4XTWA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 94
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtwA01
3JB9J 1M8VA 4M78C 4P72C 4A54A 1D3BA 3JB9G 1NYQA 2AMCA 5GAOm 3PCOB 5ELNA 4Q6GA 3HFZB 4PG3A 1B70A 4C8QA 1LYLA 1ATIA 1QF6A 1EFWA 3A31A 4XTYA 4Q15A 1E22A 1HTTA 1L0WA 1ADYA 4YROA 4YRCA 1NJ5A 2ZR3A 2P0LA 2EWNA 4NL2A 4PJOG 3QSUA 1N9SA 1X54A 4M7AA 4H2SA 2IY5A 4XEMA 4YREA 3JCMJ 4P3NA 4M78F 4UP8A 3NELA 4M77G 1LNXA 4XQ3A 5GAOl 2QHSA 3P8YA 3NEMA 4PJOE 3V8KA 3BW1A 4CH4A 3HRKA 5GAN6 4M77E 3A7UA 4JRIA 4PJOC 4UP7A 4RCCA 2XGTA 4M77C 3JCMf 1B34A 3BDUA 2I2LA 1B34B 4J5YA 3FJPA 1USYA 1KMMA 4TVAA 1NJ2A 3IKMB 4CH6A 4TVAB 4XTWA 4CH3A 1LJOA 1J5WA 3JCMV 3RESA 4JRKA 1E1TA 5GAN7 3UFGA 1YFSA 5GAMg 4Y91A 2QTXA 4K86A 4XEOA 1U1SA 2HNIA 4C92A 5LJ5f 3W3SA 4C92B 4TVYA 2ZT8A 1SESA 4H2XB 3TUPA 4PJOF 3M4GA 4CS2A 1ASYA 3RIRA 4YCWA 4M77F 1E24A 1YFRA 3IKLA 5LJ3h 3HXUA 2EJFA 1M5Q1 12ASA 1Y96A 5GANe 3QO5A 3JCMX 4XTVA 1NYRA 4YPFA 3QHSA 4F7UA 2E3CA 2E65A 2E5AA 4H2WA 5GAN4 1WPYA 1EQRA 4TTVA 1JBMA 1H641 3SB2A 2VXEA 4C8QE 3HXVA 4TQDA 4O2DA 1SRYA 1ADJA 4P3PA 5GANd 5GAOr 2ZGWA 3RUXA 5I21A 4P75C 4N0AC 3RGLA 4HWSA 5GANj 2CJAA 4X5OA 4M7DB 3NENA 3TEHA 4M7AE 5C52B 4YRPA 2ZIMA 2ZT7A 4DPGA 1EOVA 2ZINA 2CJBA 3KFUA 4XU2A 2ALYB 2FYKA 1I81A 3L2ZA 3TEGA 1MGQA 2Q7HA 3SWNB 4HWPA 3V7SA 3HFOA 5GANh 3PCOA 3RERA 1TH7A 3JCMc 1USYC 4HWOA 4PHCA 3EFRA 1W66A 11ASA 3HFZA 5KNNA 2DZ9A 4C92G 2EJGA 4XTUA 2EAYA 3HY1A 4J6YA 3QNEA 2C8MA 2Q5IA 1ASZA 4C92E 4YCVA 4M7AF 4HT8A 2I4NA 4C92C 5GAOq 4P75A 4N0AA 2YHTA 1B7YB 5LJ3e 2AKWA 4M7DD 2ZIOA 4WI1A 3VQYA 4BWAA 4H2UA 5GAOp 4JLIA 2AKWB 3JB9I 5E3IA 5GAMf 4M75B 4F7UG 3HRIA 3V8LA 3VBBA 2ZT6A 3QTCA 5GMKm 2DKGA 3RACA 4F7UE 2CJ9A 2ZXFA 4YRKA 3V8JA 4P71C 3VU3C 3E9IA 1EIYA 1VQZA 2VXFA 5LJ3d 5LJ3g 1KOGA 1BIBA 1EIYB 3QO3A 3JB9F 2ZTGA 4NOYA 2FB7A 3L4GB 3EFSA 4XU3A 2I4LA 1NNHA 4K88A 1X2HA 3HXXA 4J6WA 4C92F 3HXZA 4YRMA 1HC7A 5LJ3j 4YRNA 2CGHA 2ZT5A 1B76A 3BJUA 4YRLA 3VQXA 4H2TA 4YCUA 2Q5HA 4P74A 4H2XA 2DU5A 1YB3A 5DY9A 4M78B 2DZCA 2EJ9A 4YRFA 4MMLA 2ZZEA 4F7UF 1SETA 1RIQA 1WNLA 1G5IA 1JRIA 4M75D 2ARUA 4P73A 3A5ZA 3JCMe 3VQWA 4G85A 4V2SA 3I7FA 4P3OA 4TWAA 4EMHA 2RHQB 4RDXA 4P71A 2RM4A 2ZNIA 3A74A 2PMEA 4ZTUB 5HGQA 2DTIA 3HFVA 2DQ3A 2J3MA 3UGTA 4WJ4A 2QHUA 5LJ5e 1N9WA 2PMFA 1X01A 4YRJA 5GANg 3NETA 4H02A 4YYEA 3DSQA 4HVCA 4QVCA 2ZZGA 2ODRD 3HXWA 4CH5A 4YRTA 2CIMA 1GGMA 1G51A 2YLBA 4M7DA 2DVEA 3LC0A 2YLCA 4J6XA 4M77B 3VQVA 2E41A 4XU0A 4M78D 3UH0A 2DEQA 5LJ5d 1PYSB 1Z7MA 3LSQA 4ZTZB 3IG2A 4HT9A 1BBWA 2ALYA 4J15A 4YRRA 4OP0A 4X9DA 3JCMW 3JCMQ 5LJ5j 4A53A 2ARSA 2K57A 2RB6A 5GAN3 4HWRA 3SWNA 3JCMh 1U1TA 3GIBA 3A7AA 3M4PA 5GAN2 3RKWA 2E64A 5GMKh 4WJ3M 1SERA 1I8FA 3PGGA 3A32A 3LSSA 1JJCA 5C53B 1WLEA 1JJCB 3FB9A 5CAIA 1WU7A 4OLFA 4G84A 1NJ6A 1BIAA 4L87A 3JCMb 4LNSA 4TVWA 5F5WA 1YCYA 5LJ5h 1B7YA 2ZCEA 5C51B 3RL6A 4BW9A 3UGQA 3A5YA 4PJOD 4P74C 3BY7A 1QE0A 1X56A 4YRIA 4M77D 1D3BB 3REXA 2AMCB 4M75A 4UPAA 2DDZA 2RHSA 4P73C 2RA2A 2RHSB 1B70B 4E51A 4C8QB 2VC8A 3V7CA 1I5LA 3P8TA 2E10A 4EMKA 3P8VA 1HK9A 4EMKB 4RQEA 4EX5A 1C0AA 3L4GA 4EO4A 2ZNJA 3HY0A 3JB9H 3HXYA 4MMKA 2RD1A 1NJ8A 4EMGA 4YP0A 4DQ2A 2IY5B 4M7AB 4M7DG 4HWTA 2DXTA 4CS4A 3HSBA 4XU1A 3BFMA 4KQEA 1IL2A 2Q7GA 4M7DE 5ELOA 2JN0A 3ICAA 5GAMe 2C7IA 3ERRA 4M7DC 5GMKl 3M4QA 4WF2A 4M78A 4P72A 4NL3A 3L1AA 5GANf 5K1XA 1B8AA 1EVLA 4AH6A 3RKXA 4H2VA 5GAN5 3MF2A 1G5HA 4C8QD 5GMKe 5GAMd 2RHQA 3RKYA 3SWNC 2DTHA 4CS3A 2DTOA 5GAMj 1H4TA 2J3LA 3RF1A 1LOJA 2E1HA 4YDQA 4M7DF 1KMNA 1H4VB 3MF1A 3OD1A 3JCMg 3JCMd 3PZCA 5GMKi 3INZA 4M7AD 4XTZA 3QO8A 4ZIBA 1I4K1 1WYDA 1KQ2A 3G1ZA 3E9HA 4X9CA 3R07A 1NJ1A 1Y96B 3HFNA 4M75G 2G4CA 4PJOA 2P5IA 2DXUA 4PJOB 1WQWA 4QVDA 4F7UB 5GMKj 2XTIA 4M77A 4C8QG 2QHVA 3AHUA 4M75E 2EL9A 2DU7A 3MEYA 3V7RA 1PYSA 5GAMh 4M75C 5LJ5g 3JCMP 2Q7EA 4RCBA 4H2YA 5GAOn 5K1PA 4C8QC 3WQZA 2Y90A 3HTZA 3IALA 4K87A 1H4QA 2ZZFA 1EVKA 4EMKC 2ARTA 2I4MA 3JB9D 4JUVA 1X2GA 1HXDA 4M7AG 1WQ7A 4UP9A 1YFTA 4C92D 3FIFA 1X55A 1H4SA 4RQFA 2ZR2A 3A7RA 5GAN8 4KR3A 3REUA 3TEHB 1BBUA 4HA8A 4KR2A 1Z7NA 2DJZA 4M7AC 1KQ1A 2QHTA 3QO7A 1N9RA 4RMFA 2ODRC 5LJ3f 2I4OA 4M78G 1YGBA 3CMQA 1E1OA 4M75F 4XTXA 4YRSA 1FYFA 4YRGA 4PNOA 4M78E 3QUIA 4C8QF 4NCXA 4TQFA 4YRQA 2DQ0A
chains in the Genus database with same CATH superfamily
1M8VA 2QDYB 1NYQA 2WACA 2KNBB 4Q6GA 1C0MA 4LDXA 1OU9A 3VRYA 1WHKA 1VYVA 1BKBA 2K2VA 3GNGA 5DLQE 1OZ3A 4XTYA 1YJNQ 2PU9B 4ME7A 3HKSA 2ECZA 3OY9A 1PWTA 1L0WA 1ADYA 5KYXA 2RH2A 4E2FB 2BIVA 3CD6T 4CC4B 2E4HA 1N9SA 1VQLQ 5FU7B 1BI2A 4XEMA 3JCMJ 4P3NA 4UP8A 2CZ1B 3H8ZA 1YJNT 1LNXA 2XIDA 1JU5C 2YDLA 5GAOl 3P8YA 4FYYB 4M77E 3A7UA 4JRIA 2HCKA 3M57A 2RQVA 2XGTA 2O2OA 1KC8U 2I2LA 4JZ3A 1KMMA 2EGAA 3JAME 1PC0A 2RHIA 5CQYA 4TVAB 2EYXA 4RTTA 3E2UA 4XTWA 5IT9E 1J5WA 4CH3A 3JCMV 4OGEA 1U8RA 5KCHA 1YI2Q 1OX8A 4PLIA 5KE2A 1RAIB 2B86A 3OB9A 2DBMA 1VQPA 2PNIA 1QCFA 4N4HA 3UA7A 1U1SA 1I5OB 4C92A 1P92A 4KULA 2ZCFB 1PSFA 4ZTJA 2BZ8A 3ZBDA 4OB1B 1E6GA 1YI2T 2HBWA 4B9XA 4ZN3A 1ASYA 2EGEA 3OS5A 4FYVB 1IREB 4BE1A 3A8HB 3CCEQ 2ZPFB 1QVFP 3QO5A 3QZ9B 3MO8A 3QHSA 1VQ8T 1M8MA 1QCOA 4TTVA 4A4FA 3VRZA 4O6JA 4P3PA 2ZGWA 2VYTA 2ZPBB 3CBOA 2MYSA 2YRDA 3EG3A 2J06A 1W1FA 3RGLA 3OW2A 2HDAA 2RF0A 4YRPA 2MWPA 1VIEA 2ZT7A 4QQGA 3VS2A 2ZINA 4XU2A 2ZZDA 2FYKA 3DLLA 3VS4A 1K8AC 4BI3A 3L2ZA 1MGQA 2XKOC 1VQNQ 1YFNA 3D7SB 5CKDA 4OMLA 1M27C 4AFQC 1TH7A 4D8KA 1GCQC 1W66A 11ASA 2EJGA 1Q86C 1WIEA 4J8OA 1VQNT 1TXQA 2C8MA 2JW4A 2Q5IA 2V8KA 4QW2A 2XICA 2CP7A 2LVMA 3GLXA 4C92C 2YHTA 2M0OA 3CCSQ 2ZIOA 4M7DD 4WI1A 3VQYA 4BWAA 4RKUE 3JB9I 5E3IA 2KXCA 2JM9A 1BI3A 2E5KA 3CPWS 4M75B 3HRIA 5CKFA 1UB4A 1AZGB 1N8RC 4F7UE 4YRKA 1PRLC 4MDWA 3VYGA 3G4SQ 1JXOA 1G2BA 2VXFA 1G3TA 4O5VA 4NOYA 3M55A 1UECA 2MPXC 1VA7A 4IIOA 3L4GB 4XU3A 1NNHA 2CP3A 2DBKA 4RTXA 4C92F 3LWHA 1HC7A 2AT1B 4YRNA 2CGHA 1ZUYA 4RG8A 2X51A 2RN8A 4IUUA 1R77A 2DK3A 2KYMA 4YCUA 4LVIA 2JNGA 3EG0A 2ATCB 2JMAA 2DU5A 2LNHB 3UWNA 5DY9A 3TCJA 4OVAA 5A0GA 4JRPA 3CEYA 1RI9A 2GF7A 3OYLA 3DB4A 1WNLA 2OI3A 4JJDA 3TEEA 2MI6A 4P73A 2HQHA 3VQWA 2ZPHB 5AYFA 4V2SA 3EH2A 1IO6A 1YJ9Q 3UATA 2P4RA 5L23A 4EMHA 2RHQB 4RDXA 4AFZC 4P71A 2RM4A 2ZNIA 1AWXA 3MKDA 3H0IA 2O9VA 5HGQA 2DTIA 3HFVA 2DQ3A 2J3MA 4WJ4A 1X2QA 3SEMA 2FRWA 4IUTA 2DIQA 1YJ9T 1YHQQ 2PVOB 2PMFA 5J39A 4YRJA 4GLKA 4YYEA 4E7LA 1QKWA 1OYXA 1BYMA 2O01E 2CIMA 5HK3A 3RMQA 1M3BA 4J7IA 1K9MR 1SG5A 2CSIA 1SHFA 3LGFA 3VQVA 1YHQT 5FWCA 4M78D 1WX6A 4CI0C 2P0QA 3GF5A 4LVKA 3LSQA 5I22A 2YSQA 1BBWA 3QWYA 1FMWA 3RMSA 4IUVA 2K57A 1N8RU 3CD6A 4FU6A 4QT7A 1KD1R 3QJYA 2RO0A 1JJCA 2K3XA 2JTFA 2A28A 2KRMA 2DEUA 1VQ7A 1KQSA 1PSEA 2GQIA 2ED1A 1Y7XA 9ATCB 1YITQ 1VQ5Q 4KBMB 2WSCE 3CXCS 3RL6A 4BW9A 3UGQA 4GY5A 4BDZA 3A5YA 4Q5WA 1QE0A 2RQTA 1X56A 1TUDA 3C4SA 2K5IA 2AMCB 4M75A 1KIKA 2LZ6B 4KUIA 3X26B 4P73C 2RHSB 1B70B 2RJDA 3P8BB 2DILA 4C8QB 2VC8A 1YITT 3V7CA 4EMKA 2H8HA 3P8VA 1HK9A 4HCZA 3LH0A 4ESRA 3L4GA 3OYYA 1WXTA 4EO4A 3JB9H 4MMKA 2VWFA 4R56A 3CCUA 4DOWA 1E7OA 2DD5A 4IUPA 4DQ2A 1MMDA 2EYZA 4HVWA 4M7AB 1C1AA 4HWTA 5J26A 3HSBA 1VQ8A 3QWXX 1Q82R 1WXBA 3OBYA 2DL8A 2DRKA 1TUGB 3ICAA 1K73R 1K0XA 3ERRA 4BI8B 4WF2A 4OMPA 2NYSA 4P72A 5EG2A 3L1AA 1AVZC 4A4EA 2EQKA 3M58A 4LDWA 1SSFA 3RKXA 1NPPA 4H2VA 5GAN5 2RQWA 2KDSA 1UJ0A 2KAFA 3MF2A 2J6KA 4KGXB 3HRTA 2RHQA 2GCXA 1HSQA 4CS3A 4Y92A 2P0KA 2LQWA 1MV3A 3NMZC 2E3IA 3M0TA 1PNJA 1UG1A 2GFUA 5IHIA 1ZUKA 1NYGA 4LDYA 4WCIA 5IHNA 2J3LA 1AOJA 1H4VB 2H3JA 3JCMd 1X6GA 1W6XA 2RQUA 1NBEB 3A98A 1KQ2A 3EG2A 3E9HA 3CPFA 2V1QA 4PJOA 1M1KR 4L59A 1WQWA 2KRSA 2P84A 3TU4K 4F14A 3EHQA 3AHUA 1VQPT 2QHVA 2BZXA 2G6FX 1OOTA 3V7RA 1H92A 1MMNA 3EHRA 1MUZA 1BB9A 4M75C 3JCMP 3M0QA 2KMTA 2HL5C 4RUGA 3WQZA 2Y90A 1WHGA 3HTZA 5I2SA 4KH0B 3I56A 4FYXB 1QCNA 2DL7A 4EMKC 5IXFA 1FMKA 2X4JA 4JUVA 2D9TA 1X2GA 4CC7A 2NLUA 1H4SA 2MCNA 3A7RA 5GAN8 5KCOA 3QJ6A 5AT1B 3TEHB 2RPNA 1W2BS 2NUZA 1KQ1A 2QHTA 1WA7A 2EKOA 3CCJT 1WJQA 2XDPA 5EC7A 1ZQ1A 2RJCA 4M75F 1FYFA 4DOVA 3SHWA 4PNOA 1Y71A 3QUIA 2VKNA 3H41A 1Q81C 1W70A 2QG9B 4P72C 1SKUB 3EFOB 2AMCA 1WJRA 1ACMB 3S3MA 1PKTA 1KD1U 2DERA 5ELNA 2DX1A 1EFNA 1B70A 1UHCA 4C8QA 2KY9A 1QF6A 1ZX6A 3A31A 3L2RA 4A4KA 1E22A 4Z02A 1NEGA 1HTTA 3UDCA 5HY6A 4LVJA 3NFCA 3VJPA 3C12A 2AKLA 5KYXB 3M56A 2EFIA 1J3TA 2QQRA 3CCMA 2ZR3A 2EWNA 3WVDB 3QSUA 4H2SA 2VVKA 5CIUA 4M7AA 2QDLA 1X6BA 3P8DA 4M77G 4XAXB 3NEMA 2CREA 1YWPA 4PJOC 2L5QA 3CCVA 4RCCA 4FM4B 2JZ2A 2NWMA 1T3SA 2VUBA 5FWBA 4J5YA 3FJPA 4HKEA 3VS5A 1USYA 4C5IA 3RDVA 3G6EA 2FEIA 1EX4A 3PE0A 1WXUA 3CC2A 2COZA 1QP3A 2HSEB 3UFGA 4JS5A 1YFSA 1RAAB 3FC3A 2QTXA 1Q82U 2VB6A 1QMCA 2X3WD 2K79A 1GFDA 2OAWA 4C92B 2CDTA 3HTRA 1U5SA 3ULRB 4H2XB 3TUPA 2DFUA 4PJOF 2FZGB 1X69A 3M4GA 4ZGEB 4HT4A 2LQ8A 5D7UA 3Q1JA 1QVFA 5LJ3h 3EAEA 4HCCA 2K9GA 3HXUA 1GFCA 4ATOA 3A5ZB 1ZA1B 3JCMX 1SF9A 4XTVA 4F16A 1JO8A 2E3CA 3SD4A 2ZAEA 2FO0A 3VKIA 2E65A 5GAN4 