4XTWA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
266
structure length
266
Chain Sequence
VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 94
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtwA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtwA01
1ADJA 4RQEA 3JB9H 4XEOA 4M7AC 3RGLA 1I8FA 3JB9I 5GANg 1M5Q1 3FIFA 3MF1A 1TH7A 2DTHA 5GAOn 1G51A 2Q7GA 3WQZA 4M78D 3P8TA 1NJ2A 3VBBA 3RL6A 4OLFA 4CH6A 2DKGA 1ASYA 1N9WA 4V2SA 1EIYB 4PJOD 2ZR2A 1X54A 3BJUA 4Y91A 4M77A 1QF6A 4ZTUB 4M7AE 2ZZEA 2CJBA 2FB7A 1JRIA 3R07A 2YLBA 3JCMb 1X55A 3V8LA 1I4K1 4XU3A 1QE0A 5LJ3g 4HWSA 4KQEA 3HXVA 4EMGA 2RM4A 11ASA 2EWNA 3RESA 1B8AA 4TVAA 3HXZA 5GANe 4C92C 4JUVA 4PNOA 3TEHA 4WJ3M 4M78F 2DU7A 1B34B 1KOGA 3IG2A 4XTWA 1WQ7A 1YGBA 4C8QB 5CAIA 3IALA 4PJOF 3JB9D 1SRYA 1H4QA 3JCMP 3TEGA 4RQFA 5GAN6 5GMKj 2RHSA 3EFRA 3RKWA 4N0AA 4P74A 4JRIA 3V8KA 4P73C 3JCMg 1HXDA 3V7SA 4C92E 1X2HA 3NETA 2I4OA 4P3OA 1L0WA 3RUXA 1EFWA 5LJ3e 3RIRA 2ZGWA 4MMLA 3QHSA 4RCBA 4YRNA 3UH0A 5GAN7 4M78A 5K1PA 4YRTA 3QSUA 2VXEA 4M77B 4BWAA 1Y96A 1NNHA 4PJOA 2J3MA 3JCMc 4K88A 1E1OA 1USYC 2CJAA 3VQVA 1BIBA 4F7UA 4J6XA 2ZCEA 3RKYA 5GAOm 3UGTA 4A53A 2DQ3A 4YDQA 5GMKh 3JCMe 2Y90A 3P8YA 2RHQA 4ZTZB 3VQYA 3SWNA 5DY9A 5GANj 4QVDA 3TEHB 5E3IA 4HVCA 2ARSA 4C8QG 2ZR3A 3JB9J 2ZZGA 4M7DC 2ZZFA 5I21A 2DTIA 2DXUA 2E3CA 4KR2A 1HC7A 1ADYA 2RHSB 3QTCA 2XTIA 4HWTA 4RCCA 4H2WA 4P72A 2YLCA 5GAMe 4ZIBA 2E5AA 4WF2A 4YRFA 5HGQA 1EVLA 1WQWA 2ZNIA 3BW1A 4C8QE 3L4GB 5LJ3j 4G84A 3L2ZA 1B76A 2EJGA 3E9HA 4M77C 3A7UA 1JJCA 4M75A 3HXXA 3QO8A 2EAYA 1Y96B 1B7YA 2QHTA 1NJ5A 5GANh 2ZT7A 3DSQA 5LJ5g 1YCYA 4UP7A 4M7AG 3QUIA 4F7UB 5GMKi 1I5LA 4NL3A 2E64A 3PCOA 2QTXA 4TQFA 2C7IA 4BW9A 5GANd 4M77E 5GAN5 1WU7A 1D3BA 4JLIA 1B70B 2PMEA 2AMCA 4CH4A 5GAN2 1LOJA 2Q7HA 3FJPA 2CIMA 1PYSB 1VQZA 5LJ3h 3V7RA 3QO5A 4CH5A 1LYLA 4N0AC 4YRJA 1GGMA 4P74C 3HY0A 2I2LA 3BDUA 1NJ8A 3IKMB 4M7AF 2VXFA 2IY5B 5GAMj 3EFSA 1G5IA 5LJ5e 3INZA 4H2TA 2K57A 4CH3A 5LJ3d 4XTYA 2E65A 4YREA 4NL2A 3VU3C 2ZNJA 4C92G 4CS2A 3IKLA 1NYQA 4M78C 1U1TA 2XGTA 4YRQA 3RKXA 2ODRC 2RB6A 2EJ9A 1Z7NA 4M75B 4PJOC 4KR3A 3JCMh 3M4QA 4M7DB 3TUPA 2DXTA 3HFZA 1RIQA 4YROA 5GMKl 3RERA 2ZTGA 2AKWA 3MF2A 1WYDA 3JCMd 3A7AA 3SWNC 3P8VA 1H4SA 4XEMA 2Q7EA 4C92F 2VC8A 3HSBA 4LNSA 5GAMh 1D3BB 1HTTA 4YYEA 4EMKA 2AMCB 1YFSA 4HT9A 4TQDA 2EL9A 1EQRA 4F7UE 4CS4A 2JN0A 1W66A 4P75A 5C53B 4Q6GA 1HK9A 2ARTA 2DQ0A 5GAMd 3A5ZA 2ARUA 1C0AA 2P0LA 3HTZA 5LJ5j 4H2UA 3A5YA 3LSSA 4TVAB 3QO3A 4AH6A 1KQ2A 4XTZA 5GAOp 1KMMA 4PG3A 4C8QD 4XQ3A 5GAOq 3QNEA 1J5WA 4H2XA 3HXUA 4G85A 4M75C 2E1HA 1N9SA 1ASZA 4M7DG 2E10A 5GAN3 3REXA 3FB9A 3G1ZA 4YCUA 4K86A 4YRSA 1X2GA 1X01A 1KQ1A 1ATIA 1EOVA 3HFZB 4H02A 1I81A 1NYRA 3NENA 4YRMA 5GAN8 2EJFA 2AKWB 2ZIMA 1M8VA 2QHUA 4M75E 3A74A 1FYFA 4YPFA 4RDXA 12ASA 4M7DE 5KNNA 2DTOA 4EMKB 5LJ5h 2PMFA 4M77G 1SERA 4C8QF 3MEYA 4M78B 1NJ1A 1LJOA 4YP0A 1IL2A 4PJOB 4M7AD 4UP8A 2C8MA 4J5YA 5LJ5d 2P5IA 4EMHA 4YRGA 3REUA 3PZCA 4WJ4A 3JCMQ 5GANf 1X56A 2RHQB 3SWNB 4CS3A 1H4VB 1BBUA 4E51A 3HRKA 4YRKA 4M77F 2QHVA 4OP0A 4C8QA 1YB3A 2ZIOA 3QO7A 5GAOl 2ZT5A 3OD1A 3L1AA 4NOYA 4WI1A 2ZINA 3SB2A 4YRRA 1E1TA 2ALYA 1SESA 4TWAA 3JCMX 3HFVA 2ZT6A 4C92D 1E24A 3GIBA 5LJ3f 4A54A 4O2DA 4DQ2A 5C51B 2ODRD 1NJ6A 3HXWA 4M78G 4EMKC 4P3NA 1H4TA 4NCXA 4XU0A 4DPGA 3JCMJ 4P71A 3ERRA 4PJOG 4P75C 2DEQA 2I4MA 1JJCB 4RMFA 3HY1A 1G5HA 1B7YB 2J3LA 1JBMA 1WPYA 4TTVA 4F7UG 3JCMV 3HRIA 2DZCA 3HXYA 4M7AA 4TVYA 3PCOB 5GAN4 4UP9A 2CGHA 4M78E 3JCMf 4HWOA 4YCVA 4TVWA 1E22A 4PJOE 1YFTA 1SETA 5GAOr 3V7CA 3M4PA 2Q5IA 3E9IA 2CJ9A 5ELNA 3A32A 2ZXFA 1N9RA 4MMKA 3JB9G 3RACA 4P72C 4XTUA 4F7UF 5GAMf 3AHUA 3RF1A 2DJZA 1Z7MA 2ALYB 4XTXA 2YHTA 4J6WA 4X9DA 1LNXA 4X9CA 4EX5A 1YFRA 3KFUA 5C52B 4XU2A 4Q15A 4HWPA 2RD1A 3M4GA 3L4GA 4UPAA 1WLEA 1MGQA 2HNIA 4M75D 3PGGA 4J6YA 3UFGA 4C92A 1BIAA 1BBWA 1KMNA 2DU5A 3V8JA 4M75G 5ELOA 4M7DD 2G4CA 5GAMg 3CMQA 4H2SA 4H2VA 3JB9F 3NEMA 3VQXA 2DVEA 4YRIA 3A7RA 3VQWA 4M7AB 3UGQA 4P73A 4HWRA 4EO4A 4X5OA 3NELA 1U1SA 3A31A 3LSQA 2I4NA 3W3SA 1B70A 3LC0A 4M77D 4XTVA 2FYKA 4YRCA 1EIYA 4HA8A 4C8QC 4M75F 3I7FA 1PYSA 3ICAA 4M7DF 3HFOA 4QVCA 3BY7A 4L87A 4H2YA 2IY5A 1USYA 5LJ5f 5K1XA 2I4LA 2DZ9A 2E41A 3HFNA 4XU1A 2Q5HA 4P3PA 4YCWA 3JCMW 5GMKm 4C92B 4J15A 3BFMA 4K87A 4P71C 4PHCA 1EVKA 4HT8A 1B34A 1WNLA 5F5WA 4H2XB 4YRLA 4JRKA 2QHSA 2DDZA 1H641 2RA2A 5GMKe 4M7DA 2ZT8A 4YRPA
chains in the Genus database with same CATH superfamily
4RQEA 1PRLC 4XEOA 2O9SA 4M7AC 5CVIA 3OYDA 1YITT 5KYUB 2E4HA 2X4XA 3MF1A 1ZBXA 1BK2A 2Q7GA 4M78D 3UA6A 1W2BA 1Q82R 4FYWB 2VUBA 4OLFA 2QI2A 1N9WA 1Q7YR 2JS0A 3GNGA 1EIYB 2ZR2A 1YI2A 2KT1A 2LC4A 3BJUA 3VS3A 3MP8A 3TSWA 4J7IA 3I9QA 1WI7A 1K0SA 1SF9A 3FDRA 2KY9A 5FU7C 1QE0A 2K79A 2LNHB 2MAMA 3ER0A 4JJDA 4J9FA 2EWNA 3RESA 1B8AA 1W2BP 4OMLA 3I55T 2CP3A 4RTUA 4JUVA 2EPDA 2D6FA 4PNOA 2VKNA 2CP5A 2DD5A 3LLRA 4M78F 2CZ6B 2RHIA 1A0NB 3E19A 1B34B 1QP3A 2NLUA 1B07A 1OEBA 2QK0A 4BI8B 1JO8A 5IHIA 1C1AA 5CAIA 3IALA 1N5ZA 1SRYA 3I5SA 3MP6A 3M0RA 5GAN6 1UGPB 3H9NA 2QASA 4IUPA 3EFRA 2OTJT 3LH0A 1JU5C 2JTFA 4C0ZA 4JRIA 3V8KA 2EYYA 5KYYB 2GFAA 1X2HA 3NETA 2CSQA 5HK0A 4PLLA 1VA7A 2ZGWA 3QHSA 4Y92A 1NJIU 1K1ZA 4YRNA 1TWBA 1RABB 3UH0A 5K1PA 3HRTA 2M02A 3QSUA 2C0OA 3VS7A 2A3LA 1NNHA 4PJOA 1OZ2A 2J3MA 1SG5A 1Y57A 3JCMc 2RF0A 5I22A 4K88A 1BKBA 1XJWB 3MP1A 3E2UA 1P92A 2ZCEA 3DLMA 2RK2A 4YDQA 2DA9A 1KC8C 2F1LA 2DQ3A 2KXDA 1YFNA 2V1QA 2QXFA 5EC7A 3TREA 1ZHIA 2GTOA 2PUKB 2COYA 3VS0A 5I21A 2KNBB 2E3CA 2CH4W 4BY6C 1E7OA 1KC8R 4RCCA 3P8DA 1YITQ 3MEVA 3H8ZA 5GAMe 3MQZA 2E5AA 3L2QA 4YRFA 2QEXT 4Z8AA 1EVLA 2BZ8A 3QDFA 3LWHA 1VQKQ 2J6KA 1SSHA 5FU6B 3L4GB 3L2ZA 1S1NA 4J9IA 1BI2A 3E9HA 1M2VB 1JJCA 1OZ3A 3HXXA 3QO8A 1VQ5T 2QHTA 3DLLA 5LJ5g 1KD1C 2DX1A 4UP7A 1K73U 2HSEB 5GMKi 4J9HA 1I5LA 1RLPC 1K9AA 3I55Q 4F04B 4DA4A 4TQFA 3CXCP 2C7IA 4BW9A 1AWWA 2HQEA 5GAN5 1B70B 2AMCA 1BYMA 1KD1R 5GAN2 1LOJA 1T0HA 2KE9A 3CPFA 1PYSB 3EGXB 1VQZA 5LJ3h 2OTJQ 2SRCA 2KRMA 1VQKA 1O75A 1UJYA 1GGMA 3MHXA 1BCMA 2I2LA 4EDUA 4P74C 3BDUA 3IKMB 2VWFA 2IY5B 3EFSA 3CMAQ 2Z0WA 3HKSA 3VU3C 1X75C 4XAXB 3VUZA 2K5IA 4AFZC 4KH1B 4OB0B 4M78C 4E7ZA 4IUQA 4LDWA 1VQ7A 4ELZC 4QQGA 1OX8A 3Q1JA 3OS1A 3RMQA 2L3PA 3JCMh 1WZOA 1UG1A 2P0PA 4M7DB 2M16A 3J81E 5CK9A 4FL6A 1ZSGA 4GLKA 2RHUA 3MF2A 5CKFA 3EH2A 1WYDA 2FZCB 2R58A 1MMGA 3SWNC 3A7AA 1QP2A 2RMOA 4C92F 2OTJA 4LNSA 3N5BB 2EGEA 1EZZB 2K5FA 3DB4A 4ZGJB 3CMAA 4HCCA 4ZN3A 4DEXA 5GAMd 3A5ZA 2BUDA 2RPNA 2ARUA 5DLOA 3R6NA 1G3SA 1UGVA 3T9NA 2A37A 5LJ5j 3A5YA 2BE7D 4F17A 3LSSA 1HJDA 3QO3A 2GFUA 4ME7A 1M3BA 4QW2A 3OSVA 1IXDA 5GAOq 2ZZDA 1ASZA 5GAN3 3REXA 1VQPT 3CCET 1YJWQ 3EG3A 2XKOC 1ATIA 2J7IA 3HFZB 4YRMA 1I81A 3M4YA 1NYRA 5KYUA 2X51A 3X28B 2JJ9A 2OI3A 2WSCE 1MV0B 2QA4Q 2QHUA 3A74A 3META 3PVQA 1Y7XA 5I2MA 1QCFA 4M7DE 4C0GA 4EMKB 4C5GA 1SERA 5CQYA 2M1HA 2GF7A 3QKJA 4OMQA 3OYLA 1LJOA 1KSWA 2LJ1A 3OW2A 2LP5A 2RNAA 3CEYA 2GGRA 2M51A 5ECAA 2P5IA 4EMHA 3JRZA 1T3SA 4XK8E 1QVGA 3FEOA 1UDLA 1YNZA 4WJ4A 2QTVA 1V1CA 1FMKA 1YJWA 1H4VB 2YRCA 1SSFA 1R8OB 4B9WA 4M77F 4ZGDB 2L2PA 2ZIOA 1X27A 3OW2P 5GAOl 2K5LA 2QA4A 5D6YA 2ZINA 3SB2A 5CR2A 1E1TA 2E3IA 3M54A 5KYYA 3PMIA 1SESA 4BDZA 3EGUA 4K11A 1LPLA 4FW2A 3JCMX 1BI0A 3GIBA 4L6V5 4LVMA 1K8AC 4DQ2A 1GBQA 1KQSA 3PFSA 4A4EA 4NCXA 1ZSZB 1AWJA 4ELYC 2DEUA 4PJOG 2CUBA 2DEQA 2I4MA 4RMFA 2DK3A 5IHKA 1K4US 1B7YB 1RAEB 3C12A 2J3LA 1JBMA 2KSSA 3JCMV 3OS0A 3HRIA 3NTKA 2PZ1A 1K8AR 3LW5E 1VOMA 3QYGB 2FO0A 3ULRB 2LMJA 4TVYA 2QQBA 2JZ2A 3S3MA 5GAN4 2F69A 4YCVA 3OYCA 3ME9A 3PNWC 2QDYB 2I0NA 1WX6A 1K9MU 1YFTA 1M3CA 5GAOr 2E6ZA 1VQPQ 3CCEQ 1KQSS 3SDZA 3JB9G 2L5QA 2LQKA 4P72C 5GAMf 1Z7MA 4Q5WA 2ALYB 2KGTA 4J6WA 5IN1A 4AG1C 2O31A 3EFOB 4X9DA 5I2SA 1LNXA 2COWA 1YFRA 2P0KA 2RD1A 3L4GA 3A8OB 2CT3A 1MGQA 2HNIA 4M75D 8ATCB 1M1KU 3UFGA 4AFSC 4C92A 2ESWA 1CKAA 1D0ZA 3V8JA 2H3JA 4CRIA 3KBGA 2QDLA 1BU1A 3CPWA 1IGUA 5D6XA 2YSQA 2L0AA 1IRXA 3NEMA 3CCRT 4OMFB 1TU0B 3M59A 4M7AB 3M9QA 2HD0A 4P73A 4EO4A 4X5OA 2M0OA 1OPKA 3RNJA 3A31A 4D8DA 1ZUYA 1QVFA 1B70A 3LC0A 4FSXA 4XTVA 1CKBA 2FYKA 4M75F 1B7TA 2AIRB 1PYSA 3LH5A 2RK1A 3UPUA 3VYHB 3UT1A 3QG1A 3EG2A 3HFOA 3BY7A 2GBQA 1GXIE 4L87A 4H2YA 2IY5A 1USYA 1K73C 5HY6A 1PC0A 2PUOB 5FU7B 3REAB 2YRVA 1VQMT 3CPWS 1Q86R 1JJ2S 2F5KA 4CI0C 3JCMW 4K87A 4P71C 1EVKA 1WNLA 1YJ9Q 4JRKA 4LE9A 2KYBA 2DDZA 1X69A 3X20B 4M7DA 4J9CA 1QLYA 1QVFS 4L5GA 4YRPA 4IUVA 3RGLA 2A08A 1U8RA 3UATA 3JB9I 3OYFA 1M5Q1 1YI2T 1TH7A 2DTHA 1U3OA 2HKNA 3WQZA 2ZAEA 1UHCA 3NGPA 3P8TA 3VBBA 4A4GA 4QKUA 3A98A 4PJOD 2YUPA 4FW1A 4M77A 4JRPA 4M7AE 2ZZEA 2CJBA 1M1FA 2DIGA 1SHGA 3ASKA 3JCMb 1X55A 1I4K1 4XU3A 2LX7A 2K2MA 5LJ3g 4HWSA 4EMGA 1YJ9A 2RM4A 3HXZA 5IHNA 3G71T 2CUDA 1WHMA 2LVMA 4KUDK 4X34A 2AKLA 1KOGA 3REBB 4C8QB 4PJOF 1U5SA 3JB9D 2V26A 3S6WA 1VYUA 4BY6B 4N0AA 3HTRA 1ZX6A 1IHWA 1YN8A 3JCMg 2QG9B 3V7SA 2RI2A 2I4OA 2F2XA 1OX9A 