4HA8A

Structure of staphylococcus aureus biotin protein ligase in complex with biotin acetylene
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Staphylococcus aureus biotin protein ligase in complex with biotin acetylene
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 100
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ha8A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ha8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ha8A02
4OMZA 5FGMA 1R1UA 2EFOA 2KRFA 4PJOC 5FFXA 2GA2A 2V1XA 4BAYA 1B1BA 3HFZA 3GX4X 4LLLA 4MTDA 2M5WA 4I09A 1WKMA 4YCVA 1XSVA 1ZLJA 3TEGA 4KR3A 2K86A 5GAMh 5GAN8 1HBXG 3VQXA 3BP8A 2ZO4A 3KP3A 4LFUA 1MZBA 3HHGA 2GWRA 1TQMA 3JTHA 1WI9A 1FOKA 2IY5A 2ZCEA 3JB9D 4KIGA 2QUFA 2G9WA 4U7BA 4FT8A 4RCCA 5F5WA 2JRTA 2VN2A 3VFZA 3LQQA 5J6XA 3V7RA 5GAOr 2COMA 4PDKA 4C92E 3A5ZA 2DPDA 5ELOA 2YSRA 4MEYF 1K6OA 1TQPA 2XGXA 1Y0UA 2Z5UA 4UP7A 1BBYA 4M75D 4YRSA 1X3UA 2I4MA 2HTSA 4XEOA 4IPAA 4GXOA 1USTA 3RPQA 5GAMd 3H3ZA 3ZPLA 5FD5A 3KZZA 4Z2YA 4M74A 4P55A 2VXZA 1P2FA 5CAIA 3HTZA 2VBXA 1KU2A 4LLNA 3IKLA 3PQJA 1W7PD 2AKWB 1ZRFA 2V79A 2JZYA 5E1ZB 4JBAA 4RMFA 1BIAA 2XKOA 2H6BA 2RDPA 4G7OF 4Q47A 3MF1A 2IA0A 1SESA 2MC3A 4A54A 1S29A 2NS0A 3A7RA 3REXA 3F8CA 3JB9G 1W4MA 2VT3A 1JHFA 1O3RA 4NCXA 4YDQA 2ZNZA 5E3IA 1ATIA 5BOXA 5JI6A 3L09A 4PJOG 1D3BB 4M77D 2RM4A 3I59B 3F6OA 1TNSA 3DPTA 3FX3A 1BN5A 2DTRA 3Q5FA 1WQWA 3HFNA 4RGRA 2DZCA 3MQ0A 2J5PA 4Y91A 5GAOm 4EMHA 1ZYRF 1NJ8A 1LQ1A 4NHJA 3KCCA 3HSRA 3JCMJ 2XAJA 3KFUA 3R6SA 3HFZB 4CS2A 5CLSA 4TQFA 3GUDA 1T0FA 2FXAA 3CLOA 3BJAA 3E5UA 2DTHA 12ASA 1JBMA 4P3NA 2VBZA 3FHZA 1R58A 2XROA 4BW9A 1P4AA 1L0OC 3F8NA 4QLCU 1SMTA 3HRKA 2IW5A 3KLOA 1KQ0A 4N9HA 5HLGA 3VU3C 3MF2A 3MWMA 1ONVA 4ZYGA 3ABTA 3FXUA 2GIVA 2XHKA 4L9JA 1HXDA 3IWFA 1BJAA 1QZYA 5L3GA 1WLEA 2ESHA 4ZYDA 1B4AA 4HLYA 3I5UA 1T38A 3GXOA 2EB7A 1JJCA 2RHSA 1IRGA 3JAMK 3INZA 4WWCA 4Y15A 1I6XA 3V7SA 2ZINA 4C8QA 3M4QA 1KA8A 5H20A 1XGNA 4KNYA 4GO1A 2XGTA 5AONA 2VOPA 2AMCA 4P71A 1REPC 2P6SA 3NRVA 2IRFG 1OR7A 3A74A 5LJ5j 1HKSA 4OU0A 2EA4A 1I8FA 2OQGA 3KE2A 4H2SA 2L02A 1S3JA 3F23A 4XLPF 2OZUA 5LJ3f 3QUIA 5FLXZ 4IXAA 1S7AA 3JCMW 1MJAA 2Q7GA 2EFQA 3HYIA 2LNBA 2QQBA 4BHBA 1WYDA 3HRMA 1ZG3A 3O2PE 4EV0A 3QSUA 1Z7MA 5GAOp 2HEOA 3WE3A 4X9DA 5GAOn 2FSWA 1OYWA 2VC1A 4HWTA 2XVCA 1LJOA 2ZNIA 4QVDA 1P4WA 1Z7NA 2QBYB 4UPAA 2P5VA 1TLHB 2DO7A 2PMEA 3HSEA 4PGHA 1KQ1A 3KZYA 4LGWA 3E6DA 3KLNA 3I54A 4UP8A 3DSQA 4YRCA 3GVAA 4ESJA 1ZG1A 4MGRA 1NJ5A 1R22A 1BI1A 1QGPA 2EL9A 1IW7F 4C8QG 4EJUA 3K0LA 2V1DA 1OPCA 4NL3A 1R1VA 4KN7X 1O7FA 3LA3A 3UH0A 1OYIA 5GANe 3EFSA 3M4GA 4Y17A 4FHTA 4H0EA 4HA8A 3FIFA 3L2ZA 1KQ8A 2Q2EA 3IKVA 2VONA 3G3ZA 2ZFWA 2PG4A 1BIBA 4EJVA 5LRSA 4GYIA 4KT5C 2FNAA 3R4KA 5HDNA 4ZZLA 3A7UA 4BNCA 2Q5IA 1NJ2A 5F6FA 1XGOA 4OIQF 2ZT6A 1KMMA 4YRTA 1T6SA 4LLGF 4P9FA 1JE8A 1B34B 1E24A 4PHCA 4ZTUB 5LJ3d 1GVJA 3EYYA 5FD6A 2K57A 2E1HA 2E7XA 3ABUA 1V3FA 2CWEA 2OAZA 3QRFF 1EIYA 2KJBA 4ENMA 2G7UA 2ARUA 3QO7A 4JK1X 4WXDA 4HF1A 1D3YA 1LEBA 5FFZA 4UUVA 2EWNA 3NEUA 3ZQ7A 1G4DA 2DVEA 4PJOD 3VOEA 4TV7A 5CVVA 3U9GA 1E2XA 3HRIA 1IUYA 1X55A 1G5IA 4M77B 3NETA 5HLIA 2MLGA 4PCQA 4D0PA 4XTXA 6PAXA 2EV5A 2CFXA 1R23A 4EJTA 4MQVA 5GAMf 4RB1A 4V2SA 2YX4A 1QF6A 3JCMe 1EVLA 4YREA 3KETA 1SD5A 3F8MA 4Q48A 3F72A 5JR3A 1W5SA 2P6TA 4J6XA 1XD7A 3JCMV 2AKWA 5CYVA 2CYYA 2VE8A 4WI1A 3G73A 1X56A 1BI2A 2J3MA 3Q9VA 2YR2A 4BYYA 2ZIMA 4JQFA 4YRKA 1KGSA 3M1EA 1Z6TA 1ON2A 2KIFA 4I01A 2H27A 3FM3A 2DK5A 2RQPA 1HTTA 3JSPA 4P73A 3GEZA 4UV8A 2DQ3A 1XGMA 1K78B 3TOBA 3KP6A 1FZPB 3HXYA 3IKTA 3SXYA 4M77E 3U1DA 2E41A 4Q15A 4KUMA 3GFJA 2DW4A 2R7FA 1YFTA 4IF4A 4HWSA 2Z9OA 3WU1B 1CGPA 2P7CB 5DD8A 4N9IA 3QOPA 4N0AA 4YFNF 4Q5SF 1PDNC 2A3SA 4WJ4A 2DEQA 1SRYA 4EJOA 2CJ9A 3KEOA 4AIKA 1TH7A 4ZYHA 1LDKB 1UHWA 1PUEE 1U6GA 4O5VA 4HV5A 3RDIA 1K7AA 2BGCA 4E51A 4HAMA 5D8KB 4U0WA 2IP2A 3JCMg 1GXPA 5D5XB 2HNIA 2DXTA 1U5TC 2RHQB 1PYSB 5GANd 4M77F 2ZXJA 2DTIA 5GAOq 1H9GA 4KN4X 3F3XA 2HGCA 5EEGA 1IRFA 3A7AA 5ED4A 1R7JA 4ESFA 1TW3A 1B34A 2KIUA 1YW7A 3NEMA 4XU1A 4XTYA 5DEQA 4R79A 1YQAA 2ZBKA 4M7DF 4RQFA 1L3LA 1H4QA 1HW2A 4PJOE 4GGGA 1Z05A 4PJOB 2DI3A 4HF0A 4EM2A 4YG2F 3LAPA 2L54A 3JB9H 4UXNA 3CTAA 2CSOA 2FOKA 4KMUX 3HSBA 1KYWA 2HTJA 2W24A 2DU9A 1BOAA 4K86A 2IA2A 3HIFA 4CO8A 5H6RA 1W5TA 3RUXA 3SWNB 1EIYB 1T39A 3C1DA 4HT9A 2GA1A 4HW0A 3JCMc 1YFRA 2EFNA 2C6YA 2C8MA 1X01A 5GANf 3I71A 3ICAA 1U5TB 3REUA 2F5FA 4M75G 3A5YA 1G3YA 2L4AA 3TEHA 3A31A 2DJZA 2RHSB 4N0AC 4CZZA 4H2XA 2CJAA 4HZFA 5LJ5d 4RAYA 2XAFA 1O7LA 1PYSA 1ZARA 4G7ZF 2RA2A 1MDMA 4KR2A 1XDUA 1TBXA 3ZMTA 1ULYA 3BZ6A 4A53A 5CVUA 3B02A 1QBJA 3IALA 4M7AG 4F7ZA 2PMFA 1MJ9A 5HS7A 2EJRA 4LMYA 2FYKA 3ELKA 2L3DA 3LWFA 3FMRA 1LVAA 1U1TA 2F5CA 4HX4A 1YFHA 4C8QE 2E1CA 4P73C 4RGSA 1MD0A 1Z1DA 1E17A 3E9HA 4M72A 4AWXB 1KU7A 2DU5A 1B59A 4A5MA 2YU3A 4BQAA 1SMYF 2BE5F 2QZ8A 4L0ZB 4X9CA 2DT5A 4M7AD 2HKOA 2Q0OA 5LGTA 1FP2A 3W3SA 2VODA 3GIBA 5IT3A 4RDXA 3WTTC 4M77C 3GLXA 3IHUA 2XTIA 1ZRDA 2HDCA 4M78D 2FEZA 4OIPF 1J75A 4F7UG 4H2XB 4HWRA 3RPUA 2I2LA 4ETSA 4A6EA 2F5EA 4HLXA 4NQWA 