2EAYA

Crystal structure of biotin protein ligase from aquifex aeolicus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 66
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eayA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2eayA01
4JUVA 1LJOA 4PJOA 4H2YA 1N9SA 4M7DG 3JCMJ 5LJ5f 3WQZA 4KR3A 4N0AC 4ZTZB 4K87A 3A31A 2DTIA 4HVCA 3RACA 4XEMA 4C92F 3V7SA 1YFRA 1KMMA 3HFVA 3V8LA 5GANj 4E51A 4Y91A 4C92G 3CMQA 3JB9I 4JRIA 4EO4A 1B8AA 2CJAA 4UPAA 3MF2A 4C8QC 5LJ3j 4TVAB 3L1AA 3V8KA 1U1TA 4M78D 4CH5A 4H2SA 2ZTGA 4XU3A 3HXUA 1X2GA 4PJOD 4XTVA 4M75E 3AHUA 1X55A 4M7AG 5GAOq 5GAOl 3I7FA 2Q7HA 4CH6A 4F7UA 3RKXA 3JCMX 2DVEA 3SB2A 1WU7A 1EVLA 1NJ1A 4V2SA 3A7UA 3LC0A 3FJPA 2DTOA 4M78B 3ICAA 5CAIA 4XEOA 1ASZA 3TUPA 4NL3A 2Q7EA 4PJOB 3BDUA 4H2TA 4X9DA 3RIRA 1G5HA 2I4OA 2AKWA 4M77C 3JCMW 4M7DC 1X01A 3SWNA 1X2HA 2YLCA 5LJ3d 4YCUA 4EMHA 5LJ5j 3M4GA 1FYFA 4UP7A 4YYEA 2VXFA 1NJ2A 2Q7GA 1QE0A 2DDZA 4YCWA 4G85A 1KQ1A 5GMKe 5GANf 1NNHA 4J6YA 5GANg 5DY9A 4C92C 2C7IA 2ARTA 2EJ9A 4CS3A 1WYDA 3RF1A 1M5Q1 1ASYA 2E64A 5LJ3g 4N0AA 1I8FA 4M75F 4PHCA 2ZNIA 4H2WA 4WI1A 4CS2A 3VQWA 3TEHA 2RHQA 5GANe 2C8MA 1I5LA 3FIFA 4HA8A 4YDQA 3QHSA 4X9CA 1JJCA 3JCMP 1YFTA 3P8TA 4YRSA 4M75G 3E9IA 4EMKC 4F7UB 4YRLA 4M7AE 3UGTA 4P3OA 4ZIBA 1ADJA 5LJ3e 4ZTUB 3JB9F 5GAN5 1I4K1 4C8QA 4XTYA 1PYSA 3RGLA 4G84A 1B70A 3G1ZA 3MEYA 4TVYA 3QO8A 2DQ0A 1E24A 1NJ5A 3L4GA 2DKGA 3BJUA 2DU5A 5LJ5d 2AMCA 4XU2A 1SESA 4A53A 3JB9J 2HNIA 4XU1A 2ALYA 2AKWB 5LJ3h 4QVCA 3PGGA 2QHUA 3IG2A 3SWNB 2J3MA 2I4NA 5F5WA 4KR2A 3L2ZA 2E3CA 3M4PA 4BW9A 3MF1A 1SERA 3NELA 1RIQA 5GMKj 4O2DA 11ASA 4P74C 4P71C 3REXA 5LJ5g 4K86A 4P3NA 2J3LA 3P8VA 2ZCEA 3A5ZA 4C8QD 3RKYA 2ZGWA 1BBUA 4YRFA 4YPFA 2I4LA 3A32A 4M77A 2RHSA 3HXWA 5GAN4 3M4QA 4RDXA 2ARSA 4M7DA 4YRJA 4NCXA 5LJ5e 1E1OA 4XTWA 1D3BA 1E1TA 2ZIOA 3TEHB 2RHQB 1MGQA 5K1XA 4XTUA 1B76A 1JJCB 2YLBA 2QTXA 4M7AF 2ZXFA 3KFUA 4M75C 2QHVA 2XGTA 3VQVA 3GIBA 4C92A 2E10A 4C8QB 3RESA 1PYSB 4BWAA 3JCMf 4OLFA 5LJ5h 1B70B 3IKLA 3QO5A 3HTZA 3JCMb 3QSUA 3L4GB 4YRKA 4J6XA 2JN0A 3QNEA 2AMCB 2RA2A 12ASA 2I4MA 3REUA 3RL6A 3OD1A 2DQ3A 4M77D 4P72C 2ALYB 3DSQA 1JBMA 4CH4A 4M7DD 2ZNJA 4F7UG 2ZT5A 5C51B 4EMKA 1H4SA 4UP8A 2Q5HA 1H4VB 3UFGA 1BIBA 2ZR3A 1TH7A 1G51A 5GANd 4H2XA 2I2LA 1I81A 5GAMf 5GAMg 3RERA 3PZCA 5E3IA 4C92D 1JRIA 2RM4A 4M78E 1YB3A 3NETA 3QTCA 4M77B 2RHSB 4PJOE 3IALA 3HY0A 4M7DB 2ZZFA 4TTVA 5GAMe 1D3BB 3EFSA 3JCMQ 1Y96A 5I21A 4P73C 1L0WA 2EAYA 4P74A 2E41A 3NEMA 4P71A 3A5YA 1EOVA 3FB9A 2E65A 3HY1A 5ELNA 2VC8A 4RCBA 4P3PA 4C92B 1HXDA 1SRYA 4YRRA 2QHTA 4TQFA 1BIAA 4HWRA 4HWOA 1ADYA 1KMNA 5GMKh 4M7AC 3IKMB 4XTXA 4DPGA 1U1SA 2ODRC 1KQ2A 5K1PA 2Q5IA 2CGHA 1EIYA 4EMKB 1H4QA 1NJ6A 5GANh 1YCYA 4M75A 4KQEA 1J5WA 3VU3C 4F7UE 3A74A 2DTHA 4CH3A 3EFRA 4YREA 3P8YA 2IY5A 1NJ8A 4H2XB 4TQDA 4TVWA 4YRTA 4WJ4A 3QO7A 4XU0A 4H02A 3JB9H 4M78F 1LOJA 5GAN8 2ZZGA 3HXXA 4P72A 5GAMj 1HK9A 2VXEA 4PJOF 1EVKA 1NYQA 1C0AA 5GAOm 4JRKA 4M78G 4RQFA 4EMGA 1H641 1USYC 4DQ2A 1KOGA 4PJOG 1Y96B 5GAOn 2CJ9A 5C52B 1QF6A 2DXTA 3HXZA 4YRPA 1BBWA 3LSSA 4M75D 3JCMd 4HWPA 5KNNA 3A7RA 4L87A 4YCVA 3HFZA 4RMFA 5GMKi 1N9RA 2K57A 4M77G 3RKWA 4YRMA 1X54A 3LSQA 4YRCA 3JCMV 4YROA 2ZT6A 2ZT8A 3A7AA 2P0LA 2ZZEA 4YRNA 1WNLA 3JB9D 2YHTA 4K88A 2DZ9A 1YGBA 2ZT7A 4HWTA 4H2UA 4P73A 4TWAA 4YRQA 4YRIA 4RQEA 3JCMg 1EIYB 1Z7NA 1LYLA 4PNOA 4M75B 1EFWA 2QHSA 4F7UF 3NENA 1N9WA 5GAMd 4Q15A 5GAN7 4OP0A 2ARUA 2IY5B 1HC7A 4C8QE 4WF2A 4P75C 5GAN2 4M7AA 3JCMe 1W66A 4H2VA 4YRGA 2PMEA 3BY7A 2ZIMA 2XTIA 4HWSA 3HRIA 3BFMA 4HT9A 4M78C 3V8JA 1HTTA 3ERRA 5GAOp 2EWNA 3JCMh 1VQZA 2G4CA 4PJOC 2CJBA 2RB6A 1M8VA 5HGQA 4XTZA 5GAN3 1E22A 4J5YA 2PMFA 2RD1A 2ZINA 2EJGA 3JCMc 4UP9A 3HFZB 1YFSA 4J15A 3HXVA 2FB7A 3PCOA 3HXYA 4MMLA 4M7AD 1X56A 4PG3A 1B7YA 4M77E 1SETA 2EL9A 4AH6A 5GAN6 1USYA 2ODRD 4M7DE 1B34A 4WJ3M 3UH0A 5GMKm 1WPYA 5GAMh 2P5IA 2CIMA 4QVDA 4EX5A 3HFOA 4MMKA 1EQRA 2DXUA 4C92E 4C8QF 5C53B 4M7AB 1Z7MA 3BW1A 2DZCA 5LJ3f 1WLEA 4JLIA 4Q6GA 3VQXA 2ZR2A 3E9HA 4C8QG 2DEQA 4NOYA 4A54A 1WQ7A 2E5AA 1IL2A 4CS4A 4TVAA 2EJFA 4NL2A 3VQYA 4RCCA 1G5IA 3INZA 4J6WA 3UGQA 1NYRA 5ELOA 2Y90A 4XQ3A 3VBBA 3QO3A 3RUXA 4P75A 2DJZA 4LNSA 3HFNA 3QUIA 3JB9G 3V7RA 3TEGA 4HT8A 3R07A 4YP0A 3SWNC 1ATIA 1LNXA 3PCOB 3W3SA 5GAOr 2E1HA 2DU7A 1B7YB 4M77F 1GGMA 3HSBA 2FYKA 1H4TA 5GMKl 4M7DF 4M78A 1WQWA 3V7CA 3HRKA 1B34B 4X5OA
chains in the Genus database with same CATH superfamily
3UDCA 1VQ8T 1LJOA 2DMOA 4H2YA 1YWOA 4M7DG 3CCLQ 3JCMJ 5LJ5f 1IHWA 1ZLMA 1M2VB 4KR3A 2GGRA 4ZTZB 1C1AA 3RMSA 2FG0A 4LVIA 2AKLA 4XEMA 1NBEB 1IRXA 1YJWA 3HFVA 2RJCA 8ATCB 4JPBW 3LGFA 1TSFA 2LNHB 3EG0A 2C0TA 3JB9I 4EO4A 3OYFA 1YITQ 2CJAA 2JMAA 4M4ZA 4C8QC 1VUBA 5LJ3j 4M78D 4RTXA 4ORZA 1KHIA 4LN2A 1X2GA 1VQPQ 4M75E 3CCQA 3DB3A 1AOJA 2DIGA 1IGQA 5GAOl 2P84A 1ZSZA 3E1SA 1WFWA 1KC8U 1Q81U 1KC8R 1K8AU 2NUPB 2RJDA 5KYWA 3EHQA 4E6RA 4MZMA 2BUDA 4II1A 4M78B 5CAIA 1ASZA 3TUPA 2F1LA 4NL3A 1D1BA 1NZ9A 3TSZA 3EG9A 1G5HA 2O01E 3H9NA 1GXIE 4NS5A 5D7UA 3JCMW 4RG8A 3VRZA 1UG1A 2DO3A 2OAWA 2QG9B 4YCUA 5DLQE 5LJ5j 2JTFA 3M0TA 4YYEA 2M0YA 2VXFA 1NJ2A 2Q7GA 3CMEA 1D0XA 1EFNA 2FRYA 1VQ8A 3VS1A 1YJWQ 4J9BA 2JTMA 3WVEB 2EYZA 3ME9A 2JW4A 2K3BA 3OYIA 2EKHA 1VQ4T 2KROA 3FDRA 2PUKB 3CBPA 3CXCA 3TEHA 1VIFA 2C8MA 3QWXX 2CP7A 4EIKA 3QHSA 1AWXA 3JCMP 2J7IA 2EYXA 4F7UB 2M0OA 3CCQQ 4P3OA 3SDZA 1Y0MA 2XDPA 5LJ3e 4ZTUB 1IB8A 1ZSGA 2LQKA 2D8HA 2PTKA 2RJFA 1W2BP 1E24A 1NJ5A 1BU1A 2DKGA 3CCRQ 2XG8D 4A53A 3MCAB 4MZPA 1TOVA 2ALYA 2FZGB 2O31A 1O75A 3IG2A 4KUDK 3HTRA 3M4PA 2K3YA 5GMKj 4O5VA 1WHLA 4HT4A 5M9OA 4OMFB 4P71C 4K86A 3LW5E 4CC4B 2ZCEA 4C8QD 3G71T 3I56T 3PTAA 3CMEQ 2PU9B 4YRFA 3C94A 3A32A 2RHXA 4M77A 2LT1A 2F2VA 3LLRA 1VQ8Q 3M4QA 4OB0B 5LJ5e 1B07A 1D3BA 3TSWA 1RABB 2WSFE 2HSEB 2GCXA 2I0NA 2YUPA 4M7AF 1PG5B 3QJ6A 1UFFA 3M0SA 5HY6A 3EGXB 3OMCA 2E10A 2XIDA 4C92A 4C8QB 1PNJA 4OLFA 1B70B 2P0QA 4MDWA 1VQ4A 2LX7A 2DL4A 3QNEA 3OSVA 3REUA 4P72C 1JJ2P 4AFSC 3MHXA 4F7UG 4EMKA 3TREA 3CCST 5I11A 4F17A 2ZR3A 1NYGA 5FU7C 2NUZA 1PRLC 5HKCA 1MV3A 2KDSA 1IREB 4H2XA 1G8XA 3OYYA 5GAMg 4E7HA 2DK3A 1JRIA 3A5ZB 2QQ9A 4M78E 1GRIA 4OMOA 1YB3A 1UJ0A 1FMVA 2MK5A 1VQNT 3UA7A 1AWWA 2CUDA 5GJWB 1VQKT 1UTIA 3EFSA 4LE9A 3QWYA 1L0WA 4P74A 1EIFA 2RQWA 3VJPA 1N8RU 3FB9A 1QCFA 1K9MR 3G71A 1R0CB 3I56A 4P3PA 1N8RR 4C0FA 2DL7A 4L5GA 4PJMA 1ADYA 3HRUA 2LQ8A 1OZ3A 1U1SA 4F04B 2ODRC 1KD1C 4Z88A 1TUCA 1VQ4Q 4JDSA 2DETA 2XDBA 1M1FA 3WXMB 1YCYA 4M75A 2HEQA 3VU3C 4F7UE 3MP6A 2RN8A 2H3EB 2YRVA 3JRZA 4OMPA 1NJIC 2ZPBB 4YRTA 1WJSA 2EIFA 4LDVA 1C6VX 2QQSA 3JB9H 4E47A 1UGQB 5GAN8 5J3BA 4D6WA 2VXEA 2DA9A 2EYYA 2NYSA 2DJQA 1C0AA 2DPPB 4RQFA 2RMOA 4FYWB 3CCSA 4DQ2A 4CC2A 3MQZA 1KFZA 2L3RA 3HL8A 2EGAA 2DXTA 3HXZA 4YRPA 4LDYA 1VYUA 1BBWA 4FSSA 2K2MA 3LSSA 2RQVA 3KUFA 4RMFA 4C5IA 5GMKi 3MEUA 2HSPA 3BDLA 1PD1A 4YRCA 3JCMV 1BI2A 2ZT6A 3G71Q 1VQMT 2J6FA 5DM7R 3I56Q 1WNLA 1VQKA 2YHTA 2ECZA 5KCHA 1YNZA 2EYQA 1HYOA 3J80E 4P73A 4YRQA 4ZTJA 4RQEA 3MEAA 3JCMg 2QEXT 3LYIA 1F1BB 4RTUA 1PRMC 1JB0E 2ZZDA 3H0IA 3NENA 1N9WA 1H3ZA 4Q15A 5GAN7 1QQJA 2IY5B 2DXCA 4C8QE 2CDTA 1HC7A 3A8MB 5GAN2 2EVRA 1I07A 1U5SA 5KYXA 1SSHA 2COYA 3M9QA 4X1VA 2PMEA 2NUTB 4J7FA 2C0IA 2ZPHB 4Q5WA 1EZZB 3X20B 2EPDA 1ZBXA 4E7KA 3M5AA 2OTJT 3CD6T 3BFMA 2WACA 1Z9QA 5IN1A 1YJNT 1M90U 2ENMA 2JOYA 2O2OA 2GQIA 3ERRA 2EQIA 2WSCE 4OMMA 1KG1A 1M90R 5FU7B 3VS0A 3I5RA 2CT4A 4PJOC 2CJBA 3CCSQ 4XTZA 4ZN1A 5GAN3 3MPUB 2EJGA 4FT4A 4HVUA 3M53A 2FB7A 1E6GA 3MKDA 1B7YA 4AH6A 1SETA 2EL9A 3FJ5A 3Q1JA 2ODRD 2QI2A 3G4ST 1W4SA 3GOXA 5CK9A 2WSEE 3ZBDA 5KYYB 5J39A 2KEAA 2QGGA 4XAXB 5L23A 5GAMh 1VQKQ 4EX5A 3M4YA 3M0QA 1UHCA 1M2VA 3HFOA 2K5FA 4MMKA 1EQRA 3SD4A 2VGMA 2F5TX 2DXUA 2HD0A 1ARKA 4EPCA 4LUEA 3SEMA 1SRLA 2D0NA 1VQMA 2B86A 2JUFA 3LGLA 2K9GA 2DIQA 2A7YA 2JNGA 4JLIA 1UJYA 2GQVA 4Q6GA 1X6BA 3LH0A 3UF4A 5FROA 4CS4A 4EDUA 3VQYA 2DBMA 4J6WA 1X6OA 5ELOA 4R0KA 1OU8A 4C5EA 5CKBA 4XQ3A 3QO3A 2COZA 1YI2A 4J9DA 3PVLA 4P75A 1Q7YC 1UECA 4IUPA 3TCJA 1ZUKA 1RAHB 1QVGA 3TEGA 1PCXA 2LCLA 2K79A 2DVJA 3A8HB 4PLLA 4LD9K 5GAOr 2EQKA 2NUPA 2DU7A 4IUVA 3CD6A 4M77F 1GGMA 3PE0A 1YJ9T 1UB4A 4M78A 3HRKA 4JUVA 3I5SA 2BTTA 4DEXA 1N9SA 1ZUYA 3OS5A 2P4TA 3WQZA 2LVMA 4K87A 1R8OB 1D0ZA 2CZ6B 3A31A 2DTIA 3H41A 3RACA 4HVCA 1CKAA 2JS0A 4C92F 2DLPA 1KMMA 2XKOC 5GANj 3NFCA 1E7OA 4RKUE 3G4SA 4E51A 4C92G 1K73U 1WX6A 1D09B 4IURA 4IIMA 3OS1A 1VQMQ 4J9HA 3P8BB 3A8LB 4TVAB 3L1AA 4JJDA 1WHHA 4CH5A 5CO7A 4PJOD 3OYMA 4XTVA 5CCAA 3AHUA 5GAOq 1M8MA 2LCCA 1RADB 3QYGB 4F7UA 5IHKA 4JS5A 5J26A 4LVMA 2R5AA 3SB2A 5ECAA 1WU7A 1ZA1B 3OYJA 2CH4W 3A7UA 1I0CA 2R57A 3LC0A 2LDMA 1VQLA 4FL6A 6AT1B 1SHGA 3X26B 1PKTA 3CD6Q 2JJ9A 4PJOB 3BDUA 2VKNA 4H2TA 3EG1A 1HD3A 3RIRA 4PFOA 1AWJA 4RTYA 4HCZA 2FPFA 1M1GA 3PMIA 2LX9A 1FYFA 2AKKA 2AIRB 2VB6A 4JJBA 3LWIA 1YJ9A 2EYWA 4YCWA 1KQSA 2KT1A 1UHFA 1X2QA 1LPLA 2M1HA 4E7LA 3CCQT 2D9TA 