4P71C

Apo phers from p. aeuriginosa
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
251
structure length
239
Chain Sequence
b'AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
total genus 62
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p71C01
1G5IA 1NJ5A 1SRYA 2Q7GA 1H4TA 1WNLA 2Q7HA 1NJ8A 4H02A 3A5ZA 4UPAA 3FJPA 1Z7NA 4P74A 3V8JA 4CH4A 2E5AA 2I4MA 3L1AA 4CH6A 3W3SA 4YDQA 4HWPA 5K1XA 3L4GB 1X2HA 5F5WA 1FYFA 4Q15A 2RHQB 5C53B 1GGMA 3RGLA 1QF6A 1BIBA 4P3NA 1L0WA 2IY5B 2E65A 3IG2A 2DZ9A 4YP0A 5E3IA 2ODRD 4UP9A 3RKWA 4YCVA 4K87A 3A74A 1YGBA 2G4CA 1G51A 3BJUA 1B7YA 4H2WA 4XTXA 3HFZA 3RUXA 3HFVA 5K1PA 1SERA 2AKWA 4UP8A 2DXUA 4P72A 3P8VA 1QE0A 2DKGA 2QHSA 4BWAA 4K88A 2ZZGA 1WQWA 3HY1A 3TEHA 2E64A 2RHSB 4XU1A 3UGTA 2ZT7A 4BW9A 4ZTZB 4H2TA 2AMCB 3V7RA 4YRFA 3QO5A 1H4VB 2ZZFA 4P72C 4PG3A 2CGHA 4TTVA 2ZT8A 3MF2A 4TVAB 4Q6GA 1NYQA 4HWOA 1YFTA 3PZCA 4ZTUB 1ASYA 3TEGA 2HNIA 3M4PA 4AH6A 4RQFA 1Z7MA 3V8LA 2ZNIA 4UP7A 4RDXA 4G84A 4YCWA 3REUA 1IL2A 2ARSA 4CH5A 1LYLA 4HA8A 3NELA 1YFSA 2J3MA 2QHVA 2J3LA 2DXTA 1J5WA 3ICAA 4YREA 2EL9A 4RQEA 1X2GA 3WQZA 1KMMA 2Q5HA 3L4GA 2E1HA 4XU3A 3HRIA 4H2VA 1EVKA 3RL6A 1SETA 2RHQA 2P5IA 2DU5A 4NCXA 12ASA 2DTOA 1BBWA 2IY5A 4DPGA 3VQYA 1EVLA 5C51B 1X56A 3P8TA 5C52B 1B70B 2ZT6A 2DTIA 4YRRA 1NJ6A 1BBUA 3PCOB 4CS4A 1VQZA 2ALYB 1PYSB 1W66A 1ADJA 1EFWA 4X5OA 4TQFA 2E10A 1N9WA 4P3PA 1ASZA 4YRLA 2EJFA 3QO7A 3UFGA 1EOVA 4YRMA 5ELNA 4WI1A 1YB3A 3VBBA 2ZIOA 4YCUA 4H2XB 1KMNA 2RHSA 1ATIA 3EFRA 2DU7A 3HRKA 1C0AA 3G1ZA 2FYKA 2XGTA 4HWSA 4YRNA 2AMCA 1B76A 2ODRC 4TQDA 4DQ2A 4WJ4A 3HTZA 3IALA 2I4OA 1WU7A 4CH3A 3RIRA 4HVCA 1WYDA 2ARUA 3HXVA 2ZIMA 4YRQA 4TVAA 3HXYA 3VQXA 2ZINA 3IKMB 2ZTGA 2XTIA 1G5HA 1BIAA 1X55A 2PMFA 4EX5A 3RACA 3TUPA 3V7CA 1E22A 2ZCEA 2C8MA 3EFSA 4G85A 2CJBA 4XU0A 5ELOA 4XU2A 1X54A 3L2ZA 3OD1A 4YPFA 3V7SA 4YRIA 2I4LA 3P8YA 2DZCA 1H4QA 4YRPA 4P73C 11ASA 2ZZEA 1HXDA 3LSQA 1B8AA 1SESA 4HWTA 4LNSA 3E9IA 2EJ9A 2I4NA 2DVEA 1HTTA 1YFRA 4XEOA 3RKXA 4WJ3M 3CMQA 3A7RA 4H2SA 4YRJA 4EO4A 4XTUA 3NENA 3HY0A 2DJZA 3VQWA 1B70A 1NJ2A 3ERRA 1EIYB 2DEQA 3HXXA 4PHCA 4CS3A 3V8KA 4ZIBA 3PCOA 3MF1A 4H2YA 2ALYA 1PYSA 3IKLA 1X01A 2DDZA 4P75C 3NEMA 3RF1A 5KNNA 3R07A 3RKYA 4YYEA 4H2XA 1WPYA 1NJ1A 1ADYA 4YRTA 3LC0A 3A7UA 1RIQA 4O2DA 1WQ7A 3MEYA 4TWAA 2ARTA 1E24A 4P74C 2ZR2A 3E9HA 1EQRA 2DTHA 4YRCA 3VQVA 4OP0A 3HXZA 4E51A 1B7YB 2ZT5A 4J15A 1KOGA 1NYRA 1WLEA 2ZR3A 3HFZB 3HXWA 3HXUA 2ZNJA 2EJGA 2DQ3A 3QNEA 1E1TA 4XEMA 1USYA 2AKWB 4H2UA 4RMFA 3NETA 2Q7EA 4P71A 2CJAA 2QHTA 3I7FA 4P73A 2C7IA 4KR2A 3LSSA 2ZGWA 2P0LA 3M4QA 3TEHB 3KFUA 2EAYA 2DQ0A 4XTVA 4P3OA 1H4SA 1JJCA 3REXA 2QHUA 2E41A 4K86A 4YRSA 1NNHA 3A32A 1E1OA 2Q5IA 4TVYA 1USYC 4YRKA 3QO8A 4XTYA 1JJCB 4P71C 5HGQA 4HWRA 2CJ9A 3A7AA 3BFMA 3A5YA 4KQEA 4YROA 4XTWA 4XTZA 4OLFA 3A31A 4L87A 4TVWA 2CIMA 4YRGA 3QTCA 4KR3A 2E3CA 2ZXFA 4P75A 4CS2A 1EIYA 2EWNA 3UGQA 3DSQA 4WF2A 1HC7A 2PMEA 3UH0A
