4P75C

Phers in complex with compound 4a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 64
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p75C01
4TVAB 4H2XB 1WPYA 3ICAA 3E9IA 4DQ2A 1WYDA 5ELOA 2DTIA 5C51B 1WLEA 3V7CA 5K1XA 2ZIMA 2XGTA 1KMMA 1H4VB 4RQEA 2QHSA 4UP8A 1WU7A 3HXYA 4P71A 4XTZA 2E3CA 4YREA 4OP0A 3LSQA 2RHQA 3A74A 1BBUA 2ARUA 2ZZFA 1GGMA 3HRIA 3RKWA 4XTYA 1B76A 1JJCB 4H2TA 1X2HA 2EJFA 2ZT5A 1QE0A 1ADYA 1HC7A 4RMFA 4X5OA 1X56A 3CMQA 4YRQA 2Q7HA 4DPGA 2EL9A 3UH0A 2CGHA 4OLFA 1B70A 4L87A 4YCVA 1NYRA 2P0LA 4K88A 1IL2A 4YDQA 4XTWA 3A31A 2DDZA 3TEHB 4ZTUB 1C0AA 4RQFA 1BBWA 1G5IA 3HXUA 4HWOA 4TVWA 1H4QA 2ZINA 2FYKA 4YRTA 4P3OA 3M4QA 2CJBA 4TQDA 2ZNJA 4P72A 2ZGWA 2ZR2A 2J3MA 3WQZA 3HXWA 1KMNA 1WNLA 3I7FA 1E22A 1Z7MA 2CJAA 4XEOA 5E3IA 2IY5A 1USYA 3HRKA 2ZT6A 3RF1A 1ATIA 3E9HA 2ALYB 2DQ0A 2J3LA 2I4NA 3LC0A 3G1ZA 2ZT8A 3REUA 3RIRA 4HWPA 4TVAA 4NCXA 4XU0A 4P72C 2ZZEA 3W3SA 4LNSA 4WF2A 1X01A 4WJ3M 1KOGA 1USYC 1YFRA 3HFZB 4YCWA 4HWSA 4P74A 5C52B 4YRNA 2QHTA 2ODRD 2ZZGA 3VQVA 1EOVA 2DTOA 4YCUA 4YRJA 2ZT7A 4J15A 1SETA 2ZXFA 3RACA 4YRSA 4BW9A 3DSQA 3A32A 1EVKA 4WI1A 3TUPA 4TTVA 3R07A 3QNEA 4H02A 3V7SA 1B7YB 1SESA 4P74C 3REXA 2ZTGA 4E51A 1JJCA 4XU3A 4H2VA 4EX5A 2AKWB 4H2YA 3UGTA 2I4MA 1B8AA 2AMCA 5ELNA 2DXTA 4XTVA 3PCOA 4CH5A 4YRKA 4XTXA 2DZ9A 4CH6A 1PYSB 4P71C 5HGQA 1QF6A 3QTCA 1X55A 3TEHA 2ARSA 3P8YA 1E1OA 2Q7GA 1BIAA 3A5YA 2XTIA 2ODRC 3RUXA 3BFMA 4H2UA 1EIYB 3A7RA 2RHQB 2QHVA 4P3PA 2EAYA 4UP9A 4O2DA 1X2GA 1N9WA 1NJ2A 2CJ9A 2Q5IA 2I4LA 4YRRA 2ZCEA 3MF1A 3UFGA 4P3NA 2ARTA 1NNHA 3V8JA 3VQWA 4BWAA 4K87A 3HTZA 2ALYA 3RL6A 3L4GB 2EWNA 4CS2A 1X54A 4YP0A 3L2ZA 1FYFA 4XU1A 1WQWA 2DZCA 2C8MA 4ZTZB 3IKLA 1YFSA 4YRLA 2E41A 2RHSB 3OD1A 3HFZA 3HXXA 4H2XA 3VBBA 1ASZA 3L1AA 4P73A 1NJ1A 3VQXA 4AH6A 1LYLA 4EO4A 2ZIOA 1NJ6A 4Q6GA 3HY0A 2DVEA 4HWTA 1H4TA 3RGLA 3LSSA 1B7YA 1ASYA 1G51A 1YFTA 1Z7NA 4P75A 4YRIA 3ERRA 4G85A 5F5WA 2ZNIA 4P73C 1YGBA 2AKWA 3HY1A 4G84A 3IG2A 2Q7EA 2Q5HA 4HWRA 4KQEA 2DTHA 1VQZA 2PMEA 2EJ9A 4YRFA 1H4SA 2C7IA 3TEGA 1PYSA 1NJ8A 2CIMA 4YRMA 4H2SA 4P75C 3IALA 2E64A 3NEMA 5K1PA 4KR2A 3QO5A 4H2WA 3M4PA 1RIQA 1EIYA 3BJUA 3HFVA 3NETA 2G4CA 2E1HA 4PG3A 4UP7A 1W66A 1G5HA 3A7AA 3VQYA 3PZCA 4YROA 2EJGA 4CH3A 2DQ3A 1BIBA 3UGQA 3QO8A 1NYQA 4CH4A 2AMCB 3P8TA 4YRCA 3HXVA 3PCOB 4WJ4A 1E1TA 3V8KA 4PHCA 3EFRA 4Q15A 2DJZA 3L4GA 3NENA 12ASA 3NELA 1EQRA 2PMFA 2P5IA 1YB3A 4ZIBA 4TWAA 1B70B 3HXZA 4YPFA 3RKYA 1EFWA 2E65A 1HXDA 4YRPA 2E10A 4TVYA 4KR3A 3IKMB 1NJ5A 2RHSA 4XTUA 5C53B 4CS3A 3A7UA 3P8VA 5KNNA 1SERA 2DKGA 4HA8A 1L0WA 4TQFA 1HTTA 2ZR3A 11ASA 4YRGA 3MEYA 4HVCA 2DEQA 3EFSA 2HNIA 2DXUA 2E5AA 1SRYA 1EVLA 3KFUA 2QHUA 3QO7A 2I4OA 1ADJA 2DU7A 4K86A 4RDXA 2DU5A 3FJPA 4XEMA 4UPAA 3V8LA 1WQ7A 3MF2A 1J5WA 2IY5B 3RKXA 3A5ZA 3V7RA 4XU2A 4CS4A 1E24A 4YYEA
