4P75C

Phers in complex with compound 4a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase/ligase inhibitor
total genus 64
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p75C01
2G4CA 4WI1A 3E9HA 1SETA 2DVEA 2CIMA 4YRSA 2DDZA 4YRTA 4CH3A 1NJ2A 1HXDA 1BIAA 2C7IA 2I4OA 1N9WA 1Z7NA 4YRQA 2DQ3A 3VQWA 2DEQA 3NEMA 2AMCA 2ARSA 2ARTA 1B76A 3MF1A 3QO8A 4DPGA 3VBBA 2E3CA 1B7YA 4K88A 12ASA 2ZXFA 1B70A 3REXA 3VQXA 1Z7MA 4YRFA 3W3SA 1NJ1A 1BIBA 3BJUA 4LNSA 1BBUA 3ICAA 2Q7EA 1WYDA 1WLEA 1X54A 3HFZA 4UPAA 2XGTA 1EVKA 3HY0A 1PYSA 2I4MA 4AH6A 4HWTA 3RGLA 1EIYA 4XEMA 2ZR3A 1YFTA 4TQDA 4YRCA 4UP8A 5C51B 1WNLA 5ELOA 4YRKA 4P3OA 3PCOB 2DTOA 4HWSA 3RL6A 4YRIA 4XU2A 3L4GB 1ASYA 2E1HA 2DQ0A 3BFMA 3A31A 2ZTGA 4H2TA 4H2SA 4CH6A 2PMEA 1EQRA 4OP0A 4WJ4A 4RQFA 4H2YA 1BBWA 3A5YA 4ZTUB 2DTHA 1E1TA 4RDXA 1G51A 3HRIA 3QNEA 4XTYA 2I4LA 1ADJA 1JJCB 4K86A 1HC7A 1USYC 3LC0A 3HXZA 3M4PA 1YGBA 4CS3A 4YCVA 4XTUA 1SERA 1YFSA 1X55A 2EJ9A 4YDQA 2IY5A 4P74C 4YRJA 2ZT6A 1H4VB 2ZZFA 3UFGA 1NJ8A 4BWAA 3PZCA 4P73A 2ODRD 4CH4A 1W66A 4TVYA 1ADYA 3IALA 4ZTZB 4P72A 4E51A 4P75C 2P0LA 1SRYA 3L2ZA 2QHVA 4XU1A 3L1AA 3TEGA 2J3MA 3P8YA 4G84A 3UGQA 1IL2A 2DKGA 4H2UA 4L87A 4YRLA 1SESA 1KMNA 3VQYA 2ZZEA 2CJAA 3NENA 5C53B 2Q5IA 3HXVA 2ZNIA 2AMCB 4UP9A 4KR3A 4HVCA 11ASA 4YCWA 2ODRC 1B7YB 4XEOA 4KR2A 1B70B 3M4QA 3P8VA 3RUXA 1NNHA 1C0AA 4TVAA 3TEHA 4YRRA 3EFSA 5E3IA 3I7FA 1KMMA 2ALYA 2EJGA 2PMFA 4WF2A 4HWPA 1H4SA 3KFUA 2DU5A 1GGMA 4PG3A 1G5IA 3V7SA 1ASZA 2AKWA 3HFZB 2RHSA 1LYLA 3RF1A 2CJ9A 1KOGA 1X2HA 2ZGWA 4TVWA 1PYSB 1FYFA 1USYA 4WJ3M 1ATIA 2ZZGA 1EIYB 3RIRA 2DZ9A 3LSQA 4YP0A 2EJFA 4YPFA 3RKXA 2XTIA 4TWAA 3CMQA 1H4TA 1NJ5A 1EFWA 2RHQA 2EL9A 3IKMB 3QTCA 4BW9A 3FJPA 3V7RA 1QF6A 5KNNA 4K87A 3V7CA 4H2WA 4XU0A 3IKLA 3HXXA 3G1ZA 2QHUA 4P75A 3HXYA 4YYEA 4H2XA 3HFVA 1E1OA 4HA8A 5K1PA 2HNIA 4O2DA 4XTZA 2Q7HA 1NYRA 3A32A 1VQZA 4UP7A 1QE0A 3A74A 4XTWA 4P3NA 5F5WA 1YFRA 4J15A 4XTXA 2IY5B 1X56A 3HXUA 3NETA 4OLFA 2Q5HA 3R07A 4P71C 2E41A 1B8AA 1NJ6A 3E9IA 3RKYA 3RKWA 3WQZA 4RQEA 1G5HA 3QO5A 4EO4A 1WQWA 4YRPA 2QHSA 2DTIA 3OD1A 1YB3A 4X5OA 2E64A 3A7UA 4YRGA 2ZNJA 4YROA 1J5WA 2DXUA 4NCXA 3MEYA 3REUA 2E5AA 4EX5A 3IG2A 2FYKA 3UH0A 4H02A 4KQEA 3HTZA 2DJZA 4PHCA 2Q7GA 2C8MA 4TVAB 4P73C 3TEHB 4HWRA 1EOVA 1WU7A 2ALYB 4Q15A 4Q6GA 2J3LA 2ZR2A 4P72C 4RMFA 1E24A 2I4NA 2AKWB 5K1XA 1WPYA 2RHSB 4TTVA 3HRKA 2CJBA 1X2GA 2E65A 4XTVA 4H2VA 1E22A 5HGQA 4P74A 2QHTA 3EFRA 4CH5A 3PCOA 3RACA 3L4GA 3UGTA 4YRNA 3V8JA 2RHQB 4P71A 2ZT5A 2DZCA 3TUPA 2ZT8A 3VQVA 3NELA 4CS2A 3A7AA 2DXTA 4TQFA 4CS4A 4HWOA 1X01A 4P3PA 2E10A 1JJCA 4H2XB 1HTTA 1EVLA 2CGHA 3DSQA 1WQ7A 3V8KA 3ERRA 2ARUA 4G85A 4DQ2A 2DU7A 3QO7A 3V8LA 1RIQA 1NYQA 3P8TA 4YREA 5ELNA 4YCUA 3HY1A 1H4QA 2ZCEA 4XU3A 2ZIOA 2EAYA 3MF2A 3A5ZA 3HXWA 5C52B 2ZINA 3A7RA 2ZIMA 2P5IA 4YRMA 3LSSA 1L0WA 2ZT7A 4ZIBA 2EWNA