chains in the Genus database with same CATH superfamily
1G5IA 1NJ5A 1SRYA 2Q7GA 1H4TA 1WNLA 2Q7HA 1NJ8A 4H02A 3A5ZA 4UPAA 3FJPA 1Z7NA 4P74A 3V8JA 4CH4A 2E5AA 2I4MA 3L1AA 4CH6A 3W3SA 4YDQA 4HWPA 5K1XA 3L4GB 1X2HA 5F5WA 1FYFA 4Q15A 2RHQB 5C53B 1GGMA 3RGLA 1QF6A 2NS6A 1BIBA 4P3NA 1L0WA 2IY5B 2E65A 3IG2A 2DZ9A 4YP0A 5E3IA 2ODRD 4UP9A 3RKWA 4YCVA 4K87A 3A74A 1YGBA 2G4CA 1G51A 3BJUA 1B7YA 4H2WA 4XTXA 3HFZA 3RUXA 3HFVA 5K1PA 1SERA 2AKWA 4UP8A 2DXUA 4P72A 3P8VA 1QE0A 2DKGA 2QHSA 4BWAA 4K88A 2ZZGA 1WQWA 3HY1A 3TEHA 2E64A 2RHSB 4XU1A 3UGTA 2ZT7A 4BW9A 4ZTZB 4H2TA 2AMCB 3V7RA 4YRFA 3QO5A 1H4VB 2ZZFA 4P72C 4PG3A 2CGHA 4TTVA 2ZT8A 3MF2A 4TVAB 4Q6GA 1NYQA 4HWOA 1YFTA 3PZCA 4ZTUB 1ASYA 3TEGA 2HNIA 3M4PA 4AH6A 4RQFA 1Z7MA 3V8LA 2ZNIA 4UP7A 4RDXA 4G84A 4YCWA 3REUA 1IL2A 2ARSA 4CH5A 1LYLA 4HA8A 3NELA 1YFSA 2J3MA 2QHVA 2J3LA 2DXTA 1J5WA 3ICAA 4YREA 2EL9A 4RQEA 1X2GA 3WQZA 1KMMA 2Q5HA 3L4GA 2E1HA 4XU3A 3HRIA 4H2VA 1EVKA 3RL6A 1SETA 2RHQA 2P5IA 2DU5A 4NCXA 12ASA 2DTOA 1BBWA 2IY5A 4DPGA 3VQYA 1EVLA 5C51B 1X56A 3P8TA 5C52B 1B70B 2ZT6A 2DTIA 4YRRA 1NJ6A 1BBUA 3PCOB 4CS4A 1VQZA 2ALYB 1PYSB 1W66A 1ADJA 1EFWA 4X5OA 4TQFA 2E10A 1N9WA 4P3PA 4LVJA 1ASZA 4YRLA 4LVIA 2EJFA 3QO7A 3UFGA 1EOVA 4YRMA 5ELNA 4WI1A 1YB3A 3VBBA 2ZIOA 4YCUA 4H2XB 1KMNA 2RHSA 1ATIA 3EFRA 2DU7A 3HRKA 1C0AA 3G1ZA 2FYKA 2XGTA 4HWSA 4YRNA 2AMCA 1B76A 2ODRC 4TQDA 4DQ2A 4WJ4A 3HTZA 3IALA 2I4OA 1WU7A 4CH3A 3RIRA 4HVCA 1WYDA 2ARUA 3HXVA 4HT4A 2ZIMA 4YRQA 4TVAA 3HXYA 3VQXA 2ZINA 3IKMB 2ZTGA 2XTIA 1G5HA 1BIAA 1X55A 2PMFA 4EX5A 3RACA 3TUPA 3V7CA 1E22A 2ZCEA 2C8MA 3EFSA 4G85A 2CJBA 4XU0A 5ELOA 4XU2A 1X54A 3L2ZA 3OD1A 4YPFA 3V7SA 4YRIA 2I4LA 4LVLA 3P8YA 2DZCA 1H4QA 4YRPA 4P73C 11ASA 2ZZEA 1HXDA 3LSQA 1B8AA 1SESA 4HWTA 4LNSA 3E9IA 2EJ9A 2I4NA 2DVEA 1HTTA 1YFRA 4XEOA 3RKXA 4WJ3M 3CMQA 3A7RA 4H2SA 4YRJA 4EO4A 4XTUA 3NENA 3HY0A 2DJZA 3VQWA 1B70A 1NJ2A 3ERRA 1EIYB 2DEQA 3HXXA 4PHCA 4CS3A 3V8KA 4ZIBA 3PCOA 3MF1A 4H2YA 2ALYA 1PYSA 3IKLA 1X01A 2DDZA 4P75C 3NEMA 3RF1A 5KNNA 3R07A 3RKYA 4YYEA 4H2XA 1WPYA 1NJ1A 1ADYA 4YRTA 4LVMA 3LC0A 3A7UA 1RIQA 4O2DA 1WQ7A 3MEYA 4TWAA 2ARTA 1E24A 4P74C 2ZR2A 3E9HA 1EQRA 2DTHA 4YRCA 3VQVA 2A8EA 4OP0A 3HXZA 4E51A 1B7YB 3MQZA 2ZT5A 4J15A 1KOGA 1NYRA 1WLEA 2ZR3A 3HFZB 3HXWA 