2EAYA

Crystal structure of biotin protein ligase from aquifex aeolicus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
231
structure length
219
Chain Sequence
b'MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 66
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eayA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2eayA01
2E10A 1B34B 4YRKA 4P3PA 3JCMP 2I4LA 1Y96B 2DTOA 4M75A 5GAMj 3LSQA 2DQ0A 2ARUA 3REUA 3V7CA 4C8QB 3JCMb 1PYSA 2DTIA 3OD1A 4EMKC 4M77D 2EWNA 4PJOB 1NJ8A 4F7UB 5LJ3j 3V7RA 4LNSA 4RMFA 4TVYA 4EMGA 1EVLA 4XTXA 1NNHA 4YCVA 1X2HA 4M75B 3MEYA 3DSQA 4P3NA 1LYLA 4K87A 4H2YA 4UP7A 5GANh 1X2GA 1EOVA 1PYSB 1LJOA 1N9RA 4WJ4A 4YREA 1MGQA 3GIBA 4C92B 3HRKA 1NYQA 3M4GA 1E22A 1JRIA 5GAN8 3JCMX 4YCUA 4YRFA 1LNXA 1EIYA 3SB2A 4NL2A 4H2VA 4C8QD 5GAMd 4MMLA 1VQZA 4HWSA 4CS4A 1YFTA 1YB3A 4M78G 3JB9G 1H4QA 1N9SA 5GMKi 4XU2A 3HXYA 2IY5A 4XU0A 4XQ3A 5LJ3d 4YRQA 4M7DG 2ZR3A 4M75D 2Q5HA 3V8LA 1JJCA 1SETA 4M7AB 1I81A 3HSBA 4HWPA 1EIYB 1Z7MA 2QTXA 4DPGA 3JB9H 4WI1A 2ZIMA 4WJ3M 4C92D 2QHUA 3V8KA 4M78E 4HT9A 2J3LA 2RHQA 3HXWA 1HC7A 1BBUA 4YP0A 4J6XA 1YFSA 4TVWA 2YHTA 5GAMh 3RGLA 2VXEA 2RHSA 4XTYA 4M7DE 3G1ZA 2CJAA 3QTCA 3SWNC 3IG2A 1JJCB 4BW9A 1D3BA 3RKYA 2DU5A 3RL6A 4M78C 5LJ3h 4HT8A 4YRSA 4XTVA 3IALA 1H4TA 5GMKm 3HFZA 2ZGWA 5GAOm 5K1PA 4M7DC 3JB9J 1G5IA 1X54A 4J15A 1YGBA 4P72C 3LC0A 4YRGA 3VQYA 1WQWA 4ZTUB 3E9IA 4XTUA 2XTIA 1J5WA 2ZIOA 2VXFA 1I5LA 4M78F 4YDQA 4YYEA 3IKMB 1E24A 2ZZGA 1B34A 3RESA 1Y96A 1NJ1A 4RDXA 3HFZB 4YROA 3QNEA 4M7DF 4CS3A 4XU1A 4YRJA 4YRPA 4NCXA 3RKXA 3REXA 4PJOA 2DKGA 3QSUA 3P8VA 4RQEA 2C8MA 3BY7A 4AH6A 1U1SA 3A7UA 1EQRA 4JRKA 3A7AA 2ZXFA 2PMFA 4C92A 3VU3C 1USYC 2Y90A 2ARTA 1M5Q1 1GGMA 2C7IA 2E41A 1I8FA 1WYDA 1KMMA 4M77G 4P74A 4TWAA 3VQVA 2ZZFA 4RCBA 3L1AA 4E51A 3UH0A 4YRLA 4XEOA 4HA8A 5ELOA 3HY1A 4V2SA 4CH4A 2EJ9A 2ZZEA 1NJ5A 4PHCA 4YPFA 5C53B 4P71C 3HXVA 4YCWA 1QF6A 4P73A 1G51A 1QE0A 2I4NA 4HVCA 3NEMA 3M4QA 4YRNA 1H4SA 3JCMV 3A32A 3RERA 1B8AA 4M77E 3NELA 3CMQA 4UP9A 1M8VA 4M7AA 4G84A 3JCMc 2ODRD 4PJOD 1E1OA 3NENA 3R07A 4YRMA 3V8JA 1FYFA 5GANg 5GAOn 2DXTA 4C8QG 3HRIA 3BJUA 1BBWA 4PJOG 4DQ2A 4F7UG 4M77C 3AHUA 3BW1A 2CJBA 3JCMQ 4EMKA 4N0AC 2DU7A 3P8TA 2FB7A 4P75C 1EFWA 3RKWA 4UPAA 4J6YA 4X9DA 4M75G 2Q5IA 4Q6GA 3JCMf 4XTZA 5LJ5f 2ZT8A 3PCOA 4QVCA 4C8QE 4K88A 1NJ2A 3VBBA 4PJOE 2EJGA 3RIRA 4C92G 4F7UE 4M77F 4X5OA 1JBMA 3L4GB 3RF1A 4XTWA 4EMKB 3FB9A 1ASYA 5GAOq 3QHSA 4KR3A 4HWRA 1ATIA 2RD1A 4TVAB 2Q7HA 3HXXA 3QO8A 2DZCA 4M75E 4CH5A 4C8QC 1WNLA 1SESA 3PCOB 3JCMg 1NYRA 2AMCA 5LJ5g 4A54A 4C92E 3JCMe 1L0WA 3HFOA 4M7AD 2DEQA 2RB6A 4TTVA 5LJ5e 4WF2A 5GMKl 2VC8A 4QVDA 4ZTZB 5KNNA 5GAOl 3WQZA 2ZTGA 5GAN3 4NL3A 2ZCEA 4M75C 2DQ3A 4K86A 2DXUA 2I2LA 2ZR2A 3V7SA 2EJFA 4C8QF 4PJOF 3MF2A 2AMCB 4C92C 3HY0A 4CS2A 4PG3A 4F7UF 4PNOA 2DVEA 1X01A 3BFMA 3JCMW 2Q7GA 3M4PA 3A5ZA 1U1TA 4P3OA 2ARSA 4H02A 1HXDA 2K57A 2E64A 4M7AE 3HFNA 3HTZA 1TH7A 4M75F 2Q7EA 11ASA 4H2SA 1G5HA 3SWNA 3ICAA 1BIBA 1ADYA 2QHTA 2YLCA 5GAN5 3EFSA 4Q15A 3QO5A 4C92F 3I7FA 2CIMA 4M78A 3FJPA 2ZINA 1ASZA 5HGQA 5CAIA 1BIAA 1WQ7A 2CGHA 5GMKe 2FYKA 3IKLA 5E3IA 2I4MA 5GAOr 4JRIA 4M7DA 5GAN2 1YCYA 1KMNA 4A53A 2ZNJA 4O2DA 4P72A 3SWNB 1E1TA 2QHVA 3L2ZA 5LJ5j 4CH6A 5C52B 3QO7A 5GANf 4M78B 3RUXA 2EL9A 3TUPA 4KQEA 4J6WA 1WLEA 4M7AF 2YLBA 1B7YA 4M7DB 1X56A 2P0LA 2DZ9A 3EFRA 3UFGA 2AKWA 2PMEA 1B70A 2ALYA 5C51B 4RCCA 1N9WA 4XU3A 2RA2A 1LOJA 4JLIA 2ZT5A 2E65A 2P5IA 3JCMJ 4YRCA 2HNIA 4Y91A 4X9CA 5GANe 3JB9I 1B7YB 4MMKA 4YRTA 1KQ2A 2J3MA 3L4GA 4L87A 1YFRA 4NOYA 2ZT6A 3JCMd 2AKWB 3ERRA 4M78D 3JB9D 1B70B 1USYA 2ALYB 5LJ5d 4TVAA 4H2UA 5GMKj 3UGQA 1H4VB 4H2XA 5DY9A 3QO3A 4M7DD 3INZA 3HXUA 5GAMf 1SRYA 2ZT7A 3UGTA 2RM4A 3A74A 2G4CA 2E1HA 1WU7A 3NETA 4P71A 3TEHA 4YRIA 1SERA 4EX5A 4EMHA 1Z7NA 1HK9A 3VQWA 5LJ3f 4YRRA 4H2XB 3PGGA 2XGTA 3JCMh 2ODRC 3VQXA 3A31A 4PJOC 1KOGA 5LJ5h 3E9HA 2IY5B 4HWTA 4J5YA 2E3CA 5GAMg 12ASA 2QHSA 3TEHB 4H2TA 2DDZA 1HTTA 5GAMe 3A5YA 4XEMA 5K1XA 2JN0A 1ADJA 4M7AG 4BWAA 4M77A 5GANj 3PZCA 4RQFA 5LJ3g 2RHQB 4N0AA 4OLFA 1EVKA 4EO4A 4CH3A 5LJ3e 4P75A 4TQFA 3HFVA 4G85A 2DTHA 2E5AA 3P8YA 5ELNA 1NJ6A 2RHSB 5GAOp 1IL2A 3HXZA 4P74C 5F5WA 3QUIA 1WPYA 1D3BB 4OP0A 4TQDA 4M77B 2I4OA 3A7RA 2EAYA 3JB9F 5GAN6 4JUVA 3MF1A 1RIQA 3BDUA 4ZIBA 4P73C 3FIFA 5GMKh 4KR2A 1C0AA 4HWOA 4C8QA 5I21A 2ZNIA 3KFUA 1X55A 5GAN4 1W66A 2CJ9A 3LSSA 3TEGA 1B76A 3RACA 4M7AC 2DJZA 4F7UA 1I4K1 4UP8A 3W3SA 4H2WA 1KQ1A 1H641 5GAN7 5GANd
chains in the Genus database with same CATH superfamily
3I55T 1YIJQ 4M75A 5KYUB 1JU5C 2LQ8A 1QKXA 1CSKA 4IUUA 3MEWA 3JCMb 4EMKC 2EWNA 1Y7XA 2EBPA 2LX9A 1Y07A 4O6JA 2DYIA 2ESWA 4EMGA 3TSWA 2C0TA 4RKUE 1NNHA 4YCVA 2JJ9A 3HPWA 2QGFB 1TUDA 4P3NA 1UB4A 1PSEA 4K87A 4UP7A 2YWWA 5A2QE 4L59A 1PYSB 1QQJA 1W2BS 4YREA 4J7FA 3GIBA 3A8MB 2OAUA 3DLLA 1E22A 1GCQA 4YRFA 1LNXA 4M4ZA 1YITA 5D6XA 5GAMd 1YHQT 4CS4A 4M78G 5KYYB 1NEBA 1H4QA 2DBKA 2O9SA 3NGPA 4XQ3A 3VYHB 2NUPA 4LD6A 4UC4A 1PD1A 2F69A 3NTKA 1Z7MA 2K5FA 3DKMA 4WJ3M 4LUEA 2RHQA 4M78E 1G83A 1RABB 1C0MA 2B86A 1GXIE 1YFSA 2RJDA 1YJWQ 4BDYA 5GAMh 2QEXQ 4TVRA 4XTYA 2RHSA 1MHNA 3CMAT 1JJCB 2MK5A 1QWFA 1U3OA 8ATCB 4OB1B 2CS7A 3CPWP 1OQKA 2ZPBB 4YRSA 3IALA 4RMOA 3OA6A 2L3QA 3CCUT 1H4TA 1IHVA 1VQ6T 1BK2A 3TU4K 3A8LB 2DD5A 1VQKT 5K1PA 3O8VA 2PTKA 2DEUA 3JB9J 1Q82U 2M0OA 4P72C 3CCET 3LC0A 4ZTUB 3E9IA 3G6ET 1J5WA 2ZIOA 3OYEA 1PWTA 2VXFA 4M78F 3A1PA 3REAB 1NJIC 3JRZA 1NPPA 2ZZGA 2FPDA 4OGEA 3L2UA 2DL5A 1MMNA 1VQ9Q 1M9SA 1IGUA 3CCRQ 4LDUA 3OYAA 3TEEA 1SSHA 2JTEA 4YRJA 3PMTA 4YTLA 1QW1A 1TSFA 2BZYA 2B8AA 4PJOA 1NEGA 2RH2A 2OTJQ 1JB0E 2X3WD 2COYA 3CMEQ 5HCKA 2DKGA 5IHKA 2OTLA 2YT6A 1UGPB 2RQWA 4J8OA 2K5LA 1K1ZA 3MHXA 1U1SA 1EQRA 1AWWA 2QQRA 4JRKA 3A7AA 2ZXFA 3RMQA 3L2VA 1M5Q1 1KC8R 1M1KR 4KGVB 1VQ5Q 1YJNQ 4P74A 4TWAA 3VQVA 4RCBA 3UH0A 1SHGA 2DMOA 4XEOA 3HY1A 2FVUA 4CH4A 3CC7Q 4YPFA 4J9IA 1M2OA 3QZ5B 1AWOA 4IUQA 2A28A 3QWYA 3NEMA 3JCMV 3A32A 3RERA 2RHZA 2EQMA 3M0SA 1WHMA 1M8VA 3KBGA 2ATCB 2BUDA 2HMAA 4MZMA 3NFCA 4HCBA 1I0CA 3JCMc 1TS9A 3NENA 1GBQA 4LVMA 1RAIB 4ANJA 1VQNA 2DXTA 2VV5A 4C8QG 3BJUA 2EQKA 8AT1B 1AZEA 1O75A 4M77C 3PNWC 9ATCB 2JMAA 1UG1A 3MP1A 3H0FA 1AOJA 4A4HA 2DU7A 1W2BA 2HAXA 1NG2A 1VIFA 4AG1C 1EFWA 5FROA 2DERA 4J6YA 4QQDA 3PFSA 2Q5IA 1MV3A 1UE9A 2GFUA 2X9HA 1VQOQ 2X51A 4N4IA 3PCOA 2EGCA 4C8QE 3OMCA 4K88A 4PFZA 1UDLA 1PC0A 2VYTA 2DIGA 1LVKA 3M53A 2JXBA 2OI3A 3I55A 2AK5A 3QBYA 3LH5A 5HY6A 3RF1A 2O2OA 4XTWA 1SEMA 3OYFA 3I5SA 2DIQA 1ATIA 4TVAB 2Q7HA 3H6ZA 5CK9A 3QO8A 3GNFB 1TTHB 1ZSZA 2RJCA 3A8OB 1U06A 4ATOA 1KJWA 1SESA 1LPLA 2CZ0B 1IZ6A 1WJQA 3L42A 5LJ5g 2M16A 3H9NA 4M7AD 2DEQA 4TTVA 5LJ5e 1TUCA 5GMKl 4QVDA 1WXBA 5KNNA 3WQZA 2QDLA 4NL3A 1OV3A 4M75C 1G3SA 2DQ3A 4FW1A 2I2LA 1M2VA 1OX9A 3P8BB 4C8QF 2EYXA 2P0QA 2E5KA 1X43A 4C92C 2AMCB 3HY0A 4PG3A 6AT1B 2DVEA 2MAMA 2R57A 4PJLA 2QQAA 2LJ1A 3BFMA 3JCMW 1AEYA 1SRLA 1D1BA 3A5ZA 4P3OA 4OMOA 2ARSA 4H02A 2LX7A 3O5ZA 1OX8A 2E64A 3UA7A 3HTZA 3RMSA 11ASA 1G5HA 3SWNA 3ICAA 1RAHB 1ADYA 2QHTA 3EGXB 3I7FA 2CIMA 1Q95G 3OYYA 3E9FA 2RHIA 1WYXA 5HGQA 5DLQE 1GCQC 2CGHA 4RTXA 2F5TX 4CC2A 2LQWA 3LGLA 3MP6A 2SRCA 4O5VA 4M7DA 1KQSS 4A53A 3QKJA 2HL5C 2FZCB 3VS6A 3L2ZA 5LJ5j 2RQUA 4JLGA 2DLPA 5C52B 2J7IA 1Q86R 4M78B 3LX7A 2GGRA 2LT1A 2EL9A 4ESRA 3TUPA 2FHDA 3EGDB 1K76A 1VIEA 2QQBA 3CXCS 3M0QA 1WHJA 1VQ6A 3CCJQ 4J9HA 3EFRA 2VWFA 4QQGA 3G4SQ 2PMEA 1B70A 3EH1A 3CCEA 1WX6A 1KC8C 1M1KC 4JLIA 1EX4A 4KRTA 2AZVA 2K9GA 4Y91A 5GANe 2DL3A 3PT9A 3QIIA 1VQLT 3L4GA 2ZT6A 4M78D 1YWOA 2E6ZA 2RQVA 5DY9A 3CC2Q 2KXCA 5C0MA 1Y57A 3INZA 1D0YA 5GAMf 4FW2A 3OBYA 3HP9A 3PVLA 5KE2A 1WU7A 2LZ6B 1SG5A 3M0UA 4P71A 5KYXB 1T0HA 2JM9A 4EX5A 3C12A 1E7OA 2RI5A 4E7LA 2J6FA 4A4KA 2DETA 4H2XB 3PGGA 1YP5A 2HSPA 1WLPB 1KOGA 5J39A 4PJOC 4BY6B 1N27A 3CCQQ 2V8JA 1XQHA 1S72A 4ZN3A 4Z8AA 2GTOA 1N8RR 1VQ8Q 1SHFA 2ROLA 5K1XA 1HYOA 3CC4Q 5GANj 3OYIA 3PZCA 5LJ3g 2ZPHB 4N0AA 4OLFA 4IKFA 2KYMA 3TREA 1XOVA 4EO4A 2X4YA 5LJ3e 4P75A 3FLGA 4TQFA 2CH4W 4BI3A 1YITT 3MCAB 2ZPFB 4OMMA 4P74C 1TU0B 2HKQB 2FZGB 1X6GA 1R0BG 5GAN6 2JTMA 2YRVA 1ZX6A 3QZ9B 4A4FA 1X6BA 4PLLA 3MEAA 1PD0A 3CBOA 2WSCE 5KYUA 4A63B 4KUDK 4HWOA 2ZNIA 5I11A 2CJ9A 1W66A 2MPXC 3MP8A 1PG5B 1I4K1 1GRIA 1W2BP 1M8MA 1QP3A 3N5BB 3VS3A 4CC7A 2LVMA 4JS4A 3CEYA 2HQXA 1Y96B 2R5MA 3NPFA 1VQPQ 3JSCA 3V7CA 2DRKA 1GBRA 4C8QB 1PYSA 3OD1A 5KYWB 3KFVA 3PVQA 5ECAA 5LJ3j 4LNSA 5FRNA 3TQ7P 1XJWB 2XK0A 5FU6C 3CD6T 2XKOC 2KROA 2YXYA 1X75C 3MEYA 4LDXA 3DSQA 1RAFB 1UHFA 3DB4A 1X2GA 1EOVA 1AT1B 2KSSA 1TWBA 2ZPGB 4WJ4A 5I2MA 3CCST 1D1CA 1B7TA 3HRKA 4WTOB 2LQNA 1ZSZC 1BU1A 2W0ZA 1Q86C 1JRIA 3JCMX 4YCUA 1TXQA 4NL2A 4C8QD 1WA7A 3OQ5A 4HWSA 1WXUA 3CXCA 1OPLA 3JB9G 3OBWA 2YUPA 4KGXB 3OYMA 2OTLT 2DFUA 2OX7A 5IT9E 2JVVA 2JT4A 3G71T 1IB8A 3CCLT 1JJCA 2QQSA 5FU7B 1SETA 4HWPA 4KH0B 3ZEHA 1K8AR 2KRSA 1BI3A 4PLIA 4HXJA 5I2SA 2LJ3A 3IQLA 1W70A 4HT9A 