4HA8A

Structure of staphylococcus aureus biotin protein ligase in complex with biotin acetylene
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Structure of Staphylococcus aureus biotin protein ligase in complex with biotin acetylene
rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 100
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ha8A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ha8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ha8A02
1XGOA 3QTCA 4HWTA 1G3SA 3HXWA 1CGPA 4J6YA 5LJ3f 3HYIA 3O6BB 4BWAA 2OQRA 4TQDA 1D8KA 1AWCA 3UH0A 2L02A 2VC0A 4C92B 4A12A 4DPGA 4IRHA 2EAYA 5F5WA 3GVAA 4M71A 2WC2A 2JPCA 4WXDA 4KYWA 3FXUA 1EV7A 4HV6A 4LMYA 4BXUA 4EMSA 4C8QB 4M7AG 1KQ9A 2ZMEB 4LK0F 3WTZA 4M7DE 2ESHA 2M1BA 2QHVA 5AONA 3A7UA 4YRNA 4X5OA 1D3YA 4ETSA 3BPVA 5GAN5 4LB5A 3OV8A 2XROA 4A54A 4HT9A 4P9FA 1ZGAA 2GQQA 3F8FA 4TWAA 2AS5F 1FYFA 4JLIA 1ADYA 1FC3A 4ZYHA 4G7ZF 4RB2C 3J81Z 1FBUA 1XCVA 3EDPA 1XMAA 3CUQC 1LDKB 3K69A 1Z6TA 2EV0A 3GFIA 5CVVA 5GANj 1WKMA 1G6NA 2QLZA 4M78F 3KLNA 4MNUA 2H6CA 3T0YA 2MC3A 1P2FA 4HWSA 3Q9SA 3QO5A 1I6XA 3JCMd 3TO6A 1SETA 1XDUA 4BHBA 1UFMA 4GYGA 4CH4A 5LJ3d 3ERED 3TDZC 1LNXA 4OMZA 5F64A 3P8YA 4EV0A 1ON2A 1J7KA 1U5TB 5HDKA 3EFRA 4KIGA 1EIYB 3E5UA 3ELKA 3FIFA 2C7IA 4O6JA 1ONVA 5F1RA 1K6OA 1R22A 3PQJA 2DDZA 3RGLA 4P71A 4XEMA 3KP7A 3GYHX 1J5YA 2AXLA 4YCVA 3JCMb 3HXYA 1TQMA 4MEYF 5E8IA 1YFHA 2ACJA 3INZA 1X2HA 2FYKA 4RGRA 3CJNA 3E6BA 3HTUA 4HX8A 3SQNA 1BM9A 3TKYA 1PP8F 3WU0A 4M75G 1YS6A 4CHUA 4ZTUB 3GW2A 3HOSA 3RESA 5FLXK 2L54A 1H641 5GANg 5ELNA 3VOEA 4CH6A 3SZPA 2E1NA 1MDMA 1LB2A 3T8TA 2ZJ2A 3BY7A 1TQIA 4PJOA 3FM5A 1FP2A 3W6KB 4L9TA 3W3SA 1TLHB 2R3SA 4H2XB 1QBJA 1HW2A 4KA4A 1D3BB 4F7UA 1U5TC 3QAHA 4B8XA 4NL3A 3O3KA 5FO5A 2E3CA 2DJZA 2H09A 1KGSA 3E5XA 3VQWA 1B7YB 1DPRA 2EV6A 4Q6GA 3HY1A 3L1AA 2HZTA 3FJPA 5GAN7 3PFIA 3FMQA 4ENMA 3VQVA 3BWGA 2QENA 4X9DA 3J7AO 1TQPA 1G4DA 1YW8A 1G5IA 4IPAA 1UCRA 2QQBA 3V7CA 3N4MA 2VBXA 1HK9A 2RHQA 2CO5A 3CUOA 1B1BA 1USTA 2CIMA 4BHPA 1WU7A 4C8QG 2EK5A 4KT5C 1F9NA 3IRRA 5DD8A 1K79A 3R4KA 2HFHA 3K9TA 4H2VA 3I0TA 4O5VA 4M78C 2VOOA 3QSUA 4LJZF 4FX4A 1LEBA 3WQZA 4TVWA 1XSVA 1MKMA 3RKWA 5D5WB 5DCMA 1YLFA 3J81K 3I71A 1KOGA 5HOOA 1BIBA 1R1UA 1F5TA 4YRPA 2DTOA 5LGUA 1TW2A 4LG0A 1B70A 5F6FA 2DVEA 3WTYC 2ALYB 3UGTA 2A61A 2QBYB 2YPRA 4DNCA 3ZPLA 2PEXA 4KUMA 4D0PA 4EM1A 5JFRA 3BDDA 2IT0A 1ZRCA 2H27A 4EJWA 1IUYA 4JK1X 4XLNF 3KZYA 2A07F 4K88A 3MF2A 4YRJA 3ISPA 4YRRA 1QF6A 4KQEA 4EJVA 1B9MA 2LNBA 3BPXA 4FT8A 1RIOH 3HOTA 1KU9A 2ZZEA 2HTSA 2FBKA 5ED4A 4ESBA 1F4KA 3HFZB 2PJPA 1YFTA 2DLLA 2ESNA 3K1PA 4MQVA 1MD0A 3IKMB 5JI6A 4EM0B 4Q4ZF 4HX4A 4YG2F 5GAMf 2NNNA 2YR2A 4OIQF 3RKYA 4LLGF 1IAWA 2P5IA 1YIOA 4S05A 2VBZA 2DO7A 3B02A 2HS5A 4N9HA 4M77A 1XB4A 1XGMA 5GANe 3R0AA 2G7UA 3FXRA 4ZYDA 5DV5A 5JHUA 3NQOA 2DPDA 5HLGA 4M78D 3M7GA 2ZXJA 1HSTA 2K7LA 2OBPA 2QM3A 3KP2A 4YRQA 3MWMA 3EYIA 1ATIA 4K2EA 4NL2A 3M1EA 2E7WA 2K27A 5LHIA 3GWZA 4YFKF 1HKTA 3EETA 1X2GA 4RB3C 2ZO4A 2W25A 3GXOA 4ASNA 3TUPA 3P9IA 5J6XA 2MH2A 1YS7A 1IF1A 2FQ3A 4XU0A 1R00A 4P72C 1H9TA 2C6YA 2DZCA 3PCOA 4ON0A 4UXNA 4LK1F 1U1TA 1BN5A 4KICA 4M7DB 1H0MA 1ULYA 2PFBA 3PGGA 2WTEA 1OR7A 3IRQA 4EMKC 2ZXFA 3LSQA 1T39A 2BGCA 4XU3A 5GAN8 2Q2EA 12ASA 3CUQA 3WU1B 3MEYA 2PMUA 2ZCWA 1U2WA 3I7FA 1Z9CA 4CS3A 1WRJA 4UNOA 1EOVA 4WJ4A 4M7AF 2ZNIA 2HGCA 5E17F 2AMCB 2CGHA 1YO5C 3LA7A 3M4GA 5DEQA 2DT5A 3JCMP 3KFUA 2VC1A 4L0YB 2H6BA 2BBYA 5D6EA 3COAC 1FT9A 2P5VA 2VODA 3HRKA 1FYKA 2P6TA 3NEMA 3QO3A 3GF2A 4R1HA 2E5AA 1IN4A 2GA1A 1P92A 4HF0A 1W7PD 3P7NA 4M9SA 4A2UA 1KQ8A 1M5Q1 2UXXA 1KMNA 4KR3A 3RIRA 2PMHA 3JB9D 2I2LA 5GANh 1TW3A 3EFSA 3AAFA 4IRGA 3HRMA 5KNNA 3F21A 1LNWA 3Q9VA 3ZMDA 4N0AC 1L3LA 2JRTA 2Z99A 3JCMJ 4A5NA 3TDUC 4AIHA 1SFUA 2KKOA 2ZIOA 5GAOm 1ASZA 2FRHA 3A7RA 2TDXA 1Y96A 1QO0D 3DPTA 2AKWA 3P8TA 2ZGWA 5HDGA 3TO7A 4XTWA 3I64A 1G3WA 4XSZF 4JRIA 4YRSA 4Z2YA 3JTHA 4WXCA 2JZYA 5HLIA 5DCFA 2Y90A 3F8CA 1PYSA 4HF2A 3WODF 2O0YA 2XVCA 3VODA 2OZUA 4RQFA 1U5TA 4LB6B 2QQAA 1B34B 1TH7A 1D5VA 1XGNA 2CSOA 3FZVA 5GMKe 1BBUA 4X9CA 3L9FA 4HW0A 2ZNZA 2O6GE 4M75F 4KMFA 1YTYA 3SWNB 4HF1A 1P4WA 3M8FA 1ASYA 1R5HA 1L0OC 1LQ1A 4YRKA 3IHUA 1U1SA 3QO7A 1ZYRF 1BBYA 2P0LA 1X3UA 1B8AA 2I4LA 4BYYA 2E41A 4H2UA 3ROUA 4HQEA 4OMYA 1LDJA 2NAZA 2K02A 3U1DA 4RB1A 3HXXA 3RF1A 4M78A 5CJ9A 4WCGA 3AHUA 3LSSA 1KQ2A 4P3PA 3P9KA 4M7AC 4M7DG 4M6XA 4M9ZA 4Q15A 1JJCB 2ZTGA 3BJOA 4C92F 5BS6A 5D5VB 3DF8A 3CO7C 1LVAA 4HDUA 3DPLC 3E9HA 5LEKA 4UP9A 2HTJA 5GANf 1G5HA 4MTEA 4PJOD 4CYDA 1I5ZA 3O2PE 4YRMA 4XLPF 2XAJA 2EA2A 4C8QF 1HTTA 3E5QA 2VC8A 2FU4A 2VT2A 3SWNC 3G73A 4YIIA 3MZHA 3BJ6A 3DSQA 4TVYA 2X0LA 3V7SA 4CZZA 2OZ6A 2V79A 2IJLA 1BI0A 3D5LA 1K7AA 1UB9A 2HDCA 1NHAA 2F2EA 1KU7A 4H0EA 2YU3A 2ZNJA 1U8RA 5D8KB 4YFNF 4XTUA 4L9JA 4PG3A 4GGGA 4K86A 4IXAA 3JB9H 2P7CB 1EQRA 4O3MA 1W5TA 2VBWA 4IJAA 3PQKA 5ILVA 2FBHA 4XSXF 4UUVA 2NS0A 1T6SA 5FFZA 4ZYGA 5HLHA 3RKXA 2ZT8A 2VXEA 3WTSC 3TGNA 4YROA 1JBMA 5GMKh 3F23A 3ECOA 1GHCA 4PNOA 2Q7EA 5L3GA 4EJUA 5EEGA 1W7PA 4CO8A 2D45A 3TQNA 2VE8A 2VONA 2CW0F 