2DZCA

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
222
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGSPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 67
structure length 222
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dzcA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dzcA01
4C92C 4MMLA 4YCVA 3HFZB 4YYEA 5LJ5d 4M7AF 1B7YB 2Q7HA 2ZNJA 5I21A 3JCMh 1HTTA 4C8QG 2C8MA 4TVYA 4XU3A 5C53B 4XEOA 1C0AA 4A53A 4P74A 3E9IA 4HT9A 1WLEA 4PJOD 2EJGA 4Q6GA 3JCMV 4PJOG 3V8LA 4M7DF 2XTIA 2VXEA 2CJ9A 3JCMe 5GAN5 3JB9G 1HC7A 3JCMb 3HXXA 4TVAB 3TEHA 4HWOA 2IY5B 3RIRA 2C7IA 4HWPA 4DPGA 2XGTA 1EQRA 1Z7MA 3W3SA 2EL9A 2QHVA 4YCUA 4AH6A 2DXTA 4JRKA 3RKYA 3HY1A 4YRFA 1YFSA 2DXUA 4XTYA 4EMGA 1JBMA 4XEMA 2VXFA 3V7RA 5GAOq 4N0AA 4C92E 2I4LA 1M5Q1 3UGQA 3REUA 2EJFA 2DTHA 4C8QC 4P3NA 2ZGWA 3A31A 3NELA 5LJ3g 3BJUA 4F7UA 1LYLA 3L2ZA 5GMKj 1G5HA 3RKWA 4HWTA 3JCMf 5GAOp 1D3BA 4JUVA 1X2HA 2CJAA 3UFGA 4EO4A 1I8FA 3IALA 3JCMd 4NCXA 4CS2A 1E24A 5GMKm 4EMKC 4M7AC 3REXA 2FB7A 5LJ3j 4PJOE 4H2XA 4P74C 2DZCA 3P8YA 2ZR2A 5LJ3e 4A54A 4LNSA 4M77E 2AKWA 3IG2A 4RMFA 4M75E 4YRIA 5GAN4 3RKXA 2JN0A 4HWSA 4M78E 2ARUA 1G51A 4YRNA 4C92D 1KQ1A 2Q7GA 1VQZA 5GAMf 4ZTZB 1SESA 3L4GB 3GIBA 4C8QE 4XU2A 1LNXA 1M8VA 5GANh 4XQ3A 1I81A 1NYQA 2QHTA 1YB3A 3JB9I 4EX5A 4JLIA 4UP7A 4YRRA 3NETA 4M75A 4RCCA 4PJOF 4M7AG 2YHTA 1WQ7A 1KQ2A 2CJBA 3V7SA 3JB9F 5GAN7 3HTZA 1BIBA 1WNLA 3AHUA 4C8QA 2DQ0A 2YLCA 4O2DA 1B70B 2PMEA 4PG3A 1EVKA 1TH7A 3HXVA 4RQFA 4M78F 4H2YA 1QE0A 4J6XA 4F7UF 1U1TA 4H2WA 2E1HA 1ADYA 2RHSB 4TQDA 4M7DD 3LC0A 2AKWB 5GAMd 4YREA 1YFTA 2QTXA 3QO3A 3HXZA 3BFMA 3QHSA 5CAIA 3PCOB 1WPYA 1FYFA 2RHQA 4K86A 3RACA 1X2GA 4H2XB 2PMFA 4M7AB 4EMKB 4YRCA 4C8QD 2ODRC 4E51A 5GAOl 1NYRA 5GAOr 3P8TA 1H4QA 1H641 2ZCEA 4PJOA 1H4VB 1WYDA 3NENA 1E1OA 4RDXA 4YPFA 1D3BB 2Q7EA 2E10A 4WF2A 4M7DA 3IKMB 1U1SA 4CH6A 4YRKA 4CH5A 2DTIA 4CH4A 2ZZEA 4P71A 4YDQA 4TQFA 1HXDA 1PYSA 5GANj 3TEGA 5LJ3d 1EFWA 3MF1A 4NOYA 1GGMA 4P73C 4KR2A 3M4PA 4YRQA 1E1TA 1SRYA 4TTVA 3DSQA 2ARTA 2ZT6A 5LJ3f 4KR3A 1B76A 12ASA 1NNHA 2RD1A 4XTZA 3VU3C 2ZT5A 3PGGA 1BBWA 3MF2A 4EMHA 4H2VA 4YROA 4WJ3M 4J6YA 3JCMX 4UP8A 3SB2A 3JB9D 2CIMA 3HFVA 3PCOA 3UGTA 4M7AE 3UH0A 5LJ5h 5LJ3h 3TEHB 2DTOA 4OLFA 5HGQA 3JB9H 2DU7A 4P72C 3I7FA 3SWNA 3BY7A 4K87A 5GAMj 4X5OA 1X55A 2EAYA 2HNIA 4M7DE 1Z7NA 2DQ3A 4UP9A 3RERA 1L0WA 3NEMA 1WU7A 1JJCA 3P8VA 4YRLA 3RUXA 2ZZGA 2K57A 3ERRA 4P73A 4XU0A 4M77A 4C8QF 2QHUA 3A7UA 4X9CA 1N9SA 5GANf 3HXWA 1QF6A 4M7DC 3M4QA 5GAMe 5F5WA 3ICAA 3A32A 3OD1A 4P3PA 4TVAA 5GANg 3FIFA 1KMNA 4C92A 4YCWA 4C92F 2ZT7A 3LSSA 3VQWA 4P3OA 4P72A 4OP0A 4M78D 3HRIA 4YRGA 11ASA 1KMMA 1ADJA 2ZIOA 3QO7A 4NL2A 4ZTUB 4F7UE 5LJ5f 4M77D 4C8QB 5GANd 4M75D 3A74A 4M7AD 3VQXA 5GAMg 4RCBA 1USYC 1B34B 1ASZA 3HFZA 3RL6A 3JCMQ 2Q5IA 3A7RA 4TWAA 2EWNA 2J3MA 4H02A 1PYSB 1YFRA 3HXYA 5C52B 4HA8A 4F7UB 3A5YA 1N9RA 3L4GA 5GAN8 2J3LA 3A7AA 4MMKA 3QSUA 4YRMA 4XTWA 4M7DG 1H4SA 4M78G 4CS4A 3TUPA 4HVCA 3RESA 4YP0A 4RQEA 4CH3A 4M7AA 3VQVA 4PJOC 4BWAA 4M77G 1BIAA 4H2SA 4YRSA 2G4CA 4J15A 3V7CA 1B34A 2RM4A 4N0AC 2AMCA 1EIYB 5GMKe 4CS3A 3WQZA 1SERA 1JRIA 2I4NA 4ZIBA 2DVEA 3V8KA 5GMKi 3HRKA 5DY9A 3SWNB 2DU5A 2RHQB 2RB6A 4V2SA 2ZINA 3HY0A 1E22A 3IKLA 3HFOA 4L87A 3R07A 4H2UA 3HXUA 1NJ6A 2ZTGA 5GAN2 3CMQA 2P5IA 4PHCA 2I2LA 1B70A 4JRIA 3EFSA 2ZT8A 5GAOn 3JCMJ 1B7YA 2I4MA 5E3IA 2E3CA 4QVDA 3EFRA 5K1PA 3RGLA 4PNOA 5ELNA 4M78B 4BW9A 2CGHA 4XTVA 5GAN6 1W66A 3JCMg 3JCMc 4XTUA 1EVLA 2I4OA 2QHSA 2Y90A 2Q5HA 4M78C 2ZNIA 2ZIMA 1HK9A 3PZCA 2IY5A 3MEYA 5GMKl 4M77C 3QO8A 1NJ2A 2YLBA 4M75C 2RA2A 4YRPA 4NL3A 4Y91A 4HT8A 4J6WA 1H4TA 3BDUA 5GAOm 3QTCA 1X01A 3LSQA 1LJOA 3L1AA 3HFNA 3JCMP 2ZR3A 3QO5A 1NJ1A 3V8JA 1B8AA 2ALYA 2P0LA 4J5YA 4HWRA 4WJ4A 4G84A 2DKGA 4YRJA 4H2TA 1LOJA 3KFUA 5LJ5g 2DDZA 5ELOA 5GANe 4C92B 4X9DA 4G85A 5C51B 2VC8A 3RF1A 1N9WA 4P75A 4P71C 1RIQA 2E64A 4DQ2A 4M78A 4PJOB 5GMKh 1EOVA 4UPAA 5GAN3 1IL2A 4M75B 4M77B 3FJPA 4M75G 5LJ5e 1JJCB 4K88A 1X56A 2E65A 3M4GA 5GAMh 2ZXFA 3QNEA 4EMKA 3VQYA 2FYKA 4YRTA 2DZ9A 4XU1A 4F7UG 1USYA 1KOGA 3JB9J 2ARSA 4Q15A 4C92G 3A5ZA 4XTXA 2RHSA 1J5WA 2ALYB 3QUIA 4M77F 4M75F 2ODRD 1EIYA 5LJ5j 2ZZFA 1MGQA 1BBUA 1WQWA 2EJ9A 1NJ8A 2AMCB 2E41A 1G5IA 1SETA 3G1ZA 5K1XA 1YCYA 1Y96A 2DJZA 4WI1A 1I5LA 5KNNA 1X54A 3INZA 4KQEA 1ASYA 3FB9A 3E9HA 1YGBA 2E5AA 4M7DB 3SWNC 3VBBA 2DEQA 3HSBA 1NJ5A 1ATIA 4QVCA 3JCMW 3BW1A 1Y96B 4TVWA 1I4K1 4P75C
chains in the Genus database with same CATH superfamily
1YIJA 5C6SA 1KK7A 1AOJA 1HD3A 1EX4A 2RMOA 2OTJA 1YNZA 3OBYA 2HBWA 1VIEA 5I21A 5AT1B 2C8MA 2EVRA 4XEOA 4A53A 3E9IA 1FWZA 4HT9A 1WLEA 2EGEA 3CCEQ 2EGAA 3CCUQ 1AVZC 3V8LA 5KYWB 3OW2A 2BTTA 2VXEA 1OX9A 1HC7A 3QIIA 3M59A 3TEHA 3UT1A 1FMKA 2KT1A 2VVKA 4DPGA 3CCUT 1WFWA 2QHVA 4YCUA 4AH6A 3MP8A 3CXCP 2L3SA 3HKSA 1JU5C 1JBMA 3UWNA 5GAOq 4N0AA 2I4LA 2DL5A 4A4KA 1M5Q1 3S3OA 4KULA 4B9XA 1U8RA 2D8JA 3BJUA 1UTIA 1M1KC 2PU9B 1VQKQ 2CP6A 1RACB 4FYYB 2QEXQ 1VQLA 1TTHB 5ECAA 2HBPA 1X2HA 4EO4A 1I8FA 2GBQA 4EMKC 3PIPA 2CT3A 1OZ2A 4L5GA 2RN8A 4MZPA 5GJVB 5LJ3e 4A54A 1PG5B 2F2VA 2NUTB 1Q86R 4O5VA 2ROLA 4DEXA 2MYSA 4HWSA 3HPWA 2FRWA 4HT4A 4FYVB 4WCIA 1G51A 5FWBA 1KQ1A 2Q7GA 4ZTZB 1RI0A 1VQPT 2FVUA 1YIJQ 2ZPFB 4XU2A 1LNXA 4KRTA 3MP1A 1I81A 1RADB 1YB3A 3VS4A 1M90C 1UGRB 2M02A 4JLIA 4EX5A 3NETA 2EQMA 4M75A 2E3HA 3EGXB 4M7AG 2YHTA 1OPLA 1YFNA 2CJBA 1G3SA 1WNLA 2OI3A 3AHUA 2YLCA 4RTUA 2PMEA 2RNAA 2X9HA 2DETA 3G4SQ 1RLQC 2K5LA 3A8OB 1ZSZB 4JJBA 1QE0A 1Q7YR 1U1TA 2X4WA 4LE9A 1TOVA 4TQDA 4M7DD 3LC0A 4CI0C 2VB6A 1EIFA 3GP8A 1YFTA 2QTXA 3QO3A 3HXZA 3BFMA 1B7TA 2HL5C 1TS9A 1WPYA 1X2GA 4H2XB 3EH1A 4N4GA 4C8QD 4E51A 1N8RR 5GAOr 3P8TA 1H641 4KGZB 4PJOA 1H4VB 3CC2A 1E1OA 3X24B 4AMCA 4YPFA 1D3BB 1KD1C 2Q7EA 2RHIA 1W6XA 3IKMB 2QQRA 1VQ9T 4YRKA 1QMCA 3EG9B 1QKWA 2EIFA 4CH4A 4E7HA 1IHVA 5L23A 3MPUB 3MQZA 2R58A 5LJ3d 1EFWA 1JXOA 2KRMA 1UGSB 3M4PA 2KDSA 4TTVA 1AZEA 4PJJA 4BDZA 4AT1B 2VGNA 1JEGA 3CC4Q 2HMAA 5LJ3f 4D6WA 12ASA 2A3LA 1FXXA 1NNHA 2ZT5A 4XTZA 2Y4YA 4MZTA 3M0TA 2O4XB 3PGGA 4J9FA 3VU3C 1E6HA 1PRLC 4YROA 2HQHA 3SB2A 3JB9D 2CIMA 3HFVA 1MV3A 3UGTA 2YRVA 5LJ5h 5C0MA 2X51A 2COYA 1YN8A 3QDRB 3G4SA 5CQXA 4DOVA 3CD6T 4OLFA 1YJ9A 2DU7A 3C0CA 2E4HA 3BY7A 4X5OA 3CCRQ 1TSFA 4CC7A 2QEXA 3RERA 2O2OA 1Y07A 3X20B 3OSSC 1XQHA 2EQJA 3I5RA 3UA6A 2RPNA 4YRLA 2K5IA 4N4IA 1N5ZA 3G7ZA 4JDSA 2K57A 4EDUA 2LX7A 2QHUA 2MK5A 4X9CA 2V26A 3C4SA 2HDAA 2WACA 4ESRA 3ICAA 2JNGA 2PUOB 4P3PA 4TVAA 5GANg 4C92A 3A8GB 2KEAA 3VQWA 3NHNA 3I56Q 4P72A 1K8AU 2CYZB 1W2BA 2DBKA 4ZGJB 3RMQA 1KMMA 3LYIA 5D6XA 4NL2A 4HCCA 4F7UE 4LXCA 4M77D 4C8QB 5LJ5f 1PSFA 3URGA 4CRIA 2XU8A 2X4YA 2ZPEB 3CCEA 2P0PA 1WJSA 4DBQA 1VQKT 1XOVA 2KK4A 4HKEA 1ZQ1A 3QJ6A 6AT1B 1F1BB 3VJPA 2F1LA 3CMEQ 2R5AA 4Y28E 1PYSB 3HXYA 4F7UB 3CCSQ 3A5YA 2OTLQ 3JSCA 3L4GA 1N8RC 2KE9A 2J6FA 1TUCA 4CS4A 2RO0A 2B8AA 4E6RA 4PJOC 3CCJT 4E7LA 4M77G 4H2SA 4BWAA 4YRSA 2EYYA 4J15A 1SSFA 2AMCA 5FLXE 4CS3A 1VQ5Q 1EFNA 5HKCA 4ZIBA 1UHCA 2QASA 1S72T 4JJDA 3S3MA 5GMKi 1NLPC 1S72A 2IIMA 3HP9A 4QW2A 2FRYA 3L2WA 1H3HA 4J9HA 3HY0A 3EFOB 2K3BA 2H8HA 4H2UA 2JS2A 3QBYA 3T9NA 2ZTGA 2RH2A 5A0GA 3OYAA 2P5IA 4PHCA 5D7UA 2FG0A 1K1ZA 3OYIA 2CP0A 1VQ4Q 4JRIA 2PVOB 1MUZA 1WXBA 2OTJQ 1QVFP 3MEVA 1WJRA 2QTVA 4PNOA 4M78B 2K5FA 3CD6Q 4X1VA 4BW9A 1DJ7B 2J7IA 4KH1B 2QG9B 3EGUA 4LN2A 3TU4K 1EVLA 2YUQA 2E6ZA 3CC2Q 2EPDA 1BB9A 2DLPA 1JB0E 1E6GA 3GF5A 4PFPA 4TVRA 2EYWA 1K8AC 2PZ1A 1NJ2A 2CZ0B 2L3PA 2RA2A 1AWOA 3NTIA 4RTVA 1QCOA 1M1KU 2F69A 2DK3A 4OMOA 3H0HA 2EYQA 5GAOm 1X01A 2CZ6B 3LH0A 1LJOA 3OYBA 1NBEB 2ZR3A 1NJ1A 1KC8U 3OYKA 3DKMA 1B8AA 3E9GA 4C0DC 3RDVA 4J9IA 2ALYA 2LT1A 4HWRA 2DKGA 4H2TA 5LJ5g 3I55T 1TWBA 1PD1A 1H92A 2H3EB 2CUDA 4MDWA 5KCHA 4MDXA 2O31A 5FWCA 4IUPA 2A7YA 2BIVA 2FZCB 2RJEA 1YITQ 4DEYA 2RJCA 4E7IA 3CXCA 4M78A 2J6OA 2JTFA 1GRIA 1EOVA 1WHGA 4J7FA 1VQ9Q 1GXIE 3QPHA 1IL2A 1W70A 4C0DB 4M77B 1NYGA 1Y71A 3CBMA 2ZPGB 3PT9A 3OBWA 1M27C 2E65A 3EG3A 2DXCA 2P84A 4LDXA 3VQYA 2D8HA 3M54A 1G8XA 4JRQA 1VQ8Q 3M0SA 1RAHB 2COZA 1RAGB 3CBPA 4IKFA 1KOGA 3JB9J 3EHQA 4QT7A 1KSWA 4C92G 2KXCA 3G1JA 1WHLA 1J5WA 2PUKB 1Q82U 3OSVA 4L59A 2ZZFA 5DM7R 1KIKA 1WQWA 2EJ9A 4JZ4A 3H41A 2E41A 2AMCB 3EH2A 2QQSA 3OW2S 1BI2A 2DL3A 3E9FA 5KCOA 1VQLQ 3EGXA 5CKEA 1VQKA 4FT4A 3I5SA 4GLMA 2P0QA 1WGSA 4Z8AA 1VQ7A 3HSBA 2RJFA 4D8DA 2QA4Q 3JCMW 1Y96B 3H9NA 2DO3A 1VQ6Q 1NM7A 1H3ZA 2W10A 3RNJA 3OYYA 2V1RA 4NS5A 2EW3A 8AT1B 3WVDB 4QKUA 2OTJT 2K4YA 4YYEA 4M7AF 1B7YB 2ZNJA 4C8QG 4TVYA 4IIMA 5C53B 1C0AA 4P74A 3MEAA 3E1SA 1IO6A 4HVWA 4BE1A 1X6BA 1VQNA 1EZZB 4Q6GA 5IN1A 2YUNA 2XI9A 4M7DF 4LVIA 1GL5A 2KYMA 2CJ9A 4LDUA 3JCMe 2GNCA 3HXXA 4HWOA 2YT6A 3OYLA 1TXQA 2RK2A 3CMAQ 2XGTA 2ENMA 3EGDA 1EQRA 3VS0A 4BACA 3M55A 2QEXT 3QKJA 2DXTA 4JRKA 4FW2A 4IURA 4YRFA 2FZGB 1YFSA 1QCNA 2IVWA 5EG2A 2X35A 1WHMA 2X4JA 4EMGA 1ZLMA 1VQ5T 2RQWA 1MV0B 5KYXB 2F5KA 