4HA8A

Structure of staphylococcus aureus biotin protein ligase in complex with biotin acetylene
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Staphylococcus aureus biotin protein ligase in complex with biotin acetylene
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 100
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ha8A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ha8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ha8A02
3LSTA 4XRFA 3KCCA 1XD7A 3GWZA 2OAZA 5H6RA 1P92A 1I27A 2GXBA 1FLIA 4YCWA 4Y91A 1Z05A 3T1BA 2MA3A 4YIIA 5C52B 2QUFA 1J0RA 2CWEA 3EETA 5GAN8 2M87A 4RB3C 1WNLA 4HF0A 2L02A 3HUGA 2W84A 1PUEE 2OZ6A 1RI7A 1ODDA 1YIOA 2VT2A 3RTRA 2OQGA 4R1HA 5EEGA 3ZN1A 5E1ZB 3WTWC 2DO7A 1USYA 1BM9A 3V7SA 1K78B 2MLGA 4A5MA 1AOYA 2GXGA 1SFEA 2H09A 1MDMB 4LK1F 4J6WA 3RI4A 3W3SA 4AIHA 5D5VB 3CUQC 2BGCA 4A0XA 2DW4A 3F8CA 2BV6A 1USTA 4U0WA 1O57A 2KJCA 5LJ5g 2EV0A 2A6EF 2QLZA 4HX4A 4M9ZA 5HDNA 3TUPA 4PJOA 5LGUA 4TQFA 5DY9A 3M8FA 2FRHA 3B02A 2ODRD 5LJ3h 2CSOA 3F6OA 1Z91A 5K5RA 2RN7A 4EV0A 3MF1A 2ALYB 1E17A 4TVAB 1RNLA 4X9DA 4CYDA 3WE3A 2DI3A 4Y13A 3HFZA 5HGQA 2FMYA 4EM0B 2LDUA 1NYQA 1KQ8A 3AAFA 5BQTA 2VBYA 3QPHA 4C92E 2HDCA 4YRNA 2JSCA 4OMYA 4H2YA 2HWVA 3FMRA 4YYEA 3E9IA 3EQLF 4NOYA 1ASZA 5HS9A 3N4MA 2F5EA 1Z6RA 1KMMA 4UXNA 4XTZA 3I71A 3P8TA 1SFUA 2I4MA 4P73A 3IRQA 2X0LA 4HDUA 2XTIA 4F7UE 1QGPA 2ZT8A 2FSWA 5J8CA 3I0TA 2DXTA 5F1RA 1OPCA 2G4CA 3EYYA 1OMIA 1G3TA 3TEHA 2ISYA 1LNXA 2CJ9A 4UP8A 3RKWA 1YW9A 1LVAA 3HRIA 3LA3A 2UWMA 4HBLA 1IW7F 2A3SA 2GWRA 3M9AA 1G5IA 3BJ6A 4C92D 1H0MA 4C8QA 4OINF 2STWA 3F21A 4QWQA 5DCMA 2P6TA 1B34B 1OYWA 3EFRA 3GF2A 4U7DA 1K7AA 5LJ3j 4IHSA 3FM3A 3V4GA 4U88A 1S29A 4RQFA 3GLXA 3IKLA 4KA4A 1MDMA 4M7DB 5LLQA 4Y17A 2P4WA 1L0OC 2Y0MA 5CVJA 1YGBA 2XGTA 1X01A 2RHQA 4O6JA 5FFXA 3ISPA 3DKWA 1XDUA 3ECOA 2DQLA 4L0ZB 3DFGA 1SFXA 3CO6C 2M5WA 2VXZA 3IKVA 1Z7UA 4ESBA 5LJ3e 1U6GA 5DUIA 1Z6TA 4ZH4F 2YX7A 1MGQA 4H2XB 4L5IA 5LJ5f 3R60A 1OYIA 2DK8A 2IJLA 4Z2YA 2ZCEA 4YCUA 3RPUA 1IXRC 2J5PA 1G3YA 1B59A 1T0FA 3E6CC 1R23A 4G85A 2MH9A 3CJNA 4HAMA 1V3FA 3RGLA 3PFIA 2D2WA 2YLBA 4L18B 4M75C 3M1EA 1P2FA 2ZNIA 2L54A 3KP2A 3HFVA 2KJBA 3RIRA 4Q15A 1S8NA 3F8MA 3HRTA 2ZINA 3QPTA 1M5Q1 4M7DE 2I4NA 5EEHA 1D3BA 3ABTA 5JFRA 4XEOA 2PMUA 1EV7A 3HSEA 3BPVA 3R4KA 5E8IA 3EYIA 2XIGA 4LB5A 4XTWA 1LDDA 4KFCA 1P4XA 3LAJA 5FLXZ 2A69F 1FX7A 4I02A 2P5VA 2FBIA 4A0ZA 1T38A 4J6XA 3T0YA 1Z1DA 1KQ1A 3ZPLA 3ERRA 2ARSA 1BC8C 3ABUA 1QBJA 2HGCA 5L3EA 5ELOA 3FMSA 2VBZA 1EH8A 5K5OA 4F7UB 4YRMA 4A6DA 3REXA 3WG9A 3QHSA 2O8XA 1EQRA 1QO0D 3M7GA 2GA1A 3BJUA 2GZWA 1W66A 4HWOA 3RUXA 4H02A 1BI1A 2JT1A 4KNYA 1IXSB 1O3QA 2XAJA 1KOGA 1IN6A 2VE9A 1H4SA 4D0PA 3L4GA 1WKMA 5GAN4 3RPQA 2FEZA 4WCGA 4NQWA 3RL6A 3HHHA 3ZMVA 4LFUA 3HRMA 4LGWA 1WYDA 1J59A 2ZXFA 2NYXA 4BYYA 3WTSC 4RMFA 4A54A 4EMHA 5IT9Z 1W5SA 1D8KA 2P5IA 1XGNA 2E7WA 5LEKA 5E18F 5HOOA 4R8HA 3JSOA 4N0AC 2W85A 4M7AA 2D1HA 2E1HA 1LDKB 2R7FA 2L01A 1B34A 2NNYA 2K7LA 3ROUA 2ELHA 3COAC 2QQAA 3REUA 4XU1A 4H0EA 2KIMA 4KN4X 5FLXK 4OLFA 4J15A 2Q2EA 3W6JB 3P8VA 2P7CB 2RD1A 2PQ8A 3BFMA 2GIVA 3CUQA 3VFZA 4XLNF 3IL2A 2CIMA 1WQ2A 5LGNA 3GYHX 4NHJA 2ACJA 3JCMW 4LNSA 2TDXA 5GAMf 1USYC 5K5QA 5GAMj 2VC0A 2IPQX 5AIPA 2FMLA 3BDUA 1B70A 2CYYA 2FE3A 2EFQA 2EV5A 2VT3A 2EFOA 3HSBA 2YPRA 4IPAA 3TKYA 2JRTA 2ARTA 1C0WA 1CF7A 4NB5A 1RUOA 4MGRA 2AKWA 5BPIA 3KZZA 3DEUA 4I0BA 4ZZDA 4M75E 1I1SA 3GFLA 3RJPA 5TRDA 1B76A 4HOBA 1E1OA 1PYSA 3K1NA 3BOQA 2QWWA 2HOEA 4RB2C 4PCQA 3QP6A 3GFIA 2HR3A 2OZUA 4IRGA 4H2UA 4XSZF 4YRQA 1UHMA 2XAGA 1B4AA 1FYMA 4WJ4A 2DLLA 3HTUA 3LAPA 3L7WA 3IWZA 1GXPA 3WTTC 4XTYA 1E22A 2E65A 3KP5A 2L4AA 1AWCA 1NNHA 4YFKF 3GFMA 3JCMQ 4IRHA 4PGGA 5DYMA 1YQAA 4LLNA 2P5LC 5IT9K 1EIYA 3LQQA 3JCMJ 2F5CA 3EUHA 2YHTA 3HFZB 2RC4A 1SETA 1ATIA 3BJAA 2G7UA 3JB9D 4M78D 2FBKA 1GHCA 5ICGA 2CW0F 1B7YB 3F22A 3MEYA 2QHTA 2ARUA 2FXAA 4BXUA 4M75G 5DDGA 4IRIA 3J80Z 1WRJA 2A68F 1FOKA 3WTUC 2RKHA 3KEQA 3SZTA 5ELNA 4PNOA 4FT8A 3E6BA 3C1DA 3ECHA 3K0LA 3WODF 3PGGA 2QENA 3E9HA 2DJZA 2V9VA 1KYWA 2Z99A 3FXQA 4P9UA 1YG2A 4YIFA 2X4HA 3JCMX 1LNWA 3ML6A 5GANf 1BIBA 3G73A 1SAXA 3QO3A 4CGZA 5GAN5 4HA8A 3HXXA 2Q8KA 5DUKA 4M75B 1MD0A 5GAOp 1X54A 5ERIA 3HXVA 3HY0A 5K1XA 4X5OA 2F5FA 4BHBA 2A07F 4L0YB 5ICEA 3LC0A 3VOEA 3K69A 4M78F 2Q5IA 4YRJA 2ZJ2A 5H6QA 1F4KA 3T5XA 2E1CA 3TDZC 4G7HF 1FBSA 3BP8A 2IRFG 3F8BA 2H27A 1T39A 4TV7A 2EA2A 2AMCA 3RACA 4HDVA 1ZLKA 2A5YB 5HS7A 2K4BA 1L0WA 4UVBA 4F7UF 3VQYA 1FP2A 2Q5HA 2HTSA 2FF4A 4GYIA 4H2SA 4EX5A 2XHKA 4WF2A 4F7ZA 3E3VA 1LOJA 4J5YA 1JHFA 4M7AD 5DCMB 1YCYA 3IWFA 1BBYA 1UHWA 4S05A 1O3SA 1IN5A 3JSPA 4WJ3M 1VTNC 4YRCA 2PMEA 4RB1A 1NHAA 4C92F 2H6BA 2VE8A 3FZVA 4A53A 5LJ5e 4YROA 2IVMA 1SD4A 4ZTUB 2ZT6A 1D3YA 5GAMe 5GMKh 3I5UA 3JB9J 2XV4S 3M4QA 4XBFA 1XB4A 1NJ6A 2XGXA 4U0YA 5TJJA 1FT9A 2P0LA 4EMKA 2OA4A 3O6BB 2MH2A 5FO5A 3KZYA 1OR7A 1Y96B 2Q7EA 1WWXA 2O3FA 4M78A 4AVPA 4C8QC 3D0SA 2WV0A 2QQBA 4G8XA 2K02A 4TVWA 2K4JA 2MLKA 4GGGA 2W57A 3F6VA 3I7FA 1EVLA 1N9RA 2ZT7A 4N0AA 4QVCA 1HW5A 5C51B 4U7BA 2QYOA 5BOXA 1HKTA 3VU3C 