4M9XA 2B0LA 3JCMV 4RCBA 5GMKm 1YCYA 4M75C 2BEOA 2PG4A 2L3DA 3DEUA 5GANd 5C51B 2W85A 1N9WA 4EGYA 1E2XA 4WK8F 3JW4A 4QVCA 1P6RA 1OPCA 1G51A 1XSXA 2GZWA 4OP0A 5LJ5h 4P72A 4I01A 2P6SA 3FHZA 1SESA 4M6YA 5ILSA 4R8HA 3GFLA 4BNCA 3E6MA 2L4AA 4PCQA 2VBYA 5FFXA 1K78A 2IY5B 4EMKA 4N9IA 3RPUA 4BW9A 4P5OA 5HS8A 1LJOA 4F7ZA 4ESJA 4XEOA 1XD7A 1WQ7A 3A5ZA 1USSA 1RUNA 2BE5F 2V1UA 1FNNA 2K86A 5LHHA 1RUOA 4C92C 2V1XA 5HS9A 3I59A 3MZYA 2ELHA 4E51A 3TEHA 2HWVA 4JUVA 1ZAOA 5K5QA 4PJOE 4M77D 5A2QZ 1E24A 3HFVA 2E64A 2XRNA 3C7JA 4F7UE 3QHSA 3LC0A 4C8QC 2VT3A 4HBLA 4P73C 2EJRA 4U0YA 2XAHA 4LGWA 5DDGA 4MGRA 5J8CA 3KZZA 1J0RA 4UHTA 2PMEA 1O57A 1XDSA 3HFNA 1G3YA 2OU2A 1S6LA 2HNIA 4KR2A 4J5YA 3HXZA 3SB2A 3DP7A 3JTGA 1SD6A 2GWRA 1BBWA 3EUHA 4G84A 1E22A 1CF7B 1BI2A 3V8LA 2CGPA 1LDDA 3MF1A 3VFZA 3ZQ7A 3IG2A 4HX7A 4ZTZB 4I09A 4FHTA 4L87A 1S8NA 1GXPA 2LKPA 3L4GB 4WJ3M 4WX9A 1SMTA 4YRFA 2Z5UA 5GAN6 2W57A 3HRTA 2ARTA 4M74A 3RACA 1YFRA 3QU6A 1WSUA 5K1XA 4YCUA 1NJ5A 1OKRA 2GAUA 3F22A 3M9AA 2OQGA 2Q7GA 4EM2A 2CFXA 5CVUA 4LLLA 3V8KA 4K87A 3LWFA 1SERA 3SFZA 3FWEA 1I1SA 4HLXA 4A0YA 4XU1A 3GLXA 2Q8KA 1Q1HA 2XGXA 3TOBA 1ZHFA 4C92G 1ODDA 3DV8A 4TVAB 1WYDA 2RN7A 1F1ZA 2PI0A 4RCCA 2STTA 2FBIA 4PZJA 2DQRA 3I54A 1KA8A 2CJBA 3KLOA 2GA2A 3L2ZA 4UVBA 3BROA 3DQVC 2VXZA 4A6EA 3JSPA 4H2TA 1IN8A 3Q5FA 1H4QA 5GAOp 4XTYA 3WTUC 2RNJA 4NOYA 3FMRA 5DUKA 2EJGA 1VQZA 3QO8A 2HQRA 3LA3A 2M5WA 1U78A 4HVCA 3ABUA 5ELOA 2GXGA 4M77E 4H2SA 1W4MA 4MMKA 4M7AA 5FB2A 5ICCA 1IL2A 4Y17A 2FMLA 1WWXA 5K1PA 1IXRC 4I0AA 5E18F 4YRCA 4TQFA 4YRIA 2VE9A 5GMKj 3LAJA 4JRKA 2K4JA 1UHWA 2R7FA 2XKPA 3IWFA 4G8XA 3K1MA 2DK5A 2I4OA 1EH7A 1XN7A 1SAXA 3VBBA 2IRFG 3DFGA 2A69F 5H6RA 4NB5A 5A2QK 1YB3A 4GYIA 1OYYA 4IHSA 3IALA 4BAYA 5DUIA 3FMSA 1R23A 3HXUA 4WXHA 3I53A 3KEOA 4EJOA 4EMHA 3LAPA 2FNPA 3R61A 2Y75A 3R60A 1QQIA 2XHKA 4YIFA 2DAOA 3WTXC 4Y15A 3A74A 2PN6A 5J8FA 2RHSA 2YHTA 2DTIA 4M7DF 5LLQA 5CVIA 4B09A 1ZG3A 1BJAA 2K57A 3MCZA 1X01A 3OD1A 4TV7A 5LJ5j 3OOPA 1O3QA 1EVKA 3RI4A 1X54A 1OYIA 1T38A 3HXVA 3ECHA 3FXQA 3VB2A 3L7WA 3FX3A 1HQCA 1JJCA 3M8EA 3GZ6A 3GIBA 2Z33A 1S7AA 2QUFA 4YPFA 1B9NA 3MQ0A 1J9IA 3ULQB 3GFMA 3TOAA 2YLBA 2LDUA 3C3WA 4XTVA 3HY0A 3ZMZA 3R0JA 2ZZFA 1TTYA 4A53A 3HSEA 4HA8A 1YW9A 3ZN1A 2O3FA 4RGSA 2J3LA 5BQTA 2P7VB 4M75A 4EO4A 2YLCA 1UHMA 4AIJA 2Q7HA 1MJ9A 1EH6A 2OA4A 1V3FA 2EJFA 2W84A 1YGBA 5L3EA 2A6HF 2R7DA 5L3FA 2M87A 4V2SA 4Y91A 4G85A 1TNTA 2FOKA 1QPMA 1JRIA 4GCVA 2OD5A 1Z7NA 4G6QA 4RGUA 5D6FA 2O03A 4KNYA 3FF5A 3U2RA 2IPQX 5LJ5g 2CG4A 2ZKZA 4ESFA 1FLIA 3JCMX 4HWRA 4S04A 2HKOA 1J75A 4YCWA 3R6SA 1ZG5A 1FOKA 4AD9A 1LJ9A 3HTZA 2P5KA 2EFQA 2KIUA 1IRFA 4C92A 1E1TA 1XCBA 1FZPB 3HUGA 1H4VB 1PP7U 2V1DA 4XTZA 1BOAA 4KIBA 3K1NA 1T98A 2HYGD 1MDMB 2ZIMA 3W6JB 1D8JA 4U7DA 4PJOB 4YP0A 4C8QA 1ZRFA 2ZMEA 1HKSA 3E6CC 4OLFA 4ENJA 4P73A 2JT1A 4F7UB 4IHTA 2BV6A 1I5LA 4Q48A 2RQPA 3CO6C 4M7DC 4P3NA 4UP7A 2KJBA 3UFGA 5FGMA 1ZLKA 1BIAA 1ZN2A 3BOQA 2HR3A 4J6WA 1NJ2A 2ZFWA 3D0SA 4P74C 3KEQA 1FWZA 2RV8A 2RHQB 3M4PA 2WWYA 4G7OF 3H3ZA 1USYC 1G3TA 3WTVC 5CVJA 4M78E 2FSWA 1TNSA 3JB9G 1QNTA 3K0LA 3PZCA 4HOBA 3MEXA 4WWCA 1JHFA 5CVRA 5DCMB 4EMGA 1ZARA 2A5YB 2ZZGA 2DTHA 2ZNYA 2PQ8A 4HWPA 3N97A 1LEAA 4LG0B 1B70B 4MEXF 2NRAC 1EIYA 3HTSB 1FY7A 3HSBA 3BY6A 2CJAA 4LD5A 2H94A 2M30A 5LHGA 3ZMSA 1OYWA 6PAXA 5LJ3h 2RA2A 2YSRA 3WE3A 1WPYA 4ZH4F 3QU3A 5GAMg 3VU3C 3J80Z 1XGSA 2DXTA 1DP7P 2DQ3A 2FNAA 4BQAA 1SD7A 1KMMA 1FBQA 3QP5A 5LJ5e 1SD5A 2RD1A 3QNEA 4P3OA 2RVCA 2D1VA 3WTTC 3A7AA 1ZLJA 3HIFA 4XBFA 2NYXA 1C0AA 2G9WA 1I1GA 2Z9OA 4I2OA 4EJTA 5LGNA 2CQKA 2X4HA 2Q5HA 4H2XA 4M77B 3ABTA 3KP3A 2CYYA 1D3BA 3UGQA 1RZ4A 3A31A 2MLKA 3LSTA 1VTNC 2E7XA 2RGVA 4UV9A 1B7YA 3QRFF 1HW1A 1T0FA 1H4TA 2FMYA 3NRVA 4TTVA 5E8GA 4YRLA 3BZ6A 4KN7X 4N0BA 4P75C 1L0WA 1P4XA 3ICAA 5BMZA 2EA4A 2KIFA 4PJOG 2F5CA 4HWOA 4EGZA 2J5OA 3BP8A 2QYOA 1J59A 4F7UG 1IN7A 3PCOB 1BI1A 3P9CA 4M73A 4KFCA 2J3MA 3WGIA 4OINF 1B76A 5E1XA 2CJ9A 4Y13A 3DKWA 3QP6A 1IXSB 3ZMVA 5GAN2 2ZR3A 2IP2A 2LF7A 2ZT5A 2UZKA 1OMIA 2JN0A 2RDPA 1BI3A 4MMLA 5DYMA 1HKQA 2ALYA 4OIPF 2QTXA 2QBYA 1IW7F 3L09A 4M72A 4LNSA 3E3VA 2JTVA 5GAN4 5GAOl 3HSFA 4M7AD 4QWQA 1RIQA 3ML6A 1Z6RA 2FE3A 2EJ9A 3HRIA 1FYMA 2FB7A 2CWEA 2XUBA 1FPQA 2HKXA 1P4AA 2O8XA 2DQLA 3I58A 1GGMA 1QZYA 4NHJA 4ZZDA 4RMFA 1R5GA 2XAQA 5H20A 5ICGA 3F8BA 3GFJA 4ZZLA 3EYYA 1YQAA 1I27A 5ICEA 2XIGA 4RGXA 1QGPA 1I81A 2L4MA 3KE2A 3HFZA 2YX7A 5D4RA 1WNLA 1YFSA 3JCMW 1WQWA 5KVRA 5GAMe 2QWWA 2K4BA 2F5EA 1NJ8A 3MAJA 3T1BA 1O7LA 4KIFA 1EFWA 3GEZA 3WTWC 2D2WA 4WF2A 3KETA 1ON1A 2G7HA 3J80K 4QVDA 3CMQA 5ILUA 2DQ0A 2DXUA 2YX4A 4O2DA 4E70A 4MTDA 3H92A 4YYEA 4CH3A 1M8VA 2E65A 5LEJA 1Y96B 1E1OA 2P8TA 2AKWB 4L9NA 1IN5A 4CXFA 1B6AA 5E1WA 4CICA 3RUXA 2EFPA 3HRSA 1REPC 2PLYA 5GAN3 2IA2A 1PYSB 4M77G 3RYPA 3I5UA 2LSOA 1WI9A 4RDXA 3CDHA 3QUIA 4M7DA 3JSOA 4AIKA 4UV8A 3WGHA 2M45A 3VQXA 4M75D 5ERIA 2O61A 1U3EM 5DY9A 4PGHA 2STWA 5D5XB 2ARSA 5CAIA 1N9RA 5LJ3j 2FXAA 4H2YA 4RAZA 2HOEA 2ISZA 2HEOA 4P74A 2MD5A 4U0WA 3SZTA 2VXFA 4N0AA 2A3SA 2XAGA 3H3UA 1USYA 3RL6A 1Z7UA 1R1VA 2KRFA 4FX0A 