2EAYA

Crystal structure of biotin protein ligase from aquifex aeolicus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 66
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eayA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2eayA01
1H4SA 4F7UG 3MEYA 5CAIA 3JCMJ 1G5IA 2DKGA 4TQFA 4K86A 3RERA 4NOYA 1EVKA 3P8YA 5I21A 4P73C 4C8QA 2DTOA 3SWNC 4HWTA 4F7UF 1IL2A 4UP9A 4YRJA 4X5OA 2ODRC 1EFWA 4CS2A 4H2TA 5ELOA 1HTTA 1M5Q1 1WQ7A 5C52B 3RL6A 2DXTA 2Y90A 3L4GA 1B7YB 4P74A 4YRLA 3VBBA 4HWPA 4CH4A 2XTIA 5GAOm 4J15A 5LJ3f 1KMNA 2AMCB 4M7AA 4M78B 4M75B 4X9DA 3IKMB 4C8QD 5LJ5e 1L0WA 4J6YA 2I4MA 1FYFA 4EMKC 2RHSA 3V7CA 4C8QG 3TEHA 1Y96B 4YCUA 1YCYA 4CH5A 3QO8A 3QTCA 5C51B 2ZT7A 5GMKj 4C8QF 2E10A 3HSBA 3RUXA 5GAMh 5LJ5f 3A5ZA 4C92B 1NJ5A 4RQFA 1X2HA 3NELA 2RHQA 4M77B 1JJCA 12ASA 3P8TA 4M7AD 4YRQA 3HXZA 4PHCA 4CH6A 2I4OA 3LC0A 4M7AG 1X56A 2DQ3A 4P3NA 4P73A 3TUPA 3UH0A 3SWNA 1B76A 3ICAA 4WJ3M 2EJFA 2ZIOA 2PMFA 2I2LA 4M7AF 3HRIA 1JBMA 3UGTA 3L1AA 1U1SA 2Q7GA 5GAMe 4TVWA 5GAN4 4M78C 4M75C 3M4PA 2Q5IA 2CJBA 3REUA 4M78E 4M75E 2IY5A 2E41A 5F5WA 4XTVA 3NENA 4XU1A 2Q5HA 1X2GA 4EMKA 2QHSA 3R07A 4YRNA 2ODRD 1H4QA 4C92C 4H2VA 3A7UA 1USYC 1BIAA 4YYEA 2FYKA 2JN0A 4C92E 4H2WA 3I7FA 4M77C 2ALYA 5GAOp 4H2UA 4V2SA 4H02A 4YRCA 5GAMg 4M77E 4CH3A 2ZCEA 4P72C 3OD1A 3UGQA 2Q7HA 2G4CA 1WQWA 4XU2A 1ADJA 3A7AA 1ASZA 3A31A 5GAOn 3MF1A 3HFOA 3VQYA 4H2XB 3BY7A 4YDQA 1HXDA 3JCMd 2ZT8A 2P0LA 4HT8A 4Q15A 4YRSA 4M78A 4M75A 2VXEA 3HFNA 1X01A 3REXA 5GAOr 3JCMc 4X9CA 2DJZA 2DTIA 4G85A 3E9IA 3QO5A 1YFSA 5GMKi 1TH7A 1X54A 4J5YA 4XEMA 4E51A 4YREA 5LJ5h 4PNOA 1JRIA 5GANj 3EFRA 4YCWA 3V8JA 5GAN7 1WLEA 2E5AA 5LJ3e 4TVAB 4WF2A 4HVCA 1D3BB 3A32A 4RDXA 2DU5A 3JCMb 4M77A 4MMKA 2ZNIA 4JRIA 4M78D 4M75D 4RMFA 3E9HA 4ZIBA 1NJ1A 4M78G 4M75G 3HXYA 4P72A 2RB6A 4QVDA 4NL3A 2ZTGA 4YRGA 4JLIA 2I4LA 5ELNA 2CIMA 1KQ1A 4M75F 4M78F 2VXFA 4EMHA 2YLCA 4UPAA 2AKWB 4XEOA 4C92D 1X55A 4XU3A 3INZA 4TQDA 1LNXA 1YGBA 3FIFA 4C92G 4TVYA 1BBUA 3JB9J 5LJ3g 2FB7A 4M77D 5GAMd 3HFZB 4P71C 2RA2A 5GANf 4M77G 1MGQA 4MMLA 4NL2A 4YPFA 3HRKA 4C92F 1LYLA 3CMQA 4K88A 3MF2A 4Y91A 4UP8A 4CS3A 1KOGA 4PJOB 3JCMf 1NJ6A 4M77F 1GGMA 11ASA 3A7RA 2DZCA 1EIYA 3FB9A 3PCOA 5LJ5g 3PZCA 4C8QB 2ZR3A 1J5WA 1YB3A 4ZTZB 2HNIA 5GMKe 1KQ2A 2ARUA 3A5YA 5HGQA 3QUIA 1N9WA 2ZR2A 5K1XA 5GAN6 3JCMX 5GAN2 4EX5A 4WJ4A 1N9SA 1H4TA 2QHVA 4O2DA 3RACA 4XTXA 1BBWA 3L4GB 1M8VA 2PMEA 4XTWA 3HY1A 3UFGA 3HXUA 4M7AB 1EQRA 1NJ8A 2ZNJA 1I5LA 1W66A 2ZINA 4P75C 2CJAA 1EVLA 4OP0A 4YRRA 3TEHB 3AHUA 1SRYA 5GAN8 2QHUA 4OLFA 5GMKl 1B70B 3IKLA 4PJOC 3LSQA 3HXWA 4L87A 4PJOE 5DY9A 4C8QC 1YFRA 3V7SA 1G51A 4XTZA 2RHQB 5GAN5 1JJCB 4KR2A 1E1OA 4C8QE 2P5IA 2XGTA 4YRTA 4K87A 4BWAA 4M7DB 2ZXFA 2VC8A 5LJ3d 2DQ0A 5LJ3h 4CS4A 2J3LA 4JRKA 1QE0A 3P8VA 4LNSA 3IALA 1PYSB 1B7YA 4N0AC 2CJ9A 4YP0A 4P74C 1SESA 2AMCA 4J6WA 5GAN3 3L2ZA 4M7AC 1NJ2A 4XTUA 1G5HA 3GIBA 2ZZGA 2K57A 3IG2A 2EJGA 4M7AE 3VU3C 2AKWA 1Y96A 5LJ5d 3JCMQ 1B8AA 3HXVA 2ZT5A 4HWSA 3KFUA 1NNHA 2C8MA 4HT9A 3TEGA 3HFZA 4P3OA 4PG3A 5C53B 1N9RA 4P75A 4YCVA 4RQEA 4C92A 1Z7MA 1USYA 2EWNA 2ZGWA 3G1ZA 4G84A 4TTVA 1WYDA 1LOJA 2YHTA 4HWOA 3RESA 2ZZFA 3BW1A 4PJOA 4QVCA 2ALYB 4YRPA 4F7UB 4YRKA 4M7DC 5LJ5j 3SB2A 3QO7A 3BDUA 4RCCA 2YLBA 3RIRA 4A53A 5GANe 4M7DE 2ZT6A 3NETA 4J6XA 4HWRA 3RKYA 2DVEA 3BJUA 1SETA 1B34B 3A74A 2DTHA 4KQEA 5GMKh 1VQZA 1E24A 3JCMe 2E3CA 1H4VB 4EMGA 4RCBA 3FJPA 2ZIMA 1BIBA 4PJOD 4N0AA 4DQ2A 3JCMW 2EL9A 4PJOG 4H2SA 4AH6A 3QNEA 3EFSA 4A54A 4EO4A 1HK9A 3RGLA 5K1PA 1RIQA 3WQZA 5GAOq 2ZZEA 4HA8A 4PJOF 3M4QA 1Z7NA 4XU0A 5GANg 2DDZA 3JCMV 4XTYA 1B70A 4TWAA 5GAOl 2DXUA 5GAMj 4DPGA 3JCMg 1I81A 2DU7A 1ATIA 4F7UE 2RM4A 4JUVA 5GMKm 4M7DA 2E1HA 1E1TA 4BW9A 1I4K1 4P3PA 4KR3A 3QSUA 4H2XA 4H2YA 2QHTA 1PYSA 2RHSB 3VQVA 5KNNA 1SERA 4YRFA 1NYQA 2E64A 1KMMA 3QHSA 4P71A 2Q7EA 1WU7A 3JB9H 2CGHA 4YRMA 3RKXA 3BFMA 1QF6A 2DZ9A 4XQ3A 3VQXA 3JB9D 1NYRA 2EAYA 2J3MA 4M7DD 4NCXA 3JB9I 5GAMf 2E65A 3JB9G 4Q6GA 5E3IA 3HXXA 1ASYA 2C7IA 4M7DG 4TVAA 4YROA 2ARSA 3JCMP 4ZTUB 1EOVA 3V8LA 1E22A 2QTXA 1D3BA 1EIYB 3RKWA 3HY0A 3SWNB 3PCOB 1C0AA 1YFTA 3RF1A 3JB9F 1H641 3QO3A 4M7DF 3HTZA 3HFVA 1U1TA 4F7UA 1ADYA 1WPYA 3DSQA 4YRIA 3V7RA 1WNLA 1I8FA 4WI1A 3LSSA 1B34A 3PGGA 3VQWA 2IY5B 5GANd 5GANh 3V8KA 3W3SA 3ERRA 2DEQA 2ARTA 4EMKB 2EJ9A 5LJ3j 1HC7A 4UP7A 3JCMh 3NEMA 2I4NA 3M4GA 2RD1A 1LJOA
chains in the Genus database with same CATH superfamily
4P5NA 2J05A 1JU5C 3BE3A 3JCMJ 3CBMA 2JS2A 3RERA 2OTLA 2LCLA 2VYTA 1UEBA 1ZLMA 2K9GA 4BI4A 3OYBA 1IXDA 4X5OA 3FDRA 4H2TA 1ZHIA 1VQPA 5KE2A 4II1A 2HKNA 1HTTA 2HQXA 3C4SA 2XMFA 2RHIA 2LX9A 3X24B 4ZGDB 3L4GA 2Y90A 4ATOA 1SKUB 4BY6B 1NZ9A 3E9FA 1L0WA 5FROA 1FYFA 1GFDA 2RHSA 4C8QG 2DIGA 4AFZC 3TQ7P 4DA4A 4KRTA 1Y96B 3UATA 2OAWA 4DBRA 3OYMA 3CCJA 2X35A 3QTCA 4BD3A 1AVZC 3HSBA 4HVWA 1G8XA 2NUPA 1X2HA 2DD4A 2M02A 2E4HA 1HYOA 2DYIA 2I4OA 3CCVA 1QVPA 4C0ZA 3A8HB 1TUCA 3TUPA 2BZYA 3TVTA 1K9AA 1T0JA 2QXFA 3FC3A 4M7AF 3CD6A 1UJ0A 3ZEHA 4BY6C 2D8HA 2ZPFB 1S72Q 4FW2A 1B07A 1OI1A 1SF9A 1WXTA 2PVGB 4J9EA 1GCQA 2IY5A 5F5WA 3O5ZA 1X6BA 3LWHA 2D9TA 2D6FA 4HCBA 1RACB 2Q5HA 4ZGJB 2RJFA 3I56T 1I07A 1MNDA 4YRNA 4RTWA 2P4TA 2RQUA 4EDUA 4H2VA 2QQRA 3QZ5B 2JN0A 1K8AC 3FRNA 3G6ET 2IVWA 2AZSA 2DFUA 2ALYA 1NJIC 4H2UA 1XTDA 1SHFA 1RL2A 3SEMA 2CT4A 5GAMg 2LP5A 2MK5A 1M1KR 4XU2A 3Q1JA 3PIOA 4AG2C 1D0ZA 1ASZA 2DXCA 2D8JA 5I2SA 2YXYA 1ARKA 2MWPA 3LWIA 4AFQC 2DL3A 5I22A 3QZ9B 4C0GA 2R58A 2BIVA 1VQOQ 3H8ZA 2LRQA 2LZ6B 3BY7A 2IPOB 1QW1A 2JM9A 3I55A 2ZT8A 2LT4A 3QXEB 3OBWA 2F5TX 4JZ4A 3REXA 4YRSA 3HFNA 5GAOr 4OB0B 4X9CA 1YITA 1RLQC 1GFCA 4QKUA 5LL6S 3QIIA 4AG1C 1Q86R 1YFSA 4E51A 4J5YA 2O4XB 4CC4B 1VQMQ 1VQKA 4HVUA 4PNOA 3EFRA 5CKHA 5GAN7 2RJCA 2QA4T 4WF2A 2VWFA 3S3NA 1DJ7B 4OMNA 3JCMb 1TTHB 1YJ9T 3VJPA 1TSFA 4M75G 5CIUA 5KYUB 5D6WA 5FRMA 2QDLA 5A0GA 4YRGA 4R55A 1Q81C 1MV3A 2COWA 3WXMB 2KBTA 1UB4A 4M78F 2E6NA 4OGEA 3CQTA 2YLCA 4UPAA 2AKWB 4XEOA 4C92D 1VQOT 4TQDA 4CC3A 1LNXA 1K76A 2OI3A 4RTZA 3G4SA 1KK7A 3F70A 4J9IA 1YJWA 2DK3A 5I2MA 1S1NA 3FJ5A 1SEMA 3DLLA 4A4FA 4M77G 2B8AA 4RMOA 2M9UA 2EIFA 1WJQA 2KRSA 4O5VA 4Y91A 2DM1A 1FMVA 4JLGA 5KH6A 5KYWB 3OYAA 1GGMA 1RI0A 2H3JA 4GLKA 2CZ0B 1EIYA 4A4HA 5LJ5g 2PTKA 4OB1B 2X51A 3GBQA 5GMKe 2ARUA 2YWWA 1Q82R 3A5YA 2X9HA 5CO7A 2BUDA 4KGVB 5HK3A 1JEGA 4FW1A 2HSPA 1K8AU 1ZQ1A 1XJWB 3IQLA 4LUEA 4O6JA 5GAN2 2KRNA 4EX5A 1VQ4Q 1NJIU 3G1JA 2EVRA 2L3RA 3J7AF 1ZA2B 2QEXA 1VUBA 4J9DA 1SRLA 3VUZA 4PK4A 2KEAA 2X3WD 3KBGA 1I5OB 2CJAA 1EVLA 4YRRA 2EYZA 1KQSA 1SRYA 3LGFA 5GAN8 3MKDA 3N5BB 4ZN3A 2WACA 5GMKl 1B70B 2O4XA 4AFSC 4IUUA 4AMCA 1YHQQ 1JJ2P 3V7SA 3VKIA 1G51A 1UE9A 2RHQB 3KXTA 2EYQA 9ATCB 3LLRA 5M9OA 4K87A 4BWAA 3MQZA 1IHWA 4CS4A 2OAUA 1I1JA 2J3LA 4JRKA 1M30A 1PYSB 3VUBA 4N0AC 4YP0A 1SESA 3TREA 3L2ZA 1NJ2A 4XTUA 2FHDA 2K5LA 2K79A 3NGPA 4KH1B 1OQKA 2K2MA 2V8KA 2AKWA 3M56A 1RUWA 3HXVA 3CBOA 2LCCA 2LMJA 2ZT5A 1OZ3A 3ASKA 1NNHA 3TEGA 4HT9A 1Q81U 1AHJB 3EG0A 3OMGA 1K73R 5C53B 1N9RA 2KT1A 3SFMA 1AWXA 2P0QA 3LW5E 1YWPA 3CCMT 4G84A 3O8VA 1WYDA 4PFOA 4MZPA 3RESA 1YJNQ 3CCEA 5KYWA 1YHQT 2XDPA 4YRKA 3RNJA 2GBQA 4M4ZA 3BDUA 2HCKA 3RIRA 3GF5A 4A53A 5GANe 1Q82C 1CKBA 2ZPGB 3OB9A 1N8RC 4J6XA 3J80E 5D7UA 2DVEA 3BJUA 3UF4A 2DTHA 4ZTJA 3MP6A 1QQJA 3OS2A 3ZBDA 2LJ1A 1H4VB 2D1XA 4EMGA 2ZIMA 1BIBA 4N0AA 2EL9A 3M57A 4ESRA 1WZOA 3EFSA 4A54A 2ENMA 1YCSB 2QQSA 2FL7A 5GAOq 1HJDA 4PJOF 3M4QA 3ME9A 1WYXA 4D8KA 2KVQG 5C0MA 3I9QA 1B70A 2ED1A 2EQUA 1CSKA 4MZMA 4J9CA 4OB3B 5GAMj 4DPGA 4N4GA 2EYXA 3JCMg 5KYXA 2RQTA 1Y71A 3QYHB 1C1AA 1YBYA 4C5HA 1PRMC 2IIMA 3D7SB 2K7AA 4E7KA 4OMFB 4QW2A 4P3PA 4KR3A 2K5FA 1M3BA 1UGVA 1PYSA 3QJ6A 3CD6T 3OYGA 1SERA 1NYQA 2E64A 5GJVB 3QHSA 8AT1B 3GP8A 3G6EA 4P71A 1WU7A 4FU6A 2SRCA 2YDLA 3UT1A 3A5ZB 4LVKA 1D1BA 3OYDA 1K0XA 4IUTA 1QVFP 5GAMf 3JB9G 2XU8A 4KT0E 1ASYA 4M7DG 2OX7A 2CP7A 2F2WA 1D3BA 1R8OB 1UGQB 1YFTA 3A98A 3VS7A 4J7IA 3SD4A 1NLPC 4F16A 3OYFA 2XICA 3H0IA 3M58A 1S72A 1WPYA 2MCNA 3V7RA 3MHXA 1OPLA 4LN2A 4B9WA 4Y28E 3A8LB 3LSSA 3CXCA 2O88A 3V8KA 5CR2A 1IB8A 5FU7B 1M4ZA 2EJ9A 3I55T 1Q82U 4BE1A 4UP7A 3JCMh 1NE8A 3CEYA 2RD1A 1LJOA 4F7UG 2YRCA 3MEYA 4TQFA 3J81E 4K86A 3HRSA 1EVKA 3P8YA 5I21A 1UHFA 4P73C 4C8QA 1GRIA 2DTOA 3CCLQ 4HWTA 5DM7R 4UP9A 1G3SA 3HRTA 3OS1A 2A08A 4JJCA 2R5MA 2NUTA 1VQ9T 4E2FB 1VQOA 4OGCA 1M5Q1 3WVEB 4QQ6A 1JQQA 3OYEA 4ZN1A 2ECZA 3RL6A 1GCPA 1UG1A 4CH4A 4J15A 1VQ6Q 2AMCB 1M2VB 3H9NA 4M75B 4X9DA 3M0TA 4J6YA 5FU7C 2KDSA 2J6FA 4OMQA 2RQWA 2DILA 2GTOA 4CH5A 3QO8A 4PLLA 2E10A 5A0DA 5LJ5f 3OYHA 2XG8D 3A5ZA 1JJ2S 1RADB 4RQFA 2E6ZA 2OTJQ 1W1FA 4M77B 4M7AD 3M0PA 1X56A 1E6GA 3CCLT 1QWEA 4P73A 5L8RE 3UH0A 1B7TA 4C5EA 1B76A 3ICAA 2EJFA 3CCUQ 1WJRA 2LNHB 3HKSA 2EQIA 2A8EA 2I2LA 1KC8R 1JBMA 2KYBA 1K9MR 4F17A 4TVWA 5GAN4 3CMET 3CBPA 4M75C 3M4PA 2MF2A 4KH0B 2CJBA 4M75E 1LPLA 4PJLA 2JMAA 1V76A 2E41A 1VQLQ 4XTVA 4PFZA 