4P75C

Phers in complex with compound 4a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
249
structure length
235
Chain Sequence
b'ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
molecule tags Ligase/ligase inhibitor
source organism Pseudomonas aeruginosa
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
total genus 64
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p75C01
4TVAA 1GGMA 3FJPA 4YP0A 2E3CA 3P8TA 4P3NA 1SRYA 1X54A 4UP8A 4H2VA 3UGQA 2XGTA 3PCOB 4ZTUB 4TTVA 4P75A 3TEHA 2E10A 4BWAA 2DQ3A 2J3MA 1WPYA 3QTCA 1LYLA 4HWOA 11ASA 2ZIOA 2AMCA 1B76A 3BFMA 2ZCEA 2ZIMA 4H2WA 4XTZA 1E1TA 3EFRA 1X2GA 2ZR3A 3RUXA 4HWSA 1PYSA 3QO5A 4YRCA 4TVWA 4KQEA 3A7UA 2XTIA 2E65A 3V7RA 3HFVA 1USYA 2E64A 3HXZA 2ZZFA 2QHUA 3DSQA 3NELA 3IKLA 4J15A 2IY5B 1VQZA 4YRKA 2I4LA 4CS3A 1EQRA 4HA8A 1NJ6A 2Q7HA 3HXYA 1B7YA 4H2XA 4H2SA 1BIBA 4P75C 3HY0A 3CMQA 3A5YA 4P71A 4XTWA 4KR2A 1W66A 4TVYA 4CS4A 4HVCA 3NEMA 2DXUA 4P74C 3HRIA 4X5OA 3A31A 1NNHA 1BBUA 4YDQA 4YPFA 3MF2A 4OP0A 3NETA 4E51A 3A32A 2HNIA 1H4TA 2IY5A 2DXTA 3MEYA 2RHQB 4XEOA 3VQXA 3IG2A 3A74A 4WF2A 4UP7A 2CJ9A 2J3LA 2PMEA 3V8JA 4K87A 2EJFA 3EFSA 2ZT6A 1EOVA 2DJZA 1B7YB 4DPGA 4AH6A 3WQZA 2AKWA 1X55A 1X56A 1N9WA 2ZTGA 4NCXA 1J5WA 1WYDA 2EJGA 3UGTA 2ZZEA 3QNEA 2C7IA 1HTTA 3HY1A 1YGBA 4PG3A 4ZIBA 2CJBA 1ASYA 1EFWA 4P71C 3MF1A 4EO4A 2PMFA 4CH4A 3RF1A 3RL6A 2ZT7A 1B8AA 4XU2A 1C0AA 1NYQA 4RDXA 1NJ1A 3R07A 3BJUA 4XU0A 5C53B 4YRSA 2RHQA 3P8VA 3VQYA 1NJ2A 4HWTA 3LSSA 1RIQA 1WQ7A 3HFZB 2ZNJA 1SESA 5E3IA 3HXXA 3LSQA 1ADYA 1EIYA 4YRNA 3ICAA 1EVKA 4K88A 4Q15A 3M4QA 5C51B 3HXUA 3A5ZA 4TVAB 4ZTZB 1H4SA 3HRKA 2DKGA 5K1XA 2ALYB 3IKMB 4YREA 3L4GA 2ZNIA 1YFRA 3L4GB 1ATIA 1G5HA 1WQWA 4RMFA 2ZGWA 3IALA 3E9IA 3VQVA 2ODRD 4PHCA 2G4CA 3LC0A 2EJ9A 3A7AA 2DZCA 3PCOA 2Q5IA 4RQEA 4YRJA 4YCWA 5C52B 1WU7A 2QHTA 1KOGA 5ELOA 3HFZA 4Q6GA 1NJ8A 4WJ3M 2DDZA 4OLFA 3RIRA 4P74A 4HWPA 4YRPA 3RKXA 1JJCA 3OD1A 4G84A 4YRFA 3VBBA 1G51A 1E22A 1HC7A 1Z7NA 4CH6A 1FYFA 2DTHA 3I7FA 2CJAA 1X01A 2DU7A 2RHSA 1QF6A 4TQDA 3L1AA 4TWAA 4BW9A 4EX5A 4XU1A 1KMMA 4KR3A 4LNSA 5K1PA 2Q7EA 3V8LA 3QO8A 3UFGA 1YFTA 4K86A 2ARSA 1G5IA 4RQFA 2P0LA 1EIYB 3V7CA 2ZR2A 4P72C 2DZ9A 2CIMA 4WJ4A 1SETA 2ZZGA 4P3OA 4YRLA 1L0WA 3ERRA 4G85A 2E1HA 4WI1A 3G1ZA 4YYEA 2DVEA 3V8KA 2Q5HA 2RHSB 4XTVA 1E24A 4L87A 2DTOA 4YCVA 3QO7A 3REUA 1IL2A 3W3SA 3VQWA 4H02A 1Z7MA 1NJ5A 3TUPA 3HXWA 2E5AA 4CS2A 2E41A 4YRMA 2DTIA 1B70A 4P3PA 1WNLA 4XU3A 2FYKA 2EL9A 1HXDA 3UH0A 2ARTA 4P73C 4YRTA 2AMCB 4YROA 2DU5A 2EWNA 2ZT5A 1QE0A 4XTXA 3P8YA 4YRQA 4YRIA 4H2YA 3PZCA 4TQFA 3HTZA 3TEGA 4YRGA 4XTUA 2ODRC 