3V7RA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7rA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7rA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7rA02
1GXPA 5JR3A 3C18A 3RPUA 3L4GA 2VE9A 2VBZA 2UWMA 3F8CA 3RESA 3MF1A 3BJ6A 4YIIA 4JQFA 5HDGA 3ISPA 5ELOA 5DUIA 5GMKe 3M4GA 2O0YA 5D5XB 1ASZA 2RV8A 1Z05A 4CHUA 1MDMB 1B34B 1XGMA 1BM9A 1VTNC 3EUHA 1HW1A 4HT8A 4YRIA 1HXDA 3MZHA 5HDKA 2DPUA 4CYDA 4I02A 2ZT6A 4M7AF 1YLFA 2BBYA 2ZT8A 1WWXA 2A69F 3DV8A 3MF2A 1R36A 2ZXJA 4G6DA 1B34A 2LSOA 2VC1A 4ETSA 1U5TC 1HSTA 4P74A 1PUEE 1ZLKA 3CUOA 4XTUA 4Q5SF 4C92G 5BS6A 4M74A 5A2QZ 2Y48A 4A0ZA 3RIRA 1FY7A 4AVPA 4GCVA 3TKYA 3U1DA 5CVVA 3A7RA 1G51A 4B8XA 3GO5A 4M77B 1Z1DA 2PI0A 2CJBA 2HKXA 5LGUA 2VT2A 3IC7A 3GFLA 5LLQA 4TWAA 1WRJA 3KP3A 2IJLA 1G3WA 2ODRC 1BBYA 2K27A 1EH8A 3TOBA 3DXJF 1KYWA 1YW7A 1U6GA 1YIOA 4FT8A 3JCMd 1TTYA 3VOEA 4LLNA 2EA4A 2OAZA 5EEGA 4M75F 5E1ZB 5L3GA 2ETHA 3EQLF 2P7VB 4G9YA 4ENNA 4EMKB 1PP8F 3G1ZA 1FC3A 2L02A 4M75G 2XASA 3ZP5A 1RIOH 1RZ4A 2VXEA 5F5WA 2GIVA 4G85A 1ASYA 5E17F 1O7FA 3F22A 2ZO4A 1YCYA 4YCUA 4EMKA 4L18B 2DKGA 3PFIA 3EFRA 1IAWA 3F8BA 4YREA 1QO0D 4C8QF 2G7HA 5K5OA 2OZUA 1YO5C 3K2ZA 4LLGF 2P0LA 2ZZEA 4TVYA 1R1VA 1H4TA 5GMKl 5FB2A 2JTVA 2WV0A 1EQRA 3NQOA 2ZKZA 4M7DF 4YRJA 1MKMA 2ZXFA 4C8QG 1V4RA 2EB7A 1ULYA 4M72A 3RYRA 4WJ4A 3TOAA 3KEQA 4IJAA 2D2WA 4X9CA 3PCOB 1J5YA 3M8FA 1F1ZA 1JGSA 3OD1A 2HQNA 1FP2A 3BY6A 3TO9A 4ZIBA 3VQWA 3E5UA 4BWAA 1B9NA 2YHTA 3JTGA 1H641 4L9JA 3V8JA 1C0AA 2RVCA 2M87A 4A2UA 1SFUA 3ZN1A 1XCVA 1USYC 2ACJA 3T8TA 1F9NA 3NRVA 3CTAA 4EJWA 4GGGA 4N9IA 5ILSA 4NOYA 1P4WA 1Z91A 3M1EA 3DPTA 4K88A 1OYIA 3CUQB 1Z6TA 5AIQA 1I1SA 5LJ3j 5GAOp 2L4AA 2DU7A 5IT3A 2ESHA 5JVTA 2XKPA 4QWQA 1REPC 3ZMVA 1O3TA 3F6VA 1SMTA 1I27A 1XGOA 1RI7A 4IRHA 1I6XA 2OD5A 2X4HA 2VOOA 1ZREA 4HBLA 3WE2A 4P96A 5ICGA 2XGXA 1R1TA 2P6SA 1DP7P 4O3MA 3OOPA 5HLGA 4UP8A 