chains in the Genus database with same CATH superfamily
2G4CA 4WI1A 3E9HA 1SETA 2DVEA 2CIMA 4YRSA 2DDZA 4YRTA 4CH3A 1NJ2A 1HXDA 1BIAA 2C7IA 2I4OA 1N9WA 1Z7NA 4YRQA 2DQ3A 3VQWA 2DEQA 3NEMA 2AMCA 2ARSA 2ARTA 1B76A 3MF1A 3QO8A 4DPGA 3VBBA 2E3CA 1B7YA 4K88A 12ASA 2ZXFA 1B70A 3REXA 3VQXA 1Z7MA 4YRFA 3W3SA 1NJ1A 1BIBA 3BJUA 4LNSA 1BBUA 3ICAA 2Q7EA 1WYDA 1WLEA 1X54A 3HFZA 4UPAA 2XGTA 1EVKA 3HY0A 1PYSA 2I4MA 4AH6A 4HWTA 3RGLA 1EIYA 4XEMA 2ZR3A 4LVMA 1YFTA 4TQDA 4YRCA 4UP8A 5C51B 1WNLA 5ELOA 4YRKA 4P3OA 3PCOB 2DTOA 4HWSA 3RL6A 4YRIA 4XU2A 3L4GB 1ASYA 2E1HA 4HT4A 2DQ0A 3BFMA 3A31A 2ZTGA 4H2TA 4H2SA 4CH6A 2PMEA 1EQRA 4OP0A 4WJ4A 4RQFA 4H2YA 1BBWA 3A5YA 4ZTUB 2DTHA 1E1TA 4RDXA 1G51A 3HRIA 3QNEA 4XTYA 2I4LA 1ADJA 1JJCB 4K86A 1HC7A 1USYC 3LC0A 3HXZA 3M4PA 1YGBA 4CS3A 4YCVA 4XTUA 1SERA 1YFSA 1X55A 2EJ9A 4YDQA 2IY5A 4P74C 4YRJA 2ZT6A 1H4VB 2ZZFA 3UFGA 1NJ8A 4BWAA 3PZCA 4P73A 2ODRD 4CH4A 1W66A 4TVYA 1ADYA 3IALA 4ZTZB 4P72A 4E51A 4P75C 2P0LA 1SRYA 3L2ZA 2QHVA 4XU1A 3L1AA 3TEGA 2J3MA 3P8YA 4G84A 3UGQA 1IL2A 2DKGA 4H2UA 4L87A 4YRLA 1SESA 1KMNA 3VQYA 2ZZEA 2CJAA 3NENA 5C53B 2Q5IA 3HXVA 2ZNIA 2AMCB 4UP9A 4KR3A 4HVCA 11ASA 4YCWA 2ODRC 1B7YB 4XEOA 4KR2A 1B70B 3M4QA 3P8VA 3RUXA 1NNHA 1C0AA 4TVAA 3TEHA 4YRRA 3EFSA 5E3IA 3I7FA 1KMMA 2ALYA 2EJGA 2PMFA 4WF2A 4HWPA 1H4SA 3KFUA 2DU5A 1GGMA 4PG3A 1G5IA 3V7SA 4LVLA 1ASZA 2AKWA 3HFZB 2RHSA 1LYLA 3RF1A 2CJ9A 1KOGA 1X2HA 2ZGWA 4TVWA 1PYSB 1FYFA 1USYA 4WJ3M 1ATIA 2ZZGA 1EIYB 3RIRA 2DZ9A 3LSQA 4YP0A 2EJFA 4YPFA 3RKXA 2XTIA 4TWAA 3CMQA 1H4TA 1NJ5A 1EFWA 2RHQA 2EL9A 3IKMB 3QTCA 4BW9A 3FJPA 3V7RA 1QF6A 5KNNA 4K87A 3V7CA 4H2WA 4XU0A 3IKLA 3HXXA 3G1ZA 2QHUA 4P75A 3HXYA 4YYEA 4H2XA 3HFVA 1E1OA 4HA8A 5K1PA 2HNIA 4O2DA 4XTZA 2Q7HA 1NYRA 3A32A 1VQZA 4UP7A 1QE0A 3A74A 4XTWA 4P3NA 5F5WA 1YFRA 4J15A 4XTXA 2IY5B 3MQZA 1X56A 3HXUA 3NETA 4OLFA 2Q5HA 3R07A 4P71C 2E41A 1B8AA 1NJ6A 3E9IA 3RKYA 3RKWA 3WQZA 4RQEA 1G5HA 3QO5A 4EO4A 1WQWA 4YRPA 2QHSA 2DTIA 3OD1A 1YB3A 4X5OA 2NS6A 2E64A 3A7UA 4YRGA 2ZNJA 4YROA 1J5WA 2DXUA 4NCXA 3MEYA 3REUA 2E5AA 4EX5A 3IG2A 2FYKA 3UH0A 4H02A 4KQEA 3HTZA 2DJZA 4PHCA 2Q7GA 2C8MA 4LVKA 4TVAB 4P73C 3TEHB 4HWRA 1EOVA 1WU7A 2ALYB 4Q15A 4Q6GA 2J3LA 2ZR2A 4P72C 4RMFA 1E24A 2I4NA 4LVJA 2AKWB 5K1XA 1WPYA 2RHSB 4TTVA 3HRKA 2CJBA 1X2GA 2E65A 4XTVA 4H2VA 1E22A 5HGQA 