2DZCA

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
222
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGSPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 67
structure length 222
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dzcA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dzcA01
5CAIA 2DXUA 2PMEA 2ZINA 3HTZA 2P0LA 1M8VA 4PNOA 2DKGA 4PJOE 4F7UB 1USYA 4XTWA 5LJ5e 2RHQB 5LJ3g 4H2TA 2HNIA 1JBMA 1B76A 2DZCA 4PJOA 3UH0A 5GAMd 3IKMB 4TVAA 4HT8A 4E51A 3JCMX 2RHSB 3L1AA 2JN0A 1NJ1A 2CIMA 3A5YA 3V8LA 2ZTGA 4M75G 3RGLA 3FJPA 5GAOn 1E1OA 5GAN7 2FB7A 4YRMA 2E10A 5LJ3h 4C92G 3JCMW 1HC7A 4XTVA 1NJ5A 2ZXFA 3QO5A 4XEMA 2RM4A 4JRKA 4RCCA 4UP8A 5K1PA 4XQ3A 1B7YA 3A31A 3BJUA 4M78E 3IKLA 4M78C 4ZTZB 1U1TA 2E3CA 5GAOp 5GAMf 5LJ5g 2Q7EA 5GANe 4M7AE 4CH6A 4J6YA 3MF1A 2E64A 1WYDA 2Q5HA 4M7AA 1KQ1A 4M7DE 4M7DC 3OD1A 2ARUA 1Y96A 4P3PA 3HSBA 2AKWB 2DZ9A 5LJ3d 4M77G 4C8QG 1PYSB 3JCMg 5LJ5h 2I4OA 4M75B 1LJOA 1SETA 4C92B 2ZIOA 2E41A 4YREA 2RA2A 4HWRA 4RDXA 5GAMj 1G5IA 4YPFA 1N9SA 1E24A 1LYLA 3A7UA 4M75D 2YHTA 4PJOF 5GMKi 2PMFA 4LNSA 5E3IA 1X56A 2ARSA 3RACA 4TWAA 4C92D 1TH7A 4L87A 4H2YA 4N0AA 3VBBA 2VC8A 2XTIA 3A5ZA 1EQRA 1WQ7A 3JB9G 4HWTA 5GANg 5KNNA 3PCOA 3I7FA 3FB9A 3EFRA 2ZZFA 5K1XA 3WQZA 5LJ3f 4F7UG 1X2HA 4X9DA 3KFUA 2QTXA 1G51A 5LJ5d 1E22A 3VQYA 3NEMA 4UPAA 4P74C 3AHUA 3NETA 4M77B 1NYQA 4YCVA 1B34B 3V8KA 5GANh 1YCYA 1WU7A 2ALYB 1BBWA 2DTOA 4P72A 5GAN4 3SWNB 4YYEA 3RKYA 4TTVA 4HWPA 4K86A 2ZR3A 4M77D 4NOYA 4O2DA 1LOJA 4C8QD 3NELA 4Q15A 2EJ9A 5GAOm 3HFZA 5GAN6 3W3SA 4M78G 5LJ3j 3SWNC 4EO4A 1X54A 1YFTA 1SERA 2RB6A 3MEYA 4HA8A 4G85A 3P8YA 1B70A 4TVAB 5ELNA 3JCMP 5LJ5f 1USYC 1N9RA 2J3MA 4UP7A 4YRNA 2EL9A 4XU0A 3MF2A 4M7DG 2AMCB 4X5OA 4PJOC 1ATIA 1U1SA 4JUVA 4OLFA 1D3BB 2RD1A 4H2XA 1JRIA 1X2GA 4YCUA 1WPYA 5GANd 3JB9D 2DU7A 3VQWA 4Q6GA 3L4GB 4H2VA 4ZTUB 1W66A 4HT9A 4YRRA 2ZT6A 5GAOl 3JCMe 1RIQA 1KMNA 1B7YB 5LJ5j 2CGHA 2DXTA 3LC0A 4P71C 4XU3A 4M78B 4NCXA 5GMKe 5GMKm 4P71A 2C7IA 2C8MA 3A74A 2DVEA 3HXXA 2E1HA 4M7AB 1J5WA 1HK9A 2RHQA 1EIYB 4CS2A 4XU1A 1Y96B 3V7RA 4M78D 4M7DB 2E65A 3EFSA 4M7AC 3M4PA 2IY5B 2ZT5A 3RIRA 2DQ0A 3GIBA 1I5LA 3HRIA 2ZT7A 3V8JA 4M7DD 3G1ZA 4YP0A 2I4MA 4NL3A 4A54A 4Y91A 3UGQA 2QHSA 2ZGWA 5GMKl 1GGMA 5GANj 3RUXA 3BW1A 1ADJA 1WLEA 4A53A 4RMFA 1BIBA 4XEOA 3RKXA 4TQFA 5GAOr 4C8QF 4XTZA 3HXUA 4N0AC 3JCMh 3JCMJ 4P73C 3CMQA 3QTCA 4KQEA 4PJOG 2P5IA 2YLBA 4P73A 4JLIA 4OP0A 1H641 1VQZA 2FYKA 3NENA 4XU2A 3PZCA 3RESA 4TQDA 1MGQA 2ODRC 2AKWA 2DTIA 4KR2A 3JB9H 1PYSA 4M75A 3DSQA 4NL2A 5HGQA 1KOGA 4P75A 2DQ3A 4ZIBA 3REUA 4UP9A 2ZNJA 4C92A 4XTUA 4XTXA 2YLCA 4RQEA 2DTHA 4P72C 1B8AA 5GAN5 4F7UF 1H4VB 5GAN3 1ASZA 1ADYA 1NJ6A 2Y90A 4YRKA 3QSUA 1YGBA 3JCMV 1YFSA 4MMKA 3JCMd 3QO8A 5F5WA 3JB9I 1HTTA 3TEHA 4RQFA 3JB9J 1BIAA 4EMGA 3BFMA 1FYFA 1KMMA 4H2XB 1NJ2A 4PJOB 3L2ZA 2DDZA 2XGTA 4CH3A 4J15A 3SB2A 3LSSA 4M7AG 2E5AA 1JJCA 3BY7A 3RERA 2QHVA 4EX5A 4EMKA 2ZCEA 1X01A 4P3NA 4C8QE 4YRQA 2I4NA 2ZZGA 3VQXA 4YRGA 4YDQA 4M77A 4C8QA 2EJGA 4PJOD 2CJAA 1B34A 3JCMb 4H2WA 3HXWA 4WJ3M 3QO3A 4QVCA 3JCMf 4YRLA 4XTYA 3A32A 3FIFA 1WQWA 1NNHA 1SESA 2EWNA 5C53B 4MMLA 3HY0A 1IL2A 4F7UE 4M75F 5I21A 4YRFA 3UGTA 2DU5A 4KR3A 3P8VA 1NYRA 2AMCA 4C92F 4F7UA 3INZA 4BW9A 1D3BA 4EMHA 3VQVA 4QVDA 2J3LA 5GANf 3ICAA 1YFRA 2ZIMA 3RF1A 3A7AA 2ARTA 4CS4A 4DQ2A 3L4GA 2G4CA 1H4TA 2RHSA 3IALA 4X9CA 1BBUA 2Q5IA 4HWOA 5C52B 4M7AD 3QHSA 1ASYA 3HFOA 4JRIA 5GMKj 3HRKA 4J5YA 4H2UA 4WF2A 4YROA 2EAYA 3PGGA 4G84A 4P3OA 4M78A 1SRYA 5GAOq 1Z7NA 3V7CA 5GAN8 5GAMe 3QNEA 4WI1A 4V2SA 4M77F 4YRTA 3PCOB 4YRSA 1EIYA 1EOVA 4DPGA 4YRPA 1KQ2A 3M4QA 4M7DA 2ZNIA 5C51B 1QE0A 1H4QA 2DJZA 3UFGA 2IY5A 2DEQA 1M5Q1 4BWAA 1I8FA 3V7SA 4HWSA 4AH6A 1C0AA 5GMKh 1E1TA 3JCMc 1G5HA 4M75E 3REXA 4M75C 5DY9A 4RCBA 4P75C 4J6XA 4C92E 3RL6A 2ODRD 4C92C 3VU3C 4H2SA 2CJ9A 3JB9F 4CH4A 3QUIA 3QO7A 2Q7GA 1YB3A 3TUPA 3TEHB 3HFZB 3TEGA 2EJFA 4K88A 3LSQA 4K87A 3HFVA 1QF6A 5GAMg 4HVCA 12ASA 2ZT8A 4PHCA 4YCWA 5ELOA 1B70B 1JJCB 3IG2A 3ERRA 4EMKB 3HXYA 4PG3A 4YRCA 4CH5A 4WJ4A 4H02A 1I81A 11ASA 5LJ3e 3M4GA 1HXDA 2Q7HA 2QHUA 1NJ8A 1H4SA 2ZR2A 3RKWA 4CS3A 4J6WA 3HXZA 4C8QB 2VXEA 3A7RA 4EMKC 3E9IA 4P74A 5GAN2 1I4K1 5GAMh 3HFNA 4M77E 1EVLA 1X55A 4M77C 3HXVA 3P8TA 4C8QC 4TVWA 4M78F 2QHTA 3BDUA 2I4LA 2VXFA 2CJBA 4TVYA 3HY1A 1N9WA 1EFWA 3R07A 3JCMQ 4M7AF 4YRJA 2ALYA 2I2LA 1EVKA 4YRIA 3E9HA 1WNLA 1LNXA 3SWNA 2ZZEA 1L0WA 4M7DF 2K57A 1Z7MA
chains in the Genus database with same CATH superfamily
3VS6A 2BTTA 2PMEA 2XU8A 1X2QA 2P0LA 2Y4YA 1M8VA 4PNOA 3S3NA 2DKGA 1VQPA 1WHGA 1Q81C 1ZUKA 4F7UB 5LJ5e 4H2TA 3FDRA 1FMVA 1B76A 4LDUA 2GFUA 2NLUA 3IKMB 4E51A 3JCMX 3L1AA 1W2BP 1NPRA 2HQHA 1NJ1A 1VQPQ 2CIMA 2EYWA 2ABLA 2AT1B 3V8LA 4M75G 3RGLA 5GAOn 1E1OA 5GAN7 2FB7A 1VA7A 3CCQA 2LT4A 3D7SB 1B07A 2K3BA 4XEMA 4JRKA 1WJQA 3CC2A 4RCCA 5A0DA 1JO8A 4AG2C 5K1PA 1QP2A 4OB3B 4M78E 2EQUA 3CCQQ 4ZTZB 5LJ5g 3OS1A 2CZ1B 2JTEA 3CC2Q 2EVRA 1XJWB 1VQMA 2DAQA 4Q5WA 1VYTA 1QCFA 4M7DE 4OMFB 2COZA 2OTJA 2P4RA 4UC4A 2ARUA 1Y96A 1WHMA 4J9CA 5LJ3d 4OB1B 3JCMg 5LJ5h 2I4OA 1E6GA 1LJOA 1SETA 1OEBA 1VQMQ 1Q86C 2ZIOA 1BI0A 1K8AU 1VQOT 4YREA 2RA2A 5GAMj 3FJ5A 2OTJQ 2RHYA 2O4XB 1E24A 1G3YA 5HY6A 2D6FA 2YHTA 4LVJA 1GFDA 2AKKA 2ESWA 4E7KA 2ARSA 3RR6A 4LVKA 2NUZA 1WQ7A 4HWTA 2RJCA 5KNNA 3M56A 3FB9A 1IGUA 4IUUA 2ZZFA 5K1XA 2EIFA 2H3EB 5LJ3f 3ULRB 5IH2A 4M77B 1NYQA 4YCVA 4CC3A 1PC0A 3THKA 4CC7A 1WU7A 4IUTA 3CCET 1RAIB 2ALYB 1BBWA 4P72A 5GAN4 4YYEA 2F2XA 3SEMA 2NWMA 5IT9E 4ELYC 4KGZB 2ZR3A 4Q15A 4O2DA 2RK2A 1WFWA 1UJYA 5HK3A 1NYGA 3W3SA 4GY5A 1KQSP 3CCLT 1OV3A 3MEYA 4HA8A 3P8YA 2L3PA 4JRQA 5D7UA 5ELNA 2P0KA 2K3XA 1AZGB 2CP7A 3TEEA 3QYGB 2QQSA 5CKFA 4YRNA 2EL9A 4X5OA 1FMWA 2FEIA 3G1JA 2WSCE 1YIJT 2W10A 3A1PA 1X2GA 4YCUA 1WPYA 5GANd 3VQWA 2V8JA 2HKNA 2D1XA 3L4GB 4Q6GA 1AD5A 2M0YA 1J3TA 1QVGP 3CCSA 3OS2A 4MDXA 4D8KA 1VQNA 5AT1B 2ZT6A 2E3IA 1H8KA 1MMDA 5GAOl 2XK0A 1RIQA 2GTOA 1KMNA 2DPPB 2PU9B 3M53A 3MJXA 1UECA 3R6OA 2P4TA 2CGHA 3OYLA 1OZ3A 3CCSQ 3FRNA 3LC0A 4P71C 4M78B 1Y57A 2DXCA 1KD1R 4NCXA 5GMKe 1VQNQ 5FROA 4OMOA 2RO0A 2DVEA 3QYHB 2XD0A 2MF2A 4JZ4A 1OI1A 1HK9A 2RHQA 3X20B 2RHIA 1Y96B 3EG0A 1VYUA 2LCLA 1WI7A 4M7DB 2PVDB 2XKOC 3LWHA 3C4SA 2E65A 3RIRA 1YI2A 1I5LA 2DETA 1VQ9T 3I35A 1TU0B 3OS0A 5CQYA 1SSHA 4HXJA 3G6ET 2DD5A 4A54A 2DO3A 4Y91A 1YI2Q 1I07A 2ZGWA 4ME7A 1GGMA 3RUXA 1RLPC 5KH6A 4BACA 2HMAA 1WLEA 1TTHB 2F2WA 3RKXA 1Q81U 2EBPA 2LQNA 2WSEE 3CCMT 4E7IA 2ZZDA 4P73C 2JT4A 3NGPA 5CKBA 2YLBA 1ABQA 4OP0A 2VWFA 1PM3A 2CSQA 4DBFA 1MGQA 4VUBA 4E2FB 1DJ7B 3FEOA 1I5OB 4M75A 4NL2A 1VQ5A 5HGQA 3REUA 2ZNJA 2C0TA 5CKDA 4XTUA 4ESRA 4XTXA 4Z89A 2M16A 1O9SA 1B8AA 3GF5A 5KE2A 2K9GA 2QQ9A 1HD3A 1FMKA 2RMOA 4YRKA 1TWBA 1VQ5Q 1YFSA 2MK5A 3JCMd 3QO8A 4B9XA 4JDSA 3JB9J 2GGRA 3BDLA 4EMGA 1AWJA 1NM7A 2EYYA 1MMNA 2IVWA 3FLGA 5KYWB 4PJOB 1QKXA 3H0IA 2IPOB 2DDZA 2D9TA 4RKUE 3OSVA 4M7AG 1JJCA 3RERA 1W2BS 2M51A 4RG2A 1KC8C 2ENMA 1Q82C 3X26B 2OAWA 2ROLA 2AZVA 3H6ZA 2EYXA 4ANJA 4YDQA 3CBMA 5KCHA 2CJAA 1Q86U 1B34A 4LNPA 5I11A 4C0DB 5A2QE 2F5TX 2KXCA 3CC7A 1MUZA 2LJ3A 2FRYA 3HXWA 1G3SA 1S1NA 1KHCA 3RNJA 3JCMf 1OU8A 2E6NA 3M5AA 2RN8A 3FIFA 1VQPT 1QQJA 1GFCA 2EPDA 1CKAA 2EWNA 1UTIA 3GPLA 3LGFA 4MMLA 3CC7Q 5J39A 4F16A 2X4XA 4BD3A 2Z0WA 2DU5A 2RI2A 1OZ2A 1IGQA 3P8VA 2AMCA 4GLKA 5DLOA 1ZQ1A 1U06A 1SKUB 5HKCA 3A7AA 1X6BA 3CCQT 1LCKA 5DM7R 4DQ2A 2G4CA 1SPKA 1H4TA 3IALA 5CK9A 4HWOA 5C52B 3CC2T 3QHSA 2IG0A 3GBQA 3HFOA 4AMCA 2E6ZA 1N8RC 4FYYB 2LZ6B 3OMGA 2GF7A 4WF2A 1CSKA 4Z02A 1ACMB 3LH5A 2K2MA 1KJWA 2DYIA 2E3HA 1VQOA 2YRDA 1VQ4A 5GAN8 1ZLMA 1AWXA 2DL3A 1VQMT 4WI1A 3CCVA 4JRPA 4V2SA 4YRSA 2JJ9A 2JM8A 2CZ6B 1EIYA 5D6WA 2DD4A 1Q7YC 2CT4A 1G8XA 1VQOQ 4HCKA 1VQ4Q 1H4QA 2DJZA 2K3YA 2LT1A 2DEQA 2FG0A 2CSIA 3L2QA 3M0TA 1WYXA 1I8FA 4HWSA 3CCVQ 4HCBA 1AEYA 1C0AA 1G5HA 1WA7A 5DY9A 1VQKA 3GOXA 4P75C 1EZZB 4C92E 4IKFA 1AZEA 1OX8A 3CC4A 2QTVA 2J6KA 1YB3A 3TUPA 2G6FX 2LP5A 1QVPA 1KQSS 3VRZA 1H92A 2RHUA 1VQKQ 1NG2A 2YT6A 4HVCA 2QEXA 2ZT8A 1NEGA 1WIEA 3CC4Q 1Z9ZA 1JJCB 3HXYA 4WJ4A 2BZ8A 3TREA 3EGDA 3WVDB 5LJ3e 3M4GA 1NJ8A 2NS6A 4J6WA 1M90R 1P92A 4EMKC 4P74A 2QEXQ 2H8HA 3X25B 1IB8A 1RL2A 4ZN1A 3HRTA 1TOVA 2W0ZA 2PQWA 1EVLA 4M77C 3P8TA 3MKDA 3I55A 3VRYA 2E4HA 2QHTA 1UFFA 1OPLA 1F1BB 2CJBA 3HY1A 1C6VX 2AK5A 1MHNA 4BDZA 2EKHA 1N9WA 3ZEHA 1YHQA 1M4ZA 1ABOA 4YRJA 4BY6B 4FW2A 1M1FA 2KAFA 1YJ9A 1W4SA 2JM9A 1L0WA 1G2BA 2KEAA 2GTJA 3I55Q 2LJ0A 4A4FA 3HTZA 2A0FB 2QXFA 4D8DA 3A8LB 4XTWA 1YHQQ 5LJ3g 2DNUA 1YJ9Q 4J9HA 5GAMd 3CCST 2V1RA 4HT8A 1A0NB 4PFOA 1K1ZA 4JZ3A 2B8AA 4N4IA 1VQNT 1RAFB 1UUEA 2K6DA 3M0UA 3PVQA 4YRMA 5LJ3h 3VS4A 3JCMW 2RQUA 4XTVA 3CPWP 3QIIA 2K5IA 4AT1B 4EDUA 4M78C 4DA4A 1K73C 2E3CA 4F14A 5GAMf 5GANe 3O8VA 4M7AE 1WHLA 2VVKA 1H3ZA 1KC8U 2Q5HA 1YI2T 3AT1B 3C95A 5J26A 1Q82U 4M7AA 4M7DC 3OD1A 4ZGDB 4IUVA 3LX7A 3CCMA 2AKWB 2DZ9A 3HTRA 5I22A 