2EAYA

Crystal structure of biotin protein ligase from aquifex aeolicus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLCELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
total genus 66
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2007-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eayA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2eayA01
1MGQA 5GMKj 3LC0A 4CH6A 2E65A 3HRIA 1KMMA 5LJ3g 4M78G 4G84A 3MF1A 1EVKA 4TWAA 1BBUA 1NJ8A 2Q7EA 3HTZA 4YCVA 1BIBA 4P3PA 4XTYA 5GAMf 4YREA 5GANe 3AHUA 4C8QA 3HFOA 4YRKA 1X54A 2DXUA 3WQZA 2ZTGA 1H4TA 4G85A 4P3NA 4P71C 3RL6A 4M7AC 2RHQA 4EMKA 1H641 1PYSB 4XTZA 3ICAA 4Q15A 5I21A 4H02A 5ELNA 3EFSA 3V8KA 2ZCEA 3RUXA 4N0AC 4F7UF 5LJ5f 2IY5B 1TH7A 2ODRD 4YPFA 5GANg 1EIYB 3HFNA 5KNNA 1BIAA 4V2SA 4HWSA 2ZZFA 5CAIA 4F7UB 4H2XB 2RHSB 4P73A 1C0AA 2E10A 3TEGA 1Y96B 2ARUA 4JUVA 1B8AA 1I5LA 4M7DE 2Q5HA 4K86A 4TQFA 5GAMg 1HXDA 2CIMA 3NENA 5LJ3f 3SWNB 5GAN7 2YLCA 4EX5A 4H2VA 1E1TA 2ZIMA 1SERA 2I4LA 5C51B 2AMCA 4M77F 4C92E 4P71A 4P3OA 4C92G 2EJGA 2VC8A 5GAN3 3JB9H 1E1OA 4HT9A 3GIBA 2DZ9A 3VU3C 3BFMA 5ELOA 1RIQA 4C8QC 4TVAA 3QO3A 4TTVA 2EJ9A 4PG3A 4X5OA 3V7SA 3G1ZA 4KQEA 4YRSA 3TEHA 1G5IA 4M77B 3JB9J 4YRJA 4HWRA 4PNOA 1JJCA 3HXUA 4M7AA 1LYLA 1QE0A 2ALYA 1N9RA 2FYKA 4J6XA 2P0LA 3EFRA 4C8QB 1ADYA 2EL9A 3E9IA 5GANf 5GAN5 1Z7MA 4M7AG 3HRKA 4HA8A 3FIFA 3HXWA 4NL3A 4PJOC 2QHTA 3HFVA 1SETA 4P75A 5HGQA 1KQ1A 2QHSA 4M75A 2C7IA 2E3CA 4CS4A 2AKWB 4ZTUB 4DQ2A 2RA2A 2EJFA 3JCMP 4M75G 5LJ5e 3HXVA 1I4K1 2E41A 5GMKe 5LJ3j 2ZXFA 1D3BB 4RQEA 4J6YA 1N9WA 1X2GA 1EVLA 3A7AA 3HXYA 1SESA 2ARSA 3QO5A 4KR3A 5DY9A 1W66A 2Q7GA 3REUA 4M78D 3LSQA 4DPGA 4XTUA 2FB7A 3JCMc 3A74A 4TQDA 1E22A 3P8VA 4K87A 5GANh 3V8JA 2XTIA 3PCOB 1YFTA 2ZR2A 4YRQA 4M7DA 4JLIA 3RF1A 3QUIA 3KFUA 4M75D 1VQZA 4H2TA 3JCMV 1GGMA 3L2ZA 4YRTA 1H4VB 2P5IA 3HSBA 2DTIA 4M75B 3IKMB 4RQFA 3RACA 3MF2A 4F7UE 4C92A 3OD1A 3JB9I 3MEYA 3UFGA 1JRIA 2ZNJA 1YB3A 4OLFA 1NJ2A 4RDXA 2DEQA 4M7DD 3QTCA 3JCMJ 2HNIA 1ASYA 3SWNA 1SRYA 3QSUA 4N0AA 4J15A 5GAOp 2ALYB 5LJ3h 3UH0A 3VQWA 3HY0A 5LJ3d 1JBMA 2RHQB 2Y90A 2Q5IA 4M7AF 3HFZA 2CJ9A 5GAOm 1EOVA 4WJ3M 4M78E 4YRFA 1B34A 2RM4A 1BBWA 2I2LA 4TVWA 3BY7A 2CJAA 3FJPA 5GAN2 1KOGA 4YRCA 1EIYA 1H4SA 1Z7NA 2DTHA 3RKWA 4EMKC 1JJCB 4PJOE 3HXXA 4YCUA 5C52B 5GAOr 3RERA 3SWNC 3JCMd 4PJOA 2ZZEA 4YRPA 5F5WA 2DXTA 4XU3A 3JCMW 2YHTA 3VQXA 4O2DA 2G4CA 1YFRA 4A54A 4YCWA 4OP0A 2CGHA 3JCMb 5GANd 1N9SA 4J6WA 5LJ3e 2RD1A 2DZCA 4UP7A 5GAMe 4YP0A 4RCBA 2YLBA 4JRIA 4PHCA 2DQ3A 5GAMh 3JB9G 4QVCA 4C8QE 3I7FA 4CS3A 3V7CA 3TEHB 4M78C 1X56A 4F7UG 1EFWA 11ASA 1HK9A 3BW1A 4PJOD 4F7UA 2ODRC 4NOYA 4EMKB 1Y96A 4PJOG 4YRNA 3HY1A 4PJOB 3NEMA 4XU2A 3NETA 4LNSA 4UP9A 3PZCA 5K1PA 3DSQA 4QVDA 2ZT6A 4M77G 4M7DC 4M78B 4P73C 3A7RA 2AMCB 4X9CA 1NJ1A 1L0WA 4RMFA 1EQRA 3FB9A 4HWTA 2RHSA 3A32A 1J5WA 3QNEA 1LJOA 2AKWA 3L4GA 2I4OA 1X01A 2DU5A 4P72C 2I4NA 4J5YA 1USYA 5GAMj 1YFSA 1B70B 2ZIOA 4UP8A 4P74A 1WNLA 3VQVA 3P8YA 1HC7A 1WPYA 2ZT7A 4EMHA 4WF2A 3BDUA 4C8QD 1U1SA 4X9DA 3BJUA 4H2UA 5GAOq 3VQYA 4HWPA 3HFZB 1LNXA 2VXEA 4L87A 2ZNIA 4K88A 3M4GA 2J3MA 2IY5A 3QO7A 5GMKi 4E51A 4M7AD 2DJZA 3JCMQ 4EO4A 1KMNA 4H2WA 4PJOF 3A5YA 1I81A 3E9HA 3M4QA 5E3IA 1B7YA 4M7DG 3L1AA 4HVCA 4XTVA 3JCMh 3LSSA 4CH4A 3UGQA 1YCYA 4YRGA 1U1TA 2E1HA 1E24A 4H2SA 1X2HA 2I4MA 4C8QF 4Y91A 2Q7HA 3CMQA 3P8TA 4XQ3A 3IALA 5GAN6 2DVEA 4BWAA 4A53A 4H2XA 4NCXA 4M7DF 5LJ5j 1B34B 1WU7A 5LJ5d 4M77A 1G5HA 5LJ5h 4XTWA 3A7UA 2PMEA 2ZINA 1M5Q1 4M77E 4C92F 2EAYA 1WYDA 4P72A 4P75C 4JRKA 4UPAA 2K57A 4M7DB 3V7RA 4M7AE 2QHVA 2QTXA 3V8LA 1WQWA 4C92D 4TVYA 2CJBA 2ZGWA 5GANj 4WI1A 3JB9D 2EWNA 4C92B 1G51A 4WJ4A 4HWOA 4M75C 1ADJA 2ARTA 5GMKl 5C53B 4CH5A 4XEOA 3RESA 3IG2A 4Q6GA 3REXA 3R07A 4M77D 1HTTA 3ERRA 1NYRA 4CH3A 1X55A 3IKLA 3QO8A 4ZIBA 1IL2A 4YDQA 5GAN8 3RIRA 4YRLA 4RCCA 3NELA 3JCMf 1NJ6A 4XU0A 2ZR3A 2DKGA 5GMKm 2QHUA 1WLEA 4M78A 1KQ2A 4BW9A 5GAOn 1B76A 4AH6A 4YRRA 5K1XA 1ATIA 1I8FA 2RB6A 3SB2A 4HT8A 4C8QG 2DU7A 1H4QA 5GAMd 4M75E 3JB9F 4XEMA 4NL2A 4M7AB 3JCMX 5GAN4 3L4GB 2PMFA 1ASZA 5GAOl 3UGTA 1YGBA 4C92C 3TUPA 1B7YB 4MMLA 1PYSA 4P74C 3JCMe 4M75F 12ASA 2ZZGA 4H2YA 2DQ0A 1NJ5A 4M77C 3PGGA 1WQ7A 3VBBA 4YYEA 4ZTZB 3RKXA 5LJ5g 4CS2A 3A31A 3RGLA 3INZA 3QHSA 2ZT5A 1USYC 2VXFA 4MMKA 1NYQA 2XGTA 4YRMA 4EMGA 1D3BA 2C8MA 2E64A 2J3LA 3W3SA 3JCMg 1LOJA 4TVAB 1M8VA 4M78F 4KR2A 2DDZA 3A5ZA 2E5AA 4YROA 4YRIA 3PCOA 3RKYA 4XU1A 1QF6A 1NNHA 3M4PA 4XTXA 1B70A 5GMKh 2JN0A 2DTOA 1FYFA 3HXZA 2ZT8A
chains in the Genus database with same CATH superfamily
4IUTA 3L2QA 5GMKj 1OU9A 2YRVA 1XJWB 3HRIA 2J7IA 2DD4A 3CC7T 5IXFA 3DB4A 4TWAA 3QBYA 4FL6A 1BBUA 2QK0A 1YJ9A 2JTMA 3TEEA 1TS9A 4C5EA 4YREA 2LT4A 3OYHA 1PM3A 3CCMQ 2O4XA 4C8QA 1KHIA 1RLPC 1YBYA 1H4TA 2F2WA 1YJWQ 1G83A 4EMKA 1IO6A 5I21A 1BI2A 3EFSA 2ZCEA 3QXEB 1UHFA 4KRTA 5CKDA 1OZ3A 5KYYA 2IY5B 1TH7A 2EQIA 4YPFA 3P8DA 2YUQA 3TSWA 4HWSA 4QQGA 2XDDA 3FLGA 3T9NA 3FDRA 4D8DA 3M0QA 3GPLA 3TEGA 1YIJT 1HYOA 4JJDA 1I5LA 4M7DE 4K86A 5GAMg 1S72A 1V76A 2CIMA 3I5RA 3NENA 2YRCA 4CC4B 3G6EQ 3S3OA 2WSFE 1QP2A 1M3CA 1BYMA 1SERA 3CXCS 2P4RA 5D6XA 5C51B 4KUDK 2AMCA 4M77F 3GNGA 2HKQB 3OYKA 4CC7A 4P3OA 4C92G 2EJGA 2VC8A 5I2SA 3JB9H 4FYWB 2RQUA 4PJLA 2YUNA 1OOTA 4OB1B 1G5IA 4M77B 4KT0E 1BCOA 4M7AA 1QE0A 2GNCA 3OA6A 1PD1A 1K9MC 5CR2A 4IIOA 3CXCP 1WDXA 5KYXB 2P4TA 1EZZB 2QEXQ 4M7AG 3A98A 4BB7A 4BY6B 3HRKA 3REAB 2FPFA 4NL3A 2OTJT 3HFVA 3F70A 4M75A 2E3CA 3UT1A 2RK2A 3I5SA 3JCMP 1OU8A 3CCST 2BZ8A 1I4K1 3HXVA 4RQEA 1NEBA 3L2RA 2ZXFA 1IB8A 2QYZA 2EGAA 1X2GA 3LX7A 3HXYA 3CCMT 4KR3A 4FM4B 1B07A 1C0MA 4M78D 1YNZA 1K0SA 4FW2A 4PJJA 4LDYA 3PCOB 4RTWA 3OYFA 5CK9A 1UGQB 1NEGA 2LNVA 2RHYA 3EG0A 4M75D 1G3TA 3OMGA 4AFZC 3EG1A 2LX9A 3UA7A 2VGMA 1X43A 4R0KA 2C0TA 3IKMB 1NLOC 4OB0B 4F7UE 3H6ZA 1VYTA 4AG1C 1GBQA 5CCAA 2CSQA 2J6FA 3KFVA 3PTAA 2HNIA 2DETA 4PK4A 3ULRB 5C6SA 3MQZA 3HY0A 1S72T 2A0FB 1YITA 2DILA 1JBMA 3ZBDA 5GJWB 4DOVA 2KAFA 5IH2A 2DO3A 3I55A 2QASA 2VKNA 3WXMB 1Q7YU 2DYBA 2EBPA 4FSXA 3CCUA 3X24B 2RQTA 4L6V5 3URGA 1G3YA 3CC4T 2PQWA 1H4SA 1RAFB 5HKCA 3RKWA 1Q81R 2K4YA 1N8RU 1JJCB 1NLPC 2KT1A 2P0KA 1WYXA 5C52B 2K6DA 3JCMd 4KH1B 5F5WA 2G4CA 1YP5A 3MP8A 4OP0A 3JCMb 2NUTA 3LGFA 2LRQA 2EKHA 1H3HA 1V29B 4RCBA 3NHNA 2PNIA 1JJ2S 3I7FA 5EG2A 4CS3A 2HDAA 1OPKA 2FL7A 2F5KA 1M1KU 3TEHB 4LD9K 4F7UG 2KROA 3OYJA 3CC2T 11ASA 5A0DA 3VS1A 4PJOD 2XICA 1NPPA 2DM1A 4EMKB 3A8LB 4ME7A 2KT8A 3MJXA 1RL2A 3NETA 4JJCA 4UP9A 3EG2A 4BI3A 2A3LA 3P8HA 3DSQA 4QVDA 1ZSGA 4ZNXA 2ROTA 4M77G 1GCPA 4GY5A 2XHCA 4J9DA 4J9HA 4LNPA 4M7DC 4DBFA 1XQHA 2QDYB 4VUBA 4RG2A 4CRIA 1NM7A 5FWCA 1UEBA 1WI7A 1JB0E 2A08A 1J5WA 1QCNA 2AKKA 1MNDA 2I4OA 2I4NA 4J5YA 1USYA 1VOMA 2OX7A 3P8YA 2KYBA 1HC7A 1WPYA 2ZT7A 2G3RA 2DL7A 1U1SA 3BJUA 4FT4A 4H2UA 2E6ZA 2XG8D 4CI0C 1NYFA 2ZPGB 1X6GA 3VQYA 1CKBA 2VYTA 2DL5A 5FWBA 3GNFB 3ZL7C 3AT1B 3QO7A 4OGEA 2R58A 1VQ7Q 4M7AD 4H2WA 1AZGB 1VQ9A 3A5YA 1I81A 2A37A 1QCFA 1M8MA 2COYA 4M7DG 2VASA 2EYXA 4L59A 1TG0A 2LJ1A 3LSSA 4RTVA 3UGQA 2KNBB 1YCYA 1VUBA 1E24A 4KGVB 2RPNA 3QZ5B 3DLLA 5KYWA 2MK5A 2Q7HA 3P8TA 3OW2P 3IALA 1VQMA 5IHIA 2WACA 1MHNA 1Z9ZA 5GJVB 1B34B 3QYHB 1D0ZA 1WU7A 1RI9A 5LJ5h 3A7UA 1M90U 4F14A 2B8AA 4BUGA 4NS5A 4M77E 2DIGA 1KSWA 4P75C 4JRKA 4AG2C 2K57A 1OX9A 3SFMA 1PRLC 3OYMA 4ZTJA 4PJNA 1WQWA 4TVYA 4X34A 1WFWA 2K7AA 2RQVA 3H0FA 4WI1A 2K5FA 1W70A 1K9AA 3QJ6A 4LVIA 4WJ4A 5C53B 4EPCA 1MMNA 4A63B 4OMFB 4HT4A 1NYRA 1X55A 4FYYB 2KXCA 3QO8A 3DKMA 1X2KA 1SSHA 4YRLA 2JTEA 4HKEA 2K3BA 2J6KA 2DKGA 3C95A 4ELZC 2KGTA 2RO0A 1N8RC 3CPWA 1QVPA 1UB4A 2JM8A 4RTUA 2RB6A 2E3IA 3E1SA 1YWPA 5EC7A 5GAMd 4FT2A 2LJ0A 3JCMX 5GAN4 4E7IA 3L4GB 1TSFA 4Z02A 4OF1A 2M16A 5GAOl 2XIDA 4A4FA 4C92C 1YGBA 1I5OB 2DL3A 4WTOB 2GTOA 3TUPA 1Q81U 1N8RR 1S1NA 4AFUC 3CCJA 1D0XA 2DQ0A 1VQ9Q 3EG9B 1UGPB 3VBBA 1WQ7A 3QJYA 5ECAA 1YWOA 3RKXA 3A31A 3INZA 1GRIA 1USYC 4YTLA 2M1HA 2VXFA 3TREA 2XGTA 2E64A 2J3LA 4ZTFA 4DBRA 1LOJA 5FRMA 3M0RA 1YJWT 1AHJB 4M78F 1EIFA 2DDZA 4ESRA 3CC2Q 1YHQA 2D8JA 1UJYA 3M4PA 4JS5A 4PJMA 2QGGA 3META 1MGQA 4QQDA 2COWA 1PCXA 3KXTA 1GFCA 1UTIA 2QTVA 4WCIA 3VYHB 4C0DC 1I1JA 2MIOA 4HCCA 4M78G 4G84A 2J06A 1KQSA 2Q7EA 3HTZA 2DEUA 4D6WA 3VS6A 4XTYA 5D6WA 3PE0A 2DD5A 4YRKA 1X54A 2E70A 1N6AA 3PT9A 2ZTGA 2I0NA 4ZN1A 4P3NA 2RF0A 3RL6A 4E6RA 2KMTA 1OYXA 2X51A 4H02A 1M90R 3V8KA 2RH2A 3I35A 3OBWA 3J81E 2ODRD 2MAMA 4JLGA 2D6FA 1AVZC 3HFNA 5KNNA 3OY9A 5CO7A 1R0CB 1K76A 3CPFA 2J6OA 4F7UB 4H2XB 3TQ7P 2E10A 1Y96B 2RNAA 2EGEA 2QA4T 1QVFS 2DK3A 1Q95G 3CEYA 4DBQA 2HBPA 5FW9A 1D09B 1HXDA 4JZ3A 2GF7A 1VQPT 2I4LA 4P71A 2IIMA 2X4WA 3ZFJA 1WIEA 3MPUB 1RIQA 4TVAA 3QO3A 4EIKA 2Y4YA 4X5OA 1MUZA 3G1ZA 1X27A 1I0CA 3LYIA 4HWRA 3HXUA 1JJCA 2K5IA 2ZZDA 1N9RA 2P0LA 2RI2A 1U8RA 2O4XB 4C8QB 1ADYA 3JV3A 3M0PA 5D6YA 2DX1A 4AFSC 1QMCA 2MF2A 5GAN5 1PNJA 1QCOA 1VQ8Q 3HXWA 2EYZA 4OVAA 2QHTA 4JS4A 4P75A 5HGQA 