2EAYA

Crystal structure of biotin protein ligase from aquifex aeolicus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
total genus 66
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eayA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2eayA01
3UGTA 4P72A 1ADJA 3A31A 4M77C 1RIQA 4YRIA 4M7AF 4YRMA 2DJZA 1KOGA 4H2XB 3VQVA 2DZ9A 2ZIMA 3A5YA 5GAOr 3QUIA 3WQZA 2AKWA 4TQDA 4YYEA 4HT8A 4RCCA 2DQ0A 4Q15A 3MEYA 3EFRA 1B76A 4M7AG 1WYDA 4PJOC 3L4GA 3VBBA 4BWAA 1N9SA 5LJ5h 2Q7EA 4A53A 1X55A 4HWOA 5LJ3g 5GAN4 4XTXA 4F7UA 3HXZA 5GAOl 1KMNA 2E65A 2EJ9A 4YDQA 5GANh 1EOVA 1HTTA 4L87A 4YRFA 3TEHB 1WQWA 2YLBA 3RKXA 2I4NA 3RIRA 3MF2A 2DVEA 3V8LA 4P75A 5GAMj 3R07A 1G5IA 4DPGA 3BJUA 4UP7A 3A7AA 4H2UA 1LNXA 4RDXA 3BDUA 5GMKi 3V8JA 3EFSA 4KQEA 4M77G 1JJCB 3HXYA 4MMLA 1N9WA 3RKWA 4MMKA 5GANg 4ZTZB 3PGGA 1B70A 2DXTA 2DXUA 5GMKm 5LJ3h 4M75E 5LJ5f 4JRKA 4YRNA 1NNHA 4ZTUB 2ARUA 2E5AA 2EWNA 1KQ1A 2RD1A 4C92B 2AKWB 3HFOA 4LNSA 4M78C 1NYRA 4CS2A 3AHUA 3HXWA 4YCUA 2Q5IA 5DY9A 4HWTA 3IKLA 5GAN5 1LYLA 3GIBA 2CGHA 2FB7A 1BBUA 4WJ3M 3FB9A 2DKGA 3SB2A 4C8QF 5GAN2 4X9DA 3JCMb 4YRCA 4PJOE 2I4MA 4F7UF 2J3MA 3RF1A 1E22A 3QO8A 2HNIA 2ODRD 2ZR2A 4X5OA 5C52B 2DTHA 4N0AC 3BW1A 1BBWA 4M7DF 1NYQA 3QO3A 4M77E 4RQFA 3IALA 2ZZEA 5GANe 4XQ3A 3HY1A 4H2WA 4M75G 1ATIA 4XTUA 4PG3A 12ASA 1LOJA 3L1AA 4N0AA 3JCMg 3ERRA 4YRTA 3QTCA 4YP0A 2Q5HA 4V2SA 2RM4A 2ZT7A 3JB9D 2QHTA 1QE0A 5ELNA 4P3PA 3HRIA 1Z7NA 1JBMA 4UPAA 4XTYA 4M7DC 2ZTGA 3IG2A 3P8YA 1EVKA 5GAOp 5GAMd 3HXUA 3TEHA 5GAMg 1SESA 1NJ2A 4XU2A 4HA8A 4KR3A 4M7AA 4XTWA 3VQWA 5K1XA 1I5LA 5GAN7 2DTOA 4H2VA 2DQ3A 1NJ1A 4G85A 2DDZA 4K86A 4A54A 4J15A 3INZA 4YROA 1E24A 1EVLA 5GAN6 4EMHA 1IL2A 4K87A 3HY0A 4AH6A 1JJCA 4OP0A 4M7AC 2IY5B 3QO7A 4CH6A 2E41A 4YREA 4WI1A 4C8QB 3RACA 4NCXA 5ELOA 2IY5A 2JN0A 3RKYA 4P75C 4J6XA 4H2SA 1M5Q1 1X01A 3E9IA 3P8TA 4HT9A 4M78E 1PYSA 4M77B 5GAN3 1ASYA 3VQYA 2DTIA 4M75D 5GMKl 5LJ3e 4M77A 2E10A 1YFTA 3V7CA 1YGBA 4RCBA 1Z7MA 4NL2A 1D3BB 3JB9F 4C8QC 4QVCA 2J3LA 4YPFA 4EO4A 2QHUA 3LC0A 1W66A 3NETA 4F7UE 4P74C 1JRIA 1H4QA 1LJOA 4JUVA 1WPYA 4CH3A 4RMFA 4TVAB 1X54A 1B7YA 2ZINA 4JLIA 2DU5A 1NJ6A 4HWPA 4PJOG 5GMKj 4M78D 2AMCB 2EAYA 4H2TA 4M77F 5GAOq 5C53B 1SETA 1BIAA 2Q7HA 5F5WA 3LSQA 1E1TA 4TVYA 3QHSA 3L2ZA 2CJAA 4EMKA 5GANd 3TEGA 3FJPA 5GAMh 2RHQA 3SWNC 5LJ5e 2CJ9A 4YRJA 1BIBA 2RA2A 3PCOA 4P73C 4XU1A 2ODRC 1I4K1 4BW9A 2EJGA 3UH0A 3JCMd 2VXEA 4C92E 3PCOB 2E64A 3CMQA 1MGQA 1NJ5A 2I2LA 1QF6A 1YB3A 3OD1A 4YRLA 2FYKA 3V8KA 3I7FA 1VQZA 3RESA 3JCMQ 3E9HA 3MF1A 3UFGA 3JCMh 4K88A 4NL3A 3HFZA 1B34B 2Q7GA 4HVCA 2ZR3A 2ZIOA 2ZNIA 4Q6GA 3VU3C 2RHSA 3HXXA 1X2HA 1HC7A 5GMKe 1X2GA 3HFVA 3ICAA 4E51A 3NELA 3A32A 1YFSA 5I21A 1E1OA 1EQRA 3A74A 3JCMX 4EX5A 3RERA 2E3CA 4EMGA 3HXVA 4WJ4A 3NEMA 3G1ZA 1EFWA 2C7IA 4XTZA 5LJ3f 4H2XA 4NOYA 3RUXA 2Y90A 2QHSA 4TTVA 4YRSA 4H02A 4YCVA 2ZT6A 2RHQB 4M78G 3V7SA 3QNEA 4P71A 4YRKA 4XU0A 1SRYA 4J6YA 2XTIA 3L4GB 4G84A 4M78A 3W3SA 3BY7A 3QSUA 4KR2A 5LJ3d 4CH4A 2RB6A 4HWSA 5GAMe 3A7RA 4P74A 2G4CA 5CAIA 3A5ZA 2ARTA 4TVAA 11ASA 1H4SA 3PZCA 1WQ7A 4DQ2A 1B7YB 4M7DE 2I4OA 4P73A 1I8FA 2AMCA 4C8QG 3HFZB 3SWNA 1I81A 2ZT8A 3M4GA 2I4LA 3KFUA 3SWNB 3BFMA 4M7DA 1USYC 3JCMe 2PMFA 3HSBA 2EJFA 2ZZGA 2PMEA 1NJ8A 4C92D 4M7DG 4PJOF 3REUA 1EIYB 2ZT5A 4PJOD 5GMKh 4TVWA 4J5YA 5E3IA 3JB9H 2C8MA 3DSQA 2P5IA 4M7AE 5LJ5j 1U1TA 2ARSA 4OLFA 1M8VA 2P0LA 1PYSB 5GANf 4XEMA 1FYFA 4M78B 2VXFA 1YCYA 4PNOA 4YRRA 1X56A 3IKMB 2ZZFA 4PJOB 4YCWA 3LSSA 3NENA 5LJ5g 4UP9A 1U1SA 1HXDA 4JRIA 3JB9J 2CIMA 4YRPA 4TWAA 4H2YA 1D3BA 2QTXA 4ZIBA 2VC8A 4P3OA 4XEOA 3M4QA 4F7UB 1WNLA 2K57A 1WU7A 4CS3A 3JCMV 1Y96A 5LJ3j 2DU7A 5C51B 2YLCA 1SERA 3JB9I 4CS4A 1Y96B 1B8AA 5HGQA 4J6WA 4F7UG 2XGTA 4M7DB 2DEQA 4M78F 1N9RA 2EL9A 4YRGA 1J5WA 4Y91A 3JCMW 4P3NA 4WF2A 4CH5A 1G5HA 4EMKB 5LJ5d 5K1PA 1ADYA 4XU3A 2YHTA 1G51A 1USYA 4RQEA 3RL6A 1L0WA 2E1HA 2ZCEA 1TH7A 3A7UA 4P72C 4X9CA 1B70B 5GAOn 3JCMP 1GGMA 3HRKA 2DZCA 4C92G 4M7DD 5GANj 2QHVA 3HTZA 4M75F 1WLEA 1HK9A 1YFRA 3TUPA 3JCMJ 3UGQA 3QO5A 1H641 3JB9G 3JCMf 1H4VB 4O2DA 4M75C 2ZXFA 4C92A 1KQ2A 4EMKC 4TQFA 4YRQA 5GAOm 3REXA 5GAN8 3FIFA 1ASZA 4M7AB 4PJOA 4UP8A 1KMMA 4C8QD 1B34A 3VQXA 1C0AA 4XTVA 3V7RA 4C8QE 2ALYB 2CJBA 2ZNJA 3RGLA 4HWRA 2RHSB 5KNNA 4M75A 4PHCA 4P71C 1H4TA 2ALYA 3M4PA 2ZGWA 4M77D 3P8VA 5GAMf 4C92F 4M75B 1EIYA 4M7AD 4QVDA 3HFNA 3JCMc 4C8QA 4C92C
chains in the Genus database with same CATH superfamily
3UGTA 1N8RR 2HDAA 4P72A 3A31A 4M77C 2ROTA 3OYMA 3VQVA 2DZ9A 2V8IA 3QUIA 2X4JA 2DYBA 2JW4A 4YYEA 1WJQA 1EZZB 4GLKA 3CCSA 1IHVA 1YI2Q 2RI3A 3CCVQ 2HQHA 2EQKA 1G3TA 1RAFB 2QGFB 1T0JA 3EGUA 1B7TA 1W2BP 5I2MA 4ANJA 3TQ7P 4BY6C 3HXZA 4DBQA 4KH0B 2E65A 4YDQA 3X20B 4L87A 1QCNA 2YLBA 1YCSB 3RKXA 1AT1B 3S3NA 1RI0A 3HTRA 1H8KA 5GAMj 2EYYA 4J9IA 2ED0A 2KGTA 4LNPA 5GMKi 2CP5A 2JS0A 4XAXB 3ZEHA 2LCCA 3OSSC 1Q81R 3HP9A 2X9HA 1JJCB 1MNDA 4II1A 4MMLA 5GANg 3REAB 3H9NA 1B70A 3CCVA 2DXTA 2DXUA 3MEAA 3OS2A 5LJ5f 4JRKA 4FYYB 3RR6A 1VQMQ 2H3EB 4RTUA 4K11A 1K8AR 1VQ8A 2RD1A 4C92B 1VQNA 1Y07A 5KCHA 3OYIA 2Q5IA 2DAQA 3CCSQ 5GAN5 3QWXX 2RJCA 3GIBA 2FB7A 3SB2A 3RMSA 5IXBA 2QEXA 4X9DA 2LTOA 4YRCA 2I4MA 4PKCC 2MIOA 3L2VA 2J3MA 3S3OA 4RKUE 1T3SA 4D8DA 1VQMA 1M2VB 4PJLA 3OY9A 2K5FA 3CC2Q 5KYXB 4X5OA 5CR2A 3ZBDA 4M7DF 1BBZA 4PFOA 2HBPA 1ZSZB 2COZA 2ZZEA 9ATCB 4E2FB 3CC4Q 1V29B 3CCLT 1K9MU 3HY1A 1NPPA 2XKOC 4J9EA 4N0AA 2W0ZA 3ERRA 4YRTA 2JOYA 3CPFA 3VYGA 2F5KA 4C0ZA 2CT3A 1SSHA 3JB9D 1UFFA 2QHTA 3CXCS 2R57A 4P3PA 1W2BA 3HRUA 1G3WA 4XTYA 1MV0B 4AG1C 2D9TA 1SSFA 1XNIA 2FPEA 5CVIA 1PSFA 5IH2A 2EKHA 1TUCA 1X6BA 1W4SA 2A08A 1VQKA 1YI2A 3G6EQ 1K9MR 1E6GA 2M51A 3CMEA 1PNJA 5GAN7 5KE3A 3A98A 4H2VA 1NJ1A 3FLGA 4G85A 5EC7A 1VQ8T 4J15A 3INZA 4YROA 1E24A 1SRMA 3U23A 3MP8A 2AKKA 4VUBA 4EMHA 5KYXA 1ZX6A 4AH6A 2PQWA 3M0QA 2RHZA 4DBFA 1FMKA 2RH2A 2DPPB 4YREA 3VYHB 1W6XA 1BK2A 4C8QB 1NZ9A 4H2SA 3CCET 1M5Q1 1X01A 4RMOA 3E9IA 4HT9A 3G6ET 2LCLA 5D7UA 5DLQE 2CDTA 1VQOT 4M75D 4KUDK 4J7IA 3A8HB 2A28A 2KEAA 4M77A 2K3YA 1IB8A 2EVRA 1YFTA 5CKHA 1HYOA 1QCOA 1OQKA 2LQKA 4OMNA 4F7UE 3EH1A 1JO8A 4CH3A 2NS6A 2CP6A 2DE0X 1G5VA 2KI7A 1X54A 4A63B 4JLIA 1OU8A 1NJ6A 4A4HA 3L42A 3CCUA 1GCQA 5A0GA 4M77F 1BIAA 1PCXA 1AEYA 1YI2T 5F5WA 1VQOQ 2BIVA 3LSQA 3CCJT 1OULA 4QQGA 1RAEB 3E9FA 4LVIA 1AOJA 1BIBA 2KRMA 1YITQ 1CKAA 1NG2A 2JNGA 3EFOA 3OBYA 2EJGA 2C0TA 1SF9A 3FDRA 2VXEA 3PCOB 2E64A 3HHTB 3H0HA 3M0SA 2I2LA 3I55A 2O9VA 1N8RU 3OD1A 2W10A 4O5VA 4RTYA 2FYKA 3I7FA 1FMVA 1PD1A 1GFDA 3E9HA 1IGQA 1OOTA 4OB0B 5A0LA 3TEEA 2DD4A 3I5SA 2Q7GA 1GBRA 2RPNA 2ZR3A 2ZIOA 2NUTB 3LLRA 3VU3C 4WCIA 3UWNA 3P8DA 2QQBA 4RTVA 1NJIU 1M90C 1PRLC 3QDFA 1EQRA 2RHIA 2J06A 2E3CA 3OYYA 4WJ4A 2DD5A 2RF0A 3CCVT 4NOYA 2R5MA 2Y90A 2QHSA 1Q86C 2D6FA 4YRSA 4AFZC 4YCVA 4M78G 2P0KA 2YRVA 3CCQQ 4RUGA 4XU0A 3CPWA 2ABLA 4GY5A 1TXQA 2XTIA 3L4GB 4M78A 1MUZA 1O75A 1X6GA 1VOMA 2LQ8A 5LJ3d 2RB6A 1I1JA 1T0HA 3VS4A 4HWSA 3GP8A 3G4SQ 4P74A 2AZSA 3GNFB 1R8OB 1H4SA 3PZCA 1JXMA 3DLLA 2D8HA 1K8AU 1PG5B 2CP0A 3FRNA 3SWNA 4HCBA 1G2BA 2ZPFB 3CXCA 4IURA 5KYUB 4LD6A 1KD1R 2VV5A 1YBYA 5CQYA 2EJFA 2KR3A 3NGPA 4LDXA 1LVKA 4C92D 2LX7A 4ZGEB 4BE0A 3G4ST 1WHGA 1WHLA 2OI3A 4PJOD 2CUBA 2KDSA 5E3IA 5J3BA 2SRCA 2CREA 2DXCA 2ECZA 2RQRA 1VQ8Q 1QMCA 3SFMA 4RG8A 4JRPA 4OMLA 2M0OA 1K0XA 1YCYA 1ZBXA 3LW5E 2KXDA 3IKMB 2DLPA 4UP9A 2XG8D 2DIGA 3CD6A 1OI1A 4JRIA 5HY6A 4TWAA 1D3BA 4QW2A 5A0DA 2LJ1A 2A8EA 5IT9E 2D1XA 5C6SA 3G71A 1AWOA 1GXIE 2JS2A 2DU7A 2CZ6B 3I55Q 1ZSZA 3PMIA 4CS4A 1B8AA 4F7UG 4C5HA 2DEQA 4M78F 2KBTA 4JJDA 1YJWA 1R0BG 3CCRT 1O9SA 4FW2A 4P3NA 4WF2A 3UATA 3ER0A 1TU0B 4LN2A 1IRXA 1ZUUA 2AZVA 4J9FA 1KSWA 2VVKA 1ZSGA 2DK3A 1G51A 2XD0A 2KT1A 1VQKQ 3A7UA 2LT4A 4C5IA 4P72C 2RHXA 4PK4A 3JCMP 3TU4K 1XQHA 1PC0A 2DZCA 2L89A 3C0CA 5GANj 1HK9A 3UGQA 3QO5A 1H641 1KFZA 5I11A 3JCMf 4EMKC 1ZUYA 3HRSA 3CMAT 2LC4A 2MOXA 4J9BA 3FIFA 1SHFA 2QDYB 1YJNQ 1ASZA 4UP8A 3CXCP 4C8QD 1MHNA 2ALYB 2Y4YA 1VQNQ 2K4YA 4HWRA 2L3QA 3BE3A 2RHSB 1UGVA 3RBBB 2HBWA 4M75B 1SPKA 4QVDA 3H8ZA 4C8QA 2QEXQ 1M27C 2K6DA 1VQ4Q 2HKNA 1YJNA 2CZ1B 2VYTA 4M7AF 4D8KA 4E7IA 4F16A 1G3YA 3AT1B 1K0SA 4CC2A 1NEBA 3EG0A 3CCQT 2DQ0A 3PFSA 3G7ZA 2LDMA 1WYDA 4PJOC 2Q7EA 2HEQA 4NS5A 1NEGA 4OMFB 2B8AA 1AWXA 2ZZDA 1KMNA 3PVQA 1QP2A 4L6V5 5GANh 2FVUA 4ZGJB 1HTTA 4QVZA 1WQWA 2QG9B 3UA7A 1YIJT 2I4NA 1D1CA 4BD3A 2DVEA 3V8LA 1Y57A 2LMJA 1PRMC 5AT1B 1E7OA 3C94A 2F2VA 4DPGA 3EH2A 2RK2A 1MMAA 1W2BS 3BDUA 4MZTA 3L2QA 3C4SA 3V8JA 2J6KA 1M1KR 1EX4A 1FXXA 3O8VA 3HXYA 4FM4B 4BB7A 2JM9A 4MMKA 1GL5A 2JTMA 4ZN1A 3QDRB 1M1KC 2LT1A 1X2QA 1WIEA 2DXBA 4M75E 2XMFA 1NNHA 2NLUA 2X51A 2ARUA 2EWNA 1QLYA 1KQ1A 4R55A 3FC3A 2AKWB 1JJ2P 3S6WA 4DEYA 4LNSA 1NYRA 4CS2A 3AHUA 3HXWA 2L3RA 3CCJA 3IKLA 2HQEA 1VQPT 2ZAEA 5FU6C 4WJ3M 7AT1B 1UHFA 1WZOA 3JCMb 5CO7A 3VV0A 4PJOE 2DL5A 2O88A 3VS7A 4N4IA 2WSCE 1YIJA 3QO8A 1UE9A 4PJNA 2GF7A 