4P75C

Phers in complex with compound 4a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
249
structure length
235
Chain Sequence
ERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 64
structure length 235
sequence length 249
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p75C01
2ODRC 1WQWA 3HY0A 1USYC 3HXZA 4XTYA 4YRPA 4HWTA 2QHVA 1YFSA 3REXA 1RIQA 4TQFA 1YFRA 2AMCA 3PCOB 4P75C 4KR3A 4TVAA 1X54A 2ALYB 3NELA 5ELOA 3P8TA 4L87A 4ZTUB 4XTUA 4K86A 2E10A 5E3IA 4CS3A 3V7CA 1WNLA 2DZ9A 1EIYB 4YROA 3A74A 1SETA 4LNSA 2CJ9A 4AH6A 4UP7A 4YRGA 3R07A 3PCOA 1EQRA 2ALYA 2FYKA 2HNIA 4BW9A 4P74A 3IKLA 3BJUA 3LSSA 1EIYA 1X55A 4XU2A 4EO4A 2ZCEA 3QNEA 3HY1A 4PG3A 1WLEA 2I4MA 4TTVA 3UGQA 3L1AA 5C52B 2ZR2A 1B7YB 1KOGA 4HWSA 4H2VA 1X56A 2DJZA 4WJ4A 4YRTA 1WU7A 1H4SA 3MEYA 3LSQA 2Q7GA 3RL6A 4XTXA 4P3OA 4KR2A 2DU7A 2ZIMA 2RHSB 5C53B 4YRNA 2DTHA 1B7YA 1B70B 4YCUA 1X2HA 12ASA 2DVEA 1WYDA 2Q5IA 4YRRA 5F5WA 3QTCA 5KNNA 3M4PA 1H4TA 3CMQA 4RQFA 2AMCB 2RHSA 1B8AA 4Q6GA 4WF2A 2AKWB 4XTWA 1IL2A 3HXYA 3A5YA 4RDXA 1SERA 2E65A 1B70A 4UPAA 3NETA 4OLFA 4WI1A 1NJ5A 2ZT7A 1YB3A 4TVWA 4XTZA 1GGMA 4UP9A 2CJBA 4YRQA 2P5IA 11ASA 2EJGA 4P74C 1PYSB 2AKWA 3BFMA 1ADYA 1BBUA 1X2GA 1N9WA 2Q7HA 1KMMA 1NYRA 4CH5A 2XTIA 1SESA 2ZIOA 1HTTA 2ZGWA 1NYQA 2DTOA 1NJ1A 4H2SA 1H4QA 2QHSA 4XEOA 4XU1A 2ZR3A 3HFVA 3P8VA 4HA8A 4BWAA 1E24A 4XU0A 3G1ZA 1PYSA 4YRFA 3V8JA 3ERRA 1BIAA 2DKGA 1NJ2A 4H2UA 4CS2A 4HVCA 1Z7MA 2E64A 2G4CA 4RMFA 3I7FA 3IALA 2J3MA 1G5HA 4G84A 4H02A 2E5AA 2DXTA 3HXWA 3OD1A 3RACA 1FYFA 3UGTA 3A7UA 4P72A 2ZZGA 1VQZA 3V7RA 4DQ2A 4O2DA 2QHUA 1WPYA 3RKYA 1C0AA 2Q5HA 4YCVA 3HXVA 2DEQA 3A31A 3MF1A 2I4OA 4P73A 2P0LA 2PMFA 3MF2A 3RIRA 1G51A 4H2YA 1ASZA 4P71A 4YRMA 4YRJA 3HXUA 2ZT5A 2C7IA 2CGHA 3V7SA 1Z7NA 3M4QA 4XTVA 4HWRA 2DQ3A 4YREA 3TEGA 2C8MA 2PMEA 3L4GB 2DZCA 3QO8A 4K88A 5ELNA 3NEMA 2CIMA 2ZINA 2J3LA 3QO7A 3VQXA 2DU5A 4J15A 3V8LA 4H2WA 4YP0A 3VQVA 1JJCB 4OP0A 3W3SA 4H2XB 1G5IA 1L0WA 2EJFA 3KFUA 1E22A 3RUXA 3VQWA 1WQ7A 3A5ZA 3RF1A 2I4LA 1EVLA 3L4GA 2ARTA 4P3PA 3NENA 2ZT6A 1YGBA 3QO5A 4EX5A 3V8KA 2I4NA 1EOVA 3A32A 3HFZB 4P3NA 4ZTZB 3HXXA 3TEHA 5K1XA 2Q7EA 3LC0A 1HXDA 1JJCA 3TUPA 4YRIA 4H2XA 2ZTGA 2ZNJA 2QHTA 4X5OA 3HTZA 4P72C 1SRYA 2DQ0A 3HRIA 3EFSA 1QE0A 2ZZFA 1EFWA 1KMNA 3L2ZA 1USYA 2DTIA 1X01A 4NCXA 3HFZA 4KQEA 4TWAA 3HRKA 1NJ6A 3E9HA 2ZZEA 4P73C 2ZT8A 2ZNIA 4UP8A 1BIBA 2E1HA 4PHCA 2CJAA 4P75A 4CH6A 5HGQA 3REUA 1E1TA 4P71C 3E9IA 3UH0A 5C51B 1NJ8A 2EWNA 3A7RA 3UFGA 3WQZA 3PZCA 4YDQA 2XGTA 1ADJA 1HC7A 4YRSA 4YRCA 1W66A 4ZIBA 4YPFA 4G85A 3A7AA 3RKWA 4CH3A 4DPGA 1EVKA 4YCWA 2ODRD 4XU3A 3FJPA 4XEMA 3IKMB 4TQDA 3DSQA 2ZXFA 1ATIA 1NNHA 4YRKA 1ASYA 1J5WA 1E1OA 2E3CA 4E51A 2ARUA 3EFRA 1B76A 2IY5B 1LYLA 2DXUA 4HWOA 1H4VB 2RHQB 4H2TA 3ICAA 4WJ3M 4Q15A 3IG2A 2ARSA 2EJ9A 2E41A 1QF6A 4HWPA 4YRLA 2EAYA 5K1PA 1BBWA 3VQYA 3RKXA 4K87A 3VBBA 1YFTA 4TVYA 3RGLA 3TEHB 3P8YA 4CH4A 4CS4A 4RQEA 4TVAB 2IY5A 2DDZA 2EL9A 4YYEA 2RHQA
