4P75C

Phers in complex with compound 4a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 64
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p75C01
3A74A 4YCWA 4HVCA 4UP8A 3HRKA 1G5IA 1B7YA 1NJ6A 2DQ0A 4CS4A 4YROA 1E22A 2Q7HA 5F5WA 4H2WA 4EX5A 2ZIMA 5HGQA 2QHUA 1RIQA 4H2VA 4XTXA 5ELNA 2EJFA 2ZR2A 4YRJA 2E41A 3WQZA 4WF2A 4E51A 1E1TA 2ZXFA 1KMNA 1WU7A 3REXA 3QTCA 2J3MA 1SRYA 4YRRA 5C51B 2E3CA 3IKMB 3IG2A 3VBBA 1SETA 3RKXA 3HFZB 3HY1A 1LYLA 2EAYA 4P75A 4YRIA 1EVLA 2I4LA 3V8KA 1KOGA 1JJCB 1H4QA 4DQ2A 3R07A 2DJZA 4RQFA 3IKLA 3A5YA 4YRTA 4YRGA 3NENA 1J5WA 5K1PA 2RHSB 2ALYA 1X2GA 3L1AA 4TVYA 5ELOA 3QO8A 2ZZEA 2DZ9A 4CH6A 1B7YB 2I4NA 4P72C 4YRSA 1SESA 1EIYB 3RF1A 1FYFA 2ZNIA 2EJGA 2DQ3A 4YP0A 1Z7MA 3HXUA 2IY5A 1H4TA 4YREA 4X5OA 5KNNA 4XEOA 4TVAB 2ODRD 3E9HA 3QNEA 4NCXA 4H02A 2CGHA 4P3PA 2DXTA 4H2XA 4CH5A 4YRFA 3EFSA 2AMCA 3QO7A 1SERA 2ZZFA 3I7FA 1YB3A 3V8LA 4XTVA 2CIMA 1BIAA 1BBWA 2ZR3A 4XTWA 3A7UA 2IY5B 1NJ8A 2DU7A 4XEMA 3BFMA 4YRPA 1B70B 4PG3A 4H2YA 4CS3A 3NELA 4YPFA 2ZT6A 12ASA 4AH6A 2DVEA 4EO4A 4XTZA 3HXZA 3L2ZA 4LNSA 3TEGA 4WJ3M 3HRIA 3ERRA 1H4SA 2AKWB 2ZCEA 4XTYA 3UH0A 4G85A 3A7RA 4HWRA 1PYSB 1WLEA 1WPYA 1NJ2A 2ZZGA 1EOVA 2C7IA 4P73C 3NEMA 4TQFA 1EVKA 1B8AA 11ASA 5C52B 4CH4A 4TVAA 2ARTA 4YRCA 2QHVA 4G84A 1ASYA 4H2XB 3KFUA 1X55A 1X56A 3LC0A 3UGQA 2I4OA 4YDQA 3PZCA 1G5HA 3VQVA 2ZTGA 5E3IA 4CH3A 2DZCA 2DTIA 1NNHA 2EL9A 3RGLA 4TWAA 1X2HA 2Q5IA 2RHSA 3RKYA 4XU1A 3PCOA 3RIRA 1QF6A 4P74A 1PYSA 3P8VA 3MF1A 1NJ5A 3P8YA 2AKWA 4O2DA 1GGMA 4P71C 1YGBA 1YFTA 4OP0A 1NJ1A 3MEYA 4CS2A 3TEHA 5C53B 2Q7EA 4XU0A 2CJ9A 1Z7NA 4RDXA 2PMEA 4RMFA 2XGTA 2ZT5A 2DEQA 2HNIA 3HXVA 1N9WA 3RL6A 4K88A 2PMFA 4XU3A 3V7RA 4TQDA 4KR2A 3EFRA 1EIYA 2Q5HA 3V7SA 4H2TA 4HA8A 4UP7A 1X54A 1HXDA 2E5AA 1EFWA 2E1HA 2RHQA 3P8TA 3FJPA 1NYQA 2EJ9A 1HTTA 2ALYB 2ZT7A 4TVWA 2ZINA 1VQZA 4DPGA 2XTIA 4KQEA 4PHCA 1X01A 4YRMA 1JJCA 3LSSA 4WI1A 1NYRA 3ICAA 4P75C 1L0WA 1YFRA 2ODRC 4YRQA 2AMCB 4ZTZB 2ZIOA 3IALA 3PCOB 4YCVA 4Q6GA 1E1OA 4WJ4A 4HWTA 3A7AA 4XTUA 3V7CA 1ASZA 3G1ZA 2G4CA 3HXXA 4YCUA 1ADYA 4YYEA 3W3SA 3VQYA 4K86A 2ZT8A 3L4GA 1EQRA 4P3OA 4OLFA 4UP9A 1W66A 4ZTUB 4TTVA 1B70A 4YRNA 4P71A 1WNLA 3TUPA 3VQXA 3LSQA 1H4VB 3HFZA 3VQWA 3L4GB 1BBUA 4HWSA 2E10A 3M4QA 2DU5A 4P74C 4H2SA 2E65A 4H2UA 3CMQA 3HFVA 2FYKA 1WQ7A 3E9IA 2RHQB 2ZGWA 2ARUA 1ADJA 4Q15A 1ATIA 3V8JA 2DTOA 1BIBA 3HXWA 2CJAA 3UFGA 4KR3A 2CJBA 2C8MA 2J3LA 2I4MA 4J15A 2E64A 1YFSA 4BW9A 4RQEA 3NETA 5K1XA 1USYC 1WYDA 3DSQA 3A31A 2DXUA 3REUA 2DTHA 2P5IA 3RKWA 2QHSA 2DDZA 2P0LA 3BJUA 3RUXA 1WQWA 3UGTA 2ZNJA 4P3NA 1USYA 4BWAA 4HWPA 3QO5A 4YRLA 3A32A 3MF2A 1G51A 4HWOA 1HC7A 1E24A 2EWNA 4XU2A 3HY0A 4L87A 4K87A 4P73A 4P72A 3M4PA 3OD1A 3A5ZA 4UPAA 2QHTA 1B76A 1QE0A 4YRKA 3TEHB 2ARSA 1IL2A 2Q7GA 2DKGA 1KMMA 3RACA 4ZIBA 3HTZA 1C0AA 3HXYA