2I4MA 5KNNA 3RACA 3E9HA 2I4OA 1ADJA 2DQ0A 5F5WA 2QHSA 2C8MA 2P5IA 1SERA 1ASZA 3KFUA 3REXA 4XEMA 4DQ2A 4YCUA 12ASA 1PYSB 2CGHA 3NENA 2ZT8A 1E1OA 1BBWA 2ZINA 4XTYA 3RKWA 4HWRA 3A7RA 3RKYA 4O2DA 1EVLA 1KMNA 3V7SA 1H4QA 4H2TA 1WLEA 2DEQA 1BIAA 2EAYA 1B70B 4UPAA 1H4VB 3RGLA 1YFSA 2QHVA 4CH3A 2I4NA 3TEHB 1X2HA 4YRRA 1JJCB 3L2ZA 4P73A 3M4PA 4P72A 4CH5A 5ELNA 4UP9A 2AKWB 2ARUA 2Q7GA 4H2XB 1YB3A 1NYRA 1USYC 2ALYA 3HXVA 5HGQA 4H2UA 2ZXFA
chains in the Genus database with same CATH superfamily
4TVAA 1GGMA 3FJPA 4YP0A 2E3CA 3P8TA 4P3NA 1SRYA 4LVIA 1X54A 4UP8A 4HT4A 4H2VA 3UGQA 2XGTA 3PCOB 4ZTUB 4TTVA 4P75A 3TEHA 2E10A 4BWAA 2DQ3A 2J3MA 1WPYA 3QTCA 1LYLA 4HWOA 11ASA 2ZIOA 2AMCA 1B76A 3BFMA 2ZCEA 2ZIMA 4H2WA 4XTZA 1E1TA 3EFRA 1X2GA 2ZR3A 3RUXA 4HWSA 1PYSA 3QO5A 4YRCA 4TVWA 4KQEA 3A7UA 2XTIA 2E65A 3V7RA 3HFVA 1USYA 2E64A 3HXZA 2ZZFA 2QHUA 3DSQA 3NELA 3IKLA 4J15A 2IY5B 1VQZA 4YRKA 2I4LA 4CS3A 1EQRA 4HA8A 1NJ6A 2Q7HA 3HXYA 1B7YA 4H2XA 4H2SA 1BIBA 4P75C 3HY0A 3CMQA 3A5YA 4P71A 4XTWA 4KR2A 1W66A 4TVYA 4CS4A 4HVCA 3NEMA 2DXUA 4P74C 3HRIA 4X5OA 3A31A 1NNHA 1BBUA 4YDQA 4YPFA 3MF2A 4OP0A 3NETA 4E51A 3A32A 2HNIA 1H4TA 2IY5A 2DXTA 3MEYA 2RHQB 4XEOA 3VQXA 3IG2A 3A74A 4WF2A 4UP7A 2CJ9A 2J3LA 2PMEA 3V8JA 4K87A 2EJFA 3EFSA 2ZT6A 1EOVA 2DJZA 1B7YB 4DPGA 4AH6A 3WQZA 2AKWA 1X55A 1X56A 1N9WA 2ZTGA 4NCXA 1J5WA 1WYDA 2EJGA 3UGTA 2ZZEA 3QNEA 2C7IA 1HTTA 3HY1A 1YGBA 4PG3A 4ZIBA 2CJBA 1ASYA 1EFWA 2A8EA 4P71C 3MF1A 4EO4A 2PMFA 4CH4A 3RF1A 3RL6A 2ZT7A 1B8AA 4XU2A 1C0AA 1NYQA 4RDXA 1NJ1A 3R07A 3BJUA 4XU0A 5C53B 4YRSA 2RHQA 3P8VA 3VQYA 1NJ2A 4HWTA 3LSSA 4LVJA 1RIQA 1WQ7A 4LVLA 3HFZB 2ZNJA 1SESA 5E3IA 3HXXA 3LSQA 1ADYA 1EIYA 4YRNA 3ICAA 1EVKA 4K88A 4Q15A 3M4QA 5C51B 3HXUA 3A5ZA 4TVAB 4ZTZB 1H4SA 3HRKA 2DKGA 5K1XA 2ALYB 3IKMB 4YREA 3L4GA 2ZNIA 1YFRA 3L4GB 1ATIA 1G5HA 1WQWA 4RMFA 2ZGWA 3IALA 3E9IA 3VQVA 2ODRD 4PHCA 2G4CA 3LC0A 2EJ9A 3A7AA 2DZCA 3PCOA 2Q5IA 4RQEA 4YRJA 4YCWA 5C52B 1WU7A 2QHTA 1KOGA 5ELOA 3HFZA 4Q6GA 1NJ8A 4WJ3M 2DDZA 4OLFA 3RIRA 4P74A 4HWPA 4YRPA 3RKXA 1JJCA 3OD1A 4G84A 4YRFA 3VBBA 1G51A 1E22A 1HC7A 1Z7NA 4CH6A 1FYFA 2DTHA 3I7FA 2CJAA 1X01A 2DU7A 2RHSA 1QF6A 4TQDA 3L1AA 4TWAA 4BW9A 4EX5A 4XU1A 1KMMA 4KR3A 4LNSA 5K1PA 2Q7EA 3V8LA 3QO8A 3UFGA 1YFTA 4K86A 2ARSA 1G5IA 4RQFA 2P0LA 1EIYB 3V7CA 2ZR2A 4P72C 2DZ9A 2CIMA 4WJ4A 1SETA 2ZZGA 4P3OA 4YRLA 1L0WA 3ERRA 4G85A 2E1HA 4WI1A 3G1ZA 4YYEA 2DVEA 3V8KA 2Q5HA 2RHSB 4XTVA 1E24A 4L87A 2DTOA 4YCVA 3QO7A 3REUA 1IL2A 3W3SA 3VQWA 4H02A 1Z7MA 1NJ5A 3TUPA 3HXWA 2E5AA 4CS2A 2E41A 4YRMA 2DTIA 1B70A 4P3PA 1WNLA 4XU3A 2FYKA 2EL9A 1HXDA 3UH0A 2ARTA 