4XTWA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
266
Chain Sequence
b'VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
molecule tags Ligase/ligase inhibitor
source organism Mycobacterium tuberculosis
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
total genus 94
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtwA01
4P71A 1WU7A 4RCBA 4YRQA 4HWRA 4N0AC 4NCXA 3RGLA 2JN0A 5LJ5j 4M7AD 5GAMf 1WLEA 3L1AA 3JCMb 5GAOr 1ADYA 1EVKA 3MF1A 2DZCA 4F7UE 4PJOA 3A7UA 3MF2A 4M78G 2ARUA 4RQFA 4M7AE 4H2YA 1WYDA 2RHSA 5GAMj 4PG3A 5GAMh 4HWOA 4RCCA 4C92A 2ZIMA 2EJGA 1HC7A 2EL9A 2XGTA 3JCMe 5CAIA 4YRJA 3A5ZA 3HFOA 1SESA 4H2WA 5GAN5 3JCMP 1X01A 4EMKB 3V7SA 4WJ3M 4M7DD 5GMKi 5C51B 2CGHA 5GAN7 4XU1A 2E1HA 3M4GA 4PNOA 2DZ9A 5GANd 2RHSB 1SERA 1G5IA 4H2TA 3V8JA 3KFUA 2Q5IA 1ASYA 4JUVA 4JRIA 4Y91A 4M75B 5GAMe 3LSQA 4X5OA 2HNIA 2RM4A 5ELNA 4P73A 1NJ6A 4M7DB 3JB9F 2RD1A 3HTZA 2VXFA 2ZGWA 4M75E 4PHCA 2IY5A 3VQWA 5GMKl 3QNEA 4P73C 3JB9D 4XTWA 2VC8A 3V8KA 1HTTA 2ARTA 2ZR3A 4XU3A 3DSQA 4TVAA 4G85A 4C8QC 4YCWA 4H2VA 5GAMg 5KNNA 4LNSA 3BFMA 3BJUA 4PJOD 4J6WA 2AMCB 4M78C 2ZZEA 4PJOF 2ZT5A 4PJOE 4V2SA 4CH3A 4AH6A 2ZCEA 4YCUA 4M77E 5GAN4 1QE0A 4J5YA 5GAOl 1Z7NA 4J6XA 3RKYA 4M77D 4HT9A 5LJ5d 4C92B 1G5HA 5ELOA 4OP0A 4C92C 4EX5A 3JCMg 4HVCA 4M7AF 5I21A 2DDZA 4UPAA 1GGMA 3HXYA 3V7RA 1KMNA 1B70A 1PYSB 1X54A 4P74C 5GAN3 4ZTUB 5GAN6 3QO3A 3BW1A 4P3PA 5GAN8 2P0LA 3A31A 4KR2A 4M78A 1WQWA 5HGQA 4PJOG 2E41A 4P74A 5GAMd 1YFSA 3A32A 3V8LA 4M77B 1EVLA 3JCMQ 1BIBA 3PCOB 3M4QA 4P72A 1N9WA 1NJ5A 3NEMA 1B8AA 4M7DE 3VQXA 3HRKA 3M4PA 3JB9G 1KMMA 1USYC 1E1OA 4YP0A 2RHQA 2ZT7A 3E9HA 5GANe 1J5WA 1Y96A 3UGTA 1KOGA 2I4MA 3W3SA 2CIMA 2ODRC 3REUA 3PGGA 4UP8A 1BIAA 5GANg 1EFWA 4EMHA 1KQ2A 2ARSA 2ZT6A 4XQ3A 4QVDA 1NYQA 3HXZA 4HWPA 4H2XB 1EIYA 4M7DG 3RESA 4L87A 5GMKj 4CS3A 4TTVA 4PJOB 4YREA 1I8FA 1MGQA 4EMKA 2DXUA 4YCVA 3HFVA 4F7UB 3V7CA 5GANj 1LJOA 3RACA 4K87A 4TQFA 5LJ3j 3EFRA 1LOJA 4M75A 1EIYB 1RIQA 4NOYA 1B70B 4YROA 1KQ1A 4X9CA 3SWNC 2J3MA 2ZR2A 3WQZA 4RMFA 1G51A 3RUXA 4YRGA 4YRPA 2DU7A 2DEQA 4F7UA 3CMQA 1ASZA 3FJPA 4TQDA 4CS4A 2PMEA 4C8QG 1B34A 4KQEA 1YFRA 4P75C 3HY1A 2K57A 2DJZA 4M77A 1L0WA 3R07A 1QF6A 2ZIOA 4C8QD 3VQVA 5LJ5f 2AMCA 2Q5HA 11ASA 3SWNA 1TH7A 4TVYA 4DPGA 4TVWA 1U1TA 3HXXA 4J6YA 4M78D 4MMLA 1N9RA 1B34B 2CJAA 4CH6A 3JCMd 3FIFA 5LJ5g 1E1TA 3GIBA 4TWAA 4M77F 4M7AG 1X55A 3E9IA 1I5LA 4JLIA 1B76A 3ERRA 3QO8A 4YDQA 1E24A 1BBWA 1EQRA 4RQEA 3TUPA 2RB6A 3L2ZA 2G4CA 4M7AA 4F7UF 4A53A 4YRCA 4BW9A 1H4QA 4A54A 3QSUA 1YCYA 1NJ8A 3RF1A 4KR3A 4H2SA 2QTXA 1N9SA 4M7AC 2YLBA 4H2XA 5LJ3e 2VXEA 2QHSA 1M5Q1 4UP9A 2E64A 3JCMh 5GAOq 3G1ZA 4YRLA 3NENA 1VQZA 2IY5B 3UFGA 5C53B 3HXUA 1B7YB 3QHSA 3HSBA 3RERA 1LYLA 4H2UA 3VBBA 4M77G 4K86A 3ICAA 3NELA 4CS2A 2RA2A 3RIRA 1H641 5GMKm 2EJFA 2DVEA 4EMGA 2QHVA 2FYKA 1H4SA 2ALYA 5LJ3h 1USYA 2QHUA 4J15A 4C8QA 2CJBA 3L4GA 4M75C 2I4LA 3OD1A 4F7UG 2DTHA 4NL3A 5GANh 2ZTGA 2DQ3A 3HFZB 4M7DC 1SETA 1NJ1A 3JCMX 2DTIA 4G84A 3EFSA 4M75F 4HA8A 4YRMA 2Q7HA 4HWTA 5GMKh 3TEGA 2DQ0A 1YGBA 3A74A 1Y96B 2C7IA 1X2HA 3I7FA 2P5IA 1I4K1 2YHTA 4HWSA 1M8VA 4XTVA 2PMFA 5LJ3f 3SWNB 5GAOn 4YRRA 4K88A 4C8QE 2ZNIA 1BBUA 3LSSA 2I2LA 4WJ4A 1ATIA 2EJ9A 2ZZGA 4M77C 5K1PA 3JB9I 3RKXA 3BY7A 4XEOA 4ZIBA 4P71C 2QHTA 4XU2A 5LJ3g 4TVAB 4M78E 4X9DA 3QUIA 4YRIA 4C92F 4M78F 3REXA 4M78B 4C92E 1YB3A 2AKWA 2I4OA 3RL6A 1LNXA 3P8TA 2E5AA 1X2GA 3JCMJ 4YRFA 3HY0A 2CJ9A 1D3BB 4Q15A 4P72C 4RDXA 1NNHA 3TEHB 3HRIA 3LC0A 4H02A 1HK9A 1YFTA 1E22A 5GAN2 2EWNA 3NETA 3QO7A 4E51A 2DXTA 4CH4A 4YRSA 1JJCA 3A7RA 3BDUA 1WPYA 3IALA 3JCMW 4XTYA 1B7YA 4OLFA 4M7DF 4XTXA 1PYSA 2DKGA 1W66A 3JB9J 2E10A 4C8QB 1C0AA 12ASA 3L4GB 4XTUA 1NYRA 3A7AA 3SB2A 4XEMA 1JBMA 3QTCA 1ADJA 4M7AB 1U1SA 4EMKC 4WI1A 4YPFA 2ZXFA 1HXDA 5GANf 3JCMV 1X56A 4WF2A 3UGQA 3MEYA 1IL2A 3VQYA 4XTZA 1SRYA 4PJOC 2RHQB 2E3CA 2ODRD 3IKMB 3P8VA 4XU0A 4YRKA 4O2DA 3HFNA 3HXVA 4BWAA 5E3IA 3AHUA 4NL2A 4P3OA 2J3LA 2FB7A 2Y90A 5GAOp 3JCMc 4M75G 2ZZFA 3RKWA 2E65A 1WNLA 2AKWB 5K1XA 5F5WA 3IKLA 3VU3C 4YRTA 1FYFA 2ZT8A 3IG2A 3TEHA 3JB9H 2DTOA 2DU5A 1D3BA 5LJ3d 3HFZA 3HXWA 5GMKe 4YRNA 4C92D 4QVCA 1H4VB 4JRKA 4DQ2A 4M75D 2I4NA 2YLCA 2ALYB 4N0AA 1JRIA 3P8YA 3INZA 4YYEA 5DY9A 5GAOm 3A5YA 4M7DA 1Z7MA 5LJ5e 2EAYA 3FB9A 3PCOA 4UP7A 3UH0A 2Q7GA 1WQ7A 2ZNJA 1H4TA 4EO4A 2ZINA 4ZTZB 2Q7EA 1EOVA 4CH5A 4MMKA 4P3NA 4C8QF 4Q6GA 1JJCB 2XTIA 3QO5A 3JCMf 5LJ5h 1I81A 5C52B 4C92G 2C8MA 1NJ2A 4P75A 4HT8A 3PZCA
chains in the Genus database with same CATH superfamily
2BZXA 2L3PA 3QJYA 4HWRA 4N0AC 4NCXA 3RGLA 2JN0A 1OU8A 4GLMA 4ESRA 4M7AD 1ADYA 1XTDA 2IVWA 4E7SA 1Q86R 1X27A 3MF1A 2EGAA 2J7IA 3CEYA 1WYDA 2RHSA 1VQ5T 5GAMj 5KYYA 2QGFB 4J9FA 3M0UA 2MF2A 4N4IA 4LDUA 1VYVA 4PG3A 3MJXA 3OYFA 1RAGB 3CD6Q 2XGTA 2EL9A 4ZN3A 1BK2A 1K9AA 4DOVA 3A5ZA 1SSHA 2F5KA 5C51B 5GAN7 1G3TA 1SERA 3CCSQ 3ZFJA 2E5QA 2Q5IA 4AMCA 7AT1B 4HT4A 2YSQA 1AEYA 2PU9B 4BY6C 1Q82R 1NJ6A 2RH2A 4ME7A 4BUGA 1M2OA 2GGRA 3VQWA 3P8HA 3H9NA 4BACA 4P73C 5A0GA 2Y4YA 1HTTA 3TVTA 4G85A 1OZ2A 4J7IA 1VQ8T 3PNWC 5IXBA 1YJNA 5HCKA 1G3YA 1YI2Q 5KYNA 1H92A 4L6V5 3NGPA 1ABOA 3A8HB 1NZ9A 2E3HA 3OW2P 4J6WA 3OW2S 2DMOA 4V2SA 1F1BB 4AH6A 4A4GA 2CSIA 2O88A 1X2KA 1OEBA 2VUBA 4YCUA 5GAN4 2RN8A 1BYMA 1QE0A 2LCCA 1Z7NA 1FYNA 4E7LA 2QDYB 1RAHB 1QWFA 5LJ5d 4J9GA 4C92C 3JCMg 1FX7A 4M7AF 4GY5A 2LCLA 1GGMA 4UPAA 1K9MU 1TUGB 1GL5A 4F17A 1X54A 4FSSA 3UATA 5KYYB 5GAN6 4A4KA 1G3SA 2PQWA 1YJNT 1E7OA 1YJ9A 2RHUA 1KG1A 3OY9A 1AT1B 1PSFA 2JS2A 4KR2A 1WQWA 1H3HA 1VQNQ 4RTVA 4PLLA 1UHCA 2A36A 3A32A 4M77B 3JCMQ 3PCOB 5CR2A 3M4QA 4D8DA 3UA7A 5KE2A 2A37A 4DBHA 1Y07A 4RTTA 4A4EA 4E2FB 1NLPC 2KROA 2ZT7A 2D9TA 2FPDA 1Q81U 1SKUB 2E12A 1IXDA 1RABB 1VQ4T 3EHQA 5KCOA 1VQPT 4JJCA 1ZA1B 1NYQA 4QVDA 1C6VX 3G6EQ 4M7DG 1OULA 1K73C 4L87A 1JQQA 3LWHA 4YREA 2EQUA 3OYYA 2A3LA 2DXUA 1TOVA 3NTHA 1AZEA 1JJ2S 4IURA 2CUDA 2LJ0A 2ZCFB 5HK3A 3RACA 4K87A 3SDZA 2D0NA 2A8EA 3EFRA 2GQVA 4M75A 1EIYB 1KQ1A 4X9CA 2J3MA 1WHKA 5FU7B 3WQZA 4JJBA 2KXDA 2WSEE 3I55Q 3CCVA 3FJ5A 4PL6A 2OI3A 3EGDB 1QMCA 1M3CA 2PMEA 4JJNK 2BZ8A 1YFRA 1KFZA 2DL5A 3HY1A 2K57A 4M77A 5D6WA 2LT4A 3VUZA 2C0IA 1PD1A 3G71T 1VQLA 1VQ4Q 3VQVA 1W2BS 2X4WA 4FSXA 1WHLA 3EH2A 1WJRA 3G71A 4Z8AA 1KQSP 2LDMA 3CCRT 3L2VA 4DPGA 2XHCA 3C12A 8AT1B 1QVPA 2CSQA 1YHQA 2CJAA 2HKQB 2FRWA 4CH6A 3OYCA 1WI7A 1UJYA 4EDUA 2FEIA 1E1TA 4M7AG 3OYKA 1X55A 5I11A 1I5LA 1E24A 5LL6S 4J9HA 3L2ZA 3CCEA 5CKFA 2G4CA 4M7AA 2RQRA 1VIEA 1YCYA 2FZCB 3QBYA 1I1JA 2RK1A 2YLBA 3CC4Q 2FRYA 4UP9A 5KYXB 3LX7A 2EQJA 2XG8D 4YRLA 1UTIA 3NENA 1P92A 1RACB 2VWFA 3OBWA 2M0OA 3JRZA 1MUZA 1VQKT 1B7YB 3QHSA 2KBTA 3HSBA 3RERA 3VBBA 4M77G 3ICAA 5GMKm 4EMGA 2QHVA 2QHUA 1VQPA 2DL7A 4PLIA 3WVEB 2CJBA 3L4GA 2PZ1A 3OD1A 2XI9A 4E7KA 2FZGB 4NL3A 2DNUA 1NJ1A 2D6FA 1R0CB 2HSEB 4B9XA 3JCMX 1YHQQ 5KE3A 4FT2A 2ESWA 1WXUA 2CT4A 4OGCA 3TEGA 2DQ0A 1YGBA 3A74A 1Y96B 1SHFA 3J81E 4FL6A 2DF6A 3JAME 3I7FA 1TUCA 2C06A 4F16A 4HWSA 1VQOT 2PMFA 4X34A 5LJ3f 3SWNB 3J80E 2ZNIA 3ZEHA 1K76A 3RR6A 2VGMA 1KHCA 2A28A 1M90C 5FRMA 1QCFA 3RKXA 3BY7A 4RTWA 2QHTA 4M78E 2E70A 3CCVQ 2G6FX 3QUIA 4YRIA 4C92E 2COYA 2AKWA 2I4OA 1LNXA 4LD6A 3PVQA 4IUTA 1GRIA 4YRFA 4P72C 4RDXA 1K1ZA 1NNHA 3TEHB 2CZ6B 1JJ2A 4Z89A 3LC0A 1S1NA 5M9OA 2HKNA 1YFTA 2HL3A 3MEUA 4F14A 3QZ5B 2EWNA 1HYOA 4C0ZA 1K0XA 2FHDA 2DXTA 2DE0X 4C0DC 2M16A 1MNEA 3GNFB 1UE9A 3QPHA 1M90R 2B8AA 1B7YA 4OLFA 1N8RR 3OYEA 2O01E 2DKGA 3JB9J 4RKUE 2L0AA 3QWYA 3X28B 2P0PA 4RTZA 1QVFS 1QVFP 1MNDA 3CC7A 3JV3A 4XTUA 1AVZC 1GCQA 3E1SA 1A0NB 4WI1A 2HQEA 1WHGA 2KAFA 4CC2A 3HHTB 4WF2A 3A8LB 2FVUA 4XTZA 4P5NA 2RHQB 2EQIA 4FYXB 1XJWB 3S3OA 3P8VA 4XU0A 2M1HA 3HFNA 3HXVA 4E6RA 5E3IA 1TU0B 1FXXA 1VQOQ 3MCAB 1VIFA 2RQTA 3MPUB 1WNLA 1WYXA 4HXJA 2QQSA 2RI5A 4YRTA 4J7FA 2ZT8A 4LUDA 3TEHA 4PK4A 2DTOA 2F1LA 5LJ3d 2JVVA 3HFZA 2YRDA 2KNBB 3CCRA 4TVRA 2BE7D 3I35A 4KT0E 2K2MA 2XIDA 4YYEA 5GAOm 5KCHA 5LJ5e 5FWBA 4UP7A 2AK5A 1YITT 2LC4A 5CKHA 3I56Q 3UH0A 2R58A 3NTKA 2ZINA 2VB6A 2VGNA 3UT1A 2HCKA 2RK2A 1JO8A 2GBQA 2B86A 3REAB 4C8QF 3QO5A 3CXCS 3CXCP 1FMVA 5LJ5h 1RADB 2CZ0B 1G2BA 2K2VA 4P75A 4HT8A 1ZSZA 3PZCA 4P71A 4C5IA 4RCBA 1VQ6A 4YRQA 3R6OA 1CKBA 1BCOA 4IUUA 3OS2A 2JOYA 1SRMA 3CBOA 5I2MA 4A4FA 1PG5B 1EVKA 3GPLA 4PJLA 4PJOA 4LNPA 4M78G 5IH2A 2ARUA 3GNGA 1M1FA 2ED0A 5IHIA 1M1KR 2ZPIB 5GAMh 1NEGA 1WHMA 2EYXA 4IKFA 1ZUUA 1T0HA 2ENMA 2ZIMA 2KK4A 2EJGA 5GJWB 1KIKA 2E6ZA 1UFFA 4H2WA 5GAN5 3JCMP 2AZVA 4EMKB 4WJ3M 2CGHA 4D6WA 4XU1A 1SG5A 2NUTB 1QQJA 2KR3A 1RI0A 3MEWA 3KFUA 4JUVA 1G3WA 4M75B 4Y91A 2K3XA 5ELNA 2DX1A 3QJ6A 2CH4A 3DB4A 3HTZA 2J05A 4HCKA 2BKDN 2FG0A 1WLPB 4PJNA 4ATOA 4OB0B 2R5AA 4FYYB 2ZR3A 3DSQA 1AZGB 1QKXA 1SEMA 1KQSA 4RTYA 4AFSC 2LT1A 9ATCB 1PWTA 3BFMA 1Q81R 3CMAT 2DYBA 3VS7A 1TTHB 2Y4XA 3DB3A 1QVGA 1JU5C 1VYUA 2C0OA 3U23A 2DD5A 4PJOE 2ZT5A 2KE9A 3VYGA 2NWMA 4M77E 2DM1A 3TREA 5GAOl 1U5SA 