3G4SQ 4IUQA 1AWOA 2RNAA 3OQ5A 4BDYA 4A4HA 4GLKA 2DAQA 2RI5A 1I8FA 4M75F 4PHCA 2LTOA 4WI1A 2Y4XA 3M0RA 3MEVA 5GANe 1N5ZA 2PUOB 1MMDA 4YRSA 4M75G 5I22A 1ADJA 1BKBA 3JB9F 3EGXA 2Y4YA 5GAN5 1Y7XA 1KIKA 4C8QA 2RF0A 3RGLA 4G84A 1B70A 2DL5A 3QO8A 1WI7A 2KK4A 2A08A 3CMAA 1RAGB 1UE9A 3OYCA 2IG0A 4KT0E 4XU2A 3VYGA 1OZ2A 1GFCA 1R77A 5LJ3h 1VQLQ 4J9IA 4QVCA 2KMTA 2KRMA 1NM7A 3ER0A 3MJXA 1Y71A 2AK5A 1XTDA 2RHYA 3MF1A 3NELA 1K1ZA 1MV0B 1KHCA 5IHIA 2E4HA 2VYTA 1BI3A 4BD3A 3A5ZA 2V8KA 1YJ9Q 2RI2A 1YFNA 4C5GA 3OA6A 3S3NA 5GAN4 1WGSA 2E6NA 4JJNK 1C0MA 4A4KA 4YRJA 3KXTA 4E7JA 1E1TA 1NPPA 1FYNA 2QQBA 2FPDA 1JJCB 4IUUA 2YLBA 3ZFJA 2QTXA 2ZXFA 3CXCS 3CCET 3PFSA 2LC4A 2H8HA 4PL6A 3M55A 4FCYA 2XGTA 2DRKA 1PYSB 5LJ5h 2CUBA 3HTZA 4YRKA 4J6XA 2JN0A 3RL6A 1R0BG 2RA2A 2I4MA 5FLXE 3OD1A 1XOVA 1I5OB 1UDLA 3DSQA 5HK3A 3CMAQ 2F2XA 1Q81R 3HPWA 1K8AR 1H4SA 2Q5HA 3L2QA 3UFGA 3QJYA 1G51A 2ZPFB 3OSSC 1G3WA 5GANd 3VYHB 2E12A 2F2WA 1M2OA 2I2LA 1I81A 1U3OA 3RERA 1M1KU 3OW2P 2O9VA 2DX1A 2PVDB 2RM4A 1M1KR 1ABQA 5KYNA 3NETA 3EGDB 3NHNA 2RHSB 3OYNA 4PJOE 3IALA 1GCQC 4L59A 1X69A 3CPWA 1OV3A 2ZZFA 3OYAA 5CQYA 1IHVA 5C0MA 2AZSA 4E7ZA 1OQKA 4QT7A 2ZPIB 4HXJA 1M3CA 1NE8A 2EQUA 2X3XD 4P71A 3A5YA 1JU5C 2X4XA 1MNDA 3VUBA 2XDDA 3X25B 2E65A 2VC8A 4RCBA 1N6AA 1HXDA 1SRYA 4AG2C 4Z8AA 4ZN3A 1ZBJA 4TQFA 4HWRA 4N4HA 3OYEA 5GMKh 1BCOA 4D8DA 3IKMB 3EFOB 5HCKA 5KCOA 2Q5IA 2D1XA 1QP2A 2CGHA 2KSSA 4VUBA 1OPLA 1H4QA 2PQWA 3CCEA 3HRSA 1WJQA 3OYGA 1NJ6A 4KQEA 1J5WA 3L2VA 3LWHA 2AZVA 2YUOA 2IY5A 4TQDA 1VQ7T 2IIMA 3X24B 4M78F 1LOJA 3H8ZA 1BBZA 2NUTA 3JAME 1KK7A 2ZZGA 4P72A 1DJ7B 3HRTA 1EVKA 1G3SA 3CC2T 3ZL7C 4MDXA 2FL7A 4M78G 2LZ6B 5EG2A 1ZQ1A 2E5QA 1USYC 3UWNA 3KFVA 1K9MC 1OI1A 1Y96B 5A0LA 5GAOn 2CJ9A 2GNCA 3GBQA 2HKNA 4AMCA 2J05A 3JCMd 3E9FA 2R58A 4IIOA 1WYXA 3T9NA 4MZTA 2L3QA 4IUTA 2ZPEB 2IVWA 4HCKA 5FU6C 4QW2A 2P0LA 2ZZEA 3CC4A 1B3QA 4KUIA 4BDZA 2CS7A 4K88A 1YGBA 2ROLA 2V8IA 3C0CA 2EFIA 5KYYA 3URGA 4YRIA 1EIYB 5IXBA 1Z7NA 4ELZC 2CKKA 1JXOA 1WDXA 3L2WA 1MMGA 1PD0A 2QHSA 4HCCA 4F7UF 1VYTA 2L8DA 2M51A 3CCEQ 4OB3B 3FRNA 1NEGA 2YUQA 4GBQA 2CSQA 3CCVT 1UEBA 1W66A 4F16A 4OB1B 3A98A 4KGVB 2KXCA 4FM4B 1PWTA 2YDLA 2XTIA 2DD5A 4OF1A 1XJWB 1QLYA 4Z89A 3UT1A 1HTTA 4J9EA 1VQZA 3REAB 5KYUB 3CEYA 1VQ7A 1M8VA 1RAFB 5HGQA 2RD1A 2RJEA 2ZAEA 1X6GA 4UP9A 4J15A 3CC2A 3HXYA 4PG3A 3CPFA 3WVDB 3QIIA 2L3SA 2K3XA 2O88A 3A8GB 4HCBA 4WJ3M 3UH0A 5IT9E 1W1FA 2QDLA 1M3AA 2E5KA 2QK0A 2XU8A 2KXDA 3RNJA 1RL2A 3QBYA 4R56A 1UUEA 5A0GA 4C8QF 5C53B 1WHKA 1QVFA 4FYYB 2LJ0A 1OPKA 3BW1A 1WLEA 3VQXA 4HVWA 2ZR2A 3CCMT 4C8QG 2DEQA 4A54A 1WQ7A 2HL3A 1OEBA 1WXUA 3VS2A 4TVAA 2EJFA 1QWFA 3INZA 1NYRA 1G2BA 1RACB 3VBBA 5AYFA 4ME7A 1S72T 2DJZA 3GP8A 3CCVA 2JZ2A 2YRDA 3H0FA 4HT8A 3R07A 4YP0A 3SWNC 1VQ7Q 3SFMA 4DBQA 3PCOB 3W3SA 3EG2A 2KRNA 2FYKA 2KR3A 1H4TA 2O9SA 3CC2Q 2CH4A 4X5OA 2YWWA 2X9HA 4PJOA 1SHFA 3M0UA 4FSXA 4N0AC 1SSFA 2GTJA 3V7SA 5D6YA 2Z0WA 3ASKA 2HQEA 5FU6B 5CIUA 3V8LA 3ZEHA 4AFUC 3DLMA 1BCMA 1V76A 3QDRB 4JRIA 4J9CA 1ACMB 5EC7A 1YI2T 2CP2A 1LCKA 1U1TA 3V8KA 4H2SA 1VQOT 4XU3A 3RDVA 2MMPA 1X55A 2M02A 1YCSB 4A63B 4BUGA 8AT1B 1SEMA 2B8AA 3A1PA 1VIEA 4CH6A 2RQTA 2DL3A 3S6WA 3CCMA 2P4RA 1A0NB 2DVEA 1RLPC 3CCVQ 1YHQA 3CXCP 1EVLA 3OYBA 1QVGS 1X75C 1NJ1A 4FYXB 4V2SA 3UPUA 1X43A 1IXDA 2DTOA 1YBYA 2Q7EA 3LH5A 1S72A 4X9DA 4RTWA 3PNWC 3GNGA 1E6HA 1YN8A 1SF9A 4M7DC 3J7AF 2MOXA 1VOMA 2OAUA 1NJIU 4EMHA 4UP7A 3M4GA 1NJIR 4PFPA 2X51A 3U23A 1QE0A 3OYLA 3DB4A 2DDZA 4G85A 1KQ1A 2GBQA 3PVQA 3NTKA 3EG3A 4J6YA 5GANf 1H92A 5DY9A 4AT1B 1NNHA 2ARTA 2EJ9A 2C06A 2CSIA 5CKHA 2W0ZA 3RF1A 1M5Q1 2LRQA 5LJ3g 2PVOB 2ZNIA 4A4GA 3VQWA 1J3TA 2GFUA 5LL6S 1I5LA 4X9CA 1JJCA 3OS0A 1YFTA 3EH2A 3UGTA 2PVGB 4ZIBA 1VQLT 1AD5A 2HDAA 1I4K1 2CP3A 1PYSA 4JRPA 4LNPA 2VGNA 3CCMQ 3MEYA 4TVYA 1VQOA 2DQ0A 1P92A 3OYKA 3BJUA 4J8OA 1K0SA 1SESA 1ZX6A 3JB9J 1BI0A 2HNIA 2AKWB 1G5VA 1X2KA 2DM1A 3PGGA 4AFQC 4DOWA 1K76A 1S72Q 4KR2A 3SWNB 4RTVA 2I4NA 5F5WA 3L2ZA 2E3CA 3MEWA 5FWBA 4LUDA 4BW9A 1RIQA 4O2DA 3GF5A 11ASA 1Q86C 3REXA 5LJ5g 2EW3A 3P8VA 3AT1B 1RI0A 3R6NA 1WXTA 3RKYA 1BBUA 1QVPA 4YPFA 3EGDA 1KQSS 2RHSA 4LDXA 3UA6A 3EAEA 3OBWA 3UATA 4ESRA 4NCXA 2KAFA 4XTWA 2ROTA 4BE0A 1H3HA 2ZIOA 2RHQB 1K73R 4C5HA 1S1NA 1B76A 3QZ9B 1W2BA 3TEEA 2JM9A 1BYMA 1PSFA 2L0AA 2LCSA 1Q82C 3KFUA 2QHVA 3CMAT 4OMQA 1FX7A 4OB2B 3VQVA 4J9FA 3GIBA 1NLOC 1RI9A 3RESA 4BWAA 3JCMf 3IKLA 1T0JA 2F5KA 5DLOA 3JCMb 1XNIA 3MP8A 3L4GB 2VASA 3EH1A 2AMCB 1YI2Q 12ASA 3EFOA 4WTOB 1QW1A 2COWA 2DQ3A 1VQOQ 1JBMA 1Y07A 4CH4A 3DKMA 4M7DD 3VS7A 4FW2A 1WZOA 2X4JA 3JV3A 5C51B 2QXFA 1BIBA 1WJRA 1OX9A 4LDUA 4PJNA 2LQNA 3CCJT 2MWPA 2M9UA 1W6XA 2X4YA 2EKOA 5I2SA 3G6ET 2CREA 3QTCA 3HY0A 4M7DB 2ABLA 4GY5A 2OTLA 1VQ6A 5GAMe 3VKIA 1BB9A 4QQ6A 3JCMQ 1Q7YU 3EGUA 1Y96A 3NMZC 2VVKA 5I21A 1M27C 2EAYA 1Q7YR 4FU6A 2QASA 2E41A 3NEMA 1WA7A 4PJJA 1B7TA 1EOVA 1HJDA 3HY1A 2E3IA 5ELNA 2RH2A 3L2RA 1JJ2A 2O4XB 2QHTA 1BIAA 1KC8C 4HWOA 1AZGB 2AT1B 1YP5A 2X4WA 3M54A 4JRQA 1Q81C 4M7AC 1K8AC 2DILA 4XTXA 4J9GA 2LNVA 3NPFA 5K1PA 1MUZA 4LVLA 1EIYA 1QP3A 4CC7A 4BE2A 4L6V5 2W10A 4RMOA 2A8EA 4C0GA 4PKCC 5I2MA 4CH3A 1TG0A 3EFRA 5FRMA 1VQPA 3P8YA 1YIJT 1IZ6A 1VA7A 1JQQA 2CP0A 4XU0A 1Y57A 1NPRA 2MAMA 4IKFA 1HK9A 2HCKA 4PJOF 2QTVA 5GAOm 4JRKA 4J7IA 4EMGA 1TUDA 1AHJB 4B6MA 3OY9A 5FRNA 4PJOG 3CCJA 2CP5A 4WCIA 4BI4A 1AEYA 3CPWS 5KYUA 1VQ6Q 2KRSA 4PLIA 1QWEA 2SRCA 5IHNA 3E9GA 3G6EA 4HWPA 3C95A 3A7RA 4YCVA 4Z02A 2LP5A 2JM8A 3LSQA 2JVVA 4YROA 1GCQA 4BB7A 2ZT8A 2RI3A 1QMCA 3M0PA 1AT1B 1JEGA 2DZ9A 4FYVB 2KI7A 2RPNA 4BACA 4DBHA 1PM3A 4PNOA 1EFWA 2X3WD 2XHCA 5GAMd 2SEMA 2E6ZA 2L89A 4DOVA 4WF2A 2A36A 2D8JA 3JCMe 4ZGDB 1X27A 3O5ZA 1OU9A 4F14A 4YRGA 2MWOA 3BY7A 2ZIMA 1PSEA 2XI9A 5L8RE 3I55T 5CKEA 4XK8E 3P8HA 4HWSA 4HT9A 3V8JA 1SG5A 3HP9A 5GAOp 1VQ5T 4LD6A 1GL5A 2G4CA 1YIJA 3CCRA 1TWBA 1E22A 4K11A 4J5YA 2FRWA 3CBOA 3CCJQ 3CC4T 1WHMA 3HFZB 1YFSA 2KYBA 2EBPA 2A37A 3PCOA 3MP1A 4MMLA 4M7AD 2H3JA 2IPOB 3G6EQ 2JT4A 2DE0X 4KGZB 1USYA 4DA4A 4M7DE 2CT3A 2KQWA 1QVGP 5D6WA 3QXEB 1FWZA 3MO8A 3X28B 2QYZA 4QVDA 1O9SA 1T3LA 4LDWA 4RTTA 2PZ1A 2AHJB 4CRIA 4FT2A 4M7AB 1Z7MA 4LXCA 1ZSZC 2RK1A 1OULA 3E9HA 2EGEA 2E5AA 2DFUA 1OOTA 3TVTA 2DYIA 4NL2A 1ZA2B 2DF6A 2Y90A 2J06A 5KH6A 4LVJA 3CC7T 2V26A 2HBWA 9ATCB 3JSCA 2LJ3A 2E70A 3RUXA 2BKDN 2L2PA 1PKSA 3HFNA 3R6OA 1MMAA 4GLMA 2DYBA 1YIJQ 2HBPA 5FW9A 1UGSB 3I55A 3PMTA 1IO6A 1N8RC 5D6XA 3GNFB 5CKDA 7AT1B 3HSBA 1QKXA 1H8KA 1WQWA 1B34B 4B9WA 1VQ5A 2OI3A 2HL5C 3OYHA 2EQMA 4PJLA 1RAAB 3NTHA 4RG2A 4R55A 4TVRA 2A28A 1QCOA 4QQDA 5CVIA 1YFRA 2KGTA 2MIOA 1TS9A 4Y91A 1M30A 3CMQA 1QVFS 5KE3A 1B8AA 4UPAA 3MF2A 2ZCFB 2ED1A 3L2UA 2K7AA 2KBTA 2ZTGA 1NLPC 3HXUA 2KYMA 1KQSP 1MNEA 1MHNA 4ZTFA 4M7AG 3I7FA 2Q7HA 4DBRA 2NS6A 4JJCA 3RKXA 3JCMX 4N4IA 5FWCA 4KBMB 4QVZA 1D1AA 1TUGB 3TU4K 2QGFB 3FJPA 3VS3A 1EX4A 3ICAA 3I55Q 4XEOA 3CC7A 1JXMA 2I4OA 2CZ7B 2AKWA 4M77C 2YXYA 4UC4A 2OJ2A 3C12A 2LT4A 1VQ5Q 1X01A 2LQWA 1V1CA 2HQHA 2MF2A 2YLCA 3SWNA 5LJ3d 3CQTA 1X2HA 3CC4Q 3P8DA 3VS6A 4BI8B 1FXXA 3M57A 3CCUT 5GMKe 5GANg 4C92C 2BE9B 4OMNA 2C7IA 4CS3A 1WYDA 3D7SB 5GJVB 4N4GA 1U8RA 1K9MU 4BI3A 1ASYA 3IQLA 2E64A 4N0AA 2K4YA 3HHTB 1PC0A 4H2WA 1FMKA 4CS2A 2YSQA 2EQJA 1M90C 2P0PA 4OVAA 2RHQA 2NLUA 3FIFA 3QDFA 4HA8A 4ZGEB 2DERA 4YDQA 1YHQT 5IXFA 3P8TA 1ZSZB 3E9IA 2JXBA 4EMKC 3I9QA 2V8JA 4M7AE 4YRLA 2XMFA 2DL8A 4C0DC 4XTYA 3C4SA 3S3MA 1T3SA 3G1ZA 3TQ7P 5KYWB 2QA4T 4KULA 1RLQC 3L4GA 2V1QA 3OS2A 2DU5A 5LJ5d 2D6FA 5A2QE 1CKBA 2AMCA 3QKJA 3EG9B 2XD0A 4XU1A 1RUWA 2FPEA 3CC7Q 2XICA 3NTIA 1RAEB 2QHUA 4PK4A 2RO0A 3LX7A 2J3MA 1SKUB 3PT9A 1SERA 5IH2A 4LVKA 4P74C 3ULRB 2RQRA 4P3NA 2J3LA 4FW1A 2E3HA 2ZGWA 3OMGA 4RUGA 2I4LA 3HXWA 2OX7A 4RDXA 2ARSA 4M7DA 1E1OA 4OMLA 3TEHB 3H6ZA 4BY6C 1VQNA 2RK2A 2BIVA 1MGQA 5K1XA 4XTUA 2KE9A 1GFDA 2FZKB 4J83A 3CCUA 3CPWP 4M75C 4PFZA 3L42A 5CKFA 4DEYA 1V29B 4Y92A 2O4XA 4P5NA 4ATOA 3E2UA 4CI0C 3VRYA 3QO5A 1K9AA 1WXBA 3OBYA 4O6JA 2QAZA 2MCNA 3QSUA 3QPHA 1IGUA 1AVZC 1K4US 3E19A 4OGEA 3OW2S 4M77D 1G3TA 2ALYB 1ZUUA 2A0FB 4X34A 3VUZA 2ZNJA 2ZT5A 2JMCA 3O8VA 3QZ5B 1KD1U 4UP8A 1H4VB 4YTLA 2RHUA 2YUNA 2MI6A 1GCPA 1KD1R 2R5MA 1TH7A 3CBMA 2EGCA 3RBBB 4ELYC 2QA4A 5GAMf 3PZCA 2BZXA 5E3IA 5IAYA 1T0HA 4C92D 4A4FA 3VS5A 4JS4A 2L3PA 4D8KA 4KH1B 1K73C 4M77B 3GPLA 5CQXA 2VUBA 2QQRA 2C0OA 1FMWA 4TTVA 4FIBA 1D3BB 1VQ9T 4P73C 2DNUA 2JS2A 2DXBA 3FC3A 4C0ZA 1UGVA 1Z9ZA 2L5QA 2FVUA 1VQNQ 4HVVA 4Y28E 3PIPA 4C92B 1LVKA 1W2BS 4YRRA 3OB9A 3A8OB 2RHIA 3CCUQ 2VWFA 4RTZA 1KMNA 1BI1A 1ZHIA 3RMQA 2A3LA 5AT1B 4DPGA 1G83A 1TXQA 1M3BA 1KQ2A 3OW2A 1D1CA 4EMKB 4E7SA 5GANh 1NYFA 2JTEA 1YHQQ 3A74A 2DTHA 3GLXA 2RQUA 2NWMA 3NGPA 4C0DB 1GBQA 2BZYA 2CZ0B 1Q95G 3HKSA 2QEXA 4YREA 4KH0B 1G3YA 1NJ8A 4H2XB 2CYZB 2KY9A 4KGXB 1K0XA 4TVWA 4WJ4A 3QO7A 4KRTA 4H02A 2VV5A 2OTLT 2QA4Q 1VQ6T 3HXXA 5GAMj 1NYQA 2K2VA 4JZ4A 1UGRB 1H641 3M56A 1I1JA 