chains in the Genus database with same CATH superfamily
4TVAB 4H2XB 1WPYA 3ICAA 3E9IA 4DQ2A 1WYDA 5ELOA 2DTIA 5C51B 1WLEA 3V7CA 5K1XA 2ZIMA 2XGTA 1KMMA 1H4VB 4RQEA 2QHSA 4UP8A 1WU7A 3HXYA 4P71A 4XTZA 2E3CA 4YREA 4OP0A 3LSQA 2RHQA 3A74A 1BBUA 2ARUA 2ZZFA 1GGMA 3HRIA 3RKWA 4XTYA 1B76A 1JJCB 4H2TA 1X2HA 2EJFA 2ZT5A 1QE0A 1ADYA 1HC7A 4RMFA 4X5OA 1X56A 3CMQA 4YRQA 2Q7HA 4DPGA 2EL9A 3UH0A 2CGHA 4OLFA 1B70A 4L87A 4YCVA 4LVKA 1NYRA 2P0LA 4K88A 1IL2A 4YDQA 4XTWA 3A31A 2DDZA 3TEHB 4ZTUB 1C0AA 4RQFA 1BBWA 1G5IA 3HXUA 4HWOA 4TVWA 1H4QA 2ZINA 2FYKA 4YRTA 4P3OA 3M4QA 2CJBA 4TQDA 2ZNJA 4P72A 2ZGWA 2ZR2A 2J3MA 3WQZA 3HXWA 1KMNA 1WNLA 3I7FA 1E22A 1Z7MA 2CJAA 4XEOA 5E3IA 2IY5A 1USYA 3HRKA 2ZT6A 3RF1A 1ATIA 3E9HA 2ALYB 2DQ0A 2J3LA 2I4NA 3LC0A 3G1ZA 2ZT8A 3REUA 3RIRA 4HWPA 4TVAA 4NCXA 4XU0A 4P72C 2ZZEA 3W3SA 4LNSA 4WF2A 1X01A 4WJ3M 1KOGA 1USYC 1YFRA 3HFZB 4YCWA 4HWSA 4P74A 5C52B 4YRNA 2QHTA 2ODRD 2ZZGA 3VQVA 1EOVA 2DTOA 4YCUA 4YRJA 2ZT7A 4LVLA 4J15A 1SETA 2ZXFA 3RACA 4YRSA 4BW9A 3DSQA 2NS6A 3A32A 1EVKA 4WI1A 3TUPA 4TTVA 3R07A 3QNEA 4H02A 3V7SA 1B7YB 1SESA 4P74C 3REXA 2ZTGA 4E51A 1JJCA 4XU3A 4H2VA 4EX5A 2AKWB 4H2YA 3UGTA 2I4MA 1B8AA 2AMCA 5ELNA 2DXTA 4XTVA 3PCOA 4CH5A 4YRKA 4XTXA 2DZ9A 4CH6A 1PYSB 4P71C 5HGQA 1QF6A 3QTCA 1X55A 3TEHA 2ARSA 3P8YA 1E1OA 2Q7GA 1BIAA 3A5YA 2XTIA 2ODRC 3RUXA 3BFMA 4H2UA 1EIYB 3A7RA 2RHQB 2QHVA 4P3PA 2EAYA 4UP9A 4O2DA 1X2GA 1N9WA 1NJ2A 2CJ9A 2Q5IA 2I4LA 4YRRA 2ZCEA 3MF1A 3UFGA 4P3NA 2ARTA 1NNHA 3V8JA 3VQWA 4BWAA 4K87A 3HTZA 2ALYA 3RL6A 3L4GB 2EWNA 4CS2A 1X54A 4YP0A 3L2ZA 1FYFA 4LVIA 4XU1A 1WQWA 2DZCA 4LVMA 2C8MA 4ZTZB 3IKLA 1YFSA 4YRLA 2E41A 2RHSB 3OD1A 3HFZA 3HXXA 4H2XA 3VBBA 1ASZA 2A8EA 3L1AA 4P73A 1NJ1A 3VQXA 4AH6A 1LYLA 4EO4A 2ZIOA 1NJ6A 4Q6GA 3HY0A 2DVEA 4HWTA 1H4TA 3RGLA 3LSSA 1B7YA 1ASYA 1G51A 1YFTA 1Z7NA 4P75A 4YRIA 3ERRA 4G85A 5F5WA 2ZNIA 4P73C 1YGBA 2AKWA 3HY1A 4G84A 3IG2A 2Q7EA 2Q5HA 4HWRA 4KQEA 2DTHA 1VQZA 2PMEA 2EJ9A 4YRFA 1H4SA 2C7IA 3TEGA 1PYSA 1NJ8A 2CIMA 4YRMA 3MQZA 4H2SA 4P75C 3IALA 2E64A 3NEMA 5K1PA 4KR2A 3QO5A 4H2WA 3M4PA 1RIQA 1EIYA 3BJUA 3HFVA 3NETA 2G4CA 2E1HA 4PG3A 4UP7A 1W66A 1G5HA 3A7AA 3VQYA 3PZCA 4YROA 2EJGA 4CH3A 2DQ3A 1BIBA 3UGQA 3QO8A 1NYQA 4CH4A 2AMCB 3P8TA 4YRCA 3HXVA 3PCOB 4WJ4A 1E1TA 4HT4A 3V8KA 4PHCA 3EFRA 4Q15A 2DJZA 3L4GA 3NENA 12ASA 3NELA 1EQRA 2PMFA 2P5IA 