2QDLA 4ZTFA 1JQQA 2GGRA 1VQ4A 1M2VA 3C12A 2KE9A 1NYQA 4ZNXA 5C0MA 2O31A 4FIBA 3CCRQ 1NYFA 4H2WA 1UB4A 4HKEA 3SDZA 4PG3A 3LYIA 1OYXA 3G71T 3M0RA 4E7ZA 4BDZA 4KH1B 1N6AA 2GNCA 4YP0A 5D6XA 2Q5HA 1JU5C 2CS7A 3QZ9B 5A2QE 1RAAB 4HVVA 2RM4A 2ZT7A 5L23A 1QE0A 3P8HA 3CD6T 3HRIA 1JBMA 4UPAA 2O4XB 3P8YA 3E1SA 2CP2A 2OJ2A 3EGXA 2DL4A 3HXUA 1VQ9A 2K3BA 2DM1A 1TUDA 1WI7A 4XK8E 5IHKA 8ATCB 1WXBA 4EIKA 1WDXA 3VQWA 4OGEA 2F69A 2DDZA 3URGA 2YSQA 3DKMA 2MI6A 1WYXA 1N27A 4K87A 2RHUA 3HY0A 4LVJA 2DL3A 4OP0A 1K76A 3H0IA 3I9QA 5I22A 2IY5B 3QO7A 1M1FA 2HL5C 3VS3A 2DEUA 4LUDA 4KGVB 1U8RA 4AFUC 3I35A 1G8XA 4NCXA 2L0AA 2J7IA 4J6XA 2AIRB 4OF1A 4ATOA 3REBB 5J39A 2EQIA 4M78E 1PYSA 2L3SA 1S72Q 3VQYA 3TSWA 5GMKl 3GBQA 5LJ3e 2J05A 3QZ5B 3QYGB 4KT0E 4RCBA 1Z7MA 4LVMA 3JB9F 4QVCA 1RABB 2J3LA 4YPFA 1FWZA 1ARKA 1W66A 4P74C 2Y4XA 4TVAB 3CCMQ 1YWOA 2HAXA 3CBPA 3M4YA 5GMKj 2AMCB 2EAYA 2HSEB 4L5GA 5ECAA 1SETA 2Q7HA 1KG1A 4LDYA 3M57A 2PNIA 3EG2A 2YUOA 5CCAA 2LRQA 2DRKA 1VQ7A 2CJ9A 4YRJA 3QXEB 2MWOA 3PCOA 4P73C 4BW9A 1UGRB 4IUTA 3UH0A 4IIMA 3JCMd 2NYSA 1UJ0A 2FO0A 3CC7Q 3L2WA 2OTLT 1NPRA 3EGDB 2P0QA 3TSZA 4IUVA 1PM3A 1AWWA 2E12A 5I2SA 3GPLA 2CSQA 2XK0A 4K88A 1RI9A 4Y92A 1M1GA 3VUZA 1B34B 3EHQA 5KYYA 4IKFA 2ZNIA 4Q6GA 3HXXA 3LGFA 5GMKe 3HFVA 3ICAA 3CCMA 3NELA 3A32A 2KRNA 3I56Q 1YFSA 2GBQA 3JCMX 2YXYA 3CMEQ 4EMGA 2OTJQ 4PJMA 2DNUA 3G1ZA 1PSEA 1EFWA 3PVLA 2X4XA 2C7IA 3VS1A 4XTZA 4BI4A 2JJ9A 5LJ3f 1VYTA 3N5BB 4H02A 2V8JA 2CZ0B 4P71A 1GFCA 4YRKA 1VQOA 3EG9B 2L8DA 4KUIA 2E3IA 3W3SA 2LCSA 5IHIA 4KR2A 4X1VA 2MCNA 2CUDA 2OTJA 1YN8A 2WACA 4JS4A 2DILA 3A5ZA 4OMOA 2ARTA 2DFUA 2C06A 2FL7A 1QWFA 2YUQA 3VS2A 3TVTA 2V1QA 1IHWA 4KULA 2AMCA 1PD0A 1UGPB 1UTIA 4P5NA 3G6EA 2E70A 2GFAA 5J26A 2PZ1A 3CCEA 1K73R 2P84A 3BFMA 1VQLA 2KRSA 3CMET 2O01E 3JCMe 4E7LA 1H3ZA 3HSBA 2J6FA 2FRWA 3OYJA 2F1LA 2HZYA 3PIOA 1H92A 4PJOF 1D0XA 2Z0WA 4DOVA 3LH0A 2V8KA 1M9SA 3ZL7C 1H3HA 3OS5A 4JPBW 2K3XA 5FWCA 3M0UA 4UC4A 3JB9H 2C8MA 2P5IA 4MZMA 1QWEA 2LX9A 3E9GA 1XTDA 2L2PA 1M3CA 2BUDA 4RTWA 3LH5A 4OLFA 1Q7YR 3J7AF 1TOVA 2EFIA 1FYFA 3TCJA 4PNOA 3UF4A 4YRRA 4KGXB 2ZZFA 1IREB 2EQMA 3CCLA 5LJ5g 1OZ3A 4FT2A 1IXDA 1HXDA 3JB9J 5FU6B 3DLMA 1YHQT 2VC8A 4F7UB 1WNLA 1M3BA 2FZKB 3HRTA 5LJ3j 5C51B 4MDXA 3M54A 4GLMA 3JB9I 4J6WA 2XGTA 2EL9A 1Q7YU 1LCKA 2A0FB 4CH5A 1G5HA 4EMKB 2L3PA 1ADYA 4XU3A 1BI2A 1USYA 1L0WA 2WSFE 1WGSA 2ZCEA 2BTTA 1AWJA 5GAOn 1Q86R 2RQWA 2QXFA 4CRIA 2OTLQ 2LP5A 1WJRA 3JB9G 2DMOA 2VGMA 1BKBA 4M75C 2GFUA 2HMAA 4R56A 2G3RA 2X4WA 1M3AA 2NWMA 3CC4A 4HVWA 5AYFA 1CKBA 2BZ8A 4XTVA 4C0FA 1ACMB 2ZNJA 4OMMA 4FCYA 2ROLA 1G83A 4WTOB 1S72A 1H4TA 5FU7B 3OYLA 1YIJQ 1N8RC 2ALYA 1E6HA 1BU1A 1BI1A 1WJSA 2EKOA 3ZFJA 1QVFS 3EAEA 2QTVA 2RNAA 4C92C 2RQVA 3VS6A 3QKJA 2MAMA 1RIQA 2DJQA 4Z02A 4E7JA 4YRIA 2DJZA 4Z8AA 2QQ9A 4IUPA 1YJNT 1KOGA 4RTTA 3OA6A 5GAOr 3WQZA 1VQ6T 1RAIB 1UEBA 1S1NA 2P4TA 4HT8A 4Q15A 2KYMA 5DLOA 1B76A 4M7AG 1Q81U 3L4GA 3VBBA 4BWAA 4QT7A 1N9SA 2PVDB 2DERA 1X55A 4F14A 1PHTA 1YJ9T 3CC2A 1NLPC 3CCMT 1ZSZC 4F7UA 5GAOl 1YITT 1U3OA 1EOVA 3GNGA 2FPFA 3OMGA 3RIRA 2EBPA 4P75A 1G5IA 2FHDA 3CC2T 1LPLA 2LJ0A 1NBEB 3A7AA 4H2UA 1LNXA 2JM8A 4RDXA 4KQEA 1X6OA 4M77G 1RAGB 1N9WA 3RKWA 4LVKA 4ZTZB 4A4KA 1PWTA 5GMKm 5LJ3h 1Q81C 1KK7A 2QGGA 3G1JA 4O6JA 2JUFA 2D0NA 4JS5A 2KT8A 4M78C 4YCUA 4HWTA 5DY9A 3KXTA 4A4EA 2PTKA 1LYLA 4FYWB 1OZ2A 5CKFA 1BBUA 5FLXE 4C8QF 2CKKA 5GAN2 2A7YA 3META 1Q82C 4F7UF 5FROA 3RF1A 1I0CA 1E22A 2HNIA 2O9SA 3I56T 5IN1A 2ODRD 2ZR2A 1CSKA 3NMZC 3CD6Q 3VJPA 5C52B 2DTHA 4N0AC 3BW1A 4BACA 4E7HA 2M02A 3QO3A 4M77E 4ZN3A 1KQSS 4RTZA 1WHKA 4RQFA 3IALA 1XJWB 3PT9A 2QA4T 4HCZA 1QVPA 2K2VA 4M75G 1ATIA 4XTUA 1LOJA 3L1AA 3JCMg 5GJVB 4N4GA 1D09B 3QTCA 1UGSB 4V2SA 1MNEA 3E2UA 2ZPGB 1VYVA 1WXTA 3M58A 4HXJA 2BE7D 3EGXB 2R5AA 4M7DC 2HQXA 1EFNA 2CT4A 2ZTGA 1D0ZA 2QA4A 5GAOp 1HSQA 5GAMd 2XIDA 1BI0A 2O2OA 1Q82R 1W70A 5GAMg 2JTFA 3CMAA 1NJ2A 4XU2A 4HA8A 2EGCA 4PFPA 3H0FA 1B07A 1G3SA 5KCOA 4M7AA 5IXFA 4FSXA 1NLOC 1YHQA 2DQ3A 3KFVA 3M55A 2CZ7B 4A54A 1ZA1B 3RDVA 1EVLA 3DB3A 1QKWA 1RADB 1OPKA 1ZBJA 2GQVA 4LUEA 1JJCA 4M7AC 1VQ4T 4WI1A 3NPFA 3G71Q 2IY5A 4CC7A 2JN0A 3M0TA 1AZGB 1N5ZA 3P8TA 4C5GA 4EDUA 1M90U 1ASYA 3QBYA 1UJYA 1UDLA 1YJWQ 4J9CA 2E10A 4OB3B 2LQNA 1VQPA 4MZPA 3MCAB 1FYNA 3V7CA 1YGBA 4NL2A 1QP3A 1T3LA 4OGCA 2XDBA 2QHUA 3LC0A 1YITA 3NETA 1RLQC 4A4FA 2GTJA 1H4QA 4JUVA 1WPYA 1KQSA 2F2XA 3A8MB 2KAFA 1YJ9A 1B7YA 3OMCA 1VQ6Q 2ZINA 3SD4A 4HWPA 4M78D 3Q1JA 5GAOq 2NUPB 1I5OB 1AVZC 5C53B 3CBMA 3CCUQ 1E1TA 4TVYA 3A1PA 3QHSA 3L2ZA 1WHJA 2CJAA 4EMKA 3S3MA 5GANd 3MEVA 2OTJT 3JV3A 4BDYA 3FJPA 4TVRA 3SWNC 1X69A 2BZXA 5LJ5e 3OYAA 2RA2A 1BB9A 3CCEQ 2ODRC 1I4K1 4AFQC 4FW1A 2JT4A 3G4SA 2KSSA 4Z88A 3DB4A 3FJ5A 2NUZA 1MGQA 4HCKA 3X28B 2YRDA 4A4GA 1JEGA 1ABOA 1QF6A 1YB3A 3ME9A 1TWBA 3LGLA 2XICA 1WX6A 3V8KA 1U06A 3CCUT 2QYZA 3JCMQ 2QQSA 3MF1A 3UFGA 3QJ6A 4ELYC 1KC8U 5M9OA 2C0OA 1Q95G 2EQUA 4LXCA 3JSCA 4AT1B 2MWPA 5IHNA 4D6WA 3CCQA 1IO6A 4OVAA 2DBKA 1X2GA 3F70A 1WLPB 2EQJA 4E51A 3I56A 1M1KU 1Y0MA 3M56A 2E6ZA 8AT1B 4N4HA 1K9MC 3A74A 3RERA 4PL6A 3QYHB 3NEMA 3CEYA 1YWPA 2YT6A 1JJ2A 2RQUA 2E4HA 1Y71A 3PMTA 3HKSA 4TTVA 2QA4Q 3EG9A 2ZT6A 2KVQG 4Q5WA 3V7SA 4Z89A 3OYKA 3QNEA 2YRCA 4F17A 3EFOB 1SRYA 1I07A 4DBHA 1IZ6A 4CH4A 4CI0C 1SKUB 2LJ3A 3NTIA 2RI2A 2OAUA 2EW3A 3LX7A 3M5AA 3OSVA 2X35A 3A5ZB 1B7YB 2O4XA 2DO3A 2I4OA 4P73A 4PLLA 1VIFA 1KD1C 4C8QG 1I81A 2L5QA 4QQDA 2ZT8A 4QKUA 3M4GA 3E19A 2I4LA 2NUTA 2ZCFB 4AFSC 4KGZB 3NFCA 1USYC 4J9GA 2PMFA 5KE2A 1NYGA 3I55T 2EYWA 2ZZGA 4LDVA 2FPDA 1NJ8A 3REUA 1K1ZA 2ZT5A 2RN8A 1C1AA 1QW1A 1W1FA 3CC7A 1OX8A 4TVWA 4J5YA 1HD3A 1Q7YC 3DSQA 3OQ5A 3UDCA 4M7AE 2DA9A 1U1TA 2IG0A 2ARSA 1TS9A 1S72T 2P0LA 1PYSB 1VQLT 1ZUKA 3GOXA 4M78B 2VXFA 2QQAA 3VS0A 1VQPQ 1KD1U 2KMTA 1X56A 2HSPA 5FRMA 3LSSA 3NENA 1U1SA 4YRPA 2FEIA 5FWBA 2P0PA 2JMCA 1QCFA 1QQJA 3MKDA 4ELZC 5FU7C 3JCMV 1Y96A 4CS3A 2B86A 1VQNT 4BE1A 2YLCA 2KROA 3OYNA 1Q82U 4LDUA 1SERA 5HK3A 2LNHB 5HGQA 2KYBA 2QASA 4E7SA 4DEXA 1N9RA 2DETA 3CC4T 5D6YA 4YRGA 2JVVA 1YFNA 2RJEA 2H8HA 2P4RA 3KBGA 5LJ5d 1RL2A 4DA4A 5K1PA 1RACB 1GBQA 1ZA2B 1FX7A 1K8AC 4RQEA 2COYA 3RL6A 2E1HA 4L59A 2K7AA 3ASKA 2ZPHB 1MMNA 1TH7A 4F04B 2YUNA 4LD9K 1GGMA 2FG0A 4JJBA 4M7DD 3TREA 2QHVA 1K9AA 4M75F 3X26B 1YP5A 3CCJQ 4OB2B 1WLEA 2ATCB 1YFRA 2XDDA 3JCMJ 3TUPA 3EGDA 5KH6A 1H4VB 1KQ2A 1BI3A 3LWIA 4YRQA 3OYBA 5GAOm 4M7AB 1RUWA 1UECA 2YUPA 1KMMA 4DBRA 1B34A 5KYYB 1GCQC 2V1RA 3CC7T 2CJBA 1AHJB 3RGLA 4ORZA 2CYZB 4P71C 3OYHA 2M0YA 2VUBA 2ZGWA 3P8VA 5CQXA 5GAMf 4C92F 2EPDA 1Z9QA 4M7AD 1UGQB 2E5KA 3HFNA 4RG2A 2K9GA 2FZCB 3NHNA 2LZ6B 3OBWA 1ADJA 3RMQA 1XOVA 4HVUA 4YRMA 2DVJA 4BE2A 4HT4A 4H2XB 1RAHB 2ZIMA 2CP3A 3A5YA 4ZTJA 2IIMA 1SG5A 4JZ3A 2RO0A 1JB0E 2K5LA 3NTHA 2IVWA 3EHRA 2AKWA 2CH4A 2QAZA 4TQDA 4RCCA 3HL8A 3MEYA 3EFRA 1X27A 3QJYA 1VQMT 4ZGDB 2KXCA 5LJ5h 4IIOA 4A53A 4HWOA 3NTKA 5LJ3g 5GAN4 2QEXT 3VKIA 4XTXA 4E47A 1BCOA 2GQIA 2EJ9A 3FEOA 1MV3A 2X3XD 3M53A 4YRFA 3TEHB 1JXOA 4FL6A 3BDLA 1KC8R 5L8RE 2EIFA 2K79A 3MF2A 5HK0A 1OEBA 3R07A 3H6ZA 2BE9B 3BJUA 2ED1A 4HCCA 3GLXA 4UP7A 4J8OA 1J3TA 4BI3A 2XI9A 1NJIR 1K4US 3EFSA 2KNBB 3C95A 1V76A 4CC4B 1B3QA 4J9DA 4JLGA 5LL6S 3PGGA 4AMCA 3KUFA 3UA6A 1NJIC 3MEWA 4FSSA 2D0QB 4YRNA 2CSIA 4ZTUB 1SRLA 2HD0A 2E5AA 2A37A 3VRYA 2HL3A 2JZ2A 3HFOA 1QVFA 3MP1A 2A3LA 1K73U 1M8MA 4FT4A 2CGHA 4RTXA 1OPLA 4BI8B 1C6VX 1ZHIA 2DKGA 3FB9A 3CPWP 1VQ9T 2KK4A 2E5QA 4Y28E 4ESRA 2VWFA 2EGEA 1BCMA 1KJWA 1QVGS 3OS0A 2COWA 2RI5A 2RJFA 4PFZA 3OS1A 2C0IA 2K2MA 3OYGA 2I0NA 1BYMA 3H41A 1KHCA 1BBWA 1PKTA 2JMAA 4PLIA 3QIIA 5GANe 4XQ3A 2RJDA 3JRZA 2ZPBB 1TTHB 5CKBA 1F1BB 5DM7R 12ASA 5CIUA 4KBMB 2D8JA 3R6OA 1P92A 2OTLA 2H3JA 2HKQB 1KHIA 2SEMA 3OYCA 3D7SB 3MP6A 5ELNA 3CPWS 2J6OA 1YJWT 1Z7NA 1WHMA 3VRZA 1OU9A 3IG2A 1EVKA 2G6FX 2FRYA 2ESWA 1NM7A 2KQWA 2MPXC 3TEHA 2XDPA 3CCLQ 1SESA 3OW2S 2WSEE 1VQKT 2MF2A 3MPUB 5KYUA 4KR3A 3UT1A 4XTWA 2DL7A 2JXBA 2DL8A 5K1XA 1I5LA 2ENMA 4X34A 1KIKA 2DTOA 1PKSA 3OYDA 2LVMA 4K86A 2M16A 2BZYA 3QPHA 1AZEA 5GAN6 1IL2A 3JAME 4OMQA 1M4ZA 4DOWA 1U5SA 3PIPA 4CH6A 4KRTA 2E41A 4QQ6A 2DYIA 3RACA 2RHYA 5ELOA 4BUGA 3RKYA 4P75C 1QVGA 1AD5A 3SEMA 2AT1B 2PUKB 1YNZA 4M77B 5GAN3 1R0CB 2RMOA 1WFWA 1X43A 2DTIA 1QVFP 1VQLQ 1HJDA 1MMDA 1VIEA 1ZLMA 2PVGB 2PUOB 4R0KA 1UG1A 1D3BB 2DF6A 4C8QC 4EO4A 2PVOB 1JRIA 1LJOA 4RMFA 1SEMA 1KC8C 4E7KA 3A8GB 5FRNA 2DU5A 2QQRA 4J9HA 4PJOG 1FMWA 3VUBA 3P8BB 4H2TA 1VYUA 3OB9A 4YTLA 4J7FA 3EG1A 1M30A 4JRQA 3T9NA 1OX9A 2NUPA 3J80E 2YWWA 1RLPC 4BY6B 2ZPEB 4C0DB 1VQ5T 2ZPIB 4OB1B 3TEGA 5GAMh 2RQTA 2RHQA 1V1CA 2M1HA 4FYXB 4FU6A 4C0DC 3X24B 4XU1A 1ZQ1A 3EG3A 2CP7A 3M9QA 3MO8A 4C92E 1UHCA 2QI2A 3CMQA 1VA7A 1NJ5A 3OYEA 4YRLA 1GCPA 3X25B 1VQZA 3RESA 3CBOA 3OYFA 3JCMh 2XHCA 4EPCA 2OX7A 4NL3A 2VB6A 3HFZA 3CCST 1R77A 4HVCA 2F2WA 2OAWA 4FYVB 2RHSA 1D1BA 1X2HA 4B9WA 1HC7A 2HCKA 2MK5A 1WHHA 3UPUA 