4P74A 2QHTA 3EFRA 4CH5A 3PCOA 2A8EA 3RACA 3L4GA 3UGTA 4YRNA 3V8JA 2RHQB 4P71A 2ZT5A 2DZCA 3TUPA 2ZT8A 3VQVA 3NELA 4CS2A 3A7AA 2DXTA 4TQFA 4CS4A 4HWOA 1X01A 4P3PA 4LVIA 2E10A 1JJCA 4H2XB 1HTTA 1EVLA 2CGHA 3DSQA 1WQ7A 3V8KA 3ERRA 2ARUA 4G85A 4DQ2A 2DU7A 3QO7A 3V8LA 1RIQA 1NYQA 3P8TA 4YREA 5ELNA 4YCUA 3HY1A 1H4QA 2ZCEA 4XU3A 2ZIOA 2EAYA 3MF2A 3A5ZA 3HXWA 5C52B 2ZINA 3A7RA 2ZIMA 2P5IA 4YRMA 3LSSA 1L0WA 2ZT7A 4ZIBA 2EWNA
chains in the Genus database with same CATH topology
2G4CA 4WI1A 3E9HA 1SETA 2DVEA 2CIMA 4YRSA 2DDZA 4YRTA 4CH3A 1NJ2A 1HXDA 1BIAA 2C7IA 2I4OA 1N9WA 1Z7NA 4YRQA 2DQ3A 3VQWA 2DEQA 3NEMA 2AMCA 2ARSA 2ARTA 1B76A 3MF1A 3QO8A 4DPGA 3VBBA 2E3CA 1B7YA 4K88A 12ASA 2ZXFA 1B70A 3REXA 3VQXA 1Z7MA 4YRFA 3W3SA 1NJ1A 1BIBA 3BJUA 4LNSA 1BBUA 3ICAA 2Q7EA 1WYDA 1WLEA 1X54A 3HFZA 4UPAA 2XGTA 1EVKA 3HY0A 1PYSA 2I4MA 4AH6A 4HWTA 3RGLA 1EIYA 4XEMA 2ZR3A 4LVMA 1YFTA 4TQDA 4YRCA 4UP8A 5C51B 1WNLA 5ELOA 4YRKA 4P3OA 3PCOB 2DTOA 4HWSA 3RL6A 4YRIA 4XU2A 3L4GB 1ASYA 2E1HA 4HT4A 2DQ0A 3BFMA 3A31A 2ZTGA 4H2TA 4H2SA 4CH6A 2PMEA 1EQRA 4OP0A 4WJ4A 4RQFA 4H2YA 1BBWA 3A5YA 4ZTUB 2DTHA 1E1TA 4RDXA 1G51A 3HRIA 3QNEA 4XTYA 2I4LA 1ADJA 1JJCB 4K86A 1HC7A 1USYC 3LC0A 3HXZA 3M4PA 1YGBA 4CS3A 4YCVA 4XTUA 1SERA 1YFSA 1X55A 2EJ9A 4YDQA 2IY5A 4P74C 4YRJA 2ZT6A 1H4VB 2ZZFA 3UFGA 1NJ8A 4BWAA 3PZCA 4P73A 2ODRD 4CH4A 1W66A 4TVYA 1ADYA 3IALA 4ZTZB 4P72A 4E51A 4P75C 2P0LA 1SRYA 3L2ZA 2QHVA 4XU1A 3L1AA 3TEGA 2J3MA 3P8YA 4G84A 3UGQA 1IL2A 2DKGA 4H2UA 4L87A 4YRLA 1SESA 1KMNA 3VQYA 2ZZEA 2CJAA 3NENA 5C53B 2Q5IA 3HXVA 2ZNIA 2AMCB 4UP9A 4KR3A 4HVCA 11ASA 4YCWA 2ODRC 1B7YB 4XEOA 4KR2A 1B70B 3M4QA 3P8VA 3RUXA 1NNHA 1C0AA 4TVAA 3TEHA 4YRRA 3EFSA 5E3IA 3I7FA 1KMMA 2ALYA 2EJGA 2PMFA 4WF2A 4HWPA 1H4SA 3KFUA 2DU5A 1GGMA 4PG3A 1G5IA 3V7SA 4LVLA 1ASZA 2AKWA 3HFZB 2RHSA 1LYLA 3RF1A 2CJ9A 1KOGA 1X2HA 2ZGWA 4TVWA 1PYSB 1FYFA 1USYA 4WJ3M 1ATIA 2ZZGA 1EIYB 3RIRA 2DZ9A 3LSQA 4YP0A 2EJFA 4YPFA 3RKXA 2XTIA 4TWAA 3CMQA 1H4TA 1NJ5A 1EFWA 2RHQA 2EL9A 3IKMB 3QTCA 4BW9A 3FJPA 3V7RA 1QF6A 5KNNA 4K87A 3V7CA 4H2WA 4XU0A 3IKLA 3HXXA 3G1ZA 2QHUA 4P75A 3HXYA 4YYEA 4H2XA 3HFVA 1E1OA 4HA8A 5K1PA 2HNIA 4O2DA 4XTZA 2Q7HA 1NYRA 3A32A 1VQZA 4UP7A 1QE0A 3A74A 4XTWA 4P3NA 5F5WA 1YFRA 4J15A 4XTXA 2IY5B 3MQZA 1X56A 3HXUA 3NETA 4OLFA 2Q5HA 3R07A 4P71C 2E41A 1B8AA 1NJ6A 3E9IA 3RKYA 3RKWA 3WQZA 4RQEA 1G5HA 3QO5A 4EO4A 1WQWA 4YRPA 2QHSA 2DTIA 3OD1A 1YB3A 4X5OA 2NS6A 2E64A 3A7UA 4YRGA 2ZNJA 4YROA 1J5WA 2DXUA 4NCXA 3MEYA 3REUA 2E5AA 4EX5A 3IG2A 2FYKA 3UH0A 4H02A 4KQEA 3HTZA 2DJZA 4PHCA 2Q7GA 2C8MA 4LVKA 4TVAB 