4P71C

Apo phers from p. aeuriginosa
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
251
structure length
239
Chain Sequence
AAERIDVTLPGRGQLSGGLHPVTRTLERIEQCFSRIGYEVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMESQQPPIRIVCPGRVYRCDSDLTHSPMFHQVEGLLVDEGVSFADLKGTIEEFLRAFFEKQLEVRFRPSFFPFTEPSAEVDIQCQTGWLEVMGCGMVHPNVLRMSNIDPEKFQGFAFGMGAERLAMLRYGVNDLRLFFDNDLRFLGQFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of a novel auxiliary pocket in bacterial phenylalanyl-tRNA synthetase druggability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Ligase
molecule keywords Phenylalanine--tRNA ligase beta subunit
total genus 62
structure length 239
sequence length 251
chains with identical sequence D
ec nomenclature ec 6.1.1.20: Phenylalanine--tRNA ligase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4p71C01
4YRRA 1NJ8A 4AH6A 2DQ0A 4YP0A 3PZCA 2DVEA 4G85A 3G1ZA 1PYSB 4P3NA 2QHTA 3RUXA 2DDZA 2FYKA 2ODRC 2CIMA 3HTZA 4XU2A 4XEOA 3V8KA 4XTXA 1KMMA 1B7YB 5E3IA 2DTHA 4H2XB 4TTVA 4RMFA 4CH5A 3A32A 2Q7EA 1BIBA 2HNIA 3P8YA 4YRKA 3RIRA 2DXUA 2RHQB 4ZTZB 4ZTUB 1JJCB 3ICAA 2DQ3A 4NCXA 3UGTA 2AMCB 3OD1A 4YCWA 2DZCA 4P71A 1NJ5A 1C0AA 2DU5A 1BBWA 3TEGA 1WU7A 1N9WA 3UGQA 1NNHA 2ODRD 3HFZB 4RQFA 4YRJA 4YCVA 1HTTA 2I4OA 4P74C 4P3OA 2ZGWA 4P72C 3FJPA 2RHQA 1EVKA 3A7AA 1W66A 3LSSA 4H2TA 2I4LA 1G51A 1X2HA 3RF1A 2IY5B 3VQWA 4P75C 4UPAA 3L4GB 3V7CA 3A7RA 4YRNA 1KOGA 1ATIA 4KQEA 3REUA 4BW9A 4YRIA 1QF6A 1KMNA 4HWTA 1E24A 2ARTA 4XTYA 2I4MA 4H02A 2ZNJA 2E65A 3LSQA 4H2SA 4K88A 1X2GA 5ELNA 1JJCA 1H4TA 2E1HA 2ZT6A 4YREA 2ZNIA 1ADJA 2EAYA 3DSQA 4XTWA 4UP7A 3A31A 4H2XA 4RDXA 4HVCA 3RKYA 4HWPA 4RQEA 4YCUA 3W3SA 2CJ9A 5K1PA 3A5YA 3HXXA 1YGBA 3MF1A 3BJUA 3M4PA 1Z7MA 4J15A 3BFMA 1WNLA 2ZIMA 4H2UA 3A7UA 2J3MA 4CH3A 4PHCA 4TVAA 2EJ9A 4P73C 1H4VB 4XU1A 1NJ1A 3E9IA 4YYEA 3R07A 3V8LA 3QO8A 3M4QA 1IL2A 2DU7A 3NETA 4DQ2A 4HA8A 2C7IA 3HRKA 1USYA 2QHVA 4HWSA 3MEYA 1QE0A 4H2WA 4Q6GA 3NELA 1NYRA 3NENA 2ZR3A 2Q7GA 2EL9A 3RKWA 4DPGA 4EO4A 4TVWA 1E22A 4KR3A 2ZZEA 3IG2A 4HWOA 1YFSA 3RL6A 4UP9A 2DKGA 3IKLA 3V7SA 3TUPA 2PMEA 4PG3A 1YFRA 3L4GA 4K86A 4YRPA 3UFGA 4P74A 1WQWA 4X5OA 3REXA 3KFUA 1X55A 4LNSA 4P72A 4CS3A 1PYSA 2DTIA 1EIYA 3UH0A 1G5IA 3HY1A 2Q5HA 3L2ZA 1RIQA 3HRIA 4G84A 3WQZA 1GGMA 4YPFA 3EFRA 3V7RA 5C51B 2J3LA 3PCOA 2ARUA 2XTIA 1G5HA 1ASZA 1WLEA 2DJZA 2RHSA 1B70B 1EOVA 2AKWA 1LYLA 1E1OA 3QO7A 4EX5A 1NYQA 3HFZA 5KNNA 2DEQA 3NEMA 3I7FA 5ELOA 1YB3A 2CJAA 3ERRA 1YFTA 3HY0A 2ZZGA 2PMFA 4YRTA 2AMCA 2ZCEA 1HC7A 1J5WA 1H4SA 4YDQA 4Q15A 2QHSA 3HXZA 4XEMA 2DXTA 4ZIBA 5K1XA 3IALA 3EFSA 2E64A 4YRLA 1B7YA 3RKXA 2ZZFA 1EFWA 1FYFA 4OLFA 4XU3A 11ASA 