4XTWA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 94
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtwA01
1N9WA 4M7DE 4M78C 3HXUA 5GAOp 3A7UA 4YRNA 2DXUA 5C53B 3PCOA 3JCMb 3HTZA 3REXA 2EJ9A 4X5OA 4E51A 2DJZA 3BFMA 4YRTA 4K88A 4G84A 3L2ZA 3JCMh 4WJ4A 5DY9A 5F5WA 3A74A 4YCUA 5CAIA 3L4GB 4H2VA 5LJ3h 2JN0A 2CJ9A 1H4TA 4RMFA 2ZNJA 2RB6A 4M77G 4EO4A 1JBMA 2DZ9A 3QHSA 3JCMe 1NNHA 2AKWB 4C8QB 4M7DC 4QVDA 2EJGA 4UP7A 4HWSA 5LJ3e 4H2SA 3JCMc 4C8QE 4YRFA 4PJOD 1WYDA 4TVYA 4H2WA 4PHCA 4M7AA 3RACA 4P74C 1RIQA 3HSBA 3RF1A 4HVCA 2DKGA 1X01A 1YFTA 4J6WA 4AH6A 1E1TA 3FB9A 2CGHA 5GAMf 1QE0A 3JCMQ 5KNNA 2AMCB 2E10A 3MF1A 4EMHA 5GANg 4YRSA 1ASZA 5GANf 3A31A 2DQ0A 1KOGA 4N0AA 3V8LA 1ASYA 1EQRA 4M7AG 3QTCA 1ADYA 1QF6A 1YFSA 4F7UA 1JRIA 1USYC 4XTWA 3QO3A 1N9RA 4MMKA 3E9IA 4CS3A 2IY5B 1WQWA 1G5IA 3IALA 2YLBA 1J5WA 2ZZFA 4C8QC 4UPAA 3JB9H 3NENA 1YCYA 1G51A 5E3IA 2QHVA 4KR3A 4J6YA 4C92A 12ASA 5GAMe 4Q15A 4DQ2A 2Q7EA 2AKWA 5I21A 4M75F 2ARSA 4F7UG 2DXTA 3FJPA 4XTYA 4XU0A 2ARUA 4NOYA 1TH7A 2DQ3A 4XU1A 1NJ8A 4NCXA 3PCOB 4ZTUB 4OLFA 4MMLA 5GAN7 2ZTGA 3A7RA 1H4QA 3JB9F 4C92G 4JRIA 3UFGA 4PNOA 5GAOq 2ZR2A 4ZIBA 5LJ5e 1KMMA 3LC0A 3LSSA 1EVLA 2VC8A 3HFVA 3EFRA 3RKYA 4L87A 2E65A 1LNXA 2I4MA 2FYKA 4Y91A 3RKXA 4K87A 2DU7A 3HFOA 2RHSB 2RM4A 4OP0A 4P72C 1EFWA 2G4CA 2ZXFA 5GMKl 4YRCA 3P8TA 4G85A 4YREA 2ZGWA 4PJOF 4RQFA 1L0WA 1SESA 5GAOn 4HT8A 4YRKA 1ATIA 1B34A 1YGBA 2EL9A 1B70A 3ERRA 3IKLA 3P8YA 3VBBA 4M7AE 2EJFA 3SB2A 4TTVA 4YRGA 4JUVA 5GMKh 2ODRC 1M8VA 3IKMB 4P3OA 3BDUA 3ICAA 4M75D 1LOJA 4WF2A 3KFUA 4H2UA 5GMKm 4M78D 5LJ3j 2DTOA 5ELNA 1YFRA 4F7UB 2E41A 1E1OA 5GMKe 5ELOA 4CH3A 1HXDA 1MGQA 4F7UE 3JB9D 5C51B 2Q5HA 1LYLA 4J15A 1I81A 3QUIA 4EX5A 4C92B 2C8MA 2Q5IA 2DZCA 1E24A 3M4PA 4HWOA 2RHQA 2ZT5A 4KQEA 5K1PA 4CS2A 4M7AC 3VQYA 3JCMd 2RHSA 3A7AA 5GAN4 4C92E 3QSUA 3UGTA 3HY1A 5LJ3d 1BIBA 1Z7MA 2DTHA 3OD1A 4N0AC 4YRPA 1BIAA 4XEOA 3LSQA 4YRMA 1EIYB 1X56A 4YYEA 3QO7A 5GAMj 1EOVA 3G1ZA 4H2TA 3W3SA 4RCCA 1NJ1A 2J3MA 3JCMP 1NJ5A 3UH0A 2Q7HA 4X9DA 4JRKA 2E1HA 2YHTA 1SETA 3M4GA 2Y90A 1NYQA 4YRJA 1SERA 5GAMh 3R07A 4K86A 4C92C 3V7CA 4PJOA 5GAOm 5GANh 2K57A 2ZT7A 1B34B 3JCMJ 5LJ5j 2ZR3A 1B70B 2I2LA 3NEMA 4XTZA 2PMEA 4C8QD 4ZTZB 4M77F 1WPYA 4YRIA 2ZINA 3A32A 3JCMX 3RKWA 5GAOr 3HRIA 4X9CA 1HK9A 3CMQA 5GANe 5LJ5h 2ZCEA 4PJOG 2FB7A 4M78F 1PYSA 2QTXA 2CJBA 1NJ6A 2ALYA 2ZNIA 4QVCA 4BWAA 1KQ2A 1WQ7A 1JJCA 3IG2A 3NETA 3M4QA 2E5AA 3EFSA 4YCVA 3SWNB 1B76A 1EIYA 1USYA 2ZZGA 3INZA 3VU3C 1WNLA 3RERA 4O2DA 2RHQB 4CH5A 4DPGA 4XTVA 3TEGA 3RIRA 4XTUA 1WLEA 4M7AF 4TWAA 4HWRA 4XTXA 4EMKA 4TVAB 3HFZB 4YROA 4M7DF 4YDQA 5GMKj 2I4OA 2E64A 2P0LA 4RQEA 2DEQA 1D3BA 1KQ1A 4H2XA 3TEHB 4NL3A 2CJAA 5GAN8 1X2GA 4V2SA 4M77D 4XU2A 4XQ3A 4P71A 1B8AA 3HRKA 3MEYA 3RGLA 4HWTA 3V7RA 3L1AA 2XTIA 2ODRD 4BW9A 5K1XA 4HWPA 5GAN5 4HT9A 4H02A 4TVWA 3VQVA 4A53A 4PJOB 4P73A 3TUPA 3SWNA 2CIMA 3A5ZA 3JCMg 4A54A 4PG3A 4P75A 4Q6GA 3JCMf 3RL6A 5GAN6 4PJOE 5HGQA 2ZIOA 4C8QF 5LJ3g 1E22A 1ADJA 4YRLA 4M77A 5LJ3f 2EAYA 3NELA 1W66A 4TQDA 1U1SA 4HA8A 3QNEA 3JCMW 4J6XA 3PZCA 4M75A 1BBWA 3BY7A 4XU3A 3QO5A 1PYSB 4M7AD 3BW1A 4M78A 2ZT8A 4TVAA 3HFZA 2ALYB 4H2YA 1B7YB 2DVEA 4M7DD 2DTIA 1SRYA 3HXXA 1JJCB 2VXEA 2ZIMA 1KMNA 3TEHA 1IL2A 4JLIA 5GAOl 1G5HA 4TQFA 3MF2A 1HC7A 4CH6A 2YLCA 1X2HA 1NJ2A 2DU5A 4M75G 5C52B 2I4NA 3JB9J 4PJOC 2ARTA 2ZT6A 3QO8A 2XGTA 4M78G 3HXZA 5GANj 4KR2A 3PGGA 2J3LA 3P8VA 2C7IA 3RUXA 2VXFA 3E9HA 2HNIA 4CH4A 5GAMg 4EMKB 3JB9G 3A5YA 4YRRA 1GGMA 4M7DA 4CS4A 3JCMV 1BBUA 4YRQA 2E3CA 4RDXA 4WJ3M 4LNSA 2Q7GA 3DSQA 1D3BB 4C92D 1VQZA 4H2XB 1HTTA 4P3NA 5GAMd 4P74A 1Y96B 2RD1A 1M5Q1 3AHUA 2QHTA 11ASA 5GMKi 4WI1A 5GAN2 1I8FA 1U1TA 3JB9I 5GANd 4YCWA 4M7DG 1Z7NA 5LJ5g 1X54A 1B7YA 2QHSA 1WU7A 3L4GA 3UGQA 5LJ5f 1YB3A 5GAN3 4UP8A 3V7SA 1C0AA 1LJOA 1FYFA 5LJ5d 4UP9A 3HY0A 1EVKA 3REUA 4EMKC 2EWNA 4C8QA 1NYRA 2QHUA 4M77B 3BJUA 3HFNA 4M75B 4RCBA 4M77E 3I7FA 4M78B 2RA2A 3V8JA 3RESA 3HXVA 4M75E 3VQXA 3FIFA 4P71C 1H4VB 4XEMA 2AMCA 4M78E 1X55A 1I5LA 3GIBA 4C8QG 4NL2A 2ZZEA 4YP0A 1Y96A 2PMFA 3VQWA 1N9SA 2P5IA 4P73C 3WQZA 4F7UF 3SWNC 4P3PA 3V8KA 2DDZA 2I4LA 4EMGA 4P75C 2IY5A 3HXYA 1I4K1 1H641 3HXWA 4M7AB 4YPFA 4M77C 4J5YA 4M7DB 4P72A 4C92F 1H4SA 4M75C
chains in the Genus database with same CATH superfamily
1YNZA 1W70A 3HXUA 1QKWA 2JMAA 2AHJB 2KXDA 1VQ7Q 5KYXB 3CCQA 3OS1A 3PCOA 3JCMb 2QG9B 2L3RA 4X5OA 1MHNA 2DJZA 2Y4YA 4YRTA 4J9BA 3URGA 1JJ2S 4HKEA 5F5WA 4HVUA 3L4GB 1N8RR 2ZPEB 2JN0A 1MV0B 1X2KA 1VQ7A 1NZ9A 1H4TA 2RB6A 1YJ9Q 3VS7A 1D0XA 2Y4XA 1JBMA 2DZ9A 2EQKA 1EX4A 3JCMe 4C8QB 3UWNA 4QVDA 1SRMA 4UP7A 4HWSA 1AD5A 4B6MA 1Q86R 5KYNA 2MF2A 4PHCA 2QAZA 3RACA 3LWIA 1YITT 3CEYA 3PMIA 4J6WA 1PWTA 4JJDA 2CGHA 2LCCA 5GAMf 1TOVA 5KNNA 4RTVA 2O9VA 4YRSA 1NJIR 2YRDA 3CCRT 1VQKT 4ESRA 3E9GA 3QTCA 4PLLA 1QWFA 4PFPA 3HKSA 2CH4A 2XDPA 1Y07A 1USYC 1YJWQ 1MNEA 2XU8A 4XTWA 4J7FA 4CS3A 1G5IA 5FRMA 2HQHA 3G4ST 1VYVA 4R55A 4UPAA 2EKOA 2PU9B 1WYXA 4J6YA 4C92A 5GAMe 4DQ2A 2HDAA 2AKWA 3EG3A 5I21A 1T3LA 4F7UG 1YJWA 1IHWA 2EGAA 4OMOA 2LP5A 1NJ8A 4ZTUB 2HQEA 4OLFA 1M27C 1VUBA 4MMLA 3RNJA 5GAN7 2ZTGA 7AT1B 1UUEA 1V29B 2MWOA 2VVKA 3UATA 2A8EA 1V76A 1GFCA 2MI6A 4E47A 3RDVA 3RBBB 4BY6C 3EFOB 4J9HA 1ZUKA 4LNPA 5LJ5e 4MDXA 2RF0A 3LC0A 4JLGA 4PFOA 4LE9A 3HFVA 1LNXA 2DRKA 2I4MA 4O5VA 5I11A 4K87A 3F70A 2CP0A 3E2UA 5FW9A 2RHSB 2CUBA 2FPDA 1G3YA 4YRCA 2RJFA 3P8TA 4Y28E 2KI7A 2QQ9A 1EFNA 2DL8A 1SESA 3C4SA 5GAOn 4LVKA 2DILA 5KYWA 1Q81R 2K3BA 3GOXA 1M2VB 2D8JA 1WFWA 1VQ9T 1NBEB 3FJ5A 2OTLT 3ERRA 2C0OA 4M7AE 4HXJA 1ARKA 4HCBA 4YRGA 4N4GA 3IKMB 2DMOA 5FROA 1NEBA 4M75D 2V1QA 5KCOA 2A0FB 5D6YA 4M78D 5LJ3j 2AKKA 2J05A 1E1OA 3G71Q 2L8DA 2B86A 1CSKA 1R77A 5KCHA 3X24B 3OMCA 5ELOA 1I0CA 3CMEQ 2FL7A 1Z9QA 2YXYA 5A0DA 4ZNXA 3CXCP 2COWA 4LDVA 2BZ8A 1NJIC 3MP1A 1ZSZB 4EX5A 2RHQA 2ZT5A 2D1XA 4CS2A 1WGSA 4M7AC 3VQYA 1WLPB 3CXCA 3G71A 2RI3A 3CBPA 3CMEA 1AVZC 3HY1A 5LJ3d 1WA7A 1OYXA 2A08A 4A4KA 1Q7YR 1BIBA 2DTHA 1BI3A 4J9CA 2IVWA 1X2QA 3OD1A 4XEOA 2PUOB 3L2WA 1RI0A 5IHNA 2A7YA 2KNBB 2WSFE 3JV3A 1PM3A 2F5KA 2COYA 1LPLA 4FIBA 1Y57A 2C06A 2E1HA 2YHTA 1J3TA 3O8VA 3OYHA 4YRJA 2ZPHB 3LLRA 2D6FA 5GAMh 1SERA 1KFZA 2QK0A 2EQJA 5GAOm 3OW2P 2KQWA 3CCVT 2PVGB 3M0UA 4WCIA 4QT7A 3N5BB 4XTZA 2DD4A 1WPYA 4HCKA 1R8OB 3OW2A 4BDYA 1HSQA 4KRTA 1KC8R 2JOYA 2K5IA 2QEXT 5GAOr 1TUGB 2K5LA 5IH2A 5LJ5h 2ZCEA 4LD9K 4CC4B 4M78F 1VQ8Q 1YN8A 5KYUA 2ZNIA 3A1PA 4QVCA 4JJCA 4BWAA 1WQ7A 3H9NA 3OSSC 2XKOC 2LZ6B 1RAEB 2CP6A 1UTIA 3SWNB 4KH1B 1YCSB 2LQ8A 1VQ8A 3INZA 1D0YA 3RERA 1PG5B 1TWBA 4O2DA 4DPGA 3TEGA 3RIRA 2D9TA 3KUFA 4XTUA 4FL6A 3QDFA 1FMWA 2KE9A 3S3NA 2RQUA 5IAYA 4TVAB 4YROA 4PJMA 2CS7A 2HBPA 4YDQA 2FPFA 2ROLA 2FEIA 4F16A 1D3BA 4OGCA 1OEBA 4OMLA 1ZSGA 4NL3A 3FDRA 1G5VA 4A63B 3VS0A 2CJAA 1AWOA 1CKBA 2VUBA 2FRYA 4DBQA 2LCSA 1Q7YC 3RGLA 4HWTA 2LX7A 2XDDA 3CCMQ 1RAAB 2RQRA 2RH2A 1NM7A 1QCOA 5GAN5 1VQKQ 4TVWA 2IPOB 2QYZA 2AT1B 4E7JA 1M90U 3EH1A 4PJOB 3TUPA 4E7LA 2R5MA 2CIMA 3JCMg 1VQLT 4A54A 1KQSS 3RL6A 5HGQA 1K73U 1PRMC 2WSCE 2X3WD 1HYOA 1RABB 3CCMA 1BK2A 2KGTA 3S6WA 2P0QA 4YRLA 5LJ3f 2EAYA 3NELA 1W66A 1VQKA 4MDWA 3QNEA 2GQIA 3RMSA 3JCMW 1WX6A 3I55T 1T3SA 3A8MB 1XNIA 3QO5A 2MK5A 2Z0WA 1RAHB 3BW1A 2ZT8A 1NYFA 1KJWA 2L2PA 2DTIA 4CRIA 1JJCB 3L2RA 1IL2A 3TEHA 4CH6A 1NJ2A 2EQIA 3UA7A 2XGTA 1PKSA 2EGEA 2ZAEA 5GANj 3P8VA 2VXFA 4A4EA 4PLIA 2DD5A 2MCNA 5GAMg 3JB9G 5EG2A 2M02A 1GGMA 3SEMA 4M7DA 1BBUA 4FSXA 4C92D 3EHQA 2DYBA 4KUIA 1QVGP 2CP7A 9ATCB 3R6NA 2CP2A 2QGFB 1UGSB 2I0NA 2OTLQ 1QVGA 4WI1A 1I8FA 2DXCA 5GANd 4YCWA 4BUGA 4J83A 1O75A 1UGPB 5LJ5g 2KYMA 1T0HA 3L4GA 1YB3A 2RQWA 3ASKA 1EZZB 3E19A 3JSCA 3A8HB 2GQVA 3A5ZB 1XJWB 4HCZA 2EYWA 4ZN1A 1EVKA 2DBKA 3REUA 4EMKC 2EWNA 4C8QA 2QHUA 4FCYA 4M77B 1G3SA 4AG2C 1GCQC 2YUNA 3OYDA 1Y0MA 1I5OB 2BE9B 4IUQA 2RA2A 3HXVA 4M75E 4QW2A 2JS2A 3FIFA 4P71C 3VQXA 1H4VB 1AHJB 4FYYB 4M78E 3GIBA 3OYYA 2CZ6B 4NL2A 2ZZEA 2EIFA 1YFNA 2GFUA 4FYWB 1S72T 1H641 3JAME 3CCUT 4M7AB 4YPFA 2ZPBB 1K8AU 4XK8E 4P72A 4C92F 4M75C 4Z88A 1K9MR 3OYMA 1N9WA 3M0PA 4M78C 3VYHB 1WJQA 5GAOp 3VS5A 1K0SA 1UGVA 2PZ1A 5A0LA 3REXA 3HTZA 2EJ9A 3LGLA 2JTEA 3BFMA 3Q1JA 3QWYA 3CBMA 1Q82R 3EAEA 3L2ZA 2QEXQ 2LNVA 2AIRB 3BE3A 3EFOA 1C6VX 5CQYA 4HCCA 3M55A 4H2VA 1KIKA 5LJ3h 2F5TX 2QA4T 3RMQA 2JZ2A 2ZNJA 4M77G 2XIDA 1OZ2A 2LC4A 3LGFA 2QASA 3DKMA 2CDTA 2QEXA 2GCXA 1OQKA 4C0DB 2LT4A 1KHIA 3WXMB 4H2SA 3EGXB 4YRFA 4TVYA 1WIEA 3J81E 1M2VA 1RIQA 3RF1A 1W1FA 3AT1B 2M0YA 4AH6A 1E1TA 3FB9A 2X4YA 4AT1B 3JCMQ 3O5ZA 1SSHA 3DLLA 2AMCB 2E10A 3VYGA 2O88A 3MF1A 4EMHA 2DL5A 1ASZA 4RG2A 5GANf 3A31A 2DQ0A 4VUBA 3V8LA 3VS3A 1M9SA 4M7AG 3TCJA 2M16A 2DBMA 2BZYA 1BB9A 1K4US 2JM8A 1WQWA 1G3WA 1VQ6Q 1R0BG 4RKUE 3JB9H 4JRQA 4KR3A 1ZSZA 4Q15A 5C0MA 2CKKA 4RTYA 2Q7EA 4N4IA 2A28A 2ARSA 2DXTA 3FJPA 4XU0A 2ARUA 4NOYA 1Z9ZA 4IUVA 1VQ6A 3G6EQ 1UEBA 3LX7A 