2DZCA

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
222
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGSPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 67
structure length 222
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dzcA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dzcA01
3QO3A 3HTZA 4PJOF 4BW9A 3JCMV 3JCMb 4M7DD 4AH6A 1MGQA 5GAMg 1M5Q1 2EWNA 2ZCEA 1E1TA 5GAN7 1HTTA 4P74A 2DVEA 4YP0A 4P75C 3NETA 2ZGWA 2J3MA 4H2XB 3RKWA 5GMKm 4YCWA 4C8QB 3VQWA 3BDUA 4XTUA 3TEHA 4YRJA 4J15A 3MEYA 4LNSA 3R07A 5GAN4 1IL2A 1LOJA 3L4GB 1N9SA 3RIRA 2Y90A 4CS2A 1EIYA 5GAOn 1LYLA 4C92B 4MMLA 2J3LA 4H2WA 2FB7A 4HWOA 5LJ5g 5GAOl 2DTOA 1QE0A 4M78C 1ADYA 3GIBA 1E1OA 1X54A 4OP0A 2ZZFA 2IY5A 4P73C 2DTIA 3NEMA 3HXZA 1JJCA 3RGLA 2RD1A 3JB9H 4M78F 3IG2A 2RHSA 4EMKA 2AKWA 3HFNA 5GAOp 4YYEA 4RQFA 1NJ1A 4TVAB 1HK9A 2ARSA 5GAN8 4M75E 3JCMh 4DPGA 1YB3A 1SERA 3MF2A 1ASYA 3BFMA 3V7RA 1VQZA 4UP9A 4UP8A 1FYFA 2RM4A 2Q5IA 1Z7NA 1Z7MA 4KQEA 5GAN2 4K86A 3VU3C 2ZZGA 2ZTGA 4TQFA 3CMQA 4M7AE 4WJ4A 12ASA 1WQWA 2RHQA 4K88A 3FJPA 4O2DA 3PGGA 1BBUA 3SB2A 1ADJA 1U1SA 4P72C 4KR2A 2E65A 2EAYA 3NENA 3PCOB 4ZTZB 2DXUA 3A32A 4ZTUB 1PYSA 2VXEA 4C8QC 1G5HA 4JUVA 1B7YA 4PJOE 1B76A 4CS4A 4H2UA 2E41A 1B8AA 2CJBA 3JCMX 2ZIOA 4M7AA 1D3BA 1G5IA 1Y96A 3A5ZA 3A7UA 4JRIA 5GMKl 1X2HA 3JCMf 5K1XA 2RA2A 3AHUA 4WI1A 4YRKA 3WQZA 3PZCA 4P3OA 1EVKA 4M77G 3DSQA 2QTXA 2Q5HA 2CJAA 2DQ0A 1WPYA 2I4NA 3LSQA 2PMFA 4XTWA 3RUXA 3JB9I 3QO7A 2ZNIA 2DDZA 4TVAA 4PG3A 3HSBA 1YGBA 2DU7A 1H4QA 4M7DE 4C8QA 4XTVA 4L87A 4M77C 3RKYA 4KR3A 3RF1A 3P8VA 3L1AA 4C92F 4DQ2A 4TWAA 3HY1A 4YPFA 2DU5A 2QHVA 4X5OA 4YRQA 5GAN3 4PJOC 3V7CA 4QVCA 2I4LA 2ODRC 4TTVA 1ASZA 4H2YA 3UGTA 3E9HA 1BIBA 4NL3A 1QF6A 3QNEA 1WLEA 4M7DF 1L0WA 5ELOA 3JCMc 1D3BB 3A74A 4V2SA 1HXDA 2CGHA 1NJ6A 4M78G 3A5YA 2E5AA 2ZXFA 3MF1A 4QVDA 2ZIMA 4PHCA 3HXVA 3A7AA 4TVYA 4YROA 3EFSA 2RHQB 4UPAA 1I8FA 4M7AD 4YDQA 3BJUA 3RESA 3FIFA 4P71C 3HFVA 3RL6A 2C7IA 4NOYA 3JCMQ 4YRGA 4M7AF 4BWAA 5GAMh 3JCMe 3L2ZA 2YLCA 1LJOA 4K87A 4RDXA 4F7UG 1C0AA 2DJZA 3M4QA 4EMKB 3LSSA 5LJ5e 1KMNA 1PYSB 5DY9A 4UP7A 5KNNA 4G84A 4XQ3A 1X56A 4PJOD 3QO5A 4P3PA 4YRIA 3HRKA 2RHSB 1BIAA 3P8TA 2DZ9A 1N9RA 4M78E 1H4TA 4XU3A 4F7UE 5LJ5j 3A31A 1JJCB 5C53B 1KQ1A 4CH3A 3SWNB 1USYA 4EO4A 4Q6GA 4RQEA 4JLIA 2JN0A 1I5LA 4PJOG 4HVCA 2ARUA 3QHSA 3ERRA 3V8LA 1E22A 4P71A 4XTZA 2P0LA 2I4OA 2DXTA 4YRTA 3REXA 2ARTA 5GAMf 4M7AC 4J5YA 4XU1A 2YHTA 5LJ3d 1HC7A 2QHTA 2E64A 2YLBA 4M7DA 1JBMA 1I4K1 5GAOr 2AMCB 4HWRA 2QHSA 4E51A 4YRSA 5GMKj 3FB9A 3RERA 4YRFA 2ZR3A 4Y91A 4F7UF 4WF2A 4G85A 3INZA 2ZNJA 4M78B 1NJ8A 3HXYA 5LJ5f 1YCYA 3HFZB 3JCMJ 4M7DG 4C8QG 4HWTA 1Y96B 4Q15A 4M7AB 2IY5B 4OLFA 2ZT6A 1BBWA 3P8YA 5GMKe 1KQ2A 3QTCA 3V7SA 2ZT7A 4XTYA 1B7YB 4XEOA 4YRMA 5F5WA 1NJ2A 3VQVA 5GAMj 5GANe 4YRCA 4C92A 5GANh 1WYDA 1JRIA 3RACA 1B70A 4YCVA 4P74C 4PJOA 2I4MA 4HA8A 2C8MA 3IKMB 4X9CA 3I7FA 2VXFA 5GANf 2EJ9A 2E3CA 3IALA 1H641 3HFOA 2DQ3A 1NNHA 5GAMe 5GAN5 5LJ5d 1YFRA 2DTHA 2RB6A 3JB9F 4TQDA 1EVLA 1X2GA 4PNOA 4YRLA 4XTXA 4N0AA 4HWPA 3M4GA 4M77B 1M8VA 1H4SA 3VBBA 4HT9A 4M77D 3JCMg 2ALYB 4H2VA 5LJ3e 1TH7A 4TVWA 2CIMA 2XGTA 5GANd 1I81A 3JCMW 4P73A 3UGQA 4F7UA 3PCOA 4H2SA 4RCBA 4YRPA 11ASA 1N9WA 2Q7GA 4NL2A 1EOVA 4C8QF 2ZZEA 4WJ3M 4M78D 4H02A 5LJ3h 4YREA 4HWSA 3HXUA 5K1PA 3HXWA 4C92E 2I2LA 4X9DA 4M77F 2DEQA 3TUPA 4YRNA 2K57A 1GGMA 4EX5A 1E24A 1EFWA 2HNIA 5LJ5h 1SRYA 1YFSA 4CH4A 4HT8A 4P75A 3L4GA 1WNLA 2P5IA 3JB9D 1NJ5A 1SESA 3HY0A 4C92D 5E3IA 4M75A 1X55A 4EMGA 2VC8A 4EMKC 3JCMP 1EQRA 3QO8A 3TEHB 3A7RA 5CAIA 5GMKi 1G51A 2DKGA 2AKWB 1X01A 4J6YA 2ZT8A 5ELNA 3BW1A 1U1TA 4H2XA 4P72A 3M4PA 3NELA 3ICAA 4YCUA 4M75G 1ATIA 4M75C 4M7DB 4PJOB 1YFTA 5GMKh 1B70B 1WQ7A 2CJ9A 5GAMd 5GAOq 1NYRA 3IKLA 1USYC 1LNXA 2XTIA 4N0AC 3HRIA 4C8QD 1EIYB 1W66A 3VQXA 2ZINA 4JRKA 4J6XA 2Q7EA 3SWNC 3HFZA 5C52B 1NYQA 1RIQA 4M78A 3LC0A 4J6WA 4C92G 3V8JA 3UFGA 5GAN6 1WU7A 5GANj 4XEMA 4M7DC 3BY7A 4C8QE 2ALYA 2E10A 3G1ZA 2PMEA 3JB9G 2ZR2A 4F7UB 2DZCA 4M75B 3JB9J 4C92C 2AMCA 5HGQA 4XU2A 4EMHA 3W3SA 4P3NA 4M75F 4M7AG 1B34A 1H4VB 4NCXA 3EFRA 1B34B 4M77A 4RMFA 5C51B 4XU0A 3QUIA 1KOGA 4YRRA 3V8KA 2G4CA 4M77E 2Q7HA 2EJGA 4M75D 3TEGA 2EL9A 3OD1A 1SETA 4CH6A 3KFUA 4RCCA 4CS3A 3VQYA 4ZIBA 4H2TA 4A54A 3SWNA 2E1HA 2EJFA 4A53A 1J5WA 3JCMd 5LJ3g 3RKXA 5LJ3j 3QSUA 2QHUA 2ZT5A 3E9IA 5GAOm 2ODRD 2FYKA 5GANg 4CH5A 3REUA 1KMMA 5I21A 3HXXA 5LJ3f 3UH0A 4MMKA
chains in the Genus database with same CATH superfamily
1FX7A 2KQWA 3QO3A 3A98A 2L3PA 3OYJA 1WHLA 2GFUA 2KBTA 4L5GA 3UF4A 3UDCA 4IUQA 1VQ7Q 1M5Q1 3H0FA 2EWNA 4EIKA 2ZCEA 2DA9A 3OSVA 2DVEA 2RH2A 4H2XB 1CKAA 2DM1A 3TQ7P 4A4EA 3H0IA 1K1ZA 3G6EQ 3CCRT 2ED0A 3BDUA 1W2BP 1AWJA 5DLOA 4BE2A 3X25B 1TS9A 5GAN4 1AHJB 2RK1A 1VQNA 2HEQA 1W6XA 3FRNA 3A8MB 3PT9A 4C92B 4XK8E 1M4ZA 2J3LA 1G3YA 2FB7A 4LNPA 1QVGS 4HWOA 5LJ5g 3G71T 3VV0A 3DB4A 4LXCA 2LNVA 4M78C 2M0YA 2G6FX 3GIBA 2ZZFA 2DTIA 1VQ4T 3RGLA 3QJYA 4KBMB 1UHFA 1H8KA 1Q95G 5IXBA 3JB9H 4AMCA 5ECAA 2RHSA 2V8IA 1U3OA 2X4WA 1AVZC 1NJ1A 2ESWA 3QYHB 3MEUA 3E9FA 1G3SA 1KC8R 2LZ6B 1K8AC 2RQWA 1SERA 2NLUA 2HCKA 3BFMA 3V7RA 2DXCA 2RM4A 2J05A 4BB7A 1QWEA 2ZZGA 3REBB 1VQ5T 3C95A 2RHQA 1XNIA 2CUBA 3FC3A 2KAFA 3CPFA 1UJYA 1XOVA 3FJPA 4O2DA 1BI3A 3SB2A 2ZPBB 1QVGA 2EAYA 1M2VB 2DXUA 4RKUE 4LDUA 4N4IA 1R0BG 2VYTA 4C8QC 1G5HA 3M53A 4PJOE 3HP9A 3CD6Q 4H2UA 1Q7YU 2IIMA 4DA4A 1B8AA 2QEXQ 4IUPA 3OYYA 4JJBA 4ANJA 3C4SA 3A7UA 4OB1B 5GMKl 3I56T 1AEYA 1KD1R 3JCMf 3OYFA 1SF9A 3AHUA 3WQZA 4ELZC 3PZCA 3HRSA 1EVKA 2DILA 4F14A 2HSEB 2QTXA 2GTOA 2LDMA 3LWHA 1Q81R 1OYXA 4QQGA 2O9SA 3CC7T 2I4NA 3LX7A 2PMFA 3RUXA 4FU6A 2D6FA 1VQLA 2VGNA 3QWYA 4HCBA 2DD5A 3X24B 4UC4A 1YBYA 4BE1A 2RI2A 3RNJA 3H9NA 4C92F 4A4KA 2O31A 1K73C 2QHVA 4KT0E 1LVKA 5GAN3 4PJOC 1NJIR 3URGA 4QVCA 2I4LA 3C0CA 4HXJA 1VQOQ 3TSWA 4NL3A 1QCOA 3CCET 4FYWB 4M78G 4FL6A 1VA7A 4QVDA 1YJWQ 1IRXA 1QVPA 3RMSA 4TVYA 4YROA 1YIJQ 2JS0A 3C12A 2A08A 2SEMA 4E2FB 4M7AD 1T3LA 2EKOA 4BDYA 4IUUA 2EYQA 1EX4A 1OPLA 4P71C 4MZTA 2OTJT 2LJ1A 2C7IA 1W4SA 2DRMA 4YRGA 1KD1C 1UB4A 3MCAB 4ZTFA 2KRSA 2EYXA 1BK2A 2O4XA 1BCOA 1JJ2S 3O5ZA 2CP5A 2NWMA 4OMOA 3EH1A 2W10A 2ABLA 3P8TA 3CPWA 2P4RA 1B7TA 4CRIA 1H4TA 4XU3A 5D6YA 3A31A 1KQ1A 2ED1A 3I5SA 1USYA 4EO4A 2K4YA 4Q6GA 4JLIA 5L8RE 1I5LA 4PJOG 4HVCA 3ERRA 1UDLA 2DEUA 2JVVA 1SRMA 5FWCA 1BCMA 2ARTA 4XAXB 5GAMf 1M1KU 2NUPB 1VQPT 3CMAT 4ZN1A 2AIRB 2QXFA 1YHQQ 1WI7A 1RAEB 2LQNA 3TCJA 2CUDA 2JTMA 4L6V5 5IHKA 2QHSA 1M1GA 2GTJA 4LN2A 4E51A 4PK4A 1TSFA 3OYEA 3CCJA 3RERA 4YRFA 3VS0A 4HVUA 1T3SA 4Y91A 1R77A 3CCVA 4FIBA 1VQ6T 4G85A 2KR3A 1QWFA 4J7IA 2C06A 2XDDA 3JCMJ 3J7AF 2G3RA 4J9IA 4ME7A 4OLFA 3EG9A 2BIVA 2RK2A 3CPWS 5I22A 5GMKe 1R0CB 2FVUA 3MP8A 3PVLA 1G3WA 3OQ5A 1GFDA 4XEOA 3I55A 5KE2A 5GAMj 1V29B 3NFCA 4GLKA 4OGEA 4C92A 2LQWA 3F70A 1JRIA 2FEIA 4GLMA 4YCVA 3A8OB 1BKBA 1ZHIA 3CC4A 1ZA2B 3IKMB 4P5NA 4GBQA 5GANf 2QDLA 3LYIA 1NE8A 2E3CA 2KT8A 2H3JA 2XMFA 2CZ7B 1NBEB 1JJ2P 2CSQA 1YJ9A 5GAN5 1S1NA 2C0IA 4JLGA 4OMMA 5FROA 2KYBA 2LVMA 2KRNA 1E7OA 1EVLA 1X2GA 4YRLA 2MWOA 3M4GA 1M8VA 5CVIA 1VQ7T 3THKA 4ZNXA 1VQOT 1ABQA 1ZX6A 2O88A 1TXQA 2DJQA 3LLRA 3VS2A 1FMWA 4P73A 3UGQA 4Z88A 4CC2A 2AKLA 2EGAA 4NL2A 2HMAA 4WJ3M 1N8RR 4HWSA 5K1PA 2M1HA 4HVVA 1GBRA 2K5FA 4NS5A 1D0ZA 4M77F 2SRCA 1VQ9A 3TUPA 2K57A 3OYAA 4EX5A 1RAAB 1EFWA 3TEEA 4RTUA 5LJ5h 1YFSA 3NMZC 2M9UA 3HRTA 2E6NA 3L4GA 1ZSGA 4F16A 3VS3A 5E3IA 2CKKA 4EMGA 2VC8A 4EMKC 5KYXA 3JCMP 2RN8A 4YTLA 5CAIA 5GMKi 4J6YA 3CCRA 2COYA 1H3HA 3BW1A 2ZT8A 2L89A 3LGLA 3CPWP 1WGSA 3EFOB 1QVFS 2A36A 2QEXT 4M75G 1ATIA 4M75C 4M7DB 5FU6B 2EW3A 4DOVA 1YFTA 3OYLA 2DK3A 5GAMd 4M4ZA 3SD4A 3MKDA 1LNXA 2XTIA 4PJMA 4RTZA 4DOWA 1EIYB 1PG5B 3RMQA 2L2PA 2DIQA 2VVKA 1NYQA 1RIQA 2PVGB 4M78A 3LC0A 4C92G 2Y4YA 3LGFA 2QA4Q 3UFGA 4XEMA 3OYKA 3BY7A 4FYYB 2BZYA 3HTRA 1RI0A 2GFAA 2CT4A 3JB9G 8ATCB 4RTYA 2EQMA 4DBQA 4P3NA 1PSFA 2CP3A 1VQ5A 2MAMA 3OA6A 4M7AG 1H4VB 4O5VA 3P8DA 2X4JA 3PFSA 1VQMA 3CC2Q 1TUDA 1MMAA 2EL9A 1D09B 1SEMA 3CC7Q 2RHUA 3E9GA 2A0FB 1V1CA 4A54A 2LX7A 4C5HA 1VQNT 2Y4XA 1MV3A 1VYUA 2ZT5A 1VQKA 2ODRD 3CCLT 2OJ2A 2FYKA 1KMMA 3N5BB 2HQEA 4BDZA 3VS5A 1ZUUA 2GGRA 2KI7A 3J81E 1B3QA 3JCMb 1MGQA 1JXMA 2A28A 3QZ9B 5CO7A 1I07A 2F69A 2GQIA 2DVJA 3PNWC 5CKDA 4YP0A 2DPPB 3OS2A 4RTVA 1VQLT 4O6JA 1Y07A 2K7AA 4AFZC 4R55A 2PTKA 4YCWA 2EGEA 2NS6A 3CCJQ 2MPXC 4XTUA 4N4GA 3TEHA 2ZAEA 4YRJA 4J15A 5EC7A 1YJNA 2RNAA 3CC4T 5A0GA 4LNSA 3VRYA 1UGPB 4LDXA 2D8HA 3OYIA 4CS2A 1N9SA 3NTIA 5GAOl 2DTOA 2L0AA 2CP0A 3UATA 3VS7A 2ECZA 4WTOB 1QVFP 4LUEA 1E1OA 4PLIA 2IY5A 4P73C 1Q7YC 3E19A 3DLLA 2DE0X 2HD0A 2LQ8A 4PFOA 2ATCB 4BE0A 5HKCA 2LT4A 4JS4A 2V1RA 4EMKA 1WZOA 4LD9K 3CCMT 1IREB 5GAN8 2C0OA 4DPGA 2D9TA 2E3IA 1YB3A 5GJWB 1ASYA 3CCQQ 1M3AA 3C94A 5AT1B 2QDYB 1NG2A 2CH4A 2Q5IA 1G83A 1Z7NA 1Z7MA 1VQKQ 1X6GA 4CI0C 2RJEA 2ZPEB 3TSZA 1M90U 4TQFA 