1VIEA 4PL6A 3CBMA 4RTTA 3CCUQ 2HBWA 4ZTUB 1BI0A 4BY6C 4M75G 4ZGJB 3OW2S 3MO8A 2ECZA 2E41A 2LP5A 1VQOQ 3A7AA 1EVLA 4LD6A 1JJ2A 3VS2A 4M4ZA 3CCQQ 5DY9A 2EQJA 5FU7B 1U06A 4OB3B 2XU8A 4TQDA 1E22A 3P8VA 2DLPA 3V8JA 1KC8C 4M7DA 4JLIA 1N27A 3QUIA 3S3MA 1VQZA 4LE9A 3SD4A 1WXBA 3L2ZA 2NLUA 4YRTA 2P5IA 2XKOC 4RQFA 1M1KR 3U23A 1JXOA 3MEYA 4PLLA 3UFGA 1R0BG 1UG1A 1QKXA 1FMKA 1YIJQ 1YB3A 5DLOA 4OLFA 1NJ2A 2DEQA 2JT4A 2QQSA 4M7DD 4LDXA 3JCMJ 3VQWA 5LJ3d 2V8JA 1HD3A 2Y90A 3C94A 2IVWA 4M7AF 5GAOm 1VQ9T 1EOVA 2HQEA 3FRNA 1BBWA 2RM4A 4TVWA 2I2LA 2QI2A 1VIFA 3FJPA 1Y07A 1LPLA 2R5MA 4BI8B 5IXBA 3G71T 4BE2A 1AWWA 4DOWA 4B9XA 1PRMC 4F16A 2YT6A 2XI9A 4YCUA 5GAOr 3WVEB 3RERA 3SWNC 1AWXA 3UATA 4ELYC 1KD1R 3VQXA 3CC7Q 4O2DA 4IUVA 2J05A 1Q82C 2CGHA 5M9OA 3TVTA 1C1AA 4BD3A 1W4SA 4UP7A 2K3YA 2RJDA 1OX8A 3NFCA 1ABOA 2JMCA 4YP0A 1QP3A 4JRIA 3JB9G 4QVCA 3RMQA 2EYQA 3V7CA 1RAAB 1KIKA 1X56A 4QKUA 2E12A 4QVZA 2L3PA 3X25B 2X9HA 3BW1A 1VQ8A 3CMAA 3THKA 2NUPA 1KC8R 4F7UA 2BTTA 3C12A 1EFNA 2LT1A 1K0XA 2JOYA 3M0TA 4PJOG 2ZPHB 1D1CA 3PZCA 3CCVQ 3VS5A 1BK2A 2BZYA 1ZA2B 5CVIA 2YRDA 2QQBA 4P73C 3CCRA 1G5VA 3A7RA 4IUPA 4J7FA 4DEYA 2YXYA 2M9UA 1HSQA 3E19A 2MPXC 2L8DA 1LJOA 2AKWA 1X01A 2LQKA 3REBB 3G4SQ 4UP8A 4MZTA 3JSCA 4EMHA 3UWNA 5KCOA 3CCEA 4J9BA 1VQNA 4X9DA 2M02A 2OAWA 3HFZB 1LNXA 1YFNA 1YIJA 1WHLA 2ZNIA 3M4GA 2L2PA 2IY5A 3QIIA 4E51A 1VQMQ 3CCET 1M3AA 4J8OA 3PFSA 3NGPA 1KMNA 4LVMA 3E9HA 1AOJA 2E4HA 2X3XD 2JVVA 1YI2A 3TSZA 5FRNA 3L1AA 3UF4A 3OYBA 1NYGA 2LQ8A 1NJIC 2JNGA 1YN8A 3MCAB 1SRMA 3JCMh 3G6EA 4RTXA 1FMVA 5KYYB 1WA7A 2R57A 3JRZA 1SHGA 2E1HA 4FYVB 4R56A 2DFUA 1X2HA 1QLYA 1R77A 4Y91A 2MWPA 5GAN6 4BWAA 2K9GA 2KQWA 1FMWA 3NTIA 4J9GA 1P92A 4NCXA 4M7DF 1ZSZC 4LDWA 2MCNA 1ZBJA 1M1GA 2ZCFB 3I55Q 3CCQT 1H8KA 3QKJA 1UFFA 3OS5A 3RMSA 1YJWA 1QVFP 2PMEA 1M5Q1 1PWTA 1WYDA 2L0AA 4M7DB 3V7RA 4C5IA 3MEWA 2QHVA 1XOVA 2QTXA 1AWJA 1UGRB 3CCMA 2CJBA 1M4ZA 4C5HA 3CCLT 2CZ7B 1ZHIA 1IHWA 2HEQA 1VQ8T 4M75C 1X6BA 3CCJT 1ADJA 4PFPA 2JS2A 3M0UA 2PZ1A 1FYNA 4Q6GA 3R07A 2P84A 1LCKA 4HCKA 1ZUYA 3ERRA 2HL3A 2YWWA 4ZIBA 1YJNA 1IL2A 3OYGA 1GBRA 1Y71A 2RI3A 3R6OA 2ZR3A 5IHNA 4E47A 2V26A 3CMAQ 1QVGP 2L89A 1PSEA 1SEMA 5I11A 5K1XA 3IQLA 1ATIA 1W1FA 2DF6A 4QW2A 3SB2A 2V1QA 3VUBA 2W0ZA 1GFDA 1H4QA 1K8AC 2EVRA 2BKDN 1TU0B 4M75E 2DPPB 3HRTA 3JB9F 2QDLA 4PKCC 1X75C 2DBMA 5IAYA 1OQKA 2DRKA 1ASZA 4RTYA 3M53A 4MMLA 1B7YB 4P74C 5CKHA 2HQHA 2QEXA 2KY9A 2VVKA 1E6GA 1Q86U 4YYEA 2C0IA 2P0PA 5LJ5g 3VRYA 1UGVA 4MMKA 1NYQA 4QQ6A 4EMGA 1SPKA 2EFIA 2GCXA 4AFQC 2E5KA 4TVAB 2NS6A 4KR2A 1AZEA 1Q82U 1DJ7B 2H3EB 2RHIA 3PCOA 5KYNA 3RKYA 4XU1A 1QF6A 1M30A 4XTXA 1SRLA 1PKSA 5GMKh 3M9QA 3CCVA 2IG0A 3OYYA 1FYFA 2ZT8A 2D9TA 4BI4A 1K9MR 1K9MU 2NUTB 3LC0A 3H9NA 2D0NA 3J80E 3UPUA 1QKWA 4RG8A 2A7YA 5FU7C 1VQ6Q 3MF1A 3MKDA 2VV5A 1BIBA 5CQYA 5GANe 3A5ZB 3AHUA 1Q82R 3HFOA 4LVJA 2M51A 2D8HA 2DXUA 2DBKA 2MMPA 3CPWS 2HKNA 3OB9A 4P71C 3A1PA 1KD1U 2QXFA 1PYSB 4XTZA 1TXQA 1X6OA 1YITQ 3OSSC 3RR6A 3CCJQ 5ELNA 3UDCA 1X2QA 2NUZA 4F7UF 1XNIA 3M4YA 3OYDA 2F2XA 3EG9A 2QQRA 5GANg 3L2WA 1WXUA 3SDZA 1BIAA 3PNWC 5AT1B 2FRYA 1Q7YR 2RHSB 4P73A 1VYVA 1K73R 1MMGA 1WJQA 2ARUA 1WHGA 5CQXA 1B8AA 1UE9A 4OMQA 2RN8A 4FCYA 2Q5HA 4TQFA 2V1RA 1G8XA 5LJ3f 5HK3A 4FIBA 4KGZB 3RDVA 4QT7A 2YLCA 4EX5A 2E5QA 5CKBA 1JEGA 2FZKB 2XDPA 1VQKQ 2ZIMA 2LMJA 1ZLMA 3CC2A 4IURA 5IN1A 4C0FA 3OBYA 4BDYA 3EH2A 2CH4W 1WJRA 4JRQA 1E1OA 4HT9A 2DZ9A 3VU3C 3BFMA 5ELOA 1SSFA 1T3LA 4TTVA 1M2VA 1RI0A 2EJ9A 3V7SA 4JRPA 4PG3A 4KGXB 3CD6Q 2LJ3A 3JB9J 1RABB 2KE9A 1ARKA 2GGRA 1BI1A 4OMNA 2ALYA 4R55A 2D1XA 2OTLA 3E9IA 2QQ9A 1ZUKA 3G1JA 5GANf 3CCUT 1BB9A 1OPLA 2LZ6B 3FIFA 4PJOC 4ZN3A 4OMPA 4GLMA 4JDSA 1KQ1A 2QHSA 2LCLA 3VJPA 1WHMA 2C7IA 4DQ2A 3PVQA 5GMKe 5LJ3j 1D3BB 2CT4A 1SESA 2ARSA 3QO5A 2HQXA 3REUA 1JO8A 4RMOA 3MEVA 3M54A 4DPGA 3JCMc 3A74A 2FZGB 4K87A 3EHRA 3OS0A 2XTIA 2PUOB 2VUBA 5L8RE 4YRQA 5KYWB 1BCMA 1QWFA 3CMEA 3HP9A 2DL4A 4H2TA 3CPWP 3EGXB 2AZVA 1GGMA 1YHQT 1H4VB 3HSBA 2DTIA 4M75B 1O75A 1YJNQ 1SHFA 3MF2A 3RACA 1KQSP 4DBHA 4C92A 3OD1A 2AHJB 5FROA 1CKAA 1K1ZA 2RHXA 1JRIA 2ZNJA 2JMAA 1NG2A 5KYUA 2JXBA 3CCRT 4RDXA 4HCZA 1TWBA 1OV3A 2O9SA 1YCSB 3FEOA 3MEAA 1ASYA 3SWNA 1SRYA 2DVJA 2X4YA 4N0AA 5GAOp 3UH0A 1TOVA 5A0LA 3A8MB 3HFZA 2CJ9A 2JTFA 3CBOA 4PFZA 4A4GA 3H8ZA 5L23A 4WJ3M 1Q86R 5KCHA 4M78E 1B34A 1VQ5Q 2EYWA 4BE1A 1VQ6A 2CS7A 1VA7A 5GAN2 2EPDA 1KOGA 4YRCA 2G6FX 5KH6A 3E2UA 2OTJA 4IUQA 2R5AA 2QAZA 4PJOE 2GFUA 4FU6A 2XMFA 1TUDA 2DMOA 4BE0A 2D0QB 3PMTA 1Z9QA 2DXTA 1PSFA 2YHTA 2LCSA 4DA4A 4D8KA 4LN2A 4DEXA 3S3NA 3CXCA 5GANd 1KK7A 2DRMA 4J6WA 5LJ3e 2RD1A 4C0ZA 4HCBA 1V1CA 3OW2A 2QA4A 1WGSA 1QW1A 2YLBA 4OMOA 1E7OA 2EQMA 4L5GA 5GAMh 3O5ZA 5IHKA 1KD1C 2LCCA 2DIQA 4RKUE 5HY6A 4ZGEB 1EFWA 3LW5E 2EIFA 3VS7A 2KRNA 3X28B 2HD0A 4NOYA 1K4US 4YRNA 3HY1A 2KR3A 3ASKA 4XU2A 1QVGS 4LNSA 2MOXA 5K1PA 1YJ9Q 3CQTA 4LDVA 1T3SA 2ZT6A 3PIOA 3X26B 3CCLQ 4M78B 5DLQE 4HVUA 2ESWA 2F2VA 2QG9B 2FVUA 1NE8A 3P8BB 2AMCB 3EAEA 2OJ2A 4X9CA 1ZQ1A 2PVDB 1L0WA 4ANJA 8AT1B 3M56A 4HXJA 4GLKA 2RHSA 2OAUA 1ACMB 4O6JA 3QNEA 1NPRA 2NWMA 3I55T 1IHVA 1BBZA 3NTKA 4P72C 2CP7A 1YFSA 3MP6A 2ZIOA 4P74A 1WNLA 1UUEA 1AT1B 2LQNA 4WF2A 3Q1JA 1ABQA 3PIPA 4B6MA 3D7SB 1KFZA 2RJCA 5I22A 1TTHB 3SHWA 2AK5A 2VXEA 4L87A 1LVKA 3LWHA 2CUDA 4JZ4A 2AT1B 2ZAEA 2PTKA 1M2VB 5GMKi 1S72Q 3JCMQ 4EO4A 3CBPA 3S6WA 4J9EA 4PJOF 5A0GA 1WJSA 4N4GA 1F1BB 2V8KA 4PLIA 5J3BA 2ATCB 5E3IA 2DYIA 1B7YA 5FLXE 4ORZA 3L2VA 1RAHB 1N5ZA 3MHXA 1RLQC 4C0GA 4HVCA 2IPOB 4CC2A 2FHDA 2EW3A 3EG3A 4KH0B 1YJNT 1U1TA 2I4MA 2KI7A 3OMCA 3OS2A 3CMQA 2JUFA 1I07A 3EGXA 2LNHB 1M1FA 2JZ2A 3ME9A 4A53A 2CP5A 1VQPQ 4H2XA 4E7ZA 5IT9E 4JPBW 3PMIA 4A4KA 3QZ9B 4XAXB 4FYXB 4N4HA 5LJ5d 2JM9A 2HMAA 1G5HA 2ZINA 4J9IA 2B86A 1K8AU 1BU1A 2K3XA 2QQAA 2FG0A 3A8HB 2H8HA 2O2OA 4UPAA 3G71A 4M7AE 2LDMA 2CT3A 1PG5B 1IREB 3CMEQ 3HTRA 3JAME 3CCQA 2EQUA 3LH5A 2EWNA 1IXDA 3QWYA 3H0IA 4C92B 3M55A 1UJ0A 3G7ZA 1Y57A 2P0QA 4HWOA 2ARTA 1C6VX 4CH5A 4XEOA 3ZEHA 1HTTA 4LUDA 4LUEA 1U5SA 3IKLA 4YDQA 3M5AA 2EYYA 1VQ7T 4XU0A 4RTZA 3OQ5A 2SEMA 4OB2B 5GMKm 5GAOn 3VS3A 4AH6A 4YRRA 4AT1B 1VQ4Q 1SG5A 2CYZB 2WSCE 2DA9A 1OULA 4Z88A 4C8QG 1VQKT 4NL2A 4LVLA 2KEAA 3UGTA 3LWIA 3GBQA 4A4HA 3C0CA 1PYSA 2AZSA 3JCMe 3M58A 3MP1A 4M75F 12ASA 2ZZGA 2BZXA 2ENMA 4E7SA 4H2YA 3I56Q 4A4EA 2PVOB 2JW4A 2XK0A 1FX7A 5I2MA 4CS2A 1KG1A 2VB6A 4II1A 3QHSA 2KK4A 4LXCA 1YJ9T 4P5NA 5D7UA 4YRMA 2C8MA 3NTHA 3QYGB 2FRWA 3JCMg 3RBBB 2ZPIB 1BKBA 2ZPFB 1J3TA 2KYMA 1GCQA 1WLPB 2XDBA 1D1BA 2X4JA 5KYXA 3VV0A 1VQ6T 1PHTA 5AYFA 2EQKA 5CIUA 1U3OA 1GL5A 3HRSA 4MDWA 4IUUA 1VQ4T 4CH6A 2E65A 1KMMA 5LJ3g 3EFOA 1GXIE 2CDTA 2O9VA 1EVKA 2RHUA 1NJ8A 2L3RA 4LVKA 4YCVA 3N5BB 2CP2A 3EGDB 4P3PA 4PFOA 1R8OB 2GTJA 5GAMf 5C0MA 1ZA1B 1AEYA 3WQZA 1E6HA 2NUPB 4G85A 4E7JA 2MYSA 2DXBA 4M7AC 2KRSA 2RHQA 1H641 1Q7YC 3ICAA 2DJQA 2PU9B 2KSSA 2LQWA 4Q15A 1K8AR 1VQLQ 3GF5A 2K79A 3RUXA 4N0AC 5LJ5f 3R6NA 1TUCA 2GQIA 4J83A 2CP6A 1GCQC 4J7IA 3CMET 1EIYB 2COZA 2LX7A 3QDFA 4V2SA 1IGUA 2VGNA 2ZZFA 3EGUA 2CP0A 5CAIA 3VKIA 1C0AA 1VQLA 4E7HA 4C0DB 1H92A 1AWOA 1KHCA 2HL5C 2M0OA 1IRXA 4JUVA 2W10A 2FZCB 2CZ6B 2C06A 3J7AF 9ATCB 3QPHA 1SF9A 1ZBXA 3SWNB 5GAN7 3HRUA 2VWFA 2LVMA 1PC0A 1E1TA 4H2VA 2DAQA 3I9QA 1YI2Q 4C92E 1YI2T 1X69A 1D0YA 1OI1A 4ATOA 2KRMA 5GAN3 1SKUB 1MNEA 3GIBA 2JJ9A 4FSSA 2ZPBB 4C8QC 3VUZA 2F5TX 2A36A 4KQEA 4YRSA 1XTDA 3TEHA 2KVQG 4YRJA 2BE7D 4PNOA 2E6NA 1WHKA 1LYLA 1MV3A 3DLMA 2FYKA 4J6XA 1O9SA 3CCSQ 1B3QA 3EFRA 2MI6A 4RUGA 2EL9A 2OTLQ 1MV0B 2GQVA 3I56A 1Z7MA 3VS4A 4BACA 3X20B 2LC4A 1IZ6A 4HA8A 5LL6S 3VS0A 2OTJQ 3QDRB 1WXTA 3NMZC 3LH0A 3OS1A 1SETA 3RNJA 1VQLT 2QEXT 1Y7XA 1CSKA 2FPDA 4CS4A 1M27C 2AKWB 2RA2A 5HCKA 2EJFA 5LJ5e 2DERA 2K2MA 3BDLA 3BE3A 2K5LA 4J6YA 1N9WA 1W2BA 5FU6C 4EDUA 2ED0A 4Y92A 2AIRB 1W66A 2Q7GA 3CD6T 3ER0A 3LSQA 4XTUA 2FB7A 2X4XA 5GANh 2BIVA 7AT1B 1YFTA 2ZR2A 4MZPA 1D1AA 3OYCA 3RF1A 3KFUA 1ZSZA 2RK1A 3JCMV 1WZOA 1QVGA 1G3WA 3EHQA 4ZGDB 4FW1A 3FC3A 4IIMA 4E2FB 3JB9I 1VYUA 2CUBA 2DE0X 2PUKB 3OYLA 1VQ4A 2RQWA 3EGDA 1QQJA 2Y4XA 4C5GA 1KJWA 2SRCA 4Q5WA 3TCJA 3UA6A 3QTCA 4CC3A 2CZ1B 3QSUA 4J15A 2CREA 2ALYB 5LJ3h 3CD6A 3LLRA 3OYEA 2WSEE 2HSPA 1G3SA 5KE3A 5DM7R 2RHQB 2Q5IA 2ROLA 2K2VA 1G2BA 2M0YA 1EX4A 5CKFA 5FU6B 1OEBA 4YRFA 3MEUA 1VQ5A 1JXMA 1WHJA 3I56T 3BY7A 2CJAA 2V8IA 2NYSA 4KUIA 1M90C 1EIYA 2FO0A 4OMLA 1Z7NA 2DTHA 1QVFA 4EMKC 3G4ST 3HXXA 4E7LA 1IGQA 1B7TA 2Z0WA 4YRPA 4KBMB 4PJOA 2ZZEA 3L2UA 1PD0A 4XU3A 3CC4Q 3JCMW 2MWOA 2F69A 1YFRA 1TUGB 2L5QA 4O5VA 4A54A 4YCWA 1N9SA 2DZCA 4GBQA 5GAMe 1PKTA 2RJEA 1Q81C 4TVRA 4PHCA 2EGCA 2DQ3A 1MMDA 2C0OA 2DL8A 3HKSA 4C8QE 3CCVT 2KXDA 4M78C 5A2QE 3OSVA 1HK9A 3M0SA 4JJBA 4F04B 1KC8U 3CCRQ 3O8VA 2BUDA 2ODRC 1Y96A 2ABLA 4PJOB 3NEMA 1JU5C 1K73C 1VQNQ 3C4SA 1M1KC 1VQOA 6AT1B 3VRZA 1YHQQ 2CP3A 1RUWA 2KBTA 2CSIA 1RADB 4J9FA 4X1VA 1NJ1A 4RMFA 1EQRA 3FB9A 3EH1A 2XD0A 4HWTA 1M3BA 