2G3RA 2LJ1A 5HK0A 4ZNXA 1KOGA 3CCLT 3FEOA 3M58A 1QF6A 5C52B 2OTJA 4JZ3A 4ANJA 2J6KA 1N27A 3REBB 1YWPA 1YJNA 4M75D 2HMAA 4AFZC 4E2FB 2RHZA 2F69A 2KT8A 2BZ8A 5KNNA 4L87A 3I35A 3KBGA 3HFZA 1N9RA 2K57A 4M77G 4OGCA 3RKWA 2YRCA 3SHWA 4YRMA 1X54A 3G7ZA 2ED0A 1OYXA 4AG1C 3A7AA 2DRMA 2KVQG 2MPXC 3G1JA 1YITT 1JJ2S 3JB9D 4YRNA 3N5BB 1VQ9A 5C6SA 4BY6B 2ZT7A 4HWTA 4H2UA 2HZYA 4TWAA 2GF7A 1AZEA 1KJWA 1VQPT 1LYLA 2K6DA 1KSWA 1XQHA 4M75B 4QQGA 4QKUA 1ABOA 3F70A 2QDYB 4OP0A 2ARUA 4P75C 5CR2A 4M7AA 4H2VA 2BE7D 1U06A 1QKWA 2QEXQ 1MMNA 3VV0A 4HKEA 3FLGA 2HKQB 3HRIA 1QVFP 3QYHB 2X35A 4E7IA 2DEUA 4M78C 3VS4A 2EWNA 3JCMh 2DBKA 1TTHB 2RB6A 2ZPGB 2KNBB 1NG2A 1M4ZA 2ZINA 2GTOA 1WIEA 2PMFA 1WHGA 3JCMc 2FO0A 2OTJQ 2ESWA 4B9XA 3HXVA 2D0QB 3RR6A 1YJNQ 1PHTA 3BE3A 1X56A 1YJWT 4JLGA 1JO8A 2V1RA 2LMJA 2FZCB 4M77E 5GAN6 1WHJA 3CCLA 1SPKA 1B34A 1RAIB 1NEBA 5GMKm 2M16A 3THKA 3M59A 1WPYA 2ATCB 2P5IA 2FHDA 1VQ9Q 2CIMA 2DD4A 1TU0B 3DLLA 1Q86U 2CP6A 1VYVA 2QQAA 4C92E 4DBFA 1Q86R 1WLPB 2K5LA 1YITA 1HSQA 3J81E 2DZCA 2XK0A 5KYXB 5LJ3f 5KE2A 1D0YA 2P0KA 3OYDA 4NOYA 1M1KC 1IL2A 1M9SA 1QCNA 2J6OA 2FEIA 3EHRA 1BK2A 2YT6A 2G6FX 4RCCA 3CCRT 3META 1G5IA 2HAXA 5A0DA 3UGQA 2K5IA 1SRMA 1OX8A 2MYSA 1Q82U 4LNSA 4ZGJB 1GBRA 3QUIA 4BE1A 3JB9G 3V7RA 1Q82R 2GFAA 1CSKA 4CC3A 1ATIA 3PIOA 1LNXA 2E1HA 2PNIA 2OTLQ 1B7YB 1W70A 4A4EA 1UGPB 3CMET 3QG1A 2HQXA 5GMKl 4M7DF 2CZ1B 3V7CA 3H0HA 3S3OA
chains in the Genus database with same CATH topology
3UDCA 1VQ8T 1LJOA 4H2YA 4M7DG 3JCMJ 5LJ5f 4KR3A 4ZTZB 3RMSA 4LVIA 4XEMA 1YJWA 3HFVA 2RJCA 3LGFA 3JB9I 4EO4A 3OYFA 2CJAA 4C8QC 5LJ3j 1VUBA 4M78D 1KHIA 1X2GA 4M75E 3CCQA 3DB3A 2DIGA 5GAOl 3E1SA 1KC8U 1Q81U 1K8AU 2RJDA 4MZMA 2BUDA 4II1A 4M78B 5CAIA 1ASZA 3TUPA 4NL3A 1NZ9A 1G5HA 2O01E 1GXIE 4NS5A 3JCMW 4RG8A 2DO3A 4YCUA 5DLQE 5LJ5j 2JTFA 4YYEA 2VXFA 1NJ2A 2Q7GA 3CMEA 1VQ8A 2JTMA 3WVEB 3ME9A 3OYIA 1VQ4T 3FDRA 2PUKB 3CBPA 3CXCA 3TEHA 1VIFA 2C8MA 3QHSA 3JCMP 4F7UB 2M0OA 4P3OA 3SDZA 2XDPA 5LJ3e 4ZTUB 2LQKA 2RJFA 1E24A 1NJ5A 2DKGA 2XG8D 4A53A 3MCAB 4MZPA 2ALYA 1O75A 3IG2A 4KUDK 3M4PA 2K3YA 5GMKj 4O5VA 4HT4A 5M9OA 4OMFB 4P71C 4K86A 3LW5E 2ZCEA 4C8QD 3G71T 3I56T 3PTAA 4YRFA 2PU9B 3C94A 3A32A 2RHXA 4M77A 2LT1A 3LLRA 3M4QA 4OB0B 5LJ5e 1D3BA 2WSFE 2GCXA 4M7AF 3QJ6A 5HY6A 3OMCA 4C92A 2E10A 2XIDA 4C8QB 4OLFA 1B70B 2P0QA 4MDWA 1VQ4A 3QNEA 3OSVA 3REUA 4P72C 3MHXA 4F7UG 4EMKA 3TREA 3CCST 2ZR3A 5FU7C 5HKCA 2KDSA 1IREB 4H2XA 3OYYA 5GAMg 4E7HA 2DK3A 1JRIA 3A5ZB 2QQ9A 4M78E 1YB3A 1VQNT 1VQKT 3EFSA 1L0WA 4P74A 1EIFA 3VJPA 1N8RU 3FB9A 3G71A 3I56A 4P3PA 4C0FA 4L5GA 1ADYA 3HRUA 2LQ8A 1OZ3A 1U1SA 2ODRC 1KD1C 4JDSA 2XDBA 1M1FA 3WXMB 1YCYA 4M75A 3VU3C 4F7UE 3MP6A 2YRVA 3JRZA 1NJIC 2ZPBB 4YRTA 1WJSA 2EIFA 4LDVA 2QQSA 3JB9H 4E47A 1UGQB 5GAN8 5J3BA 4D6WA 2VXEA 1C0AA 2DPPB 4RQFA 3CCSA 4DQ2A 3MQZA 2L3RA 3HL8A 2DXTA 3HXZA 4YRPA 4LDYA 1BBWA 3LSSA 3KUFA 4RMFA 4C5IA 5GMKi 3MEUA 3BDLA 4YRCA 3JCMV 1BI2A 2ZT6A 1VQMT 5DM7R 1WNLA 1VQKA 2YHTA 5KCHA 2EYQA 3J80E 4P73A 4YRQA 4ZTJA 4RQEA 3MEAA 3JCMg 2QEXT 3LYIA 1JB0E 2ZZDA 3NENA 1N9WA 1H3ZA 4Q15A 5GAN7 2IY5B 2DXCA 4C8QE 1HC7A 3A8MB 5GAN2 3M9QA 2PMEA 4J7FA 2ZPHB 4Q5WA 3X20B 1ZBXA 4E7KA 3M5AA 2OTJT 3CD6T 3BFMA 2WACA 5IN1A 1YJNT 1M90U 2JOYA 3ERRA 2WSCE 1KG1A 5FU7B 4PJOC 2CJBA 4XTZA 4ZN1A 5GAN3 2EJGA 4FT4A 3M53A 2FB7A 1B7YA 4AH6A 1SETA 2EL9A 3Q1JA 2ODRD 2QI2A 3G4ST 1W4SA 3GOXA 5CK9A 2WSEE 3ZBDA 5J39A 4XAXB 5GAMh 4EX5A 3M4YA 3HFOA 2K5FA 4MMKA 1EQRA 3SD4A 2VGMA 2F5TX 2DXUA 2HD0A 4EPCA 1VQMA 2JUFA 3LGLA 2DIQA 2A7YA 2JNGA 4JLIA 2GQVA 4Q6GA 3LH0A 5FROA 4CS4A 4EDUA 3VQYA 4J6WA 1X6OA 5ELOA 4C5EA 5CKBA 4XQ3A 3QO3A 1YI2A 4P75A 1Q7YC 4IUPA 3TCJA 3TEGA 1QVGA 2LCLA 3A8HB 4PLLA 4LD9K 5GAOr 2EQKA 2DU7A 4IUVA 3CD6A 4M77F 1GGMA 1YJ9T 1UB4A 4M78A 3HRKA 4JUVA 1N9SA 3OS5A 2P4TA 3WQZA 2LVMA 4K87A 1R8OB 2CZ6B 3A31A 2DTIA 4HVCA 3RACA 4C92F 1KMMA 2XKOC 5GANj 3NFCA 4RKUE 3G4SA 4E51A 4C92G 1K73U 4IURA 3OS1A 3P8BB 3A8LB 4TVAB 3L1AA 4CH5A 5CO7A 4PJOD 3OYMA 4XTVA 5CCAA 3AHUA 5GAOq 2LCCA 3QYGB 4F7UA 4JS5A 5J26A 4LVMA 2R5AA 3SB2A 1WU7A 3OYJA 3A7UA 2R57A 3LC0A 2LDMA 1VQLA 4FL6A 3X26B 4PJOB 3BDUA 4H2TA 3RIRA 4HCZA 1M1GA 3PMIA 2LX9A 1FYFA 3LWIA 1YJ9A 4YCWA 1KQSA 2M1HA 4E7LA 3CCQT 2D9TA 4IUQA 3OQ5A 4BDYA 4A4HA 4GLKA 2DAQA 2RI5A 1I8FA 4M75F 4PHCA 2LTOA 4WI1A 2Y4XA 3MEVA 5GANe 2PUOB 4YRSA 4M75G 1ADJA 1BKBA 3JB9F 2Y4YA 5GAN5 1Y7XA 4C8QA 3RGLA 4G84A 1B70A 3QO8A 2KK4A 3CMAA 3OYCA 2IG0A 4KT0E 4XU2A 3VYGA 1OZ2A 5LJ3h 4QVCA 2KMTA 3ER0A 1Y71A 1XTDA 2RHYA 3MF1A 3NELA 1KHCA 2VYTA 1BI3A 4BD3A 3A5ZA 2V8KA 2RI2A 4C5GA 3OA6A 3S3NA 5GAN4 1WGSA 2E6NA 4JJNK 4A4KA 4YRJA 3KXTA 4E7JA 1E1TA 1NPPA 2QQBA 1JJCB 4IUUA 2YLBA 3ZFJA 2QTXA 2ZXFA 3CXCS 3CCET 3PFSA 2LC4A 4PL6A 3M55A 2XGTA 1PYSB 5LJ5h 3HTZA 4YRKA 4J6XA 2JN0A 3RL6A 2RA2A 2I4MA 5FLXE 3OD1A 1XOVA 3DSQA 5HK3A 3HPWA 1H4SA 2Q5HA 3L2QA 3UFGA 3QJYA 1G51A 2ZPFB 3OSSC 1G3WA 5GANd 3VYHB 2E12A 2I2LA 1I81A 3RERA 1M1KU 2PVDB 2RM4A 3NETA 2RHSB 3OYNA 4PJOE 3IALA 4L59A 3CPWA 2ZZFA 3OYAA 5CQYA 5C0MA 2ZPIB 1NE8A 2EQUA 4P71A 3A5YA 2X4XA 3VUBA 2XDDA 3X25B 2E65A 2VC8A 4RCBA 1N6AA 1HXDA 1SRYA 4ZN3A 4TQFA 4HWRA 4N4HA 3OYEA 5GMKh 3IKMB 5KCOA 2Q5IA 1QP2A 2CGHA 2KSSA 4VUBA 1H4QA 2PQWA 3CCEA 3HRSA 1WJQA 3OYGA 1NJ6A 4KQEA 1J5WA 3L2VA 3LWHA 2IY5A 4TQDA 1VQ7T 3X24B 4M78F 1LOJA 3H8ZA 3JAME 2ZZGA 4P72A 1DJ7B 3HRTA 1EVKA 1G3SA 3CC2T 4MDXA 2FL7A 4M78G 5EG2A 1ZQ1A 2E5QA 1USYC 3UWNA 1K9MC 1OI1A 1Y96B 5A0LA 5GAOn 2CJ9A 3JCMd 3E9FA 2R58A 3T9NA 4MZTA 4IUTA 2ZPEB 2IVWA 5FU6C 4QW2A 2P0LA 2ZZEA 3CC4A 4KUIA 4BDZA 2CS7A 4K88A 1YGBA 2V8IA 2EFIA 3URGA 4YRIA 1EIYB 1Z7NA 4ELZC 2CKKA 3L2WA 2QHSA 4HCCA 4F7UF 2L8DA 4OB3B 3FRNA 1W66A 3CCVT 1UEBA 4OB1B 4FM4B 2XTIA 2DD5A 4OF1A 3UT1A 1HTTA 1VQZA 3CEYA 1VQ7A 1M8VA 5HGQA 2RD1A 2RJEA 4UP9A 4J15A 3CC2A 3HXYA 4PG3A 3CPFA 3WVDB 3QIIA 2K3XA 3A8GB 4HCBA 4WJ3M 3UH0A 5IT9E 2XU8A 1RL2A 3QBYA 4R56A 5A0GA 4C8QF 5C53B 1QVFA 3BW1A 1WLEA 3VQXA 2ZR2A 3CCMT 4C8QG 2DEQA 4A54A 1WQ7A 4TVAA 2EJFA 3INZA 1NYRA 3VBBA 5AYFA 4ME7A 1S72T 2DJZA 3GP8A 3CCVA 2JZ2A 4HT8A 3R07A 4YP0A 3SWNC 3SFMA 3PCOB 3W3SA 2FYKA 1H4TA 4X5OA 4PJOA 4FSXA 4N0AC 1SSFA 3V7SA 5D6YA 3ASKA 5FU6B 2HQEA 5CIUA 3V8LA 3ZEHA 3DLMA 3QDRB 4JRIA 1YI2T 3V8KA 1U1TA 4H2SA 1VQOT 4XU3A 2MMPA 1X55A 4BUGA 2B8AA 1VIEA 4CH6A 3S6WA 3CCMA 2DVEA 1YHQA 1EVLA 3OYBA 1QVGS 1X75C 1NJ1A 4V2SA 3UPUA 2DTOA 1YBYA 2Q7EA 1S72A 4X9DA 3PNWC 3GNGA 4M7DC 3J7AF 2OAUA 1NJIU 4EMHA 4UP7A 3M4GA 1QE0A 3OYLA 3DB4A 2DDZA 4G85A 1KQ1A 5GANf 3NTKA 1NNHA 4J6YA 5DY9A 2ARTA 2EJ9A 2C06A 5CKHA 3RF1A 1M5Q1 2LRQA 5LJ3g 2PVOB 2ZNIA 4A4GA 3VQWA 2GFUA 5LL6S 1I5LA 4X9CA 1JJCA 3OS0A 1YFTA 3UGTA 2PVGB 4ZIBA 1VQLT 1I4K1 1PYSA 4JRPA 2VGNA 3MEYA 4TVYA 1VQOA 2DQ0A 1P92A 3OYKA 3BJUA 4J8OA 1SESA 3JB9J 1BI0A 2HNIA 2AKWB 1G5VA 3PGGA 4DOWA 4KR2A 3SWNB 5F5WA 2I4NA 3L2ZA 2E3CA 3MEWA 4BW9A 1RIQA 4O2DA 3GF5A 11ASA 1Q86C 3REXA 5LJ5g 3P8VA 1RI0A 3RKYA 1BBUA 1QVPA 4YPFA 1KQSS 2RHSA 4LDXA 3EAEA 3OBWA 4NCXA 2KAFA 4XTWA 4BE0A 2ZIOA 2RHQB 4C5HA 1B76A 3QZ9B 1W2BA 3TEEA 1BYMA 1PSFA 1Q82C 3KFUA 2QHVA 3CMAT 1FX7A 4OB2B 3VQVA 3GIBA 3RESA 4BWAA 3JCMf 3IKLA 2F5KA 5DLOA 3JCMb 1XNIA 3MP8A 3L4GB 2AMCB 12ASA 1QW1A 2DQ3A 1JBMA 1Y07A 4CH4A 3DKMA 4M7DD 2X4JA 5C51B 2QXFA 1BIBA 1WJRA 4LDUA 3CCJT 2MWPA 2M9UA 2X4YA 2EKOA 5I2SA 3G6ET 3QTCA 3HY0A 4M7DB 4GY5A 2OTLA 1VQ6A 5GAMe 3VKIA 4QQ6A 3JCMQ 1Q7YU 1Y96A 5I21A 2EAYA 4FU6A 2E41A 3NEMA 1EOVA 3HY1A 5ELNA 2RH2A 3L2RA 1JJ2A 2O4XB 2QHTA 1BIAA 1KC8C 4HWOA 2X4WA 1Q81C 3M54A 4JRQA 4M7AC 1K8AC 4XTXA 2LNVA 5K1PA 4LVLA 1EIYA 1QP3A 4BE2A 4L6V5 4RMOA 2A8EA 4C0GA 4PKCC 5I2MA 4CH3A 3EFRA 5FRMA 1VQPA 3P8YA 1YIJT 1IZ6A 4XU0A 1NPRA 2MAMA 4IKFA 1HK9A 4PJOF 5GAOm 4JRKA 4J7IA 4EMGA 1AHJB 3OY9A 5FRNA 4PJOG 3CCJA 4BI4A 3CPWS 4PLIA 3E9GA 3G6EA 4HWPA 3C95A 3A7RA 4YCVA 4Z02A 3LSQA 2JVVA 4YROA 4BB7A 2ZT8A 2RI3A 2DZ9A 4BACA 4PNOA 1EFWA 2XHCA 5GAMd 2E6ZA 2L89A 4DOVA 4WF2A 3JCMe 4ZGDB 4YRGA 2MWOA 3BY7A 2ZIMA 1PSEA 2XI9A 5L8RE 3I55T 5CKEA 4XK8E 3P8HA 4HWSA 4HT9A 3V8JA 3HP9A 5GAOp 1VQ5T 4LD6A 2G4CA 1YIJA 3CCRA 1E22A 4J5YA 3CBOA 3CC4T 3HFZB 1YFSA 3PCOA 3MP1A 4MMLA 4M7AD 2H3JA 1USYA 4DA4A 4M7DE 2KQWA 5D6WA 3QXEB 1FWZA 3MO8A 3X28B 4QVDA 1O9SA 4LDWA 2AHJB 4CRIA 4FT2A 4M7AB 1Z7MA 2RK1A 3E9HA 2E5AA 4NL2A 2Y90A 5KH6A 4LVJA 3CC7T 3JSCA 2E70A 3RUXA 2BKDN 3HFNA 3R6OA 2HBPA 1UGSB 3I55A 3PMTA 1N8RC 5D6XA 3GNFB 5CKDA 3HSBA 1WQWA 1B34B 4B9WA 1VQ5A 3OYHA 2EQMA 3NTHA 4RG2A 4R55A 4TVRA 4QQDA 5CVIA 1YFRA 4Y91A 3CMQA 1QVFS 5KE3A 1B8AA 4UPAA 3MF2A 2ZCFB 3L2UA 2ZTGA 3HXUA 1MHNA 4ZTFA 4M7AG 3I7FA 2Q7HA 2NS6A 3RKXA 3JCMX 4N4IA 4KBMB 4QVZA 3TU4K 3FJPA 3ICAA 4XEOA 3CC7A 2I4OA 2CZ7B 2AKWA 4M77C 4UC4A 3C12A 2LT4A 1X01A 3SWNA 2MF2A 2YLCA 1X2HA 5LJ3d 3P8DA 4BI8B 1FXXA 3M57A 3CCUT 5GMKe 5GANg 4C92C 4CS3A 2C7IA 1WYDA 4N4GA 1U8RA 1K9MU 4BI3A 1ASYA 2E64A 4N0AA 2K4YA 3HHTB 4H2WA 4CS2A 2EQJA 1M90C 2P0PA 4OVAA 2RHQA 