1WPYA 1EQRA 1K1ZA 1JBMA 1H641 1OPLA 3PIOA 2KROA 3SB2A 2OX7A 2JMCA 2YRVA 1UGSB 2XDDA 2DM1A 4LVMA 4TQDA 4O2DA 1I0CA 1B07A 3NTKA 3CCRT 1ARKA 1TSFA 2O9SA 3OYDA 2Y4XA 5ECAA 2RMOA 4N0AC 4PFOA 5GANj 1D1BA 4M7DB 2KK4A 1CKBA 2A3LA 3TEHA 2EQJA 3PMIA 3E19A 2ALYB 2EBPA 1R0BG 2K3YA 2JS2A 2D0QB 3TEGA 2Q7HA 2V26A 3VS6A 4HWPA 1RABB 3EFOA 3HFOA 2GQVA 1USYC 3OSVA 2DO3A 2A08A 1OPKA 3CD6Q 4J6YA 4CC3A 1VYTA 4HXJA 3CPWP 3KBGA 4C92E 1K0SA 2OTJA 4M7AF 2DXBA 1VQ6T 1SPKA 4E7JA 3L2QA 3OYGA 1VQ7Q 4D6WA 1TOVA 4JLIA 5A2QE 1D0YA 1FXXA 1ZBJA 4F7UG 4OMFB 3CCLA 3V8LA 4PFZA 2DKGA 2CJ9A 3A8MB 4C5GA 1VQ7T 4J9DA 3OQ5A 1EIYA 5LJ3g 4PJNA 3QO3A 3UF4A 3JB9F 1QP2A 1FMVA 1X2KA 2KT8A 4PL6A 4Z89A 3EFSA 3ZFJA 1GCQA 4K88A 4YRMA 1X2HA 4DEXA 5LJ3j 4BI4A 1IB8A 1F1BB 1K8AR 1UUEA 3CCUQ 1JJ2S 2J6OA 3T9NA 3CMAA 1UFFA 4H2XA 3QPHA 4M78B 1VQ8Q 2EJ9A 2ZZEA 3LW5E 4DBRA 1G5IA 1JRIA 1Q86R 4Y28E 2AKKA 3A5ZA 3CCUT 4G85A 4P3OA 3C94A 2DPPB 2MF2A 5D6XA 4JRQA 4GLMA 3UGTA 3CCJA 4RTZA 3EGXB 4J9IA 4F17A 3J81E 1AHJB 4HVCA 4YTLA 2HZYA 1N8RR 2ZZGA 2ODRD 2VV5A 3HXWA 1W4SA 2ZPGB 3HPWA 2P4TA 4FSXA 7AT1B 2YLBA 1XOVA 4M7DA 4II1A 2LNVA 4BE0A 2O31A 4XU0A 2DEQA 4ZTZB 3MP1A 5KH6A 2ALYA 4AG1C 4YRRA 1VIFA 4E7HA 2X4WA 2GTJA 2ZPIB 4A53A 3WVEB 2RB6A 1YWOA 2EGCA 2HBPA 1IRXA 2EQMA 5GAN2 4B9WA 2M16A 1C6VX 3CXCP 2X9HA 1SERA 4WJ3M 3I56Q 3H0FA 5FRMA 1IXDA 2GNCA 1KK7A 2IIMA 1WLEA 1JJCB 3FB9A 3H0HA 1NJ6A 1BIAA 1AD5A 3JCMb 3N5BB 2X4YA 3MP6A 5IH2A 2ZCEA 3META 2PVDB 3EGDB 2LP5A 3I56T 1ZBXA 3G71A 1KHCA 2LQNA 1UGQB 4M77D 1H8KA 2B8AA 1UJYA 4UPAA 1Q7YC 2DDZA 2X4XA 2V8IA 4OB3B 1H3HA 3I5SA 3M4YA 3PTAA 2YXYA 4L5GA 3CBPA 4EMKB 4RQEA 1MNDA 4EX5A 1OX9A 2QEXA 3CQTA 1QW1A 2DLPA 3HRSA 4EMGA 4YP0A 1XQHA 4PKCC 2IY5B 4LD9K 6AT1B 4ELYC 2FZCB 4XU1A 2ESWA 1JXMA 4DBHA 2L89A 1YBYA 1TS9A 2QA4A 5ELOA 2JN0A 2LX9A 3CCMQ 2C7IA 1Y07A 3MEWA 4M7DC 1PCXA 2OAUA 4M78A 1IZ6A 1QVGS 3TSZA 1G5VA 5GANf 1YCSB 3CCRA 4HCBA 1EVLA 1Z9QA 4AH6A 2EPDA 4FT4A 2YWWA 4BB7A 3CCVQ 3CCMT 1U3OA 1G5HA 3OYCA 2GGRA 2FG0A 4EPCA 3M54A 3G6EQ 2LJ1A 1K8AU 3CC2Q 1BCOA 5GAMj 3EGXA 4OMOA 2A7YA 4PLLA 1H4TA 3CCVT 4M7DF 1KMNA 3MF1A 4RTWA 3INZA 5GMKi 3SDZA 4ZIBA 2BE7D 4J9HA 1Q86U 1WYDA 4OGCA 3G6ET 1HJDA 1SRLA 2YRCA 1NJ1A 1Y96B 3CC2T 2IPOB 4EDUA 2G4CA 3E9FA 4PJOB 1BK2A 2JXBA 4C8QG 4M75E 2DU7A 2D6FA 3MEYA 1D1CA 1WHMA 2DL4A 3TVTA 5KE3A 2PTKA 1VQ6A 2CUBA 1Q7YU 1W2BP 1RLQC 1EVKA 1OI1A 2ARTA 4HVUA 2I4MA 3THKA 2KGTA 1HXDA 2RK2A 4M7AG 2DVJA 4MZTA 1MHNA 4N4IA 1VQ4A 4UP9A 1YFTA 1X55A 3QYHB 2EIFA 2ZR2A 2KVQG 3JRZA 1ABOA 4KR3A 1VOMA 3REUA 4LXCA 3R6NA 3KXTA 1UTIA 2NUTB 1WJSA 5LJ3f 4CRIA 1WHJA 3CMQA 1WDXA 2A0FB 3EGDA 4C5EA 1X27A 4J9CA 1BI1A 4NCXA 4TQFA 4YRQA 1NZ9A 4HVVA 3JB9J 4M78C 2YUNA 4A54A 3FLGA 3JB9G 5KYYA 5GAOm 1VQKT 1T0HA 2DYBA 5L8RE 1EIFA 2GTOA 3HFZB 1BBZA 2F1LA 2K7AA 1AWOA 1M90C 5CO7A 1LYLA 4E7ZA 1QWEA 1ATIA 2KXDA 2DNUA 2K5FA 2PUKB 3IQLA 3GBQA 2QQBA 2R58A 3OA6A 1YN8A 2X35A 1GBQA 3I55T 2KI7A 3QG1A 1X75C 4NL2A 2OTJQ 1X54A 2IY5A 3O5ZA 2CT4A 3ZEHA 3L2UA 4M78F 1NPRA 2H3EB 2D8JA 4XQ3A 2QHSA 4PJOE 1M3AA 3V8KA 3BW1A 4CH4A 3QDRB 4LE9A 2DA9A 2J6FA 3X25B 1RADB 1B34A 3CCLQ 1AT1B 2OTJT 5CKEA 3MEAA 1NJ2A 3IKMB 3M9QA 1M2VB 3O8VA 4Z8AA 5M9OA 4TVRA 1RAFB 1JB0E 5KYUB 1E1TA 3QZ5B 3KFVA 1GCPA 4Y91A 4K86A 4XEOA 2KT1A 2EKHA 3CCLT 2AK5A 2LTOA 2HNIA 1UE9A 4N4GA 4IURA 1Q81R 3CCEA 3MQZA 1SESA 3HP9A 2F5KA 5I2MA 4CS2A 1VQPQ 1VQ9A 1E24A 3M59A 1X43A 1TUCA 3FRNA 3CMAQ 1NYFA 1Y96A 5GANe 4BY6C 1NYRA 2M1HA 1D09B 1K76A 2AZVA 4X34A 2SRCA 3MCAB 3VV0A 3GNFB 8ATCB 2VXEA 2LCLA 4C8QE 3NTIA 3CMAT 3HRUA 5KYNA 2CZ6B 4WTOB 4FL6A 1ADJA 3I35A 1VQOA 5GANd 5GAOr 3L2VA 2BTTA 3LWIA 3CCJQ 2PQWA 3LLRA 1NE8A 4P75C 2CJAA 2C0TA 3H9NA 1OV3A 4M7AE 5C52B 2ZIMA 2YUPA 2XD0A 4DPGA 1EOVA 1MMGA 5C0MA 5CVIA 2CJBA 3KFUA 2NUTA 5C6SA 3S3NA 4FIBA 1G3WA 2RHYA 2CZ7B 3TQ7P 1I81A 1KG1A 1FX7A 2DIGA 2LT1A 4ANJA 3OW2S 3V7SA 3UPUA 5GANh 3RERA 3A8LB 3JCMc 4HWOA 4AFUC 4PHCA 4C0DB 1ZLMA 4FW1A 3HFZA 3CPWA 4C92G 4XTUA 3E1SA 2HKQB 3OYNA 5HKCA 3QIIA 1ASZA 4RTUA 1TWBA 2E6NA 3A8OB 4HT8A 2I4NA 3OYJA 2RI5A 3AT1B 4N0AA 1JQQA 1D0XA 5LJ3e 2AKWA 5GAOp 4LDUA 2AIRB 2FPEA 4LDVA 2LDMA 5GAMf 1KSWA 5LL6S 3QTCA 1K9AA 1QKXA 5KYWB 3G71Q 3V8JA 2F2VA 4X1VA 1VYUA 2P0PA 2OJ2A 3VU3C 3E9IA 1QWFA 2E70A 5LJ3d 1EIYB 1JJ2P 3JV3A 2NS6A 3OS0A 2I4LA 2ZPEB 3HXZA 2C0OA 4J6WA 1M2VA 4JZ4A 1N6AA 2F69A 3G71T 2ZT5A 2W10A 4AMCA 1B76A 3BJUA 5KYUA 2HMAA 3OYAA 2LT4A 4LD6A 2QEXQ 4YRLA 3VQXA 4ZN1A 4ZGDB 4ZNXA 2RK1A 1RI0A 1M2OA 4PJLA 4QQ6A 2HSPA 4YRFA 1FWZA 1ZSZC 4MMLA 2QA4Q 2QEXT 1SETA 1N5ZA 2XG8D 1S72A 2ARUA 1S1NA 1BI0A 1ZUUA 3FEOA 4KGVB 2L3QA 1YJWT 3JSCA 3CCRQ 1MNEA 4ZTFA 1M9SA 2PMEA 5FU6C 2HD0A 2EYWA 1PKSA 2CZ0B 2QA4T 2DAQA 1Q81U 3TSWA 2E6ZA 2QHUA 2ED0A 2RHUA 2QAZA 3BDLA 5GANg 3NETA 2DD4A 3DSQA 2YUQA 4QVCA 2RJFA 4YRTA 2LJ3A 2RI2A 1VQKA 1KC8C 2JTEA 1GGMA 1G51A 4M4ZA 3E9GA 2CH4W 3LC0A 4J6XA 4M77B 3QYGB 3UH0A 2CP5A 3J7AF 2FZKB 3PFSA 4HT9A 1GRIA 4J15A 2XK0A 2E3HA 2KSSA 4OP0A 2V8JA 3JCMW 3NTHA 3JCMQ 1NJIR 5LJ5j 3I55A 2OTLA 3LYIA 1NG2A 5GAN3 4BD3A 2PVGB 3CXCA 1SEMA 2W0ZA 4HWRA 1U1TA 5DM7R 3QDFA 3GIBA 1VQ6Q 2E64A 5GMKh 2VGMA 2AZSA 1I8FA 4FYWB 3PGGA 3A32A 3LSSA 1UGRB 2XMFA 3M0PA 5CAIA 4MDXA 3X20B 4R0KA 1VQ4Q 1NM7A 2EYYA 4L87A 2DL5A 1I1JA 4LNSA 2FPDA 5A0LA 1YCYA 3OS1A 5C51B 2VASA 2R5MA 4RG2A 4A63B 2O4XB 3BY7A 1M3CA 4R55A 1WHHA 1VUBA 1D3BB 1K4US 3REXA 1LCKA 1VQ4T 2XHCA 2RA2A 5KYWA 1KQSS 4BUGA 3VS3A 2J05A 1O9SA 1YNZA 5CKHA 3DLMA 3P8TA 2E10A 2DXCA 4A4GA 1XJWB 2EQIA 2QI2A 3HY0A 1RACB 4LUEA 3HXYA 2RD1A 1VQMA 2KE9A 2MIOA 1QVGP 1M30A 1TU0B 1NJIC 2Q7GA 2FHDA 4M7DE 2COWA 3CBMA 3CC4A 5CQXA 3PMTA 5GAMe 1OULA 4IUQA 1WLPB 2V1RA 3OBWA 5D6WA 5GMKl 3M4QA 2Y4YA 2DJQA 3PT9A 3MEVA 5CCAA 1VQLT 2CP6A 3MEUA 1B8AA 2A36A 1T3LA 5FLXE 3CMEA 1PD0A 2BE9B 1G3YA 2F2WA 5GAMd 5CK9A 4PFPA 2MOXA 2DTOA 2C0IA 4C0DC 3RF1A 3MP8A 2QQ9A 4ORZA 4YDQA 1Q7YR 3OD1A 1OZ2A 3PZCA 5CR2A 4XTZA 2QQSA 3X28B 3QO8A 1I4K1 1WFWA 3C95A 3NPFA 4RMOA 3HFNA 4OF1A 4M75G 4IKFA 3J80E 2DXUA 3S6WA 2P5IA 2ROLA 4F7UB 3MHXA 4PJJA 4QVDA 4M77A 5IXBA 5GMKj 2BZYA 1VQ9Q 2XTIA 3S3OA 3MJXA 2L0AA 1QVPA 4KH1B 2K2MA 2EL9A 4E7IA 5GAMh 4KUDK 1W2BA 3CCET 2Q7EA 4RCBA 2FPFA 5K1PA 4MZPA 3IALA 1H4QA 4K87A 1RUWA 4OMMA 2E5QA 3PIPA 2K3BA 1VQ9T 2F2XA 1IHWA 4ELZC 4AT1B 1UGPB 1XTDA 8AT1B 1CSKA 1LPLA 1WQ7A 1XNIA 4UC4A 3HHTB 3FIFA 4XK8E 4C92D 2DMOA 1VQOQ 2E12A 1NLOC 3WXMB 2D0NA 2WSFE 3QO7A 4RMFA 2ODRC 1CKAA 1YGBA 2COYA 1E1OA 3M53A 1RAGB 2JTMA 2RJEA 4XTXA 4YRSA 2RQRA 4E6RA 4C0GA 1SSHA 5A0DA 4YRGA 4E7SA 2HL3A 2IVWA 4BY6B 4M78E 1NJIU 1VQOT 2O4XA 2I0NA 1OQKA 2DQ0A 2DYIA 4C0FA 2IG0A 1D3BA 4MZMA 2SEMA 3FDRA 5FRNA 3C0CA 3OS2A 3PCOB 5KYYB 4AG2C 1H3ZA 4PG3A 5J3BA 3U23A 1AEYA 2Z0WA 3ER0A 1G8XA 2QYZA 1EFWA 2DETA 4Q15A 3LGLA 3EH1A 2BKDN 3OYEA 4YROA 3QBYA 2LQKA 4ZGJB 4YRCA 4JS4A 4OB0B 1NJ5A 2P0LA 1HD3A 5FW9A 4PJOG 1YJWA 3SFMA 1GL5A 4YREA 3NELA 4BDYA 2KR3A 2RHXA 3FJ5A 3HRKA 5GAN6 3M0UA 3CCST 1A0NB 4UP7A 1M1FA 4M77C 3JCMf 1YIJA 3BDUA 1B34B 2KYBA 4TVAA 2JT4A 2A37A 3P8HA 4FT2A 4JJCA 4CH6A 3HL8A 3R6OA 1LJOA 2LRQA 3RESA 2ROTA 3G4ST 2MK5A 1KHIA 4JRKA 3L2WA 2XDBA 5GAN7 1WYXA 5GAMg 4OMQA 1SHGA 3OMGA 5LJ5f 3W3SA 1KFZA 4TVYA 2ZT8A 1BU1A 1IHVA 4LN2A 2ENMA 2QTVA 1QQJA 3RBBB 3RIRA 1PHTA 2EQUA 4YCWA 4M77F 1YFRA 4JDSA 2CH4A 3IKLA 5D6YA 3PNWC 1RL2A 2PZ1A 4QKUA 1M90R 2EJFA 4NS5A 1M5Q1 2EYQA 3KUFA 4LNPA 1UGVA 12ASA 4RTVA 5DLOA 2M9UA 4YPFA 4F7UA 3CC7A 1S72Q 2E5AA 4H2WA 4L6V5 2GBQA 1AWWA 2RI3A 1NEBA 1LVKA 1IGQA 4J9BA 1M1GA 3CCQA 3HXVA 1I07A 1OU8A 3PVQA 3UT1A 1QVFS 2A8EA 3GPLA 1SRYA 4F04B 2QXFA 3RUXA 5I21A 1S72T 2JS0A 4HWSA 4X5OA 3NENA 3LH5A 2VGNA 3OW2P 5FU7C 1ZSZB 2M51A 2XI9A 2HKNA 2D1XA 1VQKQ 2QGGA 2DE0X 4OB2B 1D1AA 3PVLA 3SWNB 4Z88A 5FU6B 1YJNA 3PCOA 4IIMA 4DEYA 4BE2A 3EFRA 3I55Q 3I9QA 2OTLQ 5KNNA 4J9EA 2DZ9A 1PG5B 2EAYA 2JVVA 1PRMC 3TREA 3HY1A 2PUOB 1Q95G 3QNEA 3G7ZA 2XU8A 3OYMA 4YCVA 4DBQA 1VQLA 5GJVB 4GBQA 4KRTA 5GAOq 4P75A 4CC2A 1B7YB 2OTLT 2RHZA 4H2UA 3GOXA 2AKWB 1N27A 3VS1A 3NGPA 1ZSGA 2J7IA 3M0SA 3QKJA 4RTYA 3VBBA 1JEGA 2ZT6A 3M5AA 5GMKm 1VQ5T 3RACA 2ZXFA 1Z9ZA 3ASKA 2CP0A 1JJ2A 4P71C 1YI2A 4JJNK 1VQZA 3UA6A 5I11A 5CKBA 1K9MC 1KOGA 1BIBA 1X6OA 1G3SA 2KEAA 2LC4A 4DBFA 2ZTGA 3VYHB 2FB7A 2M0YA 1B3QA 3ZL7C 1E6HA 4E7KA 3HXXA 2EVRA 3DKMA 4PJMA 3VS0A 4B6MA 3REAB 2FVUA 4JPBW 1WZOA 1PD1A 2L2PA 4FW2A 5IAYA 3M0RA 1VQMQ 4H2TA 3EGUA 2Q5HA 4P74A 2HQXA 4OMNA 5IN1A 1YB3A 1KD1C 2DZCA 4F7UF 1UHFA 1WHLA 1RIQA 3CC4Q 2YT6A 1G83A 2FL7A 4M75D 1HYOA 1UDLA 3JCMe 1RAHB 2K4YA 2MWOA 1ZA2B 1VQMT 3I7FA 4BACA 4TWAA 2LCSA 2WSEE 2CYZB 1UEBA 4J9GA 3A74A 1RAEB 5HK0A 3ME9A 4ZTUB 1D0ZA 4JJBA 3CC4T 3CMEQ 4C5HA 1AWJA 2LJ0A 2LMJA 3L42A 5LJ5e 1N9WA 1X01A 4H02A 4LUDA 2DL3A 3OMCA 1GBRA 1M90U 4CH5A 1TTHB 3EG9B 3CMET 2DVEA 1KJWA 2YLCA 2K6DA 1WI7A 2CSQA 2E41A 1VQNA 1ZSZA 5LJ5d 1PYSB 1Z7MA 3IG2A 1WGSA 2L3SA 2CP2A 2KBTA 2CT3A 4X9DA 1Q82C 1M4ZA 2JJ9A 3G1JA 4PK4A 