3BDLA 3X25B 4FSSA 1X2GA 3CPWS 4E7ZA 4B9XA 3R6OA 2QHSA 1X6GA 1UDLA 2NWMA 1MMGA 2ODRD 1H4QA 4J8OA 1USYC 2FYKA 1O9SA 3URGA 4RTUA 1G2BA 4M77C 4H02A 4YRCA 1IREB 3OYLA 4J7FA 4M77E 3QDRB 3VRZA 2LDMA 2OTJT 4FYVB 3UGQA 3CC7Q 2Q7HA 2G4CA 1WQWA 1ADJA 2C0TA 3M59A 2DNUA 3TCJA 2X4JA 1RAIB 2GFAA 3CPFA 5GAOn 4OMMA 4C5GA 3VQYA 3A8OB 2KGTA 1QVGP 4YDQA 1HXDA 4D8DA 5L23A 4JRPA 4HT8A 4A4EA 3CCMA 4M75A 5ECAA 3JCMc 2DJZA 4RTTA 3E9IA 3I35A 4E7LA 1TH7A 3HP9A 3VS1A 4YREA 1VQ5Q 1YHQA 2C06A 2VASA 1WLPB 3HL8A 5LJ3e 1OYXA 2CZ6B 2G6FX 1YFNA 2DVJA 4HVCA 3A32A 2DA9A 4NS5A 1KIKA 4M77A 4MMKA 4OMOA 3CCET 4M78D 3MEWA 3MEAA 1RAHB 4ZIBA 5IH2A 3HXYA 2M51A 3CC7T 2RB6A 4NL3A 2QI2A 4PFPA 2I4LA 1ZSZB 1VQ7Q 3UWNA 3P8HA 1KQ1A 4ZNXA 1KJWA 2LJ0A 4EMHA 2PUOB 2LC4A 1X55A 1WHKA 2O01E 1XOVA 2E12A 1YGBA 3EG2A 3VS3A 3DLMA 1VIFA 4C92G 4TVYA 3JB9J 1NYGA 5GAMd 3REAB 2RA2A 2CS7A 3M9QA 1T3LA 2ED0A 4MMLA 4YPFA 3HRKA 1LYLA 2XKOC 4C5IA 1TUGB 4CS3A 1KOGA 3CC4Q 1VQ5T 3JCMf 1FXXA 2XK0A 11ASA 3PCOA 3PFSA 4OVAA 1KD1C 2E70A 2FRWA 2M16A 3LX7A 4FYYB 2ZR3A 4UC4A 1PRLC 5HGQA 1N9WA 1WA7A 2BKDN 5GAN6 5HKCA 4Z02A 5KCHA 1ZSZC 1N9SA 1H4TA 2DBMA 3EGDB 1OEBA 1BBWA 3GNGA 2COYA 1M8VA 1VQ7T 2PMEA 5CCAA 4E6RA 4M7AB 1EQRA 1OZ2A 2DETA 1M90R 1NJ8A 2ZNJA 2J6OA 1H92A 5J3BA 1MHNA 4P75C 1X2KA 1OU8A 3TEHB 5HK0A 3AHUA 2KR3A 2L3PA 2EYYA 2H3EB 2J06A 1AWOA 3X28B 1UUEA 4MZTA 3LSQA 3M4YA 4LXCA 1UFFA 5GAN5 1JJCB 4KR2A 3UA6A 2RI2A 4J9FA 4YRTA 2M0YA 3A8GB 2R5AA 2RI5A 4M7DB 2VC8A 3THKA 2RMOA 4FL6A 3IALA 3OMCA 4XK8E 2CJ9A 1S72T 4P74C 2J6KA 4M7AC 4FM4B 5FW9A 1G5HA 3GIBA 2ZZGA 2KXDA 1RABB 4M7AE 3LH0A 1Y96A 5LJ5d 4HWSA 2A0FB 3KFUA 3VYGA 4E7JA 2C8MA 3EG3A 5A0LA 2KYMA 4P75A 2V1QA 2V8JA 3DB4A 2P84A 3VYHB 2ZGWA 1H3ZA 2DMOA 2YHTA 2VVKA 2LVMA 1VQ9A 2ZZFA 1C0MA 1PC0A 3CCSQ 3CMAQ 4YRPA 4F7UB 2KMTA 4M7DC 3SB2A 3M0SA 3QO7A 1W6XA 3JRZA 2JTEA 2X3XD 4BI3A 1EIFA 4M7DE 2P4RA 3NETA 3RKYA 3OW2A 3SDZA 3OYNA 3A74A 4KQEA 2G3RA 2Y4YA 5GMKh 1VQZA 4L5GA 1KD1U 2DRKA 3FJPA 5IHIA 1TG0A 3VS6A 4PJOD 2KY9A 3ZFJA 1ZA1B 1NPRA 5IXBA 1VQMT 2MOXA 4LVMA 1HK9A 3RGLA 2HBWA 3WQZA 4HA8A 3CCLA 1SPKA 3E19A 4KBMB 5GANg 2P0PA 2O9SA 2CP6A 5IHNA 3JCMV 2RHUA 2VB6A 2QTVA 1QMCA 1M1KC 2NS6A 3EH1A 2MWOA 3CMAT 2DU7A 2W10A 4BDZA 5IT9E 1ATIA 4F7UE 3CMEA 4IKFA 2RM4A 1X2QA 1OU9A 4KUDK 2XIDA 4JJNK 1QVGS 4M7DA 1E1TA 1I4K1 4H2YA 5KYYB 1W2BA 2L3QA 3LGLA 3EG1A 2KT8A 3OBYA 1OV3A 2HMAA 1Q7YR 2O2OA 2D0QB 4GY5A 1AZGB 1Q86C 1MMDA 4OF1A 4YRMA 3BFMA 1G5VA 2EQKA 2OTJA 2RQRA 1NYRA 1YIJQ 3H41A 2A36A 3JB9I 4LD9K 2EPDA 2KNBB 3HXXA 1NBEB 4YROA 3PT9A 3JCMP 4ZTUB 2ZPHB 3CC2Q 1WIEA 1TU0B 3V8LA 1E22A 3S6WA 3RKWA 2LQKA 3SWNB 3RF1A 1O75A 1ZBJA 2PNIA 5KYUA 1N6AA 4F7UA 1FWZA 3L2WA 2OTLQ 1VQ4T 4E7IA 5EG2A 4FIBA 1V29B 2YUOA 1PG5B 1D1CA 5CKFA 3CCRQ 4FYXB 1I8FA 5CQXA 2HDAA 2FZGB 2NYSA 3QWYA 4DEYA 3PGGA 2FG0A 3LYIA 5GANh 4F04B 4LNPA 3ERRA 2DEQA 2M0OA 1TWBA 4EMKB 3OSVA 2LQNA 3RBBB 1GL5A 1IO6A 3NEMA 4RG2A 2MAMA 3VS0A 4KGZB 1WHHA 2CYZB 4J83A 1HSQA 2DKGA 1G5IA 4ANJA 4ELZC 2LTOA 2DL5A 3JAME 3CC7A 3SWNC 1T3SA 4JS4A 3M0RA 1ZSGA 4YRJA 3CCJQ 2KSSA 3E1SA 3CC2T 4CRIA 1EFWA 4CS2A 4E47A 3EHRA 1Q95G 5KCOA 3E2UA 1KQSP 1ZUKA 2DL7A 2WSEE 3AT1B 2DERA 4LDYA 2KK4A 3HHTB 1OPKA 2DL4A 2DXTA 1B7YB 3CCVQ 4HWPA 1M1KU 3G71Q 2XTIA 5GAOm 1KMNA 3IKMB 5LJ5e 1BBZA 2BE9B 4EMKC 1TUDA 2K3XA 2EFIA 1X69A 2PUKB 2RJEA 1VQ5A 3OYKA 2YUPA 1KHIA 4AT1B 4YCUA 3ULRB 3M5AA 4KGXB 4PLIA 2HQEA 4TVRA 5C51B 8ATCB 2ZT7A 5GMKj 4Z8AA 5FU6B 4C8QF 1PKTA 1SSHA 2EW3A 4C92B 1M3AA 2DEUA 2XHCA 1NJ5A 4DBQA 1YJNT 4DOWA 2QDYB 3NELA 3P8TA 2RHQA 1Q86U 1WFWA 4CI0C 4YRQA 1W70A 3HXZA 1M2OA 4PHCA 4CH6A 3LC0A 4M7AG 1IHVA 1XQHA 4P3NA 3H0FA 3SWNA 2PQWA 2DD5A 1VQ7A 2GQVA 3E9GA 2NUZA 5D6XA 2M1HA 4LE9A 4LD6A 2PMFA 4MDXA 2ROLA 2AKKA 2Q7GA 3PVLA 2DRMA 2RHYA 4RTYA 3G71T 4B6MA 3RMSA 2J7IA 3QWXX 3NENA 4XU1A 1GBRA 1K73C 3CC4A 4EMKA 6AT1B 2ZCFB 5FU6C 1P92A 2EKOA 3R07A 4C92C 3QKJA 2ZPEB 5CK9A 1BIAA 2RH2A 4YYEA 4ORZA 2OJ2A 1TOVA 2L3SA 4C92E 3I7FA 1ZUYA 4H2WA 1G3TA 5GAOp 1YITQ 3MJXA 1X27A 3TEEA 3OD1A 3NTKA 1VQKQ 1VQNQ 1QLYA 3CCQQ 2DE0X 3QJYA 3HFOA 2HL3A 4H2XB 2KI7A 5KYNA 2XDDA 1SSFA 1YWOA 2ZZDA 1K4US 1H8KA 1JO8A 1YI2Q 1PWTA 1LVKA 1ACMB 4G85A 2EBPA 4BACA 3QO5A 2JM8A 5GMKi 1X54A 3QPHA 4WCIA 4N4IA 2CP2A 2GTJA 3L2QA 2V8IA 2LQ8A 1QKWA 2HKQB 5KE3A 5GANj 3V8JA 1WLEA 1U8RA 2E5AA 3G4SQ 1YJWQ 4TVAB 1VQ8Q 2KAFA 4PKCC 4PL6A 4JRIA 5CQYA 3REBB 1IGQA 2YRVA 3META 3E9HA 4QT7A 1T0HA 4M78G 1AOJA 4Z89A 1NJ1A 1UGPB 3U23A 2VV5A 5CVIA 3PMIA 3WVDB 2W0ZA 4JLIA 2CIMA 4M75F 1VQMA 2CSIA 4EPCA 3SHWA 4XU3A 1PD0A 3PIPA 3GPLA 2JNGA 2KQWA 5LJ3g 3HFZB 2K2VA 5IXFA 2DIQA 4FYWB 1ZUUA 5GANf 1MGQA 2RQVA 2KRMA 2QEXQ 1D1AA 3CMAA 3CMQA 4K88A 5FWCA 3MF2A 4UP8A 1VYTA 2EQJA 4M77F 2ESWA 1D0XA 3CXCP 1UTIA 1QCFA 3FB9A 3PZCA 2YRDA 3FLGA 1UECA 1K73U 2FZKB 3MPUB 1KQ2A 1VQ8T 1Y57A 3TSWA 4BB7A 3QUIA 2ZR2A 2QASA 3OYYA 5K1XA 2CP5A 4O2DA 3RACA 3ZL7C 4XTXA 1VQ6T 3L4GB 1NLOC 4X34A 3HY1A 3UFGA 3HXUA 2RJDA 1KG1A 4XAXB 3VS5A 2ZINA 3I5SA 2FPDA 2O31A 3L2VA 4JJBA 3UDCA 2FRYA 2QHUA 2H8HA 3M55A 2WSFE 3HXWA 4L87A 4BI8B 2LQWA 2CZ7B 3QYGB 5DY9A 1VQ4A 2JW4A 4XTZA 1E1OA 1KQSS 1M27C 4FT2A 2XGTA 2F2VA 2KE9A 3CCUT 3X20B 1ABQA 2ZXFA 4OMPA 3UA7A 3EGUA 5LJ3h 2DQ0A 1QE0A 4LNSA 1BI2A 4HCZA 3DB3A 3GLXA 1RAAB 2AMCA 1U5SA 1BCOA 4GLMA 1M2VA 2EGEA 5GAN3 5CKEA 5DLOA 1U06A 3A1PA 5IN1A 2K57A 1VQLT 1YIJA 1KHCA 4BUGA 3HFZA 4PG3A 4DEXA 2CUBA 3CC2A 2ROTA 4TTVA 1N5ZA 2EWNA 3PMTA 1USYA 3G1ZA 4HT4A 2GGRA 4HWOA 1K8AR 3BW1A 2ALYB 2XDBA 1NJIR 1C6VX 1NYFA 3MO8A 4CC7A 4QVZA 1K0SA 1X75C 3RMQA 2X4WA 3CCRA 4RCCA 2I0NA 1KC8C 1K9MC 2ABLA 3MCAB 1N27A 1SETA 2DAQA 3L42A 2QAZA 3NPFA 4D6WA 1ZBXA 2L0AA 2RK2A 3JSCA 3NMZC 1NEBA 2GCXA 4RCBA 3GOXA 4RTVA 3P8DA 4FSXA 1IRXA 1OX8A 4DQ2A 2A3LA 1QVFS 1GCQC 4EIKA 2DO3A 4PJOG 4H2SA 2RPNA 1WXBA 5FLXE 1YJNA 4AH6A 3S3MA 2V26A 2COZA 1WHJA 3S3OA 4PJMA 1AD5A 4OB2B 1IZ6A 4LVIA 3I56Q 2HBPA 2RO0A 2CP3A 2BZ8A 3C12A 1Z7NA 5DLQE 3PE0A 2PU9B 2F5KA 2VGMA 2RNAA 2Z0WA 4TWAA 3G6EQ 3OYJA 1BI3A 2DXUA 3M54A 2HAXA 3NFCA 4JDSA 1I81A 2F1LA 1MMAA 2QGGA 4WTOB 1QKXA 3G71A 4CC2A 5GMKm 4BW9A 3EGXB 3QSUA 1MNEA 1E7OA 3GNFB 1Q81R 1JXOA 5HCKA 2AT1B 5CKBA 2E5QA 4DOVA 5KNNA 3A8MB 2AZVA 4YRFA 4PJNA 2GQIA 4IUVA 2LCSA 1KMMA 2Q7EA 3JB9H 2R57A 1YP5A 3C95A 2RHXA 4XQ3A 1GBQA 4JPBW 2ATCB 1M9SA 3CC4T 2EAYA 4NCXA 2E65A 4YTLA 2XI9A 4Q6GA 5E3IA 2ARSA 1JB0E 1EOVA 2QTXA 1EIYB 2QA4Q 1C0AA 2E3HA 2YUQA 2ZPIB 3JB9F 3EG9B 4M7DF 2IG0A 3HFVA 1U1TA 1PSFA 1YJ9Q 4J9GA 1ADYA 1ZSZA 4IUPA 4YRIA 1AT1B 2L89A 2ZAEA 2KXCA 2AHJB 5C6SA 3NHNA 2YSQA 5GANd 4BDYA 1MMNA 2E5KA 4HVVA 2PVOB 2ARTA 1BB9A 1KC8U 5LJ3j 1HC7A 2GF7A 1K9MU 3RDVA 2I4NA 3M4GA 1H4SA 1RLPC 3CXCS 3P8BB 5CAIA 1QWFA 1YNZA 2JVVA 2QYZA 4NOYA 4A63B 4LDWA 1VQNA 3CCQA 1M8MA 4F7UF 1U3OA 1IL2A 3HRUA 4MDWA 4BE2A 3VS2A 2ODRC 2EQMA 1X43A 3G7ZA 1PHTA 2A28A 5ELOA 1WHMA 4LDXA 3VS4A 1WQ7A 4DBHA 1WJSA 5C52B 1FYNA 3EGDA 2NLUA 1NG2A 3VBBA 1YI2A 4P74A 4YRLA 3MEUA 5LJ3f 5A2QE 2WSCE 4ZGEB 3EGXA 4M78B 1M90C 2CSQA 1JJ2A 4M7AA 4C8QD 2DLPA 2K6DA 2I4MA 1M1FA 1UHCA 2CUDA 3V7CA 3TEHA 2AK5A 1YCYA 3R6NA 2CP0A 2HQHA 3OYCA 3RUXA 5I11A 5GAMh 1VQ8A 1Z9ZA 2PVDB 3CCST 3M0UA 2HSEB 1QP2A 2JUFA 1JJCA 12ASA 2LJ3A 2DQ3A 2VGNA 1VQ6A 2FZCB 1R0BG 3HPWA 4A4KA 4Y92A 4WJ3M 2K4YA 3EG9A 2ZIOA 2DF6A 1J3TA 3UGTA 3HRIA 4RUGA 3L1AA 3CPWA 1U1SA 1N8RR 2JZ2A 2L2PA 5GAMe 2MI6A 4M78C 1D0YA 2Q5IA 4QQGA 5J26A 4M78E 3REUA 4AFUC 1QCOA 4RTXA 2VUBA 2JTMA 4IUQA 4F14A 1TS9A 3OW2P 1BYMA 3QG1A 1K1ZA 3X26B 3A7UA 3CCUA 1AWWA 3VRYA 3CCMQ 1FX7A 4V2SA 1OOTA 1Z9QA 2RHZA 4CH3A 2JS0A 4LDVA 2ZCEA 2C0OA 4P72C 4VUBA 1XNIA 2CH4W 2JOYA 5KYXB 3A7AA 4IIOA 2DYBA 4HXJA 3A31A 1WX6A 1VQLA 1BI1A 4LVJA 3MF1A 1VQPQ 2Y4XA 3PTAA 2HZYA 2VKNA 3OQ5A 4Q5WA 3JCMd 1W4SA 2P0LA 3UPUA 1EX4A 1Y7XA 4Q15A 1BCMA 4M78A 1OX9A 2VXEA 2B86A 1X01A 3NTHA 4HCCA 3EHQA 2DTIA 1BKBA 4KUIA 2GFUA 4XEMA 1BI0A 1YIJT 3PNWC 5LJ5h 2XD0A 3H6ZA 1JRIA 1M90U 4K11A 1W2BP 4YCWA 1RAEB 5EC7A 4HKEA 3CPWP 4X1VA 1D3BB 4RDXA 5CKDA 2DU5A 2ZNIA 2RK1A 1VA7A 2JJ9A 4M75D 2JTFA 4RMFA 3L2RA 2OTLT 4P72A 4QVDA 1QP3A 2RI3A 3MEVA 3OS0A 2ZTGA 1SG5A 3KFVA 3CCRT 5KYYA 1QVFA 3EAEA 2K3YA 5ELNA 2DPPB 1PM3A 2D0NA 2SEMA 3FEOA 1WDXA 3ER0A 3JV3A 2F69A 1TXQA 5AYFA 1Q7YC 1VQPT 3EFOB 2VXFA 4R56A 1JXMA 3INZA 3OS5A 3PVQA 3CD6Q 3FIFA 2DL8A 1YN8A 2LT1A 1BBUA 1MV0B 2FB7A 4M77D 4P71C 4L6V5 3MP8A 2FPFA 3KUFA 3LH5A 3MP1A 4NL2A 4C92F 4J9BA 1AWJA 3OSSC 2MYSA 4ELYC 5HY6A 1NPPA 2QGFB 4PJOB 1NJ6A 2A7YA 2CDTA 2HEQA 3A7RA 4A4GA 2DZCA 3L2UA 3CCJT 2HD0A 4C8QB 2MIOA 1J5WA 1YB3A 4ZTZB 2X4XA 4LUDA 2HNIA 2EGAA 2NUTB 3EH2A 1Y07A 1G3WA 3JCMX 2MPXC 4WJ4A 3OYIA 3CCVT 2QHVA 2MMPA 4N4HA 1NM7A 4IURA 4OMLA 4XTWA 2E3IA 2K5IA 4KULA 4FCYA 3I56A 1I5LA 1W66A 2DX1A 3I5RA 1VIEA 4OP0A 4Z88A 3I55Q 2GNCA 2C0IA 2EYWA 2EGCA 1BK2A 4OLFA 2AKLA 3IKLA 2RF0A 1R0CB 4PJOC 4ZTFA 3T9NA 2CKKA 2L5QA 5IHKA 1NEGA 3HTRA 4C0DB 1B3QA 1LCKA 4PJOE 5FRNA 4C8QC 1M1GA 1YFRA 4L59A 