4HA8A

Structure of staphylococcus aureus biotin protein ligase in complex with biotin acetylene
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structure of Staphylococcus aureus biotin protein ligase in complex with biotin acetylene
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 100
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ha8A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ha8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ha8A02
5E1WA 2CWEA 1FYMA 4RGXA 1RIQA 2A68F 5LJ5g 4YRKA 2O3FA 2V9VA 1CGPA 3EFSA 1I81A 2M30A 4I7HA 5E3IA 1XSVA 3GYHX 2XTIA 5GMKi 2EFWA 2EA2A 2DAOA 1S8NA 3E5QA 4EQQA 4ENKA 4G85A 3WG9A 3EFRA 4OOIA 3P8YA 3QPHA 1PYSA 1YFRA 4HT9A 4JRKA 2M1BA 4XSZF 1T0FA 3L4GA 4ESJA 4TVYA 2ADUA 1QF6A 1YFHA 3J81Z 3JCMf 2FBKA 1FSHA 1FYFA 2FU4A 1I5ZA 5CVRA 2ZT6A 1W7PA 5JI6A 2HNIA 3RKWA 3P8TA 3H3ZA 4EMKC 5LJ3g 2GIVA 3K1NA 1EH7A 3LA7A 1ZRDA 1P6RA 2QBYB 5HDKA 1TLHB 2JRTA 2BEOA 1IN7A 1WKMA 4XU1A 3JCMQ 3GXOA 3M1EA 2IA2A 3D5LA 1WQ7A 3IKLA 2CG4A 4L9TA 4TVAA 5HS9A 1Z6RA 1HW2A 3F3XA 1NJ5A 5A2QZ 3WTVC 1OKRA 3HRUA 1IN5A 1O3SA 3ML6A 4LG0A 4LGWA 3HFZA 3GUDA 5F6FA 4J5YA 2O0YA 1O7LA 4P74A 4HLYA 1UCRA 3P8VA 3QP5A 3ROUA 2DJZA 2AKWA 1FZPB 2BV6A 2Y0MA 2RVCA 5LJ5h 1IRGA 1HC7A 4EGZA 1FBSA 1LNWA 3DV8A 5ICCA 4Q15A 3RIRA 3WTWC 3TEGA 1C0WA 3SWNC 1XB4A 1ZGJA 1H4TA 3F6VA 1RIOH 3CUQC 3MWMA 3SHFA 1TW3A 5DDGA 4P72A 1B4AA 2OA4A 3C18A 1DUXC 2EWNA 1MDMA 1E1TA 4YFKF 4XEOA 2ALYA 1R5GA 4D0PA 4DNCA 3P9IA 1D8KA 2DTRA 1I1GA 1MGQA 2DZCA 4C92A 5HS8A 2JPCA 3KZZA 1E1OA 1MJBA 4MQVA 2I4NA 3LSQA 1YLFA 2E7WA 4KN7X 4PG3A 2CQKA 4PJOA 1D3BA 4H0EA 3JCMe 1YS6A 2D2WA 5LJ3h 2P7CB 3L2CA 4RGSA 2ZCEA 5DEQA 2H27A 2XKPA 5K5OA 3R0AA 4O3MA 2DXTA 3KFUA 2CFXA 5DUKA 1U5TA 2CYYA 3WQZA 2E41A 2LF8A 4EMKB 3MEYA 4MEXF 1TNSA 2Q5IA 4EJTA 4YRPA 2J3MA 4XU0A 2EJRA 4YREA 5JFRA 3KP2A 3JCMW 2VBXA 3COAC 5DUIA 2CJ9A 5HOOA 2J5OA 4BH9A 5H6RA 3UFGA 5CJ9A 2DEQA 5F5WA 4N0AA 2O03A 3B02A 4PCQA 4A0ZA 3KP5A 4BYYA 1O3TA 2GAUA 2BE5F 1ZRFA 4H2XA 4EJVA 1HSJA 3OV8A 4ASNA 1X56A 3MCZA 3WTSC 1S29A 1KMMA 3RJPA 3LA3A 1T38A 2E1NA 1NJ2A 3B73A 2QQBA 3E9IA 5LGUA 3HXYA 3I59A 1S7OA 2M45A 2NS0A 1YFSA 1W7PD 2PMEA 1KQ1A 1AOYA 3WU1B 2DBBA 3K1PA 3F8CA 3QPTA 3I0TA 4K86A 4PJOG 3IG2A 3SWNB 2IA0A 4XTVA 1LJOA 3SFZA 1K78A 1TTYA 2GXBA 1MJ9A 4G6QA 5GANj 2EL9A 3CUQB 3M8EA 5E8GA 2DO7A 4OINF 3BPVA 4CDGA 2V79A 1CF7A 4M75A 2NNYA 3E9HA 1YW9A 2DQRA 3ABUA 5KK1A 2LF7A 2OBPA 1KA8A 1KGSA 2GA2A 4RAYA 4Y17A 1WRJA 5GAN8 1B9MA 3NRVA 4OMZA 1QZZA 2DTIA 3QUIA 2ARSA 2YX4A 1JJCB 1BOAA 1BI2A 4G6DA 2ZBKA 2HWVA 4HWRA 1I5LA 3A7AA 4Q47A 2W25A 5LRSA 2YU3A 2XIGA 4P74C 3FIFA 1OMIA 2EFNA 3K9TA 2P6SA 2ZNYA 4UVAA 4P9FA 3E3VA 2GWRA 2P7VB 2ETHA 3EYYA 3DQVC 4RS8A 5E8IA 1USYA 3ZMSA 3E6CC 5GAOp 1YB3A 1WSUA 1QPMA 5GANd 3A5YA 3NQOA 2OQRA 1K79A 2MH2A 5JHUA 3N97A 5DCMA 1RNLA 3SB2A 4P72C 4HF1A 1ASZA 2P5KA 1U1TA 1NNHA 2QHVA 2R3SA 2IW5A 5D5XB 2CJBA 1FP1D 2KRFA 4GYGA 3L7WA 1EH6A 3JCMX 2Z33A 2Z9OA 2I2LA 4UV8A 4M75G 1EH8A 4L9VA 4C92C 4PJOD 1H4QA 2XAQA 4EVIA 2F5CA 1WU7A 2DVEA 2O8XA 4M7AA 3QSUA 1PYSB 2VE9A 4N0BA 2ISYA 2QHTA 4YROA 3A32A 3E97A 3FWEA 1FNNA 1X3UA 5LHHA 1B34A 3L4GB 3K0LA 3WGHA 1K6OA 1R58A 3R6SA 1TBXA 2FBIA 2RNJA 4JQFA 1W7PB 4KUMA 1GHCA 1U5TC 2PEXA 3LSTA 4A5NA 4M9SA 4A6EA 3TO7A 3GW2A 5DD8A 3HHHA 4RCBA 4PHCA 2VOOA 1BI3A 1U3EM 3BP8A 3F6OA 5BPIA 4WXHA 4K88A 2XKOA 1SFUA 1ON2A 4TVAB 4G7HF 1L3LA 4Q48A 1BI1A 1H4SA 2M87A 2P6TA 5GAMh 3W6KB 4CXFA 2DK8A 3EDPA 4M7DD 3HFZB 4M7DE 3ZMZA 3QP6A 4F7UA 1X54A 1ZH5A 2CGPA 1SMTA 3T8TA 2ZCWA 3CMQA 2IRFG 2R7FA 3QO5A 5L3DA 2COMA 2AKWB 3KE2A 3H92A 4FT8A 3DXJF 1XSXA 3LQQA 1ZN2A 3WODF 2HTSA 2Q7HA 4UVCA 4Q6GA 3K69A 2K02A 4B09A 2R7DA 2NYXA 5F64A 2HQNA 4DQ2A 4YRSA 1EOVA 2I4MA 2DTOA 1Z91A 4LLLA 2RHQA 1HKQA 1VTNC 2ZZGA 3P7NA 1IXRC 1MDMB 4M75C 2DU9A 2ALYB 1ADJA 4M78A 4U7BA 1ZG3A 1V3FA 5GAN4 3ECHA 2ARTA 4TQDA 1J7KA 5LBQA 2V1UA 3GLXA 1MKMA 4C92B 1GXQA 5FFZA 3FMRA 4PNOA 1G3WA 1HW1A 3DEUA 3HYIA 4GYIA 4AH6A 1XD7A 3HSFA 3SZPA 1STZA 2BGCA 2QYOA 4A53A 2FB7A 4M7DF 4PJOB 4H2YA 1D3BB 3QOPA 3RTRA 2XAHA 5FLXZ 3SZTA 2NAZA 1XDSA 1BBYA 4XQ3A 1WPYA 5ELNA 4JLIA 4MEYF 3J80Z 3NEUA 2OD5A 2W24A 4ZZDA 4YRCA 3QO3A 4NCXA 5H6QA 3TGNA 4YFNF 3JB9J 2ZGWA 2VBWA 2UZKA 1B76A 5L3GA 3HOSA 3HOTA 1LDDA 4BQAA 4BHPA 4A5MA 4YDQA 3F8FA 4BNCA 3V8LA 4YRIA 2DKGA 4AD9A 2HKOA 4EGYA 5GANf 4H2XB 3Q5FA 4U0VA 4NOYA 5C51B 5BOXA 4KQEA 1DPRA 2EV6A 1MGTA 3TDUC 3IC7A 3NELA 1WQ2A 4UXNA 4XEMA 1EV7A 3FB9A 1P2FA 5GAN7 2I4LA 1YS7A 4M7AC 2HS5A 2Q2EA 4LJZF 4GXOA 3T0YA 1ZG1A 4AIJA 2JN0A 3Q9SA 2JPBA 3ABTA 1QZYA 1U6GA 1SETA 4I02A 2IY5A 2J5PA 2H6CA 5FD5A 1HKTA 2EFOA 1U78A 3L2ZA 1KQ8A 2QM3A 3LC0A 2PI0A 3VQXA 3D0SA 1UB9A 2M5WA 2YLCA 1JHHA 4KIBA 4XRFA 5CLSA 4LB6B 4MTEA 5FFXA 1K7AA 1WLEA 1E17A 2ZTGA 1J75A 4MGRA 3A7RA 4R8HA 4RQEA 1CF7B 4M75B 3U9GA 3GZ6A 3FMQA 2EFQA 3I58A 1D3YA 4O2DA 3FX3A 4ZH4F 1UHMA 2PG4A 4IRGA 3HRKA 4YRGA 2FXAA 3RYPA 3RPUA 2HTJA 3PFIA 5GAMd 2PMHA 2NRAC 3JAMZ 3VQWA 1TQIA 3CLOA 4HZFA 4HWPA 3BY7A 3KZYA 4AWXB 1B7YA 1KOGA 2E7XA 3IL2A 3K2ZA 4KT5C 1HBXG 4ETSA 3G3ZA 4P96A 4MMKA 1LB2A 