1UGQB 4M7AE 1NYGA 4QQDA 1CKBA 4OB3B 3PGGA 1V76A 4KR2A 1GCQA 3NENA 3QBYA 3X28B 3ME9A 4PKCC 2DXBA 1YJ9T 3UT1A 1RADB 4CS4A 3ZFJA 1ZSZB 4M7AA 1G5IA 1Y96A 3A5ZA 4J9CA 3CCUT 1I5OB 2RF0A 2CP7A 5K1XA 2EYZA 3UPUA 2CYZB 2GF7A 3CC7A 1VQ4Q 5FRMA 1MMDA 3TVTA 3S3MA 3OW2P 2Q5HA 1QP3A 3KFVA 2BUDA 2AK5A 1D0YA 1D1AA 1A0NB 3QG1A 4PFPA 1UGVA 2L3QA 2ZNIA 2QQAA 2DDZA 4TVAA 4PG3A 3HSBA 1KIKA 3RKYA 4KR3A 3RF1A 3P8VA 1YITA 2D8JA 2P0PA 4C0FA 4DQ2A 4TWAA 3HY1A 2EIFA 2H3EB 5KCOA 2FRWA 3L2QA 5KYYA 3MEVA 4C0DC 3PVQA 4H2YA 3UGTA 1IGQA 3MP1A 1ZSZC 2KXDA 3PTAA 4ORZA 3M0PA 3JCMc 5ELOA 4V2SA 2CGHA 1M90C 2XK0A 3SHWA 2ZIMA 3HXVA 1N27A 2HAXA 2K9GA 5KYWB 4DBFA 3T9NA 1WXTA 1K9MR 1OEBA 5KYUA 3HFVA 3RL6A 4JJDA 3PMIA 4NOYA 3L2RA 2ROTA 4JS5A 5GAMh 2DRKA 1ACMB 3L2ZA 1NM7A 3A5ZB 3X20B 2KMTA 1CSKA 4RDXA 1QP2A 4F7UG 2COZA 1X43A 1KMNA 4LVJA 5DY9A 2A37A 4C0DB 1Q82R 2LNHB 3A8GB 1QW1A 3M59A 3QO5A 4P3PA 4YRIA 2RHSB 1VQ9Q 2ZZDA 2M0OA 4BI4A 3OYCA 1VQ4A 5C0MA 2DL3A 4M78E 3TU4K 3I56Q 5LJ5j 1D1CA 1JJCB 4JZ4A 1RI9A 1DJ7B 2JN0A 2ARUA 1XJWB 2O2OA 4R0KA 4P71A 1UGSB 2EVRA 2XIDA 4YRTA 8AT1B 3GF5A 2A8EA 2ZPIB 5HY6A 2V26A 1OULA 4FT2A 2L3SA 2F2VA 2YLBA 4M7DA 1I4K1 3ZEHA 3ULRB 4BUGA 4HWRA 1N8RC 4YRSA 1YN8A 1HD3A 2ENMA 4C0ZA 1LPLA 3S6WA 4OGCA 4F7UF 3GOXA 3INZA 2ZNJA 2FPFA 4KGXB 4E7HA 2X51A 5LJ5f 1NJ8A 4ATOA 1YCYA 3CEYA 1S72T 4M7AB 1T0HA 4KULA 3P8YA 1OZ2A 4BI8B 4XTYA 1B7YB 1KK7A 1M30A 3MP6A 2HKQB 1VQ6A 3CQTA 3MHXA 1IXDA 4P74C 2K3XA 4HA8A 2C8MA 2K2VA 3RBBB 1PRLC 1D1BA 3I7FA 2VXFA 2EJ9A 2JNGA 2BZXA 1H641 1KQSS 1YP5A 2RPNA 2CZ0B 3CCRQ 2QI2A 3L2VA 3I5RA 5DM7R 5CK9A 1MV0B 4TQDA 4FCYA 1Q82C 4FW2A 1H3ZA 1WJRA 4KUDK 2LT1A 2YRVA 1E6GA 4FM4B 3EG2A 1H4SA 2KRMA 1IZ6A 4JRQA 2RQTA 4H2VA 2OI3A 1TH7A 1OX9A 4II1A 3JAME 2CIMA 1G5VA 3QPHA 2D1XA 4H2SA 4HCKA 1N9WA 4RMOA 2EYWA 1R8OB 2CP2A 2IG0A 4C8QF 2X3XD 3G4ST 4YREA 3HXUA 2L5QA 3CC4Q 4C92E 2I2LA 2FL7A 2DEQA 2QG9B 1ZUYA 1GGMA 1NJIU 1BI0A 1JB0E 2VWFA 2JMAA 2PNIA 1C0MA 2DYIA 3G4SQ 1WNLA 4LE9A 2IVWA 3S3OA 2K79A 1SESA 3HY0A 3QIIA 2GBQA 4M75A 3QO8A 3VJPA 1Y71A 4J9GA 3OYBA 5A0LA 2ZPGB 1NLPC 3CCUQ 1OOTA 1U1TA 5D7UA 3LWIA 1K0XA 2DNUA 2HQHA 2DL7A 3PE0A 5GMKh 1B70B 1WX6A 1SSFA 3MEWA 4JJCA 4ZGDB 3M56A 1USYC 1VIFA 1E6HA 1TUCA 1VYVA 4J7FA 2E12A 1YJNQ 1WHHA 2PZ1A 2ZINA 4JRKA 2DETA 1VQ8T 2X9HA 4J6XA 1Q7YR 3SWNC 3NHNA 4DEXA 1J3TA 3CC2T 1N5ZA 3V8JA 1PHTA 5GAN6 5I11A 5GANj 5KE3A 2RMOA 3G1ZA 2PMEA 2LQKA 2PVOB 2BE9B 1KC8U 1S72Q 4J9EA 3JB9J 4AT1B 4EMHA 3QJ6A 4E47A 2M02A 1W70A 3EFRA 1B34B 2QYZA 1K9MU 2OTLT 2FZKB 1KOGA 4YRRA 3V8KA 2G4CA 4M77E 1Y0MA 2EJGA 2EGCA 4M75D 5CQYA 4C5EA 3KFUA 4CH6A 4RCCA 1M27C 1X2QA 1GBQA 4CS3A 4N4HA 4ZIBA 1YWPA 4H2TA 2EJFA 2VB6A 2RO0A 4HVWA 3QSUA 3CXCS 1QQJA 3E9IA 5KYWA 1N8RU 1GL5A 3UH0A 2FHDA 5HCKA 3IQLA 4ZGJB 1YJWA 2KGTA 2ROLA 2K3YA 3HTZA 2C0TA 4BW9A 4OVAA 1SSHA 1PWTA 4A63B 3L2WA 3JCMV 2L3RA 2QQRA 4PFZA 3OY9A 4AH6A 2CZ6B 2KROA 1VOMA 1E1TA 3ZL7C 2WSEE 5GAN7 4D6WA 1HTTA 4P74A 3EFOA 4Q5WA 2CDTA 2MF2A 2OAUA 3EGXA 5GMKm 1WHJA 3VQWA 1BI2A 9ATCB 3CCSA 3R07A 3EHQA 4IIMA 4B9XA 4MZMA 2QA4T 4FYVB 4J9FA 3RIRA 2Y90A 5GAOn 1LYLA 2LC4A 3CCQT 3QDFA 5L23A 1HSQA 3UWNA 1QE0A 3CCMQ 2X4YA 1PCXA 1M1KC 1YHQT 1ADYA 1X54A 3SFMA 4OP0A 4LDYA 5A0DA 3NEMA 4Z02A 3NGPA 5CR2A 2RD1A 1YITQ 2QGFB 3IG2A 1FYNA 2EKHA 1YI2T 4YYEA 5GAOp 2RQUA 5KYXB 2JT4A 2DFUA 1QKXA 3NTKA 1YHQA 4ELYC 3JCMh 2JTEA 2ZPHB 3M5AA 3MF2A 4QKUA 5DLQE 4UP9A 2YUNA 4UP8A 1M1FA 3CMEA 1FYFA 4LDWA 3WVDB 4KQEA 5CIUA 5GAN2 3EGDB 1K4US 3MQZA 4AFSC 2ZTGA 3CMQA 1PM3A 3CMAA 1VQPA 4K88A 1YIJT 2BZ8A 2NYSA 4ESRA 3CCST 2F2XA 1OX8A 2MCNA 1BBUA 3HKSA 1U1SA 4P72C 3CMEQ 1YFNA 4ZTZB 3A32A 2QEXA 1Q86R 3VS4A 4FW1A 1B7YA 1B76A 3OYGA 3H6ZA 1WHKA 2CJBA 1PC0A 2ZIOA 1VIEA 4WCIA 1EZZB 1M8MA 2PVDB 1Q81C 2QQBA 3P8HA 4JRIA 4E7SA 3OW2A 1ZBXA 5D6XA 1G3TA 2E4HA 1YJWT 4P3OA 3GNGA 4M77G 2QQ9A 3OW2S 3CMET 3D7SB 4OMQA 4R56A 2RQRA 2OTJQ 1SPKA 3SDZA 4RTXA 2DAQA 2CJAA 2DQ0A 3LSQA 1EFNA 1VQ5Q 6AT1B 3QO7A 5FU7C 3UA7A 1YGBA 2CT3A 2DU7A 4C8QA 1O9SA 5M9OA 4L87A 3A1PA 2KK4A 3EGUA 3PMTA 1P92A 3OMCA 4IURA 3OYDA 3S3NA 1LCKA 2WSCE 1RAGB 2MIOA 2QK0A 1GRIA 4YPFA 2DU5A 5J39A 5HK0A 2F1LA 2RHIA 2ODRC 2DO3A 1KQSP 1KFZA 1NEGA 3MJXA 3E9HA 2J6KA 1QF6A 2EYYA 5D6WA 1D3BB 3A74A 2EFIA 1HXDA 1NJ6A 3A5YA 1I1JA 2ZXFA 4PHCA 2EQIA 3MF1A 2J6FA 2J06A 5CKBA 1RUWA 4OMFB 3M9QA 3EFSA 4HT4A 3R6NA 3I9QA 2J7IA 4UPAA 1I8FA 4YDQA 3RESA 4Z8AA 3FIFA 2R57A 1PKSA 2CS7A 1QCFA 2JOYA 4M7AF 4BWAA 1RAHB 1Q86C 2XKOC 1VUBA 3M57A 1NLOC 2E3HA 2XU8A 1NEBA 2JW4A 2X4XA 3HPWA 4AG1C 1C0AA 2DJZA 2E6ZA 3M4QA 3G1JA 4EMKB 2YUPA 3OBYA 5LJ5e 1XQHA 3QDRB 2CH4W 2KY9A 4UP7A 1ZSZA 2EBPA 4G84A 4XQ3A 4ZTJA 1FXXA 5FRNA 1X56A 1F1BB 2OAWA 3HRKA 1BIAA 2DZ9A 3CCEA 1S72A 2DF6A 5FU6C 3OBWA 2DBMA 3E2UA 1JXOA 3SWNB 2YUOA 4CH3A 4C5GA 4E7JA 4LUDA 5C6SA 3V8LA 4XTZA 2P0LA 3H8ZA 2DXTA 2JM9A 4CC4B 3EG0A 2DL5A 2V8JA 4J5YA 4XU1A 1X75C 3OS5A 2YHTA 5LJ3d 1HC7A 4X1VA 3G6ET 2QAZA 2RI5A 2XDBA 4QT7A 3G71Q 3L2UA 5GMKj 3FB9A 3MO8A 4MZPA 4DBRA 2ZR3A 2BE7D 2J6OA 1UEBA 1WJQA 3CCEQ 4C5IA 4M7DG 1WFWA 2IY5B 4KUIA 4LD6A 3V7SA 1TWBA 2FO0A 4EDUA 2ZT7A 4YRMA 5J3BA 2QGGA 1NJ2A 5GANe 4YRCA 1ZQ1A 2OTJA 5GANh 1WYDA 4BD3A 1B70A 2XDPA 4PJOA 2I4MA 4X9CA 3IALA 1C1AA 5CQXA 3HFOA 1VQMT 2DQ3A 2DL4A 2MMPA 5GAMe 3CCUA 3I56A 4MDXA 5LJ5d 1UECA 1YFRA 2DTHA 3CXCP 1OI1A 1PRMC 4N0AA 3M0QA 1VQMQ 4M77B 3PIOA 3KBGA 2E70A 4E7IA 3VBBA 3RR6A 4HT9A 3JCMg 2MYSA 3M55A 1IB8A 2LP5A 3FJ5A 4M77D 5FW9A 2ALYB 5LJ3e 1C6VX 1Q86U 4TVWA 2P84A 3EG3A 3Q1JA 5GANd 1I81A 3R6OA 3JCMW 1VQOA 3PCOA 4RCBA 4YRPA 11ASA 2LJ0A 2Q7GA 4JRPA 3CD6T 2ZZEA 1M2OA 2CP6A 2MOXA 1AD5A 4M78D 1X27A 3I55T 3H41A 3CBPA 3CCMA 2X35A 4X9DA 1WXBA 4OMLA 3NPFA 1E24A 2HNIA 4VUBA 4Y28E 4CH4A 1G8XA 4HT8A 1YI2Q 2B8AA 2EQJA 2MI6A 4E7ZA 2FRYA 1SKUB 1NJ5A 2K3BA 1WA7A 1Z9ZA 1T0JA 1M90R 1X55A 4BY6C 1EQRA 1JJ2A 3TEHB 1K8AR 4DBHA 1BBZA 1PKTA 1UHCA 2DKGA 1X01A 4PJLA 2LCSA 1U8RA 5ELNA 3QXEB 4P72A 4A4HA 3M4PA 3CCVQ 5AYFA 3NELA 2FZCB 1JEGA 2CSIA 2YT6A 2NUZA 5FLXE 2F5TX 1MMNA 1RACB 3G71A 5GAOq 1KSWA 1MNEA 2NUTA 1NYRA 3IKLA 1VQNQ 3CXCA 1OPKA 1OU8A 4N0AC 3CCVT 3HRIA 3HL8A 4C8QD 2KYMA 3NTHA 1YJNT 4E6RA 1W66A 3VQXA 3GNFB 2KE9A 3PIPA 2Q7EA 4KRTA 5C52B 4KH0B 2NUTB 2XICA 3JV3A 1WU7A 4M7DC 1Y7XA 3AT1B 1SRLA 4C8QE 4JJNK 4F7UB 2R5AA 2RHXA 4C92C 4BY6B 2JXBA 4FT4A 5HGQA 4XU2A 3W3SA 2XI9A 1B34A 2QTVA 2DL8A 5I2MA 1VQLQ 1K9AA 1MHNA 1M3CA 4M77A 5C51B 2DERA 2LMJA 3QUIA 3LH0A 1X2KA 3GLXA 4OMNA 1X69A 3OB9A 1NJIC 2Q7HA 1SHFA 2M16A 3TEGA 2JJ9A 1AT1B 1UJ0A 2E1HA 4A53A 2MK5A 1J5WA 1MUZA 4A4GA 3JCMd 2QA4A 2XD0A 2QHUA 1B07A 2R5MA 5LJ3j 1WYXA 2YRDA 2D0QB 5GANg 3REUA 5LJ3f 3M0SA 1TG0A 3EH2A 1AWWA 4RTTA 4KGVB 4IUTA 4OMPA 1PD0A 3EAEA 4GY5A 4PJOF 3G4SA 3CD6A 4FSSA 2YSQA 4D8DA 2Z0WA 2BKDN 4M7DD 3VRZA 3JRZA 5IN1A 2FZGB 1VQ9T 5GAMg 1Y57A 4J83A 3VUZA 1UUEA 2VKNA 3VYGA 4P75C 3OS0A 1FMKA 3NETA 2ZGWA 1BYMA 2J3MA 3RKWA 3OYHA 1ZA1B 4C8QB 4OB0B 1WDXA 3M0RA 1AZEA 4CC3A 3JSCA 2HDAA 3MEYA 2RJFA 2FG0A 2A3LA 4AFUC 1IL2A 3I55Q 2VUBA 1EIFA 1LOJA 2AT1B 1VQ6Q 3L4GB 4LDVA 1EIYA 1QLYA 4MMLA 1IHWA 4H2WA 3BE3A 2O01E 2MWPA 4Z89A 2K2MA 3H0HA 1NPPA 1TU0B 3WVEB 1YJ9Q 5KYYB 1ZLMA 3HXZA 1K0SA 1JJCA 3VUBA 1YITT 3A8HB 2RI3A 4M78F 4HCZA 1TUGB 2AKWA 3HFNA 2RHYA 4RQFA 4E7KA 2KXCA 4TVAB 1HK9A 3P8BB 2ARSA 4LVKA 4M75E 3TREA 3EG1A 1AOJA 1W1FA 1VQZA 4B6MA 4J8OA 3G7ZA 3META 4JPBW 3REAB 4K86A 4LVIA 3VU3C 1QCNA 4WJ4A 12ASA 1WQWA 1H92A 2FPEA 2KVQG 2PUKB 3CCJT 2K5IA 5A2QE 2KT1A 2HL3A 2JTFA 4EPCA 2EQKA 3ER0A 1ADJA 2E65A 3PCOB 1VQ7A 2JM8A 4ZTUB 2VV5A 3FEOA 1PYSA 2VXEA 1JO8A 4JUVA 4RTWA 2E41A 1JQQA 3A8LB 1QMCA 3JCMX 1Z9QA 3EG9B 1RAFB 1D3BA 5KCHA 1X6BA 1Q82U 1IO6A 1U5SA 4PL6A 1X2HA 2KNBB 2E5KA 2RJCA 4OB2B 4RG2A 2RA2A 4WI1A 4YRKA 5IAYA 3M0UA 1SG5A 2OX7A 5IHNA 3DSQA 3OYMA 2HBPA 2K6DA 1FWZA 2AHJB 1TTHB 4KGZB 3DKMA 2OTLA 3DLMA 1XTDA 1WPYA 1RABB 4XTWA 3JB9I 2P0QA 1GFCA 2LTOA 1KHIA 1H4QA 4M7DE 1KD1U 3J80E 4XTVA 4M77C 1RAIB 4JZ3A 3CBOA 3L1AA 4DEYA 1KC8C 2HSPA 1ARKA 2HL5C 2LCCA 4IIOA 4X5OA 4YRQA 3V7CA 4FYXB 2LX9A 3EHRA 4TTVA 1ASZA 1K9MC 1WLPB 1BIBA 3QNEA 4FSXA 3CCLQ 1WLEA 2ZPFB 4M7DF 1L0WA 3DB3A 1HJDA 1M2VA 2FPDA 2RHZA 3UA6A 2E5AA 1YIJA 3ASKA 2LRQA 2PUOB 3A7AA 3VS1A 3CCSQ 2JZ2A 2RHQB 4LVLA 3OMGA 2O9VA 1GXIE 3RDVA 1ZUKA 2EQUA 3G6EA 3U23A 3BJUA 2DD4A 3MPUB 1ZBJA 2GCXA 2PU9B 2COWA 3FDRA 1TOVA 1K8AU 3JCMQ 2AKKA 2V8KA 2GNCA 1YNZA 1MMGA 3JCMe 1WXUA 3HRUA 1OU9A 2YLCA 4QQ6A 1UFFA 1LJOA 3BDLA 2YDLA 4K87A 4AFQC 2JMCA 2E5QA 3LSSA 2D0NA 1PYSB 2YUQA 2CZ1B 5GJVB 4D8KA 3KXTA 5KNNA 1M1KR 2PQWA 5CCAA 4PJOD 1ABOA 3CCLA 2B86A 3OSSC 5IXFA 2O4XB 4E7LA 2I0NA 1N9RA 1D0XA 4J9DA 1IHVA 4F7UE 5C53B 4F17A 5IH2A 4B9WA 4RQEA 2F2WA 2P4TA 3QHSA 4F04B 3GPLA 1Q81U 2DLPA 2DMOA 1E22A 3M4YA 4ZGEB 2K5LA 2I4OA 3ZBDA 3EGDA 1KJWA 3REXA 4M7AC 1MNDA 2HQXA 2XHCA 2P0KA 3GBQA 3CC2A 1OQKA 1AZGB 1UE9A 1PSEA 1IGUA 3O8VA 2QHTA 2E64A 1JBMA 3VS6A 5GAOr 1UG1A 4IUVA 1YCSB 2AMCB 5IHIA 1K73U 