4P71C

Apo phers from p. aeuriginosa
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylalanine--tRNA ligase beta subunit
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
total genus 62
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p71C01
3V8JA 2RHSB 3HFZA 3WQZA 2DVEA 3IKLA 4TVAB 2PMEA 4OP0A 3TEHB 4CH6A 1L0WA 2ODRD 5C51B 3BJUA 4XTUA 2ZZFA 4YRSA 2DJZA 4L87A 1X2HA 3A7AA 2CJ9A 4HA8A 2Q5IA 2ZNIA 5C52B 1Z7MA 1USYA 4P71C 1WQWA 4UP9A 1ATIA 5K1PA 3HRKA 1BBWA 4BW9A 3OD1A 2EAYA 4CH5A 1B7YB 3PZCA 1LYLA 3A31A 4H2WA 2ZGWA 1X54A 2C7IA 2DZ9A 3CMQA 3VQWA 2XGTA 1NYRA 1HC7A 1NNHA 4YRKA 2ARTA 4XTZA 1WNLA 1N9WA 3M4QA 4P73C 3RGLA 3PCOB 3V7RA 1NJ5A 1YFSA 1WPYA 2QHTA 2Q7EA 2ZCEA 2ARUA 1G51A 5KNNA 2EL9A 1JJCA 4H2UA 3RL6A 12ASA 4DQ2A 4P74C 2DKGA 3ICAA 3QNEA 4YRCA 3MF1A 5ELOA 4TWAA 4YRMA 2ZT7A 2RHSA 4YRNA 1Z7NA 4O2DA 4TVAA 4PHCA 1WLEA 3TEHA 2ZZEA 4UPAA 4TQDA 2RHQB 1EQRA 4H2SA 3UGQA 4HWOA 2QHUA 1EVKA 3BFMA 3EFSA 4WI1A 4X5OA 4HWTA 4YROA 2AMCA 2ALYB 4YRRA 2DQ3A 3A5ZA 4HWRA 3VQXA 2EJ9A 1G5HA 1J5WA 1H4TA 3HRIA 1WU7A 4WJ3M 3HXZA 1FYFA 3A74A 4P3PA 3RUXA 1EIYB 1RIQA 2Q7GA 1X2GA 4RQEA 4TTVA 4YRPA 1ADJA 4YREA 3P8VA 4YDQA 3RKWA 4K87A 4YPFA 4H2VA 4P72A 4YYEA 3MF2A 11ASA 2E65A 1B8AA 2CJAA 3VQYA 4H2YA 3A7UA 1GGMA 2DXTA 3R07A 3PCOA 4XU2A 2DTOA 3L4GB 3HXVA 1USYC 3REUA 1ASYA 4XEMA 2Q7HA 1E1OA 3W3SA 2DTHA 1E24A 4G85A 2ZIMA 2G4CA 4RMFA 3HXYA 1SERA 4YRLA 1E22A 2XTIA 2ZT6A 3TEGA 3DSQA 1B70B 4ZTZB 4YRJA 3TUPA 2DTIA 3UGTA 3QO7A 1NYQA 1B76A 3EFRA 2EJFA 4CS4A 1NJ2A 3RIRA 2AKWB 3HXXA 2ALYA 3QTCA 3MEYA 1YB3A 1W66A 1QE0A 3FJPA 2Q5HA 4K86A 5HGQA 2I4NA 4P73A 3A7RA 1EOVA 4RDXA 2I4LA 2ARSA 2CIMA 1EIYA 1ASZA 4UP8A 3V8LA 4J15A 4H2XB 1SRYA 2DU7A 2E1HA 3NEMA 3LSQA 5F5WA 4XTXA 1PYSB 2ZR2A 1KMMA 5C53B 4NCXA 1ADYA 2QHSA 1YGBA 2IY5B 4Q15A 4P75A 2I4MA 3L1AA 3A32A 3P8YA 3UFGA 4H2TA 4HVCA 1KMNA 3ERRA 3HXWA 4RQFA 3HY0A 3P8TA 4YCVA 1BIBA 3V7SA 1B7YA 2ZINA 4BWAA 3IG2A 4WF2A 1WYDA 4CH3A 4EX5A 1H4SA 4H02A 4YRGA 4AH6A 3VQVA 4XU1A 2E3CA 4XTYA 1B70A 4P72C 1NJ6A 3HY1A 3V7CA 1SETA 3M4PA 3V8KA 4KR3A 2ODRC 4YCWA 4YCUA 4G84A 1C0AA 2C8MA 1VQZA 4YRIA 2AKWA 3VBBA 2I4OA 5E3IA 2HNIA 3LSSA 2CJBA 2AMCB 4XU3A 4CS2A 4P71A 1BBUA 2EWNA 4TVYA 4PG3A 1HXDA 3G1ZA 3RKXA 4YP0A 1E1TA 2P5IA 3HXUA 3NETA 2ZT8A 4CS3A 3I7FA 4P3OA 4KQEA 2DDZA 4H2XA 3KFUA 4XU0A 4ZIBA 1X56A 4YRTA 3HFZB 1IL2A 1BIAA 3HFVA 2RHQA 2ZTGA 4KR2A 3RACA 2E41A 4LNSA 2DEQA 1PYSA 1NJ8A 2DZCA 4WJ4A 1H4VB 4TQFA 3E9HA 2IY5A 4DPGA 2DXUA 1YFTA 4XTVA 2E5AA 1WQ7A 2DU5A 5K1XA 1YFRA 3NELA 4XEOA 2J3MA 3RKYA 3QO5A 2ZZGA 2ZIOA 2DQ0A 2J3LA 2FYKA 3A5YA 2CGHA 4ZTUB 4P74A 3E9IA 5ELNA 4CH4A 4XTWA 1HTTA 3IKMB 4P3NA 2EJGA 2PMFA 3UH0A 1QF6A 4HWPA 4EO4A 1SESA 4YRFA 4TVWA 3HTZA 2ZR3A 3NENA 3L2ZA 1H4QA 3RF1A 3QO8A 1EVLA 1NJ1A 4OLFA 4P75C 3L4GA 2QHVA 2ZXFA 1KOGA 1EFWA 3IALA 3LC0A 3REXA 4HWSA 2P0LA 4Q6GA 1X55A 4K88A 1JJCB 2ZNJA 4E51A 4UP7A 1G5IA 2E10A 4YRQA 1X01A 2ZT5A 2E64A