3HXUA 2ZNJA 2EJGA 2DQ3A 3QNEA 1E1TA 4XEMA 1USYA 2AKWB 4H2UA 4RMFA 3NETA 2Q7EA 4P71A 2CJAA 2QHTA 4LVKA 3I7FA 4P73A 2C7IA 4KR2A 3LSSA 2ZGWA 2P0LA 3M4QA 3TEHB 3KFUA 2EAYA 2DQ0A 4XTVA 4P3OA 1H4SA 1JJCA 3REXA 2QHUA 2E41A 4K86A 4YRSA 1NNHA 3A32A 1E1OA 2Q5IA 4TVYA 1USYC 4YRKA 3QO8A 4XTYA 1JJCB 4P71C 5HGQA 4HWRA 2CJ9A 3A7AA 3BFMA 3A5YA 4KQEA 4YROA 4XTWA 4XTZA 4OLFA 3A31A 4L87A 4TVWA 2CIMA 4YRGA 3QTCA 4KR3A 2E3CA 2ZXFA 4P75A 4CS2A 1EIYA 2EWNA 3UGQA 3DSQA 4WF2A 1HC7A 2PMEA 3UH0A
chains in the Genus database with same CATH topology
1G5IA 1NJ5A 1SRYA 2Q7GA 1H4TA 1WNLA 2Q7HA 1NJ8A 4H02A 3A5ZA 4UPAA 3FJPA 1Z7NA 4P74A 3V8JA 4CH4A 2E5AA 2I4MA 3L1AA 4CH6A 3W3SA 4YDQA 4HWPA 5K1XA 3L4GB 1X2HA 5F5WA 1FYFA 4Q15A 2RHQB 5C53B 1GGMA 3RGLA 1QF6A 2NS6A 1BIBA 4P3NA 1L0WA 2IY5B 2E65A 3IG2A 2DZ9A 4YP0A 5E3IA 2ODRD 4UP9A 3RKWA 4YCVA 4K87A 3A74A 1YGBA 2G4CA 1G51A 3BJUA 1B7YA 4H2WA 4XTXA 3HFZA 3RUXA 3HFVA 5K1PA 1SERA 2AKWA 4UP8A 2DXUA 4P72A 3P8VA 1QE0A 2DKGA 2QHSA 4BWAA 4K88A 2ZZGA 1WQWA 3HY1A 3TEHA 2E64A 2RHSB 4XU1A 3UGTA 2ZT7A 4BW9A 4ZTZB 4H2TA 2AMCB 3V7RA 4YRFA 3QO5A 1H4VB 2ZZFA 4P72C 4PG3A 2CGHA 4TTVA 2ZT8A 3MF2A 4TVAB 4Q6GA 1NYQA 4HWOA 1YFTA 3PZCA 4ZTUB 1ASYA 3TEGA 2HNIA 3M4PA 4AH6A 4RQFA 1Z7MA 3V8LA 2ZNIA 4UP7A 4RDXA 4G84A 4YCWA 3REUA 1IL2A 2ARSA 4CH5A 1LYLA 4HA8A 3NELA 1YFSA 2J3MA 2QHVA 2J3LA 2DXTA 1J5WA 3ICAA 4YREA 2EL9A 4RQEA 1X2GA 3WQZA 1KMMA 2Q5HA 3L4GA 2E1HA 4XU3A 3HRIA 4H2VA 1EVKA 3RL6A 1SETA 2RHQA 2P5IA 2DU5A 4NCXA 12ASA 2DTOA 1BBWA 2IY5A 4DPGA 3VQYA 1EVLA 5C51B 1X56A 3P8TA 5C52B 1B70B 2ZT6A 2DTIA 4YRRA 1NJ6A 1BBUA 3PCOB 4CS4A 1VQZA 2ALYB 1PYSB 1W66A 1ADJA 1EFWA 4X5OA 4TQFA 2E10A 1N9WA 4P3PA 4LVJA 1ASZA 4YRLA 4LVIA 2EJFA 3QO7A 3UFGA 1EOVA 4YRMA 5ELNA 4WI1A 1YB3A 3VBBA 2ZIOA 4YCUA 4H2XB 1KMNA 2RHSA 1ATIA 3EFRA 2DU7A 3HRKA 1C0AA 3G1ZA 2FYKA 2XGTA 4HWSA 4YRNA 2AMCA 1B76A 2ODRC 4TQDA 4DQ2A 4WJ4A 3HTZA 3IALA 2I4OA 1WU7A 4CH3A 3RIRA 4HVCA 1WYDA 2ARUA 3HXVA 4HT4A 2ZIMA 4YRQA 4TVAA 3HXYA 3VQXA 2ZINA 3IKMB 2ZTGA 2XTIA 1G5HA 1BIAA 1X55A 2PMFA 4EX5A 3RACA 3TUPA 3V7CA 1E22A 2ZCEA 2C8MA 3EFSA 4G85A 2CJBA 4XU0A 5ELOA 4XU2A 1X54A 3L2ZA 3OD1A 4YPFA 3V7SA 4YRIA 2I4LA 4LVLA 3P8YA 2DZCA 1H4QA 4YRPA 4P73C 11ASA 2ZZEA 1HXDA 3LSQA 1B8AA 1SESA 4HWTA 4LNSA 3E9IA 2EJ9A 2I4NA 2DVEA 1HTTA 1YFRA 4XEOA 3RKXA 4WJ3M 3CMQA 3A7RA 4H2SA 4YRJA 4EO4A 4XTUA 3NENA 3HY0A 2DJZA 3VQWA 1B70A 1NJ2A 3ERRA 1EIYB 2DEQA 3HXXA 4PHCA 4CS3A 3V8KA 4ZIBA 3PCOA 3MF1A 4H2YA 2ALYA 1PYSA 3IKLA 1X01A 2DDZA 4P75C 3NEMA 3RF1A 5KNNA 3R07A 3RKYA 4YYEA 4H2XA 1WPYA 1NJ1A 1ADYA 4YRTA 4LVMA 3LC0A 3A7UA 1RIQA 