1YB3A 4ZIBA 4TWAA 4LVJA 1B70B 3HXZA 4YPFA 3RKYA 1EFWA 2E65A 1HXDA 4YRPA 2E10A 4TVYA 4KR3A 3IKMB 1NJ5A 2RHSA 4XTUA 5C53B 4CS3A 3A7UA 3P8VA 5KNNA 1SERA 2DKGA 4HA8A 1L0WA 4TQFA 1HTTA 2ZR3A 11ASA 4YRGA 3MEYA 4HVCA 2DEQA 3EFSA 2HNIA 2DXUA 2E5AA 1SRYA 1EVLA 3KFUA 2QHUA 3QO7A 2I4OA 1ADJA 2DU7A 4K86A 4RDXA 2DU5A 3FJPA 4XEMA 4UPAA 3V8LA 1WQ7A 3MF2A 1J5WA 2IY5B 3RKXA 3A5ZA 3V7RA 4XU2A 4CS4A 1E24A 4YYEA
chains in the Genus database with same CATH topology
4TVAB 4H2XB 1WPYA 3ICAA 3E9IA 4DQ2A 1WYDA 5ELOA 2DTIA 5C51B 1WLEA 3V7CA 5K1XA 2ZIMA 2XGTA 1KMMA 1H4VB 4RQEA 2QHSA 4UP8A 1WU7A 3HXYA 4P71A 4XTZA 2E3CA 4YREA 4OP0A 3LSQA 2RHQA 3A74A 1BBUA 2ARUA 2ZZFA 1GGMA 3HRIA 3RKWA 4XTYA 1B76A 1JJCB 4H2TA 1X2HA 2EJFA 2ZT5A 1QE0A 1ADYA 1HC7A 4RMFA 4X5OA 1X56A 3CMQA 4YRQA 2Q7HA 4DPGA 2EL9A 3UH0A 2CGHA 4OLFA 1B70A 4L87A 4YCVA 4LVKA 1NYRA 2P0LA 4K88A 1IL2A 4YDQA 4XTWA 3A31A 2DDZA 3TEHB 4ZTUB 1C0AA 4RQFA 1BBWA 1G5IA 3HXUA 4HWOA 4TVWA 1H4QA 2ZINA 2FYKA 4YRTA 4P3OA 3M4QA 2CJBA 4TQDA 2ZNJA 4P72A 2ZGWA 2ZR2A 2J3MA 3WQZA 3HXWA 1KMNA 1WNLA 3I7FA 1E22A 1Z7MA 2CJAA 4XEOA 5E3IA 2IY5A 1USYA 3HRKA 2ZT6A 3RF1A 1ATIA 3E9HA 2ALYB 2DQ0A 2J3LA 2I4NA 3LC0A 3G1ZA 2ZT8A 3REUA 3RIRA 4HWPA 4TVAA 4NCXA 4XU0A 4P72C 2ZZEA 3W3SA 4LNSA 4WF2A 1X01A 4WJ3M 1KOGA 1USYC 1YFRA 3HFZB 4YCWA 4HWSA 4P74A 5C52B 4YRNA 2QHTA 2ODRD 2ZZGA 3VQVA 1EOVA 2DTOA 4YCUA 4YRJA 2ZT7A 4LVLA 4J15A 1SETA 2ZXFA 3RACA 4YRSA 4BW9A 3DSQA 2NS6A 3A32A 1EVKA 4WI1A 3TUPA 4TTVA 3R07A 3QNEA 4H02A 3V7SA 1B7YB 1SESA 4P74C 3REXA 2ZTGA 4E51A 1JJCA 4XU3A 4H2VA 4EX5A 2AKWB 4H2YA 3UGTA 2I4MA 1B8AA 2AMCA 5ELNA 2DXTA 4XTVA 3PCOA 4CH5A 4YRKA 4XTXA 2DZ9A 4CH6A 1PYSB 4P71C 5HGQA 1QF6A 3QTCA 1X55A 3TEHA 2ARSA 3P8YA 1E1OA 2Q7GA 1BIAA 3A5YA 2XTIA 2ODRC 3RUXA 3BFMA 4H2UA 1EIYB 3A7RA 2RHQB 2QHVA 4P3PA 2EAYA 4UP9A 4O2DA 1X2GA 1N9WA 1NJ2A 2CJ9A 2Q5IA 2I4LA 4YRRA 2ZCEA 3MF1A 3UFGA 4P3NA 2ARTA 1NNHA 3V8JA 3VQWA 4BWAA 4K87A 3HTZA 2ALYA 3RL6A 3L4GB 2EWNA 4CS2A 1X54A 4YP0A 3L2ZA 1FYFA 4LVIA 4XU1A 1WQWA 2DZCA 4LVMA 2C8MA 4ZTZB 3IKLA 1YFSA 4YRLA 2E41A 2RHSB 3OD1A 3HFZA 3HXXA 4H2XA 3VBBA 1ASZA 2A8EA 3L1AA 4P73A 1NJ1A 3VQXA 4AH6A 1LYLA 4EO4A 2ZIOA 1NJ6A 4Q6GA 3HY0A 2DVEA 4HWTA 1H4TA 3RGLA 3LSSA 1B7YA 1ASYA 1G51A 1YFTA 1Z7NA 4P75A 4YRIA 3ERRA 4G85A 5F5WA 2ZNIA 4P73C 1YGBA 2AKWA 3HY1A 4G84A 3IG2A 2Q7EA 2Q5HA 4HWRA 4KQEA 2DTHA 1VQZA 2PMEA 2EJ9A 4YRFA 1H4SA 2C7IA 3TEGA 1PYSA 1NJ8A 2CIMA 4YRMA 3MQZA 4H2SA 4P75C 3IALA 2E64A 3NEMA 5K1PA 4KR2A 3QO5A 4H2WA 3M4PA 1RIQA 1EIYA 3BJUA 3HFVA 3NETA 2G4CA 2E1HA 4PG3A 4UP7A 1W66A 1G5HA 3A7AA 3VQYA 3PZCA 