4XTWA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 94
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtwA01
4YRFA 2VXEA 5C51B 2DQ3A 1NJ8A 2C7IA 4PG3A 4HT8A 3VBBA 3HFZB 4M78A 5GAN8 1EVKA 2EJ9A 4YRPA 2RM4A 3MEYA 4RCCA 1B76A 4ZTUB 4M77E 4XQ3A 4XTXA 11ASA 2ZCEA 2DZ9A 5LJ5f 1WQWA 4M78D 2XGTA 4JUVA 2VC8A 2E5AA 1JRIA 5GAN4 2AMCB 4M7DB 4CS2A 4C8QE 3HRKA 3A32A 5LJ3g 2CIMA 4P3PA 2DXTA 4PJOC 3VQWA 2DTOA 4C8QB 4J6XA 2K57A 4P73A 1J5WA 2YHTA 5GAMd 4C92C 2ZTGA 1H4QA 5LJ5e 3JCMP 4YRSA 4P3OA 4M7AE 2Q7HA 2AKWA 4M7AC 1Z7NA 1YFRA 4N0AC 3HXUA 1JBMA 2IY5A 2YLCA 5GAN6 4PNOA 3RACA 3HXYA 3HTZA 2RD1A 3BW1A 1M8VA 5GMKh 5GMKe 2ARSA 4YRJA 1KQ1A 2ZT7A 4WJ4A 4YCWA 3PGGA 3JCMd 4DPGA 1YCYA 1X56A 4M78B 1SERA 4XEMA 3UH0A 1NJ6A 1Y96A 4MMKA 4M77B 4WF2A 2E1HA 1WLEA 1E22A 5GMKm 4HWRA 2E65A 1B34A 4TVYA 1W66A 3SWNA 3A7AA 3IG2A 2AMCA 3QO3A 3JCMX 4YRCA 5GANf 4A54A 12ASA 2DJZA 4YROA 5GMKj 1B7YB 4J6YA 1BBUA 4M7DA 4F7UA 1HTTA 4TQDA 3TUPA 2E10A 4RQFA 1WNLA 3EFRA 4V2SA 1E1OA 5GAOl 2EWNA 1X54A 2ALYA 3OD1A 4M75G 3JCMW 4M7AB 3A74A 1Z7MA 3SB2A 3HFZA 4ZIBA 5K1PA 4C92E 3HXWA 1H4SA 1E24A 1G51A 4X9DA 2RHSB 4UP9A 2XTIA 2AKWB 2J3MA 4ZTZB 1I81A 4WI1A 5GMKl 3RL6A 3JB9J 2QHTA 3WQZA 3HSBA 4YCVA 1JJCA 4P72A 1JJCB 2I4MA 4H2XA 4G85A 3A5YA 2ZXFA 5GMKi 1YGBA 3HXXA 2I4OA 1C0AA 2ZNIA 4JLIA 2E41A 4Q6GA 4M75A 5GAOm 3M4PA 1WQ7A 5DY9A 4QVDA 1EIYA 5LJ3d 4YRNA 4M75E 2E3CA 1ATIA 4BW9A 2Q5IA 4C92D 1U1TA 4F7UE 2G4CA 5LJ5d 4F7UG 5GAMg 4KQEA 3RIRA 2QHVA 4HA8A 4EMGA 4E51A 5GAMj 2J3LA 1QE0A 2I4NA 4F7UB 3REUA 3P8VA 4XTYA 3L1AA 3JCMQ 5CAIA 1X01A 2ZR2A 1H4TA 1U1SA 1FYFA 4KR2A 4X9CA 3RERA 5GAOp 4C8QA 3AHUA 4PJOD 1HXDA 4P72C 1BIBA 2EJFA 3M4GA 4CS4A 4M77G 1WU7A 1BIAA 1NJ2A 1EFWA 3UGTA 4TQFA 1H641 4YRKA 2DEQA 4QVCA 2CJBA 4EMHA 4K88A 1KMNA 4H2VA 3QO7A 2RA2A 4G84A 1EVLA 3JCMg 4XU3A 4PJOB 4M7DF 3IALA 4K86A 4P75C 3PZCA 1M5Q1 3VQXA 1EOVA 1SRYA 1B7YA 3FJPA 4M75B 3L2ZA 3HY0A 2CJAA 4HWPA 3QTCA 4XTVA 1NJ5A 2ZT6A 5ELOA 1ADYA 1X55A 2Q5HA 1ASYA 3BFMA 3MF1A 4L87A 4X5OA 4YRMA 1Y96B 3RKWA 4M77D 3V8LA 1HK9A 5GANe 2ZNJA 3E9IA 1IL2A 4P73C 4HWSA 4C8QD 2ARUA 4P3NA 2P5IA 2QTXA 1L0WA 4EX5A 4YRGA 2DQ0A 1N9SA 4M77F 2Q7EA 4M78E 3JCMh 4M78G 1H4VB 1LOJA 4M7AA 2PMEA 4YDQA 1B8AA 1VQZA 4J6WA 1N9RA 3MF2A 3PCOA 1EIYB 4C92A 4YRIA 3FIFA 4J15A 2ZGWA 2YLBA 3A7UA 1GGMA 4HWTA 2IY5B 5GANh 3SWNB 1YB3A 4UP7A 1KMMA 5LJ3j 4UPAA 4CH6A 4Q15A 4TTVA 4CS3A 4OLFA 4TVWA 5LJ3e 2RHQB 5GAN7 4LNSA 3W3SA 4M7DG 4M75C 3JB9G 3R07A 4M7DE 3QUIA 5K1XA 1E1TA 4M77C 5GAN3 4NL2A 4P71A 3QHSA 4J5YA 4JRKA 1B70A 3NENA 3GIBA 3LSQA 3UFGA 5GAN5 3RKYA 3HFVA 3VQYA 4BWAA 2PMFA 3V7SA 1D3BB 2CJ9A 3VU3C 1NNHA 2DVEA 4XTZA 4EMKC 1QF6A 5LJ3f 3RF1A 1USYA 4YREA 2C8MA 2FB7A 1N9WA 3JB9I 4RDXA 4XU1A 1LJOA 2DDZA 2ZINA 3ERRA 2DZCA 3A5ZA 4C8QC 4PJOF 2ZT8A 2E64A 4DQ2A 4XU2A 5GANg 1TH7A 5E3IA 3HFNA 4YCUA 1USYC 2Q7GA 3ICAA 2DXUA 1B70B 3RKXA 4M7DD 4P75A 2I2LA 3QNEA 2EAYA 4EMKA 2DTIA 4N0AA 4C92G 4A53A 1I5LA 2FYKA 4M77A 3DSQA 2ODRC 5C52B 3LSSA 4M7AG 1NYRA 1ASZA 1SESA 1NJ1A 4CH4A 3REXA 2ZIOA 5LJ5j 2RHSA 4C92B 1G5HA 3JCMc 3RESA 3EFSA 4P74A 3SWNC 4PJOG 4UP8A 4XTWA 2DKGA 3BJUA 3JCMe 3JB9H 3G1ZA 4JRIA 4M75D 4M7DC 5F5WA 1WYDA 1D3BA 1PYSB 4YYEA 4KR3A 1RIQA 2DU5A 4M7AF 1ADJA 1HC7A 3HXVA 2QHUA 3TEHB 2ZZFA 4O2DA 1EQRA 5GAOq 4HVCA 3P8YA 1YFTA 4C92F 5ELNA 4M78F 4K87A 1YFSA 4XTUA 3HFOA 3TEHA 2I4LA 2Y90A 1LNXA 5GAMf 5GAOr 4C8QF 4P74C 1MGQA 4YRRA 3V7RA 4H2TA 2ZZEA 4PJOA 4MMLA 3HY1A 1KOGA 4Y91A 2DU7A 3I7FA 4P71C 3LC0A 3A31A 2ZT5A 3M4QA 3JB9F 4OP0A 3RUXA 1WPYA 5I21A 5GAOn 4AH6A 3VQVA 3NETA 5GAMe 1NYQA 3QSUA 1X2HA 2ALYB 3V7CA 4C8QG 3UGQA 3E9HA 3JB9D 4H02A 4HT9A 2ODRD 5GANj 4YRTA 1X2GA 3JCMV 3NEMA 3QO8A 1B34B 1I8FA 3JCMb 5GAN2 4TVAB 3BDUA 4TVAA 3QO5A 3P8TA 4RCBA 4PHCA 5HGQA 3L4GB 4H2UA 2EL9A 2RHQA 3JCMf 4HWOA 4NCXA 2JN0A 4YPFA 1KQ2A 1G5IA 2QHSA 4YP0A 4NOYA 3A7RA 3BY7A 4H2SA 4PJOE 3HXZA 4CH3A 4WJ3M 2DTHA 4EO4A 3PCOB 2VXFA 4YRLA 2RB6A 2P0LA 3KFUA 4NL3A 1SETA 5KNNA 4TWAA 3TEGA 2EJGA 4CH5A 5GANd 3RGLA 3HRIA 3FB9A 4XEOA 4YRQA 2ARTA 4H2WA 4RMFA 5LJ3h 4H2YA 3JCMJ 1I4K1 3IKMB 5LJ5g 3IKLA 5LJ5h 3NELA 2ZIMA 3V8JA 2ZZGA 5GAMh 3V8KA 4M78C 1LYLA 3L4GA 4M7AD 1BBWA 4F7UF 2HNIA 3INZA 5C53B 4H2XB 4M75F 4XU0A 4EMKB 4RQEA 1PYSA 3CMQA 2CGHA 2ZR3A
chains in the Genus database with same CATH superfamily
4YRFA 9ATCB 2A8EA 4PG3A 1OQKA 1RLQC 3VBBA 2GQVA 3NHNA 4M78A 2JTFA 5FWBA 2LMJA 1EVKA 4DBFA 4YRPA 2RM4A 3MEYA 3PE0A 4OB2B 1B76A 4LUDA 3VRZA 1PRMC 2DNUA 3LWIA 1JXOA 1N8RU 3X25B 2YSQA 4E7IA 11ASA 3CCMA 3TEEA 5LJ5f 4PLIA 2P0QA 3OSSC 1VQ8Q 2HSPA 2XDPA 4M78D 1MMAA 2VC8A 4JUVA 4YTLA 4CC3A 2YXYA 1VQMT 1ZLMA 2M0YA 4M7DB 4GLMA 4BB7A 4C8QE 3SFMA 1M3BA 4ESRA 3A32A 2V1QA 4LD6A 1JO8A 3EG0A 1H4QA 5CKDA 1IHWA 3OYJA 4MZMA 4J9CA 1Z7NA 1G3YA 1T0JA 1G3WA 4PNOA 2P4TA 2DD4A 4OB1B 1TUCA 3CCUQ 4XK8E 2RD1A 2HL5C 4HXJA 3BW1A 5J26A 1ZUYA 2ARSA 3OYHA 3PIOA 4M4ZA 1WJSA 3HPWA 1K0XA 2M9UA 1KQ1A 2ZT7A 4DOWA 4QW2A 2BTTA 5CIUA 2JW4A 1YCYA 2NLUA 1SEMA 1Z9ZA 4XEMA 2RF0A 5CK9A 2DA9A 2MI6A 1YWPA 5GMKm 4HWRA 4TVYA 2PVGB 3EFOA 4N4GA 3JCMX 4YRCA 2E5KA 4J9GA 4JS5A 3CC2T 2RH2A 4YROA 1B7YB 2GNCA 4PJNA 4OB0B 4PL6A 1BBUA 1QKXA 4RQFA 3TSZA 2KVQG 2L89A 1W4SA 2HKNA 2MMPA 2HQXA 3UA7A 2ALYA 2LJ1A 1J3TA 3VS4A 4ORZA 5K1PA 3SHWA 3HXWA 1RACB 4FM4B 4UP9A 2D0NA 1DJ7B 1D09B 1UG1A 4GBQA 2KT8A 2HL3A 2BZ8A 3PNWC 4WI1A 4LVKA 2FPFA 1GRIA 1V29B 3RL6A 2F69A 2JNGA 1AOJA 3LYIA 2QHTA 1VQLA 4YCVA 2QEXA 2C0TA 3VS7A 4AG1C 3ER0A 5FU7C 2K5LA 1JJCA 2E12A 1JJCB 2QI2A 1YITT 3M0TA 2DRMA 2OTJQ 2QQ9A 2KE9A 2J6FA 1YGBA 3EAEA 3EG1A 4J9FA 1EZZB 2B86A 2E41A 4Z02A 5GAOm 3TCJA 4R56A 4P5NA 5DY9A 2RMOA 5FLXE 5LJ3d 2EVRA 4M75E 3CCST 4BI4A 4PFOA 3OMCA 3O5ZA 4F7UE 1AEYA 2G4CA 3HL8A 2DRKA 4Z89A 2DL7A 1QVGA 4KQEA 3C0CA 2ZAEA 4FSXA 2M16A 2I4NA 1SG5A 3P8VA 1XJWB 4XTYA 5HY6A 2AT1B 3X26B 3JCMQ 2MWPA 3ZBDA 1Y71A 4X1VA 1NPPA 5CVIA 1WI7A 2QYZA 3RR6A 3AHUA 4P72C 1BIBA 1W2BP 1D1AA 5CKFA 1Q7YU 5I2MA 1K8AC 2QK0A 1QVFA 4CS4A 3M0SA 2BIVA 5EC7A 4QVCA 1M2VA 4LDWA 4FT2A 4RTWA 1JXMA 3CCQT 1G8XA 2KYMA 2OTLA 2RA2A 3GLXA 4G84A 2LNVA 4M7DF 4KUIA 3MO8A 3PZCA 4JRPA 3A8LB 2E70A 4JJCA 4M75B 1QW1A 2VV5A 4J9HA 2JJ9A 3QZ9B 1JB0E 2ZT6A 3CCRQ 3SDZA 1X55A 1PSEA 3BFMA 3MF1A 3LW5E 3NMZC 1HK9A 2CUDA 1GXIE 3E9IA 5FROA 2NUZA 3M58A 4P73C 4HWSA 1M9SA 3H0HA 3CCLQ 1T3LA 1X6GA 2DQ0A 4KH1B 3KBGA 2F1LA 3JCMh 4LDVA 1TG0A 4M78G 2KRSA 3A1PA 2PMEA 2R5AA 3G71A 2QXFA 3MF2A 2A08A 3PCOA 2K9GA 1BBZA 4C92A 4YRIA 3A7UA 1M1KR 2EQJA 3HRTA 2KY9A 3SWNB 1YB3A 4UP7A 4UPAA 5FRNA 4OLFA 4TVWA 1UGRB 2ROLA 3JAME 3JB9G 2A37A 3CCJT 5K1XA 1PC0A 3MEAA 1VQ5Q 4PK4A 2EYWA 4NL2A 1NEBA 2DYBA 1B70A 3LSQA 4BWAA 2PMFA 3V7SA 2CJ9A 3VU3C 1KQSS 1NNHA 1ZBJA 3BE3A 1NJIR 1USYA 3E2UA 2XMFA 1AZGB 1KD1U 2RHXA 2BE9B 3CCSA 1N9WA 3JB9I 4RDXA 4XU1A 3EH2A 3CBOA 3GPLA 1MHNA 3X24B 1N8RC 1H8KA 1Q82U 2CS7A 4DQ2A 2L8DA 2LVMA 3L2VA 2PTKA 1VQ6Q 2ENMA 1Q82R 2MWOA 3CPWP 3ICAA 3CPWA 3H8ZA 4LNPA 3RKXA 4P75A 2DL3A 2R58A 2ZPEB 5AT1B 2J6KA 4QT7A 4N0AA 1ZSZC 2HDAA 4XAXB 2FYKA 3HTRA 5C52B 3OSVA 3LSSA 2E6ZA 1EFNA 4IUPA 2X3WD 2RN8A 4FW1A 5KCOA 5AYFA 1ASZA 2DL4A 1SESA 1NJ1A 4AG2C 2ZIOA 4C0GA 3VJPA 3WVDB 1YHQQ 2RHSA 3JCMc 3RESA 2BKDN 3SWNC 3OYCA 3M59A 1K73U 3FDRA 3JCMe 1WA7A 2DPPB 2OAWA 5IH2A 1D1BA 3G1ZA 4OMFB 3UDCA 4M7DC 1WYDA 3CBPA 1W70A 2KEAA 3FRNA 4KR3A 1P92A 1UJYA 2J06A 1ZX6A 1AWOA 1SPKA 2ZPHB 1EQRA 1O9SA 2LQNA 1OI1A 3CXCP 2EQKA 2ED0A 3M4YA 2I4LA 2Y90A 5GAMf 4P74C 2Y4XA 7AT1B 2KSSA 2P4RA 3OYDA 2HD0A 2ED1A 4MMLA 2P84A 3M0QA 2DU7A 1SF9A 2R57A 3JB9F 2WSEE 2X3XD 1M30A 3VQVA 3RNJA 3G71T 1VQOT 1VOMA 2FZKB 1QVFP 4DBRA 4C0DB 1Q86R 1UGVA 2Z0WA 3E1SA 3OB9A 1O75A 3PMIA 3OYBA 4H02A 4J7FA 4YRTA 3QJ6A 1X2GA 1I8FA 3JCMb 1AD5A 2DIQA 4E7KA 3U23A 4RCBA 4H2UA 4HWOA 2LT4A 2F2XA 4FYVB 1VQMQ 1E6GA 1KQ2A 2CH4A 4LDXA 2X4WA 1NYFA 2DIGA 1D1CA 4JJNK 4PJOE 4R0KA 4EO4A 3PCOB 1UGQB 2AIRB 1KD1C 1FXXA 4TVRA 1K1ZA 3HRIA 3FB9A 4XEOA 2ARTA 3CCEQ 2LT1A 4DEYA 4RMFA 4H2YA 2KRNA 1KD1R 2CKKA 1I4K1 3IKMB 5LJ5g 3IKLA 3GOXA 3V8JA 3EFOB 3DLMA 1LYLA 1VQMA 2COWA 1BBWA 4JJBA 4F7UF 2HNIA 1QLYA 2RQRA 4M75F 1Q7YR 3CMQA 2ZR3A 2IVWA 2DXCA 1KJWA 1M3AA 1ZHIA 1NJ8A 5C51B 3OYGA 2DL5A 3HFZB 3VS3A 5GAN8 1WGSA 2HKQB 4A4HA 1R0BG 4RCCA 1VQ8A 4ZTUB 1HD3A 2D8JA 3UF4A 3CCRA 2ZCEA 2DZ9A 1I5OB 2QTVA 1XOVA 1JJ2S 1JRIA 2RK2A 2QEXT 2EYXA 5GAN4 1YWOA 1K73C 2AMCB 1K0SA 4FW2A 3TU4K 4CS2A 5CKHA 5IHKA 2K3YA 3HRKA 1M90C 1ACMB 5LJ3g 1IXDA 4P3PA 4PJOC 1GL5A 2DTOA 4BE1A 2LCLA 2YHTA 4OGCA 5KYXA 1C6VX 1SSFA 1Q81U 5LJ5e 4BUGA 2Q7HA 2AKWA 4M7AC 3A8GB 2C0OA 2JTEA 4N0AC 2C0IA 1QVGP 1SKUB 2IY5A 1BCMA 1K9MR 1YJ9Q 4KGVB 4HCCA 3EG9A 3PIPA 2DERA 4IUVA 1VQOA 2CREA 1VQKT 2VGNA 4RTUA 1M27C 4YCWA 1WYXA 2VUBA 3CXCA 1X56A 4M78B 1UHFA 1SERA 1NJ6A 3HRUA 4M77B 2G6FX 2E65A 1B34A 1W66A 1MMGA 5A0LA 1PSFA 2FPDA 1AT1B 4L6V5 3FJ5A 2EFIA 2XK0A 1WHJA 2KR3A 4QVZA 3S3NA 2DEUA 2JS2A 1N6AA 2CZ7B 3G6EA 1Q82C 2DX1A 