chains in the Genus database with same CATH superfamily
3V8JA 2RHSB 3HFZA 3WQZA 2DVEA 3IKLA 4TVAB 2PMEA 4OP0A 3TEHB 4CH6A 1L0WA 2ODRD 5C51B 3BJUA 4XTUA 2ZZFA 3MQZA 4YRSA 2DJZA 4L87A 1X2HA 3A7AA 2CJ9A 4HA8A 2Q5IA 2ZNIA 4HT4A 5C52B 1Z7MA 1USYA 4P71C 1WQWA 4UP9A 1ATIA 5K1PA 3HRKA 1BBWA 4BW9A 3OD1A 2EAYA 4CH5A 1B7YB 3PZCA 1LYLA 3A31A 4H2WA 2ZGWA 1X54A 2C7IA 2DZ9A 3CMQA 3VQWA 2XGTA 1NYRA 1HC7A 1NNHA 4YRKA 2ARTA 4XTZA 1WNLA 1N9WA 3M4QA 4LVMA 4P73C 3RGLA 3PCOB 3V7RA 1NJ5A 1YFSA 1WPYA 2QHTA 2Q7EA 2ZCEA 2ARUA 1G51A 5KNNA 2EL9A 1JJCA 4H2UA 3RL6A 12ASA 4DQ2A 4P74C 2DKGA 3ICAA 3QNEA 4YRCA 3MF1A 5ELOA 4TWAA 4YRMA 2ZT7A 2RHSA 4YRNA 1Z7NA 4O2DA 4TVAA 4PHCA 1WLEA 3TEHA 2ZZEA 4UPAA 4TQDA 2RHQB 1EQRA 4H2SA 3UGQA 4HWOA 2QHUA 1EVKA 3BFMA 3EFSA 4WI1A 4X5OA 4HWTA 4YROA 2AMCA 2ALYB 4YRRA 2DQ3A 3A5ZA 4HWRA 3VQXA 2EJ9A 1G5HA 1J5WA 1H4TA 3HRIA 1WU7A 4WJ3M 3HXZA 4LVLA 1FYFA 3A74A 4P3PA 3RUXA 1EIYB 1RIQA 2A8EA 2Q7GA 1X2GA 4RQEA 4TTVA 4YRPA 1ADJA 4YREA 3P8VA 4YDQA 3RKWA 4K87A 4YPFA 4H2VA 4P72A 4YYEA 3MF2A 11ASA 2E65A 1B8AA 2CJAA 4LVIA 3VQYA 4H2YA 3A7UA 1GGMA 2DXTA 3R07A 3PCOA 4XU2A 2DTOA 3L4GB 3HXVA 1USYC 3REUA 1ASYA 4XEMA 2Q7HA 1E1OA 3W3SA 2DTHA 1E24A 4G85A 2ZIMA 2G4CA 4RMFA 3HXYA 1SERA 4YRLA 1E22A 2XTIA 2ZT6A 3TEGA 3DSQA 1B70B 4ZTZB 4YRJA 3TUPA 2DTIA 3UGTA 3QO7A 1NYQA 1B76A 3EFRA 2EJFA 4CS4A 1NJ2A 3RIRA 2AKWB 3HXXA 2ALYA 3QTCA 3MEYA 1YB3A 1W66A 1QE0A 3FJPA 2Q5HA 4K86A 5HGQA 2I4NA 4P73A 3A7RA 1EOVA 4RDXA 2I4LA 2ARSA 2CIMA 1EIYA 1ASZA 4UP8A 3V8LA 4J15A 4H2XB 1SRYA 2DU7A 2E1HA 3NEMA 3LSQA 5F5WA 4XTXA 1PYSB 2ZR2A 1KMMA 5C53B 4NCXA 1ADYA 2QHSA 1YGBA 2IY5B 4Q15A 4P75A 2I4MA 3L1AA 3A32A 3P8YA 3UFGA 4H2TA 4HVCA 1KMNA 3ERRA 3HXWA 4RQFA 3HY0A 3P8TA 4YCVA 1BIBA 3V7SA 1B7YA 2ZINA 4BWAA 3IG2A 4WF2A 1WYDA 4CH3A 4EX5A 1H4SA 4H02A 4YRGA 4AH6A 3VQVA 4XU1A 2E3CA 4XTYA 1B70A 4P72C 1NJ6A 3HY1A 3V7CA 1SETA 3M4PA 3V8KA 4KR3A 2ODRC 4LVKA 4YCWA 4YCUA 4G84A 1C0AA 2C8MA 1VQZA 4YRIA 2AKWA 3VBBA 2I4OA 5E3IA 2HNIA 3LSSA 2CJBA 2AMCB 4XU3A 4CS2A 4P71A 1BBUA 2EWNA 4TVYA 4PG3A 1HXDA 3G1ZA 3RKXA 4YP0A 1E1TA 2P5IA 3HXUA 3NETA 2ZT8A 4CS3A 3I7FA 4P3OA 4KQEA 2DDZA 4H2XA 3KFUA 4XU0A 4ZIBA 1X56A 4YRTA 3HFZB 1IL2A 1BIAA 3HFVA 2RHQA 2ZTGA 4KR2A 3RACA 2E41A 4LNSA 2DEQA 1PYSA 1NJ8A 2DZCA 4WJ4A 1H4VB 