3P8TA 1NJ2A 1B8AA 2ALYA 1X01A 2ZT7A 2EJGA 2ZR2A 3RACA 1E1TA 1NJ6A 4CS4A 3VQYA 4P71C 1BBUA 4TQDA 4L87A 2ZIOA 4TVYA 2EJFA 4WJ3M 3HXWA 4P73A 1B70A 2AKWB 3A74A 3MF2A 4K87A 4CH4A 3HXVA 4XTZA 3VQVA 2ZTGA 4YRQA 1SETA 2ARSA 2EWNA 4XU0A 5C53B 2Q7HA 4P3PA 3TEHB 1EIYB 1X56A 3V8JA 4TWAA 1VQZA 3CMQA 1USYC 4HWRA 3RGLA 3HFVA 4KR2A 2C8MA 4H2YA 4UP8A 3IKMB 2ZT8A 2ZT5A 4CH6A 4P75A 2E5AA 1Z7NA 1WPYA 5HGQA 4TQFA 2DTOA 1EQRA 3P8VA 2P5IA 1L0WA 2E10A 2P0LA 2ALYB 1ADYA 3TEHA 1H4QA 2QHUA 1SESA 4YRMA 4H2VA 4YROA 3VBBA 5C52B 3VQXA 1SERA 1SRYA 3E9HA 4XTUA 4TVAB 2DZ9A 4YRGA 2ZINA 4XTVA 2ZXFA 3QTCA 3L1AA 1WQ7A 2CJBA 2Q5IA 4E51A 2E3CA 1B76A 2I4NA 4O2DA 2CGHA 3QNEA 4YRFA 12ASA 4OP0A 2XGTA 3A5ZA 4WJ4A 1X54A 1ASYA 4WF2A 1EVLA 2G4CA 5F5WA 1HXDA 3QO5A 4WI1A 4YRSA 3LC0A 2IY5A 1WYDA 3HXUA 4YRCA 2RHSB 4CS2A 2E41A 3PCOB 3HXYA 4BWAA 1BIAA
chains in the Genus database with same CATH superfamily
4YRRA 1NJ8A 4AH6A 2DQ0A 4YP0A 2A8EA 3PZCA 2DVEA 4G85A 3G1ZA 1PYSB 4P3NA 2QHTA 3RUXA 2DDZA 2FYKA 2ODRC 2CIMA 3HTZA 4XU2A 4XEOA 3V8KA 4XTXA 1KMMA 1B7YB 5E3IA 2DTHA 4H2XB 4TTVA 4RMFA 4CH5A 3A32A 2Q7EA 1BIBA 2HNIA 3P8YA 4YRKA 3RIRA 2DXUA 2RHQB 4ZTZB 4ZTUB 1JJCB 3ICAA 2DQ3A 4NCXA 3UGTA 2AMCB 3OD1A 4YCWA 2DZCA 4P71A 1NJ5A 1C0AA 2DU5A 1BBWA 3TEGA 1WU7A 1N9WA 3UGQA 1NNHA 2ODRD 3HFZB 4RQFA 4YRJA 4YCVA 1HTTA 2I4OA 4P74C 4P3OA 2ZGWA 4P72C 3FJPA 2RHQA 1EVKA 3A7AA 1W66A 3LSSA 4H2TA 2I4LA 1G51A 1X2HA 3RF1A 2IY5B 3VQWA 4P75C 4UPAA 3L4GB 3V7CA 3A7RA 4YRNA 1KOGA 1ATIA 4KQEA 3REUA 4BW9A 4YRIA 1QF6A 1KMNA 4HWTA 1E24A 2ARTA 4XTYA 2I4MA 4H02A 2ZNJA 2E65A 3LSQA 4H2SA 4K88A 1X2GA 5ELNA 1JJCA 1H4TA 2E1HA 2ZT6A 4YREA 2ZNIA 1ADJA 2EAYA 3DSQA 4XTWA 4UP7A 3A31A 4H2XA 4RDXA 4HVCA 3RKYA 4HWPA 4RQEA 4YCUA 3W3SA 2CJ9A 5K1PA 3A5YA 3HXXA 1YGBA 3MF1A 3BJUA 3M4PA 1Z7MA 4J15A 3BFMA 1WNLA 2ZIMA 4H2UA 3A7UA 2J3MA 4CH3A 4PHCA 4TVAA 2EJ9A 4P73C 1H4VB 4XU1A 1NJ1A 3E9IA 4YYEA 3R07A 3V8LA 3QO8A 3M4QA 1IL2A 2DU7A 3NETA 4DQ2A 4HA8A 4LVIA 2C7IA 3HRKA 1USYA 2QHVA 4HWSA 3MEYA 1QE0A 4H2WA 4Q6GA 3NELA 1NYRA 3NENA 2ZR3A 2Q7GA 2EL9A 3RKWA 4DPGA 4EO4A 4TVWA 1E22A 4KR3A 2ZZEA 3IG2A 4HWOA 1YFSA 3RL6A 4UP9A 2DKGA 3IKLA 3V7SA 3TUPA 4LVKA 2PMEA 4PG3A 1YFRA 3L4GA 4K86A 4YRPA 4LVMA 3UFGA 4P74A 1WQWA 4X5OA 3REXA 3KFUA 1X55A 4LNSA 4P72A 4CS3A 1PYSA 2DTIA 1EIYA 3UH0A 1G5IA 3HY1A 2Q5HA 3L2ZA 1RIQA 3HRIA 4G84A 3WQZA 1GGMA 4YPFA 3EFRA 3V7RA 5C51B 2J3LA 3PCOA 2ARUA 2XTIA 1G5HA 1ASZA 1WLEA 2DJZA 2RHSA 1B70B 1EOVA 2AKWA 1LYLA 1E1OA 3QO7A 4EX5A 1NYQA 3HFZA 5KNNA 2DEQA 3NEMA 3I7FA 5ELOA 1YB3A 2CJAA 3ERRA 1YFTA 3HY0A 2ZZGA 2PMFA 4YRTA 2AMCA 2ZCEA 1HC7A 1J5WA 1H4SA 4YDQA 4Q15A 2QHSA 3HXZA 4XEMA 2DXTA 4ZIBA 5K1XA 3IALA 3EFSA 