4HA8A

Structure of staphylococcus aureus biotin protein ligase in complex with biotin acetylene
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
molecule tags Ligase
source organism Staphylococcus aureus
publication title Structure of Staphylococcus aureus biotin protein ligase in complex with biotin acetylene
rcsb
total genus 100
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ha8A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ha8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4ha8A02
1H4QA 1CF7A 5GAMh 2ZT5A 4KNYA 3JW4A 1FYLA 2EL9A 2RGVA 1ZRCA 3HSEA 5L3EA 2EK5A 1QZYA 3PGGA 4FHTA 1SFXA 4YIFA 2RNJA 2JN0A 3NENA 1SMTA 5E18F 3HFZB 4C92F 4UP9A 4CGZA 5DEQA 2ZXFA 2DU5A 2Q0OA 2Q2EA 2DTIA 3BP8A 1NJ5A 2X0LA 4O6JA 3MEXA 4OU0A 4PJOD 2O03A 1FSEA 2WTEA 2L4MA 3HYIA 3QU3A 1H641 1B59A 2IA1A 5GANf 2K02A 3QO3A 3KP3A 3CMQA 2ZTGA 3Q9SA 4O5VA 3NETA 4TV7A 1B8AA 2IVMA 4HLXA 5LJ5e 3EYIA 2ZCEA 3LSQA 1L0OC 3A7RA 4XU3A 1DUXC 2QUFA 1LVAA 4XTWA 3CO6C 3NQOA 5GAOr 3WTYC 3LWFA 1WQWA 4M7AG 3T5XA 4YDQA 2VN2A 1ZG5A 1F5TA 2DFIA 1HK9A 1S6LA 1HTTA 5LJ3e 4X5OA 1HW5A 5K5QA 3QSUA 1ONVA 5CJ9A 5FFZA 1XGSA 2XKPA 3AHUA 2L02A 2RHSA 3GFIA 2G7HA 1TW2A 5H20A 2OQGA 3BFMA 2I4OA 4I01A 4MTEA 1ADYA 2YX4A 1YW8A 3VB2A 4R8HA 1Z1DA 3ZMTA 2XVCA 1V4RA 2ESHA 4RQEA 2PQ8A 1O3TA 2PN6A 2HOEA 2E1CA 3HHHA 3KLNA 3QAHA 3P8YA 5CVUA 1DP7P 1LJOA 2QM3A 5J8FA 3UH0A 2V9VA 1MZBA 4M78F 1W5SA 1LYLA 4FX4A 4JQFA 4U88A 3K9TA 1YW7A 2I4LA 3IG2A 1S8NA 3IC7A 3H3UA 2ZO4A 1LNWA 4KMFA 3HUGA 3L7WA 1ZLJA 1I81A 2XAHA 2EJFA 1H4VB 4U0YA 3QPTA 4Z2YA 2D45A 1MDMA 1YO5C 4PJOC 4RGSA 4KIGA 2E7WA 1TQIA 3VU3C 1XCBA 1FSHA 5A2QK 1B9MA 2HGCA 3MZYA 3LAJA 4RB0A 1FP1D 1ZARA 4WXDA 2NNYA 4I09A 3B73A 2M1BA 3HOTA 2QTXA 4YFXF 2F5DA 1IXRC 3I59B 3RI4A 3BJAA 4J6XA 3TGNA 2HDCA 2P5VA 2OD5A 3EUHA 4HDUA 1OR7A 1NJ8A 4UV9A 5GMKm 3JCMW 2DXUA 1PDNC 3MWMA 1JE8A 2ZKZA 2YLCA 3E5XA 5D6EA 4H2XB 4BYYA 5D5VB 1UCRA 4CHUA 2AXLA 1MJAA 4Q4ZF 2XAFA 4M77E 1L0WA 1GXQA 2JZYA 5LJ3g 4LNSA 1RI7A 2K7LA 4P74C 1LDJA 2FF4A 4EO4A 4KFCA 2KRFA 3SFZA 4H02A 2DU7A 5KVRA 3F8FA 4E70A 4NOYA 4YPFA 2RDPA 4DQ2A 3IKVA 4U0WA 1U5TC 4M77F 2FBKA 3F6OA 4YRGA 4ENNA 3TKYA 2MC3A 4HQMA 4EX5A 5CVIA 2VC1A 4P96A 4TVWA 4P73A 4A53A 4M75D 4WF2A 3JCMX 4HZFA 5BPIA 2EFPA 1ASYA 3REOA 2CFXA 3TQNA 4M9SA 5BMZA 3M8EA 5ICCA 3JCMg 2JTVA 3ZMUA 5HLGA 4A0ZA 3HY0A 4Q47A 3F21A 1IW7F 3ZPLA 3DV8A 1TNTA 4EV0A 2P4WA 4Q6GA 1EFWA 2I2LA 4M7DG 4YREA 3HRKA 3OV8A 3REXA 3JAMK 1IZ1A 5F5WA 3IALA 3SB2A 1U3EM 4L9VA 3EFSA 2IA2A 1I1SA 2NS0A 4OIPF 1R58A 5ERIA 3VEPA 2YHTA 4P72A 1G5IA 2VXZA 2ZINA 5DY9A 2E3CA 4KN7X 1DDNA 3PQJA 5FFXA 2OZUA 1G6NA 1K78B 1BI2A 1X54A 2IP2A 2KIUA 3HFVA 4H2SA 3MF2A 2MLKA 3ZN1A 1KQ2A 5LRRA 5E3IA 2R3SA 2DBBA 2ADUA 3WGHA 2QLZA 5K1PA 3WTTC 2FQ3A 4WXCA 2RVCA 1E17A 3BJ6A 4P71A 5BOXA 4ESJA 1J2XA 3LAPA 3GIBA 4M7AD 2JRTA 3LQQA 5GANj 3F3XA 4QVCA 5LRSA 4M75G 2QBYB 4RS8A 3TOBA 1BBUA 5HVQC 1I27A 5E1WA 3CTAA 4JRKA 4K87A 5F6FA 1DPUA 5LEKA 4HWTA 2LDUA 1RIOH 4KIFA 1T98A 4UP8A 2DI3A 4F7ZA 2ISZA 3RGLA 1F9NA 3NEUA 2VBYA 3E9IA 2DQ3A 3DEUA 4RB1A 3UGTA 2ALYA 3JCMe 3VBBA 4RAZA 2DVEA 4HBLA 2UWMA 4L0ZB 4N0BA 1U5TB 3JCMJ 4C92E 2STTA 3ZMSA 4M6XA 3C7JA 4C92G 3WTSC 3T1BA 2P8TA 1HXDA 3ERRA 4EQQA 2Z9OA 1R00A 4KMUX 2TDXA 5LJ5f 3T0YA 3GZ6A 4MHGA 2WV0A 4ZZDA 3N4MA 2CYYA 2OA4A 1STZA 1BI0A 4KIBA 5DYMA 3PCOB 1HKQA 4J6YA 3IKLA 1KOGA 4M75B 5GAOm 3HFZA 4O3MA 2FU4A 4HWPA 1XCVA 4BH9A 2E7XA 1B34A 1Z7UA 1PYSB 4IJAA 4I7HA 1LQ1A 1K79A 1SD6A 2EJRA 1ULYA 3M9AA 5EEHA 1QZZA 1VQZA 5DD4A 1EOVA 2OQRA 1J5YA 5D6FA 3FXUA 1ZLKA 1P6RA 1BBYA 1D3BA 1SD4A 4OIRF 1EH6A 4M7DA 2LKPA 1HW1A 2CQKA 2VC0A 1B1BA 1ZREA 3VQYA 1I5ZA 4M75C 4M9ZA 2EJ9A 4MQ9F 1YS6A 4LG0B 5FD6A 2DW4A 2VONA 2K27A 2RA2A 3OD1A 1SFEA 5L3BA 4P9UA 4HDVA 2G7UA 3BW1A 2PFBA 3FMSA 4BHCA 2IJLA 1X01A 3JSPA 3MAJA 2RHQB 3F8CA 1G3YA 4Y15A 3COAC 5GMKi 4QWQA 2CGHA 4A12A 4L5IA 3JCMV 4M7DE 1OPCA 3VQXA 1QF6A 4XTYA 1BC8C 3LC0A 2CJ9A 2PMUA 2ISYA 2PJPA 4R1HA 3FHZA 2BBYA 2XIGA 4RQFA 4ENJA 3RDIA 3QO7A 1QNTA 3DP7A 2EV0A 3V7SA 3HRUA 4UVBA 1WQ7A 3JB9F 5H6RA 2P6TA 4LG0A 2DDZA 4H2UA 2QZ8A 4FX0A 5D4SA 2VXFA 5DDGA 1O7LA 5GMKe 2C6YA 2OZ6A 2WWYA 2W24A 4CH4A 4ZTUB 4MTDA 2OU2A 3KCCA 1ON2A 3GVAA 4M77B 4JK1X 2MH9A 4HX8A 4G94A 1MD0A 3CO7C 4PHCA 4C8QE 1GHCA 4Q5SF 4KT5C 3GLXA 4EMHA 4WK8F 1FOKA 1KYZA 2HKOA 1JJCA 1LDDA 4YCVA 2QBYA 5DCMA 3JCMP 2Q5IA 3E97A 1WI9A 2YPRA 4UNOA 4KQEA 4NHJA 4TWAA 2QHVA 3HRTA 5D8LB 2HTSA 2JPCA 4BHBA 3V8LA 2A61A 3A32A 2HYFA 4HT9A 1SRYA 5DCMB 1ZYRF 2AMCA 1KQ9A 2E64A 1H4SA 3L4GA 1ZHFA 4IRHA 3I4PA 3KP2A 1OYIA 1YFRA 5CLSA 3J7AO 1B7YA 4CS3A 2CJBA 3DFGA 3K69A 1JRIA 4IPAA 4P3NA 3W6JB 3UGQA 5J6XA 5GAN4 4M77C 4A6DA 4OLFA 1LNXA 1LOJA 3GUDA 1FPQA 4M7AF 3HY1A 2JSCA 3ULQB 3HSRA 1QGPA 1IN4A 4EM2A 1U2WA 1HC7A 3HRMA 2ZJ2A 1ZG3A 3QU6A 5ILUA 3RESA 1B70A 3BDUA 4F7UA 3HRSA 3CJNA 2GXBA 4OMZA 2HZTA 2BGCA 4YRCA 2EA2A 3L9FA 3P9CA 1W4MA 3A7AA 3RTRA 1G5HA 5ED4A 1B6AA 4NB5A 3HXVA 3WU1B 3PCOA 2DQRA 4AVPA 3F23A 5CYVA 2XUBA 4M78A 1Z91A 4YRJA 2DZCA 3GXOA 4R79A 4HF2A 2IA0A 3WGIA 1T38A 1QBJA 2Q7GA 4YRFA 1C0WA 2CIMA 2W84A 2GZWA 