1FYKA 4NOYA 1NJ1A 4A12A 3SWNC 5L3DA 1FP1D 1W7PA 3TGNA 2K02A 3WTZA 2HYGD 1IN4A 4G6QA 1LOJA 3NQOA 4XSXF 2LF8A 2ZIOA 1U78A 4M7DA 3H3UA 1F1ZA 5K5RA 4P72C 5K5OA 1DPRA 2YHTA 4YFKF 3R0JA 5D4SA 2P5IA 1SD7A 5LGUA 3IL2A 3FZVA 1R1TA 1QNTA 4P5OA 1H9TA 5BPIA 4CDGA 4M73A 4WCGA 2QBYA 4AD9A 4C8QD 5GANj 1FWZA 4ENJA 1O3TA 1QPMA 1F9NA 1I5ZA 2Q7EA 1NHAA 2CGHA 2D45A 4M75F 1QQIA 2RD1A 5FLXK 1GGMA 5GAMg 4RQEA 2RB6A 1X2GA 1M5Q1 4HX7A 3SHFA 3SQNA 2ODRD 2RHQA 1IXCA 3HRUA 1UFMA 2Z99A 2IA1A 1H641 1ZAOA 2QYOA 2QHUA 3IRRA 2STTA 1ZGAA 3FM5A 3HOSA 3MZHA 3P9IA 3K2ZA 3WTSC 4I0AA 1TTYA 1YTYA 3LSQA 4IHTA 4C92B 4OIRF 4P72A 3RERA 2ELHA 1TNTA 2EV0A 1P92A 2FRHA 5GANh 1Z6RA 4CXFA 2EFPA 3ERRA 1N9RA 4ON0A 11ASA 3M8EA 4FX0A 1ADJA 5HS8A 3K9TA 2HQRA 4J6WA 2Y48A 3MEYA 1CF7B 4HDUA 2UZKA 4XQ3A 3CDHA 1ZHFA 1R00A 5A2QZ 3E5QA 5ERIA 4LG0A 5KNNA 4LB5A 4HF2A 2DTOA 1WRJA 4GYGA 1D8KA 2XAHA 3ZMVA 4M77A 3ZP5A 2K4BA 5GAOl 4ZH4F 3SB2A 4F7UE 1BC8C 4F7UB 1DP7P 3OOPA 2B0LA 5D8LB 4PGGA 2PN6A 1YYVA 4UVCA 4JRKA 1NYRA 1U8RA 5HS9A 3L7WA 2ZXFA 2MLKA 4KYWA 2P4WA 4I0BA 4P71C 1RIOH 4YIFA 3DKWA 3OV8A 3P8YA 1G5HA 5LRRA 5DCMA 1D5VA 4MMLA 4HWPA 3F8FA 3IWZA 5GAMj 2AXLA 4PG3A 4M71A 4EMKA 1KQ2A 5GAN4 2MH9A 1MGTA 4M75E 3I4PA 2NYXA 4XU2A 1Z91A 1LNWA 3GWZA 2RNJA 3NENA 3LFKA 2V6CA 1FBUA 2GQQA 5ICGA 1WPYA 1B70B 2UWMA 1UHMA 3H92A 3JCMh 1MGQA 2D1VA 4C92F 3DXJF 1UB9A 2NNYA 1B76A 3QPHA 1I1SA 3P8TA 4M9SA 4UNOA 1K78A 1ZREA 2EA2A 1MJBA 3ECOA 5DUIA 3M9AA 2Q5HA 1H4VB 4EGYA 3EFRA 1RI7A 2PLYA 2ALYA 5ILSA 2DFIA 2PEXA 2QHVA 3R07A 4JLIA 4M75C 4M78A 1O57A 1M8VA 1B9NA 3T8RA 4CS4A 2K4JA 1KU9A 1FLIA 1XMAA 3QU6A 3VEPA 2M8EA 1AOYA 2MBFA 3QNEA 3JAMZ 2C7IA 5GMKh 1BM9A 3HFVA 2FBHA 4BXUA 2EFWA 5ICCA 3FXQA 3E6CC 4UP9A 4H2YA 4EVIA 2FQ3A 2HKXA 4YRPA 5JFRA 3L9FA 4OIOF 2J3LA 5AIQA 1LEAA 2UXXA 4BHCA 2JN0A 4A0XA 3RI4A 2EJFA 3FMSA 5DYMA 2HZTA 3G1ZA 3M8FA 5L3FA 4C8QF 2P8TA 2MH2A 3IC7A 2E65A 1YS7A 2XAQA 4I98B 5K5QA 3QP5A 5GANg 5H6QA 5ICEA 2FF4A 3HOTA 4TVAB 2JTVA 3ULQB 5LHGA 1XGSA 1YIOA 2QQ9A 4LNSA 2VXFA 3EDPA 4LB6B 1HKTA 2EAYA 1YG2A 1YW8A 1I27A 4U0VA 3BDDA 1N9SA 5CJ9A 1BBWA 1FSEA 3QO3A 5D5WB 4WXCA 4M6YA 1VTNC 2M30A 2A69F 5K1YA 4KIBA 3J81K 5J8CA 5ILVA 4RB2C 2NAZA 3QHSA 3J80Z 1IAWA 4YRJA 2VOOA 4A0ZA 3EETA 1HW5A 2Z3YA 5DDGA 4E70A 1WQ2A 2DU7A 2V9VA 2ZKZA 3EUHA 4EM0B 3T0YA 5CVIA 4YRRA 4M7DC 1OMIA 4G6DA 4KIFA 2P5LC 3RIRA 3F8BA 4IRIA 1B7YA 3RYRA 4BWAA 4BH9A 2I4LA 5BQTA 2Y0MA 4MEXF 2GAUA 4C92C 2WWYA 4YCWA 1DDNA 1JJCB 5JVTA 1IF1A 2P7VB 2FBKA 4C8QB 3RYPA 1HC7A 5LHIA 2CG4A 5LJ5f 3ZMSA 4YRFA 4OMYA 3JCMf 1LYLA 3WTXC 1QZZA 3L1AA 2H94A 4CYDA 4Q6GA 3ZMDA 1YW9A 1TW2A 3N97A 4CS3A 3WQZA 3FF5A 2M1BA 1KQ9A 3LAJA 2A5YB 5F64A 2XRNA 5EEHA 3DP7A 3BY7A 3TKYA 2A07F 4XBFA 2OQRA 3ROUA 4M7DE 4I02A 1FYLA 3TO7A 4WK8F 1ADYA 2STWA 4PNOA 5CVJA 1PP8F 4YROA 3IG2A 5E18F 1YGBA 4RGXA 2E64A 2QTXA 2Y75A 1IN7A 3HY1A 2VBYA 5E1XA 3HTSB 4H2WA 1ZG5A 1T98A 2G7HA 3BPXA 2DZ9A 2ZZGA 5FO5A 1B9MA 2GXGA 1JRIA 4XU0A 3W6KB 4YRNA 5LEKA 1DPUA 2PMUA 1HKQA 4S04A 3S2WA 3HRSA 2KJCA 1USYC 5DY9A 4EMGA 5E20A 5K1XA 3CUQC 3NELA 1WQ7A 5TJJA 5D4RA 3SZTA 1LNXA 1EQRA 1A04A 2HFHA 4TVWA 5C53B 3GZ6A 2MA3A 5GAN2 4LJZF 4CHUA 2PFBA 4G8XA 1Q1HA 2RGVA 5HVQC 2O61A 3BPVA 2TDXA 2VC0A 1S8NA 4KDPA 4M7DB 2FNPA 1YB3A 1BC7C 2L4MA 1G3TA 5DD4A 4FX4A 3VBBA 3F6VA 4OINF 4YP0A 2W84A 3I58A 2DKGA 4M75A 1XMKA 3T5XA 4YPFA 2WV0A 4CH4A 4KA4A 4XTZA 3PCOA 2ZZEA 1IXRC 2ZNYA 5CVRA 4YFXF 3TDUC 1Z9CA 5E17F 1IN5A 3E5XA 3PQKA 4M78B 1MKMA 2ESNA 5E8IA 3REOA 4M6XA 3WU0A 4HYEA 4P3OA 4AH6A 4G85A 2M87A 4F7UF 3RKXA 4EMSA 1B6AA 2WTEA 3HSFA 5BS6A 5F1RA 3BJOA 4QWQA 3V4GA 2ZT7A 5D5VB 2JSCA 1UCRA 3CUOA 1G3SA 3BDUA 4MQ9F 2ARSA 3JB9I 2FU4A 5IT9Z 4IRGA 4X5OA 1Z7UA 1E1TA 4OLFA 3WTWC 3T1BA 2HQNA 1B70A 5GAN3 3HTUA 4M7AE 3CUQA 1BI0A 2HOEA 2XIGA 4NL2A 4J15A 3E97A 2QENA 5KK1A 4IRHA 3MAJA 3I59A 1J7KA 3VODA 3WE2A 1TQIA 4O2DA 4A2UA 3P9KA 5LHHA 5GAN5 1NYQA 3TUPA 1HSTA 3CJNA 5LJ5g 2VC8A 2J5OA 4ASNA 3BWGA 3K1PA 4RB3C 1OYYA 1D8JA 4M78E 3FB9A 2PMHA 3GFLA 4R8HA 3R0AA 3DPLC 4G9YA 1H0MA 2OD5A 2EK5A 1ZN2A 3WGHA 1D3BA 3GYHX 1V4RA 3WGIA 2L01A 2O6GE 2HR3A 3QO8A 2K27A 1E22A 4MNUA 4DPGA 3AAFA 1FC3A 4K88A 2XAGA 1IL2A 2OBPA 4L5IA 3HFOA 5L3BA 3RKYA 3I64A 2I4NA 4HVCA 4UVAA 2ZTGA 5LJ3h 3LA7A 4C92D 3BY6A 4XTVA 3W6JB 4JRIA 4G84A 5K1PA 4YYEA 2KIMA 2VBWA 3ML6A 2ETHA 3RTRA 2RN7A 3B73A 1W7PB 3U2RA 3LSTA 4JUVA 2PJPA 1SFEA 2H09A 2WC2A 5I21A 2Z33A 4EMKC 3PGGA 1XSXA 5DUKA 2R3SA 1G3WA 4HDVA 1OKRA 1FY7A 2DDZA 2LDUA 3GFMA 2ZMEB 3JCMQ 4ZTZB 3E6MA 1KYZA 4DNCA 4P9UA 3V8JA 1ASZA 2GXBA 1EH6A 5C51B 4IVNA 3FJPA 3FMQA 5IT9K 3WGGA 1RZ4A 2RV8A 1RIQA 1FYMA 3TO6A 1XSDA 3BW1A 1YO5C 2AS5F 4M9XA 5LJ3e 2ZT8A 4B09A 3DFGA 3PFIA 1WSUA 4U0YA 2ODRC 3RL6A 2A61A 4P96A 3ZN1A 4EQQA 1DUXC 4H02A 3E9IA 4IHSA 3UGTA 3BOQA 4P75C 4K2EA 5LLQA 4LK0F 5HDGA 4CH6A 2FE3A 1XB4A 4ENKA 3O6BB 1O3SA 3ZMZA 4L18B 1NJ6A 4MTEA 1S7OA 5HDKA 4M77G 3E3VA 2O8XA 1XCVA 4TWAA 3QP6A 3TQNA 2YLCA 4AIHA 1U3EM 2DXUA 1FBQA 5LGNA 5GMKe 4XRFA 2P5KA 4J6YA 2IVMA 4P75A 2W25A 2XKPA 2UXNA 3C18A 3JB9J 3HXUA 1B7YB 1USSA 3A32A 2DPUA 1U1SA 3V8KA 1WU7A 3UGQA 4P3PA 