5GJWB 2FO0A 4RKUE 4C8QE 5FWBA 2P5IA 1PCXA 2QQ9A 2YUNA 5LJ3d 1VQ9Q 3P8VA 5D6YA 3H0HA 2HL5C 1B7YA 1H3HA 2QQBA 2JT4A 4J6WA 4FT4A 2ZPBB 3IG2A 3OA6A 2EJGA 3EFOA 3VU3C 5J39A 4JJDA 1SRMA 1GXIE 3JCMQ 1B8AA 3TSZA 2QK0A 1ABOA 4IIMA 3QBYA 2PZ1A 4P3OA 1WHLA 4QQDA 4YCVA 4RQEA 4C92A 1Q7YU 1N8RU 1PNJA 2JXBA 3VV0A 1Z7MA 2QA4A 1RAGB 1WGSA 4LDUA 2FVUA 4C0DC 1LOJA 1YITT 2EKHA 4JS5A 1BU1A 4PJOA 4QVCA 1KFZA 1YJ9A 1MUZA 1VQKT 1VQNT 3CCQT 1EZZB 1UGRB 5IAYA 5AT1B 5LJ5j 2K3BA 4GBQA 1G83A 2YLBA 2DJQA 1X6OA 1E6HA 2ZT6A 4HWRA 1FMKA 1B34B 1KSWA 2BE7D 1RAFB 2L8DA 1E24A 3JCMe 2E3CA 4LVLA 2O9VA 2F2XA 3CMEQ 2QQAA 7AT1B 1YI2T 2CT3A 2RN8A 3JCMW 1PKSA 2X4YA 1ZX6A 2CZ1B 3CCSA 4HCKA 1AEYA 3C94A 3OW2S 3QNEA 1RI9A 4EO4A 1IGUA 5K1PA 1RIQA 1G3YA 2ZZEA 1VOMA 3OY9A 3QDFA 4XU0A 2DDZA 3G4ST 2CREA 2YT6A 1PD1A 4XTYA 4PJJA 1YJWT 1QVGA 5GAOl 2FEIA 3TU4K 1R77A 2LX7A 4ME7A 1I0CA 3M0QA 2DBKA 1QCNA 2BZXA 4JUVA 1FMWA 1SHGA 1A0NB 2DXBA 2E1HA 4H2XA 2QHTA 1CKAA 2RHSB 1M3CA 3VQVA 4JRQA 1OULA 2AIRB 2FPEA 2KROA 4RG8A 2LNVA 2CGHA 1EFNA 3RKXA 1UJYA 1D09B 1QF6A 3RR6A 1F1BB 2DZ9A 2QEXT 3VQXA 1W2BS 3JB9D 3C0CA 4DBFA 1HD3A 2NUPB 2J3MA 4M7DD 3M53A 1VYUA 2QG9B 2C7IA 4TVAA 2BTTA 4C0FA 3HY0A 2CH4A 3PCOB 3NTIA 1H641 2A37A 3DKMA 3QO3A 1PSEA 1VYVA 4BE0A 1KD1R 3HTZA 1Y0MA 3CCEQ 4E7HA 1WHGA 4R0KA 2JMCA 2P0KA 3DSQA 1WNLA 4JZ3A 4WI1A 1WXUA 1B34A 3VQWA 2IY5B 1AZEA 1WI7A 3W3SA 1V1CA 1UGSB 2V1RA 4E7SA 4J9HA
chains in the Genus database with same CATH topology
4P5NA 3JCMJ 3CBMA 3RERA 2OTLA 2LCLA 2VYTA 1UEBA 4BI4A 3OYBA 4X5OA 3FDRA 4H2TA 1ZHIA 1VQPA 5KE2A 4II1A 1HTTA 2HQXA 3C4SA 2RHIA 2LX9A 3X24B 4ZGDB 3L4GA 2Y90A 4ATOA 4BY6B 1NZ9A 3E9FA 1L0WA 5FROA 1FYFA 2RHSA 4C8QG 2DIGA 4DA4A 1Y96B 3OYMA 3CCJA 2X35A 3QTCA 4BD3A 3HSBA 1X2HA 2DD4A 2I4OA 3CCVA 1QVPA 4C0ZA 3A8HB 3TUPA 2QXFA 3FC3A 4M7AF 3CD6A 3ZEHA 4BY6C 2ZPFB 1OI1A 2PVGB 2IY5A 5F5WA 3LWHA 2D9TA 2D6FA 4HCBA 2Q5HA 4ZGJB 2RJFA 3I56T 4YRNA 2P4TA 4EDUA 4H2VA 2QQRA 3QZ5B 2JN0A 1K8AC 3FRNA 3G6ET 2IVWA 2ALYA 1NJIC 4H2UA 1XTDA 1RL2A 5GAMg 4XU2A 3Q1JA 3PIOA 1ASZA 2DXCA 5I2SA 2MWPA 3LWIA 3QZ9B 4C0GA 2R58A 2BIVA 3H8ZA 2LRQA 3BY7A 1QW1A 3I55A 2ZT8A 2LT4A 3QXEB 3OBWA 2F5TX 3REXA 4YRSA 3HFNA 5GAOr 4OB0B 4X9CA 1YITA 5LL6S 3QIIA 1YFSA 4E51A 4J5YA 2O4XB 1VQKA 4PNOA 3EFRA 5CKHA 5GAN7 2RJCA 2QA4T 4WF2A 3S3NA 1DJ7B 3JCMb 1YJ9T 3VJPA 4M75G 5CIUA 5D6WA 5FRMA 5A0GA 4YRGA 4R55A 1Q81C 3WXMB 1UB4A 4M78F 2E6NA 4OGEA 2YLCA 4UPAA 2AKWB 4XEOA 4C92D 1VQOT 4TQDA 1LNXA 3G4SA 3F70A 1YJWA 2DK3A 5I2MA 3DLLA 4A4FA 4M77G 2B8AA 4RMOA 2M9UA 2EIFA 1WJQA 4O5VA 4Y91A 4JLGA 5KH6A 3OYAA 1GGMA 1RI0A 2H3JA 4GLKA 2CZ0B 1EIYA 4A4HA 5LJ5g 4OB1B 5GMKe 2ARUA 3A5YA 5CO7A 2BUDA 5HK3A 1K8AU 1ZQ1A 4O6JA 5GAN2 4EX5A 1NJIU 2L3RA 3J7AF 2QEXA 1VUBA 3VUZA 3KBGA 2CJAA 1EVLA 4YRRA 1KQSA 1SRYA 3LGFA 5GAN8 3N5BB 4ZN3A 2WACA 5GMKl 1B70B 2O4XA 4IUUA 3V7SA 3VKIA 1G51A 2RHQB 3KXTA 2EYQA 3LLRA 5M9OA 4K87A 4BWAA 3MQZA 4CS4A 2OAUA 2J3LA 4JRKA 1PYSB 3VUBA 4N0AC 4YP0A 1SESA 3TREA 3L2ZA 1NJ2A 4XTUA 2FHDA 2K5LA 2V8KA 2AKWA 3M56A 3HXVA 3CBOA 2LCCA 2ZT5A 1OZ3A 3ASKA 1NNHA 3TEGA 4HT9A 1Q81U 1AHJB 3OMGA 5C53B 1N9RA 3SFMA 3LW5E 2P0QA 3CCMT 4G84A 3O8VA 1WYDA 4MZPA 3RESA 3CCEA 1YHQT 2XDPA 4YRKA 3BDUA 3RIRA 3GF5A 4A53A 5GANe 1Q82C 2ZPGB 3OB9A 1N8RC 4J6XA 3J80E 2DVEA 3BJUA 2DTHA 4ZTJA 3MP6A 3OS2A 3ZBDA 1H4VB 4EMGA 2ZIMA 1BIBA 4N0AA 2EL9A 3M57A 3EFSA 4A54A 2QQSA 2FL7A 5GAOq 4PJOF 3M4QA 3ME9A 2KVQG 5C0MA 1B70A 2EQUA 4MZMA 4OB3B 5GAMj 4DPGA 4N4GA 3JCMg 1Y71A 3QYHB 1YBYA 4C5HA 4E7KA 4OMFB 4QW2A 4P3PA 4KR3A 2K5FA 1PYSA 3QJ6A 3CD6T 3OYGA 1SERA 1NYQA 2E64A 3QHSA 3GP8A 3G6EA 4P71A 1WU7A 4FU6A 3UT1A 3A5ZB 4LVKA 3OYDA 4IUTA 5GAMf 3JB9G 2XU8A 4KT0E 1ASYA 4M7DG 1D3BA 1R8OB 1UGQB 1YFTA 4J7IA 3SD4A 3OYFA 2XICA 3M58A 1S72A 1WPYA 3V7RA 3MHXA 4B9WA 4Y28E 3A8LB 3LSSA 3CXCA 3V8KA 5CR2A 5FU7B 1M4ZA 2EJ9A 3I55T 1Q82U 4BE1A 4UP7A 3JCMh 1NE8A 3CEYA 2RD1A 1LJOA 4F7UG 3MEYA 4TQFA 3J81E 4K86A 3HRSA 1EVKA 3P8YA 5I21A 4P73C 4C8QA 2DTOA 4HWTA 5DM7R 4UP9A 1G3SA 3HRTA 3OS1A 2R5MA 1VQ9T 1VQOA 4OGCA 1M5Q1 3WVEB 4QQ6A 3OYEA 4ZN1A 3RL6A 4CH4A 4J15A 2AMCB 4M75B 4X9DA 4J6YA 5FU7C 2KDSA 4CH5A 3QO8A 4PLLA 2E10A 5A0DA 5LJ5f 3OYHA 2XG8D 3A5ZA 1JJ2S 4RQFA 2E6ZA 4M77B 4M7AD 1X56A 3CCLT 4P73A 5L8RE 3UH0A 4C5EA 1B76A 3ICAA 2EJFA 1WJRA 3HKSA 2A8EA 2I2LA 1JBMA 4TVWA 5GAN4 3CMET 3CBPA 4M75C 3M4PA 2MF2A 2CJBA 4M75E 2E41A 4XTVA 3BDLA 3X25B 1X2GA 3CPWS 4B9XA 3R6OA 2QHSA 2ODRD 1H4QA 4J8OA 1USYC 2FYKA 1O9SA 3URGA 4M77C 4H02A 4YRCA 1IREB 3OYLA 4J7FA 4M77E 3QDRB 2LDMA 2OTJT 3UGQA 2Q7HA 2G4CA 1WQWA 1ADJA 3M59A 3TCJA 2X4JA 2GFAA 3CPFA 5GAOn 4C5GA 3VQYA 3A8OB 4YDQA 1HXDA 4JRPA 4HT8A 4A4EA 3CCMA 4M75A 3JCMc 2DJZA 3E9IA 4E7LA 1TH7A 3HP9A 4YREA 1YHQA 2C06A 3HL8A 5LJ3e 1OYXA 2CZ6B 4HVCA 3A32A 4NS5A 4M77A 4MMKA 3CCET 4M78D 3MEWA 3MEAA 4ZIBA 3HXYA 3CC7T 2RB6A 4NL3A 2QI2A 2I4LA 3UWNA 3P8HA 1KQ1A 4EMHA 2PUOB 2LC4A 1X55A 2O01E 1XOVA 2E12A 1YGBA 3DLMA 1VIFA 4C92G 4TVYA 3JB9J 5GAMd 2RA2A 2CS7A 3M9QA 4MMLA 4YPFA 3HRKA 1LYLA 2XKOC 4C5IA 4CS3A 1KOGA 1VQ5T 3JCMf 1FXXA 2XK0A 11ASA 3PCOA 3PFSA 4OVAA 1KD1C 2E70A 2M16A 3LX7A 2ZR3A 4UC4A 5HGQA 1N9WA 2BKDN 5GAN6 5HKCA 4Z02A 5KCHA 1N9SA 1H4TA 1BBWA 3GNGA 1M8VA 1VQ7T 2PMEA 5CCAA 4M7AB 1EQRA 1OZ2A 1NJ8A 2ZNJA 5J3BA 1MHNA 4P75C 3TEHB 5HK0A 3AHUA 3X28B 4MZTA 3LSQA 3M4YA 5GAN5 1JJCB 4KR2A 2RI2A 4YRTA 3A8GB 2R5AA 2RI5A 4M7DB 2VC8A 4FL6A 3IALA 3OMCA 4XK8E 2CJ9A 1S72T 4P74C 4M7AC 4FM4B 1G5HA 3GIBA 2ZZGA 4M7AE 3LH0A 1Y96A 5LJ5d 4HWSA 3KFUA 3VYGA 4E7JA 2C8MA 5A0LA 4P75A 2V8JA 3DB4A 3VYHB 1H3ZA 2ZGWA 2YHTA 2LVMA 1VQ9A 2ZZFA 4YRPA 4F7UB 2KMTA 4M7DC 3SB2A 3QO7A 3JRZA 4BI3A 1EIFA 4M7DE 3NETA 3RKYA 3OW2A 3SDZA 3OYNA 3A74A 4KQEA 2G3RA 2Y4YA 5GMKh 1VQZA 4L5GA 1KD1U 3FJPA 4PJOD 2KY9A 3ZFJA 1NPRA 1VQMT 4LVMA 1HK9A 3RGLA 3WQZA 4HA8A 3CCLA 3E19A 4KBMB 5GANg 2P0PA 3JCMV 2RHUA 1M1KC 2NS6A 2MWOA 3CMAT 2DU7A 4BDZA 5IT9E 1ATIA 4F7UE 3CMEA 4IKFA 2RM4A 4KUDK 2XIDA 4JJNK 1QVGS 4M7DA 1E1TA 1I4K1 4H2YA 1W2BA 3LGLA 3OBYA 2D0QB 4GY5A 1Q86C 4OF1A 4YRMA 3BFMA 1G5VA 2EQKA 2OTJA 1NYRA 3JB9I 4LD9K 3HXXA 4YROA 3PT9A 3JCMP 4ZTUB 2ZPHB 3V8LA 1E22A 3S6WA 3RKWA 2LQKA 3SWNB 3RF1A 1O75A 1N6AA 4F7UA 1FWZA 3L2WA 1VQ4T 4E7IA 5EG2A 4FIBA 1V29B 5CKFA 1I8FA 5CQXA 3PGGA 3LYIA 5GANh 3ERRA 2DEQA 2M0OA 4EMKB 3OSVA 3NEMA 4RG2A 2MAMA 2CYZB 4J83A 1G5IA 2DKGA 4ELZC 2LTOA 3JAME 3CC7A 3SWNC 4JS4A 4YRJA 2KSSA 3E1SA 3CC2T 4CRIA 1EFWA 4CS2A 4E47A 5KCOA 2WSEE 4LDYA 2KK4A 3HHTB 2DXTA 1B7YB 4HWPA 1M1KU 2XTIA 5GAOm 1KMNA 3IKMB 5LJ5e 4EMKC 2K3XA 2EFIA 2PUKB 2RJEA 1VQ5A 3OYKA 1KHIA 4YCUA 3M5AA 4PLIA 2HQEA 4TVRA 5C51B 2ZT7A 5GMKj 5FU6B 4C8QF 4C92B 2XHCA 1NJ5A 1YJNT 4DOWA 2QDYB 3NELA 3P8TA 2RHQA 1Q86U 4CI0C 4YRQA 3HXZA 4PHCA 4CH6A 3LC0A 4M7AG 1XQHA 4P3NA 3SWNA 2PQWA 2DD5A 1VQ7A 2GQVA 3E9GA 5D6XA 2M1HA 4LD6A 2PMFA 4MDXA 2Q7GA 2RHYA 3G71T 3RMSA 3NENA 4XU1A 1K73C 3CC4A 4EMKA 2ZCFB 5FU6C 1P92A 2EKOA 3R07A 4C92C 3QKJA 2ZPEB 5CK9A 1BIAA 2RH2A 4YYEA 4C92E 4H2WA 3I7FA 1G3TA 5GAOp 3TEEA 3OD1A 3NTKA 3QJYA 3HFOA 4H2XB 2XDDA 1SSFA 2ZZDA 4G85A 4BACA 3QO5A 5GMKi 1X54A 3QPHA 4N4IA 3L2QA 2V8IA 2LQ8A 5KE3A 5GANj 3V8JA 1WLEA 1U8RA 2E5AA 4TVAB 2KAFA 4PKCC 4PL6A 4JRIA 5CQYA 2YRVA 3META 3E9HA 1NJ1A 4M78G 1UGPB 2VV5A 5CVIA 3PMIA 3WVDB 4JLIA 2CIMA 4M75F 1VQMA 4EPCA 4XU3A 3PIPA 3GPLA 2JNGA 2KQWA 5LJ3g 3HFZB 2K2VA 2DIQA 5GANf 1MGQA 3CMAA 3CMQA 4K88A 3MF2A 4UP8A 2EQJA 4M77F 3FB9A 3PZCA 3FLGA 1K73U 1KQ2A 1VQ8T 4BB7A 3QUIA 2ZR2A 3OYYA 5K1XA 4O2DA 3RACA 4XTXA 1VQ6T 3L4GB 4X34A 3HY1A 3UFGA 3HXUA 2RJDA 1KG1A 4XAXB 2ZINA 3L2VA 3UDCA 2QHUA 3M55A 2WSFE 3HXWA 4L87A 4BI8B 2CZ7B 3QYGB 5DY9A 1VQ4A 4XTZA 1E1OA 1KQSS 4FT2A 2XGTA 3CCUT 3X20B 2ZXFA 2DQ0A 5LJ3h 1QE0A 4LNSA 1BI2A 4HCZA 3DB3A 3GLXA 2AMCA 5GAN3 5CKEA 5DLOA 5IN1A 2K57A 1VQLT 1YIJA 1KHCA 4BUGA 3HFZA 4PG3A 3CC2A 4TTVA 1USYA 2EWNA 3PMTA 3G1ZA 4HT4A 4HWOA 3BW1A 2ALYB 2XDBA 3MO8A 4QVZA 1X75C 3RMQA 2X4WA 3CCRA 4RCCA 1KC8C 1K9MC 3MCAB 1N27A 1SETA 2DAQA 3L42A 4D6WA 1ZBXA 2RK2A 3JSCA 2GCXA 4RCBA 3GOXA 3P8DA 4FSXA 4DQ2A 2A3LA 1QVFS 2DO3A 4PJOG 4H2SA 5FLXE 1YJNA 4AH6A 3S3MA 3S3OA 4OB2B 1IZ6A 4LVIA 2HBPA 2RO0A 3C12A 1Z7NA 5DLQE 2PU9B 2F5KA 2VGMA 4TWAA 3OYJA 1BI3A 2DXUA 3M54A 2HAXA 3NFCA 4JDSA 1I81A 3G71A 5GMKm 4BW9A 3QSUA 3GNFB 5CKBA 2E5QA 4DOVA 5KNNA 3A8MB 4YRFA 4IUVA 1KMMA 2Q7EA 3JB9H 2R57A 3C95A 2RHXA 4XQ3A 1M9SA 3CC4T 2EAYA 4NCXA 2E65A 4YTLA 2XI9A 4Q6GA 5E3IA 2ARSA 1JB0E 1EOVA 2QTXA 1EIYB 1C0AA 2ZPIB 3JB9F 4M7DF 2IG0A 3HFVA 1U1TA 1PSFA 1ADYA 4IUPA 4YRIA 2L89A 2AHJB 5C6SA 5GANd 4BDYA 2PVOB 2ARTA 1KC8U 5LJ3j 1HC7A 2GF7A 1K9MU 2I4NA 3M4GA 1H4SA 3CXCS 3P8BB 5CAIA 2JVVA 4NOYA 4LDWA 1VQNA 3CCQA 4F7UF 1IL2A 3HRUA 4MDWA 4BE2A 2ODRC 2EQMA 3G7ZA 5ELOA 4LDXA 1WQ7A 1WJSA 5C52B 2NLUA 3VBBA 1YI2A 4P74A 4YRLA 3MEUA 5LJ3f 5A2QE 2WSCE 4ZGEB 4M7AA 4M78B 1M90C 1JJ2A 4C8QD 2I4MA 1M1FA 3V7CA 3TEHA 1YCYA 3OYCA 3RUXA 5GAMh 1VQ8A 2PVDB 3CCST 