3V7RA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7rA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7rA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7rA02
4XSZF 1HSJA 4PG3A 3LFKA 2P4WA 1UCRA 2QQAA 2QHTA 5HLGA 4J6XA 2F5CA 1L3LA 3IALA 4HW0A 2Q5HA 3ML6A 3ZMVA 4YCVA 2EJRA 3WTTC 4ENKA 1G3TA 1JJCB 3BPXA 3WG9A 2K4JA 1QO0D 4C92D 4Q15A 2VE9A 2NYXA 1Z6RA 2DJZA 4YIIA 3E5XA 3DSQA 3LSTA 4H2SA 3TO6A 3ZN0A 3DP7A 3QP6A 1M5Q1 2YHTA 3B02A 4F7UF 4MEYF 3A5ZA 1EVKA 4WXHA 2ZIMA 2DQ0A 3V8KA 2QWWA 1B59A 4I2OA 3TOAA 2ZNZA 2IT0A 5DV5A 3TEGA 1B6AA 3LSSA 1V4RA 4LK1F 1U78A 2YLBA 1Z7MA 3SB2A 1R5GA 3TKYA 2DW4A 4UPAA 5HGQA 4EM0B 3SZTA 2J5OA 4E70A 4XLNF 2MLKA 2FMLA 3FM5A 2ZT7A 4UV8A 3CTAA 1H9GA 4M7DG 4XU3A 4BWAA 3JTHA 4HZFA 2AS5F 4CO8A 1AWCA 4PJOB 2HEOA 2D2WA 1HQCA 1IXSB 4XTWA 4YCUA 4TTVA 5GAMf 2EFQA 4KN7X 1IL2A 2KIFA 4C92E 1I8FA 3QSUA 3L7WA 2UXXA 4CXFA 2DXTA 2D1VA 3G1ZA 4S04A 4C8QF 2HFHA 3JB9H 4P74C 3A7UA 4AIJA 1HBXG 2PFBA 4LFUA 5C51B 3WU0A 1U1SA 5GAMh 5L3DA 1FOKA 4ZIBA 1EOVA 5GAN4 4J5YA 3ABTA 1GXQA 1XMKA 2RA2A 4DQ2A 1NNHA 4A53A 4YFXF 5F5WA 3GZ5A 3KP2A 2OA4A 3V4GA 3MEYA 4EM1A 4L0YB 4UVAA 4ON0A 4RCCA 2QUFA 3HSEA 3K1NA 3L00A 2VOPA 1JJCA 1HTTA 3V7SA 1NJ8A 2ALYB 1IZ1A 4RGUA 11ASA 1PP7U 4H2YA 1EFWA 2GIVA 1G5HA 3HOTA 3L2ZA 4XBFA 2PMUA 1C0AA 3F3XA 1XN7A 4KICA 2DEQA 4AIKA 4BW9A 5GAOr 3IWZA 1FBUA 1XCVA 1YS6A 2ZR2A 4HYEA 4D0PA 3VQVA 2ZZGA 3EDPA 1IF1A 2CG4A 2RM4A 2LF7A 4J6YA 5CVIA 1Z9CA 2EFWA 4HVCA 4RAZA 2GAUA 5FFZA 2RVCA 2XASA 3G73A 1B7YB 2V9VA 2DK8A 3EYYA 4PJOG 4FX0A 1XD7A 4UVBA 4P9UA 2ETHA 2FQ3A 2Z5UA 2O3FA 4C8QD 2QQBA 4M75C 4U7BA 4WWCA 1JHHA 3L4GA 2GXBA 4F7UE 2I4MA 4O2DA 1QQIA 3MQ0A 4PJOA 3G3ZA 4H2TA 1XSXA 12ASA 4K2EA 1TLHB 5CJ9A 1X3UA 2CGHA 3RACA 4A6EA 3BDUA 3CLOA 1MD0A 2MH2A 2BYVE 1R23A 4OLFA 4HWRA 1VTNC 3J7AO 3WTYC 4P9FA 4EMHA 4RGSA 4XTUA 1WYDA 4S05A 4YRRA 3QP5A 5HS8A 2A6EF 3K2ZA 2CFXA 4XU2A 4YRJA 3T8TA 2QM3A 3PZCA 4WI1A 4L9TA 4C8QE 1P92A 1NJ5A 1LEAA 1D8JA 1JRIA 3P8TA 2E1NA 4LD5A 1R5HA 1WQ2A 2RKHA 2B0LA 4I98B 2ALYA 2XAFA 2EFOA 1IN4A 3MF2A 3JCMV 3JAMK 4HDUA 4I7HA 3DQVC 4IRGA 3E6MA 2YPRA 2EFNA 2PMHA 2P7CB 2EL9A 3RF1A 1JXSA 1FSEA 2ZT8A 1ULYA 5LHGA 2DZCA 4CDGA 4M7AC 1WWXA 4X5OA 3DEUA 1LNXA 4XU0A 4RS8A 2ZMEB 5DD4A 3BOQA 3FMSA 1G5IA 1ZG3A 3R0JA 4M75E 1M8VA 1B7YA 2VN2A 2Q5IA 1BIBA 5K1YA 5CLSA 2CJAA 4GO1A 4BH9A 5LJ5e 2VONA 4JQFA 3JCMf 3BZ6A 3CUQB 1AOYA 2WWYA 3LAPA 5D8LB 2A61A 1G51A 4ENNA 2G7UA 3SHFA 2BGCA 2VC8A 4M6XA 4DNCA 4CZZA 1HW1A 1ODDA 1SFXA 3HTZA 4HWSA 3JCMh 3BJAA 1SFUA 3WGGA 4KR2A 3F8BA 2QBYB 1IXCA 4G6QA 1MGTA 1LYLA 1D3BB 3NEUA 3P9KA 4XLPF 1TQMA 2KIUA 2V79A 2M1BA 3WE2A 2ZFWA 2Q2EA 1BBUA 5HDKA 3M7GA 2O61A 4BNCA 3HFZB 3BPVA 4Y17A 4CS4A 4P75A 1KQ8A 2R7FA 2JN0A 3RYRA 1MZBA 4TVAB 3FMRA 1I5LA 2ELHA 5LJ3d 4C92B 4RQEA 2XKPA 1UHWA 3F8CA 3IRQA 3SFZA 4HOBA 4KUMA 4YFKF 4K88A 1BI0A 3HXZA 4M78G 3DXJF 5HDGA 3M1EA 4P72A 3MF1A 4YRQA 1W7PD 2XV4S 4RAYA 2GXGA 1G3YA 1X2HA 4NL2A 4L5IA 4R1HA 4MQVA 3QO5A 4M7AE 1E17A 4HWOA 3GUDA 1MJAA 3JCMc 3R61A 2FEZA 3TUPA 5FD6A 2STTA 4XTVA 2QENA 3P8VA 4ESJA 1SAXA 4P5OA 3Q5FA 2OZ6A 2ODRC 2E64A 2YX4A 1PYSA 4EGZA 5E1XA 5ILUA 2HQRA 4UVCA 2DBBA 4A0ZA 2HQNA 3JCMd 4K86A 2ZMEA 4U0WA 2FYKA 1D8KA 1O3RA 4O6JA 5LLQA 3GIBA 3RERA 2XHKA 3QPHA 4KA4A 1E22A 4NB5A 1S6LA 5LJ3j 3CUQA 5DD8A 3GFMA 4RCBA 2ARSA 1SMTA 4HT8A 2L3DA 1JGSA 5ELNA 2DZ9A 4FHTA 2H94A 5KNNA 3A7AA 4ETSA 5JFRA 3A31A 3KCCA 2KIMA 4WCGA 2HKXA 2OQRA 4M77F 1I5ZA 2G7HA 1X2GA 3R07A 2QBYA 1WPYA 3GYHX 2JSCA 1D3BA 4P75C 4XEOA 2DT5A 3UGQA 4EM2A 1OYYA 1OYIA 2F2EA 2H27A 3HFZA 4A0XA 1HKTA 4H2VA 4M78F 1WI9A 1XGOA 4TVAA 1JBMA 2ESHA 1J5WA 4CH6A 2O6GE 4C92A 1D5VA 4P72C 3RKWA 3KEOA 3HXVA 2CYYA 5ICFA 4YRPA 3I59B 5L3GA 2XAGA 3E6CC 3L09A 2CQKA 4YDQA 2P6TA 1D3YA 5C52B 4RB0A 4N9IA 5GAN3 1CF7A 1HSTA 5GANf 2E7WA 1E24A 2HKOA 2A5YB 4EMGA 1FSHA 3HHGA 2CWEA 2WC2A 2L4AA 1KU9A 4B09A 3HXWA 3ZMTA 2G4CA 3HXXA 1S29A 1I6XA 2DU7A 3GO5A 2UWMA 5K5RA 2DPUA 5GANh 1P4WA 4OINF 1BOAA 3TO7A 3JSPA 4RB3C 4F7ZA 5LGNA 1N9WA 4A2UA 5D5WB 2M30A 3P7NA 2H6CA 4M77D 1G3WA 3KP4A 3SXYA 1BI1A 3QNEA 2ZCWA 3HUGA 2FSWA 1JE8A 1R1TA 3FJPA 3IC7A 2IA1A 1UFMA 2KKOA 3JSOA 1HW2A 3R0AA 2DKGA 1WQWA 5H6QA 5ILVA 3LA7A 4YRTA 4ASNA 4M78D 1BBYA 2L02A 5KVRA 4M75B 4P96A 3TQNA 4LLNA 2MBFA 1NYRA 1TH7A 1I81A 4CYDA 1H0MA 3REUA 4ENJA 4G94A 4PGHA 2Q7EA 1RNLA 2DTOA 3HSFA 2XAHA 1LDKB 4BHBA 4F7UA 4LG0B 2RHQB 2JPCA 4C92C 3P9CA 3QAHA 4K87A 4HT9A 4P74A 3BDDA 4M77E 3GFJA 4EJTA 2D1HA 2W85A 2JPBA 4Y91A 1ADYA 4UP8A 3I59A 1LVAA 3ZQ7A 4TVWA 1YCYA 1G3SA 1LB2A 1WLEA 4P73A 3CO6C 1FYKA 2UXNA 2RGVA 2YX7A 1FWZA 2DQRA 1NJ2A 3KETA 3RESA 3CDHA 4TQFA 1RUNA 2XAJA 2K27A 3ECOA 4OU0A 4KR3A 2ZTGA 2IPQX 2XTIA 3QO3A 4I0AA 5JI6A 2X4HA 2O03A 4KIBA 3KLOA 1BJAA 4O3MA 3F22A 3AAFA 1ZARA 2P6SA 2OBPA 5EEHA 1U5TA 4J15A 4ZTUB 1RUOA 3K69A 4A12A 2C8MA 1NJ6A 5IT9K 4IHSA 3I53A 3GZ6A 3F72A 3ELKA 3WTSC 3JCMW 3IHUA 4LNSA 4LLGF 2OU2A 3REOA 4M7AB 4WJ4A 2IRFG 2ZIOA 2V1DA 4TQDA 5ILSA 2P0LA 2EB7A 1R7JA 3LA2A 4HBLA 2MLGA 3GX4X 3HTSB 3L4GB 1YW9A 4KT5C 4UNOA 3JCMb 2IA0A 4Q5SF 