4P71C

Apo phers from p. aeuriginosa
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 62
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p71C01
2DEQA 4YP0A 4BWAA 3P8YA 1H4SA 2E5AA 1EVLA 2ZR2A 1WQ7A 3UFGA 3VQYA 3E9HA 4H2VA 2E64A 4XU1A 2AKWA 4P73C 2RHQB 2PMFA 4G85A 4DQ2A 1SETA 2DQ0A 3R07A 3UH0A 3CMQA 2ZT6A 4HVCA 2DZ9A 2ZINA 2I4MA 1EFWA 2CIMA 2E3CA 3L4GA 1B76A 1VQZA 4TVWA 2ALYB 2ZNIA 3MEYA 4K88A 1H4VB 12ASA 1ADYA 1Z7NA 4P74A 4WJ3M 3HXYA 3LSSA 3NEMA 3HXWA 3L1AA 4EX5A 3VQVA 2EWNA 2E10A 2RHQA 1B7YB 5K1PA 2XTIA 3M4PA 1NJ8A 2ZZGA 4WI1A 4HWRA 1B8AA 4TTVA 3ERRA 4H2SA 3HXVA 1NJ1A 1W66A 3HRKA 4HA8A 4YRLA 4RQFA 3QO7A 3OD1A 3QO8A 5ELOA 4OP0A 2I4NA 4L87A 4YRKA 4YRMA 1X55A 3RKXA 1EIYB 4LNSA 3EFRA 4TWAA 4UP9A 4P3OA 2E41A 11ASA 4XEOA 3RF1A 1YFRA 2DZCA 3PZCA 4YRJA 1JJCB 3MF1A 1X2GA 1PYSB 4CS4A 4XTUA 3NETA 3G1ZA 3TEGA 3QO5A 1ASYA 4YRQA 1SESA 1JJCA 3W3SA 3L4GB 3A7RA 4K87A 3PCOB 4XU3A 1C0AA 4P74C 4K86A 2ARTA 1WLEA 2DTHA 2ZZEA 4OLFA 2ZIOA 2ZXFA 1G5HA 3REUA 4CH5A 1J5WA 3QNEA 1Z7MA 2EJFA 4AH6A 3TEHA 2QHTA 2ZR3A 2QHVA 2ARUA 4CH6A 2ODRD 3V7SA 1NYRA 3V7CA 3TUPA 4TQFA 2P5IA 2ZCEA 2EAYA 3IKMB 2E65A 2Q7GA 3A31A 4P75A 2PMEA 3RGLA 1B70B 5C53B 1EOVA 2J3MA 5HGQA 4YYEA 3NELA 4PG3A 1WPYA 2FYKA 1WU7A 4ZIBA 2IY5A 4YRIA 4XTXA 4ZTZB 4YRGA 3HXZA 2C8MA 3V8KA 1B70A 3A7AA 2DXTA 3UGQA 3RL6A 1E24A 3HXXA 2DU7A 4KR3A 4YRCA 4WJ4A 5K1XA 2DVEA 2Q7HA 4YRRA 1BBUA 3P8VA 1GGMA 3A5YA 2G4CA 4H2YA 1WQWA 4PHCA 1SERA 1ADJA 4E51A 1NYQA 3HRIA 2CJBA 3VQXA 3WQZA 2DDZA 2J3LA 3M4QA 1WYDA 1SRYA 1BBWA 3V8JA 3HFZA 4KQEA 4RQEA 1NNHA 4H2WA 1KMMA 3VBBA 3ICAA 3NENA 2C7IA 4CS2A 4RMFA 3TEHB 4P75C 4YRPA 2ALYA 4TVYA 1G51A 3A32A 4YREA 3HFZB 2AMCB 3LSQA 4H2XA 4YRNA 3RIRA 3HY0A 1N9WA 5C52B 1HXDA 3FJPA 4J15A 3QTCA 3EFSA 3PCOA 1KMNA 2ZIMA 2RHSA 1PYSA 3A7UA 1E1TA 3IG2A 3P8TA 4H2XB 3MF2A 4XTZA 5E3IA 4WF2A 5C51B 1X01A 3HTZA 1HTTA 1YFTA 4H02A 4XTWA 4XU2A 1H4QA 1NJ2A 2ZT5A 4P73A 2XGTA 1G5IA 4CS3A 3IKLA 1YB3A 3VQWA 3LC0A 2QHUA 4YCVA 4YROA 3I7FA 3RKWA 2DU5A 1IL2A 1X56A 5F5WA 4YDQA 3BJUA 4X5OA 2DTOA 1BIBA 4P3NA 1X54A 4Q6GA 1EVKA 2ZNJA 4UPAA 4Q15A 3L2ZA 2DTIA 1HC7A 3HXUA 2EL9A 2ARSA 2ODRC 2ZT8A 4P71C 1WNLA 4H2UA 2Q5HA 2EJGA 1USYA 4YRTA 2I4LA 4RDXA 1EIYA 3A5ZA 5ELNA 2DQ3A 4HWOA 4UP8A 3HY1A 4HWSA 4YCWA 2RHSB 2EJ9A 5KNNA 2P0LA 4XEMA 1NJ5A 2Q7EA 3A74A 1KOGA 3IALA 3RACA 4XTVA 2Q5IA 4CH4A 1FYFA 2QHSA 4P71A 3V7RA 4NCXA 4YRSA 4YCUA 2AMCA 1X2HA 2ZT7A 1BIAA 4HWTA 2CJAA 4P3PA 3RUXA 1ATIA 4EO4A 1YGBA 4O2DA 1E22A 4XU0A 4HWPA 3KFUA 2ZGWA 4TQDA 4TVAA 4UP7A 2E1HA 3V8LA 2DKGA 4KR2A 1LYLA 4H2TA 2DJZA 1L0WA 3DSQA 4YRFA 1E1OA 2HNIA 4G84A 4P72A 1EQRA 4XTYA 4DPGA 2CGHA 4P72C 1USYC 2I4OA 3REXA 1QF6A 1ASZA 4TVAB 1NJ6A 4BW9A 1H4TA 2ZTGA 3UGTA 3E9IA 1B7YA 3HFVA 1QE0A 4CH3A 2CJ9A 4YPFA 4ZTUB 1RIQA 1YFSA 2IY5B 2ZZFA 3RKYA 2AKWB 3BFMA 2DXUA
