4XTWA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 94
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtwA01
4M78D 4OP0A 2I4OA 5GMKi 4M77C 4C92G 1SRYA 5HGQA 1N9WA 3I7FA 1M5Q1 3A31A 2DZCA 3VBBA 5GAN2 1ASYA 4JUVA 2RHSA 2ZZFA 1BBWA 1WU7A 4BWAA 4M7DC 4M75A 3RUXA 3M4PA 1IL2A 3MF2A 1ASZA 1JBMA 2DQ3A 2ZZGA 3NEMA 2DU7A 3HY0A 2Q7HA 4YDQA 5GAOq 1E1TA 4YRMA 1KQ1A 4M7DD 3SB2A 4TTVA 2ZINA 1D3BA 4EX5A 1X55A 1X01A 1N9RA 4QVDA 4M77B 2AMCB 3W3SA 4YRFA 2P0LA 2ZCEA 2QTXA 1B34A 3V7RA 4M7DG 2QHSA 4P73C 5K1XA 4M75F 2Q5IA 2Q5HA 3A7RA 2DXUA 5GAOr 4MMKA 4P74A 1NJ5A 3JCMP 3HSBA 4HWPA 4K87A 4JLIA 2EJFA 2I4MA 1X56A 4H2SA 5LJ5e 3TUPA 2RHQA 2RB6A 4YRSA 4M7AF 4M7AG 4HT9A 2ODRD 1E1OA 1TH7A 2J3LA 3HXWA 4TQDA 1HC7A 1U1TA 3EFRA 3BY7A 5ELOA 2VXEA 5LJ3g 3HXXA 4YRLA 5C53B 3V8KA 4N0AC 4EMKC 4C8QD 5LJ5h 2E1HA 2Y90A 1YFRA 2I4LA 4ZTZB 4C92F 2DDZA 1WLEA 4HT8A 1EIYB 4KR3A 4A54A 5GAN4 2CGHA 4RDXA 4YRNA 4EO4A 4CS4A 1NJ1A 2DXTA 1D3BB 3HY1A 5GMKm 1I81A 3V8JA 4M78F 4J6YA 1YFTA 2AKWB 2ZT6A 1LNXA 5GAMf 3VQXA 5C52B 1USYC 3RACA 3FB9A 1U1SA 3KFUA 4J5YA 3P8YA 1EQRA 4XTWA 3HFOA 4X9CA 2C8MA 5GAMj 3R07A 1EVLA 1X2HA 1C0AA 4P3NA 4M75B 4UPAA 3RF1A 3HXVA 3QO3A 2VXFA 2ZT8A 4EMGA 2E65A 2P5IA 3RESA 4NL2A 4H2XA 4XEMA 2ZNJA 3BW1A 3JCMV 1E22A 5GAMd 3PCOA 4YCUA 4PJOE 3OD1A 4M7AB 4M7DF 5KNNA 4P71C 1B7YA 4XTZA 4DPGA 4HWSA 4HWTA 4QVCA 4UP9A 4F7UG 2RA2A 3G1ZA 3TEHA 4TVAA 4BW9A 1FYFA 4NCXA 3QHSA 4M77F 4M77G 4ZTUB 3JB9J 4Q6GA 3A7UA 3TEHB 4M7AE 3HXUA 3VQWA 1NJ8A 3QSUA 4E51A 3JCMh 2ZZEA 5LJ3h 3HTZA 3L4GA 4TVWA 2DVEA 4K86A 3HFZA 1YB3A 3JCMW 4XU3A 5GAMh 3QO8A 2J3MA 5LJ5j 1N9SA 4P3OA 4XU2A 3ERRA 5GANd 2CIMA 4C8QF 3AHUA 1H4VB 4WI1A 4F7UA 5LJ5g 4AH6A 5GANe 2CJ9A 4C92E 4YRPA 5ELNA 3NETA 2E64A 4M77E 2DJZA 3L1AA 4C92D 1SETA 3V7SA 3QO5A 2AKWA 3CMQA 1B70A 4H02A 3UH0A 3HXYA 1NYRA 3JB9F 4X5OA 4YP0A 4YREA 4O2DA 1BIAA 4YRQA 1B70B 1YGBA 4CS3A 4WJ3M 1EIYA 2ZIOA 1NNHA 5GAOl 3V7CA 3NENA 1H4QA 1BIBA 3QUIA 4M75G 3TEGA 1H4TA 3PGGA 4M7AC 5GANh 4TWAA 4H2YA 2Q7GA 4F7UF 3JB9I 4G85A 1WQ7A 1QE0A 5LJ5f 2ARUA 1HK9A 4NL3A 3RKYA 5LJ3f 1WYDA 4RCBA 4LNSA 2YHTA 5E3IA 4A53A 1WQWA 3BDUA 3JCMQ 3RKXA 4HA8A 4H2UA 1G5IA 3JCMe 4P71A 4C8QE 2DTOA 4X9DA 4YRRA 4PJOA 2IY5B 1LOJA 3JCMb 4TVAB 2EWNA 2DEQA 1ADYA 2DZ9A 2AMCA 1JJCB 5GMKe 1B7YB 4F7UE 5GAMg 2I4NA 2ZNIA 2E10A 5DY9A 11ASA 3PCOB 1BBUA 2EL9A 1I8FA 5GMKj 1Z7MA 1M8VA 4PG3A 2ARSA 4HWOA 2DQ0A 3BJUA 5GAOp 4Y91A 3M4GA 4XTXA 1B76A 4PJOF 5GAN3 2C7IA 2DU5A 4M7DE 1NJ6A 1X2GA 3MF1A 4CH3A 1HTTA 4YRJA 4XTUA 5GAN6 2VC8A 1ATIA 4P72A 4RQFA 4EMHA 1VQZA 4HVCA 1H4SA 4XTVA 4XU1A 5GAOn 3JB9D 4YROA 4N0AA 4EMKA 3BFMA 1WNLA 3HRIA 2PMEA 3UFGA 4H2VA 4RQEA 3LSSA 3REXA 3WQZA 5GANg 4YPFA 4WF2A 1LJOA 4CH5A 3FIFA 4YRGA 4PJOB 1LYLA 3GIBA 3LSQA 4HWRA 2CJBA 2QHVA 3VQVA 3SWNC 2ZXFA 2QHTA 2ARTA 2QHUA 3RGLA 4PJOG 2E5AA 4C92A 1PYSA 4PNOA 4P73A 4XEOA 3V8LA 4CS2A 3HXZA 4YCVA 4C92B 5GAOm 2ZIMA 3RIRA 3ICAA 4ZIBA 5CAIA 1RIQA 1KMNA 2XGTA 4H2WA 2PMFA 5GANf 3P8VA 4RMFA 3HRKA 4YRCA 3A7AA 1B34B 1KQ2A 3L2ZA 4KR2A 3SWNB 4RCCA 5GAN8 1HXDA 1J5WA 3NELA 4L87A 4EMKB 3IKMB 4H2TA 4M78B 4YYEA 4M75C 3JCMg 3JCMd 2ZR3A 3JCMJ 3JB9H 4P75C 3INZA 1X54A 4JRKA 3UGQA 2RM4A 3FJPA 5GMKh 4M78E 2FYKA 3E9IA 3JCMc 1Z7NA 4J6WA 5LJ3d 1NYQA 3A5ZA 5C51B 3QO7A 1KOGA 2RHSB 1KMMA 4K88A 1QF6A 1H641 4M78G 1MGQA 5GAN7 5LJ3e 3HFZB 4PJOC 2XTIA 4CH4A 3L4GB 3JCMX 2K57A 5GANj 3JB9G 5LJ5d 3EFSA 1JJCA 2ZR2A 1JRIA 3JCMf 1EOVA 2DKGA 3HFVA 2ALYB 4XTYA 4YRKA 2FB7A 1WPYA 4JRIA 1ADJA 3RL6A 5GAN5 2ZGWA 3VU3C 1USYA 2IY5A 2JN0A 2RD1A 3HFNA 4P75A 3RKWA 4YRTA 1SESA 2EJ9A 4PHCA 4CH6A 4M7DA 1E24A 4G84A 1Y96A 3A5YA 5GMKl 4M7AA 4C8QG 4P3PA 3PZCA 3A32A 3IALA 4M75E 2HNIA 2ZTGA 4H2XB 2DTHA 4NOYA 4YCWA 1W66A 3LC0A 1YFSA 2ODRC 4M78C 1G5HA 2YLCA 4DQ2A 1NJ2A 2DTIA 4TVYA 3IG2A 4J6XA 3RERA 4M77D 5K1PA 4KQEA 1GGMA 3UGTA 4C8QB 2E3CA 1YCYA 4C92C 1G51A 4M78A 1L0WA 4P74C 1B8AA 3SWNA 4C8QA 2YLBA 5GAMe 2ZT7A 4OLFA 4M75D 2G4CA 2EAYA 4TQFA 4F7UB 1SERA 4UP8A 12ASA 4Q15A 3REUA 4YRIA 3A74A 1EVKA 3VQYA 4M7AD 4V2SA 4J15A 4P72C 3E9HA 4XU0A 2E41A 5F5WA 4WJ4A 4XQ3A 1PYSB 2CJAA 4C8QC 2RHQB 4UP7A 3IKLA 3QTCA 1I5LA 1Y96B 1EFWA 4M7DB 2ZT5A 2I2LA 1I4K1 4PJOD 3M4QA 3MEYA 2Q7EA 5LJ3j 3DSQA 2EJGA 4MMLA 2ALYA 3QNEA 5I21A 4M77A 3P8TA
chains in the Genus database with same CATH superfamily
4F16A 4GLKA 4L59A 2CUDA 4M77C 2W0ZA 3I7FA 4R55A 4ZGJB 1G3TA 1V76A 5GAN2 4E7HA 4JUVA 2ESWA 2RHSA 4PKCC 2PUOB 1WU7A 2FO0A 4EIKA 3EG9A 3MPUB 1TS9A 3ULRB 4C0GA 3RUXA 3CC2Q 1IL2A 3MF2A 5KYUA 2DQ3A 3OYLA 1ASZA 3I55Q 1M8MA 3L2UA 2JNGA 3JSCA 4YDQA 1V1CA 2CP0A 2ZAEA 4HKEA 4YRMA 1KQ1A 3M9QA 3SB2A 2QEXQ 2HSEB 2DD5A 5CK9A 1VQLQ 1RAHB 2ZINA 1D3BA 1E6GA 1X55A 1X01A 1Y7XA 5HY6A 2QQSA 3ME9A 1WX6A 1JQQA 4P73C 1QQJA 1WHGA 3HTRA 2OI3A 3SFMA 2Q5HA 2DXUA 1NG2A 3KFVA 2NUPA 3CCJA 4LDVA 1WDXA 2I4MA 2DYIA 3M0TA 2DVJA 5LJ5e 1G8XA 4YRSA 3CC7A 4TQDA 1HC7A 3BY7A 3GNGA 3HXXA 4YRLA 3V8KA 2LNHB 2OX7A 5EG2A 1UHFA 1OX9A 1GCQC 1AZEA 3OS2A 2L3SA 4RDXA 4EO4A 3CC4A 4DBFA 3OY9A 4J7FA 1YI2Q 1I81A 2D1XA 4M78F 2KY9A 2AKWB 2MOXA 3E1SA 2K3BA 1VQ8T 5KYWB 3CQTA 5FW9A 2OTLT 1USYC 3VS0A 3A1PA 1YP5A 2KT8A 3HFOA 5GAMj 4N4HA 1ZHIA 1VQ4T 1WXUA 2CZ1B 3LH5A 1N8RC 1NJIR 4BE1A 3L2VA 1YIJA 4BI8B 2VXFA 4EMGA 1M2VA 1M3CA 2V8JA 3CCLA 3OYGA 1WJQA 1E22A 3G6EA 2AZSA 2RI5A 4QT7A 3OD1A 5KNNA 3TCJA 4B6MA 2XDBA 1RI9A 4DPGA 4HWSA 1OPLA 2A08A 2Y4YA 4F7UG 2ABLA 4KUIA 3PIPA 3G1ZA 3TEHA 2J06A 4TVAA 4KGXB 3CBOA 2C0TA 2DLPA 3CBPA 1B07A 4F04B 4M7AE 3HXUA 4LDWA 3MKDA 2JVVA 2GCXA 3OSSC 4P5NA 4L6V5 2RQUA 3OYYA 2ZZEA 5LJ3h 2QA4A 1BB9A 2COWA 1MMAA 3HTZA 4TVWA 3HFZA 5FLXE 1QVGA 4XU3A 1M1GA 3E2UA 4J9BA 1ZSZB 1M1KU 2J3MA 5LJ5j 1NBEB 3ERRA 2CT3A 4HXJA 4WI1A 4N4IA 4OGEA 4IIOA 1QWFA 5LJ5g 2DRMA 4YRPA 3NETA 2E64A 4M77E 3L1AA 2KSSA 2LQNA 3CCSQ 3QO5A 1FMKA 1G3YA 4QW2A 1S72Q 3UH0A 3ER0A 1B70A 1IO6A 2DAQA 1NYRA 2QYZA 3CCRA 3C0CA 4YP0A 2X3XD 2YRVA 1JJ2S 1YGBA 4CS3A 1C1AA 1RUWA 1EIYA 1Q86R 2ZIOA 2K2VA 1HYOA 1AWJA 1BIBA 4M75G 3G6ET 2BE9B 4M7AC 4TWAA 4F7UF 3NTHA 1WQ7A 3WVDB 1Y07A 2CP7A 1X6GA 3MEWA 4B9XA 1QE0A 2NS6A 2A36A 2MYSA 2L5QA 5A2QE 4NL3A 2HEQA 1VQ7Q 2V8IA 4OMMA 1VQ9A 1VQ4A 4A53A 1WQWA 3CPFA 1KIKA 1I1JA 1S1NA 4P71A 2L8DA 2B8AA 3SEMA 5IHNA 1TTHB 1YIJQ 1UJYA 3JCMb 4YTLA 1ADYA 2DZ9A 1QVPA 4FL6A 2DRKA 5ECAA 5GJVB 3G4SQ 5GAMg 2A7YA 2KBTA 2EGAA 4E7LA 5GJWB 2ZPGB 3O8VA 1KQSA 1NEGA 2EYXA 2FL7A 1M30A 2CSIA 2K3XA 3A5ZB 3BJUA 4HWOA 4Y91A 2VVKA 3QYHB 4OMFB 1VQNQ 3GLXA 3MF1A 4CH3A 3LX7A 1Q82U 3CCET 3M59A 1EFNA 1VQ5A 2HMAA 2YRCA 2VC8A 3EFOA 3VS6A 4P72A 4BD3A 4RQFA 2JTMA 4PL6A 4EMHA 4XTVA 3QPHA 5J39A 5GAOn 3THKA 4EMKA 3OYIA 2GTOA 4RQEA 4A4HA 1D09B 4IUUA 3LWHA 4WF2A 1LJOA 4CH5A 5DLOA 1W1FA 4FIBA 4E7ZA 4YRGA 1LYLA 2O4XA 2RN8A 1I5OB 2DX1A 3HPWA 2IVWA 3M54A 1X6OA 2JM8A 1D0ZA 1Q7YR 4PJOG 5I22A 4C92A 1FMWA 4OB1B 2GFAA 2Y4XA 1MNDA 3URGA 2P4RA 3RIRA 1RADB 4KUDK 4X1VA 2RO0A 1KMNA 2YSQA 5GANf 1WZOA 4RMFA 2BTTA 3HRKA 4JRPA 1LCKA 3A8HB 4YRCA 5A0GA 3L2ZA 3TREA 3SWNB 3PVQA 1HXDA 3NELA 5FWCA 2CP5A 1ZUYA 4YYEA 2ED0A 2YUNA 3EGDA 1YIJT 1WJSA 3EFOB 1FXXA 4JLGA 1AWOA 5IHKA 3P8DA 1B7TA 2NLUA 2RF0A 2QTVA 4C5IA 1M90C 3JCMc 3PMIA 1FYNA 2LCLA 5LJ3d 1YI2A 3A5ZA 1NLPC 4BDYA 1XNIA 1I07A 1X43A 3CMET 3L4GB 3JCMX 5GANj 3JB9G 3EFSA 5IXBA 2XG8D 2L2PA 2DEUA 3EH1A 1EOVA 1OEBA 3I5SA 4XTYA 4YRKA 2FB7A 2ECZA 4JRIA 2EQIA 1AWXA 3PFSA 2CH4W 2JN0A 4C5GA 4FT2A 4OB3B 4P75A 3RKWA 1M1KC 3CMEA 2E6ZA 2OTLA 3KBGA 1S72T 3A5YA 2RJEA 2LT1A 4OF1A 2HNIA 4H2XB 2DTHA 3N5BB 4LVLA 3GOXA 1OQKA 1IXDA 1MNEA 2DTIA 4J6XA 4M77D 1UECA 4ZN3A 1QVGP 1GGMA 2EYQA 2RJFA 2E3CA 1ZSGA 2M9UA 4KBMB 1X2QA 3EG2A 3R6OA 1VYTA 2JUFA 2AIRB 2KR3A 4C8QA 4C0FA 1YJWT 1ABOA 1KFZA 4OLFA 1MHNA 4M75D 3BDLA 5CO7A 2G4CA 1Y57A 1N8RU 1MV3A 4Z02A 3LGLA 1NJIC 4UP8A 1AWWA 12ASA 1IZ6A 1WHHA 5KYNA 1UFFA 1MMNA 2EQMA 2ZPHB 3A74A 1PSFA 1EVKA 4M7AD 3QWXX 1ZSZA 2E41A 4FT4A 3CPWA 4A4GA 2RHQB 4UP7A 1M3AA 2WSCE 2JT4A 3REAB 3A98A 2ZT5A 2I2LA 4ME7A 2W10A 4LVIA 3OSVA 4E6RA 1ARKA 1I4K1 3CCUT 3PNWC 2XI9A 3I5RA 2ROLA 3DSQA 3EGUA 4HCBA 2EYWA 4MMLA 2YDLA 1SG5A 4OP0A 3M5AA 4RG2A 2CSQA 4AG2C 2I4OA 4C92G 1ZQ1A 1O9SA 3QJ6A 1M5Q1 3VS2A 1ZLMA 5C6SA 1RACB 1XOVA 4M7DC 1YWOA 5HKCA 4RTZA 2D8JA 1JBMA 3NEMA 4MDXA 2H3JA 5GAOq 1S72A 1E1TA 1VQKT 4M7DD 2FEIA 1UDLA 3OMCA 5CKHA 1PRLC 4QVDA 1YNZA 2AMCB 2RQRA 2DK3A 3OYCA 2PNIA 2Q5IA 5GAOr 1Q81U 2ZPFB 4O6JA 1NJ5A 4HWPA 2EJFA 2EQUA 3TUPA 2RHQA 3HP9A 2ODRD 1Y71A 1TH7A 5J3BA 2J3LA 2ZPBB 1U1TA 3EFRA 1BBZA 5C0MA 3EHQA 1BCMA 4EMKC 4KT0E 5LJ5h 2E1HA 2AZVA 2NUPB 4PFOA 2RK2A 4ZTZB 3QIIA 1RLPC 1OULA 4ZGDB 4DBHA 2CGHA 3HRTA 2FRWA 4JJNK 1T0JA 2KRSA 1RABB 3VRZA 1WFWA 5GMKm 3I56Q 4J6YA 1PNJA 5GAMf 2V8KA 3RACA 3FB9A 3H6ZA 3KFUA 4J5YA 3P8YA 2LDMA 5IH2A 4XTWA 5FU7C 4RTYA 1LPLA 4FSXA 2RJCA 2PVGB 1C0AA 1WHLA 4CC4B 1NYFA 2XK0A 3EG9B 4UPAA 1WI7A 2RJDA 3VS5A 3G1JA 3G6EQ 1K9MU 3RESA 3OMGA 1N27A 6AT1B 4XEMA 4QQ6A 2KMTA 