2ZKZA 3I59B 4MQ9F 3N97A 1XCVA 2UXNA 2DDZA 1J9IA 1K79A 4OMZA 2HKOA 4B09A 3JCMh 1JGSA 4WWCA 1T6SA 5GMKi 2IW5A 2XASA 1W7PD 4P75C 2EJ9A 1HSTA 4N9HA 1HW2A 2QBYA 2VOOA 3I59A 4FX0A 1K6OA 3V8JA 4M75F 2XVCA 2CGHA 1XGMA 5E8GA 1SD7A 3DXJF 2D45A 4B8XA 5KNNA 4HV6A 5I21A 2DAOA 5HDGA 4PJOF 4HF1A 3IKMB 5LJ5h 4P5OA 3K1MA 1XMAA 2R7DA 1X56A 4G7ZF 2IT0A 3WTVC 1V4RA 3M4GA 1USSA 4BH9A 1R5GA 1KQ9A 4KN7X 1MJAA 4O2DA 4RGRA 1I5ZA 1B1BA 3QOPA 4P74A 3HY1A 1NJ2A 1S6LA 4ESFA 5GAN2 3F8FA 1D5VA 3KFUA 1SRYA 4XQ3A 4I98B 4Y15A 4LG0A 4XU0A 2HFHA 1I81A 2OD5A 3ZMDA 3GUDA 4HX8A 5GANd 3PCOA 4P72C 3TO6A 4PZJA 4G6QA 1E24A 1TLHB 4RGXA 3VQVA 4MNUA 1ZARA 5LJ3d 4A12A 3R0AA 4P3PA 4JRKA 1QPMA 1H4QA 2ZNYA 3SWNB 4L9JA 3JB9F 3PQJA 3BWGA 4YP0A 1IAWA 3O2PE 3F8NA 2JPBA 3K2ZA 2A6HF 3KFWX 1U8RA 4HX7A 3IC7A 2DQ3A 3VQXA 2FNPA 1IRGA 1KGSA 1DDNA 1FPQA 3GZ5A 2EJRA 5CVRA 1OKRA 4ETSA 1DUXC 3CMQA 2NRAC 1QZYA 5IT3A 4M71A 1E1TA 1MJBA 2IY5A 1G4DA 1IUYA 3KE2A 4M9XA 3INZA 4M77B 2ESHA 3WTYC 2ISZA 3HFOA 3JCMe 2DT5A 2QBYB 4C92G 4EJTA 1U3EM 2YX4A 3WTZA 2PJPA 2PG4A 5D5WB 3QTCA 4H2VA 2ZIMA 2A61A 4IHTA 3KP7A 5LHGA 5GAMh 3ZMTA 4S04A 1FC3A 2ZMEB 2RGVA 4EJOA 5E17F 4EJWA 4N0BA 3FIFA 5D5UB 2JPCA 4M7AE 3EFSA 3GVAA 3KLNA 4ASNA 4FHTA 5ED4A 2XAQA 2Y90A 2V6CA 1P6RA 3E97A 4EGYA 3MEXA 4LMYA 1HSJA 2EAYA 1I5LA 3JTHA 5F6FA 3FF5A 5L3DA 5JR3A 4R79A 1JXSA 1BOAA 2ZMEA 1XSXA 4WXCA 4C92C 5J8FA 4M77D 3L2CA 4GCVA 2ZR3A 4CH5A 4YFNF 1ZRDA 4UPAA 1GXQA 2ADUA 5KK1A 4KQEA 3P9KA 4KDPA 5ILSA 3SZPA 2ZIOA 1F1ZA 1WSUA 1EIYB 5K1PA 1FSHA 4M78C 5DD8A 1U5TB 1HKQA 3QU6A 4CO8A 3HSRA 1RZ4A 3PZCA 5ICCA 2GQQA 2NNNA 5LRSA 3QRFF 1DPUA 3HOSA 1TQPA 5GAMg 5DD4A 1R1UA 2GAUA 1U1TA 4M75A 4E70A 4RB0A 3HTSB 3R6SA 4L87A 2O61A 2AS5F 3JB9I 2RHSB 4M6YA 3A7RA 3P9CA 4ZYEA 1XMKA 1R58A 2J3LA 1FY7A 5GAOq 5JHUA 3JCMb 3FXUA 4NL2A 1HTTA 2DTRA 4ZYHA 2Y75A 1O3TA 4M7DD 1WLEA 1P4WA 4YRGA 2E1NA 2AMCB 4L9NA 2DU9A 4TQDA 2YLCA 1SMYF 5LJ5j 4M7DA 2ZZFA 1MJ9A 4XLPF 3H3UA 3IALA 4KR3A 1WQWA 2G7HA 3KP4A 1S7AA 4NL3A 4IVNA 2QHVA 2HNIA 2R3SA 3M4PA 2HKXA 3NENA 1R00A 2EK5A 4WX9A 4K2EA 1QZZA 3GFJA 1IN7A 3ZQ7A 6PAXA 4CH3A 3J80K 2P8TA 4AIJA 3JB9G 4M78G 4KIFA 1XN7A 2HYFA 2OBPA 2RVCA 2HYGD 1ON2A 3NETA 2QHUA 4I0AA 4P72A 4KIBA 5HVQC 2XAHA 2AKWB 3REOA 5LJ3f 3LA2A 1J7KA 2DXUA 1EFWA 5F5WA 3G1ZA 4OIPF 4PJOD 1ZREA 4RAYA 1O3RA 3DV8A 4BW9A 3MZHA 1IXCA 4KMFA 1FYKA 1Y96A 1ZLJA 2JN0A 4PDKA 1IZ1A 1FSEA 3SQNA 3JB9H 3F23A 3HTZA 2YR2A 1VQZA 2KRFA 2XKOA 5HLGA 1YW8A 4ENJA 3F3XA 4MQVA 4YRIA 3V7CA 4ON0A 5LGTA 3MQ0A 2V79A 1A04A 4MTEA 2J3MA 3J7AO 2ZZGA 3HRKA 1LEBA 4EGZA 1U78A 4UP7A 4TVAA 2ALYA 1L3LA 4WXDA 3TOBA 1SESA 1IL2A 1HQCA 4QVDA 4N9IA 2WC2A 4BQAA 5E3IA 4G94A 4PGHA 3P8YA 5D4SA 4KYWA 2DTIA 1HKSA 2DPUA 5GANj 3E5UA 3RYPA 2E3CA 3QSUA 5K1YA 1TTYA 2C8MA 1XCBA 1TNSA 3B73A 4A6EA 4UVCA 1QQIA 2CG4A 3FJPA 5C53B 1X3UA 2K86A 3ZMSA 3RDIA 4EMSA 1I4K1 3JCMd 4LLGF 5KVRA 4M7DG 5FB2A 3GW2A 2NS0A 5D8KB 3GXOA 2RQPA 1TNTA 1DP7P 4YDQA 2QQ9A 3SXYA 4K88A 2O6GE 3HIFA 3HYIA 1YTYA 3CUOA 3KETA 5CVUA 4KT5C 2FU4A 4XU2A 2PN6A 5D5XB 3GZ6A 4HQMA 4PHCA 4A5NA 5DEQA 4OOIA 2LF7A 2M45A 3SB2A 4MHGA 5GAN7 1B9MA 5E20A 5CVIA 4TTVA 1X2GA 3V8LA 3BROA 2LSOA 3QUIA 3MF2A 1YS6A 1UFMA 4PJOE 1ZHFA 5A2QK 3IKTA 4LG0B 2VN2A 4HYEA 4KMUX 1YFHA 4KR2A 4OIQF 2LKPA 4PJOG 2XUBA 2HZTA 1ZRCA 2E5AA 2K57A 2C7IA 4Q6GA 1MZBA 1PDNC 1QF6A 3SFZA 3NEUA 5GANg 3E6MA 3S2WA 1LQ1A 4J6YA 4KICA 5GANh 3NRVA 12ASA 1JBMA 5HLIA 3RKYA 3I64A 3CLOA 1E2XA 2BBYA 4H2XA 4DPGA 3MAJA 1R22A 2UXXA 3HRUA 1PYSB 3Q5FA 3L09A 1G3SA 2HS5A 4PJOC 3FHZA 3I4PA 3WU0A 4CH4A 4CICA 3KP6A 5FFZA 1ZG5A 4C8QE 3TOAA 5L3GA 4M74A 3JW4A 4CS3A 1J2XA 1YS7A 4UUVA 2EJGA 2M30A 2H6CA 4GYGA 4CZZA 2Q7HA 1WI9A 5CLSA 2E10A 1W7PA 4YFXF 4EQQA 2RV8A 3ZMUA 1ONVA 4HWPA 2VBWA 4IXAA 1LEAA 4C92B 4F7UA 3R61A 2O0YA 5L3BA 2AXLA 3JCMV 2I4OA 1B8AA 2IY5B 2ZR2A 1YW7A 3U2RA 2CJAA 3A5YA 3Q9VA 3ZMZA 2ODRC 3FXRA 1TQMA 3LA7A 1XGSA 4L5JA 4ENMA 4C8QD 3J81Z 2ETHA 4EM1A 4M72A 1IF1A 2VC8A 4AIKA 4EMKC 3CTAA 1LJOA 2WTEA 3GX4X 2PBIA 5D4RA 2ZZEA 5D6FA 2CQKA 1SERA 1ZN2A 3ZP5A 5HDKA 1R1TA 1U5TA 2I2LA 4YRSA 1TW3A 3L4GB 5ILVA 2DQ0A 3FMQA 1TQIA 4M78E 3QO7A 11ASA 3JCMg 5D6EA 1MKMA 5ILUA 2EFPA 3K1PA 1DPRA 4YRKA 5ICFA 2RDPA 1BN5A 1KYZA 2CGPA 4TVYA 2LNBA 3FWEA 5LRRA 1YFTA 2ZCWA 3TGNA 5D8LB 4JLIA 5LJ3g 3LQRA 5GANe 3DSQA 4WI1A 2EA4A 2PI0A 3BPXA 3TO7A 4YRTA 1FBUA 3NEMA 3T8TA 1JJCB 1K78A 3L9FA 4YRFA 1B70B 1HXDA 4XTUA 3H3ZA 3I58A 1MGTA 3NQOA 3F72A 4ZIBA 5BS6A 2RHSA 2HQRA 3WE2A 2W25A 5CAIA 3H92A 5LEJA 3ERED 3CUQB 2D1VA 5LBQA 4EMGA 3Q9SA 2MD5A 1KU9A 4RGSA 3L00A 1UB9A 5GAN3 1J5WA 4XTXA 2ESNA 1S3JA 2HEOA 4XSXF 2QTXA 4EVIA 4TWAA 4C8QG 5LHHA 2DTHA 4BAYA 2XKPA 1BI2A 2EB7A 3FM5A 3QU3A 3SHFA 1WPYA 4HWTA 3HXWA 4HWRA 5L3FA 5GMKe 1LYLA 2BYVE 4P74C 2C6YA 4LLLA 3LFKA 1KU3A 5L3CA 5GMKm 3ELKA 5JVTA 2I4LA 2Z9OA 3QP5A 3GIBA 4EMKB 5LJ5d 2DK5A 5CVVA 4KIGA 5HLHA 2F5DA 2OQRA 4X9CA 1NJ1A 2XROA 4ENNA 4OIRF 2KKOA 4M73A 1YB3A 1JE8A 4UV8A 3QO8A 4BNCA 2PMHA 5FGMA 2VBXA 2OU2A 1XGOA 4YPFA 1PP8F 1PP7U 4RDXA 3L1AA 3O3KA 3WTXC 1BI0A 4IF4A 4M7AG 1ADYA 3UFGA 4JRIA 5GAN6 4BHPA 1GGMA 1OYYA 4P71A 