2E64A 4YRLA 1B7YA 3RKXA 2ZZFA 1EFWA 1FYFA 4OLFA 4XU3A 11ASA 3P8TA 1NJ2A 1B8AA 2ALYA 1X01A 2ZT7A 3MQZA 2EJGA 2ZR2A 3RACA 1E1TA 1NJ6A 4CS4A 3VQYA 4P71C 1BBUA 4TQDA 4L87A 2ZIOA 4TVYA 2EJFA 4WJ3M 4LVLA 3HXWA 4P73A 1B70A 2AKWB 3A74A 3MF2A 4K87A 4CH4A 3HXVA 4XTZA 3VQVA 2ZTGA 4YRQA 1SETA 2ARSA 2EWNA 4XU0A 5C53B 2Q7HA 4P3PA 4HT4A 3TEHB 1EIYB 1X56A 3V8JA 4TWAA 1VQZA 3CMQA 1USYC 4HWRA 3RGLA 3HFVA 4KR2A 2C8MA 4H2YA 4UP8A 3IKMB 2ZT8A 2ZT5A 4CH6A 4P75A 2E5AA 1Z7NA 1WPYA 5HGQA 4TQFA 2DTOA 1EQRA 3P8VA 2P5IA 1L0WA 2E10A 2P0LA 2ALYB 1ADYA 3TEHA 1H4QA 2QHUA 1SESA 4YRMA 4H2VA 4YROA 3VBBA 5C52B 3VQXA 1SERA 1SRYA 3E9HA 4XTUA 4TVAB 2DZ9A 4YRGA 2ZINA 4XTVA 2ZXFA 3QTCA 3L1AA 1WQ7A 2CJBA 2Q5IA 4E51A 2E3CA 1B76A 2I4NA 4O2DA 2CGHA 3QNEA 4YRFA 12ASA 4OP0A 2XGTA 3A5ZA 4LVJA 4WJ4A 1X54A 1ASYA 4WF2A 1EVLA 2G4CA 5F5WA 1HXDA 3QO5A 4WI1A 2NS6A 4YRSA 3LC0A 2IY5A 1WYDA 3HXUA 4YRCA 2RHSB 4CS2A 2E41A 3PCOB 3HXYA 4BWAA 1BIAA
chains in the Genus database with same CATH topology
4YRRA 1NJ8A 4AH6A 2DQ0A 4YP0A 2A8EA 3PZCA 2DVEA 4G85A 3G1ZA 1PYSB 4P3NA 2QHTA 3RUXA 2DDZA 2FYKA 2ODRC 2CIMA 3HTZA 4XU2A 4XEOA 3V8KA 4XTXA 1KMMA 1B7YB 5E3IA 2DTHA 4H2XB 4TTVA 4RMFA 4CH5A 3A32A 2Q7EA 1BIBA 2HNIA 3P8YA 4YRKA 3RIRA 2DXUA 2RHQB 4ZTZB 4ZTUB 1JJCB 3ICAA 2DQ3A 4NCXA 3UGTA 2AMCB 3OD1A 4YCWA 2DZCA 4P71A 1NJ5A 1C0AA 2DU5A 1BBWA 3TEGA 1WU7A 1N9WA 3UGQA 1NNHA 2ODRD 3HFZB 4RQFA 4YRJA 4YCVA 1HTTA 2I4OA 4P74C 4P3OA 2ZGWA 4P72C 3FJPA 2RHQA 1EVKA 3A7AA 1W66A 3LSSA 4H2TA 2I4LA 1G51A 1X2HA 3RF1A 2IY5B 3VQWA 4P75C 4UPAA 3L4GB 3V7CA 3A7RA 4YRNA 1KOGA 1ATIA 4KQEA 3REUA 4BW9A 4YRIA 1QF6A 1KMNA 4HWTA 1E24A 2ARTA 4XTYA 2I4MA 4H02A 2ZNJA 2E65A 3LSQA 4H2SA 4K88A 1X2GA 5ELNA 1JJCA 1H4TA 2E1HA 2ZT6A 4YREA 2ZNIA 1ADJA 2EAYA 3DSQA 4XTWA 4UP7A 3A31A 4H2XA 4RDXA 4HVCA 3RKYA 4HWPA 4RQEA 4YCUA 3W3SA 2CJ9A 5K1PA 3A5YA 3HXXA 1YGBA 3MF1A 3BJUA 3M4PA 1Z7MA 4J15A 3BFMA 1WNLA 2ZIMA 4H2UA 3A7UA 2J3MA 4CH3A 4PHCA 4TVAA 2EJ9A 4P73C 1H4VB 4XU1A 1NJ1A 3E9IA 4YYEA 3R07A 3V8LA 3QO8A 3M4QA 1IL2A 2DU7A 3NETA 4DQ2A 4HA8A 4LVIA 2C7IA 3HRKA 1USYA 2QHVA 4HWSA 3MEYA 1QE0A 4H2WA 4Q6GA 3NELA 1NYRA 3NENA 2ZR3A 2Q7GA 2EL9A 3RKWA 4DPGA 4EO4A 4TVWA 1E22A 4KR3A 2ZZEA 3IG2A 4HWOA 1YFSA 3RL6A 4UP9A 2DKGA 3IKLA 3V7SA 3TUPA 4LVKA 2PMEA 4PG3A 1YFRA 3L4GA 4K86A 4YRPA 4LVMA 3UFGA 4P74A 1WQWA 4X5OA 3REXA 3KFUA 1X55A 4LNSA 4P72A 4CS3A 1PYSA 2DTIA 1EIYA 3UH0A 1G5IA 3HY1A 2Q5HA 3L2ZA 1RIQA 3HRIA 4G84A 3WQZA 1GGMA 4YPFA 3EFRA 3V7RA 5C51B 2J3LA 3PCOA 2ARUA 2XTIA 1G5HA 1ASZA 1WLEA 2DJZA 2RHSA 1B70B 1EOVA 2AKWA 1LYLA 1E1OA 3QO7A 4EX5A 1NYQA 3HFZA 5KNNA 2DEQA 3NEMA 3I7FA 5ELOA 1YB3A 2CJAA 3ERRA 1YFTA 3HY0A 2ZZGA 2PMFA 4YRTA 