3H3ZA 4M75A 3WGHA 5LJ3g 5DEQA 4AVPA 3I7FA 1ZAOA 4KYWA 3H92A 2Z33A 1P4AA 1EV7A 2HTSA 6PAXA 4JRKA 1USYA 4EGYA 3PCOB 2K4BA 2ZXJA 4LG0A 2RHQA 4YRCA 3KP5A 5GMKi 5GAOp 5F1RA 1F5TA 1B9NA 1Q1HA 3HTUA 4WK8F 5FD5A 2XUBA 1SFEA 3VU3C 2DO7A 4RDXA 2JZYA 2VC0A 4P73C 4YROA 1ZH5A 3MAJA 5L3FA 1F9NA 3COAC 1ZRDA 4CGZA 5TRDA 5LJ5g 3HY0A 1U6GA 1EIYA 1LOJA 1KOGA 5BPDA 1PP8F 2RDPA 2RD1A 1B34B 1LQ1A 3BW1A 3GW2A 3LA3A 3IL2A 4V2SA 5E3IA 2ZNIA 2ZT5A 4C8QC 3WE3A 2BE5F 4ZZDA 3T0YA 1EH6A 1U5TC 1EH7A 5E8IA 1HKQA 4R79A 2XKOA 1C0WA 2HNIA 3KZYA 1FP2A 1Z91A 2YLCA 1S7OA 1FY7A 4M7AG 4PCQA 4JUVA 2WTEA 3QRFF 2DU9A 5BQTA 2NNNA 1IN5A 4ZYDA 2TDXA 2CJ9A 3REXA 2ZXFA 4KQEA 3VEPA 4Z2YA 3SQNA 4WXDA 4M7DF 4M7AA 3F23A 3BJUA 2DU5A 2JTVA 3O3KA 4IRHA 5GAMd 4HDVA 4GXOA 4HWTA 2K02A 2VODA 3MEXA 1HK9A 2DFIA 2DQ3A 2DXUA 4FX4A 2JRTA 1USYC 1XSDA 2Y75A 4XTZA 4YPFA 2EV0A 4CHUA 3ECHA 3K9TA 1MGQA 5BPIA 1DPRA 1N9RA 2W24A 2KJBA 1OMIA 2ZGWA 2E5AA 2ZINA 3PCOA 3QU6A 1S8NA 2IJLA 2AMCB 2YR2A 1TQPA 1ZLKA 2C6YA 3C1DA 3GVAA 3L2CA 2XRNA 1TW3A 2A69F 2QHVA 1R1VA 2AXLA 2O8XA 4Y13A 2QLZA 1X54A 1ZRFA 1ZLJA 3F6VA 3C7JA 3L9FA 5GAMj 5KK1A 1B34A 3KLNA 2XGTA 3I0TA 1Z7UA 4AWXB 5LBQA 1O3SA 3O2PE 5D5UB 1B4AA 5LJ3e 5BOXA 4M7DD 1T98A 1YFTA 5GAN2 4HF0A 3IKVA 3TDUC 5CAIA 4XTXA 1PUEE 3I5UA 4CS3A 4PJOF 4L0ZB 4I09A 1PYSB 3P8YA 4UV9A 2VBZA 2EJ9A 2Q0OA 3D0SA 3QTCA 3V7RA 4CH3A 4LK0F 3M9AA 1YTYA 4M74A 3J80Z 3DPTA 1I1GA 3KP6A 4G6DA 2QYOA 1ZG5A 2YSRA 2F5EA 1H4QA 2HWVA 1ONVA 4EMKA 1KYWA 2DPDA 4XTYA 3JCMe 3VBBA 3JCMX 2VBYA 2PEXA 5DYMA 2RV8A 1R36A 3Q9VA 1B1BA 3LQQA 3HXYA 4M7DE 2LF8A 3OOPA 1S3JA 2M5WA 3R60A 5E8GA 3ZPLA 3EQLF 3D5LA 2I4LA 2HOEA 3RKYA 3HSBA 4HX7A 3WTVC 4H2WA 2AMCA 1X55A 2IP2A 1FPQA 4X9DA 3E6BA 2ZNJA 2H6BA 4QVDA 2IY5B 3VQXA 5LHHA 2E1CA 2GQQA 3IKMB 2PG4A 4ESBA 2FE3A 1KMNA 4EJUA 1ZGJA 5ERIA 3NENA 3LSQA 1QBJA 4KNYA 3H3UA 5FLXZ 1FBQA 4PJOD 4HV5A 1FP1D 1YLFA 1FC3A 5TJJA 5CVUA 2VXZA 2HTJA 2EV5A 4CH4A 4N0BA 4YRNA 3V8JA 5LRSA 1CF7B 3N4MA 2BV6A 3HOSA 4G8XA 1YG2A 1O3QA 4M77A 1R1UA 2Y90A 1HKSA 2W84A 2JT1A 3ROUA 4QVCA 3E3VA 3O6BB 1TQIA 2E10A 1LDJA 5BMZA 3HRTA 1XB4A 2L4MA 2RC4A 4YG2F 2EK5A 4YRMA 4A6DA 4OIPF 3E5QA 5L3EA 4EMKC 4WXCA 3JB9I 4KN4X 2HZTA 3E9IA 1ATIA 5DCFA 1DUXC 1TNTA 4GGGA 5J8CA 3TGNA 1OPCA 2AKWA 2ISYA 5HDNA 4CS2A 4QLCU 4PJOE 2ZKZA 4RQFA 4J6WA 3QPTA 3VOEA 1QPMA 2C7IA 4LJZF 5GAN7 2QZ8A 1ASZA 5E20A 1JHFA 3SZPA 5LGTA 1OKRA 2I4NA 2R7DA 1WU7A 1DPUA 1Z7NA 4M9XA 1XDSA 5HLIA 5J8FA 1U8RA 5CVVA 4A54A 5A2QZ 3W6JB 2W25A 1F1ZA 1YS7A 1XMAA 2XAQA 1BI3A 4C92G 2FNAA 4WF2A 3GXOA 1BBWA 4F7UB 4YIFA 2IY5A 4PGGA 5K5OA 1KU2A 1RIOH 5DUIA 4FT8A 1YW8A 2RHSB 5GMKh 3V8LA 1H4TA 1XCBA 2P7VB 3FX3A 1RI7A 4YRIA 2A6HF 1B8AA 1RZ4A 3CJNA 2FU4A 4PZJA 3RIRA 2XGXA 1QZZA 4M77C 3I4PA 4YRKA 4U88A 2PMEA 1X56A 4OOIA 2IA2A 3ZMSA 4PDKA 2LSOA 1U2WA 1KA8A 2VOOA 5GANe 1E2XA 1IUYA 3CUOA 2FBIA 4RB1A 2DVEA 3MZHA 2FB7A 3TO9A 3PFIA 4HAMA 3E6DA 2RQPA 1P6RA 3QO8A 4BQAA 5AONA 4P3OA 1F4KA 1NYQA 5D6EA 4MNUA 1MDMB 3EFRA 4C8QB 4M78C 2QTXA 3C3WA 2Q7GA 2YU3A 1U5TB 1K7AA 4XSXF 1NJ1A 4MGRA 4JRIA 1H641 4HA8A 4YREA 3ZMZA 1FX7A 2HYFA 2MA3A 4HX8A 3RYPA 3SWNC 3M4PA 2V1XA 3BFMA 3RI4A 2J3MA 3J81Z 1KU7A 3BROA 1B76A 5A2QK 1GHCA 1L0OC 2EV6A 1ASYA 4F7UG 4G84A 4U7DA 2QVOA 4OP0A 1Y96B 1J5YA 5L3BA 1TBXA 1W5SA 3OV8A 2DQLA 3M8FA 1LDDA 1EVLA 4I0BA 1T38A 2STWA 3TOBA 3U2RA 5GAN5 1XGNA 4I01A 3UGTA 4ENMA 2RHSA 5JHUA 4L9VA 4E51A 2V6CA 3F8NA 3QOPA 5E1WA 5GANd 5HLHA 1QNTA 2GWRA 4M7DB 1KMMA 3IWFA 3M4GA 1EIYB 1W5TA 4TWAA 1SETA 1YB3A 5GAOq 3A5YA 2GZWA 4C8QG 3UH0A 5DY9A 1T0FA 5H20A 4M78E 2FXAA 3TDZC 4EJOA 4N0AC 4O5VA 5K5QA 4N9HA 4B8XA 2I4OA 3FXQA 1MDMA 1LNWA 4C8QA 1Z05A 1HXDA 4HF1A 2VBXA 4OIOF 2FMYA 2XROA 2K7LA 3HFNA 1W66A 2CW0F 1YGBA 2FF4A 4UP7A 2NRAC 3QO7A 4G9YA 2F5FA 2OAZA 4MQ9F 4GYGA 2CJBA 3A74A 3J81K 2PN6A 4Q4ZF 5ICGA 3IKLA 1I27A 3FF5A 5F64A 5GANj 4M75G 4R8HA 4H02A 2COMA 4EQQA 1ZHFA 3A7RA 3OD1A 2ESNA 4KIFA 2NS0A 3GWZA 1NHAA 4ZZLA 2ZO4A 4U0VA 5FO5A 1K78B 3GFIA 1ZGAA 4IRIA 3W6KB 2Z3YA 2ZNYA 4RGXA 1SD5A 4Q6GA 2DK5A 3E9HA 5GAMe 2A3SA 2GA1A 4WX9A 3EETA 3VB2A 5J6XA 3W3SA 1Y96A 2HS5A 3I54A 4YRFA 2IW5A 3RGLA 5CVRA 3ABUA 2A68F 1J2XA 4H0EA 5F6FA 3HFVA 3RKXA 5IT3A 5ICCA 3WODF 2P5KA 1Z1DA 1A04A 1SESA 2OQGA 3RTRA 2CO5A 1FZPB 1W7PB 3BY6A 3KEQA 1IN7A 4AH6A 2E1HA 5JR3A 2I2LA 2CIMA 4M7DA 5HS9A 4A5MA 1FYLA 3T8RA 2ACJA 2FOKA 1KQ0A 1SMYF 2DLLA 5LHIA 1P2FA 3T1BA 1E1TA 1OR7A 3JCMg 3BJOA 4ZYGA 3JTGA 3MWMA 1MJ9A 3A32A 4EMSA 1G4DA 3N97A 3PGGA 4P71A 1GXPA 2MH9A 4G7OF 1USSA 4LGWA 3RDIA 3GLXA 3NETA 3DKWA 4Q48A 2BBYA 3EUHA 3MZYA 3GFLA 1IN6A 2LDUA 1KGSA 4UUVA 2LKPA 4ESFA 1QF6A 3LWFA 4OMYA 3F8MA 2ARUA 3F8FA 4M75F 2FRHA 1J59A 1WRJA 3WTZA 4EVIA 4Y15A 3ERRA 2OD5A 3FIFA 3JB9G 1FYMA 2DTIA 2MD5A 2HGCA 2Q8KA 5E18F 5ICEA 3HRMA 3FM3A 3WTUC 2ISZA 4X9CA 1YFHA 1J75A 4EMKB 3JAMZ 1XSVA 4CICA 2WV0A 4IF4A 2RB6A 3KP3A 2G9WA 5LRRA 1K78A 3BJ6A 4L9NA 3U1DA 3T5XA 1LJ9A 3JCMP 4MEXF 1YW7A 1GGMA 3E97A 3WTXC 1K6OA 1ON2A 1VQZA 3DFGA 4A0YA 1GVJA 1ADJA 1USTA 1ZREA 4BHCA 1N9SA 3ULQB 2K57A 4P55A 4M7DC 3IRRA 1BC8C 1J7KA 