2DTHA 4C8QC 1X27A 2WSFE 2MF2A 3NGPA 3A31A 1T3LA 3CCLA 2JMCA 1YI2Q 2NUPA 2E5QA 3JV3A 3SD4A 3G6EA 2PVGB 1K0SA 2GF7A 2ED1A 3UFGA 3JCMd 4CS2A 2BZ8A 1E24A 1QVGS 1AZGB 1WLPB 1PSEA 1R8OB 5LJ3j 3OYDA 1B3QA 2FHDA 1G3YA 3NFCA 2MOXA 3CCVQ 3PIOA 4LNSA 3CC4T 4A4HA 4M77E 2AKWA 3IG2A 1VQNQ 4RMFA 3GBQA 5GAN4 4E2FB 2JN0A 4GY5A 2MWPA 3LH5A 2Y4XA 3OB9A 4QVZA 1Z9QA 3I55A 4CC4B 1SESA 3L4GB 2A37A 2QGGA 5KYXA 1RUWA 3G71T 5GANh 1M8VA 1K9MC 1ZSGA 5L8RE 3JB9I 2JT4A 1Q7YC 3A8MB 4HVUA 4UP7A 2MMPA 3H0IA 2WSEE 3CCJQ 3OS2A 3QYHB 2YSQA 2HEQA 1WQ7A 4OGCA 3JB9F 4A63B 2JVVA 4C8QA 1B70B 4LUDA 1JJ2P 3M9QA 3CPFA 1EVKA 1Q81C 1GFCA 4RQFA 4H2YA 1G2BA 4F7UF 4L6V5 1MMDA 1YITT 1NEGA 2E1HA 1IZ6A 2M16A 2RF0A 3J7AF 3UDCA 4O6JA 5GAMd 2K2VA 4YREA 5CAIA 1QWFA 2EQKA 2E12A 3CPWS 3PCOB 1FYFA 2RHQA 4K86A 1MMAA 4QQ6A 3UPUA 2PMFA 4M7AB 4E7JA 2O88A 3OMCA 1UEBA 3OYGA 4FCYA 2K7AA 2P4RA 4RDXA 2DX1A 4LDYA 2E10A 3VS2A 3HL8A 4KT0E 1U1SA 4CH5A 2DTIA 3PFSA 1WHHA 2DJQA 4E7SA 4ZTFA 4P71A 4EPCA 1NPPA 2EGCA 3VUBA 4TQFA 2HSEB 5KYNA 3TSZA 3C12A 4Z89A 3BDLA 1GGMA 4P73C 4YRQA 1E1TA 4B9WA 1X2QA 4CC2A 1M3AA 3GNFB 3CCVA 5HY6A 2RD1A 4OVAA 3Q1JA 4RKUE 3CCQQ 4EMHA 4WJ3M 3PCOA 4M7AE 2ZZDA 3UH0A 1C0MA 5LJ3h 4A4GA 1WIEA 5HGQA 3JB9H 3IQLA 4P72C 1YJ9T 3SWNA 3I7FA 2EQIA 1N8RU 1YI2A 2V1QA 4M7DE 1Z7NA 2DAQA 4K11A 1L0WA 1VQMQ 2DXBA 1V1CA 1JJCA 1WU7A 3I9QA 3P8VA 3CCMT 2A8EA 4OMLA 1AD5A 1D1AA 4JJCA 4BB7A 1ABOA 2V8JA 4M77A 1OU8A 4E47A 3A7UA 1LPLA 2RK1A 3HXWA 3M4QA 5GAMe 1YCSB 4AFQC 5I22A 2KY9A 2LCSA 3SHWA 1VYTA 2ZT7A 2QYZA 3LSSA 1OZ3A 3TCJA 4OP0A 1UJ0A 4LD6A 1MHNA 5KYYA 4LUEA 4LVLA 4Q5WA 2RQUA 3RBBB 4R55A 1Q86U 1K0XA 4HVVA 4C5GA 3OY9A 4C0ZA 2OX7A 4QQDA 3JCMQ 2DRMA 4IUVA 4TWAA 1IXDA 1OI1A 1QVPA 2R5MA 3LLRA 5J39A 4BDYA 2NLUA 4MMKA 1TU0B 2KMTA 4KBMB 4PLIA 2KGTA 3VV0A 3G71A 2M51A 4RQEA 1VQMA 2YUOA 4M7AA 4KUDK 1M3BA 3CXCS 3KBGA 1VQNT 1R77A 3V7CA 2RM4A 1BKBA 3OQ5A 3JRZA 1UGPB 4OB1B 2DVEA 2VASA 1PNJA 3SWNB 5A2QE 5IT9E 1YJWA 1JJ2A 3GLXA 2RHQB 2RB6A 1MNDA 3CCLT 3IKLA 3EG0A 4L87A 1SF9A 4KH0B 4RTXA 2ATCB 3HXUA 1QQJA 4C0FA 2MPXC 4F16A 1G3TA 2FO0A 3C95A 1B70A 2F2XA 5GAOn 5E3IA 3CPWA 3NTHA 2E3CA 3CCET 1LVKA 3UATA 3QDFA 4QVDA 1IGQA 3EFRA 2GGRA 5K1PA 1J3TA 2COWA 1Q82R 3NTKA 1BYMA 2CGHA 4XTVA 5GAN6 2KNBB 1Q95G 1VQ7Q 3JCMc 2CSQA 5EC7A 4ME7A 5CVIA 4AG2C 1KQSA 2E3IA 3QZ5B 5FU7B 2KBTA 4BI3A 2ZNIA 2D6FA 5IAYA 3L2VA 3MEYA 1MMGA 1QP3A 5GMKl 2BZXA 4M75C 3FDRA 4J6WA 1H4TA 1QKXA 4JLGA 2A28A 2VUBA 4C5HA 2KR3A 3LSQA 3QYGB 3JCMP 3HFNA 3CCVT 3MEWA 1CKAA 2NS6A 2LQWA 4WJ4A 1AT1B 3KFUA 3TVTA 2F2WA 2KRNA 1M90U 1VYVA 5GANe 5ELOA 1M30A 2JMAA 3WXMB 2AZSA 1IREB 4P75A 4GLKA 1ZUUA 1WXUA 1YP5A 1RIQA 2E64A 4N4HA 1NE8A 4DQ2A 1YJNT 2GTOA 1M1KR 4PJOB 5GMKh 4UPAA 5I2SA 1PM3A 3CCMA 1JXMA 1GBRA 3FJPA 1KC8R 4M75G 1VUBA 1NPRA 2JTMA 2RI2A 1JJCB 1X56A 3QNEA 2ZXFA 2DPPB 2FPFA 1BCOA 5FU7C 4ELYC 4EMKA 2QQAA 2CH4W 1T0HA 2KQWA 1PCXA 1RLPC 3MEUA 2FZKB 3A5ZA 3EGDB 2LQKA 4XTXA 1XTDA 2LZ6B 3QJYA 3A8HB 3QUIA 4M77F 3TQ7P 2O9SA 2JM8A 3GPLA 1X69A 1ACMB 2ODRD 5LJ5j 3OS5A 1MGQA 3L2QA 1TUGB 1NJ8A 2KI7A 1GBQA 1Y96A 2NYSA 2DYBA 5KNNA 3CCLQ 1SRMA 4DA4A 1X54A 3INZA 4KQEA 2LJ3A 3QG1A 1ASYA 1YGBA 2E5AA 2KVQG 2GFUA 3HRSA 1NJ5A 4QVCA 2K3YA 3CD6A 3BW1A 4TVWA 1I4K1 2M1HA 1T3SA 1UUEA 2X3WD 4IUQA 1G83A 2J6KA 2ECZA 1HTTA 2VV5A 3JCMh 1HYOA 3OYJA 4XU3A 2RQVA 1AEYA 4BE2A 5J3BA 4PJOD 3JCMV 2R57A 2RJDA 2HL3A 4HXJA 2ED0A 5GAN5 3J80E 3JB9G 3VUZA 3JCMb 1UG1A 4TVAB 1UDLA 3EG1A 1D09B 3RIRA 3I56A 4JS4A 1K73C 1S72Q 3I56T 3META 1VQPA 1Z7MA 3W3SA 2RHUA 2EL9A 1RI9A 5FU6C 1QVGA 1B07A 3HY1A 3WVEB 1NJIC 2HSPA 4XTYA 1KQSP 2VXFA 1U3OA 1K73U 4J8OA 1SRLA 1QP2A 4C92E 2XICA 2QA4A 3CMET 2EJFA 3EHRA 3LGFA 2MAMA 2ZGWA 3NELA 3ME9A 2ESWA 5LJ3g 1BI0A 1LYLA 3CC7T 5GMKj 2D0NA 4HWTA 2E6NA 2L3RA 3JCMf 5GAOp 3CCRA 2CZ1B 2HKNA 3CCRT 5M9OA 1M4ZA 4RG8A 1ZUKA 2QXFA 2DBMA 1I1JA 4M7AC 4C5IA 2EKOA 3A8LB 4PJOE 4P74C 1JQQA 2ZR2A 3F70A 1X6OA 2LMJA 1M2OA 3M56A 4FSXA 3CC4A 2DMOA 5J26A 1CSKA 1WX6A 4BE0A 1OULA 3RKXA 2DIQA 4M78E 2FPEA 2CSIA 4C92D 5D6YA 2SEMA 3PNWC 2BE7D 1ZA1B 4XQ3A 3TSWA 2DE0X 3ZL7C 4FW1A 3HHTB 2MCNA 5GJWB 1YJNA 3MCAB 2QGFB 4RCCA 3I35A 2EKHA 1KQ2A 3V7SA 1UHFA 1WA7A 2BUDA 1GCQC 1NZ9A 2FPDA 2X4XA 5IHIA 4PG3A 1YJWT 2AK5A 1CKBA 4PJMA 4HCBA 1TH7A 5CCAA 4OGEA 2LCCA 4J6XA 2CREA 3SFMA 2JW4A 1ADYA 2RHSB 2AKWB 4OMFB 3EFOA 3QHSA 3AT1B 5A0DA 1MNEA 2DERA 5FRMA 1NJIU 3H8ZA 5CKFA 3LX7A 2ROTA 3LGLA 5KYWA 2M0YA 2RI5A 3A98A 2D9TA 1HJDA 1BK2A 3VRZA 5GAOl 1ZA2B 3M0UA 2DIGA 2EYXA 3KXTA 1WYDA 2NUPB 1YJNQ 3X25B 4WF2A 4HCZA 4J9BA 4F04B 4IIOA 3M0PA 2XMFA 2AKKA 2ZZEA 1JJ2S 3CEYA 3HTRA 1HXDA 1PYSA 5GANj 3TEGA 2DM1A 2MI6A 3MF1A 4NOYA 4KR2A 2PQWA 2DF6A 4BI4A 5KYUB 2ZT6A 4KR3A 2ABLA 3CC7Q 3OYEA 4J6YA 1C6VX 4RUGA 1IB8A 1RABB 1MMNA 3PMIA 2XKOC 2JTEA 1GCPA 3J81E 2DTOA 3R6NA 2OTLT 4OB3B 2QQ9A 4K87A 2JM9A 2QI2A 5GAMj 1KC8C 2HNIA 1VA7A 4UP9A 4PFZA 4FM4B 2J05A 4PKCC 4X34A 2HD0A 2YDLA 2CUBA 3RUXA 3ERRA 4JRPA 1RAEB 4C8QF 4LD9K 2EQUA 5IH2A 3CMEA 1N9SA 2X3XD 5GANf 1QVFA 3VYHB 2VKNA 5F5WA 1M90R 3OD1A 4OMNA 1Z9ZA 1VQ7T 1KMNA 4YCWA 1I07A 4C92F 1OOTA 4Z88A 1VQPQ 4OF1A 3ER0A 3M0QA 3VKIA 4Z02A 3L42A 2H3JA 3ZEHA 1N27A 11ASA 5KE3A 1ADJA 2ZIOA 1WHKA 3SEMA 5IXBA 4ZTUB 4BD3A 4HCKA 4A4FA 1ABQA 2BE9B 4M75D 3A74A 1WXTA 1B34B 1G3WA 2VWFA 3OYHA 3N5BB 4J9GA 3JAME 2M9UA 3HFZA 4RG2A 3OA6A 2HQXA 3A7RA 2EWNA 2E5KA 1YFRA 5C52B 1PKTA 3G71Q 1N9RA 2JJ9A 2RHXA 5GAN8 2J3LA 1YHQT 3QSUA 4YRMA 2NUZA 3QZ9B 1H4SA 2LJ0A 1WZOA 4CH3A 3S6WA 1GFDA 1QLYA 2XK0A 1BIAA 2CZ7B 2KT8A 3E2UA 2G4CA 1WYXA 2F5TX 1B34A 1SERA 3WQZA 2BZYA 4FT2A 1YJ9Q 3A1PA 1M8MA 2RI3A 2V8IA 3V8KA 4RMOA 1W4SA 4LVMA 2KYBA 1BBZA 5DY9A 2QQBA 3CPWP 2DEUA 2AHJB 3U23A 1PRMC 3CC7A 1IRXA 1E22A 3HFOA 1OQKA 3R07A 4DBHA 2K6DA 1UECA 4RTTA 3ZFJA 1VIFA 3CMQA 2I2LA 3EFSA 3QWYA 4LDWA 1B7YA 2ZT8A 3EG2A 4J9CA 3M58A 1ZUYA 3RGLA 5ELNA 2DILA 2QK0A 4DBRA 5IHKA 2DL8A 3TREA 3OYCA 3P8DA 5DLOA 2XD0A 2LP5A 3H0FA 1D0YA 2I4OA 3X26B 2QHSA 4M78C 4RTWA 3NMZC 2NUTA 1HK9A 3PZCA 2IY5A 1HSQA 2LQNA 1K9MU 3QO8A 1Y7XA 4XK8E 3VRYA 4PLLA 2P4TA 2YLBA 1TUDA 5DLQE 4NL3A 1SEMA 1KHCA 3CCQT 1YBYA 1UGVA 3L1AA 1H8KA 3QO5A 1IGUA 2OAUA 1WI7A 2PVDB 7AT1B 1WDXA 3M57A 4GBQA 2P0LA 4J5YA 2ZAEA 1OEBA 4G84A 1OV3A 1ZHIA 2O01E 3X28B 3L2RA 1SKUB 3HRTA 2FEIA 4C92B 4X9DA 3ULRB 4G85A 3VYGA 5C51B 3O5ZA 1VQ6T 2VC8A 1Q86C 5I11A 3RF1A 4J83A 3M5AA 1O75A 1V76A 4ZN3A 3CCMQ 1D1CA 4R0KA 2GFAA 2AZVA 1QVGP 5GAN3 4M75B 4J9EA 3M53A 4FIBA 5LJ5e 4RTZA 4K88A 2DVJA 3UF4A 1Y0MA 3GNGA 2LT4A 5CQYA 5AYFA 1X43A 4YRTA 2YRDA 4XU1A 2DD4A 1USYA 1WJQA 2LX9A 2LQ8A 4Q15A 2RHSA 2ALYB 1I5OB 4BY6C 3H6ZA 4II1A 1GCQA 3PTAA 2E70A 1EIYA 2HZYA 2LNVA 2VYTA 2CS7A 1N6AA 1RAAB 4JPBW 3PVQA 1G5IA 4QQGA 5K1XA 1VOMA 4DBFA 1YWOA 1C1AA 1ZX6A 2DJZA 2K9GA 1PD0A 3FB9A 2K2MA 3CQTA 4M7DB 3SWNC 3VBBA 2DEQA 3EG9A 1OU9A 4P75C 3EAEA 1KD1R 4C92C 4MMLA 1PKSA 4YCVA 1R0CB 4R56A 1AWXA 1O9SA 4AFZC 3HFZB 2AKLA 2SRCA 2I0NA 5LJ5d 2Q7HA 2L89A 1UE9A 2W0ZA 1KFZA 3LWIA 2G3RA 3O8VA 4WTOB 5CKDA 2EJGA 1BCMA 2C0TA 4PJOG 2XTIA 5HCKA 3FJ5A 1ZBXA 4P5NA 3REAB 2IPOB 4ZTJA 5FRNA 4ZGEB 1YJWQ 2IY5B 2C7IA 5KE2A 3CCUA 4HWPA 4LVKA 1D1BA 4C5EA 1VQOQ 2J06A 2KAFA 5HK0A 1ZSZA 3DB4A 2O4XA 3D7SB 3RKYA 4PFOA 1U06A 3P8BB 1Q82C 2L2PA 3HRUA 2DXUA 3OYMA 4ANJA 5IHNA 2G6FX 1G5VA 1M2VA 4XEMA 2CKKA 1NYFA 2EBPA 3V7RA 1OYXA 1YHQQ 5A0LA 1X2KA 2L8DA 3UGQA 2ZPHB 3REUA 2AIRB 4P3NA 1U5SA 4KGXB 2KSSA 1Q81U 2OAWA 3VS6A 4F7UA 3L2ZA 1G5HA 3RKWA 2ZPBB 1D3BA 4JUVA 1VYUA 2GTJA 1KHIA 1XNIA 4F14A 3FLGA 2CJAA 1FYNA 3IALA 1K76A 4NCXA 1QCFA 5GMKm 1RAFB 3REXA 3KUFA 1Q7YU 3QXEB 1X75C 2FB7A 4H2XA 4FSSA 2DZCA 3LW5E 3CCQA 3P8YA 4RTYA 3OYFA 4M75E 4YRIA 1RL2A 1UJYA 2ARUA 4YRNA 3VS3A 1M3CA 2CP7A 4AFUC 5IXFA 3VS7A 2JUFA 1VQZA 5GAMf 1SHGA 3GIBA 1VQ6A 4C8QE 1T0JA 3CCST 2DL4A 1NYQA 3PVLA 1RAIB 2QHTA 2VGMA 4A4EA 1KQSS 4YRRA 4PJOF 4PJNA 2JZ2A 5D6WA 5GAN7 3HTZA 1BIBA 1X6GA 2QA4T 2DQ0A 1K9AA 4O2DA 2JXBA 4J7IA 3HXVA 4M78F 1V29B 3PE0A 4H2WA 2HQEA 2RHYA 3ASKA 1S1NA 3A5ZB 3C94A 3FC3A 1W1FA 4C0GA 2XIDA 4F17A 3RACA 8ATCB 2CP2A 4EMKB 4YRCA 1BU1A 5HK3A 2AT1B 2GQVA 2ODRC 1NYRA 4OMQA 9ATCB 1H4QA 3RR6A 2Z0WA 5LL6S 2ZCEA 2OJ2A 3CC2T 4LDVA 1AWWA 3NENA 3OS0A 1OX8A 1BI3A 1NG2A 1ZSZC 4JZ3A 1VQ9A 4M7DA 4CH6A 2D0QB 5CKBA 4KGVB 4KUIA 1Y57A 4YDQA 3KFVA 3BE3A 4PK4A 2DRKA 4OMPA 2KXDA 1D0XA 1FMVA 1BI1A 4IUUA 1SHFA 3OMGA 2BKDN 4B6MA 1SRYA 3DSQA 2KROA 2ARTA 4J9DA 5CIUA 1ARKA 1B76A 3E19A 3FEOA 1BBWA 3MF2A 1K8AR 4H2VA 3JCMX 4FYWB 4UP8A 1FX7A 3MP6A 3S3NA 4PJLA 3TEHB 2LDMA 1NJIR 2XG8D 3M4YA 1D0ZA 4BI8B 2LJ1A 1X55A 2EAYA 4ZN1A 2L0AA 2DQ3A 4DOWA 2HAXA 2XHCA 2CP5A 1FMWA 3CCJA 1P92A 3NEMA 2JS0A 3P8HA 2PTKA 2ZZGA 3PMTA 2L3QA 4E7ZA 4ATOA 4P73A 4XU0A 2QAZA 3R6OA 2M0OA 4MZMA 1SG5A 2YUPA 3VS5A 1M1GA 1K9MR 1QF6A 4M7DC 1VQ4A 1VQ4T 4JS5A 3A32A 3L2UA 4FU6A 3FIFA 3MJXA 5CK9A 1VQOA 4YTLA 1VQOT 2ZPIB 4ZNXA 4ORZA 2DD5A 2B86A 4P3OA 4M78D 3HRIA 4YRGA 2V8KA 2EFIA 2GCXA 2RHZA 