2EAYA

Crystal structure of biotin protein ligase from aquifex aeolicus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus
rcsb
source organism Aquifex aeolicus
total genus 66
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eayA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2eayA01
4XTZA 1J5WA 4NCXA 4TVAA 3LSSA 4M77C 4YRFA 4HT8A 2P5IA 5LJ5j 4M7AC 1EIYA 4YRIA 2XTIA 1YCYA 1HC7A 4M78C 3M4PA 4YDQA 3E9HA 3V7RA 4YRLA 3TEGA 3RIRA 2I4NA 4KR3A 2J3LA 4H2UA 4P74A 2E3CA 2DTOA 4MMKA 1WQ7A 3GIBA 3QHSA 4PJOB 5CAIA 2DXTA 4XU2A 5K1XA 5DY9A 3RKXA 1N9SA 3VBBA 12ASA 4XTUA 3TEHB 4A54A 4M75F 5LJ3j 4TWAA 3HY0A 4X5OA 1LJOA 5E3IA 4H02A 4C8QD 3A7AA 1USYC 4QVCA 3RKYA 3MF1A 2ZR3A 4JLIA 4P75C 2Q5IA 5GMKe 4CS3A 2EJFA 2RD1A 3OD1A 1L0WA 4M75G 2ZIMA 1BBUA 1NJ2A 4TTVA 4DQ2A 1I4K1 1NNHA 4XTWA 3EFSA 3HXXA 5LJ5d 4HA8A 3QO3A 3VQXA 3JCMg 3VQVA 4HWTA 4PJOA 2JN0A 3INZA 5GANg 5ELOA 5GANf 3AHUA 4M77D 1X01A 1SERA 3I7FA 4P3PA 2PMFA 4OP0A 4M7AD 1KQ2A 4M7DE 3L4GB 4H2TA 1NJ6A 1I5LA 3TEHA 3BDUA 2RB6A 4M78D 2E10A 5GAOl 5ELNA 4J6XA 3V8LA 4PNOA 4PJOE 3RF1A 4BWAA 3DSQA 2E64A 5GAN6 1ADJA 1E24A 4F7UB 4YCWA 1NJ1A 3NELA 1QF6A 4YRMA 2QHVA 4YRCA 3JCMe 4AH6A 4RCBA 4UP8A 4JRIA 1NYQA 2ARUA 2QHTA 2FB7A 2EWNA 5LJ3d 4C92C 4KR2A 11ASA 3JCMb 1HXDA 3CMQA 3JB9I 4M77B 5GAMh 1EQRA 2RA2A 3MF2A 2ARSA 4EMGA 2EJ9A 3A32A 4M7AB 2YLBA 1U1SA 2EL9A 3HXWA 2CJBA 4P72A 4M78B 3L4GA 2CGHA 3LSQA 1H641 4M75C 4P73A 5C53B 4UPAA 2DXUA 2DZCA 4BW9A 3PCOB 4ZTUB 5GAN4 3BFMA 4NL2A 1B70B 1N9WA 3SWNC 3JB9G 2ZNJA 1KQ1A 3QO5A 3REUA 3PGGA 1QE0A 2Q5HA 1LOJA 1I8FA 4M7DF 3LC0A 4YRTA 4ZIBA 3A7UA 3VQWA 2Q7EA 4C8QE 1D3BB 4X9CA 3HXVA 4PJOF 3JCMc 4M77A 1KMNA 2ODRD 3HFNA 2ALYB 2ZZEA 4YRRA 4XTYA 4YREA 3FIFA 4M7AA 4M7DG 4YRNA 4EMKC 2E5AA 5GMKh 1E1TA 4EX5A 4M78A 4K88A 4PJOG 2ZINA 4Y91A 1HTTA 4CS4A 1KMMA 5GMKm 3PCOA 1Z7MA 5GAMj 4C92D 2CIMA 1GGMA 3BY7A 3V7SA 1WQWA 4M7AE 4XTXA 1B70A 4XU3A 3G1ZA 2RHQB 1JRIA 4XU1A 4M78E 3EFRA 2P0LA 4P71C 3KFUA 4Q6GA 5GMKi 3L2ZA 4P3OA 3M4QA 1D3BA 2I4MA 1WLEA 1X2GA 4J6YA 4HWPA 2FYKA 4HVCA 4O2DA 1EFWA 2ALYA 1G5HA 2E1HA 1U1TA 1USYA 1SETA 1WNLA 1X54A 3JCMh 1Y96B 5GANh 4P75A 4C8QF 4H2WA 1HK9A 5GAN5 4C92B 3HXUA 4CH5A 5GAN3 4KQEA 3JCMf 3P8YA 1X55A 3BW1A 1IL2A 2YHTA 2ZGWA 2DZ9A 4N0AC 3IG2A 3REXA 4YRQA 3W3SA 4YRJA 1B76A 2RHQA 4TQDA 3SB2A 2YLCA 4YPFA 4C8QG 5GAOq 2G4CA 5F5WA 2DVEA 4M7DC 5GMKj 1MGQA 4H2VA 2C8MA 4RQFA 2Y90A 2ZT8A 2QHUA 1E22A 4YRKA 3JCMJ 5C52B 2VXEA 4M75B 4M77F 4PJOC 2QTXA 1BBWA 4J15A 5GAMd 3HFZB 2DJZA 4M7AF 4WF2A 4X9DA 2C7IA 4TQFA 4M78F 3JCMX 1Y96A 4XTVA 3SWNB 4YRGA 4WJ3M 3A7RA 4MMLA 4TVYA 1WU7A 2I4LA 4RQEA 4C92A 1ASZA 1JJCB 4M7AG 3RL6A 1H4VB 1EVKA 3HRIA 3RKWA 5K1PA 2ZCEA 4HT9A 2DDZA 3RESA 5I21A 1X2HA 2J3MA 3WQZA 3A74A 2K57A 5GANj 3QNEA 2HNIA 4EMKB 3QTCA 1EOVA 4C92E 1Z7NA 3JB9D 5GAOm 3NEMA 4M75A 2RHSB 4J6WA 3E9IA 2VXFA 2DKGA 3HFZA 5GAN2 4EMHA 2ZT5A 3P8TA 4F7UA 1VQZA 1ADYA 2DU7A 3P8VA 4XEMA 4YROA 3HTZA 2DTIA 5GAN8 3SWNA 4K87A 2PMEA 4C8QC 1RIQA 4JRKA 3HXZA 1WYDA 3HFVA 5KNNA 1TH7A 4CH4A 3V8JA 2E41A 5LJ5e 1JJCA 2ZT7A 3V8KA 4F7UE 3RACA 1B7YB 1G5IA 5HGQA 3ICAA 4NOYA 1SRYA 1C0AA 3HSBA 1B34B 5LJ3g 1EVLA 3UFGA 4G85A 3M4GA 3JCMP 2DEQA 4PG3A 3JB9H 4EMKA 1YGBA 4XU0A 1H4TA 4YRPA 4YRSA 4M77E 3V7CA 2RHSA 3QO8A 2ZXFA 4H2SA 4HWRA 5GAMe 5GAOp 4CH3A 4NL3A 2AMCB 4K86A 4H2YA 3JCMd 3RGLA 4G84A 3A5YA 5GANd 5LJ3e 4P74C 2Q7GA 1LNXA 3FJPA 4M7DB 4C92F 4P71A 4CH6A 2AKWB 2ZT6A 3A5ZA 2ZZFA 4OLFA 4M75D 1B7YA 3HY1A 4E51A 4UP9A 1YFSA 1B8AA 4H2XB 1B34A 4ZTZB 3IALA 4HWOA 1E1OA 1SESA 2ZTGA 3NENA 3JB9J 4CS2A 1PYSB 5GAN7 3L1AA 4C92G 3BJUA 3R07A 2IY5B 1ATIA 1H4QA 1I81A 4Q15A 2ZNIA 4YCVA 3ERRA 3HRKA 4RMFA 1YFTA 2ZR2A 4F7UF 1YB3A 4RCCA 2AMCA 4TVWA 5C51B 4N0AA 3RUXA 5GAOr 1KOGA 4JUVA 4M7DA 3HFOA 1NJ8A 4F7UG 2EJGA 2AKWA 2QHSA 3UH0A 1WPYA 3RERA 5GAOn 4P3NA 1N9RA 2CJ9A 2I2LA 4XEOA 1H4SA 4EO4A 4H2XA 3UGTA 1PYSA 3IKLA 4YYEA 3QSUA 4M77G 2IY5A 1M8VA 2ODRC 2ZIOA 2E65A 4C8QB 2EAYA 3VU3C 4HWSA 3JCMV 5LJ5h 1M5Q1 1BIAA 4A53A 1JBMA 2DQ3A 2RM4A 1NYRA 4WI1A 4M78G 2DTHA 1NJ5A 4L87A 5LJ5g 5GANe 5LJ5f 1LYLA 3MEYA 1BIBA 2CJAA 4TVAB 4UP7A 4RDXA 2Q7HA 4XQ3A 2ARTA 1ASYA 1FYFA 3QUIA 2XGTA 1EIYB 3HXYA 4V2SA 4P72C 3TUPA 3FB9A 3JCMQ 3JB9F 2ZZGA 3NETA 3QO7A 4P73C 2I4OA 5GAMg 3IKMB 5GAMf 5LJ3h 4YP0A 1YFRA 4M75E 1X56A 4C8QA 4M7DD 2DQ0A 2DU5A 4WJ4A 5GMKl 1W66A 4J5YA 3A31A 3JCMW 4YCUA 5LJ3f 4PJOD 2VC8A 4DPGA 3VQYA 4QVDA 3UGQA 3PZCA 4PHCA 1G51A 4LNSA
chains in the Genus database with same CATH superfamily
1J5WA 1T3LA 2ECZA 1HD3A 2D0QB 1BB9A 2Z0WA 2PUOB 4AT1B 4YRIA 1YCYA 5L23A 5IN1A 4KBMB 2MAMA 1WIEA 1QCFA 2LX9A 4N4HA 3E9HA 3CPWS 2JUFA 3TEGA 2RHZA 2PU9B 2I4NA 2PVOB 4P74A 1VUBA 3ZEHA 3M57A 2CZ0B 2DXTA 2MWPA 3OW2A 1S72T 4FYXB 5DY9A 3G6EA 2A37A 2F5TX 1N9SA 1QVGP 1HSQA 4RTUA 5HK3A 5DM7R 4X5OA 1LJOA 1X27A 1BCMA 1U06A 1K73U 4H02A 4C8QD 1RI0A 1USYC 1GCQA 2DYIA 3CCMQ 2ZR3A 4CC2A 4FSSA 2O88A 2RI3A 3NTHA 3ME9A 1PM3A 3CEYA 2Q5IA 2E4HA 3M54A 4CS3A 2EJFA 2KXCA 3CCQQ 1ABOA 3OYEA 3CCUA 1Z9QA 1NJ2A 2LJ1A 3EFSA 4ME7A 1OI1A 5KE2A 3VQVA 4HWTA 4MDWA 3H0FA 3INZA 3NTIA 2RH2A 4J7IA 4Z02A 2A8EA 4P3PA 4OP0A 1E6HA 3L4GB 3EG9A 1LPLA 1PG5B 1I5LA 2CH4A 1WJQA 2E10A 4A4EA 1G8XA 4PNOA 3DSQA 2ESWA 2LT4A 1ADJA 3G6ET 1YIJT 1QVPA 4YCWA 2RMOA 3CPWP 4YRMA 2QHVA 1NE8A 1X6BA 1M9SA 2DRKA 2HD0A 3CC7A 2RO0A 4FT4A 2R5MA 2I0NA 1LCKA 4J9IA 4PFPA 2FB7A 2EWNA 1WI7A 4C92C 1KIKA 2M9UA 3HKSA 4FIBA 2P0PA 3TSWA 11ASA 4DBFA 3L2QA 2HKQB 3I35A 4M77B 2CT4A 1BYMA 3MF2A 2KI7A 3CCUT 5CIUA 2EL9A 3ULRB 4ZN1A 3EFOA 1M30A 3CBMA 1BU1A 1D0ZA 1RAHB 1VQOA 5C53B 4PJMA 4KGVB 1QMCA 2BKDN 1C1AA 1WDXA 2LQKA 5IH2A 5GAN4 2GCXA 3VS3A 4J9EA 4QVZA 4Z88A 3JB9G 2HL3A 1WGSA 2ENMA 5FU6B 2HAXA 2WACA 2VUBA 3LWIA 1LOJA 1I8FA 3VS5A 3VQWA 1VQ4T 1D3BB 5ECAA 3HRSA 4X9CA 1QVFS 3HXVA 2DL7A 1YHQQ 4JS5A 3P8BB 1KG1A 1KMNA 3CC7T 3HFNA 1NZ9A 1ZUUA 4XTYA 2DILA 4C0DC 1VQLQ 3CCJT 3C0CA 2MIOA 4LDWA 4BE1A 2E5AA 4CC7A 2KYBA 4K88A 1ABQA 1Q81R 1WHKA 2ZINA 1HTTA 1M3AA 2C0TA 2LMJA 2JZ2A 3VS1A 3Q1JA 2CIMA 1V76A 4OMMA 4M7AE 2VGMA 2RQRA 2VGNA 1B70A 1AWXA 4XU1A 4M78E 1YCSB 1KD1U 1Q7YC 4Q6GA 4ESRA 4F16A 1Q95G 1WXUA 2NUPA 5D6YA 3M4QA 1WLEA 3MP1A 3TQ7P 4BY6B 1Q81C 2FYKA 1R8OB 2PZ1A 1FWZA 1ZSGA 2ALYA 2HZYA 1AZEA 4JJBA 2LCLA 1USYA 4J9GA 1X54A 1Y96B 4A4HA 1OQKA 1K9MR 1GBQA 5KYWA 2G3RA 1B3QA 4KULA 1HK9A 3LLRA 5A0LA 3S6WA 2XDPA 5I2MA 4CH5A 1M2VB 3TSZA 3BW1A 1H92A 2DZ9A 2QI2A 4LDYA 1R77A 1OU9A 4RUGA 2RHQA 1KK7A 3SB2A 4HVVA 5GAOq 1NG2A 2JJ9A 5GMKj 1QVFP 4FYWB 1ZA1B 1PD1A 9ATCB 2Y90A 3HTRA 3G71A 4LVLA 1E22A 1N6AA 3CCSQ 3JCMJ 4RTVA 4PJOC 4J15A 5GAMd 4M7AF 3THKA 2KDSA 7AT1B 4J9DA 3VS6A 4M78F 5FLXE 3JCMX 4XTVA 3SWNB 4DBQA 3G4SA 2LX7A 3I55Q 3CCVT 2QEXA 2DIGA 4JLGA 3MP8A 2E3HA 1PKTA 4C92A 2ED0A 4M7AG 4OB2B 3I56T 2RQVA 4AFUC 3PMTA 4AG2C 3X24B 2DIQA 1JXMA 2J3MA 1MMNA 1QWEA 3QWXX 2A0FB 1WXBA 1ZUYA 3I5RA 2HNIA 2AKKA 2EBPA 3QTCA 2CZ6B 2EQMA 3NEMA 4RKUE 2JW4A 4FW1A 1RAEB 2E3IA 2VXFA 3HFZA 4EMHA 2ZPBB 5IHIA 2DU7A 4XEMA 1VQ5Q 4KT0E 2K3XA 5GAN8 1NM7A 4C8QC 4JRKA 2HBWA 3HXZA 1YITT 2O4XA 2CKKA 1MMDA 2Y4XA 4CH4A 2E41A 3A5ZB 2HQXA 2LTOA 3FC3A 3RACA 3JAME 3ICAA 1SRYA 3G4ST 3HSBA 2L3RA 1IHWA 3CCET 2QEXT 2JM8A 3VV0A 4PG3A 4MDXA 3MHXA 1YGBA 2JS2A 2DK3A 1H4TA 3CD6T 4HT4A 4YRSA 3SEMA 3WVEB 3E2UA 3V7CA 4AMCA 1CKBA 4HWRA 2GQIA 1VQ7Q 3ASKA 4H2YA 2H3EB 3VKIA 1YJNT 3JCMd 5GANd 3UF4A 2DRMA 4JJCA 1G3WA 2HCKA 4NS5A 2Q7GA 2K5LA 1UTIA 1W70A 2CSIA 4E7JA 4QQDA 4M75D 1B7YA 3HY1A 4UP9A 1YFSA 1B8AA 3M0QA 4H2XB 2QQRA 2AK5A 2K7AA 2FPDA 3CCRT 3JB9J 5GAN7 1SPKA 1OEBA 1V29B 2LVMA 1H4QA 3EGDA 3EHRA 1AT1B 4QW2A 1NJIR 4RMFA 1PC0A 1YB3A 2JXBA 5C51B 2M1HA 4OMNA 2COZA 1VQ9Q 1TTHB 1MMGA 4JUVA 4BD3A 2QQBA 4QT7A 2O01E 1M1KU 1WLPB 1WPYA 1SRLA 3FDRA 3UH0A 2EFIA 1NJIC 2YWWA 5GAOn 1N9RA 3MPUB 3C4SA 3KUFA 1U5SA 3X28B 5CKDA 1PYSA 1C6VX 1TU0B 5KYYA 1AHJB 2IY5A 1M8VA 2BZXA 2PTKA 4CRIA 3UATA 1VQNA 1M4ZA 4MZMA 1BKBA 1TS9A 1RAGB 2RM4A 3OS0A 2VWFA 1Z9ZA 3WXMB 4LDVA 2FRYA 1JJ2A 4DOWA 2K4YA 4BDZA 1UUEA 4Q5WA 4IUTA 4PK4A 1K8AR 5LJ5f 1LYLA 2CJAA 2LT1A 1SSFA 2XMFA 2MCNA 2COWA 2FL7A 4V2SA 3M58A 3SHWA 3S3OA 4P72C 2EKHA 4BE0A 3CC2Q 3NETA 2D8HA 2GF7A 4P73C 1K8AC 2RJEA 3IKMB 5GAMf 3J7AF 1YFRA 3CMAT 4C8QA 3EH1A 4M7DD 4R0KA 4WJ4A 4J5YA 3RR6A 5LJ3f 4FYYB 3TVTA 3VQYA 4QVDA 4J9BA 8AT1B 3MP6A 3C94A 1G51A 2RQWA 2QGGA 4LNSA 2LCSA 2VV5A 4XTZA 3OMGA 3QJYA 1FMKA 2KT8A 1UE9A 3LSSA 1YWOA 3KBGA 3DB3A 1X43A 2A3LA 2P5IA 5LJ5j 4M7AC 1VYVA 4RTXA 1VQPQ 3LGFA 4M78C 4XK8E 3M4PA 3UA7A 3CXCS 1W6XA 2BIVA 1YJWT 2J3LA 2GNCA 3VS2A 2D8JA 1Q82R 1N8RR 1WJRA 3QHSA 4GBQA 4C5IA 1S72Q 4AFZC 1VQ6T 3HPWA 1SHFA 2RQUA 4XU2A 1NYGA 2NS6A 4DOVA 3PIPA 2CYZB 4ELZC 3VBBA 2OTJT 1YJ9A 3EG9B 2V8IA 4LVIA 5LJ3j 4C5GA 4TWAA 4D8DA 5E3IA 2KBTA 5KYUA 1M3BA 2YDLA 4OB3B 3HRTA 4FCYA 3BDLA 1N8RC 4QVCA 1N5ZA 1BI0A 1D0XA 3RKYA 3H41A 4LVJA 3H9NA 4P75C 2DEUA 3N5BB 2A28A 3CCLA 5GMKe 2O31A 2K5IA 2RD1A 2ZIMA 2DXBA 