2A07F 2Z9OA 2ZZFA 2E65A 1HC7A 2EA2A 1REPC 2UZKA 1W7PA 1KQ1A 2W57A 1T6SA 2OZUA 4HWPA 3DV8A 1SD7A 4L9JA 3JCMQ 3LC0A 4G7HF 4M9ZA 1KQ2A 3P9IA 3VODA 2FNPA 5HS7A 4BAYA 3GF2A 3HYIA 1XGMA 4LB6B 5ELOA 4KIGA 2PBIA 4EO4A 4P71C 5FB2A 4HLYA 4M75D 3JCMJ 1SRYA 1FNNA 4M7AF 4HQMA 4L87A 3HXUA 2M87A 5D4SA 4M77B 3I58A 3FXRA 2DTHA 3HHHA 2KRFA 1TNSA 4H2XB 1ON1A 3JB9F 3GEZA 5H6RA 4IXAA 1XDUA 1EQRA 3ZP5A 5LGUA 5LJ3f 2E7XA 5GMKl 3VFZA 4RB2C 5DUKA 3PQJA 5BS6A 1UHMA 4M78B 4I02A 3HRSA 2XIGA 4YFNF 2V1UA 3FMQA 3U9GA 2M8EA 3I64A 5AIQA 1IRFA 3DPLC 4G85A 2IVMA 3HSRA 4MTEA 3L1AA 4ZYHA 1ZG1A 3NELA 2Q7HA 3VQWA 2AKWB 5HVQC 2EJFA 5LJ3h 1G6NA 2LNBA 2DI3A 4WJ3M 3V7CA 1YYVA 3SWNB 3FWEA 2RNJA 3NRVA 5D4RA 1S7AA 5GAOl 3ICAA 5GANg 2D45A 4KMFA 5LJ5f 3NEMA 1T2KA 4ZTZB 4PJOC 4XU1A 1IN8A 2EA4A 4OIQF 2P8TA 1P4XA 1IAWA 3KFWX 3F21A 2VBWA 3IKTA 5GAOn 5LEKA 4KDPA 3I71A 4IPAA 3FB9A 2FBKA 5JVTA 1MJBA 1WNLA 2BEOA 4UXNA 5DDGA 5LJ5h 4NL3A 3LQRA 5FFXA 1H4VB 2PLYA 3ZMDA 4M7AD 4EX5A 4MHGA 2H09A 4HV6A 4YP0A 4QWQA 4ZH4F 1I4K1 3QU3A 2QQ9A 1BN5A 3RL6A 4EJVA 1B9MA 3IG2A 1YO5C 2PQ8A 5ED4A 4M77G 3JB9D 2ADUA 2CSOA 2L01A 1U3EM 1MKMA 1FT9A 2ZJ2A 4CH5A 4RGRA 1TW2A 4TV7A 3BY7A 3HIFA 2ZR3A 3CMQA 2VXEA 1HW5A 2QHSA 2X0LA 3K1MA 4XRFA 3S2WA 5GAN6 4YRLA 1SERA 2ZCEA 4H2XA 2RN7A 1WKMA 2NAZA 1FLIA 1R58A 2Y0MA 4UP9A 4YRGA 4KFCA 2E3CA 4P3PA 3J80K 2DDZA 5E1ZB 3ZN1A 4G7ZF 4GCVA 3QUIA 3WTWC 4BHPA 2J3LA 3KE2A 5D5XB 4M78A 3Q9SA 1EH8A 4TVYA 2HR3A 3M8EA 3WGIA 3ISPA 1RIQA 1W4MA 3RUXA 4EJWA 4IHTA 5LJ5d 3M4QA 5DCMB 4PNOA 4H2UA 1ZN2A 1Y0UA 1YQAA 2VT3A 2P5VA 4A5NA 2XVCA 3SWNA 3TEHB 1O57A 1L0WA 2P5IA 1ZRCA 2E41A 4MMLA 3AHUA 1UB9A 1QZYA 2L54A 1KU3A 2VC1A 4AD9A 1H9TA 3FZVA 5E17F 3HRIA 3MFKA 1X01A 3ZMUA 1WQ7A 2QHUA 1O7FA 3HRKA 2M45A 1B70B 2FA5A 1WSUA 1J9IA 2FBHA 3EYIA 1T39A 4PHCA 5GMKe 1IRGA 4HX4A 2KJCA 4BXUA 4LLLA 3HFOA 5K1XA 5HOOA 4M71A 2EFPA 3JB9J 4M6YA 2ODRD 1BI2A 1TTYA 4MTDA 1CGPA 3UFGA 3NQOA 2VE8A 4XQ3A 5FLXK 4OMZA 4ZYEA 4L18B 3MCZA 2K86A 4NHJA 2ZT6A 4LMYA 5FGMA 3RPUA 4HQEA 2MC3A 3FHZA 1K79A 5K1PA 4GYIA 5LJ5j 4M72A 2ZZEA 1KQ9A 3JW4A 3F6OA 3DF8A 4UHTA 4IJAA 1FBSA 4HLXA 3WQZA 5CYVA 1KYZA 4OIRF 4M9SA 1LEBA 1J0RA 2HYGD 4JBAA 1BC7C 5GAMg 1R22A 3C18A 1V3FA 5D5VB 3KFUA 2J5PA 2Z99A 2P5LC 1SD6A 1STZA 4JLIA 4NQWA 1E1OA 1PDNC 1QE0A 4N0AA 3E5UA 4IVNA 5CVJA 2VXFA 3K0LA 2PMFA 4P3NA 5D6FA 2ZBKA 2HDCA 3BWGA 2VT2A 4NCXA 1QGPA 1YIOA 3CO7C 2EAYA 2O0YA 5DCMA 2CGPA 1H4SA 1LJOA 3ERED 2DTRA 3R4KA 5EEGA 3TEHA 2DAOA 1YFSA 1DDNA 3CUQC 4EV0A 1BM9A 4XEMA 2Y48A 5C53B 4MMKA 4C92F 4DPGA 1ZYRF 2R3SA 3QHSA 3HY1A 5AIPA 4RMFA 1I1SA 4L5JA 1B70A 2NNYA 4YYEA 5IT9Z 3KZZA 3VQYA 5GMKm 4LB5A 1OYWA 1O3TA 1YFRA 4KMUX 2F5DA 3R6SA 2PJPA 4Q47A 1U1TA 4BYYA 4YRSA 1IXRC 3EFSA 3PQKA 2EWNA 1R00A 1DP7P 1XGSA 4U0YA 1SD4A 4NOYA 3INZA 5L3CA 2ARTA 5D8KB 4YCWA 4M73A 1BIAA 3B73A 5LEJA 3WU1B 1FYFA 3KP7A 3RJPA 3K1PA 1IW7F 2PI0A 3HRUA 5GAOm 5I21A 3RPQA 1O7LA 5GAN8 3BP8A 3LAJA 2EJGA 5GMKj 2GA2A 4AIHA 3FXUA 4JK1X 1Z6TA 4HF2A
chains in the Genus database with same CATH superfamily
1HSJA 2CH4W 4PG3A 3LFKA 1AA7A 2BY3A 2F5CA 1L3LA 4BDZA 3MKYB 1FOWA 2WSCE 5EG0B 2RJEA 1JJCB 3BPXA 4XK8E 1OPKA 4Q15A 1Z6RA 1E3OC 2DJZA 3E5XA 1M5Q1 4ZTJA 1WGSA 5CKBA 1EVKA 2EW3A 4LVIA 2K6DA 1BR1A 3VWBA 4D8KA 2MD0A 4I2OA 2LCCA 3TOAA 4PLIA 2IT0A 1BU1A 4OVAA 5DV5A 2RH2A 2YLBA 3QPLA 3CCST 5IHIA 4UPAA 2J5OA 3BR2A 3FM5A 4XLNF 3CC4A 2ZT7A 4D5CA 4BWAA 2HEOA 2D2WA 1HQCA 1IGUA 4TTVA 1BJZA 5D6WA 4KN7X 3CCRT 2KIFA 4N4NB 3LH0A 1NYFA 1JKQC 4RBOA 2UXXA 4KGZB 3OS0A 2EVRA 2DA1A 1O9SA 4ZIBA 5GAN4 4CCKA 3ABTA 3HKZN 1XMKA 2RA2A 1K4US 2GLOA 1YJNT 2M4KA 3IH2A 4A3EJ 3GZ5A 3KP2A 2EKHA 4L0YB 5M3FJ 2QUFA 3HSEA 2AKKA 1NJIR 5KYXB 2ALYB 1PP7U 4H2YA 1EFWA 1RR7A 2XDBA 2DRKA 1W2BS 2X6XA 1DP3A 2DEQA 4B3AA 1MBFA 1YS6A 4HYEA 4FYWB 3Q3SA 2ZZGA 3EDPA 2YUQA 2X35A 2DTZA 4WTOB 1Z9CA 1WXUA 3JRDA 2XASA 1OJLA 2QXFA 5FU6B 1PKTA 2FRWA 5EEAA 2M0MA 4WWCA 2GXBA 4F7UE 2I4MA 3OYGA 4H2TA 3HL2A 3LW5E 4ZJZA 1TLHB 3FIWA 3QYGB 1X3UA 2L3SA 3BR0A 1AU7A 1MD0A 5IY5H 1AWOA 4OLFA 1B8IA 3M07A 3WTYC 2Q2EB 3H9JA 2A6EF 4J19A 1VQOI 4XU2A 3G2BA 3HHTB 3PZCA 2FOWA 1NJ5A 3CC7T 3FKIJ 2GQVA 3N05A 2E1NA 3M58A 1KZHA 2QSFX 1WQ2A 2B0LA 1X2KA 4JZ4A 1PJRA 3OYMA 2YRVA 4BJ6C 2EINH 3MF2A 3JAMK 4A3GJ 3ZQFA 2EL9A 5C4XJ 4FCYA 2ZT8A 1W70A 3VS0A 1WX6A 1GXIE 2MAMA 2ZMEB 5DD4A 4IL6C 4M75E 1RAEB 3OSGA 1B7YA 1BIBA 2DL8A 4EIKA 5K1YA 1XOVA 5CLSA 2CJAA 4BH9A 2R93J 4C5IA 2VONA 1D1AA 3OYIA 3LAPA 4JYKA 3CLQA 4FTHA 2E3HA 4ENNA 3VYTB 4ZYAA 4M6XA 3META 4NC8A 1HW1A 1SFXA 4LXCA 3VYSB 3WGGA 1PG5B 3MEWA 1IXCA 1LYLA 1D3BB 2NUTB 4XLPF 1TQMA 2KIUA 2V79A 1UG1A 2ZFWA 1BYMA 3MMYB 1BBUA 3M7GA 5IT9E 2O61A 2K5CA 2KSSA 2JN0A 1F1BB 4J9GA 3FMRA 1I5LA 3GNGA 5LJ3d 4VUBA 2IVWA 4HOBA 3RR6A 3M0TA 4YFKF 4JJNK 2KNBB 4K88A 4P72A 4C3IJ 1W7PD 2XV4S 2L9RA 2KGTA 4NL2A 4R1HA 2ECZA 2X4XA 1IXDA 3JCMc 2CUDA 2STTA 2QENA 3P8VA 4ESJA 1VQLA 3KBGA 2OZ6A 4E2FB 2E64A 4EGZA 2R7VA 2BZ8A 4U0WA 1W0TA 2FYKA 4O6JA 1AWJA 5LLQA 3GIBA 3RERA 3QPHA 4KA4A 1E22A 5LJ3j 5DD8A 1N75A 2H94A 1R0CB 1ZUYA 3A31A 3WHCA 3KCCA 