chains in the Genus database with same CATH superfamily
2ODRC 1WQWA 3HY0A 1USYC 3HXZA 4XTYA 4YRPA 4HWTA 2QHVA 1YFSA 3REXA 1RIQA 4TQFA 1YFRA 2AMCA 3PCOB 4P75C 4KR3A 4TVAA 1X54A 2ALYB 3NELA 5ELOA 3P8TA 4L87A 4ZTUB 4XTUA 4K86A 2E10A 5E3IA 4CS3A 3V7CA 1WNLA 2DZ9A 1EIYB 4YROA 3A74A 1SETA 4LNSA 2CJ9A 4AH6A 4UP7A 4YRGA 3R07A 3PCOA 1EQRA 2ALYA 2FYKA 2HNIA 4BW9A 4P74A 3IKLA 3BJUA 3LSSA 1EIYA 1X55A 4XU2A 4EO4A 2ZCEA 3QNEA 3HY1A 4PG3A 1WLEA 2I4MA 4TTVA 3UGQA 3L1AA 5C52B 2ZR2A 1B7YB 1KOGA 4HWSA 4H2VA 1X56A 2DJZA 4WJ4A 4YRTA 1WU7A 1H4SA 3MEYA 3LSQA 2Q7GA 3RL6A 4XTXA 4P3OA 4KR2A 2DU7A 2ZIMA 2RHSB 5C53B 4YRNA 2DTHA 1B7YA 1B70B 4YCUA 1X2HA 12ASA 2DVEA 1WYDA 2Q5IA 4YRRA 5F5WA 3QTCA 5KNNA 3M4PA 1H4TA 3CMQA 4LVKA 4RQFA 2AMCB 2RHSA 1B8AA 4Q6GA 4WF2A 2AKWB 4XTWA 1IL2A 3HXYA 3A5YA 4RDXA 1SERA 2E65A 1B70A 4UPAA 3NETA 4OLFA 4WI1A 1NJ5A 2ZT7A 1YB3A 4TVWA 4XTZA 1GGMA 4UP9A 2CJBA 4YRQA 2P5IA 11ASA 2EJGA 4P74C 1PYSB 2AKWA 3BFMA 1ADYA 1BBUA 1X2GA 1N9WA 2Q7HA 1KMMA 1NYRA 4CH5A 2XTIA 1SESA 2ZIOA 1HTTA 2ZGWA 1NYQA 2DTOA 1NJ1A 4H2SA 1H4QA 2QHSA 4XEOA 4XU1A 2ZR3A 3HFVA 3P8VA 4HA8A 4BWAA 1E24A 4XU0A 3G1ZA 1PYSA 4YRFA 3V8JA 3ERRA 1BIAA 2DKGA 1NJ2A 4H2UA 4CS2A 4HVCA 1Z7MA 2E64A 2G4CA 4RMFA 3I7FA 3IALA 2J3MA 1G5HA 4G84A 4H02A 2E5AA 2DXTA 3HXWA 3OD1A 3RACA 1FYFA 3UGTA 3A7UA 4P72A 2ZZGA 1VQZA 3V7RA 4DQ2A 4O2DA 2QHUA 1WPYA 3RKYA 3MQZA 1C0AA 2Q5HA 4YCVA 3HXVA 2DEQA 3A31A 3MF1A 2I4OA 4P73A 2P0LA 2PMFA 3MF2A 3RIRA 1G51A 4H2YA 1ASZA 4P71A 4YRMA 4YRJA 4LVLA 3HXUA 2ZT5A 2C7IA 2CGHA 3V7SA 1Z7NA 3M4QA 4XTVA 4HWRA 2DQ3A 4YREA 3TEGA 2C8MA 2PMEA 3L4GB 2DZCA 3QO8A 4K88A 5ELNA 3NEMA 2CIMA 2ZINA 2J3LA 3QO7A 3VQXA 2DU5A 4J15A 3V8LA 4H2WA 4YP0A 3VQVA 1JJCB 4OP0A 3W3SA 4H2XB 1G5IA 1L0WA 2EJFA 3KFUA 1E22A 3RUXA 3VQWA 1WQ7A 3A5ZA 3RF1A 2I4LA 1EVLA 3L4GA 2ARTA 4P3PA 3NENA 2ZT6A 1YGBA 3QO5A 4EX5A 3V8KA 2I4NA 1EOVA 3A32A 3HFZB 4P3NA 4ZTZB 3HXXA 3TEHA 5K1XA 2Q7EA 3LC0A 1HXDA 1JJCA 3TUPA 4YRIA 4H2XA 2ZTGA 4LVJA 2ZNJA 2QHTA 4X5OA 3HTZA 4P72C 4LVIA 1SRYA 2DQ0A 3HRIA 3EFSA 1QE0A 2ZZFA 1EFWA 1KMNA 3L2ZA 1USYA 2DTIA 1X01A 4NCXA 3HFZA 4KQEA 4TWAA 3HRKA 1NJ6A 3E9HA 2ZZEA 4P73C 2ZT8A 2ZNIA 4UP8A 4LVMA 1BIBA 2E1HA 4PHCA 2CJAA 4P75A 4CH6A 5HGQA 3REUA 1E1TA 4P71C 3E9IA 3UH0A 