2ARSA 1AZEA 2L3PA 2KQWA 1K73C 3VUZA 3SWNA 3JCMh 3X24B 2JM8A 3A7AA 3M4PA 1K9MU 3RKWA 1BCMA 2RNAA 2CKKA 3F70A 4J7FA 2MAMA 5C53B 1FYNA 1YP5A 2L8DA 3RR6A 3CCSA 1WU7A 4OLFA 2CS7A 4G84A 2R57A 4TVWA 5F5WA 1ZHIA 3OSSC 2NUPB 1KQSP 5LJ5h 1B7YA 4PJOD 3VS7A 4P74C 1PM3A 2K5LA 3G4SA 4YRIA 3H6ZA 2HQEA 2AHJB 3EG1A 4FCYA 2RHSA 3OYKA 4E51A 3I5RA 2L3RA 1MV0B 1I5LA 1T0JA 2MMPA 4J9FA 2QQAA 1M1KC 1KC8R 1R0CB 1C0AA 1ABQA 1NLPC 2ZNJA 2BUDA 1QVGA 2C06A 3DB3A 1GXIE 2GFAA 1NJ8A 2ABLA 1MMAA 4M7DG 2DXTA 4CS4A 4AFSC 1OEBA 3BFMA 4KQEA 1IL2A 4EIKA 2QASA 3BE3A 4QQDA 5IHKA 4FSSA 1YJWQ 1YJ9A 4NL3A 2JOYA 2X3XD 5GJWB 5K1XA 1O75A 4K11A 2LX7A 2QGFB 4LVLA 4C8QD 1YIJQ 5GMKe 3RKYA 1YHQA 2DRMA 3SWNC 2DTHA 3OYIA 4VUBA 1K73U 2G3RA 1B7TA 3VUBA 2JUFA 1LOJA 2E1HA 1R8OB 3JCMg 4JLGA 1YIJT 4A4HA 1QLYA 4M7AD 1V1CA 3A8GB 4QVZA 2M02A 4HCKA 3RNJA 3G1ZA 1Y0MA 2DF6A 4X9CA 1TG0A 3R07A 1V76A 3EG9A 4P5NA 4KT0E 4DA4A 2CUDA 2R5AA 2KRNA 3OYBA 2QK0A 3QXEB 4J83A 3OYFA 1PYSA 5LJ5g 1U06A 4H2YA 5GAOn 3LX7A 4C8QC 2O88A 3CC7Q 3REBB 2LCCA 2HAXA 2ZZFA 5HCKA 3JB9D 3GP8A 3CCQQ 3OYHA 3MPUB 3A1PA 3NHNA 1M1KU 1SRMA 4RQFA 3URGA 1BBUA 4HA8A 2EW3A 1YITA 1VQ5A 1RLPC 3CC7T 1Z7NA 4D8DA 4KR2A 1V29B 2DJZA 2F5TX 4M7AC 4C0ZA 1N9RA 5FROA 2I4OA 4M78G 3CCQT 2HEQA 1Y57A 2FRYA 2YUOA 4KGZB 2NUPA 1DJ7B 4C8QF 4E47A 1IGUA 2D8HA 1EZZB
chains in the Genus database with same CATH topology
1M8VA 2QDYB 1NYQA 2WACA 4Q6GA 4LDXA 2K2VA 1BKBA 3GNGA 5DLQE 1OZ3A 4XTYA 2PU9B 4ME7A 3HKSA 3OY9A 1L0WA 1ADYA 2RH2A 2BIVA 3CD6T 1N9SA 5FU7B 1BI2A 4XEMA 3JCMJ 4P3NA 4UP8A 2CZ1B 3H8ZA 1YJNT 1LNXA 2XIDA 5GAOl 3P8YA 4M77E 3A7UA 4JRIA 3M57A 2XGTA 1KC8U 2I2LA 1KMMA 3JAME 2RHIA 5CQYA 4TVAB 4XTWA 5IT9E 4CH3A 1J5WA 3JCMV 4OGEA 1U8RA 5KCHA 4PLIA 5KE2A 3OB9A 1VQPA 4N4HA 1U1SA 4C92A 1P92A 4KULA 2ZCFB 1PSFA 4ZTJA 3ZBDA 4OB1B 1YI2T 4B9XA 4ZN3A 1ASYA 3OS5A 1IREB 4BE1A 3A8HB 2ZPFB 3QO5A 3QZ9B 3MO8A 3QHSA 1VQ8T 4TTVA 4A4FA 4O6JA 4P3PA 2ZGWA 2VYTA 2ZPBB 3CBOA 3RGLA 3OW2A 4YRPA 2MWPA 1VIEA 2ZT7A 4QQGA 2ZINA 4XU2A 2ZZDA 2FYKA 3DLLA 1K8AC 4BI3A 3L2ZA 1MGQA 2XKOC 5CKDA 1TH7A 1W66A 11ASA 2EJGA 1Q86C 4J8OA 1VQNT 2C8MA 2Q5IA 2V8KA 4QW2A 2XICA 2LVMA 3GLXA 4C92C 2YHTA 2M0OA 2ZIOA 4M7DD 4WI1A 3VQYA 4BWAA 4RKUE 3JB9I 5E3IA 1BI3A 3CPWS 4M75B 3HRIA 5CKFA 1UB4A 1N8RC 4F7UE 4YRKA 3VYGA 4MDWA 2VXFA 1G3TA 4O5VA 4NOYA 3M55A 3L4GB 4XU3A 1NNHA 4C92F 3LWHA 1HC7A 4YRNA 2CGHA 4RG8A 4IUUA 2DK3A 4YCUA 4LVIA 2JNGA 2DU5A 3UWNA 5DY9A 3TCJA 4OVAA 5A0GA 4JRPA 3CEYA 2GF7A 3OYLA 3DB4A 1WNLA 3TEEA 2MI6A 4P73A 3VQWA 2ZPHB 5AYFA 4V2SA 4EMHA 2RHQB 4RDXA 4P71A 2RM4A 2ZNIA 5HGQA 2DTIA 3HFVA 2DQ3A 2J3MA 4WJ4A 4IUTA 2DIQA 1YJ9T 2PVOB 2PMFA 5J39A 4YRJA 4GLKA 4YYEA 4E7LA 1OYXA 1BYMA 2O01E 2CIMA 5HK3A 3RMQA 4J7IA 3LGFA 3VQVA 1YHQT 4M78D 4CI0C 2P0QA 3GF5A 4LVKA 3LSQA 1BBWA 3RMSA 4IUVA 2K57A 1N8RU 3CD6A 4FU6A 2RO0A 3QJYA 1JJCA 2K3XA 2JTFA 1VQ7A 1KQSA 1PSEA 1Y7XA 4KBMB 2WSCE 3CXCS 3RL6A 4BW9A 3UGQA 4GY5A 4BDZA 3A5YA 4Q5WA 1QE0A 1X56A 3C4SA 2K5IA 2AMCB 4M75A 4KUIA 3X26B 4P73C 2RHSB 1B70B 2RJDA 3P8BB 4C8QB 1YITT 2VC8A 3V7CA 4EMKA 3P8VA 1HK9A 4HCZA 3LH0A 3L4GA 3OYYA 4EO4A 3JB9H 4MMKA 4R56A 3CCUA 4DOWA 2DD5A 4IUPA 4DQ2A 4M7AB 4HWTA 5J26A 3HSBA 1VQ8A 3OBYA 3ICAA 3ERRA 4BI8B 4WF2A 4P72A 5EG2A 3L1AA 4A4EA 2EQKA 3M58A 4LDWA 1SSFA 3RKXA 1NPPA 4H2VA 5GAN5 2KDSA 2KAFA 3MF2A 3HRTA 2RHQA 2GCXA 4CS3A 2P0KA 2GFUA 2J3LA 4LDYA 1H4VB 2H3JA 3JCMd 1KQ2A 3E9HA 3CPFA 4PJOA 4L59A 1WQWA 3TU4K 2QHVA 3AHUA 1VQPT 3V7RA 4M75C 3JCMP 2KMTA 3WQZA 2Y90A 3HTZA 5I2SA 3I56A 4EMKC 2X4JA 4JUVA 1X2GA 2D9TA 2NLUA 1H4SA 3A7RA 5GAN8 5KCOA 3QJ6A 3TEHB 1W2BS 1KQ1A 2QHTA 2EKOA 3CCJT 1WJQA 2XDPA 1ZQ1A 2RJCA 4M75F 1FYFA 4DOVA 4PNOA 1Y71A 3QUIA 1Q81C 4P72C 2AMCA 1WJRA 3S3MA 1KD1U 5ELNA 1B70A 4C8QA 2KY9A 1QF6A 3A31A 3L2RA 4A4KA 1E22A 4Z02A 1HTTA 3UDCA 5HY6A 4LVJA 3NFCA 3VJPA 3C12A 3M56A 2EFIA 2QQRA 3CCMA 2ZR3A 2EWNA 3WVDB 3QSUA 4H2SA 5CIUA 4M7AA 3P8DA 4M77G 4XAXB 3NEMA 4PJOC 2L5QA 3CCVA 4RCCA 4FM4B 2JZ2A 2VUBA 4J5YA 3FJPA 4HKEA 1USYA 4C5IA 3G6EA 3CC2A 1QP3A 3UFGA 4JS5A 1YFSA 3FC3A 2QTXA 1Q82U 4C92B 4H2XB 3TUPA 4PJOF 3M4GA 4ZGEB 4HT4A 2LQ8A 3Q1JA 1QVFA 5LJ3h 3EAEA 4HCCA 3HXUA 4ATOA 3A5ZB 3JCMX 4XTVA 2E3CA 3SD4A 3VKIA 2E65A 5GAN4 1WPYA 1EQRA 1JBMA 1H641 3PIOA 3SB2A 2YRVA 1UGSB 2XDDA 4LVMA 4TQDA 4O2DA 3NTKA 3CCRT 3OYDA 2Y4XA 4N0AC 5GANj 4M7DB 2KK4A 3TEHA 2A3LA 2EQJA 3PMIA 3E19A 2ALYB 2K3YA 2D0QB 3TEGA 2Q7HA 4HWPA 3HFOA 2GQVA 1USYC 3OSVA 2DO3A 4J6YA 3KBGA 4C92E 2OTJA 4M7AF 2DXBA 1VQ6T 4E7JA 3L2QA 3OYGA 4D6WA 4JLIA 5A2QE 1FXXA 4F7UG 4OMFB 3CCLA 3V8LA 2DKGA 2CJ9A 3A8MB 4C5GA 1VQ7T 3OQ5A 1EIYA 5LJ3g 3QO3A 3JB9F 1QP2A 4PL6A 3EFSA 3ZFJA 4K88A 4YRMA 1X2HA 5LJ3j 4BI4A 1JJ2S 3T9NA 3CMAA 4H2XA 3QPHA 4M78B 2EJ9A 2ZZEA 3LW5E 1G5IA 1JRIA 4Y28E 3A5ZA 3CCUT 4G85A 4P3OA 3C94A 2DPPB 2MF2A 5D6XA 4JRQA 3UGTA 3CCJA 3J81E 1AHJB 4HVCA 4YTLA 2ZZGA 2ODRD 2VV5A 3HXWA 1W4SA 2ZPGB 3HPWA 2P4TA 4FSXA 2YLBA 1XOVA 4M7DA 4II1A 2LNVA 4BE0A 4XU0A 2DEQA 4ZTZB 3MP1A 5KH6A 2ALYA 4YRRA 1VIFA 4E7HA 2X4WA 2ZPIB 4A53A 3WVEB 2RB6A 2HBPA 2EQMA 5GAN2 4B9WA 2M16A 4WJ3M 1SERA 5FRMA 1WLEA 1JJCB 3FB9A 1NJ6A 1BIAA 3JCMb 3N5BB 2X4YA 3MP6A 2ZCEA 3META 2PVDB 3I56T 1ZBXA 3G71A 1KHCA 1UGQB 4M77D 2B8AA 4UPAA 1Q7YC 2DDZA 2X4XA 2V8IA 4OB3B 3M4YA 3PTAA 4L5GA 3CBPA 4EMKB 4RQEA 4EX5A 2QEXA 1QW1A 3HRSA 4EMGA 4YP0A 1XQHA 4PKCC 2IY5B 4LD9K 4ELYC 4XU1A 2L89A 1YBYA 2QA4A 5ELOA 2JN0A 2LX9A 2C7IA 1Y07A 3MEWA 4M7DC 2OAUA 4M78A 1IZ6A 1QVGS 1G5VA 5GANf 3CCRA 4HCBA 1EVLA 4AH6A 4FT4A 4BB7A 3CCMT 1G5HA 3OYCA 4EPCA 3M54A 1K8AU 5GAMj 2A7YA 4PLLA 1H4TA 3CCVT 4M7DF 1KMNA 3MF1A 5GMKi 3INZA 3SDZA 4ZIBA 1Q86U 1WYDA 4OGCA 3G6ET 1NJ1A 1Y96B 3CC2T 4EDUA 2G4CA 3E9FA 4PJOB 4C8QG 4M75E 2DU7A 2D6FA 3MEYA 5KE3A 1VQ6A 1Q7YU 1EVKA 1OI1A 2ARTA 2I4MA 4M7AG 2RK2A 1HXDA 4MZTA 4N4IA 1MHNA 1VQ4A 4UP9A 1YFTA 1X55A 3QYHB 2EIFA 2ZR2A 2KVQG 3JRZA 4KR3A 3REUA 3KXTA 5LJ3f 1WJSA 4CRIA 3CMQA 4C5EA 1BI1A 4NCXA 4TQFA 4YRQA 1NZ9A 3JB9J 4M78C 4A54A 3FLGA 3JB9G 5GAOm 1VQKT 5L8RE 1EIFA 3HFZB 1M90C 5CO7A 1LYLA 1ATIA 2K5FA 2PUKB 2QQBA 2R58A 3OA6A 2X35A 3I55T 3QG1A 1X75C 4NL2A 1X54A 2IY5A 3ZEHA 3L2UA 1NPRA 4M78F 4XQ3A 2QHSA 4PJOE 3V8KA 3BW1A 4CH4A 3QDRB 3X25B 1B34A 2OTJT 5CKEA 3MEAA 1NJ2A 3IKMB 3M9QA 3O8VA 5M9OA 4TVRA 1JB0E 1E1TA 3QZ5B 4Y91A 4K86A 4XEOA 3CCLT 2LTOA 2HNIA 4N4GA 4IURA 3CCEA 3MQZA 1SESA 3HP9A 2F5KA 5I2MA 4CS2A 1VQ9A 1E24A 3M59A 3FRNA 1Y96A 5GANe 4BY6C 1NYRA 2M1HA 4X34A 3MCAB 3VV0A 3GNFB 2VXEA 2LCLA 4C8QE 3NTIA 3CMAT 3HRUA 2CZ6B 4FL6A 1ADJA 1VQOA 5GANd 5GAOr 3L2VA 3LWIA 2PQWA 3LLRA 1NE8A 4P75C 2CJAA 4M7AE 5C52B 2ZIMA 2XD0A 4DPGA 1EOVA 5C0MA 5CVIA 2CJBA 3KFUA 5C6SA 3S3NA 4FIBA 1G3WA 2RHYA 2CZ7B 1I81A 1KG1A 1FX7A 2DIGA 2LT1A 3OW2S 3V7SA 3UPUA 5GANh 3RERA 3A8LB 3JCMc 4HWOA 4PHCA 4C0DB 3HFZA 3CPWA 4C92G 4XTUA 3E1SA 3OYNA 5HKCA 3QIIA 1ASZA 2E6NA 3A8OB 4HT8A 2I4NA 3OYJA 2RI5A 4N0AA 5LJ3e 2AKWA 5GAOp 4LDUA 4LDVA 5GAMf 2LDMA 5LL6S 3QTCA 3V8JA 2P0PA 3VU3C 3E9IA 2E70A 5LJ3d 1EIYB 2NS6A 3OS0A 2I4LA 2ZPEB 3HXZA 4J6WA 1N6AA 2F69A 3G71T 2ZT5A 1B76A 3BJUA 3OYAA 2LT4A 4LD6A 4YRLA 3VQXA 4ZN1A 4ZGDB 2RK1A 1RI0A 4QQ6A 4YRFA 1FWZA 4MMLA 2QEXT 1SETA 2XG8D 1S72A 2ARUA 1BI0A 3FEOA 1YJWT 3JSCA 4ZTFA 1M9SA 2PMEA 5FU6C 2HD0A 2QA4T 2CZ0B 2DAQA 1Q81U 2E6ZA 2QHUA 2RHUA 3BDLA 5GANg 3NETA 2DD4A 3DSQA 4QVCA 2RJFA 4YRTA 2RI2A 1VQKA 1KC8C 1GGMA 1G51A 3E9GA 3LC0A 4J6XA 4M77B 3QYGB 3UH0A 3J7AF 3PFSA 4HT9A 4J15A 2XK0A 2KSSA 4OP0A 2V8JA 3JCMW 3NTHA 3JCMQ 5LJ5j 3I55A 2OTLA 3LYIA 5GAN3 4BD3A 2PVGB 3CXCA 4HWRA 1U1TA 5DM7R 3GIBA 2E64A 5GMKh 2VGMA 1I8FA 3PGGA 3A32A 3LSSA 1UGRB 5CAIA 4MDXA 3X20B 4L87A 4LNSA 5A0LA 1YCYA 3OS1A 5C51B 2R5MA 4RG2A 2O4XB 3BY7A 4R55A 1VUBA 1D3BB 3REXA 1VQ4T 2XHCA 2RA2A 1KQSS 4BUGA 1O9SA 5CKHA 3DLMA 3P8TA 2E10A 2DXCA 4A4GA 2QI2A 3HY0A 3HXYA 2RD1A 1VQMA 1NJIC 2Q7GA 2FHDA 4M7DE 3CBMA 3CC4A 5CQXA 3PMTA 5GAMe 4IUQA 5D6WA 3OBWA 5GMKl 3M4QA 2Y4YA 3PT9A 3MEVA 5CCAA 1VQLT 3MEUA 1B8AA 5FLXE 3CMEA 1G3YA 5GAMd 5CK9A 2DTOA 4C0DC 3RF1A 3MP8A 2QQ9A 4YDQA 3OD1A 1OZ2A 3PZCA 5CR2A 4XTZA 2QQSA 3X28B 3QO8A 1I4K1 3C95A 4RMOA 3HFNA 4OF1A 4M75G 4IKFA 2P5IA 3J80E 2DXUA 3S6WA 4QVDA 4F7UB 3MHXA 5GMKj 2XTIA 4M77A 3S3OA 1QVPA 2EL9A 4E7IA 5GAMh 4KUDK 1W2BA 3CCET 2Q7EA 4RCBA 5K1PA 4MZPA 3IALA 1H4QA 4K87A 2E5QA 3PIPA 1VQ9T 4ELZC 1UGPB 1XTDA 1WQ7A 1XNIA 4UC4A 3HHTB 3FIFA 4XK8E 4C92D 2E12A 3WXMB 2WSFE 3QO7A 4RMFA 2ODRC 1YGBA 1E1OA 3M53A 2JTMA 2RJEA 4XTXA 4YRSA 5A0DA 4C0GA 4YRGA 2IVWA 4BY6B 1NJIU 4M78E 1VQOT 2O4XA 2DQ0A 4C0FA 2IG0A 1D3BA 4MZMA 3FDRA 5FRNA 3PCOB 3OS2A 1H3ZA 4PG3A 5J3BA 3ER0A 1EFWA 4Q15A 3LGLA 2BKDN 3OYEA 4YROA 3QBYA 2LQKA 4ZGJB 4YRCA 4JS4A 4OB0B 1NJ5A 2P0LA 4PJOG 1YJWA 3SFMA 4YREA 3NELA 4BDYA 2RHXA 3HRKA 5GAN6 3CCST 4UP7A 1M1FA 4M77C 3JCMf 1YIJA 3BDUA 1B34B 4TVAA 4FT2A 3P8HA 4CH6A 3HL8A 3R6OA 1LJOA 2LRQA 3RESA 3G4ST 1KHIA 4JRKA 3L2WA 2XDBA 5GAN7 5GAMg 3OMGA 5LJ5f 