4A4KA 3RUXA 2WACA 1NBEB 1EFWA 2O9VA 3A8LB 3H0FA 3RIRA 1BB9A 1M90R 1PSFA 4C5HA 2VXEA 2KT8A 1Y96A 1VQLQ 2DILA 1QCOA 1IHVA 3OYKA 2JUFA 2L8DA 2ZPFB 2XU8A 1WXBA 1BIBA 3QYHB 1GBRA 3X24B 3QJYA 2COZA 5GAOm 1GFCA 2E6NA 3NTIA 3UGTA 5GMKh 5KYWB 1B3QA 1Q81U 1UGRB 4FYXB 3TEHB 4II1A 5E3IA 4HVCA 2LQ8A 3CBOA 4BUGA 1RAAB 3CCQT 2ZZFA 2PVOB 4C5EA 2RHSB 2YUNA 3PIOA 4ZIBA 2WSFE 1WQWA 2ZNIA 2ROLA 1PRMC 1VQLA 4C8QE 5LJ3j 1ZSZA 1YJNQ 1TS9A 1G2BA 4M75A 1RAGB 1B7YA 2HAXA 5GANh 1R0BG 1YCYA 3JV3A 1Q95G 4KGXB 3EGDA 2EYZA 5HKCA 4F7UB 1N8RU 4CC3A 5C6SA 2ABLA 2LRQA 3G71Q 2VYTA 4HCKA 1VQKT 2M9UA 1D1BA 2LNVA 1D3BA 1FYNA 2HDAA 1YWOA 4JLIA 4BI4A 1K0XA 1WU7A 4CC7A 2Q7HA 4IKFA 3LWIA 7AT1B 2QQRA 2J6OA 3OYNA 2CZ7B 3VJPA 3V7RA 4CH5A 3VS4A 4MDXA 3RBBB 2E70A 2H3EB 1NJ8A 1YJNA 3EFOA 5LJ5e 1VQ7T 3INZA 1M30A 1AVZC 5A0DA 2K57A 4H2TA 3TVTA 4YREA 2KRSA 3GF5A 2O01E 2ZNJA 4C92G 4CS2A 4HCBA 1U1TA 2XGTA 4YRQA 4HCZA 1KHCA 2J6FA 2ODRC 1ZUKA 2ZPGB 2XDBA 3FRNA 1Z7NA 4PJOC 2D0QB 4KR3A 1E6GA 4IIMA 3M4QA 1ZUUA 1X2KA 3G71A 1WIEA 1MMAA 1PD1A 2KVQG 3CQTA 1WHJA 5D6WA 4LDVA 3CMAT 3I5RA 1H8KA 3P8VA 4LD6A 2DLPA 1YFSA 1UECA 4HT9A 3CCQQ 1EQRA 2MK5A 4F7UE 4R0KA 3OYIA 4JS5A 1W66A 4P75A 1YWPA 2PTKA 4Q6GA 1HD3A 1M4ZA 1OPLA 2DQ0A 1M9SA 4PFPA 1SEMA 1NYGA 1FX7A 1U06A 2D9TA 2RJEA 2DL8A 4H2UA 4RTXA 2RQRA 1KFZA 4TVAB 2KYMA 4AH6A 1KQ2A 4XTZA 4BE2A 1KMMA 4PG3A 4XQ3A 1RUWA 3CC4A 3PT9A 3VKIA 1UHFA 2NS6A 4M7DG 3FB9A 2RI5A 4RG2A 2DBMA 4IUUA 5GAN8 2EJFA 3O8VA 2AKWB 1RI9A 3CCQA 1M8VA 4GBQA 2X9HA 1UE9A 1GCQA 3LYIA 2P4TA 3JAME 2JOYA 2MIOA 4M77G 3I56T 2FZKB 1WJSA 3C0CA 1UGSB 3D7SB 2DJQA 5M9OA 1IL2A 2C8MA 1YJWT 1VQ7Q 4J5YA 5LJ5d 1NE8A 2LT4A 3A8GB 2LDMA 4YRGA 3URGA 2YT6A 3G6EQ 3JCMQ 4LXCA 2JM8A 3HP9A 2RHQB 2QA4T 1BBUA 2ENMA 4E51A 1G3WA 3HRKA 3J80E 1QCNA 4YRKA 4ZGEB 5KYXA 3CCMA 2KR3A 4C8QA 1RL2A 1YB3A 3VRZA 4C0DC 3QO7A 4BI3A 2DXBA 2JMCA 1N27A 4IUTA 2YWWA 2NUTB 1IREB 3HRUA 2ZT6A 4C92D 3OBYA 1E24A 2JW4A 4A54A 2DE0X 2DL4A 1WHKA 1NJ6A 1H4TA 5FROA 4DPGA 5A0LA 4O5VA 3ERRA 4E2FB 2CDTA 2EIFA 4DEYA 3MEAA 3G6EA 3CCUT 4TTVA 1WXTA 3JSCA 2KRNA 2YUQA 1D1AA 1PWTA 5KYWA 3PCOB 2X3WD 4UP9A 3ZEHA 4OB2B 2ROTA 1VQ8Q 1E22A 1SETA 3M4PA 5ELNA 5C0MA 3A32A 1N9RA 4MMKA 3OY9A 1M2OA 5KE3A 4E7LA 5FWCA 4XTXA 2YHTA 2HMAA 2ECZA 3G4ST 2RN8A 4X9CA 1WYXA 1AEYA 5C52B 1PHTA 2QAZA 3M4GA 4OB1B 4AFQC 2RJDA 1PM3A 3PGGA 2K9GA 3OMGA 3X26B 3OYEA 3I56Q 4M75G 4M7DD 3QBYA 2DFUA 2HZYA 5GAMg 3C95A 4H2VA 3MO8A 3G1JA 3HPWA 4PJLA 1KJWA 2CP2A 1VQ8A 3X25B 2KK4A 3VQWA 2DMOA 2ZPHB 2VVKA 3L2RA 2OJ2A 3UGQA 4PL6A 2E3HA 4RMOA 1D0XA 4LDXA 4HWRA 2NWMA 3NELA 1I07A 1DJ7B 2K4YA 4A63B 3W3SA 5L8RE 4PLIA 4M77D 3AT1B 1EIYA 3I7FA 3QIIA 4M7DF 4FU6A 4C0FA 2J05A 1Y0MA 2EQUA 4LNPA 3CCVQ 5LJ5f 3I56A 1JB0E 2AK5A 1WFWA 3EG9B 2Q5HA 1WA7A 3UWNA 4P3PA 1MMDA 3A1PA 1V76A 1M27C 1PKTA 4VUBA 3OYJA 2CZ1B 3CMEQ 4PHCA 5F5WA 1B34A 1OU8A 2XI9A 2QHSA 2EGAA 4J9BA 2RA2A 3CCUQ 4JS4A 1XNIA 3L42A 1I8FA 2VGNA 4RTZA 4MZPA 5I11A 1QVGP 5GANg 4LVJA 1AZEA 2A0FB 2ZCFB 1VQ6A 2CREA 2YXYA 1D1CA 1QW1A 2MWPA 4R56A 1HSQA 2M0YA 1NJ2A 2O4XB 2K6DA 2X4JA 4C5IA 3GP8A 2DKGA 4V2SA 2LCSA 2D8JA 3C94A 1ACMB 3CCVA 1QF6A 1Q82U 1YJ9T 4ZTUB 1SRLA 2IG0A 1Q7YU 2FB7A 3S3NA 2JT4A 3R07A 1NM7A 2EYXA 4O6JA 3G4SQ 3CMEA 4KT0E 1ZLMA 4JLGA 5FU6C 3NFCA 4TVAA 1KQSP 2KXCA 3ZL7C 4C92C 3CCUA 3KFVA 4RTWA 1NJIC 4WJ3M 2XHCA 5AYFA 1C0MA 2DU7A 2JTMA 4XTWA 1WQ7A 1AWXA 1TUCA 1NYFA 2AT1B 2KDSA 2XICA 3G7ZA 4MZMA 1H4QA 3TEGA 1IZ6A 2A36A 4GY5A 5GMKj 2K3BA 4QQ6A 2XDPA 3OQ5A 4D8KA 1VQOQ 1D09B 1WJRA 4P73C 2LJ3A 2K3XA 1NJIR 1HXDA 2QGGA 4P3OA 1NLPC 2DD4A 3PIPA 1L0WA 3PVLA 1OQKA 4OB3B 5LJ3e 2QQSA 2DPPB 2KBTA 3WVDB 4JZ3A 3CCSQ 4YRTA 1M2VA 3M53A 3G4SA 4N4GA 2CS7A 1E1OA 1JJ2A 1USYC 2YDLA 3VQVA 4E7HA 1JXMA 5D7UA 2V8JA 1AOJA 1EFNA 2ZPBB 4A53A 5FRMA 3JCMe 3QXEB 2RHQA 4ZTZB 3VQYA 2FPEA 4DOVA 5GANj 4QVDA 1VQ4Q 2HEQA 2G3RA 3U23A 2ARSA 4C8QG 3OYHA 1VQOA 1UTIA 3M0TA 1AT1B 5CIUA 3JB9J 4M7DC 2B8AA 3CPWP 3EGXA 3TQ7P 2DXUA 4KR2A 6AT1B 1HC7A 3E9FA 1VQLT 3J7AF 4X1VA 2XTIA 3QTCA 2D0NA 1OOTA 4H2WA 4P72A 2YLCA 2DF6A 4WF2A 4OGEA 5HGQA 3CCSA 3BW1A 1KC8U 2JNGA 1UB4A 2L3QA 4HXJA 1GL5A 3FJ5A 1QVFP 4G84A 1B76A 3EHQA 2HQXA 3NHNA 2MWOA 3MKDA 1BBZA 4M77C 2CZ0B 5KH6A 1K73R 2AKKA 1FWZA 1M3AA 1JQQA 3CBPA 2ZT7A 1YBYA 4HVWA 4EPCA 2AHJB 3QUIA 4FT4A 1VQ4A 2A7YA 3PCOA 1OYXA 2J06A 2QTXA 3FLGA 4WCIA 2CH4A 2DETA 1HYOA 4LVKA 3UF4A 1NPRA 4B9XA 1YJNT 2B86A 1RI0A 1O9SA 4RTTA 1RLQC 1XTDA 3QO5A 2PQWA 5KCOA 4N0AC 1KD1U 4YRJA 3HY0A 4DBRA 4M7AF 2JS2A 3CCJT 3CCLQ 1G5IA 2BIVA 3FC3A 1MMNA 2LCCA 4CH3A 5LJ3d 4XTYA 3OS5A 3LGLA 4HVVA 2X4WA 1NYQA 1WJQA 2OTLQ 4MDWA 4LUEA 4ANJA 2EJ9A 2X4YA 1GFDA 1Y07A 2LX9A 4J83A 3TUPA 1PSEA 4LD9K 2DXTA 3HFZA 4YROA 5KYNA 5GMKl 2ZTGA 2XK0A 1YIJA 4PKCC 3JCMd 1TSFA 3OYAA 4XEMA 2VC8A 1Z9QA 3HSBA 4J9GA 2A8EA 5GAMh 3M56A 1SKUB 1HTTA 4EMKA 2AMCB 1QQJA 3CD6A 2NYSA 3CCLA 2EL9A 4TQDA 4DBHA 1YP5A 4CS4A 2JN0A 5IH2A 2DAQA 1HK9A 4WTOB 1MV3A 3ZFJA 2OTLA 1NEGA 3CC4T 2P0LA 2IPOB 4UC4A 3MPUB 2GQIA 3THKA 1SRMA 2ATCB 1ZSZC 4KUIA 5GAOp 4C8QD 2QGFB 3QNEA 1J5WA 4G85A 2XDDA 2QQ9A 1PCXA 4M75C 2E1HA 3I35A 2OX7A 3KUFA 3G1ZA 1G3TA 2RJFA 4YCUA 4K86A 4TVRA 4DBFA 4YRSA 1GCPA 9ATCB 4M4ZA 3OBWA 1EOVA 2FPFA 2R57A 4H02A 4OMMA 3H0IA 4PJMA 2F2WA 3MEUA 2O88A 2DL3A 5A2QE 3GBQA 2O4XA 1FYFA 2AZSA 12ASA 4LVLA 1VIFA 2PMFA 1H3HA 3EH1A 3M0PA 4C8QF 3MEYA 4M78B 3M58A 1T3LA 3OYGA 4YP0A 1ZA2B 4BB7A 4PK4A 3OYBA 3A5ZB 4UP8A 3CCJQ 2KROA 3CC7A 3EHRA 3GPLA 4BE1A 2E12A 5CKEA 3CCMT 3REUA 3PZCA 5DLQE 2YRDA 1W1FA 2LCLA 1KG1A 5FWBA 4KRTA 3SWNB 4CS3A 1ZBJA 2HCKA 4Y28E 2EGCA 1FMVA 4OP0A 1Y71A 2ZT5A 3OD1A 4WI1A 3QWYA 3F70A 2XD0A 4YRRA 2ALYA 2DL5A 3QDRB 2PNIA 4JDSA 5LJ3f 4O2DA 2NUZA 1S72Q 3G6ET 4AFUC 4FCYA 4RG8A 4QT7A 2X35A 2ZPIB 4XU0A 3CCJA 1K9MC 4RKUE 3UA7A 4P75C 2GQVA 2V1RA 1G3YA 2DNUA 1YHQQ 3HXYA 2MPXC 2DZCA 2VB6A 3CC4Q 5CKBA 4YTLA 4M7AA 3H0HA 3SHWA 1K9MR 3HRSA 3L2VA 4M78E 3JCMf 1K8AU 4LN2A 2RO0A 1M1KC 3M0UA 1OV3A 2NUPB 3MJXA 2Q5IA 4KH0B 1W2BS 1BI3A 4KGZB 4OGCA 2ZXFA 4E7KA 4QQDA 1FMWA 2DXCA 2G6FX 4XTUA 4F7UF 1S72A 1UGQB 1BI1A 2CP0A 3AHUA 2Y4XA 3OYMA 3QZ9B 1M1KR 4N4HA 4EX5A 1R0CB 2VGMA 3VUBA 4Q15A 1GCQC 4HWPA 2RHYA 4UPAA 2L3RA 2EBPA 1WLEA 2KQWA 2FEIA 1BIAA 2C06A 1BBWA 1YHQA 3CC2Q 1KMNA 1KK7A 1VQ8T 1LVKA 5ELOA 4J9DA 5HCKA 3CMQA 4H2SA 3VQXA 1OI1A 1W6XA 3TSZA 3P8HA 2RI3A 1KIKA 4JJBA 5L23A 3CCMQ 1X43A 1FXXA 2GNCA 2F2VA 3H41A 2RQUA 2P84A 3SEMA 1VQ9T 2LQNA 1UFFA 3E9GA 3CBMA 1H92A 4HA8A 4YRCA 1NEBA 4C8QC 3E1SA 3ICAA 4JPBW 2FHDA 2MI6A 5EG2A 5J26A 2DIQA 3VRYA 3CC2A 2FPDA 2DZ9A 2E41A 4BE0A 4XU1A 4RTYA 1WHLA 3CXCA 5FRNA 5KE2A 3QZ5B 2QYZA 5GMKm 4C92B 4J15A 3BFMA 3GOXA 1QMCA 2K2VA 1Q86U 4HT8A 2JXBA 4HVUA 4H2XB 2JVVA 4QVZA 4OMPA 4EIKA 5GMKe 1VQ6T 2ZT8A 4JJCA 8AT1B 1ADJA 3JB9H 2FVUA 5FLXE 3EG0A 3A8MB 3FIFA 3CCVT 2A28A 1QKXA 4OMNA 4E47A 2EKHA 5GAOn 2DRMA 1G51A 4PFZA 2EQIA 1ARKA 3RL6A 4CH6A 1ASYA 1YITA 4LDYA 1N6AA 3CMET 3R6OA 1X54A 4Y91A 3CXCS 2EFIA 2MYSA 2X3XD 1AHJB 2CKKA 5LL6S 1JRIA 4PJJA 2YLBA 2MOXA 1OU9A 3V8LA 1UUEA 3VS5A 4KQEA 4GLMA 4E7JA 3HXVA 2D1XA 11ASA 4AT1B 1X2QA 1UJ0A 5IT9E 5GANe 2HKQB 3TEHA 3PTAA 2ED0A 3IG2A 2DVJA 4E7SA 2E5QA 2E5KA 3EAEA 1YGBA 4FM4B 3GLXA 3IQLA 3I55A 3JCMP 3A8HB 3DKMA 4RQFA 3GNFB 2RHSA 1ABOA 2W0ZA 4FT2A 3RKWA 2RQWA 1RAIB 4P74A 1M8MA 4RUGA 3C4SA 4A4FA 4C92E 3L2WA 2XG8D 3LGFA 3NPFA 2DBKA 4MMLA 1XQHA 1VQ9Q 1Q81C 1AWOA 4RCBA 1LCKA 5GAN7 4M78A 2BZXA 2RHZA 3OB9A 1M90U 1R77A 4PJNA 4M77B 4BWAA 2SEMA 1TUGB 2RQVA 1WLPB 3EG1A 2CJAA 2R5AA 2QEXQ 4OVAA 2ED1A 3P8BB 5CQXA 4F7UA 1OULA 4J6XA 1Q81R 1I0CA 1VQOT 3RKYA 2GTJA 4IURA 3P8YA 2Y90A 4Z88A 4IIOA 3SWNA 5DY9A 1VYTA 4FYYB 1RACB 1VQNT 2ZR3A 2EQJA 1VQ5Q 2O2OA 3BE3A 2P0QA 4FYVB 2ZZGA 3CCST 1VQ6Q 2DTIA 2W10A 4F14A 1WHHA 3M57A 1ADYA 4HWTA 4JRQA 1X6OA 2DL7A 1VQ9A 2MCNA 4FIBA 3VS6A 3HHTB 1D0YA 1N8RC 2CP7A 3BDLA 2KI7A 2YUOA 2OAWA 2GCXA 4NS5A 3OMCA 2EJGA 5KCHA 2JMAA 2QEXA 1VQ4T 1CSKA 3A7UA 1G8XA 3O5ZA 1K76A 2EAYA 1QWEA 2HBWA 1WHGA 1Y96B 1TUDA 1N8RR 4LUDA 4ATOA 1NG2A 1NJ5A 4ESRA 3DSQA 2C0IA 2HL5C 4M7AG 2PVDB 3QPHA 4BDYA 2EVRA 4NL3A 2E64A 1VQ5A 1PD0A 1H3ZA 5GANd 4M77E 5J3BA 5HK3A 2PMEA 4CH4A 2CSIA 2NUPA 1E6HA 3FJPA 2XIDA 3OA6A 2CIMA 3M5AA 1Z9ZA 1ZA1B 3SFMA 1MHNA 1LYLA 4MZTA 1TG0A 2IIMA 4ZN1A 5CO7A 2K7AA 2VXFA 5GAMj 2EYQA 4J9EA 3OW2S 2E65A 4NL2A 1GRIA 3IKLA 1VYVA 3WVEB 1RAFB 2C0TA 4J8OA 3RKXA 1QVGS 2RB6A 2DO3A 2RQTA 4M75B 2RHXA 1PKSA 1YIJT 4KBMB 3RMSA 1G5VA 4D6WA 4F16A 1NZ9A 2EQMA 3EGDB 3H6ZA 5FW9A 3VS2A 3WXMB 1RIQA 2LQWA 3RERA 2AKWA 3CD6T 3CCLT 4OF1A 2CYZB 1V29B 1H4SA 2Q7EA 4JJNK 2FG0A 2DRKA 4E6RA 1VQNQ 1D3BB 4YYEA 1I1JA 2OTLT 2D8HA 5C53B 2PVGB 2RJCA 2ARTA 1SHFA 1M1GA 5IAYA 1TTHB 2RH2A 1C0AA 2H8HA 2EW3A 5GJWB 3HTZA 3QJ6A 2HQHA 1MUZA 2LJ0A 4ZTFA 4LDUA 2V8IA 4BD3A 4H2XA 3HXUA 1ZQ1A 4Z02A 1N9SA 2CP6A 2BE9B 2E10A 2JTEA 1JJ2P 4BACA 1X2GA 1X01A 3S3OA 3UDCA 1KQ1A 3NENA 1VQNA 1KHIA 1VUBA 2FRYA 5IXBA 1QVPA 2ZIMA 3RR6A 2NUTA 