4TQFA 3E9HA 2IY5A 4DPGA 2DXUA 1YFTA 4XTVA 2E5AA 1WQ7A 2NS6A 2DU5A 5K1XA 1YFRA 3NELA 4XEOA 2J3MA 3RKYA 3QO5A 2ZZGA 2ZIOA 2DQ0A 2J3LA 2FYKA 3A5YA 2CGHA 4ZTUB 4P74A 3E9IA 5ELNA 4CH4A 4XTWA 4LVJA 1HTTA 3IKMB 4P3NA 2EJGA 2PMFA 3UH0A 1QF6A 4HWPA 4EO4A 1SESA 4YRFA 4TVWA 3HTZA 2ZR3A 3NENA 3L2ZA 1H4QA 3RF1A 3QO8A 1EVLA 1NJ1A 4OLFA 4P75C 3L4GA 2QHVA 2ZXFA 1KOGA 1EFWA 3IALA 3LC0A 3REXA 4HWSA 2P0LA 4Q6GA 1X55A 4K88A 1JJCB 2ZNJA 4E51A 4UP7A 1G5IA 2E10A 4YRQA 1X01A 2ZT5A 2E64A
chains in the Genus database with same CATH topology
3V8JA 2RHSB 3HFZA 3WQZA 2DVEA 3IKLA 4TVAB 2PMEA 4OP0A 3TEHB 4CH6A 1L0WA 2ODRD 5C51B 3BJUA 4XTUA 2ZZFA 3MQZA 4YRSA 2DJZA 4L87A 1X2HA 3A7AA 2CJ9A 4HA8A 2Q5IA 2ZNIA 4HT4A 5C52B 1Z7MA 1USYA 4P71C 1WQWA 4UP9A 1ATIA 5K1PA 3HRKA 1BBWA 4BW9A 3OD1A 2EAYA 4CH5A 1B7YB 3PZCA 1LYLA 3A31A 4H2WA 2ZGWA 1X54A 2C7IA 2DZ9A 3CMQA 3VQWA 2XGTA 1NYRA 1HC7A 1NNHA 4YRKA 2ARTA 4XTZA 1WNLA 1N9WA 3M4QA 4LVMA 4P73C 3RGLA 3PCOB 3V7RA 1NJ5A 1YFSA 1WPYA 2QHTA 2Q7EA 2ZCEA 2ARUA 1G51A 5KNNA 2EL9A 1JJCA 4H2UA 3RL6A 12ASA 4DQ2A 4P74C 2DKGA 3ICAA 3QNEA 4YRCA 3MF1A 5ELOA 4TWAA 4YRMA 2ZT7A 2RHSA 4YRNA 1Z7NA 4O2DA 4TVAA 4PHCA 1WLEA 3TEHA 2ZZEA 4UPAA 4TQDA 2RHQB 1EQRA 4H2SA 3UGQA 4HWOA 2QHUA 1EVKA 3BFMA 3EFSA 4WI1A 4X5OA 4HWTA 4YROA 2AMCA 2ALYB 4YRRA 2DQ3A 3A5ZA 4HWRA 3VQXA 2EJ9A 1G5HA 1J5WA 1H4TA 3HRIA 1WU7A 4WJ3M 3HXZA 4LVLA 1FYFA 3A74A 4P3PA 3RUXA 1EIYB 1RIQA 2A8EA 2Q7GA 1X2GA 4RQEA 4TTVA 4YRPA 1ADJA 4YREA 3P8VA 4YDQA 3RKWA 4K87A 4YPFA 4H2VA 4P72A 4YYEA 3MF2A 11ASA 2E65A 1B8AA 2CJAA 4LVIA 3VQYA 4H2YA 3A7UA 1GGMA 2DXTA 3R07A 3PCOA 4XU2A 2DTOA 3L4GB 3HXVA 1USYC 3REUA 1ASYA 4XEMA 2Q7HA 1E1OA 3W3SA 2DTHA 1E24A 4G85A 2ZIMA 2G4CA 4RMFA 3HXYA 1SERA 4YRLA 1E22A 2XTIA 2ZT6A 3TEGA 3DSQA 1B70B 4ZTZB 4YRJA 3TUPA 2DTIA 3UGTA 3QO7A 1NYQA 1B76A 3EFRA 2EJFA 4CS4A 1NJ2A 3RIRA 2AKWB 3HXXA 2ALYA 3QTCA 3MEYA 1YB3A 1W66A 1QE0A 3FJPA 2Q5HA 4K86A 5HGQA 2I4NA 4P73A 3A7RA 1EOVA 4RDXA 2I4LA 2ARSA 2CIMA 1EIYA 1ASZA 4UP8A 3V8LA 4J15A 4H2XB 1SRYA 2DU7A 2E1HA 3NEMA 3LSQA 5F5WA 4XTXA 1PYSB 2ZR2A 1KMMA 5C53B 4NCXA 1ADYA 2QHSA 1YGBA 2IY5B 4Q15A 4P75A 2I4MA 3L1AA 3A32A 3P8YA 3UFGA 4H2TA 4HVCA 1KMNA 3ERRA 3HXWA 4RQFA 3HY0A 3P8TA 4YCVA 1BIBA 3V7SA 1B7YA 2ZINA 4BWAA 3IG2A 4WF2A 1WYDA 4CH3A 4EX5A 1H4SA 4H02A 4YRGA 4AH6A 3VQVA 4XU1A 2E3CA 4XTYA 1B70A 4P72C 1NJ6A 3HY1A 3V7CA 1SETA 3M4PA 3V8KA 4KR3A 2ODRC 4LVKA 4YCWA 4YCUA 4G84A 1C0AA 2C8MA 1VQZA 4YRIA 2AKWA 3VBBA 2I4OA 5E3IA 2HNIA 3LSSA 2CJBA 2AMCB 4XU3A 4CS2A 4P71A 1BBUA 2EWNA 4TVYA 4PG3A 1HXDA 3G1ZA 3RKXA 4YP0A 1E1TA 2P5IA 3HXUA 3NETA 2ZT8A 