5ICFA 3JCMc 4HAMA 4PGGA 5HVQC 4M7AE 2AMCA 4M78B 3GX4X 1I8FA 5C53B 4AH6A 2ZBKA 1Z1DA 1O3SA 5LJ5f 4UP8A 5AIPA 5LGTA 2ZINA 2GIVA 2VN2A 1IN6A 2Z3YA 5H6QA 1Z05A 1SFXA 3TEGA 5GAOr 4C92D 2DU5A 1QZZA 1MZBA 4PDKA 3M4QA 2JPBA 3KP5A 3IKTA 1S7OA 1HBXG 2QZ8A 3SXYA 1NYQA 4RAYA 5GAMh 5LRSA 2ARUA 2JSCA 2UWMA 1ZG1A 2XKOA 1S29A 4G6DA 4C8QD 3ERRA 5KK1A 4U88A 2M8EA 3KCCA 5GMKl 2Y48A 5L3CA 3JB9F 1IXCA 1TBXA 1ZH5A 1C0WA 1MGQA 4ENNA 4P9UA 3R07A 3JCMg 1Y0UA 1B4AA 2E10A 2XAFA 3QPTA 1N9SA 5I21A 3NEUA 3WGGA 4OOIA 1SRYA 3WE2A 3E9IA 3HHGA 1GVJA 2RB6A 1SD4A 5E1ZB 5LJ3g 5K5OA 2QHUA 4YREA 4WI1A 4YRTA 4BH9A 2EFOA 3HHHA 5L3BA 1SFEA 4ENKA 3V4GA 2MLGA 4LFUA 3GUDA 4GXOA 4EX5A 4RB0A 1HXDA 1WLEA 4I0BA 5C52B 1RI7A 4ZYEA 2Q0OA 4L5IA 5LJ5d 3F8MA 4OIRF 1B34A 1W7PB 1SMYF 2DK8A 1YW7A 5HDNA 5JVTA 2V9VA 3C18A 4M75E 1JE8A 1KYZA 3SWNA 2P5LC 3VEPA 3BDUA 5IT3A 1R36A 1NYRA 4P75A 1PUEE 1S3JA 1DDNA 2G4CA 3QPHA 4NCXA 2FEZA 3RDIA 5BPDA 2RC4A 3LQQA 1I4K1 1JXSA 4G9YA 4A6DA 3DXJF 1T2KA 2DU7A 2I4NA 2WV0A 2KJCA 1Z7MA 4QLCU 1LYLA 4ZIBA 5BPIA 2E1HA 3BFMA 2XGTA 1K78B 4EMKB 4U7BA 4G94A 4L9VA 1J5WA 5CLSA 4HDVA 3JB9I 4HLYA 3RERA 3V7RA 3ZN0A 5L3DA 2DZ9A 4LLNA 2EB7A 2OAZA 4C92E 3LFKA 4MHGA 2A68F 5TJJA 5D5UB 1KYWA 1KQ1A 3JCMQ 2IVMA 1ADJA 4GO1A 3I59B 4YFXF 3TEHB 4PJOF 3F8NA 2I4MA 4C8QE 3IL2A 4M78G 3FB9A 4AVPA 4CGZA 4F7UF 2ZCEA 1J2XA 4BHCA 4XRFA 2EFNA 4I7HA 3NELA 4Q5SF 2DBBA 5D4SA 5HS7A 3NENA 2QQ9A 2KIMA 4P96A 5IT9Z 3T8RA 4CH5A 2V6CA 3LQRA 4L18B 3REXA 3IWZA 2E1CA 2W24A 5CYVA 3T5XA 4CDGA 1EVLA 3JCMe 3ZMUA 5EEHA 2ZR2A 1X55A 1XMKA 5TRDA 5JR3A 3P8VA 3E97A 5LJ3e 3REOA 4A0ZA 3CLOA 1FSEA 4AWXB 4OIOF 3KFWX 1W66A 2IA0A 3G3ZA 3L00A 3QOPA 4L5JA 1HSJA 2HQNA 4HV5A 4YDQA 2PMFA 3KP4A 2COMA 3BW1A 5GAMd 3BJAA 1B59A 4H2WA 2EV5A 2UXNA 4XU2A 1KU3A 3I4PA 4I98B 3JAMZ 1O7FA 3LA2A 1MJAA 5HGQA 2FA5A 1YG2A 1LOJA 4UVCA 3B73A 4CS2A 4IRIA 1O3TA 2VOPA 2QHTA 1YYVA 1KQ0A 4OU0A 4JQFA 3GZ5A 2XTIA 1IZ1A 5K1YA 1STZA 2DPUA 5GAMj 4IF4A 2ODRC 4IVNA 4P71C 1FYLA 3BJUA 2A6EF 2LF8A 3SHFA 1FBSA 2ZT6A 3F72A 2DEQA 1A04A 2IY5A 3A5YA 3MFKA 4KMUX 4R79A 1KU2A 4EVIA 1NNHA 3F6OA 4HT8A 1E17A 3F3XA 2EL9A 3NETA 3L2CA 2Y0MA 1Z91A 3RJPA 1ZGJA 2EWNA 2ISYA 3REUA 3V8JA 4M77F 5BOXA 1EH8A 2DTRA 5FD6A 3CTAA 4PJOC 4PHCA 1R1TA 1FX7A 3HRUA 4M7AB 3WG9A 1PDNC 3KP6A 2GXBA 4KN4X 4HYEA 5LBQA 1U6GA 2C8MA 5LRRA 5GAOq 3G1ZA 1MGTA 1JHHA 3HSRA 1V4RA 4J15A 3JCMh 2MH9A 3IKVA 1BC8C 3E6DA 1MJBA 4DQ2A 4KDPA 1CF7A 1HW5A 2P4WA 3A32A 2RM4A 2ADUA 4L0ZB 2L01A 2FF4A 4Q47A 1BC7C 4YRGA 1HC7A 4A5MA 2XV4S 2F5FA 1IRGA 2DW4A 1JGSA 4M7DD 2RHSB 2PBIA 3RTRA 3L4GA 5IT9K 4J6XA 1NJ6A 5GMKi 4H02A 2ODRD 2XASA 4RS8A 4P55A 3S2WA 4MQ9F 4A0XA 3ZMTA 4NQWA 3JB9J 1H9GA 5E20A 3U9GA 3IC7A 2EFWA 11ASA 1GXQA 4I02A 1FSHA 1NJ1A 4CS4A 1ZRDA 1O3RA 1WQ2A 3RPQA 2MBFA 5AIQA 3C1DA 5GAOn 5FD5A 2MA3A 2ZT7A 3HFOA 2QVOA 4XQ3A 4G7HF 3EQLF 1QE0A 2DU9A 2DI3A 2ETHA 4TVAA 1H4SA 4U0VA 2D1HA 2DFIA 1X56A 2IA1A 1FP1D 3JAMK 2HYFA 2RKHA 3FM3A 3ZP5A 3IKLA 2QHSA 2F5DA 4JBAA 5DD4A 4HQMA 3GO5A 4UVAA 4EQQA 1AOYA 1R7JA 2NNYA 5E3IA 4M75B 5K5RA 1RNLA 1R58A 3K2ZA 1XSDA 3F6VA 3VQYA 1W5SA 3TO9A 2DKGA 3RYRA 1ZREA 5D8LB 5FLXZ 2Q5IA 4HZFA 2IW5A 2BYVE 4XTXA 1DPUA 4RQEA 3CUQB 4M77C 3JCMf 1DUXC 4UPAA 2J5PA
chains in the Genus database with same CATH superfamily
3QTCA 1G3SA 4J6YA 5LJ3f 3HYIA 4IHXA 1D8KA 3PIPF 2J7IA 4C0GA 3RQ4A 4A12A 4B9XA 1M90U 2CZ1B 1WGXA 3FXUA 1EV7A 4BXUA 4I76A 4M7AG 4UUTA 3FKJA 1TUDA 5AONA 2ED0A 3HPWA 3ZFJA 3W6VA 4A54A 3K4MA 4P9FA 2GQQA 3ABLH 2O2OA 1WHMA 2MIOA 1FC3A 4ZYHA 2O4XA 2JW4A 1R9TJ 4RG8A 3NTIA 4FSSA 4FM4B 3KLNA 2H6CA 3T0YA 3BCAA 1OEBA 3H3VK 1P2FA 4HWSA 3H5RA 1CKAA 3TO6A 1LCKA 4BHBA 4GYGA 2QCOA 2GF7A 1WVRA 1M90C 3ERED 1GUUA 3GTMJ 1OCOH 4JX4A 4EV0A 2NWMA 2F48A 1N75A 4FTHA 1Y56A 2A5WA 5C44J 4KIGA 3ELKA 3FIFA 4O6JA 4BL0B 1ETKA 1MBJA 3PQJA 2XGDA 1PUFA 3VS1A 2V8JA 1OYXA 3CCVI 4ZDOA 3HXYA 2FYKA 4RGRA 3CJNA 3E6BA 1E3HA 1TUGB 3TKYA 2P0WA 2YUSA 1MMNA 3BTJA 5FLXK 3H9GA 2RI3A 3OW2S 1X2KA 3T8TA 2ZJ2A 5BNGA 3BY7A 3FM5A 4FL6A 3W3SA 3G71Q 2CT3A 2HPIA 2E3CA 2VXDA 2H09A 1B7YB 4J83A 2BOLA 5D7UA 2A3LA 4BQQA 2IS6A 1GDTA 4X9DA 3VS2A 3GTKJ 3J7AO 1U9OA 4A3EJ 1YW8A 3MKZA 3E9FA 3MKLA 4IPAA 1UCRA 3V7CA 3N4MA 2XU8A 4DZPA 2GTJA 4OMMA 2OTJT 3CC2Q 2CIMA 5DM7R 4C8QG 1WU7A 4KT5C 3IRRA 5DD8A 4XIDA 2K5CA 3R4KA 2HFHA 1Z67A 3I0TA 4O5VA 4M78C 2VOOA 1KFZA 1ZSGA 3QSUA 3DU6A 1LEBA 3WQZA 2EBIA 3C94A 1K8AR 1XSVA 3RKWA 5DCMA 1KOGA 3I71A 3FBNB 3ABMH 1VZ0A 2JUCA 3M0UA 1TW2A 2ELKA 3L2RA 2DVEA 2QBYB 1XQHA 3BDDA 2DBKA 2H27A 4EJWA 4C0DB 3PL8A 4XLNF 1Z7LA 4K88A 4YRJA 4LVKA 1XJWB 2GQVA 4J9GA 3KFVA 1B9MA 4FT8A 4PJNA 3HOTA 5FLVA 2RREA 1YITA 4BI4A 4MO7A 4MQVA 3IKMB 4Q4ZF 4YG2F 2YR2A 4OIQF 1IAWA 2YT6A 2FRWA 1ZR4A 2NS7A 4ESRA 3HGGA 2DO7A 2HS5A 4HCCA 1SEMA 1XGMA 2BE9B 5DV5A 3CC7T 4RLQA 2QM3A 3ZGKA 2CUFA 4IQJA 1RR8C 2K27A 4YFKF 3BCBA 4RB3C 1WFWA 1X6BA 4EIKA 3TUPA 3CDLA 1BL0A 3A0BC 4XKCA 3PCOA 1U1TA 2D1XA 1BN5A 3PVLA 1OR7A 3IRQA 4EMKC 2ZXFA 3H41A 2BGCA 3MEWA 3CCEA 2HL5C 1VQLT 3PM1A 5GAN8 12ASA 3WU1B 1BCOA 2PMUA 2D8HA 1Z9CA 1MSFC 3VYRB 4UNOA 4ZTFA 2QA4T 4J9EA 2AMCB 1QVTA 