1I07A 4RG8A 1HC7A 4YP0A 2BIVA 1M3AA 1RL2A 3ZL7C 1OULA 2GFAA 1Q81U 1VYVA 3RGLA 2VXEA 3QTCA 3SWNC 4JZ4A 1R0CB 2LCSA 2EYYA 1D3BA 1QCOA 1QCNA 3Q1JA 2DA9A 4QKUA 3CCVA 1VUBA 4XTVA 4HT8A 2HCKA 3UF4A 3X24B 2PVDB 2EFIA 3NTIA 2QA4Q 5GMKm 3QYGB 1UEBA 3VS0A 4M7DC 5CR2A 1D1AA 4J15A 2E4HA 3QDRB 1YGBA 4XTUA 3LLRA 3UATA 3GLXA 2O4XA 1VQNT 2KDSA 1ZBJA 4FT2A 1B34A 3RESA 1N8RC 4R56A 1C1AA 3C94A 2GCXA 3QJ6A 3REXA 1QVGA 3GBQA 3AT1B 1WDXA 2HQHA 1VQ7Q 2NUTB 2P4RA 2LDMA 1OI1A 1VQ4A 2EGEA 3P8VA 4N4GA 4DA4A 3CCMQ 4RQEA 2XIDA 1KSWA 1D0XA 1W1FA 3BY7A 2HEQA 2M02A 2OAWA 5CVIA 2G6FX 3GP8A 2GTJA 2V8IA 3A7UA 2A0FB 2L3PA 1NPRA 5A0LA 2PMFA 1OZ3A 4C92A 2ARTA 1XNIA 4E7IA 2C7IA 1X2KA 4LN2A 4RTZA 1WYDA 4LVJA 4DOVA 1VYUA 1WZOA 2VKNA 2CT3A 2P84A 3L1AA 3A8HB 5L23A 2NLUA 4HA8A 5ELOA 2OJ2A 3VRYA 2ZZEA 2AKLA 4AFZC 4P71C 1V76A 2L3SA 3I56Q 1BYMA 4YCWA 4P73A 4ZGDB 4B9WA 1OOTA 2QEXT 2C06A 4OMFB 2QYZA 1ABQA 2J6OA 4FSSA 4DBRA 1SKUB 4M7AA 2HSEB 4OMLA 2CREA 4MDXA 1WHGA 4G84A 4LDWA 2ODRD 2EQIA 2ROTA 2J06A 4PKCC 2EPDA 2PNIA 1GFCA 3M59A 2Z0WA 5J3BA 2CT4A 5J26A 3HRIA 1KFZA 4PJOG 4DQ2A 2R58A 2CJBA 1X69A 1ZUKA 4N0AC 4HVVA 1JXMA 3FEOA 2KYBA 2JS0A 4P75C 3RKWA 3I55Q 4X9DA 2CUBA 1U5SA 2CH4A 2FO0A 1VQ9T 5FW9A 1FXXA 2PVOB 4XTZA 3CCRT 4PJNA 1NJ2A 4PJOE 3VBBA 2K7AA 2M0YA 1X2QA 1JBMA 2P4TA 3FB9A 1N5ZA 4AFSC 1WI7A 2FPEA 2RD1A 1B3QA 1YWPA 2VVKA 1TOVA 2BKDN 3OS2A 4FYVB 1DJ7B 2AMCA 4OMNA 4BUGA 3CD6A 1K8AC 1Q82R 2JS2A 2JZ2A 4WF2A 2DILA 3ER0A 4ZTZB 1NYGA 3H0IA 2ZTGA 5GAN3 2XICA 2MF2A 1VQ5T 1S1NA 3CCSA 2ZR2A 3V7SA 2EJFA 1PM3A 3I35A 2DVJA 1YHQQ 1LCKA 1WHKA 2GQVA 1ACMB 2LNVA 4PJOF 1KQSP 3MF2A 2WSFE 1KHCA 4E6RA 4PNOA 1BCMA 1NZ9A 1X01A 3PTAA 1K0XA 2HBPA 2E3HA 2Q7GA 2YRDA 4JPBW 2FRYA 3C4SA 2D0NA 2Q7EA 3UA6A 1PKSA 1BIBA 3CXCP 1OPKA 1OEBA 5GAN5 2DX1A 2DXCA 4Q15A 3G71A 3QO5A 1Z9ZA 3VRZA 1BI2A 1AHJB 3CCLA 4M78A 2IPOB 1J3TA 2LQKA 1ASZA 4XAXB 1WQ7A 2KQWA 3IKLA 5E3IA 1T0JA 4J9FA 2I4MA 3CMAQ 1T3LA 3HRUA 3FJ5A 2KRNA 2ZNJA 1E1TA 4JJNK 2HD0A 1S72T 2QHVA 2ABLA 3OYHA 3QO7A 1RAGB 2ENMA 1MNDA 2MCNA 3RR6A 3CCUQ 1VQOT 1YJ9A 3PE0A 2YUNA 1VQKQ 2CSIA 1ZA1B 4J6WA 1WLEA 3UT1A 5GJWB 2F2XA 1YIJA 3OS5A 1WHLA 1X56A 1WIEA 1D09B 3G6EQ 2DZ9A 4PFPA 3UFGA 2M51A 5C51B 3VYGA 3A98A 2KK4A 4RCCA 2LP5A 2D9TA 4XU3A 3UDCA 2ZT5A 1YBYA 2E65A 1YCSB 2MYSA 4X9CA 1K9MU 1B7YB 2CUDA 5KYXA 1M4ZA 1YFRA 3JCMd 3ERRA 3JB9D 2ALYB 1PRLC 4E47A 5KCOA 3TSZA 1UJ0A 4H2XA 3JAME 4QQ6A 1UHCA 1PKTA 3QJYA 2HL3A 3E2UA 5IAYA 5I22A 2ZT7A 3UGTA 2RM4A 3NETA 3EG0A 4BE2A 3X26B 3WVEB 4EMHA 3OYDA 3C95A 3HKSA 4LVLA 3LW5E 2XGTA 3JCMh 3MPUB 5IN1A 3E9HA 1WFWA 3TVTA 3X20B 4J5YA 5GAMg 2NUPB 2P0KA 2QAZA 5GAMe 3A5YA 4XEMA 1M90U 1ADJA 2RI2A 2NS6A 2VASA 3KXTA 1MV0B 3PIOA 4RQFA 2QEXA 2RHQB 4LDVA 1GCPA 1MNEA 3HFVA 4G85A 2E5AA 5ELNA 2QQ9A 1K73R 2RF0A 3ZFJA 4C5HA 1NJ6A 4MZPA 2RHSB 2YRCA 5GAOp 3NHNA 4XK8E 3HXZA 1GL5A 3PIPA 1PNJA 1ZHIA 3CCJT 5CQXA 3OW2S 2I4OA 2AT1B 4JUVA 3MF1A 3L2QA 1Q82C 3MJXA 1RIQA 4MDWA 4P73C 3SD4A 3JV3A 3LYIA 2L5QA 5GMKh 4E7KA 4C8QA 3KFUA 5GAN4 1OYXA 1BI0A 5KYWA 4M7AC 1VQMT 1VQ9A 2DJZA 1G3TA 2R5AA 3CCRA 4FYXB 3URGA 2CSQA 3U23A 1UGQB 5FRMA 5GAN7 1BCOA 2DJQA 3HHTB 2DM1A 4E2FB 2NYSA 5GAMj 2OTJA 2DQ0A 3CMEA 3M58A 2JOYA 1JO8A 2IG0A 3SHWA 4PJOB 3CCVT 2CZ1B 2D0QB 3BDLA 1WJRA 3V7RA 4RMFA 1ABOA 4ZTFA 2M1HA 3NMZC 3OB9A 5DM7R 4D8DA 2W10A 3DLMA 4RTWA 1JJ2A 1X2HA 3I9QA 1LYLA 2EQUA 4H2YA 2RQRA 2K3BA 2HDAA 1V1CA 1LJOA 1VQ5A 1N9RA 3CCQT 1YJNA 3OYNA 2LNHB 3ZBDA 2O88A 3M4GA 3CC7A 2DL4A 5GAN8 1G3WA 2K3YA 3QXEB 3SB2A 4H2VA 4LNPA 4AG2C 2X4WA 1IRXA 3EHRA 2PQWA 4MMLA 1VQZA 1R8OB 1Q7YU 2DRMA 2KXDA 3OS0A 1N9SA 1VQ4T 5FWCA 3HXYA 2IY5A 1K0SA 2FZKB 4XU0A 2FG0A 2VGMA 4J9BA 2ZR3A 4FM4B 2Q5HA 4Z02A 3HSBA 1EIYB 2RHXA 2QTXA 4WI1A 4KGZB 2QHUA 2J3LA 1BBUA 5D6YA 2A36A 1R77A 4TVWA 2H3JA 2KMTA 4II1A 3THKA 5CKDA 2CJAA 1ZQ1A 1VQOA 1C6VX 1YI2T 2DU5A 4LD9K 3RL6A 4C0DB 1N6AA 4M78C 1QVGS 3VUBA 3BE3A 4NS5A 3OSSC 4L6V5 2KAFA 2HKNA 2LMJA 1RAEB 2JNGA 4YRGA 3VQYA 1WQWA 2CYZB 4J9GA 1JQQA 1VQLQ 3H41A 2XTIA 2YUOA 4BI4A 5LL6S 1X6OA 1E24A 1ZA2B 2HZYA 2M9UA 2RK1A 1NJ1A 4RDXA 3HFZB 4FT4A 4OB2B 4YROA 3QNEA 3H0HA 3SEMA 4CS3A 1G2BA 2GBQA 2RJFA 2CP2A 2RO0A 3RKXA 2EKHA 2BE7D 3EG2A 4C5GA 2CP6A 2YDLA 4K11A 3LWHA 4JZ3A 1K73C 3EG9B 3S3MA 1NM7A 3OW2A 5KH6A 2LTOA 3E9GA 2PVGB 1IXDA 3VU3C 1TUGB 4IUPA 1GGMA 4FCYA 2ECZA 1NBEB 2DO3A 4BDZA 1KMMA 4M77G 3M0RA 3A8GB 4V2SA 4Z88A 2EJ9A 5CKEA 4PL6A 4PHCA 4HCKA 4C5EA 5KYYA 3HXVA 4L5GA 2E3IA 1G51A 1YITQ 1QE0A 2P0PA 2I4NA 1SF9A 2ZAEA 3M4QA 2RN8A 3GPLA 4M77E 5CKHA 2CP5A 3CQTA 4UP9A 4HKEA 1AWJA 5IXBA 4PK4A 2ED1A 4LE9A 1E1OA 3V8JA 3G7ZA 3CCJA 2L3RA 1FYFA 5GAOn 4ZGEB 1RLQC 3L2RA 4F17A 4F7UG 3AHUA 3BW1A 3VS5A 4EPCA 1IO6A 1RACB 2DXBA 3P8TA 1OU8A 3DB3A 1A0NB 4IIOA 3M56A 4M75G 1VQMA 4Q6GA 3JCMf 1MMAA 1KD1R 3M0TA 3MEUA 2ZT8A 2KRMA 1UFFA 1QLYA 2V26A 2EKOA 1Q81R 3RIRA 4C92G 4F7UE 4BE1A 4M77F 1KG1A 4C0FA 3CC2A 3L4GB 4EMKB 1YJ9T 1ASYA 2Y4YA 3QHSA 4BACA 1CKAA 2X4XA 1QP2A 3CD6Q 2DZCA 1K8AU 2A08A 4M75E 4BD3A 4CH5A 1YIJT 1MMGA 4C8QC 2X35A 3X25B 2XG8D 4A54A 4C92E 5M9OA 1L0WA 3HFOA 1AZGB 2PUOB 2RB6A 1NJIU 1BKBA 1MMDA 1WXTA 2VC8A 3NTHA 4HVUA 4A4GA 2A8EA 5GAOl 1XTDA 2ZCEA 4KH1B 3CCQA 4K86A 3OYBA 2ED0A 2X4JA 3G1JA 2F2VA 5EC7A 2CP3A 4F7UF 1FYNA 2OTLQ 3OYLA 4ZTJA 4C0GA 3VKIA 1U1TA 1RLPC 3G71Q 1HXDA 5CKBA 2K57A 4GLKA 4M7AE 3CCLQ 4M75F 4JJBA 3HRSA 1FMVA 1KHIA 3HTRA 4H2SA 1ZSGA 2JUFA 4C92F 2YUQA 4ZNXA 2ZINA 4CC3A 2VB6A 1X27A 2D8HA 5CAIA 1BIAA 2DL8A 2GF7A 3EFOB 5FU7C 5FLXE 3FRNA 3M0PA 1NLOC 2KT1A 1FWZA 1NE8A 5GAOr 3F70A 5GAN2 1KMNA 4KT0E 4GLMA 3OYJA 2YSQA 4D6WA 2RK2A 2NUZA 2J6KA 2PUKB 1FX7A 3RUXA 1YI2A 2VGNA 5KYNA 4FU6A 2C0IA 1YJWT 2L0AA 3SDZA 2QASA 2YLBA 3EG3A 4M7AF 1H3ZA 1B7YA 3R6OA 3GF5A 1QMCA 1VQPA 2E12A 2V8KA 4OGCA 3VUZA 1VQNQ 3OYKA 2A37A 5EG2A 2ALYA 2RMOA 2BE9B 4D8KA 1M1GA 2RA2A 3ME9A 1QWEA 2O9VA 4BB7A 2P5IA 3JCMJ 2ZPIB 2HNIA 4YRCA 4HCCA 1UGVA 3JB9I 2RNAA 3RBBB 1KQ2A 3LGFA 4NOYA 2GNCA 1PSFA 2AKWB 1QVFA 2J05A 1USYA 5LJ5d 4TVAA 1ARKA 2I0NA 1ZUYA 2K2MA 2XDPA 5D7UA 1RI9A 3MQZA 2E70A 1VA7A 4HCZA 4MZTA 3HXUA 3VS1A 1QCFA 3A74A 2G4CA 3MKDA 2OTJT 1RI0A 3QYHB 3CMET 4LVKA 1HK9A 3VQWA 4CRIA 4J9DA 2JMCA 3E1SA 3MO8A 2MWOA 3OW2P 2ODRC 4AMCA 5LJ5h 4J9EA 3OYCA 2XMFA 1FMKA 1IGQA 2E3CA 1RAAB 3TEHB 2DAQA 1G3YA 2COWA 5HK3A 1M3BA 1KD1C 1YFNA 2WACA 1YJNT 5GJVB 1Q81C 2K3XA 2L89A 1WGSA 1EVKA 3EGXA 1UGSB 3CC7T 2RPNA 4CH3A 2CDTA 1T3SA 2JW4A 2GQIA 3P8YA 5FWBA 4BI8B 4Z89A 3S3NA 2CP0A 1IL2A 3VS7A 1OU9A 5IHNA 4LDYA 1YNZA 2QA4A 1K9AA 1GFDA 1D3BB 4TQDA 4A4EA 4M77B 3A7RA 2EAYA 2EIFA 2MWPA 1UUEA 2DL7A 2SEMA 3EHQA 3I5RA 4OB3B 4ZIBA 2EYQA 3FIFA 4RUGA 1TG0A 4KR2A 4KBMB 1X55A 2QTVA 4DOWA 3TEGA 3EGDA 3EG1A 1B76A 1JJ2S 1W4SA 3RACA 4UP8A 2RHYA 2O4XB 2QDYB 1IHWA 1I1JA 5GANd 2QI2A 4OF1A 2E10A 1JEGA 1B34B 4YRKA 4P3PA 3JCMP 2I4LA 2DTOA 3LSQA 1BI1A 1VQ7A 2ARUA 3REUA 1VQ6Q 5DLOA 2DNUA 4E7SA 1M27C 2DTIA 3CCMA 4N4HA 4M77D 3QPHA 2KE9A 3OY9A 2HBWA 1NJ8A 4F7UB 2EGAA 3CCEQ 2G3RA 1KC8U 2L8DA 4TVYA 1M1KU 2HQEA 1EVLA 1AD5A 4XTXA 4F04B 4CI0C 3E19A 4M75B 1UTIA 4OVAA 3RDVA 2LRQA 5GANh 1VOMA 2Y4XA 1MGQA 4J9CA 1K9MR 4C92B 1B07A 4QW2A 2O31A 1NYQA 2KBTA 1EIFA 4IURA 4FYWB 3I56A 1E6HA 1EIYA 5CQYA 3META 2FPFA 1YFTA 4DEYA 2KT8A 4IIMA 1YB3A 2MOXA 3VV0A 5CCAA 2CKKA 2EYWA 5GMKi 4XU2A 1QVGP 3EH2A 2F5KA 1WHHA 3SFMA 1P92A 2RI3A 5LJ3d 4JS5A 1QVPA 2WSEE 4YRQA 4F14A 4M7DG 4M75D 4BE0A 3V8LA 3EAEA 4M7AB 1I81A 4DPGA 3JB9H 1S72Q 1PCXA 1O9SA 2ZIMA 3GNGA 3GOXA 1UGRB 3J80E 4C92D 3V8KA 3HXWA 1H8KA 4WCIA 2EW3A 3LH0A 1HJDA 2D6FA 4J6XA 2YHTA 3CBPA 4Y92A 4FIBA 4JRQA 4M7DE 3G1ZA 1M90R 3IG2A 4BW9A 1BB9A 3M54A 2LCLA 3RKYA 1RADB 1YJWA 4JJDA 5LJ3h 4R55A 2QG9B 4X1VA 2D8JA 2IVWA 3VJPA 4F16A 3TCJA 4DBHA 3HFZA 2ZGWA 5GAOm 2K4YA 2PZ1A 4C0ZA 1G5IA 1X54A 2H3EB 4DBFA 4KUIA 4VUBA 1SRMA 4LVIA 3OS1A 1M1FA 1I5LA 3G4ST 4YDQA 4YYEA 3IKMB 4PFOA 3EG9A 1Y96A 3FDRA 2JTFA 2DPPB 4IUVA 4M7DF 4XU1A 4YRPA 4NCXA 1K73U 3UPUA 4ORZA 2DF6A 1YHQA 3CPWS 1RUWA 2COZA 2QGGA 2NWMA 2K5IA 5A0DA 1SPKA 4AFQC 1QVFP 5IH2A 1UECA 3D7SB 3QSUA 2DK3A 2C8MA 1PRMC 4AH6A 4ELYC 3CC2T 5IHIA 2ZPEB 3LWIA 4JRPA 4EDUA 1NLPC 2AZSA 2DE0X 2FRWA 1H92A 1EZZB 1USYC 1AWXA 2Y90A 1CKBA 4KULA 5CKFA 4QVZA 2E41A 1HD3A 1I8FA 2XHCA 1BBZA 2PU9B 2ZZFA 4E51A 4YRLA 1G5VA 4X34A 4IUTA 3CMAA 2KNBB 1NJ5A 1Q86U 5C53B 1IREB 1ZLMA 4FL6A 1QF6A 3X28B 3ULRB 1AVZC 2X3XD 2VUBA 1VQ8T 4HVCA 4YRNA 1H4SA 3CCUA 5L8RE 4C5IA 1B8AA 3NELA 3CMQA 1VQKA 2FL7A 4JJCA 3CC4T 5D6WA 4E7HA 4PJOD 1Q7YR 3R07A 4YRMA 2MMPA 2AKKA 2LT4A 3G6EA 4OMPA 5GANg 2ZZDA 1BBWA 2KVQG 1VQMQ 4J7IA 3JCMQ 4EMKA 4JDSA 1MUZA 1UJYA 2A7YA 3UWNA 4LUDA 2FB7A 1K9MC 2K6DA 4UPAA 2A3LA 1KIKA 1U8RA 4P5NA 5LJ5f 4PJJA 4QVCA 4B9XA 3PMIA 2KR3A 2EVRA 2L2PA 2EJGA 3CCVQ 4X5OA 3QDFA 4RTUA 3RNJA 5GAOq 2EQJA 3CBMA 4HWRA 4KR3A 2K2VA 3HXXA 4AT1B 3P8DA 3ASKA 5FU6B 1WNLA 2E5QA 3PCOB 1VQPT 3JCMg 1NYRA 4J83A 3KUFA 2RHUA 4ELZC 2XU8A 3JCMe 4HT4A 4Y28E 3QG1A 4OB0B 2BTTA 