4RUGA 1VQKT 3EGXB 5KH6A 1U06A 5FU7B 1GCPA 1BB9A 4WF2A 3HHTB 4M78B 1YWOA 3HXYA 1JU5C 3HFZB 1PNJA 3M58A 3CBMA 4HWTA 4C8QG 1Y96B 4Q15A 1OZ3A 1RLQC 5FWBA 2ZT6A 3OS1A 2YWWA 1BBWA 1KQ2A 2A7YA 3QTCA 1BI1A 1WHGA 4PJJA 4CC7A 5F5WA 3VQVA 4QVZA 3LW5E 2X3WD 5KYNA 1NYFA 3RACA 1K76A 2HBWA 1VQ8Q 2F5KA 3L42A 4J9HA 2R58A 4TVRA 4C0GA 2KSSA 1NNHA 2KEAA 1KG1A 4J9BA 1N6AA 1M3BA 3VYHB 2RB6A 3JB9F 2H8HA 1O75A 4QW2A 4PNOA 3CCQA 5J26A 4XTXA 1RL2A 4HWPA 1I0CA 4KH1B 3VKIA 1NPRA 2XGTA 3QYGB 4JDSA 1AWXA 3MEAA 4F7UA 4HCCA 3FLGA 5CKEA 1WHMA 1EOVA 3GP8A 1WJSA 4H02A 2W0ZA 5CKHA 5LJ3h 5CKFA 1W2BA 2ZCFB 3HXWA 1FMVA 2YRCA 1G2BA 1VYTA 1VQ8A 4YRNA 5EG2A 3QKJA 2CREA 1SRYA 1W2BS 4P75A 2M51A 2RJDA 3KUFA 4X34A 2P5IA 3JB9D 1KQSA 3WXMB 1K73R 4K11A 2OTLQ 3I35A 4C92D 1X6OA 4ZN3A 3A7RA 3X26B 4L59A 1G51A 2AKWB 1PD1A 3E1SA 1UTIA 4AG2C 1QVGP 1NZ9A 2YXYA 4PJNA 3M54A 4H2XA 3ICAA 4YCUA 1HYOA 2DIGA 2JUFA 2VGMA 4BACA 2WSFE 4PJOB 1WQ7A 2CJ9A 2NUPA 2IPOB 4BI3A 2EPDA 5I2SA 2AZVA 1AWOA 2QQSA 3OYNA 2WACA 2JS2A 2LCLA 4RG8A 2L8DA 1WIEA 3HFZA 1BU1A 2KDSA 3QZ5B 1RLPC 1UGRB 1GCQC 2V1QA 3LH5A 4J6WA 2DYBA 4MDWA 2ALYA 2E10A 1OV3A 2ZR2A 2DZCA 5IT9E 1SHGA 4M75B 3QWXX 3M0TA 2AMCA 5HK3A 4OF1A 4PLLA 4M75F 4NCXA 2BTTA 2XG8D 2QASA 3SEMA 2HKNA 7AT1B 5LL6S 4RMFA 4HKEA 4XU0A 4IKFA 1QKWA 1YI2A 2VASA 2RQVA 2DBKA 1M9SA 1QVFA 3OD1A 1SETA 2LJ3A 5KYUB 4Y92A 3VQYA 3SWNA 3CMAQ 1VQPQ 5LJ3g 1KHCA 3RKXA 4A4FA 5GAOm 2HZYA 4LVMA 4CH5A 2DX1A 5I21A 3HXXA 2AZSA 4MMKA 2GQVA
chains in the Genus database with same CATH topology
1FX7A 2KQWA 3QO3A 3OYJA 2GFUA 4L5GA 3UDCA 4IUQA 1M5Q1 2EWNA 2ZCEA 3OSVA 2DVEA 2RH2A 4H2XB 4A4EA 3CCRT 3BDUA 5DLOA 4BE2A 3X25B 5GAN4 1AHJB 2RK1A 1VQNA 3FRNA 3A8MB 3PT9A 4C92B 4XK8E 1M4ZA 2J3LA 1G3YA 2FB7A 1QVGS 4HWOA 5LJ5g 3G71T 3VV0A 3DB4A 4M78C 2LNVA 3GIBA 2ZZFA 2DTIA 1VQ4T 3RGLA 3QJYA 4KBMB 3JB9H 2RHSA 2V8IA 2X4WA 1NJ1A 3QYHB 3MEUA 3E9FA 1G3SA 1K8AC 1SERA 2NLUA 3BFMA 3V7RA 2DXCA 2RM4A 4BB7A 2ZZGA 1VQ5T 3C95A 2RHQA 1XNIA 3FC3A 2KAFA 3CPFA 1XOVA 3FJPA 4O2DA 1BI3A 3SB2A 2ZPBB 1QVGA 2EAYA 2DXUA 4RKUE 4LDUA 4N4IA 2VYTA 4C8QC 1G5HA 3M53A 4PJOE 3HP9A 4H2UA 1Q7YU 4DA4A 1B8AA 4IUPA 3OYYA 3C4SA 3A7UA 4OB1B 5GMKl 3I56T 3JCMf 3OYFA 3AHUA 3WQZA 4ELZC 3PZCA 3HRSA 1EVKA 2QTXA 2LDMA 3LWHA 1OYXA 4QQGA 3CC7T 2I4NA 3LX7A 2PMFA 3RUXA 4FU6A 2D6FA 1VQLA 2VGNA 4HCBA 2DD5A 3X24B 1YBYA 4UC4A 4BE1A 2RI2A 4C92F 4A4KA 2QHVA 4KT0E 5GAN3 4PJOC 3URGA 4QVCA 2I4LA 4NL3A 3CCET 4M78G 4FL6A 4QVDA 1QVPA 3RMSA 4TVYA 4YROA 3C12A 4M7AD 2EKOA 4BDYA 4IUUA 2EYQA 4P71C 4MZTA 2OTJT 2C7IA 1W4SA 4YRGA 1KD1C 1UB4A 3MCAB 4ZTFA 2O4XA 1JJ2S 3P8TA 3CPWA 4CRIA 1H4TA 4XU3A 5D6YA 3A31A 1KQ1A 1USYA 4EO4A 2K4YA 4Q6GA 4JLIA 5L8RE 1I5LA 4PJOG 4HVCA 3ERRA 2JVVA 2ARTA 4XAXB 5GAMf 1M1KU 1VQPT 3CMAT 4ZN1A 2QXFA 3TCJA 2JTMA 4L6V5 2QHSA 1M1GA 4E51A 3CCJA 3RERA 3OYEA 4YRFA 4Y91A 3CCVA 4FIBA 1VQ6T 4G85A 4J7IA 2C06A 2XDDA 3JCMJ 3J7AF 2G3RA 4ME7A 4OLFA 2BIVA 2RK2A 3CPWS 5GMKe 2FVUA 3MP8A 1G3WA 3OQ5A 4XEOA 3I55A 5GAMj 5KE2A 1V29B 3NFCA 4GLKA 4OGEA 4C92A 3F70A 1JRIA 4YCVA 3A8OB 1BKBA 1ZHIA 3CC4A 3IKMB 4P5NA 5GANf 3LYIA 1NE8A 2E3CA 2H3JA 2CZ7B 1YJ9A 5GAN5 4JLGA 5FROA 2LVMA 1EVLA 1X2GA 4YRLA 2MWOA 3M4GA 1M8VA 5CVIA 1VQ7T 1VQOT 3LLRA 4P73A 3UGQA 4NL2A 4WJ3M 4HWSA 5K1PA 2M1HA 2K5FA 4NS5A 4M77F 1VQ9A 3TUPA 2K57A 3OYAA 4EX5A 1EFWA 3TEEA 5LJ5h 1YFSA 2M9UA 3HRTA 2E6NA 3L4GA 5E3IA 2CKKA 4EMGA 2VC8A 4EMKC 3JCMP 5CAIA 4YTLA 5GMKi 4J6YA 3CCRA 2ZT8A 3BW1A 2L89A 3LGLA 1WGSA 1QVFS 2QEXT 4M75G 1ATIA 4M75C 4M7DB 5FU6B 4DOVA 1YFTA 3OYLA 2DK3A 5GAMd 3SD4A 1LNXA 2XTIA 4DOWA 1EIYB 3RMQA 2DIQA 1NYQA 1RIQA 2PVGB 4M78A 3LC0A 4C92G 2Y4YA 3LGFA 3UFGA 4XEMA 3OYKA 3BY7A 1RI0A 2GFAA 3JB9G 2EQMA 4P3NA 1PSFA 1VQ5A 2MAMA 3OA6A 4M7AG 1H4VB 4O5VA 3P8DA 2X4JA 3PFSA 1VQMA 2EL9A 2RHUA 3E9GA 4A54A 4C5HA 1VQNT 2Y4XA 2ZT5A 1VQKA 2ODRD 3CCLT 2FYKA 1KMMA 3N5BB 2HQEA 4BDZA 3J81E 3JCMb 1MGQA 3QZ9B 5CO7A 2F69A 3PNWC 5CKDA 4YP0A 2DPPB 3OS2A 1VQLT 4O6JA 1Y07A 4R55A 4YCWA 2NS6A 4XTUA 4N4GA 3TEHA 4YRJA 4J15A 1YJNA 3CC4T 5A0GA 4LNSA 1UGPB 4LDXA 3OYIA 4CS2A 1N9SA 3NTIA 5GAOl 2DTOA 1E1OA 4PLIA 2IY5A 4P73C 1Q7YC 3E19A 3DLLA 2HD0A 2LQ8A 4BE0A 5HKCA 2LT4A 4JS4A 4EMKA 4LD9K 3CCMT 1IREB 5GAN8 4DPGA 2D9TA 1YB3A 1ASYA 3C94A 2QDYB 2Q5IA 1Z7NA 1Z7MA 4CI0C 2RJEA 2ZPEB 1M90U 4TQFA 1UGQB 4M7AE 4QQDA 4OB3B 3PGGA 4KR2A 3NENA 3QBYA 3X28B 3ME9A 4PKCC 2DXBA 1YJ9T 3UT1A 4CS4A 3ZFJA 4M7AA 1G5IA 1Y96A 3A5ZA 3CCUT 5K1XA 3UPUA 2CYZB 2GF7A 3CC7A 5FRMA 3S3MA 2Q5HA 1QP3A 2BUDA 3QG1A 2ZNIA 4TVAA 2QQAA 2DDZA 4PG3A 3HSBA 3RKYA 4KR3A 3RF1A 3P8VA 1YITA 2P0PA 4C0FA 4DQ2A 4TWAA 3HY1A 2EIFA 5KCOA 3L2QA 3MEVA 4C0DC 4H2YA 3UGTA 3MP1A 3PTAA 5ELOA 3JCMc 4V2SA 2CGHA 1M90C 2XK0A 2ZIMA 3HXVA 1N27A 2HAXA 3T9NA 3HFVA 3RL6A 3PMIA 4NOYA 3L2RA 4JS5A 5GAMh 3L2ZA 3A5ZB 3X20B 2KMTA 4RDXA 1QP2A 4F7UG 1KMNA 4LVJA 5DY9A 4C0DB 3A8GB 1QW1A 3M59A 3QO5A 4P3PA 4YRIA 2RHSB 2ZZDA 2M0OA 4BI4A 3OYCA 1VQ4A 5C0MA 3TU4K 4M78E 5LJ5j 1JJCB 1DJ7B 2JN0A 2ARUA 4P71A 1UGSB 2XIDA 4YRTA 3GF5A 2A8EA 2ZPIB 5HY6A 4FT2A 2YLBA 4M7DA 1I4K1 3ZEHA 4BUGA 4HWRA 1N8RC 4YRSA 4C0ZA 3S6WA 4OGCA 4F7UF 3GOXA 3INZA 2ZNJA 4E7HA 1NJ8A 5LJ5f 4ATOA 1YCYA 3CEYA 1S72T 4M7AB 4KULA 3P8YA 1OZ2A 4BI8B 4XTYA 1B7YB 3MP6A 1VQ6A 3MHXA 4P74C 2K3XA 4HA8A 2C8MA 2K2VA 3I7FA 2VXFA 2EJ9A 2JNGA 1H641 1KQSS 2CZ0B 2QI2A 3L2VA 5DM7R 5CK9A 4TQDA 1Q82C 1H3ZA 1WJRA 4KUDK 2LT1A 2YRVA 4FM4B 1H4SA 1IZ6A 4JRQA 4H2VA 1TH7A 4II1A 3JAME 2CIMA 1G5VA 3QPHA 4H2SA 1N9WA 4RMOA 1R8OB 4C8QF 2IG0A 3G4ST 4YREA 3HXUA 2L5QA 4C92E 2I2LA 2FL7A 2DEQA 1GGMA 1NJIU 1BI0A 1JB0E 1WNLA 2IVWA 3S3OA 1SESA 3HY0A 3QIIA 4M75A 3QO8A 3VJPA 1Y71A 3OYBA 5A0LA 2ZPGB 1U1TA 3LWIA 5GMKh 1B70B 1SSFA 3MEWA 4ZGDB 3M56A 1USYC 1VIFA 4J7FA 2E12A 2ZINA 4JRKA 1VQ8T 4J6XA 3SWNC 3CC2T 3V8JA 5GAN6 5GANj 5KE3A 3G1ZA 2PMEA 2LQKA 2PVOB 1KC8U 3JB9J 4EMHA 3QJ6A 4E47A 3EFRA 1B34B 1K9MU 2OTLT 1KOGA 4YRRA 3V8KA 2G4CA 4M77E 2EJGA 4M75D 5CQYA 4C5EA 3KFUA 4CH6A 4RCCA 4CS3A 4N4HA 4ZIBA 4H2TA 2EJFA 2RO0A 3QSUA 3CXCS 3E9IA 1N8RU 3UH0A 2FHDA 4ZGJB 1YJWA 2K3YA 3HTZA 4BW9A 4OVAA 3L2WA 3JCMV 2L3RA 2QQRA 3OY9A 4AH6A 2CZ6B 1E1TA 2WSEE 5GAN7 4D6WA 1HTTA 4P74A 4Q5WA 2MF2A 2OAUA 5GMKm 3VQWA 1BI2A 3CCSA 3R07A 4B9XA 4MZMA 2QA4T 3RIRA 2Y90A 5GAOn 1LYLA 2LC4A 3CCQT 3UWNA 1QE0A 2X4YA 1M1KC 1YHQT 1ADYA 1X54A 3SFMA 4OP0A 4LDYA 5A0DA 3NEMA 4Z02A 5CR2A 2RD1A 3IG2A 1YI2T 4YYEA 5GAOp 3NTKA 1YHQA 4ELYC 3JCMh 2ZPHB 3M5AA 3MF2A 5DLQE 4UP9A 4UP8A 1M1FA 3CMEA 1FYFA 4LDWA 3WVDB 4KQEA 5CIUA 5GAN2 3MQZA 2ZTGA 3CMQA 3CMAA 1VQPA 4K88A 1YIJT 3CCST 1BBUA 3HKSA 1U1SA 4P72C 4ZTZB 3A32A 2QEXA 1B7YA 1B76A 3OYGA 3H6ZA 2CJBA 2ZIOA 1VIEA 2PVDB 1Q81C 2QQBA 3P8HA 4JRIA 3OW2A 1ZBXA 5D6XA 1G3TA 1YJWT 4P3OA 3GNGA 4M77G 2QQ9A 3OW2S 3CMET 4R56A 3SDZA 2DAQA 2CJAA 2DQ0A 3LSQA 3QO7A 5FU7C 1YGBA 2DU7A 4C8QA 1O9SA 5M9OA 4L87A 2KK4A 3PMTA 1P92A 3OMCA 4IURA 3OYDA 3S3NA 2WSCE 4YPFA 2DU5A 5J39A 5HK0A 2RHIA 2ODRC 2DO3A 3E9HA 1QF6A 5D6WA 1D3BB 3A74A 2EFIA 1HXDA 1NJ6A 3A5YA 2ZXFA 4PHCA 3MF1A 5CKBA 4OMFB 3M9QA 3EFSA 4HT4A 4UPAA 1I8FA 4YDQA 3RESA 3FIFA 2R57A 2CS7A 2JOYA 4M7AF 4BWAA 1Q86C 2XKOC 1VUBA 3M57A 2XU8A 2X4XA 3HPWA 1C0AA 2DJZA 2E6ZA 3M4QA 4EMKB 3OBYA 5LJ5e 1XQHA 3QDRB 2KY9A 4UP7A 4G84A 4XQ3A 4ZTJA 1FXXA 5FRNA 1X56A 3HRKA 1BIAA 2DZ9A 3CCEA 1S72A 5FU6C 3OBWA 4CH3A 3SWNB 4C5GA 4E7JA 5C6SA 3V8LA 4XTZA 2P0LA 3H8ZA 2DXTA 2V8JA 4J5YA 4XU1A 1X75C 3OS5A 2YHTA 5LJ3d 1HC7A 3G6ET 2RI5A 2XDBA 3L2UA 5GMKj 3FB9A 3MO8A 4MZPA 2ZR3A 1UEBA 1WJQA 4C5IA 4M7DG 2IY5B 4KUIA 4LD6A 3V7SA 4EDUA 2ZT7A 4YRMA 5J3BA 1NJ2A 5GANe 4YRCA 1ZQ1A 2OTJA 5GANh 1WYDA 4BD3A 1B70A 2XDPA 4PJOA 2I4MA 4X9CA 3IALA 5CQXA 3HFOA 1VQMT 2DQ3A 2MMPA 5GAMe 3CCUA 3I56A 4MDXA 5LJ5d 1YFRA 2DTHA 1OI1A 4N0AA 4M77B 3PIOA 3KBGA 2E70A 4E7IA 3VBBA 4HT9A 4M77D 3M55A 3JCMg 2ALYB 5LJ3e 1Q86U 4TVWA 3Q1JA 5GANd 1I81A 3R6OA 3JCMW 1VQOA 3PCOA 4RCBA 4YRPA 11ASA 2Q7GA 4JRPA 3CD6T 2ZZEA 4M78D 3I55T 3CBPA 3CCMA 2X35A 4X9DA 1E24A 2HNIA 4VUBA 4Y28E 4CH4A 4HT8A 2B8AA 2EQJA 2MI6A 1NJ5A 1X55A 4BY6C 1EQRA 1JJ2A 3TEHB 2DKGA 1X01A 1U8RA 5ELNA 3QXEB 4P72A 4A4HA 3M4PA 5AYFA 3NELA 5FLXE 2F5TX 3G71A 5GAOq 1NYRA 3IKLA 3CXCA 4N0AC 3CCVT 3HRIA 3HL8A 4C8QD 1YJNT 3NTHA 1W66A 3VQXA 3GNFB 3PIPA 2Q7EA 5C52B 2XICA 1WU7A 4M7DC 1Y7XA 4C8QE 4JJNK 4F7UB 2R5AA 2RHXA 4C92C 4BY6B 4FT4A 5HGQA 4XU2A 3W3SA 2XI9A 1B34A 5I2MA 1MHNA 4M77A 5C51B 3QUIA 3LH0A 3GLXA 3OB9A 1NJIC 2Q7HA 2M16A 3TEGA 4A53A 2E1HA 1J5WA 4A4GA 2QA4A 3JCMd 2XD0A 2QHUA 5LJ3j 2R5MA 2D0QB 5GANg 3REUA 5LJ3f 4IUTA 3EAEA 4GY5A 4PJOF 3CD6A 3G4SA 2BKDN 4M7DD 3JRZA 5IN1A 1VQ9T 5GAMg 4J83A 3VUZA 3VYGA 4P75C 3OS0A 3NETA 2ZGWA 1BYMA 2J3MA 3RKWA 3OYHA 4C8QB 4OB0B 3JSCA 3MEYA 2RJFA 2A3LA 1IL2A 2VUBA 1EIFA 1LOJA 3L4GB 4LDVA 1EIYA 4MMLA 4H2WA 2O01E 2MWPA 1NPPA 3WVEB 3HXZA 1JJCA 3VUBA 1YITT 3A8HB 2RI3A 4M78F 4HCZA 2AKWA 3HFNA 2RHYA 4RQFA 4E7KA 4TVAB 1HK9A 3P8BB 2ARSA 4LVKA 4M75E 3TREA 1VQZA 4J8OA 