3EDPA 3JTGA 2P5KA 1ON1A 3VB2A 4RS8A 3WGGA 1WQ7A 3BJOA 5BPDA 4CS2A 2P7VB 1O7FA 4YCVA 3J81K 1X2HA 2ZGWA 3BZ6A 2ZO4A 1JJCA 3FX3A 1ZAOA 5GMKj 1T2KA 3PCOB 3R0JA 1Z9CA 1KQ2A 2CO5A 2RHQB 3OOPA 3P7NA 1Y0UA 1U1SA 4ZTZB 2Z3YA 1ZGAA 3D5LA 1H9TA 2V1XA 2V1UA 2RB6A 1HBXG 2FA5A 4C8QB 3T8RA 2CFXA 2VOPA 1EH6A 3VQWA 2ZXJA 1LB2A 4CS4A 2IA2A 4BHCA 1YYVA 2DKGA 4F7UG 2J5OA 1G3WA 2RM4A 1F9NA 2DQRA 5DV5A 5A2QZ 4CHUA 5GAOn 3JAMK 3BW1A 1G5HA 4XEMA 1P4AA 2DU5A 2E41A 4OU0A 3V7RA 2M1BA 1QNTA 4O5VA 5H20A 4M77E 1G6NA 5GAOl 4EJUA 5GAOr 4HV5A 3DPLC 4CDGA 2EFNA 2YSRA 5BMZA 1KMNA 1EVKA 1I8FA 2JTVA 4LB6B 2FBHA 3A74A 3A5ZA 4P3OA 2QM3A 4M77F 3DPTA 4I2OA 1FP1D 5GAMd 1LDJA 3GEZA 1JHHA 4FX4A 1IRFA 5AIQA 3HSFA 1RUNA 4Q48A 4L9VA 1ZGJA 2DZCA 4PJOB 2PEXA 2DZ9A 3ZN0A 4O3MA 4G9YA 3BY7A 4ZZLA 4JQFA 4DNCA 3SWNC 1RIQA 3M8EA 3QAHA 2DPDA 1R5HA 4HLYA 1TH7A 3QO5A 4RGUA 1STZA 2Q7GA 4WXHA 3TQNA 4I01A 3TDUC 3JAMZ 1YFRA 4DQ2A 4GO1A 4UVAA 1FZPB 4LJZF 2CJBA 2EFWA 3HFNA 3HHGA 1G51A 2KIFA 4P3NA 3IRRA 2V1DA 4EJVA 2L4MA 2EL9A 2VC1A 2VXEA 5GMKl 1HW1A 1U2WA 3E6DA 4HT9A 2M8EA 1W4MA 4GXOA 3MFKA 2STTA 1TBXA 3PQKA 4HW0A 1XSDA 4HQEA 2RA2A 2HQNA 1F5TA 4LD5A 1GVJA 4M77A 3RERA 2VODA 1W5TA 2DTOA 2COMA 1BBUA 5FD6A 2Z5UA 5JI6A 2QVOA 2ZFWA 4XU3A 4EO4A 4M7DC 4M7DF 2EV6A 3GO5A 4HWSA 3TEGA 2QHSA 2Y48A 5F64A 3UH0A 3KLOA 4M7AC 2E7XA 1B9NA 4P71C 4KUMA 3LSQA 2ZTGA 3QNEA 3E5QA 3TEHB 1R1VA 2XRNA 1R36A 3ICAA 1FBQA 4PG3A 1KU7A 1SMTA 4H2TA 4UNOA 1Z7NA 3VBBA 1H641 4JUVA 4A2UA 1ZYRF 3OD1A 3UGTA 3IHUA 4YRPA 4AH6A 4UP9A 4HF2A 2Q0OA 1ZG1A 3WQZA 3TO9A 3W6KB 1XDSA 1B7YA 4P75A 3ULQB 1RIOH 4I7HA 1YFSA 2ZNZA 4G7OF 4Q5SF 3WGHA 1KU2A 2FQ3A 3OV8A 2BEOA 1ZG3A 3V8KA 3U1DA 4L9TA 3NELA 1CGPA 1FYLA 2DFIA 5HS8A 4M77C 1S7OA 3IG2A 2IP2A 1J5YA 2FOKA 1WU7A 4CH6A 2MBFA 3L2ZA 1KQ0A 2JZYA 1UCRA 4RCBA 1N9SA 3I53A 1FWZA 4P96A 1IN4A 2DU7A 3WU1B 4HVCA 2VXFA 2ZT5A 2MC3A 3HXYA 3VEPA 3A7UA 1ASYA 3K9TA 1NJ8A 4YRLA 5CJ9A 1ULYA 4MEYF 1EOVA 2EWNA 1Z7MA 1XSVA 4ESJA 2O03A 4CXFA 4ZYDA 4MMKA 4M77G 3CO7C 3VODA 2G9WA 3MCZA 4MTDA 4EM2A 4M75D 2DVEA 3E5XA 3WGIA 4MEXF 3I54A 1LJ9A 2ZNJA 1Q1HA 3BY6A 3SWNA 4M6XA 1YO5C 1BC7C 3JCMf 2XAFA 3LWFA 4HZFA 1H9GA 3JCMP 3AHUA 4AWXB 4RQEA 3C3WA 2IA1A 2P6SA 4ZYGA 3LSSA 4M7AF 4H2WA 3CDHA 1ADJA 4OP0A 2NAZA 2YU3A 4I09A 4IJAA 2QZ8A 5E1XA 2UZKA 1R7JA 1X55A 1C0AA 1U5TC 3DQVC 2H94A 5FD5A 3P9IA 4V2SA 2B0LA 4QLCU 4RAZA 1M8VA 3RKXA 1HK9A 4E51A 3RF1A 4YREA 1T98A 1BJAA 1H4TA 4G6DA 1QE0A 2L3DA 3KEOA 2RNJA 3KP3A 2FB7A 2VONA 2E64A 3U9GA 4NCXA 2Z33A 1D3BB 4BWAA 2PLYA 5E1WA 4U0VA 4P9FA 3HXUA 2PMFA 4OIOF 4G84A 1FYFA 3FB9A 2IA0A 2KIUA 1SD6A 1H4VB 3DF8A 2FYKA 4ENKA 1KA8A 3RESA 4MMLA 4WK8F 1IN8A 3A32A 1W7PB 2HTJA 2BE5F 3HOTA 2LF8A 5LHIA 3R07A 3A31A 1BI3A 1BBWA 4C92A 1ZRFA 4M78B 4M7AB 5CYVA 2WWYA 4P73C 4HLXA 3HXZA 1JRIA 4AD9A 4YG2F 4C8QF 1NJ5A 4HT8A 2K27A 1N9WA 1REPC 5DCFA 3RYRA 2GA2A 3C18A 3C7JA 3JCMc 1YLFA 1TW2A 1I6XA 2FNAA 3MZYA 3DP7A 3MWMA 1ZH5A 1J75A 1NYRA 4Q4ZF 4JK1X 4P55A 4UHTA 4K86A 1I1GA 3G3ZA 2PFBA 2W24A 4LK0F 3UGQA 4XTVA 4M9SA 4YRRA 2DBBA 5GAOm 5AONA 1D8JA 1EH7A 1HC7A 4UV9A 2EJFA 1SD5A 3HRSA 3A7AA 4A0YA 5J6XA 1BIAA 4JBAA 1FNNA 4RCCA 2DEQA 4K87A 2F2EA 2ZBKA 1O7LA 1CF7B 1B6AA 4Q47A 3BDDA
chains in the Genus database with same CATH superfamily
2K7AA 3LSTA 2WB1N 4XRFA 4E4HA 2GLOA 3KCCA 3N05A 1XD7A 3GWZA 2OAZA 1VQ9I 2SEMA 1LPQA 1KQSA 2A08A 4X34A 5H6RA 3NARA 1IJWC 1P92A 1I27A 1Y57A 2KBTA 2DEUA 3R6NA 2GXBA 2IVWA 3CXCP 1QVGP 1FLIA 1EJ9A 4Y91A 1Z05A 4M3FA 4OVAA 4AFSC 3T1BA 2MA3A 3C0CA 4YIIA 3D5RC 1X3WB 5C52B 2QUFA 3OMGA 1J0RA 1UMQA 2EVRA 2C0TA 2XF5A 5LD2C 3REAB 2CWEA 3EETA 5GAN8 2MW8A 2M87A 1T0HA 3AKZA 3G1MA 1YRNB 4RB3C 1WNLA 4HF0A 2L02A 3HUGA 2W84A 1PUEE 3HOVJ 1ZSGA 3OYYA 3FXJA 2UV1A 2NS6A 4MIMA 5EDNA 2M4GA 3DKYA 3CLQA 3QWLA 2EZLA 2OZ6A 1RI7A 2OV7A 2Y69H 1ODDA 1YIOA 2VT2A 3LSIA 3PUFA 3RTRA 2OQGA 4R1HA 4BEHA 5FKNA 2YUQA 5EEGA 3ZN1A 2BW3A 5B5EC 1SEUA 5E1ZB 3WTWC 2R5MA 2DA4A 2DO7A 4B43A 5CR2A 3S1QJ 1TU0B 1USYA 4DBFA 3K4NA 1BM9A 3V7SA 3E7LA 2F2WA 2W4SA 2MLGA 1K78B 2K2VA 3PVQA 4PL6A 3O5ZA 3M0PA 4A5MA 1AOYA 2GXGA 1SFEA 2H09A 1MDMB 2DA1A 2FJ1A 4LK1F 2BTTA 4J6WA 4OB3B 3RI4A 2HMAA 4AIHA 5D5VB 3W3SA 3CUQC 2BGCA 4A0XA 4Y92A 2CQNA 2DW4A 1QP2A 2BZXA 5J3LA 3F8CA 5IXBA 1Z77A 2DDBA 2BV6A 4A3DJ 2EYZA 2QAZA 3C94A 1H8KA 1PSEA 4OF1A 1USTA 4YCWA 4U0WA 5M5YJ 1O57A 4UB6C 2KJCA 5LJ5g 2EV0A 2A6EF 2QLZA 4HX4A 4M9ZA 5HDNA 3TUPA 4PJOA 4IUTA 5LGUA 1BJZA 4TQFA 2V6EA 1A6IA 4RLFA 1UE9A 4BQQA 5J1YA 2V4JC 5DY9A 3K4JA 3M8FA 4M4ZA 1X75C 1WJ5A 1RETA 2FRHA 3B02A 2JA5J 2ODRD 1MH4A 3OS1A 5LJ3h 3LX7A 2CSOA 1XPXA 3GTMJ 2RHUA 3F6OA 2QEXT 2RJDA 1Z91A 5K5RA 2H1KA 2RN7A 4EV0A 2R5ZB 1QVPA 3U23A 3MF1A 2ALYB 1VUBA 2DL8A 3FIFA 1E17A 4TVAB 2K2MA 4C0FA 1RNLA 2XDPA 4CYDA 4X9DA 2CYZB 1UJ0A 3WE3A 3J7ZI 2DI3A 3CC4T 4Y13A 3HFZA 2EPDA 5HGQA 2FMYA 4EM0B 2LDUA 3CF2A 4D9JA 2YU9J 3E1SA 1KQ8A 3JSCA 3AAFA 3VS1A 1YI2T 2NVQJ 1NYQA 5KYNA 4LVKA 3RQIA 3ZQCA 4K11A 2JVGA 1Z0XA 1GLNA 3CDLA 5BQTA 5GTHC 1MMNA 2VBYA 2CP3A 1BYMA 3KUFA 3HKZA 3QPHA 5F27A 2V8KA 4C92E 1LCKA 2HDCA 5A2QE 4YRNA 2JSCA 1FMVA 4OMYA 4H2YA 