4JZ4A 3J81E 3R6NA 5I21A 1E1OA 2AK5A 4EX5A 4OMPA 4J83A 5KYWB 4E6RA 3HXVA 1VQ5Q 1QVGP 1VQ9Q 3GF5A 5GJWB 4H2XA 4LE9A 2R58A 3RUXA 2GTOA 1EIFA 3PTAA 1VQ6A 1X75C 2RHQB 1QKXA 1VQ7T 3A8LB 4J6YA 4IUQA 2DBMA 2FZGB 3L2UA 4G84A 4C0GA 3BY7A 3QSUA 3M59A 5GAMe 3PNWC 3A7RA 1TG0A 2EYQA 2G4CA 5CAIA 2VASA 1YJ9Q 3MQZA 3OW2A 4JJCA 3SHWA 4TVAA 11ASA 1WQ7A 3M0PA 1IGUA 4DQ2A 4M7DE 1I8FA 1C0MA 5KYNA 1UUEA 3HPWA 3WVDB 3HFZB 4AG2C 2E3HA 3KFUA 3SWNB 2EYZA 5D6WA 1VQ7Q 3THKA 4M7DA 3VS5A 2X4YA 2CH4W 2PMEA 4M7DG 1D0YA 1EIYB 2XU8A 2EGAA 2LNVA 1YHQQ 5GMKh 3MEUA 3MHXA 3O5ZA 4ME7A 3ULRB 1VQ5A 4M4ZA 5CK9A 3IQLA 1M2OA 4B9XA 5LJ5j 5HCKA 1WXUA 4GBQA 1M8VA 2PU9B 4LDWA 1DJ7B 1A0NB 2E6NA 5GANf 4XEMA 4CC3A 5CKDA 4PJOB 1NE8A 4YCWA 3I5RA 3WXMB 2CIMA 2F5TX 1JJ2S 4MDWA 4H2YA 2QTXA 2IPOB 1MMGA 4ZIBA 4P3OA 4XEOA 4LVLA 2A36A 4JDSA 3M4QA 1WU7A 2K57A 3QG1A 4JJNK 1Z9ZA 2DRMA 5KYWA 3PE0A 5HKCA 2LQWA 1Y96B 3WVEB 1VUBA 1ABQA 1WA7A 4M7DB 5EG2A 2QK0A 4IUUA 3CMAQ 1J5WA 4Y91A 3JCMW 1M90R 6AT1B 2DIQA 2YHTA 2BKDN 2K5IA 2VGNA 1SHGA 3LWHA 2EYXA 4X9CA 1KQSP 1B70B 1GRIA 2KY9A 3RNJA 2RK1A 3HRKA 4C92G 3OW2P 3HTZA 2GCXA 2AHJB 1TSFA 4O2DA 2ZXFA 4C92A 1OV3A 4TQFA 3CCRA 5CKEA 3REXA 5GAN8 2AKLA 4PJOA 3A8OB 5IAYA 3L2RA 4PJJA 1X2KA 3VQXA 1C0AA 1D1AA 2MMPA 5FW9A 2YDLA 3V7RA 4C8QE 1Y7XA 2MYSA 2V26A 5KNNA 4M75A 4PHCA 2JTEA 4C5EA 4B6MA 3M4PA 4M77D 1EIYA 2M9UA 3CQTA 1K73C 2DX1A 1Q86U 3QWYA 2X3WD 3MJXA 3JCMc 2VKNA 1TUGB
chains in the Genus database with same CATH topology
3UGTA 4P72A 3A31A 4M77C 3OYMA 3VQVA 2DZ9A 2V8IA 3QUIA 2X4JA 4YYEA 1WJQA 4GLKA 3CCSA 2RI3A 2EQKA 1G3TA 5I2MA 4BY6C 3HXZA 2E65A 4YDQA 3X20B 4L87A 2YLBA 3RKXA 3S3NA 1RI0A 5GAMj 5GMKi 4XAXB 3ZEHA 2LCCA 3OSSC 3HP9A 1JJCB 4II1A 4MMLA 5GANg 1B70A 3CCVA 2DXTA 2DXUA 3MEAA 3OS2A 5LJ5f 4JRKA 1VQ8A 2RD1A 4C92B 1VQNA 1Y07A 5KCHA 3OYIA 2Q5IA 2DAQA 5GAN5 2RJCA 3GIBA 2FB7A 3SB2A 3RMSA 2QEXA 4X9DA 2LTOA 4YRCA 2I4MA 4PKCC 3L2VA 2J3MA 3S3OA 4RKUE 1VQMA 3OY9A 2K5FA 4X5OA 5CR2A 3ZBDA 4M7DF 2HBPA 2ZZEA 1V29B 3CCLT 1K9MU 3HY1A 1NPPA 2XKOC 4N0AA 3ERRA 4YRTA 2JOYA 3CPFA 3VYGA 2F5KA 4C0ZA 3JB9D 2QHTA 3CXCS 2R57A 4P3PA 1W2BA 3HRUA 1G3WA 4XTYA 2D9TA 1SSFA 1XNIA 5CVIA 1PSFA 1W4SA 1VQKA 1YI2A 3CMEA 5GAN7 5KE3A 4H2VA 1NJ1A 3FLGA 4G85A 1VQ8T 4J15A 3INZA 4YROA 1E24A 3MP8A 4VUBA 4EMHA 4AH6A 2PQWA 2RHZA 2RH2A 2DPPB 4YREA 3VYHB 4C8QB 1NZ9A 4H2SA 3CCET 1M5Q1 1X01A 4RMOA 3E9IA 4HT9A 3G6ET 2LCLA 5DLQE 1VQOT 4M75D 4KUDK 4J7IA 3A8HB 4M77A 2K3YA 1YFTA 5CKHA 2LQKA 4F7UE 4CH3A 2NS6A 1G5VA 1X54A 4JLIA 1NJ6A 4A4HA 3L42A 3CCUA 5A0GA 4M77F 1BIAA 1YI2T 5F5WA 2BIVA 3LSQA 3CCJT 4QQGA 3E9FA 4LVIA 1BIBA 2JNGA 3OBYA 2EJGA 3FDRA 2VXEA 3PCOB 2E64A 3HHTB 2I2LA 3I55A 1N8RU 3OD1A 4O5VA 2FYKA 3I7FA 3E9HA 4OB0B 5A0LA 3TEEA 2DD4A 2Q7GA 2ZR3A 2ZIOA 3LLRA 3VU3C 3UWNA 3P8DA 2QQBA 1NJIU 1M90C 1EQRA 2RHIA 2E3CA 3OYYA 4WJ4A 2DD5A 3CCVT 4NOYA 2R5MA 2Y90A 2QHSA 1Q86C 2D6FA 4YRSA 4YCVA 4M78G 2P0KA 2YRVA 4XU0A 3CPWA 4GY5A 2XTIA 3L4GB 4M78A 1O75A 2LQ8A 5LJ3d 2RB6A 4HWSA 3GP8A 4P74A 3GNFB 1R8OB 1H4SA 3PZCA 3DLLA 1K8AU 3FRNA 3SWNA 4HCBA 2ZPFB 3CXCA 4IURA 4LD6A 2VV5A 1YBYA 5CQYA 2EJFA 4LDXA 4C92D 4ZGEB 4BE0A 3G4ST 4PJOD 2KDSA 5E3IA 5J3BA 2DXCA 3SFMA 4RG8A 4JRPA 2M0OA 1YCYA 1ZBXA 3LW5E 3IKMB 4UP9A 2XG8D 2DIGA 3CD6A 1OI1A 4JRIA 5HY6A 4TWAA 1D3BA 4QW2A 5A0DA 2A8EA 5IT9E 5C6SA 3G71A 1GXIE 2DU7A 2CZ6B 3PMIA 4CS4A 1B8AA 4F7UG 4C5HA 2DEQA 4M78F 1YJWA 3CCRT 1O9SA 4P3NA 4WF2A 3ER0A 2DK3A 1G51A 2XD0A 3A7UA 2LT4A 4C5IA 4P72C 2RHXA 3JCMP 3TU4K 1XQHA 2DZCA 2L89A 5GANj 1HK9A 3UGQA 3QO5A 1H641 3JCMf 4EMKC 3HRSA 3CMAT 2LC4A 3FIFA 1ASZA 2QDYB 4UP8A 4C8QD 1MHNA 2ALYB 2Y4YA 2K4YA 4HWRA 2RHSB 4M75B 4QVDA 3H8ZA 4C8QA 1YJNA 2CZ1B 2VYTA 4M7AF 4E7IA 1G3YA 3CCQT 2DQ0A 3PFSA 3G7ZA 2LDMA 1WYDA 4PJOC 2Q7EA 4NS5A 4OMFB 2B8AA 2ZZDA 1KMNA 1QP2A 4L6V5 5GANh 2FVUA 4ZGJB 1HTTA 4QVZA 1WQWA 1YIJT 2I4NA 4BD3A 2DVEA 3V8LA 3C94A 4DPGA 2RK2A 1W2BS 3BDUA 4MZTA 3L2QA 3C4SA 3V8JA 1FXXA 3O8VA 3HXYA 4FM4B 4BB7A 4MMKA 2JTMA 4ZN1A 3QDRB 1M1KC 2LT1A 2DXBA 4M75E 1NNHA 2NLUA 2ARUA 2EWNA 1KQ1A 4R55A 3FC3A 2AKWB 3S6WA 4LNSA 4CS2A 1NYRA 3AHUA 3HXWA 2L3RA 3CCJA 3IKLA 2HQEA 1VQPT 5FU6C 4WJ3M 3JCMb 4PJOE 5CO7A 3VV0A 4N4IA 2WSCE 1YIJA 3QO8A 2GF7A 4ZTFA 1VQ4A 3C12A 1NYQA 5C0MA 4FIBA 4H2WA 1UB4A 4HKEA 3SDZA 4PG3A 3LYIA 1OYXA 3G71T 4BDZA 1N6AA 4YP0A 5D6XA 2Q5HA 3QZ9B 2CS7A 5A2QE 2RM4A 2ZT7A 1QE0A 3P8HA 3CD6T 3HRIA 1JBMA 4UPAA 2O4XB 3P8YA 3E1SA 3HXUA 1VQ9A 4XK8E 3VQWA 4OGEA 2F69A 2DDZA 3URGA 3DKMA 2MI6A 1N27A 4K87A 2RHUA 3HY0A 4LVJA 4OP0A 2IY5B 3QO7A 1M1FA 1U8RA 4NCXA 4J6XA 4ATOA 4OF1A 5J39A 4M78E 1PYSA 3VQYA 5GMKl 5LJ3e 3QZ5B 3QYGB 4KT0E 4RCBA 1Z7MA 4LVMA 3JB9F 4QVCA 2J3LA 4YPFA 1FWZA 1W66A 4P74C 2Y4XA 4TVAB 2HAXA 3CBPA 3M4YA 5GMKj 2AMCB 2EAYA 4L5GA 1SETA 2Q7HA 1KG1A 4LDYA 3M57A 5CCAA 2LRQA 1VQ7A 2CJ9A 4YRJA 3QXEB 2MWOA 3PCOA 4P73C 4BW9A 1UGRB 4IUTA 3UH0A 3JCMd 3L2WA 2OTLT 1NPRA 2P0QA 4IUVA 2E12A 5I2SA 3GPLA 2XK0A 4K88A 1M1GA 3VUZA 1B34B 4IKFA 2ZNIA 4Q6GA 3HXXA 3LGFA 5GMKe 3HFVA 3ICAA 3CCMA 3NELA 3A32A 1YFSA 3JCMX 4EMGA 3G1ZA 1PSEA 1EFWA 2X4XA 2C7IA 4XTZA 4BI4A 5LJ3f 3N5BB 4H02A 2V8JA 2CZ0B 4P71A 4YRKA 1VQOA 2L8DA 4KUIA 3W3SA 4KR2A 2OTJA 2WACA 4JS4A 3A5ZA 2ARTA 2C06A 2FL7A 4KULA 2AMCA 3G6EA 1UGPB 4P5NA 2E70A 2GFAA 5J26A 3CCEA 3BFMA 1VQLA 3CMET 2O01E 3JCMe 4E7LA 1H3ZA 3HSBA 3OYJA 3PIOA 4PJOF 4DOVA 3LH0A 2V8KA 1M9SA 3OS5A 2K3XA 4UC4A 3JB9H 2C8MA 2P5IA 4MZMA 2LX9A 3E9GA 1XTDA 2BUDA 4OLFA 3J7AF 2EFIA 1FYFA 3TCJA 4PNOA 4YRRA 2ZZFA 1IREB 2EQMA 3CCLA 5LJ5g 1OZ3A 4FT2A 1HXDA 3JB9J 5FU6B 3DLMA 1YHQT 2VC8A 4F7UB 1WNLA 3HRTA 5LJ3j 5C51B 4MDXA 3M54A 3JB9I 4J6WA 2XGTA 2EL9A 1Q7YU 4CH5A 1G5HA 4EMKB 1ADYA 4XU3A 1BI2A 1USYA 1L0WA 2WSFE 1WGSA 2ZCEA 5GAOn 2QXFA 4CRIA 1WJRA 3JB9G 2VGMA 1BKBA 4M75C 2GFUA 4R56A 2G3RA 2X4WA 3CC4A 5AYFA 4XTVA 4C0FA 2ZNJA 1S72A 1H4TA 5FU7B 3OYLA 1N8RC 2ALYA 1BI1A 1WJSA 2EKOA 3ZFJA 1QVFS 3EAEA 4C92C 3QKJA 2MAMA 1RIQA 4Z02A 4E7JA 4YRIA 2DJZA 2QQ9A 4IUPA 1YJNT 1KOGA 3OA6A 5GAOr 3WQZA 1VQ6T 1UEBA 2P4TA 4HT8A 4Q15A 5DLOA 1B76A 4M7AG 1Q81U 3L4GA 3VBBA 4BWAA 1N9SA 2PVDB 1X55A 1YJ9T 3CC2A 3CCMT 4F7UA 5GAOl 1YITT 1EOVA 3GNGA 3OMGA 3RIRA 4P75A 1G5IA 2FHDA 3CC2T 3A7AA 4H2UA 1LNXA 4RDXA 4KQEA 1X6OA 4M77G 1N9WA 3RKWA 4LVKA 4ZTZB 4A4KA 5GMKm 5LJ3h 1Q81C 4O6JA 2JUFA 4JS5A 4M78C 4YCUA 4HWTA 5DY9A 3KXTA 4A4EA 1LYLA 1OZ2A 5CKFA 1BBUA 5FLXE 4C8QF 2CKKA 5GAN2 2A7YA 3META 1Q82C 4F7UF 5FROA 3RF1A 1E22A 2HNIA 3I56T 5IN1A 2ODRD 2ZR2A 5C52B 3VJPA 2DTHA 4N0AC 3BW1A 4BACA 4E7HA 3QO3A 4M77E 4ZN3A 1KQSS 4RQFA 3IALA 3PT9A 2QA4T 4HCZA 1QVPA 2K2VA 4M75G 1ATIA 4XTUA 1LOJA 3L1AA 3JCMg 4N4GA 3QTCA 1UGSB 4V2SA 2ZPGB 3M58A 2R5AA 4M7DC 2HQXA 2ZTGA 2QA4A 5GAOp 5GAMd 2XIDA 1BI0A 5GAMg 2JTFA 3CMAA 1NJ2A 4XU2A 4HA8A 1G3SA 5KCOA 4M7AA 4FSXA 1YHQA 2DQ3A 3M55A 2CZ7B 4A54A 1EVLA 3DB3A 2GQVA 1JJCA 4M7AC 1VQ4T 4WI1A 2IY5A 2JN0A 3P8TA 4C5GA 4EDUA 1M90U 1ASYA 3QBYA 2E10A 4OB3B 1VQPA 4MZPA 3MCAB 3V7CA 1YGBA 4NL2A 1QP3A 4OGCA 2XDBA 2QHUA 3LC0A 1YITA 3NETA 4A4FA 1H4QA 4JUVA 1WPYA 1KQSA 3A8MB 2KAFA 1YJ9A 1B7YA 3OMCA 2ZINA 3SD4A 4HWPA 4M78D 3Q1JA 5GAOq 5C53B 3CBMA 1E1TA 4TVYA 3QHSA 3L2ZA 2CJAA 4EMKA 3S3MA 5GANd 3MEVA 2OTJT 4BDYA 3FJPA 4TVRA 3SWNC 3OYAA 5LJ5e 2RA2A 2ODRC 1I4K1 3G4SA 2KSSA 3DB4A 1MGQA 3X28B 4A4GA 1QF6A 1YB3A 3ME9A 3LGLA 2XICA 3V8KA 3CCUT 3JCMQ 2QQSA 3MF1A 3UFGA 3QJ6A 4ELYC 1KC8U 5M9OA 2EQUA 3JSCA 2MWPA 4D6WA 3CCQA 4OVAA 1X2GA 3F70A 2EQJA 4E51A 3I56A 1M1KU 3M56A 2E6ZA 4N4HA 1K9MC 3A74A 3RERA 4PL6A 3QYHB 3NEMA 3CEYA 1JJ2A 1Y71A 3PMTA 3HKSA 4TTVA 2ZT6A 2KVQG 4Q5WA 3V7SA 3QNEA 3OYKA 1SRYA 1IZ6A 4CH4A 4CI0C 3NTIA 2RI2A 2OAUA 3LX7A 3M5AA 3OSVA 2X35A 3A5ZB 1B7YB 2O4XA 2DO3A 2I4OA 4P73A 4PLLA 1VIFA 1KD1C 4C8QG 1I81A 2L5QA 4QQDA 2ZT8A 3M4GA 3E19A 2I4LA 2ZCFB 3NFCA 1USYC 2PMFA 5KE2A 3I55T 2ZZGA 4LDVA 1NJ8A 3REUA 2ZT5A 1QW1A 3CC7A 4TVWA 4J5YA 1Q7YC 3DSQA 3OQ5A 3UDCA 4M7AE 1U1TA 2IG0A 2ARSA 1S72T 2P0LA 1PYSB 1VQLT 3GOXA 4M78B 2VXFA 2QQAA 1KD1U 2KMTA 1X56A 5FRMA 3LSSA 3NENA 1U1SA 4YRPA 2P0PA 4CS3A 4ELZC 5FU7C 3JCMV 1Y96A 1VQNT 4BE1A 2YLCA 3OYNA 1Q82U 4LDUA 1SERA 5HK3A 5HGQA 1N9RA 3CC4T 5D6YA 4YRGA 2JVVA 2RJEA 3KBGA 4DA4A 5LJ5d 1RL2A 5K1PA 1FX7A 1K8AC 4RQEA 3RL6A 2E1HA 3ASKA 4L59A 2ZPHB 1TH7A 4LD9K 1GGMA 4M7DD 2QHVA 3TREA 4M75F 3X26B 1WLEA 4OB2B 1YFRA 3TUPA 2XDDA 3JCMJ 5KH6A 1H4VB 1KQ2A 1BI3A 3LWIA 4YRQA 3OYBA 5GAOm 4M7AB 1KMMA 1B34A 3CC7T 2CJBA 1AHJB 3RGLA 2CYZB 4P71C 3OYHA 2VUBA 2ZGWA 3P8VA 5CQXA 5GAMf 4C92F 4M7AD 1UGQB 3HFNA 4RG2A 3OBWA 1ADJA 3RMQA 1XOVA 4YRMA 4BE2A 4HT4A 4H2XB 2ZIMA 3A5YA 4ZTJA 2RO0A 1JB0E 2K5LA 3NTHA 2IVWA 2AKWA 4TQDA 4RCCA 3HL8A 3MEYA 3EFRA 3QJYA 1VQMT 4ZGDB 5LJ5h 4A53A 4HWOA 3NTKA 5LJ3g 5GAN4 2QEXT 3VKIA 4XTXA 4E47A 2EJ9A 3FEOA 3M53A 4YRFA 3TEHB 4FL6A 3BDLA 5L8RE 2EIFA 3MF2A 5HK0A 3R07A 3H6ZA 3BJUA 4HCCA 3GLXA 4UP7A 4J8OA 4BI3A 2XI9A 3EFSA 3C95A 4JLGA 5LL6S 3PGGA 3KUFA 1NJIC 3MEWA 2D0QB 