3RKYA 2NS6A 4M77D 1G5HA 5ELOA 1UGQB 4HVCA 3CPFA 4XK8E 2L8DA 1B70A 1PYSB 5J26A 4FYVB 3TEEA 2ROLA 5GAN3 1VQ8A 3BW1A 3D7SB 2R57A 5GAN8 3A31A 3QWXX 5EC7A 2E41A 5D6YA 4P74A 5GAMd 2JMCA 2EYWA 1EVLA 1W6XA 1X2QA 2V8JA 1NJ5A 2JXBA 2LQWA 3MP1A 2XK0A 2ROTA 3HRKA 3M4PA 1M30A 2M0YA 2JS0A 3KXTA 1USYC 2MOXA 4OMOA 2P4TA 2RHQA 3OW2A 2X4YA 2MI6A 1NJIU 2I4MA 2WACA 3PGGA 4UP8A 1BIAA 5GANg 4KGXB 4EMHA 4FW2A 4RTUA 2ARSA 3VS5A 4IIMA 2QQ9A 1B3QA 3VS0A 4H2XB 2YUPA 4J9IA 3I5RA 5GMKj 1QVGP 1VQ5A 4TTVA 1K4US 1I8FA 3H0IA 5KYUB 3HFVA 1KC8C 1YJ9T 3EGDA 3PT9A 3V7CA 1LJOA 1AOJA 4KBMB 1C1AA 1KK7A 1D09B 4LD9K 1SF9A 1LOJA 3REBB 3CCST 3EG9B 1RIQA 2EYZA 2A08A 6AT1B 2ZR2A 4RMFA 2X4JA 2PNIA 3VUBA 3RUXA 2MK5A 4B6MA 3WVDB 1BI0A 4JDSA 4YRGA 3LH5A 4F7UA 2QQRA 2CP6A 4CS4A 2AZSA 1B34A 3MHXA 4KQEA 3VV0A 1YN8A 5IT9E 1Q7YU 4P75C 3I56A 4JRPA 2V26A 2ZIOA 4J9DA 3A8OB 4BE0A 2YT6A 1V76A 3TSWA 2ED1A 1M2VA 5LJ5f 4MZTA 4ORZA 3M56A 2AMCA 2GFUA 11ASA 2KSSA 3SWNA 4TVYA 2DXBA 2V1QA 2LVMA 1U1TA 2H3JA 4J6YA 3CCEQ 3QIIA 1XQHA 2NUPB 3FRNA 2GTOA 4AT1B 1EX4A 4OGEA 2PUOB 3M5AA 5IHKA 1KQSS 3E9IA 4JLIA 2COWA 3QO8A 2MIOA 1BBWA 4RQEA 4IUQA 1X6OA 2XKOC 1M27C 4D8KA 2CYZB 4XAXB 3M0RA 4PFPA 4A53A 2YRCA 1SSFA 1VQMT 3CMAA 2RI2A 4H2SA 2BIVA 1PRMC 4H2XA 2QEXQ 1S72Q 2VXEA 1QKWA 3QKJA 3JCMh 4OMPA 3C95A 1VQZA 2IY5B 3OYLA 3A98A 2XMFA 1I5OB 1Y71A 3L2UA 1LYLA 3QG1A 2EJFA 3OYNA 1H4SA 2GFAA 5LJ3h 4J15A 1XNIA 3G7ZA 2X3XD 4YTLA 3EG3A 2ZTGA 2RHIA 4M7DC 2CREA 3M0PA 1KC8U 2RF0A 2DTIA 4HWTA 3QYGB 2JTFA 1ZA2B 5L23A 2NUTA 2C7IA 1N8RC 1H3ZA 3CC4T 3CC2T 1I4K1 4Q5WA 2DETA 1M8VA 2CH4W 4XTVA 3RMQA 1NLOC 4K88A 4C0FA 4YRRA 2E4HA 1BBUA 2M51A 2I2LA 1ATIA 2QK0A 2DA9A 2QASA 1VQ8Q 5K1PA 4LXCA 2JNGA 2YWWA 2CT3A 5CCAA 2X51A 4R55A 4ZIBA 1K8AR 2MCNA 4P71C 1BBZA 4XU2A 4TVAB 1Q95G 5IN1A 4C92F 2ZZDA 1VQ6T 1VQKQ 2H8HA 5CK9A 3X24B 4Z02A 1YIJQ 2DIQA 2JW4A 3FEOA 3JCMJ 3S3MA 4RTXA 8ATCB 2CJ9A 3HY0A 4CRIA 5KYXA 3HRIA 2GTJA 1PHTA 3A1PA 2QA4Q 1HK9A 1E22A 5GAN2 2QAZA 3P8BB 3OA6A 2M02A 3QO7A 1AWJA 4M4ZA 1VQNA 3S6WA 1G8XA 1MV3A 3BDUA 1SPKA 2J6OA 3CCMQ 3MKDA 4XTXA 1K8AC 1QP3A 1PYSA 4OB1B 5AT1B 2FL7A 2E10A 4L59A 4C8QB 1W2BP 2RPNA 1IB8A 3T9NA 1NYRA 2VV5A 4J9BA 1ADJA 3UF4A 3RDVA 4EMKC 2AT1B 2O4XA 2BUDA 1RLPC 4ELZC 2NUPA 1LCKA 1X56A 3PMIA 4QQGA 2XDBA 1VQ9A 3UGQA 1NYFA 3MEYA 2K5FA 2O9SA 4AFZC 3VYHB 3CCQA 4PJOC 1SRYA 2ODRD 3IKMB 1QW1A 4BWAA 1KD1R 2DL4A 3QYHB 3TSZA 1RAAB 2DXCA 4LDWA 3EGXA 2ZZFA 1NYGA 3CC7T 5F5WA 1V29B 1FYFA 1YJWA 2K6DA 3JB9H 2DU5A 3H0FA 3M57A 5FU6C 5J3BA 3O5ZA 1NM7A 4C0GA 1ARKA 1KSWA 4DEYA 3GOXA 5HKCA 1VQ6Q 4N0AA 2LCSA 3P8YA 3C4SA 5CIUA 5A0LA 3A5YA 1Z7MA 2RQVA 2EIFA 1Q7YC 2Q7GA 2ZNJA 1H4TA 4EO4A 2DBMA 3CD6A 1D0ZA 2COZA 1EOVA 4CH5A 2RJCA 3MQZA 3TCJA 3FC3A 3OYHA 4Q6GA 2ATCB 2XTIA 3I55A 3M59A 4AFUC 2CDTA 4C92G 1JJ2P 1ZUKA 2O31A 2KYMA 1OZ3A 2XDPA 2BE9B 3OS5A 4BDYA 1WLEA 2JM8A 1M3BA 3ASKA 2DZCA 4RQFA 5FLXE 1UGRB 4QQ6A 2DERA 4RUGA 1WX6A 3TU4K 1PKSA 4QVZA 3C94A 1VQOA 3G6EA 1VYTA 1VOMA 3QZ9B 3CCMT 1C0MA 3EG0A 1HC7A 4KH0B 1WHJA 2ZPHB 3OB9A 2JTMA 2PTKA 5CAIA 4YRJA 4HCCA 3PFSA 1SESA 1FMKA 3V7SA 4MZPA 2E1HA 2DZ9A 5ECAA 5GANd 2EPDA 2RHSB 1UDLA 2SEMA 2DK3A 2DPPB 2H3EB 2QA4A 2KVQG 3HL8A 3V8JA 4BI8B 4CC3A 1ASYA 5D7UA 5FRNA 2HNIA 4P73A 2J6FA 1AHJB 3JB9F 2RD1A 1JXMA 3CMEA 2XU8A 5DLQE 4PHCA 2IY5A 4LDXA 1VQKA 2K9GA 4DOWA 5GMKl 2HSPA 3X26B 4ZGEB 1YITQ 2KYBA 1M1KC 3X25B 2OX7A 3V8KA 2IPOB 4XU3A 4TVAA 4JPBW 1RAFB 4C8QC 4H2VA 2DAQA 5GAMg 2K79A 2PVGB 4LNSA 1VQMA 2DIGA 3BJUA 2KDSA 1VQNT 1U8RA 2X4XA 2HL5C 3CCJQ 1BI1A 2F69A 2AMCB 3A8GB 2ZPBB 3MEVA 4PJOF 5C0MA 2HD0A 2OTJT 4CH3A 1ZHIA 1EIFA 1IHWA 4OB3B 1ZBJA 4BB7A 4J6XA 4HT9A 2FO0A 1BI3A 3SHWA 2D8JA 2DDZA 1WHHA 1J3TA 1KMNA 2CKKA 2NLUA 3UA6A 2RNAA 4CC7A 1BI2A 1E6HA 2OJ2A 3QO3A 2DLPA 1GCPA 3MEAA 4P3PA 2JMAA 4ZTFA 1UB4A 1PC0A 5HGQA 3LGFA 4KUDK 4E7JA 4JS5A 4BI3A 1BIBA 3CCLT 5CVIA 4CI0C 4P72A 3EHRA 3ME9A 3NEMA 1Z9ZA 2PVDB 4WCIA 2HEQA 1B8AA 1WGSA 3S3NA 4M7DE 1DJ7B 3JB9G 1RI9A 1KMMA 2QA4T 2JJ9A 2RQWA 3CCSA 4YP0A 3I9QA 5GANe 1OPLA 1J5WA 1UECA 3H8ZA 4RG2A 1QVGS 2GNCA 3W3SA 3REUA 1X43A 5D6XA 1EFWA 2CP5A 2P0QA 1KQ2A 2SRCA 2ZT6A 4NS5A 4XQ3A 3HXZA 4E7HA 4LDVA 4FCYA 1BCMA 1EIYA 2G3RA 2LX7A 1NPPA 1IHVA 4PJOB 3WXMB 3G1JA 1KD1C 4E7ZA 4YCVA 4F7UB 2LQNA 4EIKA 5GANj 2JZ2A 2OAWA 5LJ3j 1U06A 2J06A 4QQDA 4JJDA 1V1CA 3VS1A 1B70B 4YROA 3SWNC 1ABQA 3NMZC 1G51A 2JUFA 1PM3A 4C0DB 2YUOA 2DEQA 3DLMA 5FU6B 1YIJT 4C8QG 2DL8A 1UEBA 2DJZA 4Z88A 4ELYC 3R07A 5KH6A 4C8QD 4UC4A 2KEAA 2LQKA 4RG8A 4DEXA 2DBKA 4QW2A 5KYWA 3HKSA 5CQXA 4Y92A 3M0TA 2Q5HA 4TVWA 1WDXA 1AWOA 4MMLA 2EKHA 1X6BA 1N9RA 1YIJA 1O9SA 5IXFA 3OQ5A 3GIBA 4M77F 1GFDA 4PKCC 1Q81C 2CZ1B 3CCUA 3ERRA 3OMGA 1NPRA 2EVRA 4EPCA 1W70A 4RMOA 3HP9A 1MMGA 2RB6A 2E3IA 1PSEA 2RHXA 4YRCA 4DBFA 4BW9A 1H4QA 4QT7A 1NJ8A 3RF1A 5GJVB 2QTXA 1N9SA 1VQ9T 4M7AC 2GCXA 1UGPB 5LJ3e 2EKOA 1M5Q1 2QG9B 2E64A 4GLKA 4R56A 1LVKA 1KD1U 3G1ZA 5I2SA 1ZQ1A 3EG1A 3BDLA 2P84A 1WXTA 3UFGA 5C53B 4R0KA 3META 3HXUA 5CKEA 1VQ7T 2DJQA 4H2UA 2DVJA 3P8DA 4KGVB 3OYJA 2QGGA 2DVEA 1GFCA 2FYKA 1UGSB 2DD4A 3E19A 4C8QA 1TWBA 4OMLA 3OYGA 2YRVA 2DQ3A 1TXQA 2VYTA 3URGA 4FW1A 1SHGA 3HFZB 1FMWA 2O4XB 2LMJA 3MP8A 3F70A 4OMQA 4G84A 2RJFA 2PVOB 3VS2A 2KRMA 4HA8A 3HRUA 2OTLA 3KUFA 1TS9A 1MMNA 2M9UA 2CUBA 1ZSGA 2O9VA 2P5IA 1RLQC 3PIPA 1VUBA 2F5TX 1T0JA 2E5KA 4HKEA 5GAOn 4VUBA 5L8RE 1GXIE 1MHNA 3CMAQ 3OYAA 3OS0A 5CKBA 4II1A 1YWOA 2QEXT 4J83A 1S72T 3RNJA 5FWCA 2K3YA 5LJ3g 4X9DA 2AKKA 2LJ3A 3REXA 4M78B 4OMNA 1WZOA 1VQPQ 3OYIA 2C0TA 2A0FB 2E5AA 1WIEA 1X2GA 3UWNA 1M8MA 2P4RA 2DRKA 1O75A 1YFNA 2OTJA 3LW5E 3M0SA 3L2QA 4JLGA 1IGQA 5HY6A 3CC2A 3LH0A 3CC4A 2OTJQ 2LX9A 4F04B 3J7AF 1Z9QA 2HBPA 4YRSA 2CP3A 3Q1JA 3RMSA 4DA4A 3A7RA 2LRQA 3OYBA 4AG1C 1WPYA 1SRLA 3JCMW 2AIRB 1UJ0A 4XTYA 4Y28E 4LVLA 4M7DF 2QXFA 4N4HA 1W66A 1KJWA 4LVMA 1M2VB 5CQYA 3LGLA 3KBGA 1ZLMA 2HBWA 4MDWA 4OVAA 2BZYA 1ZUYA 3VKIA 2NYSA 2MWOA 1VQ7A 1T3SA 5I22A 4JZ3A 2K5IA 2HQXA 4M7AB 2QQBA 1U1SA 2V1RA 2RHZA 3GP8A 2JT4A 1T3LA 3M58A 2L3RA 1UG1A 2DFUA 1HXDA 5GANf 3CPWA 1VQLQ 2L2PA 1IL2A 4WTOB 4K11A 3L42A 3VRYA 4O2DA 1KC8R 1NG2A 1B07A 1TUDA 2IG0A 4LVKA 3AHUA 1UUEA 3KFVA 2FB7A 5GAOp 1NBEB 2L3QA 2E65A 5AYFA 3IKLA 3VU3C 2LTOA 3IG2A 4PFZA 3CCLQ 1H8KA 3H41A 4C92D 4QVCA 1H4VB 4JRKA 3NHNA 1IREB 3CCRQ 2GQIA 2XICA 2YLCA 1YP5A 1K9MC 1EFNA 5IHNA 2ZPFB 4LE9A 4HVUA 5DY9A 3GLXA 1OX9A 1ZSZB 3PCOA 1ZSZC 3NTIA 2MAMA 2PUKB 3THKA 4BY6B 4OMMA 2CP0A 1K0SA 1OYXA 2VASA 4MMKA 4P3NA 1X75C 2JTEA 2HZYA 1ACMB 1JJCB 3JCMf 1K9MR 1YITA 1I81A 3LYIA 2OTLT 1NJ2A 4OB2B 1WA7A 1WU7A 1OX8A 2RMOA 3GF5A 5LJ5j 4BE1A 3MP6A 5GAMf 1YWPA 5CKDA 3L1AA 3JCMb 1I07A 5GAOr 1JB0E 1Q86U 4F7UE 1Y57A 3A7UA 3MF2A 1YCSB 4M7AE 4H2YA 1X6GA 2J6KA 1NEBA 4ZN1A 1M3AA 2KRNA 3IQLA 3PMTA 2YDLA 4HWOA 4RCCA 4C92A 1WJQA 4FU6A 1K73U 1YJ9Q 3OSVA 3DLLA 2ZPEB 3G4SQ 3VS3A 1BB9A 3JCMe 4J9EA 3HFOA 1NJIC 1X01A 5KYUA 4M7DD 5GMKi 1PRLC 2XDDA 2KI7A 2EW3A 3M4GA 1N27A 1E6GA 4PNOA 1OOTA 1QWEA 1K8AU 4ZNXA 4FT4A 1G5IA 4H2TA 1BU1A 5GAMe 4JRIA 3LSQA 2O2OA 4X5OA 1R8OB 3CCUT 2RM4A 4BE2A 4M7DB 2L89A 3CCLA 1LPLA 1VA7A 2RQUA 2VXFA 2ZGWA 3E9GA 4M75E 1NE8A 2RI3A 2R5MA 3QNEA 1M1KU 3JB9D 4XTWA 2VC8A 3EGUA 4E7IA 2ARTA 1MMDA 1YI2A 2V8IA 1QCOA 4YCWA 1YJNQ 3O8VA 2RO0A 4DBRA 5KNNA 3UPUA 2EGCA 3QDRB 4HVVA 4PJOD 2QTVA 1QLYA 2EQKA 1MV0B 4M78C 2CS7A 2ZZEA 2DO3A 5FW9A 1AWXA 2ZCEA 2LNHB 4OF1A 4C5GA 1M4ZA 4J5YA 4QKUA 3CPWS 1VQ7Q 1YHQT 1I0CA 4C92B 4EX5A 4OP0A 2VKNA 5I21A 3SFMA 3HXYA 2YUNA 3V7RA 1Y7XA 4JZ4A 4P74C 1TG0A 4ZTUB 4JS4A 4HVWA 5DLOA 2P0LA 4M78A 3PIOA 4PJOG 2KY9A 5FROA 3LWIA 1YFSA 3OYMA 3A8MB 3OBYA 4BD3A 4ANJA 2D0QB 3V8LA 3CMET 3E2UA 1N9WA 2L3SA 1OU9A 1GBQA 1PNJA 4OMFB 2AHJB 1HSQA 3VQXA 2KRSA 1D0XA 2ABLA 1E1OA 2K3BA 1K73R 1CSKA 2DYIA 3E9HA 1Y96A 4A63B 4PJMA 3UGTA 2IIMA 1KOGA 3ULRB 2EBPA 2HAXA 2X3WD 1W2BA 2CIMA 4IIOA 2ODRC 4IUPA 2X35A 1QCNA 3G4SA 3EFOA 3CCMA 4HWPA 1WJSA 1D0YA 3EG9A 3G6ET 3VRZA 3TQ7P 2K4YA 3RESA 2GF7A 4CS3A 1KHIA 2XD0A 1MGQA 3G4ST 1G5VA 4EMKA 1XOVA 1RUWA 1VQ4A 1M90U 3VJPA 3M54A 4KRTA 2A7YA 1N8RU 4FM4B 2BTTA 5IAYA 2OTLQ 4TQFA 2WSCE 1TSFA 3CC7Q 1U3OA 3CCET 4NOYA 2D8HA 4X1VA 3I55T 5HK0A 3CBPA 2NUZA 3N5BB 4YRPA 2DU7A 4GBQA 3HPWA 2HQHA 3CMQA 3CD6T 1ASZA 3FJPA 4TQDA 1PD0A 2OAUA 1YBYA 3EG2A 3NFCA 1Q7YR 1RAIB 1L0WA 4ZTJA 1QF6A 4PJJA 1N6AA 2FZKB 1R0BG 3GBQA 3CXCA 3LLRA 1B7TA 2I0NA 2YXYA 2RJDA 1YI2T 4O5VA 1TH7A 1M1GA 2MPXC 3HXXA 4M78D 4J9CA 2F2WA 1EZZB 1UHFA 1YJWT 1B34B 1AWWA 3JCMd 3FIFA 5LJ5g 4TWAA 3AT1B 1OV3A 2QDLA 1B76A 4YDQA 2KGTA 3I5SA 1EQRA 3EFOB 3TUPA 2CP7A 5DM7R 4L5GA 2LZ6B 1Q86C 4F7UF 2DILA 5J39A 4A54A 3QSUA 1UGVA 3EH1A 4B9WA 2MMPA 4KR3A 1JXOA 1W4SA 4ZGJB 3UDCA 3SEMA 1X69A 3QDFA 2QHSA 2ECZA 3RBBB 5GAOq 1YNZA 1NJIR 1CKAA 4IUVA 3R6NA 2RJEA 2FPEA 1PKTA 4CS2A 4K86A 3NELA 1YJWQ 3RIRA 2RA2A 1H641 2EGEA 3H0HA 1R77A 2EFIA 2D1XA 4FYWB 2ALYA 1USYA 4O6JA 4M75C 3H6ZA 2LJ1A 4BDZA 2I4LA 4F7UG 5GANh 1JEGA 1GCQC 1SETA 