2DT5A 3MKWB 3EH1A 3RZDJ 2Y30A 2H6BA 3EGXB 5D6EA 3COAC 4FISA 1JQQA 3M9QA 4HF0A 5IY5H 3A1YA 4A2UA 1KQ8A 1M5Q1 4BXXJ 3D7SB 2KVQG 3RIRA 4UB6C 1LE8B 3I56T 3OA6A 1RABB 2R57A 4BI3A 4BJ5C 3JB9D 3EFSA 2M1HA 1UGQB 3AAFA 3HRMA 5KNNA 3Q9VA 1VYUA 1PVEA 4AIHA 1SFUA 5GAOm 1ASZA 4X0GA 3B6AA 3EPZA 3Q0UA 4C0ZA 2R7WA 3VWBA 3H36A 1WHLA 3I64A 4XSZF 4JRIA 4YRSA 4KGZB 4Z2YA 1UGPB 2JZYA 1YJWT 1Y7XA 3WODF 3VODA 2OZUA 1U5TA 3IAM2 5GMKe 1B72A 2K9LA 4HW0A 2XF7A 2ZNZA 4M75F 1A6IA 5J1RA 3M8FA 4BKXA 1U1SA 1AHJB 1ZYRF 2LDMA 3QO7A 2EZLA 1UTIA 4BYYA 2QAZA 3CJTB 3EH2A 2E41A 4H2UA 1LDJA 2PZ1A 1X1PA 5H2FC 2FL7A 3PIOF 3RF1A 1VQNQ 2K2MA 5CJ9A 3AHUA 3LSSA 4M7DG 2DXBA 2QGGA 4C5IA 5HCKA 1A31A 4PSWA 2L89A 2X1EA 2FPDA 2R5ZA 4ZGEB 1XX5A 3DF8A 3E9HA 4UP9A 5GANf 4MTEA 1UECA 2XAJA 1VQLI 2V26A 4Q5WA 1UHFA 2VC8A 3MQZA 2DVJA 1WX6A 3DSQA 2X0LA 2OZ6A 3RR6A 3D5LA 2QA4I 5C0MA 1UB9A 2K3FA 5J26A 2LBFB 2ZNJA 5D8KB 4YFNF 4PG3A 2JOYA 2RO0A 1I5OB 3JB9H 3GCMA 4DZJA 1MV0B 3PQKA 2FBHA 4XSXF 2DN0A 2NS0A 4ZYGA 1UHCA 3EUKL 5E3MA 4YROA 3DTKA 3UNGC 3I56I 5GMKh 3F23A 3ECOA 4PLIA 4CO8A 2P81A 2D45A 1N8RR 2VONA 3M0QA 5CR2A 5GAGJ 5FU7B 2NUZA 1M8MA 1JJ6C 3JCMV 2ZJRF 4RCBA 5GMKm 2ECCA 3I5RA 3CMMA 3FIWA 2L3DA 1N9WA 1H92A 3CCLA 4EGYA 4YEJA 4WK8F 4A63B 2EQIA 2KYMA 1OPCA 2HOTA 5LJ5h 4I01A 4HNTA 3QWLA 4R8HA 3DLLF 3E6MA 1NH3A 4PCQA 5F0CA 2XF5A 3ZQLA 1YJWI 4BQOA 3RPUA 1B8IB 4P5OA 1A0NB 4F7ZA 2DMNA 1ZLMA 1AD5A 3PUFA 3A5ZA 2V1XA 1ZSZB 4JUVA 4PJOE 1M3AA 4M77D 2H1LA 1QKWA 1E24A 2E64A 3PNTA 2JTEA 3CC4A 4U0YA 1J3TA 1SRMA 1G2HA 4UHTA 3K10A 3K4JA 4J5YA 3JTGA 1F1BB 4G84A 2CGPA 1VIEA 2CT4A 1JTYA 3LL7A 3IG2A 4XNFA 3B6CA 1V55H 4BU2A 2P0KA 2BTTA 5DM6F 1GXPA 2LKPA 1YJWQ 1W0TA 2W57A 5HNHA 1WSUA 4NQWB 5K1XA 2E2HJ 2F4OB 2GBQA 1M2VB 3LSGA 3F22A 2OQGA 2CFXA 5CVUA 3V8KA 3JV3A 3JAME 2L7ZA 4K87A 1UJYA 3SDZA 2QSFX 5KE2A 3FWEA 4HLXA 3VS7A 2WV1A 4C30A 2Q8KA 1Q1HA 2K3XA 4C92G 3DV8A 1WYDA 2RN7A 2PI0A 4RCCA 2O9LA 3PUBA 4PZJA 2DQRA 1KA8A 2ZFUA 3VYSB 4UVBA 3VYGA 2VXZA 1R77A 4H2TA 1IN8A 4XLAA 3Q5FA 2EYQA 4XTYA 1K4SA 3DCFA 1K1ZA 4XKBA 2P0PA 2HQRA 4E6RA 1OPKA 1U78A 4HVCA 4CC7A 1NYFA 2GXGA 3LFUA 1FOXA 1ABOA 2KYBA 4H2SA 3EFOB 1W5CC 1SHFA 5FB2A 1IL2A 3ABKH 4Y17A 4LIVA 2FMLA 1WWXA 4PKCC 2VKHA 1IXRC 2W7NA 3LAJA 4JRKA 1UHWA 1XN7A 2IRFG 2A69F 2X51A 2BZ8A 1HOMA 3I53A 2LKSA 4A4GA 3KEOA 2Y75A 1QQIA 2DAOA 4Y15A 3A74A 5CKFA 2PN6A 5J8FA 5LLQA 5CVIA 4B09A 1CQTA 4KUDK 1WA7A 3OOPA 1X27A 4YELA 2QF7A 1X54A 1OYIA 1IV6A 2NUPB 8ATCB 4Y33A 1Q82U 3VB2A 3GIBA 3G1LA 1DGRM 2F1LA 1S7AA 2D9TA 1B9NA 1D0YA 3MQ0A 5CKTA 5HY6A 2GTOA 2YLBA 3C3WA 4RKUE 3R0JA 2ZZFA 1K0XA 3RDVA 1OX9A 1QHHD 4HA8A 3ZN1A 3X2QH 5CCAA 1W4SA 4XLEA 1UHMA 2LCCA 4ZYAA 1WJCA 2A6HF 1YITT 4G85A 5FKMA 1Z7NA 5D6FA 2DL3A 1WH7A 3U2RA 2DETA 2X1CA 2IPQX 2CG4A 4ESFA 2X35A 3VS0A 3JCMX 1S7EA 4FIBA 4FQGA 3CCUA 2A05A 2ICWG 4YCWA 1BU1A 1MNEA 1ZG5A 3I55A 4ZTJA 4V19K 2CH4W 4C92A 3C2GA 3HUGA 4D6WA 2DMPA 3TL4X 2Y0SN 4C5GA 1MDMB 1MSEC 2EQRA 2ZMEA 1HKSA 4OLFA 2IS1A 8AT1B 2A6TA 4D9JA 1VQPQ 2NVTJ 3U21A 2PU9B 5JLXA 5KAIC 5DS9A 2HVRA 5FGMA 2CS3A 1BIAA 3BOQA 3T9NA 3Q0WA 2HR3A 2O7OA 4P74C 3KXTA 1MIJA 2DXCA 1N78A 1G3TA 3K4CA 3QYFA 2X85A 1TNSA 1Q1VA 1AWOA 4M3BA 4E47A 3JB9G 1QNTA 3PZCA 1B3QA 4HOBA 2XF6A 2DF6A 4WWCA 2Y0SA 2BE7D 4LG0B 2C0OA 1Y57A 3HTSB 1FY7A 2AHJB 2NVUB 1SAUA 3DKYA 4CCNA 1OCRH 5I2SA 2WY7Q 1IV8A 2M30A 5LHGA 3LW5E 2K9MA 1OYWA 3EGUA 2YSRA 1QVPA 5JVGF 4ZH4F 1WIEA 3VU3C 1Y1VJ 1XGSA 2FNAA 4BQAA 4HVWA 1SD7A 2BW3B 5FLMJ 1QVFP 1W2BP 1VQ7Q 1Z9ZA 2RD1A 1IO6A 2D1VA 3FXOA 3WTTC 2V1RA 4XBFA 2VJIA 2Z9OA 4EJTA 3OYGA 2CQKA 1FJLA 3E2UA 4H2XA 4BGDA 1YITI 4XN0A 1D3BA 2LJ3A 3MD2A 1T0FA 2MC4A 1H4TA 2WADA 2FMYA 1TL8A 4YRLA 3S2HJ 2PVOB 3QIIA 4P75C 1L0WA 2LOOA 1G5VA 1C6VX 2J5OA 1OFCX 1J59A 4F7UG 5GAEJ 1ITYA 2FEIA 1KHCA 3WGIA 4OINF 1B76A 2CJ9A 1HSQA 2VQHA 1R49A 2BIVA 2W1OA 3ZR8X 4PLLA 2ZT5A 1ZK8A 1BI3A 4MMLA 2DMUA 4FETA 1IW7F 4M72A 2VYTA 5GAOl 4QWQA 1QVGA 4F92B 1IGUA 2EJ9A 2CZ6B 3BQYA 1FPQA 1GGMA 1QZYA 3HTRA 4IUUA 4NHJA 1R5GA 3GZNB 1DU6A 2LTOA 2VWFA 3GFJA 5ICEA 3GTLJ 4RGXA 1R71A 4RG2A 1VQ9Q 2XGEA 3HFZA 2YX7A 5KVRA 5GAMe 4HXJA 2QWWA 2SEMA 3MAJA 1O7LA 4KIFA 1T0HA 2FG0A 4IX7A 3FJ5A 4RTWA 2E71A 1UE9A 4BY6C 4WF2A 2RPNA 3KETA 1TP4A 2J6KA 4OAYA 3J80K 4QVDA 3CMQA 2BZTA 3MEVA 3EUAA 4JJNK 1YHQQ 4O2DA 3CMYA 1PSEA 4OMLA 4MTDA 3H92A 3A8GB 2E65A 1E1OA 1BBZA 4L9NA 3NTKA 4IUTA 5IH2A 3UPUA 2Z2SB 1Z3XA 1OCPA 4M77G 2E5QA 3RYPA 4AFSC 3H5NA 1IGQA 1WI9A 3CCLT 3ZL7C 3WGHA 2M45A 1X1AA 5DY9A 1E3PA 2FPEA 3JRCA 2STWA 1A6QA 2E36A 1N9RA 5LJ3j 2FXAA 4H2YA 2LYCA 3SZTA 3QKJA 2PTKA 1YFNA 3H3UA 3RL6A 2KRFA 1R1VA 3CCJA 4HAMA 4PGGA 5HVQC 1I8FA 2A0FB 4AH6A 2ZBKA 1Z1DA 3C2BA 2VGNA 5LJ5f 4QKUA 1SFXA 3TEGA 2BY3A 1YBYA 1QZZA 2GBYA 4PDKA 3M4QA 4HEA2 3IKTA 2B9SA 3DEWA 2K3YA 1QWEA 2QZ8A 2JTMA 4L6V5 2HOSA 5GAMh 3QJYA 2VI6A 3L1PA 2XKOA 3URGA 5GMKl 3S1NJ 3QYBA 5L3CA 1RLQC 1UUEA 5A0DA 3OYLA 2DDAA 3R07A 2HCKA 3JCMg 1B4AA 5I21A 1NLOC 4LVJA 4DGWB 3SJMA 5FKOA 4BH9A 3PNYA 1K73C 3REBB 2FOWA 4ENKA 4LFUA 1WXBA 1HXDA 3HL8A 1WLEA 2KE9A 4XRMA 1RI7A 3F8MA 4OIRF 1B34A 1SMYF 5KYXA 1TWFJ 5HDNA 5JVTA 