2AMCA 2ZCEA 1HC7A 1J5WA 1H4SA 4YDQA 4Q15A 2QHSA 3HXZA 4XEMA 2DXTA 4ZIBA 5K1XA 3IALA 3EFSA 2E64A 4YRLA 1B7YA 3RKXA 2ZZFA 1EFWA 1FYFA 4OLFA 4XU3A 11ASA 3P8TA 1NJ2A 1B8AA 2ALYA 1X01A 2ZT7A 3MQZA 2EJGA 2ZR2A 3RACA 1E1TA 1NJ6A 4CS4A 3VQYA 4P71C 1BBUA 4TQDA 4L87A 2ZIOA 4TVYA 2EJFA 4WJ3M 4LVLA 3HXWA 4P73A 1B70A 2AKWB 3A74A 3MF2A 4K87A 4CH4A 3HXVA 4XTZA 3VQVA 2ZTGA 4YRQA 1SETA 2ARSA 2EWNA 4XU0A 5C53B 2Q7HA 4P3PA 4HT4A 3TEHB 1EIYB 1X56A 3V8JA 4TWAA 1VQZA 3CMQA 1USYC 4HWRA 3RGLA 3HFVA 4KR2A 2C8MA 4H2YA 4UP8A 3IKMB 2ZT8A 2ZT5A 4CH6A 4P75A 2E5AA 1Z7NA 1WPYA 5HGQA 4TQFA 2DTOA 1EQRA 3P8VA 2P5IA 1L0WA 2E10A 2P0LA 2ALYB 1ADYA 3TEHA 1H4QA 2QHUA 1SESA 4YRMA 4H2VA 4YROA 3VBBA 5C52B 3VQXA 1SERA 1SRYA 3E9HA 4XTUA 4TVAB 2DZ9A 4YRGA 2ZINA 4XTVA 2ZXFA 3QTCA 3L1AA 1WQ7A 2CJBA 2Q5IA 4E51A 2E3CA 1B76A 2I4NA 4O2DA 2CGHA 3QNEA 4YRFA 12ASA 4OP0A 2XGTA 3A5ZA 4LVJA 4WJ4A 1X54A 1ASYA 4WF2A 1EVLA 2G4CA 5F5WA 1HXDA 3QO5A 4WI1A 2NS6A 4YRSA 3LC0A 2IY5A 1WYDA 3HXUA 4YRCA 2RHSB 4CS2A 2E41A 3PCOB 3HXYA 4BWAA 1BIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRR A;  1NJ8 A;  4AH6 A;  2DQ0 A;  4YP0 A;  3PZC A;  2DVE A;  4G85 A;  3G1Z A;  1PYS B;  4P3N A;  2QHT A;  3RUX A;  2DDZ A;  2FYK A;  2ODR C;  2CIM A;  3HTZ A;  4XU2 A;  4XEO A;  3V8K A;  4XTX A;  1KMM A;  1B7Y B;  5E3I A;  2DTH A;  4H2X B;  4TTV A;  4RMF A;  4CH5 A;  3A32 A;  2Q7E A;  1BIB A;  2HNI A;  3P8Y A;  4YRK A;  3RIR A;  2DXU A;  2RHQ B;  4ZTZ B;  4ZTU B;  1JJC B;  3ICA A;  2DQ3 A;  4NCX A;  3UGT A;  2AMC B;  3OD1 A;  4YCW A;  2DZC A;  4P71 A;  1NJ5 A;  1C0A A;  2DU5 A;  1BBW A;  3TEG A;  1WU7 A;  1N9W A;  3UGQ A;  1NNH A;  2ODR D;  3HFZ B;  4RQF A;  4YRJ A;  4YCV A;  1HTT A;  2I4O A;  4P74 C;  4P3O A;  2ZGW A;  4P72 C;  3FJP A;  2RHQ A;  1EVK A;  3A7A A;  1W66 A;  3LSS A;  4H2T A;  2I4L A;  1G51 A;  1X2H A;  3RF1 A;  2IY5 B;  3VQW A;  4P75 C;  4UPA A;  3L4G B;  3V7C A;  3A7R A;  4YRN A;  1KOG A;  1ATI A;  4KQE A;  3REU A;  4BW9 A;  4YRI A;  1QF6 A;  1KMN A;  4HWT A;  1E24 A;  2ART A;  4XTY A;  2I4M A;  4H02 A;  2ZNJ A;  2E65 A;  3LSQ A;  4H2S A;  4K88 A;  1X2G A;  5ELN A;  1JJC A;  1H4T A;  2E1H A;  2ZT6 A;  4YRE A;  2ZNI A;  1ADJ A;  2EAY A;  3DSQ A;  4XTW A;  4UP7 A;  3A31 A;  4H2X A;  4RDX A;  4HVC A;  3RKY A;  4HWP A;  4RQE A;  4YCU A;  3W3S A;  2CJ9 A;  5K1P A;  3A5Y A;  3HXX A;  1YGB A;  3MF1 A;  3BJU A;  3M4P A;  1Z7M A;  4J15 A;  3BFM A;  1WNL A;  2ZIM A;  4H2U A;  3A7U A;  2J3M A;  4CH3 A;  4PHC A;  4TVA A;  2EJ9 A;  4P73 C;  1H4V B;  4XU1 A;  1NJ1 A;  3E9I A;  4YYE A;  3R07 A;  3V8L A;  3QO8 A;  3M4Q A;  1IL2 A;  2DU7 A;  3NET A;  4DQ2 A;  4HA8 A;  2C7I A;  3HRK