1KJWA 3BW1A 3JCMV 2ZNJA 3PCOA 1WYXA 4PJOE 1SPKA 4P71C 1H3HA 3OYHA 2O88A 2KVQG 4DOVA 4QVCA 2KI7A 2QQBA 1B3QA 4ATOA 4UP9A 2JMAA 2RA2A 1OU8A 2JXBA 2LJ3A 4LD9K 4BW9A 2LT4A 4OMNA 4E2FB 1YJWQ 5HCKA 2E3HA 4NCXA 5L23A 4ZTUB 2HL5C 3TEHB 2DJQA 3E19A 2RHYA 2M51A 1NJ8A 3VV0A 3QSUA 2EPDA 1MUZA 1IGUA 1TWBA 3SD4A 4DEYA 3CCQQ 4BACA 1K1ZA 3CD6T 3PMTA 2EVRA 2P4TA 2K5FA 2FPEA 1MV0B 3S3MA 1BK2A 1N9SA 1V29B 4XU2A 2A28A 4Q5WA 5GANd 4K11A 5KYYB 1VQPA 1H4VB 2DO3A 2DPPB 2YXYA 1OI1A 4F7UA 4LDXA 4AH6A 2O31A 4C92E 1W6XA 3LLRA 9ATCB 1O75A 2DJZA 2JJ9A 1CSKA 1SETA 3V7SA 1BKBA 4C5HA 3EGDB 3CMAQ 3CMQA 4AFQC 3HXYA 3JB9F 4YREA 3I55T 2E70A 1B70B 2XIDA 4CC7A 3MP1A 3VYGA 1NNHA 2LJ1A 1ZSZC 1TSFA 5GAOl 4ELYC 3NENA 2AKLA 1M90U 1H4TA 4DBQA 5CIUA 5GANh 2EGEA 4BB7A 2Q7GA 4G85A 2EBPA 2EKHA 4MZPA 4KH1B 4RTTA 3TU4K 2KGTA 3CCJT 1HK9A 1YITA 1WA7A 5LJ3f 1WYDA 4D6WA 2LX7A 5E3IA 4C0DC 3BDUA 1KC8C 2VKNA 4O5VA 4F14A 1X27A 1G5IA 3JCMe 8AT1B 1YITT 1KQSS 4KGZB 2DTOA 1UEBA 2MPXC 1QKXA 1VQ5Q 1IGQA 2IY5B 2KXCA 3GP8A 2EWNA 2RHZA 2X9HA 1CKBA 2D8HA 1VQ7T 1UHCA 2XICA 3QZ9B 2X51A 4JJDA 1PD0A 3CBMA 1YJ9T 2J6FA 2HZYA 2LNVA 2I4NA 4BE0A 2E10A 5DY9A 11ASA 5CKFA 2ZZDA 4BI3A 3NHNA 1BBUA 1WJRA 1I8FA 1FX7A 5GMKj 3L2WA 4PG3A 1M2VB 4BY6C 2QASA 2XU8A 5A0DA 5GAOp 2QI2A 3M4GA 4XTXA 1M1FA 2J05A 5GAN3 2DU5A 2X4XA 1YHQT 2KEAA 1M4ZA 1ZA2B 2VUBA 4LD6A 3I9QA 5GAN6 1JJ2A 2RQVA 1ATIA 1UGQB 4KULA 2Z0WA 3GPLA 1RAAB 4FW1A 1YJNQ 1H4SA 4XU1A 3UDCA 2LX9A 2RQTA 3LSSA 3WQZA 3E9GA 3H0FA 3FIFA 4PJOB 1R77A 3GIBA 3LSQA 4HWRA 2GQVA 1AEYA 2CJBA 3VQVA 3SWNC 1D1CA 1YHQQ 2QHTA 4RTVA 2K9GA 1K73R 3CD6Q 2PVOB 1Z9ZA 2OAWA 5FROA 4PNOA 4P73A 4YCVA 3MQZA 4A4FA 3PE0A 3S6WA 3OYKA 1SSFA 3UA6A 2PMFA 2K3YA 5DLQE 1JJ2P 3CC7Q 2K4YA 4C0ZA 4J7IA 4KR2A 4II1A 3LH0A 5GAN8 2MWPA 4WCIA 5IHIA 1QP2A 4L87A 1BCOA 5KYXB 4M78B 2JMCA 3JCMg 1K4US 5EC7A 3JCMd 4AMCA 1OPKA 3CCUQ 2PVDB 2RM4A 5KCHA 2LVMA 3CCJQ 2LRQA 4M78E 1VQ8Q 3H9NA 3CC7T 4FW2A 3M0RA 3QO7A 1KOGA 1X6BA 1QF6A 2QG9B 1YN8A 3QBYA 4M78G 1MGQA 4CH4A 4HVUA 4PJOC 4A4KA 3ASKA 4LDYA 2XDPA 5LJ5d 2GFUA 1JJCA 4LN2A 4FYXB 1I0CA 2HQEA 1Q7YU 2HQHA 2DKGA 3HFVA 3PIOA 2ALYB 1UTIA 1G3SA 1WPYA 3QYGB 1QVFS 1HSQA 1GRIA 3MP6A 5GAN5 2HKNA 5I2SA 2IY5A 2RD1A 2X4WA 2PUKB 1EZZB 2VB6A 3RR6A 4G84A 1RAFB 4LVJA 5GMKl 1KC8R 3CCST 7AT1B 4AFZC 4M75E 2ZTGA 1U06A 3PT9A 3X28B 4KGVB 4UC4A 2KYBA 3X25B 4YCWA 3LC0A 1YFSA 3VJPA 1TXQA 3HRUA 2QXFA 4M78C 1RAGB 4QQGA 4DQ2A 2HBPA 2K5LA 4GLMA 1VQLT 2KAFA 1TU0B 4QVZA 1YCYA 1QP3A 1QVGS 2A3LA 1JU5C 1U8RA 3EAEA 2LQKA 3OA6A 4NS5A 3OYNA 2C06A 1SHFA 2P0QA 1IRXA 3MHXA 3FC3A 1XTDA 2EW3A 2EAYA 3PVLA 3VKIA 4TQFA 3MJXA 3OYDA 2AKKA 5KYYA 4BE2A 2JZ2A 2NUZA 1YHQA 3VQYA 1PCXA 2BUDA 1PHTA 4J15A 3E9HA 4Z8AA 4XU0A 3J81E 1K9AA 4WJ4A 4XQ3A 1PG5B 1Z9QA 2XMFA 1GBQA 1BYMA 1Y96B 1EFWA 3LWIA 1VQ4Q 4J8OA 2BIVA 3M4YA 1QWEA 4PJOD 4FYYB 3CCSA 3M4QA 4HCZA 1BI1A 3SHWA 1TOVA 5CKDA 3X20B 2Q7EA 3OBYA 1UUEA 3M0QA 3HKSA 4PFZA 3RNJA 3U23A 3UATA 3RMQA 1GCPA 3QNEA 1XQHA 2EGCA 3P8TA 1WHMA 1ZA1B 1NE8A 2WSEE 5GMKi 1SRYA 2R5AA 3A31A 3VBBA 2RHUA 4A63B 1E6HA 3L2RA 1KHCA 4BWAA 4MDWA 4Y92A 1JEGA 4R56A 2IIMA 2GQIA 2DU7A 3HY0A 2MI6A 3CMAA 1VQKA 3WXMB 2A37A 3J80E 1KK7A 1QW1A 4TTVA 1JO8A 2VWFA 1VYVA 2X4JA 2YRDA 3W3SA 2P0LA 1BU1A 1PRMC 1ZUKA 2ROTA 2ZCEA 1B34A 2KK4A 4M7DG 2JM9A 1NYGA 3I35A 5K1XA 4LE9A 3CCEQ 4M75F 3A7RA 3JCMP 3HSBA 4K87A 4JLIA 1E7OA 3UF4A 1X56A 3TVTA 2DERA 3CCRT 4M7AF 4M7AG 4HT9A 3HXWA 1HJDA 1KC8U 1SEMA 2G3RA 3CPWP 4PJMA 5ELOA 3OYBA 2GNCA 5LJ3g 3OYAA 1VQLA 1K9MR 4C8QD 2QEXA 1QCOA 5L8RE 2Y90A 1J3TA 1UB4A 2KDSA 2L89A 3CCVT 4E7JA 3EG0A 2FHDA 1Q95G 2QA4T 4C92F 2RI2A 4KH0B 2E6NA 4A4EA 1JB0E 2LP5A 3VS4A 4IIMA 2DMOA 4A54A 3VYHB 1M2OA 4YRNA 2BZYA 1KSWA 1NJ1A 3ZL7C 3S3NA 3HY1A 3JRZA 1RI0A 2DYBA 1QKWA 3V8JA 3VS1A 2ZT6A 1LNXA 1NPRA 3VQXA 5C52B 3M56A 2MK5A 3UA7A 3CCMQ 2XD0A 4X9CA 2C8MA 2ENMA 1VA7A 4TVRA 1EVLA 1R0BG 1UGSB 2CS7A 2P0KA 2CREA 3G71T 2EKOA 4ANJA 1X75C 5D6YA 5AYFA 1X2HA 1QVFA 3MEVA 4M75B 3RF1A 3HXVA 3QO3A 4J9HA 2ZT8A 3RDVA 2E65A 2P5IA 4PLIA 2LQWA 1AVZC 2VASA 3G7ZA 3KUFA 4IURA 3C95A 3H0HA 4YCUA 2XKOC 4DBRA 4L5GA 4FSSA 4M7AB 4R0KA 4M7DF 1B7YA 2RK1A 4XTZA 3NTKA 4WTOB 1F1BB 2HL3A 5LL6S 2I0NA 4ZNXA 3C94A 3DKMA 4E7IA 1Q81R 1FYFA 3QHSA 5CKBA 4M77G 2DA9A 5KH6A 3JB9J 3A7UA 1SF9A 2YWWA 3T9NA 1X69A 4OMLA 4E51A 4B9WA 1OOTA 3JCMh 1IB8A 2NYSA 1YB3A 2LZ6B 1VOMA 1D1BA 3QO8A 2HSPA 1YJNA 1YJNT 4JZ3A 2HQXA 1WXBA 1NM7A 1VQKQ 2CZ6B 2J6KA 3HRSA 3OS1A 1KG1A 2FG0A 2NUTB 5A0LA 4IKFA 1ACMB 5GANe 2KROA 2OTJQ 2F2VA 2CJ9A 5ELNA 4PJJA 2D9TA 2CP3A 3M0UA 1N6AA 4H02A 1VQOA 2DD4A 4OVAA 2WACA 5KYXA 2RNAA 3FEOA 1BIAA 4YRQA 1VQMA 1NPPA 1Q82R 4RTUA 3GF5A 2H3EB 3PTAA 2CZ0B 3UT1A 1YJ9Q 3QUIA 1PC0A 3TEGA 2EYYA 3OBWA 1PKSA 1QVFP 1WXTA 4CRIA 1ZX6A 5LJ5f 2ARUA 1YFNA 3BE3A 3X24B 2B86A 2OJ2A 2HBWA 2DIQA 3P8BB 4RCBA 3C4SA 2YHTA 4JRQA 1KD1R 4LNSA 2DXCA 2V26A 3JCMQ 1AHJB 1EIFA 4Z89A 2PTKA 4C8QE 4X9DA 3OYEA 4Z88A 4PJOA 2FVUA 1D0YA 3OB9A 3I56T 2DEQA 3OYMA 1VQ7A 2AMCA 1TUCA 1ZUUA 5KCOA 3CCUA 2RQWA 3FLGA 3PCOB 2ATCB 2EL9A 3QWYA 1Z7MA 1M8VA 1K73U 4M4ZA 1Q7YC 2DQ0A 3DB4A 2YUPA 2LCSA 2FPFA 1B76A 1AZGB 2XDDA 1NJ6A 4DEXA 4RTXA 5KE3A 2M1HA 4DOWA 5CVIA 3JB9D 2QQ9A 1VYUA 4IUQA 2PU9B 3BFMA 2O2OA 4N0AA 3HRIA 3UFGA 4H2VA 1K9MC 4KRTA 3L42A 5GANg 3VS3A 3NTIA 4YPFA 2L0AA 3ZBDA 2A0FB 2E12A 4JS5A 1K8AC 4HVWA 4IUTA 4CI0C 2BE7D 2LC4A 2ZXFA 3CCEA 2P0PA 2ARTA 2QHUA 3MO8A 2CZ7B 2E5AA 1PYSA 3CXCA 3AT1B 1W2BA 1LVKA 4XEOA 1Q86C 4CS2A 1GBRA 2OTJA 4C92B 5GAOm 3QJYA 1BI3A 3A8OB 2ZIMA 3ICAA 2JOYA 5CAIA 1RIQA 3WVEB 2L3PA 1RAIB 2E5KA 1NJIU 2QGGA 3M0PA 4OGCA 1K8AR 3I55A 3A7AA 1KQ2A 3EGXB 2K6DA 3CXCS 1W2BS 5J26A 4EMKB 1SRLA 3IKMB 4H2TA 4M75C 2DL4A 1H3ZA 2HD0A 3GBQA 5CQXA 3REBB 3JB9H 4PLLA 3VUZA 3L2QA 3UGQA 4J9FA 3OQ5A 2OTLQ 5GMKh 1CKAA 3CEYA 3QXEB 1Z7NA 1YI2T 1T3SA 2LQ8A 3MEAA 1KMMA 4MZMA 2SEMA 2VGMA 5HK3A 1H641 2CUBA 2QDLA 4XK8E 4FYWB 4HVVA 2FZKB 1T0HA 3ZEHA 1YWPA 4ESRA 1JRIA 3OW2P 2JS0A 1FMVA 2AHJB 1ADJA 2MMPA 4C5EA 3RL6A 1WLPB 1USYA 3HFNA 1DJ7B 1FWZA 1UGPB 4YRTA 1SESA 2EJ9A 4PHCA 3P8HA 2H8HA 3MEUA 4CH6A 1E24A 1PKTA 2QQAA 4C8QG 1W4SA 2DFUA 4P3PA 1BI0A 3IALA 1D0XA 5CCAA 3MCAB 1GCQA 1VIEA 1SKUB 2K79A 2E4HA 1A0NB 2SRCA 3A8GB 1ABQA 1G5HA 3IQLA 3CCQT 2RHXA 1NJ2A 3CCVA 2C0OA 4TVYA 3IG2A 2D0QB 3ZFJA 1NLOC 4KQEA 2QEXT 3OS5A 3UGTA 4C8QB 3CCLT 1G51A 1WHKA 4J9CA 1B8AA 3SWNA 3EGXA 2YLBA 5D7UA 5GAMe 2ZT7A 3JV3A 2E5QA 8ATCB 1QCNA 2KYMA 2DE0X 2YT6A 1OYXA 1SERA 3REUA 2CP2A 2E3IA 3HL8A 2KXDA 4V2SA 3E9FA 2DIGA 4D8KA 3DB3A 5F5WA 3LW5E 4J9GA 1PYSB 2CJAA 4JPBW 1Y0MA 3TSZA 1H8KA 4J83A 4ELZC 1I5LA 1VQ5T 2HKQB 3CC2A 4ZN1A 1T3LA 1U5SA 1YITQ 4ZTFA 2DILA 1RL2A 1TG0A 2DL8A 3TQ7P 2EJGA 2QDYB 4OB2B 5I21A 4M77A 3CPWS 2QK0A 4M78D 4AT1B 2CDTA 2DNUA 5HGQA 1N9WA 2DZCA 1Q81C 3RMSA 1ASYA 4HCKA 2F2WA 4BI4A 3EG1A 3M0SA 4FCYA 2ZZFA 5IN1A 2EYZA 4FU6A 1BBWA 2DBMA 4M75A 3OW2A 2O9SA 1N8RR 3M4PA 2QGFB 2ZZGA 2FRYA 4XAXB 3CCRQ 2Q7HA 1TUGB 1GFDA 4LUDA 5D6XA 1K0SA 4IUPA 2P84A 4EX5A 1C0MA 1N9RA 3R6NA 4M77B 2DL5A 2X35A 4YRFA 2QTXA 1MMGA 1WGSA 3V7RA 2QHSA 4OMOA 1IHWA 2LJ0A 2MF2A 1SRMA 4MMKA 4P74A 2MCNA 1SSHA 2VYTA 3A8LB 2PQWA 4RG8A 4H2SA 1R0CB 1YJ9A 4HCCA 2ED1A 2O01E 2RB6A 4OB0B 4EDUA 4RUGA 1E1OA 2LTOA 5FRMA 1VQNT 2VXEA 5C53B 2RI3A 2NWMA 1QCFA 4N0AC 3KXTA 4JS4A 2J6OA 2RMOA 1YFRA 2I4LA 2O4XB 1EX4A 1VQMT 2DDZA 1WLEA 2EFIA 2OAUA 4HT8A 1EIYB 4KR3A 4F17A 5GAN4 4CS4A 2CYZB 4QQDA 2KE9A 1PM3A 2DXTA 1D3BB 1OU9A 3R07A 1YFTA 2K2MA 3FJ5A 3NMZC 2L3QA 4JJBA 2RPNA 1U1SA 1EQRA 3CCMT 1YBYA 2GF7A 2L3RA 4Y28E 2M16A 2MIOA 4P3NA 4QKUA 4JJCA 3FDRA 3J7AF 1VQ6Q 2GGRA 3C12A 4ZTJA 4NL2A 4H2XA 1OX8A 5FRNA 3QZ5B 4ORZA 3A8MB 5GAMd 3DLLA 1BI2A 5KE2A 4VUBA 1SHGA 2K5IA 4HWTA 1AOJA 5FWBA 3H41A 2KT1A 1UGVA 1VQPT 1NEBA 3CC4T 1K8AU 2R57A 2KRMA 2GTJA 4GBQA 3NPFA 4M77F 3CCMA 4Q6GA 5FU6C 1VQNA 1UGRB 3VQWA 4RKUE 1M27C 4OMPA 2JW4A 2RHIA 3CD6A 2JS2A 1WHJA 3HHTB 4BDZA 3CCQA 3L4GA 2DVEA 4K86A 2F5TX 3JCMW 5GAMh 4HT4A 4P3OA 1PSEA 4AFSC 2FZGB 5M9OA 2CIMA 4C8QF 3AHUA 1UJ0A 4LVMA 5IAYA 3OW2S 2EQJA 2DBKA 4J9IA 4C92D 3F70A 5FU7B 3CXCP 1W2BP 2AKWA 1M9SA 1ZBJA 2PZ1A 4X5OA 3GNFB 4J9DA 1QMCA 1VQ6A 4O2DA 2KQWA 1HD3A 2CH4A 1VQ9Q 2ZPEB 2COYA 4WJ3M 4BUGA 2COZA 3QDFA 4PFPA 3V7CA 3CMEQ 1H4QA 2YUOA 2IG0A 2NUTA 3PGGA 4H2YA 4JDSA 4E47A 3JB9I 4CC3A 1AT1B 1YJWA 3DLMA 5CR2A 3H8ZA 4E7SA 1YCSB 3RKYA 1G5VA 1VQ6T 3LYIA 5FU6B 2EQKA 2LMJA 2FZCB 1UE9A 3RKXA 1XJWB 3QDRB 4HA8A 4H2UA 3M58A 1QLYA 3QKJA 4LDUA 4PJLA 4YRRA 4MZTA 1LOJA 2F1LA 4E7KA 1PWTA 1ZBXA 3LGFA 2R5MA 4TVAB 2HCKA 4LNPA 4J9EA 2QA4Q 2DL3A 5CQYA 2M02A 1JJCB 5GMKe 1B7YB 4F7UE 2ZNIA 2BZ8A 3NFCA 1KHIA 1VQMQ 1OV3A 2BKDN 3JAME 3VRYA 2ARSA 1C6VX 4N4GA 1VQ9T 1M90R 1AD5A 4PJOF 2J7IA 3VUBA 2C7IA 3UPUA 4M7DE 2MWOA 1X2GA 2EIFA 4EPCA 1HTTA 4YRJA 3M55A 4XTUA 5KYWA 4CC2A 3M53A 2CT4A 4HVCA 1VQZA 2OTJT 1PD1A 4YROA 2PMEA 1WNLA 3REXA 1IREB 1WIEA 3G71A 5I2MA 2D6FA 4C0DB 