4BKXA 2DA5A 2M51A 3QZ9B 5IN1A 2HWVA 3FMRA 4YYEA 2ZT8A 3E9IA 1Y39A 2ZPHB 3EQLF 4ZTJA 2EBPA 2YUNA 3JRGA 4NOYA 4QQDA 4IUVA 4AFUC 3SEQA 2FL7A 5HS9A 1R4NB 3I56I 3N4MA 2VJJA 2GQIA 3AT1B 1ASZA 2RQRA 2F5EA 1Z6RA 1KMMA 4UXNA 4XTZA 2X6OA 3CMYA 2LX7A 2ECCA 1MBGA 2AT1B 3G71Q 3DEWA 4UP8A 4FCYA 1UHCA 3I71A 2ED1A 1YHQQ 2HQ5A 3M59A 1RI9A 1SFUA 3RNJA 3P8TA 2I4MA 4AYBA 3SDZA 3OSGA 2DFUA 3QIIA 3IRQA 3EGUA 4C5HA 4P73A 4ZNXA 2X0LA 4HDUA 1HJDA 4FW2A 3CD6I 1QGPA 4F7UE 2FSWA 5J8CA 3I0TA 2DXTA 1IV8A 1OPCA 4HG2A 3EYYA 5F1RA 2YSQA 1Q7YC 2G4CA 2EIMH 2WAQA 1YJWI 1OMIA 2G0EA 2PX9A 1G3TA 4HCKA 1KQSP 3TEHA 1JQQA 3MP1A 2ISYA 2DA9A 1LNXA 2EKOA 2E2IJ 3CD6Q 2XSJC 5J1RA 1YJNT 3I9V2 4DBRA 2CJ9A 1OJLA 3BC8A 1YW9A 1LVAA 2Q2EB 3RKWA 1YE9A 3EG3A 3VS5A 3HRIA 2VASA 1OEBA 3LA3A 4CRIA 2UWMA 2JA7J 3MVPA 4Y4RA 1V55H 1IW7F 2K85A 4HBLA 2A3SA 3ZGKA 3CJQB 1TUCA 2GWRA 1KC8R 4B9XA 3M9AA 4JJDA 4FSSA 3A8GB 4M3BA 4FYXB 1G5IA 3BJ6A 4C92D 1H0MA 4HEA2 1S72I 4C8QA 4OINF 3ERMA 2STWA 3F21A 4QWQA 1Z9ZA 5DCMA 2DL3A 2P6TA 3CC4I 2E4HA 4B44A 1S7EA 1OYWA 1B34B 2ENMA 4KH0B 4EX5A 2FZKB 3EFRA 2R5YA 2HQEA 4C30A 3GF2A 4U7DA 1K7AA 5LJ3j 2HDDA 1NM7A 4IHYA 4IHSA 3OSSC 5IHIA 3LH0A 3FM3A 1V76A 3V4GA 4U88A 4XOPA 4JOMA 5J1UA 4BXFA 1YWPA 4KULA 1S29A 4RQFA 3GLXA 3KYCB 2EIJH 4PFPA 4C2MJ 2A0FB 4JZ3A 3IKLA 4KA4A 3DCFA 1MDMA 3S2HJ 5LLQA 4Y17A 2LJ1A 2RHZA 3KBGA 4M7DB 2P4WA 3OWTA 2R92J 1MBKA 3VUBA 1L0OC 2Y0MA 5CVJA 8AT1B 4KITB 3S32A 4BDYA 5FWBA 1YGBA 1X01A 1VQ4Q 2XGTA 2RHQA 3H3VK 4O6JA 4B6MA 2AQFA 2NUTA 2MIOA 5FFXA 3ISPA 4DOZA 4RMOA 2HQXA 2JWTA 3DKWA 2LKXA 1XDUA 1OI1A 3ECOA 1JXOA 2DQLA 1GFDA 4J01A 2DA6A 2GBYA 4L0ZB 4L5GA 1IHVA 4JJCA 3L2RA 3DFGA 1Q7YR 1ZA1B 1SFXA 4B4CA 3CCMA 3CO6C 4AIDA 5GAEJ 5A0GA 4PUSA 2M5WA 2E35A 2VXZA 1HSQA 3IKVA 4LNSA 1Z7UA 3A02A 1KC8U 4ESBA 1VQMA 1TWAJ 5LJ3e 1U6GA 4D5FA 1WJQA 3OYKA 5DUIA 2M34A 2JTFA 2KQWA 1Z6TA 4ZH4F 1DJ7B 3E9FA 2DODA 1GCPA 4CC2A 2XB5A 2YX7A 1MGQA 4H2XB 4L5IA 1B07A 1JO8A 3H5AA 5LJ5f 1NK3P 3R60A 2QSGX 1OYIA 1M2VA 2DK8A 2OTJQ 1QLYA 3CJRB 2VQHA 2IJLA 4Z2YA 1W1WE 4RM3A 2ZCEA 3NHNA 3P8HA 3RPUA 2OTLQ 4YCUA 1IXRC 4RM2A 2J5PA 1VQ7T 1G3YA 2R93J 1ZUUA 3CBMA 2K9QA 1B59A 3DLLA 1T0FA 3E6CC 4C3IJ 2BZYA 1R23A 1VFCA 3SFIA 4G85A 1U9OA 1TWCJ 2MH9A 4A3MJ 1BBZA 2O9VA 2WSCE 3OSFA 3CJNA 4HAMA 3PJRA 1DGWY 1V3FA 2RF0A 1B8IA 3RGLA 2FQ4A 3PFIA 4AFZC 4TVRA 3PNTA 3OYEA 2D2WA 1MNMC 4L59A 4BEHB 2YLBA 4L18B 4M75C 2M7AA 3M1EA 1P2FA 2ZNIA 2L54A 3KP2A 5J4VA 1J3TA 3HFVA 1SANA 2KJBA 3RIRA 4Q15A 1S8NA 4LNPA 3L2UA 5GADJ 4H4KC 2O88A 4AM3A 3F8MA 3HRTA 2ZINA 3A01A 3QPTA 2GOMA 1M4ZA 1M5Q1 4M7DE 2I4NA 4A3LJ 2VUBA 4F16A 5EEHA 3SEMA 1D3BA 3M0SA 4FIBA 4FT4A 3ABTA 5JFRA 4XEOA 2VLAA 2P84A 1JJ2A 4OMPA 1K0XA 1JU5C 2DL5A 3OYNA 2PMUA 1YX5A 4CCLA 1M3BA 3FIWA 1EV7A 2RH2A 3HSEA 3BPVA 3EH1A 4E7IA 2KE9A 1WJDA 3LSPA 3R4KA 1WHGA 1ZBXA 5E8IA 3EYIA 4F93B 2EYXA 1YX3A 3A0BC 1TWBA 2KGTA 2XIGA 4R0KA 4XLCA 3M07A 4LB5A 3OS5A 4XTWA 1LDDA 4KFCA 2CZ7B 1VQ9Q 1P4XA 1PRLC 3LAJA 2R58A 5FLXZ 2A69F 4Z89A 1FX7A 4I02A 4AVZA 2P5VA 5B1AH 2FO0A 3QWYA 1BOBA 4F52A 5IP9J 1NJIR 3CMET 2FBIA 4A0ZA 1T38A 4JP0A 3T0YA 4BBSJ 4J6XA 5D6WA 1Z1DA 4DYCA 5D6XA 3UDCA 1KQ1A 4IIMA 3ZPLA 1D1CA 4F91B 4E7HA 2LR8A 3B6CA 4C5IA 4LG3A 3ERRA 2ARSA 1BC8C 2E1MB 2E60A 3ABUA 2HGCA 1QBJA 5L3EA 1PKSA 3CCUQ 1W2BP 5ELOA 3FMSA 2VBZA 1EH8A 2IGOA 2JUCA 1VI0A 5K5OA 4LITA 1B72A 2O4XA 4BU2A 4F7UB 2L3SA 2NXNB 2RI5A 4YRMA 3OW2S 1Y0NA 4A6DA 2FRYA 3REXA 2P0WA 1BR4A 3I3LA 3WG9A 4I6ZA 3ZQIA 1K4TA 2LP0A 2RJEA 3QHSA 1H3ZA 2O8XA 1EQRA 1QO0D 3M7GA 2GA1A 2YUPA 3C2BA 2BHZA 5I2MA 3BJUA 2QA4I 1YBYA 3KIOA 4A3FJ 2JA8J 2GZWA 2DBKA 4FYVB 2KMUA 5FLXE 3DTIA 2HPIA 2NUPB 1JT6A 4A3IJ 5M9OA 1W66A 2LT1A 4N4HA 3RUXA 4HWOA 4A63B 4H02A 1BI1A 2JT1A 2DYSH 2XDVA 1SF9A 3CPFA 4KNYA 4EIKA 3QPSA 1IXSB 3HEFA 5LFAA 2XAJA 1O3QA 1IN6A 3CMAT 1KOGA 3ZQHA 2HBPA 3HGYA 2J06A 2VE9A 5CIUA 1YJWA 4D0PA 2FRWA 3VS3A 3L4GA 1H4SA 2FZGB 1M90C 1WKMA 2BZTA 5GP9A 1BA5A 2W10A 5GAN4 3RPQA 4DIQA 2FEZA 4WCGA 3S2DJ 1OCOH 4NQWA 3VPRA 1AWXA 4A3GJ 3HHHA 3VSKA 3RL6A 3ZMVA 1TT0A 2IIMA 5CQXA 4LFUA 2HZDA 2LOOA 1OZ3A 2RK2A 3HRMA 4LGWA 2L8DA 1WYDA 3U21A 4QVZA 1J59A 1YITI 5HK0A 1VQPT 2ZXFA 2HZYA 2NYXA 3FK7A 4BYYA 3WTSC 1UDLA 1WXUA 3MQZA 4LDYA 5KCMA 1F1BB 2L9VA 1RESA 1JUPA 1UHSA 1WJAA 2JVVA 3VYRB 4A3JJ 2JM9A 2DJQA 4LDWA 4RMFA 1UG1A 4A54A 2A05A 3GLLA 1UZCA 2A5WA 4EMHA 5IT9Z 2JM8A 2QK0A 1W5SA 1D8KA 1PD1A 4AUXA 3QZ5B 3MEVA 3K6GA 1PYVA 2OTLA 2E19A 2EGAA 1XGNA 4EATA 2E7WA 5E79C 5LEKA 5E18F 3G4SI 5HOOA 4CCNA 1YFNA 4R8HA 2CUEA 3JSOA 1SSFA 2W85A 2K9GA 2X4WA 2D1HA 2E1HA 4N0AC 4M7AA 3X28B 3S1MJ 1KD1U 1LDKB 4DYQA 2V8IA 2WB1A 2R7FA 3HGGA 2L01A 1B34A 2CUBA 2NNYA 2V7FA 2K7LA 1RLQC 2J6FA 3H5RA 3ROUA 3E19A 4RG8A 4E2FB 2ELHA 4M3DA 3COAC 1IB8A 3QXEB 2QQAA 1M1FA 4BUPA 2DOAA 1IREB 3REUA 4XU1A 1MHNA 5I2SA 4H0EA 1K4US 2JTMA 4DEXA 2KIMA 1K73R 4KN4X 5FLXK 2WSEE 5KCHA 4J9CA 1N8RU 4J15A 4OLFA 1I50J 3I35A 2Q2EA 4PJMA 4BY6C 3RQ4A 3W6JB 2J05A 2XC7A 3P8VA 2RPNA 2P7CB 5IT9E 2EQUA 2RD1A 4FTHA 1N75A 2PQ8A 4BQOA 3BFMA 2EH3A 1OQYA 2JUGA 4RA2A 2GIVA 3CUQA 4QPQA 2X48A 1X6GA 3VFZA 2BUDA 4XLNF 