1HW5A 1ATIA 4S05A 3I4PA 3ZN1A 4HLXA 5EEHA 1B70B 1N9WA 4HT8A 4ESBA 3BDUA 2F5DA 1ZARA 2ZJ2A 1P4AA 4P3PA 1SD5A 3RYRA 2RQPA 3IALA 1R00A 1KQ0A 1HKSA 5DCMB 1DP7P 1OYWA 5AIPA 1Z6TA 3IRQA 4YRQA 3E5UA 4HAMA 2K57A 5GANe 4M71A 4M78C 4WF2A 4EJUA 2L4MA 4LFUA 1VQZA 3CUOA 4HF2A 1OYIA 4MQ9F 3V7SA 4HQMA 3WGGA 2FSWA 4I0BA 3BDDA 4LB5A 3I53A 3JB9G 1X55A 3R0JA 1ZHFA 3QU6A 4HX7A 2DI3A 1P4XA 2VT3A 3RERA 4NHJA 1FX7A 2ZINA 3VOEA 3Q9VA 4KICA 2PMUA 5LLQA 4Z2YA 2OU2A 2FEZA 2ISZA 1D8JA 3VEPA 3SQNA 3JCMg 1G3TA 1IXCA 3HUGA 1SD4A 2XRNA 5GAOq 3VB2A 2Z99A 1YTYA 2CJAA 4LD5A 2E64A 4YRFA 2ZO4A 3LWFA 4LK0F 3JSPA 4PGHA 5D8LB 1Q1HA 2E1HA 3BWGA 1B8AA 4EM2A 1S6LA 2MC3A 2EA4A 3TEHA 4RAZA 4GO1A 1TNTA 1ODDA 4RB0A 3ZMDA 1TH7A 5K1XA 2HKXA 5LGNA 3HXVA 1B59A 4IHTA 5CYVA 4WXCA 3HSRA 3LAPA 3BJOA 3E6MA 2IT0A 4I0AA 4N9IA 4L0YB 3GX4X 2KJCA 3FM3A 3C3WA 1O3RA 5J6XA 3IRRA 3DFGA 1W5TA 5F1RA 3F22A 3G1ZA 3KP6A 3L9FA 2ZXFA 1ZGAA 4I09A 2XAFA 4KDPA 4H2SA 1G5HA 4KFCA 4CZZA 2GZWA 4TV7A 2ZIMA 2K86A 2CO5A 3VQVA 2D1VA 3ERED 4TQFA 2FBHA 3V7CA 3JB9D 2GA1A 4UNOA 2RHQB 2VXFA 4YRLA 2P5IA 1R5HA 4AIKA 4BAYA 1ASYA 2ZMEA 5E1XA 3F23A 4M78B 4XBFA 5ICGA 4YP0A 2GXGA 1H641 1KQ2A 3GIBA 3PQJA 4BWAA 4U0WA 2PBIA 5LEKA 1T39A 1I8FA 2E3CA 2Q7GA 1XMKA 2EJFA 4DPGA 3KCCA 3KLNA 4RGUA 4BW9A 3JAMK 2OZ6A 2PFBA 3JCMh 2VBZA 4C92G 1B1BA 1FY7A 5BS6A 2IVMA 2VOPA 4H02A 3DPTA 2UXNA 3BPXA 4RDXA 5L3FA 3J81K 3MF1A 1X2HA 2UXXA 2EK5A 1ZREA 2EFPA 2Y90A 3JB9H 3L09A 2DQ0A 3NEMA 3AAFA 1H0MA 3GVAA 3QAHA 5FGMA 1FYKA 2QTXA 5I21A 2WV0A 4M72A 5GMKm 3TOAA 1UFMA 3GWZA 3L00A 4KA4A 1Y96A 1LEBA 1Z7UA 4HW0A 4FHTA 1JRIA 3M8FA 5ILUA 3JB9F 4M77A 4I01A 1LOJA 4BXUA 1YCYA 3IWZA 4WXDA 3RPQA 4QVCA 3JCMP 2XUBA 5A2QK 4KMFA 1QQIA 2YX7A 3HRIA 1G3YA 4YRJA 2K27A 3ERRA 3PCOA 1NJ6A 5LGTA 2D45A 3FHZA 1LYLA 1KU3A 1DDNA 4N9HA 1QNTA 5LJ5d 2XVCA 2W84A 2ZNZA 1REPC 1EIYA 3RGLA 3HFVA 2IY5B 3KP3A 4CH4A 2FE3A 4M74A 1ZG5A 1J2XA 2VC0A 2ODRC 2JZYA 1LJ9A 5D4SA 3RKYA 2ZR2A 1FP2A 4C8QA 2Q7EA 1G4DA 1B9NA 1KYWA 2Q8KA 2A07F 4UUVA 1FOKA 5DYMA 2QVOA 4C92D 4XTYA 1Z7NA 4C92E 5D4RA 4Y15A 5LRRA 4J6XA 3T5XA 4L5IA 3I7FA 1HSTA 5IT9Z 3DPLC 5GAN2 2QBYA 2AS5F 1J59A 3FXRA 4AIHA 3LQRA 3MZHA 4PJOE 1O3QA 1LDJA 2ACJA 3A7UA 5HLIA 5E17F 1KU2A 2BBYA 3NETA 3MEXA 2A3SA 1XCVA 4CO8A 4WJ4A 5BQTA 3IHUA 5BMZA 4A6DA 1QE0A 1B7YB 5C52B 3HFOA 2GQQA 5LJ3d 3M9AA 2VC1A 4HV5A 5GAOm 1G51A 2YLBA 3LSSA 3F8MA 3O6BB 2HQRA 3ZMTA 3RUXA 3T1BA 4EJOA 1B6AA 1RZ4A 3RF1A 3MAJA 3IWFA 4X5OA 2G7UA 3PGGA 4NL3A 1S3JA 2O61A 1YGBA 3FM5A 4Y13A 1GGMA 4E70A 4YFXF 3DKWA 1BC8C 3CTAA 2DU5A 1W5SA 1KMNA 3GEZA 4M9ZA 2QLZA 4WCGA 4TWAA 1XGMA 1UHWA 3V8KA 2RHSA 3EETA 2H6BA 4RQFA 1G6NA 1F5TA 1TQPA 4G84A 3I71A 4C92F 3WE3A 2DDZA 2XV4S 2P5VA 4EV0A 4OU0A 2JSCA 1SMYF 2RM4A 3ZQ7A 5GAN6 3HRMA 4LG0B 4YCWA 4PJOF 3BJAA 4EM0B 3HY1A 1FBQA 3TOBA 1XN7A 3CO6C 5L3EA 1WYDA 2DXUA 4EO4A 4YRTA 1XGNA 4YG2F 5CAIA 4M7AG 2ZT8A 1R7JA 4JK1X 4J6WA 4EX5A 4LLGF 4ENMA 1G5IA 3KETA 4GCVA 4XLPF 3MF2A 1RUNA 4M75D 2EAYA 4M75E 4YCVA 2ZNJA 1LQ1A 2XGXA 4X9DA 4L5JA 4PZJA 3V4GA 5AONA 2VE8A 4R1HA 2UWMA 3TEHB 3BZ6A 1MJAA 4M77C 3JW4A 2ESHA 3REXA 3RL6A 2L3DA 3GZ5A 3LFKA 2A61A 4EMSA 3TDZC 4HWSA 3FZVA 4CS3A 4L0ZB 4WI1A 4ZYEA 2CW0F 4L9JA 2J3LA 3QTCA 4J15A 3HSBA 2QHSA 2RD1A 1IUYA 3T8RA 1EVKA 2DU7A 5FO5A 2YHTA 2Q5HA 2KIMA 2IPQX 3EYIA 2DZ9A 5GMKe 2ZNIA 1T6SA 1BI0A 1O7FA 4IRIA 1PUEE 4F7UG 1YIOA 2Q0OA 3BJ6A 4G9YA 1SERA 3UH0A 1U5TB 1XSDA 2P8TA 3HIFA 3QRFF 2E10A 3HTZA 4CS2A 2W85A 2ZZFA 3GF2A 2DFIA 2QENA 4IHSA 3HXUA 4C8QC 4M75F 4OIRF 3KEOA 3BW1A 1PDNC 3DP7A 3C7JA 4BHCA 5ILSA 4WJ3M 1ONVA 2A5YB 3IKVA 1U8RA 2ZMEB 2XHKA 2VONA 3HFNA 5HVQC 2YR2A 4M7AD 4HYEA 4WK8F 4M7AE 5BPDA 3I64A 3UGQA 4L9NA 1M8VA 3UGTA 2ZFWA 5FD6A 4M78G 4IF4A 4BHBA 3VODA 3QHSA 5GMKl 4HBLA 5GAMj 4UHTA 4L87A 3I59B 1BIAA 1KYZA 2FF4A 4UP7A 2RGVA 3M4QA 4CYDA 1W66A 3CO7C 2DT5A 1U2WA 4P3NA 3MQ0A 3N4MA 2CGHA 4KYWA 4LK1F 4LMYA 4U7DA 3TKYA 1T98A 1WQWA 2HFHA 2PQ8A 3ZN0A 1MZBA 1K78B 4QLCU 1LEAA 2FQ3A 3C1DA 3MFKA 1IAWA 2MBFA 2HYGD 1P4WA 3WGIA 4UVBA 3TO9A 1Y96B 5H20A 2IP2A 2XROA 2FOKA 1XGSA 3OOPA 4G8XA 4Q5SF 2C8MA 1IRFA 4O6JA 2IJLA 4PGGA 2ZR3A 1Z7MA 4F7UE 4EMHA 5GAOr 5E20A 1JE8A 1J9IA 4M7AF 1U1SA 4EMGA 2PMFA 2PLYA 5GANg 5HS7A 1C0AA 2YSRA 1F4KA 3PCOB 3E6DA 1R1UA 2LNBA 1Z1DA 5D5WB 2RDPA 1F1ZA 4HDVA 3QNEA 1EFWA 5DCFA 3GFIA 1KQ9A 2WC2A 3E6BA 1SD7A 4EM1A 2MD5A 4WWCA 3FF5A 6PAXA 2EV0A 2HEOA 2L02A 2DK5A 2TDXA 1EIYB 2FNPA 4P3OA 2EV5A 4KMUX 4G94A 5ED4A 1TQMA 5D6FA 3IKTA 2STTA 1OR7A 3RKXA 5CVUA 1IZ1A 4M78D 4M78E 4C8QB 1Z05A 4XTZA 2DW4A 5LJ5e 3I54A 5ERIA 3RESA 3GO5A 3REOA 4HVCA 2RA2A 1FSEA 2LDUA 3S2WA 3JCMJ 2P5LC 3M4GA 1OPCA 3A74A 1E2XA 5GAOl 2ZT5A 5GMKj 3EUHA 4G7OF 3IKMB 4F7UF 2Y48A 2QZ8A 5CVJA 4ENJA 3R07A 4OIOF 4M7AB 3U1DA 4MNUA 3HXXA 4OMYA 4R79A 1S7AA 1B34B 4A0YA 4A2UA 2H94A 2DPDA 5FLXK 5DV5A 4HF0A 2KJBA 5J8CA 1RUOA 4B8XA 2RN7A 1AWCA 3J80K 4YPFA 3HSEA 3WTYC 2QQ9A 3AHUA 1ZLJA 2FYKA 1ULYA 3ZP5A 3BJUA 1BBUA 5LJ3e 3WE2A 1DPUA 3P9CA 2D1HA 3P9KA 1OYYA 4IJAA 5ELOA 2AXLA 5J8FA 4M78F 2ZT7A 4H2VA 3SXYA 2RHSB 5GANh 4L18B 2RC4A 2L01A 3VU3C 2F5FA 2VBYA 1LNXA 3HXZA 