4HA8A

Structure of staphylococcus aureus biotin protein ligase in complex with biotin acetylene
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structure of Staphylococcus aureus biotin protein ligase in complex with biotin acetylene
rcsb
source organism Staphylococcus aureus
total genus 100
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ha8A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ha8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ha8A02
4O6JA 5TJJA 1QBJA 5LJ5g 5L3GA 1KYZA 4HV5A 4N9HA 4RAZA 1F9NA 4TWAA 1J59A 4L5IA 3KETA 3E6BA 3TO7A 3ZN0A 2I4NA 1LDJA 4IHTA 2ZBKA 3PCOA 5F64A 3SWNB 4HBLA 3EFSA 2R3SA 4H2XB 4BNCA 2AS5F 2STTA 4EO4A 3Q9VA 2KJCA 3KLOA 3JCMX 2CW0F 2PMFA 1HKSA 4MEYF 1X2HA 4P72C 4L5JA 1J5YA 4LK0F 4RGXA 1BI1A 2O0YA 3VB2A 2HOEA 2BV6A 1E17A 1BI0A 5A2QZ 3V7RA 4Y13A 3LQRA 4JQFA 4TVYA 4M78E 1HTTA 2VC1A 2IY5A 4Q48A 1FLIA 1WI9A 1LJOA 5LJ3j 2PBIA 5H6RA 3NEUA 3PCOB 1USTA 3N97A 2PMHA 1FYMA 4G6DA 3IG2A 3J80K 1R7JA 4EMHA 3DP7A 4FX0A 4I98B 4GYGA 3HSBA 1GGMA 4M75G 4CGZA 2WTEA 1FPQA 2R7FA 5L3FA 3W6JB 4P73A 1ZG3A 4IJAA 5HLIA 1Z7NA 2AMCA 2IP2A 5LJ5h 3CO7C 2O61A 3HOSA 5LHIA 2IY5B 1T6SA 1NJ5A 2O6GE 2DW4A 2COMA 4JBAA 2D2WA 3I64A 3L00A 1YFHA 2Q0OA 4EMKA 2A5YB 3RYRA 1TW2A 1RZ4A 2Y0MA 1WQ7A 5HS9A 2BYVE 2EFWA 1EVKA 1IN5A 3F22A 5BPDA 2H94A 1UHMA 5GAMe 4M7AG 1LEBA 3FZVA 2LF7A 1WSUA 4CYDA 1F4KA 5ELNA 4M77E 3J81K 1KU2A 4K2EA 2CWEA 3R0JA 4Z2YA 1Z7UA 2AMCB 3ISPA 4CH4A 3SHFA 1WYDA 2ZMEA 1U3EM 2GQQA 5K1YA 2LKPA 1TNTA 4A5NA 1BBWA 4GYIA 2DJZA 1TTYA 1T98A 4O3MA 4EMKB 1J0RA 3KCCA 1QZZA 3IWZA 3HTZA 2YPRA 2E65A 3JB9H 4PG3A 2PFBA 2PLYA 3MAJA 2RC4A 1EOVA 3QPTA 3LQQA 2X4HA 2E3CA 2OZ6A 4ENJA 4M78F 3REXA 2XASA 1M8VA 1OPCA 1R5HA 1HK9A 1N9RA 5GANd 4LMYA 4KMUX 4CO8A 1DUXC 2HQNA 1XMKA 2ZMEB 4G7ZF 1MD0A 1DPUA 1N9WA 1T0FA 2MA3A 2OAZA 4KUMA 1WQWA 2M8EA 1FWZA 1HW5A 1LEAA 4M7DE 4OIPF 3F8CA 3GXOA 1OYWA 4NB5A 3JCMQ 3TUPA 4TTVA 1R58A 3T0YA 1ZG5A 3SWNC 4XTVA 2IW5A 3E5UA 4UVBA 1B59A 1Q1HA 2VE9A 2CQKA 4C8QE 4AIKA 5LJ3f 3G1ZA 3RI4A 4YCVA 2IPQX 2GWRA 2HKOA 2V6CA 4YREA 1S29A 2HQRA 5CVVA 3ZMUA 4YCUA 4E70A 4HX4A 2QBYA 4ESBA 2OD5A 2RM4A 1XGMA 2GXBA 2K02A 3HRSA 3JB9D 1WQ2A 3E6MA 1BBYA 4M77F 4IRGA 3DXJF 3ZQ7A 2PEXA 4RS8A 3EDPA 4B09A 1B6AA 1YG2A 1UHWA 3PFIA 2HWVA 5D6EA 2CJ9A 4RGSA 1FSHA 3JCMW 3V7SA 3WTZA 1NJ1A 4HLYA 4HWPA 1X55A 2CO5A 3ELKA 5C53B 4HWTA 2KRFA 4WXCA 3M9AA 2QBYB 1ZN2A 2Q7GA 1KU7A 2QHUA 4XQ3A 2YX7A 1FBSA 3WU1B 5LJ5d 3NQOA 4G84A 1C0AA 5ED4A 2MLGA 3K69A 2ZNYA 1P2FA 1O3QA 3WE2A 3HXUA 1XSDA 3EYYA 2XIGA 1NYRA 5E3IA 4WJ3M 2PMUA 1USSA 1TH7A 1KQ1A 3HY1A 4I02A 5DCFA 3J7AO 5GAMh 4NQWA 3HSFA 2VC8A 4RQEA 1E1TA 3WODF 4M7DF 1XD7A 4P73C 5GMKh 4KQEA 3DV8A 2ARSA 4QVCA 5JVTA 5K5QA 3F6OA 3COAC 3TGNA 1BC7C 3QU6A 2EV6A 2PN6A 1T38A 4UP8A 3IALA 4HOBA 3RERA 5E18F 3QAHA 3A7RA 4EJVA 1XDSA 3VODA 4G94A 1G5IA 3P9CA 4F7UE 2IVMA 1FYLA 4C8QF 4EMKC 3QHSA 3OD1A 5GAOm 4U0YA 3JCMe 3KP3A 4UUVA 3WQZA 3RACA 3QUIA 4M6XA 2EK5A 3GEZA 1R00A 2TDXA 1P4WA 4I0BA 4C8QG 5IT9K 1YFTA 2EV0A 3M7GA 5LEJA 1IN4A 2K86A 4HWSA 2ZT6A 3TEGA 4XBFA 3J80Z 4A53A 5A2QK 2DU7A 3FMRA 2VOOA 2DZCA 1EVLA 3KLNA 3A5YA 5ICEA 4TQFA 5E8GA 4YRPA 3QRFF 3UH0A 2FEZA 3JW4A 2QUFA 4IRHA 4M9ZA 1PDNC 1FOKA 4JRIA 2CIMA 4PJOG 2EV5A 3LA2A 4EV0A 1XGNA 2ZFWA 4P9FA 3L1AA 1HW1A 1QQIA 1RIOH 3V8KA 1AOYA 1SFXA 4AH6A 3JB9I 2VXEA 2UXXA 2QQ9A 5LGUA 4RDXA 5H6QA 2A3SA 1EFWA 3JCMV 1UFMA 4A12A 2RNJA 3KEOA 2DTIA 4HDUA 4RB3C 3C3WA 2M5WA 4IRIA 3OOPA 4LGWA 1YYVA 2EFPA 1SAXA 2ZR3A 2XAJA 4YRFA 2DLLA 5DUKA 1ZHFA 3R60A 3J81Z 2FBHA 2OQGA 5BPIA 3QTCA 6PAXA 4ZYGA 2FYKA 4PDKA 4P75A 4XTWA 5GAOl 3LSQA 1SD6A 1JHFA 1P4XA 3IRQA 4ZYHA 4YRTA 4IF4A 3JB9J 4G8XA 1K6OA 3MCZA 2CYYA 1TQPA 3C1DA 3M4QA 2L4AA 4BYYA 2KJBA 4V2SA 4P71A 3I58A 3JCMg 4HX7A 4F7UF 4HWRA 2QVOA 5DY9A 4HX8A 1I1SA 4YRGA 4A0XA 4YRNA 1LJ9A 1FBQA 5HS8A 4XTZA 3TEHA 2FU4A 1STZA 4H2VA 4H2UA 4KN7X 3BJAA 3LC0A 4G85A 4YCWA 2Q5HA 4EM1A 4EMGA 4C92A 4I0AA 1OMIA 2DFIA 4RAYA 4ASNA 3H3UA 2ZXFA 4E51A 5L3DA 4WWCA 5E17F 2EL9A 4LLNA 2XTIA 2E1NA 5EEHA 2JSCA 1UB9A 1TLHB 4WJ4A 2DTHA 4UHTA 5LGTA 3NEMA 2CSOA 4OINF 2CJBA 5GAMd 5CYVA 4J15A 2HDCA 1G5HA 5FD5A 3TEHB 2XAHA 2C7IA 2VOPA 4CDGA 1KGSA 4ZYDA 3DF8A 2HTJA 3D5LA 1ZARA 5I21A 1YB3A 2HEOA 4F7ZA 4C92B 5LBQA 2L4MA 1WRJA 2IRFG 2ELHA 2P5VA 2DT5A 1MKMA 3MWMA 2STWA 2QYOA 1J9IA 3JCMh 1RI7A 1Y0UA 4XTXA 2D45A 2HGCA 4Y91A 4MTDA 2OA4A 2YHTA 2H09A 3I7FA 1BIAA 4HVCA 5GANj 1ASZA 4M75E 4ENMA 2VODA 5HDNA 1L0OC 2VBYA 3LA7A 3IKVA 4XLNF 1D5VA 2W85A 2EAYA 4X5OA 3JTGA 1KU3A 1FSEA 4MHGA 1XMAA 4HWOA 2NNYA 2RVCA 5HS7A 4K87A 1XN7A 4G7OF 5J8CA 2DTRA 2QHSA 3EFRA 4UPAA 3HRTA 4YRCA 3SXYA 3M8EA 5GAN2 1MDMA 4BXUA 3BP8A 2J5OA 1FNNA 2ZCEA 2FBIA 3GWZA 4RB0A 1O3TA 2EFNA 3B73A 1KOGA 5BS6A 1ONVA 3MEYA 5GANh 3BJ6A 1OKRA 1J7KA 1MJAA 2QTXA 4M7AE 2G4CA 1T2KA 4EQQA 2A69F 1RIQA 1GVJA 4IXAA 1IN7A 4XEOA 3CO6C 1JBMA 3HTUA 12ASA 2E64A 1R36A 1NNHA 4OP0A 1P6RA 2F5EA 2QHVA 1MDMB 2NYXA 5FFZA 4I2OA 4PNOA 1HW2A 3L7WA 3E5QA 2FXAA 4I09A 3IKMB 1JE8A 3F3XA 3I71A 2DPDA 2GZWA 1G6NA 4OMZA 3K1NA 5J8FA 2VT3A 3RL6A 4WK8F 3VQWA 1WWXA 