4P73C 4YRTA 2AMCB 4YROA 2DU5A 2EWNA 4LVMA 2ZT5A 1QE0A 4XTXA 3P8YA 4YRQA 4YRIA 4H2YA 3PZCA 4TQFA 3HTZA 3TEGA 4YRGA 4XTUA 2ODRC 2I4MA 2NS6A 5KNNA 3MQZA 3RACA 3E9HA 2I4OA 1ADJA 2DQ0A 5F5WA 2QHSA 2C8MA 2P5IA 1SERA 1ASZA 3KFUA 3REXA 4XEMA 4DQ2A 4YCUA 12ASA 1PYSB 2CGHA 3NENA 2ZT8A 1E1OA 1BBWA 2ZINA 4XTYA 3RKWA 4HWRA 3A7RA 3RKYA 4O2DA 1EVLA 1KMNA 3V7SA 1H4QA 4H2TA 1WLEA 2DEQA 1BIAA 2EAYA 1B70B 4UPAA 1H4VB 3RGLA 1YFSA 2QHVA 4CH3A 2I4NA 3TEHB 1X2HA 4YRRA 1JJCB 3L2ZA 4P73A 3M4PA 4P72A 4CH5A 5ELNA 4UP9A 2AKWB 2ARUA 2Q7GA 4H2XB 1YB3A 1NYRA 1USYC 2ALYA 3HXVA 5HGQA 4LVKA 4H2UA 2ZXFA
chains in the Genus database with same CATH topology
4TVAA 1GGMA 3FJPA 4YP0A 2E3CA 3P8TA 4P3NA 1SRYA 4LVIA 1X54A 4UP8A 4HT4A 4H2VA 3UGQA 2XGTA 3PCOB 4ZTUB 4TTVA 4P75A 3TEHA 2E10A 4BWAA 2DQ3A 2J3MA 1WPYA 3QTCA 1LYLA 4HWOA 11ASA 2ZIOA 2AMCA 1B76A 3BFMA 2ZCEA 2ZIMA 4H2WA 4XTZA 1E1TA 3EFRA 1X2GA 2ZR3A 3RUXA 4HWSA 1PYSA 3QO5A 4YRCA 4TVWA 4KQEA 3A7UA 2XTIA 2E65A 3V7RA 3HFVA 1USYA 2E64A 3HXZA 2ZZFA 2QHUA 3DSQA 3NELA 3IKLA 4J15A 2IY5B 1VQZA 4YRKA 2I4LA 4CS3A 1EQRA 4HA8A 1NJ6A 2Q7HA 3HXYA 1B7YA 4H2XA 4H2SA 1BIBA 4P75C 3HY0A 3CMQA 3A5YA 4P71A 4XTWA 4KR2A 1W66A 4TVYA 4CS4A 4HVCA 3NEMA 2DXUA 4P74C 3HRIA 4X5OA 3A31A 1NNHA 1BBUA 4YDQA 4YPFA 3MF2A 4OP0A 3NETA 4E51A 3A32A 2HNIA 1H4TA 2IY5A 2DXTA 3MEYA 2RHQB 4XEOA 3VQXA 3IG2A 3A74A 4WF2A 4UP7A 2CJ9A 2J3LA 2PMEA 3V8JA 4K87A 2EJFA 3EFSA 2ZT6A 1EOVA 2DJZA 1B7YB 4DPGA 4AH6A 3WQZA 2AKWA 1X55A 1X56A 1N9WA 2ZTGA 4NCXA 1J5WA 1WYDA 2EJGA 3UGTA 2ZZEA 3QNEA 2C7IA 1HTTA 3HY1A 1YGBA 4PG3A 4ZIBA 2CJBA 1ASYA 1EFWA 2A8EA 4P71C 3MF1A 4EO4A 2PMFA 4CH4A 3RF1A 3RL6A 2ZT7A 1B8AA 4XU2A 1C0AA 1NYQA 4RDXA 1NJ1A 3R07A 3BJUA 4XU0A 5C53B 4YRSA 2RHQA 3P8VA 3VQYA 1NJ2A 4HWTA 3LSSA 4LVJA 1RIQA 1WQ7A 4LVLA 3HFZB 2ZNJA 1SESA 5E3IA 3HXXA 3LSQA 1ADYA 1EIYA 4YRNA 3ICAA 1EVKA 4K88A 4Q15A 3M4QA 5C51B 3HXUA 3A5ZA 4TVAB 4ZTZB 1H4SA 3HRKA 2DKGA 5K1XA 2ALYB 3IKMB 4YREA 3L4GA 2ZNIA 1YFRA 3L4GB 1ATIA 1G5HA 1WQWA 4RMFA 2ZGWA 3IALA 3E9IA 3VQVA 2ODRD 4PHCA 2G4CA 3LC0A 2EJ9A 3A7AA 2DZCA 3PCOA 2Q5IA 4RQEA 4YRJA 4YCWA 5C52B 1WU7A 2QHTA 1KOGA 5ELOA 3HFZA 4Q6GA 1NJ8A 4WJ3M 2DDZA 4OLFA 3RIRA 4P74A 4HWPA 4YRPA 3RKXA 1JJCA 3OD1A 4G84A 4YRFA 3VBBA 1G51A 1E22A 1HC7A 1Z7NA 4CH6A 1FYFA 2DTHA 3I7FA 2CJAA 1X01A 2DU7A 2RHSA 1QF6A 4TQDA 3L1AA 4TWAA 4BW9A 4EX5A 4XU1A 1KMMA 4KR3A 4LNSA 5K1PA 2Q7EA 3V8LA 3QO8A 3UFGA 1YFTA 4K86A 2ARSA 1G5IA 4RQFA 2P0LA 1EIYB 3V7CA 2ZR2A 4P72C 2DZ9A 2CIMA 4WJ4A 1SETA 2ZZGA 4P3OA 4YRLA 1L0WA 3ERRA 4G85A 2E1HA 4WI1A 3G1ZA 4YYEA 2DVEA 3V8KA 2Q5HA 2RHSB 4XTVA 1E24A 4L87A 2DTOA 4YCVA 