2OTLT 1BBUA 3MO8A 1RAAB 2KY9A 2WSCE 4BB7A 4DQ2A 1I4K1 4XTWA 1NPPA 2KROA 3VQXA 1QKWA 4BE2A 2E5QA 2JN0A 3G1JA 5ELOA 2KXDA 5GANf 3DKMA 4M77D 1X01A 1IO6A 3FRNA 3EFOB 3J80E 1NJ6A 1H8KA 1T3SA 3TEHA 3BDUA 5D7UA 3C12A 1UGRB 2DLPA 4C5HA 3G6EQ 1YIJQ 4IKFA 3V8LA 4PJOE 4BWAA 4C0GA 1VIFA 5D6XA 3MEUA 5HKCA 2B86A 3R6OA 3VS0A 3CXCP 3A1PA 4J83A 1WHGA 2EQUA 2IVWA 2K5FA 1NYQA 2ARUA 1KSWA 4KR2A 2DF6A 5CKEA 1IXDA 3VUBA 4HCCA 3JCMb 1HXDA 1QP2A 1ACMB 3CMQA 3HL8A 4PLLA 2HKNA 2HEQA 2RA2A 2V26A 1W4SA 3A32A 2RHIA 4L5GA 5IAYA 3UPUA 1VQKA 3HXWA 2CJBA 2B8AA 4P72A 2LJ3A 4M75C 1I1JA 3QZ9B 2P4RA 4FW2A 4FM4B 4LUDA 4P73A 2DXUA 2EKOA 2DZCA 4BW9A 3DB4A 3RMSA 2KRNA 4BI4A 3M55A 2HQHA 4ZTUB 2CP5A 2L8DA 2DYBA 2GBQA 1B70B 4D8KA 2M0YA 1I0CA 1VQ4Q 1MV3A 1TUCA 1IGUA 1VQMT 2MPXC 4YRTA 4HCKA 3A7UA 4ZIBA 4C8QE 2NUPB 1OPKA 1YN8A 4PJOF 1UJ0A 1YI2A 2JTEA 3CCJQ 2HSPA 2ALYB 2F5KA 4R55A 4YRRA 5CKBA 4YREA 2ZPEB 1GBRA 4M7AA 2OJ2A 1MMAA 5GMKh 3AT1B 4OMPA 4M78A 6AT1B 2PVGB 5KYWB 2ROLA 4OB0B 4PJOG 2J6OA 1AWWA 3M56A 1KMMA 5GMKm 4FU6A 3PCOA 2J6FA 2NLUA 4BUGA 2RHQB 2VB6A 5GJWB 3SFMA 1UECA 3EFRA 4P71C 3HRUA 5A2QE 1X2GA 5IXFA 2EPDA 2D6FA 2V1RA 1G5HA 1U1TA 1XOVA 2HBPA 2QG9B 1TSFA 4P75A 3OB9A 4PLIA 4C8QF 3E9GA 1RL2A 1ZX6A 3MEWA 3HXUA 4C92B 3QPHA 1RABB 1K4US 2QA4A 5GAN3 3PIOA 3IQLA 5HK0A 5AYFA 3W3SA 3QDFA 5FU7C 1B76A 2M16A 1QW1A 4FYVB 4C8QG 2DVEA 4M7DC 1MGQA 2LQNA 3JSCA 2C8MA 1D1BA 2ZT8A 1HYOA 2KRSA 2VXEA 2QTXA 5J39A 4QQGA 3HFZB 1RLQC 3EGXA 4HVUA 4WF2A 3M0RA 2C7IA 2HMAA 2EIFA 3CCVQ 2QXFA 3A7RA 4MMLA 1MHNA 2IIMA 2O4XB 3ER0A 3QWYA 3I56Q 3CC4A 1IRXA 2X51A 1ASZA 4DEYA 2KE9A 2X3WD 3R6NA 3RKWA 2VVKA 1RAIB 2R5AA 3KFVA 1X2HA 2AZVA 5A0DA 4LE9A 4C0DB 2DL4A 2DL3A 3QNEA 3M9QA 1TG0A 2JVVA 1M8MA 2YUPA 4GLMA 3JB9D 1TUGB 5GAOm 4M75A 2DM1A 2QDLA 4J6WA 3P8TA 5CK9A 4B9WA 4LXCA 4E7IA 1K0XA 3P8VA 3HTZA 1OX9A 4PFZA 1YITQ 2CT3A 1WYDA 3OS5A 4J9HA 4HXJA 5KNNA 5LJ5e 2LDMA 3EG3A 4F7UE 1B7YB 2DMOA 3DLLA 2XU8A 3A8GB 3CCEQ 4E7SA 2COYA 4NOYA 2QEXQ 5HGQA 5LJ3g 1WHMA 4JRQA 4G85A 1Q7YR 2CDTA 2LQ8A 2ZPGB 3JCMP 3CC4T 1ZQ1A 2DPPB 3CD6Q 3T9NA 3P8HA 3EGDB 3CCMA 1PCXA 2A36A 4OMQA 1KJWA 3QO8A 2ZXFA 1QQJA 5GAMe 3OS2A 4NL3A 3CCQA 1K1ZA 1YJNQ 1JEGA 2RPNA 4LDUA 1DJ7B 4K86A 4IIMA 1VQOT 3A5YA 3REBB 3NTKA 5LJ3e 1W2BS 4P71A 4CH6A 2C0IA 4OLFA 3CCRQ 3M0TA 5FU6C 4Z89A 1B34A 4PFOA 1OZ2A 1EFNA 1Q81U 3IALA 2FPFA 4HWOA 2ZTGA 5IHKA 4CS2A 1PYSB 3CBOA 5KYYB 2IY5B 2E6ZA 2ZNIA 3ERRA 2DJQA 1Q86R 1ZBXA 5I11A 5C0MA 4F7UF 2ZR2A 2PQWA 3QDRB 2AMCA 2FO0A 4TVWA 2ZAEA 3EH2A 1KOGA 4M7DA 2LCCA 4F7UG 2QHSA 4GLKA 1Q86C 4C5EA 1KQSA 1KFZA 3LH5A 1ZSZC 1K9MU 1WYXA 4OMOA 5KCHA 3TREA 2XI9A 3A8HB 3OYGA 1NLPC 1OPLA 2PNIA 5CQYA 4DBRA 1RADB 1J3TA 2D9TA 1HJDA 3QSUA 1UB4A 4PL6A 2RJFA 2ZIOA 2E65A 2YUQA 4IURA 4C8QB 2LNHB 1AEYA 2EYWA 2WSEE 5LJ5h 2VASA 3NFCA 4LNPA 3OYFA 3VS4A 4M78G 4PKCC 2XICA 2MI6A 2VKNA 2GFUA 1W2BP 4F14A 1YHQA 4QQ6A 5GANe 3MEYA 3TCJA 1VYTA 2NUTA 4QKUA 1BIBA 2L3QA 4KGXB 4JPBW 1VQLA 4XQ3A 2ARTA 1ASYA 2EYXA 3GBQA 1LVKA 3QUIA 1SHGA 1QVGA 2DFUA 3C95A 4JZ3A 3G71T 3FB9A 1WHHA 3JCMQ 3CMAQ 3QZ5B 3SDZA 1IGQA 5LJ3h 3DLMA 1TXQA 4M75E 1X6GA 4BDYA 2FZCB 5CKFA 1O9SA 1UJYA 3OYLA 3A31A 2K6DA 2BTTA 3JCMW 3SD4A 2VC8A 3OSSC 2HDAA 1NEGA 2K79A 3URGA 5CO7A 2QYZA 4NCXA 3H0IA 2DO3A 4TVAA 4RTWA 5KYUB 2KSSA 4HT8A 5KH6A 2K2MA 1PRLC 2RF0A 2F2WA 5IT9E 1EIYA 1Y71A 1G2BA 2XTIA 1HC7A 2XDDA 4YDQA 2MK5A 3ZBDA 3CPFA 4CC3A 3GLXA 1YJWQ 3V7RA 4YRLA 4IUQA 2DD5A 3CPWA 2DETA 5LL6S 2DTOA 1D0YA 1VQ6Q 1WQ7A 2EYYA 5I22A 3GIBA 2M02A 2WSFE 1UFFA 3OW2S 5CAIA 2OTJQ 5K1XA 3CCSA 2KT1A 3RKXA 2DAQA 4Z8AA 4XTUA 3TEHB 4A54A 2XIDA 4M75F 4A63B 1RACB 2V8KA 3HY0A 5I2SA 4O5VA 2YRCA 1UGPB 3MF1A 2KNBB 3LW5E 3I55A 2J7IA 4JLIA 2OTLQ 3OD1A 1L0WA 2ATCB 2FHDA 4M75G 1M90R 3EG2A 3OA6A 2ED1A 3OSVA 4TTVA 1YBYA 2V8JA 2JNGA 3HXXA 3CMEA 4HA8A 1RUWA 1JO8A 3QO3A 4PJOA 3OYBA 2CUBA 2LJ0A 3AHUA 1WX6A 1ZSZA 3I7FA 1M1KC 2PMFA 1BCOA 1NJIU 1M90C 4M7DE 4H2TA 3PNWC 3VYHB 3E9FA 3OY9A 1VQ5A 1O75A 3RF1A 1PD0A 4AG1C 1B7TA 1EX4A 2E64A 4F7UB 4C0FA 1NJ1A 3NELA 1QF6A 4YRCA 2BUDA 4AH6A 1OULA 2AIRB 1D1AA 2QHTA 1SEMA 5IHNA 3S3MA 5FWBA 2NYSA 2NWMA 3OW2P 1AWJA 2YRVA 1EQRA 2ARSA 4EMGA 4J8OA 1KHIA 3PMIA 4M7AB 2YLBA 2J06A 2QK0A 1TWBA 4M78B 2XHCA 4ZGEB 3CMET 1ZLMA 3RMQA 1VQ7A 2CZ7B 3QYGB 3O5ZA 4UPAA 2K9GA 1K0SA 3PCOB 2CZ1B 4GY5A 1K8AU 3BFMA 1N9WA 2FEIA 1MNDA 4WTOB 2EGEA 1VQMQ 1JB0E 3REUA 3VRYA 3PVQA 4KRTA 4D6WA 4M7DF 3LC0A 1VQNT 3VS7A 3PVLA 3GNFB 4UC4A 3FJ5A 3QXEB 3JCMc 2EQKA 2J05A 2LNVA 1QVFA 5D6WA 1NEBA 1X6OA 1Y0MA 2ZZEA 2V1QA 3FIFA 4IUUA 1X2QA 1R0CB 4M7DG 4YRNA 4EMKC 2OAWA 4EX5A 2KVQG 1M27C 1WXTA 4E7LA 1MUZA 1Z7MA 1VQ9A 5GAMj 4C92D 3LGLA 1UHFA 4MZTA 3NHNA 5CVIA 2KEAA 4A4GA 5GMKi 3L2ZA 4P3OA 3MJXA 2I4MA 3GP8A 4J6YA 4HWPA 2BZYA 1SSHA 1KC8R 1MNEA 2X9HA 3EGXB 2XG8D 5FRNA 2E1HA 4P5NA 1T0JA 5FWCA 1E6GA 1BI2A 3OQ5A 1Q82U 1N8RU 4JJNK 5GAN5 1VYUA 5FW9A 4KQEA 3JCMf 1KC8C 1IL2A 2YHTA 3IG2A 4TQDA 2M0OA 2L89A 2G4CA 3X25B 4YPFA 1QCOA 1UDLA 3L2VA 2P4TA 3A8OB 4Y92A 3L2UA 4OMFB 2ROTA 2QHUA 5M9OA 1VOMA 2YRDA 4PJLA 4YRKA 4M75B 4M77F 1G5VA 3CC2A 2EQJA 2DL8A 3E1SA 3OYIA 2DJZA 2QQAA 2XK0A 3E19A 4X9DA 1YJ9T 4N4GA 1WZOA 4LD6A 4TQFA 1QLYA 1XJWB 4YRGA 1GCPA 1ARKA 4RG8A 1Y07A 2I4LA 2P0KA 3M5AA 3CCUQ 4O6JA 3CCLT 5EC7A 1EVKA 3HRIA 5K1PA 1XQHA 4HT9A 2DDZA 2ZZDA 5I21A 3WQZA 4EPCA 2MWOA 2K57A 5GANj 4KGZB 4II1A 1WA7A 2H3JA 1EOVA 1Z7NA 1VQPA 4DBHA 4OMLA 3G7ZA 2CS7A 3E9IA 5GAN2 4ZGJB 2L5QA 4F7UA 1VQZA 1AD5A 3NGPA 1VQ8A 2X4YA 2P0QA 3OYKA 4YTLA 1BI3A 2DTIA 2LC4A 4K87A 2PMEA 1RIQA 1S72A 3HFVA 3CC7Q 1TH7A 1K9AA 3PT9A 2CH4W 3OYJA 1JJCA 2ZT7A 3V8KA 2J6KA 2X3XD 3X26B 1FX7A 1QWFA 1ZUKA 1B34B 1EVLA 1JXOA 3CC4Q 4EIKA 2LQWA 2QGFB 1WHJA 2DXCA 2F1LA 2K2VA 2DEQA 2EGCA 4EMKA 4E7HA 4E2FB 4HKEA 3GPLA 4XU0A 1TUDA 1WHLA 2RHSA 4ZN3A 4OGCA 4CH3A 5EG2A 4RMOA 1VQKT 2F2VA 4LN2A 2AMCB 1VQOQ 1K73R 4ZTFA 1ZBJA 1E7OA 3RGLA 4G84A 1IREB 1VQPT 1UEBA 5FU7B 2BZ8A 1NPRA 1LNXA 4M7DB 1M1FA 4LVMA 3D7SB 3M53A 2ABLA 5A0GA 1VQ8T 3EG0A 4ZGDB 2ZZFA 4M4ZA 2RJDA 4E51A 2DL5A 1K73C 1D09B 3VJPA 1D1CA 1T0HA 1SESA 3NENA 1YIJA 4F04B 1W1FA 3HHTB 3R07A 1YI2T 4Q15A 3LYIA 2JTFA 4ZTJA 3WVDB 2VYTA 2K3BA 3QG1A 1YFTA 4X34A 2ZPFB 1OU8A 3MCAB 2KR3A 1FMWA 3O8VA 2XKOC 2NUTB 5GAOr 2M51A 5CKHA 2AKWA 2O9VA 5C6SA 2FZGB 3OYMA 3RERA 2NUZA 2CJ9A 2I2LA 3MQZA 2C06A 3OYAA 1IB8A 2JM9A 3NMZC 3UGTA 2RNAA 4J9CA 4KH0B 3IKLA 1AVZC 3I9QA 2EAYA 3VU3C 3UA6A 1B07A 4HWSA 1VQ4A 1JJ2S 1BIAA 4A53A 1JBMA 3M4YA 2DQ3A 1NYRA 2DTHA 1S1NA 2E6NA 4L87A 2O2OA 5LJ5g 2LZ6B 2QA4T 1GFCA 3CCJA 5FRMA 4TVAB 4UP7A 2Q7HA 2CP6A 3META 5CQXA 1EIYB 3G71Q 3HXYA 3UWNA 2D1XA 1M3CA 3LH0A 3JB9F 2ZZGA 3U23A 3QO7A 2DA9A 2I4OA 5GAMg 1RLPC 4YP0A 2EW3A 1V1CA 2DQ0A 3PE0A 4F17A 2DU5A 5KE3A 3G4SQ 3CQTA 5GMKl 2E70A 4AFQC 1W66A 3JV3A 4OVAA 2LRQA 4YCUA 2DERA 4DPGA 2KMTA 4PHCA 5KYNA 3UT1A 2C0OA 2YT6A 4M77C 4VUBA 2JT4A 4YRFA 3A8LB 1X2KA 2ZPHB 1KD1R 1EZZB 4IIOA 2XDBA 2AHJB 4JDSA 1NYFA 1I07A 1IHVA 1UG1A 4LVKA 3GOXA 3RBBB 2SRCA 3EHQA 3RIRA 1JJ2P 5HY6A 4E47A 4KR3A 2QDYB 5KYXA 2DX1A 3CXCA 4H2UA 2E3CA 2RHYA 4MMKA 4RTYA 1Q7YU 1KD1C 2GQVA 4PJOB 3VYGA 4XAXB 2GTJA 1ZSZB 1TOVA 4ZNXA 3A8MB 4BI8B 2QASA 3OYCA 2AT1B 2KGTA 3REAB 12ASA 3L2WA 2MOXA 2CP0A 4LDXA 3L2RA 3A7AA 3CCVA 1M1GA 4JS4A 3J81E 4KUDK 1OX8A 4PJNA 1G3YA 1UHCA 3CCMT 3I56A 2RN8A 2JS0A 2YSQA 3CCQT 2ZPIB 8ATCB 1NNHA 1XNIA 1JU5C 4KUIA 3LX7A 5LJ5d 2XD0A 3JCMg 1U8RA 1NBEB 5GANg 4E7KA 3X20B 3OYYA 1SERA 4FL6A 1GL5A 4MZPA 1Q86U 4PJJA 2RK2A 4M7AD 2GFAA 4BY6C 1KQ2A 1KHCA 1QKXA 1K9MC 2RB6A 4M78D 3QJ6A 5GAOl 2R57A 5ELNA 4J6XA 5AT1B 2DNUA 1YITA 4OF1A 5GAN6 2F69A 1E24A 2RQTA 2FZKB 4JRPA 3JCMe 2KRMA 1IZ6A 4RCBA 4UP8A 3A98A 4JRIA 1SRMA 1X75C 3H6ZA 5LJ3d 2O9SA 3CCEA 1YFNA 3JB9I 1BBZA 2FVUA 2L3SA 5GAMh 2CREA 2X4JA 2X4XA 3CD6A 2EJ9A 3OYHA 1UGQB 1U1SA 3CMEQ 1SKUB 2YXYA 3H8ZA 2EYQA 3L4GA 2CGHA 3LSQA 1H641 2GGRA 1YJNA 5L8RE 1CSKA 4IUPA 4NL2A 3SWNC 2ZNJA 1KQ1A 3QO5A 2YUOA 2G6FX 3PGGA 1VQNQ 3RNJA 3MEAA 1QE0A 1RI9A 2Q5HA 3ZL7C 1SG5A 2Q7EA 1OOTA 4B6MA 3CCRA 5J26A 3PTAA 3VUZA 1C0MA 2MYSA 2L3PA 3L42A 4M77A 1BK2A 5FROA 1YHQT 2ODRD 4ATOA 2KAFA 2H8HA 3FLGA 2E12A 2L2PA 3P8DA 1G3TA 3F70A 1VQLT 1E1TA 3GNGA 1N27A 4Y91A 4CS4A 1ZA2B 2CP2A 2CP3A 1GXIE 1YP5A 1I5OB 1GGMA 3BY7A 3V7SA 1WQWA 4XTXA 4XU3A 3G1ZA 2JMAA 3I5SA 1JRIA 3KFUA 2P0LA 4HCBA 1D3BA 3FEOA 3HP9A 4HVCA 2BE7D 4O2DA 4TVRA 1EFWA 1PHTA 2DBKA 4L6V5 3QBYA 1M1KR 1SETA 2A08A 1WNLA 3JCMh 3EG1A 2RJCA 5GANh 4A4KA 4H2WA 2X35A 1BI1A 2QTVA 3TEEA 3P8YA 4DA4A 1X55A 2F2XA 2ZGWA 4RG2A 1OZ3A 3ZFJA 3QKJA 4N0AC 3REXA 4YRQA 2CUDA 2MF2A 4YRJA 2YLCA 2KQWA 4RTZA 5F5WA 2EGAA 1MV0B 5CR2A 4H2VA 4CI0C 3EGUA 4RQFA 1R0BG 5C52B 1BBWA 3CCST 1YJ9Q 3KXTA 1GFDA 1M90U 3CMAA 1G83A 1GRIA 3OBWA 2IG0A 1QCNA 2EVRA 1Y96A 4WJ3M 4ORZA 1FYNA 3H0HA 4TVYA 1WU7A 2GTOA 3CCLQ 2P84A 4RQEA 1CKAA 5KCOA 3I55T 5HCKA 1M2VA 1JJCB 2W10A 3RL6A 1H4VB 1FXXA 4JZ4A 2RI2A 2ZCEA 1OYXA 3BE3A 3RESA 2OI3A 3M0SA 