4P73C 3TEHB 4HWRA 1EOVA 1WU7A 2ALYB 4Q15A 4Q6GA 2J3LA 2ZR2A 4P72C 4RMFA 1E24A 2I4NA 4LVJA 2AKWB 5K1XA 1WPYA 2RHSB 4TTVA 3HRKA 2CJBA 1X2GA 2E65A 4XTVA 4H2VA 1E22A 5HGQA 4P74A 2QHTA 3EFRA 4CH5A 3PCOA 2A8EA 3RACA 3L4GA 3UGTA 4YRNA 3V8JA 2RHQB 4P71A 2ZT5A 2DZCA 3TUPA 2ZT8A 3VQVA 3NELA 4CS2A 3A7AA 2DXTA 4TQFA 4CS4A 4HWOA 1X01A 4P3PA 4LVIA 2E10A 1JJCA 4H2XB 1HTTA 1EVLA 2CGHA 3DSQA 1WQ7A 3V8KA 3ERRA 2ARUA 4G85A 4DQ2A 2DU7A 3QO7A 3V8LA 1RIQA 1NYQA 3P8TA 4YREA 5ELNA 4YCUA 3HY1A 1H4QA 2ZCEA 4XU3A 2ZIOA 2EAYA 3MF2A 3A5ZA 3HXWA 5C52B 2ZINA 3A7RA 2ZIMA 2P5IA 4YRMA 3LSSA 1L0WA 2ZT7A 4ZIBA 2EWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G4C A;  4WI1 A;  3E9H A;  1SET A;  2DVE A;  2CIM A;  4YRS A;  2DDZ A;  4YRT A;  4CH3 A;  1NJ2 A;  1HXD A;  1BIA A;  2C7I A;  2I4O A;  1N9W A;  1Z7N A;  4YRQ A;  2DQ3 A;  3VQW A;  2DEQ A;  3NEM A;  2AMC A;  2ARS A;  2ART A;  1B76 A;  3MF1 A;  3QO8 A;  4DPG A;  3VBB A;  2E3C A;  1B7Y A;  4K88 A;  12AS A;  2ZXF A;  1B70 A;  3REX A;  3VQX A;  1Z7M A;  4YRF A;  3W3S A;  1NJ1 A;  1BIB A;  3BJU A;  4LNS A;  1BBU A;  3ICA A;  2Q7E A;  1WYD A;  1WLE A;  1X54 A;  3HFZ A;  4UPA A;  2XGT A;  1EVK A;  3HY0 A;  1PYS A;  2I4M A;  4AH6 A;  4HWT A;  3RGL A;  1EIY A;  4XEM A;  2ZR3 A;  1YFT A;  4TQD A;  4YRC A;  4UP8 A;  5C51 B;  1WNL A;  5ELO A;  4YRK A;  4P3O A;  3PCO B;  2DTO A;  4HWS A;  3RL6 A;  4YRI A;  4XU2 A;  3L4G B;  1ASY A;  2E1H A;  2DQ0 A;  3BFM A;  3A31 A;  2ZTG A;  4H2T A;  4H2S A;  4CH6 A;  2PME A;  1EQR A;  4OP0 A;  4WJ4 A;  4RQF A;  4H2Y A;  1BBW A;  3A5Y A;  4ZTU B;  2DTH A;  1E1T A;  4RDX A;  1G51 A;  3HRI A;  3QNE A;  4XTY A;  2I4L A;  1ADJ A;  1JJC B;  4K86 A;  1HC7 A;  1USY C;  3LC0 A;  3HXZ A;  3M4P A;  1YGB A;  4CS3 A;  4YCV A;  4XTU A;  1SER A;  1YFS A;  1X55 A;  2EJ9 A;  4YDQ A;  2IY5 A;  4P74 C;  4YRJ A;  2ZT6 A;  1H4V B;  2ZZF A;  3UFG A;  1NJ8 A;  4BWA A;  3PZC A;  4P73 A;  2ODR D;  4CH4 A;  1W66 A;  4TVY A;  1ADY A;  3IAL A;  4ZTZ B;  4P72 A;  4E51 A;  4P75 C;  2P0L A;  1SRY A;  3L2Z A;  2QHV A;  4XU1 A;  3L1A A;  3TEG A;  2J3M A;  3P8Y A;  4G84 A;  3UGQ A;  1IL2 A;  2DKG A;  4H2U A;  4L87 A;  4YRL A;  1SES A;  1KMN A;  3VQY A;  2ZZE A;  2CJA A;  3NEN A;  5C53 B;  2Q5I A;  3HXV A;  2ZNI A;  2AMC B;  4UP9 A;  4KR3 A;  4HVC A;  11AS A;  4YCW A;  2ODR C;  1B7Y B;  4XEO A;  4KR2 A;  1B70 B;  3M4Q A;  3P8V A;  3RUX A;  1NNH A;  1C0A A;  4TVA A;  3TEH A;  4YRR A;  3EFS A;  5E3I A;  3I7F A;  1KMM A;  2ALY A;  2EJG A;  2PMF A;  4WF2 A;  4HWP A;  1H4S A;  3KFU A;  2DU5 A;  1GGM A;  4PG3 A;  