1XNIA 2H1LA 3IL2A 3PO3J 2HKQB 3E9GA 4RUGA 2CIMA 1WQ2A 5FRMA 5IAYA 2P0PA 5LGNA 3GYHX 4NHJA 1P7IA 2ACJA 4X1EA 1WVRA 3JCMW 2TDXA 2JMWA 5GAMf 2FOWA 1YJNA 5K5QA 5GAMj 2VC0A 1W2BA 3ER0A 2IPQX 1T3SA 5AIPA 2FMLA 1MUZA 2ECZA 3OA6A 3KXTA 4CI0C 3BDUA 2L3QA 3HC7A 2E5ZA 4BXXJ 1BW5A 2CYYA 2KI7A 1B70A 2FE3A 2Y4XA 1UG2A 2EFQA 2EV5A 2VT3A 2EFOA 3NGPA 3BCBA 2JRMA 3GTGJ 1H8AC 2IS2A 3HSBA 3DB3A 2H8WA 2YPRA 4V2FA 5DM6F 3NTIA 4IPAA 4XLHA 2JRTA 3TKYA 2ARTA 3CCYA 1C0WA 2KDSA 3CCLQ 4D5CA 2DILA 1HLVA 1CF7A 1FIAA 1Y6IA 1HCRA 1JJ2P 4NB5A 2J6OA 1RUOA 2CUZA 1ENHA 4MGRA 1TSFA 3L42A 5F08A 2AKWA 3DLLF 5BPIA 3KZZA 3DEUA 2EGCA 3EPZA 4HCZA 4I0BA 5K7ZA 4ZZDA 4XICA 2KMTA 3VS2A 2CP5A 1R5ID 1ZK8A 4Y7NJ 2JT4A 3NAUA 3OL3A 2KT1A 4M75E 1I1SA 4IEJA 4LD9K 3EAEA 3GFLA 3GTLJ 3RJPA 5TRDA 4PLIA 5FJ8J 3W2AA 2CT4A 3H36A 2XGEA 4HOBA 1B76A 1E1OA 3CCLT 3M55A 1W6XA 1PYSA 3K1NA 3BOQA 3J7AY 2QWWA 2K5FA 2HOEA 3T9NA 4RB2C 1JJ6C 3K70C 3BG7A 2O31A 4PCQA 1X58A 3QP6A 3GFIA 2CSQA 2HR3A 2KPMA 2VWFA 2NS7A 4IOAF 2OZUA 4IRGA 1X6OA 4M3EA 4H2UA 4XSZF 4N4OB 4BE1A 4Y52J 1UHMA 2XAGA 1B4AA 1FYMA 1WX6A 2GFAA 2ROLA 3FJ5A 2DLLA 4WJ4A 2VJ4A 2D1XA 3RDVA 2JA2A 3HTUA 1V29B 2XGCA 3LAPA 1VQKQ 2DERA 3DKXA 3L7WA 3VYSB 2R7RA 4XLFA 2VKNA 3QKJA 3M53A 5KYWA 3IWZA 2IS6A 2AZVA 1VZ0A 1MNEA 1WJSA 2VQCA 1GXPA 3WTTC 2OAWA 4J83A 4XTYA 1N78A 1K73C 1E22A 3J80E 1D0YA 1ZR4A 5IP7J 3NTKA 4RTZA 2RNGA 2E65A 3KP5A 2L4AA 1AWCA 3CCVI 1UB4A 1NNHA 4YFKF 3GFMA 3JCMQ 1CKAA 4IRHA 4PGGA 5IY5H 5DYMA 1ZQ1A 1YQAA 3CC2I 4LLNA 3S17J 2AKLA 2C0IA 3MP6A 1TZLA 2DX1A 2P5LC 5IT9K 4FL6A 3FK6A 3LQQA 1EIYA 2VQLA 3IAS2 3JCMJ 2F5CA 4AFQC 3EUHA 1Y0MA 2KLOA 2YHTA 3PFSA 1YI2Q 3HFZB 2L7ZA 2RC4A 2DNUA 3TP3A 1ATIA 1SETA 2PVOB 3BJAA 2Y9ZA 4XN3A 1I5OB 2G7UA 5CK9A 3JB9D 4M78D 2FBKA 1RLPC 3MKYB 1GHCA 3CC7Q 5ICGA 3LWIA 5EF6A 2FHDA 2KRMA 3PMIA 2J6KA 2CW0F 2VI6A 4V2GA 1B7YB 3DLAA 3F22A 2B7EA 4Z8AA 3MEYA 3GTQJ 2QHTA 2ARUA 2FD5A 1APLC 1A35A 2FXAA 4KT6A 4BXUA 5EG0A 2ME0A 4XORA 1F36A 5DDGA 4IRIA 1VOMA 4KGXB 4M75G 3J80Z 1WRJA 2A68F 1FOKA 2MI6A 3WTUC 2RKHA 1VQ8I 3KEQA 3SZTA 5HKCA 1YHQT 4ATOA 5ELNA 3IAM2 5HLTA 4FT8A 1EZZB 4PNOA 3E6BA 3MKDA 2KT8A 3C1DA 1R77A 1QCOA 1Q86R 3ECHA 3HZJA 3K0LA 3WODF 4C0GA 2XU8A 4B3AA 3OMCA 3PGGA 1X1AA 2GOXB 3G4ST 1K9AA 1VQLQ 3G2BA 2MG4A 2X6XA 1IG7A 1HDPA 1ZQ3P 4QT7A 3K4CA 2QENA 1ERDA 4KGVB 3E9HA 2DJZA 2V9VA 2P4TA 1KYWA 2Z99A 2I5UA 3FXQA 4P9UA 1YG2A 2DCEA 4YIFA 2X4HA 2LBFB 1LNWA 2W82A 2E5QA 2LT4A 3JCMX 3ML6A 4HVWA 5GANf 3JRBA 1BIBA 3G73A 1SFOJ 2XAUA 3HJEA 3U1KA 1SAXA 3FKJA 2KIQA 4HA8A 2M2EA 1T08B 4B47A 4CGZA 1NYGA 2K6DA 2RNAA 5AT1B 2JJ9A 3VS4A 1VNDA 2COBA 3JRIA 3EUHC 3CCQA 2Q8KA 5DUKA 4M75B 1MD0A 3SHWA 5GAOp 1X54A 5ERIA 1VQLT 3HHTB 4E7SA 1UGSB 1VQNT 3HXVA 3HY0A 2MYSA 4J00A 5K1XA 4X5OA 2R7OA 2GM4A 2F5FA 4BHBA 2CS7A 2A07F 4L0YB 2NUZA 5ICEA 3GF5A 3LC0A 2BZ8A 3FBNB 3K69A 3VOEA 1IO6A 4M78F 2Q5IA 4YRJA 2ZJ2A 1MBJA 5H6QA 5FLVA 2M9UA 3QQAA 1F4KA 2BVMA 3M4YA 1XX5A 1LUJB 3T5XA 2E1CA 2QF7A 3TDZC 1WIEA 4G7HF 1FBSA 3CQZJ 2YT6A 3A5ZB 1S9HA 1IO2A 4HCCA 3BP8A 2DYIA 2IRFG 3F8BA 2DRMA 4HVUA 2H27A 4MDXA 2KK4A 5FKMA 1FEXA 1T39A 4TV7A 2EA2A 2AMCA 2M9HA 3RACA 4HDVA 5KNLA 1Y8QB 1ZLKA 3BT9A 3OYFA 1W36C 4NUBA 1DU6A 3E2UA 2A5YB 5HS7A 2D8JA 2K4BA 3PTAA 4PJNA 4UVBA 4ZYAA 1L0WA 4F7UF 3CZ6A 4MFDA 3CCMT 3VQYA 2LCLA 1FP2A 2Q5HA 2BY0A 4HNVA 1RR7A 4C5EA 1BW6A 2HTSA 3HPWA 2FF4A 4GYIA 4H2SA 2F2VA 2XHKA 4WF2A 4F7ZA 1MMAA 1P7JA 3E3VA 4BE2A 1LOJA 2XKOC 3M54A 4J5YA 4KT0E 1JHFA 3K4KA 4M7AD 5DCMB 5IYDJ 1YCYA 2LRQA 3IWFA 2E12A 1BBYA 3I5SA 5GAN5 5IP6A 1UHWA 1XG1A 4S05A 2LFBA 1O3SA 2I0NA 2K79A 5FWCA 5J3BA 1U3OA 3A4CA 4KRTA 4G12A 3G6ET 1IN5A 1M90R 3JSPA 4A4EA 3H0GJ 4WJ3M 1VTNC 1YJ9I 2LTOA 3S3MA 3MP8A 4YRCA 2EW3A 3BLYA 4RB1A 1NHAA 4C92F 2PMEA 2H6BA 1BL0A 1U5SA 2KZVA 1POGA 1W36D 4DZPA 2DMPA 2VE8A 3FZVA 2M02A 4A53A 5LJ5e 4YROA 2IVMA 2XSDC 3IP4B 1SD4A 3OW2A 4YTLA 4ZTUB 2JSPA 4KJZA 4E6KG 2ZT6A 1D3YA 5GAMe 1B8IB 2RI2A 5CCAA 1K83J 5GMKh 3I5UA 1ETKA 5M5WJ 1E3OC 2JJ7A 3S14J 2XV4S 3JB9J 3M4QA 3MKWB 4XBFA 3M4OJ 4WCIA 2XF7A 3BCAA 1XB4A 1WLPB 3HKSA 4AG1C 1NJ6A 2XGXA 4U0YA 3A8HB 4BBRJ 2DVJA 2BOLA 5EEAA 1ZUKA 5TJJA 1FT9A 2NVYJ 1UGRB 2P0LA 4EMKA 2OA4A 1UUEA 4P1WA 2VB6A 3M0QA 1NK2P 4AYBN 3O6BB 2JMAA 2MH2A 5FO5A 2MAMA 2DJNA 3BE3A 3FXLA 1S5LC 3KZYA 4QTRA 1E3HA 1OR7A 4JPBW 1M1GA 4E7LA 2VKDA 1Y96B 5KYYB 2Q7EA 1WWXA 4DW6A 1UGVA 2O3FA 4M78A 4AVPA 1WHJA 3EGXA 1SEMA 2FG0A 4C8QC 4CC7A 4F17A 3D0SA 3VSLA 1VQ8Q 2DDAA 2QQBA 2WV0A 2DYBA 2KXDA 3RPUD 3CBOA 3CCRT 2QEXQ 4G8XA 3HOZJ 1ORKA 1XS9A 2RN8A 2ZJQF 2K02A 5IHKA 4TVWA 4OMQA 3CCSQ 2K4JA 2MLKA 4GGGA 1E6GA 5KYUA 1XTAA 2HL3A 3ZFJA 1JXMA 3F6VA 3DBLB 3I7FA 4PK4A 1Y71A 3C95A 1EVLA 1I3QJ 1N9RA 1HC8A 2ZT7A 2NVTJ 3QYHB 4N0AA 1JI8A 1N6AA 4QVCA 2LYCA 2ZAEA 1HW5A 5C51B 4E7ZA 4U7BA 2QYOA 3A01B 4IO9F 4A4GA 5BOXA 2CRGA 4ZN3A 2O5RA 1HKTA 3VU3C 2P81A 4OAZA 2RREA 3G6EI 4J8OA 3A0HC 3RR6A 2ZKZA 3G6EA 3I59B 1XJWB 2GFUA 4MQ9F 1DU0A 2XDBA 3N97A 1XCVA 2UXNA 3CCST 1LFBA 2DDZA 1Q1VA 2DOFA 2XPWA 1J9IA 3OBYA 2WA0A 4AU7A 4RKUE 1K79A 1KD1R 2QYZA 4OMZA 1NH3A 4W97A 3D1NI 2X4YA 2PUKB 2HKOA 2EZKA 