2YXYA 3GOXA 4BUGA 2DYIA 3QO7A 1M1FA 1Q81R 2C0OA 5KYUA 5GANd 1A0NB 4M7AD 3VQXA 2DFUA 4RCBA 5GAMg 2YRCA 2XDDA 2CDTA 1USYC 4OB2B 1NEBA 1ASZA 4JJNK 3RL6A 1R0BG 4IUTA 3RMSA 2Q5IA 2J3MA 4H02A 1QW1A 3DLMA 1VQLT 1KG1A 4HA8A 5FU6B 1SSHA 1YIJT 2DL7A 3A7AA 3UA7A 3OYNA 4XTWA 4M7DG 2C06A 1YHQA 1YI2T 4M78G 1JO8A 3TUPA 4HVCA 3CCSA 3RESA 4YP0A 2GQIA 3OS1A 5FROA 3VQVA 1WHJA 1W2BS 2MIOA 2WSCE 3CBOA 3DB3A 2XDPA 4N0AC 1EIYB 5GMKe 1UFFA 1JRIA 1PWTA 4EIKA 2I4NA 3CMAT 3CMAA 4OMMA 3HRKA 2LVMA 1I0CA 4ELZC 5KYYB 2DU5A 4V2SA 2ZINA 1M9SA 1PC0A 3MHXA 2CH4A 1ZBJA 4AG1C 4UC4A 3SDZA 1NJ6A 5GAN2 2NWMA 4PL6A 2K79A 1VQ8A 1VQ8T 4AFSC 2HCKA 2C0IA 2I4MA 3JCMJ 1K4US 1W66A 3MO8A 3JCMg 2P0KA 2HKQB 1XJWB 4XTUA 2A0FB 4LVJA 1YITA 1E7OA 5KH6A 2LNHB 2LTOA 2QDYB 2Y90A 2Q5HA 2ZIMA 4M77C 2RQRA 2RQTA 3MKDA 5FW9A 4YRPA 1W2BP 4Y91A 4HT8A 1VQMT 3BDUA 3QTCA 2DA9A 1K73R 2O9VA 2K3XA 4M4ZA 3V8JA 3OW2P 2D1XA 2EYZA 1KD1U 4OB0B 4YRJA 5CKHA 1SPKA 1KJWA 1LOJA 1AWJA 2ZCFB 3TEEA 2PNIA 2DDZA 4Y92A 3G4ST 1UGQB 2LCLA 2A08A 1N9WA 4P71C 3ZBDA 3QWXX 1M2VB 3M0RA 5CO7A 3FRNA 2L5QA 3NPFA 2CP3A 3M4GA 5GAMh 3I55Q 2CT4A 2FYKA 2A36A 1QWEA 1OPKA 2DZ9A 2IG0A 4D8KA 4F7UG 4BY6B 1YWPA 3THKA 2ARSA 4ZGDB 2FL7A 1QVFS 1NLOC 4E7KA 2XDBA 2YWWA 2KRSA 3DLLA 1PHTA 4M75F 2LRQA 4CC3A 2JOYA 2LC4A 1BBUA 1LCKA 5CR2A 1SETA 3G1ZA 1VQ5A 3G6EQ 4VUBA 1UB4A 1YCYA 4WI1A 1I5LA 2QDLA 3E9HA 4LNPA 1IHWA 3LWHA 5I2MA 3VS1A 2MWOA 3REBB 3G6ET 1AHJB 2DNUA 1ATIA 1TG0A 4FYXB 4XAXB 2OTLA 4FL6A
chains in the Genus database with same CATH topology
1YIJA 5C6SA 2OTJA 3OBYA 1VIEA 5I21A 2C8MA 4XEOA 4A53A 3E9IA 1FWZA 4HT9A 1WLEA 3V8LA 3OW2A 2VXEA 1HC7A 3QIIA 3M59A 3TEHA 3UT1A 4DPGA 3CCUT 2QHVA 4YCUA 4AH6A 3MP8A 3HKSA 1JBMA 3UWNA 5GAOq 4N0AA 2I4LA 4A4KA 1M5Q1 3S3OA 4KULA 4B9XA 1U8RA 3BJUA 1M1KC 2PU9B 1VQLA 2HBPA 1X2HA 4EO4A 1I8FA 4EMKC 3PIPA 1OZ2A 4L5GA 4MZPA 5LJ3e 4A54A 4O5VA 4HWSA 3HPWA 4HT4A 1G51A 1KQ1A 2Q7GA 4ZTZB 1RI0A 1VQPT 2FVUA 2ZPFB 4XU2A 1LNXA 3MP1A 1I81A 1YB3A 1M90C 1UGRB 4EX5A 4JLIA 3NETA 2EQMA 4M75A 4M7AG 2YHTA 2CJBA 1G3SA 1WNLA 3AHUA 2YLCA 2PMEA 3A8OB 2K5LA 1QE0A 1U1TA 2X4WA 4TQDA 4M7DD 3LC0A 4CI0C 1EIFA 3GP8A 1YFTA 2QTXA 3QO3A 3HXZA 3BFMA 1WPYA 1X2GA 4H2XB 4N4GA 4C8QD 4E51A 5GAOr 3P8TA 1H641 4PJOA 1H4VB 3CC2A 1E1OA 3X24B 4YPFA 1D3BB 1KD1C 2Q7EA 2RHIA 3IKMB 2QQRA 1VQ9T 4YRKA 2EIFA 4CH4A 4E7HA 3MQZA 2R58A 5LJ3d 1EFWA 1UGSB 3M4PA 2KDSA 4TTVA 4BDZA 2VGNA 5LJ3f 4D6WA 12ASA 2A3LA 1FXXA 1NNHA 2ZT5A 2Y4YA 4MZTA 4XTZA 3VU3C 2O4XB 3PGGA 4YROA 3SB2A 3JB9D 2CIMA 3HFVA 3UGTA 2YRVA 5LJ5h 5C0MA 3QDRB 3G4SA 5CQXA 4DOVA 3CD6T 4OLFA 1YJ9A 2DU7A 3BY7A 4X5OA 2QEXA 3RERA 1Y07A 3X20B 3OSSC 1XQHA 2EQJA 4YRLA 2K5IA 4N4IA 3G7ZA 4JDSA 2K57A 4EDUA 2QHUA 4X9CA 3C4SA 2WACA 3ICAA 2JNGA 2PUOB 4P3PA 4TVAA 5GANg 4C92A 3A8GB 3VQWA 4P72A 1K8AU 2CYZB 1W2BA 4ZGJB 3RMQA 1KMMA 3LYIA 5D6XA 4NL2A 4HCCA 4F7UE 5LJ5f 4M77D 4C8QB 1PSFA 3URGA 4CRIA 2XU8A 2X4YA 2ZPEB 3CCEA 2P0PA 1WJSA 1VQKT 1XOVA 2KK4A 4HKEA 1ZQ1A 3QJ6A 3VJPA 2R5AA 4Y28E 1PYSB 3HXYA 4F7UB 3A5YA 3JSCA 3L4GA 1N8RC 4CS4A 2RO0A 2B8AA 4PJOC 3CCJT 4E7LA 4M77G 4H2SA 4BWAA 4YRSA 4J15A 1SSFA 2AMCA 5FLXE 4CS3A 5HKCA 4ZIBA 1S72T 3S3MA 5GMKi 1S72A 3HP9A 4QW2A 3L2WA 3HY0A 4H2UA 3QBYA 3T9NA 2ZTGA 2RH2A 5A0GA 3OYAA 2P5IA 4PHCA 3OYIA 4JRIA 2PVOB 3MEVA 1WJRA 4PNOA 4M78B 2K5FA 4BW9A 1DJ7B 3TU4K 1EVLA 2E6ZA 1JB0E 3GF5A 4TVRA 1K8AC 1NJ2A 2CZ0B 2RA2A 3NTIA 1M1KU 2F69A 2DK3A 5GAOm 2EYQA 1X01A 2CZ6B 3LH0A 1LJOA 3OYBA 2ZR3A 1NJ1A 1KC8U 3OYKA 3DKMA 1B8AA 3E9GA 4C0DC 2ALYA 2LT1A 4HWRA 2DKGA 4H2TA 5LJ5g 3I55T 4MDWA 5KCHA 4MDXA 4IUPA 2A7YA 2BIVA 2RJEA 2RJCA 4E7IA 3CXCA 4M78A 2JTFA 1EOVA 1GXIE 4J7FA 3QPHA 1IL2A 4C0DB 4M77B 1Y71A 3CBMA 2ZPGB 3PT9A 3OBWA 2E65A 2DXCA 4LDXA 3VQYA 3M54A 4JRQA 3CBPA 4IKFA 1KOGA 3JB9J 4C92G 1J5WA 2PUKB 1Q82U 3OSVA 4L59A 2ZZFA 5DM7R 1WQWA 2EJ9A 2AMCB 2E41A 2QQSA 3OW2S 1BI2A 3E9FA 5KCOA 5CKEA 1VQKA 4FT4A 2P0QA 1WGSA 1VQ7A 3HSBA 2RJFA 3JCMW 1Y96B 2DO3A 1H3ZA 3OYYA 4NS5A 3WVDB 2OTJT 2K4YA 4YYEA 4M7AF 1B7YB 2ZNJA 4C8QG 4TVYA 1C0AA 5C53B 4P74A 3MEAA 3E1SA 4BE1A 1VQNA 4Q6GA 5IN1A 2XI9A 4M7DF 4LVIA 2CJ9A 4LDUA 3JCMe 3HXXA 4HWOA 3OYLA 2RK2A 2XGTA 1EQRA 4BACA 3M55A 2QEXT 3QKJA 2DXTA 4JRKA 4IURA 4YRFA 1YFSA 2IVWA 5EG2A 2X35A 2X4JA 4EMGA 1VQ5T 2F5KA 2DTHA 4C8QC 2WSFE 2MF2A 3A31A 3CCLA 2E5QA 3SD4A 3G6EA 2PVGB 2GF7A 3UFGA 3JCMd 4CS2A 1E24A 1QVGS 1PSEA 1R8OB 5LJ3j 3OYDA 2FHDA 1G3YA 3NFCA 3PIOA 4LNSA 3CC4T 4A4HA 4M77E 2AKWA 3IG2A 4RMFA 5GAN4 2JN0A 4GY5A 2MWPA 2Y4XA 3OB9A 4QVZA 3I55A 1SESA 3L4GB 3G71T 5GANh 1M8VA 1K9MC 5L8RE 3JB9I 1Q7YC 3A8MB 4UP7A 2MMPA 2WSEE 3OS2A 3QYHB 1WQ7A 4OGCA 3JB9F 2JVVA 4C8QA 1B70B 3M9QA 3CPFA 1EVKA 1Q81C 4RQFA 4H2YA 4F7UF 4L6V5 1YITT 2E1HA 1IZ6A 2M16A 3J7AF 3UDCA 4O6JA 5GAMd 2K2VA 4YREA 5CAIA 2EQKA 2E12A 3CPWS 3PCOB 1FYFA 2RHQA 4K86A 4QQ6A 3UPUA 2PMFA 4M7AB 4E7JA 3OMCA 1UEBA 3OYGA 4RDXA 4LDYA 2E10A 3HL8A 4KT0E 1U1SA 4CH5A 2DTIA 3PFSA 4ZTFA 4P71A 4EPCA 1NPPA 3VUBA 4TQFA 3C12A 3BDLA 1GGMA 4P73C 4YRQA 1E1TA 4B9WA 3GNFB 3CCVA 5HY6A 2RD1A 4OVAA 3Q1JA 4RKUE 4EMHA 4WJ3M 3PCOA 4M7AE 2ZZDA 3UH0A 5LJ3h 4A4GA 5HGQA 3JB9H 4P72C 1YJ9T 3SWNA 3I7FA 1N8RU 1YI2A 4M7DE 1Z7NA 2DAQA 1L0WA 2DXBA 1WU7A 1JJCA 3P8VA 3CCMT 2A8EA 4BB7A 2V8JA 4M77A 4E47A 3A7UA 2RK1A 3HXWA 3M4QA 5GAMe 2KY9A 2ZT7A 3LSSA 1OZ3A 3TCJA 4OP0A 4LD6A 1MHNA 4LVLA 4Q5WA 4R55A 1Q86U 4C5GA 3OY9A 4C0ZA 4QQDA 3JCMQ 4IUVA 4TWAA 1OI1A 1QVPA 2R5MA 3LLRA 5J39A 4BDYA 2NLUA 4MMKA 2KMTA 4KBMB 4PLIA 3VV0A 3G71A 4RQEA 1VQMA 4M7AA 4KUDK 3CXCS 3KBGA 1VQNT 3V7CA 2RM4A 1BKBA 3OQ5A 3JRZA 1UGPB 4OB1B 2DVEA 1JJ2A 3SWNB 5A2QE 5IT9E 1YJWA 2RHQB 3GLXA 2RB6A 3CCLT 3IKLA 4L87A 3HXUA 4C0FA 1G3TA 3C95A 1B70A 5GAOn 5E3IA 3CPWA 3NTHA 2E3CA 3CCET 4QVDA 3EFRA 5K1PA 3NTKA 1BYMA 2CGHA 4XTVA 5GAN6 3JCMc 4ME7A 5CVIA 1KQSA 3QZ5B 5FU7B 4BI3A 2ZNIA 2D6FA 5IAYA 3L2VA 3MEYA 1QP3A 5GMKl 4M75C 3FDRA 4J6WA 1H4TA 4JLGA 2VUBA 4C5HA 3LSQA 3QYGB 3JCMP 3HFNA 3CCVT 3MEWA 2NS6A 4WJ4A 3KFUA 1M90U 5ELOA 5GANe 3WXMB 1IREB 4P75A 4GLKA 1RIQA 2E64A 4N4HA 1NE8A 4DQ2A 1YJNT 4PJOB 5GMKh 4UPAA 5I2SA 3CCMA 3FJPA 4M75G 1VUBA 1NPRA 2JTMA 2RI2A 1JJCB 1X56A 3QNEA 2ZXFA 2DPPB 4EMKA 5FU7C 4ELYC 2QQAA 2KQWA 3MEUA 3A5ZA 2LQKA 4XTXA 1XTDA 3QJYA 3A8HB 3QUIA 4M77F 3GPLA 2ODRD 5LJ5j 3OS5A 1MGQA 3L2QA 1NJ8A 1Y96A 5KNNA 4DA4A 1X54A 3INZA 4KQEA 3QG1A 1ASYA 1YGBA 2E5AA 2KVQG 2GFUA 3HRSA 1NJ5A 4QVCA 2K3YA 3CD6A 3BW1A 4TVWA 1I4K1 2M1HA 4IUQA 1HTTA 2VV5A 3JCMh 3OYJA 4XU3A 4BE2A 5J3BA 4PJOD 3JCMV 2R57A 2RJDA 5GAN5 3J80E 3JB9G 3VUZA 3JCMb 4TVAB 3RIRA 3I56A 4JS4A 1K73C 3I56T 3META 1VQPA 1Z7MA 3W3SA 2RHUA 2EL9A 5FU6C 1QVGA 3HY1A 3WVEB 1NJIC 4XTYA 2VXFA 1K73U 4J8OA 4C92E 1QP2A 2QA4A 2XICA 3CMET 2EJFA 3LGFA 2MAMA 2ZGWA 3NELA 3ME9A 5LJ3g 1BI0A 1LYLA 3CC7T 5GMKj 4HWTA 2E6NA 2L3RA 3JCMf 5GAOp 3CCRA 2CZ1B 3CCRT 5M9OA 1M4ZA 4RG8A 2QXFA 4M7AC 4C5IA 2EKOA 3A8LB 4PJOE 4P74C 2ZR2A 3F70A 1X6OA 3M56A 4FSXA 3CC4A 5J26A 4BE0A 3RKXA 2DIQA 4M78E 4C92D 5D6YA 3PNWC 4XQ3A 3HHTB 1YJNA 3MCAB 4RCCA 1KQ2A 3V7SA 2BUDA 1NZ9A 2X4XA 4PG3A 1YJWT 4HCBA 1TH7A 5CCAA 4OGEA 2LCCA 4J6XA 3SFMA 2RHSB 1ADYA 2AKWB 4OMFB 3QHSA 5A0DA 5FRMA 1NJIU 3H8ZA 5CKFA 3LX7A 3LGLA 2RI5A 2D9TA 5GAOl 2DIGA 3KXTA 1WYDA 3X25B 4WF2A 4HCZA 2ZZEA 1JJ2S 3CEYA 1HXDA 1PYSA 5GANj 3TEGA 2MI6A 3MF1A 4NOYA 4KR2A 2PQWA 4BI4A 2ZT6A 4KR3A 3OYEA 4J6YA 3PMIA 2XKOC 3J81E 2DTOA 2OTLT 4OB3B 2QQ9A 4K87A 2QI2A 5GAMj 1KC8C 2HNIA 4UP9A 4FM4B 4PKCC 4X34A 2HD0A 3RUXA 3ERRA 4JRPA 4C8QF 4LD9K 2EQUA 3CMEA 1N9SA 1QVFA 5GANf 3VYHB 5F5WA 3OD1A 1VQ7T 1KMNA 4YCWA 4C92F 4OF1A 3ER0A 3VKIA 4Z02A 3L42A 2H3JA 3ZEHA 1N27A 11ASA 5KE3A 2ZIOA 1ADJA 4ZTUB 4BD3A 4A4FA 4M75D 3A74A 1B34B 1G3WA 3OYHA 3N5BB 3JAME 2M9UA 3HFZA 4RG2A 3OA6A 2HQXA 3A7RA 2EWNA 1YFRA 5C52B 1N9RA 2RHXA 5GAN8 2J3LA 1YHQT 3QSUA 4YRMA 3QZ9B 1H4SA 4CH3A 3S6WA 2XK0A 1BIAA 2CZ7B 2G4CA 2F5TX 1B34A 1SERA 3WQZA 4FT2A 2RI3A 2V8IA 3V8KA 4RMOA 1W4SA 4LVMA 5DY9A 2QQBA 2AHJB 3CC7A 1E22A 3HFOA 3R07A 3ZFJA 1VIFA 3CMQA 2I2LA 3EFSA 2ZT8A 4LDWA 1B7YA 3M58A 3RGLA 5ELNA 3TREA 3OYCA 3P8DA 5DLOA 2XD0A 2I4OA 3X26B 2QHSA 4M78C 1HK9A 3PZCA 2IY5A 1K9MU 3QO8A 1Y7XA 4XK8E 4PLLA 2P4TA 2YLBA 5DLQE 4NL3A 1KHCA 3CCQT 1YBYA 3L1AA 3QO5A 2OAUA 2PVDB 3M57A 2P0LA 4J5YA 4G84A 1ZHIA 2O01E 3X28B 3L2RA 3HRTA 4C92B 4X9DA 4G85A 3VYGA 5C51B 1VQ6T 2VC8A 1Q86C 3RF1A 4J83A 3M5AA 1O75A 4ZN3A 2GFAA 5GAN3 4M75B 3M53A 4FIBA 5LJ5e 4K88A 3GNGA 2LT4A 5CQYA 5AYFA 4YRTA 4XU1A 2DD4A 1USYA 1WJQA 2LX9A 2LQ8A 4Q15A 2RHSA 2ALYB 4BY6C 3H6ZA 4II1A 3PTAA 2E70A 1EIYA 2LNVA 2VYTA 2CS7A 1N6AA 1G5IA 4QQGA 5K1XA 2DJZA 3FB9A 4M7DB 3SWNC 3VBBA 2DEQA 4P75C 3EAEA 4C92C 4MMLA 4YCVA 4R56A 1O9SA 3HFZB 5LJ5d 2Q7HA 2L89A 3LWIA 2G3RA 3O8VA 5CKDA 2EJGA 4PJOG 2XTIA 1ZBXA 4P5NA 4ZTJA 5FRNA 4ZGEB 2IY5B 2C7IA 5KE2A 3CCUA 4HWPA 4LVKA 4C5EA 2KAFA 5HK0A 3DB4A 2O4XA 3RKYA 3P8BB 1Q82C 3HRUA 2DXUA 3OYMA 1G5VA 4XEMA 2CKKA 3V7RA 1OYXA 5A0LA 2L8DA 3UGQA 2ZPHB 