1ZBXA 3R6NA 4P5NA 1SHFA 3OYNA 1BK2A 4C92B 4IIOA 2CT3A 4QT7A 4BE1A 1UGQB 4HWRA 2LQWA 3CCMQ 1VQ7A 3GNGA 3H41A 2JNGA 4YPFA 3A7UA 4LNSA 1X56A 1K76A 2JUFA 3EGDB 1S72A 4H2YA 3VBBA 1EQRA 5GANg 3JSCA 1T0HA 1WGSA 1ZSZB 3M58A 4FIBA 1VQ7Q 3RBBB 4QVZA 1K9AA 3EFRA 3M0PA 4KT0E 4XK8E 2K7AA 1W1FA 4X9DA 1NJIR 2QTXA 4E47A 1VQ5T 1S72Q 1RACB 2DLPA 4C5HA 3AHUA 3VS0A 3NETA 5FRMA 1KG1A 5GANh 1N8RU 1WXTA 3PIPA 1NBEB 4TTVA 4RMOA 2HBPA 1W70A 2DVJA 3H0FA 4FT2A 4M77D 4NOYA 3NELA 2ZPGB 3HFZA 2O2OA 3SWNC 3OB9A 4EO4A 2KT1A 1PSFA 2EKOA 4PK4A 1G5VA 4G85A 3EH1A 4D6WA 2J3MA 2X3WD 3OBWA 1Q7YU 1USYC 4LVIA 1X27A 2R58A 1PRLC 4XU0A 3MF2A 1BI3A 1KSWA 3QWYA 4PJOC 1SSFA 1D3BB 2YUQA 2LQ8A 2K79A 3M59A 3GNFB 3EAEA 4IURA 2P0PA 1V29B 3JB9D 1UEBA 9ATCB 1EFNA 1W2BA 2KDSA 3CC7T 1NEBA 2AIRB 4BI4A 4H2VA 3OW2P 5KCOA 4LXCA 1V1CA 1SF9A 4C0DC 3JCMe 2L3SA 3VV0A 6AT1B 4FSXA 2FVUA 2HKQB 2DM1A 2DXTA 3QZ9B 4PJNA 2YUOA 3A98A 3PMIA 2FO0A 5GMKm 2LNHB 2C7IA 3PE0A 3QWXX 2C06A 5IAYA 4OF1A 4M7AB 4PJLA 3H0HA 2CH4W 4KRTA 1D09B 4M78D 2KNBB 5IHKA 1KIKA 1RADB 3VS3A 1WXBA 3M4PA 2IY5B 1UHFA 4BE2A 2CREA 2DQ0A 2NYSA 2EGAA 4HVWA 3CQTA 1R8OB 3M0QA 4M7DD 2PVGB 2HSPA 3G1ZA 4YP0A 3URGA 3RMQA 2EYZA 1VQ4T 4GBQA 2GQIA 3BW1A 4LDYA 2EW3A 1WDXA 1WHJA 3CCVT 4A53A 1RAEB 2GBQA 1H3HA 4XEOA 1ZUUA 4TQFA 4C8QF 3QPHA 3QZ5B 1IO6A 2CUBA 2AHJB 3OYJA 5KYYA 4N0AC 3JCMh 2HAXA 1YJWA 2CUDA 2P5IA 2XI9A 4F17A 4CI0C 4JLIA 1VQZA 1H641 2DBKA 2FYKA 2QDYB 3RESA 4TQDA 2X4WA 3HPWA 2J6FA 3GLXA 1VQKT 4KR2A 1PYSA 3ZBDA 1KD1C 3CC4T 1YJWQ 1OPKA 1NE8A 1KOGA 2DQ3A 3OBYA 3L2VA 2OX7A 4R0KA 2C0OA 2HZYA 4F7UF 2DL8A 2QEXT 1WXUA 4LDXA 5HK0A 1X2KA 1PG5B 3JCMV 2QG9B 4CC4B 1K73U 1RUWA 4QQGA 5F5WA 2M02A 4RQFA 2O31A 4ORZA 4L59A 2RQWA 3A8HB 3OSSC 3OYMA 2QQBA 5KE3A 3L2ZA 2XGTA 3PNWC 3LSSA 2E5AA 4FYXB 2RPNA 2MIOA 3JV3A 2CP3A 4YRQA 1RAAB 1RLQC 3I55T 5C6SA 2I4NA 2ZZGA 4YRGA 1M1GA 4PJOD 2HQXA 2D8JA 3JCMb 1YHQT 4FSSA 2GCXA 1YJ9T 3OQ5A 3A8GB 2LCSA 1JJ2S 5FU7B 4XTYA 1Y07A 2VGMA 1GCQA 3LH0A 4BY6C 3UA6A 4LD6A 1SESA 1YCSB 1K9MR 1IREB 2CP6A 3HY0A 2ZCFB 5I21A 1MMAA 3M0RA 2VUBA 1WJRA 3VQVA 4QVDA 4OMQA 5GANf 2J3LA 1YFRA 3ICAA 5ECAA 2PZ1A 4CS4A 2A3LA 2CKKA 2ED0A 3HHTB 1ASYA 1X6GA 3OYBA 3TSWA 4R55A 5CR2A 1PKSA 2DE0X 1BB9A 2EAYA 4RTZA 5KYYB 3OYAA 3UDCA 4J9EA 5CKEA 5GAMe 1EIFA 1VQ6A 4L5GA 4A4EA 3G71A 1TG0A 4C5IA 2DMOA 4M77F 2IIMA 2KROA 1K4US 4DPGA 4YRPA 3DB4A 4ZTFA 1E6HA 1QCOA 2FPFA 1E7OA 2NUTA 1QVFS 5IHIA 3JAME 2JVVA 2OAUA 3UFGA 5FWCA 1M5Q1 1VQ6Q 4BWAA 3G71Q 2EQMA 1T3SA 5GMKh 4PFPA 1E1TA 3VS5A 4M75E 3PT9A 2HL5C 1VQ7T 2DX1A 4RCBA 4J6XA 4C92C 3VU3C 2ZPBB 2LRQA 2OTLT 3JB9F 3QUIA 4CH4A 3RDVA 2DFUA 3DLMA 1S72T 3TEGA 4K87A 3CXCS 4C0GA 1MV0B 5GAMg 2LNVA 2OJ2A 3LWIA 1BI1A 2NUPA 2HEQA 2QQAA 2JMAA 3UPUA 4YRCA 1AVZC 4CH5A 5FRNA 4H02A 11ASA 1GBQA 1ZSZC 3VS1A 3IQLA 4CRIA 1HXDA 2ZR2A 4PLIA 3RKWA 1D0YA 3CCUA 3HXZA 1FYNA 4LUEA 1B7TA 3QJ6A 3A7RA 2QASA 2X9HA 5GAMh 1UHCA 5LL6S 1GCPA 4LVMA 3HXVA 4C8QC 4M78F 2RF0A 3OS5A 2LCCA 3CCUQ 2ECZA 3R07A 3JCMQ 1BCMA 2QGFB 1EVKA 1BI2A 1WNLA 1OYXA 1WHHA 1R0CB 2D0QB 3VUBA 4M7DF 2K57A 1YFTA 1Z7NA 2KE9A 1UGVA 4IIMA 4FYVB 1VQ8A 1PCXA 2XIDA 1ZUYA 1ZA1B 5DLQE 4LN2A 3L2UA 4FT4A 5A0GA 2RHQB 1JBMA 2MAMA 2X3XD 3MCAB 4OGCA 1BCOA 3PTAA 3UH0A 1VQ8Q 2JN0A 4K11A 4DOVA 2L8DA 1KD1U 3CCJA 4J83A 4B9WA 3A5YA 5CCAA 2ZTGA 3MEWA 2YSQA 1HC7A 2RQVA 2PNIA 1NJ5A 2ZXFA 3QO5A 2JS2A 4KH1B 1M3BA 1JXOA 5FLXE 3CCJQ 3L2WA 1JXMA 1M90C 1PNJA 1YFNA 3A31A 3CBPA 2R57A 1YITA 3IKLA 1V76A 2XDPA 4HCZA 5IXBA 2KRNA 1UB4A 1M8MA 2VV5A 2NUTB 1X75C 1N27A 3MF1A 2E64A 1OQKA 4FW1A 2L0AA 1D1AA 1KQ1A 2JZ2A 1YITQ 2XDDA 4QQDA 2V8IA 3NFCA 4LUDA 2DILA 3I5RA 4M77G 5L8RE 1AHJB 3EG1A 4FU6A 4BI8B 3ME9A 4M75B 1O75A 5GJVB 2E41A 4KUDK 3MHXA 3S3MA 3S6WA 1R77A 1G5IA 2BUDA 2KMTA 5C0MA 4KGVB 4O6JA 4JS5A 1N9SA 1LYLA 4PJOF 5GMKi 3EG2A 5E3IA 4X1VA 3RACA 4C92D 2RNAA 1YJWT 3J80E 4L87A 4NS5A 1T3LA 3A5ZA 3JB9G 2XHCA 2FPDA 1CKBA 1YWOA 3PCOA 2ROTA 3I7FA 4IUQA 1X2HA 3SDZA 1RI0A 1QP3A 4JJCA 1UG1A 2XICA 3C94A 3FC3A 2C0IA 1B34B 2DBMA 1QVGS 1R0BG 1AWWA 3OMCA 1M1KR 3EFOA 4FL6A 1UE9A 4K86A 4ZGJB 2CZ0B 4C8QD 2EJ9A 2P84A 2RHZA 5GAN6 3NTIA 5CIUA 4M78G 4C5GA 2CH4A 1QCNA 1SERA 3P8DA 1M3CA 2RB6A 4PFZA 3UF4A 1B70A 2B86A 1LPLA 2RHXA 1N9RA 1RABB 4UP7A 2J05A 4M7DG 2RJFA 2AMCB 3CEYA 2DEUA 3RMSA 1U1SA 2ED1A 4PJJA 3PFSA 1JRIA 1NLPC 2QK0A 2DU7A 4JJBA 2FL7A 3NMZC 2LX7A 1Y0MA 4HT9A 2FHDA 2DA9A 4DBRA 4YRRA 2XMFA 4X34A 2EYQA 3E9GA 3MEVA 1YP5A 1ZX6A 5LJ5j 3ZL7C 3UA7A 1NJIC 5FU7C 2JOYA 1JJ2A 4XU3A 4LE9A 3M55A 2KRMA 4FCYA 1WHKA 2C8MA 3A74A 2MI6A 2E1HA 3L2RA 1EIYB 1D0ZA 3QKJA 1M2VA 1NPPA 2DRMA 2QDLA 4HVVA 2BKDN 3ER0A 3V7RA 2PUOB 3EFSA 2ZT5A 5CQXA 1X43A 1PD0A 2CP0A 3HRIA 3CCRA 2O88A 4PKCC 2CZ7B 4R56A 2I4MA 1PKTA 1Y71A 3M4YA 1TUDA 1TUGB 2X4JA 3UGQA 4QQ6A 2I0NA 2JXBA 5GMKl 3CCRQ 3MQZA 1VQ6T 3A5ZB 3G71T 4L6V5 1BIBA 2L5QA 3TCJA 1UJ0A 3MO8A 4XTZA 4EIKA 3HXUA 2X51A 3META 1T0JA 2OTLA 4BDYA 3JCMJ 1K8AR 3QTCA 4KQEA 4PJOG 3TQ7P 5A0LA 2MYSA 2EQJA 4J9GA 3NENA 2KYBA 2ZAEA 3QDRB 4OB2B 2KSSA 1OULA 1XOVA 3DB3A 1SEMA 2MWPA 1UDLA 4JJNK 1WLPB 3TU4K 2DTIA 4PLLA 2OTLQ 1EX4A 1QVFA 4JS4A 3G4SA 3EHRA 1OU9A 4P75A 4ZIBA 1BYMA 2DL4A 1WJSA 2DTHA 2LX9A 4N4HA 4P72C 5GAN5 1H4VB 4OMPA 1M90U 1WX6A 4AFZC 4ELZC 1ADYA 4E7HA 3G4SQ 3QSUA 2DL7A 2F69A 2LC4A 3VUZA 3JB9I 3TEHA 3LYIA 4A4GA 3MPUB 1BIAA 5I2MA 3CXCA 2R5AA 3CCUT 1FYFA 1UGRB 3KXTA 2VGNA 1PWTA 3A8MB 3QBYA 1MV3A 2CS7A 2GFAA 4B6MA 3SB2A 8ATCB 3CPFA 2QHVA 4EX5A 4BUGA 4EMKA 3P8HA 3PVLA 1X01A 4Z88A 4FM4B 1HJDA 2VKNA 3Q1JA 4M77A 1ZA2B 2EJGA 3NTHA 4RUGA 5IHNA 3CMET 3E9FA 2DK3A 2A37A 2MPXC 2O9SA 2ATCB 4QVCA 1NZ9A 1QWEA 4YRLA 1VQ8T 2K4YA 3A32A 2DRKA 3M9QA 1WQWA 2K5FA 4JLGA 1M2VB 2KK4A 2RJDA 1IL2A 2HD0A 4RTYA 4GLMA 4HVUA 3QXEB 4KR3A 4C92F 3CCJT 1GBRA 4EMHA 2ZIMA 3RF1A 1IXDA 4II1A 2ARTA 3L4GA 2RHSA 4OVAA 4X9CA 2Q5IA 3KFVA 4BB7A 3VYGA 5GMKj 1IHVA 1N5ZA 5FWBA 3HRKA 4OB0B 1KHIA 2SEMA 1YBYA 3X28B 4C0ZA 1YITT 8AT1B 2EFIA 2A36A 2ZPIB 3TSZA 4YROA 4YTLA 5KYXA 2LTOA 4M78A 1SRYA 1TSFA 2K5LA 2K2VA 3CD6A 3KUFA 3DLLA 2RJEA 2KI7A 3QJYA 3P8BB 2COYA 2FRWA 4M7DA 3JRZA 3I56T 2ZNIA 5C51B 1QE0A 1RI9A 1QLYA 3CD6Q 4E7ZA 2E5KA 3V7SA 1Q81R 4AH6A 4MZPA 3JCMc 1K9MC 4M75C 3QDFA 2D8HA 2CJ9A 1NJIU 3TEHB 2VB6A 3HFZB 4DBHA 2EJFA 2LDMA 4K88A 4DBQA 3LSQA 3HFVA 2WSFE 4A4KA 1QF6A 2D0NA 1M9SA 3REAB 2QA4A 4YCWA 5ELOA 2J6OA 1C1AA 2EGEA 2PUKB 4EMKB 4PG3A 1KQSA 2QHUA 2Q7HA 1U8RA 1RAHB 2MCNA 4AG1C 5FU6B 3I9QA 2VXEA 1VIEA 3E9IA 5GAN2 2QA4Q 3HFNA 4J7IA 2RK1A 1RAGB 2QQRA 2ZPFB 4TVWA 3BDUA 2DERA 2I4LA 2VXFA 3GP8A 2LVMA 1G83A 4E6RA 4ZTJA 2XG8D 1QVGA 1EFWA 2YRCA 4M7AF 2I2LA 2VYTA 4YRIA 3E9HA 3BE3A 3PIOA 1MNEA 2CYZB 3CPWS 3SWNA 2ZZEA 3O5ZA 5GAN3 1Z7MA 2M0OA 5CAIA 2DXUA 3CMAA 2ZINA 3OYEA 1Q86R 4PJOE 3EGUA 5D6YA 1N6AA 3HKSA 4Y92A 1USYA 5KYWA 2G3RA 2HNIA 2DZCA 4PJOA 1ZHIA 3MP1A 2YDLA 4TVAA 2MWOA 2RHSB 3CMAQ 1K0SA 2H3JA 1JB0E 1M30A 3VJPA 2X4YA 2PTKA 4AFSC 2DJQA 1SG5A 3FJPA 5KYUA 4J9IA 2E10A 4C92G 2YUNA 5I2SA 1K0XA 4BE0A 4OMLA 5KYXB 2RM4A 1AOJA 4UP8A 5KYNA 2L3QA 1TXQA 3PMTA 4XQ3A 1B7YA 3NTKA 3BJUA 2DIQA 2FZCB 1VIFA 2X35A 1U1TA 5GAOp 2Q7EA 4CH6A 4Z8AA 4J6YA 4WCIA 2V26A 1WYDA 3MEUA 3CCRT 1Q95G 1QW1A 4A4HA 1ARKA 1IZ6A 4P3PA 2KY9A 3OYIA 2O9VA 3HSBA 4C8QG 1PYSB 3E19A 1IRXA 1U3OA 2ZPEB 1G3TA 2BZXA 2CP5A 2LQKA 2YRVA 4RDXA 1HYOA 1D1BA 1PSEA 2KGTA 3HRUA 4RG8A 2KQWA 3C12A 2F1LA 3QG1A 4M75D 4C5EA 2PMFA 5HCKA 1QWFA 3EG3A 5CVIA 1JEGA 3OYHA 1VQLA 4TWAA 2RI3A 1TH7A 1IHWA 1X69A 4N0AA 1ZSGA 2VC8A 2XTIA 2RI5A 2A28A 2EGCA 1YJNA 4TVRA 3WQZA 5EG2A 4F7UG 3MP6A 1VQLQ 3KFUA 3DKMA 2AKLA 3G4ST 1G51A 3UATA 5LJ5d 1WZOA 1E22A 3VQYA 3NEMA 4UPAA 4P74C 1GRIA 2HDAA 3J7AF 2MOXA 4OMMA 3V8KA 1YCYA 2CP2A 1YJNQ 3OW2S 1JQQA 2DTOA 3TVTA 3SWNB 2A8EA 3RKYA 4HWPA 1PHTA 1LOJA 2DYBA 7AT1B 5GAOm 3CMEA 4XAXB 4QW2A 5LJ3j 2GNCA 2FZKB 4ATOA 1X54A 3E1SA 5M9OA 4IUPA 1X6OA 1VYVA 2JW4A 2KYMA 4TVAB 2O01E 3JCMP 3HRSA 5LJ5f 5IXFA 1BU1A 4HKEA 3CMEQ 3EGXA 1ATIA 2HSEB 4JUVA 2WACA 4OLFA 2RD1A 4KULA 4H2XA 5KYUB 3S3OA 2BZYA 5EC7A 3OYFA 3EG9A 4E7LA 3M54A 1K9MU 5GJWB 4ZTUB 1W66A 4RTTA 5FW9A 2BIVA 1Y7XA 2GQVA 1M3AA 1B7YB 1YN8A 2COWA 2M9UA 2FPEA 1B3QA 2QAZA 1ZBJA 2HL3A 4J8OA 4P71A 1I0CA 3OY9A 3UT1A 3NPFA 4BI3A 2XDBA 1YNZA 3HXXA 3G7ZA 1J5WA 3NHNA 4J9BA 3X24B 4XU1A 4J7FA 4EPCA 4CS2A 4MDWA 3EH2A 1M1KC 2KBTA 3C0CA 1FX7A 3F70A 3VKIA 4M7AC 3GIBA 3U23A 1TS9A 4PL6A 2ZT7A 3V8JA 1PD1A 4AFQC 1NYFA 1C0MA 4AFUC 3T9NA 4ZNXA 2JS0A 4KH0B 3I56A 2J7IA 4NL3A 1KC8R 1Q82R 4E7JA 3N5BB 2SRCA 2QHSA 3CD6T 2A08A 5GANj 1ADJA 1AWOA 2DF6A 4RMFA 1VOMA 5GAOr 2KXDA 2L89A 4O5VA 3I56Q 2OTJT 2NUPB 4RTWA 3CMQA 3VYHB 5CO7A 3A8OB 2VASA 4P73A 3E2UA 2F5KA 1OX9A 4XU2A 3PZCA 2ODRC 2Y4XA 2AKWA 3JB9H 2BE9B 3DSQA 4RTVA 4UP9A 4C92A 1LVKA 3UWNA 2YLCA 4RQEA 4KBMB 2E70A 1FXXA 1BKBA 2JTMA 3CCEA 1SHGA 1ASZA 3ASKA 4PJMA 2QA4T 1NJ6A 2Y90A 4DEXA 3OYKA 1YGBA 4MMKA 1HTTA 2P0QA 1TUCA 2ZPHB 1MMGA 2FZGB 3BFMA 1XNIA 2DL5A 3MP8A 