chains in the Genus database with same CATH superfamily
2DEQA 4YP0A 4BWAA 3P8YA 1H4SA 2E5AA 1EVLA 2ZR2A 1WQ7A 3UFGA 3VQYA 3E9HA 4H2VA 2E64A 4XU1A 2AKWA 4P73C 2RHQB 2PMFA 4G85A 4DQ2A 1SETA 2DQ0A 3R07A 3UH0A 3CMQA 2ZT6A 4HVCA 2DZ9A 2ZINA 2I4MA 1EFWA 2CIMA 2E3CA 3L4GA 1B76A 1VQZA 4TVWA 2ALYB 2ZNIA 3MEYA 4K88A 1H4VB 12ASA 1ADYA 1Z7NA 4P74A 4WJ3M 3HXYA 3LSSA 3NEMA 3HXWA 3L1AA 4EX5A 3VQVA 2EWNA 2E10A 2RHQA 1B7YB 5K1PA 2XTIA 3M4PA 1NJ8A 2ZZGA 4WI1A 4HWRA 1B8AA 4TTVA 3ERRA 4H2SA 3HXVA 1NJ1A 1W66A 3HRKA 4HA8A 4YRLA 4RQFA 3QO7A 3OD1A 3QO8A 5ELOA 4OP0A 2I4NA 4L87A 4YRKA 4YRMA 1X55A 4LVJA 3RKXA 1EIYB 4LNSA 3EFRA 4LVMA 4TWAA 4UP9A 4P3OA 2E41A 11ASA 4XEOA 3RF1A 1YFRA 2DZCA 3PZCA 4YRJA 1JJCB 3MF1A 1X2GA 1PYSB 4CS4A 4XTUA 3NETA 3G1ZA 3TEGA 3QO5A 1ASYA 4YRQA 1SESA 1JJCA 3W3SA 3L4GB 3A7RA 4K87A 3PCOB 4LVKA 4XU3A 1C0AA 4P74C 4K86A 2ARTA 1WLEA 2DTHA 2ZZEA 4OLFA 2ZIOA 2ZXFA 1G5HA 3REUA 4CH5A 1J5WA 3QNEA 1Z7MA 2EJFA 4AH6A 3TEHA 2QHTA 2ZR3A 2QHVA 2ARUA 4CH6A 2ODRD 3V7SA 1NYRA 3V7CA 4LVLA 3TUPA 4TQFA 2P5IA 2ZCEA 2EAYA 3IKMB 2E65A 2Q7GA 3A31A 4P75A 2PMEA 3RGLA 1B70B 5C53B 1EOVA 2J3MA 5HGQA 4YYEA 3NELA 4PG3A 1WPYA 2FYKA 1WU7A 4ZIBA 2IY5A 4YRIA 4XTXA 4ZTZB 4YRGA 3HXZA 2C8MA 3V8KA 1B70A 3A7AA 2DXTA 3UGQA 3RL6A 1E24A 3HXXA 2DU7A 4KR3A 4YRCA 4WJ4A 5K1XA 2DVEA 2Q7HA 4YRRA 1BBUA 3P8VA 4HT4A 1GGMA 2A8EA 3A5YA 2G4CA 4H2YA 1WQWA 4PHCA 1SERA 1ADJA 4E51A 1NYQA 3HRIA 2CJBA 3VQXA 3WQZA 2DDZA 2J3LA 3M4QA 1WYDA 1SRYA 1BBWA 3V8JA 3HFZA 4KQEA 4RQEA 1NNHA 4H2WA 1KMMA 3VBBA 3ICAA 3NENA 2C7IA 4CS2A 4RMFA 3TEHB 4P75C 4YRPA 2ALYA 4TVYA 3MQZA 1G51A 3A32A 4YREA 3HFZB 2AMCB 3LSQA 4H2XA 4YRNA 3RIRA 3HY0A 1N9WA 5C52B 1HXDA 3FJPA 4J15A 3QTCA 3EFSA 3PCOA 1KMNA 2ZIMA 2RHSA 1PYSA 3A7UA 1E1TA 3IG2A 3P8TA 4H2XB 3MF2A 4XTZA 5E3IA 4WF2A 5C51B 1X01A 3HTZA 1HTTA 1YFTA 4H02A 4XTWA 4XU2A 1H4QA 1NJ2A 2ZT5A 4P73A 2XGTA 1G5IA 4CS3A 3IKLA 1YB3A 3VQWA 3LC0A 2QHUA 4YCVA 4YROA 3I7FA 3RKWA 2DU5A 1IL2A 1X56A 5F5WA 4YDQA 3BJUA 4X5OA 2DTOA 1BIBA 4P3NA 1X54A 4Q6GA 1EVKA 2ZNJA 4UPAA 4Q15A 3L2ZA 2DTIA 1HC7A 3HXUA 2EL9A 4LVIA 2ARSA 2ODRC 2ZT8A 4P71C 1WNLA 4H2UA 2Q5HA 2EJGA 1USYA 4YRTA 2I4LA 4RDXA 1EIYA 3A5ZA 5ELNA 2DQ3A 4HWOA 4UP8A 3HY1A 4HWSA 4YCWA 2RHSB 2NS6A 2EJ9A 5KNNA 2P0LA 4XEMA 1NJ5A 2Q7EA 3A74A 1KOGA 3IALA 3RACA 4XTVA 2Q5IA 4CH4A 1FYFA 2QHSA 4P71A 3V7RA 4NCXA 4YRSA 4YCUA 