2KT1A 3ER0A 4LUEA 2YUQA 4KUIA 1GBRA 3EFSA 2JM9A 3EAEA 4M75F 4YRMA 2Q7HA 3HRTA 2K5LA 1W1FA 5GMKh 3CCQQ 5A0DA 1X2HA 1VQ9Q 3CC2Q 2QI2A 3BE3A 3ZBDA 2YHTA 3M9QA 3MO8A 1PCXA 2QQAA 2EQMA 5FU7C 3OYDA 4C8QE 1QVFA 2LP5A 3M55A 4AG2C 3LSSA 4WJ4A 2EYYA 2EJ9A 2ZZGA 4M77C 3JB9I 1IO6A 1IZ6A 2CP2A 4XEOA 3OMCA 4PFOA 1ZX6A 1AD5A 2KXCA 2W10A 1M9SA 1WFWA 3HRSA 4M78F 2HDAA 1YB3A 1Q82U 2WSFE 3RL6A 3P8TA 2LQ8A 1D3BB 4Q15A 4KH1B 4H02A 3G71Q 3M4YA 3FLGA 2ZAEA 2V8KA 2HMAA 1HJDA 1VQ5Q 3NETA 3E9FA 4HCZA 4E51A 1D1CA 4CH4A 3CCQT 3C0CA 1JJCA 4HCBA 4C5HA 3IALA 4JRQA 2F2VA 2CZ7B 2EYQA 2LNVA 1ZBXA 2MYSA 4LN2A 5KYWB 4MDXA 1C0AA 12ASA 3L4GB 1RAEB 1FWZA 3SB2A 3A7AA 4XEMA 1JBMA 3DKMA 3QTCA 2KT8A 4FIBA 4YPFA 4AFQC 1WXBA 2ZXFA 2L5QA 4E47A 3JCMV 3OSSC 2E6NA 2DRMA 3CCJA 3PVLA 3CBMA 1N5ZA 2QYZA 4C5EA 3CQTA 3VQYA 3CCJT 3VS4A 1VQMQ 2E3CA 5CO7A 2Z0WA 3ZL7C 2DL3A 4YRKA 2F2XA 1IRXA 4MZMA 3OS1A 3SD4A 1IGUA 3M53A 3VS6A 1OI1A 1MMAA 4NL2A 4P3OA 3X20B 2J3LA 4LDYA 4LVIA 3CCUQ 2Y90A 4N4GA 1RL2A 3JCMc 4BI4A 4M75G 2VVKA 4J8OA 3RKWA 3M0QA 2AKWB 5K1XA 3CPWP 2P0KA 3L2RA 2KMTA 3CMEQ 3A5ZB 1D3BA 3HXWA 5GMKe 4YRNA 3FDRA 4DQ2A 4M75D 2K7AA 2I4NA 2RHYA 1QP2A 1OQKA 3PTAA 3QXEB 2ALYB 1JRIA 5A2QE 3INZA 2QEXA 1S72A 3L2WA 4M7DA 4ZGDB 1VQLT 5C6SA 4LVJA 4DBQA 2EAYA 3EGXB 3FB9A 2X9HA 3I56T 2MWPA 3NPFA 1WQ7A 2AKLA 1G83A 3JSCA 4ZTZB 5EG2A 2Q7EA 2ZPGB 4A4HA 2FPFA 1Q82C 1D1AA 2W0ZA 4CC4B 2KQWA 3PE0A 4KGZB 2DEUA 3HTRA 1D1BA 3CCVT 1Y0MA 5C52B 2C8MA 1BKBA 1HD3A 1OPKA 4KULA 2DTHA
chains in the Genus database with same CATH topology
3QJYA 4HWRA 4N0AC 4NCXA 3RGLA 2JN0A 4M7AD 1ADYA 1XTDA 2IVWA 3MF1A 3CEYA 1WYDA 2RHSA 1VQ5T 5GAMj 2MF2A 4N4IA 4LDUA 4PG3A 3OYFA 2XGTA 2EL9A 4ZN3A 4DOVA 3A5ZA 2F5KA 5C51B 5GAN7 1G3TA 1SERA 3ZFJA 2E5QA 2Q5IA 4HT4A 2PU9B 4BY6C 1NJ6A 2RH2A 4ME7A 4BUGA 3VQWA 3P8HA 4BACA 4P73C 5A0GA 2Y4YA 1HTTA 4G85A 1OZ2A 4J7IA 1VQ8T 3PNWC 1YJNA 1G3YA 4L6V5 3A8HB 1NZ9A 4J6WA 3OW2S 4V2SA 4AH6A 4A4GA 2VUBA 4YCUA 5GAN4 1BYMA 1QE0A 2LCCA 1Z7NA 4E7LA 2QDYB 5LJ5d 4C92C 3JCMg 1FX7A 4M7AF 4GY5A 2LCLA 1GGMA 4UPAA 1K9MU 1X54A 1YJNT 5GAN6 4A4KA 1G3SA 2PQWA 1YJ9A 2RHUA 1KG1A 3OY9A 1PSFA 4KR2A 1WQWA 4PLLA 3A32A 4M77B 3JCMQ 3PCOB 5CR2A 3M4QA 5KE2A 1Y07A 4A4EA 2ZT7A 2D9TA 1Q81U 2E12A 1VQ4T 5KCOA 1VQPT 1NYQA 4QVDA 4M7DG 1K73C 4L87A 3LWHA 4YREA 2EQUA 3OYYA 2A3LA 2DXUA 3NTHA 1JJ2S 4IURA 2ZCFB 5HK3A 3RACA 4K87A 3SDZA 2A8EA 3EFRA 2GQVA 4M75A 1EIYB 1KQ1A 4X9CA 2J3MA 5FU7B 3WQZA 2WSEE 3CCVA 4PL6A 2PMEA 4JJNK 1YFRA 3HY1A 2K57A 4M77A 5D6WA 2LT4A 3VUZA 3G71T 1VQLA 3VQVA 1W2BS 2X4WA 4FSXA 1WJRA 3G71A 2LDMA 3CCRT 3L2VA 4DPGA 2XHCA 3C12A 1QVPA 1YHQA 2CJAA 4CH6A 3OYCA 4EDUA 1E1TA 4M7AG 3OYKA 1X55A 1I5LA 1E24A 5LL6S 3L2ZA 3CCEA 5CKFA 2G4CA 4M7AA 1VIEA 1YCYA 3QBYA 2RK1A 2YLBA 4UP9A 3LX7A 2EQJA 2XG8D 4YRLA 3NENA 1P92A 3OBWA 2M0OA 3JRZA 1VQKT 1B7YB 3QHSA 3HSBA 3RERA 3VBBA 4M77G 3ICAA 5GMKm 4EMGA 2QHVA 2QHUA 1VQPA 4PLIA 3WVEB 2CJBA 3L4GA 3OD1A 2XI9A 4E7KA 4NL3A 1NJ1A 2D6FA 3JCMX 4B9XA 5KE3A 4FT2A 4OGCA 3TEGA 2DQ0A 1YGBA 3A74A 1Y96B 3J81E 4FL6A 3JAME 3I7FA 2C06A 4HWSA 1VQOT 2PMFA 4X34A 5LJ3f 3SWNB 3J80E 2ZNIA 3ZEHA 2VGMA 1KHCA 1M90C 5FRMA 3RKXA 3BY7A 2QHTA 4M78E 2E70A 3QUIA 4YRIA 4C92E 2AKWA 2I4OA 1LNXA 4LD6A 4IUTA 4YRFA 4P72C 4RDXA 1NNHA 3TEHB 2CZ6B 1JJ2A 3LC0A 5M9OA 1YFTA 3MEUA 3QZ5B 2EWNA 4C0ZA 2FHDA 2DXTA 4C0DC 2M16A 3GNFB 3QPHA 2B8AA 1B7YA 4OLFA 3OYEA 2O01E 2DKGA 3JB9J 4RKUE 3X28B 2P0PA 1QVFS 3CC7A 4XTUA 3E1SA 4WI1A 2HQEA 2KAFA 3HHTB 4WF2A 3A8LB 2FVUA 4XTZA 4P5NA 2RHQB 3S3OA 3P8VA 4XU0A 2M1HA 3HFNA 3HXVA 5E3IA 1FXXA 3MCAB 1VIFA 1WNLA 2QQSA 2RI5A 4YRTA 4J7FA 2ZT8A 3TEHA 2DTOA 5LJ3d 2JVVA 3HFZA 3CCRA 4TVRA 4KT0E 2XIDA 4YYEA 5GAOm 5KCHA 5LJ5e 4UP7A 1YITT 2LC4A 5CKHA 3UH0A 2R58A 3NTKA 2ZINA 2VGNA 3UT1A 2RK2A 4C8QF 3QO5A 3CXCS 5LJ5h 2CZ0B 2K2VA 4P75A 4HT8A 3PZCA 4P71A 4C5IA 4RCBA 1VQ6A 4YRQA 3R6OA 4IUUA 3OS2A 2JOYA 3CBOA 5I2MA 4A4FA 1EVKA 3GPLA 4PJOA 4M78G 2ARUA 3GNGA 1M1FA 2ZPIB 5GAMh 4IKFA 2ZIMA 2KK4A 2EJGA 2E6ZA 4H2WA 5GAN5 3JCMP 4WJ3M 4EMKB 2CGHA 4D6WA 4XU1A 1RI0A 3MEWA 3KFUA 4JUVA 1G3WA 4M75B 4Y91A 2K3XA 5ELNA 3QJ6A 3DB4A 3HTZA 2BKDN 4ATOA 4OB0B 2R5AA 2ZR3A 3DSQA 1KQSA 2LT1A 3BFMA 3CMAT 2Y4XA 3DB3A 1QVGA 2ZT5A 2DD5A 4PJOE 3VYGA 4M77E 3TREA 5GAOl 3RKYA 2NS6A 4M77D 1G5HA 5ELOA 1UGQB 4HVCA 3CPFA 4XK8E 2L8DA 1B70A 1PYSB 5J26A 3TEEA 5GAN3 1VQ8A 3BW1A 2R57A 5GAN8 3A31A 2E41A 5D6YA 4P74A 5GAMd 1EVLA 2V8JA 1NJ5A 3MP1A 2XK0A 3HRKA 3M4PA 3KXTA 1USYC 2P4TA 2RHQA 3OW2A 2X4YA 2MI6A 1NJIU 2I4MA 2WACA 3PGGA 4UP8A 1BIAA 5GANg 4EMHA 2ARSA 2QQ9A 4H2XB 5GMKj 4TTVA 1VQ5A 1I8FA 3HFVA 1KC8C 1YJ9T 3PT9A 3V7CA 1LJOA 4KBMB 4LD9K 1LOJA 3CCST 1RIQA 2ZR2A 4RMFA 2X4JA 3VUBA 3RUXA 3WVDB 1BI0A 4JDSA 4YRGA 4F7UA 2QQRA 4CS4A 1B34A 3MHXA 4KQEA 3VV0A 5IT9E 1Q7YU 4P75C 3I56A 4JRPA 2ZIOA 3A8OB 4BE0A 5LJ5f 4MZTA 3M56A 2AMCA 2GFUA 11ASA 2KSSA 3SWNA 4TVYA 2DXBA 2LVMA 1U1TA 2H3JA 4J6YA 3QIIA 1XQHA 3FRNA 4OGEA 2PUOB 3M5AA 1KQSS 3E9IA 4JLIA 3QO8A 1BBWA 4RQEA 4IUQA 1X6OA 2XKOC 2CYZB 4XAXB 4A53A 1SSFA 1VQMT 3CMAA 2RI2A 4H2SA 2BIVA 4H2XA 2VXEA 3QKJA 3JCMh 3C95A 1VQZA 2IY5B 3OYLA 1Y71A 3L2UA 1LYLA 3QG1A 2EJFA 3OYNA 1H4SA 2GFAA 5LJ3h 4J15A 1XNIA 3G7ZA 4YTLA 2ZTGA 2RHIA 4M7DC 1KC8U 2DTIA 4HWTA 3QYGB 2JTFA 2C7IA 1N8RC 1H3ZA 3CC4T 3CC2T 1I4K1 4Q5WA 1M8VA 4XTVA 3RMQA 4YRRA 4K88A 4C0FA 1BBUA 2I2LA 1ATIA 5K1PA 2JNGA 5CCAA 4R55A 4ZIBA 4P71C 4XU2A 4TVAB 5IN1A 4C92F 2ZZDA 1VQ6T 5CK9A 3X24B 4Z02A 2DIQA 3FEOA 3JCMJ 3S3MA 2CJ9A 3HY0A 4CRIA 3HRIA 1HK9A 1E22A 5GAN2 3P8BB 3OA6A 3QO7A 1VQNA 3S6WA 3BDUA 4XTXA 1K8AC 1QP3A 1PYSA 4OB1B 2FL7A 2E10A 4L59A 4C8QB 3T9NA 1NYRA 2VV5A 1ADJA 4EMKC 2O4XA 2BUDA 4ELZC 1X56A 3PMIA 4QQGA 2XDBA 1VQ9A 3UGQA 3MEYA 2K5FA 3VYHB 3CCQA 4PJOC 1SRYA 2ODRD 3IKMB 1QW1A 4BWAA 3QYHB 2DXCA 4LDWA 2ZZFA 3CC7T 5F5WA 1V29B 1FYFA 1YJWA 3JB9H 2DU5A 3M57A 5FU6C 5J3BA 4C0GA 3GOXA 5HKCA 4N0AA 3P8YA 3C4SA 5CIUA 5A0LA 3A5YA 1Z7MA 2EIFA 1Q7YC 2Q7GA 2ZNJA 1H4TA 4EO4A 3CD6A 1EOVA 4CH5A 2RJCA 3MQZA 3TCJA 3FC3A 3OYHA 4Q6GA 2XTIA 3I55A 3M59A 4C92G 1OZ3A 2XDPA 3OS5A 4BDYA 1WLEA 3ASKA 2DZCA 4RQFA 5FLXE 1UGRB 4QQ6A 3TU4K 4QVZA 3C94A 1VQOA 3G6EA 3QZ9B 3CCMT 1HC7A 2ZPHB 3OB9A 2JTMA 5CAIA 4YRJA 4HCCA 3PFSA 1SESA 3V7SA 4MZPA 2E1HA 2DZ9A 5GANd 2RHSB 2DK3A 2DPPB 2QA4A 2KVQG 3HL8A 3V8JA 4BI8B 1ASYA 5FRNA 2HNIA 4P73A 1AHJB 3JB9F 2RD1A 3CMEA 2XU8A 5DLQE 4PHCA 2IY5A 4LDXA 1VQKA 4DOWA 5GMKl 3X26B 4ZGEB 1M1KC 3X25B 3V8KA 4XU3A 4TVAA 4C8QC 4H2VA 2DAQA 5GAMg 2PVGB 4LNSA 1VQMA 2DIGA 3BJUA 2KDSA 1VQNT 1U8RA 2X4XA 1BI1A 2F69A 2AMCB 3A8GB 2ZPBB 3MEVA 4PJOF 5C0MA 2HD0A 2OTJT 4CH3A 1ZHIA 1EIFA 4OB3B 4BB7A 4J6XA 4HT9A 1BI3A 2DDZA 1KMNA 2CKKA 2NLUA 1BI2A 3QO3A 3MEAA 4P3PA 4ZTFA 1UB4A 5HGQA 3LGFA 4KUDK 4E7JA 4JS5A 4BI3A 1BIBA 3CCLT 5CVIA 4CI0C 4P72A 3ME9A 3NEMA 2PVDB 1B8AA 1WGSA 3S3NA 4M7DE 1DJ7B 3JB9G 1KMMA 2QA4T 3CCSA 4YP0A 5GANe 1J5WA 3H8ZA 4RG2A 1QVGS 3W3SA 3REUA 5D6XA 1EFWA 2P0QA 1KQ2A 2ZT6A 4NS5A 4XQ3A 3HXZA 4E7HA 4LDVA 1EIYA 2G3RA 1NPPA 4PJOB 3WXMB 1KD1C 4YCVA 4F7UB 5GANj 2JZ2A 5LJ3j 4QQDA 1B70B 4YROA 3SWNC 1G51A 2JUFA 4C0DB 2DEQA 3DLMA 5FU6B 1YIJT 4C8QG 1UEBA 2DJZA 4ELYC 3R07A 5KH6A 4C8QD 4UC4A 2LQKA 4RG8A 4QW2A 3HKSA 5CQXA 2Q5HA 4TVWA 4MMLA 1N9RA 1YIJA 1O9SA 3OQ5A 3GIBA 4M77F 4PKCC 1Q81C 2CZ1B 3CCUA 3ERRA 3OMGA 1NPRA 4EPCA 4RMOA 3HP9A 2RB6A 1PSEA 2RHXA 4YRCA 4BW9A 1H4QA 1NJ8A 3RF1A 2QTXA 1N9SA 1VQ9T 4M7AC 2GCXA 1UGPB 5LJ3e 2EKOA 1M5Q1 4GLKA 2E64A 4R56A 1KD1U 3G1ZA 5I2SA 1ZQ1A 3BDLA 3UFGA 5C53B 3META 3HXUA 5CKEA 1VQ7T 4H2UA 3P8DA 3OYJA 2DVEA 2FYKA 1UGSB 2DD4A 3E19A 4C8QA 3OYGA 2YRVA 2DQ3A 2VYTA 3URGA 3HFZB 2O4XB 3MP8A 3F70A 4G84A 2RJFA 2PVOB 4HA8A 3HRUA 2OTLA 3KUFA 2M9UA 2P5IA 3PIPA 1VUBA 2F5TX 4HKEA 5GAOn 4VUBA 5L8RE 1GXIE 1MHNA 3OYAA 3OS0A 4II1A 5CKBA 2QEXT 1S72T 4J83A 2K3YA 5LJ3g 4X9DA 3REXA 4M78B 3OYIA 2E5AA 1X2GA 3UWNA 1O75A 2OTJA 3LW5E 3L2QA 4JLGA 5HY6A 3CC2A 3LH0A 3CC4A 2LX9A 3J7AF 2HBPA 4YRSA 3Q1JA 3RMSA 4DA4A 3A7RA 2LRQA 3OYBA 1WPYA 3JCMW 4XTYA 4Y28E 4LVLA 4M7DF 2QXFA 1W66A 4N4HA 4LVMA 5CQYA 3LGLA 3KBGA 4MDWA 4OVAA 3VKIA 2MWOA 1VQ7A 2K5IA 2HQXA 4M7AB 2QQBA 1U1SA 3GP8A 2RHZA 3M58A 2L3RA 1HXDA 5GANf 3CPWA 1IL2A 3L42A 4O2DA 2IG0A 4LVKA 3AHUA 2FB7A 5GAOp 2E65A 5AYFA 3IKLA 3VU3C 2LTOA 3IG2A 4C92D 4QVCA 1H4VB 4JRKA 1IREB 2XICA 2YLCA 1K9MC 2ZPFB 5DY9A 3GLXA 3PCOA 3NTIA 2MAMA 2PUKB 4BY6B 1OYXA 4MMKA 4P3NA 1X75C 1JJCB 3JCMf 1YITA 1I81A 3LYIA 2OTLT 1NJ2A 4OB2B 1WU7A 3GF5A 5LJ5j 4BE1A 3MP6A 5GAMf 5CKDA 3L1AA 3JCMb 5GAOr 1JB0E 1Q86U 4F7UE 3A7UA 3MF2A 4M7AE 4H2YA 4ZN1A 3PMTA 4HWOA 4RCCA 4C92A 1WJQA 4FU6A 1K73U 3OSVA 3DLLA 2ZPEB 3JCMe 3HFOA 1NJIC 1X01A 4M7DD 5GMKi 2XDDA 3M4GA 1N27A 4PNOA 1K8AU 4FT4A 1G5IA 4H2TA 5GAMe 4JRIA 3LSQA 4X5OA 1R8OB 3CCUT 2RM4A 4BE2A 4M7DB 2L89A 3CCLA 3E9GA 2VXFA 2ZGWA 4M75E 1NE8A 2RI3A 2R5MA 3QNEA 1M1KU 3JB9D 4XTWA 2VC8A 4E7IA 2ARTA 1YI2A 2V8IA 4YCWA 3O8VA 2RO0A 5KNNA 3UPUA 3QDRB 4PJOD 2EQKA 