5C51B 1NJ8A 2EWNA 3A7RA 3UFGA 3WQZA 3PZCA 4YDQA 2XGTA 1ADJA 1HC7A 4YRSA 4YRCA 1W66A 4ZIBA 4YPFA 4G85A 3A7AA 3RKWA 4CH3A 4DPGA 1EVKA 4YCWA 2ODRD 4XU3A 3FJPA 4XEMA 3IKMB 4TQDA 3DSQA 2ZXFA 1ATIA 1NNHA 4YRKA 1ASYA 1J5WA 1E1OA 2E3CA 4E51A 2ARUA 3EFRA 1B76A 2IY5B 1LYLA 2DXUA 4HWOA 1H4VB 2RHQB 4H2TA 3ICAA 4WJ3M 4Q15A 3IG2A 2ARSA 2EJ9A 2E41A 1QF6A 4HWPA 4YRLA 2NS6A 2EAYA 5K1PA 1BBWA 3VQYA 3RKXA 4K87A 3VBBA 1YFTA 4TVYA 3RGLA 3TEHB 3P8YA 4CH4A 4CS4A 4RQEA 2A8EA 4TVAB 2IY5A 2DDZA 2EL9A 4YYEA 2RHQA 4HT4A
chains in the Genus database with same CATH topology
2ODRC 1WQWA 3HY0A 1USYC 3HXZA 4XTYA 4YRPA 4HWTA 2QHVA 1YFSA 3REXA 1RIQA 4TQFA 1YFRA 2AMCA 3PCOB 4P75C 4KR3A 4TVAA 1X54A 2ALYB 3NELA 5ELOA 3P8TA 4L87A 4ZTUB 4XTUA 4K86A 2E10A 5E3IA 4CS3A 3V7CA 1WNLA 2DZ9A 1EIYB 4YROA 3A74A 1SETA 4LNSA 2CJ9A 4AH6A 4UP7A 4YRGA 3R07A 3PCOA 1EQRA 2ALYA 2FYKA 2HNIA 4BW9A 4P74A 3IKLA 3BJUA 3LSSA 1EIYA 1X55A 4XU2A 4EO4A 2ZCEA 3QNEA 3HY1A 4PG3A 1WLEA 2I4MA 4TTVA 3UGQA 3L1AA 5C52B 2ZR2A 1B7YB 1KOGA 4HWSA 4H2VA 1X56A 2DJZA 4WJ4A 4YRTA 1WU7A 1H4SA 3MEYA 3LSQA 2Q7GA 3RL6A 4XTXA 4P3OA 4KR2A 2DU7A 2ZIMA 2RHSB 5C53B 4YRNA 2DTHA 1B7YA 1B70B 4YCUA 1X2HA 12ASA 2DVEA 1WYDA 2Q5IA 4YRRA 5F5WA 3QTCA 5KNNA 3M4PA 1H4TA 3CMQA 4LVKA 4RQFA 2AMCB 2RHSA 1B8AA 4Q6GA 4WF2A 2AKWB 4XTWA 1IL2A 3HXYA 3A5YA 4RDXA 1SERA 2E65A 1B70A 4UPAA 3NETA 4OLFA 4WI1A 1NJ5A 2ZT7A 1YB3A 4TVWA 4XTZA 1GGMA 4UP9A 2CJBA 4YRQA 2P5IA 11ASA 2EJGA 4P74C 1PYSB 2AKWA 3BFMA 1ADYA 1BBUA 1X2GA 1N9WA 2Q7HA 1KMMA 1NYRA 4CH5A 2XTIA 1SESA 2ZIOA 1HTTA 2ZGWA 1NYQA 2DTOA 1NJ1A 4H2SA 1H4QA 2QHSA 4XEOA 4XU1A 2ZR3A 3HFVA 3P8VA 4HA8A 4BWAA 1E24A 4XU0A 3G1ZA 1PYSA 4YRFA 3V8JA 3ERRA 1BIAA 2DKGA 1NJ2A 4H2UA 4CS2A 4HVCA 1Z7MA 2E64A 2G4CA 4RMFA 3I7FA 3IALA 2J3MA 1G5HA 4G84A 4H02A 2E5AA 2DXTA 3HXWA 3OD1A 3RACA 1FYFA 3UGTA 3A7UA 4P72A 2ZZGA 1VQZA 3V7RA 4DQ2A 4O2DA 2QHUA 1WPYA 3RKYA 3MQZA 1C0AA 2Q5HA 4YCVA 3HXVA 2DEQA 3A31A 3MF1A 2I4OA 4P73A 2P0LA 2PMFA 3MF2A 3RIRA 1G51A 4H2YA 1ASZA 4P71A 4YRMA 4YRJA 4LVLA 3HXUA 2ZT5A 2C7IA 2CGHA 3V7SA 1Z7NA 3M4QA 4XTVA 4HWRA 2DQ3A 4YREA 3TEGA 2C8MA 2PMEA 3L4GB 2DZCA 3QO8A 4K88A 5ELNA 3NEMA 2CIMA 2ZINA 2J3LA 3QO7A 3VQXA 2DU5A 4J15A 3V8LA 4H2WA 4YP0A 3VQVA 1JJCB 4OP0A 3W3SA 4H2XB 1G5IA 1L0WA 2EJFA 3KFUA 1E22A 3RUXA 3VQWA 1WQ7A 3A5ZA 3RF1A 2I4LA 1EVLA 3L4GA 2ARTA 4P3PA 3NENA 2ZT6A 1YGBA 3QO5A 4EX5A 3V8KA 2I4NA 1EOVA 3A32A 3HFZB 4P3NA 4ZTZB 3HXXA 3TEHA 5K1XA 2Q7EA 3LC0A 1HXDA 1JJCA 3TUPA 4YRIA 4H2XA 2ZTGA 4LVJA 2ZNJA 2QHTA 4X5OA 3HTZA 4P72C 4LVIA 1SRYA 2DQ0A 3HRIA 3EFSA 1QE0A 2ZZFA 1EFWA 1KMNA 3L2ZA 1USYA 2DTIA 