3EGXB 3MEAA 3CCEQ 1ZSZA 1N8RR 1KMMA 4H2XB 3VS7A 3CCLA 1NJ2A 1I1JA 1UGSB 4CH3A 3EG9B 4J15A 3BY7A 1D0XA 2ZCEA 4LVLA 4P3NA 4C8QE 5FU6C 3REBB 2E12A 2YUPA 4MZMA 4A63B 3VQXA 4C8QA 4E7SA 1YIJA 3CCLQ 4H2WA 2JMCA 4J9DA 2RQRA 2KT8A 1Q7YR 4WJ3M 1KK7A 1K8AC 4HCCA 3QO3A 2RH2A 3CMAT 4KGXB 3LW5E 2MMPA 2HCKA 2LMJA 1JU5C 2J06A 1YIJQ 1NNHA 5C53B 3CPWA 4DOWA 2KR3A 1XQHA 2QYZA 4C0FA 4KUIA 2A7YA 1BBZA 2AZSA 4FYWB 4F7UE 1HSQA 4ZN3A 4M75F 4YRFA 3UGTA 1GL5A 1NYRA 3KBGA 4F7UA 1U5SA 3INZA 4BW9A 1D3BA 2R5MA 3CBOA 4DEYA 2PVOB 4LDVA 4HT4A 4RTUA 2M1HA 3LLRA 1UGPB 3L42A 1M27C 2EQKA 1BBUA 1KFZA 4M7AD 5L23A 2L3RA 4JRIA 3M57A 3VS2A 4J9FA 1JJ2P 1VQ9A 4J5YA 4H2UA 1SRLA 2KRSA 4JJDA 4OGEA 3EHQA 1NLOC 3PGGA 3G6EA 4G84A 4M4ZA 3WVEB 3OA6A 4P3OA 4WTOB 2L2PA 4Y28E 5GAOq 4F04B 4JPBW 5CKHA 3V7CA 4LD9K 1FWZA 4ZGEB 3QNEA 4N4GA 1VQ9Q 3SD4A 4YRTA 3PCOB 1OOTA 1EOVA 5J3BA 2DXBA 3ZFJA 1KQ2A 2F2VA 2HBWA 1XTDA 2EQIA 3G6EQ 3M4QA 1AT1B 2E5QA 3M0SA 2IY5A 1PRMC 3LGLA 3HL8A 2V8KA 4RTXA 3HP9A 3REXA 2RQTA 5IN1A 1D1CA 1GXIE 3H8ZA 5D6XA 3RL6A 2DIGA 2ODRD 2HQEA 3EFOB 3I5SA 3SFMA 3WXMB 4H2SA 1VQLT 3QO7A 3OYCA 2Q7GA 3SHWA 4CC2A 2BE7D 2QI2A 2QGGA 4LDWA 2O4XA 2KVQG 12ASA 4QKUA 4MZTA 2JTFA 1YJNT 4PHCA 2YWWA 1B70B 2CDTA 2OI3A 3ERRA 3IG2A 1M1KU 1I81A 1H4SA 1W6XA 1VUBA 1QVFP 1QMCA 4CS3A 1Z9QA 4C8QB 1QKWA 3J81E 2V1QA 2LJ1A 1I4K1 4OMNA 1G3WA 1K73R 4M77E 1X55A 3OYDA 1M2OA 1YWPA 4TVYA 1SRMA 3OYYA 2YXYA 3OW2A 2ALYA 1MNDA 5AYFA 3CXCP 3H9NA 1LNXA 3OYGA 1GCQC
chains in the Genus database with same CATH topology
2PMEA 2XU8A 2P0LA 2Y4YA 1M8VA 4PNOA 3S3NA 2DKGA 1VQPA 1Q81C 4F7UB 5LJ5e 4H2TA 3FDRA 1B76A 4LDUA 2GFUA 2NLUA 3IKMB 4E51A 3JCMX 3L1AA 1NPRA 1NJ1A 2CIMA 3V8LA 4M75G 3RGLA 5GAOn 1E1OA 5GAN7 2FB7A 3CCQA 2LT4A 4XEMA 4JRKA 1WJQA 3CC2A 4RCCA 5A0DA 5K1PA 1QP2A 4OB3B 4M78E 2EQUA 4ZTZB 5LJ5g 3OS1A 2CZ1B 1VQMA 2DAQA 4Q5WA 4M7DE 4OMFB 2OTJA 4UC4A 2ARUA 1Y96A 5LJ3d 4OB1B 3JCMg 5LJ5h 2I4OA 1LJOA 1SETA 1Q86C 2ZIOA 1BI0A 1K8AU 1VQOT 4YREA 2RA2A 5GAMj 2RHYA 2O4XB 1E24A 1G3YA 5HY6A 2D6FA 2YHTA 4LVJA 4E7KA 2ARSA 4LVKA 1WQ7A 4HWTA 2RJCA 5KNNA 3M56A 3FB9A 4IUUA 2ZZFA 5K1XA 2EIFA 5LJ3f 4M77B 1NYQA 4YCVA 1WU7A 4IUTA 3CCET 2ALYB 1BBWA 4P72A 5GAN4 4YYEA 5IT9E 2ZR3A 4ELYC 4Q15A 4O2DA 2RK2A 5HK3A 3W3SA 4GY5A 3CCLT 3MEYA 4HA8A 3P8YA 4JRQA 5ELNA 2P0KA 2K3XA 3TEEA 3QYGB 2QQSA 5CKFA 4YRNA 2EL9A 4X5OA 2WSCE 1YIJT 1X2GA 4YCUA 1WPYA 5GANd 3VQWA 2V8JA 4Q6GA 3L4GB 3CCSA 3OS2A 4MDXA 1VQNA 2ZT6A 5GAOl 2XK0A 1RIQA 1KMNA 2DPPB 2PU9B 3M53A 3R6OA 2P4TA 2CGHA 3OYLA 1OZ3A 3FRNA 3LC0A 4P71C 4M78B 2DXCA 4NCXA 5GMKe 5FROA 2RO0A 2DVEA 3QYHB 2XD0A 2MF2A 1OI1A 1HK9A 2RHQA 3X20B 2RHIA 1Y96B 2LCLA 4M7DB 2PVDB 2XKOC 3LWHA 3C4SA 2E65A 3RIRA 1YI2A 1I5LA 1VQ9T 3OS0A 5CQYA 3G6ET 2DD5A 4A54A 2DO3A 4Y91A 2ZGWA 4ME7A 1GGMA 3RUXA 5KH6A 4BACA 1WLEA 3RKXA 1Q81U 2WSEE 3CCMT 4E7IA 2ZZDA 4P73C 5CKBA 2YLBA 4OP0A 1MGQA 4VUBA 1DJ7B 3FEOA 4M75A 4NL2A 1VQ5A 5HGQA 3REUA 2ZNJA 5CKDA 4XTUA 4XTXA 2M16A 1O9SA 1B8AA 3GF5A 5KE2A 2QQ9A 4YRKA 1YFSA 3JCMd 3QO8A 4B9XA 4JDSA 3JB9J 3BDLA 4EMGA 2IVWA 3FLGA 4PJOB 2DDZA 2D9TA 4RKUE 3OSVA 4M7AG 1JJCA 3RERA 1W2BS 4RG2A 1KC8C 1Q82C 3X26B 3H6ZA 4YDQA 3CBMA 5KCHA 2CJAA 1Q86U 1B34A 5A2QE 4C0DB 2F5TX 3CC7A 3HXWA 1G3SA 1KHCA 3JCMf 2E6NA 3M5AA 3FIFA 1VQPT 2EWNA 3GPLA 3LGFA 4MMLA 5J39A 2X4XA 4BD3A 2DU5A 2RI2A 1OZ2A 3P8VA 2AMCA 4GLKA 5DLOA 1ZQ1A 5HKCA 3A7AA 3CCQT 5DM7R 4DQ2A 2G4CA 1H4TA 3IALA 5CK9A 4HWOA 5C52B 3CC2T 3QHSA 2IG0A 3HFOA 2E6ZA 1N8RC 3OMGA 2GF7A 4WF2A 4Z02A 1VQOA 1VQ4A 5GAN8 1VQMT 4WI1A 3CCVA 4JRPA 4V2SA 4YRSA 2CZ6B 1EIYA 5D6WA 2DD4A 1Q7YC 1H4QA 2DJZA 2K3YA 2LT1A 2DEQA 3L2QA 1I8FA 4HWSA 4HCBA 1C0AA 1G5HA 5DY9A 1VQKA 3GOXA 4P75C 4C92E 4IKFA 3CC4A 1YB3A 3TUPA 1QVPA 1KQSS 2RHUA 4HVCA 2QEXA 2ZT8A 1JJCB 3HXYA 4WJ4A 3TREA 3WVDB 5LJ3e 3M4GA 1NJ8A 2NS6A 4J6WA 1P92A 4EMKC 4P74A 3X25B 1RL2A 4ZN1A 3HRTA 2PQWA 1EVLA 4M77C 3P8TA 3I55A 2QHTA 2CJBA 3HY1A 1MHNA 4BDZA 1N9WA 3ZEHA 1YHQA 1M4ZA 4YRJA 4BY6B 1M1FA 2KAFA 1YJ9A 1W4SA 1L0WA 4A4FA 3HTZA 2QXFA 3A8LB 4XTWA 5LJ3g 5GAMd 3CCST 4HT8A 2B8AA 4N4IA 1VQNT 4YRMA 5LJ3h 3JCMW 4XTVA 3QIIA 2K5IA 4EDUA 4M78C 4DA4A 1K73C 2E3CA 5GAMf 5GANe 3O8VA 4M7AE 1H3ZA 1KC8U 2Q5HA 1YI2T 3C95A 5J26A 1Q82U 4M7AA 4M7DC 3OD1A 4ZGDB 4IUVA 3LX7A 3CCMA 2AKWB 2DZ9A 1ZBXA 4P5NA 3OYNA 4C92B 4BE1A 1UGQB 4HWRA 1VQ7A 3GNGA 2JNGA 4YPFA 3A7UA 4LNSA 1X56A 2JUFA 1S72A 4H2YA 3VBBA 1EQRA 5GANg 3JSCA 1WGSA 3M58A 4FIBA 4QVZA 3EFRA 4KT0E 4XK8E 4X9DA 2QTXA 4E47A 1VQ5T 4C5HA 3AHUA 3NETA 5FRMA 1KG1A 5GANh 1N8RU 3PIPA 4TTVA 4RMOA 2HBPA 4FT2A 4M77D 4NOYA 3NELA 2ZPGB 3HFZA 3SWNC 3OB9A 4EO4A 1PSFA 2EKOA 1G5VA 4G85A 4D6WA 2J3MA 3OBWA 1Q7YU 1USYC 4LVIA 2R58A 4XU0A 3MF2A 1BI3A 4PJOC 1SSFA 1D3BB 2LQ8A 3M59A 4IURA 3GNFB 3EAEA 2P0PA 1V29B 3JB9D 1UEBA 1W2BA 2KDSA 3CC7T 4BI4A 4H2VA 5KCOA 4C0DC 3JCMe 3VV0A 4FSXA 2FVUA 2DXTA 3QZ9B 3PMIA 5GMKm 2C7IA 2C06A 5IAYA 4OF1A 4M7AB 4M78D 3M4PA 2IY5B 4BE2A 2DQ0A 1R8OB 4M7DD 2PVGB 3G1ZA 4YP0A 3URGA 3RMQA 1VQ4T 3BW1A 4LDYA 3CCVT 4A53A 4XEOA 4TQFA 4C8QF 3QPHA 3QZ5B 2AHJB 3OYJA 2HAXA 4N0AC 3JCMh 1YJWA 2P5IA 2XI9A 4CI0C 4JLIA 1VQZA 1H641 2FYKA 2QDYB 3RESA 4TQDA 2X4WA 3HPWA 3GLXA 1VQKT 4KR2A 1PYSA 3ZBDA 1KD1C 3CC4T 1NE8A 1KOGA 2DQ3A 3OBYA 3L2VA 4F7UF 2QEXT 4LDXA 5HK0A 3JCMV 1K73U 4QQGA 5F5WA 4RQFA 4L59A 3A8HB 3OSSC 3OYMA 2QQBA 5KE3A 3L2ZA 2XGTA 3PNWC 3LSSA 2E5AA 4YRQA 3I55T 5C6SA 2I4NA 2ZZGA 4YRGA 1M1GA 4PJOD 2HQXA 3JCMb 1YHQT 2GCXA 1YJ9T 3OQ5A 3A8GB 1JJ2S 5FU7B 4XTYA 1Y07A 2VGMA 3LH0A 4BY6C 4LD6A 1SESA 1IREB 3HY0A 2ZCFB 5I21A 2VUBA 1WJRA 3VQVA 4QVDA 2J3LA 5GANf 3ICAA 1YFRA 4CS4A 2A3LA 2CKKA 3HHTB 1ASYA 3OYBA 4R55A 5CR2A 2EAYA 3OYAA 3UDCA 5CKEA 5GAMe 1EIFA 1VQ6A 4L5GA 4A4EA 3G71A 4C5IA 4M77F 4DPGA 4YRPA 3DB4A 4ZTFA 1QVFS 3JAME 2JVVA 2OAUA 3UFGA 1M5Q1 4BWAA 2EQMA 5GMKh 1E1TA 4M75E 3PT9A 1VQ7T 4RCBA 4J6XA 4C92C 3VU3C 2ZPBB 2LRQA 2OTLT 3JB9F 3QUIA 4CH4A 3DLMA 1S72T 3TEGA 4K87A 3CXCS 4C0GA 5GAMg 2LNVA 3LWIA 1BI1A 2QQAA 3UPUA 4YRCA 4CH5A 5FRNA 4H02A 11ASA 4CRIA 1HXDA 2ZR2A 4PLIA 3RKWA 3CCUA 3HXZA 3QJ6A 3A7RA 5GAMh 5LL6S 4LVMA 3HXVA 4C8QC 4M78F 3OS5A 2LCCA 3R07A 3JCMQ 1EVKA 1BI2A 1WNLA 1OYXA 2D0QB 3VUBA 1YFTA 1Z7NA 4M7DF 2K57A 1VQ8A 2XIDA 5DLQE 3L2UA 4FT4A 5A0GA 2RHQB 1JBMA 2MAMA 3MCAB 3PTAA 4OGCA 3UH0A 2JN0A 4DOVA 2L8DA 1KD1U 3CCJA 4J83A 4B9WA 3A5YA 5CCAA 2ZTGA 3MEWA 1HC7A 1NJ5A 2ZXFA 3QO5A 5FLXE 3L2WA 1M90C 3A31A 3CBPA 2R57A 1YITA 3IKLA 2XDPA 4HCZA 1UB4A 2VV5A 1X75C 1N27A 3MF1A 2E64A 1KQ1A 2JZ2A 2XDDA 4QQDA 2V8IA 3NFCA 4M77G 5L8RE 1AHJB 4FU6A 4BI8B 3ME9A 4M75B 1O75A 2E41A 4KUDK 3MHXA 3S3MA 3S6WA 1G5IA 2BUDA 2KMTA 5C0MA 4O6JA 4JS5A 1N9SA 1LYLA 4PJOF 5GMKi 5E3IA 3RACA 4C92D 1YJWT 3J80E 4L87A 4NS5A 3A5ZA 3JB9G 2XHCA 3PCOA 3I7FA 4IUQA 1X2HA 3SDZA 1RI0A 1QP3A 2XICA 3C94A 3FC3A 1B34B 1QVGS 3OMCA 4FL6A 4K86A 4ZGJB 2CZ0B 4C8QD 2EJ9A 2RHZA 5GAN6 3NTIA 5CIUA 4M78G 4C5GA 1SERA 3P8DA 2RB6A 1B70A 2RHXA 1N9RA 4UP7A 4M7DG 2RJFA 2AMCB 3CEYA 3RMSA 1U1SA 3PFSA 1JRIA 2DU7A 2FL7A 4HT9A 2FHDA 4YRRA 4X34A 2EYQA 3E9GA 3MEVA 5LJ5j 1NJIC 5FU7C 2JOYA 1JJ2A 4XU3A 3M55A 2C8MA 3A74A 2MI6A 2E1HA 3L2RA 1EIYB 3QKJA 1NPPA 2BKDN 3ER0A 3V7RA 2PUOB 3EFSA 2ZT5A 5CQXA 3HRIA 3CCRA 4PKCC 2CZ7B 4R56A 2I4MA 3M4YA 1Y71A 2X4JA 3UGQA 4QQ6A 5GMKl 3MQZA 1VQ6T 3A5ZB 3G71T 4L6V5 1BIBA 2L5QA 3TCJA 3MO8A 4XTZA 3HXUA 3META 2OTLA 4BDYA 3JCMJ 3QTCA 4KQEA 4PJOG 5A0LA 2EQJA 3NENA 3QDRB 4OB2B 2KSSA 1XOVA 3DB3A 2MWPA 4JJNK 3TU4K 2DTIA 4PLLA 1QVFA 4JS4A 3G4SA 4P75A 4ZIBA 1BYMA 1WJSA 2DTHA 2LX9A 4N4HA 4P72C 5GAN5 1H4VB 1M90U 4ELZC 1ADYA 4E7HA 3QSUA 2F69A 3VUZA 2LC4A 3JB9I 3TEHA 3LYIA 4A4GA 1BIAA 5I2MA 3CXCA 2R5AA 3CCUT 1FYFA 1UGRB 3KXTA 2VGNA 3A8MB 3QBYA 2CS7A 2GFAA 3SB2A 3CPFA 2QHVA 4EX5A 4BUGA 4EMKA 3P8HA 1X01A 4FM4B 3Q1JA 4M77A 2EJGA 3NTHA 3CMET 3E9FA 2DK3A 4QVCA 1NZ9A 4YRLA 1VQ8T 2K4YA 3A32A 3M9QA 1WQWA 2K5FA 4JLGA 2KK4A 2RJDA 1IL2A 2HD0A 3QXEB 4KR3A 4C92F 3CCJT 4EMHA 2ZIMA 3RF1A 4II1A 2ARTA 3L4GA 2RHSA 4OVAA 4X9CA 2Q5IA 4BB7A 3VYGA 5GMKj 3HRKA 4OB0B 1KHIA 1YBYA 3X28B 4C0ZA 1YITT 2EFIA 2ZPIB 4YROA 4YTLA 2LTOA 4M78A 1SRYA 2K5LA 2K2VA 3CD6A 3KUFA 3DLLA 2RJEA 3QJYA 3P8BB 4M7DA 3JRZA 3I56T 2ZNIA 5C51B 1QE0A 3V7SA 4AH6A 4MZPA 3JCMc 1K9MC 4M75C 2CJ9A 1NJIU 3TEHB 3HFZB 2EJFA 2LDMA 4K88A 3LSQA 3HFVA 2WSFE 4A4KA 1QF6A 1M9SA 2QA4A 4YCWA 5ELOA 2PUKB 4EMKB 4PG3A 1KQSA 2QHUA 2Q7HA 1U8RA 5FU6B 2VXEA 1VIEA 3E9IA 5GAN2 3HFNA 4J7IA 2RK1A 2QQRA 2ZPFB 4TVWA 3BDUA 2I4LA 2VXFA 3GP8A 2LVMA 4ZTJA 2XG8D 1QVGA 1EFWA 4M7AF 2I2LA 2VYTA 4YRIA 3E9HA 3PIOA 2CYZB 3CPWS 3SWNA 2ZZEA 5GAN3 1Z7MA 2M0OA 5CAIA 2DXUA 3CMAA 2ZINA 3OYEA 4PJOE 5D6YA 1N6AA 3HKSA 1USYA 2G3RA 2HNIA 2DZCA 4PJOA 1ZHIA 3MP1A 4TVAA 2MWOA 2RHSB 2H3JA 1JB0E 3VJPA 2X4YA 3FJPA 2E10A 4C92G 5I2SA 4BE0A 2RM4A 4UP8A 3PMTA 4XQ3A 1B7YA 3NTKA 3BJUA 2DIQA 1VIFA 2X35A 1U1TA 5GAOp 2Q7EA 4CH6A 4J6YA 1WYDA 3MEUA 3CCRT 1QW1A 4A4HA 1IZ6A 4P3PA 2KY9A 3OYIA 3HSBA 4C8QG 