1G5I A;  3V7S A;  1ASZ A;  2AKW A;  3HFZ B;  2RHS A;  1LYL A;  3RF1 A;  2CJ9 A;  1KOG A;  1X2H A;  2ZGW A;  4TVW A;  1PYS B;  1FYF A;  1USY A;  4WJ3 M;  1ATI A;  2ZZG A;  1EIY B;  3RIR A;  2DZ9 A;  3LSQ A;  4YP0 A;  2EJF A;  4YPF A;  3RKX A;  2XTI A;  4TWA A;  3CMQ A;  1H4T A;  1NJ5 A;  1EFW A;  2RHQ A;  2EL9 A;  3IKM B;  3QTC A;  4BW9 A;  3FJP A;  3V7R A;  1QF6 A;  5KNN A;  4K87 A;  3V7C A;  4H2W A;  4XU0 A;  3IKL A;  3HXX A;  3G1Z A;  2QHU A;  4P75 A;  3HXY A;  4YYE A;  4H2X A;  3HFV A;  1E1O A;  4HA8 A;  5K1P A;  2HNI A;  4O2D A;  4XTZ A;  2Q7H A;  1NYR A;  3A32 A;  1VQZ A;  4UP7 A;  1QE0 A;  3A74 A;  4XTW A;  4P3N A;  5F5W A;  1YFR A;  4J15 A;  4XTX A;  2IY5 B;  1X56 A;  3HXU A;  3NET A;  4OLF A;  2Q5H A;  3R07 A;  4P71 C;  2E41 A;  1B8A A;  1NJ6 A;  3E9I A;  3RKY A;  3RKW A;  3WQZ A;  4RQE A;  1G5H A;  3QO5 A;  4EO4 A;  1WQW A;  4YRP A;  2QHS A;  2DTI A;  3OD1 A;  1YB3 A;  4X5O A;  2E64 A;  3A7U A;  4YRG A;  2ZNJ A;  4YRO A;  1J5W A;  2DXU A;  4NCX A;  3MEY A;  3REU A;  2E5A A;  4EX5 A;  3IG2 A;  2FYK A;  3UH0 A;  4H02 A;  4KQE A;  3HTZ A;  2DJZ A;  4PHC A;  2Q7G A;  2C8M A;  4TVA B;  4P73 C;  3TEH B;  4HWR A;  1EOV A;  1WU7 A;  2ALY B;  4Q15 A;  4Q6G A;  2J3L A;  2ZR2 A;  4P72 C;  4RMF A;  1E24 A;  2I4N A;  2AKW B;  5K1X A;  1WPY A;  2RHS B;  4TTV A;  3HRK A;  2CJB A;  1X2G A;  2E65 A;  4XTV A;  4H2V A;  1E22 A;  5HGQ A;  4P74 A;  2QHT A;  3EFR A;  4CH5 A;  3PCO A;  3RAC A;  3L4G A;  3UGT A;  4YRN A;  3V8J A;  2RHQ B;  4P71 A;  2ZT5 A;  2DZC A;  3TUP A;  2ZT8 A;  3VQV A;  3NEL A;  4CS2 A;  3A7A A;  2DXT A;  4TQF A;  4CS4 A;  4HWO A;  1X01 A;  4P3P A;  2E10 A;  1JJC A;  4H2X B;  1HTT A;  1EVL A;  2CGH A;  3DSQ A;  1WQ7 A;  3V8K A;  3ERR A;  2ARU A;  4G85 A;  4DQ2 A;  2DU7 A;  3QO7 A;  3V8L A;  1RIQ A;  1NYQ A;  3P8T A;  4YRE A;  5ELN A;  4YCU A;  3HY1 A;  1H4Q A;  2ZCE A;  4XU3 A;  2ZIO A;  2EAY A;  3MF2 A;  3A5Z A;  3HXW A;  5C52 B;  2ZIN A;  3A7R A;  2ZIM A;  2P5I A;  4YRM A;  3LSS A;  1L0W A;  2ZT7 A;  4ZIB A;  2EWN A; 
#chains in the Genus database with same CATH topology
 2G4C A;  4WI1 A;  3E9H A;  1SET A;  2DVE A;  2CIM A;  4YRS A;  2DDZ A;  4YRT A;  4CH3 A;  1NJ2 A;  1HXD A;  1BIA A;  2C7I A;  2I4O A;  1N9W A;  1Z7N A;  4YRQ A;  2DQ3 A;  3VQW A;  2DEQ A;  3NEM A;  2AMC A;  2ARS A;  2ART A;  1B76 A;  3MF1 A;  3QO8 A;  4DPG A;  3VBB A;  2E3C A;  1B7Y A;  4K88 A;  12AS A;  2ZXF A;  1B70 A;  3REX A;  3VQX A;  1Z7M A;  4YRF A;  3W3S A;  1NJ1 A;  1BIB A;  3BJU A;  4LNS A;  1BBU A;  3ICA A;  2Q7E A;  1WYD A;  1WLE A;  