1X01A 4NCXA 3HFZA 4KQEA 4TWAA 3HRKA 1NJ6A 3E9HA 2ZZEA 4P73C 2ZT8A 2ZNIA 4UP8A 4LVMA 1BIBA 2E1HA 4PHCA 2CJAA 4P75A 4CH6A 5HGQA 3REUA 1E1TA 4P71C 3E9IA 3UH0A 5C51B 1NJ8A 2EWNA 3A7RA 3UFGA 3WQZA 3PZCA 4YDQA 2XGTA 1ADJA 1HC7A 4YRSA 4YRCA 1W66A 4ZIBA 4YPFA 4G85A 3A7AA 3RKWA 4CH3A 4DPGA 1EVKA 4YCWA 2ODRD 4XU3A 3FJPA 4XEMA 3IKMB 4TQDA 3DSQA 2ZXFA 1ATIA 1NNHA 4YRKA 1ASYA 1J5WA 1E1OA 2E3CA 4E51A 2ARUA 3EFRA 1B76A 2IY5B 1LYLA 2DXUA 4HWOA 1H4VB 2RHQB 4H2TA 3ICAA 4WJ3M 4Q15A 3IG2A 2ARSA 2EJ9A 2E41A 1QF6A 4HWPA 4YRLA 2NS6A 2EAYA 5K1PA 1BBWA 3VQYA 3RKXA 4K87A 3VBBA 1YFTA 4TVYA 3RGLA 3TEHB 3P8YA 4CH4A 4CS4A 4RQEA 2A8EA 4TVAB 2IY5A 2DDZA 2EL9A 4YYEA 2RHQA 4HT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODR C;  1WQW A;  3HY0 A;  1USY C;  3HXZ A;  4XTY A;  4YRP A;  4HWT A;  2QHV A;  1YFS A;  3REX A;  1RIQ A;  4TQF A;  1YFR A;  2AMC A;  3PCO B;  4P75 C;  4KR3 A;  4TVA A;  1X54 A;  2ALY B;  3NEL A;  5ELO A;  3P8T A;  4L87 A;  4ZTU B;  4XTU A;  4K86 A;  2E10 A;  5E3I A;  4CS3 A;  3V7C A;  1WNL A;  2DZ9 A;  1EIY B;  4YRO A;  3A74 A;  1SET A;  4LNS A;  2CJ9 A;  4AH6 A;  4UP7 A;  4YRG A;  3R07 A;  3PCO A;  1EQR A;  2ALY A;  2FYK A;  2HNI A;  4BW9 A;  4P74 A;  3IKL A;  3BJU A;  3LSS A;  1EIY A;  1X55 A;  4XU2 A;  4EO4 A;  2ZCE A;  3QNE A;  3HY1 A;  4PG3 A;  1WLE A;  2I4M A;  4TTV A;  3UGQ A;  3L1A A;  5C52 B;  2ZR2 A;  1B7Y B;  1KOG A;  4HWS A;  4H2V A;  1X56 A;  2DJZ A;  4WJ4 A;  4YRT A;  1WU7 A;  1H4S A;  3MEY A;  3LSQ A;  2Q7G A;  3RL6 A;  4XTX A;  4P3O A;  4KR2 A;  2DU7 A;  2ZIM A;  2RHS B;  5C53 B;  4YRN A;  2DTH A;  1B7Y A;  1B70 B;  4YCU A;  1X2H A;  12AS A;  2DVE A;  1WYD A;  2Q5I A;  4YRR A;  5F5W A;  3QTC A;  5KNN A;  3M4P A;  1H4T A;  3CMQ A;  4RQF A;  2AMC B;  2RHS A;  1B8A A;  4Q6G A;  4WF2 A;  2AKW B;  4XTW A;  1IL2 A;  3HXY A;  3A5Y A;  4RDX A;  1SER A;  2E65 A;  1B70 A;  4UPA A;  3NET A;  4OLF A;  4WI1 A;  1NJ5 A;  2ZT7 A;  1YB3 A;  4TVW A;  4XTZ A;  1GGM A;  4UP9 A;  2CJB A;  4YRQ A;  2P5I A;  11AS A;  2EJG A;  4P74 C;  1PYS B;  2AKW A;  3BFM A;  1ADY A;  1BBU A;  1X2G A;  1N9W A;  2Q7H A;  1KMM A;  1NYR A;  4CH5 A;  2XTI A;  1SES A;  2ZIO A;  1HTT A;  2ZGW A;  1NYQ A;  2DTO A;  1NJ1 A;  4H2S A;  1H4Q A;  2QHS A;  4XEO A;  4XU1 A;  2ZR3 A;  3HFV A;  3P8V A;  4HA8 A;  4BWA A;  1E24 A;  4XU0 A;  3G1Z A;  1PYS A;  4YRF A;  3V8J A;  3ERR A;  1BIA A;  2DKG A;  1NJ2 A;  4H2U A;  4CS2 A;  4HVC A;  1Z7M A;  2E64 A;  2G4C A;  4RMF A;  3I7F A;  3IAL A;  2J3M A;  1G5H A;  4G84 A;  4H02 A;  2E5A A;  2DXT A;  3HXW A;  3OD1 A;  3RAC A;  1FYF A;  