3W3SA 4TVYA 2ZT8A 3RIRA 2EQUA 4YCWA 4M77F 1YFRA 4JDSA 3IKLA 5D6YA 3PNWC 1RL2A 2EJFA 4NS5A 1M5Q1 2EYQA 3KUFA 12ASA 5DLOA 2M9UA 4YPFA 4F7UA 3CC7A 2E5AA 4H2WA 4L6V5 2RI3A 1M1GA 3CCQA 3HXVA 3UT1A 1QVFS 2A8EA 3GPLA 1SRYA 2QXFA 3RUXA 5I21A 1S72T 4HWSA 4X5OA 3NENA 2VGNA 5FU7C 2XI9A 4OB2B 3SWNB 5FU6B 1YJNA 3PCOA 4BE2A 3EFRA 5KNNA 2DZ9A 2EAYA 2JVVA 3HY1A 3TREA 2PUOB 3QNEA 3G7ZA 2XU8A 3OYMA 4YCVA 1VQLA 5GAOq 4P75A 1B7YB 2OTLT 2RHZA 4H2UA 3GOXA 2AKWB 1N27A 3QKJA 3VBBA 2ZT6A 3M5AA 5GMKm 1VQ5T 3RACA 2ZXFA 3ASKA 1JJ2A 4P71C 1YI2A 4JJNK 1VQZA 1K9MC 5CKBA 1KOGA 1BIBA 1X6OA 1G3SA 2LC4A 2ZTGA 3VYHB 2FB7A 4E7KA 3HXXA 3DKMA 2FVUA 5IAYA 4H2TA 2Q5HA 4P74A 2HQXA 5IN1A 1YB3A 1KD1C 2DZCA 4F7UF 1RIQA 2FL7A 4M75D 3JCMe 2K4YA 2MWOA 1VQMT 3I7FA 4BACA 4TWAA 2WSEE 2CYZB 1UEBA 3A74A 5HK0A 3ME9A 4ZTUB 3CC4T 4C5HA 3L42A 5LJ5e 1N9WA 1X01A 4H02A 3OMCA 1M90U 4CH5A 3CMET 2DVEA 2YLCA 2E41A 1VQNA 5LJ5d 1PYSB 1Z7MA 3IG2A 1WGSA 4X9DA 1Q82C 1M4ZA 2ARSA 2KQWA 1K73C 3VUZA 3SWNA 3JCMh 3X24B 3A7AA 3M4PA 1K9MU 3RKWA 2CKKA 3F70A 4J7FA 2MAMA 5C53B 2L8DA 3CCSA 1WU7A 4OLFA 2CS7A 4G84A 2R57A 4TVWA 5F5WA 1ZHIA 3OSSC 5LJ5h 1B7YA 4PJOD 4P74C 2K5LA 3G4SA 4YRIA 3H6ZA 2HQEA 2AHJB 2RHSA 3OYKA 4E51A 2L3RA 1I5LA 2MMPA 2QQAA 1M1KC 1C0AA 2ZNJA 2BUDA 1QVGA 2C06A 3DB3A 1GXIE 2GFAA 1NJ8A 4M7DG 2DXTA 4CS4A 3BFMA 4KQEA 1IL2A 4QQDA 1YJ9A 4NL3A 2JOYA 5K1XA 1O75A 4LVLA 4C8QD 5GMKe 3RKYA 1YHQA 3SWNC 2DTHA 3OYIA 4VUBA 1K73U 2G3RA 3VUBA 2JUFA 1LOJA 2E1HA 1R8OB 3JCMg 4JLGA 1YIJT 4A4HA 4M7AD 3A8GB 4QVZA 3G1ZA 4X9CA 3R07A 4P5NA 4KT0E 4DA4A 2R5AA 3OYBA 3QXEB 4J83A 3OYFA 1PYSA 5LJ5g 4H2YA 5GAOn 3LX7A 4C8QC 2LCCA 2HAXA 2ZZFA 3JB9D 3GP8A 3OYHA 1M1KU 4RQFA 3URGA 1BBUA 4HA8A 1YITA 1VQ5A 3CC7T 4KR2A 1Z7NA 1V29B 2DJZA 2F5TX 4M7AC 4C0ZA 1N9RA 5FROA 2I4OA 4M78G 3CCQT 1DJ7B 4C8QF 4E47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 J;  1M8V A;  4M78 C;  4P72 C;  4A54 A;  1D3B A;  3JB9 G;  1NYQ A;  2AMC A;  5GAO m;  3PCO B;  5ELN A;  4Q6G A;  3HFZ B;  4PG3 A;  1B70 A;  4C8Q A;  1LYL A;  1ATI A;  1QF6 A;  1EFW A;  3A31 A;  4XTY A;  4Q15 A;  1E22 A;  1HTT A;  1L0W A;  1ADY A;  4YRO A;  4YRC A;  1NJ5 A;  2ZR3 A;  2P0L A;  2EWN A;  4NL2 A;  4PJO G;  3QSU A;  1N9S A;  1X54 A;  4M7A A;  4H2S A;  2IY5 A;  4XEM A;  4YRE A;  3JCM J;  4P3N A;  4M78 F;  4UP8 A;  3NEL A;  4M77 G;  1LNX A;  4XQ3 A;  5GAO l;  2QHS A;  3P8Y A;  3NEM A;  4PJO E;  3V8K A;  3BW1 A;  4CH4 A;  3HRK A;  5GAN 6;  4M77 E;  3A7U A;  4JRI A;  4PJO C;  4UP7 A;  4RCC A;  2XGT A;  4M77 C;  3JCM f;  1B34 A;  3BDU A;  2I2L A;  1B34 B;  4J5Y A;  3FJP A;  1USY A;  1KMM A;  4TVA A;  1NJ2 A;  3IKM B;  4CH6 A;  4TVA B;  4XTW A;  4CH3 A;  1LJO A;  1J5W A;  3JCM V;  3RES A;  4JRK A;  1E1T A;  5GAN 7;  3UFG A;  1YFS A;  5GAM g;  4Y91 A;  2QTX A;  4K86 A;  4XEO A;  1U1S A;  2HNI A;  4C92 A;  5LJ5 f;  3W3S A;  4C92 B;  4TVY A;  2ZT8 A;  1SES A;  4H2X B;  3TUP A;  4PJO F;  3M4G A;  4CS2 A;  1ASY A;  3RIR A;  4YCW A;  4M77 F;  1E24 A;  1YFR A;  3IKL A;  5LJ3 h;  3HXU A;  2EJF A;  1M5Q 1;  12AS A;  1Y96 A;  5GAN e;  3QO5 A;  3JCM X;  4XTV A;  1NYR A;  4YPF A;  3QHS A;  4F7U A;  2E3C A;  2E65 A;  2E5A A;  4H2W A;  5GAN 4;  1WPY A;  1EQR A;  4TTV A;  1JBM A;  1H64 1;  3SB2 A;  2VXE A;  4C8Q E;  3HXV A;  4TQD A;  4O2D A;  1SRY A;  1ADJ A;  4P3P A;  5GAN d;  5GAO r;  2ZGW A;  3RUX A;  5I21 A;  4P75 C;  4N0A C;  3RGL A;  4HWS A;  5GAN j;  2CJA A;  4X5O A;  4M7D B;  3NEN A;  3TEH A;  4M7A E;  5C52 B;  4YRP A;  2ZIM A;  2ZT7 A;  4DPG A;  1EOV A;  2ZIN A;  2CJB A;  3KFU A;  4XU2 A;  2ALY B;  2FYK A;  1I81 A;  3L2Z A;  3TEG A;  1MGQ A;  2Q7H A;  3SWN B;  4HWP A;  3V7S A;  3HFO A;  5GAN h;  3PCO A;  3RER A;  1TH7 A;  3JCM c;  1USY C;  4HWO A;  4PHC A;  3EFR A;  1W66 A;  11AS A;  3HFZ A;  5KNN A;  2DZ9 A;  4C92 G;  2EJG A;  4XTU A;  2EAY A;  3HY1 A;  4J6Y A;  3QNE A;  2C8M A;  2Q5I A;  1ASZ A;  4C92 E;  4YCV A;  4M7A F;  4HT8 A;  2I4N A;  4C92 C;  5GAO q;  4P75 A;  4N0A A;  2YHT A;  1B7Y B;  5LJ3 e;  2AKW A;  4M7D D;  2ZIO A;  4WI1 A;  3VQY A;  4BWA A;  4H2U A;  5GAO p;  4JLI A;  2AKW B;  3JB9 I;  5E3I A;  5GAM f;  4M75 B;  4F7U G;  3HRI A;  3V8L A;  3VBB A;  2ZT6 A;  3QTC A;  5GMK m;  2DKG A;  3RAC A;  4F7U E;  2CJ9 A;  2ZXF A;  4YRK A;  3V8J A;  4P71 C;  3VU3 C;  3E9I A;  1EIY A;  1VQZ A;  2VXF A;  5LJ3 d;  5LJ3 g;  1KOG A;  1BIB A;  1EIY B;  3QO3 A;  3JB9 F;  2ZTG A;  4NOY A;  2FB7 A;  3L4G B;  3EFS A;  4XU3 A;  2I4L A;  1NNH A;  4K88 A;  1X2H A;  3HXX A;  4J6W A;  4C92 F;  3HXZ A;  4YRM A;  1HC7 A;  5LJ3 j;  4YRN A;  2CGH A;  2ZT5 A;  1B76 A;  3BJU A;  4YRL A;  3VQX A;  4H2T A;  4YCU A;  2Q5H A;  4P74 A;  4H2X A;  2DU5 A;  1YB3 A;  5DY9 A;  4M78 B;  2DZC A;  2EJ9 A;  4YRF A;  4MML A;  2ZZE A;  4F7U F;  1SET A;  1RIQ A;  1WNL A;  1G5I A;  1JRI A;  4M75 D;  2ARU A;  4P73 A;  3A5Z A;  3JCM e;  3VQW A;  4G85 A;  4V2S A;  3I7F A;  4P3O A;  4TWA A;  4EMH A;  2RHQ B;  4RDX A;  4P71 A;  2RM4 A;  2ZNI A;  3A74 A;  2PME A;  4ZTU B;  5HGQ A;  2DTI A;  3HFV A;  2DQ3 A;  2J3M A;  3UGT A;  4WJ4 A;  2QHU A;  5LJ5 e;  1N9W A;  2PMF A;  1X01 A;  4YRJ A;  5GAN g;  3NET A;  4H02 A;  4YYE A;  3DSQ A;  4HVC A;  4QVC A;  2ZZG A;  2ODR D;  3HXW A;  4CH5 A;  4YRT A;  2CIM A;  1GGM A;  1G51 A;  2YLB A;  4M7D A;  2DVE A;  3LC0 A;  2YLC A;  4J6X A;  4M77 B;  3VQV A;  2E41 A;  4XU0 A;  4M78 D;  3UH0 A;  2DEQ A;  5LJ5 d;  1PYS B;  1Z7M A;  3LSQ A;  4ZTZ B;  3IG2 A;  4HT9 A;  1BBW A;  2ALY A;  4J15 A;  4YRR A;  4OP0 A;  4X9D A;  3JCM W;  3JCM Q;  5LJ5 j;  4A53 A;  2ARS A;  2K57 A;  2RB6 A;  5GAN 3;  4HWR A;  3SWN A;  3JCM h;  1U1T A;  3GIB A;  3A7A A;  3M4P A;  5GAN 2;  3RKW A;  2E64 A;  5GMK h;  4WJ3 M;  1SER A;  1I8F A;  3PGG A;  3A32 A;  3LSS A;  1JJC A;  5C53 B;  1WLE A;  1JJC B;  3FB9 A;  5CAI A;  1WU7 A;  4OLF A;  4G84 A;  1NJ6 A;  1BIA A;  4L87 A;  3JCM b;  4LNS A;  4TVW A;  5F5W A;  1YCY A;  5LJ5 h;  1B7Y A;  2ZCE A;  5C51 B;  3RL6 A;  4BW9 A;  3UGQ A;  3A5Y A;  4PJO D;  4P74 C;  3BY7 A;  1QE0 A;  1X56 A;  4YRI A;  4M77 D;  1D3B B;  3REX A;  2AMC B;  4M75 A;  4UPA A;  2DDZ A;  2RHS A;  4P73 C;  2RA2 A;  2RHS B;  1B70 B;  4E51 A;  4C8Q B;  2VC8 A;  3V7C A;  1I5L A;  3P8T A;  2E10 A;  4EMK A;  3P8V A;  1HK9 A;  4EMK B;  4RQE A;  4EX5 A;  1C0A A;  3L4G A;  4EO4 A;  2ZNJ A;  3HY0 A;  3JB9 H;  3HXY A;  4MMK A;  2RD1 A;  1NJ8 A;  4EMG A;  4YP0 A;  4DQ2 A;  2IY5 B;  4M7A B;  4M7D G;  4HWT A;  2DXT A;  4CS4 A;  3HSB A;  4XU1 A;  3BFM A;  4KQE A;  1IL2 A;  2Q7G A;  4M7D E;  5ELO A;  2JN0 A;  3ICA A;  5GAM e;  2C7I A;  3ERR A;  4M7D C;  5GMK l;  3M4Q A;  4WF2 A;  4M78 A;  4P72 A;  4NL3 A;  3L1A A;  5GAN f;  5K1X A;  1B8A A;  1EVL A;  4AH6 A;  3RKX A;  4H2V A;  5GAN 5;  3MF2 A;  1G5H A;  4C8Q D;  5GMK e;  5GAM d;  2RHQ A;  3RKY A;  3SWN C;  2DTH A;  4CS3 A;  2DTO A;  5GAM j;  1H4T A;  2J3L A;  3RF1 A;  1LOJ A;  2E1H A;  4YDQ A;  4M7D F;  1KMN A;  1H4V B;  3MF1 A;  3OD1 A;  3JCM g;  3JCM d;  3PZC A;  5GMK i;  3INZ A;  4M7A D;  4XTZ A;  3QO8 A;  4ZIB A;  1I4K 1;  1WYD A;  1KQ2 A;  3G1Z A;  3E9H A;  4X9C A;  3R07 A;  1NJ1 A;  1Y96 B;  3HFN A;  4M75 G;  2G4C A;  4PJO A;  2P5I A;  2DXU A;  4PJO B;  1WQW A;  4QVD A;  4F7U B;  5GMK j;  2XTI A;  4M77 A;  4C8Q G;  2QHV A;  3AHU A;  4M75 E;  2EL9 A;  2DU7 A;  3MEY A;  3V7R A;  1PYS A;  5GAM h;  4M75 C;  5LJ5 g;  3JCM P;  2Q7E A;  4RCB A;  4H2Y A;  5GAO n;  5K1P A;  4C8Q C;  3WQZ A;  2Y90 A;  3HTZ A;  3IAL A;  4K87 A;  1H4Q A;  2ZZF A;  1EVK A;  4EMK C;  2ART A;  2I4M A;  3JB9 D;  4JUV A;  1X2G A;  1HXD A;  4M7A G;  1WQ7 A;  4UP9 A;  1YFT A;  4C92 D;  3FIF A;  1X55 A;  1H4S A;  4RQF A;  2ZR2 A;  3A7R A;  5GAN 8;  4KR3 A;  3REU A;  3TEH B;  1BBU A;  4HA8 A;  4KR2 A;  1Z7N A;  2DJZ A;  4M7A C;  1KQ1 A;  2QHT A;  3QO7 A;  1N9R A;  4RMF A;  2ODR C;  5LJ3 f;  2I4O A;  4M78 G;  1YGB A;  3CMQ A;  1E1O A;  4M75 F;  4XTX A;  4YRS A;  1FYF A;  4YRG A;  4PNO A;  4M78 E;  3QUI A;  4C8Q F;  4NCX A;  4TQF A;  4YRQ A;  2DQ0 A; 
#chains in the Genus database with same CATH topology