2NLUA 3FIFA 4HA8A 4ZGEB 4YDQA 1YHQT 3P8TA 3E9IA 4EMKC 2V8JA 4M7AE 4YRLA 4C0DC 4XTYA 3C4SA 3S3MA 3G1ZA 2QA4T 4KULA 3L4GA 3OS2A 2DU5A 5LJ5d 2AMCA 5A2QE 2D6FA 3QKJA 2XD0A 4XU1A 2XICA 3NTIA 2QHUA 2RO0A 3LX7A 2J3MA 3PT9A 1SERA 4LVKA 4P74C 4P3NA 2J3LA 2ZGWA 3OMGA 2I4LA 3HXWA 4RDXA 2ARSA 4M7DA 1E1OA 3TEHB 3H6ZA 4BY6C 1VQNA 2RK2A 2BIVA 1MGQA 5K1XA 4XTUA 4J83A 3CCUA 4M75C 3L42A 5CKFA 1V29B 2O4XA 4P5NA 4ATOA 4CI0C 3QO5A 3OBYA 4O6JA 3QSUA 3QPHA 3E19A 4OGEA 3OW2S 4M77D 1G3TA 2ALYB 4X34A 3VUZA 2ZNJA 2ZT5A 3O8VA 3QZ5B 1KD1U 4UP8A 1H4VB 4YTLA 2RHUA 2MI6A 2R5MA 1TH7A 3CBMA 4ELYC 2QA4A 5GAMf 3PZCA 5E3IA 5IAYA 4C92D 4A4FA 4JS4A 1K73C 4M77B 3GPLA 5CQXA 2VUBA 2QQRA 4TTVA 4FIBA 1D3BB 1VQ9T 4P73C 2DXBA 3FC3A 4C0ZA 2L5QA 2FVUA 4Y28E 3PIPA 4C92B 1W2BS 4YRRA 3OB9A 3A8OB 2RHIA 1KMNA 1BI1A 1ZHIA 3RMQA 2A3LA 4DPGA 1KQ2A 3OW2A 4EMKB 5GANh 3A74A 2DTHA 3GLXA 4C0DB 3HKSA 2CZ0B 2QEXA 4YREA 1G3YA 1NJ8A 4H2XB 2CYZB 2KY9A 4TVWA 4WJ4A 3QO7A 4H02A 2VV5A 2OTLT 1VQ6T 3HXXA 5GAMj 1NYQA 2K2VA 1UGRB 1H641 3M56A 2G3RA 5HK0A 1KOGA 3CCLT 3FEOA 3M58A 1QF6A 5C52B 2OTJA 1N27A 1YJNA 4M75D 2RHZA 2F69A 5KNNA 4L87A 3KBGA 3HFZA 1N9RA 2K57A 4M77G 4OGCA 3RKWA 4YRMA 1X54A 3G7ZA 1OYXA 3A7AA 2KVQG 1YITT 1JJ2S 4YRNA 3JB9D 3N5BB 1VQ9A 5C6SA 4BY6B 2ZT7A 4HWTA 4H2UA 4TWAA 2GF7A 1VQPT 1LYLA 1XQHA 4M75B 4QQGA 3F70A 2QDYB 4OP0A 2ARUA 4P75C 5CR2A 4M7AA 4H2VA 3VV0A 4HKEA 3FLGA 3HRIA 3QYHB 2X35A 4E7IA 4M78C 2EWNA 3JCMh 2RB6A 2ZPGB 1M4ZA 2ZINA 2PMFA 3JCMc 4B9XA 3HXVA 2D0QB 1X56A 1YJWT 4JLGA 4M77E 5GAN6 3CCLA 1B34A 5GMKm 2M16A 3M59A 1WPYA 2P5IA 2FHDA 2CIMA 2DD4A 3DLLA 1Q86U 2QQAA 4C92E 2K5LA 1YITA 3J81E 2DZCA 2XK0A 5LJ3f 5KE2A 2P0KA 3OYDA 4NOYA 1M1KC 1IL2A 1M9SA 3CCRT 4RCCA 3META 1G5IA 2HAXA 5A0DA 3UGQA 2K5IA 1Q82U 4LNSA 4ZGJB 3QUIA 4BE1A 3JB9G 3V7RA 2GFAA 1ATIA 3PIOA 1LNXA 2E1HA 1B7YB 4A4EA 1UGPB 3CMET 3QG1A 2HQXA 5GMKl 4M7DF 2CZ1B 3V7CA 3S3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JUV A;  1LJO A;  4PJO A;  4H2Y A;  1N9S A;  4M7D G;  3JCM J;  5LJ5 f;  3WQZ A;  4KR3 A;  4N0A C;  4ZTZ B;  4K87 A;  3A31 A;  2DTI A;  4HVC A;  3RAC A;  4XEM A;  4C92 F;  3V7S A;  1YFR A;  1KMM A;  3HFV A;  3V8L A;  5GAN j;  4E51 A;  4Y91 A;  4C92 G;  3CMQ A;  3JB9 I;  4JRI A;  4EO4 A;  1B8A A;  2CJA A;  4UPA A;  3MF2 A;  4C8Q C;  5LJ3 j;  4TVA B;  3L1A A;  3V8K A;  1U1T A;  4M78 D;  4CH5 A;  4H2S A;  2ZTG A;  4XU3 A;  3HXU A;  1X2G A;  4PJO D;  4XTV A;  4M75 E;  3AHU A;  1X55 A;  4M7A G;  5GAO q;  5GAO l;  3I7F A;  2Q7H A;  4CH6 A;  4F7U A;  3RKX A;  3JCM X;  2DVE A;  3SB2 A;  1WU7 A;  1EVL A;  1NJ1 A;  4V2S A;  3A7U A;  3LC0 A;  3FJP A;  2DTO A;  4M78 B;  3ICA A;  5CAI A;  4XEO A;  1ASZ A;  3TUP A;  4NL3 A;  2Q7E A;  4PJO B;  3BDU A;  4H2T A;  4X9D A;  3RIR A;  1G5H A;  2I4O A;  2AKW A;  4M77 C;  3JCM W;  4M7D C;  1X01 A;  3SWN A;  1X2H A;  2YLC A;  5LJ3 d;  4YCU A;  4EMH A;  5LJ5 j;  3M4G A;  1FYF A;  4UP7 A;  4YYE A;  2VXF A;  1NJ2 A;  2Q7G A;  1QE0 A;  2DDZ A;  4YCW A;  4G85 A;  1KQ1 A;  5GMK e;  5GAN f;  1NNH A;  4J6Y A;  5GAN g;  5DY9 A;  4C92 C;  2C7I A;  2ART A;  2EJ9 A;  4CS3 A;  1WYD A;  3RF1 A;  1M5Q 1;  1ASY A;  2E64 A;  5LJ3 g;  4N0A A;  1I8F A;  4M75 F;  4PHC A;  2ZNI A;  4H2W A;  4WI1 A;  4CS2 A;  3VQW A;  3TEH A;  2RHQ A;  5GAN e;  2C8M A;  1I5L A;  3FIF A;  4HA8 A;  4YDQ A;  3QHS A;  4X9C A;  1JJC A;  3JCM P;  1YFT A;  3P8T A;  4YRS A;  4M75 G;  3E9I A;  4EMK C;  4F7U B;  4YRL A;  4M7A E;  3UGT A;  4P3O A;  4ZIB A;  1ADJ A;  5LJ3 e;  4ZTU B;  3JB9 F;  5GAN 5;  1I4K 1;  4C8Q A;  4XTY A;  1PYS A;  3RGL A;  4G84 A;  1B70 A;  3G1Z A;  3MEY A;  4TVY A;  3QO8 A;  2DQ0 A;  1E24 A;  1NJ5 A;  3L4G A;  2DKG A;  3BJU A;  2DU5 A;  5LJ5 d;  2AMC A;  4XU2 A;  1SES A;  4A53 A;  3JB9 J;  2HNI A;  4XU1 A;  2ALY A;  2AKW B;  5LJ3 h;  4QVC A;  3PGG A;  2QHU A;  3IG2 A;  3SWN B;  2J3M A;  2I4N A;  5F5W A;  4KR2 A;  3L2Z A;  2E3C A;  3M4P A;  4BW9 A;  3MF1 A;  1SER A;  3NEL A;  1RIQ A;  5GMK j;  4O2D A;  11AS A;  4P74 C;  4P71 C;  3REX A;  5LJ5 g;  4K86 A;  4P3N A;  2J3L A;  3P8V A;  2ZCE A;  3A5Z A;  4C8Q D;  3RKY A;  2ZGW A;  1BBU A;  4YRF A;  4YPF A;  2I4L A;  3A32 A;  4M77 A;  2RHS A;  3HXW A;  5GAN 4;  3M4Q A;  4RDX A;  2ARS A;  4M7D A;  4YRJ A;  4NCX A;  5LJ5 e;  1E1O A;  4XTW A;  1D3B A;  1E1T A;  2ZIO A;  3TEH B;  2RHQ B;  1MGQ A;  5K1X A;  4XTU A;  1B76 A;  1JJC B;  2YLB A;  2QTX A;  4M7A F;  2ZXF A;  3KFU A;  4M75 C;  2QHV A;  2XGT A;  3VQV A;  3GIB A;  4C92 A;  2E10 A;  4C8Q B;  3RES A;  1PYS B;  4BWA A;  3JCM f;  4OLF A;  5LJ5 h;  1B70 B;  3IKL A;  3QO5 A;  3HTZ A;  3JCM b;  3QSU A;  3L4G B;  4YRK A;  4J6X A;  2JN0 A;  3QNE A;  2AMC B;  2RA2 A;  12AS A;  2I4M A;  3REU A;  3RL6 A;  3OD1 A;  2DQ3 A;  4M77 D;  4P72 C;  2ALY B;  3DSQ A;  1JBM A;  4CH4 A;  4M7D D;  2ZNJ A;  4F7U G;  2ZT5 A;  5C51 B;  4EMK A;  1H4S A;  4UP8 A;  2Q5H A;  1H4V B;  3UFG A;  1BIB A;  2ZR3 A;  1TH7 A;  1G51 A;  5GAN d;  4H2X A;  2I2L A;  1I81 A;  5GAM f;  5GAM g;  3RER A;  3PZC A;  5E3I A;  4C92 D;  1JRI A;  2RM4 A;  4M78 E;  1YB3 A;  3NET A;  3QTC A;  4M77 B;  2RHS B;  4PJO E;  3IAL A;  3HY0 A;  4M7D B;  2ZZF A;  4TTV A;  5GAM e;  1D3B B;  3EFS A;  3JCM Q;  1Y96 A;  5I21 A;  4P73 C;  1L0W A;  2EAY A;  4P74 A;  2E41 A;  3NEM A;  4P71 A;  3A5Y A;  1EOV A;  3FB9 A;  2E65 A;  3HY1 A;  5ELN A;  2VC8 A;  4RCB A;  4P3P A;  4C92 B;  1HXD A;  1SRY A;  4YRR A;  2QHT A;  4TQF A;  1BIA A;  4HWR A;  4HWO A;  1ADY A;  1KMN A;  5GMK h;  4M7A C;  3IKM B;  4XTX A;  4DPG A;  1U1S A;  2ODR C;  1KQ2 A;  5K1P A;  2Q5I A;  2CGH A;  1EIY A;  4EMK B;  1H4Q A;  1NJ6 A;  5GAN h;  1YCY A;  4M75 A;  4KQE A;  1J5W A;  3VU3 C;  4F7U E;  3A74 A;  2DTH A;  4CH3 A;  3EFR A;  4YRE A;  3P8Y A;  2IY5 A;  1NJ8 A;  4H2X B;  4TQD A;  4TVW A;  4YRT A;  4WJ4 A;  3QO7 A;  4XU0 A;  4H02 A;  3JB9 H;  4M78 F;  1LOJ A;  5GAN 8;  2ZZG A;  3HXX A;  4P72 A;  5GAM j;  1HK9 A;  2VXE A;  4PJO F;  1EVK A;  1NYQ A;  1C0A A;  5GAO m;  4JRK A;  4M78 G;  4RQF A;  4EMG A;  1H64 1;  1USY C;  4DQ2 A;  1KOG A;  4PJO G;  1Y96 B;  5GAO n;  2CJ9 A;  5C52 B;  1QF6 A;  2DXT A;  3HXZ A;  4YRP A;  1BBW A;  3LSS A;  4M75 D;  3JCM d;  4HWP A;  5KNN A;  3A7R A;  4L87 A;  4YCV A;  3HFZ A;  4RMF A;  5GMK i;  1N9R A;  2K57 A;  4M77 G;  3RKW A;  4YRM A;  1X54 A;  3LSQ A;  4YRC A;  3JCM V;  4YRO A;  2ZT6 A;  2ZT8 A;  3A7A A;  2P0L A;  2ZZE A;  4YRN A;  1WNL A;  3JB9 D;  2YHT A;  4K88 A;  2DZ9 A;  1YGB A;  2ZT7 A;  4HWT A;  4H2U A;  4P73 A;  4TWA A;  4YRQ A;  4YRI A;  4RQE A;  3JCM g;  1EIY B;  1Z7N A;  1LYL A;  4PNO A;  4M75 B;  1EFW A;  2QHS A;  4F7U F;  3NEN A;  1N9W A;  5GAM d;  4Q15 A;  5GAN 7;  4OP0 A;  2ARU A;  2IY5 B;  1HC7 A;  4C8Q E;  4WF2 A;  4P75 C;  5GAN 2;  4M7A A;  3JCM e;  1W66 A;  4H2V A;  4YRG A;  2PME A;  3BY7 A;  2ZIM A;  2XTI A;  4HWS A;  3HRI A;  3BFM A;  4HT9 A;  4M78 C;  3V8J A;  1HTT A;  3ERR A;  5GAO p;  2EWN A;  3JCM h;  1VQZ A;  2G4C A;  4PJO C;  2CJB A;  2RB6 A;  1M8V A;  5HGQ A;  4XTZ A;  5GAN 3;  1E22 A;  4J5Y A;  2PMF A;  2RD1 A;  2ZIN A;  2EJG A;  3JCM c;  4UP9 A;  3HFZ B;  1YFS A;  4J15 A;  3HXV A;  2FB7 A;  3PCO A;  3HXY A;  4MML A;  4M7A D;  1X56 A;  4PG3 A;  1B7Y A;  4M77 E;  1SET A;  2EL9 A;  4AH6 A;  5GAN 6;  1USY A;  2ODR D;  4M7D E;  1B34 A;  4WJ3 M;  3UH0 A;  5GMK m;  1WPY A;  5GAM h;  2P5I A;  2CIM A;  4QVD A;  4EX5 A;  3HFO A;  4MMK A;  1EQR A;  2DXU A;  4C92 E;  4C8Q F;  5C53 B;  4M7A B;  1Z7M A;  3BW1 A;  2DZC A;  5LJ3 f;  1WLE A;  4JLI A;  4Q6G A;  3VQX A;  2ZR2 A;  3E9H A;  4C8Q G;  2DEQ A;  4NOY A;  4A54 A;  1WQ7 A;  2E5A A;  1IL2 A;  4CS4 A;  4TVA A;  2EJF A;  4NL2 A;  3VQY A;  4RCC A;  1G5I A;  3INZ A;  4J6W A;  3UGQ A;  1NYR A;  5ELO A;  2Y90 A;  4XQ3 A;  3VBB A;  3QO3 A;  3RUX A;  4P75 A;  2DJZ A;  4LNS A;  3HFN A;  3QUI A;  3JB9 G;  3V7R A;  3TEG A;  4HT8 A;  3R07 A;  4YP0 A;  3SWN C;  1ATI A;  1LNX A;  3PCO B;  3W3S A;  5GAO r;  2E1H A;  2DU7 A;  1B7Y B;  4M77 F;  1GGM A;  3HSB A;  2FYK A;  1H4T A;  5GMK l;  4M7D F;  4M78 A;  1WQW A;  3V7C A;  3HRK A;  1B34 B;  4X5O A; 
#chains in the Genus database with same CATH topology