1VQPA 3CCEA 3OS2A 1NPPA 4HKEA 1YCSB 2KEAA 1TOVA 4M75E 1XOVA 4YPFA 4RDXA 3LX7A 2R5MA 4FSSA 2CT4A 5KNNA 1PG5B 2DTOA 4CC4B 5LJ5h 1Q86C 3CC7T 2KMTA 3TU4K 2DYBA 1NJ1A 2XMFA 3RDVA 1AD5A 2P4RA 3TCJA 4PJOB 4M7AD 5CKHA 3PMTA 1IGQA 4CC2A 4ZTJA 1J3TA 4P5NA 4DOWA 4A4HA 3VYGA 5GANf 1X56A 2IVWA 1MNDA 3NMZC 3HL8A 2QHVA 1YIJQ 3ZBDA 4B6MA 2DYIA 2V8KA 4OMOA 1TXQA 2K3YA 3L1AA 4NOYA 2KAFA 3OSSC 3CD6Q 4TWAA 3HFVA 5IXFA 5AT1B 5C51B 2ODRD 2BKDN 3HXWA 4M78G 4EMKC 4P3NA 2EQKA 4HT4A 3JCMJ 4P71A 3L2UA 1G83A 1T0JA 2HSPA 2FRWA 3OYYA 1JJCB 3HY1A 4AG2C 1G5HA 1W4SA 5CKDA 2LTOA 1WPYA 4F7UG 4DBQA 3M0QA 3TEEA 2PU9B 4LVIA 2L3SA 2MF2A 2WSEE 2CGHA 4E7IA 3M0SA 1C6VX 4HWOA 2VV5A 4AMCA 4R55A 3VV0A 4TVWA 3MCAB 1UEBA 2EYWA 4PJOE 1S72T 2AZVA 2MMPA 2FZGB 2VASA 4J7FA 4ORZA 5KYXB 3V7CA 1M90C 3E9IA 1W70A 2L89A 2CJ9A 3CCRQ 1WXUA 3RACA 3SD4A 2HBPA 4JZ4A 3RF1A 2DJZA 5A0GA 1YHQT 1VIEA 2FL7A 3KFUA 1PNJA 3EG9A 4XU2A 1QKWA 2ZPEB 3MEWA 1WGSA 4J6YA 1JEGA 3CC7Q 2DU5A 4L59A 2G4CA 1QWFA 3M55A 2LT1A 2DM1A 2JM9A 2OAUA 4KGVB 5J39A 3JB9F 4C0DB 1F1BB 1NLOC 1JXOA 2DVEA 2BTTA 5CCAA 4YRIA 2LZ6B 2Y4YA 3A7RA 1ABQA 2QQAA 1VQMQ 4PFOA 4RTVA 1U1SA 4KULA 3LSQA 2HL3A 4Z89A 3CCRA 2I4NA 1X6GA 3NTHA 3QWXX 3CC2T 3KXTA 2BZYA 4QVCA 1EIFA 5DM7R 1WDXA 2EKOA 1RAHB 1BCOA 2F5TX 1YI2Q 1IO6A 5K1XA 2I4LA 3DB3A 3HFNA 1EX4A 4YCWA 5GJVB 1AZGB 1RADB 1IB8A 4ZNXA 4N4IA 1X6BA 3VS1A 1MNEA 4YRLA 1VQMA 2DERA 1H641 3PE0A 1Q82C 1I5OB 1SPKA 1Q7YC
chains in the Genus database with same CATH topology
4RQEA 4XEOA 4M7AC 5CVIA 3OYDA 1YITT 2X4XA 3MF1A 1ZBXA 2Q7GA 4M78D 1W2BA 2VUBA 4OLFA 2QI2A 1N9WA 3GNGA 1EIYB 2ZR2A 1YI2A 2LC4A 3BJUA 3MP8A 4J7IA 3FDRA 2KY9A 5FU7C 1QE0A 2MAMA 3ER0A 2EWNA 3RESA 1B8AA 3I55T 4JUVA 2D6FA 4PNOA 2DD5A 3LLRA 4M78F 2CZ6B 2RHIA 3E19A 1B34B 1QP3A 2NLUA 4BI8B 5CAIA 3IALA 1SRYA 3MP6A 5GAN6 1UGPB 4IUPA 2OTJT 3EFRA 3LH0A 4C0ZA 2JTFA 4JRIA 3V8KA 2GFAA 1X2HA 3NETA 5HK0A 4PLLA 2ZGWA 3QHSA 1NJIU 4YRNA 3UH0A 5K1PA 3HRTA 3QSUA 2A3LA 1NNHA 4PJOA 1OZ2A 2J3MA 3JCMc 4K88A 1BKBA 3MP1A 1P92A 2ZCEA 3DLMA 2RK2A 4YDQA 1KC8C 2DQ3A 2QXFA 3TREA 1ZHIA 2PUKB 5I21A 2E3CA 4BY6C 4RCCA 3P8DA 3MEVA 3H8ZA 5GAMe 3MQZA 2E5AA 3L2QA 4YRFA 2QEXT 1EVLA 3LWHA 5FU6B 3L4GB 3L2ZA 1BI2A 3E9HA 1JJCA 1OZ3A 3HXXA 3QO8A 1VQ5T 2QHTA 3DLLA 5LJ5g 1KD1C 4UP7A 1K73U 5GMKi 1I5LA 4TQFA 4DA4A 2C7IA 4BW9A 2HQEA 5GAN5 1B70B 2AMCA 1BYMA 5GAN2 1LOJA 3CPFA 1PYSB 1VQZA 5LJ3h 1VQKA 1O75A 1GGMA 4P74C 3MHXA 4EDUA 2I2LA 3BDUA 3IKMB 2IY5B 3EFSA 3HKSA 3VU3C 1X75C 4XAXB 3VUZA 2K5IA 4OB0B 4M78C 4IUQA 4LDWA 1VQ7A 4ELZC 4QQGA 3Q1JA 3OS1A 3RMQA 3JCMh 2P0PA 4M7DB 2M16A 3J81E 5CK9A 4FL6A 4GLKA 2RHUA 3MF2A 5CKFA 1WYDA 2R58A 3A7AA 3SWNC 1QP2A 4C92F 2OTJA 4LNSA 3N5BB 2K5FA 3DB4A 4ZGJB 3CMAA 4HCCA 4ZN3A 5GAMd 3A5ZA 2BUDA 2ARUA 5DLOA 1G3SA 3T9NA 5LJ5j 3A5YA 3LSSA 3QO3A 2GFUA 4ME7A 4QW2A 3OSVA 5GAOq 2ZZDA 1ASZA 5GAN3 3REXA 1VQPT 3CCET 2XKOC 1ATIA 3HFZB 4YRMA 1I81A 3M4YA 1NYRA 3X28B 2WSCE 2QHUA 3A74A 3META 1Y7XA 5I2MA 4M7DE 4C0GA 4EMKB 4C5GA 1SERA 5CQYA 2M1HA 2GF7A 3QKJA 3OYLA 1LJOA 3OW2A 3CEYA 2P5IA 4EMHA 3JRZA 4XK8E 1QVGA 3FEOA 4WJ4A 1YJWA 1H4VB 1SSFA 1R8OB 4B9WA 4M77F 4ZGDB 2ZIOA 5GAOl 2K5LA 2QA4A 5D6YA 2ZINA 3SB2A 5CR2A 1E1TA 3M54A 1SESA 3PMIA 4BDZA 3JCMX 1BI0A 3GIBA 4L6V5 4LVMA 1K8AC 4DQ2A 1KQSA 3PFSA 4A4EA 4NCXA 4ELYC 4PJOG 2DEQA 2I4MA 4RMFA 2DK3A 1B7YB 2J3LA 3C12A 1JBMA 2KSSA 3JCMV 3OS0A 3HRIA 3NTKA 3LW5E 3QYGB 4TVYA 2QQBA 2JZ2A 3S3MA 5GAN4 2F69A 4YCVA 3OYCA 3ME9A 3PNWC 2QDYB 1K9MU 1YFTA 5GAOr 2E6ZA 1KQSS 3SDZA 3JB9G 2L5QA 2LQKA 4P72C 5GAMf 1Z7MA 2ALYB 4Q5WA 4J6WA 5IN1A 4X9DA 5I2SA 1LNXA 1YFRA 2P0KA 2RD1A 3L4GA 3A8OB 1MGQA 2HNIA 4M75D 1M1KU 3UFGA 4C92A 3V8JA 2H3JA 4CRIA 3KBGA 3CPWA 5D6XA 3NEMA 3CCRT 4OMFB 3M59A 4M7AB 3M9QA 2HD0A 4P73A 4EO4A 4X5OA 2M0OA 3A31A 1QVFA 1B70A 3LC0A 4FSXA 4XTVA 2FYKA 4M75F 1PYSA 2RK1A 3UPUA 3VYHB 3UT1A 3QG1A 3HFOA 1GXIE 3BY7A 4L87A 4H2YA 2IY5A 1USYA 1K73C 5HY6A 2PUOB 5FU7B 2YRVA 1VQMT 3CPWS 1JJ2S 2F5KA 4CI0C 3JCMW 4K87A 4P71C 1EVKA 1WNLA 4JRKA 2DDZA 3X20B 4M7DA 1QVFS 4L5GA 4YRPA 4IUVA 3RGLA 1U8RA 3JB9I 3OYFA 1M5Q1 1YI2T 1TH7A 2DTHA 3WQZA 3P8TA 3VBBA 4A4GA 4PJOD 4M77A 4JRPA 4M7AE 2ZZEA 2CJBA 1M1FA 2DIGA 3ASKA 3JCMb 1X55A 1I4K1 4XU3A 5LJ3g 4HWSA 4EMGA 1YJ9A 2RM4A 3HXZA 3G71T 2LVMA 4KUDK 4X34A 1KOGA 4C8QB 4PJOF 3JB9D 3S6WA 4BY6B 4N0AA 3JCMg 3V7SA 2RI2A 2I4OA 4A4KA 3RUXA 2WACA 1EFWA 3A8LB 3RIRA 1PSFA 4C5HA 2VXEA 1Y96A 3OYKA 2JUFA 2L8DA 2ZPFB 2XU8A 1BIBA 3QYHB 3X24B 3QJYA 5GAOm 2E6NA 3NTIA 3UGTA 5GMKh 1Q81U 1UGRB 3TEHB 4II1A 5E3IA 4HVCA 2LQ8A 3CBOA 4BUGA 3CCQT 2ZZFA 2PVOB 4C5EA 2RHSB 3PIOA 4ZIBA 2WSFE 1WQWA 2ZNIA 1VQLA 4C8QE 5LJ3j 4M75A 1B7YA 2HAXA 5GANh 1YCYA 5HKCA 4F7UB 1N8RU 5C6SA 2LRQA 2VYTA 1VQKT 2M9UA 1WU7A 2LNVA 1D3BA 4BI4A 4JLIA 2Q7HA 4IKFA 3LWIA 2QQRA 3OYNA 2CZ7B 3VJPA 3V7RA 4CH5A 4MDXA 2E70A 1NJ8A 1YJNA 5LJ5e 1VQ7T 3INZA 4H2TA 5A0DA 2K57A 4YREA 3GF5A 2O01E 2ZNJA 4C92G 4CS2A 4HCBA 1U1TA 2XGTA 4YRQA 4HCZA 1KHCA 2ODRC 2XDBA 2ZPGB 3FRNA 1Z7NA 4PJOC 2D0QB 4KR3A 3M4QA 3G71A 2KVQG 5D6WA 4LDVA 3CMAT 3P8VA 4LD6A 1YFSA 4HT9A 1EQRA 3OYIA 4F7UE 4JS5A 1W66A 4P75A 4Q6GA 1M4ZA 2DQ0A 1M9SA 1FX7A 2D9TA 2RJEA 4H2UA 4TVAB 4AH6A 1KQ2A 4XTZA 4BE2A 1KMMA 4PG3A 4XQ3A 3CC4A 3PT9A 3VKIA 2NS6A 4M7DG 3FB9A 2RI5A 4RG2A 4IUUA 5GAN8 2EJFA 3O8VA 2AKWB 3CCQA 1M8VA 3LYIA 2P4TA 3JAME 2JOYA 4M77G 3I56T 1WJSA 1UGSB 5M9OA 1IL2A 2C8MA 1YJWT 4J5YA 5LJ5d 1NE8A 2LT4A 3A8GB 2LDMA 4YRGA 3URGA 3JCMQ 3HP9A 2RHQB 2QA4T 1BBUA 4E51A 1G3WA 3HRKA 3J80E 4YRKA 4ZGEB 3CCMA 4C8QA 1RL2A 1YB3A 4C0DC 3QO7A 4BI3A 2DXBA 1N27A 4IUTA 1IREB 3HRUA 2ZT6A 4C92D 3OBYA 1E24A 4A54A 1NJ6A 1H4TA 5FROA 4DPGA 5A0LA 4O5VA 3ERRA 2EIFA 3MEAA 3G6EA 3CCUT 4TTVA 3JSCA 3PCOB 4UP9A 3ZEHA 4OB2B 1E22A 1SETA 3M4PA 5ELNA 5C0MA 3A32A 1N9RA 4MMKA 3OY9A 5KE3A 4E7LA 4XTXA 2YHTA 3G4ST 4X9CA 5C52B 4OB1B 3M4GA 2RJDA 3PGGA 3X26B 3OMGA 3OYEA 4M75G 4M7DD 3QBYA 5GAMg 3C95A 4H2VA 3MO8A 3HPWA 1VQ8A 3X25B 2KK4A 3VQWA 2ZPHB 3L2RA 3UGQA 4PL6A 4RMOA 4LDXA 4HWRA 3NELA 1DJ7B 2K4YA 3W3SA 5L8RE 4PLIA 4M77D 1EIYA 3I7FA 4M7DF 3QIIA 4FU6A 4C0FA 2EQUA 5LJ5f 3I56A 1JB0E 2Q5HA 3UWNA 4P3PA 4VUBA 3OYJA 2CZ1B 4PHCA 5F5WA 1B34A 2XI9A 2QHSA 2RA2A 4JS4A 1XNIA 3L42A 1I8FA 2VGNA 4MZPA 5GANg 4LVJA 2ZCFB 1VQ6A 1QW1A 2MWPA 4R56A 1NJ2A 2O4XB 2X4JA 4C5IA 3GP8A 2DKGA 4V2SA 3C94A 3CCVA 1QF6A 1Q82U 1YJ9T 4ZTUB 2IG0A 1Q7YU 2FB7A 3S3NA 3R07A 4O6JA 3CMEA 4KT0E 4JLGA 5FU6C 3NFCA 4TVAA 4C92C 3CCUA 1NJIC 4WJ3M 2XHCA 5AYFA 2DU7A 2JTMA 4XTWA 1WQ7A 2KDSA 2XICA 3G7ZA 4MZMA 1H4QA 3TEGA 1IZ6A 5GMKj 4GY5A 4QQ6A 2XDPA 3OQ5A 1WJRA 4P73C 2K3XA 1HXDA 4P3OA 2DD4A 3PIPA 1L0WA 4OB3B 5LJ3e 2QQSA 2DPPB 3WVDB 4YRTA 3M53A 3G4SA 4N4GA 2CS7A 1E1OA 1JJ2A 1USYC 3VQVA 4E7HA 2V8JA 2ZPBB 4A53A 5FRMA 3JCMe 3QXEB 2RHQA 4ZTZB 3VQYA 4DOVA 5GANj 4QVDA 2G3RA 2ARSA 4C8QG 3OYHA 1VQOA 5CIUA 3JB9J 4M7DC 2B8AA 2DXUA 4KR2A 1HC7A 3E9FA 1VQLT 3J7AF 2XTIA 3QTCA 4H2WA 4P72A 2YLCA 4WF2A 4OGEA 5HGQA 3CCSA 3BW1A 1KC8U 2JNGA 1UB4A 4G84A 1B76A 2HQXA 2MWOA 4M77C 2CZ0B 5KH6A 1FWZA 2ZT7A 3CBPA 1YBYA 4EPCA 2AHJB 3QUIA 4FT4A 1VQ4A 2A7YA 3PCOA 1OYXA 2QTXA 3FLGA 4LVKA 4B9XA 1NPRA 1YJNT 1RI0A 1O9SA 1XTDA 3QO5A 2PQWA 5KCOA 4N0AC 1KD1U 4YRJA 3HY0A 4M7AF 3CCJT 1G5IA 2BIVA 3FC3A 2LCCA 4CH3A 5LJ3d 4XTYA 3OS5A 3LGLA 1NYQA 2X4WA 1WJQA 4MDWA 2EJ9A 2X4YA 1Y07A 2LX9A 4J83A 3TUPA 1PSEA 4LD9K 2DXTA 3HFZA 4YROA 5GMKl 2ZTGA 2XK0A 1YIJA 4PKCC 3JCMd 3OYAA 4XEMA 2VC8A 3HSBA 2A8EA 5GAMh 3M56A 1HTTA 4EMKA 2AMCB 3CD6A 3CCLA 2EL9A 4TQDA 4CS4A 2JN0A 2DAQA 1HK9A 3ZFJA 2OTLA 3CC4T 2P0LA 4UC4A 4KUIA 5GAOp 4C8QD 3QNEA 1J5WA 4G85A 2XDDA 2QQ9A 4M75C 2E1HA 3KUFA 3G1ZA 1G3TA 2RJFA 4YCUA 4K86A 4TVRA 4YRSA 3OBWA 1EOVA 2R57A 4H02A 3MEUA 5A2QE 2O4XA 1FYFA 12ASA 4LVLA 1VIFA 2PMFA 4C8QF 3MEYA 4M78B 3M58A 3OYGA 4YP0A 4BB7A 3OYBA 3A5ZB 4UP8A 3CC7A 3GPLA 4BE1A 2E12A 5CKEA 3CCMT 3REUA 3PZCA 5DLQE 2LCLA 1KG1A 3SWNB 4CS3A 4Y28E 4OP0A 1Y71A 2ZT5A 3OD1A 4WI1A 3F70A 2XD0A 4YRRA 2ALYA 3QDRB 4JDSA 5LJ3f 4O2DA 3G6ET 4RG8A 2X35A 2ZPIB 4XU0A 3CCJA 1K9MC 4RKUE 4P75C 2GQVA 1G3YA 3HXYA 2DZCA 5CKBA 4YTLA 4M7AA 3HRSA 3L2VA 4M78E 3JCMf 1K8AU 2RO0A 1M1KC 2Q5IA 1W2BS 1BI3A 4OGCA 2ZXFA 4E7KA 4QQDA 2DXCA 4XTUA 4F7UF 1S72A 3AHUA 1UGQB 1BI1A 2Y4XA 3OYMA 3QZ9B 4N4HA 4EX5A 2VGMA 3VUBA 4Q15A 4HWPA 2RHYA 4UPAA 2L3RA 1WLEA 2KQWA 1BIAA 2C06A 1BBWA 1YHQA 1KMNA 1VQ8T 5ELOA 3CMQA 4H2SA 3VQXA 1OI1A 3P8HA 2RI3A 1FXXA 1VQ9T 3E9GA 4YRCA 3CBMA 4HA8A 4C8QC 3E1SA 3ICAA 2FHDA 2MI6A 5EG2A 5J26A 2DIQA 3CC2A 2DZ9A 2E41A 4BE0A 4XU1A 3CXCA 5FRNA 5KE2A 3QZ5B 5GMKm 4C92B 4J15A 3BFMA 3GOXA 2K2VA 1Q86U 4HT8A 4H2XB 2JVVA 4QVZA 5GMKe 2ZT8A 1VQ6T 1ADJA 3JB9H 2FVUA 5FLXE 3A8MB 3FIFA 3CCVT 4E47A 5GAOn 1G51A 3RL6A 4CH6A 1ASYA 1YITA 4LDYA 1N6AA 3CMET 3R6OA 1X54A 4Y91A 3CXCS 2EFIA 1AHJB 2CKKA 5LL6S 1JRIA 2YLBA 3V8LA 4KQEA 3HXVA 4E7JA 11ASA 5IT9E 5GANe 3TEHA 3PTAA 3IG2A 2E5QA 3EAEA 1YGBA 4FM4B 3GLXA 3I55A 3JCMP 3A8HB 