1PYSB 3E19A 2ZPEB 1G3TA 2LQKA 2YRVA 4RDXA 1PSEA 4RG8A 3HRUA 2KQWA 3C12A 4M75D 3QG1A 4C5EA 2PMFA 5CVIA 3OYHA 1VQLA 4TWAA 2RI3A 1TH7A 4N0AA 2VC8A 2XTIA 2RI5A 1YJNA 4TVRA 3WQZA 5EG2A 4F7UG 3MP6A 3KFUA 3DKMA 3G4ST 1G51A 5LJ5d 1E22A 3VQYA 3NEMA 4UPAA 4P74C 3J7AF 3V8KA 1YCYA 3OW2S 2DTOA 2A8EA 3SWNB 3RKYA 4HWPA 1LOJA 5GAOm 3CMEA 4XAXB 4QW2A 5LJ3j 4ATOA 1X54A 3E1SA 5M9OA 4IUPA 1X6OA 4TVAB 2O01E 3JCMP 3HRSA 5LJ5f 4HKEA 1ATIA 2WACA 4JUVA 4OLFA 2RD1A 4KULA 4H2XA 3S3OA 3OYFA 4E7LA 3M54A 1K9MU 4ZTUB 1W66A 2BIVA 1Y7XA 2GQVA 1B7YB 2M9UA 4J8OA 4P71A 3OY9A 3UT1A 2XDBA 4BI3A 3HXXA 3G7ZA 1J5WA 3X24B 4XU1A 4J7FA 4EPCA 4CS2A 4MDWA 1M1KC 1FX7A 3F70A 3VKIA 4M7AC 3GIBA 4PL6A 2ZT7A 3V8JA 3T9NA 3I56A 4NL3A 4E7JA 3N5BB 2QHSA 3CD6T 5GANj 1ADJA 4RMFA 5GAOr 2L89A 4O5VA 2OTJT 3CMQA 3VYHB 5CO7A 3A8OB 4P73A 2F5KA 4XU2A 3PZCA 2ODRC 2Y4XA 2AKWA 3JB9H 3DSQA 4UP9A 4C92A 3UWNA 2YLCA 4RQEA 4KBMB 2E70A 1FXXA 1BKBA 2JTMA 3CCEA 1ASZA 3ASKA 2QA4T 1NJ6A 2Y90A 3OYKA 1YGBA 4MMKA 1HTTA 2P0QA 2ZPHB 3BFMA 1XNIA 3MP8A 3MEAA 1KMMA 4H2XB 3CCLA 1NJ2A 1UGSB 4CH3A 4J15A 3BY7A 2ZCEA 4LVLA 4P3NA 4C8QE 5FU6C 2E12A 4MZMA 3VQXA 4C8QA 1YIJA 4H2WA 4WJ3M 1K8AC 4HCCA 3QO3A 2RH2A 3CMAT 3LW5E 2MMPA 1NNHA 5C53B 3CPWA 4DOWA 1XQHA 4C0FA 4KUIA 2A7YA 4F7UE 4ZN3A 4M75F 4YRFA 3UGTA 1NYRA 3KBGA 4F7UA 3INZA 4BW9A 1D3BA 2R5MA 3CBOA 2PVOB 4LDVA 4HT4A 2M1HA 3LLRA 1UGPB 3L42A 2EQKA 1BBUA 4M7AD 2L3RA 4JRIA 3M57A 1VQ9A 4J5YA 4H2UA 4OGEA 3G6EA 3PGGA 4G84A 3WVEB 3OA6A 4P3OA 4Y28E 5GAOq 5CKHA 3V7CA 4LD9K 1FWZA 4ZGEB 3QNEA 4N4GA 3SD4A 4YRTA 3PCOB 1EOVA 5J3BA 2DXBA 3ZFJA 1KQ2A 1XTDA 3M4QA 2E5QA 2IY5A 3LGLA 3HL8A 2V8KA 3HP9A 3REXA 5IN1A 1GXIE 3H8ZA 5D6XA 3RL6A 2DIGA 2ODRD 2HQEA 3SFMA 3WXMB 4H2SA 1VQLT 3QO7A 3OYCA 2Q7GA 2QI2A 4LDWA 2O4XA 2KVQG 12ASA 4MZTA 2JTFA 1YJNT 4PHCA 1B70B 3IG2A 3ERRA 1M1KU 1I81A 1H4SA 1VUBA 4CS3A 4C8QB 3J81E 1I4K1 1G3WA 4M77E 1X55A 3OYDA 4TVYA 3OYYA 3OW2A 2ALYA 5AYFA 1LNXA 3OYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAI A;  2DXU A;  2PME A;  2ZIN A;  3HTZ A;  2P0L A;  1M8V A;  4PNO A;  2DKG A;  4PJO E;  4F7U B;  1USY A;  4XTW A;  5LJ5 e;  2RHQ B;  5LJ3 g;  4H2T A;  2HNI A;  1JBM A;  1B76 A;  2DZC A;  4PJO A;  3UH0 A;  5GAM d;  3IKM B;  4TVA A;  4HT8 A;  4E51 A;  3JCM X;  2RHS B;  3L1A A;  2JN0 A;  1NJ1 A;  2CIM A;  3A5Y A;  3V8L A;  2ZTG A;  4M75 G;  3RGL A;  3FJP A;  5GAO n;  1E1O A;  5GAN 7;  2FB7 A;  4YRM A;  2E10 A;  5LJ3 h;  4C92 G;  3JCM W;  1HC7 A;  4XTV A;  1NJ5 A;  2ZXF A;  3QO5 A;  4XEM A;  2RM4 A;  4JRK A;  4RCC A;  4UP8 A;  5K1P A;  4XQ3 A;  1B7Y A;  3A31 A;  3BJU A;  4M78 E;  3IKL A;  4M78 C;  4ZTZ B;  1U1T A;  2E3C A;  5GAO p;  5GAM f;  5LJ5 g;  2Q7E A;  5GAN e;  4M7A E;  4CH6 A;  4J6Y A;  3MF1 A;  2E64 A;  1WYD A;  2Q5H A;  4M7A A;  1KQ1 A;  4M7D E;  4M7D C;  3OD1 A;  2ARU A;  1Y96 A;  4P3P A;  3HSB A;  2AKW B;  2DZ9 A;  5LJ3 d;  4M77 G;  4C8Q G;  1PYS B;  3JCM g;  5LJ5 h;  2I4O A;  4M75 B;  1LJO A;  1SET A;  4C92 B;  2ZIO A;  2E41 A;  4YRE A;  2RA2 A;  4HWR A;  4RDX A;  5GAM j;  1G5I A;  4YPF A;  1N9S A;  1E24 A;  1LYL A;  3A7U A;  4M75 D;  2YHT A;  4PJO F;  5GMK i;  2PMF A;  4LNS A;  5E3I A;  1X56 A;  2ARS A;  3RAC A;  4TWA A;  4C92 D;  1TH7 A;  4L87 A;  4H2Y A;  4N0A A;  3VBB A;  2VC8 A;  2XTI A;  3A5Z A;  1EQR A;  1WQ7 A;  3JB9 G;  4HWT A;  5GAN g;  5KNN A;  3PCO A;  3I7F A;  3FB9 A;  3EFR A;  2ZZF A;  5K1X A;  3WQZ A;  5LJ3 f;  4F7U G;  1X2H A;  4X9D A;  3KFU A;  2QTX A;  1G51 A;  5LJ5 d;  1E22 A;  3VQY A;  3NEM A;  4UPA A;  4P74 C;  3AHU A;  3NET A;  4M77 B;  1NYQ A;  4YCV A;  1B34 B;  3V8K A;  5GAN h;  1YCY A;  1WU7 A;  2ALY B;  1BBW A;  2DTO A;  4P72 A;  5GAN 4;  3SWN B;  4YYE A;  3RKY A;  4TTV A;  4HWP A;  4K86 A;  2ZR3 A;  4M77 D;  4NOY A;  4O2D A;  1LOJ A;  4C8Q D;  3NEL A;  4Q15 A;  2EJ9 A;  5GAO m;  3HFZ A;  5GAN 6;  3W3S A;  4M78 G;  5LJ3 j;  3SWN C;  4EO4 A;  1X54 A;  1YFT A;  1SER A;  2RB6 A;  3MEY A;  4HA8 A;  4G85 A;  3P8Y A;  1B70 A;  4TVA B;  5ELN A;  3JCM P;  5LJ5 f;  1USY C;  1N9R A;  2J3M A;  4UP7 A;  4YRN A;  2EL9 A;  4XU0 A;  3MF2 A;  4M7D G;  2AMC B;  4X5O A;  4PJO C;  1ATI A;  1U1S A;  4JUV A;  4OLF A;  1D3B B;  2RD1 A;  4H2X A;  1JRI A;  1X2G A;  4YCU A;  1WPY A;  5GAN d;  3JB9 D;  2DU7 A;  3VQW A;  4Q6G A;  3L4G B;  4H2V A;  4ZTU B;  1W66 A;  4HT9 A;  4YRR A;  2ZT6 A;  5GAO l;  3JCM e;  1RIQ A;  1KMN A;  1B7Y B;  5LJ5 j;  2CGH A;  2DXT A;  3LC0 A;  4P71 C;  4XU3 A;  4M78 B;  4NCX A;  5GMK e;  5GMK m;  4P71 A;  2C7I A;  2C8M A;  3A74 A;  2DVE A;  3HXX A;  2E1H A;  4M7A B;  1J5W A;  1HK9 A;  2RHQ A;  1EIY B;  4CS2 A;  4XU1 A;  1Y96 B;  3V7R A;  4M78 D;  4M7D B;  2E65 A;  3EFS A;  4M7A C;  3M4P A;  2IY5 B;  2ZT5 A;  3RIR A;  2DQ0 A;  3GIB A;  1I5L A;  3HRI A;  2ZT7 A;  3V8J A;  4M7D D;  3G1Z A;  4YP0 A;  2I4M A;  4NL3 A;  4A54 A;  4Y91 A;  3UGQ A;  2QHS A;  2ZGW A;  5GMK l;  1GGM A;  5GAN j;  3RUX A;  3BW1 A;  1ADJ A;  1WLE A;  4A53 A;  4RMF A;  1BIB A;  4XEO A;  3RKX A;  4TQF A;  5GAO r;  4C8Q F;  4XTZ A;  3HXU A;  4N0A C;  3JCM h;  3JCM J;  4P73 C;  3CMQ A;  3QTC A;  4KQE A;  4PJO G;  2P5I A;  2YLB A;  4P73 A;  4JLI A;  4OP0 A;  1H64 1;  1VQZ A;  2FYK A;  3NEN A;  4XU2 A;  3PZC A;  3RES A;  4TQD A;  1MGQ A;  2ODR C;  2AKW A;  2DTI A;  4KR2 A;  3JB9 H;  1PYS A;  4M75 A;  3DSQ A;  4NL2 A;  5HGQ A;  1KOG A;  4P75 A;  2DQ3 A;  4ZIB A;  3REU A;  4UP9 A;  2ZNJ A;  4C92 A;  4XTU A;  4XTX A;  2YLC A;  4RQE A;  2DTH A;  4P72 C;  1B8A A;  5GAN 5;  4F7U F;  1H4V B;  5GAN 3;  1ASZ A;  1ADY A;  1NJ6 A;  2Y90 A;  4YRK A;  3QSU A;  1YGB A;  3JCM V;  1YFS A;  4MMK A;  3JCM d;  3QO8 A;  5F5W A;  3JB9 I;  1HTT A;  3TEH A;  4RQF A;  3JB9 J;  1BIA A;  4EMG A;  3BFM A;  1FYF A;  1KMM A;  4H2X B;  1NJ2 A;  4PJO B;  3L2Z A;  2DDZ A;  2XGT A;  4CH3 A;  4J15 A;  3SB2 A;  3LSS A;  4M7A G;  2E5A A;  1JJC A;  3BY7 A;  3RER A;  2QHV A;  4EX5 A;  4EMK A;  2ZCE A;  1X01 A;  4P3N A;  4C8Q E;  4YRQ A;  2I4N A;  2ZZG A;  3VQX A;  4YRG A;  4YDQ A;  4M77 A;  4C8Q A;  2EJG A;  4PJO D;  2CJA A;  1B34 A;  3JCM b;  4H2W A;  3HXW A;  4WJ3 M;  3QO3 A;  4QVC A;  3JCM f;  4YRL A;  4XTY A;  3A32 A;  3FIF A;  1WQW A;  1NNH A;  1SES A;  2EWN A;  5C53 B;  4MML A;  3HY0 A;  1IL2 A;  4F7U E;  4M75 F;  5I21 A;  4YRF A;  3UGT A;  2DU5 A;  4KR3 A;  3P8V A;  1NYR A;  2AMC A;  4C92 F;  4F7U A;  3INZ A;  4BW9 A;  1D3B A;  4EMH A;  3VQV A;  4QVD A;  2J3L A;  5GAN f;  3ICA A;  1YFR A;  2ZIM A;  3RF1 A;  3A7A A;  2ART A;  4CS4 A;  4DQ2 A;  3L4G A;  2G4C A;  1H4T A;  2RHS A;  3IAL A;  4X9C A;  1BBU A;  2Q5I A;  4HWO A;  5C52 B;  4M7A D;  3QHS A;  1ASY A;  3HFO A;  4JRI A;  5GMK j;  3HRK A;  4J5Y A;  4H2U A;  4WF2 A;  4YRO A;  2EAY A;  3PGG A;  4G84 A;  4P3O A;  4M78 A;  1SRY A;  5GAO q;  1Z7N A;  3V7C A;  5GAN 8;  5GAM e;  3QNE A;  4WI1 A;  4V2S A;  4M77 F;  4YRT A;  3PCO B;  4YRS A;  1EIY A;  1EOV A;  4DPG A;  4YRP A;  1KQ2 A;  3M4Q A;  4M7D A;  2ZNI A;  5C51 B;  1QE0 A;  1H4Q A;  2DJZ A;  3UFG A;  2IY5 A;  2DEQ A;  1M5Q 1;  4BWA A;  1I8F A;  3V7S A;  4HWS A;  4AH6 A;  1C0A A;  5GMK h;  1E1T A;  3JCM c;  1G5H A;  4M75 E;  3REX A;  4M75 C;  5DY9 A;  4RCB A;  4P75 C;  4J6X A;  4C92 E;  3RL6 A;  2ODR D;  4C92 C;  3VU3 C;  4H2S A;  2CJ9 A;  3JB9 F;  4CH4 A;  3QUI A;  3QO7 A;  2Q7G A;  1YB3 A;  3TUP A;  3TEH B;  3HFZ B;  3TEG A;  2EJF A;  4K88 A;  3LSQ A;  4K87 A;  3HFV A;  1QF6 A;  5GAM g;  4HVC A;  12AS A;  2ZT8 A;  4PHC A;  4YCW A;  5ELO A;  1B70 B;  1JJC B;  3IG2 A;  3ERR A;  4EMK B;  3HXY A;  4PG3 A;  4YRC A;  4CH5 A;  4WJ4 A;  4H02 A;  1I81 A;  11AS A;  5LJ3 e;  3M4G A;  1HXD A;  2Q7H A;  2QHU A;  1NJ8 A;  1H4S A;  2ZR2 A;  3RKW A;  4CS3 A;  4J6W A;  3HXZ A;  4C8Q B;  2VXE A;  3A7R A;  4EMK C;  3E9I A;  4P74 A;  5GAN 2;  1I4K 1;  5GAM h;  3HFN A;  4M77 E;  1EVL A;  1X55 A;  4M77 C;  3HXV A;  3P8T A;  4C8Q C;  4TVW A;  4M78 F;  2QHT A;  3BDU A;  2I4L A;  2VXF A;  2CJB A;  4TVY A;  3HY1 A;  1N9W A;  1EFW A;  3R07 A;  3JCM Q;  4M7A F;  4YRJ A;  2ALY A;  2I2L A;  1EVK A;  4YRI A;  3E9H A;  1WNL A;  1LNX A;  3SWN A;  2ZZE A;  1L0W A;  4M7D F;  2K57 A;  1Z7M A; 
#chains in the Genus database with same CATH topology