2C0OA 2V1RA 2MI6A 4Q5WA 3FC3A 1N8RU 1YN8A 2D1XA 4GBQA 2NUTA 2DXUA 1SSFA 2F2WA 1ZSZB 4B6MA 4LXCA 1M90C 4FSXA 4RG2A 4CS2A 2EYZA 2IIMA 3S6WA 1VQ4Q 1Y71A 3M55A 3M4PA 2KY9A 4E7ZA 4PJMA 2ZCFB 3EFOA 4E7JA 2LJ0A 1KK7A 2H8HA 3HFNA 1TH7A 1M2VB 2FEIA 2YLCA 3M57A 3EFSA 1OZ2A 3FJPA 2QK0A 5KE3A 3HL8A 3A5ZB 5GMKe 2CZ6B 2FYKA 3VS4A 4AFUC 5A0GA 3J81E 1HSQA 2XD0A 2RJEA 4JRIA 5CO7A 1YCYA 4HVWA 1YI2Q 2F1LA 4O2DA 4P72A 3SWNB 3CPFA 4CH6A 4BY6C 5C6SA 3CPWA 2QXFA 5GANf 3M9QA 2CP7A 3L2WA 1QVFS 4ME7A 1EFNA 3T9NA 1QKWA 4KQEA 3J7AF 4M7DB 4C0DC 3OSVA 3S3OA 3M5AA 4CC4B 2P0LA 5AT1B 4DBQA 5KCHA 2AKWA 3C0CA 3HRTA 4R0KA 1N9WA 2QA4T 1LOJA 1KQSA 3G4SA 1FMWA 2DD4A 4MMKA 4YRTA 4RTVA 2J3MA 4L87A 3VS2A 1B70B 2KI7A 4H2UA 1ZBXA 5GMKj 2K79A 3UGQA 1M30A 1H4VB 4DEXA 2XI9A 4QT7A 5AYFA 3QO3A 5IXFA 5HKCA 1G8XA 1D0ZA 4M7DD 1PHTA 1SRYA 2RQTA 5HK0A 1NYFA 2E1HA 4YRIA 3TEHA 1SERA 1Q7YC 1VQ7T 4GY5A 5CIUA 1Z7NA 2XDDA 1Z9QA 5LJ3f 3CCMT 4YRRA 3H8ZA 4FYYB 1W6XA 1E6GA 3VQXA 3OYGA 1KD1U 3A31A 2CZ7B 1VYTA 2IY5B 1V29B 2BZ8A 3R6NA 4HWTA 1I5OB 3CCSQ 1NJIR 12ASA 2QHSA 3M4YA 2JM8A 4H2TA 2DDZA 1HTTA 2KGTA 1F1BB 2JN0A 1Y0MA 4M7AG 2O01E 2DBMA 3WXMB 4M77A 4BWAA 1JJ2P 2MIOA 4OMQA 1K4US 2V1QA 1VQ8A 3QWXX 1M3CA 4ZN1A 2DTHA 3I56T 2AHJB 3CC4A 2XDBA 4RTYA 1H3HA 3REBB 1WJSA 5F5WA 3QUIA 1WPYA 4OP0A 4EIKA 2LCCA 2LC4A 4ZGJB 3JB9F 4RTTA 3BDUA 1VQLA 2KEAA 1ZUUA 1JXOA 1C0AA 3P8HA 5I21A 3LSSA 2E6NA 3EGUA 3OMGA 2AIRB 4F7UA 1YJ9Q 3W3SA 4H2WA 1KQ1A 2BZXA 3WVDB 2DYBA 3MEVA 1H641 7AT1B
chains in the Genus database with same CATH topology
3I55T 4M75A 2LQ8A 4IUUA 3MEWA 3JCMb 4EMKC 2EWNA 1Y7XA 2LX9A 1Y07A 4O6JA 4EMGA 4RKUE 1NNHA 4YCVA 3HPWA 4P3NA 1UB4A 1PSEA 4K87A 4UP7A 5A2QE 4L59A 1PYSB 1W2BS 4YREA 4J7FA 3GIBA 3A8MB 2OAUA 3DLLA 1E22A 4YRFA 1LNXA 1YITA 5D6XA 5GAMd 1YHQT 4CS4A 4M78G 1H4QA 4XQ3A 3VYHB 4LD6A 4UC4A 2F69A 3NTKA 1Z7MA 2K5FA 3DKMA 4WJ3M 2RHQA 4M78E 1GXIE 1YFSA 2RJDA 4BDYA 5GAMh 4TVRA 4XTYA 2RHSA 1MHNA 3CMAT 1JJCB 4OB1B 2CS7A 2ZPBB 4YRSA 3IALA 4RMOA 3OA6A 3CCUT 1H4TA 1VQ6T 3TU4K 3A8LB 2DD5A 1VQKT 5K1PA 3O8VA 3JB9J 1Q82U 2M0OA 4P72C 3CCET 3LC0A 4ZTUB 3E9IA 3G6ET 1J5WA 2ZIOA 3OYEA 2VXFA 4M78F 1NJIC 3JRZA 1NPPA 2ZZGA 4OGEA 3L2UA 1M9SA 4LDUA 3OYAA 3TEEA 4YRJA 3PMTA 4YTLA 1QW1A 2B8AA 4PJOA 2RH2A 1JB0E 2DKGA 2OTLA 1UGPB 4J8OA 2K5LA 3MHXA 1U1SA 1EQRA 2QQRA 4JRKA 3A7AA 2ZXFA 3RMQA 3L2VA 1M5Q1 4P74A 4TWAA 3VQVA 4RCBA 3UH0A 4XEOA 3HY1A 2FVUA 4CH4A 4YPFA 3QZ5B 4IUQA 3NEMA 3JCMV 3A32A 3RERA 2RHZA 2EQMA 1M8VA 3KBGA 2BUDA 4MZMA 3NFCA 4HCBA 3JCMc 3NENA 4LVMA 1VQNA 2DXTA 2VV5A 4C8QG 3BJUA 2EQKA 1O75A 4M77C 3PNWC 3MP1A 4A4HA 2DU7A 1W2BA 2HAXA 1VIFA 1EFWA 5FROA 4J6YA 4QQDA 3PFSA 2Q5IA 2GFUA 3PCOA 4N4IA 4C8QE 3OMCA 4K88A 2VYTA 2DIGA 3M53A 3I55A 3QBYA 5HY6A 3RF1A 4XTWA 3OYFA 2DIQA 1ATIA 4TVAB 2Q7HA 3H6ZA 5CK9A 3QO8A 3GNFB 2RJCA 3A8OB 4ATOA 1SESA 2CZ0B 1IZ6A 1WJQA 3L42A 5LJ5g 2M16A 4M7AD 2DEQA 4TTVA 5LJ5e 5GMKl 4QVDA 5KNNA 3WQZA 4NL3A 4M75C 1G3SA 2DQ3A 2I2LA 3P8BB 4C8QF 2P0QA 2AMCB 4C92C 3HY0A 4PG3A 2DVEA 2MAMA 2R57A 2QQAA 3BFMA 3JCMW 3A5ZA 4P3OA 2ARSA 4H02A 2E64A 3HTZA 3RMSA 11ASA 1G5HA 3SWNA 3ICAA 1ADYA 2QHTA 3I7FA 2CIMA 3OYYA 3E9FA 2RHIA 5HGQA 5DLQE 2CGHA 2F5TX 3LGLA 3MP6A 4O5VA 4M7DA 1KQSS 4A53A 3QKJA 3L2ZA 5LJ5j 4JLGA 5C52B 4M78B 3LX7A 2LT1A 2EL9A 3TUPA 2FHDA 1VIEA 2QQBA 3CXCS 1VQ6A 3EFRA 4QQGA 2PMEA 1B70A 3CCEA 1KC8C 1M1KC 4JLIA 4Y91A 5GANe 3PT9A 3QIIA 1VQLT 3L4GA 2ZT6A 4M78D 2E6ZA 5DY9A 5C0MA 3INZA 5GAMf 3OBYA 3HP9A 5KE2A 1WU7A 4P71A 4EX5A 3C12A 2RI5A 4E7LA 4A4KA 4H2XB 3PGGA 1KOGA 5J39A 4PJOC 4BY6B 1N27A 2V8JA 1XQHA 1S72A 4ZN3A 5K1XA 5GANj 3OYIA 3PZCA 5LJ3g 2ZPHB 4N0AA 4OLFA 4IKFA 3TREA 1XOVA 4EO4A 2X4YA 5LJ3e 4P75A 3FLGA 4TQFA 4BI3A 1YITT 3MCAB 2ZPFB 4P74C 5GAN6 2JTMA 2YRVA 3QZ9B 4A4FA 4PLLA 3MEAA 3CBOA 2WSCE 4KUDK 4HWOA 2ZNIA 2CJ9A 1W66A 3MP8A 1I4K1 1QP3A 3N5BB 2LVMA 4JS4A 3CEYA 2HQXA 1Y96B 2R5MA 3JSCA 3V7CA 4C8QB 1PYSA 3OD1A 5LJ3j 4LNSA 5FRNA 2XK0A 5FU6C 3CD6T 2XKOC 1X75C 3MEYA 4LDXA 3DSQA 3DB4A 1X2GA 1EOVA 2KSSA 2ZPGB 4WJ4A 5I2MA 3CCST 3HRKA 1Q86C 1JRIA 3JCMX 4YCUA 4NL2A 4C8QD 3OQ5A 4HWSA 3CXCA 3JB9G 3OBWA 3OYMA 2OTLT 5IT9E 2JVVA 3G71T 3CCLT 1JJCA 2QQSA 5FU7B 1SETA 4HWPA 3ZEHA 1BI3A 4PLIA 5I2SA 4HT9A 4RG8A 1HC7A 4YP0A 2BIVA 1RL2A 2GFAA 1Q81U 3RGLA 2VXEA 3QTCA 3SWNC 1D3BA 3Q1JA 3CCVA 1VUBA 4XTVA 4HT8A 3X24B 2PVDB 2EFIA 3NTIA 5GMKm 3QYGB 1UEBA 4M7DC 5CR2A 4J15A 3QDRB 1YGBA 4XTUA 3LLRA 3GLXA 2O4XA 1VQNT 2KDSA 4FT2A 1B34A 3RESA 1N8RC 4R56A 3C94A 2GCXA 3QJ6A 3REXA 1QVGA 2LDMA 1OI1A 1VQ4A 3P8VA 4N4GA 4DA4A 4RQEA 2XIDA 3BY7A 5CVIA 3GP8A 2V8IA 3A7UA 1NPRA 5A0LA 2PMFA 1OZ3A 4C92A 2ARTA 1XNIA 4E7IA 2C7IA 1WYDA 4LVJA 4DOVA 3L1AA 3A8HB 2NLUA 4HA8A 5ELOA 2ZZEA 4P71C 1BYMA 4YCWA 4P73A 4ZGDB 4B9WA 2QEXT 2C06A 4OMFB 4M7AA 4MDXA 4G84A 4LDWA 2ODRD 4PKCC 3M59A 5J3BA 5J26A 3HRIA 4PJOG 4DQ2A 2R58A 2CJBA 4N0AC 3FEOA 4P75C 3RKWA 4X9DA 1VQ9T 1FXXA 2PVOB 4XTZA 3CCRT 1NJ2A 3VBBA 4PJOE 1JBMA 2P4TA 3FB9A 2RD1A 2BKDN 3OS2A 1DJ7B 2AMCA 4BUGA 3CD6A 1K8AC 2JZ2A 4WF2A 3ER0A 4ZTZB 2ZTGA 5GAN3 2XICA 2MF2A 1VQ5T 3CCSA 2ZR2A 3V7SA 2EJFA 2GQVA 2LNVA 4PJOF 3MF2A 2WSFE 1KHCA 4PNOA 1NZ9A 1X01A 3PTAA 2HBPA 2Q7GA 3C4SA 2Q7EA 1BIBA 5GAN5 2DXCA 4Q15A 3G71A 3QO5A 1BI2A 1AHJB 3CCLA 4M78A 2LQKA 1ASZA 4XAXB 1WQ7A 2KQWA 3IKLA 5E3IA 2I4MA 3HRUA 2ZNJA 1E1TA 4JJNK 2HD0A 1S72T 2QHVA 3OYHA 3QO7A 1VQOT 1YJ9A 4J6WA 1WLEA 3UT1A 1YIJA 3OS5A 1X56A 2DZ9A 3UFGA 5C51B 3VYGA 2KK4A 4RCCA 2D9TA 4XU3A 3UDCA 2ZT5A 1YBYA 2E65A 4X9CA 1K9MU 1B7YB 1M4ZA 1YFRA 3JCMd 3ERRA 3JB9D 2ALYB 4E47A 5KCOA 4H2XA 3JAME 4QQ6A 3QJYA 5IAYA 2ZT7A 3UGTA 2RM4A 3NETA 4BE2A 3X26B 3WVEB 4EMHA 3OYDA 3C95A 3HKSA 4LVLA 3LW5E 2XGTA 3JCMh 5IN1A 3E9HA 3X20B 4J5YA 5GAMg 2P0KA 3A5YA 5GAMe 4XEMA 1M90U 1ADJA 2RI2A 2NS6A 3KXTA 3PIOA 4RQFA 2QEXA 2RHQB 4LDVA 3HFVA 4G85A 2E5AA 5ELNA 2QQ9A 3ZFJA 4C5HA 1NJ6A 4MZPA 2RHSB 5GAOp 4XK8E 3HXZA 3PIPA 1ZHIA 3CCJT 5CQXA 3OW2S 2I4OA 4JUVA 3MF1A 3L2QA 1Q82C 1RIQA 4MDWA 4P73C 3SD4A 3LYIA 2L5QA 5GMKh 4E7KA 4C8QA 3KFUA 5GAN4 1OYXA 1BI0A 4M7AC 1VQMT 1VQ9A 2DJZA 1G3TA 2R5AA 3CCRA 3URGA 5FRMA 1UGQB 5GAN7 3HHTB 5GAMj 2OTJA 2DQ0A 3CMEA 3M58A 2JOYA 2IG0A 4PJOB 3CCVT 2CZ1B 2D0QB 3BDLA 1WJRA 3V7RA 4RMFA 4ZTFA 2M1HA 3OB9A 5DM7R 3DLMA 1JJ2A 1X2HA 1LYLA 2EQUA 4H2YA 1LJOA 1VQ5A 1N9RA 3CCQT 1YJNA 3OYNA 3ZBDA 3M4GA 3CC7A 5GAN8 1G3WA 2K3YA 3QXEB 3SB2A 4H2VA 2X4WA 2PQWA 4MMLA 1VQZA 1R8OB 1Q7YU 3OS0A 1N9SA 1VQ4T 3HXYA 2IY5A 4XU0A 2VGMA 2ZR3A 4FM4B 2Q5HA 4Z02A 3HSBA 1EIYB 2RHXA 2QTXA 4WI1A 2QHUA 2J3LA 1BBUA 5D6YA 4TVWA 2H3JA 2KMTA 4II1A 5CKDA 2CJAA 1ZQ1A 1VQOA 1YI2T 2DU5A 4LD9K 3RL6A 4C0DB 1N6AA 4M78C 1QVGS 3VUBA 4NS5A 3OSSC 4L6V5 2KAFA 2JNGA 4YRGA 3VQYA 2CYZB 1WQWA 2XTIA 4BI4A 5LL6S 1X6OA 1E24A 2M9UA 2RK1A 1NJ1A 4RDXA 3HFZB 4FT4A 4OB2B 4YROA 3QNEA 4CS3A 2RJFA 2RO0A 3RKXA 4C5GA 3LWHA 1K73C 3S3MA 3OW2A 5KH6A 2LTOA 3E9GA 2PVGB 3VU3C 4IUPA 1GGMA 2DO3A 4BDZA 1KMMA 4M77G 3A8GB 4V2SA 2EJ9A 5CKEA 4PL6A 4PHCA 4C5EA 3HXVA 4L5GA 1G51A 1QE0A 2P0PA 2I4NA 3M4QA 3GPLA 4M77E 5CKHA 4UP9A 4HKEA 1E1OA 3V8JA 3G7ZA 3CCJA 2L3RA 1FYFA 5GAOn 4ZGEB 3L2RA 4F7UG 3AHUA 3BW1A 4EPCA 2DXBA 3P8TA 3DB3A 3M56A 4M75G 1VQMA 4Q6GA 3JCMf 3MEUA 2ZT8A 2EKOA 3RIRA 4C92G 4F7UE 4BE1A 4M77F 1KG1A 4C0FA 3CC2A 3L4GB 4EMKB 1YJ9T 1ASYA 2Y4YA 3QHSA 4BACA 2X4XA 1QP2A 2DZCA 1K8AU 4M75E 4BD3A 4CH5A 1YIJT 4C8QC 2X35A 3X25B 2XG8D 4A54A 4C92E 5M9OA 1L0WA 3HFOA 2PUOB 2RB6A 1NJIU 1BKBA 2VC8A 3NTHA 4A4GA 2A8EA 5GAOl 1XTDA 2ZCEA 3CCQA 4K86A 3OYBA 2X4JA 4F7UF 3OYLA 4ZTJA 4C0GA 3VKIA 1U1TA 1HXDA 5CKBA 2K57A 4GLKA 4M7AE 4M75F 3HRSA 1KHIA 4H2SA 2JUFA 4C92F 2ZINA 5CAIA 1BIAA 2GF7A 5FLXE 5FU7C 3FRNA 1FWZA 1NE8A 5GAOr 3F70A 5GAN2 1KMNA 4KT0E 3OYJA 4D6WA 2RK2A 2PUKB 1FX7A 3RUXA 1YI2A 2VGNA 4FU6A 1YJWT 3SDZA 4M7AF 2YLBA 1H3ZA 1B7YA 3R6OA 3GF5A 1VQPA 2E12A 2V8KA 4OGCA 3VUZA 3OYKA 5EG2A 2ALYA 1M1GA 2RA2A 3ME9A 4BB7A 2P5IA 3JCMJ 2ZPIB 2HNIA 4YRCA 4HCCA 3JB9I 1KQ2A 3LGFA 4NOYA 1PSFA 2AKWB 1QVFA 1USYA 5LJ5d 4TVAA 2XDPA 3MQZA 2E70A 4HCZA 4MZTA 3HXUA 3A74A 2G4CA 2OTJT 1RI0A 3QYHB 3CMET 4LVKA 1HK9A 3VQWA 4CRIA 3E1SA 3MO8A 2MWOA 2ODRC 5LJ5h 3OYCA 2E3CA 3TEHB 2DAQA 1G3YA 5HK3A 1KD1C 2WACA 1YJNT 1Q81C 2K3XA 2L89A 1WGSA 1EVKA 1UGSB 3CC7T 4CH3A 3P8YA 3S3NA 4BI8B 1IL2A 4LDYA 2QA4A 1D3BB 4TQDA 4A4EA 4M77B 3A7RA 2EAYA 2EIFA 2MWPA 4OB3B 4ZIBA 2EYQA 3FIFA 4KR2A 4KBMB 1X55A 4DOWA 3TEGA 1B76A 3RACA 1JJ2S 1W4SA 4UP8A 2RHYA 2O4XB 2QDYB 5GANd 2QI2A 4OF1A 2E10A 1B34B 4YRKA 4P3PA 3JCMP 2I4LA 2DTOA 3LSQA 1BI1A 1VQ7A 2ARUA 3REUA 5DLOA 2DTIA 3CCMA 4N4HA 4M77D 3QPHA 3OY9A 1NJ8A 4F7UB 2G3RA 1KC8U 2L8DA 4TVYA 1M1KU 2HQEA 1EVLA 4XTXA 4CI0C 3E19A 4M75B 4OVAA 2LRQA 5GANh 2Y4XA 1MGQA 4C92B 4QW2A 1NYQA 1EIFA 4IURA 3I56A 1EIYA 5CQYA 3META 1YFTA 1YB3A 3VV0A 5CCAA 2CKKA 5GMKi 4XU2A 2F5KA 3SFMA 1P92A 2RI3A 5LJ3d 4JS5A 1QVPA 2WSEE 4YRQA 4M7DG 4M75D 4BE0A 3V8LA 3EAEA 4M7AB 1I81A 4DPGA 3JB9H 1O9SA 2ZIMA 3GNGA 3GOXA 