4YRNA 4ZTUB 2HD0A 2E5AA 2JZ2A 3HFOA 1QVFA 3MP1A 2A3LA 1K73U 4FT4A 2CGHA 4BI8B 1ZHIA 3FB9A 2DKGA 1VQ9T 2KK4A 2E5QA 4Y28E 1QVGS 3OS0A 2RI5A 2RJFA 3OS1A 3OYGA 1BYMA 1KHCA 1BBWA 4PLIA 3QIIA 5GANe 4XQ3A 2RJDA 3JRZA 2ZPBB 5CKBA 5DM7R 12ASA 5CIUA 4KBMB 3R6OA 1P92A 2OTLA 2H3JA 1KHIA 3OYCA 3MP6A 5ELNA 3CPWS 1YJWT 1Z7NA 3IG2A 1EVKA 2KQWA 3TEHA 2XDPA 1SESA 3OW2S 2WSEE 1VQKT 2MF2A 4KR3A 3UT1A 4XTWA 5K1XA 1I5LA 4X34A 2DTOA 3OYDA 2LVMA 4K86A 2M16A 3QPHA 5GAN6 1IL2A 3JAME 1M4ZA 4DOWA 3PIPA 4CH6A 2E41A 4QQ6A 3RACA 2RHYA 5ELOA 4BUGA 3RKYA 4P75C 1QVGA 2PUKB 4M77B 5GAN3 2DTIA 1VIEA 2PVGB 2PUOB 1D3BB 4C8QC 4EO4A 2PVOB 1JRIA 1LJOA 4RMFA 1KC8C 4E7KA 3A8GB 5FRNA 2DU5A 2QQRA 4PJOG 3VUBA 3P8BB 4H2TA 3OB9A 4YTLA 4J7FA 4JRQA 3T9NA 3J80E 4BY6B 2ZPEB 4C0DB 1VQ5T 2ZPIB 4OB1B 3TEGA 5GAMh 2RHQA 2M1HA 4FU6A 4C0DC 3X24B 4XU1A 1ZQ1A 3M9QA 3MO8A 4C92E 2QI2A 3CMQA 1NJ5A 3OYEA 4YRLA 3X25B 1VQZA 3RESA 3CBOA 3OYFA 3JCMh 2XHCA 4EPCA 4NL3A 3HFZA 3CCST 4HVCA 2RHSA 1X2HA 4B9WA 1HC7A 3UPUA 3J81E 5I21A 1E1OA 4EX5A 4J83A 3HXVA 3GF5A 4H2XA 2R58A 3RUXA 1EIFA 3PTAA 1VQ6A 1X75C 2RHQB 1VQ7T 3A8LB 4J6YA 4IUQA 3L2UA 4G84A 4C0GA 3BY7A 3QSUA 3M59A 5GAMe 3PNWC 3A7RA 2EYQA 2G4CA 5CAIA 3MQZA 3OW2A 4TVAA 11ASA 1WQ7A 4DQ2A 4M7DE 1I8FA 3HPWA 3WVDB 3HFZB 3KFUA 3SWNB 5D6WA 4M7DA 2X4YA 2PMEA 4M7DG 1EIYB 2XU8A 2LNVA 5GMKh 3MEUA 3MHXA 4ME7A 1VQ5A 5CK9A 4B9XA 5LJ5j 1M8VA 2PU9B 4LDWA 1DJ7B 2E6NA 5GANf 4XEMA 5CKDA 4PJOB 1NE8A 4YCWA 3WXMB 2CIMA 2F5TX 1JJ2S 4MDWA 4H2YA 2QTXA 4ZIBA 4P3OA 4XEOA 4LVLA 3M4QA 4JDSA 1WU7A 2K57A 3QG1A 4JJNK 5HKCA 1Y96B 3WVEB 1VUBA 4M7DB 5EG2A 4IUUA 1J5WA 4Y91A 3JCMW 2DIQA 2YHTA 2BKDN 2K5IA 2VGNA 3LWHA 4X9CA 1B70B 2KY9A 2RK1A 3HRKA 4C92G 3HTZA 2GCXA 2AHJB 4O2DA 2ZXFA 4C92A 4TQFA 3CCRA 5CKEA 3REXA 5GAN8 4PJOA 3A8OB 5IAYA 3L2RA 3VQXA 1C0AA 2MMPA 3V7RA 4C8QE 1Y7XA 5KNNA 4M75A 4PHCA 4C5EA 3M4PA 4M77D 1EIYA 2M9UA 1K73C 1Q86U 3JCMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGT A;  4P72 A;  1ADJ A;  3A31 A;  4M77 C;  1RIQ A;  4YRI A;  4M7A F;  4YRM A;  2DJZ A;  1KOG A;  4H2X B;  3VQV A;  2DZ9 A;  2ZIM A;  3A5Y A;  5GAO r;  3QUI A;  3WQZ A;  2AKW A;  4TQD A;  4YYE A;  4HT8 A;  4RCC A;  2DQ0 A;  4Q15 A;  3MEY A;  3EFR A;  1B76 A;  4M7A G;  1WYD A;  4PJO C;  3L4G A;  3VBB A;  4BWA A;  1N9S A;  5LJ5 h;  2Q7E A;  4A53 A;  1X55 A;  4HWO A;  5LJ3 g;  5GAN 4;  4XTX A;  4F7U A;  3HXZ A;  5GAO l;  1KMN A;  2E65 A;  2EJ9 A;  4YDQ A;  5GAN h;  1EOV A;  1HTT A;  4L87 A;  4YRF A;  3TEH B;  1WQW A;  2YLB A;  3RKX A;  2I4N A;  3RIR A;  3MF2 A;  2DVE A;  3V8L A;  4P75 A;  5GAM j;  3R07 A;  1G5I A;  4DPG A;  3BJU A;  4UP7 A;  3A7A A;  4H2U A;  1LNX A;  4RDX A;  3BDU A;  5GMK i;  3V8J A;  3EFS A;  4KQE A;  4M77 G;  1JJC B;  3HXY A;  4MML A;  1N9W A;  3RKW A;  4MMK A;  5GAN g;  4ZTZ B;  3PGG A;  1B70 A;  2DXT A;  2DXU A;  5GMK m;  5LJ3 h;  4M75 E;  5LJ5 f;  4JRK A;  4YRN A;  1NNH A;  4ZTU B;  2ARU A;  2E5A A;  2EWN A;  1KQ1 A;  2RD1 A;  4C92 B;  2AKW B;  3HFO A;  4LNS A;  4M78 C;  1NYR A;  4CS2 A;  3AHU A;  3HXW A;  4YCU A;  2Q5I A;  5DY9 A;  4HWT A;  3IKL A;  5GAN 5;  1LYL A;  3GIB A;  2CGH A;  2FB7 A;  1BBU A;  4WJ3 M;  3FB9 A;  2DKG A;  3SB2 A;  4C8Q F;  5GAN 2;  4X9D A;  3JCM b;  4YRC A;  4PJO E;  2I4M A;  4F7U F;  2J3M A;  3RF1 A;  1E22 A;  3QO8 A;  2HNI A;  2ODR D;  2ZR2 A;  4X5O A;  5C52 B;  2DTH A;  4N0A C;  3BW1 A;  1BBW A;  4M7D F;  1NYQ A;  3QO3 A;  4M77 E;  4RQF A;  3IAL A;  2ZZE A;  5GAN e;  4XQ3 A;  3HY1 A;  4H2W A;  4M75 G;  1ATI A;  4XTU A;  4PG3 A;  12AS A;  1LOJ A;  3L1A A;  4N0A A;  3JCM g;  3ERR A;  4YRT A;  3QTC A;  4YP0 A;  2Q5H A;  4V2S A;  2RM4 A;  2ZT7 A;  3JB9 D;  2QHT A;  1QE0 A;  5ELN A;  4P3P A;  3HRI A;  1Z7N A;  1JBM A;  4UPA A;  4XTY A;  4M7D C;  2ZTG A;  3IG2 A;  3P8Y A;  1EVK A;  5GAO p;  5GAM d;  3HXU A;  3TEH A;  5GAM g;  1SES A;  1NJ2 A;  4XU2 A;  4HA8 A;  4KR3 A;  4M7A A;  4XTW A;  3VQW A;  5K1X A;  1I5L A;  5GAN 7;  2DTO A;  4H2V A;  2DQ3 A;  1NJ1 A;  4G85 A;  2DDZ A;  4K86 A;  4A54 A;  4J15 A;  3INZ A;  4YRO A;  1E24 A;  1EVL A;  5GAN 6;  4EMH A;  1IL2 A;  4K87 A;  3HY0 A;  4AH6 A;  1JJC A;  4OP0 A;  4M7A C;  2IY5 B;  3QO7 A;  4CH6 A;  2E41 A;  4YRE A;  4WI1 A;  4C8Q B;  3RAC A;  4NCX A;  5ELO A;  2IY5 A;  2JN0 A;  3RKY A;  4P75 C;  4J6X A;  4H2S A;  1M5Q 1;  1X01 A;  3E9I A;  3P8T A;  4HT9 A;  4M78 E;  1PYS A;  4M77 B;  5GAN 3;  1ASY A;  3VQY A;  2DTI A;  4M75 D;  5GMK l;  5LJ3 e;  4M77 A;  2E10 A;  1YFT A;  3V7C A;  1YGB A;  4RCB A;  1Z7M A;  4NL2 A;  1D3B B;  3JB9 F;  4C8Q C;  4QVC A;  2J3L A;  4YPF A;  4EO4 A;  2QHU A;  3LC0 A;  1W66 A;  3NET A;  4F7U E;  4P74 C;  1JRI A;  1H4Q A;  1LJO A;  4JUV A;  1WPY A;  4CH3 A;  4RMF A;  4TVA B;  1X54 A;  1B7Y A;  2ZIN A;  4JLI A;  2DU5 A;  1NJ6 A;  4HWP A;  4PJO G;  5GMK j;  4M78 D;  2AMC B;  2EAY A;  4H2T A;  4M77 F;  5GAO q;  5C53 B;  1SET A;  1BIA A;  2Q7H A;  5F5W A;  3LSQ A;  1E1T A;  4TVY A;  3QHS A;  3L2Z A;  2CJA A;  4EMK A;  5GAN d;  3TEG A;  3FJP A;  5GAM h;  2RHQ A;  3SWN C;  5LJ5 e;  2CJ9 A;  4YRJ A;  1BIB A;  2RA2 A;  3PCO A;  4P73 C;  4XU1 A;  2ODR C;  1I4K 1;  4BW9 A;  2EJG A;  3UH0 A;  3JCM d;  2VXE A;  4C92 E;  3PCO B;  2E64 A;  3CMQ A;  1MGQ A;  1NJ5 A;  2I2L A;  1QF6 A;  1YB3 A;  3OD1 A;  4YRL A;  2FYK A;  3V8K A;  3I7F A;  1VQZ A;  3RES A;  3JCM Q;  3E9H A;  3MF1 A;  3UFG A;  3JCM h;  4K88 A;  4NL3 A;  3HFZ A;  1B34 B;  2Q7G A;  4HVC A;  2ZR3 A;  2ZIO A;  2ZNI A;  4Q6G A;  3VU3 C;  2RHS A;  3HXX A;  1X2H A;  1HC7 A;  5GMK e;  1X2G A;  3HFV A;  3ICA A;  4E51 A;  3NEL A;  3A32 A;  1YFS A;  5I21 A;  1E1O A;  1EQR A;  3A74 A;  3JCM X;  4EX5 A;  3RER A;  2E3C A;  4EMG A;  3HXV A;  4WJ4 A;  3NEM A;  3G1Z A;  1EFW A;  2C7I A;  4XTZ A;  5LJ3 f;  4H2X A;  4NOY A;  3RUX A;  2Y90 A;  2QHS A;  4TTV A;  4YRS A;  4H02 A;  4YCV A;  2ZT6 A;  2RHQ B;  4M78 G;  3V7S A;  3QNE A;  4P71 A;  4YRK A;  4XU0 A;  1SRY A;  4J6Y A;  2XTI A;  3L4G B;  4G84 A;  4M78 A;  3W3S A;  3BY7 A;  3QSU A;  4KR2 A;  5LJ3 d;  4CH4 A;  2RB6 A;  4HWS A;  5GAM e;  3A7R A;  4P74 A;  2G4C A;  5CAI A;  3A5Z A;  2ART A;  4TVA A;  11AS A;  1H4S A;  3PZC A;  1WQ7 A;  4DQ2 A;  1B7Y B;  4M7D E;  2I4O A;  4P73 A;  1I8F A;  2AMC A;  4C8Q G;  3HFZ B;  3SWN A;  1I81 A;  2ZT8 A;  3M4G A;  2I4L A;  3KFU A;  3SWN B;  3BFM A;  4M7D A;  1USY C;  3JCM e;  2PMF A;  3HSB A;  2EJF A;  2ZZG A;  2PME A;  1NJ8 A;  4C92 D;  4M7D G;  4PJO F;  3REU A;  1EIY B;  2ZT5 A;  4PJO D;  5GMK h;  4TVW A;  4J5Y A;  5E3I A;  3JB9 H;  2C8M A;  3DSQ A;  2P5I A;  4M7A E;  5LJ5 j;  1U1T A;  2ARS A;  4OLF A;  1M8V A;  2P0L A;  1PYS B;  5GAN f;  4XEM A;  1FYF A;  4M78 B;  2VXF A;  1YCY A;  4PNO A;  4YRR A;  1X56 A;  3IKM B;  2ZZF A;  4PJO B;  4YCW A;  3LSS A;  3NEN A;  5LJ5 g;  4UP9 A;  1U1S A;  1HXD A;  4JRI A;  3JB9 J;  2CIM A;  4YRP A;  4TWA A;  4H2Y A;  1D3B A;  2QTX A;  4ZIB A;  2VC8 A;  4P3O A;  4XEO A;  3M4Q A;  4F7U B;  1WNL A;  2K57 A;  1WU7 A;  4CS3 A;  3JCM V;  1Y96 A;  5LJ3 j;  2DU7 A;  5C51 B;  2YLC A;  1SER A;  3JB9 I;  4CS4 A;  1Y96 B;  1B8A A;  5HGQ A;  4J6W A;  4F7U G;  2XGT A;  4M7D B;  2DEQ A;  4M78 F;  1N9R A;  2EL9 A;  4YRG A;  1J5W A;  4Y91 A;  3JCM W;  4P3N A;  4WF2 A;  4CH5 A;  1G5H A;  4EMK B;  5LJ5 d;  5K1P A;  1ADY A;  4XU3 A;  2YHT A;  1G51 A;  1USY A;  4RQE A;  3RL6 A;  1L0W A;  2E1H A;  2ZCE A;  1TH7 A;  3A7U A;  4P72 C;  4X9C A;  1B70 B;  5GAO n;  3JCM P;  1GGM A;  3HRK A;  2DZC A;  4C92 G;  4M7D D;  5GAN j;  2QHV A;  3HTZ A;  4M75 F;  1WLE A;  1HK9 A;  1YFR A;  3TUP A;  3JCM J;  3UGQ A;  3QO5 A;  1H64 1;  3JB9 G;  3JCM f;  1H4V B;  4O2D A;  4M75 C;  2ZXF A;  4C92 A;  1KQ2 A;  4EMK C;  4TQF A;  4YRQ A;  5GAO m;  3REX A;  5GAN 8;  3FIF A;  1ASZ A;  4M7A B;  4PJO A;  4UP8 A;  1KMM A;  4C8Q D;  1B34 A;  3VQX A;  1C0A A;  4XTV A;  3V7R A;  4C8Q E;  2ALY B;  2CJB A;  2ZNJ A;  3RGL A;  4HWR A;  2RHS B;  5KNN A;  4M75 A;  4PHC A;  4P71 C;  1H4T A;  2ALY A;  3M4P A;  2ZGW A;  4M77 D;  3P8V A;  5GAM f;  4C92 F;  4M75 B;  1EIY A;  4M7A D;  4QVD A;  3HFN A;  3JCM c;  4C8Q A;  4C92 C; 
#chains in the Genus database with same CATH topology