3DKMA 4RQFA 3GNFB 2RHSA 4FT2A 3RKWA 4P74A 3C4SA 4A4FA 4C92E 3L2WA 2XG8D 3LGFA 4MMLA 1XQHA 1Q81C 4RCBA 5GAN7 4M78A 2RHZA 3OB9A 1M90U 4M77B 4BWAA 2CJAA 2R5AA 4OVAA 3P8BB 5CQXA 4F7UA 4J6XA 1VQOT 3RKYA 4IURA 3P8YA 2Y90A 3SWNA 5DY9A 1VQNT 2ZR3A 2EQJA 2P0QA 2ZZGA 3CCST 2DTIA 3M57A 1ADYA 4HWTA 4JRQA 1X6OA 1VQ9A 4FIBA 3HHTB 1N8RC 3BDLA 2GCXA 4NS5A 3OMCA 2EJGA 5KCHA 2QEXA 1VQ4T 3A7UA 2EAYA 1Y96B 4ATOA 1NJ5A 3DSQA 4M7AG 2PVDB 3QPHA 4BDYA 4NL3A 2E64A 1VQ5A 1H3ZA 5GANd 4M77E 5J3BA 5HK3A 2PMEA 4CH4A 3FJPA 3OA6A 2XIDA 2CIMA 3M5AA 3SFMA 1MHNA 1LYLA 4MZTA 4ZN1A 5CO7A 2VXFA 5GAMj 2EYQA 3OW2S 2E65A 4NL2A 3IKLA 3WVEB 4J8OA 3RKXA 1QVGS 2RB6A 2DO3A 4M75B 2RHXA 1YIJT 4KBMB 3RMSA 1G5VA 4D6WA 1NZ9A 2EQMA 3H6ZA 3WXMB 1RIQA 3RERA 2AKWA 3CD6T 3CCLT 4OF1A 2CYZB 1V29B 1H4SA 2Q7EA 4JJNK 1D3BB 4YYEA 2OTLT 5C53B 2PVGB 2RJCA 2ARTA 1M1GA 5IAYA 2RH2A 1C0AA 3HTZA 3QJ6A 4ZTFA 4LDUA 2V8IA 4BD3A 4H2XA 3HXUA 1ZQ1A 4Z02A 1N9SA 2E10A 4BACA 1X2GA 1X01A 3S3OA 3UDCA 1KQ1A 3NENA 1VQNA 1KHIA 1VUBA 1QVPA 2ZIMA 1VQPA 3CCEA 3OS2A 1NPPA 4HKEA 4M75E 1XOVA 4YPFA 4RDXA 3LX7A 2R5MA 5KNNA 2DTOA 5LJ5h 1Q86C 3CC7T 2KMTA 3TU4K 1NJ1A 3TCJA 4PJOB 4M7AD 5CKHA 3PMTA 4ZTJA 4P5NA 4DOWA 4A4HA 3VYGA 5GANf 1X56A 2IVWA 3HL8A 2QHVA 3ZBDA 2V8KA 2K3YA 3L1AA 4NOYA 2KAFA 3OSSC 4TWAA 3HFVA 5C51B 2ODRD 2BKDN 3HXWA 4M78G 4EMKC 4P3NA 2EQKA 4HT4A 3JCMJ 4P71A 3L2UA 3OYYA 1JJCB 3HY1A 1G5HA 1W4SA 5CKDA 2LTOA 1WPYA 4F7UG 3TEEA 2PU9B 4LVIA 2MF2A 2WSEE 2CGHA 4E7IA 4HWOA 2VV5A 4R55A 3VV0A 4TVWA 3MCAB 1UEBA 4PJOE 1S72T 2MMPA 4J7FA 3V7CA 1M90C 3E9IA 2L89A 2CJ9A 3RACA 3SD4A 2HBPA 3RF1A 2DJZA 5A0GA 1YHQT 1VIEA 2FL7A 3KFUA 4XU2A 2ZPEB 3MEWA 1WGSA 4J6YA 2DU5A 4L59A 2G4CA 3M55A 2LT1A 2OAUA 5J39A 3JB9F 4C0DB 2DVEA 4YRIA 5CCAA 3A7RA 2Y4YA 2QQAA 1U1SA 4KULA 3LSQA 3CCRA 2I4NA 3NTHA 3CC2T 3KXTA 4QVCA 1EIFA 5DM7R 2EKOA 2F5TX 5K1XA 2I4LA 3DB3A 3HFNA 4YCWA 4N4IA 4YRLA 1VQMA 1H641 1Q82C 1Q7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ADJ A;  4RQE A;  3JB9 H;  4XEO A;  4M7A C;  3RGL A;  1I8F A;  3JB9 I;  5GAN g;  1M5Q 1;  3FIF A;  3MF1 A;  1TH7 A;  2DTH A;  5GAO n;  1G51 A;  2Q7G A;  3WQZ A;  4M78 D;  3P8T A;  1NJ2 A;  3VBB A;  3RL6 A;  4OLF A;  4CH6 A;  2DKG A;  1ASY A;  1N9W A;  4V2S A;  1EIY B;  4PJO D;  2ZR2 A;  1X54 A;  3BJU A;  4Y91 A;  4M77 A;  1QF6 A;  4ZTU B;  4M7A E;  2ZZE A;  2CJB A;  2FB7 A;  1JRI A;  3R07 A;  2YLB A;  3JCM b;  1X55 A;  3V8L A;  1I4K 1;  4XU3 A;  1QE0 A;  5LJ3 g;  4HWS A;  4KQE A;  3HXV A;  4EMG A;  2RM4 A;  11AS A;  2EWN A;  3RES A;  1B8A A;  4TVA A;  3HXZ A;  5GAN e;  4C92 C;  4JUV A;  4PNO A;  3TEH A;  4WJ3 M;  4M78 F;  2DU7 A;  1B34 B;  1KOG A;  3IG2 A;  4XTW A;  1WQ7 A;  1YGB A;  4C8Q B;  5CAI A;  3IAL A;  4PJO F;  3JB9 D;  1SRY A;  1H4Q A;  3JCM P;  3TEG A;  4RQF A;  5GAN 6;  5GMK j;  2RHS A;  3EFR A;  3RKW A;  4N0A A;  4P74 A;  4JRI A;  3V8K A;  4P73 C;  3JCM g;  1HXD A;  3V7S A;  4C92 E;  1X2H A;  3NET A;  2I4O A;  4P3O A;  1L0W A;  3RUX A;  1EFW A;  5LJ3 e;  3RIR A;  2ZGW A;  4MML A;  3QHS A;  4RCB A;  4YRN A;  3UH0 A;  5GAN 7;  4M78 A;  5K1P A;  4YRT A;  3QSU A;  2VXE A;  4M77 B;  4BWA A;  1Y96 A;  1NNH A;  4PJO A;  2J3M A;  3JCM c;  4K88 A;  1E1O A;  1USY C;  2CJA A;  3VQV A;  1BIB A;  4F7U A;  4J6X A;  2ZCE A;  3RKY A;  5GAO m;  3UGT A;  4A53 A;  2DQ3 A;  4YDQ A;  5GMK h;  3JCM e;  2Y90 A;  3P8Y A;  2RHQ A;  4ZTZ B;  3VQY A;  3SWN A;  5DY9 A;  5GAN j;  4QVD A;  3TEH B;  5E3I A;  4HVC A;  2ARS A;  4C8Q G;  2ZR3 A;  3JB9 J;  2ZZG A;  4M7D C;  2ZZF A;  5I21 A;  2DTI A;  2DXU A;  2E3C A;  4KR2 A;  1HC7 A;  1ADY A;  2RHS B;  3QTC A;  2XTI A;  4HWT A;  4RCC A;  4H2W A;  4P72 A;  2YLC A;  5GAM e;  4ZIB A;  2E5A A;  4WF2 A;  4YRF A;  5HGQ A;  1EVL A;  1WQW A;  2ZNI A;  3BW1 A;  4C8Q E;  3L4G B;  5LJ3 j;  4G84 A;  3L2Z A;  1B76 A;  2EJG A;  3E9H A;  4M77 C;  3A7U A;  1JJC A;  4M75 A;  3HXX A;  3QO8 A;  2EAY A;  1Y96 B;  1B7Y A;  2QHT A;  1NJ5 A;  5GAN h;  2ZT7 A;  3DSQ A;  5LJ5 g;  1YCY A;  4UP7 A;  4M7A G;  3QUI A;  4F7U B;  5GMK i;  1I5L A;  4NL3 A;  2E64 A;  3PCO A;  2QTX A;  4TQF A;  2C7I A;  4BW9 A;  5GAN d;  4M77 E;  5GAN 5;  1WU7 A;  1D3B A;  4JLI A;  1B70 B;  2PME A;  2AMC A;  4CH4 A;  5GAN 2;  1LOJ A;  2Q7H A;  3FJP A;  2CIM A;  1PYS B;  1VQZ A;  5LJ3 h;  3V7R A;  3QO5 A;  4CH5 A;  1LYL A;  4N0A C;  4YRJ A;  1GGM A;  4P74 C;  3HY0 A;  2I2L A;  3BDU A;  1NJ8 A;  3IKM B;  4M7A F;  2VXF A;  2IY5 B;  5GAM j;  3EFS A;  1G5I A;  5LJ5 e;  3INZ A;  4H2T A;  2K57 A;  4CH3 A;  5LJ3 d;  4XTY A;  2E65 A;  4YRE A;  4NL2 A;  3VU3 C;  2ZNJ A;  4C92 G;  4CS2 A;  3IKL A;  1NYQ A;  4M78 C;  1U1T A;  2XGT A;  4YRQ A;  3RKX A;  2ODR C;  2RB6 A;  2EJ9 A;  1Z7N A;  4M75 B;  4PJO C;  4KR3 A;  3JCM h;  3M4Q A;  4M7D B;  3TUP A;  2DXT A;  3HFZ A;  1RIQ A;  4YRO A;  5GMK l;  3RER A;  2ZTG A;  2AKW A;  3MF2 A;  1WYD A;  3JCM d;  3A7A A;  3SWN C;  3P8V A;  1H4S A;  4XEM A;  2Q7E A;  4C92 F;  2VC8 A;  3HSB A;  4LNS A;  5GAM h;  1D3B B;  1HTT A;  4YYE A;  4EMK A;  2AMC B;  1YFS A;  4HT9 A;  4TQD A;  2EL9 A;  1EQR A;  4F7U E;  4CS4 A;  2JN0 A;  1W66 A;  4P75 A;  5C53 B;  4Q6G A;  1HK9 A;  2ART A;  2DQ0 A;  5GAM d;  3A5Z A;  2ARU A;  1C0A A;  2P0L A;  3HTZ A;  5LJ5 j;  4H2U A;  3A5Y A;  3LSS A;  4TVA B;  3QO3 A;  4AH6 A;  1KQ2 A;  4XTZ A;  5GAO p;  1KMM A;  4PG3 A;  4C8Q D;  4XQ3 A;  5GAO q;  3QNE A;  1J5W A;  4H2X A;  3HXU A;  4G85 A;  4M75 C;  2E1H A;  1N9S A;  1ASZ A;  4M7D G;  2E10 A;  5GAN 3;  3REX A;  3FB9 A;  3G1Z A;  4YCU A;  4K86 A;  4YRS A;  1X2G A;  1X01 A;  1KQ1 A;  1ATI A;  1EOV A;  3HFZ B;  4H02 A;  1I81 A;  1NYR A;  3NEN A;  4YRM A;  5GAN 8;  2EJF A;  2AKW B;  2ZIM A;  1M8V A;  2QHU A;  4M75 E;  3A74 A;  1FYF A;  4YPF A;  4RDX A;  12AS A;  4M7D E;  5KNN A;  2DTO A;  4EMK B;  5LJ5 h;  2PMF A;  4M77 G;  1SER A;  4C8Q F;  3MEY A;  4M78 B;  1NJ1 A;  1LJO A;  4YP0 A;  1IL2 A;  4PJO B;  4M7A D;  4UP8 A;  2C8M A;  4J5Y A;  5LJ5 d;  2P5I A;  4EMH A;  4YRG A;  3REU A;  3PZC A;  4WJ4 A;  3JCM Q;  5GAN f;  1X56 A;  2RHQ B;  3SWN B;  4CS3 A;  1H4V B;  1BBU A;  4E51 A;  3HRK A;  4YRK A;  4M77 F;  2QHV A;  4OP0 A;  4C8Q A;  1YB3 A;  2ZIO A;  3QO7 A;  5GAO l;  2ZT5 A;  3OD1 A;  3L1A A;  4NOY A;  4WI1 A;  2ZIN A;  3SB2 A;  4YRR A;  1E1T A;  2ALY A;  1SES A;  4TWA A;  3JCM X;  3HFV A;  2ZT6 A;  4C92 D;  1E24 A;  3GIB A;  5LJ3 f;  4A54 A;  4O2D A;  4DQ2 A;  5C51 B;  2ODR D;  1NJ6 A;  3HXW A;  4M78 G;  4EMK C;  4P3N A;  1H4T A;  4NCX A;  4XU0 A;  4DPG A;  3JCM J;  4P71 A;  3ERR A;  4PJO G;  4P75 C;  2DEQ A;  2I4M A;  1JJC B;  4RMF A;  3HY1 A;  1G5H A;  1B7Y B;  2J3L A;  1JBM A;  1WPY A;  4TTV A;  4F7U G;  3JCM V;  3HRI A;  2DZC A;  3HXY A;  4M7A A;  4TVY A;  3PCO B;  5GAN 4;  4UP9 A;  2CGH A;  4M78 E;  3JCM f;  4HWO A;  4YCV A;  4TVW A;  1E22 A;  4PJO E;  1YFT A;  1SET A;  5GAO r;  3V7C A;  3M4P A;  2Q5I A;  3E9I A;  2CJ9 A;  5ELN A;  3A32 A;  2ZXF A;  1N9R A;  4MMK A;  3JB9 G;  3RAC A;  4P72 C;  4XTU A;  4F7U F;  5GAM f;  3AHU A;  3RF1 A;  2DJZ A;  1Z7M A;  2ALY B;  4XTX A;  2YHT A;  4J6W A;  4X9D A;  1LNX A;  4X9C A;  4EX5 A;  1YFR A;  3KFU A;  5C52 B;  4XU2 A;  4Q15 A;  4HWP A;  2RD1 A;  3M4G A;  3L4G A;  4UPA A;  1WLE A;  1MGQ A;  2HNI A;  4M75 D;  3PGG A;  4J6Y A;  3UFG A;  4C92 A;  1BIA A;  1BBW A;  1KMN A;  2DU5 A;  3V8J A;  4M75 G;  5ELO A;  4M7D D;  2G4C A;  5GAM g;  3CMQ A;  4H2S A;  4H2V A;  3JB9 F;  3NEM A;  3VQX A;  2DVE A;  4YRI A;  3A7R A;  3VQW A;  4M7A B;  3UGQ A;  4P73 A;  4HWR A;  4EO4 A;  4X5O A;  3NEL A;  1U1S A;  3A31 A;  3LSQ A;  2I4N A;  3W3S A;  1B70 A;  3LC0 A;  4M77 D;  4XTV A;  2FYK A;  4YRC A;  1EIY A;  4HA8 A;  4C8Q C;  4M75 F;  3I7F A;  1PYS A;  3ICA A;  4M7D F;  3HFO A;  4QVC A;  3BY7 A;  4L87 A;  4H2Y A;  2IY5 A;  1USY A;  5LJ5 f;  5K1X A;  2I4L A;  2DZ9 A;  2E41 A;  3HFN A;  4XU1 A;  2Q5H A;  4P3P A;  4YCW A;  3JCM W;  5GMK m;  4C92 B;  4J15 A;  3BFM A;  4K87 A;  4P71 C;  4PHC A;  1EVK A;  4HT8 A;  1B34 A;  1WNL A;  5F5W A;  4H2X B;  4YRL A;  4JRK A;  2QHS A;  2DDZ A;  1H64 1;  2RA2 A;  5GMK e;  4M7D A;  2ZT8 A;  4YRP A; 
#chains in the Genus database with same CATH topology
