2DZCA

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
222
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGSPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 222
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dzcA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dzcA01
3JCMd 4N0AA 5GMKj 4TTVA 1E24A 2ARTA 2RHQB 3RGLA 3CMQA 3HXVA 2AKWA 1EOVA 2ZT6A 2AKWB 4RQFA 4NCXA 3JCMe 1KOGA 3V7SA 4H2TA 3REXA 3R07A 4M7DF 4KR2A 4G85A 1B7YA 4C92E 1FYFA 3W3SA 1LOJA 1YGBA 1B7YB 3HFZB 4RMFA 1N9WA 2ZNJA 4RCCA 4M78A 2CJ9A 4M78B 4G84A 3JB9J 2E65A 4K86A 4HA8A 4ZTZB 3A7RA 4DQ2A 4CS2A 2VXFA 5F5WA 2ODRD 2E1HA 2ODRC 4F7UE 1Y96A 2Q5IA 4EMHA 1Y96B 4L87A 1Z7MA 3HXYA 2Y90A 4PJOE 1KQ2A 2ZZFA 2P0LA 3HXXA 5ELOA 4PG3A 4P73C 1B76A 4XEMA 1E1TA 4TQFA 3MF1A 1U1TA 3L2ZA 2K57A 3PZCA 2E5AA 3UH0A 5KNNA 4C92G 2DTHA 3JCMJ 1M5Q1 4M7DA 4KR3A 3HY0A 1ATIA 4M7DB 2ZIOA 3V8JA 3V7CA 3PGGA 5GAN5 4YRJA 2ZCEA 2DU7A 3QO7A 4F7UG 3L1AA 2HNIA 4P3PA 2ZZGA 4X9DA 3HFOA 3VBBA 1X54A 2QHSA 2VXEA 4WI1A 4P75C 4WF2A 5GAMg 1SRYA 4P74C 3ERRA 5GAMj 4M75B 3JCMQ 1QF6A 5GAN7 2DU5A 3BFMA 1JJCB 2AMCA 2AMCB 3A74A 1WNLA 1ASZA 1QE0A 2I4MA 3HXUA 1ADJA 4XU0A 2DTIA 4J15A 1KMNA 4YCWA 4J6WA 2EJGA 2XTIA 5LJ5h 3KFUA 1H641 4F7UF 2CIMA 4KQEA 1C0AA 3HY1A 4HWPA 3REUA 5C53B 1KMMA 4YRRA 4YDQA 1G5IA 3JCMW 1HTTA 4XQ3A 3VQVA 4JRIA 2J3MA 4JUVA 3NENA 4Y91A 4P71C 4YRCA 3VQXA 4MMKA 4RCBA 5GMKh 2CGHA 5GANh 3SWNC 4P3OA 4C8QD 1NJ5A 4C8QC 1X01A 4XTZA 2QTXA 3INZA 2QHTA 3JB9D 4C92A 2ARUA 2ZINA 1YFTA 4C92B 3A31A 2DDZA 1SESA 1SERA 1KQ1A 4RDXA 5LJ5g 2J3LA 1PYSA 3I7FA 5LJ5j 1B70A 1PYSB 1E22A 3JB9I 1B70B 3HSBA 2ALYB 4F7UA 2DEQA 1G51A 4M77D 4F7UB 1BIAA 4M77C 4H2WA 1H4TA 4YRNA 1D3BA 1M8VA 1H4VB 3IKLA 3HFNA 4PJOB 4EMGA 5GANg 1ASYA 3L4GA 2RHQA 5GANj 3L4GB 2ZZEA 4M75G 4K87A 3VQWA 5GAN3 1ADYA 1VQZA 3HFVA 4XU1A 1B8AA 3JCMb 2CJAA 4HWSA 4C8QE 3HFZA 4QVDA 2JN0A 3P8TA 2EL9A 4RQEA 3GIBA 5LJ5d 5K1PA 1HXDA 4XTWA 1H4SA 3QO3A 2E41A 2DJZA 3JB9H 4M75F 2YLBA 4M77E 4TVAA 1L0WA 4QVCA 3M4PA 3QO8A 4TVAB 1NYQA 5GAN6 3JCMP 1NYRA 4HVCA 5GAMh 2DTOA 5GANd 4XTUA 3LSQA 3V8LA 1SETA 1I81A 3QHSA 4C8QG 1YCYA 4JRKA 2E64A 3TEHB 3JB9G 2PMFA 3A5YA 5GMKe 4CH6A 1HK9A 3OD1A 2DKGA 4UP8A 2DQ0A 4XU2A 4UP9A 4CS3A 3G1ZA 1RIQA 3NEMA 2E3CA 1H4QA 4Q15A 5C52B 4YROA 4YREA 1NJ1A 4PJOG 4M77G 1LJOA 4M7AD 4P72A 4M7AC 1EQRA 4K88A 5LJ3g 4M7DC 2EWNA 1YFRA 2ZT8A 1J5WA 5LJ3j 3P8YA 4M75A 5GMKm 4P75A 1N9RA 4YRSA 1JJCA 1USYC 4C8QF 4HWOA 4PNOA 4O2DA 4C92F 4P74A 2ZTGA 3RESA 2G4CA 1GGMA 3JB9F 3IKMB 2DZCA 1HC7A 1W66A 3TUPA 1X2HA 1NJ8A 3LSSA 2E10A 4WJ3M 5GAN2 2RD1A 2I4NA 3QUIA 4PJOF 4M77F 4TWAA 4H2YA 3DSQA 3V7RA 3FJPA 4ZTUB 3UGQA 1X55A 4P3NA 2VC8A 3JCMc 3RF1A 3BDUA 2RB6A 3RKWA 2ZT5A 2ZXFA 4EMKA 1WYDA 4EMKB 4XEOA 3SWNB 4M7AE 5GAOn 4C8QA 2DXUA 5GAMf 3HXWA 3TEGA 2EJFA 5GAMd 3M4QA 4C8QB 3RUXA 4M7DE 3JCMg 2EJ9A 3SB2A 4YYEA 3A7AA 5I21A 2C7IA 1Z7NA 5GAMe 2ALYA 4CH3A 3EFSA 3HXZA 2ZR3A 4HWTA 3RL6A 3BJUA 1G5HA 2DQ3A 4X5OA 2I2LA 4PJOA 4M77A 3E9HA 4M77B 4YRKA 3RERA 5GMKi 3NETA 4J6XA 4HT9A 4M7AG 1E1OA 2RA2A 1JRIA 1BBWA 1BBUA 2RHSA 2IY5A 2RHSB 3A5ZA 2IY5B 4MMLA 1I8FA 2I4LA 2EAYA 2Q7HA 2DVEA 4J6YA 2Q7EA 4N0AC 3UGTA 3A32A 3NELA 4JLIA 4YCVA 2I4OA 5LJ5f 5GAOq 3QTCA 4YRMA 4UPAA 4CS4A 4H2UA 3E9IA 2CJBA 4YRGA 2RM4A 5GMKl 1EFWA 4V2SA 2DXTA 3HTZA 1WLEA 4M7AF 3ICAA 5LJ5e 4J5YA 4H02A 2ZNIA 1NJ6A 5LJ3h 5ELNA 4M78D 5GANf 4M78C 1B34A 3UFGA 1B34B 4XU3A 4P73A 4A54A 5GAOm 3MEYA 4Q6GA 1LYLA 3VQYA 2Q7GA 4OLFA 1I4K1 3TEHA 4NL2A 1WQWA 1X56A 3V8KA 12ASA 4ZIBA 4LNSA 3RIRA 1X2GA 2YHTA 5GANe 2P5IA 4EO4A 2ZIMA 4YRTA 2XGTA 4UP7A 2FB7A 1N9SA 4YCUA 1EVKA 4DPGA 5GAOp 1YFSA 5K1XA 4CH5A 4YRQA 4YRLA 3AHUA 3IALA 3IG2A 1I5LA 4E51A 4M7DD 3RKXA 3BY7A 4XTXA 4M7AA 4M7AB 4YP0A 1MGQA 2DZ9A 1WQ7A 1NJ2A 5CAIA 1YB3A 4TVYA 3HRKA 1USYA 2FYKA 3M4GA 1WPYA 5E3IA 4P72C 4HT8A 4H2XA 1IL2A 3JCMh 3PCOA 4M78E 4NL3A 3MF2A 4H2XB 3PCOB 2YLCA 4YRFA 4M75D 4M75C 2ZR2A 3FIFA 3LC0A 4H2VA 1TH7A 4A53A 2C8MA 2QHUA 2ZT7A 5DY9A 3JCMV 1NNHA 3QO5A 2Q5HA 1JBMA 4OP0A 4P71A 3EFRA 2ZGWA 1EVLA 3SWNA 5LJ3f 11ASA 5LJ3d 4BWAA 4M78G 4X9CA 5GAN8 3HRIA 3BW1A 4XTYA 3RACA 5LJ3e 1EIYA 5GAOr 1EIYB 4PHCA 4EMKC 1BIBA 4TVWA 3QNEA 4YRPA 4EX5A 5C51B 4C92D 2PMEA 4XTVA 4C92C 4WJ4A 4AH6A 4BW9A 4M75E 5GAOl 4YPFA 3A7UA 1LNXA 4H2SA 4M7DG 5GAN4 4M78F 1WU7A 4TQDA 3QSUA 4NOYA 3VU3C 4YRIA 4HWRA 4PJOD 3FB9A 4PJOC 5HGQA 2ARSA 3P8VA 3WQZA 1D3BB 2QHVA 1U1SA 3JCMf 3RKYA 4CH4A 3JCMX
chains in the Genus database with same CATH superfamily
1K8AC 4N0AA 1AZGB 1OPKA 2CH4A 2PUKB 4OVAA 4OGEA 3RGLA 4LDWA 2C0IA 1EOVA 2MI6A 2ZT6A 2COZA 3NTKA 1QVGP 2VYTA 4H2TA 3OYYA 1TU0B 3L2RA 2X4YA 1XQHA 4IUPA 2KK4A 1VQOA 4G85A 2ZZDA 1VQ6Q 4RTUA 1VQNQ 1M1GA 1LOJA 4KUIA 3HFZB 1N9WA 2CKKA 4KBMB 1PRLC 2VGNA 4OMMA 4G84A 3JB9J 3WVDB 3RBBB 1Q86R 3EG2A 1YNZA 2DA9A 2E1HA 2ODRC 4F7UE 4EIKA 2EPDA 2Y90A 1MUZA 2ZZFA 2P0LA 4P73C 4LN2A 3A98A 4MZTA 3MF1A 3L2ZA 3X28B 1D0YA 3EFOA 4C92G 4ZTJA 3EFOB 3JCMJ 2HQXA 3M55A 4FW1A 2FRWA 4FYVB 4M7DA 2QQBA 3ZEHA 3I9QA 4M7DB 2FPFA 3VYGA 1BU1A 2L0AA 2DU7A 3GPLA 1U8RA 2JTFA 3L1AA 1Y71A 2HCKA 3CC7A 3UDCA 2VWFA 3GLXA 4P3PA 1QP2A 2LX7A 5KH6A 3CMEQ 1X54A 2QEXA 1NYFA 1JEGA 1K8AU 4P75C 4EPCA 5GAMg 4P74C 3CEYA 4M75B 2J7IA 2DYBA 3J81E 1YJWT 2VASA 2LT4A 1OX9A 2OAUA 3A74A 2X3WD 1ADJA 4J83A 2QGFB 4L6V5 1WHMA 4LDVA 4IUUA 4J6WA 2XTIA 2EYZA 3TCJA 4F7UF 2I0NA 4D6WA 4HWPA 2CZ1B 2MYSA 4JS5A 5C53B 1KMMA 3LGFA 1NZ9A 2LJ0A 4JRIA 1VQ7T 2J3MA 4JUVA 2JXBA 4Y91A 2M16A 3VQXA 4Z8AA 3GNGA 2BZXA 1YWPA 4XTZA 2QTXA 4C92A 2ZINA 4RKUE 4C92B 1YFNA 4A4EA 2EKHA 1V1CA 1ZHIA 1A0NB 1HSQA 1KQ1A 1BI1A 5LJ5g 1PYSA 1B70A 1PYSB 1E22A 1B70B 1YHQT 1TUGB 2DEQA 4ESRA 1BIAA 1H4TA 4YRNA 5CR2A 1R8OB 2A0FB 3IKLA 3L42A 4PJOB 1RABB 3SD4A 2OI3A 1M1KC 4F14A 1FX7A 1BI3A 5GANj 1YWOA 4WTOB 2ZZEA 5FRMA 3H0FA 3EGDA 2COYA 2DF6A 3HFVA 3EGDB 4ELYC 4FU6A 3M54A 3M0UA 3FC3A 1N8RU 4QVDA 1H3ZA 2EL9A 2A37A 4RQEA 1T3LA 1HXDA 4QQGA 4CC7A 2L3QA 2HBPA 4XTWA 3M5AA 2XHCA 4BB7A 3L2QA 2D6FA 4YTLA 5I11A 3JB9H 4TVAA 2DEUA 3M4PA 2DRKA 2XG8D 4TVAB 1AWXA 1NYRA 4HVCA 3PVQA 5EC7A 2DTOA 2JM8A 1VYVA 2GF7A 2J6OA 1GRIA 1K76A 1RAHB 2WACA 2CP0A 2PMFA 4CH6A 1HK9A 3OD1A 2DKGA 2QG9B 2DK3A 4XU2A 2ROTA 2BZYA 3P8HA 3PIOA 3G1ZA 1H4QA 3CCEA 1K9MR 2A28A 5C52B 4YROA 2X51A 3LW5E 3QKJA 1WA7A 1NJIR 5I2MA 2LX9A 3KBGA 1UGRB 1EQRA 3CBPA 3VRYA 5LJ3g 3E1SA 4P75A 3L2UA 4YRSA 2DD4A 4PNOA 1ABQA 2QI2A 4P74A 1O75A 1GGMA 3IKMB 1KHIA 2AKLA 1W66A 5CKBA 2RHIA 1UHCA 3CC7T 3LSSA 1RI0A 5D7UA 1MMNA 1RAEB 4PJJA 5HY6A 5GJVB 2QEXT 1RI9A 3MP1A 3OS1A 2K2MA 3DSQA 2O31A 1RAGB 2R57A 5FU6C 1X75C 1M3AA 8AT1B 1RADB 2HQHA 2K5FA 3X25B 3UGQA 3TEEA 2FZCB 3CD6Q 4P5NA 1WJSA 1AWOA 2KXCA 3OYEA 5GAOn 1PM3A 1YITQ 1NM7A 1D0XA 3GF5A 2XMFA 4YYEA 1PHTA 1WXBA 1Z7NA 3QXEB 2M02A 1QVFS 1Q82U 2WSFE 1M1FA 3HXZA 1R77A 4FT4A 2YRDA 1WGSA 3ME9A 1WX6A 3ZL7C 4KGVB 3OYFA 3E9HA 4OB2B 4YRKA 4FYWB 1Z9ZA 5IXBA 3MEAA 1E1OA 1QKXA 2RA2A 2DMOA 2RHSA 1I07A 2RHSB 1PKTA 1W1FA 1YJ9Q 2KROA 1WHLA 2Q7EA 4PFOA 4RMOA 3OS2A 2V8JA 3C4SA 4IIOA 3A8OB 1VYUA 4ZGJB 2MOXA 3U23A 1VA7A 4UPAA 1WXUA 2MWPA 3G71A 5CKFA 2AIRB 3JRZA 4GY5A 1YJNQ 1T0HA 3VUBA 3M0QA 1S72Q 4J5YA 4H02A 2RQTA 1HYOA 1EIFA 3VV0A 4RTXA 1VQKT 3UFGA 1QLYA 3HPWA 3MEYA 2P0QA 4C0GA 2Q7GA 4OLFA 2PVDB 4AT1B 3CXCP 4C5HA 1KC8C 1VQLA 4LNSA 3RIRA 1X2GA 5GANe 4EO4A 2ZIMA 2XGTA 5IN1A 1M3CA 4YCUA 1EVKA 1IGQA 2QK0A 4AFQC 3TREA 3OYGA 3CCQQ 3S3OA 4XK8E 3Q1JA 2RI5A 3I5SA 3QYGB 4AFSC 4M7DD 2HDAA 3BY7A 5I2SA 5ECAA 2QYZA 2H8HA 5FWBA 2DZ9A 3VS0A 2E4HA 1ABOA 4TVYA 2KGTA 3QIIA 1I5OB 4PJMA 1SEMA 1WPYA 2FVUA 1IHWA 2PVOB 2VGMA 4OB0B 4IUQA 3PCOA 1EX4A 3PCOB 1W2BS 4M75D 2JT4A 2FHDA 1U3OA 2QQAA 1NG2A 1TH7A 3CPWS 4OMQA 2K5LA 1KFZA 4GLMA 5KCOA 3KFVA 5FU6B 4P71A 2CT3A 4GLKA 11ASA 2LC4A 3N5BB 1BBZA 3DLLA 2ZPHB 3T9NA 4O6JA 1VQPA 1BYMA 1KC8U 1SHGA 5CCAA 1VQ8Q 2DBMA 3QNEA 3FLGA 4EX5A 4C5GA 4PFZA 4JZ3A 4C92D 1VQ5Q 2HAXA 2AT1B 3JAME 4BW9A 1QVGS 2XI9A 4M75E 2DL8A 1M1KR 2MF2A 5IHNA 1JJ2A 2DRMA 3LYIA 2WSCE 2NUTA 2L3SA 2NUTB 1QW1A 4NOYA 4KGXB 2LQ8A 3PT9A 4PJOD 2W0ZA 2GGRA 3FB9A 5D6XA 2ARSA 3P8VA 2WSEE 1UJYA 4QT7A 1U1SA 4L59A 3JCMf 2AK5A 3JCMX 1WHKA 4BACA 5GMKj 3UT1A 4TTVA 3SFMA 2ARTA 2IIMA 1M4ZA 2YRVA 3CMQA 3HXVA 2DLPA 2RQVA 1E7OA 3EG3A 2JVVA 3REXA 3WVEB 5CQXA 4ZGDB 1H3HA 2L3RA 2ED0A 5J39A 4M7DF 4KR2A 2JTEA 4C92E 3E9GA 1Q7YR 2M0OA 1YGBA 4RMFA 1WXTA 2V8IA 3PNWC 4RCCA 3OBWA 3C95A 3HRTA 4J8OA 1VQ4Q 2ODRD 1Y96A 4N4GA 1Y96B 3O5ZA 3G71T 4OMPA 2CSQA 3CCJA 4F16A 2H3JA 2O88A 3HXYA 4BI8B 4PJOE 4E7KA 1MNDA 3CC4A 4XEMA 2KDSA 1E1TA 4TQFA 1GFCA 1SF9A 3EH2A 3META 3HRSA 2E5AA 3EH1A 3H0HA 3M0RA 2X35A 2PQWA 1VQLT 3HY0A 1GL5A 4BD3A 2ZPGB 3V8JA 1VUBA 1G3TA 4YRJA 4D8KA 1VQMQ 1W2BA 1BB9A 2HNIA 1MMAA 2ZZGA 1F1BB 3HFOA 4AFUC 4LDYA 2E3IA 1KD1U 2MWOA 3QZ5B 5FW9A 4DA4A 5GAN7 4FT2A 2DU5A 1JJCB 1G2BA 1WNLA 1QE0A 4M4ZA 2DAQA 3VS3A 4J15A 1KMNA 3TSWA 4LVMA 4PLLA 3WXMB 2EJGA 4FL6A 3OYMA 