3V7RA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7rA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7rA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7rA02
1WLEA 4M73A 5H20A 1G5IA 2RHQA 5GAN5 2XUBA 1KU2A 2O03A 1ULYA 4WK8F 5FD5A 4YRFA 3LSTA 1G3YA 1OYIA 4A12A 4C92B 1VQZA 3E5QA 5L3BA 4JRIA 1FSEA 5DEQA 1ON1A 3ECOA 2RDPA 5HDKA 2EB7A 2JTVA 4JRKA 2DU5A 4UPAA 2ZCWA 1BIBA 1Z6TA 4FHTA 4YRKA 3QHSA 3HXYA 1X2GA 4M78A 3B73A 3COAC 2HR3A 4ZTZB 2QTXA 1YS7A 4UP8A 1W4MA 3V8KA 3PFIA 5DCFA 3WE3A 5E8GA 3DP7A 3BPVA 4I7HA 3ML6A 4YRTA 2GZWA 2OD5A 1W5SA 2EFNA 3JCMJ 4H2UA 2VOOA 4P74A 2J5PA 4KT5C 4M9SA 4L5IA 2HTSA 2JPBA 1ATIA 4G7ZF 4HWRA 4HF0A 1ZLJA 1F4KA 3J81K 3UFGA 4GCVA 1K6OA 2L4MA 4RB1A 1BM9A 3M7GA 5DY9A 3RF1A 3TKYA 2PMHA 4HV6A 1B34B 1BIAA 1U1TA 4E51A 3EFSA 2O3FA 3C18A 4H0EA 2MBFA 1FBSA 5KK1A 1JHHA 5HDGA 4TVAA 2QQ9A 2P0LA 4C8QG 1FPQA 1YW8A 1BBWA 2WTEA 1TBXA 1J2XA 2DKGA 4GGGA 4LG0B 4HWPA 3GWZA 5GAMj 3JB9D 3CO7C 3BJUA 1LDKB 1HSTA 3QO3A 1JHFA 4K88A 1QPMA 4A5MA 1B1BA 3GXOA 1FP2A 5CVVA 4YREA 1FBQA 1WYDA 2ESNA 3FXQA 1MGQA 5H6QA 4MEYF 4M7DC 2GQQA 3ABTA 4CYDA 2QHUA 3O2PE 5D5WB 4EMKB 4C8QF 3CJNA 3VQYA 2O61A 1OYYA 4N0AC 4H2SA 3CUOA 1A04A 1HXDA 4C92D 5GAMg 2EA4A 4MHGA 1B76A 1KA8A 3PCOA 2PN6A 1MD0A 1ZHFA 2LKPA 4KUMA 4ESJA 2X0LA 2CO5A 2EAYA 1I1SA 4JUVA 1J59A 5FO5A 2FNAA 4KYWA 4L0ZB 4M7AB 2PMEA 4MGRA 2IA2A 1KMNA 3WTZA 1XN7A 1BJAA 4DPGA 2M30A 2G9WA 2ZKZA 4GYGA 5LLQA 2XAGA 3HIFA 4JBAA 1KQ1A 2XHKA 4Q6GA 3RGLA 3ULQB 1BI0A 2COMA 4B09A 3HFZA 2DU7A 4P55A 1AOYA 4KIGA 3KE2A 3FM5A 5L3EA 2L02A 4OIPF 2PBIA 2ZZEA 2FMYA 3A5ZA 1JE8A 4XBFA 3FF5A 4EQQA 2AKWA 5HLGA 4BH9A 3H3ZA 1V3FA 2JT1A 4I01A 5ILUA 1O3SA 2PQ8A 1CF7B 1EIYB 1LNWA 1HKSA 3M8FA 3QSUA 5J6XA 2CWEA 3DPTA 2STTA 2LNBA 3TOAA 4F7UE 3RKXA 2IA0A 4J5YA 3AHUA 3M4PA 2XGXA 4AIHA 4NQWA 4ETSA 3HFNA 3M8EA 4FT8A 3BOQA 4M7AC 1XSDA 2RC4A 1PUEE 4UV9A 3WU0A 2DK5A 1QE0A 2E1CA 1O3RA 1R36A 3GW2A 3RUXA 4UP7A 1FLIA 1G51A 2VC1A 4BHBA 4OMZA 4EGYA 1Z91A 4ENKA 4ZIBA 3E5XA 1VTNC 2RN7A 2ZR2A 3HXVA 1PYSB 1RIQA 3JCMc 1H641 4MTEA 3HXWA 5IT3A 1MDMB 4L87A 2ZCEA 2FB7A 1OPCA 4M71A 4YRGA 3A32A 3JB9J 4KNYA 4LK1F 1ASZA 3A7RA 1Z7NA 4AIKA 2VBXA 2D2WA 3LQQA 2FF4A 5LEJA 3JCMe 5K1PA 3E6CC 2ELHA 3ZP5A 2ZIMA 4C92E 5DCMB 4G85A 2BEOA 2XVCA 3BP8A 5DYMA 3IKVA 4EJWA 1I81A 1SMTA 1SRYA 4L9NA 3TO9A 1X3UA 1FC3A 4A0ZA 2FXAA 4YRQA 4CHUA 4MQVA 3J7AO 4X9CA 5TJJA 3MCZA 4PJOB 1B7YB 1R5HA 3ERRA 3F72A 4Q15A 5GAOl 2D45A 4A0YA 2EJRA 3C7JA 4EVIA 2CG4A 3DKWA 2E41A 2M8EA 2V1UA 1Z7UA 2AMCB 4YP0A 1JBMA 1O7LA 2G7UA 5GMKm 1E17A 2WC2A 1NYRA 1RUOA 3D0SA 1MKMA 2HFHA 1ZAOA 2C8MA 2ZBKA 5FD6A 4G7HF 4IRIA 1P4AA 2KIFA 2MC3A 4BNCA 1KQ8A 5F1RA 5F5WA 2V79A 1T0FA 4NHJA 1XMAA 4YRRA 4H2XB 1U5TA 2OBPA 2BYVE 4NB5A 3MF2A 2ZJ2A 2RKHA 4TQFA 3JB9G 4JLIA 1EV7A 1X2HA 1Z6RA 2NNYA 1QZZA 4U0YA 3VODA 2QHSA 4KMFA 4YG2F 4Q4ZF 3ZQ7A 2H09A 1XGNA 2PMFA 1ZGJA 4N9IA 3TDZC 1OMIA 1ADJA 4HWSA 1YG2A 1H4TA 3ZMZA 5GMKh 1B8AA 4A53A 5JFRA 3FIFA 1EH8A 1UCRA 3KP3A 5HS7A 4M77G 4YRNA 4RB3C 2HTJA 3Q9VA 1MZBA 1FYKA 2K57A 2IY5B 2O8XA 4M7DG 2YPRA 2EV6A 3HXZA 4KR3A 5D5VB 3P7NA 2V6CA 3HHHA 1ON2A 5A2QK 1XDSA 5TRDA 2J5OA 4M9ZA 2NS0A 5ELOA 3DPLC 4HX4A 5DUIA 2BBYA 3V7RA 3FHZA 1HQCA 2ALYB 4YPFA 3K1MA 1I1GA 2D1HA 3BWGA 5DDGA 1JRIA 3I53A 2MD5A 4N0AA 2FYKA 4V2SA 4MMKA 3EYYA 1D8JA 3WG9A 5CYVA 2AS5F 3M4QA 4C8QD 4TTVA 2DJZA 1K78B 2DLLA 5LGTA 1EVLA 4AH6A 2W84A 1KYZA 1J5WA 3SWNB 5GMKl 4G7OF 3I5UA 1EOVA 3VFZA 4CS3A 3SB2A 4I0AA 3FZVA 4YRCA 3GX4X 2OQGA 3IRQA 4PGGA 1BBYA 5LJ3g 1ZARA 3JB9H 3JB9F 3F3XA 1FYLA 3K1PA 1ZRDA 4QLCU 3MZYA 1WQ2A 3ELKA 3DQVC 1BI2A 1P4WA 3P9KA 2KIMA 2QBYA 4NOYA 4P72C 3NETA 4Y17A 3ROUA 1YIOA 1WI9A 1IW7F 1IXSB 4EV0A 2I2LA 2P8TA 1FYMA 2M5WA 4S05A 2ZZGA 2W85A 3WGHA 1ZLKA 1T6SA 2D1VA 1SAXA 2DFIA 4C92F 2HQRA 3I59A 3TO6A 5DD8A 4XRFA 4LB6B 2QHTA 3IC7A 3BDUA 4HX8A 4XSXF 5D8LB 3QPHA 4QVDA 1IN4A 4EO4A 4LG0A 4EJTA 3JCMV 2IRFG 3F8BA 1IN7A 2JN0A 4A5NA 1FOKA 1JJCB 3J81Z 4O3MA 3U2RA 1HSJA 5GANe 3RI4A 1W7PA 5FFZA 4M78C 3R6SA 5D8KB 1OYWA 3QU3A 3FMSA 2Y48A 3PCOB 2DPUA 4M75G 3ISPA 5E18F 3Q9SA 4O2DA 4HWTA 1SD4A 1NJ1A 3SXYA 4CGZA 2VC8A 2DQRA 5HVQC 5HGQA 2O0YA 4C92G 2L54A 1N9WA 1YO5C 1QO0D 4BYYA 2DTIA 2F5FA 4AVPA 4YCWA 3FXRA 4L9VA 3DV8A 4ZTUB 2VE8A 2HKOA 2PG4A 5ELNA 2NAZA 4KMUX 4H2TA 3FB9A 5AIPA 4YRSA 2GXBA 3GYHX 2DBBA 3L1AA 4UNOA 1XGSA 1XD7A 3WTWC 1LOJA 5L3CA 3SHFA 3SZPA 1S7AA 1MJ9A 3K0LA 2VXFA 3QUIA 3GFJA 5BPDA 5C53B 4QWQA 4M75F 2DT5A 3V7CA 3JTGA 3LC0A 3E6BA 2MH9A 2IVMA 2DTOA 1TQMA 3LA2A 3VB2A 4WXDA 1V4RA 4PJOA 1R1TA 2MLGA 1HTTA 4LJZF 5D6EA 4NL2A 2YX4A 1DPRA 3EYIA 3GLXA 3WTVC 4L9TA 5LJ3f 1IUYA 2EL9A 3KP5A 4P75A 2JPCA 4RB0A 5LRRA 4PHCA 2KIUA 2TDXA 2K02A 4J6YA 2QQBA 2ESHA 4KFCA 1QNTA 4WXHA 4X5OA 5DUKA 2A5YB 2PLYA 5E1WA 3JCMX 3TDUC 4TWAA 2CFXA 2M87A 2ALYA 2K4JA 4RQEA 4AWXB 1X01A 1Z05A 5L3GA 4CS2A 2YHTA 3WTSC 1QBJA 4IF4A 1G4DA 1IXRC 2HQNA 4XTYA 3IKLA 4WJ4A 4PCQA 4Q5SF 1J7KA 3EDPA 3WE2A 3HUGA 2OZUA 4WJ3M 3M1EA 4EM2A 2RB6A 5LGNA 3LQRA 2A3SA 2CJAA 1E1OA 4ZYHA 1UB9A 3ECHA 4WX9A 3KFUA 5GANj 4Y91A 3IKTA 