 3UDC A;  1VQ8 T;  1LJO A;  2DMO A;  4H2Y A;  1YWO A;  4M7D G;  3CCL Q;  3JCM J;  5LJ5 f;  1IHW A;  1ZLM A;  1M2V B;  4KR3 A;  2GGR A;  4ZTZ B;  1C1A A;  3RMS A;  2FG0 A;  4LVI A;  2AKL A;  4XEM A;  1NBE B;  1IRX A;  1YJW A;  3HFV A;  2RJC A;  8ATC B;  4JPB W;  3LGF A;  1TSF A;  2LNH B;  3EG0 A;  2C0T A;  3JB9 I;  4EO4 A;  3OYF A;  1YIT Q;  2CJA A;  2JMA A;  4M4Z A;  4C8Q C;  1VUB A;  5LJ3 j;  4M78 D;  4RTX A;  4ORZ A;  1KHI A;  4LN2 A;  1X2G A;  1VQP Q;  4M75 E;  3CCQ A;  3DB3 A;  1AOJ A;  2DIG A;  1IGQ A;  5GAO l;  2P84 A;  1ZSZ A;  3E1S A;  1WFW A;  1KC8 U;  1Q81 U;  1KC8 R;  1K8A U;  2NUP B;  2RJD A;  5KYW A;  3EHQ A;  4E6R A;  4MZM A;  2BUD A;  4II1 A;  4M78 B;  5CAI A;  1ASZ A;  3TUP A;  2F1L A;  4NL3 A;  1D1B A;  1NZ9 A;  3TSZ A;  3EG9 A;  1G5H A;  2O01 E;  3H9N A;  1GXI E;  4NS5 A;  5D7U A;  3JCM W;  4RG8 A;  3VRZ A;  1UG1 A;  2DO3 A;  2OAW A;  2QG9 B;  4YCU A;  5DLQ E;  5LJ5 j;  2JTF A;  3M0T A;  4YYE A;  2M0Y A;  2VXF A;  1NJ2 A;  2Q7G A;  3CME A;  1D0X A;  1EFN A;  2FRY A;  1VQ8 A;  3VS1 A;  1YJW Q;  4J9B A;  2JTM A;  3WVE B;  2EYZ A;  3ME9 A;  2JW4 A;  2K3B A;  3OYI A;  2EKH A;  1VQ4 T;  2KRO A;  3FDR A;  2PUK B;  3CBP A;  3CXC A;  3TEH A;  1VIF A;  2C8M A;  3QWX X;  2CP7 A;  4EIK A;  3QHS A;  1AWX A;  3JCM P;  2J7I A;  2EYX A;  4F7U B;  2M0O A;  3CCQ Q;  4P3O A;  3SDZ A;  1Y0M A;  2XDP A;  5LJ3 e;  4ZTU B;  1IB8 A;  1ZSG A;  2LQK A;  2D8H A;  2PTK A;  2RJF A;  1W2B P;  1E24 A;  1NJ5 A;  1BU1 A;  2DKG A;  3CCR Q;  2XG8 D;  4A53 A;  3MCA B;  4MZP A;  1TOV A;  2ALY A;  2FZG B;  2O31 A;  1O75 A;  3IG2 A;  4KUD K;  3HTR A;  3M4P A;  2K3Y A;  5GMK j;  4O5V A;  1WHL A;  4HT4 A;  5M9O A;  4OMF B;  4P71 C;  4K86 A;  3LW5 E;  4CC4 B;  2ZCE A;  4C8Q D;  3G71 T;  3I56 T;  3PTA A;  3CME Q;  2PU9 B;  4YRF A;  3C94 A;  3A32 A;  2RHX A;  4M77 A;  2LT1 A;  2F2V A;  3LLR A;  1VQ8 Q;  3M4Q A;  4OB0 B;  5LJ5 e;  1B07 A;  1D3B A;  3TSW A;  1RAB B;  2WSF E;  2HSE B;  2GCX A;  2I0N A;  2YUP A;  4M7A F;  1PG5 B;  3QJ6 A;  1UFF A;  3M0S A;  5HY6 A;  3EGX B;  3OMC A;  2E10 A;  2XID A;  4C92 A;  4C8Q B;  1PNJ A;  4OLF A;  1B70 B;  2P0Q A;  4MDW A;  1VQ4 A;  2LX7 A;  2DL4 A;  3QNE A;  3OSV A;  3REU A;  4P72 C;  1JJ2 P;  4AFS C;  3MHX A;  4F7U G;  4EMK A;  3TRE A;  3CCS T;  5I11 A;  4F17 A;  2ZR3 A;  1NYG A;  5FU7 C;  2NUZ A;  1PRL C;  5HKC A;  1MV3 A;  2KDS A;  1IRE B;  4H2X A;  1G8X A;  3OYY A;  5GAM g;  4E7H A;  2DK3 A;  1JRI A;  3A5Z B;  2QQ9 A;  4M78 E;  1GRI A;  4OMO A;  1YB3 A;  1UJ0 A;  1FMV A;  2MK5 A;  1VQN T;  3UA7 A;  1AWW A;  2CUD A;  5GJW B;  1VQK T;  1UTI A;  3EFS A;  4LE9 A;  3QWY A;  1L0W A;  4P74 A;  1EIF A;  2RQW A;  3VJP A;  1N8R U;  3FB9 A;  1QCF A;  1K9M R;  3G71 A;  1R0C B;  3I56 A;  4P3P A;  1N8R R;  4C0F A;  2DL7 A;  4L5G A;  4PJM A;  1ADY A;  3HRU A;  2LQ8 A;  1OZ3 A;  1U1S A;  4F04 B;  2ODR C;  1KD1 C;  4Z88 A;  1TUC A;  1VQ4 Q;  4JDS A;  2DET A;  2XDB A;  1M1F A;  3WXM B;  1YCY A;  4M75 A;  2HEQ A;  3VU3 C;  4F7U E;  3MP6 A;  2RN8 A;  2H3E B;  2YRV A;  3JRZ A;  4OMP A;  1NJI C;  2ZPB B;  4YRT A;  1WJS A;  2EIF A;  4LDV A;  1C6V X;  2QQS A;  3JB9 H;  4E47 A;  1UGQ B;  5GAN 8;  5J3B A;  4D6W A;  2VXE A;  2DA9 A;  2EYY A;  2NYS A;  2DJQ A;  1C0A A;  2DPP B;  4RQF A;  2RMO A;  4FYW B;  3CCS A;  4DQ2 A;  4CC2 A;  3MQZ A;  1KFZ A;  2L3R A;  3HL8 A;  2EGA A;  2DXT A;  3HXZ A;  4YRP A;  4LDY A;  1VYU A;  1BBW A;  4FSS A;  2K2M A;  3LSS A;  2RQV A;  3KUF A;  4RMF A;  4C5I A;  5GMK i;  3MEU A;  2HSP A;  3BDL A;  1PD1 A;  4YRC A;  3JCM V;  1BI2 A;  2ZT6 A;  3G71 Q;  1VQM T;  2J6F A;  5DM7 R;  3I56 Q;  1WNL A;  1VQK A;  2YHT A;  2ECZ A;  5KCH A;  1YNZ A;  2EYQ A;  1HYO A;  3J80 E;  4P73 A;  4YRQ A;  4ZTJ A;  4RQE A;  3MEA A;  3JCM g;  2QEX T;  3LYI A;  1F1B B;  4RTU A;  1PRM C;  1JB0 E;  2ZZD A;  3H0I A;  3NEN A;  1N9W A;  1H3Z A;  4Q15 A;  5GAN 7;  1QQJ A;  2IY5 B;  2DXC A;  4C8Q E;  2CDT A;  1HC7 A;  3A8M B;  5GAN 2;  2EVR A;  1I07 A;  1U5S A;  5KYX A;  1SSH A;  2COY A;  3M9Q A;  4X1V A;  2PME A;  2NUT B;  4J7F A;  2C0I A;  2ZPH B;  4Q5W A;  1EZZ B;  3X20 B;  2EPD A;  1ZBX A;  4E7K A;  3M5A A;  2OTJ T;  3CD6 T;  3BFM A;  2WAC A;  1Z9Q A;  5IN1 A;  1YJN T;  1M90 U;  2ENM A;  2JOY A;  2O2O A;  2GQI A;  3ERR A;  2EQI A;  2WSC E;  4OMM A;  1KG1 A;  1M90 R;  5FU7 B;  3VS0 A;  3I5R A;  2CT4 A;  4PJO C;  2CJB A;  3CCS Q;  4XTZ A;  4ZN1 A;  5GAN 3;  3MPU B;  2EJG A;  4FT4 A;  4HVU A;  3M53 A;  2FB7 A;  1E6G A;  3MKD A;  1B7Y A;  4AH6 A;  1SET A;  2EL9 A;  3FJ5 A;  3Q1J A;  2ODR D;  2QI2 A;  3G4S T;  1W4S A;  3GOX A;  5CK9 A;  2WSE E;  3ZBD A;  5KYY B;  5J39 A;  2KEA A;  2QGG A;  4XAX B;  5L23 A;  5GAM h;  1VQK Q;  4EX5 A;  3M4Y A;  3M0Q A;  1UHC A;  1M2V A;  3HFO A;  2K5F A;  4MMK A;  1EQR A;  3SD4 A;  2VGM A;  2F5T X;  2DXU A;  2HD0 A;  1ARK A;  4EPC A;  4LUE A;  3SEM A;  1SRL A;  2D0N A;  1VQM A;  2B86 A;  2JUF A;  3LGL A;  2K9G A;  2DIQ A;  2A7Y A;  2JNG A;  4JLI A;  1UJY A;  2GQV A;  4Q6G A;  1X6B A;  3LH0 A;  3UF4 A;  5FRO A;  4CS4 A;  4EDU A;  3VQY A;  2DBM A;  4J6W A;  1X6O A;  5ELO A;  4R0K A;  1OU8 A;  4C5E A;  5CKB A;  4XQ3 A;  3QO3 A;  2COZ A;  1YI2 A;  4J9D A;  3PVL A;  4P75 A;  1Q7Y C;  1UEC A;  4IUP A;  3TCJ A;  1ZUK A;  1RAH B;  1QVG A;  3TEG A;  1PCX A;  2LCL A;  2K79 A;  2DVJ A;  3A8H B;  4PLL A;  4LD9 K;  5GAO r;  2EQK A;  2NUP A;  2DU7 A;  4IUV A;  3CD6 A;  4M77 F;  1GGM A;  3PE0 A;  1YJ9 T;  1UB4 A;  4M78 A;  3HRK A;  4JUV A;  3I5S A;  2BTT A;  4DEX A;  1N9S A;  1ZUY A;  3OS5 A;  2P4T A;  3WQZ A;  2LVM A;  4K87 A;  1R8O B;  1D0Z A;  2CZ6 B;  3A31 A;  2DTI A;  3H41 A;  3RAC A;  4HVC A;  1CKA A;  2JS0 A;  4C92 F;  2DLP A;  1KMM A;  2XKO C;  5GAN j;  3NFC A;  1E7O A;  4RKU E;  3G4S A;  4E51 A;  4C92 G;  1K73 U;  1WX6 A;  1D09 B;  4IUR A;  4IIM A;  3OS1 A;  1VQM Q;  4J9H A;  3P8B B;  3A8L B;  4TVA B;  3L1A A;  4JJD A;  1WHH A;  4CH5 A;  5CO7 A;  4PJO D;  3OYM A;  4XTV A;  5CCA A;  3AHU A;  5GAO q;  1M8M A;  2LCC A;  1RAD B;  3QYG B;  4F7U A;  5IHK A;  4JS5 A;  5J26 A;  4LVM A;  2R5A A;  3SB2 A;  5ECA A;  1WU7 A;  1ZA1 B;  3OYJ A;  2CH4 W;  3A7U A;  1I0C A;  2R57 A;  3LC0 A;  2LDM A;  1VQL A;  4FL6 A;  6AT1 B;  1SHG A;  3X26 B;  1PKT A;  3CD6 Q;  2JJ9 A;  4PJO B;  3BDU A;  2VKN A;  4H2T A;  3EG1 A;  1HD3 A;  3RIR A;  4PFO A;  1AWJ A;  4RTY A;  4HCZ A;  2FPF A;  1M1G A;  3PMI A;  2LX9 A;  1FYF A;  2AKK A;  2AIR B;  2VB6 A;  4JJB A;  3LWI A;  1YJ9 A;  2EYW A;  4YCW A;  1KQS A;  2KT1 A;  1UHF A;  1X2Q A;  1LPL A;  2M1H A;  4E7L A;  3CCQ T;  2D9T A;  3G4S Q;  4IUQ A;  1AWO A;  2RNA A;  3OQ5 A;  4BDY A;  4A4H A;  4GLK A;  2DAQ A;  2RI5 A;  1I8F A;  4M75 F;  4PHC A;  2LTO A;  4WI1 A;  2Y4X A;  3M0R A;  3MEV A;  5GAN e;  1N5Z A;  2PUO B;  1MMD A;  4YRS A;  4M75 G;  5I22 A;  1ADJ A;  1BKB A;  3JB9 F;  3EGX A;  2Y4Y A;  5GAN 5;  1Y7X A;  1KIK A;  4C8Q A;  2RF0 A;  3RGL A;  4G84 A;  1B70 A;  2DL5 A;  3QO8 A;  1WI7 A;  2KK4 A;  2A08 A;  3CMA A;  1RAG B;  1UE9 A;  3OYC A;  2IG0 A;  4KT0 E;  4XU2 A;  3VYG A;  1OZ2 A;  1GFC A;  1R77 A;  5LJ3 h;  1VQL Q;  4J9I A;  4QVC A;  2KMT A;  2KRM A;  1NM7 A;  3ER0 A;  3MJX A;  1Y71 A;  2AK5 A;  1XTD A;  2RHY A;  3MF1 A;  3NEL A;  1K1Z A;  1MV0 B;  1KHC A;  5IHI A;  2E4H A;  2VYT A;  1BI3 A;  4BD3 A;  3A5Z A;  2V8K A;  1YJ9 Q;  2RI2 A;  1YFN A;  4C5G A;  3OA6 A;  3S3N A;  5GAN 4;  1WGS A;  2E6N A;  4JJN K;  1C0M A;  4A4K A;  4YRJ A;  3KXT A;  4E7J A;  1E1T A;  1NPP A;  1FYN A;  2QQB A;  2FPD A;  1JJC B;  4IUU A;  2YLB A;  3ZFJ A;  2QTX A;  2ZXF A;  3CXC S;  3CCE T;  3PFS A;  2LC4 A;  2H8H A;  4PL6 A;  3M55 A;  4FCY A;  2XGT A;  2DRK A;  1PYS B;  5LJ5 h;  2CUB A;  3HTZ A;  4YRK A;  4J6X A;  2JN0 A;  3RL6 A;  1R0B G;  2RA2 A;  2I4M A;  5FLX E;  3OD1 A;  1XOV A;  1I5O B;  1UDL A;  3DSQ A;  5HK3 A;  3CMA Q;  2F2X A;  1Q81 R;  3HPW A;  1K8A R;  1H4S A;  2Q5H A;  3L2Q A;  3UFG A;  3QJY A;  1G51 A;  2ZPF B;  3OSS C;  1G3W A;  5GAN d;  3VYH B;  2E12 A;  2F2W A;  1M2O A;  2I2L A;  1I81 A;  1U3O A;  3RER A;  1M1K U;  3OW2 P;  2O9V A;  2DX1 A;  2PVD B;  2RM4 A;  1M1K R;  1ABQ A;  5KYN A;  3NET A;  3EGD B;  3NHN A;  2RHS B;  3OYN A;  4PJO E;  3IAL A;  1GCQ C;  4L59 A;  1X69 A;  3CPW A;  1OV3 A;  2ZZF A;  3OYA A;  5CQY A;  1IHV A;  5C0M A;  2AZS A;  4E7Z A;  1OQK A;  4QT7 A;  2ZPI B;  4HXJ A;  1M3C A;  1NE8 A;  2EQU A;  2X3X D;  4P71 A;  3A5Y A;  1JU5 C;  2X4X A;  1MND A;  3VUB A;  2XDD A;  3X25 B;  2E65 A;  2VC8 A;  4RCB A;  1N6A A;  1HXD A;  1SRY A;  4AG2 C;  4Z8A A;  4ZN3 A;  1ZBJ A;  4TQF A;  4HWR A;  4N4H A;  3OYE A;  5GMK h;  1BCO A;  4D8D A;  3IKM B;  3EFO B;  5HCK A;  5KCO A;  2Q5I A;  2D1X A;  1QP2 A;  2CGH A;  2KSS A;  4VUB A;  1OPL A;  1H4Q A;  2PQW A;  3CCE A;  3HRS A;  1WJQ A;  3OYG A;  1NJ6 A;  4KQE A;  1J5W A;  3L2V A;  3LWH A;  2AZV A;  2YUO A;  2IY5 A;  4TQD A;  1VQ7 T;  2IIM A;  3X24 B;  4M78 F;  1LOJ A;  3H8Z A;  1BBZ A;  2NUT A;  3JAM E;  1KK7 A;  2ZZG A;  4P72 A;  1DJ7 B;  3HRT A;  1EVK A;  1G3S A;  3CC2 T;  3ZL7 C;  4MDX A;  2FL7 A;  4M78 G;  2LZ6 B;  5EG2 A;  1ZQ1 A;  2E5Q A;  1USY C;  3UWN A;  3KFV A;  1K9M C;  1OI1 A;  1Y96 B;  5A0L A;  5GAO n;  2CJ9 A;  2GNC A;  3GBQ A;  2HKN A;  4AMC A;  2J05 A;  3JCM d;  3E9F A;  2R58 A;  4IIO A;  1WYX A;  3T9N A;  4MZT A;  2L3Q A;  4IUT A;  2ZPE B;  2IVW A;  4HCK A;  5FU6 C;  4QW2 A;  2P0L A;  2ZZE A;  3CC4 A;  1B3Q A;  4KUI A;  4BDZ A;  2CS7 A;  4K88 