4WF2A 1FBSA 2E10A 3CUQB 4LD5A 4ZIBA 3L2CA 4CH3A 1SFUA 1X54A 1EH8A 3HRTA 2K7LA 3QU3A 2ZMEA 1S6LA 3I0TA 3FWEA 1EVKA 1LDJA 1FNNA 2ZZFA 3VQVA 2YX7A 2F2EA 3KP4A 4H2UA 2HS5A 4YRIA 2FB7A 4C92A 3MEXA 4KMFA 5C52B 1I4K1 4WX9A 1HK9A 5ICFA 2CJBA 4B8XA 2QLZA 4L0YB 1MDMB 1ZRCA 1C0AA 3PZCA 2RC4A 3LA2A 4G94A 2A6HF 3C7JA 1VQZA 4H2VA 2PQ8A 4LG0B 3L4GB 1SETA 1R5GA 3SWNA 4WJ3M 1QO0D 1RUNA 2HYFA 2XASA 2BV6A 3P9CA 2ARTA 5TRDA 3WG9A 4OOIA 1KOGA 2BBYA 2KKOA 3R60A 4PJOF 3PCOB 4AIJA 4GCVA 5GMKl 2I4OA 2E3CA 4HQEA 1HQCA 2OZ6A 5GAN7 2QM3A 3CO7C 2CIMA 5FB2A 1GHCA 2IY5B 1N9WA 5DCFA 5HLHA 2MD5A 4RS8A 1LDDA 4IJAA 2YLBA 1EOVA 1STZA 5LBQA 2V1UA 4RCBA 2RKHA 4XTWA 3K69A 5D6EA 4OP0A 3C3WA 3BJUA 2XV4S 4M9ZA 1JHHA 4L9VA 4C8QC 2ISYA 4HBLA 3MZYA 3HXWA 4TTVA 5GMKi 1FPQA 5HGQA 3ISPA 2D1HA 5DCMB 4U88A 4L9NA 4TQDA 1SFXA 2ADUA 1LJ9A 3E6BA 4O3MA 2W85A 4A0YA 2W57A 1SERA 3VQWA 2NNNA 3SZPA 2VXEA 1X2HA 4EO4A 3V8LA 4PZJA 4ZZDA 1WNLA 1SD4A 1ZLKA 1C0WA 3KP5A 4KFCA 3IKMB 3RF1A 3BROA 2FA5A 3HUGA 1LB2A 2IPQX 2X0LA 3Q9SA 3GFIA 2VE9A 5L3EA 5LJ3g 4YRLA 1HSJA 4M78F 2FBIA 3J7AO 4KICA 1YCYA 2QHTA 4P74C 3P8VA 1JXSA 1FT9A 3FXRA 3D0SA 3GF2A 3F21A 3J81Z 4EGZA 4ENNA 2ISZA 4M7DD 1Y96A 1FYFA 2DK8A 3ZMUA 4M78C 2O0YA 2H6CA 4M7AF 4WXHA 4UVBA 1AWCA 2E1NA 5AIPA 2A6EF 2F5DA 3DQVC 1ZH5A 3HXZA 3SFZA 4U7DA 2EV6A 4R1HA 3QPTA 2EJGA 2G4CA 4N0BA 4H2TA 3RGLA 3HHHA 2ZCWA 1FX7A 3JTGA 1J9IA 4LK1F 2E7WA 1I1GA 1IN6A 4EMKB 1EFWA 4F7UA 1KMNA 2PBIA 5D6FA 2D2WA 1HW1A 3GW2A 4L87A 4HV6A 3WODF 3JCMX 4XU3A 1NNHA 1ZGJA 3GO5A 4PJOA 3MFKA 3BJ6A 1WWXA 3KEQA 4M7AA 1R5HA 3L4GA 3DF8A 2E5AA 3AHUA 4TVYA 5KVRA 2FMYA 1SD6A 1J2XA 4DQ2A 2ZT5A 4UV9A 1QE0A 2LF7A 3CMQA 3ERED 1J0RA 1SAXA 1F4KA 2JPBA 4NB5A 1USYA 4KQEA 4CGZA 3D5LA 5BMZA 4HWOA 3LSSA 2QWWA 4BHPA 4TVAA 3V7CA 2IJLA 2ALYB 2O3FA 3O3KA 2QVOA 2ZGWA 4Q4ZF 3JSOA 5L3CA 1FSHA 5E8GA 1G6NA 4QVCA 2ZR2A 2LKPA 5J8FA 4HQMA 1RNLA 1U5TA 1ASYA 3JB9F 1ON1A 3L00A 4L5JA 1G51A 2OA4A 5E1WA 3J80K 2HWVA 2JT1A 1H4TA 1YLFA 1YS6A 3QAHA 3RESA 4YRQA 2CO5A 3QTCA 3ECHA 3M7GA 3I53A 2P0LA 3TO9A 4AVPA 2CGPA 2RVCA 5DV5A 4MMKA 4Y13A 2ZR3A 1B8AA 2DQLA 2IT0A 3I7FA 1EH7A 2O03A 4RB0A 2M45A 3N4MA 2OU2A 2A68F 3M4PA 1U2WA 3JW4A 5ILUA 1J5WA 3JCMP 4M7DG 1CF7A 1XDSA 2YPRA 2XUBA 3TDZC 4M7AB 4M7AC 2FMLA 4XLNF 3MCZA 3WTUC 1J59A 1H4SA 5LJ5e 1J5YA 2PI0A 3UFGA 1IZ1A 2QHSA 3VB2A 2X4HA 3KFWX 2DLLA 4YRGA 1JGSA 3DEUA 5ELNA 2Y90A 1IN8A 3TOAA 5HOOA 4J5YA 3DV8A 4M78G 4EX5A 5GAN6 3QO5A 5A2QK 3BFMA 3LQRA 3RJPA 3HXXA 1XN7A 5D5UB 4EM1A 4O6JA 3COAC 4RAZA 5JHUA 3RACA 4HOBA 4I7HA 2DQ0A 4P74A 1L0WA 3LC0A 2JPCA 5GMKm 2CW0F 1R36A 5LEJA 4YRMA 3K1NA 1F5TA 2BYVE 3EQLF 4YCUA 3KP7A 4MHGA 1YFSA 1EV7A 4C92G 1K79A 3P7NA 3CO6C 4L9TA 3OD1A 4CH5A 4HX8A 4HT8A 5LJ5h 3GZ5A 1KU3A 2VT2A 2Q7HA 1P6RA 4XSZF 1PP7U 3RKWA 3T8TA 4A5NA 3K1MA 2Q8KA 4K87A 3EYIA 1IXSB 2ZJ2A 2CQKA 1GXQA 2BEOA 1ODDA 1I81A 5GMKj 5BPDA 5LJ3j 1E1OA 4RGUA 3TEHB 3ZN0A 2DQRA 1RUOA 5GAMe 1XCBA 2AMCB 3VQYA 4XEMA 3IRQA 1BBUA 3HY0A 4ZYEA 4G7HF 2R7DA 2EJ9A 4EJWA 2GZWA 2NRAC 2DAOA 4S05A 1T2KA 4UHTA 4ESBA 4I2OA 1Y96B 2ZNJA 2ACJA 3WTYC 4M75B 1O3QA 3WTVC 1BI3A 4CICA 3F22A 3R61A 3JCMd 4YIIA 1P4XA 2QQAA 3KP2A 4A6DA 2LSOA 4XTUA 1W66A 1I5LA 3HXVA 2DBBA 3JCMb
chains in the Genus database with same CATH superfamily
3HGYA 3MCAB 1VQ8A 4OMZA 5FU7B 1OCPA 1R1UA 3ABKH 3BCAA 2EFOA 2KRFA 2L7FP 5FGMA 5HLTA 4PJOC 5FFXA 2GA2A 2V1XA 4BAYA 2AQEA 1ERDA 4AFZC 1B1BA 3HFZA 2E6NA 1VQ5A 1IC8A 4XQFA 4LLLA 3GX4X 4MTDA 3NEMA 2M5WA 3BTLA 1X4PA 4I09A 1QPIA 5I2SA 4DBRA 1LPLA 1WKMA 4YCVA 5GAGJ 1XSVA 1X2NA 4CCNA 2X51A 1ZLJA 5GPAA 4C0FA 1X1DA 4XLEA 3TEGA 4KR3A 2K86A 2TRTA 2W0ZA 5GAMh 5GAN8 1HBXG 2YUPA 3VQXA 3BP8A 2ZO4A 2CQ7A 3KP3A 2V1RA 3VDXA 3HC7A 3G71A 2WSFE 3L2RA 4LFUA 1MZBA 3HHGA 5CKBA 2GWRA 4CYCB 2XC7A 1IV8A 1TQMA 1WI9A 3IH4A 3JTHA 3AG4H 5KAIC 1JUSA 2LX9A 3F70A 1FOKA 1BA5A 2E12A 4E6RA 2EBPA 2KT1A 2QKLB 3BR6A 2Y4XA 4L6V5 2OTLT 2IY5A 4TVRA 4NBQA 5GP9A 4XMYA 3AT1B 4RG2A 2WADA 3BR5A 2ZCEA 2QK0A 3JB9D 2KYMA 4KIGA 1FOYA 2QUFA 5GAHJ 1NM7A 2HNHA 2XPUA 2ZPFB 5CKHA 3EUAA 2G9WA 4U7BA 4E2FB 1VQMQ 4FT8A 4A4GA 4RCCA 2ZAEA 5F5WA 4XRSG 2JRTA 2VN2A 3VFZA 2MFZA 1ZR4A 4ZDOA 3LQQA 5J6XA 1PCXA 2F69A 4PL6A 3H5RA 3G6ET 1ZUUA 1IO6A 3V7RA 5GAOr 2JN6A 1K0SA 1QRYA 2COMA 1BR2A 4PDKA 4C92E 3A5ZA 2DPDA 5ELOA 2YSRA 4MEYF 1K6OA 5LL6S 3K4KA 3PIOA 2K9GA 1TQPA 2XGXA 2CS7A 1Y0UA 2RJFA 2Z5UA 3QDFA 1CSKA 1BBYA 4XONA 4M75D 4UP7A 1X3UA 3I9QA 2LX7A 2DVJA 2I4MA 4YRSA 1QVUA 2HTSA 2HQAA 2Y69H 3LSKA 4IPAA 2PQWA 2DETA 2R7SA 2IPOB 4GXOA 1USTA 2ME6A 2RQRA 3RPQA 1B8IB 2KVQG 3R6NA 5GAMd 2CMPA 2GBYA 3H3ZA 3ZPLA 2VQLA 4QQ6A 2R93J 5FD5A 3EH2A 2ZFUA 1DP3A 3KZZA 4MZMA 1BR4A 2VJIA 2DA1A 4M74A 4P55A 4Z2YA 1UGSB 1Q7YR 2VXZA 1P2FA 2X1EA 5CAIA 1T08B 1Q7YC 2LY9A 3HTZA 2VBXA 1KU2A 4LLNA 2X3WD 3IKLA 3PQJA 3LGFA 5FLXE 1J09A 1P9QC 1W7PD 2PU9B 2P84A 3M0UA 2E2HJ 1AWWA 2AKWB 1SG5A 2IIMA 1VQKQ 1PYVA 1ZRFA 2O2OA 1RL2A 4FETA 2NUTB 2XDDA 1IDZA 2V79A 2JZYA 1YJWQ 3C94A 1OZ3A 2BHYA 1V1CA 5B1AH 1TWFJ 2KRCA 5E1ZB 4JBAA 4RMFA 1BIAA 2XKOA 4D7NA 4M3DA 3BR2A 2H6BA 2RDPA 4G7OF 2ENMA 3DU6A 3H9JA 1HCRA 2BUDA 