3V7RA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7rA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7rA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7rA02
1L0OC 2BBYA 4MQ9F 1MDMA 4LG0A 1X2GA 3A7UA 1IF1A 1YW9A 1U1SA 3WTTC 2GZWA 2CJAA 2KKOA 2DAOA 2MC3A 3A74A 4HWSA 2EJRA 5GMKm 1TQIA 3PCOA 4XTVA 1KYWA 4E70A 4L18B 1R5GA 5E1WA 5IT3A 1KU9A 2YLCA 3E97A 4AWXB 2EV5A 5L3CA 3RF1A 5BOXA 3HRIA 5GMKe 5D8LB 3D5LA 2HS5A 2A5YB 1TBXA 4PJOD 3KP6A 1EQRA 1P4XA 3HXWA 4S04A 4M75E 1G6NA 4RAZA 1FYKA 3F21A 2HNIA 3BPVA 3TOBA 3QTCA 3TEHA 4HQMA 5LHGA 2VE9A 3KE2A 4BXUA 2DU9A 4MTDA 4TQFA 3W3SA 5GAMh 1H641 3JCMb 2FQ3A 4MHGA 4KFCA 3ZN1A 2V9VA 2EJGA 1X2HA 1DP7P 1H0MA 2FBHA 2P8TA 4OIPF 5LJ5f 1HTTA 1GHCA 2XRNA 3SWNA 4EVIA 3C3WA 4ENMA 4KNYA 4XLPF 1ZRFA 2ZIOA 3MFKA 2M45A 1W4MA 4EMSA 5GAMg 3TO9A 2ESHA 4WCGA 3I53A 4C8QA 3U9GA 1QZYA 1JHFA 2HKOA 2GQQA 5E8IA 3R07A 5H20A 4NL3A 3CDHA 3QU3A 1USYC 2DJZA 2ADUA 2DO7A 1LDKB 1LEAA 4CHUA 3KLOA 3SWNC 5DDGA 1FYFA 3I58A 2E1NA 3P7NA 2ZT6A 4K87A 4M77E 2YHTA 3RESA 1J0RA 4ENKA 2PFBA 1FP2A 4Q48A 4MTEA 5BPDA 2EJFA 2QHTA 2IA1A 4GCVA 2P4WA 4CS4A 1EFWA 2A3SA 4FT8A 4LGWA 4P72A 1ZYRF 4F7UG 4A54A 4G7OF 1JHHA 3J80K 2XASA 4YRTA 5E18F 4AH6A 1FC3A 4JBAA 3JCMg 3JCMW 3ISPA 5L3GA 2NYXA 4M78D 2F5DA 3QSUA 3BROA 3SXYA 3P8TA 4LNSA 2FNAA 1USTA 1MZBA 3G73A 6PAXA 1D3BB 2RQPA 4UP7A 2J5PA 4C92D 3ERED 1SD6A 4ZYHA 2Q7HA 2VC8A 3DEUA 4BHBA 1EVLA 2R7FA 1RIQA 2DQRA 3UFGA 4M77C 4XEMA 2Q2EA 3PGGA 5HVQC 4TVWA 4LD5A 1IAWA 4H2VA 4YRQA 2Y0MA 1PUEE 3OD1A 4EGZA 3FMRA 1MD0A 3WGIA 5HGQA 5GAN5 4YRLA 4CH4A 2M8EA 1O3SA 2Z99A 4EM0B 4G8XA 2EFNA 3MEYA 4WXHA 5I21A 3CUQA 4M7AB 2CSOA 1HKSA 1OYWA 2ZXJA 5GAOn 1CF7A 5DEQA 3TKYA 4ZZLA 1PYSA 4R8HA 2Q5HA 2HTJA 5JVTA 1HKQA 2DLLA 1ZRDA 3I64A 3CTAA 4EJVA 2RM4A 2QVOA 1D3YA 2OAZA 4KA4A 5FFXA 5J8CA 5DUIA 3O6BB 3KEQA 3JCMe 2ZT8A 1HKTA 4M7AE 4ZIBA 4XU2A 5H6RA 2DTRA 3CUQC 2C8MA 2PMUA 1KQ8A 3FXUA 3FF5A 2V1UA 4YROA 2VODA 1I81A 4ZH4F 3R0JA 3SZTA 5DCFA 4WJ4A 5AIPA 3JW4A 1WU7A 1LJOA 2W25A 2QYOA 1HK9A 2HYGD 1IXRC 2DEQA 2DKGA 3LAPA 4ON0A 3SHFA 3L2CA 3LSQA 2J5OA 1BI1A 3GX4X 4LB5A 1YGBA 4YRSA 5GAN3 1FBUA 1FY7A 2GWRA 5F1RA 4AIKA 1XDSA 3FX3A 3GO5A 2CGPA 4O6JA 1ZREA 2G7HA 2UZKA 3AHUA 4KDPA 1YS7A 1WQ2A 2ZCEA 3JB9H 3P9CA 3M8EA 4K2EA 5LJ3f 2J3LA 4HWPA 2ODRC 4C8QF 1W5TA 2EAYA 2UXXA 3KFUA 3HTZA 4XBFA 3VBBA 5LJ3j 2VC1A 3VU3C 1ULYA 2FEZA 2A07F 1RNLA 1STZA 1ZG1A 3MQ0A 4LK0F 3BDDA 2NNNA 2PMFA 3JAMK 1F4KA 1SFXA 3C18A 2BV6A 2DTIA 2LSOA 3JCMP 2ZBKA 2H6BA 5DV5A 3E5UA 2QHSA 4YCVA 1HC7A 2A69F 1DPRA 1EH6A 5C53B 4LLLA 1UB9A 2P5VA 1WSUA 2HEOA 5DY9A 1BN5A 2RA2A 4XRFA 5GANh 3IALA 4I0BA 1QGPA 4KIBA 1BC8C 3I4PA 3RACA 2ETHA 4CO8A 5D4RA 3M9AA 4HDVA 4PJOF 4BQAA 1N9SA 5J6XA 3HTUA 3RKXA 5H6QA 1DDNA 3EETA 2V1DA 4L5IA 2IT0A 3GUDA 2DPUA 1XCBA 3CJNA 3BPXA 1FBQA 3C1DA 4UPAA 2E7XA 2D2WA 1I1SA 2DZCA 3V7CA 3JB9J 4C8QE 5GANj 2J3MA 1JE8A 2CGHA 2E65A 5HLIA 1KU7A 4CGZA 2WTEA 4EJUA 4RB2C 4XTYA 4P72C 3HRUA 3WTUC 2F5CA 4P75A 4M6XA 3I5UA 1YW7A 1IN6A 5GAOr 5E1ZB 5L3BA 2HYFA 4O2DA 1GGMA 4DPGA 1ATIA 2ZINA 2VC0A 3KETA 4PCQA 5DD8A 3B73A 5GAN8 2IA0A 3HTSB 3GIBA 1JBMA 1F9NA 1IL2A 5HDKA 3I7FA 2XAFA 4Y91A 4RB3C 1SETA 1XSDA 4GYGA 1KMNA 2RHQB 4JRKA 4LLGF 5EEGA 4P5OA 2DU5A 4P9FA 3IHUA 2IVMA 2FRHA 1Y96A 4LLNA 2OQGA 4ZYGA 3WTXC 1UFMA 2KIMA 3QP6A 3GFIA 1WQ7A 2JZYA 3MCZA 4I02A 3REOA 4C92E 1I8FA 4L5JA 3VFZA 11ASA 1LVAA 2BE5F 3ZMTA 2HR3A 3TDZC 1N9WA 3K2ZA 4H2WA 4MMKA 4JQFA 4P9UA 2EFPA 3QAHA 3J81Z 2PLYA 3SWNB 1Y96B 2O0YA 4ENJA 3BY7A 4MQVA 1ONVA 4XU3A 3FM5A 3ZMVA 1UCRA 1WNLA 3R6SA 2E1HA 1TQMA 2CW0F 4J15A 5LEJA 5LLQA 1ODDA 3TEGA 2H27A 1GVJA 2YPRA 2AKWA 3LSSA 4M73A 1D8JA 1U6GA 2F2EA 3GEZA 2GIVA 4LG0B 1CGPA 4U7DA 5GAMj 5E1XA 3BW1A 3FXRA 1XGOA 3VQVA 4U0VA 1FSHA 3T8TA 3HRSA 2LF8A 4M77D 4L0ZB 1HBXG 3VQWA 1B4AA 2XGXA 4M77F 2PN6A 1OYYA 2RGVA 2DT5A 3M8FA 4O5VA 5HDGA 5LJ3d 1LB2A 3A7RA 4KYWA 3HXYA 3ABTA 4A0YA 2QHVA 2MA3A 2K27A 3RPQA 2O61A 3R61A 4KIGA 2YX7A 3SB2A 3HFZB 3P8VA 3K0LA 2MD5A 2OU2A 4J5YA 5ED4A 4CH3A 2M87A 3K69A 4L9NA 2CQKA 3RKWA 2QQ9A 2RV8A 2Z5UA 5GANf 5K1PA 4UNOA 5FD5A 2FBIA 2KJCA 4HWOA 4IF4A 1ADYA 4A12A 2Y75A 2VXEA 4HX4A 3ERRA 4BWAA 1XCVA 4K86A 2P6TA 4OIQF 4EMHA 5FD6A 4EM1A 1NYQA 4HVCA 2STWA 5CVRA 1R58A 2XIGA 1Z6TA 4PDKA 1BBUA 2BYVE 2VONA 1NJ6A 4EGYA 1RIOH 3CLOA 4RB0A 4Q6GA 3QO3A 4M78G 1ZLJA 2TDXA 3MF2A 1MGTA 2A61A 3BP8A 3HOTA 3RI4A 4M6YA 3HRTA 3RJPA 1XN7A 4F7UB 2FMYA 3HY1A 3F8NA 5HS8A 1J5YA 4EJTA 3A31A 5LGTA 4N0AA 4L0YB 3VEPA 4BYYA 3ICAA 2WC2A 5GANe 4J6WA 3M4QA 1FYMA 2AS5F 4HLYA 3EQLF 3M4PA 3RGLA 1W7PD 2HZTA 3N4MA 5C52B 4PHCA 1XGMA 1ZG5A 4FHTA 3DV8A 4JUVA 4YRMA 5CAIA 2FF4A 1X56A 3H3UA 3RKYA 2CO5A 3GFJA 3K1MA 5IT9Z 4CYDA 4J6YA 2ODRD 3L4GB 4YYEA 1G5HA 2EA2A 4P55A 1M5Q1 4KN4X 2F5FA 4IRIA 4N0AC 3V7RA 4YRJA 4M77A 2GXGA 2PJPA 5L3FA 4YCWA 3J81K 4HOBA 4Q5SF 2VBXA 3LAJA 3G1ZA 1LJ9A 3QO8A 5FO5A 1TTYA 4Y13A 3K1NA 2K86A 4UVBA 4MGRA 1DPUA 2UWMA 2DQ3A 3DFGA 4P96A 2RVCA 1BI2A 5GAOl 5F64A 5HS9A 5ERIA 1W7PB 4XTZA 3JSOA 2CJ9A 4C8QD 2GAUA 2R3SA 3MZHA 3TOAA 2OZ6A 1ADJA 3ECHA 