2AMCA 1X2HA 2ZT7A 1BIAA 4HWTA 2CJAA 4P3PA 3RUXA 1ATIA 4EO4A 1YGBA 4O2DA 1E22A 4XU0A 4HWPA 3KFUA 2ZGWA 4TQDA 4TVAA 4UP7A 2E1HA 3V8LA 2DKGA 4KR2A 1LYLA 4H2TA 2DJZA 1L0WA 3DSQA 4YRFA 1E1OA 2HNIA 4G84A 4P72A 1EQRA 4XTYA 4DPGA 2CGHA 4P72C 1USYC 2I4OA 3REXA 1QF6A 1ASZA 4TVAB 1NJ6A 4BW9A 1H4TA 2ZTGA 3UGTA 3E9IA 1B7YA 3HFVA 1QE0A 4CH3A 2CJ9A 4YPFA 4ZTUB 1RIQA 1YFSA 2IY5B 2ZZFA 3RKYA 2AKWB 3BFMA 2DXUA
chains in the Genus database with same CATH topology
2DEQA 4YP0A 4BWAA 3P8YA 1H4SA 2E5AA 1EVLA 2ZR2A 1WQ7A 3UFGA 3VQYA 3E9HA 4H2VA 2E64A 4XU1A 2AKWA 4P73C 2RHQB 2PMFA 4G85A 4DQ2A 1SETA 2DQ0A 3R07A 3UH0A 3CMQA 2ZT6A 4HVCA 2DZ9A 2ZINA 2I4MA 1EFWA 2CIMA 2E3CA 3L4GA 1B76A 1VQZA 4TVWA 2ALYB 2ZNIA 3MEYA 4K88A 1H4VB 12ASA 1ADYA 1Z7NA 4P74A 4WJ3M 3HXYA 3LSSA 3NEMA 3HXWA 3L1AA 4EX5A 3VQVA 2EWNA 2E10A 2RHQA 1B7YB 5K1PA 2XTIA 3M4PA 1NJ8A 2ZZGA 4WI1A 4HWRA 1B8AA 4TTVA 3ERRA 4H2SA 3HXVA 1NJ1A 1W66A 3HRKA 4HA8A 4YRLA 4RQFA 3QO7A 3OD1A 3QO8A 5ELOA 4OP0A 2I4NA 4L87A 4YRKA 4YRMA 1X55A 4LVJA 3RKXA 1EIYB 4LNSA 3EFRA 4LVMA 4TWAA 4UP9A 4P3OA 2E41A 11ASA 4XEOA 3RF1A 1YFRA 2DZCA 3PZCA 4YRJA 1JJCB 3MF1A 1X2GA 1PYSB 4CS4A 4XTUA 3NETA 3G1ZA 3TEGA 3QO5A 1ASYA 4YRQA 1SESA 1JJCA 3W3SA 3L4GB 3A7RA 4K87A 3PCOB 4LVKA 4XU3A 1C0AA 4P74C 4K86A 2ARTA 1WLEA 2DTHA 2ZZEA 4OLFA 2ZIOA 2ZXFA 1G5HA 3REUA 4CH5A 1J5WA 3QNEA 1Z7MA 2EJFA 4AH6A 3TEHA 2QHTA 2ZR3A 2QHVA 2ARUA 4CH6A 2ODRD 3V7SA 1NYRA 3V7CA 4LVLA 3TUPA 4TQFA 2P5IA 2ZCEA 2EAYA 3IKMB 2E65A 2Q7GA 3A31A 4P75A 2PMEA 3RGLA 1B70B 5C53B 1EOVA 2J3MA 5HGQA 4YYEA 3NELA 4PG3A 1WPYA 2FYKA 1WU7A 4ZIBA 2IY5A 4YRIA 4XTXA 4ZTZB 4YRGA 3HXZA 2C8MA 3V8KA 1B70A 3A7AA 2DXTA 3UGQA 3RL6A 1E24A 3HXXA 2DU7A 4KR3A 4YRCA 4WJ4A 5K1XA 2DVEA 2Q7HA 4YRRA 1BBUA 3P8VA 4HT4A 1GGMA 2A8EA 3A5YA 2G4CA 4H2YA 1WQWA 4PHCA 1SERA 1ADJA 4E51A 1NYQA 3HRIA 2CJBA 3VQXA 3WQZA 2DDZA 2J3LA 3M4QA 1WYDA 1SRYA 1BBWA 3V8JA 3HFZA 4KQEA 4RQEA 1NNHA 4H2WA 1KMMA 3VBBA 3ICAA 3NENA 2C7IA 4CS2A 4RMFA 3TEHB 4P75C 4YRPA 2ALYA 4TVYA 3MQZA 1G51A 3A32A 4YREA 3HFZB 2AMCB 3LSQA 4H2XA 4YRNA 3RIRA 3HY0A 1N9WA 5C52B 1HXDA 3FJPA 4J15A 3QTCA 3EFSA 3PCOA 1KMNA 2ZIMA 2RHSA 1PYSA 3A7UA 1E1TA 3IG2A 3P8TA 4H2XB 3MF2A 4XTZA 5E3IA 4WF2A 5C51B 1X01A 3HTZA 1HTTA 1YFTA 4H02A 4XTWA 4XU2A 1H4QA 1NJ2A 2ZT5A 4P73A 2XGTA 1G5IA 4CS3A 3IKLA 1YB3A 3VQWA 3LC0A 2QHUA 4YCVA 4YROA 3I7FA 3RKWA 2DU5A 1IL2A 1X56A 5F5WA 4YDQA 3BJUA 4X5OA 2DTOA 1BIBA 4P3NA 1X54A 4Q6GA 1EVKA 2ZNJA 4UPAA 4Q15A 3L2ZA 2DTIA 1HC7A 3HXUA 2EL9A 4LVIA 2ARSA 2ODRC 2ZT8A 4P71C 1WNLA 4H2UA 2Q5HA 2EJGA 1USYA 4YRTA 2I4LA 4RDXA 1EIYA 3A5ZA 5ELNA 