2EFIA 1RLQC 2DVJA 2OTJQ 3HY1A 2M1HA 2AZVA 5A2QE 1AHJB 4HCZA 3OYAA 1HTTA 4XQ3A 3CCUQ 1K1ZA 5IH2A 2RJCA 4OMOA 4R55A 4MMKA 5GMKh 3HRUA 2ZAEA 2RH2A 4P3OA 4C8QC 1VQKQ 4ZNXA 2QA4Q 2QHTA 3OW2A 1YBYA 4FW2A 2ARUA 1YFTA 1FMWA 1SERA 1VQPT 3CC2Q 2GTOA 1KQSP 1ZUKA 5L8RE 2COWA 2FZKB 3HSBA 4AFZC 2ALYB 3GBQA 4M77C 2JZ2A 3HP9A 2CP2A 2E6ZA 2K3XA 4EMGA 4J9HA 5GANg 3L4GA 1Z9QA 4ZGEB 3L4GB 2F2VA 5CO7A 4M75G 4K87A 3KUFA 2O2OA 1VQZA 2F1LA 2LMJA 2V26A 2LCLA 2X4WA 3CBOA 4J9CA 2QAZA 4E7SA 4OB3B 3JCMb 2CJAA 3REAB 4A63B 1M30A 3HFZA 3UA7A 1G8XA 3A1PA 5LJ5d 4IKFA 2LJ3A 5K1PA 1IRXA 5CIUA 1AEYA 1XOVA 2E70A 3G4SQ 2E41A 3M9QA 1M90C 1P92A 2CSIA 4J7IA 3CCMA 2O4XA 4JPBW 1N5ZA 2O4XB 4QVCA 2LT1A 2RF0A 5GAN6 3G6EA 3JCMP 3LSQA 1PD0A 1SETA 1V29B 2P0KA 4C8QG 3PTAA 3LWHA 2PU9B 2HMAA 3TEHB 3CCVQ 2NUPA 2GTJA 5GMKe 2NUPB 4N4IA 1FWZA 1NLOC 4UP9A 4CS3A 3PMIA 1WJQA 4Q15A 2XDBA 3CCJT 1KSWA 3I56A 4YREA 4PJOG 4M77G 4P72A 4M7AC 2CUBA 3OQ5A 1OI1A 4K88A 5M9OA 1YFRA 1J5WA 3EG1A 3CCSQ 3P8YA 4M75A 3CCRA 2D0QB 3REBB 3SEMA 1CKBA 2LNVA 4O2DA 2EQJA 2R58A 5CQYA 3GP8A 3RMSA 3F70A 1FYNA 3PVLA 2DZCA 3TUPA 1N8RC 2F5KA 1NJ8A 4NS5A 1PWTA 4CRIA 1BK2A 3EGUA 2EW3A 4BDZA 5L23A 4DOWA 1R0BG 2KRSA 2I4NA 2G6FX 3VS1A 3QWYA 2CUDA 4FSSA 4KH1B 1NYGA 1SSHA 1U5SA 4A4GA 3KXTA 2DO3A 4ZTUB 5A0LA 1M90U 4P3NA 2V8KA 4QQDA 3RF1A 3BDUA 4CC4B 1OOTA 4C8QA 2DXUA 5GAMf 2K79A 1VQ9A 4C8QB 2EJ9A 1LVKA 2LQNA 4JZ4A 3A7AA 1N6AA 2KYMA 5I21A 2C7IA 3X26B 2ZPIB 4Z02A 3MEWA 3SDZA 4JS4A 4N4HA 2IG0A 1ACMB 3GOXA 2RHXA 2DD5A 3I35A 1QWEA 2JJ9A 3VS5A 4KT0E 3OSVA 3QJ6A 4FM4B 1FMVA 4PJOA 4M77A 2ZPFB 2XDPA 2BUDA 1NPPA 4M77B 3DB4A 5GMKi 3NMZC 4J6XA 4HT9A 1X6BA 4M7AG 2KSSA 1N27A 3VRZA 3NFCA 1BBWA 2IY5A 2A36A 2DL4A 2CREA 2IY5B 4BI3A 2ZCFB 1PSEA 2EAYA 1AWWA 2EGAA 2Q7HA 1Q95G 3ZFJA 3UF4A 2F2XA 2QDLA 5KE2A 3LH5A 3UGTA 3OMGA 4YCVA 2LCSA 5LJ5f 5GAOq 3QTCA 2K5IA 2JMAA 4H2UA 2CJBA 4YRGA 5GMKl 1D1BA 2C0OA 2DXTA 1SG5A 1IZ6A 1HD3A 1WLEA 5CKHA 2K9GA 4HVUA 3ICAA 3OS5A 3EHRA 2FG0A 4KUDK 5FRNA 4MZMA 3P8BB 1VQOT 3MKDA 4P73A 4A54A 3OSSC 3OYDA 1LYLA 4PJLA 2DL7A 4ZIBA 4NL2A 1WQWA 3V8KA 2EBPA 1FXXA 3H0IA 1JQQA 2OTLA 3QJYA 2HKQB 1Q82C 1YI2A 1LCKA 3I55Q 4DPGA 3M4YA 2DETA 1OEBA 1PD1A 3CCMT 4PLIA 2ED1A 2PTKA 3G6ET 4BE1A 3CCLQ 4HXJA 1ZUYA 4E51A 3I5RA 4M7AA 4M7AB 4YP0A 3CMAQ 1YB3A 1NJ2A 1RACB 3HRKA 2XIDA 2ENMA 1VQ6A 1VQNA 2E5KA 2L2PA 1YIJQ 4H2XA 3LGLA 4NL3A 4B6MA 2EGEA 4H2XB 4LVKA 3I56T 4ORZA 4YRFA 3PMTA 4DOVA 4J9GA 3FIFA 1UHFA 5DY9A 1NNHA 1QCOA 1UGVA 3QO5A 3CCRT 2K3BA 2Q5HA 3FRNA 2OX7A 1XNIA 4ZN1A 2QASA 1JBMA 2CP7A 4E7LA 2M51A 4HCBA 1C6VX 2IVWA 2AKKA 2CDTA 4ME7A 5LJ3f 2E5QA 4BWAA 4OMNA 1BI0A 1ZQ1A 3M56A 4QKUA 4A4FA 2J6FA 1Q81U 2YT6A 2L5QA 3P8DA 1EIYA 1SKUB 1EIYB 5AYFA 2JS2A 3QYHB 1U06A 2FZGB 4EMKC 2DILA 5KYNA 1GBRA 2XICA 5C51B 3A8MB 3CMEA 4XTVA 2JMCA 4WJ4A 4AH6A 5CK9A 4DBRA 5GAOl 4Y92A 1PC0A 1K8AR 3A7UA 1VQ9T 4GBQA 1LNXA 5GAN4 3URGA 3PE0A 3VU3C 5IT9E 5LL6S 2FRYA 1D3BB 2P4TA 3A5YA 3JCMd 4LE9A 2JNGA 2LJ1A 1E24A 2RHQB 6AT1B 1TOVA 4RTTA 2AKWA 1G3WA 2AKWB 2KYBA 2F69A 1YJWQ 4NCXA 4FSXA 3MQZA 3R07A 4LD6A 2GFUA 1K4US 3FEOA 2KT1A 2DJQA 1LPLA 2ZNJA 2BKDN 3OYKA 4VUBA 1K73U 5KYXA 3S6WA 2KQWA 5KYXB 1MV0B 1QMCA 4F17A 4DQ2A 4CS2A 2VXFA 1QVPA 3NTHA 5F5WA 1VQ7Q 4OF1A 1TG0A 2Q5IA 4L87A 1Z7MA 4RTZA 2HZYA 5HK0A 3VS4A 1KQ2A 3CPFA 1WDXA 4L5GA 5ELOA 4PK4A 3UA6A 2D0NA 3HTRA 1FMKA 3THKA 4RG2A 2CP6A 2K57A 3PZCA 3UH0A 1KHCA 5KNNA 2RI3A 4RTYA 1YCSB 2DTHA 3CBMA 1Q86C 4Z89A 1M5Q1 2KI7A 4KR3A 2OTLT 2MIOA 2ZIOA 2R5MA 3V7CA 3PGGA 2FEIA 1YI2T 1IREB 1E6HA 3RNJA 4MDXA 1YHQQ 1D1AA 2ZCEA 3QO7A 1B7TA 1W4SA 3NPFA 3X20B 3UPUA 3CCET 3VBBA 1N8RR 2RJFA 2VXEA 2B8AA 1OQKA 3VS2A 1OU9A 4WI1A 4WF2A 1AT1B 3JCMQ 1QF6A 1QP3A 4F04B 3BFMA 2AMCA 5KYYA 4R56A 4ZTFA 2AMCB 5KYYB 1KIKA 4LVIA 4PKCC 2DTIA 1I1JA 4E7IA 1OZ3A 4RUGA 1VQ6T 1VQNT 2EYYA 1Y07A 5DLOA 5LJ5h 1KQSS 1H641 2CIMA 4KQEA 3ZBDA 2NWMA 2A08A 1SRMA 1QVFA 1PKSA 3VYHB 2VV5A 3VQVA 5IHIA 2PZ1A 3NENA 5J3BA 2GNCA 1WHGA 1X2QA 2XD0A 1KG1A 2YDLA 4YRCA 1BI2A 4RCBA 3ASKA 2CGHA 2YUPA 1GCQC 3SWNC 5FROA 4C8QD 1NJ5A 2CP3A 4Y28E 3INZA 3H6ZA 2K2VA 2VVKA 2PVGB 2K4YA 3A31A 2DDZA 4LVLA 1SESA 4IIMA 1Q86U 4RDXA 2J3LA 4CC3A 4CI0C 4OB1B 1QKWA 1VOMA 2A3LA 2SRCA 4A4HA 4M77D 1XTDA 4X34A 2HL3A 1KD1C 3C0CA 2X9HA 4E2FB 2D1XA 3HFNA 3CMET 4C5IA 1ASYA 2DL5A 8ATCB 3EG9A 1QQJA 4ATOA 2P0PA 4K11A 1WHHA 2HL5C 3EG9B 5GAN3 2C0TA 1K0XA 4C0DC 4XU1A 2KAFA 3CD6A 1B8AA 4HWSA 4C8QE 3CC7Q 1YITA 2DXCA 4PL6A 4R0KA 3JV3A 4JRPA 2QEXQ 1RAIB 2MMPA 1H4SA 2CP5A 4E7HA 3RMQA 1OV3A 1Q82R 1GFDA 2DJZA 4M75F 1IHVA 4LXCA 2YLBA 4M77E 1L0WA 3QO8A 1GBQA 2GBQA 1Y7XA 2P4RA 4E6RA 1WZOA 5GANd 1JJ2P 4XTUA 3V8LA 2X4XA 2IPOB 4J9EA 3BDLA 1I81A 3QHSA 1YCYA 5KE3A 2E64A 2LQKA 1D0ZA 3JB9G 3MPUB 1ZSZC 4AG2C 4ZN3A 1YJ9A 1RIQA 1O9SA 3VKIA 2EQIA 3EAEA 9ATCB 1E6GA 4HT4A 3LH0A 1NJ1A 3CPWA 1LJOA 4M7AD 3OB9A 4JRQA 4HVVA 1AZEA 4M7DC 2ZT8A 4DBFA 1NEGA 1SRLA 3QBYA 1N9RA 4EDUA 1YJNA 1JJCA 1USYC 2BE7D 3C94A 4C8QF 3TU4K 4C92F 4HWOA 2ZTGA 1X43A 1S72A 2KR3A 1JB0E 1K9MC 3ER0A 3RESA 2M9UA 1HC7A 1ZSGA 2ATCB 1X69A 2E10A 2MCNA 1B3QA 5D6WA 1QCNA 2NYSA 3J7AF 4LNPA 2RD1A 4AG1C 2DERA 1JXOA 3QUIA 1AD5A 2DXBA 1VQ7A 4PJOF 2YSQA 4M77F 4JLGA 4H2YA 1AOJA 2KE9A 2ABLA 3FJPA 1X55A 4IUVA 2LZ6B 3JCMc 3CCQA 3RKWA 1QVGA 3CQTA 1GCQA 1WYDA 5KCHA 4XEOA 3SWNB 2X3XD 4M7AE 3TEGA 4PJNA 1OU8A 5GAMd 3A8GB 3SB2A 3QG1A 2PNIA 1WFWA 5AT1B 2QDYB 2QGGA 1W2BP 2ALYA 4CH3A 4HWTA 1J3TA 2RO0A 4BE2A 3BJUA 4D8DA 1TTHB 2RHYA 1NLPC 3IQLA 4HCKA 4WCIA 3RERA 2BE9B 2LRQA 1G83A 1BBUA 4MZPA 1WIEA 3A5ZA 4MMLA 1ZUUA 1I8FA 2MAMA 3A5ZB 2X4JA 1TSFA 2DFUA 4J9IA 1K9MU 2DVEA 3DKMA 1KJWA 4C0DB 4IUTA 1TUDA 2PUOB 1NJIU 5IXFA 3A32A 4FYYB 4J9FA 5EG2A 3BE3A 4TVRA 5KYUA 2I4OA 5KYUB 4YRMA 2LCCA 2V1QA 1MNEA 1KC8R 1VQ8A 3HTZA 2B86A 1CSKA 4M7AF 2EYXA 2RK1A 2ZNIA 3OW2P 1VQ5A 4LDUA 3CD6T 1NJ6A 5GANf 4M78C 1B34A 1B34B 1H92A 1YITT 5HKCA 1OULA 3VQYA 1X27A 3W3SA 3TEHA 1M8MA 4RTVA 12ASA 4LUDA 3TSZA 1CKAA 1UE9A 2YHTA 2JM9A 4YRTA 2KBTA 2EGCA 1GXIE 2QTVA 1UGSB 2FB7A 5GAOp 1YFSA 1BKBA 4CH5A 1ZSZA 4HKEA 4J9DA 2F2WA 1ZSZB 2SEMA 5HCKA 3CC4T 2E12A 3AT1B 2XU8A 3EG0A 4XTXA 1Y0MA 4FIBA 1WQ7A 4KULA 1M27C 1YP5A 1USYA 2FYKA 1YJ9T 4BY6C 2HD0A 3R6OA 1OYXA 3JCMh 4HT8A 1IL2A 2DNUA 2YLCA 2DBKA 2MPXC 1AWJA 2JW4A 4H2VA 3NHNA 1WJRA 1EZZB 2C8MA 2QHUA 2ZT7A 1VQ4A 3DB3A 3JCMV 1YJNT 3R6NA 1ZBJA 1OX8A 2HBWA 1S72T 4OP0A 3EHQA 1TS9A 1EVLA 2H3EB 4OMLA 5LJ3d 2W10A 4M78G 1JXMA 1OZ2A 1M3BA 1M2OA 1NBEB 5CKDA 3RDVA 1VYTA 3DLMA 3BW1A 3OYJA 4E7JA 4XTYA 3RACA 1X2KA 2K6DA 5GAOr 2YUOA 1VQMA 1PNJA 1QWFA 3G71Q 2RQWA 3LX7A 1BIBA 2YUQA 4YRPA 3ULRB 1ZA2B 1X6OA 3MO8A 2PMEA 1KD1R 3CCQT 2QXFA 4BUGA 2LP5A 4II1A 2KMTA 2BTTA 2DPPB 2BIVA 4Z88A 1VQLQ 4H2SA 1WU7A 3QSUA 4C0FA 2RJDA 4YRIA 4CC2A 5HGQA 3RR6A 3CXCS 3WQZA 2KY9A 4ANJA 2QHVA 2OTJA 3M59A 5CVIA 4CH4A 3VUZA 4J7FA 2V1RA 1B07A 2RN8A 2BZ8A 3CCUA 3M0SA 4RQFA 3JCMe 5CKEA 1KOGA 3OYNA 3V7SA 1EFNA 1UJ0A 1PRMC 1SPKA 2EVRA 2CZ0B 1VQKA 1ZBXA 2EKOA 1PSFA 2J6KA 1B7YA 2EQKA 1FYFA 2QA4A 3OYIA 1B7YB 3VJPA 2L3PA 1T0JA 1XJWB 4M78A 2CJ9A 3G1JA 4M78B 2VB6A 2E6NA 2E65A 3CC2A 1Q81C 4K86A 4HA8A 4ZTZB 3A7RA 5KYWA 2RNAA 2RHZA 4EMHA 5KYWB 1VQ8T 3E19A 4UC4A 2HKNA 1TXQA 3HXXA 1Q7YC 4PG3A 1VQ5T 1B76A 2L8DA 2ROLA 4Q5WA 1U1TA 1UGPB 1NPRA 4O5VA 3G7ZA 1VQPQ 1H8KA 1ATIA 5FWCA 3QWXX 2J06A 1HJDA 2F5TX 2JTMA 5GAN5 1C1AA 1WLPB 1MMGA 2HSEB 4F7UG 5GJWB 4X9DA 1IO6A 2OAWA 4QVZA 3OYLA 4OGCA 4BY6B 2ZPBB 2QHSA 2VUBA 1M1KU 1SRYA 2D9TA 3ERRA 1WYXA 5GAMj 3G4SA 7AT1B 3TQ7P 2G3RA 1C0MA 2GCXA 1IGUA 1ASZA 2I4MA 3HXUA 4XU0A 4YCWA 1K73C 3VS6A 3KFUA 1C0AA 3CCVA 3REUA 3MJXA 3OYBA 4YRRA 4YDQA 1G5IA 3JCMW 3E2UA 2KXDA 1VQ4T 3S3MA 2RI2A 2CS7A 4P71C 1RLPC 4KH0B 5GANh 2NUZA 3OYHA 1X01A 3QPHA 1Q7YU 1WI7A 4RTWA 3JB9D 4PFPA 3OBYA 2FPDA 1G3YA 3CCSA 2EYQA 2CH4W 3C12A 2DIGA 2A7YA 3OS0A 3I7FA 5LJ5j 5C0MA 3QZ9B 3JB9I 4LD9K 3CXCA 2L89A 4E47A 4F7UA 1VQMT 1G51A 4F7UB 1VIFA 4H2WA 3CCJQ 1D3BA 1M8VA 1RAFB 1H4VB 3CC4Q 2YRCA 3EGXA 2ESWA 2RHQA 3EGXB 1T3SA 4HCCA 2RK2A 3VQWA 1TUCA 1UB4A 1ADYA 1JJ2S 1NE8A 2FPEA 1WHJA 1M90R 2FO0A 4B9WA 2EQUA 2CT4A 1VIEA 1M2VA 1UEBA 1UECA 1M2VB 3NGPA 2JN0A 2AHJB 4JJDA 2OTJT 3JSCA 3P8TA 4JJCA 1R0CB 3GIBA 1K0SA 2JOYA 1OPLA 1G3SA 1K9AA 2HEQA 3FDRA 2QQSA 2YUNA 3QO3A 3CCUT 2RPNA 5C6SA 2RJEA 3M0PA 2KT8A 3X24B 4J9BA 1NYQA 2A8EA 5GAMh 2QA4T 2P84A 3UATA 4JRKA 1TWBA 1UG1A 4BI4A 4E7ZA 2DE0X 3A8LB 3CC2T 3OY9A 4UP8A 2DQ0A 1S1NA 3NEMA 2E3CA 2LNHB 5HK3A 2C06A 5FU7C 1ZLMA 3HL8A 2K7AA 4JJNK 2ZPEB 2K3YA 2GQIA 2Y4YA 4IURA 2AZSA 2EWNA 5LJ3j 5FLXE 3H9NA 5GMKm 3GNFB 5J26A 1PG5B 3E9FA 2G4CA 3JB9F 2LQWA 2QQ9A 3OA6A 1X2HA 2DL3A 4DBQA 1IB8A 1ZX6A 2D8JA 2EIFA 4WJ3M 2LTOA 5GAN2 2D8HA 2RHUA 2O9VA 2Y4XA 5DM7R 4TWAA 1QCFA 1W6XA 3I55A 3V7RA 2KRMA 3G4ST 4DEXA 5A0GA 1W70A 4DEYA 1ARKA 5DLQE 3TVTA 2VC8A 2DM1A 4XAXB 2RB6A 4HVWA 2ZT5A 3CCLA 4EMKA 1VQOQ 2ZXFA 1NEBA 4EMKB 1UGQB 3HXWA 2EJFA 3M4QA 3QDRB 3RUXA 2QQRA 4M7DE 