1X54 A;  3HFZ A;  4UPA A;  2XGT A;  1EVK A;  3HY0 A;  1PYS A;  2I4M A;  4AH6 A;  4HWT A;  3RGL A;  1EIY A;  4XEM A;  2ZR3 A;  4LVM A;  1YFT A;  4TQD A;  4YRC A;  4UP8 A;  5C51 B;  1WNL A;  5ELO A;  4YRK A;  4P3O A;  3PCO B;  2DTO A;  4HWS A;  3RL6 A;  4YRI A;  4XU2 A;  3L4G B;  1ASY A;  2E1H A;  4HT4 A;  2DQ0 A;  3BFM A;  3A31 A;  2ZTG A;  4H2T A;  4H2S A;  4CH6 A;  2PME A;  1EQR A;  4OP0 A;  4WJ4 A;  4RQF A;  4H2Y A;  1BBW A;  3A5Y A;  4ZTU B;  2DTH A;  1E1T A;  4RDX A;  1G51 A;  3HRI A;  3QNE A;  4XTY A;  2I4L A;  1ADJ A;  1JJC B;  4K86 A;  1HC7 A;  1USY C;  3LC0 A;  3HXZ A;  3M4P A;  1YGB A;  4CS3 A;  4YCV A;  4XTU A;  1SER A;  1YFS A;  1X55 A;  2EJ9 A;  4YDQ A;  2IY5 A;  4P74 C;  4YRJ A;  2ZT6 A;  1H4V B;  2ZZF A;  3UFG A;  1NJ8 A;  4BWA A;  3PZC A;  4P73 A;  2ODR D;  4CH4 A;  1W66 A;  4TVY A;  1ADY A;  3IAL A;  4ZTZ B;  4P72 A;  4E51 A;  4P75 C;  2P0L A;  1SRY A;  3L2Z A;  2QHV A;  4XU1 A;  3L1A A;  3TEG A;  2J3M A;  3P8Y A;  4G84 A;  3UGQ A;  1IL2 A;  2DKG A;  4H2U A;  4L87 A;  4YRL A;  1SES A;  1KMN A;  3VQY A;  2ZZE A;  2CJA A;  3NEN A;  5C53 B;  2Q5I A;  3HXV A;  2ZNI A;  2AMC B;  4UP9 A;  4KR3 A;  4HVC A;  11AS A;  4YCW A;  2ODR C;  1B7Y B;  4XEO A;  4KR2 A;  1B70 B;  3M4Q A;  3P8V A;  3RUX A;  1NNH A;  1C0A A;  4TVA A;  3TEH A;  4YRR A;  3EFS A;  5E3I A;  3I7F A;  1KMM A;  2ALY A;  2EJG A;  2PMF A;  4WF2 A;  4HWP A;  1H4S A;  3KFU A;  2DU5 A;  1GGM A;  4PG3 A;  1G5I A;  3V7S A;  4LVL A;  1ASZ A;  2AKW A;  3HFZ B;  2RHS A;  1LYL A;  3RF1 A;  2CJ9 A;  1KOG A;  1X2H A;  2ZGW A;  4TVW A;  1PYS B;  1FYF A;  1USY A;  4WJ3 M;  1ATI A;  2ZZG A;  1EIY B;  3RIR A;  2DZ9 A;  3LSQ A;  4YP0 A;  2EJF A;  4YPF A;  3RKX A;  2XTI A;  4TWA A;  3CMQ A;  1H4T A;  1NJ5 A;  1EFW A;  2RHQ A;  2EL9 A;  3IKM B;  3QTC A;  4BW9 A;  3FJP A;  3V7R A;  1QF6 A;  5KNN A;  4K87 A;  3V7C A;  4H2W A;  4XU0 A;  3IKL A;  3HXX A;  3G1Z A;  2QHU A;  4P75 A;  3HXY A;  4YYE A;  4H2X A;  3HFV A;  1E1O A;  4HA8 A;  5K1P A;  2HNI A;  4O2D A;  4XTZ A;  2Q7H A;  1NYR A;  3A32 A;  1VQZ A;  4UP7 A;  1QE0 A;  3A74 A;  4XTW A;  4P3N A;  5F5W A;  1YFR A;  4J15 A;  4XTX A;  2IY5 B;  3MQZ A;  1X56 A;  3HXU A;  3NET A;  4OLF A;  2Q5H A;  3R07 A;  4P71 C;  2E41 A;  1B8A A;  1NJ6 A;  3E9I A;  3RKY A;  3RKW A;  3WQZ A;  4RQE A;  1G5H A;  3QO5 A;  4EO4 A;  1WQW A;  4YRP A;  2QHS A;  2DTI A;  3OD1 A;  1YB3 A;  4X5O A;  2NS6 A;  2E64 A;  3A7U A;  4YRG A;  2ZNJ A;  4YRO A;  1J5W A;  2DXU A;  4NCX A;  3MEY A;  3REU A;  2E5A A;  4EX5 A;  3IG2 A;  2FYK A;  3UH0 A;  4H02 A;  