3G7ZA 3META 4K86A 4LVIA 3VU3C 4WJ4A 12ASA 1WQWA 2KVQG 2PUKB 3CCJT 2K5IA 5A2QE 2JTFA 4EPCA 2EQKA 3ER0A 1ADJA 2E65A 3PCOB 1VQ7A 4ZTUB 2VV5A 3FEOA 1PYSA 2VXEA 4JUVA 2E41A 3A8LB 3JCMX 1D3BA 5KCHA 1Q82U 4PL6A 1X2HA 2RJCA 4OB2B 4RG2A 2RA2A 4WI1A 4YRKA 5IAYA 3DSQA 3OYMA 2HBPA 1FWZA 2AHJB 3DKMA 2OTLA 3DLMA 1XTDA 1WPYA 4XTWA 3JB9I 2P0QA 2LTOA 1KHIA 1H4QA 4M7DE 1KD1U 3J80E 4XTVA 4M77C 3CBOA 3L1AA 1KC8C 2LCCA 4X5OA 4YRQA 3V7CA 2LX9A 4TTVA 1ASZA 1K9MC 1BIBA 3QNEA 4FSXA 1WLEA 2ZPFB 4M7DF 1L0WA 3DB3A 2RHZA 2E5AA 1YIJA 3ASKA 2LRQA 2PUOB 3A7AA 2JZ2A 2RHQB 4LVLA 3OMGA 1GXIE 2EQUA 3G6EA 3BJUA 2DD4A 2GCXA 2PU9B 3FDRA 1K8AU 3JCMQ 2V8KA 3JCMe 3HRUA 2YLCA 4QQ6A 1LJOA 3BDLA 4K87A 2E5QA 3LSSA 1PYSB 2CZ1B 3KXTA 5KNNA 2PQWA 5CCAA 4PJOD 3CCLA 3OSSC 2O4XB 4E7LA 1N9RA 4F7UE 5C53B 4B9WA 4RQEA 2P4TA 3QHSA 3GPLA 1Q81U 1E22A 3M4YA 4ZGEB 2K5LA 2I4OA 3ZBDA 3REXA 4M7AC 2HQXA 2XHCA 2P0KA 3CC2A 1PSEA 3O8VA 2QHTA 2E64A 1JBMA 5GAOr 4IUVA 2AMCB 1K73U 1VQKT 5KH6A 4WF2A 5FU7B 3HHTB 4M78B 3HXYA 3HFZB 3M58A 3CBMA 4HWTA 4C8QG 1Y96B 4Q15A 1OZ3A 2ZT6A 3OS1A 1BBWA 1KQ2A 2A7YA 3QTCA 1BI1A 5F5WA 3VQVA 4QVZA 3LW5E 3RACA 2F5KA 3L42A 2R58A 4TVRA 4C0GA 2KSSA 1NNHA 1KG1A 1N6AA 3VYHB 2RB6A 3JB9F 1O75A 4QW2A 4PNOA 3CCQA 5J26A 4XTXA 1RL2A 4HWPA 3VKIA 1NPRA 2XGTA 3QYGB 4JDSA 4F7UA 3MEAA 4HCCA 3FLGA 5CKEA 1EOVA 3GP8A 1WJSA 4H02A 5CKHA 5LJ3h 5CKFA 1W2BA 2ZCFB 3HXWA 1VQ8A 4YRNA 5EG2A 3QKJA 1SRYA 1W2BS 4P75A 2RJDA 3KUFA 4X34A 2P5IA 3JB9D 1KQSA 3WXMB 4C92D 1X6OA 4ZN3A 3A7RA 3X26B 4L59A 2AKWB 1G51A 3E1SA 1NZ9A 3M54A 4H2XA 3ICAA 4YCUA 2DIGA 2JUFA 2VGMA 4BACA 2WSFE 4PJOB 1WQ7A 2CJ9A 4BI3A 5I2SA 2QQSA 3OYNA 2WACA 2LCLA 4RG8A 2L8DA 3HFZA 2KDSA 3QZ5B 1UGRB 4J6WA 4MDWA 2ALYA 2E10A 2ZR2A 2DZCA 5IT9E 4M75B 2AMCA 5HK3A 4OF1A 4PLLA 4M75F 4NCXA 2XG8D 5LL6S 4RMFA 4HKEA 4XU0A 4IKFA 1YI2A 1M9SA 1QVFA 3OD1A 1SETA 3VQYA 3SWNA 5LJ3g 1KHCA 3RKXA 4A4FA 5GAOm 4LVMA 4CH5A 5I21A 3HXXA 1K73C 4MMKA 2GQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO3 A;  3HTZ A;  4PJO F;  4BW9 A;  3JCM V;  3JCM b;  4M7D D;  4AH6 A;  1MGQ A;  5GAM g;  1M5Q 1;  2EWN A;  2ZCE A;  1E1T A;  5GAN 7;  1HTT A;  4P74 A;  2DVE A;  4YP0 A;  4P75 C;  3NET A;  2ZGW A;  2J3M A;  4H2X B;  3RKW A;  5GMK m;  4YCW A;  4C8Q B;  3VQW A;  3BDU A;  4XTU A;  3TEH A;  4YRJ A;  4J15 A;  3MEY A;  4LNS A;  3R07 A;  5GAN 4;  1IL2 A;  1LOJ A;  3L4G B;  1N9S A;  3RIR A;  2Y90 A;  4CS2 A;  1EIY A;  5GAO n;  1LYL A;  4C92 B;  4MML A;  2J3L A;  4H2W A;  2FB7 A;  4HWO A;  5LJ5 g;  5GAO l;  2DTO A;  1QE0 A;  4M78 C;  1ADY A;  3GIB A;  1E1O A;  1X54 A;  4OP0 A;  2ZZF A;  2IY5 A;  4P73 C;  2DTI A;  3NEM A;  3HXZ A;  1JJC A;  3RGL A;  2RD1 A;  3JB9 H;  4M78 F;  3IG2 A;  2RHS A;  4EMK A;  2AKW A;  3HFN A;  5GAO p;  4YYE A;  4RQF A;  1NJ1 A;  4TVA B;  1HK9 A;  2ARS A;  5GAN 8;  4M75 E;  3JCM h;  4DPG A;  1YB3 A;  1SER A;  3MF2 A;  1ASY A;  3BFM A;  3V7R A;  1VQZ A;  4UP9 A;  4UP8 A;  1FYF A;  2RM4 A;  2Q5I A;  1Z7N A;  1Z7M A;  4KQE A;  5GAN 2;  4K86 A;  3VU3 C;  2ZZG A;  2ZTG A;  4TQF A;  3CMQ A;  4M7A E;  4WJ4 A;  12AS A;  1WQW A;  2RHQ A;  4K88 A;  3FJP A;  4O2D A;  3PGG A;  1BBU A;  3SB2 A;  1ADJ A;  1U1S A;  4P72 C;  4KR2 A;  2E65 A;  2EAY A;  3NEN A;  3PCO B;  4ZTZ B;  2DXU A;  3A32 A;  4ZTU B;  1PYS A;  2VXE A;  4C8Q C;  1G5H A;  4JUV A;  1B7Y A;  4PJO E;  1B76 A;  4CS4 A;  4H2U A;  2E41 A;  1B8A A;  2CJB A;  3JCM X;  2ZIO A;  4M7A A;  1D3B A;  1G5I A;  1Y96 A;  3A5Z A;  3A7U A;  4JRI A;  5GMK l;  1X2H A;  3JCM f;  5K1X A;  2RA2 A;  3AHU A;  4WI1 A;  4YRK A;  3WQZ A;  3PZC A;  4P3O A;  1EVK A;  4M77 G;  3DSQ A;  2QTX A;  2Q5H A;  2CJA A;  2DQ0 A;  1WPY A;  2I4N A;  3LSQ A;  2PMF A;  4XTW A;  3RUX A;  3JB9 I;  3QO7 A;  2ZNI A;  2DDZ A;  4TVA A;  4PG3 A;  3HSB A;  1YGB A;  2DU7 A;  1H4Q A;  4M7D E;  4C8Q A;  4XTV A;  4L87 A;  4M77 C;  3RKY A;  4KR3 A;  3RF1 A;  3P8V A;  3L1A A;  4C92 F;  4DQ2 A;  4TWA A;  3HY1 A;  4YPF A;  2DU5 A;  2QHV A;  4X5O A;  4YRQ A;  5GAN 3;  4PJO C;  3V7C A;  4QVC A;  2I4L A;  2ODR C;  4TTV A;  1ASZ A;  4H2Y A;  3UGT A;  3E9H A;  1BIB A;  4NL3 A;  1QF6 A;  3QNE A;  1WLE A;  4M7D F;  1L0W A;  5ELO A;  3JCM c;  1D3B B;  3A74 A;  4V2S A;  1HXD A;  2CGH A;  1NJ6 A;  4M78 G;  3A5Y A;  2E5A A;  2ZXF A;  3MF1 A;  4QVD A;  2ZIM A;  4PHC A;  3HXV A;  3A7A A;  4TVY A;  4YRO A;  3EFS A;  2RHQ B;  4UPA A;  1I8F A;  4M7A D;  4YDQ A;  3BJU A;  3RES A;  3FIF A;  4P71 C;  3HFV A;  3RL6 A;  2C7I A;  4NOY A;  3JCM Q;  4YRG A;  4M7A F;  4BWA A;  5GAM h;  3JCM e;  3L2Z A;  2YLC A;  1LJO A;  4K87 A;  4RDX A;  4F7U G;  1C0A A;  2DJZ A;  3M4Q A;  4EMK B;  3LSS A;  5LJ5 e;  1KMN A;  1PYS B;  5DY9 A;  4UP7 A;  5KNN A;  4G84 A;  4XQ3 A;  1X56 A;  4PJO D;  3QO5 A;  4P3P A;  4YRI A;  3HRK A;  2RHS B;  1BIA A;  3P8T A;  2DZ9 A;  1N9R A;  4M78 E;  1H4T A;  4XU3 A;  4F7U E;  5LJ5 j;  3A31 A;  1JJC B;  5C53 B;  1KQ1 A;  4CH3 A;  3SWN B;  1USY A;  4EO4 A;  4Q6G A;  4RQE A;  4JLI A;  2JN0 A;  1I5L A;  4PJO G;  4HVC A;  2ARU A;  3QHS A;  3ERR A;  3V8L A;  1E22 A;  4P71 A;  4XTZ A;  2P0L A;  2I4O A;  2DXT A;  4YRT A;  3REX A;  2ART A;  5GAM f;  4M7A C;  4J5Y A;  4XU1 A;  2YHT A;  5LJ3 d;  1HC7 A;  2QHT A;  2E64 A;  2YLB A;  4M7D A;  1JBM A;  1I4K 1;  5GAO r;  2AMC B;  4HWR A;  2QHS A;  4E51 A;  4YRS A;  5GMK j;  3FB9 A;  3RER A;  4YRF A;  2ZR3 A;  4Y91 A;  4F7U F;  4WF2 A;  4G85 A;  3INZ A;  2ZNJ A;  4M78 B;  1NJ8 A;  3HXY A;  5LJ5 f;  1YCY A;  3HFZ B;  3JCM J;  4M7D G;  4C8Q G;  4HWT A;  1Y96 B;  4Q15 A;  4M7A B;  2IY5 B;  4OLF A;  2ZT6 A;  1BBW A;  3P8Y A;  5GMK e;  1KQ2 A;  3QTC A;  3V7S A;  2ZT7 A;  4XTY A;  1B7Y B;  4XEO A;  4YRM A;  5F5W A;  1NJ2 A;  3VQV A;  5GAM j;  5GAN e;  4YRC A;  4C92 A;  5GAN h;  1WYD A;  1JRI A;  3RAC A;  1B70 A;  4YCV A;  4P74 C;  4PJO A;  2I4M A;  4HA8 A;  2C8M A;  3IKM B;  4X9C A;  3I7F A;  2VXF A;  5GAN f;  2EJ9 A;  2E3C A;  3IAL A;  1H64 1;  3HFO A;  2DQ3 A;  1NNH A;  5GAM e;  5GAN 5;  5LJ5 d;  1YFR A;  2DTH A;  2RB6 A;  3JB9 F;  4TQD A;  1EVL A;  1X2G A;  4PNO A;  4YRL A;  4XTX A;  4N0A A;  4HWP A;  3M4G A;  4M77 B;  1M8V A;  1H4S A;  3VBB A;  4HT9 A;  4M77 D;  3JCM g;  2ALY B;  4H2V A;  5LJ3 e;  1TH7 A;  4TVW A;  2CIM A;  2XGT A;  5GAN d;  1I81 A;  3JCM W;  4P73 A;  3UGQ A;  4F7U A;  3PCO A;  4H2S A;  4RCB A;  4YRP A;  11AS A;  1N9W A;  2Q7G A;  4NL2 A;  1EOV A;  4C8Q F;  2ZZE A;  4WJ3 M;  4M78 D;  4H02 A;  5LJ3 h;  4YRE A;  4HWS A;  3HXU A;  5K1P A;  3HXW A;  4C92 E;  2I2L A;  4X9D A;  4M77 F;  2DEQ A;  3TUP A;  4YRN A;  2K57 A;  1GGM A;  4EX5 A;  1E24 A;  1EFW A;  2HNI A;  5LJ5 h;  1SRY A;  1YFS A;  4CH4 A;  4HT8 A;  4P75 A;  3L4G A;  1WNL A;  2P5I A;  3JB9 D;  1NJ5 A;  1SES A;  3HY0 A;  4C92 D;  5E3I A;  4M75 A;  1X55 A;  4EMG A;  2VC8 A;  4EMK C;  3JCM P;  1EQR A;  3QO8 A;  3TEH B;  3A7R A;  5CAI A;  5GMK i;  1G51 A;  2DKG A;  2AKW B;  1X01 A;  4J6Y A;  2ZT8 A;  5ELN A;  3BW1 A;  1U1T A;  4H2X A;  4P72 A;  3M4P A;  3NEL A;  3ICA A;  4YCU A;  4M75 G;  1ATI A;  4M75 C;  4M7D B;  4PJO B;  1YFT A;  5GMK h;  1B70 B;  1WQ7 A;  2CJ9 A;  5GAM d;  5GAO q;  1NYR A;  3IKL A;  1USY C;  1LNX A;  2XTI A;  4N0A C;  3HRI A;  4C8Q D;  1EIY B;  1W66 A;  3VQX A;  2ZIN A;  4JRK A;  4J6X A;  2Q7E A;  3SWN C;  3HFZ A;  5C52 B;  1NYQ A;  1RIQ A;  4M78 A;  3LC0 A;  4J6W A;  4C92 G;  3V8J A;  3UFG A;  5GAN 6;  1WU7 A;  5GAN j;  4XEM A;  4M7D C;  3BY7 A;  4C8Q E;  2ALY A;  2E10 A;  3G1Z A;  2PME A;  3JB9 G;  2ZR2 A;  4F7U B;  2DZC A;  4M75 B;  3JB9 J;  4C92 C;  2AMC A;  5HGQ A;  4XU2 A;  4EMH A;  3W3S A;  4P3N A;  4M75 F;  4M7A G;  1B34 A;  1H4V B;  4NCX A;  3EFR A;  1B34 B;  4M77 A;  4RMF A;  5C51 B;  4XU0 A;  3QUI A;  1KOG A;  4YRR A;  3V8K A;  2G4C A;  4M77 E;  2Q7H A;  2EJG A;  4M75 D;  3TEG A;  2EL9 A;  3OD1 A;  1SET A;  4CH6 A;  3KFU A;  4RCC A;  4CS3 A;  3VQY A;  4ZIB A;  4H2T A;  4A54 A;  3SWN A;  2E1H A;  2EJF A;  4A53 A;  1J5W A;  3JCM d;  5LJ3 g;  3RKX A;  5LJ3 j;  3QSU A;  2QHU A;  2ZT5 A;  3E9I A;  5GAO m;  2ODR D;  2FYK A;  5GAN g;  4CH5 A;  3REU A;  1KMM A;  5I21 A;  3HXX A;  5LJ3 f;  3UH0 A;  4MMK A; 
#chains in the Genus database with same CATH topology