A;  1YGB A;  2ROL A;  2V8I A;  3C0C A;  2EFI A;  5KYY A;  3URG A;  4YRI A;  1EIY B;  5IXB A;  1Z7N A;  4ELZ C;  2CKK A;  1JXO A;  1WDX A;  3L2W A;  1MMG A;  1PD0 A;  2QHS A;  4HCC A;  4F7U F;  1VYT A;  2L8D A;  2M51 A;  3CCE Q;  4OB3 B;  3FRN A;  1NEG A;  2YUQ A;  4GBQ A;  2CSQ A;  3CCV T;  1UEB A;  1W66 A;  4F16 A;  4OB1 B;  3A98 A;  4KGV B;  2KXC A;  4FM4 B;  1PWT A;  2YDL A;  2XTI A;  2DD5 A;  4OF1 A;  1XJW B;  1QLY A;  4Z89 A;  3UT1 A;  1HTT A;  4J9E A;  1VQZ A;  3REA B;  5KYU B;  3CEY A;  1VQ7 A;  1M8V A;  1RAF B;  5HGQ A;  2RD1 A;  2RJE A;  2ZAE A;  1X6G A;  4UP9 A;  4J15 A;  3CC2 A;  3HXY A;  4PG3 A;  3CPF A;  3WVD B;  3QII A;  2L3S A;  2K3X A;  2O88 A;  3A8G B;  4HCB A;  4WJ3 M;  3UH0 A;  5IT9 E;  1W1F A;  2QDL A;  1M3A A;  2E5K A;  2QK0 A;  2XU8 A;  2KXD A;  3RNJ A;  1RL2 A;  3QBY A;  4R56 A;  1UUE A;  5A0G A;  4C8Q F;  5C53 B;  1WHK A;  1QVF A;  4FYY B;  2LJ0 A;  1OPK A;  3BW1 A;  1WLE A;  3VQX A;  4HVW A;  2ZR2 A;  3CCM T;  4C8Q G;  2DEQ A;  4A54 A;  1WQ7 A;  2HL3 A;  1OEB A;  1WXU A;  3VS2 A;  4TVA A;  2EJF A;  1QWF A;  3INZ A;  1NYR A;  1G2B A;  1RAC B;  3VBB A;  5AYF A;  4ME7 A;  1S72 T;  2DJZ A;  3GP8 A;  3CCV A;  2JZ2 A;  2YRD A;  3H0F A;  4HT8 A;  3R07 A;  4YP0 A;  3SWN C;  1VQ7 Q;  3SFM A;  4DBQ A;  3PCO B;  3W3S A;  3EG2 A;  2KRN A;  2FYK A;  2KR3 A;  1H4T A;  2O9S A;  3CC2 Q;  2CH4 A;  4X5O A;  2YWW A;  2X9H A;  4PJO A;  1SHF A;  3M0U A;  4FSX A;  4N0A C;  1SSF A;  2GTJ A;  3V7S A;  5D6Y A;  2Z0W A;  3ASK A;  2HQE A;  5FU6 B;  5CIU A;  3V8L A;  3ZEH A;  4AFU C;  3DLM A;  1BCM A;  1V76 A;  3QDR B;  4JRI A;  4J9C A;  1ACM B;  5EC7 A;  1YI2 T;  2CP2 A;  1LCK A;  1U1T A;  3V8K A;  4H2S A;  1VQO T;  4XU3 A;  3RDV A;  2MMP A;  1X55 A;  2M02 A;  1YCS B;  4A63 B;  4BUG A;  8AT1 B;  1SEM A;  2B8A A;  3A1P A;  1VIE A;  4CH6 A;  2RQT A;  2DL3 A;  3S6W A;  3CCM A;  2P4R A;  1A0N B;  2DVE A;  1RLP C;  3CCV Q;  1YHQ A;  3CXC P;  1EVL A;  3OYB A;  1QVG S;  1X75 C;  1NJ1 A;  4FYX B;  4V2S A;  3UPU A;  1X43 A;  1IXD A;  2DTO A;  1YBY A;  2Q7E A;  3LH5 A;  1S72 A;  4X9D A;  4RTW A;  3PNW C;  3GNG A;  1E6H A;  1YN8 A;  1SF9 A;  4M7D C;  3J7A F;  2MOX A;  1VOM A;  2OAU A;  1NJI U;  4EMH A;  4UP7 A;  3M4G A;  1NJI R;  4PFP A;  2X51 A;  3U23 A;  1QE0 A;  3OYL A;  3DB4 A;  2DDZ A;  4G85 A;  1KQ1 A;  2GBQ A;  3PVQ A;  3NTK A;  3EG3 A;  4J6Y A;  5GAN f;  1H92 A;  5DY9 A;  4AT1 B;  1NNH A;  2ART A;  2EJ9 A;  2C06 A;  2CSI A;  5CKH A;  2W0Z A;  3RF1 A;  1M5Q 1;  2LRQ A;  5LJ3 g;  2PVO B;  2ZNI A;  4A4G A;  3VQW A;  1J3T A;  2GFU A;  5LL6 S;  1I5L A;  4X9C A;  1JJC A;  3OS0 A;  1YFT A;  3EH2 A;  3UGT A;  2PVG B;  4ZIB A;  1VQL T;  1AD5 A;  2HDA A;  1I4K 1;  2CP3 A;  1PYS A;  4JRP A;  4LNP A;  2VGN A;  3CCM Q;  3MEY A;  4TVY A;  1VQO A;  2DQ0 A;  1P92 A;  3OYK A;  3BJU A;  4J8O A;  1K0S A;  1SES A;  1ZX6 A;  3JB9 J;  1BI0 A;  2HNI A;  2AKW B;  1G5V A;  1X2K A;  2DM1 A;  3PGG A;  4AFQ C;  4DOW A;  1K76 A;  1S72 Q;  4KR2 A;  3SWN B;  4RTV A;  2I4N A;  5F5W A;  3L2Z A;  2E3C A;  3MEW A;  5FWB A;  4LUD A;  4BW9 A;  1RIQ A;  4O2D A;  3GF5 A;  11AS A;  1Q86 C;  3REX A;  5LJ5 g;  2EW3 A;  3P8V A;  3AT1 B;  1RI0 A;  3R6N A;  1WXT A;  3RKY A;  1BBU A;  1QVP A;  4YPF A;  3EGD A;  1KQS S;  2RHS A;  4LDX A;  3UA6 A;  3EAE A;  3OBW A;  3UAT A;  4ESR A;  4NCX A;  2KAF A;  4XTW A;  2ROT A;  4BE0 A;  1H3H A;  2ZIO A;  2RHQ B;  1K73 R;  4C5H A;  1S1N A;  1B76 A;  3QZ9 B;  1W2B A;  3TEE A;  2JM9 A;  1BYM A;  1PSF A;  2L0A A;  2LCS A;  1Q82 C;  3KFU A;  2QHV A;  3CMA T;  4OMQ A;  1FX7 A;  4OB2 B;  3VQV A;  4J9F A;  3GIB A;  1NLO C;  1RI9 A;  3RES A;  4BWA A;  3JCM f;  3IKL A;  1T0J A;  2F5K A;  5DLO A;  3JCM b;  1XNI A;  3MP8 A;  3L4G B;  2VAS A;  3EH1 A;  2AMC B;  1YI2 Q;  12AS A;  3EFO A;  4WTO B;  1QW1 A;  2COW A;  2DQ3 A;  1VQO Q;  1JBM A;  1Y07 A;  4CH4 A;  3DKM A;  4M7D D;  3VS7 A;  4FW2 A;  1WZO A;  2X4J A;  3JV3 A;  5C51 B;  2QXF A;  1BIB A;  1WJR A;  1OX9 A;  4LDU A;  4PJN A;  2LQN A;  3CCJ T;  2MWP A;  2M9U A;  1W6X A;  2X4Y A;  2EKO A;  5I2S A;  3G6E T;  2CRE A;  3QTC A;  3HY0 A;  4M7D B;  2ABL A;  4GY5 A;  2OTL A;  1VQ6 A;  5GAM e;  3VKI A;  1BB9 A;  4QQ6 A;  3JCM Q;  1Q7Y U;  3EGU A;  1Y96 A;  3NMZ C;  2VVK A;  5I21 A;  1M27 C;  2EAY A;  1Q7Y R;  4FU6 A;  2QAS A;  2E41 A;  3NEM A;  1WA7 A;  4PJJ A;  1B7T A;  1EOV A;  1HJD A;  3HY1 A;  2E3I A;  5ELN A;  2RH2 A;  3L2R A;  1JJ2 A;  2O4X B;  2QHT A;  1BIA A;  1KC8 C;  4HWO A;  1AZG B;  2AT1 B;  1YP5 A;  2X4W A;  3M54 A;  4JRQ A;  1Q81 C;  4M7A C;  1K8A C;  2DIL A;  4XTX A;  4J9G A;  2LNV A;  3NPF A;  5K1P A;  1MUZ A;  4LVL A;  1EIY A;  1QP3 A;  4CC7 A;  4BE2 A;  4L6V 5;  2W10 A;  4RMO A;  2A8E A;  4C0G A;  4PKC C;  5I2M A;  4CH3 A;  1TG0 A;  3EFR A;  5FRM A;  1VQP A;  3P8Y A;  1YIJ T;  1IZ6 A;  1VA7 A;  1JQQ A;  2CP0 A;  4XU0 A;  1Y57 A;  1NPR A;  2MAM A;  4IKF A;  1HK9 A;  2HCK A;  4PJO F;  2QTV A;  5GAO m;  4JRK A;  4J7I A;  4EMG A;  1TUD A;  1AHJ B;  4B6M A;  3OY9 A;  5FRN A;  4PJO G;  3CCJ A;  2CP5 A;  4WCI A;  4BI4 A;  1AEY A;  3CPW S;  5KYU A;  1VQ6 Q;  2KRS A;  4PLI A;  1QWE A;  2SRC A;  5IHN A;  3E9G A;  3G6E A;  4HWP A;  3C95 A;  3A7R A;  4YCV A;  4Z02 A;  2LP5 A;  2JM8 A;  3LSQ A;  2JVV A;  4YRO A;  1GCQ A;  4BB7 A;  2ZT8 A;  2RI3 A;  1QMC A;  3M0P A;  1AT1 B;  1JEG A;  2DZ9 A;  4FYV B;  2KI7 A;  2RPN A;  4BAC A;  4DBH A;  1PM3 A;  4PNO A;  1EFW A;  2X3W D;  2XHC A;  5GAM d;  2SEM A;  2E6Z A;  2L89 A;  4DOV A;  4WF2 A;  2A36 A;  2D8J A;  3JCM e;  4ZGD B;  1X27 A;  3O5Z A;  1OU9 A;  4F14 A;  4YRG A;  2MWO A;  3BY7 A;  2ZIM A;  1PSE A;  2XI9 A;  5L8R E;  3I55 T;  5CKE A;  4XK8 E;  3P8H A;  4HWS A;  4HT9 A;  3V8J A;  1SG5 A;  3HP9 A;  5GAO p;  1VQ5 T;  4LD6 A;  1GL5 A;  2G4C A;  1YIJ A;  3CCR A;  1TWB A;  1E22 A;  4K11 A;  4J5Y A;  2FRW A;  3CBO A;  3CCJ Q;  3CC4 T;  1WHM A;  3HFZ B;  1YFS A;  2KYB A;  2EBP A;  2A37 A;  3PCO A;  3MP1 A;  4MML A;  4M7A D;  2H3J A;  2IPO B;  3G6E Q;  2JT4 A;  2DE0 X;  4KGZ B;  1USY A;  4DA4 A;  4M7D E;  2CT3 A;  2KQW A;  1QVG P;  5D6W A;  3QXE B;  1FWZ A;  3MO8 A;  3X28 B;  2QYZ A;  4QVD A;  1O9S A;  1T3L A;  4LDW A;  4RTT A;  2PZ1 A;  2AHJ B;  4CRI A;  4FT2 A;  4M7A B;  1Z7M A;  4LXC A;  1ZSZ C;  2RK1 A;  1OUL A;  3E9H A;  2EGE A;  2E5A A;  2DFU A;  1OOT A;  3TVT A;  2DYI A;  4NL2 A;  1ZA2 B;  2DF6 A;  2Y90 A;  2J06 A;  5KH6 A;  4LVJ A;  3CC7 T;  2V26 A;  2HBW A;  9ATC B;  3JSC A;  2LJ3 A;  2E70 A;  3RUX A;  2BKD N;  2L2P A;  1PKS A;  3HFN A;  3R6O A;  1MMA A;  4GLM A;  2DYB A;  1YIJ Q;  2HBP A;  5FW9 A;  1UGS B;  3I55 A;  3PMT A;  1IO6 A;  1N8R C;  5D6X A;  3GNF B;  5CKD A;  7AT1 B;  3HSB A;  1QKX A;  1H8K A;  1WQW A;  1B34 B;  4B9W A;  1VQ5 A;  2OI3 A;  2HL5 C;  3OYH A;  2EQM A;  4PJL A;  1RAA B;  3NTH A;  4RG2 A;  4R55 A;  4TVR A;  2A28 A;  1QCO A;  4QQD A;  5CVI A;  1YFR A;  2KGT A;  2MIO A;  1TS9 A;  4Y91 A;  1M30 A;  3CMQ A;  1QVF S;  5KE3 A;  1B8A A;  4UPA A;  3MF2 A;  2ZCF B;  2ED1 A;  3L2U A;  2K7A A;  2KBT A;  2ZTG A;  1NLP C;  3HXU A;  2KYM A;  1KQS P;  1MNE A;  1MHN A;  4ZTF A;  4M7A G;  3I7F A;  2Q7H A;  4DBR A;  2NS6 A;  4JJC A;  3RKX A;  3JCM X;  4N4I A;  5FWC A;  4KBM B;  4QVZ A;  1D1A A;  1TUG B;  3TU4 K;  2QGF B;  3FJP A;  3VS3 A;  1EX4 A;  3ICA A;  3I55 Q;  4XEO A;  3CC7 A;  1JXM A;  2I4O A;  2CZ7 B;  2AKW A;  4M77 C;  2YXY A;  4UC4 A;  2OJ2 A;  3C12 A;  2LT4 A;  1VQ5 Q;  1X01 A;  2LQW A;  1V1C A;  2HQH A;  2MF2 A;  2YLC A;  3SWN A;  5LJ3 d;  3CQT A;  1X2H A;  3CC4 Q;  3P8D A;  3VS6 A;  4BI8 B;  1FXX A;  3M57 A;  3CCU T;  5GMK e;  5GAN g;  4C92 C;  2BE9 B;  4OMN A;  2C7I A;  4CS3 A;  1WYD A;  3D7S B;  5GJV B;  4N4G A;  1U8R A;  1K9M U;  4BI3 A;  1ASY A;  3IQL A;  2E64 A;  4N0A A;  2K4Y A;  3HHT B;  1PC0 A;  4H2W A;  1FMK A;  4CS2 A;  2YSQ A;  2EQJ A;  1M90 C;  2P0P A;  4OVA A;  2RHQ A;  2NLU A;  3FIF A;  3QDF A;  4HA8 A;  4ZGE B;  2DER A;  4YDQ A;  1YHQ T;  5IXF A;  3P8T A;  1ZSZ B;  3E9I A;  2JXB A;  4EMK C;  3I9Q A;  2V8J A;  4M7A E;  4YRL A;  2XMF A;  2DL8 A;  4C0D C;  4XTY A;  3C4S A;  3S3M A;  1T3S A;  3G1Z A;  3TQ7 P;  5KYW B;  2QA4 T;  4KUL A;  1RLQ C;  3L4G A;  2V1Q A;  3OS2 A;  2DU5 A;  5LJ5 d;  2D6F A;  5A2Q E;  1CKB A;  2AMC A;  3QKJ A;  3EG9 B;  2XD0 A;  4XU1 A;  1RUW A;  2FPE A;  3CC7 Q;  2XIC A;  3NTI A;  1RAE B;  2QHU A;  4PK4 A;  2RO0 A;  3LX7 A;  2J3M A;  1SKU B;  3PT9 A;  1SER A;  5IH2 A;  4LVK A;  4P74 C;  3ULR B;  2RQR A;  4P3N A;  2J3L A;  4FW1 A;  2E3H A;  2ZGW A;  3OMG A;  4RUG A;  2I4L A;  3HXW A;  2OX7 A;  4RDX A;  2ARS A;  4M7D A;  1E1O A;  4OML A;  3TEH B;  3H6Z A;  4BY6 C;  1VQN A;  2RK2 A;  2BIV A;  1MGQ A;  5K1X A;  4XTU A;  2KE9 A;  1GFD A;  2FZK B;  4J83 A;  3CCU A;  3CPW P;  4M75 C;  4PFZ A;  