1VQ6A 3SEMA 2RJCA 1QQJA 1VUBA 1WHGA 3OD1A 2KBTA 4M75G 4RTTA 4ZIBA 1H4SA 1E24A 2FL7A 3EHQA 3R6NA 2MIOA 5GJVB 1N5ZA 3VS1A 4IIOA 1WJRA 2J3MA 4ZTZB 2D9TA 2DK3A 5GMKl 1YN8A 4FYXB 3A8OB 2RQTA 2MCNA 3HSBA 3OYFA 5KYWB 3GP8A 1RAEB 1YHQA 2IIMA 3CD6T 2ZXFA 3HXXA 5CKBA 2I4OA 3P8BB 2AK5A 2ZNIA 4JLIA 4M75A 4QVDA 2KQWA 1EIYA 1IO6A 1WZOA 4YRNA 1M1KC 1PRLC 4L59A 1MNDA 5GAMg 4F04B 1H3ZA 2MK5A 1NYGA 4E51A 3P8HA 2D8HA 2VYTA 2J3LA 1QE0A 3GF5A 4F7UB 3REUA 2XDDA 3O8VA 3CCET 2RQWA 3URGA 1VYVA 5CAIA 1E6HA 1U1SA 1FYFA 4RTVA 1JEGA 3UT1A 5GAOp 3CC7T 1ARKA 2FPEA 4OMQA 3C4SA 3M4GA 2LX9A 1WU7A 1BIAA 1RAFB 1QWFA 4PJJA 2E4HA 1WHKA 2NUPA 3CMET 2QA4T 2QASA 5KYYB 1VQ5A 1ZSGA 4EMHA 2E3IA 1NLOC 2E6NA 1KMNA 4OGEA 1VQ9A 5IHNA 2F5TX 4XU3A 2PVDB 4HCBA 3H9NA 3OYAA 4K86A 4P75C 3META 1M5Q1 3VQXA 3QWYA 3QPHA 3H0IA 3HY0A 2WACA 2JUFA 3LLRA 1T0HA 4L87A 4YRMA 3CCVT 1ZA1B 2AHJB 1Y96B 4HCZA 4B9WA 4M77D 4KT0E 3G4ST 3CCJA 4CC4B 1IL2A 4OMOA 1VQ4A 2DFUA 1D0XA 6AT1B 3L2RA 2ARUA 1YI2A 1K9MC 4P3NA 2P5IA 5IN1A 2D0QB 1N9SA 1NE8A 1UB4A 1H4VB 3HRSA 2KDSA 4YDQA 1B8AA 2GFAA 4J6WA 1RABB 4KRTA 4FT4A 5KYNA 1XTDA 4LE9A 2JMCA 2ZGWA 3WVEB 2IY5B 5GANh 3GBQA 4AT1B 1OPKA 1KMMA 1QWEA 2M51A 4IURA 4CS3A 3PTAA 2RHQB 4Y92A 5GAN7 1VQ4Q 4M75C 3R07A 3QUIA 4KGZB 2K3BA 4M77C 5GAN3 1YI2Q 5KYUA 2RHIA 1UE9A 3M53A 3GIBA 1VQ9T 1S72T 3OYYA 2V8IA 3MP1A 1K9AA 1M4ZA 3RMSA 3ULRB 3EG9B 4AFQC 4XTZA 3EGXA 1M90R 1AWWA 2JT4A 3EGXB 2A0FB 3MJXA 1WX6A 1AWXA 1WXUA 3ERRA 2L3RA 3A5ZA 3M56A 5CQXA 4OMNA 2IPOB 3GNFB 3OYMA 2E64A 1PD1A 3VYHB 4DBQA 4XU2A 2K6DA 5E3IA 1ABOA 1NZ9A 2PZ1A 3CCEA 2RPNA 3C95A 1U06A 1VQLT 3JSCA 4BE2A 4C5IA 3J7AF 2A28A 1ZA2B 1QKWA 3QNEA 2HZYA 2DTIA 3DSQA 2DETA 1W1FA 2FG0A 4F16A 1BI0A 4M7AG 3EH1A 1X27A 2QA4A 3REXA 2RHZA 3HHTB 1GBQA 2CH4W 2K4YA 1R77A 2YUPA 3E19A 4PJOG 5A0DA 2DKGA 2G3RA 3BJUA 3E9GA 1SHGA 4ZN1A 1IB8A 1RIQA 1HC7A 3HXVA 3MQZA 3MP8A 1OZ2A 3TEHB 5D6XA 2EGEA 3VUBA 2EGAA 4C92F 1PG5B 4E7SA 4K87A 1YFSA 3M57A 3TEHA 4LVIA 1LNXA 2V8KA 1UGSB 3NTHA 4LN2A 4J8OA 5IAYA 3UATA 3OYKA 1KOGA 3VS5A 3I7FA 1N27A 2ZT5A 4IUUA 3MCAB 1RL2A 5I21A 4AH6A 4LD9K 3NETA 1FMKA 3JRZA 1RI9A 1BI1A 3QSUA 1QCFA 5EG2A 1TUGB 2ALYB 3V7CA 2DBKA 4B6MA 3E9HA 3H41A 2NS6A 3I35A 4KH0B 2DAQA 1RAHB 2KXDA 4TVAB 3BDUA 1WXTA 1RAGB 1FMWA 3EGDA 4J7IA 1SRMA 3L4GB 3CCMT 1G5IA 1IZ6A 4YP0A 2FVUA 4X34A 4NOYA 3LGFA 2COZA 2SRCA 1OZ3A 4CH3A 1BYMA 4WJ3M 2DTHA 1OU9A 1RLPC 3KXTA 1VQKA 2RK1A 1MNEA 3A8HB 1E7OA 3M0PA 1PKTA 2RB6A 1UDLA 3KFUA 4NL3A 1SETA 2FHDA 5KNNA 4VUBA 3TEGA 2EJGA 3I55Q 4J83A 3RGLA 4JJDA 1C1AA 2E5QA 5LJ3h 3OS2A 4BY6B 2NUPB 4J9IA 1GCQA 5IXBA 2ZZGA 3OQ5A 3NPFA 5GAMh 3RMQA 3EGDB 4M78C 2RI3A 3L4GA 4C0DC 1UHCA 1NBEB 3OS0A 4H2XB 1WDXA 1N8RR 4BI8B 3QXEB 3QIIA 5KYUB 4J9DA 2CGHA 1TWBA 1UEBA 3QDRB 2VXEA 2DQ3A 4JLGA 3L2UA 1Y7XA 2EKHA 3RDVA 2C7IA 2RHYA 4HT8A 1NG2A 1GFCA 2XICA 4Q5WA 4BY6C 2V1RA 3A5ZB 2L3QA 2EJ9A 2QG9B 3H0FA 1PM3A 4BDZA 4M77E 2E3HA 1D0YA 2JXBA 4FSSA 2XGTA 4FYWB 2KROA 2O01E 3VRYA 2GTOA 1RADB 3REBB 2CP2A 4E7JA 1LPLA 4JDSA 2NUTA 2DVJA 2NUTB 3VQWA 1R0CB 2A3LA 1YNZA 2PUOB 4C8QB 2K57A 4P73A 5D7UA 1J5WA 3I56T 4AFSC 2DXBA 4MZPA 3JCMP 4D6WA 4YRSA 2YRDA 2RJFA 4JRQA 2LC4A 5GJWB 3F70A 3HXUA 2MYSA 3I5SA 1UGPB 5GAN6 1VIEA 2CDTA 3RACA 2L3SA 4J9BA 3CEYA 3HTZA 2HBWA 1YJNA 5GMKe 2ECZA 4QQGA 4YRJA 3M0RA 5J39A 4HVWA 3PGGA 3JCMd 1PHTA 3PT9A 3G71Q 5HK0A 1QVPA 1PNJA 1Y96A 4MMKA 4WF2A 4KBMB 1KQSP 2E1HA 2OTLQ 4AMCA 2W0ZA 2A7YA 1M1FA 3SWNA 4A63B 3BDLA 4GY5A 2AMCA 3IG2A 12ASA 1D0ZA 2O9SA 2DL8A 5GMKj 4L5GA 5CO7A 4F7UA 2YUNA 1WNLA 1NPRA 1QP3A 1X69A 5GAOl 2EWNA 1FYNA 2J6OA 2VGMA 2YWWA 5IHIA 3QYHB 5A2QE 3JCMW 3A74A 1VQ7Q 3HFZA 4ELYC 2BE7D 4C92E 1YITQ 1YJWA 2RHSB 2XI9A 4CI0C 5CR2A 2ZCFB 2XTIA 4LUEA 2AKWB 4LDYA 3MPUB 1PWTA 4WTOB 3LWHA 1MUZA 2VB6A 4H2XA 2FEIA 2OTLT 2NYSA 4PFZA 3OY9A 1WHMA 5KE3A 1WQ7A 2GCXA 2ZPGB 4PLLA 2DE0X 1TXQA 3M0UA 4BW9A 2YUOA 1K9MU 4C92D 1U1TA 2GGRA 5LJ5d 3G4SQ 2LQWA 4PJMA 2QHVA 4N4IA 3L42A 3NTIA 5GAMj 3PFSA 5C0MA 3L1AA 4LVLA 1X01A 1U8RA 5FW9A 1H4TA 1IGQA 4X9CA 3RERA 2CZ0B 5HKCA 1G83A 5FU6B 2XD0A 3I56A 1F1BB 1SRLA 4M77G 1TUDA 3Q1JA 2B8AA 4FIBA 2FRYA 1WFWA 2OAUA 2DILA 3NFCA 4ATOA 2GFUA 4MDXA 1KFZA 1SSHA 1Q81R 4TQFA 3UGTA 3G4SA 2DEQA 2V8JA 5KCHA 2CJBA 2K79A 1VQ4T 5CQYA 2OX7A 2X35A 3CBMA 2DMOA 1X6OA 4LVJA 3CPWS 2XHCA 1TSFA 2WSCE 4D8KA 2CP6A 2VVKA 2M02A 4FL6A 1VQ7T 3IALA 3CMAA 1VQPA 1PCXA 1QCNA 1EOVA 2LNHB 2NWMA 3ME9A 3L2ZA 1ZUKA 4HWPA 4EPCA 3UPUA 2PUKB 5D6WA 4XTVA 4QKUA 5ELOA 3T9NA 4OMPA 5DM7R 4ZTJA 5GANe 2ZNJA 1ZSZB 4FYYB 3CCUA 4C8QD 3CCVQ 1S72A 2HSEB 2OTJT 2LZ6B 2CYZB 2QTXA 4M77F 4M78E 3HP9A 1X43A 3N5BB 2C06A 1LOJA 4M7AA 1FMVA 2QDLA 1VA7A 4FU6A 1VQZA 2COYA 2OJ2A 1VYUA 2QAZA 1EIYB 2QA4Q 4CC2A 1KC8R 3FIFA 4J15A 3QWXX 3LH5A 5CCAA 4HWTA 4O6JA 2XDBA 4JPBW 4C0ZA 5LJ3j 4Q15A 2KYBA 4KGXB 4TTVA 2XIDA 4KULA 5LJ3e 4D8DA 1BKBA 1I0CA 1E1TA 1TU0B 4P71A 2RQUA 1Q86C 4J5YA 4JRKA 3NENA 3OS5A 2QGFB 3RKYA 3HFVA 3VQYA 2O4XB 1OYXA 1QVFS 5LJ3f 5IXFA 1VQOQ 2C8MA 2CSQA 4IUTA 2FB7A 5CKEA 2J05A 3M5AA 4OF1A 2QQRA 2DDZA 2ZINA 1K73R 4RMOA 3CC4Q 4RTZA 2JTMA 3L2WA 1BI3A 2ZT8A 1U3OA 1LVKA 5GANg 4A4EA 1TH7A 3PVLA 3M55A 3HFNA 2IG0A 2CZ6B 2Q7GA 1QMCA 2EW3A 1WJQA 1B70B 4M7DD 2YRCA 2EAYA 4EMKA 1UECA 2RO0A 4C0FA 1I5LA 4M77A 2ODRC 1AZEA 2PQWA 2AKLA 1NYRA 1Q7YC 1BK2A 3CC4A 2GF7A 1KSWA 2JM8A 1AWJA 2SEMA 4BDYA 3A98A 4P74A 1EFWA 2JVVA 3UA6A 1M3CA 4UP8A 4XTWA 1ZBXA 3ZEHA 2JMAA 1WXBA 2D1XA 1OULA 5FWCA 3JB9H 3G6ET 4JRIA 4M75D 5F5WA 2EYZA 1D3BA 3QBYA 1QVGS 3MEWA 2DU5A 1CSKA 2DYIA 2ZPFB 5I22A 5I2SA 1M2OA 1EIFA 2ZZFA 4O2DA 5GAOq 3ZFJA 4IIMA 3P8YA 2H3JA 1YFTA 2RQVA 5ELNA 2P0KA 2K3XA 4M78F 3HFOA 2RHUA 2JZ2A 3LGLA 2W10A 4C8QF 2Y4YA 1MGQA 4YRRA 1A0NB 4H2TA 1VIFA 1WHHA 2OTJA 1GFDA 3HY1A 3KFVA 3CD6A 1GBRA 3LC0A 2GTJA 3M4QA 4OP0A 1NJIC 3RUXA 1WPYA 1TS9A 5GAOn 3CQTA 5GAMe 2QQSA 3FEOA 1HYOA 1X2HA 4E7HA 1T3SA 4C8QG 2BZYA 2FZCB 4HT9A 5GANj 3MHXA 3QO8A 4FCYA 1K76A 2WSFE 5GAN2 4PFPA 4HVUA 3CMAT 5HGQA 3H6ZA 2RHQA 4NCXA 3JCMf 1H3HA 3VUZA 2JN0A 4YPFA 3M54A 1U5SA 1YI2T 3A7RA 3BY7A 3SD4A 1G2BA 2HQHA 4H2SA 3HXZA 3TQ7P 1BU1A 5FRMA 3C94A 3S6WA 2P0LA 5DLQE 1UUEA 4J9EA 3CMEA 3ASKA 4E7LA 4IKFA 1VQ5T 1NEGA 4YRQA 5J3BA 1YFNA 3JCMJ 1IGUA 1JJ2A 5LJ5h 2K5IA 1YJNQ 1H92A 5FU6C 3VV0A 2A36A 3QYGB 1GCPA 3QZ5B 3VKIA 3INZA 5C53B 2EKOA 5IT9E 4CC7A 4RQEA 1PKSA 1PYSA 2D6FA 2CZ1B 3OYNA 4LDUA 3CCSQ 4Y28E 1C0MA 1X2KA 2I0NA 4ANJA 1FX7A 3DB4A 1JQQA 2X4YA 3CCQA 3UWNA 3OYLA 3VS6A 3FC3A 4XQ3A 4XTXA 3GNGA 4RUGA 2O31A 2BUDA 4PJLA 1WQWA 8AT1B 1NLPC 2E5AA 1VQ9Q 2QGGA 1K8AR 1WLPB 3CCMQ 2LJ0A 1G3SA 4O5VA 1XQHA 1W2BS 1R8OB 1YP5A 2DLPA 2MPXC 2VWFA 2CIMA 1QP2A 2DXTA 1S72Q 4KUDK 1KC8C 4J6XA 3S3MA 4WCIA 2F5KA 1M8MA 5GAMd 4C92C 2ZTGA 3HKSA 2F2VA 4NS5A 4P3OA 4M7AE 3CCQQ 3J81E 1OPLA 2CP0A 1YFRA 2LJ3A 1JBMA 2YLCA 2KI7A 1X75C 4C5EA 4ZGEB 3HXYA 2LTOA 2ZPIB 2YRVA 3J80E 1M8VA 5GMKh 2CUBA 4WJ4A 1X2QA 1NM7A 2BZXA 4DPGA 3OMGA 1CKAA 3FLGA 4F14A 1PD0A 2O4XA 1W2BA 3UH0A 3CC4T 2VKNA 2RNAA 1M2VB 3X20B 2ZPBB 3I9QA 1WLEA 3D7SB 1E22A 3REAB 3CCRT 2DJQA 1TOVA 3THKA 3OW2A 3A7AA 3QO3A 1TTHB 4E6RA 5GANf 4A54A 2DJZA 5I11A 1B07A 1MV0B 1OV3A 4J6YA 2KMTA 5DLOA 1IRXA 4M7DA 1HTTA 4TQDA 3TUPA 2XU8A 2E10A 1SHFA 2K7AA 1VQ7A 3EFRA 2RI5A 4V2SA 4E2FB 1E1OA 4RTYA 3CXCS 1VQNT 1VQPT 4C5GA 2KNBB 1X54A 2EQIA 4M7AB 1Z7MA 3SB2A 2RJDA 2AZSA 2KRMA 2EYYA 1G51A 4X9DA 3VYGA 2PVOB 1JU5C 3EG2A 2LDMA 3C12A 4II1A 3G1JA 1BB9A 2X9HA 4BI3A 4F17A 1I81A 2FZGB 4ZN3A 4LVMA 2PU9B 1UTIA 1ZSZA 3E9FA 3EGUA 3JB9J 2YT6A 1MMDA 3WQZA 2K2MA 1KIKA 4P72A 2KXCA 2I4MA 4G85A 1Y57A 3A5YA 1V76A 4RKUE 5D6YA 1WIEA 5GMKi 1FWZA 2O2OA 1C0AA 3I5RA 2L5QA 4Q6GA 1CKBA 2KAFA 1M1GA 2DF6A 2HBPA 1Z9QA 3LH0A 4RG8A 3M4PA 1S1NA 3CPFA 2EGCA 2E3CA 3OYEA 1ATIA 3CC2Q 3OS1A 2Q5IA 4ELZC 2JM9A 4F7UG 3RIRA 4C5HA 3CCVA 2P0PA 4HA8A 4EMGA 4DOVA 5L23A 2JS0A 3NGPA 3CCLT 3A8MB 1VQ6T 1Y07A 2ZR2A 1HJDA 4KR2A 2VASA 3X28B 4C8QA 2LP5A 2K5FA 1K8AU 1YJ9A 4PJOD 1HXDA 3CD6Q 3R6OA 1VQNA 2EJFA 2M0OA 4OMLA 1NJIU 1NJ2A 2GQIA 1JJ2P 5L8RE 1ZUUA 3QKJA 2MF2A 1H641 4YRKA 1VYTA 3MEVA 3I55A 2EQUA 3ZL7C 1YCSB 4K88A 3DB3A 1VQPQ 4GLKA 1G3TA 2ATCB 1YHQT 2O88A 3QO7A 1KG1A 4H2VA 1EVLA 4LXCA 3JCMg 3KUFA 4PJOB 2LCSA 2QEXQ 1W6XA 3CC7Q 1B7YA 1SRYA 2RI2A 3FJPA 1V1CA 2DO3A 2CJAA 2O9VA 1G5VA 3QTCA 5KYXB 1KC8U 1NJ5A 5ECAA 5LL6S 1ASYA 1ADYA 2Q5HA 1Q81C 1XNIA 2GBQA 4X5OA 1AHJB 3RKWA 3V8LA 1OU8A 2K2VA 8ATCB 2F2WA 2H3EB 2CP7A 4MZTA 2FRWA 3VS2A 1KK7A 4JZ3A 1WHLA 1L0WA 2RJEA 4EX5A 1B3QA 4YRGA 3CC7A 2ESWA 2LRQA 2Q7EA 1OOTA 2FO0A 1UFFA 2CT4A 3EG3A 1OEBA 1N9RA 3OYIA 3DKMA 4DA4A 2L0AA 3LX7A 4A4FA 2YLBA 1RI0A 1GGMA 1ABQA 2L3PA 4CH6A 4HKEA 2DM1A 4BE0A 3OBWA 1ZQ1A 2YDLA 3WXMB 1M90U 4LNSA 3W3SA 2L2PA 2MAMA 4M7DG 5KYWA 4M7DE 3AT1B 3PVQA 3P8DA 3PMTA 3QHSA 4E47A 3UFGA 5GAN5 4B9XA 2OI3A 2HMAA 1D3BB 4BD3A 2AZVA 4JS4A 2DVEA 1AVZC 2HQEA 1IHVA 4EMKC 4K11A 1QF6A 3RF1A 4YREA 4CRIA 3TREA 2JOYA 1YIJA 