2MAMA 2QHVA 4RTWA 2BZXA 1M1KR 3RGLA 1W70A 3EG3A 4PK4A 5IXFA 2A8EA 1NZ9A 2HDAA 3UWNA 3V8LA 4LUEA 2X3WD 3HXZA 3OS0A 2DETA 4ZIBA 3CC4Q 1GL5A 2AK5A 1VQPQ 2XGTA 4H2WA 2VGNA 4FYVB 3P8VA 2G6FX 2VV5A 1B34B 2KNBB 1K73C 4RCCA 1J5WA 3META 3QG1A 3D7SB 4OMQA 1H92A 2ZR3A 2O9VA 3JCMJ 4P75C 3INZA 4AFUC 1X54A 2F2XA 2F5KA 3G71Q 2ZPIB 2C0IA 4JRKA 4PJNA 3FJPA 1MMDA 3EH2A 5KYUB 2FYKA 2QAZA 3E9IA 2AT1B 3Q1JA 3I56A 4J6WA 1NYQA 5C51B 2D0NA 2RHSB 4K88A 1U3OA 1G2BA 1KD1C 5GAN7 2FPDA 5LJ3e 1KD1U 2XTIA 1D1AA 3HFZB 2K57A 1JXOA 2CKKA 1R8OB 1K0XA 5I11A 2ZR2A 1OZ3A 2KRNA 3JCMf 3CCVQ 3RBBB 3EHRA 3OYFA 3CCLQ 1GXIE 3TEEA 2ZGWA 3VS7A 1JXMA 3VU3C 4FM4B 5D6WA 1Q86U 5HK0A 3O5ZA 2IPOB 2X4YA 1VQ8A 1K76A 4M7DA 1Y96A 3CMAT 4M7AA 5DM7R 2QQRA 3PZCA 4JZ4A 3A32A 1RAEB 4NOYA 4D8DA 1W66A 2M0OA 4GY5A 2ODRC 1VQOQ 3SDZA 1VQOT 1VUBA 3G4SA 2ZCFB 1G3WA 2YLCA 3TSWA 2DF6A 2JTEA 1N5ZA 4RMOA 3RERA 4X34A 5K1PA 4IUVA 3CC2T 2DL7A 1Q82C 4ZGEB 1OZ2A 4C92C 2CP6A 4M78A 2R58A 4LVKA 1L0WA 4P74C 2F69A 4LXCA 1IHVA 3OYJA 1GFCA 2GBQA 1UG1A 1G83A 4F7UB 4AG1C 3H0IA 5CKEA 3S3OA 4Q15A 4YRIA 2HAXA 2XHCA 4DA4A 2WSFE 2V1RA 4P72C 3G4ST 2K7AA 3FRNA 2LCCA 4C8QC 2YUQA 3MP8A 3IKLA 3QTCA 4M7DB 1RLQC 2RH2A 2V1QA 3M57A 3MEYA 1X2KA 5IT9E 5LJ3j 5AT1B 1TUDA 1KQSP 2DXBA 3X26B 4BY6B 1P92A 2DM1A 2ALYA 2M0YA 3NGPA 2JTFA 1VIFA 1M3BA
chains in the Genus database with same CATH topology
4GLKA 4L59A 4M77C 3I7FA 4R55A 4ZGJB 1G3TA 4E7HA 5GAN2 4JUVA 2RHSA 4PKCC 2PUOB 1WU7A 4C0GA 3RUXA 1IL2A 3MF2A 1ASZA 2DQ3A 3OYLA 3L2UA 2JNGA 3JSCA 4YDQA 4HKEA 4YRMA 1KQ1A 3M9QA 3SB2A 2DD5A 5CK9A 2ZINA 1D3BA 1X55A 1X01A 1Y7XA 5HY6A 2QQSA 3ME9A 4P73C 3SFMA 2Q5HA 2DXUA 3CCJA 4LDVA 2I4MA 5LJ5e 4YRSA 3CC7A 4TQDA 1HC7A 3BY7A 3GNGA 3HXXA 4YRLA 3V8KA 5EG2A 3OS2A 4RDXA 4EO4A 3CC4A 3OY9A 4J7FA 1I81A 4M78F 2KY9A 2AKWB 3E1SA 1VQ8T 1USYC 2OTLT 3HFOA 5GAMj 4N4HA 1ZHIA 1VQ4T 2CZ1B 1N8RC 4BE1A 3L2VA 1YIJA 4BI8B 2VXFA 4EMGA 2V8JA 3CCLA 3OYGA 1WJQA 1E22A 3G6EA 2RI5A 3OD1A 5KNNA 3TCJA 2XDBA 4DPGA 4HWSA 4F7UG 2Y4YA 4KUIA 3PIPA 3G1ZA 3TEHA 4TVAA 3CBOA 3CBPA 4M7AE 3HXUA 4LDWA 2JVVA 2GCXA 3OSSC 4P5NA 4L6V5 3OYYA 2ZZEA 5LJ3h 2QA4A 3HTZA 4TVWA 3HFZA 5FLXE 1QVGA 4XU3A 1M1GA 1M1KU 2J3MA 5LJ5j 3ERRA 4WI1A 4N4IA 4OGEA 5LJ5g 4YRPA 3NETA 2E64A 4M77E 3L1AA 2KSSA 3QO5A 1G3YA 4QW2A 3UH0A 3ER0A 1B70A 2DAQA 1NYRA 3CCRA 4YP0A 2YRVA 1JJ2S 1YGBA 4CS3A 1EIYA 2ZIOA 2K2VA 1BIBA 4M75G 3G6ET 4M7AC 4TWAA 4F7UF 3NTHA 1WQ7A 3WVDB 1Y07A 1QE0A 3MEWA 4B9XA 2NS6A 2L5QA 5A2QE 4NL3A 2V8IA 1VQ9A 1VQ4A 4A53A 1WQWA 3CPFA 4P71A 2L8DA 2B8AA 3JCMb 4YTLA 1ADYA 2DZ9A 1QVPA 4FL6A 5GAMg 2A7YA 4E7LA 2ZPGB 3O8VA 1KQSA 2FL7A 2K3XA 3A5ZB 4HWOA 3BJUA 3QYHB 4Y91A 4OMFB 3GLXA 3MF1A 4CH3A 3LX7A 1Q82U 3CCET 3M59A 1VQ5A 2VC8A 4P72A 4BD3A 4RQFA 2JTMA 4PL6A 4EMHA 4XTVA 5GAOn 3QPHA 5J39A 4EMKA 3OYIA 4RQEA 4A4HA 4IUUA 3LWHA 4WF2A 1LJOA 4CH5A 5DLOA 4FIBA 4YRGA 1LYLA 2O4XA 3HPWA 2IVWA 3M54A 1X6OA 4PJOG 4C92A 4OB1B 2GFAA 2Y4XA 3URGA 3RIRA 4KUDK 2RO0A 1KMNA 5GANf 4RMFA 3HRKA 4JRPA 4YRCA 3A8HB 5A0GA 3L2ZA 3TREA 3SWNB 1HXDA 3NELA 4YYEA 1YIJT 1WJSA 1FXXA 4JLGA 3P8DA 2NLUA 4C5IA 1M90C 3JCMc 3PMIA 2LCLA 5LJ3d 1YI2A 3A5ZA 4BDYA 1XNIA 3CMET 3L4GB 3JCMX 5GANj 3JB9G 3EFSA 2XG8D 1EOVA 4XTYA 4YRKA 2FB7A 4JRIA 3PFSA 2JN0A 4C5GA 4FT2A 4P75A 4OB3B 3RKWA 1M1KC 3CMEA 2E6ZA 2OTLA 3KBGA 1S72T 3A5YA 2RJEA 2LT1A 4OF1A 2HNIA 4H2XB 2DTHA 3N5BB 4LVLA 3GOXA 2DTIA 4J6XA 4M77D 4ZN3A 1GGMA 2EYQA 2RJFA 2E3CA 2M9UA 4KBMB 3R6OA 2JUFA 4C8QA 4C0FA 1YJWT 4OLFA 1MHNA 4M75D 3BDLA 5CO7A 2G4CA 1N8RU 4Z02A 3LGLA 1NJIC 4UP8A 12ASA 1IZ6A 2EQMA 2ZPHB 3A74A 1PSFA 1EVKA 4M7AD 2E41A 4FT4A 3CPWA 4A4GA 2RHQB 4UP7A 2WSCE 2ZT5A 2I2LA 4ME7A 4LVIA 3OSVA 1I4K1 3CCUT 3PNWC 2XI9A 3DSQA 4HCBA 4MMLA 4OP0A 3M5AA 4RG2A 2I4OA 4C92G 1ZQ1A 1O9SA 3QJ6A 1M5Q1 5C6SA 1XOVA 4M7DC 5HKCA 1JBMA 3NEMA 4MDXA 2H3JA 5GAOq 1S72A 1E1TA 1VQKT 4M7DD 3OMCA 5CKHA 4QVDA 2AMCB 2DK3A 3OYCA 2Q5IA 5GAOr 1Q81U 2ZPFB 4O6JA 1NJ5A 4HWPA 2EJFA 2EQUA 3TUPA 2RHQA 3HP9A 2ODRD 1Y71A 1TH7A 5J3BA 2J3LA 2ZPBB 1U1TA 3EFRA 5C0MA 4EMKC 4KT0E 5LJ5h 2E1HA 2RK2A 4ZTZB 3QIIA 4ZGDB 2CGHA 3HRTA 4JJNK 5GMKm 4J6YA 5GAMf 2V8KA 3RACA 3FB9A 3H6ZA 3KFUA 4J5YA 3P8YA 2LDMA 4XTWA 5FU7C 4FSXA 2RJCA 2PVGB 1C0AA 2XK0A 4UPAA 2RJDA 1K9MU 3RESA 3OMGA 1N27A 4XEMA 4QQ6A 2KMTA 2ZNJA 3BW1A 3JCMV 3PCOA 4PJOE 4P71C 3OYHA 2KVQG 4DOVA 4QVCA 2QQBA 4ATOA 4UP9A 2RA2A 4LD9K 4BW9A 2LT4A 4NCXA 4ZTUB 3TEHB 3E19A 2RHYA 1NJ8A 3VV0A 3QSUA 3SD4A 4BACA 3CD6T 3PMTA 2P4TA 2K5FA 3S3MA 1N9SA 1V29B 4XU2A 4Q5WA 5GANd 1VQPA 1H4VB 2DO3A 2DPPB 4LDXA 1OI1A 4F7UA 4AH6A 4C92E 3LLRA 1O75A 2DJZA 1SETA 3V7SA 1BKBA 4C5HA 3CMQA 3HXYA 3JB9F 4YREA 3I55T 2E70A 1B70B 2XIDA 3MP1A 3VYGA 1NNHA 5GAOl 3NENA 4ELYC 1M90U 1H4TA 5CIUA 5GANh 4BB7A 2Q7GA 4G85A 4MZPA 3TU4K 3CCJT 1HK9A 1YITA 5LJ3f 1WYDA 4D6WA 5E3IA 4C0DC 3BDUA 1KC8C 4O5VA 1G5IA 3JCMe 1YITT 1KQSS 2DTOA 1UEBA 2IY5B 3GP8A 2EWNA 2RHZA 1VQ7T 2XICA 3QZ9B 3CBMA 1YJ9T 2LNVA 2I4NA 4BE0A 2E10A 5DY9A 11ASA 5CKFA 2ZZDA 4BI3A 1BBUA 1I8FA 1FX7A 1WJRA 5GMKj 3L2WA 4PG3A 4BY6C 2XU8A 5A0DA 5GAOp 2QI2A 3M4GA 4XTXA 1M1FA 5GAN3 2DU5A 2X4XA 1YHQT 1M4ZA 2VUBA 4LD6A 5GAN6 1JJ2A 1ATIA 1UGQB 4KULA 3GPLA 1H4SA 4XU1A 3UDCA 2LX9A 3LSSA 3WQZA 3E9GA 3FIFA 4PJOB 3GIBA 3LSQA 4HWRA 2GQVA 2CJBA 3VQVA 3SWNC 2QHTA 2PVOB 5FROA 4PNOA 4P73A 4YCVA 3MQZA 4A4FA 3OYKA 3S6WA 1SSFA 2PMFA 2K3YA 5DLQE 2K4YA 4C0ZA 4J7IA 4KR2A 4II1A 3LH0A 5GAN8 2MWPA 1QP2A 4L87A 4M78B 3JCMg 3JCMd 2PVDB 2RM4A 5KCHA 2LVMA 2LRQA 4M78E 3CC7T 3QO7A 1KOGA 1QF6A 3QBYA 4M78G 1MGQA 4CH4A 4PJOC 4A4KA 3ASKA 4LDYA 2XDPA 5LJ5d 2GFUA 1JJCA 2HQEA 1Q7YU 2DKGA 3HFVA 3PIOA 2ALYB 1G3SA 1WPYA 3QYGB 1QVFS 3MP6A 5GAN5 5I2SA 2IY5A 2RD1A 2X4WA 2PUKB 4G84A 4LVJA 5GMKl 3CCST 4M75E 2ZTGA 3PT9A 3X28B 4UC4A 3X25B 4YCWA 3LC0A 1YFSA 3VJPA 3HRUA 4M78C 2QXFA 4QQGA 4DQ2A 2HBPA 2K5LA 1VQLT 2KAFA 4QVZA 1YCYA 1QP3A 1QVGS 2A3LA 1U8RA 3EAEA 2LQKA 3OA6A 4NS5A 3OYNA 2C06A 2P0QA 3MHXA 3FC3A 1XTDA 3VKIA 2EAYA 4TQFA 3OYDA 4BE2A 2JZ2A 1YHQA 3VQYA 2BUDA 4J15A 3E9HA 4XU0A 3J81E 4WJ4A 4XQ3A 1BYMA 1Y96B 1EFWA 3LWIA 4J8OA 2BIVA 3M4YA 4PJOD 3CCSA 3M4QA 4HCZA 1BI1A 5CKDA 3X20B 2Q7EA 3OBYA 3HKSA 3RMQA 3QNEA 1XQHA 3P8TA 1NE8A 2WSEE 5GMKi 1SRYA 2R5AA 3A31A 3VBBA 2RHUA 3L2RA 1KHCA 4BWAA 4MDWA 4R56A 2DU7A 3HY0A 2MI6A 3CMAA 1VQKA 3WXMB 3J80E 1QW1A 4TTVA 2X4JA 3W3SA 2P0LA 2ZCEA 1B34A 2KK4A 4M7DG 5K1XA 4M75F 3A7RA 3JCMP 3HSBA 4K87A 4JLIA 1X56A 3CCRT 4M7AF 4M7AG 4HT9A 3HXWA 1KC8U 2G3RA 5ELOA 3OYBA 3OYAA 5LJ3g 1VQLA 4C8QD 2QEXA 5L8RE 2Y90A 1UB4A 2KDSA 2L89A 3CCVT 4E7JA 2FHDA 2QA4T 4C92F 2RI2A 2E6NA 4A4EA 1JB0E 4A54A 3VYHB 4YRNA 1NJ1A 3S3NA 3HY1A 3JRZA 1RI0A 3V8JA 2ZT6A 1LNXA 1NPRA 3VQXA 5C52B 3M56A 2XD0A 4X9CA 2C8MA 4TVRA 1EVLA 1UGSB 2CS7A 2P0KA 3G71T 2EKOA 1X2HA 1X75C 5D6YA 5AYFA 1QVFA 3MEVA 4M75B 3RF1A 3HXVA 3QO3A 2ZT8A 2E65A 2P5IA 4PLIA 3G7ZA 4IURA 3KUFA 3C95A 4YCUA 2XKOC 4L5GA 4M7AB 4M7DF 1B7YA 2RK1A 4XTZA 3NTKA 5LL6S 3C94A 3DKMA 4E7IA 1FYFA 3QHSA 5CKBA 4M77G 5KH6A 3JB9J 3A7UA 3T9NA 4E51A 4B9WA 3JCMh 1YB3A 3QO8A 1YJNA 1YJNT 2HQXA 2CZ6B 3HRSA 3OS1A 1KG1A 5A0LA 4IKFA 5GANe 2CJ9A 5ELNA 2D9TA 1N6AA 4H02A 1VQOA 2DD4A 4OVAA 2WACA 3FEOA 1BIAA 4YRQA 1VQMA 1NPPA 3GF5A 3PTAA 2CZ0B 3UT1A 3QUIA 3TEGA 3OBWA 4CRIA 5LJ5f 2ARUA 3X24B 2DIQA 3P8BB 4LNSA 4RCBA 3C4SA 2YHTA 4JRQA 2DXCA 3JCMQ 1AHJB 1EIFA 4C8QE 4X9DA 3OYEA 4PJOA 2FVUA 3OB9A 3I56T 2DEQA 3OYMA 1VQ7A 2AMCA 5KCOA 3CCUA 3FLGA 3PCOB 2EL9A 1Z7MA 1M8VA 1K73U 1Q7YC 2DQ0A 3DB4A 1B76A 2XDDA 1NJ6A 5KE3A 2M1HA 4DOWA 5CVIA 3JB9D 2QQ9A 4IUQA 2PU9B 3BFMA 4N0AA 3HRIA 3UFGA 4H2VA 1K9MC 3L42A 5GANg 3NTIA 4YPFA 3ZBDA 2E12A 4JS5A 1K8AC 4IUTA 4CI0C 2LC4A 2ZXFA 3CCEA 2P0PA 2ARTA 2QHUA 3MO8A 2CZ7B 2E5AA 1PYSA 3CXCA 1W2BA 4XEOA 1Q86C 4CS2A 2OTJA 4C92B 5GAOm 3QJYA 1BI3A 3A8OB 2ZIMA 3ICAA 2JOYA 5CAIA 1RIQA 3WVEB 1NJIU 4OGCA 3I55A 3A7AA 1KQ2A 3CXCS 1W2BS 5J26A 4EMKB 3IKMB 4H2TA 4M75C 1H3ZA 2HD0A 5CQXA 3JB9H 4PLLA 3VUZA 3L2QA 3UGQA 3OQ5A 5GMKh 3CEYA 3QXEB 1Z7NA 1YI2T 2LQ8A 3MEAA 1KMMA 4MZMA 2VGMA 5HK3A 1H641 4XK8E 3ZEHA 1JRIA 2AHJB 1ADJA 2MMPA 4C5EA 3RL6A 1USYA 3HFNA 1DJ7B 1FWZA 1UGPB 4YRTA 1SESA 2EJ9A 4PHCA 3P8HA 3MEUA 4CH6A 1E24A 2QQAA 4C8QG 1W4SA 4P3PA 1BI0A 3IALA 5CCAA 3MCAB 1VIEA 3A8GB 1G5HA 3CCQT 1NJ2A 2RHXA 3CCVA 4TVYA 3IG2A 2D0QB 3ZFJA 4KQEA 2QEXT 3OS5A 3UGTA 4C8QB 3CCLT 1G51A 1B8AA 3SWNA 2YLBA 5GAMe 2ZT7A 2E5QA 1OYXA 1SERA 3REUA 3HL8A 4V2SA 3E9FA 2DIGA 3DB3A 5F5WA 3LW5E 1PYSB 2CJAA 4ELZC 4J83A 1I5LA 1VQ5T 3CC2A 4ZN1A 4ZTFA 1RL2A 2EJGA 2QDYB 4OB2B 5I21A 4M77A 3CPWS 4M78D 5HGQA 1N9WA 2DZCA 1Q81C 3RMSA 1ASYA 4BI4A 2ZZFA 5IN1A 1BBWA 4FU6A 4M75A 3OW2A 3M4PA 2ZZGA 4XAXB 2Q7HA 5D6XA 4IUPA 4EX5A 1N9RA 4M77B 2X35A 4YRFA 2QTXA 3V7RA 1WGSA 2QHSA 2MF2A 4MMKA 4P74A 2VYTA 3A8LB 2PQWA 4RG8A 4H2SA 1YJ9A 4HCCA 4OB0B 2O01E 2RB6A 4EDUA 1E1OA 2LTOA 5FRMA 1VQNT 2VXEA 5C53B 2RI3A 4N0AC 3KXTA 4JS4A 1YFRA 2I4LA 2O4XB 1VQMT 