A;  1USY A;  2QHV A;  4HWS A;  3MEY A;  1QE0 A;  4H2W A;  4Q6G A;  3NEL A;  1NYR A;  3NEN A;  2ZR3 A;  2Q7G A;  2EL9 A;  3RKW A;  4DPG A;  4EO4 A;  4TVW A;  1E22 A;  4KR3 A;  2ZZE A;  3IG2 A;  4HWO A;  1YFS A;  3RL6 A;  4UP9 A;  2DKG A;  3IKL A;  3V7S A;  3TUP A;  2PME A;  4PG3 A;  1YFR A;  3L4G A;  4K86 A;  4YRP A;  3UFG A;  4P74 A;  1WQW A;  4X5O A;  3REX A;  3KFU A;  1X55 A;  4LNS A;  4P72 A;  4CS3 A;  1PYS A;  2DTI A;  1EIY A;  3UH0 A;  1G5I A;  3HY1 A;  2Q5H A;  3L2Z A;  1RIQ A;  3HRI A;  4G84 A;  3WQZ A;  1GGM A;  4YPF A;  3EFR A;  3V7R A;  5C51 B;  2J3L A;  3PCO A;  2ARU A;  2XTI A;  1G5H A;  1ASZ A;  1WLE A;  2DJZ A;  2RHS A;  1B70 B;  1EOV A;  2AKW A;  1LYL A;  1E1O A;  3QO7 A;  4EX5 A;  1NYQ A;  3HFZ A;  5KNN A;  2DEQ A;  3NEM A;  3I7F A;  5ELO A;  1YB3 A;  2CJA A;  3ERR A;  1YFT A;  3HY0 A;  2ZZG A;  2PMF A;  4YRT A;  2AMC A;  2ZCE A;  1HC7 A;  1J5W A;  1H4S A;  4YDQ A;  4Q15 A;  2QHS A;  3HXZ A;  4XEM A;  2DXT A;  4ZIB A;  5K1X A;  3IAL A;  3EFS A;  2E64 A;  4YRL A;  1B7Y A;  3RKX A;  2ZZF A;  1EFW A;  1FYF A;  4OLF A;  4XU3 A;  11AS A;  3P8T A;  1NJ2 A;  1B8A A;  2ALY A;  1X01 A;  2ZT7 A;  2EJG A;  2ZR2 A;  3RAC A;  1E1T A;  1NJ6 A;  4CS4 A;  3VQY A;  4P71 C;  1BBU A;  4TQD A;  4L87 A;  2ZIO A;  4TVY A;  2EJF A;  4WJ3 M;  3HXW A;  4P73 A;  1B70 A;  2AKW B;  3A74 A;  3MF2 A;  4K87 A;  4CH4 A;  3HXV A;  4XTZ A;  3VQV A;  2ZTG A;  4YRQ A;  1SET A;  2ARS A;  2EWN A;  4XU0 A;  5C53 B;  2Q7H A;  4P3P A;  3TEH B;  1EIY B;  1X56 A;  3V8J A;  4TWA A;  1VQZ A;  3CMQ A;  1USY C;  4HWR A;  3RGL A;  3HFV A;  4KR2 A;  2C8M A;  4H2Y A;  4UP8 A;  3IKM B;  2ZT8 A;  2ZT5 A;  4CH6 A;  4P75 A;  2E5A A;  1Z7N A;  1WPY A;  5HGQ A;  4TQF A;  2DTO A;  1EQR A;  3P8V A;  2P5I A;  1L0W A;  2E10 A;  2P0L A;  2ALY B;  1ADY A;  3TEH A;  1H4Q A;  2QHU A;  1SES A;  4YRM A;  4H2V A;  4YRO A;  3VBB A;  5C52 B;  3VQX A;  1SER A;  1SRY A;  3E9H A;  4XTU A;  4TVA B;  2DZ9 A;  4YRG A;  2ZIN A;  4XTV A;  2ZXF A;  3QTC A;  3L1A A;  1WQ7 A;  2CJB A;  2Q5I A;  4E51 A;  2E3C A;  1B76 A;  2I4N A;  4O2D A;  2CGH A;  3QNE A;  4YRF A;  12AS A;  4OP0 A;  2XGT A;  3A5Z A;  4WJ4 A;  1X54 A;  1ASY A;  4WF2 A;  1EVL A;  2G4C A;  5F5W A;  1HXD A;  3QO5 A;  4WI1 A;  4YRS A;  3LC0 A;  2IY5 A;  1WYD A;  3HXU A;  4YRC A;  2RHS B;  4CS2 A;  2E41 A;  3PCO B;  3HXY A;  4BWA A;  1BIA A; 
#chains in the Genus database with same CATH topology