4LLNA 2ZIMA 1PYSA 3U9GA 2XAJA 4ENKA 1EIYA 4YG2F 5KNNA 4KYWA 2RB6A 2P5KA 2VT3A 3JB9J 4M78G 1M5Q1 1NHAA 2DO7A 3IWZA 3TO6A 3BDDA 3L09A 4YRPA 1XDUA 4P71C 4AD9A 4HT8A 3VQWA 3IWFA 4A6EA 4L5JA 4GXOA 1EVLA 1X3UA 1D3BB 2Y90A 4M7AB 4YFKF 4H0EA 4I02A 5FGMA 1OYWA 3F8NA 1RUNA 3RJPA 2R7FA 4UVAA 4RB2C 4N0AA 4CDGA 4AIKA 2ZNJA 5J8CA 4G8XA 4LGWA 4EMKA 4BW9A 4YRIA 2RKHA 1KMMA 1J75A 1NJ1A 1MJ9A 2C8MA 5CVRA 1R5GA 4Y13A 2NRAC 2GA2A 4XEMA 4CO8A 3MZHA 2YU3A 4B8XA 2CJAA 4M77D 4OP0A 1I1GA 3ICAA 2VXEA 3W3SA 3Q9VA 1YYVA 1I6XA 1FZPB 4CH3A 2XTIA 1TBXA 3HSFA 5K1XA 1Q1HA 3M4QA 2XASA 3SXYA 3DSQA 1WYDA 2W57A 4MNUA 5ELNA 1SETA 2YSRA 3GW2A 4M7AC 1S7OA 1RZ4A 5ILSA 3R4KA 3WTXC 4GYIA 1FP2A 3J81K 5GMKh 4Y17A 4K88A 2HS5A 3I58A 4A2UA 5GANg 1YGBA 3FZVA 3KEQA 3W6KB 3GO5A 4XLNF 3M1EA 2W25A 2LNBA 4RGUA 3TEGA 4IVNA 4RGRA 4HLYA 3L4GB 2F5FA 3HXUA 1D8JA 3FXQA 4ETSA 1YCYA 3MEYA 4KR2A 3WU0A 3B02A 4A0XA 3NRVA 3L00A 2ZT8A 2M30A 4YRRA 2GIVA 5DCFA 1O3RA 1SERA 2V1DA 1MDMB 4KR3A 2DK8A 5JFRA 4CICA 1WWXA 2Q7EA 1XGNA 5GAOn 3GYHX 3GFLA 2QENA 1R1VA 1Z7NA 3BY6A 4O2DA 3GF2A 3LA2A 4RCBA 2VE8A 3P8VA 3WQZA 3RL6A 3RACA 2RHSB 5GAOp 4L9JA 3JCMc 2QHUA 2RC4A 1O3QA 3HTZA 2NYXA 4G7ZF 3KFUA 2M5WA 4HYEA 2H94A 1FYMA 4M78C 4P75C 3RYPA 3JAMZ 1GVJA 1Z6RA 5IT9K 4M78D 1B34B 5C52B 5LJ5h 1Y96B 1N9SA 5LBQA 2DAOA 4S04A 1V3FA 2V1UA 3P7NA 3VFZA 5LJ3f 4M75E 3ZP5A 3CUQB 2ZZEA 1U8RA 4ZTZB 2GWRA 5HOOA 5GAMj 1T39A 4RMFA 1G3WA 1W7PD 1BJAA 1YFSA 2EJGA 4IRIA 2D1VA 5E1XA 3P9IA 2UXXA 4YYEA 4LD5A 3PZCA 3MFKA 1YS7A 2PG4A 2PEXA 3D0SA 2HQRA 5LJ3d 4K2EA 2BV6A 2PMEA 2Z3YA 1HW2A 1XDSA 3R61A 4YRSA 2ZNIA 4K86A 2KJBA 2A07F 1W7PB 3DKWA 1NJ6A 1U1SA 5GANe 3EDPA 3U2RA 2HEOA 5FLXK 4C8QB 3WE3A 5GMKl 1B76A 2O3FA 4J6WA 5CVJA 4M75A 4M73A 3FM3A 3ISPA 5L3CA 2LSOA 3E6BA 3R60A 2DU9A 1H4TA 4IRGA 4HWSA 2PLYA 3KZYA 1IN8A 1F4KA 4BXUA 3QNEA 4P75A 2KJCA 2EV5A 4HQEA 1IRGA 2HTJA 5K5RA 4PJOF 5HLIA 2R7DA 3TO9A 1XGMA 3SZPA 1PP7U 2Y75A 5DUKA 3IL2A 3FB9A 4ZYHA 4C92D 3BWGA 3HFNA 1X56A 3TOAA 1BC7C 4YRKA 4H2TA 3F72A 4N9HA 2H27A 1S29A 5GAN5 1QO0D 1IUYA 1Z6TA 4YIIA 4ASNA 3RKYA 4J15A 2VBZA 4JLIA 4EJWA 4M77A 2MBFA 3QO5A 4EJTA 4F7UF 1WRJA 4P9FA 1TLHB 3UFGA 2STWA 3HIFA 1L3LA 5K1YA 2OAZA 4M6YA 2BE5F 2E10A 5JVTA 4XLPF 1FBUA 3HHGA 3TEHB 1A04A 2E41A 4CXFA 2PMFA 1ZAOA 2ETHA 4HA8A 2Q7HA 3C18A 4F7UG 3JCMd 3H92A 2VOOA 4OOIA 2IRFG 1BIBA 3FF5A 1KYWA 3TDZC 2A68F 1JGSA 3JB9D 1ASZA 4GO1A 3SWNA 4L9NA 2A6HF 4E51A 3V7RA 4ZZLA 2CWEA 5CVVA 4M7DC 3ABTA 1SD7A 4A5MA 3BPVA 3HOSA 2E1NA 1UHMA 3JSOA 2X4HA 3QP6A 2EAYA 1R22A 1D8KA 2GXGA 6PAXA 2XAGA 4DPGA 2CO5A 2XKOA 4H2VA 2L4AA 2IW5A 3FMRA 1X2HA 2ZGWA 1M8VA 5D4RA 5I21A 2E1HA 4YCUA 1EH8A 2O6GE 4TQFA 2HWVA 4XSZF 4YFNF 3SZTA 2GA1A 1B9NA 2FMLA 1FYKA 1WKMA 3WGGA 1WPYA 4L18B 1IN5A 4XU1A 4U7DA 2ARTA 4PJOE 3G3ZA 2DK5A 3JCMb 2HNIA 4GCVA 2FB7A 2A3SA 1J5WA 1SESA 2OBPA 1QQIA 3KFWX 1OKRA 4I2OA 3M7GA 4HX4A 4P72C 5FD5A 3A5YA 1YB3A 5FB2A 2AS5F 4P74A 3JB9G 1Z7MA 4YCWA 4H2XA 4AIHA 1KU7A 1IN6A 2M8EA 1PUEE 2DXTA 3WE2A 4XEOA 5JR3A 3LSSA 3EYYA 4C8QF 3BJUA 2RV8A 1TQPA 2QHSA 5HS8A 1KQ8A 2PMHA 1K7AA 1TNSA 3HXWA 1LDKB 2NAZA 2GQQA 1Z9CA 1KU9A 1UB9A 1XSDA 4BWAA 4D0PA 1ZGAA 1J9IA 5L3GA 3WTVC 4ENMA 2XV4S 4DNCA 4HX7A 4ON0A 3K0LA 1VTNC 2V79A 4H2WA 1ADJA 3GX4X 1KQ1A 3CLOA 1EH7A 4XTVA 1EV7A 1JHHA 4U7BA 1E24A 5L3DA 3E5QA 3HSBA 2DQ0A 2CGPA 3GZ5A 4HAMA 5L3FA 4PCQA 4BHPA 2FNPA 3IKTA 2UZKA 1XN7A 2RQPA 4G7HF 2FXAA 3D5LA 4LB6B 5DUIA 3U1DA 3LFKA 2CW0F 2XGTA 2QWWA 3RF1A 1S3JA 3QOPA 4UP7A 1YIOA 1H0MA 4KA4A 2ZR2A 1T0FA 1HBXG 1SAXA 1FX7A 1XSXA 4HF0A 2FYKA 1IXCA 5ICGA 5LGTA 5E8GA 3ROUA 4L87A 2ZCWA 3TUPA 1BIAA 1I8FA 3PFIA 3SQNA 5JHUA 4UV8A 3TEHA 4EMKB 3KP7A 1X55A 4PZJA 1ZH5A 1G4DA 1JBMA 2A69F 3I5UA 2B0LA 3GFJA 4ZH4F 3ECOA 3E9HA 2Q5HA 4C92B 2FRHA 3E6DA 5GMKj 4IXAA 4Q15A 3Q5FA 4CS4A 4G84A 3K2ZA 5DD8A 3GWZA 2H09A 1WSUA 4HVCA 11ASA 3HTSB 4A5NA 2ZIOA 2JPBA 4H2YA 3C1DA 4YRLA 3N97A 1HSJA 4XU0A 5LJ3h 1XSVA 1YFHA 3FXRA 4GGGA 2ZXJA 4F7UE 4HWRA 5LLQA 4LMYA 3M4GA 3QRFF 1K78A 5D5WB 3DXJF 2J3MA 1BI1A 1FT9A 5BS6A 2MA3A 1NYRA 3DPLC 4M78E 1F1ZA 4LB5A 4J5YA 3I0TA 2P5LC 2DPUA 4WJ4A 3KP4A 2ZMEB 2ARSA 2ZZGA 1P92A 3KETA 1OYYA 1USSA 2H6CA 4NL2A 4C92A 3IHUA 5GAN7 1IXSB 2HFHA 3I53A 3R07A 4NQWA 2LF7A 3F22A 1XMAA 1WNLA 4CH5A 3F8MA 3G73A 4ZYDA 1FBQA 3AAFA 3MCZA 3OOPA 4MMLA 2P0LA 1X2GA 5ELOA 1FYFA 3P9KA 3RUXA 4AIJA 3T8TA 4M75F 5LEJA 5E20A 2I4NA 5F64A 4Q48A 4MEYF 1FNNA 1YW9A 1BN5A 4PJOG 1ZRFA 4BNCA 5GAN8 2EA4A 5GAMe 4LK1F 1IL2A 4UUVA 2D1HA 1O7FA 3QTCA 2AKWA 2ACJA 2WC2A 4A54A 2FSWA 1BBWA 3SHFA 1ZRDA 4B09A 1YG2A 2AMCB 2HQNA 5ICEA 2K57A 1W66A 3FM5A 4ZYEA 4IHSA 4PJOB 1ZGJA 1EIYB 2FOKA 4TVYA 5IT9Z 1AWCA 2VC8A 1QE0A 4UVCA 3E5UA 2P5IA 3BPXA 3QPHA 1U78A 4M74A 3TO7A 3TDUC 4C8QA 4XSXF 3KZZA 5AIQA 4YP0A 4M71A 2XROA 3EETA 4G9YA 5GAMd 4UPAA 5D5UB 1J7KA 2O61A 1TH7A 4M7AE 4FT8A 2RD1A 3V8JA 4YRTA 2PI0A 1QPMA 3ZMVA 4OIQF 2FMYA 1GXPA 5ICFA 2Y0MA 1BOAA 3VOEA 2EB7A 2ODRD 5LHIA 5AIPA 4RDXA 5HS7A 1NNHA 12ASA 1FWZA 4I0AA 3F8BA 5E17F 3O2PE 3BROA 5HGQA 2ARUA 3FJPA 3ZN0A 2MD5A 4EMSA 4JBAA 2XRNA 1OMIA 3KP5A 2J5PA 4EJUA 4WWCA 2KIFA 3E6MA 3EQLF 