2DQ3A 4HWOA 4UP8A 3HY1A 4HWSA 4YCWA 2RHSB 2NS6A 2EJ9A 5KNNA 2P0LA 4XEMA 1NJ5A 2Q7EA 3A74A 1KOGA 3IALA 3RACA 4XTVA 2Q5IA 4CH4A 1FYFA 2QHSA 4P71A 3V7RA 4NCXA 4YRSA 4YCUA 2AMCA 1X2HA 2ZT7A 1BIAA 4HWTA 2CJAA 4P3PA 3RUXA 1ATIA 4EO4A 1YGBA 4O2DA 1E22A 4XU0A 4HWPA 3KFUA 2ZGWA 4TQDA 4TVAA 4UP7A 2E1HA 3V8LA 2DKGA 4KR2A 1LYLA 4H2TA 2DJZA 1L0WA 3DSQA 4YRFA 1E1OA 2HNIA 4G84A 4P72A 1EQRA 4XTYA 4DPGA 2CGHA 4P72C 1USYC 2I4OA 3REXA 1QF6A 1ASZA 4TVAB 1NJ6A 4BW9A 1H4TA 2ZTGA 3UGTA 3E9IA 1B7YA 3HFVA 1QE0A 4CH3A 2CJ9A 4YPFA 4ZTUB 1RIQA 1YFSA 2IY5B 2ZZFA 3RKYA 2AKWB 3BFMA 2DXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEQ A;  4YP0 A;  4BWA A;  3P8Y A;  1H4S A;  2E5A A;  1EVL A;  2ZR2 A;  1WQ7 A;  3UFG A;  3VQY A;  3E9H A;  4H2V A;  2E64 A;  4XU1 A;  2AKW A;  4P73 C;  2RHQ B;  2PMF A;  4G85 A;  4DQ2 A;  1SET A;  2DQ0 A;  3R07 A;  3UH0 A;  3CMQ A;  2ZT6 A;  4HVC A;  2DZ9 A;  2ZIN A;  2I4M A;  1EFW A;  2CIM A;  2E3C A;  3L4G A;  1B76 A;  1VQZ A;  4TVW A;  2ALY B;  2ZNI A;  3MEY A;  4K88 A;  1H4V B;  12AS A;  1ADY A;  1Z7N A;  4P74 A;  4WJ3 M;  3HXY A;  3LSS A;  3NEM A;  3HXW A;  3L1A A;  4EX5 A;  3VQV A;  2EWN A;  2E10 A;  2RHQ A;  1B7Y B;  5K1P A;  2XTI A;  3M4P A;  1NJ8 A;  2ZZG A;  4WI1 A;  4HWR A;  1B8A A;  4TTV A;  3ERR A;  4H2S A;  3HXV A;  1NJ1 A;  1W66 A;  3HRK A;  4HA8 A;  4YRL A;  4RQF A;  3QO7 A;  3OD1 A;  3QO8 A;  5ELO A;  4OP0 A;  2I4N A;  4L87 A;  4YRK A;  4YRM A;  1X55 A;  3RKX A;  1EIY B;  4LNS A;  3EFR A;  4TWA A;  4UP9 A;  4P3O A;  2E41 A;  11AS A;  4XEO A;  3RF1 A;  1YFR A;  2DZC A;  3PZC A;  4YRJ A;  1JJC B;  3MF1 A;  1X2G A;  1PYS B;  4CS4 A;  4XTU A;  3NET A;  3G1Z A;  3TEG A;  3QO5 A;  1ASY A;  4YRQ A;  1SES A;  1JJC A;  3W3S A;  3L4G B;  3A7R A;  4K87 A;  3PCO B;  4XU3 A;  1C0A A;  4P74 C;  4K86 A;  2ART A;  1WLE A;  2DTH A;  2ZZE A;  4OLF A;  2ZIO A;  2ZXF A;  1G5H A;  3REU A;  4CH5 A;  1J5W A;  3QNE A;  1Z7M A;  2EJF A;  4AH6 A;  3TEH A;  2QHT A;  2ZR3 A;  2QHV A;  2ARU A;  4CH6 A;  2ODR D;  3V7S A;  1NYR A;  3V7C A;  3TUP A;  4TQF A;  2P5I A;  2ZCE A;  2EAY A;  3IKM B;  2E65 A;  2Q7G A;  3A31 A;  4P75 A;  2PME A;  3RGL A;  1B70 B;  5C53 B;  1EOV A;  2J3M A;  5HGQ A;  4YYE A;  3NEL A;  4PG3 A;  1WPY A;  2FYK A;  1WU7 A;  4ZIB A;  2IY5 A;  4YRI A;  4XTX A;  4ZTZ B;  4YRG A;  3HXZ A;  2C8M A;  3V8K A;  1B70 A;  3A7A A;  2DXT A;  3UGQ A;  3RL6 A;  1E24 A;  3HXX A;  2DU7 A;  4KR3 A;  4YRC A;  4WJ4 A;  5K1X A;  2DVE A;  2Q7H A;  4YRR A;  1BBU A;  3P8V A;  1GGM A;  3A5Y A;  2G4C A;  4H2Y A;  1WQW A;  4PHC A;  