4BU2A 3JRFA 4LIVA 2QBYA 2MABA 3GYHX 2V1RA 3S6WA 1KC8R 4A0XA 3ABKH 3OSVA 3CCSA 3M8JA 1JBMA 3MVPA 5FKOA 2O6GE 3QYBA 3RKWA 1PSEA 4MDXA 2CKKA 5ICFA 4YRPA 2QGGA 3I59B 2QA4T 3CCRA 2A5YB 4EMGA 1FSHA 2MCNA 3GF5A 2CWEA 2WC2A 1KU9A 3HXXA 1P4WA 1BOAA 3TO7A 3JSPA 5LGNA 1N9WA 1QWEA 1YJNA 2Y9YA 3SXYA 3GCMA 1ORKA 3ZRGA 2L9VA 2P0PA 4DJAA 1JE8A 5GTHC 4JJBA 2IA1A 3FK7A 1WQWA 5H6QA 2Y30A 1VQPI 4YRTA 1X6GA 2VUMJ 1BBYA 2DX1A 1R5ID 2L02A 5KVRA 4RLFA 4M75B 3JRIA 2LR8A 4LLNA 1NYRA 2BY0A 1I81A 4CYDA 1SKUB 4G94A 2Q7EA 2MSYA 1WI3A 2XAHA 6AT1B 1LDKB 3KYLA 4W1UA 2JVVA 4II3A 2JPCA 4C92C 3P9CA 4K87A 3VS3A 3BDDA 3I5SA 2QDLA 4Y91A 2GXAA 4UP8A 3ZQ7A 2ZB9A 2EYWA 3P8HA 1W5CC 4QT7A 1TT5B 2IS6A 3CMAT 3ECOA 4UC4A 2ZTGA 1NPRA 3FRNA 1XQHA 4RM3A 4MZTA 3QO3A 1PSFA 2VPLA 2X4HA 3PFYA 1BJAA 2ME0A 3QYEA 3NARA 2P6SA 4J15A 1RACB 3ME9A 4XRSG 2VKEA 4BACA 3ELKA 5EGOB 4LNSA 4LLGF 3CC7A 4FIBA 2DL5A 1KSWA 3ASNH 4XRSA 3EHQA 5ILSA 1OU8A 2Y4YA 4TQDA 3OYLA 5F27A 5DLOA 5IP9J 3REBB 5HCKA 2HPMA 5LJ3g 1K73R 5DEQA 1TG0A 1YIJQ 3I7FA 2Y9ZA 1M1EB 2LJ3A 4KYWA 3H92A 2JTEA 2K4BA 4C9YA 4LG0A 4KBMB 5GAOp 5F1RA 3A8GB 4WK8F 2V8KA 2DT6A 3VU3C 4Y7NJ 1MV3A 1UE9A 4P73C 3LWHA 4YROA 4DIQA 1F9NA 1QVFS 1FJLA 4RTVA 3OS1A 2DXBA 3I4MJ 4IHYA 5E3IA 5CKEA 2ZNIA 2YWWA 3GTOJ 2PMZA 2BE5F 1U5TC 1UHFA 1Z91A 4Y3OA 2R7OA 2K5IA 4PCQA 2DU9A 2EYZA 5BQTA 2KT0A 1NG7A 2O88A 1X2QA 4XKBA 1VQKT 3SQNA 3C94A 4IUTA 4XK4A 2DT7B 3A0BC 4HWTA 3MEXA 3M59A 3A02A 2XB0X 3H6ZA 2CS3A 5FU7C 3NMZC 1UGVA 1MGQA 1DPRA 2ZGWA 3K7AJ 1H8AC 1YJ9Q 3CCET 3PCOA 3ONQA 5FJ8J 2M1HA 1TQPA 2JMCA 2XF5A 2QLZA 1ZLJA 1O4XA 4AU7A 4LVKA 3NTIA 2C06A 4LN2A 1K9MU 2IGKA 3R6OA 4AWXB 1BB9A 1X2NA 5LJ3e 5HLTA 2MG4A 5GAN2 4HF0A 1YJWT 4CS3A 1SHGA 2EGEA 2XIDA 3P8YA 1POGA 2VBZA 2BOLA 3D0SA 3HOXJ 1Y0MA 4KULA 3V7RA 3S16J 3PO2J 2QK0A 4LK0F 3FLGA 3RZDJ 1QW1A 1A0NB 2JUGA 4M74A 3KP6A 1ZG5A 2F5EA 2LBFA 2QA4A 2UUZA 1IRXA 2AZSA 1H4QA 2DPDA 1UECA 4XTYA 1LFBA 5DM6F 5DYMA 4NNJA 5I22A 5FRMA 1R36A 1B1BA 2O7OA 2CV1A 3CCUT 3EQLF 3MQZA 2I4LA 2QEXQ 4M3FA 1WGXA 4H2WA 1MIJA 2IP2A 2ZNJA 4QVDA 3A8OB 2GQQA 2R7RA 1KMNA 3A0HC 5M5XJ 2QSHX 1RAHB 5ERIA 3NENA 3LSQA 2AXTC 4KNYA 3H3UA 1FBQA 1GCPA 2FL7A 2DMQA 4N0BA 3G1MA 3N4MA 4M77A 4M3GA 2Y90A 1HKSA 2JT1A 1PUFB 3O6BB 5L23A 1P9QC 2KE9A 2EK5A 3H5RA 5J1UA 1H8KA 5L3EA 4EMKC 4WXCA 1VQ5I 1OCPA 1TNTA 2O5RA 3PNWC 3HPWA 2AKWA 4QSHA 3DU5A 2JQ7A 1TSFA 4RTYA 1QP2A 1OPLA 3CMAA 1IO2A 2VJ5A 1QPMA 3CMMA 5J3BA 3LLRA 2BHYA 2N8GA 1ASZA 5E20A 3SZPA 3DLLA 1U8RA 5CVVA 4A54A 5A2QZ 4D8DA 4OB0B 4IHVA 1XMAA 4KGXB 4C92G 4WF2A 2D9TA 2IY5A 4PGGA 2FHDA 5K5OA 1RIOH 4FT8A 1D09B 1M3CA 1H4TA 1RI7A 1B72B 3DEWA 2A6HF 1TWAJ 4CC7A 2FU4A 3RIRA 1HD3A 2PMEA 2IA2A 3ZMSA 3F0CA 3OA6A 1U2WA 1KA8A 3PL8A 1ETWA 1GVDA 2C0TA 1RESA 1ZSZC 2B9SA 3E6DA 2RQPA 1BW6A 4BQAA 1NYQA 3MP8A 1YHQQ 3S14J 1IREB 4MNUA 4C8QB 2DPPB 4FE7A 2PNIA 1FIAA 5J4VA 1VQ8T 2CH0A 2DF6A 1Q81U 4L5EA 4WCIA 1KK7A 1H641 3VKIA 2OAUA 2DRMA 1FX7A 2JA2A 2OTJQ 2A3LA 1ZR2A 2VJJA 4C5EA 1K4TA 2YDLA 1GHCA 2CP0A 1L0OC 4OMNA 2QYZA 1M9SA 1ETOA 2JZ2A 5DTDA 2FJ1A 1OFCX 3WVDB 1W5SA 2DQLA 2R92J 1VQKA 1QPIA 4C2MJ 1RI9A 1I3AA 5JHUA 1OISA 2CUEA 3LWIA 3QBYA 2DETA 4Q5WA 2ZXWH 4EDUA 1NBEB 1EIYB 1X1PA 2XGDA 3PSFA 1WHGA 1Z77A 2X9HA 5FKKA 3CCJQ 5DY9A 1K8AR 2L5QA 2I10A 1MHNA 4N0AC 3F70A 2LVSA 4O5VA 2X6OA 2MWOA 3CCEA 2OX7A 3FXQA 5LD2C 1Q1VA 1VQ6T 2LFBA 2D0QB 3RBBB 5CK9A 5E3NA 4UP7A 3QO7A 2CJBA 2PN6A 3I55Q 1A5JA 3G6EQ 2XGEA 4BJTA 3H0DA 3H9GA 1ZGWA 4EQQA 3OD1A 4PFPA 4KIFA 3RNJA 3A01B 3W6KB 2Z3YA 1YIJI 2ZNYA 2M16A 3E9HA 3P8DA 2A3SA 2GA1A 3EETA 3VB2A 1M90U 1YJWA 1Y96A 3MKDA 3I54A 1Z9ZA 4A4EA 2IW5A 1Y8RB 2H8WA 4BL0B 2IEKA 4A3MJ 1E6GA 2L7ZA 3RKXA 5ICCA 3WODF 1SESA 2CO5A 5JR3A 1IDYA 1UAAA 3OYBA 2I2LA 1PCXA 3L2RA 1JTYA 5KCMA 2KP6A 3JCMg 1FTZA 1S72T 4ZYGA 3JTGA 3DTKA 3A32A 1IUFA 3ZR8X 1G4DA 3N97A 4IHXA 2DYRH 3CCUA 4P71A 2MH9A 1W0UA 3CPWP 1A35A 1WJCA 2BXYA 1WLPB 3MZYA 1AHDP 2K85A 4D6WA 5FROA 3OYAA 5KYWA 4C0GA 3LWFA 1CQTA 3GTLJ 3VYUB 4M75F 2FRHA 1J59A 5J4YA 4Y15A 2EIFA 1QKWA 5FLXE 3OYKA 2KR3A 4BY6B 5E18F 5ICEA 3HRMA 3OIQA 1PD0A 3WTUC 1YFHA 2D5VA 4C2TA 1K9MC 2RB6A 5LRRA 2G9WA 3M0UA 5CKDA 4JDSA 1K78A 2F4OB 2LG4A 4MZMA 3U1DA 4CYCA 3O8HA 4BE1A 3T5XA 3DTEA 1M2VB 1UUEA 4MEXF 2ABLA 1GGMA 1UZCA 3WTXC 1YJ9I 1VQZA 4A0YA 1ADJA 2K57A 1J7KA 2Z9OA 1WJAA 2ZZFA 2WB1N 2KQWA 1VQMQ 4HWPA 3DV8A 1SD7A 1A36A 4L9JA 1MBKA 4M9ZA 1KQ2A 3P9IA 3VODA 3GF2A 3A8HB 4AIDA 2QG9B 3HYIA 5ELOA 1QQJA 4EO4A 4DBQA 2L8DA 1QU3A 1VZ0A 4HQMA 2DA7A 4L87A 4V19K 2M87A 2EYQA 2CU7A 1JKRC 3I58A 4C0FA 2KRFA 1T3SA 4OAYA 1Y1WJ 3PTAA 3JB9F 2BZYA 3GEZA 5LJ3f 5AYFA 2R7SA 4KRTA 5BS6A 3HRSA 2V1UA 5AIQA 2IVMA 2QGUA 2AQEA 4ZYHA 3NELA 3HJEA 1A6QA 2J7IA 1I5OB 4Z6YA 5CQYA 4OB3B 4P1WA 1TUDA 1GBRA 2XHCA 1OZ3A 2QEXI 4LITA 2EA4A 3JR9A 1P4XA 3KFWX 1IO6A 2O4XA 1VQ8A 5JVTA 1HA8A 5IYDJ 2ZPBB 2OTLQ 1UTIA 5LJ5h 5GPAA 3OBYA 4EX5A 3B6CA 2DL3A 4A3KJ 4YP0A 2BW3A 2DDAA 2HVSA 3MKWB 3QU3A 5IPAA 3RL6A 4EJVA 1T3LA 5ED4A 4HVVA 2L01A 2ROLA 4A3JJ 2DBMA 3BR1A 2VWFA 2RJFA 4RGRA 1TW2A 3X2QH 2CP5A 3L1PA 2ZR3A 3HIFA 3CMQA 1F36A 