3JCMg 3CCVT 2HQEA 3CMAA 1D09B 1UFFA 5GAMe 2KEAA 3J80E 4RG8A 3EFSA 3PIPA 2ZR3A 1YIJA 2XDDA 3CCMQ 3RL6A 1D1CA 1G5HA 2DQ3A 3L2WA 4X5OA 2I2LA 2J05A 2CZ6B 3G6EQ 3MP6A 3M0TA 4ELZC 4BDYA 5A0DA 3NETA 2M0YA 2JS0A 3CCST 4C5EA 3PFSA 3OW2S 1JRIA 1SHFA 2R5AA 1GCPA 1DJ7B 2I4LA 1MHNA 1X6GA 4J6YA 4FYXB 4N0AC 2GFAA 1QVFP 3FJ5A 3I56Q 3HHTB 3NELA 4JLIA 2KVQG 1KK7A 2HSPA 4CS4A 3E9IA 3LWIA 4DBHA 1RL2A 2RM4A 1Q81R 3OYCA 1EFWA 3CCRQ 4V2SA 3M53A 2CYZB 1UDLA 1YN8A 3LLRA 5LJ5e 3HKSA 1G5VA 1JO8A 1V76A 5LJ3h 5ELNA 3S3NA 4M78D 4FCYA 2DX1A 3MHXA 4XU3A 2OJ2A 5GAOm 4Q6GA 1I4K1 1X56A 2YXYA 3UWNA 2XK0A 4OMFB 2LDMA 4QQ6A 2P5IA 4UP7A 1N9SA 1IXDA 5K1XA 3O8VA 1ZA1B 3D7SB 2GQVA 3VS7A 4YRQA 3QDFA 1PCXA 4YRLA 2MK5A 3AHUA 5FU7B 1I0CA 1UUEA 3NTIA 3IALA 5I22A 3IG2A 5IAYA 1I5LA 3RKXA 1VQ9Q 1MGQA 1YJWA 3MP8A 4X1VA 2YWWA 4MDWA 2E3HA 1RAAB 5CAIA 2RQRA 1BCMA 4JJBA 3M4GA 5E3IA 3M57A 3A8HB 1KQSA 2DYIA 2KRNA 4P72C 1NJIC 2LVMA 4M78E 3MF2A 1UTIA 2KNBB 2NLUA 2EYWA 1K73R 4M75C 2ZR2A 3LC0A 1SSFA 1MV3A 4A53A 2ECZA 2XKOC 2O01E 2O9SA 2NS6A 1RUWA 3H41A 2CZ7B 3MCAB 3EFRA 3MEVA 5IHKA 2ZGWA 3OMCA 3SWNA 1BCOA 4A4KA 2RMOA 1M9SA 1JU5C 4X9CA 5GAN8 3L2VA 4LDXA 4JDSA 3HRIA 2VKNA 4BE0A 5LJ3e 1MMDA 4KRTA 3I55T 1YHQA 4LVJA 3CPWP 4B9XA 2FL7A 4PHCA 3MEUA 4QW2A 4TVWA 5D6YA 1AVZC 4C0ZA 4C92C 2EQMA 3CCLT 1Y57A 4YPFA 2Z0WA 4AMCA 4M7DG 2OTLQ 2JUFA 2DIQA 4M78F 3CMAT 3H8ZA 4TQDA 3SHWA 1YI2Q 4HWRA 4KGZB 4LUEA 4PJOC 3CCEQ 1YIJT 3RKYA 3M58A 2RQUA
chains in the Genus database with same CATH topology
1K8AC 4N0AA 4OGEA 2PUKB 4OVAA 3RGLA 4LDWA 1EOVA 2MI6A 2ZT6A 3NTKA 2VYTA 4H2TA 3OYYA 3L2RA 2X4YA 1XQHA 4IUPA 2KK4A 1VQOA 4G85A 2ZZDA 1M1GA 1LOJA 4KUIA 3HFZB 1N9WA 2CKKA 4KBMB 2VGNA 4G84A 3JB9J 3WVDB 2E1HA 2ODRC 4F7UE 2Y90A 2ZZFA 2P0LA 4P73C 4MZTA 3MF1A 3L2ZA 3X28B 4C92G 4ZTJA 3JCMJ 2HQXA 3M55A 4M7DA 2QQBA 3ZEHA 4M7DB 3VYGA 2DU7A 3GPLA 1U8RA 2JTFA 3L1AA 1Y71A 3CC7A 3UDCA 3GLXA 4P3PA 1QP2A 5KH6A 1X54A 2QEXA 1K8AU 4P75C 4EPCA 5GAMg 4P74C 3CEYA 4M75B 3J81E 1YJWT 2LT4A 2OAUA 3A74A 1ADJA 4J83A 4L6V5 4LDVA 4IUUA 4J6WA 2XTIA 3TCJA 4F7UF 4D6WA 4HWPA 2CZ1B 4JS5A 5C53B 1KMMA 3LGFA 1NZ9A 4JRIA 1VQ7T 2J3MA 4JUVA 4Y91A 2M16A 3VQXA 3GNGA 4XTZA 2QTXA 4C92A 2ZINA 4RKUE 4C92B 4A4EA 1ZHIA 1KQ1A 1BI1A 5LJ5g 1PYSA 1B70A 1PYSB 1E22A 1B70B 1YHQT 2DEQA 1BIAA 1H4TA 4YRNA 5CR2A 1R8OB 3IKLA 3L42A 4PJOB 3SD4A 1M1KC 1FX7A 1BI3A 5GANj 2ZZEA 5FRMA 3HFVA 4ELYC 4FU6A 3M54A 3FC3A 1N8RU 4QVDA 1H3ZA 2EL9A 4RQEA 1HXDA 4QQGA 2HBPA 4XTWA 3M5AA 2XHCA 4BB7A 3L2QA 2D6FA 4YTLA 3JB9H 4TVAA 3M4PA 2XG8D 4TVAB 1NYRA 4HVCA 2DTOA 2GF7A 2WACA 2PMFA 4CH6A 1HK9A 3OD1A 2DKGA 2DK3A 4XU2A 3P8HA 3PIOA 3G1ZA 1H4QA 3CCEA 5C52B 4YROA 3LW5E 3QKJA 5I2MA 2LX9A 3KBGA 1UGRB 1EQRA 3CBPA 5LJ3g 3E1SA 4P75A 3L2UA 4YRSA 2DD4A 4PNOA 2QI2A 4P74A 1O75A 1GGMA 3IKMB 1KHIA 1W66A 5CKBA 2RHIA 3CC7T 3LSSA 1RI0A 5HY6A 2QEXT 3MP1A 3OS1A 3DSQA 2R57A 5FU6C 1X75C 2K5FA 3X25B 3UGQA 3TEEA 4P5NA 1WJSA 3OYEA 5GAOn 3GF5A 4YYEA 1Z7NA 3QXEB 1QVFS 1Q82U 2WSFE 1M1FA 3HXZA 4FT4A 1WGSA 3ME9A 3OYFA 3E9HA 4OB2B 4YRKA 3MEAA 1E1OA 2RA2A 2RHSA 2RHSB 2Q7EA 4RMOA 3OS2A 2V8JA 3C4SA 3A8OB 4ZGJB 4UPAA 2MWPA 3G71A 5CKFA 3JRZA 4GY5A 3VUBA 4J5YA 4H02A 1EIFA 3VV0A 1VQKT 3UFGA 3HPWA 3MEYA 2P0QA 4C0GA 2Q7GA 4OLFA 2PVDB 4C5HA 1KC8C 1VQLA 4LNSA 3RIRA 1X2GA 5GANe 4EO4A 2ZIMA 2XGTA 5IN1A 4YCUA 1EVKA 3TREA 3OYGA 3S3OA 4XK8E 3Q1JA 2RI5A 3QYGB 4M7DD 3BY7A 5I2SA 2DZ9A 4TVYA 3QIIA 2FVUA 1WPYA 2PVOB 2VGMA 4OB0B 4IUQA 3PCOA 3PCOB 1W2BS 4M75D 2FHDA 2QQAA 1TH7A 3CPWS 2K5LA 5KCOA 5FU6B 4P71A 4GLKA 11ASA 2LC4A 3N5BB 3DLLA 2ZPHB 3T9NA 4O6JA 1VQPA 1BYMA 1KC8U 5CCAA 3QNEA 3FLGA 4EX5A 4C5GA 4C92D 2HAXA 3JAME 4BW9A 1QVGS 2XI9A 4M75E 2MF2A 1JJ2A 3LYIA 2WSCE 1QW1A 4NOYA 2LQ8A 3PT9A 4PJOD 3FB9A 5D6XA 2ARSA 3P8VA 2WSEE 1U1SA 3JCMf 4L59A 3JCMX 4BACA 5GMKj 3UT1A 4TTVA 3SFMA 2ARTA 1M4ZA 2YRVA 3CMQA 3HXVA 2JVVA 3REXA 3WVEB 5CQXA 4ZGDB 2L3RA 4M7DF 5J39A 4KR2A 4C92E 3E9GA 1YGBA 2M0OA 4RMFA 2V8IA 3PNWC 4RCCA 3OBWA 3C95A 3HRTA 4J8OA 2ODRD 1Y96A 4N4GA 1Y96B 3G71T 3CCJA 3HXYA 2H3JA 4BI8B 4PJOE 4E7KA 3CC4A 4XEMA 2KDSA 1E1TA 4TQFA 3META 3HRSA 2E5AA 2X35A 2PQWA 1VQLT 3HY0A 4BD3A 2ZPGB 3V8JA 1VUBA 1G3TA 4YRJA 1W2BA 2HNIA 2ZZGA 3HFOA 4LDYA 1KD1U 2MWOA 3QZ5B 4DA4A 5GAN7 4FT2A 2DU5A 1JJCB 1WNLA 1QE0A 2DAQA 4J15A 1KMNA 4LVMA 4PLLA 3WXMB 2EJGA 4FL6A 3OYMA 2EFIA 3HY1A 2M1HA 5A2QE 1AHJB 4HCZA 3OYAA 1HTTA 4XQ3A 2RJCA 4R55A 4MMKA 5GMKh 3HRUA 2RH2A 4P3OA 4C8QC 2QHTA 3OW2A 1YBYA 2ARUA 1YFTA 1SERA 1VQPT 5L8RE 3HSBA 2ALYB 4M77C 2JZ2A 3HP9A 2E6ZA 2K3XA 4EMGA 5GANg 3L4GA 4ZGEB 3L4GB 5CO7A 4M75G 4K87A 3KUFA 1VQZA 3CBOA 2LCLA 2X4WA 4OB3B 3JCMb 2CJAA 3HFZA 5LJ5d 4IKFA 5K1PA 5CIUA 1XOVA 2E70A 2E41A 3M9QA 1M90C 1P92A 4J7IA 3CCMA 2O4XA 4QVCA 2O4XB 2LT1A 3G6EA 5GAN6 3JCMP 3LSQA 1SETA 1V29B 2P0KA 4C8QG 3PTAA 3LWHA 2PU9B 3TEHB 5GMKe 4N4IA 1FWZA 4UP9A 4CS3A 3PMIA 1WJQA 4Q15A 2XDBA 3CCJT 3I56A 4YREA 4PJOG 4M77G 4P72A 4M7AC 3OQ5A 1OI1A 4K88A 5M9OA 1YFRA 1J5WA 3P8YA 4M75A 3CCRA 2D0QB 2LNVA 4O2DA 2EQJA 2R58A 5CQYA 3GP8A 3RMSA 3F70A 2DZCA 3TUPA 1N8RC 2F5KA 1NJ8A 4NS5A 4CRIA 4BDZA 4DOWA 2I4NA 4A4GA 3KXTA 2DO3A 4ZTUB 5A0LA 1M90U 4P3NA 2V8KA 4QQDA 3RF1A 3BDUA 4C8QA 2DXUA 5GAMf 1VQ9A 4C8QB 2EJ9A 3A7AA 1N6AA 5I21A 2C7IA 3X26B 2ZPIB 4Z02A 3MEWA 3SDZA 4JS4A 4N4HA 2IG0A 3GOXA 2RHXA 2DD5A 4KT0E 3OSVA 3QJ6A 4FM4B 4PJOA 4M77A 2ZPFB 2XDPA 2BUDA 1NPPA 4M77B 3DB4A 5GMKi 4J6XA 4HT9A 4M7AG 2KSSA 1N27A 3NFCA 1BBWA 2IY5A 2IY5B 4BI3A 2ZCFB 1PSEA 2EAYA 2Q7HA 3ZFJA 5KE2A 3UGTA 3OMGA 4YCVA 5LJ5f 5GAOq 3QTCA 2K5IA 4H2UA 2CJBA 4YRGA 5GMKl 2DXTA 1IZ6A 1WLEA 5CKHA 3ICAA 3OS5A 4KUDK 5FRNA 4MZMA 3P8BB 1VQOT 4P73A 4A54A 3OSSC 3OYDA 1LYLA 4ZIBA 4NL2A 1WQWA 3V8KA 1FXXA 2OTLA 3QJYA 1Q82C 1YI2A 4DPGA 3M4YA 3CCMT 4PLIA 3G6ET 4BE1A 4E51A 4M7AA 4M7AB 4YP0A 1YB3A 1NJ2A 3HRKA 2XIDA 1VQ6A 1VQNA 4H2XA 3LGLA 4NL3A 4H2XB 4LVKA 3I56T 4YRFA 3PMTA 4DOVA 3FIFA 5DY9A 1NNHA 3QO5A 3CCRT 2Q5HA 3FRNA 1XNIA 4ZN1A 1JBMA 4E7LA 4HCBA 2IVWA 5LJ3f 4ME7A 2E5QA 4BWAA 1BI0A 1ZQ1A 3M56A 4A4FA 1Q81U 2L5QA 3P8DA 1EIYA 1EIYB 5AYFA 3QYHB 4EMKC 2XICA 5C51B 3A8MB 3CMEA 4XTVA 4WJ4A 4AH6A 5CK9A 5GAOl 3A7UA 1VQ9T 1LNXA 5GAN4 3URGA 3VU3C 5IT9E 5LL6S 1D3BB 2P4TA 3A5YA 3JCMd 2JNGA 1E24A 2RHQB 2AKWA 1G3WA 2AKWB 2F69A 4NCXA 4FSXA 3MQZA 3R07A 4LD6A 2GFUA 3FEOA 2ZNJA 2BKDN 3OYKA 4VUBA 1K73U 3S6WA 2KQWA 4DQ2A 4CS2A 2VXFA 1QVPA 3NTHA 5F5WA 4OF1A 2Q5IA 4L87A 1Z7MA 5HK0A 1KQ2A 3CPFA 4L5GA 5ELOA 4RG2A 3PZCA 2K57A 3UH0A 1KHCA 5KNNA 2RI3A 2DTHA 3CBMA 1Q86C 1M5Q1 4KR3A 2OTLT 2ZIOA 2R5MA 3V7CA 3PGGA 1YI2T 1IREB 4MDXA 2ZCEA 3QO7A 1W4SA 3X20B 3UPUA 3CCET 3VBBA 2RJFA 2VXEA 2B8AA 4WI1A 4WF2A 3JCMQ 1QF6A 1QP3A 3BFMA 2AMCA 4R56A 4ZTFA 2AMCB 4LVIA 4PKCC 2DTIA 4E7IA 1OZ3A 1VQ6T 1VQNT 1Y07A 5DLOA 5LJ5h 1KQSS 1H641 2CIMA 4KQEA 3ZBDA 1QVFA 3VYHB 2VV5A 3VQVA 3NENA 5J3BA 2XD0A 1KG1A 4YRCA 1BI2A 4RCBA 3ASKA 2CGHA 3SWNC 5FROA 4C8QD 1NJ5A 4Y28E 3INZA 3H6ZA 2K2VA 2PVGB 2K4YA 3A31A 2DDZA 4LVLA 1SESA 1Q86U 4RDXA 2J3LA 4CI0C 4OB1B 2A3LA 4A4HA 4M77D 1XTDA 4X34A 1KD1C 3CMET 3HFNA 4C5IA 1ASYA 4ATOA 2P0PA 5GAN3 4C0DC 4XU1A 2KAFA 3CD6A 1B8AA 4HWSA 4C8QE 1YITA 2DXCA 4PL6A 4JRPA 2MMPA 1H4SA 4E7HA 3RMQA 2DJZA 4M75F 2YLBA 4M77E 1L0WA 3QO8A 1Y7XA 5GANd 4XTUA 3V8LA 2X4XA 3BDLA 1I81A 3QHSA 1YCYA 5KE3A 2E64A 2LQKA 3JB9G 4ZN3A 1YJ9A 1RIQA 1O9SA 3VKIA 3EAEA 4HT4A 3LH0A 1NJ1A 3CPWA 1LJOA 4M7AD 3OB9A 4JRQA 4M7DC 2ZT8A 3QBYA 1N9RA 4EDUA 1YJNA 1USYC 1JJCA 4C8QF 3C94A 3TU4K 4HWOA 4C92F 2ZTGA 1S72A 1JB0E 1K9MC 3ER0A 3RESA 2M9UA 1HC7A 2E10A 5D6WA 3J7AF 2RD1A 3QUIA 2DXBA 1VQ7A 4PJOF 4M77F 4JLGA 4H2YA 3FJPA 1X55A 4IUVA 3JCMc 3CCQA 3RKWA 1QVGA 1WYDA 5KCHA 4XEOA 3SWNB 4M7AE 3TEGA 5GAMd 3A8GB 3SB2A 3QG1A 2QDYB 2ALYA 4CH3A 4HWTA 2RO0A 4BE2A 3BJUA 2RHYA 3RERA 2LRQA 1BBUA 4MZPA 3A5ZA 4MMLA 1I8FA 2MAMA 3A5ZB 2X4JA 1K9MU 2DVEA 3DKMA 4C0DB 4IUTA 2PUOB 1NJIU 3A32A 5EG2A 4TVRA 2I4OA 4YRMA 2LCCA 1VQ8A 3HTZA 4M7AF 2RK1A 2ZNIA 1VQ5A 4LDUA 3CD6T 1NJ6A 5GANf 4M78C 1B34A 1B34B 1YITT 5HKCA 3VQYA 3W3SA 3TEHA 12ASA 2YHTA 4YRTA 1GXIE 1UGSB 2FB7A 5GAOp 1YFSA 1BKBA 4CH5A 4HKEA 3CC4T 2E12A 2XU8A 4XTXA 4FIBA 1WQ7A 4KULA 1USYA 2FYKA 1YJ9T 4BY6C 4HT8A 2HD0A 3R6OA 1OYXA 3JCMh 1IL2A 2YLCA 4H2VA 1WJRA 2C8MA 2QHUA 2ZT7A 1VQ4A 3DB3A 3JCMV 1YJNT 1S72T 4OP0A 1EVLA 5LJ3d 4M78G 1OZ2A 5CKDA 3DLMA 3BW1A 3OYJA 4E7JA 4XTYA 3RACA 5GAOr 1VQMA 3LX7A 1BIBA 4YRPA 3MO8A 1X6OA 2PMEA 3CCQT 2QXFA 4BUGA 4II1A 2KMTA 2DPPB 2BIVA 4H2SA 1WU7A 3QSUA 4C0FA 2RJDA 4YRIA 5HGQA 3CXCS 3WQZA 2KY9A 2QHVA 2OTJA 3M59A 5CVIA 4CH4A 3VUZA 4J7FA 3CCUA 4RQFA 3JCMe 5CKEA 1KOGA 3OYNA 3V7SA 2CZ0B 1VQKA 1ZBXA 2EKOA 1PSFA 1B7YA 2EQKA 1FYFA 2QA4A 3OYIA 1B7YB 3VJPA 4M78A 2CJ9A 4M78B 2E6NA 2E65A 3CC2A 1Q81C 4K86A 4HA8A 4ZTZB 3A7RA 2RHZA 4EMHA 1VQ8T 3E19A 4UC4A 3HXXA 1Q7YC 4PG3A 1VQ5T 1B76A 2L8DA 4Q5WA 1U1TA 1UGPB 1NPRA 4O5VA 3G7ZA 1ATIA 2F5TX 2JTMA 5GAN5 4F7UG 4X9DA 4QVZA 3OYLA 4OGCA 4BY6B 