3A7RA 2NUZA 1GBQA 3L2UA 3UDCA 3I55Q 2COZA 4JRIA 2FVUA 5GAOq 2ZR2A 4ZIBA 2LJ1A 3R6OA 1KMMA 4E7IA 3G6EA 2ATCB 4Y91A 3A8OB 2DU7A 1VQPT 1M1KU 3I55A 1NLOC 4OP0A 2C0IA 3CPFA 3GNGA 4FW1A 2X4JA 5GMKl 2ZGWA 3NFCA 1TUDA 2KBTA 1L0WA 1QP2A 2ESWA 4HT8A 4BE1A 1ATIA 1YGBA 3MCAB 4C0FA 1WHHA 5KYYB 3OBWA 3OYEA 8ATCB 1BBZA 2LNHB 3VJPA 4TTVA 1M8VA 3VKIA 2KMTA 4P3OA 4IUTA 2RQVA 2NWMA 1PSFA 4WF2A 3OYLA 2KYBA 1JU5C 2EGCA 1U3OA 5GMKm 1UECA 2LJ3A 1YFRA 4F7UB 3QG1A 4O6JA 2RPNA 4JJNK 2DL4A 3FEOA 4CH3A 1ZA2B 4QQ6A 1MGQA 1UB4A 4FYVB 2J7IA 2Q5HA 1JXOA 4J15A 3EGUA 1OX9A 1AEYA 1I81A 1TXQA 2DF6A 2C8MA 1H92A 2DZCA 2XHCA 2RJDA 3CCJT 4AFSC 4GLMA 3A7AA 5GAN4 4C92E 2D0NA 2JVVA 1I1JA 3EH2A 5FU7C 3UGTA 4JJBA 2BE7D 1RACB 5DLOA 4E6RA 1QCNA 4EDUA 1YJ9A 4YRPA 1UHCA 1D1CA 3LSQA 4YRMA 5C6SA 3QO7A 4H2TA 4QVZA 2GF7A 1WZOA 2RK1A 1NJ1A 2EVRA 2J3MA 3CD6T 1YHQQ 4X9DA 3SHWA 2CSQA 4JRKA 4OB3B 3G1JA 5CKBA 3M4GA 1NYQA 5L8RE 4GY5A 2K9GA 4C92C 1YI2T 4JPBW 4PJOA 2VGMA 2HQXA 1S72Q 1LVKA 3A98A 5GANh 4J9IA 2ROTA 2ZT7A 2RHYA 5HK3A 1G3TA 1YHQA 2ZR3A 1B70B 2M0OA 3CCUQ 4JS4A 2I2LA 3NEMA 2PMEA 4C8QD 1CKAA 3NTKA 1PHTA 2V8KA 3JCMX 2VWFA 4D6WA 5GJWB 3SFMA 3HRIA 4F14A 2KRMA 4BI3A 3EG9A 3CMQA 1S72A 1C0MA 2QTXA 2SRCA 2OTJT 1WHKA 3CCUA 1JJCA 3IG2A 4MZTA 4YCVA 1EIYA 2EYYA 1USYA 2KY9A 5IHKA 2AZSA 2RHUA 2ZZGA 2FZCB 2F2WA 2PQWA 4OVAA 4C5EA 2QA4Q 1Q86U 3OYJA 2XD0A 1WLEA 1IZ6A 2RO0A 4HWRA 2QI2A 4JRPA 3CMAQ 2WACA 3CPWP 1ABQA 2VKNA 4M7DF 2LX9A 1VQMT 5GMKj 1OPLA 2ED0A 1VQ4T 2O31A 3NMZC 4HVVA 2BUDA 3PVLA 2QA4A 3CPWA 5HY6A 3H8ZA 2LCLA 4XU2A 3OB9A 4XQ3A 3CMAA 1B8AA 3HRKA 5GJVB 4MZPA 2D0QB 2GFAA 3OYBA 2CZ7B 1IRXA 5K1XA 3M59A 4FT4A 1IXDA 3CC2Q 3VQVA 2QQBA 5L23A 4LDYA 3OS2A 4P73A 4GBQA 3A5ZA 1GCPA 2JTFA 1QMCA 4RTWA 1OX8A 2JW4A 5FRNA 2EPDA 4PG3A 4P75A 2ZZDA 4C8QF 2E5KA 2QTVA 3OYFA 4J9DA 3D7SB 1ADJA 4M77A 3CC2A 4TQDA 1U1SA 1OV3A 4J6XA 4F04B 1RAIB 3FC3A 3PFSA 2W0ZA 4KH0B 1PYSB 3HFZA 2ALYB 4AFZC 2DVEA 2E4HA 2QQSA 2CUDA 2VXEA 2DXBA 2OAWA 4JLIA 5GAOl 1G5HA 4TQFA 2XDBA 4IKFA 1VQ5T 1HC7A 1SG5A 4FYXB 4AFQC 4M75G 4OMQA 2E70A 3NPFA 3QO8A 2J6KA 3P8BB 4M78G 1Q81U 1M2OA 4KT0E 2J3LA 1QW1A 1BKBA 2NUPA 3PE0A 1VQPQ 2HNIA 4CH4A 1UJYA 2LRQA 4YRRA 4CI0C 1GXIE 3JCMV 4E7SA 2E3CA 3OYGA 3ZL7C 3TU4K 3QZ9B 2PUKB 5CKEA 4P74A 1GFDA 2CZ1B 3VUZA 3HRSA 4ZGDB 11ASA 1B7TA 3GLXA 1LCKA 3OS0A 2M1HA 3ZEHA 2FRWA 5ECAA 4D8KA 1E6HA 5FU6C 1AWJA 1H8KA 1B7YA 2YDLA 1BU1A 3P8DA 1U8RA 3PIPA 5GAN3 1D0ZA 2O2OA 2EKHA 3V7SA 1GL5A 3EG0A 2R5AA 2ED1A 4PL6A 1LJOA 5DLQE 2EQUA 1SSFA 1MNDA 2DA9A 3NTHA 4PFZA 1NYRA 1I07A 1OOTA 3QYGB 4L6V5 3HFNA 3EGXA 3OYNA 5IN1A 3CCJQ 2M51A 3C12A 1NLPC 2XICA 2KK4A 3I7FA 3H0IA 3CC4T 4XEMA 5I2MA 2AMCA 4ZTJA 1ZA1B 3LH5A 2RHXA 3OYCA 2X9HA 1YITQ 3L2VA 1Y96A 2YSQA 2ECZA 3CCJA 3VQWA 1D1BA 1FXXA 3C94A 3CXCS 2P5IA 3QJYA 3WQZA 3V8KA 2FG0A 2DDZA 2I4LA 2FHDA 1D1AA 4EMGA 2DERA 3CD6Q 2JTMA 3CCRQ 1PD0A 2BKDN 3HXWA 4QQGA 1YITA 4J5YA 2RJEA 2DE0X 2RQTA 1M1FA 3J80E 5FU7B 1KC8U 5M9OA 1KD1U 3SD4A 1UGQB 2K2MA 4M7DE 3G4SQ 4LVMA 3RR6A 5EC7A 3CD6A 2C0TA 1RLPC 3CCRA 1N5ZA 2VB6A 2L89A 3PMTA 3HRTA 2BTTA 2K3XA 4K88A 4G84A 3TSWA 5DY9A 3A74A 4YCUA 5CAIA 3G4SA 1NPPA 1E6GA 3OY9A 2MIOA 2DK3A 2FZGB 2X3XD 1YBYA 4DBFA 2CJ9A 3GBQA 4C5HA 4RMFA 2EW3A 2J06A 2HEQA 3I5SA 3OW2S 2P0PA 5AT1B 3ZFJA 2AKWB 3H0HA 5CQXA 1FMKA 1ZBJA 3QKJA 3L2QA 1YJNT 4M7DC 2EJGA 3M0RA 5IXBA 5LJ3e 2IIMA 3LW5E 3JCMc 4C8QE 5A2QE 4PJOD 1SPKA 2A3LA 2GBQA 3VUBA 4AFUC 1M90C 2F2VA 1Q95G 4HVCA 1X6GA 4DOVA 1B07A 1QE0A 5KYYA 2XG8D 2KT8A 1K73C 5D6XA 1VQMQ 3L42A 2V1RA 2WSEE 2DIQA 1KOGA 4C5IA 4N0AA 1VQ9Q 5KYXA 1EQRA 1SF9A 2E3HA 4BY6B 1QP3A 1MMNA 1QF6A 4F7UA 1JRIA 2KVQG 1RADB 2RNAA 1IREB 3QO3A 4DBRA 3IALA 1VQMA 2YLBA 4C8QC 2YUQA 5KYWB 3NENA 1YCYA 1VQ9A 5E3IA 1VQ7T 2QHVA 2YUPA 2OTLA 3QXEB 12ASA 1S1NA 1K8AR 3VS6A 4DOWA 1TH7A 1X69A 4C5GA 1UFFA 4XU1A 4NCXA 3JRZA 2KRNA 1H4QA 3UF4A 3ULRB 3JB9F 4C92G 1NYGA 1X6OA 1Y7XA 5CKHA 4A4FA 3UFGA 3NHNA 3OQ5A 4PNOA 2LQWA 1W2BP 2HL5C 2LQNA 3H0FA 4L59A 1JEGA 1EVLA 1BYMA 2VC8A 4K11A 3CC7T 3EGDB 3RKYA 1ZLMA 3S3MA 2VYTA 1W2BA 3MHXA 2PVDB 2A36A 3HFOA 2RM4A 3A8LB 4P72C 1EFWA 1HJDA 4HT4A 2G4CA 4YREA 2KROA 4PJOF 4BI8B 5FLXE 4RQFA 1TU0B 2K3YA 2MWPA 3HL8A 1QKXA 2K79A 5J3BA 4YRKA 1TTHB 1B70A 3IKLA 3P8YA 1DJ7B 2FO0A 3HHTB 2A37A 2ABLA 5GMKh 1T0JA 3CCVQ 3X25B 2EYXA 1AZEA 3WVDB 3ICAA 3META 1LOJA 3KFUA 2QQRA 1E7OA 3VRYA 2DTOA 4FT2A 2P84A 3MP6A 2KSSA 3CCVA 5C51B 1JXMA 2JS0A 1LYLA 3OYAA 3EHRA 4KQEA 1XTDA 2HBWA 4E2FB 4KULA 1E24A 1QWEA 2GTJA 2P4TA 3JCMd 1QVGS 3KBGA 2RHSA 3QSUA 2YRCA 3I5RA 1AWXA 3CCET 4R0KA 5KYUB 3M0SA 1Z7MA 3T9NA 1K9AA 2CYZB 4J9FA 1K8AC 3X20B 4ORZA 3QBYA 3QYHB 5GAMj 3W3SA 3VS1A 3X28B 4MZMA 1H3ZA 1WI7A 3JCMP 2L3PA 3DB4A 3UH0A 3PTAA 1JJ2P 2Q7HA 4LN2A 2NS6A 4LVLA 1SETA 1W4SA 1ZSZC 4K86A 1JJ2A 1K9MU 1D09B 1PCXA 2B8AA 2K57A 3M0QA 1B34B 3JCMJ 5LJ5j 3LYIA 2F69A 4M77F 4YRIA 2ZINA 3A32A 1VQLQ 1VQNT 4X9CA 5GANe 3TSZA 2QDYB 2FB7A 1PYSA 2MMPA 2ALYA 1KQ2A 1VQOT 5D6WA 3NETA 5CVIA 2E5AA 3OA6A 2DAQA 1B76A 3FLGA 1VQLA 1RAGB 1MUZA 1RL2A 1PSEA 2O9SA 2M9UA 3VU3C 1M3CA 5CIUA 3I35A 3CBOA 3OSVA 4M7AF 4R56A 4TWAA 1YJNQ 2H8HA 2GNCA 4RQEA 1NE8A 2LQKA 1KQ1A 1ZUUA 4CC3A 5IXFA 2HMAA 3TEHB 2CREA 2XI9A 4ELYC 2D8HA 2KDSA 5J39A 2NLUA 2ZPIB 4FM4B 2MYSA 1YJNA 1H3HA 3GNFB 1UG1A 3V7RA 2DJQA 3L1AA 1N27A 5D7UA 2XTIA 2ODRD 4PJLA 4DBHA 3MQZA 4HWPA 3QJ6A 4H02A 4RMOA 4AMCA 2VGNA 2JUFA 2HKNA 2EQMA 1OU9A 1WDXA 1BI0A 3SWNA 1ACMB 1WHJA 4Q6GA 3JCMf 5GAN6 4PJOE 1VQ8T 5LJ3g 1GRIA 4N4HA 1K1ZA 1C1AA 1E22A 4DEXA 4HA8A 4LD6A 4II1A 1M1KC 3BY7A 4XU3A 4TVAA 4OMFB 1QLYA 1NG2A 4H2YA 3KXTA 1HD3A 4M7DD 1SRYA 2DM1A 4A4HA 1X43A 2E5QA 1QCFA 4IUPA 2YLCA 2FZKB 1G83A 2DU5A 3MO8A 2I4NA 3JB9J 4PJOC 1AOJA 4CC7A 2LTOA 5CKDA 3HXZA 4E7ZA 3VS4A 3CC7Q 2HAXA 4BE2A 2C7IA 3QIIA 3RUXA 2LT1A 3M58A 1SEMA 4JZ3A 3CCST 4EMKB 5HK0A 3WVEB 4ELZC 2DRMA 4CS4A 1UE9A 4YRQA 1VIEA 4RDXA 2Q7GA 4H2XB 1RI9A 1UHFA 2YT6A 4KGXB 2L3QA 2BZXA 2KR3A 3OBYA 3KFVA 3CC7A 3CCMT 1TUCA 2P4RA 2K6DA 4RTXA 2RD1A 1WHMA 1WXTA 5GAN2 2J6OA 1U1TA 2DIGA 1IB8A 2CP3A 3I9QA 4M7DG 2V8JA 5DM7R 2XMFA 1N8RU 2CSIA 2QHSA 3CQTA 3UGQA 5LJ5f 2DYIA 2L5QA 1GBRA 4KGVB 5KH6A 3QDRB 1BI1A 3M54A 1FYFA 1Y71A 1TSFA 6AT1B 3ER0A 3HY0A 4Z02A 4EPCA 2E6ZA 1AZGB 3BDLA 2E12A 3M57A 4M75B 4RCBA 4RUGA 4M77E 2OAUA 4M78B 1OI1A 3CCLT 2G3RA 3CCEQ 3M56A 2EFIA 1XOVA 3HPWA 2ZPFB 5IT9E 1YWOA 4C8QG 3QPHA 2X35A 1NJIU 1FWZA 2JT4A 1QQJA 2X4XA 3S3OA 1PC0A 3PNWC 2PMFA 3C95A 5HCKA 1N9SA 4BE0A 2DX1A 2RI5A 4P73C 4F7UF 5KE3A 3CCEA 2L0AA 3G7ZA 4F17A 3HP9A 4P75C 1G2BA 1N8RC 3HXYA 3A8GB 2RHIA 2DFUA 1V1CA 4M77C 1XQHA 1IGQA 1H4SA 1M4ZA 2GGRA 2CP5A 3MP8A 4TVRA 2JMCA 2R58A 4X34A 2DO3A 3I56T 3A7UA 2J6FA 4YRNA 2DXUA 5C53B 1Q86C 1UGRB 3TQ7P 1NEGA 4E51A 3JCMh 1VQNQ 4WJ4A 1VIFA 4Q5WA 1W6XA 4OB2B 2K4YA 4PJNA 1WXUA 2NUTB 2CT3A 4IIMA 4RG8A 1G8XA 4BDZA 1VQOQ 2O01E 3EGDA 4FU6A 4EO4A 1NPRA 2KT1A 4AG1C 1QVPA 3QHSA 1NNHA 3M5AA 2G6FX 4BB7A 1VQNA 1IHVA 2R57A 1A0NB 4KUDK 4FSSA 2YWWA 1KQSP 1WYDA 2E3IA 4H2WA 1VQOA 3HTRA 1M1GA 4M7AA 4P74C 3HSBA 2DKGA 1BCMA 1X01A 1YFTA 1JB0E 4ATOA 1YIJT 1PRLC 4J9EA 1ABOA 2EBPA 3P8HA 1KQSA 2DL3A 5GANg 1KSWA 4KGZB 2L3SA 1EIFA 2DETA 2V26A 1ASYA 3SDZA 2O4XB 1VQPA 1ADYA 1YFSA 2VV5A 4A4GA 2YRVA 1N9RA 4MMKA 4E7HA 3E9IA 2IY5B 2LJ0A 1J5WA 4IUUA 2ZZFA 4C0DC 2PNIA 4M4ZA 1G51A 2RMOA 4OF1A 1WJSA 2W10A 3CPWS 1M90R 3UPUA 2LVMA 2X51A 3HRUA 1WJRA 5J26A 1KD1R 4M75F 4XTYA 2HL3A 4OGEA 1K73R 2YUOA 1AT1B 1Q7YU 2DQ3A 1Q81C 3PCOB 3FRNA 4PKCC 4IIOA 1M3BA 1UJ0A 4J7IA 4ZGJB 2RN8A 1SRLA 3M0TA 2JJ9A 2XK0A 3REBB 3REAB 5A0GA 4RTUA 4P5NA 4ANJA 1TG0A 3LSSA 4L87A 3EFRA 2EYZA 2E65A 2F1LA 8AT1B 2FYKA 2MOXA 3RKXA 2PVOB 1SKUB 4OMMA 2FPEA 2ZXFA 1U06A 4G85A 2K2VA 5LL6S 1YWPA 4J9GA 1B34A 3H6ZA 2EL9A 2KXCA 1YI2Q 1AWWA 3CCSQ 3VBBA 2EJFA 3SB2A 1X75C 2AZVA 4JUVA 4C0GA 2ODRC 3BDUA 2DLPA 5I2SA 1VQ6T 4H2UA 3IQLA 5ELNA 3MEVA 1YI2A 4JZ4A 2E41A 3CCSA 4YTLA 1B3QA 1M8MA 5GMKe 3MPUB 1HXDA 3OYIA 3LH0A 1PKTA 4F7UE 3JB9D 1BI2A 4DEYA 2OTJQ 1VYUA 4OMPA 3M4YA 2JNGA 3VV0A 3MEAA 3QUIA 4WTOB 4ZTZB 4C92B 1FX7A 3G6ET 2K5FA 2Q5IA 3M4PA 4HWOA 5K1PA 2KEAA 1N6AA 3ME9A 4OB0B 3VRZA 2IG0A 4ZTFA 1WXBA 4GLKA 3GPLA 2AKLA 3EG9B 5CR2A 2OTJA 2ENMA 4N0AC 1O9SA 1BIAA 1EIYB 1X56A 1KC8C 4YYEA 1KD1C 3CCLQ 1EOVA 3G1ZA 1SHFA 1VQ4Q 1VOMA 4RCCA 1ZQ1A 3TVTA 1OPKA 1KK7A 4LUDA 2OI3A 3M9QA 1NJ5A 3CCQT 2Y90A 3DB3A 1MMGA 4LVJA 4FW2A 2DEUA 3R07A 3E9FA 4Z8AA 4IURA 3V7CA 1RUWA 4D8DA 3CCLA 1VQ4A 4JS5A 4OB1B 2LDMA 5CKFA 4DA4A 2CT4A 1R0CB 4X1VA 3EG1A 3THKA 2KRSA 4LXCA 3RKWA 5IHIA 5CO7A 1HK9A 3E1SA 1ZX6A 4JDSA 4PJOG 2EYQA 2CJBA 1NJ6A 3I56Q 4ZGEB 2PTKA 4EIKA 2GTOA 1YJ9T 4NS5A 3M4QA 3EFSA 2P0KA 1M3AA 4HVWA 3OS5A 1K0XA 2DPPB 3I56A 1WNLA 2RHQB 2KAFA 1QVFP 2HSPA 4CH5A 4XTVA 2CZ0B 2DNUA 1VQ5Q 3UA6A 4UC4A 4Y92A 4XTXA 4EMKA 2VASA 3HFZB 1QVFA 2I4OA 2E64A 1YP5A 2P0LA 5HKCA 4OMNA 2DEQA 2E6NA 3H41A 4H2XA 1GCQA 1FYNA 1KG1A 2BIVA 4BD3A 