 4RQE A;  1PRL C;  4XEO A;  2O9S A;  4M7A C;  5CVI A;  3OYD A;  1YIT T;  5KYU B;  2E4H A;  2X4X A;  3MF1 A;  1ZBX A;  1BK2 A;  2Q7G A;  4M78 D;  3UA6 A;  1W2B A;  1Q82 R;  4FYW B;  2VUB A;  4OLF A;  2QI2 A;  1N9W A;  1Q7Y R;  2JS0 A;  3GNG A;  1EIY B;  2ZR2 A;  1YI2 A;  2KT1 A;  2LC4 A;  3BJU A;  3VS3 A;  3MP8 A;  3TSW A;  4J7I A;  3I9Q A;  1WI7 A;  1K0S A;  1SF9 A;  3FDR A;  2KY9 A;  5FU7 C;  1QE0 A;  2K79 A;  2LNH B;  2MAM A;  3ER0 A;  4JJD A;  4J9F A;  2EWN A;  3RES A;  1B8A A;  1W2B P;  4OML A;  3I55 T;  2CP3 A;  4RTU A;  4JUV A;  2EPD A;  2D6F A;  4PNO A;  2VKN A;  2CP5 A;  2DD5 A;  3LLR A;  4M78 F;  2CZ6 B;  2RHI A;  1A0N B;  3E19 A;  1B34 B;  1QP3 A;  2NLU A;  1B07 A;  1OEB A;  2QK0 A;  4BI8 B;  1JO8 A;  5IHI A;  1C1A A;  5CAI A;  3IAL A;  1N5Z A;  1SRY A;  3I5S A;  3MP6 A;  3M0R A;  5GAN 6;  1UGP B;  3H9N A;  2QAS A;  4IUP A;  3EFR A;  2OTJ T;  3LH0 A;  1JU5 C;  2JTF A;  4C0Z A;  4JRI A;  3V8K A;  2EYY A;  5KYY B;  2GFA A;  1X2H A;  3NET A;  2CSQ A;  5HK0 A;  4PLL A;  1VA7 A;  2ZGW A;  3QHS A;  4Y92 A;  1NJI U;  1K1Z A;  4YRN A;  1TWB A;  1RAB B;  3UH0 A;  5K1P A;  3HRT A;  2M02 A;  3QSU A;  2C0O A;  3VS7 A;  2A3L A;  1NNH A;  4PJO A;  1OZ2 A;  2J3M A;  1SG5 A;  1Y57 A;  3JCM c;  2RF0 A;  5I22 A;  4K88 A;  1BKB A;  1XJW B;  3MP1 A;  3E2U A;  1P92 A;  2ZCE A;  3DLM A;  2RK2 A;  4YDQ A;  2DA9 A;  1KC8 C;  2F1L A;  2DQ3 A;  2KXD A;  1YFN A;  2V1Q A;  2QXF A;  5EC7 A;  3TRE A;  1ZHI A;  2GTO A;  2PUK B;  2COY A;  3VS0 A;  5I21 A;  2KNB B;  2E3C A;  2CH4 W;  4BY6 C;  1E7O A;  1KC8 R;  4RCC A;  3P8D A;  1YIT Q;  3MEV A;  3H8Z A;  5GAM e;  3MQZ A;  2E5A A;  3L2Q A;  4YRF A;  2QEX T;  4Z8A A;  1EVL A;  2BZ8 A;  3QDF A;  3LWH A;  1VQK Q;  2J6K A;  1SSH A;  5FU6 B;  3L4G B;  3L2Z A;  1S1N A;  4J9I A;  1BI2 A;  3E9H A;  1M2V B;  1JJC A;  1OZ3 A;  3HXX A;  3QO8 A;  1VQ5 T;  2QHT A;  3DLL A;  5LJ5 g;  1KD1 C;  2DX1 A;  4UP7 A;  1K73 U;  2HSE B;  5GMK i;  4J9H A;  1I5L A;  1RLP C;  1K9A A;  3I55 Q;  4F04 B;  4DA4 A;  4TQF A;  3CXC P;  2C7I A;  4BW9 A;  1AWW A;  2HQE A;  5GAN 5;  1B70 B;  2AMC A;  1BYM A;  1KD1 R;  5GAN 2;  1LOJ A;  1T0H A;  2KE9 A;  3CPF A;  1PYS B;  3EGX B;  1VQZ A;  5LJ3 h;  2OTJ Q;  2SRC A;  2KRM A;  1VQK A;  1O75 A;  1UJY A;  1GGM A;  3MHX A;  1BCM A;  2I2L A;  4EDU A;  4P74 C;  3BDU A;  3IKM B;  2VWF A;  2IY5 B;  3EFS A;  3CMA Q;  2Z0W A;  3HKS A;  3VU3 C;  1X75 C;  4XAX B;  3VUZ A;  2K5I A;  4AFZ C;  4KH1 B;  4OB0 B;  4M78 C;  4E7Z A;  4IUQ A;  4LDW A;  1VQ7 A;  4ELZ C;  4QQG A;  1OX8 A;  3Q1J A;  3OS1 A;  3RMQ A;  2L3P A;  3JCM h;  1WZO A;  1UG1 A;  2P0P A;  4M7D B;  2M16 A;  3J81 E;  5CK9 A;  4FL6 A;  1ZSG A;  4GLK A;  2RHU A;  3MF2 A;  5CKF A;  3EH2 A;  1WYD A;  2FZC B;  2R58 A;  1MMG A;  3SWN C;  3A7A A;  1QP2 A;  2RMO A;  4C92 F;  2OTJ A;  4LNS A;  3N5B B;  2EGE A;  1EZZ B;  2K5F A;  3DB4 A;  4ZGJ B;  3CMA A;  4HCC A;  4ZN3 A;  4DEX A;  5GAM d;  3A5Z A;  2BUD A;  2RPN A;  2ARU A;  5DLO A;  3R6N A;  1G3S A;  1UGV A;  3T9N A;  2A37 A;  5LJ5 j;  3A5Y A;  2BE7 D;  4F17 A;  3LSS A;  1HJD A;  3QO3 A;  2GFU A;  4ME7 A;  1M3B A;  4QW2 A;  3OSV A;  1IXD A;  5GAO q;  2ZZD A;  1ASZ A;  5GAN 3;  3REX A;  1VQP T;  3CCE T;  1YJW Q;  3EG3 A;  2XKO C;  1ATI A;  2J7I A;  3HFZ B;  4YRM A;  1I81 A;  3M4Y A;  1NYR A;  5KYU A;  2X51 A;  3X28 B;  2JJ9 A;  2OI3 A;  2WSC E;  1MV0 B;  2QA4 Q;  2QHU A;  3A74 A;  3MET A;  3PVQ A;  1Y7X A;  5I2M A;  1QCF A;  4M7D E;  4C0G A;  4EMK B;  4C5G A;  1SER A;  5CQY A;  2M1H A;  2GF7 A;  3QKJ A;  4OMQ A;  3OYL A;  1LJO A;  1KSW A;  2LJ1 A;  3OW2 A;  2LP5 A;  2RNA A;  3CEY A;  2GGR A;  2M51 A;  5ECA A;  2P5I A;  4EMH A;  3JRZ A;  1T3S A;  4XK8 E;  1QVG A;  3FEO A;  1UDL A;  1YNZ A;  4WJ4 A;  2QTV A;  1V1C A;  1FMK A;  1YJW A;  1H4V B;  2YRC A;  1SSF A;  1R8O B;  4B9W A;  4M77 F;  4ZGD B;  2L2P A;  2ZIO A;  1X27 A;  3OW2 P;  5GAO l;  2K5L A;  2QA4 A;  5D6Y A;  2ZIN A;  3SB2 A;  5CR2 A;  1E1T A;  2E3I A;  3M54 A;  5KYY A;  3PMI A;  1SES A;  4BDZ A;  3EGU A;  4K11 A;  1LPL A;  4FW2 A;  3JCM X;  1BI0 A;  3GIB A;  4L6V 5;  4LVM A;  1K8A C;  4DQ2 A;  1GBQ A;  1KQS A;  3PFS A;  4A4E A;  4NCX A;  1ZSZ B;  1AWJ A;  4ELY C;  2DEU A;  4PJO G;  2CUB A;  2DEQ A;  2I4M A;  4RMF A;  2DK3 A;  5IHK A;  1K4U S;  1B7Y B;  1RAE B;  3C12 A;  2J3L A;  1JBM A;  2KSS A;  3JCM V;  3OS0 A;  3HRI A;  3NTK A;  2PZ1 A;  1K8A R;  3LW5 E;  1VOM A;  3QYG B;  2FO0 A;  3ULR B;  2LMJ A;  4TVY A;  2QQB A;  2JZ2 A;  3S3M A;  5GAN 4;  2F69 A;  4YCV A;  3OYC A;  3ME9 A;  3PNW C;  2QDY B;  2I0N A;  1WX6 A;  1K9M U;  1YFT A;  1M3C A;  5GAO r;  2E6Z A;  1VQP Q;  3CCE Q;  1KQS S;  3SDZ A;  3JB9 G;  2L5Q A;  2LQK A;  4P72 C;  5GAM f;  1Z7M A;  4Q5W A;  2ALY B;  2KGT A;  4J6W A;  5IN1 A;  4AG1 C;  2O31 A;  3EFO B;  4X9D A;  5I2S A;  1LNX A;  2COW A;  1YFR A;  2P0K A;  2RD1 A;  3L4G A;  3A8O B;  2CT3 A;  1MGQ A;  2HNI A;  4M75 D;  8ATC B;  1M1K U;  3UFG A;  4AFS C;  4C92 A;  2ESW A;  1CKA A;  1D0Z A;  3V8J A;  2H3J A;  4CRI A;  3KBG A;  2QDL A;  1BU1 A;  3CPW A;  1IGU A;  5D6X A;  2YSQ A;  2L0A A;  1IRX A;  3NEM A;  3CCR T;  4OMF B;  1TU0 B;  3M59 A;  4M7A B;  3M9Q A;  2HD0 A;  4P73 A;  4EO4 A;  4X5O A;  2M0O A;  1OPK A;  3RNJ A;  3A31 A;  4D8D A;  1ZUY A;  1QVF A;  1B70 A;  3LC0 A;  4FSX A;  4XTV A;  1CKB A;  2FYK A;  4M75 F;  1B7T A;  2AIR B;  1PYS A;  3LH5 A;  2RK1 A;  3UPU A;  3VYH B;  3UT1 A;  3QG1 A;  3EG2 A;  3HFO A;  3BY7 A;  2GBQ A;  1GXI E;  4L87 A;  4H2Y A;  2IY5 A;  1USY A;  1K73 C;  5HY6 A;  1PC0 A;  2PUO B;  5FU7 B;  3REA B;  2YRV A;  1VQM T;  3CPW S;  1Q86 R;  1JJ2 S;  2F5K A;  4CI0 C;  3JCM W;  4K87 A;  4P71 C;  1EVK A;  1WNL A;  1YJ9 Q;  4JRK A;  4LE9 A;  2KYB A;  2DDZ A;  1X69 A;  3X20 B;  4M7D A;  4J9C A;  1QLY A;  1QVF S;  4L5G A;  4YRP A;  4IUV A;  3RGL A;  2A08 A;  1U8R A;  3UAT A;  3JB9 I;  3OYF A;  1M5Q 1;  1YI2 T;  1TH7 A;  2DTH A;  1U3O A;  2HKN A;  3WQZ A;  2ZAE A;  1UHC A;  3NGP A;  3P8T A;  3VBB A;  4A4G A;  4QKU A;  3A98 A;  4PJO D;  2YUP A;  4FW1 A;  4M77 A;  4JRP A;  4M7A E;  2ZZE A;  2CJB A;  1M1F A;  2DIG A;  1SHG A;  3ASK A;  3JCM b;  1X55 A;  1I4K 1;  4XU3 A;  2LX7 A;  2K2M A;  5LJ3 g;  4HWS A;  4EMG A;  1YJ9 A;  2RM4 A;  3HXZ A;  5IHN A;  3G71 T;  2CUD A;  1WHM A;  2LVM A;  4KUD K;  4X34 A;  2AKL A;  1KOG A;  3REB B;  4C8Q B;  4PJO F;  1U5S A;  3JB9 D;  2V26 A;  3S6W A;  1VYU A;  4BY6 B;  4N0A A;  3HTR A;  1ZX6 A;  1IHW A;  1YN8 A;  3JCM g;  2QG9 B;  3V7S A;  2RI2 A;  2I4O A;  2F2X A;  1OX9 A;  4A4K A;  3RUX A;  2WAC A;  1NBE B;  1EFW A;  2O9V A;  3A8L B;  3H0F A;  3RIR A;  1BB9 A;  1M90 R;  1PSF A;  4C5H A;  2VXE A;  2KT8 A;  1Y96 A;  1VQL Q;  2DIL A;  1QCO A;  1IHV A;  3OYK A;  2JUF A;  2L8D A;  2ZPF B;  2XU8 A;  1WXB A;  1BIB A;  3QYH B;  1GBR A;  3X24 B;  3QJY A;  2COZ A;  5GAO m;  1GFC A;  2E6N A;  3NTI A;  3UGT A;  5GMK h;  5KYW B;  1B3Q A;  1Q81 U;  1UGR B;  4FYX B;  3TEH B;  4II1 A;  5E3I A;  4HVC A;  2LQ8 A;  3CBO A;  4BUG A;  1RAA B;  3CCQ T;  2ZZF A;  2PVO B;  4C5E A;  2RHS B;  2YUN A;  3PIO A;  4ZIB A;  2WSF E;  1WQW A;  2ZNI A;  2ROL A;  1PRM C;  1VQL A;  4C8Q E;  5LJ3 j;  1ZSZ A;  1YJN Q;  1TS9 A;  1G2B A;  4M75 A;  1RAG B;  1B7Y A;  2HAX A;  5GAN h;  1R0B G;  1YCY A;  3JV3 A;  1Q95 G;  4KGX B;  3EGD A;  2EYZ A;  5HKC A;  4F7U B;  1N8R U;  4CC3 A;  5C6S A;  2ABL A;  2LRQ A;  3G71 Q;  2VYT A;  4HCK A;  1VQK T;  2M9U A;  1D1B A;  2LNV A;  1D3B A;  1FYN A;  2HDA A;  1YWO A;  4JLI A;  4BI4 A;  1K0X A;  1WU7 A;  4CC7 A;  2Q7H A;  4IKF A;  3LWI A;  7AT1 B;  2QQR A;  2J6O A;  3OYN A;  2CZ7 B;  3VJP A;  3V7R A;  4CH5 A;  3VS4 A;  4MDX A;  3RBB B;  2E70 A;  2H3E B;  1NJ8 A;  1YJN A;  3EFO A;  5LJ5 e;  1VQ7 T;  3INZ A;  1M30 A;  1AVZ C;  5A0D A;  2K57 A;  4H2T A;  3TVT A;  4YRE A;  2KRS A;  3GF5 A;  2O01 E;  2ZNJ A;  4C92 G;  4CS2 A;  4HCB A;  1U1T A;  2XGT A;  4YRQ A;  4HCZ A;  1KHC A;  2J6F A;  2ODR C;  1ZUK A;  2ZPG B;  2XDB A;  3FRN A;  1Z7N A;  4PJO C;  2D0Q B;  4KR3 A;  1E6G A;  4IIM A;  3M4Q A;  1ZUU A;  1X2K A;  3G71 A;  1WIE A;  1MMA A;  1PD1 A;  2KVQ G;  3CQT A;  1WHJ A;  5D6W A;  4LDV A;  3CMA T;  3I5R A;  1H8K A;  3P8V A;  4LD6 A;  2DLP A;  1YFS A;  1UEC A;  4HT9 A;  3CCQ Q;  1EQR A;  2MK5 A;  4F7U E;  4R0K A;  3OYI A;  4JS5 A;  1W66 A;  4P75 A;  1YWP A;  2PTK A;  4Q6G A;  1HD3 A;  1M4Z A;  1OPL A;  2DQ0 A;  1M9S A;  4PFP A;  1SEM A;  1NYG A;  1FX7 A;  1U06 A;  2D9T A;  2RJE A;  2DL8 A;  4H2U A;  4RTX A;  2RQR A;  1KFZ A;  4TVA B;  2KYM A;  4AH6 A;  1KQ2 A;  4XTZ A;  4BE2 A;  1KMM A;  4PG3 A;  4XQ3 A;  1RUW A;  3CC4 A;  3PT9 A;  3VKI A;  1UHF A;  2NS6 A;  4M7D G;  3FB9 A;  2RI5 A;  4RG2 A;  2DBM A;  4IUU A;  5GAN 8;  2EJF A;  3O8V A;  2AKW B;  1RI9 A;  3CCQ A;  1M8V A;  4GBQ A;  2X9H A;  1UE9 A;  1GCQ A;  3LYI A;  2P4T A;  3JAM E;  2JOY A;  2MIO A;  4M77 G;  3I56 T;  2FZK B;  1WJS A;  3C0C A;  1UGS B;  3D7S B;  2DJQ A;  5M9O A;  1IL2 A;  2C8M A;  1YJW T;  1VQ7 Q;  4J5Y A;  5LJ5 d;  1NE8 A;  2LT4 A;  3A8G B;  2LDM A;  4YRG A;  3URG A;  2YT6 A;  3G6E Q;  3JCM Q;  4LXC A;  2JM8 A;  3HP9 A;  2RHQ B;  2QA4 T;  1BBU A;  2ENM A;  4E51 A;  1G3W A;  3HRK A;  3J80 E;  1QCN A;  4YRK A;  4ZGE B;  5KYX A;  3CCM A;  2KR3 A;  4C8Q A;  1RL2 A;  1YB3 A;  3VRZ A;  4C0D C;  3QO7 A;  4BI3 A;  2DXB A;  2JMC A;  1N27 A;  4IUT A;  2YWW A;  2NUT B;  1IRE B;  3HRU A;  2ZT6 A;  4C92 D;  3OBY A;  1E24 A;  2JW4 