2DDZA 1WLEA 2EFIA 2OAUA 4HT8A 1EIYB 4KR3A 5GAN4 4CS4A 2CYZB 4QQDA 2DXTA 1D3BB 3R07A 1YFTA 1U1SA 1EQRA 3CCMT 1YBYA 2GF7A 2L3RA 4Y28E 2M16A 4P3NA 3FDRA 3J7AF 3C12A 4ZTJA 4NL2A 4H2XA 5FRNA 3QZ5B 3A8MB 5GAMd 3DLLA 1BI2A 5KE2A 4VUBA 2K5IA 4HWTA 1VQPT 3CC4T 1K8AU 2R57A 4M77F 3CCMA 4Q6GA 5FU6C 1VQNA 1UGRB 3VQWA 4RKUE 2RHIA 3CD6A 3HHTB 4BDZA 3CCQA 3L4GA 2DVEA 4K86A 2F5TX 3JCMW 5GAMh 4HT4A 4P3OA 1PSEA 5M9OA 2CIMA 4C8QF 3AHUA 4LVMA 5IAYA 3OW2S 2EQJA 4C92D 3F70A 5FU7B 2AKWA 1M9SA 4X5OA 3GNFB 4O2DA 1VQ6A 2KQWA 2ZPEB 4WJ3M 4BUGA 3V7CA 1H4QA 2IG0A 3PGGA 4H2YA 4JDSA 4E47A 3JB9I 1YJWA 3DLMA 5CR2A 3H8ZA 1G5VA 3RKYA 1VQ6T 3LYIA 5FU6B 2EQKA 3RKXA 3QDRB 4HA8A 4H2UA 3M58A 3QKJA 4LDUA 4YRRA 4MZTA 1LOJA 4E7KA 1ZBXA 3LGFA 2R5MA 4TVAB 5CQYA 1JJCB 5GMKe 1B7YB 4F7UE 2ZNIA 3NFCA 1KHIA 2BKDN 3JAME 2ARSA 4N4GA 1VQ9T 4PJOF 3VUBA 2C7IA 3UPUA 4M7DE 2MWOA 1X2GA 2EIFA 4EPCA 1HTTA 4YRJA 3M55A 4XTUA 3M53A 4HVCA 1VQZA 2OTJT 4YROA 2PMEA 1WNLA 3REXA 1IREB 3G71A 5I2MA 2D6FA 4C0DB 2MAMA 2QHVA 3RGLA 2A8EA 1NZ9A 3UWNA 3V8LA 3HXZA 3OS0A 4ZIBA 2XGTA 4H2WA 2VGNA 3P8VA 2VV5A 1B34B 1K73C 4RCCA 1J5WA 3META 3QG1A 2ZR3A 3JCMJ 4P75C 3INZA 1X54A 2F5KA 2ZPIB 4JRKA 3FJPA 2FYKA 3E9IA 3Q1JA 3I56A 4J6WA 1NYQA 5C51B 2RHSB 4K88A 1KD1C 5GAN7 5LJ3e 1KD1U 2XTIA 3HFZB 2K57A 2CKKA 1R8OB 2ZR2A 1OZ3A 3JCMf 3OYFA 1GXIE 3TEEA 2ZGWA 3VU3C 4FM4B 5D6WA 1Q86U 5HK0A 2X4YA 1VQ8A 4M7DA 1Y96A 3CMAT 4M7AA 5DM7R 2QQRA 3PZCA 3A32A 4NOYA 1W66A 2M0OA 4GY5A 2ODRC 3SDZA 1VQOT 1VUBA 3G4SA 2ZCFB 1G3WA 2YLCA 4RMOA 3RERA 4X34A 5K1PA 4IUVA 3CC2T 1Q82C 4ZGEB 1OZ2A 4C92C 2R58A 4M78A 4LVKA 1L0WA 4P74C 2F69A 3OYJA 4F7UB 5CKEA 3S3OA 4Q15A 4YRIA 2HAXA 2XHCA 4DA4A 2WSFE 4P72C 3G4ST 3FRNA 2LCCA 4C8QC 3MP8A 3IKLA 3QTCA 4M7DB 2RH2A 3M57A 3MEYA 5IT9E 5LJ3j 2DXBA 3X26B 4BY6B 1P92A 2ALYA 2JTFA 1VIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 D;  4OP0 A;  2I4O A;  5GMK i;  4M77 C;  4C92 G;  1SRY A;  5HGQ A;  1N9W A;  3I7F A;  1M5Q 1;  3A31 A;  2DZC A;  3VBB A;  5GAN 2;  1ASY A;  4JUV A;  2RHS A;  2ZZF A;  1BBW A;  1WU7 A;  4BWA A;  4M7D C;  4M75 A;  3RUX A;  3M4P A;  1IL2 A;  3MF2 A;  1ASZ A;  1JBM A;  2DQ3 A;  2ZZG A;  3NEM A;  2DU7 A;  3HY0 A;  2Q7H A;  4YDQ A;  5GAO q;  1E1T A;  4YRM A;  1KQ1 A;  4M7D D;  3SB2 A;  4TTV A;  2ZIN A;  1D3B A;  4EX5 A;  1X55 A;  1X01 A;  1N9R A;  4QVD A;  4M77 B;  2AMC B;  3W3S A;  4YRF A;  2P0L A;  2ZCE A;  2QTX A;  1B34 A;  3V7R A;  4M7D G;  2QHS A;  4P73 C;  5K1X A;  4M75 F;  2Q5I A;  2Q5H A;  3A7R A;  2DXU A;  5GAO r;  4MMK A;  4P74 A;  1NJ5 A;  3JCM P;  3HSB A;  4HWP A;  4K87 A;  4JLI A;  2EJF A;  2I4M A;  1X56 A;  4H2S A;  5LJ5 e;  3TUP A;  2RHQ A;  2RB6 A;  4YRS A;  4M7A F;  4M7A G;  4HT9 A;  2ODR D;  1E1O A;  1TH7 A;  2J3L A;  3HXW A;  4TQD A;  1HC7 A;  1U1T A;  3EFR A;  3BY7 A;  5ELO A;  2VXE A;  5LJ3 g;  3HXX A;  4YRL A;  5C53 B;  3V8K A;  4N0A C;  4EMK C;  4C8Q D;  5LJ5 h;  2E1H A;  2Y90 A;  1YFR A;  2I4L A;  4ZTZ B;  4C92 F;  2DDZ A;  1WLE A;  4HT8 A;  1EIY B;  4KR3 A;  4A54 A;  5GAN 4;  2CGH A;  4RDX A;  4YRN A;  4EO4 A;  4CS4 A;  1NJ1 A;  2DXT A;  1D3B B;  3HY1 A;  5GMK m;  1I81 A;  3V8J A;  4M78 F;  4J6Y A;  1YFT A;  2AKW B;  2ZT6 A;  1LNX A;  5GAM f;  3VQX A;  5C52 B;  1USY C;  3RAC A;  3FB9 A;  1U1S A;  3KFU A;  4J5Y A;  3P8Y A;  1EQR A;  4XTW A;  3HFO A;  4X9C A;  2C8M A;  5GAM j;  3R07 A;  1EVL A;  1X2H A;  1C0A A;  4P3N A;  4M75 B;  4UPA A;  3RF1 A;  3HXV A;  3QO3 A;  2VXF A;  2ZT8 A;  4EMG A;  2E65 A;  2P5I A;  3RES A;  4NL2 A;  4H2X A;  4XEM A;  2ZNJ A;  3BW1 A;  3JCM V;  1E22 A;  5GAM d;  3PCO A;  4YCU A;  4PJO E;  3OD1 A;  4M7A B;  4M7D F;  5KNN A;  4P71 C;  1B7Y A;  4XTZ A;  4DPG A;  4HWS A;  4HWT A;  4QVC A;  4UP9 A;  4F7U G;  2RA2 A;  3G1Z A;  3TEH A;  4TVA A;  4BW9 A;  1FYF A;  4NCX A;  3QHS A;  4M77 F;  4M77 G;  4ZTU B;  3JB9 J;  4Q6G A;  3A7U A;  3TEH B;  4M7A E;  3HXU A;  3VQW A;  1NJ8 A;  3QSU A;  4E51 A;  3JCM h;  2ZZE A;  5LJ3 h;  3HTZ A;  3L4G A;  4TVW A;  2DVE A;  4K86 A;  3HFZ A;  1YB3 A;  3JCM W;  4XU3 A;  5GAM h;  3QO8 A;  2J3M A;  5LJ5 j;  1N9S A;  4P3O A;  4XU2 A;  3ERR A;  5GAN d;  2CIM A;  4C8Q F;  3AHU A;  1H4V B;  4WI1 A;  4F7U A;  5LJ5 g;  4AH6 A;  5GAN e;  2CJ9 A;  4C92 E;  4YRP A;  5ELN A;  3NET A;  2E64 A;  4M77 E;  2DJZ A;  3L1A A;  4C92 D;  1SET A;  3V7S A;  3QO5 A;  2AKW A;  3CMQ A;  1B70 A;  4H02 A;  3UH0 A;  3HXY A;  1NYR A;  3JB9 F;  4X5O A;  4YP0 A;  4YRE A;  4O2D A;  1BIA A;  4YRQ A;  1B70 B;  1YGB A;  4CS3 A;  4WJ3 M;  1EIY A;  2ZIO A;  1NNH A;  5GAO l;  3V7C A;  3NEN A;  1H4Q A;  1BIB A;  3QUI A;  4M75 G;  3TEG A;  1H4T A;  3PGG A;  4M7A C;  5GAN h;  4TWA A;  4H2Y A;  2Q7G A;  4F7U F;  3JB9 I;  4G85 A;  1WQ7 A;  1QE0 A;  5LJ5 f;  2ARU A;  1HK9 A;  4NL3 A;  3RKY A;  5LJ3 f;  1WYD A;  4RCB A;  4LNS A;  2YHT A;  5E3I A;  4A53 A;  1WQW A;  3BDU A;  3JCM Q;  3RKX A;  4HA8 A;  4H2U A;  1G5I A;  3JCM e;  4P71 A;  4C8Q E;  2DTO A;  4X9D A;  4YRR A;  4PJO A;  2IY5 B;  1LOJ A;  3JCM b;  4TVA B;  2EWN A;  2DEQ A;  1ADY A;  2DZ9 A;  2AMC A;  1JJC B;  5GMK e;  1B7Y B;  4F7U E;  5GAM g;  2I4N A;  2ZNI A;  2E10 A;  5DY9 A;  11AS A;  3PCO B;  1BBU A;  2EL9 A;  1I8F A;  5GMK j;  1Z7M A;  1M8V A;  4PG3 A;  2ARS A;  4HWO A;  2DQ0 A;  3BJU A;  5GAO p;  4Y91 A;  3M4G A;  4XTX A;  1B76 A;  4PJO F;  5GAN 3;  2C7I A;  2DU5 A;  4M7D E;  1NJ6 A;  1X2G A;  3MF1 A;  4CH3 A;  1HTT A;  4YRJ A;  4XTU A;  5GAN 6;  2VC8 A;  1ATI A;  4P72 A;  4RQF A;  4EMH A;  1VQZ A;  4HVC A;  1H4S A;  4XTV A;  4XU1 A;  5GAO n;  3JB9 D;  4YRO A;  4N0A A;  4EMK A;  3BFM A;  1WNL A;  3HRI A;  2PME A;  3UFG A;  4H2V A;  4RQE A;  3LSS A;  3REX A;  3WQZ A;  5GAN g;  4YPF A;  4WF2 A;  1LJO A;  4CH5 A;  3FIF A;  4YRG A;  4PJO B;  1LYL A;  3GIB A;  3LSQ A;  4HWR A;  2CJB A;  2QHV A;  3VQV A;  3SWN C;  2ZXF A;  2QHT A;  2ART A;  2QHU A;  3RGL A;  4PJO G;  2E5A A;  4C92 A;  1PYS A;  4PNO A;  4P73 A;  4XEO A;  3V8L A;  4CS2 A;  3HXZ A;  4YCV A;  4C92 B;  5GAO m;  2ZIM A;  3RIR A;  3ICA A;  4ZIB A;  5CAI A;  1RIQ A;  1KMN A;  2XGT A;  4H2W A;  2PMF A;  5GAN f;  3P8V A;  4RMF A;  3HRK A;  4YRC A;  3A7A A;  1B34 B;  1KQ2 A;  3L2Z A;  4KR2 A;  3SWN B;  4RCC A;  5GAN 8;  1HXD A;  1J5W A;  3NEL A;  4L87 A;  4EMK B;  3IKM B;  4H2T A;  4M78 B;  4YYE A;  4M75 C;  3JCM g;  3JCM d;  2ZR3 A;  3JCM J;  3JB9 H;  4P75 C;  3INZ A;  1X54 A;  4JRK A;  3UGQ A;  2RM4 A;  3FJP A;  5GMK h;  4M78 E;  2FYK A;  3E9I A;  3JCM c;  1Z7N A;  4J6W A;  5LJ3 d;  1NYQ A;  3A5Z A;  5C51 B;  3QO7 A;  1KOG A;  2RHS B;  1KMM A;  4K88 A;  1QF6 A;  1H64 1;  4M78 G;  1MGQ A;  5GAN 7;  5LJ3 e;  3HFZ B;  4PJO C;  2XTI A;  4CH4 A;  3L4G B;  3JCM X;  2K57 A;  5GAN j;  3JB9 G;  5LJ5 d;  3EFS A;  1JJC A;  2ZR2 A;  1JRI A;  3JCM f;  1EOV A;  2DKG A;  3HFV A;  2ALY B;  4XTY A;  4YRK A;  2FB7 A;  1WPY A;  4JRI A;  1ADJ A;  3RL6 A;  5GAN 5;  2ZGW A;  3VU3 C;  1USY A;  2IY5 A;  2JN0 A;  2RD1 A;  3HFN A;  4P75 A;  3RKW A;  4YRT A;  1SES A;  2EJ9 A;  4PHC A;  4CH6 A;  4M7D A;  1E24 A;  4G84 A;  1Y96 A;  3A5Y A;  5GMK l;  4M7A A;  4C8Q G;  4P3P A;  3PZC A;  3A32 A;  3IAL A;  4M75 E;  2HNI A;  2ZTG A;  4H2X B;  2DTH A;  4NOY A;  4YCW A;  1W66 A;  3LC0 A;  1YFS A;  2ODR C;  4M78 C;  1G5H A;  2YLC A;  4DQ2 A;  1NJ2 A;  2DTI A;  4TVY A;  3IG2 A;  4J6X A;  3RER A;  4M77 D;  5K1P A;  4KQE A;  1GGM A;  3UGT A;  4C8Q B;  2E3C A;  1YCY A;  4C92 C;  1G51 A;  4M78 A;  1L0W A;  4P74 C;  1B8A A;  3SWN A;  4C8Q A;  2YLB A;  5GAM e;  2ZT7 A;  4OLF A;  4M75 D;  2G4C A;  2EAY A;  4TQF A;  4F7U B;  1SER A;  4UP8 A;  12AS A;  4Q15 A;  3REU A;  4YRI A;  3A74 A;  1EVK A;  3VQY A;  4M7A D;  4V2S A;  4J15 A;  4P72 C;  3E9H A;  4XU0 A;  2E41 A;  5F5W A;  4WJ4 A;  4XQ3 A;  1PYS B;  2CJA A;  4C8Q C;  2RHQ B;  4UP7 A;  3IKL A;  3QTC A;  1I5L A;  1Y96 B;  1EFW A;  4M7D B;  2ZT5 A;  2I2L A;  1I4K 1;  4PJO D;  3M4Q A;  3MEY A;  2Q7E A;  5LJ3 j;  3DSQ A;  2EJG A;  4MML A;  2ALY A;  3QNE A;  5I21 A;  4M77 A;  3P8T A; 
#chains in the Genus database with same CATH topology