4MNUA 1F1ZA 1IRFA 1T39A 4OU0A 1OKRA 2DZCA 4EGZA 1HW1A 2J3LA 1KMMA 1YS6A 4BWAA 4JQFA 4XTUA 3SWNA 4CH4A 3WTXC 1USTA 2I4NA 2E5AA 4HF2A 5DV5A 1UHMA 4YIFA 2VBYA 5KVRA 2W57A 3MFKA 3UH0A 4CH6A 4RCCA 4YIIA 3G3ZA 1BN5A 2FRHA 1WPYA 2RHSA 3HFZB 5GAN3 2VT2A 4YYEA 4E70A 2P7CB 1YFRA 3KEOA 4TVAB 5H6RA 5HS9A 4PJOE 3C1DA 1B34A 2ZT8A 4NL3A 3L7WA 5DCMA 3RKWA 1Q1HA 2Y90A 2CGHA 4ZYDA 4F7UF 3PZCA 4Y15A 5D5UB 3HTUA 2HNIA 5GAN7 1NJ6A 1H0MA 4RGXA 4K87A 2DPDA 3IKMB 2M1BA 4TVYA 1X56A 3HTZA 1IN8A 1S6LA 1U2WA 4XTZA 2W24A 4CS4A 4CZZA 1Z9CA 4RGSA 3JTHA 4XQ3A 4TVWA 1ZRFA 4HF1A 3E6MA 4HBLA 5DD4A 3CUQC 3HRIA 2A69F 1XMKA 5L3FA 2DVEA 4HDUA 5IT9Z 3K2ZA 2ARUA 3KCCA 3BPXA 3I58A 1ZGAA 1STZA 4M75A 4LNSA 1RNLA 1LJOA 1MJAA 1YW9A 3IHUA 1WNLA 4HT8A 3ZMVA 3R0JA 1YFTA 4OLFA 4YRMA 1IL2A 3HSFA 4IHSA 2CJBA 1USYA 1QQIA 3R0AA 1FZPB 1KOGA 3I7FA 1U5TB 2KJCA 4OP0A 5ILSA 5FB2A 3F8CA 2LDUA 2Q5IA 1EFWA 2R3SA 2VODA 3JCMd 3ICAA 3E3VA 3HYIA 3VQVA 4M75C 2ZNIA 3ZPLA 5LHHA 4PJOF 1BC8C 1SMYF 1LJ9A 3JCMP 4H2YA 4OMYA 2HS5A 4GYIA 4C92C 2QYOA 4ZYEA 4I2OA 4YCUA 4N0BA 4O5VA 4CDGA 1SFEA 2DZ9A 4H2XA 4IRGA 4M72A 5J8FA 4HVCA 3F22A 3P8VA 2DQ3A 3KETA 1SD5A 1BI3A 4ENJA 4YFKF 5LHGA 3MWMA 4MTDA 1W66A 2ETHA 5LJ3j 2NNNA 4BQAA 3F8NA 3O6BB 4ENNA 2ZR3A 5AIQA 2QBYB 1XGOA 3CO6C 4I02A 5LJ5d 4RAZA 3NELA 5C52B 2LSOA 1R58A 12ASA 1FT9A 5ICEA 2CSOA 2XRNA 4UVAA 3INZA 2Q8KA 1EH7A 4M78D 1ZN2A 4K86A 1IZ1A 3REOA 3QU6A 2A6EF 1O57A 3IALA 4NCXA 2RHSB 2XASA 2A61A 3JAMZ 1F5TA 3L9FA 1HW2A 4M6YA 5BS6A 3KP6A 4M78B 2ADUA 5L3DA 3FWEA 2F2EA 3WU1B 1JXSA 2DXTA 4ASNA 2ZZFA 2Z99A 4M77E 3SWNC 5GAN2 2E1HA 2CGPA 2B0LA 3I59B 4Z2YA 1FSHA 1IRGA 4DNCA 2RM4A 2I4LA 2RV8A 1B70B 3DFGA 4LLLA 1LDJA 5GAN8 2XAFA 5D6FA 1H9TA 3E6DA 1HKTA 1E22A 1P2FA 1W7PB 4P96A 4P9UA 3WGIA 4HW0A 1Y96B 2P6TA 6PAXA 3U1DA 3NENA 2YX7A 3TUPA 4RQFA 3QO7A 3RKYA 1CF7A 2QQAA 4U0VA 2DXUA 3NRVA 1EIYA 1U1SA 5GMKe 3RACA 3A7AA 5BOXA 2PFBA 4ZZDA 4D0PA 1J75A 3OV8A 2K27A 3JCMf 4L18B 2IP2A 2R7DA 1B9MA 3QO5A 1ZG3A 5CVIA 5CVJA 2E10A 5EEGA 2E64A 4EMKC 4KIFA 5GANh 3B02A 2QLZA 3LFKA 1HBXG 1D3YA 4B8XA 3VU3C 5LRSA 2QVOA 2X4HA 3L4GB 4GXOA 1SETA 3T5XA 2E7XA 2HZTA 3F8FA 4P75C 3JCMb 3ERED 3UGTA 2W25A 4R1HA 4WF2A 3NEUA 5GAOm 4G9YA 2VONA 2EJ9A 1HK9A 1MDMA 4WXCA 4S04A 5ERIA 4PJOC 5GANg 4CH3A 3M4GA 3PQJA 3I0TA 1DPUA 3M9AA 2ZNZA 1I5LA 2RD1A 3R61A 2VE9A 4PGHA 1M8VA 4P71C 1YCYA 3QTCA 4BHCA 4WWCA 4Y13A 3JCMh 2FMLA 4EM1A 2UWMA 1SFXA 3L4GA 4P73A 2L4AA 2RNJA 1YGBA 2Q7EA 2ODRD 1NJ8A 3T0YA 3ZN1A 2DEQA 1TLHB 1K78A 2O6GE 1ZG5A 3KLNA 4WI1A 4GO1A 4XTVA 3RERA 2IPQX 1KU3A 1HW5A 2KRFA 3BJOA 1Z1DA 5E17F 4EM0B 1LVAA 2IA1A 5I21A 3VEPA 2F5CA 3CLOA 2YR2A 2ZXFA 3I71A 2AKWB 1Y0UA 3HRUA 4LFUA 2XGTA 2XAQA 5ICGA 4OIQF 3GF2A 5A2QZ 1XB4A 2ZXJA 3HRTA 1T98A 2HYFA 3PGGA 2Z9OA 3BZ6A 3HXUA 1FX7A 1NHAA 3QRFF 1L0OC 3QAHA 2VBWA 1WKMA 2Y75A 1E24A 2BV6A 4HAMA 2M45A 4WCGA 1S3JA 3T8TA 4RB2C 3RPQA 2XV4S 2BE5F 3UGQA 3WODF 3DXJF 3P8TA 4RDXA 3A7UA 3TOBA 1R1VA 4XU2A 3GFLA 1S29A 4M78E 2NRAC 2VXZA 2JSCA 4YCVA 2XIGA 3LSSA 4C8QC 1IN5A 1H4VB 4P3OA 1ZG1A 4CICA 2ZFWA 1IF1A 3HOTA 1KYWA 2C7IA 3V8JA 4P72A 3H92A 2DTRA 2EV0A 3ZMDA 2QM3A 3L09A 1RI7A 4K2EA 4XLPF 2GAUA 3SFZA 3AAFA 2R7FA 4LMYA 3SQNA 3IWZA 2Z33A 1ZRCA 3VQWA 4EX5A 3JAMK 4Q47A 5GAMd 5HS8A 5LJ5j 1GXQA 4IPAA 3F8MA 4IJAA 1EH6A 2UXXA 4BXUA 3I4PA 2LF8A 3T1BA 4XU0A 5GAMe 5LJ3d 3S2WA 4UUVA 2CJ9A 3WTYC 3GZ6A 5GAN4 2AMCA 5E1XA 3LSQA 1YTYA 3JSOA 3ABUA 4J15A 1FYFA 1I8FA 4HT9A 1LEBA 5LJ5g 4M7DF 2HWVA 3HRKA 4M77C 4TQDA 1TW3A 5JI6A 1K7AA 2RA2A 3W3SA 1WRJA 2BGCA 1J9IA 1DDNA 1FP1D 1KU9A 4HWOA 1WQWA 4HDVA 2DK8A 3RTRA 3CUQB 1LB2A 1HKQA 3V4GA 1SD6A 4IHTA 1N9SA 3GFMA 1W5TA 2OA4A 2AXLA 3TGNA 4KDPA 3QP6A 3U9GA 4M7DD 2MH2A 2IW5A 4YRIA 3K9TA 4M77A 4HA8A 3LWFA 2XROA 2CYYA 5K5OA 3WGGA 1NJ5A 1MJBA 3BDDA 2EFWA 1J5YA 2FE3A 4QVCA 4LK0F 3E9HA 4CO8A 3BFMA 2PMUA 1FNNA 3ZMTA 5E3IA 3F6VA 4EJOA 3IL2A 4MEXF 1S7OA 3QO8A 4X9DA 2DW4A 3A5YA 3I64A 3NEMA 2OAZA 4RAYA 3A74A 2P4WA 4EMSA 1DP7P 1G3WA 1X55A 3HHGA 3CTAA 1B9NA 4ZZLA 1WU7A 1G6NA 4ZH4F 2H94A 4L9JA 3RL6A 3VBBA 1KQ9A 3GZ5A 4OIRF 1G5HA 1U8RA 3JCMg 2K86A 1EQRA 2ARSA 3BROA 4A54A 1YLFA 3Q5FA 3HXXA 3CDHA 4HQMA 2A68F 1F9NA 3QOPA 3TQNA 4YROA 5K1XA 4U7BA 1U5TC 3LAJA 3V7SA 3A31A 1N9RA 4PG3A 4C8QA 2YLBA 3FJPA 2XKPA 1EVKA 1YFHA 2EA2A 4A6EA 5E8IA 4RGUA 5J8CA 1B4AA 2GXGA 1RZ4A 2H27A 5GMKi 2G4CA 3W6KB 2RQPA 3F21A 1SFUA 2EFQA 3MAJA 5LBQA 5K1YA 1X54A 1MGTA 2DDZA 4KQEA 3ZMUA 1P4XA 2VOPA 3WTTC 5HLIA 1J0RA 1ASYA 3MQ0A 1LNXA 1U3EM 4M7AD 4RMFA 4XSZF 1I5ZA 4LLGF 5LJ3e 2MLKA 5EEHA 4XU3A 5GAN6 2J3MA 2HOEA 2ZNYA 1FY7A 1ZH5A 4G8XA 3QNEA 3E5UA 1YW7A 4BAYA 3I54A 3EUHA 1E1TA 1JGSA 4MMLA 2FBKA 2KKOA 3LA3A 2P5VA 3E9IA 1M5Q1 5KNNA 3PQKA 4A0XA 4M75D 4M7DB 3G1ZA 1U78A 2RHQB 2OU2A 1PYSA 1ONVA 4OINF 1REPC 5LJ3h 1GGMA 1HC7A 2QENA 2FOKA 1XGMA 3FXUA 3GEZA 1GHCA 2F5EA 1YB3A 4P73C 5GANf 4HX7A 1TQIA 2IT0A 1TNTA 2UXNA 3TEGA 4JK1X 5D4RA 3IWFA 1S8NA 5GAOp 4M7AA 3L00A 4ESBA 2HKXA 4OOIA 2JZYA 3RJPA 5E20A 1B59A 3SZTA 2VBZA 1TH7A 1FWZA 2YLCA 2E7WA 5K5RA 4M77D 1I27A 4LLNA 3R07A 3LA7A 5CLSA 