2HR3A 1SRYA 2X0LA 3FXUA 4JRIA 3KP4A 3O2PE 4CHUA 1USSA 4QWQA 2C6YA 2MLGA 2C7IA 5HGQA 3A31A 1NJ8A 3RACA 2H09A 3R61A 3GFJA 2V1DA 3JTGA 3QU3A 4F7UB 4ESFA 1JHFA 1FWZA 1R1VA 3PZCA 4Q4ZF 1WWXA 1XMAA 3WTZA 1QO0D 3BY6A 3BFMA 5ILVA 2CIMA 2IA1A 4YYEA 2FA5A 1YW8A 2PN6A 4KR3A 4LLNA 3M4PA 2V6CA 3F21A 2VXEA 3REUA 1FPQA 1IN6A 1IW7F 1SFXA 4RCCA 2VN2A 1ZRCA 3ECOA 4NQWA 4YIIA 1D5VA 2DPUA 2HZTA 4CGZA 3FMSA 1SESA 3LA2A 2Y75A 2A6HF 3I5UA 3MZYA 3OD1A 5CVIA 1N9RA 1Y0UA 5K5RA 2VT2A 3NENA 2OQGA 2W57A 3VQYA 1FC3A 1N9SA 2AMCA 1LVAA 1P92A 1JBMA 4HOBA 3GFLA 2RV8A 2VXZA 4U0YA 3KFWX 4XU2A 5L3BA 4ZIBA 3RI4A 4M9XA 1E24A 3W6JB 1PP8F 4M6XA 3JCMc 5GAOn 3DSQA 4P73A 4ZYGA 3HTUA 1USTA 2ESNA 1H4VB 5LJ5j 5D6EA 3HXWA 3G73A 1IL2A 4UPAA 4JBAA 2WTEA 5GAMf 2ARUA 1HTTA 5CVVA 4UP8A 4HWTA 4XLNF 2EJ9A 1BC7C 2QUFA 4M7DA 4CS4A 1XCBA 3QO7A 1J0RA 5LHIA 1KU7A 2E65A 4CH6A 1SFEA 3ICAA 3HRTA 3JTHA 2ELHA 5EEGA 4HDUA 1WNLA 1I27A 1H9GA 1F9NA 1I1SA 3O3KA 1JGSA 4RGRA 2F5EA 4Y91A 3CDHA 2OZUA 5HDGA 4A0XA 1O57A 4A54A 3CJNA 3HTSB 5ICFA 4H2TA 4FX0A 3QO8A 4OIPF 5L3CA 5LJ3j 2ODRD 4XTXA 1L0OC 1YG2A 1PP7U 2XASA 4AVPA 2FNAA 4KN4X 4XU3A 2ZKZA 5FB2A 2K4JA 4P55A 1IF1A 1G3SA 1HQCA 1M5Q1 3R4KA 1ZLKA 5GAMg 1X01A 1W4MA 5GAN5 4ENNA 1YYVA 4S04A 4IVNA 4RB1A 2PJPA 1B70A 1FT9A 5GAN3 4OIQF 4M7DG 4M73A 1IXSB 2DQLA 1YQAA 1EQRA 4NB5A 2CSOA 2FRHA 4XTWA 4MTDA 4YRMA 2JTVA 5JVTA 2HOEA 3JSOA 2A69F 4ZTZB 4G7ZF 3ELKA 4M77G 2VODA 1XGOA 4CH3A 4HX8A 1KU9A 2YPRA 5DD4A 4J6YA 1GVJA 3R60A 3BROA 5HLHA 1HXDA 3W3SA 4ZZLA 1I6XA 4UV9A 1NJ1A 4I98B 4P75A 4CICA 5K1YA 3M7GA 2Z5UA 1FYLA 2V1XA 4P71A 1JXSA 3JB9I 5GAMe 3F8BA 1YO5C 3ZPLA 1MD0A 3BOQA 1IN8A 4HWOA 2FMLA 4PJOC 5HDNA 5ICEA 3VBBA 12ASA 3V8JA 5K1PA 3JCMV 2RB6A 5D5VB 4H2UA 2A6EF 4YCUA 1ZAOA 1NYQA 5TJJA 1ADYA 4E51A 1YW7A 4U88A 4IXAA 2G9WA 2HGCA 4K2EA 3TQNA 2E5AA 4K87A 1BJAA 1L0WA 4C8QG 4HV6A 2O6GE 4OLFA 1I4K1 1QBJA 3FXQA 5IT3A 2B0LA 2E1CA 4I2OA 1TW2A 4XTUA 3WTUC 5AIQA 3JCMb 1T2KA 2ZXJA 1ON1A 1FLIA 2I4OA 4N0AC 1YFTA 1A04A 3JCMd 2G4CA 4P5OA 2L4AA 2OAZA 1BM9A 4IPAA 2L54A 3RDIA 3HY0A 4JUVA 4IRHA 4YIFA 4P73C 4F7ZA 1HK9A 4ON0A 2DLLA 5K5QA 2XAJA 4KIGA 4MHGA 4KIFA 4PDKA 4X9CA 5E18F 5KVRA 4M77D 4M77E 1NHAA 2VC8A 4M7DC 1X2GA 5D5UB 5D8KB 4WX9A 1R36A 2EJGA 3WTTC 5HLGA 4EMKA 1H9TA 3E5XA 1NYRA 4EJWA 2KIFA 3V7RA 2EB7A 3PQKA 2HDCA 4M6YA 4GGGA 2QQAA 5DY9A 4TVWA 2ZZEA 4TTVA 3GFMA 4P9UA 2LKPA 3U2RA 3KLOA 1FBUA 3VFZA 2WWYA 2ZIOA 3KP7A 4V2SA 4NL2A 1J5YA 2Z3YA 4HQEA 3HRSA 1BIBA 3KEQA 4CH5A 2JT1A 4H2WA 2G7HA 5LEJA 1V4RA 3F8NA 4O5VA 2K7LA 2BYVE 1R23A 4C8QD 4C8QE 3WU0A 4YRNA 3K1MA 2DTHA 4UP9A 3L1AA 5TRDA 1QGPA 2DQ3A 3A5ZA 1EVLA 2MH9A 5E1ZB 4M77F 1USYC 3F72A 2QWWA 3H3UA 3SWNA 4YRRA 4HA8A 5LJ5f 2LSOA 3FJPA 1LDKB 4OP0A 5IT9K 4RB3C 3ISPA 1R22A 2MLKA 2P4WA 2RKHA 3CUQA 1J5WA 2AMCB 2M8EA 1RI7A 1XDUA 2MA3A 1GXPA 2KKOA 4KR2A 4XSXF 4ZTUB 2QHUA 4QVDA 3TUPA 4KNYA 4ZYHA 4RB2C 5LHGA 4A12A 5GMKh 1WI9A 1BBWA 1BN5A 3DF8A 1SD6A 1ZYRF 11ASA 1JJCA 5KNNA 4P75C 2STWA 3EQLF 2NNNA 4RMFA 1SAXA 2KIUA 5JR3A 3J7AO 4P71C 3ZMUA 3ZMVA 2P0LA 3LAJA 2X4HA 4ZYDA 3TO6A 4LNSA 4C8QF 2F2EA 3ULQB 2HYFA 4MMLA 1E22A 5C53B 3WTXC 4M7DB 2XAGA 1IN4A 2K4BA 5LJ3f 3HHGA 1R1TA 4HX4A 4FX4A 1Z9CA 2XGTA 4M77B 3INZA 2FMYA
chains in the Genus database with same CATH superfamily
2CWEA 3J80E 5LJ5g 4DBQA 1M9SA 2ECCA 2V9VA 3QDRB 1CGPA 1QPIA 3THKA 4I7HA 5E3IA 1KC8U 1VQNT 2IS4A 3EHRA 4HSTA 2EA2A 2DAOA 3E5QA 4G85A 5HLTA 3EFRA 4OOIA 3QPHA 3EGDA 4QPQA 2LH9A 2KT8A 2QK0A 2M1BA 3PO3J 3J81Z 1R9TJ 3JCMf 3AL0B 2FU4A 1Q86R 2ECZA 1TP4A 1RESA 3S17J 3RKWA 2E1MB 1IB8A 1ZRDA 1P6RA 2YT6A 3VYRB 1TLHB 2BEOA 4HPQA 1BBZA 1WKMA 3JCMQ 1WQ7A 2CG4A 2F2XA 1AVZC 4TVAA 3BDLA 1NJ5A 4BD3A 3H1CA 3ML6A 4LG0A 3HFZA 2CS7A 1VQPI 2V1NA 4J5YA 2O0YA 4P74A 1UCRA 1BR1A 3P8VA 1OFCX 3ROUA 4JX5A 4EGZA 3CCUA 3SWNC 3BT9A 2VJ5A 1YP5A 4A4EA 1TZLA 1RIOH 2HXIA 3H8ZA 1RUWA 4P72A 3E1SA 2EWNA 4YFKF 1R5GA 3SEMA 2DTRA 1MNMC 2EYQA 5F08A 2QYZA 3TU4K 5HS8A 2CYZB 1SVOA 2BHYA 3KZZA 2JWTA 3CCSQ 2ZSIB 2I4NA 5GADJ 2TCTA 4PG3A 1I5OB 4PJOA 3JCMe 1N8RC 1SF9A 3KYCB 3W6VA 2P7CB 1YJWA 2DFUA 5FLVA 3MEYA 4MEXF 2DBMA 2Q5IA 1SC7A 2GLOA 3COAC 1VQ6I 4BH9A 2HPMA 2WSEE 5DTDA 3BG3A 3B02A 3VYTB 2ENMA 3OYAA 3KP5A 4BYYA 3K4JA 1YJNQ 2BE5F 3OV8A 2EGCA 2KDOA 1X56A 3MCZA 3QKJA 3WTSC 4HKEA 1S29A 1N78A 2CUJA 3B73A 3E9IA 5LGUA 3HXYA 3TQ7P 1S7OA 2M45A 1W7PD 1AOYA 5KE3A 3AG2H 2ID6A 3K1PA 3F8CA 3A5ZB 2JMAA 1BJZA 3I0TA 4K86A 4PJOG 3SWNB 2ECBA 2NOGA 2DIQA 3M3YJ 3M8EA 5E8GA 4CDGA 1WHJA 4M75A 3E9HA 2DQRA 3OSVA 3NTKA 1KA8A 2NVYJ 3FKJA 2GA2A 4RAYA 1WRJA 5GAN8 4A63B 3HL2A 1Z3XA 3A98A 1BI2A 1IXDA 2FG0A 2EFIA 2R7ZJ 3ZQQA 2OTLI 1OMIA 2CUZA 2P6SA 4V2GA 2R5ZB 2P7VB 1M3CA 1HCRA 5E8IA 2NUTB 5GAOp 3A5YA 2HKQB 4UC4A 1WHUA 2MH2A 3N97A 2XRLA 2VPLA 2P5KA 2QHVA 1KIKA 3L7WA 1EH6A 1VQPA 2Z33A 2Z9OA 4M75G 1EH8A 4C92C 1Q81R 4JLGA 2M9HA 2H8WA 2F5CA 2DVEA 1QCOA 3QSUA 1Z3YA 4N0BA 2ISYA 1M4ZA 1P7IA 2QHTA 1X3UA 3L4GB 3M4OJ 1WJ5A 5FJ8J 2QKMB 2PZ1A 4JQFA 1W7PB 2PEXA 3LSTA 4XN3A 2K4YA 3TO7A 3GW2A 5DD8A 3HHHA 2OCEA 4DW6A 5C4JJ 1K8AR 3JRFA 4WXHA 1NH3A 2YWWA 4IUUA 3ZQLA 2XKOA 2ZMEC 4NC7A 