2PJRA 3EGDA 3S2WA 3UT1A 1A31A 4HSRA 4YRGA 1ZSZA 2E3CA 4P3PA 1BCOA 3J80K 3ZN1A 3QUIA 1EH8A 1NK3P 3M8EA 3S15J 3HDDA 5LJ5d 3QWYA 1TWBA 3E19A 1ZN2A 4E7IA 1YQAA 2PZ1A 3M57A 5FU6C 1WJSA 1L0WA 2P5IA 1ZRCA 1GBQA 1UFFA 2L54A 1BA5A 3BG7A 1BK2A 3HXLA 4AD9A 1WQ7A 1O7FA 1T39A 1U06A 1VQ6A 2MF2A 1JB0E 2E5NA 5K1XA 2TRTA 4M71A 4AYBA 3JB9J 3MPUB 3LGLA 4MTDA 3GBQA 1Q81C 5KYYA 2VE8A 1OCCH 4XQ3A 4OMZA 4ZYEA 4E47A 3MCZA 2ZT6A 2E71A 3RPUA 3JRHA 5C44J 4RAFA 4LVLA 4FISA 2F4IA 1K79A 1VYUA 2VL8A 5LJ5j 2CUZA 3LSRA 3JW4A 1MV0B 5HNHA 2NVQJ 1UJ0A 2PTKA 1FBSA 4HLXA 4OIRF 1VNDA 4HNTA 5D5VB 2JNGA 2LD5A 4OGEA 2HAXA 2CZ6B 1STZA 1MMAA 1VOMA 4NQWA 1V55H 1NEGA 5JLXA 4N0AA 2HQXA 4IVNA 2VXFA 1K83J 3NWTA 1AWWA 2HDCA 2VT2A 1YIOA 2ZMEC 2O0YA 2CGPA 2VB6A 1H4SA 2OTJI 1LJOA 4BGDA 1BM9A 4OGCA 4MMKA 2R3SA 1I1SA 3FXLA 2LY1A 1RETA 1B70A 2NNYA 5IT9Z 3KZZA 1TWHJ 3MJXA 2ID3A 1OYWA 1O3TA 3L2QA 2F5DA 3CCYA 5GPCA 3EFSA 1YITQ 2FX0A 1DP7P 2ED0A 4U0YA 2E6NA 1WH7A 2CZ7B 5D8KB 2BY1A 4YCWA 1QVUA 1BBZA 3BCBA 3NWSA 5GAOm 1M2OA 5I21A 1OOTA 1O7LA 3BP8A 3A1YA 3VSLA 4AIHA 3TMOA 3LMMA 4JK1X 1Z6TA 4HF2A 2XK0A 1HDDC 1T0HA 1PHTA 2XMFA 3DU6A 1OV3A 1SRLA 4XQFA 1M90C 2EKOA 3IH4A 2QHTA 4PSWA 2M8GX 3ML6A 3FJ5A 2DL7A 5E3OA 3OYNA 3DLAA 1VQLQ 1G3TA 3TL4X 2KK4A 2V7FA 4C92D 1DGWY 2MW8A 1YRNB 4YIIA 4J9HA 3G6EI 4XNFA 3LSTA 3TO6A 4RUGA 5J47A 3DP7A 1DU0A 4MEYF 3A5ZA 3V8KA 3FISA 2K9NA 1XMXA 3WXMB 4MIMA 3OYFA 3ZGKA 1VQ7Q 3JCUC 1B6AA 3LSSA 4LK1F 1U78A 1Z7MA 3CCQT 5JLWA 4EM0B 2F1LA 2LDMA 2MLKA 3TBIA 4HZFA 4CO8A 3DKMA 5IXBA 2MWPA 5E3MA 2EFQA 4C92E 1LFPA 3L7WA 3FXJA 4S04A 4C8QF 3W2AA 1TU0B 3A7UA 4AIJA 2EZHA 2PFBA 3S8PA 2V9KA 5C51B 5L3DA 1FOKA 4J5YA 1VYVA 3J7AF 1GXQA 1NNHA 3O8GA 1AT1B 1IRZA 3CCRQ 4A4HA 2EGCA 1OCOH 1R71A 2OA4A 2PUKB 4N4HA 2CMPA 4EM1A 4UVAA 3K1NA 2VLAA 5EG0A 1QVPA 1JJCA 1CKAA 3EPZA 3X25B 2O31A 5KH6A 4RGUA 1G5HA 4PUSA 2PMUA 1C0AA 2XF6A 3F3XA 1XN7A 3MP1A 4KICA 1BW5A 4BW9A 1FBUA 2P0WA 2BZXA 2BHZA 2CG4A 4JX5A 2JA7J 2LF7A 4J6YA 2HBPA 5GP9A 4HVCA 5FFZA 3W3CA 4CCJA 1DGRM 2HBWA 2DMTA 1V5EA 2GIZA 4UVBA 4P9UA 2ETHA 1WYXA 3A03A 2F5VA 2QQBA 4M75C 4U7BA 3L4GA 3LSIA 3G3ZA 3SFIA 1VQMI 4K2EA 1K6YA 1VQOT 2CGHA 3RACA 4XOTA 2E2IJ 4G6TB 1ETKA 2MH2A 1B3QA 3HGYA 4ESRA 1VTNC 1UHSA 4RG2A 2E6ZA 4P9FA 4XTUA 1Y57A 4S05A 1KQSA 1QCOA 2VV5A 2LMJA 2E3IA 1IHWA 2WBMA 1YP5A 4L9TA 1RLPC 1JJ2A 1LEAA 1D8JA 1IG7A 2OCEA 1JRIA 3PMIA 3QXEB 2O9VA 4B4CA 5KYXA 2ALYA 3PIPF 2XDDA 2LCLA 1Q86U 4I7HA 2DODA 1JXSA 2HDDA 3K10A 1YE9A 1K61A 4CCNA 4XU0A 4RS8A 3EG0A 3G1JA 3BOQA 3FMSA 2EQMA 1G5IA 1ZG3A 2VN2A 1BKBA 4AFUC 1D1BA 1X3ZB 5LJ5e 3CQTA 3JCMf 3BZ6A 3CUQB 1AOYA 1AEYA 2F5TX 2I8DA 2OTLI 4DW6A 2A61A 4CCOA 2YUOA 4QPOA 4M3DA 4HWSA 3BJAA 4D7NA 4G6QA 1MGTA 3AG3H 1NLOC 3L2VA 2CRGA 4LUDA 4M6VA 2M1BA 3PM1A 2Q2EA 1WJBA 3GMEA 1U3OA 3EGUA 2ZAEA 3HFZB 4P75A 5M5YJ 1GDTA 4C92B 4RQEA 2XKPA 1Z7LA 3IRQA 3SFZA 2QQ8A 1VUBA 5HK0A 1BI0A 3HXZA 4M78G 3DXJF 2X9DA 2XSDC 3M1EA 4BQNA 5IHNA 4L5IA 2YSQA 1E17A 4F55A 4CH7A 2FEZA 2P84A 3OIOA 2IG0A 5H2FC 3DKXA 1SAXA 4P5OA 3JRCA 1PYSA 4BB7A 3MN2A 2HQNA 4K86A 2ZMEA 1XPXA 1NG2A 3CCVT 2R7WA 2HKNA 4JLGA 2H8RA 2XHKA 1I1JA 1S6LA 4RCBA 3GFMA 4BS9A 1JTXA 1SMTA 2DZ9A 2QQSA 2XDVA 2KIMA 2P81A 1FMVA 1IJWC 2F6CA 5CKTA 1PYVA 2G7HA 2RHYA 1HF0A 1MNEA 2E4HA 2JSCA 1D3BA 2NUTA 1Q7YU 2DT5A 2BVMA 1GT0C 4IUPA 3AKZA 1RKTA 2F2EA 1UJYA 2Z1DA 2EILH 1N8RR 3CCQA 2ESHA 1J5WA 3CCMT 4LDXA 2NOGA 3KEOA 3HXVA 3G4ST 4ZGDB 3WU2C 5L3GA 2XAGA 5KYUB 2IGNA 2P6TA 4JS5A 4YDQA 4DEXA 5GAN3 2VJIA 2E7WA 1E24A 3ZMTA 1YI2A 4BBRJ 3L2UA 4FW2A 2EIKH 3DBRB 3DEEA 4ZC3A 4XAXB 1VQPT 4RTTA 2LRDA 3D1NI 4F7ZA 4A2UA 3P7NA 4CUGA 4B44A 3KP4A 1BI1A 2ZCWA 2JUCA 1R1TA 1Q82U 1X1DA 3IC7A 3M55A 1WPKA 3JSOA 2KKOA 2F5KA 3MP6A 2AIRB 1YITI 4ASNA 1JEGA 1H3ZA 4HKEA 4CC3A 4JX6A 4GFBA 2KYBA 5HK3A 5CQGA 2MBFA 1V5GA 4RTUA 4ENJA 2EYYA 4IX7A 5FU7B 1OX8A 3HSFA 3OBWA 2RPNA 4BHBA 4R56A 4F7UA 1MUZA 3OR2C 1LKXA 2XC7A 1R4MB 1OX9A 3DLMA 5I2SA 4EJTA 2OV7A 3SEMA 2D1HA 4AG2C 3Q0UA 1Y1VJ 1T33A 1Y6IA 3I59A 4TVWA 1YCYA 3UPUA 1G3SA 1WLEA 1GV2A 2UXNA 2DQRA 3AL0B 3KETA 1VQLI 2HQEA 2FZKB 4DOWA 4TQFA 1OZ2A 1VQOA 2DE0X 4OU0A 2M0OA 1LPLA 1SSFA 2D8HA 4CCMA 3RPUD 5JI6A 4JX4A 4KIBA 4O3MA 1GUUA 2MIOA 1ZARA 4C3JJ 3LSGA 1IB8A 1TWCJ 3QZ9B 1IC8A 4A12A 1VQ7I 2C8MA 4IHSA 3CBOA 3HKZA 1AKHA 3GZ6A 3TEDA 3ZQCA 1BR4A 2MYSA 3OS5A 2OU2A 4ZNXA 2V1DA 1GCQC 2P0LA 4M3EA 4AFSC 4ELZC 2RK1A 3LA2A 4HBLA 2MLGA 4LUEA 1XC5A 1RAGB 2HKQB 3OOUA 2X4YA 4J01A 3UKGA 3H3ZA 4M75A 3MCAB 1MBGA 1TWFJ 3WGHA 2M7AA 3K4NA 3HOVJ 2KZGA 2CT4A 1MSEC 1P4AA 2HTSA 6PAXA 2XF7A 3CPFA 4JRKA 1H3HA 1F5TA 5FWBA 2L3RA 3CPWS 2Y0SN 4HCBA 1SFEA 4RDXA 2JZYA 1VQNQ 3MAJA 3CCRI 4CGZA 2DEUA 3K6GA 3J7AY 1T0FC 2DOEA 2RD1A 3ESWB 3OSSC 1B34B 4LDUA 3GW2A 3IL2A 2LNHB 4V2SA 3A8MB 4C8QC 2X1CA 3WE3A 2OCCH 2P4TA 1EH6A 2XB5A 2DCEA 4R79A 1T0JA 1FP2A 2HYJA 2DYIA 3WG7H 1FY7A 1WJFA 4PJ0C 4E7ZA 1X27A 3QRFF 1IN5A 3REXA 2TDXA 1Q86R 3QKJA 4ZDLA 3C2BA 3VEPA 4Z2YA 5EGOA 4M7DF 3F23A 1X43A 5GAMd 3O3KA 2X85A 4GXOA 4BE2A 2VODA 3Q0WA 4YEJA 3Q0VA 1IHVA 1USYC 4XTZA 2CUBA 3ECHA 4RG8A 