chains in the Genus database with same CATH superfamily
3A74A 4YCWA 4HVCA 4UP8A 3HRKA 1G5IA 1B7YA 1NJ6A 2DQ0A 4CS4A 4YROA 1E22A 2Q7HA 5F5WA 4H2WA 4EX5A 2ZIMA 5HGQA 2QHUA 1RIQA 4H2VA 4XTXA 5ELNA 2EJFA 2ZR2A 4YRJA 2E41A 3WQZA 4WF2A 4E51A 1E1TA 2ZXFA 1KMNA 1WU7A 3REXA 3QTCA 2J3MA 1SRYA 4YRRA 5C51B 2E3CA 3IKMB 3IG2A 3VBBA 1SETA 3RKXA 3HFZB 3HY1A 1LYLA 2EAYA 4P75A 4YRIA 1EVLA 2I4LA 3V8KA 1KOGA 1JJCB 4LVMA 1H4QA 4DQ2A 3R07A 2DJZA 4RQFA 3IKLA 3A5YA 4YRTA 4YRGA 3NENA 1J5WA 5K1PA 2RHSB 2ALYA 1X2GA 3L1AA 4TVYA 5ELOA 3QO8A 2ZZEA 2DZ9A 3MQZA 4CH6A 1B7YB 2I4NA 4P72C 4YRSA 1SESA 1EIYB 3RF1A 1FYFA 2ZNIA 2EJGA 2DQ3A 4YP0A 1Z7MA 3HXUA 2IY5A 1H4TA 4YREA 4X5OA 5KNNA 4XEOA 4TVAB 2ODRD 3E9HA 3QNEA 4NCXA 4H02A 2CGHA 4P3PA 2DXTA 4H2XA 4CH5A 4YRFA 3EFSA 2AMCA 3QO7A 1SERA 2ZZFA 3I7FA 1YB3A 3V8LA 4XTVA 2CIMA 4LVIA 1BIAA 1BBWA 2ZR3A 4XTWA 3A7UA 2IY5B 1NJ8A 2DU7A 4XEMA 3BFMA 4YRPA 1B70B 4PG3A 4H2YA 4CS3A 3NELA 4YPFA 2ZT6A 12ASA 4AH6A 2DVEA 4EO4A 4XTZA 3HXZA 3L2ZA 4LNSA 3TEGA 4WJ3M 3HRIA 3ERRA 1H4SA 2AKWB 2ZCEA 4XTYA 3UH0A 4G85A 3A7RA 4HWRA 1PYSB 1WLEA 1WPYA 1NJ2A 2ZZGA 1EOVA 2C7IA 4P73C 3NEMA 4TQFA 1EVKA 1B8AA 11ASA 5C52B 4CH4A 4TVAA 2ARTA 4YRCA 2QHVA 4G84A 1ASYA 4H2XB 3KFUA 1X55A 1X56A 3LC0A 3UGQA 2I4OA 4YDQA 3PZCA 1G5HA 3VQVA 2ZTGA 5E3IA 4CH3A 2DZCA 2DTIA 1NNHA 2EL9A 3RGLA 4TWAA 1X2HA 2Q5IA 2RHSA 3RKYA 4XU1A 3PCOA 3RIRA 1QF6A 4P74A 1PYSA 3P8VA 3MF1A 1NJ5A 3P8YA 2AKWA 4O2DA 1GGMA 4P71C 1YGBA 1YFTA 4OP0A 1NJ1A 3MEYA 4CS2A 3TEHA 5C53B 2Q7EA 4XU0A 2CJ9A 1Z7NA 4RDXA 2PMEA 4LVLA 4RMFA 2XGTA 2ZT5A 2DEQA 2NS6A 2HNIA 3HXVA 1N9WA 3RL6A 4K88A 2PMFA 4XU3A 3V7RA 4TQDA 4KR2A 3EFRA 1EIYA 2Q5HA 3V7SA 4H2TA 4HA8A 4UP7A 1X54A 1HXDA 2E5AA 1EFWA 2E1HA 2RHQA 3P8TA 3FJPA 1NYQA 2EJ9A 1HTTA 2ALYB 2ZT7A 4TVWA 2ZINA 1VQZA 4DPGA 2XTIA 4KQEA 4PHCA 1X01A 4LVJA 4YRMA 1JJCA 3LSSA 4WI1A 1NYRA 3ICAA 4P75C 1L0WA 1YFRA 2ODRC 4YRQA 2AMCB 4ZTZB 2ZIOA 3IALA 3PCOB 4YCVA 4Q6GA 1E1OA 4WJ4A 4HWTA 3A7AA 4XTUA 3V7CA 1ASZA 3G1ZA 2G4CA 3HXXA 4YCUA 1ADYA 4YYEA 3W3SA 3VQYA 4K86A 2ZT8A 3L4GA 1EQRA 4P3OA 4OLFA 4UP9A 1W66A 4ZTUB 4TTVA 1B70A 4YRNA 4P71A 1WNLA 3TUPA 3VQXA 3LSQA 2A8EA 1H4VB 3HFZA 3VQWA 3L4GB 1BBUA 4HWSA 2E10A 3M4QA 2DU5A 4P74C 4H2SA 2E65A 4H2UA 4LVKA 3CMQA 3HFVA 2FYKA 1WQ7A 3E9IA 2RHQB 2ZGWA 2ARUA 1ADJA 4Q15A 1ATIA 3V8JA 2DTOA 4HT4A 1BIBA 3HXWA 2CJAA 3UFGA 4KR3A 