3G6ET 1VF9A 1L3LA 4Q48A 1BI1A 1H4SA 2M87A 2P6TA 3CCMI 1JJ2P 3W6KB 1WYXA 2L7KA 3EDPA 2BZYA 1MMSA 1QVGA 2ED0A 3QO5A 3OYGA 1JKOC 1AWJA 2COMA 4C0DC 2AKWB 3KE2A 1OCCH 2BE9B 1M90R 5GAHJ 1VQ6A 2H3EB 4Q6GA 2NVUB 2R7DA 3PM1A 1V29B 2HQNA 1EOVA 4ZGDB 4LLLA 1VQOT 1HKQA 1VTNC 1WJRA 2EGEA 9ATCB 4PJ0C 1ZG3A 2V1UA 4AYBA 1MKMA 5IPAA 4C92B 2F5TX 1G3WA 1HW1A 3DEUA 3HYIA 4AH6A 1XD7A 2BGCA 5AYFA 1F1BB 2QYOA 1ETOA 1J09A 1SEMA 4M7DF 4HEA2 1D3BB 1FOXA 2XAHA 4ANJA 2NAZA 1QKXA 2OJ2A 2WY8Q 1Z9ZA 4XQ3A 4JRQA 3DLAA 2EIFA 2WB1N 5HCKA 3VSLA 3OWTA 1VQ8T 1ORKA 5FROA 2B86A 1YHQT 2F5VA 4NCXA 5HKCA 4BY1J 4YFNF 2HXOA 3MPUB 4A69C 1B76A 1WHLA 1QWFA 4A5MA 4YDQA 4XM3A 2YUOA 1JUSA 4H2XB 3PUBA 3RZOJ 4X6AJ 2OTLA 5BOXA 2CZ6B 4KQEA 3LSHA 1Y39A 1UB4A 1WQ2A 1EV7A 5CKFA 5CCAA 5GAN7 2X6YA 2I4LA 4M7AC 2K2VA 4IOAF 3OYEA 4AIJA 3Q9SA 2CP3A 2VGMA 4A3JJ 3G6EA 1VQ4T 3QQAA 1QCNA 1Z7LA 1VYTA 3L2ZA 2PI0A 5CR2A 1QHHD 3H3VK 3UA7A 2YLCA 3W2AA 2ZTGA 4R8HA 1I6HJ 1UJ8A 3GZ6A 3FMQA 4FL6A 3QYGB 3FX3A 2W1OA 5EGOA 3HRKA 5DLQE 2ZB9A 3M8JA 3RYPA 1TWBA 3RPUA 2HTJA 4RA2A 2KPMA 1IO6A 3CLOA 4HZFA 3CCYA 3KZYA 2EZIA 2RK1A 4H4KC 3BG6A 2KDZA 5KHDA 2LC2A 4P96A 4MMKA 4JPBW 2K2MA 1ZHIA 3V42A 1W4SA 2PJRB 3BDUA 2ZJ2A 1P4AA 1TWAJ 3RYRA 2RQPA 5EG0A 3OSGA 2FZKB 3PO2J 4QVZA 1HKSA 4N4HA 3IRQA 3E5UA 1WHHA 1DP3A 1UHFA 1E3HA 5FRNA 1WXTA 3CCMA 4C2MJ 1O4XA 3ZL7C 3HC7A 2K3YA 4E6RA 4HQMA 2FSWA 2KRNA 1AWWA 3N5BB 4BGDA 2E1OA 2JUCA 3JRGA 4HX7A 2RI5A 2DI3A 1KD1R 1VQNQ 2CDTA 1YCSB 2LOOA 1GFDA 3L2VA 2AHQA 2OU2A 2FEZA 4RMOA 3SQNA 2J05A 3JCMg 3RQ4A 2LY1A 2L2PA 3Q3SA 3QZ9B 3JSPA 2KMUA 2E2HJ 2E1HA 2KISA 1B8AA 1S6LA 4GO1A 1ODDA 1UEBA 4RB0A 4A3LJ 5K1XA 2XHCA 3HXVA 4IHTA 4FISA 3LAPA 2DK3A 3CDLA 5KNLA 3BJOA 3E6MA 1ZR2A 1YIJI 3GX4X 2JN6A 2KJCA 3C3WA 1QRYA 1V54H 3L9FA 1U06A 4I09A 2X4WA 1Y0NA 2RAEA 2E60A 2CO5A 1RL2A 3VQVA 2PUKB 9ANTA 1O9SA 3TEDA 4EDUA 3JB9D 2VXFA 1R5HA 4W97A 3I35A 5GPAA 2DJQA 5ICGA 3HJEA 3GIBA 4BWAA 2PBIA 1T39A 3DU5A 2EJFA 4BW9A 4IHVA 2PFBA 1JKPC 2VBZA 6AT1B 1B1BA 3DPTA 1V5EA 1D0YA 2O9SA 2Y90A 3L09A 3J7AY 2DQ0A 1F36A 1LFPA 2K3FA 3OBYA 1WI7A 3GVAA 1FYKA 5I21A 2VVKA 5HNHA 2F69A 1UFMA 2DYSH 3G1JA 1Y96A 3QYEA 2KRCA 1YCYA 4WXDA 1W0UA 3NTHA 1V55H 1JO8A 1N6AA 2K9MA 3E9FA 2K27A 3ERRA 1NJ6A 1FOYA 2D45A 1KQSS 3FHZA 2E2IJ 1KU3A 2Q2EB 3CC7T 4ITVA 2OTJT 5GJVB 4M3EA 2X1CA 1REPC 1FMVA 3RGLA 1SRLA 2FJ1A 4M74A 1J2XA 2DL4A 2JZYA 4OF1A 3BQZA 3B6CA 4XR6A 4B48A 2QASA 1FP2A 4XK8E 2Q7EA 1D1AA 1B9NA 3IAM2 5DYMA 4C92E 4L5IA 1HSTA 5IT9Z 2COBA 4MDWA 1J59A 1X2QA 3MZHA 1KFZA 1LDJA 5HLIA 5E17F 3EPZA 1XCVA 4S0HB 1AHDP 2MGQA 1B7YB 3HFOA 3M9AA 1HDPA 5J4VA 1YE9A 4HV5A 1G51A 3OYLA 3LSSA 4QPOA 1ZSZA 2LYCA 5KYUA 5KYYA 4X5OA 2JJ9A 4E70A 3DKWA 3DLLA 4M9ZA 2QLZA 4WCGA 4TWAA 1UHWA 5J26A 1VNDA 2BXYA 1G6NA 4HG2A 5IP9J 2KHMA 3I71A 1DGRM 2DDZA 4E7HA 3PIOA 4J9FA 2HNHA 1T08B 2HQHA 3HRMA 1LFUP 4M3FA 1OOTA 3FBIB 1RLQC 4DGWB 4EO4A 2LCSA 2DA3A 4YRTA 2M0CA 4HCZA 4EX5A 4KH0B 2RI2A 3PIPA 2XDBA 2DMPA 4HCCA 2ZNJA 3C2BA 2L3RA 3VS6A 4QW2A 3VKIA 3RBBB 2DT6A 2OTJA 5AONA 2JUGA 2UWMA 2P4RA 2XB0X 1Q7YR 3TEHB 3LW5E 4M77C 4J83A 4EMSA 3M5AA 1H3HA 3FZVA 4YRVA 2RO0A 2CV1A 4HNTA 2RHZA 3ZQCA 2QSGX 3HSBA 4LUDA 2LJ1A 3LSMA 2YHTA 1K4US 1KHIA 2KIMA 3EYIA 3D5RC 5GMKe 4C3IJ 1O7FA 2L9NA 2FPDA 1DU6A 3G6EQ 3A01A 4F7UG 3HTZA 4BJTA 4YTLA 4XLAA 2HVQA 3RDVA 2KLOA 3IKVA 2XHKA 2VONA 2ZCFB 5HVQC 4WK8F 4M7AE 2CRGA 3UGQA 5FD6A 5E3OA 4C5EA 1EA3A 1VQOQ 5GMKl 4HBLA 2X9HA 1AA7A 1BIAA 4UP7A 2DT5A 1U2WA 4P3NA 3GZNB 3MQ0A 1OV3A 4KYWA 3EFOA 1T98A 3ZN0A 1MZBA 4QIWN 1K78B 3HOWJ 1ZKGA 4AVZA 1IAWA 4IHYA 3TO9A 4UVBA 5CQGA 5FLXE 1TUCA 1XGSA 3FC3A 1MUZA 2XSDC 4IKFA 2FO0A 3AKZA 4O6JA 1VQ8Q 1YHQQ 1JXOA 1SG5A 1XJWB 4MLOA 2DX1A 5E20A 1J9IA 1G59A 1C0AA 5D5WB 4HDVA 2WC2A 2MD5A 4WWCA 2FPFA 5I2MA 3FF5A 6PAXA 2HSEB 1BK2A 2EV5A 4KMUX 1TQMA 3IKTA 2CP2A 5CVUA 1IZ1A 2KMTA 2AZVA 4M78D 4XTZA 2DYBA 4FYXB 1VQ4Q 3PVQA 4GRIA 4J00A 3CF5F 2P5LC 1OPCA 2KT0A 1NJIU 1LPQA 5GAOl 5GMKj 3EUHA 3VS3A 4M3BA 5M5WJ 1JKQC 4F7UF 2DFEA 3R07A 2MAMA 1S7AA 2M7AA 3MKYB 3LMMA 1B34B 4A2UA 2CT4A 3S15J 3VYGA 3PMTA 4B8XA 3J80K 3G4SA 2QQ9A 1ULYA 5M5YJ 3F9KA 4E7ZA 1HYOA 2XDPA 4JP0A 2RC4A 2L01A 2VBYA 2ZPBB 4KULA 4CHUA 3O2PE 1LFBA 1USSA 2C7IA 1RI9A 3JRIA 3D7SB 1ZTRA 5LD2C 1XMAA 1AWXA 1N8RU 5ILVA 1A35A 2WV1A 5D7UA 2V6CA 3F21A 3REUA 4FASD 2X4YA 2BZXA 2J7IA 1NK3P 5FWBA 4RCCA 3LSRA 2VN2A 1IRXA 4ZDOA 3G1MA 3CMMA 4A3BJ 2AIRB 3LA2A 3I5UA 4E7IA 1Y8RB 5CVIA 5K5RA 1FC3A 3FK7A 4RAFA 4HOBA 1S72I 3JRDA 2RV8A 2VXZA 5L3BA 2JA8J 1CKBA 2GOXB 1PP8F 4BL0B 3S93A 1K4TA 5GAOn 2R4GA 4F14A 1V1CA 3HTUA 1X27A 1FXXA 3BTCA 1H4VB 2NUPB 3G73A 4UPAA 3H9GA 3OYHA 1AU7A 5CVVA 1VQKT 1J0RA 5LHIA 2E65A 4CH6A 1QCFA 3ICAA 1WJSA 2QEXI 3EHQA 3Q0WA 5EEGA 4HDUA 2X35A 5GTIC 1H9GA 4Y92A 4DYRA 4A93J 1UGSB 3O3KA 1JGGA 2X4XA 2KT1A 2CW7A 1VQLT 3JCUC 4H2TA 2QA4I 1Q86U 3QO8A 4OIPF 1W6XA 2ODRD 4J9BA 2QG9B 2XASA 2FNAA 4DYCA 2WSCE 5FB2A 2K4JA 3PVLA 1IF1A 3BR6A 4Y3OA 4MDXA 1HQCA 3R4KA 3K4CA 1W4MA 1RAFB 1G8XA 1PRMC 4RB1A 2ATCB 4QT7A 1EF4A 1EQRA 5KAFC 2RREA 4MTDA 2JTVA 4ZTZB 5HODA 3OSFA 1XGOA 2X6WA 1KU9A 4HX8A 3OYFA 