4Q47A 1PWTA 3MF1A 2JSPA 3X2QH 3OYCA 2IA0A 2KZVA 2LCCA 4HVWA 3J81E 5C44J 2MC3A 1SESA 2E34A 4VUBA 4A54A 4A4EA 1S29A 3THKA 2ZSHB 1W6XA 2NS0A 4XK4A 3A7RA 4ZTFA 3PNTA 3REXA 4BQQA 3F8CA 4IQJA 1HDDC 4IIMA 4OF1A 3EG9B 4AG2C 2GF7A 2JWTA 3G4SA 3JB9G 1VQKT 2FL7A 4RTVA 3SYTA 2XGCA 2LRDA 1W4MA 3VPRA 4B3AA 2VT3A 2ICWG 1JHFA 1O3RA 2L7ZA 1SHGA 1YJNT 2ZNZA 4NCXA 5E3IA 4YDQA 1ATIA 5BOXA 5JI6A 1KJWA 1M8MA 3L09A 1TC3C 4OMFB 2M9HA 2P0KA 2E6ZA 2XSJC 3RKQA 4PJOG 4A4HA 1M90R 1D3BB 3CBOA 3JRAA 4M77D 4RM2A 2RM4A 3N05A 3I59B 3PO3J 3F6OA 1TNSA 1AZEA 1QVGS 1T95A 3DPTA 3I4NJ 4F92B 2MCNA 1ETKA 2XPWA 3FX3A 4LVJA 2HL5C 2VASA 2JZ2A 4RTTA 2H8HA 2VWFA 4A3EJ 1BN5A 2DTRA 1Q81R 3Q5FA 1WQWA 3HFNA 2BZXA 1N8RR 4RGRA 3ZQGA 2DZCA 2PMZA 3MQ0A 2J5PA 5M3FJ 3GNFB 3ZOBA 4NC7A 1VQ8I 4J9IA 4Y91A 4H4KC 4EMHA 3LSRA 5GAOm 2ZT5A 1YN8A 1ZYRF 3AFHA 3IUOA 1QMCA 1NJ8A 1LQ1A 4NHJA 3KCCA 1WHLA 2HKQB 3R6OA 3HSRA 3JCMJ 3CCUT 4RA2A 2XAJA 3KFUA 3SWNC 3R6SA 4W1UA 2MPXC 4J83A 3HFZB 4CS2A 5CLSA 4TQFA 3GUDA 4J9EA 3RSNA 1T0FA 2FXAA 3BG3A 3CLOA 5HNFA 1R49A 1UMQA 3BJAA 3E5UA 4YIRX 3G4SI 1B72B 2DTHA 2ROTA 3OY9A 1VQ4Q 12ASA 3JR9A 4DZJA 1JBMA 3PL8A 2PUKB 4C0DC 5C0MA 4P3NA 2YWWA 3H6ZA 2VBZA 2HQHA 4JPBW 4F55A 3PNYA 3FHZA 1R58A 2XROA 4OMOA 3TBIA 4BW9A 1P4AA 3PO2J 3CQTA 3KYCB 1L0OC 3F8NA 4QLCU 1VQLT 1RKWA 2BZYA 1N25A 2IGMA 3ZXSA 1SMTA 2DL7A 2IW5A 3HRKA 3KLOA 1KQ0A 4F52A 3JRFA 2VL8A 4N9HA 3CCVI 5HLGA 3VU3C 2FX0A 4IUVA 3MF2A 3MWMA 1ONVA 4ZYGA 2L8DA 3ABTA 1A5JA 2A08A 1M90C 3FXUA 2GIVA 2XHKA 2IS6A 3CLQA 3F0CA 1F36A 3QPLA 1T8IA 3L2QA 4HCBA 4L9JA 2DJNA 4JS5A 1HXDA 2VJJA 4B6MA 2E1MC 3U1KA 3IWFA 1BJAA 1Y07A 1QZYA 3G1OA 5L3GA 2DXBA 2DOAA 2BZ8A 1WLEA 1QP2A 5JVGF 4LVIA 2ESHA 4ZYDA 3FXLA 4XR6A 1B4AA 2HD0A 4HLYA 3I5UA 2GOMA 1T38A 3GXOA 4DBHA 2EB7A 1E0EA 1O75A 3MO8A 4ME7A 1X4OA 2WAQA 4AM3A 2EQRA 1JJCA 1IRGA 2RHSA 5IOZA 3IP4B 5KYWA 3VRZA 3VUZA 4XKWA 2BY1A 3JAMK 5M5YJ 4WWCA 4Y15A 3INZA 4II1A 1I6XA 3V7SA 4PLLA 1T3SA 3CC7Q 2ZINA 1AD5A 4C8QA 1KA8A 1MH4A 3M4QA 1XG1A 1YJ9Q 1T56A 2HDAA 5H20A 2X85A 2QQSA 3H5NA 2XU8A 3JRZA 3QKJA 2VYTA 4PLIA 2CH4A 3SEMA 4RLQA 1XGNA 2KRSA 4KNYA 2B7EA 4GO1A 4E47A 2XGTA 5AONA 2VOPA 3C0CA 2AMCA 1WLPB 2KRMA 4P71A 1MMGA 1REPC 2P6SA 3SD4A 3M07A 3NRVA 3SDGA 2Y31A 2SRCA 3SWNB 4LVKA 1JUPA 2IRFG 1OR7A 3A74A 5K7FA 5LJ5j 1HKSA 4MDXA 2L3SA 1QVGP 1QLYA 4OU0A 1WZ2A 2EA4A 2A28A 3MEWA 1I8FA 5FWCA 1Z67A 2Y0SA 4B47A 2VKDA 4A3KJ 3TW6A 3DPUA 2OQGA 1IRZA 3KE2A 2DILA 1LVKA 3M55A 3TEEA 3VV0A 4H2SA 2KGTA 3MEAA 1AOJA 5DS9A 2QGFB 1Y0NA 2L02A 3A02A 3GP8A 1TG0A 1K73U 4RTZA 4QPOA 1S3JA 1JXMA 3F23A 4XLPF 2R7XA 1M9SA 1MNEA 2OZUA 5LJ3f 1NEBA 3QUIA 5HK0A 4G12A 5FLXZ 1YHQQ 2H3EB 4B43A 3CD6Q 4IXAA 1S7AA 1YRNB 1MJAA 3JCMW 3ZR8X 2VV5A 1NJ5A 2EFQA 2Q7GA 3HYIA 2LNBA 2QQBA 4W97A 2JTFA 4XLCA 4BHBA 3H0IA 2O9LA 1WYDA 3HRMA 4FCYA 1AZGB 1ZG3A 1AWOA 1N75A 3O2PE 4EV0A 2R5ZB 4CYCA 3EGDB 3VS1A 3QSUA 1Z7MA 2FUG2 5GAOp 3GZNB 2CUEA 4C3JJ 3WE3A 2HEOA 3SDZA 2HOSA 4D9JA 2DF6A 3I55T 1UGRB 3S2DJ 2DCEA 2QQRA 2ZPBB 4X9DA 5GAOn 2FSWA 1OYWA 1PD0A 2VC1A 3OYGA 4PFZA 4HWTA 1IJWC 2XVCA 1LJOA 2ZNIA 4QVDA 1VZ0A 1M1KC 2E5ZA 1UDLA 3K4LA 4BBRJ 1P4WA 1Z7NA 4B4CA 4I99C 2QBYB 3CMET 4UPAA 2P5VA 1TLHB 2DO7A 2MG4A 2DX1A 2OCCH 1RESA 3HSEA 3KZYA 4PGHA 4LGWA 3FK7A 5JHFA 1KQ1A 3E6DA 2PVGB 3ME9A 2B86A 2K9LA 5KYWB 4ORZA 5IHNA 1PD1A 3KLNA 3DLAA 3LSGA 3I54A 2AQFA 1W1FA 1YI2T 1YJWT 2XICA 4UP8A 3DSQA 4YRCA 3GVAA 2ID6A 4JZ4A 2MD0A 5A2QE 3OW2S 2F4IA 3BQZA 4ESJA 1ZG1A 2JA2A 3JRHA 4MGRA 1WFWA 3IAS2 4J9BA 4KRTA 5KYXA 1R22A 1BI1A 1QGPA 4QQGA 1VQOT 1IW7F 2EL9A 4GY5A 1TP4A 3ER0A 4C8QG 3VSLA 1KFZA 2PMZN 1VYVA 2CQNA 4EJUA 3K0LA 2D1XA 2V1DA 1OPCA 1MIJA 1EJ9A 4NL3A 1R1VA 3S93A 1KIKA 4KN7X 1O7FA 2ZMEC 1X3WB 5M9OA 3LA3A 3UH0A 1OYIA 2M4KA 3DCFA 1PHTA 1TU0B 1PVEA 1OULA 3EFSA 3M4GA 5GANe 4Y17A 3CCVT 4FHTA 3VYSB 4HA8A 4H0EA 2RQWA 3FIFA 3L2ZA 3PUFA 1KQ8A 2KPMA 2Q2EA 4NQWB 1K9MU 3IKVA 2VONA 1QCFA 2C0IA 3G3ZA 2O4XA 1X6GA 2ZFWA 3PJRA 3FXOA 4XN0A 1JKRC 2PG4A 4CCJA 1BIBA 4EJVA 2YUOA 4DA4A 5LRSA 2DBMA 2OCEA 4GYIA 2IAIA 1TWBA 3G71T 4KT5C 1FXXA 1Q81U 2FNAA 1Z3YA 4DJAA 3R4KA 5HDNA 4Z8AA 3DBHB 4ZZLA 1E7OA 3A7UA 4BACA 4XEOA 2KY9A 5KCMA 3T9NA 4BNCA 1VFCA 1HA8A 2Q5IA 3I3LA 2EQJA 4NC6A 1NJ2A 5F6FA 1XGOA 4OIQF 1WJEA 2MF2A 2ZT6A 4M3EA 1KMMA 2Y30A 3FBNB 1UB4A 4YRTA 1NG7A 1T6SA 5FRMA 2F2XA 2XHCA 4LLGF 4P9FA 1JE8A 1ABOA 1B34B 3M54A 1E24A 4PHCA 4ZTUB 3CCMA 4FL6A 2VQGA 1UELB 4OB2B 5LJ3d 1YFNA 4X1VA 1GVJA 1KQSP 1WIEA 2R5YA 3NFCA 1QVGA 3EYYA 5FD6A 2GM4A 2HVQA 2K57A 3CCJA 3LWIA 1WI3A 2E1HA 2E7XA 2V9KA 3QWYA 3ABUA 1V3FA 2OTJT 2CWEA 3KYLA 1NPPA 2OAZA 4CC7A 3QRFF 1EIYA 2KJBA 4ENMA 2G7UA 5D6XA 1K4TA 2ARUA 3QO7A 4JK1X 4WXDA 2WSEE 4HF1A 2X6WA 1D3YA 1LEBA 3UNGC 5FFZA 1PKSA 4UUVA 3I56Q 2EWNA 1M3AA 2R7OA 3PNVA 1GRIA 2K5FA 3NEUA 2O88A 2GOXB 4U87A 3ZQ7A 1YP5A 1G4DA 2DVEA 4PJOD 3ZQCA 2VJ5A 4RMNA 3VOEA 5J1RA 3FEOA 4TV7A 5CVVA 3U9GA 1E2XA 2E70A 1OR7C 2V8IA 2ZJRF 1IUYA 3HRIA 1X55A 1G5IA 1RI0A 3I4MJ 4M4ZA 4M77B 3NETA 2RH2A 5HLIA 3A98A 2DXIA 2Z1DA 2JS0A 2MLGA 4PCQA 4JYKA 4D0PA 2R7RA 2O7OA 2CQXA 6PAXA 4XTXA 3BG9A 2EV5A 2CFXA 1R23A 