4M78C 2CS7A 2ZZEA 2DO3A 2ZCEA 4OF1A 4C5GA 1M4ZA 4J5YA 3CPWS 1YHQT 4C92B 4EX5A 4OP0A 5I21A 3SFMA 3HXYA 3V7RA 1Y7XA 4P74C 4ZTUB 4JS4A 5DLOA 2P0LA 4M78A 3PIOA 4PJOG 2KY9A 5FROA 3LWIA 1YFSA 3OYMA 3A8MB 3OBYA 4BD3A 2D0QB 3V8LA 3CMET 1N9WA 4OMFB 2AHJB 3VQXA 1E1OA 3E9HA 1Y96A 3UGTA 1KOGA 2HAXA 1W2BA 2CIMA 2ODRC 4IUPA 2X35A 3G4SA 3CCMA 4HWPA 1WJSA 3G6ET 2K4YA 3RESA 2GF7A 4CS3A 1KHIA 2XD0A 1MGQA 3G4ST 1G5VA 4EMKA 1XOVA 1VQ4A 1M90U 3VJPA 3M54A 2A7YA 1N8RU 4FM4B 5IAYA 4TQFA 2WSCE 3CCET 4NOYA 3I55T 5HK0A 3CBPA 3N5BB 4YRPA 2DU7A 3HPWA 3CMQA 3CD6T 1ASZA 3FJPA 4TQDA 2OAUA 1YBYA 3NFCA 1L0WA 4ZTJA 1QF6A 1N6AA 3CXCA 3LLRA 2RJDA 1YI2T 4O5VA 1TH7A 1M1GA 3HXXA 4M78D 1YJWT 1B34B 3JCMd 3FIFA 5LJ5g 4TWAA 1B76A 4YDQA 1EQRA 3TUPA 5DM7R 4L5GA 1Q86C 4F7UF 5J39A 4A54A 3QSUA 4B9WA 2MMPA 4KR3A 1W4SA 4ZGJB 3UDCA 2QHSA 5GAOq 4IUVA 2RJEA 4CS2A 4K86A 3NELA 2RA2A 3RIRA 1H641 2EFIA 2ALYA 1USYA 4O6JA 4M75C 3H6ZA 4BDZA 2I4LA 4F7UG 5GANh 1SETA 3ER0A 4KUIA 3EFSA 3EAEA 4M75F 4YRMA 2Q7HA 3HRTA 2K5LA 5GMKh 5A0DA 1X2HA 2QI2A 3ZBDA 2YHTA 3M9QA 3MO8A 2QQAA 2EQMA 5FU7C 3OYDA 4C8QE 1QVFA 3M55A 3LSSA 4WJ4A 2EJ9A 2ZZGA 4M77C 3JB9I 1IZ6A 4XEOA 3OMCA 1M9SA 3HRSA 4M78F 1YB3A 1Q82U 2WSFE 3RL6A 3P8TA 2LQ8A 1D3BB 4Q15A 4H02A 3M4YA 3FLGA 2V8KA 3NETA 3E9FA 4HCZA 4E51A 4CH4A 3CCQT 1JJCA 4HCBA 4C5HA 3IALA 4JRQA 2CZ7B 2EYQA 2LNVA 1ZBXA 4MDXA 1C0AA 12ASA 3L4GB 1FWZA 3SB2A 3A7AA 4XEMA 1JBMA 3DKMA 3QTCA 4FIBA 4YPFA 2ZXFA 2L5QA 4E47A 3JCMV 3OSSC 2E6NA 3CCJA 3CBMA 4C5EA 3VQYA 3CCJT 2E3CA 5CO7A 4YRKA 4MZMA 3OS1A 3SD4A 3M53A 1OI1A 4NL2A 4P3OA 3X20B 2J3LA 4LDYA 4LVIA 2Y90A 4N4GA 1RL2A 3JCMc 4BI4A 4M75G 4J8OA 3RKWA 2AKWB 5K1XA 2P0KA 3L2RA 2KMTA 3A5ZB 1D3BA 3HXWA 5GMKe 4YRNA 3FDRA 4DQ2A 4M75D 2I4NA 2RHYA 1QP2A 3PTAA 3QXEB 2ALYB 1JRIA 5A2QE 3INZA 2QEXA 1S72A 3L2WA 4M7DA 4ZGDB 1VQLT 5C6SA 4LVJA 2EAYA 3FB9A 3I56T 2MWPA 1WQ7A 3JSCA 4ZTZB 5EG2A 2Q7EA 2ZPGB 4A4HA 1Q82C 2KQWA 3CCVT 5C52B 2C8MA 1BKBA 4KULA 2DTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P71 A;  1WU7 A;  4RCB A;  4YRQ A;  4HWR A;  4N0A C;  4NCX A;  3RGL A;  2JN0 A;  5LJ5 j;  4M7A D;  5GAM f;  1WLE A;  3L1A A;  3JCM b;  5GAO r;  1ADY A;  1EVK A;  3MF1 A;  2DZC A;  4F7U E;  4PJO A;  3A7U A;  3MF2 A;  4M78 G;  2ARU A;  4RQF A;  4M7A E;  4H2Y A;  1WYD A;  2RHS A;  5GAM j;  4PG3 A;  5GAM h;  4HWO A;  4RCC A;  4C92 A;  2ZIM A;  2EJG A;  1HC7 A;  2EL9 A;  2XGT A;  3JCM e;  5CAI A;  4YRJ A;  3A5Z A;  3HFO A;  1SES A;  4H2W A;  5GAN 5;  3JCM P;  1X01 A;  4EMK B;  3V7S A;  4WJ3 M;  4M7D D;  5GMK i;  5C51 B;  2CGH A;  5GAN 7;  4XU1 A;  2E1H A;  3M4G A;  4PNO A;  2DZ9 A;  5GAN d;  2RHS B;  1SER A;  1G5I A;  4H2T A;  3V8J A;  3KFU A;  2Q5I A;  1ASY A;  4JUV A;  4JRI A;  4Y91 A;  4M75 B;  5GAM e;  3LSQ A;  4X5O A;  2HNI A;  2RM4 A;  5ELN A;  4P73 A;  1NJ6 A;  4M7D B;  3JB9 F;  2RD1 A;  3HTZ A;  2VXF A;  2ZGW A;  4M75 E;  4PHC A;  2IY5 A;  3VQW A;  5GMK l;  3QNE A;  4P73 C;  3JB9 D;  4XTW A;  2VC8 A;  3V8K A;  1HTT A;  2ART A;  2ZR3 A;  4XU3 A;  3DSQ A;  4TVA A;  4G85 A;  4C8Q C;  4YCW A;  4H2V A;  5GAM g;  5KNN A;  4LNS A;  3BFM A;  3BJU A;  4PJO D;  4J6W A;  2AMC B;  4M78 C;  2ZZE A;  4PJO F;  2ZT5 A;  4PJO E;  4V2S A;  4CH3 A;  4AH6 A;  2ZCE A;  4YCU A;  4M77 E;  5GAN 4;  1QE0 A;  4J5Y A;  5GAO l;  1Z7N A;  4J6X A;  3RKY A;  4M77 D;  4HT9 A;  5LJ5 d;  4C92 B;  1G5H A;  5ELO A;  4OP0 A;  4C92 C;  4EX5 A;  3JCM g;  4HVC A;  4M7A F;  5I21 A;  2DDZ A;  4UPA A;  1GGM A;  3HXY A;  3V7R A;  1KMN A;  1B70 A;  1PYS B;  1X54 A;  4P74 C;  5GAN 3;  4ZTU B;  5GAN 6;  3QO3 A;  3BW1 A;  4P3P A;  5GAN 8;  2P0L A;  3A31 A;  4KR2 A;  4M78 A;  1WQW A;  5HGQ A;  4PJO G;  2E41 A;  4P74 A;  5GAM d;  1YFS A;  3A32 A;  3V8L A;  4M77 B;  1EVL A;  3JCM Q;  1BIB A;  3PCO B;  3M4Q A;  4P72 A;  1N9W A;  1NJ5 A;  3NEM A;  1B8A A;  4M7D E;  3VQX A;  3HRK A;  3M4P A;  3JB9 G;  1KMM A;  1USY C;  1E1O A;  4YP0 A;  2RHQ A;  2ZT7 A;  3E9H A;  5GAN e;  1J5W A;  1Y96 A;  3UGT A;  1KOG A;  2I4M A;  3W3S A;  2CIM A;  2ODR C;  3REU A;  3PGG A;  4UP8 A;  1BIA A;  5GAN g;  1EFW A;  4EMH A;  1KQ2 A;  2ARS A;  2ZT6 A;  4XQ3 A;  4QVD A;  1NYQ A;  3HXZ A;  4HWP A;  4H2X B;  1EIY A;  4M7D G;  3RES A;  4L87 A;  5GMK j;  4CS3 A;  4TTV A;  4PJO B;  4YRE A;  1I8F A;  1MGQ A;  4EMK A;  2DXU A;  4YCV A;  3HFV A;  4F7U B;  3V7C A;  5GAN j;  1LJO A;  3RAC A;  4K87 A;  4TQF A;  5LJ3 j;  3EFR A;  1LOJ A;  4M75 A;  1EIY B;  1RIQ A;  4NOY A;  1B70 B;  4YRO A;  1KQ1 A;  4X9C A;  3SWN C;  2J3M A;  2ZR2 A;  3WQZ A;  4RMF A;  1G51 A;  3RUX A;  4YRG A;  4YRP A;  2DU7 A;  2DEQ A;  4F7U A;  3CMQ A;  1ASZ A;  3FJP A;  4TQD A;  4CS4 A;  2PME A;  4C8Q G;  1B34 A;  4KQE A;  1YFR A;  4P75 C;  3HY1 A;  2K57 A;  2DJZ A;  4M77 A;  1L0W A;  3R07 A;  1QF6 A;  2ZIO A;  4C8Q D;  3VQV A;  5LJ5 f;  2AMC A;  2Q5H A;  11AS A;  3SWN A;  1TH7 A;  4TVY A;  4DPG A;  4TVW A;  1U1T A;  3HXX A;  4J6Y A;  4M78 D;  4MML A;  1N9R A;  1B34 B;  2CJA A;  4CH6 A;  3JCM d;  3FIF A;  5LJ5 g;  1E1T A;  3GIB A;  4TWA A;  4M77 F;  4M7A G;  1X55 A;  3E9I A;  1I5L A;  4JLI A;  1B76 A;  3ERR A;  3QO8 A;  4YDQ A;  1E24 A;  1BBW A;  1EQR A;  4RQE A;  3TUP A;  2RB6 A;  3L2Z A;  2G4C A;  4M7A A;  4F7U F;  4A53 A;  4YRC A;  4BW9 A;  1H4Q A;  4A54 A;  3QSU A;  1YCY A;  1NJ8 A;  3RF1 A;  4KR3 A;  4H2S A;  2QTX A;  1N9S A;  4M7A C;  2YLB A;  4H2X A;  5LJ3 e;  2VXE A;  2QHS A;  1M5Q 1;  4UP9 A;  2E64 A;  3JCM h;  5GAO q;  3G1Z A;  4YRL A;  3NEN A;  1VQZ A;  2IY5 B;  3UFG A;  5C53 B;  3HXU A;  1B7Y B;  3QHS A;  3HSB A;  3RER A;  1LYL A;  4H2U A;  3VBB A;  4M77 G;  4K86 A;  3ICA A;  3NEL A;  4CS2 A;  2RA2 A;  3RIR A;  1H64 1;  5GMK m;  2EJF A;  2DVE A;  4EMG A;  2QHV A;  2FYK A;  1H4S A;  2ALY A;  5LJ3 h;  1USY A;  2QHU A;  4J15 A;  4C8Q A;  2CJB A;  3L4G A;  4M75 C;  2I4L A;  3OD1 A;  4F7U G;  2DTH A;  4NL3 A;  5GAN h;  2ZTG A;  2DQ3 A;  3HFZ B;  4M7D C;  1SET A;  1NJ1 A;  3JCM X;  2DTI A;  4G84 A;  3EFS A;  4M75 F;  4HA8 A;  4YRM A;  2Q7H A;  4HWT A;  5GMK h;  3TEG A;  2DQ0 A;  1YGB A;  3A74 A;  1Y96 B;  2C7I A;  1X2H A;  3I7F A;  2P5I A;  1I4K 1;  2YHT A;  4HWS A;  1M8V A;  4XTV A;  2PMF A;  5LJ3 f;  3SWN B;  5GAO n;  4YRR A;  4K88 A;  4C8Q E;  2ZNI A;  1BBU A;  3LSS A;  2I2L A;  4WJ4 A;  1ATI A;  2EJ9 A;  2ZZG A;  4M77 C;  5K1P A;  3JB9 I;  3RKX A;  3BY7 A;  4XEO A;  4ZIB A;  4P71 C;  2QHT A;  4XU2 A;  5LJ3 g;  4TVA B;  4M78 E;  4X9D A;  3QUI A;  4YRI A;  4C92 F;  4M78 F;  3REX A;  4M78 B;  4C92 E;  1YB3 A;  2AKW A;  2I4O A;  3RL6 A;  1LNX A;  3P8T A;  2E5A A;  1X2G A;  3JCM J;  4YRF A;  3HY0 A;  2CJ9 A;  1D3B B;  4Q15 A;  4P72 C;  4RDX A;  1NNH A;  3TEH B;  3HRI A;  3LC0 A;  4H02 A;  1HK9 A;  1YFT A;  1E22 A;  5GAN 2;  2EWN A;  3NET A;  3QO7 A;  4E51 A;  2DXT A;  4CH4 A;  4YRS A;  1JJC A;  3A7R A;  3BDU A;  1WPY A;  3IAL A;  3JCM W;  4XTY A;  1B7Y A;  4OLF A;  4M7D F;  4XTX A;  1PYS A;  2DKG A;  1W66 A;  3JB9 J;  2E10 A;  4C8Q B;  1C0A A;  12AS A;  3L4G B;  4XTU A;  1NYR A;  3A7A A;  3SB2 A;  4XEM A;  1JBM A;  3QTC A;  1ADJ A;  4M7A B;  1U1S A;  4EMK C;  4WI1 A;  4YPF A;  2ZXF A;  1HXD A;  5GAN f;  3JCM V;  1X56 A;  4WF2 A;  3UGQ A;  3MEY A;  1IL2 A;  3VQY A;  4XTZ A;  1SRY A;  4PJO C;  2RHQ B;  2E3C A;  2ODR D;  3IKM B;  3P8V A;  4XU0 A;  4YRK A;  4O2D A;  3HFN A;  3HXV A;  4BWA A;  5E3I A;  3AHU A;  4NL2 A;  4P3O A;  2J3L A;  2FB7 A;  2Y90 A;  5GAO p;  3JCM c;  4M75 G;  2ZZF A;  3RKW A;  2E65 A;  1WNL A;  2AKW B;  5K1X A;  5F5W A;  3IKL A;  3VU3 C;  4YRT A;  1FYF A;  2ZT8 A;  3IG2 A;  3TEH A;  3JB9 H;  2DTO A;  2DU5 A;  1D3B A;  5LJ3 d;  3HFZ A;  3HXW A;  5GMK e;  4YRN A;  4C92 D;  4QVC A;  1H4V B;  4JRK A;  4DQ2 A;  4M75 D;  2I4N A;  2YLC A;  2ALY B;  4N0A A;  1JRI A;  3P8Y A;  3INZ A;  4YYE A;  5DY9 A;  5GAO m;  3A5Y A;  4M7D A;  1Z7M A;  5LJ5 e;  2EAY A;  3FB9 A;  3PCO A;  4UP7 A;  3UH0 A;  2Q7G A;  1WQ7 A;  2ZNJ A;  1H4T A;  4EO4 A;  2ZIN A;  4ZTZ B;  2Q7E A;  1EOV A;  4CH5 A;  4MMK A;  4P3N A;  4C8Q F;  4Q6G A;  1JJC B;  2XTI A;  3QO5 A;  3JCM f;  5LJ5 h;  1I81 A;  5C52 B;  4C92 G;  2C8M A;  1NJ2 A;  4P75 A;  4HT8 A;  3PZC A; 
#chains in the Genus database with same CATH topology