1VQ8T 1YJWT 1LJOA 2DZCA 3QDFA 3MEUA 4C8QC 4PJOF 4Z8AA 2KK4A 2EPDA 1VQKQ 2KGTA 4YCUA 1USYC 4EDUA 2DXUA 1YBYA 2HCKA 2X4XA 1Y0MA 2I2LA 2LX7A 4C92G 4ZTFA 4A53A 2LQKA 2V26A 1QCOA 1YIJQ 1VQLQ 1Q86U 3I55T 4CH4A 2X4JA 5LJ5j 2ABLA 4C92B 2HEQA 1G5HA 1KHIA 3EFSA 1UJ0A 4EIKA 4DEXA 1RAAB 5KYYA 2CT3A 2QQAA 4R55A 3G6EQ 2EIFA 4ZGDB 2QQBA 1PYSB 4YYEA 2X51A 4M7AF 1ADJA 2QHUA 5C6SA 3CMEQ 1KQSA 5KH6A 4HVCA 4ME7A 4A4KA 4ZGJB 1LCKA 1Q95G 2R5MA 4JZ4A 4XTUA 2PNIA 1YIJT 3TSWA 2XKOC 2EBPA 3QG1A 4MDWA 3JV3A 5GAOr 1X6BA 2KT1A 3CCLA 2ZZDA 1MMNA 4A4GA 1HSQA 2H8HA 3V7RA 3IQLA 2ZZEA 1OX9A 3TVTA 4PJOA 4PKCC 4Z88A 4RTXA 2AKKA 2DD5A 4Y91A 4P71C 2XG8D 3A31A 2CSIA 1K4US 1I07A 1BCOA 4HT4A 1YJ9T 1M1KU 3L2QA 1KHCA 2QDYB 1GCQC 3MKDA 5KE2A 1NYQA 4IUQA 2YUQA 1RAIB 2EYQA 4QQ6A 3UGQA 3JB9D 1BI2A 5FU7B 3M9QA 1YJWQ 3I56Q 2EQMA 5M9OA 3DLLA 2ODRD 5HK3A 4OVAA 4BACA 3CCJQ 3JCMV 4RG2A 3NEMA 1B34B 2ROTA 4TVAA 3QO5A 2MOXA 3P8TA 4PHCA 2EL9A 3CC2A 3CCUT 2QHSA 1B7TA 2CP3A 4QQDA 3RBBB 3QJYA 2CP5A 3OW2S 2HAXA 1OX8A 3CMAQ 4HVVA 4N4HA 1MV3A 2LQ8A 3OBYA 4OB3B 2VXFA 4YRLA 3G7ZA 4TWAA 4CH5A 5GANd 1IREB 3MP6A 4AFUC 4H2WA 2M1HA 2DBMA 3OA6A 1VQNQ 3VS0A 3OW2P 2ZIMA 3NELA 3NTKA 4AFZC 3V8KA 1EX4A 4ZNXA 5HCKA 4M7AD 3S3OA 4DBHA 1I1JA 3EHRA 2LCCA 1YITA 5A0GA 4UC4A 4XU0A 4EMKB 4OMMA 1YJNT 4HCKA 1RUWA 4E7ZA 2J7IA
chains in the Genus database with same CATH topology
4YRFA 2A8EA 4PG3A 3VBBA 2GQVA 4M78A 2JTFA 1EVKA 4YRPA 2RM4A 3MEYA 4OB2B 1B76A 3LWIA 1N8RU 3X25B 4E7IA 11ASA 3CCMA 3TEEA 5LJ5f 4PLIA 2P0QA 3OSSC 2XDPA 4M78D 4JUVA 2VC8A 4YTLA 1VQMT 4M7DB 4BB7A 4C8QE 3SFMA 3A32A 4LD6A 1H4QA 5CKDA 3OYJA 4MZMA 1Z7NA 1G3YA 1G3WA 4PNOA 2P4TA 2DD4A 4OB1B 4XK8E 2RD1A 3BW1A 5J26A 2ARSA 3OYHA 3PIOA 1WJSA 3HPWA 2M9UA 1KQ1A 2ZT7A 4DOWA 4QW2A 5CIUA 1YCYA 2NLUA 4XEMA 5CK9A 2MI6A 5GMKm 4HWRA 4TVYA 2PVGB 4N4GA 3JCMX 4YRCA 4JS5A 3CC2T 2RH2A 4YROA 1B7YB 4OB0B 1BBUA 4PL6A 4RQFA 2KVQG 2L89A 1W4SA 2MMPA 2HQXA 2ALYA 5K1PA 3HXWA 4FM4B 4UP9A 1DJ7B 3PNWC 4WI1A 4LVKA 1V29B 3RL6A 2F69A 2JNGA 3LYIA 2QHTA 1VQLA 4YCVA 2QEXA 3ER0A 5FU7C 2K5LA 1JJCA 2E12A 1JJCB 2QI2A 1YITT 2QQ9A 1YGBA 3EAEA 2E41A 4Z02A 5GAOm 3TCJA 4R56A 4P5NA 5DY9A 5FLXE 5LJ3d 4M75E 3CCST 4BI4A 3OMCA 4F7UE 2G4CA 3HL8A 4KQEA 1QVGA 4FSXA 2M16A 2I4NA 3P8VA 5HY6A 4XTYA 3X26B 3JCMQ 2MWPA 3ZBDA 1Y71A 1NPPA 5CVIA 3AHUA 4P72C 1BIBA 5CKFA 1Q7YU 5I2MA 1K8AC 1QVFA 4CS4A 2BIVA 4QVCA 4LDWA 4FT2A 3CCQT 2OTLA 2RA2A 3GLXA 4G84A 2LNVA 4M7DF 4KUIA 3MO8A 3PZCA 4JRPA 3A8LB 2E70A 4M75B 1QW1A 2VV5A 3QZ9B 1JB0E 2ZT6A 3SDZA 1X55A 1PSEA 3BFMA 3MF1A 3LW5E 1HK9A 1GXIE 3E9IA 5FROA 3M58A 4P73C 4HWSA 1M9SA 2DQ0A 3KBGA 3JCMh 4LDVA 4M78G 2PMEA 2R5AA 3G71A 2QXFA 3MF2A 3PCOA 4C92A 4YRIA 3A7UA 2EQJA 3HRTA 2KY9A 3SWNB 1YB3A 4UP7A 4UPAA 5FRNA 4OLFA 4TVWA 1UGRB 3JAME 3JB9G 3CCJT 5K1XA 3MEAA 4NL2A 1B70A 3LSQA 4BWAA 2PMFA 3V7SA 2CJ9A 3VU3C 1KQSS 1NNHA 1USYA 1KD1U 2RHXA 3CCSA 1N9WA 3JB9I 4RDXA 4XU1A 3GPLA 3CBOA 1MHNA 3X24B 1N8RC 1Q82U 2CS7A 4DQ2A 2L8DA 2LVMA 3L2VA 2MWOA 3ICAA 3CPWA 3H8ZA 3RKXA 4P75A 2R58A 2ZPEB 4N0AA 4XAXB 2FYKA 5C52B 3OSVA 3LSSA 2E6ZA 4IUPA 5KCOA 5AYFA 1ASZA 1SESA 1NJ1A 2ZIOA 4C0GA 3VJPA 3WVDB 2RHSA 3JCMc 3RESA 2BKDN 3SWNC 3OYCA 3M59A 1K73U 3FDRA 3JCMe 2DPPB 3G1ZA 4OMFB 3UDCA 4M7DC 1WYDA 3CBPA 3FRNA 4KR3A 1P92A 2ZPHB 1EQRA 1O9SA 1OI1A 2EQKA 3M4YA 2I4LA 2Y90A 5GAMf 4P74C 2Y4XA 2KSSA 3OYDA 2HD0A 4MMLA 2DU7A 2R57A 3JB9F 2WSEE 3VQVA 3G71T 1VQOT 4C0DB 3E1SA 3OB9A 1O75A 3PMIA 3OYBA 4H02A 4J7FA 4YRTA 3QJ6A 1X2GA 1I8FA 3JCMb 2DIQA 4E7KA 4RCBA 4H2UA 4HWOA 2LT4A 1KQ2A 4LDXA 2X4WA 2DIGA 4JJNK 4PJOE 4EO4A 3PCOB 1UGQB 1KD1C 1FXXA 4TVRA 3HRIA 3FB9A 4XEOA 2ARTA 2LT1A 4RMFA 4H2YA 2CKKA 1I4K1 3IKMB 5LJ5g 3IKLA 3GOXA 3V8JA 3DLMA 1LYLA 1VQMA 1BBWA 4F7UF 2HNIA 4M75F 3CMQA 2ZR3A 2IVWA 2DXCA 5C51B 1NJ8A 1ZHIA 3OYGA 3HFZB 5GAN8 1WGSA 4A4HA 4RCCA 1VQ8A 4ZTUB 3CCRA 2ZCEA 2DZ9A 1XOVA 1JJ2S 1JRIA 2RK2A 2QEXT 5GAN4 1K73C 2AMCB 3TU4K 4CS2A 5CKHA 2K3YA 3HRKA 1M90C 5LJ3g 4P3PA 4PJOC 2DTOA 4BE1A 2LCLA 2YHTA 4OGCA 1SSFA 1Q81U 5LJ5e 4BUGA 2Q7HA 2AKWA 4M7AC 3A8GB 4N0AC 2IY5A 4HCCA 3PIPA 4IUVA 1VQOA 1VQKT 2VGNA 4YCWA 2VUBA 3CXCA 1X56A 4M78B 1SERA 1NJ6A 3HRUA 4M77B 2E65A 1B34A 1W66A 5A0LA 1PSFA 4L6V5 2EFIA 2XK0A 4QVZA 3S3NA 1N6AA 2CZ7B 3G6EA 1Q82C 1VQ6A 2RJCA 1VUBA 3OD1A 4M75G 4ZIBA 1H4SA 1E24A 2FL7A 1WJRA 2J3MA 4ZTZB 2D9TA 2DK3A 5GMKl 3A8OB 3HSBA 3OYFA 3GP8A 1YHQA 3CD6T 2ZXFA 3HXXA 5CKBA 2I4OA 3P8BB 2ZNIA 4JLIA 4M75A 4QVDA 2KQWA 1EIYA 4YRNA 1M1KC 4L59A 5GAMg 1H3ZA 4E51A 3P8HA 2VYTA 2J3LA 1QE0A 3GF5A 4F7UB 3REUA 2XDDA 3O8VA 3CCET 3URGA 5CAIA 1U1SA 1FYFA 3UT1A 5GAOp 3CC7T 3C4SA 3M4GA 2LX9A 1WU7A 1BIAA 3CMET 2QA4T 1VQ5A 4EMHA 2E6NA 1KMNA 4OGEA 1VQ9A 2F5TX 4XU3A 2PVDB 4HCBA 3OYAA 4K86A 4P75C 3META 1M5Q1 3VQXA 3QPHA 3HY0A 2WACA 2JUFA 3LLRA 4L87A 4YRMA 3CCVT 2AHJB 1Y96B 4HCZA 4B9WA 4M77D 4KT0E 3G4ST 3CCJA 1IL2A 1VQ4A 3L2RA 2ARUA 1YI2A 1K9MC 4P3NA 2P5IA 5IN1A 2D0QB 1N9SA 1NE8A 1UB4A 1H4VB 3HRSA 2KDSA 4YDQA 1B8AA 2GFAA 4J6WA 4FT4A 1XTDA 2ZGWA 3WVEB 2IY5B 5GANh 1KMMA 4IURA 4CS3A 3PTAA 2RHQB 5GAN7 4M75C 3R07A 3QUIA 4M77C 5GAN3 2RHIA 3M53A 3GIBA 1VQ9T 1S72T 3OYYA 2V8IA 3MP1A 1M4ZA 3RMSA 4XTZA 3ERRA 2L3RA 3A5ZA 3M56A 5CQXA 3GNFB 3OYMA 2E64A 3VYHB 4XU2A 5E3IA 1NZ9A 3CCEA 3C95A 1VQLT 3JSCA 4BE2A 4C5IA 3J7AF 3QNEA 2DTIA 3DSQA 1BI0A 4M7AG 2QA4A 3REXA 2RHZA 3HHTB 2K4YA 4PJOG 3E19A 5A0DA 2DKGA 2G3RA 3BJUA 3E9GA 4ZN1A 1RIQA 1HC7A 3MQZA 3HXVA 3MP8A 1OZ2A 3TEHB 5D6XA 3VUBA 4C92F 4K87A 1YFSA 3M57A 3TEHA 4LVIA 1LNXA 2V8KA 1UGSB 3NTHA 4J8OA 5IAYA 3OYKA 1KOGA 3I7FA 1N27A 2ZT5A 4IUUA 3MCAB 1RL2A 5I21A 4AH6A 4LD9K 3NETA 3JRZA 1BI1A 3QSUA 5EG2A 2ALYB 3V7CA 3E9HA 2NS6A 2DAQA 4TVAB 3BDUA 3L4GB 4J7IA 3CCMT 1G5IA 1IZ6A 4YP0A 2FVUA 4X34A 4NOYA 3LGFA 1OZ3A 4CH3A 1BYMA 4WJ3M 2DTHA 3KXTA 1VQKA 2RK1A 3A8HB 2RB6A 3KFUA 4NL3A 1SETA 2FHDA 5KNNA 4VUBA 3TEGA 2EJGA 4J83A 3RGLA 2E5QA 5LJ3h 3OS2A 4BY6B 2ZZGA 3OQ5A 5GAMh 3RMQA 4M78C 3L4GA 2RI3A 4C0DC 3OS0A 4H2XB 4BI8B 3QXEB 3QIIA 2CGHA 1UEBA 3QDRB 2VXEA 2DQ3A 4JLGA 3L2UA 1Y7XA 2C7IA 2RHYA 4HT8A 2XICA 4Q5WA 4BY6C 3A5ZB 2EJ9A 4BDZA 4M77E 2XGTA 2O01E 4E7JA 4JDSA 3VQWA 2A3LA 2PUOB 4C8QB 2K57A 4P73A 1J5WA 3I56T 2DXBA 4MZPA 3JCMP 4D6WA 4YRSA 2RJFA 4JRQA 2LC4A 3F70A 3HXUA 1UGPB 5GAN6 1VIEA 3RACA 3CEYA 3HTZA 1YJNA 5GMKe 4QQGA 4YRJA 5J39A 3PGGA 3JCMd 3PT9A 5HK0A 1QVPA 1Y96A 4MMKA 4WF2A 4KBMB 2E1HA 2A7YA 1M1FA 3SWNA 3BDLA 4GY5A 2AMCA 3IG2A 12ASA 5GMKj 4L5GA 5CO7A 4F7UA 1WNLA 1NPRA 1QP3A 5GAOl 2EWNA 2VGMA 5A2QE 3QYHB 3JCMW 3A74A 3HFZA 4ELYC 4C92E 1YJWA 2RHSB 2XI9A 4CI0C 5CR2A 2ZCFB 2XTIA 2AKWB 4LDYA 3LWHA 4H2XA 2OTLT 3OY9A 5KE3A 1WQ7A 2GCXA 2ZPGB 4PLLA 4BW9A 1K9MU 4C92D 1U1TA 5LJ5d 2QHVA 4N4IA 3L42A 3NTIA 5GAMj 3PFSA 5C0MA 3L1AA 4LVLA 1X01A 1H4TA 4X9CA 3RERA 2CZ0B 5HKCA 5FU6B 2XD0A 3I56A 4M77G 3Q1JA 2B8AA 4FIBA 4ATOA 2OAUA 3NFCA 4MDXA 1EFWA 2GFUA 3UGTA 4TQFA 3G4SA 2DEQA 2V8JA 5KCHA 2CJBA 1VQ4T 5CQYA 2X35A 3CBMA 1X6OA 4LVJA 3CPWS 2XHCA 2WSCE 4FL6A 1VQ7T 3IALA 3CMAA 1VQPA 1EOVA 3ME9A 3L2ZA 4HWPA 4EPCA 3UPUA 2PUKB 5D6WA 4XTVA 5ELOA 3T9NA 5DM7R 4ZTJA 5GANe 2ZNJA 3CCUA 4C8QD 1S72A 2OTJT 2CYZB 2QTXA 4M77F 4M78E 3HP9A 3N5BB 2C06A 1LOJA 4M7AA 4FU6A 1VQZA 1EIYB 3FIFA 4J15A 5CCAA 4HWTA 4O6JA 2XDBA 4C0ZA 5LJ3j 4Q15A 4TTVA 2XIDA 4KULA 5LJ3e 1BKBA 1E1TA 4P71A 1Q86C 4J5YA 4JRKA 3NENA 3OS5A 3RKYA 3HFVA 3VQYA 2O4XB 1OYXA 1QVFS 5LJ3f 2C8MA 4IUTA 2FB7A 5CKEA 3M5AA 4OF1A 2QQRA 2DDZA 2ZINA 4RMOA 2JTMA 3L2WA 1BI3A 2ZT8A 5GANg 4A4EA 1TH7A 3M55A 3HFNA 2IG0A 2CZ6B 2Q7GA 1WJQA 1B70B 4M7DD 2EAYA 4EMKA 2RO0A 4C0FA 1I5LA 4M77A 2ODRC 2PQWA 1NYRA 1Q7YC 3CC4A 2GF7A 4BDYA 4P74A 2JVVA 4UP8A 4XTWA 1ZBXA 3ZEHA 3JB9H 3G6ET 4JRIA 4M75D 5F5WA 1D3BA 3QBYA 1QVGS 3MEWA 2DU5A 5I2SA 2ZPFB 1EIFA 2ZZFA 4O2DA 5GAOq 3ZFJA 3P8YA 2H3JA 1YFTA 5ELNA 2P0KA 2K3XA 4M78F 3HFOA 2RHUA 2JZ2A 3LGLA 4C8QF 2Y4YA 1MGQA 4YRRA 4H2TA 1VIFA 2OTJA 3HY1A 3CD6A 3LC0A 3M4QA 4OP0A 1NJIC 3RUXA 1WPYA 5GAOn 5GAMe 2QQSA 3FEOA 1X2HA 4E7HA 4C8QG 4HT9A 5GANj 3MHXA 3QO8A 2WSFE 5GAN2 3CMAT 5HGQA 3H6ZA 4NCXA 2RHQA 3JCMf 3VUZA 2JN0A 4YPFA 3M54A 1YI2T 3A7RA 3BY7A 3SD4A 4H2SA 3HXZA 5FRMA 3C94A 3S6WA 2P0LA 5DLQE 3CMEA 3ASKA 4E7LA 4IKFA 1VQ5T 4YRQA 5J3BA 3JCMJ 1JJ2A 5LJ5h 2K5IA 5FU6C 3VV0A 3QYGB 3QZ5B 3VKIA 3INZA 5C53B 2EKOA 5IT9E 4RQEA 1PYSA 2D6FA 2CZ1B 3OYNA 4LDUA 4Y28E 1FX7A 3DB4A 2X4YA 3CCQA 3UWNA 3OYLA 3FC3A 4XQ3A 4XTXA 3GNGA 2BUDA 1WQWA 2E5AA 1G3SA 4O5VA 1XQHA 1W2BS 1R8OB 2CIMA 1QP2A 2DXTA 4KUDK 1KC8C 4J6XA 3S3MA 2F5KA 5GAMd 4C92C 2ZTGA 3HKSA 4NS5A 4P3OA 4M7AE 3J81E 1YFRA 1JBMA 2YLCA 1X75C 4C5EA 4ZGEB 3HXYA 2LTOA 2ZPIB 2YRVA 3J80E 1M8VA 5GMKh 4WJ4A 4DPGA 3OMGA 3FLGA 2O4XA 1W2BA 3UH0A 3CC4T 3X20B 2ZPBB 1WLEA 1E22A 3CCRT 3OW2A 3A7AA 3QO3A 5GANf 4A54A 2DJZA 1HTTA 2KMTA 4J6YA 5DLOA 4M7DA 4TQDA 3TUPA 2XU8A 2E10A 1VQ7A 3EFRA 2RI5A 4V2SA 1E1OA 1VQNT 3CXCS 1VQPT 4C5GA 1X54A 4M7AB 1Z7MA 3SB2A 2RJDA 