4WI1A 3LC0A 4L87A 2PQ8A 3HOSA 3HYIA 3Q5FA 3QPHA 1H9GA 4ESJA 3A7AA 1HSTA 1B70A 3HFVA 1PYSB 1S6LA 5AIQA 4NL2A 4D0PA 4C8QC 3T0YA 3RYPA 4M77B 4TVAA 1B34A 3QUIA 1QBJA 4Q4ZF 4G7HF 4IHSA 1YFTA 4HV6A 1USYA 1WRJA 2OZUA 3FB9A 1YCYA 1SESA 5GAOm 3BWGA 3JB9I 2QQBA 1RUNA 1LNXA 2V79A 3V7SA 2D45A 1QF6A 2NS0A 1KOGA 5LEKA 2I2LA 2Q5IA 2DI3A 4EMKA 4YP0A 1E1TA 2QWWA 3LWFA 1I5LA 3T1BA 1NJ8A 1XD7A 3P9IA 4U0YA 5TRDA 3F22A 2YLBA 2ZJ2A 1ZLKA 4UP8A 1YTYA 2OA4A 3SFZA 1YO5C 3QU6A 3IG2A 1EVKA 3BY6A 3TO7A 3F6OA 4F7UE 1P4WA 4WXCA 4RDXA 3EYIA 2M1BA 4HV5A 2DFIA 1ON1A 5GAN7 3JB9D 3L9FA 3RYRA 2NRAC 2MH9A 1U5TA 1XMKA 2XAGA 1WKMA 1JXSA 4EMKC 1NJ5A 5HLGA 4UUVA 5FB2A 1N9RA 4PJOB 3DQVC 3LFKA 2W84A 1QO0D 5GAMe 2L01A 5DCMB 4TQDA 4AIJA 2EK5A 4OIRF 1XSXA 1YB3A 4WK8F 3QOPA 4M9SA 1WQWA 4L9JA 3HY0A 3GZ6A 2I4MA 4GXOA 1R1UA 3J7AO 2P6SA 2K02A 1SMTA 1YLFA 3D0SA 1G3WA 4N9IA 1FX7A 1SD7A 1T0FA 1MJAA 1PP7U 5LJ5e 2BGCA 3GW2A 1BI3A 5EEHA 1U5TB 3IRQA 2LF7A 1IN4A 4ETSA 1J9IA 4LK1F 2W57A 3M4GA 2EB7A 2YU3A 1XGNA 4M78F 4C8QB 2EJ9A 3L7WA 2DU7A 2RB6A 1FWZA 3A5YA 3JTHA 2DVEA 3M1EA 2XKOA 3G3ZA 3JB9G 5E20A 4S05A 3MAJA 3L2ZA 1B7YA 3BOQA 3ZMZA 2EV0A 2X0LA 3HRKA 1I6XA 4YRRA 3TEHB 5GAN4 4YRKA 3DP7A 3RL6A 4YIIA 4KT5C 4HWTA 5FGMA 1LOJA 5GAMf 4C92G 4IXAA 3JAMZ 2VOOA 1X3UA 2OD5A 5CLSA 12ASA 1G51A 4ESFA 3HRMA 2DTHA 1XDUA 3A5ZA 1Q1HA 3QHSA 2IY5B 3K1PA 3KZZA 4YPFA 4PJOE 4CZZA 2FSWA 3ELKA 2RDPA 4B09A 3HHGA 2F5EA 2QHUA 4M78E 1AOYA 2RN7A 2QZ8A 4M7AD 4KR2A 4OOIA 5C51B 4HDUA 2P7VB 1HXDA 2FB7A 4M72A 1J59A 2DPDA 2RHQA 3E9IA 1SD4A 3WTZA 3JCMJ 2X4HA 3GLXA 5D4SA 1B9MA 2GXBA 1WPYA 4O3MA 3F8MA 5D6EA 2IA2A 2FA5A 4UVAA 3TQNA 5FLXZ 3LQRA 1Z91A 1L3LA 3GFLA 4P71A 3JB9F 1KQ0A 4M7AA 2BEOA 2ZO4A 3EDPA 3DF8A 5LHIA 2ALYB 1VQZA 4KIFA 5LJ3g 1QPMA 3BJ6A 3E5XA 4ZYEA 4AVPA 1R7JA 4ZTZB 3KEOA 3VOEA 1B6AA 4RGSA 4CH6A 3KP2A 4MEYF 4M9XA 3JCMd 2G7UA 4M78A 1MJ9A 4H2TA 3WQZA 5GMKj 2O3FA 2ZNJA 3HXZA 2WWYA 5J8FA 1B59A 1S29A 2RC4A 4Y15A 4I2OA 1LDJA 3NRVA 4UVCA 4YREA 4A0ZA 1NHAA 4RCCA 5TJJA 4C92F 3F72A 3MWMA 1R1VA 1FYLA 3KP3A 1NJ1A 1I4K1 1SFEA 2GA1A 5HLHA 1T38A 3JCMh 1ZAOA 3FM3A 1S8NA 5D5VB 2FU4A 3QP5A 1T39A 4YRGA 4UV8A 2ISYA 1T6SA 3FMSA 3F8BA 4OMYA 2FNPA 4L9VA 1X01A 4M74A 2E1CA 3IWFA 1FPQA 5GAOq 1KMMA 1BBYA 1AWCA 3HSFA 4KN7X 5DD4A 4WJ3M 1B8AA 4JLIA 2O8XA 1FT9A 2I4LA 2RD1A 2DTOA 1D8KA 5E8GA 4XU0A 3BFMA 5HDNA 2D1HA 5GAMd 4P3OA 3QO5A 2PEXA 1EOVA 5F5WA 1ZGJA 1F5TA 2P7CB 4G85A 1V3FA 1V4RA 1O3TA 3TO6A 3HFZA 1WYDA 4HW0A 1IRGA 3HSEA 3F6VA 1WI9A 2D1VA 3J80Z 4M78B 1YIOA 2L4MA 3IRRA 2FMLA 1E24A 4EM2A 1E22A 2K4BA 5JI6A 1B9NA 4CICA 3JCMV 3GVAA 1KU2A 1WWXA 2VXZA 4P73A 4RQFA 3I54A 4M7AF 2C7IA 5BQTA 3SZPA 4HT8A 2ZZFA 2XAJA 3L09A 2Z9OA 5LJ5h 2E3CA 1J75A 3KFWX 3TGNA 4G9YA 3IKMB 1EIYB 2ZT5A 1JJCB 5BMZA 2OQRA 2VBZA 4RCBA 3IKVA 3EFSA 3CO6C 2JN0A 4LFUA 2ARTA 5AONA 1LEBA 4P74A 3EFRA 1Z7MA 3T5XA 2XAHA 4NQWA 3RUXA 3ROUA 4TV7A 3DSQA 5K5RA 4HX8A 1S3JA 3ZP5A 1RZ4A 5LJ5g 2CWEA 4BW9A 4C92A 4F7UF 3HHHA 1ON2A 4MEXF 5D5XB 2E64A 5K1YA 3F23A 4I98B 1OYIA 2IY5A 4MMLA 3E5QA 1OR7A 1CF7B 1E2XA 3Q9VA 3L00A 3O3KA 2Z33A 3ULQB 1FNNA 2YR2A 1HSJA 3DPTA 2O03A 2L3DA 4PGHA 2QQAA 3EYYA 4M7DG 2IW5A 1R5HA 1MJBA 4A5MA 4TTVA 4U7BA 4H2SA 3H3ZA 3QO7A 3UGTA 4M7DE 2E5AA 1NYRA 1Z7NA 1J7KA 1EV7A 4NOYA 3E6BA 1IXSB 5D6FA 2P5LC 3ZN0A 4NHJA 3OV8A 3HUGA 1W5SA 3KCCA 1L0WA 4PJOA 4XSZF 4P3NA 1BIBA 1XGSA 5ICFA 2PG4A 3FIFA 5E17F 4V2SA 1KGSA 2DQLA 2EA4A 3ZQ7A 4E51A 4Q47A 4IJAA 2ELHA 2KRFA 3BJUA 1JRIA 3FWEA 1PDNC 2P5IA 4DNCA 1GXPA 3BDUA 2VT2A 3H92A 1C0AA 1ASYA 1X54A 2XTIA 1LYLA 3GF2A 2XROA 2L02A 2VBYA 3R0AA 4IVNA 2FYKA 3HIFA 5HS7A 4RGRA 5GAN2 2QTXA 5DCMA 3ZMDA 1M8VA 1FLIA 2H6CA 4TWAA 5K5OA 4N0BA 2NAZA 4KQEA 1G3SA 2CG4A 4PJOG 2ZT7A 4XSXF 1IXCA 3WGGA 3IKTA 5DYMA 2HDCA 3S2WA 4YG2F 4XEOA 2FE3A 3CO7C 4RGXA 1H4TA 1K78A 4M71A 2ZIMA 4P73C 4XQ3A 3WU0A 2WV0A 3JTGA 4Q15A 2K4JA 1QZZA 2FOKA 5KK1A 3WGHA 3VQYA 4WF2A 2Z3YA 4HYEA 5GAOp 1E1OA 2O6GE 2ZGWA 4M7DA 1OPCA 2ISZA 4EJOA 2JPBA 2EWNA 3WE2A 2ZXFA 1IN5A 2EV6A 2VOPA 1S7AA 4P3PA 1UHWA 1UHMA 1IUYA 1I27A 4H2YA 2VN2A 2XKPA 2AMCB 4IRHA 1J2XA 2HFHA 2XVCA 4A2UA 1TNSA 2VBWA 2MH2A 2W24A 4QWQA 3NENA 3KZYA 2QENA 5LRRA 4ESBA 1U78A 1LQ1A 4OLFA 3I71A 4HT9A 1XB4A 4YRCA 1MGQA 4M75F 1R1TA 2ACJA 3F8CA 2L54A 3WG9A 2XAQA 1IRFA 1IN7A 1TLHB 4C92B 2G4CA 2FXAA 1H4SA 2P0LA 4XTXA 2Q0OA 5LJ3h 2ZNIA 1ZN2A 4M77G 3IWZA 1Z6RA 2RHSB 1RI7A 4OIOF 4X5OA 1T2KA 5LJ3e 1P2FA 4YRNA 3BZ6A 5ILSA 4KMFA 1P6RA 4M9ZA 1IW7F 3ECOA 1MDMB 3HFNA 3LA7A 4G6DA 2Y48A 4ZYDA 4M75B 1KQ1A 5ICEA 3R60A 1Y0UA 1JJCA 2R7DA 3QRFF 2COMA 3HFOA 1EIYA 1SERA 1R36A 3BJOA 3DXJF 4UV9A 5GMKl 5LGNA 4CS2A 3I59B 3CUQB 1HW5A 4A6DA 3REUA 4F7ZA 4KR3A 3L4GA 1K79A 2XUBA 4ZTUB 4EX5A 1U2WA 2JT1A 4WWCA 1U8RA 1KQ9A 2DK5A 1R00A 2ZR2A 1U5TC 5LGUA 3NQOA 4CDGA 1VTNC 3C7JA 4YIFA 5ICGA 1Z9CA 2B0LA 2CFXA 4M7DF 4M7AC 4R79A 3K9TA 2DXTA 4NB5A 5GANg 1ZHFA 4QLCU 1ZGAA 2H09A 3IKLA 1O3RA 5IT9K 1P4AA 2JSCA 1U1TA 4BAYA 1SD5A 4IPAA 2KIFA 3TUPA 4BHCA 2E10A 4YFNF 3GWZA 4UHTA 1F1ZA 3I0TA 2C6YA 5L3DA 1SFUA 4EV0A 1U3EM 1DUXC 1A04A 2IRFG 