1YHQT 3MJXA 4B9XA 3EG2A 1VQ5A 2QDLA 5GAN8 1X2GA 2QXFA 4V2SA 4M77D 1YIJQ 4P71A 1WHGA 1YJWT 3MEYA 4LDWA 4BW9A 1IO6A 4LDUA 4HT9A 1WHLA 2NUPB 2RHZA 1P92A 2DL7A 4A53A 1SHGA 1YIJA 1ZBXA 1F1BB 4RTZA 5KE2A 1ZHIA 2ZIOA 2HD0A 2V8IA 2MPXC 2CH4W 3GP8A 3TEEA 3PZCA 4M75A 1BBWA 3PVQA 1VA7A 2AK5A 4PK4A 2X4WA 3MEWA 4M78A 4M7AD 1RLQC 1B7YB 3VS2A 1OZ3A 3HXXA 1PD1A 2MAMA 2ZIMA 1KMNA 4Z89A 5FWBA 3MF2A 2RI2A 1IGUA 5FU6B 2HCKA 1X2HA 4LUEA 3CC4Q 5C52B 4LVIA 3CMAT 2ARTA 3TREA 2ZT6A 5CCAA 4B9WA 5I22A 2ZCFB 1OULA 4KR2A 3PGGA 2H3EB 4BI4A 2ZPGB 4QQDA 1M1KR 5AYFA 3E9HA 3A5YA 2OJ2A 2NYSA 3CC4A 4WJ3M 4LNSA 4C0ZA 3PIOA 3DSQA 1D3BB 1VQZA 1RAFB 5FWCA 1TS9A 1HTTA 4P3NA 5GAMd 2H3JA 1Y96B 1X27A 3PT9A 1M30A 3CC2T 1W2BS 5CK9A 1M5Q1 3AHUA 2QHTA 5GMKi 1Q82U 4XAXB 3G71T 1ZUYA 3GF5A 3ZBDA 3JB9I 3CMET 3QZ5B 1QVFS 1Z7NA 1X54A 1BCOA 4PJJA 1WU7A 2HZYA 2DVJA 3LWHA 2NUTA 1FMVA 3QWXX 4UP8A 1C0AA 2QQAA 2JXBA 5LJ5d 4L5GA 4UP9A 2OX7A 4RTTA 4E7KA 1UDLA 1X6BA 3NGPA 1VYTA 2SEMA 3NTIA 3BJUA 2HSEB 4QKUA 3OMGA 2QGGA 3C0CA 3UT1A 3V8JA 3RESA 2RJCA 1K9MC 2RK2A 1X55A 3MKDA 1I5LA 1OU8A 4ZN3A 3X26B 3U23A 1K76A 1PNJA 4YP0A 1MMDA 1JO8A 4ME7A 1U5SA 2O4XA 1Q82C 2LMJA 3OYKA 1MMAA 2JM9A 3SWNC 4P3PA 4BACA 3DLMA 2IY5A 1I4K1 4CC2A 4LDXA 3J7AF 3CCQQ 2K7AA 3M53A 3MEUA 1JQQA 4M7DB 4KBMB 1MV3A 2HKQB 2F2XA 1KHCA 4J8OA
chains in the Genus database with same CATH topology
3HXUA 2AHJB 3CCQA 3OS1A 3PCOA 3JCMb 2L3RA 4X5OA 1MHNA 2DJZA 2Y4YA 4YRTA 3URGA 1JJ2S 4HKEA 5F5WA 3L4GB 2ZPEB 2JN0A 1VQ7A 1NZ9A 1H4TA 2RB6A 2Y4XA 1JBMA 2DZ9A 2EQKA 3JCMe 4C8QB 3UWNA 4QVDA 4UP7A 4HWSA 2MF2A 4PHCA 3RACA 3LWIA 1YITT 3CEYA 3PMIA 4J6WA 2CGHA 2LCCA 5GAMf 5KNNA 4YRSA 3CCRT 1VQKT 3E9GA 3QTCA 4PLLA 3HKSA 1USYC 2XDPA 1Y07A 4XTWA 2XU8A 4J7FA 4CS3A 1G5IA 5FRMA 3G4ST 4UPAA 4R55A 2EKOA 2PU9B 4J6YA 4C92A 5GAMe 4DQ2A 2AKWA 5I21A 4F7UG 1YJWA 1NJ8A 4ZTUB 2HQEA 4OLFA 1VUBA 4MMLA 5GAN7 2ZTGA 2MWOA 1V29B 2A8EA 2MI6A 4E47A 4BY6C 5LJ5e 4MDXA 3LC0A 4JLGA 3HFVA 1LNXA 2I4MA 4O5VA 4K87A 3F70A 2RHSB 1G3YA 4YRCA 2RJFA 3P8TA 4Y28E 2QQ9A 1SESA 3C4SA 5GAOn 4LVKA 3GOXA 1VQ9T 2OTLT 3ERRA 4M7AE 4HCBA 4YRGA 4N4GA 3IKMB 5FROA 4M75D 5KCOA 5D6YA 4M78D 5LJ3j 1E1OA 2L8DA 5KCHA 5ELOA 3X24B 3OMCA 2FL7A 5A0DA 4LDVA 1NJIC 3MP1A 4EX5A 2RHQA 2ZT5A 4CS2A 1WGSA 4M7AC 3VQYA 3CXCA 3G71A 2RI3A 3CBPA 3CMEA 3HY1A 5LJ3d 1OYXA 4A4KA 1BIBA 2DTHA 1BI3A 2IVWA 3OD1A 4XEOA 2PUOB 3L2WA 1RI0A 2A7YA 2WSFE 2F5KA 4FIBA 2C06A 2E1HA 2YHTA 4YRJA 3O8VA 3OYHA 2ZPHB 3LLRA 2D6FA 5GAMh 1SERA 2EQJA 5GAOm 2KQWA 3CCVT 2PVGB 3N5BB 4XTZA 2DD4A 1WPYA 1R8OB 3OW2A 4BDYA 2JOYA 2K5IA 2QEXT 5GAOr 2K5LA 2ZCEA 5LJ5h 4LD9K 4M78F 2ZNIA 4QVCA 4BWAA 1WQ7A 3OSSC 2XKOC 3SWNB 2LQ8A 1VQ8A 3INZA 3RERA 4O2DA 4DPGA 3TEGA 3RIRA 2D9TA 3KUFA 4XTUA 4FL6A 3S3NA 5IAYA 4TVAB 4YROA 2CS7A 2HBPA 4YDQA 1D3BA 4OGCA 4NL3A 3FDRA 1G5VA 2CJAA 2VUBA 1Q7YC 3RGLA 4HWTA 2XDDA 2RH2A 5GAN5 4TVWA 4E7JA 1M90U 4PJOB 3TUPA 4E7LA 2R5MA 2CIMA 3JCMg 1VQLT 4A54A 1KQSS 3RL6A 5HGQA 1K73U 2WSCE 3CCMA 3S6WA 2P0QA 4YRLA 5LJ3f 2EAYA 3NELA 1W66A 1VQKA 4MDWA 3QNEA 3RMSA 3JCMW 3I55T 3A8MB 1XNIA 3QO5A 3BW1A 2ZT8A 2DTIA 4CRIA 1JJCB 3L2RA 1IL2A 3TEHA 4CH6A 1NJ2A 2XGTA 5GANj 3P8VA 2VXFA 4A4EA 4PLIA 2DD5A 5GAMg 3JB9G 5EG2A 1GGMA 4M7DA 1BBUA 4FSXA 4C92D 4KUIA 1UGSB 1QVGA 4WI1A 1I8FA 2DXCA 5GANd 4YCWA 4BUGA 4J83A 1O75A 1UGPB 5LJ5g 3L4GA 1YB3A 3ASKA 3E19A 3JSCA 3A8HB 2GQVA 3A5ZB 4HCZA 4ZN1A 1EVKA 3REUA 4EMKC 2EWNA 4C8QA 2QHUA 4M77B 1G3SA 3OYDA 4IUQA 2RA2A 3HXVA 4M75E 4QW2A 3VQXA 3FIFA 4P71C 1H4VB 1AHJB 4M78E 3GIBA 3OYYA 2CZ6B 4NL2A 2ZZEA 2EIFA 2GFUA 1S72T 1H641 3JAME 3CCUT 4M7AB 4YPFA 2ZPBB 1K8AU 4XK8E 4P72A 4C92F 4M75C 3OYMA 1N9WA 4M78C 3VYHB 1WJQA 5GAOp 5A0LA 3REXA 3HTZA 2EJ9A 3LGLA 3BFMA 3Q1JA 3CBMA 3EAEA 3L2ZA 2LNVA 5CQYA 4HCCA 3M55A 4H2VA 5LJ3h 2F5TX 2QA4T 3RMQA 2JZ2A 2ZNJA 4M77G 2XIDA 1OZ2A 2LC4A 3LGFA 3DKMA 2QEXA 2GCXA 4C0DB 2LT4A 1KHIA 3WXMB 4H2SA 4YRFA 4TVYA 3J81E 1RIQA 3RF1A 4AH6A 1E1TA 3FB9A 2X4YA 3JCMQ 3DLLA 2AMCB 2E10A 3VYGA 3MF1A 4EMHA 1ASZA 4RG2A 5GANf 3A31A 2DQ0A 4VUBA 3V8LA 1M9SA 4M7AG 3TCJA 2M16A 1WQWA 1G3WA 3JB9H 4RKUE 4JRQA 4KR3A 4Q15A 5C0MA 2CKKA 2Q7EA 4N4IA 2ARSA 2DXTA 3FJPA 4XU0A 2ARUA 4NOYA 4IUVA 1VQ6A 1UEBA 3LX7A 3A7RA 3L2UA 3UDCA 4JRIA 2FVUA 5GAOq 2ZR2A 4ZIBA 3R6OA 1KMMA 4E7IA 3G6EA 4Y91A 3A8OB 2DU7A 1VQPT 1M1KU 3I55A 4OP0A 3CPFA 3GNGA 5GMKl 2X4JA 2ZGWA 3NFCA 1L0WA 1QP2A 4HT8A 4BE1A 1ATIA 1YGBA 3MCAB 4C0FA 3OBWA 3OYEA 4TTVA 3VJPA 1M8VA 3VKIA 2KMTA 4P3OA 4IUTA 1PSFA 4WF2A 3OYLA 5GMKm 1YFRA 4F7UB 3QG1A 4O6JA 4JJNK 3FEOA 4CH3A 4QQ6A 1MGQA 1UB4A 2Q5HA 4J15A 1I81A 2C8MA 2DZCA 2XHCA 2RJDA 3CCJT 3A7AA 5GAN4 4C92E 2JVVA 5FU7C 3UGTA 5DLOA 4EDUA 1YJ9A 4YRPA 3LSQA 4YRMA 5C6SA 3QO7A 4H2TA 4QVZA 2GF7A 2RK1A 1NJ1A 2J3MA 3CD6T 4X9DA 4JRKA 4OB3B 5CKBA 3M4GA 1NYQA 5L8RE 4GY5A 4C92C 1YI2T 4PJOA 2VGMA 2HQXA 5GANh 2ZT7A 2RHYA 5HK3A 1G3TA 1YHQA 2ZR3A 1B70B 2M0OA 4JS4A 2I2LA 3NEMA 2PMEA 4C8QD 3NTKA 2V8KA 3JCMX 4D6WA 3SFMA 3HRIA 4BI3A 3CMQA 1S72A 2QTXA 2OTJT 3CCUA 1JJCA 3IG2A 4MZTA 4YCVA 1EIYA 1USYA 2KY9A 2RHUA 2ZZGA 2PQWA 4OVAA 4C5EA 1Q86U 3OYJA 2XD0A 1WLEA 1IZ6A 2RO0A 4HWRA 2QI2A 4JRPA 2WACA 4M7DF 2LX9A 1VQMT 5GMKj 1VQ4T 2BUDA 2QA4A 3CPWA 5HY6A 3H8ZA 2LCLA 4XU2A 3OB9A 4XQ3A 3CMAA 1B8AA 3HRKA 4MZPA 2D0QB 2GFAA 3OYBA 2CZ7B 5K1XA 3M59A 4FT4A 3VQVA 2QQBA 4LDYA 3OS2A 4P73A 3A5ZA 2JTFA 4PG3A 5FRNA 4P75A 2ZZDA 4C8QF 3OYFA 1ADJA 4M77A 3CC2A 4TQDA 1U1SA 4J6XA 3FC3A 3PFSA 1PYSB 3HFZA 2ALYB 2DVEA 2QQSA 2VXEA 2DXBA 4JLIA 5GAOl 1G5HA 4TQFA 2XDBA 4IKFA 1VQ5T 1HC7A 4M75G 2E70A 3QO8A 3P8BB 4M78G 1Q81U 4KT0E 2J3LA 1QW1A 1BKBA 2HNIA 4CH4A 2LRQA 4YRRA 4CI0C 1GXIE 3JCMV 2E3CA 3OYGA 3TU4K 3QZ9B 2PUKB 5CKEA 4P74A 2CZ1B 3VUZA 3HRSA 4ZGDB 11ASA 3GLXA 3OS0A 2M1HA 3ZEHA 5FU6C 1B7YA 3P8DA 1U8RA 3PIPA 5GAN3 3V7SA 2R5AA 4PL6A 1LJOA 5DLQE 2EQUA 1SSFA 3NTHA 1NYRA 3QYGB 4L6V5 3HFNA 3OYNA 5IN1A 3C12A 2XICA 2KK4A 3I7FA 3CC4T 4XEMA 5I2MA 2AMCA 4ZTJA 2RHXA 3OYCA 3L2VA 1Y96A 3CCJA 3VQWA 1FXXA 3C94A 3CXCS 2P5IA 3QJYA 3WQZA 3V8KA 2DDZA 2I4LA 2FHDA 4EMGA 2JTMA 2BKDN 3HXWA 4QQGA 1YITA 4J5YA 2RJEA 3J80E 1M1FA 5FU7B 1KC8U 1KD1U 5M9OA 3SD4A 1UGQB 4M7DE 4LVMA 3CD6A 3CCRA 3PMTA 2L89A 3HRTA 2K3XA 4K88A 4G84A 5DY9A 3A74A 4YCUA 5CAIA 3G4SA 1NPPA 3OY9A 2DK3A 1YBYA 2CJ9A 4C5HA 4RMFA 3OW2S 2P0PA 3ZFJA 2AKWB 5CQXA 4M7DC 1YJNT 3QKJA 3L2QA 2EJGA 5LJ3e 3LW5E 3JCMc 4C8QE 5A2QE 4PJOD 2A3LA 3VUBA 1M90C 4HVCA 4DOVA 1QE0A 2XG8D 1K73C 5D6XA 3L42A 2WSEE 2DIQA 1KOGA 4C5IA 4N0AA 1EQRA 4BY6B 1QP3A 1QF6A 4F7UA 1JRIA 2KVQG 1IREB 3QO3A 3IALA 1VQMA 2YLBA 4C8QC 3NENA 1YCYA 1VQ9A 5E3IA 1VQ7T 2QHVA 2OTLA 3QXEB 12ASA 4DOWA 1TH7A 4C5GA 4XU1A 4NCXA 3JRZA 1H4QA 3JB9F 4C92G 1X6OA 1Y7XA 5CKHA 4A4FA 3UFGA 3OQ5A 4PNOA 4L59A 1EVLA 1BYMA 2VC8A 3CC7T 3RKYA 3S3MA 2VYTA 1W2BA 3MHXA 2PVDB 3HFOA 2RM4A 3A8LB 4P72C 1EFWA 4HT4A 2G4CA 4YREA 4PJOF 4BI8B 5FLXE 4RQFA 2K3YA 2MWPA 3HL8A 5J3BA 4YRKA 1B70A 3IKLA 3P8YA 1DJ7B 3HHTB 5GMKh 3X25B 3WVDB 3ICAA 3META 1LOJA 3KFUA 2QQRA 2DTOA 4FT2A 3MP6A 2KSSA 3CCVA 5C51B 1LYLA 3OYAA 4KQEA 1XTDA 1E24A 4KULA 2P4TA 3JCMd 1QVGS 3KBGA 2RHSA 3QSUA 3CCET 1Z7MA 3T9NA 2CYZB 1K8AC 3X20B 3QBYA 3QYHB 5GAMj 3W3SA 3X28B 4MZMA 1H3ZA 3JCMP 3DB4A 3UH0A 3PTAA 2Q7HA 2NS6A 4LVLA 1SETA 1W4SA 4K86A 1JJ2A 1K9MU 2K57A 2B8AA 1B34B 3JCMJ 5LJ5j 3LYIA 2F69A 4M77F 4YRIA 2ZINA 3A32A 1VQNT 4X9CA 5GANe 2QDYB 2FB7A 1PYSA 2MMPA 2ALYA 1KQ2A 1VQOT 5D6WA 3NETA 5CVIA 2E5AA 3OA6A 2DAQA 1B76A 3FLGA 1VQLA 1RL2A 1PSEA 2M9UA 3VU3C 5CIUA 3CBOA 3OSVA 4M7AF 4R56A 4TWAA 4RQEA 1NE8A 2LQKA 1KQ1A 3TEHB 2XI9A 4ELYC 2KDSA 5J39A 2NLUA 2ZPIB 4FM4B 1YJNA 3GNFB 3V7RA 3L1AA 1N27A 2XTIA 2ODRD 3MQZA 4HWPA 3QJ6A 4H02A 4RMOA 2VGNA 2JUFA 2EQMA 3SWNA 1BI0A 4Q6GA 3JCMf 5GAN6 4PJOE 1VQ8T 5LJ3g 4N4HA 1E22A 4HA8A 4LD6A 4II1A 1M1KC 3BY7A 4XU3A 4TVAA 4OMFB 4H2YA 3KXTA 4M7DD 1SRYA 4A4HA 2E5QA 4IUPA 2YLCA 2DU5A 3MO8A 2I4NA 3JB9J 4PJOC 2LTOA 5CKDA 3HXZA 2HAXA 4BE2A 2C7IA 3QIIA 3RUXA 2LT1A 3M58A 3CCST 4EMKB 5HK0A 3WVEB 4ELZC 4CS4A 4YRQA 1VIEA 4RDXA 2Q7GA 4H2XB 3OBYA 3CC7A 3CCMT 2RD1A 5GAN2 1U1TA 2DIGA 4M7DG 2V8JA 5DM7R 1N8RU 2QHSA 3UGQA 5LJ5f 2L5QA 5KH6A 3QDRB 1BI1A 3M54A 1FYFA 1Y71A 3ER0A 3HY0A 4Z02A 4EPCA 2E6ZA 3BDLA 2E12A 3M57A 4M75B 4RCBA 4M77E 2OAUA 4M78B 1OI1A 3CCLT 2G3RA 3M56A 2EFIA 1XOVA 3HPWA 2ZPFB 5IT9E 4C8QG 3QPHA 2X35A 1NJIU 1FWZA 2X4XA 3S3OA 3PNWC 2PMFA 3C95A 1N9SA 4BE0A 2RI5A 4P73C 4F7UF 5KE3A 3CCEA 3G7ZA 3HP9A 4P75C 1N8RC 3HXYA 3A8GB 2RHIA 4M77C 1XQHA 1H4SA 1M4ZA 3MP8A 4TVRA 2R58A 4X34A 2DO3A 3I56T 3A7UA 4YRNA 2DXUA 5C53B 1Q86C 1UGRB 4E51A 3JCMh 4WJ4A 1VIFA 4Q5WA 4OB2B 2K4YA 4RG8A 4BDZA 2O01E 4FU6A 4EO4A 1NPRA 1QVPA 3QHSA 1NNHA 3M5AA 4BB7A 1VQNA 2R57A 4KUDK 1WYDA 4H2WA 1VQOA 4M7AA 1M1GA 4P74C 3HSBA 2DKGA 1X01A 1YFTA 1JB0E 4ATOA 1YIJT 1KQSA 3P8HA 5GANg 1EIFA 1ASYA 3SDZA 2O4XB 1VQPA 1ADYA 1YFSA 2VV5A 4A4GA 2YRVA 1N9RA 4MMKA 4E7HA 3E9IA 2IY5B 1J5WA 4IUUA 