4CS3A 3I7FA 4P3OA 4KQEA 2DDZA 4H2XA 3KFUA 4XU0A 4ZIBA 1X56A 4YRTA 3HFZB 1IL2A 1BIAA 3HFVA 2RHQA 2ZTGA 4KR2A 3RACA 2E41A 4LNSA 2DEQA 1PYSA 1NJ8A 2DZCA 4WJ4A 1H4VB 4TQFA 3E9HA 2IY5A 4DPGA 2DXUA 1YFTA 4XTVA 2E5AA 1WQ7A 2NS6A 2DU5A 5K1XA 1YFRA 3NELA 4XEOA 2J3MA 3RKYA 3QO5A 2ZZGA 2ZIOA 2DQ0A 2J3LA 2FYKA 3A5YA 2CGHA 4ZTUB 4P74A 3E9IA 5ELNA 4CH4A 4XTWA 4LVJA 1HTTA 3IKMB 4P3NA 2EJGA 2PMFA 3UH0A 1QF6A 4HWPA 4EO4A 1SESA 4YRFA 4TVWA 3HTZA 2ZR3A 3NENA 3L2ZA 1H4QA 3RF1A 3QO8A 1EVLA 1NJ1A 4OLFA 4P75C 3L4GA 2QHVA 2ZXFA 1KOGA 1EFWA 3IALA 3LC0A 3REXA 4HWSA 2P0LA 4Q6GA 1X55A 4K88A 1JJCB 2ZNJA 4E51A 4UP7A 1G5IA 2E10A 4YRQA 1X01A 2ZT5A 2E64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8J A;  2RHS B;  3HFZ A;  3WQZ A;  2DVE A;  3IKL A;  4TVA B;  2PME A;  4OP0 A;  3TEH B;  4CH6 A;  1L0W A;  2ODR D;  5C51 B;  3BJU A;  4XTU A;  2ZZF A;  4YRS A;  2DJZ A;  4L87 A;  1X2H A;  3A7A A;  2CJ9 A;  4HA8 A;  2Q5I A;  2ZNI A;  5C52 B;  1Z7M A;  1USY A;  4P71 C;  1WQW A;  4UP9 A;  1ATI A;  5K1P A;  3HRK A;  1BBW A;  4BW9 A;  3OD1 A;  2EAY A;  4CH5 A;  1B7Y B;  3PZC A;  1LYL A;  3A31 A;  4H2W A;  2ZGW A;  1X54 A;  2C7I A;  2DZ9 A;  3CMQ A;  3VQW A;  2XGT A;  1NYR A;  1HC7 A;  1NNH A;  4YRK A;  2ART A;  4XTZ A;  1WNL A;  1N9W A;  3M4Q A;  4P73 C;  3RGL A;  3PCO B;  3V7R A;  1NJ5 A;  1YFS A;  1WPY A;  2QHT A;  2Q7E A;  2ZCE A;  2ARU A;  1G51 A;  5KNN A;  2EL9 A;  1JJC A;  4H2U A;  3RL6 A;  12AS A;  4DQ2 A;  4P74 C;  2DKG A;  3ICA A;  3QNE A;  4YRC A;  3MF1 A;  5ELO A;  4TWA A;  4YRM A;  2ZT7 A;  2RHS A;  4YRN A;  1Z7N A;  4O2D A;  4TVA A;  4PHC A;  1WLE A;  3TEH A;  2ZZE A;  4UPA A;  4TQD A;  2RHQ B;  1EQR A;  4H2S A;  3UGQ A;  4HWO A;  2QHU A;  1EVK A;  3BFM A;  3EFS A;  4WI1 A;  4X5O A;  4HWT A;  4YRO A;  2AMC A;  2ALY B;  4YRR A;  2DQ3 A;  3A5Z A;  4HWR A;  3VQX A;  2EJ9 A;  1G5H A;  1J5W A;  1H4T A;  3HRI A;  1WU7 A;  4WJ3 M;  3HXZ A;  1FYF A;  3A74 A;  4P3P A;  3RUX A;  1EIY B;  1RIQ A;  2Q7G A;  1X2G A;  4RQE A;  4TTV A;  4YRP A;  1ADJ A;  4YRE A;  3P8V A;  4YDQ A;  3RKW A;  4K87 A;  4YPF A;  4H2V A;  4P72 A;  4YYE A;  3MF2 A;  11AS A;  2E65 A;  1B8A A;  2CJA A;  3VQY A;  4H2Y A;  3A7U A;  1GGM A;  2DXT A;  3R07 A;  3PCO A;  4XU2 A;  2DTO A;  3L4G B;  3HXV A;  1USY C;  3REU A;  1ASY A;  4XEM A;  2Q7H A;  1E1O A;  3W3S A;  2DTH A;  1E24 A;  4G85 A;  2ZIM A;  2G4C A;  4RMF A;  3HXY A;  1SER A;  4YRL A;  1E22 A;  2XTI A;  2ZT6 A;  3TEG A;  3DSQ A;  1B70 B;  4ZTZ B;  4YRJ A;  3TUP A;  2DTI A;  3UGT A;  3QO7 A;  1NYQ A;  1B76 A;  3EFR A;  2EJF A;  4CS4 A;  1NJ2 