1UGRB 3J80E 4C92D 3V8KA 3HXWA 3LH0A 2D6FA 4J6XA 2YHTA 3CBPA 4JRQA 4FIBA 4M7DE 3G1ZA 3IG2A 4BW9A 3M54A 2LCLA 3RKYA 1YJWA 5LJ3h 4R55A 2IVWA 3VJPA 3TCJA 3HFZA 2ZGWA 5GAOm 2K4YA 4C0ZA 1G5IA 1X54A 4KUIA 4VUBA 4LVIA 3OS1A 1M1FA 1I5LA 3G4ST 4YDQA 4YYEA 3IKMB 1Y96A 3FDRA 2JTFA 2DPPB 4IUVA 4M7DF 4XU1A 4YRPA 4NCXA 1K73U 3UPUA 1YHQA 3CPWS 2K5IA 5A0DA 3QSUA 2DK3A 2C8MA 4AH6A 4ELYC 3CC2T 2ZPEB 3LWIA 4JRPA 4EDUA 1USYC 2Y90A 4KULA 5CKFA 4QVZA 2E41A 1I8FA 2XHCA 2PU9B 2ZZFA 4E51A 4YRLA 1G5VA 4X34A 4IUTA 3CMAA 1NJ5A 1Q86U 5C53B 1IREB 4FL6A 1QF6A 3X28B 2VUBA 1VQ8T 4HVCA 4YRNA 1H4SA 3CCUA 5L8RE 4C5IA 1B8AA 3NELA 3CMQA 1VQKA 2FL7A 3CC4T 5D6WA 4E7HA 4PJOD 3R07A 4YRMA 2MMPA 2LT4A 3G6EA 5GANg 2ZZDA 1BBWA 2KVQG 4J7IA 3JCMQ 4EMKA 4JDSA 2A7YA 3UWNA 2FB7A 1K9MC 4UPAA 2A3LA 1U8RA 4P5NA 5LJ5f 4QVCA 4B9XA 3PMIA 2EJGA 4X5OA 5GAOq 4KR3A 2EQJA 3CBMA 4HWRA 2K2VA 3HXXA 3P8DA 3ASKA 5FU6B 1WNLA 2E5QA 3PCOB 1VQPT 3JCMg 1NYRA 4J83A 3KUFA 2RHUA 4ELZC 2XU8A 3JCMe 4HT4A 4Y28E 3QG1A 4OB0B 4Q5WA 2MI6A 3FC3A 1N8RU 2DXUA 1SSFA 1M90C 4FSXA 4RG2A 4CS2A 3S6WA 1Y71A 3M55A 3M4PA 2KY9A 2ZCFB 4E7JA 3HFNA 1TH7A 2YLCA 3M57A 3EFSA 1OZ2A 3FJPA 5KE3A 3HL8A 3A5ZB 5GMKe 2CZ6B 2FYKA 5A0GA 3J81E 2XD0A 2RJEA 4JRIA 5CO7A 1YCYA 4O2DA 4P72A 3SWNB 3CPFA 4CH6A 4BY6C 5C6SA 3CPWA 2QXFA 5GANf 3M9QA 3L2WA 1QVFS 4ME7A 3T9NA 4KQEA 3J7AF 4M7DB 4C0DC 3OSVA 3S3OA 3M5AA 2P0LA 5KCHA 2AKWA 3HRTA 1N9WA 2QA4T 1LOJA 1KQSA 3G4SA 2DD4A 4MMKA 4YRTA 2J3MA 4L87A 1B70B 4H2UA 1ZBXA 5GMKj 3UGQA 1H4VB 2XI9A 5AYFA 3QO3A 5HKCA 4M7DD 1SRYA 5HK0A 2E1HA 4YRIA 3TEHA 1SERA 1Q7YC 1VQ7T 4GY5A 5CIUA 1Z7NA 2XDDA 5LJ3f 4YRRA 3CCMT 3H8ZA 3VQXA 3OYGA 1KD1U 3A31A 2CZ7B 2IY5B 1V29B 4HWTA 12ASA 2QHSA 3M4YA 4H2TA 2DDZA 1HTTA 2JN0A 4M7AG 2O01E 3WXMB 4BWAA 4M77A 1VQ8A 4ZN1A 2DTHA 3I56T 2AHJB 3CC4A 2XDBA 1WJSA 5F5WA 3QUIA 1WPYA 4OP0A 2LCCA 2LC4A 4ZGJB 3JB9F 3BDUA 1VQLA 1C0AA 3P8HA 5I21A 3LSSA 2E6NA 3OMGA 4F7UA 3W3SA 4H2WA 1KQ1A 3WVDB 3MEVA 1H641
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E10 A;  1B34 B;  4YRK A;  4P3P A;  3JCM P;  2I4L A;  1Y96 B;  2DTO A;  4M75 A;  5GAM j;  3LSQ A;  2DQ0 A;  2ARU A;  3REU A;  3V7C A;  4C8Q B;  3JCM b;  1PYS A;  2DTI A;  3OD1 A;  4EMK C;  4M77 D;  2EWN A;  4PJO B;  1NJ8 A;  4F7U B;  5LJ3 j;  3V7R A;  4LNS A;  4RMF A;  4TVY A;  4EMG A;  1EVL A;  4XTX A;  1NNH A;  4YCV A;  1X2H A;  4M75 B;  3MEY A;  3DSQ A;  4P3N A;  1LYL A;  4K87 A;  4H2Y A;  4UP7 A;  5GAN h;  1X2G A;  1EOV A;  1PYS B;  1LJO A;  1N9R A;  4WJ4 A;  4YRE A;  1MGQ A;  3GIB A;  4C92 B;  3HRK A;  1NYQ A;  3M4G A;  1E22 A;  1JRI A;  5GAN 8;  3JCM X;  4YCU A;  4YRF A;  1LNX A;  1EIY A;  3SB2 A;  4NL2 A;  4H2V A;  4C8Q D;  5GAM d;  4MML A;  1VQZ A;  4HWS A;  4CS4 A;  1YFT A;  1YB3 A;  4M78 G;  3JB9 G;  1H4Q A;  1N9S A;  5GMK i;  4XU2 A;  3HXY A;  2IY5 A;  4XU0 A;  4XQ3 A;  5LJ3 d;  4YRQ A;  4M7D G;  2ZR3 A;  4M75 D;  2Q5H A;  3V8L A;  1JJC A;  1SET A;  4M7A B;  1I81 A;  3HSB A;  4HWP A;  1EIY B;  1Z7M A;  2QTX A;  4DPG A;  3JB9 H;  4WI1 A;  2ZIM A;  4WJ3 M;  4C92 D;  2QHU A;  3V8K A;  4M78 E;  4HT9 A;  2J3L A;  2RHQ A;  3HXW A;  1HC7 A;  1BBU A;  4YP0 A;  4J6X A;  1YFS A;  4TVW A;  2YHT A;  5GAM h;  3RGL A;  2VXE A;  2RHS A;  4XTY A;  4M7D E;  3G1Z A;  2CJA A;  3QTC A;  3SWN C;  3IG2 A;  1JJC B;  4BW9 A;  1D3B A;  3RKY A;  2DU5 A;  3RL6 A;  4M78 C;  5LJ3 h;  4HT8 A;  4YRS A;  4XTV A;  3IAL A;  1H4T A;  5GMK m;  3HFZ A;  2ZGW A;  5GAO m;  5K1P A;  4M7D C;  3JB9 J;  1G5I A;  1X54 A;  4J15 A;  1YGB A;  4P72 C;  3LC0 A;  4YRG A;  3VQY A;  1WQW A;  4ZTU B;  3E9I A;  4XTU A;  2XTI A;  1J5W A;  2ZIO A;  2VXF A;  1I5L A;  4M78 F;  4YDQ A;  4YYE A;  3IKM B;  1E24 A;  2ZZG A;  1B34 A;  3RES A;  1Y96 A;  1NJ1 A;  4RDX A;  3HFZ B;  4YRO A;  3QNE A;  4M7D F;  4CS3 A;  4XU1 A;  4YRJ A;  4YRP A;  4NCX A;  3RKX A;  3REX A;  4PJO A;  2DKG A;  3QSU A;  3P8V A;  4RQE A;  2C8M A;  3BY7 A;  4AH6 A;  1U1S A;  3A7U A;  1EQR A;  4JRK A;  3A7A A;  2ZXF A;  2PMF A;  4C92 A;  3VU3 C;  1USY C;  2Y90 A;  2ART A;  1M5Q 1;  1GGM A;  2C7I A;  2E41 A;  1I8F A;  1WYD A;  1KMM A;  4M77 G;  4P74 A;  4TWA A;  3VQV A;  2ZZF A;  4RCB A;  3L1A A;  4E51 A;  3UH0 A;  4YRL A;  4XEO A;  4HA8 A;  5ELO A;  3HY1 A;  4V2S A;  4CH4 A;  2EJ9 A;  2ZZE A;  1NJ5 A;  4PHC A;  4YPF A;  5C53 B;  4P71 C;  3HXV A;  4YCW A;  1QF6 A;  4P73 A;  1G51 A;  1QE0 A;  2I4N A;  4HVC A;  3NEM A;  3M4Q A;  4YRN A;  1H4S A;  3JCM V;  3A32 A;  3RER A;  1B8A A;  4M77 E;  3NEL A;  3CMQ A;  4UP9 A;  1M8V A;  4M7A A;  4G84 A;  3JCM c;  2ODR D;  4PJO D;  1E1O A;  3NEN A;  3R07 A;  4YRM A;  3V8J A;  1FYF A;  5GAN g;  5GAO n;  2DXT A;  4C8Q G;  3HRI A;  3BJU A;  1BBW A;  4PJO G;  4DQ2 A;  4F7U G;  4M77 C;  3AHU A;  3BW1 A;  2CJB A;  3JCM Q;  4EMK A;  4N0A C;  2DU7 A;  3P8T A;  2FB7 A;  4P75 C;  1EFW A;  3RKW A;  4UPA A;  4J6Y A;  4X9D A;  4M75 G;  2Q5I A;  4Q6G A;  3JCM f;  4XTZ A;  5LJ5 f;  2ZT8 A;  3PCO A;  4QVC A;  4C8Q E;  4K88 A;  1NJ2 A;  3VBB A;  4PJO E;  2EJG A;  3RIR A;  4C92 G;  4F7U E;  4M77 F;  4X5O A;  1JBM A;  3L4G B;  3RF1 A;  4XTW A;  4EMK B;  3FB9 A;  1ASY A;  5GAO q;  3QHS A;  4KR3 A;  4HWR A;  1ATI A;  2RD1 A;  4TVA B;  2Q7H A;  3HXX A;  3QO8 A;  2DZC A;  4M75 E;  4CH5 A;  4C8Q C;  1WNL A;  1SES A;  3PCO B;  3JCM g;  1NYR A;  2AMC A;  5LJ5 g;  4A54 A;  4C92 E;  3JCM e;  1L0W A;  3HFO A;  4M7A D;  2DEQ A;  2RB6 A;  4TTV A;  5LJ5 e;  4WF2 A;  5GMK l;  2VC8 A;  4QVD A;  4ZTZ B;  5KNN A;  5GAO l;  3WQZ A;  2ZTG A;  5GAN 3;  4NL3 A;  2ZCE A;  4M75 C;  2DQ3 A;  4K86 A;  2DXU A;  2I2L A;  2ZR2 A;  3V7S A;  2EJF A;  4C8Q F;  4PJO F;  3MF2 A;  2AMC B;  4C92 C;  3HY0 A;  4CS2 A;  4PG3 A;  4F7U F;  4PNO A;  2DVE A;  1X01 A;  3BFM A;  3JCM W;  2Q7G A;  3M4P A;  3A5Z A;  1U1T A;  4P3O A;  2ARS A;  4H02 A;  1HXD A;  2K57 A;  2E64 A;  4M7A E;  3HFN A;  3HTZ A;  1TH7 A;  4M75 F;  2Q7E A;  11AS A;  4H2S A;  1G5H A;  3SWN A;  3ICA A;  1BIB A;  1ADY A;  2QHT A;  2YLC A;  5GAN 5;  3EFS A;  4Q15 A;  3QO5 A;  4C92 F;  3I7F A;  2CIM A;  4M78 A;  3FJP A;  2ZIN A;  1ASZ A;  5HGQ A;  5CAI A;  1BIA A;  1WQ7 A;  2CGH A;  5GMK e;  2FYK A;  3IKL A;  5E3I A;  2I4M A;  5GAO r;  4JRI A;  4M7D A;  5GAN 2;  1YCY A;  1KMN A;  4A53 A;  2ZNJ A;  4O2D A;  4P72 A;  3SWN B;  1E1T A;  2QHV A;  3L2Z A;  5LJ5 j;  4CH6 A;  5C52 B;  3QO7 A;  5GAN f;  4M78 B;  3RUX A;  2EL9 A;  3TUP A;  4KQE A;  4J6W A;  1WLE A;  4M7A F;  2YLB A;  1B7Y A;  4M7D B;  1X56 A;  2P0L A;  2DZ9 A;  3EFR A;  3UFG A;  2AKW A;  2PME A;  1B70 A;  2ALY A;  5C51 B;  4RCC A;  1N9W A;  4XU3 A;  2RA2 A;  1LOJ A;  4JLI A;  2ZT5 A;  2E65 A;  2P5I A;  3JCM J;  4YRC A;  2HNI A;  4Y91 A;  4X9C A;  5GAN e;  3JB9 I;  1B7Y B;  4MMK A;  4YRT A;  1KQ2 A;  2J3M A;  3L4G A;  4L87 A;  1YFR A;  4NOY A;  2ZT6 A;  3JCM d;  2AKW B;  3ERR A;  4M78 D;  3JB9 D;  1B70 B;  1USY A;  2ALY B;  5LJ5 d;  4TVA A;  4H2U A;  5GMK j;  3UGQ A;  1H4V B;  4H2X A;  5DY9 A;  3QO3 A;  4M7D D;  3INZ A;  3HXU A;  5GAM f;  1SRY A;  2ZT7 A;  3UGT A;  2RM4 A;  3A74 A;  2G4C A;  2E1H A;  1WU7 A;  3NET A;  4P71 A;  3TEH A;  4YRI A;  1SER A;  4EX5 A;  4EMH A;  1Z7N A;  1HK9 A;  3VQW A;  5LJ3 f;  4YRR A;  4H2X B;  3PGG A;  2XGT A;  3JCM h;  2ODR C;  3VQX A;  3A31 A;  4PJO C;  1KOG A;  5LJ5 h;  3E9H A;  2IY5 B;  4HWT A;  4J5Y A;  2E3C A;  5GAM g;  12AS A;  2QHS A;  3TEH B;  4H2T A;  2DDZ A;  1HTT A;  5GAM e;  3A5Y A;  4XEM A;  5K1X A;  2JN0 A;  1ADJ A;  4M7A G;  4BWA A;  4M77 A;  5GAN j;  3PZC A;  4RQF A;  5LJ3 g;  2RHQ B;  4N0A A;  4OLF A;  1EVK A;  4EO4 A;  4CH3 A;  5LJ3 e;  4P75 A;  4TQF A;  3HFV A;  4G85 A;  2DTH A;  2E5A A;  3P8Y A;  5ELN A;  1NJ6 A;  2RHS B;  5GAO p;  1IL2 A;  3HXZ A;  4P74 C;  5F5W A;  3QUI A;  1WPY A;  1D3B B;  4OP0 A;  4TQD A;  4M77 B;  2I4O A;  3A7R A;  2EAY A;  3JB9 F;  5GAN 6;  4JUV A;  3MF1 A;  1RIQ A;  3BDU A;  4ZIB A;  4P73 C;  3FIF A;  5GMK h;  4KR2 A;  1C0A A;  4HWO A;  4C8Q A;  5I21 A;  2ZNI A;  3KFU A;  1X55 A;  5GAN 4;  1W66 A;  2CJ9 A;  3LSS A;  3TEG A;  1B76 A;  3RAC A;  4M7A C;  2DJZ A;  4F7U A;  1I4K 1;  4UP8 A;  3W3S A;  4H2W A;  1KQ1 A;  1H64 1;  5GAN 7;  5GAN d; 
#chains in the Genus database with same CATH topology