 1FX7 A;  2KQW A;  3QO3 A;  3A98 A;  2L3P A;  3OYJ A;  1WHL A;  2GFU A;  2KBT A;  4L5G A;  3UF4 A;  3UDC A;  4IUQ A;  1VQ7 Q;  1M5Q 1;  3H0F A;  2EWN A;  4EIK A;  2ZCE A;  2DA9 A;  3OSV A;  2DVE A;  2RH2 A;  4H2X B;  1CKA A;  2DM1 A;  3TQ7 P;  4A4E A;  3H0I A;  1K1Z A;  3G6E Q;  3CCR T;  2ED0 A;  3BDU A;  1W2B P;  1AWJ A;  5DLO A;  4BE2 A;  3X25 B;  1TS9 A;  5GAN 4;  1AHJ B;  2RK1 A;  1VQN A;  2HEQ A;  1W6X A;  3FRN A;  3A8M B;  3PT9 A;  4C92 B;  4XK8 E;  1M4Z A;  2J3L A;  1G3Y A;  2FB7 A;  4LNP A;  1QVG S;  4HWO A;  5LJ5 g;  3G71 T;  3VV0 A;  3DB4 A;  4LXC A;  2LNV A;  4M78 C;  2M0Y A;  2G6F X;  3GIB A;  2ZZF A;  2DTI A;  1VQ4 T;  3RGL A;  3QJY A;  4KBM B;  1UHF A;  1H8K A;  1Q95 G;  5IXB A;  3JB9 H;  4AMC A;  5ECA A;  2RHS A;  2V8I A;  1U3O A;  2X4W A;  1AVZ C;  1NJ1 A;  2ESW A;  3QYH B;  3MEU A;  3E9F A;  1G3S A;  1KC8 R;  2LZ6 B;  1K8A C;  2RQW A;  1SER A;  2NLU A;  2HCK A;  3BFM A;  3V7R A;  2DXC A;  2RM4 A;  2J05 A;  4BB7 A;  1QWE A;  2ZZG A;  3REB B;  1VQ5 T;  3C95 A;  2RHQ A;  1XNI A;  2CUB A;  3FC3 A;  2KAF A;  3CPF A;  1UJY A;  1XOV A;  3FJP A;  4O2D A;  1BI3 A;  3SB2 A;  2ZPB B;  1QVG A;  2EAY A;  1M2V B;  2DXU A;  4RKU E;  4LDU A;  4N4I A;  1R0B G;  2VYT A;  4C8Q C;  1G5H A;  3M53 A;  4PJO E;  3HP9 A;  3CD6 Q;  4H2U A;  1Q7Y U;  2IIM A;  4DA4 A;  1B8A A;  2QEX Q;  4IUP A;  3OYY A;  4JJB A;  4ANJ A;  3C4S A;  3A7U A;  4OB1 B;  5GMK l;  3I56 T;  1AEY A;  1KD1 R;  3JCM f;  3OYF A;  1SF9 A;  3AHU A;  3WQZ A;  4ELZ C;  3PZC A;  3HRS A;  1EVK A;  2DIL A;  4F14 A;  2HSE B;  2QTX A;  2GTO A;  2LDM A;  3LWH A;  1Q81 R;  1OYX A;  4QQG A;  2O9S A;  3CC7 T;  2I4N A;  3LX7 A;  2PMF A;  3RUX A;  4FU6 A;  2D6F A;  1VQL A;  2VGN A;  3QWY A;  4HCB A;  2DD5 A;  3X24 B;  4UC4 A;  1YBY A;  4BE1 A;  2RI2 A;  3RNJ A;  3H9N A;  4C92 F;  4A4K A;  2O31 A;  1K73 C;  2QHV A;  4KT0 E;  1LVK A;  5GAN 3;  4PJO C;  1NJI R;  3URG A;  4QVC A;  2I4L A;  3C0C A;  4HXJ A;  1VQO Q;  3TSW A;  4NL3 A;  1QCO A;  3CCE T;  4FYW B;  4M78 G;  4FL6 A;  1VA7 A;  4QVD A;  1YJW Q;  1IRX A;  1QVP A;  3RMS A;  4TVY A;  4YRO A;  1YIJ Q;  2JS0 A;  3C12 A;  2A08 A;  2SEM A;  4E2F B;  4M7A D;  1T3L A;  2EKO A;  4BDY A;  4IUU A;  2EYQ A;  1EX4 A;  1OPL A;  4P71 C;  4MZT A;  2OTJ T;  2LJ1 A;  2C7I A;  1W4S A;  2DRM A;  4YRG A;  1KD1 C;  1UB4 A;  3MCA B;  4ZTF A;  2KRS A;  2EYX A;  1BK2 A;  2O4X A;  1BCO A;  1JJ2 S;  3O5Z A;  2CP5 A;  2NWM A;  4OMO A;  3EH1 A;  2W10 A;  2ABL A;  3P8T A;  3CPW A;  2P4R A;  1B7T A;  4CRI A;  1H4T A;  4XU3 A;  5D6Y A;  3A31 A;  1KQ1 A;  2ED1 A;  3I5S A;  1USY A;  4EO4 A;  2K4Y A;  4Q6G A;  4JLI A;  5L8R E;  1I5L A;  4PJO G;  4HVC A;  3ERR A;  1UDL A;  2DEU A;  2JVV A;  1SRM A;  5FWC A;  1BCM A;  2ART A;  4XAX B;  5GAM f;  1M1K U;  2NUP B;  1VQP T;  3CMA T;  4ZN1 A;  2AIR B;  2QXF A;  1YHQ Q;  1WI7 A;  1RAE B;  2LQN A;  3TCJ A;  2CUD A;  2JTM A;  4L6V 5;  5IHK A;  2QHS A;  1M1G A;  2GTJ A;  4LN2 A;  4E51 A;  4PK4 A;  1TSF A;  3OYE A;  3CCJ A;  3RER A;  4YRF A;  3VS0 A;  4HVU A;  1T3S A;  4Y91 A;  1R77 A;  3CCV A;  4FIB A;  1VQ6 T;  4G85 A;  2KR3 A;  1QWF A;  4J7I A;  2C06 A;  2XDD A;  3JCM J;  3J7A F;  2G3R A;  4J9I A;  4ME7 A;  4OLF A;  3EG9 A;  2BIV A;  2RK2 A;  3CPW S;  5I22 A;  5GMK e;  1R0C B;  2FVU A;  3MP8 A;  3PVL A;  1G3W A;  3OQ5 A;  1GFD A;  4XEO A;  3I55 A;  5KE2 A;  5GAM j;  1V29 B;  3NFC A;  4GLK A;  4OGE A;  4C92 A;  2LQW A;  3F70 A;  1JRI A;  2FEI A;  4GLM A;  4YCV A;  3A8O B;  1BKB A;  1ZHI A;  3CC4 A;  1ZA2 B;  3IKM B;  4P5N A;  4GBQ A;  5GAN f;  2QDL A;  3LYI A;  1NE8 A;  2E3C A;  2KT8 A;  2H3J A;  2XMF A;  2CZ7 B;  1NBE B;  1JJ2 P;  2CSQ A;  1YJ9 A;  5GAN 5;  1S1N A;  2C0I A;  4JLG A;  4OMM A;  5FRO A;  2KYB A;  2LVM A;  2KRN A;  1E7O A;  1EVL A;  1X2G A;  4YRL A;  2MWO A;  3M4G A;  1M8V A;  5CVI A;  1VQ7 T;  3THK A;  4ZNX A;  1VQO T;  1ABQ A;  1ZX6 A;  2O88 A;  1TXQ A;  2DJQ A;  3LLR A;  3VS2 A;  1FMW A;  4P73 A;  3UGQ A;  4Z88 A;  4CC2 A;  2AKL A;  2EGA A;  4NL2 A;  2HMA A;  4WJ3 M;  1N8R R;  4HWS A;  5K1P A;  2M1H A;  4HVV A;  1GBR A;  2K5F A;  4NS5 A;  1D0Z A;  4M77 F;  2SRC A;  1VQ9 A;  3TUP A;  2K57 A;  3OYA A;  4EX5 A;  1RAA B;  1EFW A;  3TEE A;  4RTU A;  5LJ5 h;  1YFS A;  3NMZ C;  2M9U A;  3HRT A;  2E6N A;  3L4G A;  1ZSG A;  4F16 A;  3VS3 A;  5E3I A;  2CKK A;  4EMG A;  2VC8 A;  4EMK C;  5KYX A;  3JCM P;  2RN8 A;  4YTL A;  5CAI A;  5GMK i;  4J6Y A;  3CCR A;  2COY A;  1H3H A;  3BW1 A;  2ZT8 A;  2L89 A;  3LGL A;  3CPW P;  1WGS A;  3EFO B;  1QVF S;  2A36 A;  2QEX T;  4M75 G;  1ATI A;  4M75 C;  4M7D B;  5FU6 B;  2EW3 A;  4DOV A;  1YFT A;  3OYL A;  2DK3 A;  5GAM d;  4M4Z A;  3SD4 A;  3MKD A;  1LNX A;  2XTI A;  4PJM A;  4RTZ A;  4DOW A;  1EIY B;  1PG5 B;  3RMQ A;  2L2P A;  2DIQ A;  2VVK A;  1NYQ A;  1RIQ A;  2PVG B;  4M78 A;  3LC0 A;  4C92 G;  2Y4Y A;  3LGF A;  2QA4 Q;  3UFG A;  4XEM A;  3OYK A;  3BY7 A;  4FYY B;  2BZY A;  3HTR A;  1RI0 A;  2GFA A;  2CT4 A;  3JB9 G;  8ATC B;  4RTY A;  2EQM A;  4DBQ A;  4P3N A;  1PSF A;  2CP3 A;  1VQ5 A;  2MAM A;  3OA6 A;  4M7A G;  1H4V B;  4O5V A;  3P8D A;  2X4J A;  3PFS A;  1VQM A;  3CC2 Q;  1TUD A;  1MMA A;  2EL9 A;  1D09 B;  1SEM A;  3CC7 Q;  2RHU A;  3E9G A;  2A0F B;  1V1C A;  4A54 A;  2LX7 A;  4C5H A;  1VQN T;  2Y4X A;  1MV3 A;  1VYU A;  2ZT5 A;  1VQK A;  2ODR D;  3CCL T;  2OJ2 A;  2FYK A;  1KMM A;  3N5B B;  2HQE A;  4BDZ A;  3VS5 A;  1ZUU A;  2GGR A;  2KI7 A;  3J81 E;  1B3Q A;  3JCM b;  1MGQ A;  1JXM A;  2A28 A;  3QZ9 B;  5CO7 A;  1I07 A;  2F69 A;  2GQI A;  2DVJ A;  3PNW C;  5CKD A;  4YP0 A;  2DPP B;  3OS2 A;  4RTV A;  1VQL T;  4O6J A;  1Y07 A;  2K7A A;  4AFZ C;  4R55 A;  2PTK A;  4YCW A;  2EGE A;  2NS6 A;  3CCJ Q;  2MPX C;  4XTU A;  4N4G A;  3TEH A;  2ZAE A;  4YRJ A;  4J15 A;  5EC7 A;  1YJN A;  2RNA A;  3CC4 T;  5A0G A;  4LNS A;  3VRY A;  1UGP B;  4LDX A;  2D8H A;  3OYI A;  4CS2 A;  1N9S A;  3NTI A;  5GAO l;  2DTO A;  2L0A A;  2CP0 A;  3UAT A;  3VS7 A;  2ECZ A;  4WTO B;  1QVF P;  4LUE A;  1E1O A;  4PLI A;  2IY5 A;  4P73 C;  1Q7Y C;  3E19 A;  3DLL A;  2DE0 X;  2HD0 A;  2LQ8 A;  4PFO A;  2ATC B;  4BE0 A;  5HKC A;  2LT4 A;  4JS4 A;  2V1R A;  4EMK A;  1WZO A;  4LD9 K;  3CCM T;  1IRE B;  5GAN 8;  2C0O A;  4DPG A;  2D9T A;  2E3I A;  1YB3 A;  5GJW B;  1ASY A;  3CCQ Q;  1M3A A;  3C94 A;  5AT1 B;  2QDY B;  1NG2 A;  2CH4 A;  2Q5I A;  1G83 A;  1Z7N A;  1Z7M A;  1VQK Q;  1X6G A;  4CI0 C;  2RJE A;  2ZPE B;  3TSZ A;  1M90 U;  4TQF A;  1UGQ B;  4M7A E;  1NYG A;  4QQD A;  1CKB A;  4OB3 B;  3PGG A;  1V76 A;  4KR2 A;  1GCQ A;  3NEN A;  3QBY A;  3X28 B;  3ME9 A;  4PKC C;  2DXB A;  1YJ9 T;  3UT1 A;  1RAD B;  4CS4 A;  3ZFJ A;  1ZSZ B;  4M7A A;  1G5I A;  1Y96 A;  3A5Z A;  4J9C A;  3CCU T;  1I5O B;  2RF0 A;  2CP7 A;  5K1X A;  2EYZ A;  3UPU A;  2CYZ B;  2GF7 A;  3CC7 A;  1VQ4 Q;  5FRM A;  1MMD A;  3TVT A;  3S3M A;  3OW2 P;  2Q5H A;  1QP3 A;  3KFV A;  2BUD A;  2AK5 A;  1D0Y A;  1D1A A;  1A0N B;  3QG1 A;  4PFP A;  1UGV A;  2L3Q A;  2ZNI A;  2QQA A;  2DDZ A;  4TVA A;  4PG3 A;  3HSB A;  1KIK A;  3RKY A;  4KR3 A;  3RF1 A;  3P8V A;  1YIT A;  2D8J A;  2P0P A;  4C0F A;  4DQ2 A;  4TWA A;  3HY1 A;  2EIF A;  2H3E B;  5KCO A;  2FRW A;  3L2Q A;  5KYY A;  3MEV A;  4C0D C;  3PVQ A;  4H2Y A;  3UGT A;  1IGQ A;  3MP1 A;  1ZSZ C;  2KXD A;  3PTA A;  4ORZ A;  3M0P A;  3JCM c;  5ELO A;  4V2S A;  2CGH A;  1M90 C;  2XK0 A;  3SHW A;  2ZIM A;  3HXV A;  1N27 A;  2HAX A;  2K9G A;  5KYW B;  4DBF A;  3T9N A;  1WXT A;  1K9M R;  1OEB A;  5KYU A;  3HFV A;  3RL6 A;  4JJD A;  3PMI A;  4NOY A;  3L2R A;  2ROT A;  4JS5 A;  5GAM h;  2DRK A;  1ACM B;  3L2Z A;  1NM7 A;  3A5Z B;  3X20 B;  2KMT A;  1CSK A;  4RDX A;  1QP2 A;  4F7U G;  2COZ A;  1X43 A;  1KMN A;  4LVJ A;  5DY9 A;  2A37 A;  4C0D B;  1Q82 R;  2LNH B;  3A8G B;  1QW1 A;  3M59 A;  3QO5 A;  4P3P A;  4YRI A;  2RHS B;  1VQ9 Q;  2ZZD A;  2M0O A;  4BI4 A;  3OYC A;  1VQ4 A;  5C0M A;  2DL3 A;  4M78 E;  3TU4 K;  3I56 Q;  5LJ5 j;  1D1C A;  1JJC B;  4JZ4 A;  1RI9 A;  1DJ7 B;  2JN0 A;  2ARU A;  1XJW B;  2O2O A;  4R0K A;  4P71 A;  1UGS B;  2EVR A;  2XID A;  4YRT A;  8AT1 B;  3GF5 A;  2A8E A;  2ZPI B;  5HY6 A;  2V26 A;  1OUL A;  4FT2 A;  2L3S A;  2F2V A;  2YLB A;  4M7D A;  1I4K 1;  3ZEH A;  3ULR B;  4BUG A;  4HWR A;  1N8R C;  4YRS A;  1YN8 A;  1HD3 A;  2ENM A;  4C0Z A;  1LPL A;  3S6W A;  4OGC A;  4F7U F;  3GOX A;  3INZ A;  2ZNJ A;  2FPF A;  4KGX B;  4E7H A;  2X51 A;  5LJ5 f;  1NJ8 A;  4ATO A;  1YCY A;  3CEY A;  1S72 T;  4M7A B;  1T0H A;  4KUL A;  3P8Y A;  1OZ2 A;  4BI8 B;  4XTY A;  1B7Y B;  1KK7 A;  1M30 A;  3MP6 A;  2HKQ B;  1VQ6 A;  3CQT A;  3MHX A;  1IXD A;  4P74 C;  2K3X A;  4HA8 A;  2C8M A;  2K2V A;  3RBB B;  1PRL C;  1D1B A;  3I7F A;  2VXF A;  2EJ9 A;  2JNG A;  2BZX A;  1H64 1;  1KQS S;  1YP5 A;  2RPN A;  2CZ0 B;  3CCR Q;  2QI2 A;  3L2V A;  3I5R A;  5DM7 R;  5CK9 A;  1MV0 B;  4TQD A;  4FCY A;  1Q82 C;  4FW2 A;  1H3Z A;  1WJR A;  4KUD K;  2LT1 A;  2YRV A;  1E6G A;  4FM4 B;  3EG2 A;  1H4S A;  2KRM A;  1IZ6 A;  4JRQ A;  2RQT A;  4H2V A;  2OI3 A;  1TH7 A;  1OX9 A;  4II1 A;  3JAM E;  2CIM A;  1G5V A;  3QPH A;  2D1X A;  4H2S A;  4HCK A;  1N9W A;  4RMO A;  2EYW A;  1R8O B;  2CP2 A;  2IG0 A;  4C8Q F;  2X3X D;  3G4S T;  4YRE A;  3HXU A;  2L5Q A;  3CC4 Q;  4C92 E;  2I2L A;  2FL7 A;  2DEQ A;  2QG9 B;  1ZUY A;  1GGM A;  1NJI U;  1BI0 A;  1JB0 E;  2VWF A;  2JMA A;  2PNI A;  1C0M A;  2DYI