A;  3RIR A;  2AKW B;  3HXX A;  2ALY A;  3QTC A;  3MEY A;  1YB3 A;  1W66 A;  1QE0 A;  3FJP A;  2Q5H A;  4K86 A;  5HGQ A;  2I4N A;  4P73 A;  3A7R A;  1EOV A;  4RDX A;  2I4L A;  2ARS A;  2CIM A;  1EIY A;  1ASZ A;  4UP8 A;  3V8L A;  4J15 A;  4H2X B;  1SRY A;  2DU7 A;  2E1H A;  3NEM A;  3LSQ A;  5F5W A;  4XTX A;  1PYS B;  2ZR2 A;  1KMM A;  5C53 B;  4NCX A;  1ADY A;  2QHS A;  1YGB A;  2IY5 B;  4Q15 A;  4P75 A;  2I4M A;  3L1A A;  3A32 A;  3P8Y A;  3UFG A;  4H2T A;  4HVC A;  1KMN A;  3ERR A;  3HXW A;  4RQF A;  3HY0 A;  3P8T A;  4YCV A;  1BIB A;  3V7S A;  1B7Y A;  2ZIN A;  4BWA A;  3IG2 A;  4WF2 A;  1WYD A;  4CH3 A;  4EX5 A;  1H4S A;  4H02 A;  4YRG A;  4AH6 A;  3VQV A;  4XU1 A;  2E3C A;  4XTY A;  1B70 A;  4P72 C;  1NJ6 A;  3HY1 A;  3V7C A;  1SET A;  3M4P A;  3V8K A;  4KR3 A;  2ODR C;  4YCW A;  4YCU A;  4G84 A;  1C0A A;  2C8M A;  1VQZ A;  4YRI A;  2AKW A;  3VBB A;  2I4O A;  5E3I A;  2HNI A;  3LSS A;  2CJB A;  2AMC B;  4XU3 A;  4CS2 A;  4P71 A;  1BBU A;  2EWN A;  4TVY A;  4PG3 A;  1HXD A;  3G1Z A;  3RKX A;  4YP0 A;  1E1T A;  2P5I A;  3HXU A;  3NET A;  2ZT8 A;  4CS3 A;  3I7F A;  4P3O A;  4KQE A;  2DDZ A;  4H2X A;  3KFU A;  4XU0 A;  4ZIB A;  1X56 A;  4YRT A;  3HFZ B;  1IL2 A;  1BIA A;  3HFV A;  2RHQ A;  2ZTG A;  4KR2 A;  3RAC A;  2E41 A;  4LNS A;  2DEQ A;  1PYS A;  1NJ8 A;  2DZC A;  4WJ4 A;  1H4V B;  4TQF A;  3E9H A;  2IY5 A;  4DPG A;  2DXU A;  1YFT A;  4XTV A;  2E5A A;  1WQ7 A;  2DU5 A;  5K1X A;  1YFR A;  3NEL A;  4XEO A;  2J3M A;  3RKY A;  3QO5 A;  2ZZG A;  2ZIO A;  2DQ0 A;  2J3L A;  2FYK A;  3A5Y A;  2CGH A;  4ZTU B;  4P74 A;  3E9I A;  5ELN A;  4CH4 A;  4XTW A;  1HTT A;  3IKM B;  4P3N A;  2EJG A;  2PMF A;  3UH0 A;  1QF6 A;  4HWP A;  4EO4 A;  1SES A;  4YRF A;  4TVW A;  3HTZ A;  2ZR3 A;  3NEN A;  3L2Z A;  1H4Q A;  3RF1 A;  3QO8 A;  1EVL A;  1NJ1 A;  4OLF A;  4P75 C;  3L4G A;  2QHV A;  2ZXF A;  1KOG A;  1EFW A;  3IAL A;  3LC0 A;  3REX A;  4HWS A;  2P0L A;  4Q6G A;  1X55 A;  4K88 A;  1JJC B;  2ZNJ A;  4E51 A;  4UP7 A;  1G5I A;  2E10 A;  4YRQ A;  1X01 A;  2ZT5 A;  2E64 A; 
#chains in the Genus database with same CATH topology
 3V8J A;  2RHS B;  3HFZ A;  3WQZ A;  2DVE A;  3IKL A;  4TVA B;  2PME A;  4OP0 A;  3TEH B;  4CH6 A;  1L0W A;  2ODR D;  5C51 B;  3BJU A;  4XTU A;  2ZZF A;  3MQZ A;  4YRS A;  2DJZ A;  4L87 A;  1X2H A;  3A7A A;  2CJ9 A;  4HA8 A;  2Q5I A;  2ZNI A;  4HT4 A;  5C52 B;  1Z7M A;  1USY A;  4P71 C;  1WQW A;  4UP9 A;  1ATI A;  5K1P A;  3HRK A;  1BBW A;  4BW9 A;  3OD1 A;  2EAY A;  4CH5 A;  1B7Y B;  3PZC A;  1LYL A;  3A31 A;  4H2W A;  