 4F16 A;  4GLK A;  4L59 A;  2CUD A;  4M77 C;  2W0Z A;  3I7F A;  4R55 A;  4ZGJ B;  1G3T A;  1V76 A;  5GAN 2;  4E7H A;  4JUV A;  2ESW A;  2RHS A;  4PKC C;  2PUO B;  1WU7 A;  2FO0 A;  4EIK A;  3EG9 A;  3MPU B;  1TS9 A;  3ULR B;  4C0G A;  3RUX A;  3CC2 Q;  1IL2 A;  3MF2 A;  5KYU A;  2DQ3 A;  3OYL A;  1ASZ A;  3I55 Q;  1M8M A;  3L2U A;  2JNG A;  3JSC A;  4YDQ A;  1V1C A;  2CP0 A;  2ZAE A;  4HKE A;  4YRM A;  1KQ1 A;  3M9Q A;  3SB2 A;  2QEX Q;  2HSE B;  2DD5 A;  5CK9 A;  1VQL Q;  1RAH B;  2ZIN A;  1D3B A;  1E6G A;  1X55 A;  1X01 A;  1Y7X A;  5HY6 A;  2QQS A;  3ME9 A;  1WX6 A;  1JQQ A;  4P73 C;  1QQJ A;  1WHG A;  3HTR A;  2OI3 A;  3SFM A;  2Q5H A;  2DXU A;  1NG2 A;  3KFV A;  2NUP A;  3CCJ A;  4LDV A;  1WDX A;  2I4M A;  2DYI A;  3M0T A;  2DVJ A;  5LJ5 e;  1G8X A;  4YRS A;  3CC7 A;  4TQD A;  1HC7 A;  3BY7 A;  3GNG A;  3HXX A;  4YRL A;  3V8K A;  2LNH B;  2OX7 A;  5EG2 A;  1UHF A;  1OX9 A;  1GCQ C;  1AZE A;  3OS2 A;  2L3S A;  4RDX A;  4EO4 A;  3CC4 A;  4DBF A;  3OY9 A;  4J7F A;  1YI2 Q;  1I81 A;  2D1X A;  4M78 F;  2KY9 A;  2AKW B;  2MOX A;  3E1S A;  2K3B A;  1VQ8 T;  5KYW B;  3CQT A;  5FW9 A;  2OTL T;  1USY C;  3VS0 A;  3A1P A;  1YP5 A;  2KT8 A;  3HFO A;  5GAM j;  4N4H A;  1ZHI A;  1VQ4 T;  1WXU A;  2CZ1 B;  3LH5 A;  1N8R C;  1NJI R;  4BE1 A;  3L2V A;  1YIJ A;  4BI8 B;  2VXF A;  4EMG A;  1M2V A;  1M3C A;  2V8J A;  3CCL A;  3OYG A;  1WJQ A;  1E22 A;  3G6E A;  2AZS A;  2RI5 A;  4QT7 A;  3OD1 A;  5KNN A;  3TCJ A;  4B6M A;  2XDB A;  1RI9 A;  4DPG A;  4HWS A;  1OPL A;  2A08 A;  2Y4Y A;  4F7U G;  2ABL A;  4KUI A;  3PIP A;  3G1Z A;  3TEH A;  2J06 A;  4TVA A;  4KGX B;  3CBO A;  2C0T A;  2DLP A;  3CBP A;  1B07 A;  4F04 B;  4M7A E;  3HXU A;  4LDW A;  3MKD A;  2JVV A;  2GCX A;  3OSS C;  4P5N A;  4L6V 5;  2RQU A;  3OYY A;  2ZZE A;  5LJ3 h;  2QA4 A;  1BB9 A;  2COW A;  1MMA A;  3HTZ A;  4TVW A;  3HFZ A;  5FLX E;  1QVG A;  4XU3 A;  1M1G A;  3E2U A;  4J9B A;  1ZSZ B;  1M1K U;  2J3M A;  5LJ5 j;  1NBE B;  3ERR A;  2CT3 A;  4HXJ A;  4WI1 A;  4N4I A;  4OGE A;  4IIO A;  1QWF A;  5LJ5 g;  2DRM A;  4YRP A;  3NET A;  2E64 A;  4M77 E;  3L1A A;  2KSS A;  2LQN A;  3CCS Q;  3QO5 A;  1FMK A;  1G3Y A;  4QW2 A;  1S72 Q;  3UH0 A;  3ER0 A;  1B70 A;  1IO6 A;  2DAQ A;  1NYR A;  2QYZ A;  3CCR A;  3C0C A;  4YP0 A;  2X3X D;  2YRV A;  1JJ2 S;  1YGB A;  4CS3 A;  1C1A A;  1RUW A;  1EIY A;  1Q86 R;  2ZIO A;  2K2V A;  1HYO A;  1AWJ A;  1BIB A;  4M75 G;  3G6E T;  2BE9 B;  4M7A C;  4TWA A;  4F7U F;  3NTH A;  1WQ7 A;  3WVD B;  1Y07 A;  2CP7 A;  1X6G A;  3MEW A;  4B9X A;  1QE0 A;  2NS6 A;  2A36 A;  2MYS A;  2L5Q A;  5A2Q E;  4NL3 A;  2HEQ A;  1VQ7 Q;  2V8I A;  4OMM A;  1VQ9 A;  1VQ4 A;  4A53 A;  1WQW A;  3CPF A;  1KIK A;  1I1J A;  1S1N A;  4P71 A;  2L8D A;  2B8A A;  3SEM A;  5IHN A;  1TTH B;  1YIJ Q;  1UJY A;  3JCM b;  4YTL A;  1ADY A;  2DZ9 A;  1QVP A;  4FL6 A;  2DRK A;  5ECA A;  5GJV B;  3G4S Q;  5GAM g;  2A7Y A;  2KBT A;  2EGA A;  4E7L A;  5GJW B;  2ZPG B;  3O8V A;  1KQS A;  1NEG A;  2EYX A;  2FL7 A;  1M30 A;  2CSI A;  2K3X A;  3A5Z B;  3BJU A;  4HWO A;  4Y91 A;  2VVK A;  3QYH B;  4OMF B;  1VQN Q;  3GLX A;  3MF1 A;  4CH3 A;  3LX7 A;  1Q82 U;  3CCE T;  3M59 A;  1EFN A;  1VQ5 A;  2HMA A;  2YRC A;  2VC8 A;  3EFO A;  3VS6 A;  4P72 A;  4BD3 A;  4RQF A;  2JTM A;  4PL6 A;  4EMH A;  4XTV A;  3QPH A;  5J39 A;  5GAO n;  3THK A;  4EMK A;  3OYI A;  2GTO A;  4RQE A;  4A4H A;  1D09 B;  4IUU A;  3LWH A;  4WF2 A;  1LJO A;  4CH5 A;  5DLO A;  1W1F A;  4FIB A;  4E7Z A;  4YRG A;  1LYL A;  2O4X A;  2RN8 A;  1I5O B;  2DX1 A;  3HPW A;  2IVW A;  3M54 A;  1X6O A;  2JM8 A;  1D0Z A;  1Q7Y R;  4PJO G;  5I22 A;  4C92 A;  1FMW A;  4OB1 B;  2GFA A;  2Y4X A;  1MND A;  3URG A;  2P4R A;  3RIR A;  1RAD B;  4KUD K;  4X1V A;  2RO0 A;  1KMN A;  2YSQ A;  5GAN f;  1WZO A;  4RMF A;  2BTT A;  3HRK A;  4JRP A;  1LCK A;  3A8H B;  4YRC A;  5A0G A;  3L2Z A;  3TRE A;  3SWN B;  3PVQ A;  1HXD A;  3NEL A;  5FWC A;  2CP5 A;  1ZUY A;  4YYE A;  2ED0 A;  2YUN A;  3EGD A;  1YIJ T;  1WJS A;  3EFO B;  1FXX A;  4JLG A;  1AWO A;  5IHK A;  3P8D A;  1B7T A;  2NLU A;  2RF0 A;  2QTV A;  4C5I A;  1M90 C;  3JCM c;  3PMI A;  1FYN A;  2LCL A;  5LJ3 d;  1YI2 A;  3A5Z A;  1NLP C;  4BDY A;  1XNI A;  1I07 A;  1X43 A;  3CME T;  3L4G B;  3JCM X;  5GAN j;  3JB9 G;  3EFS A;  5IXB A;  2XG8 D;  2L2P A;  2DEU A;  3EH1 A;  1EOV A;  1OEB A;  3I5S A;  4XTY A;  4YRK A;  2FB7 A;  2ECZ A;  4JRI A;  2EQI A;  1AWX A;  3PFS A;  2CH4 W;  2JN0 A;  4C5G A;  4FT2 A;  4OB3 B;  4P75 A;  3RKW A;  1M1K C;  3CME A;  2E6Z A;  2OTL A;  3KBG A;  1S72 T;  3A5Y A;  2RJE A;  2LT1 A;  4OF1 A;  2HNI A;  4H2X B;  2DTH A;  3N5B B;  4LVL A;  3GOX A;  1OQK A;  1IXD A;  1MNE A;  2DTI A;  4J6X A;  4M77 D;  1UEC A;  4ZN3 A;  1QVG P;  1GGM A;  2EYQ A;  2RJF A;  2E3C A;  1ZSG A;  2M9U A;  4KBM B;  1X2Q A;  3EG2 A;  3R6O A;  1VYT A;  2JUF A;  2AIR B;  2KR3 A;  4C8Q A;  4C0F A;  1YJW T;  1ABO A;  1KFZ A;  4OLF A;  1MHN A;  4M75 D;  3BDL A;  5CO7 A;  2G4C A;  1Y57 A;  1N8R U;  1MV3 A;  4Z02 A;  3LGL A;  1NJI C;  4UP8 A;  1AWW A;  12AS A;  1IZ6 A;  1WHH A;  5KYN A;  1UFF A;  1MMN A;  2EQM A;  2ZPH B;  3A74 A;  1PSF A;  1EVK A;  4M7A D;  3QWX X;  1ZSZ A;  2E41 A;  4FT4 A;  3CPW A;  4A4G A;  2RHQ B;  4UP7 A;  1M3A A;  2WSC E;  2JT4 A;  3REA B;  3A98 A;  2ZT5 A;  2I2L A;  4ME7 A;  2W10 A;  4LVI A;  3OSV A;  4E6R A;  1ARK A;  1I4K 1;  3CCU T;  3PNW C;  2XI9 A;  3I5R A;  2ROL A;  3DSQ A;  3EGU A;  4HCB A;  2EYW A;  4MML A;  2YDL A;  1SG5 A;  4OP0 A;  3M5A A;  4RG2 A;  2CSQ A;  4AG2 C;  2I4O A;  4C92 G;  1ZQ1 A;  1O9S A;  3QJ6 A;  1M5Q 1;  3VS2 A;  1ZLM A;  5C6S A;  1RAC B;  1XOV A;  4M7D C;  1YWO A;  5HKC A;  4RTZ A;  2D8J A;  1JBM A;  3NEM A;  4MDX A;  2H3J A;  5GAO q;  1S72 A;  1E1T A;  1VQK T;  4M7D D;  2FEI A;  1UDL A;  3OMC A;  5CKH A;  1PRL C;  4QVD A;  1YNZ A;  2AMC B;  2RQR A;  2DK3 A;  3OYC A;  2PNI A;  2Q5I A;  5GAO r;  1Q81 U;  2ZPF B;  4O6J A;  1NJ5 A;  4HWP A;  2EJF A;  2EQU A;  3TUP A;  2RHQ A;  3HP9 A;  2ODR D;  1Y71 A;  1TH7 A;  5J3B A;  2J3L A;  2ZPB B;  1U1T A;  3EFR A;  1BBZ A;  5C0M A;  3EHQ A;  1BCM A;  4EMK C;  4KT0 E;  5LJ5 h;  2E1H A;  2AZV A;  2NUP B;  4PFO A;  2RK2 A;  4ZTZ B;  3QII A;  1RLP C;  1OUL A;  4ZGD B;  4DBH A;  2CGH A;  3HRT A;  2FRW A;  4JJN K;  1T0J A;  2KRS A;  1RAB B;  3VRZ A;  1WFW A;  5GMK m;  3I56 Q;  4J6Y A;  1PNJ A;  5GAM f;  2V8K A;  3RAC A;  3FB9 A;  3H6Z A;  3KFU A;  4J5Y A;  3P8Y A;  2LDM A;  5IH2 A;  4XTW A;  5FU7 C;  4RTY A;  1LPL A;  4FSX A;  2RJC A;  2PVG B;  1C0A A;  1WHL A;  4CC4 B;  1NYF A;  2XK0 A;  3EG9 B;  4UPA A;  1WI7 A;  2RJD A;  3VS5 A;  3G1J A;  3G6E Q;  1K9M U;  3RES A;  3OMG A;  1N27 A;  6AT1 B;  4XEM A;  4QQ6 A;  2KMT A;  1KJW A;  3BW1 A;  3JCM V;  2ZNJ A;  3PCO A;  1WYX A;  4PJO E;  1SPK A;  4P71 C;  1H3H A;  3OYH A;  2O88 A;  2KVQ G;  4DOV A;  4QVC A;  2KI7 A;  2QQB A;  1B3Q A;  4ATO A;  4UP9 A;  2JMA A;  2RA2 A;  1OU8 A;  2JXB A;  2LJ3 A;  4LD9 K;  4BW9 A;  2LT4 A;  4OMN A;  4E2F B;  1YJW Q;  5HCK A;  2E3H A;  4NCX A;  5L23 A;  4ZTU B;  2HL5 C;  3TEH B;  2DJQ A;  3E19 A;  2RHY A;  2M51 A;  1NJ8 A;  3VV0 A;  3QSU A;  2EPD A;  1MUZ A;  1IGU A;  1TWB A;  3SD4 A;  4DEY A;  3CCQ Q;  4BAC A;  1K1Z A;  3CD6 T;  3PMT A;  2EVR A;  2P4T A;  2K5F A;  2FPE A;  1MV0 B;  3S3M A;  1BK2 A;  1N9S A;  1V29 B;  4XU2 A;  2A28 A;  4Q5W A;  5GAN d;  4K11 A;  5KYY B;  1VQP A;  1H4V B;  2DO3 A;  2DPP B;  2YXY A;  1OI1 A;  4F7U A;  4LDX A;  4AH6 A;  2O31 A;  4C92 E;  1W6X A;  3LLR A;  9ATC B;  1O75 A;  2DJZ A;  2JJ9 A;  1CSK A;  1SET A;  3V7S A;  1BKB A;  4C5H A;  3EGD B;  3CMA Q;  3CMQ A;  4AFQ C;  3HXY A;  3JB9 F;  4YRE A;  3I55 T;  2E70 A;  1B70 B;  2XID A;  4CC7 A;  3MP1 A;  3VYG A;  1NNH A;  2LJ1 A;  1ZSZ C;  1TSF A;  5GAO l;  4ELY C;  3NEN A;  2AKL A;  1M90 U;  1H4T A;  4DBQ A;  5CIU A;  5GAN h;  2EGE A;  4BB7 A;  2Q7G A;  4G85 A;  2EBP A;  2EKH A;  4MZP A;  4KH1 B;  4RTT A;  3TU4 K;  2KGT A;  3CCJ T;  1HK9 A;  1YIT A;  1WA7 A;  5LJ3 f;  1WYD A;  4D6W A;  2LX7 A;  5E3I A;  4C0D C;  3BDU A;  1KC8 C;  2VKN A;  4O5V A;  4F14 A;  1X27 A;  1G5I A;  3JCM e;  8AT1 B;  1YIT T;  1KQS S;  4KGZ B;  2DTO A;  1UEB A;  2MPX C;  1QKX A;  1VQ5 Q;  1IGQ A;  2IY5 B;  2KXC A;  3GP8 A;  2EWN A;  2RHZ A;  2X9H A;  1CKB A;  2D8H A;  1VQ7 T;  1UHC A;  2XIC A;  3QZ9 B;  2X51 A;  4JJD A;  1PD0 A;  3CBM A;  1YJ9 T;  2J6F A;  2HZY A;  2LNV A;  2I4N A;  4BE0 A;  2E10 A;  5DY9 A;  11AS A;  5CKF A;  2ZZD A;  4BI3 A;  3NHN A;  1BBU A;  1WJR A;  1I8F A;  1FX7 A;  5GMK j;  3L2W A;  4PG3 A;  1M2V B;  4BY6 C;  2QAS A;  2XU8 A;  5A0D A;  5GAO p;  2QI2 A;  3M4G A;  4XTX A;  1M1F A;  2J05 A;  5GAN 3;  2DU5 A;  2X4X A;  1YHQ T;  2KEA A;  1M4Z A;  1ZA2 B;  2VUB A;  4LD6 A;  3I9Q A;  5GAN 6;  1JJ2 A;  2RQV A;  1ATI A;  1UGQ B;  4KUL A;  2Z0W A;  3GPL A;  1RAA B;  4FW1 A;  1YJN Q;  1H4S A;  4XU1 A;  3UDC A;  2LX9 A;  2RQT A;  3LSS A;  3WQZ A;  3E9G A;  3H0F A;  3FIF A;  4PJO B;  1R77 A;  3GIB A;  3LSQ A;  4HWR A;  2GQV A;  1AEY A;  2CJB A;  3VQV A;  3SWN C;  1D1C A;  1YHQ Q;  2QHT A;  4RTV A;  2K9G A;  1K73 R;  3CD6 Q;  2PVO B;  1Z9Z A;  2OAW A;  5FRO A;  4PNO A;  4P73 A;  4YCV A;  3MQZ A;  4A4F A;  3PE0 A;  3S6W A;  3OYK A;  1SSF A;  3UA6 A;  2PMF A;  2K3Y A;  5DLQ E;  1JJ2 P;  3CC7 Q;  2K4Y A;  4C0Z A;  4J7I A;  4KR2 A;  4II1 A;  3LH0 A;  5GAN 8;  2MWP A;  4WCI A;  5IHI A;  1QP2 A;  4L87 A;  1BCO A;  5KYX B;  4M78 B;  2JMC A;  3JCM g;  1K4U