 3VS6 A;  2BTT A;  2PME A;  2XU8 A;  1X2Q A;  2P0L A;  2Y4Y A;  1M8V A;  4PNO A;  3S3N A;  2DKG A;  1VQP A;  1WHG A;  1Q81 C;  1ZUK A;  4F7U B;  5LJ5 e;  4H2T A;  3FDR A;  1FMV A;  1B76 A;  4LDU A;  2GFU A;  2NLU A;  3IKM B;  4E51 A;  3JCM X;  3L1A A;  1W2B P;  1NPR A;  2HQH A;  1NJ1 A;  1VQP Q;  2CIM A;  2EYW A;  2ABL A;  2AT1 B;  3V8L A;  4M75 G;  3RGL A;  5GAO n;  1E1O A;  5GAN 7;  2FB7 A;  1VA7 A;  3CCQ A;  2LT4 A;  3D7S B;  1B07 A;  2K3B A;  4XEM A;  4JRK A;  1WJQ A;  3CC2 A;  4RCC A;  5A0D A;  1JO8 A;  4AG2 C;  5K1P A;  1QP2 A;  4OB3 B;  4M78 E;  2EQU A;  3CCQ Q;  4ZTZ B;  5LJ5 g;  3OS1 A;  2CZ1 B;  2JTE A;  3CC2 Q;  2EVR A;  1XJW B;  1VQM A;  2DAQ A;  4Q5W A;  1VYT A;  1QCF A;  4M7D E;  4OMF B;  2COZ A;  2OTJ A;  2P4R A;  4UC4 A;  2ARU A;  1Y96 A;  1WHM A;  4J9C A;  5LJ3 d;  4OB1 B;  3JCM g;  5LJ5 h;  2I4O A;  1E6G A;  1LJO A;  1SET A;  1OEB A;  1VQM Q;  1Q86 C;  2ZIO A;  1BI0 A;  1K8A U;  1VQO T;  4YRE A;  2RA2 A;  5GAM j;  3FJ5 A;  2OTJ Q;  2RHY A;  2O4X B;  1E24 A;  1G3Y A;  5HY6 A;  2D6F A;  2YHT A;  4LVJ A;  1GFD A;  2AKK A;  2ESW A;  4E7K A;  2ARS A;  3RR6 A;  4LVK A;  2NUZ A;  1WQ7 A;  4HWT A;  2RJC A;  5KNN A;  3M56 A;  3FB9 A;  1IGU A;  4IUU A;  2ZZF A;  5K1X A;  2EIF A;  2H3E B;  5LJ3 f;  3ULR B;  5IH2 A;  4M77 B;  1NYQ A;  4YCV A;  4CC3 A;  1PC0 A;  3THK A;  4CC7 A;  1WU7 A;  4IUT A;  3CCE T;  1RAI B;  2ALY B;  1BBW A;  4P72 A;  5GAN 4;  4YYE A;  2F2X A;  3SEM A;  2NWM A;  5IT9 E;  4ELY C;  4KGZ B;  2ZR3 A;  4Q15 A;  4O2D A;  2RK2 A;  1WFW A;  1UJY A;  5HK3 A;  1NYG A;  3W3S A;  4GY5 A;  1KQS P;  3CCL T;  1OV3 A;  3MEY A;  4HA8 A;  3P8Y A;  2L3P A;  4JRQ A;  5D7U A;  5ELN A;  2P0K A;  2K3X A;  1AZG B;  2CP7 A;  3TEE A;  3QYG B;  2QQS A;  5CKF A;  4YRN A;  2EL9 A;  4X5O A;  1FMW A;  2FEI A;  3G1J A;  2WSC E;  1YIJ T;  2W10 A;  3A1P A;  1X2G A;  4YCU A;  1WPY A;  5GAN d;  3VQW A;  2V8J A;  2HKN A;  2D1X A;  3L4G B;  4Q6G A;  1AD5 A;  2M0Y A;  1J3T A;  1QVG P;  3CCS A;  3OS2 A;  4MDX A;  4D8K A;  1VQN A;  5AT1 B;  2ZT6 A;  2E3I A;  1H8K A;  1MMD A;  5GAO l;  2XK0 A;  1RIQ A;  2GTO A;  1KMN A;  2DPP B;  2PU9 B;  3M53 A;  3MJX A;  1UEC A;  3R6O A;  2P4T A;  2CGH A;  3OYL A;  1OZ3 A;  3CCS Q;  3FRN A;  3LC0 A;  4P71 C;  4M78 B;  1Y57 A;  2DXC A;  1KD1 R;  4NCX A;  5GMK e;  1VQN Q;  5FRO A;  4OMO A;  2RO0 A;  2DVE A;  3QYH B;  2XD0 A;  2MF2 A;  4JZ4 A;  1OI1 A;  1HK9 A;  2RHQ A;  3X20 B;  2RHI A;  1Y96 B;  3EG0 A;  1VYU A;  2LCL A;  1WI7 A;  4M7D B;  2PVD B;  2XKO C;  3LWH A;  3C4S A;  2E65 A;  3RIR A;  1YI2 A;  1I5L A;  2DET A;  1VQ9 T;  3I35 A;  1TU0 B;  3OS0 A;  5CQY A;  1SSH A;  4HXJ A;  3G6E T;  2DD5 A;  4A54 A;  2DO3 A;  4Y91 A;  1YI2 Q;  1I07 A;  2ZGW A;  4ME7 A;  1GGM A;  3RUX A;  1RLP C;  5KH6 A;  4BAC A;  2HMA A;  1WLE A;  1TTH B;  2F2W A;  3RKX A;  1Q81 U;  2EBP A;  2LQN A;  2WSE E;  3CCM T;  4E7I A;  2ZZD A;  4P73 C;  2JT4 A;  3NGP A;  5CKB A;  2YLB A;  1ABQ A;  4OP0 A;  2VWF A;  1PM3 A;  2CSQ A;  4DBF A;  1MGQ A;  4VUB A;  4E2F B;  1DJ7 B;  3FEO A;  1I5O B;  4M75 A;  4NL2 A;  1VQ5 A;  5HGQ A;  3REU A;  2ZNJ A;  2C0T A;  5CKD A;  4XTU A;  4ESR A;  4XTX A;  4Z89 A;  2M16 A;  1O9S A;  1B8A A;  3GF5 A;  5KE2 A;  2K9G A;  2QQ9 A;  1HD3 A;  1FMK A;  2RMO A;  4YRK A;  1TWB A;  1VQ5 Q;  1YFS A;  2MK5 A;  3JCM d;  3QO8 A;  4B9X A;  4JDS A;  3JB9 J;  2GGR A;  3BDL A;  4EMG A;  1AWJ A;  1NM7 A;  2EYY A;  1MMN A;  2IVW A;  3FLG A;  5KYW B;  4PJO B;  1QKX A;  3H0I A;  2IPO B;  2DDZ A;  2D9T A;  4RKU E;  3OSV A;  4M7A G;  1JJC A;  3RER A;  1W2B S;  2M51 A;  4RG2 A;  1KC8 C;  2ENM A;  1Q82 C;  3X26 B;  2OAW A;  2ROL A;  2AZV A;  3H6Z A;  2EYX A;  4ANJ A;  4YDQ A;  3CBM A;  5KCH A;  2CJA A;  1Q86 U;  1B34 A;  4LNP A;  5I11 A;  4C0D B;  5A2Q E;  2F5T X;  2KXC A;  3CC7 A;  1MUZ A;  2LJ3 A;  2FRY A;  3HXW A;  1G3S A;  1S1N A;  1KHC A;  3RNJ A;  3JCM f;  1OU8 A;  2E6N A;  3M5A A;  2RN8 A;  3FIF A;  1VQP T;  1QQJ A;  1GFC A;  2EPD A;  1CKA A;  2EWN A;  1UTI A;  3GPL A;  3LGF A;  4MML A;  3CC7 Q;  5J39 A;  4F16 A;  2X4X A;  4BD3 A;  2Z0W A;  2DU5 A;  2RI2 A;  1OZ2 A;  1IGQ A;  3P8V A;  2AMC A;  4GLK A;  5DLO A;  1ZQ1 A;  1U06 A;  1SKU B;  5HKC A;  3A7A A;  1X6B A;  3CCQ T;  1LCK A;  5DM7 R;  4DQ2 A;  2G4C A;  1SPK A;  1H4T A;  3IAL A;  5CK9 A;  4HWO A;  5C52 B;  3CC2 T;  3QHS A;  2IG0 A;  3GBQ A;  3HFO A;  4AMC A;  2E6Z A;  1N8R C;  4FYY B;  2LZ6 B;  3OMG A;  2GF7 A;  4WF2 A;  1CSK A;  4Z02 A;  1ACM B;  3LH5 A;  2K2M A;  1KJW A;  2DYI A;  2E3H A;  1VQO A;  2YRD A;  1VQ4 A;  5GAN 8;  1ZLM A;  1AWX A;  2DL3 A;  1VQM T;  4WI1 A;  3CCV A;  4JRP A;  4V2S A;  4YRS A;  2JJ9 A;  2JM8 A;  2CZ6 B;  1EIY A;  5D6W A;  2DD4 A;  1Q7Y C;  2CT4 A;  1G8X A;  1VQO Q;  4HCK A;  1VQ4 Q;  1H4Q A;  2DJZ A;  2K3Y A;  2LT1 A;  2DEQ A;  2FG0 A;  2CSI A;  3L2Q A;  3M0T A;  1WYX A;  1I8F A;  4HWS A;  3CCV Q;  4HCB A;  1AEY A;  1C0A A;  1G5H A;  1WA7 A;  5DY9 A;  1VQK A;  3GOX A;  4P75 C;  1EZZ B;  4C92 E;  4IKF A;  1AZE A;  1OX8 A;  3CC4 A;  2QTV A;  2J6K A;  1YB3 A;  3TUP A;  2G6F X;  2LP5 A;  1QVP A;  1KQS S;  3VRZ A;  1H92 A;  2RHU A;  1VQK Q;  1NG2 A;  2YT6 A;  4HVC A;  2QEX A;  2ZT8 A;  1NEG A;  1WIE A;  3CC4 Q;  1Z9Z A;  1JJC B;  3HXY A;  4WJ4 A;  2BZ8 A;  3TRE A;  3EGD A;  3WVD B;  5LJ3 e;  3M4G A;  1NJ8 A;  2NS6 A;  4J6W A;  1M90 R;  1P92 A;  4EMK C;  4P74 A;  2QEX Q;  2H8H A;  3X25 B;  1IB8 A;  1RL2 A;  4ZN1 A;  3HRT A;  1TOV A;  2W0Z A;  2PQW A;  1EVL A;  4M77 C;  3P8T A;  3MKD A;  3I55 A;  3VRY A;  2E4H A;  2QHT A;  1UFF A;  1OPL A;  1F1B B;  2CJB A;  3HY1 A;  1C6V X;  2AK5 A;  1MHN A;  4BDZ A;  2EKH A;  1N9W A;  3ZEH A;  1YHQ A;  1M4Z A;  1ABO A;  4YRJ A;  4BY6 B;  4FW2 A;  1M1F A;  2KAF A;  1YJ9 A;  1W4S A;  2JM9 A;  1L0W A;  1G2B A;  2KEA A;  2GTJ A;  3I55 Q;  2LJ0 A;  4A4F A;  3HTZ A;  2A0F B;  2QXF A;  4D8D A;  3A8L B;  4XTW A;  1YHQ Q;  5LJ3 g;  2DNU A;  1YJ9 Q;  4J9H A;  5GAM d;  3CCS T;  2V1R A;  4HT8 A;  1A0N B;  4PFO A;  1K1Z A;  4JZ3 A;  2B8A A;  4N4I A;  1VQN T;  1RAF B;  1UUE A;  2K6D A;  3M0U A;  3PVQ A;  4YRM A;  5LJ3 h;  3VS4 A;  3JCM W;  2RQU A;  4XTV A;  3CPW P;  3QII A;  2K5I A;  4AT1 B;  4EDU A;  4M78 C;  4DA4 A;  1K73 C;  2E3C A;  4F14 A;  5GAM f;  5GAN e;  3O8V A;  4M7A E;  1WHL A;  2VVK A;  1H3Z A;  1KC8 U;  2Q5H A;  1YI2 T;  3AT1 B;  3C95 A;  5J26 A;  1Q82 U;  4M7A A;  4M7D C;  3OD1 A;  4ZGD B;  4IUV A;  3LX7 A;  3CCM A;  2AKW B;  2DZ9 A;  3HTR A;  5I22 A;  1ZBX A;  3R6N A;  4P5N A;  1SHF A;  3OYN A;  1BK2 A;  4C92 B;  4IIO A;  2CT3 A;  4QT7 A;  4BE1 A;  1UGQ B;  4HWR A;  2LQW A;  3CCM Q;  1VQ7 A;  3GNG A;  3H41 A;  2JNG A;  4YPF A;  3A7U A;  4LNS A;  1X56 A;  1K76 A;  2JUF A;  3EGD B;  1S72 A;  4H2Y A;  3VBB A;  1EQR A;  5GAN g;  3JSC A;  1T0H A;  1WGS A;  1ZSZ B;  3M58 A;  4FIB A;  1VQ7 Q;  3RBB B;  4QVZ A;  1K9A A;  3EFR A;  3M0P A;  4KT0 E;  4XK8 E;  2K7A A;  1W1F A;  4X9D A;  1NJI R;  2QTX A;  4E47 A;  1VQ5 T;  1S72 Q;  1RAC B;  2DLP A;  4C5H A;  3AHU A;  3VS0 A;  3NET A;  5FRM A;  1KG1 A;  5GAN h;  1N8R U;  1WXT A;  3PIP A;  1NBE B;  4TTV A;  4RMO A;  2HBP A;  1W70 A;  2DVJ A;  3H0F A;  4FT2 A;  4M77 D;  4NOY A;  3NEL A;  2ZPG B;  3HFZ A;  2O2O A;  3SWN C;  3OB9 A;  4EO4 A;  2KT1 A;  1PSF A;  2EKO A;  4PK4 A;  1G5V A;  4G85 A;  3EH1 A;  4D6W A;  2J3M A;  2X3W D;  3OBW A;  1Q7Y U;  1USY C;  4LVI A;  1X27 A;  2R58 A;  1PRL C;  4XU0 A;  3MF2 A;  1BI3 A;  1KSW A;  3QWY A;  4PJO C;  1SSF A;  1D3B B;  2YUQ A;  2LQ8 A;  2K79 A;  3M59 A;  3GNF B;  3EAE A;  4IUR A;  2P0P A;  1V29 B;  3JB9 D;  1UEB A;  9ATC B;  1EFN A;  1W2B A;  2KDS A;  3CC7 T;  1NEB A;  2AIR B;  4BI4 A;  4H2V A;  3OW2 P;  5KCO A;  4LXC A;  1V1C A;  1SF9 A;  4C0D C;  3JCM e;  2L3S A;  3VV0 A;  6AT1 B;  4FSX A;  2FVU A;  2HKQ B;  2DM1 A;  2DXT A;  3QZ9 B;  4PJN A;  2YUO A;  3A98 A;  3PMI A;  2FO0 A;  5GMK m;  2LNH B;  2C7I A;  3PE0 A;  3QWX X;  2C06 A;  5IAY A;  4OF1 A;  4M7A B;  4PJL A;  3H0H A;  2CH4 W;  4KRT A;  1D09 B;  4M78 D;  2KNB B;  5IHK A;  1KIK A;  1RAD B;  3VS3 A;  1WXB A;  3M4P A;  2IY5 B;  1UHF A;  4BE2 A;  2CRE A;  2DQ0 A;  2NYS A;  2EGA A;  4HVW A;  3CQT A;  1R8O B;  3M0Q A;  4M7D D;  2PVG B;  2HSP A;  3G1Z A;  4YP0 A;  3URG A;  3RMQ A;  2EYZ A;  1VQ4 T;  4GBQ A;  2GQI A;  3BW1 A;  4LDY A;  2EW3 A;  1WDX A;  1WHJ A;  3CCV T;  4A53 A;  1RAE B;  2GBQ A;  1H3H A;  4XEO A;  1ZUU A;  4TQF A;  4C8Q F;  3QPH A;  3QZ5 B;  1IO6 A;  2CUB A;  2AHJ B;  3OYJ A;  5KYY A;  4N0A C;  3JCM h;  2HAX A;  1YJW A;  2CUD A;  2P5I A;  2XI9 A;  4F17 A;  4CI0 C;  4JLI A;  1VQZ A;  1H64 1;  2DBK A;  2FYK A;  2QDY B;  3RES A;  4TQD A;  2X4W A;  3HPW A;  2J6F A;  3GLX A;  1VQK T;  4KR2 A;  1PYS A;  3ZBD A;  1KD1 C;  3CC4 T;  1YJW Q;  1OPK A;  1NE8 A;  1KOG A;  2DQ3 A;  3OBY A;  3L2V A;  2OX7 A;  4R0K A;  2C0O A;  2HZY A;  4F7U F;  2DL8 A;  2QEX T;  1WXU A;  4LDX A;  5HK0 A;  1X2K A;  1PG5 B;  3JCM V;  2QG9 B;  4CC4 B;  1K73 U;  1RUW A;  4QQG A;  5F5W A;  2M02 A;  4RQF A;  2O31 A;  4ORZ A;  4L59 A;  2RQW A;  3A8H B;  3OSS C;  3OYM A;  2QQB A;  5KE3 A;  3L2Z A;  2XGT A;  3PNW C;  3LSS A;  2E5A A;  4FYX B;  2RPN A;  2MIO A;  3JV3 A;  2CP3 A;  4YRQ A;  1RAA B;  1RLQ C;  3I55 T;  5C6S A;  2I4N A;  2ZZG A;  4YRG A;  1M1G A;  4PJO D;  2HQX A;  2D8J A;  3JCM b;  1YHQ T;  4FSS A;  2GCX A;  1YJ9 T;  3OQ5 A;  3A8G B;  2LCS A;  1JJ2 S;  5FU7 B;  4XTY A;  1Y07 