2YR2A 4G85A 1TQMA 3V8KA 3SWNB 3HXZA 2COMA 4BQAA 1UHWA 3WTZA 3KE2A 4P55A 1USYC 3R0JA 5HDKA 4MQVA 4EM0B 3JCMQ 3LSTA 4N0AC 1CF7B 2KIMA 3MF1A 4P3PA 4A0YA 4EGYA 5HDNA 2QQAA 4WXHA 1G3SA 2L01A 3EFRA 2DTHA 4EVIA 4AWXB 2Z99A 4M9XA 1T6SA 3GFMA 5GANh 5CAIA 4RB3C 4LJZF 1KMNA 3L2ZA 1ODDA 3CDHA 4LLLA 3IRRA 1ZN2A 3LA3A 4HV5A 1R23A 3L2CA 3JTGA 2DEQA 4XTXA 4M7DB 1JXSA 3FMQA 1HSTA 3NEMA 3A5ZA 5LJ3j 4EJVA 3WTUC 4XQ3A 3ZMZA 1HKSA 3JCMf 2C7IA 2VBWA 2LF8A 1ATIA 1IN7A 3M8FA 1KGSA 3HXXA 2XAQA 3INZA 5LHGA 4PDKA 1B7YB 3J81Z 4HV6A 4CYDA 1O57A 4JUVA 4ZIBA 2PBIA 3R6SA 1T2KA 2DJZA 2J5OA 1D5VA 5C51B 3ABUA 1SFUA 1E22A 2BEOA 3ERED 2EWNA 4GYGA 5LGNA 1R1UA 2D2WA 1EVKA 3LA7A 4HF1A 2BYVE 4PG3A 2E5AA 2EFWA 3MQ0A 2QQ9A 1MGQA 1LEBA 4TVAA 3E3VA 1S7AA 2FBHA 2EFQA 4BAYA 4YRQA 4CZZA 2H6BA 2XHKA 1RUOA 1I5LA 3KLOA 3I71A 3L1AA 4WJ3M 4MMKA 3ZQ7A 3I54A 4C92C 1W5TA 2ZZFA 3LQRA 4M77G 4X9CA 1R7JA 1J0RA 2XGXA 1H9GA 4Y91A 3JB9I 4EM1A 4TQDA 3BOQA 4WI1A 1C0AA 1XB4A 2K4BA 3REUA 3E6CC 1XMKA 3K1MA 1H9TA 2ZT7A 5GAMg 4MGRA 5GAOq 3QHSA 1ON1A 1XGOA 5KK1A 4X9DA 1N9WA 2J3LA 5GAN3 4RCCA 4G6DA 2IY5B 2A6EF 4XRFA 4KUMA 3HRIA 3I7FA 4G7OF 1BM9A 1P4WA 2HYGD 5H6QA 4N9IA 3RERA 1JJCB 4TTVA 3DQVC 3DPTA 3RKWA 3F6VA 1KA8A 3A7UA 4OIOF 2ELHA 2Y48A 2V6CA 5LJ5g 4HOBA 2UXNA 1E2XA 4M7DF 2MH2A 2FNAA 1Y0UA 2ALYB 4PNOA 1Y96A 1UFMA 4P5OA 4F7UB 3G1ZA 4XBFA 5GAMf 2F2EA 4L0YB 3KP6A 1FBSA 4KICA 2HR3A 1YFTA 1YTYA 1KQ0A 4I98B 3RYRA 5HS9A 3IKMB 1Z05A 4I0BA 3DF8A 4LFUA 1KU3A 2EFOA 4P3OA 4AH6A 3RPQA 4HWOA 3C3WA 3ML6A 1LJ9A 1USTA 4WCGA 3M4PA 5E1ZB 4OINF 4YROA 4WX9A 1WU7A 1K6OA 1YLFA 1YQAA 4KN4X 3QO8A 3NELA 3JTHA 2NNNA 3J80Z 1KU2A 2A5YB 2F5EA 1G51A 4LLGF 1D3YA 1SD5A 1B70B 2QQBA 2DPDA 4ESBA 3RKXA 2IT0A 1B4AA 2KKOA 2RM4A 3BZ6A 1DPRA 3JCMh 1U1TA 2DLLA 2DTOA 3R0AA 4M7AA 3H3ZA 1MGTA 2RHQA 2MLGA 4XTZA 3O3KA 4UXNA 2DTRA 4S05A 2DZ9A 2VBXA 1R5HA 4C8QG 4U0VA 3A31A 1RIQA 4ESFA 1AOYA 5D8KB 2VOPA 5LJ5j 3V4GA 2K86A 5HDGA 3VQVA 2ZMEA 2JT1A 3BY7A 5C53B 1R1TA 4EMKC 4NCXA 2M45A 1HKTA 4CH6A 2DKGA 2O0YA 1N9RA 1LEAA 4YRNA 1I4K1 4YRMA 3VODA 4KDPA 4PGGA 2I4MA 4EMGA 2QHTA 4TVAB 2L3DA 3QUIA 1WQ2A 4XU2A 4MEXF 2P7VB 2EV6A 2Z33A 3CUOA 2ZNZA 2VT2A 3GEZA 3FX3A 3HFOA 4QVDA 5TJJA 4C8QC 5F1RA 2V1XA 5JI6A 1PP8F 3K1NA 3K1PA 4C8QD 1SMYF 2RN7A 1FC3A 5AONA 4P73C 1U5TA 3FWEA 1R36A 1P2FA 1REPC 2CG4A 2K4JA 3I64A 4IF4A 1FY7A 4L9TA 5K5OA 4RAYA 1CGPA 2ZBKA 1RNLA 1U6GA 1FLIA 3WODF 1IRFA 3HXYA 2FEZA 1E1OA 5GAN6 2ZNYA 4CS2A 2ESNA 5D5XB 3WTWC 5BPDA 1XD7A 2QVOA 2E65A 1TW3A 2QYOA 1LB2A 1NJ2A 5GAN2 3JB9H 2FBIA 1MKMA 3CUQC 4V2SA 1G3TA 3RIRA 2VODA 1E1TA 2O8XA 4JRIA 2VE9A 3HTUA 1W7PA 4M72A 2ZT6A 3WG9A 5FLXZ 3T8RA 4PGHA 2IY5A 3FIFA 5E8IA 3KEOA 2YLBA 3CUQA 2FA5A 3SWNC 4NL3A 4M78B 1WLEA 3PQKA 2GAUA 5DV5A 2G4CA 5A2QZ 4EJOA 2HKXA 5ILVA 5LGUA 1JHFA 3ELKA 1IAWA 2CSOA 3I59A 2L54A 2DQLA 4G6QA 3IRQA 1IF1A 2YX7A 4IHTA 5FO5A 3O6BB 1NYQA 4UHTA 5HLHA 4QLCU 3RPUA 4PJOA 3BJOA 2F5CA 4ZYGA 5LJ5d 2P6SA 4XTUA 4M7DD 2IPQX 5EEGA 2G9WA 3P8TA 4OMYA 2Q8KA 3V7CA 1ZG1A 4EGZA 5TRDA 1P4AA 3QP5A 2P7CB 1P4XA 3ECHA 2ZFWA 1O3SA 2M87A 2ODRC 2Z5UA 2AKWB 5GANd 2DT5A 1BI3A 2EFNA 5BQTA 3A74A 3S2WA 1MJBA 5LHHA 1EQRA 4RGXA 1J59A 3J80K 5IT3A 1USYA 2FE3A 2ZR3A 4HW0A 1TTYA 5GAOl 3ZMDA 2W85A 1GGMA 1HQCA 4LK0F
chains in the Genus database with same CATH superfamily
4BE2A 2SRCA 3CMEQ 1R6RA 4FYVB 2B86A 2JMWA 1AOJA 1KJWA 1H4QA 1CF7A 5GAMh 3H0FA 2ZT5A 5H2FC 5KYXA 3CC2T 4XRSA 3JW4A 1FYLA 4KNYA 2EL9A 2RGVA 1ZRCA 3HSEA 4HT4A 5L3EA 4DBFA 3QBYA 3M4QA 4M3FA 2EK5A 1QZYA 2JUFA 1W0UA 3PGGA 3OYMA 3DPUA 4FHTA 3VUBA 1QWFA 1SFXA 1RESA 4YIFA 1QVFA 3OYKA 2YDLA 2RNJA 2EINH 2JN0A 3NENA 1TWFJ 1SMTA 5E18F 4BUPA 1HA8A 3GP8A 4K11A 3HFZB 5FKNA 4C92F 4XLEA 4JS5A 4CGZA 4A3BJ 2LNHB 5FW9A 4UP9A 5DEQA 4KR2A 2E5QA 2ZXFA 2DU5A 2Q0OA 2Q2EA 2DTIA 3BP8A 3A8MB 2GFUA 6AT1B 1NJ5A 3BZKA 3L2RA 2X0LA 4O6JA 1LE8A 3MEXA 4OU0A 4YTLA 5JVGF 3RPUD 4J19A 3LH0A 5CIUA 2O03A 2CV2A 4PJOD 1FSEA 2WTEA 2QSHX 2ZPGB 2EGAA 2L4MA 4IUPA 3HKZA 3HYIA 3BG5A 3QU3A 1H641 1PHTA 2KRMA 1NYFA 1GRIA 3VV0A 1YJNA 3GLLA 1B59A 2IA1A 1NLPC 2BIVA 3OSFA 5GANf 1OU8A 2CZ7B 4KUDK 2JW4A 2K02A 3QO3A 3KP3A 2MC4A 2VJJA 3CMQA 4G6TB 2ZTGA 4BBSJ 3Q9SA 4O5VA 1HYOA 3NETA 4TV7A 1B8AA 2IVMA 2OF7A 3V42A 2R7OA 4HLXA 2JUCA 3OYGA 1QW1A 5LJ5e 4BB7A 2HOSA 2DF6A 4I99C 3EYIA 2ZCEA 3GTGJ 3LSQA 1L0OC 3A7RA 4XU3A 1DUXC 4UC4A 1W70A 1OEBA 2KROA 2QUFA 1IV8A 1Q7YU 1LVAA 2E3IA 3QPSA 3C4SA 3CO6C 2YRDA 2EIKH 4XTWA 3PNTA 3M53A 3NQOA 4HSRA 2X1DA 2LFBA 3PSFA 4BJ6C 2Y9ZA 2MWOA 3ER0A 5GAOr 3WTYC 3LWFA 1WQWA 1PM3A 5J3LA 3EUKL 4M7AG 1UHSA 4E7SA 4CCNA 2MGQA 3T5XA 1G5VA 4YDQA 2VN2A 1ZG5A 1VZ0A 5GTHC 1F5TA 3C2BA 1B72A 3GTMJ 2DFIA 4KUIA 1UJYA 2EFIA 2NUPA 1HK9A 1RAHB 1T95A 1S6LA 1DU0A 4AFSC 2VXDA 4DGWB 5LJ3e 1NM7A 1HTTA 1D0YA 3CCQA 1YBYA 1VQMA 2DJNA 4XLCA 2A6TA 3VKIA 3I9V2 3OR2C 2O31A 4X5OA 2DFEA 1HW5A 3VYHB 5K5QA 3TMOA 3QSUA 1ONVA 5CJ9A 5FFZA 1XGSA 3DCFA 2XKPA 2XF6A 3MD2A 4FE7A 4OMQA 1Q86R 5J1YA 2L02A 3AHUA 2RHSA 3I55Q 3GFIA 5KNLA 2G7HA 1TW2A 5H20A 4A3MJ 2OQGA 1RR8C 1S9HA 1H8AC 3BFMA 4IURA 5AYFA 2I4OA 4I01A 4MTEA 1UEBA 1UUEA 4OB3B 5E3MA 