3REUA 4P3NA 2KSSA 1Q81U 4F7UA 3L2ZA 1G5HA 3RKWA 2ZPBB 1D3BA 4JUVA 1KHIA 1XNIA 3FLGA 2CJAA 3IALA 4NCXA 5GMKm 3REXA 3KUFA 1Q7YU 3QXEB 1X75C 2FB7A 4H2XA 2DZCA 3LW5E 3CCQA 3P8YA 3OYFA 4M75E 4YRIA 1RL2A 2ARUA 4YRNA 2JUFA 1VQZA 5GAMf 3GIBA 1VQ6A 4C8QE 3CCST 1NYQA 2QHTA 2VGMA 4A4EA 1KQSS 4YRRA 4PJOF 5D6WA 2JZ2A 5GAN7 3HTZA 1BIBA 2QA4T 2DQ0A 4O2DA 4J7IA 3HXVA 4M78F 1V29B 4H2WA 2HQEA 2RHYA 3ASKA 3A5ZB 3C94A 3FC3A 4C0GA 2XIDA 3RACA 4EMKB 4YRCA 5HK3A 2GQVA 2ODRC 1NYRA 1H4QA 5LL6S 2ZCEA 3CC2T 4LDVA 3NENA 3OS0A 1BI3A 1VQ9A 4M7DA 4CH6A 2D0QB 5CKBA 4KUIA 4YDQA 1BI1A 4IUUA 3OMGA 2BKDN 1SRYA 3DSQA 2ARTA 5CIUA 1B76A 3E19A 3FEOA 1BBWA 3MF2A 4H2VA 3JCMX 4UP8A 1FX7A 3MP6A 3S3NA 3TEHB 2LDMA 2XG8D 3M4YA 4BI8B 1X55A 2EAYA 4ZN1A 2DQ3A 4DOWA 2HAXA 2XHCA 3CCJA 1P92A 3NEMA 3P8HA 2ZZGA 3PMTA 4ATOA 4P73A 4XU0A 3R6OA 2M0OA 4MZMA 1M1GA 1QF6A 4M7DC 1VQ4A 1VQ4T 4JS5A 3A32A 3L2UA 4FU6A 3FIFA 5CK9A 1VQOA 4YTLA 1VQOT 2ZPIB 2DD5A 4P3OA 4M78D 3HRIA 4YRGA 2V8KA 2EFIA 2GCXA 2RHZA 3GOXA 4BUGA 3QO7A 1M1FA 5GANd 4M7AD 3VQXA 5GAMg 4RCBA 2XDDA 1USYC 4OB2B 1ASZA 4JJNK 3RL6A 3RMSA 4IUTA 2Q5IA 2J3MA 4H02A 1QW1A 3DLMA 1VQLT 1KG1A 4HA8A 5FU6B 1YIJT 3A7AA 3OYNA 4XTWA 4M7DG 2C06A 1YHQA 1YI2T 4M78G 3TUPA 4HVCA 3CCSA 3RESA 4YP0A 3OS1A 5FROA 3VQVA 1W2BS 3CBOA 2WSCE 3DB3A 2XDPA 4N0AC 1EIYB 5GMKe 1JRIA 2I4NA 3CMAT 3CMAA 3HRKA 2LVMA 4ELZC 2DU5A 4V2SA 2ZINA 1M9SA 3MHXA 4UC4A 3SDZA 1NJ6A 5GAN2 1VQ8A 4PL6A 1VQ8T 2I4MA 3JCMJ 1W66A 3MO8A 3JCMg 2P0KA 4XTUA 4LVJA 1YITA 5KH6A 2LTOA 2QDYB 2Y90A 2Q5HA 2ZIMA 4M77C 4YRPA 4Y91A 4HT8A 1VQMT 3BDUA 3QTCA 2K3XA 3V8JA 1KD1U 4OB0B 4YRJA 5CKHA 1LOJA 2ZCFB 3TEEA 2DDZA 3G4ST 1UGQB 2LCLA 1N9WA 4P71C 3ZBDA 5CO7A 3FRNA 2L5QA 3M4GA 5GAMh 2FYKA 2DZ9A 2IG0A 4F7UG 4BY6B 2ARSA 4ZGDB 2FL7A 1QVFS 4E7KA 2XDBA 3DLLA 4M75F 2LRQA 2JOYA 2LC4A 1BBUA 5CR2A 1SETA 3G1ZA 1VQ5A 4VUBA 1UB4A 1YCYA 4WI1A 1I5LA 3E9HA 3LWHA 5I2MA 2MWOA 3G6ET 1ATIA 1AHJB 4XAXB 2OTLA 4FL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 C;  4MML A;  4YCV A;  3HFZ B;  4YYE A;  5LJ5 d;  4M7A F;  1B7Y B;  2Q7H A;  2ZNJ A;  5I21 A;  3JCM h;  1HTT A;  4C8Q G;  2C8M A;  4TVY A;  4XU3 A;  5C53 B;  4XEO A;  1C0A A;  4A53 A;  4P74 A;  3E9I A;  4HT9 A;  1WLE A;  4PJO D;  2EJG A;  4Q6G A;  3JCM V;  4PJO G;  3V8L A;  4M7D F;  2XTI A;  2VXE A;  2CJ9 A;  3JCM e;  5GAN 5;  3JB9 G;  1HC7 A;  3JCM b;  3HXX A;  4TVA B;  3TEH A;  4HWO A;  2IY5 B;  3RIR A;  2C7I A;  4HWP A;  4DPG A;  2XGT A;  1EQR A;  1Z7M A;  3W3S A;  2EL9 A;  2QHV A;  4YCU A;  4AH6 A;  2DXT A;  4JRK A;  3RKY A;  3HY1 A;  4YRF A;  1YFS A;  2DXU A;  4XTY A;  4EMG A;  1JBM A;  4XEM A;  2VXF A;  3V7R A;  5GAO q;  4N0A A;  4C92 E;  2I4L A;  1M5Q 1;  3UGQ A;  3REU A;  2EJF A;  2DTH A;  4C8Q C;  4P3N A;  2ZGW A;  3A31 A;  3NEL A;  5LJ3 g;  3BJU A;  4F7U A;  1LYL A;  3L2Z A;  5GMK j;  1G5H A;  3RKW A;  4HWT A;  3JCM f;  5GAO p;  1D3B A;  4JUV A;  1X2H A;  2CJA A;  3UFG A;  4EO4 A;  1I8F A;  3IAL A;  3JCM d;  4NCX A;  4CS2 A;  1E24 A;  5GMK m;  4EMK C;  4M7A C;  3REX A;  2FB7 A;  5LJ3 j;  4PJO E;  4H2X A;  4P74 C;  2DZC A;  3P8Y A;  2ZR2 A;  5LJ3 e;  4A54 A;  4LNS A;  4M77 E;  2AKW A;  3IG2 A;  4RMF A;  4M75 E;  4YRI A;  5GAN 4;  3RKX A;  2JN0 A;  4HWS A;  4M78 E;  2ARU A;  1G51 A;  4YRN A;  4C92 D;  1KQ1 A;  2Q7G A;  1VQZ A;  5GAM f;  4ZTZ B;  1SES A;  3L4G B;  3GIB A;  4C8Q E;  4XU2 A;  1LNX A;  1M8V A;  5GAN h;  4XQ3 A;  1I81 A;  1NYQ A;  2QHT A;  1YB3 A;  3JB9 I;  4EX5 A;  4JLI A;  4UP7 A;  4YRR A;  3NET A;  4M75 A;  4RCC A;  4PJO F;  4M7A G;  2YHT A;  1WQ7 A;  1KQ2 A;  2CJB A;  3V7S A;  3JB9 F;  5GAN 7;  3HTZ A;  1BIB A;  1WNL A;  3AHU A;  4C8Q A;  2DQ0 A;  2YLC A;  4O2D A;  1B70 B;  2PME A;  4PG3 A;  1EVK A;  1TH7 A;  3HXV A;  4RQF A;  4M78 F;  4H2Y A;  1QE0 A;  4J6X A;  4F7U F;  1U1T A;  4H2W A;  2E1H A;  1ADY A;  2RHS B;  4TQD A;  4M7D D;  3LC0 A;  2AKW B;  5GAM d;  4YRE A;  1YFT A;  2QTX A;  3QO3 A;  3HXZ A;  3BFM A;  3QHS A;  5CAI A;  3PCO B;  1WPY A;  1FYF A;  2RHQ A;  4K86 A;  3RAC A;  1X2G A;  4H2X B;  2PMF A;  4M7A B;  4EMK B;  4YRC A;  4C8Q D;  2ODR C;  4E51 A;  5GAO l;  1NYR A;  5GAO r;  3P8T A;  1H4Q A;  1H64 1;  2ZCE A;  4PJO A;  1H4V B;  1WYD A;  3NEN A;  1E1O A;  4RDX A;  4YPF A;  1D3B B;  2Q7E A;  2E10 A;  4WF2 A;  4M7D A;  3IKM B;  1U1S A;  4CH6 A;  4YRK A;  4CH5 A;  2DTI A;  4CH4 A;  2ZZE A;  4P71 A;  4YDQ A;  4TQF A;  1HXD A;  1PYS A;  5GAN j;  3TEG A;  5LJ3 d;  1EFW A;  3MF1 A;  4NOY A;  1GGM A;  4P73 C;  4KR2 A;  3M4P A;  4YRQ A;  1E1T A;  1SRY A;  4TTV A;  3DSQ A;  2ART A;  2ZT6 A;  5LJ3 f;  4KR3 A;  1B76 A;  12AS A;  1NNH A;  2RD1 A;  4XTZ A;  3VU3 C;  2ZT5 A;  3PGG A;  1BBW A;  3MF2 A;  4EMH A;  4H2V A;  4YRO A;  4WJ3 M;  4J6Y A;  3JCM X;  4UP8 A;  3SB2 A;  3JB9 D;  2CIM A;  3HFV A;  3PCO A;  3UGT A;  4M7A E;  3UH0 A;  5LJ5 h;  5LJ3 h;  3TEH B;  2DTO A;  4OLF A;  5HGQ A;  3JB9 H;  2DU7 A;  4P72 C;  3I7F A;  3SWN A;  3BY7 A;  4K87 A;  5GAM j;  4X5O A;  1X55 A;  2EAY A;  2HNI A;  4M7D E;  1Z7N A;  2DQ3 A;  4UP9 A;  3RER A;  1L0W A;  3NEM A;  1WU7 A;  1JJC A;  3P8V A;  4YRL A;  3RUX A;  2ZZG A;  2K57 A;  3ERR A;  4P73 A;  4XU0 A;  4M77 A;  4C8Q F;  2QHU A;  3A7U A;  4X9C A;  1N9S A;  5GAN f;  3HXW A;  1QF6 A;  4M7D C;  3M4Q A;  5GAM e;  5F5W A;  3ICA A;  3A32 A;  3OD1 A;  4P3P A;  4TVA A;  5GAN g;  3FIF A;  1KMN A;  4C92 A;  4YCW A;  4C92 F;  2ZT7 A;  3LSS A;  3VQW A;  4P3O A;  4P72 A;  4OP0 A;  4M78 D;  3HRI A;  4YRG A;  11AS A;  1KMM A;  1ADJ A;  2ZIO A;  3QO7 A;  4NL2 A;  4ZTU B;  4F7U E;  5LJ5 f;  4M77 D;  4C8Q B;  5GAN d;  4M75 D;  3A74 A;  4M7A D;  3VQX A;  5GAM g;  4RCB A;  1USY C;  1B34 B;  1ASZ A;  3HFZ A;  3RL6 A;  3JCM Q;  2Q5I A;  3A7R A;  4TWA A;  2EWN A;  2J3M A;  4H02 A;  1PYS B;  1YFR A;  3HXY A;  5C52 B;  4HA8 A;  4F7U B;  3A5Y A;  1N9R A;  3L4G A;  5GAN 8;  2J3L A;  3A7A A;  4MMK A;  3QSU A;  4YRM A;  4XTW A;  4M7D G;  1H4S A;  4M78 G;  4CS4 A;  3TUP A;  4HVC A;  3RES A;  4YP0 A;  4RQE A;  4CH3 A;  4M7A A;  3VQV A;  4PJO C;  4BWA A;  4M77 G;  1BIA A;  4H2S A;  4YRS A;  2G4C A;  4J15 A;  3V7C A;  1B34 A;  2RM4 A;  4N0A C;  2AMC A;  1EIY B;  5GMK e;  4CS3 A;  3WQZ A;  1SER A;  1JRI A;  2I4N A;  4ZIB A;  2DVE A;  3V8K A;  5GMK i;  3HRK A;  5DY9 A;  3SWN B;  2DU5 A;  2RHQ B;  2RB6 A;  4V2S A;  2ZIN A;  3HY0 A;  1E22 A;  3IKL A;  3HFO A;  4L87 A;  3R07 A;  4H2U A;  3HXU A;  1NJ6 A;  2ZTG A;  5GAN 2;  3CMQ A;  2P5I A;  4PHC A;  2I2L A;  1B70 A;  4JRI A;  3EFS A;  2ZT8 A;  5GAO n;  3JCM J;  1B7Y A;  2I4M A;  5E3I A;  2E3C A;  4QVD A;  3EFR A;  5K1P A;  3RGL A;  4PNO A;  5ELN A;  4M78 B;  4BW9 A;  2CGH A;  4XTV A;  5GAN 6;  1W66 A;  3JCM g;  3JCM c;  4XTU A;  1EVL A;  2I4O A;  2QHS A;  2Y90 A;  2Q5H A;  4M78 C;  2ZNI A;  2ZIM A;  1HK9 A;  3PZC A;  2IY5 A;  3MEY A;  5GMK l;  4M77 C;  3QO8 A;  1NJ2 A;  2YLB A;  4M75 C;  2RA2 A;  4YRP A;  4NL3 A;  4Y91 A;  4HT8 A;  4J6W A;  1H4T A;  3BDU A;  5GAO m;  3QTC A;  1X01 A;  3LSQ A;  1LJO A;  3L1A A;  3HFN A;  3JCM P;  2ZR3 A;  3QO5 A;  1NJ1 A;  3V8J A;  1B8A A;  2ALY A;  2P0L A;  4J5Y A;  4HWR A;  4WJ4 A;  4G84 A;  2DKG A;  4YRJ A;  4H2T A;  1LOJ A;  3KFU A;  5LJ5 g;  2DDZ A;  5ELO A;  5GAN e;  4C92 B;  4X9D A;  4G85 A;  5C51 B;  2VC8 A;  3RF1 A;  1N9W A;  4P75 A;  4P71 C;  1RIQ A;  2E64 A;  4DQ2 A;  4M78 A;  4PJO B;  5GMK h;  1EOV A;  4UPA A;  5GAN 3;  1IL2 A;  4M75 B;  4M77 B;  3FJP A;  4M75 G;  5LJ5 e;  1JJC B;  4K88 A;  1X56 A;  2E65 A;  3M4G A;  5GAM h;  2ZXF A;  3QNE A;  4EMK A;  3VQY A;  2FYK A;  4YRT A;  2DZ9 A;  4XU1 A;  4F7U G;  1USY A;  1KOG A;  3JB9 J;  2ARS A;  4Q15 A;  4C92 G;  3A5Z A;  4XTX A;  2RHS A;  1J5W A;  2ALY B;  3QUI A;  4M77 F;  4M75 F;  2ODR D;  1EIY A;  5LJ5 j;  2ZZF A;  1MGQ A;  1BBU A;  1WQW A;  2EJ9 A;  1NJ8 A;  2AMC B;  2E41 A;  1G5I A;  1SET A;  3G1Z A;  5K1X A;  1YCY A;  1Y96 A;  2DJZ A;  4WI1 A;  1I5L A;  5KNN A;  1X54 A;  3INZ A;  4KQE A;  1ASY A;  3FB9 A;  3E9H A;  1YGB A;  2E5A A;  4M7D B;  3SWN C;  3VBB A;  2DEQ A;  3HSB A;  1NJ5 A;  1ATI A;  4QVC A;  3JCM W;  3BW1 A;  1Y96 B;  4TVW A;  1I4K 1;  4P75 C; 
#chains in the Genus database with same CATH topology