 2BZX A;  2L3P A;  3QJY A;  4HWR A;  4N0A C;  4NCX A;  3RGL A;  2JN0 A;  1OU8 A;  4GLM A;  4ESR A;  4M7A D;  1ADY A;  1XTD A;  2IVW A;  4E7S A;  1Q86 R;  1X27 A;  3MF1 A;  2EGA A;  2J7I A;  3CEY A;  1WYD A;  2RHS A;  1VQ5 T;  5GAM j;  5KYY A;  2QGF B;  4J9F A;  3M0U A;  2MF2 A;  4N4I A;  4LDU A;  1VYV A;  4PG3 A;  3MJX A;  3OYF A;  1RAG B;  3CD6 Q;  2XGT A;  2EL9 A;  4ZN3 A;  1BK2 A;  1K9A A;  4DOV A;  3A5Z A;  1SSH A;  2F5K A;  5C51 B;  5GAN 7;  1G3T A;  1SER A;  3CCS Q;  3ZFJ A;  2E5Q A;  2Q5I A;  4AMC A;  7AT1 B;  4HT4 A;  2YSQ A;  1AEY A;  2PU9 B;  4BY6 C;  1Q82 R;  1NJ6 A;  2RH2 A;  4ME7 A;  4BUG A;  1M2O A;  2GGR A;  3VQW A;  3P8H A;  3H9N A;  4BAC A;  4P73 C;  5A0G A;  2Y4Y A;  1HTT A;  3TVT A;  4G85 A;  1OZ2 A;  4J7I A;  1VQ8 T;  3PNW C;  5IXB A;  1YJN A;  5HCK A;  1G3Y A;  1YI2 Q;  5KYN A;  1H92 A;  4L6V 5;  3NGP A;  1ABO A;  3A8H B;  1NZ9 A;  2E3H A;  3OW2 P;  4J6W A;  3OW2 S;  2DMO A;  4V2S A;  1F1B B;  4AH6 A;  4A4G A;  2CSI A;  2O88 A;  1X2K A;  1OEB A;  2VUB A;  4YCU A;  5GAN 4;  2RN8 A;  1BYM A;  1QE0 A;  2LCC A;  1Z7N A;  1FYN A;  4E7L A;  2QDY B;  1RAH B;  1QWF A;  5LJ5 d;  4J9G A;  4C92 C;  3JCM g;  1FX7 A;  4M7A F;  4GY5 A;  2LCL A;  1GGM A;  4UPA A;  1K9M U;  1TUG B;  1GL5 A;  4F17 A;  1X54 A;  4FSS A;  3UAT A;  5KYY B;  5GAN 6;  4A4K A;  1G3S A;  2PQW A;  1YJN T;  1E7O A;  1YJ9 A;  2RHU A;  1KG1 A;  3OY9 A;  1AT1 B;  1PSF A;  2JS2 A;  4KR2 A;  1WQW A;  1H3H A;  1VQN Q;  4RTV A;  4PLL A;  1UHC A;  2A36 A;  3A32 A;  4M77 B;  3JCM Q;  3PCO B;  5CR2 A;  3M4Q A;  4D8D A;  3UA7 A;  5KE2 A;  2A37 A;  4DBH A;  1Y07 A;  4RTT A;  4A4E A;  4E2F B;  1NLP C;  2KRO A;  2ZT7 A;  2D9T A;  2FPD A;  1Q81 U;  1SKU B;  2E12 A;  1IXD A;  1RAB B;  1VQ4 T;  3EHQ A;  5KCO A;  1VQP T;  4JJC A;  1ZA1 B;  1NYQ A;  4QVD A;  1C6V X;  3G6E Q;  4M7D G;  1OUL A;  1K73 C;  4L87 A;  1JQQ A;  3LWH A;  4YRE A;  2EQU A;  3OYY A;  2A3L A;  2DXU A;  1TOV A;  3NTH A;  1AZE A;  1JJ2 S;  4IUR A;  2CUD A;  2LJ0 A;  2ZCF B;  5HK3 A;  3RAC A;  4K87 A;  3SDZ A;  2D0N A;  2A8E A;  3EFR A;  2GQV A;  4M75 A;  1EIY B;  1KQ1 A;  4X9C A;  2J3M A;  1WHK A;  5FU7 B;  3WQZ A;  4JJB A;  2KXD A;  2WSE E;  3I55 Q;  3CCV A;  3FJ5 A;  4PL6 A;  2OI3 A;  3EGD B;  1QMC A;  1M3C A;  2PME A;  4JJN K;  2BZ8 A;  1YFR A;  1KFZ A;  2DL5 A;  3HY1 A;  2K57 A;  4M77 A;  5D6W A;  2LT4 A;  3VUZ A;  2C0I A;  1PD1 A;  3G71 T;  1VQL A;  1VQ4 Q;  3VQV A;  1W2B S;  2X4W A;  4FSX A;  1WHL A;  3EH2 A;  1WJR A;  3G71 A;  4Z8A A;  1KQS P;  2LDM A;  3CCR T;  3L2V A;  4DPG A;  2XHC A;  3C12 A;  8AT1 B;  1QVP A;  2CSQ A;  1YHQ A;  2CJA A;  2HKQ B;  2FRW A;  4CH6 A;  3OYC A;  1WI7 A;  1UJY A;  4EDU A;  2FEI A;  1E1T A;  4M7A G;  3OYK A;  1X55 A;  5I11 A;  1I5L A;  1E24 A;  5LL6 S;  4J9H A;  3L2Z A;  3CCE A;  5CKF A;  2G4C A;  4M7A A;  2RQR A;  1VIE A;  1YCY A;  2FZC B;  3QBY A;  1I1J A;  2RK1 A;  2YLB A;  3CC4 Q;  2FRY A;  4UP9 A;  5KYX B;  3LX7 A;  2EQJ A;  2XG8 D;  4YRL A;  1UTI A;  3NEN A;  1P92 A;  1RAC B;  2VWF A;  3OBW A;  2M0O A;  3JRZ A;  1MUZ A;  1VQK T;  1B7Y B;  3QHS A;  2KBT A;  3HSB A;  3RER A;  3VBB A;  4M77 G;  3ICA A;  5GMK m;  4EMG A;  2QHV A;  2QHU A;  1VQP A;  2DL7 A;  4PLI A;  3WVE B;  2CJB A;  3L4G A;  2PZ1 A;  3OD1 A;  2XI9 A;  4E7K A;  2FZG B;  4NL3 A;  2DNU A;  1NJ1 A;  2D6F A;  1R0C B;  2HSE B;  4B9X A;  3JCM X;  1YHQ Q;  5KE3 A;  4FT2 A;  2ESW A;  1WXU A;  2CT4 A;  4OGC A;  3TEG A;  2DQ0 A;  1YGB A;  3A74 A;  1Y96 B;  1SHF A;  3J81 E;  4FL6 A;  2DF6 A;  3JAM E;  3I7F A;  1TUC A;  2C06 A;  4F16 A;  4HWS A;  1VQO T;  2PMF A;  4X34 A;  5LJ3 f;  3SWN B;  3J80 E;  2ZNI A;  3ZEH A;  1K76 A;  3RR6 A;  2VGM A;  1KHC A;  2A28 A;  1M90 C;  5FRM A;  1QCF A;  3RKX A;  3BY7 A;  4RTW A;  2QHT A;  4M78 E;  2E70 A;  3CCV Q;  2G6F X;  3QUI A;  4YRI A;  4C92 E;  2COY A;  2AKW A;  2I4O A;  1LNX A;  4LD6 A;  3PVQ A;  4IUT A;  1GRI A;  4YRF A;  4P72 C;  4RDX A;  1K1Z A;  1NNH A;  3TEH B;  2CZ6 B;  1JJ2 A;  4Z89 A;  3LC0 A;  1S1N A;  5M9O A;  2HKN A;  1YFT A;  2HL3 A;  3MEU A;  4F14 A;  3QZ5 B;  2EWN A;  1HYO A;  4C0Z A;  1K0X A;  2FHD A;  2DXT A;  2DE0 X;  4C0D C;  2M16 A;  1MNE A;  3GNF B;  1UE9 A;  3QPH A;  1M90 R;  2B8A A;  1B7Y A;  4OLF A;  1N8R R;  3OYE A;  2O01 E;  2DKG A;  3JB9 J;  4RKU E;  2L0A A;  3QWY A;  3X28 B;  2P0P A;  4RTZ A;  1QVF S;  1QVF P;  1MND A;  3CC7 A;  3JV3 A;  4XTU A;  1AVZ C;  1GCQ A;  3E1S A;  1A0N B;  4WI1 A;  2HQE A;  1WHG A;  2KAF A;  4CC2 A;  3HHT B;  4WF2 A;  3A8L B;  2FVU A;  4XTZ A;  4P5N A;  2RHQ B;  2EQI A;  4FYX B;  1XJW B;  3S3O A;  3P8V A;  4XU0 A;  2M1H A;  3HFN A;  3HXV A;  4E6R A;  5E3I A;  1TU0 B;  1FXX A;  1VQO Q;  3MCA B;  1VIF A;  2RQT A;  3MPU B;  1WNL A;  1WYX A;  4HXJ A;  2QQS A;  2RI5 A;  4YRT A;  4J7F A;  2ZT8 A;  4LUD A;  3TEH A;  4PK4 A;  2DTO A;  2F1L A;  5LJ3 d;  2JVV A;  3HFZ A;  2YRD A;  2KNB B;  3CCR A;  4TVR A;  2BE7 D;  3I35 A;  4KT0 E;  2K2M A;  2XID A;  4YYE A;  5GAO m;  5KCH A;  5LJ5 e;  5FWB A;  4UP7 A;  2AK5 A;  1YIT T;  2LC4 A;  5CKH A;  3I56 Q;  3UH0 A;  2R58 A;  3NTK A;  2ZIN A;  2VB6 A;  2VGN A;  3UT1 A;  2HCK A;  2RK2 A;  1JO8 A;  2GBQ A;  2B86 A;  3REA B;  4C8Q F;  3QO5 A;  3CXC S;  3CXC P;  1FMV A;  5LJ5 h;  1RAD B;  2CZ0 B;  1G2B A;  2K2V A;  4P75 A;  4HT8 A;  1ZSZ A;  3PZC A;  4P71 A;  4C5I A;  4RCB A;  1VQ6 A;  4YRQ A;  3R6O A;  1CKB A;  1BCO A;  4IUU A;  3OS2 A;  2JOY A;  1SRM A;  3CBO A;  5I2M A;  4A4F A;  1PG5 B;  1EVK A;  3GPL A;  4PJL A;  4PJO A;  4LNP A;  4M78 G;  5IH2 A;  2ARU A;  3GNG A;  1M1F A;  2ED0 A;  5IHI A;  1M1K R;  2ZPI B;  5GAM h;  1NEG A;  1WHM A;  2EYX A;  4IKF A;  1ZUU A;  1T0H A;  2ENM A;  2ZIM A;  2KK4 A;  2EJG A;  5GJW B;  1KIK A;  2E6Z A;  1UFF A;  4H2W A;  5GAN 5;  3JCM P;  2AZV A;  4EMK B;  4WJ3 M;  2CGH A;  4D6W A;  4XU1 A;  1SG5 A;  2NUT B;  1QQJ A;  2KR3 A;  1RI0 A;  3MEW A;  3KFU A;  4JUV A;  1G3W A;  4M75 B;  4Y91 A;  2K3X A;  5ELN A;  2DX1 A;  3QJ6 A;  2CH4 A;  3DB4 A;  3HTZ A;  2J05 A;  4HCK A;  2BKD N;  2FG0 A;  1WLP B;  4PJN A;  4ATO A;  4OB0 B;  2R5A A;  4FYY B;  2ZR3 A;  3DSQ A;  1AZG B;  1QKX A;  1SEM A;  1KQS A;  4RTY A;  4AFS C;  2LT1 A;  9ATC B;  1PWT A;  3BFM A;  1Q81 R;  3CMA T;  2DYB A;  3VS7 A;  1TTH B;  2Y4X A;  3DB3 A;  1QVG A;  1JU5 C;  1VYU A;  2C0O A;  3U23 A;  2DD5 A;  4PJO E;  2ZT5 A;  2KE9 A;  3VYG A;  2NWM A;  4M77 E;  2DM1 A;  3TRE A;  5GAO l;  1U5S A;  3RKY A;  2NS6 A;  4M77 D;  1G5H A;  5ELO A;  1UGQ B;  4HVC A;  3CPF A;  4XK8 E;  2L8D A;  1B70 A;  1PYS B;  5J26 A;  4FYV B;  3TEE A;  2ROL A;  5GAN 3;  1VQ8 A;  3BW1 A;  3D7S B;  2R57 A;  5GAN 8;  3A31 A;  3QWX X;  5EC7 A;  2E41 A;  5D6Y A;  4P74 A;  5GAM d;  2JMC A;  2EYW A;  1EVL A;  1W6X A;  1X2Q A;  2V8J A;  1NJ5 A;  2JXB A;  2LQW A;  3MP1 A;  2XK0 A;  2ROT A;  3HRK A;  3M4P A;  1M30 A;  2M0Y A;  2JS0 A;  3KXT A;  1USY C;  2MOX A;  4OMO A;  2P4T A;  2RHQ A;  3OW2 A;  2X4Y A;  2MI6 A;  1NJI U;  2I4M A;  2WAC A;  3PGG A;  4UP8 A;  1BIA A;  5GAN g;  4KGX B;  4EMH A;  4FW2 A;  4RTU A;  2ARS A;  3VS5 A;  4IIM A;  2QQ9 A;  1B3Q A;  3VS0 A;  4H2X B;  2YUP A;  4J9I A;  3I5R A;  5GMK j;  1QVG P;  1VQ5 A;  4TTV A;  1K4U S;  1I8F A;  3H0I A;  5KYU B;  3HFV A;  1KC8 C;  1YJ9 T;  3EGD A;  3PT9 A;  3V7C A;  1LJO A;  1AOJ A;  4KBM B;  1C1A A;  1KK7 A;  1D09 B;  4LD9 K;  1SF9 A;  1LOJ A;  3REB B;  3CCS T;  3EG9 B;  1RIQ A;  2EYZ A;  2A08 A;  6AT1 B;  2ZR2 A;  4RMF A;  2X4J A;  2PNI A;  3VUB A;  3RUX A;  2MK5 A;  4B6M A;  3WVD B;  1BI0 A;  4JDS A;  4YRG A;  3LH5 A;  4F7U A;  2QQR A;  2CP6 A;  4CS4 A;  2AZS A;  1B34 A;  3MHX A;  4KQE A;  3VV0 A;  1YN8 A;  5IT9 E;  1Q7Y U;  4P75 C;  3I56 A;  4JRP A;  2V26 A;  2ZIO A;  4J9D A;  3A8O B;  4BE0 A;  2YT6 A;  1V76 A;  3TSW A;  2ED1 A;  1M2V A;  5LJ5 f;  4MZT A;  4ORZ A;  3M56 A;  2AMC A;  2GFU A;  11AS A;  2KSS A;  3SWN A;  4TVY A;  2DXB A;  2V1Q A;  2LVM A;  1U1T A;  2H3J A;  4J6Y A;  3CCE Q;  3QII A;  1XQH A;  2NUP B;  3FRN A;  2GTO A;  4AT1 B;  1EX4 A;  4OGE A;  2PUO B;  3M5A A;  5IHK A;  1KQS S;  3E9I A;  4JLI A;  2COW A;  3QO8 A;  2MIO A;  1BBW A;  4RQE A;  4IUQ A;  1X6O A;  2XKO C;  1M27 C;  4D8K A;  2CYZ B;  4XAX B;  3M0R A;  4PFP A;  4A53 A;  2YRC A;  1SSF A;  1VQM T;  3CMA A;  2RI2 A;  4H2S A;  2BIV A;  1PRM C;  4H2X A;  2QEX Q;  1S72 Q;  2VXE A;  1QKW A;  3QKJ A;  3JCM h;  4OMP A;  3C95 A;  1VQZ A;  2IY5 B;  3OYL A;  3A98 A;  2XMF A;  1I5O B;  1Y71 A;  3L2U A;  1LYL A;  3QG1 A;  2EJF A;  3OYN A;  1H4S A;  2GFA A;  5LJ3 h;  4J15 A;  1XNI A;  3G7Z A;  2X3X D;  4YTL A;  3EG3 A;  2ZTG A;  2RHI A;  4M7D C;  2CRE A;  3M0P A;  1KC8 U;  2RF0 A;  2DTI A;  4HWT A;  3QYG B;  2JTF A;  1ZA2 B;  5L23 A;  2NUT A;  2C7I A;  1N8R C;  1H3Z A;  3CC4 T;  3CC2 T;  1I4K 1;  4Q5W A;  2DET A;  1M8V A;  2CH4 W;  4XTV A;  3RMQ A;  1NLO C;  4K88 A;  4C0F A;  4YRR A;  2E4H A;  1BBU A;  2M51 A;  2I2L A;  1ATI A;  2QK0 A;  2DA9 A;  2QAS A;  1VQ8 Q;  5K1P A;  4LXC A;  2JNG A;  2YWW A;  2CT3 A;  5CCA A;  2X51 A;  4R55 A;  4ZIB A;  1K8A R;  2MCN A;  4P71 C;  1BBZ A;  4XU2 A;  4TVA B;  1Q95 G;  5IN1 A;  4C92 F;  2ZZD A;  1VQ6 T;  1VQK Q;  2H8H A;  5CK9 A;  3X24 B;  4Z02 A;  1YIJ Q;  2DIQ A;  2JW4 A;  3FEO A;  3JCM J;  3S3M A;  4RTX A;  8ATC B;  2CJ9 A;  3HY0 A;  4CRI A;  5KYX A;  3HRI A;  2GTJ A;  1PHT A;  3A1P A;  2QA4 Q;  1HK9 A;  1E22 A;  5GAN 2;  2QAZ A;  3P8B B;  3OA6 