1SER A;  1ADJ A;  4E51 A;  1NYQ A;  3HRI A;  2CJB A;  3VQX A;  3WQZ A;  2DDZ A;  2J3L A;  3M4Q A;  1WYD A;  1SRY A;  1BBW A;  3V8J A;  3HFZ A;  4KQE A;  4RQE A;  1NNH A;  4H2W A;  1KMM A;  3VBB A;  3ICA A;  3NEN A;  2C7I A;  4CS2 A;  4RMF A;  3TEH B;  4P75 C;  4YRP A;  2ALY A;  4TVY A;  1G51 A;  3A32 A;  4YRE A;  3HFZ B;  2AMC B;  3LSQ A;  4H2X A;  4YRN A;  3RIR A;  3HY0 A;  1N9W A;  5C52 B;  1HXD A;  3FJP A;  4J15 A;  3QTC A;  3EFS A;  3PCO A;  1KMN A;  2ZIM A;  2RHS A;  1PYS A;  3A7U A;  1E1T A;  3IG2 A;  3P8T A;  4H2X B;  3MF2 A;  4XTZ A;  5E3I A;  4WF2 A;  5C51 B;  1X01 A;  3HTZ A;  1HTT A;  1YFT A;  4H02 A;  4XTW A;  4XU2 A;  1H4Q A;  1NJ2 A;  2ZT5 A;  4P73 A;  2XGT A;  1G5I A;  4CS3 A;  3IKL A;  1YB3 A;  3VQW A;  3LC0 A;  2QHU A;  4YCV A;  4YRO A;  3I7F A;  3RKW A;  2DU5 A;  1IL2 A;  1X56 A;  5F5W A;  4YDQ A;  3BJU A;  4X5O A;  2DTO A;  1BIB A;  4P3N A;  1X54 A;  4Q6G A;  1EVK A;  2ZNJ A;  4UPA A;  4Q15 A;  3L2Z A;  2DTI A;  1HC7 A;  3HXU A;  2EL9 A;  2ARS A;  2ODR C;  2ZT8 A;  4P71 C;  1WNL A;  4H2U A;  2Q5H A;  2EJG A;  1USY A;  4YRT A;  2I4L A;  4RDX A;  1EIY A;  3A5Z A;  5ELN A;  2DQ3 A;  4HWO A;  4UP8 A;  3HY1 A;  4HWS A;  4YCW A;  2RHS B;  2EJ9 A;  5KNN A;  2P0L A;  4XEM A;  1NJ5 A;  2Q7E A;  3A74 A;  1KOG A;  3IAL A;  3RAC A;  4XTV A;  2Q5I A;  4CH4 A;  1FYF A;  2QHS A;  4P71 A;  3V7R A;  4NCX A;  4YRS A;  4YCU A;  2AMC A;  1X2H A;  2ZT7 A;  1BIA A;  4HWT A;  2CJA A;  4P3P A;  3RUX A;  1ATI A;  4EO4 A;  1YGB A;  4O2D A;  1E22 A;  4XU0 A;  4HWP A;  3KFU A;  2ZGW A;  4TQD A;  4TVA A;  4UP7 A;  2E1H A;  3V8L A;  2DKG A;  4KR2 A;  1LYL A;  4H2T A;  2DJZ A;  1L0W A;  3DSQ A;  4YRF A;  1E1O A;  2HNI A;  4G84 A;  4P72 A;  1EQR A;  4XTY A;  4DPG A;  2CGH A;  4P72 C;  1USY C;  2I4O A;  3REX A;  1QF6 A;  1ASZ A;  4TVA B;  1NJ6 A;  4BW9 A;  1H4T A;  2ZTG A;  3UGT A;  3E9I A;  1B7Y A;  3HFV A;  1QE0 A;  4CH3 A;  2CJ9 A;  4YPF A;  4ZTU B;  1RIQ A;  1YFS A;  2IY5 B;  2ZZF A;  3RKY A;  2AKW B;  3BFM A;  2DXU A; 
#chains in the Genus database with same CATH topology
 2DEQ A;  4YP0 A;  4BWA A;  3P8Y A;  1H4S A;  2E5A A;  1EVL A;  2ZR2 A;  1WQ7 A;  3UFG A;  3VQY A;  3E9H A;  4H2V A;  2E64 A;  4XU1 A;  2AKW A;  4P73 C;  2RHQ B;  2PMF A;  4G85 A;  4DQ2 A;  1SET A;  2DQ0 A;  3R07 A;  3UH0 A;  3CMQ A;  2ZT6 A;  4HVC A;  2DZ9 A;  2ZIN A;  2I4M A;  1EFW A;  2CIM A;  2E3C A;  3L4G A;  1B76 A;  1VQZ A;  4TVW A;  2ALY B;  2ZNI A;  3MEY A;  4K88 A;  1H4V B;  12AS A;  1ADY A;  1Z7N A;  4P74 A;  4WJ3 M;  3HXY A;  3LSS A;  3NEM A;  3HXW