1Y0MA 3A32A 1WHHA 1NBEB 1H3ZA 4E7KA 3L4GA 4AMCA 2DU5A 3GP8A 2HSEB 1W2BP 5GAMj 1B70B 2CH4A 3VQVA 3G71Q 3BDUA 5HK0A 4C8QD 2X3WD 2RQRA 4OGCA 5GAOq 2DNUA 3L42A 1FXXA 4HWPA 2A28A 2FPEA 3CMAT 4K88A 1RACB 2J3MA 1NJIU 1KQSS 2A8EA 1M9SA 2DJZA 4BDZA 3FJ5A 1VQPA 4HVVA 3A8OB 3NPFA 2L3SA 2YUOA 3M4QA 5KYUB 4F17A 4J9CA 4Y28E 4MDXA 4HVWA 3CCSA 2GBQA 4XTVA 2KDSA 2ZPEB 4CH4A 2DXCA 4YRGA 4H2SA 4C8QF 3OYIA 1K73U 4XQ3A 2DVEA 5J26A 1RAIB 2BE9B 3G6ET 5LJ5j 4B9WA 1QWEA 4IKFA 2L3QA 3H0HA 2RHZA 4M77A 2YDLA 4XTWA 2HAXA 3HHTB 1AD5A 3PVLA 4C92F 1VQOT 2EAYA 4P72A 3M59A 3CC4A 1ZSZB 3TU4K 2JS0A 3SEMA 3V8LA 4C92D 1HJDA 3E9FA 1ZUUA 2CKKA 2ZGWA 1UECA 2H3JA 5GANj 3JB9D 1OZ2A 1G51A 3EFOB 1FWZA 5GMKl 1YITT 3RESA 3IG2A 1UGSB 1VQ7A 3REXA 2RJFA 4M77D 2OTLT 4OMMA 2HZYA 4Z89A 1Q86C 4CH3A 4K11A 1A0NB 3HL8A 4UC4A 2GFAA 5GAN8 3RIRA 4RCCA 2F1LA 3NELA 3JCMf 1VQMT 3CCEQ 3CC7A 2O31A 1NJ6A 1VQKA 3WVDB 2QHUA 1WLEA 1MMAA 3KUFA 4M78A 1KQ2A 4BW9A 1B76A 1RAGB 3GOXA 1I8FA 3DB3A 3G4SA 1JQQA 2LTOA 4HT8A 2DU7A 3H41A 3QWXX 4LDUA 4XEMA 1WX6A 5CKEA 4M7AB 1W2BS 2E3HA 4JJNK 1NJIR 1UHCA 2PMFA 4N4IA 1JJ2P 2O88A 5KE2A 2QA4Q 3LGLA 2O01E 2YUPA 1RAEB 1T0JA 2QGFB 1VQ5T 1NZ9A 2AKLA 3KBGA 3VYGA 4M77C 3A8GB 1NJ5A 3PGGA 4KULA 4ZTZB 1T0HA 2X35A 3RGLA 1VQNT 5J39A 2ZT5A 2ED1A 3E9GA 1D3BA 2HCKA 3W3SA 1BI3A 1W6XA 1M8VA 2OI3A 3M57A 2YSQA 3A5ZA 3CCLA 2E5AA 4Z8AA 4YROA 3OYAA 1UDLA 4YRIA 8ATCB 2RI5A 3OYNA 2PVGB 1NNHA 2RMOA 1ZX6A 3QG1A 1B70A 3GLXA 3HPWA 2JN0A 4MZMA 1M2OA 2FEIA 2DTOA 2EKOA 4XK8E 2CZ0B 3HXZA
chains in the Genus database with same CATH topology
4IUTA 3L2QA 5GMKj 2YRVA 3HRIA 2DD4A 3CC7T 3DB4A 4TWAA 3QBYA 4FL6A 1BBUA 1YJ9A 2JTMA 3TEEA 4C5EA 4YREA 2LT4A 3OYHA 2O4XA 4C8QA 1KHIA 1YBYA 1H4TA 4EMKA 5I21A 1BI2A 3EFSA 2ZCEA 3QXEB 5CKDA 1OZ3A 2IY5B 1TH7A 4YPFA 3P8DA 4HWSA 4QQGA 2XDDA 3FLGA 3T9NA 3FDRA 3GPLA 3TEGA 1YIJT 1I5LA 4M7DE 4K86A 5GAMg 1S72A 2CIMA 3NENA 3S3OA 2WSFE 1QP2A 1BYMA 1SERA 3CXCS 5D6XA 5C51B 4KUDK 2AMCA 4M77F 3GNGA 3OYKA 4P3OA 4C92G 2EJGA 2VC8A 5I2SA 3JB9H 4OB1B 1G5IA 4M77B 4KT0E 4M7AA 1QE0A 3OA6A 1K9MC 5CR2A 2P4TA 4M7AG 4BB7A 4BY6B 3HRKA 4NL3A 2OTJT 3HFVA 3F70A 4M75A 2E3CA 3UT1A 2RK2A 3JCMP 3CCST 3HXVA 1I4K1 4RQEA 3L2RA 2ZXFA 1X2GA 3LX7A 3HXYA 3CCMT 4KR3A 4FM4B 4M78D 4LDYA 3PCOB 3OYFA 5CK9A 1UGQB 2LNVA 2RHYA 4M75D 1G3TA 3OMGA 2LX9A 2VGMA 3IKMB 4OB0B 4F7UE 3H6ZA 5CCAA 3PTAA 2HNIA 5C6SA 3MQZA 3HY0A 1S72T 1YITA 1JBMA 3ZBDA 4DOVA 2KAFA 2DO3A 3I55A 3WXMB 1Q7YU 4FSXA 3CCUA 3X24B 4L6V5 3URGA 1G3YA 3CC4T 2PQWA 1H4SA 5HKCA 3RKWA 1N8RU 2K4YA 1JJCB 2P0KA 5C52B 3JCMd 5F5WA 2G4CA 3MP8A 4OP0A 3JCMb 3LGFA 2LRQA 1V29B 4RCBA 1JJ2S 3I7FA 5EG2A 4CS3A 2FL7A 2F5KA 1M1KU 3TEHB 4LD9K 4F7UG 3OYJA 3CC2T 11ASA 5A0DA 4PJOD 2XICA 1NPPA 4EMKB 3A8LB 4ME7A 1RL2A 3NETA 4UP9A 4BI3A 2A3LA 3P8HA 3DSQA 4QVDA 4M77G 4GY5A 2XHCA 4M7DC 1XQHA 2QDYB 4RG2A 4VUBA 4CRIA 1UEBA 1JB0E 1J5WA 2I4OA 2I4NA 4J5YA 1USYA 3P8YA 1HC7A 1WPYA 2ZT7A 2G3RA 1U1SA 3BJUA 4FT4A 4H2UA 2E6ZA 2XG8D 4CI0C 2ZPGB 3VQYA 2VYTA 3GNFB 3QO7A 4OGEA 2R58A 4M7AD 4H2WA 1VQ9A 3A5YA 1I81A 4M7DG 4L59A 3LSSA 3UGQA 1YCYA 1VUBA 1E24A 3QZ5B 3DLLA 2Q7HA 3P8TA 3IALA 1VQMA 2WACA 1MHNA 1B34B 3QYHB 1WU7A 5LJ5h 3A7UA 1M90U 2B8AA 4BUGA 2DIGA 4M77E 4NS5A 4P75C 4JRKA 2K57A 3SFMA 3OYMA 4ZTJA 1WQWA 4TVYA 4X34A 4WI1A 2K5FA 3QJ6A 4LVIA 4WJ4A 5C53B 4EPCA 4OMFB 4HT4A 1NYRA 1X55A 3QO8A 3DKMA 4YRLA 4HKEA 3C95A 2DKGA 4ELZC 2RO0A 1N8RC 3CPWA 1QVPA 1UB4A 2RB6A 3E1SA 5GAMd 4FT2A 3JCMX 5GAN4 4E7IA 3L4GB 4Z02A 4OF1A 2M16A 5GAOl 2XIDA 4A4FA 4C92C 1YGBA 3TUPA 1Q81U 3CCJA 2DQ0A 1UGPB 3VBBA 1WQ7A 3QJYA 3RKXA 3A31A 3INZA 1USYC 4YTLA 2M1HA 2VXFA 3TREA 2XGTA 2E64A 2J3LA 4ZTFA 1LOJA 5FRMA 1YJWT 1AHJB 4M78F 1EIFA 2DDZA 1YHQA 3M4PA 4JS5A 3META 1MGQA 4QQDA 3KXTA 3VYHB 4C0DC 4HCCA 4M78G 4G84A 1KQSA 2Q7EA 3HTZA 4D6WA 4XTYA 5D6WA 2DD5A 4YRKA 1X54A 2E70A 1N6AA 3PT9A 2ZTGA 4ZN1A 4P3NA 3RL6A 2KMTA 1OYXA 4H02A 3V8KA 2RH2A 3OBWA 3J81E 2ODRD 2MAMA 4JLGA 2D6FA 3HFNA 5KNNA 3OY9A 5CO7A 3CPFA 4F7UB 4H2XB 2E10A 1Y96B 2QA4T 1QVFS 2DK3A 3CEYA 2HBPA 1HXDA 2GF7A 1VQPT 2I4LA 4P71A 2X4WA 3ZFJA 1RIQA 4TVAA 3QO3A 2Y4YA 4X5OA 3G1ZA 3LYIA 4HWRA 3HXUA 1JJCA 2K5IA 2ZZDA 1N9RA 2P0LA 2RI2A 1U8RA 2O4XB 4C8QB 1ADYA 5D6YA 2MF2A 5GAN5 3HXWA 4OVAA 2QHTA 4JS4A 4P75A 5HGQA 1VIEA 4PL6A 3CBMA 4ZTUB 1BI0A 4BY6C 4M75G 4ZGJB 3OW2S 3MO8A 2E41A 3A7AA 1EVLA 4LD6A 1JJ2A 5DY9A 2EQJA 5FU7B 4OB3B 2XU8A 4TQDA 1E22A 3P8VA 3V8JA 1KC8C 4M7DA 4JLIA 1N27A 3QUIA 3S3MA 1VQZA 3SD4A 3L2ZA 2NLUA 4YRTA 2P5IA 2XKOC 4RQFA 3MEYA 4PLLA 3UFGA 1YB3A 5DLOA 4OLFA 1NJ2A 2DEQA 2QQSA 4M7DD 4LDXA 3JCMJ 3VQWA 5LJ3d 2V8JA 2Y90A 3C94A 2IVWA 4M7AF 5GAOm 1VQ9T 1EOVA 2HQEA 3FRNA 1BBWA 2RM4A 4TVWA 2I2LA 2QI2A 1VIFA 3FJPA 1Y07A 2R5MA 4BI8B 3G71T 4BE2A 4DOWA 4B9XA 2XI9A 4YCUA 5GAOr 3WVEB 3RERA 3SWNC 4ELYC 3VQXA 4O2DA 4IUVA 1Q82C 2CGHA 5M9OA 4BD3A 4UP7A 1W4SA 2K3YA 2RJDA 3NFCA 4YP0A 1QP3A 4JRIA 3JB9G 4QVCA 3RMQA 2EYQA 3V7CA 1X56A 2E12A 4QVZA 3X25B 3BW1A 1VQ8A 3CMAA 4F7UA 3C12A 2LT1A 2JOYA 4PJOG 2ZPHB 3PZCA 5CVIA 2QQBA 4P73C 3CCRA 1G5VA 3A7RA 4IUPA 4J7FA 2M9UA 3E19A 2L8DA 1LJOA 2AKWA 1X01A 2LQKA 4UP8A 4MZTA 3JSCA 4EMHA 3UWNA 5KCOA 3CCEA 4X9DA 3HFZB 1LNXA 1YIJA 2ZNIA 3M4GA 2IY5A 3QIIA 4E51A 3CCET 4J8OA 3PFSA 1KMNA 4LVMA 3E9HA 2JVVA 1YI2A 5FRNA 3L1AA 3OYBA 2LQ8A 1NJIC 2JNGA 3MCAB 3JCMh 3G6EA 2R57A 3JRZA 2E1HA 4R56A 1X2HA 4Y91A 2MWPA 5GAN6 4BWAA 2KQWA 3NTIA 4NCXA 1P92A 4M7DF 4LDWA 1M1GA 2ZCFB 3CCQT 3QKJA 3RMSA 3OS5A 1YJWA 2PMEA 1M5Q1 1WYDA 4M7DB 3V7RA 4C5IA 3MEWA 2QHVA 1XOVA 2QTXA 1UGRB 3CCMA 2CJBA 1M4ZA 4C5HA 3CCLT 2CZ7B 1ZHIA 1VQ8T 4M75C 3CCJT 1ADJA 4Q6GA 3R07A 3ERRA 4ZIBA 1YJNA 1IL2A 3OYGA 1Y71A 2RI3A 3R6OA 2ZR3A 4E47A 2L89A 1PSEA 5K1XA 1ATIA 4QW2A 3SB2A 3VUBA 1H4QA 1K8AC 2BKDN 4M75E 2DPPB 3HRTA 3JB9F 4PKCC 1X75C 5IAYA 1ASZA 3M53A 4MMLA 1B7YB 4P74C 5CKHA 2QEXA 2KY9A 1Q86U 4YYEA 2P0PA 5LJ5g 4MMKA 1NYQA 4QQ6A 4EMGA 2EFIA 2GCXA 4TVAB 2NS6A 4KR2A 1Q82U 1DJ7B 2RHIA 3PCOA 3RKYA 4XU1A 1QF6A 4XTXA 5GMKh 3M9QA 3CCVA 2IG0A 3OYYA 1FYFA 2ZT8A 2D9TA 4BI4A 1K9MU 3LC0A 3J80E 3UPUA 4RG8A 2A7YA 5FU7C 3MF1A 2VV5A 1BIBA 5CQYA 5GANe 3A5ZB 3AHUA 3HFOA 4LVJA 2DXUA 2MMPA 3CPWS 3OB9A 4P71C 1KD1U 2QXFA 1PYSB 4XTZA 1X6OA 3OSSC 5ELNA 3UDCA 4F7UF 1XNIA 3M4YA 3OYDA 2QQRA 5GANg 3L2WA 3SDZA 1BIAA 3PNWC 2RHSB 4P73A 1WJQA 2ARUA 5CQXA 1B8AA 2Q5HA 4TQFA 5LJ3f 5HK3A 4FIBA 2YLCA 4EX5A 2E5QA 5CKBA 2XDPA 2ZIMA 3CC2A 4IURA 5IN1A 4C0FA 3OBYA 4BDYA 1WJRA 4JRQA 1E1OA 4HT9A 2DZ9A 3VU3C 3BFMA 5ELOA 1SSFA 4TTVA 1RI0A 2EJ9A 4JRPA 3V7SA 4PG3A 3JB9J 1BI1A 2ALYA 4R55A 2OTLA 3E9IA 2QQ9A 5GANf 3CCUT 4XK8E 3FIFA 4PJOC 4ZN3A 4JDSA 1KQ1A 2QHSA 2LCLA 3VJPA 2C7IA 4DQ2A 5GMKe 5LJ3j 1D3BB 1SESA 2ARSA 3QO5A 2HQXA 3REUA 4RMOA 3MEVA 3M54A 4DPGA 3JCMc 3A74A 4K87A 3OS0A 2XTIA 2PUOB 2VUBA 5L8RE 4YRQA 3CMEA 3HP9A 4H2TA 1GGMA 1YHQT 1H4VB 3HSBA 2DTIA 4M75B 1O75A 3RACA 3MF2A 4C92A 3OD1A 2AHJB 5FROA 2RHXA 1JRIA 2ZNJA 3CCRT 4RDXA 4HCZA 3FEOA 3MEAA 1ASYA 3SWNA 1SRYA 4N0AA 2X4YA 5GAOp 3UH0A 5A0LA 3A8MB 3HFZA 2CJ9A 2JTFA 3CBOA 4A4GA 3H8ZA 4WJ3M 5KCHA 4M78E 1B34A 4BE1A 1VQ6A 2CS7A 5GAN2 1KOGA 4YRCA 5KH6A 2OTJA 4IUQA 2R5AA 4PJOE 2GFUA 4FU6A 4BE0A 2D0QB 3PMTA 2DXTA 1PSFA 2YHTA 4DA4A 3S3NA 3CXCA 5GANd 4J6WA 5LJ3e 2RD1A 4C0ZA 4HCBA 3OW2A 2QA4A 1WGSA 1QW1A 2YLBA 2EQMA 4L5GA 5GAMh 1KD1C 2LCCA 2DIQA 4RKUE 5HY6A 4ZGEB 1EFWA 3LW5E 2EIFA 3X28B 2HD0A 4NOYA 4YRNA 3HY1A 3ASKA 4XU2A 1QVGS 4LNSA 5K1PA 4LDVA 2ZT6A 3PIOA 3X26B 4M78B 5DLQE 2FVUA 1NE8A 3P8BB 2AMCB 3EAEA 4X9CA 1ZQ1A 2PVDB 1L0WA 3M56A 4GLKA 2RHSA 2OAUA 4O6JA 3QNEA 1NPRA 3I55T 3NTKA 4P72C 1YFSA 3MP6A 2ZIOA 4P74A 1WNLA 4WF2A 3Q1JA 3PIPA 2RJCA 2VXEA 4L87A 3LWHA 5GMKi 3JCMQ 4EO4A 3CBPA 3S6WA 4PJOF 5A0GA 1WJSA 4N4GA 2V8KA 4PLIA 5J3BA 5E3IA 1B7YA 5FLXE 3L2VA 3MHXA 4C0GA 4HVCA 2FHDA 1YJNT 1U1TA 2I4MA 3OMCA 3OS2A 3CMQA 2JUFA 1M1FA 2JZ2A 3ME9A 4A53A 4H2XA 5IT9E 3PMIA 4A4KA 3QZ9B 4XAXB 4N4HA 5LJ5d 1G5HA 2ZINA 1K8AU 2K3XA 2QQAA 3A8HB 4UPAA 3G71A 4M7AE 2LDMA 1IREB 3JAME 3CCQA 2EQUA 2EWNA 4C92B 3M55A 3G7ZA 4HWOA 2P0QA 2ARTA 4CH5A 4XEOA 3ZEHA 1HTTA 3IKLA 4YDQA 3M5AA 1VQ7T 4XU0A 3OQ5A 4OB2B 5GMKm 5GAOn 4AH6A 4YRRA 2CYZB 2WSCE 4C8QG 1VQKT 4NL2A 4LVLA 3UGTA 3LWIA 4A4HA 1PYSA 3JCMe 3M58A 3MP1A 4M75F 12ASA 2ZZGA 4H2YA 4A4EA 2PVOB 2XK0A 1FX7A 5I2MA 4CS2A 1KG1A 4II1A 3QHSA 2KK4A 1YJ9T 4P5NA 4YRMA 2C8MA 3NTHA 3QYGB 3JCMg 2ZPIB 1BKBA 2ZPFB 2XDBA 2X4JA 3VV0A 1VQ6T 5AYFA 2EQKA 5CIUA 3HRSA 4MDWA 4IUUA 1VQ4T 4CH6A 2E65A 1KMMA 5LJ3g 1GXIE 1EVKA 2RHUA 1NJ8A 2L3RA 4LVKA 4YCVA 3N5BB 4P3PA 5C0MA 1R8OB 5GAMf 3WQZA 4G85A 4E7JA 2DXBA 4M7AC 2RHQA 1H641 1Q7YC 3ICAA 2PU9B 2KSSA 4Q15A 3GF5A 3RUXA 4N0AC 5LJ5f 4J83A 4J7IA 3CMET 1EIYB 4V2SA 2VGNA 2ZZFA 5CAIA 3VKIA 1C0AA 1VQLA 4E7HA 4C0DB 1KHCA 2M0OA 4JUVA 2CZ6B 2C06A 3J7AF 3QPHA 1ZBXA 3SWNB 5GAN7 3HRUA 2LVMA 4H2VA 1E1TA 2DAQA 4C92E 1YI2T 1OI1A 4ATOA 5GAN3 3GIBA 2ZPBB 4C8QC 3VUZA 2F5TX 4KQEA 4YRSA 1XTDA 3TEHA 2KVQG 4YRJA 4PNOA 2E6NA 1LYLA 3DLMA 2FYKA 4J6XA 1O9SA 3EFRA 2MI6A 2EL9A 2GQVA 3I56A 1Z7MA 4BACA 3X20B 2LC4A 1IZ6A 4HA8A 5LL6S 3QDRB 3LH0A 3OS1A 1SETA 1VQLT 2QEXT 1Y7XA 4CS4A 2AKWB 2RA2A 2EJFA 5LJ5e 3BDLA 2K5LA 4J6YA 1N9WA 1W2BA 5FU6C 4EDUA 1W66A 2Q7GA 3CD6T 3ER0A 3LSQA 4XTUA 2FB7A 2X4XA 5GANh 2BIVA 1YFTA 2ZR2A 4MZPA 3OYCA 3RF1A 3KFUA 2RK1A 3JCMV 1QVGA 1G3WA 3FC3A 4ZGDB 3JB9I 2PUKB 3OYLA 1VQ4A 4C5GA 2Y4XA 4Q5WA 3TCJA 3QTCA 2CZ1B 3QSUA 4J15A 2ALYB 5LJ3h 3CD6A 3LLRA 3OYEA 2WSEE 1G3SA 5KE3A 5DM7R 2RHQB 2Q5IA 2K2VA 5CKFA 5FU6B 4YRFA 3MEUA 1VQ5A 3I56T 2CJAA 3BY7A 2V8IA 4KUIA 1M90C 1EIYA 1Z7NA 2DTHA 1QVFA 4EMKC 3G4ST 3HXXA 4E7LA 4YRPA 4KBMB 4PJOA 2ZZEA 3L2UA 4XU3A 3JCMW 2MWOA 2F69A 1YFRA 2L5QA 4YCWA 4O5VA 4A54A 1N9SA 2DZCA 5GAMe 2RJEA 1Q81C 4TVRA 4PHCA 2DQ3A 3HKSA 4C8QE 3CCVT 4M78C 5A2QE 3OSVA 1HK9A 1KC8U 3O8VA 2BUDA 2ODRC 1Y96A 4PJOB 3NEMA 1K73C 3C4SA 1M1KC 1VQOA 1NJ1A 4RMFA 1EQRA 3FB9A 2XD0A 4HWTA 3A32A 1H3ZA 4E7KA 3L4GA 2DU5A 3GP8A 5GAMj 1B70B 3VQVA 3BDUA 5HK0A 4C8QD 4OGCA 5GAOq 3L42A 1FXXA 4HWPA 3CMAT 4K88A 2J3MA 1NJIU 1KQSS 2A8EA 1M9SA 2DJZA 4BDZA 1VQPA 3A8OB 3M4QA 4Y28E 4MDXA 3CCSA 4XTVA 2KDSA 2ZPEB 4CH4A 2DXCA 4YRGA 4H2SA 4C8QF 3OYIA 1K73U 4XQ3A 2DVEA 5J26A 3G6ET 5LJ5j 4B9WA 4IKFA 2RHZA 4M77A 4XTWA 2HAXA 3HHTB 4C92F 1VQOT 4P72A 2EAYA 3M59A 3CC4A 3TU4K 3V8LA 4C92D 3E9FA 2ZGWA 2CKKA 5GANj 2H3JA 3JB9D 1OZ2A 1G51A 1FWZA 5GMKl 1YITT 3RESA 3IG2A 1UGSB 1VQ7A 3REXA 2RJFA 4M77D 2OTLT 1Q86C 4CH3A 3HL8A 4UC4A 2GFAA 5GAN8 3RIRA 4RCCA 3NELA 3JCMf 1VQMT 3CC7A 1NJ6A 1VQKA 3WVDB 2QHUA 1WLEA 4M78A 3KUFA 1KQ2A 4BW9A 1B76A 3GOXA 1I8FA 3DB3A 3G4SA 2LTOA 4HT8A 2DU7A 4LDUA 4XEMA 5CKEA 4M7AB 1W2BS 4JJNK 2PMFA 4N4IA 5KE2A 3LGLA 2O01E 1VQ5T 1NZ9A 3KBGA 3VYGA 4M77C 3A8GB 1NJ5A 3PGGA 4KULA 4ZTZB 2X35A 3RGLA 1VQNT 5J39A 2ZT5A 3E9GA 1D3BA 3W3SA 1BI3A 1M8VA 3M57A 3A5ZA 3CCLA 2E5AA 4YROA 3OYAA 4YRIA 2RI5A 3OYNA 2PVGB 1NNHA 3QG1A 1B70A 3GLXA 3HPWA 2JN0A 4MZMA 2DTOA 2EKOA 1VQNA 2CZ0B 3HXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MGQ A;  5GMK j;  3LC0 A;  4CH6 A;  2E65 A;  3HRI A;  1KMM A;  5LJ3 g;  4M78 G;  4G84 A;  3MF1 A;  1EVK A;  4TWA A;  1BBU A;  1NJ8 A;  2Q7E A;  3HTZ A;  4YCV A;  1BIB A;  4P3P A;  4XTY A;  5GAM f;  4YRE A;  5GAN e;  3AHU A;  4C8Q A;  3HFO A;  4YRK A;  1X54 A;  2DXU A;  3WQZ A;  2ZTG A;  1H4T A;  4G85 A;  4P3N A;  4P71 C;  3RL6 A;  4M7A C;  2RHQ A;  4EMK A;  1H64 1;  1PYS B;  4XTZ A;  3ICA A;  4Q15 A;  5I21 A;  4H02 A;  5ELN A;  3EFS A;  3V8K A;  2ZCE A;  3RUX A;  4N0A C;  4F7U F;  5LJ5 f;  2IY5 B;  1TH7 A;  2ODR D;  4YPF A;  5GAN g;  1EIY B;  3HFN A;  5KNN A;  1BIA A;  4V2S A;  4HWS A;  2ZZF A;  5CAI A;  4F7U B;  4H2X B;  2RHS B;  4P73 A;  1C0A A;  2E10 A;  3TEG A;  1Y96 B;  2ARU A;  4JUV A;  1B8A A;  1I5L A;  4M7D E;  2Q5H A;  4K86 A;  4TQF A;  5GAM g;  1HXD A;  2CIM A;  3NEN A;  5LJ3 f;  3SWN B;  5GAN 7;  2YLC A;  4EX5 A;  4H2V A;  1E1T A;  2ZIM A;  1SER A;  2I4L A;  5C51 B;  2AMC A;  4M77 F;  4C92 E;  4P71 A;  4P3O A;  4C92 G;  2EJG A;  2VC8 A;  5GAN 3;  3JB9 H;  1E1O A;  4HT9 A;  3GIB A;  2DZ9 A;  3VU3 C;  3BFM A;  5ELO A;  1RIQ A;  4C8Q C;  4TVA A;  3QO3 A;  4TTV A;  2EJ9 A;  4PG3 A;  4X5O A;  3V7S A;  3G1Z A;  4KQE A;  4YRS A;  3TEH A;  1G5I A;  4M77 B;  3JB9 J;  4YRJ A;  4HWR A;  4PNO A;  1JJC A;  3HXU A;  4M7A A;  1LYL A;  1QE0 A;  2ALY A;  1N9R A;  2FYK A;  4J6X A;  2P0L A;  3EFR A;  4C8Q B;  1ADY A;  2EL9 A;  3E9I A;  5GAN f;  5GAN 5;  1Z7M A;  4M7A G;  3HRK A;  4HA8 A;  3FIF A;  3HXW A;  4NL3 A;  4PJO C;  2QHT A;  3HFV A;  1SET A;  4P75 A;  5HGQ A;  1KQ1 A;  2QHS A;  4M75 A;  2C7I A;  2E3C A;  4CS4 A;  2AKW B;  4ZTU B;  4DQ2 A;  2RA2 A;  2EJF A;  3JCM P;  4M75 G;  5LJ5 e;  3HXV A;  1I4K 1;  2E41 A;  5GMK e;  5LJ3 j;  2ZXF A;  1D3B B;  4RQE A;  4J6Y A;  1N9W A;  1X2G A;  1EVL A;  3A7A A;  3HXY A;  1SES A;  2ARS A;  3QO5 A;  4KR3 A;  5DY9 A;  1W66 A;  2Q7G A;  3REU A;  4M78 D;  3LSQ A;  4DPG A;  4XTU A;  2FB7 A;  3JCM c;  3A74 A;  4TQD A;  1E22 A;  3P8V A;  4K87 A;  5GAN h;  3V8J A;  2XTI A;  3PCO B;  1YFT A;  2ZR2 A;  4YRQ A;  4M7D A;  4JLI A;  3RF1 A;  3QUI A;  3KFU A;  4M75 D;  1VQZ A;  4H2T A;  3JCM V;  1GGM A;  3L2Z A;  4YRT A;  1H4V B;  2P5I A;  3HSB A;  2DTI A;  4M75 B;  3IKM B;  4RQF A;  3RAC A;  3MF2 A;  4F7U E;  4C92 A;  3OD1 A;  3JB9 I;  3MEY A;  3UFG A;  1JRI A;  2ZNJ A;  1YB3 A;  4OLF A;  1NJ2 A;  4RDX A;  2DEQ A;  4M7D D;  3QTC A;  3JCM J;  2HNI A;  1ASY A;  3SWN A;  1SRY A;  3QSU A;  4N0A A;  4J15 A;  5GAO p;  2ALY B;  5LJ3 h;  3UH0 A;  3VQW A;  3HY0 A;  5LJ3 d;  1JBM A;  2RHQ B;  2Y90 A;  2Q5I A;  4M7A F;  3HFZ A;  2CJ9 A;  5GAO m;  1EOV A;  4WJ3 M;  4M78 E;  4YRF A;  1B34 A;  2RM4 A;  1BBW A;  2I2L A;  4TVW A;  3BY7 A;  2CJA A;  3FJP A;  5GAN 2;  1KOG A;  4YRC A;  1EIY A;  1H4S A;  1Z7N A;  2DTH A;  3RKW A;  4EMK C;  1JJC B;  4PJO E;  3HXX A;  4YCU A;  5C52 B;  5GAO r;  3RER A;  3SWN C;  3JCM d;  4PJO A;  2ZZE A;  4YRP A;  5F5W A;  2DXT A;  4XU3 A;  3JCM W;  2YHT A;  3VQX A;  4O2D A;  2G4C A;  1YFR A;  4A54 A;  4YCW A;  4OP0 A;  2CGH A;  3JCM b;  5GAN d;  1N9S A;  4J6W A;  5LJ3 e;  2RD1 A;  2DZC A;  4UP7 A;  5GAM e;  4YP0 A;  4RCB A;  2YLB A;  4JRI A;  4PHC A;  2DQ3 A;  5GAM h;  3JB9 G;  4QVC A;  4C8Q E;  3I7F A;  4CS3 A;  3V7C A;  3TEH B;  4M78 C;  1X56 A;  4F7U G;  1EFW A;  11AS A;  1HK9 A;  3BW1 A;  4PJO D;  4F7U A;  2ODR C;  4NOY A;  4EMK B;  1Y96 A;  4PJO G;  4YRN A;  3HY1 A;  4PJO B;  3NEM A;  4XU2 A;  3NET A;  4LNS A;  4UP9 A;  3PZC A;  5K1P A;  3DSQ A;  4QVD A;  2ZT6 A;  4M77 G;  4M7D C;  4M78 B;  4P73 C;  3A7R A;  2AMC B;  4X9C A;  1NJ1 A;  1L0W A;  4RMF A;  1EQR A;  3FB9 A;  4HWT A;  2RHS A;  3A32 A;  1J5W A;  3QNE A;  1LJO A;  2AKW A;  3L4G A;  2I4O A;  1X01 A;  2DU5 A;  4P72 C;  2I4N A;  4J5Y A;  1USY A;  5GAM j;  1YFS A;  1B70 B;  2ZIO A;  4UP8 A;  4P74 A;  1WNL A;  3VQV A;  3P8Y A;  1HC7 A;  1WPY A;  2ZT7 A;  4EMH A;  4WF2 A;  3BDU A;  4C8Q D;  1U1S A;  4X9D A;  3BJU A;  4H2U A;  5GAO q;  3VQY A;  4HWP A;  3HFZ B;  1LNX A;  2VXE A;  4L87 A;  2ZNI A;  4K88 A;  3M4G A;  2J3M A;  2IY5 A;  3QO7 A;  5GMK i;  4E51 A;  4M7A D;  2DJZ A;  3JCM Q;  4EO4 A;  1KMN A;  4H2W A;  4PJO F;  3A5Y A;  1I81 A;  3E9H A;  3M4Q A;  5E3I A;  1B7Y A;  4M7D G;  3L1A A;  4HVC A;  4XTV A;  3JCM h;  3LSS A;  4CH4 A;  3UGQ A;  1YCY A;  4YRG A;  1U1T A;  2E1H A;  1E24 A;  4H2S A;  1X2H A;  2I4M A;  4C8Q F;  4Y91 A;  2Q7H A;  3CMQ A;  3P8T A;  4XQ3 A;  3IAL A;  5GAN 6;  2DVE A;  4BWA A;  4A53 A;  4H2X A;  4NCX A;  4M7D F;  5LJ5 j;  1B34 B;  1WU7 A;  5LJ5 d;  4M77 A;  1G5H A;  5LJ5 h;  4XTW A;  3A7U A;  2PME A;  2ZIN A;  1M5Q 1;  4M77 E;  4C92 F;  2EAY A;  1WYD A;  4P72 A;  4P75 C;  4JRK A;  4UPA A;  2K57 A;  4M7D B;  3V7R A;  4M7A E;  2QHV A;  2QTX A;  3V8L A;  1WQW A;  4C92 D;  4TVY A;  2CJB A;  2ZGW A;  5GAN j;  4WI1 A;  3JB9 D;  2EWN A;  4C92 B;  1G51 A;  4WJ4 A;  4HWO A;  4M75 C;  1ADJ A;  2ART A;  5GMK l;  5C53 B;  4CH5 A;  4XEO A;  3RES A;  3IG2 A;  4Q6G A;  3REX A;  3R07 A;  4M77 D;  1HTT A;  3ERR A;  1NYR A;  4CH3 A;  1X55 A;  3IKL A;  3QO8 A;  4ZIB A;  1IL2 A;  4YDQ A;  5GAN 8;  3RIR A;  4YRL A;  4RCC A;  3NEL A;  3JCM f;  1NJ6 A;  4XU0 A;  2ZR3 A;  2DKG A;  5GMK m;  2QHU A;  1WLE A;  4M78 A;  1KQ2 A;  4BW9 A;  5GAO n;  1B76 A;  4AH6 A;  4YRR A;  5K1X A;  1ATI A;  1I8F A;  2RB6 A;  3SB2 A;  4HT8 A;  4C8Q G;  2DU7 A;  1H4Q A;  5GAM d;  4M75 E;  3JB9 F;  4XEM A;  4NL2 A;  4M7A B;  3JCM X;  5GAN 4;  3L4G B;  2PMF A;  1ASZ A;  5GAO l;  3UGT A;  1YGB A;  4C92 C;  3TUP A;  1B7Y B;  4MML A;  1PYS A;  4P74 C;  3JCM e;  4M75 F;  12AS A;  2ZZG A;  4H2Y A;  2DQ0 A;  1NJ5 A;  4M77 C;  3PGG A;  1WQ7 A;  3VBB A;  4YYE A;  4ZTZ B;  3RKX A;  5LJ5 g;  4CS2 A;  3A31 A;  3RGL A;  3INZ A;  3QHS A;  2ZT5 A;  1USY C;  2VXF A;  4MMK A;  1NYQ A;  2XGT A;  4YRM A;  4EMG A;  1D3B A;  2C8M A;  2E64 A;  2J3L A;  3W3S A;  3JCM g;  1LOJ A;  4TVA B;  1M8V A;  4M78 F;  4KR2 A;  2DDZ A;  3A5Z A;  2E5A A;  4YRO A;  4YRI A;  3PCO A;  3RKY A;  4XU1 A;  1QF6 A;  1NNH A;  3M4P A;  4XTX A;  1B70 A;  5GMK h;  2JN0 A;  2DTO A;  1FYF A;  3HXZ A;  2ZT8 A; 
#chains in the Genus database with same CATH topology