2ZGW A;  1X54 A;  2C7I A;  2DZ9 A;  3CMQ A;  3VQW A;  2XGT A;  1NYR A;  1HC7 A;  1NNH A;  4YRK A;  2ART A;  4XTZ A;  1WNL A;  1N9W A;  3M4Q A;  4LVM A;  4P73 C;  3RGL A;  3PCO B;  3V7R A;  1NJ5 A;  1YFS A;  1WPY A;  2QHT A;  2Q7E A;  2ZCE A;  2ARU A;  1G51 A;  5KNN A;  2EL9 A;  1JJC A;  4H2U A;  3RL6 A;  12AS A;  4DQ2 A;  4P74 C;  2DKG A;  3ICA A;  3QNE A;  4YRC A;  3MF1 A;  5ELO A;  4TWA A;  4YRM A;  2ZT7 A;  2RHS A;  4YRN A;  1Z7N A;  4O2D A;  4TVA A;  4PHC A;  1WLE A;  3TEH A;  2ZZE A;  4UPA A;  4TQD A;  2RHQ B;  1EQR A;  4H2S A;  3UGQ A;  4HWO A;  2QHU A;  1EVK A;  3BFM A;  3EFS A;  4WI1 A;  4X5O A;  4HWT A;  4YRO A;  2AMC A;  2ALY B;  4YRR A;  2DQ3 A;  3A5Z A;  4HWR A;  3VQX A;  2EJ9 A;  1G5H A;  1J5W A;  1H4T A;  3HRI A;  1WU7 A;  4WJ3 M;  3HXZ A;  4LVL A;  1FYF A;  3A74 A;  4P3P A;  3RUX A;  1EIY B;  1RIQ A;  2A8E A;  2Q7G A;  1X2G A;  4RQE A;  4TTV A;  4YRP A;  1ADJ A;  4YRE A;  3P8V A;  4YDQ A;  3RKW A;  4K87 A;  4YPF A;  4H2V A;  4P72 A;  4YYE A;  3MF2 A;  11AS A;  2E65 A;  1B8A A;  2CJA A;  4LVI A;  3VQY A;  4H2Y A;  3A7U A;  1GGM A;  2DXT A;  3R07 A;  3PCO A;  4XU2 A;  2DTO A;  3L4G B;  3HXV A;  1USY C;  3REU A;  1ASY A;  4XEM A;  2Q7H A;  1E1O A;  3W3S A;  2DTH A;  1E24 A;  4G85 A;  2ZIM A;  2G4C A;  4RMF A;  3HXY A;  1SER A;  4YRL A;  1E22 A;  2XTI A;  2ZT6 A;  3TEG A;  3DSQ A;  1B70 B;  4ZTZ B;  4YRJ A;  3TUP A;  2DTI A;  3UGT A;  3QO7 A;  1NYQ A;  1B76 A;  3EFR A;  2EJF A;  4CS4 A;  1NJ2 A;  3RIR A;  2AKW B;  3HXX A;  2ALY A;  3QTC A;  3MEY A;  1YB3 A;  1W66 A;  1QE0 A;  3FJP A;  2Q5H A;  4K86 A;  5HGQ A;  2I4N A;  4P73 A;  3A7R A;  1EOV A;  4RDX A;  2I4L A;  2ARS A;  2CIM A;  1EIY A;  1ASZ A;  4UP8 A;  3V8L A;  4J15 A;  4H2X B;  1SRY A;  2DU7 A;  2E1H A;  3NEM A;  3LSQ A;  5F5W A;  4XTX A;  1PYS B;  2ZR2 A;  1KMM A;  5C53 B;  4NCX A;  1ADY A;  2QHS A;  1YGB A;  2IY5 B;  4Q15 A;  4P75 A;  2I4M A;  3L1A A;  3A32 A;  3P8Y A;  3UFG A;  4H2T A;  4HVC A;  1KMN A;  3ERR A;  3HXW A;  4RQF A;  3HY0 A;  3P8T A;  4YCV A;  1BIB A;  3V7S A;  1B7Y A;  2ZIN A;  4BWA A;  3IG2 A;  4WF2 A;  1WYD A;  4CH3 A;  4EX5 A;  1H4S A;  4H02 A;  4YRG A;  4AH6 A;  3VQV A;  4XU1 A;  2E3C A;  4XTY A;  1B70 A;  4P72 C;  1NJ6 A;  3HY1 A;  3V7C A;  1SET A;  3M4P A;  3V8K A;  4KR3 A;  2ODR C;  4LVK A;  4YCW A;  4YCU A;  4G84 A;  1C0A A;  2C8M A;  1VQZ A;  4YRI A;  2AKW A;  3VBB A;  2I4O A;  5E3I A;  2HNI A;  3LSS A;  2CJB A;  2AMC B;  4XU3 A;  4CS2 A;  4P71 A;  1BBU A;  2EWN A;  4TVY A;  4PG3 A;  1HXD A;  3G1Z A;  3RKX A;  4YP0 A;  1E1T A;  2P5I A;  