4P71C

Apo phers from p. aeuriginosa
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 62
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p71C01
1EIYB 3IKLA 3P8TA 1Z7MA 3LSSA 1X54A 3EFRA 3OD1A 4K88A 3QNEA 4RDXA 3VQXA 4YROA 4RMFA 2CGHA 11ASA 3R07A 4BWAA 1ASZA 3RKYA 1EVKA 2E5AA 4YRRA 3A74A 4AH6A 1WPYA 4CH5A 2QHUA 1B7YB 3RL6A 1EFWA 3ICAA 2EL9A 1KOGA 3MEYA 4YRLA 2DDZA 1G51A 1H4QA 2XGTA 4EO4A 1YGBA 3P8VA 4Q6GA 4BW9A 3PZCA 2DQ0A 3HXUA 4HWPA 1FYFA 4DQ2A 1B8AA 2ZXFA 2J3MA 2ZGWA 2RHSA 2PMEA 1J5WA 5K1PA 2DTHA 2ZR3A 2EJGA 2ARUA 1ASYA 1KMMA 3M4QA 4YRNA 4UP8A 4YRFA 1G5IA 4P75C 2P0LA 4YRJA 1X01A 3PCOA 3UGTA 3UH0A 4P72C 4UPAA 3REUA 2I4MA 4PHCA 2ARSA 2ZT6A 3MF1A 4XTYA 3QTCA 1WYDA 4CH4A 2EAYA 2P5IA 2G4CA 1USYC 2CIMA 1VQZA 4P3NA 2E65A 4YCWA 4OP0A 4HA8A 1BBWA 4XTZA 4YPFA 1W66A 3MF2A 4J15A 4UP9A 1X55A 1JJCB 4WJ4A 3HXXA 2ODRD 3L1AA 4TWAA 3A7AA 2E41A 2ZZFA 3FJPA 4CS2A 2AKWB 3KFUA 2I4NA 4K87A 1YB3A 3BJUA 1HXDA 4WF2A 3A7UA 3V7CA 3A5YA 4XTXA 4P75A 5F5WA 4WJ3M 4P72A 4E51A 1N9WA 1NJ2A 3NENA 4YREA 1B7YA 3IKMB 1NYRA 3I7FA 3BFMA 3LC0A 4XTVA 4YRPA 5C51B 4YRQA 1SETA 4ZIBA 4YRCA 4ZTUB 3QO5A 1B76A 4YRTA 1USYA 1WQ7A 3HXYA 1NJ8A 1PYSA 2RHQB 2DTIA 1BIBA 4CH6A 3A7RA 4XTWA 4P71C 3UGQA 3L2ZA 4OLFA 1PYSB 4XU2A 2Q5HA 2DZ9A 3RF1A 4KR3A 2CJBA 1E24A 4TQDA 1E1OA 2E64A 4H02A 4CS3A 4Q15A 3G1ZA 4YCUA 1YFSA 3HRKA 5KNNA 4YRKA 2ZNIA 3HY0A 4YRGA 2DXUA 4YCVA 3NEMA 1E1TA 3UFGA 3QO7A 3RIRA 2ZCEA 2Q7EA 4XU0A 2XTIA 4H2XB 3V8LA 4XU3A 2ZIMA 2ARTA 3HXZA 3HXWA 2DU7A 1QE0A 1BBUA 3RKWA 4YDQA 4XEOA 3TUPA 4ZTZB 2IY5A 2I4LA 3W3SA 4XEMA 3E9HA 1HTTA 1YFTA 2IY5B 4H2VA 3V8JA 3WQZA 1QF6A 2Q7HA 4P73C 4P71A 1IL2A 2CJ9A 4LNSA 1SERA 2DVEA 4G85A 3NELA 3RUXA 3TEGA 1JJCA 1ADJA 4P3PA 2ZNJA 4PG3A 4YRMA 1BIAA 2EWNA 3EFSA 2AKWA 1EQRA 3RKXA 1H4VB 4P3OA 2FYKA 4TVWA 4XU1A 3HFZB 4K86A 1KMNA 3VQWA 4CS4A 2ZT7A 3DSQA 3A31A 3QO8A 4H2TA 2C8MA 4H2WA 5C52B 4P74A 4RQFA 2J3LA 2Q7GA 3REXA 2ZR2A 2AMCB 4L87A 4UP7A 2CJAA 2QHTA 4HWTA 2ZT8A 1X2GA 3HTZA 2RHQA 4H2YA 1ADYA 1LYLA 4P73A 1C0AA 2ZINA 4RQEA 1X56A 1NJ5A 3TEHA 1WLEA 4EX5A 2Q5IA 2ODRC 4YP0A 1B70A 2ZZEA 3TEHB 4XTUA 1NNHA 2QHSA 3HXVA 1RIQA 3RGLA 3NETA 5E3IA 3V8KA 1NJ1A 1B70B 5K1XA 3A5ZA 12ASA 3HY1A 1YFRA 2E10A 4YRSA 4WI1A 2HNIA 2EJ9A 3HFVA 3E9IA 2DU5A 4YRIA 4HWSA 2DKGA 2ZZGA 3V7RA 3VQVA 3IG2A 2QHVA 2C7IA 1X2HA 3M4PA 4TVAA 4H2XA 3ERRA 1L0WA 4TQFA 2DQ3A 2E3CA 4TVAB 4KR2A 4P74C 1EVLA 3VQYA 4TTVA 2PMFA 1G5HA 2RHSB 4H2UA 1HC7A 5C53B 2ALYA 3P8YA 1H4SA 1WNLA 1H4TA 4NCXA 3RACA 3VBBA 1Z7NA 2ALYB 2ZIOA 1ATIA 4KQEA 3PCOB 2I4OA 3L4GA 1WU7A 4HVCA 2DTOA 3HFZA 1NJ6A 3L4GB 1E22A 4TVYA 5ELNA 3IALA 4H2SA 2ZT5A 4O2DA 3A32A 3HRIA 1EOVA 3CMQA 4CH3A 4DPGA 2DJZA 2EJFA 4G84A 2E1HA 2DEQA 4HWOA 5HGQA 5ELOA 1NYQA 3V7SA 2AMCA 1GGMA 2ZTGA 4HWRA 1SRYA 4YYEA 1EIYA 4X5OA 1SESA 3LSQA 1WQWA 2DZCA 2DXTA