4I01A 3RDIA 3FZVA 3I59A 2ZZEA 5L3EA 2QBYA 4TVYA 4FX0A 4KUMA 1J5WA 5LHHA 1I1GA 1T98A 1O7LA 3AAFA 2LNBA 3KP5A 4M75A 3FJPA 5HOOA 1K7AA 1O7FA 4C8QG 5BS6A 3NEUA 3VB2A 3V8KA 2P5KA 2A68F 2EFWA 2ESNA 1K6OA 3IC7A 4EJWA 3KLNA 3N97A 4WX9A 3NEMA 4BNCA 2RHSA 5CVJA 4LB6B 4HX7A 4L9TA 4X9DA 4IHTA 2HTSA 4N9HA 3V8JA 4ENNA 2VXFA 2YX4A 2DQ0A 5FFZA 4OU0A 1S7OA 1BIAA 5CVVA 2PBIA 1NJ2A 3FXQA 3REXA 4CS3A 3ZPLA 2CYYA 4RAYA 2PMHA 1SAXA 3V8LA 4RMFA 4LJZF 4Z2YA 1ZH5A 3P9KA 1YG2A 2XV4S 4YRIA 3HXXA 4H2XA 4R1HA 3LQQA 5DUKA 1XMAA 3O2PE 2AKWB 4A53A 4HF0A 2PMEA 4A0XA 4YRPA 4CH5A 3BJAA 1IZ1A 1RUOA 2H94A 3P8YA 3GFMA 4UXNA 1QE0A 3RIRA 4OMZA 1B7YB 2KIUA 1TW2A 5K1XA 1OKRA 3ABUA 4XU1A 3MZYA 2I4OA 2G9WA 4K88A 2Y90A 4I7HA 4I09A 4EMGA 4QVDA 1Z05A 2E7WA 4Y17A 1D5VA 5D8KB 3FMQA 3ZMSA 2DK8A 4YDQA 4PG3A 1YFHA 2LKPA 2RNJA 4EO4A 2UXNA 2PI0A 3PCOB 4HF1A 4ASNA 2Q8KA 4GO1A 2ZMEB 4AIHA 3WTSC 4EQQA 5LJ5d 3WODF 4XTUA 5JFRA 4BH9A 4P74C 1O3QA 5E3IA 3WE3A 4JRIA 4HBLA 3OOPA 4JK1X 4RB1A 4HQEA 2IP2A 4HA8A 2HOEA 4A5NA 2V6CA 3JCMQ 2NNYA 3RTRA 3KP7A 4LMYA 3U2RA 3E6DA 2HWVA 4KMUX 2EFQA 4HZFA 3PQKA 1KA8A 5JR3A 2A6EF 2VT3A 5ELNA 2DXUA 4HLXA 3L1AA 2ARSA 3LA2A 3E3VA 2HKXA 3UH0A 3GZ5A 1TH7A 1GXQA 3M7GA 2JPCA 2XHKA 1USSA 5D5UB 4J6XA 3E6MA 1BM9A 3F3XA 3MF1A 2QUFA 2JTVA 1HW1A 5K5QA 1HQCA 4RS8A 1O57A 2HQNA 3B02A 1SRYA 3MEXA 5CVUA 4M7AG 1WLEA 3PQJA 2W85A 2IJLA 2Q7EA 1IN8A 3GXOA 3E9HA 5A2QZ 1EH7A 2DW4A 1TNTA 1ASZA 5ELOA 4FX4A 2ZTGA 2ZMEA 5GMKh 1TW3A 1E17A 2AXLA 1G5IA 2ZZGA 1MKMA 4BHPA 3WTWC 5CJ9A 3JSPA 3HXUA 5GAN6 3U1DA 1H9TA 4TVAB 4G6QA 1X55A 5JHUA 1FZPB 1ZG3A 3HSRA 4B8XA 2QLZA 3HXVA 3QNEA 5A2QK 1B70B 2L4AA 1P92A 2DDZA 5FLXK 1YYVA 1R22A 1PP8F 3W6KB 4P71C 4EMKB 4RQEA 3DPLC 5ILVA 1Z1DA 3QPTA 1FP1D 4YFXF 2YSRA 4M75C 1ZARA 4ZZDA 4OINF 1W7PA 2M5WA 2DBBA 4U88A 1FSEA 1JGSA 1XSVA 4M78C 5BPIA 4H2UA 4H2XB 4M7DC 2V1XA 3ZMUA 1H4VB 1B34B 4NCXA 4A6EA 4C92C 1QQIA 4M75D 2KJBA 3LA3A 1YW8A 3W6JB 5GANd 1G4DA 1BI0A 2VE8A 4IRGA 2AMCA 2ZR3A 4YFKF 4H0EA 1KU3A 4MNUA 1YQAA 4PNOA 3UGQA 1B76A 3JCMc 4U0WA 2ZKZA 2CJBA 4G94A 3NETA 1NNHA 2FBKA 4HAMA 1ZRCA 1KYZA 1B1BA 4HWRA 1Z7UA 5ILUA 2A6HF 4OP0A 1FOKA 5LJ5j 4M7DB 4G84A 2DZ9A 5F6FA 3F8FA 1REPC 1SMYF 3CUOA 3KP4A 4PJOC 2K57A 2HGCA 1W66A 1BBWA 1R23A 3CMQA 1BC7C 4HF2A 3PFIA 2QBYB 4CXFA 3T8RA 2ZCWA 1BJAA 1I5ZA 4RGUA 3VQXA 4XLNF 1K78B 2Q7GA 2I4NA 3INZA 3HSBA 1BOAA 2HQRA 3TDUC 3V4GA 2ZNZA 4X9CA 2MBFA 1FBSA 3EUHA 1YFRA 2LDUA 2ARUA 2EL9A 4M75G 2EFOA 2CIMA 2RKHA 1G3YA 4XTWA 4H02A 2ZFWA 3RPUA 3COAC 5KVRA 1LNWA 4G7ZF 5LRSA 4PZJA 3WTVC 4YRFA 4P75C 4PGGA 1EH8A 1KQ2A 4GYIA 5GMKi 2GA2A 3VODA 4F7UA 2OBPA 1H4QA 2M30A 3GYHX 3JCMf 1YS6A 4DQ2A 2E41A 4I0AA 1G3TA 1D3BA 5KNNA 3JCMX 1QNTA 2IPQX 2QM3A 2MLKA 3DKWA 1TQPA 5CYVA 2XGTA 1C0WA 4KICA 5LBQA 3WU1B 2JRTA 3FHZA 3IL2A 5D5WB 5CVIA 3NELA 3ML6A 4UP9A 3LSTA 2ALYA 3RERA 2ZNYA 4QVCA 3WTYC 2K7LA 3E6CC 3A32A 5ICCA 1YFSA 2MLGA 4M7DD 4YCUA 4AD9A 4WXDA 1HW2A 3R4KA 3SQNA 3PZCA 2STTA 4GGGA 1OMIA 3Q9SA 1LDDA
chains in the Genus database with same CATH superfamily
1L0OC 2BBYA 4MQ9F 3GTMJ 1MDMA 4LG0A 3TSWA 4D6WA 1X2GA 2K5LA 2PMZN 2R7SA 3I5SA 3A7UA 5J26A 3MCAB 4QW2A 2ZC2A 1IF1A 4BJ5C 1YW9A 4H4KC 1U1SA 3FC3A 3WTTC 1NJIC 1N6AA 3VV0A 2GZWA 4KITB 5IOYA 1FJLA 2PTKA 1AWXA 1QVGP 4JX6A 1M3CA 3G1OA 3OOUA 2ZJQF 3PO2J 4Y28E 2CJAA 2KKOA 2IEKA 3A01A 3SJMA 2DAOA 2HEQA 2X4JA 2MC3A 5LD2C 1JJ8C 2Z0WA 2EJRA 3A74A 4HWSA 3OWTA 5GMKm 1TQIA 2RREA 3LSPA 1VQ6T 5CCAA 3PCOA 1FIPA 4XTVA 3UPUA 4A4HA 2NLUA 1KYWA 5KCMA 3CCUA 4E70A 4L18B 3FXJA 3V42A 2DK3A 4A4EA 1WHGA 1R5GA 5E1WA 1YI2Q 5IT3A 2R5YA 1KU9A 2YWWA 1BU1A 3PMIA 1I3QJ 2E36A 2KT0A 2YLCA 3OSSC 4ZGJB 3E97A 1LKXA 1VQOA 2ZZEA 1YJNT 2VKEA 4AWXB 3PVQA 2EV5A 1LFUP 1NLOC 5L3CA 2C06A 5BOXA 2M9HA 3RF1A 3BR3A 3I56I 2R5YB 1FMKA 2YT6A 3HRIA 1MW7A 5GMKe 2L89A 5D8LB 3D5LA 3FDRA 1ZKGA 1T0FC 2HS5A 2H8RA 2A5YB 1YCSB 2JS2A 1TBXA 3N5BB 4PJOD 3KP6A 1EQRA 1P4XA 4A3FJ 2O01E 3PT9A 3HXWA 4S04A 4M75E 1SRLA 1G6NA 4RAZA 3QYGB 3S3OA 2OAUA 3DKMA 3X24B 5KE3A 3CCVQ 1FYKA 3F21A 2HNIA 1KJWA 5I2SA 3BPVA 4F14A 3TOBA 3QTCA 4ELYC 4BJ6C 2JS0A 3TEHA 4BUPA 4HQMA 5LHGA 3CLQA 2VE9A 3KE2A 2KRCA 1M2VB 2A28A 4BXUA 5FKKA 2DU9A 4MTDA 1WXTA 4AFQC 4FQGA 1VQ7T 4TQFA 3W3SA 2YS9A 3CD6I 1H641 5I11A 3JCMb 5GAMh 1I1JA 2FQ3A 4MHGA 3EHQA 4KFCA 3EH2A 2DJNA 3ZN1A 2BY1A 1G2BA 2K3FA 3MMYB 2V9VA 2L3SA 2VLAA 3M5AA 4J9IA 1XG1A 2EJGA 1X2HA 1DP7P 3BR0A 9ANTA 2FVUA 1N75A 1H0MA 2FBHA 2P8TA 4OIPF 2C0IA 5LJ5f 1HTTA 3ZQGA 1ORKA 1GHCA 4N4OB 3VYSB 5J1RA 2DILA 2XRNA 2ECZA 4EVIA 3SWNA 3C3WA 4ENMA 4KNYA 2A6TA 4XLPF 1ZRFA 4IUUA 2ZIOA 3MFKA 1R0BG 4GLMA 2M45A 1W4MA 3K4JA 2ZPHB 1M1KU 4MDWA 4EMSA 1X4OA 4A93J 1BA5A 1I0CA 3TO9A 2KY9A 2L5QA 2O9SA 4TVRA 2D8JA 5GAMg 3QYHB 2ESHA 4WCGA 2DA3A 3DU6A 3I53A 4XQFA 4IURA 4C8QA 4XMYA 4RAFA 5J3LA 3U9GA 4YRVA 1QZYA 1JHFA 1WDXA 3EUHC 3RMSA 2HKOA 2GQQA 5E8IA 2XMFA 5H20A 2RHZA 3R07A 3U1KA 3MZ8A 1OPLA 3CDHA 3QU3A 2KDSA 2QG9B 2DJZA 2ADUA 4KBMB 4NL3A 1LDKB 2DO7A 1USYC 1LEAA 3CDIA 2RHIA 5GAOl 1PYVA 2J7IA 2VL8A 4CHUA 3A03A 4KGXB 3KLOA 3QG1A 3DTKA 4CC4B 