 3UGT A;  1N8R R;  2HDA A;  4P72 A;  3A31 A;  4M77 C;  2ROT A;  3OYM A;  3VQV A;  2DZ9 A;  2V8I A;  3QUI A;  2X4J A;  2DYB A;  2JW4 A;  4YYE A;  1WJQ A;  1EZZ B;  4GLK A;  3CCS A;  1IHV A;  1YI2 Q;  2RI3 A;  3CCV Q;  2HQH A;  2EQK A;  1G3T A;  1RAF B;  2QGF B;  1T0J A;  3EGU A;  1B7T A;  1W2B P;  5I2M A;  4ANJ A;  3TQ7 P;  4BY6 C;  3HXZ A;  4DBQ A;  4KH0 B;  2E65 A;  4YDQ A;  3X20 B;  4L87 A;  1QCN A;  2YLB A;  1YCS B;  3RKX A;  1AT1 B;  3S3N A;  1RI0 A;  3HTR A;  1H8K A;  5GAM j;  2EYY A;  4J9I A;  2ED0 A;  2KGT A;  4LNP A;  5GMK i;  2CP5 A;  2JS0 A;  4XAX B;  3ZEH A;  2LCC A;  3OSS C;  1Q81 R;  3HP9 A;  2X9H A;  1JJC B;  1MND A;  4II1 A;  4MML A;  5GAN g;  3REA B;  3H9N A;  1B70 A;  3CCV A;  2DXT A;  2DXU A;  3MEA A;  3OS2 A;  5LJ5 f;  4JRK A;  4FYY B;  3RR6 A;  1VQM Q;  2H3E B;  4RTU A;  4K11 A;  1K8A R;  1VQ8 A;  2RD1 A;  4C92 B;  1VQN A;  1Y07 A;  5KCH A;  3OYI A;  2Q5I A;  2DAQ A;  3CCS Q;  5GAN 5;  3QWX X;  2RJC A;  3GIB A;  2FB7 A;  3SB2 A;  3RMS A;  5IXB A;  2QEX A;  4X9D A;  2LTO A;  4YRC A;  2I4M A;  4PKC C;  2MIO A;  3L2V A;  2J3M A;  3S3O A;  4RKU E;  1T3S A;  4D8D A;  1VQM A;  1M2V B;  4PJL A;  3OY9 A;  2K5F A;  3CC2 Q;  5KYX B;  4X5O A;  5CR2 A;  3ZBD A;  4M7D F;  1BBZ A;  4PFO A;  2HBP A;  1ZSZ B;  2COZ A;  2ZZE A;  9ATC B;  4E2F B;  3CC4 Q;  1V29 B;  3CCL T;  1K9M U;  3HY1 A;  1NPP A;  2XKO C;  4J9E A;  4N0A A;  2W0Z A;  3ERR A;  4YRT A;  2JOY A;  3CPF A;  3VYG A;  2F5K A;  4C0Z A;  2CT3 A;  1SSH A;  3JB9 D;  1UFF A;  2QHT A;  3CXC S;  2R57 A;  4P3P A;  1W2B A;  3HRU A;  1G3W A;  4XTY A;  1MV0 B;  4AG1 C;  2D9T A;  1SSF A;  1XNI A;  2FPE A;  5CVI A;  1PSF A;  5IH2 A;  2EKH A;  1TUC A;  1X6B A;  1W4S A;  2A08 A;  1VQK A;  1YI2 A;  3G6E Q;  1K9M R;  1E6G A;  2M51 A;  3CME A;  1PNJ A;  5GAN 7;  5KE3 A;  3A98 A;  4H2V A;  1NJ1 A;  3FLG A;  4G85 A;  5EC7 A;  1VQ8 T;  4J15 A;  3INZ A;  4YRO A;  1E24 A;  1SRM A;  3U23 A;  3MP8 A;  2AKK A;  4VUB A;  4EMH A;  5KYX A;  1ZX6 A;  4AH6 A;  2PQW A;  3M0Q A;  2RHZ A;  4DBF A;  1FMK A;  2RH2 A;  2DPP B;  4YRE A;  3VYH B;  1W6X A;  1BK2 A;  4C8Q B;  1NZ9 A;  4H2S A;  3CCE T;  1M5Q 1;  1X01 A;  4RMO A;  3E9I A;  4HT9 A;  3G6E T;  2LCL A;  5D7U A;  5DLQ E;  2CDT A;  1VQO T;  4M75 D;  4KUD K;  4J7I A;  3A8H B;  2A28 A;  2KEA A;  4M77 A;  2K3Y A;  1IB8 A;  2EVR A;  1YFT A;  5CKH A;  1HYO A;  1QCO A;  1OQK A;  2LQK A;  4OMN A;  4F7U E;  3EH1 A;  1JO8 A;  4CH3 A;  2NS6 A;  2CP6 A;  2DE0 X;  1G5V A;  2KI7 A;  1X54 A;  4A63 B;  4JLI A;  1OU8 A;  1NJ6 A;  4A4H A;  3L42 A;  3CCU A;  1GCQ A;  5A0G A;  4M77 F;  1BIA A;  1PCX A;  1AEY A;  1YI2 T;  5F5W A;  1VQO Q;  2BIV A;  3LSQ A;  3CCJ T;  1OUL A;  4QQG A;  1RAE B;  3E9F A;  4LVI A;  1AOJ A;  1BIB A;  2KRM A;  1YIT Q;  1CKA A;  1NG2 A;  2JNG A;  3EFO A;  3OBY A;  2EJG A;  2C0T A;  1SF9 A;  3FDR A;  2VXE A;  3PCO B;  2E64 A;  3HHT B;  3H0H A;  3M0S A;  2I2L A;  3I55 A;  2O9V A;  1N8R U;  3OD1 A;  2W10 A;  4O5V A;  4RTY A;  2FYK A;  3I7F A;  1FMV A;  1PD1 A;  1GFD A;  3E9H A;  1IGQ A;  1OOT A;  4OB0 B;  5A0L A;  3TEE A;  2DD4 A;  3I5S A;  2Q7G A;  1GBR A;  2RPN A;  2ZR3 A;  2ZIO A;  2NUT B;  3LLR A;  3VU3 C;  4WCI A;  3UWN A;  3P8D A;  2QQB A;  4RTV A;  1NJI U;  1M90 C;  1PRL C;  3QDF A;  1EQR A;  2RHI A;  2J06 A;  2E3C A;  3OYY A;  4WJ4 A;  2DD5 A;  2RF0 A;  3CCV T;  4NOY A;  2R5M A;  2Y90 A;  2QHS A;  1Q86 C;  2D6F A;  4YRS A;  4AFZ C;  4YCV A;  4M78 G;  2P0K A;  2YRV A;  3CCQ Q;  4RUG A;  4XU0 A;  3CPW A;  2ABL A;  4GY5 A;  1TXQ A;  2XTI A;  3L4G B;  4M78 A;  1MUZ A;  1O75 A;  1X6G A;  1VOM A;  2LQ8 A;  5LJ3 d;  2RB6 A;  1I1J A;  1T0H A;  3VS4 A;  4HWS A;  3GP8 A;  3G4S Q;  4P74 A;  2AZS A;  3GNF B;  1R8O B;  1H4S A;  3PZC A;  1JXM A;  3DLL A;  2D8H A;  1K8A U;  1PG5 B;  2CP0 A;  3FRN A;  3SWN A;  4HCB A;  1G2B A;  2ZPF B;  3CXC A;  4IUR A;  5KYU B;  4LD6 A;  1KD1 R;  2VV5 A;  1YBY A;  5CQY A;  2EJF A;  2KR3 A;  3NGP A;  4LDX A;  1LVK A;  4C92 D;  2LX7 A;  4ZGE B;  4BE0 A;  3G4S T;  1WHG A;  1WHL A;  2OI3 A;  4PJO D;  2CUB A;  2KDS A;  5E3I A;  5J3B A;  2SRC A;  2CRE A;  2DXC A;  2ECZ A;  2RQR A;  1VQ8 Q;  1QMC A;  3SFM A;  4RG8 A;  4JRP A;  4OML A;  2M0O A;  1K0X A;  1YCY A;  1ZBX A;  3LW5 E;  2KXD A;  3IKM B;  2DLP A;  4UP9 A;  2XG8 D;  2DIG A;  3CD6 A;  1OI1 A;  4JRI A;  5HY6 A;  4TWA A;  1D3B A;  4QW2 A;  5A0D A;  2LJ1 A;  2A8E A;  5IT9 E;  2D1X A;  5C6S A;  3G71 A;  1AWO A;  1GXI E;  2JS2 A;  2DU7 A;  2CZ6 B;  3I55 Q;  1ZSZ A;  3PMI A;  4CS4 A;  1B8A A;  4F7U G;  4C5H A;  2DEQ A;  4M78 F;  2KBT A;  4JJD A;  1YJW A;  1R0B G;  3CCR T;  1O9S A;  4FW2 A;  4P3N A;  4WF2 A;  3UAT A;  3ER0 A;  1TU0 B;  4LN2 A;  1IRX A;  1ZUU A;  2AZV A;  4J9F A;  1KSW A;  2VVK A;  1ZSG A;  2DK3 A;  1G51 A;  2XD0 A;  2KT1 A;  1VQK Q;  3A7U A;  2LT4 A;  4C5I A;  4P72 C;  2RHX A;  4PK4 A;  3JCM P;  3TU4 K;  1XQH A;  1PC0 A;  2DZC A;  2L89 A;  3C0C A;  5GAN j;  1HK9 A;  3UGQ A;  3QO5 A;  1H64 1;  1KFZ A;  5I11 A;  3JCM f;  4EMK C;  1ZUY A;  3HRS A;  3CMA T;  2LC4 A;  2MOX A;  4J9B A;  3FIF A;  1SHF A;  2QDY B;  1YJN Q;  1ASZ A;  4UP8 A;  3CXC P;  4C8Q D;  1MHN A;  2ALY B;  2Y4Y A;  1VQN Q;  2K4Y A;  4HWR A;  2L3Q A;  3BE3 A;  2RHS B;  1UGV A;  3RBB B;  2HBW A;  4M75 B;  1SPK A;  4QVD A;  3H8Z A;  4C8Q A;  2QEX Q;  1M27 C;  2K6D A;  1VQ4 Q;  2HKN A;  1YJN A;  2CZ1 B;  2VYT A;  4M7A F;  4D8K A;  4E7I A;  4F16 A;  1G3Y A;  3AT1 B;  1K0S A;  4CC2 A;  1NEB A;  3EG0 A;  3CCQ T;  2DQ0 A;  3PFS A;  3G7Z A;  2LDM A;  1WYD A;  4PJO C;  2Q7E A;  2HEQ A;  4NS5 A;  1NEG A;  4OMF B;  2B8A A;  1AWX A;  2ZZD A;  1KMN A;  3PVQ A;  1QP2 A;  4L6V 5;  5GAN h;  2FVU A;  4ZGJ B;  1HTT A;  4QVZ A;  1WQW A;  2QG9 B;  3UA7 A;  1YIJ T;  2I4N A;  1D1C A;  4BD3 A;  2DVE A;  3V8L A;  1Y57 A;  2LMJ A;  1PRM C;  5AT1 B;  1E7O A;  3C94 A;  2F2V A;  4DPG A;  3EH2 A;  2RK2 A;  1MMA A;  1W2B S;  3BDU A;  4MZT A;  3L2Q A;  3C4S A;  3V8J A;  2J6K A;  1M1K R;  1EX4 A;  1FXX A;  3O8V A;  3HXY A;  4FM4 B;  4BB7 A;  2JM9 A;  4MMK A;  1GL5 A;  2JTM A;  4ZN1 A;  3QDR B;  1M1K C;  2LT1 A;  1X2Q A;  1WIE A;  2DXB A;  4M75 E;  2XMF A;  1NNH A;  2NLU A;  2X51 A;  2ARU A;  2EWN A;  1QLY A;  1KQ1 A;  4R55 A;  3FC3 A;  2AKW B;  1JJ2 P;  3S6W A;  4DEY A;  4LNS A;  1NYR A;  4CS2 A;  3AHU A;  3HXW A;  2L3R A;  3CCJ A;  3IKL A;  2HQE A;  1VQP T;  2ZAE A;  5FU6 C;  4WJ3 M;  7AT1 B;  1UHF A;  1WZO A;  3JCM b;  5CO7 A;  3VV0 A;  4PJO E;  2DL5 A;  2O88 A;  3VS7 A;  4N4I A;  2WSC E;  1YIJ A;  3QO8 A;  1UE9 A;  4PJN A;  2GF7 A;  2QDL A;  4ZTF A;  1JQQ A;  2GGR A;  1VQ4 A;  1M2V A;  3C12 A;  2KE9 A;  1NYQ A;  4ZNX A;  5C0M A;  2O31 A;  4FIB A;  3CCR Q;  1NYF A;  4H2W A;  1UB4 A;  4HKE A;  3SDZ A;  4PG3 A;  3LYI A;  1OYX A;  3G71 T;  3M0R A;  4E7Z A;  4BDZ A;  4KH1 B;  1N6A A;  2GNC A;  4YP0 A;  5D6X A;  2Q5H A;  1JU5 C;  2CS7 A;  3QZ9 B;  5A2Q E;  1RAA B;  4HVV A;  2RM4 A;  2ZT7 A;  5L23 A;  1QE0 A;  3P8H A;  3CD6 T;  3HRI A;  1JBM A;  4UPA A;  2O4X B;  3P8Y A;  3E1S A;  2CP2 A;  2OJ2 A;  3EGX A;  2DL4 A;  3HXU A;  1VQ9 A;  2K3B A;  2DM1 A;  1TUD A;  1WI7 A;  4XK8 E;  5IHK A;  8ATC B;  1WXB A;  4EIK A;  1WDX A;  3VQW A;  4OGE A;  2F69 A;  2DDZ A;  3URG A;  2YSQ A;  3DKM A;  2MI6 A;  1WYX A;  1N27 A;  4K87 A;  2RHU A;  3HY0 A;  4LVJ A;  2DL3 A;  4OP0 A;  1K76 A;  3H0I A;  3I9Q A;  5I22 A;  2IY5 B;  3QO7 A;  1M1F A;  2HL5 C;  3VS3 A;  2DEU A;  4LUD A;  4KGV B;  1U8R A;  4AFU C;  3I35 A;  1G8X A;  4NCX A;  2L0A A;  2J7I A;  4J6X A;  2AIR B;  4OF1 A;  4ATO A;  3REB B;  5J39 A;  2EQI A;  4M78 E;  1PYS A;  2L3S A;  1S72 Q;  3VQY A;  3TSW A;  5GMK l;  3GBQ A;  5LJ3 e;  2J05 A;  3QZ5 B;  3QYG B;  4KT0 E;  4RCB A;  1Z7M A;  4LVM A;  3JB9 F;  4QVC A;  1RAB B;  2J3L A;  4YPF A;  1FWZ A;  1ARK A;  1W66 A;  4P74 C;  2Y4X A;  4TVA B;  3CCM Q;  1YWO A;  2HAX A;  3CBP A;  3M4Y A;  5GMK j;  2AMC B;  2EAY A;  2HSE B;  4L5G A;  5ECA A;  1SET A;  2Q7H A;  1KG1 A;  4LDY A;  3M57 A;  2PNI A;  3EG2 A;  2YUO A;  5CCA A;  2LRQ A;  2DRK A;  1VQ7 A;  2CJ9 A;  4YRJ A;  3QXE B;  2MWO A;  3PCO A;  4P73 C;  4BW9 A;  1UGR B;  4IUT A;  3UH0 A;  4IIM A;  3JCM d;  2NYS A;  1UJ0 A;  2FO0 A;  3CC7 Q;  3L2W A;  2OTL T;  1NPR A;  3EGD B;  2P0Q A;  3TSZ A;  4IUV A;  1PM3 A;  1AWW A;  2E12 A;  5I2S A;  3GPL A;  2CSQ A;  2XK0 A;  4K88 A;  1RI9 A;  4Y92 A;  1M1G A;  3VUZ A;  1B34 B;  3EHQ A;  5KYY A;  4IKF A;  2ZNI A;  4Q6G A;  3HXX A;  3LGF A;  5GMK e;  3HFV A;  3ICA A;  3CCM A;  3NEL A;  3A32 A;  2KRN A;  3I56 Q;  1YFS A;  2GBQ A;  3JCM X;  2YXY A;  3CME Q;  4EMG A;  2OTJ Q;  4PJM A;  2DNU A;  3G1Z A;  1PSE A;  1EFW A;  3PVL A;  2X4X A;  2C7I A;  3VS1 A;  4XTZ A;  4BI4 A;  2JJ9 A;  5LJ3 f;  1VYT A;  3N5B B;  4H02 A;  2V8J A;  2CZ0 B;  4P71 A;  1GFC A;  4YRK A;  1VQO A;  3EG9 B;  2L8D A;  4KUI A;  2E3I A;  3W3S A;  2LCS A;  5IHI A;  4KR2 A;  4X1V A;  2MCN A;  2CUD A;  2OTJ A;  1YN8 A;  2WAC A;  4JS4 A;  2DIL A;  3A5Z A;  4OMO A;  2ART A;  2DFU A;  2C06 A;  2FL7 A;  1QWF A;  2YUQ A;  3VS2 A;  3TVT A;  2V1Q A;  1IHW A;  4KUL A;  2AMC A;  1PD0 A;  1UGP B;  1UTI A;  4P5N A;  3G6E A;  2E70 A;  2GFA A;  5J26 A;  2PZ1 A;  3CCE A;  1K73 R;  2P84 A;  3BFM A;  1VQL A;  2KRS A;  3CME T;  2O01 E;  3JCM e;  4E7L A;  1H3Z A;  3HSB A;  2J6F A;  2FRW A;  3OYJ A;  2F1L A;  2HZY A;  3PIO A;  1H92 A;  4PJO F;  1D0X A;  2Z0W A;  4DOV A;  3LH0 A;  2V8K A;  1M9S A;  3ZL7 C;  1H3H A;  