2K5CA 3BG7A 2EQKA 2QDLA 4EJTA 3AL0B 3LFUA 4MQVA 1C0MA 4YTLA 5GAMf 2O5RA 3LSJA 2A6TA 2JRMA 4RB1A 3S16J 3ZBDA 1NJIC 2YX4A 4V2SA 1OV3A 1WJAA 1FIPA 2D0NA 2RHIA 1Q86R 3JCMe 1QF6A 2QEXI 1X1PA 1EVLA 1WH5A 2EJFA 4YREA 2K3FA 1F43A 3KETA 4QSHA 1NYGA 2GBQA 1R77A 1N27A 3BTJA 1ZK8A 1VUBA 1P7IA 1SD5A 3CMAA 3FISA 2BOLA 3F8MA 5J3LA 5FU6B 3CF5F 4Q48A 3F72A 1VIFA 5JR3A 4E7LA 2Y4YA 3VRYA 2OTLQ 3VYRB 1W5SA 1HF0A 4JRKA 2P6TA 4J6XA 1XD7A 3JCMV 2AKWA 5CYVA 2CYYA 2VE8A 4WI1A 3G73A 2X48A 4J7FA 3DWLE 3HOWJ 1S5LC 1X56A 3KZIC 3SDBA 2KYBA 1BI2A 2J3MA 4R56A 1KD1U 3UATA 3Q9VA 2YR2A 5HKCA 1POGA 3A03A 3DEWA 4BYYA 4EDUA 4JQFA 2OTJA 4PSXA 2ZIMA 4YRKA 1BOBA 2M2EA 4QTRA 2DL4A 4B9XA 2DT7B 1KGSA 3M1EA 5IP6A 2K3XA 1Z6TA 1ON2A 3EHQA 3X24B 3D5RC 5LJ3e 1A6QA 2KIFA 2WA0A 2HSEB 4A93J 3NTIA 4AMCA 4I01A 1VQ8Q 2LDMA 3PUBA 2RJCA 2H27A 3FM3A 5CQEA 2L7MP 2JMAA 2DK5A 2E5NA 2RQPA 1UG2A 2FVUA 2LJ0A 1HTTA 3JSPA 1WI7A 4P73A 2X6OA 1OPLA 2M7BA 3GEZA 4UV8A 2BVMA 5B3SH 1G59A 1OU8A 1XGMA 3PSFA 1K78B 4PJMA 1S1NA 3TOBA 3KP6A 2CV1A 1UEBA 2JTEA 2KNBB 3CCMQ 1FZPB 3HXYA 1C0AA 3IKTA 2EH3A 3SXYA 5GTHC 4M77E 3U1DA 2E41A 4Q15A 4KUMA 3GFJA 2DW4A 2R7FA 2CP0A 1YFTA 4IF4A 1IV6A 4HWSA 5EGOA 3PMTA 2Z9OA 3WU1B 1GBQA 2H8WA 1CGPA 2P7CB 5DD8A 4C0ZA 2LBFA 4N9IA 1YI2Q 3K4BA 3QOPA 3LWHA 4CH7A 4AVZA 1X43A 4N0AA 4YFNF 4Q5SF 1N6AA 1AA7A 2P0PA 3G6EI 1PDNC 2A3SA 4WJ4A 2DEQA 1SRYA 4EJOA 2JVGA 2CJ9A 1Z21A 3KEOA 4AIKA 1TH7A 2X4YA 4ZYHA 1LDKB 2ZJPF 2KE9A 4WTOB 1TOVA 1UHWA 2K85A 1PUEE 1U6GA 2VQCA 4HV5A 4O5VA 4KT6A 3RDIA 2BGCA 1K7AA 3OB9A 5J1YA 4E51A 2DA3A 4HAMA 4ZDPA 5D8KB 4U0WA 2IP2A 1Y56A 2OPTA 1JB0E 2DJIA 2GGRA 4XN3A 3L1PA 2VGMA 3JCMg 2CFOA 3ASOH 3DTKA 2BE9B 1GXPA 5D5XB 2F5KA 1G2BA 1Z9ZA 2DXTA 2HNIA 3C95A 3AG2H 1Q86C 2OTJQ 1U5TC 2RHQB 4CZCA 1PYSB 4J19A 1IGNA 5GANd 4M3FA 4FW2A 4M77F 2ZXJA 1N77A 2DTIA 3GTQJ 1U9NA 3B6AA 3BDLA 5GAOq 4LVMA 3S3MA 1H9GA 4KN4X 1YIJA 1MH3A 3A0BC 3HEFA 3F3XA 2HGCA 4BY7J 3OR1C 1AU7A 4D8KA 4P5NA 1K9AA 5EEGA 4KULA 2EZIA 3FK6A 1IRFA 3OYAA 2JA6J 3ULRB 3A7AA 2QF7A 1R7JA 4ESFA 5ED4A 4LNPA 2L3PA 1TW3A 5EJCA 2KIUA 1YW7A 4J00A 1B34A 4FU6A 4OVAA 4R0KA 4WCIA 4XU1A 2RJEA 4XTYA 5J1UA 3G2BA 3SFIA 4II3A 2CH4W 2K4YA 1BB9A 2M1HA 2LLKA 5DEQA 4R79A 1YQAA 2ZBKA 1XJWB 3EG0A 4OWRB 3CMEQ 1A6IA 2IGKA 1WXUA 4BXFA 1YI2A 4RQFA 2OF7A 2F2WA 1L3LA 3TVTA 1H4QA 1HW2A 2HVSA 2LH9A 4RDUA 4PJOE 3OOUA 4GGGA 1VQNQ 4A3MJ 1H8AC 1G5VA 1U5SA 1Z05A 4PJOB 2DI3A 4HF0A 4EM2A 4YG2F 2EVRA 3LAPA 1EF4A 2G3RA 2K79A 2L54A 3JB9H 4I76A 4UXNA 3CTAA 2CSOA 2LC4A 2FOKA 4KMUX 1A31A 4D8DA 1VQPI 3HSBA 4OMQA 1OCRH 1KYWA 2DD5A 2HTJA 3QOEA 2W24A 3FXMA 4F91B 2QA4I 3JRBA 3TEDA 1CKBA 2DU9A 1R0BG 1BOAA 4IUPA 3OQ5A 4K86A 2DYRH 2IA2A 3L2VA 1VIEA 3HL2A 3LMMA 3HIFA 2NVYJ 4CO8A 2QCOA 5FU6C 3URGA 3REAB 4ELZC 3RPUD 4IUUA 4IOCF 1VA7A 2DYBA 3QWXX 3CCJQ 5H6RA 4ESRA 1W5TA 2LMDA 3QQAA 3AG3H 1JKQC 2CZ1B 1PNJA 1T39A 3RUXA 1NEGA 2F4MB 3C1DA 5KE3A 2L7KA 2AO9A 2GA1A 3L2WA 2GLOA 2EGCA 2NUPB 5EDNA 5CIUA 4HT9A 4HW0A 3JCMc 5CCAA 4IHYA 2Q1ZB 3EHRA 1Q7YU 1YFRA 2DXCA 2ZZDA 1SKUB 2EFNA 4HT4A 2C6YA 1S7EA 2JTMA 2C8MA 1X01A 3TSZA 2JA5J 2BZTA 3I71A 1M3CA 3S14J 5LJ3g 5GANf 4XAXB 2LC2A 2JVVA 3G4SQ 3HOVJ 3ICAA 1U5TB 1O4XA 4IKFA 1WDXA 2RNAA 4A3GJ 2I0NA 3REUA 3IH3A 2LTPA 2FZGB 2DL8A 3ZQFA 2F5FA 4BE1A 1TXQA 1PRMC 4M75G 5GAEJ 2JNGA 1G3YA 2L4AA 2JMCA 3I55Q 3GPLA 2DERA 3M0PA 2M34A 3A31A 3TEHA 1BCOA 2DJZA 2QEXA 1MMAA 2RHSB 4N0AC 4CZZA 1ZTRA 4H2XA 3UDCA 4AFSC 2CJAA 4HZFA 1XS9A 4RAYA 5LJ5d 4EEFG 2V6EA 2XAFA 1OCZH 1VF9A 4M3GA 3EG3A 2HBPA 1O7LA 1RI9A 2M8GX 1UGVA 2MGQA 4N4GA 3X25B 1PYSA 1YE9A 1ZARA 2DMPA 4G7ZF 2RA2A 2WACA 3LGLA 3VS5A 1MDMA 4KR2A 2OUMA 4Q5WA 3CC2I 1NLOC 4X6AJ 1W1WE 1XDUA 1TBXA 3ZMTA 3M56A 1TWHJ 1SVMA 1ULYA 1WVRA 2PVOB 3BZ6A 1D1CA 2ROLA 3HPHA 4A53A 5CVUA 2MK5A 3FLGA 3B02A 4DEXA 3H0DA 2KROA 1WFXA 3D7SB 1K76A 3PMIA 3X28B 1QBJA 1NE8A 4LE9A 3IALA 4ZN1A 4M7AG 1D5YA 2GCXA 2LFBA 2WY7Q 4NNJA 1ACMB 1VQLA 3CCVA 4F7ZA 4XLFA 1I5OB 4BI4A 5I11A 2PMFA 3HP9A 1MJ9A 3LSHA 1TWCJ 1M1EB 5HS7A 2EJRA 3SEQA 4AIDA 2ZPEB 4KUIA 4LMYA 2FYKA 3OYJA 3ELKA 1Q86U 3K4JA 2DFFA 2L3DA 4F14A 2HEQA 3LWFA 1TZLA 1K73C 4BJ5C 1S72A 3FMRA 1LVAA 1EZZB 2F5CA 4HX4A 1YFHA 1U1TA 4C8QE 2E1CA 5DTDA 4E7ZA 4P73C 4RGSA 4LG3A 1MD0A 4HPQA 5IY5H 2CW8A 2R4GA 3ZQQA 2HQEA 4XIDA 1LE8A 4HSRA 1Z1DA 2VKVA 4BKXA 4A3JJ 1E17A 2DPPB 5AYFA 3E9HA 4M72A 4AWXB 1KU7A 3OW2P 4J01A 5B1BH 2DU5A 1B59A 3UKGA 2ESWA 1PUFA 4A5MA 2XB0X 4Y92A 2K3YA 2TCTA 2X4JA 3A8OB 2YU3A 1Y6IA 1QWFA 3VS3A 3ZCOA 2HI3A 1WJDA 2NS8A 5DM6F 1SMYF 2BW3B 2BE5F 4G6TB 2QZ8A 1GT0C 4BQAA 4L0ZB 1I0CA 2AZSA 2H8RA 2DT5A 2ED0A 4X9CA 3CCET 4CCOA 4BDYA 3M53A 4M7AD 1MBFA 2HKOA 3CCYA 2Q0OA 2EYYA 5LGTA 3HTRA 2DYIA 4HCKA 4A69C 3NMZC 1FP2A 5FKNA 1AHDP 2QTVA 1KHCA 3W3SA 2VODA 2PJRB 3J80E 1WCMJ 1GL5A 1VYUA 4Z88A 2CW7A 3GIBA 3NWTA 3Q3SA 1UHSA 3GTGJ 3S1MJ 1OX8A 5IT3A 1AWXA 4RDXA 3WTTC 5KYXB 3ZQHA 1IGUA 1WHHA 4M77C 3FKJA 3GLXA 4UUSB 3J7ZI 3IHUA 3K6GA 2COYA 2GFAA 2D6FA 1ZRDA 3KBGA 2XTIA 2HSPA 3CMAI 1RC9A 2HDCA 4BY1J 4OGEA 4M78D 2FEZA 2VKEA 3QYEA 3CCSI 3DLLF 4ZTJA 1J75A 4OIPF 4F7UG 5J47A 3RPUA 2I2LA 4H2XB 