S;  5EC7 A;  3JCM d;  4AMC A;  1OPK A;  3CCU Q;  2PVD B;  2RM4 A;  5KCH A;  2LVM A;  3CCJ Q;  2LRQ A;  4M78 E;  1VQ8 Q;  3H9N A;  3CC7 T;  4FW2 A;  3M0R A;  3QO7 A;  1KOG A;  1X6B A;  1QF6 A;  2QG9 B;  1YN8 A;  3QBY A;  4M78 G;  1MGQ A;  4CH4 A;  4HVU A;  4PJO C;  4A4K A;  3ASK A;  4LDY A;  2XDP A;  5LJ5 d;  2GFU A;  1JJC A;  4LN2 A;  4FYX B;  1I0C A;  2HQE A;  1Q7Y U;  2HQH A;  2DKG A;  3HFV A;  3PIO A;  2ALY B;  1UTI A;  1G3S A;  1WPY A;  3QYG B;  1QVF S;  1HSQ A;  1GRI A;  3MP6 A;  5GAN 5;  2HKN A;  5I2S A;  2IY5 A;  2RD1 A;  2X4W A;  2PUK B;  1EZZ B;  2VB6 A;  3RR6 A;  4G84 A;  1RAF B;  4LVJ A;  5GMK l;  1KC8 R;  3CCS T;  7AT1 B;  4AFZ C;  4M75 E;  2ZTG A;  1U06 A;  3PT9 A;  3X28 B;  4KGV B;  4UC4 A;  2KYB A;  3X25 B;  4YCW A;  3LC0 A;  1YFS A;  3VJP A;  1TXQ A;  3HRU A;  2QXF A;  4M78 C;  1RAG B;  4QQG A;  4DQ2 A;  2HBP A;  2K5L A;  4GLM A;  1VQL T;  2KAF A;  1TU0 B;  4QVZ A;  1YCY A;  1QP3 A;  1QVG S;  2A3L A;  1JU5 C;  1U8R A;  3EAE A;  2LQK A;  3OA6 A;  4NS5 A;  3OYN A;  2C06 A;  1SHF A;  2P0Q A;  1IRX A;  3MHX A;  3FC3 A;  1XTD A;  2EW3 A;  2EAY A;  3PVL A;  3VKI A;  4TQF A;  3MJX A;  3OYD A;  2AKK A;  5KYY A;  4BE2 A;  2JZ2 A;  2NUZ A;  1YHQ A;  3VQY A;  1PCX A;  2BUD A;  1PHT A;  4J15 A;  3E9H A;  4Z8A A;  4XU0 A;  3J81 E;  1K9A A;  4WJ4 A;  4XQ3 A;  1PG5 B;  1Z9Q A;  2XMF A;  1GBQ A;  1BYM A;  1Y96 B;  1EFW A;  3LWI A;  1VQ4 Q;  4J8O A;  2BIV A;  3M4Y A;  1QWE A;  4PJO D;  4FYY B;  3CCS A;  3M4Q A;  4HCZ A;  1BI1 A;  3SHW A;  1TOV A;  5CKD A;  3X20 B;  2Q7E A;  3OBY A;  1UUE A;  3M0Q A;  3HKS A;  4PFZ A;  3RNJ A;  3U23 A;  3UAT A;  3RMQ A;  1GCP A;  3QNE A;  1XQH A;  2EGC A;  3P8T A;  1WHM A;  1ZA1 B;  1NE8 A;  2WSE E;  5GMK i;  1SRY A;  2R5A A;  3A31 A;  3VBB A;  2RHU A;  4A63 B;  1E6H A;  3L2R A;  1KHC A;  4BWA A;  4MDW A;  4Y92 A;  1JEG A;  4R56 A;  2IIM A;  2GQI A;  2DU7 A;  3HY0 A;  2MI6 A;  3CMA A;  1VQK A;  3WXM B;  2A37 A;  3J80 E;  1KK7 A;  1QW1 A;  4TTV A;  1JO8 A;  2VWF A;  1VYV A;  2X4J A;  2YRD A;  3W3S A;  2P0L A;  1BU1 A;  1PRM C;  1ZUK A;  2ROT A;  2ZCE A;  1B34 A;  2KK4 A;  4M7D G;  2JM9 A;  1NYG A;  3I35 A;  5K1X A;  4LE9 A;  3CCE Q;  4M75 F;  3A7R A;  3JCM P;  3HSB A;  4K87 A;  4JLI A;  1E7O A;  3UF4 A;  1X56 A;  3TVT A;  2DER A;  3CCR T;  4M7A F;  4M7A G;  4HT9 A;  3HXW A;  1HJD A;  1KC8 U;  1SEM A;  2G3R A;  3CPW P;  4PJM A;  5ELO A;  3OYB A;  2GNC A;  5LJ3 g;  3OYA A;  1VQL A;  1K9M R;  4C8Q D;  2QEX A;  1QCO A;  5L8R E;  2Y90 A;  1J3T A;  1UB4 A;  2KDS A;  2L89 A;  3CCV T;  4E7J A;  3EG0 A;  2FHD A;  1Q95 G;  2QA4 T;  4C92 F;  2RI2 A;  4KH0 B;  2E6N A;  4A4E A;  1JB0 E;  2LP5 A;  3VS4 A;  4IIM A;  2DMO A;  4A54 A;  3VYH B;  1M2O A;  4YRN A;  2BZY A;  1KSW A;  1NJ1 A;  3ZL7 C;  3S3N A;  3HY1 A;  3JRZ A;  1RI0 A;  2DYB A;  1QKW A;  3V8J A;  3VS1 A;  2ZT6 A;  1LNX A;  1NPR A;  3VQX A;  5C52 B;  3M56 A;  2MK5 A;  3UA7 A;  3CCM Q;  2XD0 A;  4X9C A;  2C8M A;  2ENM A;  1VA7 A;  4TVR A;  1EVL A;  1R0B G;  1UGS B;  2CS7 A;  2P0K A;  2CRE A;  3G71 T;  2EKO A;  4ANJ A;  1X75 C;  5D6Y A;  5AYF A;  1X2H A;  1QVF A;  3MEV A;  4M75 B;  3RF1 A;  3HXV A;  3QO3 A;  4J9H A;  2ZT8 A;  3RDV A;  2E65 A;  2P5I A;  4PLI A;  2LQW A;  1AVZ C;  2VAS A;  3G7Z A;  3KUF A;  4IUR A;  3C95 A;  3H0H A;  4YCU A;  2XKO C;  4DBR A;  4L5G A;  4FSS A;  4M7A B;  4R0K A;  4M7D F;  1B7Y A;  2RK1 A;  4XTZ A;  3NTK A;  4WTO B;  1F1B B;  2HL3 A;  5LL6 S;  2I0N A;  4ZNX A;  3C94 A;  3DKM A;  4E7I A;  1Q81 R;  1FYF A;  3QHS A;  5CKB A;  4M77 G;  2DA9 A;  5KH6 A;  3JB9 J;  3A7U A;  1SF9 A;  2YWW A;  3T9N A;  1X69 A;  4OML A;  4E51 A;  4B9W A;  1OOT A;  3JCM h;  1IB8 A;  2NYS A;  1YB3 A;  2LZ6 B;  1VOM A;  1D1B A;  3QO8 A;  2HSP A;  1YJN A;  1YJN T;  4JZ3 A;  2HQX A;  1WXB A;  1NM7 A;  1VQK Q;  2CZ6 B;  2J6K A;  3HRS A;  3OS1 A;  1KG1 A;  2FG0 A;  2NUT B;  5A0L A;  4IKF A;  1ACM B;  5GAN e;  2KRO A;  2OTJ Q;  2F2V A;  2CJ9 A;  5ELN A;  4PJJ A;  2D9T A;  2CP3 A;  3M0U A;  1N6A A;  4H02 A;  1VQO A;  2DD4 A;  4OVA A;  2WAC A;  5KYX A;  2RNA A;  3FEO A;  1BIA A;  4YRQ A;  1VQM A;  1NPP A;  1Q82 R;  4RTU A;  3GF5 A;  2H3E B;  3PTA A;  2CZ0 B;  3UT1 A;  1YJ9 Q;  3QUI A;  1PC0 A;  3TEG A;  2EYY A;  3OBW A;  1PKS A;  1QVF P;  1WXT A;  4CRI A;  1ZX6 A;  5LJ5 f;  2ARU A;  1YFN A;  3BE3 A;  3X24 B;  2B86 A;  2OJ2 A;  2HBW A;  2DIQ A;  3P8B B;  4RCB A;  3C4S A;  2YHT A;  4JRQ A;  1KD1 R;  4LNS A;  2DXC A;  2V26 A;  3JCM Q;  1AHJ B;  1EIF A;  4Z89 A;  2PTK A;  4C8Q E;  4X9D A;  3OYE A;  4Z88 A;  4PJO A;  2FVU A;  1D0Y A;  3OB9 A;  3I56 T;  2DEQ A;  3OYM A;  1VQ7 A;  2AMC A;  1TUC A;  1ZUU A;  5KCO A;  3CCU A;  2RQW A;  3FLG A;  3PCO B;  2ATC B;  2EL9 A;  3QWY A;  1Z7M A;  1M8V A;  1K73 U;  4M4Z A;  1Q7Y C;  2DQ0 A;  3DB4 A;  2YUP A;  2LCS A;  2FPF A;  1B76 A;  1AZG B;  2XDD A;  1NJ6 A;  4DEX A;  4RTX A;  5KE3 A;  2M1H A;  4DOW A;  5CVI A;  3JB9 D;  2QQ9 A;  1VYU A;  4IUQ A;  2PU9 B;  3BFM A;  2O2O A;  4N0A A;  3HRI A;  3UFG A;  4H2V A;  1K9M C;  4KRT A;  3L42 A;  5GAN g;  3VS3 A;  3NTI A;  4YPF A;  2L0A A;  3ZBD A;  2A0F B;  2E12 A;  4JS5 A;  1K8A C;  4HVW A;  4IUT A;  4CI0 C;  2BE7 D;  2LC4 A;  2ZXF A;  3CCE A;  2P0P A;  2ART A;  2QHU A;  3MO8 A;  2CZ7 B;  2E5A A;  1PYS A;  3CXC A;  3AT1 B;  1W2B A;  1LVK A;  4XEO A;  1Q86 C;  4CS2 A;  1GBR A;  2OTJ A;  4C92 B;  5GAO m;  3QJY A;  1BI3 A;  3A8O B;  2ZIM A;  3ICA A;  2JOY A;  5CAI A;  1RIQ A;  3WVE B;  2L3P A;  1RAI B;  2E5K A;  1NJI U;  2QGG A;  3M0P A;  4OGC A;  1K8A R;  3I55 A;  3A7A A;  1KQ2 A;  3EGX B;  2K6D A;  3CXC S;  1W2B S;  5J26 A;  4EMK B;  1SRL A;  3IKM B;  4H2T A;  4M75 C;  2DL4 A;  1H3Z A;  2HD0 A;  3GBQ A;  5CQX A;  3REB B;  3JB9 H;  4PLL A;  3VUZ A;  3L2Q A;  3UGQ A;  4J9F A;  3OQ5 A;  2OTL Q;  5GMK h;  1CKA A;  3CEY A;  3QXE B;  1Z7N A;  1YI2 T;  1T3S A;  2LQ8 A;  3MEA A;  1KMM A;  4MZM A;  2SEM A;  2VGM A;  5HK3 A;  1H64 1;  2CUB A;  2QDL A;  4XK8 E;  4FYW B;  4HVV A;  2FZK B;  1T0H A;  3ZEH A;  1YWP A;  4ESR A;  1JRI A;  3OW2 P;  2JS0 A;  1FMV A;  2AHJ B;  1ADJ A;  2MMP A;  4C5E A;  3RL6 A;  1WLP B;  1USY A;  3HFN A;  1DJ7 B;  1FWZ A;  1UGP B;  4YRT A;  1SES A;  2EJ9 A;  4PHC A;  3P8H A;  2H8H A;  3MEU A;  4CH6 A;  1E24 A;  1PKT A;  2QQA A;  4C8Q G;  1W4S A;  2DFU A;  4P3P A;  1BI0 A;  3IAL A;  1D0X A;  5CCA A;  3MCA B;  1GCQ A;  1VIE A;  1SKU B;  2K79 A;  2E4H A;  1A0N B;  2SRC A;  3A8G B;  1ABQ A;  1G5H A;  3IQL A;  3CCQ T;  2RHX A;  1NJ2 A;  3CCV A;  2C0O A;  4TVY A;  3IG2 A;  2D0Q B;  3ZFJ A;  1NLO C;  4KQE A;  2QEX T;  3OS5 A;  3UGT A;  4C8Q B;  3CCL T;  1G51 A;  1WHK A;  4J9C A;  1B8A A;  3SWN A;  3EGX A;  2YLB A;  5D7U A;  5GAM e;  2ZT7 A;  3JV3 A;  2E5Q A;  8ATC B;  1QCN A;  2KYM A;  2DE0 X;  2YT6 A;  1OYX A;  1SER A;  3REU A;  2CP2 A;  2E3I A;  3HL8 A;  2KXD A;  4V2S A;  3E9F A;  2DIG A;  4D8K A;  3DB3 A;  5F5W A;  3LW5 E;  4J9G A;  1PYS B;  2CJA A;  4JPB W;  1Y0M A;  3TSZ A;  1H8K A;  4J83 A;  4ELZ C;  1I5L A;  1VQ5 T;  2HKQ B;  3CC2 A;  4ZN1 A;  1T3L A;  1U5S A;  1YIT Q;  4ZTF A;  2DIL A;  1RL2 A;  1TG0 A;  2DL8 A;  3TQ7 P;  2EJG A;  2QDY B;  4OB2 B;  5I21 A;  4M77 A;  3CPW S;  2QK0 A;  4M78 D;  4AT1 B;  2CDT A;  2DNU A;  5HGQ A;  1N9W A;  2DZC A;  1Q81 C;  3RMS A;  1ASY A;  4HCK A;  2F2W A;  4BI4 A;  3EG1 A;  3M0S A;  4FCY A;  2ZZF A;  5IN1 A;  2EYZ A;  4FU6 A;  1BBW A;  2DBM A;  4M75 A;  3OW2 A;  2O9S A;  1N8R R;  3M4P A;  2QGF B;  2ZZG A;  2FRY A;  4XAX B;  3CCR Q;  2Q7H A;  1TUG B;  1GFD A;  4LUD A;  5D6X A;  1K0S A;  4IUP A;  2P84 A;  4EX5 A;  1C0M A;  1N9R A;  3R6N A;  4M77 B;  2DL5 A;  2X35 A;  4YRF A;  2QTX A;  1MMG A;  1WGS A;  3V7R A;  2QHS A;  4OMO A;  1IHW A;  2LJ0 A;  2MF2 A;  1SRM A;  4MMK A;  4P74 A;  2MCN A;  1SSH A;  2VYT A;  3A8L B;  2PQW A;  4RG8 A;  4H2S A;  1R0C B;  1YJ9 A;  4HCC A;  2ED1 A;  2O01 E;  2RB6 A;  4OB0 B;  4EDU A;  4RUG A;  1E1O A;  2LTO A;  5FRM A;  1VQN T;  2VXE A;  5C53 B;  2RI3 A;  2NWM A;  1QCF A;  4N0A C;  3KXT A;  4JS4 A;  2J6O A;  2RMO A;  1YFR A;  2I4L A;  2O4X B;  1EX4 A;  1VQM T;  2DDZ A;  1WLE A;  2EFI A;  2OAU A;  4HT8 A;  1EIY B;  4KR3 A;  4F17 A;  5GAN 4;  4CS4 A;  2CYZ B;  4QQD A;  2KE9 A;  1PM3 A;  2DXT A;  1D3B B;  1OU9 A;  3R07 A;  1YFT A;  2K2M A;  3FJ5 A;  3NMZ C;  2L3Q A;  4JJB A;  2RPN A;  1U1S A;  1EQR A;  3CCM T;  1YBY A;  2GF7 A;  2L3R A;  4Y28 E;  2M16 A;  2MIO A;  4P3N A;  4QKU A;  4JJC A;  3FDR A;  3J7A F;  1VQ6 Q;  2GGR A;  3C12 A;  4ZTJ A;  4NL2 A;  4H2X A;  1OX8 A;  5FRN A;  3QZ5 B;  4ORZ A;  3A8M B;  5GAM d;  3DLL A;  1BI2 A;  5KE2 A;  4VUB A;  1SHG A;  2K5I A;  4HWT A;  1AOJ A;  5FWB A;  3H41 A;  2KT1 A;  1UGV A;  1VQP T;  1NEB A;  3CC4 T;  1K8A U;  2R57 A;  2KRM A;  2GTJ A;  4GBQ A;  3NPF A;  4M77 F;  3CCM A;  4Q6G A;  5FU6 C;  1VQN A;  1UGR B;  3VQW A;  4RKU E;  1M27 C;  4OMP A;  2JW4 A;  2RHI A;  3CD6 A;  2JS2 A;  1WHJ A;  3HHT B;  4BDZ A;  3CCQ A;  3L4G A;  2DVE A;  4K86 A;  2F5T X;  3JCM W;  5GAM h;  4HT4 A;  4P3O A;  1PSE A;  4AFS C;  2FZG B;  5M9O A;  2CIM A;  4C8Q F;  3AHU A;  1UJ0 A;  4LVM A;  5IAY A;  3OW2 S;  2EQJ A;  2DBK A;  4J9I A;  4C92 D;  3F70 A;  5FU7 B;  3CXC P;  1W2B P;  2AKW A;  1M9S A;  1ZBJ A;  2PZ1 A;  4X5O A;  3GNF B;  4J9D A;  1QMC A;  1VQ6 A;  4O2D A;  2KQW A;  1HD3 A;  2CH4 A;  1VQ9 Q;  2ZPE B;  2COY A;  4WJ3 M;  4BUG A;  2COZ A;  3QDF A;  4PFP A;  3V7C A;  3CME Q;  1H4Q A;  2YUO A;  2IG0 A;  2NUT A;  3PGG A;  4H2Y A;  4JDS A;  4E47 A;  3JB9 I;  4CC3 A;  1AT1 B;  1YJW A;  3DLM A;  5CR2 A;  3H8Z A;  4E7S A;  1YCS B;  3RKY A;  1G5V A;  1VQ6 T;  3LYI A;  5FU6 B;  2EQK A;  2LMJ A;  2FZC B;  1UE9 A;  3RKX A;  1XJW B;  3QDR B;  4HA8 A;  4H2U A;  3M58 A;  1QLY A;  3QKJ A;  4LDU A;  4PJL A;  4YRR A;  4MZT A;  1LOJ A;  2F1L A;  4E7K A;  1PWT A;  1ZBX A;  3LGF A;  2R5M A;  4TVA B;  2HCK A;  4LNP A;  4J9E A;  2QA4 Q;  2DL3 A;  5CQY A;  2M02 A;  1JJC B;  5GMK e;  1B7Y B;  4F7U E;  2ZNI A;  2BZ8 A;  3NFC A;  1KHI A;  1VQM Q;  1OV3 A;  2BKD N;  3JAM E;  3VRY A;  2ARS A;  1C6V X;  4N4G A;  1VQ9 T;  1M90 R;  1AD5 A;  4PJO F;  2J7I A;  3VUB A;  2C7I A;  3UPU A;  4M7D E;  2MWO A;  1X2G A;  2EIF A;  4EPC A;  1HTT A;  4YRJ A;  3M55 A;  4XTU A;  5KYW A;  4CC2 A;  3M53 A;  2CT4 A;  4HVC A;  1VQZ A;  2OTJ T;  1PD1 A;  4YRO A;  2PME A;  1WNL A;  3REX A;  1IRE B;  1WIE A;  3G71 A;  5I2M A;  2D6F A;  4C0D B;  2MAM A;  2QHV A;  4RTW A;  2BZX A;  1M1K R;  3RGL A;  1W70 A;  3EG3 A;  4PK4 A;  5IXF A;  2A8E A;  1NZ9 A;  2HDA A;  3UWN A;  3V8L A;  4LUE A;  2X3W D;  3HXZ A;  3OS0 A;  2DET A;  4ZIB A;  3CC4 Q;  1GL5 A;  2AK5 A;  1VQP Q;  2XGT A;  4H2W A;  2VGN A;  4FYV B;  3P8V A;  2G6F X;  2VV5 A;  1B34 B;  2KNB B;  1K73 C;  4RCC A;  1J5W A;  3MET A;  3QG1 A;  3D7S B;  4OMQ A;  1H92 A;  2ZR3 A;  2O9V A;  3JCM J;  4P75 C;  3INZ A;  4AFU C;  1X54 A;  2F2X A;  2F5K A;  3G71 Q;  2ZPI B;  2C0I A;  4JRK A;  4PJN A;  3FJP A;  1MMD A;  3EH2 A;  5KYU B;  2FYK A;  2QAZ A;  3E9I A;  2AT1 B;  3Q1J A;  3I56 A;  4J6W A;  1NYQ A;  5C51 B;  2D0N A;  2RHS B;  4K88 A;  1U3O A;  1G2B A;  1KD1 C;  5GAN 7;  2FPD A;  5LJ3 e;  1KD1 U;  2XTI A;  1D1A A;  3HFZ B;  2K57 A;  1JXO A;  2CKK A;  1R8O B;  1K0X A;  5I11 A;  2ZR2 A;  1OZ3 A;  2KRN A;  3JCM f;  3CCV Q;  3RBB B;  3EHR A;  3OYF A;  3CCL Q;  1GXI E;  3TEE A;  2ZGW A;  3VS7 A;  1JXM A;  3VU3 C;  4FM4 B;  5D6W A;  1Q86 U;  5HK0 A;  3O5Z A;  2IPO B;  2X4Y A;  1VQ8 A;  1K76 A;  4M7D A;  1Y96 A;  3CMA T;  4M7A A;  5DM7 R;  2QQR A;  3PZC A;  4JZ4 A;  3A32 A;  1RAE B;  4NOY A;  4D8D A;  1W66 A;  2M0O A;  4GY5 A;  2ODR C;  1VQO Q;  3SDZ A;  1VQO T;  1VUB A;  3G4S A;  2ZCF B;  1G3W A;  2YLC A;  3TSW A;  2DF6 A;  2JTE A;  1N5Z A;  4RMO A;  3RER A;  4X34 A;  5K1P A;  4IUV A;  3CC2 T;  2DL7 A;  1Q82 C;  4ZGE B;  1OZ2 A;  4C92 C;  2CP6 A;  4M78 A;  2R58 A;  4LVK A;  1L0W A;  4P74 C;  2F69 A;  4LXC A;  1IHV A;  3OYJ A;  1GFC A;  2GBQ A;  1UG1 A;  1G83 A;  4F7U B;  4AG1 C;  3H0I A;  5CKE A;  3S3O A;  4Q15 A;  4YRI A;  2HAX A;  2XHC A;  4DA4 A;  2WSF E;  2V1R A;  4P72 C;  3G4S T;  2K7A A;  3FRN A;  2LCC A;  4C8Q C;  2YUQ A;  3MP8 A;  3IKL A;  3QTC A;  4M7D B;  1RLQ C;  2RH2 A;  2V1Q A;  3M57 A;  3MEY A;  1X2K A;  5IT9 E;  5LJ3 j;  5AT1 B;  1TUD A;  1KQS P;  2DXB A;  3X26 B;  4BY6 B;  1P92 A;  2DM1 A;  2ALY A;  2M0Y A;  3NGP A;  2JTF A;  1VIF A;  1M3B A; 
#chains in the Genus database with same CATH homology
 4GLK A;  4L59 A;  4M77 C;  3I7F A;  4R55 A;  4ZGJ B;  1G3T A;  4E7H A;  5GAN 2;  4JUV A;  2RHS A;  4PKC C;  2PUO B;  1WU7 A;  4C0G A;  3RUX A;  1IL2 A;  3MF2 A;  1ASZ A;  2DQ3 A;  3OYL A;  3L2U A;  2JNG A;  3JSC A;  4YDQ A;  4HKE A;  4YRM A;  1KQ1 A;  3M9Q A;  3SB2 A;  2DD5 A;  5CK9 A;  2ZIN A;  1D3B A;  1X55 A;  1X01 A;  1Y7X A;  5HY6 A;  2QQS A;  3ME9 A;  4P73 C;  3SFM A;  2Q5H A;  2DXU A;  3CCJ A;  4LDV A;  2I4M A;  5LJ5 e;  4YRS A;  3CC7 A;  4TQD A;  1HC7 A;  3BY7 A;  3GNG A;  3HXX A;  4YRL A;  3V8K A;  5EG2 A;  3OS2 A;  4RDX A;  4EO4 A;  3CC4 A;  3OY9 A;  4J7F A;  1I81 A;  4M78 F;  2KY9 A;  2AKW B;  3E1S A;  1VQ8 T;  1USY C;  2OTL T;  3HFO A;  5GAM j;  4N4H A;  1ZHI A;  1VQ4 T;  2CZ1 B;  1N8R C;  4BE1 A;  3L2V A;  1YIJ A;  4BI8 B;  2VXF A;  4EMG A;  2V8J A;  3CCL A;  3OYG A;  1WJQ A;  1E22 A;  3G6E A;  2RI5 A;  3OD1 A;  5KNN A;  3TCJ A;  2XDB A;  4DPG A;  4HWS A;  4F7U G;  2Y4Y A;  4KUI A;  3PIP A;  3G1Z A;  3TEH A;  4TVA A;  3CBO A;  3CBP A;  4M7A E;  3HXU A;  4LDW A;  2JVV A;  2GCX A;  3OSS C;  4P5N A;  4L6V 5;  3OYY A;  2ZZE A;  5LJ3 h;  2QA4 A;  3HTZ A;  4TVW A;  3HFZ A;  5FLX E;  1QVG A;  4XU3 A;  1M1G A;  1M1K U;  2J3M A;  5LJ5 j;  3ERR A;  4WI1 A;  4N4I A;  4OGE A;  5LJ5 g;  4YRP A;  3NET A;  2E64 A;  4M77 E;  3L1A A;  2KSS A;  3QO5 A;  1G3Y A;  4QW2 A;  3UH0 A;  3ER0 A;  1B70 A;  2DAQ A;  1NYR A;  3CCR A;  4YP0 A;  2YRV A;  1JJ2 S;  1YGB A;  4CS3 A;  1EIY A;  2ZIO A;  2K2V A;  1BIB A;  4M75 G;  3G6E T;  4M7A C;  4TWA A;  4F7U F;  3NTH A;  1WQ7 A;  3WVD B;  1Y07 A;  1QE0 A;  3MEW A;  4B9X A;  2NS6 A;  2L5Q A;  5A2Q E;  4NL3 A;  2V8I A;  1VQ9 A;  1VQ4 A;  4A53 A;  1WQW A;  3CPF A;  4P71 A;  2L8D A;  2B8A A;  3JCM b;  4YTL A;  1ADY A;  2DZ9 A;  1QVP A;  4FL6 A;  5GAM g;  2A7Y A;  4E7L A;  2ZPG B;  3O8V A;  1KQS A;  2FL7 A;  2K3X A;  3A5Z B;  4HWO A;  3BJU A;  3QYH B;  4Y91 A;  4OMF B;  3GLX A;  3MF1 A;  4CH3 A;  3LX7 A;  1Q82 U;  3CCE T;  3M59 A;  1VQ5 A;  2VC8 A;  4P72 A;  4BD3 A;  4RQF A;  2JTM A;  4PL6 A;  4EMH A;  4XTV A;  5GAO n;  3QPH A;  5J39 A;  4EMK A;  3OYI A;  4RQE A;  4A4H A;  4IUU A;  3LWH A;  4WF2 A;  1LJO A;  4CH5 A;  5DLO A;  4FIB A;  4YRG A;  1LYL A;  2O4X A;  3HPW A;  2IVW A;  3M54 A;  1X6O A;  4PJO G;  4C92 A;  4OB1 B;  2GFA A;  2Y4X A;  3URG A;  3RIR A;  4KUD K;  2RO0 A;  1KMN A;  5GAN f;  4RMF A;  3HRK A;  4JRP A;  4YRC A;  3A8H B;  5A0G A;  3L2Z A;  3TRE A;  3SWN B;  1HXD A;  3NEL A;  4YYE A;  1YIJ T;  1WJS A;  1FXX A;  4JLG A;  3P8D A;  2NLU A;  4C5I A;  1M90 C;  3JCM c;  3PMI A;  2LCL A;  5LJ3 d;  1YI2 A;  3A5Z A;  4BDY A;  1XNI A;  3CME T;  3L4G B;  3JCM X;  5GAN j;  3JB9 G;  3EFS A;  2XG8 D;  1EOV A;  4XTY A;  4YRK A;  2FB7 A;  4JRI A;  3PFS A;  2JN0 A;  4C5G A;  4FT2 A;  4P75 A;  4OB3 B;  3RKW A;  1M1K C;  3CME A;  2E6Z A;  2OTL A;  3KBG A;  1S72 T;  3A5Y A;  2RJE A;  2LT1 A;  4OF1 A;  2HNI A;  4H2X B;  2DTH A;  3N5B B;  4LVL A;  3GOX A;  2DTI A;  4J6X A;  4M77 D;  4ZN3 A;  1GGM A;  2EYQ A;  2RJF A;  2E3C A;  2M9U A;  4KBM B;  3R6O A;  2JUF A;  4C8Q A;  4C0F A;  1YJW T;  4OLF A;  1MHN A;  4M75 D;  3BDL A;  5CO7 A;  2G4C A;  1N8R U;  4Z02 A;  3LGL A;  1NJI C;  4UP8 A;  12AS A;  1IZ6 A;  2EQM A;  2ZPH B;  3A74 A;  1PSF A;  1EVK A;  4M7A D;  2E41 A;  4FT4 A;  3CPW A;  4A4G A;  2RHQ B;  4UP7 A;  2WSC E;  2ZT5 A;  2I2L A;  4ME7 A;  4LVI A;  3OSV A;  1I4K 1;  3CCU T;  3PNW C;  2XI9 A;  3DSQ A;  4HCB A;  4MML A;  4OP0 A;  3M5A A;  4RG2 A;  2I4O A;  4C92 G;  1ZQ1 A;  1O9S A;  3QJ6 A;  1M5Q 1;  5C6S A;  1XOV A;  4M7D C;  5HKC A;  1JBM A;  3NEM A;  4MDX A;  2H3J A;  5GAO q;  1S72 A;  1E1T A;  1VQK T;  4M7D D;  3OMC A;  5CKH A;  4QVD A;  2AMC B;  2DK3 A;  3OYC A;  2Q5I A;  5GAO r;  1Q81 U;  2ZPF B;  4O6J A;  1NJ5 A;  4HWP A;  2EJF A;  2EQU A;  3TUP A;  2RHQ A;  3HP9 A;  2ODR D;  1Y71 A;  1TH7 A;  5J3B A;  2J3L A;  2ZPB B;  1U1T A;  3EFR A;  5C0M A;  4EMK C;  4KT0 E;  5LJ5 h;  2E1H A;  2RK2 A;  4ZTZ B;  3QII A;  4ZGD B;  2CGH A;  3HRT A;  4JJN K;  5GMK m;  4J6Y A;  5GAM f;  2V8K A;  3RAC A;  3FB9 A;  3H6Z A;  3KFU A;  4J5Y A;  3P8Y A;  2LDM A;  4XTW A;  5FU7 C;  4FSX A;  2RJC A;  2PVG B;  1C0A A;  2XK0 A;  4UPA A;  2RJD A;  1K9M U;  3RES A;  3OMG A;  1N27 A;  4XEM A;  4QQ6 A;  2KMT A;  2ZNJ A;  3BW1 A;  3JCM V;  3PCO A;  4PJO E;  4P71 C;  3OYH A;  2KVQ G;  4DOV A;  4QVC A;  2QQB A;  4ATO A;  4UP9 A;  2RA2 A;  4LD9 K;  4BW9 A;  2LT4 A;  4NCX A;  4ZTU B;  3TEH B;  3E19 A;  2RHY A;  1NJ8 A;  3VV0 A;  3QSU A;  3SD4 A;  4BAC A;  3CD6 T;  3PMT A;  2P4T A;  2K5F A;  3S3M A;  1N9S A;  1V29 B;  4XU2 A;  4Q5W A;  5GAN d;  1VQP A;  1H4V B;  2DO3 A;  2DPP B;  4LDX A;  1OI1 A;  4F7U A;  4AH6 A;  4C92 E;  3LLR A;  1O75 A;  2DJZ A;  1SET A;  3V7S A;  1BKB A;  4C5H A;  3CMQ A;  3HXY A;  3JB9 F;  4YRE A;  3I55 T;  2E70 A;  1B70 B;  2XID A;  3MP1 A;  3VYG A;  1NNH A;  5GAO l;  3NEN A;  4ELY C;  1M90 U;  1H4T A;  5CIU A;  5GAN h;  4BB7 A;  2Q7G A;  4G85 A;  4MZP A;  3TU4 K;  3CCJ T;  1HK9 A;  1YIT A;  5LJ3 f;  1WYD A;  4D6W A;  5E3I A;  4C0D C;  3BDU A;  1KC8 