2DZCA

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
222
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGSPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 222
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dzcA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dzcA01
1YFTA 3TUPA 1B7YB 1YFSA 3QNEA 4N0AA 3RKWA 2DDZA 4YRMA 4MMLA 3BY7A 4G85A 3E9HA 4M7DA 4E51A 1YGBA 4YPFA 4YRFA 3P8TA 1H4VB 3ICAA 11ASA 2ZINA 3PCOB 4XQ3A 1PYSB 3JCMe 2P0LA 4BW9A 4TQFA 3IKMB 4X9CA 4XEMA 2ZR2A 4YDQA 2AMCA 3CMQA 1USYA 4M75A 1HC7A 3P8YA 4P72C 4F7UG 3NETA 2DTIA 4EMKC 4M7AF 4F7UB 3JCMJ 3JCMf 2ARSA 2DQ3A 4YRGA 2YLBA 3HXUA 1NJ2A 1WYDA 3JCMc 3QO8A 3HXZA 2XGTA 4Q6GA 4HA8A 1YCYA 4C92D 3UGTA 2YLCA 3KFUA 1B70A 2DZ9A 3REUA 4M7DB 3G1ZA 2HNIA 4M7AD 3JCMX 5C52B 4PJOG 2CJBA 5LJ3j 4P75C 2I4OA 1D3BA 4TVYA 4XTZA 2DTOA 2EJGA 1ASZA 1E24A 2ARUA 4YRIA 4ZIBA 4C8QF 5GMKi 3LSSA 4M77G 5GAMd 4P3NA 4WF2A 4M75G 4TVAB 1EOVA 4J15A 2Q7EA 2AMCB 5LJ5g 2PMFA 4M75B 4CS3A 4HVCA 1TH7A 3JCMh 2I2LA 2I4LA 4XU0A 3HFZA 5F5WA 4C8QD 5LJ3e 3GIBA 2JN0A 5I21A 2VXEA 5GAOr 1B70B 1KOGA 4YP0A 3EFRA 2ZR3A 3IALA 1E1OA 3HXVA 4YCUA 4EMKA 1D3BB 2FB7A 2QHTA 1LYLA 4H2VA 4AH6A 2ZNIA 4C8QC 4P71C 5C53B 1YB3A 1I81A 4NL2A 2CIMA 4H2YA 4C92E 2E1HA 1NJ6A 3RESA 4HWTA 1Z7MA 4M78A 1H4SA 2ARTA 1X01A 4CH4A 1IL2A 1N9SA 3RGLA 2QHUA 4DPGA 12ASA 3HFZB 1B34A 4EMGA 3BW1A 2RHQA 2E41A 1G51A 1X56A 4H2SA 2Q7HA 2DU5A 4XEOA 4J5YA 2ZTGA 5GAN7 4X5OA 1I8FA 4YCVA 3JCMQ 3HY0A 3MEYA 3HRKA 4CH6A 2QHSA 3VBBA 3RL6A 3VQXA 4EO4A 4XTXA 4YRNA 3SB2A 1YFRA 2DJZA 4HT9A 3DSQA 4YRTA 4M78G 4F7UE 3RKXA 5GAMf 3M4PA 2RHSA 4PNOA 2RM4A 4M78B 5GMKl 1H4QA 2E10A 3RACA 3SWNA 3LSQA 1B34B 1VQZA 2RHQB 3EFSA 4TTVA 5LJ3d 4P3PA 1BBUA 5GANg 3V8LA 4M7DE 3REXA 4PJOA 4XTYA 5K1XA 4P73C 4CS4A 2ODRC 4QVDA 5GMKm 4Y91A 4YRRA 3QUIA 4NCXA 1G5HA 1E1TA 1KMNA 3A7UA 3UFGA 4QVCA 5GANj 3INZA 3V7RA 4XTWA 3LC0A 2ZZEA 5GAN4 4C92F 4M77A 4EMHA 2ZZFA 3JCMb 2ALYA 4YRSA 4M75E 4UP8A 1I4K1 2ZT5A 4H02A 2QTXA 5GAMh 2Q5IA 2C7IA 3I7FA 4OP0A 2RHSB 4LNSA 1BIAA 2DU7A 2ZXFA 3SWNB 3A5ZA 1JBMA 2DVEA 1EFWA 3FJPA 4YRPA 4RQFA 5GANe 2VXFA 2ZGWA 1H641 2ZNJA 2DEQA 1B8AA 3UGQA 4V2SA 4PJOB 1BIBA 1NJ8A 1X2HA 2ZZGA 3A7RA 3BFMA 2ZT7A 3JCMV 3HRIA 3JCMW 4C92C 4J6WA 3VU3C 4F7UF 4M77B 5ELNA 1EIYA 4PG3A 4RCBA 3AHUA 4M7AC 4X9DA 2ALYB 2J3MA 1LJOA 2IY5A 4P3OA 2C8MA 5LJ5j 3TEGA 4H2WA 5CAIA 1SERA 2DXUA 1WU7A 4M7DF 4K86A 3E9IA 5GAOl 1ADYA 1NJ5A 4TWAA 4BWAA 4TVWA 4P72A 1M8VA 1U1TA 4K87A 5LJ3f 3QO7A 4YROA 1U1SA 4HWSA 4RQEA 3VQYA 3JB9F 2G4CA 1B76A 4M7DD 4M75F 4A54A 2Q7GA 1WQWA 5GAOm 2DKGA 5LJ5e 4XTUA 5HGQA 2DQ0A 4PJOD 3L4GA 4O2DA 4TQDA 2RD1A 1EIYB 2CJAA 4UPAA 1QE0A 3MF2A 4M78E 1ADJA 2IY5B 4P75A 3JB9D 4N0AC 2PMEA 4M77D 2ZIMA 4YRJA 4M75D 5LJ5f 3W3SA 4M7DC 5GAMg 3PZCA 2ZIOA 4JUVA 3HTZA 2K57A 3TEHA 3QO3A 4YRLA 1SRYA 1BBWA 1EVLA 3VQWA 5GANd 5LJ3h 4OLFA 4M7AA 4EMKB 4ZTZB 1JJCA 2E5AA 5C51B 3FIFA 4WI1A 4M75C 3RUXA 4HWPA 4RCCA 1JRIA 3L4GB 2E65A 4P74C 1H4TA 1L0WA 5GAN3 3JB9H 2EJ9A 3V8KA 3JCMg 5GAOp 2Q5HA 4RDXA 3BJUA 4JLIA 3R07A 4ZTUB 1WQ7A 1ASYA 4C8QA 4L87A 4P71A 3HFOA 4NL3A 3RIRA 4C92G 3TEHB 1EQRA 2AKWA 1N9RA 5GAN2 4PJOE 3HXYA 4M7AG 1LOJA 4J6XA 4H2TA 1JJCB 5DY9A 1Y96A 2EWNA 4H2XA 1HXDA 4M77E 3QTCA 4M78F 1NNHA 2CJ9A 2YHTA 4H2UA 3OD1A 5GAOn 5LJ5d 4UP9A 4WJ4A 2ZT6A 1X2GA 4KR2A 4G84A 1NYQA 4KQEA 4YREA 4MMKA 3VQVA 3IG2A 3A7AA 4PHCA 4C8QG 1WPYA 2ZCEA 4KR3A 4TVAA 4M78D 3JB9J 4XU1A 4C8QB 2QHVA 2Y90A 1E22A 1ATIA 2AKWB 1C0AA 2E64A 2E3CA 4A53A 5KNNA 2EAYA 3ERRA 3V7SA 4P74A 5ELOA 3HFNA 5GANf 5LJ3g 1Y96B 4H2XB 4HWOA 2VC8A 1EVKA 4M78C 4M7DG 2RA2A 1LNXA 2RB6A 3RKYA 4P73A 4CS2A 4NOYA 4EX5A 2J3LA 2XTIA 2DTHA 5GMKj 1HK9A 3V7CA 1X54A 4CH5A 3JB9G 4PJOF 3QSUA 5GAN8 4DQ2A 4XTVA 1QF6A 3M4QA 3L2ZA 4YRKA 2DXTA 4CH3A 3NEMA 4M77F 1X55A 3A74A 1I5LA 4XU2A 4JRIA 2P5IA 5GANh 3PGGA 1Z7NA 4RMFA 3A5YA 2I4NA 3NENA 4XU3A 3BDUA 5GMKe 1NJ1A 1MGQA 3QHSA 3SWNC 3V8JA 3WQZA 3HFVA 3A31A 1FYFA 4J6YA 2EL9A 3JCMd 3IKLA 3L1AA 4PJOC 3M4GA 4Q15A 1KQ2A 4C92A 4HWRA 3QO5A 5E3IA 5GAMj 4HT8A 2FYKA 4JRKA 5K1PA 3UH0A 3JCMP 1GGMA 4UP7A 3NELA 3HY1A 1B7YA 4M77C 3P8VA 4M7AE 1USYC 3RF1A 3HXWA 4YRCA 1WNLA 2DZCA 2I4MA 1J5WA 1NYRA 4WJ3M 1W66A 5GAOq 1KMMA 4YRQA 5GAN5 3PCOA 1PYSA 3HXXA 1HTTA 2EJFA 5GAMe 1M5Q1 5LJ5h 1SETA 1G5IA 3MF1A 1KQ1A 4K88A 4YYEA 3HSBA 3JB9I 5GAN6 1RIQA 5GMKh 1WLEA 4C8QE 4F7UA 3A32A 4YCWA 4C92B 3FB9A 2CGHA 2ODRD 3RERA 2ZT8A 1N9WA 4M7AB 1SESA
chains in the Genus database with same CATH superfamily
1YFTA 2EVRA 2P84A 2XG8D 1JJ2S 4N0AA 2NS6A 4YRMA 2ROLA 4G85A 3E9HA 5FRNA 1YGBA 1YITA 1KQSS 3REAB 1UGPB 2K7AA 1O75A 1OPKA 3PTAA 4YRFA 3C4SA 1PNJA 3JCMe 2F2VA 1FWZA 2P4RA 4X9CA 1YCSB 3UPUA 2XMFA 3I5RA 4M75A 4IKFA 4EMKC 3MP1A 4F7UB 1U8RA 3CCRQ 3JCMJ 3OSSC 3JCMf 2ARSA 4PFPA 3M57A 5I11A 4RMOA 2DQ3A 2O4XB 3HXUA 2XICA 4GY5A 4C92D 3JSCA 2YLCA 2D1XA 1B70A 2DZ9A 3REUA 4M7DB 3G1ZA 5C52B 1P92A 5IHKA 1PC0A 1D3BA 1WI7A 4J7IA 4XTZA 2EJGA 1Q86C 2DXBA 3MEVA 2KYMA 3MP8A 4ZIBA 1XJWB 2QGFB 2COZA 2M02A 2XU8A 1FMWA 2QAZA 1VQOA 4M75G 1NEBA 1KJWA 2AMCB 4HVCA 1TUDA 2PVDB 5IN1A 2K3BA 4XU0A 2JMCA 1E6GA 2ABLA 1WJRA 2GCXA 2RF0A 4J9HA 1RAHB 1WJSA 3H0HA 3GIBA 2JN0A 4J83A 3F70A 3EH1A 4KUIA 3ASKA 2RHXA 2VXEA 1VQ6A 1JQQA 1KOGA 1Z9QA 1QMCA 4F17A 5D6XA 3TQ7P 1E1OA 2DK3A 3NFCA 4N4HA 4EMKA 1M1KR 4FM4B 4H2VA 1JJ2P 2ZNIA 2M0OA 4C8QC 3VKIA 4LDVA 3NGPA 3HRUA 4EPCA 1R77A 1AWWA 1QCNA 2KRSA 1G2BA 4PK4A 2E1HA 4DBFA 1H4SA 3ZBDA 4R0KA 2ARTA 1X01A 4LVLA 1N9SA 5KYXA 1VYVA 3WVEB 4JS5A 1Y7XA 3HFZB 3PIPA 2RHQA 2E41A 2RJDA 5FU6C 1X56A 4QT7A 1KD1C 1M1KU 3CCUA 2KEAA 2G6FX 3JCMQ 2EGCA 2F1LA 3CCLT 3MEYA 3OYYA 3CMEQ 2QHSA 2GTJA 4DEYA 3RL6A 4E7ZA 4EO4A 4XTXA 2OTLA 4YRNA 2L3PA 1YFRA 1IHVA 1N27A 4PNOA 2LQKA 1RACB 3MPUB 1JB0E 3SWNA 4HCKA 1B34B 4BY6C 2K2MA 3CCST 4OGCA 1BI3A 3EFSA 1NG2A 5LJ3d 3X26B 4P3PA 5GANg 4BUGA 4PJOA 4XTYA 4CS4A 5IXBA 1B07A 2HBWA 1KMNA 4LVMA 4QVCA 1WJQA 4XTWA 2AKKA 4B9XA 1JXMA 4C92F 4LNPA 2C0OA 4M75E 1U06A 3G7ZA 2JUFA 2Q5IA 4OP0A 5D7UA 2VB6A 2RHSB 4DBHA 2RK1A 5KYUA 3CPWS 1K73C 1N5ZA 5I2SA 4RQFA 2M51A 3H6ZA 2VXFA 2DEQA 4YTLA 4E7HA 1QKWA 1BIBA 2HCKA 4JZ4A 1NJ8A 4FYYB 2ZT7A 3I9QA 3GNFB 4ELYC 4DBQA 4ZN1A 5CKBA 2MYSA 3QG1A 3CQTA 1Y57A 3VU3C 1EIYA 3JRZA 4RCBA 3AHUA 4IUTA 2DETA 4E7LA 2BTTA 2ROTA 2ZPHB 2J3MA 1LJOA 1YJNT 4P5NA 2EYZA 4FYWB 2A8EA 4H2WA 2J6OA 1SERA 1MUZA 2DXUA 1VQMQ 4IUUA 3CC4T 2KVQG 4A4GA 3A5ZB 3UA7A 4K86A 3CCSA 4BWAA 1WIEA 2F2WA 2L3RA 2VVKA 2RJFA 3P8BB 1S72T 4TVWA 4KUDK 4P72A 2QQ9A 2QXFA 1ZA1B 4RTUA 1U1SA 2LZ6B 1FX7A 3EG0A 5LJ5e 2DQ0A 3L4GA 2WSCE 2LCLA 3OY9A 3OW2S 2PZ1A 4L6V5 2QA4A 2OTJA 2CJAA 1OULA 4P75A 1D1CA 2PMEA 4M75D 4PLLA 5LJ5f 4M7DC 2I0NA 1QW1A 4JUVA 3X20B 1I1JA 1TG0A 4IIMA 3S6WA 3Q1JA 3OYLA 1NJIR 4ZTZB 2MI6A 3CPWP 7AT1B 3ULRB 4JLGA 1YHQT 4WI1A 4DOWA 1JRIA 2V8IA 2E65A 1AD5A 1ACMB 2EJ9A 2EQIA 3V8KA 4RDXA 3CC4A 3BJUA 3EG2A 3CC7Q 4FT4A 2J06A 3GNGA 1NJIU 1ZUUA 3RDVA 1UFFA 2NUTA 4PJOE 1BK2A 4HXJA 4KRTA 1MV0B 2JJ9A 1LOJA 4H2TA 5KE2A 4M78F 1NNHA 2YUQA 2CT3A 2D9TA 4WJ4A 4F04B 1WX6A 2D0NA 1QVFP 1X2QA 3OYKA 3M5AA 4KQEA 1Q7YR 4MMKA 1OPLA 3IG2A 2FRYA 4KBMB 5IXFA 1TWBA 3R6OA 2F5TX 3OW2P 2QHVA 2JNGA 2DNUA 3HRSA 1C0AA 4A53A 5D6WA 2EAYA 3ERRA 3EFOA 3G4ST 3EGUA 1EZZB 1YHQA 1IHWA 4H2XB 2DO3A 3QYHB 1EFNA 4M7DG 4MDXA 3PMTA 1VQ4Q 3SFMA 4LDXA 2MK5A 1Q7YU 2QDLA 2DF6A 4CS2A 2P0QA 4NOYA 1WLPB 3DLMA 4OB0B 1IXDA 1KHCA 5C0MA 3J81E 2XTIA 2RI3A 3DKMA 3JB9G 3QSUA 2W10A 4D8KA 4DQ2A 1QF6A 1M1KC 3M4QA 4YRKA 2JS0A 1KHIA 3G6EQ 2KMTA 3CCMQ 3OS5A 1OEBA 4JRIA 2P5IA 1YBYA 2ZPIB 1T3SA 4RTYA 2X9HA 3A5YA 3TEEA 5IH2A 1EIFA 2LQWA 1JU5C 3E19A 1NJ1A 1VQ7Q 5HKCA 4FYVB 4OB2B 1FYFA 2QEXT 1VQNQ 4RTZA 3OMGA 3JCMd 3GLXA 2OAUA 1KC8R 4C92A 4ATOA 5E3IA 4HT8A 2JTEA 2FYKA 4OGEA 1FMVA 3P8VA 1ZX6A 1VQ5Q 4PJMA 3MP6A 3RF1A 3I55T 1T0JA 4ZNXA 1YI2T 1WNLA 5L8RE 4BDZA 2I4MA 3VS7A 2FHDA 1KMMA 2CSIA 3PCOA 4J9GA 2HZYA 3CCVT 1VQ8A 3FC3A 3PT9A 4AG2C 1HTTA 1YIJQ 1M9SA 5GAMe 1M5Q1 5LJ5h 2KNBB 1KC8U 1KQ1A 2O31A 5KYWA 4YYEA 5FW9A 1RIQA 3M0UA 4MDWA 3CC2Q 4F14A 3HKSA 1K9MR 4PJLA 2LVMA 2RHZA 1H8KA 3I56T 4M7AB 5A0GA 3CCQT 3OA6A 1PKTA 1B7YB 2NWMA 4PFZA 5DLQE 2DDZA 3BY7A 2ED0A 3FJ5A 2GNCA 1PYSB 4LDYA 2PU9B 1ZA2B 2P0LA 3HTRA 4IUQA 2DIQA 3CBOA 2KAFA 3CD6T 1K9MU 2ZR2A 2Y4XA 3CMQA 3OYBA 3M0PA 1SEMA 3NETA 1TOVA 2DTIA 1M27C 4M7AF 2HMAA 1TS9A 5AYFA 2FVUA 4ZTJA 2KXCA 2R58A 4RG8A 3LWHA 1NJ2A 1LVKA 3JCMc 3HXZA 1YI2A 2JMAA 2D8HA 3KFUA 1I07A 4C5EA 4TVYA 1YJ9Q 1E24A 4LDWA 2OX7A 1SHGA 2ENMA 4C8QF 5GMKi 3OYCA 4RUGA 4WF2A 4J15A 4ORZA 2PMFA 4E7KA 3A8MB 2I2LA 2YSQA 4FW1A 2I4LA 3VS1A 1VQ9Q 2LT1A 2YDLA 3I56A 5F5WA 1UJ0A 4JDSA 1AWJA 3OB9A 4O5VA 2MWPA 5I21A 1YJWT 2J6KA 3X24B 2QQRA 4OMPA 1HJDA 1FYNA 3IALA 1TUGB 4B9WA 2BKDN 2FB7A 2DEUA 1LYLA 4AH6A 2MIOA 4RG2A 4P71C 2LC4A 2JS2A 1I81A 1NJIC 1K8AR 1E7OA 4C92E 4OVAA 1NJ6A 2FPFA 4M78A 3C95A 2BZXA 1YITQ 3CCJT 3E1SA 6AT1B 3RGLA 2B86A 3QXEB 2QHUA 