2ZZFA 4C0DC 1G51A 4OF1A 1WJSA 3CPWS 3UPUA 2LVMA 3HRUA 1WJRA 5J26A 4M75F 4XTYA 4OGEA 1Q7YU 2DQ3A 1Q81C 3PCOB 3FRNA 4PKCC 4J7IA 4ZGJB 2XK0A 5A0GA 4P5NA 3LSSA 4L87A 3EFRA 2E65A 2FYKA 3RKXA 2PVOB 2ZXFA 4G85A 2K2VA 5LL6S 1B34A 3H6ZA 2EL9A 3VBBA 2EJFA 3SB2A 1X75C 4JUVA 4C0GA 2ODRC 3BDUA 5I2SA 1VQ6T 4H2UA 5ELNA 3MEVA 1YI2A 2E41A 3CCSA 4YTLA 5GMKe 1HXDA 3OYIA 3LH0A 4F7UE 3JB9D 1BI2A 3VV0A 3M4YA 2JNGA 3MEAA 3QUIA 4ZTZB 4C92B 1FX7A 3G6ET 2K5FA 2Q5IA 3M4PA 4HWOA 5K1PA 1N6AA 3ME9A 4OB0B 2IG0A 4ZTFA 4GLKA 3GPLA 5CR2A 2OTJA 4N0AC 1O9SA 1BIAA 1EIYB 1X56A 1KC8C 4YYEA 1KD1C 1EOVA 3G1ZA 4RCCA 1ZQ1A 3M9QA 1NJ5A 3CCQT 2Y90A 3DB3A 4LVJA 3R07A 3E9FA 4IURA 3V7CA 3CCLA 1VQ4A 4JS5A 4OB1B 2LDMA 5CKFA 4DA4A 3RKWA 5CO7A 1HK9A 3E1SA 4JDSA 4PJOG 2EYQA 2CJBA 1NJ6A 4ZGEB 1YJ9T 3M4QA 4NS5A 3EFSA 2P0KA 3OS5A 2DPPB 3I56A 1WNLA 2RHQB 2KAFA 4CH5A 4XTVA 2CZ0B 4UC4A 4XTXA 4EMKA 3HFZB 1QVFA 2I4OA 2E64A 2P0LA 5HKCA 2DEQA 2E6NA 4H2XA 1KG1A 2BIVA 4BD3A 1YHQT 4B9XA 1VQ5A 5GAN8 1X2GA 2QXFA 4V2SA 4M77D 4P71A 1YJWT 3MEYA 4LDWA 4BW9A 4LDUA 4HT9A 2RHZA 1P92A 4A53A 1YIJA 1ZBXA 5KE2A 1ZHIA 2ZIOA 2HD0A 2V8IA 3GP8A 3TEEA 3PZCA 4M75A 1BBWA 4M7AD 2X4WA 3MEWA 4M78A 1B7YB 1OZ3A 3HXXA 2MAMA 2ZIMA 1KMNA 3MF2A 2RI2A 5FU6B 1X2HA 5C52B 4LVIA 3CMAT 2ARTA 3TREA 2ZT6A 5CCAA 4B9WA 2ZCFB 4KR2A 3PGGA 4BI4A 2ZPGB 4QQDA 5AYFA 3E9HA 3A5YA 3CC4A 4WJ3M 4LNSA 4C0ZA 3PIOA 3DSQA 1D3BB 1VQZA 1HTTA 4P3NA 5GAMd 2H3JA 1Y96B 3PT9A 3CC2T 1W2BS 5CK9A 1M5Q1 3AHUA 2QHTA 5GMKi 1Q82U 4XAXB 3G71T 3GF5A 3ZBDA 3JB9I 3CMET 3QZ5B 1QVFS 1Z7NA 1X54A 1WU7A 3LWHA 4UP8A 1C0AA 2QQAA 5LJ5d 4L5GA 4UP9A 4E7KA 3NTIA 3BJUA 3OMGA 3UT1A 3V8JA 3RESA 2RJCA 1K9MC 2RK2A 1X55A 1I5LA 4ZN3A 3X26B 4YP0A 4ME7A 2O4XA 1Q82C 3OYKA 3SWNC 4P3PA 4BACA 3DLMA 2IY5A 1I4K1 4LDXA 3J7AF 3M53A 3MEUA 4M7DB 4KBMB 1KHCA 4J8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9W A;  4M7D E;  4M78 C;  3HXU A;  5GAO p;  3A7U A;  4YRN A;  2DXU A;  5C53 B;  3PCO A;  3JCM b;  3HTZ A;  3REX A;  2EJ9 A;  4X5O A;  4E51 A;  2DJZ A;  3BFM A;  4YRT A;  4K88 A;  4G84 A;  3L2Z A;  3JCM h;  4WJ4 A;  5DY9 A;  5F5W A;  3A74 A;  4YCU A;  5CAI A;  3L4G B;  4H2V A;  5LJ3 h;  2JN0 A;  2CJ9 A;  1H4T A;  4RMF A;  2ZNJ A;  2RB6 A;  4M77 G;  4EO4 A;  1JBM A;  2DZ9 A;  3QHS A;  3JCM e;  1NNH A;  2AKW B;  4C8Q B;  4M7D C;  4QVD A;  2EJG A;  4UP7 A;  4HWS A;  5LJ3 e;  4H2S A;  3JCM c;  4C8Q E;  4YRF A;  4PJO D;  1WYD A;  4TVY A;  4H2W A;  4PHC A;  4M7A A;  3RAC A;  4P74 C;  1RIQ A;  3HSB A;  3RF1 A;  4HVC A;  2DKG A;  1X01 A;  1YFT A;  4J6W A;  4AH6 A;  1E1T A;  3FB9 A;  2CGH A;  5GAM f;  1QE0 A;  3JCM Q;  5KNN A;  2AMC B;  2E10 A;  3MF1 A;  4EMH A;  5GAN g;  4YRS A;  1ASZ A;  5GAN f;  3A31 A;  2DQ0 A;  1KOG A;  4N0A A;  3V8L A;  1ASY A;  1EQR A;  4M7A G;  3QTC A;  1ADY A;  1QF6 A;  1YFS A;  4F7U A;  1JRI A;  1USY C;  4XTW A;  3QO3 A;  1N9R A;  4MMK A;  3E9I A;  4CS3 A;  2IY5 B;  1WQW A;  1G5I A;  3IAL A;  2YLB A;  1J5W A;  2ZZF A;  4C8Q C;  4UPA A;  3JB9 H;  3NEN A;  1YCY A;  1G51 A;  5E3I A;  2QHV A;  4KR3 A;  4J6Y A;  4C92 A;  12AS A;  5GAM e;  4Q15 A;  4DQ2 A;  2Q7E A;  2AKW A;  5I21 A;  4M75 F;  2ARS A;  4F7U G;  2DXT A;  3FJP A;  4XTY A;  4XU0 A;  2ARU A;  4NOY A;  1TH7 A;  2DQ3 A;  4XU1 A;  1NJ8 A;  4NCX A;  3PCO B;  4ZTU B;  4OLF A;  4MML A;  5GAN 7;  2ZTG A;  3A7R A;  1H4Q A;  3JB9 F;  4C92 G;  4JRI A;  3UFG A;  4PNO A;  5GAO q;  2ZR2 A;  4ZIB A;  5LJ5 e;  1KMM A;  3LC0 A;  3LSS A;  1EVL A;  2VC8 A;  3HFV A;  3EFR A;  3RKY A;  4L87 A;  2E65 A;  1LNX A;  2I4M A;  2FYK A;  4Y91 A;  3RKX A;  4K87 A;  2DU7 A;  3HFO A;  2RHS B;  2RM4 A;  4OP0 A;  4P72 C;  1EFW A;  2G4C A;  2ZXF A;  5GMK l;  4YRC A;  3P8T A;  4G85 A;  4YRE A;  2ZGW A;  4PJO F;  4RQF A;  1L0W A;  1SES A;  5GAO n;  4HT8 A;  4YRK A;  1ATI A;  1B34 A;  1YGB A;  2EL9 A;  1B70 A;  3ERR A;  3IKL A;  3P8Y A;  3VBB A;  4M7A E;  2EJF A;  3SB2 A;  4TTV A;  4YRG A;  4JUV A;  5GMK h;  2ODR C;  1M8V A;  3IKM B;  4P3O A;  3BDU A;  3ICA A;  4M75 D;  1LOJ A;  4WF2 A;  3KFU A;  4H2U A;  5GMK m;  4M78 D;  5LJ3 j;  2DTO A;  5ELN A;  1YFR A;  4F7U B;  2E41 A;  1E1O A;  5GMK e;  5ELO A;  4CH3 A;  1HXD A;  1MGQ A;  4F7U E;  3JB9 D;  5C51 B;  2Q5H A;  1LYL A;  4J15 A;  1I81 A;  3QUI A;  4EX5 A;  4C92 B;  2C8M A;  2Q5I A;  2DZC A;  1E24 A;  3M4P A;  4HWO A;  2RHQ A;  2ZT5 A;  4KQE A;  5K1P A;  4CS2 A;  4M7A C;  3VQY A;  3JCM d;  2RHS A;  3A7A A;  5GAN 4;  4C92 E;  3QSU A;  3UGT A;  3HY1 A;  5LJ3 d;  1BIB A;  1Z7M A;  2DTH A;  3OD1 A;  4N0A C;  4YRP A;  1BIA A;  4XEO A;  3LSQ A;  4YRM A;  1EIY B;  1X56 A;  4YYE A;  3QO7 A;  5GAM j;  1EOV A;  3G1Z A;  4H2T A;  3W3S A;  4RCC A;  1NJ1 A;  2J3M A;  3JCM P;  1NJ5 A;  3UH0 A;  2Q7H A;  4X9D A;  4JRK A;  2E1H A;  2YHT A;  1SET A;  3M4G A;  2Y90 A;  1NYQ A;  4YRJ A;  1SER A;  5GAM h;  3R07 A;  4K86 A;  4C92 C;  3V7C A;  4PJO A;  5GAO m;  5GAN h;  2K57 A;  2ZT7 A;  1B34 B;  3JCM J;  5LJ5 j;  2ZR3 A;  1B70 B;  2I2L A;  3NEM A;  4XTZ A;  2PME A;  4C8Q D;  4ZTZ B;  4M77 F;  1WPY A;  4YRI A;  2ZIN A;  3A32 A;  3JCM X;  3RKW A;  5GAO r;  3HRI A;  4X9C A;  1HK9 A;  3CMQ A;  5GAN e;  5LJ5 h;  2ZCE A;  4PJO G;  2FB7 A;  4M78 F;  1PYS A;  2QTX A;  2CJB A;  1NJ6 A;  2ALY A;  2ZNI A;  4QVC A;  4BWA A;  1KQ2 A;  1WQ7 A;  1JJC A;  3IG2 A;  3NET A;  3M4Q A;  2E5A A;  3EFS A;  4YCV A;  3SWN B;  1B76 A;  1EIY A;  1USY A;  2ZZG A;  3INZ A;  3VU3 C;  1WNL A;  3RER A;  4O2D A;  2RHQ B;  4CH5 A;  4DPG A;  4XTV A;  3TEG A;  3RIR A;  4XTU A;  1WLE A;  4M7A F;  4TWA A;  4HWR A;  4XTX A;  4EMK A;  4TVA B;  3HFZ B;  4YRO A;  4M7D F;  4YDQ A;  5GMK j;  2I4O A;  2E64 A;  2P0L A;  4RQE A;  2DEQ A;  1D3B A;  1KQ1 A;  4H2X A;  3TEH B;  4NL3 A;  2CJA A;  5GAN 8;  1X2G A;  4V2S A;  4M77 D;  4XU2 A;  4XQ3 A;  4P71 A;  1B8A A;  3HRK A;  3MEY A;  3RGL A;  4HWT A;  3V7R A;  3L1A A;  2XTI A;  2ODR D;  4BW9 A;  5K1X A;  4HWP A;  5GAN 5;  4HT9 A;  4H02 A;  4TVW A;  3VQV A;  4A53 A;  4PJO B;  4P73 A;  3TUP A;  3SWN A;  2CIM A;  3A5Z A;  3JCM g;  4A54 A;  4PG3 A;  4P75 A;  4Q6G A;  3JCM f;  3RL6 A;  5GAN 6;  4PJO E;  5HGQ A;  2ZIO A;  4C8Q F;  5LJ3 g;  1E22 A;  1ADJ A;  4YRL A;  4M77 A;  5LJ3 f;  2EAY A;  3NEL A;  1W66 A;  4TQD A;  1U1S A;  4HA8 A;  3QNE A;  3JCM W;  4J6X A;  3PZC A;  4M75 A;  1BBW A;  3BY7 A;  4XU3 A;  3QO5 A;  1PYS B;  4M7A D;  3BW1 A;  4M78 A;  2ZT8 A;  4TVA A;  3HFZ A;  2ALY B;  4H2Y A;  1B7Y B;  2DVE A;  4M7D D;  2DTI A;  1SRY A;  3HXX A;  1JJC B;  2VXE A;  2ZIM A;  1KMN A;  3TEH A;  1IL2 A;  4JLI A;  5GAO l;  1G5H A;  4TQF A;  3MF2 A;  1HC7 A;  4CH6 A;  2YLC A;  1X2H A;  1NJ2 A;  2DU5 A;  4M75 G;  5C52 B;  2I4N A;  3JB9 J;  4PJO C;  2ART A;  2ZT6 A;  3QO8 A;  2XGT A;  4M78 G;  3HXZ A;  5GAN j;  4KR2 A;  3PGG A;  2J3L A;  3P8V A;  2C7I A;  3RUX A;  2VXF A;  3E9H A;  2HNI A;  4CH4 A;  5GAM g;  4EMK B;  3JB9 G;  3A5Y A;  4YRR A;  1GGM A;  4M7D A;  4CS4 A;  3JCM V;  1BBU A;  4YRQ A;  2E3C A;  4RDX A;  4WJ3 M;  4LNS A;  2Q7G A;  3DSQ A;  1D3B B;  4C92 D;  1VQZ A;  4H2X B;  1HTT A;  4P3N A;  5GAM d;  4P74 A;  1Y96 B;  2RD1 A;  1M5Q 1;  3AHU A;  2QHT A;  11AS A;  5GMK i;  4WI1 A;  5GAN 2;  1I8F A;  1U1T A;  3JB9 I;  5GAN d;  4YCW A;  4M7D G;  1Z7N A;  5LJ5 g;  1X54 A;  1B7Y A;  2QHS A;  1WU7 A;  3L4G A;  3UGQ A;  5LJ5 f;  1YB3 A;  5GAN 3;  4UP8 A;  3V7S A;  1C0A A;  1LJO A;  1FYF A;  5LJ5 d;  4UP9 A;  3HY0 A;  1EVK A;  3REU A;  4EMK C;  2EWN A;  4C8Q A;  1NYR A;  2QHU A;  4M77 B;  3BJU A;  3HFN A;  4M75 B;  4RCB A;  4M77 E;  3I7F A;  4M78 B;  2RA2 A;  3V8J A;  3RES A;  3HXV A;  4M75 E;  3VQX A;  3FIF A;  4P71 C;  1H4V B;  4XEM A;  2AMC A;  4M78 E;  1X55 A;  1I5L A;  3GIB A;  4C8Q G;  4NL2 A;  2ZZE A;  4YP0 A;  1Y96 A;  2PMF A;  3VQW A;  1N9S A;  2P5I A;  4P73 C;  3WQZ A;  4F7U F;  3SWN C;  4P3P A;  3V8K A;  2DDZ A;  2I4L A;  4EMG A;  4P75 C;  2IY5 A;  3HXY A;  1I4K 1;  1H64 1;  3HXW A;  4M7A B;  4YPF A;  4M77 C;  4J5Y A;  4M7D B;  4P72 A;  4C92 F;  1H4S A;  4M75 C; 
#chains in the Genus database with same CATH topology