3OQ5A 1GVJA 2DA9A 1A6IA 2GF7A 2VJJA 2X48A 3QWXX 3A03A 2R7QA 4UV9A 1NJ1A 2LP0A 1FYLA 1E3PA 3JB9I 5J1UA 2C0OA 3BOQA 1IN8A 3CCEQ 2J06A 4HWOA 2KIQA 3CC7Q 2RB6A 5D5VB 2A6EF 2O4XA 2J6OA 2OTJQ 1ADYA 4IXAA 3OYNA 2E5AA 3ZEHA 1UGVA 4C8QG 4HV6A 2O6GE 4OLFA 2BVLA 1QBJA 5IT3A 4EATA 4HXJA 4XTUA 5GTHC 3WTUC 3I56A 2ZXJA 1Y1WJ 1FLIA 3ZFJA 3H0FA 4F17A 1TUDA 4P5OA 1YX5A 2OAZA 1B72B 1N25A 3HY0A 3PSIA 4F7ZA 4L6V5 5IYBJ 2DLLA 2B63J 4KIFA 4X9CA 4ATOA 3QJYA 4II2A 5KVRA 4II1A 4M77E 1NHAA 3Q1JA 1S72A 4D5FA 4BXFA 1H9TA 3V7RA 2EB7A 3PQKA 2HDCA 2EQMA 4GGGA 2VI6A 1R0CB 2LT1A 4P9UA 2LKPA 3KFVA 2WWYA 1VQMA 3HRSA 2E34A 3S16J 1PKSA 5LEJA 3EGXB 3F8NA 3BE3A 1QZEA 4O5VA 2K7LA 2DA1A 4MFEA 4YRNA 1JJ2S 2DTHA 1UECA 1IJWC 5J3BA 3O8VA 1QGPA 2DQ3A 5FKMA 1EVLA 1PM3A 1R22A 2MLKA 2RKHA 3PFYA 4V2FA 4C0ZA 1RI7A 2ZPGB 1A0NB 1WJBA 1R6RA 2CP5A 4KR2A 2O2OA 2QA4A 2DE0X 3A8MB 2GXAA 4KNYA 2E19A 4A12A 4XOPA 1SD6A 4XLFA 1TS9A 1ZUKA 5KNNA 2GNCA 2EIJH 2O9LA 2ZZDA 4P71C 3ZMUA 3ZMVA 5B5EC 2X4HA 4XRSG 2DFHA 3ZQGA 3G2BA 1RC9A 4AFSC 4C8QF 3VS4A 2RHXA 1VIFA 1H89C 5LJ3f 2X3WD 4HX4A 4FX4A 2XGTA 3KIOA 2HZYA 5E1WA 1Q81U 2KI7A 1VQ7I 2O3FA 1RETA 2BOLA 3GYHX 4OMFB 4JS4A 5A0GA 2DRKA 5GMKi 3HXLA 5K7ZA 1N27A 2PU9B 3GNGA 2IGMA 2PVOB 2BW3B 2LC4A 1T0FA 4ESJA 4TVYA 1K8AU 2D5VA 3S2HJ 3AT1B 1FYFA 1I5ZA 5CVRA 5CKHA 2QBYB 5HDKA 3CCQA 1V76A 1WVRA 3FXKA 1UE9A 1IN7A 2IA2A 3D5LA 3IKLA 4GLMA 4HSRA 1HW2A 4RTYA 4FQGA 5A2QZ 8AT1B 3NFCA 1M90U 1OKRA 1O3SA 2IG0A 1OCZH 3GUDA 5CKDA 1RAEB 5F6FA 2K5IA 3S8PA 4HLYA 4UUSA 4HCKA 3QP5A 2D9TA 1T3SA 1FZPB 2E71A 3TP3A 1YITT 1HC7A 1FBSA 4IEJA 3MP6A 3WTWC 2CV0A 5FKLA 3TEGA 1XB4A 2PVDB 2IS1A 1ZGJA 1H4TA 2AT1B 1N75A 1M1KC 5DDGA 2BZ8A 1MSEC 2NS6A 2ALYA 2VPRA 1MBKA 1Y56A 2WAQA 1D8KA 2O31A 1I1GA 3CEYA 2DZCA 2JPCA 4NC6A 1E1OA 1MJBA 2DOAA 4M4ZA 1YLFA 2E7WA 2KRSA 1YRNB 1SVLA 4H0EA 2FD5A 1ZBJA 3L2CA 4O3MA 3OW2A 3KFUA 3GTJJ 4WTOB 2K9QA 2X4JA 2K6DA 4DOZA 5FU6C 1SVMA 2E41A 3WQZA 2LF8A 2R93J 4IHXA 4NBQA 3GTQJ 4KH1B 2RQRA 2EJRA 5JFRA 4OB0B 5H6RA 2CFOA 4N0AA 4PCQA 2D8HA 4A0ZA 2ZXIA 1LE8A 1ZRFA 3M59A 2D0QB 4CUGA 4QQDA 1KMMA 3LA3A 4KITB 1T38A 2LQ8A 2QQBA 3SDBA 2NS0A 1YFSA 2KYBA 2R7WA 4RUGA 3CCRI 2H8RA 3QPTA 1TT5B 3IG2A 3FDYA 4N4NB 3H5AA 3ASKA 2IA0A 3VS1A 4XTVA 1TUGB 1GVDA 1LJOA 1K78A 2GXBA 5GANj 2EL9A 2K5CA 3DTEA 2VUBA 3BPVA 1OCRH 2JA2A 4D1QA 2W4SA 3K2AA 2NNYA 1YITA 5HNFA 2IIMA 1YW9A 4Y4RA 1WGXA 2LF7A 2OBPA 1KGSA 3IH3A 4OMZA 2ARSA 4OB1B 1UG2A 5K7HA 1JJCB 5KCOA 4OMPA 2KEAA 2M34A 1B8IA 4IX7A 3JV3A 5LRSA 3PT9A 4D7NA 1NYFA 3CD6A 4P74C 2K5FA 4UUTA 1TXQA 3FLGA 3DQVC 1VQ5A 4F04B 1QPMA 2A28A 1X19A 2OQRA 3G71I 3LNQA 1RNLA 1VQKQ 3SB2A 5FKKA 2YUPA 4P72C 1IRZA 1H88C 1KD1U 2IW5A 5D5XB 2I10A 4X0GA 1QWEA 2LJ3A 3FEOA 4ELYC 4L9VA 1UGRB 4PJOD 1H4QA 4EVIA 3M1CA 3EGDB 2VE9A 1VQLQ 3FWEA 1B34A 3CJRB 3WGHA 1IHVA 2OCCH 3R6SA 3L2WA 1TBXA 1AWOA 1WJCA 5IOZA 2ZXWH 2QGUA 1ZK8A 3CPFA 4AU7A 4M9SA 4A6EA 1BI3A 2DAQA 2NXNB 4II3A 2HZDA 2QGGA 4QQGA 2M8GX 1ON2A 4TVAB 1JU5C 3HKZN 2CSIA 3CXCP 5GAMh 2DK8A 4M7DD 3HFZB 2HVSA 3ZMZA 1X54A 2DXIA 2CGPA 3T8TA 3CMQA 3W2WA 4XNFA 2CV2A 2R7FA 5L3DA 1Z21A 4FETA 3DXJF 3HKSA 1RLPC 1XSXA 2GBQA 1ZN2A 1Y8QB 2HTSA 2Q7HA 1I50J 3PSFA 4OMOA 3CBOA 3X24B 3HL8A 3CCLT 4DQ2A 2I4MA 2DTOA 1IXRC 4M75C 4M78A 2CP0A 5GAN4 3QPLA 1J7KA 5LBQA 3GLXA 4E47A 2IXSA 3CF2A 1GXQA 5FFZA 3FMRA 2A36A 2JTEA 3MKDA 3CCRA 4GYIA 4LDUA 4A53A 4R56A 1ZUYA 4PJOB 4H2YA 3QOPA 5FLXZ 3SZTA 5CIUA 3HOUJ 3ESWB 1XDSA 1BBYA 1TWHJ 5ELNA 2J6FA 2EQIA 1PD1A 1MNDA 3TW7A 4ZZDA 1R5ID 4TVRA 4HVVA 3HB9A 3TGNA 1XOVA 1VIEA 3NTIA 3HOSA 1LDDA 4BQAA 4FE7A 3FXJA 2VKHA 4DOVA 3F8FA 2DKGA 4LVMA 4AD9A 2HKOA 3RMSA 4U0VA 4NOYA 4A4KA 4N4OB 1M1GA 1VA7A 3NELA 2XF7A 4ESRA 1P2FA 2LMDA 5KYWA 4XORA 4BQOA 3T0YA 4J01A 2JPBA 1P9QC 4A3IJ 3CP8A 3G71A 1U6GA 2IY5A 5CPRB 2EFOA 1U78A 1KQ8A 2E5NA 1OLTA 2MSYA 3CJQB 2LX7A 2K9NA 4KIBA 5CLSA 4XRFA 4J9CA 4MTEA 1K7AA 3CCSI 2EYXA 1E17A 3OY9A 1U5SA 4M75B 3U9GA 1K9MR 2EFQA 3MJXA 2XKOC 4PSWA 3L2UA 4ZH4F 1UHMA 2FXAA 2BVMA 2RHIA 5CK9A 4FIBA 2LVSA 5ECAA 3I55T 2PMHA 4QSHA 3VQWA 1TQIA 4OGEA 2D0NA 2ZPHB 1JT6A 4HWPA 1WJEA 2E7XA 2Y30A 4KT5C 1HBXG 3CMAA 1LB2A 1HW5A 4S05A 1YJNI 3I4PA 4HLXA 1AKHB 2F5DA 4E6KG 1YOVB 2CQ7A 3DKXA 2GGRA 3D5SC 2V8IA 3MVPA 1OYWA 3LSJA 4F91B 5DLOA 4WF2A 4LFUA 3CC2T 1VQZA 3OIPA 1OYIA 2QI2A 3OA6A 3V7SA 2B7EA 3KXTA 3S2DJ 3REBB 1ZHFA 3QU6A 3TSWA 1QVUA 1WFXA 1WXBA 2VT3A 2V6EA 3GTKJ 1YJ9T 2ZINA 2Y0SN 1Q7YU 3Q9VA 3HOXJ 5LLQA 2FPEA 3M0PA 1D8JA 4ME7A 1G3TA 4BKXA 3HUGA 1SD4A 2VKNA 2VJIA 2XRNA 3GNFB 2X9DA 3MN2A 2E64A 4YRFA 2P84A 4LK0F 1YBYA 3OR1C 2J6KA 4EM2A 2EA4A 4RAZA 1X1CA 1TH7A 3FHNA 3IP4B 1K9AA 5CYVA 3L1PA 2XSJC 2Z2SB 2OUMA 4L0YB 3BLYA 1O3RA 5F1RA 3F22A 3KP6A 3LH0A 2XK0A 2ZPEB 3WVDB 2XAFA 1X3ZB 3ZRGA 1D5YA 4LN2A 4TV7A 4RTZA 1MBGA 1XQHA 1K73R 2MOXA 5IHIA 2LQNA 3I55A 3I5SA 2VKVA 1X6GA 1HJDA 1BYMA 4LE9A 3K70C 1WJQA 1Q82R 3V7CA 2GA1A 4UNOA 3C2HA 2LD5A 1W36D 4YRLA 1YITQ 2P5IA 3GBQA 2ZMEA 5E1XA 2EGAA 3GF5A 3PQJA 1YWPA 5LEKA 1BL0A 3DKYA 2Q7GA 4X1EA 1XMKA 4DPGA 3KCCA 3KLNA 4PK4A 2OZ6A 2R7SA 3OMCA 3ABMH 4C92G 2R7OA 3HOVJ 2VOPA 3BPXA 1RR8C 