4YROA 2EJGA 4CH3A 2DQ3A 1BIBA 3UGQA 3QO8A 1NYQA 4CH4A 2AMCB 3P8TA 4YRCA 3HXVA 3PCOB 4WJ4A 1E1TA 4HT4A 3V8KA 4PHCA 3EFRA 4Q15A 2DJZA 3L4GA 3NENA 12ASA 3NELA 1EQRA 2PMFA 2P5IA 1YB3A 4ZIBA 4TWAA 4LVJA 1B70B 3HXZA 4YPFA 3RKYA 1EFWA 2E65A 1HXDA 4YRPA 2E10A 4TVYA 4KR3A 3IKMB 1NJ5A 2RHSA 4XTUA 5C53B 4CS3A 3A7UA 3P8VA 5KNNA 1SERA 2DKGA 4HA8A 1L0WA 4TQFA 1HTTA 2ZR3A 11ASA 4YRGA 3MEYA 4HVCA 2DEQA 3EFSA 2HNIA 2DXUA 2E5AA 1SRYA 1EVLA 3KFUA 2QHUA 3QO7A 2I4OA 1ADJA 2DU7A 4K86A 4RDXA 2DU5A 3FJPA 4XEMA 4UPAA 3V8LA 1WQ7A 3MF2A 1J5WA 2IY5B 3RKXA 3A5ZA 3V7RA 4XU2A 4CS4A 1E24A 4YYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVA B;  4H2X B;  1WPY A;  3ICA A;  3E9I A;  4DQ2 A;  1WYD A;  5ELO A;  2DTI A;  5C51 B;  1WLE A;  3V7C A;  5K1X A;  2ZIM A;  2XGT A;  1KMM A;  1H4V B;  4RQE A;  2QHS A;  4UP8 A;  1WU7 A;  3HXY A;  4P71 A;  4XTZ A;  2E3C A;  4YRE A;  4OP0 A;  3LSQ A;  2RHQ A;  3A74 A;  1BBU A;  2ARU A;  2ZZF A;  1GGM A;  3HRI A;  3RKW A;  4XTY A;  1B76 A;  1JJC B;  4H2T A;  1X2H A;  2EJF A;  2ZT5 A;  1QE0 A;  1ADY A;  1HC7 A;  4RMF A;  4X5O A;  1X56 A;  3CMQ A;  4YRQ A;  2Q7H A;  4DPG A;  2EL9 A;  3UH0 A;  2CGH A;  4OLF A;  1B70 A;  4L87 A;  4YCV A;  1NYR A;  2P0L A;  4K88 A;  1IL2 A;  4YDQ A;  4XTW A;  3A31 A;  2DDZ A;  3TEH B;  4ZTU B;  1C0A A;  4RQF A;  1BBW A;  1G5I A;  3HXU A;  4HWO A;  4TVW A;  1H4Q A;  2ZIN A;  2FYK A;  4YRT A;  4P3O A;  3M4Q A;  2CJB A;  4TQD A;  2ZNJ A;  4P72 A;  2ZGW A;  2ZR2 A;  2J3M A;  3WQZ A;  3HXW A;  1KMN A;  1WNL A;  3I7F A;  1E22 A;  1Z7M A;  2CJA A;  4XEO A;  5E3I A;  2IY5 A;  1USY A;  3HRK A;  2ZT6 A;  3RF1 A;  1ATI A;  3E9H A;  2ALY B;  2DQ0 A;  2J3L A;  2I4N A;  3LC0 A;  3G1Z A;  2ZT8 A;  3REU A;  3RIR A;  4HWP A;  4TVA A;  4NCX A;  4XU0 A;  4P72 C;  2ZZE A;  3W3S A;  4LNS A;  4WF2 A;  1X01 A;  4WJ3 M;  1KOG A;  1USY C;  1YFR A;  3HFZ B;  4YCW A;  4HWS A;  4P74 A;  5C52 B;  4YRN A;  2QHT A;  2ODR D;  2ZZG A;  3VQV A;  1EOV A;  2DTO A;  4YCU A;  4YRJ A;  2ZT7 A;  4J15 A;  1SET A;  2ZXF A;  3RAC A;  4YRS A;  4BW9 A;  3DSQ A;  3A32 A;  1EVK A;  4WI1 A;  3TUP A;  4TTV A;  3R07 A;  3QNE A;  4H02 A;  3V7S A;  1B7Y B;  1SES A;  4P74 C;  3REX A;  2ZTG A;  4E51 A;  1JJC A;  4XU3 A;  4H2V A;  4EX5 A;  2AKW B;  4H2Y A;  3UGT A;  2I4M A;  1B8A A;  2AMC A;  5ELN A;  2DXT A;  4XTV A;  3PCO A;  4CH5 A;  4YRK A;  4XTX A;  2DZ9 A;  4CH6 A;  1PYS B;  4P71 C;  5HGQ A;  1QF6 A;  3QTC A;  1X55 A;  3TEH A;  2ARS A;  3P8Y A;  1E1O A;  2Q7G A;  1BIA A;  3A5Y A;  2XTI A;  2ODR C;  3RUX A;  3BFM A;  4H2U A;  1EIY B;  