1ADYA 2YX4A 3DEWA 2VWFA 1M2OA 1YW8A 2JNGA 3VB2A 3A4CA 4ORZA 5DM7F 4R8HA 1Z1DA 3PFYA 1PYVA 2I10A 4HVWA 3ZMTA 2XVCA 1V4RA 4DBHA 1H3ZA 2LYCA 2ESHA 4RQEA 2FZCB 5IP9J 1ERDA 1VA7A 4PFZA 2PQ8A 1O3TA 3BG9A 1H92A 2PN6A 2ECZA 2BZ8A 2HOEA 1QHGA 1TC3C 2E1CA 3HHHA 4JZ3A 4PJLA 3KLNA 3QAHA 3MP8A 5CVUA 1DP7P 1T8IA 1PUFA 1EX4A 1LJOA 2QM3A 5J8FA 3P8YA 4E7JA 3UH0A 2CW7A 1FOXA 2V9VA 3OWTA 4XLAA 3H3VK 1D0ZA 4AFZC 1RAIB 3HL2A 3A1PA 1MZBA 4BBRJ 2HQAA 1OV3A 2K5IA 2DBMA 4M78F 2F4MB 1OQKA 1OU9A 4NS5A 1W5SA 4X1VA 1WHGA 5GAEJ 3GPLA 4HEA2 1HC8A 5D7UA 1S72T 3OIOA 1Q7YR 4FX4A 1LYLA 1IHWA 4JQFA 4U88A 1O75A 3K9TA 3OSGA 1YW7A 2I4LA 3IG2A 2EQJA 1S8NA 2LT4A 2DOEA 5F1JA 3PO3J 4KGZB 3S17J 3IC7A 3H3UA 3CCST 2ZO4A 1LNWA 5FKMA 1AWXA 2WACA 4XQFA 4KMFA 1M3CA 3HUGA 1SANA 3L7WA 1NEBA 1ZLJA 1I81A 2A37A 4QT7A 2L7ZA 2XAHA 2EJFA 2XAUA 1H4VB 3SDZA 4D7MA 3EH1A 4GDFA 1NJIR 1UG1A 4U0YA 1M3BA 1ZUUA 2XPVA 4DEXA 1WJCA 3QPTA 1WJEA 4Z2YA 2D45A 2YUSA 1MDMA 1YO5C 4PJOC 1K0SA 2COYA 4RGSA 2FVUA 4KIGA 3BQYA 5IYBJ 2FL7A 2E7WA 1TQIA 3VU3C 2NVXJ 1WJ5A 1XCBA 5A2QK 1FSHA 1B9MA 4HSTA 3S1MJ 2HGCA 1MHNA 4DEYA 3MZYA 3LAJA 2KBTA 2QTVA 3OYBA 4RB0A 1FP1D 1ZARA 4WXDA 2NNYA 1IO6A 2COZA 4I09A 3CC7I 2M9HA 3B73A 3QODA 3ZQCA 2M1BA 3HOTA 2NXNB 3A03A 4MIMA 4YEJA 2QTXA 4B48A 4YFXF 2F5DA 1IXRC 3I59B 3OYDA 3CCEA 3RI4A 4DIQA 2H8WA 3BJAA 3VPRA 4J6XA 3TGNA 3CJRB 5M3MJ 2BY0A 3BG6A 3GTLJ 2HDCA 3PMIA 2P5VA 3OMYA 2H3EB 2OD5A 3RQIA 3EUHA 4HDUA 1OR7A 3HC7A 3EG1A 3LSMA 3FRNA 4UV9A 5GMKm 1IO2A 1NJ8A 3JCMW 4B6MA 2WAQA 2K3PA 3A2KA 2DXUA 1Q82R 1VQPI 4HNVA 1PDNC 1OCCH 3MWMA 1JE8A 4D5CA 2ZKZA 2FZKB 1WZ2A 3S14J 2PVDB 3HPGA 2YLCA 3E5XA 3CC4T 5D6EA 4H2XB 4BYYA 3CCRQ 4N4HA 5D5VB 1UCRA 3G4SI 2DYRH 3QQAA 4PUSA 4CHUA 2AXLA 4XL9A 2ZZDA 2DDBA 3CCLI 4B43A 3PIOA 1MJAA 4Q4ZF 1OJLA 1TXQA 1MNDA 2K40A 2XAFA 2ME6A 3MHXA 4M77E 1YHQQ 3IH2A 1L0WA 1GXQA 2JZYA 1OCTC 5LJ3g 4LNSA 3OIQA 3NHNA 4Y4RA 2L7FP 2RO0A 3CCSA 1RI7A 2K7LA 1RAGB 4P74C 1ETQA 1LDJA 2VYTA 2L7KA 3M0TA 1QVGS 2FF4A 2NWMA 4EO4A 4PKCC 1Q86U 1M1GA 1BCMA 4KFCA 1KD1U 2KRFA 4DOVA 1BKBA 5IT9E 3SFZA 4H02A 3JRAA 2B8AA 1PRLC 2CZ1B 2D0NA 4J9CA 2P81A 3MEWA 5KVRA 1YITA 2DU7A 2BZTA 3F8FA 4E70A 4NOYA 4YPFA 3J7ZI 1XS9A 2RDPA 1UG2A 4II3A 4DQ2A 3IKVA 3M3YJ 4U0WA 1U5TC 3ASKA 4M77F 4CC4B 2J06A 2MIOA 2FBKA 1XNIA 4E47A 3F6OA 5HODA 3I56Q 2DPPB 4YRGA 4AUXA 2WBMA 5HNFA 4ENNA 1IG7A 2E2HJ 3TKYA 2MC3A 3J81E 4HQMA 4II1A 4EX5A 5CVIA 3EG9A 1A0NB 2HZDA 1R77A 2VC1A 4P96A 1ZA2B 4TVWA 3CCUI 1O9SA 4P73A 5GP9A 4CCOA 2XD0A 5EG2A 3G71Q 4XOPA 3CCQI 2EYWA 4A53A 1VQMI 4M75D 4WF2A 5J39A 2X1EA 2CKKA 4P1WA 1CSKA 4JRPA 1K8AU 5F0CA 3JCMX 4HZFA 3LSRA 5BPIA 1UECA 2GTJA 3I55A 2KE9A 3SHWA 1YHQA 1EKEA 2EFPA 1RL2A 2FD5A 3C95A 2WAQN 3REOA 1ASYA 1YI2A 2MWPA 3ABMH 2CFXA 3M57A 5CKEA 3H36A 1WJFA 3M54A 4J9DA 3EPZA 3TQNA 4M9SA 5BMZA 3M8EA 4KT0E 5ICCA 1RPWA 2CH0A 3LSHA 4JX6A 1RACB 1LE8B 3JCMg 2JTVA 1N78A 1V76A 3H41A 2EKHA 2CJJA 5A0DA 4BI3A 4JRQA 1YJ9Q 3ZMUA 5HLGA 1YRNA 4A0ZA 3SEQA 4BEHA 3FLGA 3HY0A 1WHUA 3FK7A 4UPAA 4Q47A 3F21A 1NK2P 1IW7F 3ZPLA 3HL8A 2A5WA 3DV8A 1TNTA 2R7XA 4EV0A 2CUJA 3K4JA 5KYWA 1GFDA 1QVTA 2P4WA 4Q6GA 1EFWA 3BTLA 2I2LA 4M7DG 4YREA 3LSPA 1KC8R 3HRKA 3OV8A 3REXA 1X27A 3JAMK 1IZ1A 2KPMA 1UG0A 5F5WA 4QW2A 2JA2A 2LBFB 2FOWA 2HI3A 3GTQJ 2ATCB 3IALA 1ABQA 2GM4A 2IGOA 4IHWA 2FJ1A 3SB2A 3Q0UA 4E7ZA 4L9VA 5CQGA 3UR3C 4DBRA 1U3EM 3EFSA 2LRQA 1T0FC 2IA2A 1I1SA 1M3AA 4BS9A 2NS0A 4OIPF 3S1RJ 3HPWA 1R58A 5ERIA 3VEPA 2J6KA 2YHTA 1Q82U 1G5IA 4P72A 2VXZA 1R5ID 1I0CA 1ZSZA 2ZINA 5DY9A 2OTJT 2PJRB 2E3CA 1JXOA 4KN7X 4ABZA 2NS7A 1DDNA 2BW3A 3PQJA 1Y0MA 5J1RA 1YWPA 4XTVA 1YJWA 5I11A 5FFXA 2OZUA 1Z0XA 1TUCA 1G6NA 3PVLA 2EQUA 1K78B 2J6FA 1BI2A 1X54A 1P9QC 2IP2A 3G71T 2WADA 5C6SA 4Q5WA 1OI1A 2EILH 3CXCA 1QVGP 2VKDA 1VQ5Q 4L87A 2KIUA 3JRFA 1Z9QA 4FSSA 3HFVA 5B66C 1Y71A 3MF2A 4H2SA 3X20B 5JLXA 2ZR2A 2VJ4A 1FOYA 2MLKA 2ZSIB 5LRRA 3ZN1A 1K4TA 4IIMA 1KQ2A 5E3IA 2R3SA 3BR2A 2DBBA 1JJ2P 3LMMA 3OBYA 3LL7A 2OTLT 2ADUA 3M0PA 4NBQA 3WGHA 2RQUA 2QLZA 2V26A 2JS2A 5K1PA 3VDXA 3WTTC 3FC3A 2FQ3A 2R7RA 2E5ZA 5HKCA 1XTAA 4XN0A 3ZQFA 2XRLA 2JA6J 2KYBA 1N8RC 4WXCA 2JM9A 2NVTJ 1NJIU 3TEEA 2FPEA 1VYTA 2RVCA 1E17A 3BJ6A 4C2MJ 4OWRB 5FLMJ 2HVQA 4P71A 5BOXA 4M3GA 1J2XA 3LAPA 2XGDA 4ESJA 5IN1A 5KYNA 3GIBA 5KAIC 1A6IA 2JRTA 4FETA 4AFQC 4KULA 3LQQA 1OZ2A 2XK0A 3FJ5A 2LY2A 1OPKA 1X6BA 5GANj 3F3XA 1ZR4A 5LRSA 2OCCH 3J7AY 4QVCA 4M75G 2QBYB 4RM3A 2QEXI 4RS8A 4ZC3A 3TOBA 2PNIA 3CCJA 1BBUA 1MSFC 5HVQC 2LJ0A 1I27A 3A0BC 4KH1B 1GCQA 2QHUA 5E1WA 2ZMEC 3CTAA 4JRKA 4FT2A 5FU6C 3CCJT 4K87A 2CW8A 2DT6A 5F6FA 1DPUA 5LEKA 3LGLA 4XRMA 2KMUA 3H35A 4CCJA 4HWTA 5FLXE 3OYAA 3CMAI 3CCSI 2LDUA 2M8GX 2XI9A 4HCBA 2R5AA 4C5GA 2LTPA 1BOBA 3PL8A 4BJ5C 1RIOH 2LX7A 4KIFA 1XJWB 1YJ9T 2O88A 2QA4A 2QEXA 1G51A 1T98A 1YOVB 1QA6A 4UP8A 1FEXA 2DI3A 3L1PA 2PUKB 4F7ZA 1X1PA 4LXCA 2ISZA 2MFZA 3G7ZA 3VS5A 4RLQA 3RGLA 1F9NA 3NEUA 2VBYA 2M3AA 4DW6A 3E9IA 1DQUA 5GJVB 1IZ6A 2CUFA 2YT6A 3OMGA 1JTYA 4XK8E 5I2SA 4UUSA 3DEUA 2DQ3A 4RB1A 3CCYA 3UGTA 2ALYA 2W7NA 3JCMe 3VBBA 4RAZA 2DVEA 4HBLA 2UWMA 4L0ZB 4N0BA 1U5TB 3JCMJ 