3QO7A 3REUA 1IL2A 3W3SA 3VQWA 4H02A 1Z7MA 1NJ5A 3TUPA 3HXWA 2E5AA 4CS2A 2E41A 4YRMA 2DTIA 1B70A 4P3PA 1WNLA 4XU3A 2FYKA 2EL9A 1HXDA 3UH0A 2ARTA 4P73C 4YRTA 2AMCB 4YROA 2DU5A 2EWNA 4LVMA 2ZT5A 1QE0A 4XTXA 3P8YA 4YRQA 4YRIA 4H2YA 3PZCA 4TQFA 3HTZA 3TEGA 4YRGA 4XTUA 2ODRC 2I4MA 2NS6A 5KNNA 3MQZA 3RACA 3E9HA 2I4OA 1ADJA 2DQ0A 5F5WA 2QHSA 2C8MA 2P5IA 1SERA 1ASZA 3KFUA 3REXA 4XEMA 4DQ2A 4YCUA 12ASA 1PYSB 2CGHA 3NENA 2ZT8A 1E1OA 1BBWA 2ZINA 4XTYA 3RKWA 4HWRA 3A7RA 3RKYA 4O2DA 1EVLA 1KMNA 3V7SA 1H4QA 4H2TA 1WLEA 2DEQA 1BIAA 2EAYA 1B70B 4UPAA 1H4VB 3RGLA 1YFSA 2QHVA 4CH3A 2I4NA 3TEHB 1X2HA 4YRRA 1JJCB 3L2ZA 4P73A 3M4PA 4P72A 4CH5A 5ELNA 4UP9A 2AKWB 2ARUA 2Q7GA 4H2XB 1YB3A 1NYRA 1USYC 2ALYA 3HXVA 5HGQA 4LVKA 4H2UA 2ZXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVA A;  1GGM A;  3FJP A;  4YP0 A;  2E3C A;  3P8T A;  4P3N A;  1SRY A;  1X54 A;  4UP8 A;  4H2V A;  3UGQ A;  2XGT A;  3PCO B;  4ZTU B;  4TTV A;  4P75 A;  3TEH A;  2E10 A;  4BWA A;  2DQ3 A;  2J3M A;  1WPY A;  3QTC A;  1LYL A;  4HWO A;  11AS A;  2ZIO A;  2AMC A;  1B76 A;  3BFM A;  2ZCE A;  2ZIM A;  4H2W A;  4XTZ A;  1E1T A;  3EFR A;  1X2G A;  2ZR3 A;  3RUX A;  4HWS A;  1PYS A;  3QO5 A;  4YRC A;  4TVW A;  4KQE A;  3A7U A;  2XTI A;  2E65 A;  3V7R A;  3HFV A;  1USY A;  2E64 A;  3HXZ A;  2ZZF A;  2QHU A;  3DSQ A;  3NEL A;  3IKL A;  4J15 A;  2IY5 B;  1VQZ A;  4YRK A;  2I4L A;  4CS3 A;  1EQR A;  4HA8 A;  1NJ6 A;  2Q7H A;  3HXY A;  1B7Y A;  4H2X A;  4H2S A;  1BIB A;  4P75 C;  3HY0 A;  3CMQ A;  3A5Y A;  4P71 A;  4XTW A;  4KR2 A;  1W66 A;  4TVY A;  4CS4 A;  4HVC A;  3NEM A;  2DXU A;  4P74 C;  3HRI A;  4X5O A;  3A31 A;  1NNH A;  1BBU A;  4YDQ A;  4YPF A;  3MF2 A;  4OP0 A;  3NET A;  4E51 A;  3A32 A;  2HNI A;  1H4T A;  2IY5 A;  2DXT A;  3MEY A;  2RHQ B;  4XEO A;  3VQX A;  3IG2 A;  3A74 A;  4WF2 A;  4UP7 A;  2CJ9 A;  2J3L A;  2PME A;  3V8J A;  4K87 A;  2EJF A;  3EFS A;  2ZT6 A;  1EOV A;  2DJZ A;  1B7Y B;  4DPG A;  4AH6 A;  3WQZ A;  2AKW A;  1X55 A;  1X56 A;  1N9W A;  2ZTG A;  4NCX A;  1J5W A;  1WYD A;  2EJG A;  3UGT A;  2ZZE A;  3QNE A;  2C7I A;  1HTT A;  3HY1 A;  1YGB A;  4PG3 A;  4ZIB A;  2CJB A;  1ASY A;  1EFW A;  4P71 C;  3MF1 A;  4EO4 A;  2PMF A;  4CH4 A;  3RF1 A;  3RL6 A;  2ZT7 A;  1B8A A;  4XU2 A;  1C0A A;  1NYQ A;  4RDX A;  1NJ1 A;  3R07 A;  3BJU A;  4XU0 A;  5C53 B;  4YRS A;  2RHQ A;  3P8V A;  3VQY A;  1NJ2 A;  4HWT A;  3LSS A;  1RIQ A;  1WQ7 A;  3HFZ B;  2ZNJ A;  1SES A;  5E3I A;  3HXX A;  3LSQ A;  1ADY A;  1EIY A;  4YRN A;  3ICA A;  1EVK A;  4K88 A;  4Q15 A;  3M4Q A;  5C51 B;  3HXU A;  3A5Z A;  4TVA