4O2DA 1WQ7A 3MEYA 4TWAA 2ARTA 1E24A 4P74C 2ZR2A 3E9HA 1EQRA 2DTHA 4YRCA 3VQVA 2A8EA 4OP0A 3HXZA 4E51A 1B7YB 3MQZA 2ZT5A 4J15A 1KOGA 1NYRA 1WLEA 2ZR3A 3HFZB 3HXWA 3HXUA 2ZNJA 2EJGA 2DQ3A 3QNEA 1E1TA 4XEMA 1USYA 2AKWB 4H2UA 4RMFA 3NETA 2Q7EA 4P71A 2CJAA 2QHTA 4LVKA 3I7FA 4P73A 2C7IA 4KR2A 3LSSA 2ZGWA 2P0LA 3M4QA 3TEHB 3KFUA 2EAYA 2DQ0A 4XTVA 4P3OA 1H4SA 1JJCA 3REXA 2QHUA 2E41A 4K86A 4YRSA 1NNHA 3A32A 1E1OA 2Q5IA 4TVYA 1USYC 4YRKA 3QO8A 4XTYA 1JJCB 4P71C 5HGQA 4HWRA 2CJ9A 3A7AA 3BFMA 3A5YA 4KQEA 4YROA 4XTWA 4XTZA 4OLFA 3A31A 4L87A 4TVWA 2CIMA 4YRGA 3QTCA 4KR3A 2E3CA 2ZXFA 4P75A 4CS2A 1EIYA 2EWNA 3UGQA 3DSQA 4WF2A 1HC7A 2PMEA 3UH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5I A;  1NJ5 A;  1SRY A;  2Q7G A;  1H4T A;  1WNL A;  2Q7H A;  1NJ8 A;  4H02 A;  3A5Z A;  4UPA A;  3FJP A;  1Z7N A;  4P74 A;  3V8J A;  4CH4 A;  2E5A A;  2I4M A;  3L1A A;  4CH6 A;  3W3S A;  4YDQ A;  4HWP A;  5K1X A;  3L4G B;  1X2H A;  5F5W A;  1FYF A;  4Q15 A;  2RHQ B;  5C53 B;  1GGM A;  3RGL A;  1QF6 A;  1BIB A;  4P3N A;  1L0W A;  2IY5 B;  2E65 A;  3IG2 A;  2DZ9 A;  4YP0 A;  5E3I A;  2ODR D;  4UP9 A;  3RKW A;  4YCV A;  4K87 A;  3A74 A;  1YGB A;  2G4C A;  1G51 A;  3BJU A;  1B7Y A;  4H2W A;  4XTX A;  3HFZ A;  3RUX A;  3HFV A;  5K1P A;  1SER A;  2AKW A;  4UP8 A;  2DXU A;  4P72 A;  3P8V A;  1QE0 A;  2DKG A;  2QHS A;  4BWA A;  4K88 A;  2ZZG A;  1WQW A;  3HY1 A;  3TEH A;  2E64 A;  2RHS B;  4XU1 A;  3UGT A;  2ZT7 A;  4BW9 A;  4ZTZ B;  4H2T A;  2AMC B;  3V7R A;  4YRF A;  3QO5 A;  1H4V B;  2ZZF A;  4P72 C;  4PG3 A;  2CGH A;  4TTV A;  2ZT8 A;  3MF2 A;  4TVA B;  4Q6G A;  1NYQ A;  4HWO A;  1YFT A;  3PZC A;  4ZTU B;  1ASY A;  3TEG A;  2HNI A;  3M4P A;  4AH6 A;  4RQF A;  1Z7M A;  3V8L A;  2ZNI A;  4UP7 A;  4RDX A;  4G84 A;  4YCW A;  3REU A;  1IL2 A;  2ARS A;  4CH5 A;  1LYL A;  4HA8 A;  3NEL A;  1YFS A;  2J3M A;  2QHV A;  2J3L A;  2DXT A;  1J5W A;  3ICA A;  4YRE A;  2EL9 A;  4RQE A;  1X2G A;  3WQZ A;  1KMM A;  2Q5H A;  3L4G A;  2E1H A;  4XU3 A;  3HRI A;  4H2V A;  1EVK A;  3RL6 A;  1SET A;  2RHQ A;  2P5I A;  2DU5 A;  4NCX A;  12AS A;  2DTO A;  1BBW A;  2IY5 A;  4DPG A;  3VQY A;  1EVL A;  5C51 B;  1X56 A;  3P8T A;  5C52 B;  1B70 B;  2ZT6 A;  2DTI A;  4YRR A;  1NJ6 A;  1BBU A;  3PCO B;  4CS4 A;  1VQZ A;  2ALY B;  1PYS B;  1W66 A;  1ADJ A;  1EFW A;  4X5O A;  4TQF A;  2E10 A;  1N9W A;  4P3P A;  1ASZ A;  4YRL A;  2EJF A;  3QO7 A;  3UFG A;  1EOV A;  4YRM A;  5ELN A;  4WI1 A;  1YB3 A;  3VBB A;  2ZIO A;  4YCU A;  4H2X B;  1KMN A;  2RHS A;  1ATI A;  3EFR A;  2DU7 A;  3HRK A;  1C0A A;  