chains in the Genus database with same CATH superfamily
1EIYB 3IKLA 3P8TA 1Z7MA 3LSSA 1X54A 3EFRA 3OD1A 4K88A 3QNEA 4RDXA 3VQXA 4YROA 4RMFA 2CGHA 11ASA 3R07A 4BWAA 1ASZA 3RKYA 1EVKA 2E5AA 4YRRA 3A74A 4AH6A 1WPYA 4CH5A 2QHUA 1B7YB 3RL6A 1EFWA 3ICAA 2EL9A 1KOGA 3MEYA 4YRLA 2DDZA 1G51A 1H4QA 2XGTA 4EO4A 1YGBA 3P8VA 4Q6GA 4BW9A 3PZCA 2DQ0A 3HXUA 4HWPA 1FYFA 4DQ2A 1B8AA 2ZXFA 2J3MA 2ZGWA 2RHSA 2A8EA 2PMEA 1J5WA 5K1PA 2DTHA 2ZR3A 2EJGA 4LVIA 2ARUA 1ASYA 1KMMA 3M4QA 4YRNA 4UP8A 4YRFA 1G5IA 4P75C 2P0LA 4YRJA 1X01A 3PCOA 3UGTA 3UH0A 4P72C 4UPAA 3REUA 2I4MA 4PHCA 2ARSA 2ZT6A 3MF1A 4XTYA 3QTCA 1WYDA 4CH4A 2EAYA 2P5IA 2G4CA 1USYC 2CIMA 1VQZA 4P3NA 2E65A 4YCWA 4OP0A 4HA8A 1BBWA 4XTZA 4YPFA 1W66A 3MF2A 4J15A 4UP9A 4LVMA 1X55A 1JJCB 4WJ4A 3HXXA 2ODRD 3L1AA 4TWAA 3A7AA 2E41A 2ZZFA 3FJPA 4CS2A 2AKWB 3KFUA 2I4NA 4K87A 1YB3A 3BJUA 1HXDA 4WF2A 3A7UA 3V7CA 3A5YA 4XTXA 4P75A 5F5WA 4WJ3M 4P72A 4E51A 1N9WA 1NJ2A 3NENA 4YREA 1B7YA 2NS6A 3IKMB 1NYRA 3I7FA 3BFMA 3LC0A 4XTVA 4YRPA 5C51B 4YRQA 1SETA 4ZIBA 4YRCA 4ZTUB 3QO5A 1B76A 4YRTA 1USYA 1WQ7A 3HXYA 4LVLA 1NJ8A 1PYSA 2RHQB 2DTIA 1BIBA 4CH6A 3A7RA 4LVKA 4XTWA 4P71C 3UGQA 3L2ZA 4OLFA 1PYSB 4XU2A 2Q5HA 2DZ9A 3RF1A 4KR3A 2CJBA 1E24A 4TQDA 1E1OA 2E64A 4H02A 4CS3A 4Q15A 3G1ZA 4YCUA 1YFSA 3HRKA 5KNNA 4YRKA 2ZNIA 3HY0A 4YRGA 2DXUA 4YCVA 3NEMA 1E1TA 3UFGA 3QO7A 3RIRA 2ZCEA 2Q7EA 4XU0A 2XTIA 4H2XB 3V8LA 4XU3A 2ZIMA 2ARTA 3HXZA 3HXWA 2DU7A 1QE0A 1BBUA 3RKWA 4YDQA 4XEOA 3TUPA 4ZTZB 2IY5A 2I4LA 3W3SA 4XEMA 3E9HA 1HTTA 1YFTA 2IY5B 4H2VA 3V8JA 3WQZA 1QF6A 2Q7HA 4P73C 4P71A 1IL2A 2CJ9A 4LNSA 1SERA 2DVEA 4G85A 3NELA 3RUXA 3TEGA 1JJCA 1ADJA 4P3PA 2ZNJA 4LVJA 4PG3A 4YRMA 1BIAA 2EWNA 3EFSA 2AKWA 1EQRA 3RKXA 1H4VB 4P3OA 2FYKA 4TVWA 4XU1A 3HFZB 4K86A 1KMNA 3VQWA 4CS4A 2ZT7A 3DSQA 3A31A 3QO8A 4H2TA 2C8MA 4H2WA 5C52B 4P74A 4RQFA 2J3LA 2Q7GA 3REXA 2ZR2A 2AMCB 4L87A 4UP7A 2CJAA 2QHTA 4HWTA 2ZT8A 1X2GA 3HTZA 2RHQA 4H2YA 1ADYA 1LYLA 4P73A 1C0AA 2ZINA 4RQEA 1X56A 1NJ5A 3TEHA 1WLEA 4EX5A 2Q5IA 2ODRC 4YP0A 1B70A 2ZZEA 3TEHB 4XTUA 1NNHA 2QHSA 3HXVA 1RIQA 3RGLA 3NETA 5E3IA 3V8KA 1NJ1A 1B70B 5K1XA 3A5ZA 12ASA 3HY1A 1YFRA 2E10A 4YRSA 4WI1A 2HNIA 2EJ9A 3HFVA 3E9IA 2DU5A 4YRIA 4HWSA 2DKGA 2ZZGA 3V7RA 3VQVA 3IG2A 2QHVA 2C7IA 1X2HA 3M4PA 4TVAA 4H2XA 3ERRA 1L0WA 4TQFA 2DQ3A 2E3CA 4TVAB 4KR2A 4P74C 1EVLA 3MQZA 3VQYA 