B;  4ZTZ B;  1H4S A;  3HRK A;  2DKG A;  5K1X A;  2ALY B;  3IKM B;  4YRE A;  3L4G A;  2ZNI A;  1YFR A;  3L4G B;  1ATI A;  1G5H A;  1WQW A;  4RMF A;  2ZGW A;  3IAL A;  3E9I A;  3VQV A;  2ODR D;  4PHC A;  2G4C A;  3LC0 A;  2EJ9 A;  3A7A A;  2DZC A;  3PCO A;  2Q5I A;  4RQE A;  4YRJ A;  4YCW A;  5C52 B;  1WU7 A;  2QHT A;  1KOG A;  5ELO A;  3HFZ A;  4Q6G A;  1NJ8 A;  4WJ3 M;  2DDZ A;  4OLF A;  3RIR A;  4P74 A;  4HWP A;  4YRP A;  3RKX A;  1JJC A;  3OD1 A;  4G84 A;  4YRF A;  3VBB A;  1G51 A;  1E22 A;  1HC7 A;  1Z7N A;  4CH6 A;  1FYF A;  2DTH A;  3I7F A;  2CJA A;  1X01 A;  2DU7 A;  2RHS A;  1QF6 A;  4TQD A;  3L1A A;  4TWA A;  4BW9 A;  4EX5 A;  4XU1 A;  1KMM A;  4KR3 A;  4LNS A;  5K1P A;  2Q7E A;  3V8L A;  3QO8 A;  3UFG A;  1YFT A;  4K86 A;  2ARS A;  1G5I A;  4RQF A;  2P0L A;  1EIY B;  3V7C A;  2ZR2 A;  4P72 C;  2DZ9 A;  2CIM A;  4WJ4 A;  1SET A;  2ZZG A;  4P3O A;  4YRL A;  1L0W A;  3ERR A;  4G85 A;  2E1H A;  4WI1 A;  3G1Z A;  4YYE A;  2DVE A;  3V8K A;  2Q5H A;  2RHS B;  4XTV A;  1E24 A;  4L87 A;  2DTO A;  4YCV A;  3QO7 A;  3REU A;  1IL2 A;  3W3S A;  3VQW A;  4H02 A;  1Z7M A;  1NJ5 A;  3TUP A;  3HXW A;  2E5A A;  4CS2 A;  2E41 A;  4YRM A;  2DTI A;  1B70 A;  4P3P A;  1WNL A;  4XU3 A;  2FYK A;  2EL9 A;  1HXD A;  3UH0 A;  2ART A;  4P73 C;  4YRT A;  2AMC B;  4YRO A;  2DU5 A;  2EWN A;  2ZT5 A;  1QE0 A;  4XTX A;  3P8Y A;  4YRQ A;  4YRI A;  4H2Y A;  3PZC A;  4TQF A;  3HTZ A;  3TEG A;  4YRG A;  4XTU A;  2ODR C;  2I4M A;  5KNN A;  3RAC A;  3E9H A;  2I4O A;  1ADJ A;  2DQ0 A;  5F5W A;  2QHS A;  2C8M A;  2P5I A;  1SER A;  1ASZ A;  3KFU A;  3REX A;  4XEM A;  4DQ2 A;  4YCU A;  12AS A;  1PYS B;  2CGH A;  3NEN A;  2ZT8 A;  1E1O A;  1BBW A;  2ZIN A;  4XTY A;  3RKW A;  4HWR A;  3A7R A;  3RKY A;  4O2D A;  1EVL A;  1KMN A;  3V7S A;  1H4Q A;  4H2T A;  1WLE A;  2DEQ A;  1BIA A;  2EAY A;  1B70 B;  4UPA A;  1H4V B;  3RGL A;  1YFS A;  2QHV A;  4CH3 A;  2I4N A;  3TEH B;  1X2H A;  4YRR A;  1JJC B;  3L2Z A;  4P73 A;  3M4P A;  4P72 A;  4CH5 A;  5ELN A;  4UP9 A;  2AKW B;  2ARU A;  2Q7G A;  4H2X B;  1YB3 A;  1NYR A;  1USY C;  2ALY A;  3HXV A;  5HGQ A;  4H2U A;  2ZXF A; 
#chains in the Genus database with same CATH topology