 1YNZ A;  1W70 A;  3HXU A;  1QKW A;  2JMA A;  2AHJ B;  2KXD A;  1VQ7 Q;  5KYX B;  3CCQ A;  3OS1 A;  3PCO A;  3JCM b;  2QG9 B;  2L3R A;  4X5O A;  1MHN A;  2DJZ A;  2Y4Y A;  4YRT A;  4J9B A;  3URG A;  1JJ2 S;  4HKE A;  5F5W A;  4HVU A;  3L4G B;  1N8R R;  2ZPE B;  2JN0 A;  1MV0 B;  1X2K A;  1VQ7 A;  1NZ9 A;  1H4T A;  2RB6 A;  1YJ9 Q;  3VS7 A;  1D0X A;  2Y4X A;  1JBM A;  2DZ9 A;  2EQK A;  1EX4 A;  3JCM e;  4C8Q B;  3UWN A;  4QVD A;  1SRM A;  4UP7 A;  4HWS A;  1AD5 A;  4B6M A;  1Q86 R;  5KYN A;  2MF2 A;  4PHC A;  2QAZ A;  3RAC A;  3LWI A;  1YIT T;  3CEY A;  3PMI A;  4J6W A;  1PWT A;  4JJD A;  2CGH A;  2LCC A;  5GAM f;  1TOV A;  5KNN A;  4RTV A;  2O9V A;  4YRS A;  1NJI R;  2YRD A;  3CCR T;  1VQK T;  4ESR A;  3E9G A;  3QTC A;  4PLL A;  1QWF A;  4PFP A;  3HKS A;  2CH4 A;  2XDP A;  1Y07 A;  1USY C;  1YJW Q;  1MNE A;  2XU8 A;  4XTW A;  4J7F A;  4CS3 A;  1G5I A;  5FRM A;  2HQH A;  3G4S T;  1VYV A;  4R55 A;  4UPA A;  2EKO A;  2PU9 B;  1WYX A;  4J6Y A;  4C92 A;  5GAM e;  4DQ2 A;  2HDA A;  2AKW A;  3EG3 A;  5I21 A;  1T3L A;  4F7U G;  1YJW A;  1IHW A;  2EGA A;  4OMO A;  2LP5 A;  1NJ8 A;  4ZTU B;  2HQE A;  4OLF A;  1M27 C;  1VUB A;  4MML A;  3RNJ A;  5GAN 7;  2ZTG A;  7AT1 B;  1UUE A;  1V29 B;  2MWO A;  2VVK A;  3UAT A;  2A8E A;  1V76 A;  1GFC A;  2MI6 A;  4E47 A;  3RDV A;  3RBB B;  4BY6 C;  3EFO B;  4J9H A;  1ZUK A;  4LNP A;  5LJ5 e;  4MDX A;  2RF0 A;  3LC0 A;  4JLG A;  4PFO A;  4LE9 A;  3HFV A;  1LNX A;  2DRK A;  2I4M A;  4O5V A;  5I11 A;  4K87 A;  3F70 A;  2CP0 A;  3E2U A;  5FW9 A;  2RHS B;  2CUB A;  2FPD A;  1G3Y A;  4YRC A;  2RJF A;  3P8T A;  4Y28 E;  2KI7 A;  2QQ9 A;  1EFN A;  2DL8 A;  1SES A;  3C4S A;  5GAO n;  4LVK A;  2DIL A;  5KYW A;  1Q81 R;  2K3B A;  3GOX A;  1M2V B;  2D8J A;  1WFW A;  1VQ9 T;  1NBE B;  3FJ5 A;  2OTL T;  3ERR A;  2C0O A;  4M7A E;  4HXJ A;  1ARK A;  4HCB A;  4YRG A;  4N4G A;  3IKM B;  2DMO A;  5FRO A;  1NEB A;  4M75 D;  2V1Q A;  5KCO A;  2A0F B;  5D6Y A;  4M78 D;  5LJ3 j;  2AKK A;  2J05 A;  1E1O A;  3G71 Q;  2L8D A;  2B86 A;  1CSK A;  1R77 A;  5KCH A;  3X24 B;  3OMC A;  5ELO A;  1I0C A;  3CME Q;  2FL7 A;  1Z9Q A;  2YXY A;  5A0D A;  4ZNX A;  3CXC P;  2COW A;  4LDV A;  2BZ8 A;  1NJI C;  3MP1 A;  1ZSZ B;  4EX5 A;  2RHQ A;  2ZT5 A;  2D1X A;  4CS2 A;  1WGS A;  4M7A C;  3VQY A;  1WLP B;  3CXC A;  3G71 A;  2RI3 A;  3CBP A;  3CME A;  1AVZ C;  3HY1 A;  5LJ3 d;  1WA7 A;  1OYX A;  2A08 A;  4A4K A;  1Q7Y R;  1BIB A;  2DTH A;  1BI3 A;  4J9C A;  2IVW A;  1X2Q A;  3OD1 A;  4XEO A;  2PUO B;  3L2W A;  1RI0 A;  5IHN A;  2A7Y A;  2KNB B;  2WSF E;  3JV3 A;  1PM3 A;  2F5K A;  2COY A;  1LPL A;  4FIB A;  1Y57 A;  2C06 A;  2E1H A;  2YHT A;  1J3T A;  3O8V A;  3OYH A;  4YRJ A;  2ZPH B;  3LLR A;  2D6F A;  5GAM h;  1SER A;  1KFZ A;  2QK0 A;  2EQJ A;  5GAO m;  3OW2 P;  2KQW A;  3CCV T;  2PVG B;  3M0U A;  4WCI A;  4QT7 A;  3N5B B;  4XTZ A;  2DD4 A;  1WPY A;  4HCK A;  1R8O B;  3OW2 A;  4BDY A;  1HSQ A;  4KRT A;  1KC8 R;  2JOY A;  2K5I A;  2QEX T;  5GAO r;  1TUG B;  2K5L A;  5IH2 A;  5LJ5 h;  2ZCE A;  4LD9 K;  4CC4 B;  4M78 F;  1VQ8 Q;  1YN8 A;  5KYU A;  2ZNI A;  3A1P A;  4QVC A;  4JJC A;  4BWA A;  1WQ7 A;  3H9N A;  3OSS C;  2XKO C;  2LZ6 B;  1RAE B;  2CP6 A;  1UTI A;  3SWN B;  4KH1 B;  1YCS B;  2LQ8 A;  1VQ8 A;  3INZ A;  1D0Y A;  3RER A;  1PG5 B;  1TWB A;  4O2D A;  4DPG A;  3TEG A;  3RIR A;  2D9T A;  3KUF A;  4XTU A;  4FL6 A;  3QDF A;  1FMW A;  2KE9 A;  3S3N A;  2RQU A;  5IAY A;  4TVA B;  4YRO A;  4PJM A;  2CS7 A;  2HBP A;  4YDQ A;  2FPF A;  2ROL A;  2FEI A;  4F16 A;  1D3B A;  4OGC A;  1OEB A;  4OML A;  1ZSG A;  4NL3 A;  3FDR A;  1G5V A;  4A63 B;  3VS0 A;  2CJA A;  1AWO A;  1CKB A;  2VUB A;  2FRY A;  4DBQ A;  2LCS A;  1Q7Y C;  3RGL A;  4HWT A;  2LX7 A;  2XDD A;  3CCM Q;  1RAA B;  2RQR A;  2RH2 A;  1NM7 A;  1QCO A;  5GAN 5;  1VQK Q;  4TVW A;  2IPO B;  2QYZ A;  2AT1 B;  4E7J A;  1M90 U;  3EH1 A;  4PJO B;  3TUP A;  4E7L A;  2R5M A;  2CIM A;  3JCM g;  1VQL T;  4A54 A;  1KQS S;  3RL6 A;  5HGQ A;  1K73 U;  1PRM C;  2WSC E;  2X3W D;  1HYO A;  1RAB B;  3CCM A;  1BK2 A;  2KGT A;  3S6W A;  2P0Q A;  4YRL A;  5LJ3 f;  2EAY A;  3NEL A;  1W66 A;  1VQK A;  4MDW A;  3QNE A;  2GQI A;  3RMS A;  3JCM W;  1WX6 A;  3I55 T;  1T3S A;  3A8M B;  1XNI A;  3QO5 A;  2MK5 A;  2Z0W A;  1RAH B;  3BW1 A;  2ZT8 A;  1NYF A;  1KJW A;  2L2P A;  2DTI A;  4CRI A;  1JJC B;  3L2R A;  1IL2 A;  3TEH A;  4CH6 A;  1NJ2 A;  2EQI A;  3UA7 A;  2XGT A;  1PKS A;  2EGE A;  2ZAE A;  5GAN j;  3P8V A;  2VXF A;  4A4E A;  4PLI A;  2DD5 A;  2MCN A;  5GAM g;  3JB9 G;  5EG2 A;  2M02 A;  1GGM A;  3SEM A;  4M7D A;  1BBU A;  4FSX A;  4C92 D;  3EHQ A;  2DYB A;  4KUI A;  1QVG P;  2CP7 A;  9ATC B;  3R6N A;  2CP2 A;  2QGF B;  1UGS B;  2I0N A;  2OTL Q;  1QVG A;  4WI1 A;  1I8F A;  2DXC A;  5GAN d;  4YCW A;  4BUG A;  4J83 A;  1O75 A;  1UGP B;  5LJ5 g;  2KYM A;  1T0H A;  3L4G A;  1YB3 A;  2RQW A;  3ASK A;  1EZZ B;  3E19 A;  3JSC A;  3A8H B;  2GQV A;  3A5Z B;  1XJW B;  4HCZ A;  2EYW A;  4ZN1 A;  1EVK A;  2DBK A;  3REU A;  4EMK C;  2EWN A;  4C8Q A;  2QHU A;  4FCY A;  4M77 B;  1G3S A;  4AG2 C;  1GCQ C;  2YUN A;  3OYD A;  1Y0M A;  1I5O B;  2BE9 B;  4IUQ A;  2RA2 A;  3HXV A;  4M75 E;  4QW2 A;  2JS2 A;  3FIF A;  4P71 C;  3VQX A;  1H4V B;  1AHJ B;  4FYY B;  4M78 E;  3GIB A;  3OYY A;  2CZ6 B;  4NL2 A;  2ZZE A;  2EIF A;  1YFN A;  2GFU A;  4FYW B;  1S72 T;  1H64 1;  3JAM E;  3CCU T;  4M7A B;  4YPF A;  2ZPB B;  1K8A U;  4XK8 E;  4P72 A;  4C92 F;  4M75 C;  4Z88 A;  1K9M R;  3OYM A;  1N9W A;  3M0P A;  4M78 C;  3VYH B;  1WJQ A;  5GAO p;  3VS5 A;  1K0S A;  1UGV A;  2PZ1 A;  5A0L A;  3REX A;  3HTZ A;  2EJ9 A;  3LGL A;  2JTE A;  3BFM A;  3Q1J A;  3QWY A;  3CBM A;  1Q82 R;  3EAE A;  3L2Z A;  2QEX Q;  2LNV A;  2AIR B;  3BE3 A;  3EFO A;  1C6V X;  5CQY A;  4HCC A;  3M55 A;  4H2V A;  1KIK A;  5LJ3 h;  2F5T X;  2QA4 T;  3RMQ A;  2JZ2 A;  2ZNJ A;  4M77 G;  2XID A;  1OZ2 A;  2LC4 A;  3LGF A;  2QAS A;  3DKM A;  2CDT A;  2QEX A;  2GCX A;  1OQK A;  4C0D B;  2LT4 A;  1KHI A;  3WXM B;  4H2S A;  3EGX B;  4YRF A;  4TVY A;  1WIE A;  3J81 E;  1M2V A;  1RIQ A;  3RF1 A;  1W1F A;  3AT1 B;  2M0Y A;  4AH6 A;  1E1T A;  3FB9 A;  2X4Y A;  4AT1 B;  3JCM Q;  3O5Z A;  1SSH A;  3DLL A;  2AMC B;  2E10 A;  3VYG A;  2O88 A;  3MF1 A;  4EMH A;  2DL5 A;  1ASZ A;  4RG2 A;  5GAN f;  3A31 A;  2DQ0 A;  4VUB A;  3V8L A;  3VS3 A;  1M9S A;  4M7A G;  3TCJ A;  2M16 A;  2DBM A;  2BZY A;  1BB9 A;  1K4U S;  2JM8 A;  1WQW A;  1G3W A;  1VQ6 Q;  1R0B G;  4RKU E;  3JB9 H;  4JRQ A;  4KR3 A;  1ZSZ A;  4Q15 A;  5C0M A;  2CKK A;  4RTY A;  2Q7E A;  4N4I A;  2A28 A;  2ARS A;  2DXT A;  3FJP A;  4XU0 A;  2ARU A;  4NOY A;  1Z9Z A;  4IUV A;  1VQ6 A;  3G6E Q;  1UEB A;  3LX7 A;  3A7R A;  2NUZ A;  1GBQ A;  3L2U A;  3UDC A;  3I55 Q;  2COZ A;  4JRI A;  2FVU A;  5GAO q;  2ZR2 A;  4ZIB A;  2LJ1 A;  3R6O A;  1KMM A;  4E7I A;  3G6E A;  2ATC B;  4Y91 A;  3A8O B;  2DU7 A;  1VQP T;  1M1K U;  3I55 A;  1NLO C;  4OP0 A;  2C0I A;  3CPF A;  3GNG A;  4FW1 A;  2X4J A;  5GMK l;  2ZGW A;  3NFC A;  1TUD A;  2KBT A;  1L0W A;  1QP2 A;  2ESW A;  4HT8 A;  4BE1 A;  1ATI A;  1YGB A;  3MCA B;  4C0F A;  1WHH A;  5KYY B;  3OBW A;  3OYE A;  8ATC B;  1BBZ A;  2LNH B;  3VJP A;  4TTV A;  1M8V A;  3VKI A;  2KMT A;  4P3O A;  4IUT A;  2RQV A;  2NWM A;  1PSF A;  4WF2 A;  3OYL A;  2KYB A;  1JU5 C;  2EGC A;  1U3O A;  5GMK m;  1UEC A;  2LJ3 A;  1YFR A;  4F7U B;  3QG1 A;  4O6J A;  2RPN A;  4JJN K;  2DL4 A;  3FEO A;  4CH3 A;  1ZA2 B;  4QQ6 A;  1MGQ A;  1UB4 A;  4FYV B;  2J7I A;  2Q5H A;  1JXO A;  4J15 A;  3EGU A;  1OX9 A;  1AEY A;  1I81 A;  1TXQ A;  2DF6 A;  2C8M A;  1H92 A;  2DZC A;  2XHC A;  2RJD A;  3CCJ T;  4AFS C;  4GLM A;  3A7A A;  5GAN 4;  4C92 E;  2D0N A;  2JVV A;  1I1J A;  3EH2 A;  5FU7 C;  3UGT A;  4JJB A;  2BE7 D;  1RAC B;  5DLO A;  4E6R A;  1QCN A;  4EDU A;  1YJ9 A;  4YRP A;  1UHC A;  1D1C A;  3LSQ A;  4YRM A;  5C6S A;  3QO7 A;  4H2T A;  4QVZ A;  2GF7 A;  1WZO A;  2RK1 A;  1NJ1 A;  2EVR A;  2J3M A;  3CD6 T;  1YHQ Q;  4X9D A;  3SHW A;  2CSQ A;  4JRK A;  4OB3 B;  3G1J A;  5CKB A;  3M4G A;  1NYQ A;  5L8R E;  4GY5 A;  2K9G A;  4C92 C;  1YI2 T;  4JPB W;  4PJO A;  2VGM A;  2HQX A;  1S72 Q;  1LVK A;  3A98 A;  5GAN h;  4J9I A;  2ROT A;  2ZT7 A;  2RHY A;  5HK3 A;  1G3T A;  1YHQ A;  2ZR3 A;  1B70 B;  2M0O A;  3CCU Q;  4JS4 A;  2I2L A;  3NEM A;  2PME A;  4C8Q D;  1CKA A;  3NTK A;  1PHT A;  2V8K A;  3JCM X;  2VWF A;  4D6W A;  5GJW B;  3SFM A;  3HRI A;  4F14 A;  2KRM A;  4BI3 A;  3EG9 A;  3CMQ A;  1S72 A;  1C0M A;  2QTX A;  2SRC A;  2OTJ T;  1WHK A;  3CCU A;  1JJC A;  3IG2 A;  4MZT A;  4YCV A;  1EIY A;  2EYY A;  1USY A;  2KY9 A;  5IHK A;  2AZS A;  2RHU A;  2ZZG A;  2FZC B;  2F2W A;  2PQW A;  4OVA A;  4C5E A;  2QA4 Q;  1Q86 U;  3OYJ A;  2XD0 A;  1WLE A;  1IZ6 A;  2RO0 A;  4HWR A;  2QI2 A;  4JRP A;  3CMA Q;  2WAC A;  3CPW P;  1ABQ A;  2VKN A;  4M7D F;  2LX9 A;  1VQM T;  5GMK j;  1OPL A;  2ED0 A;  1VQ4 T;  2O31 A;  3NMZ C;  4HVV A;  2BUD A;  3PVL A;  2QA4 A;  3CPW A;  5HY6 A;  3H8Z A;  2LCL A;  4XU2 A;  3OB9 A;  4XQ3 A;  3CMA A;  1B8A A;  3HRK A;  5GJV B;  4MZP A;  2D0Q B;  2GFA A;  3OYB A;  2CZ7 B;  1IRX A;  5K1X A;  3M59 A;  4FT4 A;  1IXD A;  3CC2 Q;  3VQV A;  2QQB A;  5L23 A;  4LDY A;  3OS2 A;  4P73 A;  4GBQ A;  3A5Z A;  1GCP A;  2JTF A;  1QMC A;  4RTW A;  1OX8 A;  2JW4 A;  5FRN A;  2EPD A;  4PG3 A;  4P75 A;  2ZZD A;  4C8Q F;  2E5K A;  2QTV A;  3OYF A;  4J9D A;  3D7S B;  1ADJ A;  4M77 