3A7R A;  2RHQ B;  2QHV A;  4P3P A;  2EAY A;  4UP9 A;  4O2D A;  1X2G A;  1N9W A;  1NJ2 A;  2CJ9 A;  2Q5I A;  2I4L A;  4YRR A;  2ZCE A;  3MF1 A;  3UFG A;  4P3N A;  2ART A;  1NNH A;  3V8J A;  3VQW A;  4BWA A;  4K87 A;  3HTZ A;  2ALY A;  3RL6 A;  3L4G B;  2EWN A;  4CS2 A;  1X54 A;  4YP0 A;  3L2Z A;  1FYF A;  4XU1 A;  1WQW A;  2DZC A;  2C8M A;  4ZTZ B;  3IKL A;  1YFS A;  4YRL A;  2E41 A;  2RHS B;  3OD1 A;  3HFZ A;  3HXX A;  4H2X A;  3VBB A;  1ASZ A;  3L1A A;  4P73 A;  1NJ1 A;  3VQX A;  4AH6 A;  1LYL A;  4EO4 A;  2ZIO A;  1NJ6 A;  4Q6G A;  3HY0 A;  2DVE A;  4HWT A;  1H4T A;  3RGL A;  3LSS A;  1B7Y A;  1ASY A;  1G51 A;  1YFT A;  1Z7N A;  4P75 A;  4YRI A;  3ERR A;  4G85 A;  5F5W A;  2ZNI A;  4P73 C;  1YGB A;  2AKW A;  3HY1 A;  4G84 A;  3IG2 A;  2Q7E A;  2Q5H A;  4HWR A;  4KQE A;  2DTH A;  1VQZ A;  2PME A;  2EJ9 A;  4YRF A;  1H4S A;  2C7I A;  3TEG A;  1PYS A;  1NJ8 A;  2CIM A;  4YRM A;  4H2S A;  4P75 C;  3IAL A;  2E64 A;  3NEM A;  5K1P A;  4KR2 A;  3QO5 A;  4H2W A;  3M4P A;  1RIQ A;  1EIY A;  3BJU A;  3HFV A;  3NET A;  2G4C A;  2E1H A;  4PG3 A;  4UP7 A;  1W66 A;  1G5H A;  3A7A A;  3VQY A;  3PZC A;  4YRO A;  2EJG A;  4CH3 A;  2DQ3 A;  1BIB A;  3UGQ A;  3QO8 A;  1NYQ A;  4CH4 A;  2AMC B;  3P8T A;  4YRC A;  3HXV A;  3PCO B;  4WJ4 A;  1E1T A;  3V8K A;  4PHC A;  3EFR A;  4Q15 A;  2DJZ A;  3L4G A;  3NEN A;  12AS A;  3NEL A;  1EQR A;  2PMF A;  2P5I A;  1YB3 A;  4ZIB A;  4TWA A;  1B70 B;  3HXZ A;  4YPF A;  3RKY A;  1EFW A;  2E65 A;  1HXD A;  4YRP A;  2E10 A;  4TVY A;  4KR3 A;  3IKM B;  1NJ5 A;  2RHS A;  4XTU A;  5C53 B;  4CS3 A;  3A7U A;  3P8V A;  5KNN A;  1SER A;  2DKG A;  4HA8 A;  1L0W A;  4TQF A;  1HTT A;  2ZR3 A;  11AS A;  4YRG A;  3MEY A;  4HVC A;  2DEQ A;  3EFS A;  2HNI A;  2DXU A;  2E5A A;  1SRY A;  1EVL A;  3KFU A;  2QHU A;  3QO7 A;  2I4O A;  1ADJ A;  2DU7 A;  4K86 A;  4RDX A;  2DU5 A;  3FJP A;  4XEM A;  4UPA A;  3V8L A;  1WQ7 A;  3MF2 A;  1J5W A;  2IY5 B;  3RKX A;  3A5Z A;  3V7R A;  4XU2 A;  4CS4 A;  1E24 A;  4YYE A; 
#chains in the Genus database with same CATH topology
 4TVA B;  4H2X B;  1WPY A;  3ICA A;  3E9I A;  4DQ2 A;  1WYD A;  5ELO A;  2DTI A;  5C51 B;  1WLE A;  3V7C A;  5K1X A;  2ZIM A;  2XGT A;  1KMM A;  1H4V B;  4RQE A;  2QHS A;  4UP8 A;  1WU7 A;  3HXY A;  4P71 A;  4XTZ A;  2E3C A;  4YRE A;  4OP0 A;  3LSQ A;  2RHQ A;  3A74 A;  1BBU A;  2ARU A;  2ZZF A;  1GGM A;  3HRI A;  3RKW A;  4XTY A;  1B76 A;  1JJC B;  4H2T A;  1X2H A;  2EJF A;  2ZT5 A;  1QE0 A;  1ADY A;  1HC7 A;  4RMF A;  4X5O A;  1X56 A;  3CMQ A;  4YRQ A;  2Q7H