5D4SA 5BQTA 1SESA 2K7LA 3FMRA 1YYVA 4XTXA 4KICA 1B7YA 2GIVA 5FGMA 1SD7A 3KP4A 1UHWA 4KN4X 2DQLA 2V1DA 4A2UA 4P5OA 2ARTA 4M74A 1LDDA 3LAPA 4EMKA 3FM3A 4CH5A 4M7AE 1PP7U 4M77F 1L3LA 3HSBA 5HDNA 5JHUA 1LYLA 2DU9A 2F5DA 1R00A 2STWA 2DAOA 4F7ZA 4I98B 2Q7HA 3KEQA 3TEHA 1PP8F 4HV5A 4N9HA 3RDIA 3BW1A 2RVCA 3V8LA 2Q2EA 4R79A 3RIRA 2P5IA 1D3BB 3HY0A 3F6OA 5CVRA 1R7JA 5JR3A 4M7AG 1KQ2A 2XAHA 3QP5A 3GO5A 4U88A 4IVNA 4M75E 1P92A 4BW9A 3VQXA 5K5QA 2CIMA 2ISYA 2PI0A 3K69A 4EJVA 1WSUA 2ZMEB 3MF1A 5ILVA 4I09A 2ZT7A 4HZFA 1H4QA 2XKOA 5CVUA 4DQ2A 3R4KA 3D5LA 2YU3A 3REXA 1DUXC 3J80K 4I0BA 5GANd 5FFXA 1QZYA 4BHPA 2EFPA 4IRHA 3JW4A 4KR2A 5BMZA 2GA1A 1NYQA 2FSWA 1IAWA 5LEKA 3IRRA 2E65A 2H6BA 1B6AA 1XSXA 4M7AF 2Z5UA 3ZN0A 1D8KA 2A07F 2XTIA 2FA5A 4UV8A 1KQ0A 4UP9A 2DI3A 3H3UA 2IY5A 3WTUC 3MEYA 3K1NA 1NNHA 1K79A 2P7VB 2Q7GA 1TTYA 5D5XB 4EJUA 3HSRA 2Z3YA 5AONA 4ON0A 5LGUA 5HOOA 4P3NA 2EFOA 2YSRA 4H02A 1IXCA 1Y96A 4FX4A 4UHTA 4F7UG 2FNPA 1BOAA 2ZGWA 2VN2A 1ZYRF 1TW2A 4C8QB 4M77B 1B70A 4YFNF 5IT9K 4Q48A 5FLXZ 4YRLA 4P71A 2P5KA 2H6CA 2QWWA 4G6QA 1AWCA 2A6HF 1ADYA 2WV0A 3RESA 1R1UA 1QGPA 2FU4A 3RPUA 4R8HA 2ZNJA 3JCMQ 3FX3A 3P8YA 1G3SA 3DF8A 3E97A 4HLXA 4PDKA 2ZMEA 5CJ9A 5ED4A 3OOPA 3JCMW 3GFIA 1T2KA 4IXAA 2L3DA 1G3TA 4LD5A 3R60A 1WWXA 1ODDA 3TO7A 1XDUA 1U6GA 3RYPA 4P74C 3BJ6A 2Q5HA 4PJOD 3KP2A 2G7HA 4M78G 4UXNA 4YRJA 4HYEA 1TQPA 2V1XA 1USYC 5FLXK 2CW0F 2FQ3A 2GWRA 2QHVA 2P5LC 2EJFA 4YDQA 3VOEA 4RGRA 4XEMA 5GAOn 4H2WA 2VXEA 3IG2A 4XLNF 2DO7A 2RGVA 1R22A 4TV7A 2ODRC 5C51B 1BI1A 5LJ5e 2DQ0A 3W6JB 2ZTGA 4ENMA 2GA2A 4U7DA 4U0WA 5LJ5f 2E1NA 1C0WA 3GVAA 1QF6A 2E3CA 3P9IA 4PJOG 1USSA 2IJLA 2VC0A 1I4K1 2L01A 1NJ2A 1W7PD 4M78F 5GAOq 2ACJA 4F7UB 5CAIA 3OD1A 3HFVA 1OR7A 1R5GA 2FBHA 4OIOF 1BC7C 4M6XA 1RUNA 2EJGA 1LEAA 1JJCA 3DSQA 3F23A 5GAOr 4FX0A 5LJ5h 4AIJA 2HEOA 1L0WA 1UFMA 4O6JA 1YFSA 2FEZA 3RYRA 4F7UA 3L2ZA 1RIOH 4G84A 4YRPA 1BBUA 4L5JA 2K4BA 3J80Z 1E2XA 3KZYA 4M9XA 2QUFA 3NQOA 2NYXA 2QZ8A 4AD9A 5HLHA 3HY1A 1H9GA 1I6XA 2ZO4A 2CQKA 4RS8A 2MA3A 2HDCA 4M7DA 2PJPA 1R23A 4P3PA 4ZYGA 1YQAA 4HQEA 3CMQA 3HOSA 2EK5A 4ESFA 5JVTA 2DTHA 4MQ9F 1GVJA 5ICCA 1KU7A 2WWYA 3EFRA 3P9CA 2FBIA 3WQZA 2ZT5A 2HGCA 3HSEA 5BPIA 4M7DE 5GAMf 3EETA 3ZMSA 5GMKj 3JB9I 3EQLF 1LQ1A 3HFOA 4PZJA 4UVBA 4LB5A 1CGPA 5F6FA 1O3QA 2JRTA 1XSVA 3HTSB 2OZ6A 3JSPA 4J6WA 1PDNC 5ICFA 4KA4A 4UVCA 1IN6A 3DEUA 3C3WA 2PEXA 1KGSA 2EV5A 4EMGA 3GIBA 2UZKA 2HYGD 4KN7X 1FBUA 1WQ7A 3MEXA 4C92A 4HOBA 2LF7A 2Y0MA 5GAMh 1XCBA 3KZZA 3BJAA 3GUDA 1O3TA 1ZREA 4LGWA 2C6YA 4C8QE 2P6SA 1GXPA 2EWNA 3N4MA 3HRMA 2XAJA 4M75B 3T8RA 3L2CA 4J6XA 4G6DA 4A6DA 1D3BA 4P9FA 11ASA 1Z7MA 2ZINA 1C0AA 1O7FA 3BY6A 3G73A 1TNSA 3KFWX 3TEHB 2VT3A 2ISZA 1H4SA 4CXFA 4XEOA 1P6RA 5F64A 4YFXF 2V9VA 4XTWA 3MZHA 3BY7A 3O3KA 4RCBA 4PNOA 1T38A 4HLYA 2ZIOA 3FMQA 2I4OA 5LHIA 3HRSA 2KJBA 3QPTA 2I4MA 3REUA 3KP7A 3N97A 3CUQA 1SERA 5E1ZB 4XU1A 4EMHA 4H2VA 4G94A 3KLOA 1XCVA 2OQRA 2ZT6A 4L0YB 1D5VA 2Q0OA 4KIBA
chains in the Genus database with same CATH superfamily
1WLEA 3H0DA 4FE4A 2NLUA 4M73A 5H20A 1G5IA 2WY8Q 3KEYA 1JU5C 2MWOA 5IXBA 2RHQA 1VNDA 1YRNB 1YJNI 1YHQT 4B9XA 1PJRA 5GAN5 2XUBA 1KU2A 2LD5A 2O03A 1ULYA 3FK6A 5FD5A 4WK8F 2E12A 4LUDA 1V29B 3AG2H 3LSTA 1JKRC 4YRFA 1LKXA 3MKYB 1G3YA 1JI8A 1OYIA 4A12A 4C92B 1A31A 1VQZA 2VXDA 3E5QA 5L3BA 4JRIA 4A3FJ 2BVMA 1X2MA 2QK0A 3CMAI 1FSEA 3VUBA 2DA4A 2C0IA 5DEQA 3HP9A 1ON1A 3ECOA 1OX9A 2WSCE 2RDPA 5HDKA 1ZA1B 2CT3A 3LYIA 3OS5A 2EB7A 2JTVA 4JRKA 3RNJA 1K8AR 1UG2A 2DU5A 2FD5A 4OAYA 4UPAA 1GBQA 4Z89A 3BQZA 1N75A 3H1CA 5KYYA 3CPWA 2EQKA 1X2NA 2CV1A 2RHXA 2ZCWA 1BIBA 1Z6TA 4FHTA 5F0HA 2AIRB 2RK1A 3QHSA 4OMMA 3HXYA 4YRKA 1X2GA 5I22A 4M78A 1IG7A 3OW2S 3UDCA 4LVKA 2CP2A 3B73A 3COAC 5CO7A 2HR3A 1Q81R 4ZTZB 2QTXA 4NDLA 1YS7A 2EZKA 4UP8A 2A3LA 2DPPB 5KYWB 1GV5A 1W4MA 2LKXA 2JMAA 3V8KA 3GP8A 1Z77A 3PFIA 4CYCB 5DCFA 1HD3A 3WE3A 1ZSZC 4XTYA 4D6WA 3P8HA 5E8GA 2AKKA 5IN1A 3DP7A 1CKBA 5CK9A 3BPVA 1V5FA 4I7HA 5BNGA 1J09A 3ML6A 1UJ0A 4YRTA 2GZWA 1BJZA 2OD5A 5I2MA 1W5SA 3OYLA 2HCKA 2QQRA 4JLGA 2EFNA 3JCMJ 1GL5A 4H2UA 2VOOA 2L3QA 2BVLA 4P74A 2EQUA 5B3SH 4IQ4A 3E9IA 2RHYA 2J5PA 3KYDB 4KT5C 3PMIA 2QEXA 4M9SA 4L5IA 2HTSA 2JPBA 4UUTA 4ZDOA 2FRYA 1ATIA 4GLKA 3K4CA 1UE9A 2CSIA 4G7ZF 4HWRA 2XDVA 3EGXA 3I5SA 4FTHA 2LLKA 4HF0A 2O2OA 2CUDA 4V2FA 1ZLJA 4HEA2 2ZMEC 1F4KA 3CMEQ 3O8GA 3VDXA 2I8DA 2P0WA 2ME0A 3J81K 1RADB 4NBQA 2RNGA 1TU0B 1ZBXA 3UFGA 4XKWA 1VQOI 4KUDK 2E70A 1BKBA 2HDAA 1WJ5A 2M34A 4GCVA 1K6OA 3LGLA 3CCMT 2L4MA 4ATOA 4RB1A 1X1CA 5F1JA 1BM9A 2ME6A 3M7GA 2C0OA 2KY9A 5DY9A 4DEYA 4LOCA 3RF1A 3TKYA 2C06A 2PMHA 4HV6A 4MFDA 1B34B 1BIAA 1PM3A 4B3XA 1ZX6A 2D0QB 3CCEA 1WJSA 2EGAA 1U1TA 4E51A 2Y0SN 3EFSA 2O3FA 3C18A 3OMYA 3QYBA 1WI3A 4H0EA 2MBFA 1FBSA 5KK1A 1EF4A 1JHHA 2KZVA 5HDGA 4TVAA 2QQ9A 2P0LA 4C8QG 2CZ1B 3GCMA 4QSHA 1FPQA 4XLCA 1HCRA 3HOYJ 2PQWA 4ZJZA 2O9VA 1YW8A 3PSIA 4RAGA 2L3PA 4VUBA 4L5EA 2XK0A 1BBWA 2X6YA 2WTEA 2JA6J 1DJ7B 1TBXA 2DBMA 2M51A 1EX4A 3CC7A 1J2XA 1G2BA 3MHXA 5C6SA 3R6OA 4ZDLA 5EF6A 4GGGA 