A;  3CC2 A;  4TQD A;  1U1S A;  1OV3 A;  4J6X A;  4F04 B;  1RAI B;  3FC3 A;  3PFS A;  2W0Z A;  4KH0 B;  1PYS B;  3HFZ A;  2ALY B;  4AFZ C;  2DVE A;  2E4H A;  2QQS A;  2CUD A;  2VXE A;  2DXB A;  2OAW A;  4JLI A;  5GAO l;  1G5H A;  4TQF A;  2XDB A;  4IKF A;  1VQ5 T;  1HC7 A;  1SG5 A;  4FYX B;  4AFQ C;  4M75 G;  4OMQ A;  2E70 A;  3NPF A;  3QO8 A;  2J6K A;  3P8B B;  4M78 G;  1Q81 U;  1M2O A;  4KT0 E;  2J3L A;  1QW1 A;  1BKB A;  2NUP A;  3PE0 A;  1VQP Q;  2HNI A;  4CH4 A;  1UJY A;  2LRQ A;  4YRR A;  4CI0 C;  1GXI E;  3JCM V;  4E7S A;  2E3C A;  3OYG A;  3ZL7 C;  3TU4 K;  3QZ9 B;  2PUK B;  5CKE A;  4P74 A;  1GFD A;  2CZ1 B;  3VUZ A;  3HRS A;  4ZGD B;  11AS A;  1B7T A;  3GLX A;  1LCK A;  3OS0 A;  2M1H A;  3ZEH A;  2FRW A;  5ECA A;  4D8K A;  1E6H A;  5FU6 C;  1AWJ A;  1H8K A;  1B7Y A;  2YDL A;  1BU1 A;  3P8D A;  1U8R A;  3PIP A;  5GAN 3;  1D0Z A;  2O2O A;  2EKH A;  3V7S A;  1GL5 A;  3EG0 A;  2R5A A;  2ED1 A;  4PL6 A;  1LJO A;  5DLQ E;  2EQU A;  1SSF A;  1MND A;  2DA9 A;  3NTH A;  4PFZ A;  1NYR A;  1I07 A;  1OOT A;  3QYG B;  4L6V 5;  3HFN A;  3EGX A;  3OYN A;  5IN1 A;  3CCJ Q;  2M51 A;  3C12 A;  1NLP C;  2XIC A;  2KK4 A;  3I7F A;  3H0I A;  3CC4 T;  4XEM A;  5I2M A;  2AMC A;  4ZTJ A;  1ZA1 B;  3LH5 A;  2RHX A;  3OYC A;  2X9H A;  1YIT Q;  3L2V A;  1Y96 A;  2YSQ A;  2ECZ A;  3CCJ A;  3VQW A;  1D1B A;  1FXX A;  3C94 A;  3CXC S;  2P5I A;  3QJY A;  3WQZ A;  3V8K A;  2FG0 A;  2DDZ A;  2I4L A;  2FHD A;  1D1A A;  4EMG A;  2DER A;  3CD6 Q;  2JTM A;  3CCR Q;  1PD0 A;  2BKD N;  3HXW A;  4QQG A;  1YIT A;  4J5Y A;  2RJE A;  2DE0 X;  2RQT A;  1M1F A;  3J80 E;  5FU7 B;  1KC8 U;  5M9O A;  1KD1 U;  3SD4 A;  1UGQ B;  2K2M A;  4M7D E;  3G4S Q;  4LVM A;  3RR6 A;  5EC7 A;  3CD6 A;  2C0T A;  1RLP C;  3CCR A;  1N5Z A;  2VB6 A;  2L89 A;  3PMT A;  3HRT A;  2BTT A;  2K3X A;  4K88 A;  4G84 A;  3TSW A;  5DY9 A;  3A74 A;  4YCU A;  5CAI A;  3G4S A;  1NPP A;  1E6G A;  3OY9 A;  2MIO A;  2DK3 A;  2FZG B;  2X3X D;  1YBY A;  4DBF A;  2CJ9 A;  3GBQ A;  4C5H A;  4RMF A;  2EW3 A;  2J06 A;  2HEQ A;  3I5S A;  3OW2 S;  2P0P A;  5AT1 B;  3ZFJ A;  2AKW B;  3H0H A;  5CQX A;  1FMK A;  1ZBJ A;  3QKJ A;  3L2Q A;  1YJN T;  4M7D C;  2EJG A;  3M0R A;  5IXB A;  5LJ3 e;  2IIM A;  3LW5 E;  3JCM c;  4C8Q E;  5A2Q E;  4PJO D;  1SPK A;  2A3L A;  2GBQ A;  3VUB A;  4AFU C;  1M90 C;  2F2V A;  1Q95 G;  4HVC A;  1X6G A;  4DOV A;  1B07 A;  1QE0 A;  5KYY A;  2XG8 D;  2KT8 A;  1K73 C;  5D6X A;  1VQM Q;  3L42 A;  2V1R A;  2WSE E;  2DIQ A;  1KOG A;  4C5I A;  4N0A A;  1VQ9 Q;  5KYX A;  1EQR A;  1SF9 A;  2E3H A;  4BY6 B;  1QP3 A;  1MMN A;  1QF6 A;  4F7U A;  1JRI A;  2KVQ G;  1RAD B;  2RNA A;  1IRE B;  3QO3 A;  4DBR A;  3IAL A;  1VQM A;  2YLB A;  4C8Q C;  2YUQ A;  5KYW B;  3NEN A;  1YCY A;  1VQ9 A;  5E3I A;  1VQ7 T;  2QHV A;  2YUP A;  2OTL A;  3QXE B;  12AS A;  1S1N A;  1K8A R;  3VS6 A;  4DOW A;  1TH7 A;  1X69 A;  4C5G A;  1UFF A;  4XU1 A;  4NCX A;  3JRZ A;  2KRN A;  1H4Q A;  3UF4 A;  3ULR B;  3JB9 F;  4C92 G;  1NYG A;  1X6O A;  1Y7X A;  5CKH A;  4A4F A;  3UFG A;  3NHN A;  3OQ5 A;  4PNO A;  2LQW A;  1W2B P;  2HL5 C;  2LQN A;  3H0F A;  4L59 A;  1JEG A;  1EVL A;  1BYM A;  2VC8 A;  4K11 A;  3CC7 T;  3EGD B;  3RKY A;  1ZLM A;  3S3M A;  2VYT A;  1W2B A;  3MHX A;  2PVD B;  2A36 A;  3HFO A;  2RM4 A;  3A8L B;  4P72 C;  1EFW A;  1HJD A;  4HT4 A;  2G4C A;  4YRE A;  2KRO A;  4PJO F;  4BI8 B;  5FLX E;  4RQF A;  1TU0 B;  2K3Y A;  2MWP A;  3HL8 A;  1QKX A;  2K79 A;  5J3B A;  4YRK A;  1TTH B;  1B70 A;  3IKL A;  3P8Y A;  1DJ7 B;  2FO0 A;  3HHT B;  2A37 A;  2ABL A;  5GMK h;  1T0J A;  3CCV Q;  3X25 B;  2EYX A;  1AZE A;  3WVD B;  3ICA A;  3MET A;  1LOJ A;  3KFU A;  2QQR A;  1E7O A;  3VRY A;  2DTO A;  4FT2 A;  2P84 A;  3MP6 A;  2KSS A;  3CCV A;  5C51 B;  1JXM A;  2JS0 A;  1LYL A;  3OYA A;  3EHR A;  4KQE A;  1XTD A;  2HBW A;  4E2F B;  4KUL A;  1E24 A;  1QWE A;  2GTJ A;  2P4T A;  3JCM d;  1QVG S;  3KBG A;  2RHS A;  3QSU A;  2YRC A;  3I5R A;  1AWX A;  3CCE T;  4R0K A;  5KYU B;  3M0S A;  1Z7M A;  3T9N A;  1K9A A;  2CYZ B;  4J9F A;  1K8A C;  3X20 B;  4ORZ A;  3QBY A;  3QYH B;  5GAM j;  3W3S A;  3VS1 A;  3X28 B;  4MZM A;  1H3Z A;  1WI7 A;  3JCM P;  2L3P A;  3DB4 A;  3UH0 A;  3PTA A;  1JJ2 P;  2Q7H A;  4LN2 A;  2NS6 A;  4LVL A;  1SET A;  1W4S A;  1ZSZ C;  4K86 A;  1JJ2 A;  1K9M U;  1D09 B;  1PCX A;  2B8A A;  2K57 A;  3M0Q A;  1B34 B;  3JCM J;  5LJ5 j;  3LYI A;  2F69 A;  4M77 F;  4YRI A;  2ZIN A;  3A32 A;  1VQL Q;  1VQN T;  4X9C A;  5GAN e;  3TSZ A;  2QDY B;  2FB7 A;  1PYS A;  2MMP A;  2ALY A;  1KQ2 A;  1VQO T;  5D6W A;  3NET A;  5CVI A;  2E5A A;  3OA6 A;  2DAQ A;  1B76 A;  3FLG A;  1VQL A;  1RAG B;  1MUZ A;  1RL2 A;  1PSE A;  2O9S A;  2M9U A;  3VU3 C;  1M3C A;  5CIU A;  3I35 A;  3CBO A;  3OSV A;  4M7A F;  4R56 A;  4TWA A;  1YJN Q;  2H8H A;  2GNC A;  4RQE A;  1NE8 A;  2LQK A;  1KQ1 A;  1ZUU A;  4CC3 A;  5IXF A;  2HMA A;  3TEH B;  2CRE A;  2XI9 A;  4ELY C;  2D8H A;  2KDS A;  5J39 A;  2NLU A;  2ZPI B;  4FM4 B;  2MYS A;  1YJN A;  1H3H A;  3GNF B;  1UG1 A;  3V7R A;  2DJQ A;  3L1A A;  1N27 A;  5D7U A;  2XTI A;  2ODR D;  4PJL A;  4DBH A;  3MQZ A;  4HWP A;  3QJ6 A;  4H02 A;  4RMO A;  4AMC A;  2VGN A;  2JUF A;  2HKN A;  2EQM A;  1OU9 A;  1WDX A;  1BI0 A;  3SWN A;  1ACM B;  1WHJ A;  4Q6G A;  3JCM f;  5GAN 6;  4PJO E;  1VQ8 T;  5LJ3 g;  1GRI A;  4N4H A;  1K1Z A;  1C1A A;  1E22 A;  4DEX A;  4HA8 A;  4LD6 A;  4II1 A;  1M1K C;  3BY7 A;  4XU3 A;  4TVA A;  4OMF B;  1QLY A;  1NG2 A;  4H2Y A;  3KXT A;  1HD3 A;  4M7D D;  1SRY A;  2DM1 A;  4A4H A;  1X43 A;  2E5Q A;  1QCF A;  4IUP A;  2YLC A;  2FZK B;  1G83 A;  2DU5 A;  3MO8 A;  2I4N A;  3JB9 J;  4PJO C;  1AOJ A;  4CC7 A;  2LTO A;  5CKD A;  3HXZ A;  4E7Z A;  3VS4 A;  3CC7 Q;  2HAX A;  4BE2 A;  2C7I A;  3QII A;  3RUX A;  2LT1 A;  3M58 A;  1SEM A;  4JZ3 A;  3CCS T;  4EMK B;  5HK0 A;  3WVE B;  4ELZ C;  2DRM A;  4CS4 A;  1UE9 A;  4YRQ A;  1VIE A;  4RDX A;  2Q7G A;  4H2X B;  1RI9 A;  1UHF A;  2YT6 A;  4KGX B;  2L3Q A;  2BZX A;  2KR3 A;  3OBY A;  3KFV A;  3CC7 A;  3CCM T;  1TUC A;  2P4R A;  2K6D A;  4RTX A;  2RD1 A;  1WHM A;  1WXT A;  5GAN 2;  2J6O A;  1U1T A;  2DIG A;  1IB8 A;  2CP3 A;  3I9Q A;  4M7D G;  2V8J A;  5DM7 R;  2XMF A;  1N8R U;  2CSI A;  2QHS A;  3CQT A;  3UGQ A;  5LJ5 f;  2DYI A;  2L5Q A;  1GBR A;  4KGV B;  5KH6 A;  3QDR B;  1BI1 A;  3M54 A;  1FYF A;  1Y71 A;  1TSF A;  6AT1 B;  3ER0 A;  3HY0 A;  4Z02 A;  4EPC A;  2E6Z A;  1AZG B;  3BDL A;  2E12 A;  3M57 A;  4M75 B;  4RCB A;  4RUG A;  4M77 E;  2OAU A;  4M78 B;  1OI1 A;  3CCL T;  2G3R A;  3CCE Q;  3M56 A;  2EFI A;  1XOV A;  3HPW A;  2ZPF B;  5IT9 E;  1YWO A;  4C8Q G;  3QPH A;  2X35 A;  1NJI U;  1FWZ A;  2JT4 A;  1QQJ A;  2X4X A;  3S3O A;  1PC0 A;  3PNW C;  2PMF A;  3C95 A;  5HCK A;  1N9S A;  4BE0 A;  2DX1 A;  2RI5 A;  4P73 C;  4F7U F;  5KE3 A;  3CCE A;  2L0A A;  3G7Z A;  4F17 A;  3HP9 A;  4P75 C;  1G2B A;  1N8R C;  3HXY A;  3A8G B;  2RHI A;  2DFU A;  1V1C A;  4M77 C;  1XQH A;  1IGQ A;  1H4S A;  1M4Z A;  2GGR A;  2CP5 A;  3MP8 A;  4TVR A;  2JMC A;  2R58 A;  4X34 A;  2DO3 A;  3I56 T;  3A7U A;  2J6F A;  4YRN A;  2DXU A;  5C53 B;  1Q86 C;  1UGR B;  3TQ7 P;  1NEG A;  4E51 A;  3JCM h;  1VQN Q;  4WJ4 A;  1VIF A;  4Q5W A;  1W6X A;  4OB2 B;  2K4Y A;  4PJN A;  1WXU A;  2NUT B;  2CT3 A;  4IIM A;  4RG8 A;  1G8X A;  4BDZ A;  1VQO Q;  2O01 E;  3EGD A;  4FU6 A;  4EO4 A;  1NPR A;  2KT1 A;  4AG1 C;  1QVP A;  3QHS A;  1NNH A;  3M5A A;  2G6F X;  4BB7 A;  1VQN A;  1IHV A;  2R57 A;  1A0N B;  4KUD K;  4FSS A;  2YWW A;  1KQS P;  1WYD A;  2E3I A;  4H2W A;  1VQO A;  3HTR A;  1M1G A;  4M7A A;  4P74 C;  3HSB A;  2DKG A;  1BCM A;  1X01 A;  1YFT A;  1JB0 E;  4ATO A;  1YIJ T;  1PRL C;  4J9E A;  1ABO A;  2EBP A;  3P8H A;  1KQS A;  2DL3 A;  5GAN g;  1KSW A;  4KGZ B;  2L3S A;  1EIF A;  2DET A;  2V26 A;  1ASY A;  3SDZ A;  2O4X B;  1VQP A;  1ADY A;  1YFS A;  2VV5 A;  4A4G A;  2YRV A;  1N9R A;  4MMK A;  4E7H A;  3E9I A;  2IY5 B;  2LJ0 A;  1J5W A;  4IUU A;  2ZZF A;  4C0D C;  2PNI A;  4M4Z A;  1G51 A;  2RMO A;  4OF1 A;  1WJS A;  2W10 A;  3CPW S;  1M90 R;  3UPU A;  2LVM A;  2X51 A;  3HRU A;  1WJR A;  5J26 A;  1KD1 R;  4M75 F;  4XTY A;  2HL3 A;  4OGE A;  1K73 R;  2YUO A;  1AT1 B;  1Q7Y U;  2DQ3 A;  1Q81 C;  3PCO B;  3FRN A;  4PKC C;  4IIO A;  1M3B A;  1UJ0 A;  4J7I A;  4ZGJ B;  2RN8 A;  1SRL A;  3M0T A;  2JJ9 A;  2XK0 A;  3REB B;  3REA B;  5A0G A;  4RTU A;  4P5N A;  4ANJ A;  1TG0 A;  3LSS A;  4L87 A;  3EFR A;  2EYZ A;  2E65 A;  2F1L A;  8AT1 B;  2FYK A;  2MOX A;  3RKX A;  2PVO B;  1SKU B;  4OMM A;  2FPE A;  2ZXF A;  1U06 A;  4G85 A;  2K2V A;  5LL6 S;  1YWP A;  4J9G A;  1B34 A;  3H6Z A;  2EL9 A;  2KXC A;  1YI2 Q;  1AWW A;  3CCS Q;  3VBB A;  2EJF A;  3SB2 A;  1X75 