3G1Z A;  2FYK A;  2XGT A;  4HWS A;  4YRN A;  2AMC A;  1B76 A;  2ODR C;  4TQD A;  4DQ2 A;  4WJ4 A;  3HTZ A;  3IAL A;  2I4O A;  1WU7 A;  4CH3 A;  3RIR A;  4HVC A;  1WYD A;  2ARU A;  3HXV A;  2ZIM A;  4YRQ A;  4TVA A;  3HXY A;  3VQX A;  2ZIN A;  3IKM B;  2ZTG A;  2XTI A;  1G5H A;  1BIA A;  1X55 A;  2PMF A;  4EX5 A;  3RAC A;  3TUP A;  3V7C A;  1E22 A;  2ZCE A;  2C8M A;  3EFS A;  4G85 A;  2CJB A;  4XU0 A;  5ELO A;  4XU2 A;  1X54 A;  3L2Z A;  3OD1 A;  4YPF A;  3V7S A;  4YRI A;  2I4L A;  3P8Y A;  2DZC A;  1H4Q A;  4YRP A;  4P73 C;  11AS A;  2ZZE A;  1HXD A;  3LSQ A;  1B8A A;  1SES A;  4HWT A;  4LNS A;  3E9I A;  2EJ9 A;  2I4N A;  2DVE A;  1HTT A;  1YFR A;  4XEO A;  3RKX A;  4WJ3 M;  3CMQ A;  3A7R A;  4H2S A;  4YRJ A;  4EO4 A;  4XTU A;  3NEN A;  3HY0 A;  2DJZ A;  3VQW A;  1B70 A;  1NJ2 A;  3ERR A;  1EIY B;  2DEQ A;  3HXX A;  4PHC A;  4CS3 A;  3V8K A;  4ZIB A;  3PCO A;  3MF1 A;  4H2Y A;  2ALY A;  1PYS A;  3IKL A;  1X01 A;  2DDZ A;  4P75 C;  3NEM A;  3RF1 A;  5KNN A;  3R07 A;  3RKY A;  4YYE A;  4H2X A;  1WPY A;  1NJ1 A;  1ADY A;  4YRT A;  3LC0 A;  3A7U A;  1RIQ A;  4O2D A;  1WQ7 A;  3MEY A;  4TWA A;  2ART A;  1E24 A;  4P74 C;  2ZR2 A;  3E9H A;  1EQR A;  2DTH A;  4YRC A;  3VQV A;  4OP0 A;  3HXZ A;  4E51 A;  1B7Y B;  2ZT5 A;  4J15 A;  1KOG A;  1NYR A;  1WLE A;  2ZR3 A;  3HFZ B;  3HXW A;  3HXU A;  2ZNJ A;  2EJG A;  2DQ3 A;  3QNE A;  1E1T A;  4XEM A;  1USY A;  2AKW B;  4H2U A;  4RMF A;  3NET A;  2Q7E A;  4P71 A;  2CJA A;  2QHT A;  3I7F A;  4P73 A;  2C7I A;  4KR2 A;  3LSS A;  2ZGW A;  2P0L A;  3M4Q A;  3TEH B;  3KFU A;  2EAY A;  2DQ0 A;  4XTV A;  4P3O A;  1H4S A;  1JJC A;  3REX A;  2QHU A;  2E41 A;  4K86 A;  4YRS A;  1NNH A;  3A32 A;  1E1O A;  2Q5I A;  4TVY A;  1USY C;  4YRK A;  3QO8 A;  4XTY A;  1JJC B;  4P71 C;  5HGQ A;  4HWR A;  2CJ9 A;  3A7A A;  3BFM A;  3A5Y A;  4KQE A;  4YRO A;  4XTW A;  4XTZ A;  4OLF A;  3A31 A;  4L87 A;  4TVW A;  2CIM A;  4YRG A;  3QTC A;  4KR3 A;  2E3C A;  2ZXF A;  4P75 A;  4CS2 A;  1EIY A;  2EWN A;  3UGQ A;  3DSQ A;  4WF2 A;  1HC7 A;  2PME A;  3UH0 A; 
#chains in the Genus database with same CATH topology
 1G5I A;  1NJ5 A;  1SRY A;  2Q7G A;  1H4T A;  1WNL A;  2Q7H A;  1NJ8 A;  4H02 A;  3A5Z A;  4UPA A;  3FJP A;  1Z7N A;  4P74 A;  3V8J A;  4CH4 A;  2E5A A;  2I4M A;  3L1A A;  4CH6 A;  3W3S A;  4YDQ A;  4HWP A;  5K1X A;  3L4G B;  1X2H A;  5F5W A;  1FYF A;  4Q15 A;  2RHQ B;  5C53 B;  1GGM A;  3RGL A;  1QF6 A;  2NS6 A;  1BIB A;  4P3N A;  1L0W A;  2IY5 B;  2E65 A;  3IG2 A;  2DZ9 A;  4YP0 A;  5E3I A;  2ODR D;  4UP9 A;  3RKW A;  