4LB6B 3QO5A 3WTUC 1LDKB 3RJPA 5D5WB 5IT9Z 2MD5A 3FIFA 1YS6A 3DFGA 3QNEA 1BJAA 4YIIA 1XCVA 4Y17A 4TVWA 3IHUA 1H4QA 4PGGA 4N9IA 5LJ3g 4P75C 3KZYA 2ZKZA 4QWQA 2G7HA 5BOXA 5K1XA 4YRMA 5LJ5j 2EA4A 2P5IA 1SRYA 3TOAA 4FHTA 3FF5A 2P0LA 3NELA 1XB4A 2XAQA 1W7PD 1I81A 1LNXA 3JAMK 4M75F 1U1TA 3DQVC 1RUOA 4P71C 2XKPA 1U2WA 2IA0A 2Y90A 2ADUA 2LF8A 4UNOA 1BM9A 4JK1X 2QHTA 4KYWA 5E1XA 1W4MA 2E7WA 3SZPA 2D1VA 3KP5A 2VBWA 1YIOA 2FMLA 4HAMA 11ASA 3MF2A 2EJGA 3HY0A 4M78A 5CVJA 4RGRA 3QP6A 1M5Q1 5TRDA 1B76A 1W7PA 3P8TA 4EGYA 5LLQA 4MTEA 2Y75A 5GANf 4M7AF 2FOKA 3TKYA 1H4SA 3CUQA 1NYQA 2EJRA 1Z05A 3GO5A 1QPMA 3JCMd 1KQ8A 3GFJA 4M77D 2RV8A 2YU3A 5CVIA 3LAJA 4AIHA 2GAUA 1QF6A 2MC3A 4RCCA 1B9MA 3HRMA 3H3ZA 3ZMSA 1P92A 4M78B 2ZR2A 3JSPA 3JSOA 2DVEA 2OQRA 3PQJA 3F8NA 3LFKA 1IW7F 1W7PB 4LJZF 4MNUA 4CHUA 1ADYA 3HHHA 4QVDA 2P6TA 4OIOF 4M73A 3A31A 3CUQB 4YRSA 4PCQA 2P7CB 2K4JA 4KFCA 1LOJA 3JCMb 5DEQA 2VN2A 1MJ9A 3QO7A 3U2RA 3VOEA 4M77A 2AXLA 1K79A 2LNBA 4XU1A 5ICCA 2B0LA 2XGXA 2JPBA 5DYMA 3ECOA 1BI2A 1B9NA 1TNSA 4N0BA 3QO8A 3I5UA 3T8TA 2HZTA 4ZZDA 2J5PA 2FSWA 2QWWA 2W24A 4RB2C 4Q5SF 1BIBA 4H0EA 1CF7A 1ZRDA 4A2UA 2XRNA 3RDIA 3DPLC 1E22A 3T8RA 4EX5A 3P9KA 4M77B 1FP1D 3UGQA 4YFNF 5JHUA 2E10A 1JHHA 4KT5C 5LJ5f 4YG2F 5ICFA 4UVAA 5D5UB 4UP9A 4M9XA 1E2XA 4KNYA 2HTSA 1R5GA 4M9SA 4N0AA 4L0ZB 4EMSA 1KYWA 5IT3A 4JRKA 1YGBA 4M7DA 3BY7A 4XU3A 4Y15A 5GMKi 2HKXA 1FT9A 1IXSB 3I0TA 2M45A 1W66A 3WGHA 3D0SA 3WTXC 3GIBA 2YX4A 4PJOE 3GZ5A 3HSEA 2ZINA 3MZYA 2W57A 1YO5C 4YIFA 5HLGA 1X56A 3KE2A 4C8QA 2M87A 5LGNA 1O3RA 2V1DA 1YW7A 5GMKm 3OV8A 3G73A 5GAMj 2PG4A 1YFRA 4EJUA 2YLCA 5GMKj 3NENA 2AKWA 4M7DB 3KFWX 1KQ9A 1PP8F 4UV9A 2RDPA 3C7JA 2PJPA 4A0YA 3FX3A 3SZTA 3A32A 4AWXB 4RQFA 2XAGA 2M1BA 2L54A 1IXCA 3CMQA 4O2DA 3RKXA 1U5TA 3RPQA 4WI1A 2XROA 5E1WA 1Y96A 2ZT7A 2L01A 2P8TA 3F23A 4XU0A 3E9HA 3R07A 5L3CA 4IHSA 4EGZA 2F5DA 1B70A 2V79A 2V9VA 5LRRA 4L9VA 3NRVA 3O6BB 2AKWB 2ZT8A 2HR3A 4M78C 4P3OA 4KDPA 1YTYA 1DPRA 2ZZGA 1SERA 4NHJA 4KIBA 4DNCA 2ISYA 1BOAA 1MGTA 1J75A 2HYGD 3Q5FA 2J3MA 5HLHA 3EETA 3FXQA 3CUQC 1SFUA 1U5TB 1PUEE 1Y96B 1F1ZA 1Z6TA 4CS3A 2MLKA 5ILSA 4UVCA 2ODRC 5GMKl 3JAMZ 3ULQB 1T39A 2A61A 2NRAC 3A7AA 2Z3YA 4P9UA 2F5FA 2E1CA 1GHCA 1EH8A 1IN8A 4XU2A 4PJOF 4MMKA 3T5XA 1FP2A 4LG0A 5E8IA 1QZYA 3IWFA 2KKOA 3K1MA 4F7UA 4YRJA 4A6EA 3DSQA 3ZMVA 4IPAA 3JB9F 3M4PA 3DEUA 4AD9A 1E1OA 1WU7A 4OLFA 3HFNA 4GCVA 4LD5A 4ESJA 4UV8A 3WTTC 3U9GA 1OR7A 2IJLA 3WGIA 3HTSB 4M77C 2CJAA 3GFLA 2QLZA 2GXGA 3CTAA 1FZPB 3JB9G 1VQZA 2QM3A 3GUDA 1H4VB 1X54A 2VE8A 5DCMA 1U78A 2I4MA 5CVRA 1KA8A 4M74A 4ZH4F 2Q2EA 1K7AA 2Q7EA 4OU0A 5D4SA 3ROUA 4LG0B 3F72A 4EM2A 4F7UB 3ML6A 1R22A 4MEXF 4CH3A 2FF4A 5FD6A 4BQAA 4U7DA 3VFZA 5E1ZB 1HKQA 2XV4S 3E97A 4I7HA 2DK8A 5GAMf 3IKTA 2P7VB 4XSXF 3WTYC 1B7YA 4LB5A 2QENA 4HLXA 4C92D 2VBXA 3E6CC 2RGVA 3M8FA 5FB2A 3VQYA 3FB9A 5GAN5 4HT9A 3P7NA 5DCMB 4ON0A 1I27A 2DI3A 4PGHA 1EIYA 1NJ6A 4HQEA 1SD7A 2NNNA 3T1BA 3V8LA 1PYSA 3I4PA 2HNIA 4N0AC 4PHCA 2DAOA 3A5ZA 5GAOn 4M7DC 2O3FA 4YFKF 4O5VA 4HT8A 5J6XA 2K57A 1B7YB 5GAN7 2DU5A 3HXZA 3RTRA 3MQ0A 1NJ2A 1YW8A 4S05A 1XGSA 2LDUA 1PP7U 2Z9OA 1EIYB 1FX7A 5E20A 3BY6A 5GAOq 3GYHX 1G3YA 1S7OA 4YYEA 4OIRF 1PYSB 2K27A 2Q8KA 3RYPA 4YRIA 4ZYEA 2DK5A 3IRRA 2ACJA 1HSJA 4P55A 1ODDA 1TQIA 2FBKA 5D4RA 1B1BA 4RGUA 5CLSA 2R7DA 3I54A 3WGGA 1KQ2A 5DD8A 3ZN1A 1DDNA 3C18A 2DXTA 1MJBA 2H6CA 1G3TA 1S7AA 2A6HF 1IL2A 1MZBA 1U5TC 2Z33A 1HKTA 1IXRC 1BC8C 2XAFA 2MH2A 5HGQA 4HF1A 3QU3A 3AHUA 4OMYA 3REUA 4JUVA 3LA3A 5LJ3e 3L4GA 5KNNA 4M75D 2MH9A 3WTVC 2WC2A 1RUNA 3V4GA 3K0LA 2JT1A 3ABTA 4EVIA 3ZP5A 4A6DA 2XHKA 3G3ZA 4K86A 3GF2A 3O3KA 1HXDA 3TO6A 1ZLJA 3KFUA 3A74A 5EEGA 2DEQA 2V1XA 3O2PE 2VONA 3VQXA 4EJTA 4NL3A 2ZNJA 3L4GB 4KIGA 5K5OA 4J6WA 4M75A 3SQNA 2EWNA 5D6FA 4M7AD 3HFZA 4HZFA 5DUIA 4MQVA 3HXXA 2BBYA 4RCBA 1WNLA 1TQMA 1QO0D 5CVUA 4YFXF 3SFZA 1XGOA 2EA2A 4P74A 2VBZA 3IL2A 3SWNA 1QNTA 3JTHA 2G9WA 3GFIA 3JCMJ 5FGMA 4CS2A 1MGQA 2VC0A 1BN5A 1J5WA 3CDHA 1ZAOA 4BHPA 1KMMA 3HRUA 2ZCWA 4R1HA 1IN6A 2Q5IA 2ISZA 1G4DA 4M72A 2FRHA 4M75B 2C8MA 3CLOA 4M7AA 3HFZB 3F8FA 1ATIA 3FJPA 3BW1A 1NHAA 1H9TA 3ZMZA 2H6BA 1ZH5A 3W6KB 4X9CA 1R23A 4P5OA 3TDZC 3HFOA 1C0WA 1FC3A 3JCMf 3IKLA 3QSUA 1WLEA 3FMSA 1YS7A 1B34A 1D8JA 1E24A 2D1HA 4XSZF 4M78D 2ETHA 1KU9A 2ZJ2A 2VXFA 4J5YA 1UCRA 5CJ9A 1SMTA 4G9YA 3VBBA 3GFMA 4H2YA 4DQ2A 5GAOp 4OOIA 1HQCA 2UZKA 4NCXA 4AIJA 3K2ZA 2ALYA 4KN4X 4UP7A 4M7AB 3LSSA 1FBUA 1SFEA 1ZGJA 4MQ9F 1XCBA 4CH6A 3QP5A 2QQAA 1YFSA 1OYIA 2KIMA 5ERIA 1IAWA 3QPHA 3A7UA 2CG4A 3R4KA 4H2WA 1Z9CA 5D8LB 1I1GA 2ODRD 1EH6A 2BEOA 3P9IA 4L0YB 5GAN3 2O8XA 4HW0A 3VEPA 1B34B 4YRQA 2ESHA 2OZUA 4C92C 3GX4X 3FWEA 1B4AA 3BOQA 4HA8A 1LB2A 5ILUA 4NOYA 5HOOA 3L9FA 1SMYF 3E5XA 1QE0A 2ALYB 1O7FA 2YSRA 3BDUA 1ZYRF 3RKYA 2A07F 4BAYA 2EJ9A 3WG9A 3INZA 2ZIOA 1S8NA 2DQLA 1FYKA 2WV0A 3HXWA 4KICA 5GAN8 1G3WA 1IUYA 5D8KB 4I01A 3DPTA 3V7CA 5LJ3h 1USYA 5KK1A 1ZRFA 3MEXA 1YCYA 4LFUA 1D3BA 1VTNC 4ZIBA 4ENKA 4KMFA 4B8XA 5FFXA 1FY7A 4OIQF 2RHSA 5D5XB 3HOTA 1AWCA 5GMKe 1QGPA 2FNPA 4BH9A 4U88A 1EV7A 2W25A 1X01A 