1G51A 4X9DA 3VYGA 2PVOB 2LDMA 3C12A 4II1A 4BI3A 1I81A 4ZN3A 4LVMA 2PU9B 3E9FA 3JB9J 3WQZA 4P72A 2I4MA 4G85A 3A5YA 4RKUE 5D6YA 5GMKi 1FWZA 1C0AA 2L5QA 4Q6GA 2KAFA 1M1GA 3M4PA 2HBPA 3LH0A 4RG8A 3CPFA 2E3CA 3OYEA 1ATIA 3OS1A 2Q5IA 4ELZC 4F7UG 3RIRA 4C5HA 3CCVA 2P0PA 4HA8A 4EMGA 4DOVA 3CCLT 3A8MB 1VQ6T 1Y07A 2ZR2A 4KR2A 3X28B 4C8QA 2K5FA 1K8AU 1YJ9A 4PJOD 1HXDA 3R6OA 1VQNA 2EJFA 2M0OA 1NJIU 1NJ2A 5L8RE 3QKJA 2MF2A 1H641 4YRKA 3MEVA 3I55A 2EQUA 4K88A 3DB3A 4GLKA 1G3TA 1YHQT 3QO7A 4H2VA 1KG1A 1EVLA 3KUFA 3JCMg 4PJOB 1SRYA 1B7YA 2RI2A 3FJPA 2DO3A 2CJAA 1G5VA 3QTCA 1KC8U 1NJ5A 5LL6S 1ASYA 1ADYA 2Q5HA 1Q81C 1XNIA 4X5OA 1AHJB 3RKWA 3V8LA 2K2VA 4MZTA 1L0WA 2RJEA 4EX5A 4YRGA 3CC7A 2LRQA 2Q7EA 1N9RA 3OYIA 3DKMA 4DA4A 3LX7A 4A4FA 2YLBA 1RI0A 1GGMA 4CH6A 4HKEA 4BE0A 3OBWA 1ZQ1A 3WXMB 1M90U 4LNSA 3W3SA 2MAMA 4M7DG 4M7DE 3P8DA 3PMTA 3QHSA 4E47A 3UFGA 5GAN5 4B9XA 1D3BB 4BD3A 4JS4A 2DVEA 2HQEA 4EMKC 1QF6A 3RF1A 4YREA 4CRIA 3TREA 2JOYA 1YIJA 1VQ8T 1YJWT 1LJOA 2DZCA 3MEUA 4C8QC 4PJOF 2KK4A 4YCUA 1USYC 4EDUA 2DXUA 1YBYA 2X4XA 2I2LA 4C92G 4ZTFA 4A53A 2LQKA 1Q86U 3I55T 4CH4A 2X4JA 5LJ5j 4C92B 1G5HA 1KHIA 3EFSA 2QQAA 4R55A 2EIFA 4ZGDB 2QQBA 1PYSB 4YYEA 4M7AF 1ADJA 2QHUA 5C6SA 1KQSA 5KH6A 4HVCA 4ME7A 4A4KA 4ZGJB 2R5MA 4XTUA 1YIJT 2XKOC 3QG1A 4MDWA 5GAOr 3CCLA 2ZZDA 4A4GA 3V7RA 2ZZEA 4PJOA 4PKCC 2DD5A 4P71C 4Y91A 2XG8D 3A31A 4HT4A 1YJ9T 1M1KU 3L2QA 1KHCA 2QDYB 5KE2A 1NYQA 4IUQA 2EYQA 4QQ6A 3UGQA 3JB9D 1BI2A 5FU7B 3M9QA 2EQMA 5M9OA 3DLLA 2ODRD 5HK3A 4OVAA 4BACA 3JCMV 4RG2A 3NEMA 1B34B 4TVAA 3QO5A 3P8TA 4PHCA 2EL9A 3CC2A 3CCUT 2QHSA 4QQDA 3QJYA 3OW2S 2HAXA 4N4HA 2LQ8A 3OBYA 4OB3B 2VXFA 4YRLA 3G7ZA 4TWAA 4CH5A 5GANd 1IREB 3MP6A 4H2WA 2M1HA 3OA6A 3NELA 2ZIMA 3NTKA 3V8KA 4M7AD 3S3OA 2LCCA 1YITA 5A0GA 4UC4A 4XU0A 4EMKB 1YJNT 1U8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRF A;  2VXE A;  5C51 B;  2DQ3 A;  1NJ8 A;  2C7I A;  4PG3 A;  4HT8 A;  3VBB A;  3HFZ B;  4M78 A;  5GAN 8;  1EVK A;  2EJ9 A;  4YRP A;  2RM4 A;  3MEY A;  4RCC A;  1B76 A;  4ZTU B;  4M77 E;  4XQ3 A;  4XTX A;  11AS A;  2ZCE A;  2DZ9 A;  5LJ5 f;  1WQW A;  4M78 D;  2XGT A;  4JUV A;  2VC8 A;  2E5A A;  1JRI A;  5GAN 4;  2AMC B;  4M7D B;  4CS2 A;  4C8Q E;  3HRK A;  3A32 A;  5LJ3 g;  2CIM A;  4P3P A;  2DXT A;  4PJO C;  3VQW A;  2DTO A;  4C8Q B;  4J6X A;  2K57 A;  4P73 A;  1J5W A;  2YHT A;  5GAM d;  4C92 C;  2ZTG A;  1H4Q A;  5LJ5 e;  3JCM P;  4YRS A;  4P3O A;  4M7A E;  2Q7H A;  2AKW A;  4M7A C;  1Z7N A;  1YFR A;  4N0A C;  3HXU A;  1JBM A;  2IY5 A;  2YLC A;  5GAN 6;  4PNO A;  3RAC A;  3HXY A;  3HTZ A;  2RD1 A;  3BW1 A;  1M8V A;  5GMK h;  5GMK e;  2ARS A;  4YRJ A;  1KQ1 A;  2ZT7 A;  4WJ4 A;  4YCW A;  3PGG A;  3JCM d;  4DPG A;  1YCY A;  1X56 A;  4M78 B;  1SER A;  4XEM A;  3UH0 A;  1NJ6 A;  1Y96 A;  4MMK A;  4M77 B;  4WF2 A;  2E1H A;  1WLE A;  1E22 A;  5GMK m;  4HWR A;  2E65 A;  1B34 A;  4TVY A;  1W66 A;  3SWN A;  3A7A A;  3IG2 A;  2AMC A;  3QO3 A;  3JCM X;  4YRC A;  5GAN f;  4A54 A;  12AS A;  2DJZ A;  4YRO A;  5GMK j;  1B7Y B;  4J6Y A;  1BBU A;  4M7D A;  4F7U A;  1HTT A;  4TQD A;  3TUP A;  2E10 A;  4RQF A;  1WNL A;  3EFR A;  4V2S A;  1E1O A;  5GAO l;  2EWN A;  1X54 A;  2ALY A;  3OD1 A;  4M75 G;  3JCM W;  4M7A B;  3A74 A;  1Z7M A;  3SB2 A;  3HFZ A;  4ZIB A;  5K1P A;  4C92 E;  3HXW A;  1H4S A;  1E24 A;  1G51 A;  4X9D A;  2RHS B;  4UP9 A;  2XTI A;  2AKW B;  2J3M A;  4ZTZ B;  1I81 A;  4WI1 A;  5GMK l;  3RL6 A;  3JB9 J;  2QHT A;  3WQZ A;  3HSB A;  4YCV A;  1JJC A;  4P72 A;  1JJC B;  2I4M A;  4H2X A;  4G85 A;  3A5Y A;  2ZXF A;  5GMK i;  1YGB A;  3HXX A;  2I4O A;  1C0A A;  2ZNI A;  4JLI A;  2E41 A;  4Q6G A;  4M75 A;  5GAO m;  3M4P A;  1WQ7 A;  5DY9 A;  4QVD A;  1EIY A;  5LJ3 d;  4YRN A;  4M75 E;  2E3C A;  1ATI A;  4BW9 A;  2Q5I A;  4C92 D;  1U1T A;  4F7U E;  2G4C A;  5LJ5 d;  4F7U G;  5GAM g;  4KQE A;  3RIR A;  2QHV A;  4HA8 A;  4EMG A;  4E51 A;  5GAM j;  2J3L A;  1QE0 A;  2I4N A;  4F7U B;  3REU A;  3P8V A;  4XTY A;  3L1A A;  3JCM Q;  5CAI A;  1X01 A;  2ZR2 A;  1H4T A;  1U1S A;  1FYF A;  4KR2 A;  4X9C A;  3RER A;  5GAO p;  4C8Q A;  3AHU A;  4PJO D;  1HXD A;  4P72 C;  1BIB A;  2EJF A;  3M4G A;  4CS4 A;  4M77 G;  1WU7 A;  1BIA A;  1NJ2 A;  1EFW A;  3UGT A;  4TQF A;  1H64 1;  4YRK A;  2DEQ A;  4QVC A;  2CJB A;  4EMH A;  4K88 A;  1KMN A;  4H2V A;  3QO7 A;  2RA2 A;  4G84 A;  1EVL A;  3JCM g;  4XU3 A;  4PJO B;  4M7D F;  3IAL A;  4K86 A;  4P75 C;  3PZC A;  1M5Q 1;  3VQX A;  1EOV A;  1SRY A;  1B7Y A;  3FJP A;  4M75 B;  3L2Z A;  3HY0 A;  2CJA A;  4HWP A;  3QTC A;  4XTV A;  1NJ5 A;  2ZT6 A;  5ELO A;  1ADY A;  1X55 A;  2Q5H A;  1ASY A;  3BFM A;  3MF1 A;  4L87 A;  4X5O A;  4YRM A;  1Y96 B;  3RKW A;  4M77 D;  3V8L A;  1HK9 A;  5GAN e;  2ZNJ A;  3E9I A;  1IL2 A;  4P73 C;  4HWS A;  4C8Q D;  2ARU A;  4P3N A;  2P5I A;  2QTX A;  1L0W A;  4EX5 A;  4YRG A;  2DQ0 A;  1N9S A;  4M77 F;  2Q7E A;  4M78 E;  3JCM h;  4M78 G;  1H4V B;  1LOJ A;  4M7A A;  2PME A;  4YDQ A;  1B8A A;  1VQZ A;  4J6W A;  1N9R A;  3MF2 A;  3PCO A;  1EIY B;  4C92 A;  4YRI A;  3FIF A;  4J15 A;  2ZGW A;  2YLB A;  3A7U A;  1GGM A;  4HWT A;  2IY5 B;  5GAN h;  3SWN B;  1YB3 A;  4UP7 A;  1KMM A;  5LJ3 j;  4UPA A;  4CH6 A;  4Q15 A;  4TTV A;  4CS3 A;  4OLF A;  4TVW A;  5LJ3 e;  2RHQ B;  5GAN 7;  4LNS A;  3W3S A;  4M7D G;  4M75 C;  3JB9 G;  3R07 A;  4M7D E;  3QUI A;  5K1X A;  1E1T A;  4M77 C;  5GAN 3;  4NL2 A;  4P71 A;  3QHS A;  4J5Y A;  4JRK A;  1B70 A;  3NEN A;  3GIB A;  3LSQ A;  3UFG A;  5GAN 5;  3RKY A;  3HFV A;  3VQY A;  4BWA A;  2PMF A;  3V7S A;  1D3B B;  2CJ9 A;  3VU3 C;  1NNH A;  2DVE A;  4XTZ A;  4EMK C;  1QF6 A;  5LJ3 f;  3RF1 A;  1USY A;  4YRE A;  2C8M A;  2FB7 A;  1N9W A;  3JB9 I;  4RDX A;  4XU1 A;  1LJO A;  2DDZ A;  2ZIN A;  3ERR A;  2DZC A;  3A5Z A;  4C8Q C;  4PJO F;  2ZT8 A;  2E64 A;  4DQ2 A;  4XU2 A;  5GAN g;  1TH7 A;  5E3I A;  3HFN A;  4YCU A;  1USY C;  2Q7G A;  3ICA A;  2DXU A;  1B70 B;  3RKX A;  4M7D D;  4P75 A;  2I2L A;  3QNE A;  2EAY A;  4EMK A;  2DTI A;  4N0A A;  4C92 G;  4A53 A;  1I5L A;  2FYK A;  4M77 A;  3DSQ A;  2ODR C;  5C52 B;  3LSS A;  4M7A G;  1NYR A;  1ASZ A;  1SES A;  1NJ1 A;  4CH4 A;  3REX A;  2ZIO A;  5LJ5 j;  2RHS A;  4C92 B;  1G5H A;  3JCM c;  3RES A;  3EFS A;  4P74 A;  3SWN C;  4PJO G;  4UP8 A;  4XTW A;  2DKG A;  3BJU A;  3JCM e;  3JB9 H;  3G1Z A;  4JRI A;  4M75 D;  4M7D C;  5F5W A;  1WYD A;  1D3B A;  1PYS B;  4YYE A;  4KR3 A;  1RIQ A;  2DU5 A;  4M7A F;  1ADJ A;  1HC7 A;  3HXV A;  2QHU A;  3TEH B;  2ZZF A;  4O2D A;  1EQR A;  5GAO q;  4HVC A;  3P8Y A;  1YFT A;  4C92 F;  5ELN A;  4M78 F;  4K87 A;  1YFS A;  4XTU A;  3HFO A;  3TEH A;  2I4L A;  2Y90 A;  1LNX A;  5GAM f;  5GAO r;  4C8Q F;  4P74 C;  1MGQ A;  4YRR A;  3V7R A;  4H2T A;  2ZZE A;  4PJO A;  4MML A;  3HY1 A;  1KOG A;  4Y91 A;  2DU7 A;  3I7F A;  4P71 C;  3LC0 A;  3A31 A;  2ZT5 A;  3M4Q A;  3JB9 F;  4OP0 A;  3RUX A;  1WPY A;  5I21 A;  5GAO n;  4AH6 A;  3VQV A;  3NET A;  5GAM e;  1NYQ A;  3QSU A;  1X2H A;  2ALY B;  3V7C A;  4C8Q G;  3UGQ A;  3E9H A;  3JB9 D;  4H02 A;  4HT9 A;  2ODR D;  5GAN j;  4YRT A;  1X2G A;  3JCM V;  3NEM A;  3QO8 A;  1B34 B;  1I8F A;  3JCM b;  5GAN 2;  4TVA B;  3BDU A;  4TVA A;  3QO5 A;  3P8T A;  4RCB A;  4PHC A;  5HGQ A;  3L4G B;  4H2U A;  2EL9 A;  2RHQ A;  3JCM f;  4HWO A;  4NCX A;  2JN0 A;  4YPF A;  1KQ2 A;  1G5I A;  2QHS A;  4YP0 A;  4NOY A;  3A7R A;  3BY7 A;  4H2S A;  4PJO E;  3HXZ A;  4CH3 A;  4WJ3 M;  2DTH A;  4EO4 A;  3PCO B;  2VXF A;  4YRL A;  2RB6 A;  2P0L A;  3KFU A;  4NL3 A;  1SET A;  5KNN A;  4TWA A;  3TEG A;  2EJG A;  4CH5 A;  5GAN d;  3RGL A;  3HRI A;  3FB9 A;  4XEO A;  4YRQ A;  2ART A;  4H2W A;  4RMF A;  5LJ3 h;  4H2Y A;  3JCM J;  1I4K 1;  3IKM B;  5LJ5 g;  3IKL A;  5LJ5 h;  3NEL A;  2ZIM A;  3V8J A;  2ZZG A;  5GAM h;  3V8K A;  4M78 C;  1LYL A;  3L4G A;  4M7A D;  1BBW A;  4F7U F;  2HNI A;  3INZ A;  5C53 B;  4H2X B;  4M75 F;  4XU0 A;  4EMK B;  4RQE A;  1PYS A;  3CMQ A;  2CGH A;  2ZR3 A; 
#chains in the Genus database with same CATH topology