A;  2M02 A;  3QO7 A;  1AWJ A;  4M4Z A;  1VQN A;  3S6W A;  1G8X A;  1MV3 A;  3BDU A;  1SPK A;  2J6O A;  3CCM Q;  3MKD A;  4XTX A;  1K8A C;  1QP3 A;  1PYS A;  4OB1 B;  5AT1 B;  2FL7 A;  2E10 A;  4L59 A;  4C8Q B;  1W2B P;  2RPN A;  1IB8 A;  3T9N A;  1NYR A;  2VV5 A;  4J9B A;  1ADJ A;  3UF4 A;  3RDV A;  4EMK C;  2AT1 B;  2O4X A;  2BUD A;  1RLP C;  4ELZ C;  2NUP A;  1LCK A;  1X56 A;  3PMI A;  4QQG A;  2XDB A;  1VQ9 A;  3UGQ A;  1NYF A;  3MEY A;  2K5F A;  2O9S A;  4AFZ C;  3VYH B;  3CCQ A;  4PJO C;  1SRY A;  2ODR D;  3IKM B;  1QW1 A;  4BWA A;  1KD1 R;  2DL4 A;  3QYH B;  3TSZ A;  1RAA B;  2DXC A;  4LDW A;  3EGX A;  2ZZF A;  1NYG A;  3CC7 T;  5F5W A;  1V29 B;  1FYF A;  1YJW A;  2K6D A;  3JB9 H;  2DU5 A;  3H0F A;  3M57 A;  5FU6 C;  5J3B A;  3O5Z A;  1NM7 A;  4C0G A;  1ARK A;  1KSW A;  4DEY A;  3GOX A;  5HKC A;  1VQ6 Q;  4N0A A;  2LCS A;  3P8Y A;  3C4S A;  5CIU A;  5A0L A;  3A5Y A;  1Z7M A;  2RQV A;  2EIF A;  1Q7Y C;  2Q7G A;  2ZNJ A;  1H4T A;  4EO4 A;  2DBM A;  3CD6 A;  1D0Z A;  2COZ A;  1EOV A;  4CH5 A;  2RJC A;  3MQZ A;  3TCJ A;  3FC3 A;  3OYH A;  4Q6G A;  2ATC B;  2XTI A;  3I55 A;  3M59 A;  4AFU C;  2CDT A;  4C92 G;  1JJ2 P;  1ZUK A;  2O31 A;  2KYM A;  1OZ3 A;  2XDP A;  2BE9 B;  3OS5 A;  4BDY A;  1WLE A;  2JM8 A;  1M3B A;  3ASK A;  2DZC A;  4RQF A;  5FLX E;  1UGR B;  4QQ6 A;  2DER A;  4RUG A;  1WX6 A;  3TU4 K;  1PKS A;  4QVZ A;  3C94 A;  1VQO A;  3G6E A;  1VYT A;  1VOM A;  3QZ9 B;  3CCM T;  1C0M A;  3EG0 A;  1HC7 A;  4KH0 B;  1WHJ A;  2ZPH B;  3OB9 A;  2JTM A;  2PTK A;  5CAI A;  4YRJ A;  4HCC A;  3PFS A;  1SES A;  1FMK A;  3V7S A;  4MZP A;  2E1H A;  2DZ9 A;  5ECA A;  5GAN d;  2EPD A;  2RHS B;  1UDL A;  2SEM A;  2DK3 A;  2DPP B;  2H3E B;  2QA4 A;  2KVQ G;  3HL8 A;  3V8J A;  4BI8 B;  4CC3 A;  1ASY A;  5D7U A;  5FRN A;  2HNI A;  4P73 A;  2J6F A;  1AHJ B;  3JB9 F;  2RD1 A;  1JXM A;  3CME A;  2XU8 A;  5DLQ E;  4PHC A;  2IY5 A;  4LDX A;  1VQK A;  2K9G A;  4DOW A;  5GMK l;  2HSP A;  3X26 B;  4ZGE B;  1YIT Q;  2KYB A;  1M1K C;  3X25 B;  2OX7 A;  3V8K A;  2IPO B;  4XU3 A;  4TVA A;  4JPB W;  1RAF B;  4C8Q C;  4H2V A;  2DAQ A;  5GAM g;  2K79 A;  2PVG B;  4LNS A;  1VQM A;  2DIG A;  3BJU A;  2KDS A;  1VQN T;  1U8R A;  2X4X A;  2HL5 C;  3CCJ Q;  1BI1 A;  2F69 A;  2AMC B;  3A8G B;  2ZPB B;  3MEV A;  4PJO F;  5C0M A;  2HD0 A;  2OTJ T;  4CH3 A;  1ZHI A;  1EIF A;  1IHW A;  4OB3 B;  1ZBJ A;  4BB7 A;  4J6X A;  4HT9 A;  2FO0 A;  1BI3 A;  3SHW A;  2D8J A;  2DDZ A;  1WHH A;  1J3T A;  1KMN A;  2CKK A;  2NLU A;  3UA6 A;  2RNA A;  4CC7 A;  1BI2 A;  1E6H A;  2OJ2 A;  3QO3 A;  2DLP A;  1GCP A;  3MEA A;  4P3P A;  2JMA A;  4ZTF A;  1UB4 A;  1PC0 A;  5HGQ A;  3LGF A;  4KUD K;  4E7J A;  4JS5 A;  4BI3 A;  1BIB A;  3CCL T;  5CVI A;  4CI0 C;  4P72 A;  3EHR A;  3ME9 A;  3NEM A;  1Z9Z A;  2PVD B;  4WCI A;  2HEQ A;  1B8A A;  1WGS A;  3S3N A;  4M7D E;  1DJ7 B;  3JB9 G;  1RI9 A;  1KMM A;  2QA4 T;  2JJ9 A;  2RQW A;  3CCS A;  4YP0 A;  3I9Q A;  5GAN e;  1OPL A;  1J5W A;  1UEC A;  3H8Z A;  4RG2 A;  1QVG S;  2GNC A;  3W3S A;  3REU A;  1X43 A;  5D6X A;  1EFW A;  2CP5 A;  2P0Q A;  1KQ2 A;  2SRC A;  2ZT6 A;  4NS5 A;  4XQ3 A;  3HXZ A;  4E7H A;  4LDV A;  4FCY A;  1BCM A;  1EIY A;  2G3R A;  2LX7 A;  1NPP A;  1IHV A;  4PJO B;  3WXM B;  3G1J A;  1KD1 C;  4E7Z A;  4YCV A;  4F7U B;  2LQN A;  4EIK A;  5GAN j;  2JZ2 A;  2OAW A;  5LJ3 j;  1U06 A;  2J06 A;  4QQD A;  4JJD A;  1V1C A;  3VS1 A;  1B70 B;  4YRO A;  3SWN C;  1ABQ A;  3NMZ C;  1G51 A;  2JUF A;  1PM3 A;  4C0D B;  2YUO A;  2DEQ A;  3DLM A;  5FU6 B;  1YIJ T;  4C8Q G;  2DL8 A;  1UEB A;  2DJZ A;  4Z88 A;  4ELY C;  3R07 A;  5KH6 A;  4C8Q D;  4UC4 A;  2KEA A;  2LQK A;  4RG8 A;  4DEX A;  2DBK A;  4QW2 A;  5KYW A;  3HKS A;  5CQX A;  4Y92 A;  3M0T A;  2Q5H A;  4TVW A;  1WDX A;  1AWO A;  4MML A;  2EKH A;  1X6B A;  1N9R A;  1YIJ A;  1O9S A;  5IXF A;  3OQ5 A;  3GIB A;  4M77 F;  1GFD A;  4PKC C;  1Q81 C;  2CZ1 B;  3CCU A;  3ERR A;  3OMG A;  1NPR A;  2EVR A;  4EPC A;  1W70 A;  4RMO A;  3HP9 A;  1MMG A;  2RB6 A;  2E3I A;  1PSE A;  2RHX A;  4YRC A;  4DBF A;  4BW9 A;  1H4Q A;  4QT7 A;  1NJ8 A;  3RF1 A;  5GJV B;  2QTX A;  1N9S A;  1VQ9 T;  4M7A C;  2GCX A;  1UGP B;  5LJ3 e;  2EKO A;  1M5Q 1;  2QG9 B;  2E64 A;  4GLK A;  4R56 A;  1LVK A;  1KD1 U;  3G1Z A;  5I2S A;  1ZQ1 A;  3EG1 A;  3BDL A;  2P84 A;  1WXT A;  3UFG A;  5C53 B;  4R0K A;  3MET A;  3HXU A;  5CKE A;  1VQ7 T;  2DJQ A;  4H2U A;  2DVJ A;  3P8D A;  4KGV B;  3OYJ A;  2QGG A;  2DVE A;  1GFC A;  2FYK A;  1UGS B;  2DD4 A;  3E19 A;  4C8Q A;  1TWB A;  4OML A;  3OYG A;  2YRV A;  2DQ3 A;  1TXQ A;  2VYT A;  3URG A;  4FW1 A;  1SHG A;  3HFZ B;  1FMW A;  2O4X B;  2LMJ A;  3MP8 A;  3F70 A;  4OMQ A;  4G84 A;  2RJF A;  2PVO B;  3VS2 A;  2KRM A;  4HA8 A;  3HRU A;  2OTL A;  3KUF A;  1TS9 A;  1MMN A;  2M9U A;  2CUB A;  1ZSG A;  2O9V A;  2P5I A;  1RLQ C;  3PIP A;  1VUB A;  2F5T X;  1T0J A;  2E5K A;  4HKE A;  5GAO n;  4VUB A;  5L8R E;  1GXI E;  1MHN A;  3CMA Q;  3OYA A;  3OS0 A;  5CKB A;  4II1 A;  1YWO A;  2QEX T;  4J83 A;  1S72 T;  3RNJ A;  5FWC A;  2K3Y A;  5LJ3 g;  4X9D A;  2AKK A;  2LJ3 A;  3REX A;  4M78 B;  4OMN A;  1WZO A;  1VQP Q;  3OYI A;  2C0T A;  2A0F B;  2E5A A;  1WIE A;  1X2G A;  3UWN A;  1M8M A;  2P4R A;  2DRK A;  1O75 A;  1YFN A;  2OTJ A;  3LW5 E;  3M0S A;  3L2Q A;  4JLG A;  1IGQ A;  5HY6 A;  3CC2 A;  3LH0 A;  3CC4 A;  2OTJ Q;  2LX9 A;  4F04 B;  3J7A F;  1Z9Q A;  2HBP A;  4YRS A;  2CP3 A;  3Q1J A;  3RMS A;  4DA4 A;  3A7R A;  2LRQ A;  3OYB A;  4AG1 C;  1WPY A;  1SRL A;  3JCM W;  2AIR B;  1UJ0 A;  4XTY A;  4Y28 E;  4LVL A;  4M7D F;  2QXF A;  4N4H A;  1W66 A;  1KJW A;  4LVM A;  1M2V B;  5CQY A;  3LGL A;  3KBG A;  1ZLM A;  2HBW A;  4MDW A;  4OVA A;  2BZY A;  1ZUY A;  3VKI A;  2NYS A;  2MWO A;  1VQ7 A;  1T3S A;  5I22 A;  4JZ3 A;  2K5I A;  2HQX A;  4M7A B;  2QQB A;  1U1S A;  2V1R A;  2RHZ A;  3GP8 A;  2JT4 A;  1T3L A;  3M58 A;  2L3R A;  1UG1 A;  2DFU A;  1HXD A;  5GAN f;  3CPW A;  1VQL Q;  2L2P A;  1IL2 A;  4WTO B;  4K11 A;  3L42 A;  3VRY A;  4O2D A;  1KC8 R;  1NG2 A;  1B07 A;  1TUD A;  2IG0 A;  4LVK A;  3AHU A;  1UUE A;  3KFV A;  2FB7 A;  5GAO p;  1NBE B;  2L3Q A;  2E65 A;  5AYF A;  3IKL A;  3VU3 C;  2LTO A;  3IG2 A;  4PFZ A;  3CCL Q;  1H8K A;  3H41 A;  4C92 D;  4QVC A;  1H4V B;  4JRK A;  3NHN A;  1IRE B;  3CCR Q;  2GQI A;  2XIC A;  2YLC A;  1YP5 A;  1K9M C;  1EFN A;  5IHN A;  2ZPF B;  4LE9 A;  4HVU A;  5DY9 A;  3GLX A;  1OX9 A;  1ZSZ B;  3PCO A;  1ZSZ C;  3NTI A;  2MAM A;  2PUK B;  3THK A;  4BY6 B;  4OMM A;  2CP0 A;  1K0S A;  1OYX A;  2VAS A;  4MMK A;  4P3N A;  1X75 C;  2JTE A;  2HZY A;  1ACM B;  1JJC B;  3JCM f;  1K9M R;  1YIT A;  1I81 A;  3LYI A;  2OTL T;  1NJ2 A;  4OB2 B;  1WA7 A;  1WU7 A;  1OX8 A;  2RMO A;  3GF5 A;  5LJ5 j;  4BE1 A;  3MP6 A;  5GAM f;  1YWP A;  5CKD A;  3L1A A;  3JCM b;  1I07 A;  5GAO r;  1JB0 E;  1Q86 U;  4F7U E;  1Y57 A;  3A7U A;  3MF2 A;  1YCS B;  4M7A E;  4H2Y A;  1X6G A;  2J6K A;  1NEB A;  4ZN1 A;  1M3A A;  2KRN A;  3IQL A;  3PMT A;  2YDL A;  4HWO A;  4RCC A;  4C92 A;  1WJQ A;  4FU6 A;  1K73 U;  1YJ9 Q;  3OSV A;  3DLL A;  2ZPE B;  3G4S Q;  3VS3 A;  1BB9 A;  3JCM e;  4J9E A;  3HFO A;  1NJI C;  1X01 A;  5KYU A;  4M7D D;  5GMK i;  1PRL C;  2XDD A;  2KI7 A;  2EW3 A;  3M4G A;  1N27 A;  1E6G A;  4PNO A;  1OOT A;  1QWE A;  1K8A U;  4ZNX A;  4FT4 A;  1G5I A;  4H2T A;  1BU1 A;  5GAM e;  4JRI A;  3LSQ A;  2O2O A;  4X5O A;  1R8O B;  3CCU T;  2RM4 A;  4BE2 A;  4M7D B;  2L89 A;  3CCL A;  1LPL A;  1VA7 A;  2RQU A;  2VXF A;  2ZGW A;  3E9G A;  4M75 E;  1NE8 A;  2RI3 A;  2R5M A;  3QNE A;  1M1K U;  3JB9 D;  4XTW A;  2VC8 A;  3EGU A;  4E7I A;  2ART A;  1MMD A;  1YI2 A;  2V8I A;  1QCO A;  4YCW A;  1YJN Q;  3O8V A;  2RO0 A;  4DBR A;  5KNN A;  3UPU A;  2EGC A;  3QDR B;  4HVV A;  4PJO D;  2QTV A;  1QLY A;  2EQK A;  1MV0 B;  4M78 C;  2CS7 A;  2ZZE A;  2DO3 A;  5FW9 A;  1AWX A;  2ZCE A;  2LNH B;  4OF1 A;  4C5G A;  1M4Z A;  4J5Y A;  4QKU A;  3CPW S;  1VQ7 Q;  1YHQ T;  1I0C A;  4C92 B;  4EX5 A;  4OP0 A;  2VKN A;  5I21 A;  3SFM A;  3HXY A;  2YUN A;  3V7R A;  1Y7X A;  4JZ4 A;  4P74 C;  1TG0 A;  4ZTU B;  4JS4 A;  4HVW A;  5DLO A;  2P0L A;  4M78 A;  3PIO A;  4PJO G;  2KY9 A;  5FRO A;  3LWI A;  1YFS A;  3OYM A;  3A8M B;  3OBY A;  4BD3 A;  4ANJ A;  2D0Q B;  3V8L A;  3CME T;  3E2U A;  1N9W A;  2L3S A;  1OU9 A;  1GBQ A;  1PNJ A;  4OMF B;  2AHJ B;  1HSQ A;  3VQX A;  2KRS A;  1D0X A;  2ABL A;  1E1O A;  2K3B A;  1K73 R;  1CSK A;  2DYI A;  3E9H A;  1Y96 A;  4A63 B;  4PJM A;  3UGT A;  2IIM A;  1KOG A;  3ULR B;  2EBP A;  2HAX A;  2X3W D;  1W2B A;  2CIM A;  4IIO A;  2ODR C;  4IUP A;  2X35 A;  1QCN A;  3G4S A;  3EFO A;  3CCM A;  4HWP A;  1WJS A;  1D0Y A;  3EG9 A;  3G6E T;  3VRZ A;  3TQ7 P;  2K4Y A;  3RES A;  2GF7 A;  4CS3 