 4IUT A;  3L2Q A;  5GMK j;  1OU9 A;  2YRV A;  1XJW B;  3HRI A;  2J7I A;  2DD4 A;  3CC7 T;  5IXF A;  3DB4 A;  4TWA A;  3QBY A;  4FL6 A;  1BBU A;  2QK0 A;  1YJ9 A;  2JTM A;  3TEE A;  1TS9 A;  4C5E A;  4YRE A;  2LT4 A;  3OYH A;  1PM3 A;  3CCM Q;  2O4X A;  4C8Q A;  1KHI A;  1RLP C;  1YBY A;  1H4T A;  2F2W A;  1YJW Q;  1G83 A;  4EMK A;  1IO6 A;  5I21 A;  1BI2 A;  3EFS A;  2ZCE A;  3QXE B;  1UHF A;  4KRT A;  5CKD A;  1OZ3 A;  5KYY A;  2IY5 B;  1TH7 A;  2EQI A;  4YPF A;  3P8D A;  2YUQ A;  3TSW A;  4HWS A;  4QQG A;  2XDD A;  3FLG A;  3T9N A;  3FDR A;  4D8D A;  3M0Q A;  3GPL A;  3TEG A;  1YIJ T;  1HYO A;  4JJD A;  1I5L A;  4M7D E;  4K86 A;  5GAM g;  1S72 A;  1V76 A;  2CIM A;  3I5R A;  3NEN A;  2YRC A;  4CC4 B;  3G6E Q;  3S3O A;  2WSF E;  1QP2 A;  1M3C A;  1BYM A;  1SER A;  3CXC S;  2P4R A;  5D6X A;  5C51 B;  4KUD K;  2AMC A;  4M77 F;  3GNG A;  2HKQ B;  3OYK A;  4CC7 A;  4P3O A;  4C92 G;  2EJG A;  2VC8 A;  5I2S A;  3JB9 H;  4FYW B;  2RQU A;  4PJL A;  2YUN A;  1OOT A;  4OB1 B;  1G5I A;  4M77 B;  4KT0 E;  1BCO A;  4M7A A;  1QE0 A;  2GNC A;  3OA6 A;  1PD1 A;  1K9M C;  5CR2 A;  4IIO A;  3CXC P;  1WDX A;  5KYX B;  2P4T A;  1EZZ B;  2QEX Q;  4M7A G;  3A98 A;  4BB7 A;  4BY6 B;  3HRK A;  3REA B;  2FPF A;  4NL3 A;  2OTJ T;  3HFV A;  3F70 A;  4M75 A;  2E3C A;  3UT1 A;  2RK2 A;  3I5S A;  3JCM P;  1OU8 A;  3CCS T;  2BZ8 A;  1I4K 1;  3HXV A;  4RQE A;  1NEB A;  3L2R A;  2ZXF A;  1IB8 A;  2QYZ A;  2EGA A;  1X2G A;  3LX7 A;  3HXY A;  3CCM T;  4KR3 A;  4FM4 B;  1B07 A;  1C0M A;  4M78 D;  1YNZ A;  1K0S A;  4FW2 A;  4PJJ A;  4LDY A;  3PCO B;  4RTW A;  3OYF A;  5CK9 A;  1UGQ B;  1NEG A;  2LNV A;  2RHY A;  3EG0 A;  4M75 D;  1G3T A;  3OMG A;  4AFZ C;  3EG1 A;  2LX9 A;  3UA7 A;  2VGM A;  1X43 A;  4R0K A;  2C0T A;  3IKM B;  1NLO C;  4OB0 B;  4F7U E;  3H6Z A;  1VYT A;  4AG1 C;  1GBQ A;  5CCA A;  2CSQ A;  2J6F A;  3KFV A;  3PTA A;  2HNI A;  2DET A;  4PK4 A;  3ULR B;  5C6S A;  3MQZ A;  3HY0 A;  1S72 T;  2A0F B;  1YIT A;  2DIL A;  1JBM A;  3ZBD A;  5GJW B;  4DOV A;  2KAF A;  5IH2 A;  2DO3 A;  3I55 A;  2QAS A;  2VKN A;  3WXM B;  1Q7Y U;  2DYB A;  2EBP A;  4FSX A;  3CCU A;  3X24 B;  2RQT A;  4L6V 5;  3URG A;  1G3Y A;  3CC4 T;  2PQW A;  1H4S A;  1RAF B;  5HKC A;  3RKW A;  1Q81 R;  2K4Y A;  1N8R U;  1JJC B;  1NLP C;  2KT1 A;  2P0K A;  1WYX A;  5C52 B;  2K6D A;  3JCM d;  4KH1 B;  5F5W A;  2G4C A;  1YP5 A;  3MP8 A;  4OP0 A;  3JCM b;  2NUT A;  3LGF A;  2LRQ A;  2EKH A;  1H3H A;  1V29 B;  4RCB A;  3NHN A;  2PNI A;  1JJ2 S;  3I7F A;  5EG2 A;  4CS3 A;  2HDA A;  1OPK A;  2FL7 A;  2F5K A;  1M1K U;  3TEH B;  4LD9 K;  4F7U G;  2KRO A;  3OYJ A;  3CC2 T;  11AS A;  5A0D A;  3VS1 A;  4PJO D;  2XIC A;  1NPP A;  2DM1 A;  4EMK B;  3A8L B;  4ME7 A;  2KT8 A;  3MJX A;  1RL2 A;  3NET A;  4JJC A;  4UP9 A;  3EG2 A;  4BI3 A;  2A3L A;  3P8H A;  3DSQ A;  4QVD A;  1ZSG A;  4ZNX A;  2ROT A;  4M77 G;  1GCP A;  4GY5 A;  2XHC A;  4J9D A;  4J9H A;  4LNP A;  4M7D C;  4DBF A;  1XQH A;  2QDY B;  4VUB A;  4RG2 A;  4CRI A;  1NM7 A;  5FWC A;  1UEB A;  1WI7 A;  1JB0 E;  2A08 A;  1J5W A;  1QCN A;  2AKK A;  1MND A;  2I4O A;  2I4N A;  4J5Y A;  1USY A;  1VOM A;  2OX7 A;  3P8Y A;  2KYB A;  1HC7 A;  1WPY A;  2ZT7 A;  2G3R A;  2DL7 A;  1U1S A;  3BJU A;  4FT4 A;  4H2U A;  2E6Z A;  2XG8 D;  4CI0 C;  1NYF A;  2ZPG B;  1X6G A;  3VQY A;  1CKB A;  2VYT A;  2DL5 A;  5FWB A;  3GNF B;  3ZL7 C;  3AT1 B;  3QO7 A;  4OGE A;  2R58 A;  1VQ7 Q;  4M7A D;  4H2W A;  1AZG B;  1VQ9 A;  3A5Y A;  1I81 A;  2A37 A;  1QCF A;  1M8M A;  2COY A;  4M7D G;  2VAS A;  2EYX A;  4L59 A;  1TG0 A;  2LJ1 A;  3LSS A;  4RTV A;  3UGQ A;  2KNB B;  1YCY A;  1VUB A;  1E24 A;  4KGV B;  2RPN A;  3QZ5 B;  3DLL A;  5KYW A;  2MK5 A;  2Q7H A;  3P8T A;  3OW2 P;  3IAL A;  1VQM A;  5IHI A;  2WAC A;  1MHN A;  1Z9Z A;  5GJV B;  1B34 B;  3QYH B;  1D0Z A;  1WU7 A;  1RI9 A;  5LJ5 h;  3A7U A;  1M90 U;  4F14 A;  2B8A A;  4BUG A;  4NS5 A;  4M77 E;  2DIG A;  1KSW A;  4P75 C;  4JRK A;  4AG2 C;  2K57 A;  1OX9 A;  3SFM A;  1PRL C;  3OYM A;  4ZTJ A;  4PJN A;  1WQW A;  4TVY A;  4X34 A;  1WFW A;  2K7A A;  2RQV A;  3H0F A;  4WI1 A;  2K5F A;  1W70 A;  1K9A A;  3QJ6 A;  4LVI A;  4WJ4 A;  5C53 B;  4EPC A;  1MMN A;  4A63 B;  4OMF B;  4HT4 A;  1NYR A;  1X55 A;  4FYY B;  2KXC A;  3QO8 A;  3DKM A;  1X2K A;  1SSH A;  4YRL A;  2JTE A;  4HKE A;  2K3B A;  2J6K A;  2DKG A;  3C95 A;  4ELZ C;  2KGT A;  2RO0 A;  1N8R C;  3CPW A;  1QVP A;  1UB4 A;  2JM8 A;  4RTU A;  2RB6 A;  2E3I A;  3E1S A;  1YWP A;  5EC7 A;  5GAM d;  4FT2 A;  2LJ0 A;  3JCM X;  5GAN 4;  4E7I A;  3L4G B;  1TSF A;  4Z02 A;  4OF1 A;  2M16 A;  5GAO l;  2XID A;  4A4F A;  4C92 C;  1YGB A;  1I5O B;  2DL3 A;  4WTO B;  2GTO A;  3TUP A;  1Q81 U;  1N8R R;  1S1N A;  4AFU C;  3CCJ A;  1D0X A;  2DQ0 A;  1VQ9 Q;  3EG9 B;  1UGP B;  3VBB A;  1WQ7 A;  3QJY A;  5ECA A;  1YWO A;  3RKX A;  3A31 A;  3INZ A;  1GRI A;  1USY C;  4YTL A;  2M1H A;  2VXF A;  3TRE A;  2XGT A;  2E64 A;  2J3L A;  4ZTF A;  4DBR A;  1LOJ A;  5FRM A;  3M0R A;  1YJW T;  1AHJ B;  4M78 F;  1EIF A;  2DDZ A;  4ESR A;  3CC2 Q;  1YHQ A;  2D8J A;  1UJY A;  3M4P A;  4JS5 A;  4PJM A;  2QGG A;  3MET A;  1MGQ A;  4QQD A;  2COW A;  1PCX A;  3KXT A;  1GFC A;  1UTI A;  2QTV A;  4WCI A;  3VYH B;  4C0D C;  1I1J A;  2MIO A;  4HCC A;  4M78 G;  4G84 A;  2J06 A;  1KQS A;  2Q7E A;  3HTZ A;  2DEU A;  4D6W A;  3VS6 A;  4XTY A;  5D6W A;  3PE0 A;  2DD5 A;  4YRK A;  1X54 A;  2E70 A;  1N6A A;  3PT9 A;  2ZTG A;  2I0N A;  4ZN1 A;  4P3N A;  2RF0 A;  3RL6 A;  4E6R A;  2KMT A;  1OYX A;  2X51 A;  4H02 A;  1M90 R;  3V8K A;  2RH2 A;  3I35 A;  3OBW A;  3J81 E;  2ODR D;  2MAM A;  4JLG A;  2D6F A;  1AVZ C;  3HFN A;  5KNN A;  3OY9 A;  5CO7 A;  1R0C B;  1K76 A;  3CPF A;  2J6O A;  4F7U B;  4H2X B;  3TQ7 P;  2E10 A;  1Y96 B;  2RNA A;  2EGE A;  2QA4 T;  1QVF S;  2DK3 A;  1Q95 G;  3CEY A;  4DBQ A;  2HBP A;  5FW9 A;  1D09 B;  1HXD A;  4JZ3 A;  2GF7 A;  1VQP T;  2I4L A;  4P71 A;  2IIM A;  2X4W A;  3ZFJ A;  1WIE A;  3MPU B;  1RIQ A;  4TVA A;  3QO3 A;  4EIK A;  2Y4Y A;  4X5O A;  1MUZ A;  3G1Z A;  1X27 A;  1I0C A;  3LYI A;  4HWR A;  3HXU A;  1JJC A;  2K5I A;  2ZZD A;  1N9R A;  2P0L A;  2RI2 A;  1U8R A;  2O4X B;  4C8Q B;  1ADY A;  3JV3 A;  3M0P A;  5D6Y A;  2DX1 A;  4AFS C;  1QMC A;  2MF2 A;  5GAN 5;  1PNJ A;  1QCO A;  1VQ8 Q;  3HXW A;  2EYZ A;  4OVA A;  2QHT A;  4JS4 A;  4P75 A;  5HGQ A;  1VIE A;  4PL6 A;  3CBM A;  4RTT A;  3CCU Q;  2HBW A;  4ZTU B;  1BI0 A;  4BY6 C;  4M75 G;  4ZGJ B;  3OW2 S;  3MO8 A;  2ECZ A;  2E41 A;  2LP5 A;  1VQO Q;  3A7A A;  1EVL A;  4LD6 A;  1JJ2 A;  3VS2 A;  4M4Z A;  3CCQ Q;  5DY9 A;  2EQJ A;  5FU7 B;  1U06 A;  4OB3 B;  2XU8 A;  4TQD A;  1E22 A;  3P8V A;  2DLP A;  3V8J A;  1KC8 C;  4M7D A;  4JLI A;  1N27 A;  3QUI A;  3S3M A;  1VQZ A;  4LE9 A;  3SD4 A;  1WXB A;  3L2Z A;  2NLU A;  4YRT A;  2P5I A;  2XKO C;  4RQF A;  1M1K R;  3U23 A;  1JXO A;  3MEY A;  4PLL A;  3UFG A;  1R0B G;  1UG1 A;  1QKX A;  1FMK A;  1YIJ Q;  1YB3 A;  5DLO A;  4OLF A;  1NJ2 A;  2DEQ A;  2JT4 A;  2QQS A;  4M7D D;  4LDX A;  3JCM J;  3VQW A;  5LJ3 d;  2V8J A;  1HD3 A;  2Y90 A;  3C94 A;  2IVW A;  4M7A F;  5GAO m;  1VQ9 T;  1EOV A;  2HQE A;  3FRN A;  1BBW A;  2RM4 A;  4TVW A;  2I2L A;  2QI2 A;  1VIF A;  3FJP A;  1Y07 A;  1LPL A;  2R5M A;  4BI8 B;  5IXB A;  3G71 T;  4BE2 A;  1AWW A;  4DOW A;  4B9X A;  1PRM C;  4F16 A;  2YT6 A;  2XI9 A;  4YCU A;  5GAO r;  3WVE B;  3RER A;  3SWN C;  1AWX A;  3UAT A;  4ELY C;  1KD1 R;  3VQX A;  3CC7 Q;  4O2D A;  4IUV A;  2J05 A;  1Q82 C;  2CGH A;  5M9O A;  3TVT A;  1C1A A;  4BD3 A;  1W4S A;  4UP7 A;  2K3Y A;  2RJD A;  1OX8 A;  3NFC A;  1ABO A;  2JMC A;  4YP0 A;  1QP3 A;  4JRI A;  3JB9 G;  4QVC A;  3RMQ A;  2EYQ A;  3V7C A;  1RAA B;  1KIK A;  1X56 A;  4QKU A;  2E12 A;  4QVZ A;  2L3P A;  3X25 B;  2X9H A;  3BW1 A;  1VQ8 A;  3CMA A;  3THK A;  2NUP A;  1KC8 R;  4F7U A;  2BTT A;  3C12 A;  1EFN A;  2LT1 A;  1K0X A;  2JOY A;  3M0T A;  4PJO G;  2ZPH B;  1D1C A;  3PZC A;  3CCV Q;  3VS5 A;  1BK2 A;  2BZY A;  1ZA2 B;  5CVI A;  2YRD A;  2QQB A;  4P73 C;  3CCR A;  1G5V A;  3A7R A;  4IUP A;  4J7F A;  4DEY A;  2YXY A;  2M9U A;  1HSQ A;  3E19 A;  2MPX C;  2L8D A;  1LJO A;  2AKW A;  1X01 A;  2LQK A;  3REB B;  3G4S Q;  4UP8 A;  4MZT A;  3JSC A;  4EMH A;  3UWN A;  5KCO A;  3CCE A;  4J9B A;  1VQN A;  4X9D A;  2M02 A;  2OAW A;  3HFZ B;  1LNX A;  1YFN A;  1YIJ A;  1WHL A;  2ZNI A;  3M4G A;  2L2P A;  2IY5 A;  3QII A;  4E51 A;  1VQM Q;  3CCE T;  1M3A A;  4J8O A;  3PFS A;  3NGP A;  1KMN A;  4LVM A;  3E9H A;  1AOJ A;  2E4H A;  2X3X D;  2JVV A;  1YI2 A;  3TSZ A;  5FRN A;  3L1A A;  3UF4 A;  3OYB A;  1NYG A;  2LQ8 A;  1NJI C;  2JNG A;  1YN8 A;  3MCA B;  1SRM A;  3JCM h;  3G6E A;  4RTX A;  1FMV A;  5KYY B;  1WA7 A;  2R57 A;  3JRZ A;  1SHG A;  2E1H A;  4FYV B;  4R56 A;  2DFU A;  1X2H A;  1QLY A;  1R77 A;  4Y91 A;  2MWP A;  5GAN 6;  4BWA A;  2K9G A;  2KQW A;  1FMW A;  3NTI A;  4J9G A;  1P92 A;  4NCX A;  4M7D F;  1ZSZ C;  4LDW A;  2MCN A;  1ZBJ A;  1M1G A;  2ZCF B;  3I55 Q;  3CCQ T;  1H8K A;  3QKJ A;  1UFF A;  3OS5 A;  3RMS A;  1YJW A;  1QVF P;  2PME A;  1M5Q 1;  1PWT A;  1WYD A;  2L0A A;  4M7D B;  3V7R A;  4C5I A;  3MEW A;  2QHV A;  1XOV A;  2QTX A;  1AWJ A;  1UGR B;  3CCM A;  2CJB A;  1M4Z A;  4C5H A;  3CCL T;  2CZ7 B;  1ZHI A;  1IHW A;  2HEQ A;  1VQ8 T;  4M75 C;  1X6B A;  3CCJ T;  1ADJ A;  4PFP A;  