2LTPA 1RL2A 1AWJA 4HCBA 3OBWA 3DLLF 1SPKA 3VUZA 5KE2A 3SWNC 5DDGA 1FYFA 3I58A 2F5KA 2E1NA 3CP8A 3GMEA 3P7NA 4UUSA 1PKSA 1PC0A 2ZT6A 1RAFB 4K87A 3L2QA 2M1HA 2O7OA 4B1RA 2BE7D 2YHTA 4JX4A 1A5JA 2FPEA 4J9BA 1WA7A 3RESA 5IAYA 1E0EA 1J0RA 4ENKA 1ZLMA 5FWBA 1WXBA 3G71I 2PFBA 3CCSI 2YUNA 3A98A 4FYYB 2O5RA 3BR5A 1XOVA 1FP2A 5A0GA 4GRIA 4KQEA 1LPQA 3LH0A 4Q48A 4MTEA 4HNTA 3KZIC 3DTIA 4II3A 2M4GA 3M07A 4DGWB 5BPDA 2IA1A 2EJFA 2ROTA 4GCVA 4BI8B 2QHTA 1XJWB 1VQOI 3PUBA 2L7KA 2P4WA 1MSFC 1UAAA 5KHDA 1MBFA 2V1RA 2H1LA 3CMET 5FJ8J 3ZGKA 4CS4A 2LCLA 3QWYA 1EFWA 2A3SA 2DPPB 4FT8A 4LGWA 4PK4A 3BG9A 1ZYRF 4P72A 4F7UG 4A54A 4ZDLA 4G7OF 3CCRQ 1JHHA 3J80K 2F2VA 1X19A 1Q82C 3CCLI 2XASA 2L9RA 3PNYA 5E18F 3H1CA 1FC3A 2HYJA 4YRTA 4JBAA 3JCMg 4AH6A 2HVRA 4QPQA 1Z0XA 4G12A 3JCMW 3ISPA 5L3GA 1N8RR 5KH6A 2F4OB 2NYXA 2WAEA 4D8DA 3UDCA 4M78D 2F5DA 1X6BA 1SEUA 1VQ5T 3BROA 3SXYA 3QSUA 3P8TA 1R0CB 2FNAA 4LNSA 1USTA 2GF7A 1VQ4Q 4C0GA 1BYMA 4QPOA 1MZBA 2AT1B 3G73A 6PAXA 1VQ8Q 1D3BB 2PX9A 2RQPA 3A8MB 4UP7A 2J5PA 4C92D 1R77A 3ERED 1SD6A 2IBDA 2XDBA 4KUDK 3FKIJ 4ZYHA 1RPWA 1AWOA 2Q7HA 4QTRA 4KH1B 2LOOA 4BBRJ 2VC8A 3DEUA 2LBFB 4BHBA 1EVLA 2R7FA 1RIQA 4AG1C 2DQRA 3UFGA 1VI0A 3HTRA 4M77C 4XEMA 2Q2EA 3PGGA 4B44A 1SANA 2M51A 4C3IJ 3JRAA 4ZN3A 2MSYA 5HVQC 1W1FA 3PUFA 4TVWA 4LD5A 3GTOJ 3S93A 1IAWA 4H2VA 4HSTA 2YUPA 2HPIA 3I55Q 2Y0MA 4YRQA 1PUEE 1IB8A 3H5AA 4IL6C 4XLEA 3OD1A 4EGZA 2JT4A 4M7AF 3FMRA 1I5OB 1MD0A 3WGIA 4E7KA 2ED1A 5GAN5 3NMZC 5HGQA 3PJRA 1CSKA 4BE0A 5DM7F 2A36A 2E2JJ 4HVUA 1G8XA 2P5IA 3NTHA 4YRLA 5K7ZA 5IP7J 2M8EA 3I55T 4CH4A 4BY1J 1O3SA 2F48A 4RMNA 2KYBA 2Z99A 4EM0B 2ZPBB 3BQZA 3OR2C 4G8XA 2EFNA 4RAGA 2DL7A 2GQIA 4WXHA 5I21A 2L9NA 3MEYA 1W70A 3CUQA 4E6RA 4AIDA 4M7AB 2CSOA 4MFEA 4A69C 1HKSA 1MBJA 1OYWA 1NLPC 2A7YA 2YUQA 3MP6A 4HKEA 1QHHD 2ZXJA 1CF7A 1TXQA 3L42A 4L5GA 5GAOn 2Q5HA 1YI2T 5DEQA 3J80E 3TKYA 3FRNA 4ZZLA 1PYSA 2LH9A 4R8HA 1TS9A 2HQAA 4PJJA 3CJTB 2HTJA 4RLQA 4BY7J 3LSRA 1EIFA 3RQIA 4YELA 5JVTA 3C0CA 1HKQA 2DLLA 3CCLT 2V8KA 3CCMA 1ZX6A 1WJDA 4BL0B 1ZRDA 3CQTA 3TSZA 3I64A 2R7VA 2DRMA 3CTAA 4EJVA 1BR2A 3VPRA 2CUFA 2RM4A 5CKEA 2QVOA 2CW7A 1D3YA 4A3LJ 2OAZA 2XPVA 4KA4A 5FFXA 5J8CA 1M4ZA 4KRTA 5DUIA 3O6BB 1JO8A 4J9DA 4OB2B 2HOTA 3SEMA 2KK4A 1WJCA 1JT0A 3KEQA 3JCMe 2ZT8A 2RQUA 1VQ9T 2A3LA 1HKTA 5D6YA 1NG6A 4M7AE 3REAB 1D0YA 4ZIBA 4XU2A 5H6RA 4X1EA 2DTRA 3HOXJ 5KYYB 3CUQC 2C8MA 2PMUA 2CUDA 1OYXA 2FG0A 1KQ8A 4R56A 3FXUA 2KVQG 1RKWA 3FF5A 3MEAA 1LE8A 3FXKA 2V1UA 2WSEE 4YROA 4L5EA 2VODA 1I81A 1IG7A 4LNPA 5KCHA 2ESWA 4ZH4F 3R0JA 4UB6C 4F52A 2J05A 2K9MA 2PZ1A 2LY1A 1NPRA 2KL4A 4C30A 5DCFA 3SZTA 3CBPA 4WJ4A 2H8WA 1VQ4T 3CJQB 5AIPA 3JW4A 2QDYB 1WU7A 3A5ZB 1LJOA 2W25A 2QYOA 2IS2A 3OYFA 5CQGA 2HYGD 1LFPA 1Z3XA 1HK9A 1IGUA 3META 4LVLA 4LDVA 1IXRC 3CC7I 2DEQA 2DKGA 3LAPA 4OMLA 1WFXA 4ON0A 3SHFA 3L2CA 1M30A 4E7ZA 2K2VA 3VS7A 3CESA 2J5OA 3LSQA 2GGRA 4DEXA 1VQLT 5JLWA 1BI1A 3IV5A 1U0JA 3GX4X 4LB5A 1BJZA 1YGBA 1C6VX 2ZZDA 5GAN3 3CCQQ 4YRSA 1QPIA 2LQWA 2GTOA 5HNHA 1FBUA 1FY7A 5IYDJ 3I56T 4ZDPA 4LE9A 3CCVI 2GWRA 5F1RA 5C4JJ 5FWCA 3IP4B 4AIKA 1RC9A 1XDSA 4BDYA 4DEYA 1K8AR 2L9VA 3VUBA 3FX3A 3M0UA 4CCOA 2BZYA 4J9HA 3GO5A 4YEJA 3HL2A 2JQ7A 1A35A 2CGPA 1BW5A 4O6JA 1ZREA 2LYCA 1PSFA 2X4WA 1GBQA 4FSXA 2G7HA 2UZKA 5A0DA 3F9KA 3AHUA 4KDPA 2VJJA 3OMGA 4L6V5 1YS7A 1WQ2A 3WVDB 3ZOBA 1XC5A 1JXMA 1U3OA 2ZCEA 3JB9H 2ME0A 2Q1ZB 3P9CA 5B66C 2B86A 1RAIB 3M8EA 2LNHB 2EH3A 4K2EA 2K3XA 1U8BA 2R92J 1B7TA 2HSEB 2PVGB 3EG1A 5FU7B 5LJ3f 2J3LA 3CDLA 2VQLA 1Q7YR 4HWPA 2EIJH 1N77A 2ODRC 4C8QF 1W5TA 2EAYA 2UXXA 1ETQA 4FYWB 3KFUA 3RMQA 3HTZA 4XBFA 3CMEI 4C5HA 3VBBA 5LJ3j 1FMVA 2RI5A 2VB6A 2Z1DA 2VQHA 2VC1A 3VU3C 3S14J 1ULYA 1Z9QA 1VQ8T 1QLYA 5IH2A 2FEZA 2SEMA 1ETKA 1POGA 1RNLA 4RM2A 2A07F 1STZA 1RABB 1ZG1A 2E5QA 4CH7A 3MQ0A 1K73R 1Z3YA 2D8HA 4LK0F 1IZ6A 3M57A 3BDDA 5IHNA 2LP0A 4KT0E 2NNNA 3DLLA 3JREA 4PKCC 2PMFA 3A8OB 2EQKA 3JAMK 5C44J 3E9FA 1VQ7Q 1F4KA 1SFXA 3C18A 2BV6A 2XF5A 2LSOA 2DTIA 4AMCA 3JCMP 2ZBKA 2H6BA 5DV5A 4MZTA 3E5UA 1R4MB 1UTIA 2QHSA 2HDDA 2CT4A 4YCVA 1K0XA 4M6VA 2TCTA 1VYVA 2A69F 1Y0MA 1HC7A 1DPRA 1EH6A 2LG4A 5C53B 4LLLA 1UB9A 3W2VA 2P5VA 1WSUA 2HEOA 2E1MC 5DY9A 2W4SA 2BY2A 3H36A 2CUJA 4D5FA 1M90U 2AZSA 3PSIA 1BN5A 1UECA 2HVSA 2RA2A 4XRFA 5GANh 1GFDA 3BR6A 3IALA 3HXLA 4I0BA 3K4CA 4NDLA 1QGPA 4KIBA 2CSIA 4Y33A 1LVKA 1BC8C 3I4PA 2E5ZA 3QODA 2ZPFB 1IUFA 3G71Q 2QA4Q 2ETHA 2BHYA 4CO8A 5EF6A 3CEYA 5D4RA 5FLVA 3RACA 4C0DB 3M9AA 4UC4A 4HDVA 4PJOF 2KGTA 3QKJA 4BQAA 1N9SA 2XPUA 5J6XA 1M3AA 2OX7A 3HTUA 1OCTC 4LN2A 5FRNA 3T9NA 3VKIA 3G4ST 3RKXA 5H6QA 1DDNA 3EETA 3VWBA 2V1DA 4L5IA 2X48A 2IT0A 1K1ZA 5CKFA 2VI6A 3GUDA 2DPUA 1XCBA 3CJNA 2IPOB 1ZELA 4UUSB 2KMTA 3VDXA 3BPXA 1FBQA 2BW3A 1JQQA 2HDAA 4FT4A 4J7IA 2QSGX 2KRHA 3C1DA 2XKOC 3CPWS 3CCVA 1SVMA 2DA6A 2E7XA 4RKUE 4UPAA 2QASA 3A0BC 1SVOA 1X1PA 2D2WA 1I1SA 3V7CA 2A37A 4B3AA 2DZCA 5DM7R 3JB9J 4C8QE 5GANj 1GBRA 4JP0A 3HOYJ 1FMWA 2CQXA 1FTZA 2EQJA 4IO9F 1TUCA 4M77E 3I56A 3G71A 2J3MA 1JE8A 2LX7A 1G5VA 2FPDA 2CGHA 4F55A 