2CJBA 2C8MA 2J3LA 2I4MA 4J15A 2E64A 1YFSA 4BW9A 4RQEA 3NETA 5K1XA 1USYC 1WYDA 3DSQA 3A31A 2DXUA 3REUA 2DTHA 2P5IA 3RKWA 2QHSA 2DDZA 2P0LA 3BJUA 3RUXA 1WQWA 3UGTA 2ZNJA 4P3NA 1USYA 4BWAA 4HWPA 3QO5A 4YRLA 3A32A 3MF2A 1G51A 4HWOA 1HC7A 1E24A 2EWNA 4XU2A 3HY0A 4L87A 4K87A 4P73A 4P72A 3M4PA 3OD1A 3A5ZA 4UPAA 2QHTA 1B76A 1QE0A 4YRKA 3TEHB 2ARSA 1IL2A 2Q7GA 2DKGA 1KMMA 3RACA 4ZIBA 3HTZA 1C0AA 3HXYA
chains in the Genus database with same CATH topology
3A74A 4YCWA 4HVCA 4UP8A 3HRKA 1G5IA 1B7YA 1NJ6A 2DQ0A 4CS4A 4YROA 1E22A 2Q7HA 5F5WA 4H2WA 4EX5A 2ZIMA 5HGQA 2QHUA 1RIQA 4H2VA 4XTXA 5ELNA 2EJFA 2ZR2A 4YRJA 2E41A 3WQZA 4WF2A 4E51A 1E1TA 2ZXFA 1KMNA 1WU7A 3REXA 3QTCA 2J3MA 1SRYA 4YRRA 5C51B 2E3CA 3IKMB 3IG2A 3VBBA 1SETA 3RKXA 3HFZB 3HY1A 1LYLA 2EAYA 4P75A 4YRIA 1EVLA 2I4LA 3V8KA 1KOGA 1JJCB 4LVMA 1H4QA 4DQ2A 3R07A 2DJZA 4RQFA 3IKLA 3A5YA 4YRTA 4YRGA 3NENA 1J5WA 5K1PA 2RHSB 2ALYA 1X2GA 3L1AA 4TVYA 5ELOA 3QO8A 2ZZEA 2DZ9A 3MQZA 4CH6A 1B7YB 2I4NA 4P72C 4YRSA 1SESA 1EIYB 3RF1A 1FYFA 2ZNIA 2EJGA 2DQ3A 4YP0A 1Z7MA 3HXUA 2IY5A 1H4TA 4YREA 4X5OA 5KNNA 4XEOA 4TVAB 2ODRD 3E9HA 3QNEA 4NCXA 4H02A 2CGHA 4P3PA 2DXTA 4H2XA 4CH5A 4YRFA 3EFSA 2AMCA 3QO7A 1SERA 2ZZFA 3I7FA 1YB3A 3V8LA 4XTVA 2CIMA 4LVIA 1BIAA 1BBWA 2ZR3A 4XTWA 3A7UA 2IY5B 1NJ8A 2DU7A 4XEMA 3BFMA 4YRPA 1B70B 4PG3A 4H2YA 4CS3A 3NELA 4YPFA 2ZT6A 12ASA 4AH6A 2DVEA 4EO4A 4XTZA 3HXZA 3L2ZA 4LNSA 3TEGA 4WJ3M 3HRIA 3ERRA 1H4SA 2AKWB 2ZCEA 4XTYA 3UH0A 4G85A 3A7RA 4HWRA 1PYSB 1WLEA 1WPYA 1NJ2A 2ZZGA 1EOVA 2C7IA 4P73C 3NEMA 4TQFA 1EVKA 1B8AA 11ASA 5C52B 4CH4A 4TVAA 2ARTA 4YRCA 2QHVA 4G84A 1ASYA 4H2XB 3KFUA 1X55A 1X56A 3LC0A 3UGQA 2I4OA 4YDQA 3PZCA 1G5HA 3VQVA 2ZTGA 5E3IA 4CH3A 2DZCA 2DTIA 1NNHA 2EL9A 3RGLA 4TWAA 1X2HA 2Q5IA 2RHSA 3RKYA 4XU1A 3PCOA 3RIRA 1QF6A 4P74A 1PYSA 3P8VA 3MF1A 1NJ5A 3P8YA 2AKWA 4O2DA 1GGMA 4P71C 1YGBA 1YFTA 4OP0A 1NJ1A 3MEYA 4CS2A 3TEHA 5C53B 2Q7EA 4XU0A 2CJ9A 1Z7NA 4RDXA 2PMEA 4LVLA 4RMFA 2XGTA 2ZT5A 2DEQA 2NS6A 2HNIA 3HXVA 1N9WA 3RL6A 4K88A 2PMFA 4XU3A 3V7RA 4TQDA 4KR2A 3EFRA 1EIYA 2Q5HA 3V7SA 4H2TA 4HA8A 4UP7A 1X54A 1HXDA 2E5AA 1EFWA 2E1HA 2RHQA 3P8TA 3FJPA 1NYQA 2EJ9A 1HTTA 2ALYB 2ZT7A 4TVWA 2ZINA 1VQZA 4DPGA 2XTIA 4KQEA 4PHCA 1X01A 4LVJA 4YRMA 1JJCA 3LSSA 4WI1A 1NYRA 3ICAA 4P75C 1L0WA 1YFRA 2ODRC 4YRQA 2AMCB 4ZTZB 2ZIOA 3IALA 3PCOB 4YCVA 4Q6GA 1E1OA 4WJ4A 4HWTA 3A7AA 4XTUA 3V7CA 1ASZA 3G1ZA 2G4CA 3HXXA 4YCUA 1ADYA 4YYEA 3W3SA 3VQYA 4K86A 2ZT8A 3L4GA 1EQRA 4P3OA 4OLFA 4UP9A 1W66A 4ZTUB 4TTVA 1B70A 4YRNA 4P71A 1WNLA 3TUPA 3VQXA 3LSQA 2A8EA 1H4VB 3HFZA 3VQWA 3L4GB 