3L42 A;  5CKF A;  4DEY A;  1V29 B;  4Y92 A;  2O4X A;  4P5N A;  4ATO A;  3E2U A;  4CI0 C;  3VRY A;  3QO5 A;  1K9A A;  1WXB A;  3OBY A;  4O6J A;  2QAZ A;  2MCN A;  3QSU A;  3QPH A;  1IGU A;  1AVZ C;  1K4U S;  3E19 A;  4OGE A;  3OW2 S;  4M77 D;  1G3T A;  2ALY B;  1ZUU A;  2A0F B;  4X34 A;  3VUZ A;  2ZNJ A;  2ZT5 A;  2JMC A;  3O8V A;  3QZ5 B;  1KD1 U;  4UP8 A;  1H4V B;  4YTL A;  2RHU A;  2YUN A;  2MI6 A;  1GCP A;  1KD1 R;  2R5M A;  1TH7 A;  3CBM A;  2EGC A;  3RBB B;  4ELY C;  2QA4 A;  5GAM f;  3PZC A;  2BZX A;  5E3I A;  5IAY A;  1T0H A;  4C92 D;  4A4F A;  3VS5 A;  4JS4 A;  2L3P A;  4D8K A;  4KH1 B;  1K73 C;  4M77 B;  3GPL A;  5CQX A;  2VUB A;  2QQR A;  2C0O A;  1FMW A;  4TTV A;  4FIB A;  1D3B B;  1VQ9 T;  4P73 C;  2DNU A;  2JS2 A;  2DXB A;  3FC3 A;  4C0Z A;  1UGV A;  1Z9Z A;  2L5Q A;  2FVU A;  1VQN Q;  4HVV A;  4Y28 E;  3PIP A;  4C92 B;  1LVK A;  1W2B S;  4YRR A;  3OB9 A;  3A8O B;  2RHI A;  3CCU Q;  2VWF A;  4RTZ A;  1KMN A;  1BI1 A;  1ZHI A;  3RMQ A;  2A3L A;  5AT1 B;  4DPG A;  1G83 A;  1TXQ A;  1M3B A;  1KQ2 A;  3OW2 A;  1D1C A;  4EMK B;  4E7S A;  5GAN h;  1NYF A;  2JTE A;  1YHQ Q;  3A74 A;  2DTH A;  3GLX A;  2RQU A;  2NWM A;  3NGP A;  4C0D B;  1GBQ A;  2BZY A;  2CZ0 B;  1Q95 G;  3HKS A;  2QEX A;  4YRE A;  4KH0 B;  1G3Y A;  1NJ8 A;  4H2X B;  2CYZ B;  2KY9 A;  4KGX B;  1K0X A;  4TVW A;  4WJ4 A;  3QO7 A;  4KRT A;  4H02 A;  2VV5 A;  2OTL T;  2QA4 Q;  1VQ6 T;  3HXX A;  5GAM j;  1NYQ A;  2K2V A;  4JZ4 A;  1UGR B;  1H64 1;  3M56 A;  1I1J A;  2G3R A;  2LJ1 A;  5HK0 A;  4ZNX A;  1KOG A;  3CCL T;  3FEO A;  3M58 A;  1QF6 A;  5C52 B;  2OTJ A;  4JZ3 A;  4ANJ A;  2J6K A;  1N27 A;  3REB B;  1YWP A;  1YJN A;  4M75 D;  2HMA A;  4AFZ C;  4E2F B;  2RHZ A;  2F69 A;  2KT8 A;  2BZ8 A;  5KNN A;  4L87 A;  3I35 A;  3KBG A;  3HFZ A;  1N9R A;  2K57 A;  4M77 G;  4OGC A;  3RKW A;  2YRC A;  3SHW A;  4YRM A;  1X54 A;  3G7Z A;  2ED0 A;  1OYX A;  4AG1 C;  3A7A A;  2DRM A;  2KVQ G;  2MPX C;  3G1J A;  1YIT T;  1JJ2 S;  3JB9 D;  4YRN A;  3N5B B;  1VQ9 A;  5C6S A;  4BY6 B;  2ZT7 A;  4HWT A;  4H2U A;  2HZY A;  4TWA A;  2GF7 A;  1AZE A;  1KJW A;  1VQP T;  1LYL A;  2K6D A;  1KSW A;  1XQH A;  4M75 B;  4QQG A;  4QKU A;  1ABO A;  3F70 A;  2QDY B;  4OP0 A;  2ARU A;  4P75 C;  5CR2 A;  4M7A A;  4H2V A;  2BE7 D;  1U06 A;  1QKW A;  2QEX Q;  1MMN A;  3VV0 A;  4HKE A;  3FLG A;  2HKQ B;  3HRI A;  1QVF P;  3QYH B;  2X35 A;  4E7I A;  2DEU A;  4M78 C;  3VS4 A;  2EWN A;  3JCM h;  2DBK A;  1TTH B;  2RB6 A;  2ZPG B;  2KNB B;  1NG2 A;  1M4Z A;  2ZIN A;  2GTO A;  1WIE A;  2PMF A;  1WHG A;  3JCM c;  2FO0 A;  2OTJ Q;  2ESW A;  4B9X A;  3HXV A;  2D0Q B;  3RR6 A;  1YJN Q;  1PHT A;  3BE3 A;  1X56 A;  1YJW T;  4JLG A;  1JO8 A;  2V1R A;  2LMJ A;  2FZC B;  4M77 E;  5GAN 6;  1WHJ A;  3CCL A;  1SPK A;  1B34 A;  1RAI B;  1NEB A;  5GMK m;  2M16 A;  3THK A;  3M59 A;  1WPY A;  2ATC B;  2P5I A;  2FHD A;  1VQ9 Q;  2CIM A;  2DD4 A;  1TU0 B;  3DLL A;  1Q86 U;  2CP6 A;  1VYV A;  2QQA A;  4C92 E;  4DBF A;  1Q86 R;  1WLP B;  2K5L A;  1YIT A;  1HSQ A;  3J81 E;  2DZC A;  2XK0 A;  5KYX B;  5LJ3 f;  5KE2 A;  1D0Y A;  2P0K A;  3OYD A;  4NOY A;  1M1K C;  1IL2 A;  1M9S A;  1QCN A;  2J6O A;  2FEI A;  3EHR A;  1BK2 A;  2YT6 A;  2G6F X;  4RCC A;  3CCR T;  3MET A;  1G5I A;  2HAX A;  5A0D A;  3UGQ A;  2K5I A;  1SRM A;  1OX8 A;  2MYS A;  1Q82 U;  4LNS A;  4ZGJ B;  1GBR A;  3QUI A;  4BE1 A;  3JB9 G;  3V7R A;  1Q82 R;  2GFA A;  1CSK A;  4CC3 A;  1ATI A;  3PIO A;  1LNX A;  2E1H A;  2PNI A;  2OTL Q;  1B7Y B;  1W70 A;  4A4E A;  1UGP B;  3CME T;  3QG1 A;  2HQX A;  5GMK l;  4M7D F;  2CZ1 B;  3V7C A;  3H0H A;  3S3O A; 
#chains in the Genus database with same CATH homology
 3UDC A;  1VQ8 T;  1LJO A;  4H2Y A;  4M7D G;  3JCM J;  5LJ5 f;  4KR3 A;  4ZTZ B;  3RMS A;  4LVI A;  4XEM A;  1YJW A;  3HFV A;  2RJC A;  3LGF A;  3JB9 I;  4EO4 A;  3OYF A;  2CJA A;  4C8Q C;  5LJ3 j;  1VUB A;  4M78 D;  1KHI A;  1X2G A;  4M75 E;  3CCQ A;  3DB3 A;  2DIG A;  5GAO l;  3E1S A;  1KC8 U;  1Q81 U;  1K8A U;  2RJD A;  4MZM A;  2BUD A;  4II1 A;  4M78 B;  5CAI A;  1ASZ A;  3TUP A;  4NL3 A;  1NZ9 A;  1G5H A;  2O01 E;  1GXI E;  4NS5 A;  3JCM W;  4RG8 A;  2DO3 A;  4YCU A;  5DLQ E;  5LJ5 j;  2JTF A;  4YYE A;  2VXF A;  1NJ2 A;  2Q7G A;  3CME A;  1VQ8 A;  2JTM A;  3WVE B;  3ME9 A;  3OYI A;  1VQ4 T;  3FDR A;  2PUK B;  3CBP A;  3CXC A;  3TEH A;  1VIF A;  2C8M A;  3QHS A;  3JCM P;  4F7U B;  2M0O A;  4P3O A;  3SDZ A;  2XDP A;  5LJ3 e;  4ZTU B;  2LQK A;  2RJF A;  1E24 A;  1NJ5 A;  2DKG A;  2XG8 D;  4A53 A;  3MCA B;  4MZP A;  2ALY A;  1O75 A;  3IG2 A;  4KUD K;  3M4P A;  2K3Y A;  5GMK j;  4O5V A;  4HT4 A;  5M9O A;  4OMF B;  4P71 C;  4K86 A;  3LW5 E;  2ZCE A;  4C8Q D;  3G71 T;  3I56 T;  3PTA A;  4YRF A;  2PU9 B;  3C94 A;  3A32 A;  2RHX A;  4M77 A;  2LT1 A;  3LLR A;  3M4Q A;  4OB0 B;  5LJ5 e;  1D3B A;  2WSF E;  2GCX A;  4M7A F;  3QJ6 A;  5HY6 A;  3OMC A;  4C92 A;  2E10 A;  2XID A;  4C8Q B;  4OLF A;  1B70 B;  2P0Q A;  4MDW A;  1VQ4 A;  3QNE A;  3OSV A;  3REU A;  4P72 C;  3MHX A;  4F7U G;  4EMK A;  3TRE A;  3CCS T;  2ZR3 A;  5FU7 C;  5HKC A;  2KDS A;  1IRE B;  4H2X A;  3OYY A;  5GAM g;  4E7H A;  2DK3 A;  1JRI A;  3A5Z B;  2QQ9 A;  4M78 E;  1YB3 A;  1VQN T;  1VQK T;  3EFS A;  1L0W A;  4P74 A;  1EIF A;  3VJP A;  1N8R U;  3FB9 A;  3G71 A;  3I56 A;  4P3P A;  4C0F A;  4L5G A;  1ADY A;  3HRU A;  2LQ8 A;  1OZ3 A;  1U1S A;  2ODR C;  1KD1 C;  4JDS A;  2XDB A;  1M1F A;  3WXM B;  1YCY A;  4M75 A;  3VU3 C;  4F7U E;  3MP6 A;  2YRV A;  3JRZ A;  1NJI C;  2ZPB B;  4YRT A;  1WJS A;  2EIF A;  4LDV A;  2QQS A;  3JB9 H;  4E47 A;  1UGQ B;  5GAN 8;  5J3B A;  4D6W A;  2VXE A;  1C0A A;  2DPP B;  4RQF A;  3CCS A;  4DQ2 A;  3MQZ A;  2L3R A;  3HL8 A;  2DXT A;  3HXZ A;  4YRP A;  4LDY A;  1BBW A;  3LSS A;  3KUF A;  4RMF A;  4C5I A;  5GMK i;  3MEU A;  3BDL A;  4YRC A;  3JCM V;  1BI2 A;  2ZT6 A;  1VQM T;  5DM7 R;  1WNL A;  1VQK A;  2YHT A;  5KCH A;  2EYQ A;  3J80 E;  4P73 A;  4YRQ A;  4ZTJ A;  4RQE A;  3MEA A;  3JCM g;  2QEX T;  3LYI A;  1JB0 E;  2ZZD A;  3NEN A;  1N9W A;  1H3Z A;  4Q15 A;  5GAN 7;  2IY5 B;  2DXC A;  4C8Q E;  1HC7 A;  3A8M B;  5GAN 2;  3M9Q A;  2PME A;  4J7F A;  2ZPH B;  4Q5W A;  3X20 B;  1ZBX A;  4E7K A;  3M5A A;  2OTJ T;  3CD6 T;  3BFM A;  2WAC A;  5IN1 A;  1YJN T;  1M90 U;  2JOY A;  3ERR A;  2WSC E;  1KG1 A;  5FU7 B;  4PJO C;  2CJB A;  4XTZ A;  4ZN1 A;  5GAN 3;  2EJG A;  4FT4 A;  3M53 A;  2FB7 A;  1B7Y A;  4AH6 A;  1SET A;  2EL9 A;  3Q1J A;  2ODR D;  2QI2 A;  3G4S T;  1W4S A;  3GOX A;  5CK9 A;  2WSE E;  3ZBD A;  5J39 A;  4XAX B;  5GAM h;  4EX5 A;  3M4Y A;  3HFO A;  2K5F A;  4MMK A;  1EQR A;  3SD4 A;  2VGM A;  2F5T X;  2DXU A;  2HD0 A;  4EPC A;  1VQM A;  2JUF A;  3LGL A;  2DIQ A;  2A7Y A;  2JNG A;  4JLI A;  2GQV A;  4Q6G A;  3LH0 A;  5FRO A;  4CS4 A;  4EDU A;  3VQY A;  4J6W A;  1X6O A;  5ELO A;  4C5E A;  5CKB A;  4XQ3 A;  3QO3 A;  1YI2 A;  4P75 A;  1Q7Y C;  4IUP A;  3TCJ A;  3TEG A;  1QVG A;  2LCL A;  3A8H B;  4PLL A;  4LD9 K;  5GAO r;  2EQK A;  2DU7 A;  4IUV A;  3CD6 A;  4M77 F;  1GGM A;  1YJ9 T;  1UB4 A;  4M78 A;  3HRK A;  4JUV A;  1N9S A;  3OS5 A;  2P4T A;  3WQZ A;  2LVM A;  4K87 A;  1R8O B;  2CZ6 B;  3A31 A;  2DTI A;  4HVC A;  3RAC A;  4C92 F;  1KMM A;  2XKO C;  5GAN j;  3NFC A;  4RKU E;  3G4S A;  4E51 A;  4C92 G;  1K73 U;  4IUR A;  3OS1 A;  3P8B B;  3A8L B;  4TVA B;  3L1A A;  4CH5 A;  5CO7 A;  4PJO D;  3OYM A;  4XTV A;  5CCA A;  3AHU A;  5GAO q;  2LCC A;  3QYG B;  4F7U A;  4JS5 A;  5J26 A;  4LVM A;  2R5A A;  3SB2 A;  1WU7 A;  3OYJ A;  3A7U A;  2R57 A;  3LC0 A;  2LDM A;  1VQL A;  4FL6 A;  3X26 B;  4PJO B;  3BDU A;  4H2T A;  3RIR A;  4HCZ A;  1M1G A;  3PMI A;  2LX9 A;  1FYF A;  3LWI A;  1YJ9 A;  4YCW A;  1KQS A;  2M1H A;  4E7L A;  3CCQ T;  2D9T A;  4IUQ A;  3OQ5 A;  4BDY A;  4A4H A;  4GLK A;  2DAQ A;  2RI5 A;  1I8F A;  4M75 F;  4PHC A;  2LTO A;  4WI1 A;  2Y4X A;  3MEV A;  5GAN e;  2PUO B;  4YRS A;  4M75 G;  1ADJ A;  1BKB A;  3JB9 F;  2Y4Y A;  5GAN 5;  1Y7X A;  4C8Q A;  3RGL A;  4G84 A;  1B70 A;  3QO8 A;  2KK4 A;  3CMA A;  3OYC A;  2IG0 A;  4KT0 E;  4XU2 A;  3VYG A;  1OZ2 A;  5LJ3 h;  4QVC A;  2KMT A;  3ER0 A;  1Y71 A;  1XTD A;  2RHY A;  3MF1 A;  3NEL A;  1KHC A;  2VYT A;  1BI3 A;  4BD3 A;  3A5Z A;  2V8K A;  2RI2 A;  4C5G A;  3OA6 A;  3S3N A;  5GAN 4;  1WGS A;  2E6N A;  4JJN K;  4A4K A;  4YRJ A;  3KXT A;  4E7J A;  1E1T A;  1NPP A;  2QQB A;  1JJC B;  4IUU A;  2YLB A;  3ZFJ A;  2QTX A;  2ZXF A;  3CXC S;  3CCE T;  3PFS A;  2LC4 A;  4PL6 A;  3M55 A;  2XGT A;  1PYS B;  5LJ5 h;  3HTZ A;  4YRK A;  4J6X A;  2JN0 A;  3RL6 A;  2RA2 A;  2I4M A;  5FLX E;  3OD1 A;  1XOV A;  3DSQ A;  5HK3 A;  3HPW A;  1H4S A;  2Q5H A;  3L2Q A;  3UFG A;  3QJY A;  1G51 A;  2ZPF B;  3OSS C;  1G3W A;  5GAN d;  