 1M8V A;  2QDY B;  1NYQ A;  2WAC A;  2KNB B;  4Q6G A;  1C0M A;  4LDX A;  1OU9 A;  3VRY A;  1WHK A;  1VYV A;  1BKB A;  2K2V A;  3GNG A;  5DLQ E;  1OZ3 A;  4XTY A;  1YJN Q;  2PU9 B;  4ME7 A;  3HKS A;  2ECZ A;  3OY9 A;  1PWT A;  1L0W A;  1ADY A;  5KYX A;  2RH2 A;  4E2F B;  2BIV A;  3CD6 T;  4CC4 B;  2E4H A;  1N9S A;  1VQL Q;  5FU7 B;  1BI2 A;  4XEM A;  3JCM J;  4P3N A;  4UP8 A;  2CZ1 B;  3H8Z A;  1YJN T;  1LNX A;  2XID A;  1JU5 C;  2YDL A;  5GAO l;  3P8Y A;  4FYY B;  4M77 E;  3A7U A;  4JRI A;  2HCK A;  3M57 A;  2RQV A;  2XGT A;  2O2O A;  1KC8 U;  2I2L A;  4JZ3 A;  1KMM A;  2EGA A;  3JAM E;  1PC0 A;  2RHI A;  5CQY A;  4TVA B;  2EYX A;  4RTT A;  3E2U A;  4XTW A;  5IT9 E;  1J5W A;  4CH3 A;  3JCM V;  4OGE A;  1U8R A;  5KCH A;  1YI2 Q;  1OX8 A;  4PLI A;  5KE2 A;  1RAI B;  2B86 A;  3OB9 A;  2DBM A;  1VQP A;  2PNI A;  1QCF A;  4N4H A;  3UA7 A;  1U1S A;  1I5O B;  4C92 A;  1P92 A;  4KUL A;  2ZCF B;  1PSF A;  4ZTJ A;  2BZ8 A;  3ZBD A;  4OB1 B;  1E6G A;  1YI2 T;  2HBW A;  4B9X A;  4ZN3 A;  1ASY A;  2EGE A;  3OS5 A;  4FYV B;  1IRE B;  4BE1 A;  3A8H B;  3CCE Q;  2ZPF B;  1QVF P;  3QO5 A;  3QZ9 B;  3MO8 A;  3QHS A;  1VQ8 T;  1M8M A;  1QCO A;  4TTV A;  4A4F A;  3VRZ A;  4O6J A;  4P3P A;  2ZGW A;  2VYT A;  2ZPB B;  3CBO A;  2MYS A;  2YRD A;  3EG3 A;  2J06 A;  1W1F A;  3RGL A;  3OW2 A;  2HDA A;  2RF0 A;  4YRP A;  2MWP A;  1VIE A;  2ZT7 A;  4QQG A;  3VS2 A;  2ZIN A;  4XU2 A;  2ZZD A;  2FYK A;  3DLL A;  3VS4 A;  1K8A C;  4BI3 A;  3L2Z A;  1MGQ A;  2XKO C;  1VQN Q;  1YFN A;  3D7S B;  5CKD A;  4OML A;  1M27 C;  4AFQ C;  1TH7 A;  4D8K A;  1GCQ C;  1W66 A;  11AS A;  2EJG A;  1Q86 C;  1WIE A;  4J8O A;  1VQN T;  1TXQ A;  2C8M A;  2JW4 A;  2Q5I A;  2V8K A;  4QW2 A;  2XIC A;  2CP7 A;  2LVM A;  3GLX A;  4C92 C;  2YHT A;  2M0O A;  3CCS Q;  2ZIO A;  4M7D D;  4WI1 A;  3VQY A;  4BWA A;  4RKU E;  3JB9 I;  5E3I A;  2KXC A;  2JM9 A;  1BI3 A;  2E5K A;  3CPW S;  4M75 B;  3HRI A;  5CKF A;  1UB4 A;  1AZG B;  1N8R C;  4F7U E;  4YRK A;  1PRL C;  4MDW A;  3VYG A;  3G4S Q;  1JXO A;  1G2B A;  2VXF A;  1G3T A;  4O5V A;  4NOY A;  3M55 A;  1UEC A;  2MPX C;  1VA7 A;  4IIO A;  3L4G B;  4XU3 A;  1NNH A;  2CP3 A;  2DBK A;  4RTX A;  4C92 F;  3LWH A;  1HC7 A;  2AT1 B;  4YRN A;  2CGH A;  1ZUY A;  4RG8 A;  2X51 A;  2RN8 A;  4IUU A;  1R77 A;  2DK3 A;  2KYM A;  4YCU A;  4LVI A;  2JNG A;  3EG0 A;  2ATC B;  2JMA A;  2DU5 A;  2LNH B;  3UWN A;  5DY9 A;  3TCJ A;  4OVA A;  5A0G A;  4JRP A;  3CEY A;  1RI9 A;  2GF7 A;  3OYL A;  3DB4 A;  1WNL A;  2OI3 A;  4JJD A;  3TEE A;  2MI6 A;  4P73 A;  2HQH A;  3VQW A;  2ZPH B;  5AYF A;  4V2S A;  3EH2 A;  1IO6 A;  1YJ9 Q;  3UAT A;  2P4R A;  5L23 A;  4EMH A;  2RHQ B;  4RDX A;  4AFZ C;  4P71 A;  2RM4 A;  2ZNI A;  1AWX A;  3MKD A;  3H0I A;  2O9V A;  5HGQ A;  2DTI A;  3HFV A;  2DQ3 A;  2J3M A;  4WJ4 A;  1X2Q A;  3SEM A;  2FRW A;  4IUT A;  2DIQ A;  1YJ9 T;  1YHQ Q;  2PVO B;  2PMF A;  5J39 A;  4YRJ A;  4GLK A;  4YYE A;  4E7L A;  1QKW A;  1OYX A;  1BYM A;  2O01 E;  2CIM A;  5HK3 A;  3RMQ A;  1M3B A;  4J7I A;  1K9M R;  1SG5 A;  2CSI A;  1SHF A;  3LGF A;  3VQV A;  1YHQ T;  5FWC A;  4M78 D;  1WX6 A;  4CI0 C;  2P0Q A;  3GF5 A;  4LVK A;  3LSQ A;  5I22 A;  2YSQ A;  1BBW A;  3QWY A;  1FMW A;  3RMS A;  4IUV A;  2K57 A;  1N8R U;  3CD6 A;  4FU6 A;  4QT7 A;  1KD1 R;  3QJY A;  2RO0 A;  1JJC A;  2K3X A;  2JTF A;  2A28 A;  2KRM A;  2DEU A;  1VQ7 A;  1KQS A;  1PSE A;  2GQI A;  2ED1 A;  1Y7X A;  9ATC B;  1YIT Q;  1VQ5 Q;  4KBM B;  2WSC E;  3CXC S;  3RL6 A;  4BW9 A;  3UGQ A;  4GY5 A;  4BDZ A;  3A5Y A;  4Q5W A;  1QE0 A;  2RQT A;  1X56 A;  1TUD A;  3C4S A;  2K5I A;  2AMC B;  4M75 A;  1KIK A;  2LZ6 B;  4KUI A;  3X26 B;  4P73 C;  2RHS B;  1B70 B;  2RJD A;  3P8B B;  2DIL A;  4C8Q B;  2VC8 A;  1YIT T;  3V7C A;  4EMK A;  2H8H A;  3P8V A;  1HK9 A;  4HCZ A;  3LH0 A;  4ESR A;  3L4G A;  3OYY A;  1WXT A;  4EO4 A;  3JB9 H;  4MMK A;  2VWF A;  4R56 A;  3CCU A;  4DOW A;  1E7O A;  2DD5 A;  4IUP A;  4DQ2 A;  1MMD A;  2EYZ A;  4HVW A;  4M7A B;  1C1A A;  4HWT A;  5J26 A;  3HSB A;  1VQ8 A;  3QWX X;  1Q82 R;  1WXB A;  3OBY A;  2DL8 A;  2DRK A;  1TUG B;  3ICA A;  1K73 R;  1K0X A;  3ERR A;  4BI8 B;  4WF2 A;  4OMP A;  2NYS A;  4P72 A;  5EG2 A;  3L1A A;  1AVZ C;  4A4E A;  2EQK A;  3M58 A;  4LDW A;  1SSF A;  3RKX A;  1NPP A;  4H2V A;  5GAN 5;  2RQW A;  2KDS A;  1UJ0 A;  2KAF A;  3MF2 A;  2J6K A;  4KGX B;  3HRT A;  2RHQ A;  2GCX A;  1HSQ A;  4CS3 A;  4Y92 A;  2P0K A;  2LQW A;  1MV3 A;  3NMZ C;  2E3I A;  3M0T A;  1PNJ A;  1UG1 A;  2GFU A;  5IHI A;  1ZUK A;  1NYG A;  4LDY A;  4WCI A;  5IHN A;  2J3L A;  1AOJ A;  1H4V B;  2H3J A;  3JCM d;  1X6G A;  1W6X A;  2RQU A;  1NBE B;  3A98 A;  1KQ2 A;  3EG2 A;  3E9H A;  3CPF A;  2V1Q A;  4PJO A;  1M1K R;  4L59 A;  1WQW A;  2KRS A;  2P84 A;  3TU4 K;  4F14 A;  3EHQ A;  3AHU A;  1VQP T;  2QHV A;  2BZX A;  2G6F X;  1OOT A;  3V7R A;  1H92 A;  1MMN A;  3EHR A;  1MUZ A;  1BB9 A;  4M75 C;  3JCM P;  3M0Q A;  2KMT A;  2HL5 C;  4RUG A;  3WQZ A;  2Y90 A;  1WHG A;  3HTZ A;  5I2S A;  4KH0 B;  3I56 A;  4FYX B;  1QCN A;  2DL7 A;  4EMK C;  5IXF A;  1FMK A;  2X4J A;  4JUV A;  2D9T A;  1X2G A;  4CC7 A;  2NLU A;  1H4S A;  2MCN A;  3A7R A;  5GAN 8;  5KCO A;  3QJ6 A;  5AT1 B;  3TEH B;  2RPN A;  1W2B S;  2NUZ A;  1KQ1 A;  2QHT A;  1WA7 A;  2EKO A;  3CCJ T;  1WJQ A;  2XDP A;  5EC7 A;  1ZQ1 A;  2RJC A;  4M75 F;  1FYF A;  4DOV A;  3SHW A;  4PNO A;  1Y71 A;  3QUI A;  2VKN A;  3H41 A;  1Q81 C;  1W70 A;  2QG9 B;  4P72 C;  1SKU B;  3EFO B;  2AMC A;  1WJR A;  1ACM B;  3S3M A;  1PKT A;  1KD1 U;  2DER A;  5ELN A;  2DX1 A;  1EFN A;  1B70 A;  1UHC A;  4C8Q A;  2KY9 A;  1QF6 A;  1ZX6 A;  3A31 A;  3L2R A;  4A4K A;  1E22 A;  4Z02 A;  1NEG A;  1HTT A;  3UDC A;  5HY6 A;  4LVJ A;  3NFC A;  3VJP A;  3C12 A;  2AKL A;  5KYX B;  3M56 A;  2EFI A;  1J3T A;  2QQR A;  3CCM A;  2ZR3 A;  2EWN A;  3WVD B;  3QSU A;  4H2S A;  2VVK A;  5CIU A;  4M7A A;  2QDL A;  1X6B A;  3P8D A;  4M77 G;  4XAX B;  3NEM A;  2CRE A;  1YWP A;  4PJO C;  2L5Q A;  3CCV A;  4RCC A;  4FM4 B;  2JZ2 A;  2NWM A;  1T3S A;  2VUB A;  5FWB A;  4J5Y A;  3FJP A;  4HKE A;  3VS5 A;  1USY A;  4C5I A;  3RDV A;  3G6E A;  2FEI A;  1EX4 A;  3PE0 A;  1WXU A;  3CC2 A;  2COZ A;  1QP3 A;  2HSE B;  3UFG A;  4JS5 A;  1YFS A;  1RAA B;  3FC3 A;  2QTX A;  1Q82 U;  2VB6 A;  1QMC A;  2X3W D;  2K79 A;  1GFD A;  2OAW A;  4C92 B;  2CDT A;  3HTR A;  1U5S A;  3ULR B;  4H2X B;  3TUP A;  2DFU A;  4PJO F;  2FZG B;  1X69 A;  3M4G A;  4ZGE B;  4HT4 A;  2LQ8 A;  5D7U A;  3Q1J A;  1QVF A;  5LJ3 h;  3EAE A;  4HCC A;  2K9G A;  3HXU A;  1GFC A;  4ATO A;  3A5Z B;  1ZA1 B;  3JCM X;  1SF9 A;  4XTV A;  4F16 A;  1JO8 A;  2E3C A;  3SD4 A;  2ZAE A;  2FO0 A;  3VKI A;  2E65 A;  5GAN 4;  1WPY A;  1EQR A;  1K1Z A;  1JBM A;  1H64 1;  1OPL A;  3PIO A;  2KRO A;  3SB2 A;  2OX7 A;  2JMC A;  2YRV A;  1UGS B;  2XDD A;  2DM1 A;  4LVM A;  4TQD A;  4O2D A;  1I0C A;  1B07 A;  3NTK A;  3CCR T;  1ARK A;  1TSF A;  2O9S A;  3OYD A;  2Y4X A;  5ECA A;  2RMO A;  4N0A C;  4PFO A;  5GAN j;  1D1B A;  4M7D B;  2KK4 A;  1CKB A;  2A3L A;  3TEH A;  2EQJ A;  3PMI A;  3E19 A;  2ALY B;  2EBP A;  1R0B G;  2K3Y A;  2JS2 A;  2D0Q B;  3TEG A;  2Q7H A;  2V26 A;  3VS6 A;  4HWP A;  1RAB B;  3EFO A;  3HFO A;  2GQV A;  1USY C;  3OSV A;  2DO3 A;  2A08 A;  1OPK A;  3CD6 Q;  4J6Y A;  4CC3 A;  1VYT A;  4HXJ A;  3CPW P;  3KBG A;  4C92 E;  1K0S A;  2OTJ A;  4M7A F;  2DXB A;  1VQ6 T;  1SPK A;  4E7J A;  3L2Q A;  3OYG A;  1VQ7 Q;  4D6W A;  1TOV A;  4JLI A;  5A2Q E;  1D0Y A;  1FXX A;  1ZBJ A;  4F7U G;  4OMF B;  3CCL A;  3V8L A;  4PFZ A;  2DKG A;  2CJ9 A;  3A8M B;  4C5G A;  1VQ7 T;  4J9D A;  3OQ5 A;  1EIY A;  5LJ3 g;  4PJN A;  3QO3 A;  3UF4 A;  3JB9 F;  1QP2 A;  1FMV A;  1X2K A;  2KT8 A;  4PL6 A;  4Z89 A;  3EFS A;  3ZFJ A;  1GCQ A;  4K88 A;  4YRM A;  1X2H A;  4DEX A;  5LJ3 j;  4BI4 A;  1IB8 A;  1F1B B;  1K8A R;  1UUE A;  3CCU Q;  1JJ2 S;  2J6O A;  3T9N A;  3CMA A;  1UFF A;  4H2X A;  3QPH A;  4M78 B;  1VQ8 Q;  2EJ9 A;  2ZZE A;  3LW5 E;  4DBR A;  1G5I A;  1JRI A;  1Q86 R;  4Y28 E;  2AKK A;  3A5Z A;  3CCU T;  4G85 A;  4P3O A;  3C94 A;  2DPP B;  2MF2 A;  5D6X A;  4JRQ A;  4GLM A;  3UGT A;  3CCJ A;  4RTZ A;  3EGX B;  4J9I A;  4F17 A;  3J81 E;  1AHJ B;  4HVC A;  4YTL A;  2HZY A;  1N8R R;  2ZZG A;  2ODR D;  2VV5 A;  3HXW A;  1W4S A;  2ZPG B;  3HPW A;  2P4T A;  4FSX A;  7AT1 B;  2YLB A;  1XOV A;  4M7D A;  4II1 A;  2LNV A;  4BE0 A;  2O31 A;  4XU0 A;  2DEQ A;  4ZTZ B;  3MP1 A;  5KH6 A;  2ALY A;  4AG1 C;  4YRR A;  1VIF A;  4E7H A;  2X4W A;  2GTJ A;  2ZPI B;  4A53 A;  3WVE B;  2RB6 A;  1YWO A;  2EGC A;  2HBP A;  1IRX A;  2EQM A;  5GAN 2;  4B9W A;  2M16 A;  1C6V X;  3CXC P;  2X9H A;  1SER A;  4WJ3 M;  3I56 Q;  3H0F A;  5FRM A;  1IXD A;  2GNC A;  1KK7 A;  2IIM A;  1WLE A;  1JJC B;  3FB9 A;  3H0H A;  1NJ6 A;  1BIA A;  1AD5 A;  3JCM b;  3N5B B;  2X4Y A;  3MP6 A;  5IH2 A;  2ZCE A;  3MET A;  2PVD B;  3EGD B;  2LP5 A;  3I56 T;  1ZBX A;  3G71 A;  1KHC A;  2LQN A;  1UGQ B;  4M77 D;  1H8K A;  2B8A A;  1UJY A;  4UPA A;  1Q7Y C;  2DDZ A;  2X4X A;  2V8I A;  4OB3 B;  1H3H A;  3I5S A;  3M4Y A;  3PTA A;  2YXY A;  4L5G A;  3CBP A;  4EMK B;  4RQE A;  1MND A;  4EX5 A;  1OX9 A;  2QEX A;  3CQT A;  1QW1 A;  2DLP A;  3HRS A;  4EMG A;  4YP0 A;  1XQH A;  4PKC C;  2IY5 B;  4LD9 K;  6AT1 B;  4ELY C;  2FZC B;  4XU1 A;  2ESW A;  1JXM A;  4DBH A;  2L89 A;  1YBY A;  1TS9 A;  2QA4 A;  5ELO A;  2JN0 A;  2LX9 A;  3CCM Q;  2C7I A;  1Y07 A;  3MEW