3UGT A;  3A7U A;  4P72 A;  2ZZG A;  1VQZ A;  3V7R A;  4DQ2 A;  4O2D A;  2QHU A;  1WPY A;  3RKY A;  1C0A A;  2Q5H A;  4YCV A;  3HXV A;  2DEQ A;  3A31 A;  3MF1 A;  2I4O A;  4P73 A;  2P0L A;  2PMF A;  3MF2 A;  3RIR A;  1G51 A;  4H2Y A;  1ASZ A;  4P71 A;  4YRM A;  4YRJ A;  3HXU A;  2ZT5 A;  2C7I A;  2CGH A;  3V7S A;  1Z7N A;  3M4Q A;  4XTV A;  4HWR A;  2DQ3 A;  4YRE A;  3TEG A;  2C8M A;  2PME A;  3L4G B;  2DZC A;  3QO8 A;  4K88 A;  5ELN A;  3NEM A;  2CIM A;  2ZIN A;  2J3L A;  3QO7 A;  3VQX A;  2DU5 A;  4J15 A;  3V8L A;  4H2W A;  4YP0 A;  3VQV A;  1JJC B;  4OP0 A;  3W3S A;  4H2X B;  1G5I A;  1L0W A;  2EJF A;  3KFU A;  1E22 A;  3RUX A;  3VQW A;  1WQ7 A;  3A5Z A;  3RF1 A;  2I4L A;  1EVL A;  3L4G A;  2ART A;  4P3P A;  3NEN A;  2ZT6 A;  1YGB A;  3QO5 A;  4EX5 A;  3V8K A;  2I4N A;  1EOV A;  3A32 A;  3HFZ B;  4P3N A;  4ZTZ B;  3HXX A;  3TEH A;  5K1X A;  2Q7E A;  3LC0 A;  1HXD A;  1JJC A;  3TUP A;  4YRI A;  4H2X A;  2ZTG A;  2ZNJ A;  2QHT A;  4X5O A;  3HTZ A;  4P72 C;  1SRY A;  2DQ0 A;  3HRI A;  3EFS A;  1QE0 A;  2ZZF A;  1EFW A;  1KMN A;  3L2Z A;  1USY A;  2DTI A;  1X01 A;  4NCX A;  3HFZ A;  4KQE A;  4TWA A;  3HRK A;  1NJ6 A;  3E9H A;  2ZZE A;  4P73 C;  2ZT8 A;  2ZNI A;  4UP8 A;  1BIB A;  2E1H A;  4PHC A;  2CJA A;  4P75 A;  4CH6 A;  5HGQ A;  3REU A;  1E1T A;  4P71 C;  3E9I A;  3UH0 A;  5C51 B;  1NJ8 A;  2EWN A;  3A7R A;  3UFG A;  3WQZ A;  3PZC A;  4YDQ A;  2XGT A;  1ADJ A;  1HC7 A;  4YRS A;  4YRC A;  1W66 A;  4ZIB A;  4YPF A;  4G85 A;  3A7A A;  3RKW A;  4CH3 A;  4DPG A;  1EVK A;  4YCW A;  2ODR D;  4XU3 A;  3FJP A;  4XEM A;  3IKM B;  4TQD A;  3DSQ A;  2ZXF A;  1ATI A;  1NNH A;  4YRK A;  1ASY A;  1J5W A;  1E1O A;  2E3C A;  4E51 A;  2ARU A;  3EFR A;  1B76 A;  2IY5 B;  1LYL A;  2DXU A;  4HWO A;  1H4V B;  2RHQ B;  4H2T A;  3ICA A;  4WJ3 M;  4Q15 A;  3IG2 A;  2ARS A;  2EJ9 A;  2E41 A;  1QF6 A;  4HWP A;  4YRL A;  2EAY A;  5K1P A;  1BBW A;  3VQY A;  3RKX A;  4K87 A;  3VBB A;  1YFT A;  4TVY A;  3RGL A;  3TEH B;  3P8Y A;  4CH4 A;  4CS4 A;  4RQE A;  4TVA B;  2IY5 A;  2DDZ A;  2EL9 A;  4YYE A;  2RHQ A; 
#chains in the Genus database with same CATH topology
 2ODR C;  1WQW A;  3HY0 A;  1USY C;  3HXZ A;  4XTY A;  4YRP A;  4HWT A;  2QHV A;  1YFS A;  3REX A;  1RIQ A;  4TQF A;  1YFR A;  2AMC A;  3PCO B;  4P75 C;  4KR3 A;  4TVA A;  1X54 A;  2ALY B;  3NEL A;  5ELO A;  3P8T A;  4L87 A;  4ZTU B;  4XTU A;  4K86 A;  2E10 A;  5E3I A;  4CS3 A;  3V7C A;  1WNL A;  2DZ9 A;  1EIY B;  4YRO A;  3A74 A;  1SET A;  4LNS A;  2CJ9 A;  4AH6 A;  4UP7 A;  4YRG A;  3R07 A;  3PCO A;  1EQR