A;  3L1A A;  4EX5 A;  3VQV A;  2EWN A;  2E10 A;  2RHQ A;  1B7Y B;  5K1P A;  2XTI A;  3M4P A;  1NJ8 A;  2ZZG A;  4WI1 A;  4HWR A;  1B8A A;  4TTV A;  3ERR A;  4H2S A;  3HXV A;  1NJ1 A;  1W66 A;  3HRK A;  4HA8 A;  4YRL A;  4RQF A;  3QO7 A;  3OD1 A;  3QO8 A;  5ELO A;  4OP0 A;  2I4N A;  4L87 A;  4YRK A;  4YRM A;  1X55 A;  4LVJ A;  3RKX A;  1EIY B;  4LNS A;  3EFR A;  4LVM A;  4TWA A;  4UP9 A;  4P3O A;  2E41 A;  11AS A;  4XEO A;  3RF1 A;  1YFR A;  2DZC A;  3PZC A;  4YRJ A;  1JJC B;  3MF1 A;  1X2G A;  1PYS B;  4CS4 A;  4XTU A;  3NET A;  3G1Z A;  3TEG A;  3QO5 A;  1ASY A;  4YRQ A;  1SES A;  1JJC A;  3W3S A;  3L4G B;  3A7R A;  4K87 A;  3PCO B;  4LVK A;  4XU3 A;  1C0A A;  4P74 C;  4K86 A;  2ART A;  1WLE A;  2DTH A;  2ZZE A;  4OLF A;  2ZIO A;  2ZXF A;  1G5H A;  3REU A;  4CH5 A;  1J5W A;  3QNE A;  1Z7M A;  2EJF A;  4AH6 A;  3TEH A;  2QHT A;  2ZR3 A;  2QHV A;  2ARU A;  4CH6 A;  2ODR D;  3V7S A;  1NYR A;  3V7C A;  4LVL A;  3TUP A;  4TQF A;  2P5I A;  2ZCE A;  2EAY A;  3IKM B;  2E65 A;  2Q7G A;  3A31 A;  4P75 A;  2PME A;  3RGL A;  1B70 B;  5C53 B;  1EOV A;  2J3M A;  5HGQ A;  4YYE A;  3NEL A;  4PG3 A;  1WPY A;  2FYK A;  1WU7 A;  4ZIB A;  2IY5 A;  4YRI A;  4XTX A;  4ZTZ B;  4YRG A;  3HXZ A;  2C8M A;  3V8K A;  1B70 A;  3A7A A;  2DXT A;  3UGQ A;  3RL6 A;  1E24 A;  3HXX A;  2DU7 A;  4KR3 A;  4YRC A;  4WJ4 A;  5K1X A;  2DVE A;  2Q7H A;  4YRR A;  1BBU A;  3P8V A;  4HT4 A;  1GGM A;  2A8E A;  3A5Y A;  2G4C A;  4H2Y A;  1WQW A;  4PHC A;  1SER A;  1ADJ A;  4E51 A;  1NYQ A;  3HRI A;  2CJB A;  3VQX A;  3WQZ A;  2DDZ A;  2J3L A;  3M4Q A;  1WYD A;  1SRY A;  1BBW A;  3V8J A;  3HFZ A;  4KQE A;  4RQE A;  1NNH A;  4H2W A;  1KMM A;  3VBB A;  3ICA A;  3NEN A;  2C7I A;  4CS2 A;  4RMF A;  3TEH B;  4P75 C;  4YRP A;  2ALY A;  4TVY A;  3MQZ A;  1G51 A;  3A32 A;  4YRE A;  3HFZ B;  2AMC B;  3LSQ A;  4H2X A;  4YRN A;  3RIR A;  3HY0 A;  1N9W A;  5C52 B;  1HXD A;  3FJP A;  4J15 A;  3QTC A;  3EFS A;  3PCO A;  1KMN A;  2ZIM A;  2RHS A;  1PYS A;  3A7U A;  1E1T A;  3IG2 A;  3P8T A;  4H2X B;  3MF2 A;  4XTZ A;  5E3I A;  4WF2 A;  5C51 B;  1X01 A;  3HTZ A;  1HTT A;  1YFT A;  4H02 A;  4XTW A;  4XU2 A;  1H4Q A;  1NJ2 A;  2ZT5 A;  4P73 A;  2XGT A;  1G5I A;  4CS3 A;  3IKL A;  1YB3 A;  3VQW A;  3LC0 A;  2QHU A;  4YCV A;  4YRO A;  3I7F A;  3RKW A;  2DU5 A;  1IL2 A;  1X56 A;  5F5W A;  4YDQ A;  3BJU A;  4X5O A;  2DTO A;  1BIB A;  4P3N A;  1X54 A;  4Q6G A;  1EVK A;  2ZNJ A;  4UPA A;  4Q15 A;  3L2Z A;  2DTI A;  1HC7 A;  3HXU A;  2EL9 A;  4LVI A;  2ARS A;  2ODR C;  2ZT8 A;  4P71 C;  