1BBUA 4HWSA 2E10A 3M4QA 2DU5A 4P74C 4H2SA 2E65A 4H2UA 4LVKA 3CMQA 3HFVA 2FYKA 1WQ7A 3E9IA 2RHQB 2ZGWA 2ARUA 1ADJA 4Q15A 1ATIA 3V8JA 2DTOA 4HT4A 1BIBA 3HXWA 2CJAA 3UFGA 4KR3A 2CJBA 2C8MA 2J3LA 2I4MA 4J15A 2E64A 1YFSA 4BW9A 4RQEA 3NETA 5K1XA 1USYC 1WYDA 3DSQA 3A31A 2DXUA 3REUA 2DTHA 2P5IA 3RKWA 2QHSA 2DDZA 2P0LA 3BJUA 3RUXA 1WQWA 3UGTA 2ZNJA 4P3NA 1USYA 4BWAA 4HWPA 3QO5A 4YRLA 3A32A 3MF2A 1G51A 4HWOA 1HC7A 1E24A 2EWNA 4XU2A 3HY0A 4L87A 4K87A 4P73A 4P72A 3M4PA 3OD1A 3A5ZA 4UPAA 2QHTA 1B76A 1QE0A 4YRKA 3TEHB 2ARSA 1IL2A 2Q7GA 2DKGA 1KMMA 3RACA 4ZIBA 3HTZA 1C0AA 3HXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A74 A;  4YCW A;  4HVC A;  4UP8 A;  3HRK A;  1G5I A;  1B7Y A;  1NJ6 A;  2DQ0 A;  4CS4 A;  4YRO A;  1E22 A;  2Q7H A;  5F5W A;  4H2W A;  4EX5 A;  2ZIM A;  5HGQ A;  2QHU A;  1RIQ A;  4H2V A;  4XTX A;  5ELN A;  2EJF A;  2ZR2 A;  4YRJ A;  2E41 A;  3WQZ A;  4WF2 A;  4E51 A;  1E1T A;  2ZXF A;  1KMN A;  1WU7 A;  3REX A;  3QTC A;  2J3M A;  1SRY A;  4YRR A;  5C51 B;  2E3C A;  3IKM B;  3IG2 A;  3VBB A;  1SET A;  3RKX A;  3HFZ B;  3HY1 A;  1LYL A;  2EAY A;  4P75 A;  4YRI A;  1EVL A;  2I4L A;  3V8K A;  1KOG A;  1JJC B;  1H4Q A;  4DQ2 A;  3R07 A;  2DJZ A;  4RQF A;  3IKL A;  3A5Y A;  4YRT A;  4YRG A;  3NEN A;  1J5W A;  5K1P A;  2RHS B;  2ALY A;  1X2G A;  3L1A A;  4TVY A;  5ELO A;  3QO8 A;  2ZZE A;  2DZ9 A;  4CH6 A;  1B7Y B;  2I4N A;  4P72 C;  4YRS A;  1SES A;  1EIY B;  3RF1 A;  1FYF A;  2ZNI A;  2EJG A;  2DQ3 A;  4YP0 A;  1Z7M A;  3HXU A;  2IY5 A;  1H4T A;  4YRE A;  4X5O A;  5KNN A;  4XEO A;  4TVA B;  2ODR D;  3E9H A;  3QNE A;  4NCX A;  4H02 A;  2CGH A;  4P3P A;  2DXT A;  4H2X A;  4CH5 A;  4YRF A;  3EFS A;  2AMC A;  3QO7 A;  1SER A;  2ZZF A;  3I7F A;  1YB3 A;  3V8L A;  4XTV A;  2CIM A;  1BIA A;  1BBW A;  2ZR3 A;  4XTW A;  3A7U A;  2IY5 B;  1NJ8 A;  2DU7 A;  4XEM A;  3BFM A;  4YRP A;  1B70 B;  4PG3 A;  4H2Y A;  4CS3 A;  3NEL A;  4YPF A;  2ZT6 A;  12AS A;  4AH6 A;  2DVE A;  4EO4 A;  4XTZ A;  3HXZ A;  3L2Z A;  4LNS A;  3TEG A;  4WJ3 M;  3HRI A;  3ERR A;  1H4S A;  2AKW B;  2ZCE A;  4XTY A;  3UH0 A;  4G85 A;  3A7R A;  4HWR A;  1PYS B;  1WLE A;  1WPY A;  1NJ2 A;  2ZZG A;  1EOV A;  2C7I A;  4P73 C;  3NEM A;  4TQF A;  1EVK A;  1B8A A;  11AS A;  5C52 B;  4CH4 A;  4TVA A;  2ART A;  4YRC A;  2QHV A;  4G84 A;  1ASY A;  4H2X B;  3KFU A;  1X55 A;  1X56 A;  3LC0 A;  3UGQ A;  2I4O A;  4YDQ A;  3PZC A;  1G5H A;  3VQV A;  2ZTG A;  5E3I A;  4CH3 A;  2DZC A;  2DTI A;  1NNH A;  2EL9 A;  3RGL A;  4TWA A;  1X2H A;  2Q5I A;  2RHS A;  3RKY A;  4XU1 A;  