4F7UA 2ZFWA 2EJFA 2ZNJA 5EEHA 1LNXA 5D6EA 4YCVA 2KRFA 4XLNF 2DO7A 3KE2A 4OINF 3Q9VA 4M78E 1X55A 4PCQA 1H9TA 4NQWA 1RNLA 1NJ2A 3JCMW 1WYDA 4WCGA 4H2SA 2ELHA 1LJOA 2E3CA 4RGUA 1TW3A 2VBYA 2K86A 4EGZA 2Q0OA 4ENJA 1QQIA 1QF6A 2QQBA 4ASNA 3F8FA 4IF4A 1USTA 4HDVA 4P55A 2DTHA 2XHKA 1S29A 4M77F 2CJ9A 2GXGA 1LYLA 4PJOB 2W84A 4YDQA 2FB7A 1B8AA 2FNPA 1KU7A 2VONA 2GZWA 2VBXA 4G94A 3BPVA 5GANh 2DTOA 2RGVA 3L00A 3VQYA 2EK5A 3CDHA 2MC3A 1Z7MA 5GAOn 1O3QA 4OP0A 3QU6A 5GANj 1IL2A 3FMQA 3VFZA 2K4BA 3W6KB 4ZZDA 4ZYHA 3RI4A 1R5HA 1BBUA 4U88A 4PGHA 3WTTC 4HT9A 3KP2A 3C1DA 4ZYGA 3HFNA 4QLCU 1CF7A 3F8MA 1AWCA 3UGQA 1HQCA 3E5QA 1YG2A 3WGGA 2K57A 3O6BB 4HWSA 3BDUA 3L09A 3DQVC 1DPUA 3SWNB 2YX7A 4C92D 2IT0A 1B4AA 3KLOA 2Z33A 2COMA 2OZ6A 1ZAOA 2XKOA 4RB2C 4FX0A 4RQFA 5HS9A 3FM5A 3M7GA 3KZYA 1YFRA 3HHGA 1KYZA 5K1YA 4XTYA 2AMCB 4RMFA 3I58A 2DQ0A 1ZGJA 5HLHA 1G3SA 3E3VA 5FD6A 1A04A 4L0YB 3UH0A 2EFPA 3KP4A 6PAXA 2J3LA 4KT5C 3HRKA 5AONA 1YFHA 1KOGA 4LGWA 2XAJA 4UXNA 2AMCA 3HY0A 2OA4A 1GXQA 1IXCA 4M6XA 3K69A 2CG4A 2Z3YA 3WGHA 5HVQC 2E1NA 1X3UA 4YG2F 2FQ3A 4EO4A 3L1AA 4O5VA 3PGGA 2XGTA 2HNIA 5C52B 4HWPA 5GANe 4M75D 3IKLA 4JUVA 2R7DA 3BJUA 3CMQA 1Z9CA 3J81Z 1JE8A 3GFMA 4RDXA 2BGCA 2IRFG 4CXFA 4HA8A 1XGSA 1O3SA 2LF7A 3ERED 2C8MA 3WU1B 12ASA 1YB3A 3ML6A 4F7UE 5LJ3d 3KEOA 1KU3A 4CDGA 1E24A 1EVKA 3OV8A 2F5CA 1DDNA 1E2XA 2FMYA 5HS7A 4LG0A 1FOKA 5CAIA 2A68F 4ESFA 2NNYA 3DF8A 2DPDA 1HKTA 3JCMh 1JJCB 4M7AC 4L5IA 1HW2A 4H2UA 4U0VA 2RKHA 4A6DA 2TDXA 3ZPLA 3HSBA 4C92A 3MWMA 5GAN8 2KIUA 5E20A 1JJCA 5BPDA 4H2WA 1P92A 3QHSA 1F5TA 1T98A 1GVJA 1ZRFA 1YW8A 4UVAA 4ESJA 2QTXA 1LDDA 3FWEA 1KU2A 4UV9A 1IRFA 4RB1A 5E8IA 4LJZF 4WWCA 5H6RA 4N9HA 5LJ5h 4Q47A 5LBQA 3HTZA 3E6DA 4I0AA 5LGNA 2WTEA 2QHVA 2ZINA 2DEQA 3KP6A 4EJUA 5LJ5j 2XVCA 3D5LA 3DEUA 3HRUA 3HXVA 3R60A 3GFIA 3UFGA 4NB5A 3EFSA 4J6XA 1SETA 2HYFA 4P73A 3TEHB 4P5OA 3JCMg 4A0XA 