3C18A 4M75E 3SWNA 3TREA 1R36A 1PM3A 1S3JA 2LZ6B 3QPHA 2CSIA 4RMNA 2FEZA 3RDIA 5BPDA 3LH0A 4IKFA 2ZPIB 3X26B 1FOYA 2CP7A 2E60A 2L7KA 1MBFA 4ZIBA 3M54A 1K78B 1YWOA 5HNFA 4HVVA 5GP9A 4RTXA 5ECAA 2XIDA 3CCLI 1KC8U 1I39A 1PNJA 4MHGA 3JCMQ 4FYWB 4YFXF 3F8NA 1LPLA 2I4MA 5D6WA 1P9QC 3OYAA 4M78G 1U5SA 4LUEA 4CGZA 3ULRB 1J2XA 1Y8QB 4C2TA 2EFNA 4I7HA 3NELA 5D4SA 5HS7A 2VQGA 2KIMA 3QWXX 4L18B 2EPDA 2V9PA 1HD3A 3TP3A 2LKXA 3P8VA 3NGPA 3VSLA 2MAMA 3RCOA 1FSEA 1UAAA 2DYBA 1W66A 2IA0A 3A8MB 3L00A 3QOPA 4L5JA 4II3A 1HSJA 2HQNA 3S15J 3KP4A 5E3LA 1B59A 2MABA 4L59A 4XU2A 1KU3A 3I4PA 3JAMZ 1S72A 3LA2A 1MJAA 3CCSA 1YG2A 1T8IA 3CCMA 2ABLA 2QHTA 2JJ7A 2UV1A 4JQFA 4S0HB 1IZ1A 1Q86U 2ZPEB 3IV5A 3BG6A 4EDUA 2RJCA 3M4YA 4AMCA 4QQDA 3MO8A 3UWNA 2LF8A 1VQ4A 5KAFC 2ZT6A 1GFDA 5E3NA 4C9YA 1QMCA 4PSXA 3MFKA 4KMUX 1C1AA 1NNHA 4F16A 4A3CJ 1LKXA 3NETA 1QCNA 5DLQE 3CCUT 1Z91A 3RJPA 1N27A 3I55T 5FD6A 5A2QE 1R1TA 4M7AB 1Q81U 2BVLA 4LDXA 5LBQA 2C8MA 3DPUA 5GAOq 2R5AA 3HSRA 2IVWA 1OX8A 2QGUA 1ZX6A 5J3BA 3E6DA 1HW5A 2P4WA 3A32A 2ADUA 1VQKA 3NWSA 3TSWA 2BXZA 2EKHA 2DIQA 3REAB 3VDXA 2F5FA 2EINH 4B1RA 3L4GA 2B86A 1NJ6A 1ACMB 2LJ0A 2XASA 2KNBB 1JB0E 4A0XA 3VYUB 3U9GA 4OF1A 3DU5A 2DTZA 11ASA 1GXQA 1RACB 3QPLA 3OYDA 3RPQA 2VPRA 2VGMA 5FD5A 1Q81C 2LC4A 2KZGA 1ZA2B 1AT1B 1UZCA 3BZCA 3HFOA 2QVOA 2LK2A 2GCXA 3HXLA 4G7HF 3EGDA 1QE0A 2DU9A 4AG1C 1FP1D 3ZP5A 2QHSA 4HQMA 3ERMA 1VQ5Q 2YUPA 2RJFA 2R58A 3MPUB 1OZ2A 4B6MA 1ZREA 5IXFA 2XPUA 1VOMA 3ZRGA 4II1A 4HZFA 4WTOB 2RF0A 3E7LA 1BBYA 3HPHA 1T08B 4HWTA 1O75A 1CGPA 2DMOA 3O6BB 4BWAA 2HDWA 3LSKA 2OQRA 4OB1B 4TQDA 3UH0A 2XPVA 3OSGA 4DPGA 1SRLA 3MP6A 4LG3A 4A4HA 4WXDA 2FVUA 3TW6A 4C8QB 1TWBA 4Y92A 3ONQA 4HCKA 3A7UA 1WFXA 3PJRA 4LB5A 2XROA 1EJ9A 2RHXA 2KISA 1OR7C 3PMIA 4JLIA 3A8LB 3CXCA 1GV2A 1B07A 3GF5A 4RB2C 3BTCA 2XGCA 3EDPA 1XMAA 1LDKB 3K69A 3UA7A 3OW2P 1Z6TA 3GFIA 5CVVA 5GANj 3VS3A 2ZJQF 2W0ZA 2MC3A 3Q9SA 3QO5A 3JCMd 1NG7A 1XDUA 3DLAA 1UFMA 3OIOA 2DFEA 2A36A 4E2FB 4LDVA 2HZDA 1ON2A 1J7KA 3HM5A 4ABZA 1U5TB 2W10A 2VV5A 1OQYA 3EFRA 5CKHA 4C5EA 1BCMA 1ONVA 4PJJA 2M2EA 1R22A 2NUTB 2DDZA 2HI3A 4P71A 4D8DA 3GYHX 1TSFA 1J5YA 1WXTA 2JA5J 2COYA 5A0GA 3JCMb 4MEYF 5E8IA 3ZQGA 4UUSB 3M56A 2R5YB 4HX8A 3SHWA 4Z89A 4C2MJ 4ZTUB 3GW2A 4ATOA 3CJRB 1U3OA 2WSEE 3C12A 2K9QA 5ELNA 4A3IJ 4CH6A 1NJIU 3LX7A 1YI2A 1LB2A 4PJOA 3O5ZA 3A98A 1G59A 2LD5A 4XMYA 2DL7A 2KPMA 3KYDB 1U5TC 3O3KA 1SKUB 1DPRA 2F5TX 3HY1A 3L1AA 2HZTA 5GAN7 3PFIA 3UR3C 1ZHIA 3FMQA 4ENMA 3VQVA 3BWGA 2LTPA 2DYSH 2QENA 2M8GX 3SD4A 4XLFA 1GXIE 3CCRA 2RHQA 2CO5A 1B1BA 1JKOC 3WU2C 2OC6A 3K9TA 1IHWA 3AKZA 3JREA 4TVWA 3CCJT 1YCSB 4OAZA 5HOOA 1BIBA 1R1UA 3A03A 2DTOA 1B70A 4YIRX 3LNQA 1I3QJ 2A61A 3VKIA 2VASA 4QPOA 2ZSHB 3ZPLA 2A08A 3K4BA 4EM1A 4BE0A 5JFRA 3W2AA 2DXIA 3CCQA 3VS5A 2LY2A 1UJ0A 2KDSA 3HG9A 3OR2C 2EIKH 1RIOH 3H0FA 3OIPA 2HTSA 4D7NA 2DERA 2E12A 1WJDA 2PJPA 2DLLA 3K1PA 3JRDA 3A01B 4EM0B 4HX4A 5GAMf 3OS2A 2EYYA 5GAHJ 3A1PA 2K6DA 2DPDA 5HLGA 3LSHA 3M7GA 3SFMA 1HSTA 2OBPA 1XC5A 4YRQA 4F52A 5LHIA 1X2GA 3ER0A 2ZO4A 2EYXA 1A35A 4ASNA 4AUXA 2MH2A 1YS7A 3X28B 1IF1A 2FQ3A 4XU0A 2DZCA 5F04A 4ON0A 4LK1F 1Y07A 4M7DB 1ULYA 1K73R 3GPLA 3LSQA 1D0XA 1NYGA 2JVVA 5KYNA 1OCCH 3VS6A 4EEFG 2CQNA 4XU3A 2Q2EA 3CUQA 4QQGA 5KYYA 3MEYA 1ZR2A 1U2WA 4ZDLA 1BOBA 2RH2A 1IRXA 4CS3A 1WRJA 4M7AF 2Z16A 1QP2A 2EQJA 3KFUA 4OB2B 4L0YB 4JZ3A 1FT9A 2VODA 3HRKA 5KCOA 1FYKA 3NEMA 1D09B 4R1HA 4PJLA 2OI3A 3G1JA 1X6OA 3CCJI 2C0IA 3AT1B 3FDRA 2PMHA 2NVYJ 2VQCA 3FRNA 3PTAA 4NS5A 3G71A 5K7FA 1D1AA 4C5HA 2QYZA 3BDLA 4A5NA 1IDYA 2LMJA 3N05A 2TDXA 4IUQA 2E5NA 1Y96A 2AKWA 3PIPA 5HDGA 3TO7A 4XTWA 1IHVA 2LC2A 3SYTA 3CC2A 1S72T 4OVAA 1PYSA 2IGNA 3EG2A 2O0YA 3CCMT 4LB6B 2QQAA 5FRNA 1XGNA 2CSOA 3OMYA 3A02A 1JKQC 4E7LA 4X9CA 1A5JA 3LWHA 2KRCA 4XORA 1PWTA 3I9V2 1VQ4T 2KT8A 4KBMB 1R5HA 1L0OC 2KT0A 2P0LA 1X3UA 2CUBA 2KMUA 1SC7A 1IJWC 2ENMA 1WXUA 2DA6A 1O9SA 3TSZA 2DEUA 1D5YA 1KQ2A 2CREA 4PFPA 5CKEA 3J7YJ 5D5VB 1R0BG 3PSIA 3DPLC 5L23A 2ROTA 1I5ZA 2QDYB 3O2PE 4C8QF 4UC4A 2LVSA 2FU4A 5IYDJ 1VQKT 2V79A 5B3SH 2VPLA 1K7AA 2QI2A 1NHAA 2F2EA 1R4MB 4QQ6A 3JR9A 3OSFA 3BG3A 3GNFB 4W97A 2VBWA 2FD5A 4IJAA 4B3AA 2QGFB 4UUVA 1IUFA 1T6SA 2PUOB 1YX3A 5FFZA 2KRMA 3RKXA 2EGEA 2R7TA 1JBMA 3JRHA 2QQ8A 1NE8A 4EJUA 5EEGA 2ZJPF 1D0ZA 2EGAA 4J9FA 2R93J 2L3PA 4BEHA 2IEKA 4DBQA 1Y8RB 2FO0A 1K8AU 3LMMA 5C51B 4XL9A 4QVCA 1P6RA 1XSXA 1MMGA 4OP0A 2ED1A 4P72A 2P6SA 4M6YA 4JLGA 4BNCA 3PNWC 3EHQA 1S72I 5C3EJ 2J6OA 1W6XA 4D8KA 3CCMI 1OCTC 1XD7A 2QSHX 2DODA 4HRIA 1FNNA 5LHHA 4C92C 3CCYA 2QKLB 3I59A 3MZYA 1VQ4I 5EJCA 5K5QA 5A2QZ 3C7JA 5FKLA 2DOEA 2EJRA 2HVSA 3QBYA 4LGWA 5DDGA 5J8CA 1LVKA 3KZZA 1J0RA 2PMEA 1Y6IA 4AFZC 1O57A 3HFNA 2OU2A 2HNIA 4KISA 1PRLC 2CYZB 5IT9E 5EG2A 3EUHA 5KYWA 1E22A 4MZMA 1CF7B 1NEGA 1LDDA 1ABQA 4I09A 4L87A 1HLVA 2CW7A 1S8NA 1KG1A 3WVDB 2RN8A 1TG0A 3META 2Z5UA 3JRAA 3HRTA 5CKBA 1AZGB 4B47A 3CCMQ 3RACA 3LSRA 4CCLA 5J4YA 1OKRA 1VQKI 2R7RA 3M9AA 3I35A 2I0NA 2Q7GA 2LCSA 3LWFA 1I1SA 4XU1A 2JN6A 1BA5A 3GLXA 3TOBA 1ZHFA 1VQNA 4E7IA 3IAS2 4J7FA 3I54A 2CQ7A 1AEYA 