4YCV A;  4K87 A;  3A74 A;  1YGB A;  2G4C A;  1G51 A;  3BJU A;  1B7Y A;  4H2W A;  4XTX A;  3HFZ A;  3RUX A;  3HFV A;  5K1P A;  1SER A;  2AKW A;  4UP8 A;  2DXU A;  4P72 A;  3P8V A;  1QE0 A;  2DKG A;  2QHS A;  4BWA A;  4K88 A;  2ZZG A;  1WQW A;  3HY1 A;  3TEH A;  2E64 A;  2RHS B;  4XU1 A;  3UGT A;  2ZT7 A;  4BW9 A;  4ZTZ B;  4H2T A;  2AMC B;  3V7R A;  4YRF A;  3QO5 A;  1H4V B;  2ZZF A;  4P72 C;  4PG3 A;  2CGH A;  4TTV A;  2ZT8 A;  3MF2 A;  4TVA B;  4Q6G A;  1NYQ A;  4HWO A;  1YFT A;  3PZC A;  4ZTU B;  1ASY A;  3TEG A;  2HNI A;  3M4P A;  4AH6 A;  4RQF A;  1Z7M A;  3V8L A;  2ZNI A;  4UP7 A;  4RDX A;  4G84 A;  4YCW A;  3REU A;  1IL2 A;  2ARS A;  4CH5 A;  1LYL A;  4HA8 A;  3NEL A;  1YFS A;  2J3M A;  2QHV A;  2J3L A;  2DXT A;  1J5W A;  3ICA A;  4YRE A;  2EL9 A;  4RQE A;  1X2G A;  3WQZ A;  1KMM A;  2Q5H A;  3L4G A;  2E1H A;  4XU3 A;  3HRI A;  4H2V A;  1EVK A;  3RL6 A;  1SET A;  2RHQ A;  2P5I A;  2DU5 A;  4NCX A;  12AS A;  2DTO A;  1BBW A;  2IY5 A;  4DPG A;  3VQY A;  1EVL A;  5C51 B;  1X56 A;  3P8T A;  5C52 B;  1B70 B;  2ZT6 A;  2DTI A;  4YRR A;  1NJ6 A;  1BBU A;  3PCO B;  4CS4 A;  1VQZ A;  2ALY B;  1PYS B;  1W66 A;  1ADJ A;  1EFW A;  4X5O A;  4TQF A;  2E10 A;  1N9W A;  4P3P A;  4LVJ A;  1ASZ A;  4YRL A;  4LVI A;  2EJF A;  3QO7 A;  3UFG A;  1EOV A;  4YRM A;  5ELN A;  4WI1 A;  1YB3 A;  3VBB A;  2ZIO A;  4YCU A;  4H2X B;  1KMN A;  2RHS A;  1ATI A;  3EFR A;  2DU7 A;  3HRK A;  1C0A A;  3G1Z A;  2FYK A;  2XGT A;  4HWS A;  4YRN A;  2AMC A;  1B76 A;  2ODR C;  4TQD A;  4DQ2 A;  4WJ4 A;  3HTZ A;  3IAL A;  2I4O A;  1WU7 A;  4CH3 A;  3RIR A;  4HVC A;  1WYD A;  2ARU A;  3HXV A;  4HT4 A;  2ZIM A;  4YRQ A;  4TVA A;  3HXY A;  3VQX A;  2ZIN A;  3IKM B;  2ZTG A;  2XTI A;  1G5H A;  1BIA A;  1X55 A;  2PMF A;  4EX5 A;  3RAC A;  3TUP A;  3V7C A;  1E22 A;  2ZCE A;  2C8M A;  3EFS A;  4G85 A;  2CJB A;  4XU0 A;  5ELO A;  4XU2 A;  1X54 A;  3L2Z A;  3OD1 A;  4YPF A;  3V7S A;  4YRI A;  2I4L A;  4LVL A;  3P8Y A;  2DZC A;  1H4Q A;  4YRP A;  4P73 C;  11AS A;  2ZZE A;  1HXD A;  3LSQ A;  1B8A A;  1SES A;  4HWT A;  4LNS A;  3E9I A;  2EJ9 A;  2I4N A;  2DVE A;  1HTT A;  1YFR A;  4XEO A;  3RKX A;  4WJ3 M;  3CMQ A;  3A7R A;  4H2S A;  4YRJ A;  4EO4 A;  4XTU A;  3NEN A;  3HY0 A;  2DJZ A;  3VQW A;  1B70 A;  1NJ2 A;  3ERR A;  1EIY B;  2DEQ A;  3HXX A;  4PHC A;  4CS3 A;  3V8K A;  4ZIB A;  3PCO A;  3MF1 A;  4H2Y A;  2ALY A;  1PYS A;  3IKL A;  1X01 A;  2DDZ A;  4P75 C;  3NEM A;  3RF1 A;  5KNN A;  3R07 A;  3RKY A;  4YYE A;  4H2X A;  1WPY A;  1NJ1 A;  1ADY A;  4YRT A;  4LVM A;  3LC0 A;  