3PCO A;  3RIR A;  1QF6 A;  4P74 A;  1PYS A;  3P8V A;  3MF1 A;  1NJ5 A;  3P8Y A;  2AKW A;  4O2D A;  1GGM A;  4P71 C;  1YGB A;  1YFT A;  4OP0 A;  1NJ1 A;  3MEY A;  4CS2 A;  3TEH A;  5C53 B;  2Q7E A;  4XU0 A;  2CJ9 A;  1Z7N A;  4RDX A;  2PME A;  4RMF A;  2XGT A;  2ZT5 A;  2DEQ A;  2HNI A;  3HXV A;  1N9W A;  3RL6 A;  4K88 A;  2PMF A;  4XU3 A;  3V7R A;  4TQD A;  4KR2 A;  3EFR A;  1EIY A;  2Q5H A;  3V7S A;  4H2T A;  4HA8 A;  4UP7 A;  1X54 A;  1HXD A;  2E5A A;  1EFW A;  2E1H A;  2RHQ A;  3P8T A;  3FJP A;  1NYQ A;  2EJ9 A;  1HTT A;  2ALY B;  2ZT7 A;  4TVW A;  2ZIN A;  1VQZ A;  4DPG A;  2XTI A;  4KQE A;  4PHC A;  1X01 A;  4YRM A;  1JJC A;  3LSS A;  4WI1 A;  1NYR A;  3ICA A;  4P75 C;  1L0W A;  1YFR A;  2ODR C;  4YRQ A;  2AMC B;  4ZTZ B;  2ZIO A;  3IAL A;  3PCO B;  4YCV A;  4Q6G A;  1E1O A;  4WJ4 A;  4HWT A;  3A7A A;  4XTU A;  3V7C A;  1ASZ A;  3G1Z A;  2G4C A;  3HXX A;  4YCU A;  1ADY A;  4YYE A;  3W3S A;  3VQY A;  4K86 A;  2ZT8 A;  3L4G A;  1EQR A;  4P3O A;  4OLF A;  4UP9 A;  1W66 A;  4ZTU B;  4TTV A;  1B70 A;  4YRN A;  4P71 A;  1WNL A;  3TUP A;  3VQX A;  3LSQ A;  1H4V B;  3HFZ A;  3VQW A;  3L4G B;  1BBU A;  4HWS A;  2E10 A;  3M4Q A;  2DU5 A;  4P74 C;  4H2S A;  2E65 A;  4H2U A;  3CMQ A;  3HFV A;  2FYK A;  1WQ7 A;  3E9I A;  2RHQ B;  2ZGW A;  2ARU A;  1ADJ A;  4Q15 A;  1ATI A;  3V8J A;  2DTO A;  1BIB A;  3HXW A;  2CJA A;  3UFG A;  4KR3 A;  2CJB A;  2C8M A;  2J3L A;  2I4M A;  4J15 A;  2E64 A;  1YFS A;  4BW9 A;  4RQE A;  3NET A;  5K1X A;  1USY C;  1WYD A;  3DSQ A;  3A31 A;  2DXU A;  3REU A;  2DTH A;  2P5I A;  3RKW A;  2QHS A;  2DDZ A;  2P0L A;  3BJU A;  3RUX A;  1WQW A;  3UGT A;  2ZNJ A;  4P3N A;  1USY A;  4BWA A;  4HWP A;  3QO5 A;  4YRL A;  3A32 A;  3MF2 A;  1G51 A;  4HWO A;  1HC7 A;  1E24 A;  2EWN A;  4XU2 A;  3HY0 A;  4L87 A;  4K87 A;  4P73 A;  4P72 A;  3M4P A;  3OD1 A;  3A5Z A;  4UPA A;  2QHT A;  1B76 A;  1QE0 A;  4YRK A;  3TEH B;  2ARS A;  1IL2 A;  2Q7G A;  2DKG A;  1KMM A;  3RAC A;  4ZIB A;  3HTZ A;  1C0A A;  3HXY A; 
#chains in the Genus database with same CATH topology
 3A74 A;  4YCW A;  4HVC A;  4UP8 A;  3HRK A;  1G5I A;  1B7Y A;  1NJ6 A;  2DQ0 A;  4CS4 A;  4YRO A;  1E22 A;  2Q7H A;  5F5W A;  4H2W A;  4EX5 A;  2ZIM A;  5HGQ A;  2QHU A;  1RIQ A;  4H2V A;  4XTX A;  5ELN A;  2EJF A;  2ZR2 A;  4YRJ A;  2E41 A;  3WQZ A;  4WF2 A;  4E51 A;  1E1T A;  2ZXF A;  1KMN A;  1WU7 A;  3REX A;  3QTC A;  2J3M A;  1SRY A;  4YRR A;  5C51 B;  2E3C A;  3IKM B;  3IG2 A;  3VBB A;  1SET A;  3RKX A;  3HFZ B;  3HY1 A;  1LYL A;  2EAY A;  4P75 A;  