A;  3G4S Q;  1WNL A;  4LE9 A;  2IVW A;  3S3O A;  2K79 A;  1SES A;  3HY0 A;  3QII A;  2GBQ A;  4M75 A;  3QO8 A;  3VJP A;  1Y71 A;  4J9G A;  3OYB A;  5A0L A;  2ZPG B;  1NLP C;  3CCU Q;  1OOT A;  1U1T A;  5D7U A;  3LWI A;  1K0X A;  2DNU A;  2HQH A;  2DL7 A;  3PE0 A;  5GMK h;  1B70 B;  1WX6 A;  1SSF A;  3MEW A;  4JJC A;  4ZGD B;  3M56 A;  1USY C;  1VIF A;  1E6H A;  1TUC A;  1VYV A;  4J7F A;  2E12 A;  1YJN Q;  1WHH A;  2PZ1 A;  2ZIN A;  4JRK A;  2DET A;  1VQ8 T;  2X9H A;  4J6X A;  1Q7Y R;  3SWN C;  3NHN A;  4DEX A;  1J3T A;  3CC2 T;  1N5Z A;  3V8J A;  1PHT A;  5GAN 6;  5I11 A;  5GAN j;  5KE3 A;  2RMO A;  3G1Z A;  2PME A;  2LQK A;  2PVO B;  2BE9 B;  1KC8 U;  1S72 Q;  4J9E A;  3JB9 J;  4AT1 B;  4EMH A;  3QJ6 A;  4E47 A;  2M02 A;  1W70 A;  3EFR A;  1B34 B;  2QYZ A;  1K9M U;  2OTL T;  2FZK B;  1KOG A;  4YRR A;  3V8K A;  2G4C A;  4M77 E;  1Y0M A;  2EJG A;  2EGC A;  4M75 D;  5CQY A;  4C5E A;  3KFU A;  4CH6 A;  4RCC A;  1M27 C;  1X2Q A;  1GBQ A;  4CS3 A;  4N4H A;  4ZIB A;  1YWP A;  4H2T A;  2EJF A;  2VB6 A;  2RO0 A;  4HVW A;  3QSU A;  3CXC S;  1QQJ A;  3E9I A;  5KYW A;  1N8R U;  1GL5 A;  3UH0 A;  2FHD A;  5HCK A;  3IQL A;  4ZGJ B;  1YJW A;  2KGT A;  2ROL A;  2K3Y A;  3HTZ A;  2C0T A;  4BW9 A;  4OVA A;  1SSH A;  1PWT A;  4A63 B;  3L2W A;  3JCM V;  2L3R A;  2QQR A;  4PFZ A;  3OY9 A;  4AH6 A;  2CZ6 B;  2KRO A;  1VOM A;  1E1T A;  3ZL7 C;  2WSE E;  5GAN 7;  4D6W A;  1HTT A;  4P74 A;  3EFO A;  4Q5W A;  2CDT A;  2MF2 A;  2OAU A;  3EGX A;  5GMK m;  1WHJ A;  3VQW A;  1BI2 A;  9ATC B;  3CCS A;  3R07 A;  3EHQ A;  4IIM A;  4B9X A;  4MZM A;  2QA4 T;  4FYV B;  4J9F A;  3RIR A;  2Y90 A;  5GAO n;  1LYL A;  2LC4 A;  3CCQ T;  3QDF A;  5L23 A;  1HSQ A;  3UWN A;  1QE0 A;  3CCM Q;  2X4Y A;  1PCX A;  1M1K C;  1YHQ T;  1ADY A;  1X54 A;  3SFM A;  4OP0 A;  4LDY A;  5A0D A;  3NEM A;  4Z02 A;  3NGP A;  5CR2 A;  2RD1 A;  1YIT Q;  2QGF B;  3IG2 A;  1FYN A;  2EKH A;  1YI2 T;  4YYE A;  5GAO p;  2RQU A;  5KYX B;  2JT4 A;  2DFU A;  1QKX A;  3NTK A;  1YHQ A;  4ELY C;  3JCM h;  2JTE A;  2ZPH B;  3M5A A;  3MF2 A;  4QKU A;  5DLQ E;  4UP9 A;  2YUN A;  4UP8 A;  1M1F A;  3CME A;  1FYF A;  4LDW A;  3WVD B;  4KQE A;  5CIU A;  5GAN 2;  3EGD B;  1K4U S;  3MQZ A;  4AFS C;  2ZTG A;  3CMQ A;  1PM3 A;  3CMA A;  1VQP A;  4K88 A;  1YIJ T;  2BZ8 A;  2NYS A;  4ESR A;  3CCS T;  2F2X A;  1OX8 A;  2MCN A;  1BBU A;  3HKS A;  1U1S A;  4P72 C;  3CME Q;  1YFN A;  4ZTZ B;  3A32 A;  2QEX A;  1Q86 R;  3VS4 A;  4FW1 A;  1B7Y A;  1B76 A;  3OYG A;  3H6Z A;  1WHK A;  2CJB A;  1PC0 A;  2ZIO A;  1VIE A;  4WCI A;  1EZZ B;  1M8M A;  2PVD B;  1Q81 C;  2QQB A;  3P8H A;  4JRI A;  4E7S A;  3OW2 A;  1ZBX A;  5D6X A;  1G3T A;  2E4H A;  1YJW T;  4P3O A;  3GNG A;  4M77 G;  2QQ9 A;  3OW2 S;  3CME T;  3D7S B;  4OMQ A;  4R56 A;  2RQR A;  2OTJ Q;  1SPK A;  3SDZ A;  4RTX A;  2DAQ A;  2CJA A;  2DQ0 A;  3LSQ A;  1EFN A;  1VQ5 Q;  6AT1 B;  3QO7 A;  5FU7 C;  3UA7 A;  1YGB A;  2CT3 A;  2DU7 A;  4C8Q A;  1O9S A;  5M9O A;  4L87 A;  3A1P A;  2KK4 A;  3EGU A;  3PMT A;  1P92 A;  3OMC A;  4IUR A;  3OYD A;  3S3N A;  1LCK A;  2WSC E;  1RAG B;  2MIO A;  2QK0 A;  1GRI A;  4YPF A;  2DU5 A;  5J39 A;  5HK0 A;  2F1L A;  2RHI A;  2ODR C;  2DO3 A;  1KQS P;  1KFZ A;  1NEG A;  3MJX A;  3E9H A;  2J6K A;  1QF6 A;  2EYY A;  5D6W A;  1D3B B;  3A74 A;  2EFI A;  1HXD A;  1NJ6 A;  3A5Y A;  1I1J A;  2ZXF A;  4PHC A;  2EQI A;  3MF1 A;  2J6F A;  2J06 A;  5CKB A;  1RUW A;  4OMF B;  3M9Q A;  3EFS A;  4HT4 A;  3R6N A;  3I9Q A;  2J7I A;  4UPA A;  1I8F A;  4YDQ A;  3RES A;  4Z8A A;  3FIF A;  2R57 A;  1PKS A;  2CS7 A;  1QCF A;  2JOY A;  4M7A F;  4BWA A;  1RAH B;  1Q86 C;  2XKO C;  1VUB A;  3M57 A;  1NLO C;  2E3H A;  2XU8 A;  1NEB A;  2JW4 A;  2X4X A;  3HPW A;  4AG1 C;  1C0A A;  2DJZ A;  2E6Z A;  3M4Q A;  3G1J A;  4EMK B;  2YUP A;  3OBY A;  5LJ5 e;  1XQH A;  3QDR B;  2CH4 W;  2KY9 A;  4UP7 A;  1ZSZ A;  2EBP A;  4G84 A;  4XQ3 A;  4ZTJ A;  1FXX A;  5FRN A;  1X56 A;  1F1B B;  2OAW A;  3HRK A;  1BIA A;  2DZ9 A;  3CCE A;  1S72 A;  2DF6 A;  5FU6 C;  3OBW A;  2DBM A;  3E2U A;  1JXO A;  3SWN B;  2YUO A;  4CH3 A;  4C5G A;  4E7J A;  4LUD A;  5C6S A;  3V8L A;  4XTZ A;  2P0L A;  3H8Z A;  2DXT A;  2JM9 A;  4CC4 B;  3EG0 A;  2DL5 A;  2V8J A;  4J5Y A;  4XU1 A;  1X75 C;  3OS5 A;  2YHT A;  5LJ3 d;  1HC7 A;  4X1V A;  3G6E T;  2QAZ A;  2RI5 A;  2XDB A;  4QT7 A;  3G71 Q;  3L2U A;  5GMK j;  3FB9 A;  3MO8 A;  4MZP A;  4DBR A;  2ZR3 A;  2BE7 D;  2J6O A;  1UEB A;  1WJQ A;  3CCE Q;  4C5I A;  4M7D G;  1WFW A;  2IY5 B;  4KUI A;  4LD6 A;  3V7S A;  1TWB A;  2FO0 A;  4EDU A;  2ZT7 A;  4YRM A;  5J3B A;  2QGG A;  1NJ2 A;  5GAN e;  4YRC A;  1ZQ1 A;  2OTJ A;  5GAN h;  1WYD A;  4BD3 A;  1B70 A;  2XDP A;  4PJO A;  2I4M A;  4X9C A;  3IAL A;  1C1A A;  5CQX A;  3HFO A;  1VQM T;  2DQ3 A;  2DL4 A;  2MMP A;  5GAM e;  3CCU A;  3I56 A;  4MDX A;  5LJ5 d;  1UEC A;  1YFR A;  2DTH A;  3CXC P;  1OI1 A;  1PRM C;  4N0A A;  3M0Q A;  1VQM Q;  4M77 B;  3PIO A;  3KBG A;  2E70 A;  4E7I A;  3VBB A;  3RR6 A;  4HT9 A;  3JCM g;  2MYS A;  3M55 A;  1IB8 A;  2LP5 A;  3FJ5 A;  4M77 D;  5FW9 A;  2ALY B;  5LJ3 e;  1C6V X;  1Q86 U;  4TVW A;  2P84 A;  3EG3 A;  3Q1J A;  5GAN d;  1I81 A;  3R6O A;  3JCM W;  1VQO A;  3PCO A;  4RCB A;  4YRP A;  11AS A;  2LJ0 A;  2Q7G A;  4JRP A;  3CD6 T;  2ZZE A;  1M2O A;  2CP6 A;  2MOX A;  1AD5 A;  4M78 D;  1X27 A;  3I55 T;  3H41 A;  3CBP A;  3CCM A;  2X35 A;  4X9D A;  1WXB A;  4OML A;  3NPF A;  1E24 A;  2HNI A;  4VUB A;  4Y28 E;  4CH4 A;  1G8X A;  4HT8 A;  1YI2 Q;  2B8A A;  2EQJ A;  2MI6 A;  4E7Z A;  2FRY A;  1SKU B;  1NJ5 A;  2K3B A;  1WA7 A;  1Z9Z A;  1T0J A;  1M90 R;  1X55 A;  4BY6 C;  1EQR A;  1JJ2 A;  3TEH B;  1K8A R;  4DBH A;  1BBZ A;  1PKT A;  1UHC A;  2DKG A;  1X01 A;  4PJL A;  2LCS A;  1U8R A;  5ELN A;  3QXE B;  4P72 A;  4A4H A;  3M4P A;  3CCV Q;  5AYF A;  3NEL A;  2FZC B;  1JEG A;  2CSI A;  2YT6 A;  2NUZ A;  5FLX E;  2F5T X;  1MMN A;  1RAC B;  3G71 A;  5GAO q;  1KSW A;  1MNE A;  2NUT A;  1NYR A;  3IKL A;  1VQN Q;  3CXC A;  1OPK A;  1OU8 A;  4N0A C;  3CCV T;  3HRI A;  3HL8 A;  4C8Q D;  2KYM A;  3NTH A;  1YJN T;  4E6R A;  1W66 A;  3VQX A;  3GNF B;  2KE9 A;  3PIP A;  2Q7E A;  4KRT A;  5C52 B;  4KH0 B;  2NUT B;  2XIC A;  3JV3 A;  1WU7 A;  4M7D C;  1Y7X A;  3AT1 B;  1SRL A;  4C8Q E;  4JJN K;  4F7U B;  2R5A A;  2RHX A;  4C92 C;  4BY6 B;  2JXB A;  4FT4 A;  5HGQ A;  4XU2 A;  3W3S A;  2XI9 A;  1B34 A;  2QTV A;  2DL8 A;  5I2M A;  1VQL Q;  1K9A A;  1MHN A;  1M3C A;  4M77 A;  5C51 B;  2DER A;  2LMJ A;  3QUI A;  3LH0 A;  1X2K A;  3GLX A;  4OMN A;  1X69 A;  3OB9 A;  1NJI C;  2Q7H A;  1SHF A;  2M16 A;  3TEG A;  2JJ9 A;  1AT1 B;  1UJ0 A;  2E1H A;  4A53 A;  2MK5 A;  1J5W A;  1MUZ A;  4A4G A;  3JCM d;  2QA4 A;  2XD0 A;  2QHU A;  1B07 A;  2R5M A;  5LJ3 j;  1WYX A;  2YRD A;  2D0Q B;  5GAN g;  3REU A;  5LJ3 f;  3M0S A;  1TG0 A;  3EH2 A;  1AWW A;  4RTT A;  4KGV B;  4IUT A;  4OMP A;  1PD0 A;  3EAE A;  4GY5 A;  4PJO F;  3G4S A;  3CD6 A;  4FSS A;  2YSQ A;  4D8D A;  2Z0W A;  2BKD N;  4M7D D;  3VRZ A;  3JRZ A;  5IN1 A;  2FZG B;  1VQ9 T;  5GAM g;  1Y57 A;  4J83 A;  3VUZ A;  1UUE A;  2VKN A;  3VYG A;  4P75 C;  3OS0 A;  1FMK A;  3NET A;  2ZGW A;  1BYM A;  2J3M A;  3RKW A;  3OYH A;  1ZA1 B;  4C8Q B;  4OB0 B;  1WDX A;  3M0R A;  1AZE A;  4CC3 A;  3JSC A;  2HDA A;  3MEY A;  2RJF A;  2FG0 A;  2A3L A;  4AFU C;  1IL2 A;  3I55 Q;  2VUB A;  1EIF A;  1LOJ A;  2AT1 B;  1VQ6 Q;  3L4G B;  4LDV A;  1EIY A;  1QLY A;  4MML A;  1IHW A;  4H2W A;  3BE3 A;  2O01 E;  2MWP A;  4Z89 A;  2K2M A;  3H0H A;  1NPP A;  1TU0 B;  3WVE B;  1YJ9 Q;  5KYY B;  1ZLM A;  3HXZ A;  1K0S A;  1JJC A;  3VUB A;  1YIT T;  3A8H B;  2RI3 A;  4M78 F;  4HCZ A;  1TUG B;  2AKW A;  3HFN A;  2RHY A;  4RQF A;  4E7K A;  2KXC A;  4TVA B;  1HK9 A;  3P8B B;  2ARS A;  4LVK A;  4M75 E;  3TRE A;  3EG1 A;  1AOJ A;  1W1F A;  1VQZ A;  4B6M A;  4J8O A;  3G7Z A;  3MET A;  4JPB W;  3REA B;  4K86 A;  4LVI A;  3VU3 C;  1QCN A;  4WJ4 A;  12AS A;  1WQW A;  1H92 A;  2FPE A;  2KVQ G;  2PUK B;  3CCJ T;  2K5I A;  5A2Q E;  2KT1 A;  2HL3 A;  2JTF A;  4EPC A;  2EQK A;  3ER0 A;  1ADJ A;  2E65 A;  3PCO B;  1VQ7 A;  2JM8 A;  4ZTU B;  2VV5 A;  3FEO A;  1PYS A;  2VXE A;  1JO8 A;  4JUV A;  4RTW A;  2E41 A;  1JQQ A;  3A8L B;  1QMC A;  3JCM X;  1Z9Q A;  3EG9 B;  1RAF B;  1D3B A;  5KCH A;  1X6B A;  1Q82 U;  1IO6 A;  1U5S A;  4PL6 A;  1X2H A;  2KNB B;  2E5K A;  2RJC A;  4OB2 B;  4RG2 A;  2RA2 A;  4WI1 A;  4YRK A;  5IAY A;  3M0U A;  1SG5 A;  2OX7 A;  5IHN A;  3DSQ A;  3OYM A;  2HBP A;  2K6D A;  1FWZ A;  2AHJ B;  1TTH B;  4KGZ B;  3DKM A;  2OTL A;  3DLM A;  1XTD A;  1WPY A;  1RAB B;  4XTW A;  3JB9 I;  2P0Q A;  1GFC A;  2LTO A;  1KHI A;  1H4Q A;  4M7D E;  1KD1 U;  3J80 E;  4XTV A;  4M77 C;  1RAI B;  