3OS5 A;  4JPB W;  2K3X A;  5FWC A;  3M0U A;  4UC4 A;  3JB9 H;  2C8M A;  2P5I A;  4MZM A;  1QWE A;  2LX9 A;  3E9G A;  1XTD A;  2L2P A;  1M3C A;  2BUD A;  4RTW A;  3LH5 A;  4OLF A;  1Q7Y R;  3J7A F;  1TOV A;  2EFI A;  1FYF A;  3TCJ A;  4PNO A;  3UF4 A;  4YRR A;  4KGX B;  2ZZF A;  1IRE B;  2EQM A;  3CCL A;  5LJ5 g;  1OZ3 A;  4FT2 A;  1IXD A;  1HXD A;  3JB9 J;  5FU6 B;  3DLM A;  1YHQ T;  2VC8 A;  4F7U B;  1WNL A;  1M3B A;  2FZK B;  3HRT A;  5LJ3 j;  5C51 B;  4MDX A;  3M54 A;  4GLM A;  3JB9 I;  4J6W A;  2XGT A;  2EL9 A;  1Q7Y U;  1LCK A;  2A0F B;  4CH5 A;  1G5H A;  4EMK B;  2L3P A;  1ADY A;  4XU3 A;  1BI2 A;  1USY A;  1L0W A;  2WSF E;  1WGS A;  2ZCE A;  2BTT A;  1AWJ A;  5GAO n;  1Q86 R;  2RQW A;  2QXF A;  4CRI A;  2OTL Q;  2LP5 A;  1WJR A;  3JB9 G;  2DMO A;  2VGM A;  1BKB A;  4M75 C;  2GFU A;  2HMA A;  4R56 A;  2G3R A;  2X4W A;  1M3A A;  2NWM A;  3CC4 A;  4HVW A;  5AYF A;  1CKB A;  2BZ8 A;  4XTV A;  4C0F A;  1ACM B;  2ZNJ A;  4OMM A;  4FCY A;  2ROL A;  1G83 A;  4WTO B;  1S72 A;  1H4T A;  5FU7 B;  3OYL A;  1YIJ Q;  1N8R C;  2ALY A;  1E6H A;  1BU1 A;  1BI1 A;  1WJS A;  2EKO A;  3ZFJ A;  1QVF S;  3EAE A;  2QTV A;  2RNA A;  4C92 C;  2RQV A;  3VS6 A;  3QKJ A;  2MAM A;  1RIQ A;  2DJQ A;  4Z02 A;  4E7J A;  4YRI A;  2DJZ A;  4Z8A A;  2QQ9 A;  4IUP A;  1YJN T;  1KOG A;  4RTT A;  3OA6 A;  5GAO r;  3WQZ A;  1VQ6 T;  1RAI B;  1UEB A;  1S1N A;  2P4T A;  4HT8 A;  4Q15 A;  2KYM A;  5DLO A;  1B76 A;  4M7A G;  1Q81 U;  3L4G A;  3VBB A;  4BWA A;  4QT7 A;  1N9S A;  2PVD B;  2DER A;  1X55 A;  4F14 A;  1PHT A;  1YJ9 T;  3CC2 A;  1NLP C;  3CCM T;  1ZSZ C;  4F7U A;  5GAO l;  1YIT T;  1U3O A;  1EOV A;  3GNG A;  2FPF A;  3OMG A;  3RIR A;  2EBP A;  4P75 A;  1G5I A;  2FHD A;  3CC2 T;  1LPL A;  2LJ0 A;  1NBE B;  3A7A A;  4H2U A;  1LNX A;  2JM8 A;  4RDX A;  4KQE A;  1X6O A;  4M77 G;  1RAG B;  1N9W A;  3RKW A;  4LVK A;  4ZTZ B;  4A4K A;  1PWT A;  5GMK m;  5LJ3 h;  1Q81 C;  1KK7 A;  2QGG A;  3G1J A;  4O6J A;  2JUF A;  2D0N A;  4JS5 A;  2KT8 A;  4M78 C;  4YCU A;  4HWT A;  5DY9 A;  3KXT A;  4A4E A;  2PTK A;  1LYL A;  4FYW B;  1OZ2 A;  5CKF A;  1BBU A;  5FLX E;  4C8Q F;  2CKK A;  5GAN 2;  2A7Y A;  3MET A;  1Q82 C;  4F7U F;  5FRO A;  3RF1 A;  1I0C A;  1E22 A;  2HNI A;  2O9S A;  3I56 T;  5IN1 A;  2ODR D;  2ZR2 A;  1CSK A;  3NMZ C;  3CD6 Q;  3VJP A;  5C52 B;  2DTH A;  4N0A C;  3BW1 A;  4BAC A;  4E7H A;  2M02 A;  3QO3 A;  4M77 E;  4ZN3 A;  1KQS S;  4RTZ A;  1WHK A;  4RQF A;  3IAL A;  1XJW B;  3PT9 A;  2QA4 T;  4HCZ A;  1QVP A;  2K2V A;  4M75 G;  1ATI A;  4XTU A;  1LOJ A;  3L1A A;  3JCM g;  5GJV B;  4N4G A;  1D09 B;  3QTC A;  1UGS B;  4V2S A;  1MNE A;  3E2U A;  2ZPG B;  1VYV A;  1WXT A;  3M58 A;  4HXJ A;  2BE7 D;  3EGX B;  2R5A A;  4M7D C;  2HQX A;  1EFN A;  2CT4 A;  2ZTG A;  1D0Z A;  2QA4 A;  5GAO p;  1HSQ A;  5GAM d;  2XID A;  1BI0 A;  2O2O A;  1Q82 R;  1W70 A;  5GAM g;  2JTF A;  3CMA A;  1NJ2 A;  4XU2 A;  4HA8 A;  2EGC A;  4PFP A;  3H0F A;  1B07 A;  1G3S A;  5KCO A;  4M7A A;  5IXF A;  4FSX A;  1NLO C;  1YHQ A;  2DQ3 A;  3KFV A;  3M55 A;  2CZ7 B;  4A54 A;  1ZA1 B;  3RDV A;  1EVL A;  3DB3 A;  1QKW A;  1RAD B;  1OPK A;  1ZBJ A;  2GQV A;  4LUE A;  1JJC A;  4M7A C;  1VQ4 T;  4WI1 A;  3NPF A;  3G71 Q;  2IY5 A;  4CC7 A;  2JN0 A;  3M0T A;  1AZG B;  1N5Z A;  3P8T A;  4C5G A;  4EDU A;  1M90 U;  1ASY A;  3QBY A;  1UJY A;  1UDL A;  1YJW Q;  4J9C A;  2E10 A;  4OB3 B;  2LQN A;  1VQP A;  4MZP A;  3MCA B;  1FYN A;  3V7C A;  1YGB A;  4NL2 A;  1QP3 A;  1T3L A;  4OGC A;  2XDB A;  2QHU A;  3LC0 A;  1YIT A;  3NET A;  1RLQ C;  4A4F A;  2GTJ A;  1H4Q A;  4JUV A;  1WPY A;  1KQS A;  2F2X A;  3A8M B;  2KAF A;  1YJ9 A;  1B7Y A;  3OMC A;  1VQ6 Q;  2ZIN A;  3SD4 A;  4HWP A;  4M78 D;  3Q1J A;  5GAO q;  2NUP B;  1I5O B;  1AVZ C;  5C53 B;  3CBM A;  3CCU Q;  1E1T A;  4TVY A;  3A1P A;  3QHS A;  3L2Z A;  1WHJ A;  2CJA A;  4EMK A;  3S3M A;  5GAN d;  3MEV A;  2OTJ T;  3JV3 A;  4BDY A;  3FJP A;  4TVR A;  3SWN C;  1X69 A;  2BZX A;  5LJ5 e;  3OYA A;  2RA2 A;  1BB9 A;  3CCE Q;  2ODR C;  1I4K 1;  4AFQ C;  4FW1 A;  2JT4 A;  3G4S A;  2KSS A;  4Z88 A;  3DB4 A;  3FJ5 A;  2NUZ A;  1MGQ A;  4HCK A;  3X28 B;  2YRD A;  4A4G A;  1JEG A;  1ABO A;  1QF6 A;  1YB3 A;  3ME9 A;  1TWB A;  3LGL A;  2XIC A;  1WX6 A;  3V8K A;  1U06 A;  3CCU T;  2QYZ A;  3JCM Q;  2QQS A;  3MF1 A;  3UFG A;  3QJ6 A;  4ELY C;  1KC8 U;  5M9O A;  2C0O A;  1Q95 G;  2EQU A;  4LXC A;  3JSC A;  4AT1 B;  2MWP A;  5IHN A;  4D6W A;  3CCQ A;  1IO6 A;  4OVA A;  2DBK A;  1X2G A;  3F70 A;  1WLP B;  2EQJ A;  4E51 A;  3I56 A;  1M1K U;  1Y0M A;  3M56 A;  2E6Z A;  8AT1 B;  4N4H A;  1K9M C;  3A74 A;  3RER A;  4PL6 A;  3QYH B;  3NEM A;  3CEY A;  1YWP A;  2YT6 A;  1JJ2 A;  2RQU A;  2E4H A;  1Y71 A;  3PMT A;  3HKS A;  4TTV A;  2QA4 Q;  3EG9 A;  2ZT6 A;  2KVQ G;  4Q5W A;  3V7S A;  4Z89 A;  3OYK A;  3QNE A;  2YRC A;  4F17 A;  3EFO B;  1SRY A;  1I07 A;  4DBH A;  1IZ6 A;  4CH4 A;  4CI0 C;  1SKU B;  2LJ3 A;  3NTI A;  2RI2 A;  2OAU A;  2EW3 A;  3LX7 A;  3M5A A;  3OSV A;  2X35 A;  3A5Z B;  1B7Y B;  2O4X A;  2DO3 A;  2I4O A;  4P73 A;  4PLL A;  1VIF A;  1KD1 C;  4C8Q G;  1I81 A;  2L5Q A;  4QQD A;  2ZT8 A;  4QKU A;  3M4G A;  3E19 A;  2I4L A;  2NUT A;  2ZCF B;  4AFS C;  4KGZ B;  3NFC A;  1USY C;  4J9G A;  2PMF A;  5KE2 A;  1NYG A;  3I55 T;  2EYW A;  2ZZG A;  4LDV A;  2FPD A;  1NJ8 A;  3REU A;  1K1Z A;  2ZT5 A;  2RN8 A;  1C1A A;  1QW1 A;  1W1F A;  3CC7 A;  1OX8 A;  4TVW A;  4J5Y A;  1HD3 A;  1Q7Y C;  3DSQ A;  3OQ5 A;  3UDC A;  4M7A E;  2DA9 A;  1U1T A;  2IG0 A;  2ARS A;  1TS9 A;  1S72 T;  2P0L A;  1PYS B;  1VQL T;  1ZUK A;  3GOX A;  4M78 B;  2VXF A;  2QQA A;  3VS0 A;  1VQP Q;  1KD1 U;  2KMT A;  1X56 A;  2HSP A;  5FRM A;  3LSS A;  3NEN A;  1U1S A;  4YRP A;  2FEI A;  5FWB A;  2P0P A;  2JMC A;  1QCF A;  1QQJ A;  3MKD A;  4ELZ C;  5FU7 C;  3JCM V;  1Y96 A;  4CS3 A;  2B86 A;  1VQN T;  4BE1 A;  2YLC A;  2KRO A;  3OYN A;  1Q82 U;  4LDU A;  1SER A;  5HK3 A;  2LNH B;  5HGQ A;  2KYB A;  2QAS A;  4E7S A;  4DEX A;  1N9R A;  2DET A;  3CC4 T;  5D6Y A;  4YRG A;  2JVV A;  1YFN A;  2RJE A;  2H8H A;  2P4R A;  3KBG A;  5LJ5 d;  1RL2 A;  4DA4 A;  5K1P A;  1RAC B;  1GBQ A;  1ZA2 B;  1FX7 A;  1K8A C;  4RQE A;  2COY A;  3RL6 A;  2E1H A;  4L59 A;  2K7A A;  3ASK A;  2ZPH B;  1MMN A;  1TH7 A;  4F04 B;  2YUN A;  4LD9 K;  1GGM A;  2FG0 A;  4JJB A;  4M7D D;  3TRE A;  2QHV A;  1K9A A;  4M75 F;  3X26 B;  1YP5 A;  3CCJ Q;  4OB2 B;  1WLE A;  2ATC B;  1YFR A;  2XDD A;  3JCM J;  3TUP A;  3EGD A;  5KH6 A;  1H4V B;  1KQ2 A;  1BI3 A;  3LWI A;  4YRQ A;  3OYB A;  5GAO m;  4M7A B;  1RUW A;  1UEC A;  2YUP A;  1KMM A;  4DBR A;  1B34 A;  5KYY B;  1GCQ C;  2V1R A;  3CC7 T;  2CJB A;  1AHJ B;  3RGL A;  4ORZ A;  2CYZ B;  4P71 C;  3OYH A;  2M0Y A;  2VUB A;  2ZGW A;  3P8V A;  5CQX A;  5GAM f;  4C92 F;  2EPD A;  1Z9Q A;  4M7A D;  1UGQ B;  2E5K A;  3HFN A;  4RG2 A;  2K9G A;  2FZC B;  3NHN A;  2LZ6 B;  3OBW A;  1ADJ A;  3RMQ A;  1XOV A;  4HVU A;  4YRM A;  2DVJ A;  4BE2 A;  4HT4 A;  4H2X B;  1RAH B;  2ZIM A;  2CP3 A;  3A5Y A;  4ZTJ A;  2IIM A;  1SG5 A;  4JZ3 A;  2RO0 A;  1JB0 E;  2K5L A;  3NTH A;  2IVW A;  3EHR A;  2AKW A;  2CH4 A;  2QAZ A;  4TQD A;  4RCC A;  3HL8 A;  3MEY A;  3EFR A;  1X27 A;  3QJY A;  1VQM T;  4ZGD B;  2KXC A;  5LJ5 h;  4IIO A;  4A53 A;  4HWO A;  3NTK A;  5LJ3 g;  5GAN 4;  2QEX T;  3VKI A;  4XTX A;  4E47 A;  1BCO A;  2GQI A;  2EJ9 A;  3FEO A;  1MV3 A;  2X3X D;  3M53 A;  4YRF A;  3TEH B;  1JXO A;  4FL6 A;  3BDL A;  1KC8 R;  5L8R E;  2EIF A;  2K79 A;  3MF2 A;  5HK0 A;  1OEB A;  3R07 A;  3H6Z A;  2BE9 B;  3BJU A;  2ED1 A;  4HCC A;  3GLX A;  4UP7 A;  4J8O A;  1J3T A;  4BI3 A;  2XI9 A;  1NJI R;  1K4U S;  3EFS A;  2KNB B;  3C95 A;  1V76 A;  4CC4 B;  1B3Q A;  4J9D A;  4JLG A;  5LL6 S;  3PGG A;  4AMC A;  3KUF A;  3UA6 A;  1NJI C;  3MEW A;  4FSS A;  2D0Q B;  4YRN A;  2CSI A;  4ZTU B;  1SRL A;  2HD0 A;  2E5A A;  2A37 A;  3VRY A;  2HL3 A;  2JZ2 A;  3HFO A;  1QVF A;  3MP1 A;  2A3L A;  1K73 U;  1M8M A;  4FT4 A;  2CGH A;  4RTX A;  1OPL A;  4BI8 B;  1C6V X;  1ZHI A;  2DKG A;  3FB9 A;  3CPW P;  1VQ9 T;  2KK4 A;  2E5Q A;  4Y28 E;  4ESR A;  2VWF A;  2EGE A;  1BCM A;  1KJW A;  1QVG S;  3OS0 A;  2COW A;  2RI5 A;  2RJF A;  4PFZ A;  3OS1 A;  2C0I A;  2K2M A;  3OYG A;  2I0N A;  1BYM A;  3H41 A;  1KHC A;  1BBW A;  1PKT A;  2JMA A;  4PLI A;  3QII A;  5GAN e;  4XQ3 A;  2RJD A;  3JRZ A;  2ZPB B;  1TTH B;  5CKB A;  1F1B B;  5DM7 R;  12AS A;  5CIU A;  4KBM B;  2D8J A;  3R6O A;  1P92 A;  2OTL A;  2H3J A;  2HKQ B;  1KHI A;  2SEM A;  3OYC A;  3D7S B;  3MP6 A;  5ELN A;  3CPW S;  2J6O A;  1YJW T;  1Z7N A;  1WHM A;  3VRZ A;  1OU9 A;  3IG2 A;  1EVK A;  2G6F X;  2FRY A;  2ESW A;  1NM7 A;  2KQW A;  2MPX C;  3TEH A;  2XDP A;  3CCL Q;  1SES A;  