2ZPBB 2QHSA 2VUBA 1M1KU 1SRYA 2D9TA 3ERRA 5GAMj 3G4SA 2G3RA 2GCXA 1ASZA 2I4MA 3HXUA 4XU0A 4YCWA 1K73C 3KFUA 1C0AA 3CCVA 3REUA 3OYBA 4YRRA 4YDQA 1G5IA 3JCMW 1VQ4T 3S3MA 2RI2A 2CS7A 4P71C 5GANh 3OYHA 1X01A 3QPHA 1Q7YU 3JB9D 3OBYA 1G3YA 3CCSA 2EYQA 3C12A 2DIGA 2A7YA 3OS0A 3I7FA 5LJ5j 5C0MA 3QZ9B 3JB9I 4LD9K 3CXCA 2L89A 4E47A 4F7UA 1VQMT 1G51A 4F7UB 1VIFA 4H2WA 1D3BA 1M8VA 1H4VB 2RHQA 4HCCA 2RK2A 3VQWA 1UB4A 1ADYA 1JJ2S 1NE8A 4B9WA 2EQUA 1VIEA 1UEBA 2JN0A 2AHJB 2OTJT 3P8TA 3JSCA 3GIBA 2JOYA 1G3SA 3FDRA 2QQSA 3QO3A 3CCUT 5C6SA 2RJEA 3X24B 1NYQA 2A8EA 5GAMh 2QA4T 4JRKA 4BI4A 3A8LB 3CC2T 3OY9A 4UP8A 2DQ0A 3NEMA 2E3CA 5HK3A 2C06A 5FU7C 3HL8A 4JJNK 2ZPEB 2K3YA 2Y4YA 4IURA 2EWNA 5LJ3j 5FLXE 5GMKm 3GNFB 5J26A 3E9FA 2G4CA 3JB9F 2QQ9A 3OA6A 1X2HA 2EIFA 4WJ3M 2LTOA 5GAN2 2RHUA 2Y4XA 5DM7R 4TWAA 3I55A 3V7RA 3G4ST 5A0GA 5DLQE 2VC8A 4XAXB 2RB6A 2ZT5A 3CCLA 4EMKA 2ZXFA 4EMKB 1UGQB 3HXWA 2EJFA 3M4QA 3QDRB 3RUXA 2QQRA 4M7DE 3JCMg 3CCVT 2HQEA 3CMAA 5GAMe 3J80E 4RG8A 3EFSA 3PIPA 2ZR3A 1YIJA 2XDDA 3RL6A 1G5HA 2DQ3A 3L2WA 4X5OA 2I2LA 2CZ6B 3MP6A 4ELZC 4BDYA 5A0DA 3NETA 3CCST 4C5EA 3PFSA 3OW2S 1JRIA 2R5AA 1DJ7B 2I4LA 1MHNA 4J6YA 4N0AC 2GFAA 3HHTB 3NELA 4JLIA 2KVQG 4CS4A 3E9IA 3LWIA 1RL2A 2RM4A 3OYCA 1EFWA 4V2SA 3M53A 2CYZB 3LLRA 5LJ5e 3HKSA 1G5VA 5LJ3h 5ELNA 3S3NA 4M78D 3MHXA 4XU3A 5GAOm 4Q6GA 1I4K1 1X56A 3UWNA 2XK0A 4OMFB 2LDMA 4QQ6A 2P5IA 4UP7A 1N9SA 5K1XA 3O8VA 2GQVA 4YRQA 4YRLA 3AHUA 5FU7B 3NTIA 3IALA 3IG2A 5IAYA 1I5LA 3RKXA 1MGQA 1YJWA 3MP8A 4MDWA 5CAIA 3M4GA 5E3IA 3M57A 3A8HB 1KQSA 4P72C 1NJIC 2LVMA 4M78E 3MF2A 2NLUA 4M75C 2ZR2A 3LC0A 1SSFA 4A53A 2XKOC 2O01E 2NS6A 2CZ7B 3MCAB 3EFRA 3MEVA 2ZGWA 3OMCA 3SWNA 4A4KA 1M9SA 4X9CA 5GAN8 3L2VA 4LDXA 4JDSA 3HRIA 4BE0A 5LJ3e 3I55T 1YHQA 4LVJA 4B9XA 2FL7A 4PHCA 3MEUA 4QW2A 4TVWA 5D6YA 4C0ZA 4C92C 2EQMA 3CCLT 4YPFA 4M7DG 2JUFA 2DIQA 4M78F 3CMAT 3H8ZA 4TQDA 4HWRA 4PJOC 1YIJT 3RKYA 3M58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM d;  4N0A A;  5GMK j;  4TTV A;  1E24 A;  2ART A;  2RHQ B;  3RGL A;  3CMQ A;  3HXV A;  2AKW A;  1EOV A;  2ZT6 A;  2AKW B;  4RQF A;  4NCX A;  3JCM e;  1KOG A;  3V7S A;  4H2T A;  3REX A;  3R07 A;  4M7D F;  4KR2 A;  4G85 A;  1B7Y A;  4C92 E;  1FYF A;  3W3S A;  1LOJ A;  1YGB A;  1B7Y B;  3HFZ B;  4RMF A;  1N9W A;  2ZNJ A;  4RCC A;  4M78 A;  2CJ9 A;  4M78 B;  4G84 A;  3JB9 J;  2E65 A;  4K86 A;  4HA8 A;  4ZTZ B;  3A7R A;  4DQ2 A;  4CS2 A;  2VXF A;  5F5W A;  2ODR D;  2E1H A;  2ODR C;  4F7U E;  1Y96 A;  2Q5I A;  4EMH A;  1Y96 B;  4L87 A;  1Z7M A;  3HXY A;  2Y90 A;  4PJO E;  1KQ2 A;  2ZZF A;  2P0L A;  3HXX A;  5ELO A;  4PG3 A;  4P73 C;  1B76 A;  4XEM A;  1E1T A;  4TQF A;  3MF1 A;  1U1T A;  3L2Z A;  2K57 A;  3PZC A;  2E5A A;  3UH0 A;  5KNN A;  4C92 G;  2DTH A;  3JCM J;  1M5Q 1;  4M7D A;  4KR3 A;  3HY0 A;  1ATI A;  4M7D B;  2ZIO A;  3V8J A;  3V7C A;  3PGG A;  5GAN 5;  4YRJ A;  2ZCE A;  2DU7 A;  3QO7 A;  4F7U G;  3L1A A;  2HNI A;  4P3P A;  2ZZG A;  4X9D A;  3HFO A;  3VBB A;  1X54 A;  2QHS A;  2VXE A;  4WI1 A;  4P75 C;  4WF2 A;  5GAM g;  1SRY A;  4P74 C;  3ERR A;  5GAM j;  4M75 B;  3JCM Q;  1QF6 A;  5GAN 7;  2DU5 A;  3BFM A;  1JJC B;  2AMC A;  2AMC B;  3A74 A;  1WNL A;  1ASZ A;  1QE0 A;  2I4M A;  3HXU A;  1ADJ A;  4XU0 A;  2DTI A;  4J15 A;  1KMN A;  4YCW A;  4J6W A;  2EJG A;  2XTI A;  5LJ5 h;  3KFU A;  1H64 1;  4F7U F;  2CIM A;  4KQE A;  1C0A A;  3HY1 A;  4HWP A;  3REU A;  5C53 B;  1KMM A;  4YRR A;  4YDQ A;  1G5I A;  3JCM W;  1HTT A;  4XQ3 A;  3VQV A;  4JRI A;  2J3M A;  4JUV A;  3NEN A;  4Y91 A;  4P71 C;  4YRC A;  3VQX A;  4MMK A;  4RCB A;  5GMK h;  2CGH A;  5GAN h;  3SWN C;  4P3O A;  4C8Q D;  1NJ5 A;  4C8Q C;  1X01 A;  4XTZ A;  2QTX A;  3INZ A;  2QHT A;  3JB9 D;  4C92 A;  2ARU A;  2ZIN A;  1YFT A;  4C92 B;  3A31 A;  2DDZ A;  1SES A;  1SER A;  1KQ1 A;  4RDX A;  5LJ5 g;  2J3L A;  1PYS A;  3I7F A;  5LJ5 j;  1B70 A;  1PYS B;  1E22 A;  3JB9 I;  1B70 B;  3HSB A;  2ALY B;  4F7U A;  2DEQ A;  1G51 A;  4M77 D;  4F7U B;  1BIA A;  4M77 C;  4H2W A;  1H4T A;  4YRN A;  1D3B A;  1M8V A;  1H4V B;  3IKL A;  3HFN A;  4PJO B;  4EMG A;  5GAN g;  1ASY A;  3L4G A;  2RHQ A;  5GAN j;  3L4G B;  2ZZE A;  4M75 G;  4K87 A;  3VQW A;  5GAN 3;  1ADY A;  1VQZ A;  3HFV A;  4XU1 A;  1B8A A;  3JCM b;  2CJA A;  4HWS A;  4C8Q E;  3HFZ A;  4QVD A;  2JN0 A;  3P8T A;  2EL9 A;  4RQE A;  3GIB A;  5LJ5 d;  5K1P A;  1HXD A;  4XTW A;  1H4S A;  3QO3 A;  2E41 A;  2DJZ A;  3JB9 H;  4M75 F;  2YLB A;  4M77 E;  4TVA A;  1L0W A;  4QVC A;  3M4P A;  3QO8 A;  4TVA B;  1NYQ A;  5GAN 6;  3JCM P;  1NYR A;  4HVC A;  5GAM h;  2DTO A;  5GAN d;  4XTU A;  3LSQ A;  3V8L A;  1SET A;  1I81 A;  3QHS A;  4C8Q G;  1YCY A;  4JRK A;  2E64 A;  3TEH B;  3JB9 G;  2PMF A;  3A5Y A;  5GMK e;  4CH6 A;  1HK9 A;  3OD1 A;  2DKG A;  4UP8 A;  2DQ0 A;  4XU2 A;  4UP9 A;  4CS3 A;  3G1Z A;  1RIQ A;  3NEM A;  2E3C A;  1H4Q A;  4Q15 A;  5C52 B;  4YRO A;  4YRE A;  1NJ1 A;  4PJO G;  4M77 G;  1LJO A;  4M7A D;  4P72 A;  4M7A C;  1EQR A;  4K88 A;  5LJ3 g;  4M7D C;  2EWN A;  1YFR A;  2ZT8 A;  1J5W A;  5LJ3 j;  3P8Y A;  4M75 A;  5GMK m;  4P75 A;  1N9R A;  4YRS A;  1JJC A;  1USY C;  4C8Q F;  4HWO A;  4PNO A;  4O2D A;  4C92 F;  4P74 A;  2ZTG A;  3RES A;  2G4C A;  1GGM A;  3JB9 F;  3IKM B;  2DZC A;  1HC7 A;  1W66 A;  3TUP A;  1X2H A;  1NJ8 A;  3LSS A;  2E10 A;  4WJ3 M;  5GAN 2;  2RD1 A;  2I4N A;  3QUI A;  4PJO F;  4M77 F;  4TWA A;  4H2Y A;  3DSQ A;  3V7R A;  3FJP A;  4ZTU B;  3UGQ A;  1X55 A;  4P3N A;  2VC8 A;  3JCM c;  3RF1 A;  3BDU A;  2RB6 A;  3RKW A;  2ZT5 A;  2ZXF A;  4EMK A;  1WYD A;  4EMK B;  4XEO A;  3SWN B;  4M7A E;  5GAO n;  4C8Q A;  2DXU A;  5GAM f;  3HXW A;  3TEG A;  2EJF A;  5GAM d;  3M4Q A;  4C8Q B;  3RUX A;  4M7D E;  3JCM g;  2EJ9 A;  3SB2 A;  4YYE A;  3A7A A;  5I21 A;  2C7I A;  1Z7N A;  5GAM e;  2ALY A;  4CH3 A;  3EFS A;  3HXZ A;  2ZR3 A;  4HWT A;  3RL6 A;  3BJU A;  1G5H A;  2DQ3 A;  4X5O A;  2I2L A;  4PJO A;  4M77 A;  3E9H A;  4M77 B;  4YRK A;  3RER A;  5GMK i;  3NET A;  4J6X A;  4HT9 A;  4M7A G;  1E1O A;  2RA2 A;  1JRI A;  1BBW A;  1BBU A;  2RHS A;  2IY5 A;  2RHS B;  3A5Z A;  2IY5 B;  4MML A;  1I8F A;  2I4L A;  2EAY A;  2Q7H A;  2DVE A;  4J6Y A;  2Q7E A;  4N0A C;  3UGT A;  3A32 A;  3NEL A;  4JLI A;  4YCV A;  2I4O A;  5LJ5 f;  5GAO q;  3QTC A;  4YRM A;  4UPA A;  4CS4 A;  4H2U A;  3E9I A;  2CJB A;  4YRG A;  2RM4 A;  5GMK l;  1EFW A;  4V2S A;  2DXT A;  3HTZ A;  1WLE A;  4M7A F;  3ICA A;  5LJ5 e;  4J5Y A;  4H02 A;  2ZNI A;  1NJ6 A;  5LJ3 h;  5ELN A;  4M78 D;  5GAN f;  4M78 C;  1B34 A;  3UFG A;  1B34 B;  4XU3 A;  4P73 A;  4A54 A;  5GAO m;  3MEY A;  4Q6G A;  1LYL A;  3VQY A;  2Q7G A;  4OLF A;  1I4K 1;  3TEH A;  4NL2 A;  1WQW A;  1X56 A;  3V8K A;  12AS A;  4ZIB A;  4LNS A;  3RIR A;  1X2G A;  2YHT A;  5GAN e;  2P5I A;  4EO4 A;  2ZIM A;  4YRT A;  2XGT A;  4UP7 A;  2FB7 A;  1N9S A;  4YCU A;  1EVK A;  4DPG A;  5GAO p;  1YFS A;  5K1X A;  4CH5 A;  4YRQ A;  4YRL A;  3AHU A;  3IAL A;  3IG2 A;  1I5L A;  4E51 A;  4M7D D;  3RKX A;  3BY7 A;  4XTX A;  4M7A A;  4M7A B;  4YP0 A;  1MGQ A;  2DZ9 A;  1WQ7 A;  1NJ2 A;  5CAI A;  1YB3 A;  4TVY A;  3HRK A;  1USY A;  2FYK A;  3M4G A;  1WPY A;  5E3I A;  4P72 C;  4HT8 A;  4H2X A;  1IL2 A;  3JCM h;  3PCO A;  4M78 E;  4NL3 A;  3MF2 A;  4H2X B;  3PCO B;  2YLC A;  4YRF A;  4M75 D;  4M75 C;  2ZR2 A;  3FIF A;  3LC0 A;  4H2V A;  1TH7 A;  4A53 A;  2C8M A;  2QHU A;  2ZT7 A;  5DY9 A;  3JCM V;  1NNH A;  3QO5 A;  2Q5H A;  1JBM A;  4OP0 A;  4P71 A;  3EFR A;  2ZGW A;  1EVL A;  3SWN A;  5LJ3 f;  11AS A;  5LJ3 d;  4BWA A;  4M78 G;  4X9C A;  5GAN 8;  3HRI A;  3BW1 A;  4XTY A;  3RAC A;  5LJ3 e;  1EIY A;  5GAO r;  1EIY B;  4PHC A;  4EMK C;  1BIB A;  4TVW A;  3QNE A;  4YRP A;  4EX5 A;  5C51 B;  4C92 D;  2PME A;  4XTV A;  4C92 C;  4WJ4 A;  4AH6 A;  4BW9 A;  4M75 E;  5GAO l;  4YPF A;  3A7U A;  1LNX A;  4H2S A;  4M7D G;  5GAN 4;  4M78 F;  1WU7 A;  4TQD A;  3QSU A;  4NOY A;  3VU3 C;  4YRI A;  4HWR A;  4PJO D;  3FB9 A;  4PJO C;  5HGQ A;  2ARS A;  3P8V A;  3WQZ A;  1D3B B;  2QHV A;  1U1S A;  3JCM f;  3RKY A;  4CH4 A;  3JCM X; 
#chains in the Genus database with same CATH topology