3K4LA 5HLIA 1KU7A 2R7QA 3BG5A 1QU3A 1PRLC 2E65A 2HKQB 2J6OA 1W1WE 3OS1A 2V1NA 4CGZA 2HMAA 1AKHA 2WTEA 2XPWA 2E5KA 2EPDA 3GCMA 4LOCA 2E1OA 4EJUA 5B3SH 4RB2C 2E4HA 2LQ8A 4RUGA 4XTYA 3TREA 5J39A 3CCRA 2K5IA 4P72C 1ZSZB 3HRUA 4XRMA 3WTUC 3NARA 5C6SA 2F5CA 1JKRC 4M6XA 4P75A 1G59A 3TW7A 1WFWA 1A6QA 2AHJB 4BQOA 4HT4A 2Y2ZA 3I5UA 1YJ9Q 1YW7A 1IN6A 5GAOr 2L0KA 5E1ZB 1FOXA 5L3BA 4BQNA 2HYFA 2E2IJ 1ZQ1A 2KT1A 1GGMA 3OIOA 4O2DA 4DPGA 1VQ5I 1IDZA 4MFDA 2CKKA 2ZPGB 2IVWA 2BY0A 3C94A 2DT7B 4Y4RA 3PNTA 3R6OA 4OMMA 2DFEA 2MOXA 1AHDP 1ATIA 3NELA 1X3ZB 2Y4YA 2ZINA 1D1AA 2VC0A 3KETA 2LKXA 4PCQA 4B43A 5DD8A 3B73A 1RI9A 3CXCP 1K73C 5GAN8 4M7DA 1IXDA 2IA0A 3CCRT 2EIMH 3HTSB 3EHRA 3GIBA 1ETYA 2V1QA 5KNLA 1JBMA 1F9NA 1IL2A 5HDKA 3I7FA 2XAFA 2B8AA 2M0YA 4Y91A 1YIJA 1M2VA 4JZ4A 1X1BA 5HLTA 3W6VA 4RB3C 1SETA 1XSDA 4BUGA 4GYGA 3JRZA 1KMNA 2VIXA 1HDDC 2X1EA 1RESA 2RHQB 4JRKA 1GVDA 4LLGF 3M4OJ 1T0JA 5EEGA 2V8JA 4CC7A 2JOYA 1VZ0A 4ZGDB 4P5OA 4LUEA 4VUBA 1A36A 2DU5A 3CCET 4P9FA 3IHUA 2IVMA 2AXTC 1ABOA 2FRYA 3THKA 2NS6A 2FRHA 1Y96A 4LLNA 1FYNA 2LLKA 2OQGA 1WI7A 4ZYGA 2HOSA 1Q86U 2L2OA 3WTXC 5IYCJ 3CC7T 1UFMA 2KIMA 3QP6A 3J7ZI 3GFIA 1GCQC 2F4IA 2KDOA 2JZYA 4AYBA 3MCZA 1WQ7A 2XDDA 2WV1A 4I02A 3REOA 4CYCB 2W7NA 4C92E 1T95A 1I8FA 1W2BA 4L5JA 3VFZA 11ASA 1LVAA 3CPWA 1WJAA 2BE5F 3ZMTA 2HR3A 2HI3A 1Y1WJ 3TDZC 3JR9A 1NK2P 5J1UA 4PFZA 3K2ZA 1N9WA 4H2WA 3MP1A 4MMKA 1I50J 4JQFA 4P9UA 2EFPA 2BXYA 3QAHA 2BKDN 3UWNA 1B72B 1QW1A 4BI3A 3J81Z 1JTYA 2PLYA 1IV6A 3SWNB 3BCBA 3EGXA 3VRZA 4J83A 3NWTA 2O0YA 1Y96B 1OCPA 4ENJA 1OISA 3ZQQA 3K4KA 4XR6A 1YWOA 3KFVA 2H3EB 2ROLA 1I39A 4XLCA 2M02A 3BY7A 2QCOA 4MQVA 4LDWA 1Y8RB 1ONVA 4U87A 3FM5A 3ZMVA 1NM7A 1UCRA 3O8GA 1OOTA 1WNLA 2K4YA 3A01B 3EFOA 3R6SA 1JUMA 1UZCA 4NQWB 1W36D 2E1HA 1TQMA 2EQIA 2CW0F 2DDAA 4OMNA 5LEJA 5CIUA 4J15A 2GOXB 2H1KA 1TP4A 4BXFA 5LLQA 5HY6A 1ODDA 2E60A 5FKNA 4ELZC 1WX6A 3TEGA 5M5WJ 3A0HC 2H27A 1GVJA 2YPRA 3ONQA 1VUBA 3FXLA 2AKWA 3LSSA 4M73A 1D8JA 3KYLA 1U6GA 2F2EA 3GEZA 2GIVA 4LG0B 1CGPA 3S16J 4U7DA 1WJRA 4Y52J 2CDTA 4OGEA 5CQEA 2JVGA 3NWSA 5GAMj 2RPNA 1YP5A 2KYMA 4ATOA 5E1XA 1R8OB 3BW1A 3FK6A 3FXRA 1WJ5A 1XGOA 3VQVA 4U0VA 5IT9E 1FSHA 3T8TA 3HRSA 1M2OA 2X4YA 2LF8A 2F1LA 3DB4A 4IIOA 4M77D 2KSSA 4OB0B 4L0ZB 5KYXA 1HBXG 1VNDA 1B4AA 2HPMA 4Z8AA 2X1DA 3VQWA 2DYBA 2QA4A 2VGNA 2XGXA 4DJAA 2M0MA 4M77F 3CC4A 3FEOA 4WCIA 2PN6A 4FW1A 1OYYA 2RGVA 2V6EA 2GBQA 2R7ZJ 2DT5A 3CMYA 1C1AA 3M8FA 1Y6IA 3IQLA 1IC8A 1QP2A 4O5VA 5HDGA 4C3JJ 1HF0A 1SFOJ 3I35A 3NTIA 4V2FA 5LJ3d 1LB2A 1D0XA 1UHFA 2JZ2A 4IIMA 1QVGA 3A7RA 1QKXA 4NBQA 3ZQFA 4KYWA 2DD5A 3HXYA 3HKZN 1JT6A 3ABTA 4XKBA 2LTOA 3HPGA 4FETA 2DRKA 1S72T 4A0YA 1CQTA 3CCJA 1VQNQ 2QHVA 2E2HJ 3CMAA 2MA3A 2K27A 5GJWB 2X9DA 3EG3A 5GTHC 5GADJ 3RPQA 2O61A 3CCJT 2FJ1A 3R61A 1OCOH 4KIGA 2EKOA 2YX7A 1K4SA 3SB2A 3HFZB 3P8VA 1TZLA 3K0LA 4J9CA 2CV1A 2QQ8A 1JTXA 2MD5A 2OU2A 4J5YA 2PQWA 2OJED 5ED4A 4CH3A 2CQNA 1YWPA 2LT4A 2M87A 3K69A 1MBKA 5E3NA 4L9NA 1YE9A 1R71A 1MMGA 5C4XJ 2CQKA 4P1WA 2QQ9A 1K6YA 3LOCA 3RKWA 1UJYA 2RV8A 3X25B 4C9YA 3VSKA 2EPFA 2Z5UA 5GANf 5K1PA 4UNOA 5FD5A 2M0OA 2OAWA 2FBIA 2VKDA 2KJCA 1T3SA 4LD9K 4HWOA 4IF4A 1ADYA 4XN0A 2KRMA 4A12A 3OB9A 1QWEA 1YJ9T 2Y75A 2QSHX 1LPLA 2VXEA 3PIPA 1M9SA 1VQPA 4HX4A 3ERRA 2A05A 1G2HA 4BWAA 1XCVA 1PUFB 4K86A 2P6TA 5CKHA 1ZSZC 2DEUA 2P81A 2EIKH 3TEDA 3Q0UA 5EGOA 4OIQF 2BE9B 4XAXB 5FD6A 4EMHA 4EM1A 3Q0VA 4Z6YA 1MMAA 3GNFB 3M54A 1NYQA 2STWA 4HVCA 3GTPJ 1ZUUA 4BU2A 2CP6A 4UUTA 1PHTA 3FLGA 4BI4A 1QZEA 1R58A 5CVRA 1OQKA 3IUOA 1KIKA 2XIGA 1Z6TA 2XB0X 4PDKA 1BBUA 2BYVE 3HP9A 2VONA 3A02A 2RF0A 1HOMA 1NJ6A 1VFCA 2WB1A 4EGYA 3K7AJ 3CLOA 1RIOH 1S1NA 4RB0A 1T3LA 2AQEA 1XNIA 2CP3A 4IKFA 2EVRA 2PVOB 3EUAA 3AL0C 3EAEA 2EIFA 3QIIA 5B5EC 1ZLJA 3QO3A 4M78G 2QA4I 2TDXA 3MF2A 3IAM2 1MGTA 4IUTA 2FZCB 2A61A 3BP8A 3HOTA 3RI4A 3OIPA 1YRNB 4F17A 3IH2A 4M6YA 3HRTA 3RJPA 1XN7A 4F7UB 2FMYA 3HY1A 1YJWQ 1V5GA 3F8NA 1KHIA 1KC8U 1X1AA 2A8EA 5HS8A 1J5YA 1NG7A 4EJTA 2MWOA 5LGTA 1KK7A 1KFZA 4N0AA 4L0YB 3A31A 3UR3C 1KD1U 3VYRB 1ZTRA 3HOVJ 3VEPA 4BYYA 4ZGEB 3ICAA 3CD6A 2WC2A 2DXBA 1FXXA 5GANe 4J6WA 1KQSS 3M4QA 4E7LA 3LFUA 1FYMA 4HLYA 3EQLF 2JA2A 3WU2C 2AS5F 1WIEA 2FZKB 3ULRB 1W2BP 3M4PA 3DBHB 3RGLA 3FJ5A 1W7PD 2HZTA 3N4MA 1C0MA 2RNAA 5GJVB 2O31A 3RNJA 4PHCA 5C52B 1XGMA 1VQMQ 2NWMA 2ZJPF 1ZG5A 2Y0SA 4FHTA 2NVTJ 3OSFA 3DV8A 2RQQA 1P7IA 4JUVA 4YRMA 5CAIA 2IGNA 2FF4A 2M9UA 3SEQA 3OYCA 3CCEA 1X56A 3M3YJ 3H3UA 5F27A 2CO5A 3GFJA 3K1MA 3RKYA 4CYDA 4Y7NJ 5HNFA 5IT9Z 1TOVA 2GQVA 5IHIA 5FKLA 2ODRD 1G5HA 2EA2A 4P55A 1R4NB 3S6WA 4YYEA 2E5NA 1M5Q1 4KN4X 1IGQA 4AT1B 4ANJA 3GOXA 1VQMT 2HXIA 2F5FA 4PSXA 4IRIA 4N0AC 4M3BA 3V7RA 3BT9A 1N25A 4YRJA 4M77A 2E34A 2P4TA 2GXGA 2PJPA 5L3FA 4EIKA 1S7EA 1QVFP 3J81K 4YCWA 2RK1A 3IH4A 4HOBA 2VPLA 4G6TB 4Q5SF 1LCKA 2VBXA 1X6GA 3LAJA 2HL5C 4FW2A 3G1ZA 1OCRH 3HB9A 1LJ9A 2CJJA 5M5YJ 1UJ0A 4F3QA 1F1BB 5FO5A 2DF6A 1TTYA 2R4GA 2RNGA 4ZYAA 3K1NA 4ABZA 2K86A 3FDYA 4Y13A 3OY9A 2K79A 1Q82U 4UVBA 4XOTA 1TT5B 1D0ZA 1S5LC 4MGRA 2R7WA 1DPUA 