2JZ2A 3BROA 4P1WA 2PQWA 1H4QA 4LOCA 3FMRA 1GBQA 3QO8A 4ZN3A 3VRYA 3LA3A 2E2JJ 3ABUA 5ELOA 2E3HA 3CBMA 1W4MA 3PO3J 4MMKA 3AL0C 5K1PA 3OYCA 2JS2A 5M9OA 1AWXA 1M3CA 5GMKj 2EIJH 1T0FC 3IWFA 2I4OA 1EH7A 5I22A 4IIOA 1ZUUA 1YB3A 4GYIA 3LSIA 1R23A 2FNPA 3R61A 1PSFA 3R60A 4DW6A 2DFFA 5A0LA 2RHSA 4M7DF 2DTIA 2L3QA 2ID6A 4FT4A 1BJAA 3CCRT 4CC4B 2K57A 5EGOA 1X01A 4TV7A 5LJ5j 1EVKA 5AT1B 2L7MP 1RR7A 2EVRA 3QG1A 1Z0XA 3DB3A 4A69C 4L5EA 3ASNH 3ECHA 1OULA 4ZJZA 4B48A 3FX3A 5TISC 1E6GA 1J9IA 2RHUA 2AZSA 1XPXA 2LDUA 4JDSA 3JRBA 5F08A 3ESWB 1TTYA 3CCQT 4J8OA 3CDIA 2EQKA 4RGSA 1NG2A 2MWOA 2P7VB 4M75A 4EO4A 2YLCA 2Q7HA 3H1CA 5L3EA 4N4IA 3DBLB 2R7DA 2FZGB 4PJMA 1JRIA 3F9KA 4G6QA 2O03A 4KNYA 2LT4A 2NLUA 4S04A 3FXMA 2DOFA 3R6SA 1RRJA 2MWPA 1FOKA 1YRNB 2KIUA 4AC0A 1E1TA 1XCBA 1FZPB 2X48A 4OB3B 3K1NA 2VJ5A 1D8JA 1WJFA 1ZRFA 2A8EA 1YJWA 4P73A 4CC3A 4F7UB 2BV6A 4Q48A 3BC8A 3CO6C 2HPMA 4P3NA 2KJBA 2EH3A 1WHHA 4QPQA 4J6WA 1NJ2A 2ZFWA 3D0SA 2DM1A 2RV8A 3J81E 4ZN1A 3M4PA 1TWHJ 2D5VA 4ZC3A 4CRIA 3RPUD 2KAFA 2ZC2A 1JHFA 4KGVB 1ZARA 2DTHA 2H3JA 2ROLA 1FOWA 1RKTA 2COWA 1SG5A 4NBQA 1KD1U 2PVGB 1Y0MA 3HSBA 2XKOC 3BY6A 2H94A 4C0FA 4TVRA 1BKBA 3H0HA 3ZMSA 4JRQA 6PAXA 3DLLA 1N8RC 4HPQA 3BG9A 4M3GA 5GAMg 3G71T 2DQ3A 4E7SA 2JA6J 3QNEA 4HNUA 1LPQA 1ZLJA 3HIFA 1C0AA 4I2OA 2I5UA 2I10A 1POGA 1RETA 4M77B 3MVPA 2ZXWH 2MLKA 5IPAA 3LSTA 2E7XA 2F4MB 3CC2T 4LDWA 1B7YA 3OSVA 2A7YA 3FHNA 1HW1A 4DA4A 2IIMA 2AXTC 5E8GA 4N0BA 2F5KA 2EA4A 4HWOA 1Z9QA 4LE9A 2LR8A 3TVTA 4E7HA 2X6WA 3UT1A 3DKWA 2B8AA 2RDPA 5EZHA 3QXEB 2RNGA 1F43A 2DMTA 2QBYA 2JTVA 5GJVB 1RIQA 2VL8A 2XUBA 2DMQA 4XOTA 2DQLA 4FU6A 1KJWA 3S8PA 4RMFA 2XAQA 3F8BA 4ZZLA 4MZTA 3EYYA 5FU6C 1M1KR 1YQAA 2D8JA 3KE2A 3OL3A 2EIFA 5D4RA 1YFSA 1YIJT 2K4BA 2K79A 2F5EA 1YP5A 1QQJA 4Y52J 1MMAA 4CCOA 5IHIA 2LVMA 2DQ0A 2DXUA 1VQPA 1WJAA 2HMAA 4YYEA 2DT7B 1SFKA 3EHRA 5LEJA 2LLKA 2P8TA 4W1UA 3A4CA 4CXFA 2HQHA 3G71I 1B6AA 2J06A 1RAHB 1A36A 2PLYA 2IA2A 2LSOA 1FIAA 4RDXA 3CDHA 5F27A 2R7XA 1VA7A 2HDAA 2O61A 5KYUB 1W1WE 2H1KA 2ARSA 2VUBA 5CAIA 1MBHA 1FMKA 3G7ZA 4RAZA 3CC2I 2HOEA 2ISZA 5FW9A 2VXFA 3PNVA 2FX0A 5ICFA 4ELYC 2GFAA 2K5IA 2KI7A 4M7AE 2AMCA 4M78B 5IOYA 3LSPA 3E9GA 1O3SA 2GIVA 2VN2A 2Z3YA 5H6QA 1Z05A 5IAYA 3EGXA 1MW7A 5FKNA 4C92D 1GCPA 2BY2A 1MZBA 3KP5A 1S7OA 2MGQA 1NYQA 3OYIA 1VQ7A 2LQWA 2X4YA 2UWMA 1LE8A 1ZG1A 2QQRA 1S29A 1QPIA 5KK1A 2DFHA 4XAXB 3JB9F 2EW3A 4Z6YA 2LNHB 4ENNA 2Y31A 3L2WA 2XAFA 3QPTA 4X34A 3WE2A 3E9IA 2RB6A 4HKEA 1PKTA 3GTQJ 3PFYA 4DOZA 1BR2A 4GBQA 4LXCA 2EFOA 5F1JA 1OV3A 3F0CA 2MLGA 1IGNA 4GXOA 4XK4A 2R5MA 1YIJI 4PJ0C 4ZYEA 2Q0OA 4L5IA 4M3EA 1GFCA 1W7PB 2DK8A 1YW7A 3S16J 2V9VA 3MKYB 2XMFA 1VQNT 3VEPA 3BDUA 1NYRA 1PUEE 1SF9A 3HKZN 1DDNA 4MDXA 4NCXA 2R7VA 5D6XA 4A6DA 3SEQA 1X1CA 2OAWA 1G83A 1UG0A 5LD2C 1LYLA 2XGTA 1JJ2A 4EMKB 4G94A 4L9VA 2CSQA 3RERA 4HLYA 3JB9I 3V7RA 4LLNA 4RTYA 2OAZA 2L7FP 2J6FA 1VQ9A 5TJJA 5D5UB 2AT1B 1KYWA 4PK4A 3EG9B 3TEHB 4XKWA 1YIJQ 3G6ET 2V8IA 4C8QE 1ETVA 4F7UF 1ERDA 2JMWA 4XRFA 4J01A 3HKZA 4Q5SF 1YHQA 4P96A 5IT9Z 3ZQFA 2LBFA 2W4SA 1PHTA 3S3OA 3IWZA 2E1CA 3T5XA 1XTAA 2DL8A 2F69A 2MMPA 5TRDA 5LJ3e 4DJAA 3CLOA 4OMOA 2WBMA 1FMWA 3CP2A 3G3ZA 2RQTA 4MFEA 3P8BB 2COMA 5GAMd 3EAEA 2M3AA 5K7ZA 5FWCA 2UXNA 5J3LA 4KH0B 3OYEA 4I98B 5HGQA 1LOJA 1BR4A 4IRIA 2VJJA 2VOPA 1KQ0A 4OU0A 2JM8A 2L9SA 1X6GA 5E3OA 2XTIA 2JSPA 5GAMj 2RK2A 4IF4A 2ODRC 4MLOA 4P71C 3SHFA 1FBSA 2NS8A 3F72A 5J40A 3IH3A 3A5YA 1B8IA 4XRSA 3H6ZA 1QVGP 4EVIA 2LJ1A 2R4GA 3F6OA 4HT8A 2EL9A 1ZSZA 1VQNI 1OPLA 2EWNA 2IPOB 4GFBA 3GLLA 1WH5A 2HU9A 3REUA 3V8JA 4M77F 5BOXA 4PJOC 3I9QA 4PHCA 1FX7A 3OYBA 2EQMA 3KP6A 2X3XD 1OISA 1U6GA 4BDZA 1JHHA 2XSDC 4X6AJ 1V4RA 1NG6A 3IUOA 1MJBA 4KDPA 3KPHA 2PJRB 4L0ZB 2FF4A 3H9NA 2KQWA 4YRGA 5IP7J 1WGSA 4A5MA 2XV4S 1V54H 4XLCA 2PBIA 3GP8A 3G6EI 2DJNA 4H02A 3K2AA 1AKHB 4MQ9F 3ZMTA 4NQWA 3JB9J 1H9GA 2X6XA 5IHNA 1M2VA 1NJ1A 1ZRDA 4ZDPA 1O3RA 4CCKA 4BE2A 3Q0VA 2F2WA 5AIQA 3C1DA 2XB5A 2MA3A 3SDBA 4XQ3A 1UJ8A 3KEYA 3Q1JA 3EQLF 2DI3A 1YJ9A 2ZZDA 2AQFA 2D1HA 2DFIA 3JAMK 3FM3A 2FRYA 4OMNA 4UVAA 4EQQA 1AOYA 4B9WA 3OS1A 5E3IA 4LD6A 3G4SQ 1RAEB 3CEYA 3OYNA 3TO9A 3WHBA 2DKGA 2YS9A 3RYRA 5D8LB 2RHYA 3G6EQ 2Q5IA 1Q86R 3EFOA 3CUQB 3JCMf 1DUXC 1IO2A 4UPAA 2J5PA 2VVKA 3SEMA 3I3LA 3RBBB 3TBIA 2LRQA 3FK6A 1O4XA 2HKNA 2RQWA 1APLC 3HOYJ 4HCZA 1JU5C 3OS5A 2L02A 1H88C 3QPSA 4IRHA 5F5WA 4LNPA 1I3AA 4M71A 1T33A 2JPCA 4KYWA 3ZXSA 2E1OA 4Y3OA 1KQ9A 4XICA 2QEXT 3WTZA 4M7DE 2ESHA 2M1BA 1PG5B 2DRMA 1K61A 2WSFE 1D3YA 1ZGAA 4TWAA 4DYCA 1FYFA 4ZNXA 1ADYA 2NUPA 3J81Z 1FBUA 3CUQC 1S1NA 1JUSA 2QLZA 4M78F 1ETXA 4MNUA 4FE7A 4G12A 3GNGA 3K4NA 2YU9J 1I6XA 1SETA 3LLRA 3CMEA 4CH4A 4IHWA 2CRGA 2V6EA 3TDZC 4OMZA 1ARKA 3P8YA 5HDKA 2KRHA 1QP3A 1EIYB 3E5UA 1VQ8Q 3S14J 3GBGA 4XEMA 3D1NI 1BB9A 1CKBA 3KP7A 2AXLA 4YCVA 3N5BB 1SSHA 4RTUA 3CMAT 5HLTA 3HTUA 1BM9A 3CD6I 3WG7H 3WU0A 1YS6A 3RESA 1R5ID 2L54A 1VQPT 2D0NA 2KLOA 2E1NA 2MFZA 1MDMA 4PL6A 3W6KB 4L9TA 5GPCA 3QAHA 1AWJA 4NL3A 5FO5A 3PSFA 2DJZA 1KGSA 2M9HA 3E5XA 3VQWA 3BTIA 2DYIA 3H35A 1WCMJ 3CPFA 2O31A 2V4JC 5F0FA 1TQPA 