4TTVA 2PMFA 1G5HA 2RHSB 4H2UA 1HC7A 5C53B 2ALYA 3P8YA 1H4SA 1WNLA 1H4TA 4NCXA 3RACA 3VBBA 1Z7NA 2ALYB 2ZIOA 1ATIA 4KQEA 3PCOB 2I4OA 3L4GA 1WU7A 4HVCA 2DTOA 3HFZA 1NJ6A 3L4GB 1E22A 4TVYA 5ELNA 3IALA 4H2SA 2ZT5A 4O2DA 3A32A 3HRIA 1EOVA 3CMQA 4HT4A 4CH3A 4DPGA 2DJZA 2EJFA 4G84A 2E1HA 2DEQA 4HWOA 5HGQA 5ELOA 1NYQA 3V7SA 2AMCA 1GGMA 2ZTGA 4HWRA 1SRYA 4YYEA 1EIYA 4X5OA 1SESA 3LSQA 1WQWA 2DZCA 2DXTA
chains in the Genus database with same CATH topology
1EIYB 3IKLA 3P8TA 1Z7MA 3LSSA 1X54A 3EFRA 3OD1A 4K88A 3QNEA 4RDXA 3VQXA 4YROA 4RMFA 2CGHA 11ASA 3R07A 4BWAA 1ASZA 3RKYA 1EVKA 2E5AA 4YRRA 3A74A 4AH6A 1WPYA 4CH5A 2QHUA 1B7YB 3RL6A 1EFWA 3ICAA 2EL9A 1KOGA 3MEYA 4YRLA 2DDZA 1G51A 1H4QA 2XGTA 4EO4A 1YGBA 3P8VA 4Q6GA 4BW9A 3PZCA 2DQ0A 3HXUA 4HWPA 1FYFA 4DQ2A 1B8AA 2ZXFA 2J3MA 2ZGWA 2RHSA 2A8EA 2PMEA 1J5WA 5K1PA 2DTHA 2ZR3A 2EJGA 4LVIA 2ARUA 1ASYA 1KMMA 3M4QA 4YRNA 4UP8A 4YRFA 1G5IA 4P75C 2P0LA 4YRJA 1X01A 3PCOA 3UGTA 3UH0A 4P72C 4UPAA 3REUA 2I4MA 4PHCA 2ARSA 2ZT6A 3MF1A 4XTYA 3QTCA 1WYDA 4CH4A 2EAYA 2P5IA 2G4CA 1USYC 2CIMA 1VQZA 4P3NA 2E65A 4YCWA 4OP0A 4HA8A 1BBWA 4XTZA 4YPFA 1W66A 3MF2A 4J15A 4UP9A 4LVMA 1X55A 1JJCB 4WJ4A 3HXXA 2ODRD 3L1AA 4TWAA 3A7AA 2E41A 2ZZFA 3FJPA 4CS2A 2AKWB 3KFUA 2I4NA 4K87A 1YB3A 3BJUA 1HXDA 4WF2A 3A7UA 3V7CA 3A5YA 4XTXA 4P75A 5F5WA 4WJ3M 4P72A 4E51A 1N9WA 1NJ2A 3NENA 4YREA 1B7YA 2NS6A 3IKMB 1NYRA 3I7FA 3BFMA 3LC0A 4XTVA 4YRPA 5C51B 4YRQA 1SETA 4ZIBA 4YRCA 4ZTUB 3QO5A 1B76A 4YRTA 1USYA 1WQ7A 3HXYA 4LVLA 1NJ8A 1PYSA 2RHQB 2DTIA 1BIBA 4CH6A 3A7RA 4LVKA 4XTWA 4P71C 3UGQA 3L2ZA 4OLFA 1PYSB 4XU2A 2Q5HA 2DZ9A 3RF1A 4KR3A 2CJBA 1E24A 4TQDA 1E1OA 2E64A 4H02A 4CS3A 4Q15A 3G1ZA 4YCUA 1YFSA 3HRKA 5KNNA 4YRKA 2ZNIA 3HY0A 4YRGA 2DXUA 4YCVA 3NEMA 1E1TA 3UFGA 3QO7A 3RIRA 2ZCEA 2Q7EA 4XU0A 2XTIA 4H2XB 3V8LA 4XU3A 2ZIMA 2ARTA 3HXZA 3HXWA 2DU7A 1QE0A 1BBUA 3RKWA 4YDQA 4XEOA 3TUPA 4ZTZB 2IY5A 2I4LA 3W3SA 4XEMA 3E9HA 1HTTA 1YFTA 2IY5B 4H2VA 3V8JA 3WQZA 1QF6A 2Q7HA 4P73C 4P71A 1IL2A 2CJ9A 4LNSA 1SERA 2DVEA 4G85A 3NELA 3RUXA 3TEGA 1JJCA 1ADJA 4P3PA 2ZNJA 4LVJA 4PG3A 4YRMA 1BIAA 2EWNA 3EFSA 2AKWA 1EQRA 3RKXA 1H4VB 4P3OA 2FYKA 4TVWA 4XU1A 3HFZB 4K86A 1KMNA 3VQWA 4CS4A 2ZT7A 3DSQA 3A31A 3QO8A 4H2TA 2C8MA 4H2WA 5C52B 4P74A 4RQFA 2J3LA 2Q7GA 3REXA 2ZR2A 2AMCB 4L87A 4UP7A 2CJAA 2QHTA 4HWTA 2ZT8A 1X2GA 3HTZA 2RHQA 4H2YA 1ADYA 1LYLA 4P73A 1C0AA 2ZINA 4RQEA 1X56A 1NJ5A 3TEHA 1WLEA 4EX5A 2Q5IA 2ODRC 4YP0A 1B70A 2ZZEA 3TEHB 4XTUA 1NNHA 2QHSA 3HXVA 1RIQA 3RGLA 3NETA 5E3IA 3V8KA 1NJ1A 1B70B 5K1XA 3A5ZA 12ASA 3HY1A 1YFRA 2E10A 4YRSA 4WI1A 2HNIA 