2RJDA 4C92E 3PT9A 4XKWA 3G6ET 2STTA 2X4YA 4OMNA 4ZN1A 3CCET 3ZMSA 3F70A 1VQNT 1F43A 1QVFS 3M07A 2QASA 1WYXA 3CPWP 4M6XA 2B63J 3C7JA 4C92G 3WTSC 3T1BA 2P8TA 1HXDA 2OTJQ 1UZCA 3ERRA 2G0EA 1TWBA 3KXTA 4EQQA 3M8JA 3CCQT 2DXIA 2Z9OA 1R00A 2O9LA 4KMUX 2KDOA 2TDXA 2EQIA 5LJ5f 3T0YA 3OW2P 4F92B 2EGEA 4E4HA 4MHGA 2V7FA 3BR3A 3GZ6A 2WV0A 1M1KC 1SVOA 4ZZDA 3N4MA 3TQ7P 2CYYA 3NFCA 1VQ6T 1VQPT 2OA4A 1STZA 4JX4A 1BI0A 2ICWG 4KIBA 3OYCA 1SHGA 3CDLA 1R9TJ 5DYMA 4JX5A 2MYSA 3DTEA 3AL0B 5J26A 3PCOB 1HKQA 1E0EA 5IXFA 4PSWA 1K0XA 4X0GA 1M90C 4J6YA 3VS1A 3IKLA 1KOGA 4D7NA 2YSQA 4M75B 5GAOm 3HFZA 2M9UA 1FIAA 1VQ7T 1R8OB 4O3MA 2FU4A 3OL4A 4HWPA 4C3IJ 5EGOA 1ITYA 2LQNA 1XCVA 4BH9A 2L9VA 2MG4A 2E7XA 4I6ZA 1Z7UA 1B34A 2DL8A 2H1LA 3CD6I 1PYSB 2JM8A 4IJAA 4I7HA 1LQ1A 1K79A 5CKTA 2I0NA 3EFOB 3SFMA 2IPOB 4EMHA 5CKDA 1SD6A 1S72Q 2EJRA 1ULYA 2DDAA 3M9AA 3ZOBA 4ZDLA 2GFAA 5EEHA 1QZZA 1VQZA 5LFAA 5DD4A 5F0HA 1EOVA 2OQRA 1J5YA 2AHQA 1MIJA 2LVSA 3FXUA 5D6FA 1M2VA 3Q1JA 1ZLKA 1P6RA 2HNHA 5A0GA 1BBYA 3CXCP 3ABLH 5HNHA 5LD2C 1D3BA 2KR3A 1SD4A 4OIRF 1EH6A 2DMOA 4B9WA 1YIJQ 3CCEQ 1GLNA 2LKPA 4M7DA 4JYKA 1HW1A 2CQKA 3K2AA 2VC0A 1B1BA 5IY5H 1ZREA 2DXCA 4KISA 3VQYA 3I3LA 3RQ4A 2DBKA 2LDMA 2IS2A 2P0QA 1NPPA 1I5ZA 1JB0E 2X9HA 1GBRA 2NVQJ 2MOXA 2DMPA 3ASNH 4M75C 4M9ZA 2EJ9A 4MQ9F 3OY9A 1YS6A 1RABB 4Y92A 2P0PA 1UAAA 1I3QJ 3CF5F 4LG0B 3M0UA 1OULA 4LD6A 5FD6A 2G3RA 1NYQA 4A3KJ 2A7YA 2DW4A 1VQ7I 5F08A 2DL7A 2VONA 2K27A 3K4KA 1RR7A 1SFEA 2RA2A 5L3BA 4P9UA 4J9HA 3OD1A 3WVEB 4HDVA 3QDRB 4EPCA 2BZYA 3G4SA 2G7UA 4DYCA 3NARA 5FKKA 3BW1A 1Y07A 1C0MA 2Y30A 4ESRA 8ATCB 3CCLA 1R4NB 2PFBA 1T3LA 1TZLA 3JRGA 2R0QC 1K9MU 3FMSA 4BHCA 1IDZA 2IJLA 2K9MA 1X01A 2GCXA 3JSPA 3MAJA 2RHQB 1N5ZA 3F8CA 1G3YA 2DERA 2DFHA 1YJWQ 5GJWB 2JMAA 5J4VA 4Y15A 1I5OB 3CCMA 2Y69H 3HOWJ 4GBQA 2D8HA 2KT0A 1IC8A 2GOMA 4GFBA 3C0CA 3COAC 5GMKi 5B3SH 3BTIA 3ASOH 1NK3P 4QWQA 1VIFA 4BKXA 2CGHA 3PE0A 1VQ8A 1R49A 4A12A 1PSFA 4L5IA 3M4OJ 3RDVA 2MK5A 1XX5A 3JCMV 4M7DE 2RPNA 1YIJA 1OPCA 2FEIA 3VQXA 1QF6A 2KNBB 4XTYA 1BC8C 1T56A 3JRBA 2GOXB 3LC0A 3MEVA 4HCCA 2NOGA 3BQZA 2WSFE 2PMUA 4KJZA 1LFBA 2ISYA 4R1HA 2M0CA 2BBYA 3K4LA 4FASD 3FHZA 1GT0C 2PJPA 2HQEA 3A8GB 2A05A 2XIGA 4CC3A 4RQFA 3GNGA 3ZFJA 4ENJA 3RDIA 2EQRA 3QO7A 3CMYA 3HOVJ 1JJ2S 1QNTA 3DP7A 3HKZN 2EV0A 4N4NB 3HRUA 3V7SA 2GNCA 2HDAA 4FYYB 3CCUT 1UJ0A 4HG2A 4WI1A 4UVBA 1WQ7A 3JB9F 1QCFA 2EZLA 4JPBW 5H6RA 2P6TA 2K9LA 2Z0WA 5EYRA 4LG0A 2DDZA 2LG4A 4H2UA 3OYFA 2QZ8A 4FX0A 5D4SA 4F93B 1ZBJA 2VXFA 2M02A 4LDUA 1S7EA 2LCSA 5DDGA 1O7LA 4J8OA 3CC2A 5GMKe 3MZ8A 2LQKA 4IUTA 2C6YA 2OZ6A 2OTLI 2WWYA 3J80E 2W24A 4CH4A 2KXDA 3EUAA 3G71I 4ZTUB 4MTDA 2MF2A 5KE2A 2LREA 4RTWA 2OU2A 3KCCA 1ON2A 3GVAA 1VQ9I 2CP0A 4M77B 2DILA 1TWAJ 4JK1X 1Z77A 5HLTA 2MH9A 1K1ZA 5A0LA 3GOXA 1JKRC 4HX8A 4L6V5 4G94A 3VYRB 2BTTA 4XM3A 3M0SA 2ROLA 4KBMB 1VQNI 1MD0A 2DJIA 3CO7C 2VKEA 2YUQA 5FWCA 1TT5B 1RKTA 4BU2A 4PHCA 1I3AA 5CPRB 2P4TA 4C8QE 2LLKA 3IP4B 2DA7A 1GHCA 4C0DB 1YIJT 4Q5SF 2F5KA 2F4OB 3GLXA 4KT5C 1UGVA 4WK8F 1SC7A 1FOKA 5FRMA 3DKXA 1KYZA 2HKOA 3KUFA 3G71A 1JJCA 1LDDA 4QPOA 4YCVA 1ETYA 3HXLA 3S93A 5DM6F 2ZXWH 3PIPF 4EATA 4ZJZA 2AO9A 2QBYA 2VIXA 5DCMA 3JCMP 1YJWT 2Q5IA 3E97A 1VQKQ 1WI9A 3DLAA 1TWCJ 2GIZA 2YPRA 4UNOA 2LP5A 3ZQQA 4NHJA 1YJNI 4KQEA 4TWAA 2ME0A 1IRZA 2R7UA 2Z2SB 2QHVA 3HRTA 2DYSH 5D8LB 4UY8I 3E2UA 2DO3A 2HTSA 4JZ4A 4ANJA 2JPCA 2Y0SA 4FW2A 2EKOA 4WTOB 3GF5A 1UELB 4BHBA 3V8LA 3Q3SA 2A61A 4XKVA 4LNPA 2HYFA 4HT9A 3A32A 1SRYA 1D1BA 3OIPA 1RI9A 5DCMB 5J3BA 1ZYRF 2JMCA 3A0HC 2AMCA 1KQ9A 2E64A 1H4SA 3L4GA 1ZHFA 2BXZA 2XSJC 2JJ9A 2DMUA 2LX9A 1PD0A 2XDDA 4E2FB 5KYUB 4IRHA 3I4PA 3CD6A 1X3WB 4BY7J 1NZ9A 3KP2A 1WLPB 1OYIA 3FDYA 1YFRA 2DYBA 3MN2A 5J1UA 2HQHA 5CLSA 3AL0C 3J7AO 3QXEB 2X6OA 1B7YA 2IXSA 4CS3A 2LCLA 4Z8AA 2CJBA 3DFGA 1R0BG 2RQTA 4LUDA 3OS1A 3K69A 4XR6A 1JRIA 1X1BA 1GXIE 3CMMA 4IPAA 3W6JB 4AC0A 4P3NA 4E7KA 4KGVB 3UGQA 2KI7A 3QYGB 1ZA1B 3CC4Q 5FKOA 5J6XA 2QF7A 5EDNA 4Z89A 1ZKGA 4KH0B 3SJMA 2QA4Q 1ORKA 5GAN4 4YIRX 4M77C 4OAZA 3FBNB 4A6DA 2E1MC 3TSWA 4OLFA 1QHHD 2EBIA 3VQVA 1LNXA 2KL4A 4RDUA 2JTEA 1LOJA 1QKXA 3GUDA 1FPQA 5TISC 4M7AF 3HY1A 2JSCA 3ULQB 1F36A 3HSRA 1QGPA 1IN4A 3A01B 3KYCB 4EM2A 2R5ZA 1U2WA 3FXLA 3I55T 2RQQA 1HC7A 3HRMA 2M2EA 2QAZA 2ZJ2A 1ZG3A 1UHFA 3G1MA 2NLUA 5IP6A 3PFSA 1V29B 3QU6A 5ILUA 2LQ8A 3M0RA 3RESA 1B70A 3BDUA 4F7UA 3HRSA 4IZZA 2O2OA 3A31A 1VQ8I 3CJNA 2GXBA 1G2BA 2M0YA 3MMYB 5CO7A 4LD9K 4OMZA 2HZTA 2BGCA 2IS1A 2EA2A 3L9FA 3P9CA 2VUMJ 1W4MA 2E34A 3OW2S 1IDYA 3A7AA 2FUG2 3WVDB 3RTRA 2TCTA 1G5HA 5ED4A 1NEGA 1B6AA 4NB5A 3HXVA 3WU1B 3DLLF 2HDDA 3PCOA 3CCJI 2DQRA 4AVPA 3F23A 1QCOA 5CYVA 1JI8A 2XUBA 4M78A 1Z91A 4YRJA 2DZCA 3QYEA 3QWLA 4A4EA 3GXOA 3FKIJ 4R79A 1JU5C 1LFPA 4KITB 2V4JC 2IA0A 4HF2A 3WGIA 1T38A 1QBJA 2C0OA 2V1RA 2Q7GA 4YRFA 2ZPEB 4CYCA 1C0WA 2CIMA 2W84A 2GZWA 1TT0A 2R7WA 1VQLT 1B8IA 4BY1J 4LLNA 2ZIMA 1PYSA 3U9GA 1JKOC 4UUTA 1NTCA 3CQZJ 1J3TA 4XAXB 2XAJA 4ENKA 1IGUA 3VYUB 5C4XJ 4OMFB 1T0HA 1EIYA 4GY5A 4YG2F 4HVVA 5J4YA 4KYWA 3HOUJ 5KNNA 2XPWA 2RB6A 2P5KA 2VT3A 1W0TA 4CYCB 3HGYA 