4KQE A;  3HTZ A;  2DJZ A;  4PHC A;  2Q7G A;  2C8M A;  4LVK A;  4TVA B;  4P73 C;  3TEH B;  4HWR A;  1EOV A;  1WU7 A;  2ALY B;  4Q15 A;  4Q6G A;  2J3L A;  2ZR2 A;  4P72 C;  4RMF A;  1E24 A;  2I4N A;  4LVJ A;  2AKW B;  5K1X A;  1WPY A;  2RHS B;  4TTV A;  3HRK A;  2CJB A;  1X2G A;  2E65 A;  4XTV A;  4H2V A;  1E22 A;  5HGQ A;  4P74 A;  2QHT A;  3EFR A;  4CH5 A;  3PCO A;  2A8E A;  3RAC A;  3L4G A;  3UGT A;  4YRN A;  3V8J A;  2RHQ B;  4P71 A;  2ZT5 A;  2DZC A;  3TUP A;  2ZT8 A;  3VQV A;  3NEL A;  4CS2 A;  3A7A A;  2DXT A;  4TQF A;  4CS4 A;  4HWO A;  1X01 A;  4P3P A;  4LVI A;  2E10 A;  1JJC A;  4H2X B;  1HTT A;  1EVL A;  2CGH A;  3DSQ A;  1WQ7 A;  3V8K A;  3ERR A;  2ARU A;  4G85 A;  4DQ2 A;  2DU7 A;  3QO7 A;  3V8L A;  1RIQ A;  1NYQ A;  3P8T A;  4YRE A;  5ELN A;  4YCU A;  3HY1 A;  1H4Q A;  2ZCE A;  4XU3 A;  2ZIO A;  2EAY A;  3MF2 A;  3A5Z A;  3HXW A;  5C52 B;  2ZIN A;  3A7R A;  2ZIM A;  2P5I A;  4YRM A;  3LSS A;  1L0W A;  2ZT7 A;  4ZIB A;  2EWN A; 
#chains in the Genus database with same CATH homology
 2G4C A;  4WI1 A;  3E9H A;  1SET A;  2DVE A;  2CIM A;  4YRS A;  2DDZ A;  4YRT A;  4CH3 A;  1NJ2 A;  1HXD A;  1BIA A;  2C7I A;  2I4O A;  1N9W A;  1Z7N A;  4YRQ A;  2DQ3 A;  3VQW A;  2DEQ A;  3NEM A;  2AMC A;  2ARS A;  2ART A;  1B76 A;  3MF1 A;  3QO8 A;  4DPG A;  3VBB A;  2E3C A;  1B7Y A;  4K88 A;  12AS A;  2ZXF A;  1B70 A;  3REX A;  3VQX A;  1Z7M A;  4YRF A;  3W3S A;  1NJ1 A;  1BIB A;  3BJU A;  4LNS A;  1BBU A;  3ICA A;  2Q7E A;  1WYD A;  1WLE A;  1X54 A;  3HFZ A;  4UPA A;  2XGT A;  1EVK A;  3HY0 A;  1PYS A;  2I4M A;  4AH6 A;  4HWT A;  3RGL A;  1EIY A;  4XEM A;  2ZR3 A;  4LVM A;  1YFT A;  4TQD A;  4YRC A;  4UP8 A;  5C51 B;  1WNL A;  5ELO A;  4YRK A;  4P3O A;  3PCO B;  2DTO A;  4HWS A;  3RL6 A;  4YRI A;  4XU2 A;  3L4G B;  1ASY A;  2E1H A;  4HT4 A;  2DQ0 A;  3BFM A;  3A31 A;  2ZTG A;  4H2T A;  4H2S A;  4CH6 A;  2PME A;  1EQR A;  4OP0 A;  4WJ4 A;  4RQF A;  4H2Y A;  1BBW A;  3A5Y A;  4ZTU B;  2DTH A;  1E1T A;  4RDX A;  1G51 A;  3HRI A;  3QNE A;  4XTY A;  2I4L A;  1ADJ A;  1JJC B;  4K86 A;  1HC7 A;  1USY C;  3LC0 A;  3HXZ A;  3M4P A;  1YGB A;  4CS3 A;  4YCV A;  4XTU A;  1SER A;  1YFS A;  1X55 A;  2EJ9 A;  4YDQ A;  2IY5 A;  4P74 C;  4YRJ A;  2ZT6 A;  1H4V B;  2ZZF A;  3UFG A;  1NJ8 A;  4BWA A;  3PZC A;  4P73 A;  2ODR D;  4CH4 A;  1W66 A;  4TVY A;  1ADY A;  3IAL A;  4ZTZ B;  4P72 A;  4E51 A;  4P75 C;  2P0L A;  1SRY A;  3L2Z A;  2QHV A;  4XU1 A;  3L1A A;  3TEG A;  2J3M A;  3P8Y A;  4G84 A;  3UGQ A;  1IL2 A;  2DKG A;  4H2U A;  4L87 A;  4YRL