 4TVA A;  1GGM A;  3FJP A;  4YP0 A;  2E3C A;  3P8T A;  4P3N A;  1SRY A;  4LVI A;  1X54 A;  4UP8 A;  4HT4 A;  4H2V A;  3UGQ A;  2XGT A;  3PCO B;  4ZTU B;  4TTV A;  4P75 A;  3TEH A;  2E10 A;  4BWA A;  2DQ3 A;  2J3M A;  1WPY A;  3QTC A;  1LYL A;  4HWO A;  11AS A;  2ZIO A;  2AMC A;  1B76 A;  3BFM A;  2ZCE A;  2ZIM A;  4H2W A;  4XTZ A;  1E1T A;  3EFR A;  1X2G A;  2ZR3 A;  3RUX A;  4HWS A;  1PYS A;  3QO5 A;  4YRC A;  4TVW A;  4KQE A;  3A7U A;  2XTI A;  2E65 A;  3V7R A;  3HFV A;  1USY A;  2E64 A;  3HXZ A;  2ZZF A;  2QHU A;  3DSQ A;  3NEL A;  3IKL A;  4J15 A;  2IY5 B;  1VQZ A;  4YRK A;  2I4L A;  4CS3 A;  1EQR A;  4HA8 A;  1NJ6 A;  2Q7H A;  3HXY A;  1B7Y A;  4H2X A;  4H2S A;  1BIB A;  4P75 C;  3HY0 A;  3CMQ A;  3A5Y A;  4P71 A;  4XTW A;  4KR2 A;  1W66 A;  4TVY A;  4CS4 A;  4HVC A;  3NEM A;  2DXU A;  4P74 C;  3HRI A;  4X5O A;  3A31 A;  1NNH A;  1BBU A;  4YDQ A;  4YPF A;  3MF2 A;  4OP0 A;  3NET A;  4E51 A;  3A32 A;  2HNI A;  1H4T A;  2IY5 A;  2DXT A;  3MEY A;  2RHQ B;  4XEO A;  3VQX A;  3IG2 A;  3A74 A;  4WF2 A;  4UP7 A;  2CJ9 A;  2J3L A;  2PME A;  3V8J A;  4K87 A;  2EJF A;  3EFS A;  2ZT6 A;  1EOV A;  2DJZ A;  1B7Y B;  4DPG A;  4AH6 A;  3WQZ A;  2AKW A;  1X55 A;  1X56 A;  1N9W A;  2ZTG A;  4NCX A;  1J5W A;  1WYD A;  2EJG A;  3UGT A;  2ZZE A;  3QNE A;  2C7I A;  1HTT A;  3HY1 A;  1YGB A;  4PG3 A;  4ZIB A;  2CJB A;  1ASY A;  1EFW A;  2A8E A;  4P71 C;  3MF1 A;  4EO4 A;  2PMF A;  4CH4 A;  3RF1 A;  3RL6 A;  2ZT7 A;  1B8A A;  4XU2 A;  1C0A A;  1NYQ A;  4RDX A;  1NJ1 A;  3R07 A;  3BJU A;  4XU0 A;  5C53 B;  4YRS A;  2RHQ A;  3P8V A;  3VQY A;  1NJ2 A;  4HWT A;  3LSS A;  4LVJ A;  1RIQ A;  1WQ7 A;  4LVL A;  3HFZ B;  2ZNJ A;  1SES A;  5E3I A;  3HXX A;  3LSQ A;  1ADY A;  1EIY A;  4YRN A;  3ICA A;  1EVK A;  4K88 A;  4Q15 A;  3M4Q A;  5C51 B;  3HXU A;  3A5Z A;  4TVA B;  4ZTZ B;  1H4S A;  3HRK A;  2DKG A;  5K1X A;  2ALY B;  3IKM B;  4YRE A;  3L4G A;  2ZNI A;  1YFR A;  3L4G B;  1ATI A;  1G5H A;  1WQW A;  4RMF A;  2ZGW A;  3IAL A;  3E9I A;  3VQV A;  2ODR D;  4PHC A;  2G4C A;  3LC0 A;  2EJ9 A;  3A7A A;  2DZC A;  3PCO A;  2Q5I A;  4RQE A;  4YRJ A;  4YCW A;  5C52 B;  1WU7 A;  2QHT A;  1KOG A;  5ELO A;  3HFZ A;  4Q6G A;  1NJ8 A;  4WJ3 M;  2DDZ A;  4OLF A;  3RIR A;  4P74 A;  4HWP A;  4YRP A;  3RKX A;  1JJC A;  3OD1 A;  4G84 A;  4YRF A;  3VBB A;  1G51 A;  1E22 A;  1HC7 A;  1Z7N A;  4CH6 A;  1FYF A;  2DTH A;  3I7F A;  2CJA A;  1X01 A;  2DU7 A;  2RHS A;  1QF6 A;  4TQD A;  3L1A A;  4TWA A;  4BW9 A;  4EX5 A;  4XU1 A;  1KMM A;  4KR3 A;  4LNS A;  5K1P A;  2Q7E A;  3V8L A;  3QO8 A;  3UFG A;  1YFT A;  4K86 A;  2ARS A;  1G5I A;  4RQF A;  2P0L A;  1EIY B;  3V7C A;  2ZR2 A;  4P72 C;  2DZ9 A;  2CIM A;  4WJ4 A;  1SET A;  2ZZG A;  4P3O A;  4YRL A;  1L0W A;  3ERR A;  4G85 A;  2E1H A;  4WI1 A;  3G1Z A;  4YYE A;  2DVE A;  3V8K A;  2Q5H A;  2RHS B;  4XTV A;  1E24 A;  4L87 A;  2DTO A;  4YCV A;  3QO7 A;  3REU A;  1IL2 A;  3W3S A;  3VQW A;  4H02 A;  1Z7M A;  1NJ5 A;  