 1K8A C;  4N0A A;  1AZG B;  1OPK A;  2CH4 A;  2PUK B;  4OVA A;  4OGE A;  3RGL A;  4LDW A;  2C0I A;  1EOV A;  2MI6 A;  2ZT6 A;  2COZ A;  3NTK A;  1QVG P;  2VYT A;  4H2T A;  3OYY A;  1TU0 B;  3L2R A;  2X4Y A;  1XQH A;  4IUP A;  2KK4 A;  1VQO A;  4G85 A;  2ZZD A;  1VQ6 Q;  4RTU A;  1VQN Q;  1M1G A;  1LOJ A;  4KUI A;  3HFZ B;  1N9W A;  2CKK A;  4KBM B;  1PRL C;  2VGN A;  4OMM A;  4G84 A;  3JB9 J;  3WVD B;  3RBB B;  1Q86 R;  3EG2 A;  1YNZ A;  2DA9 A;  2E1H A;  2ODR C;  4F7U E;  4EIK A;  2EPD A;  2Y90 A;  1MUZ A;  2ZZF A;  2P0L A;  4P73 C;  4LN2 A;  3A98 A;  4MZT A;  3MF1 A;  3L2Z A;  3X28 B;  1D0Y A;  3EFO A;  4C92 G;  4ZTJ A;  3EFO B;  3JCM J;  2HQX A;  3M55 A;  4FW1 A;  2FRW A;  4FYV B;  4M7D A;  2QQB A;  3ZEH A;  3I9Q A;  4M7D B;  2FPF A;  3VYG A;  1BU1 A;  2L0A A;  2DU7 A;  3GPL A;  1U8R A;  2JTF A;  3L1A A;  1Y71 A;  2HCK A;  3CC7 A;  3UDC A;  2VWF A;  3GLX A;  4P3P A;  1QP2 A;  2LX7 A;  5KH6 A;  3CME Q;  1X54 A;  2QEX A;  1NYF A;  1JEG A;  1K8A U;  4P75 C;  4EPC A;  5GAM g;  4P74 C;  3CEY A;  4M75 B;  2J7I A;  2DYB A;  3J81 E;  1YJW T;  2VAS A;  2LT4 A;  1OX9 A;  2OAU A;  3A74 A;  2X3W D;  1ADJ A;  4J83 A;  2QGF B;  4L6V 5;  1WHM A;  4LDV A;  4IUU A;  4J6W A;  2XTI A;  2EYZ A;  3TCJ A;  4F7U F;  2I0N A;  4D6W A;  4HWP A;  2CZ1 B;  2MYS A;  4JS5 A;  5C53 B;  1KMM A;  3LGF A;  1NZ9 A;  2LJ0 A;  4JRI A;  1VQ7 T;  2J3M A;  4JUV A;  2JXB A;  4Y91 A;  2M16 A;  3VQX A;  4Z8A A;  3GNG A;  2BZX A;  1YWP A;  4XTZ A;  2QTX A;  4C92 A;  2ZIN A;  4RKU E;  4C92 B;  1YFN A;  4A4E A;  2EKH A;  1V1C A;  1ZHI A;  1A0N B;  1HSQ A;  1KQ1 A;  1BI1 A;  5LJ5 g;  1PYS A;  1B70 A;  1PYS B;  1E22 A;  1B70 B;  1YHQ T;  1TUG B;  2DEQ A;  4ESR A;  1BIA A;  1H4T A;  4YRN A;  5CR2 A;  1R8O B;  2A0F B;  3IKL A;  3L42 A;  4PJO B;  1RAB B;  3SD4 A;  2OI3 A;  1M1K C;  4F14 A;  1FX7 A;  1BI3 A;  5GAN j;  1YWO A;  4WTO B;  2ZZE A;  5FRM A;  3H0F A;  3EGD A;  2COY A;  2DF6 A;  3HFV A;  3EGD B;  4ELY C;  4FU6 A;  3M54 A;  3M0U A;  3FC3 A;  1N8R U;  4QVD A;  1H3Z A;  2EL9 A;  2A37 A;  4RQE A;  1T3L A;  1HXD A;  4QQG A;  4CC7 A;  2L3Q A;  2HBP A;  4XTW A;  3M5A A;  2XHC A;  4BB7 A;  3L2Q A;  2D6F A;  4YTL A;  5I11 A;  3JB9 H;  4TVA A;  2DEU A;  3M4P A;  2DRK A;  2XG8 D;  4TVA B;  1AWX A;  1NYR A;  4HVC A;  3PVQ A;  5EC7 A;  2DTO A;  2JM8 A;  1VYV A;  2GF7 A;  2J6O A;  1GRI A;  1K76 A;  1RAH B;  2WAC A;  2CP0 A;  2PMF A;  4CH6 A;  1HK9 A;  3OD1 A;  2DKG A;  2QG9 B;  2DK3 A;  4XU2 A;  2ROT A;  2BZY A;  3P8H A;  3PIO A;  3G1Z A;  1H4Q A;  3CCE A;  1K9M R;  2A28 A;  5C52 B;  4YRO A;  2X51 A;  3LW5 E;  3QKJ A;  1WA7 A;  1NJI R;  5I2M A;  2LX9 A;  3KBG A;  1UGR B;  1EQR A;  3CBP A;  3VRY A;  5LJ3 g;  3E1S A;  4P75 A;  3L2U A;  4YRS A;  2DD4 A;  4PNO A;  1ABQ A;  2QI2 A;  4P74 A;  1O75 A;  1GGM A;  3IKM B;  1KHI A;  2AKL A;  1W66 A;  5CKB A;  2RHI A;  1UHC A;  3CC7 T;  3LSS A;  1RI0 A;  5D7U A;  1MMN A;  1RAE B;  4PJJ A;  5HY6 A;  5GJV B;  2QEX T;  1RI9 A;  3MP1 A;  3OS1 A;  2K2M A;  3DSQ A;  2O31 A;  1RAG B;  2R57 A;  5FU6 C;  1X75 C;  1M3A A;  8AT1 B;  1RAD B;  2HQH A;  2K5F A;  3X25 B;  3UGQ A;  3TEE A;  2FZC B;  3CD6 Q;  4P5N A;  1WJS A;  1AWO A;  2KXC A;  3OYE A;  5GAO n;  1PM3 A;  1YIT Q;  1NM7 A;  1D0X A;  3GF5 A;  2XMF A;  4YYE A;  1PHT A;  1WXB A;  1Z7N A;  3QXE B;  2M02 A;  1QVF S;  1Q82 U;  2WSF E;  1M1F A;  3HXZ A;  1R77 A;  4FT4 A;  2YRD A;  1WGS A;  3ME9 A;  1WX6 A;  3ZL7 C;  4KGV B;  3OYF A;  3E9H A;  4OB2 B;  4YRK A;  4FYW B;  1Z9Z A;  5IXB A;  3MEA A;  1E1O A;  1QKX A;  2RA2 A;  2DMO A;  2RHS A;  1I07 A;  2RHS B;  1PKT A;  1W1F A;  1YJ9 Q;  2KRO A;  1WHL A;  2Q7E A;  4PFO A;  4RMO A;  3OS2 A;  2V8J A;  3C4S A;  4IIO A;  3A8O B;  1VYU A;  4ZGJ B;  2MOX A;  3U23 A;  1VA7 A;  4UPA A;  1WXU A;  2MWP A;  3G71 A;  5CKF A;  2AIR B;  3JRZ A;  4GY5 A;  1YJN Q;  1T0H A;  3VUB A;  3M0Q A;  1S72 Q;  4J5Y A;  4H02 A;  2RQT A;  1HYO A;  1EIF A;  3VV0 A;  4RTX A;  1VQK T;  3UFG A;  1QLY A;  3HPW A;  3MEY A;  2P0Q A;  4C0G A;  2Q7G A;  4OLF A;  2PVD B;  4AT1 B;  3CXC P;  4C5H A;  1KC8 C;  1VQL A;  4LNS A;  3RIR A;  1X2G A;  5GAN e;  4EO4 A;  2ZIM A;  2XGT A;  5IN1 A;  1M3C A;  4YCU A;  1EVK A;  1IGQ A;  2QK0 A;  4AFQ C;  3TRE A;  3OYG A;  3CCQ Q;  3S3O A;  4XK8 E;  3Q1J A;  2RI5 A;  3I5S A;  3QYG B;  4AFS C;  4M7D D;  2HDA A;  3BY7 A;  5I2S A;  5ECA A;  2QYZ A;  2H8H A;  5FWB A;  2DZ9 A;  3VS0 A;  2E4H A;  1ABO A;  4TVY A;  2KGT A;  3QII A;  1I5O B;  4PJM A;  1SEM A;  1WPY A;  2FVU A;  1IHW A;  2PVO B;  2VGM A;  4OB0 B;  4IUQ A;  3PCO A;  1EX4 A;  3PCO B;  1W2B S;  4M75 D;  2JT4 A;  2FHD A;  1U3O A;  2QQA A;  1NG2 A;  1TH7 A;  3CPW S;  4OMQ A;  2K5L A;  1KFZ A;  4GLM A;  5KCO A;  3KFV A;  5FU6 B;  4P71 A;  2CT3 A;  4GLK A;  11AS A;  2LC4 A;  3N5B B;  1BBZ A;  3DLL A;  2ZPH B;  3T9N A;  4O6J A;  1VQP A;  1BYM A;  1KC8 U;  1SHG A;  5CCA A;  1VQ8 Q;  2DBM A;  3QNE A;  3FLG A;  4EX5 A;  4C5G A;  4PFZ A;  4JZ3 A;  4C92 D;  1VQ5 Q;  2HAX A;  2AT1 B;  3JAM E;  4BW9 A;  1QVG S;  2XI9 A;  4M75 E;  2DL8 A;  1M1K R;  2MF2 A;  5IHN A;  1JJ2 A;  2DRM A;  3LYI A;  2WSC E;  2NUT A;  2L3S A;  2NUT B;  1QW1 A;  4NOY A;  4KGX B;  2LQ8 A;  3PT9 A;  4PJO D;  2W0Z A;  2GGR A;  3FB9 A;  5D6X A;  2ARS A;  3P8V A;  2WSE E;  1UJY A;  4QT7 A;  1U1S A;  4L59 A;  3JCM f;  2AK5 A;  3JCM X;  1WHK A;  4BAC A;  5GMK j;  3UT1 A;  4TTV A;  3SFM A;  2ART A;  2IIM A;  1M4Z A;  2YRV A;  3CMQ A;  3HXV A;  2DLP A;  2RQV A;  1E7O A;  3EG3 A;  2JVV A;  3REX A;  3WVE B;  5CQX A;  4ZGD B;  1H3H A;  2L3R A;  2ED0 A;  5J39 A;  4M7D F;  4KR2 A;  2JTE A;  4C92 E;  3E9G A;  1Q7Y R;  2M0O A;  1YGB A;  4RMF A;  1WXT A;  2V8I A;  3PNW C;  4RCC A;  3OBW A;  3C95 A;  3HRT A;  4J8O A;  1VQ4 Q;  2ODR D;  1Y96 A;  4N4G A;  1Y96 B;  3O5Z A;  3G71 T;  4OMP A;  2CSQ A;  3CCJ A;  4F16 A;  2H3J A;  2O88 A;  3HXY A;  4BI8 B;  4PJO E;  4E7K A;  1MND A;  3CC4 A;  4XEM A;  2KDS A;  1E1T A;  4TQF A;  1GFC A;  1SF9 A;  3EH2 A;  3MET A;  3HRS A;  2E5A A;  3EH1 A;  3H0H A;  3M0R A;  2X35 A;  2PQW A;  1VQL T;  3HY0 A;  1GL5 A;  4BD3 A;  2ZPG B;  3V8J A;  1VUB A;  1G3T A;  4YRJ A;  4D8K A;  1VQM Q;  1W2B A;  1BB9 A;  2HNI A;  1MMA A;  2ZZG A;  1F1B B;  3HFO A;  4AFU C;  4LDY A;  2E3I A;  1KD1 U;  2MWO A;  3QZ5 B;  5FW9 A;  4DA4 A;  5GAN 7;  4FT2 A;  2DU5 A;  1JJC B;  1G2B A;  1WNL A;  1QE0 A;  4M4Z A;  2DAQ A;  3VS3 A;  4J15 A;  1KMN A;  3TSW A;  4LVM A;  4PLL A;  3WXM B;  2EJG A;  4FL6 A;  3OYM A;  2EFI A;  1RLQ C;  2DVJ A;  2OTJ Q;  3HY1 A;  2M1H A;  2AZV A;  5A2Q E;  1AHJ B;  4HCZ A;  3OYA A;  1HTT A;  4XQ3 A;  3CCU Q;  1K1Z A;  5IH2 A;  2RJC A;  4OMO A;  4R55 A;  4MMK A;  5GMK h;  3HRU A;  2ZAE A;  2RH2 A;  4P3O A;  4C8Q C;  1VQK Q;  4ZNX A;  2QA4 Q;  2QHT A;  3OW2 A;  1YBY A;  4FW2 A;  2ARU A;  1YFT A;  1FMW A;  1SER A;  1VQP T;  3CC2 Q;  2GTO A;  1KQS P;  1ZUK A;  5L8R E;  2COW A;  2FZK B;  3HSB A;  4AFZ C;  2ALY B;  3GBQ A;  4M77 C;  2JZ2 A;  3HP9 A;  2CP2 A;  2E6Z A;  2K3X A;  4EMG A;  4J9H A;  5GAN g;  3L4G A;  1Z9Q A;  4ZGE B;  3L4G B;  2F2V A;  5CO7 A;  4M75 G;  4K87 A;  3KUF A;  2O2O A;  1VQZ A;  2F1L A;  2LMJ A;  2V26 A;  2LCL A;  2X4W A;  3CBO A;  4J9C A;  2QAZ A;  4E7S A;  4OB3 B;  3JCM b;  2CJA A;  3REA B;  4A63 B;  1M30 A;  3HFZ A;  3UA7 A;  1G8X A;  3A1P A;  5LJ5 d;  4IKF A;  2LJ3 A;  5K1P A;  1IRX A;  5CIU A;  1AEY A;  1XOV A;  2E70 A;  3G4S Q;  2E41 A;  3M9Q A;  1M90 C;  1P92 A;  2CSI A;  4J7I A;  3CCM A;  2O4X A;  4JPB W;  1N5Z A;  2O4X B;  4QVC A;  2LT1 A;  2RF0 A;  5GAN 6;  3G6E A;  3JCM P;  3LSQ A;  1PD0 A;  1SET A;  1V29 B;  2P0K A;  4C8Q G;  3PTA A;  3LWH A;  2PU9 B;  2HMA A;  3TEH B;  3CCV Q;  2NUP A;  2GTJ A;  5GMK e;  2NUP B;  4N4I A;  1FWZ A;  1NLO C;  4UP9 A;  4CS3 A;  3PMI A;  1WJQ A;  4Q15 A;  2XDB A;  3CCJ T;  1KSW A;  3I56 A;  4YRE A;  4PJO G;  4M77 G;  4P72 A;  4M7A C;  2CUB A;  3OQ5 A;  1OI1 A;  4K88 A;  5M9O A;  1YFR A;  1J5W A;  3EG1 A;  3CCS Q;  3P8Y A;  4M75 A;  3CCR A;  2D0Q B;  3REB B;  3SEM A;  1CKB A;  2LNV A;  4O2D A;  2EQJ A;  2R58 A;  5CQY A;  3GP8 A;  3RMS A;  3F70 A;  1FYN A;  3PVL A;  2DZC A;  3TUP A;  1N8R C;  2F5K A;  1NJ8 A;  4NS5 A;  1PWT A;  4CRI A;  1BK2 A;  3EGU A;  2EW3 A;  4BDZ A;  5L23 A;  4DOW A;  1R0B G;  2KRS A;  2I4N A;  2G6F X;  3VS1 A;  3QWY A;  2CUD A;  4FSS A;  4KH1 B;  1NYG A;  1SSH A;  1U5S A;  4A4G A;  3KXT A;  2DO3 A;  4ZTU B;  5A0L A;  1M90 U;  4P3N A;  2V8K A;  4QQD A;  3RF1 A;  3BDU A;  4CC4 B;  1OOT A;  4C8Q A;  2DXU A;  5GAM f;  2K79 A;  1VQ9 A;  4C8Q B;  2EJ9 A;  1LVK A;  2LQN A;  4JZ4 A;  3A7A A;  1N6A A;  2KYM A;  5I21 A;  2C7I A;  3X26 B;  2ZPI B;  4Z02 A;  3MEW A;  3SDZ A;  4JS4 A;  4N4H A;  2IG0 A;  1ACM B;  3GOX A;  2RHX A;  2DD5 A;  3I35 A;  1QWE A;  2JJ9 A;  3VS5 A;  4KT0 E;  3OSV A;  3QJ6 A;  4FM4 B;  1FMV A;  4PJO A;  4M77 A;  2ZPF B;  2XDP A;  2BUD A;  1NPP A;  4M77 B;  3DB4 A;  5GMK i;  3NMZ C;  4J6X A;  4HT9 A;  1X6B A;  4M7A G;  2KSS A;  1N27 A;  3VRZ A;  3NFC A;  1BBW A;  2IY5 A;  2A36 A;  2DL4 A;  2CRE A;  2IY5 B;  4BI3 A;  2ZCF B;  1PSE A;  2EAY A;  1AWW A;  2EGA A;  2Q7H A;  1Q95 G;  3ZFJ A;  3UF4 A;  2F2X A;  2QDL A;  5KE2 A;  3LH5 A;  3UGT A;  3OMG A;  4YCV A;  2LCS A;  5LJ5 f;  5GAO q;  3QTC A;  2K5I A;  2JMA A;  4H2U A;  2CJB A;  4YRG A;  5GMK l;  1D1B A;  2C0O A;  2DXT A;  1SG5 A;  1IZ6 A;  1HD3 A;  1WLE A;  5CKH A;  2K9G A;  4HVU