1ZHIA 3A74A 1H3HA 2FPEA 3TU4K 4CC4B 4EMKB 1VIEA 4C92E 2CP7A 2RHSB 2DE0X 2DKGA 2JMCA 4ELYC 1G3SA 3VRZA 2ZT5A 4Y28E 1YJWA 1PKSA 1ADYA 4YROA 2DVJA 4C0ZA 2BE9B 3SWNA 1VQ6A 1PRMC 2AZSA 1VQ5T 2D0NA 2OX7A 4IUVA 4KH1B 2LP5A 1X69A 3V8JA 4LD9K 3QIIA 2OTJA 2X4WA 1WJSA 5DLOA 4J9FA 1G5IA 1C0AA 3UFGA 2QQ9A 2R58A 3M4GA 2Y4YA 1AOJA 4WCIA 3JB9H 3PFSA 4BI3A 2JOYA 1VQKQ 4YRPA 4M77E 2OTLA 4H2SA 2RI5A 5GAOp 1AZGB 3MEVA 4EDUA 1JQQA 4E7ZA 1VQ7T 1K76A 4P74C 4AFSC 2CSQA 3EAEA 1VQ8Q 3FJPA 3CBPA 2DD4A 4C92F 1QP3A 2AKWB 2FG0A 1H3ZA 2ZT6A 3A5ZA 1W2BA 3OYNA 1PSFA 2YUNA 3M59A 4OB1B 2QAZA 5CCAA 4ZTZB 2QQSA 4ANJA 1M2OA 3OS1A 1PSEA 1E1OA 1XTDA 1YI2Q 2HL5C 3L1AA 4C92G 5J3BA 3BJUA 1ATIA 1I81A 1PNJA 1EIFA 4YCVA 1YNZA 4B9XA 1GCQC 3OYDA 1NLOC 3HRKA 2FRWA 1UGVA 4E6RA 2E5KA 4RCCA 1Q82C 2DBMA 1RAFB 3JRZA 4N0AA 2ZCFB 2MMPA 1KC8U 3RUXA 1VQ9T 1KQSS 3HFOA 4L59A 1NJ8A 2EJGA 2KK4A 4P3NA 3OBYA 4DEXA 2OAUA 4XEOA 1H4SA 3QYHB 4EO4A 2AKLA 4H2XA 4J7FA 4HCZA 3M0UA 1YWPA 2IPOB 1UGSB 2K3YA 2SEMA 1P92A 5GJVB 4FSXA 1AWOA 4HVWA 4YYEA 4M77G 3LWHA 2ODRC 4N4IA 2HQEA 3S3NA 3MKDA 4X1VA 1OV3A 2A7YA 1VQMA 3NPFA 3JCMV 3M0PA 4A4FA 1M5Q1 4OGEA 4WI1A 3UDCA 1WFWA 3RDVA 2QA4Q 1NJ5A 1FMVA 2HSEB 2EYZA 2W0ZA 1U3OA 4RDXA 2JTMA 1QVGS 2L0AA 1FYFA 2XGTA 1F1BB 1SF9A 4K11A 4LUEA 2PVDB 5IXBA 3TUPA 3GF5A 3OMCA 2KYMA 3CC2T 5DLQE 4BACA 1X56A 4FT2A 5KYXB 1VA7A 2RK1A 4JJDA 1Y7XA 2PUKB 4RTTA 4R56A 1PWTA 1A0NB 2RHXA 4PJOD 1Y57A 2EQIA 2RHUA 1KQSP 3UGQA 3PZCA
chains in the Genus database with same CATH topology
1J5WA 2D0QB 2PUOB 4YRIA 1YCYA 5IN1A 4KBMB 2MAMA 2LX9A 4N4HA 3E9HA 3CPWS 2JUFA 3TEGA 2RHZA 2PU9B 2I4NA 2PVOB 4P74A 1VUBA 3ZEHA 3M57A 2CZ0B 2DXTA 2MWPA 3OW2A 1S72T 5DY9A 3G6EA 2F5TX 1N9SA 5HK3A 5DM7R 4X5OA 1LJOA 1K73U 4H02A 4C8QD 1RI0A 1USYC 2ZR3A 2RI3A 3NTHA 3ME9A 2Q5IA 3CEYA 4CS3A 3M54A 2EJFA 3OYEA 3CCUA 1NJ2A 3EFSA 4ME7A 1OI1A 5KE2A 3VQVA 4HWTA 4MDWA 3INZA 3NTIA 2RH2A 4J7IA 4Z02A 2A8EA 4P3PA 4OP0A 3L4GB 1I5LA 1WJQA 2E10A 4A4EA 4PNOA 3DSQA 2LT4A 1ADJA 3G6ET 1YIJT 1QVPA 4YCWA 4YRMA 2QHVA 1NE8A 1M9SA 2HD0A 3CC7A 2RO0A 4FT4A 2R5MA 2FB7A 2EWNA 4C92C 2M9UA 3HKSA 4FIBA 2P0PA 11ASA 3L2QA 4M77B 1BYMA 3MF2A 3CCUT 5CIUA 2EL9A 4ZN1A 3CBMA 1VQOA 5C53B 2BKDN 2LQKA 5GAN4 2GCXA 4QVZA 3JB9G 1WGSA 5FU6B 2HAXA 2WACA 2VUBA 3LWIA 1LOJA 1I8FA 3VQWA 1VQ4T 1D3BB 3HRSA 4X9CA 1QVFS 3HXVA 4JS5A 3P8BB 1KG1A 1KMNA 3CC7T 3HFNA 1NZ9A 4XTYA 4C0DC 3CCJT 4LDWA 4BE1A 2E5AA 4K88A 2ZINA 1HTTA 2JZ2A 3Q1JA 2CIMA 4M7AE 2VGMA 2VGNA 1B70A 4XU1A 4M78E 1KD1U 1Q7YC 4Q6GA 3M4QA 5D6YA 1WLEA 3MP1A 4BY6B 1Q81C 2FYKA 1R8OB 1FWZA 2ALYA 2LCLA 1USYA 1X54A 1Y96B 4A4HA 2G3RA 4KULA 1HK9A 3LLRA 5A0LA 3S6WA 2XDPA 5I2MA 4CH5A 3BW1A 2DZ9A 2QI2A 4LDYA 2RHQA 3SB2A 5GAOq 5GMKj 2Y90A 3G71A 4LVLA 1E22A 1N6AA 3JCMJ 4PJOC 4J15A 5GAMd 4M7AF 2KDSA 4M78F 5FLXE 3JCMX 4XTVA 3SWNB 3G4SA 3CCVT 2QEXA 2DIGA 4JLGA 3MP8A 4C92A 4M7AG 4OB2B 3I56T 3PMTA 3X24B 2DIQA 2J3MA 2HNIA 3QTCA 2CZ6B 2EQMA 3NEMA 4RKUE 2VXFA 3HFZA 4EMHA 2ZPBB 2DU7A 4XEMA 4KT0E 2K3XA 5GAN8 4C8QC 4JRKA 3HXZA 1YITT 2O4XA 2CKKA 2Y4XA 4CH4A 2E41A 3A5ZB 2HQXA 2LTOA 3FC3A 3RACA 3JAME 3ICAA 1SRYA 3G4ST 3HSBA 2L3RA 3CCET 2QEXT 3VV0A 4PG3A 4MDXA 3MHXA 1YGBA 2DK3A 1H4TA 3CD6T 4HT4A 4YRSA 3WVEB 3V7CA 4HWRA 3ASKA 4H2YA 3VKIA 1YJNT 3JCMd 5GANd 1G3WA 4NS5A 2Q7GA 2K5LA 4E7JA 4QQDA 4M75D 1B7YA 3HY1A 4UP9A 1YFSA 1B8AA 4H2XB 2QQRA 3CCRT 3JB9J 5GAN7 1V29B 2LVMA 1H4QA 4RMFA 4QW2A 1YB3A 5C51B 2M1HA 4JUVA 4BD3A 2QQBA 2O01E 1M1KU 1WPYA 3FDRA 3UH0A 2EFIA 1NJIC 5GAOn 1N9RA 3C4SA 3KUFA 3X28B 5CKDA 1PYSA 1AHJB 2IY5A 1M8VA 4CRIA 1VQNA 1M4ZA 4MZMA 1BKBA 2RM4A 3OS0A 3WXMB 4LDVA 1JJ2A 4DOWA 2K4YA 4BDZA 4Q5WA 4IUTA 5LJ5f 1LYLA 2CJAA 2LT1A 1SSFA 2FL7A 4V2SA 3M58A 3S3OA 4P72C 4BE0A 3NETA 2GF7A 4P73C 1K8AC 2RJEA 3IKMB 5GAMf 3J7AF 1YFRA 3CMAT 4C8QA 4M7DD 4WJ4A 4J5YA 5LJ3f 3VQYA 4QVDA 3MP6A 3C94A 1G51A 4LNSA 2VV5A 4XTZA 3OMGA 3QJYA 3LSSA 3KBGA 3DB3A 2A3LA 2P5IA 5LJ5j 4M7AC 3LGFA 4M78C 4XK8E 3M4PA 3CXCS 2BIVA 1YJWT 2J3LA 1WJRA 3QHSA 4C5IA 1VQ6T 3HPWA 4XU2A 2NS6A 4DOVA 3PIPA 2CYZB 4ELZC 3VBBA 2OTJT 1YJ9A 2V8IA 4LVIA 5LJ3j 4C5GA 4TWAA 5E3IA 4OB3B 3HRTA 3BDLA 1N8RC 4QVCA 1BI0A 3RKYA 4LVJA 4P75C 3N5BB 3CCLA 5GMKe 2K5IA 2RD1A 2ZIMA 2DXBA 2OTLT 1BBUA 3MO8A 2KY9A 2WSCE 4BB7A 4DQ2A 1I4K1 4XTWA 1NPPA 3VQXA 4BE2A 2E5QA 2JN0A 5ELOA 5GANf 3DKMA 4M77D 1X01A 3FRNA 3J80E 1NJ6A 3TEHA 3BDUA 3C12A 1UGRB 4C5HA 4IKFA 3V8LA 4PJOE 4BWAA 4C0GA 1VIFA 5D6XA 3MEUA 5HKCA 3R6OA 4J83A 2EQUA 2IVWA 2K5FA 1NYQA 2ARUA 4KR2A 5CKEA 3VUBA 4HCCA 3JCMb 1HXDA 1QP2A 3CMQA 3HL8A 4PLLA 2RA2A 1W4SA 3A32A 2RHIA 4L5GA 5IAYA 3UPUA 1VQKA 3HXWA 2CJBA 2B8AA 4P72A 4M75C 3QZ9B 4FM4B 4P73A 2DXUA 2EKOA 2DZCA 4BW9A 3DB4A 3RMSA 4BI4A 3M55A 4ZTUB 2L8DA 1B70B 1VQMT 4YRTA 4ZIBA 3A7UA 4C8QE 4PJOF 1YI2A 2ALYB 2F5KA 4R55A 4YRRA 5CKBA 4YREA 2ZPEB 4M7AA 5GMKh 4M78A 2PVGB 4OB0B 4PJOG 3M56A 1KMMA 5GMKm 4FU6A 3PCOA 2NLUA 4BUGA 2RHQB 3SFMA 3EFRA 4P71C 3HRUA 5A2QE 1X2GA 2D6FA 1G5HA 1U1TA 1XOVA 2HBPA 4P75A 3OB9A 4PLIA 4C8QF 3E9GA 1RL2A 3MEWA 3HXUA 4C92B 3QPHA 2QA4A 5GAN3 3PIOA 5HK0A 5AYFA 3W3SA 5FU7C 1B76A 2M16A 1QW1A 4C8QG 2DVEA 4M7DC 1MGQA 3JSCA 2C8MA 2ZT8A 2VXEA 2QTXA 5J39A 4QQGA 3HFZB 4WF2A 2C7IA 2EIFA 2QXFA 3A7RA 4MMLA 1MHNA 2O4XB 3ER0A 3CC4A 1ASZA 3RKWA 2R5AA 1X2HA 5A0DA 4C0DB 3QNEA 3M9QA 2JVVA 3JB9D 5GAOm 4M75A 4J6WA 3P8TA 5CK9A 4B9WA 4E7IA 3P8VA 3HTZA 1WYDA 3OS5A 5KNNA 5LJ5e 2LDMA 4F7UE 1B7YB 3DLLA 2XU8A 3A8GB 5HGQA 4NOYA 5LJ3g 4JRQA 4G85A 2LQ8A 2ZPGB 3JCMP 3CC4T 1ZQ1A 2DPPB 3T9NA 3P8HA 3CCMA 3QO8A 2ZXFA 5GAMe 3OS2A 4NL3A 3CCQA 4LDUA 1DJ7B 4K86A 1VQOT 3A5YA 3NTKA 5LJ3e 1W2BS 4P71A 4CH6A 4OLFA 5FU6C 1B34A 1OZ2A 1Q81U 3IALA 4HWOA 2ZTGA 4CS2A 1PYSB 3CBOA 2IY5B 2E6ZA 2ZNIA 3ERRA 1ZBXA 5C0MA 4F7UF 2ZR2A 2PQWA 3QDRB 2AMCA 4TVWA 1KOGA 4M7DA 2LCCA 4F7UG 2QHSA 4GLKA 1Q86C 4C5EA 1KQSA 1K9MU 5KCHA 3TREA 2XI9A 3A8HB 3OYGA 5CQYA 2D9TA 3QSUA 1UB4A 4PL6A 2RJFA 2ZIOA 2E65A 4IURA 4C8QB 2WSEE 5LJ5h 3NFCA 3OYFA 4M78G 4PKCC 2XICA 2MI6A 2GFUA 1YHQA 4QQ6A 5GANe 3MEYA 3TCJA 1BIBA 1VQLA 4XQ3A 2ARTA 1ASYA 3QUIA 1QVGA 3C95A 3G71T 3FB9A 3JCMQ 3QZ5B 3SDZA 5LJ3h 3DLMA 4M75E 4BDYA 5CKFA 1O9SA 3OYLA 3A31A 3JCMW 3SD4A 2VC8A 3OSSC 3URGA 5CO7A 4NCXA 2DO3A 4TVAA 2KSSA 4HT8A 5KH6A 5IT9E 1EIYA 1Y71A 2XTIA 1HC7A 2XDDA 4YDQA 3ZBDA 3CPFA 3GLXA 3V7RA 4YRLA 4IUQA 2DD5A 3CPWA 5LL6S 2DTOA 1WQ7A 3GIBA 2WSFE 3OW2S 5CAIA 5K1XA 3CCSA 3RKXA 2DAQA 4XTUA 3TEHB 4A54A 2XIDA 4M75F 3HY0A 2V8KA 5I2SA 4O5VA 1UGPB 3MF1A 3LW5E 3I55A 4JLIA 3OD1A 1L0WA 4M75G 2FHDA 3OA6A 3OSVA 4TTVA 1YBYA 2V8JA 2JNGA 3HXXA 3CMEA 4HA8A 3QO3A 4PJOA 3OYBA 3AHUA 3I7FA 1M1KC 2PMFA 1NJIU 1M90C 4M7DE 4H2TA 3PNWC 3VYHB 3E9FA 3OY9A 1VQ5A 1O75A 3RF1A 2E64A 4F7UB 4C0FA 1NJ1A 3NELA 1QF6A 4YRCA 2BUDA 4AH6A 2QHTA 3S3MA 2YRVA 1EQRA 2ARSA 4EMGA 4J8OA 1KHIA 3PMIA 4M7AB 2YLBA 4M78B 2XHCA 4ZGEB 3CMET 3RMQA 1VQ7A 2CZ7B 3QYGB 4UPAA 3PCOB 2CZ1B 4GY5A 1K8AU 3BFMA 1N9WA 3REUA 1JB0E 4D6WA 4M7DF 3LC0A 1VQNT 3GNFB 4UC4A 3QXEB 3JCMc 2EQKA 2LNVA 1QVFA 5D6WA 2ZZEA 1X6OA 3FIFA 4IUUA 4M7DG 4YRNA 4EMKC 4EX5A 2KVQG 4E7LA 1Z7MA 1VQ9A 5GAMj 4C92D 3LGLA 4MZTA 5CVIA 4A4GA 5GMKi 3L2ZA 4P3OA 2I4MA 3GP8A 4J6YA 4HWPA 2XG8D 5FRNA 2E1HA 4P5NA 1BI2A 3OQ5A 1Q82U 1N8RU 4JJNK 5GAN5 4KQEA 3JCMf 1KC8C 1IL2A 2YHTA 3IG2A 4TQDA 2M0OA 2L89A 2G4CA 3X25B 4YPFA 3L2VA 2P4TA 3A8OB 3L2UA 4OMFB 2QHUA 5M9OA 4YRKA 4M75B 4M77F 1G5VA 3CC2A 2EQJA 3E1SA 3OYIA 2DJZA 2QQAA 2XK0A 3E19A 4X9DA 1YJ9T 4N4GA 4LD6A 4TQFA 4YRGA 4RG8A 1Y07A 2I4LA 2P0KA 3M5AA 4O6JA 3CCLT 1EVKA 3HRIA 5K1PA 1XQHA 4HT9A 2DDZA 2ZZDA 5I21A 3WQZA 4EPCA 2MWOA 2K57A 5GANj 4II1A 2H3JA 1EOVA 1Z7NA 1VQPA 3G7ZA 2CS7A 3E9IA 5GAN2 4ZGJB 2L5QA 4F7UA 1VQZA 1VQ8A 2X4YA 2P0QA 3OYKA 4YTLA 1BI3A 2DTIA 2LC4A 4K87A 2PMEA 1RIQA 1S72A 3HFVA 1TH7A 3PT9A 3OYJA 1JJCA 2ZT7A 3V8KA 3X26B 1FX7A 1B34B 1EVLA 2DXCA 2K2VA 2DEQA 4EMKA 4E7HA 4HKEA 3GPLA 4XU0A 2RHSA 4ZN3A 4OGCA 4CH3A 5EG2A 4RMOA 1VQKT 2AMCB 4ZTFA 3RGLA 4G84A 1IREB 1VQPT 1UEBA 5FU7B 1NPRA 1LNXA 4M7DB 1M1FA 4LVMA 3M53A 5A0GA 1VQ8T 4ZGDB 2ZZFA 2RJDA 4E51A 1K73C 3VJPA 1SESA 3NENA 1YIJA 3HHTB 3R07A 1YI2T 4Q15A 3LYIA 2JTFA 4ZTJA 3WVDB 2VYTA 3QG1A 1YFTA 4X34A 2ZPFB 3MCAB 3O8VA 2XKOC 5GAOr 2AKWA 5CKHA 5C6SA 3OYMA 3RERA 2CJ9A 2I2LA 3MQZA 2C06A 3OYAA 3UGTA 3IKLA 2EAYA 3VU3C 4HWSA 1VQ4A 1JJ2S 1BIAA 4A53A 1JBMA 3M4YA 2DQ3A 1NYRA 2DTHA 2E6NA 4L87A 5LJ5g 2QA4T 3CCJA 5FRMA 4TVAB 4UP7A 2Q7HA 3META 5CQXA 1EIYB 3HXYA 3UWNA 3LH0A 3JB9F 2ZZGA 3QO7A 2I4OA 5GAMg 4YP0A 2DQ0A 2DU5A 5KE3A 5GMKl 2E70A 1W66A 4YCUA 4OVAA 2LRQA 4DPGA 2KMTA 4PHCA 3UT1A 4M77C 4VUBA 4YRFA 3A8LB 2ZPHB 2XDBA 2AHJB 4JDSA 4LVKA 3GOXA 3RIRA 5HY6A 4E47A 4KR3A 2QDYB 3CXCA 4H2UA 2E3CA 2RHYA 4MMKA 1KD1C 1Q7YU 2GQVA 4PJOB 3VYGA 4XAXB 3A8MB 4BI8B 3OYCA 12ASA 3L2WA 4LDXA 3L2RA 3A7AA 3CCVA 1M1GA 4JS4A 3J81E 4KUDK 1G3YA 3CCMT 3I56A 3CCQT 2ZPIB 1NNHA 1XNIA 4KUIA 3LX7A 5LJ5d 2XD0A 3JCMg 1U8RA 5GANg 4E7KA 3X20B 3OYYA 1SERA 