3H36A 1H8KA 2AT1B 4L59A 4BUPA 4RKUE 4ETSA 1SFOJ 2QA4A 3HJEA 4A6EA 1TTHB 3ZRGA 2F5EA 2Q2EB 2KMUA 4HLXA 4NQWA 4NUBA 4D5FA 2KRHA 1U8BA 1FYKA 1PKTA 4A12A 3K2AA 1OCTC 2AK5A 3RZOJ 5L3DA 2ABLA 2FRYA 3B6CA 2JS2A 4QQDA 1FP1D 1W7PA 2E1MB 3TGNA 3KFVA 2K02A 3WTZA 2LNVA 1R4MB 2HYGD 1IN4A 1Y1WJ 4G6QA 4Y52J 3I56I 1KHIA 1LOJA 3NQOA 3CZ6A 3O8VA 2RAEA 2M0OA 2BE7D 4XSXF 2R0QC 2RQVA 2W48A 5EC7A 2OJED 2LF8A 3VSKA 2ZIOA 4UB6C 1EIYB 1U78A 4M7DA 3H3UA 3IH2A 2XIDA 1F1ZA 5K5RA 3TMOA 5J26A 4P72C 5K5OA 1DPRA 3GCMA 4D7MA 4YFKF 3R0JA 2HL3A 5D4SA 2YHTA 1H89C 5EYRA 2XDPA 3DB3A 2P5IA 1SD7A 4BQNA 2RREA 5LGUA 3IL2A 3FZVA 1BK2A 4MDWA 1ZA1B 5CKEA 2ZPIB 1R1TA 1QNTA 4P5OA 1JTYA 1H9TA 5BPIA 4CDGA 5GADJ 3PIOF 4M73A 4WCGA 4FTHA 2QBYA 1K9MR 2CV0A 4BE2A 1UHFA 1K73R 5IP7J 1SAUA 3BG6A 3MVPA 4AD9A 5C4JJ 4OB1B 2AXTC 5IN1A 5IH2A 3JAME 3AKZA 4C8QD 3KXTA 2R92J 3PTAA 5GANj 3OMYA 1FWZA 4ENJA 1O3TA 1QPMA 1N8RC 1F9NA 2CREA 2PUOB 1I5ZA 5KYYB 2Q7EA 1NHAA 2WSCE 4KJZA 2CGHA 2D45A 1JKPC 1GCQA 4M75F 2CQQA 2A05A 1GFCA 1QQIA 2RD1A 5FLXK 1GGMA 5GAMg 2XD0A 1OOTA 1GV2A 2V7FA 4RQEA 2GTOA 3E2UA 2RB6A 3NHNA 1RAEB 1X2GA 1M5Q1 2CUDA 1GVDA 4HX7A 1Y71A 3SHFA 3TCJA 3SQNA 2ODRD 3W2WA 1QVPA 1M1KR 2RHQA 1IXCA 1IO2A 3HRUA 2RQUA 1UFMA 1W2BS 1S72Q 1LKXA 2Z99A 2Y9ZA 1Y39A 5FLVA 2A37A 2LQNA 2IA1A 3QG1A 5EZGA 1D1BA 2VI6A 1K8AC 1H641 1ZAOA 2RHXA 3OYNA 3BCBA 3E0JB 1U06A 1WYXA 2ED1A 2QSGX 1ETWA 2QYOA 3CCVQ 1JKOC 2CV2A 3IRRA 2STTA 2QHUA 1ZGAA 3FM5A 2GQVA 5J4YA 3EG2A 5F1JA 3HOSA 2RI2A 4UC4A 4JJBA 5HODA 1HC8A 4HCZA 3MZHA 3P9IA 4M3BA 1E3HA 2OV7A 2NOGA 2X6XA 3K2ZA 1HD3A 3WTSC 3MMYB 3JRIA 1APLC 2MOXA 4KITB 4I0AA 5LD2C 1TTYA 1OQKA 5DM7R 2KT0A 1YTYA 2MW8A 2YU9J 2LP5A 3LSQA 3EAEA 4IHTA 2DA9A 4C92B 4BY6C 1VQ5T 4OIRF 4P72A 3RERA 2JUFA 1TNTA 2ELHA 2EV0A 2M7AA 3JRGA 2RK2A 3IAM2 1P92A 3QZ9B 1RAAB 2FRHA 2IGOA 1Z6RA 4XKVA 5GANh 1ABQA 1KC8C 2HZDA 4CXFA 1X1BA 1UG0A 1KK7A 2EFPA 2ZSIB 1YJNI 1R71A 3ERRA 1Q81C 2W00A 1N9RA 3OYMA 4ON0A 11ASA 3M8EA 4FX0A 4KH1B 2W7NA 1Y8QB 5HS8A 1ZBXA 3K9TA 1M1KU 5FKLA 2CZ7B 1NJ1A 5E3NA 1VQOI 2JM8A 3GTLJ 2HQRA 5KH6A 1R9TJ 2QEXT 3CCLT 4J6WA 2Y48A 5IXFA 2DFEA 3MEYA 1CF7B 4HDUA 2E60A 2ZXHA 2UZKA 1AWJA 3CDHA 1ZHFA 1R00A 2A5WA 1YBYA 5A2QZ 3EGUA 4XQ3A 3E5QA 2ME0A 1IB8A 3CEYA 1IUFA 5ERIA 4LG0A 4BS9A 3ZQLA 4RTUA 5KNNA 3W2AA 4OMPA 1YITI 3DLLA 4LB5A 2FPEA 5TISC 2E1OA 4HF2A 2DTOA 3ZGKA 2COBA 4IHWA 1WRJA 3A2KA 4GYGA 2GQIA 1D8KA 1Z77A 2XAHA 3ZMVA 9ANTA 3VJPA 4M77A 2GNCA 3ZP5A 1LE8B 2R7WA 2K4BA 5GAOl 4ZH4F 3SB2A 4F7UE 1QWEA 2JK3A 2R58A 4C2TA 1BC8C 4F7UB 3CC4T 3OOPA 3H9GA 1DP7P 2DK3A 2J05A 2B0LA 5D8LB 4XL9A 4PGGA 3VWBA 2KRNA 5D6YA 2PN6A 1YYVA 3EUKL 3NARA 4UVCA 2H1KA 3I35A 3OYFA 5HS9A 3RCOA 3TP0A 1U8RA 1JQQA 4HVVA 1K0XA 1NYRA 3L7WA 2ZXFA 2X3XD 2MLKA 4KYWA 1JGGA 2E3IA 2P4WA 4RAGA 1G83A 2NS7A 4Y3OA 4I0BA 1IREB 1RIOH 2FG0A 4YIFA 2QXFA 4XORA 1LFBA 4P71C 3DKWA 3OV8A 3EH1A 3P8YA 1G5HA 1NLPC 3MP8A 5LRRA 5DCMA 1D5VA 3DTIA 2KISA 3X20B 4MMLA 4XNFA 4HWPA 3F8FA 1KZHA 3A1YA 3IWZA 3Q1JA 5GAMj 2FRWA 2DQ3A 2NVUB 1AHJB 1ZX6A 2AXLA 2DMTA 4PG3A 4FSXA 4M71A 2CH0A 1MSFC 4EMKA 4YP0A 1IZ6A 5FWBA 1KQ2A 1ORKA 2O01E 5GAN4 3QWLA 2MH9A 3VUBA 1MGTA 2XF5A 4FYWB 4AU7A 2F5TX 2ZC2A 3SJMA 2M4GA 2NYXA 3I4PA 3M9QA 2L9SA 4M75E 4YRLA 1KQSA 3VS7A 4XU2A 3CP8A 3S17J 1Z91A 1V29B 5HNHA 1LNWA 4ZYAA 3GWZA 2RNJA 5FRNA 2DRMA 2EKHA 3NENA 3LFKA 2E2IJ 2V6CA 2EPDA 2DMNA 3FBIB 1FBUA 2GQQA 2LBFB 5ICGA 5EG0A 1NG2A 1WPYA 2EIFA 3CCLA 2UWMA 1B70B 3BZKA 1UHMA 3H92A 3MP6A 3JCMh 2OAUA 1MGQA 2CKKA 2D1VA 4C92F 3DXJF 2CP7A 2K2VA 1UB9A 2K9QA 3OYDA 4CCMA 2NNYA 2DIQA 2X4WA 2XMFA 3QPHA 1I1SA 1BBZA 3CC2Q 1B76A 2R5YB 3P8TA 4M9SA 3DU5A 4UNOA 1K78A 1ZREA 2XDVA 1AKHB 2EA2A 2XGDA 2MAMA 2YSQA 1YOVB 4C0DB 3G4ST 1VQKA 1GFDA 1WJBA 2MWPA 1MJBA 2RHZA 3ECOA 4NDLA 5DUIA 3K4MA 3E19A 3D1NI 3DKMA 3GLLA 3M9AA 4E7IA 2Q5HA 2W4SA 3M3YJ 1IXDA 5HY6A 4JJDA 2FD5A 1Q82C 1H4VB 1DQUA 4EGYA 1NG6A 1RI7A 2HQ5A 1AVZC 2PLYA 3EFRA 3JSCA 1S72I 2N8GA 5CR2A 2BW3A 2ALYA 2EYWA 5ILSA 1I39A 2DFIA 2PEXA 4DW6A 1NPRA 2QHVA 3FHNA 2AHJB 1Z0XA 2RQQA 3TQ7P 2KXCA 3R07A 2M0MA 4JLIA 4GBQA 4M75C 4M78A 1QU3A 1O57A 3UA6A 3H9QA 1ZSGA 1M8VA 2EZLA 1B9NA 3T8RA 2MMPA 2K4JA 1KU9A 1TS9A 1YCSB 4CS4A 5CQXA 1FLIA 1XMAA 3QU6A 3VEPA 4OB3B 3ERMA 2M8EA 1AOYA 2MBFA 1MSEC 1VQMA 3G71I 4LUDA 4MIMA 2KK4A 1VQ5Q 2OAWA 4S0HB 3QNEA 3JAMZ 4UY8I 3FDYA 2EQMA 1ZUYA 2C7IA 5GMKh 1BM9A 1VQ4I 2XK0A 2DBKA 3HFVA 4M78E 2ZB9A 4OGCA 5I2MA 2FBHA 3WHCA 4BXUA 2EFWA 5B5EC 1FTZA 4BQOA 1WJFA 1DU0A 3CC4I 5CPRB 1JXOA 2I8DA 1D1AA 5FU7C 4OMLA 5ICCA 3MKDA 1K9MC 4C5EA 3BC8A 4LDVA 2HOTA 2KHMA 3FXQA 3E6CC 5FKOA 3DTEA 4UP9A 2LVMA 2EZKA 2DNUA 2JM9A 4H2YA 3H0HA 2OC6A 2DE0X 2WB1N 4EVIA 3NTKA 2FQ3A 1YHQT 1UJYA 4LUEA 2HKXA 4QT7A 5L23A 3CD6T 1H88C 1V5EA 4YRPA 3F9KA 4NC8A 5JFRA 3GBQA 4FM4B 3I5RA 3H9NA 1D0ZA 3L9FA 2R5AA 2LCSA 3CXCP 1UECA 3MEVA 3KPHA 2K9SA 1OQYA 4OIOF 2J3LA 5AIQA 1QW1A 1LEAA 2UXXA 4BHCA 1TWGJ 3S3OA 2CT4A 2FZCB 4IUQA 5I22A 2JN0A 4A0XA 1BL0A 3HBLA 3OL4A 4DOZA 4V19K 4AUXA 1CQTA 1U0JA 3LOCA 4RAFA 1O9SA 4JZ3A 3TL4X 3RI4A 4A3LJ 1V54H 1WJCA 2DA5A 3FMSA 5DYMA 2QSHX 1QCOA 2HZTA 