1QP2A 2JUFA 1JJCA 12ASA 2DQ3A 2VGNA 1VQ6A 3HPWA 4A4KA 4WJ3M 2K4YA 2ZIOA 3UGTA 3HRIA 3L1AA 3CPWA 1U1SA 2JZ2A 5GAMe 2MI6A 4M78C 2Q5IA 4QQGA 5J26A 4M78E 3REUA 2VUBA 2JTMA 4IUQA 1BYMA 3QG1A 3X26B 3A7UA 3CCUA 1FX7A 4V2SA 2RHZA 4CH3A 4LDVA 2ZCEA 4P72C 4VUBA 1XNIA 2JOYA 3A7AA 3A31A 1VQLA 1BI1A 4LVJA 3MF1A 2Y4XA 3PTAA 3OQ5A 4Q5WA 3JCMd 1W4SA 2P0LA 3UPUA 1Y7XA 4Q15A 4M78A 2VXEA 3NTHA 1X01A 4HCCA 2DTIA 1BKBA 4KUIA 2GFUA 4XEMA 1BI0A 1YIJT 3PNWC 5LJ5h 2XD0A 3H6ZA 1JRIA 1M90U 4YCWA 4HKEA 1D3BB 4RDXA 5CKDA 2DU5A 2ZNIA 2RK1A 4M75D 2JTFA 4RMFA 3L2RA 2OTLT 4P72A 4QVDA 1QP3A 2RI3A 3MEVA 3OS0A 2ZTGA 3CCRT 1QVFA 3EAEA 2K3YA 5ELNA 2DPPB 3ER0A 3FEOA 2F69A 1Q7YC 5AYFA 1VQPT 2VXFA 4R56A 3OS5A 3INZA 3FIFA 2LT1A 1BBUA 2FB7A 4M77D 4P71C 4L6V5 3MP8A 3KUFA 3MP1A 4NL2A 4C92F 3OSSC 4ELYC 5HY6A 1NPPA 1NJ6A 4PJOB 2A7YA 3A7RA 4A4GA 2DZCA 3L2UA 3CCJT 2HD0A 4C8QB 1J5WA 1YB3A 4ZTZB 2X4XA 2HNIA 1Y07A 1G3WA 3JCMX 4WJ4A 3OYIA 3CCVT 2QHVA 2MMPA 4N4HA 4IURA 4XTWA 2K5IA 4KULA 3I56A 1I5LA 1W66A 1VIEA 4OP0A 4OLFA 3IKLA 4PJOC 4ZTFA 3T9NA 2CKKA 2L5QA 4C0DB 4PJOE 5FRNA 4C8QC 1M1GA 1YFRA 4L59A 4RKUE 4C8QE 2P5IA 2QQ9A 5LJ3d 3P8VA 5D6YA 1B7YA 2QQBA 4J6WA 4FT4A 2ZPBB 3IG2A 3OA6A 2EJGA 3VU3C 5J39A 1GXIE 3JCMQ 1B8AA 3QBYA 4P3OA 4QQDA 4YCVA 4RQEA 4C92A 1Q7YU 1N8RU 1Z7MA 3VV0A 2QA4A 1WGSA 4LDUA 2FVUA 4C0DC 1LOJA 1YITT 4JS5A 4PJOA 4QVCA 1YJ9A 1VQKT 1VQNT 3CCQT 1UGRB 5IAYA 5LJ5j 2YLBA 1X6OA 2ZT6A 4HWRA 1B34B 2L8DA 1E24A 3JCMe 2E3CA 4LVLA 2QQAA 1YI2T 3JCMW 2X4YA 2CZ1B 3CCSA 3C94A 3OW2S 3QNEA 4EO4A 5K1PA 1RIQA 1G3YA 2ZZEA 3OY9A 4XU0A 2DDZA 3G4ST 4XTYA 1YJWT 1QVGA 5GAOl 3TU4K 4ME7A 4JUVA 2DXBA 2E1HA 4H2XA 2QHTA 2RHSB 3VQVA 4JRQA 4RG8A 2LNVA 2CGHA 3RKXA 1QF6A 2DZ9A 2QEXT 3VQXA 1W2BS 3JB9D 2J3MA 4M7DD 3M53A 2C7IA 4TVAA 4C0FA 3HY0A 3PCOB 3NTIA 1H641 3DKMA 3QO3A 1PSEA 4BE0A 3HTZA 4E7HA 2P0KA 3DSQA 1WNLA 4WI1A 1B34A 3VQWA 2IY5B 3W3SA 1UGSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4S A;  4F7U G;  3MEY A;  5CAI A;  3JCM J;  1G5I A;  2DKG A;  4TQF A;  4K86 A;  3RER A;  4NOY A;  1EVK A;  3P8Y A;  5I21 A;  4P73 C;  4C8Q A;  2DTO A;  3SWN C;  4HWT A;  4F7U F;  1IL2 A;  4UP9 A;  4YRJ A;  4X5O A;  2ODR C;  1EFW A;  4CS2 A;  4H2T A;  5ELO A;  1HTT A;  1M5Q 1;  1WQ7 A;  5C52 B;  3RL6 A;  2DXT A;  2Y90 A;  3L4G A;  1B7Y B;  4P74 A;  4YRL A;  3VBB A;  4HWP A;  4CH4 A;  2XTI A;  5GAO m;  4J15 A;  5LJ3 f;  1KMN A;  2AMC B;  4M7A A;  4M78 B;  4M75 B;  4X9D A;  3IKM B;  4C8Q D;  5LJ5 e;  1L0W A;  4J6Y A;  2I4M A;  1FYF A;  4EMK C;  2RHS A;  3V7C A;  4C8Q G;  3TEH A;  1Y96 B;  4YCU A;  1YCY A;  4CH5 A;  3QO8 A;  3QTC A;  5C51 B;  2ZT7 A;  5GMK j;  4C8Q F;  2E10 A;  3HSB A;  3RUX A;  5GAM h;  5LJ5 f;  3A5Z A;  4C92 B;  1NJ5 A;  4RQF A;  1X2H A;  3NEL A;  2RHQ A;  4M77 B;  1JJC A;  12AS A;  3P8T A;  4M7A D;  4YRQ A;  3HXZ A;  4PHC A;  4CH6 A;  2I4O A;  3LC0 A;  4M7A G;  1X56 A;  2DQ3 A;  4P3N A;  4P73 A;  3TUP A;  3UH0 A;  3SWN A;  1B76 A;  3ICA A;  4WJ3 M;  2EJF A;  2ZIO A;  2PMF A;  2I2L A;  4M7A F;  3HRI A;  1JBM A;  3UGT A;  3L1A A;  1U1S A;  2Q7G A;  5GAM e;  4TVW A;  5GAN 4;  4M78 C;  4M75 C;  3M4P A;  2Q5I A;  2CJB A;  3REU A;  4M78 E;  4M75 E;  2IY5 A;  2E41 A;  5F5W A;  4XTV A;  3NEN A;  4XU1 A;  2Q5H A;  1X2G A;  4EMK A;  2QHS A;  3R07 A;  4YRN A;  2ODR D;  1H4Q A;  4C92 C;  4H2V A;  3A7U A;  1USY C;  1BIA A;  4YYE A;  2FYK A;  2JN0 A;  4C92 E;  4H2W A;  3I7F A;  4M77 C;  2ALY A;  5GAO p;  4H2U A;  4V2S A;  4H02 A;  4YRC A;  5GAM g;  4M77 E;  4CH3 A;  2ZCE A;  4P72 C;  3OD1 A;  3UGQ A;  2Q7H A;  2G4C A;  1WQW A;  4XU2 A;  1ADJ A;  3A7A A;  1ASZ A;  3A31 A;  5GAO n;  3MF1 A;  3HFO A;  3VQY A;  4H2X B;  3BY7 A;  4YDQ A;  1HXD A;  3JCM d;  2ZT8 A;  2P0L A;  4HT8 A;  4Q15 A;  4YRS A;  4M78 A;  4M75 A;  2VXE A;  3HFN A;  1X01 A;  3REX A;  5GAO r;  3JCM c;  4X9C A;  2DJZ A;  2DTI A;  4G85 A;  3E9I A;  3QO5 A;  1YFS A;  5GMK i;  1TH7 A;  1X54 A;  4J5Y A;  4XEM A;  4E51 A;  4YRE A;  5LJ5 h;  4PNO A;  1JRI A;  5GAN j;  3EFR A;  4YCW A;  3V8J A;  5GAN 7;  1WLE A;  2E5A A;  5LJ3 e;  4TVA B;  4WF2 A;  4HVC A;  1D3B B;  3A32 A;  4RDX A;  2DU5 A;  3JCM b;  4M77 A;  4MMK A;  2ZNI A;  4JRI A;  4M78 D;  4M75 D;  4RMF A;  3E9H A;  4ZIB A;  1NJ1 A;  4M78 G;  4M75 G;  3HXY A;  4P72 A;  2RB6 A;  4QVD A;  4NL3 A;  2ZTG A;  4YRG A;  4JLI A;  2I4L A;  5ELN A;  2CIM A;  1KQ1 A;  4M75 F;  4M78 F;  2VXF A;  4EMH A;  2YLC A;  4UPA A;  2AKW B;  4XEO A;  4C92 D;  1X55 A;  4XU3 A;  3INZ A;  4TQD A;  1LNX A;  1YGB A;  3FIF A;  4C92 G;  4TVY A;  1BBU A;  3JB9 J;  5LJ3 g;  2FB7 A;  4M77 D;  5GAM d;  3HFZ B;  4P71 C;  2RA2 A;  5GAN f;  4M77 G;  1MGQ A;  4MML A;  4NL2 A;  4YPF A;  3HRK A;  4C92 F;  1LYL A;  3CMQ A;  4K88 A;  3MF2 A;  4Y91 A;  4UP8 A;  4CS3 A;  1KOG A;  4PJO B;  3JCM f;  1NJ6 A;  4M77 F;  1GGM A;  11AS A;  3A7R A;  2DZC A;  1EIY A;  3FB9 A;  3PCO A;  5LJ5 g;  3PZC A;  4C8Q B;  2ZR3 A;  1J5W A;  1YB3 A;  4ZTZ B;  2HNI A;  5GMK e;  1KQ2 A;  2ARU A;  3A5Y A;  5HGQ A;  3QUI A;  1N9W A;  2ZR2 A;  5K1X A;  5GAN 6;  3JCM X;  5GAN 2;  4EX5 A;  4WJ4 A;  1N9S A;  1H4T A;  2QHV A;  4O2D A;  3RAC A;  4XTX A;  1BBW A;  3L4G B;  1M8V A;  2PME A;  4XTW A;  3HY1 A;  3UFG A;  3HXU A;  4M7A B;  1EQR A;  1NJ8 A;  2ZNJ A;  1I5L A;  1W66 A;  2ZIN A;  4P75 C;  2CJA A;  1EVL A;  4OP0 A;  4YRR A;  3TEH B;  3AHU A;  1SRY A;  5GAN 8;  2QHU A;  4OLF A;  5GMK l;  1B70 B;  3IKL A;  4PJO C;  3LSQ A;  3HXW A;  4L87 A;  4PJO E;  5DY9 A;  4C8Q C;  1YFR A;  3V7S A;  1G51 A;  4XTZ A;  2RHQ B;  5GAN 5;  1JJC B;  4KR2 A;  1E1O A;  4C8Q E;  2P5I A;  2XGT A;  4YRT A;  4K87 A;  4BWA A;  4M7D B;  2ZXF A;  2VC8 A;  5LJ3 d;  2DQ0 A;  5LJ3 h;  4CS4 A;  2J3L A;  4JRK A;  1QE0 A;  3P8V A;  4LNS A;  3IAL A;  1PYS B;  1B7Y A;  4N0A C;  2CJ9 A;  4YP0 A;  4P74 C;  1SES A;  2AMC A;  4J6W A;  5GAN 3;  3L2Z A;  4M7A C;  1NJ2 A;  4XTU A;  1G5H A;  3GIB A;  2ZZG A;  2K57 A;  3IG2 A;  2EJG A;  4M7A E;  3VU3 C;  2AKW A;  1Y96 A;  5LJ5 d;  3JCM Q;  1B8A A;  3HXV A;  2ZT5 A;  4HWS A;  3KFU A;  1NNH A;  2C8M A;  4HT9 A;  3TEG A;  3HFZ A;  4P3O A;  4PG3 A;  5C53 B;  1N9R A;  4P75 A;  4YCV A;  4RQE A;  4C92 A;  1Z7M A;  1USY A;  2EWN A;  2ZGW A;  3G1Z A;  4G84 A;  4TTV A;  1WYD A;  1LOJ A;  2YHT A;  4HWO A;  3RES A;  2ZZF A;  3BW1 A;  4PJO A;  4QVC A;  2ALY B;  4YRP A;  4F7U B;  4YRK A;  4M7D C;  5LJ5 j;  3SB2 A;  3QO7 A;  3BDU A;  4RCC A;  2YLB A;  3RIR A;  4A53 A;  5GAN e;  4M7D E;  2ZT6 A;  3NET A;  4J6X A;  4HWR A;  3RKY A;  2DVE A;  3BJU A;  1SET A;  1B34 B;  3A74 A;  2DTH A;  4KQE A;  5GMK h;  1VQZ A;  1E24 A;  3JCM e;  2E3C A;  1H4V B;  4EMG A;  4RCB A;  3FJP A;  2ZIM A;  1BIB A;  4PJO D;  4N0A A;  4DQ2 A;  3JCM W;  2EL9 A;  4PJO G;  4H2S A;  4AH6 A;  3QNE A;  3EFS A;  4A54 A;  4EO4 A;  1HK9 A;  3RGL A;  5K1P A;  1RIQ A;  3WQZ A;  5GAO q;  2ZZE A;  4HA8 A;  4PJO F;  3M4Q A;  1Z7N A;  4XU0 A;  5GAN g;  2DDZ A;  3JCM V;  4XTY A;  1B70 A;  4TWA A;  5GAO l;  2DXU A;  5GAM j;  4DPG A;  3JCM g;  1I81 A;  2DU7 A;  1ATI A;  4F7U E;  2RM4 A;  4JUV A;  5GMK m;  4M7D A;  2E1H A;  1E1T A;  4BW9 A;  1I4K 1;  4P3P A;  4KR3 A;  3QSU A;  4H2X A;  4H2Y A;  2QHT A;  1PYS A;  2RHS B;  3VQV A;  5KNN A;  1SER A;  4YRF A;  1NYQ A;  2E64 A;  1KMM A;  3QHS A;  4P71 A;  2Q7E A;  1WU7 A;  3JB9 H;  2CGH A;  4YRM A;  3RKX A;  3BFM A;  1QF6 A;  2DZ9 A;  4XQ3 A;  3VQX A;  3JB9 D;  1NYR A;  2EAY A;  2J3M A;  4M7D D;  4NCX A;  3JB9 I;  5GAM f;  2E65 A;  3JB9 G;  4Q6G A;  5E3I A;  3HXX A;  1ASY A;  2C7I A;  4M7D G;  4TVA A;  4YRO A;  2ARS A;  3JCM P;  4ZTU B;  1EOV A;  3V8L A;  1E22 A;  2QTX A;  1D3B A;  1EIY B;  3RKW A;  3HY0 A;  3SWN B;  3PCO B;  1C0A A;  1YFT A;  3RF1 A;  3JB9 F;  1H64 1;  3QO3 A;  4M7D F;  3HTZ A;  3HFV A;  1U1T A;  4F7U A;  1ADY A;  1WPY A;  3DSQ A;  4YRI A;  3V7R A;  1WNL A;  1I8F A;  4WI1 A;  3LSS A;  1B34 A;  3PGG A;  3VQW A;  2IY5 B;  5GAN d;  5GAN h;  3V8K A;  3W3S A;  3ERR A;  2DEQ A;  2ART A;  4EMK B;  2EJ9 A;  5LJ3 j;  1HC7 A;  4UP7 A;  3JCM h;  3NEM A;  2I4N A;  3M4G A;  2RD1 A;  1LJO A; 
#chains in the Genus database with same CATH topology