A;  4A54 A;  2DE0 X;  2DL4 A;  1WHK A;  1NJ6 A;  1H4T A;  5FRO A;  4DPG A;  5A0L A;  4O5V A;  3ERR A;  4E2F B;  2CDT A;  2EIF A;  4DEY A;  3MEA A;  3G6E A;  3CCU T;  4TTV A;  1WXT A;  3JSC A;  2KRN A;  2YUQ A;  1D1A A;  1PWT A;  5KYW A;  3PCO B;  2X3W D;  4UP9 A;  3ZEH A;  4OB2 B;  2ROT A;  1VQ8 Q;  1E22 A;  1SET A;  3M4P A;  5ELN A;  5C0M A;  3A32 A;  1N9R A;  4MMK A;  3OY9 A;  1M2O A;  5KE3 A;  4E7L A;  5FWC A;  4XTX A;  2YHT A;  2HMA A;  2ECZ A;  3G4S T;  2RN8 A;  4X9C A;  1WYX A;  1AEY A;  5C52 B;  1PHT A;  2QAZ A;  3M4G A;  4OB1 B;  4AFQ C;  2RJD A;  1PM3 A;  3PGG A;  2K9G A;  3OMG A;  3X26 B;  3OYE A;  3I56 Q;  4M75 G;  4M7D D;  3QBY A;  2DFU A;  2HZY A;  5GAM g;  3C95 A;  4H2V A;  3MO8 A;  3G1J A;  3HPW A;  4PJL A;  1KJW A;  2CP2 A;  1VQ8 A;  3X25 B;  2KK4 A;  3VQW A;  2DMO A;  2ZPH B;  2VVK A;  3L2R A;  2OJ2 A;  3UGQ A;  4PL6 A;  2E3H A;  4RMO A;  1D0X A;  4LDX A;  4HWR A;  2NWM A;  3NEL A;  1I07 A;  1DJ7 B;  2K4Y A;  4A63 B;  3W3S A;  5L8R E;  4PLI A;  4M77 D;  3AT1 B;  1EIY A;  3I7F A;  3QII A;  4M7D F;  4FU6 A;  4C0F A;  2J05 A;  1Y0M A;  2EQU A;  4LNP A;  3CCV Q;  5LJ5 f;  3I56 A;  1JB0 E;  2AK5 A;  1WFW A;  3EG9 B;  2Q5H A;  1WA7 A;  3UWN A;  4P3P A;  1MMD A;  3A1P A;  1V76 A;  1M27 C;  1PKT A;  4VUB A;  3OYJ A;  2CZ1 B;  3CME Q;  4PHC A;  5F5W A;  1B34 A;  1OU8 A;  2XI9 A;  2QHS A;  2EGA A;  4J9B A;  2RA2 A;  3CCU Q;  4JS4 A;  1XNI A;  3L42 A;  1I8F A;  2VGN A;  4RTZ A;  4MZP A;  5I11 A;  1QVG P;  5GAN g;  4LVJ A;  1AZE A;  2A0F B;  2ZCF B;  1VQ6 A;  2CRE A;  2YXY A;  1D1C A;  1QW1 A;  2MWP A;  4R56 A;  1HSQ A;  2M0Y A;  1NJ2 A;  2O4X B;  2K6D A;  2X4J A;  4C5I A;  3GP8 A;  2DKG A;  4V2S A;  2LCS A;  2D8J A;  3C94 A;  1ACM B;  3CCV A;  1QF6 A;  1Q82 U;  1YJ9 T;  4ZTU B;  1SRL A;  2IG0 A;  1Q7Y U;  2FB7 A;  3S3N A;  2JT4 A;  3R07 A;  1NM7 A;  2EYX A;  4O6J A;  3G4S Q;  3CME A;  4KT0 E;  1ZLM A;  4JLG A;  5FU6 C;  3NFC A;  4TVA A;  1KQS P;  2KXC A;  3ZL7 C;  4C92 C;  3CCU A;  3KFV A;  4RTW A;  1NJI C;  4WJ3 M;  2XHC A;  5AYF A;  1C0M A;  2DU7 A;  2JTM A;  4XTW A;  1WQ7 A;  1AWX A;  1TUC A;  1NYF A;  2AT1 B;  2KDS A;  2XIC A;  3G7Z A;  4MZM A;  1H4Q A;  3TEG A;  1IZ6 A;  2A36 A;  4GY5 A;  5GMK j;  2K3B A;  4QQ6 A;  2XDP A;  3OQ5 A;  4D8K A;  1VQO Q;  1D09 B;  1WJR A;  4P73 C;  2LJ3 A;  2K3X A;  1NJI R;  1HXD A;  2QGG A;  4P3O A;  1NLP C;  2DD4 A;  3PIP A;  1L0W A;  3PVL A;  1OQK A;  4OB3 B;  5LJ3 e;  2QQS A;  2DPP B;  2KBT A;  3WVD B;  4JZ3 A;  3CCS Q;  4YRT A;  1M2V A;  3M53 A;  3G4S A;  4N4G A;  2CS7 A;  1E1O A;  1JJ2 A;  1USY C;  2YDL A;  3VQV A;  4E7H A;  1JXM A;  5D7U A;  2V8J A;  1AOJ A;  1EFN A;  2ZPB B;  4A53 A;  5FRM A;  3JCM e;  3QXE B;  2RHQ A;  4ZTZ B;  3VQY A;  2FPE A;  4DOV A;  5GAN j;  4QVD A;  1VQ4 Q;  2HEQ A;  2G3R A;  3U23 A;  2ARS A;  4C8Q G;  3OYH A;  1VQO A;  1UTI A;  3M0T A;  1AT1 B;  5CIU A;  3JB9 J;  4M7D C;  2B8A A;  3CPW P;  3EGX A;  3TQ7 P;  2DXU A;  4KR2 A;  6AT1 B;  1HC7 A;  3E9F A;  1VQL T;  3J7A F;  4X1V A;  2XTI A;  3QTC A;  2D0N A;  1OOT A;  4H2W A;  4P72 A;  2YLC A;  2DF6 A;  4WF2 A;  4OGE A;  5HGQ A;  3CCS A;  3BW1 A;  1KC8 U;  2JNG A;  1UB4 A;  2L3Q A;  4HXJ A;  1GL5 A;  3FJ5 A;  1QVF P;  4G84 A;  1B76 A;  3EHQ A;  2HQX A;  3NHN A;  2MWO A;  3MKD A;  1BBZ A;  4M77 C;  2CZ0 B;  5KH6 A;  1K73 R;  2AKK A;  1FWZ A;  1M3A A;  1JQQ A;  3CBP A;  2ZT7 A;  1YBY A;  4HVW A;  4EPC A;  2AHJ B;  3QUI A;  4FT4 A;  1VQ4 A;  2A7Y A;  3PCO A;  1OYX A;  2J06 A;  2QTX A;  3FLG A;  4WCI A;  2CH4 A;  2DET A;  1HYO A;  4LVK A;  3UF4 A;  1NPR A;  4B9X A;  1YJN T;  2B86 A;  1RI0 A;  1O9S A;  4RTT A;  1RLQ C;  1XTD A;  3QO5 A;  2PQW A;  5KCO A;  4N0A C;  1KD1 U;  4YRJ A;  3HY0 A;  4DBR A;  4M7A F;  2JS2 A;  3CCJ T;  3CCL Q;  1G5I A;  2BIV A;  3FC3 A;  1MMN A;  2LCC A;  4CH3 A;  5LJ3 d;  4XTY A;  3OS5 A;  3LGL A;  4HVV A;  2X4W A;  1NYQ A;  1WJQ A;  2OTL Q;  4MDW A;  4LUE A;  4ANJ A;  2EJ9 A;  2X4Y A;  1GFD A;  1Y07 A;  2LX9 A;  4J83 A;  3TUP A;  1PSE A;  4LD9 K;  2DXT A;  3HFZ A;  4YRO A;  5KYN A;  5GMK l;  2ZTG A;  2XK0 A;  1YIJ A;  4PKC C;  3JCM d;  1TSF A;  3OYA A;  4XEM A;  2VC8 A;  1Z9Q A;  3HSB A;  4J9G A;  2A8E A;  5GAM h;  3M56 A;  1SKU B;  1HTT A;  4EMK A;  2AMC B;  1QQJ A;  3CD6 A;  2NYS A;  3CCL A;  2EL9 A;  4TQD A;  4DBH A;  1YP5 A;  4CS4 A;  2JN0 A;  5IH2 A;  2DAQ A;  1HK9 A;  4WTO B;  1MV3 A;  3ZFJ A;  2OTL A;  1NEG A;  3CC4 T;  2P0L A;  2IPO B;  4UC4 A;  3MPU B;  2GQI A;  3THK A;  1SRM A;  2ATC B;  1ZSZ C;  4KUI A;  5GAO p;  4C8Q D;  2QGF B;  3QNE A;  1J5W A;  4G85 A;  2XDD A;  2QQ9 A;  1PCX A;  4M75 C;  2E1H A;  3I35 A;  2OX7 A;  3KUF A;  3G1Z A;  1G3T A;  2RJF A;  4YCU A;  4K86 A;  4TVR A;  4DBF A;  4YRS A;  1GCP A;  9ATC B;  4M4Z A;  3OBW A;  1EOV A;  2FPF A;  2R57 A;  4H02 A;  4OMM A;  3H0I A;  4PJM A;  2F2W A;  3MEU A;  2O88 A;  2DL3 A;  5A2Q E;  3GBQ A;  2O4X A;  1FYF A;  2AZS A;  12AS A;  4LVL A;  1VIF A;  2PMF A;  1H3H A;  3EH1 A;  3M0P A;  4C8Q F;  3MEY A;  4M78 B;  3M58 A;  1T3L A;  3OYG A;  4YP0 A;  1ZA2 B;  4BB7 A;  4PK4 A;  3OYB A;  3A5Z B;  4UP8 A;  3CCJ Q;  2KRO A;  3CC7 A;  3EHR A;  3GPL A;  4BE1 A;  2E12 A;  5CKE A;  3CCM T;  3REU A;  3PZC A;  5DLQ E;  2YRD A;  1W1F A;  2LCL A;  1KG1 A;  5FWB A;  4KRT A;  3SWN B;  4CS3 A;  1ZBJ A;  2HCK A;  4Y28 E;  2EGC A;  1FMV A;  4OP0 A;  1Y71 A;  2ZT5 A;  3OD1 A;  4WI1 A;  3QWY A;  3F70 A;  2XD0 A;  4YRR A;  2ALY A;  2DL5 A;  3QDR B;  2PNI A;  4JDS A;  5LJ3 f;  4O2D A;  2NUZ A;  1S72 Q;  3G6E T;  4AFU C;  4FCY A;  4RG8 A;  4QT7 A;  2X35 A;  2ZPI B;  4XU0 A;  3CCJ A;  1K9M C;  4RKU E;  3UA7 A;  4P75 C;  2GQV A;  2V1R A;  1G3Y A;  2DNU A;  1YHQ Q;  3HXY A;  2MPX C;  2DZC A;  2VB6 A;  3CC4 Q;  5CKB A;  4YTL A;  4M7A A;  3H0H A;  3SHW A;  1K9M R;  3HRS A;  3L2V A;  4M78 E;  3JCM f;  1K8A U;  4LN2 A;  2RO0 A;  1M1K C;  3M0U A;  1OV3 A;  2NUP B;  3MJX A;  2Q5I A;  4KH0 B;  1W2B S;  1BI3 A;  4KGZ B;  4OGC A;  2ZXF A;  4E7K A;  4QQD A;  1FMW A;  2DXC A;  2G6F X;  4XTU A;  4F7U F;  1S72 A;  1UGQ B;  1BI1 A;  2CP0 A;  3AHU A;  2Y4X A;  3OYM A;  3QZ9 B;  1M1K R;  4N4H A;  4EX5 A;  1R0C B;  2VGM A;  3VUB A;  4Q15 A;  1GCQ C;  4HWP A;  2RHY A;  4UPA A;  2L3R A;  2EBP A;  1WLE A;  2KQW A;  2FEI A;  1BIA A;  2C06 A;  1BBW A;  1YHQ A;  3CC2 Q;  1KMN A;  1KK7 A;  1VQ8 T;  1LVK A;  5ELO A;  4J9D A;  5HCK A;  3CMQ A;  4H2S A;  3VQX A;  1OI1 A;  1W6X A;  3TSZ A;  3P8H A;  2RI3 A;  1KIK A;  4JJB A;  5L23 A;  3CCM Q;  1X43 A;  1FXX A;  2GNC A;  2F2V A;  3H41 A;  2RQU A;  2P84 A;  3SEM A;  1VQ9 T;  2LQN A;  1UFF A;  3E9G A;  3CBM A;  1H92 A;  4HA8 A;  4YRC A;  1NEB A;  4C8Q C;  3E1S A;  3ICA A;  4JPB W;  2FHD A;  2MI6 A;  5EG2 A;  5J26 A;  2DIQ A;  3VRY A;  3CC2 A;  2FPD A;  2DZ9 A;  2E41 A;  4BE0 A;  4XU1 A;  4RTY A;  1WHL A;  3CXC A;  5FRN A;  5KE2 A;  3QZ5 B;  2QYZ A;  5GMK m;  4C92 B;  4J15 A;  3BFM A;  3GOX A;  1QMC A;  2K2V A;  1Q86 U;  4HT8 A;  2JXB A;  4HVU A;  4H2X B;  2JVV A;  4QVZ A;  4OMP A;  4EIK A;  5GMK e;  1VQ6 T;  2ZT8 A;  4JJC A;  8AT1 B;  1ADJ A;  3JB9 H;  2FVU A;  5FLX E;  3EG0 A;  3A8M B;  3FIF A;  3CCV T;  2A28 A;  1QKX A;  4OMN A;  4E47 A;  2EKH A;  5GAO n;  2DRM A;  1G51 A;  4PFZ A;  2EQI A;  1ARK A;  3RL6 A;  4CH6 A;  1ASY A;  1YIT A;  4LDY A;  1N6A A;  3CME T;  3R6O A;  1X54 A;  4Y91 A;  3CXC S;  2EFI A;  2MYS A;  2X3X D;  1AHJ B;  2CKK A;  5LL6 S;  1JRI A;  4PJJ A;  2YLB A;  2MOX A;  1OU9 A;  3V8L A;  1UUE A;  3VS5 A;  4KQE A;  4GLM A;  4E7J A;  3HXV A;  2D1X A;  11AS A;  4AT1 B;  1X2Q A;  1UJ0 A;  5IT9 E;  5GAN e;  2HKQ B;  3TEH A;  3PTA A;  2ED0 A;  3IG2 A;  2DVJ A;  4E7S A;  2E5Q A;  2E5K A;  3EAE A;  1YGB A;  4FM4 B;  3GLX A;  3IQL A;  3I55 A;  3JCM P;  3A8H B;  3DKM A;  4RQF A;  3GNF B;  2RHS A;  1ABO A;  2W0Z A;  4FT2 A;  3RKW A;  2RQW A;  1RAI B;  4P74 A;  1M8M A;  4RUG A;  3C4S A;  4A4F A;  4C92 E;  3L2W A;  2XG8 D;  3LGF A;  3NPF A;  2DBK A;  4MML A;  1XQH A;  1VQ9 Q;  1Q81 C;  1AWO A;  4RCB A;  1LCK A;  5GAN 7;  4M78 A;  2BZX A;  2RHZ A;  3OB9 A;  1M90 U;  1R77 A;  4PJN A;  4M77 B;  4BWA A;  2SEM A;  1TUG B;  2RQV A;  1WLP B;  3EG1 A;  2CJA A;  2R5A A;  2QEX Q;  4OVA A;  2ED1 A;  3P8B B;  5CQX A;  4F7U A;  1OUL A;  4J6X A;  1Q81 R;  1I0C A;  1VQO T;  3RKY A;  2GTJ A;  4IUR A;  3P8Y A;  2Y90 A;  4Z88 A;  4IIO A;  3SWN A;  5DY9 A;  1VYT A;  4FYY B;  1RAC B;  1VQN T;  2ZR3 A;  2EQJ A;  1VQ5 Q;  2O2O A;  3BE3 A;  2P0Q A;  4FYV B;  2ZZG A;  3CCS T;  1VQ6 Q;  2DTI A;  2W10 A;  4F14 A;  1WHH A;  3M57 A;  1ADY A;  4HWT A;  4JRQ A;  1X6O A;  2DL7 A;  1VQ9 A;  2MCN A;  4FIB A;  3VS6 A;  3HHT B;  1D0Y A;  1N8R C;  2CP7 A;  3BDL A;  2KI7 A;  2YUO A;  2OAW A;  2GCX A;  4NS5 A;  3OMC A;  2EJG A;  5KCH A;  2JMA A;  2QEX A;  1VQ4 