2EJ9A 3HFVA 3E9IA 2DU5A 4YRIA 4HWSA 2DKGA 2ZZGA 3V7RA 3VQVA 3IG2A 2QHVA 2C7IA 1X2HA 3M4PA 4TVAA 4H2XA 3ERRA 1L0WA 4TQFA 2DQ3A 2E3CA 4TVAB 4KR2A 4P74C 1EVLA 3MQZA 3VQYA 4TTVA 2PMFA 1G5HA 2RHSB 4H2UA 1HC7A 5C53B 2ALYA 3P8YA 1H4SA 1WNLA 1H4TA 4NCXA 3RACA 3VBBA 1Z7NA 2ALYB 2ZIOA 1ATIA 4KQEA 3PCOB 2I4OA 3L4GA 1WU7A 4HVCA 2DTOA 3HFZA 1NJ6A 3L4GB 1E22A 4TVYA 5ELNA 3IALA 4H2SA 2ZT5A 4O2DA 3A32A 3HRIA 1EOVA 3CMQA 4HT4A 4CH3A 4DPGA 2DJZA 2EJFA 4G84A 2E1HA 2DEQA 4HWOA 5HGQA 5ELOA 1NYQA 3V7SA 2AMCA 1GGMA 2ZTGA 4HWRA 1SRYA 4YYEA 1EIYA 4X5OA 1SESA 3LSQA 1WQWA 2DZCA 2DXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIY B;  3IKL A;  3P8T A;  1Z7M A;  3LSS A;  1X54 A;  3EFR A;  3OD1 A;  4K88 A;  3QNE A;  4RDX A;  3VQX A;  4YRO A;  4RMF A;  2CGH A;  11AS A;  3R07 A;  4BWA A;  1ASZ A;  3RKY A;  1EVK A;  2E5A A;  4YRR A;  3A74 A;  4AH6 A;  1WPY A;  4CH5 A;  2QHU A;  1B7Y B;  3RL6 A;  1EFW A;  3ICA A;  2EL9 A;  1KOG A;  3MEY A;  4YRL A;  2DDZ A;  1G51 A;  1H4Q A;  2XGT A;  4EO4 A;  1YGB A;  3P8V A;  4Q6G A;  4BW9 A;  3PZC A;  2DQ0 A;  3HXU A;  4HWP A;  1FYF A;  4DQ2 A;  1B8A A;  2ZXF A;  2J3M A;  2ZGW A;  2RHS A;  2PME A;  1J5W A;  5K1P A;  2DTH A;  2ZR3 A;  2EJG A;  2ARU A;  1ASY A;  1KMM A;  3M4Q A;  4YRN A;  4UP8 A;  4YRF A;  1G5I A;  4P75 C;  2P0L A;  4YRJ A;  1X01 A;  3PCO A;  3UGT A;  3UH0 A;  4P72 C;  4UPA A;  3REU A;  2I4M A;  4PHC A;  2ARS A;  2ZT6 A;  3MF1 A;  4XTY A;  3QTC A;  1WYD A;  4CH4 A;  2EAY A;  2P5I A;  2G4C A;  1USY C;  2CIM A;  1VQZ A;  4P3N A;  2E65 A;  4YCW A;  4OP0 A;  4HA8 A;  1BBW A;  4XTZ A;  4YPF A;  1W66 A;  3MF2 A;  4J15 A;  4UP9 A;  1X55 A;  1JJC B;  4WJ4 A;  3HXX A;  2ODR D;  3L1A A;  4TWA A;  3A7A A;  2E41 A;  2ZZF A;  3FJP A;  4CS2 A;  2AKW B;  3KFU A;  2I4N A;  4K87 A;  1YB3 A;  3BJU A;  1HXD A;  4WF2 A;  3A7U A;  3V7C A;  3A5Y A;  4XTX A;  4P75 A;  5F5W A;  4WJ3 M;  4P72 A;  4E51 A;  1N9W A;  1NJ2 A;  3NEN A;  4YRE A;  1B7Y A;  3IKM B;  1NYR A;  3I7F A;  3BFM A;  3LC0 A;  4XTV A;  4YRP A;  5C51 B;  4YRQ A;  1SET A;  4ZIB A;  4YRC A;  4ZTU B;  3QO5 A;  1B76 A;  4YRT A;  1USY A;  1WQ7 A;  3HXY A;  1NJ8 A;  1PYS A;  2RHQ B;  2DTI A;  1BIB A;  4CH6 A;  3A7R A;  4XTW A;  4P71 C;  3UGQ A;  3L2Z A;  4OLF A;  1PYS B;  4XU2 A;  2Q5H A;  2DZ9 A;  3RF1 A;  4KR3 A;  2CJB A;  1E24 A;  4TQD A;  1E1O A;  2E64 A;  4H02 A;  4CS3 A;  4Q15 A;  3G1Z A;  4YCU A;  1YFS A;  3HRK A;  5KNN A;  4YRK A;  2ZNI A;  3HY0 A;  4YRG A;  2DXU A;  4YCV A;  3NEM A;  1E1T A;  3UFG A;  3QO7 A;  3RIR A;  2ZCE A;  2Q7E A;  4XU0 A;  