4B09A 3JCMh 1JGSA 1XQHA 1ARKA 1X2MA 4WWCA 2D5VA 1T6SA 5GMKi 2AHJB 2IW5A 2XASA 3BZCA 4J7FA 3E0JB 3I4MJ 2LNHB 2CP7A 1W7PD 1XC5A 2CV0A 2DA3A 3OY9A 4MLOA 3PNVA 3KX2A 5EG0B 2D9TA 2EJ9A 2P0KA 4IUQA 3VS6A 3G71T 1HSTA 4N9HA 1HW2A 2VJIA 2QBYA 2VOOA 3I59A 4FX0A 1K6OA 1G59A 2GGRA 3ZBDA 4ANJA 1KIKA 4NC6A 2K5LA 3S16J 3V8JA 5M5XJ 4M75F 2XVCA 2CGHA 1XGMA 5E8GA 1SD7A 3ZL7C 1VQLI 3DXJF 2D45A 4B8XA 1RAFB 5KNNA 4HV6A 1V54H 3HPHA 2AQEA 2DAOA 3O8HA 4NQWB 5I21A 2E2HJ 3PO2J 3J7AF 5HDGA 3DBHB 4HF1A 2EIFA 4PJOF 2BY3A 3S1NJ 5LJ5h 2DIQA 3IKMB 1YJNQ 4P5OA 5KAIC 2LJ0A 1QU3A 3K1MA 2DD4A 2EQIA 1XMAA 2R7DA 2TRTA 4IHXA 3Q1JA 4C0ZA 1Z3YA 4QW2A 2PU9B 3ZR8X 1X56A 1OPLA 4G7ZF 2VXDA 2IT0A 2W00A 1KONA 1WI3A 3WTVC 1V4RA 1Q82C 3M4GA 1GCQC 3L2WA 1X2KA 3TL4X 1USSA 4BH9A 1BR2A 1R5GA 1EF4A 2Y2ZA 4PSWA 5JVGF 4J9DA 3G6EQ 1SSHA 4LDXA 1KQ9A 4II3A 4KN7X 1ACIA 2XMFA 2RK1A 1MJAA 3HB9A 2QASA 4HPQA 2R7ZJ 4O2DA 2HSEB 3TQ7P 4RGRA 1J09A 1I5ZA 1B1BA 2R5AA 4B9WA 3QOPA 2Z16A 3HG9A 2X9HA 2DO3A 4P74A 3HY1A 4IUUA 1NJ2A 2CUDA 1S6LA 2RMOA 1PVEA 2AHQA 3EG2A 4ESFA 1VYTA 5GAN2 1K9MR 1S1NA 2ZPBB 3F8FA 1D5VA 4QQ6A 3KFUA 1SRYA 4XQ3A 2AK5A 3CCSI 3H0HA 2VQGA 4I98B 1ETOA 3I55I 4RTTA 4Y15A 5E3MA 3CCSA 2IEKA 4LG0A 5DS9A 2FVUA 2JN6A 4XU0A 2HFHA 3ASOH 4RDUA 1I81A 2M4KA 2OD5A 5J40A 3ZMDA 3GUDA 2XB0X 4HX8A 2V1RA 5GANd 3SD4A 2A28A 1QVFS 3TO6A 3PCOA 4P72C 1ABQA 3Q0UA 4G6QA 4PZJA 2GQVA 3MJXA 1TLHB 4FYYB 1E24A 4RGXA 3VQVA 4MNUA 1ZARA 5LJ3d 4A12A 3CC2T 1JEGA 3TP0A 3VV0A 3R0AA 4P3PA 1SRLA 3RZDJ 4JRKA 1OCPA 1GBRA 1QPMA 1H4QA 2ZNYA 1X69A 3SWNB 4JJNK 4L9JA 2R7VA 1QRYA 4DBQA 1RR8C 2LMJA 2SRCA 2X4JA 3PQJA 3JB9F 3BWGA 2F4IA 2IXSA 4YP0A 1VQMI 3K2AA 1IAWA 3O2PE 3K10A 3F8NA 1R0CB 2JPBA 3OSVA 3K2ZA 2A6HF 3KFWX 2LLKA 3ZXSA 4II1A 1U8RA 2JTEA 3NFCA 4HX7A 1XMXA 3IC7A 3WHCA 4BDZA 2DQ3A 3VQXA 2FNPA 3ULRB 1LKXA 1RABB 1IRGA 1KGSA 2K3BA 1YJWQ 1DDNA 1FPQA 3GZ5A 1JKQC 1EX4A 2EJRA 2YUSA 1N77A 4XL9A 1G2HA 5CVRA 4ZDPA 1OKRA 4ETSA 3A1PA 4AMCA 4RTYA 1DUXC 3S6WA 4ZC3A 3UATA 2NRAC 4BI4A 3CMQA 1C0MA 3TW7A 1QZYA 5GPAA 5IT3A 4M71A 3MD2A 1MJBA 1E1TA 4J9HA 4AG2C 2IY5A 1G4DA 4HRIA 1IUYA 1E0EA 9ANTA 3KE2A 4M9XA 3BR2A 3INZA 4M77B 2ESHA 1BCOA 2LNVA 4XRSG 3WTYC 2V26A 2ISZA 3MN2A 4RTXA 1MH3A 1YJWT 3HFOA 3JCMe 1AEYA 1GUUA 2DT5A 2QBYB 4C92G 5KYXB 4EJTA 4JLGA 3EH2A 3CCUI 1U3EM 2YX4A 3WTZA 3AG4H 2HOTA 2PJPA 2PG4A 3MZ8A 2LQ8A 5D5WB 5H2FC 2XTIA 5DLQE 3QTCA 4H2VA 2DA7A 3K4BA 3SZGA 2ZIMA 3LSHA 1QW1A 2A61A 1DQUA 1QCNA 3EGXB 4PFOA 1KG1A 3GNFB 4IHTA 4BB7A 5HY6A 3KP7A 4JZ4A 5LHGA 2B63J 1LPLA 5GAMh 2EYWA 1KD1C 3ZMTA 4S04A 1FC3A 2HOAA 2K9SA 2ZMEB 2RGVA 3BR1A 4XNFA 4EJOA 1A5JA 2NWMA 2Y4YA 4A4HA 4BJ5C 5E17F 2Y31A 4N0BA 4EJWA 5D5UB 2JPCA 3GTJJ 3AL0B 5B1BH 1KZHA 2HVRA 1BK2A 3EFSA 3GVAA 1M2OA 4J9EA 3KLNA 4ZTFA 4ASNA 4FHTA 5ED4A 4MDWA 4DOVA 1VQ5T 2MABA 3B6AA 3LYIA 1X1DA 2XAQA 2Y90A 2KQRA 1P6RA 2V6CA 3E97A 5JLWA 4EGYA 3MEXA 1Y1VJ 1X27A 2A36A 4LMYA 1K4SA 1HSJA 1ZELA 3ABLH 3GZNB 1WZOA 2IGMA 3EFOA 4J9IA 2EAYA 3CCUT 1I5LA 3JTHA 5LL6S 3CCUA 5F6FA 3FF5A 1GDTA 2QQRA 2MSYA 5L3DA 2JOYA 2EKHA 5F04A 2L0AA 5JR3A 4R79A 1JXSA 1NEBA 1Y1WJ 1YIJI 3BQZA 3SDBA 1BOAA 1PCXA 2CH4W 2DT7B 2X6YA 2ZMEA 5K7HA 3CXCS 1XSXA 4WXCA 2KSSA 1QCFA 4RTWA 5J8FA 4C92C 4M77D 3L2CA 3MEUA 2ZPGB 1JUSA 3AG2H 4GCVA 4E6RA 4UY8I 1QVGA 2ZR3A 4CH5A 4YFNF 5I22A 3BZKA 3NWSA 2DK3A 1ZRDA 4QQGA 3TEDA 4IZZA 4UPAA 1GXQA 2Y30A 2ADUA 5KK1A 3S93A 1T56A 3CCET 2X9DA 4KQEA 5JHFA 4JX4A 2BXZA 3QYEA 3KYDB 3P9KA 1FYNA 1VQLA 1W2BS 4KDPA 5ILSA 2E6NA 3X25B 3FHNA 3SZPA 3SFMA 1F1ZA 2ZIOA 2RJCA 1R71A 1WSUA 4XKWA 3LFUA 4FASD 2NUTB 1UFFA 1NLOC 1EIYB 5K1PA 4IKFA 3G4SA 1ETWA 1FSHA 2CP0A 4M78C 3TSWA 5DD8A 5GJWB 1U5TB 4R56A 3OIPA 2O9SA 1HKQA 1U0JA 4MZPA 3QU6A 1M1KC 2OJED 4CO8A 3HSRA 2EQMA 1OR7C 1E3PA 1RZ4A 2EBIA 2MC4A 4BJ6C 2Y0SN 5ICCA 3PIOF 1MSFC 3PZCA 2GQQA 2NNNA 4RAFA 5LRSA 1UJ8A 4NBQA 3QRFF 1DPUA 2RHYA 2YWWA 3HOSA 2HD0A 3QODA 1TQPA 3QWXX 5GAMg 2VKVA 5DD4A 1R1UA 1CKBA 1T0JA 2GAUA 3OYLA 1OCRH 3VRYA 4JX6A 1X1CA 3BTLA 2MPXC 2JS0A 1Y8RB 2DBMA 2NUPA 1VQ6T 4GRIA 3BG9A 1TG0A 1U1TA 4M75A 4XK8E 4E70A 4XR6A 2QA4Q 1Q81C 4RB0A 3HTSB 2ESWA 3OYGA 3ZOBA 3R6SA 2KDZA 4L87A 2O61A 2AS5F 4LDVA 3JB9I 4BD3A 2F48A 1UECA 2HYJA 2RHSB 4M6YA 2FPDA 4HNUA 5IOYA 3K4LA 1IDZA 2AZSA 3QBYA 3P9CA 3L2VA 3A7RA 4ZYEA 1XMKA 2Z0WA 4LVMA 1QHGA 2V1NA 1UHFA 2L7KA 2COYA 2F4MB 1R58A 2J3LA 1V5FA 3CCQI 5A0DA 1FY7A 1ZTRA 1W70A 1YNZA 4RBOA 5GAOq 3OB9A 2C06A 5JHUA 2X3WD 3JCMb 3HOYJ 2CH0A 3M58A 3FXUA 4NL2A 2QA4T 1HTTA 2DTRA 3M5AA 3MPUB 4ZYHA 2Y75A 1O3TA 1VQNI 2XK0A 1OU8A 1ZLMA 2QG9B 4M7DD 3NWTA 3UA6A 1WLEA 2HCKA 3IH3A 1P4WA 2XGDA 5F1JA 4YRGA 3RMSA 2E1NA 3LSMA 4L9NA 2AMCB 2DU9A 3CC7I 2YLCA 4TQDA 1SMYF 4CZCA 1K61A 3S3OA 5LJ5j 4M7DA 1X2QA 4V19K 2L89A 3KFVA 1MJ9A 1QVUA 2WY8Q 4XLPF 2ZFUA 3LMMA 3H3UA 1EA3A 3IALA 1YI2A 3HUGB 4KR3A 1WQWA 5BNGA 2V8JA 1WZ2A 2G7HA 3ASNH 2DFFA 4JJBA 4IOCF 2KHMA 3KP4A 2ZPFB 1S7AA 2L7FP 4NL3A 2UUZA 1K6YA 4IVNA 3BG5A 2QHVA 2HNIA 2R3SA 3M4PA 2HKXA 3EG0A 3QG1A 3NENA 1MW7A 1R00A 4ORZA 1ETQA 2LD5A 2EK5A 4WX9A 1X2NA 5HNFA 1FOXA 4J9GA 2DA2A 2LK2A 1X4OA 1QZZA 3GFJA 1IN7A 