2NUPB 1R0BG 2VGNA 1R0CB 4C5IA 3MEAA 4H2SA 4FL6A 2DU5A 3DB4A 4J5YA 2ZTGA 1UDLA 5GAN7 2R57A 4ANJA 2HD0A 1I8FA 4YCVA 3L2VA 1PM3A 3PFSA 4CH6A 1K8AU 4KULA 1K0SA 3J7AF 4OB1B 3SB2A 2DJZA 1W1FA 2DERA 1GCPA 4M78G 2KY9A 2AZVA 3M4PA 2A37A 4N4IA 3CCEA 1H4QA 3UA6A 3VUZA 1PSFA 1NLOC 3HHTB 1MMNA 3QPHA 1M3AA 2EFIA 1CKBA 4IIOA 2Z0WA 3URGA 2RQWA 1VQOQ 3ME9A 3ZFJA 1Q7YC 1AHJB 4QVDA 2DIGA 3QUIA 2LJ3A 3UFGA 3INZA 3V7RA 2YRVA 1KSWA 2DL4A 2FZKB 1GFDA 4Z88A 1ZBJA 2ZZFA 4J9DA 2L5QA 2ALYA 2BUDA 1NPRA 1I4K1 4H02A 1RL2A 2QTXA 5FLXE 5GAMh 3NTIA 1VQ6Q 2EQMA 3TU4K 4LNSA 2E5KA 4PJJA 4E7IA 1BIAA 1G3TA 2DBMA 2RQTA 1JBMA 2DVEA 3OYAA 2MF2A 5GANe 2HQEA 1WXBA 5CKFA 4LUDA 4OMLA 3NPFA 1T3LA 2X4XA 2VGMA 1X2HA 5AT1B 1M1FA 3BFMA 2KT8A 1ZLMA 2IIMA 4F7UF 4Y92A 1WXTA 2MOXA 4M77B 1X27A 2KT1A 4M7AC 2M16A 1BI0A 2IY5A 4P3OA 4L59A 3CCUQ 2XDPA 2C8MA 3NHNA 5LJ5j 3TEGA 2LNHB 1TSFA 4X34A 4M7DF 1UECA 1ABOA 2BE9B 3E9IA 1NJ5A 2HSEB 1NPPA 2D6FA 2LCSA 2DFUA 4KH1B 2OTLQ 1M8VA 1JO8A 2P0PA 4YROA 1G8XA 1UHCA 1OX8A 4RQEA 3QYGB 3JB9F 1M2VA 4OMNA 1KC8C 2G4CA 2DL7A 4ZTFA 1OZ2A 1SKUB 2G3RA 3OS2A 1CKAA 4DEXA 1QE0A 4M78E 1ADJA 3WXMB 2KGTA 2ED1A 1LPLA 2V1QA 1VOMA 2ESWA 5CK9A 5KYYA 2ZIOA 3HTZA 3TEHA 1UJYA 3QO3A 2E4HA 1K4US 1EVLA 3VQWA 1G5VA 4LDUA 1Q82U 1IO6A 4J9IA 4E2FB 3LH0A 2CYZB 2FG0A 3LW5E 4OLFA 4M7AA 1RAGB 3UT1A 1PD0A 1QWEA 4C5GA 2YWWA 2R5MA 1K9MC 3RUXA 2DAQA 1D0YA 2WSFE 3EH2A 4LVJA 3G71T 2FO0A 1WXUA 2K6DA 1VA7A 1V29B 4P74C 1H4TA 2P4TA 1G83A 1XQHA 3PVQA 3JCMg 1MNDA 1YNZA 1X6OA 3M53A 4ZTUB 4PFOA 4Q5WA 1ASYA 4C8QA 4L87A 4NS5A 3JAME 3M59A 1NEGA 3LX7A 5FWBA 3CMAT 2HDAA 5GAN2 3SDZA 2COYA 4M7AG 4BI4A 2KI7A 1SSHA 2VYTA 4E7JA 1JJCB 5FU7B 1UG1A 1GBRA 2EWNA 2QQAA 1HXDA 4E47A 3QTCA 2C06A 2CJ9A 3OD1A 2JTFA 3CCSQ 4KT0E 2K3YA 4KR2A 2E12A 1NYQA 2YUPA 4XK8E 4K11A 4BE2A 1GBQA 3A7AA 4C8QG 4M78D 3JB9J 4XU1A 1ATIA 2DD4A 2MWOA 2AKWB 1PG5B 2E64A 2E3CA 1IGUA 4FSXA 3V7SA 2QA4Q 3CCLA 2OTJQ 3H9NA 4P74A 3HFNA 1D1AA 2LQNA 1Y96B 2X51A 4HWOA 3G71A 1RAEB 5KYNA 1PD1A 3GF5A 1VQMT 3GPLA 4J7FA 2J3LA 2DTHA 4C5HA 3A8OB 3KFVA 4JJBA 1KK7A 2DL5A 3V7CA 4JRPA 4XTVA 2XIDA 3ER0A 3CMAA 2DXTA 2KXDA 4IURA 1H92A 1QVFS 3RMSA 3L2QA 3A74A 1I5LA 4XU2A 5GANh 3PGGA 2CP5A 1Z7NA 2VUBA 1K8AC 1D1BA 3QKJA 3I5SA 1G3SA 2NYSA 1IZ6A 3LGFA 2I4NA 3CC4Q 5J3BA 1ZSZB 2QASA 1SF9A 1SPKA 3PE0A 2W0ZA 3WQZA 3OYFA 3HFVA 4AMCA 2RJEA 5IHNA 1MMDA 2JOYA 3IKLA 5J39A 2CZ6B 2LCCA 1KQ2A 3H41A 3QO5A 5GAMj 2HQXA 3UH0A 1GGMA 1C0MA 2CDTA 3QDFA 4J9FA 3E2UA 1WHLA 4M77C 4M7AE 1VIFA 1R8OB 4LN2A 2LTOA 2PVOB 4J9BA 4CC4B 2DZCA 1J5WA 3NMZC 2BZYA 5GAOq 1QVGA 4HCCA 1VUBA 5GAN5 1NBEB 2RQUA 1TUCA 2V8KA 1QWFA 3VJPA 1YJNA 2DMOA 3D7SB 4F16A 2EJFA 3VS0A 1G5IA 2CP6A 4K88A 3CC7T 3UWNA 5GMKh 1YHQQ 1S72A 4C8QE 4F7UA 3G1JA 2GGRA 3EG9B 1M30A 3FB9A 2E3IA 2ZT8A 2O4XA 4AFUC 4D8DA 3EG1A 1SESA 3PMIA 1X43A 1WZOA 3HL8A 1RAIB 2FZGB 4M7DA 3UATA 2DM1A 2KR3A 1I5OB 1TXQA 2IPOB 1H4VB 3ICAA 11ASA 2ZINA 4XQ3A 2ZZDA 2XHCA 4BW9A 4TQFA 1FMKA 4J8OA 3IKMB 3OYIA 1RLPC 1I0CA 1D0XA 5I2MA 4YDQA 1ABQA 2AMCA 4F7UG 1KQSA 3UDCA 4ELZC 1VQPT 2XK0A 4YRGA 2YLBA 1WYDA 3QO8A 2ECZA 2EQKA 4JJNK 4HA8A 1YCYA 1ZUKA 1VQ4T 2FZCB 3E9GA 1UUEA 2F2XA 3QDRB 2HNIA 4M7AD 2DL8A 3JCMX 2QG9B 1SG5A 5GJWB 2DL3A 2GF7A 3LGLA 2DTOA 1VQKT 2QYZA 1WHKA 3LSSA 2RH2A 4M77G 2FEIA 4TVAB 1HYOA 1WFWA 5LJ5g 1RI9A 4M75B 1GRIA 1Q82C 1OYXA 5FU7C 2XDDA 3CCMT 3PNWC 2DPPB 3HFZA 1YWOA 1K76A 1VQ8Q 4C8QD 5LJ3e 2LJ0A 5A0LA 4HT4A 1SRMA 2K79A 2YXYA 2O9VA 1QCFA 5GAOr 2YRDA 1B70B 2AHJB 2RNAA 4YP0A 3A1PA 1VIEA 4AFQC 3HXVA 4YCUA 2MMPA 1D3BB 1D0ZA 3AT1B 2DYIA 1PRMC 2VKNA 2QHTA 5C53B 2C0IA 2YUOA 3QZ9B 1F1BB 4NL2A 4H2YA 3FEOA 3RESA 4HWTA 4BI8B 1VQ5T 3EAEA 5A0DA 2A28A 2KBTA 2RI5A 3G4SA 4DPGA 2KSSA 4L5GA 3RBBB 1B34A 12ASA 4EMGA 3BW1A 5I22A 2M9UA 2YT6A 4OMQA 2K2VA 1WHGA 5FRMA 3CEYA 1YIJT 2AIRB 2FL7A 3M56A 2RJCA 3META 4X5OA 2L3SA 1VQKA 1H3HA 3HRKA 5FROA 3VBBA 3CC2T 2H8HA 1T0HA 2B8AA 1NM7A 3VQXA 1M90R 2E5QA 2CSQA 1ZHIA 2QQBA 3I55Q 1YI2Q 1XNIA 3DSQA 4F7UE 3RKXA 5GAMf 1X75C 2RHSA 3MEWA 2CP0A 1OI1A 5GMKl 1QVPA 3M0RA 1PSEA 2E10A 4Y28E 5KYXB 1PHTA 3LSQA 3HRTA 1ZSZC 2OI3A 2RHQB 1UGRB 1KFZA 1W6XA 2MCNA 3M4YA 3V8LA 4QQ6A 4M7DE 5K1XA 2X35A 4P73C 5GMKm 4Y91A 1Y07A 4NCXA 1G5HA 1K1ZA 1WGSA 3A8HB 1M90U 5GANj 2QEXA 4AT1B 5CR2A 3IQLA 3LC0A 2ZZEA 5GAN4 3I56Q 3VYGA 1G3WA 2JXBA 4HCZA 3JCMb 2RQVA 1W2BA 4YRSA 3VUBA 4UP8A 5M9OA 2ZT5A 1M3BA 2C7IA 2K5FA 2JTMA 2EIFA 2DE0X 2FRWA 2ZXFA 3SWNB 2NUZA 4CI0C 3EGXB 3I55A 3A5ZA 1EFWA 4YRPA 1OU9A 3EHQA 1QQJA 2H3JA 3EGDB 1YJ9T 3UGQA 3CCVA 4V2SA 4PJOB 1RABB 2X4YA 1LCKA 2ZZGA 3A7RA 2ATCB 3M0TA 2LMJA 3JCMW 2LQ8A 5ELNA 2R5AA 1WA7A 5CKEA 1ZSZA 4PG3A 4X9DA 2DXCA 3A8GB 2F5KA 3OYEA 1OZ3A 3CPFA 4OMMA 2L2PA 1UEBA 3CCQA 2O01E 5CAIA 2LRQA 1YFNA 2JM9A 5CO7A 1WU7A 2RN8A 3VS6A 4ZGJB 5EG2A 1OOTA 5GAOl 1ADYA 4FW2A 4Z89A 4GLMA 4C0ZA 2EQJA 1XTDA 2DD5A 1BYMA 3JV3A 4KGZB 3E9FA 4HWSA 3FLGA 2BZ8A 3ZEHA 3CBPA 3CD6A 1RAFB 1B76A 1SSFA 3CCEQ 4A54A 4M7DD 1IGQA 5GAOm 1AZGB 2DKGA 4XTUA 5HGQA 3OYGA 1AZEA 4JPBW 3J80E 4O2DA 1B7TA 1EIYB 1YITT 3FDRA 4HVWA 2F69A 4JRQA 3X25B 3MF2A 1BU1A 3OBYA 4TVRA 3A98A 3JB9D 4N0AC 4M77D 4YRJA 1D09B 5GAMg 2RHIA 1Z9ZA 3P8HA 2CZ1B 2K57A 1ZUYA 4HVVA 2HKQB 5HY6A 2JM8A 4YRLA 1QVGS 3LYIA 1JEGA 5LJ3h 2GQVA 2KRMA 2JZ2A 2QI2A 3O8VA 3FIFA 4M75C 5KH6A 1MV3A 1WHHA 4HWPA 2ZCFB 2QDYB 1VQLT 4VUBA 3QBYA 4KGXB 3L4GB 5GAN3 3C94A 4FYXB 3JB9H 1QP3A 4ZN3A 1A0NB 2Q5HA 3OS1A 2O9SA 4JLIA 3R07A 1YJWA 2PTKA 1WQ7A 1E6HA 1PKSA 4P71A 4NL3A 1HD3A 1EQRA 1VYTA 3VS5A 4AG1C 1M3CA 1GXIE 3HXYA 1OU8A 5CVIA 3BDLA 3KBGA 3OYJA 3MQZA 4H2XA 4HCBA 3QZ5B 3CCRT 4JZ3A 2V1RA 2YHTA 4H2UA 1VQ6T 5LJ5d 1V1CA 2ZT6A 2Y4YA 3S3OA 2CP3A 3CCJA 1X2GA 4G84A 3LH5A 8ATCB 2H3EB 2PUKB 4BI3A 3VQVA 4DOVA 2XKOC 4UC4A 4AFZC 5A2QE 2ZCEA 4PHCA 5D6YA 4TVAA 4KR3A 2XD0A 1UE9A 1BBZA 2ZPGB 3HP9A 1QKXA 2NUTB 5KNNA 2SRCA 1N8RR 2FPEA 3P8DA 1BI2A 5GANf 1J3TA 1RLQC 3MKDA 1VQLA 4RTXA 1EVKA 2LJ1A 5FWCA 3CCUT 2XDBA 1QVGP 1Q81R 1QCOA 2YUNA 4N4GA 2EYWA 4A4FA 1HK9A 1X54A 5CQXA 2EGAA 5GAN8 2AK5A 1OQKA 2OTLT 1K9AA 2HBPA 2HEQA 1N8RU 4CH3A 3MJXA 2A36A 3NEMA 4MZMA 4M77F 1Q82R 3OYMA 3EFOB 4C0GA 3X28B 4RMFA 1RI0A 2LT4A 3CCRA 2VWFA 2DRMA 1Q81U 1AVZC 2KYBA 5GMKe 1OV3A 2M0YA 3OMCA 3QHSA 3SWNC 3OSVA 3V8JA 5DM7R 4QW2A 2QTVA 4A4HA 2CP2A 3NTKA 3L2WA 1WHMA 2ZPEB 2EL9A 1U3OA 2E6NA 4PJOC 4Q15A 2L89A 4II1A 2XI9A 4A4EA 1KQSP 2D0QB 4JRKA 3VS4A 3CMET 1UHFA 3N5BB 2DYBA 1M90C 2K5IA 1B7YA 3RMQA 2DA9A 1USYC 4Z8AA 1QLYA 4YRCA 5HCKA 9ATCB 4WJ3M 4CRIA 1K0XA 1W66A 2KDSA 2RQRA 1BCMA 3MEUA 4YRQA 5EC7A 1NLPC 1PYSA 2LX9A 1ARKA 2EW3A 2RI2A 1GFCA 4MZTA 3MF1A 3TSZA 3CCLQ 3HSBA 3JB9I 1AWXA 5CKHA 2QK0A 2YRCA 4HVUA 4PLIA 4C92B 1PWTA 2IVWA 3VYHB 5KCHA 3G71Q 2AZSA 4AFSC 1N9WA 1NE8A 2PQWA 2D8JA 3TUPA 3CXCA 2CZ0B 4CC7A 3EGXA 1YFSA 4BE1A 3QNEA 2EPDA 3RKWA 4MMLA 3EGDA 4E51A 1NYFA 4YPFA 2NLUA 3P8TA 1W2BS 3PCOB 1W70A 1HSQA 4QVZA 5CIUA 3CMAQ 5KE3A 5GJVB 2CUDA 3KUFA 3SD4A 4XEMA 5KYWB 4QQGA 3P8YA 1USYA 1HC7A 4P72C 4DBRA 2LDMA 2QA4T 2OTJT 3CMEA 3WVDB 1AWOA 2E70A 3H0FA 2XGTA 4Q6GA 4E7SA 1O9SA 1ZQ1A 4LVKA 3UGTA 3NTHA 2EKHA 2L8DA 2K3XA 2X3XD 4BACA 4PJOG 2CJBA 5LJ3j 4P75C 2I4OA 2PUOB 4FT2A 1RAAB 4A63B 1ASZA 2ARUA 1Q95G 4YRIA 5IAYA 3M0SA 5GAMd 4P3NA 1EOVA 2Q7EA 4CS3A 3VRZA 1TH7A 3RNJA 3JCMh 4PL6A 1EX4A 3C0CA 2NUPA 1YJNQ 4ME7A 3R6NA 5CKDA 4MZPA 2OAWA 4LD6A 1G3YA 3O5ZA 3LWIA 1CSKA 3M54A 3EFRA 2ZR3A 3VRYA 1XOVA 4OMFB 2CZ7B 4Z02A 1S72Q 2P0KA 1RUWA 1YB3A 2MPXC 4LVIA 2M1HA 2DRKA 2RMOA 1X6BA 3OYHA 4IUVA 2CIMA 1W2BP 2SEMA 1Z7MA 3M0QA 2EGEA 4CH4A 1IL2A 4EIKA 3L42A 2J6FA 4OB3B 3KXTA 2RPNA 1AOJA 2O88A 1G51A 3DB3A 3ZL7C 2Q7HA 2J05A 4LXCA 4XEOA 3MCAB 5L23A 1VQMA 4FU6A 3HY0A 4CC3A 2CH4W 2DVJA 4ESRA 1FXXA 1H3ZA 2LX7A 1NZ9A 4HT9A 4WTOB 2CREA 4R56A 4YRTA 2RM4A 4M78B 3GOXA 4C0DB 1C6VX 3RACA 5J26A 2X4JA 4J9EA 4BB7A 2O2OA 1BKBA 1VQZA 3QIIA 4TTVA 3GP8A 1TTHB 1BBUA 3THKA 2GBQA 3L2UA 3REXA 8AT1B 2ODRC 4QKUA 4YRRA 2DX1A 3BE3A 4JS4A 1E1TA 3A7UA 1GL5A 1JJ2A 1X6GA 2E3HA 1KIKA 2AKLA 3RR6A 4M77A 4EMHA 4BD3A 2IG0A 2A3LA 2ZAEA 3L2RA 1N8RC 5IT9E 2FPDA 2DLPA 1WHJA 2CT4A 3I7FA 2GTOA 2EQUA 2DU7A 2J7IA 1C1AA 3FJPA 4D6WA 3M55A 1Q81C 2LP5A 2ZGWA 1H641 1ZBXA 2ZNJA 2DILA 2HL5C 1B8AA 1U5SA 2OJ2A 2VASA 3OBWA 4KH0B 2DBKA 3MHXA 3JCMV 1VQPQ 3CC7A 3HRIA 1X69A 4C92C 4J6WA 3G4SQ 1OX9A 1QP2A 3A8LB 3VS2A 3G6ET 2ALYB 3M9QA 1YWPA 2L0AA 1VQ8T 3VV0A 2CKKA 2EYQA 1VQKQ 1VQ7T 1Q86R 1ZSGA 4TWAA 4BE0A 2ZPBB 3EG3A 1M1GA 1U1TA 4K87A 1VQNT 1YN8A 5LJ3f 3QO7A 1GCQC 3VQYA 2CP7A 3OYNA 4M75F 2ZPFB 2Q7GA 1WQWA 2A7YA 2QQSA 4PJOD 2X4WA 1WDXA 2RD1A 4O6JA 4TQDA 2K9GA 1VQPA 4UPAA 4X1VA 2V8JA 2PVGB 2IY5B 1Q86U 1TU0B 2ZIMA 4JJDA 5ECAA 2DJQA 3QWYA 4OMOA 3W3SA 1VQ4A 4FIBA 1M4ZA 2QEXQ 2KE9A 3PZCA 3FRNA 2EKOA 3TCJA 1SRYA 4J9CA 1BBWA 1Y0MA 2JT4A 5GANd 4LUEA 4RKUE 4QQDA 3I35A 4EMKB 4RTWA 1JJCA 4ZGDB 4CC2A 2E5AA 5C51B 1M2VB 3OQ5A 1AEYA 5C6SA 1W4SA 4RCCA 1PCXA 2QGGA 3G6EA 1L0WA 1JXOA 3CCMA 2COWA 