4FL6A 4MZPA 1Q86U 2RK2A 4M7AD 2GFAA 4BY6C 1KQ2A 1KHCA 1K9MC 2RB6A 4M78D 3QJ6A 5GAOl 2R57A 5ELNA 4J6XA 1YITA 4OF1A 5GAN6 2F69A 1E24A 4JRPA 3JCMe 1IZ6A 4RCBA 4UP8A 4JRIA 1X75C 3H6ZA 5LJ3d 3CCEA 3JB9I 2FVUA 5GAMh 2X4JA 2X4XA 3CD6A 2EJ9A 3OYHA 1UGQB 1U1SA 3H8ZA 2EYQA 3L4GA 2CGHA 3LSQA 1H641 1YJNA 5L8RE 4IUPA 4NL2A 3SWNC 2ZNJA 1KQ1A 3QO5A 3PGGA 3MEAA 1QE0A 2Q5HA 2Q7EA 3CCRA 5J26A 3PTAA 3VUZA 3L42A 4M77A 5FROA 1YHQT 2ODRD 4ATOA 2KAFA 3FLGA 2E12A 3P8DA 1G3TA 3F70A 1VQLT 1E1TA 3GNGA 1N27A 4Y91A 4CS4A 1GXIE 1GGMA 3BY7A 3V7SA 1WQWA 4XTXA 4XU3A 3G1ZA 1JRIA 3KFUA 2P0LA 4HCBA 1D3BA 3FEOA 3HP9A 4HVCA 4O2DA 4TVRA 1EFWA 4L6V5 3QBYA 1SETA 1WNLA 3JCMh 2RJCA 5GANh 4A4KA 4H2WA 2X35A 1BI1A 3TEEA 3P8YA 4DA4A 1X55A 2ZGWA 4RG2A 1OZ3A 3ZFJA 3QKJA 4N0AC 3REXA 4YRQA 2MF2A 4YRJA 2YLCA 2KQWA 5F5WA 5CR2A 4H2VA 4CI0C 4RQFA 5C52B 1BBWA 3CCST 3KXTA 1M90U 3CMAA 3OBWA 2IG0A 1Y96A 4WJ3M 4TVYA 1WU7A 4RQEA 5KCOA 3I55T 1JJCB 3RL6A 1H4VB 1FXXA 2RI2A 2ZCEA 1OYXA 3RESA 1ZHIA 3A74A 3TU4K 4EMKB 1VIEA 4C92E 2RHSB 2DKGA 4ELYC 1G3SA 2ZT5A 4Y28E 1YJWA 1ADYA 4YROA 4C0ZA 3SWNA 1VQ6A 1VQ5T 4IUVA 4LD9K 3V8JA 3QIIA 2OTJA 2X4WA 1WJSA 5DLOA 1G5IA 1C0AA 3UFGA 2QQ9A 2R58A 3M4GA 2Y4YA 3JB9H 3PFSA 4BI3A 2JOYA 4YRPA 4M77E 2OTLA 4H2SA 2RI5A 5GAOp 3MEVA 4EDUA 1VQ7T 4P74C 3EAEA 3FJPA 3CBPA 2DD4A 4C92F 1QP3A 2AKWB 1H3ZA 2ZT6A 3A5ZA 1W2BA 3OYNA 1PSFA 3M59A 4OB1B 5CCAA 4ZTZB 2QQSA 3OS1A 1E1OA 1PSEA 1XTDA 3L1AA 4C92G 5J3BA 3BJUA 1ATIA 1I81A 1EIFA 4YCVA 4B9XA 3OYDA 3HRKA 1Q82C 4RCCA 3JRZA 4N0AA 2ZCFB 2MMPA 1KC8U 3RUXA 1VQ9T 1KQSS 3HFOA 4L59A 1NJ8A 2EJGA 2KK4A 4P3NA 3OBYA 2OAUA 4XEOA 1H4SA 3QYHB 4EO4A 4H2XA 4J7FA 4HCZA 2K3YA 1UGSB 1P92A 4FSXA 4YYEA 4M77G 3LWHA 2ODRC 4N4IA 2HQEA 3S3NA 1VQMA 2A7YA 3JCMV 4A4FA 1M5Q1 4OGEA 4WI1A 3UDCA 1NJ5A 4RDXA 2JTMA 1QVGS 1FYFA 2XGTA 2PVDB 3TUPA 3GF5A 3OMCA 3CC2T 5DLQE 4BACA 1X56A 4FT2A 2RK1A 1Y7XA 2PUKB 4R56A 2RHXA 4PJOD 2RHUA 3UGQA 3PZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTZ A;  1J5W A;  4NCX A;  4TVA A;  3LSS A;  4M77 C;  4YRF A;  4HT8 A;  2P5I A;  5LJ5 j;  4M7A C;  1EIY A;  4YRI A;  2XTI A;  1YCY A;  1HC7 A;  4M78 C;  3M4P A;  4YDQ A;  3E9H A;  3V7R A;  4YRL A;  3TEG A;  3RIR A;  2I4N A;  4KR3 A;  2J3L A;  4H2U A;  4P74 A;  2E3C A;  2DTO A;  4MMK A;  1WQ7 A;  3GIB A;  3QHS A;  4PJO B;  5CAI A;  2DXT A;  4XU2 A;  5K1X A;  5DY9 A;  3RKX A;  1N9S A;  3VBB A;  12AS A;  4XTU A;  3TEH B;  4A54 A;  4M75 F;  5LJ3 j;  4TWA A;  3HY0 A;  4X5O A;  1LJO A;  5E3I A;  4H02 A;  4C8Q D;  3A7A A;  1USY C;  4QVC A;  3RKY A;  3MF1 A;  2ZR3 A;  4JLI A;  4P75 C;  2Q5I A;  5GMK e;  4CS3 A;  2EJF A;  2RD1 A;  3OD1 A;  1L0W A;  4M75 G;  2ZIM A;  1BBU A;  1NJ2 A;  4TTV A;  4DQ2 A;  1I4K 1;  1NNH A;  4XTW A;  3EFS A;  3HXX A;  5LJ5 d;  4HA8 A;  3QO3 A;  3VQX A;  3JCM g;  3VQV A;  4HWT A;  4PJO A;  2JN0 A;  3INZ A;  5GAN g;  5ELO A;  5GAN f;  3AHU A;  4M77 D;  1X01 A;  1SER A;  3I7F A;  4P3P A;  2PMF A;  4OP0 A;  4M7A D;  1KQ2 A;  4M7D E;  3L4G B;  4H2T A;  1NJ6 A;  1I5L A;  3TEH A;  3BDU A;  2RB6 A;  4M78 D;  2E10 A;  5GAO l;  5ELN A;  4J6X A;  3V8L A;  4PNO A;  4PJO E;  3RF1 A;  4BWA A;  3DSQ A;  2E64 A;  5GAN 6;  1ADJ A;  1E24 A;  4F7U B;  4YCW A;  1NJ1 A;  3NEL A;  1QF6 A;  4YRM A;  2QHV A;  4YRC A;  3JCM e;  4AH6 A;  4RCB A;  4UP8 A;  4JRI A;  1NYQ A;  2ARU A;  2QHT A;  2FB7 A;  2EWN A;  5LJ3 d;  4C92 C;  4KR2 A;  11AS A;  3JCM b;  1HXD A;  3CMQ A;  3JB9 I;  4M77 B;  5GAM h;  1EQR A;  2RA2 A;  3MF2 A;  2ARS A;  4EMG A;  2EJ9 A;  3A32 A;  4M7A B;  2YLB A;  1U1S A;  2EL9 A;  3HXW A;  2CJB A;  4P72 A;  4M78 B;  3L4G A;  2CGH A;  3LSQ A;  1H64 1;  4M75 C;  4P73 A;  5C53 B;  4UPA A;  2DXU A;  2DZC A;  4BW9 A;  3PCO B;  4ZTU B;  5GAN 4;  3BFM A;  4NL2 A;  1B70 B;  1N9W A;  3SWN C;  3JB9 G;  2ZNJ A;  1KQ1 A;  3QO5 A;  3REU A;  3PGG A;  1QE0 A;  2Q5H A;  1LOJ A;  1I8F A;  4M7D F;  3LC0 A;  4YRT A;  4ZIB A;  3A7U A;  3VQW A;  2Q7E A;  4C8Q E;  1D3B B;  4X9C A;  3HXV A;  4PJO F;  3JCM c;  4M77 A;  1KMN A;  2ODR D;  3HFN A;  2ALY B;  2ZZE A;  4YRR A;  4XTY A;  4YRE A;  3FIF A;  4M7A A;  4M7D G;  4YRN A;  4EMK C;  2E5A A;  5GMK h;  1E1T A;  4EX5 A;  4M78 A;  4K88 A;  4PJO G;  2ZIN A;  4Y91 A;  1HTT A;  4CS4 A;  1KMM A;  5GMK m;  3PCO A;  1Z7M A;  5GAM j;  4C92 D;  2CIM A;  1GGM A;  3BY7 A;  3V7S A;  1WQW A;  4M7A E;  4XTX A;  1B70 A;  4XU3 A;  3G1Z A;  2RHQ B;  1JRI A;  4XU1 A;  4M78 E;  3EFR A;  2P0L A;  4P71 C;  3KFU A;  4Q6G A;  5GMK i;  3L2Z A;  4P3O A;  3M4Q A;  1D3B A;  2I4M A;  1WLE A;  1X2G A;  4J6Y A;  4HWP A;  2FYK A;  4HVC A;  4O2D A;  1EFW A;  2ALY A;  1G5H A;  2E1H A;  1U1T A;  1USY A;  1SET A;  1WNL A;  1X54 A;  3JCM h;  1Y96 B;  5GAN h;  4P75 A;  4C8Q F;  4H2W A;  1HK9 A;  5GAN 5;  4C92 B;  3HXU A;  4CH5 A;  5GAN 3;  4KQE A;  3JCM f;  3P8Y A;  1X55 A;  3BW1 A;  1IL2 A;  2YHT A;  2ZGW A;  2DZ9 A;  4N0A C;  3IG2 A;  3REX A;  4YRQ A;  3W3S A;  4YRJ A;  1B76 A;  2RHQ A;  4TQD A;  3SB2 A;  2YLC A;  4YPF A;  4C8Q G;  5GAO q;  2G4C A;  5F5W A;  2DVE A;  4M7D C;  5GMK j;  1MGQ A;  4H2V A;  2C8M A;  4RQF A;  2Y90 A;  2ZT8 A;  2QHU A;  1E22 A;  4YRK A;  3JCM J;  5C52 B;  2VXE A;  4M75 B;  4M77 F;  4PJO C;  2QTX A;  1BBW A;  4J15 A;  5GAM d;  3HFZ B;  2DJZ A;  4M7A F;  4WF2 A;  4X9D A;  2C7I A;  4TQF A;  4M78 F;  3JCM X;  1Y96 A;  4XTV A;  3SWN B;  4YRG A;  4WJ3 M;  3A7R A;  4MML A;  4TVY A;  1WU7 A;  2I4L A;  4RQE A;  4C92 A;  1ASZ A;  1JJC B;  4M7A G;  3RL6 A;  1H4V B;  1EVK A;  3HRI A;  3RKW A;  5K1P A;  2ZCE A;  4HT9 A;  2DDZ A;  3RES A;  5I21 A;  1X2H A;  2J3M A;  3WQZ A;  3A74 A;  2K57 A;  5GAN j;  3QNE A;  2HNI A;  4EMK B;  3QTC A;  1EOV A;  4C92 E;  1Z7N A;  3JB9 D;  5GAO m;  3NEM A;  4M75 A;  2RHS B;  4J6W A;  3E9I A;  2VXF A;  2DKG A;  3HFZ A;  5GAN 2;  4EMH A;  2ZT5 A;  3P8T A;  4F7U A;  1VQZ A;  1ADY A;  2DU7 A;  3P8V A;  4XEM A;  4YRO A;  3HTZ A;  2DTI A;  5GAN 8;  3SWN A;  4K87 A;  2PME A;  4C8Q C;  1RIQ A;  4JRK A;  3HXZ A;  1WYD A;  3HFV A;  5KNN A;  1TH7 A;  4CH4 A;  3V8J A;  2E41 A;  5LJ5 e;  1JJC A;  2ZT7 A;  3V8K A;  4F7U E;  3RAC A;  1B7Y B;  1G5I A;  5HGQ A;  3ICA A;  4NOY A;  1SRY A;  1C0A A;  3HSB A;  1B34 B;  5LJ3 g;  1EVL A;  3UFG A;  4G85 A;  3M4G A;  3JCM P;  2DEQ A;  4PG3 A;  3JB9 H;  4EMK A;  1YGB A;  4XU0 A;  1H4T A;  4YRP A;  4YRS A;  4M77 E;  3V7C A;  2RHS A;  3QO8 A;  2ZXF A;  4H2S A;  4HWR A;  5GAM e;  5GAO p;  4CH3 A;  4NL3 A;  2AMC B;  4K86 A;  4H2Y A;  3JCM d;  3RGL A;  4G84 A;  3A5Y A;  5GAN d;  5LJ3 e;  4P74 C;  2Q7G A;  1LNX A;  3FJP A;  4M7D B;  4C92 F;  4P71 A;  4CH6 A;  2AKW B;  2ZT6 A;  3A5Z A;  2ZZF A;  4OLF A;  4M75 D;  1B7Y A;  3HY1 A;  4E51 A;  4UP9 A;  1YFS A;  1B8A A;  4H2X B;  1B34 A;  4ZTZ B;  3IAL A;  4HWO A;  1E1O A;  1SES A;  2ZTG A;  3NEN A;  3JB9 J;  4CS2 A;  1PYS B;  5GAN 7;  3L1A A;  4C92 G;  3BJU A;  3R07 A;  2IY5 B;  1ATI A;  1H4Q A;  1I81 A;  4Q15 A;  2ZNI A;  4YCV A;  3ERR A;  3HRK A;  4RMF A;  1YFT A;  2ZR2 A;  4F7U F;  1YB3 A;  4RCC A;  2AMC A;  4TVW A;  5C51 B;  4N0A A;  3RUX A;  5GAO r;  1KOG A;  4JUV A;  4M7D A;  3HFO A;  1NJ8 A;  4F7U G;  2EJG A;  2AKW A;  2QHS A;  3UH0 A;  1WPY A;  3RER A;  5GAO n;  4P3N A;  1N9R A;  2CJ9 A;  2I2L A;  4XEO A;  1H4S A;  4EO4 A;  4H2X A;  3UGT A;  1PYS A;  3IKL A;  4YYE A;  3QSU A;  4M77 G;  2IY5 A;  1M8V A;  2ODR C;  2ZIO A;  2E65 A;  4C8Q B;  2EAY A;  3VU3 C;  4HWS A;  3JCM V;  5LJ5 h;  1M5Q 1;  1BIA A;  4A53 A;  1JBM A;  2DQ3 A;  2RM4 A;  1NYR A;  4WI1 A;  4M78 G;  2DTH A;  1NJ5 A;  4L87 A;  5LJ5 g;  5GAN e;  5LJ5 f;  1LYL A;  3MEY A;  1BIB A;  2CJA A;  4TVA B;  4UP7 A;  4RDX A;  2Q7H A;  4XQ3 A;  2ART A;  1ASY A;  1FYF A;  3QUI A;  2XGT A;  1EIY B;  3HXY A;  4V2S A;  4P72 C;  3TUP A;  3FB9 A;  3JCM Q;  3JB9 F;  2ZZG A;  3NET A;  3QO7 A;  4P73 C;  2I4O A;  5GAM g;  3IKM B;  5GAM f;  5LJ3 h;  4YP0 A;  1YFR A;  4M75 E;  1X56 A;  4C8Q A;  4M7D D;  2DQ0 A;  2DU5 A;  4WJ4 A;  5GMK l;  1W66 A;  4J5Y A;  3A31 A;  3JCM W;  4YCU A;  5LJ3 f;  4PJO D;  2VC8 A;  4DPG A;  3VQY A;  4QVD A;  3UGQ A;  3PZC A;  4PHC A;  1G51 A;  4LNS A; 
#chains in the Genus database with same CATH topology