A;  3ICA A;  3OS5 A;  3EHR A;  2FG0 A;  4KUD K;  5FRN A;  4MZM A;  3P8B B;  1VQO T;  3MKD A;  4P73 A;  4A54 A;  3OSS C;  3OYD A;  1LYL A;  4PJL A;  2DL7 A;  4ZIB A;  4NL2 A;  1WQW A;  3V8K A;  2EBP A;  1FXX A;  3H0I A;  1JQQ A;  2OTL A;  3QJY A;  2HKQ B;  1Q82 C;  1YI2 A;  1LCK A;  3I55 Q;  4DPG A;  3M4Y A;  2DET A;  1OEB A;  1PD1 A;  3CCM T;  4PLI A;  2ED1 A;  2PTK A;  3G6E T;  4BE1 A;  3CCL Q;  4HXJ A;  1ZUY A;  4E51 A;  3I5R A;  4M7A A;  4M7A B;  4YP0 A;  3CMA Q;  1YB3 A;  1NJ2 A;  1RAC B;  3HRK A;  2XID A;  2ENM A;  1VQ6 A;  1VQN A;  2E5K A;  2L2P A;  1YIJ Q;  4H2X A;  3LGL A;  4NL3 A;  4B6M A;  2EGE A;  4H2X B;  4LVK A;  3I56 T;  4ORZ A;  4YRF A;  3PMT A;  4DOV A;  4J9G A;  3FIF A;  1UHF A;  5DY9 A;  1NNH A;  1QCO A;  1UGV A;  3QO5 A;  3CCR T;  2K3B A;  2Q5H A;  3FRN A;  2OX7 A;  1XNI A;  4ZN1 A;  2QAS A;  1JBM A;  2CP7 A;  4E7L A;  2M51 A;  4HCB A;  1C6V X;  2IVW A;  2AKK A;  2CDT A;  4ME7 A;  5LJ3 f;  2E5Q A;  4BWA A;  4OMN A;  1BI0 A;  1ZQ1 A;  3M56 A;  4QKU A;  4A4F A;  2J6F A;  1Q81 U;  2YT6 A;  2L5Q A;  3P8D A;  1EIY A;  1SKU B;  1EIY B;  5AYF A;  2JS2 A;  3QYH B;  1U06 A;  2FZG B;  4EMK C;  2DIL A;  5KYN A;  1GBR A;  2XIC A;  5C51 B;  3A8M B;  3CME A;  4XTV A;  2JMC A;  4WJ4 A;  4AH6 A;  5CK9 A;  4DBR A;  5GAO l;  4Y92 A;  1PC0 A;  1K8A R;  3A7U A;  1VQ9 T;  4GBQ A;  1LNX A;  5GAN 4;  3URG A;  3PE0 A;  3VU3 C;  5IT9 E;  5LL6 S;  2FRY A;  1D3B B;  2P4T A;  3A5Y A;  3JCM d;  4LE9 A;  2JNG A;  2LJ1 A;  1E24 A;  2RHQ B;  6AT1 B;  1TOV A;  4RTT A;  2AKW A;  1G3W A;  2AKW B;  2KYB A;  2F69 A;  1YJW Q;  4NCX A;  4FSX A;  3MQZ A;  3R07 A;  4LD6 A;  2GFU A;  1K4U S;  3FEO A;  2KT1 A;  2DJQ A;  1LPL A;  2ZNJ A;  2BKD N;  3OYK A;  4VUB A;  1K73 U;  5KYX A;  3S6W A;  2KQW A;  5KYX B;  1MV0 B;  1QMC A;  4F17 A;  4DQ2 A;  4CS2 A;  2VXF A;  1QVP A;  3NTH A;  5F5W A;  1VQ7 Q;  4OF1 A;  1TG0 A;  2Q5I A;  4L87 A;  1Z7M A;  4RTZ A;  2HZY A;  5HK0 A;  3VS4 A;  1KQ2 A;  3CPF A;  1WDX A;  4L5G A;  5ELO A;  4PK4 A;  3UA6 A;  2D0N A;  3HTR A;  1FMK A;  3THK A;  4RG2 A;  2CP6 A;  2K57 A;  3PZC A;  3UH0 A;  1KHC A;  5KNN A;  2RI3 A;  4RTY A;  1YCS B;  2DTH A;  3CBM A;  1Q86 C;  4Z89 A;  1M5Q 1;  2KI7 A;  4KR3 A;  2OTL T;  2MIO A;  2ZIO A;  2R5M A;  3V7C A;  3PGG A;  2FEI A;  1YI2 T;  1IRE B;  1E6H A;  3RNJ A;  4MDX A;  1YHQ Q;  1D1A A;  2ZCE A;  3QO7 A;  1B7T A;  1W4S A;  3NPF A;  3X20 B;  3UPU A;  3CCE T;  3VBB A;  1N8R R;  2RJF A;  2VXE A;  2B8A A;  1OQK A;  3VS2 A;  1OU9 A;  4WI1 A;  4WF2 A;  1AT1 B;  3JCM Q;  1QF6 A;  1QP3 A;  4F04 B;  3BFM A;  2AMC A;  5KYY A;  4R56 A;  4ZTF A;  2AMC B;  5KYY B;  1KIK A;  4LVI A;  4PKC C;  2DTI A;  1I1J A;  4E7I A;  1OZ3 A;  4RUG A;  1VQ6 T;  1VQN T;  2EYY A;  1Y07 A;  5DLO A;  5LJ5 h;  1KQS S;  1H64 1;  2CIM A;  4KQE A;  3ZBD A;  2NWM A;  2A08 A;  1SRM A;  1QVF A;  1PKS A;  3VYH B;  2VV5 A;  3VQV A;  5IHI A;  2PZ1 A;  3NEN A;  5J3B A;  2GNC A;  1WHG A;  1X2Q A;  2XD0 A;  1KG1 A;  2YDL A;  4YRC A;  1BI2 A;  4RCB A;  3ASK A;  2CGH A;  2YUP A;  1GCQ C;  3SWN C;  5FRO A;  4C8Q D;  1NJ5 A;  2CP3 A;  4Y28 E;  3INZ A;  3H6Z A;  2K2V A;  2VVK A;  2PVG B;  2K4Y A;  3A31 A;  2DDZ A;  4LVL A;  1SES A;  4IIM A;  1Q86 U;  4RDX A;  2J3L A;  4CC3 A;  4CI0 C;  4OB1 B;  1QKW A;  1VOM A;  2A3L A;  2SRC A;  4A4H A;  4M77 D;  1XTD A;  4X34 A;  2HL3 A;  1KD1 C;  3C0C A;  2X9H A;  4E2F B;  2D1X A;  3HFN A;  3CME T;  4C5I A;  1ASY A;  2DL5 A;  8ATC B;  3EG9 A;  1QQJ A;  4ATO A;  2P0P A;  4K11 A;  1WHH A;  2HL5 C;  3EG9 B;  5GAN 3;  2C0T A;  1K0X A;  4C0D C;  4XU1 A;  2KAF A;  3CD6 A;  1B8A A;  4HWS A;  4C8Q E;  3CC7 Q;  1YIT A;  2DXC A;  4PL6 A;  4R0K A;  3JV3 A;  4JRP A;  2QEX Q;  1RAI B;  2MMP A;  1H4S A;  2CP5 A;  4E7H A;  3RMQ A;  1OV3 A;  1Q82 R;  1GFD A;  2DJZ A;  4M75 F;  1IHV A;  4LXC A;  2YLB A;  4M77 E;  1L0W A;  3QO8 A;  1GBQ A;  2GBQ A;  1Y7X A;  2P4R A;  4E6R A;  1WZO A;  5GAN d;  1JJ2 P;  4XTU A;  3V8L A;  2X4X A;  2IPO B;  4J9E A;  3BDL A;  1I81 A;  3QHS A;  1YCY A;  5KE3 A;  2E64 A;  2LQK A;  1D0Z A;  3JB9 G;  3MPU B;  1ZSZ C;  4AG2 C;  4ZN3 A;  1YJ9 A;  1RIQ A;  1O9S A;  3VKI A;  2EQI A;  3EAE A;  9ATC B;  1E6G A;  4HT4 A;  3LH0 A;  1NJ1 A;  3CPW A;  1LJO A;  4M7A D;  3OB9 A;  4JRQ A;  4HVV A;  1AZE A;  4M7D C;  2ZT8 A;  4DBF A;  1NEG A;  1SRL A;  3QBY A;  1N9R A;  4EDU A;  1YJN A;  1JJC A;  1USY C;  2BE7 D;  3C94 A;  4C8Q F;  3TU4 K;  4C92 F;  4HWO A;  2ZTG A;  1X43 A;  1S72 A;  2KR3 A;  1JB0 E;  1K9M C;  3ER0 A;  3RES A;  2M9U A;  1HC7 A;  1ZSG A;  2ATC B;  1X69 A;  2E10 A;  2MCN A;  1B3Q A;  5D6W A;  1QCN A;  2NYS A;  3J7A F;  4LNP A;  2RD1 A;  4AG1 C;  2DER A;  1JXO A;  3QUI A;  1AD5 A;  2DXB A;  1VQ7 A;  4PJO F;  2YSQ A;  4M77 F;  4JLG A;  4H2Y A;  1AOJ A;  2KE9 A;  2ABL A;  3FJP A;  1X55 A;  4IUV A;  2LZ6 B;  3JCM c;  3CCQ A;  3RKW A;  1QVG A;  3CQT A;  1GCQ A;  1WYD A;  5KCH A;  4XEO A;  3SWN B;  2X3X D;  4M7A E;  3TEG A;  4PJN A;  1OU8 A;  5GAM d;  3A8G B;  3SB2 A;  3QG1 A;  2PNI A;  1WFW A;  5AT1 B;  2QDY B;  2QGG A;  1W2B P;  2ALY A;  4CH3 A;  4HWT A;  1J3T A;  2RO0 A;  4BE2 A;  3BJU A;  4D8D A;  1TTH B;  2RHY A;  1NLP C;  3IQL A;  4HCK A;  4WCI A;  3RER A;  2BE9 B;  2LRQ A;  1G83 A;  1BBU A;  4MZP A;  1WIE A;  3A5Z A;  4MML A;  1ZUU A;  1I8F A;  2MAM A;  3A5Z B;  2X4J A;  1TSF A;  2DFU A;  4J9I A;  1K9M U;  2DVE A;  3DKM A;  1KJW A;  4C0D B;  4IUT A;  1TUD A;  2PUO B;  1NJI U;  5IXF A;  3A32 A;  4FYY B;  4J9F A;  5EG2 A;  3BE3 A;  4TVR A;  5KYU A;  2I4O A;  5KYU B;  4YRM A;  2LCC A;  2V1Q A;  1MNE A;  1KC8 R;  1VQ8 A;  3HTZ A;  2B86 A;  1CSK A;  4M7A F;  2EYX A;  2RK1 A;  2ZNI A;  3OW2 P;  1VQ5 A;  4LDU A;  3CD6 T;  1NJ6 A;  5GAN f;  4M78 C;  1B34 A;  1B34 B;  1H92 A;  1YIT T;  5HKC A;  1OUL A;  3VQY A;  1X27 A;  3W3S A;  3TEH A;  1M8M A;  4RTV A;  12AS A;  4LUD A;  3TSZ A;  1CKA A;  1UE9 A;  2YHT A;  2JM9 A;  4YRT A;  2KBT A;  2EGC A;  1GXI E;  2QTV A;  1UGS B;  2FB7 A;  5GAO p;  1YFS A;  1BKB A;  4CH5 A;  1ZSZ A;  4HKE A;  4J9D A;  2F2W A;  1ZSZ B;  2SEM A;  5HCK A;  3CC4 T;  2E12 A;  3AT1 B;  2XU8 A;  3EG0 A;  4XTX A;  1Y0M A;  4FIB A;  1WQ7 A;  4KUL A;  1M27 C;  1YP5 A;  1USY A;  2FYK A;  1YJ9 T;  4BY6 C;  2HD0 A;  3R6O A;  1OYX A;  3JCM h;  4HT8 A;  1IL2 A;  2DNU A;  2YLC A;  2DBK A;  2MPX C;  1AWJ A;  2JW4 A;  4H2V A;  3NHN A;  1WJR A;  1EZZ B;  2C8M A;  2QHU A;  2ZT7 A;  1VQ4 A;  3DB3 A;  3JCM V;  1YJN T;  3R6N A;  1ZBJ A;  1OX8 A;  2HBW A;  1S72 T;  4OP0 A;  3EHQ A;  1TS9 A;  1EVL A;  2H3E B;  4OML A;  5LJ3 d;  2W10 A;  4M78 G;  1JXM A;  1OZ2 A;  1M3B A;  1M2O A;  1NBE B;  5CKD A;  3RDV A;  1VYT A;  3DLM A;  3BW1 A;  3OYJ A;  4E7J A;  4XTY A;  3RAC A;  1X2K A;  2K6D A;  5GAO r;  2YUO A;  1VQM A;  1PNJ A;  1QWF A;  3G71 Q;  2RQW A;  3LX7 A;  1BIB A;  2YUQ A;  4YRP A;  3ULR B;  1ZA2 B;  1X6O A;  3MO8 A;  2PME A;  1KD1 R;  3CCQ T;  2QXF A;  4BUG A;  2LP5 A;  4II1 A;  2KMT A;  2BTT A;  2DPP B;  2BIV A;  4Z88 A;  1VQL Q;  4H2S A;  1WU7 A;  3QSU A;  4C0F A;  2RJD A;  4YRI A;  4CC2 A;  5HGQ A;  3RR6 A;  3CXC S;  3WQZ A;  2KY9 A;  4ANJ A;  2QHV A;  2OTJ A;  3M59 A;  5CVI A;  4CH4 A;  3VUZ A;  4J7F A;  2V1R A;  1B07 A;  2RN8 A;  2BZ8 A;  3CCU A;  3M0S A;  4RQF A;  3JCM e;  5CKE A;  1KOG A;  3OYN A;  3V7S A;  1EFN A;  1UJ0 A;  1PRM C;  1SPK A;  2EVR A;  2CZ0 B;  1VQK A;  1ZBX A;  2EKO A;  1PSF A;  2J6K A;  1B7Y A;  2EQK A;  1FYF A;  2QA4 A;  3OYI A;  1B7Y B;  3VJP A;  2L3P A;  1T0J A;  1XJW B;  4M78 A;  2CJ9 A;  3G1J A;  4M78 B;  2VB6 A;  2E6N A;  2E65 A;  3CC2 A;  1Q81 C;  4K86 A;  4HA8 A;  4ZTZ B;  3A7R A;  5KYW A;  2RNA A;  2RHZ A;  4EMH A;  5KYW B;  1VQ8 T;  3E19 A;  4UC4 A;  2HKN A;  1TXQ A;  3HXX A;  1Q7Y C;  4PG3 A;  1VQ5 T;  1B76 A;  2L8D A;  2ROL A;  4Q5W A;  1U1T A;  1UGP B;  1NPR A;  4O5V A;  3G7Z A;  1VQP Q;  1H8K A;  1ATI A;  5FWC A;  3QWX X;  2J06 A;  1HJD A;  2F5T X;  2JTM A;  5GAN 5;  1C1A A;  1WLP B;  1MMG A;  2HSE B;  4F7U G;  5GJW B;  4X9D A;  1IO6 A;  2OAW A;  4QVZ A;  3OYL A;  4OGC A;  4BY6 B;  2ZPB B;  2QHS A;  2VUB A;  1M1K U;  1SRY A;  2D9T A;  3ERR A;  1WYX A;  5GAM j;  3G4S A;  7AT1 B;  3TQ7 P;  2G3R A;  1C0M A;  2GCX A;  1IGU A;  1ASZ A;  2I4M A;  3HXU A;  4XU0 A;  4YCW A;  1K73 C;  3VS6 A;  3KFU A;  1C0A A;  3CCV A;  3REU A;  3MJX A;  3OYB A;  4YRR A;  4YDQ A;  1G5I A;  3JCM W;  3E2U A;  2KXD A;  1VQ4 T;  3S3M A;  2RI2 A;  2CS7 A;  4P71 C;  1RLP C;  4KH0 B;  5GAN h;  2NUZ A;  3OYH A;  1X01 A;  3QPH A;  1Q7Y U;  1WI7 A;  4RTW A;  3JB9 D;  4PFP A;  3OBY A;  2FPD A;  1G3Y A;  3CCS A;  2EYQ A;  2CH4 W;  3C12 A;  2DIG A;  2A7Y A;  3OS0 A;  3I7F A;  5LJ5 j;  5C0M A;  3QZ9 B;  3JB9 I;  4LD9 K;  3CXC A;  2L89 A;  4E47 A;  4F7U A;  1VQM T;  1G51 A;  4F7U B;  1VIF A;  4H2W A;  