2JS2 A;  3M0U A;  2PZ1 A;  1FYN A;  4Q6G A;  3R07 A;  2P84 A;  1LCK A;  4HCK A;  1ZUY A;  3ERR A;  2HL3 A;  2YWW A;  4ZIB A;  1YJN A;  1IL2 A;  3OYG A;  1GBR A;  1Y71 A;  2RI3 A;  3R6O A;  2ZR3 A;  5IHN A;  4E47 A;  2V26 A;  3CMA Q;  1QVG P;  2L89 A;  1PSE A;  1SEM A;  5I11 A;  5K1X A;  3IQL A;  1ATI A;  1W1F A;  2DF6 A;  4QW2 A;  3SB2 A;  2V1Q A;  3VUB A;  2W0Z A;  1GFD A;  1H4Q A;  1K8A C;  2EVR A;  2BKD N;  1TU0 B;  4M75 E;  2DPP B;  3HRT A;  3JB9 F;  2QDL A;  4PKC C;  1X75 C;  2DBM A;  5IAY A;  1OQK A;  2DRK A;  1ASZ A;  4RTY A;  3M53 A;  4MML A;  1B7Y B;  4P74 C;  5CKH A;  2HQH A;  2QEX A;  2KY9 A;  2VVK A;  1E6G A;  1Q86 U;  4YYE A;  2C0I A;  2P0P A;  5LJ5 g;  3VRY A;  1UGV A;  4MMK A;  1NYQ A;  4QQ6 A;  4EMG A;  1SPK A;  2EFI A;  2GCX A;  4AFQ C;  2E5K A;  4TVA B;  2NS6 A;  4KR2 A;  1AZE A;  1Q82 U;  1DJ7 B;  2H3E B;  2RHI A;  3PCO A;  5KYN A;  3RKY A;  4XU1 A;  1QF6 A;  1M30 A;  4XTX A;  1SRL A;  1PKS A;  5GMK h;  3M9Q A;  3CCV A;  2IG0 A;  3OYY A;  1FYF A;  2ZT8 A;  2D9T A;  4BI4 A;  1K9M R;  1K9M U;  2NUT B;  3LC0 A;  3H9N A;  2D0N A;  3J80 E;  3UPU A;  1QKW A;  4RG8 A;  2A7Y A;  5FU7 C;  1VQ6 Q;  3MF1 A;  3MKD A;  2VV5 A;  1BIB A;  5CQY A;  5GAN e;  3A5Z B;  3AHU A;  1Q82 R;  3HFO A;  4LVJ A;  2M51 A;  2D8H A;  2DXU A;  2DBK A;  2MMP A;  3CPW S;  2HKN A;  3OB9 A;  4P71 C;  3A1P A;  1KD1 U;  2QXF A;  1PYS B;  4XTZ A;  1TXQ A;  1X6O A;  1YIT Q;  3OSS C;  3RR6 A;  3CCJ Q;  5ELN A;  3UDC A;  1X2Q A;  2NUZ A;  4F7U F;  1XNI A;  3M4Y A;  3OYD A;  2F2X A;  3EG9 A;  2QQR A;  5GAN g;  3L2W A;  1WXU A;  3SDZ A;  1BIA A;  3PNW C;  5AT1 B;  2FRY A;  1Q7Y R;  2RHS B;  4P73 A;  1VYV A;  1K73 R;  1MMG A;  1WJQ A;  2ARU A;  1WHG A;  5CQX A;  1B8A A;  1UE9 A;  4OMQ A;  2RN8 A;  4FCY A;  2Q5H A;  4TQF A;  2V1R A;  1G8X A;  5LJ3 f;  5HK3 A;  4FIB A;  4KGZ B;  3RDV A;  4QT7 A;  2YLC A;  4EX5 A;  2E5Q A;  5CKB A;  1JEG A;  2FZK B;  2XDP A;  1VQK Q;  2ZIM A;  2LMJ A;  1ZLM A;  3CC2 A;  4IUR A;  5IN1 A;  4C0F A;  3OBY A;  4BDY A;  3EH2 A;  2CH4 W;  1WJR A;  4JRQ A;  1E1O A;  4HT9 A;  2DZ9 A;  3VU3 C;  3BFM A;  5ELO A;  1SSF A;  1T3L A;  4TTV A;  1M2V A;  1RI0 A;  2EJ9 A;  3V7S A;  4JRP A;  4PG3 A;  4KGX B;  3CD6 Q;  2LJ3 A;  3JB9 J;  1RAB B;  2KE9 A;  1ARK A;  2GGR A;  1BI1 A;  4OMN A;  2ALY A;  4R55 A;  2D1X A;  2OTL A;  3E9I A;  2QQ9 A;  1ZUK A;  3G1J A;  5GAN f;  3CCU T;  1BB9 A;  1OPL A;  2LZ6 B;  3FIF A;  4PJO C;  4ZN3 A;  4OMP A;  4GLM A;  4JDS A;  1KQ1 A;  2QHS A;  2LCL A;  3VJP A;  1WHM A;  2C7I A;  4DQ2 A;  3PVQ A;  5GMK e;  5LJ3 j;  1D3B B;  2CT4 A;  1SES A;  2ARS A;  3QO5 A;  2HQX A;  3REU A;  1JO8 A;  4RMO A;  3MEV A;  3M54 A;  4DPG A;  3JCM c;  3A74 A;  2FZG B;  4K87 A;  3EHR A;  3OS0 A;  2XTI A;  2PUO B;  2VUB A;  5L8R E;  4YRQ A;  5KYW B;  1BCM A;  1QWF A;  3CME A;  3HP9 A;  2DL4 A;  4H2T A;  3CPW P;  3EGX B;  2AZV A;  1GGM A;  1YHQ T;  1H4V B;  3HSB A;  2DTI A;  4M75 B;  1O75 A;  1YJN Q;  1SHF A;  3MF2 A;  3RAC A;  1KQS P;  4DBH A;  4C92 A;  3OD1 A;  2AHJ B;  5FRO A;  1CKA A;  1K1Z A;  2RHX A;  1JRI A;  2ZNJ A;  2JMA A;  1NG2 A;  5KYU A;  2JXB A;  3CCR T;  4RDX A;  4HCZ A;  1TWB A;  1OV3 A;  2O9S A;  1YCS B;  3FEO A;  3MEA A;  1ASY A;  3SWN A;  1SRY A;  2DVJ A;  2X4Y A;  4N0A A;  5GAO p;  3UH0 A;  1TOV A;  5A0L A;  3A8M B;  3HFZ A;  2CJ9 A;  2JTF A;  3CBO A;  4PFZ A;  4A4G A;  3H8Z A;  5L23 A;  4WJ3 M;  1Q86 R;  5KCH A;  4M78 E;  1B34 A;  1VQ5 Q;  2EYW A;  4BE1 A;  1VQ6 A;  2CS7 A;  1VA7 A;  5GAN 2;  2EPD A;  1KOG A;  4YRC A;  2G6F X;  5KH6 A;  3E2U A;  2OTJ A;  4IUQ A;  2R5A A;  2QAZ A;  4PJO E;  2GFU A;  4FU6 A;  2XMF A;  1TUD A;  2DMO A;  4BE0 A;  2D0Q B;  3PMT A;  1Z9Q A;  2DXT A;  1PSF A;  2YHT A;  2LCS A;  4DA4 A;  4D8K A;  4LN2 A;  4DEX A;  3S3N A;  3CXC A;  5GAN d;  1KK7 A;  2DRM A;  4J6W A;  5LJ3 e;  2RD1 A;  4C0Z A;  4HCB A;  1V1C A;  3OW2 A;  2QA4 A;  1WGS A;  1QW1 A;  2YLB A;  4OMO A;  1E7O A;  2EQM A;  4L5G A;  5GAM h;  3O5Z A;  5IHK A;  1KD1 C;  2LCC A;  2DIQ A;  4RKU E;  5HY6 A;  4ZGE B;  1EFW A;  3LW5 E;  2EIF A;  3VS7 A;  2KRN A;  3X28 B;  2HD0 A;  4NOY A;  1K4U S;  4YRN A;  3HY1 A;  2KR3 A;  3ASK A;  4XU2 A;  1QVG S;  4LNS A;  2MOX A;  5K1P A;  1YJ9 Q;  3CQT A;  4LDV A;  1T3S A;  2ZT6 A;  3PIO A;  3X26 B;  3CCL Q;  4M78 B;  5DLQ E;  4HVU A;  2ESW A;  2F2V A;  2QG9 B;  2FVU A;  1NE8 A;  3P8B B;  2AMC B;  3EAE A;  2OJ2 A;  4X9C A;  1ZQ1 A;  2PVD B;  1L0W A;  4ANJ A;  8AT1 B;  3M56 A;  4HXJ A;  4GLK A;  2RHS A;  2OAU A;  1ACM B;  4O6J A;  3QNE A;  1NPR A;  2NWM A;  3I55 T;  1IHV A;  1BBZ A;  3NTK A;  4P72 C;  2CP7 A;  1YFS A;  3MP6 A;  2ZIO A;  4P74 A;  1WNL A;  1UUE A;  1AT1 B;  2LQN A;  4WF2 A;  3Q1J A;  1ABQ A;  3PIP A;  4B6M A;  3D7S B;  1KFZ A;  2RJC A;  5I22 A;  1TTH B;  3SHW A;  2AK5 A;  2VXE A;  4L87 A;  1LVK A;  3LWH A;  2CUD A;  4JZ4 A;  2AT1 B;  2ZAE A;  2PTK A;  1M2V B;  5GMK i;  1S72 Q;  3JCM Q;  4EO4 A;  3CBP A;  3S6W A;  4J9E A;  4PJO F;  5A0G A;  1WJS A;  4N4G A;  1F1B B;  2V8K A;  4PLI A;  5J3B A;  2ATC B;  5E3I A;  2DYI A;  1B7Y A;  5FLX E;  4ORZ A;  3L2V A;  1RAH B;  1N5Z A;  3MHX A;  1RLQ C;  4C0G A;  4HVC A;  2IPO B;  4CC2 A;  2FHD A;  2EW3 A;  3EG3 A;  4KH0 B;  1YJN T;  1U1T A;  2I4M A;  2KI7 A;  3OMC A;  3OS2 A;  3CMQ A;  2JUF A;  1I07 A;  3EGX A;  2LNH B;  1M1F A;  2JZ2 A;  3ME9 A;  4A53 A;  2CP5 A;  1VQP Q;  4H2X A;  4E7Z A;  5IT9 E;  4JPB W;  3PMI A;  4A4K A;  3QZ9 B;  4XAX B;  4FYX B;  4N4H A;  5LJ5 d;  2JM9 A;  2HMA A;  1G5H A;  2ZIN A;  4J9I A;  2B86 A;  1K8A U;  1BU1 A;  2K3X A;  2QQA A;  2FG0 A;  3A8H B;  2H8H A;  2O2O A;  4UPA A;  3G71 A;  4M7A E;  2LDM A;  2CT3 A;  1PG5 B;  1IRE B;  3CME Q;  3HTR A;  3JAM E;  3CCQ A;  2EQU A;  3LH5 A;  2EWN A;  1IXD A;  3QWY A;  3H0I A;  4C92 B;  3M55 A;  1UJ0 A;  3G7Z A;  1Y57 A;  2P0Q A;  4HWO A;  2ART A;  1C6V X;  4CH5 A;  4XEO A;  3ZEH A;  1HTT A;  4LUD A;  4LUE A;  1U5S A;  3IKL A;  4YDQ A;  3M5A A;  2EYY A;  1VQ7 T;  4XU0 A;  4RTZ A;  3OQ5 A;  2SEM A;  4OB2 B;  5GMK m;  5GAO n;  3VS3 A;  4AH6 A;  4YRR A;  4AT1 B;  1VQ4 Q;  1SG5 A;  2CYZ B;  2WSC E;  2DA9 A;  1OUL A;  4Z88 A;  4C8Q G;  1VQK T;  4NL2 A;  4LVL A;  2KEA A;  3UGT A;  3LWI A;  3GBQ A;  4A4H A;  3C0C A;  1PYS A;  2AZS A;  3JCM e;  3M58 A;  3MP1 A;  4M75 F;  12AS A;  2ZZG A;  2BZX A;  2ENM A;  4E7S A;  4H2Y A;  3I56 Q;  4A4E A;  2PVO B;  2JW4 A;  2XK0 A;  1FX7 A;  5I2M A;  4CS2 A;  1KG1 A;  2VB6 A;  4II1 A;  3QHS A;  2KK4 A;  4LXC A;  1YJ9 T;  4P5N A;  5D7U A;  4YRM A;  2C8M A;  3NTH A;  3QYG B;  2FRW A;  3JCM g;  3RBB B;  2ZPI B;  1BKB A;  2ZPF B;  1J3T A;  2KYM A;  1GCQ A;  1WLP B;  2XDB A;  1D1B A;  2X4J A;  5KYX A;  3VV0 A;  1VQ6 T;  1PHT A;  5AYF A;  2EQK A;  5CIU A;  1U3O A;  1GL5 A;  3HRS A;  4MDW A;  4IUU A;  1VQ4 T;  4CH6 A;  2E65 A;  1KMM A;  5LJ3 g;  3EFO A;  1GXI E;  2CDT A;  2O9V A;  1EVK A;  2RHU A;  1NJ8 A;  2L3R A;  4LVK A;  4YCV A;  3N5B B;  2CP2 A;  3EGD B;  4P3P A;  4PFO A;  1R8O B;  2GTJ A;  5GAM f;  5C0M A;  1ZA1 B;  1AEY A;  3WQZ A;  1E6H A;  2NUP B;  4G85 A;  4E7J A;  2MYS A;  2DXB A;  4M7A C;  2KRS A;  2RHQ A;  1H64 1;  1Q7Y C;  3ICA A;  2DJQ A;  2PU9 B;  2KSS A;  2LQW A;  4Q15 A;  1K8A R;  1VQL Q;  3GF5 A;  2K79 A;  3RUX A;  4N0A C;  5LJ5 f;  3R6N A;  1TUC A;  2GQI A;  4J83 A;  2CP6 A;  1GCQ C;  4J7I A;  3CME T;  1EIY B;  2COZ A;  2LX7 A;  3QDF A;  4V2S A;  1IGU A;  2VGN A;  2ZZF A;  3EGU A;  2CP0 A;  5CAI A;  3VKI A;  1C0A A;  1VQL A;  4E7H A;  4C0D B;  1H92 A;  1AWO A;  1KHC A;  2HL5 C;  2M0O A;  1IRX A;  4JUV A;  2W10 A;  2FZC B;  2CZ6 B;  2C06 A;  3J7A F;  9ATC B;  3QPH A;  1SF9 A;  1ZBX A;  3SWN B;  5GAN 7;  3HRU A;  2VWF A;  2LVM A;  1PC0 A;  1E1T A;  4H2V A;  2DAQ A;  3I9Q A;  1YI2 Q;  4C92 E;  1YI2 T;  1X69 A;  1D0Y A;  1OI1 A;  4ATO A;  2KRM A;  5GAN 3;  1SKU B;  1MNE A;  3GIB A;  2JJ9 A;  4FSS A;  2ZPB B;  4C8Q C;  3VUZ A;  2F5T X;  2A36 A;  4KQE A;  4YRS A;  1XTD A;  3TEH A;  2KVQ G;  4YRJ A;  2BE7 D;  4PNO A;  2E6N A;  1WHK A;  1LYL A;  1MV3 A;  3DLM A;  2FYK A;  4J6X A;  1O9S A;  3CCS Q;  1B3Q A;  3EFR A;  2MI6 A;  4RUG A;  2EL9 A;  2OTL Q;  1MV0 B;  2GQV A;  3I56 A;  1Z7M A;  3VS4 A;  4BAC A;  3X20 B;  2LC4 A;  1IZ6 A;  4HA8 A;  5LL6 S;  3VS0 A;  2OTJ Q;  3QDR B;  1WXT A;  3NMZ C;  3LH0 A;  3OS1 A;  1SET A;  3RNJ A;  1VQL T;  2QEX T;  1Y7X A;  1CSK A;  2FPD A;  4CS4 A;  1M27 C;  2AKW B;  2RA2 A;  5HCK A;  2EJF A;  5LJ5 e;  2DER A;  2K2M A;  3BDL A;  3BE3 A;  2K5L A;  4J6Y A;  1N9W A;  1W2B A;  5FU6 C;  4EDU A;  2ED0 A;  4Y92 A;  2AIR B;  1W66 A;  2Q7G A;  3CD6 T;  3ER0 A;  3LSQ A;  4XTU A;  2FB7 A;  2X4X A;  5GAN h;  2BIV A;  7AT1 B;  1YFT A;  2ZR2 A;  4MZP A;  1D1A A;  3OYC A;  3RF1 A;  3KFU A;  1ZSZ A;  2RK1 A;  3JCM V;  1WZO A;  1QVG A;  1G3W