4H02A 4TV7A 2L02A 4KR3A 5DD4A 4P96A 4S04A 4XTUA 5JR3A 2JZYA 1HBXG 5GAOr 3AAFA 3LAPA 2P4WA 4KIFA 4CZZA 3NETA 2H27A 1D3BB 3JCMP 3U1DA 4HDVA 5KVRA 5HVQC 3LWFA 2CGHA 2ZZFA 3EQLF 2Z99A 3I53A 5H20A 2RHSB 5ILVA 4HQMA 1O3SA 3I59A 4M7DD 2ZZEA 4MGRA 4GXOA 4Q6GA 4BWAA 4CH5A 4ENNA 2FNAA 2I4LA 3HXYA 4M78G 1WPYA 4M75C 2ARUA 2E1HA 2PI0A 4JLIA 3F6VA 2DDZA 4A5MA 2DXUA 1JJCA 3KEQA 1F5TA 4C8QD 2ZO4A 4D0PA 3WTSC 3HUGA 1GXPA 4ESFA 3P8YA 4BHBA 2WWYA 2VXZA 2V1UA 3ZPLA 4P74C 1TW3A 3GW2A 5FO5A 3SB2A 3LSTA 2RQPA 1L3LA 4P3NA 1YW9A 1ZG1A 4L18B 3I59B 1S6LA 4QLCU 1ADJA 1ZGAA 3BPVA 1CF7B 2ZT5A 1XSXA 3KP2A 3RPUA 2CGPA 5CAIA 3HXVA 5DV5A 1R1VA 1P4AA 3L2ZA 3FXRA 5GAMg 1I8FA 1KMNA 4PJOD 1YLFA 2JPCA 4CICA 5F1RA 2W84A 4M7AC 1O7LA 3VQVA 1D8KA 3BJOA 1LQ1A 1JJCB 2A68F 1J2XA 2GIVA 4K88A 2E5AA 2EJFA 2RHQA 2DQ0A 4TVAA 1Z7MA 4RMFA 1BBUA 3VU3C 4IVNA 4BHCA 2ZNIA 3GVAA 3K9TA 4M77G 1D3YA 4YRRA 1I6XA 4FT8A 3S2WA 4WX9A 2NAZA 2ESNA 4HF0A 2ZGWA 2DQRA 3P8VA 2XUBA 2A6EF 4PJOA 3HYIA 1FYFA 5LHGA 3BJUA 3QO3A 5LRSA 1I5LA 2XKOA 5AIPA 2K4BA 4TQDA 4C8QB 1V4RA 2DPUA 2RA2A 1SD4A 4MMLA 2RHQB 4TVAB 1LDDA 2HS5A 2JTVA 4H2TA 4HF2A 5FLXK 2VT2A 2DO7A 2L3DA 3FM5A 4J6YA 1H9GA 4U7BA 4L9NA 5LJ3d 3KP4A 3M1EA 4GGGA 4XTYA 2JRTA 2XGTA 1Z91A 4A54A 1K78A 1H0MA 4X9DA 1G3SA 4YRLA 4ZTZB 1RNLA 1U1SA 4ZZLA 4PJOB 5JI6A 4GO1A 3B02A 3WE3A 3W3SA 2MBFA 4CXFA 2KIUA 3BDDA 3F21A 4G7HF 3PGGA 2FMYA 4YDQA 2EB7A 3BPXA 4M7DG 4M71A 1IZ1A 3F8BA 1X3UA 2LSOA 5D5VB 1B70B 4Q4ZF 1USYC 3GLXA 1ZREA 1JGSA 1U8RA 4WXHA 1YQAA 1B8AA 1JRIA 1K78B 5C52B 4L9JA 4UXNA 2ARTA 2E7XA 4LNSA 3KZZA 1I4K1 1IRGA 3ECHA 4YRKA 1L0WA 3DKWA 3HIFA 3ZMTA 4P3PA 3WTWC 2EFOA 2FE3A 5K1PA 2G7UA 4CS4A 4EJWA 2DU9A 2I2LA 1ON1A 2QQBA 4AVPA 4WF2A 3CJNA 1XDUA 2FB7A 1KQ0A 1ON2A 1V3FA 2K7LA 4XEMA 4WCGA 4XLPF 3RIRA 3BZ6A 1O57A 3HRKA 3HSRA 1WKMA 2RB6A 4R79A 2P5KA 3UGTA 2YR2A 5BQTA 3K1PA 2GA1A 3CUOA 2KIFA 3KP6A 2O03A 1NJ8A 5GANe 3IC7A 2FA5A 1SESA 3RESA 2OBPA 5L3EA 2I4OA 4M6YA 3ERRA 2GA2A 1G51A 4ZTUB 2ZNZA 1DP7P 3ZMDA 4YPFA 3MFKA 4P72A 2P5LC 5JFRA 3HFVA 2DZ9A 3R6SA 3R0AA 2RN7A 3RKWA 2UXNA 5AONA 5AIQA 2M30A 1HSTA 3TO9A 1LNWA 2PQ8A 5LEKA 4C92E 3RF1A 1IRFA 3ICAA 5C51B 3L09A 1S3JA 3RUXA 1R1TA 4HYEA 1CGPA 3BFMA 2DQ3A 2JN0A 3H92A 5K5RA 2OU2A 4LK1F 1H4TA 3E6DA 1JXSA 5HDGA 5ELOA 3PZCA 4C8QC 4F7UG 2ZXJA 5ICGA 3BROA 1ZRCA 3MF1A 4DPGA 1R1UA 4WXDA 1HC7A 1ASYA 2J3LA 4FX4A 1I5ZA 1LYLA 1SETA 3TDUC 4BW9A 2BGCA 2IA1A 3V8JA 4RB1A 3HHGA 4PJOC 3HRIA 1H641 3N4MA 2XVCA 1EH7A 1U6GA 3RGLA 4Q15A 3QOPA 3EUHA 5GANg 2HYFA 1N9SA 5LJ5e 1BI3A 2CFXA 1SD5A 2Q7HA 3R61A 1XSVA 2C6YA 1Z6RA 4G6QA 1LVAA 2FQ3A 2QZ8A 2Y48A 4KA4A 3KP7A 2RKHA 4J6XA 2RD1A 1GXQA 2IT0A 5GAN4 5F5WA 4HV6A 4Q47A 4LLLA 4ETSA 1Z1DA 3M4GA 2F2EA 3WU0A 1ZLKA 1EQRA 5GAN6 1ULYA 5F6FA 5DDGA 5L3BA 3FM3A 3F8MA 2Z5UA 3EYIA 4KR2A 3MZHA 3Q9SA 4YP0A 3UFGA 2BE5F 4C92F 3ABUA 2P6SA 4L9TA 2UWMA 5BMZA 1IF1A 4LLGF 2F5CA 2X0LA 2IA2A 4XRFA 4H2SA 3REOA 1REPC 5HDKA 3E3VA 4C92G 3BWGA 2EFQA 1W5TA 2YLBA 3TOBA 2DTOA 2E41A 1TBXA 1X2GA 2NS0A 4U0VA 1W5SA 5FLXZ 4L87A 4YROA 4EM0B 2DKGA 3PQKA 3FMQA 4H2XA 2ZIMA 1A04A 3TQNA 4NL2A 4U0WA 2ZTGA 4EJOA 3FHZA 4R8HA 2PMEA 3E9IA 4PZJA 2DBBA 4A0ZA 5LHHA 3GZ6A 3FXUA 1OYYA 3JCMc 2HFHA 3L2CA 3ERED
chains in the Genus database with same CATH superfamily
5TJJA 3S17J 2XK0A 1K9MR 5L3GA 4N9HA 1YHQA 5IT9E 4TWAA 4CZCA 3FBIB 2EQIA 5FLMJ 2JUCA 5CQYA 1ERDA 2AT1B 2AS5F 2KJCA 3KLOA 3CCRI 1HKSA 1J5YA 1SFOJ 4RGXA 1BI1A 2NYSA 4TVRA 1SRLA 3V7RA 3LQRA 2LD5A 4JQFA 4QTRA 1Y71A 1HTTA 4TVYA 2VC1A 2IY5A 2K2VA 1SKUB 4QQ6A 1USTA 3IG2A 5LFAA 5DM6F 1GGMA 4GYGA 3HKSA 2MFZA 4BY6B 1H8KA 4BI3A 2R7FA 1AWWA 4P73A 2H8HA 4KT0E 2WSEE 4Y52J 3HOSA 2IY5B 2O6GE 2DW4A 2D0NA 2D2WA 3L00A 1JU5C 2CMPA 2A5YB 1RZ4A 2Y0MA 1ETQA 1G2HA 2L2PA 5BPDA 1KD1R 5GAMe 3ABMH 1Q86U 4CYDA 3LOCA 4DA4A 1KQSA 1OLTA 1KU2A 1UG1A 2L9VA 1DJ7B 3KYLA 3SHFA 5K1YA 1IDZA 1TNTA 2EZHA 1E7OA 4O3MA 1J0RA 1NLPC 3OYFA 3L2RA 1ABQA 1X3ZB 3LFUA 4PG3A 1K4US 2PFBA 2PLYA 2R4GA 1EOVA 2H8RA 2DMPA 2RQWA 4PUSA 3REXA 4IKFA 4RTYA 1R5HA 3M07A 4KMUX 1DUXC 2LMDA 3GTPJ 2IPOB 5IHKA 1N9WA 1E3PA 2CDTA 5FKOA 4HCZA 1RC9A 4BQNA 1BB9A 4OIPF 1OYWA 4IO9F 1Q7YR 4XTVA 1Q1HA 3UKGA 2IXSA 2VE9A 3DWLE 5D6WA 2O7OA 4C8QE 4BY1J 2KQWA 4AIKA 4E7HA 2X6WA 4YCVA 2IPQX 2V6CA 4YREA 3LYIA 4YCUA 2CU7A 4HX4A 4ESBA 1VQ5Q 2HAXA 3HRSA 2AZSA 4IRGA 2DL7A 2DMOA 3EDPA 4B09A 2E3HA 1YG2A 3MKYB 2IEKA 2WAQN 2HWVA 5D6EA 2CJ9A 2UV1A 2FHDA 3JCMW 4BY6C 3K4NA 3I9QA 1NJ1A 4HWPA 3H0HA 4B44A 1BL0A 3F0CA 2Q7GA 1RPWA 2QHUA 2DO3A 4XQ3A 2FEIA 2AHJB 2ZNYA 1O3QA 2KIQA 1JQQA 4YTLA 5E3IA 2XIGA 2MCNA 1YP5A 4I02A 5DCFA 4JX5A 3J7AO 4J9HA 4NQWA 1JB0E 4M7DF 4P73C 1B72A 5GMKh 2RMOA 2ARSA 4ABZA 4QVCA 3VWBA 3I5SA 3TGNA 1XQHA 1BC7C 3QU6A 2EV6A 1T08B 1T38A 2JZ2A 1TL8A 4G94A 1G5IA 3P9CA 4ITVA 3OD1A 3CCMA 1X75C 1VQMQ 2HOSA 2VYTA 2EK5A 3DLAA 5C6SA 4NQWB 2QA4T 2OTLA 5DLQE 1B72B 3TEGA 2CT4A 4FSXA 3VPRA 1LPLA 1YJWI 5A2QK 2R7WA 1N27A 3FMRA 5F04A 3SEMA 1UZCA 3A5YA 1VQ6A 4TQFA 4YRPA 3G71I 3UH0A 2FEZA 3JW4A 1PDNC 2AO9A 2FZKB 4A4EA 4WCIA 3LA2A 4I99C 3CC4I 1MNDA 4P9FA 3L1AA 4AH6A 2UXXA 3AT1B 4C2TA 