 1J5W A;  1T3L A;  2ECZ A;  1HD3 A;  2D0Q B;  1BB9 A;  2Z0W A;  2PUO B;  4AT1 B;  4YRI A;  1YCY A;  5L23 A;  5IN1 A;  4KBM B;  2MAM A;  1WIE A;  1QCF A;  2LX9 A;  4N4H A;  3E9H A;  3CPW S;  2JUF A;  3TEG A;  2RHZ A;  2PU9 B;  2I4N A;  2PVO B;  4P74 A;  1VUB A;  3ZEH A;  3M57 A;  2CZ0 B;  2DXT A;  2MWP A;  3OW2 A;  1S72 T;  4FYX B;  5DY9 A;  3G6E A;  2A37 A;  2F5T X;  1N9S A;  1QVG P;  1HSQ A;  4RTU A;  5HK3 A;  5DM7 R;  4X5O A;  1LJO A;  1X27 A;  1BCM A;  1U06 A;  1K73 U;  4H02 A;  4C8Q D;  1RI0 A;  1USY C;  1GCQ A;  2DYI A;  3CCM Q;  2ZR3 A;  4CC2 A;  4FSS A;  2O88 A;  2RI3 A;  3NTH A;  3ME9 A;  1PM3 A;  3CEY A;  2Q5I A;  2E4H A;  3M54 A;  4CS3 A;  2EJF A;  2KXC A;  3CCQ Q;  1ABO A;  3OYE A;  3CCU A;  1Z9Q A;  1NJ2 A;  2LJ1 A;  3EFS A;  4ME7 A;  1OI1 A;  5KE2 A;  3VQV A;  4HWT A;  4MDW A;  3H0F A;  3INZ A;  3NTI A;  2RH2 A;  4J7I A;  4Z02 A;  2A8E A;  4P3P A;  4OP0 A;  1E6H A;  3L4G B;  3EG9 A;  1LPL A;  1PG5 B;  1I5L A;  2CH4 A;  1WJQ A;  2E10 A;  4A4E A;  1G8X A;  4PNO A;  3DSQ A;  2ESW A;  2LT4 A;  1ADJ A;  3G6E T;  1YIJ T;  1QVP A;  4YCW A;  2RMO A;  3CPW P;  4YRM A;  2QHV A;  1NE8 A;  1X6B A;  1M9S A;  2DRK A;  2HD0 A;  3CC7 A;  2RO0 A;  4FT4 A;  2R5M A;  2I0N A;  1LCK A;  4J9I A;  4PFP A;  2FB7 A;  2EWN A;  1WI7 A;  4C92 C;  1KIK A;  2M9U A;  3HKS A;  4FIB A;  2P0P A;  3TSW A;  11AS A;  4DBF A;  3L2Q A;  2HKQ B;  3I35 A;  4M77 B;  2CT4 A;  1BYM A;  3MF2 A;  2KI7 A;  3CCU T;  5CIU A;  2EL9 A;  3ULR B;  4ZN1 A;  3EFO A;  1M30 A;  3CBM A;  1BU1 A;  1D0Z A;  1RAH B;  1VQO A;  5C53 B;  4PJM A;  4KGV B;  1QMC A;  2BKD N;  1C1A A;  1WDX A;  2LQK A;  5IH2 A;  5GAN 4;  2GCX A;  3VS3 A;  4J9E A;  4QVZ A;  4Z88 A;  3JB9 G;  2HL3 A;  1WGS A;  2ENM A;  5FU6 B;  2HAX A;  2WAC A;  2VUB A;  3LWI A;  1LOJ A;  1I8F A;  3VS5 A;  3VQW A;  1VQ4 T;  1D3B B;  5ECA A;  3HRS A;  4X9C A;  1QVF S;  3HXV A;  2DL7 A;  1YHQ Q;  4JS5 A;  3P8B B;  1KG1 A;  1KMN A;  3CC7 T;  3HFN A;  1NZ9 A;  1ZUU A;  4XTY A;  2DIL A;  4C0D C;  1VQL Q;  3CCJ T;  3C0C A;  2MIO A;  4LDW A;  4BE1 A;  2E5A A;  4CC7 A;  2KYB A;  4K88 A;  1ABQ A;  1Q81 R;  1WHK A;  2ZIN A;  1HTT A;  1M3A A;  2C0T A;  2LMJ A;  2JZ2 A;  3VS1 A;  3Q1J A;  2CIM A;  1V76 A;  4OMM A;  4M7A E;  2VGM A;  2RQR A;  2VGN A;  1B70 A;  1AWX A;  4XU1 A;  4M78 E;  1YCS B;  1KD1 U;  1Q7Y C;  4Q6G A;  4ESR A;  4F16 A;  1Q95 G;  1WXU A;  2NUP A;  5D6Y A;  3M4Q A;  1WLE A;  3MP1 A;  3TQ7 P;  4BY6 B;  1Q81 C;  2FYK A;  1R8O B;  2PZ1 A;  1FWZ A;  1ZSG A;  2ALY A;  2HZY A;  1AZE A;  4JJB A;  2LCL A;  1USY A;  4J9G A;  1X54 A;  1Y96 B;  4A4H A;  1OQK A;  1K9M R;  1GBQ A;  5KYW A;  2G3R A;  1B3Q A;  4KUL A;  1HK9 A;  3LLR A;  5A0L A;  3S6W A;  2XDP A;  5I2M A;  4CH5 A;  1M2V B;  3TSZ A;  3BW1 A;  1H92 A;  2DZ9 A;  2QI2 A;  4LDY A;  1R77 A;  1OU9 A;  4RUG A;  2RHQ A;  1KK7 A;  3SB2 A;  4HVV A;  5GAO q;  1NG2 A;  2JJ9 A;  5GMK j;  1QVF P;  4FYW B;  1ZA1 B;  1PD1 A;  9ATC B;  2Y90 A;  3HTR A;  3G71 A;  4LVL A;  1E22 A;  1N6A A;  3CCS Q;  3JCM J;  4RTV A;  4PJO C;  4J15 A;  5GAM d;  4M7A F;  3THK A;  2KDS A;  7AT1 B;  4J9D A;  3VS6 A;  4M78 F;  5FLX E;  3JCM X;  4XTV A;  3SWN B;  4DBQ A;  3G4S A;  2LX7 A;  3I55 Q;  3CCV T;  2QEX A;  2DIG A;  4JLG A;  3MP8 A;  2E3H A;  1PKT A;  4C92 A;  2ED0 A;  4M7A G;  4OB2 B;  3I56 T;  2RQV A;  4AFU C;  3PMT A;  4AG2 C;  3X24 B;  2DIQ A;  1JXM A;  2J3M A;  1MMN A;  1QWE A;  3QWX X;  2A0F B;  1WXB A;  1ZUY A;  3I5R A;  2HNI A;  2AKK A;  2EBP A;  3QTC A;  2CZ6 B;  2EQM A;  3NEM A;  4RKU E;  2JW4 A;  4FW1 A;  1RAE B;  2E3I A;  2VXF A;  3HFZ A;  4EMH A;  2ZPB B;  5IHI A;  2DU7 A;  4XEM A;  1VQ5 Q;  4KT0 E;  2K3X A;  5GAN 8;  1NM7 A;  4C8Q C;  4JRK A;  2HBW A;  3HXZ A;  1YIT T;  2O4X A;  2CKK A;  1MMD A;  2Y4X A;  4CH4 A;  2E41 A;  3A5Z B;  2HQX A;  2LTO A;  3FC3 A;  3RAC A;  3JAM E;  3ICA A;  1SRY A;  3G4S T;  3HSB A;  2L3R A;  1IHW A;  3CCE T;  2QEX T;  2JM8 A;  3VV0 A;  4PG3 A;  4MDX A;  3MHX A;  1YGB A;  2JS2 A;  2DK3 A;  1H4T A;  3CD6 T;  4HT4 A;  4YRS A;  3SEM A;  3WVE B;  3E2U A;  3V7C A;  4AMC A;  1CKB A;  4HWR A;  2GQI A;  1VQ7 Q;  3ASK A;  4H2Y A;  2H3E B;  3VKI A;  1YJN T;  3JCM d;  5GAN d;  3UF4 A;  2DRM A;  4JJC A;  1G3W A;  2HCK A;  4NS5 A;  2Q7G A;  2K5L A;  1UTI A;  1W70 A;  2CSI A;  4E7J A;  4QQD A;  4M75 D;  1B7Y A;  3HY1 A;  4UP9 A;  1YFS A;  1B8A A;  3M0Q A;  4H2X B;  2QQR A;  2AK5 A;  2K7A A;  2FPD A;  3CCR T;  3JB9 J;  5GAN 7;  1SPK A;  1OEB A;  1V29 B;  2LVM A;  1H4Q A;  3EGD A;  3EHR A;  1AT1 B;  4QW2 A;  1NJI R;  4RMF A;  1PC0 A;  1YB3 A;  2JXB A;  5C51 B;  2M1H A;  4OMN A;  2COZ A;  1VQ9 Q;  1TTH B;  1MMG A;  4JUV A;  4BD3 A;  2QQB A;  4QT7 A;  2O01 E;  1M1K U;  1WLP B;  1WPY A;  1SRL A;  3FDR A;  3UH0 A;  2EFI A;  1NJI C;  2YWW A;  5GAO n;  1N9R A;  3MPU B;  3C4S A;  3KUF A;  1U5S A;  3X28 B;  5CKD A;  1PYS A;  1C6V X;  1TU0 B;  5KYY A;  1AHJ B;  2IY5 A;  1M8V A;  2BZX A;  2PTK A;  4CRI A;  3UAT A;  1VQN A;  1M4Z A;  4MZM A;  1BKB A;  1TS9 A;  1RAG B;  2RM4 A;  3OS0 A;  2VWF A;  1Z9Z A;  3WXM B;  4LDV A;  2FRY A;  1JJ2 A;  4DOW A;  2K4Y A;  4BDZ A;  1UUE A;  4Q5W A;  4IUT A;  4PK4 A;  1K8A R;  5LJ5 f;  1LYL A;  2CJA A;  2LT1 A;  1SSF A;  2XMF A;  2MCN A;  2COW A;  2FL7 A;  4V2S A;  3M58 A;  3SHW A;  3S3O A;  4P72 C;  2EKH A;  4BE0 A;  3CC2 Q;  3NET A;  2D8H A;  2GF7 A;  4P73 C;  1K8A C;  2RJE A;  3IKM B;  5GAM f;  3J7A F;  1YFR A;  3CMA T;  4C8Q A;  3EH1 A;  4M7D D;  4R0K A;  4WJ4 A;  4J5Y A;  3RR6 A;  5LJ3 f;  4FYY B;  3TVT A;  3VQY A;  4QVD A;  4J9B A;  8AT1 B;  3MP6 A;  3C94 A;  1G51 A;  2RQW A;  2QGG A;  4LNS A;  2LCS A;  2VV5 A;  4XTZ A;  3OMG A;  3QJY A;  1FMK A;  2KT8 A;  1UE9 A;  3LSS A;  1YWO A;  3KBG A;  3DB3 A;  1X43 A;  2A3L A;  2P5I A;  5LJ5 j;  4M7A C;  1VYV A;  4RTX A;  1VQP Q;  3LGF A;  4M78 C;  4XK8 E;  3M4P A;  3UA7 A;  3CXC S;  1W6X A;  2BIV A;  1YJW T;  2J3L A;  2GNC A;  3VS2 A;  2D8J A;  1Q82 R;  1N8R R;  1WJR A;  3QHS A;  4GBQ A;  4C5I A;  1S72 Q;  4AFZ C;  1VQ6 T;  3HPW A;  1SHF A;  2RQU A;  4XU2 A;  1NYG A;  2NS6 A;  4DOV A;  3PIP A;  2CYZ B;  4ELZ C;  3VBB A;  2OTJ T;  1YJ9 A;  3EG9 B;  2V8I A;  4LVI A;  5LJ3 j;  4C5G A;  4TWA A;  4D8D A;  5E3I A;  2KBT A;  5KYU A;  1M3B A;  2YDL A;  4OB3 B;  3HRT A;  4FCY A;  3BDL A;  1N8R C;  4QVC A;  1N5Z A;  1BI0 A;  1D0X A;  3RKY A;  3H41 A;  4LVJ A;  3H9N A;  4P75 C;  2DEU A;  3N5B B;  2A28 A;  3CCL A;  5GMK e;  2O31 A;  2K5I A;  2RD1 A;  2ZIM A;  2DXB A;  2OTL T;  1BBU A;  3MO8 A;  1RAA B;  2KY9 A;  2WSC E;  4BB7 A;  4DQ2 A;  1I4K 1;  4XTW A;  1NPP A;  2KRO A;  3VQX A;  1QKW A;  4BE2 A;  2E5Q A;  2JN0 A;  3G1J A;  5ELO A;  2KXD A;  5GAN f;  3DKM A;  4M77 D;  1X01 A;  1IO6 A;  3FRN A;  3EFO B;  3J80 E;  1NJ6 A;  1H8K A;  1T3S A;  3TEH A;  3BDU A;  5D7U A;  3C12 A;  1UGR B;  2DLP A;  4C5H A;  3G6E Q;  1YIJ Q;  4IKF A;  3V8L A;  4PJO E;  4BWA A;  4C0G A;  1VIF A;  5D6X A;  3MEU A;  5HKC A;  2B86 A;  3R6O A;  3VS0 A;  3CXC P;  3A1P A;  4J83 A;  1WHG A;  2EQU A;  2IVW A;  2K5F A;  1NYQ A;  2ARU A;  1KSW A;  4KR2 A;  2DF6 A;  5CKE A;  1IXD A;  3VUB A;  4HCC A;  3JCM b;  1HXD A;  1QP2 A;  1ACM B;  3CMQ A;  3HL8 A;  4PLL A;  2HKN A;  2HEQ A;  2RA2 A;  2V26 A;  1W4S A;  3A32 A;  2RHI A;  4L5G A;  5IAY A;  3UPU A;  1VQK A;  3HXW A;  2CJB A;  2B8A A;  4P72 A;  2LJ3 A;  4M75 C;  1I1J A;  3QZ9 B;  2P4R A;  4FW2 A;  4FM4 B;  4LUD A;  4P73 A;  2DXU A;  2EKO A;  2DZC A;  4BW9 A;  3DB4 A;  3RMS A;  2KRN A;  4BI4 A;  3M55 A;  2HQH A;  4ZTU B;  2CP5 A;  2L8D A;  2DYB A;  2GBQ A;  1B70 B;  4D8K A;  2M0Y A;  1I0C A;  1VQ4 Q;  1MV3 A;  1TUC A;  1IGU A;  1VQM T;  2MPX C;  4YRT A;  4HCK A;  3A7U A;  4ZIB A;  4C8Q E;  2NUP B;  1OPK A;  1YN8 A;  4PJO F;  1UJ0 A;  1YI2 A;  2JTE A;  3CCJ Q;  2HSP A;  2ALY B;  2F5K A;  4R55 A;  4YRR A;  5CKB A;  4YRE A;  2ZPE B;  1GBR A;  4M7A A;  2OJ2 A;  1MMA A;  5GMK h;  3AT1 B;  4OMP A;  4M78 A;  6AT1 B;  2PVG B;  5KYW B;  2ROL A;  4OB0 B;  4PJO G;  2J6O A;  1AWW A;  3M56 A;  1KMM A;  5GMK m;  4FU6 A;  3PCO A;  2J6F A;  2NLU A;  4BUG A;  2RHQ B;  2VB6 A;  5GJW B;  3SFM A;  1UEC A;  3EFR A;  4P71 C;  3HRU A;  5A2Q E;  1X2G A;  5IXF A;  2EPD A;  2D6F A;  2V1R A;  1G5H A;  1U1T A;  1XOV A;  2HBP A;  2QG9 B;  1TSF A;  4P75 A;  3OB9 A;  4PLI A;  4C8Q F;  3E9G A;  1RL2 A;  1ZX6 A;  3MEW A;  3HXU A;  4C92 B;  3QPH A;  1RAB B;  1K4U S;  2QA4 A;  5GAN 3;  3PIO A;  3IQL A;  5HK0 A;  5AYF A;  3W3S A;  3QDF A;  5FU7 C;  1B76 A;  2M16 A;  1QW1 A;  4FYV B;  4C8Q G;  2DVE A;  4M7D C;  1MGQ A;  2LQN A;  3JSC A;  2C8M A;  1D1B A;  2ZT8 A;  1HYO A;  2KRS A;  2VXE A;  2QTX A;  5J39 A;  4QQG A;  3HFZ B;  1RLQ C;  3EGX A;  4HVU A;  4WF2 A;  3M0R A;  2C7I A;  2HMA A;  2EIF A;  3CCV Q;  2QXF A;  3A7R A;  4MML A;  1MHN A;  2IIM A;  2O4X B;  3ER0 A;  3QWY A;  3I56 Q;  3CC4 A;  1IRX A;  2X51 A;  1ASZ A;  4DEY A;  2KE9 A;  2X3W D;  3R6N A;  3RKW A;  2VVK A;  1RAI B;  2R5A A;  3KFV A;  1X2H A;  2AZV A;  5A0D A;  4LE9 A;  4C0D B;  2DL4 A;  2DL3 A;  3QNE A;  3M9Q A;  1TG0 A;  2JVV A;  1M8M A;  2YUP A;  4GLM A;  3JB9 D;  1TUG B;  5GAO m;  4M75 A;  2DM1 A;  2QDL A;  4J6W A;  3P8T A;  5CK9 A;  4B9W A;  4LXC A;  4E7I A;  1K0X A;  3P8V A;  3HTZ A;  1OX9 A;  4PFZ A;  1YIT Q;  2CT3 A;  1WYD A;  3OS5 A;  4J9H A;  4HXJ A;  5KNN A;  5LJ5 e;  2LDM A;  3EG3 A;  4F7U E;  1B7Y B;  2DMO A;  3DLL A;  2XU8 A;  3A8G B;  3CCE