 4YRR A;  1NJ8 A;  4AH6 A;  2DQ0 A;  4YP0 A;  2A8E A;  3PZC A;  2DVE A;  4G85 A;  3G1Z A;  1PYS B;  4P3N A;  2QHT A;  3RUX A;  2DDZ A;  2FYK A;  2ODR C;  2CIM A;  3HTZ A;  4XU2 A;  4XEO A;  3V8K A;  4XTX A;  1KMM A;  1B7Y B;  5E3I A;  2DTH A;  4H2X B;  4TTV A;  4RMF A;  4CH5 A;  3A32 A;  2Q7E A;  1BIB A;  2HNI A;  3P8Y A;  4YRK A;  3RIR A;  2DXU A;  2RHQ B;  4ZTZ B;  4ZTU B;  1JJC B;  3ICA A;  2DQ3 A;  4NCX A;  3UGT A;  2AMC B;  3OD1 A;  4YCW A;  2DZC A;  4P71 A;  1NJ5 A;  1C0A A;  2DU5 A;  1BBW A;  3TEG A;  1WU7 A;  1N9W A;  3UGQ A;  1NNH A;  2ODR D;  3HFZ B;  4RQF A;  4YRJ A;  4YCV A;  1HTT A;  2I4O A;  4P74 C;  4P3O A;  2ZGW A;  4P72 C;  3FJP A;  2RHQ A;  1EVK A;  3A7A A;  1W66 A;  3LSS A;  4H2T A;  2I4L A;  1G51 A;  1X2H A;  3RF1 A;  2IY5 B;  3VQW A;  4P75 C;  4UPA A;  3L4G B;  3V7C A;  3A7R A;  4YRN A;  1KOG A;  1ATI A;  4KQE A;  3REU A;  4BW9 A;  4YRI A;  1QF6 A;  1KMN A;  4HWT A;  1E24 A;  2ART A;  4XTY A;  2I4M A;  4H02 A;  2ZNJ A;  2E65 A;  3LSQ A;  4H2S A;  4K88 A;  1X2G A;  5ELN A;  1JJC A;  1H4T A;  2E1H A;  2ZT6 A;  4YRE A;  2ZNI A;  1ADJ A;  2EAY A;  3DSQ A;  4XTW A;  4UP7 A;  3A31 A;  4H2X A;  4RDX A;  4HVC A;  3RKY A;  4HWP A;  4RQE A;  4YCU A;  3W3S A;  2CJ9 A;  5K1P A;  3A5Y A;  3HXX A;  1YGB A;  3MF1 A;  3BJU A;  3M4P A;  1Z7M A;  4J15 A;  3BFM A;  1WNL A;  2ZIM A;  4H2U A;  3A7U A;  2J3M A;  4CH3 A;  4PHC A;  4TVA A;  2EJ9 A;  4P73 C;  1H4V B;  4XU1 A;  1NJ1 A;  3E9I A;  4YYE A;  3R07 A;  3V8L A;  3QO8 A;  3M4Q A;  1IL2 A;  2DU7 A;  3NET A;  4DQ2 A;  4HA8 A;  4LVI A;  2C7I A;  3HRK A;  1USY A;  2QHV A;  4HWS A;  3MEY A;  1QE0 A;  4H2W A;  4Q6G A;  3NEL A;  1NYR A;  3NEN A;  2ZR3 A;  2Q7G A;  2EL9 A;  3RKW A;  4DPG A;  4EO4 A;  4TVW A;  1E22 A;  4KR3 A;  2ZZE A;  3IG2 A;  4HWO A;  1YFS A;  3RL6 A;  4UP9 A;  2DKG A;  3IKL A;  3V7S A;  3TUP A;  4LVK A;  2PME A;  4PG3 A;  1YFR A;  3L4G A;  4K86 A;  4YRP A;  4LVM A;  3UFG A;  4P74 A;  1WQW A;  4X5O A;  3REX A;  3KFU A;  1X55 A;  4LNS A;  4P72 A;  4CS3 A;  1PYS A;  2DTI A;  1EIY A;  3UH0 A;  1G5I A;  3HY1 A;  2Q5H A;  3L2Z A;  1RIQ A;  3HRI A;  4G84 A;  3WQZ A;  1GGM A;  4YPF A;  3EFR A;  3V7R A;  5C51 B;  2J3L A;  3PCO A;  2ARU A;  2XTI A;  1G5H A;  1ASZ A;  1WLE A;  2DJZ A;  2RHS A;  1B70 B;  1EOV A;  2AKW A;  1LYL A;  1E1O A;  3QO7 A;  4EX5 A;  1NYQ A;  3HFZ A;  5KNN A;  2DEQ A;  3NEM A;  3I7F A;  5ELO A;  1YB3 A;  2CJA A;  3ERR A;  1YFT A;  3HY0 A;  2ZZG A;  2PMF A;  4YRT A;  2AMC A;  2ZCE A;  1HC7 A;  1J5W A;  1H4S A;  4YDQ A;  4Q15 A;  2QHS A;  3HXZ A;  4XEM A;  2DXT A;  4ZIB A;  5K1X A;  3IAL A;  3EFS A;  2E64 A;  4YRL A;  1B7Y A;  3RKX A;  2ZZF A;  1EFW A;  1FYF A;  4OLF A;  4XU3 A;  11AS A;  3P8T A;  1NJ2 A;  1B8A A;  2ALY A;  1X01 A;  2ZT7 A;  3MQZ A;  2EJG A;  2ZR2 A;  3RAC A;  1E1T A;  1NJ6 A;  4CS4 A;  3VQY A;  4P71 C;  1BBU A;  