1K1ZA 3R6NA 2GOMA 1FTTA 2A7YA 1HF0A 2FBHA 5BPIA 2I0NA 4PDKA 2COYA 1SD6A 2BZXA 1WHJA 4JS4A 1WJRA 4HNTA 1WX6A 2K9NA 2OCEA 2V9PA 1KZHA 3GF5A 2KJBA 4HWRA 3TU4K 1I1SA 4YRGA 5EC7A 1LJ9A 1FBQA 5HS8A 2DMQA 1LFBA 1DP3A 2BY1A 4CC4B 3OMCA 4H2VA 4EM1A 2J6KA 2EYYA 4ASNA 2EZLA 1NK3P 4LOCA 4WWCA 2EL9A 4ZTJA 1I3AA 1UB9A 4UHTA 2F4IA 5EG0B 2CSOA 2BHYA 4J15A 2HDCA 5GTHC 1VIEA 2XU8A 2IAIA 2C7IA 1KGSA 3E7LA 3D5LA 1G2BA 1OI1A 2LP5A 1WRJA 2K5CA 2ELHA 1VQPT 3DKYA 4J83A 4KGXB 3LGFA 5B1AH 4J7FA 3E9GA 1Y8QB 2D45A 2OA4A 4XLCA 2NS7A 3P8BB 2P4RA 4HVCA 4M75E 5L23A 2CZ7B 3MEAA 3TQ7P 1KU3A 1FSEA 5HS7A 1XN7A 2KRSA 2KYMA 3KYDB 4YRCA 2LMJA 4II2A 3DLLF 4A3MJ 2J5OA 1FNNA 1KIKA 3SHWA 1FMWA 1VQNI 2ME6A 3FK6A 2EFNA 1RKTA 3HEFA 1KOGA 1RETA 3MEYA 2FPEA 3FDRA 3BJ6A 1RRJA 2XIDA 2G4CA 3EFOB 2QEXT 2RQVA 4HCCA 2A69F 1RIQA 4CCNA 4C0ZA 1WXBA 5M5YJ 2QDLA 1W1WE 2VGMA 12ASA 3CPWA 2E64A 1NNHA 2MSYA 2QHVA 5FFZA 4I2OA 1HOMA 3CQTA 2LRDA 1I5OB 1OJLA 1I0CA 3PUBA 1SC7A 2RJDA 4XM3A 4IX7A 5AT1B 1KSWA 5J8FA 3MP8A 4WK8F 3OYGA 3FIFA 4YIIA 3IHUA 3KZYA 5BOXA 1VQLT 1KHIA 2OC6A 4YRMA 2P5IA 2M02A 2BZTA 3TOAA 3FF5A 2EFIA 1I81A 3JAMK 3A02A 2D8HA 4RUGA 4Y92A 4OMLA 1ETXA 2LF8A 3LMMA 2RQUA 1U5SA 5E1XA 3E1SA 2E7WA 2VBWA 2FMLA 4HAMA 1ZSZA 2VL8A 2EJGA 5EZHA 5CVJA 1ZLMA 1W7PA 4MTEA 2FOKA 4DYQA 4RDUA 2X1DA 3CMMA 3CUQA 2EJRA 2XSDC 1Z05A 2L3QA 4FISA 3JCMd 1KQ8A 3HPGA 3LSRA 3GFJA 4AYBN 4M77D 2RV8A 4MDXA 1ZHIA 2CUZA 2K7AA 3M0TA 2LJ1A 3H3ZA 2QASA 2OQRA 4L5EA 3F8NA 1POGA 3HOZJ 1W7PB 4LJZF 3L1PA 4MNUA 4OMFB 2EGAA 1WHMA 3CUQB 3MEWA 1X2QA 2K4JA 2AXTC 5CQGA 3QYGB 2JMAA 2LNBA 3IH3A 2B0LA 3MP1A 1GXIE 1AKHA 3QWYA 4XKWA 3I5UA 3T8TA 2HZTA 3VUZA 4ZZDA 3DEWA 4XN0A 2QWWA 3RR6A 2KZGA 1ZRDA 2A3LA 4CRIA 3RDIA 1TWGJ 3GTJJ 4EX5A 3P9KA 4AFQC 2E6NA 2Y4XA 2GQVA 5ICFA 4UVAA 4KT6A 1AKHB 5CQEA 1GV2A 2HKNA 1Q81C 1QA6A 1KYWA 4M7DA 3CCEA 3BG6A 2YDLA 4NC7A 4MO7A 4Y15A 5GMKi 5FKLA 1VQ8A 1FT9A 3I0TA 4AFUC 3D0SA 3WTXC 4NC6A 3HSEA 2O9LA 1YO5C 3EGXA 3ZEHA 5HLGA 2GFUA 2M87A 1YW7A 3OW2P 2LT4A 3G73A 4Y33A 3JRHA 3CCUA 1YFRA 2YLCA 2B9SA 3NENA 2GOXB 2ZPHB 4C0DB 2AKWA 4M7DB 2XDDA 1KQ9A 4C9YA 1JO8A 4UV9A 2PJPA 4RG2A 4GDFA 3MKLA 2XAGA 3CCVA 3MEVA 1AEYA 3EGXB 1MMGA 4O2DA 4WI1A 3CMAA 4XU0A 3R07A 4A93J 2N8GA 4IHSA 4EGZA 5FLVA 2CSIA 3NRVA 2AKWB 2QG9B 2HR3A 3W6VA 4KDPA 1ZR2A 2K4YA 3OW2S 1DPRA 4NHJA 2QKMB 4V19K 2ISYA 1J75A 2HYGD 3Q5FA 2J3MA 2F2XA 3Q1JA 3EETA 2RQRA 2VB6A 3FXQA 3CUQC 1ZK8A 1NEGA 1F1ZA 4CS3A 3ABKH 5GTIC 3A2KA 3G1OA 5GMKl 3ULQB 1VQ4Q 2A61A 3VDXA 3I56I 1M3BA 3A7AA 3J80E 5E3MA 1GHCA 2EGEA 4XU2A 2D9TA 1FP2A 3IWFA 2XAUA 3K1MA 3BTCA 2BXYA 4IHWA 3FISA 3DEUA 1WU7A 4B4CA 1S72A 3HFNA 1N8RU 5GJVB 1LFPA 1OR7A 3QZ9B 3WGIA 1NTCA 3L2UA 1O4XA 1VQZA 2QM3A 1H4VB 4H4KC 1UJ8A 1KA8A 3CCJQ 2Q7EA 1X2MA 4OU0A 5D4SA 5GPCA 4W97A 2R7QA 2RNGA 3BR1A 2P81A 4CH3A 5FD6A 1M30A 4LDUA 2LTPA 4XKVA 1HJDA 2KY9A 4C92D 2RGVA 2HOAA 1Q95G 5FB2A 1W0UA 3BR5A 4II1A 1WPKA 1ZUYA 4PJLA 2DILA 2HD0A 1EIYA 2OI3A 1V54H 1SD7A 2NNNA 4XQFA 4PHCA 3A5ZA 4LD6A 5CKTA 2XF6A 1GFCA 2O3FA 4M7DC 5HCKA 4IUVA 2K57A 1M3CA 2DU5A 2V1RA 3MQ0A 5C4JJ 4S05A 4XIDA 1D5YA 2Z9OA 3JRAA 5D6XA 1EIYB 3HOWJ 3BY6A 4GBQA 2EYQA 2GIZA 1IHWA 4YYEA 2Q8KA 3A5ZB 3DLLA 4AYBA 2ACJA 2C0OA 2LCSA 4X1EA 3CDIA 5D4RA 5GJWB 3EUAA 4M6VA 1DDNA 3C18A 1YBYA 1S7AA 1R49A 1MBEA 2ID6A 1IV6A 3Q0VA 1IXRC 2PJRA 2BY0A 4PFOA 2MH2A 5HGQA 4AC0A 5FWBA 1GL5A 1AHJB 5KYNA 4P5NA 3VJPA 2HXIA 2KRNA 1RUNA 3V4GA 3CCRA 2M4KA 2MOXA 2FD5A 2JXBA 3HHTB 4K86A 2OPTA 2PJRB 3C95A 4QQGA 2KYBA 3VYHB 2JUFA 1IG7A 1YITA 4D5CA 2LC2A 2EWNA 4M7AD 1W5CC 3HFZA 4FW2A 3HXXA 1QO0D 4YFXF 1D0ZA 2ME0A 1W2BP 1W36C 3EHRA 1NJIR 2CUBA 2EA2A 1GRIA 3BTLA 2VBZA 3IL2A 1OR7C 5B66C 1A6IA 1D0XA 5FGMA 3AG4H 4CS2A 1OCTC 4BHPA 3HRUA 1IN6A 3CLOA 4HVVA 2JW4A 3HFZB 3ZMZA 2H6BA 2AIRB 4X9CA 1R23A 4P5OA 3TDZC 2WB1N 5TGTA 3JCMf 4VUBA 3QSUA 1X58A 1X1PA 2ETHA 2ZJ2A 2L0AA 5B5EC 2DEUA 3LSMA 2MWPA 4BE2A 4NCXA 1U06A 3LSSA 4S0HB 3CC2Q 3SEQA 1MH4A 1YWPA 1YFSA 1IAWA 2OTJT 2X4WA 3K2AA 1NLOC 3R4KA 3A7UA 1I1GA 1SPKA 1H8AC 2JVVA 1EH6A 4F17A 4JJCA 3GX4X 1LB2A 2O9SA 1SMYF 1QE0A 1O7FA 3BDUA 4LIUA 3M55A 3WG9A 3M58A 2DQLA 1FYKA 2EH3A 2WV0A 4HG2A 4I01A 5LJ3h 4PFZA 4LVIA 4LFUA 1QVGS 1VTNC 2KRCA 4KMFA 2RJEA 1OV3A 3OIOA 5FFXA 3UNGC 4OIQF 2A37A 5GMKe 3GBQA 4IOCF 4CCJA 3GBGA 2L02A 3H0IA 4KR3A 4P96A 3J7ZI 3SYTA 5IYBJ 3BG7A 2E5QA 5JR3A 3CCSI 3CD6I 3HL2A 1BBZA 3AAFA 3NETA 1M4ZA 4R55A 2JQ7A 5HVQC 3LWFA 4MFEA 4XMYA 1Y1VJ 3LGLA 5LD2C 2H1KA 3I59A 1YJWT 4RTTA 3O5ZA 4JZ4A 3TSZA 1OQKA 1AT1B 3G6EI 2DJQA 3EG3A 4BWAA 3QBYA 2ROTA 2E1HA 4JLIA 4J7IA 3CC4T 4A5MA 2DXUA 2LR8A 1F5TA 2GNCA 4C8QD 3G4SI 2ZO4A 3I55T 1GXPA 3DBHB 2DA6A 4ESFA 1MBHA 2PUOB 4XAXB 1Y7XA 5FO5A 4A69C 3SB2A 4FT4A 1L3LA 4P3NA 3QYFA 3I59B 3BPVA 3DB3A 1RKWA 1CF7B 3KP2A 2CGPA 1P4AA 1NZ9A 3HOVJ 3FXRA 3HG9A 2KQRA 4PJOD 4CICA 2ELJA 1KC8C 4HSTA 1Q82C 1O9SA 4PK4A 1MBJA 4RMFA 2NVUB 1R4MB 1BBUA 1PWTA 1NG7A 3GVAA 3K9TA 5FU7B 4M77G 1D3YA 1I6XA 4ZNXA 4WX9A 2DOEA 2HVRA 2ZGWA 3G71A 2XUBA 1FYFA 3BJUA 2D8JA 2R5MA 4TQDA 1V4RA 2DPUA 1OCRH 2E5ZA 4XRSG 2L7ZA 2JTVA 3RZOJ 4BACA 4BY7J 4B6MA 3M1EA 3FLGA 