3KEYA 3KPHA 4K2EA 3ZQ7A 3J80K 6PAXA 1KSWA 2FZCB 2KY9A 1JKOC 4CH3A 3C2HA 4OMOA 3LOCA 5IOZA 2D0NA 2P8TA 4XKCA 4AIJA 1HD3A 2DF6A 4LVLA 3JB9G 4M78G 2XHCA 1NPPA 4KIFA 1XN7A 2HYFA 2OBPA 2RVCA 1HDDC 1NYFA 1OZ2A 2G6FX 3CCLI 4OMMA 3LWHA 3IH4A 2HYGD 1ON2A 3G71I 4IIOA 3CCLA 2MFZA 3NETA 2QHUA 4I0AA 1EFNA 4P72A 3EUAA 1Q95G 4KIBA 5HVQC 2KEAA 2XAHA 3M0UA 3VUZA 1Z9QA 2AKWB 4NS5A 3REOA 1M90U 5LJ3f 1YJ9A 3LA2A 4D7NA 3QJ6A 3CPWS 2DLPA 1I1JA 4J9FA 1J7KA 2DXUA 1X43A 2EINH 2YRDA 1G2BA 1EFWA 5F5WA 1BCMA 2VV5A 2ID6A 4OIPF 3G1ZA 2YXYA 4GFBA 1SHGA 4PJOD 1ZREA 1C1AA 3QDFA 4OGCA 1U06A 4RAYA 4FT2A 5HCKA 1O3RA 3DV8A 4BW9A 3MZHA 2CSIA 1IXCA 5EJCA 3M57A 3OYDA 4KMFA 4LUEA 2QGFB 1FYKA 2G3RA 1Y96A 5KYYA 2GIZA 1ZLJA 4A3EJ 2COZA 3M1CA 5M3FJ 4PDKA 2RAEA 1IZ1A 2F2XA 2JN0A 2KVQG 4FU6A 1FSEA 3SQNA 3JB9H 4YRVA 3F23A 3HTZA 2YR2A 3G71A 1M8MA 2DE0X 1VQZA 2KRFA 2XKOA 3VDXA 1EKEA 5HLGA 2H3EB 1YW8A 2ID3A 3F3XA 1T0FC 4MQVA 2KRCA 4ENJA 4YRIA 2FEIA 1USYC 3V7CA 4ON0A 4D8KA 5LGTA 3MQ0A 3A1YA 2R7UA 2V79A 1A04A 4MTEA 2J3MA 3J7AO 1PKTA 4GDFA 2GF7A 2M3AA 2ZZGA 3HRKA 1LEBA 1WJBA 4EGZA 1U78A 1FMKA 4UP7A 3MHXA 4TVAA 1NEGA 1JKRC 1C6VX 1TS9A 2ALYA 3FISA 3JAME 1YOVB 1L3LA 4WXDA 1AD5A 3TOBA 2E70A 3G1JA 1RC9A 3JV3A 3URGA 1SESA 1IL2A 1HQCA 2HPMA 5A0LA 4HSTA 5FRNA 2WBMA 2LC4A 2CFOA 2L0KA 4QVDA 2KDOA 4DGWB 1N8RR 3JCUC 2QSHX 3CC4Q 1M1EB 4N9IA 2QXFA 2WC2A 1IUFA 4BQAA 4G94A 4PGHA 1WYXA 3P8YA 5E3IA 2QA4A 5J47A 5KE2A 1AWOA 1UTIA 3LSGA 5D4SA 1PC0A 4KYWA 2DTIA 3K7AJ 1HKSA 2DPUA 3A2KA 3CPWP 1JGGA 3E5UA 5GANj 1S72Q 4PSXA 2XICA 2NYSA 3MO8A 2LDMA 2VPLA 3RYPA 2PVDB 2E3CA 3OIOA 3QSUA 5K1YA 1TTYA 2DIGA 2C8MA 3WVDB 1XCBA 1TNSA 3B73A 4A6EA 4UVCA 1WGXA 3WXMB 5DM7R 1QQIA 2CG4A 2CV1A 3FJPA 5C53B 2JNGA 3V42A 4YIRX 4U87A 1X3UA 2K86A 3ZMSA 1UG0A 3RDIA 2PVGB 1K8AU 1GVDA 4BJTA 4EMSA 3H0DA 1I4K1 3JCMd 1U9NA 4LLGF 5KVRA 4QIWN 3VJPA 3OW2P 4M7DG 3FEOA 2DMTA 3GW2A 5FB2A 3G4SQ 2NS0A 2L9RA 4G6TB 5CKTA 5D8KB 1WJFA 3O8GA 3GXOA 2LTPA 3MEWA 4K86A 5TISC 2RQPA 1TNTA 2HAXA 1T3LA 1DP7P 3OYCA 1VYVA 4YDQA 2ICWG 3MCAB 2QQ9A 2M0CA 1WH7A 3SXYA 1AT1B 2IS4A 4K88A 2O6GE 3HIFA 3HYIA 1YTYA 1AZGB 3CUOA 2F5KA 1FOWA 3PL8A 3KETA 2QDYB 4Z6YA 2Z1DA 4FE7A 3L1PA 5CVUA 1TT5B 4KT5C 2FU4A 4XU2A 1MIJA 4Y28E 3H9NA 2JW4A 2LX9A 3EG9B 5C6SA 2L7MP 2PN6A 4PJ0C 3H9GA 3Q3SA 5D5XB 4HQMA 3GZ6A 2OTJI 3SEZA 1XOVA 2DXBA 4A5NA 3TSZA 1VQNQ 5DEQA 5C0MA 4OOIA 3CCJA 3CD6T 2LF7A 2H8HA 3TEEA 1KC8C 1M3CA 1E6HA 1I3AA 1ZR2A 1PSFA 4FETA 2M45A 4Y33A 4MHGA 1UGPB 3SB2A 4CUGA 3CDIA 2HL5C 5GAN7 1B9MA 1WHUA 3MMYB 4N4NB 3ASKA 2BHYA 5E20A 4FW1A 1K9MC 5CVIA 4TTVA 3RKQA 1X2GA 1SVOA 2DTZA 3V8LA 4ABZA 1HOMA 3BROA 2LSOA 3QUIA 5J26A 4CCJA 2QTVA 3MF2A 1YS6A 3P8BB 3EGDA 1UFMA 5GJVB 1ZHFA 5A2QK 2CMPA 3IKTA 4LG0B 6AT1B 1PM3A 4PJOE 2IPOB 2E2JJ 1VQ9A 5D7UA 2VN2A 4HYEA 4KMUX 1YFHA 2W7NA 3LL7A 3H41A 1OCTC 4HCBA 4BGDA 4KR2A 4LVJA 4OIQF 2TCTA 3META 3GMEA 1S72A 2VL8A 2LKPA 4PJOG 2XUBA 1D5YA 3CC2Q 3F70A 2HZTA 4DA4A 1ZRCA 2E5AA 2K57A 2C7IA 4Q6GA 1N27A 1G8XA 1MZBA 1PDNC 2BY2A 1QF6A 3SFZA 4P5NA 4C0DC 4P75C 3NEUA 4KH1B 3KZIC 3I55A 1RAIB 1VQ4T 5GANg 3H1CA 2LC2A 2L9NA 3E6MA 2X1CA 2V9KA 2ZC2A 3S2WA 1LQ1A 2FX0A 2Z2SB 1KK7A 1RAHB 3JRZA 1G5VA 3GBQA 3DLMA 4KICA 3QYGB 4J6YA 4A69C 4XRSA 5GANh 3NRVA 12ASA 2KISA 1JBMA 5HLIA 3BQYA 4XMYA 2JMCA 3RKYA 3I64A 3JRAA 1OOTA 1YJNI 1PG5B 2CKKA 3AG1H 2DRKA 2ZCFB 1RI0A 3H6ZA 1SHFA 3FKIJ 4ELYC 2VKEA 3CLOA 3QJYA 2EYYA 1E2XA 1V1CA 3RBBB 2BBYA 2AXTC 2WACA 3LNQA 2E3IA 4H2XA 1ACMB 4XLAA 4YEJA 3MAJA 4XN0A 5CQEA 4AC0A 1HA8A 1MBFA 4XLEA 3UWNA 3ZEHA 1WCMJ 1R22A 3Q0VA 2UXXA 3CF5F 3HRUA 3BG3A 1PYSB 3DPUA 1PRMC 2JK3A 3Q5FA 1W0TA 3I56T 4ITVA 3L09A 3BR5A 1G3SA 2HS5A 1SRMA 2JXBA 2QQSA 4KUDK 3W2VA 4PJOC 2OTJT 3FHZA 2VJ5A 1QPIA 3I4PA 3CMAI 3WU0A 2H3JA 4RTVA 1VQOQ 3I9QA 4CH4A 4CICA 4UUTA 3LW5E 3KP6A 5FFZA 1VQ7Q 1ZG5A 4C2UA 4C8QE 3TOAA 2CV2A 5L3GA 4EPCA 1Q86U 4M74A 3TCJA 5GTIC 3JW4A 2F1LA 4UUSA 1VQ7I 4CS3A 1J2XA 2B8AA 1YS7A 2DFHA 5KYWB 4UUVA 2EGEA 1A31A 3OOUA 2M30A 2EJGA 2H6CA 4GYGA 4CZZA 4OMFB 2Q7HA 3PT9A 1RL2A 2KR3A 2X1DA 2V9PA 3QDRB 1WI9A 3I56Q 5CLSA 2E10A 3WG7H 1W7PA 4YFXF 4HT4A 4EQQA 1D0ZA 2RV8A 2QCOA 3ZMUA 1NG2A 1ONVA 4CCOA 5FU6C 4ESRA 2VBWA 1R9TJ 4HWPA 4IXAA 1LEAA 4CH7A 2L3RA 1OLTA 3M56A 2FPEA 5D6YA 4C92B 4F7UA 1T95A 4J7IA 2RQQA 3R61A 2O0YA 2EPFA 5L3BA 4UUSB 1R0BG 2LQNA 3PIOA 2AXLA 2I10A 4J9BA 3HXLA 3MKZA 2H8RA 2OAUA 3FDRA 2MGQA 2BW3B 3JCMV 1VQ5Q 2I4OA 3K70D 1B8AA 2IY5B 4MZMA 2ZR2A 1KFZA 2DXIA 3BTJA 1MV3A 2FPFA 2R5ZA 2LH9A 1WJRA 5IPAA 1YW7A 3A8MB 1VQKA 4F3QA 3FC3A 1AWWA 1SFKA 1NJIC 1MNDA 3U2RA 2CJAA 3A5YA 1W1FA 3Q9VA 1X6BA 3ZMZA 2M8GX 2R7TA 1RRJA 1RAAB 4OB1B 3RCOA 3BTIA 2ODRC 4A3KJ 2D8HA 2DMOA 2EZHA 3FXRA 1SKUB 1H3HA 1A0NB 2PJRA 3GNGA 5CKFA 2XF6A 3CMEQ 1K0SA 1TQMA 3GPLA 3A98A 1NZ9A 3LA7A 5JLXA 1XGSA 4L5JA 4LVIA 3FLGA 3VYUB 3I56A 2YUOA 2ECBA 2ELKA 2NOJB 4HSRA 4ENMA 1VQPQ 1PD0A 4ZDLA 2GNCA 4C8QD 3J81Z 2ETHA 1Z7LA 4EM1A 3PE0A 1R4MB 2M16A 1VIEA 1W4SA 4M72A 1IF1A 2IG0A 2P4RA 4D6WA 2VC8A 4AIKA 4EMKC 3CTAA 1LJOA 2WTEA 3GX4X 2PBIA 5D4RA 2J7IA 4C9YA 1IDYA 3DWLE 2OC6A 2ZZEA 5D6FA 4CCMA 1YCSB 2CQKA 