A;  2ALY A;  2FYK A;  2HNI A;  4BW9 A;  4P74 A;  3IKL A;  3BJU A;  3LSS A;  1EIY A;  1X55 A;  4XU2 A;  4EO4 A;  2ZCE A;  3QNE A;  3HY1 A;  4PG3 A;  1WLE A;  2I4M A;  4TTV A;  3UGQ A;  3L1A A;  5C52 B;  2ZR2 A;  1B7Y B;  1KOG A;  4HWS A;  4H2V A;  1X56 A;  2DJZ A;  4WJ4 A;  4YRT A;  1WU7 A;  1H4S A;  3MEY A;  3LSQ A;  2Q7G A;  3RL6 A;  4XTX A;  4P3O A;  4KR2 A;  2DU7 A;  2ZIM A;  2RHS B;  5C53 B;  4YRN A;  2DTH A;  1B7Y A;  1B70 B;  4YCU A;  1X2H A;  12AS A;  2DVE A;  1WYD A;  2Q5I A;  4YRR A;  5F5W A;  3QTC A;  5KNN A;  3M4P A;  1H4T A;  3CMQ A;  4LVK A;  4RQF A;  2AMC B;  2RHS A;  1B8A A;  4Q6G A;  4WF2 A;  2AKW B;  4XTW A;  1IL2 A;  3HXY A;  3A5Y A;  4RDX A;  1SER A;  2E65 A;  1B70 A;  4UPA A;  3NET A;  4OLF A;  4WI1 A;  1NJ5 A;  2ZT7 A;  1YB3 A;  4TVW A;  4XTZ A;  1GGM A;  4UP9 A;  2CJB A;  4YRQ A;  2P5I A;  11AS A;  2EJG A;  4P74 C;  1PYS B;  2AKW A;  3BFM A;  1ADY A;  1BBU A;  1X2G A;  1N9W A;  2Q7H A;  1KMM A;  1NYR A;  4CH5 A;  2XTI A;  1SES A;  2ZIO A;  1HTT A;  2ZGW A;  1NYQ A;  2DTO A;  1NJ1 A;  4H2S A;  1H4Q A;  2QHS A;  4XEO A;  4XU1 A;  2ZR3 A;  3HFV A;  3P8V A;  4HA8 A;  4BWA A;  1E24 A;  4XU0 A;  3G1Z A;  1PYS A;  4YRF A;  3V8J A;  3ERR A;  1BIA A;  2DKG A;  1NJ2 A;  4H2U A;  4CS2 A;  4HVC A;  1Z7M A;  2E64 A;  2G4C A;  4RMF A;  3I7F A;  3IAL A;  2J3M A;  1G5H A;  4G84 A;  4H02 A;  2E5A A;  2DXT A;  3HXW A;  3OD1 A;  3RAC A;  1FYF A;  3UGT A;  3A7U A;  4P72 A;  2ZZG A;  1VQZ A;  3V7R A;  4DQ2 A;  4O2D A;  2QHU A;  1WPY A;  3RKY A;  3MQZ A;  1C0A A;  2Q5H A;  4YCV A;  3HXV A;  2DEQ A;  3A31 A;  3MF1 A;  2I4O A;  4P73 A;  2P0L A;  2PMF A;  3MF2 A;  3RIR A;  1G51 A;  4H2Y A;  1ASZ A;  4P71 A;  4YRM A;  4YRJ A;  4LVL A;  3HXU A;  2ZT5 A;  2C7I A;  2CGH A;  3V7S A;  1Z7N A;  3M4Q A;  4XTV A;  4HWR A;  2DQ3 A;  4YRE A;  3TEG A;  2C8M A;  2PME A;  3L4G B;  2DZC A;  3QO8 A;  4K88 A;  5ELN A;  3NEM A;  2CIM A;  2ZIN A;  2J3L A;  3QO7 A;  3VQX A;  2DU5 A;  4J15 A;  3V8L A;  4H2W A;  4YP0 A;  3VQV A;  1JJC B;  4OP0 A;  3W3S A;  4H2X B;  1G5I A;  1L0W A;  2EJF A;  3KFU A;  1E22 A;  3RUX A;  3VQW A;  1WQ7 A;  3A5Z A;  3RF1 A;  2I4L A;  1EVL A;  3L4G A;  2ART A;  4P3P A;  3NEN A;  2ZT6 A;  1YGB A;  3QO5 A;  4EX5 A;  3V8K A;  2I4N A;  1EOV A;  3A32 A;  3HFZ B;  4P3N A;  4ZTZ B;  3HXX A;  3TEH A;  5K1X A;  2Q7E A;  3LC0 A;  1HXD A;  1JJC A;  3TUP A;  4YRI A;  4H2X A;  2ZTG A;  4LVJ A;  2ZNJ A;  2QHT A;  4X5O A;  3HTZ A;  4P72 C;  4LVI A;  1SRY A;  2DQ0 A;  3HRI A;  3EFS A;  1QE0 A;  2ZZF A;  1EFW A;  1KMN A;  3L2Z A;  1USY A;  2DTI A;  