4IOAF 4E6KG 2D1XA 2DKGA 4LG0B 2AK5A 4OB2B 4HWPA 2K9MA 3GWZA 4MO7A 5GAMj 3JB9D 2KYMA 3CO7C 3BJUA 1LDKB 3K4MA 2BW3A 1I6HJ 4HXJA 1HSTA 1TWCJ 3QO3A 1MNMC 5GPAA 1JHFA 2QDYB 1QPMA 4K88A 1I07A 4AU7A 2VL8A 3K4LA 1AKHB 3CXCS 2XICA 4A5MA 1B1BA 3CJRB 2KEAA 1HSQA 2LOOA 2H8HA 3GXOA 1FP2A 2VQGA 2PZ1A 1BYMA 5CVVA 3PIOF 2XRLA 4YREA 1FBQA 4GBQA 1WYDA 2ESNA 3PNTA 3FXQA 1MGQA 4ORZA 5H6QA 4MEYF 4IURA 3G4SQ 2GQQA 4M7DC 2X6WA 3ABTA 3OYAA 4CYDA 1ETVA 2QHUA 2XAUA 3O2PE 3JR9A 5D5WB 3CCVI 4EMKB 4C8QF 3DKXA 1PWTA 2VJIA 2R5ZB 3G7ZA 4D7NA 1BW6A 2XF6A 3CJNA 4BY6C 1VQ7A 3VQYA 2O61A 3CBPA 2WA0A 1VYVA 4Y3OA 2J6KA 2CW7A 1OYYA 2AO9A 3DU6A 4N0AC 4H2SA 2K9SA 1AHDP 4D5CA 2LY1A 3W6VA 3KZIC 3CUOA 1A04A 4C5EA 1HXDA 1ZKGA 3AFHA 3G6EA 3OIQA 5K7FA 1LFUP 1GCQC 2J6FA 1HA8A 1YJNQ 3X28B 4C92D 4J7FA 5GAMg 4OMNA 2EA4A 2COYA 4MHGA 2NVXJ 1B76A 4RTYA 4AMCA 4C0ZA 5GP9A 1VQ7T 2KLOA 4YRVA 1KA8A 3CMYA 1YI2I 1X43A 1K73C 2QASA 4E2FB 1LVKA 3PCOA 2PN6A 1MD0A 3AG4H 3ZQCA 4V19K 2GQVA 2UV1A 1ZHFA 1AT1B 2I0NA 2LKPA 4C2TA 4KUMA 2DBKA 1X1PA 4ESJA 2X0LA 1UGPB 2CO5A 3CC2I 2ZXWH 2EAYA 3UF4A 2DLPA 3JSCA 1I1SA 2ECCA 4XIDA 3S2DJ 4JUVA 4R55A 3CMAQ 2CH0A 4ZGJB 2YUQA 2CUFA 1OR7C 4HCBA 1A0NB 5C0MA 1J59A 2FOWA 5F0CA 1X3WB 2FNAA 5FO5A 2QSFX 2DOEA 4KYWA 4L0ZB 4M7AB 3DLLA 2PMEA 3CCRI 4MGRA 3VYUB 2A5WA 2IA2A 2OCEA 2QGUA 3P5JA 4BQQA 1QP3A 4XR6A 3WTZA 2X4XA 1XN7A 4ITVA 1KMNA 2LBFB 1YJNA 4LN2A 1ABQA 2KR3A 1BJAA 5CQYA 4DPGA 3S1MJ 2M30A 2G9WA 2ZKZA 4GYGA 4QW2A 1ACMB 5LLQA 2XAGA 3CESA 3HIFA 4AUXA 1UGVA 4JBAA 3OMGA 2DFEA 3M0RA 3AG1H 2XHKA 1KQ1A 2R92J 1SF9A 4Q6GA 1VQMI 3M9QA 3BR1A 1APLC 2CKKA 2FZKB 3C0CA 3ULRB 2HAXA 3RGLA 3ULQB 1BI0A 4ZGEB 2COMA 1T3SA 4B09A 2RAEA 3HOXJ 1RR7A 2IS1A 2KVQG 5FU6C 1B7YA 1KONA 2XSDC 4C2MJ 3G1JA 3REAB 3HFZA 1I1JA 5FWBA 4AG2C 3CPWP 2OPTA 2DU7A 4P55A 1AOYA 2GIZA 3KE2A 3FM5A 4KIGA 5L3EA 2L02A 4OIPF 2ZPFB 2QEXT 2PBIA 2ARTA 2ZZEA 2FMYA 3A4CA 3RQIA 3M0SA 1I39A 4IZZA 4BY1J 1M1KC 2LTOA 3A5ZA 4XBFA 4EQQA 3FF5A 1JE8A 3I55A 5HLGA 2AKWA 4BH9A 3H3ZA 1V3FA 5IAYA 2JT1A 4I01A 4QQDA 5ILUA 1O3SA 2PQ8A 3HKZN 2GBYA 2XB0X 1LNWA 1CF7B 2JTMA 1HKSA 2JK3A 2GQIA 4DBFA 1EIYB 3M8FA 2OF7A 2R7QA 4A3MJ 5J6XA 1KSWA 3QSUA 2Z2SB 3GPLA 2CWEA 3QOEA 2PTKA 3M5AA 3DPTA 2STTA 2LNBA 1SKUB 3KYCB 3BCBA 4FCYA 2ZPHB 3CP8A 3TOAA 2VPLA 3GBQA 4F7UE 1K1ZA 3RKXA 2YT6A 2IA0A 2MPXC 4J5YA 1EKEA 1PUFB 4LXCA 3AHUA 2G6FX 2RH2A 2XPUA 2XGXA 1GLNA 1K76A 1RAIB 4E7SA 3M4PA 1ERDA 4AIHA 4NQWA 1G83A 4ETSA 2IGNA 3E19A 3CCRA 3HFNA 1AEYA 3M8EA 4FT8A 3CCRQ 2JRMA 2LTPA 3BOQA 4M7AC 1XSDA 2RC4A 2ZC2A 1PUEE 4UV9A 1RPWA 3WU0A 3R6NA 4J9CA 4KH0B 2DK5A 2HXIA 8AT1B 1QE0A 4IOCF 2E1CA 2JVVA 1O3RA 1R36A 3GW2A 2R7WA 3RUXA 2VQLA 4D1QA 4UP7A 2DDBA 1FLIA 1WIEA 3MMYB 1G51A 2VC1A 3LFUA 4OMZA 4BHBA 3OS0A 4EGYA 1Z91A 1VQ6T 5EG0A 4ENKA 2MIOA 3PVQA 4ZIBA 4DIQA 5KHDA 3E5XA 2DF6A 1VTNC 3CCEQ 2RN7A 4IIOA 5CKEA 2ZR2A 2P81A 2Y0SA 1ETXA 3OS2A 3CCJA 4Z8AA 3I3LA 2EGCA 1T8IA 1HLVA 2BIVA 3HXVA 1RAHB 1PYSB 2V9KA 3GTKJ 1RIQA 1NK2P 1H641 3JCMc 3PFYA 4MTEA 1T95A 1F43A 3HXWA 3O8VA 3HL2A 5IT3A 1MDMB 2IS4A 4L87A 2V4JC 1R0BG 1S1NA 2ZCEA 3OIOA 2FB7A 5HNFA 1OPCA 4M71A 2LP5A 4YRGA 4CCMA 3A32A 3BG5A 1CSKA 5DS9A 3JB9J 3OYBA 5HY6A 4KNYA 3CJTB 4LK1F 1ASZA 3A7RA 4IHYA 1WFWA 1Z7NA 4AIKA 2VBXA 2D2WA 3LQQA 3GTJJ 2FF4A 1W36D 1RLQC 5LEJA 3CC4A 4KBMB 1WDXA 2NVUB 3E6CC 4DOWA 3JCMe 5K1PA 2ELHA 2Q2EB 3ZP5A 2ZIMA 4C92E 5DCMB 3WHBA 1BB9A 4G85A 5C3EJ 1QP2A 2CZ0B 3EH2A 2BEOA 2J6OA 3ZEHA 2XVCA 3BP8A 5DYMA 2FVUA 2GLOA 4WTOB 1QVTA 2DL5A 3IKVA 2NVYJ 4EJWA 5CKTA 1I81A 3OB9A 1PD1A 1SMTA 3OL4A 4LNPA 4J01A 1SRYA 4L9NA 3ZQLA 2F4IA 3TO9A 1X3UA 1FC3A 4A0ZA 3G4SA 2FXAA 3QBYA 4CHUA 1E6HA 4MQVA 2HVQA 2JA7J 3J7AO 4DZJA 3CQZJ 1WJQA 5TJJA 2A28A 1UZCA 1ETKA 2MG4A 3BTIA 3MCZA 4HSRA 1B72B 3OMCA 1R5HA 4B9WA 3FISA 4PJOB 1VFCA 1B7YB 2KRHA 3F72A 1G5VA 3ERRA 4Q15A 5GAOl 3C2BA 4J9FA 4M3DA 5M5XJ 2D45A 3S17J 1IHVA 4A0YA 3BC8A 1JT0A 3WU2C 1Y71A 2HKNA 1HDPA 2ZPBB 3MEUA 3TREA 3L2RA 2CP5A 2EJRA 3C7JA 4EVIA 1M3BA 2DL7A 2CG4A 3DKWA 3H3VK 1KQSA 2E41A 2M8EA 1Z7UA 2V1UA 1WHLA 1JJ2P 1JBMA 3X26B 2AMCB 1O7LA 4YP0A 2G7UA 3CCJI 2IGMA 4A3BJ 1VIFA 2CQNA 4QPQA 2FPDA 5GMKm 1HYOA 3A02A 3IAM2 1E17A 5IP7J 1LPLA 2WC2A 1U06A 2ATCB 2WACA 1M1KU 1NYRA 1RUOA 3D0SA 3L1PA 1HJDA 1MKMA 3ERMA 3IUOA 3H9NA 2V1NA 4CYCA 5KYWA 2DFFA 1WJAA 1ZAOA 2HFHA 1T3LA 2C8MA 1YITQ 2DL3A 2ZBKA 4J83A 5FD6A 4G7HF 3OSFA 2R58A 2L7MP 4IRIA 1P4AA 2KIFA 2MC3A 3I4NJ 2X3XD 2Y4YA 4BNCA 1KQ8A 5F1RA 5F5WA 4H4KC 4DOVA 2R7TA 2V79A 1PKSA 4PLIA 5FU7B 1QVGP 4RLFA 1QKWA 1M2OA 1SC7A 1T0FA 2O9SA 1KD1R 5J1YA 4XKCA 5EGOA 4NHJA 1XMAA 2VLAA 4DZPA 2CZ7B 1RACB 2KI7A 3ZRGA 1YI2T 1U5TA 1RI9A 4H2XB 2OBPA 2BYVE 4NB5A 9ANTA 2LVMA 3OQ5A 2DDAA 1WZ2A 3TQ7P 3MF2A 4LIVA 1W70A 1MBKA 2J06A 3DU5A 3UWNA 3J7AF 2EZHA 2ZJ2A 2XDPA 2AHJB 3A8LB 3M0PA 4E7ZA 2RKHA 5IPAA 3PIOA 4TQFA 3JB9G 2ECBA 4EATA 3S1NJ 4D8DA 3DLLF 1D0YA 4JLIA 2ED1A 1W2BS 3S32A 1Y6IA 1UELB 1M4ZA 1NYFA 3CCRT 2ZPIB 3I55T 1EV7A 1X2HA 3ASOH 1Z6RA 2PMZA 5EGOB 2NNYA 1QZZA 4U0YA 1MIJA 2ZB9A 3VODA 2QHSA 3FXKA 3X2QH 4KMFA 2K6DA 2P4TA 4YG2F 