1KD1R 2HSPA 3TSWA 3CCVQ 1S1NA 3S3MA 3EHRA 2K4YA 2JW4A 5GAOp 3CXCS 1GCQA 1VQ7A 2KRNA 3PIOA 3HFOA 5KYYB 3RIRA 4C92G 3TEHB 3S3NA 4R55A 2AKWA 1N6AA 1N9RA 2E6ZA 2EYXA 4B6MA 1VQNA 4J6XA 2GFUA 1VYUA 5DY9A 1Y96A 2K5LA 3CCQQ 2EYYA 4RTTA 4M77E 1KD1U 5GAOn 4KGVB 4UP9A 4WCIA 1RADB 1B3QA 1VQ5A 2C0TA 2VV5A 4EDUA 4PJNA 1YP5A 4IUPA 4YREA 1BI1A 2RK2A 2GFAA 1WPYA 3CD6Q 2KROA 1UGQB 3H0IA 1M8MA 4C8QB 2Y90A 1YIJA 1E22A 3QJ6A 3CPWA 5HK3A 1UTIA 5ELOA 4LE9A 3REBB 3CC2A 2KQWA 2X3WD 3VS3A 2L3QA 2BIVA 3SEMA 1SRLA 2CS7A 5LJ3g 2VC8A 1K73R 4M78C 4RTVA 4C0DC 5CCAA 1VQ9T 2RA2A 1X2KA 5FU6B 1LNXA 2MAMA 2RB6A 4E6RA 4FCYA 2HAXA 3RKYA 4P73A 5KYUB 5HK0A 4GLKA 4C0FA 3QWXX 4EX5A 1Y71A 1UB4A 5GMKj 1KG1A 2AT1B 4CH5A 2V26A 4PJOF 3U23A 2LNVA 4ZGEB 1WYXA 3UF4A 4PKCC 3L2ZA 1IRXA 2GQIA 4HKEA 3CCET 3TREA 1X55A 1SHFA 1K73U 2HL3A 3C12A 3CXCP 5KCOA 2PNIA 3NENA 2HKNA 4XU3A 5IHIA 3BDUA 1YJWQ 2WACA 1MGQA 4BY6B 1UGSB 2JVVA 1QVFA 3MO8A 5CQYA 2RHUA 4DA4A 3A31A 4J6YA 2RO0A 4JJCA 1V76A 1M2OA 5DLOA 1MMAA 3L1AA 3M4GA 3OW2A 4GBQA 4BDYA 3EG9A 4HWRA 1BB9A 2CH4A 1YJ9A 2RHYA 3M58A 3QJYA 2A08A 5K1PA 4OF1A 2WSEE 3JCMP 3DLLA 4UP7A 1MHNA 1IREB 3NELA 3HY1A 1PRLC 1DJ7B 3CBMA 3CCJQ 3TVTA 3HXWA 4M4ZA 2HQHA 3T9NA 1NYRA 3OYDA 1VQ9A 1UGVA 3HXXA 3H8ZA 2BE7D 3GBQA 1SETA 5LL6S 1AT1B 2EBPA 1MNEA 4A4KA 2CUBA 3PVLA 1BCOA 1VQOT 4FSSA 5GAN6 1WLEA 1NYGA 1MMGA 2KK4A 3A32A 4YCWA 3OS0A 2A0FB 1VQLQ 3LLRA 4XAXB 2CGHA 4LD9K 1IB8A 3RERA 2ODRD 3HPWA 3SHWA
chains in the Genus database with same CATH topology
1YFTA 2XG8D 1JJ2S 4N0AA 2NS6A 4YRMA 4G85A 3E9HA 5FRNA 1YGBA 1YITA 1KQSS 4YRFA 1UGPB 3PTAA 1O75A 3C4SA 3JCMe 1FWZA 4X9CA 3UPUA 4M75A 4IKFA 4EMKC 3MP1A 4F7UB 1U8RA 3JCMJ 3OSSC 3JCMf 2ARSA 3M57A 4RMOA 2DQ3A 2O4XB 3HXUA 2XICA 4GY5A 4C92D 3JSCA 2YLCA 1B70A 2DZ9A 3REUA 4M7DB 3G1ZA 5C52B 1P92A 4J7IA 1D3BA 4XTZA 2EJGA 1Q86C 2DXBA 3MEVA 3MP8A 4ZIBA 2XU8A 1VQOA 4M75G 2AMCB 4HVCA 2PVDB 5IN1A 4XU0A 1WJRA 2GCXA 1WJSA 3GIBA 2JN0A 4J83A 3F70A 4KUIA 3ASKA 2RHXA 2VXEA 1VQ6A 1KOGA 5D6XA 1E1OA 2DK3A 3NFCA 4N4HA 4EMKA 4FM4B 4H2VA 2ZNIA 2M0OA 4C8QC 3VKIA 4LDVA 3HRUA 4EPCA 2E1HA 1H4SA 3ZBDA 2ARTA 1X01A 4LVLA 1N9SA 3WVEB 4JS5A 1Y7XA 3HFZB 3PIPA 2RHQA 2E41A 2RJDA 5FU6C 1X56A 1KD1C 1M1KU 3CCUA 3JCMQ 3CCLT 3MEYA 3OYYA 2QHSA 3RL6A 4EO4A 4XTXA 2OTLA 4YRNA 1YFRA 1N27A 4PNOA 2LQKA 1JB0E 3SWNA 1B34B 4BY6C 3CCST 4OGCA 1BI3A 3EFSA 5LJ3d 3X26B 4P3PA 5GANg 4BUGA 4PJOA 4XTYA 4CS4A 1KMNA 4LVMA 4QVCA 1WJQA 4XTWA 4B9XA 4C92F 4M75E 3G7ZA 2JUFA 2Q5IA 4OP0A 2RHSB 2RK1A 3CPWS 1K73C 5I2SA 4RQFA 3H6ZA 2VXFA 2DEQA 4YTLA 4E7HA 1BIBA 1NJ8A 2ZT7A 3GNFB 4ELYC 4ZN1A 5CKBA 3QG1A 3VU3C 1EIYA 3JRZA 4RCBA 3AHUA 4IUTA 4E7LA 2ZPHB 2J3MA 1LJOA 1YJNT 4P5NA 2A8EA 4H2WA 1SERA 2DXUA 4IUUA 3CC4T 2KVQG 4A4GA 3A5ZB 4K86A 3CCSA 4BWAA 2L3RA 3P8BB 2RJFA 1S72T 4TVWA 4KUDK 4P72A 2QQ9A 2QXFA 1U1SA 1FX7A 5LJ5e 2DQ0A 3L4GA 2WSCE 2LCLA 3OY9A 3OW2S 4L6V5 2QA4A 2OTJA 2CJAA 4P75A 2PMEA 4M75D 4PLLA 5LJ5f 4M7DC 1QW1A 4JUVA 3X20B 3S6WA 3Q1JA 3OYLA 4ZTZB 2MI6A 4JLGA 1YHQT 4WI1A 4DOWA 1JRIA 2V8IA 2E65A 2EJ9A 3V8KA 4RDXA 3CC4A 3BJUA 4FT4A 3GNGA 1NJIU 4PJOE 1LOJA 4H2TA 5KE2A 4M78F 1NNHA 4WJ4A 2D9TA 3OYKA 3M5AA 4KQEA 4MMKA 3IG2A 4KBMB 3R6OA 2F5TX 2QHVA 2JNGA 3HRSA 1C0AA 4A53A 5D6WA 2EAYA 3ERRA 3G4ST 1YHQA 4H2XB 2DO3A 3QYHB 4M7DG 4MDXA 3PMTA 3SFMA 4LDXA 1Q7YU 4CS2A 2P0QA 4NOYA 3DLMA 4OB0B 1KHCA 5C0MA 3J81E 2XTIA 2RI3A 3DKMA 3JB9G 3QSUA 4DQ2A 1QF6A 1M1KC 3M4QA 4YRKA 1KHIA 2KMTA 3OS5A 4JRIA 2P5IA 1YBYA 2ZPIB 3A5YA 3TEEA 1EIFA 3E19A 1NJ1A 5HKCA 4OB2B 1FYFA 2QEXT 3OMGA 3JCMd 3GLXA 2OAUA 4C92A 4ATOA 5E3IA 4HT8A 2FYKA 4OGEA 3P8VA 3MP6A 3RF1A 3I55T 1YI2T 1WNLA 5L8RE 4BDZA 2I4MA 2FHDA 1KMMA 3PCOA 3CCVT 1VQ8A 3FC3A 3PT9A 1HTTA 1M9SA 5GAMe 1M5Q1 5LJ5h 1KC8U 1KQ1A 4YYEA 1RIQA 4MDWA 3HKSA 2LVMA 2RHZA 3I56T 4M7AB 5A0GA 3CCQT 3OA6A 1B7YB 5DLQE 2DDZA 3BY7A 1PYSB 4LDYA 2PU9B 2P0LA 4IUQA 2DIQA 3CBOA 2KAFA 3CD6T 1K9MU 2ZR2A 2Y4XA 3CMQA 3OYBA 3NETA 2DTIA 4M7AF 5AYFA 2FVUA 4ZTJA 2R58A 4RG8A 3LWHA 1NJ2A 3JCMc 3HXZA 1YI2A 3KFUA 4C5EA 4TVYA 1E24A 4LDWA 4C8QF 5GMKi 3OYCA 4WF2A 4J15A 2PMFA 4E7KA 3A8MB 2I2LA 2I4LA 2LT1A 3I56A 5F5WA 4JDSA 3OB9A 4O5VA 2MWPA 5I21A 1YJWT 3X24B 2QQRA 3IALA 4B9WA 2BKDN 2FB7A 1LYLA 4AH6A 4RG2A 4P71C 2LC4A 1I81A 1NJIC 4C92E 4OVAA 1NJ6A 4M78A 3C95A 3CCJT 3E1SA 3RGLA 3QXEB 2QHUA 2VGNA 4C5IA 3MEAA 4H2SA 4FL6A 2DU5A 3DB4A 4J5YA 2ZTGA 5GAN7 2R57A 2HD0A 1I8FA 4YCVA 3L2VA 3PFSA 4CH6A 1K8AU 4KULA 3J7AF 4OB1B 3SB2A 2DJZA 4M78G 2KY9A 3M4PA 4N4IA 3CCEA 1H4QA 3VUZA 1PSFA 3HHTB 3QPHA 2EFIA 3URGA 3ME9A 3ZFJA 1Q7YC 1AHJB 4QVDA 2DIGA 3QUIA 3UFGA 3INZA 3V7RA 2YRVA 2ZZFA 2L5QA 2ALYA 2BUDA 1NPRA 1I4K1 4H02A 1RL2A 2QTXA 5FLXE 5GAMh 3NTIA 2EQMA 3TU4K 4LNSA 4E7IA 1BIAA 1G3TA 1JBMA 2DVEA 3OYAA 2MF2A 5GANe 2HQEA 5CKFA 2X4XA 2VGMA 1X2HA 1M1FA 3BFMA 4F7UF 4M77B 4M7AC 2M16A 1BI0A 2IY5A 4P3OA 4L59A 2XDPA 2C8MA 5LJ5j 3TEGA 4X34A 4M7DF 3E9IA 1NJ5A 1NPPA 2D6FA 1M8VA 2P0PA 4YROA 4RQEA 3QYGB 3JB9F 2G4CA 1KC8C 4ZTFA 1OZ2A 2G3RA 3OS2A 1QE0A 4M78E 1ADJA 3WXMB 5CK9A 2ZIOA 3HTZA 3TEHA 3QO3A 1EVLA 3VQWA 1G5VA 4LDUA 1Q82U 3LH0A 2CYZB 3LW5E 4OLFA 4M7AA 3UT1A 4C5GA 2R5MA 1K9MC 3RUXA 2DAQA 2WSFE 4LVJA 3G71T 1V29B 4P74C 1H4TA 2P4TA 1XQHA 3JCMg 1X6OA 3M53A 4ZTUB 4Q5WA 1ASYA 4C8QA 4L87A 4NS5A 3JAME 3M59A 3LX7A 3CMAT 5GAN2 3SDZA 4M7AG 4BI4A 2VYTA 4E7JA 1JJCB 5FU7B 2EWNA 2QQAA 1HXDA 4E47A 3QTCA 2C06A 2CJ9A 3OD1A 2JTFA 4KT0E 2K3YA 4KR2A 2E12A 1NYQA 4XK8E 4BE2A 3A7AA 4C8QG 4M78D 3JB9J 4XU1A 1ATIA 2MWOA 2DD4A 2AKWB 2E64A 2E3CA 4FSXA 3V7SA 3CCLA 4P74A 3HFNA 1Y96B 4HWOA 3G71A 3GF5A 1VQMT 3GPLA 4J7FA 2J3LA 2DTHA 4C5HA 3A8OB 3V7CA 4JRPA 4XTVA 2XIDA 3ER0A 3CMAA 2DXTA 4IURA 1QVFS 3RMSA 3L2QA 3A74A 1I5LA 4XU2A 5GANh 3PGGA 1Z7NA 2VUBA 1K8AC 3QKJA 1G3SA 1IZ6A 3LGFA 2I4NA 5J3BA 3WQZA 3OYFA 3HFVA 2RJEA 2JOYA 3IKLA 5J39A 2CZ6B 2LCCA 1KQ2A 3QO5A 5GAMj 2HQXA 3UH0A 1GGMA 4M77C 4M7AE 1VIFA 1R8OB 2LTOA 2PVOB 2DZCA 1J5WA 5GAOq 1QVGA 4HCCA 1VUBA 5GAN5 2V8KA 3VJPA 1YJNA 2EJFA 1G5IA 4K88A 3CC7T 3UWNA 5GMKh 1S72A 4C8QE 4F7UA 3FB9A 2ZT8A 2O4XA 1SESA 3PMIA 3HL8A 4M7DA 1H4VB 3ICAA 11ASA 2ZINA 4XQ3A 2ZZDA 2XHCA 4BW9A 4TQFA 4J8OA 3IKMB 3OYIA 5I2MA 4YDQA 2AMCA 4F7UG 1KQSA 3UDCA 4ELZC 1VQPT 2XK0A 4YRGA 2YLBA 1WYDA 3QO8A 2EQKA 4JJNK 4HA8A 1YCYA 1VQ4T 3E9GA 3QDRB 2HNIA 4M7AD 3JCMX 2GF7A 3LGLA 2DTOA 1VQKT 3LSSA 2RH2A 4M77G 4TVAB 5LJ5g 4M75B 1Q82C 1OYXA 5FU7C 2XDDA 3CCMT 3PNWC 2DPPB 3HFZA 4C8QD 5LJ3e 5A0LA 4HT4A 5GAOr 1B70B 2AHJB 4YP0A 1VIEA 3HXVA 4YCUA 2MMPA 1D3BB 2QHTA 5C53B 3QZ9B 4NL2A 4H2YA 3FEOA 3RESA 4HWTA 4BI8B 1VQ5T 3EAEA 5A0DA 2RI5A 3G4SA 4DPGA 2KSSA 4L5GA 12ASA 1B34A 4EMGA 3BW1A 2M9UA 2K2VA 5FRMA 3CEYA 1YIJT 2FL7A 3M56A 2RJCA 3META 4X5OA 1VQKA 3HRKA 5FROA 3VBBA 3CC2T 2B8AA 3VQXA 2E5QA 2QQBA 1ZHIA 1XNIA 3DSQA 4F7UE 3RKXA 5GAMf 1X75C 2RHSA 3MEWA 1OI1A 5GMKl 1QVPA 1PSEA 2E10A 4Y28E 3LSQA 3HRTA 2RHQB 1UGRB 3M4YA 3V8LA 4QQ6A 4M7DE 5K1XA 2X35A 4P73C 5GMKm 4Y91A 1Y07A 4NCXA 1G5HA 1WGSA 1M90U 3A8HB 5GANj 2QEXA 5CR2A 3LC0A 2ZZEA 5GAN4 3VYGA 1G3WA 4HCZA 3JCMb 4YRSA 1W2BA 3VUBA 4UP8A 5M9OA 2ZT5A 2C7IA 2K5FA 2JTMA 2EIFA 2ZXFA 3SWNB 4CI0C 3I55A 3A5ZA 1EFWA 4YRPA 2H3JA 1YJ9T 3UGQA 3CCVA 4V2SA 4PJOB 2X4YA 2ZZGA 3A7RA 3JCMW 2LQ8A 5ELNA 2R5AA 5CKEA 4PG3A 4X9DA 2DXCA 3A8GB 2F5KA 3OYEA 1OZ3A 3CPFA 1UEBA 3CCQA 2O01E 5CAIA 2LRQA 5CO7A 1WU7A 4ZGJB 5EG2A 5GAOl 1ADYA 4C0ZA 2EQJA 1XTDA 2DD5A 1BYMA 3E9FA 4HWSA 3FLGA 3ZEHA 3CBPA 3CD6A 1B76A 1SSFA 4M7DD 4A54A 5GAOm 2DKGA 4XTUA 5HGQA 3OYGA 3J80E 4O2DA 1EIYB 1YITT 3FDRA 2F69A 4JRQA 3X25B 3MF2A 3OBYA 4TVRA 3JB9D 4N0AC 4M77D 4YRJA 5GAMg 2RHIA 3P8HA 2CZ1B 2K57A 5HY6A 4YRLA 1QVGS 3LYIA 5LJ3h 2GQVA 2QI2A 2JZ2A 3O8VA 3FIFA 4M75C 5KH6A 4HWPA 2ZCFB 2QDYB 1VQLT 4VUBA 3QBYA 3L4GB 5GAN3 3C94A 3JB9H 1QP3A 4ZN3A 2Q5HA 3OS1A 4JLIA 3R07A 1YJWA 1WQ7A 4P71A 4NL3A 1EQRA 1GXIE 3HXYA 5CVIA 3BDLA 3KBGA 3OYJA 3MQZA 4H2XA 4HCBA 3QZ5B 3CCRT 2YHTA 4H2UA 1VQ6T 5LJ5d 2ZT6A 2Y4YA 3S3OA 3CCJA 1X2GA 4G84A 2PUKB 4BI3A 3VQVA 4DOVA 2XKOC 4UC4A 5A2QE 4PHCA 2ZCEA 5D6YA 4TVAA 4KR3A 2XD0A 2ZPGB 3HP9A 5KNNA 3P8DA 1BI2A 5GANf 1VQLA 1EVKA 3CCUT 2XDBA 4N4GA 4A4FA 1HK9A 1X54A 5CQXA 5GAN8 2OTLT 2HBPA 1N8RU 4CH3A 3NEMA 4MZMA 4M77F 3OYMA 4C0GA 3X28B 4RMFA 1RI0A 2LT4A 3CCRA 1Q81U 5GMKe 3OMCA 3QHSA 3SWNC 3OSVA 3V8JA 5DM7R 4QW2A 4A4HA 3NTKA 3L2WA 2ZPEB 2EL9A 2E6NA 4PJOC 4Q15A 2L89A 4II1A 2XI9A 4A4EA 2D0QB 4JRKA 3CMET 3N5BB 1M90C 2K5IA 1B7YA 3RMQA 1USYC 4YRCA 4WJ3M 4CRIA 1W66A 2KDSA 3MEUA 4YRQA 1PYSA 2LX9A 2RI2A 4MZTA 3MF1A 3HSBA 3JB9I 5CKHA 4PLIA 4C92B 2IVWA 3VYHB 5KCHA 1N9WA 1NE8A 2PQWA 3TUPA 3CXCA 2CZ0B 1YFSA 4BE1A 3QNEA 3RKWA 4MMLA 4E51A 4YPFA 2NLUA 3P8TA 1W2BS 3PCOB 4QVZA 5CIUA 5KE3A 3KUFA 3SD4A 4XEMA 4QQGA 3P8YA 1USYA 1HC7A 4P72C 2LDMA 2QA4T 2OTJT 3CMEA 3WVDB 2E70A 2XGTA 4Q6GA 1O9SA 1ZQ1A 4LVKA 3UGTA 3NTHA 2L8DA 2K3XA 4BACA 4PJOG 2CJBA 5LJ3j 4P75C 2I4OA 2PUOB 4FT2A 1ASZA 2ARUA 4YRIA 5IAYA 