1X01 A;  4NCX A;  3HFZ A;  4KQE A;  4TWA A;  3HRK A;  1NJ6 A;  3E9H A;  2ZZE A;  4P73 C;  2ZT8 A;  2ZNI A;  4UP8 A;  4LVM A;  1BIB A;  2E1H A;  4PHC A;  2CJA A;  4P75 A;  4CH6 A;  5HGQ A;  3REU A;  1E1T A;  4P71 C;  3E9I A;  3UH0 A;  5C51 B;  1NJ8 A;  2EWN A;  3A7R A;  3UFG A;  3WQZ A;  3PZC A;  4YDQ A;  2XGT A;  1ADJ A;  1HC7 A;  4YRS A;  4YRC A;  1W66 A;  4ZIB A;  4YPF A;  4G85 A;  3A7A A;  3RKW A;  4CH3 A;  4DPG A;  1EVK A;  4YCW A;  2ODR D;  4XU3 A;  3FJP A;  4XEM A;  3IKM B;  4TQD A;  3DSQ A;  2ZXF A;  1ATI A;  1NNH A;  4YRK A;  1ASY A;  1J5W A;  1E1O A;  2E3C A;  4E51 A;  2ARU A;  3EFR A;  1B76 A;  2IY5 B;  1LYL A;  2DXU A;  4HWO A;  1H4V B;  2RHQ B;  4H2T A;  3ICA A;  4WJ3 M;  4Q15 A;  3IG2 A;  2ARS A;  2EJ9 A;  2E41 A;  1QF6 A;  4HWP A;  4YRL A;  2NS6 A;  2EAY A;  5K1P A;  1BBW A;  3VQY A;  3RKX A;  4K87 A;  3VBB A;  1YFT A;  4TVY A;  3RGL A;  3TEH B;  3P8Y A;  4CH4 A;  4CS4 A;  4RQE A;  2A8E A;  4TVA B;  2IY5 A;  2DDZ A;  2EL9 A;  4YYE A;  2RHQ A;  4HT4 A; 
#chains in the Genus database with same CATH homology
 2ODR C;  1WQW A;  3HY0 A;  1USY C;  3HXZ A;  4XTY A;  4YRP A;  4HWT A;  2QHV A;  1YFS A;  3REX A;  1RIQ A;  4TQF A;  1YFR A;  2AMC A;  3PCO B;  4P75 C;  4KR3 A;  4TVA A;  1X54 A;  2ALY B;  3NEL A;  5ELO A;  3P8T A;  4L87 A;  4ZTU B;  4XTU A;  4K86 A;  2E10 A;  5E3I A;  4CS3 A;  3V7C A;  1WNL A;  2DZ9 A;  1EIY B;  4YRO A;  3A74 A;  1SET A;  4LNS A;  2CJ9 A;  4AH6 A;  4UP7 A;  4YRG A;  3R07 A;  3PCO A;  1EQR A;  2ALY A;  2FYK A;  2HNI A;  4BW9 A;  4P74 A;  3IKL A;  3BJU A;  3LSS A;  1EIY A;  1X55 A;  4XU2 A;  4EO4 A;  2ZCE A;  3QNE A;  3HY1 A;  4PG3 A;  1WLE A;  2I4M A;  4TTV A;  3UGQ A;  3L1A A;  5C52 B;  2ZR2 A;  1B7Y B;  1KOG A;  4HWS A;  4H2V A;  1X56 A;  2DJZ A;  4WJ4 A;  4YRT A;  1WU7 A;  1H4S A;  3MEY A;  3LSQ A;  2Q7G A;  3RL6 A;  4XTX A;  4P3O A;  4KR2 A;  2DU7 A;  2ZIM A;  2RHS B;  5C53 B;  4YRN A;  2DTH A;  1B7Y A;  1B70 B;  4YCU A;  1X2H A;  12AS A;  2DVE A;  1WYD A;  2Q5I A;  4YRR A;  5F5W A;  3QTC A;  5KNN A;  3M4P A;  1H4T A;  3CMQ A;  4LVK A;  4RQF A;  2AMC B;  2RHS A;  1B8A A;  4Q6G A;  4WF2 A;  2AKW B;  4XTW A;  1IL2 A;  3HXY A;  3A5Y A;  4RDX A;  1SER A;  2E65 A;  1B70 A;  4UPA A;  3NET A;  4OLF A;  4WI1 A;  1NJ5 A;  2ZT7 A;  1YB3 A;  4TVW A;  4XTZ A;  1GGM A;  4UP9 A;  2CJB A;  4YRQ A;  2P5I A;  11AS A;  2EJG A;  4P74 C;  1PYS B;  2AKW A;  3BFM A;  1ADY A;  1BBU A;  1X2G A;  1N9W A;  2Q7H A;  1KMM A;  1NYR A;  4CH5 A;  2XTI A;  1SES A;  2ZIO A;  1HTT A;  2ZGW A;  1NYQ A;  2DTO A;  1NJ1 A;  4H2S A;  