4ZTJA 1UMQA 4Q4ZF 3U1KA 3ZQ7A 1ZUKA 2H09A 1XGNA 2LFBA 1ETYA 2CQXA 5J26A 1ZGJA 1VQ6Q 2PMFA 2JVGA 4N9IA 3TDZC 1TL8A 1OMIA 2CJJA 1ADJA 4HWSA 2E71A 4BI4A 1YG2A 1H4TA 2EH3A 2VQCA 3ZMZA 5GMKh 1B8AA 1WYXA 2R0QC 3AKZA 4MIMA 5JFRA 2D0NA 4A53A 4C3IJ 3FIFA 1EH8A 1UCRA 3CCQT 3KP3A 4JS4A 5HS7A 3RBBB 2DCEA 2E5QA 4M77G 1TG0A 4A4HA 1VQ8T 4YRNA 2NVTJ 4RB3C 2HTJA 3PE0A 2HQXA 3Q9VA 1MZBA 1W0UA 1FYKA 3OR1C 2K57A 2YU9J 1OZ3A 2IY5B 2O8XA 2NXNB 4M7DG 2YPRA 2EV6A 3UNGC 1M1EB 3ME9A 2K9LA 1KQSP 3RCOA 1HOMA 1V1CA 1WHHA 3GBGA 1T0FC 3CCMQ 3HG9A 4X0GA 2YUNA 4RTVA 3O8HA 5D5VB 3HXZA 4KR3A 1D1BA 1QCNA 4N4GA 1WXBA 3P7NA 2KXDA 2V6CA 3AL0C 2VKEA 1ON2A 2BHZA 3HHHA 5A2QK 1BA5A 3D5SC 2KRMA 4ELZC 3SFIA 1XDSA 1QVPA 1SAUA 5TRDA 3TP3A 3LH0A 3SDGA 4UY8I 2J5OA 2K3BA 2Q1ZB 4CUGA 1M9SA 3DTKA 2D9TA 4N4IA 3KFVA 1VQNT 4M9ZA 1VQ7I 1JJ2S 1POGA 4HVVA 3PMTA 2NS0A 1LPQA 5KYUA 5ELOA 2VYTA 3S6WA 2VASA 3H0HA 2CT4A 3DPLC 4HX4A 2J05A 1AA7A 2R57A 1VQ4A 1D1CA 5DUIA 4XRSA 2BBYA 4XAXB 1GCQA 1YI2Q 3V7RA 3FHZA 2MABA 4BI3A 1HQCA 1NK3P 3DCFA 5IYCJ 2Y4XA 2ALYB 4YPFA 3K1MA 1I1GA 2D1HA 3BWGA 5DDGA 1JRIA 3I53A 2OC6A 2MD5A 4N0AA 2FYKA 1M90R 4EDUA 3BE3A 1SFOJ 3CMET 4V2SA 2L9VA 4MMKA 1H3HA 3EYYA 4CRIA 1D8JA 3WG9A 5CYVA 3FHNA 2AS5F 1Q95G 2LMDA 3FBNB 3SJMA 2DJQA 2L5QA 4C8QD 3M4QA 1IV8A 4MLOA 4XOPA 2VUMJ 4TTVA 1MBGA 1K78B 2DLLA 5LGTA 2DJZA 2LCCA 3RMSA 1EVLA 3QWXX 4AH6A 5IY5H 2W84A 1DQUA 2EW3A 1KYZA 5KE2A 2LDMA 2VWFA 2LC2A 2M8GX 2ZCFB 5TISC 1YWPA 2JW4A 4LE9A 1J5WA 4LDYA 1MBEA 1QVFP 3ZXSA 2E3IA 1XOVA 1LFPA 2KFDA 3SWNB 5GMKl 4G7OF 3I5UA 1EOVA 3VFZA 4CS3A 4AM3A 2DE0X 2R5MA 5CKBA 3SB2A 3LWIA 4LD9K 2O9LA 2PUOB 3W2AA 4I0AA 2DYSH 2XGDA 1Y0MA 5FLXE 3FZVA 1Y8QB 4YRCA 3SD4A 1IO2A 2TCTA 3DBRB 2OQGA 3GX4X 3IRQA 4PGGA 2HL3A 1Y7XA 2BOLA 4XLAA 2BZTA 1SPKA 1BBYA 2MD0A 4XRMA 5LJ3g 2JVHA 1ZARA 1FTTA 2GCXA 4ABZA 1QQJA 3JB9H 4IX7A 1YE9A 3Q1JA 3M0UA 4KT0E 2RQUA 3K10A 3QG1A 3JB9F 4C0DB 4FETA 2L9NA 4E7IA 1JUPA 5EJCA 2CH4W 3T9NA 3F3XA 1FYLA 3VUZA 3JRZA 2MSYA 3ZQFA 2BE9B 3CCQA 2GXAA 3K1PA 3FJ5A 1ZRDA 4QLCU 3MZYA 1OOTA 1WQ2A 2COBA 2HBWA 1ETWA 1FXXA 3ELKA 3DQVC 4BE0A 2X85A 1BI2A 1I3AA 1A5JA 3KBGA 1P4WA 3P9KA 5CQXA 3NFCA 4IUTA 2EILH 1VQ5I 3TCJA 2KIMA 2QBYA 1M3AA 4KT6A 1WHMA 4NOYA 4OB0B 4OGEA 4P72C 4DBRA 4Y17A 5E3LA 3ROUA 1TTHB 3QYGB 3NETA 1YIOA 3Q0WA 1VQPQ 1WI9A 4B4CA 5IOZA 3UATA 3X24B 2IBDA 3RR6A 2ELKA 1IW7F 1IXSB 2RF0A 3ZL7C 3G71Q 3PM1A 4EV0A 2I2LA 2HOAA 2P8TA 1FYMA 4A93J 2DXIA 2JZ2A 2M0OA 1M3CA 2DMUA 2M5WA 4S05A 3M53A 2ZZGA 3TSWA 3MN2A 2W85A 3WGHA 1ZLKA 2DN0A 4J19A 1T6SA 2D1VA 5KCOA 2L3SA 2RI5A 1OQKA 5M9OA 3ZBDA 1SAXA 2DFIA 3DEWA 4PFOA 2HQRA 3I59A 3TO6A 4C92F 5DD8A 4XRFA 4LB6B 6AT1B 1V5EA 5CR2A 1YHQA 2OV7A 3IC7A 2QHTA 2V26A 3BDUA 4HX8A 1PSEA 4XSXF 4N4HA 5D8LB 3L2WA 2FO0A 3QPHA 2LX9A 4QVDA 4A3EJ 1IN4A 2HI3A 4EO4A 4LG0A 4EJTA 1H8KA 2IRFG 1N25A 3JCMV 2FX0A 2CP3A 4FW1A 1EA3A 3F8BA 3VRZA 5IYBJ 1IN7A 2JN0A 1K9AA 4A5NA 4I76A 1FOKA 1JJCB 3J81Z 4O3MA 3CD6I 3U2RA 1N78A 1WHUA 1HSJA 5GANe 3RI4A 1MMGA 1W7PA 4IUPA 1AWOA 4XK4A 5FFZA 3EG1A 4M78C 3IH3A 3PSFA 1QPIA 3M55A 3VYHB 3CC7Q 1FMVA 3R6SA 2GTOA 2E6ZA 2YWWA 3WG7H 5D8KB 1OYWA 4HRIA 3FXMA 3QU3A 3FMSA 2Y48A 2DIQA 3PCOB 2DPUA 2YXYA 1F36A 1PC0A 3ISPA 5LD2C 5E18F 4M75G 1S72A 5M3MJ 3Q9SA 4O2DA 1W1FA 2PVDB 2A05A 3VWBA 2EQJA 1BR4A 1SD4A 1BU1A 3NARA 4HWTA 1NJ1A 3SXYA 3TW7A 4CGZA 2VC8A 2DQRA 5HVQC 2DOAA 1TUGB 2P4RA 2ROTA 3PNWC 5HGQA 2O0YA 4C92G 2L54A 1OPLA 2MYSA 1OU9A 1N9WA 1YO5C 2DXBA 1QO0D 4BYYA 4ZTFA 2DTIA 3H5RA 2L7FP 3EFOA 2F5FA 4AVPA 4YCWA 2BY3A 3G6ET 3LGFA 3FXRA 2CS7A 4PLLA 4L9VA 4FSXA 1SHGA 3DV8A 1VQ4I 2VE8A 2ROLA 2HKOA 2PG4A 4PL6A 4ZTUB 2QEXQ 5ELNA 2NAZA 1C6VX 4QPOA 4KMUX 1MMSA 3CEYA 3FB9A 5AIPA 1YJ9T 1ZUYA 4H2TA 2BY0A 2GXBA 4YRSA 3GYHX 2DBBA 3HBLA 1GV2A 3L1AA 3M58A 4UNOA 2NUTB 4OB3B 5KYNA 1XGSA 1Q82C 1XD7A 2ZXIA 2VI6A 3HC7A 3WTWC 9ATCB 4CCLA 3WXMB 1LOJA 5L3CA 1LUJB 1N8RC 3SHFA 2C0TA 3SZPA 1S7AA 3K4KA 2KE9A 1MJ9A 3K0LA 2W7NA 2E2IJ 2QI2A 2VXFA 4FM4B 3QUIA 3QYFA 3S16J 3GFJA 5EZGA 2FUG2 5BPDA 5C53B 3KUFA 4QWQA 1FIPA 2I5UA 4M75F 2DT5A 3V7CA 2JN6A 1BR1A 1W0TA 1UUEA 3JTGA 3A8OB 3LC0A 3OIPA 3E6BA 2MH9A 2IVMA 4BXXJ 2AT1B 2E19A 2DTOA 1S9HA 3LX7A 1TQMA 4Y4RA 2DA9A 1K0XA 4KRTA 3W2VA 3LA2A 3VB2A 4WXDA 2KT1A 1NM7A 2HVRA 1Y1VJ 2AZVA 1V4RA 2K9QA 2GFAA 2RHZA 1QVFS 2M4GA 4PJOA 1R1TA 2MLGA 3OSGA 4LJZF 2OAUA 2XD0A 5D6EA 1TUCA 2VVKA 4F92B 1BCOA 3CQTA 1OYXA 4NL2A 3THKA 2K3PA 2YX4A 3LWHA 5HKCA 5TGTA 1KD1C 4IIMA 1DPRA 5JHFA 2UUZA 3EYIA 1QU3A 2KAFA 2DRMA 4MZTA 2IG0A 2JS2A 2OX7A 4L6V5 2CRGA 3LSHA 4BKXA 3GLXA 3WTVC 4L9TA 2KDZA 1ZR2A 1IUYA 5LJ3f 3KP5A 4IO9F 2EL9A 1QZEA 2YDLA 2JPCA 4JJBA 4P75A 3LL7A 4B47A 4RB0A 2MFZA 1AVZC 2I10A 1C1AA 4Y92A 5LRRA 4PHCA 3ZQIA 2EKHA 1IHWA 2KIUA 5IHIA 2TDXA 3D5RC 2K02A 3ABLH 1X6GA 2O4XA 4J6YA 3REBB 1SVLA 4RTUA 3MEAA 1DGRM 2GNCA 1VQ8A 3LSGA 2QQBA 2ESHA 4BJ6C 4KFCA 1QNTA 4WXHA 3GTOJ 1UHSA 1OCTC 1B3QA 5DUKA 1R8OB 4X5OA 2A5YB 2PLYA 5I11A 4A3CJ 4AFUC 3LSMA 5E1WA 1ZTRA 2DYBA 3JCMX 1SFKA 2DJNA 4JX6A 3TDUC 1X2QA 2JJ9A 4FT2A 2FEIA 4TWAA 1UJ8A 2CFXA 1N6AA 