3CCJ Q;  1D3B A;  1M8V A;  1RAF B;  1H4V B;  3CC4 Q;  2YRC A;  3EGX A;  2ESW A;  2RHQ A;  3EGX B;  1T3S A;  4HCC A;  2RK2 A;  3VQW A;  1TUC A;  1UB4 A;  1ADY A;  1JJ2 S;  1NE8 A;  2FPE A;  1WHJ A;  1M90 R;  2FO0 A;  4B9W A;  2EQU A;  2CT4 A;  1VIE A;  1M2V A;  1UEB A;  1UEC A;  1M2V B;  3NGP A;  2JN0 A;  2AHJ B;  4JJD A;  2OTJ T;  3JSC A;  3P8T A;  4JJC A;  1R0C B;  3GIB A;  1K0S A;  2JOY A;  1OPL A;  1G3S A;  1K9A A;  2HEQ A;  3FDR A;  2QQS A;  2YUN A;  3QO3 A;  3CCU T;  2RPN A;  5C6S A;  2RJE A;  3M0P A;  2KT8 A;  3X24 B;  4J9B A;  1NYQ A;  2A8E A;  5GAM h;  2QA4 T;  2P84 A;  3UAT A;  4JRK A;  1TWB A;  1UG1 A;  4BI4 A;  4E7Z A;  2DE0 X;  3A8L B;  3CC2 T;  3OY9 A;  4UP8 A;  2DQ0 A;  1S1N A;  3NEM A;  2E3C A;  2LNH B;  5HK3 A;  2C06 A;  5FU7 C;  1ZLM A;  3HL8 A;  2K7A A;  4JJN K;  2ZPE B;  2K3Y A;  2GQI A;  2Y4Y A;  4IUR A;  2AZS A;  2EWN A;  5LJ3 j;  5FLX E;  3H9N A;  5GMK m;  3GNF B;  5J26 A;  1PG5 B;  3E9F A;  2G4C A;  3JB9 F;  2LQW A;  2QQ9 A;  3OA6 A;  1X2H A;  2DL3 A;  4DBQ A;  1IB8 A;  1ZX6 A;  2D8J A;  2EIF A;  4WJ3 M;  2LTO A;  5GAN 2;  2D8H A;  2RHU A;  2O9V A;  2Y4X A;  5DM7 R;  4TWA A;  1QCF A;  1W6X A;  3I55 A;  3V7R A;  2KRM A;  3G4S T;  4DEX A;  5A0G A;  1W70 A;  4DEY A;  1ARK A;  5DLQ E;  3TVT A;  2VC8 A;  2DM1 A;  4XAX B;  2RB6 A;  4HVW A;  2ZT5 A;  3CCL A;  4EMK A;  1VQO Q;  2ZXF A;  1NEB A;  4EMK B;  1UGQ B;  3HXW A;  2EJF A;  3M4Q A;  3QDR B;  3RUX A;  2QQR A;  4M7D E;  3JCM g;  3CCV T;  2HQE A;  3CMA A;  1D09 B;  1UFF A;  5GAM e;  2KEA A;  3J80 E;  4RG8 A;  3EFS A;  3PIP A;  2ZR3 A;  1YIJ A;  2XDD A;  3CCM Q;  3RL6 A;  1D1C A;  1G5H A;  2DQ3 A;  3L2W A;  4X5O A;  2I2L A;  2J05 A;  2CZ6 B;  3G6E Q;  3MP6 A;  3M0T A;  4ELZ C;  4BDY A;  5A0D A;  3NET A;  2M0Y A;  2JS0 A;  3CCS T;  4C5E A;  3PFS A;  3OW2 S;  1JRI A;  1SHF A;  2R5A A;  1GCP A;  1DJ7 B;  2I4L A;  1MHN A;  1X6G A;  4J6Y A;  4FYX B;  4N0A C;  2GFA A;  1QVF P;  3FJ5 A;  3I56 Q;  3HHT B;  3NEL A;  4JLI A;  2KVQ G;  1KK7 A;  2HSP A;  4CS4 A;  3E9I A;  3LWI A;  4DBH A;  1RL2 A;  2RM4 A;  1Q81 R;  3OYC A;  1EFW A;  3CCR Q;  4V2S A;  3M53 A;  2CYZ B;  1UDL A;  1YN8 A;  3LLR A;  5LJ5 e;  3HKS A;  1G5V A;  1JO8 A;  1V76 A;  5LJ3 h;  5ELN A;  3S3N A;  4M78 D;  4FCY A;  2DX1 A;  3MHX A;  4XU3 A;  2OJ2 A;  5GAO m;  4Q6G A;  1I4K 1;  1X56 A;  2YXY A;  3UWN A;  2XK0 A;  4OMF B;  2LDM A;  4QQ6 A;  2P5I A;  4UP7 A;  1N9S A;  1IXD A;  5K1X A;  3O8V A;  1ZA1 B;  3D7S B;  2GQV A;  3VS7 A;  4YRQ A;  3QDF A;  1PCX A;  4YRL A;  2MK5 A;  3AHU A;  5FU7 B;  1I0C A;  1UUE A;  3NTI A;  3IAL A;  5I22 A;  3IG2 A;  5IAY A;  1I5L A;  3RKX A;  1VQ9 Q;  1MGQ A;  1YJW A;  3MP8 A;  4X1V A;  2YWW A;  4MDW A;  2E3H A;  1RAA B;  5CAI A;  2RQR A;  1BCM A;  4JJB A;  3M4G A;  5E3I A;  3M57 A;  3A8H B;  1KQS A;  2DYI A;  2KRN A;  4P72 C;  1NJI C;  2LVM A;  4M78 E;  3MF2 A;  1UTI A;  2KNB B;  2NLU A;  2EYW A;  1K73 R;  4M75 C;  2ZR2 A;  3LC0 A;  1SSF A;  1MV3 A;  4A53 A;  2ECZ A;  2XKO C;  2O01 E;  2O9S A;  2NS6 A;  1RUW A;  3H41 A;  2CZ7 B;  3MCA B;  3EFR A;  3MEV A;  5IHK A;  2ZGW A;  3OMC A;  3SWN A;  1BCO A;  4A4K A;  2RMO A;  1M9S A;  1JU5 C;  4X9C A;  5GAN 8;  3L2V A;  4LDX A;  4JDS A;  3HRI A;  2VKN A;  4BE0 A;  5LJ3 e;  1MMD A;  4KRT A;  3I55 T;  1YHQ A;  4LVJ A;  3CPW P;  4B9X A;  2FL7 A;  4PHC A;  3MEU A;  4QW2 A;  4TVW A;  5D6Y A;  1AVZ C;  4C0Z A;  4C92 C;  2EQM A;  3CCL T;  1Y57 A;  4YPF A;  2Z0W A;  4AMC A;  4M7D G;  2OTL Q;  2JUF A;  2DIQ A;  4M78 F;  3CMA T;  3H8Z A;  4TQD A;  3SHW A;  1YI2 Q;  4HWR A;  4KGZ B;  4LUE A;  4PJO C;  3CCE Q;  1YIJ T;  3RKY A;  3M58 A;  2RQU A; 
#chains in the Genus database with same CATH homology
 1K8A C;  4N0A A;  4OGE A;  2PUK B;  4OVA A;  3RGL A;  4LDW A;  1EOV A;  2MI6 A;  2ZT6 A;  3NTK A;  2VYT A;  4H2T A;  3OYY A;  3L2R A;  2X4Y A;  1XQH A;  4IUP A;  2KK4 A;  1VQO A;  4G85 A;  2ZZD A;  1M1G A;  1LOJ A;  4KUI A;  3HFZ B;  1N9W A;  2CKK A;  4KBM B;  2VGN A;  4G84 A;  3JB9 J;  3WVD B;  2E1H A;  2ODR C;  4F7U E;  2Y90 A;  2ZZF A;  2P0L A;  4P73 C;  4MZT A;  3MF1 A;  3L2Z A;  3X28 B;  4C92 G;  4ZTJ A;  3JCM J;  2HQX A;  3M55 A;  4M7D A;  2QQB A;  3ZEH A;  4M7D B;  3VYG A;  2DU7 A;  3GPL A;  1U8R A;  2JTF A;  3L1A A;  1Y71 A;  3CC7 A;  3UDC A;  3GLX A;  4P3P A;  1QP2 A;  5KH6 A;  1X54 A;  2QEX A;  1K8A U;  4P75 C;  4EPC A;  5GAM g;  4P74 C;  3CEY A;  4M75 B;  3J81 E;  1YJW T;  2LT4 A;  2OAU A;  3A74 A;  1ADJ A;  4J83 A;  4L6V 5;  4LDV A;  4IUU A;  4J6W A;  2XTI A;  3TCJ A;  4F7U F;  4D6W A;  4HWP A;  2CZ1 B;  4JS5 A;  5C53 B;  1KMM A;  3LGF A;  1NZ9 A;  4JRI A;  1VQ7 T;  2J3M A;  4JUV A;  4Y91 A;  2M16 A;  3VQX A;  3GNG A;  4XTZ A;  2QTX A;  4C92 A;  2ZIN A;  4RKU E;  4C92 B;  4A4E A;  1ZHI A;  1KQ1 A;  1BI1 A;  5LJ5 g;  1PYS A;  1B70 A;  1PYS B;  1E22 A;  1B70 B;  1YHQ T;  2DEQ A;  1BIA A;  1H4T A;  4YRN A;  5CR2 A;  1R8O B;  3IKL A;  3L42 A;  4PJO B;  3SD4 A;  1M1K C;  1FX7 A;  1BI3 A;  5GAN j;  2ZZE A;  5FRM A;  3HFV A;  4ELY C;  4FU6 A;  3M54 A;  3FC3 A;  1N8R U;  4QVD A;  1H3Z A;  2EL9 A;  4RQE A;  1HXD A;  4QQG A;  2HBP A;  4XTW A;  3M5A A;  2XHC A;  4BB7 A;  3L2Q A;  2D6F A;  4YTL A;  3JB9 H;  4TVA A;  3M4P A;  2XG8 D;  4TVA B;  1NYR A;  4HVC A;  2DTO A;  2GF7 A;  2WAC A;  2PMF A;  4CH6 A;  1HK9 A;  3OD1 A;  2DKG A;  2DK3 A;  4XU2 A;  3P8H A;  3PIO A;  3G1Z A;  1H4Q A;  3CCE A;  5C52 B;  4YRO A;  3LW5 E;  3QKJ A;  5I2M A;  2LX9 A;  3KBG A;  1UGR B;  1EQR A;  3CBP A;  5LJ3 g;  3E1S A;  4P75 A;  3L2U A;  4YRS A;  2DD4 A;  4PNO A;  2QI2 A;  4P74 A;  1O75 A;  1GGM A;  3IKM B;  1KHI A;  1W66 A;  5CKB A;  2RHI A;  3CC7 T;  3LSS A;  1RI0 A;  5HY6 A;  2QEX T;  3MP1 A;  3OS1 A;  3DSQ A;  2R57 A;  5FU6 C;  1X75 C;  2K5F A;  3X25 B;  3UGQ A;  3TEE A;  4P5N A;  1WJS A;  3OYE A;  5GAO n;  3GF5 A;  4YYE A;  1Z7N A;  3QXE B;  1QVF S;  1Q82 U;  2WSF E;  1M1F A;  3HXZ A;  4FT4 A;  1WGS A;  3ME9 A;  3OYF A;  3E9H A;  4OB2 B;  4YRK A;  3MEA A;  1E1O A;  2RA2 A;  2RHS A;  2RHS B;  2Q7E A;  4RMO A;  3OS2 A;  2V8J A;  3C4S A;  3A8O B;  4ZGJ B;  4UPA A;  2MWP A;  3G71 A;  5CKF A;  3JRZ A;  4GY5 A;  3VUB A;  4J5Y A;  4H02 A;  1EIF A;  3VV0 A;  1VQK T;  3UFG A;  3HPW A;  3MEY A;  2P0Q A;  4C0G A;  2Q7G A;  4OLF A;  2PVD B;  4C5H A;  1KC8 C;  1VQL A;  4LNS A;  3RIR A;  1X2G A;  5GAN e;  4EO4 A;  2ZIM A;  2XGT A;  5IN1 A;  4YCU A;  1EVK A;  3TRE A;  3OYG A;  3S3O A;  4XK8 E;  3Q1J A;  2RI5 A;  3QYG B;  4M7D D;  3BY7 A;  5I2S A;  2DZ9 A;  4TVY A;  3QII A;  2FVU A;  1WPY A;  2PVO B;  2VGM A;  4OB0 B;  4IUQ A;  3PCO A;  3PCO B;  1W2B S;  4M75 D;  2FHD A;  2QQA A;  1TH7 A;  3CPW S;  2K5L A;  5KCO A;  5FU6 B;  4P71 A;  4GLK A;  11AS A;  2LC4 A;  3N5B B;  3DLL A;  2ZPH B;  3T9N A;  4O6J A;  1VQP A;  1BYM A;  1KC8 U;  5CCA A;  3QNE A;  3FLG A;  4EX5 A;  4C5G A;  4C92 D;  2HAX A;  3JAM E;  4BW9 A;  1QVG S;  2XI9 A;  4M75 E;  2MF2 A;  1JJ2 A;  3LYI A;  2WSC E;  1QW1 A;  4NOY A;  2LQ8 A;  3PT9 A;  4PJO D;  3FB9 A;  5D6X A;  2ARS A;  3P8V A;  2WSE E;  1U1S A;  3JCM f;  4L59 A;  3JCM X;  4BAC A;  5GMK j;  3UT1 A;  4TTV A;  3SFM A;  2ART A;  1M4Z A;  2YRV A;  3CMQ A;  3HXV A;  2JVV A;  3REX A;  3WVE B;  5CQX A;  4ZGD B;  2L3R A;  4M7D F;  5J39 A;  4KR2 A;  4C92 E;  3E9G A;  1YGB A;  2M0O A;  4RMF A;  2V8I A;  3PNW C;  4RCC A;  3OBW A;  3C95 A;  3HRT A;  4J8O A;  2ODR D;  1Y96 A;  4N4G A;  1Y96 B;  3G71 T;  3CCJ A;  3HXY A;  2H3J A;  4BI8 B;  4PJO E;  4E7K A;  3CC4 A;  4XEM A;  2KDS A;  1E1T A;  4TQF A;  3MET A;  3HRS A;  2E5A A;  2X35 A;  2PQW A;  1VQL T;  3HY0 A;  4BD3 A;  2ZPG B;  3V8J A;  1VUB A;  1G3T A;  4YRJ A;  1W2B A;  2HNI A;  2ZZG A;  3HFO A;  4LDY A;  1KD1 U;  2MWO A;  3QZ5 B;  4DA4 A;  5GAN 7;  4FT2 A;  2DU5 A;  1JJC B;  1WNL A;  1QE0 A;  2DAQ A;  4J15 A;  1KMN A;  4LVM A;  4PLL A;  3WXM B;  2EJG A;  4FL6 A;  3OYM A;  2EFI A;  3HY1 A;  2M1H A;  5A2Q E;  1AHJ B;  4HCZ A;  3OYA A;  1HTT A;  4XQ3 A;  2RJC A;  4R55 A;  4MMK A;  5GMK h;  3HRU A;  2RH2 A;  4P3O A;  4C8Q C;  2QHT A;  3OW2 A;  1YBY A;  2ARU A;  1YFT A;  1SER A;  1VQP T;  5L8R E;  3HSB A;  2ALY B;  4M77 C;  2JZ2 A;  3HP9 A;  2E6Z A;  2K3X A;  4EMG A;  5GAN g;  3L4G A;  4ZGE B;  3L4G B;  5CO7 A;  4M75 G;  4K87 A;  3KUF A;  1VQZ A;  3CBO A;  2LCL A;  2X4W A;  4OB3 B;  3JCM b;  2CJA A;  3HFZ A;  5LJ5 d;  4IKF A;  5K1P A;  5CIU A;  1XOV A;  2E70 A;  2E41 A;  3M9Q A;  1M90 C;  1P92 A;  4J7I A;  3CCM A;  2O4X A;  4QVC A;  2O4X B;  2LT1 A;  3G6E A;  5GAN 6;  3JCM P;  3LSQ A;  1SET A;  1V29 B;  2P0K A;  4C8Q G;  3PTA A;  3LWH A;  2PU9 B;  3TEH B;  5GMK e;  4N4I A;  1FWZ A;  4UP9 A;  4CS3 A;  3PMI A;  1WJQ A;  4Q15 A;  2XDB A;  3CCJ T;  3I56 A;  4YRE A;  4PJO G;  4M77 G;  4P72 A;  4M7A C;  3OQ5 A;  1OI1 A;  