2XTI A;  4H2X B;  3V8L A;  4XU3 A;  2ZIM A;  2ART A;  3HXZ A;  3HXW A;  2DU7 A;  1QE0 A;  1BBU A;  3RKW A;  4YDQ A;  4XEO A;  3TUP A;  4ZTZ B;  2IY5 A;  2I4L A;  3W3S A;  4XEM A;  3E9H A;  1HTT A;  1YFT A;  2IY5 B;  4H2V A;  3V8J A;  3WQZ A;  1QF6 A;  2Q7H A;  4P73 C;  4P71 A;  1IL2 A;  2CJ9 A;  4LNS A;  1SER A;  2DVE A;  4G85 A;  3NEL A;  3RUX A;  3TEG A;  1JJC A;  1ADJ A;  4P3P A;  2ZNJ A;  4PG3 A;  4YRM A;  1BIA A;  2EWN A;  3EFS A;  2AKW A;  1EQR A;  3RKX A;  1H4V B;  4P3O A;  2FYK A;  4TVW A;  4XU1 A;  3HFZ B;  4K86 A;  1KMN A;  3VQW A;  4CS4 A;  2ZT7 A;  3DSQ A;  3A31 A;  3QO8 A;  4H2T A;  2C8M A;  4H2W A;  5C52 B;  4P74 A;  4RQF A;  2J3L A;  2Q7G A;  3REX A;  2ZR2 A;  2AMC B;  4L87 A;  4UP7 A;  2CJA A;  2QHT A;  4HWT A;  2ZT8 A;  1X2G A;  3HTZ A;  2RHQ A;  4H2Y A;  1ADY A;  1LYL A;  4P73 A;  1C0A A;  2ZIN A;  4RQE A;  1X56 A;  1NJ5 A;  3TEH A;  1WLE A;  4EX5 A;  2Q5I A;  2ODR C;  4YP0 A;  1B70 A;  2ZZE A;  3TEH B;  4XTU A;  1NNH A;  2QHS A;  3HXV A;  1RIQ A;  3RGL A;  3NET A;  5E3I A;  3V8K A;  1NJ1 A;  1B70 B;  5K1X A;  3A5Z A;  12AS A;  3HY1 A;  1YFR A;  2E10 A;  4YRS A;  4WI1 A;  2HNI A;  2EJ9 A;  3HFV A;  3E9I A;  2DU5 A;  4YRI A;  4HWS A;  2DKG A;  2ZZG A;  3V7R A;  3VQV A;  3IG2 A;  2QHV A;  2C7I A;  1X2H A;  3M4P A;  4TVA A;  4H2X A;  3ERR A;  1L0W A;  4TQF A;  2DQ3 A;  2E3C A;  4TVA B;  4KR2 A;  4P74 C;  1EVL A;  3VQY A;  4TTV A;  2PMF A;  1G5H A;  2RHS B;  4H2U A;  1HC7 A;  5C53 B;  2ALY A;  3P8Y A;  1H4S A;  1WNL A;  1H4T A;  4NCX A;  3RAC A;  3VBB A;  1Z7N A;  2ALY B;  2ZIO A;  1ATI A;  4KQE A;  3PCO B;  2I4O A;  3L4G A;  1WU7 A;  4HVC A;  2DTO A;  3HFZ A;  1NJ6 A;  3L4G B;  1E22 A;  4TVY A;  5ELN A;  3IAL A;  4H2S A;  2ZT5 A;  4O2D A;  3A32 A;  3HRI A;  1EOV A;  3CMQ A;  4CH3 A;  4DPG A;  2DJZ A;  2EJF A;  4G84 A;  2E1H A;  2DEQ A;  4HWO A;  5HGQ A;  5ELO A;  1NYQ A;  3V7S A;  2AMC A;  1GGM A;  2ZTG A;  4HWR A;  1SRY A;  4YYE A;  1EIY A;  4X5O A;  1SES A;  3LSQ A;  1WQW A;  2DZC A;  2DXT A; 
#chains in the Genus database with same CATH topology
 1EIY B;  3IKL A;  3P8T A;  1Z7M A;  3LSS A;  1X54 A;  3EFR A;  3OD1 A;  4K88 A;  3QNE A;  4RDX A;  3VQX A;  4YRO A;  4RMF A;  2CGH A;  11AS A;  3R07 A;  4BWA A;  1ASZ A;  3RKY A;  1EVK A;  2E5A A;  4YRR A;  3A74 A;  4AH6 A;  1WPY A;  4CH5 A;  2QHU A;  1B7Y B;  3RL6 A;  1EFW A;  3ICA A;  2EL9 A;  1KOG A;  3MEY A;  4YRL A;  2DDZ A;  1G51 A;  1H4Q A;  2XGT A;  4EO4 A;  1YGB A;  3P8V A;  4Q6G A;  4BW9 A;  3PZC A;  2DQ0 A;  3HXU A;  4HWP A;  1FYF A;  4DQ2 A;  1B8A