2HBWA 1X2HA 2UXXA 2EK5A 3JB9H 5KH6A 1X1AA 1MV3A 3CCSA 5L23A 3NEMA 3AAFA 1H0MA 2GTOA 3QAHA 2WV0A 4ZN1A 1BU1A 3X2QH 3TOAA 4ZGEB 5GMKm 3GWZA 1B07A 1ZQ3P 4LDYA 1JRIA 5ILUA 4I01A 3IWZA 3RPQA 2XUBA 2DN0A 1FMKA 1QQIA 3VYSB 1VQ9T 1K1ZA 1G3YA 3PCOA 1EX4A 3JR9A 3OL4A 1LYLA 1YJNA 3OW2P 3E19A 1PJRA 2MMPA 4N9HA 2EZKA 2XVCA 3L42A 2LK2A 4D8KA 4AYBN 3KP3A 2ZPFB 5HK0A 1MV0B 2BW3A 1ZG5A 2HAXA 1LJ9A 5EZHA 1IHWA 4LDWA 2IEKA 3E2UA 4MZMA 2SRCA 1U8BA 5LRRA 1V5FA 2QEXT 3KZIC 3BCAA 3VS0A 3DPLC 3BC8A 4DZJA 2QBYA 4QKUA 4JJBA 3FXRA 4AIHA 1GRIA 5EGOB 2GOMA 4PJOE 1O3QA 2R92J 1KU2A 2BBYA 4QTRA 2EIKH 4BEHA 4D9JA 2A8EA 1MBHA 3OSSC 2DIGA 5GAOm 2DXBA 5TGTA 2HQRA 3ZMTA 3T1BA 1B6AA 1RZ4A 3IWFA 2G7UA 4NL3A 3G1OA 2GBYA 4YFXF 4BDYA 1BC8C 1W5SA 5EG0B 4I6ZA 3M07A 1XX5A 2R7XA 3FXLA 3V8KA 2RHSA 2DJIA 3MEWA 4FYWB 2KE9A 4C92F 2IGNA 1W2BP 3CMET 2RM4A 5GAN6 4YCWA 1QW1A 1JEGA 2X51A 2MD0A 3KBGA 2O8KA 3TBIA 1K73C 1XGNA 3OMYA 4M7AG 2ZT8A 1QVTA 3J7AF 4EIKA 4LLGF 1G5IA 1YRNA 1M8MA 3MF2A 2EH3A 2EAYA 4M75E 1SHFA 4YCVA 2KRMA 3RCOA 4JRPA 2A5WA 2XGXA 2HKNA 4PZJA 3DWLE 2ID3A 3BZ6A 2VXDA 1MJAA 2ESHA 2L3DA 3NPFA 3GZ5A 3DBHB 5DS9A 4WI1A 2YRVA 2QDYB 2HPIA 4LITA 1ZA1B 1KHCA 4L9JA 1JXMA 2XDDA 4J15A 2QHSA 4BJ6C 1IUYA 3Q0UA 5FO5A 3A0HC 2IPQX 1UG1A 3S1NJ 2DZ9A 3N05A 3HOZJ 2Y9YA 1WH7A 1WX6A 2Q0OA 3BJ6A 4G9YA 4LIUA 1U5TB 3HIFA 1VFCA 2E10A 4OB3B 1QHGA 2ZZFA 3GF2A 2DFIA 2QENA 3A1YA 1GBQA 3OYKA 3ABKH 3HXUA 3AL0C 5C6SA 2E5KA 3DP7A 3C7JA 3MZ8A 4BHCA 3JRHA 1ONVA 1VQNI 2XPVA 2JOYA 2E1MC 2FL7A 2DL8A 1AZGB 2HI3A 4L9NA 3CCLQ 2KZGA 1M8VA 3UGTA 2ZFWA 5FWCA 4IF4A 1WZOA 3QHSA 4UHTA 4CCJA 3OMGA 4XLEA 3I59B 2HVRA 1RR7A 2RGVA 1X4OA 4CYDA 1W66A 3MKLA 5GAEJ 5EF6A 3N4MA 4LMYA 3QWLA 3M0SA 2L9SA 4QLCU 1IG7A 3UATA 1LEAA 4A3EJ 1MW7A 2HYGD 2JTFA 3WGIA 1Y96B 1ACIA 2VWFA 2IP2A 1UELB 3OOPA 4G8XA 2R7VA 4Q5SF 5B3SH 2JMWA 2VYTA 2IJLA 1FYNA 4W1UA 3VS7A 3HPHA 4RKUE 4M7AF 4EMGA 2RJCA 4AFZC 3E6DA 2LNBA 2DO3A 2LZ6B 5DCFA 3GFIA 1KQ9A 5KCMA 3H41A 2YS9A 3CCVT 4CC4B 5CQXA 4P3OA 1TOVA 1HF0A 4G94A 5ED4A 2UV1A 1OR7A 3CBPA 2MI6A 2DA2A 3QPSA 2E5ZA 2F5KA 3VS2A 4RG8A 3RSNA 2EZHA 2LDUA 1SFOJ 3BR0A 2M2EA 4AM3A 3A74A 1E2XA 2HL5C 2ZT5A 4FW1A 5EYRA 1Y6IA 3G1LA 2Y48A 4ENJA 2RJEA 4L5GA 2BKDN 3U1DA 1E6GA 1KQSA 4R79A 5DV5A 5IOYA 3CC4T 5J8CA 1WA7A 2W0ZA 1ZSZB 1UGQB 2V8KA 1TSFA 5KYUB 3I55Q 5KYYB 2DJNA 3BJUA 1BBUA 3P9KA 2MPXC 2FRWA 3J81E 4IJAA 1ITYA 2AXLA 4H2VA 4GBQA 2F5FA 1LNXA 3HXZA 3LX7A 1X6BA 4QWQA 2C6YA 5JHFA 2EKOA 3WHCA 2V1DA 4F7UB 1X1DA 4ESFA 3L2QA 2EYYA 1FWZA 1R1VA 3PZCA 2MW8A 2JVGA 1QO0D 3CC2Q 3BY6A 4DIQA 2QKLB 3DTIA 4KR3A 1YW8A 4LLNA 2CQQA 2HQXA 2PMZN 2O01E 1IW7F 2JK3A 2NOJB 1OPKA 1ZRCA 4NQWA 4YIIA 2ME6A 1VQNA 1X2NA 3CLQA 4RTVA 1WH5A 1H8AC 2HZTA 1YJ9Q 3BG7A 3FMSA 3CCVA 2JXBA 2ZPIB 1XTDA 2VT2A 2OQGA 3C4SA 3GFLA 2LG4A 5A0DA 4ZIBA 3RI4A 4M9XA 1P7JA 4XL9A 4Z89A 4PFPA 3W6JB 3CDIA 3KYDB 3A01B 3MHXA 3IQLA 2XG8D 3LWIA 5D6EA 5GAMf 1RPWA 4UP8A 1BC7C 4M7DA 1XCBA 1Y1VJ 1TWFJ 3UA6A 2EVRA 3CC4A 1SFEA 3EAEA 2LTPA 3JTHA 5CKTA 3C95A 1NPPA 1JT0A 3EUHC 2E3IA 4RAGA 1R0BG 3E0JB 2EYZA 1JKRC 4Y91A 5GP9A 2HOTA 1NLPC 3QDFA 2RPNA 1GV5A 2OZUA 4LDVA 1O57A 4A54A 1X43A 2XGDA 3IH2A 3QG1A 5ICFA 1R4MB 3CBMA 2M4KA 2XICA 3EFOB 4M3GA 4ENNA 2HL3A 4IVNA 2PJPA 2VJ4A 1AKHA 1SAUA 4M7DG 2EPDA 1MNEA 2CSOA 1ABQA 3G6EI 4G7ZF 3J7YJ 2DETA 4M77G 2VODA 4CH3A 5IP7J 2YPRA 2DILA 1PYVA 2OAUA 3R60A 3BROA 1AD5A 2L5QA 1M2VA 1RAAB 3A8GB 4I98B 4CICA 5K1YA 3M7GA 1VQ9Q 5GAMe 3QBYA 3F8BA 1YO5C 3W3CA 3ZPLA 1MD0A 3EH2A 5ICEA 12ASA 2DL3A 3NMZC 1ZAOA 3MO8A 1NYGA 2HGCA 2L9VA 3TQNA 3KUFA 4K87A 2L0KA 3M53A 1ERDA 3FXOA 2E1CA 1TW2A 1M1FA 1ON1A 1JUPA 3ZXSA 1R71A 2I4OA 2KL4A 1YFTA 2BXZA 1A04A 3P8HA 2QEXQ 4DEYA 3K6GA 1OYXA 4IRHA 4YIFA 1U3OA 5B66C 4BQNA 1NTCA 2I8DA 1VQ8I 5K5QA 2XAJA 4KIGA 2LJ0A 1YHQI 5J1RA 4A4GA 4MZPA 2VC8A 1X2GA 5D8KB 1R36A 2EZLA 2DMOA 2KDSA 2KY9A 3M56A 2BTTA 4EMKA 1RACB 2V1RA 1MH4A 2CSQA 4M6YA 3LSPA 4TVWA 3Q0VA 1NG6A 3GFMA 1PG5B 4V2SA 2M1HA 4BY7J 4NL2A 1K0SA 1BIBA 4JZ4A 4CCLA 2JT1A 2LKSA 1GFCA 3OS2A 3K4LA 3CMEQ 4C8QD 3WU0A 3K1MA 3CXCS 2N8GA 3A8LB 3FRNA 3L1AA 2DL5A 1ENHA 1XTAA 3M54A 4M77F 1USYC 3H3UA 4CCKA 4YRRA 5LJ5f 3OL3A 3CUQA 1FTZA 1Z9QA 2YRCA 2MA3A 2RI3A 4XSXF 3K4MA 4CSWA 4B3XA 4AIDA 4ZYHA 5LHGA 4OB2B 1WI9A 3EG9A 3WU2C 1T0HA 2XU8A 3DF8A 3MP1A 2D8JA 11ASA 2STWA 2EQUA 4HRIA 2KIUA 5JR3A 2VV5A 2I0NA 3TO6A 1IC8A 4LNSA 4MMLA 4YIRX 4B47A 3WTXC 2C0TA 1IN4A 2K4BA 1W5CC 4IUQA 2EW3A 1Z9CA 3FDRA 3INZA 2DYIA 1FYMA 2EKHA 4YRKA 1OQKA 3KX2A 2NVTJ 1I81A 2M30A 3HDDA 1XSVA 3MQZA 3MKZA 2EFWA 1S8NA 1FTTA 4EQQA 4ENKA 2K3BA 1WPKA 4J9IA 1IDZA 3WG9A 1VQOA 2OI3A 1PYSA 1YFRA 2DVJA 1X2MA 4JRKA 3LGLA 4AFQC 3PNWC 2JS2A 1YFHA 5FKOA 1FSHA 4KBMB 3LGFA 4Z02A 2HNIA 1QP3A 3QOEA 3CZ6A 3P8TA 3H3ZA 1F43A 1EH7A 4B9WA 2FUG2 3HPGA 4FYYB 3ULRB 3M1EA 1EJ9A 4MIMA 1BW6A 2O5RA 3SD4A 3OS0A 2YXYA 1VQ8A 1YHQA 3F3XA 2KBTA 5EZGA 3WTVC 2W00A 3CPWP 3HRUA 1OU8A 4LGWA 1QKWA 2BY3A 1OCTC 2F2VA 2E36A 4LVLA 2Y69H 4ZGJB 2XAUA 4XK4A 3S3MA 2BV6A 2Y0MA 1BR4A 1IRGA 3BR3A 3CCVQ 4Q15A 5ICCA 2O4XB 2YU9J 3CCJT 2O9VA 5CQYA 3F6VA 3MWMA 4HVWA 3SHFA 3H5RA 2DDAA 