1H4Q A;  2QHS A;  4XEO A;  4XU1 A;  2ZR3 A;  3HFV A;  3P8V A;  4HA8 A;  4BWA A;  1E24 A;  4XU0 A;  3G1Z A;  1PYS A;  4YRF A;  3V8J A;  3ERR A;  1BIA A;  2DKG A;  1NJ2 A;  4H2U A;  4CS2 A;  4HVC A;  1Z7M A;  2E64 A;  2G4C A;  4RMF A;  3I7F A;  3IAL A;  2J3M A;  1G5H A;  4G84 A;  4H02 A;  2E5A A;  2DXT A;  3HXW A;  3OD1 A;  3RAC A;  1FYF A;  3UGT A;  3A7U A;  4P72 A;  2ZZG A;  1VQZ A;  3V7R A;  4DQ2 A;  4O2D A;  2QHU A;  1WPY A;  3RKY A;  3MQZ A;  1C0A A;  2Q5H A;  4YCV A;  3HXV A;  2DEQ A;  3A31 A;  3MF1 A;  2I4O A;  4P73 A;  2P0L A;  2PMF A;  3MF2 A;  3RIR A;  1G51 A;  4H2Y A;  1ASZ A;  4P71 A;  4YRM A;  4YRJ A;  4LVL A;  3HXU A;  2ZT5 A;  2C7I A;  2CGH A;  3V7S A;  1Z7N A;  3M4Q A;  4XTV A;  4HWR A;  2DQ3 A;  4YRE A;  3TEG A;  2C8M A;  2PME A;  3L4G B;  2DZC A;  3QO8 A;  4K88 A;  5ELN A;  3NEM A;  2CIM A;  2ZIN A;  2J3L A;  3QO7 A;  3VQX A;  2DU5 A;  4J15 A;  3V8L A;  4H2W A;  4YP0 A;  3VQV A;  1JJC B;  4OP0 A;  3W3S A;  4H2X B;  1G5I A;  1L0W A;  2EJF A;  3KFU A;  1E22 A;  3RUX A;  3VQW A;  1WQ7 A;  3A5Z A;  3RF1 A;  2I4L A;  1EVL A;  3L4G A;  2ART A;  4P3P A;  3NEN A;  2ZT6 A;  1YGB A;  3QO5 A;  4EX5 A;  3V8K A;  2I4N A;  1EOV A;  3A32 A;  3HFZ B;  4P3N A;  4ZTZ B;  3HXX A;  3TEH A;  5K1X A;  2Q7E A;  3LC0 A;  1HXD A;  1JJC A;  3TUP A;  4YRI A;  4H2X A;  2ZTG A;  4LVJ A;  2ZNJ A;  2QHT A;  4X5O A;  3HTZ A;  4P72 C;  4LVI A;  1SRY A;  2DQ0 A;  3HRI A;  3EFS A;  1QE0 A;  2ZZF A;  1EFW A;  1KMN A;  3L2Z A;  1USY A;  2DTI A;  1X01 A;  4NCX A;  3HFZ A;  4KQE A;  4TWA A;  3HRK A;  1NJ6 A;  3E9H A;  2ZZE A;  4P73 C;  2ZT8 A;  2ZNI A;  4UP8 A;  4LVM A;  1BIB A;  2E1H A;  4PHC A;  2CJA A;  4P75 A;  4CH6 A;  5HGQ A;  3REU A;  1E1T A;  4P71 C;  3E9I A;  3UH0 A;  5C51 B;  1NJ8 A;  2EWN A;  3A7R A;  3UFG A;  3WQZ A;  3PZC A;  4YDQ A;  2XGT A;  1ADJ A;  1HC7 A;  4YRS A;  4YRC A;  1W66 A;  4ZIB A;  4YPF A;  4G85 A;  3A7A A;  3RKW A;  4CH3 A;  4DPG A;  1EVK A;  4YCW A;  2ODR D;  4XU3 A;  3FJP A;  4XEM A;  3IKM B;  4TQD A;  3DSQ A;  2ZXF A;  1ATI A;  1NNH A;  4YRK A;  1ASY A;  1J5W A;  1E1O A;  2E3C A;  4E51 A;  2ARU A;  3EFR A;  1B76 A;  2IY5 B;  1LYL A;  2DXU A;  4HWO A;  1H4V B;  2RHQ B;  4H2T A;  3ICA A;  4WJ3 M;  4Q15 A;  3IG2 A;  2ARS A;  2EJ9 A;  2E41 A;  1QF6 A;  4HWP A;  4YRL A;  2NS6 A;  2EAY A;  5K1P A;  1BBW A;  3VQY A;  3RKX A;  4K87 A;  3VBB A;  1YFT A;  4TVY A;  3RGL A;  3TEH B;  3P8Y A;  4CH4 A;  4CS4 A;  4RQE A;  2A8E A;  4TVA B;  2IY5 A;  2DDZ A;  2EL9 A;  4YYE A;  2RHQ A;  4HT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...