3A74A 1FSHA 2A3SA 1C0WA 4KIGA 4ZYDA 3K0LA 5D8LB 1H4QA 4OIPF 3BW1A 5GAMj 3GFJA 4IXAA 3CO7C 2JT1A 4AWXB 2Q2EA 1TQMA 4R8HA 1MGQA 4TTVA 1NNHA 4EM2A 3ICAA 4OLFA 3P7NA 2I4OA 3I53A 3IALA 4NCXA 1USSA 4IHSA 3JCMJ 3IRQA 3AHUA 5F1RA 3T5XA 3I5UA 5H6QA 1HC7A 4E51A 2QQAA 2V1UA 1KU9A 4G8XA 4C8QC 2Z9OA 3HRMA 2P5LC 2QBYB 5CVJA 1YGBA 3JCMe 3JB9H 1ON1A 2CSOA 3E9IA 5ICFA 2ZR2A 4UUVA 3HFVA 2YU3A 4LLLA 4LB6B 4UPAA 4OMYA 3CLOA 3WTSC 3O2PE 1I1GA 4M7DC 3GYHX 4PGGA 2HTSA 2ODRD 1S7OA 3ZMZA 2FU4A 2CJAA 3HFZB 3L4GB 2QBYA 1FSEA 4HDUA 2FMLA 2PMHA 2L3DA 1SESA 2M45A 4XEOA 3LQRA 4HYEA 1SD6A 5TRDA 4E70A 2C6YA 5GMKi 4EMHA 5ED4A 2FNAA 2PQ8A 1WSUA 3HFZA 2O3FA 3BOQA 2PG4A 3R61A 3QUIA 4B09A 2HKOA 3RKXA 2CO5A 2RDPA 4BNCA 3LAJA 3W3SA 2LKPA 5CVIA 1O7LA 4TV7A 5GAOq 4RGXA 1KMMA 4ZZLA 2FBHA 3JB9F 1NJ6A 2E7XA 3D0SA 5DDGA 1H9GA 5ICEA 4H2YA 3SZPA 2QM3A 4M78B 5GAN7 2QHSA 2ZCEA 4YRCA 5L3DA 2DU9A 1FLIA 3ZMUA 1ZRCA 4O2DA 5JFRA 4HF2A 3JB9G 4FX4A 2QQ9A 2EL9A 4HV5A 5DV5A 1EH6A 1E1TA 3LA7A 4M7AG 4XQ3A 1YFSA 4P74C 1XMAA 3ZN0A 2DVEA 3RPQA 4I0BA 3KP7A 5CVRA 1QPMA 4M78A 2E1HA 4ESBA 4C92E 1NJ5A 2Q7EA 1WQ2A 4WJ3M 1YS7A 3SQNA 4KMFA 1R1UA 5FFZA 4ZTZB 4J5YA 1ZYRF 2EV5A 3I71A 2JZYA 1B70B 2DTRA 2EJGA 4GO1A 3KCCA 1L0WA 2WC2A 5D5WB 2E5AA 4CO8A 4CH5A 3DKWA 4R1HA 4M77C 2H94A 3IWZA 4Y91A 1R22A 5K5QA 1ONVA 1B70A 2PN6A 1I81A 1M5Q1 4EX5A 3J80K 1YS6A 4YROA 3HIFA 1NYQA 1J7KA 1STZA 3RJPA 2EFNA 4M75E 2VOPA 1E17A 1TH7A 4D0PA 3FX3A 3ECOA 5LJ5d 1SD5A 2MH2A 4Q48A 4UP9A 4JK1X 2I4NA 2IPQX 2ZTGA 3Q9SA 3RACA 2GXBA 5TJJA 4EMKC 1X2GA 4V2SA 5FLXK 3FMSA 4P71C 2DK8A 2IA0A 2HFHA 2NNNA 1YTYA 2RM4A 1UFMA 4NL3A 2BEOA 3JCMX 3TUPA 4HQMA 2QHUA 3I59B 5D8KB 5GAMd 1QGPA 2RNJA 5FGMA 4C8QE 3REXA 5HGQA 3LWFA 1P2FA 1OKRA 1OMIA 3WU0A 5BOXA 4AIKA 3LAPA 2V9VA 4XU2A 4DQ2A 3W6JB 4M7DG 2J3MA 3TEGA 1W7PD 2F5EA 5LEKA 1H4SA 1IN4A 1IW7F 1QZZA 4MMLA 3I59A 4QVDA 5GAN5 2RHSB 2XRNA 1GGMA 