3TUP A;  3HXW A;  2E5A A;  4CS2 A;  2E41 A;  4YRM A;  2DTI A;  1B70 A;  4P3P A;  1WNL A;  4XU3 A;  2FYK A;  2EL9 A;  1HXD A;  3UH0 A;  2ART A;  4P73 C;  4YRT A;  2AMC B;  4YRO A;  2DU5 A;  2EWN A;  4LVM A;  2ZT5 A;  1QE0 A;  4XTX A;  3P8Y A;  4YRQ A;  4YRI A;  4H2Y A;  3PZC A;  4TQF A;  3HTZ A;  3TEG A;  4YRG A;  4XTU A;  2ODR C;  2I4M A;  2NS6 A;  5KNN A;  3MQZ A;  3RAC A;  3E9H A;  2I4O A;  1ADJ A;  2DQ0 A;  5F5W A;  2QHS A;  2C8M A;  2P5I A;  1SER A;  1ASZ A;  3KFU A;  3REX A;  4XEM A;  4DQ2 A;  4YCU A;  12AS A;  1PYS B;  2CGH A;  3NEN A;  2ZT8 A;  1E1O A;  1BBW A;  2ZIN A;  4XTY A;  3RKW A;  4HWR A;  3A7R A;  3RKY A;  4O2D A;  1EVL A;  1KMN A;  3V7S A;  1H4Q A;  4H2T A;  1WLE A;  2DEQ A;  1BIA A;  2EAY A;  1B70 B;  4UPA A;  1H4V B;  3RGL A;  1YFS A;  2QHV A;  4CH3 A;  2I4N A;  3TEH B;  1X2H A;  4YRR A;  1JJC B;  3L2Z A;  4P73 A;  3M4P A;  4P72 A;  4CH5 A;  5ELN A;  4UP9 A;  2AKW B;  2ARU A;  2Q7G A;  4H2X B;  1YB3 A;  1NYR A;  1USY C;  2ALY A;  3HXV A;  5HGQ A;  4LVK A;  4H2U A;  2ZXF A; 
#chains in the Genus database with same CATH homology
 4TVA A;  1GGM A;  3FJP A;  4YP0 A;  2E3C A;  3P8T A;  4P3N A;  1SRY A;  4LVI A;  1X54 A;  4UP8 A;  4HT4 A;  4H2V A;  3UGQ A;  2XGT A;  3PCO B;  4ZTU B;  4TTV A;  4P75 A;  3TEH A;  2E10 A;  4BWA A;  2DQ3 A;  2J3M A;  1WPY A;  3QTC A;  1LYL A;  4HWO A;  11AS A;  2ZIO A;  2AMC A;  1B76 A;  3BFM A;  2ZCE A;  2ZIM A;  4H2W A;  4XTZ A;  1E1T A;  3EFR A;  1X2G A;  2ZR3 A;  3RUX A;  4HWS A;  1PYS A;  3QO5 A;  4YRC A;  4TVW A;  4KQE A;  3A7U A;  2XTI A;  2E65 A;  3V7R A;  3HFV A;  1USY A;  2E64 A;  3HXZ A;  2ZZF A;  2QHU A;  3DSQ A;  3NEL A;  3IKL A;  4J15 A;  2IY5 B;  1VQZ A;  4YRK A;  2I4L A;  4CS3 A;  1EQR A;  4HA8 A;  1NJ6 A;  2Q7H A;  3HXY A;  1B7Y A;  4H2X A;  4H2S A;  1BIB A;  4P75 C;  3HY0 A;  3CMQ A;  3A5Y A;  4P71 A;  4XTW A;  4KR2 A;  1W66 A;  4TVY A;  4CS4 A;  4HVC A;  3NEM A;  2DXU A;  4P74 C;  3HRI A;  4X5O A;  3A31 A;  1NNH A;  1BBU A;  4YDQ A;  4YPF A;  3MF2 A;  4OP0 A;  3NET A;  4E51 A;  3A32 A;  2HNI A;  1H4T A;  2IY5 A;  2DXT A;  3MEY A;  2RHQ B;  4XEO A;  3VQX A;  3IG2 A;  3A74 A;  4WF2 A;  4UP7 A;  2CJ9 A;  2J3L A;  2PME A;  3V8J A;  4K87 A;  2EJF A;  3EFS A;  2ZT6 A;  1EOV A;  2DJZ A;  1B7Y B;  4DPG A;  4AH6 A;  3WQZ A;  2AKW A;  1X55 A;  1X56 A;  1N9W A;  2ZTG A;  4NCX A;  1J5W A;  1WYD A;  2EJG A;  3UGT A;  2ZZE A;  3QNE A;  2C7I A;  1HTT A;  3HY1 A;  1YGB A;  4PG3 A;  4ZIB A;  2CJB A;  1ASY A;  1EFW A;  2A8E A;  4P71 C;  3MF1 A;  4EO4 A;  2PMF A;  4CH4 A;  3RF1 A;  3RL6 A;  2ZT7 A;  1B8A