 4P5N A;  2J05 A;  1JU5 C;  3BE3 A;  3JCM J;  3CBM A;  2JS2 A;  3RER A;  2OTL A;  2LCL A;  2VYT A;  1UEB A;  1ZLM A;  2K9G A;  4BI4 A;  3OYB A;  1IXD A;  4X5O A;  3FDR A;  4H2T A;  1ZHI A;  1VQP A;  5KE2 A;  4II1 A;  2HKN A;  1HTT A;  2HQX A;  3C4S A;  2XMF A;  2RHI A;  2LX9 A;  3X24 B;  4ZGD B;  3L4G A;  2Y90 A;  4ATO A;  1SKU B;  4BY6 B;  1NZ9 A;  3E9F A;  1L0W A;  5FRO A;  1FYF A;  1GFD A;  2RHS A;  4C8Q G;  2DIG A;  4AFZ C;  3TQ7 P;  4DA4 A;  4KRT A;  1Y96 B;  3UAT A;  2OAW A;  4DBR A;  3OYM A;  3CCJ A;  2X35 A;  3QTC A;  4BD3 A;  1AVZ C;  3HSB A;  4HVW A;  1G8X A;  2NUP A;  1X2H A;  2DD4 A;  2M02 A;  2E4H A;  1HYO A;  2DYI A;  2I4O A;  3CCV A;  1QVP A;  4C0Z A;  3A8H B;  1TUC A;  3TUP A;  2BZY A;  3TVT A;  1K9A A;  1T0J A;  2QXF A;  3FC3 A;  4M7A F;  3CD6 A;  1UJ0 A;  3ZEH A;  4BY6 C;  2D8H A;  2ZPF B;  1S72 Q;  4FW2 A;  1B07 A;  1OI1 A;  1SF9 A;  1WXT A;  2PVG B;  4J9E A;  1GCQ A;  2IY5 A;  5F5W A;  3O5Z A;  1X6B A;  3LWH A;  2D9T A;  2D6F A;  4HCB A;  1RAC B;  2Q5H A;  4ZGJ B;  2RJF A;  3I56 T;  1I07 A;  1MND A;  4YRN A;  4RTW A;  2P4T A;  2RQU A;  4EDU A;  4H2V A;  2QQR A;  3QZ5 B;  2JN0 A;  1K8A C;  3FRN A;  3G6E T;  2IVW A;  2AZS A;  2DFU A;  2ALY A;  1NJI C;  4H2U A;  1XTD A;  1SHF A;  1RL2 A;  3SEM A;  2CT4 A;  5GAM g;  2LP5 A;  2MK5 A;  1M1K R;  4XU2 A;  3Q1J A;  3PIO A;  4AG2 C;  1D0Z A;  1ASZ A;  2DXC A;  2D8J A;  5I2S A;  2YXY A;  1ARK A;  2MWP A;  3LWI A;  4AFQ C;  2DL3 A;  5I22 A;  3QZ9 B;  4C0G A;  2R58 A;  2BIV A;  1VQO Q;  3H8Z A;  2LRQ A;  2LZ6 B;  3BY7 A;  2IPO B;  1QW1 A;  2JM9 A;  3I55 A;  2ZT8 A;  2LT4 A;  3QXE B;  3OBW A;  2F5T X;  4JZ4 A;  3REX A;  4YRS A;  3HFN A;  5GAO r;  4OB0 B;  4X9C A;  1YIT A;  1RLQ C;  1GFC A;  4QKU A;  5LL6 S;  3QII A;  4AG1 C;  1Q86 R;  1YFS A;  4E51 A;  4J5Y A;  2O4X B;  4CC4 B;  1VQM Q;  1VQK A;  4HVU A;  4PNO A;  3EFR A;  5CKH A;  5GAN 7;  2RJC A;  2QA4 T;  4WF2 A;  2VWF A;  3S3N A;  1DJ7 B;  4OMN A;  3JCM b;  1TTH B;  1YJ9 T;  3VJP A;  1TSF A;  4M75 G;  5CIU A;  5KYU B;  5D6W A;  5FRM A;  2QDL A;  5A0G A;  4YRG A;  4R55 A;  1Q81 C;  1MV3 A;  2COW A;  3WXM B;  2KBT A;  1UB4 A;  4M78 F;  2E6N A;  4OGE A;  3CQT A;  2YLC A;  4UPA A;  2AKW B;  4XEO A;  4C92 D;  1VQO T;  4TQD A;  4CC3 A;  1LNX A;  1K76 A;  2OI3 A;  4RTZ A;  3G4S A;  1KK7 A;  3F70 A;  4J9I A;  1YJW A;  2DK3 A;  5I2M A;  1S1N A;  3FJ5 A;  1SEM A;  3DLL A;  4A4F A;  4M77 G;  2B8A A;  4RMO A;  2M9U A;  2EIF A;  1WJQ A;  2KRS A;  4O5V A;  4Y91 A;  2DM1 A;  1FMV A;  4JLG A;  5KH6 A;  5KYW B;  3OYA A;  1GGM A;  1RI0 A;  2H3J A;  4GLK A;  2CZ0 B;  1EIY A;  4A4H A;  5LJ5 g;  2PTK A;  4OB1 B;  2X51 A;  3GBQ A;  5GMK e;  2ARU A;  2YWW A;  1Q82 R;  3A5Y A;  2X9H A;  5CO7 A;  2BUD A;  4KGV B;  5HK3 A;  1JEG A;  4FW1 A;  2HSP A;  1K8A U;  1ZQ1 A;  1XJW B;  3IQL A;  4LUE A;  4O6J A;  5GAN 2;  2KRN A;  4EX5 A;  1VQ4 Q;  1NJI U;  3G1J A;  2EVR A;  2L3R A;  3J7A F;  1ZA2 B;  2QEX A;  1VUB A;  4J9D A;  1SRL A;  3VUZ A;  4PK4 A;  2KEA A;  2X3W D;  3KBG A;  1I5O B;  2CJA A;  1EVL A;  4YRR A;  2EYZ A;  1KQS A;  1SRY A;  3LGF A;  5GAN 8;  3MKD A;  3N5B B;  4ZN3 A;  2WAC A;  5GMK l;  1B70 B;  2O4X A;  4AFS C;  4IUU A;  4AMC A;  1YHQ Q;  1JJ2 P;  3V7S A;  3VKI A;  1G51 A;  1UE9 A;  2RHQ B;  3KXT A;  2EYQ A;  9ATC B;  3LLR A;  5M9O A;  4K87 A;  4BWA A;  3MQZ A;  1IHW A;  4CS4 A;  2OAU A;  1I1J A;  2J3L A;  4JRK A;  1M30 A;  1PYS B;  3VUB A;  4N0A C;  4YP0 A;  1SES A;  3TRE A;  3L2Z A;  1NJ2 A;  4XTU A;  2FHD A;  2K5L A;  2K79 A;  3NGP A;  4KH1 B;  1OQK A;  2K2M A;  2V8K A;  2AKW A;  3M56 A;  1RUW A;  3HXV A;  3CBO A;  2LCC A;  2LMJ A;  2ZT5 A;  1OZ3 A;  3ASK A;  1NNH A;  3TEG A;  4HT9 A;  1Q81 U;  1AHJ B;  3EG0 A;  3OMG A;  1K73 R;  5C53 B;  1N9R A;  2KT1 A;  3SFM A;  1AWX A;  2P0Q A;  3LW5 E;  1YWP A;  3CCM T;  4G84 A;  3O8V A;  1WYD A;  4PFO A;  4MZP A;  3RES A;  1YJN Q;  3CCE A;  5KYW A;  1YHQ T;  2XDP A;  4YRK A;  3RNJ A;  2GBQ A;  4M4Z A;  3BDU A;  2HCK A;  3RIR A;  3GF5 A;  4A53 A;  5GAN e;  1Q82 C;  1CKB A;  2ZPG B;  3OB9 A;  1N8R C;  4J6X A;  3J80 E;  5D7U A;  2DVE A;  3BJU A;  3UF4 A;  2DTH A;  4ZTJ A;  3MP6 A;  1QQJ A;  3OS2 A;  3ZBD A;  2LJ1 A;  1H4V B;  2D1X A;  4EMG A;  2ZIM A;  1BIB A;  4N0A A;  2EL9 A;  3M57 A;  4ESR A;  1WZO A;  3EFS A;  4A54 A;  2ENM A;  1YCS B;  2QQS A;  2FL7 A;  5GAO q;  1HJD A;  4PJO F;  3M4Q A;  3ME9 A;  1WYX A;  4D8K A;  2KVQ G;  5C0M A;  3I9Q A;  1B70 A;  2ED1 A;  2EQU A;  1CSK A;  4MZM A;  4J9C A;  4OB3 B;  5GAM j;  4DPG A;  4N4G A;  2EYX A;  3JCM g;  5KYX A;  2RQT A;  1Y71 A;  3QYH B;  1C1A A;  1YBY A;  4C5H A;  1PRM C;  2IIM A;  3D7S B;  2K7A A;  4E7K A;  4OMF B;  4QW2 A;  4P3P A;  4KR3 A;  2K5F A;  1M3B A;  1UGV A;  1PYS A;  3QJ6 A;  3CD6 T;  3OYG A;  1SER A;  1NYQ A;  2E64 A;  5GJV B;  3QHS A;  8AT1 B;  3GP8 A;  3G6E A;  4P71 A;  1WU7 A;  4FU6 A;  2SRC A;  2YDL A;  3UT1 A;  3A5Z B;  4LVK A;  1D1B A;  3OYD A;  1K0X A;  4IUT A;  1QVF P;  5GAM f;  3JB9 G;  2XU8 A;  4KT0 E;  1ASY A;  4M7D G;  2OX7 A;  2CP7 A;  2F2W A;  1D3B A;  1R8O B;  1UGQ B;  1YFT A;  3A98 A;  3VS7 A;  4J7I A;  3SD4 A;  1NLP C;  4F16 A;  3OYF A;  2XIC A;  3H0I A;  3M58 A;  1S72 A;  1WPY A;  2MCN A;  3V7R A;  3MHX A;  1OPL A;  4LN2 A;  4B9W A;  4Y28 E;  3A8L B;  3LSS A;  3CXC A;  2O88 A;  3V8K A;  5CR2 A;  1IB8 A;  5FU7 B;  1M4Z A;  2EJ9 A;  3I55 T;  1Q82 U;  4BE1 A;  4UP7 A;  3JCM h;  1NE8 A;  3CEY A;  2RD1 A;  1LJO A;  4F7U G;  2YRC A;  3MEY A;  4TQF A;  3J81 E;  4K86 A;  3HRS A;  1EVK A;  3P8Y A;  5I21 A;  1UHF A;  4P73 C;  4C8Q A;  1GRI A;  2DTO A;  3CCL Q;  4HWT A;  5DM7 R;  4UP9 A;  1G3S A;  3HRT A;  3OS1 A;  2A08 A;  4JJC A;  2R5M A;  2NUT A;  1VQ9 T;  4E2F B;  1VQO A;  4OGC A;  1M5Q 1;  3WVE B;  4QQ6 A;  1JQQ A;  3OYE A;  4ZN1 A;  2ECZ A;  3RL6 A;  1GCP A;  1UG1 A;  4CH4 A;  4J15 A;  1VQ6 Q;  2AMC B;  1M2V B;  3H9N A;  4M75 B;  4X9D A;  3M0T A;  4J6Y A;  5FU7 C;  2KDS A;  2J6F A;  4OMQ A;  2RQW A;  2DIL A;  2GTO A;  4CH5 A;  3QO8 A;  4PLL A;  2E10 A;  5A0D A;  5LJ5 f;  3OYH A;  2XG8 D;  3A5Z A;  1JJ2 S;  1RAD B;  4RQF A;  2E6Z A;  2OTJ Q;  1W1F A;  4M77 B;  4M7A D;  3M0P A;  1X56 A;  1E6G A;  3CCL T;  1QWE A;  4P73 A;  5L8R E;  3UH0 A;  1B7T A;  4C5E A;  1B76 A;  3ICA A;  2EJF A;  3CCU Q;  1WJR A;  2LNH B;  3HKS A;  2EQI A;  2A8E A;  2I2L A;  1KC8 R;  1JBM A;  2KYB A;  1K9M R;  4F17 A;  4TVW A;  5GAN 4;  3CME T;  3CBP A;  4M75 C;  3M4P A;  2MF2 A;  4KH0 B;  2CJB A;  4M75 E;  1LPL A;  4PJL A;  2JMA A;  1V76 A;  2E41 A;  1VQL Q;  4XTV A;  4PFZ A;  3BDL A;  3X25 B;  4FSS A;  1X2G A;  3CPW S;  4E7Z A;  4B9X A;  3R6O A;  2QHS A;  1X6G A;  1UDL A;  2NWM A;  1MMG A;  2ODR D;  1H4Q A;  4J8O A;  1USY C;  2FYK A;  1O9S A;  3URG A;  4RTU A;  1G2B A;  4M77 C;  4H02 A;  4YRC A;  1IRE B;  3OYL A;  4J7F A;  4M77 E;  3QDR B;  3VRZ A;  2LDM A;  2OTJ T;  4FYV B;  3UGQ A;  3CC7 Q;  2Q7H A;  2G4C A;  1WQW A;  1ADJ A;  2C0T A;  3M59 A;  2DNU A;  3TCJ A;  2X4J A;  1RAI B;  2GFA A;  3CPF A;  5GAO n;  4OMM A;  4C5G A;  3VQY A;  3A8O B;  2KGT A;  1QVG P;  4YDQ A;  1HXD A;  4D8D A;  5L23 A;  4JRP A;  4HT8 A;  4A4E A;  3CCM A;  4M75 A;  5ECA A;  3JCM c;  2DJZ A;  4RTT A;  3E9I A;  3I35 A;  4E7L A;  1TH7 A;  3HP9 A;  3VS1 A;  4YRE A;  1VQ5 Q;  1YHQ A;  2C06 A;  2VAS A;  1WLP B;  3HL8 A;  5LJ3 e;  1OYX A;  2CZ6 B;  2G6F X;  1YFN A;  2DVJ A;  4HVC A;  3A32 A;  2DA9 A;  4NS5 A;  1KIK A;  4M77 A;  4MMK A;  4OMO A;  3CCE T;  4M78 D;  3MEW A;  3MEA A;  1RAH B;  4ZIB A;  5IH2 A;  3HXY A;  2M51 A;  3CC7 T;  2RB6 A;  4NL3 A;  2QI2 A;  4PFP A;  2I4L A;  1ZSZ B;  1VQ7 Q;  3UWN A;  3P8H A;  1KQ1 A;  4ZNX A;  1KJW A;  2LJ0 A;  4EMH A;  2PUO B;  2LC4 A;  1X55 A;  1WHK A;  2O01 E;  1XOV A;  2E12 A;  1YGB A;  3EG2 A;  3VS3 A;  3DLM A;  1VIF A;  4C92 G;  4TVY A;  3JB9 J;  1NYG A;  5GAM d;  3REA B;  2RA2 A;  2CS7 A;  3M9Q A;  1T3L A;  2ED0 A;  4MML A;  4YPF A;  3HRK A;  1LYL A;  2XKO C;  4C5I A;  1TUG B;  4CS3 A;  1KOG A;  3CC4 Q;  1VQ5 T;  3JCM f;  1FXX A;  2XK0 A;  11AS A;  3PCO A;  3PFS A;  4OVA A;  1KD1 C;  2E70 A;  2FRW A;  2M16 A;  3LX7 A;  4FYY B;  2ZR3 A;  4UC4 A;  1PRL C;  5HGQ A;  1N9W A;  1WA7 A;  2BKD N;  5GAN 6;  5HKC A;  4Z02 A;  5KCH A;  1ZSZ C;  1N9S A;  1H4T A;  2DBM A;  3EGD B;  1OEB A;  1BBW A;  3GNG A;  2COY A;  1M8V A;  1VQ7 T;  2PME A;  5CCA A;  4E6R A;  4M7A B;  1EQR A;  1OZ2 A;  2DET A;  1M90 R;  1NJ8 A;  2ZNJ A;  2J6O A;  1H92 A;  5J3B A;  1MHN A;  4P75 C;  1X2K A;  1OU8 A;  3TEH B;  5HK0 A;  3AHU A;  2KR3 A;  2L3P A;  2EYY A;  2H3E B;  2J06 A;  1AWO A;  3X28 B;  1UUE A;  4MZT A;  3LSQ A;  3M4Y A;  4LXC A;  1UFF A;  5GAN 5;  1JJC B;  4KR2 A;  3UA6 A;  2RI2 A;  4J9F A;  4YRT A;  2M0Y A;  3A8G B;  2R5A A;  2RI5 A;  4M7D B;  2VC8 A;  3THK A;  2RMO A;  4FL6 A;  3IAL A;  3OMC A;  4XK8 E;  2CJ9 A;  1S72 T;  4P74 C;  2J6K A;  4M7A C;  4FM4 B;  5FW9 A;  1G5H A;  3GIB A;  2ZZG A;  2KXD A;  1RAB B;  4M7A E;  3LH0 A;  1Y96 A;  5LJ5 d;  4HWS A;  2A0F B;  3KFU A;  3VYG A;  4E7J A;  2C8M A;  3EG3 A;  5A0L A;  2KYM A;  4P75 A;  2V1Q A;  2V8J A;  3DB4 A;  2P84 A;  3VYH B;  2ZGW A;  1H3Z A;  2DMO A;  2YHT A;  2VVK A;  2LVM A;  1VQ9 A;  2ZZF A;  1C0M A;  1PC0 A;  3CCS Q;  3CMA Q;  4YRP A;  4F7U B;  2KMT A;  4M7D C;  3SB2 A;  3M0S A;  3QO7 A;  1W6X A;  3JRZ A;  2JTE A;  2X3X D;  4BI3 A;  1EIF A;  4M7D E;  2P4R A;  3NET A;  3RKY A;  3OW2 A;  3SDZ A;  3OYN A;  3A74 