T;  1CSK A;  3A7U A;  1G8X A;  3O5Z A;  1K76 A;  2EAY A;  1QWE A;  2HBW A;  1WHG A;  1Y96 B;  1TUD A;  1N8R R;  4LUD A;  4ATO A;  1NG2 A;  1NJ5 A;  4ESR A;  3DSQ A;  2C0I A;  2HL5 C;  4M7A G;  2PVD B;  3QPH A;  4BDY A;  2EVR A;  4NL3 A;  2E64 A;  1VQ5 A;  1PD0 A;  1H3Z A;  5GAN d;  4M77 E;  5J3B A;  5HK3 A;  2PME A;  4CH4 A;  2CSI A;  2NUP A;  1E6H A;  3FJP A;  2XID A;  3OA6 A;  2CIM A;  3M5A A;  1Z9Z A;  1ZA1 B;  3SFM A;  1MHN A;  1LYL A;  4MZT A;  1TG0 A;  2IIM A;  4ZN1 A;  5CO7 A;  2K7A A;  2VXF A;  5GAM j;  2EYQ A;  4J9E A;  3OW2 S;  2E65 A;  4NL2 A;  1GRI A;  3IKL A;  1VYV A;  3WVE B;  1RAF B;  2C0T A;  4J8O A;  3RKX A;  1QVG S;  2RB6 A;  2DO3 A;  2RQT A;  4M75 B;  2RHX A;  1PKS A;  1YIJ T;  4KBM B;  3RMS A;  1G5V A;  4D6W A;  4F16 A;  1NZ9 A;  2EQM A;  3EGD B;  3H6Z A;  5FW9 A;  3VS2 A;  3WXM B;  1RIQ A;  2LQW A;  3RER A;  2AKW A;  3CD6 T;  3CCL T;  4OF1 A;  2CYZ B;  1V29 B;  1H4S A;  2Q7E A;  4JJN K;  2FG0 A;  2DRK A;  4E6R A;  1VQN Q;  1D3B B;  4YYE A;  1I1J A;  2OTL T;  2D8H A;  5C53 B;  2PVG B;  2RJC A;  2ART A;  1SHF A;  1M1G A;  5IAY A;  1TTH B;  2RH2 A;  1C0A A;  2H8H A;  2EW3 A;  5GJW B;  3HTZ A;  3QJ6 A;  2HQH A;  1MUZ A;  2LJ0 A;  4ZTF A;  4LDU A;  2V8I A;  4BD3 A;  4H2X A;  3HXU A;  1ZQ1 A;  4Z02 A;  1N9S A;  2CP6 A;  2BE9 B;  2E10 A;  2JTE A;  1JJ2 P;  4BAC A;  1X2G A;  1X01 A;  3S3O A;  3UDC A;  1KQ1 A;  3NEN A;  1VQN A;  1KHI A;  1VUB A;  2FRY A;  5IXB A;  1QVP A;  2ZIM A;  3RR6 A;  2NUT A;  1VQP A;  3CCE A;  3OS2 A;  1NPP A;  4HKE A;  1YCS B;  2KEA A;  1TOV A;  4M75 E;  1XOV A;  4YPF A;  4RDX A;  3LX7 A;  2R5M A;  4FSS A;  2CT4 A;  5KNN A;  1PG5 B;  2DTO A;  4CC4 B;  5LJ5 h;  1Q86 C;  3CC7 T;  2KMT A;  3TU4 K;  2DYB A;  1NJ1 A;  2XMF A;  3RDV A;  1AD5 A;  2P4R A;  3TCJ A;  4PJO B;  4M7A D;  5CKH A;  3PMT A;  1IGQ A;  4CC2 A;  4ZTJ A;  1J3T A;  4P5N A;  4DOW A;  4A4H A;  3VYG A;  5GAN f;  1X56 A;  2IVW A;  1MND A;  3NMZ C;  3HL8 A;  2QHV A;  1YIJ Q;  3ZBD A;  4B6M A;  2DYI A;  2V8K A;  4OMO A;  1TXQ A;  2K3Y A;  3L1A A;  4NOY A;  2KAF A;  3OSS C;  3CD6 Q;  4TWA A;  3HFV A;  5IXF A;  5AT1 B;  5C51 B;  2ODR D;  2BKD N;  3HXW A;  4M78 G;  4EMK C;  4P3N A;  2EQK A;  4HT4 A;  3JCM J;  4P71 A;  3L2U A;  1G83 A;  1T0J A;  2HSP A;  2FRW A;  3OYY A;  1JJC B;  3HY1 A;  4AG2 C;  1G5H A;  1W4S A;  5CKD A;  2LTO A;  1WPY A;  4F7U G;  4DBQ A;  3M0Q A;  3TEE A;  2PU9 B;  4LVI A;  2L3S A;  2MF2 A;  2WSE E;  2CGH A;  4E7I A;  3M0S A;  1C6V X;  4HWO A;  2VV5 A;  4AMC A;  4R55 A;  3VV0 A;  4TVW A;  3MCA B;  1UEB A;  2EYW A;  4PJO E;  1S72 T;  2AZV A;  2MMP A;  2FZG B;  2VAS A;  4J7F A;  4ORZ A;  5KYX B;  3V7C A;  1M90 C;  3E9I A;  1W70 A;  2L89 A;  2CJ9 A;  3CCR Q;  1WXU A;  3RAC A;  3SD4 A;  2HBP A;  4JZ4 A;  3RF1 A;  2DJZ A;  5A0G A;  1YHQ T;  1VIE A;  2FL7 A;  3KFU A;  1PNJ A;  3EG9 A;  4XU2 A;  1QKW A;  2ZPE B;  3MEW A;  1WGS A;  4J6Y A;  1JEG A;  3CC7 Q;  2DU5 A;  4L59 A;  2G4C A;  1QWF A;  3M55 A;  2LT1 A;  2DM1 A;  2JM9 A;  2OAU A;  4KGV B;  5J39 A;  3JB9 F;  4C0D B;  1F1B B;  1NLO C;  1JXO A;  2DVE A;  2BTT A;  5CCA A;  4YRI A;  2LZ6 B;  2Y4Y A;  3A7R A;  1ABQ A;  2QQA A;  1VQM Q;  4PFO A;  4RTV A;  1U1S A;  4KUL A;  3LSQ A;  2HL3 A;  4Z89 A;  3CCR A;  2I4N A;  1X6G A;  3NTH A;  3QWX X;  3CC2 T;  3KXT A;  2BZY A;  4QVC A;  1EIF A;  5DM7 R;  1WDX A;  2EKO A;  1RAH B;  1BCO A;  2F5T X;  1YI2 Q;  1IO6 A;  5K1X A;  2I4L A;  3DB3 A;  3HFN A;  1EX4 A;  4YCW A;  5GJV B;  1AZG B;  1RAD B;  1IB8 A;  4ZNX A;  4N4I A;  1X6B A;  3VS1 A;  1MNE A;  4YRL A;  1VQM A;  2DER A;  1H64 1;  3PE0 A;  1Q82 C;  1I5O B;  1SPK A;  1Q7Y C; 
#chains in the Genus database with same CATH homology
 4RQE A;  4XEO A;  4M7A C;  5CVI A;  3OYD A;  1YIT T;  2X4X A;  3MF1 A;  1ZBX A;  2Q7G A;  4M78 D;  1W2B A;  2VUB A;  4OLF A;  2QI2 A;  1N9W A;  3GNG A;  1EIY B;  2ZR2 A;  1YI2 A;  2LC4 A;  3BJU A;  3MP8 A;  4J7I A;  3FDR A;  2KY9 A;  5FU7 C;  1QE0 A;  2MAM A;  3ER0 A;  2EWN A;  3RES A;  1B8A A;  3I55 T;  4JUV A;  2D6F A;  4PNO A;  2DD5 A;  3LLR A;  4M78 F;  2CZ6 B;  2RHI A;  3E19 A;  1B34 B;  1QP3 A;  2NLU A;  4BI8 B;  5CAI A;  3IAL A;  1SRY A;  3MP6 A;  5GAN 6;  1UGP B;  4IUP A;  2OTJ T;  3EFR A;  3LH0 A;  4C0Z A;  2JTF A;  4JRI A;  3V8K A;  2GFA A;  1X2H A;  3NET A;  5HK0 A;  4PLL A;  2ZGW A;  3QHS A;  1NJI U;  4YRN A;  3UH0 A;  5K1P A;  3HRT A;  3QSU A;  2A3L A;  1NNH A;  4PJO A;  1OZ2 A;  2J3M A;  3JCM c;  4K88 A;  1BKB A;  3MP1 A;  1P92 A;  2ZCE A;  3DLM A;  2RK2 A;  4YDQ A;  1KC8 C;  2DQ3 A;  2QXF A;  3TRE A;  1ZHI A;  2PUK B;  5I21 A;  2E3C A;  4BY6 C;  4RCC A;  3P8D A;  3MEV A;  3H8Z A;  5GAM e;  3MQZ A;  2E5A A;  3L2Q A;  4YRF A;  2QEX T;  1EVL A;  3LWH A;  5FU6 B;  3L4G B;  3L2Z A;  1BI2 A;  3E9H A;  1JJC A;  1OZ3 A;  3HXX A;  3QO8 A;  1VQ5 T;  2QHT A;  3DLL A;  5LJ5 g;  1KD1 C;  4UP7 A;  1K73 U;  5GMK i;  1I5L A;  4TQF A;  4DA4 A;  2C7I A;  4BW9 A;  2HQE A;  5GAN 5;  1B70 B;  2AMC A;  1BYM A;  5GAN 2;  1LOJ A;  3CPF A;  1PYS B;  1VQZ A;  5LJ3 h;  1VQK A;  1O75 A;  1GGM A;  4P74 C;  3MHX A;  4EDU A;  2I2L A;  3BDU A;  3IKM B;  2IY5 B;  3EFS A;  3HKS A;  3VU3 C;  1X75 C;  4XAX B;  3VUZ A;  2K5I A;  4OB0 B;  4M78 C;  4IUQ A;  4LDW A;  1VQ7 A;  4ELZ C;  4QQG A;  3Q1J A;  3OS1 A;  3RMQ A;  3JCM h;  2P0P A;  4M7D B;  2M16 A;  3J81 E;  5CK9 A;  4FL6 A;  4GLK A;  2RHU A;  3MF2 A;  5CKF A;  1WYD A;  2R58 A;  3A7A A;  3SWN C;  1QP2 A;  4C92 F;  2OTJ A;  4LNS A;  3N5B B;  2K5F A;  3DB4 A;  4ZGJ B;  3CMA A;  4HCC A;  4ZN3 A;  5GAM d;  3A5Z A;  2BUD A;  2ARU A;  5DLO A;  1G3S A;  3T9N A;  5LJ5 j;  3A5Y A;  3LSS A;  3QO3 A;  2GFU A;  4ME7 A;  4QW2 A;  3OSV A;  5GAO q;  2ZZD A;  1ASZ A;  5GAN 3;  3REX A;  1VQP T;  3CCE T;  2XKO C;  1ATI A;  3HFZ B;  4YRM A;  1I81 A;  3M4Y A;  1NYR A;  3X28 B;  2WSC E;  2QHU A;  3A74 A;  3MET A;  1Y7X A;  5I2M A;  4M7D E;  4C0G A;  4EMK B;  4C5G A;  1SER A;  5CQY A;  2M1H A;  2GF7 A;  3QKJ A;  3OYL A;  1LJO A;  3OW2 A;  3CEY A;  2P5I A;  4EMH A;  3JRZ A;  4XK8 E;  1QVG A;  3FEO A;  4WJ4 A;  1YJW A;  1H4V B;  1SSF A;  1R8O B;  4B9W A;  4M77 F;  4ZGD B;  2ZIO A;  5GAO l;  2K5L A;  2QA4 A;  5D6Y A;  2ZIN A;  3SB2 A;  5CR2 A;  1E1T A;  3M54 A;  1SES A;  3PMI A;  4BDZ A;  3JCM X;  1BI0 A;  3GIB A;  4L6V 5;  4LVM A;  1K8A C;  4DQ2 A;  1KQS A;  3PFS A;  4A4E A;  4NCX A;  4ELY C;  4PJO G;  2DEQ A;  2I4M A;  4RMF A;  2DK3 A;  1B7Y B;  2J3L A;  3C12 A;  1JBM A;  2KSS A;  3JCM V;  3OS0 A;  3HRI A;  3NTK A;  3LW5 E;  3QYG B;  4TVY A;  2QQB A;  2JZ2 A;  3S3M A;  5GAN 4;  2F69 A;  4YCV A;  3OYC A;  3ME9 A;  3PNW C;  2QDY B;  1K9M U;  1YFT A;  5GAO r;  2E6Z A;  1KQS S;  3SDZ A;  3JB9 G;  2L5Q A;  2LQK A;  4P72 C;  5GAM f;  1Z7M A;  2ALY B;  4Q5W A;  4J6W A;  5IN1 A;  4X9D A;  5I2S A;  1LNX A;  1YFR A;  2P0K A;  2RD1 A;  3L4G A;  3A8O B;  1MGQ A;  2HNI A;  4M75 D;  1M1K U;  3UFG A;  4C92 A;  3V8J A;  2H3J A;  4CRI A;  3KBG A;  3CPW A;  5D6X A;  3NEM A;  3CCR T;  4OMF B;  3M59 A;  4M7A B;  3M9Q A;  2HD0 A;  4P73 A;  4EO4 A;  4X5O A;  2M0O A;  3A31 A;  1QVF A;  1B70 A;  3LC0 A;  4FSX A;  4XTV A;  2FYK A;  4M75 F;  1PYS A;  2RK1 A;  3UPU A;  3VYH B;  3UT1 A;  3QG1 A;  3HFO A;  1GXI E;  3BY7 A;  4L87 A;  4H2Y A;  2IY5 A;  1USY A;  1K73 C;  5HY6 A;  2PUO B;  5FU7 B;  2YRV A;  1VQM T;  3CPW S;  1JJ2 S;  2F5K A;  4CI0 C;  3JCM W;  4K87 A;  4P71 C;  1EVK A;  1WNL A;  4JRK A;  2DDZ A;  3X20 B;  4M7D A;  1QVF S;  4L5G A;  4YRP A;  4IUV A;  3RGL A;  1U8R A;  3JB9 I;  3OYF A;  1M5Q 1;  1YI2 T;  1TH7 A;  2DTH A;  3WQZ A;  3P8T A;  3VBB A;  4A4G A;  4PJO D;  4M77 A;  4JRP A;  4M7A E;  2ZZE A;  2CJB A;  1M1F A;  2DIG A;  3ASK A;  3JCM b;  1X55 A;  1I4K 1;  4XU3 A;  5LJ3 g;  4HWS A;  4EMG A;  1YJ9 A;  2RM4 A;  3HXZ A;  3G71 T;  2LVM A;  4KUD K;  4X34 A;  1KOG A;  4C8Q B;  4PJO F;  3JB9 D;  3S6W A;  4BY6 B;  4N0A A;  3JCM g;  3V7S A;  2RI2 A;  2I4O A;  4A4K A;  3RUX A;  2WAC A;  1EFW A;  3A8L B;  3RIR A;  1PSF A;  4C5H A;  2VXE A;  1Y96 A;  3OYK A;  2JUF A;  2L8D A;  2ZPF B;  2XU8 A;  1BIB A;  3QYH B;  3X24 B;  3QJY A;  5GAO m;  2E6N A;  3NTI A;  3UGT A;  5GMK h;  1Q81 U;  1UGR B;  3TEH B;  4II1 A;  5E3I A;  4HVC A;  2LQ8 A;  3CBO A;  4BUG A;  3CCQ T;  2ZZF A;  2PVO B;  4C5E A;  2RHS B;  3PIO A;  4ZIB A;  2WSF E;  1WQW A;  2ZNI A;  1VQL A;  4C8Q E;  5LJ3 j;  4M75 A;  1B7Y A;  2HAX A;  5GAN h;  1YCY A;  5HKC A;  4F7U B;  1N8R U;  5C6S A;  2LRQ A;  2VYT A;  1VQK T;  2M9U A;  1WU7 A;  2LNV A;  1D3B A;  4BI4 A;  4JLI A;  2Q7H A;  4IKF A;  3LWI A;  2QQR A;  3OYN A;  2CZ7 B;  3VJP A;  3V7R A;  4CH5 A;  4MDX A;  2E70 A;  1NJ8 A;  1YJN A;  5LJ5 e;  1VQ7 T;  3INZ A;  4H2T A;  5A0D A;  2K57 A;  4YRE A;  3GF5 A;  2O01 E;  2ZNJ A;  4C92 G;  4CS2 A;  4HCB A;  1U1T