1SSHA 3BTJA 1U1SA 4ZZLA 1E3HA 5JI6A 2MBFA 4CXFA 2KIUA 3BDDA 5DM7F 4G7HF 3SDBA 3FDYA 4M71A 2WA0A 4RTZA 3F8BA 1B70B 4Q4ZF 2BZYA 2DOFA 2X4JA 2F2VA 1TWAJ 3GCMA 1ETWA 2UUZA 2HL3A 4JRQA 3EGDA 1JRIA 5J1YA 1P7JA 3FXMA 2X1EA 1VI0A 1VQKI 4UXNA 2KK4A 2PU9B 2E12A 1PHTA 4IIMA 2DYSH 1OU9A 1YHQQ 5KNLA 3WTWC 1Q86C 2ZSHB 3QYEA 2G7UA 1PNJA 1ON1A 4AVPA 2QKLB 2EILH 5E3NA 2K7LA 3VS6A 2XF5A 4XEMA 4A3DJ 3K4JA 1Y0MA 3EGDB 3K70C 2YR2A 2XB0X 2B8AA 1KONA 1LE8A 3I4MJ 2H1LA 1PRLC 3S1RJ 3EHQA 1SESA 3RESA 3L2WA 3IH2A 2I4OA 1YJNA 4DZJA 1G51A 4ZTUB 2LKXA 3MFKA 5KYXA 2HPMA 5J47A 2DOAA 2DYRH 2RN7A 2M7BA 1HSTA 3C94A 1E6HA 1LE8B 1XMXA 2FPDA 5FU7C 2LY1A 1UHSA 3QOEA 1I1JA 2JN0A 5K5RA 1TUCA 4XKCA 4LK1F 2Y0SN 2ATCB 5KYXB 3NARA 2RHIA 4OAYA 1VQNA 1YFNA 3BROA 1QWFA 2A28A 4WXDA 4XN3A 2RJFA 2XD0A 2BIVA 2E70A 3S3MA 1VYVA 1SETA 4BW9A 2IA1A 1MH3A 1GUUA 2RNAA 1EH7A 3RGLA 4Q15A 2QGFB 4QVZA 5LJ5e 4IHVA 4JYKA 1RAFB 1QWEA 1WGSA 4G6QA 1VQMT 3KP7A 2LOOA 3NGPA 2RD1A 1Z77A 2LQ8A 5GAN4 4LLLA 1Z1DA 3MKDA 2F2EA 3EH2A 1VQOI 5L3BA 4RBOA 5J3LA 2FG0A 1KHCA 1WJEA 3Q9SA 4C92F 3LSJA 4L9TA 4D7MA 5BMZA 4AFZC 3REOA 1REPC 4P1WA 4K11A 4C92G 3M9QA 2EFQA 2M8GX 1R71A 2YLBA 2E41A 3OR1C 1MNMC 5CCAA 2NS0A 4RTVA 4L87A 2GF7A 3FMQA 4AUXA 4RTXA 3ZQFA 4DZPA 1A04A 4U0WA 2EIFA 2PMEA 5LHHA 3FXUA 2FZCB 2HFHA 1X4PA 1QBJA 3OSVA 4HV5A 2L8DA 1RAGB 1J59A 1JUPA 3E6BA 2I4NA 1LDJA 1QCNA 3H9JA 2ZBKA 5F64A 2R3SA 4BNCA 2STTA 3Q9VA 2B63J 1V76A 3JCMX 3OIQA 1SANA 2R0QC 5FKKA 2NOJB 4LK0F 2ZAEA 2R7UA 2JOYA 2O0YA 3VB2A 2VKHA 4OGCA 1GV5A 3HGYA 2HOEA 2R92J 1E17A 1BI0A 3UA6A 2DN0A 4Y13A 3P5JA 4M78E 1YNZA 4Q48A 1HLVA 2W00A 4B3AA 4A3JJ 1WI9A 3NEUA 1QVFP 4HSRA 3N97A 3DBRB 3J80K 1G59A 3PL8A 3DP7A 4FX0A 2A8EA 3RSNA 1B07A 2WTEA 1V5EA 3DTIA 1FPQA 5L3FA 4AM3A 3LSIA 3V42A 3W6JB 3ASNH 1Z7NA 2W4SA 3GTMJ 4CCOA 2O61A 3OBYA 3MO8A 1PSFA 4F55A 2R7VA 2JT4A 3I64A 2K79A 1Y8RB 2Q0OA 4EMKA 1M1GA 1TWFJ 3RYRA 1WQ7A 3A0BC 1IN5A 4OB0B 3IQLA 2H94A 1UHMA 4M7AG 4F04B 2BUDA 3VYTB 3FZVA 2E6ZA 2L3PA 5ELNA 2QI2A 1UGPB 1QVFS 4K2EA 2CWEA 2FRYA 1Z7UA 5GAGJ 3NTHA 1BCOA 2Y30A 3OY9A 9ATCB 3CCYA 2VUMJ 2BTTA 2DJZA 3PE0A 1T98A 1AWXA 4EMKB 3Q0UA 2LBFA 1O75A 3QZ5B 2QK0A 3PTAA 3MAJA 4NBQA 3LQQA 2X4HA 2E5NA 2OZ6A 4ENJA 2QA4Q 1M8VA 1HK9A 5GANd 1J09A 1FIPA 1DPUA 3URGA 1NYFA 5I11A 1T0FA 2MA3A 2OAZA 3M59A 1WQWA 2AQEA 4DJAA 1TWHJ 2M8EA 1FWZA 1HW5A 1MSEC 2CQQA 4NB5A 3JCMQ 3TUPA 3PFSA 3ME9A 4TTVA 3S32A 1R58A 1ZG5A 4UVBA 1ARKA 2WAEA 2Z1DA 2FJ1A 4OMMA 3QIIA 3RI4A 2D1XA 2M4GA 1ETKA 2XG8D 2HQRA 5CVVA 3ZMUA 2QBYA 3W2VA 1XGMA 2K02A 1WQ2A 1RLPC 3HUGB 1BBYA 4D7NA 3I56A 3ZQ7A 2PEXA 4RS8A 1AWOA 3REBB 1UHWA 2ENMA 1QMCA 1ETOA 3WTZA 2BY2A 1X55A 2CO5A 1UECA 5C53B 5HY6A 3CCLI 2XPWA 2NWMA 2R5YA 2QBYB 1M1KU 1JGGA 4N4HA 2YX7A 1JXOA 2L7FP 1IRZA 4G84A 2RPNA 1C0AA 1GLNA 1XSDA 3EYYA 1NYRA 1KQ1A 2XB5A 2GBYA 2DXIA 2DF6A 2KL4A 2LNVA 1TT5B 5GAMh 3HSFA 1NH3A 3MJXA 4RQEA 2CFOA 1E1TA 1W6XA 2R5YB 3F6OA 4IQ4A 3COAC 1X69A 1X43A 2R7ZJ 4BUPA 2CUFA 3DTEA 4UP8A 4HOBA 2E71A 4PLLA 1XDSA 4F7UE 4E7JA 2E3IA 4C8QF 1BW6A 4EMKC 3QHSA 4HRIA 4U0YA 3WQZA 3RACA 3QUIA 4M6XA 1VQPQ 1R00A 1P4WA 4C8QG 3M7GA 1AZEA 4A53A 1QLYA 1LPQA 2DU7A 2VOOA 2QGUA 3DU6A 4DYRA 5DM7R 4EPCA 3QRFF 4M9ZA 1FOKA 4PJOG 3CPWS 1VQ7T 3IP4B 2XDBA 4JZ3A 1HW1A 1RIOH 1U9NA 2GGRA 1TG0A 4C3IJ 4M3FA 2HZYA 5CKDA 3ZCOA 4RDXA 1SHFA 3JCMV 4A12A 3KEOA 1Y0NA 4OAZA 1MMSA 3OOPA 2QEXQ 2EFPA 2DLLA 2ZJRF 3R60A 2YUPA 4ZYGA 4J9EA 9ANTA 4J8OA 5GAOl 3LSQA 1QCFA 4GLMA 1JHFA 4ZYHA 2H3EB 1K6OA 4ZGDB 2CYYA 3EG0A 4GY5A 3KZIC 1N25A 2P4TA 4P71A 3I58A 3CCMI 3HKZN 3VS2A 5HNHA 3CMEI 4DEYA 3KIOA 4A0XA 2P0KA 4YIRX 1GT0C 3FXLA 3QYHB 1ZSGA 4XTZA 2LX7A 2OTLI 1U9OA 3C2GA 2KRHA 4KN7X 3LC0A 4G85A 2Q5HA 4C92A 1OMIA 1D1BA 1VQ6I 5JLWA 1P7IA 2JSCA 2DTZA 1JUSA 1TLHB 4WJ4A 1IGNA 4KRTA 3NEMA 2DMTA 2OCCH 2XKOC 4OINF 3LH0A 2JSPA 2FX0A 1IUFA 3S15J 4D5FA 2R7TA 4ZYDA 1Z9ZA 3DF8A 4L59A 1YB3A 3BR0A 2NUZA 1H88C 4C92B 5F27A 2DM1A 3OB9A 1U0JA 1MKMA 3MWMA 2STWA 1J9IA 3QDRB 3JRGA 1RI7A 2DA1A 5IN1A 1VQ4T 2NUPA 4MTDA 2KT1A 2YHTA 1BIAA 5GANj 4IEJA 4ENMA 3OW2A 1RAAB 5HDNA 3LA7A 4XLNF 4X5OA 3JTGA 4LE9A 2E2JJ 2RVCA 4K87A 2QHSA 3L42A 2VQHA 1TUDA 2ABLA 2LVMA 3M8EA 3X24B 2NUPB 4Y4RA 3CBMA 3CCEQ 1O3TA 2YSQA 3B73A 2Y2ZA 3CCJT 1ONVA 2DD4A 1OKRA 4J00A 1VQ9I 4RG8A 2J06A 4IXAA 2Y9YA 2ID3A 4QQDA 3CCUQ 4I6ZA 2XC7A 3E5QA 2FXAA 4A3CJ 1N8RC 3IKMB 1JE8A 3F3XA 3Q0WA 3I71A 4PSWA 3G1MA 1G6NA 4OMZA 3RL6A 4LB6B 3WTUC 3KX2A 3CCVQ 5D5WB 1LKXA 1K73U 3LX7A 4N9IA 2ZKZA 5K1XA 3IUOA 3CCSA 3CD6A 4J9DA 2DCEA 1W7PD 2FL7A 4M75F 1PKSA 4E47A 1U1TA 4D9JA 4P71C 4C3JJ 1U2WA 4UNOA 2QHTA 2OAWA 4KYWA 2YUQA 4KGVB 1YIOA 3G6EA 2DXBA 2WV1A 4AMCA 3HPHA 4RGRA 1TOVA 2DFHA 1CSKA 1B76A 5GANf 3CF2A 2LJ0A 3G4SA 5EEAA 4PLIA 2QSFX 4FQGA 4BL0B 3CEYA 1S72Q 1JT6A 3LAJA 3C12A 4AIHA 4D1QA 1YI2T 1K9AA 2GAUA 4RCCA 2A6TA 1P92A 2ZR2A 3JSOA 3TMOA 2O4XA 4KJZA 4C5EA 4G6TB 1T8IA 4KFCA 1LOJA 3M56A 4C30A 3MP6A 5DEQA 3QO7A 2F4OB 1K79A 4II3A 4XLHA 4RM3A 2XGXA 4X34A 2JPBA 1UGQB 4DIQA 1VQKT 3ECOA 1BI2A 1B9NA 1JXMA 1MMDA 3TW7A 2MAMA 2DNUA 2HKQB 3E9FA 4V2FA 2X4YA 2EIJH 5IOZA 2CV0A 2W24A 