A;  1KHI A;  2XD0 A;  1MGQ A;  3G4S T;  1G5V A;  4EMK A;  1XOV A;  1RUW A;  1VQ4 A;  1M90 U;  3VJP A;  3M54 A;  4KRT A;  2A7Y A;  1N8R U;  4FM4 B;  2BTT A;  5IAY A;  2OTL Q;  4TQF A;  2WSC E;  1TSF A;  3CC7 Q;  1U3O A;  3CCE T;  4NOY A;  2D8H A;  4X1V A;  3I55 T;  5HK0 A;  3CBP A;  2NUZ A;  3N5B B;  4YRP A;  2DU7 A;  4GBQ A;  3HPW A;  2HQH A;  3CMQ A;  3CD6 T;  1ASZ A;  3FJP A;  4TQD A;  1PD0 A;  2OAU A;  1YBY A;  3EG2 A;  3NFC A;  1Q7Y R;  1RAI B;  1L0W A;  4ZTJ A;  1QF6 A;  4PJJ A;  1N6A A;  2FZK B;  1R0B G;  3GBQ A;  3CXC A;  3LLR A;  1B7T A;  2I0N A;  2YXY A;  2RJD A;  1YI2 T;  4O5V A;  1TH7 A;  1M1G A;  2MPX C;  3HXX A;  4M78 D;  4J9C A;  2F2W A;  1EZZ B;  1UHF A;  1YJW T;  1B34 B;  1AWW A;  3JCM d;  3FIF A;  5LJ5 g;  4TWA A;  3AT1 B;  1OV3 A;  2QDL A;  1B76 A;  4YDQ A;  2KGT A;  3I5S A;  1EQR A;  3EFO B;  3TUP A;  2CP7 A;  5DM7 R;  4L5G A;  2LZ6 B;  1Q86 C;  4F7U F;  2DIL A;  5J39 A;  4A54 A;  3QSU A;  1UGV A;  3EH1 A;  4B9W A;  2MMP A;  4KR3 A;  1JXO A;  1W4S A;  4ZGJ B;  3UDC A;  3SEM A;  1X69 A;  3QDF A;  2QHS A;  2ECZ A;  3RBB B;  5GAO q;  1YNZ A;  1NJI R;  1CKA A;  4IUV A;  3R6N A;  2RJE A;  2FPE A;  1PKT A;  4CS2 A;  4K86 A;  3NEL A;  1YJW Q;  3RIR A;  2RA2 A;  1H64 1;  2EGE A;  3H0H A;  1R77 A;  2EFI A;  2D1X A;  4FYW B;  2ALY A;  1USY A;  4O6J A;  4M75 C;  3H6Z A;  2LJ1 A;  4BDZ A;  2I4L A;  4F7U G;  5GAN h;  1JEG A;  1GCQ C;  1SET A;  2KT1 A;  3ER0 A;  4LUE A;  2YUQ A;  4KUI A;  1GBR A;  3EFS A;  2JM9 A;  3EAE A;  4M75 F;  4YRM A;  2Q7H A;  3HRT A;  2K5L A;  1W1F A;  5GMK h;  3CCQ Q;  5A0D A;  1X2H A;  1VQ9 Q;  3CC2 Q;  2QI2 A;  3BE3 A;  3ZBD A;  2YHT A;  3M9Q A;  3MO8 A;  1PCX A;  2QQA A;  2EQM A;  5FU7 C;  3OYD A;  4C8Q E;  1QVF A;  2LP5 A;  3M55 A;  4AG2 C;  3LSS A;  4WJ4 A;  2EYY A;  2EJ9 A;  2ZZG A;  4M77 C;  3JB9 I;  1IO6 A;  1IZ6 A;  2CP2 A;  4XEO A;  3OMC A;  4PFO A;  1ZX6 A;  1AD5 A;  2KXC A;  2W10 A;  1M9S A;  1WFW A;  3HRS A;  4M78 F;  2HDA A;  1YB3 A;  1Q82 U;  2WSF E;  3RL6 A;  3P8T A;  2LQ8 A;  1D3B B;  4Q15 A;  4KH1 B;  4H02 A;  3G71 Q;  3M4Y A;  3FLG A;  2ZAE A;  2V8K A;  2HMA A;  1HJD A;  1VQ5 Q;  3NET A;  3E9F A;  4HCZ A;  4E51 A;  1D1C A;  4CH4 A;  3CCQ T;  3C0C A;  1JJC A;  4HCB A;  4C5H A;  3IAL A;  4JRQ A;  2F2V A;  2CZ7 B;  2EYQ A;  2LNV A;  1ZBX A;  2MYS A;  4LN2 A;  5KYW B;  4MDX A;  1C0A A;  12AS A;  3L4G B;  1RAE B;  1FWZ A;  3SB2 A;  3A7A A;  4XEM A;  1JBM A;  3DKM A;  3QTC A;  2KT8 A;  4FIB A;  4YPF A;  4AFQ C;  1WXB A;  2ZXF A;  2L5Q A;  4E47 A;  3JCM V;  3OSS C;  2E6N A;  2DRM A;  3CCJ A;  3PVL A;  3CBM A;  1N5Z A;  2QYZ A;  4C5E A;  3CQT A;  3VQY A;  3CCJ T;  3VS4 A;  1VQM Q;  2E3C A;  5CO7 A;  2Z0W A;  3ZL7 C;  2DL3 A;  4YRK A;  2F2X A;  1IRX A;  4MZM A;  3OS1 A;  3SD4 A;  1IGU A;  3M53 A;  3VS6 A;  1OI1 A;  1MMA A;  4NL2 A;  4P3O A;  3X20 B;  2J3L A;  4LDY A;  4LVI A;  3CCU Q;  2Y90 A;  4N4G A;  1RL2 A;  3JCM c;  4BI4 A;  4M75 G;  2VVK A;  4J8O A;  3RKW A;  3M0Q A;  2AKW B;  5K1X A;  3CPW P;  2P0K A;  3L2R A;  2KMT A;  3CME Q;  3A5Z B;  1D3B A;  3HXW A;  5GMK e;  4YRN A;  3FDR A;  4DQ2 A;  4M75 D;  2K7A A;  2I4N A;  2RHY A;  1QP2 A;  1OQK A;  3PTA A;  3QXE B;  2ALY B;  1JRI A;  5A2Q E;  3INZ A;  2QEX A;  1S72 A;  3L2W A;  4M7D A;  4ZGD B;  1VQL T;  5C6S A;  4LVJ A;  4DBQ A;  2EAY A;  3EGX B;  3FB9 A;  2X9H A;  3I56 T;  2MWP A;  3NPF A;  1WQ7 A;  2AKL A;  1G83 A;  3JSC A;  4ZTZ B;  5EG2 A;  2Q7E A;  2ZPG B;  4A4H A;  2FPF A;  1Q82 C;  1D1A A;  2W0Z A;  4CC4 B;  2KQW A;  3PE0 A;  4KGZ B;  2DEU A;  3HTR A;  1D1B A;  3CCV T;  1Y0M A;  5C52 B;  2C8M A;  1BKB A;  1HD3 A;  1OPK A;  4KUL A;  2DTH A; 
#chains in the Genus database with same CATH homology
 3QJY A;  4HWR A;  4N0A C;  4NCX A;  3RGL A;  2JN0 A;  4M7A D;  1ADY A;  1XTD A;  2IVW A;  3MF1 A;  3CEY A;  1WYD A;  2RHS A;  1VQ5 T;  5GAM j;  2MF2 A;  4N4I A;  4LDU A;  4PG3 A;  3OYF A;  2XGT A;  2EL9 A;  4ZN3 A;  4DOV A;  3A5Z A;  2F5K A;  5C51 B;  5GAN 7;  1G3T A;  1SER A;  3ZFJ A;  2E5Q A;  2Q5I A;  4HT4 A;  2PU9 B;  4BY6 C;  1NJ6 A;  2RH2 A;  4ME7 A;  4BUG A;  3VQW A;  3P8H A;  4BAC A;  4P73 C;  5A0G A;  2Y4Y A;  1HTT A;  4G85 A;  1OZ2 A;  4J7I A;  1VQ8 T;  3PNW C;  1YJN A;  1G3Y A;  4L6V 5;  3A8H B;  1NZ9 A;  4J6W A;  3OW2 S;  4V2S A;  4AH6 A;  4A4G A;  2VUB A;  4YCU A;  5GAN 4;  1BYM A;  1QE0 A;  2LCC A;  1Z7N A;  4E7L A;  2QDY B;  5LJ5 d;  4C92 C;  3JCM g;  1FX7 A;  4M7A F;  4GY5 A;  2LCL A;  1GGM A;  4UPA A;  1K9M U;  1X54 A;  1YJN T;  5GAN 6;  4A4K A;  1G3S A;  2PQW A;  1YJ9 A;  2RHU A;  1KG1 A;  3OY9 A;  1PSF A;  4KR2 A;  1WQW A;  4PLL A;  3A32 A;  4M77 B;  3JCM Q;  3PCO B;  5CR2 A;  3M4Q A;  5KE2 A;  1Y07 A;  4A4E A;  2ZT7 A;  2D9T A;  1Q81 U;  2E12 A;  1VQ4 T;  5KCO A;  1VQP T;  1NYQ A;  4QVD A;  4M7D G;  1K73 C;  4L87 A;  3LWH A;  4YRE A;  2EQU A;  3OYY A;  2A3L A;  2DXU A;  3NTH A;  1JJ2 S;  4IUR A;  2ZCF B;  5HK3 A;  3RAC A;  4K87 A;  3SDZ A;  2A8E A;  3EFR A;  2GQV A;  4M75 A;  1EIY B;  1KQ1 A;  4X9C A;  2J3M A;  5FU7 B;  3WQZ A;  2WSE E;  3CCV A;  4PL6 A;  2PME A;  4JJN K;  1YFR A;  3HY1 A;  2K57 A;  4M77 A;  5D6W A;  2LT4 A;  3VUZ A;  3G71 T;  1VQL A;  3VQV A;  1W2B S;  2X4W A;  4FSX A;  1WJR A;  3G71 A;  2LDM A;  3CCR T;  3L2V A;  4DPG A;  2XHC A;  3C12 A;  1QVP A;  1YHQ A;  2CJA A;  4CH6 A;  3OYC A;  4EDU A;  1E1T A;  4M7A G;  3OYK A;  1X55 A;  1I5L A;  1E24 A;  5LL6 S;  3L2Z A;  3CCE A;  5CKF A;  2G4C A;  4M7A A;  1VIE A;  1YCY A;  3QBY A;  2RK1 A;  2YLB A;  4UP9 A;  3LX7 A;  2EQJ A;  2XG8 D;  4YRL A;  3NEN A;  1P92 A;  3OBW A;  2M0O A;  3JRZ A;  1VQK T;  1B7Y B;  3QHS A;  3HSB A;  3RER A;  3VBB A;  4M77 G;  3ICA A;  5GMK m;  4EMG A;  2QHV A;  2QHU A;  1VQP A;  4PLI A;  3WVE B;  2CJB A;  3L4G A;  3OD1 A;  2XI9 A;  4E7K A;  4NL3 A;  1NJ1 A;  2D6F A;  3JCM X;  4B9X A;  5KE3 A;  4FT2 A;  4OGC A;  3TEG A;  2DQ0 A;  1YGB A;  3A74 A;  1Y96 B;  3J81 E;  4FL6 A;  3JAM E;  3I7F A;  2C06 A;  4HWS A;  1VQO T;  2PMF A;  4X34 A;  5LJ3 f;  3SWN B;  3J80 E;  2ZNI A;  3ZEH A;  2VGM A;  1KHC A;  1M90 C;  5FRM A;  3RKX A;  3BY7 A;  2QHT A;  4M78 E;  2E70 A;  3QUI A;  4YRI A;  4C92 E;  2AKW A;  2I4O A;  1LNX A;  4LD6 A;  4IUT A;  4YRF A;  4P72 C;  4RDX A;  1NNH A;  3TEH B;  2CZ6 B;  1JJ2 A;  3LC0 A;  5M9O A;  1YFT A;  3MEU A;  3QZ5 B;  2EWN A;  4C0Z A;  2FHD A;  2DXT A;  4C0D C;  2M16 A;  3GNF B;  3QPH A;  2B8A A;  1B7Y A;  4OLF A;  3OYE A;  2O01 E;  2DKG A;  3JB9 J;  4RKU E;  3X28 B;  2P0P A;  1QVF S;  3CC7 A;  4XTU A;  3E1S A;  4WI1 A;  2HQE A;  2KAF A;  3HHT B;  4WF2 A;  3A8L B;  2FVU A;  4XTZ A;  4P5N A;  2RHQ B;  3S3O A;  3P8V A;  4XU0 A;  2M1H A;  3HFN A;  3HXV A;  5E3I A;  1FXX A;  3MCA B;  1VIF A;  1WNL A;  2QQS A;  2RI5 A;  4YRT A;  4J7F A;  2ZT8 A;  3TEH A;  2DTO A;  5LJ3 d;  2JVV A;  3HFZ A;  3CCR A;  4TVR A;  4KT0 E;  2XID A;  4YYE A;  5GAO m;  5KCH A;  5LJ5 e;  4UP7 A;  1YIT T;  2LC4 A;  5CKH A;  3UH0 A;  2R58 A;  3NTK A;  2ZIN A;  2VGN A;  3UT1 A;  2RK2 A;  4C8Q F;  3QO5 A;  3CXC S;  5LJ5 h;  2CZ0 B;  2K2V A;  4P75 A;  4HT8 A;  3PZC A;  4P71 A;  4C5I A;  4RCB A;  1VQ6 A;  4YRQ A;  3R6O A;  4IUU A;  3OS2 A;  2JOY A;  3CBO A;  5I2M A;  4A4F A;  1EVK A;  3GPL A;  4PJO A;  4M78 G;  2ARU A;  3GNG A;  1M1F A;  2ZPI B;  5GAM h;  4IKF A;  2ZIM A;  2KK4 A;  2EJG A;  2E6Z A;  4H2W A;  5GAN 5;  3JCM P;  4WJ3 M;  4EMK B;  2CGH A;  4D6W A;  4XU1 A;  1RI0 A;  3MEW A;  3KFU A;  4JUV A;  1G3W A;  4M75 B;  4Y91 A;  2K3X A;  5ELN A;  3QJ6 A;  3DB4 A;  3HTZ A;  2BKD N;  4ATO A;  4OB0 B;  2R5A A;  2ZR3 A;  3DSQ A;  1KQS A;  2LT1 A;  3BFM A;  3CMA T;  2Y4X A;  3DB3 A;  1QVG A;  2ZT5 A;  2DD5 A;  4PJO E;  3VYG A;  4M77 E;  3TRE A;  5GAO l;  3RKY A;  2NS6 A;  4M77 D;  1G5H A;  5ELO A;  1UGQ B;  4HVC A;  3CPF A;  4XK8 E;  2L8D A;  1B70 A;  1PYS B;  5J26 A;  3TEE A;  5GAN 3;  1VQ8 A;  3BW1 A;  2R57 A;  5GAN 8;  3A31 A;  2E41 A;  5D6Y A;  4P74 A;  5GAM d;  1EVL A;  2V8J A;  1NJ5 A;  3MP1 A;  2XK0 A;  3HRK A;  3M4P A;  3KXT A;  1USY C;  2P4T A;  2RHQ A;  3OW2 A;  2X4Y A;  2MI6 A;  1NJI U;  2I4M A;  2WAC A;  3PGG A;  4UP8 A;  1BIA A;  5GAN g;  4EMH A;  2ARS A;  2QQ9 A;  4H2X B;  5GMK j;  4TTV A;  1VQ5 A;  1I8F A;  3HFV A;  1KC8 C;  1YJ9 T;  3PT9 A;  3V7C A;  1LJO A;  4KBM B;  4LD9 K;  1LOJ A;  3CCS T;  1RIQ A;  2ZR2 A;  4RMF A;  2X4J A;  3VUB A;  3RUX A;  3WVD B;  1BI0 A;  4JDS A;  4YRG A;  4F7U A;  2QQR A;  4CS4 A;  1B34 A;  3MHX A;  4KQE A;  3VV0 A;  5IT9 E;  1Q7Y U;  4P75 C;  3I56 A;  4JRP A;  2ZIO A;  3A8O B;  4BE0 A;  5LJ5 f;  4MZT A;  3M56 A;  2AMC A;  2GFU A;  11AS A;  2KSS A;  3SWN A;  4TVY A;  2DXB A;  2LVM A;  1U1T A;  2H3J A;  4J6Y A;  3QII A;  1XQH A;  3FRN A;  4OGE A;  2PUO B;  3M5A A;  1KQS S;  3E9I A;  4JLI A;  3QO8 A;  1BBW A;  4RQE