A;  4M7D C;  1PCX A;  2OAU A;  4M78 A;  1IZ6 A;  1QVG S;  3TSZ A;  1G5V A;  5GAN f;  1YCS B;  3CCR A;  4HCB A;  1EVL A;  1Z9Q A;  4AH6 A;  2EPD A;  4FT4 A;  2YWW A;  4BB7 A;  3CCV Q;  3CCM T;  1U3O A;  1G5H A;  3OYC A;  2GGR A;  2FG0 A;  4EPC A;  3M54 A;  3G6E Q;  2LJ1 A;  1K8A U;  3CC2 Q;  1BCO A;  5GAM j;  3EGX A;  4OMO A;  2A7Y A;  4PLL A;  1H4T A;  3CCV T;  4M7D F;  1KMN A;  3MF1 A;  4RTW A;  3INZ A;  5GMK i;  3SDZ A;  4ZIB A;  2BE7 D;  4J9H A;  1Q86 U;  1WYD A;  4OGC A;  3G6E T;  1HJD A;  1SRL A;  2YRC A;  1NJ1 A;  1Y96 B;  3CC2 T;  2IPO B;  4EDU A;  2G4C A;  3E9F A;  4PJO B;  1BK2 A;  2JXB A;  4C8Q G;  4M75 E;  2DU7 A;  2D6F A;  3MEY A;  1D1C A;  1WHM A;  2DL4 A;  3TVT A;  5KE3 A;  2PTK A;  1VQ6 A;  2CUB A;  1Q7Y U;  1W2B P;  1RLQ C;  1EVK A;  1OI1 A;  2ART A;  4HVU A;  2I4M A;  3THK A;  2KGT A;  1HXD A;  2RK2 A;  4M7A G;  2DVJ A;  4MZT A;  1MHN A;  4N4I A;  1VQ4 A;  4UP9 A;  1YFT A;  1X55 A;  3QYH B;  2EIF A;  2ZR2 A;  2KVQ G;  3JRZ A;  1ABO A;  4KR3 A;  1VOM A;  3REU A;  4LXC A;  3R6N A;  3KXT A;  1UTI A;  2NUT B;  1WJS A;  5LJ3 f;  4CRI A;  1WHJ A;  3CMQ A;  1WDX A;  2A0F B;  3EGD A;  4C5E A;  1X27 A;  4J9C A;  1BI1 A;  4NCX A;  4TQF A;  4YRQ A;  1NZ9 A;  4HVV A;  3JB9 J;  4M78 C;  2YUN A;  4A54 A;  3FLG A;  3JB9 G;  5KYY A;  5GAO m;  1VQK T;  1T0H A;  2DYB A;  5L8R E;  1EIF A;  2GTO A;  3HFZ B;  1BBZ A;  2F1L A;  2K7A A;  1AWO A;  1M90 C;  5CO7 A;  1LYL A;  4E7Z A;  1QWE A;  1ATI A;  2KXD A;  2DNU A;  2K5F A;  2PUK B;  3IQL A;  3GBQ A;  2QQB A;  2R58 A;  3OA6 A;  1YN8 A;  2X35 A;  1GBQ A;  3I55 T;  2KI7 A;  3QG1 A;  1X75 C;  4NL2 A;  2OTJ Q;  1X54 A;  2IY5 A;  3O5Z A;  2CT4 A;  3ZEH A;  3L2U A;  4M78 F;  1NPR A;  2H3E B;  2D8J A;  4XQ3 A;  2QHS A;  4PJO E;  1M3A A;  3V8K A;  3BW1 A;  4CH4 A;  3QDR B;  4LE9 A;  2DA9 A;  2J6F A;  3X25 B;  1RAD B;  1B34 A;  3CCL Q;  1AT1 B;  2OTJ T;  5CKE A;  3MEA A;  1NJ2 A;  3IKM B;  3M9Q A;  1M2V B;  3O8V A;  4Z8A A;  5M9O A;  4TVR A;  1RAF B;  1JB0 E;  5KYU B;  1E1T A;  3QZ5 B;  3KFV A;  1GCP A;  4Y91 A;  4K86 A;  4XEO A;  2KT1 A;  2EKH A;  3CCL T;  2AK5 A;  2LTO A;  2HNI A;  1UE9 A;  4N4G A;  4IUR A;  1Q81 R;  3CCE A;  3MQZ A;  1SES A;  3HP9 A;  2F5K A;  5I2M A;  4CS2 A;  1VQP Q;  1VQ9 A;  1E24 A;  3M59 A;  1X43 A;  1TUC A;  3FRN A;  3CMA Q;  1NYF A;  1Y96 A;  5GAN e;  4BY6 C;  1NYR A;  2M1H A;  1D09 B;  1K76 A;  2AZV A;  4X34 A;  2SRC A;  3MCA B;  3VV0 A;  3GNF B;  8ATC B;  2VXE A;  2LCL A;  4C8Q E;  3NTI A;  3CMA T;  3HRU A;  5KYN A;  2CZ6 B;  4WTO B;  4FL6 A;  1ADJ A;  3I35 A;  1VQO A;  5GAN d;  5GAO r;  3L2V A;  2BTT A;  3LWI A;  3CCJ Q;  2PQW A;  3LLR A;  1NE8 A;  4P75 C;  2CJA A;  2C0T A;  3H9N A;  1OV3 A;  4M7A E;  5C52 B;  2ZIM A;  2YUP A;  2XD0 A;  4DPG A;  1EOV A;  1MMG A;  5C0M A;  5CVI A;  2CJB A;  3KFU A;  2NUT A;  5C6S A;  3S3N A;  4FIB A;  1G3W A;  2RHY A;  2CZ7 B;  3TQ7 P;  1I81 A;  1KG1 A;  1FX7 A;  2DIG A;  2LT1 A;  4ANJ A;  3OW2 S;  3V7S A;  3UPU A;  5GAN h;  3RER A;  3A8L B;  3JCM c;  4HWO A;  4AFU C;  4PHC A;  4C0D B;  1ZLM A;  4FW1 A;  3HFZ A;  3CPW A;  4C92 G;  4XTU A;  3E1S A;  2HKQ B;  3OYN A;  5HKC A;  3QII A;  1ASZ A;  4RTU A;  1TWB A;  2E6N A;  3A8O B;  4HT8 A;  2I4N A;  3OYJ A;  2RI5 A;  3AT1 B;  4N0A A;  1JQQ A;  1D0X A;  5LJ3 e;  2AKW A;  5GAO p;  4LDU A;  2AIR B;  2FPE A;  4LDV A;  2LDM A;  5GAM f;  1KSW A;  5LL6 S;  3QTC A;  1K9A A;  1QKX A;  5KYW B;  3G71 Q;  3V8J A;  2F2V A;  4X1V A;  1VYU A;  2P0P A;  2OJ2 A;  3VU3 C;  3E9I A;  1QWF A;  2E70 A;  5LJ3 d;  1EIY B;  1JJ2 P;  3JV3 A;  2NS6 A;  3OS0 A;  2I4L A;  2ZPE B;  3HXZ A;  2C0O A;  4J6W A;  1M2V A;  4JZ4 A;  1N6A A;  2F69 A;  3G71 T;  2ZT5 A;  2W10 A;  4AMC A;  1B76 A;  3BJU A;  5KYU A;  2HMA A;  3OYA A;  2LT4 A;  4LD6 A;  2QEX Q;  4YRL A;  3VQX A;  4ZN1 A;  4ZGD B;  4ZNX A;  2RK1 A;  1RI0 A;  1M2O A;  4PJL A;  4QQ6 A;  2HSP A;  4YRF A;  1FWZ A;  1ZSZ C;  4MML A;  2QA4 Q;  2QEX T;  1SET A;  1N5Z A;  2XG8 D;  1S72 A;  2ARU A;  1S1N A;  1BI0 A;  1ZUU A;  3FEO A;  4KGV B;  2L3Q A;  1YJW T;  3JSC A;  3CCR Q;  1MNE A;  4ZTF A;  1M9S A;  2PME A;  5FU6 C;  2HD0 A;  2EYW A;  1PKS A;  2CZ0 B;  2QA4 T;  2DAQ A;  1Q81 U;  3TSW A;  2E6Z A;  2QHU A;  2ED0 A;  2RHU A;  2QAZ A;  3BDL A;  5GAN g;  3NET A;  2DD4 A;  3DSQ A;  2YUQ A;  4QVC A;  2RJF A;  4YRT A;  2LJ3 A;  2RI2 A;  1VQK A;  1KC8 C;  2JTE A;  1GGM A;  1G51 A;  4M4Z A;  3E9G A;  2CH4 W;  3LC0 A;  4J6X A;  4M77 B;  3QYG B;  3UH0 A;  2CP5 A;  3J7A F;  2FZK B;  3PFS A;  4HT9 A;  1GRI A;  4J15 A;  2XK0 A;  2E3H A;  2KSS A;  4OP0 A;  2V8J A;  3JCM W;  3NTH A;  3JCM Q;  1NJI R;  5LJ5 j;  3I55 A;  2OTL A;  3LYI A;  1NG2 A;  5GAN 3;  4BD3 A;  2PVG B;  3CXC A;  1SEM A;  2W0Z A;  4HWR A;  1U1T A;  5DM7 R;  3QDF A;  3GIB A;  1VQ6 Q;  2E64 A;  5GMK h;  2VGM A;  2AZS A;  1I8F A;  4FYW B;  3PGG A;  3A32 A;  3LSS A;  1UGR B;  2XMF A;  3M0P A;  5CAI A;  4MDX A;  3X20 B;  4R0K A;  1VQ4 Q;  1NM7 A;  2EYY A;  4L87 A;  2DL5 A;  1I1J A;  4LNS A;  2FPD A;  5A0L A;  1YCY A;  3OS1 A;  5C51 B;  2VAS A;  2R5M A;  4RG2 A;  4A63 B;  2O4X B;  3BY7 A;  1M3C A;  4R55 A;  1WHH A;  1VUB A;  1D3B B;  1K4U S;  3REX A;  1LCK A;  1VQ4 T;  2XHC A;  2RA2 A;  5KYW A;  1KQS S;  4BUG A;  3VS3 A;  2J05 A;  1O9S A;  1YNZ A;  5CKH A;  3DLM A;  3P8T A;  2E10 A;  2DXC A;  4A4G A;  1XJW B;  2EQI A;  2QI2 A;  3HY0 A;  1RAC B;  4LUE A;  3HXY A;  2RD1 A;  1VQM A;  2KE9 A;  2MIO A;  1QVG P;  1M30 A;  1TU0 B;  1NJI C;  2Q7G A;  2FHD A;  4M7D E;  2COW A;  3CBM A;  3CC4 A;  5CQX A;  3PMT A;  5GAM e;  1OUL A;  4IUQ A;  1WLP B;  2V1R A;  3OBW A;  5D6W A;  5GMK l;  3M4Q A;  2Y4Y A;  2DJQ A;  3PT9 A;  3MEV A;  5CCA A;  1VQL T;  2CP6 A;  3MEU A;  1B8A A;  2A36 A;  1T3L A;  5FLX E;  3CME A;  1PD0 A;  2BE9 B;  1G3Y A;  2F2W A;  5GAM d;  5CK9 A;  4PFP A;  2MOX A;  2DTO A;  2C0I A;  4C0D C;  3RF1 A;  3MP8 A;  2QQ9 A;  4ORZ A;  4YDQ A;  1Q7Y R;  3OD1 A;  1OZ2 A;  3PZC A;  5CR2 A;  4XTZ A;  2QQS A;  3X28 B;  3QO8 A;  1I4K 1;  1WFW A;  3C95 A;  3NPF A;  4RMO A;  3HFN A;  4OF1 A;  4M75 G;  4IKF A;  3J80 E;  2DXU A;  3S6W A;  2P5I A;  2ROL A;  4F7U B;  3MHX A;  4PJJ A;  4QVD A;  4M77 A;  5IXB A;  5GMK j;  2BZY A;  1VQ9 Q;  2XTI A;  3S3O A;  3MJX A;  2L0A A;  1QVP A;  4KH1 B;  2K2M A;  2EL9 A;  4E7I A;  5GAM h;  4KUD K;  1W2B A;  3CCE T;  2Q7E A;  4RCB A;  2FPF A;  5K1P A;  4MZP A;  3IAL A;  1H4Q A;  4K87 A;  1RUW A;  4OMM A;  2E5Q A;  3PIP A;  2K3B A;  1VQ9 T;  2F2X A;  1IHW A;  4ELZ C;  4AT1 B;  1UGP B;  1XTD A;  8AT1 B;  1CSK A;  1LPL A;  1WQ7 A;  1XNI A;  4UC4 A;  3HHT B;  3FIF A;  4XK8 E;  4C92 D;  2DMO A;  1VQO Q;  2E12 A;  1NLO C;  3WXM B;  2D0N A;  2WSF E;  3QO7 A;  4RMF A;  2ODR C;  1CKA A;  1YGB A;  2COY A;  1E1O A;  3M53 A;  1RAG B;  2JTM A;  2RJE A;  4XTX A;  4YRS A;  2RQR A;  4E6R A;  4C0G A;  1SSH A;  5A0D A;  4YRG A;  4E7S A;  2HL3 A;  2IVW A;  4BY6 B;  4M78 E;  1NJI U;  1VQO T;  2O4X A;  2I0N A;  1OQK A;  2DQ0 A;  2DYI A;  4C0F A;  2IG0 A;  1D3B A;  4MZM A;  2SEM A;  3FDR A;  5FRN A;  3C0C A;  3OS2 A;  3PCO B;  5KYY B;  4AG2 C;  1H3Z A;  4PG3 A;  5J3B A;  3U23 A;  1AEY A;  2Z0W A;  3ER0 A;  1G8X A;  2QYZ A;  1EFW A;  2DET A;  4Q15 A;  3LGL A;  3EH1 A;  2BKD N;  3OYE A;  4YRO A;  3QBY A;  2LQK A;  4ZGJ B;  4YRC A;  4JS4 A;  4OB0 B;  1NJ5 A;  2P0L A;  1HD3 A;  5FW9 A;  4PJO G;  1YJW A;  3SFM A;  1GL5 A;  4YRE A;  3NEL A;  4BDY A;  2KR3 A;  2RHX A;  3FJ5 A;  3HRK A;  5GAN 6;  3M0U A;  3CCS T;  1A0N B;  4UP7 A;  1M1F A;  4M77 C;  3JCM f;  1YIJ A;  3BDU A;  1B34 B;  2KYB A;  4TVA A;  2JT4 A;  2A37 A;  3P8H A;  4FT2 A;  4JJC A;  4CH6 A;  3HL8 A;  3R6O A;  1LJO A;  2LRQ A;  3RES A;  2ROT A;  3G4S T;  2MK5 A;  1KHI A;  4JRK A;  3L2W A;  2XDB A;  5GAN 7;  1WYX A;  5GAM g;  4OMQ A;  1SHG A;  3OMG A;  5LJ5 f;  3W3S A;  1KFZ A;  4TVY A;  2ZT8 A;  1BU1 A;  1IHV A;  4LN2 A;  2ENM A;  2QTV A;  1QQJ A;  3RBB B;  3RIR A;  1PHT A;  2EQU A;  4YCW A;  4M77 F;  1YFR A;  4JDS A;  2CH4 A;  3IKL A;  5D6Y A;  3PNW C;  1RL2 A;  2PZ1 A;  4QKU A;  1M90 R;  2EJF A;  4NS5 A;  1M5Q 1;  2EYQ A;  3KUF A;  4LNP A;  1UGV A;  12AS A;  4RTV A;  5DLO A;  2M9U A;  4YPF A;  4F7U A;  3CC7 A;  1S72 Q;  2E5A A;  4H2W A;  4L6V 5;  2GBQ A;  1AWW A;  2RI3 A;  1NEB A;  1LVK A;  1IGQ A;  4J9B A;  1M1G A;  3CCQ A;  3HXV A;  1I07 A;  1OU8 A;  3PVQ A;  3UT1 A;  1QVF S;  2A8E A;  3GPL A;  1SRY A;  4F04 B;  2QXF A;  3RUX A;  5I21 A;  1S72 T;  2JS0 A;  4HWS A;  4X5O A;  3NEN A;  3LH5 A;  2VGN A;  3OW2 P;  5FU7 C;  1ZSZ B;  2M51 A;  2XI9 A;  2HKN A;  2D1X A;  1VQK Q;  2QGG A;  2DE0 X;  4OB2 B;  1D1A A;  3PVL A;  3SWN B;  4Z88 A;  5FU6 B;  1YJN A;  3PCO A;  4IIM A;  4DEY A;  4BE2 A;  3EFR A;  3I55 Q;  3I9Q A;  2OTL Q;  5KNN A;  4J9E