 4YRF A;  9ATC B;  2A8E A;  4PG3 A;  1OQK A;  1RLQ C;  3VBB A;  2GQV A;  3NHN A;  4M78 A;  2JTF A;  5FWB A;  2LMJ A;  1EVK A;  4DBF A;  4YRP A;  2RM4 A;  3MEY A;  3PE0 A;  4OB2 B;  1B76 A;  4LUD A;  3VRZ A;  1PRM C;  2DNU A;  3LWI A;  1JXO A;  1N8R U;  3X25 B;  2YSQ A;  4E7I A;  11AS A;  3CCM A;  3TEE A;  5LJ5 f;  4PLI A;  2P0Q A;  3OSS C;  1VQ8 Q;  2HSP A;  2XDP A;  4M78 D;  1MMA A;  2VC8 A;  4JUV A;  4YTL A;  4CC3 A;  2YXY A;  1VQM T;  1ZLM A;  2M0Y A;  4M7D B;  4GLM A;  4BB7 A;  4C8Q E;  3SFM A;  1M3B A;  4ESR A;  3A32 A;  2V1Q A;  4LD6 A;  1JO8 A;  3EG0 A;  1H4Q A;  5CKD A;  1IHW A;  3OYJ A;  4MZM A;  4J9C A;  1Z7N A;  1G3Y A;  1T0J A;  1G3W A;  4PNO A;  2P4T A;  2DD4 A;  4OB1 B;  1TUC A;  3CCU Q;  4XK8 E;  2RD1 A;  2HL5 C;  4HXJ A;  3BW1 A;  5J26 A;  1ZUY A;  2ARS A;  3OYH A;  3PIO A;  4M4Z A;  1WJS A;  3HPW A;  1K0X A;  2M9U A;  1KQ1 A;  2ZT7 A;  4DOW A;  4QW2 A;  2BTT A;  5CIU A;  2JW4 A;  1YCY A;  2NLU A;  1SEM A;  1Z9Z A;  4XEM A;  2RF0 A;  5CK9 A;  2DA9 A;  2MI6 A;  1YWP A;  5GMK m;  4HWR A;  4TVY A;  2PVG B;  3EFO A;  4N4G A;  3JCM X;  4YRC A;  2E5K A;  4J9G A;  4JS5 A;  3CC2 T;  2RH2 A;  4YRO A;  1B7Y B;  2GNC A;  4PJN A;  4OB0 B;  4PL6 A;  1BBU A;  1QKX A;  4RQF A;  3TSZ A;  2KVQ G;  2L89 A;  1W4S A;  2HKN A;  2MMP A;  2HQX A;  3UA7 A;  2ALY A;  2LJ1 A;  1J3T A;  3VS4 A;  4ORZ A;  5K1P A;  3SHW A;  3HXW A;  1RAC B;  4FM4 B;  4UP9 A;  2D0N A;  1DJ7 B;  1D09 B;  1UG1 A;  4GBQ A;  2KT8 A;  2HL3 A;  2BZ8 A;  3PNW C;  4WI1 A;  4LVK A;  2FPF A;  1GRI A;  1V29 B;  3RL6 A;  2F69 A;  2JNG A;  1AOJ A;  3LYI A;  2QHT A;  1VQL A;  4YCV A;  2QEX A;  2C0T A;  3VS7 A;  4AG1 C;  3ER0 A;  5FU7 C;  2K5L A;  1JJC A;  2E12 A;  1JJC B;  2QI2 A;  1YIT T;  3M0T A;  2DRM A;  2OTJ Q;  2QQ9 A;  2KE9 A;  2J6F A;  1YGB A;  3EAE A;  3EG1 A;  4J9F A;  1EZZ B;  2B86 A;  2E41 A;  4Z02 A;  5GAO m;  3TCJ A;  4R56 A;  4P5N A;  5DY9 A;  2RMO A;  5FLX E;  5LJ3 d;  2EVR A;  4M75 E;  3CCS T;  4BI4 A;  4PFO A;  3OMC A;  3O5Z A;  4F7U E;  1AEY A;  2G4C A;  3HL8 A;  2DRK A;  4Z89 A;  2DL7 A;  1QVG A;  4KQE A;  3C0C A;  2ZAE A;  4FSX A;  2M16 A;  2I4N A;  1SG5 A;  3P8V A;  1XJW B;  4XTY A;  5HY6 A;  2AT1 B;  3X26 B;  3JCM Q;  2MWP A;  3ZBD A;  1Y71 A;  4X1V A;  1NPP A;  5CVI A;  1WI7 A;  2QYZ A;  3RR6 A;  3AHU A;  4P72 C;  1BIB A;  1W2B P;  1D1A A;  5CKF A;  1Q7Y U;  5I2M A;  1K8A C;  2QK0 A;  1QVF A;  4CS4 A;  3M0S A;  2BIV A;  5EC7 A;  4QVC A;  1M2V A;  4LDW A;  4FT2 A;  4RTW A;  1JXM A;  3CCQ T;  1G8X A;  2KYM A;  2OTL A;  2RA2 A;  3GLX A;  4G84 A;  2LNV A;  4M7D F;  4KUI A;  3MO8 A;  3PZC A;  4JRP A;  3A8L B;  2E70 A;  4JJC A;  4M75 B;  1QW1 A;  2VV5 A;  4J9H A;  2JJ9 A;  3QZ9 B;  1JB0 E;  2ZT6 A;  3CCR Q;  3SDZ A;  1X55 A;  1PSE A;  3BFM A;  3MF1 A;  3LW5 E;  3NMZ C;  1HK9 A;  2CUD A;  1GXI E;  3E9I A;  5FRO A;  2NUZ A;  3M58 A;  4P73 C;  4HWS A;  1M9S A;  3H0H A;  3CCL Q;  1T3L A;  1X6G A;  2DQ0 A;  4KH1 B;  3KBG A;  2F1L A;  3JCM h;  4LDV A;  1TG0 A;  4M78 G;  2KRS A;  3A1P A;  2PME A;  2R5A A;  3G71 A;  2QXF A;  3MF2 A;  2A08 A;  3PCO A;  2K9G A;  1BBZ A;  4C92 A;  4YRI A;  3A7U A;  1M1K R;  2EQJ A;  3HRT A;  2KY9 A;  3SWN B;  1YB3 A;  4UP7 A;  4UPA A;  5FRN A;  4OLF A;  4TVW A;  1UGR B;  2ROL A;  3JAM E;  3JB9 G;  2A37 A;  3CCJ T;  5K1X A;  1PC0 A;  3MEA A;  1VQ5 Q;  4PK4 A;  2EYW A;  4NL2 A;  1NEB A;  2DYB A;  1B70 A;  3LSQ A;  4BWA A;  2PMF A;  3V7S A;  2CJ9 A;  3VU3 C;  1KQS S;  1NNH A;  1ZBJ A;  3BE3 A;  1NJI R;  1USY A;  3E2U A;  2XMF A;  1AZG B;  1KD1 U;  2RHX A;  2BE9 B;  3CCS A;  1N9W A;  3JB9 I;  4RDX A;  4XU1 A;  3EH2 A;  3CBO A;  3GPL A;  1MHN A;  3X24 B;  1N8R C;  1H8K A;  1Q82 U;  2CS7 A;  4DQ2 A;  2L8D A;  2LVM A;  3L2V A;  2PTK A;  1VQ6 Q;  2ENM A;  1Q82 R;  2MWO A;  3CPW P;  3ICA A;  3CPW A;  3H8Z A;  4LNP A;  3RKX A;  4P75 A;  2DL3 A;  2R58 A;  2ZPE B;  5AT1 B;  2J6K A;  4QT7 A;  4N0A A;  1ZSZ C;  2HDA A;  4XAX B;  2FYK A;  3HTR A;  5C52 B;  3OSV A;  3LSS A;  2E6Z A;  1EFN A;  4IUP A;  2X3W D;  2RN8 A;  4FW1 A;  5KCO A;  5AYF A;  1ASZ A;  2DL4 A;  1SES A;  1NJ1 A;  4AG2 C;  2ZIO A;  4C0G A;  3VJP A;  3WVD B;  1YHQ Q;  2RHS A;  3JCM c;  3RES A;  2BKD N;  3SWN C;  3OYC A;  3M59 A;  1K73 U;  3FDR A;  3JCM e;  1WA7 A;  2DPP B;  2OAW A;  5IH2 A;  1D1B A;  3G1Z A;  4OMF B;  3UDC A;  4M7D C;  1WYD A;  3CBP A;  1W70 A;  2KEA A;  3FRN A;  4KR3 A;  1P92 A;  1UJY A;  2J06 A;  1ZX6 A;  1AWO A;  1SPK A;  2ZPH B;  1EQR A;  1O9S A;  2LQN A;  1OI1 A;  3CXC P;  2EQK A;  2ED0 A;  3M4Y A;  2I4L A;  2Y90 A;  5GAM f;  4P74 C;  2Y4X A;  7AT1 B;  2KSS A;  2P4R A;  3OYD A;  2HD0 A;  2ED1 A;  4MML A;  2P84 A;  3M0Q A;  2DU7 A;  1SF9 A;  2R57 A;  3JB9 F;  2WSE E;  2X3X D;  1M30 A;  3VQV A;  3RNJ A;  3G71 T;  1VQO T;  1VOM A;  2FZK B;  1QVF P;  4DBR A;  4C0D B;  1Q86 R;  1UGV A;  2Z0W A;  3E1S A;  3OB9 A;  1O75 A;  3PMI A;  3OYB A;  4H02 A;  4J7F A;  4YRT A;  3QJ6 A;  1X2G A;  1I8F A;  3JCM b;  1AD5 A;  2DIQ A;  4E7K A;  3U23 A;  4RCB A;  4H2U A;  4HWO A;  2LT4 A;  2F2X A;  4FYV B;  1VQM Q;  1E6G A;  1KQ2 A;  2CH4 A;  4LDX A;  2X4W A;  1NYF A;  2DIG A;  1D1C A;  4JJN K;  4PJO E;  4R0K A;  4EO4 A;  3PCO B;  1UGQ B;  2AIR B;  1KD1 C;  1FXX A;  4TVR A;  1K1Z A;  3HRI A;  3FB9 A;  4XEO A;  2ART A;  3CCE Q;  2LT1 A;  4DEY A;  4RMF A;  4H2Y A;  2KRN A;  1KD1 R;  2CKK A;  1I4K 1;  3IKM B;  5LJ5 g;  3IKL A;  3GOX A;  3V8J A;  3EFO B;  3DLM A;  1LYL A;  1VQM A;  2COW A;  1BBW A;  4JJB A;  4F7U F;  2HNI A;  1QLY A;  2RQR A;  4M75 F;  1Q7Y R;  3CMQ A;  2ZR3 A;  2IVW A;  2DXC A;  1KJW A;  1M3A A;  1ZHI A;  1NJ8 A;  5C51 B;  3OYG A;  2DL5 A;  3HFZ B;  3VS3 A;  5GAN 8;  1WGS A;  2HKQ B;  4A4H A;  1R0B G;  4RCC A;  1VQ8 A;  4ZTU B;  1HD3 A;  2D8J A;  3UF4 A;  3CCR A;  2ZCE A;  2DZ9 A;  1I5O B;  2QTV A;  1XOV A;  1JJ2 S;  1JRI A;  2RK2 A;  2QEX T;  2EYX A;  5GAN 4;  1YWO A;  1K73 C;  2AMC B;  1K0S A;  4FW2 A;  3TU4 K;  4CS2 A;  5CKH A;  5IHK A;  2K3Y A;  3HRK A;  1M90 C;  1ACM B;  5LJ3 g;  1IXD A;  4P3P A;  4PJO C;  1GL5 A;  2DTO A;  4BE1 A;  2LCL A;  2YHT A;  4OGC A;  5KYX A;  1C6V X;  1SSF A;  1Q81 U;  5LJ5 e;  4BUG A;  2Q7H A;  2AKW A;  4M7A C;  3A8G B;  2C0O A;  2JTE A;  4N0A C;  2C0I A;  1QVG P;  1SKU B;  2IY5 A;  1BCM A;  1K9M R;  1YJ9 Q;  4KGV B;  4HCC A;  3EG9 A;  3PIP A;  2DER A;  4IUV A;  1VQO A;  2CRE A;  1VQK T;  2VGN A;  4RTU A;  1M27 C;  4YCW A;  1WYX A;  2VUB A;  3CXC A;  1X56 A;  4M78 B;  1UHF A;  1SER A;  1NJ6 A;  3HRU A;  4M77 B;  2G6F X;  2E65 A;  1B34 A;  1W66 A;  1MMG A;  5A0L A;  1PSF A;  2FPD A;  1AT1 B;  4L6V 5;  3FJ5 A;  2EFI A;  2XK0 A;  1WHJ A;  2KR3 A;  4QVZ A;  3S3N A;  2DEU A;  2JS2 A;  1N6A A;  2CZ7 B;  3G6E A;  1Q82 C;  2DX1 A;  1VQ6 A;  3SEM A;  2RJC A;  1QQJ A;  1VUB A;  1WHG A;  3OD1 A;  2KBT A;  4M75 G;  4RTT A;  4ZIB A;  1H4S A;  1E24 A;  2FL7 A;  3EHQ A;  3R6N A;  2MIO A;  5GJV B;  1N5Z A;  3VS1 A;  4IIO A;  1WJR A;  2J3M A;  4ZTZ B;  2D9T A;  2DK3 A;  5GMK l;  1YN8 A;  4FYX B;  3A8O B;  2RQT A;  2MCN A;  3HSB A;  3OYF A;  5KYW B;  3GP8 A;  1RAE B;  1YHQ A;  2IIM A;  3CD6 T;  2ZXF A;  3HXX A;  5CKB A;  2I4O A;  3P8B B;  2AK5 A;  2ZNI A;  4JLI A;  4M75 A;  4QVD A;  2KQW A;  1EIY A;  1IO6 A;  1WZO A;  4YRN A;  1M1K C;  1PRL C;  4L59 A;  1MND A;  5GAM g;  4F04 B;  1H3Z A;  2MK5 A;  1NYG A;  4E51 A;  3P8H A;  2D8H A;  2VYT A;  2J3L A;  1QE0 A;  3GF5 A;  4F7U B;  3REU A;  2XDD A;  3O8V A;  3CCE T;  2RQW A;  3URG A;  1VYV A;  5CAI A;  1E6H A;  1U1S A;  1FYF A;  4RTV A;  1JEG A;  3UT1 A;  5GAO p;  3CC7 T;  1ARK A;  2FPE A;  4OMQ A;  3C4S A;  3M4G A;  2LX9 A;  1WU7 A;  1BIA A;  1RAF B;  1QWF A;  4PJJ A;  2E4H A;  1WHK A;  2NUP A;  3CME T;  2QA4 T;  2QAS A;  5KYY B;  1VQ5 A;  1ZSG A;  4EMH A;  2E3I A;  1NLO C;  2E6N A;  1KMN A;  4OGE A;  1VQ9 A;  5IHN A;  2F5T X;  4XU3 A;  2PVD B;  4HCB A;  3H9N A;  3OYA A;  4K86 A;  4P75 C;  3MET A;  1M5Q 1;  3VQX A;  3QWY A;  3QPH A;  3H0I A;  3HY0 A;  2WAC A;  2JUF A;  3LLR A;  1T0H A;  4L87 A;  4YRM A;  3CCV T;  1ZA1 B;  2AHJ B;  1Y96 B;  4HCZ A;  4B9W A;  4M77 D;  4KT0 E;  3G4S T;  3CCJ A;  4CC4 B;  1IL2 A;  4OMO A;  1VQ4 A;  2DFU A;  1D0X A;  6AT1 B;  3L2R A;  2ARU A;  1YI2 A;  1K9M C;  4P3N A;  2P5I A;  5IN1 A;  2D0Q B;  1N9S A;  1NE8 A;  1UB4 A;  1H4V B;  3HRS A;  2KDS A;  4YDQ A;  1B8A A;  2GFA A;  4J6W A;  1RAB B;  4KRT A;  4FT4 A;  5KYN A;  1XTD A;  4LE9 A;  2JMC A;  2ZGW A;  3WVE B;  2IY5 B;  5GAN h;  3GBQ A;  4AT1 B;  1OPK A;  1KMM A;  1QWE A;  2M51 A;  4IUR A;  4CS3 A;  3PTA A;  2RHQ B;  4Y92 A;  5GAN 7;  1VQ4 Q;  4M75 C;  3R07 A;  3QUI A;  4KGZ B;  2K3B A;  4M77 C;  5GAN 3;  1YI2 Q;  5KYU A;  2RHI A;  1UE9 A;  3M53 A;  3GIB A;  1VQ9 T;  1S72 T;  3OYY A;  2V8I A;  3MP1 A;  1K9A A;  1M4Z A;  3RMS A;  3ULR B;  3EG9 B;  4AFQ C;  4XTZ A;  3EGX A;  1M90 R;  1AWW A;  2JT4 A;  3EGX B;  2A0F B;  3MJX A;  1WX6 A;  1AWX A;  1WXU A;  3ERR A;  2L3R A;  3A5Z A;  3M56 A;  5CQX A;  4OMN A;  2IPO B;  3GNF B;  3OYM A;  2E64 A;  1PD1 A;  3VYH B;  4DBQ A;  4XU2 A;  2K6D A;  5E3I A;  1ABO A;  1NZ9 A;  2PZ1 A;  3CCE A;  2RPN A;  3C95 A;  1U06 A;  1VQL T;  3JSC A;  4BE2 A;  4C5I A;  3J7A F;  2A28 A;  1ZA2 B;  1QKW A;  3QNE A;  2HZY A;  2DTI A;  3DSQ A;  2DET A;  1W1F A;  2FG0 A;  4F16 A;  1BI0 A;  4M7A G;  3EH1 A;  1X27 A;  2QA4 A;  3REX A;  2RHZ A;  3HHT B;  1GBQ A;  2CH4 W;  2K4Y A;  1R77 A;  2YUP A;  3E19 A;  4PJO G;  5A0D A;  2DKG A;  2G3R A;  3BJU A;  3E9G A;  1SHG A;  4ZN1 A;  1IB8 A;  1RIQ A;  1HC7 A;  3HXV A;  3MQZ A;  3MP8 A;  1OZ2 A;  3TEH B;  5D6X A;  2EGE A;  3VUB A;  2EGA A;  4C92 F;  1PG5 B;  4E7S A;  4K87 A;  1YFS A;  3M57 A;  3TEH A;  4LVI A;  1LNX A;  2V8K A;  1UGS B;  3NTH A;  4LN2 A;  4J8O A;  5IAY A;  3UAT A;  3OYK A;  1KOG A;  3VS5 A;  3I7F A;  1N27 A;  2ZT5 A;  4IUU A;  3MCA B;  1RL2 A;  5I21 A;  4AH6 A;  4LD9 K;  3NET A;  1FMK A;  3JRZ A;  1RI9 A;  1BI1 A;  3QSU A;  1QCF A;  5EG2 A;  1TUG B;  2ALY B;  3V7C A;  2DBK A;  4B6M A;  3E9H A;  3H41 A;  2NS6 A;  3I35 A;  4KH0 B;  2DAQ A;  1RAH B;  2KXD A;  4TVA B;  3BDU A;  1WXT A;  1RAG B;  1FMW A;  3EGD A;  4J7I A;  1SRM A;  3L4G B;  3CCM T;  1G5I A;  1IZ6 A;  4YP0 A;  2FVU A;  4X34 A;  4NOY A;  3LGF A;  2COZ A;  2SRC A;  1OZ3 A;  4CH3 A;  1BYM A;  4WJ3 M;  2DTH A;  1OU9 A;  1RLP C;  3KXT A;  1VQK A;  2RK1 A;  1MNE A;  3A8H B;  1E7O A;  3M0P A;  1PKT A;  2RB6 A;  1UDL A;  3KFU A;  4NL3 A;  1SET A;  2FHD A;  5KNN A;  4VUB A;  3TEG A;  2EJG A;  3I55 Q;  4J83 A;  3RGL A;  4JJD A;  1C1A A;  2E5Q A;  5LJ3 h;  3OS2 A;  4BY6 B;  2NUP B;  4J9I A;  1GCQ A;  5IXB A;  2ZZG A;  3OQ5 A;  3NPF A;  5GAM h;  3RMQ A;  3EGD B;  4M78 C;  2RI3 A;  3L4G A;  4C0D C;  1UHC A;  1NBE B;  3OS0 A;  4H2X B;  1WDX A;  1N8R R;  4BI8 B;  3QXE B;  3QII A;  5KYU B;  4J9D A;  2CGH A;  1TWB A;  1UEB A;  3QDR B;  2VXE A;  2DQ3 A;  4JLG A;  3L2U A;  1Y7X A;  2EKH A;  3RDV A;  2C7I A;  2RHY A;  4HT8 A;  1NG2 A;  1GFC A;  2XIC A;  4Q5W A;  4BY6 C;  2V1R A;  3A5Z B;  2L3Q A;  2EJ9 A;  2QG9 B;  3H0F A;  1PM3 A;  4BDZ A;  4M77 E;  2E3H A;  1D0Y A;  2JXB A;  4FSS A;  2XGT A;  4FYW B;  2KRO A;  2O01 E;  3VRY A;  2GTO A;  1RAD B;  3REB B;  2CP2 A;  4E7J A;  1LPL A;  4JDS A;  2NUT A;  2DVJ A;  2NUT B;  3VQW A;  1R0C B;  2A3L A;  1YNZ A;  2PUO B;  4C8Q B;  2K57 A;  4P73 A;  5D7U A;  1J5W A;  3I56 T;  4AFS C;  2DXB A;  4MZP A;  3JCM P;  4D6W A;  4YRS A;  2YRD A;  2RJF A;  4JRQ A;  2LC4 A;  5GJW B;  3F70 A;  3HXU A;  2MYS A;  3I5S A;  1UGP B;  5GAN 6;  1VIE A;  2CDT A;  3RAC A;  2L3S A;  4J9B A;  3CEY A;  3HTZ A;  2HBW A;  1YJN A;  5GMK e;  2ECZ A;  4QQG A;  4YRJ A;  3M0R A;  5J39 A;  4HVW A;  3PGG A;  3JCM d;  1PHT A;  3PT9 A;  3G71 Q;  5HK0 A;  1QVP A;  1PNJ A;  1Y96 A;  4MMK A;  4WF2 A;  4KBM B;  1KQS P;  2E1H A;  2OTL Q;  4AMC A;  2W0Z A;  2A7Y A;  1M1F A;  3SWN A;  4A63 B;  3BDL A;  4GY5 A;  2AMC A;  3IG2 A;  12AS A;  1D0Z A;  2O9S A;  2DL8 A;  5GMK j;  4L5G A;  5CO7 A;  4F7U A;  2YUN A;  1WNL A;  1NPR A;  1QP3 A;  1X69 A;  5GAO l;  2EWN A;  1FYN A;  2J6O A;  2VGM A;  2YWW A;  5IHI A;  3QYH B;  5A2Q E;  3JCM W;  3A74 A;  1VQ7 Q;  3HFZ A;  4ELY C;  2BE7 D;  4C92 E;  1YIT Q;  1YJW A;  2RHS B;  2XI9 A;  4CI0 C;  5CR2 A;  2ZCF B;  2XTI A;  4LUE A;  2AKW B;  4LDY A;  3MPU B;  1PWT A;  4WTO B;  3LWH A;  1MUZ A;  2VB6 A;  4H2X A;  2FEI A;  2OTL T;  2NYS A;  4PFZ A;  3OY9 A;  1WHM A;  5KE3 A;  1WQ7 A;  2GCX A;  2ZPG B;  4PLL A;  2DE0 X;  1TXQ A;  3M0U A;  4BW9 A;  2YUO A;  1K9M U;  4C92 D;  1U1T A;  2GGR A;  5LJ5 d;  3G4S Q;  2LQW A;  4PJM A;  2QHV A;  4N4I A;  3L42 A;  3NTI A;  5GAM j;  3PFS A;  5C0M A;  3L1A A;  4LVL A;  1X01 A;  1U8R A;  5FW9 A;  1H4T A;  1IGQ A;  4X9C A;  3RER A;  2CZ0 B;  5HKC A;  1G83 A;  5FU6 B;  2XD0 A;  3I56 A;  1F1B B;  1SRL A;  4M77 G;  1TUD A;  3Q1J A;  2B8A A;  4FIB A;  2FRY A;  1WFW A;  2OAU A;  2DIL A;  3NFC A;  4ATO A;  2GFU A;  4MDX A;  1KFZ A;  1SSH A;  1Q81 R;  4TQF A;  3UGT A;  3G4S A;  2DEQ A;  2V8J A;  5KCH A;  2CJB A;  2K79 A;  1VQ4 T;  5CQY A;  2OX7 A;  2X35 A;  3CBM A;  2DMO A;  1X6O A;  4LVJ A;  3CPW S;  2XHC A;  1TSF A;  2WSC E;  4D8K A;  2CP6 A;  2VVK A;  2M02 A;  4FL6 A;  1VQ7 T;  3IAL A;  3CMA A;  1VQP A;  1PCX A;  1QCN A;  1EOV A;  2LNH B;  2NWM A;  3ME9 A;  3L2Z A;  1ZUK A;  4HWP A;  4EPC A;  3UPU A;  2PUK B;  5D6W A;  4XTV A;  4QKU A;  5ELO A;  3T9N A;  4OMP A;  5DM7 R;  4ZTJ A;  5GAN e;  2ZNJ A;  1ZSZ B;  4FYY B;  3CCU A;  4C8Q D;  3CCV Q;  1S72 A;  2HSE B;  2OTJ T;  2LZ6 B;  2CYZ B;  2QTX A;  4M77 F;  4M78 E;  3HP9 A;  1X43 A;  3N5B B;  2C06 A;  1LOJ A;  4M7A A;  1FMV A;  2QDL A;  1VA7 A;  4FU6 A;  1VQZ A;  2COY A;  2OJ2 A;  1VYU A;  2QAZ A;  1EIY B;  2QA4 Q;  4CC2 A;  1KC8 R;  3FIF A;  4J15 A;  3QWX X;  3LH5 A;  5CCA A;  4HWT A;  4O6J A;  2XDB A;  4JPB W;  4C0Z A;  5LJ3 j;  4Q15 A;  2KYB A;  4KGX B;  4TTV A;  2XID A;  4KUL A;  5LJ3 e;  4D8D A;  1BKB A;  1I0C A;  1E1T A;  1TU0 B;  4P71 A;  2RQU A;  1Q86 C;  4J5Y A;  4JRK A;  3NEN A;  3OS5 A;  2QGF B;  3RKY A;  3HFV A;  3VQY A;  2O4X B;  1OYX A;  1QVF S;  5LJ3 f;  5IXF A;  1VQO Q;  2C8M A;  2CSQ A;  4IUT A;  2FB7 A;  5CKE A;  2J05 A;  3M5A A;  4OF1 A;  2QQR A;  2DDZ A;  2ZIN A;  1K73 R;  4RMO A;  3CC4 Q;  4RTZ A;  2JTM A;  3L2W A;  1BI3 A;  2ZT8 A;  1U3O A;  1LVK A;  5GAN g;  4A4E A;  1TH7 A;  3PVL A;  3M55 A;  3HFN A;  2IG0 A;  2CZ6 B;  2Q7G A;  1QMC A;  2EW3 A;  1WJQ A;  1B70 B;  4M7D D;  2YRC A;  2EAY A;  4EMK A;  1UEC A;  2RO0 A;  4C0F A;  1I5L A;  4M77 A;  2ODR C;  1AZE A;  2PQW A;  2AKL A;  1NYR A;  1Q7Y C;  1BK2 A;  3CC4 A;  2GF7 A;  1KSW A;  2JM8 A;  1AWJ A;  2SEM A;  4BDY A;  3A98 A;  4P74 A;  1EFW A;  2JVV A;  3UA6 A;  1M3C A;  4UP8 A;  4XTW A;  1ZBX A;  3ZEH A;  2JMA A;  1WXB A;  2D1X A;  1OUL A;  5FWC A;  3JB9 H;  3G6E T;  4JRI A;  4M75 D;  5F5W A;  2EYZ A;  1D3B A;  3QBY A;  1QVG S;  3MEW A;  2DU5 A;  1CSK A;  2DYI A;  2ZPF B;  5I22 A;  5I2S A;  1M2O A;  1EIF A;  2ZZF A;  4O2D A;  5GAO q;  3ZFJ A;  4IIM A;  3P8Y A;  2H3J A;  1YFT A;  2RQV A;  5ELN A;  2P0K A;  2K3X A;  4M78 F;  3HFO A;  2RHU A;  2JZ2 A;  3LGL A;  2W10 A;  4C8Q F;  2Y4Y A;  1MGQ A;  4YRR A;  1A0N B;  4H2T A;  1VIF A;  1WHH A;  2OTJ A;  1GFD A;  3HY1 A;  3KFV A;  3CD6 A;  1GBR A;  3LC0 A;  2GTJ A;  3M4Q A;  4OP0 A;  1NJI C;  3RUX A;  1WPY A;  1TS9 A;  5GAO n;  3CQT A;  5GAM e;  2QQS A;  3FEO A;  1HYO A;  1X2H A;  4E7H A;  1T3S A;  4C8Q G;  2BZY A;  2FZC B;  4HT9 A;  5GAN j;  3MHX A;  3QO8 A;  4FCY A;  1K76 A;  2WSF E;  5GAN 2;  4PFP A;  4HVU A;  3CMA T;  5HGQ A;  3H6Z A;  2RHQ A;  4NCX A;  3JCM f;  1H3H A;  3VUZ A;  2JN0 A;  4YPF A;  3M54 A;  1U5S A;  1YI2 T;  3A7R A;  3BY7 A;  3SD4 A;  1G2B A;  2HQH A;  4H2S A;  3HXZ A;  3TQ7 P;  1BU1 A;  5FRM A;  3C94 A;  3S6W A;  2P0L A;  5DLQ E;  1UUE A;  4J9E A;  3CME A;  3ASK A;  4E7L A;  4IKF A;  1VQ5 T;  1NEG A;  4YRQ A;  5J3B A;  1YFN A;  3JCM J;  1IGU A;  1JJ2 A;  5LJ5 h;  2K5I A;  1YJN Q;  1H92 A;  5FU6 C;  3VV0 A;  2A36 A;  3QYG B;  1GCP A;  3QZ5 B;  3VKI A;  3INZ A;  5C53 B;  2EKO A;  5IT9 E;  4CC7 A;  4RQE A;  1PKS A;  1PYS A;  2D6F A;  2CZ1 B;  3OYN A;  4LDU A;  3CCS Q;  4Y28 E;  1C0M A;  1X2K A;  2I0N A;  4ANJ A;  1FX7 A;  3DB4 A;  1JQQ A;  2X4Y A;  3CCQ A;  3UWN A;  3OYL A;  3VS6 A;  3FC3 A;  4XQ3 A;  4XTX A;  3GNG A;  4RUG A;  2O31 A;  2BUD A;  4PJL A;  1WQW A;  8AT1 B;  1NLP C;  2E5A A;  1VQ9 Q;  2QGG A;  1K8A R;  1WLP B;  3CCM Q;  2LJ0 A;  1G3S A;  4O5V A;  1XQH A;  1W2B S;  1R8O B;  1YP5 A;  2DLP A;  2MPX C;  2VWF A;  2CIM A;  1QP2 A;  2DXT A;  1S72 Q;  4KUD K;  1KC8 C;  4J6X A;  3S3M A;  4WCI A;  2F5K A;  1M8M A;  5GAM d;  4C92 C;  2ZTG A;  3HKS A;  2F2V A;  4NS5 A;  4P3O A;  4M7A E;  3CCQ Q;  3J81 E;  1OPL A;  2CP0 A;  1YFR A;  2LJ3 A;  1JBM A;  2YLC A;  2KI7 A;  1X75 C;  4C5E A;  4ZGE B;  3HXY A;  2LTO A;  2ZPI B;  2YRV A;  3J80 E;  1M8V A;  5GMK h;  2CUB A;  4WJ4 A;  1X2Q A;  1NM7 A;  2BZX A;  4DPG A;  3OMG A;  1CKA A;  3FLG A;  4F14 A;  1PD0 A;  2O4X A;  1W2B A;  3UH0 A;  3CC4 T;  2VKN A;  2RNA A;  1M2V B;  3X20 B;  2ZPB B;  3I9Q A;  1WLE A;  3D7S B;  1E22 A;  3REA B;  3CCR T;  2DJQ A;  1TOV A;  3THK A;  3OW2 A;  3A7A A;  3QO3 A;  1TTH B;  4E6R A;  5GAN f;  4A54 A;  2DJZ A;  5I11 A;  1B07 A;  1MV0 B;  1OV3 A;  4J6Y A;  2KMT A;  5DLO A;  1IRX A;  4M7D A;  1HTT A;  4TQD A;  3TUP A;  2XU8 A;  2E10 A;  1SHF A;  2K7A A;  1VQ7 A;  3EFR A;  2RI5 A;  4V2S A;  4E2F B;  1E1O A;  4RTY A;  3CXC S;  1VQN T;  1VQP T;  4C5G A;  2KNB B;  1X54 A;  2EQI A;  4M7A B;  1Z7M A;  3SB2 A;  2RJD A;  2AZS A;  2KRM A;  2EYY A;  1G51 A;  4X9D A;  3VYG A;  2PVO B;  1JU5 C;  3EG2 A;  2LDM A;  3C12 A;  4II1 A;  3G1J A;  1BB9 A;  2X9H A;  4BI3 A;  4F17 A;  1I81 A;  2FZG B;  4ZN3 A;  4LVM A;  2PU9 B;  1UTI A;  1ZSZ A;  3E9F A;  3EGU A;  3JB9 J;  2YT6 A;  1MMD A;  3WQZ A;  2K2M A;  1KIK A;  4P72 A;  2KXC A;  2I4M A;  4G85 A;  1Y57 A;  3A5Y A;  1V76 A;  4RKU E;  5D6Y A;  1WIE A;  5GMK i;  1FWZ A;  2O2O A;  1C0A A;  3I5R A;  2L5Q A;  4Q6G A;  1CKB A;  2KAF A;  1M1G A;  2DF6 A;  2HBP A;  1Z9Q A;  3LH0 A;  4RG8 A;  3M4P A;  1S1N A;  3CPF A;  2EGC A;  2E3C A;  3OYE A;  1ATI A;  3CC2 Q;  3OS1 A;  2Q5I A;  4ELZ C;  2JM9 A;  4F7U G;  3RIR A;  4C5H A;  3CCV