3HXU A;  3NET A;  2ZT8 A;  4CS3 A;  3I7F A;  4P3O A;  4KQE A;  2DDZ A;  4H2X A;  3KFU A;  4XU0 A;  4ZIB A;  1X56 A;  4YRT A;  3HFZ B;  1IL2 A;  1BIA A;  3HFV A;  2RHQ A;  2ZTG A;  4KR2 A;  3RAC A;  2E41 A;  4LNS A;  2DEQ A;  1PYS A;  1NJ8 A;  2DZC A;  4WJ4 A;  1H4V B;  4TQF A;  3E9H A;  2IY5 A;  4DPG A;  2DXU A;  1YFT A;  4XTV A;  2E5A A;  1WQ7 A;  2NS6 A;  2DU5 A;  5K1X A;  1YFR A;  3NEL A;  4XEO A;  2J3M A;  3RKY A;  3QO5 A;  2ZZG A;  2ZIO A;  2DQ0 A;  2J3L A;  2FYK A;  3A5Y A;  2CGH A;  4ZTU B;  4P74 A;  3E9I A;  5ELN A;  4CH4 A;  4XTW A;  4LVJ A;  1HTT A;  3IKM B;  4P3N A;  2EJG A;  2PMF A;  3UH0 A;  1QF6 A;  4HWP A;  4EO4 A;  1SES A;  4YRF A;  4TVW A;  3HTZ A;  2ZR3 A;  3NEN A;  3L2Z A;  1H4Q A;  3RF1 A;  3QO8 A;  1EVL A;  1NJ1 A;  4OLF A;  4P75 C;  3L4G A;  2QHV A;  2ZXF A;  1KOG A;  1EFW A;  3IAL A;  3LC0 A;  3REX A;  4HWS A;  2P0L A;  4Q6G A;  1X55 A;  4K88 A;  1JJC B;  2ZNJ A;  4E51 A;  4UP7 A;  1G5I A;  2E10 A;  4YRQ A;  1X01 A;  2ZT5 A;  2E64 A; 
#chains in the Genus database with same CATH homology
 3V8J A;  2RHS B;  3HFZ A;  3WQZ A;  2DVE A;  3IKL A;  4TVA B;  2PME A;  4OP0 A;  3TEH B;  4CH6 A;  1L0W A;  2ODR D;  5C51 B;  3BJU A;  4XTU A;  2ZZF A;  3MQZ A;  4YRS A;  2DJZ A;  4L87 A;  1X2H A;  3A7A A;  2CJ9 A;  4HA8 A;  2Q5I A;  2ZNI A;  4HT4 A;  5C52 B;  1Z7M A;  1USY A;  4P71 C;  1WQW A;  4UP9 A;  1ATI A;  5K1P A;  3HRK A;  1BBW A;  4BW9 A;  3OD1 A;  2EAY A;  4CH5 A;  1B7Y B;  3PZC A;  1LYL A;  3A31 A;  4H2W A;  2ZGW A;  1X54 A;  2C7I A;  2DZ9 A;  3CMQ A;  3VQW A;  2XGT A;  1NYR A;  1HC7 A;  1NNH A;  4YRK A;  2ART A;  4XTZ A;  1WNL A;  1N9W A;  3M4Q A;  4LVM A;  4P73 C;  3RGL A;  3PCO B;  3V7R A;  1NJ5 A;  1YFS A;  1WPY A;  2QHT A;  2Q7E A;  2ZCE A;  2ARU A;  1G51 A;  5KNN A;  2EL9 A;  1JJC A;  4H2U A;  3RL6 A;  12AS A;  4DQ2 A;  4P74 C;  2DKG A;  3ICA A;  3QNE A;  4YRC A;  3MF1 A;  5ELO A;  4TWA A;  4YRM A;  2ZT7 A;  2RHS A;  4YRN A;  1Z7N A;  4O2D A;  4TVA A;  4PHC A;  1WLE A;  3TEH A;  2ZZE A;  4UPA A;  4TQD A;  2RHQ B;  1EQR A;  4H2S A;  3UGQ A;  4HWO A;  2QHU A;  1EVK A;  3BFM A;  3EFS A;  4WI1 A;  4X5O A;  4HWT A;  4YRO A;  2AMC A;  2ALY B;  4YRR A;  2DQ3 A;  3A5Z A;  4HWR A;  3VQX A;  2EJ9 A;  1G5H A;  1J5W A;  1H4T A;  3HRI A;  1WU7 A;  4WJ3 M;  3HXZ A;  4LVL A;  1FYF A;  3A74 A;  4P3P A;  3RUX A;  1EIY B;  1RIQ A;  2A8E A;  2Q7G A;  1X2G A;  4RQE A;  4TTV A;  4YRP A;  1ADJ A;  4YRE A;  3P8V A;  4YDQ A;  3RKW A;  4K87 A;  4YPF A;  4H2V A;  4P72 A;  4YYE A;  3MF2 A;  11AS A;  2E65 A;  1B8A A;  2CJA A;  4LVI A;  