A;  4XU2 A;  1C0A A;  1NYQ A;  4RDX A;  1NJ1 A;  3R07 A;  3BJU A;  4XU0 A;  5C53 B;  4YRS A;  2RHQ A;  3P8V A;  3VQY A;  1NJ2 A;  4HWT A;  3LSS A;  4LVJ A;  1RIQ A;  1WQ7 A;  4LVL A;  3HFZ B;  2ZNJ A;  1SES A;  5E3I A;  3HXX A;  3LSQ A;  1ADY A;  1EIY A;  4YRN A;  3ICA A;  1EVK A;  4K88 A;  4Q15 A;  3M4Q A;  5C51 B;  3HXU A;  3A5Z A;  4TVA B;  4ZTZ B;  1H4S A;  3HRK A;  2DKG A;  5K1X A;  2ALY B;  3IKM B;  4YRE A;  3L4G A;  2ZNI A;  1YFR A;  3L4G B;  1ATI A;  1G5H A;  1WQW A;  4RMF A;  2ZGW A;  3IAL A;  3E9I A;  3VQV A;  2ODR D;  4PHC A;  2G4C A;  3LC0 A;  2EJ9 A;  3A7A A;  2DZC A;  3PCO A;  2Q5I A;  4RQE A;  4YRJ A;  4YCW A;  5C52 B;  1WU7 A;  2QHT A;  1KOG A;  5ELO A;  3HFZ A;  4Q6G A;  1NJ8 A;  4WJ3 M;  2DDZ A;  4OLF A;  3RIR A;  4P74 A;  4HWP A;  4YRP A;  3RKX A;  1JJC A;  3OD1 A;  4G84 A;  4YRF A;  3VBB A;  1G51 A;  1E22 A;  1HC7 A;  1Z7N A;  4CH6 A;  1FYF A;  2DTH A;  3I7F A;  2CJA A;  1X01 A;  2DU7 A;  2RHS A;  1QF6 A;  4TQD A;  3L1A A;  4TWA A;  4BW9 A;  4EX5 A;  4XU1 A;  1KMM A;  4KR3 A;  4LNS A;  5K1P A;  2Q7E A;  3V8L A;  3QO8 A;  3UFG A;  1YFT A;  4K86 A;  2ARS A;  1G5I A;  4RQF A;  2P0L A;  1EIY B;  3V7C A;  2ZR2 A;  4P72 C;  2DZ9 A;  2CIM A;  4WJ4 A;  1SET A;  2ZZG A;  4P3O A;  4YRL A;  1L0W A;  3ERR A;  4G85 A;  2E1H A;  4WI1 A;  3G1Z A;  4YYE A;  2DVE A;  3V8K A;  2Q5H A;  2RHS B;  4XTV A;  1E24 A;  4L87 A;  2DTO A;  4YCV A;  3QO7 A;  3REU A;  1IL2 A;  3W3S A;  3VQW A;  4H02 A;  1Z7M A;  1NJ5 A;  3TUP A;  3HXW A;  2E5A A;  4CS2 A;  2E41 A;  4YRM A;  2DTI A;  1B70 A;  4P3P A;  1WNL A;  4XU3 A;  2FYK A;  2EL9 A;  1HXD A;  3UH0 A;  2ART A;  4P73 C;  4YRT A;  2AMC B;  4YRO A;  2DU5 A;  2EWN A;  4LVM A;  2ZT5 A;  1QE0 A;  4XTX A;  3P8Y A;  4YRQ A;  4YRI A;  4H2Y A;  3PZC A;  4TQF A;  3HTZ A;  3TEG A;  4YRG A;  4XTU A;  2ODR C;  2I4M A;  2NS6 A;  5KNN A;  3MQZ A;  3RAC A;  3E9H A;  2I4O A;  1ADJ A;  2DQ0 A;  5F5W A;  2QHS A;  2C8M A;  2P5I A;  1SER A;  1ASZ A;  3KFU A;  3REX A;  4XEM A;  4DQ2 A;  4YCU A;  12AS A;  1PYS B;  2CGH A;  3NEN A;  2ZT8 A;  1E1O A;  1BBW A;  2ZIN A;  4XTY A;  3RKW A;  4HWR A;  3A7R A;  3RKY A;  4O2D A;  1EVL A;  1KMN A;  3V7S A;  1H4Q A;  4H2T A;  1WLE A;  2DEQ A;  1BIA A;  2EAY A;  1B70 B;  4UPA A;  1H4V B;  3RGL A;  1YFS A;  2QHV A;  4CH3 A;  2I4N A;  3TEH B;  1X2H A;  4YRR A;  1JJC B;  3L2Z A;  4P73 A;  3M4P A;  4P72 A;  4CH5 A;  5ELN A;  4UP9 A;  2AKW B;  2ARU A;  2Q7G A;  4H2X B;  1YB3 A;  1NYR A;  1USY C;  2ALY A;  3HXV A;  5HGQ A;  4LVK A;  4H2U A;  2ZXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...