2UWMA 3PNWC 2O88A 3DFGA 4P96A 4A4FA 2J06A 2DQ3A 5IN1A 2RVCA 1BI2A 3C2HA 4BXXJ 3TP0A 1PD0A 1ZSGA 2RJCA 3VS6A 5F64A 1VQ7A 3RR6A 3ESWB 5HS9A 1TUGB 5ERIA 1W7PB 4XTZA 3UF4A 5KYYA 1IO2A 3JSOA 3QDRB 1RAGB 4LDUA 5KYUA 2CJ9A 5D6XA 1ZHIA 2MMPA 3I5RA 4C8QD 3CCRI 1K9MU 2GAUA 1M90C 2R3SA 3FIWA 3ZR8X 3MZHA 3TOAA 2OZ6A 3SD4A 1ADJA 3HGGA 4CA0A 4YTLA 2DERA 3ECHA 3PE0A 2RH2A 4WI1A 1R6RA 3LC0A 1APLC 3CZ6A 2O9VA 4GY5A 4L87A 2PQ8A 3HOSA 3HYIA 2OCCH 3ABKH 3Q5FA 4QT7A 4XORA 3QPHA 5F0CA 1B72A 3NGPA 1H9GA 2MPXC 2KRSA 4Q5WA 1VQNT 3LSGA 4ESJA 2J6FA 3A7AA 2NVUB 1HSTA 3UA6A 1B70A 4DYCA 3HFVA 1PYSB 1S6LA 4HNVA 2VJIA 3M53A 5EDNA 2EW3A 4YPFA 2DX1A 2GXAA 3W2AA 5AIQA 3H41A 4NL2A 2NS8A 4D0PA 4C8QC 3T0YA 3PM1A 3RYPA 4M77B 4TVAA 2XI9A 3H0FA 1B34A 1E3HA 3QUIA 3SDZA 2JA5J 1QBJA 2CV2A 2XF7A 5KYWA 4Q4ZF 4G7HF 4IHSA 1YFTA 5FLMJ 2ZXIA 3WXMB 4OB3B 3CCYA 4HV6A 1USYA 3CCJI 1WRJA 2OZUA 3FB9A 3K4NA 1YCYA 5GAOm 4BACA 1SESA 2P0KA 3BWGA 5J40A 3JB9I 1D09B 2NYSA 1WVRA 3PVLA 1JKQC 1DU6A 3QJYA 3OYLA 4NCXA 2QQBA 1RUNA 3A4CA 3RPUD 1LNXA 4BS9A 2V79A 3V7SA 2YSQA 2D45A 4HG2A 1K76A 4IUQA 1QF6A 2NS0A 4AYBN 2X35A 1IHWA 3CMAI 2BTTA 1KOGA 5LEKA 2I2LA 2Q5IA 3CC4I 1M8MA 3HGYA 2IGOA 2X1CA 4B9WA 2DI3A 3CCJQ 1VQNA 2LFBA 4EMKA 4KH0B 2O2OA 2DMNA 1E1TA 2Y31A 4YP0A 2QWWA 3LWFA 1I5LA 4HXJA 3T1BA 1NJ8A 1XD7A 3NFCA 3P9IA 4U0YA 5TRDA 3F22A 2YLBA 2ZJ2A 1ZLKA 5BNGA 1R5ID 2L3QA 4UP8A 2KT8A 1YTYA 5B1AH 3JCUC 2L3PA 2YXYA 2OA4A 3SFZA 1YO5C 2O9LA 3OL4A 3QU6A 3MO8A 3IG2A 1EVKA 3BY6A 2ECCA 2L7ZA 5IOZA 3OSVA 1ETXA 3F6OA 3TO7A 3MKYB 4J01A 3EG0A 4F7UE 1P4WA 4WXCA 4V2GA 4RDXA 3EYIA 2EZHA 2VJ5A 4A3KJ 2ECBA 3MKLA 2M1BA 3D5RC 3HC7A 2DFIA 1ON1A 4HV5A 3KUFA 4PJNA 2ZCFB 2DYRH 3L9FA 3L2VA 1PG5B 2HSPA 4MLOA 3RYRA 2NRAC 4DA4A 3GZNB 2MH9A 2JNGA 2X3WD 1ZA1B 2HD0A 1U5TA 1XMKA 3MQZA 2XAGA 1WKMA 4BEHA 1JXSA 4EMKC 1K0SA 1RACB 3A8GB 1NJ5A 2WAFA 5HLGA 4UUVA 1O75A 4PFPA 3DB3A 3G1LA 5HODA 5FB2A 1G83A 1N9RA 4PJOB 2E19A 2ATCB 3DQVC 3LFKA 2VPRA 1UFFA 1GFCA 2G6FX 2JA8J 4JLGA 4W1UA 1VQMA 2W84A 3OYKA 1MH4A 3KPHA 1QO0D 5GAMe 2L01A 1Y71A 5DCMB 4FTHA 1HJDA 3DEWA 3LSJA 3I9QA 3CCEQ 4TQDA 1ERDA 4AIJA 3PIPF 1MV3A 3S1RJ 2DMPA 2EK5A 2OUMA 4NC7A 1XSXA 4OIRF 1T8IA 1MNMC 2QQRA 4Z89A 2QEXI 1OX8A 4EDUA 1KHCA 1H92A 4E4HA 2ZSHB 1YB3A 3X28B 4WK8F 3QOPA 4M9SA 1WQWA 4L9JA 3ZEHA 3HY0A 1B3QA 4CI0C 2CFOA 3GZ6A 2I4MA 4GXOA 4IX7A 1R1UA 3J7AO 3ABMH 3J7YJ 1PWTA 4C2TA 2EYWA 3I9V2 3KXTA 3ZL7C 2P6SA 1Z9ZA 2K02A 3OYDA 1W36C 1UHCA 1SMTA 1YLFA 3D0SA 5E79C 2ME6A 1G3WA 1OJLA 3EGDB 5CR2A 4N9IA 4FU6A 1JUSA 1FX7A 1SD7A 1T0FA 1MJAA 3JRGA 2W0ZA 3B6CA 1PP7U 5LJ5e 5AYFA 2BGCA 3GW2A 1BI3A 5EEHA 1U5TB 2HQXA 3IRQA 2NUTA 1YJNQ 1ZK8A 3OMYA 2LF7A 2DO3A 1IN4A 4ETSA 1J9IA 4LK1F 2W57A 3M4GA 1TG0A 4A3BJ 2EB7A 2YU3A 2C0OA 1WHMA 4FT2A 1S72I 1XGNA 2D5VA 3M55A 2OCEA 1VYUA 3J7AF 4M78F 4C8QB 2CU7A 3HPWA 4K11A 2EJ9A 3KX2A 2K5FA 3L7WA 2DU7A 2RB6A 5IPAA 2ZXWH 2QYZA 4IHVA 2XD0A 2K3YA 3G7ZA 4XKWA 3QWLA 2VKNA 1FWZA 3A5YA 1Q7YU 3JTHA 2DVEA 2LY2A 5KYXB 3L2RA 3M1EA 1E6HA 2XKOA 2HNHA 3G3ZA 3OYEA 3JB9G 3RDVA 3H0HA 1YHQQ 5E20A 2GCXA 4S05A 1YJNA 3MAJA 2JW4A 1TWHJ 1JGGA 3L2ZA 2P0WA 2C7IA 1B7YA 3BOQA 4EATA 3RBBB 2N8GA 1A6IA 3ZMZA 3L2WA 5ECAA 2EV0A 1PD1A 1UGSB 3A1PA 2PUKB 3MKDA 2F69A 2EQMA 2X0LA 2RHYA 1Q1VA 1IJWC 2DMUA 1I6XA 1EA3A 1MNDA 3LSHA 5FU6C 4B3XA 1JKOC 3HRKA 4YRRA 5GAN4 3JRIA 3TEHB 4YRKA 3DP7A 3RL6A 3LGFA 4YIIA 5E3LA 4KT5C 3H9NA 4HWTA 1UMQA 2JJ9A 5FGMA 1LOJA 3EFOB 3S3MA 3ZFJA 5GAMf 3KYDB 1VQKI 1NBEB 4C92G 4IXAA 3JAMZ 2VOOA 2MI6A 4B9XA 4MO7A 2K5CA 3E7LA 1X3UA 2Y4XA 3CC2Q 3OYYA 2OD5A 1UB4A 3BLYA 5CLSA 1VQ8I 3X2QH 1ACMB 12ASA 1W5CC 2RJEA 1OPKA 3QYFA 1G51A 4ESFA 3HRMA 2YUOA 2DTHA 3MEWA 2H8HA 1XDUA 3A5ZA 1Q1HA 4XLAA 1QVPA 3K1PA 3KZZA 2CREA 3QHSA 2E71A 5IHKA 4PJOE 1EKEA 4OWRB 4C2MJ 4CZZA 2FSWA 3ELKA 1XQHA 2DIGA 1W6XA 2RDPA 4B09A 1KSWA 1WHLA 3HHGA 3CBOA 3M1CA 1RAHB 1WPKA 2LC2A 2F5EA 2QHUA 3A8LB 1QCFA 4M78E 1AOYA 2RN7A 2QZ8A 1JUPA 3JRCA 1PJRA 2XU8A 3DLMA 4M7AD 3DKXA 4OOIA 2FO0A 4JDSA 1WJQA 4Z88A 1KD1R 5C51B 4I99C 4HDUA 2P7VB 3Q0WA 1GDTA 1B07A 1D5YA 4OMFB 2CT3A 1HXDA 2FB7A 1WGXA 3CMAT 4M72A 4CZCA 1J59A 1UG2A 2DPDA 4XOPA 4AFSC 2EBIA 3G6EQ 2E6ZA 5IP9J 1V54H 2RHQA 3CMMA 3CC4T 2NS7A 1KQSP 2XB5A 4XNFA 3OSGA 2OJ2A 3E9IA 1SD4A 1UGVA 1UHSA 2O4XA 3CCQI 1YJWI 1EFNA 3WTZA 3JCMJ 2X4HA 3GLXA 5D4SA 1B9MA 2GXBA 1WPYA 3RKQA 2Y69H 1VQ5A 5GPAA 2ABLA 4O3MA 3G6ET 3F8MA 5D6EA 2IA2A 2FA5A 4UVAA 3G4SI 2KR3A 4D8KA 1Q81C 2DCEA 4XKCA 3TQNA 1GCPA 1Y7XA 5FLXZ 3LQRA 1Z91A 4NC8A 1L3LA 2IY5B 1BR1A 1MBHA 3AKZA 2OTLT 4LVMA 3GFLA 4XK4A 4P71A 3JB9F 5CKTA 1BK2A 1QMCA 3A8HB 4BD3A 3I4MJ 1KQ0A 1NK3P 2WADA 1PRMC 4M7AA 4IUVA 2W00A 2BEOA 3RSNA 1UGRB 1WLPB 3H5RA 3EDPA 3DF8A 2ZO4A 3OR1C 1NTCA 5LHIA 1YIJI 1VIEA 4HRIA 2CZ6B 2FPFA 2HZYA 4A3CJ 4FSSA 2CH0A 2DODA 1VQZA 4KIFA 2CP2A 5LJ3g 1SF9A 1VYTA 3AG3H 5EG0B 4GDFA 1QPMA 3BJ6A 3E5XA 2Y0SN 5E3MA 4ZYEA 4GLKA 4AVPA 2UV1A 1R7JA 3M0PA 2KDZA 3CC2T 4ZTZB 3KEOA 5EYRA 5AT1B 3VOEA 2LQNA 1AKHB 1B6AA 3K4MA 4RGSA 2EYQA 2EILH 2DMOA 4IHYA 4CH6A 3KP2A 4MEYF 4M9XA 2WY8Q 5DTDA 2G7UA 