A;  4KQE A;  2G3R A;  2Y4Y A;  5GMK h;  1VQZ A;  4L5G A;  1KD1 U;  2DRK A;  3FJP A;  5IHI A;  1TG0 A;  3VS6 A;  4PJO D;  2KY9 A;  3ZFJ A;  1ZA1 B;  1NPR A;  5IXB A;  1VQM T;  2MOX A;  4LVM A;  1HK9 A;  3RGL A;  2HBW A;  3WQZ A;  4HA8 A;  3CCL A;  1SPK A;  3E19 A;  4KBM B;  5GAN g;  2P0P A;  2O9S A;  2CP6 A;  5IHN A;  3JCM V;  2RHU A;  2VB6 A;  2QTV A;  1QMC A;  1M1K C;  2NS6 A;  3EH1 A;  2MWO A;  3CMA T;  2DU7 A;  2W10 A;  4BDZ A;  5IT9 E;  1ATI A;  4F7U E;  3CME A;  4IKF A;  2RM4 A;  1X2Q A;  1OU9 A;  4KUD K;  2XID A;  4JJN K;  1QVG S;  4M7D A;  1E1T A;  1I4K 1;  4H2Y A;  5KYY B;  1W2B A;  2L3Q A;  3LGL A;  3EG1 A;  2KT8 A;  3OBY A;  1OV3 A;  2HMA A;  1Q7Y R;  2O2O A;  2D0Q B;  4GY5 A;  1AZG B;  1Q86 C;  1MMD A;  4OF1 A;  4YRM A;  3BFM A;  1G5V A;  2EQK A;  2OTJ A;  2RQR A;  1NYR A;  1YIJ Q;  3H41 A;  2A36 A;  3JB9 I;  4LD9 K;  2EPD A;  2KNB B;  3HXX A;  1NBE B;  4YRO A;  3PT9 A;  3JCM P;  4ZTU B;  2ZPH B;  3CC2 Q;  1WIE A;  1TU0 B;  3V8L A;  1E22 A;  3S6W A;  3RKW A;  2LQK A;  3SWN B;  3RF1 A;  1O75 A;  1ZBJ A;  2PNI A;  5KYU A;  1N6A A;  4F7U A;  1FWZ A;  3L2W A;  2OTL Q;  1VQ4 T;  4E7I A;  5EG2 A;  4FIB A;  1V29 B;  2YUO A;  1PG5 B;  1D1C A;  5CKF A;  3CCR Q;  4FYX B;  1I8F A;  5CQX A;  2HDA A;  2FZG B;  2NYS A;  3QWY A;  4DEY A;  3PGG A;  2FG0 A;  3LYI A;  5GAN h;  4F04 B;  4LNP A;  3ERR A;  2DEQ A;  2M0O A;  1TWB A;  4EMK B;  3OSV A;  2LQN A;  3RBB B;  1GL5 A;  1IO6 A;  3NEM A;  4RG2 A;  2MAM A;  3VS0 A;  4KGZ B;  1WHH A;  2CYZ B;  4J83 A;  1HSQ A;  2DKG A;  1G5I A;  4ANJ A;  4ELZ C;  2LTO A;  2DL5 A;  3JAM E;  3CC7 A;  3SWN C;  1T3S A;  4JS4 A;  3M0R A;  1ZSG A;  4YRJ A;  3CCJ Q;  2KSS A;  3E1S A;  3CC2 T;  4CRI A;  1EFW A;  4CS2 A;  4E47 A;  3EHR A;  1Q95 G;  5KCO A;  3E2U A;  1KQS P;  1ZUK A;  2DL7 A;  2WSE E;  3AT1 B;  2DER A;  4LDY A;  2KK4 A;  3HHT B;  1OPK A;  2DL4 A;  2DXT A;  1B7Y B;  3CCV Q;  4HWP A;  1M1K U;  3G71 Q;  2XTI A;  5GAO m;  1KMN A;  3IKM B;  5LJ5 e;  1BBZ A;  2BE9 B;  4EMK C;  1TUD A;  2K3X A;  2EFI A;  1X69 A;  2PUK B;  2RJE A;  1VQ5 A;  3OYK A;  2YUP A;  1KHI A;  4AT1 B;  4YCU A;  3ULR B;  3M5A A;  4KGX B;  4PLI A;  2HQE A;  4TVR A;  5C51 B;  8ATC B;  2ZT7 A;  5GMK j;  4Z8A A;  5FU6 B;  4C8Q F;  1PKT A;  1SSH A;  2EW3 A;  4C92 B;  1M3A A;  2DEU A;  2XHC A;  1NJ5 A;  4DBQ A;  1YJN T;  4DOW A;  2QDY B;  3NEL A;  3P8T A;  2RHQ A;  1Q86 U;  1WFW A;  4CI0 C;  4YRQ A;  1W70 A;  3HXZ A;  1M2O A;  4PHC A;  4CH6 A;  3LC0 A;  4M7A G;  1IHV A;  1XQH A;  4P3N A;  3H0F A;  3SWN A;  2PQW A;  2DD5 A;  1VQ7 A;  2GQV A;  3E9G A;  2NUZ A;  5D6X A;  2M1H A;  4LE9 A;  4LD6 A;  2PMF A;  4MDX A;  2ROL A;  2AKK A;  2Q7G A;  3PVL A;  2DRM A;  2RHY A;  4RTY A;  3G71 T;  4B6M A;  3RMS A;  2J7I A;  3QWX X;  3NEN A;  4XU1 A;  1GBR A;  1K73 C;  3CC4 A;  4EMK A;  6AT1 B;  2ZCF B;  5FU6 C;  1P92 A;  2EKO A;  3R07 A;  4C92 C;  3QKJ A;  2ZPE B;  5CK9 A;  1BIA A;  2RH2 A;  4YYE A;  4ORZ A;  2OJ2 A;  1TOV A;  2L3S A;  4C92 E;  3I7F A;  1ZUY A;  4H2W A;  1G3T A;  5GAO p;  1YIT Q;  3MJX A;  1X27 A;  3TEE A;  3OD1 A;  3NTK A;  1VQK Q;  1VQN Q;  1QLY A;  3CCQ Q;  2DE0 X;  3QJY A;  3HFO A;  2HL3 A;  4H2X B;  2KI7 A;  5KYN A;  2XDD A;  1SSF A;  1YWO A;  2ZZD A;  1K4U S;  1H8K A;  1JO8 A;  1YI2 Q;  1PWT A;  1LVK A;  1ACM B;  4G85 A;  2EBP A;  4BAC A;  3QO5 A;  2JM8 A;  5GMK i;  1X54 A;  3QPH A;  4WCI A;  4N4I A;  2CP2 A;  2GTJ A;  3L2Q A;  2V8I A;  2LQ8 A;  1QKW A;  2HKQ B;  5KE3 A;  5GAN j;  3V8J A;  1WLE A;  1U8R A;  2E5A A;  3G4S Q;  1YJW Q;  4TVA B;  1VQ8 Q;  2KAF A;  4PKC C;  4PL6 A;  4JRI A;  5CQY A;  3REB B;  1IGQ A;  2YRV A;  3MET A;  3E9H A;  4QT7 A;  1T0H A;  4M78 G;  1AOJ A;  4Z89 A;  1NJ1 A;  1UGP B;  3U23 A;  2VV5 A;  5CVI A;  3PMI A;  3WVD B;  2W0Z A;  4JLI A;  2CIM A;  4M75 F;  1VQM A;  2CSI A;  4EPC A;  3SHW A;  4XU3 A;  1PD0 A;  3PIP A;  3GPL A;  2JNG A;  2KQW A;  5LJ3 g;  3HFZ B;  2K2V A;  5IXF A;  2DIQ A;  4FYW B;  1ZUU A;  5GAN f;  1MGQ A;  2RQV A;  2KRM A;  2QEX Q;  1D1A A;  3CMA A;  3CMQ A;  4K88 A;  5FWC A;  3MF2 A;  4UP8 A;  1VYT A;  2EQJ A;  4M77 F;  2ESW A;  1D0X A;  3CXC P;  1UTI A;  1QCF A;  3FB9 A;  3PZC A;  2YRD A;  3FLG A;  1UEC A;  1K73 U;  2FZK B;  3MPU B;  1KQ2 A;  1VQ8 T;  1Y57 A;  3TSW A;  4BB7 A;  3QUI A;  2ZR2 A;  2QAS A;  3OYY A;  5K1X A;  2CP5 A;  4O2D A;  3RAC A;  3ZL7 C;  4XTX A;  1VQ6 T;  3L4G B;  1NLO C;  4X34 A;  3HY1 A;  3UFG A;  3HXU A;  2RJD A;  1KG1 A;  4XAX B;  3VS5 A;  2ZIN A;  3I5S A;  2FPD A;  2O31 A;  3L2V A;  4JJB A;  3UDC A;  2FRY A;  2QHU A;  2H8H A;  3M55 A;  2WSF E;  3HXW A;  4L87 A;  4BI8 B;  2LQW A;  2CZ7 B;  3QYG B;  5DY9 A;  1VQ4 A;  2JW4 A;  4XTZ A;  1E1O A;  1KQS S;  1M27 C;  4FT2 A;  2XGT A;  2F2V A;  2KE9 A;  3CCU T;  3X20 B;  1ABQ A;  2ZXF A;  4OMP A;  3UA7 A;  3EGU A;  5LJ3 h;  2DQ0 A;  1QE0 A;  4LNS A;  1BI2 A;  4HCZ A;  3DB3 A;  3GLX A;  1RAA B;  2AMC A;  1U5S A;  1BCO A;  4GLM A;  1M2V A;  2EGE A;  5GAN 3;  5CKE A;  5DLO A;  1U06 A;  3A1P A;  5IN1 A;  2K57 A;  1VQL T;  1YIJ A;  1KHC A;  4BUG A;  3HFZ A;  4PG3 A;  4DEX A;  2CUB A;  3CC2 A;  2ROT A;  4TTV A;  1N5Z A;  2EWN A;  3PMT A;  1USY A;  3G1Z A;  4HT4 A;  2GGR A;  4HWO A;  1K8A R;  3BW1 A;  2ALY B;  2XDB A;  1NJI R;  1C6V X;  1NYF A;  3MO8 A;  4CC7 A;  4QVZ A;  1K0S A;  1X75 C;  3RMQ A;  2X4W A;  3CCR A;  4RCC A;  2I0N A;  1KC8 C;  1K9M C;  2ABL A;  3MCA B;  1N27 A;  1SET A;  2DAQ A;  3L42 A;  2QAZ A;  3NPF A;  4D6W A;  1ZBX A;  2L0A A;  2RK2 A;  3JSC A;  3NMZ C;  1NEB A;  2GCX A;  4RCB A;  3GOX A;  4RTV A;  3P8D A;  4FSX A;  1IRX A;  1OX8 A;  4DQ2 A;  2A3L A;  1QVF S;  1GCQ C;  4EIK A;  2DO3 A;  4PJO G;  4H2S A;  2RPN A;  1WXB A;  5FLX E;  1YJN A;  4AH6 A;  3S3M A;  2V26 A;  2COZ A;  1WHJ A;  3S3O A;  4PJM A;  1AD5 A;  4OB2 B;  1IZ6 A;  4LVI A;  3I56 Q;  2HBP A;  2RO0 A;  2CP3 A;  2BZ8 A;  3C12 A;  1Z7N A;  5DLQ E;  3PE0 A;  2PU9 B;  2F5K A;  2VGM A;  2RNA A;  2Z0W A;  4TWA A;  3G6E Q;  3OYJ A;  1BI3 A;  2DXU A;  3M54 A;  2HAX A;  3NFC A;  4JDS A;  1I81 A;  2F1L A;  1MMA A;  2QGG A;  4WTO B;  1QKX A;  3G71 A;  4CC2 A;  5GMK m;  4BW9 A;  3EGX B;  3QSU A;  1MNE A;  1E7O A;  3GNF B;  1Q81 R;  1JXO A;  5HCK A;  2AT1 B;  5CKB A;  2E5Q A;  4DOV A;  5KNN A;  3A8M B;  2AZV A;  4YRF A;  4PJN A;  2GQI A;  4IUV A;  2LCS A;  1KMM A;  2Q7E A;  3JB9 H;  2R57 A;  1YP5 A;  3C95 A;  2RHX A;  4XQ3 A;  1GBQ A;  4JPB W;  2ATC B;  1M9S A;  3CC4 T;  2EAY A;  4NCX A;  2E65 A;  4YTL A;  2XI9 A;  4Q6G A;  5E3I A;  2ARS A;  1JB0 E;  1EOV A;  2QTX A;  1EIY B;  2QA4 Q;  1C0A A;  2E3H A;  2YUQ A;  2ZPI B;  3JB9 F;  3EG9 B;  4M7D F;  2IG0 A;  3HFV A;  1U1T A;  1PSF A;  1YJ9 Q;  4J9G A;  1ADY A;  1ZSZ A;  4IUP A;  4YRI A;  1AT1 B;  2L89 A;  2ZAE A;  2KXC A;  2AHJ B;  5C6S A;  3NHN A;  2YSQ A;  5GAN d;  4BDY A;  1MMN A;  2E5K A;  4HVV A;  2PVO B;  2ART A;  1BB9 A;  1KC8 U;  5LJ3 j;  1HC7 A;  2GF7 A;  1K9M U;  3RDV A;  2I4N A;  3M4G A;  1H4S A;  1RLP C;  3CXC S;  3P8B B;  5CAI A;  1QWF A;  1YNZ A;  2JVV A;  2QYZ A;  4NOY A;  4A63 B;  4LDW A;  1VQN A;  3CCQ A;  1M8M A;  4F7U F;  1U3O A;  1IL2 A;  3HRU A;  4MDW A;  4BE2 A;  3VS2 A;  2ODR C;  2EQM A;  1X43 A;  3G7Z A;  1PHT A;  2A28 A;  5ELO A;  1WHM A;  4LDX A;  3VS4 A;  1WQ7 A;  4DBH A;  1WJS A;  5C52 B;  1FYN A;  3EGD A;  2NLU A;  1NG2 A;  3VBB A;  1YI2 A;  4P74 A;  4YRL A;  3MEU A;  5LJ3 f;  5A2Q E;  2WSC E;  4ZGE B;  3EGX A;  4M78 B;  1M90 C;  2CSQ A;  1JJ2 A;  4M7A A;  4C8Q D;  2DLP A;  2K6D A;  2I4M A;  1M1F A;  1UHC A;  2CUD A;  3V7C A;  3TEH A;  2AK5 A;  1YCY A;  3R6N A;  2CP0 A;  2HQH A;  3OYC A;  3RUX A;  5I11 A;  5GAM h;  1VQ8 A;  1Z9Z A;  2PVD B;  3CCS T;  3M0U A;  2HSE B;  1QP2 A;  2JUF A;  1JJC A;  12AS A;  2LJ3 A;  2DQ3 A;  2VGN A;  1VQ6 A;  2FZC B;  1R0B G;  3HPW A;  4A4K A;  4Y92 A;  4WJ3 M;  2K4Y A;  3EG9 A;  2ZIO A;  2DF6 A;  1J3T A;  3UGT A;  3HRI A;  4RUG A;  3L1A A;  3CPW A;  1U1S A;  1N8R R;  2JZ2 A;  2L2P A;  5GAM e;  2MI6 A;  4M78 C;  1D0Y A;  2Q5I A;  4QQG A;  5J26 A;  4M78 E;  3REU A;  4AFU C;  1QCO A;  4RTX A;  2VUB A;  2JTM A;  4IUQ A;  4F14 A;  1TS9 A;  3OW2 P;  1BYM A;  3QG1 A;  1K1Z A;  3X26 B;  3A7U A;  3CCU A;  1AWW A;  3VRY A;  3CCM Q;  1FX7 A;  4V2S A;  1OOT A;  1Z9Q A;  2RHZ A;  4CH3 A;  2JS0 A;  4LDV A;  2ZCE A;  2C0O A;  4P72 C;  4VUB A;  1XNI A;  2CH4 W;  2JOY A;  5KYX B;  3A7A A;  4IIO A;  2DYB A;  4HXJ A;  3A31 A;  1WX6 A;  1VQL A;  1BI1 A;  4LVJ A;  3MF1 A;  1VQP Q;  2Y4X A;  3PTA A;  2HZY A;  2VKN A;  3OQ5 A;  4Q5W A;  3JCM d;  1W4S A;  2P0L A;  3UPU A;  1EX4 A;  1Y7X A;  4Q15 A;  1BCM A;  4M78 A;  1OX9 A;  2VXE A;  2B86 A;  1X01 A;  3NTH A;  4HCC A;  3EHQ A;  2DTI A;  1BKB A;  4KUI A;  2GFU A;  4XEM A;  1BI0 A;  1YIJ T;  3PNW C;  5LJ5 h;  