 1YIJ A;  5C6S A;  1KK7 A;  1AOJ A;  1HD3 A;  1EX4 A;  2RMO A;  2OTJ A;  1YNZ A;  3OBY A;  2HBW A;  1VIE A;  5I21 A;  5AT1 B;  2C8M A;  2EVR A;  4XEO A;  4A53 A;  3E9I A;  1FWZ A;  4HT9 A;  1WLE A;  2EGE A;  3CCE Q;  2EGA A;  3CCU Q;  1AVZ C;  3V8L A;  5KYW B;  3OW2 A;  2BTT A;  2VXE A;  1OX9 A;  1HC7 A;  3QII A;  3M59 A;  3TEH A;  3UT1 A;  1FMK A;  2KT1 A;  2VVK A;  4DPG A;  3CCU T;  1WFW A;  2QHV A;  4YCU A;  4AH6 A;  3MP8 A;  3CXC P;  2L3S A;  3HKS A;  1JU5 C;  1JBM A;  3UWN A;  5GAO q;  4N0A A;  2I4L A;  2DL5 A;  4A4K A;  1M5Q 1;  3S3O A;  4KUL A;  4B9X A;  1U8R A;  2D8J A;  3BJU A;  1UTI A;  1M1K C;  2PU9 B;  1VQK Q;  2CP6 A;  1RAC B;  4FYY B;  2QEX Q;  1VQL A;  1TTH B;  5ECA A;  2HBP A;  1X2H A;  4EO4 A;  1I8F A;  2GBQ A;  4EMK C;  3PIP A;  2CT3 A;  1OZ2 A;  4L5G A;  2RN8 A;  4MZP A;  5GJV B;  5LJ3 e;  4A54 A;  1PG5 B;  2F2V A;  2NUT B;  1Q86 R;  4O5V A;  2ROL A;  4DEX A;  2MYS A;  4HWS A;  3HPW A;  2FRW A;  4HT4 A;  4FYV B;  4WCI A;  1G51 A;  5FWB A;  1KQ1 A;  2Q7G A;  4ZTZ B;  1RI0 A;  1VQP T;  2FVU A;  1YIJ Q;  2ZPF B;  4XU2 A;  1LNX A;  4KRT A;  3MP1 A;  1I81 A;  1RAD B;  1YB3 A;  3VS4 A;  1M90 C;  1UGR B;  2M02 A;  4JLI A;  4EX5 A;  3NET A;  2EQM A;  4M75 A;  2E3H A;  3EGX B;  4M7A G;  2YHT A;  1OPL A;  1YFN A;  2CJB A;  1G3S A;  1WNL A;  2OI3 A;  3AHU A;  2YLC A;  4RTU A;  2PME A;  2RNA A;  2X9H A;  2DET A;  3G4S Q;  1RLQ C;  2K5L A;  3A8O B;  1ZSZ B;  4JJB A;  1QE0 A;  1Q7Y R;  1U1T A;  2X4W A;  4LE9 A;  1TOV A;  4TQD A;  4M7D D;  3LC0 A;  4CI0 C;  2VB6 A;  1EIF A;  3GP8 A;  1YFT A;  2QTX A;  3QO3 A;  3HXZ A;  3BFM A;  1B7T A;  2HL5 C;  1TS9 A;  1WPY A;  1X2G A;  4H2X B;  3EH1 A;  4N4G A;  4C8Q D;  4E51 A;  1N8R R;  5GAO r;  3P8T A;  1H64 1;  4KGZ B;  4PJO A;  1H4V B;  3CC2 A;  1E1O A;  3X24 B;  4AMC A;  4YPF A;  1D3B B;  1KD1 C;  2Q7E A;  2RHI A;  1W6X A;  3IKM B;  2QQR A;  1VQ9 T;  4YRK A;  1QMC A;  3EG9 B;  1QKW A;  2EIF A;  4CH4 A;  4E7H A;  1IHV A;  5L23 A;  3MPU B;  3MQZ A;  2R58 A;  5LJ3 d;  1EFW A;  1JXO A;  2KRM A;  1UGS B;  3M4P A;  2KDS A;  4TTV A;  1AZE A;  4PJJ A;  4BDZ A;  4AT1 B;  2VGN A;  1JEG A;  3CC4 Q;  2HMA A;  5LJ3 f;  4D6W A;  12AS A;  2A3L A;  1FXX A;  1NNH A;  2ZT5 A;  4XTZ A;  2Y4Y A;  4MZT A;  3M0T A;  2O4X B;  3PGG A;  4J9F A;  3VU3 C;  1E6H A;  1PRL C;  4YRO A;  2HQH A;  3SB2 A;  3JB9 D;  2CIM A;  3HFV A;  1MV3 A;  3UGT A;  2YRV A;  5LJ5 h;  5C0M A;  2X51 A;  2COY A;  1YN8 A;  3QDR B;  3G4S A;  5CQX A;  4DOV A;  3CD6 T;  4OLF A;  1YJ9 A;  2DU7 A;  3C0C A;  2E4H A;  3BY7 A;  4X5O A;  3CCR Q;  1TSF A;  4CC7 A;  2QEX A;  3RER A;  2O2O A;  1Y07 A;  3X20 B;  3OSS C;  1XQH A;  2EQJ A;  3I5R A;  3UA6 A;  2RPN A;  4YRL A;  2K5I A;  4N4I A;  1N5Z A;  3G7Z A;  4JDS A;  2K57 A;  4EDU A;  2LX7 A;  2QHU A;  2MK5 A;  4X9C A;  2V26 A;  3C4S A;  2HDA A;  2WAC A;  4ESR A;  3ICA A;  2JNG A;  2PUO B;  4P3P A;  4TVA A;  5GAN g;  4C92 A;  3A8G B;  2KEA A;  3VQW A;  3NHN A;  3I56 Q;  4P72 A;  1K8A U;  2CYZ B;  1W2B A;  2DBK A;  4ZGJ B;  3RMQ A;  1KMM A;  3LYI A;  5D6X A;  4NL2 A;  4HCC A;  4F7U E;  4LXC A;  4M77 D;  4C8Q B;  5LJ5 f;  1PSF A;  3URG A;  4CRI A;  2XU8 A;  2X4Y A;  2ZPE B;  3CCE A;  2P0P A;  1WJS A;  4DBQ A;  1VQK T;  1XOV A;  2KK4 A;  4HKE A;  1ZQ1 A;  3QJ6 A;  6AT1 B;  1F1B B;  3VJP A;  2F1L A;  3CME Q;  2R5A A;  4Y28 E;  1PYS B;  3HXY A;  4F7U B;  3CCS Q;  3A5Y A;  2OTL Q;  3JSC A;  3L4G A;  1N8R C;  2KE9 A;  2J6F A;  1TUC A;  4CS4 A;  2RO0 A;  2B8A A;  4E6R A;  4PJO C;  3CCJ T;  4E7L A;  4M77 G;  4H2S A;  4BWA A;  4YRS A;  2EYY A;  4J15 A;  1SSF A;  2AMC A;  5FLX E;  4CS3 A;  1VQ5 Q;  1EFN A;  5HKC A;  4ZIB A;  1UHC A;  2QAS A;  1S72 T;  4JJD A;  3S3M A;  5GMK i;  1NLP C;  1S72 A;  2IIM A;  3HP9 A;  4QW2 A;  2FRY A;  3L2W A;  1H3H A;  4J9H A;  3HY0 A;  3EFO B;  2K3B A;  2H8H A;  4H2U A;  2JS2 A;  3QBY A;  3T9N A;  2ZTG A;  2RH2 A;  5A0G A;  3OYA A;  2P5I A;  4PHC A;  5D7U A;  2FG0 A;  1K1Z A;  3OYI A;  2CP0 A;  1VQ4 Q;  4JRI A;  2PVO B;  1MUZ A;  1WXB A;  2OTJ Q;  1QVF P;  3MEV A;  1WJR A;  2QTV A;  4PNO A;  4M78 B;  2K5F A;  3CD6 Q;  4X1V A;  4BW9 A;  1DJ7 B;  2J7I A;  4KH1 B;  2QG9 B;  3EGU A;  4LN2 A;  3TU4 K;  1EVL A;  2YUQ A;  2E6Z A;  3CC2 Q;  2EPD A;  1BB9 A;  2DLP A;  1JB0 E;  1E6G A;  3GF5 A;  4PFP A;  4TVR A;  2EYW A;  1K8A C;  2PZ1 A;  1NJ2 A;  2CZ0 B;  2L3P A;  2RA2 A;  1AWO A;  3NTI A;  4RTV A;  1QCO A;  1M1K U;  2F69 A;  2DK3 A;  4OMO A;  3H0H A;  2EYQ A;  5GAO m;  1X01 A;  2CZ6 B;  3LH0 A;  1LJO A;  3OYB A;  1NBE B;  2ZR3 A;  1NJ1 A;  1KC8 U;  3OYK A;  3DKM A;  1B8A A;  3E9G A;  4C0D C;  3RDV A;  4J9I A;  2ALY A;  2LT1 A;  4HWR A;  2DKG A;  4H2T A;  5LJ5 g;  3I55 T;  1TWB A;  1PD1 A;  1H92 A;  2H3E B;  2CUD A;  4MDW A;  5KCH A;  4MDX A;  2O31 A;  5FWC A;  4IUP A;  2A7Y A;  2BIV A;  2FZC B;  2RJE A;  1YIT Q;  4DEY A;  2RJC A;  4E7I A;  3CXC A;  4M78 A;  2J6O A;  2JTF A;  1GRI A;  1EOV A;  1WHG A;  4J7F A;  1VQ9 Q;  1GXI E;  3QPH A;  1IL2 A;  1W70 A;  4C0D B;  4M77 B;  1NYG A;  1Y71 A;  3CBM A;  2ZPG B;  3PT9 A;  3OBW A;  1M27 C;  2E65 A;  3EG3 A;  2DXC A;  2P84 A;  4LDX A;  3VQY A;  2D8H A;  3M54 A;  1G8X A;  4JRQ A;  1VQ8 Q;  3M0S A;  1RAH B;  2COZ A;  1RAG B;  3CBP A;  4IKF A;  1KOG A;  3JB9 J;  3EHQ A;  4QT7 A;  1KSW A;  4C92 G;  2KXC A;  3G1J A;  1WHL A;  1J5W A;  2PUK B;  1Q82 U;  3OSV A;  4L59 A;  2ZZF A;  5DM7 R;  1KIK A;  1WQW A;  2EJ9 A;  4JZ4 A;  3H41 A;  2E41 A;  2AMC B;  3EH2 A;  2QQS A;  3OW2 S;  1BI2 A;  2DL3 A;  3E9F A;  5KCO A;  1VQL Q;  3EGX A;  5CKE A;  1VQK A;  4FT4 A;  3I5S A;  4GLM A;  2P0Q A;  1WGS A;  4Z8A A;  1VQ7 A;  3HSB A;  2RJF A;  4D8D A;  2QA4 Q;  3JCM W;  1Y96 B;  3H9N A;  2DO3 A;  1VQ6 Q;  1NM7 A;  1H3Z A;  2W10 A;  3RNJ A;  3OYY A;  2V1R A;  4NS5 A;  2EW3 A;  8AT1 B;  3WVD B;  4QKU A;  2OTJ T;  2K4Y A;  4YYE A;  4M7A F;  1B7Y B;  2ZNJ A;  4C8Q G;  4TVY A;  4IIM A;  5C53 B;  1C0A A;  4P74 A;  3MEA A;  3E1S A;  1IO6 A;  4HVW A;  4BE1 A;  1X6B A;  1VQN A;  1EZZ B;  4Q6G A;  5IN1 A;  2YUN A;  2XI9 A;  4M7D F;  4LVI A;  1GL5 A;  2KYM A;  2CJ9 A;  4LDU A;  3JCM e;  2GNC A;  3HXX A;  4HWO A;  2YT6 A;  3OYL A;  1TXQ A;  2RK2 A;  3CMA Q;  2XGT A;  2ENM A;  3EGD A;  1EQR A;  3VS0 A;  4BAC A;  3M55 A;  2QEX T;  3QKJ A;  2DXT A;  4JRK A;  4FW2 A;  4IUR A;  4YRF A;  2FZG B;  1YFS A;  1QCN A;  2IVW A;  5EG2 A;  2X35 A;  1WHM A;  2X4J A;  4EMG A;  1ZLM A;  1VQ5 T;  2RQW A;  1MV0 B;  5KYX B;  2F5K A;  2DTH A;  4C8Q C;  1X27 A;  2WSF E;  2MF2 A;  3NGP A;  3A31 A;  1T3L A;  3CCL A;  2JMC A;  1YI2 Q;  2NUP A;  2E5Q A;  3JV3 A;  3SD4 A;  3G6E A;  2PVG B;  1K0S A;  2GF7 A;  2ED1 A;  3UFG A;  3JCM d;  4CS2 A;  2BZ8 A;  1E24 A;  1QVG S;  1AZG B;  1WLP B;  1PSE A;  1R8O B;  5LJ3 j;  3OYD A;  1B3Q A;  2FHD A;  1G3Y A;  3NFC A;  2MOX A;  3CCV Q;  3PIO A;  4LNS A;  3CC4 T;  4A4H A;  4M77 E;  2AKW A;  3IG2 A;  1VQN Q;  4RMF A;  3GBQ A;  5GAN 4;  4E2F B;  2JN0 A;  4GY5 A;  2MWP A;  3LH5 A;  2Y4X A;  3OB9 A;  4QVZ A;  1Z9Q A;  3I55 A;  4CC4 B;  1SES A;  3L4G B;  2A37 A;  2QGG A;  5KYX A;  1RUW A;  3G71 T;  5GAN h;  1M8V A;  1K9M C;  1ZSG A;  5L8R E;  3JB9 I;  2JT4 A;  1Q7Y C;  3A8M B;  4HVU A;  4UP7 A;  2MMP A;  3H0I A;  2WSE E;  3CCJ Q;  3OS2 A;  3QYH B;  2YSQ A;  2HEQ A;  1WQ7 A;  4OGC A;  3JB9 F;  4A63 B;  2JVV A;  4C8Q A;  1B70 B;  4LUD A;  1JJ2 P;  3M9Q A;  3CPF A;  1EVK A;  1Q81 C;  1GFC A;  4RQF A;  4H2Y A;  1G2B A;  4F7U F;  4L6V 5;  1MMD A;  1YIT T;  1NEG A;  2E1H A;  1IZ6 A;  2M16 A;  2RF0 A;  3J7A F;  3UDC A;  4O6J A;  5GAM d;  2K2V A;  4YRE A;  5CAI A;  1QWF A;  2EQK A;  2E12 A;  3CPW S;  3PCO B;  1FYF A;  2RHQ A;  4K86 A;  1MMA A;  4QQ6 A;  3UPU A;  2PMF A;  4M7A B;  4E7J A;  2O88 A;  3OMC A;  1UEB A;  3OYG A;  4FCY A;  2K7A A;  2P4R A;  4RDX A;  2DX1 A;  4LDY A;  2E10 A;  3VS2 A;  3HL8 A;  4KT0 E;  1U1S A;  4CH5 A;  2DTI A;  3PFS A;  1WHH A;  2DJQ A;  4E7S A;  4ZTF A;  4P71 A;  4EPC A;  1NPP A;  2EGC A;  3VUB A;  4TQF A;  2HSE B;  5KYN A;  3TSZ A;  3C12 A;  4Z89 A;  3BDL A;  1GGM A;  4P73 C;  4YRQ A;  1E1T A;  4B9W A;  1X2Q A;  4CC2 A;  1M3A A;  3GNF B;  3CCV A;  5HY6 A;  2RD1 A;  4OVA A;  3Q1J A;  4RKU E;  3CCQ Q;  4EMH A;  4WJ3 M;  3PCO A;  4M7A E;  2ZZD A;  3UH0 A;  1C0M A;  5LJ3 h;  4A4G A;  1WIE A;  5HGQ A;  3JB9 H;  3IQL A;  4P72 C;  1YJ9 T;  3SWN A;  3I7F A;  2EQI A;  1N8R U;  1YI2 A;  2V1Q A;  4M7D E;  1Z7N A;  2DAQ A;  4K11 A;  1L0W A;  1VQM Q;  2DXB A;  1V1C A;  1JJC A;  1WU7 A;  3I9Q A;  3P8V A;  3CCM T;  2A8E A;  4OML A;  1AD5 A;  1D1A A;  4JJC A;  4BB7 A;  1ABO A;  2V8J A;  4M77 A;  1OU8 A;  4E47 A;  3A7U A;  1LPL A;  2RK1 A;  3HXW A;  3M4Q A;  5GAM e;  1YCS B;  4AFQ C;  5I22 A;  2KY9 A;  2LCS A;  3SHW A;  1VYT A;  2ZT7 A;  2QYZ A;  3LSS A;  1OZ3 A;  3TCJ A;  4OP0 A;  1UJ0 A;  4LD6 A;  1MHN A;  5KYY A;  4LUE A;  4LVL A;  4Q5W A;  2RQU A;  3RBB B;  4R55 A;  1Q86 U;  1K0X A;  4HVV A;  4C5G A;  3OY9 A;  4C0Z A;  2OX7 A;  4QQD A;  3JCM Q;  2DRM A;  4IUV A;  4TWA A;  1IXD A;  1OI1 A;  1QVP A;  2R5M A;  3LLR A;  5J39 A;  4BDY A;  2NLU A;  4MMK A;  1TU0 B;  2KMT A;  4KBM B;  4PLI A;  2KGT A;  3VV0 A;  3G71 A;  2M51 A;  4RQE A;  1VQM A;  2YUO A;  4M7A A;  4KUD K;  1M3B A;  3CXC S;  3KBG A;  1VQN T;  1R77 A;  3V7C A;  2RM4 A;  1BKB A;  3OQ5 A;  3JRZ A;  1UGP B;  4OB1 B;  2DVE A;  2VAS A;  1PNJ A;  3SWN B;  5A2Q E;  5IT9 E;  1YJW A;  1JJ2 