3VYH B;  2E12 A;  2I2L A;  1I81 A;  3RER A;  1M1K U;  2PVD B;  2RM4 A;  3NET A;  2RHS B;  3OYN A;  4PJO E;  3IAL A;  4L59 A;  3CPW A;  2ZZF A;  3OYA A;  5CQY A;  5C0M A;  2ZPI B;  1NE8 A;  2EQU A;  4P71 A;  3A5Y A;  2X4X A;  3VUB A;  2XDD A;  3X25 B;  2E65 A;  2VC8 A;  4RCB A;  1N6A A;  1HXD A;  1SRY A;  4ZN3 A;  4TQF A;  4HWR A;  4N4H A;  3OYE A;  5GMK h;  3IKM B;  5KCO A;  2Q5I A;  1QP2 A;  2CGH A;  2KSS A;  4VUB A;  1H4Q A;  2PQW A;  3CCE A;  3HRS A;  1WJQ A;  3OYG A;  1NJ6 A;  4KQE A;  1J5W A;  3L2V A;  3LWH A;  2IY5 A;  4TQD A;  1VQ7 T;  3X24 B;  4M78 F;  1LOJ A;  3H8Z A;  3JAM E;  2ZZG A;  4P72 A;  1DJ7 B;  3HRT A;  1EVK A;  1G3S A;  3CC2 T;  4MDX A;  2FL7 A;  4M78 G;  5EG2 A;  1ZQ1 A;  2E5Q A;  1USY C;  3UWN A;  1K9M C;  1OI1 A;  1Y96 B;  5A0L A;  5GAO n;  2CJ9 A;  3JCM d;  3E9F A;  2R58 A;  3T9N A;  4MZT A;  4IUT A;  2ZPE B;  2IVW A;  5FU6 C;  4QW2 A;  2P0L A;  2ZZE A;  3CC4 A;  4KUI A;  4BDZ A;  2CS7 A;  4K88 A;  1YGB A;  2V8I A;  2EFI A;  3URG A;  4YRI A;  1EIY B;  1Z7N A;  4ELZ C;  2CKK A;  3L2W A;  2QHS A;  4HCC A;  4F7U F;  2L8D A;  4OB3 B;  3FRN A;  1W66 A;  3CCV T;  1UEB A;  4OB1 B;  4FM4 B;  2XTI A;  2DD5 A;  4OF1 A;  3UT1 A;  1HTT A;  1VQZ A;  3CEY A;  1VQ7 A;  1M8V A;  5HGQ A;  2RD1 A;  2RJE A;  4UP9 A;  4J15 A;  3CC2 A;  3HXY A;  4PG3 A;  3CPF A;  3WVD B;  3QII A;  2K3X A;  3A8G B;  4HCB A;  4WJ3 M;  3UH0 A;  5IT9 E;  2XU8 A;  1RL2 A;  3QBY A;  4R56 A;  5A0G A;  4C8Q F;  5C53 B;  1QVF A;  3BW1 A;  1WLE A;  3VQX A;  2ZR2 A;  3CCM T;  4C8Q G;  2DEQ A;  4A54 A;  1WQ7 A;  4TVA A;  2EJF A;  3INZ A;  1NYR A;  3VBB A;  5AYF A;  4ME7 A;  1S72 T;  2DJZ A;  3GP8 A;  3CCV A;  2JZ2 A;  4HT8 A;  3R07 A;  4YP0 A;  3SWN C;  3SFM A;  3PCO B;  3W3S A;  2FYK A;  1H4T A;  4X5O A;  4PJO A;  4FSX A;  4N0A C;  1SSF A;  3V7S A;  5D6Y A;  3ASK A;  5FU6 B;  2HQE A;  5CIU A;  3V8L A;  3ZEH A;  3DLM A;  3QDR B;  4JRI A;  1YI2 T;  3V8K A;  1U1T A;  4H2S A;  1VQO T;  4XU3 A;  2MMP A;  1X55 A;  4BUG A;  2B8A A;  1VIE A;  4CH6 A;  3S6W A;  3CCM A;  2DVE A;  1YHQ A;  1EVL A;  3OYB A;  1QVG S;  1X75 C;  1NJ1 A;  4V2S A;  3UPU A;  2DTO A;  1YBY A;  2Q7E A;  1S72 A;  4X9D A;  3PNW C;  3GNG A;  4M7D C;  3J7A F;  2OAU A;  1NJI U;  4EMH A;  4UP7 A;  3M4G A;  1QE0 A;  3OYL A;  3DB4 A;  2DDZ A;  4G85 A;  1KQ1 A;  5GAN f;  3NTK A;  1NNH A;  4J6Y A;  5DY9 A;  2ART A;  2EJ9 A;  2C06 A;  5CKH A;  3RF1 A;  1M5Q 1;  2LRQ A;  5LJ3 g;  2PVO B;  2ZNI A;  4A4G A;  3VQW A;  2GFU A;  5LL6 S;  1I5L A;  4X9C A;  1JJC A;  3OS0 A;  1YFT A;  3UGT A;  2PVG B;  4ZIB A;  1VQL T;  1I4K 1;  1PYS A;  4JRP A;  2VGN A;  3MEY A;  4TVY A;  1VQO A;  2DQ0 A;  1P92 A;  3OYK A;  3BJU A;  4J8O A;  1SES A;  3JB9 J;  1BI0 A;  2HNI A;  2AKW B;  1G5V A;  3PGG A;  4DOW A;  4KR2 A;  3SWN B;  5F5W A;  2I4N A;  3L2Z A;  2E3C A;  3MEW A;  4BW9 A;  1RIQ A;  4O2D A;  3GF5 A;  11AS A;  1Q86 C;  3REX A;  5LJ5 g;  3P8V A;  1RI0 A;  3RKY A;  1BBU A;  1QVP A;  4YPF A;  1KQS S;  2RHS A;  4LDX A;  3EAE A;  3OBW A;  4NCX A;  2KAF A;  4XTW A;  4BE0 A;  2ZIO A;  2RHQ B;  4C5H A;  1B76 A;  3QZ9 B;  1W2B A;  3TEE A;  1BYM A;  1PSF A;  1Q82 C;  3KFU A;  2QHV A;  3CMA T;  1FX7 A;  4OB2 B;  3VQV A;  3GIB A;  3RES A;  4BWA A;  3JCM f;  3IKL A;  2F5K A;  5DLO A;  3JCM b;  1XNI A;  3MP8 A;  3L4G B;  2AMC B;  12AS A;  1QW1 A;  2DQ3 A;  1JBM A;  1Y07 A;  4CH4 A;  3DKM A;  4M7D D;  2X4J A;  5C51 B;  2QXF A;  1BIB A;  1WJR A;  4LDU A;  3CCJ T;  2MWP A;  2M9U A;  2X4Y A;  2EKO A;  5I2S A;  3G6E T;  3QTC A;  3HY0 A;  4M7D B;  4GY5 A;  2OTL A;  1VQ6 A;  5GAM e;  3VKI A;  4QQ6 A;  3JCM Q;  1Q7Y U;  1Y96 A;  5I21 A;  2EAY A;  4FU6 A;  2E41 A;  3NEM A;  1EOV A;  3HY1 A;  5ELN A;  2RH2 A;  3L2R A;  1JJ2 A;  2O4X B;  2QHT A;  1BIA A;  1KC8 C;  4HWO A;  2X4W A;  1Q81 C;  3M54 A;  4JRQ A;  4M7A C;  1K8A C;  4XTX A;  2LNV A;  5K1P A;  4LVL A;  1EIY A;  1QP3 A;  4BE2 A;  4L6V 5;  4RMO A;  2A8E A;  4C0G A;  4PKC C;  5I2M A;  4CH3 A;  3EFR A;  5FRM A;  1VQP A;  3P8Y A;  1YIJ T;  1IZ6 A;  4XU0 A;  1NPR A;  2MAM A;  4IKF A;  1HK9 A;  4PJO F;  5GAO m;  4JRK A;  4J7I A;  4EMG A;  1AHJ B;  3OY9 A;  5FRN A;  4PJO G;  3CCJ A;  4BI4 A;  3CPW S;  4PLI A;  3E9G A;  3G6E A;  4HWP A;  3C95 A;  3A7R A;  4YCV A;  4Z02 A;  3LSQ A;  2JVV A;  4YRO A;  4BB7 A;  2ZT8 A;  2RI3 A;  2DZ9 A;  4BAC A;  4PNO A;  1EFW A;  2XHC A;  5GAM d;  2E6Z A;  2L89 A;  4DOV A;  4WF2 A;  3JCM e;  4ZGD B;  4YRG A;  2MWO A;  3BY7 A;  2ZIM A;  1PSE A;  2XI9 A;  5L8R E;  3I55 T;  5CKE A;  4XK8 E;  3P8H A;  4HWS A;  4HT9 A;  3V8J A;  3HP9 A;  5GAO p;  1VQ5 T;  4LD6 A;  2G4C A;  1YIJ A;  3CCR A;  1E22 A;  4J5Y A;  3CBO A;  3CC4 T;  3HFZ B;  1YFS A;  3PCO A;  3MP1 A;  4MML A;  4M7A D;  2H3J A;  1USY A;  4DA4 A;  4M7D E;  2KQW A;  5D6W A;  3QXE B;  1FWZ A;  3MO8 A;  3X28 B;  4QVD A;  1O9S A;  4LDW A;  2AHJ B;  4CRI A;  4FT2 A;  4M7A B;  1Z7M A;  2RK1 A;  3E9H A;  2E5A A;  4NL2 A;  2Y90 A;  5KH6 A;  4LVJ A;  3CC7 T;  3JSC A;  2E70 A;  3RUX A;  2BKD N;  3HFN A;  3R6O A;  2HBP A;  1UGS B;  3I55 A;  3PMT A;  1N8R C;  5D6X A;  3GNF B;  5CKD A;  3HSB A;  1WQW A;  1B34 B;  4B9W A;  1VQ5 A;  3OYH A;  2EQM A;  3NTH A;  4RG2 A;  4R55 A;  4TVR A;  4QQD A;  5CVI A;  1YFR A;  4Y91 A;  3CMQ A;  1QVF S;  5KE3 A;  1B8A A;  4UPA A;  3MF2 A;  2ZCF B;  3L2U A;  2ZTG A;  3HXU A;  1MHN A;  4ZTF A;  4M7A G;  3I7F A;  2Q7H A;  2NS6 A;  3RKX A;  3JCM X;  4N4I A;  4KBM B;  4QVZ A;  3TU4 K;  3FJP A;  3ICA A;  4XEO A;  3CC7 A;  2I4O A;  2CZ7 B;  2AKW A;  4M77 C;  4UC4 A;  3C12 A;  2LT4 A;  1X01 A;  3SWN A;  2MF2 A;  2YLC A;  1X2H A;  5LJ3 d;  3P8D A;  4BI8 B;  1FXX A;  3M57 A;  3CCU T;  5GMK e;  5GAN g;  4C92 C;  4CS3 A;  2C7I A;  1WYD A;  4N4G A;  1U8R A;  1K9M U;  4BI3 A;  1ASY A;  2E64 A;  4N0A A;  2K4Y A;  3HHT B;  4H2W A;  4CS2 A;  2EQJ A;  1M90 C;  2P0P A;  4OVA A;  2RHQ A;  2NLU A;  3FIF A;  4HA8 A;  4ZGE B;  4YDQ A;  1YHQ T;  3P8T A;  3E9I A;  4EMK C;  2V8J A;  4M7A E;  4YRL A;  4C0D C;  4XTY A;  3C4S A;  3S3M A;  3G1Z A;  2QA4 T;  4KUL A;  3L4G A;  3OS2 A;  2DU5 A;  5LJ5 d;  2AMC A;  5A2Q E;  2D6F A;  3QKJ A;  2XD0 A;  4XU1 A;  2XIC A;  3NTI A;  2QHU A;  2RO0 A;  3LX7 A;  2J3M A;  3PT9 A;  1SER A;  4LVK A;  4P74 C;  4P3N A;  2J3L A;  2ZGW A;  3OMG A;  2I4L A;  3HXW A;  4RDX A;  2ARS A;  4M7D A;  1E1O A;  3TEH B;  3H6Z A;  4BY6 C;  1VQN A;  2RK2 A;  2BIV A;  1MGQ A;  5K1X A;  4XTU A;  4J83 A;  3CCU A;  4M75 C;  3L42 A;  5CKF A;  1V29 B;  2O4X A;  4P5N A;  4ATO A;  4CI0 C;  3QO5 A;  3OBY A;  4O6J A;  3QSU A;  3QPH A;  3E19 A;  4OGE A;  3OW2 S;  4M77 D;  1G3T A;  2ALY B;  4X34 A;  3VUZ A;  2ZNJ A;  2ZT5 A;  3O8V A;  3QZ5 B;  1KD1 U;  4UP8 A;  1H4V B;  4YTL A;  2RHU A;  2MI6 A;  2R5M A;  1TH7 A;  3CBM A;  4ELY C;  2QA4 A;  5GAM f;  3PZC A;  5E3I A;  5IAY A;  4C92 D;  4A4F A;  4JS4 A;  1K73 C;  4M77 B;  3GPL A;  5CQX A;  2VUB A;  2QQR A;  4TTV A;  4FIB A;  1D3B B;  1VQ9 T;  4P73 C;  2DXB A;  3FC3 A;  4C0Z A;  2L5Q A;  2FVU A;  4Y28 E;  3PIP A;  4C92 B;  1W2B S;  4YRR A;  3OB9 A;  3A8O B;  2RHI A;  1KMN A;  1BI1 A;  1ZHI A;  3RMQ A;  2A3L A;  4DPG A;  1KQ2 A;  3OW2 A;  4EMK B;  5GAN h;  3A74 A;  2DTH A;  3GLX A;  4C0D B;  3HKS A;  2CZ0 B;  2QEX A;  4YRE A;  1G3Y A;  1NJ8 A;  4H2X B;  2CYZ B;  2KY9 A;  4TVW A;  4WJ4 A;  3QO7 A;  4H02 A;  2VV5 A;  2OTL T;  1VQ6 T;  3HXX A;  5GAM j;  1NYQ A;  2K2V A;  1UGR B;  1H64 1;  3M56 A;  2G3R A;  5HK0 A;  1KOG A;  3CCL T;  3FEO A;  3M58 A;  1QF6 A;  5C52 B;  2OTJ A;  1N27 A;  1YJN A;  4M75 D;  2RHZ A;  2F69 A;  5KNN A;  4L87 A;  3KBG A;  3HFZ A;  1N9R A;  2K57 A;  4M77 G;  4OGC A;  3RKW A;  4YRM A;  1X54 A;  3G7Z A;  1OYX A;  3A7A A;  2KVQ G;  1YIT T;  1JJ2 S;  4YRN A;  3JB9 D;  3N5B B;  1VQ9 A;  5C6S A;  4BY6 B;  2ZT7 A;  4HWT A;  4H2U A;  4TWA A;  2GF7 A;  1VQP T;  1LYL A;  1XQH A;  4M75 B;  4QQG A;  3F70 A;  2QDY B;  4OP0 A;  2ARU A;  4P75 C;  5CR2 A;  4M7A A;  4H2V A;  3VV0 A;  4HKE A;  3FLG A;  3HRI A;  3QYH B;  2X35 A;  4E7I A;  4M78 C;  2EWN A;  3JCM h;  2RB6 A;  2ZPG B;  1M4Z A;  2ZIN A;  2PMF A;  3JCM c;  4B9X A;  3HXV A;  2D0Q B;  1X56 A;  1YJW T;  4JLG A;  4M77 E;  5GAN 6;  3CCL A;  1B34 A;  5GMK m;  2M16 A;  3M59 A;  1WPY A;  2P5I A;  2FHD A;  2CIM A;  2DD4 A;  3DLL A;  1Q86 U;  2QQA A;  4C92 E;  2K5L A;  1YIT A;  3J81 E;  2DZC A;  2XK0 A;  5LJ3 f;  5KE2 A;  2P0K A;  3OYD A;  4NOY A;  1M1K C;  1IL2 A;  1M9S A;  3CCR T;  4RCC A;  3MET A;  1G5I A;  2HAX A;  5A0D A;  3UGQ A;  2K5I A;  1Q82 U;  4LNS A;  4ZGJ B;  3QUI A;  4BE1 A;  3JB9 G;  3V7R A;  2GFA A;  1ATI A;  3PIO A;  1LNX A;  2E1H A;  1B7Y B;  4A4E A;  1UGP B;  3CME T;  3QG1 A;  2HQX A;  5GMK l;  4M7D F;  2CZ1 B;  3V7C A;  3S3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...