4YRI A;  1EVL A;  2I4L A;  3V8K A;  1KOG A;  1JJC B;  4LVM A;  1H4Q A;  4DQ2 A;  3R07 A;  2DJZ A;  4RQF A;  3IKL A;  3A5Y A;  4YRT A;  4YRG A;  3NEN A;  1J5W A;  5K1P A;  2RHS B;  2ALY A;  1X2G A;  3L1A A;  4TVY A;  5ELO A;  3QO8 A;  2ZZE A;  2DZ9 A;  3MQZ A;  4CH6 A;  1B7Y B;  2I4N A;  4P72 C;  4YRS A;  1SES A;  1EIY B;  3RF1 A;  1FYF A;  2ZNI A;  2EJG A;  2DQ3 A;  4YP0 A;  1Z7M A;  3HXU A;  2IY5 A;  1H4T A;  4YRE A;  4X5O A;  5KNN A;  4XEO A;  4TVA B;  2ODR D;  3E9H A;  3QNE A;  4NCX A;  4H02 A;  2CGH A;  4P3P A;  2DXT A;  4H2X A;  4CH5 A;  4YRF A;  3EFS A;  2AMC A;  3QO7 A;  1SER A;  2ZZF A;  3I7F A;  1YB3 A;  3V8L A;  4XTV A;  2CIM A;  4LVI A;  1BIA A;  1BBW A;  2ZR3 A;  4XTW A;  3A7U A;  2IY5 B;  1NJ8 A;  2DU7 A;  4XEM A;  3BFM A;  4YRP A;  1B70 B;  4PG3 A;  4H2Y A;  4CS3 A;  3NEL A;  4YPF A;  2ZT6 A;  12AS A;  4AH6 A;  2DVE A;  4EO4 A;  4XTZ A;  3HXZ A;  3L2Z A;  4LNS A;  3TEG A;  4WJ3 M;  3HRI A;  3ERR A;  1H4S A;  2AKW B;  2ZCE A;  4XTY A;  3UH0 A;  4G85 A;  3A7R A;  4HWR A;  1PYS B;  1WLE A;  1WPY A;  1NJ2 A;  2ZZG A;  1EOV A;  2C7I A;  4P73 C;  3NEM A;  4TQF A;  1EVK A;  1B8A A;  11AS A;  5C52 B;  4CH4 A;  4TVA A;  2ART A;  4YRC A;  2QHV A;  4G84 A;  1ASY A;  4H2X B;  3KFU A;  1X55 A;  1X56 A;  3LC0 A;  3UGQ A;  2I4O A;  4YDQ A;  3PZC A;  1G5H A;  3VQV A;  2ZTG A;  5E3I A;  4CH3 A;  2DZC A;  2DTI A;  1NNH A;  2EL9 A;  3RGL A;  4TWA A;  1X2H A;  2Q5I A;  2RHS A;  3RKY A;  4XU1 A;  3PCO A;  3RIR A;  1QF6 A;  4P74 A;  1PYS A;  3P8V A;  3MF1 A;  1NJ5 A;  3P8Y A;  2AKW A;  4O2D A;  1GGM A;  4P71 C;  1YGB A;  1YFT A;  4OP0 A;  1NJ1 A;  3MEY A;  4CS2 A;  3TEH A;  5C53 B;  2Q7E A;  4XU0 A;  2CJ9 A;  1Z7N A;  4RDX A;  2PME A;  4LVL A;  4RMF A;  2XGT A;  2ZT5 A;  2DEQ A;  2NS6 A;  2HNI A;  3HXV A;  1N9W A;  3RL6 A;  4K88 A;  2PMF A;  4XU3 A;  3V7R A;  4TQD A;  4KR2 A;  3EFR A;  1EIY A;  2Q5H A;  3V7S A;  4H2T A;  4HA8 A;  4UP7 A;  1X54 A;  1HXD A;  2E5A A;  1EFW A;  2E1H A;  2RHQ A;  3P8T A;  3FJP A;  1NYQ A;  2EJ9 A;  1HTT A;  2ALY B;  2ZT7 A;  4TVW A;  2ZIN A;  1VQZ A;  4DPG A;  2XTI A;  4KQE A;  4PHC A;  1X01 A;  4LVJ A;  4YRM A;  1JJC A;  3LSS A;  4WI1 A;  1NYR A;  3ICA A;  4P75 C;  1L0W A;  1YFR A;  2ODR C;  4YRQ A;  2AMC B;  4ZTZ B;  2ZIO A;  3IAL A;  3PCO B;  4YCV A;  4Q6G A;  1E1O A;  4WJ4 A;  4HWT A;  3A7A A;  4XTU A;  3V7C A;  1ASZ A;  3G1Z A;  2G4C A;  3HXX A;  4YCU A;  1ADY A;  4YYE A;  3W3S A;  3VQY A;  4K86 A;  2ZT8 A;  3L4G A;  1EQR A;  4P3O A;  4OLF A;  4UP9 A;  1W66 A;  4ZTU B;  4TTV A;  1B70 A;  4YRN