2W24A 2KJBA 2E5AA 1S8NA 3SZGA 3M54A 3BQYA 1ZLKA 1U5SA 3CCVA 2GBQA 2XRNA 2A69F 1AHJB 1RKWA 3X28B 2QHVA 4FU6A 1R1VA 3QQAA 1UHCA 4RDUA 2AXLA 2O8XA 1ZRFA 3F6VA 1TL8A 3BG6A 3K70C 3L9FA 5GAMj 4IHWA 5IOYA 3KLNA 2C0IA 2LQ8A 2GOMA 3EUHC 1Y0NA 3RMQA 1B4AA 1YFTA 1JUMA 5C0MA 2KBTA 2LC4A 3I35A 2F4MB 3CC7I 4UV9A 2EJ9A 2H1LA 1K1ZA 3OIPA 3CCMA 1XJWB 3M9AA 2K7AA 3G4SA 2QYOA 1AVZC 2NS8A 3FBNB 4LDYA 2K5LA 1ONVA 2E2JJ 1N78A 2VBYA 1Z67A 2CP6A 1SEMA 4HVUA 2B63J 3HXYA 2HI3A 2LF8A 1S3JA 2M5WA 5E8GA 3ZPLA 3SEQA 5KCHA 4M4ZA 2HOEA 3RKYA 2GF7A 1VQPA 2QSGX 3E6BA 1R77A 2KISA 1SRMA 1P7IA 1ZGJA 2H3JA 1PM3A 3CCUQ 5FLXZ 1FP1D 1YLFA 1FC3A 5CVUA 4I6ZA 3VDXA 4YRNA 4J9CA 5LRSA 4NS5A 2KXDA 1JJ6C 2XDPA 2W84A 1T8IA 1A6IA 1TQIA 1LDJA 3DBLB 1PRLC 4A4GA 1Q7YC 2L4MA 2VKNA 5HNFA 1KHCA 3CC2Q 4YRMA 4OIPF 4ZN1A 2PU9B 4V2FA 2HZTA 3E9IA 1JJ2S 3PNYA 5DCFA 4GGGA 4XONA 4PSXA 5J8CA 4CS2A 1V1CA 2G3RA 4QLCU 3VYRB 3QPTA 4C5HA 2DBKA 2C7IA 4QQGA 1TP4A 3RSNA 1E3PA 3V42A 1JHFA 3H0FA 2ATCB 3A2KA 2R7DA 1DPUA 2EFIA 5EZHA 4J9EA 3VS1A 1JJ8C 1F1ZA 5CCAA 1BI3A 2FNAA 3S3OA 1BBWA 4YIFA 3L42A 3BDLA 5DUIA 5GMKh 3V8LA 4FSXA 4L59A 4YRIA 2M4GA 2RNGA 2XGXA 1Q82C 3ZOBA 4KGVB 2CSIA 1E7OA 3I4PA 2ZXIA 3G71T 4YRKA 1R8OB 3PVLA 1TC3C 1R4NB 2WY7Q 3DB4A 3MZHA 3TO9A 2L9SA 1MBJA 1F4KA 2XU8A 3QJYA 1MDMB 4W97A 2QA4I 2Q7GA 4UUSB 1K7AA 1UGPB 1VYTA 5CQEA 1HOMA 4HA8A 4YREA 3ZMZA 2HYFA 3RI4A 4C30A 3NFCA 1ZA2B 2E36A 3HEFA 3H36A 1B76A 1GCQA 1VQ8Q 2IS2A 2L2OA 2EV6A 1ASYA 2K40A 2LJ0A 4RLQA 1J5YA 4MO7A 1TBXA 3D7SB 3QZ5B 2EGAA 1WZOA 4I01A 4ENMA 1KC8U 4E51A 3DTIA 3HOYJ 3F8NA 5E1WA 1B72A 5GANd 1QNTA 1WHLA 2LY9A 2D0NA 1EZZB 3EG2A 3FHNA 4XLCA 2E2HJ 3A5YA 2GZWA 4C8QG 4HXJA 1T0FA 4M78E 2FXAA 4NC6A 4PJMA 2H8HA 5K5QA 4N9HA 4A3DJ 3EHRA 2NUZA 1WFWA 1LNWA 4C8QA 3CXCA 4HF1A 4E7KA 2ZCFB 5DM7R 3I9QA 5F0FA 2FMYA 4BJ5C 2DOFA 2CW0F 4N4OB 2F5FA 3Q1JA 2O8KA 3A74A 3J81K 5GANj 2WADA 4R8HA 4H02A 3UWNA 3DWLE 1ETXA 2NS0A 2ZO4A 5FO5A 3HC7A 4IRIA 3LX7A 1ABOA 1SD5A 3P5JA 4Q6GA 2DK5A 5GAMe 4WX9A 5CO7A 5J6XA 4YRFA 1HJDA 3IAM2 4TVRA 3VYHB 1ACMB 1J2XA 4H0EA 2JS0A 2R0QC 3HFVA 1VQNI 4AH6A 3E7LA 2WV1A 4PFZA 3T8RA 1KQ0A 1SMYF 2DLLA 3PUBA 1E1TA 4DYCA 3MWMA 1HLVA 3CF5F 4F14A 2Q1ZB 3PGGA 4BI3A 5D6YA 4G7OF 2YUSA 4LGWA 4ORZA 3RDIA 3NETA 2KMTA 3EUHA 2LDUA 2LKPA 1UMQA 3F8MA 1RL2A 4A3IJ 1OCRH 8AT1B 5CPRB 1RR8C 1FYMA 2DTIA 1F43A 1YJ9T 2K2MA 2MD5A 2HGCA 2ISZA 4X9CA 1J75A 3A01A 1VQ4Q 2DA4A 2HPIA 2JA8J 5J39A 1EKEA 3JCMP 3PIPA 4N4GA 3ASKA 1NJIC 3BE3A 2QF7A 3E97A 1K73U 4R55A 1MMSA 1ETQA 3REAB 1USTA 1U0JA 4M7DC 1S7EA 3IRRA 3CJTB 1Y71A 1HC7A 1REPC 3VUZA 2W57A 1T6SA 5B66C 2MK5A 4G7HF 5HS7A 4BAYA 2A36A 1XGMA 4HRIA 5FB2A 4M75D 3A98A 3UA7A 3MEUA 4DZPA 1SRYA 2R5YB 2B7EA 4RTWA 5D4SA 4M77B 2DTHA 3HHHA 2LQNA 2ZJQF 2L0AA 5H6RA 3QODA 3OW2A 2DA6A 2E7XA 4EATA 1AZEA 5GMKl 4RB2C 1SFOJ 2NLUA 3PQJA 2DJIA 3H1CA 5FW9A 4M78B 2O01E 3PE0A 2XIGA 3EGXB 2R7ZJ 1IZ6A 2QEXT 3U9GA 2M8EA 3DPLC 3HSRA 1ZG1A 3G71A 2QI2A 2AKWB 5LJ3h 3G1LA 2RNJA 5D4RA 2K3YA 1M2VA 5GANg 2D45A 3K4BA 1T2KA 4XU1A 1IV6A 4OIQF 3F21A 1JI8A 5GAOn 4KDPA 1WA7A 2OI3A 1MJBA 5K7FA 4UXNA 5DDGA 1IGNA 2DMPA 5FFXA 3ZMDA 1M4ZA 4JJCA 3J81E 2TCTA 1I4K1 5L8RE 2IPOB 5FLVA 3CCUI 2KI7A 1B9MA 1YO5C 1JXMA 2PQ8A 3JB9D 1GLNA 2ADUA 1JT0A 3PFSA 1I50J 1PWTA 2WAQA 3GNFB 4TV7A 4BXFA 2VXEA 2JJ7A 4RM2A 2X0LA 3K1MA 4XRFA 5GAN6 5I11A 2NAZA 3LSMA 3CC2I 5J40A 4E6RA 1KD1R 2DDZA 5E1ZB 4GCVA 2Z16A 4IEJA 4BHPA 2QTVA 3KE2A 3Q9SA 4ITVA 4L5GA 4C0DB 3CDIA 3WGIA 3ISPA 1E0EA 5DCMB 2AT1B 1MBEA 4XR6A 2CV0A 4M3BA 2VT3A 5GJWB 1XX5A 4MMLA 1UB9A 1VQ5Q 2VC1A 1H9TA 4LVJA 3FZVA 3ZMUA 2FA5A 1J9IA 2FBHA 5GMKe 2KJCA 3HFOA 2K9SA 1P7JA 2EFPA 3W2WA 4M6YA 1BI2A 3HPGA 1ZLMA 4U87A 3UFGA 3H5AA 3NQOA 2AHQA 2CFOA 5HY6A 1YHQT 2K86A 5FGMA 2HCKA 4HQEA 5IN1A 3FHZA 3U23A 1EIFA 3SDZA 3F6OA 3DF8A 4IJAA 1M3BA 2RJDA 3WQZA 3E1SA 1LEBA 1C6VX 4JBAA 3RCOA 1T56A 1VF9A 1VIFA 5M9OA 2CW8A 4B3XA 3KFUA 2Z99A 2P5LC 2KMUA 4JLIA 1QE0A 5GTIC 3VS4A 5F0HA 4XLAA 2PMFA 5LL6S 4P3NA 1KC8C 5D6FA 3BWGA 1QGPA 3CJRB 3CO7C 5M5WJ 1W6XA 3ERED 5EEGA 4J9IA 1DDNA 1VQ8I 3CUQC 2CH4A 4XEMA 3PMTA 2Y48A 3HY1A 5AIPA 4L5JA 4LB5A 2MGQA 2CZ0B 2V8JA 5AT1B 3CD6T 3CCJT 3PQKA 3LNQA 1XGSA 3JAME 4XN3A 1W36C 1YJ9A 4NOYA 3INZA 2ARTA 5LEJA 3WU1B 3RJPA 2LNVA 3HRUA 3RPQA 1W2BA 4Z8AA 1I3QJ 2LTOA 3FXUA 3I55T 2LX7A 2WAEA 3G6ET 2QQAA 1MH4A 5HLGA 3IALA 5K7HA 3HBLA 2Q5HA 3JREA 3DPUA 4XIDA 2EJRA 1HC8A 2V8IA 3H3VK 2K4JA 1QO0D 1LFUP 4MFEA 3DSQA 4A3BJ 3ZN0A 3OSFA 4KT0E 4CZCA 5DLQE 3OWTA 3X20B 2YHTA 1I0CA 2ZIMA 2DQ0A 4YELA 2HQ5A 2ZNZA 4JJDA 3CJQB 2EQKA 1V4RA 2Y4XA 3AG2H 4CCLA 3TKYA 2CYZB 2DW4A 2PUOB 5GAEJ 4ZGJB 4UV8A 1K4SA 3CTAA 4GLMA 1H9GA 4M7DG 3JTHA 1AWCA 4PJOB 1IXSB 1U9OA 5GAMf 3OYJA 2VQGA 2QEXA 3QSUA 2D1VA 2EQIA 4P74C 1HBXG 2EIJH 3KIOA 3CCQQ 2Z2SB 1S5LC 5HODA 2Y69H 2VGMA 3WU0A 1U1SA 4IUUA 5GJVB 4B47A 2NS7A 1EOVA 4A3FJ 2QKMB 1S1NA 2X1DA 4DQ2A 2F2VA 3QDRB 3JRGA 2M0YA 5CR2A 1K8AU 2DA5A 1R6RA 4OMFB 4YFXF 1K73C 2CQQA 1OULA 5F5WA 3V4GA 4BQOA 3H0HA 4ON0A 1OQYA 3GTKJ 2EQRA 3L00A 1YI2Q 1HTTA 3V7SA 2WB1A 1AD5A 3OYDA 1YRNA 