3S2DJ 2BIVA 5K7HA 4M78A 1MJ9A 4QQ6A 3JCMd 1YIJQ 3LYIA 4H2TA 3WQZA 5GMKj 4XIDA 3ASNH 1Q95G 2O3FA 2ZNJA 4N4IA 1VQ4A 2WWYA 3HXZA 5J8FA 1B59A 2FD5A 3C2BA 4RTWA 1WYXA 1S29A 2CS3A 2RC4A 2DA2A 4E6KG 1W4SA 4Y15A 1EX4A 1MBGA 2LVSA 3OYBA 2K40A 4I2OA 1LDJA 3CBMA 3NRVA 2M2EA 5FKMA 2VKHA 4UVCA 4A3JJ 4EPCA 1RRJA 4QKUA 4YREA 4A0ZA 2IIMA 1NHAA 4M3DA 2A5WA 2JVHA 2BZTA 2E1MB 5TJJA 5TISC 3CF5F 4RCCA 4C92F 3BTIA 3KYCB 3F72A 3MWMA 1R1VA 1MIJA 3KP3A 1FYLA 1YRNA 3H35A 3MKWB 2E70A 3VS1A 1NJ1A 5KYNA 1I4K1 1SFEA 1XTAA 2GA1A 5HLHA 2ZPIB 2M4KA 4MIMA 2KBTA 1R9TJ 1T38A 3JCMh 1ZAOA 3FM3A 2JVVA 2DL8A 5J1YA 2K3BA 1S8NA 5D5VB 2FU4A 3QP5A 5LFAA 1T39A 2DNUA 4UV8A 4YRGA 2ISYA 1T6SA 2X6XA 5JHFA 3EG9A 2HQ5A 3FMSA 3M0QA 2F5TX 3F8BA 5HK0A 4FE4A 2BVMA 4OMYA 3GLLA 2FNPA 3O8HA 1WH7A 4L9VA 1X01A 1X69A 4M74A 2E1CA 2R7XA 5FW9A 3IWFA 2DOEA 1FPQA 3F0CA 4ZC3A 5KAFC 1EF4A 4A4GA 1OX9A 3FXOA 1NE8A 1TUDA 5GAOq 4LITA 5EGOB 1FOYA 2DBKA 1KMMA 1BBYA 5EG0A 3HSFA 4KN7X 5DD4A 4DZJA 1AWCA 3TMOA 1ZBJA 2YRVA 1WHUA 1PUFA 4RTUA 1B8AA 1UUEA 4WJ3M 4JLIA 3FISA 1Y56A 2IG0A 2HKNA 2O8XA 1FT9A 1VIFA 4M4ZA 3W3CA 1ZGWA 1X75C 3M58A 5FU7C 2I4LA 1RR7A 2RD1A 4A3MJ 3CXCS 2MYSA 2DTOA 1D8KA 3E19A 5E8GA 4XU0A 5D7UA 3BFMA 5L23A 4RMOA 5HDNA 2D1HA 4J7FA 5GAMd 3AG1H 4C3HJ 2DYIA 3QO5A 2PEXA 2ELJA 2XDPA 3QJ6A 1EOVA 4P3OA 2ZAEA 2MF2A 5F5WA 2HOAA 2HZDA 3HZJA 1ZGJA 1F5TA 2P7CB 3GF5A 3TCJA 4G85A 1V3FA 1V4RA 1N5ZA 2CP0A 1O3TA 3TO6A 2QEXT 3HFZA 4Z02A 1WYDA 3CC4Q 2M7BA 3BG7A 4HW0A 1MNEA 3HBLA 1IRGA 1DP3A 2RN8A 3CCUT 2WY7Q 1RADB 1BL0A 2CP7A 1GXIE 4IUPA 2ALYB 4F93B 3HSEA 1V5FA 3F6VA 2IS4A 1WI9A 2D1VA 3J80Z 2X6OA 1YIOA 3OS2A 2CP5A 2L4MA 3E2UA 3IRRA 1H89C 4M78B 3MHXA 3MD2A 2FMLA 4JJBA 3CCSQ 1E24A 4LDXA 4EM2A 4XKVA 2JXBA 3GTQJ 5IP6A 1Y57A 2K4BA 3D7SB 1PVEA 2VGMA 1QVUA 4OMOA 1QVFS 5JI6A 1B9NA 2HL3A 3G6EA 5JVGF 1NYFA 4CICA 1RAAB 3TBIA 3C12A 3JCMV 3CCMQ 3GVAA 2OF7A 1OEBA 1KU2A 1WWXA 2VXZA 1GLNA 2K9GA 4P73A 1VOMA 2GM4A 3VS0A 4RQFA 1OQYA 5GAGJ 3EG2A 3DCFA 3I54A 1IRZA 1ZUYA 1PKTA 5BQTA 3SZPA 4OVAA 2DMQA 4PUSA 1V76A 4RTVA 4HT8A 5EEAA 2ZZFA 2XAJA 1SRMA 2KLOA 3L09A 2Z9OA 2RJFA 5LJ5h 3S8PA 2P84A 3CCMT 2E3CA 3G2BA 4RM3A 1J75A 4II1A 3KFWX 3TGNA 4G9YA 2EYXA 3IKMB 1AWWA 3LSIA 2ZT5A 1EIYB 4B47A 1JJCB 5BMZA 2UUZA 2OQRA 2VBZA 4OB1B 4RCBA 3IKVA 3JRBA 1W2BS 2GTJA 3EFSA 2XICA 1D1BA 3CO6C 2JN0A 4LFUA 1WCMJ 2ARTA 5KAIC 3TL4X 5LL6S 5AONA 4C0ZA 3M9QA 3SZGA 3CMEA 4A4KA 3LWHA 2DA7A 1A31A 3FKJA 1LEBA 3CCQT 1K9MR 1SG5A 4P74A 3EFRA 1Z7MA 3CCEI 4Y3OA 3JRDA 3PTAA 3X20B 2BOLA 3T5XA 2XAHA 4NQWA 3RUXA 2K9SA 3ROUA 2F6CA 4TV7A 4IOCF 3HDDA 3BG3A 3IH3A 3DSQA 1WJEA 4HX8A 5K5RA 4RDUA 1S3JA 3ZP5A 2DIQA 1JKPC 2QGFB 3MEUA 4JJDA 4BBSJ 3UA7A 1MMNA 1RZ4A 5LJ5g 2CWEA 4PFOA 2NUPB 4BW9A 1YX3A 2DJIA 4C92A 2VQCA 3HHHA 3EGXB 1ON2A 4F7UF 4MEXF 2GOMA 1K9MC 5D5XB 2VKVA 1YJ9I 2E64A 2TRTA 5K1YA 4OMQA 3F23A 3ZQLA 1YIJT 4FASD 3OYIA 2CYZB 3ZQIA 2HXOA 3ER0A 1AT1B 2ZFUA 5HKCA 1VQ5Q 2GFUA 4I98B 3I4NJ 4E7HA 4KULA 1OYIA 2LCSA 1A0NB 2IY5A 1UGPB 3OBYA 4MMLA 4PL6A 3E5QA 1OR7A 2COBA 4CYCA 1CF7B 1EZZB 1X2KA 1E2XA 1BB9A 1BOBA 2BY3A 1YJNI 3F70A 3Q9VA 3L00A 3O3KA 2NUTB 1O4XA 2Z33A 2SRCA 5M5XJ 3PSFA 3ULQB 1UGQB 1FNNA 2YR2A 1HSJA 3DPTA 1IHVA 2O03A 1X2NA 2L3DA 2QQAA 3EYYA 4PGHA 1ABQA 2LT1A 1SAUA 3TU4K 2KIQA 2F2XA 4M7DG 2IW5A 4X6AJ 2EYZA 1R5HA 2VJ4A 1MJBA 1K61A 5FROA 5E3OA 2KISA 4A5MA 2M7AA 6AT1B 4M3GA 4TTVA 4U7BA 3CCUI 4H2SA 3H3ZA 3QO7A 3UGTA 1AA7A 3D1NI 2ZB9A 4CCNA 2MW8A 3G4SQ 4M7DE 2E5AA 4KGVB 2MK5A 1GUUA 2DT6A 2Z2SB 2AHQA 2MAMA 2HAXA 2ED0A 1NYRA 3ASOH 1Z7NA 1VQPI 2FEIA 1J7KA 2Q2EB 3CXCA 1EV7A 4NOYA 3DBLB 2QAZA 3E6BA 2Y9ZA 1KD1C 3UKGA 1IXSB 3VS5A 2HVQA 1TSFA 5D6FA 3ZRGA 2P5LC 3ZN0A 4NHJA 3OV8A 1YITI 3HUGA 1W5SA 2DE0X 3KCCA 1L0WA 3ZBDA 4XSZF 4PJOA 4P3NA 3BR1A 3CC2A 1BIBA 3GBQA 3WVEB 1XGSA 5ICFA 2PG4A 3FIFA 3G4SA 1ZSZA 5E17F 3QWXX 4JYKA 2L0AA 2LRQA 3SFIA 4BEHB 2E6NA 4V2SA 1KGSA 2R57A 2JA7J 2DQLA 2EA4A 1ETVA 1HLVA 1X43A 2Z16A 3ZQ7A 2I0NA 1DGRM 4Q47A 2DFUA 3M0SA 4E51A 4IJAA 3QZ9B 2Y9YA 2ELHA 2BZXA 2KRFA 4JRPA 2NUZA 1CKAA 3BJUA 1JRIA 3FWEA 1PDNC 1XPXA 2AZVA 4DNCA 3JRHA 3OYJA 3LNQA 1UG1A 3H3VK 1GXPA 2QF7A 3BDUA 2CUEA 3EGDA 4J9GA 2VT2A 3H92A 2GFAA 1JJ2S 1C0AA 4RG2A 2OTJQ 3M59A 2VQGA 4C0FA 1X54A 1ASYA 1TWFJ 1YI2I 1MV0B 2VVKA 1M1EB 1LYLA 2XTIA 2K85A 2RAEA 4FE7A 3GF2A 2XROA 2L02A 3VYHB 1ETOA 2LJ0A 3PO3J 3VYGA 1JU5C 1YI2A 2VBYA 3K4BA 4J6YA 3R0AA 3AFHA 1SC7A 2PJRA 3HKSA 3I56Q 2PMZA 2DA4A 4IVNA 3DBRB 2DFHA 2FYKA 2CH4W 2MIOA 3HIFA 5HS7A 4RGRA 2LY9A 4HSRA 1WGSA 2JUCA 1NYGA 1X1DA 5GAN2 2QTXA 1N78A 1NEGA 5DCMA 3ZMDA 1VQ8A 1M8VA 3C4SA 1FLIA 2H6CA 3OW2P 4TWAA 5K5OA 4N0BA 2V8IA 4X34A 2NAZA 2JUGA 1G3SA 4QIWN 2CG4A 5EZGA 4YIRX 1DU0A 4A3DJ 4L59A 5GAEJ 3NHNA 3BTJA 4PJOG 2ZT7A 1IDYA 4XSXF 1IXCA 3WGGA 3IKTA 5DYMA 2HDCA 3S2WA 2A0FB 2CZ1B 1TT0A 4YG2F 4XEOA 2GIZA 4A3IJ 2FE3A 1VQNI 1X1CA 3CO7C 4RGXA 1H4TA 4LDYA 3CMEQ 3S32A 1K78A 3FXMA 4M71A 2ZIMA 1MHNA 3AT1B 1Y8QB 3AG4H 3X26B 2KP6A 4P73C 4XQ3A 1T56A 2KZVA 1X2MA 3S1QJ 3WU0A 2WV0A 3OYAA 3JTGA 1TTHB 4Q15A 2K4JA 1QQJA 4A3GJ 3N05A 1XS9A 4ZTJA 