A;  2VGM A;  1GCQ A;  3LH0 A;  4BY6 C;  3UA6 A;  4LD6 A;  1SES A;  1YCS B;  1K9M R;  1IRE B;  2CP6 A;  3HY0 A;  2ZCF B;  5I21 A;  1MMA A;  3M0R A;  2VUB A;  1WJR A;  3VQV A;  4QVD A;  4OMQ A;  5GAN f;  2J3L A;  1YFR A;  3ICA A;  5ECA A;  2PZ1 A;  4CS4 A;  2A3L A;  2CKK A;  2ED0 A;  3HHT B;  1ASY A;  1X6G A;  3OYB A;  3TSW A;  4R55 A;  5CR2 A;  1PKS A;  2DE0 X;  1BB9 A;  2EAY A;  4RTZ A;  5KYY B;  3OYA A;  3UDC A;  4J9E A;  5CKE A;  5GAM e;  1EIF A;  1VQ6 A;  4L5G A;  4A4E A;  3G71 A;  1TG0 A;  4C5I A;  2DMO A;  4M77 F;  2IIM A;  2KRO A;  1K4U S;  4DPG A;  4YRP A;  3DB4 A;  4ZTF A;  1E6H A;  1QCO A;  2FPF A;  1E7O A;  2NUT A;  1QVF S;  5IHI A;  3JAM E;  2JVV A;  2OAU A;  3UFG A;  5FWC A;  1M5Q 1;  1VQ6 Q;  4BWA A;  3G71 Q;  2EQM A;  1T3S A;  5GMK h;  4PFP A;  1E1T A;  3VS5 A;  4M75 E;  3PT9 A;  2HL5 C;  1VQ7 T;  2DX1 A;  4RCB A;  4J6X A;  4C92 C;  3VU3 C;  2ZPB B;  2LRQ A;  2OTL T;  3JB9 F;  3QUI A;  4CH4 A;  3RDV A;  2DFU A;  3DLM A;  1S72 T;  3TEG A;  4K87 A;  3CXC S;  4C0G A;  1MV0 B;  5GAM g;  2LNV A;  2OJ2 A;  3LWI A;  1BI1 A;  2NUP A;  2HEQ A;  2QQA A;  2JMA A;  3UPU A;  4YRC A;  1AVZ C;  4CH5 A;  5FRN A;  4H02 A;  11AS A;  1GBQ A;  1ZSZ C;  3VS1 A;  3IQL A;  4CRI A;  1HXD A;  2ZR2 A;  4PLI A;  3RKW A;  1D0Y A;  3CCU A;  3HXZ A;  1FYN A;  4LUE A;  1B7T A;  3QJ6 A;  3A7R A;  2QAS A;  2X9H A;  5GAM h;  1UHC A;  5LL6 S;  1GCP A;  4LVM A;  3HXV A;  4C8Q C;  4M78 F;  2RF0 A;  3OS5 A;  2LCC A;  3CCU Q;  2ECZ A;  3R07 A;  3JCM Q;  1BCM A;  2QGF B;  1EVK A;  1BI2 A;  1WNL A;  1OYX A;  1WHH A;  1R0C B;  2D0Q B;  3VUB A;  4M7D F;  2K57 A;  1YFT A;  1Z7N A;  2KE9 A;  1UGV A;  4IIM A;  4FYV B;  1VQ8 A;  1PCX A;  2XID A;  1ZUY A;  1ZA1 B;  5DLQ E;  4LN2 A;  3L2U A;  4FT4 A;  5A0G A;  2RHQ B;  1JBM A;  2MAM A;  2X3X D;  3MCA B;  4OGC A;  1BCO A;  3PTA A;  3UH0 A;  1VQ8 Q;  2JN0 A;  4K11 A;  4DOV A;  2L8D A;  1KD1 U;  3CCJ A;  4J83 A;  4B9W A;  3A5Y A;  5CCA A;  2ZTG A;  3MEW A;  2YSQ A;  1HC7 A;  2RQV A;  2PNI A;  1NJ5 A;  2ZXF A;  3QO5 A;  2JS2 A;  4KH1 B;  1M3B A;  1JXO A;  5FLX E;  3CCJ Q;  3L2W A;  1JXM A;  1M90 C;  1PNJ A;  1YFN A;  3A31 A;  3CBP A;  2R57 A;  1YIT A;  3IKL A;  1V76 A;  2XDP A;  4HCZ A;  5IXB A;  2KRN A;  1UB4 A;  1M8M A;  2VV5 A;  2NUT B;  1X75 C;  1N27 A;  3MF1 A;  2E64 A;  1OQK A;  4FW1 A;  2L0A A;  1D1A A;  1KQ1 A;  2JZ2 A;  1YIT Q;  2XDD A;  4QQD A;  2V8I A;  3NFC A;  4LUD A;  2DIL A;  3I5R A;  4M77 G;  5L8R E;  1AHJ B;  3EG1 A;  4FU6 A;  4BI8 B;  3ME9 A;  4M75 B;  1O75 A;  5GJV B;  2E41 A;  4KUD K;  3MHX A;  3S3M A;  3S6W A;  1R77 A;  1G5I A;  2BUD A;  2KMT A;  5C0M A;  4KGV B;  4O6J A;  4JS5 A;  1N9S A;  1LYL A;  4PJO F;  5GMK i;  3EG2 A;  5E3I A;  4X1V A;  3RAC A;  4C92 D;  2RNA A;  1YJW T;  3J80 E;  4L87 A;  4NS5 A;  1T3L A;  3A5Z A;  3JB9 G;  2XHC A;  2FPD A;  1CKB A;  1YWO A;  3PCO A;  2ROT A;  3I7F A;  4IUQ A;  1X2H A;  3SDZ A;  1RI0 A;  1QP3 A;  4JJC A;  1UG1 A;  2XIC A;  3C94 A;  3FC3 A;  2C0I A;  1B34 B;  2DBM A;  1QVG S;  1R0B G;  1AWW A;  3OMC A;  1M1K R;  3EFO A;  4FL6 A;  1UE9 A;  4K86 A;  4ZGJ B;  2CZ0 B;  4C8Q D;  2EJ9 A;  2P84 A;  2RHZ A;  5GAN 6;  3NTI A;  5CIU A;  4M78 G;  4C5G A;  2CH4 A;  1QCN A;  1SER A;  3P8D A;  1M3C A;  2RB6 A;  4PFZ A;  3UF4 A;  1B70 A;  2B86 A;  1LPL A;  2RHX A;  1N9R A;  1RAB B;  4UP7 A;  2J05 A;  4M7D G;  2RJF A;  2AMC B;  3CEY A;  2DEU A;  3RMS A;  1U1S A;  2ED1 A;  4PJJ A;  3PFS A;  1JRI A;  1NLP C;  2QK0 A;  2DU7 A;  4JJB A;  2FL7 A;  3NMZ C;  2LX7 A;  1Y0M A;  4HT9 A;  2FHD A;  2DA9 A;  4DBR A;  4YRR A;  2XMF A;  4X34 A;  2EYQ A;  3E9G A;  3MEV A;  1YP5 A;  1ZX6 A;  5LJ5 j;  3ZL7 C;  3UA7 A;  1NJI C;  5FU7 C;  2JOY A;  1JJ2 A;  4XU3 A;  4LE9 A;  3M55 A;  2KRM A;  4FCY A;  1WHK A;  2C8M A;  3A74 A;  2MI6 A;  2E1H A;  3L2R A;  1EIY B;  1D0Z A;  3QKJ A;  1M2V A;  1NPP A;  2DRM A;  2QDL A;  4HVV A;  2BKD N;  3ER0 A;  3V7R A;  2PUO B;  3EFS A;  2ZT5 A;  5CQX A;  1X43 A;  1PD0 A;  2CP0 A;  3HRI A;  3CCR A;  2O88 A;  4PKC C;  2CZ7 B;  4R56 A;  2I4M A;  1PKT A;  1Y71 A;  3M4Y A;  1TUD A;  1TUG B;  2X4J A;  3UGQ A;  4QQ6 A;  2I0N A;  2JXB A;  5GMK l;  3CCR Q;  3MQZ A;  1VQ6 T;  3A5Z B;  3G71 T;  4L6V 5;  1BIB A;  2L5Q A;  3TCJ A;  1UJ0 A;  3MO8 A;  4XTZ A;  4EIK A;  3HXU A;  2X51 A;  3MET A;  1T0J A;  2OTL A;  4BDY A;  3JCM J;  1K8A R;  3QTC A;  4KQE A;  4PJO G;  3TQ7 P;  5A0L A;  2MYS A;  2EQJ A;  4J9G A;  3NEN A;  2KYB A;  2ZAE A;  3QDR B;  4OB2 B;  2KSS A;  1OUL A;  1XOV A;  3DB3 A;  1SEM A;  2MWP A;  1UDL A;  4JJN K;  1WLP B;  3TU4 K;  2DTI A;  4PLL A;  2OTL Q;  1EX4 A;  1QVF A;  4JS4 A;  3G4S A;  3EHR A;  1OU9 A;  4P75 A;  4ZIB A;  1BYM A;  2DL4 A;  1WJS A;  2DTH A;  2LX9 A;  4N4H A;  4P72 C;  5GAN 5;  1H4V B;  4OMP A;  1M90 U;  1WX6 A;  4AFZ C;  4ELZ C;  1ADY A;  4E7H A;  3G4S Q;  3QSU A;  2DL7 A;  2F69 A;  2LC4 A;  3VUZ A;  3JB9 I;  3TEH A;  3LYI A;  4A4G A;  3MPU B;  1BIA A;  5I2M A;  3CXC A;  2R5A A;  3CCU T;  1FYF A;  1UGR B;  3KXT A;  2VGN A;  1PWT A;  3A8M B;  3QBY A;  1MV3 A;  2CS7 A;  2GFA A;  4B6M A;  3SB2 A;  8ATC B;  3CPF A;  2QHV A;  4EX5 A;  4BUG A;  4EMK A;  3P8H A;  3PVL A;  1X01 A;  4Z88 A;  4FM4 B;  1HJD A;  2VKN A;  3Q1J A;  4M77 A;  1ZA2 B;  2EJG A;  3NTH A;  4RUG A;  5IHN A;  3CME T;  3E9F A;  2DK3 A;  2A37 A;  2MPX C;  2O9S A;  2ATC B;  4QVC A;  1NZ9 A;  1QWE A;  4YRL A;  1VQ8 T;  2K4Y A;  3A32 A;  2DRK A;  3M9Q A;  1WQW A;  2K5F A;  4JLG A;  1M2V B;  2KK4 A;  2RJD A;  1IL2 A;  2HD0 A;  4RTY A;  4GLM A;  4HVU A;  3QXE B;  4KR3 A;  4C92 F;  3CCJ T;  1GBR A;  4EMH A;  2ZIM A;  3RF1 A;  1IXD A;  4II1 A;  2ART A;  3L4G A;  2RHS A;  4OVA A;  4X9C A;  2Q5I A;  3KFV A;  4BB7 A;  3VYG A;  5GMK j;  1IHV A;  1N5Z A;  5FWB A;  3HRK A;  4OB0 B;  1KHI A;  2SEM A;  1YBY A;  3X28 B;  4C0Z A;  1YIT T;  8AT1 B;  2EFI A;  2A36 A;  2ZPI B;  3TSZ A;  4YRO A;  4YTL A;  5KYX A;  2LTO A;  4M78 A;  1SRY A;  1TSF A;  2K5L A;  2K2V A;  3CD6 A;  3KUF A;  3DLL A;  2RJE A;  2KI7 A;  3QJY A;  3P8B B;  2COY A;  2FRW A;  4M7D A;  3JRZ A;  3I56 T;  2ZNI A;  5C51 B;  1QE0 A;  1RI9 A;  1QLY A;  3CD6 Q;  4E7Z A;  2E5K A;  3V7S A;  1Q81 R;  4AH6 A;  4MZP A;  3JCM c;  1K9M C;  4M75 C;  3QDF A;  2D8H A;  2CJ9 A;  1NJI U;  3TEH B;  2VB6 A;  3HFZ B;  4DBH A;  2EJF A;  2LDM A;  4K88 A;  4DBQ A;  3LSQ A;  3HFV A;  2WSF E;  4A4K A;  1QF6 A;  2D0N A;  1M9S A;  3REA B;  2QA4 A;  4YCW A;  5ELO A;  2J6O A;  1C1A A;  2EGE A;  2PUK B;  4EMK B;  4PG3 A;  1KQS A;  2QHU A;  2Q7H A;  1U8R A;  1RAH B;  2MCN A;  4AG1 C;  5FU6 B;  3I9Q A;  2VXE A;  1VIE A;  3E9I A;  5GAN 2;  2QA4 Q;  3HFN A;  4J7I A;  2RK1 A;  1RAG B;  2QQR A;  2ZPF B;  4TVW A;  3BDU A;  2DER A;  2I4L A;  2VXF A;  3GP8 A;  2LVM A;  1G83 A;  4E6R A;  4ZTJ A;  2XG8 D;  1QVG A;  1EFW A;  2YRC A;  4M7A F;  2I2L A;  2VYT A;  4YRI A;  3E9H A;  3BE3 A;  3PIO A;  1MNE A;  2CYZ B;  3CPW S;  3SWN A;  2ZZE A;  3O5Z A;  5GAN 3;  1Z7M A;  2M0O A;  5CAI A;  2DXU A;  3CMA A;  2ZIN A;  3OYE A;  1Q86 R;  4PJO E;  3EGU A;  5D6Y A;  1N6A A;  3HKS A;  4Y92 A;  1USY A;  5KYW A;  2G3R A;  2HNI A;  2DZC A;  4PJO A;  1ZHI A;  3MP1 A;  2YDL A;  4TVA A;  2MWO A;  2RHS B;  3CMA Q;  1K0S A;  2H3J A;  1JB0 E;  1M30 A;  3VJP A;  2X4Y A;  2PTK A;  4AFS C;  2DJQ A;  1SG5 A;  3FJP A;  5KYU A;  4J9I A;  2E10 A;  4C92 G;  2YUN A;  5I2S A;  1K0X A;  4BE0 A;  4OML A;  5KYX B;  2RM4 A;  1AOJ A;  4UP8 A;  5KYN A;  2L3Q A;  1TXQ A;  3PMT A;  4XQ3 A;  1B7Y A;  3NTK A;  3BJU A;  2DIQ A;  2FZC B;  1VIF A;  2X35 A;  1U1T A;  5GAO p;  2Q7E A;  4CH6 A;  4Z8A A;  4J6Y A;  4WCI A;  2V26 A;  1WYD A;  3MEU A;  3CCR T;  1Q95 G;  1QW1 A;  4A4H A;  1ARK A;  1IZ6 A;  4P3P A;  2KY9 A;  3OYI A;  2O9V A;  3HSB A;  4C8Q G;  1PYS B;  3E19 A;  1IRX A;  1U3O A;  2ZPE B;  1G3T A;  2BZX A;  2CP5 A;  2LQK A;  2YRV A;  4RDX A;  1HYO A;  1D1B A;  1PSE A;  2KGT A;  3HRU A;  4RG8 A;  2KQW A;  3C12 A;  2F1L A;  3QG1 A;  4M75 D;  4C5E A;  2PMF A;  5HCK A;  1QWF A;  3EG3 A;  5CVI A;  1JEG A;  3OYH A;  1VQL A;  4TWA A;  2RI3 A;  1TH7 A;  1IHW A;  1X69 A;  4N0A A;  1ZSG A;  2VC8 A;  2XTI A;  2RI5 A;  2A28 A;  2EGC A;  1YJN A;  4TVR A;  3WQZ A;  5EG2 A;  4F7U G;  3MP6 A;  1VQL Q;  3KFU A;  3DKM A;  2AKL A;  3G4S T;  1G51 A;  3UAT A;  5LJ5 d;  1WZO A;  1E22 A;  3VQY A;  3NEM A;  4UPA A;  4P74 C;  1GRI A;  2HDA A;  3J7A F;  2MOX A;  4OMM A;  3V8K A;  1YCY A;  2CP2 A;  1YJN Q;  3OW2 S;  1JQQ A;  2DTO A;  3TVT A;  3SWN B;  2A8E A;  3RKY A;  4HWP A;  1PHT A;  1LOJ A;  2DYB A;  7AT1 B;  5GAO m;  3CME A;  4XAX B;  4QW2 A;  5LJ3 j;  2GNC A;  2FZK B;  4ATO A;  1X54 A;  3E1S A;  5M9O A;  4IUP A;  1X6O A;  1VYV A;  2JW4 A;  2KYM A;  4TVA B;  2O01 E;  3JCM P;  3HRS A;  5LJ5 f;  5IXF A;  1BU1 A;  4HKE A;  3CME Q;  