4Q5SF 1ETYA 4H0EA 2KRMA 5HK3A 3CZ6A 2E19A 3JRCA 2E10A 2A05A 2ESWA 4A4HA 4YEJA 4M9XA 4GFBA 3ZR8X 4KNYA 5J40A 4M9SA 4ESRA 4B43A 2C0TA 3BY7A 1X19A 4RLFA 3ZOBA 5HODA 3S2HJ 3M0UA 2M45A 1W66A 3WGHA 1XTDA 3GZ5A 2VQCA 3CLQA 2ZINA 3U21A 1RADB 4YIFA 4DEXA 3KE2A 4C8QA 3QWXX 1X56A 4F92B 2V1DA 4AT1B 2KDZA 4EJUA 5GMKj 1PRMC 3HP9A 8AT1B 1ETVA 1W2BA 4EEFG 2LVSA 1PCXA 4A0YA 1TXQA 1LUJB 3CMQA 1Z7LA 1MMNA 1U5TA 2P8TA 3F23A 5J39A 3E9HA 2F5DA 2MGQA 2VASA 5LRRA 1KG1A 1Y6IA 2VV5A 2DJIA 4NS5A 1M2VA 4P3OA 4J01A 1YTYA 3FXKA 2ZZGA 1SERA 1KFZA 1BOAA 1W36D 5HLHA 1SFUA 1U5TB 3EG1A 1QPIA 3M0RA 4FSSA 1W0TA 1IDYA 5ILSA 4JOMA 3JAMZ 1VQ8I 3MKWB 2X6YA 2V26A 2NRAC 3VSKA 1QVGA 1K8AR 5J4YA 2Z3YA 3CC7T 2F5FA 2YUOA 1M2VB 2E1OA 3ZGKA 2BXZA 4MMKA 3T5XA 2MI6A 2DMNA 5E8IA 4A6EA 2YUNA 2LQWA 4CCKA 4OLFA 4AD9A 1E1OA 4GCVA 4LD5A 2VGNA 5J26A 1RAHB 4UV8A 3RBBB 1Z67A 2DMUA 3U9GA 3HTSB 2CJAA 2QLZA 4ZDPA 3I9V2 4L6V5 3PIOF 3GUDA 1X54A 4A4FA 2FRWA 5DCMA 1U78A 4M74A 1JKQC 3HBLA 1ABOA 3TSWA 3ROUA 2DAQA 2HL5C 1R22A 4MEXF 3CC2I 4BXFA 1OPLA 4BQAA 3K4MA 4PFPA 2XV4S 4E4HA 2DK8A 2P7VB 1NPRA 2DE0X 3PVLA 2DBMA 4LB5A 2QENA 4HLXA 3E6CC 1WDXA 2HZDA 3AG3H 2DT6A 5GAN5 3I5RA 5DCMB 4PGHA 1UEBA 4HQEA 2DA2A 3T1BA 4FL6A 1VQOA 3V8LA 2K3XA 1WZ2A 2GTJA 2HNIA 4GLKA 4YFKF 4O5VA 1K9MU 4N4GA 2VIXA 4C3HJ 3PT9A 1YW8A 1FEXA 1PP7U 3HPWA 1FX7A 3H3VK 1G3YA 4AG1C 3CCQI 1VQ5A 1X3WB 4YRIA 4ZYEA 2SRCA 1I39A 1Y56A 1M90R 1SEMA 1TSFA 4PJNA 1SEUA 3A0HC 1B1BA 2X6OA 3EUKL 5CLSA 3BCAA 5M5WJ 1MJBA 3HL8A 5A0LA 2A6HF 4V2GA 1IL2A 1MZBA 1U5TC 3OS0A 1BC8C 4FYVB 2QF7A 2J6OA 2BE9B 3WTVC 1UTIA 4BE1A 2LG4A 4IUPA 1YHQT 2XHKA 2WY7Q 3G3ZA 2L9RA 3O3KA 2RQQA 2X4XA 5EEGA 2E2IJ 2V7FA 2NVXJ 2XGEA 3VQXA 4EJTA 4LUEA 3PO3J 3LSKA 1OX8A 2KBTA 4J6WA 4M75A 5A0GA 1M27C 3M0QA 4IHYA 4MQVA 3SZGA 2BBYA 1WNLA 1EKEA 3GLLA 3SFZA 2YRDA 4QIWN 2JM8A 2HBWA 2V4JC 3K6GA 5CKBA 1BKBA 4CA0A 1YJWQ 1ZAOA 2ZCWA 2O88A 4M75B 5CO7A 3AL0B 3G71Q 4AU7A 4E7LA 2KXCA 3OYYA 1ATIA 1PVEA 1EFNA 3WHBA 1ZH5A 3CC4Q 3H36A 1FC3A 3I55Q 2DX1A 3IKLA 1WLEA 3FMSA 5D6YA 1YS7A 4N4IA 4XSZF 2O31A 4M78D 4YELA 1KU9A 2KGTA 1UCRA 1ZELA 1AOJA 1R77A 1JEGA 1SMTA 3J7YJ 3VBBA 2M3AA 1C0MA 4OOIA 1HQCA 4AIJA 1TU0B 3K2ZA 1Q7YU 2ALYA 4UP7A 1FBUA 2E5KA 1SFEA 1ZGJA 3FRNA 1XCBA 3FBNB 1EIFA 4NDLA 2CG4A 2X9DA 2WBMA 4BDYA 2ODRD 1YITI 5GAN3 3M4YA 3IAM2 4YRQA 3JRIA 1B4AA 2KAFA 5ILUA 5GP9A 5HOOA 3L9FA 2MPXC 1WH7A 1X1BA 2ALYB 2LRQA 3RKYA 3A8LB 4DOZA 1X6BA 3HXWA 2L89A 1G3WA 1DU0A 3J7AY 1IUYA 1WXTA 3DPTA 5KK1A 3KEYA 4ZJZA 1YCYA 2MG4A 3PNYA 5E3LA 4ZIBA 4ENKA 2CJJA 3K70D 5C4XJ 4CUGA 3QODA 4EIKA 3M0PA 1QGPA 1G5VA 2FNPA 2KNBB 2W25A 2DJNA 1X01A 4CC7A 4QKUA 3CJRB 1UJYA 1MMAA 2JZYA 2HU9A 4ZYAA 2IS1A 2P4WA 3MN2A 3S1MJ 1IGQA 3JCMP 5CIUA 2LTOA 2V6EA 1OCPA 3EQLF 3I53A 3CCLA 2LY9A 1SAUA 4HQMA 1YJ9I 1JKOC 2R5AA 1N5ZA 1UHFA 1T95A 1OISA 4OB3B 2V1QA 4XORA 2I4LA 3HXYA 1WPYA 4C0GA 1JT0A 4M75C 3AL0C 1WCMJ 1JJCA 4D0PA 2ECCA 3WTSC 1Z3YA 4BHBA 2V1UA 1TW3A 1F1BB 3LSTA 1W1FA 2PVGB 3VS3A 1VQNQ 5EZGA 5KE2A 3RPUA 4Y3OA 1I8FA 1RAEB 2VJ4A 2JPCA 5F1RA 1MBKA 4U87A 4C0FA 3BJOA 1JJCB 1I50J 2GIVA 3X28B 5HKCA 2GBQA 2HCKA 3VV0A 4IVNA 2IGKA 3MD2A 2WSCE 4JS5A 3CCMT 2NAZA 1EA3A 2QQ8A 3M8JA 2A6EF 2KT0A 2LKSA 5LRSA 2OTLT 5AIPA 4KBMB 4XLEA 4MMLA 1IC8A 2HBPA 5FKMA 1VQ6T 5FLXK 2L3DA 3FM5A 3FIWA 3PIOA 5LJ3d 3KP4A 4XTYA 2XGTA 1B8IA 4A54A 1HD3A 1H0MA 3F70A 2FPFA 3TBIA 1DU6A 1RNLA 4GO1A 3B02A 3PMIA 3LSPA 4JDSA 2RI2A 3F21A 3VS0A 2PTKA 2FMYA 4Z89A 2EB7A 3BPXA 4M7DG 1Z0XA 3GOXA 4A4KA 1ZREA 1A0NB 1U8RA 1B8IB 1B8AA 3CMEA 2RO0A 2EPFA 5J4VA 2ARTA 2JJ9A 2MIOA 1QVFA 3FKIJ 3AFHA 4P3PA 2EFOA 2FE3A 2QQRA 2QQBA 2PMZN 5GPAA 4WCGA 2COWA 4XLPF 3HSRA 1WKMA 4R79A 3OL3A 1JUMA 4F3QA 3CUOA 2KIFA 2O03A 4LDYA 3IC7A 2FA5A 2QQSA 1VQ9T 4LXCA 3A8MB 3QJYA 2ZNZA 4P72A 5JFRA 2M30A 1M1FA 5BNGA 1TP4A 3UR3C 3M3YJ 4HPQA 3OYDA 1VFCA 3ICAA 1R5ID 5C51B 1S3JA 2IS2A 5HLTA 3RUXA 3LW5E 5K7ZA 2OU2A 1JXSA 5EG0A 1KJWA 5CPRB 3PZCA 3H5RA 4RKUE 1MV3A 4HKEA 1R1UA 1PUFA 4Y28E 4FW1A 2K3FA 4FX4A 1VQ9A 2ICWG 1YX3A 1LYLA 2BGCA 3V8JA 5I22A 2X9HA 3HRIA 1H641 2HVSA 3N4MA 2XVCA 1U6GA 2VVKA 3QOPA 2FUG2 2HYFA 2LLKA 1CKBA 2CZ1B 1M2OA 1Z6RA 3H6ZA 1M1KC 2HDAA 2QZ8A 1YJNI 2QA4I 1TT0A 1PUFB 1R6RA 3RQIA 1GXQA 2E2HJ 2O8KA 5C3EJ 4HV6A 4Q47A 1VNDA 3FHNA 2K9SA 1SG5A 1YOVB 1ZLKA 1FMKA 4JRPA 2DFUA 2ZZDA 4KR2A 2ECZA 3MZHA 4YP0A 3UFGA 3EFOA 3ABUA 2KDSA 2P6SA 1UB4A 2PX9A 3D5SC 4LLGF 4B48A 4CYCB 3CDLA 3TP0A 1YN8A 4XRFA 4Z02A 3BWGA 2I10A 1W5TA 4DBRA 1EZZB 3TOBA 2DTOA 4M3DA 1TBXA 3VS5A 4EM0B 1A6QA 2K5FA 2X6XA 3I56Q 3ZQHA 1QVUA 2ZTGA 1U3OA 2BVMA 3FHZA 4R8HA 1QCOA 1VYUA 3UATA 2M1HA 3A8OB 4O6JA 2CUEA 5LJ5g 1KYZA 4RAZA 1F9NA 1FOWA 1QZEA 2KROA 4IHTA 3SWNB 4OMNA 3EFSA 2K9LA 2WAQA 2CW0F 3ZXSA 3I4NJ 4MEYF 1X2HA 1OEBA 4P72C 4L5JA 3D7SB 1WYXA 4ZDLA 2KXDA 4XL9A 5KCHA 5FJ8J 4AG2C 1YIJI 4RM2A 3B6AA 3ZFJA 2MWOA 1N78A 2KLOA 5LJ3j 1GBRA 5H6RA 5IXBA 2PMHA 1FYMA 4A3LJ 2JTFA 4EMHA 2NOGA 4CGZA 3FXOA 1XJWB 3H8ZA 1X27A 1ZG3A 4IJAA 2RHXA 1WJAA 1VQPI 3WHCA 2IP2A 3ULRB 5LJ5h 5LHIA 4A3FJ 1T6SA 1NJ5A 1TWBA 2JTEA 2P84A 4BU2A 3UA7A 3BG5A 2NXNB 3DB4A 2QTVA 2BYVE 2G0EA 