4K88 A;  5M9O A;  1YFR A;  1J5W A;  3P8Y A;  4M75 A;  3CCR A;  2D0Q B;  2LNV A;  4O2D A;  2EQJ A;  2R58 A;  5CQY A;  3GP8 A;  3RMS A;  3F70 A;  2DZC A;  3TUP A;  1N8R C;  2F5K A;  1NJ8 A;  4NS5 A;  4CRI A;  4BDZ A;  4DOW A;  2I4N A;  4A4G A;  3KXT A;  2DO3 A;  4ZTU B;  5A0L A;  1M90 U;  4P3N A;  2V8K A;  4QQD A;  3RF1 A;  3BDU A;  4C8Q A;  2DXU A;  5GAM f;  1VQ9 A;  4C8Q B;  2EJ9 A;  3A7A A;  1N6A A;  5I21 A;  2C7I A;  3X26 B;  2ZPI B;  4Z02 A;  3MEW A;  3SDZ A;  4JS4 A;  4N4H A;  2IG0 A;  3GOX A;  2RHX A;  2DD5 A;  4KT0 E;  3OSV A;  3QJ6 A;  4FM4 B;  4PJO A;  4M77 A;  2ZPF B;  2XDP A;  2BUD A;  1NPP A;  4M77 B;  3DB4 A;  5GMK i;  4J6X A;  4HT9 A;  4M7A G;  2KSS A;  1N27 A;  3NFC A;  1BBW A;  2IY5 A;  2IY5 B;  4BI3 A;  2ZCF B;  1PSE A;  2EAY A;  2Q7H A;  3ZFJ A;  5KE2 A;  3UGT A;  3OMG A;  4YCV A;  5LJ5 f;  5GAO q;  3QTC A;  2K5I A;  4H2U A;  2CJB A;  4YRG A;  5GMK l;  2DXT A;  1IZ6 A;  1WLE A;  5CKH A;  3ICA A;  3OS5 A;  4KUD K;  5FRN A;  4MZM A;  3P8B B;  1VQO T;  4P73 A;  4A54 A;  3OSS C;  3OYD A;  1LYL A;  4ZIB A;  4NL2 A;  1WQW A;  3V8K A;  1FXX A;  2OTL A;  3QJY A;  1Q82 C;  1YI2 A;  4DPG A;  3M4Y A;  3CCM T;  4PLI A;  3G6E T;  4BE1 A;  4E51 A;  4M7A A;  4M7A B;  4YP0 A;  1YB3 A;  1NJ2 A;  3HRK A;  2XID A;  1VQ6 A;  1VQN A;  4H2X A;  3LGL A;  4NL3 A;  4H2X B;  4LVK A;  3I56 T;  4YRF A;  3PMT A;  4DOV A;  3FIF A;  5DY9 A;  1NNH A;  3QO5 A;  3CCR T;  2Q5H A;  3FRN A;  1XNI A;  4ZN1 A;  1JBM A;  4E7L A;  4HCB A;  2IVW A;  5LJ3 f;  4ME7 A;  2E5Q A;  4BWA A;  1BI0 A;  1ZQ1 A;  3M56 A;  4A4F A;  1Q81 U;  2L5Q A;  3P8D A;  1EIY A;  1EIY B;  5AYF A;  3QYH B;  4EMK C;  2XIC A;  5C51 B;  3A8M B;  3CME A;  4XTV A;  4WJ4 A;  4AH6 A;  5CK9 A;  5GAO l;  3A7U A;  1VQ9 T;  1LNX A;  5GAN 4;  3URG A;  3VU3 C;  5IT9 E;  5LL6 S;  1D3B B;  2P4T A;  3A5Y A;  3JCM d;  2JNG A;  1E24 A;  2RHQ B;  2AKW A;  1G3W A;  2AKW B;  2F69 A;  4NCX A;  4FSX A;  3MQZ A;  3R07 A;  4LD6 A;  2GFU A;  3FEO A;  2ZNJ A;  2BKD N;  3OYK A;  4VUB A;  1K73 U;  3S6W A;  2KQW A;  4DQ2 A;  4CS2 A;  2VXF A;  1QVP A;  3NTH A;  5F5W A;  4OF1 A;  2Q5I A;  4L87 A;  1Z7M A;  5HK0 A;  1KQ2 A;  3CPF A;  4L5G A;  5ELO A;  4RG2 A;  3PZC A;  2K57 A;  3UH0 A;  1KHC A;  5KNN A;  2RI3 A;  2DTH A;  3CBM A;  1Q86 C;  1M5Q 1;  4KR3 A;  2OTL T;  2ZIO A;  2R5M A;  3V7C A;  3PGG A;  1YI2 T;  1IRE B;  4MDX A;  2ZCE A;  3QO7 A;  1W4S A;  3X20 B;  3UPU A;  3CCE T;  3VBB A;  2RJF A;  2VXE A;  2B8A A;  4WI1 A;  4WF2 A;  3JCM Q;  1QF6 A;  1QP3 A;  3BFM A;  2AMC A;  4R56 A;  4ZTF A;  2AMC B;  4LVI A;  4PKC C;  2DTI A;  4E7I A;  1OZ3 A;  1VQ6 T;  1VQN T;  1Y07 A;  5DLO A;  5LJ5 h;  1KQS S;  1H64 1;  2CIM A;  4KQE A;  3ZBD A;  1QVF A;  3VYH B;  2VV5 A;  3VQV A;  3NEN A;  5J3B A;  2XD0 A;  1KG1 A;  4YRC A;  1BI2 A;  4RCB A;  3ASK A;  2CGH A;  3SWN C;  5FRO A;  4C8Q D;  1NJ5 A;  4Y28 E;  3INZ A;  3H6Z A;  2K2V A;  2PVG B;  2K4Y A;  3A31 A;  2DDZ A;  4LVL A;  1SES A;  1Q86 U;  4RDX A;  2J3L A;  4CI0 C;  4OB1 B;  2A3L A;  4A4H A;  4M77 D;  1XTD A;  4X34 A;  1KD1 C;  3CME T;  3HFN A;  4C5I A;  1ASY A;  4ATO A;  2P0P A;  5GAN 3;  4C0D C;  4XU1 A;  2KAF A;  3CD6 A;  1B8A A;  4HWS A;  4C8Q E;  1YIT A;  2DXC A;  4PL6 A;  4JRP A;  2MMP A;  1H4S A;  4E7H A;  3RMQ A;  2DJZ A;  4M75 F;  2YLB A;  4M77 E;  1L0W A;  3QO8 A;  1Y7X A;  5GAN d;  4XTU A;  3V8L A;  2X4X A;  3BDL A;  1I81 A;  3QHS A;  1YCY A;  5KE3 A;  2E64 A;  2LQK A;  3JB9 G;  4ZN3 A;  1YJ9 A;  1RIQ A;  1O9S A;  3VKI A;  3EAE A;  4HT4 A;  3LH0 A;  1NJ1 A;  3CPW A;  1LJO A;  4M7A D;  3OB9 A;  4JRQ A;  4M7D C;  2ZT8 A;  3QBY A;  1N9R A;  4EDU A;  1YJN A;  1USY C;  1JJC A;  4C8Q F;  3C94 A;  3TU4 K;  4HWO A;  4C92 F;  2ZTG A;  1S72 A;  1JB0 E;  1K9M C;  3ER0 A;  3RES A;  2M9U A;  1HC7 A;  2E10 A;  5D6W A;  3J7A F;  2RD1 A;  3QUI A;  2DXB A;  1VQ7 A;  4PJO F;  4M77 F;  4JLG A;  4H2Y A;  3FJP A;  1X55 A;  4IUV A;  3JCM c;  3CCQ A;  3RKW A;  1QVG A;  1WYD A;  5KCH A;  4XEO A;  3SWN B;  4M7A E;  3TEG A;  5GAM d;  3A8G B;  3SB2 A;  3QG1 A;  2QDY B;  2ALY A;  4CH3 A;  4HWT A;  2RO0 A;  4BE2 A;  3BJU A;  2RHY A;  3RER A;  2LRQ A;  1BBU A;  4MZP A;  3A5Z A;  4MML A;  1I8F A;  2MAM A;  3A5Z B;  2X4J A;  1K9M U;  2DVE A;  3DKM A;  4C0D B;  4IUT A;  2PUO B;  1NJI U;  3A32 A;  5EG2 A;  4TVR A;  2I4O A;  4YRM A;  2LCC A;  1VQ8 A;  3HTZ A;  4M7A F;  2RK1 A;  2ZNI A;  1VQ5 A;  4LDU A;  3CD6 T;  1NJ6 A;  5GAN f;  4M78 C;  1B34 A;  1B34 B;  1YIT T;  5HKC A;  3VQY A;  3W3S A;  3TEH A;  12AS A;  2YHT A;  4YRT A;  1GXI E;  1UGS B;  2FB7 A;  5GAO p;  1YFS A;  1BKB A;  4CH5 A;  4HKE A;  3CC4 T;  2E12 A;  2XU8 A;  4XTX A;  4FIB A;  1WQ7 A;  4KUL A;  1USY A;  2FYK A;  1YJ9 T;  4BY6 C;  4HT8 A;  2HD0 A;  3R6O A;  1OYX A;  3JCM h;  1IL2 A;  2YLC A;  4H2V A;  1WJR A;  2C8M A;  2QHU A;  2ZT7 A;  1VQ4 A;  3DB3 A;  3JCM V;  1YJN T;  1S72 T;  4OP0 A;  1EVL A;  5LJ3 d;  4M78 G;  1OZ2 A;  5CKD A;  3DLM A;  3BW1 A;  3OYJ A;  4E7J A;  4XTY A;  3RAC A;  5GAO r;  1VQM A;  3LX7 A;  1BIB A;  4YRP A;  3MO8 A;  1X6O A;  2PME A;  3CCQ T;  2QXF A;  4BUG A;  4II1 A;  2KMT A;  2DPP B;  2BIV A;  4H2S A;  1WU7 A;  3QSU A;  4C0F A;  2RJD A;  4YRI A;  5HGQ A;  3CXC S;  3WQZ A;  2KY9 A;  2QHV A;  2OTJ A;  3M59 A;  5CVI A;  4CH4 A;  3VUZ A;  4J7F A;  3CCU A;  4RQF A;  3JCM e;  5CKE A;  1KOG A;  3OYN A;  3V7S A;  2CZ0 B;  1VQK A;  1ZBX A;  2EKO A;  1PSF A;  1B7Y A;  2EQK A;  1FYF A;  2QA4 A;  3OYI A;  1B7Y B;  3VJP A;  4M78 A;  2CJ9 A;  4M78 B;  2E6N A;  2E65 A;  3CC2 A;  1Q81 C;  4K86 A;  4HA8 A;  4ZTZ B;  3A7R A;  2RHZ A;  4EMH A;  1VQ8 T;  3E19 A;  4UC4 A;  3HXX A;  1Q7Y C;  4PG3 A;  1VQ5 T;  1B76 A;  2L8D A;  4Q5W A;  1U1T A;  1UGP B;  1NPR A;  4O5V A;  3G7Z A;  1ATI A;  2F5T X;  2JTM A;  5GAN 5;  4F7U G;  4X9D A;  4QVZ A;  3OYL A;  4OGC A;  4BY6 B;  2ZPB B;  2QHS A;  2VUB A;  1M1K U;  1SRY A;  2D9T A;  3ERR A;  5GAM j;  3G4S A;  2G3R A;  2GCX A;  1ASZ A;  2I4M A;  3HXU A;  4XU0 A;  4YCW A;  1K73 C;  3KFU A;  1C0A A;  3CCV A;  3REU A;  3OYB A;  4YRR A;  4YDQ A;  1G5I A;  3JCM W;  1VQ4 T;  3S3M A;  2RI2 A;  2CS7 A;  4P71 C;  5GAN h;  3OYH A;  1X01 A;  3QPH A;  1Q7Y U;  3JB9 D;  3OBY A;  1G3Y A;  3CCS A;  2EYQ A;  3C12 A;  2DIG A;  2A7Y A;  3OS0 A;  3I7F A;  5LJ5 j;  5C0M A;  3QZ9 B;  3JB9 I;  4LD9 K;  3CXC A;  2L89 A;  4E47 A;  4F7U A;  1VQM T;  1G51 A;  4F7U B;  1VIF A;  4H2W A;  1D3B A;  1M8V A;  1H4V B;  2RHQ A;  4HCC A;  2RK2 A;  3VQW A;  1UB4 A;  1ADY A;  1JJ2 S;  1NE8 A;  4B9W A;  2EQU A;  1VIE A;  1UEB A;  2JN0 A;  2AHJ B;  2OTJ T;  3P8T A;  3JSC A;  3GIB A;  2JOY A;  1G3S A;  3FDR A;  2QQS A;  3QO3 A;  3CCU T;  5C6S A;  2RJE A;  3X24 B;  1NYQ A;  2A8E A;  5GAM h;  2QA4 T;  4JRK A;  4BI4 A;  3A8L B;  3CC2 T;  3OY9 A;  4UP8 A;  2DQ0 A;  3NEM A;  2E3C A;  5HK3 A;  2C06 A;  5FU7 C;  3HL8 A;  4JJN K;  2ZPE B;  2K3Y A;  2Y4Y A;  4IUR A;  2EWN A;  5LJ3 j;  5FLX E;  5GMK m;  3GNF B;  5J26 A;  3E9F A;  2G4C A;  3JB9 F;  2QQ9 A;  3OA6 A;  1X2H A;  2EIF A;  4WJ3 M;  2LTO A;  5GAN 2;  2RHU A;  2Y4X A;  5DM7 R;  4TWA A;  3I55 A;  3V7R A;  3G4S T;  5A0G A;  5DLQ E;  2VC8 A;  4XAX B;  2RB6 A;  2ZT5 A;  3CCL A;  4EMK A;  2ZXF A;  4EMK B;  1UGQ B;  3HXW A;  2EJF A;  3M4Q A;  3QDR B;  3RUX A;  2QQR A;  4M7D E;  3JCM g;  3CCV T;  2HQE A;  3CMA A;  5GAM e;  3J80 E;  4RG8 A;  3EFS A;  3PIP A;  2ZR3 A;  1YIJ A;  2XDD A;  3RL6 A;  1G5H A;  2DQ3 A;  3L2W A;  4X5O A;  2I2L A;  2CZ6 B;  3MP6 A;  4ELZ C;  4BDY A;  5A0D A;  3NET A;  3CCS T;  4C5E A;  3PFS A;  3OW2 S;  1JRI A;  2R5A A;  1DJ7 B;  2I4L A;  1MHN A;  4J6Y A;  4N0A C;  2GFA A;  3HHT B;  3NEL A;  4JLI A;  2KVQ G;  4CS4 A;  3E9I A;  3LWI A;  1RL2 A;  2RM4 A;  3OYC A;  1EFW A;  4V2S A;  3M53 A;  2CYZ B;  3LLR A;  5LJ5 e;  3HKS A;  1G5V A;  5LJ3 h;  5ELN A;  3S3N A;  4M78 D;  3MHX A;  4XU3 A;  5GAO m;  4Q6G A;  1I4K 1;  1X56 A;  3UWN A;  2XK0 A;  4OMF B;  2LDM A;  4QQ6 A;  2P5I A;  4UP7 A;  1N9S A;  5K1X A;  3O8V A;  2GQV A;  4YRQ A;  4YRL A;  3AHU A;  5FU7 B;  3NTI A;  3IAL A;  3IG2 A;  5IAY A;  1I5L A;  3RKX A;  1MGQ A;  1YJW A;  3MP8 A;  4MDW A;  5CAI A;  3M4G A;  5E3I A;  3M57 A;  3A8H B;  1KQS A;  4P72 C;  1NJI C;  2LVM A;  4M78 E;  3MF2 A;  2NLU A;  4M75 C;  2ZR2 A;  3LC0 A;  1SSF A;  4A53 A;  2XKO C;  2O01 E;  2NS6 A;  2CZ7 B;  3MCA B;  3EFR A;  3MEV A;  2ZGW A;  3OMC A;  3SWN A;  4A4K A;  1M9S A;  4X9C A;  5GAN 8;  3L2V A;  4LDX A;  4JDS A;  3HRI A;  4BE0 A;  5LJ3 e;  3I55 T;  1YHQ A;  4LVJ A;  4B9X A;  2FL7 A;  4PHC A;  3MEU A;  4QW2 A;  4TVW A;  5D6Y A;  4C0Z A;  4C92 C;  2EQM A;  3CCL T;  4YPF A;  4M7D G;  2JUF A;  2DIQ A;  4M78 F;  3CMA T;  3H8Z A;  4TQD A;  4HWR A;  4PJO C;  1YIJ T;  3RKY A;  3M58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...