A;  3GLX A;  2RHQ B;  2RB6 A;  1MND A;  3CCL T;  3IKL A;  3EG0 A;  4L87 A;  1SF9 A;  4KH0 B;  4RTX A;  2ATC B;  3HXU A;  1QQJ A;  4C0F A;  2MPX C;  4F16 A;  1G3T A;  2FO0 A;  3C95 A;  1B70 A;  2F2X A;  5GAO n;  5E3I A;  3CPW A;  3NTH A;  2E3C A;  3CCE T;  1LVK A;  3UAT A;  3QDF A;  4QVD A;  1IGQ A;  3EFR A;  2GGR A;  5K1P A;  1J3T A;  2COW A;  1Q82 R;  3NTK A;  1BYM A;  2CGH A;  4XTV A;  5GAN 6;  2KNB B;  1Q95 G;  1VQ7 Q;  3JCM c;  2CSQ A;  5EC7 A;  4ME7 A;  5CVI A;  4AG2 C;  1KQS A;  2E3I A;  3QZ5 B;  5FU7 B;  2KBT A;  4BI3 A;  2ZNI A;  2D6F A;  5IAY A;  3L2V A;  3MEY A;  1MMG A;  1QP3 A;  5GMK l;  2BZX A;  4M75 C;  3FDR A;  4J6W A;  1H4T A;  1QKX A;  4JLG A;  2A28 A;  2VUB A;  4C5H A;  2KR3 A;  3LSQ A;  3QYG B;  3JCM P;  3HFN A;  3CCV T;  3MEW A;  1CKA A;  2NS6 A;  2LQW A;  4WJ4 A;  1AT1 B;  3KFU A;  3TVT A;  2F2W A;  2KRN A;  1M90 U;  1VYV A;  5GAN e;  5ELO A;  1M30 A;  2JMA A;  3WXM B;  2AZS A;  1IRE B;  4P75 A;  4GLK A;  1ZUU A;  1WXU A;  1YP5 A;  1RIQ A;  2E64 A;  4N4H A;  1NE8 A;  4DQ2 A;  1YJN T;  2GTO A;  1M1K R;  4PJO B;  5GMK h;  4UPA A;  5I2S A;  1PM3 A;  3CCM A;  1JXM A;  1GBR A;  3FJP A;  1KC8 R;  4M75 G;  1VUB A;  1NPR A;  2JTM A;  2RI2 A;  1JJC B;  1X56 A;  3QNE A;  2ZXF A;  2DPP B;  2FPF A;  1BCO A;  5FU7 C;  4ELY C;  4EMK A;  2QQA A;  2CH4 W;  1T0H A;  2KQW A;  1PCX A;  1RLP C;  3MEU A;  2FZK B;  3A5Z A;  3EGD B;  2LQK A;  4XTX A;  1XTD A;  2LZ6 B;  3QJY A;  3A8H B;  3QUI A;  4M77 F;  3TQ7 P;  2O9S A;  2JM8 A;  3GPL A;  1X69 A;  1ACM B;  2ODR D;  5LJ5 j;  3OS5 A;  1MGQ A;  3L2Q A;  1TUG B;  1NJ8 A;  2KI7 A;  1GBQ A;  1Y96 A;  2NYS A;  2DYB A;  5KNN A;  3CCL Q;  1SRM A;  4DA4 A;  1X54 A;  3INZ A;  4KQE A;  2LJ3 A;  3QG1 A;  1ASY A;  1YGB A;  2E5A A;  2KVQ G;  2GFU A;  3HRS A;  1NJ5 A;  4QVC A;  2K3Y A;  3CD6 A;  3BW1 A;  4TVW A;  1I4K 1;  2M1H A;  1T3S A;  1UUE A;  2X3W D;  4IUQ A;  1G83 A;  2J6K A;  2ECZ A;  1HTT A;  2VV5 A;  3JCM h;  1HYO A;  3OYJ A;  4XU3 A;  2RQV A;  1AEY A;  4BE2 A;  5J3B A;  4PJO D;  3JCM V;  2R57 A;  2RJD A;  2HL3 A;  4HXJ A;  2ED0 A;  5GAN 5;  3J80 E;  3JB9 G;  3VUZ A;  3JCM b;  1UG1 A;  4TVA B;  1UDL A;  3EG1 A;  1D09 B;  3RIR A;  3I56 A;  4JS4 A;  1K73 C;  1S72 Q;  3I56 T;  3MET A;  1VQP A;  1Z7M A;  3W3S A;  2RHU A;  2EL9 A;  1RI9 A;  5FU6 C;  1QVG A;  1B07 A;  3HY1 A;  3WVE B;  1NJI C;  2HSP A;  4XTY A;  1KQS P;  2VXF A;  1U3O A;  1K73 U;  4J8O A;  1SRL A;  1QP2 A;  4C92 E;  2XIC A;  2QA4 A;  3CME T;  2EJF A;  3EHR A;  3LGF A;  2MAM A;  2ZGW A;  3NEL A;  3ME9 A;  2ESW A;  5LJ3 g;  1BI0 A;  1LYL A;  3CC7 T;  5GMK j;  2D0N A;  4HWT A;  2E6N A;  2L3R A;  3JCM f;  5GAO p;  3CCR A;  2CZ1 B;  2HKN A;  3CCR T;  5M9O A;  1M4Z A;  4RG8 A;  1ZUK A;  2QXF A;  2DBM A;  1I1J A;  4M7A C;  4C5I A;  2EKO A;  3A8L B;  4PJO E;  4P74 C;  1JQQ A;  2ZR2 A;  3F70 A;  1X6O A;  2LMJ A;  1M2O A;  3M56 A;  4FSX A;  3CC4 A;  2DMO A;  5J26 A;  1CSK A;  1WX6 A;  4BE0 A;  1OUL A;  3RKX A;  2DIQ A;  4M78 E;  2FPE A;  2CSI A;  4C92 D;  5D6Y A;  2SEM A;  3PNW C;  2BE7 D;  1ZA1 B;  4XQ3 A;  3TSW A;  2DE0 X;  3ZL7 C;  4FW1 A;  3HHT B;  2MCN A;  5GJW B;  1YJN A;  3MCA B;  2QGF B;  4RCC A;  3I35 A;  2EKH A;  1KQ2 A;  3V7S A;  1UHF A;  1WA7 A;  2BUD A;  1GCQ C;  1NZ9 A;  2FPD A;  2X4X A;  5IHI A;  4PG3 A;  1YJW T;  2AK5 A;  1CKB A;  4PJM A;  4HCB A;  1TH7 A;  5CCA A;  4OGE A;  2LCC A;  4J6X A;  2CRE A;  3SFM A;  2JW4 A;  1ADY A;  2RHS B;  2AKW B;  4OMF B;  3EFO A;  3QHS A;  3AT1 B;  5A0D A;  1MNE A;  2DER A;  5FRM A;  1NJI U;  3H8Z A;  5CKF A;  3LX7 A;  2ROT A;  3LGL A;  5KYW A;  2M0Y A;  2RI5 A;  3A98 A;  2D9T A;  1HJD A;  1BK2 A;  3VRZ A;  5GAO l;  1ZA2 B;  3M0U A;  2DIG A;  2EYX A;  3KXT A;  1WYD A;  2NUP B;  1YJN Q;  3X25 B;  4WF2 A;  4HCZ A;  4J9B A;  4F04 B;  4IIO A;  3M0P A;  2XMF A;  2AKK A;  2ZZE A;  1JJ2 S;  3CEY A;  3HTR A;  1HXD A;  1PYS A;  5GAN j;  3TEG A;  2DM1 A;  2MI6 A;  3MF1 A;  4NOY A;  4KR2 A;  2PQW A;  2DF6 A;  4BI4 A;  5KYU B;  2ZT6 A;  4KR3 A;  2ABL A;  3CC7 Q;  3OYE A;  4J6Y A;  1C6V X;  4RUG A;  1IB8 A;  1RAB B;  1MMN A;  3PMI A;  2XKO C;  2JTE A;  1GCP A;  3J81 E;  2DTO A;  3R6N A;  2OTL T;  4OB3 B;  2QQ9 A;  4K87 A;  2JM9 A;  2QI2 A;  5GAM j;  1KC8 C;  2HNI A;  1VA7 A;  4UP9 A;  4PFZ A;  4FM4 B;  2J05 A;  4PKC C;  4X34 A;  2HD0 A;  2YDL A;  2CUB A;  3RUX A;  3ERR A;  4JRP A;  1RAE B;  4C8Q F;  4LD9 K;  2EQU A;  5IH2 A;  3CME A;  1N9S A;  2X3X D;  5GAN f;  1QVF A;  3VYH B;  2VKN A;  5F5W A;  1M90 R;  3OD1 A;  4OMN A;  1Z9Z A;  1VQ7 T;  1KMN A;  4YCW A;  1I07 A;  4C92 F;  1OOT A;  4Z88 A;  1VQP Q;  4OF1 A;  3ER0 A;  3M0Q A;  3VKI A;  4Z02 A;  3L42 A;  2H3J A;  3ZEH A;  1N27 A;  11AS A;  5KE3 A;  1ADJ A;  2ZIO A;  1WHK A;  3SEM A;  5IXB A;  4ZTU B;  4BD3 A;  4HCK A;  4A4F A;  1ABQ A;  2BE9 B;  4M75 D;  3A74 A;  1WXT A;  1B34 B;  1G3W A;  2VWF A;  3OYH A;  3N5B B;  4J9G A;  3JAM E;  2M9U A;  3HFZ A;  4RG2 A;  3OA6 A;  2HQX A;  3A7R A;  2EWN A;  2E5K A;  1YFR A;  5C52 B;  1PKT A;  3G71 Q;  1N9R A;  2JJ9 A;  2RHX A;  5GAN 8;  2J3L A;  1YHQ T;  3QSU A;  4YRM A;  2NUZ A;  3QZ9 B;  1H4S A;  2LJ0 A;  1WZO A;  4CH3 A;  3S6W A;  1GFD A;  1QLY A;  2XK0 A;  1BIA A;  2CZ7 B;  2KT8 A;  3E2U A;  2G4C A;  1WYX A;  2F5T X;  1B34 A;  1SER A;  3WQZ A;  2BZY A;  4FT2 A;  1YJ9 Q;  3A1P A;  1M8M A;  2RI3 A;  2V8I A;  3V8K A;  4RMO A;  1W4S A;  4LVM A;  2KYB A;  1BBZ A;  5DY9 A;  2QQB A;  3CPW P;  2DEU A;  2AHJ B;  3U23 A;  1PRM C;  3CC7 A;  1IRX A;  1E22 A;  3HFO A;  1OQK A;  3R07 A;  4DBH A;  2K6D A;  1UEC A;  4RTT A;  3ZFJ A;  1VIF A;  3CMQ A;  2I2L A;  3EFS A;  3QWY A;  4LDW A;  1B7Y A;  2ZT8 A;  3EG2 A;  4J9C A;  3M58 A;  1ZUY A;  3RGL A;  5ELN A;  2DIL A;  2QK0 A;  4DBR A;  5IHK A;  2DL8 A;  3TRE A;  3OYC A;  3P8D A;  5DLO A;  2XD0 A;  2LP5 A;  3H0F A;  1D0Y A;  2I4O A;  3X26 B;  2QHS A;  4M78 C;  4RTW A;  3NMZ C;  2NUT A;  1HK9 A;  3PZC A;  2IY5 A;  1HSQ A;  2LQN A;  1K9M U;  3QO8 A;  1Y7X A;  4XK8 E;  3VRY A;  4PLL A;  2P4T A;  2YLB A;  1TUD A;  5DLQ E;  4NL3 A;  1SEM A;  1KHC A;  3CCQ T;  1YBY A;  1UGV A;  3L1A A;  1H8K A;  3QO5 A;  1IGU A;  2OAU A;  1WI7 A;  2PVD B;  7AT1 B;  1WDX A;  3M57 A;  4GBQ A;  2P0L A;  4J5Y A;  2ZAE A;  1OEB A;  4G84 A;  1OV3 A;  1ZHI A;  2O01 E;  3X28 B;  3L2R A;  1SKU B;  3HRT A;  2FEI A;  4C92 B;  4X9D A;  3ULR B;  4G85 A;  3VYG A;  5C51 B;  3O5Z A;  1VQ6 T;  2VC8 A;  1Q86 C;  5I11 A;  3RF1 A;  4J83 A;  3M5A A;  1O75 A;  1V76 A;  4ZN3 A;  3CCM Q;  1D1C A;  4R0K A;  2GFA A;  2AZV A;  1QVG P;  5GAN 3;  4M75 B;  4J9E A;  3M53 A;  4FIB A;  5LJ5 e;  4RTZ A;  4K88 A;  2DVJ A;  3UF4 A;  1Y0M A;  3GNG A;  2LT4 A;  5CQY A;  5AYF A;  1X43 A;  4YRT A;  2YRD A;  4XU1 A;  2DD4 A;  1USY A;  1WJQ A;  2LX9 A;  2LQ8 A;  4Q15 A;  2RHS A;  2ALY B;  1I5O B;  4BY6 C;  3H6Z A;  4II1 A;  1GCQ A;  3PTA A;  2E70 A;  1EIY A;  2HZY A;  2LNV A;  2VYT A;  2CS7 A;  1N6A A;  1RAA B;  4JPB W;  3PVQ A;  1G5I A;  4QQG A;  5K1X A;  1VOM A;  4DBF A;  1YWO A;  1C1A A;  1ZX6 A;  2DJZ A;  2K9G A;  1PD0 A;  3FB9 A;  2K2M A;  3CQT A;  4M7D B;  3SWN C;  3VBB A;  2DEQ A;  3EG9 A;  1OU9 A;  4P75 C;  3EAE A;  1KD1 R;  4C92 C;  4MML A;  1PKS A;  4YCV A;  1R0C B;  4R56 A;  1AWX A;  1O9S A;  4AFZ C;  3HFZ B;  2AKL A;  2SRC A;  2I0N A;  5LJ5 d;  2Q7H A;  2L89 A;  1UE9 A;  2W0Z A;  1KFZ A;  3LWI A;  2G3R A;  3O8V A;  4WTO B;  5CKD A;  2EJG A;  1BCM A;  2C0T A;  4PJO G;  2XTI A;  5HCK A;  3FJ5 A;  1ZBX A;  4P5N A;  3REA B;  2IPO B;  4ZTJ A;  5FRN A;  4ZGE B;  1YJW Q;  2IY5 B;  2C7I A;  5KE2 A;  3CCU A;  4HWP A;  4LVK A;  1D1B A;  4C5E A;  1VQO Q;  2J06 A;  2KAF A;  5HK0 A;  1ZSZ A;  3DB4 A;  2O4X A;  3D7S B;  3RKY A;  4PFO A;  1U06 A;  3P8B B;  1Q82 C;  2L2P A;  3HRU A;  2DXU A;  3OYM A;  4ANJ A;  5IHN A;  2G6F X;  1G5V A;  1M2V A;  4XEM A;  2CKK A;  1NYF A;  2EBP A;  3V7R A;  1OYX A;  1YHQ Q;  5A0L A;  1X2K A;  2L8D A;  3UGQ A;  2ZPH B;  3REU A;  2AIR B;  4P3N A;  1U5S A;  4KGX B;  2KSS A;  1Q81 U;  2OAW A;  3VS6 A;  4F7U A;  3L2Z A;  1G5H A;  3RKW A;  2ZPB B;  1D3B A;  4JUV A;  1VYU A;  2GTJ A;  1KHI A;  1XNI A;  4F14 A;  3FLG A;  2CJA A;  1FYN A;  3IAL A;  1K76 A;  4NCX A;  1QCF A;  5GMK m;  1RAF B;  3REX A;  3KUF A;  1Q7Y U;  3QXE B;  1X75 C;  2FB7 A;  4H2X A;  4FSS A;  2DZC A;  3LW5 E;  3CCQ A;  3P8Y A;  4RTY A;  3OYF A;  4M75 E;  4YRI A;  1RL2 A;  1UJY A;  2ARU A;  4YRN A;  3VS3 A;  1M3C A;  2CP7 A;  4AFU C;  5IXF A;  3VS7 A;  2JUF A;  1VQZ A;  5GAM f;  1SHG A;  3GIB A;  1VQ6 A;  4C8Q E;  1T0J A;  3CCS T;  2DL4 A;  1NYQ A;  3PVL A;  1RAI B;  2QHT A;  2VGM A;  4A4E A;  1KQS S;  4YRR A;  4PJO F;  4PJN A;  2JZ2 A;  5D6W A;  5GAN 7;  3HTZ A;  1BIB A;  1X6G A;  2QA4 T;  2DQ0 A;  1K9A A;  4O2D A;  2JXB A;  4J7I A;  3HXV A;  4M78 