1WNL A;  4H2U A;  2Q5H A;  2EJG A;  1USY A;  4YRT A;  2I4L A;  4RDX A;  1EIY A;  3A5Z A;  5ELN A;  2DQ3 A;  4HWO A;  4UP8 A;  3HY1 A;  4HWS A;  4YCW A;  2RHS B;  2NS6 A;  2EJ9 A;  5KNN A;  2P0L A;  4XEM A;  1NJ5 A;  2Q7E A;  3A74 A;  1KOG A;  3IAL A;  3RAC A;  4XTV A;  2Q5I A;  4CH4 A;  1FYF A;  2QHS A;  4P71 A;  3V7R A;  4NCX A;  4YRS A;  4YCU A;  2AMC A;  1X2H A;  2ZT7 A;  1BIA A;  4HWT A;  2CJA A;  4P3P A;  3RUX A;  1ATI A;  4EO4 A;  1YGB A;  4O2D A;  1E22 A;  4XU0 A;  4HWP A;  3KFU A;  2ZGW A;  4TQD A;  4TVA A;  4UP7 A;  2E1H A;  3V8L A;  2DKG A;  4KR2 A;  1LYL A;  4H2T A;  2DJZ A;  1L0W A;  3DSQ A;  4YRF A;  1E1O A;  2HNI A;  4G84 A;  4P72 A;  1EQR A;  4XTY A;  4DPG A;  2CGH A;  4P72 C;  1USY C;  2I4O A;  3REX A;  1QF6 A;  1ASZ A;  4TVA B;  1NJ6 A;  4BW9 A;  1H4T A;  2ZTG A;  3UGT A;  3E9I A;  1B7Y A;  3HFV A;  1QE0 A;  4CH3 A;  2CJ9 A;  4YPF A;  4ZTU B;  1RIQ A;  1YFS A;  2IY5 B;  2ZZF A;  3RKY A;  2AKW B;  3BFM A;  2DXU A; 
#chains in the Genus database with same CATH homology
 2DEQ A;  4YP0 A;  4BWA A;  3P8Y A;  1H4S A;  2E5A A;  1EVL A;  2ZR2 A;  1WQ7 A;  3UFG A;  3VQY A;  3E9H A;  4H2V A;  2E64 A;  4XU1 A;  2AKW A;  4P73 C;  2RHQ B;  2PMF A;  4G85 A;  4DQ2 A;  1SET A;  2DQ0 A;  3R07 A;  3UH0 A;  3CMQ A;  2ZT6 A;  4HVC A;  2DZ9 A;  2ZIN A;  2I4M A;  1EFW A;  2CIM A;  2E3C A;  3L4G A;  1B76 A;  1VQZ A;  4TVW A;  2ALY B;  2ZNI A;  3MEY A;  4K88 A;  1H4V B;  12AS A;  1ADY A;  1Z7N A;  4P74 A;  4WJ3 M;  3HXY A;  3LSS A;  3NEM A;  3HXW A;  3L1A A;  4EX5 A;  3VQV A;  2EWN A;  2E10 A;  2RHQ A;  1B7Y B;  5K1P A;  2XTI A;  3M4P A;  1NJ8 A;  2ZZG A;  4WI1 A;  4HWR A;  1B8A A;  4TTV A;  3ERR A;  4H2S A;  3HXV A;  1NJ1 A;  1W66 A;  3HRK A;  4HA8 A;  4YRL A;  4RQF A;  3QO7 A;  3OD1 A;  3QO8 A;  5ELO A;  4OP0 A;  2I4N A;  4L87 A;  4YRK A;  4YRM A;  1X55 A;  4LVJ A;  3RKX A;  1EIY B;  4LNS A;  3EFR A;  4LVM A;  4TWA A;  4UP9 A;  4P3O A;  2E41 A;  11AS A;  4XEO A;  3RF1 A;  1YFR A;  2DZC A;  3PZC A;  4YRJ A;  1JJC B;  3MF1 A;  1X2G A;  1PYS B;  4CS4 A;  4XTU A;  3NET A;  3G1Z A;  3TEG A;  3QO5 A;  1ASY A;  4YRQ A;  1SES A;  1JJC A;  3W3S A;  3L4G B;  3A7R A;  4K87 A;  3PCO B;  4LVK A;  4XU3 A;  1C0A A;  4P74 C;  4K86 A;  2ART A;  1WLE A;  2DTH A;  2ZZE A;  4OLF A;  2ZIO A;  2ZXF A;  1G5H A;  3REU A;  4CH5 A;  1J5W A;  3QNE A;  1Z7M A;  2EJF A;  4AH6 A;  3TEH A;  2QHT A;  2ZR3 A;  2QHV A;  2ARU A;  4CH6 A;  2ODR D;  3V7S A;  1NYR A;  3V7C A;  4LVL A;  3TUP A;  4TQF A;  2P5I A;  2ZCE A;  2EAY A;  3IKM B;  2E65 A;  2Q7G A;  