A;  2DZ9 A;  1PG5 B;  2EAY A;  2JVV A;  1PRM C;  3TRE A;  3HY1 A;  2PUO B;  1Q95 G;  3QNE A;  3G7Z A;  2XU8 A;  3OYM A;  4YCV A;  4DBQ A;  1VQL A;  5GJV B;  4GBQ A;  4KRT A;  5GAO q;  4P75 A;  4CC2 A;  1B7Y B;  2OTL T;  2RHZ A;  4H2U A;  3GOX A;  2AKW B;  1N27 A;  3VS1 A;  3NGP A;  1ZSG A;  2J7I A;  3M0S A;  3QKJ A;  4RTY A;  3VBB A;  1JEG A;  2ZT6 A;  3M5A A;  5GMK m;  1VQ5 T;  3RAC A;  2ZXF A;  1Z9Z A;  3ASK A;  2CP0 A;  1JJ2 A;  4P71 C;  1YI2 A;  4JJN K;  1VQZ A;  3UA6 A;  5I11 A;  5CKB A;  1K9M C;  1KOG A;  1BIB A;  1X6O A;  1G3S A;  2KEA A;  2LC4 A;  4DBF A;  2ZTG A;  3VYH B;  2FB7 A;  2M0Y A;  1B3Q A;  3ZL7 C;  1E6H A;  4E7K A;  3HXX A;  2EVR A;  3DKM A;  4PJM A;  3VS0 A;  4B6M A;  3REA B;  2FVU A;  4JPB W;  1WZO A;  1PD1 A;  2L2P A;  4FW2 A;  5IAY A;  3M0R A;  1VQM Q;  4H2T A;  3EGU A;  2Q5H A;  4P74 A;  2HQX A;  4OMN A;  5IN1 A;  1YB3 A;  1KD1 C;  2DZC A;  4F7U F;  1UHF A;  1WHL A;  1RIQ A;  3CC4 Q;  2YT6 A;  1G83 A;  2FL7 A;  4M75 D;  1HYO A;  1UDL A;  3JCM e;  1RAH B;  2K4Y A;  2MWO A;  1ZA2 B;  1VQM T;  3I7F A;  4BAC A;  4TWA A;  2LCS A;  2WSE E;  2CYZ B;  1UEB A;  4J9G A;  3A74 A;  1RAE B;  5HK0 A;  3ME9 A;  4ZTU B;  1D0Z A;  4JJB A;  3CC4 T;  3CME Q;  4C5H A;  1AWJ A;  2LJ0 A;  2LMJ A;  3L42 A;  5LJ5 e;  1N9W A;  1X01 A;  4H02 A;  4LUD A;  2DL3 A;  3OMC A;  1GBR A;  1M90 U;  4CH5 A;  1TTH B;  3EG9 B;  3CME T;  2DVE A;  1KJW A;  2YLC A;  2K6D A;  1WI7 A;  2CSQ A;  2E41 A;  1VQN A;  1ZSZ A;  5LJ5 d;  1PYS B;  1Z7M A;  3IG2 A;  1WGS A;  2L3S A;  2CP2 A;  2KBT A;  2CT3 A;  4X9D A;  1Q82 C;  1M4Z A;  2JJ9 A;  3G1J A;  4PK4 A;  2ARS A;  1AZE A;  2L3P A;  2KQW A;  1K73 C;  3VUZ A;  3SWN A;  3JCM h;  3X24 B;  2JM8 A;  3A7A A;  3M4P A;  1K9M U;  3RKW A;  1BCM A;  2RNA A;  2CKK A;  3F70 A;  4J7F A;  2MAM A;  5C53 B;  1FYN A;  1YP5 A;  2L8D A;  3RR6 A;  3CCS A;  1WU7 A;  4OLF A;  2CS7 A;  4G84 A;  2R57 A;  4TVW A;  5F5W A;  1ZHI A;  3OSS C;  2NUP B;  1KQS P;  5LJ5 h;  1B7Y A;  4PJO D;  3VS7 A;  4P74 C;  1PM3 A;  2K5L A;  3G4S A;  4YRI A;  3H6Z A;  2HQE A;  2AHJ B;  3EG1 A;  4FCY A;  2RHS A;  3OYK A;  4E51 A;  3I5R A;  2L3R A;  1MV0 B;  1I5L A;  1T0J A;  2MMP A;  4J9F A;  2QQA A;  1M1K C;  1KC8 R;  1R0C B;  1C0A A;  1ABQ A;  1NLP C;  2ZNJ A;  2BUD A;  1QVG A;  2C06 A;  3DB3 A;  1GXI E;  2GFA A;  1NJ8 A;  2ABL A;  1MMA A;  4M7D G;  2DXT A;  4CS4 A;  4AFS C;  1OEB A;  3BFM A;  4KQE A;  1IL2 A;  4EIK A;  2QAS A;  3BE3 A;  4QQD A;  5IHK A;  4FSS A;  1YJW Q;  1YJ9 A;  4NL3 A;  2JOY A;  2X3X D;  5GJW B;  5K1X A;  1O75 A;  4K11 A;  2LX7 A;  2QGF B;  4LVL A;  4C8Q D;  1YIJ Q;  5GMK e;  3RKY A;  1YHQ A;  2DRM A;  3SWN C;  2DTH A;  3OYI A;  4VUB A;  1K73 U;  2G3R A;  1B7T A;  3VUB A;  2JUF A;  1LOJ A;  2E1H A;  1R8O B;  3JCM g;  4JLG A;  1YIJ T;  4A4H A;  1QLY A;  4M7A D;  1V1C A;  3A8G B;  4QVZ A;  2M02 A;  4HCK A;  3RNJ A;  3G1Z A;  1Y0M A;  2DF6 A;  4X9C A;  1TG0 A;  3R07 A;  1V76 A;  3EG9 A;  4P5N A;  4KT0 E;  4DA4 A;  2CUD A;  2R5A A;  2KRN A;  3OYB A;  2QK0 A;  3QXE B;  4J83 A;  3OYF A;  1PYS A;  5LJ5 g;  1U06 A;  4H2Y A;  5GAO n;  3LX7 A;  4C8Q C;  2O88 A;  3CC7 Q;  3REB B;  2LCC A;  2HAX A;  2ZZF A;  5HCK A;  3JB9 D;  3GP8 A;  3CCQ Q;  3OYH A;  3MPU B;  3A1P A;  3NHN A;  1M1K U;  1SRM A;  4RQF A;  3URG A;  1BBU A;  4HA8 A;  2EW3 A;  1YIT A;  1VQ5 A;  1RLP C;  3CC7 T;  1Z7N A;  4D8D A;  4KR2 A;  1V29 B;  2DJZ A;  2F5T X;  4M7A C;  4C0Z A;  1N9R A;  5FRO A;  2I4O A;  4M78 G;  3CCQ T;  2HEQ A;  1Y57 A;  2FRY A;  2YUO A;  4KGZ B;  2NUP A;  1DJ7 B;  4C8Q F;  4E47 A;  1IGU A;  2D8H A;  1EZZ B; 
#chains in the Genus database with same CATH homology
 1M8V A;  2QDY B;  1NYQ A;  2WAC A;  4Q6G A;  4LDX A;  2K2V A;  1BKB A;  3GNG A;  5DLQ E;  1OZ3 A;  4XTY A;  2PU9 B;  4ME7 A;  3HKS A;  3OY9 A;  1L0W A;  1ADY A;  2RH2 A;  2BIV A;  3CD6 T;  1N9S A;  5FU7 B;  1BI2 A;  4XEM A;  3JCM J;  4P3N A;  4UP8 A;  2CZ1 B;  3H8Z A;  1YJN T;  1LNX A;  2XID A;  5GAO l;  3P8Y A;  4M77 E;  3A7U A;  4JRI A;  3M57 A;  2XGT A;  1KC8 U;  2I2L A;  1KMM A;  3JAM E;  2RHI A;  5CQY A;  4TVA B;  4XTW A;  5IT9 E;  4CH3 A;  1J5W A;  3JCM V;  4OGE A;  1U8R A;  5KCH A;  4PLI A;  5KE2 A;  3OB9 A;  1VQP A;  4N4H A;  1U1S A;  4C92 A;  1P92 A;  4KUL A;  2ZCF B;  1PSF A;  4ZTJ A;  3ZBD A;  4OB1 B;  1YI2 T;  4B9X A;  4ZN3 A;  1ASY A;  3OS5 A;  1IRE B;  4BE1 A;  3A8H B;  2ZPF B;  3QO5 A;  3QZ9 B;  3MO8 A;  3QHS A;  1VQ8 T;  4TTV A;  4A4F A;  4O6J A;  4P3P A;  2ZGW A;  2VYT A;  2ZPB B;  3CBO A;  3RGL A;  3OW2 A;  4YRP A;  2MWP A;  1VIE A;  2ZT7 A;  4QQG A;  2ZIN A;  4XU2 A;  2ZZD A;  2FYK A;  3DLL A;  1K8A C;  4BI3 A;  3L2Z A;  1MGQ A;  2XKO C;  5CKD A;  1TH7 A;  1W66 A;  11AS A;  2EJG A;  1Q86 C;  4J8O A;  1VQN T;  2C8M A;  2Q5I A;  2V8K A;  4QW2 A;  2XIC A;  2LVM A;  3GLX A;  4C92 C;  2YHT A;  2M0O A;  2ZIO A;  4M7D D;  4WI1 A;  3VQY A;  4BWA A;  4RKU E;  3JB9 I;  5E3I A;  1BI3 A;  3CPW S;  4M75 B;  3HRI A;  5CKF A;  1UB4 A;  1N8R C;  4F7U E;  4YRK A;  3VYG A;  4MDW A;  2VXF A;  1G3T A;  4O5V A;  4NOY A;  3M55 A;  3L4G B;  4XU3 A;  1NNH A;  4C92 F;  3LWH A;  1HC7 A;  4YRN A;  2CGH A;  4RG8 A;  4IUU A;  2DK3 A;  4YCU A;  4LVI A;  2JNG A;  2DU5 A;  3UWN A;  5DY9 A;  3TCJ A;  4OVA A;  5A0G A;  4JRP A;  3CEY A;  2GF7 A;  3OYL A;  3DB4 A;  1WNL A;  3TEE A;  2MI6 A;  4P73 A;  3VQW A;  2ZPH B;  5AYF A;  4V2S A;  4EMH A;  2RHQ B;  4RDX A;  4P71 A;  2RM4 A;  2ZNI A;  5HGQ A;  2DTI A;  3HFV A;  2DQ3 A;  2J3M A;  4WJ4 A;  4IUT A;  2DIQ A;  1YJ9 T;  2PVO B;  2PMF A;  5J39 A;  4YRJ A;  4GLK A;  4YYE A;  4E7L A;  1OYX A;  1BYM A;  2O01 E;  2CIM A;  5HK3 A;  3RMQ A;  4J7I A;  3LGF A;  3VQV A;  1YHQ T;  4M78 D;  4CI0 C;  2P0Q A;  3GF5 A;  4LVK A;  3LSQ A;  1BBW A;  3RMS A;  4IUV A;  2K57 A;  1N8R U;  3CD6 A;  4FU6 A;  2RO0 A;  3QJY A;  1JJC A;  2K3X A;  2JTF A;  1VQ7 A;  1KQS A;  1PSE A;  1Y7X A;  4KBM B;  2WSC E;  3CXC S;  3RL6 A;  4BW9 A;  3UGQ A;  4GY5 A;  4BDZ A;  3A5Y A;  4Q5W A;  1QE0 A;  1X56 A;  3C4S A;  2K5I A;  2AMC B;  4M75 A;  4KUI A;  3X26 B;  4P73 C;  2RHS B;  1B70 B;  2RJD A;  3P8B B;  4C8Q B;  1YIT T;  2VC8 A;  3V7C A;  4EMK A;  3P8V A;  1HK9 A;  4HCZ A;  3LH0 A;  3L4G A;  3OYY A;  4EO4 A;  3JB9 H;  4MMK A;  4R56 A;  3CCU A;  4DOW A;  2DD5 A;  4IUP A;  4DQ2 A;  4M7A B;  4HWT A;  5J26 A;  3HSB A;  1VQ8 A;  3OBY A;  3ICA A;  3ERR A;  4BI8 B;  4WF2 A;  4P72 A;  5EG2 A;  3L1A A;  4A4E A;  2EQK A;  3M58 A;  4LDW A;  1SSF A;  3RKX A;  1NPP A;  4H2V A;  5GAN 5;  2KDS A;  2KAF A;  3MF2 A;  3HRT A;  2RHQ A;  2GCX A;  4CS3 A;  2P0K A;  2GFU A;  2J3L A;  4LDY A;  1H4V B;  2H3J A;  3JCM d;  1KQ2 A;  3E9H A;  3CPF A;  4PJO A;  4L59 A;  1WQW A;  3TU4 K;  2QHV A;  3AHU A;  1VQP T;  3V7R A;  4M75 C;  3JCM P;  2KMT A;  3WQZ A;  2Y90 A;  3HTZ A;  5I2S A;  3I56 A;  4EMK C;  2X4J A;  4JUV A;  1X2G A;  2D9T A;  2NLU A;  1H4S A;  3A7R A;  5GAN 8;  5KCO A;  3QJ6 A;  3TEH B;  1W2B S;  1KQ1 A;  2QHT A;  2EKO A;  3CCJ T;  1WJQ A;  2XDP A;  1ZQ1 A;  2RJC A;  4M75 F;  1FYF A;  4DOV A;  4PNO A;  1Y71 A;  3QUI A;  1Q81 C;  4P72 C;  2AMC A;  1WJR A;  3S3M A;  1KD1 U;  5ELN A;  1B70 A;  4C8Q A;  2KY9 A;  1QF6 A;  3A31 A;  3L2R A;  4A4K A;  1E22 A;  4Z02 A;  1HTT A;  3UDC A;  5HY6 A;  4LVJ A;  3NFC A;  3VJP A;  3C12 A;  3M56 A;  2EFI A;  2QQR A;  3CCM A;  2ZR3 A;  2EWN A;  3WVD B;  3QSU A;  4H2S A;  5CIU A;  4M7A A;  3P8D A;  4M77 G;  4XAX B;  3NEM A;  4PJO C;  2L5Q A;  3CCV A;  4RCC A;  4FM4 B;  2JZ2 A;  2VUB A;  4J5Y A;  3FJP A;  4HKE A;  1USY A;  4C5I A;  3G6E A;  3CC2 A;  1QP3 A;  3UFG A;  4JS5 A;  1YFS A;  3FC3 A;  2QTX A;  1Q82 U;  4C92 B;  4H2X B;  3TUP A;  4PJO F;  3M4G A;  4ZGE B;  4HT4 A;  2LQ8 A;  3Q1J A;  1QVF A;  5LJ3 h;  3EAE A;  4HCC A;  3HXU A;  4ATO A;  3A5Z B;  3JCM X;  4XTV A;  2E3C A;  3SD4 A;  3VKI A;  2E65 A;  5GAN 4;  1WPY A;  1EQR A;  1JBM A;  1H64 1;  3PIO A;  3SB2 A;  2YRV A;  1UGS B;  2XDD A;  4LVM A;  4TQD A;  4O2D A;  3NTK A;  3CCR T;  3OYD A;  2Y4X A;  4N0A C;  5GAN j;  4M7D B;  2KK4 A;  3TEH A;  2A3L A;  2EQJ A;  3PMI A;  3E19 A;  2ALY B;  2K3Y A;  2D0Q B;  3TEG A;  2Q7H A;  4HWP A;  3HFO A;  2GQV A;  1USY C;  3OSV A;  2DO3 A;  4J6Y A;  3KBG A;  4C92 E;  2OTJ A;  4M7A F;  2DXB A;  1VQ6 T;  4E7J A;  3L2Q A;  3OYG A;  4D6W A;  4JLI A;  5A2Q E;  1FXX A;  4F7U G;  4OMF B;  3CCL A;  3V8L A;  2DKG A;  2CJ9 A;  3A8M B;  4C5G A;  1VQ7 T;  3OQ5 A;  1EIY A;  5LJ3 g;  3QO3 A;  3JB9 F;  1QP2 A;  4PL6 A;  3EFS A;  3ZFJ A;  4K88 A;  4YRM A;  1X2H A;  5LJ3 j;  4BI4 A;  1JJ2 S;  3T9N A;  3CMA A;  4H2X A;  3QPH A;  4M78 B;  2EJ9 A;  2ZZE A;  3LW5 E;  1G5I A;  1JRI A;  4Y28 E;  3A5Z A;  3CCU T;  4G85 A;  4P3O A;  3C94 A;  2DPP B;  2MF2 A;  5D6X A;  4JRQ A;  3UGT A;  3CCJ A;  3J81 E;  1AHJ B;  4HVC A;  4YTL A;  2ZZG A;  2ODR D;  2VV5 A;  3HXW A;  1W4S A;  2ZPG B;  3HPW A;  2P4T A;  4FSX A;  2YLB A;  1XOV A;  4M7D A;  4II1 A;  2LNV A;  4BE0 A;  4XU0 A;  2DEQ A;  4ZTZ B;  3MP1 A;  5KH6 A;  2ALY A;  4YRR A;  1VIF A;  4E7H A;  2X4W A;  2ZPI B;  4A53 A;  3WVE B;  2RB6 A;  2HBP A;  2EQM A;  5GAN 2;  4B9W A;  2M16 A;  4WJ3 M;  1SER A;  5FRM A;  1WLE A;  1JJC B;  3FB9 A;  1NJ6 A;  1BIA A;  3JCM b;  3N5B B;  2X4Y A;  3MP6 A;  2ZCE A;  3MET A;  2PVD B;  3I56 T;  1ZBX A;  3G71 A;  1KHC A;  1UGQ B;  4M77 D;  2B8A A;  4UPA A;  1Q7Y C;  2DDZ A;  2X4X A;  2V8I A;  4OB3 B;  3M4Y A;  3PTA A;  4L5G A;  3CBP A;  4EMK B;  4RQE A;  4EX5 A;  2QEX A;  1QW1 A;  3HRS A;  4EMG A;  4YP0 A;  1XQH A;  4PKC C;  2IY5 B;  4LD9 K;  4ELY C;  4XU1 A;  2L89 A;  1YBY A;  2QA4 A;  5ELO A;  2JN0 A;  2LX9 A;  2C7I A;  1Y07 A;  3MEW A;  4M7D C;  2OAU A;  4M78 A;  1IZ6 A;  1QVG S;  1G5V A;  5GAN f;  3CCR A;  4HCB A;  1EVL A;  4AH6 A;  4FT4 A;  4BB7 A;  3CCM T;  1G5H A;  3OYC A;  4EPC A;  3M54 A;  1K8A U;  5GAM j;  2A7Y A;  4PLL A;  1H4T A;  3CCV T;  4M7D F;  1KMN A;  3MF1 A;  5GMK i;  3INZ A;  3SDZ A;  4ZIB A;  1Q86 U;  1WYD A;  4OGC A;  3G6E T;  1NJ1 A;  1Y96 B;  3CC2 T;  4EDU A;  2G4C A;  3E9F A;  4PJO B;  4C8Q G;  4M75 E;  2DU7 A;  2D6F A;  3MEY A;  5KE3 A;  1VQ6 A;  1Q7Y U;  1EVK A;  1OI1 A;  2ART A;  2I4M A;  4M7A G;  2RK2 A;  1HXD A;  4MZT A;  4N4I A;  1MHN A;  1VQ4 A;  4UP9 A;  1YFT A;  1X55 A;  3QYH B;  2EIF A;  2ZR2 A;  2KVQ G;  3JRZ A;  4KR3 A;  3REU A;  3KXT A;  5LJ3 f;  1WJS A;  4CRI A;  3CMQ A;  4C5E A;  1BI1 A;  4NCX A;  4TQF A;  4YRQ A;  1NZ9 A;  3JB9 J;  4M78 C;  4A54 A;  3FLG A;  3JB9 G;  5GAO m;  1VQK T;  5L8R E;  1EIF A;  3HFZ B;  1M90 C;  5CO7 A;  1LYL A;  1ATI A;  2K5F A;  2PUK B;  2QQB A;  2R58 A;  3OA6 A;  2X35 A;  3I55 T;  3QG1 A;  1X75 C;  4NL2 A;  1X54 A;  2IY5 A;  3ZEH A;  3L2U A;  1NPR A;  4M78 F;  4XQ3 A;  2QHS A;  4PJO E;  3V8K A;  3BW1 A;  4CH4 A;  3QDR B;  3X25 B;  1B34 A;  2OTJ T;  5CKE A;  3MEA A;  1NJ2 A;  3IKM B;  3M9Q A;  3O8V A;  5M9O A;  4TVR A;  1JB0 E;  1E1T A;  3QZ5 B;  4Y91 A;  4K86 A;  4XEO A;  3CCL T;  2LTO A;  2HNI A;  4N4G A;  4IUR A;  3CCE A;  3MQZ A;  1SES A;  3HP9 A;  2F5K A;  5I2M A;  4CS2 A;  1VQ9 A;  1E24 A;  3M59 A;  3FRN A;  1Y96 A;  5GAN e;  4BY6 C;  1NYR A;  2M1H A;  4X34 A;  3MCA B;  3VV0 A;  3GNF B;  2VXE A;  2LCL A;  4C8Q E;  3NTI A;  3CMA T;  3HRU A;  2CZ6 B;  4FL6 A;  1ADJ A;  1VQO A;  5GAN d;  5GAO r;  3L2V A;  3LWI A;  2PQW A;  3LLR A;  1NE8 A;  4P75 C;  2CJA A;  4M7A E;  5C52 B;  2ZIM A;  2XD0 A;  4DPG A;  1EOV A;  5C0M A;  5CVI A;  2CJB A;  3KFU A;  5C6S A;  3S3N A;  4FIB A;  1G3W A;  2RHY A;  2CZ7 B;  1I81 A;  1KG1 A;  1FX7 A;  2DIG A;  2LT1 A;  3OW2 S;  3V7S A;  3UPU A;  5GAN h;  3RER A;  3A8L B;  3JCM c;  4HWO A;  4PHC A;  4C0D B;  3HFZ A;  3CPW A;  4C92 G;  4XTU A;  3E1S A;  3OYN A;  5HKC A;  3QII A;  1ASZ A;  2E6N A;  3A8O B;  4HT8 A;  2I4N A;  3OYJ A;  2RI5 A;  4N0A A;  5LJ3 e;  2AKW A;  5GAO p;  4LDU A;  4LDV A;  5GAM f;  2LDM A;  5LL6 S;  3QTC A;  3V8J A;  2P0P A;  3VU3 C;  3E9I A;  2E70 A;  5LJ3 d;  1EIY B;  2NS6 A;  3OS0 A;  2I4L A;  2ZPE B;  3HXZ A;  4J6W A;  1N6A A;  2F69 A;  3G71 T;  2ZT5 A;  1B76 A;  3BJU A;  3OYA A;  2LT4 A;  4LD6 A;  4YRL A;  3VQX A;  4ZN1 A;  4ZGD B;  2RK1 A;  1RI0 A;  4QQ6 A;  4YRF A;  1FWZ A;  4MML A;  2QEX T;  1SET A;  2XG8 D;  1S72 A;  2ARU A;  1BI0 A;  3FEO A;  1YJW T;  3JSC A;  4ZTF A;  1M9S A;  2PME A;  5FU6 C;  2HD0 A;  2QA4 T;  2CZ0 B;  2DAQ A;  1Q81 U;  2E6Z A;  2QHU A;  2RHU A;  3BDL A;  5GAN g;  3NET A;  2DD4 A;  3DSQ A;  4QVC A;  2RJF A;  4YRT A;  2RI2 A;  1VQK A;  1KC8 C;  1GGM A;  1G51 A;  3E9G A;  3LC0 A;  4J6X A;  4M77 B;  3QYG B;  3UH0 A;  3J7A F;  3PFS A;  4HT9 A;  4J15 A;  2XK0 A;  2KSS A;  4OP0 A;  2V8J A;  3JCM W;  3NTH A;  3JCM Q;  5LJ5 j;  3I55 A;  2OTL A;  3LYI A;  5GAN 3;  4BD3 A;  2PVG B;  3CXC A;  4HWR A;  1U1T A;  5DM7 R;  3GIB A;  2E64 A;  5GMK h;  2VGM A;  1I8F A;  3PGG A;  3A32 A;  3LSS A;  1UGR B;  5CAI A;  4MDX A;  3X20 B;  4L87 A;  4LNS A;  5A0L A;  1YCY A;  3OS1 A;  5C51 B;  2R5M A;  4RG2 A;  2O4X B;  3BY7 A;  4R55 A;  1VUB A;  1D3B B;  3REX A;  1VQ4 T;  2XHC A;  2RA2 A;  1KQS S;  4BUG A;  1O9S A;  5CKH A;  3DLM A;  3P8T A;  2E10 A;  2DXC A;  4A4G A;  2QI2 A;  3HY0 A;  3HXY A;  2RD1 A;  1VQM A;  1NJI C;  2Q7G A;  2FHD A;  4M7D E;  3CBM A;  3CC4 A;  5CQX A;  3PMT A;  5GAM e;  4IUQ A;  5D6W A;  3OBW A;  5GMK l;  3M4Q A;  2Y4Y A;  3PT9 A;  3MEV A;  5CCA A;  1VQL T;  3MEU A;  1B8A A;  5FLX E;  3CME A;  1G3Y A;  5GAM d;  5CK9 A;  2DTO A;  4C0D C;  3RF1 A;  3MP8 A;  2QQ9 A;  4YDQ A;  3OD1 A;  1OZ2 A;  3PZC A;  5CR2 A;  4XTZ A;  2QQS A;  3X28 B;  3QO8 A;  1I4K 1;  3C95 A;  4RMO A;  3HFN A;  4OF1 A;  4M75 G;  4IKF A;  2P5I A;  3J80 E;  2DXU A;  3S6W A;  4QVD A;  4F7U B;  3MHX A;  5GMK j;  2XTI A;  4M77 A;  3S3O A;  1QVP A;  2EL9 A;  4E7I A;  5GAM h;  4KUD K;  1W2B A;  3CCE T;  2Q7E A;  4RCB A;  5K1P A;  4MZP A;  3IAL A;  1H4Q A;  4K87 A;  2E5Q A;  3PIP A;  1VQ9 T;  4ELZ C;  1UGP B;  1XTD A;  1WQ7 A;  1XNI A;  4UC4 A;  3HHT B;  3FIF A;  4XK8 E;  4C92 D;  2E12 A;  3WXM B;  2WSF E;  3QO7 A;  4RMF A;  2ODR C;  1YGB A;  1E1O A;  3M53 A;  2JTM A;  2RJE A;  4XTX A;  4YRS A;  5A0D A;  4C0G A;  4YRG A;  2IVW A;  4BY6 B;  1NJI U;  4M78 E;  1VQO T;  2O4X A;  2DQ0 A;  4C0F A;  2IG0 A;  1D3B A;  4MZM A;  3FDR A;  5FRN A;  3PCO B;  3OS2 A;  1H3Z A;  4PG3 A;  5J3B A;  3ER0 A;  1EFW A;  4Q15 A;  3LGL A;  2BKD N;  3OYE A;  4YRO A;  3QBY A;  2LQK A;  4ZGJ B;  4YRC A;  4JS4 A;  4OB0 B;  1NJ5 A;  2P0L A;  4PJO G;  1YJW A;  3SFM A;  4YRE A;  3NEL A;  4BDY A;  2RHX A;  3HRK A;  5GAN 6;  3CCS T;  4UP7 A;  1M1F A;  4M77 C;  3JCM f;  1YIJ A;  3BDU A;  1B34 B;  4TVA A;  4FT2 A;  3P8H A;  4CH6 A;  3HL8 A;  3R6O A;  1LJO A;  2LRQ A;  3RES A;  3G4S T;  1KHI A;  4JRK A;  3L2W A;  2XDB A;  5GAN 7;  5GAM g;  3OMG A;  5LJ5 f;  3W3S A;  4TVY A;  2ZT8 A;  3RIR A;  2EQU A;  4YCW A;  4M77 F;  1YFR A;  4JDS A;  3IKL A;  5D6Y A;  3PNW C;  1RL2 A;  2EJF A;  4NS5 A;  1M5Q 1;  2EYQ A;  3KUF A;  12AS A;  5DLO A;  2M9U A;  4YPF A;  4F7U A;  3CC7 A;  2E5A A;  4H2W A;  4L6V 5;  2RI3 A;  1M1G A;  3CCQ A;  3HXV A;  3UT1 A;  1QVF S;  2A8E A;  3GPL A;  1SRY A;  2QXF A;  3RUX A;  5I21 A;  1S72 T;  4HWS A;  4X5O A;  3NEN A;  2VGN A;  5FU7 C;  2XI9 A;  4OB2 B;  3SWN B;  5FU6 B;  1YJN A;  3PCO A;  4BE2 A;  3EFR A;  5KNN A;  2DZ9 A;  2EAY A;  2JVV A;  3HY1 A;  3TRE A;  2PUO B;  3QNE A;  3G7Z A;  2XU8 A;  3OYM A;  4YCV A;  1VQL A;  5GAO q;  4P75 A;  1B7Y B;  2OTL T;  2RHZ A;  4H2U A;  3GOX A;  2AKW B;  1N27 A;  3QKJ A;  3VBB A;  2ZT6 A;  3M5A A;  5GMK m;  1VQ5 T;  3RAC A;  2ZXF A;  3ASK A;  1JJ2 A;  4P71 C;  1YI2 A;  4JJN K;  1VQZ A;  1K9M C;  5CKB A;  1KOG A;  1BIB A;  1X6O A;  1G3S A;  2LC4 A;  2ZTG A;  3VYH B;  2FB7 A;  4E7K A;  3HXX A;  3DKM A;  2FVU A;  5IAY A;  4H2T A;  2Q5H A;  4P74 A;  2HQX A;  5IN1 A;  1YB3 A;  1KD1 C;  2DZC A;  4F7U F;  1RIQ A;  2FL7 A;  4M75 D;  3JCM e;  2K4Y A;  2MWO A;  1VQM T;  3I7F A;  4BAC A;  4TWA A;  2WSE E;  2CYZ B;  1UEB A;  3A74 A;  5HK0 A;  3ME9 A;  4ZTU B;  3CC4 T;  4C5H A;  3L42 A;  5LJ5 e;  1N9W A;  1X01 A;  4H02 A;  3OMC A;  1M90 U;  4CH5 A;  3CME T;  2DVE A;  2YLC A;  2E41 A;  1VQN A;  5LJ5 d;  1PYS B;  1Z7M A;  3IG2 A;  1WGS A;  4X9D A;  1Q82 C;  1M4Z A;  2ARS A;  2KQW A;  1K73 C;  3VUZ A;  3SWN A;  3JCM h;  3X24 B;  3A7A A;  3M4P A;  1K9M U;  3RKW A;  2CKK A;  3F70 A;  4J7F A;  2MAM A;  5C53 B;  2L8D A;  3CCS A;  1WU7 A;  4OLF A;  2CS7 A;  4G84 A;  2R57 A;  4TVW A;  5F5W A;  1ZHI A;  3OSS C;  5LJ5 h;  1B7Y A;  4PJO D;  4P74 C;  2K5L A;  3G4S A;  4YRI A;  3H6Z A;  2HQE A;  2AHJ B;  2RHS A;  3OYK A;  4E51 A;  2L3R A;  1I5L A;  2MMP A;  2QQA A;  1M1K C;  1C0A A;  2ZNJ A;  2BUD A;  1QVG A;  2C06 A;  3DB3 A;  1GXI E;  2GFA A;  1NJ8 A;  4M7D G;  2DXT A;  4CS4 A;  3BFM A;  4KQE A;  1IL2 A;  4QQD A;  1YJ9 A;  4NL3 A;  2JOY A;  5K1X A;  1O75 A;  4LVL A;  4C8Q D;  5GMK e;  3RKY A;  1YHQ A;  3SWN C;  2DTH A;  3OYI A;  4VUB A;  1K73 U;  2G3R A;  3VUB A;  2JUF A;  1LOJ A;  2E1H A;  1R8O B;  3JCM g;  4JLG A;  1YIJ T;  4A4H A;  4M7A D;  3A8G B;  4QVZ A;  3G1Z A;  4X9C A;  3R07 A;  4P5N A;  4KT0 E;  4DA4 A;  2R5A A;  3OYB A;  3QXE B;  4J83 A;  3OYF A;  1PYS A;  5LJ5 g;  4H2Y A;  5GAO n;  3LX7 A;  4C8Q C;  2LCC A;  2HAX A;  2ZZF A;  3JB9 D;  3GP8 A;  3OYH A;  1M1K U;  4RQF A;  3URG A;  1BBU A;  4HA8 A;  1YIT A;  1VQ5 A;  3CC7 T;  4KR2 A;  1Z7N A;  1V29 B;  2DJZ A;  2F5T X;  4M7A C;  4C0Z A;  1N9R A;  5FRO A;  2I4O A;  4M78 G;  3CCQ T;  1DJ7 B;  4C8Q F;  4E47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...