4TQD A;  4L87 A;  2ZIO A;  4TVY A;  2EJF A;  4WJ3 M;  4LVL A;  3HXW A;  4P73 A;  1B70 A;  2AKW B;  3A74 A;  3MF2 A;  4K87 A;  4CH4 A;  3HXV A;  4XTZ A;  3VQV A;  2ZTG A;  4YRQ A;  1SET A;  2ARS A;  2EWN A;  4XU0 A;  5C53 B;  2Q7H A;  4P3P A;  4HT4 A;  3TEH B;  1EIY B;  1X56 A;  3V8J A;  4TWA A;  1VQZ A;  3CMQ A;  1USY C;  4HWR A;  3RGL A;  3HFV A;  4KR2 A;  2C8M A;  4H2Y A;  4UP8 A;  3IKM B;  2ZT8 A;  2ZT5 A;  4CH6 A;  4P75 A;  2E5A A;  1Z7N A;  1WPY A;  5HGQ A;  4TQF A;  2DTO A;  1EQR A;  3P8V A;  2P5I A;  1L0W A;  2E10 A;  2P0L A;  2ALY B;  1ADY A;  3TEH A;  1H4Q A;  2QHU A;  1SES A;  4YRM A;  4H2V A;  4YRO A;  3VBB A;  5C52 B;  3VQX A;  1SER A;  1SRY A;  3E9H A;  4XTU A;  4TVA B;  2DZ9 A;  4YRG A;  2ZIN A;  4XTV A;  2ZXF A;  3QTC A;  3L1A A;  1WQ7 A;  2CJB A;  2Q5I A;  4E51 A;  2E3C A;  1B76 A;  2I4N A;  4O2D A;  2CGH A;  3QNE A;  4YRF A;  12AS A;  4OP0 A;  2XGT A;  3A5Z A;  4LVJ A;  4WJ4 A;  1X54 A;  1ASY A;  4WF2 A;  1EVL A;  2G4C A;  5F5W A;  1HXD A;  3QO5 A;  4WI1 A;  2NS6 A;  4YRS A;  3LC0 A;  2IY5 A;  1WYD A;  3HXU A;  4YRC A;  2RHS B;  4CS2 A;  2E41 A;  3PCO B;  3HXY A;  4BWA A;  1BIA A; 
#chains in the Genus database with same CATH homology
 4YRR A;  1NJ8 A;  4AH6 A;  2DQ0 A;  4YP0 A;  2A8E A;  3PZC A;  2DVE A;  4G85 A;  3G1Z A;  1PYS B;  4P3N A;  2QHT A;  3RUX A;  2DDZ A;  2FYK A;  2ODR C;  2CIM A;  3HTZ A;  4XU2 A;  4XEO A;  3V8K A;  4XTX A;  1KMM A;  1B7Y B;  5E3I A;  2DTH A;  4H2X B;  4TTV A;  4RMF A;  4CH5 A;  3A32 A;  2Q7E A;  1BIB A;  2HNI A;  3P8Y A;  4YRK A;  3RIR A;  2DXU A;  2RHQ B;  4ZTZ B;  4ZTU B;  1JJC B;  3ICA A;  2DQ3 A;  4NCX A;  3UGT A;  2AMC B;  3OD1 A;  4YCW A;  2DZC A;  4P71 A;  1NJ5 A;  1C0A A;  2DU5 A;  1BBW A;  3TEG A;  1WU7 A;  1N9W A;  3UGQ A;  1NNH A;  2ODR D;  3HFZ B;  4RQF A;  4YRJ A;  4YCV A;  1HTT A;  2I4O A;  4P74 C;  4P3O A;  2ZGW A;  4P72 C;  3FJP A;  2RHQ A;  1EVK A;  3A7A A;  1W66 A;  3LSS A;  4H2T A;  2I4L A;  1G51 A;  1X2H A;  3RF1 A;  2IY5 B;  3VQW A;  4P75 C;  4UPA A;  3L4G B;  3V7C A;  3A7R A;  4YRN A;  1KOG A;  1ATI A;  4KQE A;  3REU A;  4BW9 A;  4YRI A;  1QF6 A;  1KMN A;  4HWT A;  1E24 A;  2ART A;  4XTY A;  2I4M A;  4H02 A;  2ZNJ A;  2E65 A;  3LSQ A;  4H2S A;  4K88 A;  1X2G A;  5ELN A;  1JJC A;  1H4T A;  2E1H A;  2ZT6 A;  4YRE A;  2ZNI A;  1ADJ A;  2EAY A;  3DSQ A;  4XTW A;  4UP7 A;  3A31 A;  4H2X A;  4RDX A;  4HVC A;  3RKY A;  4HWP A;  4RQE A;  4YCU A;  3W3S A;  2CJ9 A;  5K1P A;  3A5Y A;  3HXX A;  1YGB A;  3MF1 A;  3BJU A;  3M4P A;  1Z7M A;  4J15 A;  3BFM A;  1WNL A;  2ZIM A;  4H2U A;  3A7U A;  2J3M A;  4CH3 A;  4PHC A;  4TVA A;  2EJ9 A;  4P73 