4W97A 1QZZA 2FOKA 4XM3A 5KK1A 4I6ZA 1M1FA 3WGHA 2V9PA 1AZEA 5D6WA 3VQYA 2V7FA 4WF2A 1TL8A 2Z3YA 4HYEA 3A2KA 2P0PA 2DM1A 2NOGA 4HNUA 1RI0A 2O6GE 5GAOp 1E1OA 4FM4B 3HUGB 2ZGWA 1I07A 3E0JB 3K6GA 3ZQHA 1V29B 1OPCA 1HCRA 3LSKA 3MKZA 2ISZA 2J6KA 2XHCA 3BE3A 3OMCA 2LD5A 1YNZA 4EJOA 2JPBA 2EWNA 3WE2A 4D7NA 1OI1A 2L2PA 2ZXFA 2E12A 1IN5A 2EV6A 2LK2A 2PNIA 1RUWA 4IHXA 3TQ7P 3I3LA 4IOAF 3E1SA 2RI2A 2VOPA 2CV0A 1S7AA 4CCLA 3GPLA 4P3PA 1FIAA 1UHWA 1BR4A 1UHMA 1IUYA 5TGTA 1IREB 1R49A 1I27A 4RG8A 5KYUB 4H2YA 5CQYA 4IHWA 5HCKA 2VN2A 2XKPA 2AK5A 2L7FP 2CUZA 4QQDA 1YJ9A 2AMCB 3UATA 1FEXA 3OS5A 3HG9A 4IRHA 1J2XA 3QQAA 2RK2A 2L7MP 1QP3A 2HFHA 2XVCA 2CRGA 4A2UA 1UE9A 1TNSA 1P7JA 3EUKL 2K9LA 4BE1A 4PJLA 2P0QA 1I3AA 2VBWA 1M1KC 2WAQA 5FLXE 2MH2A 4C2UA 2W24A 1YX5A 1QVFA 3EGUA 2MABA 4FIBA 4BY6C 5EZHA 3EPZA 4QWQA 3NENA 3KZYA 1PSEA 2DOAA 3OYHA 1JJ6C 2QENA 1QKWA 3TP3A 5LRRA 3BTCA 4ESBA 2KXDA 1U78A 4DYQA 1LQ1A 5C0MA 9ATCB 2QEXQ 2DTZA 3I71A 2CS7A 4OLFA 2EKHA 1XX5A 4FISA 4HT9A 1XB4A 5IY5H 3CD6Q 4YRCA 4LVJA 1MGQA 5L8RE 4M75F 1R1TA 1AVZC 3ME9A 2ACJA 3AL0B 2AIRB 3GP8A 3F8CA 2L54A 3WG9A 2XAQA 1IRFA 1IN7A 1TLHB 1UG0A 4C92B 2G4CA 4LVKA 1AHJB 2F5VA 2FXAA 1BKBA 2NUPA 3OQ5A 4XTXA 3CPWP 1Q86R 2P0LA 1H4SA 2Q0OA 3RZOJ 5LJ3h 1MUZA 2ZNIA 1ZN2A 3DKYA 4M77G 3WG7H 3IWZA 2FHDA 1Z6RA 2DFFA 2RHSB 3RQ4A 3PIOA 2XRLA 4F04B 1RI7A 4OIOF 2LVMA 2LMDA 1T2KA 4DBHA 4X5OA 2V4JC 5LJ3e 2LREA 1P2FA 3RCOA 4YRNA 3BZ6A 3OL3A 3H0GJ 4LG3A 5CK9A 5ILSA 5F0FA 4KMFA 1BW6A 1P6RA 4M9ZA 2JTEA 3JV3A 1IW7F 4OAZA 2MG4A 3LSMA 1WJBA 3ECOA 1MDMB 3HFNA 5F08A 4KR2A 3LA7A 4G6DA 2Y48A 3SDBA 2A08A 2E3HA 4ZYDA 4M75B 4N4HA 1Y1VJ 3JAME 1KQ1A 5ICEA 3R60A 4AFUC 1ARKA 3CQZJ 1Y0UA 1JJCA 2R7DA 3QRFF 2COMA 1WHHA 3HFOA 1B8IA 1MSEC 1EIYA 1SERA 5DS9A 1R36A 2CUBA 3BJOA 3QBYA 2VXDA 3DXJF 4UV9A 4DBRA 5LGNA 5GMKl 3CMAQ 2OTJT 4CS2A 3I59B 2OTLI 3CUQB 2KZGA 3S1MJ 3Q1JA 3CCST 1HW5A 5EG2A 2WSCE 4A6DA 4I76A 1YHQI 2WACA 4F7ZA 3O5ZA 4MDXA 3REUA 2JM9A 3VRYA 3BTLA 5GPCA 4KR3A 4E7JA 3CCMI 4RTTA 3L4GA 1K79A 2IS6A 4XLFA 3VS2A 3BDLA 2K7AA 1Q81R 2XUBA 4ZTUB 4LXCA 2LR8A 5IXFA 3I55A 8ATCB 3M56A 4EX5A 1OR7C 1QRYA 1U2WA 1JB0E 4BQQA 2JT1A 4WWCA 1U8RA 3CCUQ 1KQ9A 2DK5A 4QVZA 1U9OA 1R00A 3U21A 3L1PA 1YN8A 4FCYA 2ZR2A 1N8RU 4P5NA 1TWAJ 1U5TC 5LGUA 3NQOA 2FUG2 4CDGA 1VTNC 3C7JA 1HC8A 2PU9B 4YIFA 2HCKA 5ICGA 2B0LA 4E7SA 1Z9CA 2CFXA 3C95A 1UJ8A 4NC6A 2KEAA 4BB7A 1VQPQ 2I5UA 4M7DF 4M7AC 1K73U 3BCAA 3H9GA 4R79A 2K9NA 3K9TA 5GAHJ 2DXTA 2R58A 1VQOT 4PLIA 4LVIA 4J9FA 3QYBA 4DIQA 4GFBA 1GT0C 4Y92A 1RAEB 1MBEA 5M3MJ 4NB5A 3QDFA 1XMXA 4MZMA 2X51A 1VQPT 5GANg 1ZHFA 3H9JA 2ZXHA 4HCCA 4QLCU 1F43A 1ACIA 1M90R 4FYVB 1ZGAA 2B7EA 4CCJA 2H09A 3QOEA 2VWFA 4XK8E 3IKLA 2M0CA 1O3RA 1P4AA 5IT9K 4HCKA 1ZBXA 5I22A 2JSCA 2LDMA 4CC3A 2QTVA 2W1OA 1U1TA 1J09A 1SD5A 1IV8A 2WB1N 2KIFA 2FOWA 2XGEA 4IPAA 4BAYA 4DBFA 3BG6A 3HOZJ 1KC8R 1OULA 3TUPA 3HJEA 3QXEB 4J9EA 1GV2A 3DU5A 4BHCA 2DL3A 2E10A 3OIQA 4YFNF 3GWZA 4LIVA 4UHTA 1GCQA 3WHBA 1F1ZA 2QSFX 4PSWA 3I0TA 1MH3A 2C6YA 5L3DA 3M8JA 1SFUA 4EV0A 2DA9A 1U3EM 1DUXC 4X1VA 1HSQA 2X6WA 1A04A 1K9AA 2IRFG 5F04A 1PM3A 4I01A 3RDIA 2E35A 3FZVA 4CUGA 3EG9B 3I59A 3PL8A 4CCKA 3ZXSA 5L3EA 2QBYA 2LNVA 3MPUB 1YHQT 4FX0A 2OTLA 4TVYA 4KUMA 4IZZA 1J5WA 4NNJA 5LHHA 1I1GA 1RLPC 1T98A 1O7LA 5CKDA 3AAFA 2LNBA 1T0HA 2KXCA 4XN3A 2HU9A 3KP5A 3BZKA 4M75A 1K4US 4AU7A 2K9QA 5HOOA 2OPTA 1V1CA 4HEA2 3FJPA 1KZHA 1K7AA 4E7IA 1S72Q 1O7FA 2EGEA 4M3FA 2KE9A 4C8QG 2JWTA 5BS6A 2HQEA 1H3ZA 3NEUA 3VB2A 3V8KA 3FHNA 4S0HB 3H6ZA 2P5KA 3G71T 2A68F 3DPUA 3CCQA 3HEFA 2EFWA 3TEEA 1VQ9Q 2ESNA 2O4XB 1K6OA 3IC7A 4EJWA 3KLNA 2DMTA 3N97A 1WH5A 4WX9A 3Q3SA 2NVXJ 3NEMA 2M3AA 4BNCA 3S1NJ 2RHSA 1WI3A 4DW6A 2QQSA 2FZGB 2ZPEB 5CVJA 3CP2A 4LB6B 4HX7A 4L9TA 2WBMA 4BKXA 4XLHA 3M4YA 3KEYA 3H5NA 1AU7A 4X9DA 3REBB 4ZN1A 1OLTA 4IHTA 2YRCA 2JMAA 2HTSA 1OFCX 4N9HA 3V8JA 2RMOA 1KONA 3H0DA 3ASKA 4ENNA 1HYOA 2VXFA 5A0LA 1S72A 2LCCA 4KUIA 3FBNB 5EC7A 1YJWA 2YRDA 3NPFA 1E22A 1D1CA 1V55H 2YX4A 2DQ0A 3CJRB 5FFZA 3JB9D 2ZMEC 3DWLE 4OU0A 3SYTA 1S7OA 1BIAA 1QA6A 1ZQ3P 1H8KA 1MMSA 5CVVA 3QPSA 4BGDA 2PBIA 3URGA 2KPMA 4AVZA 3FXQA 5J47A 1NJ2A 3REXA 4CS3A 2IAIA 3ZPLA 2CYYA 2FL7A 2W48A 3H8ZA 4JJNK 4RAYA 2PMHA 2JN6A 3K70C 4A3EJ 4UY8I 5F0HA 1IO6A 1SFKA 1CKBA 1QCNA 2QA4T 1SAXA 1Z7LA 2R5MA 3S3NA 4JS4A 3V8LA 5K7FA 4LJZF 4Z2YA 1XTDA 4MZPA 3O8VA 1VQKQ 4RMFA 1ZR2A 4LD6A 2DA1A 1ZH5A 3P9KA 3S17J 1SHFA 1IGNA 2VUMJ 3GBGA 1YG2A 2XV4S 4YRIA 3HXXA 4H2XA 2KNBB 4R1HA 2RHXA 2JSPA 3LQQA 5DUKA 3U23A 4CRIA 3BQYA 1XMAA 5M3FJ 1KQSA 2CQ7A 3K10A 1H8AC 3PFSA 1VQ7I 4M3EA 3CD6T 3O2PE 4ZJZA 3MVPA 2LZ6B 2FRWA 2AKWB 4ZTFA 1KC8C 4HVWA 4A53A 3J81E 4HF0A 2QEXA 4OAYA 2DJQA 2PMEA 4A0XA 2P4RA 1K8AU 4YRPA 4CH5A 3BJAA 1IZ1A 1K4TA 1RUOA 1RETA 2H94A 1JXOA 5A2QE 3P8YA 3CC7Q 3GFMA 4UXNA 3CPFA 3RIRA 1QE0A 3B6AA 2C0TA 4OMZA 1VQKA 2KIUA 1B7YB 1AOJA 2B9SA 3M0RA 2VYTA 2OTJA 2WSFE 2DA5A 1Y39A 1TW2A 2LQKA 5K1XA 1OKRA 3ABUA 1AZGB 4JOMA 3MZYA 1X6OA 2CZ0B 2RJDA 2YUSA 4XU1A 1U9NA 4RBOA 1TWBA 2JK3A 2I4OA 2G9WA 1YITT 4K88A 2FQ4A