5GAMd 4P3NA 1EOVA 2Q7EA 4CS3A 1TH7A 3JCMh 4PL6A 4ME7A 5CKDA 4MZPA 4LD6A 1G3YA 3LWIA 3M54A 3EFRA 2ZR3A 1XOVA 4OMFB 2CZ7B 4Z02A 2P0KA 1YB3A 4LVIA 2M1HA 3OYHA 4IUVA 2CIMA 1Z7MA 4CH4A 1IL2A 3L42A 4OB3B 3KXTA 1G51A 3DB3A 2Q7HA 4XEOA 3MCAB 1VQMA 4FU6A 3HY0A 1FXXA 1H3ZA 1NZ9A 4HT9A 4YRTA 4R56A 2RM4A 4M78B 3GOXA 4C0DB 3RACA 5J26A 2X4JA 4BB7A 1BKBA 1VQZA 3QIIA 4TTVA 3GP8A 1BBUA 3L2UA 3REXA 2ODRC 4YRRA 4JS4A 1E1TA 3A7UA 1JJ2A 4M77A 4EMHA 4BD3A 2IG0A 2A3LA 3L2RA 1N8RC 5IT9E 3I7FA 2EQUA 2DU7A 3FJPA 4D6WA 3M55A 1Q81C 2ZGWA 1H641 1ZBXA 2ZNJA 1B8AA 3OBWA 3MHXA 3JCMV 3CC7A 3HRIA 4C92C 4J6WA 1QP2A 3A8LB 3G6ET 2ALYB 3M9QA 1VQ8T 3VV0A 2CKKA 2EYQA 1VQ7T 4TWAA 4BE0A 2ZPBB 1M1GA 1U1TA 4K87A 1VQNT 5LJ3f 3QO7A 3VQYA 3OYNA 4M75F 2ZPFB 2Q7GA 1WQWA 2A7YA 2QQSA 4PJOD 2X4WA 2RD1A 4O6JA 4TQDA 1VQPA 4UPAA 2V8JA 2PVGB 2IY5B 1Q86U 2ZIMA 3W3SA 1VQ4A 4FIBA 1M4ZA 3PZCA 3FRNA 2EKOA 3TCJA 1SRYA 1BBWA 5GANd 4RKUE 4QQDA 4EMKB 1JJCA 4ZGDB 2E5AA 5C51B 3OQ5A 5C6SA 1W4SA 4RCCA 3G6EA 1L0WA 3CCMA 3S3MA 2K4YA 5GAOp 3CXCS 1VQ7A 3PIOA 3HFOA 3RIRA 4C92G 3TEHB 3S3NA 4R55A 2AKWA 1N6AA 1N9RA 2E6ZA 1VQNA 4J6XA 2GFUA 5DY9A 1Y96A 2K5LA 4M77E 1KD1U 5GAOn 4UP9A 1VQ5A 2VV5A 4EDUA 4IUPA 4YREA 1BI1A 2RK2A 2GFAA 1WPYA 4C8QB 1UGQB 2Y90A 1YIJA 1E22A 3QJ6A 3CPWA 5HK3A 5ELOA 3CC2A 2KQWA 2BIVA 2CS7A 5LJ3g 2VC8A 4M78C 4C0DC 5CCAA 1VQ9T 2RA2A 5FU6B 1LNXA 2MAMA 2RB6A 2HAXA 3RKYA 4P73A 5HK0A 4GLKA 4C0FA 4EX5A 1Y71A 1UB4A 5GMKj 1KG1A 4CH5A 4PJOF 2LNVA 4ZGEB 4PKCC 3L2ZA 4HKEA 3CCET 3TREA 1X55A 1K73U 3C12A 5KCOA 3NENA 4XU3A 3BDUA 2WACA 1MGQA 4BY6B 1UGSB 2JVVA 1QVFA 3MO8A 5CQYA 2RHUA 4DA4A 3A31A 4J6YA 2RO0A 5DLOA 3L1AA 3M4GA 3OW2A 4BDYA 4HWRA 1YJ9A 2RHYA 3M58A 3QJYA 5K1PA 4OF1A 2WSEE 3JCMP 3DLLA 4UP7A 1MHNA 1IREB 3NELA 3HY1A 1DJ7B 3CBMA 3HXWA 3T9NA 1NYRA 3OYDA 1VQ9A 3HXXA 3H8ZA 1SETA 5LL6S 4A4KA 1VQOT 5GAN6 1WLEA 2KK4A 3A32A 4YCWA 3OS0A 3LLRA 4XAXB 2CGHA 4LD9K 2ODRD 3RERA 3HPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFT A;  3TUP A;  1B7Y B;  1YFS A;  3QNE A;  4N0A A;  3RKW A;  2DDZ A;  4YRM A;  4MML A;  3BY7 A;  4G85 A;  3E9H A;  4M7D A;  4E51 A;  1YGB A;  4YPF A;  4YRF A;  3P8T A;  1H4V B;  3ICA A;  11AS A;  2ZIN A;  3PCO B;  4XQ3 A;  1PYS B;  3JCM e;  2P0L A;  4BW9 A;  4TQF A;  3IKM B;  4X9C A;  4XEM A;  2ZR2 A;  4YDQ A;  2AMC A;  3CMQ A;  1USY A;  4M75 A;  1HC7 A;  3P8Y A;  4P72 C;  4F7U G;  3NET A;  2DTI A;  4EMK C;  4M7A F;  4F7U B;  3JCM J;  3JCM f;  2ARS A;  2DQ3 A;  4YRG A;  2YLB A;  3HXU A;  1NJ2 A;  1WYD A;  3JCM c;  3QO8 A;  3HXZ A;  2XGT A;  4Q6G A;  4HA8 A;  1YCY A;  4C92 D;  3UGT A;  2YLC A;  3KFU A;  1B70 A;  2DZ9 A;  3REU A;  4M7D B;  3G1Z A;  2HNI A;  4M7A D;  3JCM X;  5C52 B;  4PJO G;  2CJB A;  5LJ3 j;  4P75 C;  2I4O A;  1D3B A;  4TVY A;  4XTZ A;  2DTO A;  2EJG A;  1ASZ A;  1E24 A;  2ARU A;  4YRI A;  4ZIB A;  4C8Q F;  5GMK i;  3LSS A;  4M77 G;  5GAM d;  4P3N A;  4WF2 A;  4M75 G;  4TVA B;  1EOV A;  4J15 A;  2Q7E A;  2AMC B;  5LJ5 g;  2PMF A;  4M75 B;  4CS3 A;  4HVC A;  1TH7 A;  3JCM h;  2I2L A;  2I4L A;  4XU0 A;  3HFZ A;  5F5W A;  4C8Q D;  5LJ3 e;  3GIB A;  2JN0 A;  5I21 A;  2VXE A;  5GAO r;  1B70 B;  1KOG A;  4YP0 A;  3EFR A;  2ZR3 A;  3IAL A;  1E1O A;  3HXV A;  4YCU A;  4EMK A;  1D3B B;  2FB7 A;  2QHT A;  1LYL A;  4H2V A;  4AH6 A;  2ZNI A;  4C8Q C;  4P71 C;  5C53 B;  1YB3 A;  1I81 A;  4NL2 A;  2CIM A;  4H2Y A;  4C92 E;  2E1H A;  1NJ6 A;  3RES A;  4HWT A;  1Z7M A;  4M78 A;  1H4S A;  2ART A;  1X01 A;  4CH4 A;  1IL2 A;  1N9S A;  3RGL A;  2QHU A;  4DPG A;  12AS A;  3HFZ B;  1B34 A;  4EMG A;  3BW1 A;  2RHQ A;  2E41 A;  1G51 A;  1X56 A;  4H2S A;  2Q7H A;  2DU5 A;  4XEO A;  4J5Y A;  2ZTG A;  5GAN 7;  4X5O A;  1I8F A;  4YCV A;  3JCM Q;  3HY0 A;  3MEY A;  3HRK A;  4CH6 A;  2QHS A;  3VBB A;  3RL6 A;  3VQX A;  4EO4 A;  4XTX A;  4YRN A;  3SB2 A;  1YFR A;  2DJZ A;  4HT9 A;  3DSQ A;  4YRT A;  4M78 G;  4F7U E;  3RKX A;  5GAM f;  3M4P A;  2RHS A;  4PNO A;  2RM4 A;  4M78 B;  5GMK l;  1H4Q A;  2E10 A;  3RAC A;  3SWN A;  3LSQ A;  1B34 B;  1VQZ A;  2RHQ B;  3EFS A;  4TTV A;  5LJ3 d;  4P3P A;  1BBU A;  5GAN g;  3V8L A;  4M7D E;  3REX A;  4PJO A;  4XTY A;  5K1X A;  4P73 C;  4CS4 A;  2ODR C;  4QVD A;  5GMK m;  4Y91 A;  4YRR A;  3QUI A;  4NCX A;  1G5H A;  1E1T A;  1KMN A;  3A7U A;  3UFG A;  4QVC A;  5GAN j;  3INZ A;  3V7R A;  4XTW A;  3LC0 A;  2ZZE A;  5GAN 4;  4C92 F;  4M77 A;  4EMH A;  2ZZF A;  3JCM b;  2ALY A;  4YRS A;  4M75 E;  4UP8 A;  1I4K 1;  2ZT5 A;  4H02 A;  2QTX A;  5GAM h;  2Q5I A;  2C7I A;  3I7F A;  4OP0 A;  2RHS B;  4LNS A;  1BIA A;  2DU7 A;  2ZXF A;  3SWN B;  3A5Z A;  1JBM A;  2DVE A;  1EFW A;  3FJP A;  4YRP A;  4RQF A;  5GAN e;  2VXF A;  2ZGW A;  1H64 1;  2ZNJ A;  2DEQ A;  1B8A A;  3UGQ A;  4V2S A;  4PJO B;  1BIB A;  1NJ8 A;  1X2H A;  2ZZG A;  3A7R A;  3BFM A;  2ZT7 A;  3JCM V;  3HRI A;  3JCM W;  4C92 C;  4J6W A;  3VU3 C;  4F7U F;  4M77 B;  5ELN A;  1EIY A;  4PG3 A;  4RCB A;  3AHU A;  4M7A C;  4X9D A;  2ALY B;  2J3M A;  1LJO A;  2IY5 A;  4P3O A;  2C8M A;  5LJ5 j;  3TEG A;  4H2W A;  5CAI A;  1SER A;  2DXU A;  1WU7 A;  4M7D F;  4K86 A;  3E9I A;  5GAO l;  1ADY A;  1NJ5 A;  4TWA A;  4BWA A;  4TVW A;  4P72 A;  1M8V A;  1U1T A;  4K87 A;  5LJ3 f;  3QO7 A;  4YRO A;  1U1S A;  4HWS A;  4RQE A;  3VQY A;  3JB9 F;  2G4C A;  1B76 A;  4M7D D;  4M75 F;  4A54 A;  2Q7G A;  1WQW A;  5GAO m;  2DKG A;  5LJ5 e;  4XTU A;  5HGQ A;  2DQ0 A;  4PJO D;  3L4G A;  4O2D A;  4TQD A;  2RD1 A;  1EIY B;  2CJA A;  4UPA A;  1QE0 A;  3MF2 A;  4M78 E;  1ADJ A;  2IY5 B;  4P75 A;  3JB9 D;  4N0A C;  2PME A;  4M77 D;  2ZIM A;  4YRJ A;  4M75 D;  5LJ5 f;  3W3S A;  4M7D C;  5GAM g;  3PZC A;  2ZIO A;  4JUV A;  3HTZ A;  2K57 A;  3TEH A;  3QO3 A;  4YRL A;  1SRY A;  1BBW A;  1EVL A;  3VQW A;  5GAN d;  5LJ3 h;  4OLF A;  4M7A A;  4EMK B;  4ZTZ B;  1JJC A;  2E5A A;  5C51 B;  3FIF A;  4WI1 A;  4M75 C;  3RUX A;  4HWP A;  4RCC A;  1JRI A;  3L4G B;  2E65 A;  4P74 C;  1H4T A;  1L0W A;  5GAN 3;  3JB9 H;  2EJ9 A;  3V8K A;  3JCM g;  5GAO p;  2Q5H A;  4RDX A;  3BJU A;  4JLI A;  3R07 A;  4ZTU B;  1WQ7 A;  1ASY A;  4C8Q A;  4L87 A;  4P71 A;  3HFO A;  4NL3 A;  3RIR A;  4C92 G;  3TEH B;  1EQR A;  2AKW A;  1N9R A;  5GAN 2;  4PJO E;  3HXY A;  4M7A G;  1LOJ A;  4J6X A;  4H2T A;  1JJC B;  5DY9 A;  1Y96 A;  2EWN A;  4H2X A;  1HXD A;  4M77 E;  3QTC A;  4M78 F;  1NNH A;  2CJ9 A;  2YHT A;  4H2U A;  3OD1 A;  5GAO n;  5LJ5 d;  4UP9 A;  4WJ4 A;  2ZT6 A;  1X2G A;  4KR2 A;  4G84 A;  1NYQ A;  4KQE A;  4YRE A;  4MMK A;  3VQV A;  3IG2 A;  3A7A A;  4PHC A;  4C8Q G;  1WPY A;  2ZCE A;  4KR3 A;  4TVA A;  4M78 D;  3JB9 J;  4XU1 A;  4C8Q B;  2QHV A;  2Y90 A;  1E22 A;  1ATI A;  2AKW B;  1C0A A;  2E64 A;  2E3C A;  4A53 A;  5KNN A;  2EAY A;  3ERR A;  3V7S A;  4P74 A;  5ELO A;  3HFN A;  5GAN f;  5LJ3 g;  1Y96 B;  4H2X B;  4HWO A;  2VC8 A;  1EVK A;  4M78 C;  4M7D G;  2RA2 A;  1LNX A;  2RB6 A;  3RKY A;  4P73 A;  4CS2 A;  4NOY A;  4EX5 A;  2J3L A;  2XTI A;  2DTH A;  5GMK j;  1HK9 A;  3V7C A;  1X54 A;  4CH5 A;  3JB9 G;  4PJO F;  3QSU A;  5GAN 8;  4DQ2 A;  4XTV A;  1QF6 A;  3M4Q A;  3L2Z A;  4YRK A;  2DXT A;  4CH3 A;  3NEM A;  4M77 F;  1X55 A;  3A74 A;  1I5L A;  4XU2 A;  4JRI A;  2P5I A;  5GAN h;  3PGG A;  1Z7N A;  4RMF A;  3A5Y A;  2I4N A;  3NEN A;  4XU3 A;  3BDU A;  5GMK e;  1NJ1 A;  1MGQ A;  3QHS A;  3SWN C;  3V8J A;  3WQZ A;  3HFV A;  3A31 A;  1FYF A;  4J6Y A;  2EL9 A;  3JCM d;  3IKL A;  3L1A A;  4PJO C;  3M4G A;  4Q15 A;  1KQ2 A;  4C92 A;  4HWR A;  3QO5 A;  5E3I A;  5GAM j;  4HT8 A;  2FYK A;  4JRK A;  5K1P A;  3UH0 A;  3JCM P;  1GGM A;  4UP7 A;  3NEL A;  3HY1 A;  1B7Y A;  4M77 C;  3P8V A;  4M7A E;  1USY C;  3RF1 A;  3HXW A;  4YRC A;  1WNL A;  2DZC A;  2I4M A;  1J5W A;  1NYR A;  4WJ3 M;  1W66 A;  5GAO q;  1KMM A;  4YRQ A;  5GAN 5;  3PCO A;  1PYS A;  3HXX A;  1HTT A;  2EJF A;  5GAM e;  1M5Q 1;  5LJ5 h;  1SET A;  1G5I A;  3MF1 A;  1KQ1 A;  4K88 A;  4YYE A;  3HSB A;  3JB9 I;  5GAN 6;  1RIQ A;  5GMK h;  1WLE A;  4C8Q E;  4F7U A;  3A32 A;  4YCW A;  4C92 B;  3FB9 A;  2CGH A;  2ODR D;  3RER A;  2ZT8 A;  1N9W A;  4M7A B;  1SES A; 
#chains in the Genus database with same CATH topology