2XD0 A;  3H6Z A;  1JRI A;  1M90 U;  4K11 A;  1W2B P;  4YCW A;  1RAE B;  5EC7 A;  4HKE A;  3CPW P;  4X1V A;  1D3B B;  4RDX A;  5CKD A;  2DU5 A;  2ZNI A;  2RK1 A;  1VA7 A;  2JJ9 A;  4M75 D;  2JTF A;  4RMF A;  3L2R A;  2OTL T;  4P72 A;  4QVD A;  1QP3 A;  2RI3 A;  3MEV A;  3OS0 A;  2ZTG A;  1SG5 A;  3KFV A;  3CCR T;  5KYY A;  1QVF A;  3EAE A;  2K3Y A;  5ELN A;  2DPP B;  1PM3 A;  2D0N A;  2SEM A;  3FEO A;  1WDX A;  3ER0 A;  3JV3 A;  2F69 A;  1TXQ A;  5AYF A;  1Q7Y C;  1VQP T;  3EFO B;  2VXF A;  4R56 A;  1JXM A;  3INZ A;  3OS5 A;  3PVQ A;  3CD6 Q;  3FIF A;  2DL8 A;  1YN8 A;  2LT1 A;  1BBU A;  1MV0 B;  2FB7 A;  4M77 D;  4P71 C;  4L6V 5;  3MP8 A;  2FPF A;  3KUF A;  3LH5 A;  3MP1 A;  4NL2 A;  4C92 F;  4J9B A;  1AWJ A;  3OSS C;  2MYS A;  4ELY C;  5HY6 A;  1NPP A;  2QGF B;  4PJO B;  1NJ6 A;  2A7Y A;  2CDT A;  2HEQ A;  3A7R A;  4A4G A;  2DZC A;  3L2U A;  3CCJ T;  2HD0 A;  4C8Q B;  2MIO A;  1J5W A;  1YB3 A;  4ZTZ B;  2X4X A;  4LUD A;  2HNI A;  2EGA A;  2NUT B;  3EH2 A;  1Y07 A;  1G3W A;  3JCM X;  2MPX C;  4WJ4 A;  3OYI A;  3CCV T;  2QHV A;  2MMP A;  4N4H A;  1NM7 A;  4IUR A;  4OML A;  4XTW A;  2E3I A;  2K5I A;  4KUL A;  4FCY A;  3I56 A;  1I5L A;  1W66 A;  2DX1 A;  3I5R A;  1VIE A;  4OP0 A;  4Z88 A;  3I55 Q;  2GNC A;  2C0I A;  2EYW A;  2EGC A;  1BK2 A;  4OLF A;  2AKL A;  3IKL A;  2RF0 A;  1R0C B;  4PJO C;  4ZTF A;  3T9N A;  2CKK A;  2L5Q A;  5IHK A;  1NEG A;  3HTR A;  4C0D B;  1B3Q A;  1LCK A;  4PJO E;  5FRN A;  4C8Q C;  1M1G A;  1YFR A;  4L59 A;  5GJW B;  2FO0 A;  4RKU E;  4C8Q E;  5FWB A;  2P5I A;  1PCX A;  2QQ9 A;  2YUN A;  5LJ3 d;  1VQ9 Q;  3P8V A;  5D6Y A;  3H0H A;  2HL5 C;  1B7Y A;  1H3H A;  2QQB A;  2JT4 A;  4J6W A;  4FT4 A;  2ZPB B;  3IG2 A;  3OA6 A;  2EJG A;  3EFO A;  3VU3 C;  5J39 A;  4JJD A;  1SRM A;  1GXI E;  3JCM Q;  1B8A A;  3TSZ A;  2QK0 A;  1ABO A;  4IIM A;  3QBY A;  2PZ1 A;  4P3O A;  1WHL A;  4QQD A;  4YCV A;  4RQE A;  4C92 A;  1Q7Y U;  1N8R U;  1PNJ A;  2JXB A;  3VV0 A;  1Z7M A;  2QA4 A;  1RAG B;  1WGS A;  4LDU A;  2FVU A;  4C0D C;  1LOJ A;  1YIT T;  2EKH A;  4JS5 A;  1BU1 A;  4PJO A;  4QVC A;  1KFZ A;  1YJ9 A;  1MUZ A;  1VQK T;  1VQN T;  3CCQ T;  1EZZ B;  1UGR B;  5IAY A;  5AT1 B;  5LJ5 j;  2K3B A;  4GBQ A;  1G83 A;  2YLB A;  2DJQ A;  1X6O A;  1E6H A;  2ZT6 A;  4HWR A;  1FMK A;  1B34 B;  1KSW A;  2BE7 D;  1RAF B;  2L8D A;  1E24 A;  3JCM e;  2E3C A;  4LVL A;  2O9V A;  2F2X A;  3CME Q;  2QQA A;  7AT1 B;  1YI2 T;  2CT3 A;  2RN8 A;  3JCM W;  1PKS A;  2X4Y A;  1ZX6 A;  2CZ1 B;  3CCS A;  4HCK A;  1AEY A;  3C94 A;  3OW2 S;  3QNE A;  1RI9 A;  4EO4 A;  1IGU A;  5K1P A;  1RIQ A;  1G3Y A;  2ZZE A;  1VOM A;  3OY9 A;  3QDF A;  4XU0 A;  2DDZ A;  3G4S T;  2CRE A;  2YT6 A;  1PD1 A;  4XTY A;  4PJJ A;  1YJW T;  1QVG A;  5GAO l;  2FEI A;  3TU4 K;  1R77 A;  2LX7 A;  4ME7 A;  1I0C A;  3M0Q A;  2DBK A;  1QCN A;  2BZX A;  4JUV A;  1FMW A;  1SHG A;  1A0N B;  2DXB A;  2E1H A;  4H2X A;  2QHT A;  1CKA A;  2RHS B;  1M3C A;  3VQV A;  4JRQ A;  1OUL A;  2AIR B;  2FPE A;  2KRO A;  4RG8 A;  2LNV A;  2CGH A;  1EFN A;  3RKX A;  1UJY A;  1D09 B;  1QF6 A;  3RR6 A;  1F1B B;  2DZ9 A;  2QEX T;  3VQX A;  1W2B S;  3JB9 D;  3C0C A;  4DBF A;  1HD3 A;  2NUP B;  2J3M A;  4M7D D;  3M53 A;  1VYU A;  2QG9 B;  2C7I A;  4TVA A;  2BTT A;  4C0F A;  3HY0 A;  2CH4 A;  3PCO B;  3NTI A;  1H64 1;  2A37 A;  3DKM A;  3QO3 A;  1PSE A;  1VYV A;  4BE0 A;  1KD1 R;  3HTZ A;  1Y0M A;  3CCE Q;  4E7H A;  1WHG A;  4R0K A;  2JMC A;  2P0K A;  3DSQ A;  1WNL A;  4JZ3 A;  4WI1 A;  1WXU A;  1B34 A;  3VQW A;  2IY5 B;  1AZE A;  1WI7 A;  3W3S A;  1V1C A;  1UGS B;  2V1R A;  4E7S A;  4J9H A; 
#chains in the Genus database with same CATH homology
 4P5N A;  3JCM J;  3CBM A;  3RER A;  2OTL A;  2LCL A;  2VYT A;  1UEB A;  4BI4 A;  3OYB A;  4X5O A;  3FDR A;  4H2T A;  1ZHI A;  1VQP A;  5KE2 A;  4II1 A;  1HTT A;  2HQX A;  3C4S A;  2RHI A;  2LX9 A;  3X24 B;  4ZGD B;  3L4G A;  2Y90 A;  4ATO A;  4BY6 B;  1NZ9 A;  3E9F A;  1L0W A;  5FRO A;  1FYF A;  2RHS A;  4C8Q G;  2DIG A;  4DA4 A;  1Y96 B;  3OYM A;  3CCJ A;  2X35 A;  3QTC A;  4BD3 A;  3HSB A;  1X2H A;  2DD4 A;  2I4O A;  3CCV A;  1QVP A;  4C0Z A;  3A8H B;  3TUP A;  2QXF A;  3FC3 A;  4M7A F;  3CD6 A;  3ZEH A;  4BY6 C;  2ZPF B;  1OI1 A;  2PVG B;  2IY5 A;  5F5W A;  3LWH A;  2D9T A;  2D6F A;  4HCB A;  2Q5H A;  4ZGJ B;  2RJF A;  3I56 T;  4YRN A;  2P4T A;  4EDU A;  4H2V A;  2QQR A;  3QZ5 B;  2JN0 A;  1K8A C;  3FRN A;  3G6E T;  2IVW A;  2ALY A;  1NJI C;  4H2U A;  1XTD A;  1RL2 A;  5GAM g;  4XU2 A;  3Q1J A;  3PIO A;  1ASZ A;  2DXC A;  5I2S A;  2MWP A;  3LWI A;  3QZ9 B;  4C0G A;  2R58 A;  2BIV A;  3H8Z A;  2LRQ A;  3BY7 A;  1QW1 A;  3I55 A;  2ZT8 A;  2LT4 A;  3QXE B;  3OBW A;  2F5T X;  3REX A;  4YRS A;  3HFN A;  5GAO r;  4OB0 B;  4X9C A;  1YIT A;  5LL6 S;  3QII A;  1YFS A;  4E51 A;  4J5Y A;  2O4X B;  1VQK A;  4PNO A;  3EFR A;  5CKH A;  5GAN 7;  2RJC A;  2QA4 T;  4WF2 A;  3S3N A;  1DJ7 B;  3JCM b;  1YJ9 T;  3VJP A;  4M75 G;  5CIU A;  5D6W A;  5FRM A;  5A0G A;  4YRG A;  4R55 A;  1Q81 C;  3WXM B;  1UB4 A;  4M78 F;  2E6N A;  4OGE A;  2YLC A;  4UPA A;  2AKW B;  4XEO A;  4C92 D;  1VQO T;  4TQD A;  1LNX A;  3G4S A;  3F70 A;  1YJW A;  2DK3 A;  5I2M A;  3DLL A;  4A4F A;  4M77 G;  2B8A A;  4RMO A;  2M9U A;  2EIF A;  1WJQ A;  4O5V A;  4Y91 A;  4JLG A;  5KH6 A;  3OYA A;  1GGM A;  1RI0 A;  2H3J A;  4GLK A;  2CZ0 B;  1EIY A;  4A4H A;  5LJ5 g;  4OB1 B;  5GMK e;  2ARU A;  3A5Y A;  5CO7 A;  2BUD A;  5HK3 A;  1K8A U;  1ZQ1 A;  4O6J A;  5GAN 2;  4EX5 A;  1NJI U;  2L3R A;  3J7A F;  2QEX A;  1VUB A;  3VUZ A;  3KBG A;  2CJA A;  1EVL A;  4YRR A;  1KQS A;  1SRY A;  3LGF A;  5GAN 8;  3N5B B;  4ZN3 A;  2WAC A;  5GMK l;  1B70 B;  2O4X A;  4IUU A;  3V7S A;  3VKI A;  1G51 A;  2RHQ B;  3KXT A;  2EYQ A;  3LLR A;  5M9O A;  4K87 A;  4BWA A;  3MQZ A;  4CS4 A;  2OAU A;  2J3L A;  4JRK A;  1PYS B;  3VUB A;  4N0A C;  4YP0 A;  1SES A;  3TRE A;  3L2Z A;  1NJ2 A;  4XTU A;  2FHD A;  2K5L A;  2V8K A;  2AKW A;  3M56 A;  3HXV A;  3CBO A;  2LCC A;  2ZT5 A;  1OZ3 A;  3ASK A;  1NNH A;  3TEG A;  4HT9 A;  1Q81 U;  1AHJ B;  3OMG A;  5C53 B;  1N9R A;  3SFM A;  3LW5 E;  2P0Q A;  3CCM T;  4G84 A;  3O8V A;  1WYD A;  4MZP A;  3RES A;  3CCE A;  1YHQ T;  2XDP A;  4YRK A;  3BDU A;  3RIR A;  3GF5 A;  4A53 A;  5GAN e;  1Q82 C;  2ZPG B;  3OB9 A;  1N8R C;  4J6X A;  3J80 E;  2DVE A;  3BJU A;  2DTH A;  4ZTJ A;  3MP6 A;  3OS2 A;  3ZBD A;  1H4V B;  4EMG A;  2ZIM A;  1BIB A;  4N0A A;  2EL9 A;  3M57 A;  3EFS A;  4A54 A;  2QQS A;  2FL7 A;  5GAO q;  4PJO F;  3M4Q A;  3ME9 A;  2KVQ G;  5C0M A;  1B70 A;  2EQU A;  4MZM A;  4OB3 B;  5GAM j;  4DPG A;  4N4G A;  3JCM g;  1Y71 A;  3QYH B;  1YBY A;  4C5H A;  4E7K A;  4OMF B;  4QW2 A;  4P3P A;  4KR3 A;  2K5F A;  1PYS A;  3QJ6 A;  3CD6 T;  3OYG A;  1SER A;  1NYQ A;  2E64 A;  3QHS A;  3GP8 A;  3G6E A;  4P71 A;  1WU7 A;  4FU6 A;  3UT1 A;  3A5Z B;  4LVK A;  3OYD A;  4IUT A;  5GAM f;  3JB9 G;  2XU8 A;  4KT0 E;  1ASY A;  4M7D G;  1D3B A;  1R8O B;  1UGQ B;  1YFT A;  4J7I A;  3SD4 A;  3OYF A;  2XIC A;  3M58 A;  1S72 A;  1WPY A;  3V7R A;  3MHX A;  4B9W A;  4Y28 E;  3A8L B;  3LSS A;  3CXC A;  3V8K A;  5CR2 A;  5FU7 B;  1M4Z A;  2EJ9 A;  3I55 T;  1Q82 U;  4BE1 A;  4UP7 A;  3JCM h;  1NE8 A;  3CEY A;  2RD1 A;  1LJO A;  4F7U G;  3MEY A;  4TQF A;  3J81 E;  4K86 A;  3HRS A;  1EVK A;  3P8Y A;  5I21 A;  4P73 C;  4C8Q A;  2DTO A;  4HWT A;  5DM7 R;  4UP9 A;  1G3S A;  3HRT A;  3OS1 A;  2R5M A;  1VQ9 T;  1VQO A;  4OGC A;  1M5Q 1;  3WVE B;  4QQ6 A;  3OYE A;  4ZN1 A;  3RL6 A;  4CH4 A;  4J15 A;  2AMC B;  4M75 B;  4X9D A;  4J6Y A;  5FU7 C;  2KDS A;  4CH5 A;  3QO8 A;  4PLL A;  2E10 A;  5A0D A;  5LJ5 f;  3OYH A;  2XG8 D;  3A5Z A;  1JJ2 S;  4RQF A;  2E6Z A;  4M77 B;  4M7A D;  1X56 A;  3CCL T;  4P73 A;  5L8R E;  3UH0 A;  4C5E A;  1B76 A;  3ICA A;  2EJF A;  1WJR A;  3HKS A;  2A8E A;  2I2L A;  1JBM A;  4TVW A;  5GAN 4;  3CME T;  3CBP A;  4M75 C;  3M4P A;  2MF2 A;  2CJB A;  4M75 E;  2E41 A;  4XTV A;  3BDL A;  3X25 B;  1X2G A;  3CPW S;  4B9X A;  3R6O A;  2QHS A;  2ODR D;  1H4Q A;  4J8O A;  1USY C;  2FYK A;  1O9S A;  3URG A;  4M77 C;  4H02 A;  4YRC A;  1IRE B;  3OYL A;  4J7F A;  4M77 E;  3QDR B;  2LDM A;  2OTJ T;  3UGQ A;  2Q7H A;  2G4C A;  1WQW A;  1ADJ A;  3M59 A;  3TCJ A;  2X4J A;  2GFA A;  3CPF A;  5GAO n;  4C5G A;  3VQY A;  3A8O B;  4YDQ A;  1HXD A;  4JRP A;  4HT8 A;  4A4E A;  3CCM A;  4M75 A;  3JCM c;  2DJZ A;  3E9I A;  4E7L A;  1TH7 A;  3HP9 A;  4YRE A;  1YHQ A;  2C06 A;  3HL8 A;  5LJ3 e;  1OYX A;  2CZ6 B;  4HVC A;  3A32 A;  4NS5 A;  4M77 A;  4MMK A;  3CCE T;  4M78 D;  3MEW A;  3MEA A;  4ZIB A;  3HXY A;  3CC7 T;  2RB6 A;  4NL3 A;  2QI2 A;  2I4L A;  3UWN A;  3P8H A;  1KQ1 A;  4EMH A;  2PUO B;  2LC4 A;  1X55 A;  2O01 E;  