F;  1V29 B;  3PE0 A;  4H2W A;  2HQE A;  2RHY A;  3ASK A;  1S1N A;  3A5Z B;  3C94 A;  3FC3 A;  1W1F A;  4C0G A;  2XID A;  4F17 A;  3RAC A;  8ATC B;  2CP2 A;  4EMK B;  4YRC A;  1BU1 A;  5HK3 A;  2AT1 B;  2GQV A;  2ODR C;  1NYR A;  4OMQ A;  9ATC B;  1H4Q A;  3RR6 A;  2Z0W A;  5LL6 S;  2ZCE A;  2OJ2 A;  3CC2 T;  4LDV A;  1AWW A;  3NEN A;  3OS0 A;  1OX8 A;  1BI3 A;  1NG2 A;  1ZSZ C;  4JZ3 A;  1VQ9 A;  4M7D A;  4CH6 A;  2D0Q B;  5CKB A;  4KGV B;  4KUI A;  1Y57 A;  4YDQ A;  3KFV A;  3BE3 A;  4PK4 A;  2DRK A;  4OMP A;  2KXD A;  1D0X A;  1FMV A;  1BI1 A;  4IUU A;  1SHF A;  3OMG A;  2BKD N;  4B6M A;  1SRY A;  3DSQ A;  2KRO A;  2ART A;  4J9D A;  5CIU A;  1ARK A;  1B76 A;  3E19 A;  3FEO A;  1BBW A;  3MF2 A;  1K8A R;  4H2V A;  3JCM X;  4FYW B;  4UP8 A;  1FX7 A;  3MP6 A;  3S3N A;  4PJL A;  3TEH B;  2LDM A;  1NJI R;  2XG8 D;  3M4Y A;  1D0Z A;  4BI8 B;  2LJ1 A;  1X55 A;  2EAY A;  4ZN1 A;  2L0A A;  2DQ3 A;  4DOW A;  2HAX A;  2XHC A;  2CP5 A;  1FMW A;  3CCJ A;  1P92 A;  3NEM A;  2JS0 A;  3P8H A;  2PTK A;  2ZZG A;  3PMT A;  2L3Q A;  4E7Z A;  4ATO A;  4P73 A;  4XU0 A;  2QAZ A;  3R6O A;  2M0O A;  4MZM A;  1SG5 A;  2YUP A;  3VS5 A;  1M1G A;  1K9M R;  1QF6 A;  4M7D C;  1VQ4 A;  1VQ4 T;  4JS5 A;  3A32 A;  3L2U A;  4FU6 A;  3FIF A;  3MJX A;  5CK9 A;  1VQO A;  4YTL A;  1VQO T;  2ZPI B;  4ZNX A;  4ORZ A;  2DD5 A;  2B86 A;  4P3O A;  4M78 D;  3HRI A;  4YRG A;  2V8K A;  2EFI A;  2GCX A;  2RHZ A;  2YXY A;  3GOX A;  4BUG A;  2DYI A;  3QO7 A;  1M1F A;  1Q81 R;  2C0O A;  5KYU A;  5GAN d;  1A0N B;  4M7A D;  3VQX A;  2DFU A;  4RCB A;  5GAM g;  2YRC A;  2XDD A;  2CDT A;  1USY C;  4OB2 B;  1NEB A;  1ASZ A;  4JJN K;  3RL6 A;  1R0B G;  4IUT A;  3RMS A;  2Q5I A;  2J3M A;  4H02 A;  1QW1 A;  3DLM A;  1VQL T;  1KG1 A;  4HA8 A;  5FU6 B;  1SSH A;  1YIJ T;  2DL7 A;  3A7A A;  3UA7 A;  3OYN A;  4XTW A;  4M7D G;  2C06 A;  1YHQ A;  1YI2 T;  4M78 G;  1JO8 A;  3TUP A;  4HVC A;  3CCS A;  3RES A;  4YP0 A;  2GQI A;  3OS1 A;  5FRO A;  3VQV A;  1WHJ A;  1W2B S;  2MIO A;  2WSC E;  3CBO A;  3DB3 A;  2XDP A;  4N0A C;  1EIY B;  5GMK e;  1UFF A;  1JRI A;  1PWT A;  4EIK A;  2I4N A;  3CMA T;  3CMA A;  4OMM A;  3HRK A;  2LVM A;  1I0C A;  4ELZ C;  5KYY B;  2DU5 A;  4V2S A;  2ZIN A;  1M9S A;  1PC0 A;  3MHX A;  2CH4 A;  1ZBJ A;  4AG1 C;  4UC4 A;  3SDZ A;  1NJ6 A;  5GAN 2;  2NWM A;  4PL6 A;  2K79 A;  1VQ8 A;  1VQ8 T;  4AFS C;  2HCK A;  2C0I A;  2I4M A;  3JCM J;  1K4U S;  1W66 A;  3MO8 A;  3JCM g;  2P0K A;  2HKQ B;  1XJW B;  4XTU A;  2A0F B;  4LVJ A;  1YIT A;  1E7O A;  5KH6 A;  2LNH B;  2LTO A;  2QDY B;  2Y90 A;  2Q5H A;  2ZIM A;  4M77 C;  2RQR A;  2RQT A;  3MKD A;  5FW9 A;  4YRP A;  1W2B P;  4Y91 A;  4HT8 A;  1VQM T;  3BDU A;  3QTC A;  2DA9 A;  1K73 R;  2O9V A;  2K3X A;  4M4Z A;  3V8J A;  3OW2 P;  2D1X A;  2EYZ A;  1KD1 U;  4OB0 B;  4YRJ A;  5CKH A;  1SPK A;  1KJW A;  1LOJ A;  1AWJ A;  2ZCF B;  3TEE A;  2PNI A;  2DDZ A;  4Y92 A;  3G4S T;  1UGQ B;  2LCL A;  2A08 A;  1N9W A;  4P71 C;  3ZBD A;  3QWX X;  1M2V B;  3M0R A;  5CO7 A;  3FRN A;  2L5Q A;  3NPF A;  2CP3 A;  3M4G A;  5GAM h;  3I55 Q;  2CT4 A;  2FYK A;  2A36 A;  1QWE A;  1OPK A;  2DZ9 A;  2IG0 A;  4D8K A;  4F7U G;  4BY6 B;  1YWP A;  3THK A;  2ARS A;  4ZGD B;  2FL7 A;  1QVF S;  1NLO C;  4E7K A;  2XDB A;  2YWW A;  2KRS A;  3DLL A;  1PHT A;  4M75 F;  2LRQ A;  4CC3 A;  2JOY A;  2LC4 A;  1BBU A;  1LCK A;  5CR2 A;  1SET A;  3G1Z A;  1VQ5 A;  3G6E Q;  4VUB A;  1UB4 A;  1YCY A;  4WI1 A;  1I5L A;  2QDL A;  3E9H A;  4LNP A;  1IHW A;  3LWH A;  5I2M A;  3VS1 A;  2MWO A;  3REB B;  3G6E T;  1AHJ B;  2DNU A;  1ATI A;  1TG0 A;  4FYX B;  4XAX B;  2OTL A;  4FL6 A; 
#chains in the Genus database with same CATH homology
 1YIJ A;  5C6S A;  2OTJ A;  3OBY A;  1VIE A;  5I21 A;  2C8M A;  4XEO A;  4A53 A;  3E9I A;  1FWZ A;  4HT9 A;  1WLE A;  3V8L A;  3OW2 A;  2VXE A;  1HC7 A;  3QII A;  3M59 A;  3TEH A;  3UT1 A;  4DPG A;  3CCU T;  2QHV A;  4YCU A;  4AH6 A;  3MP8 A;  3HKS A;  1JBM A;  3UWN A;  5GAO q;  4N0A A;  2I4L A;  4A4K A;  1M5Q 1;  3S3O A;  4KUL A;  4B9X A;  1U8R A;  3BJU A;  1M1K C;  2PU9 B;  1VQL A;  2HBP A;  1X2H A;  4EO4 A;  1I8F A;  4EMK C;  3PIP A;  1OZ2 A;  4L5G A;  4MZP A;  5LJ3 e;  4A54 A;  4O5V A;  4HWS A;  3HPW A;  4HT4 A;  1G51 A;  1KQ1 A;  2Q7G A;  4ZTZ B;  1RI0 A;  1VQP T;  2FVU A;  2ZPF B;  4XU2 A;  1LNX A;  3MP1 A;  1I81 A;  1YB3 A;  1M90 C;  1UGR B;  4EX5 A;  4JLI A;  3NET A;  2EQM A;  4M75 A;  4M7A G;  2YHT A;  2CJB A;  1G3S A;  1WNL A;  3AHU A;  2YLC A;  2PME A;  3A8O B;  2K5L A;  1QE0 A;  1U1T A;  2X4W A;  4TQD A;  4M7D D;  3LC0 A;  4CI0 C;  1EIF A;  3GP8 A;  1YFT A;  2QTX A;  3QO3 A;  3HXZ A;  3BFM A;  1WPY A;  1X2G A;  4H2X B;  4N4G A;  4C8Q D;  4E51 A;  5GAO r;  3P8T A;  1H64 1;  4PJO A;  1H4V B;  3CC2 A;  1E1O A;  3X24 B;  4YPF A;  1D3B B;  1KD1 C;  2Q7E A;  2RHI A;  3IKM B;  2QQR A;  1VQ9 T;  4YRK A;  2EIF A;  4CH4 A;  4E7H A;  3MQZ A;  2R58 A;  5LJ3 d;  1EFW A;  1UGS B;  3M4P A;  2KDS A;  4TTV A;  4BDZ A;  2VGN A;  5LJ3 f;  4D6W A;  12AS A;  2A3L A;  1FXX A;  1NNH A;  2ZT5 A;  2Y4Y A;  4MZT A;  4XTZ A;  3VU3 C;  2O4X B;  3PGG A;  4YRO A;  3SB2 A;  3JB9 D;  2CIM A;  3HFV A;  3UGT A;  2YRV A;  5LJ5 h;  5C0M A;  3QDR B;  3G4S A;  5CQX A;  4DOV A;  3CD6 T;  4OLF A;  1YJ9 A;  2DU7 A;  3BY7 A;  4X5O A;  2QEX A;  3RER A;  1Y07 A;  3X20 B;  3OSS C;  1XQH A;  2EQJ A;  4YRL A;  2K5I A;  4N4I A;  3G7Z A;  4JDS A;  2K57 A;  4EDU A;  2QHU A;  4X9C A;  3C4S A;  2WAC A;  3ICA A;  2JNG A;  2PUO B;  4P3P A;  4TVA A;  5GAN g;  4C92 A;  3A8G B;  3VQW A;  4P72 A;  1K8A U;  2CYZ B;  1W2B A;  4ZGJ B;  3RMQ A;  1KMM A;  3LYI A;  5D6X A;  4NL2 A;  4HCC A;  4F7U E;  5LJ5 f;  4M77 D;  4C8Q B;  1PSF A;  3URG A;  4CRI A;  2XU8 A;  2X4Y A;  2ZPE B;  3CCE A;  2P0P A;  1WJS A;  1VQK T;  1XOV A;  2KK4 A;  4HKE A;  1ZQ1 A;  3QJ6 A;  3VJP A;  2R5A A;  4Y28 E;  1PYS B;  3HXY A;  4F7U B;  3A5Y A;  3JSC A;  3L4G A;  1N8R C;  4CS4 A;  2RO0 A;  2B8A A;  4PJO C;  3CCJ T;  4E7L A;  4M77 G;  4H2S A;  4BWA A;  4YRS A;  4J15 A;  1SSF A;  2AMC A;  5FLX E;  4CS3 A;  5HKC A;  4ZIB A;  1S72 T;  3S3M A;  5GMK i;  1S72 A;  3HP9 A;  4QW2 A;  3L2W A;  3HY0 A;  4H2U A;  3QBY A;  3T9N A;  2ZTG A;  2RH2 A;  5A0G A;  3OYA A;  2P5I A;  4PHC A;  3OYI A;  4JRI A;  2PVO B;  3MEV A;  1WJR A;  4PNO A;  4M78 B;  2K5F A;  4BW9 A;  1DJ7 B;  3TU4 K;  1EVL A;  2E6Z A;  1JB0 E;  3GF5 A;  4TVR A;  1K8A C;  1NJ2 A;  2CZ0 B;  2RA2 A;  3NTI A;  1M1K U;  2F69 A;  2DK3 A;  5GAO m;  2EYQ A;  1X01 A;  2CZ6 B;  3LH0 A;  1LJO A;  3OYB A;  2ZR3 A;  1NJ1 A;  1KC8 U;  3OYK A;  3DKM A;  1B8A A;  3E9G A;  4C0D C;  2ALY A;  2LT1 A;  4HWR A;  2DKG A;  4H2T A;  5LJ5 g;  3I55 T;  4MDW A;  5KCH A;  4MDX A;  4IUP A;  2A7Y A;  2BIV A;  2RJE A;  2RJC A;  4E7I A;  3CXC A;  4M78 A;  2JTF A;  1EOV A;  1GXI E;  4J7F A;  3QPH A;  1IL2 A;  4C0D B;  4M77 B;  1Y71 A;  3CBM A;  2ZPG B;  3PT9 A;  3OBW A;  2E65 A;  2DXC A;  4LDX A;  3VQY A;  3M54 A;  4JRQ A;  3CBP A;  4IKF A;  1KOG A;  3JB9 J;  4C92 G;  1J5W A;  2PUK B;  1Q82 U;  3OSV A;  4L59 A;  2ZZF A;  5DM7 R;  1WQW A;  2EJ9 A;  2AMC B;  2E41 A;  2QQS A;  3OW2 S;  1BI2 A;  3E9F A;  5KCO A;  5CKE A;  1VQK A;  4FT4 A;  2P0Q A;  1WGS A;  1VQ7 A;  3HSB A;  2RJF A;  3JCM W;  1Y96 B;  2DO3 A;  1H3Z A;  3OYY A;  4NS5 A;  3WVD B;  2OTJ T;  2K4Y A;  4YYE A;  4M7A F;  1B7Y B;  2ZNJ A;  4C8Q G;  4TVY A;  1C0A A;  5C53 B;  4P74 A;  3MEA A;  3E1S A;  4BE1 A;  1VQN A;  4Q6G A;  5IN1 A;  2XI9 A;  4M7D F;  4LVI A;  2CJ9 A;  4LDU A;  3JCM e;  3HXX A;  4HWO A;  3OYL A;  2RK2 A;  2XGT A;  1EQR A;  4BAC A;  3M55 A;  2QEX T;  3QKJ A;  2DXT A;  4JRK A;  4IUR A;  4YRF A;  1YFS A;  2IVW A;  5EG2 A;  2X35 A;  2X4J A;  4EMG A;  1VQ5 T;  2F5K A;  2DTH A;  4C8Q C;  2WSF E;  2MF2 A;  3A31 A;  3CCL A;  2E5Q A;  3SD4 A;  3G6E A;  2PVG B;  2GF7 A;  3UFG A;  3JCM d;  4CS2 A;  1E24 A;  1QVG S;  1PSE A;  1R8O B;  5LJ3 j;  3OYD A;  2FHD A;  1G3Y A;  3NFC A;  3PIO A;  4LNS A;  3CC4 T;  4A4H A;  4M77 E;  2AKW A;  3IG2 A;  4RMF A;  5GAN 4;  2JN0 A;  4GY5 A;  2MWP A;  2Y4X A;  3OB9 A;  4QVZ A;  3I55 A;  1SES A;  3L4G B;  3G71 T;  5GAN h;  1M8V A;  1K9M C;  5L8R E;  3JB9 I;  1Q7Y C;  3A8M B;  4UP7 A;  2MMP A;  2WSE E;  3OS2 A;  3QYH B;  1WQ7 A;  4OGC A;  3JB9 F;  2JVV A;  4C8Q A;  1B70 B;  3M9Q A;  3CPF A;  1EVK A;  1Q81 C;  4RQF A;  4H2Y A;  4F7U F;  4L6V 5;  1YIT T;  2E1H A;  1IZ6 A;  2M16 A;  3J7A F;  3UDC A;  4O6J A;  5GAM d;  2K2V A;  4YRE A;  5CAI A;  2EQK A;  2E12 A;  3CPW S;  3PCO B;  1FYF A;  2RHQ A;  4K86 A;  4QQ6 A;  3UPU A;  2PMF A;  4M7A B;  4E7J A;  3OMC A;  1UEB A;  3OYG A;  4RDX A;  4LDY A;  2E10 A;  3HL8 A;  4KT0 E;  1U1S A;  4CH5 A;  2DTI A;  3PFS A;  4ZTF A;  4P71 A;  4EPC A;  1NPP A;  3VUB A;  4TQF A;  