1X6OA 4MFEA 3LNQA 2M87A 2ALYA 2AQFA 3J7YJ 2MF2A 4LUEA 2K4JA 4RG2A 2DVJA 2XC7A 4AWXB 1OCPA 2CUZA 1Z05A 2LREA 5L3GA 1K61A 1X01A 5GAGJ 2DFUA 2PU9B 1JO8A 5HLTA 2YHTA 3WTSC 4YIRX 1QBJA 2JS0A 4IF4A 2QXFA 3EAEA 2D6FA 3B6AA 1G4DA 2ZPEB 1IXRC 2HQNA 4Z6YA 3M56A 1NG6A 5EYRA 2O7OA 4PCQA 1DGWY 3BG7A 4Q5SF 1J7KA 2QKLB 3EDPA 1TS9A 4Q5WA 4JRQA 2SEMA 4BI8B 3WE2A 2M16A 4CCOA 5M5YJ 2COZA 3E9GA 1IZ6A 3HUGA 3PL8A 2OZUA 1WZOA 3M1EA 2MMPA 4IUUA 4MDWA 4WJ3M 4EM2A 2RB6A 3FC3A 5LGNA 3LQRA 2A3SA 2WV1A 1ZHIA 2K79A 1E1OA 2CJAA 3U21A 4MZPA 3QXEB 4ZYHA 2ZINA 1UB9A 1T56A 3E0JB 4JOMA 2DMPA 3JV3A 2ICWG 3ECHA 4WX9A 1DU6A 3KFUA 3FK7A 2WAFA 2GBQA 5GANj 1VQ7Q 3D7SB 4PFZA 4Y91A 1SEUA 5KYXA 1P7JA 2CUBA 3HKZA 1Q7YU 2DO3A 4YELA 1NJIC 2ZXHA 2R5AA 3IKTA 1JUMA 1X1BA 4MNUA 1F1ZA 1IRFA 1T39A 4II3A 4OU0A 2DA3A 2Y9YA 4RDUA 1OKRA 2H1LA 4E6RA 3C2GA 2DZCA 2VUBA 3CCMI 4EGZA 1HW1A 2V1RA 3HTRA 1VQ5T 1W36C 2V8JA 1YS6A 1KMMA 2J3LA 4IHXA 1BBZA 2IGOA 4BWAA 4JQFA 4XTUA 5IXFA 2XMFA 5FLMJ 2Z0WA 3SWNA 4CH4A 3WTXC 1USTA 2R7VA 1ZSZA 2ELJA 2FL7A 2I4NA 2E5AA 3OOUA 2K2MA 4HF2A 1NPPA 3A5ZB 5DV5A 1UHMA 4YIFA 2VBYA 2LMJA 1KFZA 5KVRA 2W57A 3MFKA 2W10A 1M90C 3UH0A 2MCNA 4BJTA 1ARKA 4RCCA 4CH6A 4YIIA 1RC9A 3G3ZA 3OYJA 1BN5A 2FRHA 4M77D 4LITA 1WPYA 4J9BA 2RHSA 5B1BH 1TT5B 3K4NA 3FRNA 2X4JA 2VT2A 5GAN3 1BOBA 3HFZB 4YYEA 1I50J 5C44J 4E70A 4FISA 2P7CB 1YFRA 2X48A 3KEOA 1U8BA 4R56A 4TVAB 1PHTA 1H3ZA 3DEEA 2DT6A 2KMUA 5H6RA 5HS9A 4PJOE 3H36A 4FT4A 3QZ9B 3FBIB 3BR5A 1ZLMA 3C1DA 2KL4A 3F0CA 5CQEA 1B34A 1QVGS 4NL3A 2ZT8A 2LR8A 3KX2A 3L7WA 4M3FA 5DCMA 3RKWA 4XK8E 2ZFUA 2QSGX 1Q1HA 1WHGA 2Y90A 2XF7A 4ZYDA 2CGHA 3Q0VA 1IC8A 2EYYA 3UA7A 2EPFA 2K3XA 3SEMA 4F7UF 3PZCA 1AWWA 1UTIA 4ZN3A 2JTFA 3VS5A 1QHGA 3OBYA 1X19A 4Y15A 5D5UB 2HL5C 3HTUA 2HNIA 2JA5J 3NTHA 5GAN7 5L23A 1NJ6A 1MBFA 1H0MA 4I6ZA 1NE8A 4RGXA 4K87A 2DPDA 1TUDA 1IUFA 4RTXA 3AL0B 3IKMB 2Z16A 1R9TJ 1X1DA 1YNZA 1SVOA 2M1BA 4TVYA 3J7ZI 1FYNA 1X56A 3CCSI 4B48A 1TC3C 1IN8A 5CKFA 3HTZA 1S6LA 1U2WA 1OV3A 3CBMA 2JMCA 4XTZA 2W24A 2L7ZA 1RI0A 1WLPB 1KHCA 4CS4A 4CZZA 3HUGB 1Z9CA 3H8ZA 2IS2A 1Z3YA 4RGSA 3JTHA 3HXLA 4RAFA 4F93B 1SEMA 3A8GB 4XQ3A 1ZRFA 4HF1A 5GJWB 3RDVA 4TVWA 3E6MA 4EPCA 3WVEB 3CCSA 4HBLA 5DD4A 1YHQQ 1WJRA 1OULA 3CUQC 1SHFA 3HRIA 2A69F 1XMKA 5L3FA 2EZLA 2DVEA 3J81E 3CCLI 1JKPC 2CW8A 4JX5A 1Y1WJ 4HDUA 5IT9Z 2FQ4A 3K2ZA 4ZN1A 2ARUA 3KCCA 1VQNA 5B5EC 2CS3A 1VQNQ 1MH4A 3BPXA 3I58A 4HNTA 3JRIA 1ZGAA 1STZA 2PNIA 3WVDB 3FKJA 4M75A 4LNSA 2WADA 4BBRJ 1RNLA 4ANJA 1LJOA 2OI3A 4A4GA 1MJAA 2BKDN 3DTEA 5CCAA 1YW9A 1Z9ZA 3NPFA 2KQRA 1VQ4T 3IHUA 2HNHA 2L2PA 1RLPC 1WNLA 2HKQB 1GDTA 4HT8A 1K8AU 2X6XA 2L0KA 3R0JA 3ZMVA 1S72I 1YFTA 1RRJA 2O4XB 4OLFA 3ER0A 3GZNB 4YRMA 4PFPA 1VQLI 2Y31A 2IVWA 3HSFA 1IL2A 2LQ8A 4XONA 1OLTA 4IHSA 4AG1C 2VQHA 4PSXA 5GPCA 1USYA 1R0CB 2CJBA 2M4KA 1QQIA 3G4SI 3R0AA 4AT1B 1FZPB 4DYCA 1KOGA 2IS6A 4BB7A 4A3JJ 3NGPA 1NG2A 3I7FA 2COWA 3CJQB 2WB1N 1U5TB 2K2VA 2KJCA 2V7FA 4OP0A 1FOWA 5ILSA 5FB2A 3DLAA 3F8CA 2JUFA 3OYDA 2LDUA 2Q5IA 1EFWA 2R3SA 2HD0A 1NLPC 2VODA 2BUDA 3JCMd 1Z9QA 2VGNA 3ICAA 3E3VA 3H9JA 3HYIA 3VQVA 2HMAA 1YCSB 4M75C 2ZNIA 1GFDA 2NS7A 2VB6A 2W1OA 5LHHA 3ZPLA 4PJOF 1BC8C 2RQVA 1SMYF 2KZGA 5J4VA 1LJ9A 3JCMP 2CP7A 2E2JJ 2R7UA 4RBOA 3CCET 4H2YA 4KQEA 2Y69H 4OMYA 2QA4Q 2HS5A 2X1EA 4GYIA 4C92C 2QYOA 2W00A 4ZYEA 4I2OA 4YCUA 4N0BA 4O5VA 4CDGA 1YJ9A 3OYYA 1YJWI 4RQEA 3OYIA 4GDFA 3HOUJ 2F5VA 1SFEA 2PVOB 2LYCA 3VS1A 4CS2A 2EYZA 1PRMC 2X1DA 2DZ9A 4H2XA 4IRGA 1E3OC 4M72A 3OS1A 1QA6A 5DLOA 5J8FA 4HVCA 3I56I 3F22A 3P8VA 3MKZA 1KK7A 2NUTA 3KETA 2DQ3A 3VS6A 3FXJA 1SD5A 1BI3A 2HYJA 2IAIA 4JP0A 4YFKF 4ENJA 2VKHA 4K11A 5LHGA 3MWMA 3JREA 1CKAA 3QDRB 4MTDA 1MUZA 1W66A 2ETHA 5LJ3j 3TMOA 2NNNA 5J47A 2ZAEA 4KH1B 3ONQA 3BTLA 3F8NA 3O6BB 4ENNA 1IDYA 4BQAA 1N27A 1AHJB 2BE7D 3CMAA 1Y8RB 1Q81U 3HEFA 4OB1B 2ZR3A 5AIQA 2QBYB 2EYQA 2X1CA 2EKOA 3CPWS 1XGOA 4Y7NJ 3TEDA 3CO6C 4I02A 1JJ8C 3I35A 4RAZA 5LJ5d 3NELA 1XTDA 5EZHA 2LSOA 4DW6A 5C52B 3CF5F 1AWJA 3DKYA 1R58A 2K5IA 12ASA 5EC7A 7AT1B 1FT9A 4CZCA 3HOZJ 1JXOA 3MD2A 3CD6T 5ICEA 3GTGJ 2CSOA 2XRNA 4UVAA 4FYWB 4WCIA 3S8PA 3INZA 5A0DA 1K73R 2JT4A 1YITA 1T0JA 4F52A 3EG3A 2Q8KA 1EH7A 4M78D 5FROA 4RTWA 1ZN2A 1OU8A 2OTLQ 4RLQA 1GBRA 1IZ1A 3REOA 3S14J 4K86A 1IREB 1KQSS 3QU6A 2F2XA 2A6EF 1O57A 3IALA 4NCXA 2DMTA 1SG5A 3HM5A 2RHSB 2XASA 1B72A 5CQGA 1GCPA 2K4YA 2A61A 3JAMZ 2K3FA 3IH4A 1JKQC 1F5TA 2NYSA 2EGEA 1YIJA 5HK3A 3L9FA 1HW2A 3VYGA 1YIJQ 4M6YA 5BS6A 2HQHA 3KP6A 1UHCA 3L42A 3DBLB 4IQJA 4M78B 2QQSA 2ADUA 1E3PA 2VKDA 5L3DA 1K73U 3FWEA 1K83J 1E3HA 2F2EA 3NWSA 3WU1B 1JXSA 1ZBJA 2DXTA 4FYXB 3QO5A 1MBHA 4AC0A 4ASNA 2ZZFA 2Z99A 4M77E 2IGKA 3E7LA 2LK2A 3H9QA 2XU8A 3SWNC 5GAN2 3CCLT 1Y0NA 1ZGWA 2E1HA 2CGPA 2B0LA 1RAEB 3I59B 3MZ8A 4Z2YA 1NEGA 1UGSB 1RAAB 1UHFA 1FSHA 3CDLA 1IRGA 2XPVA 3N5BB 3G71I 3I56A 4DNCA 2RM4A 4E47A 3BR2A 4GY5A 2RV8A 1B70B 1ZELA 2I4LA 3DFGA 4LLLA 5JLWA 1LDJA 5GAN8 2XKOC 4OMOA 2XAFA 5D6FA 1H9TA 1KC8R 3E6DA 2O01E 3DB4A 3SZGA 1HKTA 1E22A 4LIUA 3CP2A 2G0EA 1P2FA 1JTYA 3LH5A 4P5NA 