3VQY A;  4H2Y A;  3A7U A;  1GGM A;  2DXT A;  3R07 A;  3PCO A;  4XU2 A;  2DTO A;  3L4G B;  3HXV A;  1USY C;  3REU A;  1ASY A;  4XEM A;  2Q7H A;  1E1O A;  3W3S A;  2DTH A;  1E24 A;  4G85 A;  2ZIM A;  2G4C A;  4RMF A;  3HXY A;  1SER A;  4YRL A;  1E22 A;  2XTI A;  2ZT6 A;  3TEG A;  3DSQ A;  1B70 B;  4ZTZ B;  4YRJ A;  3TUP A;  2DTI A;  3UGT A;  3QO7 A;  1NYQ A;  1B76 A;  3EFR A;  2EJF A;  4CS4 A;  1NJ2 A;  3RIR A;  2AKW B;  3HXX A;  2ALY A;  3QTC A;  3MEY A;  1YB3 A;  1W66 A;  1QE0 A;  3FJP A;  2Q5H A;  4K86 A;  5HGQ A;  2I4N A;  4P73 A;  3A7R A;  1EOV A;  4RDX A;  2I4L A;  2ARS A;  2CIM A;  1EIY A;  1ASZ A;  4UP8 A;  3V8L A;  4J15 A;  4H2X B;  1SRY A;  2DU7 A;  2E1H A;  3NEM A;  3LSQ A;  5F5W A;  4XTX A;  1PYS B;  2ZR2 A;  1KMM A;  5C53 B;  4NCX A;  1ADY A;  2QHS A;  1YGB A;  2IY5 B;  4Q15 A;  4P75 A;  2I4M A;  3L1A A;  3A32 A;  3P8Y A;  3UFG A;  4H2T A;  4HVC A;  1KMN A;  3ERR A;  3HXW A;  4RQF A;  3HY0 A;  3P8T A;  4YCV A;  1BIB A;  3V7S A;  1B7Y A;  2ZIN A;  4BWA A;  3IG2 A;  4WF2 A;  1WYD A;  4CH3 A;  4EX5 A;  1H4S A;  4H02 A;  4YRG A;  4AH6 A;  3VQV A;  4XU1 A;  2E3C A;  4XTY A;  1B70 A;  4P72 C;  1NJ6 A;  3HY1 A;  3V7C A;  1SET A;  3M4P A;  3V8K A;  4KR3 A;  2ODR C;  4LVK A;  4YCW A;  4YCU A;  4G84 A;  1C0A A;  2C8M A;  1VQZ A;  4YRI A;  2AKW A;  3VBB A;  2I4O A;  5E3I A;  2HNI A;  3LSS A;  2CJB A;  2AMC B;  4XU3 A;  4CS2 A;  4P71 A;  1BBU A;  2EWN A;  4TVY A;  4PG3 A;  1HXD A;  3G1Z A;  3RKX A;  4YP0 A;  1E1T A;  2P5I A;  3HXU A;  3NET A;  2ZT8 A;  4CS3 A;  3I7F A;  4P3O A;  4KQE A;  2DDZ A;  4H2X A;  3KFU A;  4XU0 A;  4ZIB A;  1X56 A;  4YRT A;  3HFZ B;  1IL2 A;  1BIA A;  3HFV A;  2RHQ A;  2ZTG A;  4KR2 A;  3RAC A;  2E41 A;  4LNS A;  2DEQ A;  1PYS A;  1NJ8 A;  2DZC A;  4WJ4 A;  1H4V B;  4TQF A;  3E9H A;  2IY5 A;  4DPG A;  2DXU A;  1YFT A;  4XTV A;  2E5A A;  1WQ7 A;  2NS6 A;  2DU5 A;  5K1X A;  1YFR A;  3NEL A;  4XEO A;  2J3M A;  3RKY A;  3QO5 A;  2ZZG A;  2ZIO A;  2DQ0 A;  2J3L A;  2FYK A;  3A5Y A;  2CGH A;  4ZTU B;  4P74 A;  3E9I A;  5ELN A;  4CH4 A;  4XTW A;  4LVJ A;  1HTT A;  3IKM B;  4P3N A;  2EJG A;  2PMF A;  3UH0 A;  1QF6 A;  4HWP A;  4EO4 A;  1SES A;  4YRF A;  4TVW A;  3HTZ A;  2ZR3 A;  3NEN A;  3L2Z A;  1H4Q A;  3RF1 A;  3QO8 A;  1EVL A;  1NJ1 A;  4OLF A;  4P75 C;  3L4G A;  2QHV A;  2ZXF A;  1KOG A;  1EFW A;  3IAL A;  3LC0 A;  3REX A;  4HWS A;  2P0L A;  4Q6G A;  1X55 A;  4K88 A;  1JJC B;  2ZNJ A;  4E51 A;  4UP7 A;  1G5I A;  2E10 A;  4YRQ A;  1X01 A;  2ZT5 A;  2E64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...