3GCMA 1VQOA 3TVTA 1X19A 1YHQI 1VYUA 3M9QA 3VS0A 1MMSA 3ME9A 4DPGA 1SERA 1OQKA 1ZN2A 3ZP5A 2O8KA 1WH5A 5HDKA 3FRNA 3X24B 2MMPA 2DT6A 3NMZC 5E3NA 4XKVA 1MSEC 1R1TA 2KAFA 1U5TA 2DVEA 2I2LA 4YRSA 3PNWC 1TW3A 3BR6A 3ESWB 3L4GB 1WI7A 3JRFA 5ILVA 2D6FA 1N8RC 3TU4K 2DQ0A 3FMQA 2HU9A 1TQIA 4CYCB 1BR1A 4M78E 1FOYA 1TWHJ 1MBEA 5FROA 3J81E 5CKBA 1M1KU 1LFUP 3QO7A 11ASA 3JCMg 5D6EA 1Z3XA 3M3YJ 1MKMA 3ZQQA 4RLQA 2EFPA 5ILUA 1MBHA 3FXKA 3K1PA 1DPRA 4PJLA 1BB9A 1NBEB 5J39A 2KP6A 2ZZDA 4YRKA 5ICFA 3PSIA 2DMNA 4DJAA 2C0OA 2CZ0B 2RDPA 3WU2C 5KCOA 5C4XJ 1BN5A 1KYZA 1NE8A 2CGPA 4TVYA 1ZGWA 2LNBA 1M9SA 2RHXA 4CC3A 3FWEA 5LRRA 1YFTA 2ZCWA 4PFZA 3TGNA 5CKHA 5D8LB 4NNJA 2QQ8A 4JLIA 3ONQA 4CYCA 1QHHD 2NOGA 2R4GA 1TC3C 1OFCX 1QKXA 5LJ3g 4CSWA 1LE8A 3M8JA 2DMQA 2K5IA 3HXUA 3LQRA 1A6QA 5GANe 2HQHA 3CCRA 1UELB 3DSQA 2KYMA 4WI1A 2CDTA 2JUFA 2K3XA 2EA4A 2PI0A 3BPXA 3TO7A 4YRTA 2JVHA 1FBUA 3NEMA 2YRCA 2CW8A 3T8TA 2AO9A 1JJCB 5C44J 1K78A 2PQWA 2L3PA 5B66C 3L9FA 2B9SA 2BE7D 2QEXA 1HXDA 1Z21A 1B70B 4YRFA 1I0CA 1QVGS 4NDLA 3VKIA 1MMGA 2PMZA 4XTUA 5CKDA 3H3ZA 5KAFC 4ZGJB 2I8DA 5GPCA 3I58A 1GV5A 1MGTA 3NQOA 3SDGA 3F72A 2XIDA 4ZIBA 2ZXIA 5BS6A 2RHSA 2HQRA 2O7OA 3WE2A 3QOEA 3OS0A 2W25A 3F9KA 1WFXA 5CAIA 4YRQA 2KRHA 4W1UA 3H92A 2W48A 5LEJA 3ERED 3CQTA 3CUQB 2D1VA 5L8RE 3CP8A 4LE9A 5HK3A 1NG6A 1OCZH 5LBQA 3LGFA 2EILH 3H0FA 4EMGA 1NTCA 3Q9SA 3PIPF 3DU5A 2GXAA 2MD5A 3HDDA 2ZSHB 2LCCA 4OMNA 4OGEA 1WXBA 7AT1B 2K40A 1KU9A 4RGSA 2GTJA 3L00A 1UB9A 4CCKA 5CQYA 5GAN3 1J5WA 1O4XA 4XTXA 3THKA 1SVMA 2R0QC 1X1PA 2ESNA 2F69A 4IL6C 2WAFA 3R6OA 3ZCOA 1FTTA 1S3JA 3FXMA 2HEOA 4XSXF 2MOXA 2QTXA 4XAXB 4C2TA 2CUJA 4EVIA 3BR0A 3G1LA 5CPRB 4C8QG 1YJ9T 5EGOA 4TWAA 5LHHA 3C12A 4F04B 4GBQA 2DTHA 4BAYA 2BXYA 4KISA 1QWFA 2XKPA 1BI2A 2DJIA 2EB7A 2K9LA 3FM5A 3QU3A 3SHFA 3W6VA 1WPYA 3PIPA 5IXFA 3HXWA 2LQKA 5L3FA 4HWRA 4HWTA 5GMKe 1H89C 1LYLA 4WTOB 1A36A 4AT1B 3HTRA 2BYVE 4JS4A 4LOCA 2C6YA 4P74C 2BY1A 4LLLA 1IGNA 2CP6A 3LFKA 3CCRI 3UT1A 1PHTA 1KU3A 5L3CA 1NJIU 5GMKm 2PTKA 2GTOA 1IRXA 2Y9YA 3ELKA 5TGTA 2BIVA 5KH6A 5KYXA 3CJTB 4FM4B 5JVTA 2DETA 2I4LA 3NTHA 2Z9OA 4M3GA 3QP5A 3GIBA 5GAGJ 4PLLA 3H9JA 2JA6J 4EMKB 1RKTA 3CMAA 1OX9A 3OR2C 1GFCA 3UPUA 5LJ5d 2DK5A 5CVVA 4KIGA 4OB0B 1PUFB 2X35A 1T33A 5HLHA 1XTDA 2F5DA 2OQRA 2A6TA 4X9CA 1NJ1A 2XROA 1B72B 4ENNA 4OIRF 4B48A 4C3HJ 2RHIA 2KKOA 3VRZA 1N5ZA 3F0CA 1TTHB 4M73A 4N4GA 4FQGA 1JE8A 1VQ8A 1YB3A 4UV8A 2OI3A 3TMOA 2DL7A 1SAUA 3QO8A 4BNCA 2VGNA 3GTKJ 2PMHA 5FGMA 2VBXA 1AHDP 2FUG2 4HVVA 2COWA 2OU2A 1XGOA 4IQJA 1ZBJA 1Y07A 1BU1A 2XPUA 3VS7A 4YPFA 1PP8F 1PP7U 4RDXA 3L1AA 3O3KA 2E3HA 4BL0B 3WTXC 2LVMA 2YRVA 1BI0A 1MMDA 4IF4A 4M7AG 5FKLA 1ADYA 4RG2A 3A03A 3RMQA 3UA7A 3UFGA 4JRIA 4NC8A 5GAN6 3G7ZA 1I6HJ 4BHPA 1GGMA 3BG6A 1OYYA 2X1EA 4P71A 3EDPA 3SYTA 3OYBA 2P5KA 3JTGA 1ZUYA 1ON1A 1QA6A 2CREA 2PJRB 3PMTA 3DU6A 1AZEA 4QSHA 4FSXA 2CJJA 3UR3C 3VB2A 4RS8A 4X1VA 3CCQQ 3WGGA 1WQ7A 2F5VA 1W0UA 3BJOA 3JRHA 5BPDA 2P7VB 1RUWA 1UGQB 1WJEA 3CCEQ 4CS2A 2R7WA 5FU7C 5FU7B 1QVFA 1O7FA 3LH5A 1Q81R 3VYHB 3CXCA 4YCVA 3J81K 3UNGC 3CC7T 1X2HA 1OISA 3DEEA 2BKDN 1RACB 5I11A 2M1HA 3BZ6A 2DAQA 2ZGWA 1W5CC 1ETXA 2ZO4A 3FX3A 4E47A 1ZAOA 5DLOA 1YIJT 1JJCA 2X6WA 2K3YA 2GBQA 3WHBA 4Q5WA 5GMKj 4JX5A 1T2KA 1VF9A 3J7YJ 3PCOB 3R0JA 1Z9CA 1KQ2A 2CO5A 2B86A 3QPLA 4Z88A 1WHMA 4JRQA 2RHQB 4RTUA 1FMWA 1ZSZA 3DB4A 3OOPA 1OV3A 3P7NA 2EFIA 1Y0UA 1UJYA 1U1SA 4ZTZB 1TP4A 2Z3YA 1ZGAA 3D5LA 1H9TA 1V5EA 2OTJA 2V1XA 2V1UA 1O75A 2XRLA 2RB6A 1HBXG 2FA5A 1AWJA 3I5RA 3P8DA 4GY5A 4C8QB 3T8RA 2CFXA 2VOPA 1EH6A 2LY1A 2ZXJA 1LB2A 4LD6A 3VQWA 2IGNA 1YIJQ 5IHNA 2IA2A 1N25A 4BHCA 1YYVA 1VQ6Q 2DKGA 2QKLB 3MKLA 1KHIA 4F7UG 2A37A 3ZQLA 2LY9A 2J5OA 2E1OA 3CMMA 3OYIA 2M0OA 1G3WA 4ME7A 1JJ2S 2RM4A 1F9NA 2ZPIB 3RZOJ 2HKNA 2DQRA 5DV5A 5A2QZ 4CHUA 5GAOn 4UB8C 2OF7A 3JAMK 1GBQA 2MCNA 3BW1A 1TXQA 1G5HA 3BDLA 1P4AA 2RO0A 3DTKA 3ZQGA 5DM7F 1IGQA 3CC7A 2GCXA 3CCMQ 5EYRA 2E41A 2DU5A 2HOSA 4OU0A 2WY7Q 3V7RA 2M1BA 2JZ2A 2LQWA 1QNTA 3HKZN 4O5VA 3OYAA 2K9NA 5H20A 4M77E 3N5BB 1G6NA 2LREA 5GAOl 2PUOB 2ZSIB 4EJUA 5GAOr 1K9MU 4HV5A 5EZHA 2NVUB 2CS3A 3DPLC 1OCCH 4CDGA 1RADB 2EFNA 2YSRA 4F92B 4JYKA 3H35A 5BMZA 1VQ4A 1EVKA 1KMNA 4BY1J 2WSFE 1IV6A 1U8BA 4A3BJ 1I8FA 1ITYA 1RAEB 3EGDB 2JTVA 4BY7J 2MD0A 2X51A 2ROTA 4XK4A 1LE8B 1Q82U 1WHLA 4FYWB 4LB6B 3L2QA 2FBHA 4MO7A 2CP2A 3A74A 2VGMA 1X1BA 3A5ZA 1VQ6A 1S72T 5F0HA 4IHWA 4P3OA 2E36A 2HBWA 2LRDA 5J4YA 3BR3A 2QM3A 4C3JJ 1DP3A 4M77F 3DPTA 4XEMA 1WJCA 4I2OA 3NPFA 1PJRA 1FP1D 5GAMd 1LDJA 3GEZA 1JHHA 2CQXA 2CH4A 4CC4B 3CESA 3LLRA 3QO3A 4FX4A 1I39A 1IRFA 5AIQA 1K1ZA 3HSFA 2LJ3A 4PJJA 1RUNA 4Q48A 5HODA 2DFEA 4L9VA 1ZGJA 2ATCB 2PZ1A 2DZCA 4LDUA 4PJOB 2PEXA 1MV0B 2DZ9A 3ZN0A 2JQ7A 2A8EA 4O3MA 4G9YA 3BY7A 4ZZLA 4JQFA 1Y56A 4RAGA 2HEQA 4DNCA 4ZGDB 3SWNC 1RIQA 2E5NA 3H5NA 3M8EA 3QAHA 2DPDA 1R5HA 2ZXWH 2CZ1B 2JS2A 1WPKA 2X3XD 4HLYA 5K7FA 1TH7A 3HL8A 4HXJA 4ZGEB 3CCJQ 3QO5A 2ELJA 2HI3A 2KT0A 4RGUA 4DZJA 1NG7A 1STZA 1VQ6I 2MWOA 3CCEA 2KROA 2XG8D 2Q7GA 4WXHA 1VIFA 4DYRA 3TQNA 4I01A 2KNBB 2QI2A 3TDUC 3JAMZ 4F55A