2CUJA 1W7PB 1W2BP 4P96A 4P9UA 3WGIA 1ZR4A 1IGNA 4RM2A 4HW0A 3H41A 1Y96B 2P6TA 3VSLA 6PAXA 2RK2A 4HSTA 1U9NA 3U1DA 4B1RA 3GTLJ 2CZ6B 3PO3J 3LW5E 1N8RU 1MNEA 4P71C 2V9PA 1RESA 3OA6A 1ZSZB 3NENA 4RA2A 2FZCB 4IHWA 1JGGA 2Y2ZA 2YX7A 3SEZA 3TUPA 4RQFA 4RUGA 3RKYA 2Y9ZA 3VKIA 3QO7A 1CF7A 2QQAA 4U0VA 2RO0A 2EIMH 1M8MA 3V42A 3G6EQ 2DXUA 3NRVA 3ABMH 4CC4B 2A6TA 1JUSA 4PJLA 2KSSA 4ESRA 3G4ST 1QVFA 4HG2A 3ZQHA 1R49A 2JA2A 3EG0A 1U1SA 1EIYA 5GMKe 1Q7YC 5IP9J 2R4GA 3RACA 3I4MJ 4BU2A 3A2KA 5BOXA 5KCMA 3GF5A 3A7AA 1WI7A 2PFBA 2WY7Q 4ZZDA 1MSEC 2Y30A 1A35A 1T08B 2M7BA 4D0PA 1J75A 3FEOA 4XN0A 3OV8A 2K27A 3JCMf 2R7SA 2E1MC 4HNUA 4NQWB 4L18B 1IDZA 2IP2A 1VQPA 2R7DA 1B9MA 4C3HJ 4DYRA 1Z21A 4X6AJ 2ENMA 3OYNA 2YUPA 1ZG3A 1X27A 1QCFA 2E5NA 5CVIA 2KHMA 5CVJA 1I0CA 1MV0B 1UJYA 1B7TA 2E10A 4J9EA 4TVRA 3CXCA 5EEGA 4CCJA 2CV0A 2E64A 2EQRA 4KIFA 4EMKC 3B02A 5GANh 1P7IA 2QLZA 3M1CA 4KITB 2ZPGB 3F70A 3DLMA 1JTXA 3TU4K 3LFKA 3BT9A 1D3YA 4B8XA 1HBXG 1M30A 3HPHA 3VU3C 2LVSA 3K7AJ 5LRSA 2QVOA 2KYBA 1AKHA 2X4HA 3TSZA 4GXOA 1M27C 3L4GB 1P9QC 3D1NI 1S72Q 3C94A 2JWTA 3K4BA 2XHCA 1SETA 3T5XA 4QVZA 2E7XA 4ZDPA 1Y07A 5FRNA 3A1PA 2HZTA 3DKMA 3F8FA 2CP0A 4P75C 2KRSA 3VJPA 4E7HA 4J8OA 3M0QA 3JCMb 3ERED 4FU6A 3UGTA 2W25A 4R1HA 2M1HA 4WF2A 1TP4A 1O75A 2DIGA 1UFFA 5D6XA 2V8KA 3NEUA 5GAOm 4G9YA 4DGWB 2VONA 2LRDA 1HK9A 1MDMA 3BTJA 2EJ9A 4WXCA 4S04A 3U23A 2L9SA 5ERIA 1K9MU 4PJOC 4RM3A 5GANg 4CH3A 2ED0A 3M4GA 3KYLA 2VJ4A 1ORKA 3PQJA 2RQRA 2F4OB 1K6YA 5GAEJ 4CC2A 3I0TA 1DPUA 3H6ZA 3M9AA 5F0FA 4ZYAA 2ZNZA 2W48A 1I5LA 2RD1A 1PYVA 1M1FA 1QWEA 4BUGA 1GT0C 3DBHB 3MCAB 2LJ1A 2LT1A 2KDOA 3R61A 1I5OB 2VE9A 1VQ9I 3CPFA 4B3AA 4PGHA 5FKKA 2VV5A 3BCAA 1YCYA 2M9HA 4BHCA 1M8VA 4XLHA 4WWCA 3QTCA 1SSFA 2RMOA 1QMCA 5FW9A 4Y13A 3JCMh 2FMLA 4LVLA 4EM1A 2UWMA 1SFXA 2MGQA 3L4GA 2L4AA 2RNJA 1YGBA 4P73A 2ODRD 2Q7EA 1NJ8A 3T0YA 5H2FC 3ZN1A 2HPMA 1UB4A 4P1WA 2DEQA 3BTCA 2E6NA 1TLHB 2LQWA 1K78A 4NC7A 2GM4A 1SRLA 2FG0A 2O6GE 1ZG5A 3KLNA 1QLYA 4E7JA 4WI1A 2HEQA 4GO1A 4C5HA 4AFSC 3HPGA 1XTAA 4XTVA 5IP6A 1NG7A 3CMEI 1E6GA 1V76A 2IPQX 1AZGB 3RERA 1KU3A 1HW5A 2BY2A 2KRFA 3BJOA 4UUSA 2M3AA 1NEBA 2DXCA 3I56T 2KPMA 1Z1DA 3CCUI 5E17F 2O5RA 4EM0B 3OSVA 1LVAA 2IA1A 1WJDA 3QQAA 4DBQA 2FHDA 2X51A 1WXTA 1PSFA 3VEPA 5I21A 2F5CA 2OTJQ 1KZHA 3OW2P 3CLOA 4A2UA 3RPUD 3CCSQ 2YR2A 2BW3B 3BR6A 2D5VA 3BDLA 2ZXFA 3I71A 2AKWB 3VPRA 1Y0UA 4J9DA 1AD5A 3HRUA 4LFUA 2LCSA 2XGTA 2XAQA 4L5GA 3Q0UA 1S72T 5ICGA 2OUMA 4OIQF 3GF2A 5A2QZ 1XB4A 2ZXJA 2DA6A 3HRTA 1T98A 2HYFA 3MKLA 3ZOBA 2CYZB 2Z9OA 2HBPA 3PGGA 1D5YA 4J9HA 5HK0A 3BZ6A 2HQAA 2XDBA 3RZOJ 3HXUA 1FX7A 3OSSC 1NHAA 2MI6A 2R7RA 2ECZA 3QRFF 3EGUA 1L0OC 2CDTA 5CIUA 2XIDA 1ITYA 3QAHA 3CC4I 2X4YA 2VBWA 1WKMA 2Y75A 1E24A 2BV6A 4HAMA 2R7OA 2M45A 4WCGA 1S3JA 2WBMA 2XF5A 1YIJI 3T8TA 4RB2C 3CLQA 2VJJA 2DETA 3RPQA 3OYEA 2XV4S 1HF0A 1OI1A 2YRVA 3MJXA 4II1A 4ELYC 3UKGA 2M02A 5IHNA 2YUSA 1SRMA 4F16A 2BE5F 2EIKH 1VQKI 3UGQA 3WODF 3DXJF 5M5WJ 1JKOC 3AG3H 3P8TA 2OTLI 2LNVA 1OPKA 2HZYA 5A0LA 4RDXA 3A7UA 4X1EA 3TOBA 1R1VA 4XU2A 3GFLA 1S29A 4M78E 2NRAC 1TWAJ 2VXZA 2CUEA 4R0KA 2JSCA 2H8RA 1MMDA 2XIGA 3LSSA 1RKWA 2RJDA 4YCVA 1S5LC 4C8QC 3E9FA 1IN5A 3PUBA 1H4VB 4NC6A 1ZG1A 1N77A 4P3OA 4CICA 2K9GA 5D6YA 1R5ID 2ZFWA 3IKLA 2DYRH 5JVGF 1IF1A 3HOTA 1OISA 4RG8A 3CD6A 3NWTA 1KYWA 2C7IA 3V8JA 4C5IA 3H92A 4P72A 2DTRA 3M4OJ 3BR0A 2O8KA 3FIWA 3VS3A 2EV0A 2QM3A 3L09A 3ZMDA 4A3KJ 2IPOB 1Q7YR 2HQ5A 3C12A 3VYTB 3MKWB 3LSJA 1RI7A 1WJFA 2DA2A 2DILA 2NOJB 4XLFA 2SRCA 5KYUB 3CCVQ 1YI2A 4K2EA 2R7XA 4XLPF 4B43A 3CC7T 2FJ1A 2MAMA 2DL4A 4BJ5C 5DM7R 2GAUA 3ZQGA 1VQKA 3LLRA 1VQKQ 1J3TA 4QIWN 3SFZA 5E3OA 1PG5B 1NJIU 1HTTA 2OTLA 3AAFA 2JUCA 2KROA 2R7FA 4LMYA 3SQNA 3FDRA 3IWZA 2Z33A 5KH6A 2DOFA 4JZ4A 1ZRCA 4JJNK 3VQWA 4EX5A 5GADJ 1YJWQ 2AHQA 5F04A 3JAMK 1A36A 2LZ6B 4Q47A 1GFCA 3M57A 2RI2A 1WXUA 5GAMd 5HS8A 5LJ5j 1GXQA 4IPAA 3I55I 3F8MA 2KGTA 1WJEA 4IJAA 3PIPF 3JRHA 1EH6A 2KT8A 4KGVB 2UXXA 5FKMA 4BXUA 1XC5A 3I4PA 2LF8A 3T1BA 4XU0A 5GAMe 4A4FA 4NNJA 5LJ3d 3TBIA 1K4US 2CQ7A 3S2WA 4UUVA 1UDLA 1C0MA 2RPNA 3G1OA 1Q82R 1VZ0A 4E4HA 2CJ9A 3WTYC 3GZ6A 5GAN4 2AMCA 2KRCA 2RJFA 5E1XA 1RUWA 2GOMA 3S3MA 2QAZA 1UAAA 1VIEA 3M07A 4XM3A 2RREA 3FXOA 2F5KA 1YTYA 2R93J 2GGRA 2ZJRF 3LSQA 3JSOA 3ABUA 1VQ8Q 2B7EA 4XORA 3OYHA 2EQIA 3GNGA 1FYFA 1X1AA 4I99C 4D9JA 1AOJA 1I8FA 4J15A 4WJ4A 2VPRA 3QZ5B 3VV0A 1LEBA 5LJ5g 4HT9A 5B66C 4M7DF 1YX3A 2HWVA 3CXCP 3BR3A 3EUAA 3HRKA 3CCUQ 4FE7A 4M77C 2QG9B 2RJCA 4TQDA 1TW3A 5JI6A 1K7AA 1FMWA 2L8DA 2RA2A 3W3SA 1ENHA 1WRJA 2BGCA 2L2OA 1DDNA 1J9IA 2M9UA 1FP1D 1KU9A 1EJ9A 1JQQA 3SDBA 4HWOA 5J1RA 1V55H 4LVMA 1WQWA 1TWHJ 3AT1B 4HDVA 2MK5A 2W4SA 3I55Q 4IHVA 2DK8A 2XGCA 3MKDA 3PIPA 3A01B 2LKSA 2QGFB 4AYBA 2LBFA 1XJWB 2L9RA 3CUQB 3RTRA 1HKQA 4QTRA 1LB2A 2E2HJ 3V4GA 1PD0A 1SD6A 2N8GA 4IHTA 1VQNI 2BXYA 1N9SA 2DERA 3GFMA 1W5TA 2OA4A 2AXLA 3TGNA 1HC8A 4KDPA 2CREA 3QP6A 2JUGA 4BY7J 3U9GA 3C95A 1HDDC 4NC8A 4CI0C 4M7DD 2MH2A 2IW5A 4YRIA 3PNYA 3K9TA 2LRQA 1ZQ3P 1NLOC 1WGXA 4M77A 4OMFB 5FKNA 1Q1VA 4HA8A 