3OW2 S;  2WSE E;  1VQK T;  2MF2 A;  3MPU B;  5KYU A;  4KR3 A;  3UT1 A;  4XTW A;  2DL7 A;  2JXB A;  2DL8 A;  5K1X A;  1I5L A;  2ENM A;  4X34 A;  1KIK A;  2DTO A;  1PKS A;  3OYD A;  2LVM A;  4K86 A;  2M16 A;  2BZY A;  3QPH A;  1AZE A;  5GAN 6;  1IL2 A;  3JAM E;  4OMQ A;  1M4Z A;  4DOW A;  1U5S A;  3PIP A;  4CH6 A;  4KRT A;  2E41 A;  4QQ6 A;  2DYI A;  3RAC A;  2RHY A;  5ELO A;  4BUG A;  3RKY A;  4P75 C;  1QVG A;  1AD5 A;  3SEM A;  2AT1 B;  2PUK B;  1YNZ A;  4M77 B;  5GAN 3;  1R0C B;  2RMO A;  1WFW A;  1X43 A;  2DTI A;  1QVF P;  1VQL Q;  1HJD A;  1MMD A;  1VIE A;  1ZLM A;  2PVG B;  2PUO B;  4R0K A;  1UG1 A;  1D3B B;  2DF6 A;  4C8Q C;  4EO4 A;  2PVO B;  1JRI A;  1LJO A;  4RMF A;  1SEM A;  1KC8 C;  4E7K A;  3A8G B;  5FRN A;  2DU5 A;  2QQR A;  4J9H A;  4PJO G;  1FMW A;  3VUB A;  3P8B B;  4H2T A;  1VYU A;  3OB9 A;  4YTL A;  4J7F A;  3EG1 A;  1M30 A;  4JRQ A;  3T9N A;  1OX9 A;  2NUP A;  3J80 E;  2YWW A;  1RLP C;  4BY6 B;  2ZPE B;  4C0D B;  1VQ5 T;  2ZPI B;  4OB1 B;  3TEG A;  5GAM h;  2RQT A;  2RHQ A;  1V1C A;  2M1H A;  4FYX B;  4FU6 A;  4C0D C;  3X24 B;  4XU1 A;  1ZQ1 A;  3EG3 A;  2CP7 A;  3M9Q A;  3MO8 A;  4C92 E;  1UHC A;  2QI2 A;  3CMQ A;  1VA7 A;  1NJ5 A;  3OYE A;  4YRL A;  1GCP A;  3X25 B;  1VQZ A;  3RES A;  3CBO A;  3OYF A;  3JCM h;  2XHC A;  4EPC A;  2OX7 A;  4NL3 A;  2VB6 A;  3HFZ A;  3CCS T;  1R77 A;  4HVC A;  2F2W A;  2OAW A;  4FYV B;  2RHS A;  1D1B A;  1X2H A;  4B9W A;  1HC7 A;  2HCK A;  2MK5 A;  1WHH A;  3UPU A;  4JZ4 A;  3J81 E;  3R6N A;  5I21 A;  1E1O A;  2AK5 A;  4EX5 A;  4OMP A;  4J83 A;  5KYW B;  4E6R A;  3HXV A;  1VQ5 Q;  1QVG P;  1VQ9 Q;  3GF5 A;  5GJW B;  4H2X A;  4LE9 A;  2R58 A;  3RUX A;  2GTO A;  1EIF A;  3PTA A;  1VQ6 A;  1X75 C;  2RHQ B;  1QKX A;  1VQ7 T;  3A8L B;  4J6Y A;  4IUQ A;  2DBM A;  2FZG B;  3L2U A;  4G84 A;  4C0G A;  3BY7 A;  3QSU A;  3M59 A;  5GAM e;  3PNW C;  3A7R A;  1TG0 A;  2EYQ A;  2G4C A;  5CAI A;  2VAS A;  1YJ9 Q;  3MQZ A;  3OW2 A;  4JJC A;  3SHW A;  4TVA A;  11AS A;  1WQ7 A;  3M0P A;  1IGU A;  4DQ2 A;  4M7D E;  1I8F A;  1C0M A;  5KYN A;  1UUE A;  3HPW A;  3WVD B;  3HFZ B;  4AG2 C;  2E3H A;  3KFU A;  3SWN B;  2EYZ A;  5D6W A;  1VQ7 Q;  3THK A;  4M7D A;  3VS5 A;  2X4Y A;  2CH4 W;  2PME A;  4M7D G;  1D0Y A;  1EIY B;  2XU8 A;  2EGA A;  2LNV A;  1YHQ Q;  5GMK h;  3MEU A;  3MHX A;  3O5Z A;  4ME7 A;  3ULR B;  1VQ5 A;  4M4Z A;  5CK9 A;  3IQL A;  1M2O A;  4B9X A;  5LJ5 j;  5HCK A;  1WXU A;  4GBQ A;  1M8V A;  2PU9 B;  4LDW A;  1DJ7 B;  1A0N B;  2E6N A;  5GAN f;  4XEM A;  4CC3 A;  5CKD A;  4PJO B;  1NE8 A;  4YCW A;  3I5R A;  3WXM B;  2CIM A;  2F5T X;  1JJ2 S;  4MDW A;  4H2Y A;  2QTX A;  2IPO B;  1MMG A;  4ZIB A;  4P3O A;  4XEO A;  4LVL A;  2A36 A;  4JDS A;  3M4Q A;  1WU7 A;  2K57 A;  3QG1 A;  4JJN K;  1Z9Z A;  2DRM A;  5KYW A;  3PE0 A;  5HKC A;  2LQW A;  1Y96 B;  3WVE B;  1VUB A;  1ABQ A;  1WA7 A;  4M7D B;  5EG2 A;  2QK0 A;  4IUU A;  3CMA Q;  1J5W A;  4Y91 A;  3JCM W;  1M90 R;  6AT1 B;  2DIQ A;  2YHT A;  2BKD N;  2K5I A;  2VGN A;  1SHG A;  3LWH A;  2EYX A;  4X9C A;  1KQS P;  1B70 B;  1GRI A;  2KY9 A;  3RNJ A;  2RK1 A;  3HRK A;  4C92 G;  3OW2 P;  3HTZ A;  2GCX A;  2AHJ B;  1TSF A;  4O2D A;  2ZXF A;  4C92 A;  1OV3 A;  4TQF A;  3CCR A;  5CKE A;  3REX A;  5GAN 8;  2AKL A;  4PJO A;  3A8O B;  5IAY A;  3L2R A;  4PJJ A;  1X2K A;  3VQX A;  1C0A A;  1D1A A;  2MMP A;  5FW9 A;  2YDL A;  3V7R A;  4C8Q E;  1Y7X A;  2MYS A;  2V26 A;  5KNN A;  4M75 A;  4PHC A;  2JTE A;  4C5E A;  4B6M A;  3M4P A;  4M77 D;  1EIY A;  2M9U A;  3CQT A;  1K73 C;  2DX1 A;  1Q86 U;  3QWY A;  2X3W D;  3MJX A;  3JCM c;  2VKN A;  1TUG B; 
#chains in the Genus database with same CATH homology
 3UGT A;  4P72 A;  3A31 A;  4M77 C;  3OYM A;  3VQV A;  2DZ9 A;  2V8I A;  3QUI A;  2X4J A;  4YYE A;  1WJQ A;  4GLK A;  3CCS A;  2RI3 A;  2EQK A;  1G3T A;  5I2M A;  4BY6 C;  3HXZ A;  2E65 A;  4YDQ A;  3X20 B;  4L87 A;  2YLB A;  3RKX A;  3S3N A;  1RI0 A;  5GAM j;  5GMK i;  4XAX B;  3ZEH A;  2LCC A;  3OSS C;  3HP9 A;  1JJC B;  4II1 A;  4MML A;  5GAN g;  1B70 A;  3CCV A;  2DXT A;  2DXU A;  3MEA A;  3OS2 A;  5LJ5 f;  4JRK A;  1VQ8 A;  2RD1 A;  4C92 B;  1VQN A;  1Y07 A;  5KCH A;  3OYI A;  2Q5I A;  2DAQ A;  5GAN 5;  2RJC A;  3GIB A;  2FB7 A;  3SB2 A;  3RMS A;  2QEX A;  4X9D A;  2LTO A;  4YRC A;  2I4M A;  4PKC C;  3L2V A;  2J3M A;  3S3O A;  4RKU E;  1VQM A;  3OY9 A;  2K5F A;  4X5O A;  5CR2 A;  3ZBD A;  4M7D F;  2HBP A;  2ZZE A;  1V29 B;  3CCL T;  1K9M U;  3HY1 A;  1NPP A;  2XKO C;  4N0A A;  3ERR A;  4YRT A;  2JOY A;  3CPF A;  3VYG A;  2F5K A;  4C0Z A;  3JB9 D;  2QHT A;  3CXC S;  2R57 A;  4P3P A;  1W2B A;  3HRU A;  1G3W A;  4XTY A;  2D9T A;  1SSF A;  1XNI A;  5CVI A;  1PSF A;  1W4S A;  1VQK A;  1YI2 A;  3CME A;  5GAN 7;  5KE3 A;  4H2V A;  1NJ1 A;  3FLG A;  4G85 A;  1VQ8 T;  4J15 A;  3INZ A;  4YRO A;  1E24 A;  3MP8 A;  4VUB A;  4EMH A;  4AH6 A;  2PQW A;  2RHZ A;  2RH2 A;  2DPP B;  4YRE A;  3VYH B;  4C8Q B;  1NZ9 A;  4H2S A;  3CCE T;  1M5Q 1;  1X01 A;  4RMO A;  3E9I A;  4HT9 A;  3G6E T;  2LCL A;  5DLQ E;  1VQO T;  4M75 D;  4KUD K;  4J7I A;  3A8H B;  4M77 A;  2K3Y A;  1YFT A;  5CKH A;  2LQK A;  4F7U E;  4CH3 A;  2NS6 A;  1G5V A;  1X54 A;  4JLI A;  1NJ6 A;  4A4H A;  3L42 A;  3CCU A;  5A0G A;  4M77 F;  1BIA A;  1YI2 T;  5F5W A;  2BIV A;  3LSQ A;  3CCJ T;  4QQG A;  3E9F A;  4LVI A;  1BIB A;  2JNG A;  3OBY A;  2EJG A;  3FDR A;  2VXE A;  3PCO B;  2E64 A;  3HHT B;  2I2L A;  3I55 A;  1N8R U;  3OD1 A;  4O5V A;  2FYK A;  3I7F A;  3E9H A;  4OB0 B;  5A0L A;  3TEE A;  2DD4 A;  2Q7G A;  2ZR3 A;  2ZIO A;  3LLR A;  3VU3 C;  3UWN A;  3P8D A;  2QQB A;  1NJI U;  1M90 C;  1EQR A;  2RHI A;  2E3C A;  3OYY A;  4WJ4 A;  2DD5 A;  3CCV T;  4NOY A;  2R5M A;  2Y90 A;  2QHS A;  1Q86 C;  2D6F A;  4YRS A;  4YCV A;  4M78 G;  2P0K A;  2YRV A;  4XU0 A;  3CPW A;  4GY5 A;  2XTI A;  3L4G B;  4M78 A;  1O75 A;  2LQ8 A;  5LJ3 d;  2RB6 A;  4HWS A;  3GP8 A;  4P74 A;  3GNF B;  1R8O B;  1H4S A;  3PZC A;  3DLL A;  1K8A U;  3FRN A;  3SWN A;  4HCB A;  2ZPF B;  3CXC A;  4IUR A;  4LD6 A;  2VV5 A;  1YBY A;  5CQY A;  2EJF A;  4LDX A;  4C92 D;  4ZGE B;  4BE0 A;  3G4S T;  4PJO D;  2KDS A;  5E3I A;  5J3B A;  2DXC A;  3SFM A;  4RG8 A;  4JRP A;  2M0O A;  1YCY A;  1ZBX A;  3LW5 E;  3IKM B;  4UP9 A;  2XG8 D;  2DIG A;  3CD6 A;  1OI1 A;  4JRI A;  5HY6 A;  4TWA A;  1D3B A;  4QW2 A;  5A0D A;  2A8E A;  5IT9 E;  5C6S A;  3G71 A;  1GXI E;  2DU7 A;  2CZ6 B;  3PMI A;  4CS4 A;  1B8A A;  4F7U G;  4C5H A;  2DEQ A;  4M78 F;  1YJW A;  3CCR T;  1O9S A;  4P3N A;  4WF2 A;  3ER0 A;  2DK3 A;  1G51 A;  2XD0 A;  3A7U A;  2LT4 A;  4C5I A;  4P72 C;  2RHX A;  3JCM P;  3TU4 K;  1XQH A;  2DZC A;  2L89 A;  5GAN j;  1HK9 A;  3UGQ A;  3QO5 A;  1H64 1;  3JCM f;  4EMK C;  3HRS A;  3CMA T;  2LC4 A;  3FIF A;  1ASZ A;  2QDY B;  4UP8 A;  4C8Q D;  1MHN A;  2ALY B;  2Y4Y A;  2K4Y A;  4HWR A;  2RHS B;  4M75 B;  4QVD A;  3H8Z A;  4C8Q A;  1YJN A;  2CZ1 B;  2VYT A;  4M7A F;  4E7I A;  1G3Y A;  3CCQ T;  2DQ0 A;  3PFS A;  3G7Z A;  2LDM A;  1WYD A;  4PJO C;  2Q7E A;  4NS5 A;  4OMF B;  2B8A A;  2ZZD A;  1KMN A;  1QP2 A;  4L6V 5;  5GAN h;  2FVU A;  4ZGJ B;  1HTT A;  4QVZ A;  1WQW A;  1YIJ T;  2I4N A;  4BD3 A;  2DVE A;  3V8L A;  3C94 A;  4DPG A;  2RK2 A;  1W2B S;  3BDU A;  4MZT A;  3L2Q A;  3C4S A;  3V8J A;  1FXX A;  3O8V A;  3HXY A;  4FM4 B;  4BB7 A;  4MMK A;  2JTM A;  4ZN1 A;  3QDR B;  1M1K C;  2LT1 A;  2DXB A;  4M75 E;  1NNH A;  2NLU A;  2ARU A;  2EWN A;  1KQ1 A;  4R55 A;  3FC3 A;  2AKW B;  3S6W A;  4LNS A;  4CS2 A;  1NYR A;  3AHU A;  3HXW A;  2L3R A;  3CCJ A;  3IKL A;  2HQE A;  1VQP T;  5FU6 C;  4WJ3 M;  3JCM b;  4PJO E;  5CO7 A;  3VV0 A;  4N4I A;  2WSC E;  1YIJ A;  3QO8 A;  2GF7 A;  4ZTF A;  1VQ4 A;  3C12 A;  1NYQ A;  5C0M A;  4FIB A;  4H2W A;  1UB4 A;  4HKE A;  3SDZ A;  4PG3 A;  3LYI A;  1OYX A;  3G71 T;  4BDZ A;  1N6A A;  4YP0 A;  5D6X A;  2Q5H A;  3QZ9 B;  2CS7 A;  5A2Q E;  2RM4 A;  2ZT7 A;  1QE0 A;  3P8H A;  3CD6 T;  3HRI A;  1JBM A;  4UPA A;  2O4X B;  3P8Y A;  3E1S A;  3HXU A;  1VQ9 A;  4XK8 E;  3VQW A;  4OGE A;  2F69 A;  2DDZ A;  3URG A;  3DKM A;  2MI6 A;  1N27 A;  4K87 A;  2RHU A;  3HY0 A;  4LVJ A;  4OP0 A;  2IY5 B;  3QO7 A;  1M1F A;  1U8R A;  4NCX A;  4J6X A;  4ATO A;  4OF1 A;  5J39 A;  4M78 E;  1PYS A;  3VQY A;  5GMK l;  5LJ3 e;  3QZ5 B;  3QYG B;  4KT0 E;  4RCB A;  1Z7M A;  4LVM A;  3JB9 F;  4QVC A;  2J3L A;  4YPF A;  1FWZ A;  1W66 A;  4P74 C;  2Y4X A;  4TVA B;  2HAX A;  3CBP A;  3M4Y A;  5GMK j;  2AMC B;  2EAY A;  4L5G A;  1SET A;  2Q7H A;  1KG1 A;  4LDY A;  3M57 A;  5CCA A;  2LRQ A;  1VQ7 A;  2CJ9 A;  4YRJ A;  3QXE B;  2MWO A;  3PCO A;  4P73 C;  4BW9 A;  1UGR B;  4IUT A;  3UH0 A;  3JCM d;  3L2W A;  2OTL T;  1NPR A;  2P0Q A;  4IUV A;  2E12 A;  5I2S