4XKWA 4FT4A 3X25B 2OA4A 3BTLA 1MDMA 1VQ4A 2OX7A 1E1TA 4XEOA 2VL8A 4FM4B 3P9IA 3O8GA 2DA6A 4BE2A 4C2TA 4IHWA 2PQWA 4MQVA 4KRTA 4MZTA 1UHSA 2D2WA 5LJ3h 5JLWA 4IQ4A 2L9RA 3SEQA 3M58A 4RGSA 5DEQA 5K5OA 3R0AA 2DXTA 2YUQA 3CC4Q 3ERMA 1U5TA 2CYYA 1KSWA 2FRYA 1TNSA 3HZJA 1A36A 3K7AJ 2J3MA 4YREA 1IREB 2VBXA 5DUIA 3IH4A 2CJ9A 5HOOA 1KQSP 1NG2A 1DJ7B 3UFGA 5CJ9A 5D6WA 2O03A 1ZUUA 2WAEA 1I3AA 1O3TA 4AC0A 1NK2P 3A2KA 4EJVA 4JJNK 1HSJA 2OTJI 4ASNA 2CMPA 3GTLJ 4KT6A 2RHYA 2KZVA 2E1NA 2K3XA 1PVEA 3I59A 2PMEA 1KQ1A 3WU1B 2DBBA 1K9MU 3SFZA 1TTYA 1MJ9A 2LKXA 2HQ5A 4OINF 4KT0E 3RZDJ 2IGOA 2V79A 1CF7A 2OC6A 2JW4A 2RMOA 3ABUA 5KK1A 2VQCA 2KSSA 3CCJA 5E3NA 2JJ7A 1QZZA 2DTIA 2FHDA 1BOAA 4G6DA 3UWNA 2HWVA 4HWRA 1I5LA 3A7AA 2NVQJ 2VQGA 3CCET 2YU3A 2K40A 1M3BA 1JJ2A 2XIGA 2EFNA 1QU3A 3GTGJ 3K9TA 4UVAA 3UNGC 1ACMB 4LVJA 5C0MA 1WFWA 2CKKA 3E6CC 1GUUA 1WSUA 5FKNA 5DM6F 3X20B 1K79A 5M9OA 3H9NA 5JHUA 5EJCA 1OEBA 2IVWA 5DCMA 3WVEB 4HF1A 1ASZA 1U1TA 2R3SA 2LY2A 3M4YA 1FP1D 1H92A 4A4FA 1X1BA 3HG9A 4XLCA 2O8XA 2L7MP 2VGNA 1WHKA 3F70A 1YI2T 3A32A 3E97A 1FNNA 5LHHA 2F4OB 1DGWY 3IUOA 3K0LA 3META 1K6OA 1R58A 2CU7A 3C2GA 2FBIA 2LP5A 4KUMA 1POGA 1X3WB 4WCIA 4A5NA 2LRQA 5GPCA 2BY1A 2WAFA 2P81A 3MEAA 4RCBA 1QVFS 4PHCA 1U3EM 5BPIA 4F16A 4K88A 3NHNA 1B3QA 3DB4A 1XC5A 4JOMA 5IT9E 4IL6C 1XS9A 2V4JC 2ME0A 1K73U 2C06A 3QP6A 4F7UA 2BY0A 4XMYA 1ZH5A 1SMTA 4NDLA 1Q82U 4UUSB 2CJJA 4ZTFA 2ICWG 1UJYA 4BI8B 4PJMA 4UVCA 4MFDA 3K69A 2ZJPF 3CCEA 2K02A 4B09A 1NZ9A 2NYXA 4RTUA 2O7OA 4YRSA 1IO2A 3CC7A 2A05A 2RHQA 2ZZGA 2QQSA 3G4SI 1BKBA 3DPUA 2ALYB 1ADJA 2NUZA 5JVGF 4U7BA 1V3FA 2WBMA 4TQDA 2A6TA 4PNOA 5EDNA 2E6ZA 3PMIA 1C0MA 1W2BS 2O88A 1STZA 1GDTA 3RTRA 1WPYA 4JLIA 1K61A 3UR3C 1ZSGA 4MEYF 3J80Z 3H35A 3NEUA 2OD5A 2W24A 2XC7A 1TTHB 4C5GA 2E5QA 3BR5A 4YRCA 1A5JA 4HVUA 4XN0A 5H6QA 1YI2A 1WI3A 2KNBB 3RMQA 4KJZA 2UZKA 4HCBA 3OIQA 3QWYA 3HOTA 5CO7A 4BHPA 2CUDA 4YRIA 3H36A 2ESWA 2ZJRF 1LE8B 3TCJA 1FIPA 3M0QA 1MGTA 3CCUT 3TDUC 3IC7A 2LTOA 5GJWB 4XEMA 3FB9A 1QVGP 2XB5A 1MHNA 2FQ4A 1YS7A 2HS5A 2V1QA 2JN0A 4CCOA 2LBFA 1CSKA 1UDLA 2GQVA 1QZYA 4I02A 3M0UA 2H6CA 5FD5A 1APLC 1HKTA 1UMQA 2LMJA 2QM3A 2HOSA 2PX9A 3MP8A 3SDZA 2C0IA 5F27A 3MEVA 1UB9A 4LB6B 3NARA 1D0ZA 1J75A 1K4SA 2PVGB 1GT0C 2BE7D 4BQQA 3SZGA 4O2DA 2MCNA 2LCCA 1YJWT 1CKAA 2HDWA 4IRGA 2KXDA 2GFAA 4YRGA 3M55A 4JJCA 1YFNA 1B8IB 3LL7A 1S9HA 1GCQC 3BY7A 4AWXB 3AG3H 3IL2A 3LSIA 2JSPA 3G3ZA 3NGPA 4BBRJ 2OF7A 4UY8I 1B70B 5EEHA 1N9WA 3CQTA 4L59A 1ZARA 3DU6A 1ZQ1A 4P3PA 1KQ0A 1E0EA 4C5HA 4YRQA 4HAMA 1NJIC 4DEXA 2H8HA 4PJNA 4M78C 3H6ZA 4C0GA 3UDCA 3CUOA 4HF2A 4MQ9F 1RKTA 2M9UA 3VS5A 1PKTA 4RLFA 1A6QA 3WGGA 3BDDA 1X55A 3R0JA 3GBGA 4C30A 1P4XA 3RERA 4M3DA 3MEUA 1FX7A 3VOEA 4Z2YA 2PMUA 3SDGA 1I3QJ 3D1NI 2ISZA 2DMNA 4CYCA 3U21A 1SEUA 1D0XA 4IIMA 3DEWA 2B8AA 4LD5A 2ZO4A 3LWFA 4PGHA 1Q1HA 3S6WA 2NS7A 3BWGA 2DLPA 2DM1A 3ZMDA 2M7BA 2HKXA 5LGNA 1JUMA 1B59A 3FISA 3HSRA 3U23A 4YEJA 1ZBXA 2QGFB 3FM3A 3VV0A 1W70A 1W5TA 3G1ZA 2DFFA 4F52A 4AG2C 2CUFA 2ZXFA 3BR1A 3I56I 4CZCA 1VQKI 4KDPA 1UHCA 1G5HA 1IV6A 4KFCA 2AK5A 4CZZA 5TISC 2DT7B 3NWSA 2K86A 1VQPT 4F92B 4J8OA 2D1VA 2QDLA 3ERED 2A37A 4TQFA 5CKBA 5AT1B 1VQLI 3MCAB 1ASYA 3CCJQ 3F23A 2JM8A 3MMYB 4M78B 4XBFA 4YP0A 2GXGA 3KEYA 1TU0B 4D6WA 4U0WA 1I8FA 1FIAA 4OMNA 4K11A 5FLMJ 7AT1B 2M0YA 4DJAA 3VYUB 2X1EA 2IVMA 5BS6A 1TWGJ 3J81K 2RNGA 1ZREA 2EFPA 1VUBA 1ARKA 3L2RA 3ASOH 1VQMI 1YX3A 3JSCA 3RR6A 1S1NA 2QTXA 3L00A 4CCNA 4KA4A 1K6YA 4NUBA 2RNAA 4Z6YA 4FHTA 3M8FA 2KQWA 1LOJA 2Y0SA 3RQIA 1W0TA 1RRJA 4N4GA 2P0QA 3HRIA 1VQ6T 4YRJA 4J7FA 4E7JA 1Q86C 5KYWB 1DDNA 1PUFA 5IHNA 3SYTA 4YELA 1EIYA 4KUIA 3HFVA 2IY5B 2R5YA 2LY9A 4CH4A 1X58A 1JB0E 2ODRC 2ELKA 4C8QA 1UG0A 1KYWA 2A07F 5KCHA 4E2FB 4BBSJ 2QVOA 2X85A 4C92D 1Z7NA 4P1WA 5GAN2 2HU9A 3LQRA 3BR2A 2ACJA 5BQTA 5BMZA 4A6DA 1QE0A 5C52B 5LJ3d 4FU6A 2JNGA 3O6BB 1Q1VA 4C9YA 4Q5WA 3RUXA 4EJOA 3RF1A 1IUFA 3MAJA 1S3JA 5F1JA 2EQJA 3OYIA 1GGMA 2OTLT 2DU5A 3CTAA 1MBFA 3GEZA 2PNIA 2CZ7B 1XGMA 1X69A 2H6BA 1F5TA 3GPLA 2DODA 2QXFA 2XV4S 4EV0A 4IOCF 2G3RA 1VQKA 2JSCA 3I9V2 3ZQ7A 4LD6A 4RM3A 1PSEA 4PJOF 3HY1A 4N4IA 3CCQI 1FBQA 3TOBA 1XN7A 3EG0A 1WYDA 3VPRA 1R7JA 1KJWA 1LKXA 4J6WA 4ENMA 4GCVA 3HUGB 1VQLA 1RUNA 4GY5A 1LQ1A 1YI2Q 4ZDLA 4L5JA 2Y4YA 2VE8A 2Y9ZA 5HY6A 3LFKA 2A61A 4PLLA 3TDZC 4CS3A 3QIIA 4L0ZB 4ZYEA 2CW0F 3QTCA 3ZCOA 3T8RA 4B9XA 2DU7A 3H5NA 4V19K 1M1KR 1QP2A 3HP9A 5LL6S 1T6SA 1BI0A 2QSHX 4XRSA 1PUEE 1YIOA 1RADB 2R7TA 2CW8A 3CCMT 4F55A 1XSDA 2P8TA 5IY5H 3QRFF 4Y28E 2W85A 2SEMA 2AO9A 1UTIA 4M75F 4P5NA 3BW1A 1PDNC 2DA4A 2TRTA 1GL5A 1MBEA 4GFBA 3CJTB 4WJ3M 2CH0A 2A5YB 2ZMEB 4BU2A 3HFNA 4NNJA 4LG3A 5J3LA 4M7AD 4DBRA 5BPDA 3I64A 1MMDA 4BHBA 2F48A 5D6YA 5C4XJ 3URGA 4XLHA 2BIVA 3M4QA 4C0DB 2ZJQF 4LK1F 4U7DA 3FKIJ 4U87A 1WQWA 3BG9A 2L3SA 3MFKA 1P4WA 5H20A 3MD2A 1XMXA 5FRMA 1Q81C 1XNIA 2RN8A 2LQWA 1S7EA 4PGGA 2ZR3A 1Z7MA 1WCMJ 3FXMA 5IHKA 3LWHA 5HS7A 3W2VA 1F4KA 2VQHA 3PCOB 1R1UA 2RDPA 3S32A 1B7TA 3QNEA 1EFWA 2K3PA 3PNVA 4B3AA 1SD7A 2V9PA 1YITI 4EM1A 2CUEA 2EV0A 2TDXA 3ZQFA 1HA8A 3CCUQ 2FNPA 