3GBGA 1OQKA 3HOTA 3L2ZA 3QPSA 2K3BA 2M0CA 2A08A 1XS9A 4AIKA 5GAOr 1XCVA 3VQVA 4KH0B 2CP2A 1VQ4I 2EH3A 4XLEA 2ZFUA 2YXYA 5CVIA 2EFWA 4RAZA 2RVCA 1VQMT 3G73A 2V9VA 2DK8A 3EYYA 3DCFA 2FQ3A 2Z5UA 4IUQA 2JTMA 4C8QD 1GRIA 4RKUE 1MMDA 1N5ZA 2XICA 3ULRB 3HKSA 2R5MA 1JHHA 4O2DA 5J26A 1QQIA 5ECAA 5EJCA 4J7IA 2AQFA 1XSXA 4QQ6A 1JGGA 2RHZA 3HL8A 4D1QA 2BVLA 4A6EA 3BDUA 1ABQA 4ME7A 1R23A 3ZQQA 2R5AA 2DA2A 2JM9A 4GY5A 4RGSA 4Y4RA 2KRSA 3QIIA 3GOXA 5FKMA 4GLKA 5HS8A 3K2ZA 2CFXA 2V6EA 3AL0C 4YRJA 2QM3A 2VKHA 1FOXA 3LGFA 4C8QE 1P92A 2ZPIB 4HT4A 2DD4A 1R5HA 2XKOC 1ZK8A 2RKHA 5IH2A 4I98B 4CSWA 4BEHB 2XAFA 1IN4A 2CDTA 3JCMV 1YHQA 2EPFA 4DEYA 3DQVC 3FEOA 3E6MA 3L2WA 2P7CB 2EFNA 2WACA 1YCSB 1ULYA 5LHGA 2DZCA 4CDGA 2LP5A 2OTLT 4X5OA 3DEUA 3K70D 2WAFA 3R0JA 5IYCJ 4GO1A 2WA0A 1NLPC 1IV8A 2EBPA 3CQZJ 4JQFA 2WWYA 3UDCA 5D8LB 2G7UA 3TCJA 2VC8A 4CZZA 4KT6A 4D9JA 3JCMh 3F8BA 3PNTA 2D8JA 3P9KA 5F0CA 1YFNA 3WE2A 2K5FA 1Z21A 4HSTA 4BNCA 4CS4A 4Y17A 1ZTRA 1KQ8A 1ZA1B 2PVDB 1MZBA 4TVAB 2LKSA 3ZQIA 5A0DA 2ELHA 3S93A 2OC6A 3URGA 1UHWA 3F8CA 4KUMA 1ENHA 2E1OA 3CD6A 5HDGA 3CCJA 1ARKA 1UELB 2EQUA 4YRQA 2M3AA 1WHJA 4RAYA 3IH3A 2ZC2A 3WHBA 4MQVA 3QO5A 4M7AE 1WHUA 4HWOA 2DO3A 3M5AA 3GUDA 1MJAA 5FKNA 1PKSA 3R61A 3TUPA 5FD6A 4XTVA 2MOXA 5EC7A 2CZ1B 2NUPB 2ODRC 3Q5FA 3OB9A 2IS1A 3HZJA 5E1XA 5ILUA 2HQRA 4A0ZA 3S17J 2R5ZB 3JCMd 2KYMA 4XKCA 3I55A 3UR3C 1O3RA 3G6EA 3TW7A 3HUGB 3H8ZA 3CUQA 3OW2S 4HT8A 2L3DA 1JGSA 1JO8A 5ELNA 4FHTA 4G12A 3VSKA 5KNNA 4OB1B 3A7AA 3KEYA 2X3XD 3TQ7P 2HKXA 2WAQN 2OQRA 4M77F 4PFOA 1I5ZA 4QVZA 4RTZA 1G5VA 4LD9K 2ENMA 3OMGA 4XEOA 2JS2A 1OYYA 3LFUA 4H4KC 1WHHA 2F69A 2H27A 3HFZA 1HKTA 4M78F 3K2AA 4ZN3A 1XGOA 1QKXA 1R0BG 4CH6A 4C92A 5IHKA 2HL5C 1D5VA 4P72C 4CRIA 2DNUA 2CYYA 3QDFA 3D5SC 3L09A 1YBYA 2FRYA 1D3YA 5C52B 4EPCA 4N9IA 5EG2A 5E3LA 4AFZC 1CF7A 5GANf 2VI6A 2HKOA 3OR1C 2QQRA 3DLLF 4FYVB 2LRQA 4B09A 4E4HA 2W7NA 3IQLA 3CCMQ 3HXWA 1YOVB 4KISA 2A0FB 2EPDA 1MMNA 3GO5A 4DBRA 3G4SQ 2UWMA 5K5RA 1YITT 4RB3C 4A63B 2M30A 1X58A 1LE8B 4F93B 4II1A 1QVFA 1HW2A 2LQWA 5ILVA 3LA7A 5KE2A 3GTMJ 1C1AA 4P96A 3TQNA 3FDRA 3CMEQ 1X6BA 4PGHA 5M3MJ 2DTOA 4FL6A 5CQXA 1PD1A 2M9HA 2RHQB 1VQLT 2PVGB 1VQMA 3QAHA 1SF9A 4P74A 3JRZA 3NTHA 2W85A 2JPBA 3M0SA 2FPFA 1WDXA 5KYUA 2KLOA 1LB2A 1WXTA 4IKFA 4P73A 3TSWA 2X6YA 2RGVA 2ECBA 1NJ2A 3IP4B 1VQ7T 1RUNA 2RHIA 4KR3A 2IPQX 2HU9A 2LX9A 2O03A 4LDWA 1YWOA 2OBPA 4HNUA 2K9GA 2O9LA 3EUKL 5EEHA 1U5TA 1RUOA 4BUPA 1QMCA 2QGFB 5IT9K 2PX9A 3X26B 3OMCA 3JCMW 1ZELA 4M7AB 4LE9A 2LP0A 2ZIOA 1K8AC 2EB7A 1R7JA 1NYGA 3L4GB 4Q5SF 3EG3A 4LNPA 1UGQB 4AVPA 3C2GA 2LVMA 2RMOA 3NAUA 3EG9B 2Z33A 3CCQI 1EV7A 3CCLQ 4UY8I 2OTLA 4EGYA 2ZXJA 4YRCA 3KP5A 5GMKi 2COWA 1WJRA 2OJED 2VC0A 3QJ6A 2X6WA 4BD3A 1ZH5A 3COAC 1ZRDA 3HY0A 2LT1A 3NTKA 1U6GA 1YX5A 1LOJA 1KOGA 1TUGB 3LA3A 1YI2I 5IXFA 2LC2A 2FEIA 2ZT5A 1ZUUA 4XLFA 2QDYB 3M1CA 1EH7A 5E8IA 2XKOA 1C0WA 3KZYA 2YLCA 1S7OA 1FEXA 3J7YJ 4JUVA 3ZEHA 2NNNA 2ZXFA 4KQEA 3ZBDA 4WXDA 3SFMA 1UJ8A 2JTVA 4IRHA 1M3AA 2K02A 4DBFA 1QWFA 3TW6A 4HNVA 4FX4A 2JRTA 2Y75A 2CJJA 4YPFA 1FXXA 4CHUA 5BPIA 2LOOA 1OMIA 2LH9A 3QU6A 1WJEA 2IJLA 2AMCB 2Y31A 2YR2A 2KRHA 2JT4A 1WFXA 1TW3A 2R58A 4BXXJ 1OR7C 2X1EA 1GL5A 1X54A 1FTTA 3C7JA 3I56Q 2KRMA 3OL3A 2HDAA 3OYHA 5KK1A 1B34A 1K9AA 2XGTA 3BR6A 1Z7UA 5LBQA 3QWLA 3RZOJ 1O3SA 2E1MB 2R4GA 5D5UB 4XORA 4M7DD 1T98A 2YUPA 3VPRA 3KZIC 4HPQA 1X1CA 3D5RC 4XTXA 3I5UA 4PJOF 4L0ZB 3G1OA 4I09A 2V1NA 1PYSB 2KDSA 1JUSA 2ZJRF 1WJ5A 2JVHA 1YTYA 1VQ9T 1I1GA 4QPQA 2YSRA 4X34A 4AMCA 4EMKA 1KYWA 3M9QA 3JCMe 4XKWA 1N6AA 1ZKGA 3CF2A 3DB3A 2LREA 3CC4Q 2RV8A 2RHUA 1PNJA 3Q9VA 4M7DE 1JT6A 3PUFA 2FO0A 4HX7A 4OMMA 1YITA 1FPQA 4X9DA 2ZPHB 1ITYA 1VA7A 5LHHA 2E1CA 3IKMB 2PG4A 2FE3A 3HOUJ 1OEBA 2NVUB 2YRCA 1WJDA 3E9FA 2ELJA 4HV5A 5TJJA 2HTJA 3TU4K 2DK3A 3V8JA 2BV6A 4G8XA 1R1UA 5GADJ 4RMOA 5HKCA 3ROUA 4QVCA 2L7FP 2XPWA 4JRQA 2RC4A 4YG2F 4A6DA 4J83A 2GFUA 3E5QA 3JB9I 1RADB 4KN4X 1ATIA 3AG1H 2FZGB 3PVQA 1YN8A 2PQWA 1DUXC 1MNMC 4J9DA 1G8XA 3TGNA 1OPCA 5C4JJ 3ZL7C 5HDNA 2ZKZA 1VQ7A 2LJ1A 1VFCA 5GAN7 1N27A 3CCVI 1NK2P 1UG2A 2I4NA 1Z7NA 1M27C 3HB9A 1KQSP 4M9XA 5HLIA 1G2HA 2W25A 3IV5A 2XAQA 1JJ2P 2CT3A 3VYGA 4F7UB 2RHSB 2L3PA 2P7VB 1X4PA 2DA9A 1MBHA 3SYTA 1IDZA 2E34A 4M77C 4F16A 4E7HA 3K4JA 3EH1A 4Y28E 4E7JA 2XPVA 3A4CA 4RB1A 2DVEA 4A3LJ 5CKHA 2FB7A 3PFIA 2ELKA 4HAMA 3CCMI 1P6RA 3QO8A 4F92B 5AONA 1OU9A 5EYRA 3G4SI 3E9GA 1GFCA 3EFRA 5KAIC 4M78C 3C3WA 3PNVA 2OAWA 3G71Q 4A4KA 3BG3A 5A0LA 1AKHB 2NXNB 2LCSA 3VS6A 2MA3A 3M4PA 2V1XA 3BFMA 1S72A 3MEAA 3CP8A 2K4YA 4AUXA 3J81Z 2A28A 3S3NA 4AM3A 4AVZA 2FQ4A 3T9NA 2HVQA 2R7UA 3C95A 2VKDA 3CMEI 2K3XA 3GP8A 2HQHA 4OP0A 3EAEA 4DYRA 5L3BA 3M8FA 1EVLA 4I0BA 3N5BB 2STWA 1XGNA 4F52A 4L9VA 4A4FA 2YRDA 2DFHA 1DJ7B 3QOPA 3C2HA 1KG1A 2GWRA 4M7DB 1N8RU 4D7MA 3EG1A 2BIVA 4TWAA 1SETA 5GAOq 2H1KA 2JUFA 4IQ4A 5D6XA 1RAIB 4Y92A 2I4OA 1W36D 1MDMA 4C0DC 3GTGJ 2VBXA 3KFVA 4UUSA 2COZA 2I0NA 9ATCB 2Y0SA 3HFNA 1W66A 3J7ZI 2DMUA 2FF4A 4G9YA 2OAZA 4MQ9F 3IKLA 1I27A 3FF5A 2KDZA 5F64A 1BOBA 3BZKA 