A;  4IUQ A;  1X6O A;  2XKO C;  2CYZ B;  4XAX B;  4A53 A;  1SSF A;  1VQM T;  3CMA A;  2RI2 A;  4H2S A;  2BIV A;  4H2X A;  2VXE A;  3QKJ A;  3JCM h;  3C95 A;  1VQZ A;  2IY5 B;  3OYL A;  1Y71 A;  3L2U A;  1LYL A;  3QG1 A;  2EJF A;  3OYN A;  1H4S A;  2GFA A;  5LJ3 h;  4J15 A;  1XNI A;  3G7Z A;  4YTL A;  2ZTG A;  2RHI A;  4M7D C;  1KC8 U;  2DTI A;  4HWT A;  3QYG B;  2JTF A;  2C7I A;  1N8R C;  1H3Z A;  3CC4 T;  3CC2 T;  1I4K 1;  4Q5W A;  1M8V A;  4XTV A;  3RMQ A;  4YRR A;  4K88 A;  4C0F A;  1BBU A;  2I2L A;  1ATI A;  5K1P A;  2JNG A;  5CCA A;  4R55 A;  4ZIB A;  4P71 C;  4XU2 A;  4TVA B;  5IN1 A;  4C92 F;  2ZZD A;  1VQ6 T;  5CK9 A;  3X24 B;  4Z02 A;  2DIQ A;  3FEO A;  3JCM J;  3S3M A;  2CJ9 A;  3HY0 A;  4CRI A;  3HRI A;  1HK9 A;  1E22 A;  5GAN 2;  3P8B B;  3OA6 A;  3QO7 A;  1VQN A;  3S6W A;  3BDU A;  4XTX A;  1K8A C;  1QP3 A;  1PYS A;  4OB1 B;  2FL7 A;  2E10 A;  4L59 A;  4C8Q B;  3T9N A;  1NYR A;  2VV5 A;  1ADJ A;  4EMK C;  2O4X A;  2BUD A;  4ELZ C;  1X56 A;  3PMI A;  4QQG A;  2XDB A;  1VQ9 A;  3UGQ A;  3MEY A;  2K5F A;  3VYH B;  3CCQ A;  4PJO C;  1SRY A;  2ODR D;  3IKM B;  1QW1 A;  4BWA A;  3QYH B;  2DXC A;  4LDW A;  2ZZF A;  3CC7 T;  5F5W A;  1V29 B;  1FYF A;  1YJW A;  3JB9 H;  2DU5 A;  3M57 A;  5FU6 C;  5J3B A;  4C0G A;  3GOX A;  5HKC A;  4N0A A;  3P8Y A;  3C4S A;  5CIU A;  5A0L A;  3A5Y A;  1Z7M A;  2EIF A;  1Q7Y C;  2Q7G A;  2ZNJ A;  1H4T A;  4EO4 A;  3CD6 A;  1EOV A;  4CH5 A;  2RJC A;  3MQZ A;  3TCJ A;  3FC3 A;  3OYH A;  4Q6G A;  2XTI A;  3I55 A;  3M59 A;  4C92 G;  1OZ3 A;  2XDP A;  3OS5 A;  4BDY A;  1WLE A;  3ASK A;  2DZC A;  4RQF A;  5FLX E;  1UGR B;  4QQ6 A;  3TU4 K;  4QVZ A;  3C94 A;  1VQO A;  3G6E A;  3QZ9 B;  3CCM T;  1HC7 A;  2ZPH B;  3OB9 A;  2JTM A;  5CAI A;  4YRJ A;  4HCC A;  3PFS A;  1SES A;  3V7S A;  4MZP A;  2E1H A;  2DZ9 A;  5GAN d;  2RHS B;  2DK3 A;  2DPP B;  2QA4 A;  2KVQ G;  3HL8 A;  3V8J A;  4BI8 B;  1ASY A;  5FRN A;  2HNI A;  4P73 A;  1AHJ B;  3JB9 F;  2RD1 A;  3CME A;  2XU8 A;  5DLQ E;  4PHC A;  2IY5 A;  4LDX A;  1VQK A;  4DOW A;  5GMK l;  3X26 B;  4ZGE B;  1M1K C;  3X25 B;  3V8K A;  4XU3 A;  4TVA A;  4C8Q C;  4H2V A;  2DAQ A;  5GAM g;  2PVG B;  4LNS A;  1VQM A;  2DIG A;  3BJU A;  2KDS A;  1VQN T;  1U8R A;  2X4X A;  1BI1 A;  2F69 A;  2AMC B;  3A8G B;  2ZPB B;  3MEV A;  4PJO F;  5C0M A;  2HD0 A;  2OTJ T;  4CH3 A;  1ZHI A;  1EIF A;  4OB3 B;  4BB7 A;  4J6X A;  4HT9 A;  1BI3 A;  2DDZ A;  1KMN A;  2CKK A;  2NLU A;  1BI2 A;  3QO3 A;  3MEA A;  4P3P A;  4ZTF A;  1UB4 A;  5HGQ A;  3LGF A;  4KUD K;  4E7J A;  4JS5 A;  4BI3 A;  1BIB A;  3CCL T;  5CVI A;  4CI0 C;  4P72 A;  3ME9 A;  3NEM A;  2PVD B;  1B8A A;  1WGS A;  3S3N A;  4M7D E;  1DJ7 B;  3JB9 G;  1KMM A;  2QA4 T;  3CCS A;  4YP0 A;  5GAN e;  1J5W A;  3H8Z A;  4RG2 A;  1QVG S;  3W3S A;  3REU A;  5D6X A;  1EFW A;  2P0Q A;  1KQ2 A;  2ZT6 A;  4NS5 A;  4XQ3 A;  3HXZ A;  4E7H A;  4LDV A;  1EIY A;  2G3R A;  1NPP A;  4PJO B;  3WXM B;  1KD1 C;  4YCV A;  4F7U B;  5GAN j;  2JZ2 A;  5LJ3 j;  4QQD A;  1B70 B;  4YRO A;  3SWN C;  1G51 A;  2JUF A;  4C0D B;  2DEQ A;  3DLM A;  5FU6 B;  1YIJ T;  4C8Q G;  1UEB A;  2DJZ A;  4ELY C;  3R07 A;  5KH6 A;  4C8Q D;  4UC4 A;  2LQK A;  4RG8 A;  4QW2 A;  3HKS A;  5CQX A;  2Q5H A;  4TVW A;  4MML A;  1N9R A;  1YIJ A;  1O9S A;  3OQ5 A;  3GIB A;  4M77 F;  4PKC C;  1Q81 C;  2CZ1 B;  3CCU A;  3ERR A;  3OMG A;  1NPR A;  4EPC A;  4RMO A;  3HP9 A;  2RB6 A;  1PSE A;  2RHX A;  4YRC A;  4BW9 A;  1H4Q A;  1NJ8 A;  3RF1 A;  2QTX A;  1N9S A;  1VQ9 T;  4M7A C;  2GCX A;  1UGP B;  5LJ3 e;  2EKO A;  1M5Q 1;  4GLK A;  2E64 A;  4R56 A;  1KD1 U;  3G1Z A;  5I2S A;  1ZQ1 A;  3BDL A;  3UFG A;  5C53 B;  3MET A;  3HXU A;  5CKE A;  1VQ7 T;  4H2U A;  3P8D A;  3OYJ A;  2DVE A;  2FYK A;  1UGS B;  2DD4 A;  3E19 A;  4C8Q A;  3OYG A;  2YRV A;  2DQ3 A;  2VYT A;  3URG A;  3HFZ B;  2O4X B;  3MP8 A;  3F70 A;  4G84 A;  2RJF A;  2PVO B;  4HA8 A;  3HRU A;  2OTL A;  3KUF A;  2M9U A;  2P5I A;  3PIP A;  1VUB A;  2F5T X;  4HKE A;  5GAO n;  4VUB A;  5L8R E;  1GXI E;  1MHN A;  3OYA A;  3OS0 A;  4II1 A;  5CKB A;  2QEX T;  1S72 T;  4J83 A;  2K3Y A;  5LJ3 g;  4X9D A;  3REX A;  4M78 B;  3OYI A;  2E5A A;  1X2G A;  3UWN A;  1O75 A;  2OTJ A;  3LW5 E;  3L2Q A;  4JLG A;  5HY6 A;  3CC2 A;  3LH0 A;  3CC4 A;  2LX9 A;  3J7A F;  2HBP A;  4YRS A;  3Q1J A;  3RMS A;  4DA4 A;  3A7R A;  2LRQ A;  3OYB A;  1WPY A;  3JCM W;  4XTY A;  4Y28 E;  4LVL A;  4M7D F;  2QXF A;  1W66 A;  4N4H A;  4LVM A;  5CQY A;  3LGL A;  3KBG A;  4MDW A;  4OVA A;  3VKI A;  2MWO A;  1VQ7 A;  2K5I A;  2HQX A;  4M7A B;  2QQB A;  1U1S A;  3GP8 A;  2RHZ A;  3M58 A;  2L3R A;  1HXD A;  5GAN f;  3CPW A;  1IL2 A;  3L42 A;  4O2D A;  2IG0 A;  4LVK A;  3AHU A;  2FB7 A;  5GAO p;  2E65 A;  5AYF A;  3IKL A;  3VU3 C;  2LTO A;  3IG2 A;  4C92 D;  4QVC A;  1H4V B;  4JRK A;  1IRE B;  2XIC A;  2YLC A;  1K9M C;  2ZPF B;  5DY9 A;  3GLX A;  3PCO A;  3NTI A;  2MAM A;  2PUK B;  4BY6 B;  1OYX A;  4MMK A;  4P3N A;  1X75 C;  1JJC B;  3JCM f;  1YIT A;  1I81 A;  3LYI A;  2OTL T;  1NJ2 A;  4OB2 B;  1WU7 A;  3GF5 A;  5LJ5 j;  4BE1 A;  3MP6 A;  5GAM f;  5CKD A;  3L1A A;  3JCM b;  5GAO r;  1JB0 E;  1Q86 U;  4F7U E;  3A7U A;  3MF2 A;  4M7A E;  4H2Y A;  4ZN1 A;  3PMT A;  4HWO A;  4RCC A;  4C92 A;  1WJQ A;  4FU6 A;  1K73 U;  3OSV A;  3DLL A;  2ZPE B;  3JCM e;  3HFO A;  1NJI C;  1X01 A;  4M7D D;  5GMK i;  2XDD A;  3M4G A;  1N27 A;  4PNO A;  1K8A U;  4FT4 A;  1G5I A;  4H2T A;  5GAM e;  4JRI A;  3LSQ A;  4X5O A;  1R8O B;  3CCU T;  2RM4 A;  4BE2 A;  4M7D B;  2L89 A;  3CCL A;  3E9G A;  2VXF A;  2ZGW A;  4M75 E;  1NE8 A;  2RI3 A;  2R5M A;  3QNE A;  1M1K U;  3JB9 D;  4XTW A;  2VC8 A;  4E7I A;  2ART A;  1YI2 A;  2V8I A;  4YCW A;  3O8V A;  2RO0 A;  5KNN A;  3UPU A;  3QDR B;  4PJO D;  2EQK A;  4M78 C;  2CS7 A;  2ZZE A;  2DO3 A;  2ZCE A;  4OF1 A;  4C5G A;  1M4Z A;  4J5Y A;  3CPW S;  1YHQ T;  4C92 B;  4EX5 A;  4OP0 A;  5I21 A;  3SFM A;  3HXY A;  3V7R A;  1Y7X A;  4P74 C;  4ZTU B;  4JS4 A;  5DLO A;  2P0L A;  4M78 A;  3PIO A;  4PJO G;  2KY9 A;  5FRO A;  3LWI A;  1YFS A;  3OYM A;  3A8M B;  3OBY A;  4BD3 A;  2D0Q B;  3V8L A;  3CME T;  1N9W A;  4OMF B;  2AHJ B;  3VQX A;  1E1O A;  3E9H A;  1Y96 A;  3UGT A;  1KOG A;  2HAX A;  1W2B A;  2CIM A;  2ODR C;  4IUP A;  2X35 A;  3G4S A;  3CCM A;  4HWP A;  1WJS A;  3G6E T;  2K4Y A;  3RES A;  2GF7 A;  4CS3 A;  1KHI A;  2XD0 A;  1MGQ A;  3G4S T;  1G5V A;  4EMK A;  1XOV A;  1VQ4 A;  1M90 U;  3VJP A;  3M54 A;  2A7Y A;  1N8R U;  4FM4 B;  5IAY A;  4TQF A;  2WSC E;  3CCE T;  4NOY A;  3I55 T;  5HK0 A;  3CBP A;  3N5B B;  4YRP A;  2DU7 A;  3HPW A;  3CMQ A;  3CD6 T;  1ASZ A;  3FJP A;  4TQD A;  2OAU A;  1YBY A;  3NFC A;  1L0W A;  4ZTJ A;  1QF6 A;  1N6A A;  3CXC A;  3LLR A;  2RJD A;  1YI2 T;  4O5V A;  1TH7 A;  1M1G A;  3HXX A;  4M78 D;  1YJW T;  1B34 B;  3JCM d;  3FIF A;  5LJ5 g;  4TWA A;  1B76 A;  4YDQ A;  1EQR A;  3TUP A;  5DM7 R;  4L5G A;  1Q86 C;  4F7U F;  5J39 A;  4A54 A;  3QSU A;  4B9W A;  2MMP A;  4KR3 A;  1W4S A;  4ZGJ B;  3UDC A;  2QHS A;  5GAO q;  4IUV A;  2RJE A;  4CS2 A;  4K86 A;  3NEL A;  2RA2 A;  3RIR A;  1H64 1;  2EFI A;  2ALY A;  1USY A;  4O6J A;  4M75 C;  3H6Z A;  4BDZ A;  2I4L A;  4F7U G;  5GAN h;  1SET A;  3ER0 A;  4KUI A;  3EFS A;  3EAE A;  4M75 F;  4YRM A;  2Q7H A;  3HRT A;  2K5L A;  5GMK h;  5A0D A;  1X2H A;  2QI2 A;  3ZBD A;  2YHT A;  3M9Q A;  3MO8 A;  2QQA A;  2EQM A;  5FU7 C;  3OYD A;  4C8Q E;  1QVF A;  3M55 A;  3LSS A;  4WJ4 A;  2EJ9 A;  2ZZG A;  4M77 C;  3JB9 I;  1IZ6 A;  4XEO A;  3OMC A;  1M9S A;  3HRS A;  4M78 F;  1YB3 A;  1Q82 U;  2WSF E;  3RL6 A;  3P8T A;  2LQ8 A;  1D3B B;  4Q15 A;  4H02 A;  3M4Y A;  3FLG A;  2V8K A;  3NET A;  3E9F A;  4HCZ A;  4E51 A;  4CH4 A;  3CCQ T;  1JJC A;  4HCB A;  4C5H A;  3IAL A;  4JRQ A;  2CZ7 B;  2EYQ A;  2LNV A;  1ZBX A;  4MDX A;  1C0A A;  12AS A;  3L4G B;  1FWZ A;  3SB2 A;  3A7A A;  4XEM A;  1JBM A;  3DKM A;  3QTC A;  4FIB A;  4YPF A;  2ZXF A;  2L5Q A;  4E47 A;  3JCM V;  3OSS C;  2E6N A;  3CCJ A;  3CBM A;  4C5E A;  3VQY A;  3CCJ T;  2E3C A;  5CO7 A;  4YRK A;  4MZM A;  3OS1 A;  3SD4 A;  3M53 A;  1OI1 A;  4NL2 A;  4P3O A;  3X20 B;  2J3L A;  4LDY A;  4LVI A;  2Y90 A;  4N4G A;  1RL2 A;  3JCM c;  4BI4 A;  4M75 G;  4J8O A;  3RKW A;  2AKW B;  5K1X A;  2P0K A;  3L2R A;  2KMT A;  3A5Z B;  1D3B A;  3HXW A;  5GMK e;  4YRN A;  3FDR A;  4DQ2 A;  4M75 D;  2I4N A;  2RHY A;  1QP2 A;  3PTA A;  3QXE B;  2ALY B;  1JRI A;  5A2Q E;  3INZ A;  2QEX A;  1S72 A;  3L2W A;  4M7D A;  4ZGD B;  1VQL T;  5C6S A;  4LVJ A;  2EAY A;  3FB9 A;  3I56 T;  2MWP A;  1WQ7 A;  3JSC A;  4ZTZ B;  5EG2 A;  2Q7E A;  2ZPG B;  4A4H A;  1Q82 C;  2KQW A;  3CCV T;  5C52 B;  2C8M A;  1BKB A;  4KUL A;  2DTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...