3C12 A;  3BDL A;  1GGM A;  4P73 C;  4YRQ A;  1E1T A;  4B9W A;  3GNF B;  3CCV A;  5HY6 A;  2RD1 A;  4OVA A;  3Q1J A;  4RKU E;  4EMH A;  4WJ3 M;  3PCO A;  4M7A E;  2ZZD A;  3UH0 A;  5LJ3 h;  4A4G A;  5HGQ A;  3JB9 H;  4P72 C;  1YJ9 T;  3SWN A;  3I7F A;  1N8R U;  1YI2 A;  4M7D E;  1Z7N A;  2DAQ A;  1L0W A;  2DXB A;  1WU7 A;  1JJC A;  3P8V A;  3CCM T;  2A8E A;  4BB7 A;  2V8J A;  4M77 A;  4E47 A;  3A7U A;  2RK1 A;  3HXW A;  3M4Q A;  5GAM e;  2KY9 A;  2ZT7 A;  3LSS A;  1OZ3 A;  3TCJ A;  4OP0 A;  4LD6 A;  1MHN A;  4LVL A;  4Q5W A;  4R55 A;  1Q86 U;  4C5G A;  3OY9 A;  4C0Z A;  4QQD A;  3JCM Q;  4IUV A;  4TWA A;  1OI1 A;  1QVP A;  2R5M A;  3LLR A;  5J39 A;  4BDY A;  2NLU A;  4MMK A;  2KMT A;  4KBM B;  4PLI A;  3VV0 A;  3G71 A;  4RQE A;  1VQM A;  4M7A A;  4KUD K;  3CXC S;  3KBG A;  1VQN T;  3V7C A;  2RM4 A;  1BKB A;  3OQ5 A;  3JRZ A;  1UGP B;  4OB1 B;  2DVE A;  1JJ2 A;  3SWN B;  5A2Q E;  5IT9 E;  1YJW A;  2RHQ B;  3GLX A;  2RB6 A;  3CCL T;  3IKL A;  4L87 A;  3HXU A;  4C0F A;  1G3T A;  3C95 A;  1B70 A;  5GAO n;  5E3I A;  3CPW A;  3NTH A;  2E3C A;  3CCE T;  4QVD A;  3EFR A;  5K1P A;  3NTK A;  1BYM A;  2CGH A;  4XTV A;  5GAN 6;  3JCM c;  4ME7 A;  5CVI A;  1KQS A;  3QZ5 B;  5FU7 B;  4BI3 A;  2ZNI A;  2D6F A;  5IAY A;  3L2V A;  3MEY A;  1QP3 A;  5GMK l;  4M75 C;  3FDR A;  4J6W A;  1H4T A;  4JLG A;  2VUB A;  4C5H A;  3LSQ A;  3QYG B;  3JCM P;  3HFN A;  3CCV T;  3MEW A;  2NS6 A;  4WJ4 A;  3KFU A;  1M90 U;  5ELO A;  5GAN e;  3WXM B;  1IRE B;  4P75 A;  4GLK A;  1RIQ A;  2E64 A;  4N4H A;  1NE8 A;  4DQ2 A;  1YJN T;  4PJO B;  5GMK h;  4UPA A;  5I2S A;  3CCM A;  3FJP A;  4M75 G;  1VUB A;  1NPR A;  2JTM A;  2RI2 A;  1JJC B;  1X56 A;  3QNE A;  2ZXF A;  2DPP B;  4EMK A;  5FU7 C;  4ELY C;  2QQA A;  2KQW A;  3MEU A;  3A5Z A;  2LQK A;  4XTX A;  1XTD A;  3QJY A;  3A8H B;  3QUI A;  4M77 F;  3GPL A;  2ODR D;  5LJ5 j;  3OS5 A;  1MGQ A;  3L2Q A;  1NJ8 A;  1Y96 A;  5KNN A;  4DA4 A;  1X54 A;  3INZ A;  4KQE A;  3QG1 A;  1ASY A;  1YGB A;  2E5A A;  2KVQ G;  2GFU A;  3HRS A;  1NJ5 A;  4QVC A;  2K3Y A;  3CD6 A;  3BW1 A;  4TVW A;  1I4K 1;  2M1H A;  4IUQ A;  1HTT A;  2VV5 A;  3JCM h;  3OYJ A;  4XU3 A;  4BE2 A;  5J3B A;  4PJO D;  3JCM V;  2R57 A;  2RJD A;  5GAN 5;  3J80 E;  3JB9 G;  3VUZ A;  3JCM b;  4TVA B;  3RIR A;  3I56 A;  4JS4 A;  1K73 C;  3I56 T;  3MET A;  1VQP A;  1Z7M A;  3W3S A;  2RHU A;  2EL9 A;  5FU6 C;  1QVG A;  3HY1 A;  3WVE B;  1NJI C;  4XTY A;  2VXF A;  1K73 U;  4J8O A;  4C92 E;  1QP2 A;  2QA4 A;  2XIC A;  3CME T;  2EJF A;  3LGF A;  2MAM A;  2ZGW A;  3NEL A;  3ME9 A;  5LJ3 g;  1BI0 A;  1LYL A;  3CC7 T;  5GMK j;  4HWT A;  2E6N A;  2L3R A;  3JCM f;  5GAO p;  3CCR A;  2CZ1 B;  3CCR T;  5M9O A;  1M4Z A;  4RG8 A;  2QXF A;  4M7A C;  4C5I A;  2EKO A;  3A8L B;  4PJO E;  4P74 C;  2ZR2 A;  3F70 A;  1X6O A;  3M56 A;  4FSX A;  3CC4 A;  5J26 A;  4BE0 A;  3RKX A;  2DIQ A;  4M78 E;  4C92 D;  5D6Y A;  3PNW C;  4XQ3 A;  3HHT B;  1YJN A;  3MCA B;  4RCC A;  1KQ2 A;  3V7S A;  2BUD A;  1NZ9 A;  2X4X A;  4PG3 A;  1YJW T;  4HCB A;  1TH7 A;  5CCA A;  4OGE A;  2LCC A;  4J6X A;  3SFM A;  2RHS B;  1ADY A;  2AKW B;  4OMF B;  3QHS A;  5A0D A;  5FRM A;  1NJI U;  3H8Z A;  5CKF A;  3LX7 A;  3LGL A;  2RI5 A;  2D9T A;  5GAO l;  2DIG A;  3KXT A;  1WYD A;  3X25 B;  4WF2 A;  4HCZ A;  2ZZE A;  1JJ2 S;  3CEY A;  1HXD A;  1PYS A;  5GAN j;  3TEG A;  2MI6 A;  3MF1 A;  4NOY A;  4KR2 A;  2PQW A;  4BI4 A;  2ZT6 A;  4KR3 A;  3OYE A;  4J6Y A;  3PMI A;  2XKO C;  3J81 E;  2DTO A;  2OTL T;  4OB3 B;  2QQ9 A;  4K87 A;  2QI2 A;  5GAM j;  1KC8 C;  2HNI A;  4UP9 A;  4FM4 B;  4PKC C;  4X34 A;  2HD0 A;  3RUX A;  3ERR A;  4JRP A;  4C8Q F;  4LD9 K;  2EQU A;  3CME A;  1N9S A;  1QVF A;  5GAN f;  3VYH B;  5F5W A;  3OD1 A;  1VQ7 T;  1KMN A;  4YCW A;  4C92 F;  4OF1 A;  3ER0 A;  3VKI A;  4Z02 A;  3L42 A;  2H3J A;  3ZEH A;  1N27 A;  11AS A;  5KE3 A;  2ZIO A;  1ADJ A;  4ZTU B;  4BD3 A;  4A4F A;  4M75 D;  3A74 A;  1B34 B;  1G3W A;  3OYH A;  3N5B B;  3JAM E;  2M9U A;  3HFZ A;  4RG2 A;  3OA6 A;  2HQX A;  3A7R A;  2EWN A;  1YFR A;  5C52 B;  1N9R A;  2RHX A;  5GAN 8;  2J3L A;  1YHQ T;  3QSU A;  4YRM A;  3QZ9 B;  1H4S A;  4CH3 A;  3S6W A;  2XK0 A;  1BIA A;  2CZ7 B;  2G4C A;  2F5T X;  1B34 A;  1SER A;  3WQZ A;  4FT2 A;  2RI3 A;  2V8I A;  3V8K A;  4RMO A;  1W4S A;  4LVM A;  5DY9 A;  2QQB A;  2AHJ B;  3CC7 A;  1E22 A;  3HFO A;  3R07 A;  3ZFJ A;  1VIF A;  3CMQ A;  2I2L A;  3EFS A;  2ZT8 A;  4LDW A;  1B7Y A;  3M58 A;  3RGL A;  5ELN A;  3TRE A;  3OYC A;  3P8D A;  5DLO A;  2XD0 A;  2I4O A;  3X26 B;  2QHS A;  4M78 C;  1HK9 A;  3PZC A;  2IY5 A;  1K9M U;  3QO8 A;  1Y7X A;  4XK8 E;  4PLL A;  2P4T A;  2YLB A;  5DLQ E;  4NL3 A;  1KHC A;  3CCQ T;  1YBY A;  3L1A A;  3QO5 A;  2OAU A;  2PVD B;  3M57 A;  2P0L A;  4J5Y A;  4G84 A;  1ZHI A;  2O01 E;  3X28 B;  3L2R A;  3HRT A;  4C92 B;  4X9D A;  4G85 A;  3VYG A;  5C51 B;  1VQ6 T;  2VC8 A;  1Q86 C;  3RF1 A;  4J83 A;  3M5A A;  1O75 A;  4ZN3 A;  2GFA A;  5GAN 3;  4M75 B;  3M53 A;  4FIB A;  5LJ5 e;  4K88 A;  3GNG A;  2LT4 A;  5CQY A;  5AYF A;  4YRT A;  4XU1 A;  2DD4 A;  1USY A;  1WJQ A;  2LX9 A;  2LQ8 A;  4Q15 A;  2RHS A;  2ALY B;  4BY6 C;  3H6Z A;  4II1 A;  3PTA A;  2E70 A;  1EIY A;  2LNV A;  2VYT A;  2CS7 A;  1N6A A;  1G5I A;  4QQG A;  5K1X A;  2DJZ A;  3FB9 A;  4M7D B;  3SWN C;  3VBB A;  2DEQ A;  4P75 C;  3EAE A;  4C92 C;  4MML A;  4YCV A;  4R56 A;  1O9S A;  3HFZ B;  5LJ5 d;  2Q7H A;  2L89 A;  3LWI A;  2G3R A;  3O8V A;  5CKD A;  2EJG A;  4PJO G;  2XTI A;  1ZBX A;  4P5N A;  4ZTJ A;  5FRN A;  4ZGE B;  2IY5 B;  2C7I A;  5KE2 A;  3CCU A;  4HWP A;  4LVK A;  4C5E A;  2KAF A;  5HK0 A;  3DB4 A;  2O4X A;  3RKY A;  3P8B B;  1Q82 C;  3HRU A;  2DXU A;  3OYM A;  1G5V A;  4XEM A;  2CKK A;  3V7R A;  1OYX A;  5A0L A;  2L8D A;  3UGQ A;  2ZPH B;  3REU A;  4P3N A;  2KSS A;  1Q81 U;  4F7U A;  3L2Z A;  1G5H A;  3RKW A;  2ZPB B;  1D3B A;  4JUV A;  1KHI A;  1XNI A;  3FLG A;  2CJA A;  3IAL A;  4NCX A;  5GMK m;  3REX A;  3KUF A;  1Q7Y U;  3QXE B;  1X75 C;  2FB7 A;  4H2X A;  2DZC A;  3LW5 E;  3CCQ A;  3P8Y A;  3OYF A;  4M75 E;  4YRI A;  1RL2 A;  2ARU A;  4YRN A;  2JUF A;  1VQZ A;  5GAM f;  3GIB A;  1VQ6 A;  4C8Q E;  3CCS T;  1NYQ A;  2QHT A;  2VGM A;  4A4E A;  1KQS S;  4YRR A;  4PJO F;  5D6W A;  2JZ2 A;  5GAN 7;  3HTZ A;  1BIB A;  2QA4 T;  2DQ0 A;  4O2D A;  4J7I A;  3HXV A;  4M78 F;  1V29 B;  4H2W A;  2HQE A;  2RHY A;  3ASK A;  3A5Z B;  3C94 A;  3FC3 A;  4C0G A;  2XID A;  3RAC A;  4EMK B;  4YRC A;  5HK3 A;  2GQV A;  2ODR C;  1NYR A;  1H4Q A;  5LL6 S;  2ZCE A;  3CC2 T;  4LDV A;  3NEN A;  3OS0 A;  1BI3 A;  1VQ9 A;  4M7D A;  4CH6 A;  2D0Q B;  5CKB A;  4KUI A;  4YDQ A;  1BI1 A;  4IUU A;  3OMG A;  2BKD N;  1SRY A;  3DSQ A;  2ART A;  5CIU A;  1B76 A;  3E19 A;  3FEO A;  1BBW A;  3MF2 A;  4H2V A;  3JCM X;  4UP8 A;  1FX7 A;  3MP6 A;  3S3N A;  3TEH B;  2LDM A;  2XG8 D;  3M4Y A;  4BI8 B;  1X55 A;  2EAY A;  4ZN1 A;  2DQ3 A;  4DOW A;  2HAX A;  2XHC A;  3CCJ A;  1P92 A;  3NEM A;  3P8H A;  2ZZG A;  3PMT A;  4ATO A;  4P73 A;  4XU0 A;  3R6O A;  2M0O A;  4MZM A;  1M1G A;  1QF6 A;  4M7D C;  1VQ4 A;  1VQ4 T;  4JS5 A;  3A32 A;  3L2U A;  4FU6 A;  3FIF A;  5CK9 A;  1VQO A;  4YTL A;  1VQO T;  2ZPI B;  2DD5 A;  4P3O A;  4M78 D;  3HRI A;  4YRG A;  2V8K A;  2EFI A;  2GCX A;  2RHZ A;  3GOX A;  4BUG A;  3QO7 A;  1M1F A;  5GAN d;  4M7A D;  3VQX A;  5GAM g;  4RCB A;  2XDD A;  1USY C;  4OB2 B;  1ASZ A;  4JJN K;  3RL6 A;  3RMS A;  4IUT A;  2Q5I A;  2J3M A;  4H02 A;  1QW1 A;  3DLM A;  1VQL T;  1KG1 A;  4HA8 A;  5FU6 B;  1YIJ T;  3A7A A;  3OYN A;  4XTW A;  4M7D G;  2C06 A;  1YHQ A;  1YI2 T;  4M78 G;  3TUP A;  4HVC A;  3CCS A;  3RES A;  4YP0 A;  3OS1 A;  5FRO A;  3VQV A;  1W2B S;  3CBO A;  2WSC E;  3DB3 A;  2XDP A;  4N0A C;  1EIY B;  5GMK e;  1JRI A;  2I4N A;  3CMA T;  3CMA A;  3HRK A;  2LVM A;  4ELZ C;  2DU5 A;  4V2S A;  2ZIN A;  1M9S A;  3MHX A;  4UC4 A;  3SDZ A;  1NJ6 A;  5GAN 2;  1VQ8 A;  4PL6 A;  1VQ8 T;  2I4M A;  3JCM J;  1W66 A;  3MO8 A;  3JCM g;  2P0K A;  4XTU A;  4LVJ A;  1YIT A;  5KH6 A;  2LTO A;  2QDY B;  2Y90 A;  2Q5H A;  2ZIM A;  4M77 C;  4YRP A;  4Y91 A;  4HT8 A;  1VQM T;  3BDU A;  3QTC A;  2K3X A;  3V8J A;  1KD1 U;  4OB0 B;  4YRJ A;  5CKH A;  1LOJ A;  2ZCF B;  3TEE A;  2DDZ A;  3G4S T;  1UGQ B;  2LCL A;  1N9W A;  4P71 C;  3ZBD A;  5CO7 A;  3FRN A;  2L5Q A;  3M4G A;  5GAM h;  2FYK A;  2DZ9 A;  2IG0 A;  4F7U G;  4BY6 B;  2ARS A;  4ZGD B;  2FL7 A;  1QVF S;  4E7K A;  2XDB A;  3DLL A;  4M75 F;  2LRQ A;  2JOY A;  2LC4 A;  1BBU A;  5CR2 A;  1SET A;  3G1Z A;  1VQ5 A;  4VUB A;  1UB4 A;  1YCY A;  4WI1 A;  1I5L A;  3E9H A;  3LWH A;  5I2M A;  2MWO A;  3G6E T;  1ATI A;  1AHJ B;  4XAX B;  2OTL A;  4FL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...