A;  4P71 A;  1WNL A;  3TUP A;  3VQX A;  3LSQ A;  2A8E A;  1H4V B;  3HFZ A;  3VQW A;  3L4G B;  1BBU A;  4HWS A;  2E10 A;  3M4Q A;  2DU5 A;  4P74 C;  4H2S A;  2E65 A;  4H2U A;  4LVK A;  3CMQ A;  3HFV A;  2FYK A;  1WQ7 A;  3E9I A;  2RHQ B;  2ZGW A;  2ARU A;  1ADJ A;  4Q15 A;  1ATI A;  3V8J A;  2DTO A;  4HT4 A;  1BIB A;  3HXW A;  2CJA A;  3UFG A;  4KR3 A;  2CJB A;  2C8M A;  2J3L A;  2I4M A;  4J15 A;  2E64 A;  1YFS A;  4BW9 A;  4RQE A;  3NET A;  5K1X A;  1USY C;  1WYD A;  3DSQ A;  3A31 A;  2DXU A;  3REU A;  2DTH A;  2P5I A;  3RKW A;  2QHS A;  2DDZ A;  2P0L A;  3BJU A;  3RUX A;  1WQW A;  3UGT A;  2ZNJ A;  4P3N A;  1USY A;  4BWA A;  4HWP A;  3QO5 A;  4YRL A;  3A32 A;  3MF2 A;  1G51 A;  4HWO A;  1HC7 A;  1E24 A;  2EWN A;  4XU2 A;  3HY0 A;  4L87 A;  4K87 A;  4P73 A;  4P72 A;  3M4P A;  3OD1 A;  3A5Z A;  4UPA A;  2QHT A;  1B76 A;  1QE0 A;  4YRK A;  3TEH B;  2ARS A;  1IL2 A;  2Q7G A;  2DKG A;  1KMM A;  3RAC A;  4ZIB A;  3HTZ A;  1C0A A;  3HXY A; 
#chains in the Genus database with same CATH homology
 3A74 A;  4YCW A;  4HVC A;  4UP8 A;  3HRK A;  1G5I A;  1B7Y A;  1NJ6 A;  2DQ0 A;  4CS4 A;  4YRO A;  1E22 A;  2Q7H A;  5F5W A;  4H2W A;  4EX5 A;  2ZIM A;  5HGQ A;  2QHU A;  1RIQ A;  4H2V A;  4XTX A;  5ELN A;  2EJF A;  2ZR2 A;  4YRJ A;  2E41 A;  3WQZ A;  4WF2 A;  4E51 A;  1E1T A;  2ZXF A;  1KMN A;  1WU7 A;  3REX A;  3QTC A;  2J3M A;  1SRY A;  4YRR A;  5C51 B;  2E3C A;  3IKM B;  3IG2 A;  3VBB A;  1SET A;  3RKX A;  3HFZ B;  3HY1 A;  1LYL A;  2EAY A;  4P75 A;  4YRI A;  1EVL A;  2I4L A;  3V8K A;  1KOG A;  1JJC B;  4LVM A;  1H4Q A;  4DQ2 A;  3R07 A;  2DJZ A;  4RQF A;  3IKL A;  3A5Y A;  4YRT A;  4YRG A;  3NEN A;  1J5W A;  5K1P A;  2RHS B;  2ALY A;  1X2G A;  3L1A A;  4TVY A;  5ELO A;  3QO8 A;  2ZZE A;  2DZ9 A;  3MQZ A;  4CH6 A;  1B7Y B;  2I4N A;  4P72 C;  4YRS A;  1SES A;  1EIY B;  3RF1 A;  1FYF A;  2ZNI A;  2EJG A;  2DQ3 A;  4YP0 A;  1Z7M A;  3HXU A;  2IY5 A;  1H4T A;  4YRE A;  4X5O A;  5KNN A;  4XEO A;  4TVA B;  2ODR D;  3E9H A;  3QNE A;  4NCX A;  4H02 A;  2CGH A;  4P3P A;  2DXT A;  4H2X A;  4CH5 A;  4YRF A;  3EFS A;  2AMC A;  3QO7 A;  1SER A;  2ZZF A;  3I7F A;  1YB3 A;  3V8L A;  4XTV A;  2CIM A;  4LVI A;  1BIA A;  1BBW A;  2ZR3 A;  4XTW A;  3A7U A;  2IY5 B;  1NJ8 A;  2DU7 A;  4XEM A;  3BFM A;  4YRP A;  1B70 B;  4PG3 A;  4H2Y A;  4CS3 A;  3NEL A;  4YPF A;  2ZT6 A;  12AS A;  4AH6 A;  2DVE A;  4EO4 A;  4XTZ A;  3HXZ A;  3L2Z A;  4LNS A;  3TEG A;  4WJ3 M;  3HRI A;  3ERR A;  1H4S A;  2AKW B;  2ZCE A;  4XTY A;  3UH0 A;  4G85 A;  3A7R A;  4HWR A;  