2EFWA 1EVKA 3F22A 2M51A 1GVDA 2CS3A 2LF7A 1WSUA 4M77E 3J81K 1UG2A 3RMQA 1Q81R 4CH4A 2ZMEA 2DYIA 1H3HA 2GQQA 4XRMA 4A5NA 4GYIA 2KEAA 2D5VA 5IPAA 3CCET 2QEXI 1VQ8T 2E65A 2IGNA 1DGWY 4ANJA 4M78F 3X20B 1KK7A 3SFMA 5EG2A 4CO8A 2YUSA 2HQNA 1JJ2P 2ZMEB 4G7ZF 3CCUT 2ZJQF 4KUMA 1J3TA 1LEAA 2EQMA 5EJCA 3F8CA 3GXOA 2EQJA 4W1UA 2RHZA 1VQ7Q 3H1CA 1FYNA 3SWNC 2IW5A 3E5UA 1VQLI 3CCVT 1EJ9A 3CMAT 2F6CA 1WHLA 2XRLA 5LJ3f 2FQ4A 4FYYB 1S29A 4RTUA 2KMTA 4BE0A 2GXBA 2RAEA 3JB9D 3S14J 3E6MA 1JJ2S 2CYZB 2VPLA 5FROA 2I5UA 3PFIA 1D09B 4A4GA 1FSHA 1UGVA 4HLYA 1YWOA 2QYZA 3ELKA 4HWTA 2KRFA 4CC3A 3M9AA 3IV5A 3FXJA 1ZN2A 1K73C 2HVQA 1A31A 1KU7A 3NTIA 1ENHA 1FBSA 1ACIA 3WU1B 1UHCA 2HNHA 5ED4A 2MLGA 3K69A 3GNFB 1P2FA 2EIMH 2PMUA 3HY1A 1X4OA 3WG7H 1QHHD 1S72T 2O01E 3CC2A 1WJSA 3WODF 4WTOB 1XD7A 2AQFA 5K5QA 3NPFA 3TP3A 4UUSB 3RERA 3OA6A 3A7RA 3JAME 2VI6A 2RHYA 1FYLA 4F14A 3OL4A 3JCMe 3KP3A 4UUVA 1WHUA 2LJ3A 3BG3A 3G1JA 1A35A 3NAUA 4I0BA 5IT9K 2CV1A 2GLOA 1YRNA 3VRYA 4HWSA 2R7SA 2ZT6A 3J80Z 1WJFA 3BR6A 2YXYA 1V55H 2ZMEC 4ZN3A 1EVLA 3KLNA 3LL7A 3TW6A 2JVGA 2JUGA 1UE9A 2H8WA 5E8GA 2QUFA 2CW7A 3WXMB 3H0DA 2EV5A 4LVKA 3CCQA 4EV0A 2ZFWA 1AOYA 1SFXA 3JB9I 2OAUA 2QQ9A 1YRNB 2A3SA 4ATOA 1Z9QA 3CCSQ 2DFFA 3LWHA 3C3WA 2M5WA 4IRIA 1YYVA 1TZLA 2ZR3A 5DUKA 2G3RA 2OQGA 5KYUA 6PAXA 3B6CA 3A01A 3NMZC 3QWLA 1SVOA 1MW7A 1P4XA 3IRQA 4YRTA 4IF4A 3G6EQ 3JB9J 1NJIU 4XR6A 3VYSB 1UUEA 5CR2A 1TQPA 3C1DA 4BYYA 2WY8Q 3TEEA 4V2SA 3OWTA 3OS1A 2OJ2A 3UWNA 1K76A 1D0YA 2VKVA 4HX7A 4F7UF 2QVOA 1NG6A 5DY9A 4HX8A 3G4SQ 4LVJA 2JS2A 5KYUB 1HYOA 3TEHA 1WIEA 3MVPA 1STZA 3A01B 1S9HA 3CCRT 4H2UA 3BJAA 3MCAB 4EDUA 1Y07A 4EMGA 4I0AA 4RAYA 3H3UA 5L3DA 5E17F 2XTIA 4DBQA 5EEHA 4N4OB 4RLQA 2KE9A 3C0CA 5LGTA 2KMUA 5M3MJ 5GAMd 5CYVA 1YITT 3G1LA 5FD5A 3TEHB 2HTJA 2DERA 1B3QA 5I21A 2HEOA 3PIPF 4F7ZA 1K61A 5LBQA 2L4MA 2J6FA 2R7XA 2F2WA 2IRFG 4MIMA 3HM5A 2P5VA 2DT5A 4HVUA 2PUKB 2R93J 4XTXA 2HGCA 4Y91A 2E35A 4DOVA 3I7FA 1YX5A 4OMPA 1QVPA 5J3BA 1ASZA 1WZOA 3ZQLA 4ZC3A 2VODA 1K4SA 4NC8A 1YI2Q 3W2AA 2VBYA 3IKVA 2EAYA 1ZTRA 4MHGA 3S6WA 2IIMA 3R6OA 3BQYA 2ZCFB 3SXYA 2EW3A 3RMSA 4BXUA 1NK2P 2ZCEA 3GWZA 4RB0A 2HMAA 1NYGA 2V1NA 5BS6A 5GANh 4F52A 2QTXA 4M7AE 1T2KA 4EQQA 4F16A 3VS7A 1U8BA 2JM9A 1JBMA 1VQKQ 1RAIB 1WJQA 2M0YA 2F5EA 2NYXA 3L7WA 1PJRA 1SRMA 3PJRA 2G6FX 1Y39A 4AVZA 2GZWA 3K1NA 2VT3A 2CQNA 3VQWA 3A4CA 1ITYA 5M9OA 3WVDB 3RJPA 1AVZC 2MD5A 1YS6A 3DFGA 3QNEA 1VZ0A 1BJAA 4TVWA 4PGGA 2R7OA 2DL3A 5LJ3g 4QWQA 3QG1A 2VJ5A 1SRYA 1XB4A 2XAQA 3A98A 1NG2A 1W2BS 3LSHA 5CKFA 2XKPA 3ZQQA 2JVHA 2Y90A 2JA7J 2XGDA 2ADUA 1UDLA 1BR1A 8ATCB 3L2QA 1YJ9A 4E2FB 1MNEA 3SZPA 1BR4A 2D1VA 2BW3A 11ASA 1APLC 2VQLA 4M78A 1AD5A 3RKQA 5TRDA 3HOXJ 4EGYA 2L3RA 2LH9A 1K9MC 3TKYA 1H4SA 1NYQA 1QPMA 2IGOA 1SF9A 4C2UA 2BW3B 5FRNA 1IO2A 2L7MP 1B9MA 2XDPA 1ZUUA 4M78B 3JSPA 1XC5A 1AU7A 4IQJA 2DVEA 2VJJA 3PQJA 3LFKA 2XGCA 1IV8A 4CHUA 3HHHA 2ZPBB 4M73A 3QXEB 3A31A 4YRSA 4PCQA 5EDNA 2DT7B 1MJ9A 1KC8R 3U2RA 2X48A 1YE9A 1Q82R 1BJZA 4DGWB 2DYBA 4XU1A 5ICCA 3I35A 3CC7Q 3QO8A 4LN2A 4FT2A 4BI4A 2J5PA 2FSWA 1VQOQ 1CF7A 2XRNA 2FOWA 1E22A 1FP1D 4YFNF 5JHUA 2HSPA 3G71T 3X25B 1JHHA 4OB2B 4Y7NJ 1KD1C 3DEEA 4YG2F 1N77A 4QT7A 2OUMA 4F91B 1GDTA 3ZL7C 2DODA 1E2XA 3CBPA 5IYDJ 2L5QA 1YCSB 4L0ZB 4EMSA 2JTMA 2MF2A 3W2WA 3J7AF 4XU3A 1IXSB 3K10A 2OTJI 3GIBA 2YX4A 4PJOE 2W57A 4J9GA 1BOBA 1IJWC 3K4LA 5GMKm 5GAMj 4XNFA 2E34A 3DU5A 2V8KA 1PP8F 2K5IA 4EATA 3RCOA 2RDPA 3C7JA 1Q86R 3SZTA 2L54A 1IXCA 3RPQA 2XROA 2A36A 5E1WA 1TWCJ 1Q7YC 4B9XA 1RI9A 5L3CA 1CQTA 1B70A 4L9VA 5D7UA 2CP3A 4M78C 3RZDJ 1WI3A 4QPQA 1MGTA 2EGCA 4B1RA 1Z6TA 2MLKA 4KUDK 1IHVA 3TL4X 1YJNT 2ODRC 4FE7A 1T39A 2CZ6B 2VQGA 2E1CA 1EH8A 4LG0A 1VA7A 2E1MB 4F7UA 3S1NJ 2LC4A 1IZ6A 4PL6A 3JB9F 3M4PA 3OR2C 1E0EA 2RH2A 2DA4A 5LL6S 3I55I 1FIAA 3GFLA 2EYZA 4JJDA 2GXGA 3CTAA 2MMPA 3JB9G 2AHQA 2VE8A 2I4MA 2Q2EA 1K7AA 1XOVA 2EIKH 2F5KA 4LG0B 3BR2A 1VQNT 4F7UB 3ML6A 3QDFA 4U7DA 2WB1A 2R57A 5E1ZB 1FTZA 3CXCP 3QQAA 3E97A 5GAMf 4HCKA 1QQJA 5KAIC 3WTYC 4Z6YA 2QA4A 4BGDA 1K0SA 3VQYA 3PIPA 4IUUA 3P7NA 2RI5A 1NJ6A 2Q2EB 4FYXB 3JRFA 1PYSA 3I4PA 2DAOA 2P0WA 4RA2A 5GAN7 1T33A 3HXZA 1G83A 2LP0A 4KITB 1XGSA 2CP6A 3CXCS 1YIJT 5E20A 2YS9A 1QU3A 5GAOq 1WHKA 3GYHX 2NLUA 1PYSB 3RYPA 2DK5A 3UF4A 4OMOA 1HSJA 1OCOH 1ODDA 3VS4A 2FBKA 4BB7A 4A3GJ 1WA7A 4RGUA 3CQZJ 1KQ2A 5DD8A 3ZN1A 2DXTA 1OCZH 2MD0A 2OV7A 6AT1B 2Z33A 4CC2A 3CCLQ 4XICA 4XK8E 4HF1A 3FKJA 3QU3A 4OMYA 2PVOB 4HCBA 1XPXA 1JTXA 3L4GA 5GADJ 4M75D 2MH9A 5J1UA 2WC2A 2DRMA 3K0LA 1D1AA 2L9SA 2E1MC 2CP2A 4EVIA 5GAHJ 3ZP5A 1MBGA 1YIJA 3BLYA 1AZGB 1ZLJA 2HQEA 2V1XA 3O2PE 1RACB 1PSEA 4NL3A 2ZNJA 3MHXA 3L4GB 2DBKA 2CT3A 4RCBA 1R0CB 5CVUA 1JTYA 3VYRB 3QPSA 1XGOA 4P74A 1VQPA 1VQ5I 3JTHA 1W4SA 4I76A 3GFIA 1TC3C 3CDHA 5JHFA 2M0CA 1JKRC 4R1HA 2Q5IA 4M72A 2FRHA 3BCBA 3H0GJ 2C8MA 3F8FA 3FJPA 3BW1A 1H9TA 2F4MB 3REAB 2VUBA 3HFOA 1C0WA 2YU9J 3LLRA 3AKZA 2LNHB 3DKMA 5IHNA 1D8JA 2VXFA 5CJ9A 3GP8A 4H2YA 1OX9A 2MABA 1QP2A 3DBLB 5GAOp 2UZKA 1PD1A 2QEXA 4MQ9F 3CMYA 2DVJA 2CUDA 2R5ZA 3QP5A 2QQAA 1OYIA 5ERIA 3OYAA 