Q;  4E7S A;  2COY A;  4NOY A;  2QEX Q;  5HGQ A;  5LJ3 g;  1WHM A;  4JRQ A;  4G85 A;  1Q7Y R;  2CDT A;  2LQ8 A;  2ZPG B;  3JCM P;  3CC4 T;  1ZQ1 A;  2DPP B;  3CD6 Q;  3T9N A;  3P8H A;  3EGD B;  3CCM A;  1PCX A;  2A36 A;  4OMQ A;  1KJW A;  3QO8 A;  2ZXF A;  1QQJ A;  5GAM e;  3OS2 A;  4NL3 A;  3CCQ A;  1K1Z A;  1YJN Q;  1JEG A;  2RPN A;  4LDU A;  1DJ7 B;  4K86 A;  4IIM A;  1VQO T;  3A5Y A;  3REB B;  3NTK A;  5LJ3 e;  1W2B S;  4P71 A;  4CH6 A;  2C0I A;  4OLF A;  3CCR Q;  3M0T A;  5FU6 C;  4Z89 A;  1B34 A;  4PFO A;  1OZ2 A;  1EFN A;  1Q81 U;  3IAL A;  2FPF A;  4HWO A;  2ZTG A;  5IHK A;  4CS2 A;  1PYS B;  3CBO A;  5KYY B;  2IY5 B;  2E6Z A;  2ZNI A;  3ERR A;  2DJQ A;  1Q86 R;  1ZBX A;  5I11 A;  5C0M A;  4F7U F;  2ZR2 A;  2PQW A;  3QDR B;  2AMC A;  2FO0 A;  4TVW A;  2ZAE A;  3EH2 A;  1KOG A;  4M7D A;  2LCC A;  4F7U G;  2QHS A;  4GLK A;  1Q86 C;  4C5E A;  1KQS A;  1KFZ A;  3LH5 A;  1ZSZ C;  1K9M U;  1WYX A;  4OMO A;  5KCH A;  3TRE A;  2XI9 A;  3A8H B;  3OYG A;  1NLP C;  1OPL A;  2PNI A;  5CQY A;  4DBR A;  1RAD B;  1J3T A;  2D9T A;  1HJD A;  3QSU A;  1UB4 A;  4PL6 A;  2RJF A;  2ZIO A;  2E65 A;  2YUQ A;  4IUR A;  4C8Q B;  2LNH B;  1AEY A;  2EYW A;  2WSE E;  5LJ5 h;  2VAS A;  3NFC A;  4LNP A;  3OYF A;  3VS4 A;  4M78 G;  4PKC C;  2XIC A;  2MI6 A;  2VKN A;  2GFU A;  1W2B P;  4F14 A;  1YHQ A;  4QQ6 A;  5GAN e;  3MEY A;  3TCJ A;  1VYT A;  2NUT A;  4QKU A;  1BIB A;  2L3Q A;  4KGX B;  4JPB W;  1VQL A;  4XQ3 A;  2ART A;  1ASY A;  2EYX A;  3GBQ A;  1LVK A;  3QUI A;  1SHG A;  1QVG A;  2DFU A;  3C95 A;  4JZ3 A;  3G71 T;  3FB9 A;  1WHH A;  3JCM Q;  3CMA Q;  3QZ5 B;  3SDZ A;  1IGQ A;  5LJ3 h;  3DLM A;  1TXQ A;  4M75 E;  1X6G A;  4BDY A;  2FZC B;  5CKF A;  1O9S A;  1UJY A;  3OYL A;  3A31 A;  2K6D A;  2BTT A;  3JCM W;  3SD4 A;  2VC8 A;  3OSS C;  2HDA A;  1NEG A;  2K79 A;  3URG A;  5CO7 A;  2QYZ A;  4NCX A;  3H0I A;  2DO3 A;  4TVA A;  4RTW A;  5KYU B;  2KSS A;  4HT8 A;  5KH6 A;  2K2M A;  1PRL C;  2RF0 A;  2F2W A;  5IT9 E;  1EIY A;  1Y71 A;  1G2B A;  2XTI A;  1HC7 A;  2XDD A;  4YDQ A;  2MK5 A;  3ZBD A;  3CPF A;  4CC3 A;  3GLX A;  1YJW Q;  3V7R A;  4YRL A;  4IUQ A;  2DD5 A;  3CPW A;  2DET A;  5LL6 S;  2DTO A;  1D0Y A;  1VQ6 Q;  1WQ7 A;  2EYY A;  5I22 A;  3GIB A;  2M02 A;  2WSF E;  1UFF A;  3OW2 S;  5CAI A;  2OTJ Q;  5K1X A;  3CCS A;  2KT1 A;  3RKX A;  2DAQ A;  4Z8A A;  4XTU A;  3TEH B;  4A54 A;  2XID A;  4M75 F;  4A63 B;  1RAC B;  2V8K A;  3HY0 A;  5I2S A;  4O5V A;  2YRC A;  1UGP B;  3MF1 A;  2KNB B;  3LW5 E;  3I55 A;  2J7I A;  4JLI A;  2OTL Q;  3OD1 A;  1L0W A;  2ATC B;  2FHD A;  4M75 G;  1M90 R;  3EG2 A;  3OA6 A;  2ED1 A;  3OSV A;  4TTV A;  1YBY A;  2V8J A;  2JNG A;  3HXX A;  3CME A;  4HA8 A;  1RUW A;  1JO8 A;  3QO3 A;  4PJO A;  3OYB A;  2CUB A;  2LJ0 A;  3AHU A;  1WX6 A;  1ZSZ A;  3I7F A;  1M1K C;  2PMF A;  1BCO A;  1NJI U;  1M90 C;  4M7D E;  4H2T A;  3PNW C;  3VYH B;  3E9F A;  3OY9 A;  1VQ5 A;  1O75 A;  3RF1 A;  1PD0 A;  4AG1 C;  1B7T A;  1EX4 A;  2E64 A;  4F7U B;  4C0F A;  1NJ1 A;  3NEL A;  1QF6 A;  4YRC A;  2BUD A;  4AH6 A;  1OUL A;  2AIR B;  1D1A A;  2QHT A;  1SEM A;  5IHN A;  3S3M A;  5FWB A;  2NYS A;  2NWM A;  3OW2 P;  1AWJ A;  2YRV A;  1EQR A;  2ARS A;  4EMG A;  4J8O A;  1KHI A;  3PMI A;  4M7A B;  2YLB A;  2J06 A;  2QK0 A;  1TWB A;  4M78 B;  2XHC A;  4ZGE B;  3CME T;  1ZLM A;  3RMQ A;  1VQ7 A;  2CZ7 B;  3QYG B;  3O5Z A;  4UPA A;  2K9G A;  1K0S A;  3PCO B;  2CZ1 B;  4GY5 A;  1K8A U;  3BFM A;  1N9W A;  2FEI A;  1MND A;  4WTO B;  2EGE A;  1VQM Q;  1JB0 E;  3REU A;  3VRY A;  3PVQ A;  4KRT A;  4D6W A;  4M7D F;  3LC0 A;  1VQN T;  3VS7 A;  3PVL A;  3GNF B;  4UC4 A;  3FJ5 A;  3QXE B;  3JCM c;  2EQK A;  2J05 A;  2LNV A;  1QVF A;  5D6W A;  1NEB A;  1X6O A;  1Y0M A;  2ZZE A;  2V1Q A;  3FIF A;  4IUU A;  1X2Q A;  1R0C B;  4M7D G;  4YRN A;  4EMK C;  2OAW A;  4EX5 A;  2KVQ G;  1M27 C;  1WXT A;  4E7L A;  1MUZ A;  1Z7M A;  1VQ9 A;  5GAM j;  4C92 D;  3LGL A;  1UHF A;  4MZT A;  3NHN A;  5CVI A;  2KEA A;  4A4G A;  5GMK i;  3L2Z A;  4P3O A;  3MJX A;  2I4M A;  3GP8 A;  4J6Y A;  4HWP A;  2BZY A;  1SSH A;  1KC8 R;  1MNE A;  2X9H A;  3EGX B;  2XG8 D;  5FRN A;  2E1H A;  4P5N A;  1T0J A;  5FWC A;  1E6G A;  1BI2 A;  3OQ5 A;  1Q82 U;  1N8R U;  4JJN K;  5GAN 5;  1VYU A;  5FW9 A;  4KQE A;  3JCM f;  1KC8 C;  1IL2 A;  2YHT A;  3IG2 A;  4TQD A;  2M0O A;  2L89 A;  2G4C A;  3X25 B;  4YPF A;  1QCO A;  1UDL A;  3L2V A;  2P4T A;  3A8O B;  4Y92 A;  3L2U A;  4OMF B;  2ROT A;  2QHU A;  5M9O A;  1VOM A;  2YRD A;  4PJL A;  4YRK A;  4M75 B;  4M77 F;  1G5V A;  3CC2 A;  2EQJ A;  2DL8 A;  3E1S A;  3OYI A;  2DJZ A;  2QQA A;  2XK0 A;  3E19 A;  4X9D A;  1YJ9 T;  4N4G A;  1WZO A;  4LD6 A;  4TQF A;  1QLY A;  1XJW B;  4YRG A;  1GCP A;  1ARK A;  4RG8 A;  1Y07 A;  2I4L A;  2P0K A;  3M5A A;  3CCU Q;  4O6J A;  3CCL T;  5EC7 A;  1EVK A;  3HRI A;  5K1P A;  1XQH A;  4HT9 A;  2DDZ A;  2ZZD A;  5I21 A;  3WQZ A;  4EPC A;  2MWO A;  2K57 A;  5GAN j;  4KGZ B;  4II1 A;  1WA7 A;  2H3J A;  1EOV A;  1Z7N A;  1VQP A;  4DBH A;  4OML A;  3G7Z A;  2CS7 A;  3E9I A;  5GAN 2;  4ZGJ B;  2L5Q A;  4F7U A;  1VQZ A;  1AD5 A;  3NGP A;  1VQ8 A;  2X4Y A;  2P0Q A;  3OYK A;  4YTL A;  1BI3 A;  2DTI A;  2LC4 A;  4K87 A;  2PME A;  1RIQ A;  1S72 A;  3HFV A;  3CC7 Q;  1TH7 A;  1K9A A;  3PT9 A;  2CH4 W;  3OYJ A;  1JJC A;  2ZT7 A;  3V8K A;  2J6K A;  2X3X D;  3X26 B;  1FX7 A;  1QWF A;  1ZUK A;  1B34 B;  1EVL A;  1JXO A;  3CC4 Q;  4EIK A;  2LQW A;  2QGF B;  1WHJ A;  2DXC A;  2F1L A;  2K2V A;  2DEQ A;  2EGC A;  4EMK A;  4E7H A;  4E2F B;  4HKE A;  3GPL A;  4XU0 A;  1TUD A;  1WHL A;  2RHS A;  4ZN3 A;  4OGC A;  4CH3 A;  5EG2 A;  4RMO A;  1VQK T;  2F2V A;  4LN2 A;  2AMC B;  1VQO Q;  1K73 R;  4ZTF A;  1ZBJ A;  1E7O A;  3RGL A;  4G84 A;  1IRE B;  1VQP T;  1UEB A;  5FU7 B;  2BZ8 A;  1NPR A;  1LNX A;  4M7D B;  1M1F A;  4LVM A;  3D7S B;  3M53 A;  2ABL A;  5A0G A;  1VQ8 T;  3EG0 A;  4ZGD B;  2ZZF A;  4M4Z A;  2RJD A;  4E51 A;  2DL5 A;  1K73 C;  1D09 B;  3VJP A;  1D1C A;  1T0H A;  1SES A;  3NEN A;  1YIJ A;  4F04 B;  1W1F A;  3HHT B;  3R07 A;  1YI2 T;  4Q15 A;  3LYI A;  2JTF A;  4ZTJ A;  3WVD B;  2VYT A;  2K3B A;  3QG1 A;  1YFT A;  4X34 A;  2ZPF B;  1OU8 A;  3MCA B;  2KR3 A;  1FMW A;  3O8V A;  2XKO C;  2NUT B;  5GAO r;  2M51 A;  5CKH A;  2AKW A;  2O9V A;  5C6S A;  2FZG B;  3OYM A;  3RER A;  2NUZ A;  2CJ9 A;  2I2L A;  3MQZ A;  2C06 A;  3OYA A;  1IB8 A;  2JM9 A;  3NMZ C;  3UGT A;  2RNA A;  4J9C A;  4KH0 B;  3IKL A;  1AVZ C;  3I9Q A;  2EAY A;  3VU3 C;  3UA6 A;  1B07 A;  4HWS A;  1VQ4 A;  1JJ2 S;  1BIA A;  4A53 A;  1JBM A;  3M4Y A;  2DQ3 A;  1NYR A;  2DTH A;  1S1N A;  2E6N A;  4L87 A;  2O2O A;  5LJ5 g;  2LZ6 B;  2QA4 T;  1GFC A;  3CCJ A;  5FRM A;  4TVA B;  4UP7 A;  2Q7H A;  2CP6 A;  3MET A;  5CQX A;  1EIY B;  3G71 Q;  3HXY A;  3UWN A;  2D1X A;  1M3C A;  3LH0 A;  3JB9 F;  2ZZG A;  3U23 A;  3QO7 A;  2DA9 A;  2I4O A;  5GAM g;  1RLP C;  4YP0 A;  2EW3 A;  1V1C A;  2DQ0 A;  3PE0 A;  4F17 A;  2DU5 A;  5KE3 A;  3G4S Q;  3CQT A;  5GMK l;  2E70 A;  4AFQ C;  1W66 A;  3JV3 A;  4OVA A;  2LRQ A;  4YCU A;  2DER A;  4DPG A;  2KMT A;  4PHC A;  5KYN A;  3UT1 A;  2C0O A;  2YT6 A;  4M77 C;  4VUB A;  2JT4 A;  4YRF A;  3A8L B;  1X2K A;  2ZPH B;  1KD1 R;  1EZZ B;  4IIO A;  2XDB A;  2AHJ B;  4JDS A;  1NYF A;  1I07 A;  1IHV A;  1UG1 A;  4LVK A;  3GOX A;  3RBB B;  2SRC A;  3EHQ A;  3RIR A;  1JJ2 P;  5HY6 A;  4E47 A;  4KR3 A;  2QDY B;  5KYX A;  2DX1 A;  3CXC A;  4H2U A;  2E3C A;  2RHY A;  4MMK A;  4RTY A;  1Q7Y U;  1KD1 C;  2GQV A;  4PJO B;  3VYG A;  4XAX B;  2GTJ A;  1ZSZ B;  1TOV A;  4ZNX A;  3A8M B;  4BI8 B;  2QAS A;  3OYC A;  2AT1 B;  2KGT A;  3REA B;  12AS A;  3L2W A;  2MOX A;  2CP0 A;  4LDX A;  3L2R A;  3A7A A;  3CCV A;  1M1G A;  4JS4 A;  3J81 E;  4KUD K;  1OX8 A;  4PJN A;  1G3Y A;  1UHC A;  3CCM T;  3I56 A;  2RN8 A;  2JS0 A;  2YSQ A;  3CCQ T;  2ZPI B;  8ATC B;  1NNH A;  1XNI A;  1JU5 C;  4KUI A;  3LX7 A;  5LJ5 d;  2XD0 A;  3JCM g;  1U8R A;  1NBE B;  5GAN g;  4E7K A;  3X20 B;  3OYY A;  1SER A;  4FL6 A;  1GL5 A;  4MZP A;  1Q86 U;  4PJJ A;  2RK2 A;  4M7A D;  2GFA A;  4BY6 C;  1KQ2 A;  1KHC A;  1QKX A;  1K9M C;  2RB6 A;  4M78 D;  3QJ6 A;  5GAO l;  2R57 A;  5ELN A;  4J6X A;  5AT1 B;  2DNU A;  1YIT A;  4OF1 A;  5GAN 6;  2F69 A;  1E24 A;  2RQT A;  2FZK B;  4JRP A;  3JCM e;  2KRM A;  1IZ6 A;  4RCB A;  4UP8 A;  3A98 A;  4JRI A;  1SRM A;  1X75 C;  3H6Z A;  5LJ3 d;  2O9S A;  3CCE A;  1YFN A;  3JB9 I;  1BBZ A;  2FVU A;  2L3S A;  5GAM h;  2CRE A;  2X4J A;  2X4X A;  3CD6 A;  2EJ9 A;  3OYH A;  1UGQ B;  1U1S A;  3CME Q;  1SKU B;  2YXY A;  3H8Z A;  2EYQ A;  3L4G A;  2CGH A;  3LSQ A;  1H64 1;  2GGR A;  1YJN A;  5L8R E;  1CSK A;  4IUP A;  4NL2 A;  3SWN C;  2ZNJ A;  1KQ1 A;  3QO5 A;  2YUO