A;  3EHQ A;  4ZGD B;  4FW1 A;  3FC3 A;  4IIM A;  4E2F B;  3JB9 I;  1VYU A;  2CUB A;  2DE0 X;  2PUK B;  3OYL A;  1VQ4 A;  2RQW A;  3EGD A;  1QQJ A;  2Y4X A;  4C5G A;  1KJW A;  2SRC A;  4Q5W A;  3TCJ A;  3UA6 A;  3QTC A;  4CC3 A;  2CZ1 B;  3QSU A;  4J15 A;  2CRE A;  2ALY B;  5LJ3 h;  3CD6 A;  3LLR A;  3OYE A;  2WSE E;  2HSP A;  1G3S A;  5KE3 A;  5DM7 R;  2RHQ B;  2Q5I A;  2ROL A;  2K2V A;  1G2B A;  2M0Y A;  1EX4 A;  5CKF A;  5FU6 B;  1OEB A;  4YRF A;  3MEU A;  1VQ5 A;  1JXM A;  1WHJ A;  3I56 T;  3BY7 A;  2CJA A;  2V8I A;  2NYS A;  4KUI A;  1M90 C;  1EIY A;  2FO0 A;  4OML A;  1Z7N A;  2DTH A;  1QVF A;  4EMK C;  3G4S T;  3HXX A;  4E7L A;  1IGQ A;  1B7T A;  2Z0W A;  4YRP A;  4KBM B;  4PJO A;  2ZZE A;  3L2U A;  1PD0 A;  4XU3 A;  3CC4 Q;  3JCM W;  2MWO A;  2F69 A;  1YFR A;  1TUG B;  2L5Q A;  4O5V A;  4A54 A;  4YCW A;  1N9S A;  2DZC A;  4GBQ A;  5GAM e;  1PKT A;  2RJE A;  1Q81 C;  4TVR A;  4PHC A;  2EGC A;  2DQ3 A;  1MMD A;  2C0O A;  2DL8 A;  3HKS A;  4C8Q E;  3CCV T;  2KXD A;  4M78 C;  5A2Q E;  3OSV A;  1HK9 A;  3M0S A;  4JJB A;  4F04 B;  1KC8 U;  3CCR Q;  3O8V A;  2BUD A;  2ODR C;  1Y96 A;  2ABL A;  4PJO B;  3NEM A;  1JU5 C;  1K73 C;  1VQN Q;  3C4S A;  1M1K C;  1VQO A;  6AT1 B;  3VRZ A;  1YHQ Q;  2CP3 A;  1RUW A;  2KBT A;  2CSI A;  1RAD B;  4J9F A;  4X1V A;  1NJ1 A;  4RMF A;  1EQR A;  3FB9 A;  3EH1 A;  2XD0 A;  4HWT A;  1M3B A;  1Y0M A;  3A32 A;  1WHH A;  1NBE B;  1H3Z A;  4E7K A;  3L4G A;  4AMC A;  2DU5 A;  3GP8 A;  2HSE B;  1W2B P;  5GAM j;  1B70 B;  2CH4 A;  3VQV A;  3G71 Q;  3BDU A;  5HK0 A;  4C8Q D;  2X3W D;  2RQR A;  4OGC A;  5GAO q;  2DNU A;  3L42 A;  1FXX A;  4HWP A;  2A28 A;  2FPE A;  3CMA T;  4K88 A;  1RAC B;  2J3M A;  1NJI U;  1KQS S;  2A8E A;  1M9S A;  2DJZ A;  4BDZ A;  3FJ5 A;  1VQP A;  4HVV A;  3A8O B;  3NPF A;  2L3S A;  2YUO A;  3M4Q A;  5KYU B;  4F17 A;  4J9C A;  4Y28 E;  4MDX A;  4HVW A;  3CCS A;  2GBQ A;  4XTV A;  2KDS A;  2ZPE B;  4CH4 A;  2DXC A;  4YRG A;  4H2S A;  4C8Q F;  3OYI A;  1K73 U;  4XQ3 A;  2DVE A;  5J26 A;  1RAI B;  2BE9 B;  3G6E T;  5LJ5 j;  4B9W A;  1QWE A;  4IKF A;  2L3Q A;  3H0H A;  2RHZ A;  4M77 A;  2YDL A;  4XTW A;  2HAX A;  3HHT B;  1AD5 A;  3PVL A;  4C92 F;  1VQO T;  2EAY A;  4P72 A;  3M59 A;  3CC4 A;  1ZSZ B;  3TU4 K;  2JS0 A;  3SEM A;  3V8L A;  4C92 D;  1HJD A;  3E9F A;  1ZUU A;  2CKK A;  2ZGW A;  1UEC A;  2H3J A;  5GAN j;  3JB9 D;  1OZ2 A;  1G51 A;  3EFO B;  1FWZ A;  5GMK l;  1YIT T;  3RES A;  3IG2 A;  1UGS B;  1VQ7 A;  3REX A;  2RJF A;  4M77 D;  2OTL T;  4OMM A;  2HZY A;  4Z89 A;  1Q86 C;  4CH3 A;  4K11 A;  1A0N B;  3HL8 A;  4UC4 A;  2GFA A;  5GAN 8;  3RIR A;  4RCC A;  2F1L A;  3NEL A;  3JCM f;  1VQM T;  3CCE Q;  3CC7 A;  2O31 A;  1NJ6 A;  1VQK A;  3WVD B;  2QHU A;  1WLE A;  1MMA A;  3KUF A;  4M78 A;  1KQ2 A;  4BW9 A;  1B76 A;  1RAG B;  3GOX A;  1I8F A;  3DB3 A;  3G4S A;  1JQQ A;  2LTO A;  4HT8 A;  2DU7 A;  3H41 A;  3QWX X;  4LDU A;  4XEM A;  1WX6 A;  5CKE A;  4M7A B;  1W2B S;  2E3H A;  4JJN K;  1NJI R;  1UHC A;  2PMF A;  4N4I A;  1JJ2 P;  2O88 A;  5KE2 A;  2QA4 Q;  3LGL A;  2O01 E;  2YUP A;  1RAE B;  1T0J A;  2QGF B;  1VQ5 T;  1NZ9 A;  2AKL A;  3KBG A;  3VYG A;  4M77 C;  3A8G B;  1NJ5 A;  3PGG A;  4KUL A;  4ZTZ B;  1T0H A;  2X35 A;  3RGL A;  1VQN T;  5J39 A;  2ZT5 A;  2ED1 A;  3E9G A;  1D3B A;  2HCK A;  3W3S A;  1BI3 A;  1W6X A;  1M8V A;  2OI3 A;  3M57 A;  2YSQ A;  3A5Z A;  3CCL A;  2E5A A;  4Z8A A;  4YRO A;  3OYA A;  1UDL A;  4YRI A;  8ATC B;  2RI5 A;  3OYN A;  2PVG B;  1NNH A;  2RMO A;  1ZX6 A;  3QG1 A;  1B70 A;  3GLX A;  3HPW A;  2JN0 A;  4MZM A;  1M2O A;  2FEI A;  2DTO A;  2EKO A;  4XK8 E;  2CZ0 B;  3HXZ A; 
#chains in the Genus database with same CATH homology
 4IUT A;  3L2Q A;  5GMK j;  2YRV A;  3HRI A;  2DD4 A;  3CC7 T;  3DB4 A;  4TWA A;  3QBY A;  4FL6 A;  1BBU A;  1YJ9 A;  2JTM A;  3TEE A;  4C5E A;  4YRE A;  2LT4 A;  3OYH A;  2O4X A;  4C8Q A;  1KHI A;  1YBY A;  1H4T A;  4EMK A;  5I21 A;  1BI2 A;  3EFS A;  2ZCE A;  3QXE B;  5CKD A;  1OZ3 A;  2IY5 B;  1TH7 A;  4YPF A;  3P8D A;  4HWS A;  4QQG A;  2XDD A;  3FLG A;  3T9N A;  3FDR A;  3GPL A;  3TEG A;  1YIJ T;  1I5L A;  4M7D E;  4K86 A;  5GAM g;  1S72 A;  2CIM A;  3NEN A;  3S3O A;  2WSF E;  1QP2 A;  1BYM A;  1SER A;  3CXC S;  5D6X A;  5C51 B;  4KUD K;  2AMC A;  4M77 F;  3GNG A;  3OYK A;  4P3O A;  4C92 G;  2EJG A;  2VC8 A;  5I2S A;  3JB9 H;  4OB1 B;  1G5I A;  4M77 B;  4KT0 E;  4M7A A;  1QE0 A;  3OA6 A;  1K9M C;  5CR2 A;  2P4T A;  4M7A G;  4BB7 A;  4BY6 B;  3HRK A;  4NL3 A;  2OTJ T;  3HFV A;  3F70 A;  4M75 A;  2E3C A;  3UT1 A;  2RK2 A;  3JCM P;  3CCS T;  3HXV A;  1I4K 1;  4RQE A;  3L2R A;  2ZXF A;  1X2G A;  3LX7 A;  3HXY A;  3CCM T;  4KR3 A;  4FM4 B;  4M78 D;  4LDY A;  3PCO B;  3OYF A;  5CK9 A;  1UGQ B;  2LNV A;  2RHY A;  4M75 D;  1G3T A;  3OMG A;  2LX9 A;  2VGM A;  3IKM B;  4OB0 B;  4F7U E;  3H6Z A;  5CCA A;  3PTA A;  2HNI A;  5C6S A;  3MQZ A;  3HY0 A;  1S72 T;  1YIT A;  1JBM A;  3ZBD A;  4DOV A;  2KAF A;  2DO3 A;  3I55 A;  3WXM B;  1Q7Y U;  4FSX A;  3CCU A;  3X24 B;  4L6V 5;  3URG A;  1G3Y A;  3CC4 T;  2PQW A;  1H4S A;  5HKC A;  3RKW A;  1N8R U;  2K4Y A;  1JJC B;  2P0K A;  5C52 B;  3JCM d;  5F5W A;  2G4C A;  3MP8 A;  4OP0 A;  3JCM b;  3LGF A;  2LRQ A;  1V29 B;  4RCB A;  1JJ2 S;  3I7F A;  5EG2 A;  4CS3 A;  2FL7 A;  2F5K A;  1M1K U;  3TEH B;  4LD9 K;  4F7U G;  3OYJ A;  3CC2 T;  11AS A;  5A0D A;  4PJO D;  2XIC A;  1NPP A;  4EMK B;  3A8L B;  4ME7 A;  1RL2 A;  3NET A;  4UP9 A;  4BI3 A;  2A3L A;  3P8H A;  3DSQ A;  4QVD A;  4M77 G;  4GY5 A;  2XHC A;  4M7D C;  1XQH A;  2QDY B;  4RG2 A;  4VUB A;  4CRI A;  1UEB A;  1JB0 E;  1J5W A;  2I4O A;  2I4N A;  4J5Y A;  1USY A;  3P8Y A;  1HC7 A;  1WPY A;  2ZT7 A;  2G3R A;  1U1S A;  3BJU A;  4FT4 A;  4H2U A;  2E6Z A;  2XG8 D;  4CI0 C;  2ZPG B;  3VQY A;  2VYT A;  3GNF B;  3QO7 A;  4OGE A;  2R58 A;  4M7A D;  4H2W A;  1VQ9 A;  3A5Y A;  1I81 A;  4M7D G;  4L59 A;  3LSS A;  3UGQ A;  1YCY A;  1VUB A;  1E24 A;  3QZ5 B;  3DLL A;  2Q7H A;  3P8T A;  3IAL A;  1VQM A;  2WAC A;  1MHN A;  1B34 B;  3QYH B;  1WU7 A;  5LJ5 h;  3A7U A;  1M90 U;  2B8A A;  4BUG A;  2DIG A;  4M77 E;  4NS5 A;  4P75 C;  4JRK A;  2K57 A;  3SFM A;  3OYM A;  4ZTJ A;  1WQW A;  4TVY A;  4X34 A;  4WI1 A;  2K5F A;  3QJ6 A;  4LVI A;  4WJ4 A;  5C53 B;  4EPC A;  4OMF B;  4HT4 A;  1NYR A;  1X55 A;  3QO8 A;  3DKM A;  4YRL A;  4HKE A;  3C95 A;  2DKG A;  4ELZ C;  2RO0 A;  1N8R C;  3CPW A;  1QVP A;  1UB4 A;  2RB6 A;  3E1S A;  5GAM d;  4FT2 A;  3JCM X;  5GAN 4;  4E7I A;  3L4G B;  4Z02 A;  4OF1 A;  2M16 A;  5GAO l;  2XID A;  4A4F A;  4C92 C;  1YGB A;  3TUP A;  1Q81 U;  3CCJ A;  2DQ0 A;  1UGP B;  3VBB A;  1WQ7 A;  3QJY A;  3RKX A;  3A31 A;  3INZ A;  1USY C;  4YTL A;  2M1H A;  2VXF A;  3TRE A;  2XGT A;  2E64 A;  2J3L A;  4ZTF A;  1LOJ A;  5FRM A;  1YJW T;  1AHJ B;  4M78 F;  1EIF A;  2DDZ A;  1YHQ A;  3M4P A;  4JS5 A;  3MET A;  1MGQ A;  4QQD A;  3KXT A;  3VYH B;  4C0D C;  4HCC A;  4M78 G;  4G84 A;  1KQS A;  2Q7E A;  3HTZ A;  4D6W A;  4XTY A;  5D6W A;  2DD5 A;  4YRK A;  1X54 A;  2E70 A;  1N6A A;  3PT9 A;  2ZTG A;  4ZN1 A;  4P3N A;  3RL6 A;  2KMT A;  1OYX A;  4H02 A;  3V8K A;  2RH2 A;  3OBW A;  3J81 E;  2ODR D;  2MAM A;  4JLG A;  2D6F A;  3HFN A;  5KNN A;  3OY9 A;  5CO7 A;  3CPF A;  4F7U B;  4H2X B;  2E10 A;  1Y96 B;  2QA4 T;  1QVF S;  2DK3 A;  3CEY A;  2HBP A;  1HXD A;  2GF7 A;  1VQP T;  2I4L A;  4P71 A;  2X4W A;  3ZFJ A;  1RIQ A;  4TVA A;  3QO3 A;  2Y4Y A;  4X5O A;  3G1Z A;  3LYI A;  4HWR A;  3HXU A;  1JJC A;  2K5I A;  2ZZD A;  1N9R A;  2P0L A;  2RI2 A;  1U8R A;  2O4X B;  4C8Q B;  1ADY A;  5D6Y A;  2MF2 A;  5GAN 5;  3HXW A;  4OVA A;  2QHT A;  4JS4 A;  4P75 A;  5HGQ A;  1VIE A;  4PL6 A;  3CBM A;  4ZTU B;  1BI0 A;  4BY6 C;  4M75 G;  4ZGJ B;  3OW2 S;  3MO8 A;  2E41 A;  3A7A A;  1EVL A;  4LD6 A;  1JJ2 A;  5DY9 A;  2EQJ A;  5FU7 B;  4OB3 B;  2XU8 A;  4TQD A;  1E22 A;  3P8V A;  3V8J A;  1KC8 C;  4M7D A;  4JLI A;  1N27 A;  3QUI A;  3S3M A;  1VQZ A;  3SD4 A;  3L2Z A;  2NLU A;  4YRT A;  2P5I A;  2XKO C;  4RQF A;  3MEY A;  4PLL A;  3UFG A;  1YB3 A;  5DLO A;  4OLF A;  1NJ2 A;  2DEQ A;  2QQS A;  4M7D D;  4LDX A;  3JCM J;  3VQW A;  5LJ3 d;  2V8J A;  2Y90 A;  3C94 A;  2IVW A;  4M7A F;  5GAO m;  1VQ9 T;  1EOV A;  2HQE A;  3FRN A;  1BBW A;  2RM4 A;  4TVW A;  2I2L A;  2QI2 A;  1VIF A;  3FJP A;  1Y07 A;  2R5M A;  4BI8 B;  3G71 T;  4BE2 A;  4DOW A;  4B9X A;  2XI9 A;  4YCU A;  5GAO r;  3WVE B;  3RER A;  3SWN C;  4ELY C;  3VQX A;  4O2D A;  4IUV A;  1Q82 C;  2CGH A;  5M9O A;  4BD3 A;  4UP7 A;  1W4S A;  2K3Y A;  2RJD A;  3NFC A;  4YP0 A;  1QP3 A;  4JRI A;  3JB9 G;  4QVC A;  3RMQ A;  2EYQ A;  3V7C A;  1X56 A;  2E12 A;  4QVZ A;  3X25 B;  3BW1 A;  1VQ8 A;  3CMA A;  4F7U A;  3C12 A;  2LT1 A;  2JOY A;  