C;  2AZV A;  4JUV A;  4C0G A;  2ODR C;  3BDU A;  2DLP A;  5I2S A;  1VQ6 T;  4H2U A;  3IQL A;  5ELN A;  3MEV A;  1YI2 A;  4JZ4 A;  2E41 A;  3CCS A;  4YTL A;  1B3Q A;  1M8M A;  5GMK e;  3MPU B;  1HXD A;  3OYI A;  3LH0 A;  1PKT A;  4F7U E;  3JB9 D;  1BI2 A;  4DEY A;  2OTJ Q;  1VYU A;  4OMP A;  3M4Y A;  2JNG A;  3VV0 A;  3MEA A;  3QUI A;  4WTO B;  4ZTZ B;  4C92 B;  1FX7 A;  3G6E T;  2K5F A;  2Q5I A;  3M4P A;  4HWO A;  5K1P A;  2KEA A;  1N6A A;  3ME9 A;  4OB0 B;  3VRZ A;  2IG0 A;  4ZTF A;  1WXB A;  4GLK A;  3GPL A;  2AKL A;  3EG9 B;  5CR2 A;  2OTJ A;  2ENM A;  4N0A C;  1O9S A;  1BIA A;  1EIY B;  1X56 A;  1KC8 C;  4YYE A;  1KD1 C;  3CCL Q;  1EOV A;  3G1Z A;  1SHF A;  1VQ4 Q;  1VOM A;  4RCC A;  1ZQ1 A;  3TVT A;  1OPK A;  1KK7 A;  4LUD A;  2OI3 A;  3M9Q A;  1NJ5 A;  3CCQ T;  2Y90 A;  3DB3 A;  1MMG A;  4LVJ A;  4FW2 A;  2DEU A;  3R07 A;  3E9F A;  4Z8A A;  4IUR A;  3V7C A;  1RUW A;  4D8D A;  3CCL A;  1VQ4 A;  4JS5 A;  4OB1 B;  2LDM A;  5CKF A;  4DA4 A;  2CT4 A;  1R0C B;  4X1V A;  3EG1 A;  3THK A;  2KRS A;  4LXC A;  3RKW A;  5IHI A;  5CO7 A;  1HK9 A;  3E1S A;  1ZX6 A;  4JDS A;  4PJO G;  2EYQ A;  2CJB A;  1NJ6 A;  3I56 Q;  4ZGE B;  2PTK A;  4EIK A;  2GTO A;  1YJ9 T;  4NS5 A;  3M4Q A;  3EFS A;  2P0K A;  1M3A A;  4HVW A;  3OS5 A;  1K0X A;  2DPP B;  3I56 A;  1WNL A;  2RHQ B;  2KAF A;  1QVF P;  2HSP A;  4CH5 A;  4XTV A;  2CZ0 B;  2DNU A;  1VQ5 Q;  3UA6 A;  4UC4 A;  4Y92 A;  4XTX A;  4EMK A;  2VAS A;  3HFZ B;  1QVF A;  2I4O A;  2E64 A;  1YP5 A;  2P0L A;  5HKC A;  4OMN A;  2DEQ A;  2E6N A;  3H41 A;  4H2X A;  1GCQ A;  1FYN A;  1KG1 A;  2BIV A;  4BD3 A;  1YHQ T;  3MJX A;  4B9X A;  3EG2 A;  1VQ5 A;  2QDL A;  5GAN 8;  1X2G A;  2QXF A;  4V2S A;  4M77 D;  1YIJ Q;  4P71 A;  1WHG A;  1YJW T;  3MEY A;  4LDW A;  4BW9 A;  1IO6 A;  4LDU A;  4HT9 A;  1WHL A;  2NUP B;  2RHZ A;  1P92 A;  2DL7 A;  4A53 A;  1SHG A;  1YIJ A;  1ZBX A;  1F1B B;  4RTZ A;  5KE2 A;  1ZHI A;  2ZIO A;  2HD0 A;  2V8I A;  2MPX C;  2CH4 W;  3GP8 A;  3TEE A;  3PZC A;  4M75 A;  1BBW A;  3PVQ A;  1VA7 A;  2AK5 A;  4PK4 A;  2X4W A;  3MEW A;  4M78 A;  4M7A D;  1RLQ C;  1B7Y B;  3VS2 A;  1OZ3 A;  3HXX A;  1PD1 A;  2MAM A;  2ZIM A;  1KMN A;  4Z89 A;  5FWB A;  3MF2 A;  2RI2 A;  1IGU A;  5FU6 B;  2HCK A;  1X2H A;  4LUE A;  3CC4 Q;  5C52 B;  4LVI A;  3CMA T;  2ART A;  3TRE A;  2ZT6 A;  5CCA A;  4B9W A;  5I22 A;  2ZCF B;  1OUL A;  4KR2 A;  3PGG A;  2H3E B;  4BI4 A;  2ZPG B;  4QQD A;  1M1K R;  5AYF A;  3E9H A;  3A5Y A;  2OJ2 A;  2NYS A;  3CC4 A;  4WJ3 M;  4LNS A;  4C0Z A;  3PIO A;  3DSQ A;  1D3B B;  1VQZ A;  1RAF B;  5FWC A;  1TS9 A;  1HTT A;  4P3N A;  5GAM d;  2H3J A;  1Y96 B;  1X27 A;  3PT9 A;  1M30 A;  3CC2 T;  1W2B S;  5CK9 A;  1M5Q 1;  3AHU A;  2QHT A;  5GMK i;  1Q82 U;  4XAX B;  3G71 T;  1ZUY A;  3GF5 A;  3ZBD A;  3JB9 I;  3CME T;  3QZ5 B;  1QVF S;  1Z7N A;  1X54 A;  1BCO A;  4PJJ A;  1WU7 A;  2HZY A;  2DVJ A;  3LWH A;  2NUT A;  1FMV A;  3QWX X;  4UP8 A;  1C0A A;  2QQA A;  2JXB A;  5LJ5 d;  4L5G A;  4UP9 A;  2OX7 A;  4RTT A;  4E7K A;  1UDL A;  1X6B A;  3NGP A;  1VYT A;  2SEM A;  3NTI A;  3BJU A;  2HSE B;  4QKU A;  3OMG A;  2QGG A;  3C0C A;  3UT1 A;  3V8J A;  3RES A;  2RJC A;  1K9M C;  2RK2 A;  1X55 A;  3MKD A;  1I5L A;  1OU8 A;  4ZN3 A;  3X26 B;  3U23 A;  1K76 A;  1PNJ A;  4YP0 A;  1MMD A;  1JO8 A;  4ME7 A;  1U5S A;  2O4X A;  1Q82 C;  2LMJ A;  3OYK A;  1MMA A;  2JM9 A;  3SWN C;  4P3P A;  4BAC A;  3DLM A;  2IY5 A;  1I4K 1;  4CC2 A;  4LDX A;  3J7A F;  3CCQ Q;  2K7A A;  3M53 A;  3MEU A;  1JQQ A;  4M7D B;  4KBM B;  1MV3 A;  2HKQ B;  2F2X A;  1KHC A;  4J8O A; 
#chains in the Genus database with same CATH homology
 3HXU A;  2AHJ B;  3CCQ A;  3OS1 A;  3PCO A;  3JCM b;  2L3R A;  4X5O A;  1MHN A;  2DJZ A;  2Y4Y A;  4YRT A;  3URG A;  1JJ2 S;  4HKE A;  5F5W A;  3L4G B;  2ZPE B;  2JN0 A;  1VQ7 A;  1NZ9 A;  1H4T A;  2RB6 A;  2Y4X A;  1JBM A;  2DZ9 A;  2EQK A;  3JCM e;  4C8Q B;  3UWN A;  4QVD A;  4UP7 A;  4HWS A;  2MF2 A;  4PHC A;  3RAC A;  3LWI A;  1YIT T;  3CEY A;  3PMI A;  4J6W A;  2CGH A;  2LCC A;  5GAM f;  5KNN A;  4YRS A;  3CCR T;  1VQK T;  3E9G A;  3QTC A;  4PLL A;  3HKS A;  1USY C;  2XDP A;  1Y07 A;  4XTW A;  2XU8 A;  4J7F A;  4CS3 A;  1G5I A;  5FRM A;  3G4S T;  4UPA A;  4R55 A;  2EKO A;  2PU9 B;  4J6Y A;  4C92 A;  5GAM e;  4DQ2 A;  2AKW A;  5I21 A;  4F7U G;  1YJW A;  1NJ8 A;  4ZTU B;  2HQE A;  4OLF A;  1VUB A;  4MML A;  5GAN 7;  2ZTG A;  2MWO A;  1V29 B;  2A8E A;  2MI6 A;  4E47 A;  4BY6 C;  5LJ5 e;  4MDX A;  3LC0 A;  4JLG A;  3HFV A;  1LNX A;  2I4M A;  4O5V A;  4K87 A;  3F70 A;  2RHS B;  1G3Y A;  4YRC A;  2RJF A;  3P8T A;  4Y28 E;  2QQ9 A;  1SES A;  3C4S A;  5GAO n;  4LVK A;  3GOX A;  1VQ9 T;  2OTL T;  3ERR A;  4M7A E;  4HCB A;  4YRG A;  4N4G A;  3IKM B;  5FRO A;  4M75 D;  5KCO A;  5D6Y A;  4M78 D;  5LJ3 j;  1E1O A;  2L8D A;  5KCH A;  5ELO A;  3X24 B;  3OMC A;  2FL7 A;  5A0D A;  4LDV A;  1NJI C;  3MP1 A;  4EX5 A;  2RHQ A;  2ZT5 A;  4CS2 A;  1WGS A;  4M7A C;  3VQY A;  3CXC A;  3G71 A;  2RI3 A;  3CBP A;  3CME A;  3HY1 A;  5LJ3 d;  1OYX A;  4A4K A;  1BIB A;  2DTH A;  1BI3 A;  2IVW A;  3OD1 A;  4XEO A;  2PUO B;  3L2W A;  1RI0 A;  2A7Y A;  2WSF E;  2F5K A;  4FIB A;  2C06 A;  2E1H A;  2YHT A;  4YRJ A;  3O8V A;  3OYH A;  2ZPH B;  3LLR A;  2D6F A;  5GAM h;  1SER A;  2EQJ A;  5GAO m;  2KQW A;  3CCV T;  2PVG B;  3N5B B;  4XTZ A;  2DD4 A;  1WPY A;  1R8O B;  3OW2 A;  4BDY A;  2JOY A;  2K5I A;  2QEX T;  5GAO r;  2K5L A;  2ZCE A;  5LJ5 h;  4LD9 K;  4M78 F;  2ZNI A;  4QVC A;  4BWA A;  1WQ7 A;  3OSS C;  2XKO C;  3SWN B;  2LQ8 A;  1VQ8 A;  3INZ A;  3RER A;  4O2D A;  4DPG A;  3TEG A;  3RIR A;  2D9T A;  3KUF A;  4XTU A;  4FL6 A;  3S3N A;  5IAY A;  4TVA B;  4YRO A;  2CS7 A;  2HBP A;  4YDQ A;  1D3B A;  4OGC A;  4NL3 A;  3FDR A;  1G5V A;  2CJA A;  2VUB A;  1Q7Y C;  3RGL A;  4HWT A;  2XDD A;  2RH2 A;  5GAN 5;  4TVW A;  4E7J A;  1M90 U;  4PJO B;  3TUP A;  4E7L A;  2R5M A;  2CIM A;  3JCM g;  1VQL T;  4A54 A;  1KQS S;  3RL6 A;  5HGQ A;  1K73 U;  2WSC E;  3CCM A;  3S6W A;  2P0Q A;  4YRL A;  5LJ3 f;  2EAY A;  3NEL A;  1W66 A;  1VQK A;  4MDW A;  3QNE A;  3RMS A;  3JCM W;  3I55 T;  3A8M B;  1XNI A;  3QO5 A;  3BW1 A;  2ZT8 A;  2DTI A;  4CRI A;  1JJC B;  3L2R A;  1IL2 A;  3TEH A;  4CH6 A;  1NJ2 A;  2XGT A;  5GAN j;  3P8V A;  2VXF A;  4A4E A;  4PLI A;  2DD5 A;  5GAM g;  3JB9 G;  5EG2 A;  1GGM A;  4M7D A;  1BBU A;  4FSX A;  4C92 D;  4KUI A;  1UGS B;  1QVG A;  4WI1 A;  1I8F A;  2DXC A;  5GAN d;  4YCW A;  4BUG A;  4J83 A;  1O75 A;  1UGP B;  5LJ5 g;  3L4G A;  1YB3 A;  3ASK A;  3E19 A;  3JSC A;  3A8H B;  2GQV A;  3A5Z B;  4HCZ A;  4ZN1 A;  1EVK A;  3REU A;  4EMK C;  2EWN A;  4C8Q A;  2QHU A;  4M77 B;  1G3S A;  3OYD A;  4IUQ A;  2RA2 A;  3HXV A;  4M75 E;  4QW2 A;  3VQX A;  3FIF A;  4P71 C;  1H4V B;  1AHJ B;  4M78 E;  3GIB A;  3OYY A;  2CZ6 B;  4NL2 A;  2ZZE A;  2EIF A;  2GFU A;  1S72 T;  1H64 1;  3JAM E;  3CCU T;  4M7A B;  4YPF A;  2ZPB B;  1K8A U;  4XK8 E;  4P72 A;  4C92 F;  4M75 C;  3OYM A;  1N9W A;  4M78 C;  3VYH B;  1WJQ A;  5GAO p;  5A0L A;  3REX A;  3HTZ A;  2EJ9 A;  3LGL A;  3BFM A;  3Q1J A;  3CBM A;  3EAE A;  3L2Z A;  2LNV A;  5CQY A;  4HCC A;  3M55 A;  4H2V A;  5LJ3 h;  2F5T X;  2QA4 T;  3RMQ A;  2JZ2 A;  2ZNJ A;  4M77 G;  2XID A;  1OZ2 A;  2LC4 A;  3LGF A;  3DKM A;  2QEX A;  2GCX A;  4C0D B;  2LT4 A;  1KHI A;  3WXM B;  4H2S A;  4YRF A;  4TVY A;  3J81 E;  1RIQ A;  3RF1 A;  4AH6 A;  1E1T A;  3FB9 A;  2X4Y A;  3JCM Q;  3DLL A;  2AMC B;  2E10 A;  3VYG A;  3MF1 A;  4EMH A;  1ASZ A;  4RG2 A;  5GAN f;  3A31 A;  2DQ0 A;  4VUB A;  3V8L A;  1M9S A;  4M7A G;  3TCJ A;  2M16 A;  1WQW A;  1G3W A;  3JB9 H;  4RKU E;  4JRQ A;  4KR3 A;  4Q15 A;  5C0M A;  2CKK A;  2Q7E A;  4N4I A;  2ARS A;  2DXT A;  3FJP A;  4XU0 A;  2ARU A;  4NOY A;  4IUV A;  1VQ6 A;  1UEB A;  3LX7 A;  3A7R A;  3L2U A;  3UDC A;  4JRI A;  2FVU A;  5GAO q;  2ZR2 A;  4ZIB A;  3R6O A;  1KMM A;  4E7I A;  3G6E A;  4Y91 A;  3A8O B;  2DU7 A;  1VQP T;  1M1K U;  3I55 A;  4OP0 A;  3CPF A;  3GNG A;  5GMK l;  2X4J A;  2ZGW A;  3NFC A;  1L0W A;  1QP2 A;  4HT8 A;  4BE1 A;  1ATI A;  1YGB A;  3MCA B;  4C0F A;  3OBW A;  3OYE A;  4TTV A;  3VJP A;  1M8V A;  3VKI A;  2KMT A;  4P3O A;  4IUT A;  1PSF A;  4WF2 A;  3OYL A;  5GMK m;  1YFR A;  4F7U B;  3QG1 A;  4O6J A;  4JJN K;  3FEO A;  4CH3 A;  4QQ6 A;  1MGQ A;  1UB4 A;  2Q5H A;  4J15 A;  1I81 A;  2C8M A;  2DZC A;  2XHC A;  2RJD A;  3CCJ T;  3A7A A;  5GAN 4;  4C92 E;  2JVV A;  5FU7 C;  3UGT A;  5DLO A;  4EDU A;  1YJ9 A;  4YRP A;  3LSQ A;  4YRM A;  5C6S A;  3QO7 A;  4H2T A;  4QVZ A;  2GF7 A;  2RK1 A;  1NJ1 A;  2J3M A;  3CD6 T;  4X9D A;  4JRK A;  4OB3 B;  5CKB A;  3M4G A;  1NYQ A;  5L8R E;  4GY5 A;  4C92 C;  1YI2 T;  4PJO A;  2VGM