 1YFT A;  2EVR A;  2P84 A;  2XG8 D;  1JJ2 S;  4N0A A;  2NS6 A;  4YRM A;  2ROL A;  4G85 A;  3E9H A;  5FRN A;  1YGB A;  1YIT A;  1KQS S;  3REA B;  1UGP B;  2K7A A;  1O75 A;  1OPK A;  3PTA A;  4YRF A;  3C4S A;  1PNJ A;  3JCM e;  2F2V A;  1FWZ A;  2P4R A;  4X9C A;  1YCS B;  3UPU A;  2XMF A;  3I5R A;  4M75 A;  4IKF A;  4EMK C;  3MP1 A;  4F7U B;  1U8R A;  3CCR Q;  3JCM J;  3OSS C;  3JCM f;  2ARS A;  4PFP A;  3M57 A;  5I11 A;  4RMO A;  2DQ3 A;  2O4X B;  3HXU A;  2XIC A;  4GY5 A;  4C92 D;  3JSC A;  2YLC A;  2D1X A;  1B70 A;  2DZ9 A;  3REU A;  4M7D B;  3G1Z A;  5C52 B;  1P92 A;  5IHK A;  1PC0 A;  1D3B A;  1WI7 A;  4J7I A;  4XTZ A;  2EJG A;  1Q86 C;  2DXB A;  3MEV A;  2KYM A;  3MP8 A;  4ZIB A;  1XJW B;  2QGF B;  2COZ A;  2M02 A;  2XU8 A;  1FMW A;  2QAZ A;  1VQO A;  4M75 G;  1NEB A;  1KJW A;  2AMC B;  4HVC A;  1TUD A;  2PVD B;  5IN1 A;  2K3B A;  4XU0 A;  2JMC A;  1E6G A;  2ABL A;  1WJR A;  2GCX A;  2RF0 A;  4J9H A;  1RAH B;  1WJS A;  3H0H A;  3GIB A;  2JN0 A;  4J83 A;  3F70 A;  3EH1 A;  4KUI A;  3ASK A;  2RHX A;  2VXE A;  1VQ6 A;  1JQQ A;  1KOG A;  1Z9Q A;  1QMC A;  4F17 A;  5D6X A;  3TQ7 P;  1E1O A;  2DK3 A;  3NFC A;  4N4H A;  4EMK A;  1M1K R;  4FM4 B;  4H2V A;  1JJ2 P;  2ZNI A;  2M0O A;  4C8Q C;  3VKI A;  4LDV A;  3NGP A;  3HRU A;  4EPC A;  1R77 A;  1AWW A;  1QCN A;  2KRS A;  1G2B A;  4PK4 A;  2E1H A;  4DBF A;  1H4S A;  3ZBD A;  4R0K A;  2ART A;  1X01 A;  4LVL A;  1N9S A;  5KYX A;  1VYV A;  3WVE B;  4JS5 A;  1Y7X A;  3HFZ B;  3PIP A;  2RHQ A;  2E41 A;  2RJD A;  5FU6 C;  1X56 A;  4QT7 A;  1KD1 C;  1M1K U;  3CCU A;  2KEA A;  2G6F X;  3JCM Q;  2EGC A;  2F1L A;  3CCL T;  3MEY A;  3OYY A;  3CME Q;  2QHS A;  2GTJ A;  4DEY A;  3RL6 A;  4E7Z A;  4EO4 A;  4XTX A;  2OTL A;  4YRN A;  2L3P A;  1YFR A;  1IHV A;  1N27 A;  4PNO A;  2LQK A;  1RAC B;  3MPU B;  1JB0 E;  3SWN A;  4HCK A;  1B34 B;  4BY6 C;  2K2M A;  3CCS T;  4OGC A;  1BI3 A;  3EFS A;  1NG2 A;  5LJ3 d;  3X26 B;  4P3P A;  5GAN g;  4BUG A;  4PJO A;  4XTY A;  4CS4 A;  5IXB A;  1B07 A;  2HBW A;  1KMN A;  4LVM A;  4QVC A;  1WJQ A;  4XTW A;  2AKK A;  4B9X A;  1JXM A;  4C92 F;  4LNP A;  2C0O A;  4M75 E;  1U06 A;  3G7Z A;  2JUF A;  2Q5I A;  4OP0 A;  5D7U A;  2VB6 A;  2RHS B;  4DBH A;  2RK1 A;  5KYU A;  3CPW S;  1K73 C;  1N5Z A;  5I2S A;  4RQF A;  2M51 A;  3H6Z A;  2VXF A;  2DEQ A;  4YTL A;  4E7H A;  1QKW A;  1BIB A;  2HCK A;  4JZ4 A;  1NJ8 A;  4FYY B;  2ZT7 A;  3I9Q A;  3GNF B;  4ELY C;  4DBQ A;  4ZN1 A;  5CKB A;  2MYS A;  3QG1 A;  3CQT A;  1Y57 A;  3VU3 C;  1EIY A;  3JRZ A;  4RCB A;  3AHU A;  4IUT A;  2DET A;  4E7L A;  2BTT A;  2ROT A;  2ZPH B;  2J3M A;  1LJO A;  1YJN T;  4P5N A;  2EYZ A;  4FYW B;  2A8E A;  4H2W A;  2J6O A;  1SER A;  1MUZ A;  2DXU A;  1VQM Q;  4IUU A;  3CC4 T;  2KVQ G;  4A4G A;  3A5Z B;  3UA7 A;  4K86 A;  3CCS A;  4BWA A;  1WIE A;  2F2W A;  2L3R A;  2VVK A;  2RJF A;  3P8B B;  1S72 T;  4TVW A;  4KUD K;  4P72 A;  2QQ9 A;  2QXF A;  1ZA1 B;  4RTU A;  1U1S A;  2LZ6 B;  1FX7 A;  3EG0 A;  5LJ5 e;  2DQ0 A;  3L4G A;  2WSC E;  2LCL A;  3OY9 A;  3OW2 S;  2PZ1 A;  4L6V 5;  2QA4 A;  2OTJ A;  2CJA A;  1OUL A;  4P75 A;  1D1C A;  2PME A;  4M75 D;  4PLL A;  5LJ5 f;  4M7D C;  2I0N A;  1QW1 A;  4JUV A;  3X20 B;  1I1J A;  1TG0 A;  4IIM A;  3S6W A;  3Q1J A;  3OYL A;  1NJI R;  4ZTZ B;  2MI6 A;  3CPW P;  7AT1 B;  3ULR B;  4JLG A;  1YHQ T;  4WI1 A;  4DOW A;  1JRI A;  2V8I A;  2E65 A;  1AD5 A;  1ACM B;  2EJ9 A;  2EQI A;  3V8K A;  4RDX A;  3CC4 A;  3BJU A;  3EG2 A;  3CC7 Q;  4FT4 A;  2J06 A;  3GNG A;  1NJI U;  1ZUU A;  3RDV A;  1UFF A;  2NUT A;  4PJO E;  1BK2 A;  4HXJ A;  4KRT A;  1MV0 B;  2JJ9 A;  1LOJ A;  4H2T A;  5KE2 A;  4M78 F;  1NNH A;  2YUQ A;  2CT3 A;  2D9T A;  4WJ4 A;  4F04 B;  1WX6 A;  2D0N A;  1QVF P;  1X2Q A;  3OYK A;  3M5A A;  4KQE A;  1Q7Y R;  4MMK A;  1OPL A;  3IG2 A;  2FRY A;  4KBM B;  5IXF A;  1TWB A;  3R6O A;  2F5T X;  3OW2 P;  2QHV A;  2JNG A;  2DNU A;  3HRS A;  1C0A A;  4A53 A;  5D6W A;  2EAY A;  3ERR A;  3EFO A;  3G4S T;  3EGU A;  1EZZ B;  1YHQ A;  1IHW A;  4H2X B;  2DO3 A;  3QYH B;  1EFN A;  4M7D G;  4MDX A;  3PMT A;  1VQ4 Q;  3SFM A;  4LDX A;  2MK5 A;  1Q7Y U;  2QDL A;  2DF6 A;  4CS2 A;  2P0Q A;  4NOY A;  1WLP B;  3DLM A;  4OB0 B;  1IXD A;  1KHC A;  5C0M A;  3J81 E;  2XTI A;  2RI3 A;  3DKM A;  3JB9 G;  3QSU A;  2W10 A;  4D8K A;  4DQ2 A;  1QF6 A;  1M1K C;  3M4Q A;  4YRK A;  2JS0 A;  1KHI A;  3G6E Q;  2KMT A;  3CCM Q;  3OS5 A;  1OEB A;  4JRI A;  2P5I A;  1YBY A;  2ZPI B;  1T3S A;  4RTY A;  2X9H A;  3A5Y A;  3TEE A;  5IH2 A;  1EIF A;  2LQW A;  1JU5 C;  3E19 A;  1NJ1 A;  1VQ7 Q;  5HKC A;  4FYV B;  4OB2 B;  1FYF A;  2QEX T;  1VQN Q;  4RTZ A;  3OMG A;  3JCM d;  3GLX A;  2OAU A;  1KC8 R;  4C92 A;  4ATO A;  5E3I A;  4HT8 A;  2JTE A;  2FYK A;  4OGE A;  1FMV A;  3P8V A;  1ZX6 A;  1VQ5 Q;  4PJM A;  3MP6 A;  3RF1 A;  3I55 T;  1T0J A;  4ZNX A;  1YI2 T;  1WNL A;  5L8R E;  4BDZ A;  2I4M A;  3VS7 A;  2FHD A;  1KMM A;  2CSI A;  3PCO A;  4J9G A;  2HZY A;  3CCV T;  1VQ8 A;  3FC3 A;  3PT9 A;  4AG2 C;  1HTT A;  1YIJ Q;  1M9S A;  5GAM e;  1M5Q 1;  5LJ5 h;  2KNB B;  1KC8 U;  1KQ1 A;  2O31 A;  5KYW A;  4YYE A;  5FW9 A;  1RIQ A;  3M0U A;  4MDW A;  3CC2 Q;  4F14 A;  3HKS A;  1K9M R;  4PJL A;  2LVM A;  2RHZ A;  1H8K A;  3I56 T;  4M7A B;  5A0G A;  3CCQ T;  3OA6 A;  1PKT A;  1B7Y B;  2NWM A;  4PFZ A;  5DLQ E;  2DDZ A;  3BY7 A;  2ED0 A;  3FJ5 A;  2GNC A;  1PYS B;  4LDY A;  2PU9 B;  1ZA2 B;  2P0L A;  3HTR A;  4IUQ A;  2DIQ A;  3CBO A;  2KAF A;  3CD6 T;  1K9M U;  2ZR2 A;  2Y4X A;  3CMQ A;  3OYB A;  3M0P A;  1SEM A;  3NET A;  1TOV A;  2DTI A;  1M27 C;  4M7A F;  2HMA A;  1TS9 A;  5AYF A;  2FVU A;  4ZTJ A;  2KXC A;  2R58 A;  4RG8 A;  3LWH A;  1NJ2 A;  1LVK A;  3JCM c;  3HXZ A;  1YI2 A;  2JMA A;  2D8H A;  3KFU A;  1I07 A;  4C5E A;  4TVY A;  1YJ9 Q;  1E24 A;  4LDW A;  2OX7 A;  1SHG A;  2ENM A;  4C8Q F;  5GMK i;  3OYC A;  4RUG A;  4WF2 A;  4J15 A;  4ORZ A;  2PMF A;  4E7K A;  3A8M B;  2I2L A;  2YSQ A;  4FW1 A;  2I4L A;  3VS1 A;  1VQ9 Q;  2LT1 A;  2YDL A;  3I56 A;  5F5W A;  1UJ0 A;  4JDS A;  1AWJ A;  3OB9 A;  4O5V A;  2MWP A;  5I21 A;  1YJW T;  2J6K A;  3X24 B;  2QQR A;  4OMP A;  1HJD A;  1FYN A;  3IAL A;  1TUG B;  4B9W A;  2BKD N;  2FB7 A;  2DEU A;  1LYL A;  4AH6 A;  2MIO A;  4RG2 A;  4P71 C;  2LC4 A;  2JS2 A;  1I81 A;  1NJI C;  1K8A R;  1E7O A;  4C92 E;  4OVA A;  1NJ6 A;  2FPF A;  4M78 A;  3C95 A;  2BZX A;  1YIT Q;  3CCJ T;  3E1S A;  6AT1 B;  3RGL A;  2B86 A;  3QXE B;  2QHU A;  2NUP B;  1R0B G;  2VGN A;  1R0C B;  4C5I A;  3MEA A;  4H2S A;  4FL6 A;  2DU5 A;  3DB4 A;  4J5Y A;  2ZTG A;  1UDL A;  5GAN 7;  2R57 A;  4ANJ A;  2HD0 A;  1I8F A;  4YCV A;  3L2V A;  1PM3 A;  3PFS A;  4CH6 A;  1K8A U;  4KUL A;  1K0S A;  3J7A F;  4OB1 B;  3SB2 A;  2DJZ A;  1W1F A;  2DER A;  1GCP A;  4M78 G;  2KY9 A;  2AZV A;  3M4P A;  2A37 A;  4N4I A;  3CCE A;  1H4Q A;  3UA6 A;  3VUZ A;  1PSF A;  1NLO C;  3HHT B;  1MMN A;  3QPH A;  1M3A A;  2EFI A;  1CKB A;  4IIO A;  2Z0W A;  3URG A;  2RQW A;  1VQO Q;  3ME9 A;  3ZFJ A;  1Q7Y C;  1AHJ B;  4QVD A;  2DIG A;  3QUI A;  2LJ3 A;  3UFG A;  3INZ A;  3V7R A;  2YRV A;  1KSW A;  2DL4 A;  2FZK B;  1GFD A;  4Z88 A;  1ZBJ A;  2ZZF A;  4J9D A;  2L5Q A;  2ALY A;  2BUD A;  1NPR A;  1I4K 1;  4H02 A;  1RL2 A;  2QTX A;  5FLX E;  5GAM h;  3NTI A;  1VQ6 Q;  2EQM A;  3TU4 K;  4LNS A;  2E5K A;  4PJJ A;  4E7I A;  1BIA A;  1G3T A;  2DBM A;  2RQT A;  1JBM A;  2DVE A;  3OYA A;  2MF2 A;  5GAN e;  2HQE A;  1WXB A;  5CKF A;  4LUD A;  4OML A;  3NPF A;  1T3L A;  2X4X A;  2VGM A;  1X2H A;  5AT1 B;  1M1F A;  3BFM A;  2KT8 A;  1ZLM A;  2IIM A;  4F7U F;  4Y92 A;  1WXT A;  2MOX A;  4M77 B;  1X27 A;  2KT1 A;  4M7A C;  2M16 A;  1BI0 A;  2IY5 A;  4P3O A;  4L59 A;  3CCU Q;  2XDP A;  2C8M A;  3NHN A;  5LJ5 j;  3TEG A;  2LNH B;  1TSF A;  4X34 A;  4M7D F;  1UEC A;  1ABO A;  2BE9 B;  3E9I A;  1NJ5 A;  2HSE B;  1NPP A;  2D6F A;  2LCS A;  2DFU A;  4KH1 B;  2OTL Q;  1M8V A;  1JO8 A;  2P0P A;  4YRO A;  1G8X A;  1UHC A;  1OX8 A;  4RQE A;  3QYG B;  3JB9 F;  1M2V A;  4OMN A;  1KC8 C;  2G4C A;  2DL7 A;  4ZTF A;  1OZ2 A;  1SKU B;  2G3R A;  3OS2 A;  1CKA A;  4DEX A;  1QE0 A;  4M78 E;  1ADJ A;  3WXM B;  2KGT A;  2ED1 A;  1LPL A;  2V1Q A;  1VOM A;  2ESW A;  5CK9 A;  5KYY A;  2ZIO A;  3HTZ A;  3TEH A;  1UJY A;  3QO3 A;  2E4H A;  1K4U S;  1EVL A;  3VQW A;  1G5V A;  4LDU A;  1Q82 U;  1IO6 A;  4J9I A;  4E2F B;  3LH0 A;  2CYZ B;  2FG0 A;  3LW5 E;  4OLF A;  4M7A A;  1RAG B;  3UT1 A;  1PD0 A;  1QWE A;  4C5G A;  2YWW A;  2R5M A;  1K9M C;  3RUX A;  2DAQ A;  1D0Y A;  2WSF E;  3EH2 A;  4LVJ A;  3G71 T;  2FO0 A;  1WXU A;  2K6D A;  1VA7 A;  1V29 B;  4P74 C;  1H4T A;  2P4T A;  1G83 A;  1XQH A;  3PVQ A;  3JCM g;  1MND A;  1YNZ A;  1X6O A;  3M53 A;  4ZTU B;  4PFO A;  4Q5W A;  1ASY A;  4C8Q A;  4L87 A;  4NS5 A;  3JAM E;  3M59 A;  1NEG A;  3LX7 A;  5FWB A;  3CMA T;  2HDA A;  5GAN 2;  3SDZ A;  2COY A;  4M7A G;  4BI4 A;  2KI7 A;  1SSH A;  2VYT A;  4E7J A;  1JJC B;  5FU7 B;  1UG1 A;  1GBR A;  2EWN A;  2QQA A;  1HXD A;  4E47 A;  3QTC A;  2C06 A;  2CJ9 A;  3OD1 A;  2JTF A;  3CCS Q;  4KT0 E;  2K3Y A;  4KR2 A;  2E12 A;  1NYQ A;  2YUP A;  4XK8 E;  4K11 A;  4BE2 A;  1GBQ A;  3A7A A;  4C8Q G;  4M78 D;  3JB9 J;  4XU1 A;  1ATI A;  2DD4 A;  2MWO A;  2AKW B;  1PG5 B;  2E64 A;  2E3C A;  1IGU A;  4FSX A;  3V7S A;  2QA4 Q;  3CCL A;  2OTJ Q;  3H9N A;  4P74 A;  3HFN A;  1D1A A;  2LQN