 3I55 T;  1YIJ Q;  4M75 A;  5KYU B;  1JU5 C;  2LQ8 A;  1QKX A;  1CSK A;  4IUU A;  3MEW A;  3JCM b;  4EMK C;  2EWN A;  1Y7X A;  2EBP A;  2LX9 A;  1Y07 A;  4O6J A;  2DYI A;  2ESW A;  4EMG A;  3TSW A;  2C0T A;  4RKU E;  1NNH A;  4YCV A;  2JJ9 A;  3HPW A;  2QGF B;  1TUD A;  4P3N A;  1UB4 A;  1PSE A;  4K87 A;  4UP7 A;  2YWW A;  5A2Q E;  4L59 A;  1PYS B;  1QQJ A;  1W2B S;  4YRE A;  4J7F A;  3GIB A;  3A8M B;  2OAU A;  3DLL A;  1E22 A;  1GCQ A;  4YRF A;  1LNX A;  4M4Z A;  1YIT A;  5D6X A;  5GAM d;  1YHQ T;  4CS4 A;  4M78 G;  5KYY B;  1NEB A;  1H4Q A;  2DBK A;  2O9S A;  3NGP A;  4XQ3 A;  3VYH B;  2NUP A;  4LD6 A;  4UC4 A;  1PD1 A;  2F69 A;  3NTK A;  1Z7M A;  2K5F A;  3DKM A;  4WJ3 M;  4LUE A;  2RHQ A;  4M78 E;  1G83 A;  1RAB B;  1C0M A;  2B86 A;  1GXI E;  1YFS A;  2RJD A;  1YJW Q;  4BDY A;  5GAM h;  2QEX Q;  4TVR A;  4XTY A;  2RHS A;  1MHN A;  3CMA T;  1JJC B;  2MK5 A;  1QWF A;  1U3O A;  8ATC B;  4OB1 B;  2CS7 A;  3CPW P;  1OQK A;  2ZPB B;  4YRS A;  3IAL A;  4RMO A;  3OA6 A;  2L3Q A;  3CCU T;  1H4T A;  1IHV A;  1VQ6 T;  1BK2 A;  3TU4 K;  3A8L B;  2DD5 A;  1VQK T;  5K1P A;  3O8V A;  2PTK A;  2DEU A;  3JB9 J;  1Q82 U;  2M0O A;  4P72 C;  3CCE T;  3LC0 A;  4ZTU B;  3E9I A;  3G6E T;  1J5W A;  2ZIO A;  3OYE A;  1PWT A;  2VXF A;  4M78 F;  3A1P A;  3REA B;  1NJI C;  3JRZ A;  1NPP A;  2ZZG A;  2FPD A;  4OGE A;  3L2U A;  2DL5 A;  1MMN A;  1VQ9 Q;  1M9S A;  1IGU A;  3CCR Q;  4LDU A;  3OYA A;  3TEE A;  1SSH A;  2JTE A;  4YRJ A;  3PMT A;  4YTL A;  1QW1 A;  1TSF A;  2BZY A;  2B8A A;  4PJO A;  1NEG A;  2RH2 A;  2OTJ Q;  1JB0 E;  2X3W D;  2COY A;  3CME Q;  5HCK A;  2DKG A;  5IHK A;  2OTL A;  2YT6 A;  1UGP B;  2RQW A;  4J8O A;  2K5L A;  1K1Z A;  3MHX A;  1U1S A;  1EQR A;  1AWW A;  2QQR A;  4JRK A;  3A7A A;  2ZXF A;  3RMQ A;  3L2V A;  1M5Q 1;  1KC8 R;  1M1K R;  4KGV B;  1VQ5 Q;  1YJN Q;  4P74 A;  4TWA A;  3VQV A;  4RCB A;  3UH0 A;  1SHG A;  2DMO A;  4XEO A;  3HY1 A;  2FVU A;  4CH4 A;  3CC7 Q;  4YPF A;  4J9I A;  1M2O A;  3QZ5 B;  1AWO A;  4IUQ A;  2A28 A;  3QWY A;  3NEM A;  3JCM V;  3A32 A;  3RER A;  2RHZ A;  2EQM A;  3M0S A;  1WHM A;  1M8V A;  3KBG A;  2ATC B;  2BUD A;  2HMA A;  4MZM A;  3NFC A;  4HCB A;  1I0C A;  3JCM c;  1TS9 A;  3NEN A;  1GBQ A;  4LVM A;  1RAI B;  4ANJ A;  1VQN A;  2DXT A;  2VV5 A;  4C8Q G;  3BJU A;  2EQK A;  8AT1 B;  1AZE A;  1O75 A;  4M77 C;  3PNW C;  9ATC B;  2JMA A;  1UG1 A;  3MP1 A;  3H0F A;  1AOJ A;  4A4H A;  2DU7 A;  1W2B A;  2HAX A;  1NG2 A;  1VIF A;  4AG1 C;  1EFW A;  5FRO A;  2DER A;  4J6Y A;  4QQD A;  3PFS A;  2Q5I A;  1MV3 A;  1UE9 A;  2GFU A;  2X9H A;  1VQO Q;  2X51 A;  4N4I A;  3PCO A;  2EGC A;  4C8Q E;  3OMC A;  4K88 A;  4PFZ A;  1UDL A;  1PC0 A;  2VYT A;  2DIG A;  1LVK A;  3M53 A;  2JXB A;  2OI3 A;  3I55 A;  2AK5 A;  3QBY A;  3LH5 A;  5HY6 A;  3RF1 A;  2O2O A;  4XTW A;  1SEM A;  3OYF A;  3I5S A;  2DIQ A;  1ATI A;  4TVA B;  2Q7H A;  3H6Z A;  5CK9 A;  3QO8 A;  3GNF B;  1TTH B;  1ZSZ A;  2RJC A;  3A8O B;  1U06 A;  4ATO A;  1KJW A;  1SES A;  1LPL A;  2CZ0 B;  1IZ6 A;  1WJQ A;  3L42 A;  5LJ5 g;  2M16 A;  3H9N A;  4M7A D;  2DEQ A;  4TTV A;  5LJ5 e;  1TUC A;  5GMK l;  4QVD A;  1WXB A;  5KNN A;  3WQZ A;  2QDL A;  4NL3 A;  1OV3 A;  4M75 C;  1G3S A;  2DQ3 A;  4FW1 A;  2I2L A;  1M2V A;  1OX9 A;  3P8B B;  4C8Q F;  2EYX A;  2P0Q A;  2E5K A;  1X43 A;  4C92 C;  2AMC B;  3HY0 A;  4PG3 A;  6AT1 B;  2DVE A;  2MAM A;  2R57 A;  4PJL A;  2QQA A;  2LJ1 A;  3BFM A;  3JCM W;  1AEY A;  1SRL A;  1D1B A;  3A5Z A;  4P3O A;  4OMO A;  2ARS A;  4H02 A;  2LX7 A;  3O5Z A;  1OX8 A;  2E64 A;  3UA7 A;  3HTZ A;  3RMS A;  11AS A;  1G5H A;  3SWN A;  3ICA A;  1RAH B;  1ADY A;  2QHT A;  3EGX B;  3I7F A;  2CIM A;  1Q95 G;  3OYY A;  3E9F A;  2RHI A;  1WYX A;  5HGQ A;  5DLQ E;  1GCQ C;  2CGH A;  4RTX A;  2F5T X;  4CC2 A;  2LQW A;  3LGL A;  3MP6 A;  2SRC A;  4O5V A;  4M7D A;  1KQS S;  4A53 A;  3QKJ A;  2HL5 C;  2FZC B;  3VS6 A;  3L2Z A;  5LJ5 j;  2RQU A;  4JLG A;  2DLP A;  5C52 B;  2J7I A;  1Q86 R;  4M78 B;  3LX7 A;  2GGR A;  2LT1 A;  2EL9 A;  4ESR A;  3TUP A;  2FHD A;  3EGD B;  1K76 A;  1VIE A;  2QQB A;  3CXC S;  3M0Q A;  1WHJ A;  1VQ6 A;  3CCJ Q;  4J9H A;  3EFR A;  2VWF A;  4QQG A;  3G4S Q;  2PME A;  1B70 A;  3EH1 A;  3CCE A;  1WX6 A;  1KC8 C;  1M1K C;  4JLI A;  1EX4 A;  4KRT A;  2AZV A;  2K9G A;  4Y91 A;  5GAN e;  2DL3 A;  3PT9 A;  3QII A;  1VQL T;  3L4G A;  2ZT6 A;  4M78 D;  1YWO A;  2E6Z A;  2RQV A;  5DY9 A;  3CC2 Q;  2KXC A;  5C0M A;  1Y57 A;  3INZ A;  1D0Y A;  5GAM f;  4FW2 A;  3OBY A;  3HP9 A;  3PVL A;  5KE2 A;  1WU7 A;  2LZ6 B;  1SG5 A;  3M0U A;  4P71 A;  5KYX B;  1T0H A;  2JM9 A;  4EX5 A;  3C12 A;  1E7O A;  2RI5 A;  4E7L A;  2J6F A;  4A4K A;  2DET A;  4H2X B;  3PGG A;  1YP5 A;  2HSP A;  1WLP B;  1KOG A;  5J39 A;  4PJO C;  4BY6 B;  1N27 A;  3CCQ Q;  2V8J A;  1XQH A;  1S72 A;  4ZN3 A;  4Z8A A;  2GTO A;  1N8R R;  1VQ8 Q;  1SHF A;  2ROL A;  5K1X A;  1HYO A;  3CC4 Q;  5GAN j;  3OYI A;  3PZC A;  5LJ3 g;  2ZPH B;  4N0A A;  4OLF A;  4IKF A;  2KYM A;  3TRE A;  1XOV A;  4EO4 A;  2X4Y A;  5LJ3 e;  4P75 A;  3FLG A;  4TQF A;  2CH4 W;  4BI3 A;  1YIT T;  3MCA B;  2ZPF B;  4OMM A;  4P74 C;  1TU0 B;  2HKQ B;  2FZG B;  1X6G A;  1R0B G;  5GAN 6;  2JTM A;  2YRV A;  1ZX6 A;  3QZ9 B;  4A4F A;  1X6B A;  4PLL A;  3MEA A;  1PD0 A;  3CBO A;  2WSC E;  5KYU A;  4A63 B;  4KUD K;  4HWO A;  2ZNI A;  5I11 A;  2CJ9 A;  1W66 A;  2MPX C;  3MP8 A;  1PG5 B;  1I4K 1;  1GRI A;  1W2B P;  1M8M A;  1QP3 A;  3N5B B;  3VS3 A;  4CC7 A;  2LVM A;  4JS4 A;  3CEY A;  2HQX A;  1Y96 B;  2R5M A;  3NPF A;  1VQP Q;  3JSC A;  3V7C A;  2DRK A;  1GBR A;  4C8Q B;  1PYS A;  3OD1 A;  5KYW B;  3KFV A;  3PVQ A;  5ECA A;  5LJ3 j;  4LNS A;  5FRN A;  3TQ7 P;  1XJW B;  2XK0 A;  5FU6 C;  3CD6 T;  2XKO C;  2KRO A;  2YXY A;  1X75 C;  3MEY A;  4LDX A;  3DSQ A;  1RAF B;  1UHF A;  3DB4 A;  1X2G A;  1EOV A;  1AT1 B;  2KSS A;  1TWB A;  2ZPG B;  4WJ4 A;  5I2M A;  3CCS T;  1D1C A;  1B7T A;  3HRK A;  4WTO B;  2LQN A;  1ZSZ C;  1BU1 A;  2W0Z A;  1Q86 C;  1JRI A;  3JCM X;  4YCU A;  1TXQ A;  4NL2 A;  4C8Q D;  1WA7 A;  3OQ5 A;  4HWS A;  1WXU A;  3CXC A;  1OPL A;  3JB9 G;  3OBW A;  2YUP A;  4KGX B;  3OYM A;  2OTL T;  2DFU A;  2OX7 A;  5IT9 E;  2JVV A;  2JT4 A;  3G71 T;  1IB8 A;  3CCL T;  1JJC A;  2QQS A;  5FU7 B;  1SET A;  4HWP A;  4KH0 B;  3ZEH A;  1K8A R;  2KRS A;  1BI3 A;  4PLI A;  4HXJ A;  5I2S A;  2LJ3 A;  3IQL A;  1W70 A;  4HT9 A;  1I07 A;  4RG8 A;  1HC7 A;  4YP0 A;  2BIV A;  1M3A A;  1RL2 A;  3ZL7 C;  1OUL A;  2GFA A;  1Q81 U;  1VYV A;  3RGL A;  2VXE A;  3QTC A;  3SWN C;  4JZ4 A;  1R0C B;  2LCS A;  2EYY A;  1D3B A;  1QCO A;  1QCN A;  3Q1J A;  2DA9 A;  4QKU A;  3CCV A;  1VUB A;  4XTV A;  4HT8 A;  2HCK A;  3UF4 A;  3X24 B;  2PVD B;  2EFI A;  3NTI A;  2QA4 Q;  5GMK m;  3QYG B;  1UEB A;  3VS0 A;  4M7D C;  5CR2 A;  1D1A A;  4J15 A;  2E4H A;  3QDR B;  1YGB A;  4XTU A;  3LLR A;  3UAT A;  3GLX A;  2O4X A;  1VQN T;  2KDS A;  1ZBJ A;  4FT2 A;  1B34 A;  3RES A;  1N8R C;  4R56 A;  1C1A A;  3C94 A;  2GCX A;  3QJ6 A;  3REX A;  1QVG A;  3GBQ A;  3AT1 B;  1WDX A;  2HQH A;  1VQ7 Q;  2NUT B;  2P4R A;  2LDM A;  1OI1 A;  1VQ4 A;  2EGE A;  3P8V A;  4N4G A;  4DA4 A;  3CCM Q;  4RQE A;  2XID A;  1KSW A;  1D0X A;  1W1F A;  3BY7 A;  2HEQ A;  2M02 A;  2OAW A;  5CVI A;  2G6F X;  3GP8 A;  2GTJ A;  2V8I A;  3A7U A;  2A0F B;  2L3P A;  1NPR A;  5A0L A;  2PMF A;  1OZ3 A;  4C92 A;  2ART A;  1XNI A;  4E7I A;  2C7I A;  1X2K A;  4LN2 A;  4RTZ A;  1WYD A;  4LVJ A;  4DOV A;  1VYU A;  1WZO A;  2VKN A;  2CT3 A;  2P84 A;  3L1A A;  3A8H B;  5L23 A;  2NLU A;  4HA8 A;  5ELO A;  2OJ2 A;  3VRY A;  2ZZE A;  2AKL A;  4AFZ C;  4P71 C;  1V76 A;  2L3S A;  3I56 Q;  1BYM A;  4YCW A;  4P73 A;  4ZGD B;  4B9W A;  1OOT A;  2QEX T;  2C06 A;  4OMF B;  2QYZ A;  1ABQ A;  2J6O A;  4FSS A;  4DBR A;  1SKU B;  4M7A A;  2HSE B;  4OML A;  2CRE A;  4MDX A;  1WHG A;  4G84 A;  4LDW A;  2ODR D;  2EQI A;  2ROT A;  2J06 A;  4PKC C;  2EPD A;  2PNI A;  1GFC A;  3M59 A;  2Z0W A;  5J3B A;  2CT4 A;  5J26 A;  3HRI A;  1KFZ A;  4PJO G;  4DQ2 A;  2R58 A;  2CJB A;  1X69 A;  1ZUK A;  4N0A C;  4HVV A;  1JXM A;  3FEO A;  2KYB A;  2JS0 A;  4P75 C;  3RKW A;  3I55 Q;  4X9D A;  2CUB A;  1U5S A;  2CH4 A;  2FO0 A;  1VQ9 T;  5FW9 A;  1FXX A;  2PVO B;  4XTZ A;  3CCR T;  4PJN A;  1NJ2 A;  4PJO E;  3VBB A;  2K7A A;  2M0Y A;  1X2Q A;  1JBM A;  2P4T A;  3FB9 A;  1N5Z A;  4AFS C;  1WI7 A;  2FPE A;  2RD1 A;  1B3Q A;  1YWP A;  2VVK A;  1TOV A;  2BKD N;  3OS2 A;  4FYV B;  1DJ7 B;  2AMC A;  4OMN A;  4BUG A;  3CD6 A;  1K8A C;  1Q82 R;  2JS2 A;  2JZ2 A;  4WF2 A;  2DIL A;  3ER0 A;  4ZTZ B;  1NYG A;  3H0I A;  2ZTG A;  5GAN 3;  2XIC A;  2MF2 A;  1VQ5 T;  1S1N A;  3CCS A;  2ZR2 A;  3V7S A;  2EJF A;  1PM3 A;  3I35 A;  2DVJ A;  1YHQ Q;  1LCK A;  1WHK A;  2GQV A;  1ACM B;  2LNV A;  4PJO F;  1KQS P;  3MF2 A;  2WSF E;  1KHC A;  4E6R A;  4PNO A;  1BCM A;  1NZ9 A;  1X01 A;  3PTA A;  1K0X A;  2HBP A;  2E3H A;  2Q7G A;  2YRD A;  4JPB W;  2FRY A;  3C4S A;  2D0N A;  2Q7E A;  3UA6 A;  1PKS A;  1BIB A;  3CXC P;  1OPK A;  1OEB A;  5GAN 5;  2DX1 A;  2DXC A;  4Q15 A;  3G71 A;  3QO5 A;  1Z9Z A;  3VRZ A;  1BI2 A;  1AHJ B;  3CCL A;  4M78 A;  2IPO B;  1J3T A;  2LQK A;  1ASZ A;  4XAX B;  1WQ7 A;  2KQW A;  3IKL A;  5E3I A;  1T0J A;  4J9F A;  2I4M A;  3CMA Q;  1T3L A;  3HRU A;  3FJ5 A;  2KRN A;  2ZNJ A;  1E1T A;  4JJN K;  2HD0 