A;  2HQX A;  5GAN h;  2ZT7 A;  2RHY A;  5HK3 A;  1G3T A;  1YHQ A;  2ZR3 A;  1B70 B;  2M0O A;  4JS4 A;  2I2L A;  3NEM A;  2PME A;  4C8Q D;  3NTK A;  2V8K A;  3JCM X;  4D6W A;  3SFM A;  3HRI A;  4BI3 A;  3CMQ A;  1S72 A;  2QTX A;  2OTJ T;  3CCU A;  1JJC A;  3IG2 A;  4MZT A;  4YCV A;  1EIY A;  1USY A;  2KY9 A;  2RHU A;  2ZZG A;  2PQW A;  4OVA A;  4C5E A;  1Q86 U;  3OYJ A;  2XD0 A;  1WLE A;  1IZ6 A;  2RO0 A;  4HWR A;  2QI2 A;  4JRP A;  2WAC A;  4M7D F;  2LX9 A;  1VQM T;  5GMK j;  1VQ4 T;  2BUD A;  2QA4 A;  3CPW A;  5HY6 A;  3H8Z A;  2LCL A;  4XU2 A;  3OB9 A;  4XQ3 A;  3CMA A;  1B8A A;  3HRK A;  4MZP A;  2D0Q B;  2GFA A;  3OYB A;  2CZ7 B;  5K1X A;  3M59 A;  4FT4 A;  3VQV A;  2QQB A;  4LDY A;  3OS2 A;  4P73 A;  3A5Z A;  2JTF A;  4PG3 A;  5FRN A;  4P75 A;  2ZZD A;  4C8Q F;  3OYF A;  1ADJ A;  4M77 A;  3CC2 A;  4TQD A;  1U1S A;  4J6X A;  3FC3 A;  3PFS A;  1PYS B;  3HFZ A;  2ALY B;  2DVE A;  2QQS A;  2VXE A;  2DXB A;  4JLI A;  5GAO l;  1G5H A;  4TQF A;  2XDB A;  4IKF A;  1VQ5 T;  1HC7 A;  4M75 G;  2E70 A;  3QO8 A;  3P8B B;  4M78 G;  1Q81 U;  4KT0 E;  2J3L A;  1QW1 A;  1BKB A;  2HNI A;  4CH4 A;  2LRQ A;  4YRR A;  4CI0 C;  1GXI E;  3JCM V;  2E3C A;  3OYG A;  3TU4 K;  3QZ9 B;  2PUK B;  5CKE A;  4P74 A;  2CZ1 B;  3VUZ A;  3HRS A;  4ZGD B;  11AS A;  3GLX A;  3OS0 A;  2M1H A;  3ZEH A;  5FU6 C;  1B7Y A;  3P8D A;  1U8R A;  3PIP A;  5GAN 3;  3V7S A;  2R5A A;  4PL6 A;  1LJO A;  5DLQ E;  2EQU A;  1SSF A;  3NTH A;  1NYR A;  3QYG B;  4L6V 5;  3HFN A;  3OYN A;  5IN1 A;  3C12 A;  2XIC A;  2KK4 A;  3I7F A;  3CC4 T;  4XEM A;  5I2M A;  2AMC A;  4ZTJ A;  2RHX A;  3OYC A;  3L2V A;  1Y96 A;  3CCJ A;  3VQW A;  1FXX A;  3C94 A;  3CXC S;  2P5I A;  3QJY A;  3WQZ A;  3V8K A;  2DDZ A;  2I4L A;  2FHD A;  4EMG A;  2JTM A;  2BKD N;  3HXW A;  4QQG A;  1YIT A;  4J5Y A;  2RJE A;  3J80 E;  1M1F A;  5FU7 B;  1KC8 U;  1KD1 U;  5M9O A;  3SD4 A;  1UGQ B;  4M7D E;  4LVM A;  3CD6 A;  3CCR A;  3PMT A;  2L89 A;  3HRT A;  2K3X A;  4K88 A;  4G84 A;  5DY9 A;  3A74 A;  4YCU A;  5CAI A;  3G4S A;  1NPP A;  3OY9 A;  2DK3 A;  1YBY A;  2CJ9 A;  4C5H A;  4RMF A;  3OW2 S;  2P0P A;  3ZFJ A;  2AKW B;  5CQX A;  4M7D C;  1YJN T;  3QKJ A;  3L2Q A;  2EJG A;  5LJ3 e;  3LW5 E;  3JCM c;  4C8Q E;  5A2Q E;  4PJO D;  2A3L A;  3VUB A;  1M90 C;  4HVC A;  4DOV A;  1QE0 A;  2XG8 D;  1K73 C;  5D6X A;  3L42 A;  2WSE E;  2DIQ A;  1KOG A;  4C5I A;  4N0A A;  1EQR A;  4BY6 B;  1QP3 A;  1QF6 A;  4F7U A;  1JRI A;  2KVQ G;  1IRE B;  3QO3 A;  3IAL A;  1VQM A;  2YLB A;  4C8Q C;  3NEN A;  1YCY A;  1VQ9 A;  5E3I A;  1VQ7 T;  2QHV A;  2OTL A;  3QXE B;  12AS A;  4DOW A;  1TH7 A;  4C5G A;  4XU1 A;  4NCX A;  3JRZ A;  1H4Q A;  3JB9 F;  4C92 G;  1X6O A;  1Y7X A;  5CKH A;  4A4F A;  3UFG A;  3OQ5 A;  4PNO A;  4L59 A;  1EVL A;  1BYM A;  2VC8 A;  3CC7 T;  3RKY A;  3S3M A;  2VYT A;  1W2B A;  3MHX A;  2PVD B;  3HFO A;  2RM4 A;  3A8L B;  4P72 C;  1EFW A;  4HT4 A;  2G4C A;  4YRE A;  4PJO F;  4BI8 B;  5FLX E;  4RQF A;  2K3Y A;  2MWP A;  3HL8 A;  5J3B A;  4YRK A;  1B70 A;  3IKL A;  3P8Y A;  1DJ7 B;  3HHT B;  5GMK h;  3X25 B;  3WVD B;  3ICA A;  3MET A;  1LOJ A;  3KFU A;  2QQR A;  2DTO A;  4FT2 A;  3MP6 A;  2KSS A;  3CCV A;  5C51 B;  1LYL A;  3OYA A;  4KQE A;  1XTD A;  1E24 A;  4KUL A;  2P4T A;  3JCM d;  1QVG S;  3KBG A;  2RHS A;  3QSU A;  3CCE T;  1Z7M A;  3T9N A;  2CYZ B;  1K8A C;  3X20 B;  3QBY A;  3QYH B;  5GAM j;  3W3S A;  3X28 B;  4MZM A;  1H3Z A;  3JCM P;  3DB4 A;  3UH0 A;  3PTA A;  2Q7H A;  2NS6 A;  4LVL A;  1SET A;  1W4S A;  4K86 A;  1JJ2 A;  1K9M U;  2K57 A;  2B8A A;  1B34 B;  3JCM J;  5LJ5 j;  3LYI A;  2F69 A;  4M77 F;  4YRI A;  2ZIN A;  3A32 A;  1VQN T;  4X9C A;  5GAN e;  2QDY B;  2FB7 A;  1PYS A;  2MMP A;  2ALY A;  1KQ2 A;  1VQO T;  5D6W A;  3NET A;  5CVI A;  2E5A A;  3OA6 A;  2DAQ A;  1B76 A;  3FLG A;  1VQL A;  1RL2 A;  1PSE A;  2M9U A;  3VU3 C;  5CIU A;  3CBO A;  3OSV A;  4M7A F;  4R56 A;  4TWA A;  4RQE A;  1NE8 A;  2LQK A;  1KQ1 A;  3TEH B;  2XI9 A;  4ELY C;  2KDS A;  5J39 A;  2NLU A;  2ZPI B;  4FM4 B;  1YJN A;  3GNF B;  3V7R A;  3L1A A;  1N27 A;  2XTI A;  2ODR D;  3MQZ A;  4HWP A;  3QJ6 A;  4H02 A;  4RMO A;  2VGN A;  2JUF A;  2EQM A;  3SWN A;  1BI0 A;  4Q6G A;  3JCM f;  5GAN 6;  4PJO E;  1VQ8 T;  5LJ3 g;  4N4H A;  1E22 A;  4HA8 A;  4LD6 A;  4II1 A;  1M1K C;  3BY7 A;  4XU3 A;  4TVA A;  4OMF B;  4H2Y A;  3KXT A;  4M7D D;  1SRY A;  4A4H A;  2E5Q A;  4IUP A;  2YLC A;  2DU5 A;  3MO8 A;  2I4N A;  3JB9 J;  4PJO C;  2LTO A;  5CKD A;  3HXZ A;  2HAX A;  4BE2 A;  2C7I A;  3QII A;  3RUX A;  2LT1 A;  3M58 A;  3CCS T;  4EMK B;  5HK0 A;  3WVE B;  4ELZ C;  4CS4 A;  4YRQ A;  1VIE A;  4RDX A;  2Q7G A;  4H2X B;  3OBY A;  3CC7 A;  3CCM T;  2RD1 A;  5GAN 2;  1U1T A;  2DIG A;  4M7D G;  2V8J A;  5DM7 R;  1N8R U;  2QHS A;  3UGQ A;  5LJ5 f;  2L5Q A;  5KH6 A;  3QDR B;  1BI1 A;  3M54 A;  1FYF A;  1Y71 A;  3ER0 A;  3HY0 A;  4Z02 A;  4EPC A;  2E6Z A;  3BDL A;  2E12 A;  3M57 A;  4M75 B;  4RCB A;  4M77 E;  2OAU A;  4M78 B;  1OI1 A;  3CCL T;  2G3R A;  3M56 A;  2EFI A;  1XOV A;  3HPW A;  2ZPF B;  5IT9 E;  4C8Q G;  3QPH A;  2X35 A;  1NJI U;  1FWZ A;  2X4X A;  3S3O A;  3PNW C;  2PMF A;  3C95 A;  1N9S A;  4BE0 A;  2RI5 A;  4P73 C;  4F7U F;  5KE3 A;  3CCE A;  3G7Z A;  3HP9 A;  4P75 C;  1N8R C;  3HXY A;  3A8G B;  2RHI A;  4M77 C;  1XQH A;  1H4S A;  1M4Z A;  3MP8 A;  4TVR A;  2R58 A;  4X34 A;  2DO3 A;  3I56 T;  3A7U A;  4YRN A;  2DXU A;  5C53 B;  1Q86 C;  1UGR B;  4E51 A;  3JCM h;  4WJ4 A;  1VIF A;  4Q5W A;  4OB2 B;  2K4Y A;  4RG8 A;  4BDZ A;  2O01 E;  4FU6 A;  4EO4 A;  1NPR A;  1QVP A;  3QHS A;  1NNH A;  3M5A A;  4BB7 A;  1VQN A;  2R57 A;  4KUD K;  1WYD A;  4H2W A;  1VQO A;  4M7A A;  1M1G A;  4P74 C;  3HSB A;  2DKG A;  1X01 A;  1YFT A;  1JB0 E;  4ATO A;  1YIJ T;  1KQS A;  3P8H A;  5GAN g;  1EIF A;  1ASY A;  3SDZ A;  2O4X B;  1VQP A;  1ADY A;  1YFS A;  2VV5 A;  4A4G A;  2YRV A;  1N9R A;  4MMK A;  4E7H A;  3E9I A;  2IY5 B;  1J5W A;  4IUU A;  2ZZF A;  4C0D C;  1G51 A;  4OF1 A;  1WJS A;  3CPW S;  3UPU A;  2LVM A;  3HRU A;  1WJR A;  5J26 A;  4M75 F;  4XTY A;  4OGE A;  1Q7Y U;  2DQ3 A;  1Q81 C;  3PCO B;  3FRN A;  4PKC C;  4J7I A;  4ZGJ B;  2XK0 A;  5A0G A;  4P5N A;  3LSS A;  4L87 A;  3EFR A;  2E65 A;  2FYK A;  3RKX A;  2PVO B;  2ZXF A;  4G85 A;  2K2V A;  5LL6 S;  1B34 A;  3H6Z A;  2EL9 A;  3VBB A;  2EJF A;  3SB2 A;  1X75 C;  4JUV A;  4C0G A;  2ODR C;  3BDU A;  5I2S A;  1VQ6 T;  4H2U A;  5ELN A;  3MEV A;  1YI2 A;  2E41 A;  3CCS A;  4YTL A;  5GMK e;  1HXD A;  3OYI A;  3LH0 A;  4F7U E;  3JB9 D;  1BI2 A;  3VV0 A;  3M4Y A;  2JNG A;  3MEA A;  3QUI A;  4ZTZ B;  4C92 B;  1FX7 A;  3G6E T;  2K5F A;  2Q5I A;  3M4P A;  4HWO A;  5K1P A;  1N6A A;  3ME9 A;  4OB0 B;  2IG0 A;  4ZTF A;  4GLK A;  3GPL A;  5CR2 A;  2OTJ A;  4N0A C;  1O9S A;  1BIA A;  1EIY B;  1X56 A;  1KC8 C;  4YYE A;  1KD1 C;  1EOV A;  3G1Z A;  4RCC A;  1ZQ1 A;  3M9Q A;  1NJ5 A;  3CCQ T;  2Y90 A;  3DB3 A;  4LVJ A;  3R07 A;  3E9F A;  4IUR A;  3V7C A;  3CCL A;  1VQ4 A;  4JS5 A;  4OB1 B;  2LDM A;  5CKF A;  4DA4 A;  3RKW A;  5CO7 A;  1HK9 A;  3E1S A;  4JDS A;  4PJO G;  2EYQ A;  2CJB A;  1NJ6 A;  4ZGE B;  1YJ9 T;  3M4Q A;  4NS5 A;  3EFS A;  2P0K A;  3OS5 A;  2DPP B;  3I56 A;  1WNL A;  2RHQ B;  2KAF A;  4CH5 A;  4XTV A;  2CZ0 B;  4UC4 A;  4XTX A;  4EMK A;  3HFZ B;  1QVF A;  2I4O A;  2E64 A;  2P0L A;  5HKC A;  2DEQ A;  2E6N A;  4H2X A;  1KG1 A;  2BIV A;  4BD3 A;  1YHQ T;  4B9X A;  1VQ5 A;  5GAN 8;  1X2G A;  2QXF A;  4V2S A;  4M77 D;  4P71 A;  1YJW T;  3MEY A;  4LDW A;  4BW9 A;  4LDU A;  4HT9 A;  2RHZ A;  1P92 A;  4A53 A;  1YIJ A;  1ZBX A;  5KE2 A;  1ZHI A;  2ZIO A;  2HD0 A;  2V8I A;  3GP8 A;  3TEE A;  3PZC A;  4M75 A;  1BBW A;  4M7A D;  2X4W A;  3MEW A;  4M78 A;  1B7Y B;  1OZ3 A;  3HXX A;  2MAM A;  2ZIM A;  1KMN A;  3MF2 A;  2RI2 A;  5FU6 B;  1X2H A;  5C52 B;  4LVI A;  3CMA T;  2ART A;  3TRE A;  2ZT6 A;  5CCA A;  4B9W A;  2ZCF B;  4KR2 A;  3PGG A;  4BI4 A;  2ZPG B;  4QQD A;  5AYF A;  3E9H A;  3A5Y A;  3CC4 A;  4WJ3 M;  4LNS A;  4C0Z A;  3PIO A;  3DSQ A;  1D3B B;  1VQZ A;  1HTT A;  4P3N A;  5GAM d;  2H3J A;  1Y96 B;  3PT9 A;  3CC2 T;  1W2B S;  5CK9 A;  1M5Q 1;  3AHU A;  2QHT A;  5GMK i;  1Q82 U;  4XAX B;  3G71 T;  3GF5 A;  3ZBD A;  3JB9 I;  3CME T;  3QZ5 B;  1QVF S;  1Z7N A;  1X54 A;  1WU7 A;  3LWH A;  4UP8 A;  1C0A A;  2QQA A;  5LJ5 d;  4L5G A;  4UP9 A;  4E7K A;  3NTI A;  3BJU A;  3OMG A;  3UT1 A;  3V8J A;  3RES A;  2RJC A;  1K9M C;  2RK2 A;  1X55 A;  1I5L A;  4ZN3 A;  3X26 B;  4YP0 A;  4ME7 A;  2O4X A;  1Q82 C;  3OYK A;  3SWN C;  4P3P A;  4BAC A;  3DLM A;  2IY5 A;  1I4K 1;  4LDX A;  3J7A F;  3M53 A;  3MEU A;  4M7D B;  4KBM B;  1KHC A;  4J8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...