2NUZA 4QW2A 4BB7A 4E4HA 3G1ZA 1YX5A 4CI0C 1KSWA 4XOPA 5IHKA 2KDSA 3M8FA 1QKWA 4GRIA 5L3FA 2M02A 2VQHA 3PVQA 4C8QF 1VQ9T 4V2GA 1HDPA 2MH2A 2P8TA 5K7HA 3IC7A 2WAQN 1AT1B 1T0HA 2E65A 1YNZA 1RR8C 1EKEA 2PNIA 2CP3A 5KAFC 1YS7A 2XAQA 4I98B 5K5QA 4DBQA 3QP5A 5B66C 5GANg 2DOEA 3OMCA 5H6QA 2VJ4A 2A8EA 3CF2A 5ICEA 4RTYA 1WHUA 2V1NA 3OBWA 2QEXQ 3BR3A 5HCKA 1R4NB 1OLTA 2QA4T 2FF4A 2QSFX 3HOTA 1RPWA 3BLYA 4TVAB 3G1MA 2JTVA 3ULQB 4BEHB 5LHGA 1XGSA 1YIOA 1H3ZA 2ECCA 1OPKA 2QQ9A 3JV3A 3S6WA 5IPAA 2VXFA 2X9HA 4LNSA 3EDPA 4LB6B 2XDBA 2BVLA 1HKTA 2EAYA 3FIWA 1YG2A 1YW8A 1I27A 1NK3P 4U0VA 4IURA 3BDDA 4YELA 5CJ9A 5F0HA 2DT6A 1N9SA 3EFOA 1FSEA 3CCQA 1BBWA 3QO3A 2DEUA 2PMEA 1Z7LA 5D5WB 3ASNH 3L2UA 4WXCA 4NS5A 2JXBA 1A0NB 4M6YA 2EIMH 2RNGA 1VTNC 1ZGWA 2CRGA 5FJ8J 4IX7A 4J7IA 1YHQA 2M30A 3CD6A 2A69F 4D1QA 5K1YA 2HBWA 4KIBA 1DGWY 1V5GA 4E7JA 2IGNA 3HDDA 3GTPJ 3CPWA 3GBGA 5J8CA 3J81K 2XF6A 2X35A 3BTIA 3Q0VA 4FE7A 5ILVA 4RB2C 4J9DA 4C0GA 3OSFA 2K7AA 2H1LA 2OI3A 2JMWA 2JJ9A 1HSQA 2QI2A 2LYCA 2NAZA 3W2VA 1G2HA 3J80Z 1IAWA 2FOWA 2OX7A 3QHSA 2K3BA 4HSTA 2MIOA 4RM3A 4YRJA 2VOOA 3G1JA 3A01A 2XG8D 4A0ZA 4M7DF 2J6OA 3E9GA 3S3NA 3RNJA 3TREA 1XC5A 3BE3A 3OYIA 3EETA 1GBRA 1ETVA 3UWNA 1HW5A 2Z3YA 5DDGA 4HVUA 3CC2A 4E70A 1WQ2A 1X3ZB 2V9VA 2ZKZA 3OS5A 3EUHA 4OMMA 3VS2A 1S72T 3U23A 2DU7A 1LUJB 4II2A 2RN8A 4BJTA 4EM0B 3JCUC 3O8HA 5CVIA 2BY3A 3T0YA 4M7DC 4YRRA 3OR2C 1E6HA 1OMIA 2X1DA 4G6DA 4KIFA 2P5LC 3RIRA 1VOMA 3F8BA 4IRIA 2LCLA 7AT1B 2ID3A 3RYRA 1YI2I 1I6HJ 1PSFA 1B7YA 4FYVB 4BWAA 4BH9A 2I4LA 2WY8Q 5BQTA 3M1CA 2Y0MA 1YJ9I 2CZ6B 4MEXF 3SFMA 2GAUA 1TWAJ 3J7AY 2WWYA 4C92C 1DDNA 3HOZJ 1JJCB 4YCWA 2UUZA 2CS3A 4DYCA 2JUGA 5JVTA 1IF1A 5IYDJ 1FYNA 3H35A 2P7VB 3EGXB 3H1CA 4F16A 4BD3A 2FBKA 4C8QB 3RYPA 3CCSA 1HC7A 5LHIA 2EQIA 3HKSA 2K5LA 2CG4A 5LJ5f 3ZMSA 3G71Q 1AEYA 3K4CA 4OMYA 1V5FA 2L3QA 1UTIA 3JCMf 4D6WA 2DN0A 5A0DA 2GIZA 2CUFA 1LYLA 1IRXA 1V55H 3WTXC 1TSFA 3LH0A 1QZZA 3SEZA 4LDYA 4RMOA 3L1AA 2H94A 4CYDA 4Q6GA 3ZMDA 1YW9A 1TW2A 3N97A 1VQ9I 4JJCA 3CPWS 4CS3A 1OU9A 3WQZA 1YIJQ 3FF5A 2M1BA 1KQ9A 2VXDA 2XF7A 3CJTB 2R7VA 4OAYA 3MJXA 3LAJA 2A5YB 3FKIJ 2XRNA 5F64A 1VQOA 1WJ5A 4LIUA 5EEHA 3I56A 3DP7A 3HG9A 3H8ZA 1FMWA 3TKYA 3BY7A 2A07F 1YJNQ 4XBFA 2OQRA 3ROUA 4M7DE 4I02A 2JJ7A 3S15J 1FYLA 3TO7A 4WK8F 1ADYA 2G0EA 5EF6A 1X1CA 2BY0A 2STWA 1OZ2A 4PNOA 5KYUA 5CVJA 3CC7I 1PP8F 4YROA 3IG2A 5E18F 3G1LA 2B9SA 1SFKA 3HB9A 4RGXA 2WAFA 1WHGA 1WXBA 1X2KA 2Y75A 4C9YA 2E64A 2KBTA 2QTXA 1IN7A 3HY1A 3W6VA 2VBYA 5E1XA 3HTSB 4LVLA 4Y7NJ 1C6VX 2Z0WA 4H2WA 3PIPF 1ZG5A 3DBRB 3A5YA 1OCOH 4IL6C 3M8JA 3V42A 1T98A 5CQYA 2G7HA 1QZEA 3BPXA 4J9GA 1WH7A 2DZ9A 3VYGA 5KYYA 1VQ4A 2ZZGA 5FO5A 2KZGA 3RZDJ 2HAXA 1WJRA 1B9MA 2GXGA 1JRIA 4XU0A 3W6KB 3OW2A 4YRNA 5LEKA 3GF5A 1DPUA 5IHIA 2PMUA 1HKQA 1Y8RB 4V2FA 4S04A 1UHCA 2F1LA 1X27A 3UR3C 3S2WA 1OCCH 3HRSA 2KJCA 4ELYC 2XKOC 1ADJA 5DY9A 4EMGA 1USYC 5E20A 1GV5A 5K1XA 1JJ6C 3CUQC 1SF9A 3NELA 1JO8A 1VYTA 4C5HA 2HU9A 4BBSJ 5TJJA 1WQ7A 4JS4A 1EA3A 4PJJA 3SZTA 5D4RA 1LNXA 4GLMA 2QASA 3CCST 1EQRA 1A04A 2HFHA 4AYBA 3BG5A 4A3CJ 3DLMA 3GZ6A 4TVWA 2K6DA 2MA3A 5C53B 5GAN2 4LJZF 2C0TA 4CHUA 2PFBA 4G8XA 4JLGA 1Q1HA 1KONA 4Y33A 1VQOQ 2RGVA 5HVQC 1QVFA 2W1OA 1LPQA 5FROA 5F08A 4IOAF 1XQHA 4B9WA 2DM1A 4JDSA 3EUHC 3BPVA 2TDXA 2O61A 4ZN3A 2VC0A 1S8NA 2SEMA 1T0JA 3HL8A 2M16A 3PFSA 4KDPA 2DL5A 4M7DB 2FNPA 1AKHA 1YB3A 4CC3A 1YJWI 1BC7C 3CCEI 2FPFA 2DO3A 1DGRM 2LJ1A 4JRPA 2L4MA 1G3TA 5DD4A 4FX4A 3VBBA 2DMQA 3FXKA 1YX3A 3F6VA 4OINF 3OIQA 3TU4K 1TT0A 1K61A 1VQPT 1VQLQ 2W84A 2M9UA 3I58A 3HOUJ 1I3QJ 3HGGA 2DKGA 4OB0B 5AT1B 1NJIU 2WV1A 1RABB 4M75A 4C2UA 1XMKA 3NPFA 3T5XA 3HZJA 3P8BB 3WG7H 1VNDA 4YPFA 4BGDA 2LT1A 3OMGA 3RBBB 4L5EA 2WV0A 4CH4A 4KA4A 4XTZA 5GTIC 3EPZA 2ZZEA 4RLFA 3PCOA 1IXRC 2ZNYA 4XRMA 5CVRA 1DJ7B 3TW7A 4YFXF 3TDUC 1W70A 3CMAT 1Z9CA 5EZHA 1BCMA 5E17F 5L8RE 4C5IA 4DBFA 1WGXA 1IN5A 2E3HA 1W2BA 1JJ2P 3E5XA 2CP5A 5DM7F 1UG1A 3PQKA 1M4ZA 4QPQA 3NWSA 1WA7A 2LKSA 2YUNA 1MKMA 2ESNA 5E8IA 3ASKA 3LLRA 2VUBA 4M78B 3REOA 4M6XA 1Q1VA 4XOTA 3WU0A 5H2FC 2DD4A 4HYEA 4P3OA 4AH6A 5F27A 2I10A 1X19A 4FYYB 2WBMA 2DLPA 2EKOA 2M87A 4ZNXA 4G85A 4FQGA 3RKXA 4EMSA 4FE4A 4F7UF 3CCMI 1M2VA 1B6AA 1N8RU 2WTEA 3HSFA 5BS6A 5F1RA 1IGQA 2A7YA 3BJOA 4PFOA 4QWQA 3V4GA 2HDDA 3MZ8A 2ZT7A 5D5VB 2JSCA 1UCRA 4IUTA 3CUOA 1G3SA 3BDUA 4MQ9F 2ARSA 4KGXB 2D5VA 3JB9I 1MV0B 4PJLA 2FU4A 4BY6B 5IT9Z 3GTKJ 3VS4A 1VQ9A 2M51A 3LSIA 4IRGA 2VUMJ 4X1EA 4X5OA 5F04A 2CDTA 1Z7UA 1NJIR 1E1TA 2QG9B 2L3RA 4OLFA 1YITQ 3WTWC 2L9NA 3CMEA 3HOXJ 3CC7T 2LTOA 3P8HA 1K1ZA 3T1BA 1W4SA 2HQNA 2L0KA 1FJLA 2QYZA 5GJVB 1UE9A 5EG0B 1B70A 3OSVA 5GAN3 2XRLA 3HTUA 3HPWA 4M7AE 3CUQA 2YRDA 3GTMJ 3H41A 1BI0A 2HOEA 2XIGA 1OX9A 4CCLA 3E97A 3OYYA 4NL2A 4J15A 2QENA 5KK1A 2P4TA 4IRHA 3MAJA 3I59A 5LFAA 5E3OA 3J7YJ 1J7KA 1ETYA 4IQ4A 3VODA 3WE2A 1F1BB 1TQIA 2JT4A 3A5ZB 3CCRQ 5F0FA 2RI3A 3E1SA 1SEUA 2EYZA 2O31A 1OJLA 4A2UA 2VKNA 4O2DA 6AT1B 5E79C 3CCQT 1X6BA 3P9KA 5LHHA 2R7ZJ 2P0QA 2QGGA 5GAN5 1NYQA 3TUPA 1HSTA 3CJNA 1JU5C 1NNHA 4DOWA 2D8JA 5LJ5g 2EFIA 2VC8A 2J5OA 2K9NA 