A;  1S72 T;  2QHV A;  2ABL A;  3OYH A;  3QO7 A;  1RAG B;  2ENM A;  1MND A;  2MCN A;  3RR6 A;  3CCU Q;  1VQO T;  1YJ9 A;  3PE0 A;  2YUN A;  1VQK Q;  2CSI A;  1ZA1 B;  4J6W A;  1WLE A;  3UT1 A;  5GJW B;  2F2X A;  1YIJ A;  3OS5 A;  1WHL A;  1X56 A;  1WIE A;  1D09 B;  3G6E Q;  2DZ9 A;  4PFP A;  3UFG A;  2M51 A;  5C51 B;  3VYG A;  3A98 A;  2KK4 A;  4RCC A;  2LP5 A;  2D9T A;  4XU3 A;  3UDC A;  2ZT5 A;  1YBY A;  2E65 A;  1YCS B;  2MYS A;  4X9C A;  1K9M U;  1B7Y B;  2CUD A;  5KYX A;  1M4Z A;  1YFR A;  3JCM d;  3ERR A;  3JB9 D;  2ALY B;  1PRL C;  4E47 A;  5KCO A;  3TSZ A;  1UJ0 A;  4H2X A;  3JAM E;  4QQ6 A;  1UHC A;  1PKT A;  3QJY A;  2HL3 A;  3E2U A;  5IAY A;  5I22 A;  2ZT7 A;  3UGT A;  2RM4 A;  3NET A;  3EG0 A;  4BE2 A;  3X26 B;  3WVE B;  4EMH A;  3OYD A;  3C95 A;  3HKS A;  4LVL A;  3LW5 E;  2XGT A;  3JCM h;  3MPU B;  5IN1 A;  3E9H A;  1WFW A;  3TVT A;  3X20 B;  4J5Y A;  5GAM g;  2NUP B;  2P0K A;  2QAZ A;  5GAM e;  3A5Y A;  4XEM A;  1M90 U;  1ADJ A;  2RI2 A;  2NS6 A;  2VAS A;  3KXT A;  1MV0 B;  3PIO A;  4RQF A;  2QEX A;  2RHQ B;  4LDV A;  1GCP A;  1MNE A;  3HFV A;  4G85 A;  2E5A A;  5ELN A;  2QQ9 A;  1K73 R;  2RF0 A;  3ZFJ A;  4C5H A;  1NJ6 A;  4MZP A;  2RHS B;  2YRC A;  5GAO p;  3NHN A;  4XK8 E;  3HXZ A;  1GL5 A;  3PIP A;  1PNJ A;  1ZHI A;  3CCJ T;  5CQX A;  3OW2 S;  2I4O A;  2AT1 B;  4JUV A;  3MF1 A;  3L2Q A;  1Q82 C;  3MJX A;  1RIQ A;  4MDW A;  4P73 C;  3SD4 A;  3JV3 A;  3LYI A;  2L5Q A;  5GMK h;  4E7K A;  4C8Q A;  3KFU A;  5GAN 4;  1OYX A;  1BI0 A;  5KYW A;  4M7A C;  1VQM T;  1VQ9 A;  2DJZ A;  1G3T A;  2R5A A;  3CCR A;  4FYX B;  3URG A;  2CSQ A;  3U23 A;  1UGQ B;  5FRM A;  5GAN 7;  1BCO A;  2DJQ A;  3HHT B;  2DM1 A;  4E2F B;  2NYS A;  5GAM j;  2OTJ A;  2DQ0 A;  3CME A;  3M58 A;  2JOY A;  1JO8 A;  2IG0 A;  3SHW A;  4PJO B;  3CCV T;  2CZ1 B;  2D0Q B;  3BDL A;  1WJR A;  3V7R A;  4RMF A;  1ABO A;  4ZTF A;  2M1H A;  3NMZ C;  3OB9 A;  5DM7 R;  4D8D A;  2W10 A;  3DLM A;  4RTW A;  1JJ2 A;  1X2H A;  3I9Q A;  1LYL A;  2EQU A;  4H2Y A;  2RQR A;  2K3B A;  2HDA A;  1V1C A;  1LJO A;  1VQ5 A;  1N9R A;  3CCQ T;  1YJN A;  3OYN A;  2LNH B;  3ZBD A;  2O88 A;  3M4G A;  3CC7 A;  2DL4 A;  5GAN 8;  1G3W A;  2K3Y A;  3QXE B;  3SB2 A;  4H2V A;  4LNP A;  4AG2 C;  2X4W A;  1IRX A;  3EHR A;  2PQW A;  4MML A;  1VQZ A;  1R8O B;  1Q7Y U;  2DRM A;  2KXD A;  3OS0 A;  1N9S A;  1VQ4 T;  5FWC A;  3HXY A;  2IY5 A;  1K0S A;  2FZK B;  4XU0 A;  2FG0 A;  2VGM A;  4J9B A;  2ZR3 A;  4FM4 B;  2Q5H A;  4Z02 A;  3HSB A;  1EIY B;  2RHX A;  2QTX A;  4WI1 A;  4KGZ B;  2QHU A;  2J3L A;  1BBU A;  5D6Y A;  2A36 A;  1R77 A;  4TVW A;  2H3J A;  2KMT A;  4II1 A;  3THK A;  5CKD A;  2CJA A;  1ZQ1 A;  1VQO A;  1C6V X;  1YI2 T;  2DU5 A;  4LD9 K;  3RL6 A;  4C0D B;  1N6A A;  4M78 C;  1QVG S;  3VUB A;  3BE3 A;  4NS5 A;  3OSS C;  4L6V 5;  2KAF A;  2HKN A;  2LMJ A;  1RAE B;  2JNG A;  4YRG A;  3VQY A;  1WQW A;  2CYZ B;  4J9G A;  1JQQ A;  1VQL Q;  3H41 A;  2XTI A;  2YUO A;  4BI4 A;  5LL6 S;  1X6O A;  1E24 A;  1ZA2 B;  2HZY A;  2M9U A;  2RK1 A;  1NJ1 A;  4RDX A;  3HFZ B;  4FT4 A;  4OB2 B;  4YRO A;  3QNE A;  3H0H A;  3SEM A;  4CS3 A;  1G2B A;  2GBQ A;  2RJF A;  2CP2 A;  2RO0 A;  3RKX A;  2EKH A;  2BE7 D;  3EG2 A;  4C5G A;  2CP6 A;  2YDL A;  4K11 A;  3LWH A;  4JZ3 A;  1K73 C;  3EG9 B;  3S3M A;  1NM7 A;  3OW2 A;  5KH6 A;  2LTO A;  3E9G A;  2PVG B;  1IXD A;  3VU3 C;  1TUG B;  4IUP A;  1GGM A;  4FCY A;  2ECZ A;  1NBE B;  2DO3 A;  4BDZ A;  1KMM A;  4M77 G;  3M0R A;  3A8G B;  4V2S A;  4Z88 A;  2EJ9 A;  5CKE A;  4PL6 A;  4PHC A;  4HCK A;  4C5E A;  5KYY A;  3HXV A;  4L5G A;  2E3I A;  1G51 A;  1YIT Q;  1QE0 A;  2P0P A;  2I4N A;  1SF9 A;  2ZAE A;  3M4Q A;  2RN8 A;  3GPL A;  4M77 E;  5CKH A;  2CP5 A;  3CQT A;  4UP9 A;  4HKE A;  1AWJ A;  5IXB A;  4PK4 A;  2ED1 A;  4LE9 A;  1E1O A;  3V8J A;  3G7Z A;  3CCJ A;  2L3R A;  1FYF A;  5GAO n;  4ZGE B;  1RLQ C;  3L2R A;  4F17 A;  4F7U G;  3AHU A;  3BW1 A;  3VS5 A;  4EPC A;  1IO6 A;  1RAC B;  2DXB A;  3P8T A;  1OU8 A;  3DB3 A;  1A0N B;  4IIO A;  3M56 A;  4M75 G;  1VQM A;  4Q6G A;  3JCM f;  1MMA A;  1KD1 R;  3M0T A;  3MEU A;  2ZT8 A;  2KRM A;  1UFF A;  1QLY A;  2V26 A;  2EKO A;  1Q81 R;  3RIR A;  4C92 G;  4F7U E;  4BE1 A;  4M77 F;  1KG1 A;  4C0F A;  3CC2 A;  3L4G B;  4EMK B;  1YJ9 T;  1ASY A;  2Y4Y A;  3QHS A;  4BAC A;  1CKA A;  2X4X A;  1QP2 A;  3CD6 Q;  2DZC A;  1K8A U;  2A08 A;  4M75 E;  4BD3 A;  4CH5 A;  1YIJ T;  1MMG A;  4C8Q C;  2X35 A;  3X25 B;  2XG8 D;  4A54 A;  4C92 E;  5M9O A;  1L0W A;  3HFO A;  1AZG B;  2PUO B;  2RB6 A;  1NJI U;  1BKB A;  1MMD A;  1WXT A;  2VC8 A;  3NTH A;  4HVU A;  4A4G A;  2A8E A;  5GAO l;  1XTD A;  2ZCE A;  4KH1 B;  3CCQ A;  4K86 A;  3OYB A;  2ED0 A;  2X4J A;  3G1J A;  2F2V A;  5EC7 A;  2CP3 A;  4F7U F;  1FYN A;  2OTL Q;  3OYL A;  4ZTJ A;  4C0G A;  3VKI A;  1U1T A;  1RLP C;  3G71 Q;  1HXD A;  5CKB A;  2K57 A;  4GLK A;  4M7A E;  3CCL Q;  4M75 F;  4JJB A;  3HRS A;  1FMV A;  1KHI A;  3HTR A;  4H2S A;  1ZSG A;  2JUF A;  4C92 F;  2YUQ A;  4ZNX A;  2ZIN A;  4CC3 A;  2VB6 A;  1X27 A;  2D8H A;  5CAI A;  1BIA A;  2DL8 A;  2GF7 A;  3EFO B;  5FU7 C;  5FLX E;  3FRN A;  3M0P A;  1NLO C;  2KT1 A;  1FWZ A;  1NE8 A;  5GAO r;  3F70 A;  5GAN 2;  1KMN A;  4KT0 E;  4GLM A;  3OYJ A;  2YSQ A;  4D6W A;  2RK2 A;  2NUZ A;  2J6K A;  2PUK B;  1FX7 A;  3RUX A;  1YI2 A;  2VGN A;  5KYN A;  4FU6 A;  2C0I A;  1YJW T;  2L0A A;  3SDZ A;  2QAS A;  2YLB A;  3EG3 A;  4M7A F;  1H3Z A;  1B7Y A;  3R6O A;  3GF5 A;  1QMC A;  1VQP A;  2E12 A;  2V8K A;  4OGC A;  3VUZ A;  1VQN Q;  3OYK A;  2A37 A;  5EG2 A;  2ALY A;  2RMO A;  2BE9 B;  4D8K A;  1M1G A;  2RA2 A;  3ME9 A;  1QWE A;  2O9V A;  4BB7 A;  2P5I A;  3JCM J;  2ZPI B;  2HNI A;  4YRC A;  4HCC A;  1UGV A;  3JB9 I;  2RNA A;  3RBB B;  1KQ2 A;  3LGF A;  4NOY A;  2GNC A;  1PSF A;  2AKW B;  1QVF A;  2J05 A;  1USY A;  5LJ5 d;  4TVA A;  1ARK A;  2I0N A;  1ZUY A;  2K2M A;  2XDP A;  5D7U A;  1RI9 A;  3MQZ A;  2E70 A;  1VA7 A;  4HCZ A;  4MZT A;  3HXU A;  3VS1 A;  1QCF A;  3A74 A;  2G4C A;  3MKD A;  2OTJ T;  1RI0 A;  3QYH B;  3CME T;  4LVK A;  1HK9 A;  3VQW A;  4CRI A;  4J9D A;  2JMC A;  3E1S A;  3MO8 A;  2MWO A;  3OW2 P;  2ODR C;  4AMC A;  5LJ5 h;  4J9E A;  3OYC A;  2XMF A;  1FMK A;  1IGQ A;  2E3C A;  1RAA B;  3TEH B;  2DAQ A;  1G3Y A;  2COW A;  5HK3 A;  1M3B A;  1KD1 C;  1YFN A;  2WAC A;  1YJN T;  5GJV B;  1Q81 C;  2K3X A;  2L89 A;  1WGS A;  1EVK A;  3EGX A;  1UGS B;  3CC7 T;  2RPN A;  4CH3 A;  2CDT A;  1T3S A;  2JW4 A;  2GQI A;  3P8Y A;  5FWB A;  4BI8 B;  4Z89 A;  3S3N A;  2CP0 A;  1IL2 A;  3VS7 A;  1OU9 A;  5IHN A;  4LDY A;  1YNZ A;  2QA4 A;  1K9A A;  1GFD A;  1D3B B;  4TQD A;  4A4E A;  4M77 B;  3A7R A;  2EAY A;  2EIF A;  2MWP A;  1UUE A;  2DL7 A;  2SEM A;  3EHQ A;  3I5R A;  4OB3 B;  4ZIB A;  2EYQ A;  3FIF A;  4RUG A;  1TG0 A;  4KR2 A;  4KBM B;  1X55 A;  2QTV A;  4DOW A;  3TEG A;  3EGD A;  3EG1 A;  1B76 A;  1JJ2 S;  1W4S A;  3RAC A;  4UP8 A;  2RHY A;  2O4X B;  2QDY B;  1IHW A;  1I1J A;  5GAN d;  2QI2 A;  4OF1 A;  2E10 A;  1JEG A;  1B34 B;  4YRK A;  4P3P A;  3JCM P;  2I4L A;  2DTO A;  3LSQ A;  1BI1 A;  1VQ7 A;  2ARU A;  3REU A;  1VQ6 Q;  5DLO A;  2DNU A;  4E7S A;  1M27 C;  2DTI A;  3CCM A;  4N4H A;  4M77 D;  3QPH A;  2KE9 A;  3OY9 A;  2HBW A;  1NJ8 A;  4F7U B;  2EGA A;  3CCE Q;  2G3R A;  1KC8 U;  2L8D A;  4TVY A;  1M1K U;  2HQE A;  1EVL A;  1AD5 A;  4XTX A;  4F04 B;  4CI0 C;  3E19 A;  4M75 B;  1UTI A;  4OVA A;  3RDV A;  2LRQ A;  5GAN h;  1VOM A;  2Y4X A;  1MGQ A;  4J9C A;  1K9M R;  4C92 B;  1B07 A;  4QW2 A;  2O31 A;  1NYQ A;  2KBT A;  1EIF A;  4IUR A;  4FYW B;  3I56 A;  1E6H A;  1EIY A;  5CQY A;  3MET A;  2FPF A;  1YFT A;  4DEY A;  2KT8 A;  4IIM A;  1YB3 A;  2MOX A;  3VV0 A;  5CCA A;  2CKK A;  2EYW A;  5GMK i;  4XU2 A;  1QVG P;  3EH2 A;  2F5K A;  1WHH A;  3SFM A;  1P92 A;  2RI3 A;  5LJ3 d;  4JS5 A;  1QVP A;  2WSE E;  4YRQ A;  4F14 A;  4M7D G;  4M75 D;  4BE0 A;  3V8L A;  3EAE A;  4M7A B;  1I81 A;  4DPG A;  3JB9 H;  1S72 Q;  1PCX A;  1O9S A;  2ZIM A;  3GNG A;  3GOX A;  1UGR B;  3J80 E;  4C92 D;  3V8K A;  3HXW A;  1H8K A;  4WCI A;  2EW3 A;  3LH0 A;  1HJD A;  2D6F A;  4J6X A;  2YHT A;  3CBP A;  4Y92 A;  4FIB A;  4JRQ A;  4M7D E;  3G1Z A;  1M90 R;  3IG2 A;  4BW9 A;  1BB9 A;  3M54 A;  2LCL A;  3RKY A;  1RAD B;  1YJW A;  4JJD A;  5LJ3 h;  4R55 A;  2QG9 B;  4X1V A;  2D8J A;  2IVW A;  3VJP A;  4F16 A;  3TCJ A;  4DBH A;  3HFZ A;  2ZGW A;  5GAO m;  2K4Y A;  2PZ1 A;  4C0Z A;  1G5I A;  1X54 A;  2H3E B;  4DBF A;  4KUI A;  4VUB A;  1SRM A;  4LVI A;  3OS1 A;  1M1F A;  1I5L A;  3G4S T;  4YDQ A;  4YYE A;  3IKM B;  4PFO A;  3EG9 A;  1Y96 A;  3FDR A;  2JTF A;  2DPP B;  4IUV A;  4M7D F;  4XU1 A;  4YRP A;  4NCX A;  1K73 U;  3UPU A;  4ORZ A;  2DF6 A;  1YHQ A;  3CPW