A;  2G6F X;  3PGG A;  1VQN Q;  3RNJ A;  3MEA A;  1QE0 A;  1RI9 A;  2Q5H A;  3ZL7 C;  1SG5 A;  2Q7E A;  1OOT A;  4B6M A;  3CCR A;  5J26 A;  3PTA A;  3VUZ A;  1C0M A;  2MYS A;  2L3P A;  3L42 A;  4M77 A;  1BK2 A;  5FRO A;  1YHQ T;  2ODR D;  4ATO A;  2KAF A;  2H8H A;  3FLG A;  2E12 A;  2L2P A;  3P8D A;  1G3T A;  3F70 A;  1VQL T;  1E1T A;  3GNG A;  1N27 A;  4Y91 A;  4CS4 A;  1ZA2 B;  2CP2 A;  2CP3 A;  1GXI E;  1YP5 A;  1I5O B;  1GGM A;  3BY7 A;  3V7S A;  1WQW A;  4XTX A;  4XU3 A;  3G1Z A;  2JMA A;  3I5S A;  1JRI A;  3KFU A;  2P0L A;  4HCB A;  1D3B A;  3FEO A;  3HP9 A;  4HVC A;  2BE7 D;  4O2D A;  4TVR A;  1EFW A;  1PHT A;  2DBK A;  4L6V 5;  3QBY A;  1M1K R;  1SET A;  2A08 A;  1WNL A;  3JCM h;  3EG1 A;  2RJC A;  5GAN h;  4A4K A;  4H2W A;  2X35 A;  1BI1 A;  2QTV A;  3TEE A;  3P8Y A;  4DA4 A;  1X55 A;  2F2X A;  2ZGW A;  4RG2 A;  1OZ3 A;  3ZFJ A;  3QKJ A;  4N0A C;  3REX A;  4YRQ A;  2CUD A;  2MF2 A;  4YRJ A;  2YLC A;  2KQW A;  4RTZ A;  5F5W A;  2EGA A;  1MV0 B;  5CR2 A;  4H2V A;  4CI0 C;  3EGU A;  4RQF A;  1R0B G;  5C52 B;  1BBW A;  3CCS T;  1YJ9 Q;  3KXT A;  1GFD A;  1M90 U;  3CMA A;  1G83 A;  1GRI A;  3OBW A;  2IG0 A;  1QCN A;  2EVR A;  1Y96 A;  4WJ3 M;  4ORZ A;  1FYN A;  3H0H A;  4TVY A;  1WU7 A;  2GTO A;  3CCL Q;  2P84 A;  4RQE A;  1CKA A;  5KCO A;  3I55 T;  5HCK A;  1M2V A;  1JJC B;  2W10 A;  3RL6 A;  1H4V B;  1FXX A;  4JZ4 A;  2RI2 A;  2ZCE A;  1OYX A;  3BE3 A;  3RES A;  2OI3 A;  3M0S A;  1ZHI A;  3A74 A;  1H3H A;  2FPE A;  3TU4 K;  4CC4 B;  4EMK B;  1VIE A;  4C92 E;  2CP7 A;  2RHS B;  2DE0 X;  2DKG A;  2JMC A;  4ELY C;  1G3S A;  3VRZ A;  2ZT5 A;  4Y28 E;  1YJW A;  1PKS A;  1ADY A;  4YRO A;  2DVJ A;  4C0Z A;  2BE9 B;  3SWN A;  1VQ6 A;  1PRM C;  2AZS A;  1VQ5 T;  2D0N A;  2OX7 A;  4IUV A;  4KH1 B;  2LP5 A;  1X69 A;  3V8J A;  4LD9 K;  3QII A;  2OTJ A;  2X4W A;  1WJS A;  5DLO A;  4J9F A;  1G5I A;  1C0A A;  3UFG A;  2QQ9 A;  2R58 A;  3M4G A;  2Y4Y A;  1AOJ A;  4WCI A;  3JB9 H;  3PFS A;  4BI3 A;  2JOY A;  1VQK Q;  4YRP A;  4M77 E;  2OTL A;  4H2S A;  2RI5 A;  5GAO p;  1AZG B;  3MEV A;  4EDU A;  1JQQ A;  4E7Z A;  1VQ7 T;  1K76 A;  4P74 C;  4AFS C;  2CSQ A;  3EAE A;  1VQ8 Q;  3FJP A;  3CBP A;  2DD4 A;  4C92 F;  1QP3 A;  2AKW B;  2FG0 A;  1H3Z A;  2ZT6 A;  3A5Z A;  1W2B A;  3OYN A;  1PSF A;  2YUN A;  3M59 A;  4OB1 B;  2QAZ A;  5CCA A;  4ZTZ B;  2QQS A;  4ANJ A;  1M2O A;  3OS1 A;  1PSE A;  1E1O A;  1XTD A;  1YI2 Q;  2HL5 C;  3L1A A;  4C92 G;  5J3B A;  3BJU A;  1ATI A;  1I81 A;  1PNJ A;  1EIF A;  4YCV A;  1YNZ A;  4B9X A;  1GCQ C;  3OYD A;  1NLO C;  3HRK A;  2FRW A;  1UGV A;  4E6R A;  2E5K A;  4RCC A;  1Q82 C;  2DBM A;  1RAF B;  3JRZ A;  4N0A A;  2ZCF B;  2MMP A;  1KC8 U;  3RUX A;  1VQ9 T;  1KQS S;  3HFO A;  4L59 A;  1NJ8 A;  2EJG A;  2KK4 A;  4P3N A;  3OBY A;  4DEX A;  2OAU A;  4XEO A;  1H4S A;  3QYH B;  4EO4 A;  2AKL A;  4H2X A;  4J7F A;  4HCZ A;  3M0U A;  1YWP A;  2IPO B;  1UGS B;  2K3Y A;  2SEM A;  1P92 A;  5GJV B;  4FSX A;  1AWO A;  4HVW A;  4YYE A;  4M77 G;  3LWH A;  2ODR C;  4N4I A;  2HQE A;  3S3N A;  3MKD A;  4X1V A;  1OV3 A;  2A7Y A;  1VQM A;  3NPF A;  3JCM V;  3M0P A;  4A4F A;  1M5Q 1;  4OGE A;  4WI1 A;  3UDC A;  1WFW A;  3RDV A;  2QA4 Q;  1NJ5 A;  1FMV A;  2HSE B;  2EYZ A;  2W0Z A;  1U3O A;  4RDX A;  2JTM A;  1QVG S;  2L0A A;  1FYF A;  2XGT A;  1F1B B;  1SF9 A;  4K11 A;  4LUE A;  2PVD B;  5IXB A;  3TUP A;  3GF5 A;  3OMC A;  2KYM A;  3CC2 T;  5DLQ E;  4BAC A;  1X56 A;  4FT2 A;  5KYX B;  1VA7 A;  2RK1 A;  4JJD A;  1Y7X A;  2PUK B;  4RTT A;  4R56 A;  1PWT A;  1A0N B;  2RHX A;  4PJO D;  1Y57 A;  2EQI A;  2RHU A;  1KQS P;  3UGQ A;  3PZC A; 
#chains in the Genus database with same CATH homology
 1J5W A;  2D0Q B;  2PUO B;  4YRI A;  1YCY A;  5IN1 A;  4KBM B;  2MAM A;  2LX9 A;  4N4H A;  3E9H A;  3CPW S;  2JUF A;  3TEG A;  2RHZ A;  2PU9 B;  2I4N A;  2PVO B;  4P74 A;  1VUB A;  3ZEH A;  3M57 A;  2CZ0 B;  2DXT A;  2MWP A;  3OW2 A;  1S72 T;  5DY9 A;  3G6E A;  2F5T X;  1N9S A;  5HK3 A;  5DM7 R;  4X5O A;  1LJO A;  1K73 U;  4H02 A;  4C8Q D;  1RI0 A;  1USY C;  2ZR3 A;  2RI3 A;  3NTH A;  3ME9 A;  2Q5I A;  3CEY A;  4CS3 A;  3M54 A;  2EJF A;  3OYE A;  3CCU A;  1NJ2 A;  3EFS A;  4ME7 A;  1OI1 A;  5KE2 A;  3VQV A;  4HWT A;  4MDW A;  3INZ A;  3NTI A;  2RH2 A;  4J7I A;  4Z02 A;  2A8E A;  4P3P A;  4OP0 A;  3L4G B;  1I5L A;  1WJQ A;  2E10 A;  4A4E A;  4PNO A;  3DSQ A;  2LT4 A;  1ADJ A;  3G6E T;  1YIJ T;  1QVP A;  4YCW A;  4YRM A;  2QHV A;  1NE8 A;  1M9S A;  2HD0 A;  3CC7 A;  2RO0 A;  4FT4 A;  2R5M A;  2FB7 A;  2EWN A;  4C92 C;  2M9U A;  3HKS A;  4FIB A;  2P0P A;  11AS A;  3L2Q A;  4M77 B;  1BYM A;  3MF2 A;  3CCU T;  5CIU A;  2EL9 A;  4ZN1 A;  3CBM A;  1VQO A;  5C53 B;  2BKD N;  2LQK A;  5GAN 4;  2GCX A;  4QVZ A;  3JB9 G;  1WGS A;  5FU6 B;  2HAX A;  2WAC A;  2VUB A;  3LWI A;  1LOJ A;  1I8F A;  3VQW A;  1VQ4 T;  1D3B B;  3HRS A;  4X9C A;  1QVF S;  3HXV A;  4JS5 A;  3P8B B;  1KG1 A;  1KMN A;  3CC7 T;  3HFN A;  1NZ9 A;  4XTY A;  4C0D C;  3CCJ T;  4LDW A;  4BE1 A;  2E5A A;  4K88 A;  2ZIN A;  1HTT A;  2JZ2 A;  3Q1J A;  2CIM A;  4M7A E;  2VGM A;  2VGN A;  1B70 A;  4XU1 A;  4M78 E;  1KD1 U;  1Q7Y C;  4Q6G A;  3M4Q A;  5D6Y A;  1WLE A;  3MP1 A;  4BY6 B;  1Q81 C;  2FYK A;  1R8O B;  1FWZ A;  2ALY A;  2LCL A;  1USY A;  1X54 A;  1Y96 B;  4A4H A;  2G3R A;  4KUL A;  1HK9 A;  3LLR A;  5A0L A;  3S6W A;  2XDP A;  5I2M A;  4CH5 A;  3BW1 A;  2DZ9 A;  2QI2 A;  4LDY A;  2RHQ A;  3SB2 A;  5GAO q;  5GMK j;  2Y90 A;  3G71 A;  4LVL A;  1E22 A;  1N6A A;  3JCM J;  4PJO C;  4J15 A;  5GAM d;  4M7A F;  2KDS A;  4M78 F;  5FLX E;  3JCM X;  4XTV A;  3SWN B;  3G4S A;  3CCV T;  2QEX A;  2DIG A;  4JLG A;  3MP8 A;  4C92 A;  4M7A G;  4OB2 B;  3I56 T;  3PMT A;  3X24 B;  2DIQ A;  2J3M A;  2HNI A;  3QTC A;  2CZ6 B;  2EQM A;  3NEM A;  4RKU E;  2VXF A;  3HFZ A;  4EMH A;  2ZPB B;  2DU7 A;  4XEM A;  4KT0 E;  2K3X A;  5GAN 8;  4C8Q C;  4JRK A;  3HXZ A;  1YIT T;  2O4X A;  2CKK A;  2Y4X A;  4CH4 A;  2E41 A;  3A5Z B;  2HQX A;  2LTO A;  3FC3 A;  3RAC A;  3JAM E;  3ICA A;  1SRY A;  3G4S T;  3HSB A;  2L3R A;  3CCE T;  2QEX T;  3VV0 A;  4PG3 A;  4MDX A;  3MHX A;  1YGB A;  2DK3 A;  1H4T A;  3CD6 T;  4HT4 A;  4YRS A;  3WVE B;  3V7C A;  4HWR A;  3ASK A;  4H2Y A;  3VKI A;  1YJN T;  3JCM d;  5GAN d;  1G3W A;  4NS5 A;  2Q7G A;  2K5L A;  4E7J A;  4QQD A;  4M75 D;  1B7Y A;  3HY1 A;  4UP9 A;  1YFS A;  1B8A A;  4H2X B;  2QQR A;  3CCR T;  3JB9 J;  5GAN 7;  1V29 B;  2LVM A;  1H4Q A;  4RMF A;  4QW2 A;  1YB3 A;  5C51 B;  2M1H A;  4JUV A;  4BD3 A;  2QQB A;  2O01 E;  1M1K U;  1WPY A;  3FDR A;  3UH0 A;  2EFI A;  1NJI C;  5GAO n;  1N9R A;  3C4S A;  3KUF A;  3X28 B;  5CKD A;  1PYS A;  1AHJ B;  2IY5 A;  1M8V A;  4CRI A;  1VQN A;  1M4Z A;  4MZM A;  1BKB A;  2RM4 A;  3OS0 A;  3WXM B;  4LDV A;  1JJ2 A;  4DOW A;  2K4Y A;  4BDZ A;  4Q5W A;  4IUT A;  5LJ5 f;  1LYL A;  2CJA A;  2LT1 A;  1SSF A;  2FL7 A;  4V2S A;  3M58 A;  3S3O A;  4P72 C;  4BE0 A;  3NET A;  2GF7 A;  4P73 C;  1K8A C;  2RJE A;  3IKM B;  5GAM f;  3J7A F;  1YFR A;  3CMA T;  4C8Q A;  4M7D D;  4WJ4 A;  4J5Y A;  5LJ3 f;  3VQY A;  4QVD A;  3MP6 A;  3C94 A;  1G51 A;  4LNS A;  2VV5 A;  4XTZ A;  3OMG A;  3QJY A;  3LSS A;  3KBG A;  3DB3 A;  2A3L A;  2P5I A;  5LJ5 j;  4M7A C;  3LGF A;  4M78 C;  4XK8 E;  3M4P A;  3CXC S;  2BIV A;  1YJW T;  2J3L A;  1WJR A;  3QHS A;  4C5I A;  1VQ6 T;  3HPW A;  4XU2 A;  2NS6 A;  4DOV A;  3PIP A;  2CYZ B;  4ELZ C;  3VBB A;  2OTJ T;  1YJ9 A;  2V8I A;  4LVI A;  5LJ3 j;  4C5G A;  4TWA A;  5E3I A;  4OB3 B;  3HRT A;  3BDL A;  1N8R C;  4QVC A;  1BI0 A;  3RKY A;  4LVJ A;  4P75 C;  3N5B B;  3CCL A;  5GMK e;  2K5I A;  2RD1 A;  2ZIM A;  2DXB A;  2OTL T;  1BBU A;  3MO8 A;  2KY9 A;  2WSC E;  4BB7 A;  4DQ2 A;  1I4K 1;  4XTW A;  1NPP A;  3VQX A;  4BE2 A;  2E5Q A;  2JN0 A;  5ELO A;  5GAN f;  3DKM A;  4M77 D;  1X01 A;  3FRN A;  3J80 E;  1NJ6 A;  3TEH A;  3BDU A;  3C12 A;  1UGR B;  4C5H A;  4IKF A;  3V8L A;  4PJO E;  4BWA A;  4C0G A;  1VIF A;  5D6X A;  3MEU A;  5HKC A;  3R6O A;  4J83 A;  2EQU A;  2IVW A;  2K5F A;  1NYQ A;  2ARU A;  4KR2 A;  5CKE A;  3VUB A;  4HCC A;  3JCM b;  1HXD A;  1QP2 A;  3CMQ A;  3HL8 A;  4PLL A;  2RA2 A;  1W4S A;  3A32 A;  2RHI A;  4L5G A;  5IAY A;  3UPU A;  1VQK A;  3HXW A;  2CJB A;  2B8A A;  4P72 A;  4M75 C;  3QZ9 B;  4FM4 B;  4P73 A;  2DXU A;  2EKO A;  2DZC A;  4BW9 A;  3DB4 A;  3RMS A;  4BI4 A;  3M55 A;  4ZTU B;  2L8D A;  1B70 B;  1VQM T;  4YRT A;  4ZIB A;  3A7U A;  4C8Q E;  4PJO F;  1YI2 A;  2ALY B;  2F5K A;  4R55 A;  4YRR A;  5CKB A;  4YRE A;  2ZPE B;  4M7A A;  5GMK h;  4M78 A;  2PVG B;  4OB0 B;  4PJO G;  3M56 A;  1KMM A;  5GMK m;  4FU6 A;  3PCO A;  2NLU A;  4BUG A;  2RHQ B;  3SFM A;  3EFR A;  4P71 C;  3HRU A;  5A2Q E;  1X2G A;  2D6F A;  