4RBOA 2GOXB 2NXNB 1G5IA 3M58A 2QQBA 1RPWA 1JJ2S 2IS2A 2VBXA 1MMDA 1HK9A 1SEUA 3CUOA 2YUOA 4BHPA 2W48A 1K79A 5FROA 4H2VA 4JPBW 5CO7A 2Y69H 1TTHB 5KE3A 3IH2A 4LJZF 4FX4A 2WACA 3CD6Q 1MKMA 1IRZA 5D5WB 1YLFA 2QEXI 3ASOH 1VQ5A 3J7AY 4LG0A 2WY8Q 5F6FA 2ALYB 3UGTA 2YPRA 4DNCA 2PEXA 3ZQIA 2X6YA 2IT0A 1HYOA 1QCFA 1IUYA 3H9QA 4JK1X 2A07F 1VQ7T 2F2VA 4KQEA 2GIZA 2LNBA 3BPXA 3E1SA 1KU9A 2N8GA 5ED4A 4ESBA 1WHGA 4FYYB 1F4KA 2BW3A 4A3MJ 4JJBA 1MD0A 3H5AA 1JKRC 3K4LA 1KHIA 4BS9A 2P5IA 4C3IJ 2LP5A 2VBZA 3B02A 2CH4A 1XB4A 2JK3A 5GANe 2QEXQ 1XNIA 2G7UA 3FXRA 4ZYDA 5JHUA 3ZQCA 3NQOA 2XDPA 4M78D 4AFQC 1K76A 2ZXJA 2K7LA 2XG8D 3EYIA 1ATIA 3CMAI 3M1EA 3OYJA 3S3NA 1HKTA 2AIRB 3EETA 4IURA 3GXOA 2KP6A 4A3JJ 1R00A 4P72C 1VQPI 1H9TA 2C6YA 1OOTA 4V2FA 1LFUP 1VQMT 2PFBA 2SRCA 2WAQN 1WI7A 1T39A 2IGKA 1Y1WJ 4BJTA 1NPRA 2KK4A 2KMTA 4BUGA 2BXYA 4J9HA 3I7FA 5JHFA 1EOVA 2ZNIA 2HGCA 1VQ9T 1MUZA 5E17F 2CGHA 3O8GA 5DEQA 2VC1A 2BBYA 3G1MA 1VIFA 3ME9A 1TC3C 2P5VA 3ZEHA 1Q7YC 3CMAQ 5AYFA 4RLFA 3GF2A 1IN4A 1TS9A 1P92A 1UEBA 2DX1A 2QK0A 1W7PD 4EATA 3JRFA 4M9SA 3E19A 2UXXA 3MMYB 2A28A 1YHQT 1XS9A 2D6FA 5TGTA 2AZVA 2M02A 1JXMA 2WAQA 5GANh 5IOZA 3J7AF 2ZSIB 3QQAA 3ZMDA 1AVZC 4N0AC 1L3LA 2JRTA 1VQ7I 3S3MA 3DTIA 2DD4A 2AK5A 2FRHA 1QO0D 3DPTA 3P8TA 2ZGWA 1KQSA 2JJ9A 3JTHA 1E3OC 3CXCP 2EZHA 2COZA 2PVDB 3H0DA 3A0HC 4XR6A 4DYQA 2IGOA 1RAGB 4RQFA 2BY0A 1R0CB 4A3LJ 5HKCA 3ZCOA 1Z21A 1YTYA 3IHUA 4D7MA 4IO9F 4KRTA 2VIXA 1HJDA 1VQOT 2NAZA 3U1DA 5EG0B 4RB1A 4ME7A 1XOVA 4E7ZA 3X25B 3HJEA 4BQNA 1MBGA 2CUEA 3BJOA 5BS6A 1KIKA 1VQMI 4DBFA 3CO7C 4HDUA 3OB9A 2HTJA 1G5HA 4PJOD 4JX5A 3K7AJ 4FCYA 2XI9A 3HOVJ 4YRMA 2EA2A 3MEUA 3E5QA 2RJEA 3G73A 3MZHA 3BJ6A 2ECZA 4TVYA 2IJLA 1ZELA 1BI0A 2HEQA 1VQ9I 3DKXA 2MCNA 1KU7A 1U8RA 1SVOA 4XTUA 4L9JA 4GGGA 2QTVA 4K86A 4O3MA 1W5TA 5ILVA 3W2VA 1BK2A 3KIOA 2HSPA 2DOAA 4AFUC 4BY6B 5HLHA 2ZT8A 2KDOA 1YHQI 3CPWA 1TT0A 1BR1A 3TGNA 2M0OA 1GHCA 2Q7EA 5L3GA 2GLOA 1VQ6T 2FUG2 4YRVA 1VQMQ 2I8DA 2E70A 3TQNA 3THKA 2X4XA 4M9XA 2VKNA 1YJ9T 3RQIA 4GLMA 2XAUA 1YCYA 4M75C 2BEOA 1XMXA 3DEUA 2W85A 1E2XA 2GM4A 1G51A 2K9GA 3FHZA 2LQKA 1SESA 1JI8A 1SVLA 1OLTA 1JXOA 2VBYA 3GTPJ 4L5GA 1K78A 2IY5B 5M5XJ 5HS8A 4XEOA 1WQ7A 4H4KC 2HZYA 1USSA 2ZXHA 2BE5F 2K86A 4E7JA 3GBQA 5HS9A 4DOVA 4E51A 2ELHA 1ZQ1A 2XD0A 1ZAOA 2XC7A 5GJWB 1TUCA 5EC7A 2XRNA 4F7UE 3QHSA 1VQOI 2E6ZA 4P73C 2XAHA 3FXLA 4MGRA 3OSSC 5K7HA 2BHZA 1ZGWA 2ZPGB 2COBA 1S6LA 4KR2A 3HXZA 2ZB9A 1SD6A 1XTDA 2GWRA 3OMGA 1BBWA 1BI2A 2O5RA 3MF1A 3J7ZI 4HX7A 4FHTA 4IOAF 4IUVA 4WJ3M 4YRFA 2RQQA 5GAN6 3LGLA 2ARTA 4RTVA 1BW5A 4M74A 2MOXA 1YFRA 1I50J 1JUMA 3QYHB 2LX7A 1NJ5A 1HCRA 4EM2A 3O8VA 4D1QA 3I5SA 4J7IA 4KULA 3SFZA 1K73U 5IHKA 3CMET 2OJED 3HZJA 1VQOQ 4ZGJB 1ODDA 2P0QA 2M0CA 4TVAB 3TCJA 3CCVQ 2CJBA 3KLOA 2GA2A 3L2ZA 3EG1A 1K4TA 4A6EA 3NAUA 4CYCB 3JSPA 1VQ6I 5GAOp 2PMZN 3WTUC 4NOYA 2PUKB 2DL4A 2EJGA 1YJ9I 2JMCA 1VQZA 2YDLA 2W00A 3FDYA 2M5WA 2M7BA 4M77E 2EZIA 4M7AA 5EF6A 3SFIA 5ICCA 9ANTA 3MZ8A 2KSSA 2QQSA 1RAIB 2JVGA 4FW1A 4YRCA 1M3BA 4RAFA 3NTHA 4TQFA 4YRIA 1PJRA 3OBYA 2KHMA 2K4JA 5FRMA 4G8XA 3K1MA 5M3MJ 2DK5A 3VBBA 2DA3A 5H6RA 1BW6A 5A2QK 1OYYA 4IHSA 3FMSA 5DUIA 1X75C 4WXHA 4EJOA 4EMHA 3LAPA 4YIFA 3JRIA 1UB4A 1AOJA 2L9NA 3VYTB 1I07A 2HXOA 3P5JA 3MCZA 3OD1A 2PMZA 4CSWA 1VQ6Q 4QT7A 3RI4A 2LG4A 2O4XB 2LFBA 1YJ9Q 3HXVA 3UF4A 3CF2A 4GY5A 2K7AA 1UELB 3L7WA 1HQCA 1JJCA 3M8EA 3GZ6A 3M5AA 2QUFA 1VQ5T 4YPFA 3ULQB 2K85A 4C0DC 2AKLA 3A2KA 5FKKA 1K9MR 3ZMZA 4A53A 3HSEA 4A4EA 3H0GJ 3LYIA 1TXQA 4AIJA 4Z88A 1W36C 1EH6A 2OA4A 4C3JJ 1XG1A 1V3FA 2EJFA 2W84A 2ZPBB 4LD9K 2KGTA 4AIDA 2M87A 4V2SA 4Y91A 1PUFB 2EILH 2FOKA 2OD5A 1U8BA 1E0EA 4V2GA 4RGUA 3TW7A 3CMEI 5FLXE 4N4OB 4HWRA 3MJXA 3ZOBA 1KQSS 2F4IA 2HKOA 1J75A 2CP6A 3MKDA 4A4FA 4AD9A 1GT0C 3HTZA 2P5KA 2EFQA 2OTJI 1H4VB 2V1DA 1BOAA 1OU8A 2MK5A 2HYGD 1E6HA 3W6JB 4YP0A 4C8QA 4ENJA 2JT1A 3DKMA 1JGGA 4DEXA 1WDXA 2RQPA 5J39A 3QDRB 1ZLKA 2DFUA 2ATCB 2X1DA 2CUJA 2LREA 1I6HJ 2ZPFB 1FWZA 3M0PA 3CMEQ 3FISA 5CVJA 4P5NA 4M78E 4WCIA 3TQ7P 3K0LA 3L2UA 4J00A 5DCMB 3QJ6A 4EMGA 3OY9A 2XDVA 2OTJQ 5IP6A 4HWPA 3TU4K 3N97A 2M51A 1UG1A 1LEAA 3AFHA 4MEXF 2NRAC 2ZAEA 2E2IJ 2CW8A 2H8WA 2NUTA 2H3EB 2CJAA 4LD5A 3CC7I 2B63J 4R0KA 1PKSA 3CQTA 4UUSA 3WE3A 1VQ5I 4AT1B 2R5YA 3HOWJ 1YJNA 2R7SA 5D6YA 4KITB 1N6AA 3CPWS 1FBQA 3QP5A 5LJ5e 1SD5A 3WXMB 4FE4A 1AU7A 2RVCA 2NYXA 1WJRA 2G9WA 5LGNA 1QVGS 1Q7YR 1QA6A 2DAQA 3OYMA 2Q5HA 1R4NB 1WYXA 3ABTA 2CYYA 3UGQA 2M0MA 1RZ4A 1VTNC 1JO8A 2RGVA 4UV9A 4PFZA 2KFDA 2BVMA 4TTVA 3BZ6A 4KN7X 3DLMA 1M1FA 5BMZA 1I1JA 3F70A 4YTLA 3CC7Q 2KIFA 4PJOG 2F5CA 2MPXC 3AG4H 4EGZA 1X1BA 1VNDA 4GDFA 2QYOA 1EX4A 1IN7A 3PCOB 3AG1H 4RAGA 3P9CA 3NWTA 4B43A 4FYXB 2J3MA 1YNZA 5E1XA 2OTLT 3SZGA 1WJSA 3QP6A 4CI0C 3RKQA 2ZR3A 2IP2A 2HL3A 2DNUA 4CCJA 1OMIA 4OIPF 3L09A 4B44A 4LNSA 3E3VA 2EQUA 2Y4YA 3HSFA 4KUIA 4UB8C 2DK3A 2HVQA 2MD0A 4NUBA 2FE3A 1MMSA 2M4KA 1RAFB 2FB7A 1VQLQ 3LSJA 2CWEA 2HKXA 1ETOA 2ME0A 4HSRA 4ZZDA 2JM9A 5H20A 2XIGA 1QGPA 2QA4Q 2GOMA 3A01A 2AQEA 3JCMW 1KD1R 3FBIB 3T1BA 2JTFA 2DBMA 2OF7A 3VUZA 3TEDA 2G7HA 