S;  1RUW A;  2COZ A;  2QGG A;  2NWM A;  2K5I A;  5A0D A;  1SPK A;  4AFQ C;  1QVF P;  5IH2 A;  1UEC A;  3D7S B;  3QSU A;  2DK3 A;  2C8M A;  1PRM C;  4AH6 A;  4ELY C;  3CC2 T;  5IHI A;  2ZPE B;  3LWI A;  4JRP A;  4EDU A;  1NLP C;  2AZS A;  2DE0 X;  2FRW A;  1H92 A;  1EZZ B;  1USY C;  1AWX A;  2Y90 A;  1CKB A;  4KUL A;  5CKF A;  4QVZ A;  2E41 A;  1HD3 A;  1I8F A;  2XHC A;  1BBZ A;  2PU9 B;  2ZZF A;  4E51 A;  4YRL A;  1G5V A;  4X34 A;  4IUT A;  3CMA A;  2KNB B;  1NJ5 A;  1Q86 U;  5C53 B;  1IRE B;  1ZLM A;  4FL6 A;  1QF6 A;  3X28 B;  3ULR B;  1AVZ C;  2X3X D;  2VUB A;  1VQ8 T;  4HVC A;  4YRN A;  1H4S A;  3CCU A;  5L8R E;  4C5I A;  1B8A A;  3NEL A;  3CMQ A;  1VQK A;  2FL7 A;  4JJC A;  3CC4 T;  5D6W A;  4E7H A;  4PJO D;  1Q7Y R;  3R07 A;  4YRM A;  2MMP A;  2AKK A;  2LT4 A;  3G6E A;  4OMP A;  5GAN g;  2ZZD A;  1BBW A;  2KVQ G;  1VQM Q;  4J7I A;  3JCM Q;  4EMK A;  4JDS A;  1MUZ A;  1UJY A;  2A7Y A;  3UWN A;  4LUD A;  2FB7 A;  1K9M C;  2K6D A;  4UPA A;  2A3L A;  1KIK A;  1U8R A;  4P5N A;  5LJ5 f;  4PJJ A;  4QVC A;  4B9X A;  3PMI A;  2KR3 A;  2EVR A;  2L2P A;  2EJG A;  3CCV Q;  4X5O A;  3QDF A;  4RTU A;  3RNJ A;  5GAO q;  2EQJ A;  3CBM A;  4HWR A;  4KR3 A;  2K2V A;  3HXX A;  4AT1 B;  3P8D A;  3ASK A;  5FU6 B;  1WNL A;  2E5Q A;  3PCO B;  1VQP T;  3JCM g;  1NYR A;  4J83 A;  3KUF A;  2RHU A;  4ELZ C;  2XU8 A;  3JCM e;  4HT4 A;  4Y28 E;  3QG1 A;  4OB0 B;  2BTT A;  2C0O A;  2V1R A;  2MI6 A;  4Q5W A;  3FC3 A;  1N8R U;  1YN8 A;  2D1X A;  4GBQ A;  2NUT A;  2DXU A;  1SSF A;  2F2W A;  1ZSZ B;  4B6M A;  4LXC A;  1M90 C;  4FSX A;  4RG2 A;  4CS2 A;  2EYZ A;  2IIM A;  3S6W A;  1VQ4 Q;  1Y71 A;  3M55 A;  3M4P A;  2KY9 A;  4E7Z A;  4PJM A;  2ZCF B;  3EFO A;  4E7J A;  2LJ0 A;  1KK7 A;  2H8H A;  3HFN A;  1TH7 A;  1M2V B;  2FEI A;  2YLC A;  3M57 A;  3EFS A;  1OZ2 A;  3FJP A;  2QK0 A;  5KE3 A;  3HL8 A;  3A5Z B;  5GMK e;  2CZ6 B;  2FYK A;  3VS4 A;  4AFU C;  5A0G A;  3J81 E;  1HSQ A;  2XD0 A;  2RJE A;  4JRI A;  5CO7 A;  1YCY A;  4HVW A;  1YI2 Q;  2F1L A;  4O2D A;  4P72 A;  3SWN B;  3CPF A;  4CH6 A;  4BY6 C;  5C6S A;  3CPW A;  2QXF A;  5GAN f;  3M9Q A;  2CP7 A;  3L2W A;  1QVF S;  4ME7 A;  1EFN A;  3T9N A;  1QKW A;  4KQE A;  3J7A F;  4M7D B;  4C0D C;  3OSV A;  3S3O A;  3M5A A;  4CC4 B;  2P0L A;  5AT1 B;  4DBQ A;  5KCH A;  2AKW A;  3C0C A;  3HRT A;  4R0K A;  1N9W A;  2QA4 T;  1LOJ A;  1KQS A;  3G4S A;  1FMW A;  2DD4 A;  4MMK A;  4YRT A;  4RTV A;  2J3M A;  4L87 A;  3VS2 A;  1B70 B;  2KI7 A;  4H2U A;  1ZBX A;  5GMK j;  2K79 A;  3UGQ A;  1M30 A;  1H4V B;  4DEX A;  2XI9 A;  4QT7 A;  5AYF A;  3QO3 A;  5IXF A;  5HKC A;  1G8X A;  1D0Z A;  4M7D D;  1PHT A;  1SRY A;  2RQT A;  5HK0 A;  1NYF A;  2E1H A;  4YRI A;  3TEH A;  1SER A;  1Q7Y C;  1VQ7 T;  4GY5 A;  5CIU A;  1Z7N A;  2XDD A;  1Z9Q A;  5LJ3 f;  3CCM T;  4YRR A;  3H8Z A;  4FYY B;  1W6X A;  1E6G A;  3VQX A;  3OYG A;  1KD1 U;  3A31 A;  2CZ7 B;  1VYT A;  2IY5 B;  1V29 B;  2BZ8 A;  3R6N A;  4HWT A;  1I5O B;  3CCS Q;  1NJI R;  12AS A;  2QHS A;  3M4Y A;  2JM8 A;  4H2T A;  2DDZ A;  1HTT A;  2KGT A;  1F1B B;  2JN0 A;  1Y0M A;  4M7A G;  2O01 E;  2DBM A;  3WXM B;  4M77 A;  4BWA A;  1JJ2 P;  2MIO A;  4OMQ A;  1K4U S;  2V1Q A;  1VQ8 A;  3QWX X;  1M3C A;  4ZN1 A;  2DTH A;  3I56 T;  2AHJ B;  3CC4 A;  2XDB A;  4RTY A;  1H3H A;  3REB B;  1WJS A;  5F5W A;  3QUI A;  1WPY A;  4OP0 A;  4EIK A;  2LCC A;  2LC4 A;  4ZGJ B;  3JB9 F;  4RTT A;  3BDU A;  1VQL A;  2KEA A;  1ZUU A;  1JXO A;  1C0A A;  3P8H A;  5I21 A;  3LSS A;  2E6N A;  3EGU A;  3OMG A;  2AIR B;  4F7U A;  1YJ9 Q;  3W3S A;  4H2W A;  1KQ1 A;  2BZX A;  3WVD B;  2DYB A;  3MEV A;  1H64 1;  7AT1 B; 
#chains in the Genus database with same CATH homology
 3I55 T;  4M75 A;  2LQ8 A;  4IUU A;  3MEW A;  3JCM b;  4EMK C;  2EWN A;  1Y7X A;  2LX9 A;  1Y07 A;  4O6J A;  4EMG A;  4RKU E;  1NNH A;  4YCV A;  3HPW A;  4P3N A;  1UB4 A;  1PSE A;  4K87 A;  4UP7 A;  5A2Q E;  4L59 A;  1PYS B;  1W2B S;  4YRE A;  4J7F A;  3GIB A;  3A8M B;  2OAU A;  3DLL A;  1E22 A;  4YRF A;  1LNX A;  1YIT A;  5D6X A;  5GAM d;  1YHQ T;  4CS4 A;  4M78 G;  1H4Q A;  4XQ3 A;  3VYH B;  4LD6 A;  4UC4 A;  2F69 A;  3NTK A;  1Z7M A;  2K5F A;  3DKM A;  4WJ3 M;  2RHQ A;  4M78 E;  1GXI E;  1YFS A;  2RJD A;  4BDY A;  5GAM h;  4TVR A;  4XTY A;  2RHS A;  1MHN A;  3CMA T;  1JJC B;  4OB1 B;  2CS7 A;  2ZPB B;  4YRS A;  3IAL A;  4RMO A;  3OA6 A;  3CCU T;  1H4T A;  1VQ6 T;  3TU4 K;  3A8L B;  2DD5 A;  1VQK T;  5K1P A;  3O8V A;  3JB9 J;  1Q82 U;  2M0O A;  4P72 C;  3CCE T;  3LC0 A;  4ZTU B;  3E9I A;  3G6E T;  1J5W A;  2ZIO A;  3OYE A;  2VXF A;  4M78 F;  1NJI C;  3JRZ A;  1NPP A;  2ZZG A;  4OGE A;  3L2U A;  1M9S A;  4LDU A;  3OYA A;  3TEE A;  4YRJ A;  3PMT A;  4YTL A;  1QW1 A;  2B8A A;  4PJO A;  2RH2 A;  1JB0 E;  2DKG A;  2OTL A;  1UGP B;  4J8O A;  2K5L A;  3MHX A;  1U1S A;  1EQR A;  2QQR A;  4JRK A;  3A7A A;  2ZXF A;  3RMQ A;  3L2V A;  1M5Q 1;  4P74 A;  4TWA A;  3VQV A;  4RCB A;  3UH0 A;  4XEO A;  3HY1 A;  2FVU A;  4CH4 A;  4YPF A;  3QZ5 B;  4IUQ A;  3NEM A;  3JCM V;  3A32 A;  3RER A;  2RHZ A;  2EQM A;  1M8V A;  3KBG A;  2BUD A;  4MZM A;  3NFC A;  4HCB A;  3JCM c;  3NEN A;  4LVM A;  1VQN A;  2DXT A;  2VV5 A;  4C8Q G;  3BJU A;  2EQK A;  1O75 A;  4M77 C;  3PNW C;  3MP1 A;  4A4H A;  2DU7 A;  1W2B A;  2HAX A;  1VIF A;  1EFW A;  5FRO A;  4J6Y A;  4QQD A;  3PFS A;  2Q5I A;  2GFU A;  3PCO A;  4N4I A;  4C8Q E;  3OMC A;  4K88 A;  2VYT A;  2DIG A;  3M53 A;  3I55 A;  3QBY A;  5HY6 A;  3RF1 A;  4XTW A;  3OYF A;  2DIQ A;  1ATI A;  4TVA B;  2Q7H A;  3H6Z A;  5CK9 A;  3QO8 A;  3GNF B;  2RJC A;  3A8O B;  4ATO A;  1SES A;  2CZ0 B;  1IZ6 A;  1WJQ A;  3L42 A;  5LJ5 g;  2M16 A;  4M7A D;  2DEQ A;  4TTV A;  5LJ5 e;  5GMK l;  4QVD A;  5KNN A;  3WQZ A;  4NL3 A;  4M75 C;  1G3S A;  2DQ3 A;  2I2L A;  3P8B B;  4C8Q F;  2P0Q A;  2AMC B;  4C92 C;  3HY0 A;  4PG3 A;  2DVE A;  2MAM A;  2R57 A;  2QQA A;  3BFM A;  3JCM W;  3A5Z A;  4P3O A;  2ARS A;  4H02 A;  2E64 A;  3HTZ A;  3RMS A;  11AS A;  1G5H A;  3SWN A;  3ICA A;  1ADY A;  2QHT A;  3I7F A;  2CIM A;  3OYY A;  3E9F A;  2RHI A;  5HGQ A;  5DLQ E;  2CGH A;  2F5T X;  3LGL A;  3MP6 A;  4O5V A;  4M7D A;  1KQS S;  4A53 A;  3QKJ A;  3L2Z A;  5LJ5 j;  4JLG A;  5C52 B;  4M78 B;  3LX7 A;  2LT1 A;  2EL9 A;  3TUP A;  2FHD A;  1VIE A;  2QQB A;  3CXC S;  1VQ6 A;  3EFR A;  4QQG A;  2PME A;  1B70 A;  3CCE A;  1KC8 C;  1M1K C;  4JLI A;  4Y91 A;  5GAN e;  3PT9 A;  3QII A;  1VQL T;  3L4G A;  2ZT6 A;  4M78 D;  2E6Z A;  5DY9 A;  5C0M A;  3INZ A;  5GAM f;  3OBY A;  3HP9 A;  5KE2 A;  1WU7 A;  4P71 A;  4EX5 A;  3C12 A;  2RI5 A;  4E7L A;  4A4K A;  4H2X B;  3PGG A;  1KOG A;  5J39 A;  4PJO C;  4BY6 B;  1N27 A;  2V8J A;  1XQH A;  1S72 A;  4ZN3 A;  5K1X A;  5GAN j;  3OYI A;  3PZC A;  5LJ3 g;  2ZPH B;  4N0A A;  4OLF A;  4IKF A;  3TRE A;  1XOV A;  4EO4 A;  2X4Y A;  5LJ3 e;  4P75 A;  3FLG A;  4TQF A;  4BI3 A;  1YIT T;  3MCA B;  2ZPF B;  4P74 C;  5GAN 6;  2JTM A;  2YRV A;  3QZ9 B;  4A4F A;  4PLL A;  3MEA A;  3CBO A;  2WSC E;  4KUD K;  4HWO A;  2ZNI A;  2CJ9 A;  1W66 A;  3MP8 A;  1I4K 1;  1QP3 A;  3N5B B;  2LVM A;  4JS4 A;  3CEY A;  2HQX A;  1Y96 B;  2R5M A;  3JSC A;  3V7C A;  4C8Q B;  1PYS A;  3OD1 A;  5LJ3 j;  4LNS A;  5FRN A;  2XK0 A;  5FU6 C;  3CD6 T;  2XKO C;  1X75 C;  3MEY A;  4LDX A;  3DSQ A;  3DB4 A;  1X2G A;  1EOV A;  2KSS A;  2ZPG B;  4WJ4 A;  5I2M A;  3CCS T;  3HRK A;  1Q86 C;  1JRI A;  3JCM X;  4YCU A;  4NL2 A;  4C8Q D;  3OQ5 A;  4HWS A;  3CXC A;  3JB9 G;  3OBW A;  3OYM A;  2OTL T;  5IT9 E;  2JVV A;  3G71 T;  3CCL T;  1JJC A;  2QQS A;  5FU7 B;  1SET A;  4HWP A;  3ZEH A;  1BI3 A;  4PLI A;  5I2S A;  4HT9 A;  4RG8 A;  1HC7 A;  4YP0 A;  2BIV A;  1RL2 A;  2GFA A;  1Q81 U;  3RGL A;  2VXE A;  3QTC A;  3SWN C;  1D3B A;  3Q1J A;  3CCV A;  1VUB A;  4XTV A;  4HT8 A;  3X24 B;  2PVD B;  2EFI A;  3NTI A;  5GMK m;  3QYG B;  1UEB A;  4M7D C;  5CR2 A;  4J15 A;  3QDR B;  1YGB A;  4XTU A;  3LLR A;  3GLX A;  2O4X A;  1VQN T;  2KDS A;  4FT2 A;  1B34 A;  3RES A;  1N8R C;  4R56 A;  3C94 A;  2GCX A;  3QJ6 A;  3REX A;  1QVG A;  2LDM A;  1OI1 A;  1VQ4 A;  3P8V A;  4N4G A;  4DA4 A;  4RQE A;  2XID A;  3BY7 A;  5CVI A;  3GP8 A;  2V8I A;  3A7U A;  1NPR A;  5A0L A;  2PMF A;  1OZ3 A;  4C92 A;  2ART A;  1XNI A;  4E7I A;  2C7I A;  1WYD A;  4LVJ A;  4DOV A;  3L1A A;  3A8H B;  2NLU A;  4HA8 A;  5ELO A;  2ZZE A;  4P71 C;  1BYM A;  4YCW A;  4P73 A;  4ZGD B;  4B9W A;  2QEX T;  2C06 A;  4OMF B;  4M7A A;  4MDX A;  4G84 A;  4LDW A;  2ODR D;  4PKC C;  3M59 A;  5J3B A;  5J26 A;  3HRI A;  4PJO G;  4DQ2 A;  2R58 A;  2CJB A;  4N0A C;  3FEO A;  4P75 C;  3RKW A;  4X9D A;  1VQ9 T;  1FXX A;  2PVO B;  4XTZ A;  3CCR T;  1NJ2 A;  3VBB A;  4PJO E;  1JBM A;  2P4T A;  3FB9 A;  2RD1 A;  2BKD N;  3OS2 A;  1DJ7 