A;  4DPG A;  2EL9 A;  3UH0 A;  2CGH A;  4OLF A;  1B70 A;  4L87 A;  4YCV A;  4LVK A;  1NYR A;  2P0L A;  4K88 A;  1IL2 A;  4YDQ A;  4XTW A;  3A31 A;  2DDZ A;  3TEH B;  4ZTU B;  1C0A A;  4RQF A;  1BBW A;  1G5I A;  3HXU A;  4HWO A;  4TVW A;  1H4Q A;  2ZIN A;  2FYK A;  4YRT A;  4P3O A;  3M4Q A;  2CJB A;  4TQD A;  2ZNJ A;  4P72 A;  2ZGW A;  2ZR2 A;  2J3M A;  3WQZ A;  3HXW A;  1KMN A;  1WNL A;  3I7F A;  1E22 A;  1Z7M A;  2CJA A;  4XEO A;  5E3I A;  2IY5 A;  1USY A;  3HRK A;  2ZT6 A;  3RF1 A;  1ATI A;  3E9H A;  2ALY B;  2DQ0 A;  2J3L A;  2I4N A;  3LC0 A;  3G1Z A;  2ZT8 A;  3REU A;  3RIR A;  4HWP A;  4TVA A;  4NCX A;  4XU0 A;  4P72 C;  2ZZE A;  3W3S A;  4LNS A;  4WF2 A;  1X01 A;  4WJ3 M;  1KOG A;  1USY C;  1YFR A;  3HFZ B;  4YCW A;  4HWS A;  4P74 A;  5C52 B;  4YRN A;  2QHT A;  2ODR D;  2ZZG A;  3VQV A;  1EOV A;  2DTO A;  4YCU A;  4YRJ A;  2ZT7 A;  4LVL A;  4J15 A;  1SET A;  2ZXF A;  3RAC A;  4YRS A;  4BW9 A;  3DSQ A;  2NS6 A;  3A32 A;  1EVK A;  4WI1 A;  3TUP A;  4TTV A;  3R07 A;  3QNE A;  4H02 A;  3V7S A;  1B7Y B;  1SES A;  4P74 C;  3REX A;  2ZTG A;  4E51 A;  1JJC A;  4XU3 A;  4H2V A;  4EX5 A;  2AKW B;  4H2Y A;  3UGT A;  2I4M A;  1B8A A;  2AMC A;  5ELN A;  2DXT A;  4XTV A;  3PCO A;  4CH5 A;  4YRK A;  4XTX A;  2DZ9 A;  4CH6 A;  1PYS B;  4P71 C;  5HGQ A;  1QF6 A;  3QTC A;  1X55 A;  3TEH A;  2ARS A;  3P8Y A;  1E1O A;  2Q7G A;  1BIA A;  3A5Y A;  2XTI A;  2ODR C;  3RUX A;  3BFM A;  4H2U A;  1EIY B;  3A7R A;  2RHQ B;  2QHV A;  4P3P A;  2EAY A;  4UP9 A;  4O2D A;  1X2G A;  1N9W A;  1NJ2 A;  2CJ9 A;  2Q5I A;  2I4L A;  4YRR A;  2ZCE A;  3MF1 A;  3UFG A;  4P3N A;  2ART A;  1NNH A;  3V8J A;  3VQW A;  4BWA A;  4K87 A;  3HTZ A;  2ALY A;  3RL6 A;  3L4G B;  2EWN A;  4CS2 A;  1X54 A;  4YP0 A;  3L2Z A;  1FYF A;  4LVI A;  4XU1 A;  1WQW A;  2DZC A;  4LVM A;  2C8M A;  4ZTZ B;  3IKL A;  1YFS A;  4YRL A;  2E41 A;  2RHS B;  3OD1 A;  3HFZ A;  3HXX A;  4H2X A;  3VBB A;  1ASZ A;  2A8E A;  3L1A A;  4P73 A;  1NJ1 A;  3VQX A;  4AH6 A;  1LYL A;  4EO4 A;  2ZIO A;  1NJ6 A;  4Q6G A;  3HY0 A;  2DVE A;  4HWT A;  1H4T A;  3RGL A;  3LSS A;  1B7Y A;  1ASY A;  1G51 A;  1YFT A;  1Z7N A;  4P75 A;  4YRI A;  3ERR A;  4G85 A;  5F5W A;  2ZNI A;  4P73 C;  1YGB A;  2AKW A;  3HY1 A;  4G84 A;  3IG2 A;  2Q7E A;  2Q5H A;  4HWR A;  4KQE A;  2DTH A;  1VQZ A;  2PME A;  2EJ9 A;  4YRF A;  1H4S A;  2C7I A;  3TEG A;  1PYS A;  1NJ8 A;  2CIM A;  4YRM A;  3MQZ A;  4H2S A;  4P75 C;  3IAL A;  2E64 A;  3NEM A;  5K1P A;  4KR2 A;  3QO5 A;  4H2W A;  3M4P A;  1RIQ A;  1EIY A;  3BJU A;  3HFV