1G2BA 5ILUA 2XPWA 4IEJA 1MNMC 4XK8E 4E70A 3I56Q 2DPPB 1M8VA 5FU7C 4U87A 1WHUA 4C3HJ 1X3WB 4HT4A 1DGWY 2DL5A 2CS7A 3RUXA 2EFPA 1JTXA 3HRSA 1VFCA 2L3RA 2DCEA 4M7DA 3JSOA 1RL2A 1B72B 4F3QA 3VQXA 3UATA 1N5ZA 4M75D 5ERIA 1U3EM 1S5LC 3PMTA 3TMOA 4A3GJ 2HEOA 3LWIA 2ELJA 4U0WA 2A3SA 1GL5A 2XAGA 3M59A 1USYA 1ZSZC 2KT1A 1NK2P 4FX0A 1HDPA 2RQVA 3GX4X 1Y71A 4UP8A 2O01E 4Y4RA 2VUMJ 3KYLA 4QIWN 1WLPB 3Q3SA 3BQZA 5GAOr 4JYKA 1MH3A 2DU5A 2R5ZB 2OTLI 3SXYA 2E5ZA 4RAYA 5LRSA 2GFUA 2ARUA 1E7OA 2M8EA 3KCCA 1RC9A 2Y48A 1JEGA 3M0RA 4BB7A 1IXCA 2YUQA 3HKSA 2CFOA 1MGQA 3M0SA 1Y0UA 2HQEA 3NEUA 1SRYA 1M90R 1GVJA 1SD4A 5LJ3g 4A3KJ 1EKEA 1RLPC 4RTTA 4YRTA 5L3BA 1SFEA 4A3DJ 3V4GA 2FZKB 3L2VA 4X1VA 2K3PA 3OBWA 4EX5A 5C52B 1QW1A 2QKMB 2K9NA 2D0QB 3A8OB 2OTLQ 3QYEA 1ETQA 1ZA1B 1T56A 2EYZA 1X4PA 2YSQA 2V1QA 3PVQA 2G4CA 1I4K1 3PT9A 3VJPA 1EFNA 2DU7A 2KJCA 4X1EA 2EGCA 1Z7MA 2AKKA 2E1HA 3JRZA 4MDWA 5IXBA 1J5WA 4HDVA 3P8HA 2KIQA 3A5ZB 5CQEA 4PFOA 2OV7A 2NYSA 3LFKA 2LP0A 2IVMA 1ADJA 1PCXA 2L2PA 3M0TA 2BKDN 4E4HA 4AVPA 2F6CA 2ZCEA 1IG7A 4OGCA 2LT1A 2CP5A 2DBBA 2QQ9A 4CH5A 2V6CA 4BI8B 2W24A 4CDGA 1EVLA 3BG5A 3ZMUA 1X55A 1XMKA 5JR3A 3E97A 1Q82C 3REOA 4A0ZA 2CUDA 1WHJA 2X3WD 2EYWA 4AWXB 1DQUA 4OIOF 3KFWX 2HQXA 4HV5A 3HDDA 3GTGJ 2K5LA 2PMFA 1RESA 1NK3P 3BJAA 2EV5A 4XLHA 1RKWA 4IUPA 2MW8A 1O7FA 2FA5A 4UVCA 3B73A 1YYVA 3GZ5A 2NVXJ 3IH4A 1I0CA 4LUDA 4IVNA 4C2UA 1FYLA 3BJUA 2A6EF 3RZOJ 1TWAJ 1YWPA 4M3FA 4DIQA 1A04A 5J1UA 3CCET 1M9SA 2DA9A 1W36D 5EYRA 4R79A 1KU2A 5L8RE 1H8AC 3F3XA 3L2CA 3BE3A 2M16A 4HCBA 1M1KU 4JJDA 2DJQA 2DTRA 1U9NA 3CTAA 2HSEB 3WG9A 1PDNC 2GXBA 2EPFA 4KN4X 4RTZA 5LRRA 3G1ZA 1MGTA 3NHNA 2PNIA 1H3HA 4J15A 2JT4A 4LITA 3M57A 1RUWA 4A4KA 1CF7A 4OMFB 5EZGA 1IDZA 3QZ5B 4HNVA 2L01A 1K83J 4Q47A 1BC7C 1QKXA 1HC7A 1IRGA 1JGSA 2JA7J 5IT9K 4J6XA 3OIQA 4RS8A 1AHDP 4P55A 4FSXA 4ORZA 1M1KC 4IZZA 4EPCA 2MBFA 4OMPA 2ZXIA 2JA2A 5GAOn 1VYVA 1K6YA 3CBOA 2HQAA 2ZT7A 1T95A 1UGSB 2XHCA 2ETHA 2VLAA 3JSCA 2IA1A 2HYFA 1QHGA 2RQRA 2H8RA 7AT1B 3H9JA 4XM3A 2XDBA 4Y28E 3H8ZA 3IKLA 2QSGX 3SEZA 4LDYA 2GGRA 3CXCS 1R7JA 2NNYA 3CLQA 5K5RA 2KDZA 1R6RA 3K2ZA 4JOMA 1V5GA 4Y7NJ 1W5SA 2DO3A 1U0JA 1YJNT 4OB0B 2V7FA 4BUPA 1YIJA 3FXJA 5FLXZ 1BYMA 2G0EA 2L0KA 2BYVE 4XTXA 1DPUA 4RQEA 1PD0A 1XGOA 3KUFA 1X69A 3HXWA 1YITQ 4MFDA 3BLYA 2LQNA 1AWCA 4JZ4A 3C2HA 2VC0A 1GVDA 3OS0A 4C92B 3CCEI 4F04B 3HPGA 3HUGB 2EAYA 2IGMA 3GVAA 2WC2A 1J09A 2V1NA 1GCQA 3FEOA 2MYSA 1X2NA 2L8DA 4HV6A 4LMYA 4EMSA 2ZMEB 4LK0F 2QHVA 3QZ9B 2L0AA 4YRNA 2LY9A 4X5OA 1OJLA 4ETSA 3BPVA 5GAN5 3OV8A 4HT9A 1EF4A 3F8FA 1NTCA 2AS5F 4ZGDB 1MBKA 1TU0B 2KEAA 3HEFA 3DBHB 3OOUA 4BY1J 4G7ZF 5IN1A 1XCVA 1W1FA 1IZ6A 3OYKA 4QSHA 2EV0A 2RJDA 1WKMA 1G6NA 1HDDC 3BTLA 2RK1A 2P4TA 2BY1A 1T3SA 3ZBDA 4JJCA 2JVHA 4PUSA 5LJ3d 9ATCB 3CCEQ 1LNXA 5F64A 3P8DA 2DLPA 2ZMEC 2DA5A 2C06A 4N4NB 2C7IA 1JJ2P 4ANJA 5F1RA 1K6OA 3RGLA 3ZQQA 4VUBA 3CBPA 2EIMH 1TQMA 4XONA 1YFHA 2ACJA 3INZA 1X2HA 2L2OA 2X9HA 1ZBJA 3R6OA 3SQNA 2K5FA 1PP8F 4M75G 4CHUA 5B1BH 1YRNA 2FZCB 3HOSA 3S1RJ 2UUZA 1H641 2HOAA 4LIUA 5GANg 3VOEA 2A37A 3SZPA 4QVZA 2XICA 5B1AH 1TQIA 1D1CA 1FP2A 3MEAA 1ETWA 3CC4T 1N77A 1TLHB 2R3SA 4H2XB 1QBJA 1YJNI 2R0QC 3AL0B 1HW2A 4KA4A 1D3BB 4F7UA 4B8XA 2EV6A 4Q6GA 2JWTA 3FJPA 2K40A 4LN2A 1G4DA 3GTOJ 1PD1A 1T3LA 1KONA 4NC6A 1V76A 2KZVA 3OYHA 1ENHA 1USTA 1WZ2A 2EK5A 1F9NA 4R56A 2WAEA 4N4GA 3KX2A 3IQLA 3K6GA 3AG2H 2NOGA 3J81K 1F5TA 2CH0A 2L9VA 4YRPA 5LGUA 2OX7A 1NM7A 3G4SA 3UA6A 2KROA 3WTYC 3KBGA 1M30A 4KUMA 4D0PA 1YJNQ 1VUBA 1ZRCA 4AG2C 3G6EA 3KZYA 3MF2A 2DJIA 2VJ4A 3ISPA 4YRRA 5CIUA 1QF6A 4OMQA 5GTIC 4EJVA 4B3XA 4RMOA 1G8XA 4DEYA 2ZZEA 2FBKA 2GNCA 2JUFA 2L5QA 5CQGA 3U23A 4BD3A 3J80E 3HFZB 1BJZA 1YFTA 2ESNA 2V9KA 1C0MA 1QU3A 2DD5A 5JI6A 5J1YA 2NNNA 3GMEA 3RKYA 4LLGF 1X2MA 1YIOA 3NARA 3CQZJ 1MBEA 2PX9A 4S05A 1RI0A 3LSMA 4N9HA 4M77A 1SHGA 4D5FA 3R0AA 3VPRA 2KQRA 1WJQA 3OWTA 3KP2A 3MWMA 4K2EA 4J9BA 4NL2A 3RNJA 2E7WA 3GWZA 2OUMA 5JLWA 2W25A 3P9IA 5J6XA 2LMDA 4KT0E 1VF9A 3HBLA 1M1GA 3KZIC 3HP9A 4FYVB 1UFFA 4UXNA 2E6NA 4KICA 1H0MA 3M53A 3CC4I 4I99C 3PGGA 2WTEA 2RI2A 2VB6A 1SANA 2Y9YA 1KC8C 4MZPA 1KK7A 2ZCWA 1VQ8A 3CCLQ 1K4US 1TWCJ 4WJ4A 2LH9A 2E19A 1WJ5A 2EKOA 1YO5C 3LA7A 3M4GA 3JCMP 3LOCA 2DRKA 2P6TA 2F5VA 4CUGA 3QO3A 2E5AA 2GA1A 2KBTA 3P7NA 2JQ7A 3CP8A 1V1CA 1KMNA 1RADB 4KR3A 1GV5A 2QDLA 2I2LA 1B7TA 1V5FA 2G3RA 1MNDA 1TW3A 3CC4Q 5C6SA 5LL6S 4IRGA 2BZYA 3RMSA 4F14A 3HOUJ 3F21A 1N8RU 1LNWA 1TZLA 2Z99A 2DIGA 3JCMJ 4IIMA 3TDUC 2KKOA 2ZIOA 3A7RA 3X20B 2MF2A 2RHIA 1MHNA 2EFIA 1UGRB 3JCUC 2Z0WA 1G3WA 1X3ZB 4WXCA 5HLIA 5DCFA 2Y90A 1Q86C 3F8CA 3GTJJ 4HF2A 1H8KA 2XVCA 1B34B 1TH7A 1D5VA 3CD6A 5KYXB 4BACA 3FZVA 1BBUA 3L9FA 2DDBA 2O6GE 5KYUA 3K70C 1Q82R 4KMFA 2BZXA 1VYTA 3SWNB 2M34A 4HF1A 1P4WA 1ASYA 4MIMA 3TP0A 1LQ1A 4YRKA 3RSNA 1ZUYA 1FEXA 2RHZA 1DJ7B 1B8AA 2I4LA 2DA4A 4IHVA 3ROUA 4J19A 4HQEA 5GADJ 4OMYA 2K02A 3HXXA 4M78A 4WCGA 3BG7A 4P3PA 3P9KA 4M7AC 4M6XA 3OQ5A 4M9ZA 2NS6A 2KR3A 4Q15A 1JJCB 1OI1A 2ZTGA 3NPFA 4C92F 3DWLE 2YXYA 2KXCA 5CKDA 2LX9A 1LVAA 1HC8A 4J9CA 5LEKA 2JUGA 4ELZC 5DM7F