A;  2P0P A;  4HA8 A;  4EMG A;  4DOV A;  5L23 A;  2JS0 A;  3NGP A;  3CCL T;  3A8M B;  1VQ6 T;  1Y07 A;  2ZR2 A;  1HJD A;  4KR2 A;  2VAS A;  3X28 B;  4C8Q A;  2LP5 A;  2K5F A;  1K8A U;  1YJ9 A;  4PJO D;  1HXD A;  3CD6 Q;  3R6O A;  1VQN A;  2EJF A;  2M0O A;  4OML A;  1NJI U;  1NJ2 A;  2GQI A;  1JJ2 P;  5L8R E;  1ZUU A;  3QKJ A;  2MF2 A;  1H64 1;  4YRK A;  1VYT A;  3MEV A;  3I55 A;  2EQU A;  3ZL7 C;  1YCS B;  4K88 A;  3DB3 A;  1VQP Q;  4GLK A;  1G3T A;  2ATC B;  1YHQ T;  2O88 A;  3QO7 A;  1KG1 A;  4H2V A;  1EVL A;  4LXC A;  3JCM g;  3KUF A;  4PJO B;  2LCS A;  2QEX Q;  1W6X A;  3CC7 Q;  1B7Y A;  1SRY A;  2RI2 A;  3FJP A;  1V1C A;  2DO3 A;  2CJA A;  2O9V A;  1G5V A;  3QTC A;  5KYX B;  1KC8 U;  1NJ5 A;  5ECA A;  5LL6 S;  1ASY A;  1ADY A;  2Q5H A;  1Q81 C;  1XNI A;  2GBQ A;  4X5O A;  1AHJ B;  3RKW A;  3V8L A;  1OU8 A;  2K2V A;  8ATC B;  2F2W A;  2H3E B;  2CP7 A;  4MZT A;  2FRW A;  3VS2 A;  1KK7 A;  4JZ3 A;  1WHL A;  1L0W A;  2RJE A;  4EX5 A;  1B3Q A;  4YRG A;  3CC7 A;  2ESW A;  2LRQ A;  2Q7E A;  1OOT A;  2FO0 A;  1UFF A;  2CT4 A;  3EG3 A;  1OEB A;  1N9R A;  3OYI A;  3DKM A;  4DA4 A;  2L0A A;  3LX7 A;  4A4F A;  2YLB A;  1RI0 A;  1GGM A;  1ABQ A;  2L3P A;  4CH6 A;  4HKE A;  2DM1 A;  4BE0 A;  3OBW A;  1ZQ1 A;  2YDL A;  3WXM B;  1M90 U;  4LNS A;  3W3S A;  2L2P A;  2MAM A;  4M7D G;  5KYW A;  4M7D E;  3AT1 B;  3PVQ A;  3P8D A;  3PMT A;  3QHS A;  4E47 A;  3UFG A;  5GAN 5;  4B9X A;  2OI3 A;  2HMA A;  1D3B B;  4BD3 A;  2AZV A;  4JS4 A;  2DVE A;  1AVZ C;  2HQE A;  1IHV A;  4EMK C;  4K11 A;  1QF6 A;  3RF1 A;  4YRE A;  4CRI A;  3TRE A;  2JOY A;  1YIJ A;  1VQ8 T;  1YJW T;  1LJO A;  2DZC A;  3QDF A;  3MEU A;  4C8Q C;  4PJO F;  4Z8A A;  2KK4 A;  2EPD A;  1VQK Q;  2KGT A;  4YCU A;  1USY C;  4EDU A;  2DXU A;  1YBY A;  2HCK A;  2X4X A;  1Y0M A;  2I2L A;  2LX7 A;  4C92 G;  4ZTF A;  4A53 A;  2LQK A;  2V26 A;  1QCO A;  1YIJ Q;  1VQL Q;  1Q86 U;  3I55 T;  4CH4 A;  2X4J A;  5LJ5 j;  2ABL A;  4C92 B;  2HEQ A;  1G5H A;  1KHI A;  3EFS A;  1UJ0 A;  4EIK A;  4DEX A;  1RAA B;  5KYY A;  2CT3 A;  2QQA A;  4R55 A;  3G6E Q;  2EIF A;  4ZGD B;  2QQB A;  1PYS B;  4YYE A;  2X51 A;  4M7A F;  1ADJ A;  2QHU A;  5C6S A;  3CME Q;  1KQS A;  5KH6 A;  4HVC A;  4ME7 A;  4A4K A;  4ZGJ B;  1LCK A;  1Q95 G;  2R5M A;  4JZ4 A;  4XTU A;  2PNI A;  1YIJ T;  3TSW A;  2XKO C;  2EBP A;  3QG1 A;  4MDW A;  3JV3 A;  5GAO r;  1X6B A;  2KT1 A;  3CCL A;  2ZZD A;  1MMN A;  4A4G A;  1HSQ A;  2H8H A;  3V7R A;  3IQL A;  2ZZE A;  1OX9 A;  3TVT A;  4PJO A;  4PKC C;  4Z88 A;  4RTX A;  2AKK A;  2DD5 A;  4Y91 A;  4P71 C;  2XG8 D;  3A31 A;  2CSI A;  1K4U S;  1I07 A;  1BCO A;  4HT4 A;  1YJ9 T;  1M1K U;  3L2Q A;  1KHC A;  2QDY B;  1GCQ C;  3MKD A;  5KE2 A;  1NYQ A;  4IUQ A;  2YUQ A;  1RAI B;  2EYQ A;  4QQ6 A;  3UGQ A;  3JB9 D;  1BI2 A;  5FU7 B;  3M9Q A;  1YJW Q;  3I56 Q;  2EQM A;  5M9O A;  3DLL A;  2ODR D;  5HK3 A;  4OVA A;  4BAC A;  3CCJ Q;  3JCM V;  4RG2 A;  3NEM A;  1B34 B;  2ROT A;  4TVA A;  3QO5 A;  2MOX A;  3P8T A;  4PHC A;  2EL9 A;  3CC2 A;  3CCU T;  2QHS A;  1B7T A;  2CP3 A;  4QQD A;  3RBB B;  3QJY A;  2CP5 A;  3OW2 S;  2HAX A;  1OX8 A;  3CMA Q;  4HVV A;  4N4H A;  1MV3 A;  2LQ8 A;  3OBY A;  4OB3 B;  2VXF A;  4YRL A;  3G7Z A;  4TWA A;  4CH5 A;  5GAN d;  1IRE B;  3MP6 A;  4AFU C;  4H2W A;  2M1H A;  2DBM A;  3OA6 A;  1VQN Q;  3VS0 A;  3OW2 P;  2ZIM A;  3NEL A;  3NTK A;  4AFZ C;  3V8K A;  1EX4 A;  4ZNX A;  5HCK A;  4M7A D;  3S3O A;  4DBH A;  1I1J A;  3EHR A;  2LCC A;  1YIT A;  5A0G A;  4UC4 A;  4XU0 A;  4EMK B;  4OMM A;  1YJN T;  4HCK A;  1RUW A;  4E7Z A;  2J7I A; 
#chains in the Genus database with same CATH homology
 4YRF A;  2A8E A;  4PG3 A;  3VBB A;  2GQV A;  4M78 A;  2JTF A;  1EVK A;  4YRP A;  2RM4 A;  3MEY A;  4OB2 B;  1B76 A;  3LWI A;  1N8R U;  3X25 B;  4E7I A;  11AS A;  3CCM A;  3TEE A;  5LJ5 f;  4PLI A;  2P0Q A;  3OSS C;  2XDP A;  4M78 D;  4JUV A;  2VC8 A;  4YTL A;  1VQM T;  4M7D B;  4BB7 A;  4C8Q E;  3SFM A;  3A32 A;  4LD6 A;  1H4Q A;  5CKD A;  3OYJ A;  4MZM A;  1Z7N A;  1G3Y A;  1G3W A;  4PNO A;  2P4T A;  2DD4 A;  4OB1 B;  4XK8 E;  2RD1 A;  3BW1 A;  5J26 A;  2ARS A;  3OYH A;  3PIO A;  1WJS A;  3HPW A;  2M9U A;  1KQ1 A;  2ZT7 A;  4DOW A;  4QW2 A;  5CIU A;  1YCY A;  2NLU A;  4XEM A;  5CK9 A;  2MI6 A;  5GMK m;  4HWR A;  4TVY A;  2PVG B;  4N4G A;  3JCM X;  4YRC A;  4JS5 A;  3CC2 T;  2RH2 A;  4YRO A;  1B7Y B;  4OB0 B;  1BBU A;  4PL6 A;  4RQF A;  2KVQ G;  2L89 A;  1W4S A;  2MMP A;  2HQX A;  2ALY A;  5K1P A;  3HXW A;  4FM4 B;  4UP9 A;  1DJ7 B;  3PNW C;  4WI1 A;  4LVK A;  1V29 B;  3RL6 A;  2F69 A;  2JNG A;  3LYI A;  2QHT A;  1VQL A;  4YCV A;  2QEX A;  3ER0 A;  5FU7 C;  2K5L A;  1JJC A;  2E12 A;  1JJC B;  2QI2 A;  1YIT T;  2QQ9 A;  1YGB A;  3EAE A;  2E41 A;  4Z02 A;  5GAO m;  3TCJ A;  4R56 A;  4P5N A;  5DY9 A;  5FLX E;  5LJ3 d;  4M75 E;  3CCS T;  4BI4 A;  3OMC A;  4F7U E;  2G4C A;  3HL8 A;  4KQE A;  1QVG A;  4FSX A;  2M16 A;  2I4N A;  3P8V A;  5HY6 A;  4XTY A;  3X26 B;  3JCM Q;  2MWP A;  3ZBD A;  1Y71 A;  1NPP A;  5CVI A;  3AHU A;  4P72 C;  1BIB A;  5CKF A;  1Q7Y U;  5I2M A;  1K8A C;  1QVF A;  4CS4 A;  2BIV A;  4QVC A;  4LDW A;  4FT2 A;  3CCQ T;  2OTL A;  2RA2 A;  3GLX A;  4G84 A;  2LNV A;  4M7D F;  4KUI A;  3MO8 A;  3PZC A;  4JRP A;  3A8L B;  2E70 A;  4M75 B;  1QW1 A;  2VV5 A;  3QZ9 B;  1JB0 E;  2ZT6 A;  3SDZ A;  1X55 A;  1PSE A;  3BFM A;  3MF1 A;  3LW5 E;  1HK9 A;  1GXI E;  3E9I A;  5FRO A;  3M58 A;  4P73 C;  4HWS A;  1M9S A;  2DQ0 A;  3KBG A;  3JCM h;  4LDV A;  4M78 G;  2PME A;  2R5A A;  3G71 A;  2QXF A;  3MF2 A;  3PCO A;  4C92 A;  4YRI A;  3A7U A;  2EQJ A;  3HRT A;  2KY9 A;  3SWN B;  1YB3 A;  4UP7 A;  4UPA A;  5FRN A;  4OLF A;  4TVW A;  1UGR B;  3JAM E;  3JB9 G;  3CCJ T;  5K1X A;  3MEA A;  4NL2 A;  1B70 A;  3LSQ A;  4BWA A;  2PMF A;  3V7S A;  2CJ9 A;  3VU3 C;  1KQS S;  1NNH A;  1USY A;  1KD1 U;  2RHX A;  3CCS A;  1N9W A;  3JB9 I;  4RDX A;  4XU1 A;  3GPL A;  3CBO A;  1MHN A;  3X24 B;  1N8R C;  1Q82 U;  2CS7 A;  4DQ2 A;  2L8D A;  2LVM A;  3L2V A;  2MWO A;  3ICA A;  3CPW A;  3H8Z A;  3RKX A;  4P75 A;  2R58 A;  2ZPE B;  4N0A A;  4XAX B;  2FYK A;  5C52 B;  3OSV A;  3LSS A;  2E6Z A;  4IUP A;  5KCO A;  5AYF A;  1ASZ A;  1SES A;  1NJ1 A;  2ZIO A;  4C0G A;  3VJP A;  3WVD B;  2RHS A;  3JCM c;  3RES A;  2BKD N;  3SWN C;  3OYC A;  3M59 A;  1K73 U;  3FDR A;  3JCM e;  2DPP B;  3G1Z A;  4OMF B;  3UDC A;  4M7D C;  1WYD A;  3CBP A;  3FRN A;  4KR3 A;  1P92 A;  2ZPH B;  1EQR A;  1O9S A;  1OI1 A;  2EQK A;  3M4Y A;  2I4L A;  2Y90 A;  5GAM f;  4P74 C;  2Y4X A;  2KSS A;  3OYD A;  2HD0 A;  4MML A;  2DU7 A;  2R57 A;  3JB9 F;  2WSE E;  3VQV A;  3G71 T;  1VQO T;  4C0D B;  3E1S A;  3OB9 A;  1O75 A;  3PMI A;  3OYB A;  4H02 A;  4J7F A;  4YRT A;  3QJ6 A;  1X2G A;  1I8F A;  3JCM b;  2DIQ A;  4E7K A;  4RCB A;  4H2U A;  4HWO A;  2LT4 A;  1KQ2 A;  4LDX A;  2X4W A;  2DIG A;  4JJN K;  4PJO E;  4EO4 A;  3PCO B;  1UGQ B;  1KD1 C;  1FXX A;  4TVR A;  3HRI A;  3FB9 A;  4XEO A;  2ART A;  2LT1 A;  4RMF A;  4H2Y A;  2CKK A;  1I4K 1;  3IKM B;  5LJ5 g;  3IKL A;  3GOX A;  3V8J A;  3DLM A;  1LYL A;  1VQM A;  1BBW A;  4F7U F;  2HNI A;  4M75 F;  3CMQ A;  2ZR3 A;  2IVW A;  2DXC A;  5C51 B;  1NJ8 A;  1ZHI A;  3OYG A;  3HFZ B;  5GAN 8;  1WGS A;  4A4H A;  4RCC A;  1VQ8 A;  4ZTU B;  3CCR A;  2ZCE A;  2DZ9 A;  1XOV A;  1JJ2 S;  1JRI A;  2RK2 A;  2QEX T;  5GAN 4;  1K73 C;  2AMC B;  3TU4 K;  4CS2 A;  5CKH A;  2K3Y A;  3HRK A;  1M90 C;  5LJ3 g;  4P3P A;  4PJO C;  2DTO A;  4BE1 A;  2LCL A;  2YHT A;  4OGC A;  1SSF A;  1Q81 U;  5LJ5 e;  4BUG A;  2Q7H A;  2AKW A;  4M7A C;  3A8G B;  4N0A C;  2IY5 A;  4HCC A;  3PIP A;  4IUV A;  1VQO A;  1VQK T;  2VGN A;  4YCW A;  2VUB A;  3CXC A;  1X56 A;  4M78 B;  1SER A;  1NJ6 A;  3HRU A;  4M77 B;  2E65 A;  1B34 A;  1W66 A;  5A0L A;  1PSF A;  4L6V 5;  2EFI A;  2XK0 A;  4QVZ A;  3S3N A;  1N6A A;  2CZ7 B;  3G6E A;  1Q82 C;  1VQ6 A;  2RJC A;  1VUB A;  3OD1 A;  4M75 G;  4ZIB A;  1H4S A;  1E24 A;  2FL7 A;  1WJR A;  2J3M A;  4ZTZ B;  2D9T A;  2DK3 A;  5GMK l;  3A8O B;  3HSB A;  3OYF A;  3GP8 A;  1YHQ A;  3CD6 T;  2ZXF A;  3HXX A;  5CKB A;  2I4O A;  3P8B B;  2ZNI A;  4JLI A;  4M75 A;  4QVD A;  2KQW A;  1EIY A;  4YRN A;  1M1K C;  4L59 A;  5GAM g;  1H3Z A;  4E51 A;  3P8H A;  2VYT A;  2J3L A;  1QE0 A;  3GF5 A;  4F7U B;  3REU A;  2XDD A;  3O8V A;  3CCE T;  3URG A;  5CAI A;  1U1S A;  1FYF A;  3UT1 A;  5GAO p;  3CC7 T;  3C4S A;  3M4G A;  2LX9 A;  1WU7 A;  1BIA A;  3CME T;  2QA4 T;  1VQ5 A;  4EMH A;  2E6N A;  1KMN A;  4OGE A;  1VQ9 A;  2F5T X;  4XU3 A;  2PVD B;  4HCB A;  3OYA A;  4K86 A;  4P75 C;  3MET A;  1M5Q 1;  3VQX A;  3QPH A;  3HY0 A;  2WAC A;  2JUF A;  3LLR A;  4L87 A;  4YRM A;  3CCV T;  2AHJ B;  1Y96 B;  4HCZ A;  4B9W A;  4M77 D;  4KT0 E;  3G4S T;  3CCJ A;  1IL2 A;  1VQ4 A;  3L2R A;  2ARU A;  1YI2 A;  1K9M C;  4P3N A;  2P5I A;  5IN1 A;  2D0Q B;  1N9S A;  1NE8 A;  1UB4 A;  1H4V B;  3HRS A;  2KDS A;  4YDQ A;  1B8A A;  2GFA A;  4J6W A;  4FT4 A;  1XTD A;  2ZGW A;  3WVE B;  2IY5 B;  5GAN h;  1KMM A;  4IUR A;  4CS3 A;  3PTA A;  2RHQ B;  5GAN 7;  4M75 C;  3R07 A;  3QUI A;  4M77 C;  5GAN 3;  2RHI A;  3M53 A;  3GIB A;  1VQ9 T;  1S72 T;  3OYY A;  2V8I A;  3MP1 A;  1M4Z A;  3RMS A;  4XTZ A;  3ERR A;  2L3R A;  3A5Z A;  3M56 A;  5CQX A;  3GNF B;  3OYM A;  2E64 A;  3VYH B;  4XU2 A;  5E3I A;  1NZ9 A;  3CCE A;  3C95 A;  1VQL T;  3JSC A;  4BE2 A;  4C5I A;  3J7A F;  3QNE A;  2DTI A;  3DSQ A;  1BI0 A;  4M7A G;  2QA4 A;  3REX A;  2RHZ A;  3HHT B;  2K4Y A;  4PJO G;  3E19 A;  5A0D A;  2DKG A;  2G3R A;  3BJU A;  3E9G A;  4ZN1 A;  1RIQ A;  1HC7 A;  3MQZ A;  3HXV A;  3MP8 A;  1OZ2 A;  3TEH B;  5D6X A;  3VUB A;  4C92 F;  4K87 A;  1YFS A;  3M57 A;  3TEH A;  4LVI A;  1LNX A;  2V8K A;  1UGS B;  3NTH A;  4J8O A;  5IAY A;  3OYK A;  1KOG A;  3I7F A;  1N27 A;  2ZT5 A;  4IUU A;  3MCA B;  1RL2 A;  5I21 A;  4AH6 A;  4LD9 K;  3NET A;  3JRZ A;  1BI1 A;  3QSU A;  5EG2 A;  2ALY B;  3V7C A;  3E9H A;  2NS6 A;  2DAQ A;  4TVA B;  3BDU A;  3L4G B;  4J7I A;  3CCM T;  1G5I A;  1IZ6 A;  4YP0 A;  2FVU A;  4X34 A;  4NOY A;  3LGF A;  1OZ3 A;  4CH3 A;  1BYM A;  4WJ3 M;  2DTH A;  3KXT A;  1VQK A;  2RK1 A;  3A8H B;  2RB6 A;  3KFU A;  4NL3 A;  1SET A;  2FHD A;  5KNN A;  4VUB A;  3TEG A;  2EJG A;  4J83 A;  3RGL A;  2E5Q A;  5LJ3 h;  3OS2 A;  4BY6 B;  2ZZG A;  3OQ5 A;  5GAM h;  3RMQ A;  4M78 C;  3L4G A;  2RI3 A;  4C0D C;  3OS0 A;  4H2X B;  4BI8 B;  3QXE B;  3QII A;  2CGH A;  1UEB A;  3QDR B;  2VXE A;  2DQ3 A;  4JLG A;  3L2U A;  1Y7X A;  2C7I A;  2RHY A;  4HT8 A;  2XIC A;  4Q5W A;  4BY6 C;  3A5Z B;  2EJ9 A;  4BDZ A;  4M77 E;  2XGT A;  2O01 E;  4E7J A;  4JDS A;  3VQW A;  2A3L A;  2PUO B;  4C8Q B;  2K57 A;  4P73 A;  1J5W A;  3I56 T;  2DXB A;  4MZP A;  3JCM P;  4D6W A;  4YRS A;  2RJF A;  4JRQ A;  2LC4 A;  3F70 A;  3HXU A;  1UGP B;  5GAN 6;  1VIE A;  3RAC A;  3CEY A;  3HTZ A;  1YJN A;  5GMK e;  4QQG A;  4YRJ A;  5J39 A;  3PGG A;  3JCM d;  3PT9 A;  5HK0 A;  1QVP A;  1Y96 A;  4MMK A;  4WF2 A;  4KBM B;  2E1H A;  2A7Y A;  1M1F A;  3SWN A;  3BDL A;  4GY5 A;  2AMC A;  3IG2 A;  12AS A;  5GMK j;  4L5G A;  5CO7 A;  4F7U A;  1WNL A;  1NPR A;  1QP3 A;  5GAO l;  2EWN A;  2VGM A;  5A2Q E;  3QYH B;  3JCM W;  3A74 A;  3HFZ A;  4ELY C;  4C92 E;  1YJW A;  2RHS B;  2XI9 A;  4CI0 C;  5CR2 A;  2ZCF B;  2XTI A;  2AKW B;  4LDY A;  3LWH A;  4H2X A;  2OTL T;  3OY9 A;  5KE3 A;  1WQ7 A;  2GCX A;  2ZPG B;  4PLL A;  4BW9 A;  1K9M U;  4C92 D;  1U1T A;  5LJ5 d;  2QHV A;  4N4I A;  3L42 A;  3NTI A;  5GAM j;  3PFS A;  5C0M A;  3L1A A;  4LVL A;  1X01 A;  1H4T A;  4X9C A;  3RER A;  2CZ0 B;  5HKC A;  5FU6 B;  2XD0 A;  3I56 A;  4M77 G;  3Q1J A;  2B8A A;  4FIB A;  4ATO A;  2OAU A;  3NFC A;  4MDX A;  1EFW A;  2GFU A;  3UGT A;  4TQF A;  3G4S A;  2DEQ A;  2V8J A;  5KCH A;  2CJB A;  1VQ4 T;  5CQY A;  2X35 A;  3CBM A;  1X6O A;  4LVJ A;  3CPW S;  2XHC A;  2WSC E;  4FL6 A;  1VQ7 T;  3IAL A;  3CMA A;  1VQP A;  1EOV A;  3ME9 A;  3L2Z A;  4HWP A;  4EPC A;  3UPU A;  2PUK B;  5D6W A;  4XTV A;  5ELO A;  3T9N A;  5DM7 R;  4ZTJ A;  5GAN e;  2ZNJ A;  3CCU A;  4C8Q D;  1S72 A;  2OTJ T;  2CYZ B;  2QTX A;  4M77 F;  4M78 E;  3HP9 A;  3N5B B;  2C06 A;  1LOJ A;  4M7A A;  4FU6 A;  1VQZ A;  1EIY B;  3FIF A;  4J15 A;  5CCA A;  4HWT A;  4O6J A;  2XDB A;  4C0Z A;  5LJ3 j;  4Q15 A;  4TTV A;  2XID A;  4KUL A;  5LJ3 e;  1BKB A;  1E1T A;  4P71 A;  1Q86 C;  4J5Y A;  4JRK A;  3NEN A;  3OS5 A;  3RKY A;  3HFV A;  3VQY A;  2O4X B;  1OYX A;  1QVF S;  5LJ3 f;  2C8M A;  4IUT A;  2FB7 A;  5CKE A;  3M5A A;  4OF1 A;  2QQR A;  2DDZ A;  2ZIN A;  4RMO A;  2JTM A;  3L2W A;  1BI3 A;  2ZT8 A;  5GAN g;  4A4E A;  1TH7 A;  3M55 A;  3HFN A;  2IG0 A;  2CZ6 B;  2Q7G A;  1WJQ A;  1B70 B;  4M7D D;  2EAY A;  4EMK A;  2RO0 A;  4C0F A;  1I5L A;  4M77 A;  2ODR C;  2PQW A;  1NYR A;  1Q7Y C;  3CC4 A;  2GF7 A;  4BDY A;  4P74 A;  2JVV A;  4UP8 A;  4XTW A;  1ZBX A;  3ZEH A;  3JB9 H;  3G6E T;  4JRI A;  4M75 D;  5F5W A;  1D3B A;  3QBY A;  1QVG S;  3MEW A;  2DU5 A;  5I2S A;  2ZPF B;  1EIF A;  2ZZF A;  4O2D A;  5GAO q;  3ZFJ A;  3P8Y A;  2H3J A;  1YFT A;  5ELN A;  2P0K A;  2K3X A;  4M78 F;  3HFO A;  2RHU A;  2JZ2 A;  3LGL A;  4C8Q F;  2Y4Y A;  1MGQ A;  4YRR A;  4H2T A;  1VIF A;  2OTJ A;  3HY1 A;  3CD6 A;  3LC0 A;  3M4Q A;  4OP0 A;  1NJI C;  3RUX A;  1WPY A;  5GAO n;  5GAM e;  2QQS A;  3FEO A;  1X2H A;  4E7H A;  4C8Q G;  4HT9 A;  5GAN j;  3MHX A;  3QO8 A;  2WSF E;  5GAN 2;  3CMA T;  5HGQ A;  3H6Z A;  4NCX A;  2RHQ A;  3JCM f;  3VUZ A;  2JN0 A;  4YPF A;  3M54 A;  1YI2 T;  3A7R A;  3BY7 A;  3SD4 A;  4H2S A;  3HXZ A;  5FRM A;  3C94 A;  3S6W A;  2P0L A;  5DLQ E;  3CME A;  3ASK A;  4E7L A;  4IKF A;  1VQ5 T;  4YRQ A;  5J3B A;  3JCM J;  1JJ2 A;  5LJ5 h;  2K5I A;  5FU6 C;  3VV0 A;  3QYG B;  3QZ5 B;  3VKI A;  3INZ A;  5C53 B;  2EKO A;  5IT9 E;  4RQE A;  1PYS A;  2D6F A;  2CZ1 B;  3OYN A;  4LDU A;  4Y28 E;  1FX7 A;  3DB4 A;  2X4Y A;  3CCQ A;  3UWN A;  3OYL A;  3FC3 A;  4XQ3 A;  4XTX A;  3GNG A;  2BUD A;  1WQW A;  2E5A A;  1G3S A;  4O5V A;  1XQH A;  1W2B S;  1R8O B;  2CIM A;  1QP2 A;  2DXT A;  4KUD K;  1KC8 C;  4J6X A;  3S3M A;  2F5K A;  5GAM d;  4C92 C;  2ZTG A;  3HKS A;  4NS5 A;  4P3O A;  4M7A E;  3J81 E;  1YFR A;  1JBM A;  2YLC A;  1X75 C;  4C5E A;  4ZGE B;  3HXY A;  2LTO A;  2ZPI B;  2YRV A;  3J80 E;  1M8V A;  5GMK h;  4WJ4 A;  4DPG A;  3OMG A;  3FLG A;  2O4X A;  1W2B A;  3UH0 A;  3CC4 T;  3X20 B;  2ZPB B;  1WLE A;  1E22 A;  3CCR T;  3OW2 A;  3A7A A;  3QO3 A;  5GAN f;  4A54 A;  2DJZ A;  1HTT A;  2KMT A;  4J6Y A;  5DLO A;  4M7D A;  4TQD A;  3TUP A;  2XU8 A;  2E10 A;  1VQ7 A;  3EFR A;  2RI5 A;  4V2S A;  1E1O A;  1VQN T;  3CXC S;  1VQP T;  4C5G A;  1X54 A;  4M7A B;  1Z7M A;  3SB2 A;  2RJD A;  1G51 A;  4X9D A;  3VYG A;  2PVO B;  2LDM A;  3C12 A;  4II1 A;  4BI3 A;  1I81 A;  4ZN3 A;  4LVM A;  2PU9 B;  3E9F A;  3JB9 J;  3WQZ A;  4P72 A;  2I4M A;  4G85 A;  3A5Y A;  4RKU E;  5D6Y A;  5GMK i;  1FWZ A;  1C0A A;  2L5Q A;  4Q6G A;  2KAF A;  1M1G A;  3M4P A;  2HBP A;  3LH0 A;  4RG8 A;  3CPF A;  2E3C A;  3OYE A;  1ATI A;  3OS1 A;  2Q5I A;  4ELZ C;  4F7U G;  3RIR A;  4C5H A;  3CCV A;  2P0P A;  4HA8 A;  4EMG A;  4DOV A;  3CCL T;  3A8M B;  1VQ6 T;  1Y07 A;  2ZR2 A;  4KR2 A;  3X28 B;  4C8Q A;  2K5F A;  1K8A U;  1YJ9 A;  4PJO D;  1HXD A;  3R6O A;  1VQN A;  2EJF A;  2M0O A;  1NJI U;  1NJ2 A;  5L8R E;  3QKJ A;  2MF2 A;  1H64 1;  4YRK A;  3MEV A;  3I55 A;  2EQU A;  4K88 A;  3DB3 A;  4GLK A;  1G3T A;  1YHQ T;  3QO7 A;  4H2V A;  1KG1 A;  1EVL A;  3KUF A;  3JCM g;  4PJO B;  1SRY A;  1B7Y A;  2RI2 A;  3FJP A;  2DO3 A;  2CJA A;  1G5V A;  3QTC A;  1KC8 U;  1NJ5 A;  5LL6 S;  1ASY A;  1ADY A;  2Q5H A;  1Q81 C;  1XNI A;  4X5O A;  1AHJ B;  3RKW A;  3V8L A;  2K2V A;  4MZT A;  1L0W A;  2RJE A;  4EX5 A;  4YRG A;  3CC7 A;  2LRQ A;  2Q7E A;  1N9R A;  3OYI A;  3DKM A;  4DA4 A;  3LX7 A;  4A4F A;  2YLB A;  1RI0 A;  1GGM A;  4CH6 A;  4HKE A;  4BE0 A;  3OBW A;  1ZQ1 A;  3WXM B;  1M90 U;  4LNS A;  3W3S A;  2MAM A;  4M7D G;  4M7D E;  3P8D A;  3PMT A;  3QHS A;  4E47 A;  3UFG A;  5GAN 5;  4B9X A;  1D3B B;  4BD3 A;  4JS4 A;  2DVE A;  2HQE A;  4EMK C;  1QF6 A;  3RF1 A;  4YRE A;  4CRI A;  3TRE A;  2JOY A;  1YIJ A;  1VQ8 T;  1YJW T;  1LJO A;  2DZC A;  3MEU A;  4C8Q C;  4PJO F;  2KK4 A;  4YCU A;  1USY C;  4EDU A;  2DXU A;  1YBY A;  2X4X A;  2I2L A;  4C92 G;  4ZTF A;  4A53 A;  2LQK A;  1Q86 U;  3I55 T;  4CH4 A;  2X4J A;  5LJ5 j;  4C92 B;  1G5H A;  1KHI A;  3EFS A;  2QQA A;  4R55 A;  2EIF A;  4ZGD B;  2QQB A;  1PYS B;  4YYE A;  4M7A F;  1ADJ A;  2QHU A;  5C6S A;  1KQS A;  5KH6 A;  4HVC A;  4ME7 A;  4A4K A;  4ZGJ B;  2R5M A;  4XTU A;  1YIJ T;  2XKO C;  3QG1 A;  4MDW A;  5GAO r;  3CCL A;  2ZZD A;  4A4G A;  3V7R A;  2ZZE A;  4PJO A;  4PKC C;  2DD5 A;  4P71 C;  4Y91 A;  2XG8 D;  3A31 A;  4HT4 A;  1YJ9 T;  1M1K U;  3L2Q A;  1KHC A;  2QDY B;  5KE2 A;  1NYQ A;  4IUQ A;  2EYQ A;  4QQ6 A;  3UGQ A;  3JB9 D;  1BI2 A;  5FU7 B;  3M9Q A;  2EQM A;  5M9O A;  3DLL A;  2ODR D;  5HK3 A;  4OVA A;  4BAC A;  3JCM V;  4RG2 A;  3NEM A;  1B34 B;  4TVA A;  3QO5 A;  3P8T A;  4PHC A;  2EL9 A;  3CC2 A;  3CCU T;  2QHS A;  4QQD A;  3QJY A;  3OW2 S;  2HAX A;  4N4H A;  2LQ8 A;  3OBY A;  4OB3 B;  2VXF A;  4YRL A;  3G7Z A;  4TWA A;  4CH5 A;  5GAN d;  1IRE B;  3MP6 A;  4H2W A;  2M1H A;  3OA6 A;  3NEL A;  2ZIM A;  3NTK A;  3V8K A;  4M7A D;  3S3O A;  2LCC A;  1YIT A;  5A0G A;  4UC4 A;  4XU0 A;  4EMK B;  1YJN T;  1U8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...