A;  2ZXF A;  2J3M A;  2ZGW A;  2RHS A;  2A8E A;  2PME A;  1J5W A;  5K1P A;  2DTH A;  2ZR3 A;  2EJG A;  4LVI A;  2ARU A;  1ASY A;  1KMM A;  3M4Q A;  4YRN A;  4UP8 A;  4YRF A;  1G5I A;  4P75 C;  2P0L A;  4YRJ A;  1X01 A;  3PCO A;  3UGT A;  3UH0 A;  4P72 C;  4UPA A;  3REU A;  2I4M A;  4PHC A;  2ARS A;  2ZT6 A;  3MF1 A;  4XTY A;  3QTC A;  1WYD A;  4CH4 A;  2EAY A;  2P5I A;  2G4C A;  1USY C;  2CIM A;  1VQZ A;  4P3N A;  2E65 A;  4YCW A;  4OP0 A;  4HA8 A;  1BBW A;  4XTZ A;  4YPF A;  1W66 A;  3MF2 A;  4J15 A;  4UP9 A;  4LVM A;  1X55 A;  1JJC B;  4WJ4 A;  3HXX A;  2ODR D;  3L1A A;  4TWA A;  3A7A A;  2E41 A;  2ZZF A;  3FJP A;  4CS2 A;  2AKW B;  3KFU A;  2I4N A;  4K87 A;  1YB3 A;  3BJU A;  1HXD A;  4WF2 A;  3A7U A;  3V7C A;  3A5Y A;  4XTX A;  4P75 A;  5F5W A;  4WJ3 M;  4P72 A;  4E51 A;  1N9W A;  1NJ2 A;  3NEN A;  4YRE A;  1B7Y A;  2NS6 A;  3IKM B;  1NYR A;  3I7F A;  3BFM A;  3LC0 A;  4XTV A;  4YRP A;  5C51 B;  4YRQ A;  1SET A;  4ZIB A;  4YRC A;  4ZTU B;  3QO5 A;  1B76 A;  4YRT A;  1USY A;  1WQ7 A;  3HXY A;  4LVL A;  1NJ8 A;  1PYS A;  2RHQ B;  2DTI A;  1BIB A;  4CH6 A;  3A7R A;  4LVK A;  4XTW A;  4P71 C;  3UGQ A;  3L2Z A;  4OLF A;  1PYS B;  4XU2 A;  2Q5H A;  2DZ9 A;  3RF1 A;  4KR3 A;  2CJB A;  1E24 A;  4TQD A;  1E1O A;  2E64 A;  4H02 A;  4CS3 A;  4Q15 A;  3G1Z A;  4YCU A;  1YFS A;  3HRK A;  5KNN A;  4YRK A;  2ZNI A;  3HY0 A;  4YRG A;  2DXU A;  4YCV A;  3NEM A;  1E1T A;  3UFG A;  3QO7 A;  3RIR A;  2ZCE A;  2Q7E A;  4XU0 A;  2XTI A;  4H2X B;  3V8L A;  4XU3 A;  2ZIM A;  2ART A;  3HXZ A;  3HXW A;  2DU7 A;  1QE0 A;  1BBU A;  3RKW A;  4YDQ A;  4XEO A;  3TUP A;  4ZTZ B;  2IY5 A;  2I4L A;  3W3S A;  4XEM A;  3E9H A;  1HTT A;  1YFT A;  2IY5 B;  4H2V A;  3V8J A;  3WQZ A;  1QF6 A;  2Q7H A;  4P73 C;  4P71 A;  1IL2 A;  2CJ9 A;  4LNS A;  1SER A;  2DVE A;  4G85 A;  3NEL A;  3RUX A;  3TEG A;  1JJC A;  1ADJ A;  4P3P A;  2ZNJ A;  4LVJ A;  4PG3 A;  4YRM A;  1BIA A;  2EWN A;  3EFS A;  2AKW A;  1EQR A;  3RKX A;  1H4V B;  4P3O A;  2FYK A;  4TVW A;  4XU1 A;  3HFZ B;  4K86 A;  1KMN A;  3VQW A;  4CS4 A;  2ZT7 A;  3DSQ A;  3A31 A;  3QO8 A;  4H2T A;  2C8M A;  4H2W A;  5C52 B;  4P74 A;  4RQF A;  2J3L A;  2Q7G A;  3REX A;  2ZR2 A;  2AMC B;  4L87 A;  4UP7 A;  2CJA A;  2QHT A;  4HWT A;  2ZT8 A;  1X2G A;  3HTZ A;  2RHQ A;  4H2Y A;  1ADY A;  1LYL A;  4P73 A;  1C0A A;  2ZIN A;  4RQE A;  1X56 A;  1NJ5 A;  3TEH A;  1WLE A;  4EX5 A;  2Q5I A;  2ODR C;  4YP0 A;  1B70 A;  2ZZE A;  3TEH B;  4XTU A;  1NNH A;  2QHS A;  3HXV A;  1RIQ A;  3RGL A;  3NET A;  5E3I A;  3V8K A;  