A;  3NET A;  2G4C A;  2E1H A;  4PG3 A;  4UP7 A;  1W66 A;  1G5H A;  3A7A A;  3VQY A;  3PZC A;  4YRO A;  2EJG A;  4CH3 A;  2DQ3 A;  1BIB A;  3UGQ A;  3QO8 A;  1NYQ A;  4CH4 A;  2AMC B;  3P8T A;  4YRC A;  3HXV A;  3PCO B;  4WJ4 A;  1E1T A;  4HT4 A;  3V8K A;  4PHC A;  3EFR A;  4Q15 A;  2DJZ A;  3L4G A;  3NEN A;  12AS A;  3NEL A;  1EQR A;  2PMF A;  2P5I A;  1YB3 A;  4ZIB A;  4TWA A;  4LVJ A;  1B70 B;  3HXZ A;  4YPF A;  3RKY A;  1EFW A;  2E65 A;  1HXD A;  4YRP A;  2E10 A;  4TVY A;  4KR3 A;  3IKM B;  1NJ5 A;  2RHS A;  4XTU A;  5C53 B;  4CS3 A;  3A7U A;  3P8V A;  5KNN A;  1SER A;  2DKG A;  4HA8 A;  1L0W A;  4TQF A;  1HTT A;  2ZR3 A;  11AS A;  4YRG A;  3MEY A;  4HVC A;  2DEQ A;  3EFS A;  2HNI A;  2DXU A;  2E5A A;  1SRY A;  1EVL A;  3KFU A;  2QHU A;  3QO7 A;  2I4O A;  1ADJ A;  2DU7 A;  4K86 A;  4RDX A;  2DU5 A;  3FJP A;  4XEM A;  4UPA A;  3V8L A;  1WQ7 A;  3MF2 A;  1J5W A;  2IY5 B;  3RKX A;  3A5Z A;  3V7R A;  4XU2 A;  4CS4 A;  1E24 A;  4YYE A; 
#chains in the Genus database with same CATH homology
 4TVA B;  4H2X B;  1WPY A;  3ICA A;  3E9I A;  4DQ2 A;  1WYD A;  5ELO A;  2DTI A;  5C51 B;  1WLE A;  3V7C A;  5K1X A;  2ZIM A;  2XGT A;  1KMM A;  1H4V B;  4RQE A;  2QHS A;  4UP8 A;  1WU7 A;  3HXY A;  4P71 A;  4XTZ A;  2E3C A;  4YRE A;  4OP0 A;  3LSQ A;  2RHQ A;  3A74 A;  1BBU A;  2ARU A;  2ZZF A;  1GGM A;  3HRI A;  3RKW A;  4XTY A;  1B76 A;  1JJC B;  4H2T A;  1X2H A;  2EJF A;  2ZT5 A;  1QE0 A;  1ADY A;  1HC7 A;  4RMF A;  4X5O A;  1X56 A;  3CMQ A;  4YRQ A;  2Q7H A;  4DPG A;  2EL9 A;  3UH0 A;  2CGH A;  4OLF A;  1B70 A;  4L87 A;  4YCV A;  4LVK A;  1NYR A;  2P0L A;  4K88 A;  1IL2 A;  4YDQ A;  4XTW A;  3A31 A;  2DDZ A;  3TEH B;  4ZTU B;  1C0A A;  4RQF A;  1BBW A;  1G5I A;  3HXU A;  4HWO A;  4TVW A;  1H4Q A;  2ZIN A;  2FYK A;  4YRT A;  4P3O A;  3M4Q A;  2CJB A;  4TQD A;  2ZNJ A;  4P72 A;  2ZGW A;  2ZR2 A;  2J3M A;  3WQZ A;  3HXW A;  1KMN A;  1WNL A;  3I7F A;  1E22 A;  1Z7M A;  2CJA A;  4XEO A;  5E3I A;  2IY5 A;  1USY A;  3HRK A;  2ZT6 A;  3RF1 A;  1ATI A;  3E9H A;  2ALY B;  2DQ0 A;  2J3L A;  2I4N A;  3LC0 A;  3G1Z A;  2ZT8 A;  3REU A;  3RIR A;  4HWP A;  4TVA A;  4NCX A;  4XU0 A;  4P72 C;  2ZZE A;  3W3S A;  4LNS A;  4WF2 A;  1X01 A;  4WJ3 M;  1KOG A;  1USY C;  1YFR A;  3HFZ B;  4YCW A;  4HWS A;  4P74 A;  5C52 B;  4YRN A;  2QHT A;  2ODR D;  2ZZG A;  3VQV A;  1EOV A;  2DTO A;  4YCU A;  4YRJ A;  2ZT7 A;  4LVL A;  4J15 A;  1SET A;  2ZXF A;  3RAC A;  4YRS A;  4BW9 A;  3DSQ A;  2NS6 A;  3A32 A;  1EVK A;  4WI1 A;  3TUP A;  4TTV A;  3R07 A;  3QNE A;  