A;  3GPL A;  2XK0 A;  4K88 A;  1M1G A;  3VUZ A;  1B34 B;  4IKF A;  2ZNI A;  4Q6G A;  3HXX A;  3LGF A;  5GMK e;  3HFV A;  3ICA A;  3CCM A;  3NEL A;  3A32 A;  1YFS A;  3JCM X;  4EMG A;  3G1Z A;  1PSE A;  1EFW A;  2X4X A;  2C7I A;  4XTZ A;  4BI4 A;  5LJ3 f;  3N5B B;  4H02 A;  2V8J A;  2CZ0 B;  4P71 A;  4YRK A;  1VQO A;  2L8D A;  4KUI A;  3W3S A;  4KR2 A;  2OTJ A;  2WAC A;  4JS4 A;  3A5Z A;  2ART A;  2C06 A;  2FL7 A;  4KUL A;  2AMC A;  3G6E A;  1UGP B;  4P5N A;  2E70 A;  2GFA A;  5J26 A;  3CCE A;  3BFM A;  1VQL A;  3CME T;  2O01 E;  3JCM e;  4E7L A;  1H3Z A;  3HSB A;  3OYJ A;  3PIO A;  4PJO F;  4DOV A;  3LH0 A;  2V8K A;  1M9S A;  3OS5 A;  2K3X A;  4UC4 A;  3JB9 H;  2C8M A;  2P5I A;  4MZM A;  2LX9 A;  3E9G A;  1XTD A;  2BUD A;  4OLF A;  3J7A F;  2EFI A;  1FYF A;  3TCJ A;  4PNO A;  4YRR A;  2ZZF A;  1IRE B;  2EQM A;  3CCL A;  5LJ5 g;  1OZ3 A;  4FT2 A;  1HXD A;  3JB9 J;  5FU6 B;  3DLM A;  1YHQ T;  2VC8 A;  4F7U B;  1WNL A;  3HRT A;  5LJ3 j;  5C51 B;  4MDX A;  3M54 A;  3JB9 I;  4J6W A;  2XGT A;  2EL9 A;  1Q7Y U;  4CH5 A;  1G5H A;  4EMK B;  1ADY A;  4XU3 A;  1BI2 A;  1USY A;  1L0W A;  2WSF E;  1WGS A;  2ZCE A;  5GAO n;  2QXF A;  4CRI A;  1WJR A;  3JB9 G;  2VGM A;  1BKB A;  4M75 C;  2GFU A;  4R56 A;  2G3R A;  2X4W A;  3CC4 A;  5AYF A;  4XTV A;  4C0F A;  2ZNJ A;  1S72 A;  1H4T A;  5FU7 B;  3OYL A;  1N8R C;  2ALY A;  1BI1 A;  1WJS A;  2EKO A;  3ZFJ A;  1QVF S;  3EAE A;  4C92 C;  3QKJ A;  2MAM A;  1RIQ A;  4Z02 A;  4E7J A;  4YRI A;  2DJZ A;  2QQ9 A;  4IUP A;  1YJN T;  1KOG A;  3OA6 A;  5GAO r;  3WQZ A;  1VQ6 T;  1UEB A;  2P4T A;  4HT8 A;  4Q15 A;  5DLO A;  1B76 A;  4M7A G;  1Q81 U;  3L4G A;  3VBB A;  4BWA A;  1N9S A;  2PVD B;  1X55 A;  1YJ9 T;  3CC2 A;  3CCM T;  4F7U A;  5GAO l;  1YIT T;  1EOV A;  3GNG A;  3OMG A;  3RIR A;  4P75 A;  1G5I A;  2FHD A;  3CC2 T;  3A7A A;  4H2U A;  1LNX A;  4RDX A;  4KQE A;  1X6O A;  4M77 G;  1N9W A;  3RKW A;  4LVK A;  4ZTZ B;  4A4K A;  5GMK m;  5LJ3 h;  1Q81 C;  4O6J A;  2JUF A;  4JS5 A;  4M78 C;  4YCU A;  4HWT A;  5DY9 A;  3KXT A;  4A4E A;  1LYL A;  1OZ2 A;  5CKF A;  1BBU A;  5FLX E;  4C8Q F;  2CKK A;  5GAN 2;  2A7Y A;  3MET A;  1Q82 C;  4F7U F;  5FRO A;  3RF1 A;  1E22 A;  2HNI A;  3I56 T;  5IN1 A;  2ODR D;  2ZR2 A;  5C52 B;  3VJP A;  2DTH A;  4N0A C;  3BW1 A;  4BAC A;  4E7H A;  3QO3 A;  4M77 E;  4ZN3 A;  1KQS S;  4RQF A;  3IAL A;  3PT9 A;  2QA4 T;  4HCZ A;  1QVP A;  2K2V A;  4M75 G;  1ATI A;  4XTU A;  1LOJ A;  3L1A A;  3JCM g;  4N4G A;  3QTC A;  1UGS B;  4V2S A;  2ZPG B;  3M58 A;  2R5A A;  4M7D C;  2HQX A;  2ZTG A;  2QA4 A;  5GAO p;  5GAM d;  2XID A;  1BI0 A;  5GAM g;  2JTF A;  3CMA A;  1NJ2 A;  4XU2 A;  4HA8 A;  1G3S A;  5KCO A;  4M7A A;  4FSX A;  1YHQ A;  2DQ3 A;  3M55 A;  2CZ7 B;  4A54 A;  1EVL A;  3DB3 A;  2GQV A;  1JJC A;  4M7A C;  1VQ4 T;  4WI1 A;  2IY5 A;  2JN0 A;  3P8T A;  4C5G A;  4EDU A;  1M90 U;  1ASY A;  3QBY A;  2E10 A;  4OB3 B;  1VQP A;  4MZP A;  3MCA B;  3V7C A;  1YGB A;  4NL2 A;  1QP3 A;  4OGC A;  2XDB A;  2QHU A;  3LC0 A;  1YIT A;  3NET A;  4A4F A;  1H4Q A;  4JUV A;  1WPY A;  1KQS A;  3A8M B;  2KAF A;  1YJ9 A;  1B7Y A;  3OMC A;  2ZIN A;  3SD4 A;  4HWP A;  4M78 D;  3Q1J A;  5GAO q;  5C53 B;  3CBM A;  1E1T A;  4TVY A;  3QHS A;  3L2Z A;  2CJA A;  4EMK A;  3S3M A;  5GAN d;  3MEV A;  2OTJ T;  4BDY A;  3FJP A;  4TVR A;  3SWN C;  3OYA A;  5LJ5 e;  2RA2 A;  2ODR C;  1I4K 1;  3G4S A;  2KSS A;  3DB4 A;  1MGQ A;  3X28 B;  4A4G A;  1QF6 A;  1YB3 A;  3ME9 A;  3LGL A;  2XIC A;  3V8K A;  3CCU T;  3JCM Q;  2QQS A;  3MF1 A;  3UFG A;  3QJ6 A;  4ELY C;  1KC8 U;  5M9O A;  2EQU A;  3JSC A;  2MWP A;  4D6W A;  3CCQ A;  4OVA A;  1X2G A;  3F70 A;  2EQJ A;  4E51 A;  3I56 A;  1M1K U;  3M56 A;  2E6Z A;  4N4H A;  1K9M C;  3A74 A;  3RER A;  4PL6 A;  3QYH B;  3NEM A;  3CEY A;  1JJ2 A;  1Y71 A;  3PMT A;  3HKS A;  4TTV A;  2ZT6 A;  2KVQ G;  4Q5W A;  3V7S A;  3QNE A;  3OYK A;  1SRY A;  1IZ6 A;  4CH4 A;  4CI0 C;  3NTI A;  2RI2 A;  2OAU A;  3LX7 A;  3M5A A;  3OSV A;  2X35 A;  3A5Z B;  1B7Y B;  2O4X A;  2DO3 A;  2I4O A;  4P73 A;  4PLL A;  1VIF A;  1KD1 C;  4C8Q G;  1I81 A;  2L5Q A;  4QQD A;  2ZT8 A;  3M4G A;  3E19 A;  2I4L A;  2ZCF B;  3NFC A;  1USY C;  2PMF A;  5KE2 A;  3I55 T;  2ZZG A;  4LDV A;  1NJ8 A;  3REU A;  2ZT5 A;  1QW1 A;  3CC7 A;  4TVW A;  4J5Y A;  1Q7Y C;  3DSQ A;  3OQ5 A;  3UDC A;  4M7A E;  1U1T A;  2IG0 A;  2ARS A;  1S72 T;  2P0L A;  1PYS B;  1VQL T;  3GOX A;  4M78 B;  2VXF A;  2QQA A;  1KD1 U;  2KMT A;  1X56 A;  5FRM A;  3LSS A;  3NEN A;  1U1S A;  4YRP A;  2P0P A;  4CS3 A;  4ELZ C;  5FU7 C;  3JCM V;  1Y96 A;  1VQN T;  4BE1 A;  2YLC A;  3OYN A;  1Q82 U;  4LDU A;  1SER A;  5HK3 A;  5HGQ A;  1N9R A;  3CC4 T;  5D6Y A;  4YRG A;  2JVV A;  2RJE A;  3KBG A;  4DA4 A;  5LJ5 d;  1RL2 A;  5K1P A;  1FX7 A;  1K8A C;  4RQE A;  3RL6 A;  2E1H A;  3ASK A;  4L59 A;  2ZPH B;  1TH7 A;  4LD9 K;  1GGM A;  4M7D D;  2QHV A;  3TRE A;  4M75 F;  3X26 B;  1WLE A;  4OB2 B;  1YFR A;  3TUP A;  2XDD A;  3JCM J;  5KH6 A;  1H4V B;  1KQ2 A;  1BI3 A;  3LWI A;  4YRQ A;  3OYB A;  5GAO m;  4M7A B;  1KMM A;  1B34 A;  3CC7 T;  2CJB A;  1AHJ B;  3RGL A;  2CYZ B;  4P71 C;  3OYH A;  2VUB A;  2ZGW A;  3P8V A;  5CQX A;  5GAM f;  4C92 F;  4M7A D;  1UGQ B;  3HFN A;  4RG2 A;  3OBW A;  1ADJ A;  3RMQ A;  1XOV A;  4YRM A;  4BE2 A;  4HT4 A;  4H2X B;  2ZIM A;  3A5Y A;  4ZTJ A;  2RO0 A;  1JB0 E;  2K5L A;  3NTH A;  2IVW A;  2AKW A;  4TQD A;  4RCC A;  3HL8 A;  3MEY A;  3EFR A;  3QJY A;  1VQM T;  4ZGD B;  5LJ5 h;  4A53 A;  4HWO A;  3NTK A;  5LJ3 g;  5GAN 4;  2QEX T;  3VKI A;  4XTX A;  4E47 A;  2EJ9 A;  3FEO A;  3M53 A;  4YRF A;  3TEH B;  4FL6 A;  3BDL A;  5L8R E;  2EIF A;  3MF2 A;  5HK0 A;  3R07 A;  3H6Z A;  3BJU A;  4HCC A;  3GLX A;  4UP7 A;  4J8O A;  4BI3 A;  2XI9 A;  3EFS A;  3C95 A;  4JLG A;  5LL6 S;  3PGG A;  3KUF A;  1NJI C;  3MEW A;  2D0Q B;  4YRN A;  4ZTU B;  2HD0 A;  2E5A A;  2JZ2 A;  3HFO A;  1QVF A;  3MP1 A;  2A3L A;  1K73 U;  4FT4 A;  2CGH A;  4BI8 B;  1ZHI A;  3FB9 A;  2DKG A;  1VQ9 T;  2KK4 A;  2E5Q A;  4Y28 E;  1QVG S;  3OS0 A;  2RI5 A;  2RJF A;  3OS1 A;  3OYG A;  1BYM A;  1KHC A;  1BBW A;  4PLI A;  3QII A;  5GAN e;  4XQ3 A;  2RJD A;  3JRZ A;  2ZPB B;  5CKB A;  5DM7 R;  12AS A;  5CIU A;  4KBM B;  3R6O A;  1P92 A;  2OTL A;  2H3J A;  1KHI A;  3OYC A;  3MP6 A;  5ELN A;  3CPW S;  1YJW T;  1Z7N A;  3IG2 A;  1EVK A;  2KQW A;  3TEH A;  2XDP A;  1SES A;  3OW2 S;  2WSE E;  1VQK T;  2MF2 A;  4KR3 A;  3UT1 A;  4XTW A;  5K1X A;  1I5L A;  4X34 A;  2DTO A;  3OYD A;  2LVM A;  4K86 A;  2M16 A;  3QPH A;  5GAN 6;  1IL2 A;  3JAM E;  1M4Z A;  4DOW A;  3PIP A;  4CH6 A;  2E41 A;  4QQ6 A;  3RAC A;  2RHY A;  5ELO A;  4BUG A;  3RKY A;  4P75 C;  1QVG A;  2PUK B;  4M77 B;  5GAN 3;  2DTI A;  1VIE A;  2PVG B;  2PUO B;  1D3B B;  4C8Q C;  4EO4 A;  2PVO B;  1JRI A;  1LJO A;  4RMF A;  1KC8 C;  4E7K A;  3A8G B;  5FRN A;  2DU5 A;  2QQR A;  4PJO G;  3VUB A;  3P8B B;  4H2T A;  3OB9 A;  4YTL A;  4J7F A;  4JRQ A;  3T9N A;  3J80 E;  4BY6 B;  2ZPE B;  4C0D B;  1VQ5 T;  2ZPI B;  4OB1 B;  3TEG A;  5GAM h;  2RHQ A;  2M1H A;  4FU6 A;  4C0D C;  3X24 B;  4XU1 A;  1ZQ1 A;  3M9Q A;  3MO8 A;  4C92 E;  2QI2 A;  3CMQ A;  1NJ5 A;  3OYE A;  4YRL A;  3X25 B;  1VQZ A;  3RES A;  3CBO A;  3OYF A;  3JCM h;  2XHC A;  4EPC A;  4NL3 A;  3HFZ A;  3CCS T;  4HVC A;  2RHS A;  1X2H A;  4B9W A;  1HC7 A;  3UPU A;  3J81 E;  5I21 A;  1E1O A;  4EX5 A;  4J83 A;  3HXV A;  3GF5 A;  4H2X A;  2R58 A;  3RUX A;  1EIF A;  3PTA A;  1VQ6 A;  1X75 C;  2RHQ B;  1VQ7 T;  3A8L B;  4J6Y A;  4IUQ A;  3L2U A;  4G84 A;  4C0G A;  3BY7 A;  3QSU A;  3M59 A;  5GAM e;  3PNW C;  3A7R A;  2EYQ A;  2G4C A;  5CAI A;  3MQZ A;  3OW2 A;  4TVA A;  11AS A;  1WQ7 A;  4DQ2 A;  4M7D E;  1I8F A;  3HPW A;  3WVD B;  3HFZ B;  3KFU A;  3SWN B;  5D6W A;  4M7D A;  2X4Y A;  2PME A;  4M7D G;  1EIY B;  2XU8 A;  2LNV A;  5GMK h;  3MEU A;  3MHX A;  4ME7 A;  1VQ5 A;  5CK9 A;  4B9X A;  5LJ5 j;  1M8V A;  2PU9 B;  4LDW A;  1DJ7 B;  2E6N A;  5GAN f;  4XEM A;  5CKD A;  4PJO B;  1NE8 A;  4YCW A;  3WXM B;  2CIM A;  2F5T X;  1JJ2 S;  4MDW A;  4H2Y A;  2QTX A;  4ZIB A;  4P3O A;  4XEO A;  4LVL A;  3M4Q A;  4JDS A;  1WU7 A;  2K57 A;  3QG1 A;  4JJN K;  5HKC A;  1Y96 B;  3WVE B;  1VUB A;  4M7D B;  5EG2 A;  4IUU A;  1J5W A;  4Y91 A;  3JCM W;  2DIQ A;  2YHT A;  2BKD N;  2K5I A;  2VGN A;  3LWH A;  4X9C A;  1B70 B;  2KY9 A;  2RK1 A;  3HRK A;  4C92 G;  3HTZ A;  2GCX A;  2AHJ B;  4O2D A;  2ZXF A;  4C92 A;  4TQF A;  3CCR A;  5CKE A;  3REX A;  5GAN 8;  4PJO A;  3A8O B;  5IAY A;  3L2R A;  3VQX A;  1C0A A;  2MMP A;  3V7R A;  4C8Q E;  1Y7X A;  5KNN A;  4M75 A;  4PHC A;  4C5E A;  3M4P A;  4M77 D;  1EIY A;  2M9U A;  1K73 C;  1Q86 U;  3JCM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...