A;  1Y96 B;  2X51 A;  4HWO A;  3G71 A;  1RAE B;  5KYN A;  1PD1 A;  3GF5 A;  1VQM T;  3GPL A;  4J7F A;  2J3L A;  2DTH A;  4C5H A;  3A8O B;  3KFV A;  4JJB A;  1KK7 A;  2DL5 A;  3V7C A;  4JRP A;  4XTV A;  2XID A;  3ER0 A;  3CMA A;  2DXT A;  2KXD A;  4IUR A;  1H92 A;  1QVF S;  3RMS A;  3L2Q A;  3A74 A;  1I5L A;  4XU2 A;  5GAN h;  3PGG A;  2CP5 A;  1Z7N A;  2VUB A;  1K8A C;  1D1B A;  3QKJ A;  3I5S A;  1G3S A;  2NYS A;  1IZ6 A;  3LGF A;  2I4N A;  3CC4 Q;  5J3B A;  1ZSZ B;  2QAS A;  1SF9 A;  1SPK A;  3PE0 A;  2W0Z A;  3WQZ A;  3OYF A;  3HFV A;  4AMC A;  2RJE A;  5IHN A;  1MMD A;  2JOY A;  3IKL A;  5J39 A;  2CZ6 B;  2LCC A;  1KQ2 A;  3H41 A;  3QO5 A;  5GAM j;  2HQX A;  3UH0 A;  1GGM A;  1C0M A;  2CDT A;  3QDF A;  4J9F A;  3E2U A;  1WHL A;  4M77 C;  4M7A E;  1VIF A;  1R8O B;  4LN2 A;  2LTO A;  2PVO B;  4J9B A;  4CC4 B;  2DZC A;  1J5W A;  3NMZ C;  2BZY A;  5GAO q;  1QVG A;  4HCC A;  1VUB A;  5GAN 5;  1NBE B;  2RQU A;  1TUC A;  2V8K A;  1QWF A;  3VJP A;  1YJN A;  2DMO A;  3D7S B;  4F16 A;  2EJF A;  3VS0 A;  1G5I A;  2CP6 A;  4K88 A;  3CC7 T;  3UWN A;  5GMK h;  1YHQ Q;  1S72 A;  4C8Q E;  4F7U A;  3G1J A;  2GGR A;  3EG9 B;  1M30 A;  3FB9 A;  2E3I A;  2ZT8 A;  2O4X A;  4AFU C;  4D8D A;  3EG1 A;  1SES A;  3PMI A;  1X43 A;  1WZO A;  3HL8 A;  1RAI B;  2FZG B;  4M7D A;  3UAT A;  2DM1 A;  2KR3 A;  1I5O B;  1TXQ A;  2IPO B;  1H4V B;  3ICA A;  11AS A;  2ZIN A;  4XQ3 A;  2ZZD A;  2XHC A;  4BW9 A;  4TQF A;  1FMK A;  4J8O A;  3IKM B;  3OYI A;  1RLP C;  1I0C A;  1D0X A;  5I2M A;  4YDQ A;  1ABQ A;  2AMC A;  4F7U G;  1KQS A;  3UDC A;  4ELZ C;  1VQP T;  2XK0 A;  4YRG A;  2YLB A;  1WYD A;  3QO8 A;  2ECZ A;  2EQK A;  4JJN K;  4HA8 A;  1YCY A;  1ZUK A;  1VQ4 T;  2FZC B;  3E9G A;  1UUE A;  2F2X A;  3QDR B;  2HNI A;  4M7A D;  2DL8 A;  3JCM X;  2QG9 B;  1SG5 A;  5GJW B;  2DL3 A;  2GF7 A;  3LGL A;  2DTO A;  1VQK T;  2QYZ A;  1WHK A;  3LSS A;  2RH2 A;  4M77 G;  2FEI A;  4TVA B;  1HYO A;  1WFW A;  5LJ5 g;  1RI9 A;  4M75 B;  1GRI A;  1Q82 C;  1OYX A;  5FU7 C;  2XDD A;  3CCM T;  3PNW C;  2DPP B;  3HFZ A;  1YWO A;  1K76 A;  1VQ8 Q;  4C8Q D;  5LJ3 e;  2LJ0 A;  5A0L A;  4HT4 A;  1SRM A;  2K79 A;  2YXY A;  2O9V A;  1QCF A;  5GAO r;  2YRD A;  1B70 B;  2AHJ B;  2RNA A;  4YP0 A;  3A1P A;  1VIE A;  4AFQ C;  3HXV A;  4YCU A;  2MMP A;  1D3B B;  1D0Z A;  3AT1 B;  2DYI A;  1PRM C;  2VKN A;  2QHT A;  5C53 B;  2C0I A;  2YUO A;  3QZ9 B;  1F1B B;  4NL2 A;  4H2Y A;  3FEO A;  3RES A;  4HWT A;  4BI8 B;  1VQ5 T;  3EAE A;  5A0D A;  2A28 A;  2KBT A;  2RI5 A;  3G4S A;  4DPG A;  2KSS A;  4L5G A;  3RBB B;  1B34 A;  12AS A;  4EMG A;  3BW1 A;  5I22 A;  2M9U A;  2YT6 A;  4OMQ A;  2K2V A;  1WHG A;  5FRM A;  3CEY A;  1YIJ T;  2AIR B;  2FL7 A;  3M56 A;  2RJC A;  3MET A;  4X5O A;  2L3S A;  1VQK A;  1H3H A;  3HRK A;  5FRO A;  3VBB A;  3CC2 T;  2H8H A;  1T0H A;  2B8A A;  1NM7 A;  3VQX A;  1M90 R;  2E5Q A;  2CSQ A;  1ZHI A;  2QQB A;  3I55 Q;  1YI2 Q;  1XNI A;  3DSQ A;  4F7U E;  3RKX A;  5GAM f;  1X75 C;  2RHS A;  3MEW A;  2CP0 A;  1OI1 A;  5GMK l;  1QVP A;  3M0R A;  1PSE A;  2E10 A;  4Y28 E;  5KYX B;  1PHT A;  3LSQ A;  3HRT A;  1ZSZ C;  2OI3 A;  2RHQ B;  1UGR B;  1KFZ A;  1W6X A;  2MCN A;  3M4Y A;  3V8L A;  4QQ6 A;  4M7D E;  5K1X A;  2X35 A;  4P73 C;  5GMK m;  4Y91 A;  1Y07 A;  4NCX A;  1G5H A;  1K1Z A;  1WGS A;  3A8H B;  1M90 U;  5GAN j;  2QEX A;  4AT1 B;  5CR2 A;  3IQL A;  3LC0 A;  2ZZE A;  5GAN 4;  3I56 Q;  3VYG A;  1G3W A;  2JXB A;  4HCZ A;  3JCM b;  2RQV A;  1W2B A;  4YRS A;  3VUB A;  4UP8 A;  5M9O A;  2ZT5 A;  1M3B A;  2C7I A;  2K5F A;  2JTM A;  2EIF A;  2DE0 X;  2FRW A;  2ZXF A;  3SWN B;  2NUZ A;  4CI0 C;  3EGX B;  3I55 A;  3A5Z A;  1EFW A;  4YRP A;  1OU9 A;  3EHQ A;  1QQJ A;  2H3J A;  3EGD B;  1YJ9 T;  3UGQ A;  3CCV A;  4V2S A;  4PJO B;  1RAB B;  2X4Y A;  1LCK A;  2ZZG A;  3A7R A;  2ATC B;  3M0T A;  2LMJ A;  3JCM W;  2LQ8 A;  5ELN A;  2R5A A;  1WA7 A;  5CKE A;  1ZSZ A;  4PG3 A;  4X9D A;  2DXC A;  3A8G B;  2F5K A;  3OYE A;  1OZ3 A;  3CPF A;  4OMM A;  2L2P A;  1UEB A;  3CCQ A;  2O01 E;  5CAI A;  2LRQ A;  1YFN A;  2JM9 A;  5CO7 A;  1WU7 A;  2RN8 A;  3VS6 A;  4ZGJ B;  5EG2 A;  1OOT A;  5GAO l;  1ADY A;  4FW2 A;  4Z89 A;  4GLM A;  4C0Z A;  2EQJ A;  1XTD A;  2DD5 A;  1BYM A;  3JV3 A;  4KGZ B;  3E9F A;  4HWS A;  3FLG A;  2BZ8 A;  3ZEH A;  3CBP A;  3CD6 A;  1RAF B;  1B76 A;  1SSF A;  3CCE Q;  4A54 A;  4M7D D;  1IGQ A;  5GAO m;  1AZG B;  2DKG A;  4XTU A;  5HGQ A;  3OYG A;  1AZE A;  4JPB W;  3J80 E;  4O2D A;  1B7T A;  1EIY B;  1YIT T;  3FDR A;  4HVW A;  2F69 A;  4JRQ A;  3X25 B;  3MF2 A;  1BU1 A;  3OBY A;  4TVR A;  3A98 A;  3JB9 D;  4N0A C;  4M77 D;  4YRJ A;  1D09 B;  5GAM g;  2RHI A;  1Z9Z A;  3P8H A;  2CZ1 B;  2K57 A;  1ZUY A;  4HVV A;  2HKQ B;  5HY6 A;  2JM8 A;  4YRL A;  1QVG S;  3LYI A;  1JEG A;  5LJ3 h;  2GQV A;  2KRM A;  2JZ2 A;  2QI2 A;  3O8V A;  3FIF A;  4M75 C;  5KH6 A;  1MV3 A;  1WHH A;  4HWP A;  2ZCF B;  2QDY B;  1VQL T;  4VUB A;  3QBY A;  4KGX B;  3L4G B;  5GAN 3;  3C94 A;  4FYX B;  3JB9 H;  1QP3 A;  4ZN3 A;  1A0N B;  2Q5H A;  3OS1 A;  2O9S A;  4JLI A;  3R07 A;  1YJW A;  2PTK A;  1WQ7 A;  1E6H A;  1PKS A;  4P71 A;  4NL3 A;  1HD3 A;  1EQR A;  1VYT A;  3VS5 A;  4AG1 C;  1M3C A;  1GXI E;  3HXY A;  1OU8 A;  5CVI A;  3BDL A;  3KBG A;  3OYJ A;  3MQZ A;  4H2X A;  4HCB A;  3QZ5 B;  3CCR T;  4JZ3 A;  2V1R A;  2YHT A;  4H2U A;  1VQ6 T;  5LJ5 d;  1V1C A;  2ZT6 A;  2Y4Y A;  3S3O A;  2CP3 A;  3CCJ A;  1X2G A;  4G84 A;  3LH5 A;  8ATC B;  2H3E B;  2PUK B;  4BI3 A;  3VQV A;  4DOV A;  2XKO C;  4UC4 A;  4AFZ C;  5A2Q E;  2ZCE A;  4PHC A;  5D6Y A;  4TVA A;  4KR3 A;  2XD0 A;  1UE9 A;  1BBZ A;  2ZPG B;  3HP9 A;  1QKX A;  2NUT B;  5KNN A;  2SRC A;  1N8R R;  2FPE A;  3P8D A;  1BI2 A;  5GAN f;  1J3T A;  1RLQ C;  3MKD A;  1VQL A;  4RTX A;  1EVK A;  2LJ1 A;  5FWC A;  3CCU T;  2XDB A;  1QVG P;  1Q81 R;  1QCO A;  2YUN A;  4N4G A;  2EYW A;  4A4F A;  1HK9 A;  1X54 A;  5CQX A;  2EGA A;  5GAN 8;  2AK5 A;  1OQK A;  2OTL T;  1K9A A;  2HBP A;  2HEQ A;  1N8R U;  4CH3 A;  3MJX A;  2A36 A;  3NEM A;  4MZM A;  4M77 F;  1Q82 R;  3OYM A;  3EFO B;  4C0G A;  3X28 B;  4RMF A;  1RI0 A;  2LT4 A;  3CCR A;  2VWF A;  2DRM A;  1Q81 U;  1AVZ C;  2KYB A;  5GMK e;  1OV3 A;  2M0Y A;  3OMC A;  3QHS A;  3SWN C;  3OSV A;  3V8J A;  5DM7 R;  4QW2 A;  2QTV A;  4A4H A;  2CP2 A;  3NTK A;  3L2W A;  1WHM A;  2ZPE B;  2EL9 A;  1U3O A;  2E6N A;  4PJO C;  4Q15 A;  2L89 A;  4II1 A;  2XI9 A;  4A4E A;  1KQS P;  2D0Q B;  4JRK A;  3VS4 A;  3CME T;  1UHF A;  3N5B B;  2DYB A;  1M90 C;  2K5I A;  1B7Y A;  3RMQ A;  2DA9 A;  1USY C;  4Z8A A;  1QLY A;  4YRC A;  5HCK A;  9ATC B;  4WJ3 M;  4CRI A;  1K0X A;  1W66 A;  2KDS A;  2RQR A;  1BCM A;  3MEU A;  4YRQ A;  5EC7 A;  1NLP C;  1PYS A;  2LX9 A;  1ARK A;  2EW3 A;  2RI2 A;  1GFC A;  4MZT A;  3MF1 A;  3TSZ A;  3CCL Q;  3HSB A;  3JB9 I;  1AWX A;  5CKH A;  2QK0 A;  2YRC A;  4HVU A;  4PLI A;  4C92 B;  1PWT A;  2IVW A;  3VYH B;  5KCH A;  3G71 Q;  2AZS A;  4AFS C;  1N9W A;  1NE8 A;  2PQW A;  2D8J A;  3TUP A;  3CXC A;  2CZ0 B;  4CC7 A;  3EGX A;  1YFS A;  4BE1 A;  3QNE A;  2EPD A;  3RKW A;  4MML A;  3EGD A;  4E51 A;  1NYF A;  4YPF A;  2NLU A;  3P8T A;  1W2B S;  3PCO B;  1W70 A;  1HSQ A;  4QVZ A;  5CIU A;  3CMA Q;  5KE3 A;  5GJV B;  2CUD A;  3KUF A;  3SD4 A;  4XEM A;  5KYW B;  4QQG A;  3P8Y A;  1USY A;  1HC7 A;  4P72 C;  4DBR A;  2LDM A;  2QA4 T;  2OTJ T;  3CME A;  3WVD B;  1AWO A;  2E70 A;  3H0F A;  2XGT A;  4Q6G A;  4E7S A;  1O9S A;  1ZQ1 A;  4LVK A;  3UGT A;  3NTH A;  2EKH A;  2L8D A;  2K3X A;  2X3X D;  4BAC A;  4PJO G;  2CJB A;  5LJ3 j;  4P75 C;  2I4O A;  2PUO B;  4FT2 A;  1RAA B;  4A63 B;  1ASZ A;  2ARU A;  1Q95 G;  4YRI A;  5IAY A;  3M0S A;  5GAM d;  4P3N A;  1EOV A;  2Q7E A;  4CS3 A;  3VRZ A;  1TH7 A;  3RNJ A;  3JCM h;  4PL6 A;  1EX4 A;  3C0C A;  2NUP A;  1YJN Q;  4ME7 A;  3R6N A;  5CKD A;  4MZP A;  2OAW A;  4LD6 A;  1G3Y A;  3O5Z A;  3LWI A;  1CSK A;  3M54 A;  3EFR A;  2ZR3 A;  3VRY A;  1XOV A;  4OMF B;  2CZ7 B;  4Z02 A;  1S72 Q;  2P0K A;  1RUW A;  1YB3 A;  2MPX C;  4LVI A;  2M1H A;  2DRK A;  2RMO A;  1X6B A;  3OYH A;  4IUV A;  2CIM A;  1W2B P;  2SEM A;  1Z7M A;  3M0Q A;  2EGE A;  4CH4 A;  1IL2 A;  4EIK A;  3L42 A;  2J6F A;  4OB3 B;  3KXT A;  2RPN A;  1AOJ A;  2O88 A;  1G51 A;  3DB3 A;  3ZL7 C;  2Q7H A;  2J05 A;  4LXC A;  4XEO A;  3MCA B;  5L23 A;  1VQM A;  4FU6 A;  3HY0 A;  4CC3 A;  2CH4 W;  2DVJ A;  4ESR A;  1FXX A;  1H3Z A;  2LX7 A;  1NZ9 A;  4HT9 A;  4WTO B;  2CRE A;  4R56 A;  4YRT A;  2RM4 A;  4M78 B;  3GOX A;  4C0D B;  1C6V X;  3RAC A;  5J26 A;  2X4J A;  4J9E A;  4BB7 A;  2O2O A;  1BKB A;  1VQZ A;  3QII A;  4TTV A;  3GP8 A;  1TTH B;  1BBU A;  3THK A;  2GBQ A;  3L2U A;  3REX A;  8AT1 B;  2ODR C;  4QKU A;  4YRR A;  