1NJ1 A;  1B70 B;  5K1X A;  3A5Z A;  12AS A;  3HY1 A;  1YFR A;  2E10 A;  4YRS A;  4WI1 A;  2HNI A;  2EJ9 A;  3HFV A;  3E9I A;  2DU5 A;  4YRI A;  4HWS A;  2DKG A;  2ZZG A;  3V7R A;  3VQV A;  3IG2 A;  2QHV A;  2C7I A;  1X2H A;  3M4P A;  4TVA A;  4H2X A;  3ERR A;  1L0W A;  4TQF A;  2DQ3 A;  2E3C A;  4TVA B;  4KR2 A;  4P74 C;  1EVL A;  3MQZ A;  3VQY A;  4TTV A;  2PMF A;  1G5H A;  2RHS B;  4H2U A;  1HC7 A;  5C53 B;  2ALY A;  3P8Y A;  1H4S A;  1WNL A;  1H4T A;  4NCX A;  3RAC A;  3VBB A;  1Z7N A;  2ALY B;  2ZIO A;  1ATI A;  4KQE A;  3PCO B;  2I4O A;  3L4G A;  1WU7 A;  4HVC A;  2DTO A;  3HFZ A;  1NJ6 A;  3L4G B;  1E22 A;  4TVY A;  5ELN A;  3IAL A;  4H2S A;  2ZT5 A;  4O2D A;  3A32 A;  3HRI A;  1EOV A;  3CMQ A;  4HT4 A;  4CH3 A;  4DPG A;  2DJZ A;  2EJF A;  4G84 A;  2E1H A;  2DEQ A;  4HWO A;  5HGQ A;  5ELO A;  1NYQ A;  3V7S A;  2AMC A;  1GGM A;  2ZTG A;  4HWR A;  1SRY A;  4YYE A;  1EIY A;  4X5O A;  1SES A;  3LSQ A;  1WQW A;  2DZC A;  2DXT A; 
#chains in the Genus database with same CATH homology
 1EIY B;  3IKL A;  3P8T A;  1Z7M A;  3LSS A;  1X54 A;  3EFR A;  3OD1 A;  4K88 A;  3QNE A;  4RDX A;  3VQX A;  4YRO A;  4RMF A;  2CGH A;  11AS A;  3R07 A;  4BWA A;  1ASZ A;  3RKY A;  1EVK A;  2E5A A;  4YRR A;  3A74 A;  4AH6 A;  1WPY A;  4CH5 A;  2QHU A;  1B7Y B;  3RL6 A;  1EFW A;  3ICA A;  2EL9 A;  1KOG A;  3MEY A;  4YRL A;  2DDZ A;  1G51 A;  1H4Q A;  2XGT A;  4EO4 A;  1YGB A;  3P8V A;  4Q6G A;  4BW9 A;  3PZC A;  2DQ0 A;  3HXU A;  4HWP A;  1FYF A;  4DQ2 A;  1B8A A;  2ZXF A;  2J3M A;  2ZGW A;  2RHS A;  2A8E A;  2PME A;  1J5W A;  5K1P A;  2DTH A;  2ZR3 A;  2EJG A;  4LVI A;  2ARU A;  1ASY A;  1KMM A;  3M4Q A;  4YRN A;  4UP8 A;  4YRF A;  1G5I A;  4P75 C;  2P0L A;  4YRJ A;  1X01 A;  3PCO A;  3UGT A;  3UH0 A;  4P72 C;  4UPA A;  3REU A;  2I4M A;  4PHC A;  2ARS A;  2ZT6 A;  3MF1 A;  4XTY A;  3QTC A;  1WYD A;  4CH4 A;  2EAY A;  2P5I A;  2G4C A;  1USY C;  2CIM A;  1VQZ A;  4P3N A;  2E65 A;  4YCW A;  4OP0 A;  4HA8 A;  1BBW A;  4XTZ A;  4YPF A;  1W66 A;  3MF2 A;  4J15 A;  4UP9 A;  4LVM A;  1X55 A;  1JJC B;  4WJ4 A;  3HXX A;  2ODR D;  3L1A A;  4TWA A;  3A7A A;  2E41 A;  2ZZF A;  3FJP A;  4CS2 A;  2AKW B;  3KFU A;  2I4N A;  4K87 A;  1YB3 A;  3BJU A;  1HXD A;  4WF2 A;  3A7U A;  3V7C A;  3A5Y A;  4XTX A;  4P75 A;  5F5W A;  4WJ3 M;  4P72 A;  4E51 A;  1N9W A;  1NJ2 A;  3NEN A;  4YRE A;  1B7Y A;  2NS6 A;  3IKM B;  1NYR A;  3I7F A;  3BFM A;  3LC0 A;  4XTV A;  4YRP A;  5C51 B;  4YRQ A;  1SET A;  4ZIB A;  4YRC A;  4ZTU B;  3QO5 A;  1B76 A;  4YRT A;  1USY A;  