1WJRA 4ZNXA 3CQTA 3X24B 1WH5A 1PG5B 1SEUA 3JB9J 4M78G 1M5Q1 4GLKA 1NHAA 2DO7A 2ELJA 1QWEA 1S72A 3IWZA 3A02A 3TO6A 1Z21A 2EZKA 3BDDA 2Y31A 1MSEC 3L09A 4YRPA 1XDUA 2LJ1A 4Z02A 4P71C 4AD9A 1FTZA 2K9SA 4IKFA 1LKXA 2BOLA 2IEKA 4HT8A 2EPDA 1RETA 3VQWA 3CJQB 2QSFX 1MBEA 3IH3A 3IWFA 4A6EA 4L5JA 3VSLA 2MABA 3PM1A 2HU9A 4GXOA 1EVLA 3CC2I 1X3UA 2M34A 1D3BB 4Z88A 1N77A 2Y90A 4FISA 1UE9A 4J7FA 4M7AB 2O7OA 3S1QJ 2OI3A 3OYLA 2E2IJ 1BYMA 3H5RA 4YFKF 5B1BH 4H0EA 3BG3A 4I02A 5FGMA 1OYWA 1EZZB 3F8NA 1RUNA 3I9QA 4BACA 1N8RU 3RJPA 5E3OA 4QTRA 2EYYA 3OYJA 1VQ6I 2K9NA 3ZBDA 2R7FA 4UVAA 2R7QA 2NVUB 4RB2C 1MUZA 2KK4A 2V1QA 4N0AA 4C8QD 1KC8U 11ASA 4CDGA 4G12A 2K6DA 4CC2A 4AIKA 1HDPA 2VGMA 2DA4A 2ZNJA 5J8CA 1AU7A 2F4IA 2DXBA 4G8XA 1LPQA 2RI3A 4LGWA 4EMKA 4BW9A 2CV0A 4YRIA 3CESA 2BVLA 2RKHA 2VL8A 1PSEA 1J75A 2RHYA 1KMMA 1NJ1A 1MJ9A 2C8MA 5CVRA 1R5GA 4Y13A 3SEMA 4EEFG 2NRAC 3VUZA 4BI8B 1A5JA 2GA2A 2XB5A 4XEMA 4CO8A 4XRSG 2YU3A 3MZHA 1ZBXA 4B8XA 2LK2A 2CJAA 2KYMA 2RN8A 2PQWA 4M77D 3VRYA 1A6QA 4OP0A 1QVPA 1TUGB 1I1GA 3ICAA 2EYXA 2VXEA 2RHXA 3W3SA 3Q9VA 1I50J 1I6XA 1YYVA 1JGGA 1FZPB 4CH3A 2XTIA 3H0DA 4HRIA 3LW5E 1EF4A 1TBXA 1AT1B 3HSFA 1X43A 2DFUA 5FU7C 1KC8C 5K1XA 2EZHA 2CH4A 2LZ6B 1OCRH 1Q1HA 2OPTA 2BUDA 1Q95G 2XASA 1RI0A 3RCOA 3SXYA 2HEQA 1WYDA 3I35A 1K6YA 3DSQA 3CCRA 2D0QB 4C0DC 2HAXA 2W57A 1X2NA 4MNUA 5ELNA 2DA3A 5FKLA 2W10A 1KIKA 1SETA 3QDFA 2M4KA 2YSRA 3QJ6A 3BE3A 3GW2A 3QIIA 4MO7A 4M7AC 1S7OA 1RZ4A 4QQGA 5DTDA 2OAUA 3CMAT 3ONQA 3R4KA 4X1EA 5ILSA 3WTXC 4GYIA 1FP2A 3J81K 2YUNA 3MEAA 4OF1A 5GMKh 4Y17A 2AT1B 2HS5A 4K88A 4XLHA 3I58A 4A2UA 5GANg 1YGBA 3FZVA 1UGRB 3KEQA 2QI2A 5KE3A 3W6KB 1RKWA 3GO5A 3M1CA 3M1EA 2W25A 2LNBA 4RGUA 4XLNF 1WJSA 1ACIA 1N27A 4IVNA 4RGRA 4JDSA 2M0MA 3TEGA 4HLYA 3DBLB 5IHKA 3L4GB 2R7TA 4CCLA 2F5FA 1MBGA 1YI2I 2E19A 2L9SA 2RNGA 3HXUA 1D8JA 3FXQA 2NS6A 1S5LC 2M0OA 4ETSA 1V1CA 4DA4A 1YCYA 4NC7A 3MEYA 2DA5A 1YFNA 3WU0A 5FRNA 2G6FX 2JN6A 2WY7Q 3B02A 3CJTB 3DEEA 3DTKA 3NRVA 3L00A 4PJNA 4Y33A 2M30A 5F0FA 4A0XA 1WHKA 2BZXA 2GIVA 5DCFA 1O3RA 2AHJB 1VQKA 4YRRA 1VQ4T 2V1DA 1SERA 3TP3A 5IPAA 1PCXA 2WSEE 4R0KA 5J40A 3CCMQ 3DU6A 1MDMB 2O8KA 2IAIA 2R4GA 1ZTRA 4KR3A 2DK8A 5JFRA 2Z16A 2KRCA 3M56A 4CICA 4HVUA 5A2QE 1WWXA 1TOVA 2Q7EA 1XGNA 3LSJA 3ME9A 2NUPB 5GAOn 4CSWA 1E7OA 3GYHX 4OMPA 3THKA 2CV1A 3GFLA 3PIOF 2QENA 1SSFA 1R1VA 1XPXA 2DL4A 4FU6A 1Z7NA 2JTFA 1LFUP 3BY6A 1SKUB 3FXMA 3JSCA 4LDXA 3JRHA 2L8DA 3VS2A 3CBPA 3GF2A 3LA2A 1ZHIA 2VE8A 5GADJ 4RCBA 3P8VA 4O2DA 1KG1A 3RL6A 3WQZA 2BE9B 3RACA 4BI4A 2RHSB 2VJ5A 5GAOp 4L9JA 4OB0B 3JCMc 2K3FA 2PMZN 2MMPA 1VQMT 3AG3H 2RC4A 3J7AF 1JKQC 3ZQHA 3ZGKA 1O3QA 1M90U 3HTZA 4HWRA 4F55A 5D6YA 4J01A 2DAQA 4F16A 3T9NA 2NYXA 4G7ZF 1V5GA 3KFUA 2M5WA 2LD5A 2ABLA 4HYEA 2H94A 1ZR2A 1FYMA 2CSQA 4M78C 4WCIA 4P75C 2L89A 3RYPA 3JAMZ 2EIJH 4PLLA 4MFDA 2RREA 3M5AA 1GVJA 1Z6RA 5F04A 5IT9K 2HBWA 4M78D 1B34B 3REAB 5LJ5h 5DS9A 4OMLA 2DA1A 1JT0A 5C52B 1W4SA 1BA5A 1VQOI 2MW8A 3QWXX 4A4KA 2UV1A 1Y96B 5CKFA 1N9SA 4RA2A 5LBQA 1HCRA 4CCKA 3UA6A 4D5FA 2DAOA 3OS0A 4S04A 1V3FA 2V1UA 3P7NA 1EIFA 1WDXA 3VFZA 3JREA 4XN3A 2CP3A 1FXXA 5LJ3f 3K10A 3TSZA 4M75E 4NUBA 3CUQB 3WHCA 3ZP5A 2ZZEA 1AZGB 4AYBN 1U8RA 3M4YA 4AIDA 3L2QA 3CC7T 2A36A 4D6WA 4ZTZB 2GWRA 1FOWA 1PVEA 1R4MB 5HOOA 2HMAA 1T39A 2W82A 4D8KA 3IAM2 4DZPA 2FO0A 4RMFA 1G3WA 1VQ8T 1W7PD 1BJAA 2L9RA 3BZCA 1YJ9A 1FMVA 1OCOH 2F5VA 1YFSA 2EJGA 3FHNA 4IRIA 2D1VA 2DCEA 5E1XA 5GTIC 1GBQA 2DETA 3OR1C 3P9IA 5M3FJ 2UXXA 1W1WE 3N05A 4LD5A 3S3MA 3PZCA 4YYEA 1IJWC 1V5EA 2F48A 3MFKA 1YS7A 3K70C 2PG4A 3R6NA 2CUDA 2PEXA 3D0SA 2HQRA 2XGEA 4DBQA 1DP3A 2AXTC 4PFOA 5LJ3d 4K2EA 4LUEA 2LMJA 1N75A 5C3EJ 3EAEA 2BV6A 3I56I 4RTYA 2Z3YA 2PMEA 4HPQA 2PUOB 1W2BS 1HW2A 2X1CA 1VQLI 1XDSA 3WU2C 1XOVA 2X35A 3R61A 3CPWA 2E12A 1RAEB 2QDYB 5KHDA 3E19A 5CR2A 4YRSA 2ZNIA 1WVRA 3CBMA 2KJBA 2A07F 1W7PB 3OYNA 4K86A 2ZPFB 1P7JA 4L5EA 3H9QA 3MP1A 1VQMQ 3DKWA 1NJ6A 1U1SA 5GANe 3EDPA 3U2RA 2DRKA 1JKPC 3M58A 1Y1VJ 9ANTA 3I56A 2HEOA 5FLXK 4C8QB 3WE3A 3G6EI 3KZIC 5GMKl 2OTJA 1B76A 1B07A 1W2BP 1ZSZC 2O3FA 4DOZA 3META 4V2GA 4J6WA 5CVJA 1YX5A 1CQTA 5C0MA 4M75A 1WXBA 4M73A 2VVKA 3D7SB 4RMOA 3FM3A 3IH4A 4RLFA 4IHYA 1VQPQ 2JA8J 3ISPA 1BBZA 4PJJA 5L3CA 5IYDJ 1QCNA 2LSOA 4L59A 4ZGJB 7AT1B 3E6BA 3R60A 2DU9A 2OJ2A 2ZCFB 1RUWA 1H4TA 4IRGA 3CCRI 2RHUA 1X1CA 3DBRB 3QYFA 5B1AH 5C4JJ 2LR8A 2PLYA 1WZOA 3KZYA 2IVWA 4HWSA 1IN8A 1AKHA 1H88C 1VQ4I 1F4KA 4BXUA 3QNEA 4P75A 3LX7A 2DA6A 1K83J 2QKMB 2KJCA 1YITI 3S3OA 3CCVI 2DYIA 2EV5A 4HQEA 4GLMA 1QKWA 2EGCA 1IRGA 2HTJA 2L0KA 2RHIA 5K5RA 3DB4A 4PL6A 5HLIA 1X75C 4PJOF 2R7DA 1JUMA 3CC7Q 1WI3A 4IOAF 3TO9A 5D6WA 1XGMA 4Y52J 3SZPA 1PP7U 1W36D 2Y2ZA 3ZR8X 2Y75A 4XKCA 2F1LA 4KRTA 5DUKA 3IL2A 1CKBA 4ZYHA 3FB9A 3RKQA 3BWGA 3HFNA 3QKJA 4C92D 3TOAA 2KRSA 1X56A 1BC7C 1Y1WJ 4YRKA 4H2TA 4IUVA 1V54H 3F72A 4N9HA 2XIDA 3EUHC 2H27A 2X3XD 4QQDA 1Q82C 1AWWA 1S29A 3SEZA 5GAN5 2M16A 1QO0D 4A69C 1Z6TA 1IUYA 1JO8A 2KEAA 3A98A 3QZ5B 4YIIA 3KYDB 3WXMB 4ASNA 3CCLT 1QP3A 2OCEA 3RKYA 4J15A 3HBLA 2QSGX 5KYYA 2VBZA 1S1NA 4JLIA 3RMSA 4B47A 