3EGX A;  1ATI A;  2HSE B;  4JUV A;  2WAC A;  4OLF A;  2RD1 A;  4KUL A;  4H2X A;  5KYU B;  3S3O A;  2BZY A;  5EC7 A;  3OYF A;  3EG9 A;  4E7L A;  3M54 A;  1K9M U;  5GJW B;  4ZTU B;  1W66 A;  4RTT A;  5FW9 A;  2BIV A;  1Y7X A;  2GQV A;  1M3A A;  1B7Y B;  1YN8 A;  2COW A;  2M9U A;  2FPE A;  1B3Q A;  2QAZ A;  1ZBJ A;  2HL3 A;  4J8O A;  4P71 A;  1I0C A;  3OY9 A;  3UT1 A;  3NPF A;  4BI3 A;  2XDB A;  1YNZ A;  3HXX A;  3G7Z A;  1J5W A;  3NHN A;  4J9B A;  3X24 B;  4XU1 A;  4J7F A;  4EPC A;  4CS2 A;  4MDW A;  3EH2 A;  1M1K C;  2KBT A;  3C0C A;  1FX7 A;  3F70 A;  3VKI A;  4M7A C;  3GIB A;  3U23 A;  1TS9 A;  4PL6 A;  2ZT7 A;  3V8J A;  1PD1 A;  4AFQ C;  1NYF A;  1C0M A;  4AFU C;  3T9N A;  4ZNX A;  2JS0 A;  4KH0 B;  3I56 A;  2J7I A;  4NL3 A;  1KC8 R;  1Q82 R;  4E7J A;  3N5B B;  2SRC A;  2QHS A;  3CD6 T;  2A08 A;  5GAN j;  1ADJ A;  1AWO A;  2DF6 A;  4RMF A;  1VOM A;  5GAO r;  2KXD A;  2L89 A;  4O5V A;  3I56 Q;  2OTJ T;  2NUP B;  4RTW A;  3CMQ A;  3VYH B;  5CO7 A;  3A8O B;  2VAS A;  4P73 A;  3E2U A;  2F5K A;  1OX9 A;  4XU2 A;  3PZC A;  2ODR C;  2Y4X A;  2AKW A;  3JB9 H;  2BE9 B;  3DSQ A;  4RTV A;  4UP9 A;  4C92 A;  1LVK A;  3UWN A;  2YLC A;  4RQE A;  4KBM B;  2E70 A;  1FXX A;  1BKB A;  2JTM A;  3CCE A;  1SHG A;  1ASZ A;  3ASK A;  4PJM A;  2QA4 T;  1NJ6 A;  2Y90 A;  4DEX A;  3OYK A;  1YGB A;  4MMK A;  1HTT A;  2P0Q A;  1TUC A;  2ZPH B;  1MMG A;  2FZG B;  3BFM A;  1XNI A;  2DL5 A;  3MP8 A;  3EGX B;  3MEA A;  3CCE Q;  1ZSZ A;  1N8R R;  1KMM A;  4H2X B;  3VS7 A;  3CCL A;  1NJ2 A;  1I1J A;  1UGS B;  4CH3 A;  3EG9 B;  4J15 A;  3BY7 A;  1D0X A;  2ZCE A;  4LVL A;  4P3N A;  4C8Q E;  5FU6 C;  3REB B;  2E12 A;  2YUP A;  4MZM A;  4A63 B;  3VQX A;  4C8Q A;  4E7S A;  1YIJ A;  3CCL Q;  4H2W A;  2JMC A;  4J9D A;  2RQR A;  2KT8 A;  1Q7Y R;  4WJ3 M;  1KK7 A;  1K8A C;  4HCC A;  3QO3 A;  2RH2 A;  3CMA T;  4KGX B;  3LW5 E;  2MMP A;  2HCK A;  2LMJ A;  1JU5 C;  2J06 A;  1YIJ Q;  1NNH A;  5C53 B;  3CPW A;  4DOW A;  2KR3 A;  1XQH A;  2QYZ A;  4C0F A;  4KUI A;  2A7Y A;  1BBZ A;  2AZS A;  4FYW B;  4F7U E;  1HSQ A;  4ZN3 A;  4M75 F;  4YRF A;  3UGT A;  1GL5 A;  1NYR A;  3KBG A;  4F7U A;  1U5S A;  3INZ A;  4BW9 A;  1D3B A;  2R5M A;  3CBO A;  4DEY A;  2PVO B;  4LDV A;  4HT4 A;  4RTU A;  2M1H A;  3LLR A;  1UGP B;  3L42 A;  1M27 C;  2EQK A;  1BBU A;  1KFZ A;  4M7A D;  5L23 A;  2L3R A;  4JRI A;  3M57 A;  3VS2 A;  4J9F A;  1JJ2 P;  1VQ9 A;  4J5Y A;  4H2U A;  1SRL A;  2KRS A;  4JJD A;  4OGE A;  3EHQ A;  1NLO C;  3PGG A;  3G6E A;  4G84 A;  4M4Z A;  3WVE B;  3OA6 A;  4P3O A;  4WTO B;  2L2P A;  4Y28 E;  5GAO q;  4F04 B;  4JPB W;  5CKH A;  3V7C A;  4LD9 K;  1FWZ A;  4ZGE B;  3QNE A;  4N4G A;  1VQ9 Q;  3SD4 A;  4YRT A;  3PCO B;  1OOT A;  1EOV A;  5J3B A;  2DXB A;  3ZFJ A;  1KQ2 A;  2F2V A;  2HBW A;  1XTD A;  2EQI A;  3G6E Q;  3M4Q A;  1AT1 B;  2E5Q A;  3M0S A;  2IY5 A;  1PRM C;  3LGL A;  3HL8 A;  2V8K A;  4RTX A;  3HP9 A;  3REX A;  2RQT A;  5IN1 A;  1D1C A;  1GXI E;  3H8Z A;  5D6X A;  3RL6 A;  2DIG A;  2ODR D;  2HQE A;  3EFO B;  3I5S A;  3SFM A;  3WXM B;  4H2S A;  1VQL T;  3QO7 A;  3OYC A;  2Q7G A;  3SHW A;  4CC2 A;  2BE7 D;  2QI2 A;  2QGG A;  4LDW A;  2O4X A;  2KVQ G;  12AS A;  4QKU A;  4MZT A;  2JTF A;  1YJN T;  4PHC A;  2YWW A;  1B70 B;  2CDT A;  2OI3 A;  3ERR A;  3IG2 A;  1M1K U;  1I81 A;  1H4S A;  1W6X A;  1VUB A;  1QVF P;  1QMC A;  4CS3 A;  1Z9Q A;  4C8Q B;  1QKW A;  3J81 E;  2V1Q A;  2LJ1 A;  1I4K 1;  4OMN A;  1G3W A;  1K73 R;  4M77 E;  1X55 A;  3OYD A;  1M2O A;  1YWP A;  4TVY A;  1SRM A;  3OYY A;  2YXY A;  3OW2 A;  2ALY A;  1MND A;  5AYF A;  3CXC P;  3H9N A;  1LNX A;  3OYG A;  1GCQ C; 
#chains in the Genus database with same CATH homology
 2PME A;  2XU8 A;  2P0L A;  2Y4Y A;  1M8V A;  4PNO A;  3S3N A;  2DKG A;  1VQP A;  1Q81 C;  4F7U B;  5LJ5 e;  4H2T A;  3FDR A;  1B76 A;  4LDU A;  2GFU A;  2NLU A;  3IKM B;  4E51 A;  3JCM X;  3L1A A;  1NPR A;  1NJ1 A;  2CIM A;  3V8L A;  4M75 G;  3RGL A;  5GAO n;  1E1O A;  5GAN 7;  2FB7 A;  3CCQ A;  2LT4 A;  4XEM A;  4JRK A;  1WJQ A;  3CC2 A;  4RCC A;  5A0D A;  5K1P A;  1QP2 A;  4OB3 B;  4M78 E;  2EQU A;  4ZTZ B;  5LJ5 g;  3OS1 A;  2CZ1 B;  1VQM A;  2DAQ A;  4Q5W A;  4M7D E;  4OMF B;  2OTJ A;  4UC4 A;  2ARU A;  1Y96 A;  5LJ3 d;  4OB1 B;  3JCM g;  5LJ5 h;  2I4O A;  1LJO A;  1SET A;  1Q86 C;  2ZIO A;  1BI0 A;  1K8A U;  1VQO T;  4YRE A;  2RA2 A;  5GAM j;  2RHY A;  2O4X B;  1E24 A;  1G3Y A;  5HY6 A;  2D6F A;  2YHT A;  4LVJ A;  4E7K A;  2ARS A;  4LVK A;  1WQ7 A;  4HWT A;  2RJC A;  5KNN A;  3M56 A;  3FB9 A;  4IUU A;  2ZZF A;  5K1X A;  2EIF A;  5LJ3 f;  4M77 B;  1NYQ A;  4YCV A;  1WU7 A;  4IUT A;  3CCE T;  2ALY B;  1BBW A;  4P72 A;  5GAN 4;  4YYE A;  5IT9 E;  2ZR3 A;  4ELY C;  4Q15 A;  4O2D A;  2RK2 A;  5HK3 A;  3W3S A;  4GY5 A;  3CCL T;  3MEY A;  4HA8 A;  3P8Y A;  4JRQ A;  5ELN A;  2P0K A;  2K3X A;  3TEE A;  3QYG B;  2QQS A;  5CKF A;  4YRN A;  2EL9 A;  4X5O A;  2WSC E;  1YIJ T;  1X2G A;  4YCU A;  1WPY A;  5GAN d;  3VQW A;  2V8J A;  4Q6G A;  3L4G B;  3CCS A;  3OS2 A;  4MDX A;  1VQN A;  2ZT6 A;  5GAO l;  2XK0 A;  1RIQ A;  1KMN A;  2DPP B;  2PU9 B;  3M53 A;  3R6O A;  2P4T A;  2CGH A;  3OYL A;  1OZ3 A;  3FRN A;  3LC0 A;  4P71 C;  4M78 B;  2DXC A;  4NCX A;  5GMK e;  5FRO A;  2RO0 A;  2DVE A;  3QYH B;  2XD0 A;  2MF2 A;  1OI1 A;  1HK9 A;  2RHQ A;  3X20 B;  2RHI A;  1Y96 B;  2LCL A;  4M7D B;  2PVD B;  2XKO C;  3LWH A;  3C4S A;  2E65 A;  3RIR A;  1YI2 A;  1I5L A;  1VQ9 T;  3OS0 A;  5CQY A;  3G6E T;  2DD5 A;  4A54 A;  2DO3 A;  4Y91 A;  2ZGW A;  4ME7 A;  1GGM A;  3RUX A;  5KH6 A;  4BAC A;  1WLE A;  3RKX A;  1Q81 U;  2WSE E;  3CCM T;  4E7I A;  2ZZD A;  4P73 C;  5CKB A;  2YLB A;  4OP0 A;  1MGQ A;  4VUB A;  1DJ7 B;  3FEO A;  4M75 A;  4NL2 A;  1VQ5 A;  5HGQ A;  3REU A;  2ZNJ A;  5CKD A;  4XTU A;  4XTX A;  2M16 A;  1O9S A;  1B8A A;  3GF5 A;  5KE2 A;  2QQ9 A;  4YRK A;  1YFS A;  3JCM d;  3QO8 A;  4B9X A;  4JDS A;  3JB9 J;  3BDL A;  4EMG A;  2IVW A;  3FLG A;  4PJO B;  2DDZ A;  2D9T A;  4RKU E;  3OSV A;  4M7A G;  1JJC A;  3RER A;  1W2B S;  4RG2 A;  1KC8 C;  1Q82 C;  3X26 B;  3H6Z A;  4YDQ A;  3CBM A;  5KCH A;  2CJA A;  1Q86 U;  1B34 A;  5A2Q E;  4C0D B;  2F5T X;  3CC7 A;  3HXW A;  1G3S A;  1KHC A;  3JCM f;  2E6N A;  3M5A A;  3FIF A;  1VQP T;  2EWN A;  3GPL A;  3LGF A;  4MML A;  5J39 A;  2X4X A;  4BD3 A;  2DU5 A;  2RI2 A;  1OZ2 A;  3P8V A;  2AMC A;  4GLK A;  5DLO A;  1ZQ1 A;  5HKC A;  3A7A A;  3CCQ T;  5DM7 R;  4DQ2 A;  2G4C A;  1H4T A;  3IAL A;  5CK9 A;  4HWO A;  5C52 B;  3CC2 T;  3QHS A;  2IG0 A;  3HFO A;  2E6Z A;  1N8R C;  3OMG A;  2GF7 A;  4WF2 A;  4Z02 A;  1VQO A;  1VQ4 A;  5GAN 8;  1VQM T;  4WI1 A;  3CCV A;  4JRP A;  4V2S A;  4YRS A;  2CZ6 B;  1EIY A;  5D6W A;  2DD4 A;  1Q7Y C;  1H4Q A;  2DJZ A;  2K3Y A;  2LT1 A;  2DEQ A;  3L2Q A;  1I8F A;  4HWS A;  4HCB A;  1C0A A;  1G5H A;  5DY9 A;  1VQK A;  3GOX A;  4P75 C;  4C92 E;  4IKF A;  3CC4 A;  1YB3 A;  3TUP A;  1QVP A;  1KQS S;  2RHU A;  4HVC A;  2QEX A;  2ZT8 A;  1JJC B;  3HXY A;  4WJ4 A;  3TRE A;  3WVD B;  5LJ3 e;  3M4G A;  1NJ8 A;  2NS6 A;  4J6W A;  1P92 A;  4EMK C;  4P74 A;  3X25 B;  1RL2 A;  4ZN1 A;  3HRT A;  2PQW A;  1EVL A;  4M77 C;  3P8T A;  3I55 A;  2QHT A;  2CJB A;  3HY1 A;  1MHN A;  4BDZ A;  1N9W A;  3ZEH A;  1YHQ A;  1M4Z A;  4YRJ A;  4BY6 B;  1M1F A;  2KAF A;  1YJ9 A;  1W4S A;  1L0W A;  4A4F A;  3HTZ A;  2QXF A;  3A8L B;  4XTW A;  5LJ3 g;  5GAM d;  3CCS T;  4HT8 A;  2B8A A;  4N4I A;  1VQN T;  4YRM A;  5LJ3 h;  3JCM W;  4XTV A;  3QII A;  2K5I A;  4EDU A;  4M78 C;  4DA4 A;  1K73 C;  2E3C A;  5GAM f;  5GAN e;  3O8V A;  4M7A E;  1H3Z A;  1KC8 U;  2Q5H A;  1YI2 T;  3C95 A;  5J26 A;  1Q82 U;  4M7A A;  4M7D C;  3OD1 A;  4ZGD B;  4IUV A;  3LX7 A;  3CCM A;  2AKW B;  2DZ9 A;  1ZBX A;  4P5N A;  3OYN A;  4C92 B;  4BE1 A;  1UGQ B;  4HWR A;  1VQ7 A;  3GNG A;  2JNG A;  4YPF A;  3A7U A;  4LNS A;  1X56 A;  2JUF A;  1S72 A;  4H2Y A;  3VBB A;  1EQR A;  5GAN g;  3JSC A;  1WGS A;  3M58 A;  4FIB A;  4QVZ A;  3EFR A;  4KT0 E;  4XK8 E;  4X9D A;  2QTX A;  4E47 A;  1VQ5 T;  4C5H A;  3AHU A;  3NET A;  5FRM A;  1KG1 A;  5GAN h;  1N8R U;  3PIP A;  4TTV A;  4RMO A;  2HBP A;  4FT2 A;  4M77 D;  4NOY A;  3NEL A;  2ZPG B;  3HFZ A;  3SWN C;  3OB9 A;  4EO4 A;  1PSF A;  2EKO A;  1G5V A;  4G85 A;  4D6W A;  2J3M A;  3OBW A;  1Q7Y U;  1USY C;  4LVI A;  2R58 A;  4XU0 A;  3MF2 A;  1BI3 A;  4PJO C;  1SSF A;  1D3B B;  2LQ8 A;  3M59 A;  4IUR A;  3GNF B;  3EAE A;  2P0P A;  1V29 B;  3JB9 D;  1UEB A;  1W2B A;  2KDS A;  3CC7 T;  4BI4 A;  4H2V A;  5KCO A;  4C0D C;  3JCM e;  3VV0 A;  4FSX A;  2FVU A;  2DXT A;  3QZ9 B;  3PMI A;  5GMK m;  2C7I A;  2C06 A;  5IAY A;  4OF1 A;  4M7A B;  4M78 D;  3M4P A;  2IY5 B;  4BE2 A;  2DQ0 A;  1R8O B;  4M7D D;  2PVG B;  3G1Z A;  