2NOJB 4ASNA 4E6KG 1X75C 3GTOJ 4JRQA 1H3HA 2CUBA 3BWGA 3K1PA 4RB3C 1OYYA 2E36A 1D8JA 2EIJH 5FKMA 1WGSA 2CP6A 3FB9A 4M6VA 3M0SA 3AL0C 2PMHA 3GFLA 4R8HA 3R0AA 3DPLC 4G9YA 3CC4Q 1H0MA 1JT0A 2OD5A 2GFUA 3QJ6A 2EK5A 1ZN2A 2PX9A 3WGHA 1D3BA 3LL7A 4F04B 4MO7A 3BZCA 3GYHX 1WJQA 1V4RA 2AIRB 4BU2A 3WGIA 2QQ8A 1E3PA 4J9CA 2L01A 1FEXA 3QODA 1MBJA 1X58A 3H5AA 2J6FA 3IV5A 4F17A 2O6GE 2HR3A 2L2PA 1W2BP 2K27A 3CMEI 2RPNA 1E22A 3QO8A 3FDRA 4MNUA 4DPGA 2LKXA 3REBB 3AAFA 4MZTA 3DEEA 5DLOA 1FC3A 4K88A 1BJZA 2CP2A 1FMKA 3H3VK 2XAGA 1IL2A 3CJQB 1TL8A 2FEIA 5C6SA 4FW1A 2OBPA 4L5IA 4F93B 2EILH 1WXTA 2JA8J 3HFOA 5L3BA 3RKYA 2J06A 3I64A 5CKFA 2I4NA 2NYSA 1ZSZB 3M57A 4UVAA 4C5GA 1RLQC 2ZTGA 4HVCA 3VS0A 4HEA2 1BW5A 1VI0A 3A4CA 1MBGA 3GMEA 3LA7A 5IP9J 5LJ3h 9ATCB 4ZGDB 3QYBA 2VB6A 2H3JA 2LR8A 3JREA 1B3QA 1WHKA 4C92D 1PJRA 3BY6A 3AG1H 2JW4A 4JX5A 3W6JB 4XTVA 2XSDC 2FPDA 4JRIA 3CCMT 4G84A 4B44A 1MMDA 3S2HJ 3OA6A 5D7UA 4YYEA 5K1PA 2KIMA 4PUSA 4A4KA 3A8LB 2W82A 2VBWA 3ML6A 5IOYA 2ETHA 4LIVA 3RTRA 5EEAA 1PRLC 3CCLI 4QKUA 2RN7A 3PSIA 1NZ9A 1U3OA 4CRIA 3B73A 1W7PB 3VYUB 3U2RA 3LSTA 2OTJI 4JUVA 1TUDA 2DDBA 2PJPA 1SFEA 2H09A 2WC2A 4CSWA 3S1RJ 5I21A 4JOMA 2Z33A 4EMKC 3I56T 3PGGA 1JJ2A 1K8AR 2O9VA 4N4IA 1XSXA 2X9DA 4OMNA 3RMQA 1VQ6T 2COZA 4C3HJ 3OWTA 2RHYA 3CCQQ 4ABZA 2P81A 5DUKA 1A35A 2R3SA 3HKZN 3HPGA 4J9HA 1HOMA 4PKCC 1G3WA 3ZEHA 2Z16A 4HDVA 1OKRA 1FY7A 2DDZA 2KP6A 3GFMA 2LDUA 2ZMEB 4ZC3A 4BL0B 3M4OJ 1RLPC 1Y0MA 2EQUA 3JCMQ 3E6MA 1KYZA 2NS6A 4ZTZB 4DNCA 4P9UA 3M58A 5GJWB 1I3AA 3V8JA 3G6EQ 2GXBA 1SVOA 1ASZA 2G6FX 1EH6A 3K70C 1M27C 1Q82R 1D09B 4E7SA 1RAIB 5C51B 4IVNA 1XOVA 3FJPA 3OIPA 2EZHA 3FMQA 1ITYA 1ZKGA 5IT9K 3WGGA 1RZ4A 1JJ2S 2RV8A 1RIQA 1FYMA 3TO6A 1XTAA 1XSDA 4XK8E 3BW1A 1SC7A 1R0CB 1YO5C 1VQ7T 3I9V2 2AS5F 2E19A 4M9XA 4CCKA 3CBPA 4B09A 4DIQA 3A8HB 3DFGA 1GUUA 3PFIA 1WSUA 2DA6A 4U0YA 1JI8A 2ODRC 3RL6A 2A61A 4GFBA 1B72A 3QYHB 3NAUA 2IVWA 1MV3A 4P96A 3ZN1A 4EQQA 2E2JJ 1H92A 5HK3A 1I50J 5J40A 1DUXC 3KYDB 3E9IA 4IHSA 2IS2A 4H02A 4YRFA 3UGTA 2Y0SN 3BOQA 4XICA 4BJ6C 4CA0A 4XRSA 3OS2A 1ETXA 4EIKA 2NVXJ 4P75C 1VQ5I 1K8AU 4K2EA 1K83J 2KQRA 3CDIA 5LLQA 4LK0F 5HDGA 4JP0A 5ECAA 5F0CA 4CH6A 1K6YA 1RUWA 2DIGA 2KI7A 2FE3A 2A3LA 1XB4A 4AC0A 2LQWA 4ENKA 3ZFJA 2R7QA 3EG9A 2MI6A 3ONQA 3O6BB 8AT1B 5EGOB 1O3SA 3ZMZA 3HM5A 4L18B 1HYOA 1SHFA 2B63J 4IIOA 2CSIA 2D0QB 1NJ6A 4MTEA 2DDAA 2XPVA 1YHQI 1S7OA 3CD6I 2ATCB 2EYXA 3QBYA 2NUTA 1VQPA 5HDKA 2LQ8A 2V1QA 2YUQA 4M77G 1LFUP 4DEYA 3E3VA 4LXCA 2O8XA 1XCVA 5CKTA 4KGZB 4TWAA 2E35A 3QDRB 3QP6A 3TQNA 1VQ7I 1UFFA 2YLCA 4AIHA 1U3EM 2DXUA 3G7ZA 2A36A 1FBQA 5LGNA 5GMKe 4XRFA 1IDYA 1W36C 1FIAA 1QHHD 4PK4A 4XLAA 3I55I 1FOXA 2AKKA 3U21A 2P5KA 3OSGA 4J6YA 4B1RA 1MUZA 3MQZA 4HWRA 2IVMA 4P75A 2W25A 1MW7A 1XX5A 2XKPA 4P1WA 2UXNA 3C18A 4MLOA 3JB9J 3HXUA 1VQPQ 1NYFA 1B7YB 1USSA 3A32A 2DPUA 2QA4Q 1ZQ1A 1SSHA 2X6YA 4DZPA 1U1SA 3UPUA 1KD1C 3V8KA 1WU7A 3UGQA 4GDFA 4WF2A 1FBSA 4P3PA 2KIQA 1QKXA 4Y4RA 3QIIA 2K2MA 2LY1A 2E10A 2RJDA 3CCUI 3CUQB 4HNVA 1BR1A 2OTLI 3JRCA 4LD5A 4ZIBA 3I5SA 3L2CA 3LSMA 2HMAA 2V9PA 4CH3A 1N5ZA 1UGPB 1SFUA 4I6ZA 2YRVA 2K9MA 1TUCA 3CCJT 4B48A 1X54A 1UZCA 2MWOA 3X26B 1EH8A 3HRTA 5J4VA 2K7LA 4ZGJB 1W0UA 3QU3A 2ZMEA 1S6LA 3I0TA 2CJJA 2F5VA 2AZVA 2BXYA 2VIXA 3FWEA 5E3MA 1M2VB 4Z02A 4R55A 1LDJA 3CXCA 1KQSS 3CCEQ 2HKNA 1FNNA 3BR1A 1KC8R 2ZZFA 1JUMA 2EINH 1VQMI 3VQVA 1VQLI 2YX7A 1EIFA 3SHWA 2F2EA 4IHVA 2DAQA 4BI8B 3KP4A 3CCRA 3PNWC 5A0LA 4H2UA 2HS5A 4YRIA 2R5ZA 3EGDA 1E3OC 4RTWA 1YWPA 2FB7A 3OYKA 3MEXA 4Y28E 1WHJA 4C92A 4QIWN 4KMFA 2E5QA 4LDXA 1C1AA 4UUSA 3A8MB 5J39A 2EPFA 5C52B 1VQ6I 3K4NA 1I4K1 4WX9A 2BKDN 1HK9A 5ICFA 2LQKA 2MC4A 3G6EA 2CJBA 2HPMA 1M30A 3PM1A 4N4OB 4B8XA 2QLZA 4HNUA 1MDMB 1ZRCA 4L0YB 2HXOA 3C4SA 4BUGA 3PZCA 2RC4A 3LA2A 2R7UA 3MP1A 4FYXB 4G94A 2A6HF 3C7JA 1VQZA 4A3FJ 1M3BA 3PIPA 1OYXA 5CK9A 1YIJI 2BY2A 4H2VA 3LH5A 4IZZA 1M2OA 4YEJA 3OIOA 3LNQA 1OFCX 1N78A 2PQ8A 1GDTA 3RQIA 1UGQB 4LG0B 3L4GB 1SETA 1R5GA 3MKWB 2DFHA 3SWNA 4WJ3M 2YUSA 1PUFB 1QO0D 2DRKA 3E9FA 1SANA 3CP2A 2C06A 2F4OB 2KDOA 1NBEB 3WVDB 1RUNA 2HYFA 2XASA 2BV6A 3P9CA 4KISA 4LD9K 2ARTA 2LZ6B 4L5GA 5TRDA 2DJQA 3WG9A 4AG1C 2DYSH 4OOIA 5GPCA 2BBYA 2BIVA 5FW9A 2JUCA 4ZJZA 1KOGA 2KKOA 3R60A 3GNGA 4PJOF 3EG1A 3PCOB 1UJ8A 2WAEA 4GCVA 4XKCA 4AIJA 2LNHB 4C3IJ 5GMKl 2F48A 2I4OA 2EW3A 2E3CA 4FT2A 4HQEA 1HQCA 2OZ6A 5GAN7 2QM3A 3CO7C 3CCSQ 5FB2A 1GHCA 1EFNA 2CIMA 2LVSA 3KIOA 3N5BB 3QJYA 5CO7A 5CKDA 2IG0A 2VKHA 2IY5B 1PM3A 4FISA 1I07A 2YT6A 5IAYA 1N9WA 2LG4A 5DCFA 5HLHA 2MD5A 4RS8A 1B7TA 1LDDA 4IJAA 2RO0A 2YLBA 1U9OA 1YITA 1STZA 1EOVA 2P0WA 5LBQA 2V1UA 4HRIA 3FXJA 1D0XA 1X1AA 2RKHA 2GXAA 1XMXA 1W36D 4RCBA 4XTWA 4DOVA 3K69A 3A1PA 3CC7A 5D6EA 2MSYA 4OP0A 2L9VA 3C3WA 3BJUA 2XV4S 4M9ZA 1YRNA 1JHHA 1BU1A 4L9VA 2RMOA 2LREA 4C8QC 2ISYA 1YJWA 5IYBJ 4E7KA 4HBLA 2CT3A 3MZYA 3HXWA 2L2OA 2M3AA 4TTVA 2DODA 1ZUKA 3LX7A 3CJRB 5GMKi 1FPQA 5HGQA 3ISPA 2D1HA 3WU2C 4EATA 2ZCFB 3META 4K11A 3KUFA 5DCMB 4U88A 2KR3A 4L9NA 4TQDA 1SFXA 2ADUA 1LJ9A 3E6BA 1I1JA 3GOXA 1YJ9T 3OBYA 4O3MA 2W85A 3K10A