2LJ0A 5DM7F 3LWFA 3L2QA 2XROA 4HCZA 1YN8A 2CYYA 5K5OA 3WGGA 5DTDA 3SEQA 3S3OA 3S15J 2NUPA 2ZJPF 1W2BA 1NJ5A 2WAQA 1MJBA 3BDDA 1KC8U 2EFWA 3QYHB 1VQ9A 1WH5A 2CH4A 1J5YA 5KCHA 2FE3A 4BGDA 1VQMT 4QVCA 4LK0F 3E9HA 4JJDA 4KGXB 2EYWA 4CO8A 3BFMA 2PMUA 4D8KA 3SDZA 3EUHC 2OAWA 5IHKA 1FNNA 3FKIJ 3ZMTA 3F6VA 4EJOA 5GJVB 3IL2A 5C4XJ 3PTAA 5E3IA 5J3LA 1W6XA 2LCLA 4MEXF 2OTJA 2QGGA 2QTVA 3ZFJA 1S7OA 3QO8A 4B44A 3OYGA 4X9DA 2DW4A 3A5YA 3NTIA 2DD4A 3NHNA 2DODA 3I64A 3OWTA 4GFBA 2MW8A 3NEMA 3S93A 3CCMA 2TRTA 2OAZA 2NUPB 4FSSA 4RAYA 4X9CA 3A74A 1RABB 3ASNH 1Q82U 1K4SA 2P4WA 4EMSA 1Y39A 2DFHA 1DP7P 1E7OA 2JOYA 1G3WA 4M3EA 2RQWA 2BTTA 2K5LA 1X55A 4XNFA 2RN8A 3HHGA 3CTAA 5JLXA 4XICA 1R71A 1B9NA 3K4JA 4ZZLA 3GOXA 1WU7A 4FW2A 1G6NA 4QQGA 4ZH4F 2VKNA 5AT1B 1QHHD 2H94A 4L9JA 2R5YB 1GRIA 2BZ8A 1NJIR 3MQZA 2ZSIB 1M2VA 3S1RJ 1K0SA 2VIXA 1VQKT 4A63B 1KQ9A 3EG2A 3RL6A 3VBBA 3BZCA 3GZ5A 3QWYA 3PNVA 5IH2A 4OIRF 2MOXA 3CC4Q 4PSWA 3OW2A 1U8RA 3JCMg 2K86A 1EQRA 1G5HA 3BROA 4A54A 2ARSA 1YLFA 3Q5FA 2DL8A 3HXXA 2LY2A 4JPBW 3CDHA 3K6GA 4HQMA 2HU9A 1WJCA 1WHKA 2A68F 1F9NA 1ZQ1A 3QOPA 3TQNA 4JYKA 1M1GA 2EVRA 1JJ2A 4YROA 3TEHA 4U7BA 1U5TC 3LAJA 2GTJA 2BXZA 3V7SA 2MWPA 5K1XA 1IO6A 1VI0A 2FRWA 2KT0A 3JAME 3A31A 3QDFA 2E5KA 2FZGB 1N9RA 3K70C 1BL0A 4C8QA 4PG3A 2YLBA 3FJPA 2XKPA 1Q86U 2LC4A 1VQ5Q 1EVKA 2LT4A 1YFHA 2EA2A 3GNFB 2A08A 4OMQA 2WAQN 4A6EA 5E8IA 1W4SA 2P0KA 4BY6B 2ZJQF 1VA7A 4RGUA 5J8CA 2X6OA 1B4AA 2GXGA 4C30A 1RZ4A 2H27A 1WJBA 1WVRA 2V6EA 5GMKi 5HODA 2G4CA 2A7YA 3W6KB 4AFQC 2RQPA 3QPLA 1PRLC 3VS4A 1WH7A 1IGUA 3CCQQ 3CD6Q 1XG1A 1A6IA 1BK2A 3F21A 3QODA 1T33A 2WB1A 1SFUA 2W0ZA 1M1KR 2EFQA 3MAJA 5LBQA 1ACIA 5K1YA 4JZ3A 4J9GA 1X54A 2KK4A 1MGTA 5EG2A 2DDZA 4BD3A 3ZMUA 2ZSHB 1P4XA 1W1WE 1A6QA 3E1SA 2VOPA 2DEUA 3WTTC 3M8JA 2LH9A 5F27A 5HLIA 1J0RA 3M4YA 3VS7A 1ASYA 3MQ0A 2R5ZA 3JRDA 3OL3A 4M4ZA 1LNXA 2YRCA 3M59A 1U3EM 4M7AD 3DWLE 3S2HJ 4RMFA 4XSZF 1I5ZA 3OBWA 1MNDA 2RNAA 2X3WD 4LLGF 4IUVA 5LJ3e 2MLKA 1TWGJ 5EEHA 4XU3A 5GAN6 2J3MA 1VQ9Q 2ID6A 3EFOB 2HOEA 2ZNYA 3HPWA 3UT1A 4A4EA 1FY7A 3BZKA 1ZH5A 2YSQA 2F1LA 3A8MB 4G8XA 3QNEA 3CMEA 1G59A 3E5UA 1BR2A 1V54H 1YW7A 4BAYA 2QSHX 1QWFA 2XPWA 2EBPA 3MP1A 4HCKA 2AQEA 3I54A 2J7IA 5HCKA 3CMMA 2HQEA 5ECAA 1NH3A 5FJ8J 1G8XA 4DYQA 3EUHA 3LMMA 4IEJA 5AYFA 1JGSA 4MMLA 2FBKA 2KKOA 3LA3A 2R7ZJ 1VQPT 2K40A 1E1TA 3VYRB 1D0XA 1OCRH 1IXDA 2KRNA 4XRSG 4CCKA 4C2UA 2E1OA 2P5VA 1ABOA 3L2VA 1M5Q1 3EH1A 2NS8A 4L59A 4D7MA 3PQKA 3RZDJ 3CC4T 5KNNA 4A0XA 4M75D 3QPSA 4A3LJ 4M3BA 4NUBA 2D8HA 4Y33A 4PJ0C 3ASKA 4ZGDB 4M7DB 3G1ZA 2A0FB 5I2SA 1K9MR 2H3EB 1U78A 2IIMA 1R77A 1V5GA 2AKLA 2CP6A 4QKUA 1K9MC 2OU2A 3CC2T 1PYSA 2RHQB 3QYEA 1ONVA 2WSEE 1WPKA 4OINF 5E79C 3QJYA 1REPC 2DYIA 2JA8J 5LJ3h 2BY1A 2NS6A 4II2A 3BLYA 3OY9A 4KGZB 1GGMA 1MMNA 4J7IA 1HC7A 2QENA 4HNVA 5IYDJ 1OCCH 3ZQQA 2M0CA 2FOKA 1XGMA 3FXUA 3GEZA 3BG9A 2F5EA 4W1UA 3L2UA 1GHCA 1AWXA 1VYUA 1VQOQ 1YITT 1YB3A 4AFZC 3M0TA 2F4MB 4LDXA 4P73C 4AIDA 4BDZA 1AU7A 5GANf 4HX7A 3H0GJ 1YJ9Q 3LOCA 1TWBA 1TQIA 2IT0A 1TNTA 2UXNA 3TEGA 2P84A 3JRBA 4JK1X 5D4RA 1ZA2B 1PKTA 1MSFC 4C3JJ 1LCKA 3MEWA 3QIIA 3EGDA 4Z02A 2E60A 3I56Q 3IWFA 4B6MA 1S8NA 1RKTA 2NOGA 3HZJA 5GAOp 1YWOA 3TVTA 4BACA 4OGCA 4M7AA 3GTPJ 3L00A 2KXCA 1XNIA 2RHIA 1XX5A 5J1UA 4ZNXA 2F5TX 4F14A 4ESBA 4V2GA 1FMKA 2OTJT 3A98A 2HKXA 1OX8A 3ZCOA 2B9SA 1MMAA 4OOIA 4PJNA 1SSHA 4C0GA 1JJ6C 3LSIA 2JZYA 3RJPA 5E20A 1B59A 2WAEA 3SZTA 2VBZA 5IT9E 3HDDA 1TH7A 3OYFA 5K7HA 1FWZA 4OF1A 1AZEA 2YLCA 1NYGA 5D7UA 2E7WA 2HDWA 4DJAA 5K5RA 1I27A 2HOTA 3VYSB 4LLNA 2E35A 1VF9A 4LVJA 3R07A 2O31A 2LX7A 2PVGB 3UA6A 4OMPA 2CV2A 3MPUB 3CMAT 3P8BB 3LA7A 5CLSA 2YUOA 4LVIA 5D4SA 4U87A 3CCVA 5BQTA 2XGEA 1QKXA 2K7LA 1SESA 3H0FA 3H0IA 2B8AA 3FMRA 1RAFB 2NWMA 3K70D 1SANA 1N8RR 1BW5A 3CCEI 3ESWB 1YYVA 4XTXA 1FOYA 4KICA 1VOMA 1X69A 2GIVA 4DBHA 5FGMA 1SD7A 3EPZA 1UHWA 3KP4A 2DQLA 2V1DA 4KN4X 4P5OA 5KAIC 2K5CA 4UB6C 4AYBN 1OEBA 2RI3A 4M74A 1LDDA 3LAPA 3MO8A 3FM3A 4JDSA 4QQ6A 3KIOA 4EMKA 4M7AE 1IGQA 1VQLQ 4CH5A 1PP7U 2M0MA 4M77F 2XI9A 3PVLA 1X4OA 1L3LA 4ZC3A 5KYYB 2PJRB 1UGQB 4BUPA 1YFNA 3CCUA 5B1AH 3HSBA 2PUKB 4PJJA 5HDNA 5JHUA 2A36A 2DU9A 3VS0A 2F5DA 1LYLA 1R00A 2STWA 2DAOA 4F7ZA 2QCOA 4I98B 5GAHJ 2BZYA 1MBJA 8ATCB 3KEQA 3GTQJ 2HSEB 2Q7HA 4HCCA 4RMNA 1YIJT 3F9KA 4HV5A 4N9HA 4XLEA 3RDIA 2RVCA 3VSKA 1PP8F 1VQ6I 3V8LA 3BW1A 2Q2EA 4R79A 1H8AC 5E3NA 3RIRA 1O4XA 1VQOT 2P5IA 1D3BB 3EG9B 1QRYA 1U0JA 3HY0A 3F6OA 4XOTA 4JJCA 5CVRA 1R7JA 5JR3A 3CCLQ 2EPDA 5EEAA 4M7AG 3W2WA 1KQ2A 2XAHA 3QP5A 1WCMJ 3GO5A 3TEEA 2PMZN 4U88A 4IVNA 3GLLA 5EDNA 4M75E 1P92A 4FIBA 4BW9A 1KIKA 1OQYA 5FU7C 5K5QA 4OVAA 2CIMA 3GMEA 2ISYA 2OTJI 2EFIA 3VQXA 2PI0A 3K69A 4EJVA 1WSUA 5CKDA 2ZMEB 1VQOA 3MF1A 5ILVA 4YRQA 2DT7B 3I9V2 4I09A 3PJRA 4FQGA 4HZFA 2XDDA 2XKOA 2ZT7A 5CVUA 4DQ2A 3R4KA 1H4QA 4F55A 4BEHA 3D5LA 3ZR8X 2K7AA 2YU3A 1JXMA 4ME7A 3IAS2 1DUXC 4YTLA 3EUKL 3RSNA 3J80K 3REXA 4I0BA 1LFBA 3M3YJ 3A8HB 3X25B 5GANd 5FFXA 1QZYA 4JS5A 3UPUA 1YJWT 2D8JA 3P8DA 4MDXA 4BHPA 2EFPA 4IRHA 3JW4A 4KR2A