4IUVA 2XGCA 4HNUA 3GTPJ 4A4HA 3GMEA 3REAB 1K8AC 5D6FA 5HK3A 2STTA 2ZAEA 4A3MJ 3RKXA 3VUZA 2UUZA 3A0BC 4M78E 3FBNB 3RESA 3GO5A 3CD6I 5IYDJ 1PSFA 2RA2A 1FSEA 3S2WA 4RDUA 1LUJB 2JM9A 4G7OF 1VQ5I 3IKMB 4OIOF 4M7AB 4MNUA 3HXXA 2VKDA 4OMYA 4BEHB 3GP8A 1M90C 2DMUA 1H3ZA 4A0YA 2H94A 5E3MA 4HF0A 1YJWQ 2MFZA 1AWCA 4CRIA 4X34A 1BCOA 3DLMA 1DU0A 4DZPA 2WY7Q 4YPFA 3HSEA 3WTYC 3JAME 2YUSA 3LH5A 1J3TA 5LJ3e 1DPUA 3P9CA 1UGPB 5I11A 5ELOA 5J8FA 2ZT7A 3SXYA 2RHSB 5GANh 2K85A 4L18B 1SSFA 2HR3A 2X0LA 2DA5A 3FXUA 4JRIA 2MLGA 3K4KA 1D1BA 3A31A 2E12A 1NJ8A 3R61A 3QU3A 1RABB 2MK5A 1JHFA 3LYIA 2AZSA 3BFMA 4OMLA 2CIMA 5A2QE 1ZELA 1JTYA 1FPQA 3CPWS 2JA6J 1UAAA 1SFXA 4ZC3A 5FU7C 2XD0A 1BR2A 8ATCB 1D5VA 4F3QA 4CGZA 3ZGKA 3UKGA 2A6HF 3OD1A 1W1FA 1IGQA 4OAYA 1N9SA 2AMCA 3S1QJ 2F6CA 3JRAA 4XIDA 2M16A 3KFWX 5I22A 4LXCA 2GFUA 1Z0XA 3C12A 1E24A 3JCMc 2IBDA 2H3JA 4P73A 1PD0A 3WXMB 1YIJT 2ESNA 1XPXA 3HXWA 1IL2A 4IZZA 2WTEA 2NLUA 2PUOB 4FCYA 1HTTA 1OR7C 1O75A 4KUDK 4J9GA 2EJ9A 3H0IA 4CS4A 1KU7A 1NEBA 2ELHA 1WNLA 1I27A 1VQPQ 2HYJA 1D1CA 1I1SA 1JGSA 3RKQA 2F5EA 3OIOA 5HDGA 4A0XA 3WHBA 4FX0A 2NYSA 5L3CA 1MSFC 5LJ3j 1L0OC 1HOMA 1PP7U 2RQQA 4AVPA 5J4YA 3PFSA 4XU3A 2IGKA 2Y31A 2HOAA 5FU7B 3PUFA 1T0JA 1M5Q1 1X01A 2YUNA 1YYVA 1B70A 3RNJA 1FT9A 2V9KA 4M73A 2DQLA 4XTWA 1BA5A 5JVTA 3JSOA 2A69F 3A4CA 2PMZA 1KD1C 5DD4A 3M0RA 4J6YA 1OX9A 5HLHA 3HGYA 3W3SA 1KK7A 2A0FB 1I6XA 4P75A 2Z5UA 4NS5A 1A31A 4OGCA 1JXSA 4E7KA 5GAGJ 1AEYA 1VQ6Q 1WGSA 1OISA 2ROLA 4PJOC 2BY2A 3CCLI 5HDNA 3V8JA 1AHJB 1OI1A 1WJAA 1GLNA 3K10A 3VJPA 4E51A 1K76A 3DCFA 1YIJA 3VWBA 2G9WA 4K2EA 2RQWA 1BJAA 2B0LA 4A3FJ 3CMAI 2JZ2A 2M3AA 2EIMH 2QAZA 2KYMA 5F0CA 2L4AA 4J19A 2MYSA 1BM9A 1MMGA 2G6FX 3RDIA 3K4BA 1HDDC 2JUFA 4ON0A 1OPLA 4MHGA 3I3LA 5E18F 2Z0WA 4M77D 2M02A 4M7DC 1ETQA 2R5AA 4LOCA 2R57A 2V7FA 2EJGA 1PC0A 2W82A 2HSPA 1T95A 5HLGA 4ZYAA 1NYRA 4EJWA 2KIFA 2HCKA 2OTLQ 2QQAA 4Y52J 5DY9A 2ZZEA 4XKBA 4TTVA 3S3OA 2BHZA 3HBLA 3U2RA 4LD9K 2X3XD 3VFZA 2LDMA 2Z3YA 4HQEA 1K0XA 2BUDA 2ELJA 2RQUA 4AT1B 2EBPA 5TRDA 1ETYA 1D09B 3R6NA 4NQWB 3A5ZA 3CP2A 4B4CA 2GQIA 5E3LA 2MH9A 2VKEA 2EINH 3F72A 2QWWA 4PJLA 3SWNA 4HA8A 2LSOA 3I4MJ 4LDXA 1LDKB 3KPHA 4OP0A 1T8IA 5IT9K 4RB3C 3ISPA 2P4WA 4PKCC 3OYJA 3TEEA 1J5WA 1PRLC 2M8EA 1XDUA 1GXPA 4ZTUB 4BE0A 3I55I 2QHUA 3G4ST 4QVDA 3TUPA 2JQ7A 4RB2C 4RTWA 1NM7A 1U0JA 2D6FA 1BN5A 2CH4A 1EKEA 2F4IA 3DTKA 5L8RE 2K9SA 1I39A 3DBRB 2DA7A 3J7AO 5C44J 2CUBA 3P5JA 2P0LA 4ELZC 1VOMA 1OZ3A 3OR2C 3EG2A 3BQYA 2ZFUA 3ULQB 2HYFA 1E22A 2AHJB 2JVVA 1OU9A 4M7DB 2R5ZA 4FTHA 4A3KJ 3HHGA 2NUTA 1R1TA 2CH4W 3CCMQ 4FT2A 4M77B 2FMYA 5EC7A 3AG1H 3CC2I 1IDYA 1RIQA 4RGXA 2A68F 2Q1ZB 1UJ0A 2IS6A 3EFSA 1NG7A 5DM7F 2QSFX 2XTIA 3E7LA 3EH1A 3LOCA 4ABZA 1YJ9I 2X6OA 3CCLA 2DNUA 3A1PA 3P8YA 3TW6A 4HT9A 3DLLF 4MO7A 4XSZF 1YNZA 3L4GA 1QVGS 2ADUA 2I5UA 1RAGB 1QF6A 4KISA 4FYVB 4PFOA 2FBKA 3ABLH 3CQZJ 1S5LC 3OYDA 2ZT6A 1W7PA 1M30A 2L3QA 4LVIA 3SHWA 5JI6A 5LFAA 1Y7XA 4EMKC 5LJ3g 2GIVA 3K1NA 5A0LA 3LA7A 3PIOF 2JRTA 3TSZA 4XU1A 3GXOA 4L9TA 2P4TA 3PL8A 5HS9A 1Z6RA 2DCEA 2HD0A 2RJFA 3QXEB 2WB1A 1PCXA 1M2VB 1IN5A 3PIPF 2KRHA 2AKKA 4JS5A 1O7LA 1KONA 2AXTC 3OS1A 4C3HJ 1Q7YC 2DJZA 4ZJZA 2AKWA 2RVCA 5LJ5h 2K9GA 3FIWA 2L7ZA 1LNWA 3DV8A 1GBRA 3RIRA 1T33A 2X1DA 1C0WA 3IV5A 2HQAA 2EILH 2XI9A 4BE1A 1FMWA 3CUQC 4CI0C 1TW3A 3TL4X 1B4AA 3C18A 2FZCB 1DUXC 4E7SA 4D0PA 4DNCA 4BACA 3C94A 2RHUA 3H9QA 2GCXA 3O5ZA 1MGQA 4C92A 1MBJA 1IGNA 4RLQA 1YN8A 2COYA 3DB3A 3LSQA 1NPRA 3HOYJ 4KN7X 3J7ZI 2W7NA 2CQKA 4NC8A 1D3BA 1YS6A 3M0TA 2ZCEA 3P8BB 2H27A 2XKPA 2QQ8A 1JTXA 4AUXA 2CFXA 5DUKA 3ER0A 4EMKB 3ZBDA 4EJTA 4YRPA 5F04A 4XU0A 3KP2A 3JCMW 1VQ9I 3ONQA 2J5OA 4OMQA 2DEQA 5F5WA 1SHGA 1M1EB 4RM2A 3PTAA 4AG1C 2K9LA 2GAUA 4H2XA 1NEGA 3HM5A 2CT3A 1W36C 3JREA 4J9HA 3RJPA 2YDLA 1NJ2A 1LVKA 3I56T 1VI0A 3CC2A 4JDSA 3OS5A 2V8JA 1Z77A 4G6QA 3CUQB 5M3FJ 1R4NB 4J9DA 2DO7A 2HQEA 2DRMA 1YJ9A 2WSFE 2JRMA 1PNJA 3EG9B 4Y17A 1ETXA 1B9MA 3NRVA 3QUIA 4QQ6A 2YX4A 2LNVA 4XICA 2ZBKA 1S72T 1U9NA 4BXXJ 2GTJA 3M57A 4Q47A 2W25A 3A8OB 4OWRB 4C5IA 2ABLA 3CXCA 2E6NA 3FIFA 3HTRA 2ZNYA 4P9FA 4KGVB 3E3VA 2CQNA 2GWRA 3TP0A 2ETHA 3EYYA 4RS8A 1USYA 2V26A 2DYRH 3ZMSA 1VQMT 1YIJQ 5DM7R 1YB3A 2PJRA 5GANd 3NQOA 4J7IA 2FVUA 5M3MJ 3CMEI 4BY6C 2JA5J 1NNHA 3H0DA 5D6XA 1EIFA 1KZHA 2CJBA 5J39A 2KRFA 4KGZB 4GYGA 3S1MJ 3TREA 3JCMX 2I2LA 2P0PA 4UV8A 2W48A 1JI8A 2DF6A 2XAQA 2LNHB 1XG1A 1WU7A 4M7AA 2QF7A 1PYSB 2R5MA 3ZOBA 1ETKA 4YROA 1KC8R 2DMTA 4IQJA 2QA4T 2LVMA 1E3OC 4PJJA 2RNJA 2M51A 1SFKA 1GHCA 1U5TC 4OVAA 4C2UA 3E9GA 1FOWA 3I4NJ 2NS8A 1C6VX 1G83A 2VOOA 3BP8A 3F6OA 1SFUA 3NAUA 4G7HF 5KAIC 1H8KA 4C0FA 1SANA 4Y33A 4CXFA 4M7DE 3DKMA 2FX0A 2ZCWA 3U1KA 2IRFG 4BUPA 2W10A 3EG1A 4LUEA 3H92A 4FT8A 4JYKA 2JA7J 3LQQA 3K4NA 3WODF 4LNPA 1VQ9A 2L0AA 3S3NA 3PE0A 3DBLB 5C3EJ 1IGUA 2MWPA 2OPTA 1QA6A 5F64A 4BY6B 1Z91A 2CZ0B 1VZ0A 3P7NA 1MDMB 4KGXB 2DU9A 4CCMA 1HC8A 3ECHA 2ARTA 3QZ5B 3DEEA 2CREA 4RG2A 4G6TB 3HSFA 3SZPA 2Y2ZA 3CCQT 1SKUB 2FB7A 4ZNXA 5IAYA 2QEXA 3LSGA 1N5ZA 2LLKA 1R49A 1OZ2A 1GXIE 2HDAA 1OCPA 2ZC2A 3T9NA 3PNYA 2RH2A