1XOV A;  2E12 A;  1YGB A;  3DLM A;  1VIF A;  4C92 G;  4TVY A;  3JB9 J;  5GAM d;  2RA2 A;  2CS7 A;  3M9Q A;  4MML A;  4YPF A;  3HRK A;  1LYL A;  2XKO C;  4C5I A;  4CS3 A;  1KOG A;  1VQ5 T;  3JCM f;  1FXX A;  2XK0 A;  11AS A;  3PCO A;  3PFS A;  4OVA A;  1KD1 C;  2E70 A;  2M16 A;  3LX7 A;  2ZR3 A;  4UC4 A;  5HGQ A;  1N9W A;  2BKD N;  5GAN 6;  5HKC A;  4Z02 A;  5KCH A;  1N9S A;  1H4T A;  1BBW A;  3GNG A;  1M8V A;  1VQ7 T;  2PME A;  5CCA A;  4M7A B;  1EQR A;  1OZ2 A;  1NJ8 A;  2ZNJ A;  5J3B A;  1MHN A;  4P75 C;  3TEH B;  5HK0 A;  3AHU A;  3X28 B;  4MZT A;  3LSQ A;  3M4Y A;  5GAN 5;  1JJC B;  4KR2 A;  2RI2 A;  4YRT A;  3A8G B;  2R5A A;  2RI5 A;  4M7D B;  2VC8 A;  4FL6 A;  3IAL A;  3OMC A;  4XK8 E;  2CJ9 A;  1S72 T;  4P74 C;  4M7A C;  4FM4 B;  1G5H A;  3GIB A;  2ZZG A;  4M7A E;  3LH0 A;  1Y96 A;  5LJ5 d;  4HWS A;  3KFU A;  3VYG A;  4E7J A;  2C8M A;  5A0L A;  4P75 A;  2V8J A;  3DB4 A;  3VYH B;  1H3Z A;  2ZGW A;  2YHT A;  2LVM A;  1VQ9 A;  2ZZF A;  4YRP A;  4F7U B;  2KMT A;  4M7D C;  3SB2 A;  3QO7 A;  3JRZ A;  4BI3 A;  1EIF A;  4M7D E;  3NET A;  3RKY A;  3OW2 A;  3SDZ A;  3OYN A;  3A74 A;  4KQE A;  2G3R A;  2Y4Y A;  5GMK h;  1VQZ A;  4L5G A;  1KD1 U;  3FJP A;  4PJO D;  2KY9 A;  3ZFJ A;  1NPR A;  1VQM T;  4LVM A;  1HK9 A;  3RGL A;  3WQZ A;  4HA8 A;  3CCL A;  3E19 A;  4KBM B;  5GAN g;  2P0P A;  3JCM V;  2RHU A;  1M1K C;  2NS6 A;  2MWO A;  3CMA T;  2DU7 A;  4BDZ A;  5IT9 E;  1ATI A;  4F7U E;  3CME A;  4IKF A;  2RM4 A;  4KUD K;  2XID A;  4JJN K;  1QVG S;  4M7D A;  1E1T A;  1I4K 1;  4H2Y A;  1W2B A;  3LGL A;  3OBY A;  2D0Q B;  4GY5 A;  1Q86 C;  4OF1 A;  4YRM A;  3BFM A;  1G5V A;  2EQK A;  2OTJ A;  1NYR A;  3JB9 I;  4LD9 K;  3HXX A;  4YRO A;  3PT9 A;  3JCM P;  4ZTU B;  2ZPH B;  3V8L A;  1E22 A;  3S6W A;  3RKW A;  2LQK A;  3SWN B;  3RF1 A;  1O75 A;  1N6A A;  4F7U A;  1FWZ A;  3L2W A;  1VQ4 T;  4E7I A;  5EG2 A;  4FIB A;  1V29 B;  5CKF A;  1I8F A;  5CQX A;  3PGG A;  3LYI A;  5GAN h;  3ERR A;  2DEQ A;  2M0O A;  4EMK B;  3OSV A;  3NEM A;  4RG2 A;  2MAM A;  2CYZ B;  4J83 A;  1G5I A;  2DKG A;  4ELZ C;  2LTO A;  3JAM E;  3CC7 A;  3SWN C;  4JS4 A;  4YRJ A;  2KSS A;  3E1S A;  3CC2 T;  4CRI A;  1EFW A;  4CS2 A;  4E47 A;  5KCO A;  2WSE E;  4LDY A;  2KK4 A;  3HHT B;  2DXT A;  1B7Y B;  4HWP A;  1M1K U;  2XTI A;  5GAO m;  1KMN A;  3IKM B;  5LJ5 e;  4EMK C;  2K3X A;  2EFI A;  2PUK B;  2RJE A;  1VQ5 A;  3OYK A;  1KHI A;  4YCU A;  3M5A A;  4PLI A;  2HQE A;  4TVR A;  5C51 B;  2ZT7 A;  5GMK j;  5FU6 B;  4C8Q F;  4C92 B;  2XHC A;  1NJ5 A;  1YJN T;  4DOW A;  2QDY B;  3NEL A;  3P8T A;  2RHQ A;  1Q86 U;  4CI0 C;  4YRQ A;  3HXZ A;  4PHC A;  4CH6 A;  3LC0 A;  4M7A G;  1XQH A;  4P3N A;  3SWN A;  2PQW A;  2DD5 A;  1VQ7 A;  2GQV A;  3E9G A;  5D6X A;  2M1H A;  4LD6 A;  2PMF A;  4MDX A;  2Q7G A;  2RHY A;  3G71 T;  3RMS A;  3NEN A;  4XU1 A;  1K73 C;  3CC4 A;  4EMK A;  2ZCF B;  5FU6 C;  1P92 A;  2EKO A;  3R07 A;  4C92 C;  3QKJ A;  2ZPE B;  5CK9 A;  1BIA A;  2RH2 A;  4YYE A;  4C92 E;  4H2W A;  3I7F A;  1G3T A;  5GAO p;  3TEE A;  3OD1 A;  3NTK A;  3QJY A;  3HFO A;  4H2X B;  2XDD A;  1SSF A;  2ZZD A;  4G85 A;  4BAC A;  3QO5 A;  5GMK i;  1X54 A;  3QPH A;  4N4I A;  3L2Q A;  2V8I A;  2LQ8 A;  5KE3 A;  5GAN j;  3V8J A;  1WLE A;  1U8R A;  2E5A A;  4TVA B;  2KAF A;  4PKC C;  4PL6 A;  4JRI A;  5CQY A;  2YRV A;  3MET A;  3E9H A;  1NJ1 A;  4M78 G;  1UGP B;  2VV5 A;  5CVI A;  3PMI A;  3WVD B;  4JLI A;  2CIM A;  4M75 F;  1VQM A;  4EPC A;  4XU3 A;  3PIP A;  3GPL A;  2JNG A;  2KQW A;  5LJ3 g;  3HFZ B;  2K2V A;  2DIQ A;  5GAN f;  1MGQ A;  3CMA A;  3CMQ A;  4K88 A;  3MF2 A;  4UP8 A;  2EQJ A;  4M77 F;  3FB9 A;  3PZC A;  3FLG A;  1K73 U;  1KQ2 A;  1VQ8 T;  4BB7 A;  3QUI A;  2ZR2 A;  3OYY A;  5K1X A;  4O2D A;  3RAC A;  4XTX A;  1VQ6 T;  3L4G B;  4X34 A;  3HY1 A;  3UFG A;  3HXU A;  2RJD A;  1KG1 A;  4XAX B;  2ZIN A;  3L2V A;  3UDC A;  2QHU A;  3M55 A;  2WSF E;  3HXW A;  4L87 A;  4BI8 B;  2CZ7 B;  3QYG B;  5DY9 A;  1VQ4 A;  4XTZ A;  1E1O A;  1KQS S;  4FT2 A;  2XGT A;  3CCU T;  3X20 B;  2ZXF A;  2DQ0 A;  5LJ3 h;  1QE0 A;  4LNS A;  1BI2 A;  4HCZ A;  3DB3 A;  3GLX A;  2AMC A;  5GAN 3;  5CKE A;  5DLO A;  5IN1 A;  2K57 A;  1VQL T;  1YIJ A;  1KHC A;  4BUG A;  3HFZ A;  4PG3 A;  3CC2 A;  4TTV A;  1USY A;  2EWN A;  3PMT A;  3G1Z A;  4HT4 A;  4HWO A;  3BW1 A;  2ALY B;  2XDB A;  3MO8 A;  4QVZ A;  1X75 C;  3RMQ A;  2X4W A;  3CCR A;  4RCC A;  1KC8 C;  1K9M C;  3MCA B;  1N27 A;  1SET A;  2DAQ A;  3L42 A;  4D6W A;  1ZBX A;  2RK2 A;  3JSC A;  2GCX A;  4RCB A;  3GOX A;  3P8D A;  4FSX A;  4DQ2 A;  2A3L A;  1QVF S;  2DO3 A;  4PJO G;  4H2S A;  5FLX E;  1YJN A;  4AH6 A;  3S3M A;  3S3O A;  4OB2 B;  1IZ6 A;  4LVI A;  2HBP A;  2RO0 A;  3C12 A;  1Z7N A;  5DLQ E;  2PU9 B;  2F5K A;  2VGM A;  4TWA A;  3OYJ A;  1BI3 A;  2DXU A;  3M54 A;  2HAX A;  3NFC A;  4JDS A;  1I81 A;  3G71 A;  5GMK m;  4BW9 A;  3QSU A;  3GNF B;  5CKB A;  2E5Q A;  4DOV A;  5KNN A;  3A8M B;  4YRF A;  4IUV A;  1KMM A;  2Q7E A;  3JB9 H;  2R57 A;  3C95 A;  2RHX A;  4XQ3 A;  1M9S A;  3CC4 T;  2EAY A;  4NCX A;  2E65 A;  4YTL A;  2XI9 A;  4Q6G A;  5E3I A;  2ARS A;  1JB0 E;  1EOV A;  2QTX A;  1EIY B;  1C0A A;  2ZPI B;  3JB9 F;  4M7D F;  2IG0 A;  3HFV A;  1U1T A;  1PSF A;  1ADY A;  4IUP A;  4YRI A;  2L89 A;  2AHJ B;  5C6S A;  5GAN d;  4BDY A;  2PVO B;  2ART A;  1KC8 U;  5LJ3 j;  1HC7 A;  2GF7 A;  1K9M U;  2I4N A;  3M4G A;  1H4S A;  3CXC S;  3P8B B;  5CAI A;  2JVV A;  4NOY A;  4LDW A;  1VQN A;  3CCQ A;  4F7U F;  1IL2 A;  3HRU A;  4MDW A;  4BE2 A;  2ODR C;  2EQM A;  3G7Z A;  5ELO A;  4LDX A;  1WQ7 A;  1WJS A;  5C52 B;  2NLU A;  3VBB A;  1YI2 A;  4P74 A;  4YRL A;  3MEU A;  5LJ3 f;  5A2Q E;  2WSC E;  4ZGE B;  4M7A A;  4M78 B;  1M90 C;  1JJ2 A;  4C8Q D;  2I4M A;  1M1F A;  3V7C A;  3TEH A;  1YCY A;  3OYC A;  3RUX A;  5GAM h;  1VQ8 A;  2PVD B;  3CCS T;  1QP2 A;  2JUF A;  1JJC A;  12AS A;  2DQ3 A;  2VGN A;  1VQ6 A;  3HPW A;  4A4K A;  4WJ3 M;  2K4Y A;  2ZIO A;  3UGT A;  3HRI A;  3L1A A;  3CPW A;  1U1S A;  2JZ2 A;  5GAM e;  2MI6 A;  4M78 C;  2Q5I A;  4QQG A;  5J26 A;  4M78 E;  3REU A;  2VUB A;  2JTM A;  4IUQ A;  1BYM A;  3QG1 A;  3X26 B;  3A7U A;  3CCU A;  1FX7 A;  4V2S A;  2RHZ A;  4CH3 A;  4LDV A;  2ZCE A;  4P72 C;  4VUB A;  1XNI A;  2JOY A;  3A7A A;  3A31 A;  1VQL A;  1BI1 A;  4LVJ A;  3MF1 A;  2Y4X A;  3PTA A;  3OQ5 A;  4Q5W A;  3JCM d;  1W4S A;  2P0L A;  3UPU A;  1Y7X A;  4Q15 A;  4M78 A;  2VXE A;  3NTH A;  1X01 A;  4HCC A;  2DTI A;  1BKB A;  4KUI A;  2GFU A;  4XEM A;  1BI0 A;  1YIJ T;  3PNW C;  5LJ5 h;  2XD0 A;  3H6Z A;  1JRI A;  1M90 U;  4YCW A;  4HKE A;  1D3B B;  4RDX A;  5CKD A;  2DU5 A;  2ZNI A;  2RK1 A;  4M75 D;  2JTF A;  4RMF A;  3L2R A;  2OTL T;  4P72 A;  4QVD A;  1QP3 A;  2RI3 A;  3MEV A;  3OS0 A;  2ZTG A;  3CCR T;  1QVF A;  3EAE A;  2K3Y A;  5ELN A;  2DPP B;  3ER0 A;  3FEO A;  2F69 A;  1Q7Y C;  5AYF A;  1VQP T;  2VXF A;  4R56 A;  3OS5 A;  3INZ A;  3FIF A;  2LT1 A;  1BBU A;  2FB7 A;  4M77 D;  4P71 C;  4L6V 5;  3MP8 A;  3KUF A;  3MP1 A;  4NL2 A;  4C92 F;  3OSS C;  4ELY C;  5HY6 A;  1NPP A;  1NJ6 A;  4PJO B;  2A7Y A;  3A7R A;  4A4G A;  2DZC A;  3L2U A;  3CCJ T;  2HD0 A;  4C8Q B;  1J5W A;  1YB3 A;  4ZTZ B;  2X4X A;  2HNI A;  1Y07 A;  1G3W A;  3JCM X;  4WJ4 A;  3OYI A;  3CCV T;  2QHV A;  2MMP A;  4N4H A;  4IUR A;  4XTW A;  2K5I A;  4KUL A;  3I56 A;  1I5L A;  1W66 A;  1VIE A;  4OP0 A;  4OLF A;  3IKL A;  4PJO C;  4ZTF A;  3T9N A;  2CKK A;  2L5Q A;  4C0D B;  4PJO E;  5FRN A;  4C8Q C;  1M1G A;  1YFR A;  4L59 A;  4RKU E;  4C8Q E;  2P5I A;  2QQ9 A;  5LJ3 d;  3P8V A;  5D6Y A;  1B7Y A;  2QQB A;  4J6W A;  4FT4 A;  2ZPB B;  3IG2 A;  3OA6 A;  2EJG A;  3VU3 C;  5J39 A;  1GXI E;  3JCM Q;  1B8A A;  3QBY A;  4P3O A;  4QQD A;  4YCV A;  4RQE A;  4C92 A;  1Q7Y U;  1N8R U;  1Z7M A;  3VV0 A;  2QA4 A;  1WGS A;  4LDU A;  2FVU A;  4C0D C;  1LOJ A;  1YIT T;  4JS5 A;  4PJO A;  4QVC A;  1YJ9 A;  1VQK T;  1VQN T;  3CCQ T;  1UGR B;  5IAY A;  5LJ5 j;  2YLB A;  1X6O A;  2ZT6 A;  4HWR A;  1B34 B;  2L8D A;  1E24 A;  3JCM e;  2E3C A;  4LVL A;  2QQA A;  1YI2 T;  3JCM W;  2X4Y A;  2CZ1 B;  3CCS A;  3C94 A;  3OW2 S;  3QNE A;  4EO4 A;  5K1P A;  1RIQ A;  1G3Y A;  2ZZE A;  3OY9 A;  4XU0 A;  2DDZ A;  3G4S T;  4XTY A;  1YJW T;  1QVG A;  5GAO l;  3TU4 K;  4ME7 A;  4JUV A;  2DXB A;  2E1H A;  4H2X A;  2QHT A;  2RHS B;  3VQV A;  4JRQ A;  4RG8 A;  2LNV A;  2CGH A;  3RKX A;  1QF6 A;  2DZ9 A;  2QEX T;  3VQX A;  1W2B S;  3JB9 D;  2J3M A;  4M7D D;  3M53 A;  2C7I A;  4TVA A;  4C0F A;  3HY0 A;  3PCO B;  3NTI A;  1H64 1;  3DKM A;  3QO3 A;  1PSE A;  4BE0 A;  3HTZ A;  4E7H A;  2P0K A;  3DSQ A;  1WNL A;  4WI1 A;  1B34 A;  3VQW A;  2IY5 B;  3W3S A;  1UGS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...