4JZ3 A;  3CBO A;  3L1A A;  4DEY A;  1KC8 C;  2HSP A;  1ARK A;  2HL5 C;  2LCC A;  4IIO A;  4X5O A;  4YRQ A;  3V7C A;  4FYX B;  2LX9 A;  3EHR A;  4TTV A;  1ASZ A;  1K9M C;  1WLP B;  1BIB A;  3QNE A;  4FSX A;  3CCL Q;  1WLE A;  2ZPF B;  4M7D F;  1L0W A;  3DB3 A;  1HJD A;  1M2V A;  2FPD A;  2RHZ A;  3UA6 A;  2E5A A;  1YIJ A;  3ASK A;  2LRQ A;  2PUO B;  3A7A A;  3VS1 A;  3CCS Q;  2JZ2 A;  2RHQ B;  4LVL A;  3OMG A;  2O9V A;  1GXI E;  3RDV A;  1ZUK A;  2EQU A;  3G6E A;  3U23 A;  3BJU A;  2DD4 A;  3MPU B;  1ZBJ A;  2GCX A;  2PU9 B;  2COW A;  3FDR A;  1TOV A;  1K8A U;  3JCM Q;  2AKK A;  2V8K A;  2GNC A;  1YNZ A;  1MMG A;  3JCM e;  1WXU A;  3HRU A;  1OU9 A;  2YLC A;  4QQ6 A;  1UFF A;  1LJO A;  3BDL A;  2YDL A;  4K87 A;  4AFQ C;  2JMC A;  2E5Q A;  3LSS A;  2D0N A;  1PYS B;  2YUQ A;  2CZ1 B;  5GJV B;  4D8K A;  3KXT A;  5KNN A;  1M1K R;  2PQW A;  5CCA A;  4PJO D;  1ABO A;  3CCL A;  2B86 A;  3OSS C;  5IXF A;  2O4X B;  4E7L A;  2I0N A;  1N9R A;  1D0X A;  4J9D A;  1IHV A;  4F7U E;  5C53 B;  4F17 A;  5IH2 A;  4B9W A;  4RQE A;  2F2W A;  2P4T A;  3QHS A;  4F04 B;  3GPL A;  1Q81 U;  2DLP A;  2DMO A;  1E22 A;  3M4Y A;  4ZGE B;  2K5L A;  2I4O A;  3ZBD A;  3EGD A;  1KJW A;  3REX A;  4M7A C;  1MND A;  2HQX A;  2XHC A;  2P0K A;  3GBQ A;  3CC2 A;  1OQK A;  1AZG B;  1UE9 A;  1PSE A;  1IGU A;  3O8V A;  2QHT A;  2E64 A;  1JBM A;  3VS6 A;  5GAO r;  1UG1 A;  4IUV A;  1YCS B;  2AMC B;  5IHI A;  1K73 U;  4RUG A;  1VQK T;  3EGX B;  5KH6 A;  1U06 A;  5FU7 B;  1GCP A;  1BB9 A;  4WF2 A;  3HHT B;  4M78 B;  1YWO A;  3HXY A;  1JU5 C;  3HFZ B;  1PNJ A;  3M58 A;  3CBM A;  4HWT A;  4C8Q G;  1Y96 B;  4Q15 A;  1OZ3 A;  1RLQ C;  5FWB A;  2ZT6 A;  3OS1 A;  2YWW A;  1BBW A;  1KQ2 A;  2A7Y A;  3QTC A;  1BI1 A;  1WHG A;  4PJJ A;  4CC7 A;  5F5W A;  3VQV A;  4QVZ A;  3LW5 E;  2X3W D;  5KYN A;  1NYF A;  3RAC A;  1K76 A;  2HBW A;  1VQ8 Q;  2F5K A;  3L42 A;  4J9H A;  2R58 A;  4TVR A;  4C0G A;  2KSS A;  1NNH A;  2KEA A;  1KG1 A;  4J9B A;  1N6A A;  1M3B A;  3VYH B;  2RB6 A;  3JB9 F;  2H8H A;  1O75 A;  4QW2 A;  4PNO A;  3CCQ A;  5J26 A;  4XTX A;  1RL2 A;  4HWP A;  1I0C A;  4KH1 B;  3VKI A;  1NPR A;  2XGT A;  3QYG B;  4JDS A;  1AWX A;  3MEA A;  4F7U A;  4HCC A;  3FLG A;  5CKE A;  1WHM A;  1EOV A;  3GP8 A;  1WJS A;  4H02 A;  2W0Z A;  5CKH A;  5LJ3 h;  5CKF A;  1W2B A;  2ZCF B;  3HXW A;  1FMV A;  2YRC A;  1G2B A;  1VYT A;  1VQ8 A;  4YRN A;  5EG2 A;  3QKJ A;  2CRE A;  1SRY A;  1W2B S;  4P75 A;  2M51 A;  2RJD A;  3KUF A;  4X34 A;  2P5I A;  3JB9 D;  1KQS A;  3WXM B;  1K73 R;  4K11 A;  2OTL Q;  3I35 A;  4C92 D;  1X6O A;  4ZN3 A;  3A7R A;  3X26 B;  4L59 A;  1G51 A;  2AKW B;  1PD1 A;  3E1S A;  1UTI A;  4AG2 C;  1QVG P;  1NZ9 A;  2YXY A;  4PJN A;  3M54 A;  4H2X A;  3ICA A;  4YCU A;  1HYO A;  2DIG A;  2JUF A;  2VGM A;  4BAC A;  2WSF E;  4PJO B;  1WQ7 A;  2CJ9 A;  2NUP A;  2IPO B;  4BI3 A;  2EPD A;  5I2S A;  2AZV A;  1AWO A;  2QQS A;  3OYN A;  2WAC A;  2JS2 A;  2LCL A;  4RG8 A;  2L8D A;  1WIE A;  3HFZ A;  1BU1 A;  2KDS A;  3QZ5 B;  1RLP C;  1UGR B;  1GCQ C;  2V1Q A;  3LH5 A;  4J6W A;  2DYB A;  4MDW A;  2ALY A;  2E10 A;  1OV3 A;  2ZR2 A;  2DZC A;  5IT9 E;  1SHG A;  4M75 B;  3QWX X;  3M0T A;  2AMC A;  5HK3 A;  4OF1 A;  4PLL A;  4M75 F;  4NCX A;  2BTT A;  2XG8 D;  2QAS A;  3SEM A;  2HKN A;  7AT1 B;  5LL6 S;  4RMF A;  4HKE A;  4XU0 A;  4IKF A;  1QKW A;  1YI2 A;  2VAS A;  2RQV A;  2DBK A;  1M9S A;  1QVF A;  3OD1 A;  1SET A;  2LJ3 A;  5KYU B;  4Y92 A;  3VQY A;  3SWN A;  3CMA Q;  1VQP Q;  5LJ3 g;  1KHC A;  3RKX A;  4A4F A;  5GAO m;  2HZY A;  4LVM A;  4CH5 A;  2DX1 A;  5I21 A;  3HXX A;  2AZS A;  4MMK A;  2GQV A; 
#chains in the Genus database with same CATH homology
 1FX7 A;  2KQW A;  3QO3 A;  3OYJ A;  2GFU A;  4L5G A;  3UDC A;  4IUQ A;  1M5Q 1;  2EWN A;  2ZCE A;  3OSV A;  2DVE A;  2RH2 A;  4H2X B;  4A4E A;  3CCR T;  3BDU A;  5DLO A;  4BE2 A;  3X25 B;  5GAN 4;  1AHJ B;  2RK1 A;  1VQN A;  3FRN A;  3A8M B;  3PT9 A;  4C92 B;  4XK8 E;  1M4Z A;  2J3L A;  1G3Y A;  2FB7 A;  1QVG S;  4HWO A;  5LJ5 g;  3G71 T;  3VV0 A;  3DB4 A;  4M78 C;  2LNV A;  3GIB A;  2ZZF A;  2DTI A;  1VQ4 T;  3RGL A;  3QJY A;  4KBM B;  3JB9 H;  2RHS A;  2V8I A;  2X4W A;  1NJ1 A;  3QYH B;  3MEU A;  3E9F A;  1G3S A;  1K8A C;  1SER A;  2NLU A;  3BFM A;  3V7R A;  2DXC A;  2RM4 A;  4BB7 A;  2ZZG A;  1VQ5 T;  3C95 A;  2RHQ A;  1XNI A;  3FC3 A;  2KAF A;  3CPF A;  1XOV A;  3FJP A;  4O2D A;  1BI3 A;  3SB2 A;  2ZPB B;  1QVG A;  2EAY A;  2DXU A;  4RKU E;  4LDU A;  4N4I A;  2VYT A;  4C8Q C;  1G5H A;  3M53 A;  4PJO E;  3HP9 A;  4H2U A;  1Q7Y U;  4DA4 A;  1B8A A;  4IUP A;  3OYY A;  3C4S A;  3A7U A;  4OB1 B;  5GMK l;  3I56 T;  3JCM f;  3OYF A;  3AHU A;  3WQZ A;  4ELZ C;  3PZC A;  3HRS A;  1EVK A;  2QTX A;  2LDM A;  3LWH A;  1OYX A;  4QQG A;  3CC7 T;  2I4N A;  3LX7 A;  2PMF A;  3RUX A;  4FU6 A;  2D6F A;  1VQL A;  2VGN A;  4HCB A;  2DD5 A;  3X24 B;  1YBY A;  4UC4 A;  4BE1 A;  2RI2 A;  4C92 F;  4A4K A;  2QHV A;  4KT0 E;  5GAN 3;  4PJO C;  3URG A;  4QVC A;  2I4L A;  4NL3 A;  3CCE T;  4M78 G;  4FL6 A;  4QVD A;  1QVP A;  3RMS A;  4TVY A;  4YRO A;  3C12 A;  4M7A D;  2EKO A;  4BDY A;  4IUU A;  2EYQ A;  4P71 C;  4MZT A;  2OTJ T;  2C7I A;  1W4S A;  4YRG A;  1KD1 C;  1UB4 A;  3MCA B;  4ZTF A;  2O4X A;  1JJ2 S;  3P8T A;  3CPW A;  4CRI A;  1H4T A;  4XU3 A;  5D6Y A;  3A31 A;  1KQ1 A;  1USY A;  4EO4 A;  2K4Y A;  4Q6G A;  4JLI A;  5L8R E;  1I5L A;  4PJO G;  4HVC A;  3ERR A;  2JVV A;  2ART A;  4XAX B;  5GAM f;  1M1K U;  1VQP T;  3CMA T;  4ZN1 A;  2QXF A;  3TCJ A;  2JTM A;  4L6V 5;  2QHS A;  1M1G A;  4E51 A;  3CCJ A;  3RER A;  3OYE A;  4YRF A;  4Y91 A;  3CCV A;  4FIB A;  1VQ6 T;  4G85 A;  4J7I A;  2C06 A;  2XDD A;  3JCM J;  3J7A F;  2G3R A;  4ME7 A;  4OLF A;  2BIV A;  2RK2 A;  3CPW S;  5GMK e;  2FVU A;  3MP8 A;  1G3W A;  3OQ5 A;  4XEO A;  3I55 A;  5GAM j;  5KE2 A;  1V29 B;  3NFC A;  4GLK A;  4OGE A;  4C92 A;  3F70 A;  1JRI A;  4YCV A;  3A8O B;  1BKB A;  1ZHI A;  3CC4 A;  3IKM B;  4P5N A;  5GAN f;  3LYI A;  1NE8 A;  2E3C A;  2H3J A;  2CZ7 B;  1YJ9 A;  5GAN 5;  4JLG A;  5FRO A;  2LVM A;  1EVL A;  1X2G A;  4YRL A;  2MWO A;  3M4G A;  1M8V A;  5CVI A;  1VQ7 T;  1VQO T;  3LLR A;  4P73 A;  3UGQ A;  4NL2 A;  4WJ3 M;  4HWS A;  5K1P A;  2M1H A;  2K5F A;  4NS5 A;  4M77 F;  1VQ9 A;  3TUP A;  2K57 A;  3OYA A;  4EX5 A;  1EFW A;  3TEE A;  5LJ5 h;  1YFS A;  2M9U A;  3HRT A;  2E6N A;  3L4G A;  5E3I A;  2CKK A;  4EMG A;  2VC8 A;  4EMK C;  3JCM P;  5CAI A;  4YTL A;  5GMK i;  4J6Y A;  3CCR A;  2ZT8 A;  3BW1 A;  2L89 A;  3LGL A;  1WGS A;  1QVF S;  2QEX T;  4M75 G;  1ATI A;  4M75 C;  4M7D B;  5FU6 B;  4DOV A;  1YFT A;  3OYL A;  2DK3 A;  5GAM d;  3SD4 A;  1LNX A;  2XTI A;  4DOW A;  1EIY B;  3RMQ A;  2DIQ A;  1NYQ A;  1RIQ A;  2PVG B;  4M78 A;  3LC0 A;  4C92 G;  2Y4Y A;  3LGF A;  3UFG A;  4XEM A;  3OYK A;  3BY7 A;  1RI0 A;  2GFA A;  3JB9 G;  2EQM A;  4P3N A;  1PSF A;  1VQ5 A;  2MAM A;  3OA6 A;  4M7A G;  1H4V B;  4O5V A;  3P8D A;  2X4J A;  3PFS A;  1VQM A;  2EL9 A;  2RHU A;  3E9G A;  4A54 A;  4C5H A;  1VQN T;  2Y4X A;  2ZT5 A;  1VQK A;  2ODR D;  3CCL T;  2FYK A;  1KMM A;  3N5B B;  2HQE A;  4BDZ A;  3J81 E;  3JCM b;  1MGQ A;  3QZ9 B;  5CO7 A;  2F69 A;  3PNW C;  5CKD A;  4YP0 A;  2DPP B;  3OS2 A;  1VQL T;  4O6J A;  1Y07 A;  4R55 A;  4YCW A;  2NS6 A;  4XTU A;  4N4G A;  3TEH A;  4YRJ A;  4J15 A;  1YJN A;  3CC4 T;  5A0G A;  4LNS A;  1UGP B;  4LDX A;  3OYI A;  4CS2 A;  1N9S A;  3NTI A;  5GAO l;  2DTO A;  1E1O A;  4PLI A;  2IY5 A;  4P73 C;  1Q7Y C;  3E19 A;  3DLL A;  2HD0 A;  2LQ8 A;  4BE0 A;  5HKC A;  2LT4 A;  4JS4 A;  4EMK A;  4LD9 K;  3CCM T;  1IRE B;  5GAN 8;  4DPG A;  2D9T A;  1YB3 A;  1ASY A;  3C94 A;  2QDY B;  2Q5I A;  1Z7N A;  1Z7M A;  4CI0 C;  2RJE A;  2ZPE B;  1M90 U;  4TQF A;  1UGQ B;  4M7A E;  4QQD A;  4OB3 B;  3PGG A;  4KR2 A;  3NEN A;  3QBY A;  3X28 B;  3ME9 A;  4PKC C;  2DXB A;  1YJ9 T;  3UT1 A;  4CS4 A;  3ZFJ A;  4M7A A;  1G5I A;  1Y96 A;  3A5Z A;  3CCU T;  5K1X A;  3UPU A;  2CYZ B;  2GF7 A;  3CC7 A;  5FRM A;  3S3M A;  2Q5H A;  1QP3 A;  2BUD A;  3QG1 A;  2ZNI A;  4TVA A;  2QQA A;  2DDZ A;  4PG3 A;  3HSB A;  3RKY A;  4KR3 A;  3RF1 A;  3P8V A;  1YIT A;  2P0P A;  4C0F A;  4DQ2 A;  4TWA A;  3HY1 A;  2EIF A;  5KCO A;  3L2Q A;  3MEV A;  4C0D C;  4H2Y A;  3UGT A;  3MP1 A;  3PTA A;  5ELO A;  3JCM c;  4V2S A;  2CGH A;  1M90 C;  2XK0 A;  2ZIM A;  3HXV A;  1N27 A;  2HAX A;  3T9N A;  3HFV A;  3RL6 A;  3PMI A;  4NOY A;  3L2R A;  4JS5 A;  5GAM h;  3L2Z A;  3A5Z B;  3X20 B;  2KMT A;  4RDX A;  1QP2 A;  4F7U G;  1KMN A;  4LVJ A;  5DY9 A;  4C0D B;  3A8G B;  1QW1 A;  3M59 A;  3QO5 A;  4P3P A;  4YRI A;  2RHS B;  2ZZD A;  2M0O A;  4BI4 A;  3OYC A;  1VQ4 A;  5C0M A;  3TU4 K;  4M78 E;  5LJ5 j;  1JJC B;  1DJ7 B;  