C;  1H4V B;  4XU1 A;  1NJ1 A;  3E9I A;  4YYE A;  3R07 A;  3V8L A;  3QO8 A;  3M4Q A;  1IL2 A;  2DU7 A;  3NET A;  4DQ2 A;  4HA8 A;  4LVI A;  2C7I A;  3HRK A;  1USY A;  2QHV A;  4HWS A;  3MEY A;  1QE0 A;  4H2W A;  4Q6G A;  3NEL A;  1NYR A;  3NEN A;  2ZR3 A;  2Q7G A;  2EL9 A;  3RKW A;  4DPG A;  4EO4 A;  4TVW A;  1E22 A;  4KR3 A;  2ZZE A;  3IG2 A;  4HWO A;  1YFS A;  3RL6 A;  4UP9 A;  2DKG A;  3IKL A;  3V7S A;  3TUP A;  4LVK A;  2PME A;  4PG3 A;  1YFR A;  3L4G A;  4K86 A;  4YRP A;  4LVM A;  3UFG A;  4P74 A;  1WQW A;  4X5O A;  3REX A;  3KFU A;  1X55 A;  4LNS A;  4P72 A;  4CS3 A;  1PYS A;  2DTI A;  1EIY A;  3UH0 A;  1G5I A;  3HY1 A;  2Q5H A;  3L2Z A;  1RIQ A;  3HRI A;  4G84 A;  3WQZ A;  1GGM A;  4YPF A;  3EFR A;  3V7R A;  5C51 B;  2J3L A;  3PCO A;  2ARU A;  2XTI A;  1G5H A;  1ASZ A;  1WLE A;  2DJZ A;  2RHS A;  1B70 B;  1EOV A;  2AKW A;  1LYL A;  1E1O A;  3QO7 A;  4EX5 A;  1NYQ A;  3HFZ A;  5KNN A;  2DEQ A;  3NEM A;  3I7F A;  5ELO A;  1YB3 A;  2CJA A;  3ERR A;  1YFT A;  3HY0 A;  2ZZG A;  2PMF A;  4YRT A;  2AMC A;  2ZCE A;  1HC7 A;  1J5W A;  1H4S A;  4YDQ A;  4Q15 A;  2QHS A;  3HXZ A;  4XEM A;  2DXT A;  4ZIB A;  5K1X A;  3IAL A;  3EFS A;  2E64 A;  4YRL A;  1B7Y A;  3RKX A;  2ZZF A;  1EFW A;  1FYF A;  4OLF A;  4XU3 A;  11AS A;  3P8T A;  1NJ2 A;  1B8A A;  2ALY A;  1X01 A;  2ZT7 A;  3MQZ A;  2EJG A;  2ZR2 A;  3RAC A;  1E1T A;  1NJ6 A;  4CS4 A;  3VQY A;  4P71 C;  1BBU A;  4TQD A;  4L87 A;  2ZIO A;  4TVY A;  2EJF A;  4WJ3 M;  4LVL A;  3HXW A;  4P73 A;  1B70 A;  2AKW B;  3A74 A;  3MF2 A;  4K87 A;  4CH4 A;  3HXV A;  4XTZ A;  3VQV A;  2ZTG A;  4YRQ A;  1SET A;  2ARS A;  2EWN A;  4XU0 A;  5C53 B;  2Q7H A;  4P3P A;  4HT4 A;  3TEH B;  1EIY B;  1X56 A;  3V8J A;  4TWA A;  1VQZ A;  3CMQ A;  1USY C;  4HWR A;  3RGL A;  3HFV A;  4KR2 A;  2C8M A;  4H2Y A;  4UP8 A;  3IKM B;  2ZT8 A;  2ZT5 A;  4CH6 A;  4P75 A;  2E5A A;  1Z7N A;  1WPY A;  5HGQ A;  4TQF A;  2DTO A;  1EQR A;  3P8V A;  2P5I A;  1L0W A;  2E10 A;  2P0L A;  2ALY B;  1ADY A;  3TEH A;  1H4Q A;  2QHU A;  1SES A;  4YRM A;  4H2V A;  4YRO A;  3VBB A;  5C52 B;  3VQX A;  1SER A;  1SRY A;  3E9H A;  4XTU A;  4TVA B;  2DZ9 A;  4YRG A;  2ZIN A;  4XTV A;  2ZXF A;  3QTC A;  3L1A A;  1WQ7 A;  2CJB A;  2Q5I A;  4E51 A;  2E3C A;  1B76 A;  2I4N A;  4O2D A;  2CGH A;  3QNE A;  4YRF A;  12AS A;  4OP0 A;  2XGT A;  3A5Z A;  4LVJ A;  4WJ4 A;  1X54 A;  1ASY A;  4WF2 A;  1EVL A;  2G4C A;  5F5W A;  1HXD A;  3QO5 A;  4WI1 A;  2NS6 A;  4YRS A;  3LC0 A;  2IY5 A;  1WYD A;  3HXU A;  4YRC A;  2RHS B;  4CS2 A;  2E41 A;  3PCO B;  3HXY A;  4BWA A;  1BIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...