4ATOA 4EJWA 1VQ4A 2A8EA 3X2QH 4M77A 2MBFA 3ZQGA 4B3XA 1IHVA 1NYGA 3QO5A 2LC2A 3BTJA 4EJTA 3UF4A 2X6WA 1IB8A 2COWA 1WRJA 4F7UF 4IL6C 1WJDA 4P9FA 1TLHB 3UFGA 2NUTA 2STWA 3HIFA 3S8PA 2R5MA 1L3LA 1GUUA 2OAZA 5K1YA 3OQ5A 3QPLA 4M6YA 2LBFA 1ZUKA 2BE5F 2ECCA 1HDDC 1UFFA 2E10A 2LQWA 2MCNA 5JVTA 3JR9A 3CMEA 3A5ZB 4XLPF 3MEUA 1FBUA 3HHGA 3EGUA 2VKNA 3TEHB 1A04A 1PNJA 2V9PA 2KRNA 2GGRA 2E41A 4HCKA 1PKSA 4CXFA 1M2VB 2M7AA 2PMFA 4LVIA 1ZAOA 3CC7A 3VS4A 2ETHA 4HA8A 2Q7HA 2MAMA 1TP4A 3C18A 3VWBA 4N4IA 4F7UG 3JCMd 4AG2C 5DLOA 3W2VA 5IOZA 3H92A 1R0CB 2FRYA 2VOOA 4OOIA 2ZFUA 2E60A 2M7BA 1SRMA 1WI7A 1OCPA 2IRFG 5AT1B 2E35A 3TVTA 1Y57A 4E7LA 1BIBA 3FF5A 4NC6A 1YJ9I 1KK7A 2ZPIB 1KYWA 2JSPA 2EZIA 2XF7A 4N4OB 1Y7XA 3S6WA 4LIUA 4A3LJ 3TDZC 2A68F 4RTUA 1JGSA 1VFCA 3JB9D 1ASZA 4J00A 4GO1A 4IUQA 3DLMA 3SWNA 3K7AJ 4L9NA 2A6HF 4CI0C 1VQOA 1VQPA 4E51A 1UGSB 3ZCOA 1ETVA 3V7RA 3RZOJ 2EVRA 2QYZA 2E6ZA 2QEXQ 4ZZLA 2CWEA 2L0AA 4EIKA 2JVVA 5GAMj 1ETXA 1MMDA 1R71A 2IG0A 5CVVA 3CC2Q 3ZQIA 4M7DC 3ABTA 3JRZA 2WB1A 1SD7A 2ZAEA 4LOCA 2HL3A 4A5MA 1TSFA 3BPVA 3HOSA 3URGA 2E1NA 1UHMA 3JSOA 1OZ3A 3H9GA 3BR6A 1QPIA 3OYHA 2X4HA 3QP6A 1U9NA 2EAYA 2NUTB 1K4SA 3LH5A 1R22A 1M27C 2PZ1A 1D8KA 2D8JA 2GXGA 6PAXA 2XAGA 4JJDA 1Q86C 3RF1A 4IHXA 4DPGA 2CO5A 2XKOA 2BW3B 1NBEB 1Y8RB 4H2VA 2KY9A 2L4AA 1JEGA 2IW5A 2ZPBB 1X1AA 3FMRA 1X2HA 2ZGWA 1XQHA 5D4RA 4C3JJ 2E1HA 2KXCA 2JA5J 2QQRA 5I21A 1EH8A 1D1CA 4D8DA 2O6GE 2W1OA 4TQFA 1MH3A 2F2XA 4IUUA 4QQ6A 2HWVA 4XSZF 4YFNF 2RH2A 3SZTA 1BW6A 2GA1A 3GNFB 2PMZA 3H5AA 4DJAA 3QYHB 1B9NA 2FMLA 1N8RR 1FYKA 3OSSC 1WKMA 4F52A 2AZSA 4LDYA 3WGGA 1WPYA 4L18B 4MFEA 1K9AA 3KEYA 2DODA 2QA4T 1YI2Q 1DU6A 1IN5A 1Y6IA 2VV5A 1MBFA 4XU1A 4RAGA 4U7DA 2ARTA 2OTJI 4PJOE 4XMYA 1X58A 1BR2A 1E6GA 2RJFA 2ID6A 4PJMA 3G3ZA 2L3PA 1VQ9T 1U0JA 2DK5A 1VQKT 3JCMb 2HNIA 2EIMH 2CYZB 3VYGA 2QG9B 2BE7D 4GCVA 2FB7A 2A3SA 1WHLA 2XC7A 1J5WA 1BR1A 5HK0A 1SESA 2OBPA 2HKQB 1QQIA 3MPUB 1NG2A 3L42A 4RMNA 3X26B 3KFWX 1OKRA 5DLQE 3TP0A 3QYBA 3E7LA 2O01E 4I2OA 1RADB 2LNVA 3M7GA 4HX4A 4IO9F 1JUPA 5M5YJ 4P72C 5FD5A 2A3LA 1KQSS 2ODRC 3A5YA 1YB3A 2LT1A 5FB2A 2AS5F 3CMAQ 4P74A 4BY6B 3JB9G 2XMFA 2GLOA 3TCJA 5GPCA 1Z7MA 4YCWA 2C06A 1JJ8C 2CQXA 2F2VA 2GBQA 4A3IJ 1H3HA 4AIHA 2GBYA 4H2XA 2BHZA 1KU7A 2L3QA 2KGTA 1IN6A 2M8EA 3H0HA 1PUEE 5KYUA 8AT1B 3CD6Q 2DXTA 3WE2A 3LWHA 4XEOA 5JR3A 3LSSA 3QZ9B 4A63B 2AQFA 3EYYA 4C8QF 3BJUA 2RV8A 1RRJA 1TQPA 1HD3A 2QHSA 3HKSA 5HS8A 2R5ZB 2ZJPF 1KQ8A 2PMHA 1XTDA 1K7AA 2KDZA 2KSSA 1TNSA 3CP2A 3HXWA 1LDKB 1MV3A 2NAZA 4ZYAA 3KYLA 1JQQA 2GQQA 2SEMA 1Z9CA 1KU9A 3B6CA 1IGNA 4FQGA 1U06A 2DM1A 2R57A 2LC4A 1UB9A 4ITVA 3M9QA 1XSDA 2RJCA 2BXYA 2CU7A 2E1MB 2XF5A 3PUBA 2A28A 9ATCB 3CCMT 3EGXB 2K3XA 3AG4H 4BWAA 4D0PA 1ZGAA 1J9IA 2LVMA 2M1HA 3OOUA 4A4FA 5L3GA 2IBDA 3FXOA 1JTXA 2DOFA 3WTVC 4ENMA 1KHCA 5CKBA 1TWHJ 3VJPA 2XV4S 2WAFA 1TTHB 3L2VA 1I5LA 2DN0A 3CMEI 2HL5C 4DNCA 4OMMA 1D1AA 5FJ8J 3OS2A 1SVMA 1OFCX 2CT4A 4HX7A 4ON0A 3WHBA 3NGPA 2W48A 2H1KA 3CCSQ 3K0LA 3BR5A 1JJ6C 1WJBA 3EG0A 2CT3A 2L9NA 3OSVA 2M4GA 3SDBA 1VTNC 2A08A 2DMTA 4A3FJ 2V79A 4J9GA 4H2WA 4MLOA 2AIRB 3GX4X 1ADJA 1KQ1A 3CLOA 1EH7A 2KFDA 4V2FA 1EV7A 2HXOA 3G1OA 1JHHA 4XK4A 2O9VA 4U7BA 2KP6A 1A31A 1ETWA 3J7YJ 1X6OA 4QKUA 1E24A 2ENMA 5L3DA 3A8HB 3E5QA 4CRIA 1BU1A 3UATA 3HSBA 2DQ0A 2IGNA 4XORA 3GZ5A 2X85A 4HAMA 3JRIA 2CGPA 1T0JA 1QP2A 5L3FA 2LKXA 2H8HA 4JP0A 4CUGA 1YJWI 2JVHA 4PCQA 1IV6A 5K7HA 4BHPA 2R5YB 1E3HA 3FBIB 1WCMJ 1X19A 2FNPA 3IKTA 2D6FA 3TW6A 2MSYA 1YE9A 2UZKA 1MMNA 1XN7A 2RQPA 5EZGA 1H8KA 1YCSB 3FDRA 3HPHA 2A0FB 2K3YA 1BCOA 1JUSA 3OL3A 4FM4B 1G8XA 3G1LA 4G7HF 2C0TA 4JLGA 2RQWA 4J9FA 2WA0A 2FXAA 3D5LA 1QQJA 3FEOA 4LB6B 5DUIA 5LL6S 3U1DA 4F7UE 3LFKA 1I1JA 2CW0F 2K7AA 2K9GA 2ZC2A 3OYEA 2ZPHB 4FSXA 2QWWA 4NNJA 3ZRGA 1S3JA 3QOPA 2HD0A 1KQSA 2XGTA 2FPFA 4UP7A 2NS8A 5KYYB 1YIOA 1H0MA 1ZSGA 5B5EC 4KA4A 3S2DJ 1T0FA 1HBXG 1SAXA 1FX7A 4A3CJ 2JT4A 1XSXA 4HF0A 3MO8A 2FYKA 4OB1B 1IXCA 2Y9YA 5ICGA 1N6AA 5LGTA 3W2AA 3MKLA 3ERMA 5E8GA 1WXUA 2DA9A 3EGDA 3DB3A 4HKEA 2TRTA 4OMOA 3CCEI 3CP8A 3ROUA 2DD4A 4YRVA 2ZCWA 1ABOA 3LSGA 4LN2A 1BIAA 2HQ5A 1I8FA 3PFIA 2O9SA 3SQNA 1MBHA 3EG2A 4TVRA 4OGEA 2JTMA 2AK5A 5JHUA 3CD6T 4UV8A 3TEHA 4A4GA 4BD3A 1JT6A 2X4XA 1PD1A 2LTOA 2ELKA 3KP7A 4EMKB 1X55A 2ED1A 1D5YA 3G6EA 4PZJA 1YRNB 1ZH5A 5F27A 5KCMA 5I2MA 1G4DA 2LY1A 5KYXB 3ZEHA 2H8RA 5JHFA 1JBMA 2DE0X 2A69F 3I5UA 2B0LA 2L5QA 1FJLA 3GFJA 4ZH4F 1QRYA 3JRDA 4ZDOA 4IIOA 4FCYA 5CQYA 2OC6A 1M90R 3ECOA 1M1EB 5IOYA 3W3CA 2AKKA 3TREA 2Q5HA 2XPUA 3E9HA 4C92B 1RAAB 2FRHA 5DM7R 3E6DA 5GMKj 1X3ZB 4IXAA 4BY6C 1S72I 3QJYA 4Q15A 3Q5FA 1M9SA 3O8HA 4BL0B 2E3HA 4G84A 5IH2A 3PSIA 1WJQA 1Q81R 4CS4A 3K2ZA 4RBOA 3H9JA 5DD8A 2LRDA 4F3QA 2CUEA 3GWZA 4F91B 2EQKA 2R93J 3OB9A 2H09A 4UB6C 3SZGA 1WSUA 4HVCA 4E7IA 4A5NA 3HTSB 4IQJA 3GTKJ 1OPLA 1SF9A 2ZIOA 2JPBA 2LKSA 4H2YA 3C1DA 1Z9ZA 4YRLA 3N97A 2QGUA 2RF0A 1HSJA 3MJXA 1I07A 4XU0A 5LJ3h 4AG1C 1XSVA 1YFHA 3FXRA 1X2MA 2ZXJA 4GGGA 2E6NA 2F69A 2QQSA 2L7MP 1MMAA 1X2QA 3RR6A 5E79C 2PTKA 4DYRA 4BUGA 5LLQA 4LMYA 1LPLA 2BHYA 3M4GA 2Z1DA 