2JN0 A;  2ARU A;  4P71 A;  1UGS B;  2XID A;  4YRT A;  3GF5 A;  2A8E A;  2ZPI B;  5HY6 A;  4FT2 A;  2YLB A;  4M7D A;  1I4K 1;  3ZEH A;  4BUG A;  4HWR A;  1N8R C;  4YRS A;  4C0Z A;  3S6W A;  4OGC A;  4F7U F;  3GOX A;  3INZ A;  2ZNJ A;  4E7H A;  1NJ8 A;  5LJ5 f;  4ATO A;  1YCY A;  3CEY A;  1S72 T;  4M7A B;  4KUL A;  3P8Y A;  1OZ2 A;  4BI8 B;  4XTY A;  1B7Y B;  3MP6 A;  1VQ6 A;  3MHX A;  4P74 C;  2K3X A;  4HA8 A;  2C8M A;  2K2V A;  3I7F A;  2VXF A;  2EJ9 A;  2JNG A;  1H64 1;  1KQS S;  2CZ0 B;  2QI2 A;  3L2V A;  5DM7 R;  5CK9 A;  4TQD A;  1Q82 C;  1H3Z A;  1WJR A;  4KUD K;  2LT1 A;  2YRV A;  4FM4 B;  1H4S A;  1IZ6 A;  4JRQ A;  4H2V A;  1TH7 A;  4II1 A;  3JAM E;  2CIM A;  1G5V A;  3QPH A;  4H2S A;  1N9W A;  4RMO A;  1R8O B;  4C8Q F;  2IG0 A;  3G4S T;  4YRE A;  3HXU A;  2L5Q A;  4C92 E;  2I2L A;  2FL7 A;  2DEQ A;  1GGM A;  1NJI U;  1BI0 A;  1JB0 E;  1WNL A;  2IVW A;  3S3O A;  1SES A;  3HY0 A;  3QII A;  4M75 A;  3QO8 A;  3VJP A;  1Y71 A;  3OYB A;  5A0L A;  2ZPG B;  1U1T A;  3LWI A;  5GMK h;  1B70 B;  1SSF A;  3MEW A;  4ZGD B;  3M56 A;  1USY C;  1VIF A;  4J7F A;  2E12 A;  2ZIN A;  4JRK A;  1VQ8 T;  4J6X A;  3SWN C;  3CC2 T;  3V8J A;  5GAN 6;  5GAN j;  5KE3 A;  3G1Z A;  2PME A;  2LQK A;  2PVO B;  1KC8 U;  3JB9 J;  4EMH A;  3QJ6 A;  4E47 A;  3EFR A;  1B34 B;  1K9M U;  2OTL T;  1KOG A;  4YRR A;  3V8K A;  2G4C A;  4M77 E;  2EJG A;  4M75 D;  5CQY A;  4C5E A;  3KFU A;  4CH6 A;  4RCC A;  4CS3 A;  4N4H A;  4ZIB A;  4H2T A;  2EJF A;  2RO0 A;  3QSU A;  3CXC S;  3E9I A;  1N8R U;  3UH0 A;  2FHD A;  4ZGJ B;  1YJW A;  2K3Y A;  3HTZ A;  4BW9 A;  4OVA A;  3L2W A;  3JCM V;  2L3R A;  2QQR A;  3OY9 A;  4AH6 A;  2CZ6 B;  1E1T A;  2WSE E;  5GAN 7;  4D6W A;  1HTT A;  4P74 A;  4Q5W A;  2MF2 A;  2OAU A;  5GMK m;  3VQW A;  1BI2 A;  3CCS A;  3R07 A;  4B9X A;  4MZM A;  2QA4 T;  3RIR A;  2Y90 A;  5GAO n;  1LYL A;  2LC4 A;  3CCQ T;  3UWN A;  1QE0 A;  2X4Y A;  1M1K C;  1YHQ T;  1ADY A;  1X54 A;  3SFM A;  4OP0 A;  4LDY A;  5A0D A;  3NEM A;  4Z02 A;  5CR2 A;  2RD1 A;  3IG2 A;  1YI2 T;  4YYE A;  5GAO p;  3NTK A;  1YHQ A;  4ELY C;  3JCM h;  2ZPH B;  3M5A A;  3MF2 A;  5DLQ E;  4UP9 A;  4UP8 A;  1M1F A;  3CME A;  1FYF A;  4LDW A;  3WVD B;  4KQE A;  5CIU A;  5GAN 2;  3MQZ A;  2ZTG A;  3CMQ A;  3CMA A;  1VQP A;  4K88 A;  1YIJ T;  3CCS T;  1BBU A;  3HKS A;  1U1S A;  4P72 C;  4ZTZ B;  3A32 A;  2QEX A;  1B7Y A;  1B76 A;  3OYG A;  3H6Z A;  2CJB A;  2ZIO A;  1VIE A;  2PVD B;  1Q81 C;  2QQB A;  3P8H A;  4JRI A;  3OW2 A;  1ZBX A;  5D6X A;  1G3T A;  1YJW T;  4P3O A;  3GNG A;  4M77 G;  2QQ9 A;  3OW2 S;  3CME T;  4R56 A;  3SDZ A;  2DAQ A;  2CJA A;  2DQ0 A;  3LSQ A;  3QO7 A;  5FU7 C;  1YGB A;  2DU7 A;  4C8Q A;  1O9S A;  5M9O A;  4L87 A;  2KK4 A;  3PMT A;  1P92 A;  3OMC A;  4IUR A;  3OYD A;  3S3N A;  2WSC E;  4YPF A;  2DU5 A;  5J39 A;  5HK0 A;  2RHI A;  2ODR C;  2DO3 A;  3E9H A;  1QF6 A;  5D6W A;  1D3B B;  3A74 A;  2EFI A;  1HXD A;  1NJ6 A;  3A5Y A;  2ZXF A;  4PHC A;  3MF1 A;  5CKB A;  4OMF B;  3M9Q A;  3EFS A;  4HT4 A;  4UPA A;  1I8F A;  4YDQ A;  3RES A;  3FIF A;  2R57 A;  2CS7 A;  2JOY A;  4M7A F;  4BWA A;  1Q86 C;  2XKO C;  1VUB A;  3M57 A;  2XU8 A;  2X4X A;  3HPW A;  1C0A A;  2DJZ A;  2E6Z A;  3M4Q A;  4EMK B;  3OBY A;  5LJ5 e;  1XQH A;  3QDR B;  2KY9 A;  4UP7 A;  4G84 A;  4XQ3 A;  4ZTJ A;  1FXX A;  5FRN A;  1X56 A;  3HRK A;  1BIA A;  2DZ9 A;  3CCE A;  1S72 A;  5FU6 C;  3OBW A;  4CH3 A;  3SWN B;  4C5G A;  4E7J A;  5C6S A;  3V8L A;  4XTZ A;  2P0L A;  3H8Z A;  2DXT A;  2V8J A;  4J5Y A;  4XU1 A;  1X75 C;  3OS5 A;  2YHT A;  5LJ3 d;  1HC7 A;  3G6E T;  2RI5 A;  2XDB A;  3L2U A;  5GMK j;  3FB9 A;  3MO8 A;  4MZP A;  2ZR3 A;  1UEB A;  1WJQ A;  4C5I A;  4M7D G;  2IY5 B;  4KUI A;  4LD6 A;  3V7S A;  4EDU A;  2ZT7 A;  4YRM A;  5J3B A;  1NJ2 A;  5GAN e;  4YRC A;  1ZQ1 A;  2OTJ A;  5GAN h;  1WYD A;  4BD3 A;  1B70 A;  2XDP A;  4PJO A;  2I4M A;  4X9C A;  3IAL A;  5CQX A;  3HFO A;  1VQM T;  2DQ3 A;  2MMP A;  5GAM e;  3CCU A;  3I56 A;  4MDX A;  5LJ5 d;  1YFR A;  2DTH A;  1OI1 A;  4N0A A;  4M77 B;  3PIO A;  3KBG A;  2E70 A;  4E7I A;  3VBB A;  4HT9 A;  4M77 D;  3M55 A;  3JCM g;  2ALY B;  5LJ3 e;  1Q86 U;  4TVW A;  3Q1J A;  5GAN d;  1I81 A;  3R6O A;  3JCM W;  1VQO A;  3PCO A;  4RCB A;  4YRP A;  11AS A;  2Q7G A;  4JRP A;  3CD6 T;  2ZZE A;  4M78 D;  3I55 T;  3CBP A;  3CCM A;  2X35 A;  4X9D A;  1E24 A;  2HNI A;  4VUB A;  4Y28 E;  4CH4 A;  4HT8 A;  2B8A A;  2EQJ A;  2MI6 A;  1NJ5 A;  1X55 A;  4BY6 C;  1EQR A;  1JJ2 A;  3TEH B;  2DKG A;  1X01 A;  1U8R A;  5ELN A;  3QXE B;  4P72 A;  4A4H A;  3M4P A;  5AYF A;  3NEL A;  5FLX E;  2F5T X;  3G71 A;  5GAO q;  1NYR A;  3IKL A;  3CXC A;  4N0A C;  3CCV T;  3HRI A;  3HL8 A;  4C8Q D;  1YJN T;  3NTH A;  1W66 A;  3VQX A;  3GNF B;  3PIP A;  2Q7E A;  5C52 B;  2XIC A;  1WU7 A;  4M7D C;  1Y7X A;  4C8Q E;  4JJN K;  4F7U B;  2R5A A;  2RHX A;  4C92 C;  4BY6 B;  4FT4 A;  5HGQ A;  4XU2 A;  3W3S A;  2XI9 A;  1B34 A;  5I2M A;  1MHN A;  4M77 A;  5C51 B;  3QUI A;  3LH0 A;  3GLX A;  3OB9 A;  1NJI C;  2Q7H A;  2M16 A;  3TEG A;  4A53 A;  2E1H A;  1J5W A;  4A4G A;  2QA4 A;  3JCM d;  2XD0 A;  2QHU A;  5LJ3 j;  2R5M A;  2D0Q B;  5GAN g;  3REU A;  5LJ3 f;  4IUT A;  3EAE A;  4GY5 A;  4PJO F;  3CD6 A;  3G4S A;  2BKD N;  4M7D D;  3JRZ A;  5IN1 A;  1VQ9 T;  5GAM g;  4J83 A;  3VUZ A;  3VYG A;  4P75 C;  3OS0 A;  3NET A;  2ZGW A;  1BYM A;  2J3M A;  3RKW A;  3OYH A;  4C8Q B;  4OB0 B;  3JSC A;  3MEY A;  2RJF A;  2A3L A;  1IL2 A;  2VUB A;  1EIF A;  1LOJ A;  3L4G B;  4LDV A;  1EIY A;  4MML A;  4H2W A;  2O01 E;  2MWP A;  1NPP A;  3WVE B;  3HXZ A;  1JJC A;  3VUB A;  1YIT T;  3A8H B;  2RI3 A;  4M78 F;  4HCZ A;  2AKW A;  3HFN A;  2RHY A;  4RQF A;  4E7K A;  4TVA B;  1HK9 A;  3P8B B;  2ARS A;  4LVK A;  4M75 E;  3TRE A;  1VQZ A;  4J8O A;  3G7Z A;  3MET A;  4K86 A;  4LVI A;  3VU3 C;  4WJ4 A;  12AS A;  1WQW A;  2KVQ G;  2PUK B;  3CCJ T;  2K5I A;  5A2Q E;  2JTF A;  4EPC A;  2EQK A;  3ER0 A;  1ADJ A;  2E65 A;  3PCO B;  1VQ7 A;  4ZTU B;  2VV5 A;  3FEO A;  1PYS A;  2VXE A;  4JUV A;  2E41 A;  3A8L B;  3JCM X;  1D3B A;  5KCH A;  1Q82 U;  4PL6 A;  1X2H A;  2RJC A;  4OB2 B;  4RG2 A;  2RA2 A;  4WI1 A;  4YRK A;  5IAY A;  3DSQ A;  3OYM A;  2HBP A;  1FWZ A;  2AHJ B;  3DKM A;  2OTL A;  3DLM A;  1XTD A;  1WPY A;  4XTW A;  3JB9 I;  2P0Q A;  2LTO A;  1KHI A;  1H4Q A;  4M7D E;  1KD1 U;  3J80 E;  4XTV A;  4M77 C;  3CBO A;  3L1A A;  1KC8 C;  2LCC A;  4X5O A;  4YRQ A;  3V7C A;  2LX9 A;  4TTV A;  1ASZ A;  1K9M C;  1BIB A;  3QNE A;  4FSX A;  1WLE A;  2ZPF B;  4M7D F;  1L0W A;  3DB3 A;  2RHZ A;  2E5A A;  1YIJ A;  3ASK A;  2LRQ A;  2PUO B;  3A7A A;  2JZ2 A;  2RHQ B;  4LVL A;  3OMG A;  1GXI E;  2EQU A;  3G6E A;  3BJU A;  2DD4 A;  2GCX A;  2PU9 B;  3FDR A;  1K8A U;  3JCM Q;  2V8K A;  3JCM e;  3HRU A;  2YLC A;  4QQ6 A;  1LJO A;  3BDL A;  4K87 A;  2E5Q A;  3LSS A;  1PYS B;  2CZ1 B;  3KXT A;  5KNN A;  2PQW A;  5CCA A;  4PJO D;  3CCL A;  3OSS C;  2O4X B;  4E7L A;  1N9R A;  4F7U E;  5C53 B;  4B9W A;  4RQE A;  2P4T A;  3QHS A;  3GPL A;  1Q81 U;  1E22 A;  3M4Y A;  4ZGE B;  2K5L A;  2I4O A;  3ZBD A;  3REX A;  4M7A C;  2HQX A;  2XHC A;  2P0K A;  3CC2 A;  1PSE A;  3O8V A;  2QHT A;  2E64 A;  1JBM A;  5GAO r;  4IUV A;  2AMC B;  1K73 U;  1VQK T;  5KH6 A;  4WF2 A;  5FU7 B;  3HHT B;  4M78 B;  3HXY A;  3HFZ B;  3M58 A;  3CBM A;  4HWT A;  4C8Q G;  1Y96 B;  4Q15 A;  1OZ3 A;  2ZT6 A;  3OS1 A;  1BBW A;  1KQ2 A;  2A7Y A;  3QTC A;  1BI1 A;  5F5W A;  3VQV A;  4QVZ A;  3LW5 E;  3RAC A;  2F5K A;  3L42 A;  2R58 A;  4TVR A;  4C0G A;  2KSS A;  1NNH A;  1KG1 A;  1N6A A;  3VYH B;  2RB6 A;  3JB9 F;  1O75 A;  4QW2 A;  4PNO A;  3CCQ A;  5J26 A;  4XTX A;  1RL2 A;  4HWP A;  3VKI A;  1NPR A;  2XGT A;  3QYG B;  4JDS A;  4F7U A;  3MEA A;  4HCC A;  3FLG A;  5CKE A;  1EOV A;  3GP8 A;  1WJS A;  4H02 A;  5CKH A;  5LJ3 h;  5CKF A;  1W2B A;  2ZCF B;  3HXW A;  1VQ8 A;  4YRN A;  5EG2 A;  3QKJ A;  1SRY A;  1W2B S;  4P75 A;  2RJD A;  3KUF A;  4X34 A;  2P5I A;  3JB9 D;  1KQS A;  3WXM B;  4C92 D;  1X6O A;  4ZN3 A;  3A7R A;  3X26 B;  4L59 A;  2AKW B;  1G51 A;  3E1S A;  1NZ9 A;  3M54 A;  4H2X A;  3ICA A;  4YCU A;  2DIG A;  2JUF A;  2VGM A;  4BAC A;  2WSF E;  4PJO B;  1WQ7 A;  2CJ9 A;  4BI3 A;  5I2S A;  2QQS A;  3OYN A;  2WAC A;  2LCL A;  4RG8 A;  2L8D A;  3HFZ A;  2KDS A;  3QZ5 B;  1UGR B;  4J6W A;  4MDW A;  2ALY A;  2E10 A;  2ZR2 A;  2DZC A;  5IT9 E;  4M75 B;  2AMC A;  5HK3 A;  4OF1 A;  4PLL A;  4M75 F;  4NCX A;  2XG8 D;  5LL6 S;  4RMF A;  4HKE A;  4XU0 A;  4IKF A;  1YI2 A;  1M9S A;  1QVF A;  3OD1 A;  1SET A;  3VQY A;  3SWN A;  5LJ3 g;  1KHC A;  3RKX A;  4A4F A;  5GAO m;  4LVM A;  4CH5 A;  5I21 A;  3HXX A;  1K73 C;  4MMK A;  2GQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...