1WQ7 A;  3HXY A;  4LVL A;  1NJ8 A;  1PYS A;  2RHQ B;  2DTI A;  1BIB A;  4CH6 A;  3A7R A;  4LVK A;  4XTW A;  4P71 C;  3UGQ A;  3L2Z A;  4OLF A;  1PYS B;  4XU2 A;  2Q5H A;  2DZ9 A;  3RF1 A;  4KR3 A;  2CJB A;  1E24 A;  4TQD A;  1E1O A;  2E64 A;  4H02 A;  4CS3 A;  4Q15 A;  3G1Z A;  4YCU A;  1YFS A;  3HRK A;  5KNN A;  4YRK A;  2ZNI A;  3HY0 A;  4YRG A;  2DXU A;  4YCV A;  3NEM A;  1E1T A;  3UFG A;  3QO7 A;  3RIR A;  2ZCE A;  2Q7E A;  4XU0 A;  2XTI A;  4H2X B;  3V8L A;  4XU3 A;  2ZIM A;  2ART A;  3HXZ A;  3HXW A;  2DU7 A;  1QE0 A;  1BBU A;  3RKW A;  4YDQ A;  4XEO A;  3TUP A;  4ZTZ B;  2IY5 A;  2I4L A;  3W3S A;  4XEM A;  3E9H A;  1HTT A;  1YFT A;  2IY5 B;  4H2V A;  3V8J A;  3WQZ A;  1QF6 A;  2Q7H A;  4P73 C;  4P71 A;  1IL2 A;  2CJ9 A;  4LNS A;  1SER A;  2DVE A;  4G85 A;  3NEL A;  3RUX A;  3TEG A;  1JJC A;  1ADJ A;  4P3P A;  2ZNJ A;  4LVJ A;  4PG3 A;  4YRM A;  1BIA A;  2EWN A;  3EFS A;  2AKW A;  1EQR A;  3RKX A;  1H4V B;  4P3O A;  2FYK A;  4TVW A;  4XU1 A;  3HFZ B;  4K86 A;  1KMN A;  3VQW A;  4CS4 A;  2ZT7 A;  3DSQ A;  3A31 A;  3QO8 A;  4H2T A;  2C8M A;  4H2W A;  5C52 B;  4P74 A;  4RQF A;  2J3L A;  2Q7G A;  3REX A;  2ZR2 A;  2AMC B;  4L87 A;  4UP7 A;  2CJA A;  2QHT A;  4HWT A;  2ZT8 A;  1X2G A;  3HTZ A;  2RHQ A;  4H2Y A;  1ADY A;  1LYL A;  4P73 A;  1C0A A;  2ZIN A;  4RQE A;  1X56 A;  1NJ5 A;  3TEH A;  1WLE A;  4EX5 A;  2Q5I A;  2ODR C;  4YP0 A;  1B70 A;  2ZZE A;  3TEH B;  4XTU A;  1NNH A;  2QHS A;  3HXV A;  1RIQ A;  3RGL A;  3NET A;  5E3I A;  3V8K A;  1NJ1 A;  1B70 B;  5K1X A;  3A5Z A;  12AS A;  3HY1 A;  1YFR A;  2E10 A;  4YRS A;  4WI1 A;  2HNI A;  2EJ9 A;  3HFV A;  3E9I A;  2DU5 A;  4YRI A;  4HWS A;  2DKG A;  2ZZG A;  3V7R A;  3VQV A;  3IG2 A;  2QHV A;  2C7I A;  1X2H A;  3M4P A;  4TVA A;  4H2X A;  3ERR A;  1L0W A;  4TQF A;  2DQ3 A;  2E3C A;  4TVA B;  4KR2 A;  4P74 C;  1EVL A;  3MQZ A;  3VQY A;  4TTV A;  2PMF A;  1G5H A;  2RHS B;  4H2U A;  1HC7 A;  5C53 B;  2ALY A;  3P8Y A;  1H4S A;  1WNL A;  1H4T A;  4NCX A;  3RAC A;  3VBB A;  1Z7N A;  2ALY B;  2ZIO A;  1ATI A;  4KQE A;  3PCO B;  2I4O A;  3L4G A;  1WU7 A;  4HVC A;  2DTO A;  3HFZ A;  1NJ6 A;  3L4G B;  1E22 A;  4TVY A;  5ELN A;  3IAL A;  4H2S A;  2ZT5 A;  4O2D A;  3A32 A;  3HRI A;  1EOV A;  3CMQ A;  4HT4 A;  4CH3 A;  4DPG A;  2DJZ A;  2EJF A;  4G84 A;  2E1H A;  2DEQ A;  4HWO A;  5HGQ A;  5ELO A;  1NYQ A;  3V7S A;  2AMC A;  1GGM A;  2ZTG A;  4HWR A;  1SRY A;  4YYE A;  1EIY A;  4X5O A;  1SES A;  3LSQ A;  1WQW A;  2DZC A;  2DXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...