C;  4O5V A;  1G5I A;  3JCM e;  1YIT T;  1KQS S;  2DTO A;  1UEB A;  2IY5 B;  3GP8 A;  2EWN A;  2RHZ A;  1VQ7 T;  2XIC A;  3QZ9 B;  3CBM A;  1YJ9 T;  2LNV A;  2I4N A;  4BE0 A;  2E10 A;  5DY9 A;  11AS A;  5CKF A;  2ZZD A;  4BI3 A;  1BBU A;  1I8F A;  1FX7 A;  1WJR A;  5GMK j;  3L2W A;  4PG3 A;  4BY6 C;  2XU8 A;  5A0D A;  5GAO p;  2QI2 A;  3M4G A;  4XTX A;  1M1F A;  5GAN 3;  2DU5 A;  2X4X A;  1YHQ T;  1M4Z A;  2VUB A;  4LD6 A;  5GAN 6;  1JJ2 A;  1ATI A;  1UGQ B;  4KUL A;  3GPL A;  1H4S A;  4XU1 A;  3UDC A;  2LX9 A;  3LSS A;  3WQZ A;  3E9G A;  3FIF A;  4PJO B;  3GIB A;  3LSQ A;  4HWR A;  2GQV A;  2CJB A;  3VQV A;  3SWN C;  2QHT A;  2PVO B;  5FRO A;  4PNO A;  4P73 A;  4YCV A;  3MQZ A;  4A4F A;  3OYK A;  3S6W A;  1SSF A;  2PMF A;  2K3Y A;  5DLQ E;  2K4Y A;  4C0Z A;  4J7I A;  4KR2 A;  4II1 A;  3LH0 A;  5GAN 8;  2MWP A;  1QP2 A;  4L87 A;  4M78 B;  3JCM g;  3JCM d;  2PVD B;  2RM4 A;  5KCH A;  2LVM A;  2LRQ A;  4M78 E;  3CC7 T;  3QO7 A;  1KOG A;  1QF6 A;  3QBY A;  4M78 G;  1MGQ A;  4CH4 A;  4PJO C;  4A4K A;  3ASK A;  4LDY A;  2XDP A;  5LJ5 d;  2GFU A;  1JJC A;  2HQE A;  1Q7Y U;  2DKG A;  3HFV A;  3PIO A;  2ALY B;  1G3S A;  1WPY A;  3QYG B;  1QVF S;  3MP6 A;  5GAN 5;  5I2S A;  2IY5 A;  2RD1 A;  2X4W A;  2PUK B;  4G84 A;  4LVJ A;  5GMK l;  3CCS T;  4M75 E;  2ZTG A;  3PT9 A;  3X28 B;  4UC4 A;  3X25 B;  4YCW A;  3LC0 A;  1YFS A;  3VJP A;  3HRU A;  4M78 C;  2QXF A;  4QQG A;  4DQ2 A;  2HBP A;  2K5L A;  1VQL T;  2KAF A;  4QVZ A;  1YCY A;  1QP3 A;  1QVG S;  2A3L A;  1U8R A;  3EAE A;  2LQK A;  3OA6 A;  4NS5 A;  3OYN A;  2C06 A;  2P0Q A;  3MHX A;  3FC3 A;  1XTD A;  3VKI A;  2EAY A;  4TQF A;  3OYD A;  4BE2 A;  2JZ2 A;  1YHQ A;  3VQY A;  2BUD A;  4J15 A;  3E9H A;  4XU0 A;  3J81 E;  4WJ4 A;  4XQ3 A;  1BYM A;  1Y96 B;  1EFW A;  3LWI A;  4J8O A;  2BIV A;  3M4Y A;  4PJO D;  3CCS A;  3M4Q A;  4HCZ A;  1BI1 A;  5CKD A;  3X20 B;  2Q7E A;  3OBY A;  3HKS A;  3RMQ A;  3QNE A;  1XQH A;  3P8T A;  1NE8 A;  2WSE E;  5GMK i;  1SRY A;  2R5A A;  3A31 A;  3VBB A;  2RHU A;  3L2R A;  1KHC A;  4BWA A;  4MDW A;  4R56 A;  2DU7 A;  3HY0 A;  2MI6 A;  3CMA A;  1VQK A;  3WXM B;  3J80 E;  1QW1 A;  4TTV A;  2X4J A;  3W3S A;  2P0L A;  2ZCE A;  1B34 A;  2KK4 A;  4M7D G;  5K1X A;  4M75 F;  3A7R A;  3JCM P;  3HSB A;  4K87 A;  4JLI A;  1X56 A;  3CCR T;  4M7A F;  4M7A G;  4HT9 A;  3HXW A;  1KC8 U;  2G3R A;  5ELO A;  3OYB A;  3OYA A;  5LJ3 g;  1VQL A;  4C8Q D;  2QEX A;  5L8R E;  2Y90 A;  1UB4 A;  2KDS A;  2L89 A;  3CCV T;  4E7J A;  2FHD A;  2QA4 T;  4C92 F;  2RI2 A;  2E6N A;  4A4E A;  1JB0 E;  4A54 A;  3VYH B;  4YRN A;  1NJ1 A;  3S3N A;  3HY1 A;  3JRZ A;  1RI0 A;  3V8J A;  2ZT6 A;  1LNX A;  1NPR A;  3VQX A;  5C52 B;  3M56 A;  2XD0 A;  4X9C A;  2C8M A;  4TVR A;  1EVL A;  1UGS B;  2CS7 A;  2P0K A;  3G71 T;  2EKO A;  1X2H A;  1X75 C;  5D6Y A;  5AYF A;  1QVF A;  3MEV A;  4M75 B;  3RF1 A;  3HXV A;  3QO3 A;  2ZT8 A;  2E65 A;  2P5I A;  4PLI A;  3G7Z A;  4IUR A;  3KUF A;  3C95 A;  4YCU A;  2XKO C;  4L5G A;  4M7A B;  4M7D F;  1B7Y A;  2RK1 A;  4XTZ A;  3NTK A;  5LL6 S;  3C94 A;  3DKM A;  4E7I A;  1FYF A;  3QHS A;  5CKB A;  4M77 G;  5KH6 A;  3JB9 J;  3A7U A;  3T9N A;  4E51 A;  4B9W A;  3JCM h;  1YB3 A;  3QO8 A;  1YJN A;  1YJN T;  2HQX A;  2CZ6 B;  3HRS A;  3OS1 A;  1KG1 A;  5A0L A;  4IKF A;  5GAN e;  2CJ9 A;  5ELN A;  2D9T A;  1N6A A;  4H02 A;  1VQO A;  2DD4 A;  4OVA A;  2WAC A;  3FEO A;  1BIA A;  4YRQ A;  1VQM A;  1NPP A;  3GF5 A;  3PTA A;  2CZ0 B;  3UT1 A;  3QUI A;  3TEG A;  3OBW A;  4CRI A;  5LJ5 f;  2ARU A;  3X24 B;  2DIQ A;  3P8B B;  4LNS A;  4RCB A;  3C4S A;  2YHT A;  4JRQ A;  2DXC A;  3JCM Q;  1AHJ B;  1EIF A;  4C8Q E;  4X9D A;  3OYE A;  4PJO A;  2FVU A;  3OB9 A;  3I56 T;  2DEQ A;  3OYM A;  1VQ7 A;  2AMC A;  5KCO A;  3CCU A;  3FLG A;  3PCO B;  2EL9 A;  1Z7M A;  1M8V A;  1K73 U;  1Q7Y C;  2DQ0 A;  3DB4 A;  1B76 A;  2XDD A;  1NJ6 A;  5KE3 A;  2M1H A;  4DOW A;  5CVI A;  3JB9 D;  2QQ9 A;  4IUQ A;  2PU9 B;  3BFM A;  4N0A A;  3HRI A;  3UFG A;  4H2V A;  1K9M C;  3L42 A;  5GAN g;  3NTI A;  4YPF A;  3ZBD A;  2E12 A;  4JS5 A;  1K8A C;  4IUT A;  4CI0 C;  2LC4 A;  2ZXF A;  3CCE A;  2P0P A;  2ART A;  2QHU A;  3MO8 A;  2CZ7 B;  2E5A A;  1PYS A;  3CXC A;  1W2B A;  4XEO A;  1Q86 C;  4CS2 A;  2OTJ A;  4C92 B;  5GAO m;  3QJY A;  1BI3 A;  3A8O B;  2ZIM A;  3ICA A;  2JOY A;  5CAI A;  1RIQ A;  3WVE B;  1NJI U;  4OGC A;  3I55 A;  3A7A A;  1KQ2 A;  3CXC S;  1W2B S;  5J26 A;  4EMK B;  3IKM B;  4H2T A;  4M75 C;  1H3Z A;  2HD0 A;  5CQX A;  3JB9 H;  4PLL A;  3VUZ A;  3L2Q A;  3UGQ A;  3OQ5 A;  5GMK h;  3CEY A;  3QXE B;  1Z7N A;  1YI2 T;  2LQ8 A;  3MEA A;  1KMM A;  4MZM A;  2VGM A;  5HK3 A;  1H64 1;  4XK8 E;  3ZEH A;  1JRI A;  2AHJ B;  1ADJ A;  2MMP A;  4C5E A;  3RL6 A;  1USY A;  3HFN A;  1DJ7 B;  1FWZ A;  1UGP B;  4YRT A;  1SES A;  2EJ9 A;  4PHC A;  3P8H A;  3MEU A;  4CH6 A;  1E24 A;  2QQA A;  4C8Q G;  1W4S A;  4P3P A;  1BI0 A;  3IAL A;  5CCA A;  3MCA B;  1VIE A;  3A8G B;  1G5H A;  3CCQ T;  1NJ2 A;  2RHX A;  3CCV A;  4TVY A;  3IG2 A;  2D0Q B;  3ZFJ A;  4KQE A;  2QEX T;  3OS5 A;  3UGT A;  4C8Q B;  3CCL T;  1G51 A;  1B8A A;  3SWN A;  2YLB A;  5GAM e;  2ZT7 A;  2E5Q A;  1OYX A;  1SER A;  3REU A;  3HL8 A;  4V2S A;  3E9F A;  2DIG A;  3DB3 A;  5F5W A;  3LW5 E;  1PYS B;  2CJA A;  4ELZ C;  4J83 A;  1I5L A;  1VQ5 T;  3CC2 A;  4ZN1 A;  4ZTF A;  1RL2 A;  2EJG A;  2QDY B;  4OB2 B;  5I21 A;  4M77 A;  3CPW S;  4M78 D;  5HGQ A;  1N9W A;  2DZC A;  1Q81 C;  3RMS A;  1ASY A;  4BI4 A;  2ZZF A;  5IN1 A;  1BBW A;  4FU6 A;  4M75 A;  3OW2 A;  3M4P A;  2ZZG A;  4XAX B;  2Q7H A;  5D6X A;  4IUP A;  4EX5 A;  1N9R A;  4M77 B;  2X35 A;  4YRF A;  2QTX A;  3V7R A;  1WGS A;  2QHS A;  2MF2 A;  4MMK A;  4P74 A;  2VYT A;  3A8L B;  2PQW A;  4RG8 A;  4H2S A;  1YJ9 A;  4HCC A;  4OB0 B;  2O01 E;  2RB6 A;  4EDU A;  1E1O A;  2LTO A;  5FRM A;  1VQN T;  2VXE A;  5C53 B;  2RI3 A;  4N0A C;  3KXT A;  4JS4 A;  1YFR A;  2I4L A;  2O4X B;  1VQM T;  2DDZ A;  1WLE A;  2EFI A;  2OAU A;  4HT8 A;  1EIY B;  4KR3 A;  5GAN 4;  4CS4 A;  2CYZ B;  4QQD A;  2DXT A;  1D3B B;  3R07 A;  1YFT A;  1U1S A;  1EQR A;  3CCM T;  1YBY A;  2GF7 A;  2L3R A;  4Y28 E;  2M16 A;  4P3N A;  3FDR A;  3J7A F;  3C12 A;  4ZTJ A;  4NL2 A;  4H2X A;  5FRN A;  3QZ5 B;  3A8M B;  5GAM d;  3DLL A;  1BI2 A;  5KE2 A;  4VUB A;  2K5I A;  4HWT A;  1VQP T;  3CC4 T;  1K8A U;  2R57 A;  4M77 F;  3CCM A;  4Q6G A;  5FU6 C;  1VQN A;  1UGR B;  3VQW A;  4RKU E;  2RHI A;  3CD6 A;  3HHT B;  4BDZ A;  3CCQ A;  3L4G A;  2DVE A;  4K86 A;  2F5T X;  3JCM W;  5GAM h;  4HT4 A;  4P3O A;  1PSE A;  5M9O A;  2CIM A;  4C8Q F;  3AHU A;  4LVM A;  5IAY A;  3OW2 S;  2EQJ A;  4C92 D;  3F70 A;  5FU7 B;  2AKW A;  1M9S A;  4X5O A;  3GNF B;  4O2D A;  1VQ6 A;  2KQW A;  2ZPE B;  4WJ3 M;  4BUG A;  3V7C A;  1H4Q A;  2IG0 A;  3PGG A;  4H2Y A;  4JDS A;  4E47 A;  3JB9 I;  1YJW A;  3DLM A;  5CR2 A;  3H8Z A;  1G5V A;  3RKY A;  1VQ6 T;  3LYI A;  5FU6 B;  2EQK A;  3RKX A;  3QDR B;  4HA8 A;  4H2U A;  3M58 A;  3QKJ A;  4LDU A;  4YRR A;  4MZT A;  1LOJ A;  4E7K A;  1ZBX A;  3LGF A;  2R5M A;  4TVA B;  5CQY A;  1JJC B;  5GMK e;  1B7Y B;  4F7U E;  2ZNI A;  3NFC A;  1KHI A;  2BKD N;  3JAM E;  2ARS A;  4N4G A;  1VQ9 T;  4PJO F;  3VUB A;  2C7I A;  3UPU A;  4M7D E;  2MWO A;  1X2G A;  2EIF A;  4EPC A;  1HTT A;  4YRJ A;  3M55 A;  4XTU A;  3M53 A;  4HVC A;  1VQZ A;  2OTJ T;  4YRO A;  2PME A;  1WNL A;  3REX A;  1IRE B;  3G71 A;  5I2M A;  2D6F A;  4C0D B;  2MAM A;  2QHV A;  3RGL A;  2A8E A;  1NZ9 A;  3UWN A;  3V8L A;  3HXZ A;  3OS0 A;  4ZIB A;  2XGT A;  4H2W A;  2VGN A;  3P8V A;  2VV5 A;  1B34 B;  1K73 C;  4RCC A;  1J5W A;  3MET A;  3QG1 A;  2ZR3 A;  3JCM J;  4P75 C;  3INZ A;  1X54 A;  2F5K A;  2ZPI B;  4JRK A;  3FJP A;  2FYK A;  3E9I A;  3Q1J A;  3I56 A;  4J6W A;  1NYQ A;  5C51 B;  2RHS B;  4K88 A;  1KD1 C;  5GAN 7;  5LJ3 e;  1KD1 U;  2XTI A;  3HFZ B;  2K57 A;  2CKK A;  1R8O B;  2ZR2 A;  1OZ3 A;  3JCM f;  3OYF A;  1GXI E;  3TEE A;  2ZGW A;  3VU3 C;  4FM4 B;  5D6W A;  1Q86 U;  5HK0 A;  2X4Y A;  1VQ8 A;  4M7D A;  1Y96 A;  3CMA T;  4M7A A;  5DM7 R;  2QQR A;  3PZC A;  3A32 A;  4NOY A;  1W66 A;  2M0O A;  4GY5 A;  2ODR C;  3SDZ A;  1VQO T;  1VUB A;  3G4S A;  2ZCF B;  1G3W A;  2YLC A;  4RMO A;  3RER A;  4X34 A;  5K1P A;  4IUV A;  3CC2 T;  1Q82 C;  4ZGE B;  1OZ2 A;  4C92 C;  2R58 A;  4M78 A;  4LVK A;  1L0W A;  4P74 C;  2F69 A;  3OYJ A;  4F7U B;  5CKE A;  3S3O A;  4Q15 A;  4YRI A;  2HAX A;  2XHC A;  4DA4 A;  2WSF E;  4P72 C;  3G4S T;  3FRN A;  2LCC A;  4C8Q C;  3MP8 A;  3IKL A;  3QTC A;  4M7D B;  2RH2 A;  3M57 A;  3MEY A;  5IT9 E;  5LJ3 j;  2DXB A;  3X26 B;  4BY6 B;  1P92 A;  2ALY A;  2JTF A;  1VIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...