4H02 A;  3V7S A;  1B7Y B;  1SES A;  4P74 C;  3REX A;  2ZTG A;  4E51 A;  1JJC A;  4XU3 A;  4H2V A;  4EX5 A;  2AKW B;  4H2Y A;  3UGT A;  2I4M A;  1B8A A;  2AMC A;  5ELN A;  2DXT A;  4XTV A;  3PCO A;  4CH5 A;  4YRK A;  4XTX A;  2DZ9 A;  4CH6 A;  1PYS B;  4P71 C;  5HGQ A;  1QF6 A;  3QTC A;  1X55 A;  3TEH A;  2ARS A;  3P8Y A;  1E1O A;  2Q7G A;  1BIA A;  3A5Y A;  2XTI A;  2ODR C;  3RUX A;  3BFM A;  4H2U A;  1EIY B;  3A7R A;  2RHQ B;  2QHV A;  4P3P A;  2EAY A;  4UP9 A;  4O2D A;  1X2G A;  1N9W A;  1NJ2 A;  2CJ9 A;  2Q5I A;  2I4L A;  4YRR A;  2ZCE A;  3MF1 A;  3UFG A;  4P3N A;  2ART A;  1NNH A;  3V8J A;  3VQW A;  4BWA A;  4K87 A;  3HTZ A;  2ALY A;  3RL6 A;  3L4G B;  2EWN A;  4CS2 A;  1X54 A;  4YP0 A;  3L2Z A;  1FYF A;  4LVI A;  4XU1 A;  1WQW A;  2DZC A;  4LVM A;  2C8M A;  4ZTZ B;  3IKL A;  1YFS A;  4YRL A;  2E41 A;  2RHS B;  3OD1 A;  3HFZ A;  3HXX A;  4H2X A;  3VBB A;  1ASZ A;  2A8E A;  3L1A A;  4P73 A;  1NJ1 A;  3VQX A;  4AH6 A;  1LYL A;  4EO4 A;  2ZIO A;  1NJ6 A;  4Q6G A;  3HY0 A;  2DVE A;  4HWT A;  1H4T A;  3RGL A;  3LSS A;  1B7Y A;  1ASY A;  1G51 A;  1YFT A;  1Z7N A;  4P75 A;  4YRI A;  3ERR A;  4G85 A;  5F5W A;  2ZNI A;  4P73 C;  1YGB A;  2AKW A;  3HY1 A;  4G84 A;  3IG2 A;  2Q7E A;  2Q5H A;  4HWR A;  4KQE A;  2DTH A;  1VQZ A;  2PME A;  2EJ9 A;  4YRF A;  1H4S A;  2C7I A;  3TEG A;  1PYS A;  1NJ8 A;  2CIM A;  4YRM A;  3MQZ A;  4H2S A;  4P75 C;  3IAL A;  2E64 A;  3NEM A;  5K1P A;  4KR2 A;  3QO5 A;  4H2W A;  3M4P A;  1RIQ A;  1EIY A;  3BJU A;  3HFV A;  3NET A;  2G4C A;  2E1H A;  4PG3 A;  4UP7 A;  1W66 A;  1G5H A;  3A7A A;  3VQY A;  3PZC A;  4YRO A;  2EJG A;  4CH3 A;  2DQ3 A;  1BIB A;  3UGQ A;  3QO8 A;  1NYQ A;  4CH4 A;  2AMC B;  3P8T A;  4YRC A;  3HXV A;  3PCO B;  4WJ4 A;  1E1T A;  4HT4 A;  3V8K A;  4PHC A;  3EFR A;  4Q15 A;  2DJZ A;  3L4G A;  3NEN A;  12AS A;  3NEL A;  1EQR A;  2PMF A;  2P5I A;  1YB3 A;  4ZIB A;  4TWA A;  4LVJ A;  1B70 B;  3HXZ A;  4YPF A;  3RKY A;  1EFW A;  2E65 A;  1HXD A;  4YRP A;  2E10 A;  4TVY A;  4KR3 A;  3IKM B;  1NJ5 A;  2RHS A;  4XTU A;  5C53 B;  4CS3 A;  3A7U A;  3P8V A;  5KNN A;  1SER A;  2DKG A;  4HA8 A;  1L0W A;  4TQF A;  1HTT A;  2ZR3 A;  11AS A;  4YRG A;  3MEY A;  4HVC A;  2DEQ A;  3EFS A;  2HNI A;  2DXU A;  2E5A A;  1SRY A;  1EVL A;  3KFU A;  2QHU A;  3QO7 A;  2I4O A;  1ADJ A;  2DU7 A;  4K86 A;  4RDX A;  2DU5 A;  3FJP A;  4XEM A;  4UPA A;  3V8L A;  1WQ7 A;  3MF2 A;  1J5W A;  2IY5 B;  3RKX A;  3A5Z A;  3V7R A;  4XU2 A;  4CS4 A;  1E24 A;  4YYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...