1G5H A;  1U1T A;  1XOV A;  2HBP A;  4P75 A;  3OB9 A;  4PLI A;  4C8Q F;  3E9G A;  1RL2 A;  3MEW A;  3HXU A;  4C92 B;  3QPH A;  2QA4 A;  5GAN 3;  3PIO A;  5HK0 A;  5AYF A;  3W3S A;  5FU7 C;  1B76 A;  2M16 A;  1QW1 A;  4C8Q G;  2DVE A;  4M7D C;  1MGQ A;  3JSC A;  2C8M A;  2ZT8 A;  2VXE A;  2QTX A;  5J39 A;  4QQG A;  3HFZ B;  4WF2 A;  2C7I A;  2EIF A;  2QXF A;  3A7R A;  4MML A;  1MHN A;  2O4X B;  3ER0 A;  3CC4 A;  1ASZ A;  3RKW A;  2R5A A;  1X2H A;  5A0D A;  4C0D B;  3QNE A;  3M9Q A;  2JVV A;  3JB9 D;  5GAO m;  4M75 A;  4J6W A;  3P8T A;  5CK9 A;  4B9W A;  4E7I A;  3P8V A;  3HTZ A;  1WYD A;  3OS5 A;  5KNN A;  5LJ5 e;  2LDM A;  4F7U E;  1B7Y B;  3DLL A;  2XU8 A;  3A8G B;  5HGQ A;  4NOY A;  5LJ3 g;  4JRQ A;  4G85 A;  2LQ8 A;  2ZPG B;  3JCM P;  3CC4 T;  1ZQ1 A;  2DPP B;  3T9N A;  3P8H A;  3CCM A;  3QO8 A;  2ZXF A;  5GAM e;  3OS2 A;  4NL3 A;  3CCQ A;  4LDU A;  1DJ7 B;  4K86 A;  1VQO T;  3A5Y A;  3NTK A;  5LJ3 e;  1W2B S;  4P71 A;  4CH6 A;  4OLF A;  5FU6 C;  1B34 A;  1OZ2 A;  1Q81 U;  3IAL A;  4HWO A;  2ZTG A;  4CS2 A;  1PYS B;  3CBO A;  2IY5 B;  2E6Z A;  2ZNI A;  3ERR A;  1ZBX A;  5C0M A;  4F7U F;  2ZR2 A;  2PQW A;  3QDR B;  2AMC A;  4TVW A;  1KOG A;  4M7D A;  2LCC A;  4F7U G;  2QHS A;  4GLK A;  1Q86 C;  4C5E A;  1KQS A;  1K9M U;  5KCH A;  3TRE A;  2XI9 A;  3A8H B;  3OYG A;  5CQY A;  2D9T A;  3QSU A;  1UB4 A;  4PL6 A;  2RJF A;  2ZIO A;  2E65 A;  4IUR A;  4C8Q B;  2WSE E;  5LJ5 h;  3NFC A;  3OYF A;  4M78 G;  4PKC C;  2XIC A;  2MI6 A;  2GFU A;  1YHQ A;  4QQ6 A;  5GAN e;  3MEY A;  3TCJ A;  1BIB A;  1VQL A;  4XQ3 A;  2ART A;  1ASY A;  3QUI A;  1QVG A;  3C95 A;  3G71 T;  3FB9 A;  3JCM Q;  3QZ5 B;  3SDZ A;  5LJ3 h;  3DLM A;  4M75 E;  4BDY A;  5CKF A;  1O9S A;  3OYL A;  3A31 A;  3JCM W;  3SD4 A;  2VC8 A;  3OSS C;  3URG A;  5CO7 A;  4NCX A;  2DO3 A;  4TVA A;  2KSS A;  4HT8 A;  5KH6 A;  5IT9 E;  1EIY A;  1Y71 A;  2XTI A;  1HC7 A;  2XDD A;  4YDQ A;  3ZBD A;  3CPF A;  3GLX A;  3V7R A;  4YRL A;  4IUQ A;  2DD5 A;  3CPW A;  5LL6 S;  2DTO A;  1WQ7 A;  3GIB A;  2WSF E;  3OW2 S;  5CAI A;  5K1X A;  3CCS A;  3RKX A;  2DAQ A;  4XTU A;  3TEH B;  4A54 A;  2XID A;  4M75 F;  3HY0 A;  2V8K A;  5I2S A;  4O5V A;  1UGP B;  3MF1 A;  3LW5 E;  3I55 A;  4JLI A;  3OD1 A;  1L0W A;  4M75 G;  2FHD A;  3OA6 A;  3OSV A;  4TTV A;  1YBY A;  2V8J A;  2JNG A;  3HXX A;  3CME A;  4HA8 A;  3QO3 A;  4PJO A;  3OYB A;  3AHU A;  3I7F A;  1M1K C;  2PMF A;  1NJI U;  1M90 C;  4M7D E;  4H2T A;  3PNW C;  3VYH B;  3E9F A;  3OY9 A;  1VQ5 A;  1O75 A;  3RF1 A;  2E64 A;  4F7U B;  4C0F A;  1NJ1 A;  3NEL A;  1QF6 A;  4YRC A;  2BUD A;  4AH6 A;  2QHT A;  3S3M A;  2YRV A;  1EQR A;  2ARS A;  4EMG A;  4J8O A;  1KHI A;  3PMI A;  4M7A B;  2YLB A;  4M78 B;  2XHC A;  4ZGE B;  3CME T;  3RMQ A;  1VQ7 A;  2CZ7 B;  3QYG B;  4UPA A;  3PCO B;  2CZ1 B;  4GY5 A;  1K8A U;  3BFM A;  1N9W A;  3REU A;  1JB0 E;  4D6W A;  4M7D F;  3LC0 A;  1VQN T;  3GNF B;  4UC4 A;  3QXE B;  3JCM c;  2EQK A;  2LNV A;  1QVF A;  5D6W A;  2ZZE A;  1X6O A;  3FIF A;  4IUU A;  4M7D G;  4YRN A;  4EMK C;  4EX5 A;  2KVQ G;  4E7L A;  1Z7M A;  1VQ9 A;  5GAM j;  4C92 D;  3LGL A;  4MZT A;  5CVI A;  4A4G A;  5GMK i;  3L2Z A;  4P3O A;  2I4M A;  3GP8 A;  4J6Y A;  4HWP A;  2XG8 D;  5FRN A;  2E1H A;  4P5N A;  1BI2 A;  3OQ5 A;  1Q82 U;  1N8R U;  4JJN K;  5GAN 5;  4KQE A;  3JCM f;  1KC8 C;  1IL2 A;  2YHT A;  3IG2 A;  4TQD A;  2M0O A;  2L89 A;  2G4C A;  3X25 B;  4YPF A;  3L2V A;  2P4T A;  3A8O B;  3L2U A;  4OMF B;  2QHU A;  5M9O A;  4YRK A;  4M75 B;  4M77 F;  1G5V A;  3CC2 A;  2EQJ A;  3E1S A;  3OYI A;  2DJZ A;  2QQA A;  2XK0 A;  3E19 A;  4X9D A;  1YJ9 T;  4N4G A;  4LD6 A;  4TQF A;  4YRG A;  4RG8 A;  1Y07 A;  2I4L A;  2P0K A;  3M5A A;  4O6J A;  3CCL T;  1EVK A;  3HRI A;  5K1P A;  1XQH A;  4HT9 A;  2DDZ A;  2ZZD A;  5I21 A;  3WQZ A;  4EPC A;  2MWO A;  2K57 A;  5GAN j;  4II1 A;  2H3J A;  1EOV A;  1Z7N A;  1VQP A;  3G7Z A;  2CS7 A;  3E9I A;  5GAN 2;  4ZGJ B;  2L5Q A;  4F7U A;  1VQZ A;  1VQ8 A;  2X4Y A;  2P0Q A;  3OYK A;  4YTL A;  1BI3 A;  2DTI A;  2LC4 A;  4K87 A;  2PME A;  1RIQ A;  1S72 A;  3HFV A;  1TH7 A;  3PT9 A;  3OYJ A;  1JJC A;  2ZT7 A;  3V8K A;  3X26 B;  1FX7 A;  1B34 B;  1EVL A;  2DXC A;  2K2V A;  2DEQ A;  4EMK A;  4E7H A;  4HKE A;  3GPL A;  4XU0 A;  2RHS A;  4ZN3 A;  4OGC A;  4CH3 A;  5EG2 A;  4RMO A;  1VQK T;  2AMC B;  4ZTF A;  3RGL A;  4G84 A;  1IRE B;  1VQP T;  1UEB A;  5FU7 B;  1NPR A;  1LNX A;  4M7D B;  1M1F A;  4LVM A;  3M53 A;  5A0G A;  1VQ8 T;  4ZGD B;  2ZZF A;  2RJD A;  4E51 A;  1K73 C;  3VJP A;  1SES A;  3NEN A;  1YIJ A;  3HHT B;  3R07 A;  1YI2 T;  4Q15 A;  3LYI A;  2JTF A;  4ZTJ A;  3WVD B;  2VYT A;  3QG1 A;  1YFT A;  4X34 A;  2ZPF B;  3MCA B;  3O8V A;  2XKO C;  5GAO r;  2AKW A;  5CKH A;  5C6S A;  3OYM A;  3RER A;  2CJ9 A;  2I2L A;  3MQZ A;  2C06 A;  3OYA A;  3UGT A;  3IKL A;  2EAY A;  3VU3 C;  4HWS A;  1VQ4 A;  1JJ2 S;  1BIA A;  4A53 A;  1JBM A;  3M4Y A;  2DQ3 A;  1NYR A;  2DTH A;  2E6N A;  4L87 A;  5LJ5 g;  2QA4 T;  3CCJ A;  5FRM A;  4TVA B;  4UP7 A;  2Q7H A;  3MET A;  5CQX A;  1EIY B;  3HXY A;  3UWN A;  3LH0 A;  3JB9 F;  2ZZG A;  3QO7 A;  2I4O A;  5GAM g;  4YP0 A;  2DQ0 A;  2DU5 A;  5KE3 A;  5GMK l;  2E70 A;  1W66 A;  4YCU A;  4OVA A;  2LRQ A;  4DPG A;  2KMT A;  4PHC A;  3UT1 A;  4M77 C;  4VUB A;  4YRF A;  3A8L B;  2ZPH B;  2XDB A;  2AHJ B;  4JDS A;  4LVK A;  3GOX A;  3RIR A;  5HY6 A;  4E47 A;  4KR3 A;  2QDY B;  3CXC A;  4H2U A;  2E3C A;  2RHY A;  4MMK A;  1KD1 C;  1Q7Y U;  2GQV A;  4PJO B;  3VYG A;  4XAX B;  3A8M B;  4BI8 B;  3OYC A;  12AS A;  3L2W A;  4LDX A;  3L2R A;  3A7A A;  3CCV A;  1M1G A;  4JS4 A;  3J81 E;  4KUD K;  1G3Y A;  3CCM T;  3I56 A;  3CCQ T;  2ZPI B;  1NNH A;  1XNI A;  4KUI A;  3LX7 A;  5LJ5 d;  2XD0 A;  3JCM g;  1U8R A;  5GAN g;  4E7K A;  3X20 B;  3OYY A;  1SER A;  4FL6 A;  4MZP A;  1Q86 U;  2RK2 A;  4M7A D;  2GFA A;  4BY6 C;  1KQ2 A;  1KHC A;  1K9M C;  2RB6 A;  4M78 D;  3QJ6 A;  5GAO l;  2R57 A;  5ELN A;  4J6X A;  1YIT A;  4OF1 A;  5GAN 6;  2F69 A;  1E24 A;  4JRP A;  3JCM e;  1IZ6 A;  4RCB A;  4UP8 A;  4JRI A;  1X75 C;  3H6Z A;  5LJ3 d;  3CCE A;  3JB9 I;  2FVU A;  5GAM h;  2X4J A;  2X4X A;  3CD6 A;  2EJ9 A;  3OYH A;  1UGQ B;  1U1S A;  3H8Z A;  2EYQ A;  3L4G A;  2CGH A;  3LSQ A;  1H64 1;  1YJN A;  5L8R E;  4IUP A;  4NL2 A;  3SWN C;  2ZNJ A;  1KQ1 A;  3QO5 A;  3PGG A;  3MEA A;  1QE0 A;  2Q5H A;  2Q7E A;  3CCR A;  5J26 A;  3PTA A;  3VUZ A;  3L42 A;  4M77 A;  5FRO A;  1YHQ T;  2ODR D;  4ATO A;  2KAF A;  3FLG A;  2E12 A;  3P8D A;  1G3T A;  3F70 A;  1VQL T;  1E1T A;  3GNG A;  1N27 A;  4Y91 A;  4CS4 A;  1GXI E;  1GGM A;  3BY7 A;  3V7S A;  1WQW A;  4XTX A;  4XU3 A;  3G1Z A;  1JRI A;  3KFU A;  2P0L A;  4HCB A;  1D3B A;  3FEO A;  3HP9 A;  4HVC A;  4O2D A;  4TVR A;  1EFW A;  4L6V 5;  3QBY A;  1SET A;  1WNL A;  3JCM h;  2RJC A;  5GAN h;  4A4K A;  4H2W A;  2X35 A;  1BI1 A;  3TEE A;  3P8Y A;  4DA4 A;  1X55 A;  2ZGW A;  4RG2 A;  1OZ3 A;  3ZFJ A;  3QKJ A;  4N0A C;  3REX A;  4YRQ A;  2MF2 A;  4YRJ A;  2YLC A;  2KQW A;  5F5W A;  5CR2 A;  4H2V A;  4CI0 C;  4RQF A;  5C52 B;  1BBW A;  3CCS T;  3KXT A;  1M90 U;  3CMA A;  3OBW A;  2IG0 A;  1Y96 A;  4WJ3 M;  4TVY A;  1WU7 A;  4RQE A;  5KCO A;  3I55 T;  1JJC B;  3RL6 A;  1H4V B;  1FXX A;  2RI2 A;  2ZCE A;  1OYX A;  3RES A;  1ZHI A;  3A74 A;  3TU4 K;  4EMK B;  1VIE A;  4C92 E;  2RHS B;  2DKG A;  4ELY C;  1G3S A;  2ZT5 A;  4Y28 E;  1YJW A;  1ADY A;  4YRO A;  4C0Z A;  3SWN A;  1VQ6 A;  1VQ5 T;  4IUV A;  4LD9 K;  3V8J A;  3QII A;  2OTJ A;  2X4W A;  1WJS A;  5DLO A;  1G5I A;  1C0A A;  3UFG A;  2QQ9 A;  2R58 A;  3M4G A;  2Y4Y A;  3JB9 H;  3PFS A;  4BI3 A;  2JOY A;  4YRP A;  4M77 E;  2OTL A;  4H2S A;  2RI5 A;  5GAO p;  3MEV A;  4EDU A;  1VQ7 T;  4P74 C;  3EAE A;  3FJP A;  3CBP A;  2DD4 A;  4C92 F;  1QP3 A;  2AKW B;  1H3Z A;  2ZT6 A;  3A5Z A;  1W2B A;  3OYN A;  1PSF A;  3M59 A;  4OB1 B;  5CCA A;  4ZTZ B;  2QQS A;  3OS1 A;  1E1O A;  1PSE A;  1XTD A;  3L1A A;  4C92 G;  5J3B A;  3BJU A;  1ATI A;  1I81 A;  1EIF A;  4YCV A;  4B9X A;  3OYD A;  3HRK A;  1Q82 C;  4RCC A;  3JRZ A;  4N0A A;  2ZCF B;  2MMP A;  1KC8 U;  3RUX A;  1VQ9 T;  1KQS S;  3HFO A;  4L59 A;  1NJ8 A;  2EJG A;  2KK4 A;  4P3N A;  3OBY A;  2OAU A;  4XEO A;  1H4S A;  3QYH B;  4EO4 A;  4H2X A;  4J7F A;  4HCZ A;  2K3Y A;  1UGS B;  1P92 A;  4FSX A;  4YYE A;  4M77 G;  3LWH A;  2ODR C;  4N4I A;  2HQE A;  3S3N A;  1VQM A;  2A7Y A;  3JCM V;  4A4F A;  1M5Q 1;  4OGE A;  4WI1 A;  3UDC A;  1NJ5 A;  4RDX A;  2JTM A;  1QVG S;  1FYF A;  2XGT A;  2PVD B;  3TUP A;  3GF5 A;  3OMC A;  3CC2 T;  5DLQ E;  4BAC A;  1X56 A;  4FT2 A;  2RK1 A;  1Y7X A;  2PUK B;  4R56 A;  2RHX A;  4PJO D;  2RHU A;  3UGQ A;  3PZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...