3A7U A;  1RIQ A;  4O2D A;  1WQ7 A;  3MEY A;  4TWA A;  2ART A;  1E24 A;  4P74 C;  2ZR2 A;  3E9H A;  1EQR A;  2DTH A;  4YRC A;  3VQV A;  2A8E A;  4OP0 A;  3HXZ A;  4E51 A;  1B7Y B;  3MQZ A;  2ZT5 A;  4J15 A;  1KOG A;  1NYR A;  1WLE A;  2ZR3 A;  3HFZ B;  3HXW A;  3HXU A;  2ZNJ A;  2EJG A;  2DQ3 A;  3QNE A;  1E1T A;  4XEM A;  1USY A;  2AKW B;  4H2U A;  4RMF A;  3NET A;  2Q7E A;  4P71 A;  2CJA A;  2QHT A;  4LVK A;  3I7F A;  4P73 A;  2C7I A;  4KR2 A;  3LSS A;  2ZGW A;  2P0L A;  3M4Q A;  3TEH B;  3KFU A;  2EAY A;  2DQ0 A;  4XTV A;  4P3O A;  1H4S A;  1JJC A;  3REX A;  2QHU A;  2E41 A;  4K86 A;  4YRS A;  1NNH A;  3A32 A;  1E1O A;  2Q5I A;  4TVY A;  1USY C;  4YRK A;  3QO8 A;  4XTY A;  1JJC B;  4P71 C;  5HGQ A;  4HWR A;  2CJ9 A;  3A7A A;  3BFM A;  3A5Y A;  4KQE A;  4YRO A;  4XTW A;  4XTZ A;  4OLF A;  3A31 A;  4L87 A;  4TVW A;  2CIM A;  4YRG A;  3QTC A;  4KR3 A;  2E3C A;  2ZXF A;  4P75 A;  4CS2 A;  1EIY A;  2EWN A;  3UGQ A;  3DSQ A;  4WF2 A;  1HC7 A;  2PME A;  3UH0 A; 
#chains in the Genus database with same CATH homology
 1G5I A;  1NJ5 A;  1SRY A;  2Q7G A;  1H4T A;  1WNL A;  2Q7H A;  1NJ8 A;  4H02 A;  3A5Z A;  4UPA A;  3FJP A;  1Z7N A;  4P74 A;  3V8J A;  4CH4 A;  2E5A A;  2I4M A;  3L1A A;  4CH6 A;  3W3S A;  4YDQ A;  4HWP A;  5K1X A;  3L4G B;  1X2H A;  5F5W A;  1FYF A;  4Q15 A;  2RHQ B;  5C53 B;  1GGM A;  3RGL A;  1QF6 A;  2NS6 A;  1BIB A;  4P3N A;  1L0W A;  2IY5 B;  2E65 A;  3IG2 A;  2DZ9 A;  4YP0 A;  5E3I A;  2ODR D;  4UP9 A;  3RKW A;  4YCV A;  4K87 A;  3A74 A;  1YGB A;  2G4C A;  1G51 A;  3BJU A;  1B7Y A;  4H2W A;  4XTX A;  3HFZ A;  3RUX A;  3HFV A;  5K1P A;  1SER A;  2AKW A;  4UP8 A;  2DXU A;  4P72 A;  3P8V A;  1QE0 A;  2DKG A;  2QHS A;  4BWA A;  4K88 A;  2ZZG A;  1WQW A;  3HY1 A;  3TEH A;  2E64 A;  2RHS B;  4XU1 A;  3UGT A;  2ZT7 A;  4BW9 A;  4ZTZ B;  4H2T A;  2AMC B;  3V7R A;  4YRF A;  3QO5 A;  1H4V B;  2ZZF A;  4P72 C;  4PG3 A;  2CGH A;  4TTV A;  2ZT8 A;  3MF2 A;  4TVA B;  4Q6G A;  1NYQ A;  4HWO A;  1YFT A;  3PZC A;  4ZTU B;  1ASY A;  3TEG A;  2HNI A;  3M4P A;  4AH6 A;  4RQF A;  1Z7M A;  3V8L A;  2ZNI A;  4UP7 A;  4RDX A;  4G84 A;  4YCW A;  3REU A;  1IL2 A;  2ARS A;  4CH5 A;  1LYL A;  4HA8 A;  3NEL A;  1YFS A;  2J3M A;  2QHV A;  2J3L A;  2DXT A;  1J5W A;  3ICA A;  4YRE A;  2EL9 A;  4RQE A;  1X2G A;  3WQZ A;  1KMM A;  2Q5H A;  3L4G A;  2E1H A;  4XU3 A;  3HRI A;  4H2V A;  1EVK A;  3RL6 A;  1SET A;  2RHQ A;  2P5I A;  2DU5 A;  4NCX A;  12AS A;  2DTO A;  1BBW A;  2IY5 A;  4DPG A;  3VQY A;  1EVL A;  5C51 B;  1X56 A;  3P8T A;  5C52 B;  1B70 