B;  2AMC A;  4BUG A;  3CD6 A;  1K8A C;  2JZ2 A;  4WF2 A;  3ER0 A;  4ZTZ B;  2ZTG A;  5GAN 3;  2XIC A;  2MF2 A;  1VQ5 T;  3CCS A;  2ZR2 A;  3V7S A;  2EJF A;  2GQV A;  2LNV A;  4PJO F;  3MF2 A;  2WSF E;  1KHC A;  4PNO A;  1NZ9 A;  1X01 A;  3PTA A;  2HBP A;  2Q7G A;  3C4S A;  2Q7E A;  1BIB A;  5GAN 5;  2DXC A;  4Q15 A;  3G71 A;  3QO5 A;  1BI2 A;  1AHJ B;  3CCL A;  4M78 A;  2LQK A;  1ASZ A;  4XAX B;  1WQ7 A;  2KQW A;  3IKL A;  5E3I A;  2I4M A;  3HRU A;  2ZNJ A;  1E1T A;  4JJN K;  2HD0 A;  1S72 T;  2QHV A;  3OYH A;  3QO7 A;  1VQO T;  1YJ9 A;  4J6W A;  1WLE A;  3UT1 A;  1YIJ A;  3OS5 A;  1X56 A;  2DZ9 A;  3UFG A;  5C51 B;  3VYG A;  2KK4 A;  4RCC A;  2D9T A;  4XU3 A;  3UDC A;  2ZT5 A;  1YBY A;  2E65 A;  4X9C A;  1K9M U;  1B7Y B;  1M4Z A;  1YFR A;  3JCM d;  3ERR A;  3JB9 D;  2ALY B;  4E47 A;  5KCO A;  4H2X A;  3JAM E;  4QQ6 A;  3QJY A;  5IAY A;  2ZT7 A;  3UGT A;  2RM4 A;  3NET A;  4BE2 A;  3X26 B;  3WVE B;  4EMH A;  3OYD A;  3C95 A;  3HKS A;  4LVL A;  3LW5 E;  2XGT A;  3JCM h;  5IN1 A;  3E9H A;  3X20 B;  4J5Y A;  5GAM g;  2P0K A;  3A5Y A;  5GAM e;  4XEM A;  1M90 U;  1ADJ A;  2RI2 A;  2NS6 A;  3KXT A;  3PIO A;  4RQF A;  2QEX A;  2RHQ B;  4LDV A;  3HFV A;  4G85 A;  2E5A A;  5ELN A;  2QQ9 A;  3ZFJ A;  4C5H A;  1NJ6 A;  4MZP A;  2RHS B;  5GAO p;  4XK8 E;  3HXZ A;  3PIP A;  1ZHI A;  3CCJ T;  5CQX A;  3OW2 S;  2I4O A;  4JUV A;  3MF1 A;  3L2Q A;  1Q82 C;  1RIQ A;  4MDW A;  4P73 C;  3SD4 A;  3LYI A;  2L5Q A;  5GMK h;  4E7K A;  4C8Q A;  3KFU A;  5GAN 4;  1OYX A;  1BI0 A;  4M7A C;  1VQM T;  1VQ9 A;  2DJZ A;  1G3T A;  2R5A A;  3CCR A;  3URG A;  5FRM A;  1UGQ B;  5GAN 7;  3HHT B;  5GAM j;  2OTJ A;  2DQ0 A;  3CME A;  3M58 A;  2JOY A;  2IG0 A;  4PJO B;  3CCV T;  2CZ1 B;  2D0Q B;  3BDL A;  1WJR A;  3V7R A;  4RMF A;  4ZTF A;  2M1H A;  3OB9 A;  5DM7 R;  3DLM A;  1JJ2 A;  1X2H A;  1LYL A;  2EQU A;  4H2Y A;  1LJO A;  1VQ5 A;  1N9R A;  3CCQ T;  1YJN A;  3OYN A;  3ZBD A;  3M4G A;  3CC7 A;  5GAN 8;  1G3W A;  2K3Y A;  3QXE B;  3SB2 A;  4H2V A;  2X4W A;  2PQW A;  4MML A;  1VQZ A;  1R8O B;  1Q7Y U;  3OS0 A;  1N9S A;  1VQ4 T;  3HXY A;  2IY5 A;  4XU0 A;  2VGM A;  2ZR3 A;  4FM4 B;  2Q5H A;  4Z02 A;  3HSB A;  1EIY B;  2RHX A;  2QTX A;  4WI1 A;  2QHU A;  2J3L A;  1BBU A;  5D6Y A;  4TVW A;  2H3J A;  2KMT A;  4II1 A;  5CKD A;  2CJA A;  1ZQ1 A;  1VQO A;  1YI2 T;  2DU5 A;  4LD9 K;  3RL6 A;  4C0D B;  1N6A A;  4M78 C;  1QVG S;  3VUB A;  4NS5 A;  3OSS C;  4L6V 5;  2KAF A;  2JNG A;  4YRG A;  3VQY A;  2CYZ B;  1WQW A;  2XTI A;  4BI4 A;  5LL6 S;  1X6O A;  1E24 A;  2M9U A;  2RK1 A;  1NJ1 A;  4RDX A;  3HFZ B;  4FT4 A;  4OB2 B;  4YRO A;  3QNE A;  4CS3 A;  2RJF A;  2RO0 A;  3RKX A;  4C5G A;  3LWH A;  1K73 C;  3S3M A;  3OW2 A;  5KH6 A;  2LTO A;  3E9G A;  2PVG B;  3VU3 C;  4IUP A;  1GGM A;  2DO3 A;  4BDZ A;  1KMM A;  4M77 G;  3A8G B;  4V2S A;  2EJ9 A;  5CKE A;  4PL6 A;  4PHC A;  4C5E A;  3HXV A;  4L5G A;  1G51 A;  1QE0 A;  2P0P A;  2I4N A;  3M4Q A;  3GPL A;  4M77 E;  5CKH A;  4UP9 A;  4HKE A;  1E1O A;  3V8J A;  3G7Z A;  3CCJ A;  2L3R A;  1FYF A;  5GAO n;  4ZGE B;  3L2R A;  4F7U G;  3AHU A;  3BW1 A;  4EPC A;  2DXB A;  3P8T A;  3DB3 A;  3M56 A;  4M75 G;  1VQM A;  4Q6G A;  3JCM f;  3MEU A;  2ZT8 A;  2EKO A;  3RIR A;  4C92 G;  4F7U E;  4BE1 A;  4M77 F;  1KG1 A;  4C0F A;  3CC2 A;  3L4G B;  4EMK B;  1YJ9 T;  1ASY A;  2Y4Y A;  3QHS A;  4BAC A;  2X4X A;  1QP2 A;  2DZC A;  1K8A U;  4M75 E;  4BD3 A;  4CH5 A;  1YIJ T;  4C8Q C;  2X35 A;  3X25 B;  2XG8 D;  4A54 A;  4C92 E;  5M9O A;  1L0W A;  3HFO A;  2PUO B;  2RB6 A;  1NJI U;  1BKB A;  2VC8 A;  3NTH A;  4A4G A;  2A8E A;  5GAO l;  1XTD A;  2ZCE A;  3CCQ A;  4K86 A;  3OYB A;  2X4J A;  4F7U F;  3OYL A;  4ZTJ A;  4C0G A;  3VKI A;  1U1T A;  1HXD A;  5CKB A;  2K57 A;  4GLK A;  4M7A E;  4M75 F;  3HRS A;  1KHI A;  4H2S A;  2JUF A;  4C92 F;  2ZIN A;  5CAI A;  1BIA A;  2GF7 A;  5FLX E;  5FU7 C;  3FRN A;  1FWZ A;  1NE8 A;  5GAO r;  3F70 A;  5GAN 2;  1KMN A;  4KT0 E;  3OYJ A;  4D6W A;  2RK2 A;  2PUK B;  1FX7 A;  3RUX A;  1YI2 A;  2VGN A;  4FU6 A;  1YJW T;  3SDZ A;  4M7A F;  2YLB A;  1H3Z A;  1B7Y A;  3R6O A;  3GF5 A;  1VQP A;  2E12 A;  2V8K A;  4OGC A;  3VUZ A;  3OYK A;  5EG2 A;  2ALY A;  1M1G A;  2RA2 A;  3ME9 A;  4BB7 A;  2P5I A;  3JCM J;  2ZPI B;  2HNI A;  4YRC A;  4HCC A;  3JB9 I;  1KQ2 A;  3LGF A;  4NOY A;  1PSF A;  2AKW B;  1QVF A;  1USY A;  5LJ5 d;  4TVA A;  2XDP A;  3MQZ A;  2E70 A;  4HCZ A;  4MZT A;  3HXU A;  3A74 A;  2G4C A;  2OTJ T;  1RI0 A;  3QYH B;  3CME T;  4LVK A;  1HK9 A;  3VQW A;  4CRI A;  3E1S A;  3MO8 A;  2MWO A;  2ODR C;  5LJ5 h;  3OYC A;  2E3C A;  3TEH B;  2DAQ A;  1G3Y A;  5HK3 A;  1KD1 C;  2WAC A;  1YJN T;  1Q81 C;  2K3X A;  2L89 A;  1WGS A;  1EVK A;  1UGS B;  3CC7 T;  4CH3 A;  3P8Y A;  3S3N A;  4BI8 B;  1IL2 A;  4LDY A;  2QA4 A;  1D3B B;  4TQD A;  4A4E A;  4M77 B;  3A7R A;  2EAY A;  2EIF A;  2MWP A;  4OB3 B;  4ZIB A;  2EYQ A;  3FIF A;  4KR2 A;  4KBM B;  1X55 A;  4DOW A;  3TEG A;  1B76 A;  3RAC A;  1JJ2 S;  1W4S A;  4UP8 A;  2RHY A;  2O4X B;  2QDY B;  5GAN d;  2QI2 A;  4OF1 A;  2E10 A;  1B34 B;  4YRK A;  4P3P A;  3JCM P;  2I4L A;  2DTO A;  3LSQ A;  1BI1 A;  1VQ7 A;  2ARU A;  3REU A;  5DLO A;  2DTI A;  3CCM A;  4N4H A;  4M77 D;  3QPH A;  3OY9 A;  1NJ8 A;  4F7U B;  2G3R A;  1KC8 U;  2L8D A;  4TVY A;  1M1K U;  2HQE A;  1EVL A;  4XTX A;  4CI0 C;  3E19 A;  4M75 B;  4OVA A;  2LRQ A;  5GAN h;  2Y4X A;  1MGQ A;  4C92 B;  4QW2 A;  1NYQ A;  1EIF A;  4IUR A;  3I56 A;  1EIY A;  5CQY A;  3MET A;  1YFT A;  1YB3 A;  3VV0 A;  5CCA A;  2CKK A;  5GMK i;  4XU2 A;  2F5K A;  3SFM A;  1P92 A;  2RI3 A;  5LJ3 d;  4JS5 A;  1QVP A;  2WSE E;  4YRQ A;  4M7D G;  4M75 D;  4BE0 A;  3V8L A;  3EAE A;  4M7A B;  1I81 A;  4DPG A;  3JB9 H;  1O9S A;  2ZIM A;  3GNG A;  3GOX A;  1UGR B;  3J80 E;  4C92 D;  3V8K A;  3HXW A;  3LH0 A;  2D6F A;  4J6X A;  2YHT A;  3CBP A;  4JRQ A;  4FIB A;  4M7D E;  3G1Z A;  3IG2 A;  4BW9 A;  3M54 A;  2LCL A;  3RKY A;  1YJW A;  5LJ3 h;  4R55 A;  2IVW A;  3VJP A;  3TCJ A;  3HFZ A;  2ZGW A;  5GAO m;  2K4Y A;  4C0Z A;  1G5I A;  1X54 A;  4KUI A;  4VUB A;  4LVI A;  3OS1 A;  1M1F A;  1I5L A;  3G4S T;  4YDQ A;  4YYE A;  3IKM B;  1Y96 A;  3FDR A;  2JTF A;  2DPP B;  4IUV A;  4M7D F;  4XU1 A;  4YRP A;  4NCX A;  1K73 U;  3UPU A;  1YHQ A;  3CPW S;  2K5I A;  5A0D A;  3QSU A;  2DK3 A;  2C8M A;  4AH6 A;  4ELY C;  3CC2 T;  2ZPE B;  3LWI A;  4JRP A;  4EDU A;  1USY C;  2Y90 A;  4KUL A;  5CKF A;  4QVZ A;  2E41 A;  1I8F A;  2XHC A;  2PU9 B;  2ZZF A;  4E51 A;  4YRL A;  1G5V A;  4X34 A;  4IUT A;  3CMA A;  1NJ5 A;  1Q86 U;  5C53 B;  1IRE B;  4FL6 A;  1QF6 A;  3X28 B;  2VUB A;  1VQ8 T;  4HVC A;  4YRN A;  1H4S A;  3CCU A;  5L8R E;  4C5I A;  1B8A A;  3NEL A;  3CMQ A;  1VQK A;  2FL7 A;  3CC4 T;  5D6W A;  4E7H A;  4PJO D;  3R07 A;  4YRM A;  2MMP A;  2LT4 A;  3G6E A;  5GAN g;  2ZZD A;  1BBW A;  2KVQ G;  4J7I A;  3JCM Q;  4EMK A;  4JDS A;  2A7Y A;  3UWN A;  2FB7 A;  1K9M C;  4UPA A;  2A3L A;  1U8R A;  4P5N A;  5LJ5 f;  4QVC A;  4B9X A;  3PMI A;  2EJG A;  4X5O A;  5GAO q;  4KR3 A;  2EQJ A;  3CBM A;  4HWR A;  2K2V A;  3HXX A;  3P8D A;  3ASK A;  5FU6 B;  1WNL A;  2E5Q A;  3PCO B;  1VQP T;  3JCM g;  1NYR A;  4J83 A;  3KUF A;  2RHU A;  4ELZ C;  2XU8 A;  3JCM e;  4HT4 A;  4Y28 E;  3QG1 A;  4OB0 B;  4Q5W A;  2MI6 A;  3FC3 A;  1N8R U;  2DXU A;  1SSF A;  1M90 C;  4FSX A;  4RG2 A;  4CS2 A;  3S6W A;  1Y71 A;  3M55 A;  3M4P A;  2KY9 A;  2ZCF B;  4E7J A;  3HFN A;  1TH7 A;  2YLC A;  3M57 A;  3EFS A;  1OZ2 A;  3FJP A;  5KE3 A;  3HL8 A;  3A5Z B;  5GMK e;  2CZ6 B;  2FYK A;  5A0G A;  3J81 E;  2XD0 A;  2RJE A;  4JRI A;  5CO7 A;  1YCY A;  4O2D A;  4P72 A;  3SWN B;  3CPF A;  4CH6 A;  4BY6 C;  5C6S A;  3CPW A;  2QXF A;  5GAN f;  3M9Q A;  3L2W A;  1QVF S;  4ME7 A;  3T9N A;  4KQE A;  3J7A F;  4M7D B;  4C0D C;  3OSV A;  3S3O A;  3M5A A;  2P0L A;  5KCH A;  2AKW A;  3HRT A;  1N9W A;  2QA4 T;  1LOJ A;  1KQS A;  3G4S A;  2DD4 A;  4MMK A;  4YRT A;  2J3M A;  4L87 A;  1B70 B;  4H2U A;  1ZBX A;  5GMK j;  3UGQ A;  1H4V B;  2XI9 A;  5AYF A;  3QO3 A;  5HKC A;  4M7D D;  1SRY A;  5HK0 A;  2E1H A;  4YRI A;  3TEH A;  1SER A;  1Q7Y C;  1VQ7 T;  4GY5 A;  5CIU A;  1Z7N A;  2XDD A;  5LJ3 f;  4YRR A;  3CCM T;  3H8Z A;  3VQX A;  3OYG A;  1KD1 U;  3A31 A;  2CZ7 B;  2IY5 B;  1V29 B;  4HWT A;  12AS A;  2QHS A;  3M4Y A;  4H2T A;  2DDZ A;  1HTT A;  2JN0 A;  4M7A G;  2O01 E;  3WXM B;  4BWA A;  4M77 A;  1VQ8 A;  4ZN1 A;  2DTH A;  3I56 T;  2AHJ B;  3CC4 A;  2XDB A;  1WJS A;  5F5W A;  3QUI A;  1WPY A;  4OP0 A;  2LCC A;  2LC4 A;  4ZGJ B;  3JB9 F;  3BDU A;  1VQL A;  1C0A A;  3P8H A;  5I21 A;  3LSS A;  2E6N A;  3OMG A;  4F7U A;  3W3S A;  4H2W A;  1KQ1 A;  3WVD B;  3MEV A;  1H64 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...