A;  1SES A;  1KMN A;  3VQY A;  2ZZE A;  2CJA A;  3NEN A;  5C53 B;  2Q5I A;  3HXV A;  2ZNI A;  2AMC B;  4UP9 A;  4KR3 A;  4HVC A;  11AS A;  4YCW A;  2ODR C;  1B7Y B;  4XEO A;  4KR2 A;  1B70 B;  3M4Q A;  3P8V A;  3RUX A;  1NNH A;  1C0A A;  4TVA A;  3TEH A;  4YRR A;  3EFS A;  5E3I A;  3I7F A;  1KMM A;  2ALY A;  2EJG A;  2PMF A;  4WF2 A;  4HWP A;  1H4S A;  3KFU A;  2DU5 A;  1GGM A;  4PG3 A;  1G5I A;  3V7S A;  4LVL A;  1ASZ A;  2AKW A;  3HFZ B;  2RHS A;  1LYL A;  3RF1 A;  2CJ9 A;  1KOG A;  1X2H A;  2ZGW A;  4TVW A;  1PYS B;  1FYF A;  1USY A;  4WJ3 M;  1ATI A;  2ZZG A;  1EIY B;  3RIR A;  2DZ9 A;  3LSQ A;  4YP0 A;  2EJF A;  4YPF A;  3RKX A;  2XTI A;  4TWA A;  3CMQ A;  1H4T A;  1NJ5 A;  1EFW A;  2RHQ A;  2EL9 A;  3IKM B;  3QTC A;  4BW9 A;  3FJP A;  3V7R A;  1QF6 A;  5KNN A;  4K87 A;  3V7C A;  4H2W A;  4XU0 A;  3IKL A;  3HXX A;  3G1Z A;  2QHU A;  4P75 A;  3HXY A;  4YYE A;  4H2X A;  3HFV A;  1E1O A;  4HA8 A;  5K1P A;  2HNI A;  4O2D A;  4XTZ A;  2Q7H A;  1NYR A;  3A32 A;  1VQZ A;  4UP7 A;  1QE0 A;  3A74 A;  4XTW A;  4P3N A;  5F5W A;  1YFR A;  4J15 A;  4XTX A;  2IY5 B;  3MQZ A;  1X56 A;  3HXU A;  3NET A;  4OLF A;  2Q5H A;  3R07 A;  4P71 C;  2E41 A;  1B8A A;  1NJ6 A;  3E9I A;  3RKY A;  3RKW A;  3WQZ A;  4RQE A;  1G5H A;  3QO5 A;  4EO4 A;  1WQW A;  4YRP A;  2QHS A;  2DTI A;  3OD1 A;  1YB3 A;  4X5O A;  2NS6 A;  2E64 A;  3A7U A;  4YRG A;  2ZNJ A;  4YRO A;  1J5W A;  2DXU A;  4NCX A;  3MEY A;  3REU A;  2E5A A;  4EX5 A;  3IG2 A;  2FYK A;  3UH0 A;  4H02 A;  4KQE A;  3HTZ A;  2DJZ A;  4PHC A;  2Q7G A;  2C8M A;  4LVK A;  4TVA B;  4P73 C;  3TEH B;  4HWR A;  1EOV A;  1WU7 A;  2ALY B;  4Q15 A;  4Q6G A;  2J3L A;  2ZR2 A;  4P72 C;  4RMF A;  1E24 A;  2I4N A;  4LVJ A;  2AKW B;  5K1X A;  1WPY A;  2RHS B;  4TTV A;  3HRK A;  2CJB A;  1X2G A;  2E65 A;  4XTV A;  4H2V A;  1E22 A;  5HGQ A;  4P74 A;  2QHT A;  3EFR A;  4CH5 A;  3PCO A;  2A8E A;  3RAC A;  3L4G A;  3UGT A;  4YRN A;  3V8J A;  2RHQ B;  4P71 A;  2ZT5 A;  2DZC A;  3TUP A;  2ZT8 A;  3VQV A;  3NEL A;  4CS2 A;  3A7A A;  2DXT A;  4TQF A;  4CS4 A;  4HWO A;  1X01 A;  4P3P A;  4LVI A;  2E10 A;  1JJC A;  4H2X B;  1HTT A;  1EVL A;  2CGH A;  3DSQ A;  1WQ7 A;  3V8K A;  3ERR A;  2ARU A;  4G85 A;  4DQ2 A;  2DU7 A;  3QO7 A;  3V8L A;  1RIQ A;  1NYQ A;  3P8T A;  4YRE A;  5ELN A;  4YCU A;  3HY1 A;  1H4Q A;  2ZCE A;  4XU3 A;  2ZIO A;  2EAY A;  3MF2 A;  3A5Z A;  3HXW A;  5C52 B;  2ZIN A;  3A7R A;  2ZIM A;  2P5I A;  4YRM A;  3LSS A;  1L0W A;  2ZT7 A;  4ZIB A;  2EWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...