2DX1 A;  3BE3 A;  4JS4 A;  1E1T A;  3A7U A;  1GL5 A;  1JJ2 A;  1X6G A;  2E3H A;  1KIK A;  2AKL A;  3RR6 A;  4M77 A;  4EMH A;  4BD3 A;  2IG0 A;  2A3L A;  2ZAE A;  3L2R A;  1N8R C;  5IT9 E;  2FPD A;  2DLP A;  1WHJ A;  2CT4 A;  3I7F A;  2GTO A;  2EQU A;  2DU7 A;  2J7I A;  1C1A A;  3FJP A;  4D6W A;  3M55 A;  1Q81 C;  2LP5 A;  2ZGW A;  1H64 1;  1ZBX A;  2ZNJ A;  2DIL A;  2HL5 C;  1B8A A;  1U5S A;  2OJ2 A;  2VAS A;  3OBW A;  4KH0 B;  2DBK A;  3MHX A;  3JCM V;  1VQP Q;  3CC7 A;  3HRI A;  1X69 A;  4C92 C;  4J6W A;  3G4S Q;  1OX9 A;  1QP2 A;  3A8L B;  3VS2 A;  3G6E T;  2ALY B;  3M9Q A;  1YWP A;  2L0A A;  1VQ8 T;  3VV0 A;  2CKK A;  2EYQ A;  1VQK Q;  1VQ7 T;  1Q86 R;  1ZSG A;  4TWA A;  4BE0 A;  2ZPB B;  3EG3 A;  1M1G A;  1U1T A;  4K87 A;  1VQN T;  1YN8 A;  5LJ3 f;  3QO7 A;  1GCQ C;  3VQY A;  2CP7 A;  3OYN A;  4M75 F;  2ZPF B;  2Q7G A;  1WQW A;  2A7Y A;  2QQS A;  4PJO D;  2X4W A;  1WDX A;  2RD1 A;  4O6J A;  4TQD A;  2K9G A;  1VQP A;  4UPA A;  4X1V A;  2V8J A;  2PVG B;  2IY5 B;  1Q86 U;  1TU0 B;  2ZIM A;  4JJD A;  5ECA A;  2DJQ A;  3QWY A;  4OMO A;  3W3S A;  1VQ4 A;  4FIB A;  1M4Z A;  2QEX Q;  2KE9 A;  3PZC A;  3FRN A;  2EKO A;  3TCJ A;  1SRY A;  4J9C A;  1BBW A;  1Y0M A;  2JT4 A;  5GAN d;  4LUE A;  4RKU E;  4QQD A;  3I35 A;  4EMK B;  4RTW A;  1JJC A;  4ZGD B;  4CC2 A;  2E5A A;  5C51 B;  1M2V B;  3OQ5 A;  1AEY A;  5C6S A;  1W4S A;  4RCC A;  1PCX A;  2QGG A;  3G6E A;  1L0W A;  1JXO A;  3CCM A;  2COW A;  1KD1 R;  2HSP A;  3TSW A;  3CCV Q;  1S1N A;  3S3M A;  3EHR A;  2K4Y A;  2JW4 A;  5GAO p;  3CXC S;  1GCQ A;  1VQ7 A;  2KRN A;  3PIO A;  3HFO A;  5KYY B;  3RIR A;  4C92 G;  3TEH B;  3S3N A;  4R55 A;  2AKW A;  1N6A A;  1N9R A;  2E6Z A;  2EYX A;  4B6M A;  1VQN A;  4J6X A;  2GFU A;  1VYU A;  5DY9 A;  1Y96 A;  2K5L A;  3CCQ Q;  2EYY A;  4RTT A;  4M77 E;  1KD1 U;  5GAO n;  4KGV B;  4UP9 A;  4WCI A;  1RAD B;  1B3Q A;  1VQ5 A;  2C0T A;  2VV5 A;  4EDU A;  4PJN A;  1YP5 A;  4IUP A;  4YRE A;  1BI1 A;  2RK2 A;  2GFA A;  1WPY A;  3CD6 Q;  2KRO A;  1UGQ B;  3H0I A;  1M8M A;  4C8Q B;  2Y90 A;  1YIJ A;  1E22 A;  3QJ6 A;  3CPW A;  5HK3 A;  1UTI A;  5ELO A;  4LE9 A;  3REB B;  3CC2 A;  2KQW A;  2X3W D;  3VS3 A;  2L3Q A;  2BIV A;  3SEM A;  1SRL A;  2CS7 A;  5LJ3 g;  2VC8 A;  1K73 R;  4M78 C;  4RTV A;  4C0D C;  5CCA A;  1VQ9 T;  2RA2 A;  1X2K A;  5FU6 B;  1LNX A;  2MAM A;  2RB6 A;  4E6R A;  4FCY A;  2HAX A;  3RKY A;  4P73 A;  5KYU B;  5HK0 A;  4GLK A;  4C0F A;  3QWX X;  4EX5 A;  1Y71 A;  1UB4 A;  5GMK j;  1KG1 A;  2AT1 B;  4CH5 A;  2V26 A;  4PJO F;  3U23 A;  2LNV A;  4ZGE B;  1WYX A;  3UF4 A;  4PKC C;  3L2Z A;  1IRX A;  2GQI A;  4HKE A;  3CCE T;  3TRE A;  1X55 A;  1SHF A;  1K73 U;  2HL3 A;  3C12 A;  3CXC P;  5KCO A;  2PNI A;  3NEN A;  2HKN A;  4XU3 A;  5IHI A;  3BDU A;  1YJW Q;  2WAC A;  1MGQ A;  4BY6 B;  1UGS B;  2JVV A;  1QVF A;  3MO8 A;  5CQY A;  2RHU A;  4DA4 A;  3A31 A;  4J6Y A;  2RO0 A;  4JJC A;  1V76 A;  1M2O A;  5DLO A;  1MMA A;  3L1A A;  3M4G A;  3OW2 A;  4GBQ A;  4BDY A;  3EG9 A;  4HWR A;  1BB9 A;  2CH4 A;  1YJ9 A;  2RHY A;  3M58 A;  3QJY A;  2A08 A;  5K1P A;  4OF1 A;  2WSE E;  3JCM P;  3DLL A;  4UP7 A;  1MHN A;  1IRE B;  3NEL A;  3HY1 A;  1PRL C;  1DJ7 B;  3CBM A;  3CCJ Q;  3TVT A;  3HXW A;  4M4Z A;  2HQH A;  3T9N A;  1NYR A;  3OYD A;  1VQ9 A;  1UGV A;  3HXX A;  3H8Z A;  2BE7 D;  3GBQ A;  1SET A;  5LL6 S;  1AT1 B;  2EBP A;  1MNE A;  4A4K A;  2CUB A;  3PVL A;  1BCO A;  1VQO T;  4FSS A;  5GAN 6;  1WLE A;  1NYG A;  1MMG A;  2KK4 A;  3A32 A;  4YCW A;  3OS0 A;  2A0F B;  1VQL Q;  3LLR A;  4XAX B;  2CGH A;  4LD9 K;  1IB8 A;  3RER A;  2ODR D;  3HPW A;  3SHW A; 
#chains in the Genus database with same CATH homology
 1YFT A;  2XG8 D;  1JJ2 S;  4N0A A;  2NS6 A;  4YRM A;  4G85 A;  3E9H A;  5FRN A;  1YGB A;  1YIT A;  1KQS S;  4YRF A;  1UGP B;  3PTA A;  1O75 A;  3C4S A;  3JCM e;  1FWZ A;  4X9C A;  3UPU A;  4M75 A;  4IKF A;  4EMK C;  3MP1 A;  4F7U B;  1U8R A;  3JCM J;  3OSS C;  3JCM f;  2ARS A;  3M57 A;  4RMO A;  2DQ3 A;  2O4X B;  3HXU A;  2XIC A;  4GY5 A;  4C92 D;  3JSC A;  2YLC A;  1B70 A;  2DZ9 A;  3REU A;  4M7D B;  3G1Z A;  5C52 B;  1P92 A;  4J7I A;  1D3B A;  4XTZ A;  2EJG A;  1Q86 C;  2DXB A;  3MEV A;  3MP8 A;  4ZIB A;  2XU8 A;  1VQO A;  4M75 G;  2AMC B;  4HVC A;  2PVD B;  5IN1 A;  4XU0 A;  1WJR A;  2GCX A;  1WJS A;  3GIB A;  2JN0 A;  4J83 A;  3F70 A;  4KUI A;  3ASK A;  2RHX A;  2VXE A;  1VQ6 A;  1KOG A;  5D6X A;  1E1O A;  2DK3 A;  3NFC A;  4N4H A;  4EMK A;  4FM4 B;  4H2V A;  2ZNI A;  2M0O A;  4C8Q C;  3VKI A;  4LDV A;  3HRU A;  4EPC A;  2E1H A;  1H4S A;  3ZBD A;  2ART A;  1X01 A;  4LVL A;  1N9S A;  3WVE B;  4JS5 A;  1Y7X A;  3HFZ B;  3PIP A;  2RHQ A;  2E41 A;  2RJD A;  5FU6 C;  1X56 A;  1KD1 C;  1M1K U;  3CCU A;  3JCM Q;  3CCL T;  3MEY A;  3OYY A;  2QHS A;  3RL6 A;  4EO4 A;  4XTX A;  2OTL A;  4YRN A;  1YFR A;  1N27 A;  4PNO A;  2LQK A;  1JB0 E;  3SWN A;  1B34 B;  4BY6 C;  3CCS T;  4OGC A;  1BI3 A;  3EFS A;  5LJ3 d;  3X26 B;  4P3P A;  5GAN g;  4BUG A;  4PJO A;  4XTY A;  4CS4 A;  1KMN A;  4LVM A;  4QVC A;  1WJQ A;  4XTW A;  4B9X A;  4C92 F;  4M75 E;  3G7Z A;  2JUF A;  2Q5I A;  4OP0 A;  2RHS B;  2RK1 A;  3CPW S;  1K73 C;  5I2S A;  4RQF A;  3H6Z A;  2VXF A;  2DEQ A;  4YTL A;  4E7H A;  1BIB A;  1NJ8 A;  2ZT7 A;  3GNF B;  4ELY C;  4ZN1 A;  5CKB A;  3QG1 A;  3VU3 C;  1EIY A;  3JRZ A;  4RCB A;  3AHU A;  4IUT A;  4E7L A;  2ZPH B;  2J3M A;  1LJO A;  1YJN T;  4P5N A;  2A8E A;  4H2W A;  1SER A;  2DXU A;  4IUU A;  3CC4 T;  2KVQ G;  4A4G A;  3A5Z B;  4K86 A;  3CCS A;  4BWA A;  2L3R A;  3P8B B;  2RJF A;  1S72 T;  4TVW A;  4KUD K;  4P72 A;  2QQ9 A;  2QXF A;  1U1S A;  1FX7 A;  5LJ5 e;  2DQ0 A;  3L4G A;  2WSC E;  2LCL A;  3OY9 A;  3OW2 S;  4L6V 5;  2QA4 A;  2OTJ A;  2CJA A;  4P75 A;  2PME A;  4M75 D;  4PLL A;  5LJ5 f;  4M7D C;  1QW1 A;  4JUV A;  3X20 B;  3S6W A;  3Q1J A;  3OYL A;  4ZTZ B;  2MI6 A;  4JLG A;  1YHQ T;  4WI1 A;  4DOW A;  1JRI A;  2V8I A;  2E65 A;  2EJ9 A;  3V8K A;  4RDX A;  3CC4 A;  3BJU A;  4FT4 A;  3GNG A;  1NJI U;  4PJO E;  1LOJ A;  4H2T A;  5KE2 A;  4M78 F;  1NNH A;  4WJ4 A;  2D9T A;  3OYK A;  3M5A A;  4KQE A;  4MMK A;  3IG2 A;  4KBM B;  3R6O A;  2F5T X;  2QHV A;  2JNG A;  3HRS A;  1C0A A;  4A53 A;  5D6W A;  2EAY A;  3ERR A;  3G4S T;  1YHQ A;  4H2X B;  2DO3 A;  3QYH B;  4M7D G;  4MDX A;  3PMT A;  3SFM A;  4LDX A;  1Q7Y U;  4CS2 A;  2P0Q A;  4NOY A;  3DLM A;  4OB0 B;  1KHC A;  5C0M A;  3J81 E;  2XTI A;  2RI3 A;  3DKM A;  3JB9 G;  3QSU A;  4DQ2 A;  1QF6 A;  1M1K C;  3M4Q A;  4YRK A;  1KHI A;  2KMT A;  3OS5 A;  4JRI A;  2P5I A;  1YBY A;  2ZPI B;  3A5Y A;  3TEE A;  1EIF A;  3E19 A;  1NJ1 A;  5HKC A;  4OB2 B;  1FYF A;  2QEX T;  3OMG A;  3JCM d;  3GLX A;  2OAU A;  4C92 A;  4ATO A;  5E3I A;  4HT8 A;  2FYK A;  4OGE A;  3P8V A;  3MP6 A;  3RF1 A;  3I55 T;  1YI2 T;  1WNL A;  5L8R E;  4BDZ A;  2I4M A;  2FHD A;  1KMM A;  3PCO A;  3CCV T;  1VQ8 A;  3FC3 A;  3PT9 A;  1HTT A;  1M9S A;  5GAM e;  1M5Q 1;  5LJ5 h;  1KC8 U;  1KQ1 A;  4YYE A;  1RIQ A;  4MDW A;  3HKS A;  2LVM A;  2RHZ A;  3I56 T;  4M7A B;  5A0G A;  3CCQ T;  3OA6 A;  1B7Y B;  5DLQ E;  2DDZ A;  3BY7 A;  1PYS B;  4LDY A;  2PU9 B;  2P0L A;  4IUQ A;  2DIQ A;  3CBO A;  2KAF A;  3CD6 T;  1K9M U;  2ZR2 A;  2Y4X A;  3CMQ A;  3OYB A;  3NET A;  2DTI A;  4M7A F;  5AYF A;  2FVU A;  4ZTJ A;  2R58 A;  4RG8 A;  3LWH A;  1NJ2 A;  3JCM c;  3HXZ A;  1YI2 A;  3KFU A;  4C5E A;  4TVY A;  1E24 A;  4LDW A;  4C8Q F;  5GMK i;  3OYC A;  4WF2 A;  4J15 A;  2PMF A;  4E7K A;  3A8M B;  2I2L A;  2I4L A;  2LT1 A;  3I56 A;  5F5W A;  4JDS A;  3OB9 A;  4O5V A;  2MWP A;  5I21 A;  1YJW T;  3X24 B;  2QQR A;  3IAL A;  4B9W A;  2BKD N;  2FB7 A;  1LYL A;  4AH6 A;  4RG2 A;  4P71 C;  2LC4 A;  1I81 A;  1NJI C;  4C92 E;  4OVA A;  1NJ6 A;  4M78 A;  3C95 A;  3CCJ T;  3E1S A;  3RGL A;  3QXE B;  2QHU A;  2VGN A;  4C5I A;  3MEA A;  4H2S A;  4FL6 A;  2DU5 A;  3DB4 A;  4J5Y A;  2ZTG A;  5GAN 7;  2R57 A;  2HD0 A;  1I8F A;  4YCV A;  3L2V A;  3PFS A;  4CH6 A;  1K8A U;  4KUL A;  3J7A F;  4OB1 B;  3SB2 A;  2DJZ A;  4M78 G;  2KY9 A;  3M4P A;  4N4I A;  3CCE A;  1H4Q A;  3VUZ A;  1PSF A;  3HHT B;  3QPH A;  2EFI A;  3URG A;  3ME9 A;  3ZFJ A;  1Q7Y C;  1AHJ B;  4QVD A;  2DIG A;  3QUI A;  3UFG A;  3INZ A;  3V7R A;  2YRV A;  2ZZF A;  2L5Q A;  2ALY A;  2BUD A;  1NPR A;  1I4K 1;  4H02 A;  1RL2 A;  2QTX A;  5FLX E;  5GAM h;  3NTI A;  2EQM A;  3TU4 K;  4LNS A;  4E7I A;  1BIA A;  1G3T A;  1JBM A;  2DVE A;  3OYA A;  2MF2 A;  5GAN e;  2HQE A;  5CKF A;  2X4X A;  2VGM A;  1X2H A;  1M1F A;  3BFM A;  4F7U F;  4M77 B;  4M7A C;  2M16 A;  1BI0 A;  2IY5 A;  4P3O A;  4L59 A;  2XDP A;  2C8M A;  5LJ5 j;  3TEG A;  4X34 A;  4M7D F;  3E9I A;  1NJ5 A;  1NPP A;  2D6F A;  1M8V A;  2P0P A;  4YRO A;  