A;  2XGT A;  4YRQ A;  4HCZ A;  1KHC A;  2ODR C;  2XDB A;  2ZPG B;  3FRN A;  1Z7N A;  4PJO C;  2D0Q B;  4KR3 A;  3M4Q A;  3G71 A;  2KVQ G;  5D6W A;  4LDV A;  3CMA T;  3P8V A;  4LD6 A;  1YFS A;  4HT9 A;  1EQR A;  3OYI A;  4F7U E;  4JS5 A;  1W66 A;  4P75 A;  4Q6G A;  1M4Z A;  2DQ0 A;  1M9S A;  1FX7 A;  2D9T A;  2RJE A;  4H2U A;  4TVA B;  4AH6 A;  1KQ2 A;  4XTZ A;  4BE2 A;  1KMM A;  4PG3 A;  4XQ3 A;  3CC4 A;  3PT9 A;  3VKI A;  2NS6 A;  4M7D G;  3FB9 A;  2RI5 A;  4RG2 A;  4IUU A;  5GAN 8;  2EJF A;  3O8V A;  2AKW B;  3CCQ A;  1M8V A;  3LYI A;  2P4T A;  3JAM E;  2JOY A;  4M77 G;  3I56 T;  1WJS A;  1UGS B;  5M9O A;  1IL2 A;  2C8M A;  1YJW T;  4J5Y A;  5LJ5 d;  1NE8 A;  2LT4 A;  3A8G B;  2LDM A;  4YRG A;  3URG A;  3JCM Q;  3HP9 A;  2RHQ B;  2QA4 T;  1BBU A;  4E51 A;  1G3W A;  3HRK A;  3J80 E;  4YRK A;  4ZGE B;  3CCM A;  4C8Q A;  1RL2 A;  1YB3 A;  4C0D C;  3QO7 A;  4BI3 A;  2DXB A;  1N27 A;  4IUT A;  1IRE B;  3HRU A;  2ZT6 A;  4C92 D;  3OBY A;  1E24 A;  4A54 A;  1NJ6 A;  1H4T A;  5FRO A;  4DPG A;  5A0L A;  4O5V A;  3ERR A;  2EIF A;  3MEA A;  3G6E A;  3CCU T;  4TTV A;  3JSC A;  3PCO B;  4UP9 A;  3ZEH A;  4OB2 B;  1E22 A;  1SET A;  3M4P A;  5ELN A;  5C0M A;  3A32 A;  1N9R A;  4MMK A;  3OY9 A;  5KE3 A;  4E7L A;  4XTX A;  2YHT A;  3G4S T;  4X9C A;  5C52 B;  4OB1 B;  3M4G A;  2RJD A;  3PGG A;  3X26 B;  3OMG A;  3OYE A;  4M75 G;  4M7D D;  3QBY A;  5GAM g;  3C95 A;  4H2V A;  3MO8 A;  3HPW A;  1VQ8 A;  3X25 B;  2KK4 A;  3VQW A;  2ZPH B;  3L2R A;  3UGQ A;  4PL6 A;  4RMO A;  4LDX A;  4HWR A;  3NEL A;  1DJ7 B;  2K4Y A;  3W3S A;  5L8R E;  4PLI A;  4M77 D;  1EIY A;  3I7F A;  4M7D F;  3QII A;  4FU6 A;  4C0F A;  2EQU A;  5LJ5 f;  3I56 A;  1JB0 E;  2Q5H A;  3UWN A;  4P3P A;  4VUB A;  3OYJ A;  2CZ1 B;  4PHC A;  5F5W A;  1B34 A;  2XI9 A;  2QHS A;  2RA2 A;  4JS4 A;  1XNI A;  3L42 A;  1I8F A;  2VGN A;  4MZP A;  5GAN g;  4LVJ A;  2ZCF B;  1VQ6 A;  1QW1 A;  2MWP A;  4R56 A;  1NJ2 A;  2O4X B;  2X4J A;  4C5I A;  3GP8 A;  2DKG A;  4V2S A;  3C94 A;  3CCV A;  1QF6 A;  1Q82 U;  1YJ9 T;  4ZTU B;  2IG0 A;  1Q7Y U;  2FB7 A;  3S3N A;  3R07 A;  4O6J A;  3CME A;  4KT0 E;  4JLG A;  5FU6 C;  3NFC A;  4TVA A;  4C92 C;  3CCU A;  1NJI C;  4WJ3 M;  2XHC A;  5AYF A;  2DU7 A;  2JTM A;  4XTW A;  1WQ7 A;  2KDS A;  2XIC A;  3G7Z A;  4MZM A;  1H4Q A;  3TEG A;  1IZ6 A;  5GMK j;  4GY5 A;  4QQ6 A;  2XDP A;  3OQ5 A;  1WJR A;  4P73 C;  2K3X A;  1HXD A;  4P3O A;  2DD4 A;  3PIP A;  1L0W A;  4OB3 B;  5LJ3 e;  2QQS A;  2DPP B;  3WVD B;  4YRT A;  3M53 A;  3G4S A;  4N4G A;  2CS7 A;  1E1O A;  1JJ2 A;  1USY C;  3VQV A;  4E7H A;  2V8J A;  2ZPB B;  4A53 A;  5FRM A;  3JCM e;  3QXE B;  2RHQ A;  4ZTZ B;  3VQY A;  4DOV A;  5GAN j;  4QVD A;  2G3R A;  2ARS A;  4C8Q G;  3OYH A;  1VQO A;  5CIU A;  3JB9 J;  4M7D C;  2B8A A;  2DXU A;  4KR2 A;  1HC7 A;  3E9F A;  1VQL T;  3J7A F;  2XTI A;  3QTC A;  4H2W A;  4P72 A;  2YLC A;  4WF2 A;  4OGE A;  5HGQ A;  3CCS A;  3BW1 A;  1KC8 U;  2JNG A;  1UB4 A;  4G84 A;  1B76 A;  2HQX A;  2MWO A;  4M77 C;  2CZ0 B;  5KH6 A;  1FWZ A;  2ZT7 A;  3CBP A;  1YBY A;  4EPC A;  2AHJ B;  3QUI A;  4FT4 A;  1VQ4 A;  2A7Y A;  3PCO A;  1OYX A;  2QTX A;  3FLG A;  4LVK A;  4B9X A;  1NPR A;  1YJN T;  1RI0 A;  1O9S A;  1XTD A;  3QO5 A;  2PQW A;  5KCO A;  4N0A C;  1KD1 U;  4YRJ A;  3HY0 A;  4M7A F;  3CCJ T;  1G5I A;  2BIV A;  3FC3 A;  2LCC A;  4CH3 A;  5LJ3 d;  4XTY A;  3OS5 A;  3LGL A;  1NYQ A;  2X4W A;  1WJQ A;  4MDW A;  2EJ9 A;  2X4Y A;  1Y07 A;  2LX9 A;  4J83 A;  3TUP A;  1PSE A;  4LD9 K;  2DXT A;  3HFZ A;  4YRO A;  5GMK l;  2ZTG A;  2XK0 A;  1YIJ A;  4PKC C;  3JCM d;  3OYA A;  4XEM A;  2VC8 A;  3HSB A;  2A8E A;  5GAM h;  3M56 A;  1HTT A;  4EMK A;  2AMC B;  3CD6 A;  3CCL A;  2EL9 A;  4TQD A;  4CS4 A;  2JN0 A;  2DAQ A;  1HK9 A;  3ZFJ A;  2OTL A;  3CC4 T;  2P0L A;  4UC4 A;  4KUI A;  5GAO p;  4C8Q D;  3QNE A;  1J5W A;  4G85 A;  2XDD A;  2QQ9 A;  4M75 C;  2E1H A;  3KUF A;  3G1Z A;  1G3T A;  2RJF A;  4YCU A;  4K86 A;  4TVR A;  4YRS A;  3OBW A;  1EOV A;  2R57 A;  4H02 A;  3MEU A;  5A2Q E;  2O4X A;  1FYF A;  12AS A;  4LVL A;  1VIF A;  2PMF A;  4C8Q F;  3MEY A;  4M78 B;  3M58 A;  3OYG A;  4YP0 A;  4BB7 A;  3OYB A;  3A5Z B;  4UP8 A;  3CC7 A;  3GPL A;  4BE1 A;  2E12 A;  5CKE A;  3CCM T;  3REU A;  3PZC A;  5DLQ E;  2LCL A;  1KG1 A;  3SWN B;  4CS3 A;  4Y28 E;  4OP0 A;  1Y71 A;  2ZT5 A;  3OD1 A;  4WI1 A;  3F70 A;  2XD0 A;  4YRR A;  2ALY A;  3QDR B;  4JDS A;  5LJ3 f;  4O2D A;  3G6E T;  4RG8 A;  2X35 A;  2ZPI B;  4XU0 A;  3CCJ A;  1K9M C;  4RKU E;  4P75 C;  2GQV A;  1G3Y A;  3HXY A;  2DZC A;  5CKB A;  4YTL A;  4M7A A;  3HRS A;  3L2V A;  4M78 E;  3JCM f;  1K8A U;  2RO0 A;  1M1K C;  2Q5I A;  1W2B S;  1BI3 A;  4OGC A;  2ZXF A;  4E7K A;  4QQD A;  2DXC A;  4XTU A;  4F7U F;  1S72 A;  3AHU A;  1UGQ B;  1BI1 A;  2Y4X A;  3OYM A;  3QZ9 B;  4N4H A;  4EX5 A;  2VGM A;  3VUB A;  4Q15 A;  4HWP A;  2RHY A;  4UPA A;  2L3R A;  1WLE A;  2KQW A;  1BIA A;  2C06 A;  1BBW A;  1YHQ A;  1KMN A;  1VQ8 T;  5ELO A;  3CMQ A;  4H2S A;  3VQX A;  1OI1 A;  3P8H A;  2RI3 A;  1FXX A;  1VQ9 T;  3E9G A;  4YRC A;  3CBM A;  4HA8 A;  4C8Q C;  3E1S A;  3ICA A;  2FHD A;  2MI6 A;  5EG2 A;  5J26 A;  2DIQ A;  3CC2 A;  2DZ9 A;  2E41 A;  4BE0 A;  4XU1 A;  3CXC A;  5FRN A;  5KE2 A;  3QZ5 B;  5GMK m;  4C92 B;  4J15 A;  3BFM A;  3GOX A;  2K2V A;  1Q86 U;  4HT8 A;  4H2X B;  2JVV A;  4QVZ A;  5GMK e;  2ZT8 A;  1VQ6 T;  1ADJ A;  3JB9 H;  2FVU A;  5FLX E;  3A8M B;  3FIF A;  3CCV T;  4E47 A;  5GAO n;  1G51 A;  3RL6 A;  4CH6 A;  1ASY A;  1YIT A;  4LDY A;  1N6A A;  3CME T;  3R6O A;  1X54 A;  4Y91 A;  3CXC S;  2EFI A;  1AHJ B;  2CKK A;  5LL6 S;  1JRI A;  2YLB A;  3V8L A;  4KQE A;  3HXV A;  4E7J A;  11AS A;  5IT9 E;  5GAN e;  3TEH A;  3PTA A;  3IG2 A;  2E5Q A;  3EAE A;  1YGB A;  4FM4 B;  3GLX A;  3I55 A;  3JCM P;  3A8H B;  3DKM A;  4RQF A;  3GNF B;  2RHS A;  4FT2 A;  3RKW A;  4P74 A;  3C4S A;  4A4F A;  4C92 E;  3L2W A;  2XG8 D;  3LGF A;  4MML A;  1XQH A;  1Q81 C;  4RCB A;  5GAN 7;  4M78 A;  2RHZ A;  3OB9 A;  1M90 U;  4M77 B;  4BWA A;  2CJA A;  2R5A A;  4OVA A;  3P8B B;  5CQX A;  4F7U A;  4J6X A;  1VQO T;  3RKY A;  4IUR A;  3P8Y A;  2Y90 A;  3SWN A;  5DY9 A;  1VQN T;  2ZR3 A;  2EQJ A;  2P0Q A;  2ZZG A;  3CCS T;  2DTI A;  3M57 A;  1ADY A;  4HWT A;  4JRQ A;  1X6O A;  1VQ9 A;  4FIB A;  3HHT B;  1N8R C;  3BDL A;  2GCX A;  4NS5 A;  3OMC A;  2EJG A;  5KCH A;  2QEX A;  1VQ4 T;  3A7U A;  2EAY A;  1Y96 B;  4ATO A;  1NJ5 A;  3DSQ A;  4M7A G;  2PVD B;  3QPH A;  4BDY A;  4NL3 A;  2E64 A;  1VQ5 A;  1H3Z A;  5GAN d;  4M77 E;  5J3B A;  5HK3 A;  2PME A;  4CH4 A;  3FJP A;  3OA6 A;  2XID A;  2CIM A;  3M5A A;  3SFM A;  1MHN A;  1LYL A;  4MZT A;  4ZN1 A;  5CO7 A;  2VXF A;  5GAM j;  2EYQ A;  3OW2 S;  2E65 A;  4NL2 A;  3IKL A;  3WVE B;  4J8O A;  3RKX A;  1QVG S;  2RB6 A;  2DO3 A;  4M75 B;  2RHX A;  1YIJ T;  4KBM B;  3RMS A;  1G5V A;  4D6W A;  1NZ9 A;  2EQM A;  3H6Z A;  3WXM B;  1RIQ A;  3RER A;  2AKW A;  3CD6 T;  3CCL T;  4OF1 A;  2CYZ B;  1V29 B;  1H4S A;  2Q7E A;  4JJN K;  1D3B B;  4YYE A;  2OTL T;  5C53 B;  2PVG B;  2RJC A;  2ART A;  1M1G A;  5IAY A;  2RH2 A;  1C0A A;  3HTZ A;  3QJ6 A;  4ZTF A;  4LDU A;  2V8I A;  4BD3 A;  4H2X A;  3HXU A;  1ZQ1 A;  4Z02 A;  1N9S A;  2E10 A;  4BAC A;  1X2G A;  1X01 A;  3S3O A;  3UDC A;  1KQ1 A;  3NEN A;  1VQN A;  1KHI A;  1VUB A;  1QVP A;  2ZIM A;  1VQP A;  3CCE A;  3OS2 A;  1NPP A;  4HKE A;  4M75 E;  1XOV A;  4YPF A;  4RDX A;  3LX7 A;  2R5M A;  5KNN A;  2DTO A;  5LJ5 h;  1Q86 C;  3CC7 T;  2KMT A;  3TU4 K;  1NJ1 A;  3TCJ A;  4PJO B;  4M7A D;  5CKH A;  3PMT A;  4ZTJ A;  4P5N A;  4DOW A;  4A4H A;  3VYG A;  5GAN f;  1X56 A;  2IVW A;  3HL8 A;  2QHV A;  3ZBD A;  2V8K A;  2K3Y A;  3L1A A;  4NOY A;  2KAF A;  3OSS C;  4TWA A;  3HFV A;  5C51 B;  2ODR D;  2BKD N;  3HXW A;  4M78 G;  4EMK C;  4P3N A;  2EQK A;  4HT4 A;  3JCM J;  4P71 A;  3L2U A;  3OYY A;  1JJC B;  3HY1 A;  1G5H A;  1W4S A;  5CKD A;  2LTO A;  1WPY A;  4F7U G;  3TEE A;  2PU9 B;  4LVI A;  2MF2 A;  2WSE E;  2CGH A;  4E7I A;  4HWO A;  2VV5 A;  4R55 A;  3VV0 A;  4TVW A;  3MCA B;  1UEB A;  4PJO E;  1S72 T;  2MMP A;  4J7F A;  3V7C A;  1M90 C;  3E9I A;  2L89 A;  2CJ9 A;  3RAC A;  3SD4 A;  2HBP A;  3RF1 A;  2DJZ A;  5A0G A;  1YHQ T;  1VIE A;  2FL7 A;  3KFU A;  4XU2 A;  2ZPE B;  3MEW A;  1WGS A;  4J6Y A;  2DU5 A;  4L59 A;  2G4C A;  3M55 A;  2LT1 A;  2OAU A;  5J39 A;  3JB9 F;  4C0D B;  2DVE A;  4YRI A;  5CCA A;  3A7R A;  2Y4Y A;  2QQA A;  1U1S A;  4KUL A;  3LSQ A;  3CCR A;  2I4N A;  3NTH A;  3CC2 T;  3KXT A;  4QVC A;  1EIF A;  5DM7 R;  2EKO A;  2F5T X;  5K1X A;  2I4L A;  3DB3 A;  3HFN A;  4YCW A;  4N4I A;  4YRL A;  1VQM A;  1H64 1;  1Q82 C;  1Q7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...