3A31 A;  4P75 A;  2PME A;  3RGL A;  1B70 B;  5C53 B;  1EOV A;  2J3M A;  5HGQ A;  4YYE A;  3NEL A;  4PG3 A;  1WPY A;  2FYK A;  1WU7 A;  4ZIB A;  2IY5 A;  4YRI A;  4XTX A;  4ZTZ B;  4YRG A;  3HXZ A;  2C8M A;  3V8K A;  1B70 A;  3A7A A;  2DXT A;  3UGQ A;  3RL6 A;  1E24 A;  3HXX A;  2DU7 A;  4KR3 A;  4YRC A;  4WJ4 A;  5K1X A;  2DVE A;  2Q7H A;  4YRR A;  1BBU A;  3P8V A;  4HT4 A;  1GGM A;  2A8E A;  3A5Y A;  2G4C A;  4H2Y A;  1WQW A;  4PHC A;  1SER A;  1ADJ A;  4E51 A;  1NYQ A;  3HRI A;  2CJB A;  3VQX A;  3WQZ A;  2DDZ A;  2J3L A;  3M4Q A;  1WYD A;  1SRY A;  1BBW A;  3V8J A;  3HFZ A;  4KQE A;  4RQE A;  1NNH A;  4H2W A;  1KMM A;  3VBB A;  3ICA A;  3NEN A;  2C7I A;  4CS2 A;  4RMF A;  3TEH B;  4P75 C;  4YRP A;  2ALY A;  4TVY A;  3MQZ A;  1G51 A;  3A32 A;  4YRE A;  3HFZ B;  2AMC B;  3LSQ A;  4H2X A;  4YRN A;  3RIR A;  3HY0 A;  1N9W A;  5C52 B;  1HXD A;  3FJP A;  4J15 A;  3QTC A;  3EFS A;  3PCO A;  1KMN A;  2ZIM A;  2RHS A;  1PYS A;  3A7U A;  1E1T A;  3IG2 A;  3P8T A;  4H2X B;  3MF2 A;  4XTZ A;  5E3I A;  4WF2 A;  5C51 B;  1X01 A;  3HTZ A;  1HTT A;  1YFT A;  4H02 A;  4XTW A;  4XU2 A;  1H4Q A;  1NJ2 A;  2ZT5 A;  4P73 A;  2XGT A;  1G5I A;  4CS3 A;  3IKL A;  1YB3 A;  3VQW A;  3LC0 A;  2QHU A;  4YCV A;  4YRO A;  3I7F A;  3RKW A;  2DU5 A;  1IL2 A;  1X56 A;  5F5W A;  4YDQ A;  3BJU A;  4X5O A;  2DTO A;  1BIB A;  4P3N A;  1X54 A;  4Q6G A;  1EVK A;  2ZNJ A;  4UPA A;  4Q15 A;  3L2Z A;  2DTI A;  1HC7 A;  3HXU A;  2EL9 A;  4LVI A;  2ARS A;  2ODR C;  2ZT8 A;  4P71 C;  1WNL A;  4H2U A;  2Q5H A;  2EJG A;  1USY A;  4YRT A;  2I4L A;  4RDX A;  1EIY A;  3A5Z A;  5ELN A;  2DQ3 A;  4HWO A;  4UP8 A;  3HY1 A;  4HWS A;  4YCW A;  2RHS B;  2NS6 A;  2EJ9 A;  5KNN A;  2P0L A;  4XEM A;  1NJ5 A;  2Q7E A;  3A74 A;  1KOG A;  3IAL A;  3RAC A;  4XTV A;  2Q5I A;  4CH4 A;  1FYF A;  2QHS A;  4P71 A;  3V7R A;  4NCX A;  4YRS A;  4YCU A;  2AMC A;  1X2H A;  2ZT7 A;  1BIA A;  4HWT A;  2CJA A;  4P3P A;  3RUX A;  1ATI A;  4EO4 A;  1YGB A;  4O2D A;  1E22 A;  4XU0 A;  4HWP A;  3KFU A;  2ZGW A;  4TQD A;  4TVA A;  4UP7 A;  2E1H A;  3V8L A;  2DKG A;  4KR2 A;  1LYL A;  4H2T A;  2DJZ A;  1L0W A;  3DSQ A;  4YRF A;  1E1O A;  2HNI A;  4G84 A;  4P72 A;  1EQR A;  4XTY A;  4DPG A;  2CGH A;  4P72 C;  1USY C;  2I4O A;  3REX A;  1QF6 A;  1ASZ A;  4TVA B;  1NJ6 A;  4BW9 A;  1H4T A;  2ZTG A;  3UGT A;  3E9I A;  1B7Y A;  3HFV A;  1QE0 A;  4CH3 A;  2CJ9 A;  4YPF A;  4ZTU B;  1RIQ A;  1YFS A;  2IY5 B;  2ZZF A;  3RKY A;  2AKW B;  3BFM A;  2DXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...