B;  2ZT6 A;  2DTI A;  4YRR A;  1NJ6 A;  1BBU A;  3PCO B;  4CS4 A;  1VQZ A;  2ALY B;  1PYS B;  1W66 A;  1ADJ A;  1EFW A;  4X5O A;  4TQF A;  2E10 A;  1N9W A;  4P3P A;  4LVJ A;  1ASZ A;  4YRL A;  4LVI A;  2EJF A;  3QO7 A;  3UFG A;  1EOV A;  4YRM A;  5ELN A;  4WI1 A;  1YB3 A;  3VBB A;  2ZIO A;  4YCU A;  4H2X B;  1KMN A;  2RHS A;  1ATI A;  3EFR A;  2DU7 A;  3HRK A;  1C0A A;  3G1Z A;  2FYK A;  2XGT A;  4HWS A;  4YRN A;  2AMC A;  1B76 A;  2ODR C;  4TQD A;  4DQ2 A;  4WJ4 A;  3HTZ A;  3IAL A;  2I4O A;  1WU7 A;  4CH3 A;  3RIR A;  4HVC A;  1WYD A;  2ARU A;  3HXV A;  4HT4 A;  2ZIM A;  4YRQ A;  4TVA A;  3HXY A;  3VQX A;  2ZIN A;  3IKM B;  2ZTG A;  2XTI A;  1G5H A;  1BIA A;  1X55 A;  2PMF A;  4EX5 A;  3RAC A;  3TUP A;  3V7C A;  1E22 A;  2ZCE A;  2C8M A;  3EFS A;  4G85 A;  2CJB A;  4XU0 A;  5ELO A;  4XU2 A;  1X54 A;  3L2Z A;  3OD1 A;  4YPF A;  3V7S A;  4YRI A;  2I4L A;  4LVL A;  3P8Y A;  2DZC A;  1H4Q A;  4YRP A;  4P73 C;  11AS A;  2ZZE A;  1HXD A;  3LSQ A;  1B8A A;  1SES A;  4HWT A;  4LNS A;  3E9I A;  2EJ9 A;  2I4N A;  2DVE A;  1HTT A;  1YFR A;  4XEO A;  3RKX A;  4WJ3 M;  3CMQ A;  3A7R A;  4H2S A;  4YRJ A;  4EO4 A;  4XTU A;  3NEN A;  3HY0 A;  2DJZ A;  3VQW A;  1B70 A;  1NJ2 A;  3ERR A;  1EIY B;  2DEQ A;  3HXX A;  4PHC A;  4CS3 A;  3V8K A;  4ZIB A;  3PCO A;  3MF1 A;  4H2Y A;  2ALY A;  1PYS A;  3IKL A;  1X01 A;  2DDZ A;  4P75 C;  3NEM A;  3RF1 A;  5KNN A;  3R07 A;  3RKY A;  4YYE A;  4H2X A;  1WPY A;  1NJ1 A;  1ADY A;  4YRT A;  4LVM A;  3LC0 A;  3A7U A;  1RIQ A;  4O2D A;  1WQ7 A;  3MEY A;  4TWA A;  2ART A;  1E24 A;  4P74 C;  2ZR2 A;  3E9H A;  1EQR A;  2DTH A;  4YRC A;  3VQV A;  2A8E A;  4OP0 A;  3HXZ A;  4E51 A;  1B7Y B;  3MQZ A;  2ZT5 A;  4J15 A;  1KOG A;  1NYR A;  1WLE A;  2ZR3 A;  3HFZ B;  3HXW A;  3HXU A;  2ZNJ A;  2EJG A;  2DQ3 A;  3QNE A;  1E1T A;  4XEM A;  1USY A;  2AKW B;  4H2U A;  4RMF A;  3NET A;  2Q7E A;  4P71 A;  2CJA A;  2QHT A;  4LVK A;  3I7F A;  4P73 A;  2C7I A;  4KR2 A;  3LSS A;  2ZGW A;  2P0L A;  3M4Q A;  3TEH B;  3KFU A;  2EAY A;  2DQ0 A;  4XTV A;  4P3O A;  1H4S A;  1JJC A;  3REX A;  2QHU A;  2E41 A;  4K86 A;  4YRS A;  1NNH A;  3A32 A;  1E1O A;  2Q5I A;  4TVY A;  1USY C;  4YRK A;  3QO8 A;  4XTY A;  1JJC B;  4P71 C;  5HGQ A;  4HWR A;  2CJ9 A;  3A7A A;  3BFM A;  3A5Y A;  4KQE A;  4YRO A;  4XTW A;  4XTZ A;  4OLF A;  3A31 A;  4L87 A;  4TVW A;  2CIM A;  4YRG A;  3QTC A;  4KR3 A;  2E3C A;  2ZXF A;  4P75 A;  4CS2 A;  1EIY A;  2EWN A;  3UGQ A;  3DSQ A;  4WF2 A;  1HC7 A;  2PME A;  3UH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...