4RQE A;  3QYG B;  3JB9 F;  2G4C A;  1KC8 C;  4ZTF A;  1OZ2 A;  2G3R A;  3OS2 A;  1QE0 A;  4M78 E;  1ADJ A;  3WXM B;  5CK9 A;  2ZIO A;  3HTZ A;  3TEH A;  3QO3 A;  1EVL A;  3VQW A;  1G5V A;  4LDU A;  1Q82 U;  3LH0 A;  2CYZ B;  3LW5 E;  4OLF A;  4M7A A;  3UT1 A;  4C5G A;  2R5M A;  1K9M C;  3RUX A;  2DAQ A;  2WSF E;  4LVJ A;  3G71 T;  1V29 B;  4P74 C;  1H4T A;  2P4T A;  1XQH A;  3JCM g;  1X6O A;  3M53 A;  4ZTU B;  4Q5W A;  1ASY A;  4C8Q A;  4L87 A;  4NS5 A;  3JAM E;  3M59 A;  3LX7 A;  3CMA T;  5GAN 2;  3SDZ A;  4M7A G;  4BI4 A;  2VYT A;  4E7J A;  1JJC B;  5FU7 B;  2EWN A;  2QQA A;  1HXD A;  4E47 A;  3QTC A;  2C06 A;  2CJ9 A;  3OD1 A;  2JTF A;  4KT0 E;  2K3Y A;  4KR2 A;  2E12 A;  1NYQ A;  4XK8 E;  4BE2 A;  3A7A A;  4C8Q G;  4M78 D;  3JB9 J;  4XU1 A;  1ATI A;  2MWO A;  2DD4 A;  2AKW B;  2E64 A;  2E3C A;  4FSX A;  3V7S A;  3CCL A;  4P74 A;  3HFN A;  1Y96 B;  4HWO A;  3G71 A;  3GF5 A;  1VQM T;  3GPL A;  4J7F A;  2J3L A;  2DTH A;  4C5H A;  3A8O B;  3V7C A;  4JRP A;  4XTV A;  2XID A;  3ER0 A;  3CMA A;  2DXT A;  4IUR A;  1QVF S;  3RMS A;  3L2Q A;  3A74 A;  1I5L A;  4XU2 A;  5GAN h;  3PGG A;  1Z7N A;  2VUB A;  1K8A C;  3QKJ A;  1G3S A;  1IZ6 A;  3LGF A;  2I4N A;  5J3B A;  3WQZ A;  3OYF A;  3HFV A;  2RJE A;  2JOY A;  3IKL A;  5J39 A;  2CZ6 B;  2LCC A;  1KQ2 A;  3QO5 A;  5GAM j;  2HQX A;  3UH0 A;  1GGM A;  4M77 C;  4M7A E;  1VIF A;  1R8O B;  2LTO A;  2PVO B;  2DZC A;  1J5W A;  5GAO q;  1QVG A;  4HCC A;  1VUB A;  5GAN 5;  2V8K A;  3VJP A;  1YJN A;  2EJF A;  1G5I A;  4K88 A;  3CC7 T;  3UWN A;  5GMK h;  1S72 A;  4C8Q E;  4F7U A;  3FB9 A;  2ZT8 A;  2O4X A;  1SES A;  3PMI A;  3HL8 A;  4M7D A;  1H4V B;  3ICA A;  11AS A;  2ZIN A;  4XQ3 A;  2ZZD A;  2XHC A;  4BW9 A;  4TQF A;  4J8O A;  3IKM B;  3OYI A;  5I2M A;  4YDQ A;  2AMC A;  4F7U G;  1KQS A;  3UDC A;  4ELZ C;  1VQP T;  2XK0 A;  4YRG A;  2YLB A;  1WYD A;  3QO8 A;  2EQK A;  4JJN K;  4HA8 A;  1YCY A;  1VQ4 T;  3E9G A;  3QDR B;  2HNI A;  4M7A D;  3JCM X;  2GF7 A;  3LGL A;  2DTO A;  1VQK T;  3LSS A;  2RH2 A;  4M77 G;  4TVA B;  5LJ5 g;  4M75 B;  1Q82 C;  1OYX A;  5FU7 C;  2XDD A;  3CCM T;  3PNW C;  2DPP B;  3HFZ A;  4C8Q D;  5LJ3 e;  5A0L A;  4HT4 A;  5GAO r;  1B70 B;  2AHJ B;  4YP0 A;  1VIE A;  3HXV A;  4YCU A;  2MMP A;  1D3B B;  2QHT A;  5C53 B;  3QZ9 B;  4NL2 A;  4H2Y A;  3FEO A;  3RES A;  4HWT A;  4BI8 B;  1VQ5 T;  3EAE A;  5A0D A;  2RI5 A;  3G4S A;  4DPG A;  2KSS A;  4L5G A;  12AS A;  1B34 A;  4EMG A;  3BW1 A;  2M9U A;  2K2V A;  5FRM A;  3CEY A;  1YIJ T;  2FL7 A;  3M56 A;  2RJC A;  3MET A;  4X5O A;  1VQK A;  3HRK A;  5FRO A;  3VBB A;  3CC2 T;  2B8A A;  3VQX A;  2E5Q A;  2QQB A;  1ZHI A;  1XNI A;  3DSQ A;  4F7U E;  3RKX A;  5GAM f;  1X75 C;  2RHS A;  3MEW A;  1OI1 A;  5GMK l;  1QVP A;  1PSE A;  2E10 A;  4Y28 E;  3LSQ A;  3HRT A;  2RHQ B;  1UGR B;  3M4Y A;  3V8L A;  4QQ6 A;  4M7D E;  5K1X A;  2X35 A;  4P73 C;  5GMK m;  4Y91 A;  1Y07 A;  4NCX A;  1G5H A;  1WGS A;  1M90 U;  3A8H B;  5GAN j;  2QEX A;  5CR2 A;  3LC0 A;  2ZZE A;  5GAN 4;  3VYG A;  1G3W A;  4HCZ A;  3JCM b;  4YRS A;  1W2B A;  3VUB A;  4UP8 A;  5M9O A;  2ZT5 A;  2C7I A;  2K5F A;  2JTM A;  2EIF A;  2ZXF A;  3SWN B;  4CI0 C;  3I55 A;  3A5Z A;  1EFW A;  4YRP A;  2H3J A;  1YJ9 T;  3UGQ A;  3CCV A;  4V2S A;  4PJO B;  2X4Y A;  2ZZG A;  3A7R A;  3JCM W;  2LQ8 A;  5ELN A;  2R5A A;  5CKE A;  4PG3 A;  4X9D A;  2DXC A;  3A8G B;  2F5K A;  3OYE A;  1OZ3 A;  3CPF A;  1UEB A;  3CCQ A;  2O01 E;  5CAI A;  2LRQ A;  5CO7 A;  1WU7 A;  4ZGJ B;  5EG2 A;  5GAO l;  1ADY A;  4C0Z A;  2EQJ A;  1XTD A;  2DD5 A;  1BYM A;  3E9F A;  4HWS A;  3FLG A;  3ZEH A;  3CBP A;  3CD6 A;  1B76 A;  1SSF A;  4M7D D;  4A54 A;  5GAO m;  2DKG A;  4XTU A;  5HGQ A;  3OYG A;  3J80 E;  4O2D A;  1EIY B;  1YIT T;  3FDR A;  2F69 A;  4JRQ A;  3X25 B;  3MF2 A;  3OBY A;  4TVR A;  3JB9 D;  4N0A C;  4M77 D;  4YRJ A;  5GAM g;  2RHI A;  3P8H A;  2CZ1 B;  2K57 A;  5HY6 A;  4YRL A;  1QVG S;  3LYI A;  5LJ3 h;  2GQV A;  2QI2 A;  2JZ2 A;  3O8V A;  3FIF A;  4M75 C;  5KH6 A;  4HWP A;  2ZCF B;  2QDY B;  1VQL T;  4VUB A;  3QBY A;  3L4G B;  5GAN 3;  3C94 A;  3JB9 H;  1QP3 A;  4ZN3 A;  2Q5H A;  3OS1 A;  4JLI A;  3R07 A;  1YJW A;  1WQ7 A;  4P71 A;  4NL3 A;  1EQR A;  1GXI E;  3HXY A;  5CVI A;  3BDL A;  3KBG A;  3OYJ A;  3MQZ A;  4H2X A;  4HCB A;  3QZ5 B;  3CCR T;  2YHT A;  4H2U A;  1VQ6 T;  5LJ5 d;  2ZT6 A;  2Y4Y A;  3S3O A;  3CCJ A;  1X2G A;  4G84 A;  2PUK B;  4BI3 A;  3VQV A;  4DOV A;  2XKO C;  4UC4 A;  5A2Q E;  4PHC A;  2ZCE A;  5D6Y A;  4TVA A;  4KR3 A;  2XD0 A;  2ZPG B;  3HP9 A;  5KNN A;  3P8D A;  1BI2 A;  5GAN f;  1VQL A;  1EVK A;  3CCU T;  2XDB A;  4N4G A;  4A4F A;  1HK9 A;  1X54 A;  5CQX A;  5GAN 8;  2OTL T;  2HBP A;  1N8R U;  4CH3 A;  3NEM A;  4MZM A;  4M77 F;  3OYM A;  4C0G A;  3X28 B;  4RMF A;  1RI0 A;  2LT4 A;  3CCR A;  1Q81 U;  5GMK e;  3OMC A;  3QHS A;  3SWN C;  3OSV A;  3V8J A;  5DM7 R;  4QW2 A;  4A4H A;  3NTK A;  3L2W A;  2ZPE B;  2EL9 A;  2E6N A;  4PJO C;  4Q15 A;  2L89 A;  4II1 A;  2XI9 A;  4A4E A;  2D0Q B;  4JRK A;  3CME T;  3N5B B;  1M90 C;  2K5I A;  1B7Y A;  3RMQ A;  1USY C;  4YRC A;  4WJ3 M;  4CRI A;  1W66 A;  2KDS A;  3MEU A;  4YRQ A;  1PYS A;  2LX9 A;  2RI2 A;  4MZT A;  3MF1 A;  3HSB A;  3JB9 I;  5CKH A;  4PLI A;  4C92 B;  2IVW A;  3VYH B;  5KCH A;  1N9W A;  1NE8 A;  2PQW A;  3TUP A;  3CXC A;  2CZ0 B;  1YFS A;  4BE1 A;  3QNE A;  3RKW A;  4MML A;  4E51 A;  4YPF A;  2NLU A;  3P8T A;  1W2B S;  3PCO B;  4QVZ A;  5CIU A;  5KE3 A;  3KUF A;  3SD4 A;  4XEM A;  4QQG A;  3P8Y A;  1USY A;  1HC7 A;  4P72 C;  2LDM A;  2QA4 T;  2OTJ T;  3CME A;  3WVD B;  2E70 A;  2XGT A;  4Q6G A;  1O9S A;  1ZQ1 A;  4LVK A;  3UGT A;  3NTH A;  2L8D A;  2K3X A;  4BAC A;  4PJO G;  2CJB A;  5LJ3 j;  4P75 C;  2I4O A;  2PUO B;  4FT2 A;  1ASZ A;  2ARU A;  4YRI A;  5IAY A;  5GAM d;  4P3N A;  1EOV A;  2Q7E A;  4CS3 A;  1TH7 A;  3JCM h;  4PL6 A;  4ME7 A;  5CKD A;  4MZP A;  4LD6 A;  1G3Y A;  3LWI A;  3M54 A;  3EFR A;  2ZR3 A;  1XOV A;  4OMF B;  2CZ7 B;  4Z02 A;  2P0K A;  1YB3 A;  4LVI A;  2M1H A;  3OYH A;  4IUV A;  2CIM A;  1Z7M A;  4CH4 A;  1IL2 A;  3L42 A;  4OB3 B;  3KXT A;  1G51 A;  3DB3 A;  2Q7H A;  4XEO A;  3MCA B;  1VQM A;  4FU6 A;  3HY0 A;  1FXX A;  1H3Z A;  1NZ9 A;  4HT9 A;  4YRT A;  4R56 A;  2RM4 A;  4M78 B;  3GOX A;  4C0D B;  3RAC A;  5J26 A;  2X4J A;  4BB7 A;  1BKB A;  1VQZ A;  3QII A;  4TTV A;  3GP8 A;  1BBU A;  3L2U A;  3REX A;  2ODR C;  4YRR A;  4JS4 A;  1E1T A;  3A7U A;  1JJ2 A;  4M77 A;  4EMH A;  4BD3 A;  2IG0 A;  2A3L A;  3L2R A;  1N8R C;  5IT9 E;  3I7F A;  2EQU A;  2DU7 A;  3FJP A;  4D6W A;  3M55 A;  1Q81 C;  2ZGW A;  1H64 1;  1ZBX A;  2ZNJ A;  1B8A A;  3OBW A;  3MHX A;  3JCM V;  3CC7 A;  3HRI A;  4C92 C;  4J6W A;  1QP2 A;  3A8L B;  3G6E T;  2ALY B;  3M9Q A;  1VQ8 T;  3VV0 A;  2CKK A;  2EYQ A;  1VQ7 T;  4TWA A;  4BE0 A;  2ZPB B;  1M1G A;  1U1T A;  4K87 A;  1VQN T;  5LJ3 f;  3QO7 A;  3VQY A;  3OYN A;  4M75 F;  2ZPF B;  2Q7G A;  1WQW A;  2A7Y A;  2QQS A;  4PJO D;  2X4W A;  2RD1 A;  4O6J A;  4TQD A;  1VQP A;  4UPA A;  2V8J A;  2PVG B;  2IY5 B;  1Q86 U;  2ZIM A;  3W3S A;  1VQ4 A;  4FIB A;  1M4Z A;  3PZC A;  3FRN A;  2EKO A;  3TCJ A;  1SRY A;  1BBW A;  5GAN d;  4RKU E;  4QQD A;  4EMK B;  1JJC A;  4ZGD B;  2E5A A;  5C51 B;  3OQ5 A;  5C6S A;  1W4S A;  4RCC A;  3G6E A;  1L0W A;  3CCM A;  3S3M A;  2K4Y A;  5GAO p;  3CXC S;  1VQ7 A;  3PIO A;  3HFO A;  3RIR A;  4C92 G;  3TEH B;  3S3N A;  4R55 A;  2AKW A;  1N6A A;  1N9R A;  2E6Z A;  1VQN A;  4J6X A;  2GFU A;  5DY9 A;  1Y96 A;  2K5L A;  4M77 E;  1KD1 U;  5GAO n;  4UP9 A;  1VQ5 A;  2VV5 A;  4EDU A;  4IUP A;  4YRE A;  1BI1 A;  2RK2 A;  2GFA A;  1WPY A;  4C8Q B;  1UGQ B;  2Y90 A;  1YIJ A;  1E22 A;  3QJ6 A;  3CPW A;  5HK3 A;  5ELO A;  3CC2 A;  2KQW A;  2BIV A;  2CS7 A;  5LJ3 g;  2VC8 A;  4M78 C;  4C0D C;  5CCA A;  1VQ9 T;  2RA2 A;  5FU6 B;  1LNX A;  2MAM A;  2RB6 A;  2HAX A;  3RKY A;  4P73 A;  5HK0 A;  4GLK A;  4C0F A;  4EX5 A;  1Y71 A;  1UB4 A;  5GMK j;  1KG1 A;  4CH5 A;  4PJO F;  2LNV A;  4ZGE B;  4PKC C;  3L2Z A;  4HKE A;  3CCE T;  3TRE A;  1X55 A;  1K73 U;  3C12 A;  5KCO A;  3NEN A;  4XU3 A;  3BDU A;  2WAC A;  1MGQ A;  4BY6 B;  1UGS B;  2JVV A;  1QVF A;  3MO8 A;  5CQY A;  2RHU A;  4DA4 A;  3A31 A;  4J6Y A;  2RO0 A;  5DLO A;  3L1A A;  3M4G A;  3OW2 A;  4BDY A;  4HWR A;  1YJ9 A;  2RHY A;  3M58 A;  3QJY A;  5K1P A;  4OF1 A;  2WSE E;  3JCM P;  3DLL A;  4UP7 A;  1MHN A;  1IRE B;  3NEL A;  3HY1 A;  1DJ7 B;  3CBM A;  3HXW A;  3T9N A;  1NYR A;  3OYD A;  1VQ9 A;  3HXX A;  3H8Z A;  1SET A;  5LL6 S;  4A4K A;  1VQO T;  5GAN 6;  1WLE A;  2KK4 A;  3A32 A;  4YCW A;  3OS0 A;  3LLR A;  4XAX B;  2CGH A;  4LD9 K;  2ODR D;  3RER A;  3HPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...