3C12A 4P73C 3QRFF 1K78A 2NVYJ 5D5WB 3DXJF 5KCOA 4RUGA 2NOJB 4B9XA 2J3MA 1AHJB 3K4BA 5GAHJ 1BI1A 2VUBA 1FT9A 5BS6A 2MA3A 1Y39A 1NYRA 3DPLC 2DVJA 4M78E 2VQHA 1F1ZA 4LB5A 4J5YA 3H1CA 3I0TA 3REBB 2P5LC 4XOTA 2DPUA 3CCUA 4WJ4A 3KP4A 2ZMEB 3LSIA 4W97A 2ARSA 4VUBA 3DWLE 5IXBA 2ZZGA 2YRVA 1KQSP 4RM2A 1WHMA 2ZXIA 1I6HJ 3CCLQ 4Z6YA 1P92A 2QCOA 3KETA 1OYYA 1USSA 2EQMA 2Y4YA 1KFZA 2VKVA 3EHQA 2H6CA 4NL2A 4ZGEB 1MMSA 4MDXA 4C92A 3IHUA 1YHQI 5GAN7 1SAUA 1IXSB 2HFHA 3CF2A 3I53A 3I4NJ 2CP6A 4NQWA 3W6VA 2LF7A 1HLVA 3R07A 3FIWA 5IP7J 3F22A 1XMAA 3HG9A 3LNQA 2R7ZJ 1KD1C 1WNLA 3JCUC 2XDVA 4FW1A 4CH5A 3F8MA 3G73A 4ZYDA 1B3QA 1FBQA 3BCBA 3KIOA 3LOCA 3HUGB 3MCZA 3OOPA 3AAFA 2CH4W 2EYQA 4MMLA 5FWBA 1FYFA 3P9KA 1X2GA 5C44J 3RUXA 4AIJA 2XKOC 3T8TA 3PNYA 4B1RA 1QMCA 4M75F 2XSDC 4HNTA 5E20A 5LEJA 5CK9A 5F64A 4PSXA 4Q48A 2I4NA 4MEYF 1Y8QB 1FNNA 4I76A 3U21A 1YW9A 1BN5A 1E3PA 2ZB9A 4U87A 1PKTA 4PJOG 2CUBA 1ZRFA 4LG3A 1SRLA 3HJEA 2YWWA 2KIQA 3RZDJ 4BNCA 5GAN8 2EA4A 5GAMe 4LK1F 1IL2A 2CMPA 1X2KA 2X9DA 4UUVA 2D1HA 2V1NA 1PUFB 1OX8A 5E3NA 1O7FA 3QTCA 4UB8C 2AKWA 2ACJA 1OR7C 3OYIA 3VRZA 3K4NA 2WC2A 4AM3A 1NPRA 1WIEA 2VB6A 2ESWA 1UGQB 4A54A 1KSWA 4UUSB 4BQOA 2FSWA 4BDYA 1BBWA 3SHFA 3X25B 2OTLQ 1ZRDA 2DMNA 4B09A 1YG2A 5M9OA 2AMCB 3MP6A 4S0HB 1LCKA 2HQNA 5ICEA 2MPXC 2K57A 1W66A 3FM5A 4ZYEA 4IHSA 1YWOA 1MBKA 2DJQA 1NJIC 1ZGJA 4PJOB 1RC9A 1EIYB 2FOKA 4DOWA 4TVYA 3P8DA 5IT9Z 4OAYA 1AZEA 1AWCA 2CRGA 2VC8A 1QE0A 1ZUYA 1ZQ3P 3O8VA 1M1FA 4UVCA 1APLC 1YJNT 1HJDA 2K85A 3LLRA 3E5UA 1VI0A 3ESWB 1YP5A 1Q7YC 2P5IA 3OS5A 3GTPJ 5EF6A 3BPXA 2DTZA 3QPHA 1U78A 4M74A 4MZPA 1ARKA 5GPAA 3BC8A 1WA7A 3TO7A 1O4XA 3TDUC 4C8QA 1SFKA 5IAYA 2QK0A 4XSXF 3U1KA 1X69A 2GQVA 2E71A 1FMWA 3KZZA 3A8OB 4ZN3A 4YRCA 3EG9B 5L8RE 5AIQA 2RNAA 1W6XA 4YP0A 4M71A 2XROA 2RMOA 3CCUQ 3BCAA 3EETA 2VJIA 1TWGJ 4G9YA 1OOTA 5GAMd 3EGXA 1MMGA 1J7KA 5D5UB 2O61A 4JJBA 1QU3A 1TH7A 2Q2EB 5C51B 2E5KA 4XONA 4M7AE 4FT8A 2RD1A 3O5ZA 3V8JA 4YRTA 2ZSHB 3PJRA 2PI0A 2RHZA 2KVQG 1QPMA 2VQCA 4QSHA 2F5TX 2YUOA 1VF9A 3CMET 1HOMA 2V8JA 3ZMVA 2OTLA 4LITA 4OIQF 2FMYA 2DK3A 1GXPA 5M5XJ 5EG0B 2R7VA 5ICFA 2HPMA 3FXKA 2Y0MA 5K7ZA 2QDLA 1BOAA 3VOEA 2EB7A 2ODRD 4KGXB 5LHIA 1SFOJ 5AIPA 2ZXHA 2PX9A 4RDXA 3CCJQ 5HS7A 3G4SQ 1NNHA 12ASA 3G2BA 3DKYA 1FWZA 3P5JA 3F8BA 4I0AA 3SYTA 2X51A 5E17F 3O2PE 1WFWA 3BROA 3EGDB 4C0GA 5HGQA 1E3OC 1J09A 2WAEA 4CCMA 3VYSB 4J83A 3H8ZA 3CMAA 3FJPA 3X28B 3ZN0A 2ARUA 4PK4A 2MD5A 4EMSA 2R58A 2XICA 1FTTA 2K2MA 3OYYA 4JBAA 3DKMA 4ZTFA 2QA4I 2XRNA 1OYXA 1OMIA 4E6RA 3M59A 3KP5A 2J5PA 4EJUA 4WWCA 2KIFA 2OAWA 3E6MA 3EQLF 1M1KR 2YR2A 4G85A 1TQMA 3V8KA 3OBWA 2ID3A 3SWNB 5K7FA 2COMA 4PLIA 3HXZA 4BQAA 1UHWA 4RKUE 3WTZA 4F14A 3KE2A 1OLTA 4P55A 5HK3A 4C5IA 1USYC 3R0JA 2HXIA 5HDKA 1ACMB 1E6HA 4MQVA 4EM0B 3JCMQ 2DRMA 1M4ZA 2K5LA 3UT1A 1D0XA 2QQ8A 3LSTA 4N0AC 1U8BA 2HYJA 1CF7B 3UDCA 2KIMA 3K4CA 3FKJA 3NTIA 3MF1A 4A0YA 2K3BA 2HPIA 4P3PA 1EJ9A 2KZGA 5IYCJ 4EGYA 1WGXA 5HDNA 4LVLA 2WSCE 3GCMA 2JQ7A 2QQAA 3IAS2 4WXHA 1G59A 1G3SA 2L01A 2F2WA 2HSPA 2DTHA 1SVLA 4EVIA 1H89C 3E9GA 3EFRA 2VPRA 4AWXB 3GTJJ 2Z99A 4M9XA 3DU5A 3LGFA 1T6SA 3GFMA 2R5YA 2HQXA 3CCRT 3PUFA 5GANh 3CCQQ 5CAIA 4RB3C 3D5RC 4LJZF 4IX7A 1VQ5I 1M8VA 1KMNA 4ZGDB 5FU7B 3UWNA 1Z3YA 4C2UA 2D9TA 4YCUA 2IS4A 2KZVA 2MD0A 3VS3A 2HDWA 1ODDA 3CDHA 3L2ZA 4N4GA 2P0WA 3CPFA 4LIVA 4LLLA 5E3LA 2K5CA 2FPDA 2QGGA 1AKHB 2D5VA 3HB9A 3IRRA 1YHQT 1VQ6Q 1ZN2A 3LA3A 4FE4A 1LUJB 1R23A 4HV5A 1XC5A 2E5NA 3WG7H 3JTGA 3L2CA 2VLAA 1AD5A 1SSHA 2DEQA 2E1OA 2HOAA 1NE8A 3PMTA 4XTXA 4M7DB 1JXSA 3FMQA 1HSTA 1F1BB 1VQ5A 3NEMA 2PJRA 1M8MA 3A5ZA 4C9YA 3JV3A 2L2PA 5LJ3j 1EVKA 2CDTA 2IIMA 4EJVA 3WTUC 3EHRA 1Y56A 3G4ST 4XQ3A 3ZMZA 1HKSA 2JVGA 2J7IA 3H6ZA 2X4WA 2VQLA 3U23A 3JCMf 1MW7A 2C7IA 2KISA 1K8AC 2IGMA 2LMDA 2VBWA 4OVAA 2LF8A 1GCPA 1ATIA 4C0FA 1IN7A 1MV0B 1YN8A 4RTVA 2FQ4A 3CCVA 2I5UA 2BY3A 3PO2J 3HHTB 3I5RA 3M8FA 1KGSA 5CQEA 5KYWB 3HXXA 3DBHB 1PWTA 2XAQA 3INZA 3C2GA 5LHGA 1ZK8A 4PDKA 2JS0A 2KMTA 1B7YB 4RTZA 3J81Z 4HV6A 1QLYA 4CYDA 3P8BB 4JJCA 4D1QA 1O57A 4A93J 4JUVA 3HOXJ 4ZIBA 1V55H 2E2JJ 4EDUA 2PBIA 1VQOT 1X6GA 2HOTA 3AFHA 3R6SA 2DL3A 1OQYA 2B7EA 1T2KA 1M30A 2J5OA 3HOYJ 1D5VA 4IEJA 2DJZA 2XG8D 4BGDA 2Y4XA 3S32A 5KCHA 3ABUA 1SFUA 2KHMA 3MKDA 1E22A 4BDZA 1UHCA 4HXJA 4HCZA 2BEOA 3ERED 2EWNA 4GYGA 3CXCS 5LGNA 1R1UA 2D2WA 3FISA 4BJTA 2CZ0B 2PVGB 3TW7A 3LA7A 4DZJA 4HF1A 2BYVE 1Q1VA 4M3DA 3S1NJ 1BB9A 1JXMA 2E5AA 3MQZA 2EFWA 4PG3A 3MQ0A 2QQ9A 3BR0A 1LEBA 1MGQA 1K61A 1PJRA 3E3VA 4X34A 4C5HA 2QEXT 1S7AA 2FBHA 3CZ6A 2EFQA 4LE9A 3UKGA 4M7AD 2V8IA 4X6AJ 4AFUC 4BAYA 4YRQA 4CZZA 2H6BA 2XHKA 3A8LB 2P4RA 2OJED 3G1JA 1RUOA 2JJ7A 3KLOA 2J05A 3BLYA 1GVDA 3I71A 1A35A 1PRMC 1SEMA 4MZMA 5CCAA 3L1AA 2W00A 3W2WA 2NYSA 2P0KA 4WJ3M 3CCVT 4MMKA 3ZQ7A 1VQ7A 3I54A 4C92C 2X3WD 1K8AR 1W5TA 3KFVA 2ZZFA 2O4XB 3LQRA 4ME7A 2RI2A 4M77G 3MVPA 2JZ2A 4X9CA 1ENHA 1R7JA 1J0RA 1NH3A 4C2TA 1B72B 2XGXA 1X4OA 2BVMA 2DFFA 1H9GA 1VOMA 2JRMA 4Y91A 3JB9I 4EM1A 1K9MC 3BOQA 4C30A 4TQDA 3S3NA 3RSNA 1XB4A 4KT6A 3MKZA 3EG3A 1C0AA 2K4BA 2OUMA 4Y28E 4NC8A 3E6CC 3REUA