4YP0 A;  3URG A;  3RMQ A;  1VQ4 T;  3BW1 A;  4LDY A;  3CCV T;  4A53 A;  4XEO A;  4TQF A;  4C8Q F;  3QPH A;  3QZ5 B;  2AHJ B;  3OYJ A;  2HAX A;  4N0A C;  3JCM h;  1YJW A;  2P5I A;  2XI9 A;  4CI0 C;  4JLI A;  1VQZ A;  1H64 1;  2FYK A;  2QDY B;  3RES A;  4TQD A;  2X4W A;  3HPW A;  3GLX A;  1VQK T;  4KR2 A;  1PYS A;  3ZBD A;  1KD1 C;  3CC4 T;  1NE8 A;  1KOG A;  2DQ3 A;  3OBY A;  3L2V A;  4F7U F;  2QEX T;  4LDX A;  5HK0 A;  3JCM V;  1K73 U;  4QQG A;  5F5W A;  4RQF A;  4L59 A;  3A8H B;  3OSS C;  3OYM A;  2QQB A;  5KE3 A;  3L2Z A;  2XGT A;  3PNW C;  3LSS A;  2E5A A;  4YRQ A;  3I55 T;  5C6S A;  2I4N A;  2ZZG A;  4YRG A;  1M1G A;  4PJO D;  2HQX A;  3JCM b;  1YHQ T;  2GCX A;  1YJ9 T;  3OQ5 A;  3A8G B;  1JJ2 S;  5FU7 B;  4XTY A;  1Y07 A;  2VGM A;  3LH0 A;  4BY6 C;  4LD6 A;  1SES A;  1IRE B;  3HY0 A;  2ZCF B;  5I21 A;  2VUB A;  1WJR A;  3VQV A;  4QVD A;  2J3L A;  5GAN f;  3ICA A;  1YFR A;  4CS4 A;  2A3L A;  2CKK A;  3HHT B;  1ASY A;  3OYB A;  4R55 A;  5CR2 A;  2EAY A;  3OYA A;  3UDC A;  5CKE A;  5GAM e;  1EIF A;  1VQ6 A;  4L5G A;  4A4E A;  3G71 A;  4C5I A;  4M77 F;  4DPG A;  4YRP A;  3DB4 A;  4ZTF A;  1QVF S;  3JAM E;  2JVV A;  2OAU A;  3UFG A;  1M5Q 1;  4BWA A;  2EQM A;  5GMK h;  1E1T A;  4M75 E;  3PT9 A;  1VQ7 T;  4RCB A;  4J6X A;  4C92 C;  3VU3 C;  2ZPB B;  2LRQ A;  2OTL T;  3JB9 F;  3QUI A;  4CH4 A;  3DLM A;  1S72 T;  3TEG A;  4K87 A;  3CXC S;  4C0G A;  5GAM g;  2LNV A;  3LWI A;  1BI1 A;  2QQA A;  3UPU A;  4YRC A;  4CH5 A;  5FRN A;  4H02 A;  11AS A;  4CRI A;  1HXD A;  2ZR2 A;  4PLI A;  3RKW A;  3CCU A;  3HXZ A;  3QJ6 A;  3A7R A;  5GAM h;  5LL6 S;  4LVM A;  3HXV A;  4C8Q C;  4M78 F;  3OS5 A;  2LCC A;  3R07 A;  3JCM Q;  1EVK A;  1BI2 A;  1WNL A;  1OYX A;  2D0Q B;  3VUB A;  1YFT A;  1Z7N A;  4M7D F;  2K57 A;  1VQ8 A;  2XID A;  5DLQ E;  3L2U A;  4FT4 A;  5A0G A;  2RHQ B;  1JBM A;  2MAM A;  3MCA B;  3PTA A;  4OGC A;  3UH0 A;  2JN0 A;  4DOV A;  2L8D A;  1KD1 U;  3CCJ A;  4J83 A;  4B9W A;  3A5Y A;  5CCA A;  2ZTG A;  3MEW A;  1HC7 A;  1NJ5 A;  2ZXF A;  3QO5 A;  5FLX E;  3L2W A;  1M90 C;  3A31 A;  3CBP A;  2R57 A;  1YIT A;  3IKL A;  2XDP A;  4HCZ A;  1UB4 A;  2VV5 A;  1X75 C;  1N27 A;  3MF1 A;  2E64 A;  1KQ1 A;  2JZ2 A;  2XDD A;  4QQD A;  2V8I A;  3NFC A;  4M77 G;  5L8R E;  1AHJ B;  4FU6 A;  4BI8 B;  3ME9 A;  4M75 B;  1O75 A;  2E41 A;  4KUD K;  3MHX A;  3S3M A;  3S6W A;  1G5I A;  2BUD A;  2KMT A;  5C0M A;  4O6J A;  4JS5 A;  1N9S A;  1LYL A;  4PJO F;  5GMK i;  5E3I A;  3RAC A;  4C92 D;  1YJW T;  3J80 E;  4L87 A;  4NS5 A;  3A5Z A;  3JB9 G;  2XHC A;  3PCO A;  3I7F A;  4IUQ A;  1X2H A;  3SDZ A;  1RI0 A;  1QP3 A;  2XIC A;  3C94 A;  3FC3 A;  1B34 B;  1QVG S;  3OMC A;  4FL6 A;  4K86 A;  4ZGJ B;  2CZ0 B;  4C8Q D;  2EJ9 A;  2RHZ A;  5GAN 6;  3NTI A;  5CIU A;  4M78 G;  4C5G A;  1SER A;  3P8D A;  2RB6 A;  1B70 A;  2RHX A;  1N9R A;  4UP7 A;  4M7D G;  2RJF A;  2AMC B;  3CEY A;  3RMS A;  1U1S A;  3PFS A;  1JRI A;  2DU7 A;  2FL7 A;  4HT9 A;  2FHD A;  4YRR A;  4X34 A;  2EYQ A;  3E9G A;  3MEV A;  5LJ5 j;  1NJI C;  5FU7 C;  2JOY A;  1JJ2 A;  4XU3 A;  3M55 A;  2C8M A;  3A74 A;  2MI6 A;  2E1H A;  3L2R A;  1EIY B;  3QKJ A;  1NPP A;  2BKD N;  3ER0 A;  3V7R A;  2PUO B;  3EFS A;  2ZT5 A;  5CQX A;  3HRI A;  3CCR A;  4PKC C;  2CZ7 B;  4R56 A;  2I4M A;  3M4Y A;  1Y71 A;  2X4J A;  3UGQ A;  4QQ6 A;  5GMK l;  3MQZ A;  1VQ6 T;  3A5Z B;  3G71 T;  4L6V 5;  1BIB A;  2L5Q A;  3TCJ A;  3MO8 A;  4XTZ A;  3HXU A;  3MET A;  2OTL A;  4BDY A;  3JCM J;  3QTC A;  4KQE A;  4PJO G;  5A0L A;  2EQJ A;  3NEN A;  3QDR B;  4OB2 B;  2KSS A;  1XOV A;  3DB3 A;  2MWP A;  4JJN K;  3TU4 K;  2DTI A;  4PLL A;  1QVF A;  4JS4 A;  3G4S A;  4P75 A;  4ZIB A;  1BYM A;  1WJS A;  2DTH A;  2LX9 A;  4N4H A;  4P72 C;  5GAN 5;  1H4V B;  1M90 U;  4ELZ C;  1ADY A;  4E7H A;  3QSU A;  2F69 A;  3VUZ A;  2LC4 A;  3JB9 I;  3TEH A;  3LYI A;  4A4G A;  1BIA A;  5I2M A;  3CXC A;  2R5A A;  3CCU T;  1FYF A;  1UGR B;  3KXT A;  2VGN A;  3A8M B;  3QBY A;  2CS7 A;  2GFA A;  3SB2 A;  3CPF A;  2QHV A;  4EX5 A;  4BUG A;  4EMK A;  3P8H A;  1X01 A;  4FM4 B;  3Q1J A;  4M77 A;  2EJG A;  3NTH A;  3CME T;  3E9F A;  2DK3 A;  4QVC A;  1NZ9 A;  4YRL A;  1VQ8 T;  2K4Y A;  3A32 A;  3M9Q A;  1WQW A;  2K5F A;  4JLG A;  2KK4 A;  2RJD A;  1IL2 A;  2HD0 A;  3QXE B;  4KR3 A;  4C92 F;  3CCJ T;  4EMH A;  2ZIM A;  3RF1 A;  4II1 A;  2ART A;  3L4G A;  2RHS A;  4OVA A;  4X9C A;  2Q5I A;  4BB7 A;  3VYG A;  5GMK j;  3HRK A;  4OB0 B;  1KHI A;  1YBY A;  3X28 B;  4C0Z A;  1YIT T;  2EFI A;  2ZPI B;  4YRO A;  4YTL A;  2LTO A;  4M78 A;  1SRY A;  2K5L A;  2K2V A;  3CD6 A;  3KUF A;  3DLL A;  2RJE A;  3QJY A;  3P8B B;  4M7D A;  3JRZ A;  3I56 T;  2ZNI A;  5C51 B;  1QE0 A;  3V7S A;  4AH6 A;  4MZP A;  3JCM c;  1K9M C;  4M75 C;  2CJ9 A;  1NJI U;  3TEH B;  3HFZ B;  2EJF A;  2LDM A;  4K88 A;  3LSQ A;  3HFV A;  2WSF E;  4A4K A;  1QF6 A;  1M9S A;  2QA4 A;  4YCW A;  5ELO A;  2PUK B;  4EMK B;  4PG3 A;  1KQS A;  2QHU A;  2Q7H A;  1U8R A;  5FU6 B;  2VXE A;  1VIE A;  3E9I A;  5GAN 2;  3HFN A;  4J7I A;  2RK1 A;  2QQR A;  2ZPF B;  4TVW A;  3BDU A;  2I4L A;  2VXF A;  3GP8 A;  2LVM A;  4ZTJ A;  2XG8 D;  1QVG A;  1EFW A;  4M7A F;  2I2L A;  2VYT A;  4YRI A;  3E9H A;  3PIO A;  2CYZ B;  3CPW S;  3SWN A;  2ZZE A;  5GAN 3;  1Z7M A;  2M0O A;  5CAI A;  2DXU A;  3CMA A;  2ZIN A;  3OYE A;  4PJO E;  5D6Y A;  1N6A A;  3HKS A;  1USY A;  2G3R A;  2HNI A;  2DZC A;  4PJO A;  1ZHI A;  3MP1 A;  4TVA A;  2MWO A;  2RHS B;  2H3J A;  1JB0 E;  3VJP A;  2X4Y A;  3FJP A;  2E10 A;  4C92 G;  5I2S A;  4BE0 A;  2RM4 A;  4UP8 A;  3PMT A;  4XQ3 A;  1B7Y A;  3NTK A;  3BJU A;  2DIQ A;  1VIF A;  2X35 A;  1U1T A;  5GAO p;  2Q7E A;  4CH6 A;  4J6Y A;  1WYD A;  3MEU A;  3CCR T;  1QW1 A;  4A4H A;  1IZ6 A;  4P3P A;  2KY9 A;  3OYI A;  3HSB A;  4C8Q G;  1PYS B;  3E19 A;  2ZPE B;  1G3T A;  2LQK A;  2YRV A;  4RDX A;  1PSE A;  4RG8 A;  3HRU A;  2KQW A;  3C12 A;  4M75 D;  3QG1 A;  4C5E A;  2PMF A;  5CVI A;  3OYH A;  1VQL A;  4TWA A;  2RI3 A;  1TH7 A;  4N0A A;  2VC8 A;  2XTI A;  2RI5 A;  1YJN A;  4TVR A;  3WQZ A;  5EG2 A;  4F7U G;  3MP6 A;  3KFU A;  3DKM A;  3G4S T;  1G51 A;  5LJ5 d;  1E22 A;  3VQY A;  3NEM A;  4UPA A;  4P74 C;  3J7A F;  3V8K A;  1YCY A;  3OW2 S;  2DTO A;  2A8E A;  3SWN B;  3RKY A;  4HWP A;  1LOJ A;  5GAO m;  3CME A;  4XAX B;  4QW2 A;  5LJ3 j;  4ATO A;  1X54 A;  3E1S A;  5M9O A;  4IUP A;  1X6O A;  4TVA B;  2O01 E;  3JCM P;  3HRS A;  5LJ5 f;  4HKE A;  1ATI A;  2WAC A;  4JUV A;  4OLF A;  2RD1 A;  4KUL A;  4H2X A;  3S3O A;  3OYF A;  4E7L A;  3M54 A;  1K9M U;  4ZTU B;  1W66 A;  2BIV A;  1Y7X A;  2GQV A;  1B7Y B;  2M9U A;  4J8O A;  4P71 A;  3OY9 A;  3UT1 A;  2XDB A;  4BI3 A;  3HXX A;  3G7Z A;  1J5W A;  3X24 B;  4XU1 A;  4J7F A;  4EPC A;  4CS2 A;  4MDW A;  1M1K C;  1FX7 A;  3F70 A;  3VKI A;  4M7A C;  3GIB A;  4PL6 A;  2ZT7 A;  3V8J A;  3T9N A;  3I56 A;  4NL3 A;  4E7J A;  3N5B B;  2QHS A;  3CD6 T;  5GAN j;  1ADJ A;  4RMF A;  5GAO r;  2L89 A;  4O5V A;  2OTJ T;  3CMQ A;  3VYH B;  5CO7 A;  3A8O B;  4P73 A;  2F5K A;  4XU2 A;  3PZC A;  2ODR C;  2Y4X A;  2AKW A;  3JB9 H;  3DSQ A;  4UP9 A;  4C92 A;  3UWN A;  2YLC A;  4RQE A;  4KBM B;  2E70 A;  1FXX A;  1BKB A;  2JTM A;  3CCE A;  1ASZ A;  3ASK A;  2QA4 T;  1NJ6 A;  2Y90 A;  3OYK A;  1YGB A;  4MMK A;  1HTT A;  2P0Q A;  2ZPH B;  3BFM A;  1XNI A;  3MP8 A;  3MEA A;  1KMM A;  4H2X B;  3CCL A;  1NJ2 A;  1UGS B;  4CH3 A;  4J15 A;  3BY7 A;  2ZCE A;  4LVL A;  4P3N A;  4C8Q E;  5FU6 C;  2E12 A;  4MZM A;  3VQX A;  4C8Q A;  1YIJ A;  4H2W A;  4WJ3 M;  1K8A C;  4HCC A;  3QO3 A;  2RH2 A;  3CMA T;  3LW5 E;  2MMP A;  1NNH A;  5C53 B;  3CPW A;  4DOW A;  1XQH A;  4C0F A;  4KUI A;  2A7Y A;  4F7U E;  4ZN3 A;  4M75 F;  4YRF A;  3UGT A;  1NYR A;  3KBG A;  4F7U A;  3INZ A;  4BW9 A;  1D3B A;  2R5M A;  3CBO A;  2PVO B;  4LDV A;  4HT4 A;  2M1H A;  3LLR A;  1UGP B;  3L42 A;  2EQK A;  1BBU A;  4M7A D;  2L3R A;  4JRI A;  3M57 A;  1VQ9 A;  4J5Y A;  4H2U A;  4OGE A;  3G6E A;  3PGG A;  4G84 A;  3WVE B;  3OA6 A;  4P3O A;  4Y28 E;  5GAO q;  5CKH A;  3V7C A;  4LD9 K;  1FWZ A;  4ZGE B;  3QNE A;  4N4G A;  3SD4 A;  4YRT A;  3PCO B;  1EOV A;  5J3B A;  2DXB A;  3ZFJ A;  1KQ2 A;  1XTD A;  3M4Q A;  2E5Q A;  2IY5 A;  3LGL A;  3HL8 A;  2V8K A;  3HP9 A;  3REX A;  5IN1 A;  1GXI E;  3H8Z A;  5D6X A;  3RL6 A;  2DIG A;  2ODR D;  2HQE A;  3SFM A;  3WXM B;  4H2S A;  1VQL T;  3QO7 A;  3OYC A;  2Q7G A;  2QI2 A;  4LDW A;  2O4X A;  2KVQ G;  12AS A;  4MZT A;  2JTF A;  1YJN T;  4PHC A;  1B70 B;  3IG2 A;  3ERR A;  1M1K U;  1I81 A;  1H4S A;  1VUB A;  4CS3 A;  4C8Q B;  3J81 E;  1I4K 1;  1G3W A;  4M77 E;  1X55 A;  3OYD A;  4TVY A;  3OYY A;  3OW2 A;  2ALY A;  5AYF A;  1LNX A;  3OYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...