3A7RA 1RAAB 2RQUA 4OMQA 2J6FA 1D0XA 4ZZLA 4U0VA 1VQNT 1ZGAA 1YNZA 3HG9A 4PJLA 3DKYA 3CCLI 2HS5A 3RGLA 4OB2B 3ABUA 3J80E 2A68F 4FW1A 5KHDA 2P5KA 1Z1DA 2ID6A 1VQ9A 1XTAA 3C0CA 3RTRA 1W7PB 3NGPA 2CIMA 1FYLA 2GCXA 2ACJA 2AHJB 3CCSQ 2RI5A 3T1BA 3ER0A 2FPEA 1OR7A 3MKLA 2DMNA 2L7KA 4FASD 3VS2A 1R49A 1MW7A 2DAQA 4BKXA 4C2UA 4QQDA 3DKWA 4Q48A 3W6VA 2VGNA 3GFLA 1IN6A 1KGSA 4UUVA 1DU6A 1QF6A 4MZPA 3F8FA 5F1JA 1WRJA 4J8OA 2OD5A 4CC2A 2VASA 3QG1A 3X24B 2KEAA 2M7BA 4FM4B 2Q8KA 1YJNQ 3JAMZ 4CICA 2WV0A 4IF4A 3KP3A 4MLOA 5I2MA 1AZGB 3BJ6A 4L9NA 4X6AJ 3HOZJ 2CQNA 9ANTA 1LJ9A 2A37A 2A05A 3QYHB 1ZREA 4BHCA 1N9SA 2HNHA 4P55A 2IIMA 1KQ1A 3ZXSA 4FSSA 1NH3A 2HDWA 1X4OA 2KXCA 3I56I 3JCMQ 4IIOA 1WI7A 4PL6A 4LB6B 2IS4A 1E6HA 4DGWB 4KIGA 1ACIA 4P71C 4KITB 2HQAA 2M2EA 1FNNA 1HSQA 4M7AF 3MEVA 3HXUA 3FXRA 2KVQG 2X4WA 4JOMA 4H2XB 1ON1A 2RQTA 3BTIA 2W10A 1PRMC 3VFZA 2DD5A 4D5FA 4I02A 5B3SH 2MFZA 3I64A 5FKLA 4YRVA 4G85A 4MTEA 2HEQA 4ZTFA 2Q7HA 3VQWA 3CC7Q 2EJFA 1SEUA 5KYNA 1NTCA 1G6NA 2DI3A 4WJ3M 3CC4I 3SWNB 3FWEA 3NRVA 4LG3A 2Y2ZA 2BY2A 4DBHA 2HD0A 3ICAA 2ME6A 4JZ3A 4PJOC 1IN8A 3M4OJ 3CBMA 3HOWJ 2P8TA 1IAWA 1DQUA 2LZ6B 2HVRA 4IPAA 2QASA 4IOAF 2BEOA 4NL3A 4IIMA 3LQRA 3HP9A 3E0JB 2B86A 4JPBW 3GLLA 4MHGA 2H09A 4HV6A 2E5QA 2JRMA 4ZH4F 2GFAA 3ABMH 3IG2A 4XRMA 4M77G 3CC2T 2CSOA 1U3EM 1MKMA 3OS2A 2R5YA 1FT9A 4HG2A 3ZQHA 4CA0A 4PKCC 2W82A 1KJWA 1LUJB 3KXTA 2ZCEA 2RN7A 1WKMA 3RKQA 3UF4A 4IUVA 1R58A 4UP9A 1JKOC 4KFCA 3RMSA 4K11A 1PC0A 5IOZA 5D5XB 4M78A 1OCTC 3EGXA 3BZCA 3H35A 4TVYA 2L9NA 2LMDA 2KHMA 1W4MA 3RUXA 3M4QA 2KRCA 1D0YA 1UGRB 4PNOA 2E70A 1Y0UA 4A5NA 4PLLA 3EFOB 2XVCA 4JS4A 3TEHB 2KQRA 3AHUA 4XMYA 4NDLA 2EBIA 5E17F 2JN6A 2XI9A 3MFKA 1X01A 1VIEA 3M0RA 1WSUA 4F3QA 3EYIA 4PHCA 2DA3A 4HX4A 4BXUA 5HOOA 3M53A 2IGMA 1X75C 2ODRD 1CGPA 5FLXK 2VIXA 1WIEA 4LMYA 3RQIA 2MC3A 5TISC 2RI2A 4E6KG 2M9UA 4V2GA 2RO0A 4M72A 1KQ9A 1VQNA 1SC7A 5CYVA 4M9SA 1J0RA 5KCOA 4F91B 2J5PA 4NC7A 2I5UA 3E5UA 3G71I 5CVJA 3K0LA 3M4YA 2ZBKA 2EAYA 5DCMA 4J00A 1N8RC 3PT9A 1QHGA 2D6FA 2QA4Q 2G6FX 1RAFB 1BR2A 3MHXA 2RHXA 4J7FA 1Z0XA 1ZYRF 4DYQA 4RMFA 3VV0A 4YYEA 3VQYA 1JXOA 5GMKm 3S1QJ 2KDOA 2XRLA 1X2MA 1YFRA 3CMYA 2GBYA 4XLHA 4Q47A 1U1TA 1UEBA 4YRSA 3VJPA 1IXRC 1TWGJ 1R00A 1SHFA 4HVWA 4DA4A 2JJ9A 1SD4A 3GTJJ 5L3CA 2YS9A 1BIAA 3B73A 1FYFA 3KP7A 2ZPGB 3K1PA 1IW7F 1V5FA 4ZDPA 4Y33A 3LAJA 2GA2A 4UUTA 3FXKA 1TT0A 3CD6Q 4S0HB 5BNGA 4X1EA 4XSZF 2P4WA 1UCRA 2JXBA 5FWCA 4J6XA 2NVTJ 4HW0A 2WSEE 4Z88A 4CI0C 3ZMVA 1LCKA 4YCVA 3WTTC 4ENKA 2L89A 3TSZA 3WG9A 1J09A 2OPTA 2VE9A 2NYXA 2FPDA 1BCMA 4CC4B 4H2SA 2NWMA 3QP6A 5DM7F 1V29B 3B02A 4F7UF 4AFQC 3KYCB 4WXHA 4Y52J 2QWWA 1NEBA 1B59A 1T08B 2HXIA 3H41A 3TEGA 3CMAQ 3TP0A 3SB2A 1R5GA 2F2WA 5HGQA 2BUDA 3SZTA 4E70A 2FMLA 4XU3A 2AS5F 3GTQJ 4XTWA 4YCUA 2DDBA 2VYTA 1IL2A 2KPMA 4B9XA 3A1PA 1I8FA 2F2XA 2B8AA 3CCSI 4CXFA 2DXTA 3G1ZA 2HFHA 3JB9H 2J6OA 4LFUA 2BXZA 1QHHD 3I4NJ 3C12A 5GAMh 1B8IB 1ZSGA 4YIRX 5IAYA 4B48A 1FIPA 3QWXX 3S1NJ 2CP7A 4A53A 1K9MR 5EZGA 5IP7J 3MEYA 4FYYB 1VQ4T 4RCCA 5J1RA 2VOPA 1NJ8A 1IZ1A 5K7ZA 11ASA 2GIVA 5F04A 4XBFA 1YJNI 1I07A 3CC2A 3IWZA 2ZR2A 3FK6A 4D0PA 1Z9QA 1IF1A 2RM4A 1Y39A 1RLQC 2GAUA 1B7YB 2MPXC 1CSKA 2EIMH 2F48A 4PJOG 4FX0A 1XD7A 3RDVA 2L7MP 3UNGC 1M8MA 2O3FA 4JP0A 2UV1A 3CDLA 2HL3A 3TEEA 1QA6A 4GRIA 3MQ0A 4PJOA 2LTPA 2FG0A 1X19A 12ASA 2DOAA 5CJ9A 2PMZN 1VQKQ 1Q86C 1ERDA 3BTLA 3CLOA 3BCAA 1QVGP 2BYVE 1KIKA 3SEZA 4HWRA 3E2UA 3J7AO 3VUBA 3CXCP 4EMHA 2HOSA 2AZVA 1WYDA 4YRRA 3QP5A 2XD0A 3JRAA 3T8TA 4WI1A 1FOYA 2J05A 2JOYA 1XG1A 3P8TA 3CCEQ 4LD5A 3PJRA 2P0KA 4E7LA 2EFOA 3LSHA 4HDUA 4R0KA 4IRGA 2YPRA 2PMHA 3FBIB 2DYSH 3RF1A 1ETYA 1FSEA 1RPWA 2FUG2 1K76A 4M7AC 1WWXA 2C0OA 1LNXA 3OMYA 2JWTA 1M8VA 2Q5IA 2V26A 3BTCA 4PK4A 2W48A 5A0GA 3WVEB 5CIUA 4LD6A 2PVOB 1YJWQ 2E5KA 1G51A 3VS7A 3SHFA 3FC3A 2BGCA 1Y8QB 2X48A 4DNCA 3K4MA 5LFAA 1ODDA 3HM5A 3HTZA 4IO9F 1SFUA 4KR2A 2QBYB 1QRYA 3NEUA 3G7ZA 5HDKA 3BPVA 4ABZA 3HTRA 3SDBA 3LL7A 2R7FA 3RYRA 4PJNA 4KUDK 1FYNA 1HCRA 4LVMA 2QAZA 1U9NA 3MF1A 5DS9A 1VI0A 1APLC 4BEHA 2GXGA 1VQ5T 1G3YA 2DILA 1X2HA 2NS6A 2CQXA 3ABLH 4HCKA 2YX4A 2ZJPF 4UVCA 2DBBA 1Q81R 3BG9A 1KQSS 1X1BA 1D8KA 1T95A 3S2HJ 2JSPA 3PO3J 3O8VA 4NB5A 2G0EA 2ARSA 2NVYJ 1M1FA 3GZNB 2RN8A 4ETSA 5JFRA 2XG8D 4WCGA 5KAFC 1RC9A 3H0IA 2BTTA 1AOJA 1X2GA 3R07A 1WPYA 2KY9A 2COYA 4P75C 3JV3A 1LPQA 3S3MA 3UGQA 4EM2A 1OYIA 2DVJA 3H5NA 4H2VA 3OW2P 3O5ZA 1WI9A 2DIGA 4TVAA 1Z3XA 4MFDA 2GOXB 2EZIA 2HZYA 2E1MC 1YHQI 3E6CC 1HYOA 2CQKA 3PIOF 2K9MA 4RB0A 3SJMA 1OCZH 1HSTA 1KD1U 3HHGA 1PUFA 1KFZA 1Y7XA 4BY7J 2ROTA 2L4AA 3TP3A 4XN0A 2NUPA 2RI3A 2A8EA 2G4CA 1S29A 1I6XA 2DU7A 3SD4A 2R5ZA 2DPUA 5GANh 4OINF 3DBHB 3QOEA 4ANJA 5D5WB 4L6V5 2H6CA 4M77D 1EJ9A 1G3WA 3CPWA 3OY9A 3QNEA 3HUGA 2FSWA 1J3TA 1VQ4A 3FJPA 2RQQA 1UFMA 4E7SA 3R0AA 1RABB 2FD5A 2DKGA 1FMKA 1SG5A 2CUFA 3FXMA 4M78D 1M90R 1GV5A 1XNIA 2L2PA 1TH7A 4IQJA 1H0MA 3REUA 4QW2A 1RNLA 1B7TA 2M02A 1UB4A 2OJ2A 4LG0B 2DL4A 3CD6I 3CCJI 5KNLA 4HT9A 2JM8A 4M77E 3GFJA 3P8BB 1QLYA 3M3YJ 2AO9A 1ADYA