4FU6A 1Z9CA 5D8LB 2DXCA 1HSQA 1VYTA 1W70A 1WGXA 3P9IA 4L0YB 3G7ZA 2O8XA 4HW0A 3VEPA 3P8HA 1VF9A 2ESHA 2OZUA 2CV2A 3BOQA 3CCMQ 1VQMI 3CMEQ 2B86A 3E5XA 4BJTA 2KI7A 2YSRA 1MIJA 2R5ZB 4BAYA 3H5AA 2OTLQ 4LVLA 2EJ9A 2ZIOA 4KICA 1T0JA 5GAN8 1VQLA 2HQ5A 1D3BA 1ZSZB 4C5GA 1VQ6Q 4FM4B 1QKXA 1FY7A 2ZSIB 4A3BJ 5D5XB 3HOTA 4HVWA 1VIFA 5KH6A 4U88A 1WHGA 5DD4A 4XTUA 4BBRJ 1WFXA 1N75A 1HBXG 4XK4A 5GAOr 4LVMA 3GTGJ 4KIFA 2XDVA 4CZZA 1XX5A 1BR2A 1D3BB 4HDVA 1T3LA 5KVRA 2ZZFA 2A5WA 3I56T 5J1RA 1O3SA 2K9MA 4RMOA 3BZKA 4MGRA 3RPUD 4GXOA 3MQZA 3OMGA 3S8PA 3BZCA 3F6VA 2DDZA 3KEQA 5CKHA 2OJED 1E6GA 1WVRA 3HUGA 1FXXA 3P8YA 2WWYA 4P74C 1K0XA 2RQPA 3DCFA 1ZG1A 4L18B 3QJ6A 3SDZA 3ESWB 1WJBA 2IG0A 5M3FJ 5DV5A 1R1VA 7AT1B 3L2ZA 3KUFA 5GAMg 1KMNA 1VQ9Q 4IUTA 1O7LA 2Y0SA 3PNVA 3VQVA 1LQ1A 2A68F 5KYWA 2COZA 4K88A 2EJFA 1R4NB 2DQ0A 4QPOA 1Z7MA 3SD4A 2KP6A 4IZZA 4M3EA 4UY8I 1ZQ3P 4YRRA 4FT8A 3S2WA 1R9TJ 2EVRA 2ESNA 1RLQC 4HF0A 2AZVA 5KHDA 5LHGA 4LD9K 2XKOA 2C06A 1ZA1B 3ER0A 5KYWB 3M1CA 1SD4A 1LDDA 3QPLA 4H2TA 2CP0A 3X2QH 2VT2A 1ZA2B 1ZSZC 1H9GA 4XOTA 4U7BA 4L9NA 1T56A 4GGGA 2GTOA 1IRXA 1K78A 2QDYB 2HPIA 5CK9A 1G3SA 4YRLA 4BDZA 3A1YA 1WH5A 4IHXA 5GAEJ 1XS9A 4HNUA 1K4TA 4YDQA 3E2UA 1IZ1A 1X3UA 2KSSA 4E6KG 3GLXA 5HK0A 4KISA 1JGSA 4BQQA 2ZB9A 1K78B 3BDLA 2E7XA 4LNSA 3KZZA 1IRGA 4YRKA 3ZMTA 3HIFA 4AFSC 3META 1OZ3A 2A08A 2CS7A 2DU9A 2I2LA 2P0PA 4WF2A 1ZBJA 3CJNA 2FB7A 1KQ0A 1ON2A 1V3FA 4JJBA 2RI3A 4BS9A 3BZ6A 3HRKA 2RB6A 2KHMA 2V9KA 3K1PA 2P0QA 3KP6A 5GANe 3FJ5A 2OBPA 5L3EA 4MDWA 2GA2A 4UB8C 3BE3A 3BTIA 3P8DA 2VWFA 1OQYA 3LNQA 1Z21A 3HFVA 3R6SA 3OSSC 1QHGA 3HJEA 2UXNA 5AONA 2E60A 2NVTJ 4C0DC 2IVWA 2E36A 2VXDA 1IRFA 1RUWA 1E3OC 4OWRB 4OVAA 4HYEA 2KFDA 3H92A 3RQ4A 2K2MA 1H4TA 3E6DA 1SFKA 5HDGA 2HQAA 4BKXA 2ROLA 2JJ7A 4XKBA 1JJ2A 1UGRB 5ICGA 2VKDA 2XHCA 1ZRCA 3MF1A 4DPGA 2X3WD 1ASYA 3MZ8A 4DBFA 3W3CA 1I5ZA 1X1DA 2HQHA 3TDUC 4RB1A 2COBA 3HHGA 2A0FB 2K9GA 3C2BA 4DBHA 3EUHA 2DL4A 2MC4A 1N9SA 2RJCA 2CFXA 2Q7HA 3R61A 1XSVA 2Y48A 2IT0A 3K7AJ 3H35A 1A5JA 5KCOA 1N8RR 1P9QC 4FTHA 4ETSA 2F5VA 1EQRA 2K3YA 5GAN6 1ULYA 3H41A 3PNWC 5F6FA 4LDVA 4ZTFA 3PMTA 3F8MA 3OYIA 3EYIA 2BE5F 4MLOA 4C5IA 1VQ7I 3CP8A 2F5CA 2X0LA 2IA2A 3JSCA 4B9WA 4H2SA 3D1NI 1OPKA 5HDKA 3E3VA 2JS0A 3OYBA 1CKAA 2ZFUA 2HXOA 2K5LA 4X1VA 1LVKA 2B7EA 1UFFA 1W5SA 3CCST 3CD6T 5F0FA 5FLXZ 1QP3A 2PZ1A 1VQ8Q 2LREA 2LT1A 1WI7A 3THKA 4JLGA 1NE8A 4H2XA 4NL2A 4RTWA 1RI0A 3E9IA 1AWJA 4A0ZA 2DBBA 2MW8A 4D8KA 4BD3A 3JCMc 4E7IA 1HCRA 3WVEB 2QSGX 1MV0B 3L2CA 3ERED 4OGEA 3OYHA 3ZQGA 4E7ZA 3G6ET 2K6DA 4CI0C 4L5IA 3KETA 2EKHA 3TO7A 3LH5A 3ZN0A 3PCOA 1V29B 1BCMA 4HBLA 3G4ST 4H2XB 4EO4A 2PMFA 2VKNA 1BYMA 3CMAQ 1QVGP 2BV6A 4BEHA 5A2QZ 1OU8A 3O8VA 2M16A 4QSHA 2CSQA 1FLIA 1LJOA 2PBIA 3PCOB 4G6DA 2QSHX 1NJIC 3TEDA 1R7JA 3BC8A 1ZX6A 3HSBA 4I98B 4M75G 1PM3A 2QAZA 2GXAA 4G12A 1PC0A 1LFUP 5HLIA 1RR7A 4BEHB 2EQRA 2AMCA 2SEMA 1OYXA 3CO7C 3GTKJ 1VQ4I 2XICA 1IB8A 2COMA 4JBAA 1A36A 3ZRGA 1YFHA 1TW2A 5HS9A 2EBIA 2W1OA 1LEBA 1F4KA 3CCQQ 3EUHC 4LDXA 3R0JA 4Z2YA 3KPHA 1VUBA 2FVUA 3K4BA 2AMCB 4Q5WA 3ISPA 2OTJA 1WFWA 1WYDA 1U3EM 2WAFA 2LKPA 2Z0WA 1BBWA 1TTYA 3CCJI 3CPFA 3KCCA 2CREA 3OOUA 2DFEA 1QZZA 3IWZA 3HTZA 2YPRA 3JB9H 4E6RA 2RC4A 3MEUA 3QPTA 2E3CA 3N5BB 2XASA 4HXJA 1OPCA 1N9RA 4LMYA 4HT4A 1XMKA 2HI3A 1MD0A 1VOMA 1WXUA 2ZPIB 5B1BH 1K8AU 4DOWA 2IGMA 4M7DE 4RAFA 4UC4A 2O5RA 3T0YA 4XLAA 1B59A 3TREA 2CQKA 3A8GB 1DQUA 4LUDA 3G1ZA 3HKZA 2GWRA 2HKOA 4FETA 4E70A 4XONA 2OD5A 2RM4A 2DRKA 1R8OB 4M77F 2DA3A 3H5NA 1V5GA 1JI8A 3DXJF 2DA7A 3UPUA 1B6AA 4DW6A 3G2BA 1YJWA 1XTAA 3FC3A 2NS8A 4RGSA 3EAEA 3V7SA 4WXCA 3S3OA 3CC4A 4UUTA 2RHUA 1MSFC 2L3SA 3OYMA 3I55A 3CJTB 5LJ5d 3NQOA 5FWCA 3CCRQ 3WE2A 3HXUA 1YI2I 4WJ3M 1USSA 1TH7A 4FCYA 5EGOA 1QKWA 2XF7A 2K40A 2VC8A 3PVQA 3QKJA 4OMQA 4KQEA 3DV8A 5JVTA 2XPUA 2M7AA 2CZ0B 1YITQ 4ELYC 2Q1ZB 3VYGA 2PN6A 3IALA 2JA5J 5E18F 2MYSA 3E0JB 3QAHA 4EJVA 5C0MA 3VODA 2IVMA 4IOAF 3IH4A 5GAOm 1M90U 2XMFA 5I2SA 2DD5A 5EGOB 3GEZA 2TDXA 2HQXA 1YFTA 3M0SA 2EV0A 5LEJA 1IN4A 2K86A 4XBFA 1C1AA 2DZCA 1BW5A 5ICEA 4M3BA 4FIBA 1VQOT 3NWSA 2W48A 4PKCC 4IRHA 4JRIA 1HDPA 1G8XA 4AIDA 2CIMA 2CRGA 1XGNA 1QQIA 3V8KA 2RK2A 2VXEA 2WACA 5F0CA 5LGUA 5H6QA 2EQUA 1EFWA 1UFMA 2RNJA 2DTIA 4HDUA 3GNGA 4RB3C 2IBDA 5C44J 4LGWA 1SAXA 4YRFA 2XAJA 1VQ5T 1ZHFA 3J81Z 3QTCA 2DETA 2FYKA 1YJ9Q 5EYRA 4P75A 4XTWA 4BJ5C 4B47A 2KR3A 3EH1A 2KDOA 2K3PA 4G8XA 3FEOA 3MCZA 2HDWA 3M4QA 2NUTA 3U23A 2L4AA 1KQSP 2JWTA 2CP7A 3NHNA 3JCMg 4KH1B 1FOXA 5JVGF 3HOYJ 2EKOA 4YRNA 5F1JA 2FU4A 5H2FC 3OBWA 4YCWA 3TCJA 2DFIA 2ZXFA 1FJLA 4E51A 2ZJPF 2NUTB 4JX4A 4LLNA 2E1NA 2RN8A 3S2DJ 1K6YA 2DTHA 1PYVA 3JRDA 2ZC2A 2CJBA 2DK3A 1G5HA 1IO6A 2ELKA 3CESA 2XAHA 2EPDA 1KQSS 2VOPA 4CDGA 2XSJC 1ZARA 3OYEA 1TTHB 1MUZA 1GCQA 5AYFA 3JCMh 2QYOA 5E3OA 3CC7I 1H3ZA 3VYUB 1Y0UA 3MPUB 4UB6C 2Y31A 2H09A 1NPPA 2HEQA 3CJQB 2GQIA 1UELB 2VPRA 1ACMB 3BG9A 5E79C 1L0OC 1D5VA 1N6AA 2W85A 1PD0A 1XMAA 1TS9A 4HWOA 1JJ6C 2NNYA 2EQKA 4G7OF 5J8CA 2DTRA 3EFRA 4UPAA 3HRTA 1SSFA 2CP5A 1EX4A 5GAN2 1MDMA 3BP8A 2LYCA 2FBIA 1KD1U 2RF0A 1V5FA