4PJO G;  2ZPH B;  3PZC A;  5CVI A;  2QQB A;  4P73 C;  3CCR A;  1G5V A;  3A7R A;  4IUP A;  4J7F A;  2M9U A;  3E19 A;  2L8D A;  1LJO A;  2AKW A;  1X01 A;  2LQK A;  4UP8 A;  4MZT A;  3JSC A;  4EMH A;  3UWN A;  5KCO A;  3CCE A;  4X9D A;  3HFZ B;  1LNX A;  1YIJ A;  2ZNI A;  3M4G A;  2IY5 A;  3QII A;  4E51 A;  3CCE T;  4J8O A;  3PFS A;  1KMN A;  4LVM A;  3E9H A;  2JVV A;  1YI2 A;  5FRN A;  3L1A A;  3OYB A;  2LQ8 A;  1NJI C;  2JNG A;  3MCA B;  3JCM h;  3G6E A;  2R57 A;  3JRZ A;  2E1H A;  4R56 A;  1X2H A;  4Y91 A;  2MWP A;  5GAN 6;  4BWA A;  2KQW A;  3NTI A;  4NCX A;  1P92 A;  4M7D F;  4LDW A;  1M1G A;  2ZCF B;  3CCQ T;  3QKJ A;  3RMS A;  3OS5 A;  1YJW A;  2PME A;  1M5Q 1;  1WYD A;  4M7D B;  3V7R A;  4C5I A;  3MEW A;  2QHV A;  1XOV A;  2QTX A;  1UGR B;  3CCM A;  2CJB A;  1M4Z A;  4C5H A;  3CCL T;  2CZ7 B;  1ZHI A;  1VQ8 T;  4M75 C;  3CCJ T;  1ADJ A;  4Q6G A;  3R07 A;  3ERR A;  4ZIB A;  1YJN A;  1IL2 A;  3OYG A;  1Y71 A;  2RI3 A;  3R6O A;  2ZR3 A;  4E47 A;  2L89 A;  1PSE A;  5K1X A;  1ATI A;  4QW2 A;  3SB2 A;  3VUB A;  1H4Q A;  1K8A C;  2BKD N;  4M75 E;  2DPP B;  3HRT A;  3JB9 F;  4PKC C;  1X75 C;  5IAY A;  1ASZ A;  3M53 A;  4MML A;  1B7Y B;  4P74 C;  5CKH A;  2QEX A;  2KY9 A;  1Q86 U;  4YYE A;  2P0P A;  5LJ5 g;  4MMK A;  1NYQ A;  4QQ6 A;  4EMG A;  2EFI A;  2GCX A;  4TVA B;  2NS6 A;  4KR2 A;  1Q82 U;  1DJ7 B;  2RHI A;  3PCO A;  3RKY A;  4XU1 A;  1QF6 A;  4XTX A;  5GMK h;  3M9Q A;  3CCV A;  2IG0 A;  3OYY A;  1FYF A;  2ZT8 A;  2D9T A;  4BI4 A;  1K9M U;  3LC0 A;  3J80 E;  3UPU A;  4RG8 A;  2A7Y A;  5FU7 C;  3MF1 A;  2VV5 A;  1BIB A;  5CQY A;  5GAN e;  3A5Z B;  3AHU A;  3HFO A;  4LVJ A;  2DXU A;  2MMP A;  3CPW S;  3OB9 A;  4P71 C;  1KD1 U;  2QXF A;  1PYS B;  4XTZ A;  1X6O A;  3OSS C;  5ELN A;  3UDC A;  4F7U F;  1XNI A;  3M4Y A;  3OYD A;  2QQR A;  5GAN g;  3L2W A;  3SDZ A;  1BIA A;  3PNW C;  2RHS B;  4P73 A;  1WJQ A;  2ARU A;  5CQX A;  1B8A A;  2Q5H A;  4TQF A;  5LJ3 f;  5HK3 A;  4FIB A;  2YLC A;  4EX5 A;  2E5Q A;  5CKB A;  2XDP A;  2ZIM A;  3CC2 A;  4IUR A;  5IN1 A;  4C0F A;  3OBY A;  4BDY A;  1WJR A;  4JRQ A;  1E1O A;  4HT9 A;  2DZ9 A;  3VU3 C;  3BFM A;  5ELO A;  1SSF A;  4TTV A;  1RI0 A;  2EJ9 A;  4JRP A;  3V7S A;  4PG3 A;  3JB9 J;  1BI1 A;  2ALY A;  4R55 A;  2OTL A;  3E9I A;  2QQ9 A;  5GAN f;  3CCU T;  4XK8 E;  3FIF A;  4PJO C;  4ZN3 A;  4JDS A;  1KQ1 A;  2QHS A;  2LCL A;  3VJP A;  2C7I A;  4DQ2 A;  5GMK e;  5LJ3 j;  1D3B B;  1SES A;  2ARS A;  3QO5 A;  2HQX A;  3REU A;  4RMO A;  3MEV A;  3M54 A;  4DPG A;  3JCM c;  3A74 A;  4K87 A;  3OS0 A;  2XTI A;  2PUO B;  2VUB A;  5L8R E;  4YRQ A;  3CME A;  3HP9 A;  4H2T A;  1GGM A;  1YHQ T;  1H4V B;  3HSB A;  2DTI A;  4M75 B;  1O75 A;  3RAC A;  3MF2 A;  4C92 A;  3OD1 A;  2AHJ B;  5FRO A;  2RHX A;  1JRI A;  2ZNJ A;  3CCR T;  4RDX A;  4HCZ A;  3FEO A;  3MEA A;  1ASY A;  3SWN A;  1SRY A;  4N0A A;  2X4Y A;  5GAO p;  3UH0 A;  5A0L A;  3A8M B;  3HFZ A;  2CJ9 A;  2JTF A;  3CBO A;  4A4G A;  3H8Z A;  4WJ3 M;  5KCH A;  4M78 E;  1B34 A;  4BE1 A;  1VQ6 A;  2CS7 A;  5GAN 2;  1KOG A;  4YRC A;  5KH6 A;  2OTJ A;  4IUQ A;  2R5A A;  4PJO E;  2GFU A;  4FU6 A;  4BE0 A;  2D0Q B;  3PMT A;  2DXT A;  1PSF A;  2YHT A;  4DA4 A;  3S3N A;  3CXC A;  5GAN d;  4J6W A;  5LJ3 e;  2RD1 A;  4C0Z A;  4HCB A;  3OW2 A;  2QA4 A;  1WGS A;  1QW1 A;  2YLB A;  2EQM A;  4L5G A;  5GAM h;  1KD1 C;  2LCC A;  2DIQ A;  4RKU E;  5HY6 A;  4ZGE B;  1EFW A;  3LW5 E;  2EIF A;  3X28 B;  2HD0 A;  4NOY A;  4YRN A;  3HY1 A;  3ASK A;  4XU2 A;  1QVG S;  4LNS A;  5K1P A;  4LDV A;  2ZT6 A;  3PIO A;  3X26 B;  4M78 B;  5DLQ E;  2FVU A;  1NE8 A;  3P8B B;  2AMC B;  3EAE A;  4X9C A;  1ZQ1 A;  2PVD B;  1L0W A;  3M56 A;  4GLK A;  2RHS A;  2OAU A;  4O6J A;  3QNE A;  1NPR A;  3I55 T;  3NTK A;  4P72 C;  1YFS A;  3MP6 A;  2ZIO A;  4P74 A;  1WNL A;  4WF2 A;  3Q1J A;  3PIP A;  2RJC A;  2VXE A;  4L87 A;  3LWH A;  5GMK i;  3JCM Q;  4EO4 A;  3CBP A;  3S6W A;  4PJO F;  5A0G A;  1WJS A;  4N4G A;  2V8K A;  4PLI A;  5J3B A;  5E3I A;  1B7Y A;  5FLX E;  3L2V A;  3MHX A;  4C0G A;  4HVC A;  2FHD A;  1YJN T;  1U1T A;  2I4M A;  3OMC A;  3OS2 A;  3CMQ A;  2JUF A;  1M1F A;  2JZ2 A;  3ME9 A;  4A53 A;  4H2X A;  5IT9 E;  3PMI A;  4A4K A;  3QZ9 B;  4XAX B;  4N4H A;  5LJ5 d;  1G5H A;  2ZIN A;  1K8A U;  2K3X A;  2QQA A;  3A8H B;  4UPA A;  3G71 A;  4M7A E;  2LDM A;  1IRE B;  3JAM E;  3CCQ A;  2EQU A;  2EWN A;  4C92 B;  3M55 A;  3G7Z A;  4HWO A;  2P0Q A;  2ART A;  4CH5 A;  4XEO A;  3ZEH A;  1HTT A;  3IKL A;  4YDQ A;  3M5A A;  1VQ7 T;  4XU0 A;  3OQ5 A;  4OB2 B;  5GMK m;  5GAO n;  4AH6 A;  4YRR A;  2CYZ B;  2WSC E;  4C8Q G;  1VQK T;  4NL2 A;  4LVL A;  3UGT A;  3LWI A;  4A4H A;  1PYS A;  3JCM e;  3M58 A;  3MP1 A;  4M75 F;  12AS A;  2ZZG A;  4H2Y A;  4A4E A;  2PVO B;  2XK0 A;  1FX7 A;  5I2M A;  4CS2 A;  1KG1 A;  4II1 A;  3QHS A;  2KK4 A;  1YJ9 T;  4P5N A;  4YRM A;  2C8M A;  3NTH A;  3QYG B;  3JCM g;  2ZPI B;  1BKB A;  2ZPF B;  2XDB A;  2X4J A;  3VV0 A;  1VQ6 T;  5AYF A;  2EQK A;  5CIU A;  3HRS A;  4MDW A;  4IUU A;  1VQ4 T;  4CH6 A;  2E65 A;  1KMM A;  5LJ3 g;  1GXI E;  1EVK A;  2RHU A;  1NJ8 A;  2L3R A;  4LVK A;  4YCV A;  3N5B B;  4P3P A;  5C0M A;  1R8O B;  5GAM f;  3WQZ A;  4G85 A;  4E7J A;  2DXB A;  4M7A C;  2RHQ A;  1H64 1;  1Q7Y C;  3ICA A;  2PU9 B;  2KSS A;  4Q15 A;  3GF5 A;  3RUX A;  4N0A C;  5LJ5 f;  4J83 A;  4J7I A;  3CME T;  1EIY B;  4V2S A;  2VGN A;  2ZZF A;  5CAI A;  3VKI A;  1C0A A;  1VQL A;  4E7H A;  4C0D B;  1KHC A;  2M0O A;  4JUV A;  2CZ6 B;  2C06 A;  3J7A F;  3QPH A;  1ZBX A;  3SWN B;  5GAN 7;  3HRU A;  2LVM A;  4H2V A;  1E1T A;  2DAQ A;  4C92 E;  1YI2 T;  1OI1 A;  4ATO A;  5GAN 3;  3GIB A;  2ZPB B;  4C8Q C;  3VUZ A;  2F5T X;  4KQE A;  4YRS A;  1XTD A;  3TEH A;  2KVQ G;  4YRJ A;  4PNO A;  2E6N A;  1LYL A;  3DLM A;  2FYK A;  4J6X A;  1O9S A;  3EFR A;  2MI6 A;  2EL9 A;  2GQV A;  3I56 A;  1Z7M A;  4BAC A;  3X20 B;  2LC4 A;  1IZ6 A;  4HA8 A;  5LL6 S;  3QDR B;  3LH0 A;  3OS1 A;  1SET A;  1VQL T;  2QEX T;  1Y7X A;  4CS4 A;  2AKW B;  2RA2 A;  2EJF A;  5LJ5 e;  3BDL A;  2K5L A;  4J6Y A;  1N9W A;  1W2B A;  5FU6 C;  4EDU A;  1W66 A;  2Q7G A;  3CD6 T;  3ER0 A;  3LSQ A;  4XTU A;  2FB7 A;  2X4X A;  5GAN h;  2BIV A;  1YFT A;  2ZR2 A;  4MZP A;  3OYC A;  3RF1 A;  3KFU A;  2RK1 A;  3JCM V;  1QVG A;  1G3W A;  3FC3 A;  4ZGD B;  3JB9 I;  2PUK B;  3OYL A;  1VQ4 A;  4C5G A;  2Y4X A;  4Q5W A;  3TCJ A;  3QTC A;  2CZ1 B;  3QSU A;  4J15 A;  2ALY B;  5LJ3 h;  3CD6 A;  3LLR A;  3OYE A;  2WSE E;  1G3S A;  5KE3 A;  5DM7 R;  2RHQ B;  2Q5I A;  2K2V A;  5CKF A;  5FU6 B;  4YRF A;  3MEU A;  1VQ5 A;  3I56 T;  2CJA A;  3BY7 A;  2V8I A;  4KUI A;  1M90 C;  1EIY A;  1Z7N A;  2DTH A;  1QVF A;  4EMK C;  3G4S T;  3HXX A;  4E7L A;  4YRP A;  4KBM B;  4PJO A;  2ZZE A;  3L2U A;  4XU3 A;  3JCM W;  2MWO A;  2F69 A;  1YFR A;  2L5Q A;  4YCW A;  4O5V A;  4A54 A;  1N9S A;  2DZC A;  5GAM e;  2RJE A;  1Q81 C;  4TVR A;  4PHC A;  2DQ3 A;  3HKS A;  4C8Q E;  3CCV T;  4M78 C;  5A2Q E;  3OSV A;  1HK9 A;  1KC8 U;  3O8V A;  2BUD A;  2ODR C;  1Y96 A;  4PJO B;  3NEM A;  1K73 C;  3C4S A;  1M1K C;  1VQO A;  1NJ1 A;  4RMF A;  1EQR A;  3FB9 A;  2XD0 A;  4HWT A;  3A32 A;  1H3Z A;  4E7K A;  3L4G A;  2DU5 A;  3GP8 A;  5GAM j;  1B70 B;  3VQV A;  3BDU A;  5HK0 A;  4C8Q D;  4OGC A;  5GAO q;  3L42 A;  1FXX A;  4HWP A;  3CMA T;  4K88 A;  2J3M A;  1NJI U;  1KQS S;  2A8E A;  1M9S A;  2DJZ A;  4BDZ A;  1VQP A;  3A8O B;  3M4Q A;  4Y28 E;  4MDX A;  3CCS A;  4XTV A;  2KDS A;  2ZPE B;  4CH4 A;  2DXC A;  4YRG A;  4H2S A;  4C8Q F;  3OYI A;  1K73 U;  4XQ3 A;  2DVE A;  5J26 A;  3G6E T;  5LJ5 j;  4B9W A;  4IKF A;  2RHZ A;  4M77 A;  4XTW A;  2HAX A;  3HHT B;  4C92 F;  1VQO T;  4P72 A;  2EAY A;  3M59 A;  3CC4 A;  3TU4 K;  3V8L A;  4C92 D;  3E9F A;  2ZGW A;  2CKK A;  5GAN j;  2H3J A;  3JB9 D;  1OZ2 A;  1G51 A;  1FWZ A;  5GMK l;  1YIT T;  3RES A;  3IG2 A;  1UGS B;  1VQ7 A;  3REX A;  2RJF A;  4M77 D;  2OTL T;  1Q86 C;  4CH3 A;  3HL8 A;  4UC4 A;  2GFA A;  5GAN 8;  3RIR A;  4RCC A;  3NEL A;  3JCM f;  1VQM T;  3CC7 A;  1NJ6 A;  1VQK A;  3WVD B;  2QHU A;  1WLE A;  4M78 A;  3KUF A;  1KQ2 A;  4BW9 A;  1B76 A;  3GOX A;  1I8F A;  3DB3 A;  3G4S A;  2LTO A;  4HT8 A;  2DU7 A;  4LDU A;  4XEM A;  5CKE A;  4M7A B;  1W2B S;  4JJN K;  2PMF A;  4N4I A;  5KE2 A;  3LGL A;  2O01 E;  1VQ5 T;  1NZ9 A;  3KBG A;  3VYG A;  4M77 C;  3A8G B;  1NJ5 A;  3PGG A;  4KUL A;  4ZTZ B;  2X35 A;  3RGL A;  1VQN T;  5J39 A;  2ZT5 A;  3E9G A;  1D3B A;  3W3S A;  1BI3 A;  1M8V A;  3M57 A;  3A5Z A;  3CCL A;  2E5A A;  4YRO A;  3OYA A;  4YRI A;  2RI5 A;  3OYN A;  2PVG B;  1NNH A;  3QG1 A;  1B70 A;  3GLX A;  3HPW A;  2JN0 A;  4MZM A;  2DTO A;  2EKO A;  1VQN A;  2CZ0 B;  3HXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...