1PYS B;  1WLE A;  1WPY A;  1NJ2 A;  2ZZG A;  1EOV A;  2C7I A;  4P73 C;  3NEM A;  4TQF A;  1EVK A;  1B8A A;  11AS A;  5C52 B;  4CH4 A;  4TVA A;  2ART A;  4YRC A;  2QHV A;  4G84 A;  1ASY A;  4H2X B;  3KFU A;  1X55 A;  1X56 A;  3LC0 A;  3UGQ A;  2I4O A;  4YDQ A;  3PZC A;  1G5H A;  3VQV A;  2ZTG A;  5E3I A;  4CH3 A;  2DZC A;  2DTI A;  1NNH A;  2EL9 A;  3RGL A;  4TWA A;  1X2H A;  2Q5I A;  2RHS A;  3RKY A;  4XU1 A;  3PCO A;  3RIR A;  1QF6 A;  4P74 A;  1PYS A;  3P8V A;  3MF1 A;  1NJ5 A;  3P8Y A;  2AKW A;  4O2D A;  1GGM A;  4P71 C;  1YGB A;  1YFT A;  4OP0 A;  1NJ1 A;  3MEY A;  4CS2 A;  3TEH A;  5C53 B;  2Q7E A;  4XU0 A;  2CJ9 A;  1Z7N A;  4RDX A;  2PME A;  4LVL A;  4RMF A;  2XGT A;  2ZT5 A;  2DEQ A;  2NS6 A;  2HNI A;  3HXV A;  1N9W A;  3RL6 A;  4K88 A;  2PMF A;  4XU3 A;  3V7R A;  4TQD A;  4KR2 A;  3EFR A;  1EIY A;  2Q5H A;  3V7S A;  4H2T A;  4HA8 A;  4UP7 A;  1X54 A;  1HXD A;  2E5A A;  1EFW A;  2E1H A;  2RHQ A;  3P8T A;  3FJP A;  1NYQ A;  2EJ9 A;  1HTT A;  2ALY B;  2ZT7 A;  4TVW A;  2ZIN A;  1VQZ A;  4DPG A;  2XTI A;  4KQE A;  4PHC A;  1X01 A;  4LVJ A;  4YRM A;  1JJC A;  3LSS A;  4WI1 A;  1NYR A;  3ICA A;  4P75 C;  1L0W A;  1YFR A;  2ODR C;  4YRQ A;  2AMC B;  4ZTZ B;  2ZIO A;  3IAL A;  3PCO B;  4YCV A;  4Q6G A;  1E1O A;  4WJ4 A;  4HWT A;  3A7A A;  4XTU A;  3V7C A;  1ASZ A;  3G1Z A;  2G4C A;  3HXX A;  4YCU A;  1ADY A;  4YYE A;  3W3S A;  3VQY A;  4K86 A;  2ZT8 A;  3L4G A;  1EQR A;  4P3O A;  4OLF A;  4UP9 A;  1W66 A;  4ZTU B;  4TTV A;  1B70 A;  4YRN A;  4P71 A;  1WNL A;  3TUP A;  3VQX A;  3LSQ A;  2A8E A;  1H4V B;  3HFZ A;  3VQW A;  3L4G B;  1BBU A;  4HWS A;  2E10 A;  3M4Q A;  2DU5 A;  4P74 C;  4H2S A;  2E65 A;  4H2U A;  4LVK A;  3CMQ A;  3HFV A;  2FYK A;  1WQ7 A;  3E9I A;  2RHQ B;  2ZGW A;  2ARU A;  1ADJ A;  4Q15 A;  1ATI A;  3V8J A;  2DTO A;  4HT4 A;  1BIB A;  3HXW A;  2CJA A;  3UFG A;  4KR3 A;  2CJB A;  2C8M A;  2J3L A;  2I4M A;  4J15 A;  2E64 A;  1YFS A;  4BW9 A;  4RQE A;  3NET A;  5K1X A;  1USY C;  1WYD A;  3DSQ A;  3A31 A;  2DXU A;  3REU A;  2DTH A;  2P5I A;  3RKW A;  2QHS A;  2DDZ A;  2P0L A;  3BJU A;  3RUX A;  1WQW A;  3UGT A;  2ZNJ A;  4P3N A;  1USY A;  4BWA A;  4HWP A;  3QO5 A;  4YRL A;  3A32 A;  3MF2 A;  1G51 A;  4HWO A;  1HC7 A;  1E24 A;  2EWN A;  4XU2 A;  3HY0 A;  4L87 A;  4K87 A;  4P73 A;  4P72 A;  3M4P A;  3OD1 A;  3A5Z A;  4UPA A;  2QHT A;  1B76 A;  1QE0 A;  4YRK A;  3TEH B;  2ARS A;  1IL2 A;  2Q7G A;  2DKG A;  1KMM A;  3RAC A;  4ZIB A;  3HTZ A;  1C0A A;  3HXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...