2ZGWA 3ZMDA 3FB9A 2AKWB 4HLXA 5KK1A 4EVIA 4YFNF 1HK9A 5LJ3h 2DFIA 2ZCWA 1OR7A 3U2RA 4A53A 1XDUA 4Q15A 1DPRA 1USYA 1MZBA 2FBIA 1EH7A 3E97A 2RHSA 3DSQA 1MJBA 4MMKA 4CICA 1SRYA 3HYIA 4BXUA 1GHCA 2YLBA 2AKWA 4HX4A 4AIJA 3PQJA 1XSDA 1OPCA 4F7UB 4S04A 2E1CA 5GAOr 4P72A 3SB2A 1EFWA 2DK5A 2D45A 4AD9A 1QNTA 4YRQA 1XCBA 4HX8A 2A61A 1BOAA 3BROA 3QO7A 3CUQC 3HXZA 1J5WA 2DTIA 2FSWA 1FZPB 4P9FA 1FX7A 1XDSA 3I64A 2HOEA 1T2KA 4TQDA 2IVMA 3GUDA 4PZJA 2P7CB 2DDZA 3TDUC 2IA1A 2DQLA 3F8NA 3LA3A 4NL2A 4JRKA 2IW5A 2V79A 5FFXA 4XRFA 2LDUA 3GEZA 3MFKA 4YRTA 2VBWA 1G3YA 4CZZA 2DXTA 2OU2A 5LJ3g 1U2WA 1WLEA 4IHTA 1U1TA 1W7PB 3SHFA 2ZZGA 2LNBA 2QZ8A 3TDZC 3WTWC 3FJPA 4TVWA 3FXRA 1B6AA 3HSEA 1SAXA 2A5YB 3E6CC 2MLGA 2P5KA 4M77G 1T6SA 4MEXF 4EM1A 2FYKA 4KIFA 3RKWA 1W7PA 5LHHA 1W5TA 4G7ZF 1I8FA 3FM3A 4I7HA 5DEQA 1CF7B 3FMRA 2W57A 3ELKA 5LJ3e 1RUOA 4IRIA 5C51B 2ZNYA 4XTVA 4PJOC 4JBAA 3QO5A 2GQQA 1HKSA 2UXNA 3P8TA 1LQ1A 2P5VA 4J6YA 3QTCA 4BHCA 1XGNA 4MQVA 2KIMA 3V7SA 3VBBA 3GVAA 2HYGD 2E64A 1B59A 3MQ0A 1WPYA 2EJ9A 1ZN2A 4NHJA 1P4XA 4EJVA 1S7AA 4KNYA 3FXUA 2FRHA 1D8JA 3WQZA 4GYIA 3JB9D 4ENMA 2Q8KA 4N0AC 4M7AD 5JHUA 1D3YA 3F6OA 1W5SA 2C7IA 4EQQA 4RGRA 1MD0A 2QYOA 3KFUA 3ABUA 4K86A 4OMZA 1KQ1A 2NAZA 4M71A 4RS8A 3RGLA 1K78A 5A2QK 3CJNA 1U3EM 1LVAA 2GAUA 4L87A 1PYSA 4KDPA 5GANg 3SWNC 1JHFA 3RF1A 2ZT5A 1SD4A 5BPIA 2YSRA 4CS4A 1KGSA 2V1XA 4HWRA 4EMGA 3NEMA 4RCCA 1NJ1A 3M4QA 5KVRA 1G6NA 4I09A 2PBIA 2IY5B 4DNCA 2XROA 2YPRA 4ZTUB 1FWZA 3QU3A 1S8NA 2XIGA 1EV7A 5LGTA 3HTSB 4YRMA 2ZR3A 2ZMEB 1WQWA 4P3OA 3IL2A 3LFKA 4CGZA 1FPQA 4M9XA 3P8VA 1JBMA 2E7WA 2IY5A 2KJCA 4LG0B 2Y90A 5LRRA 2KIFA 3JCMf 3R6SA 4M9SA 3MZYA 4F7UF 4EJOA 2ZMEA 2MLKA 1TW2A 4J6WA 1J9IA 4Y13A 4U7BA 4XTWA 3B73A 2VT3A 2NYXA 4MGRA 3WODF 4C92B 1L0OC 2Y0MA 1XMKA 2AXLA 3L2ZA 2HEOA 1R23A 3K1NA 4YRSA 4C8QD 1N9RA 5DD8A 4OU0A 2BYVE 4Y15A 3L2CA 3QSUA 5I21A 3GXOA 4M7AA 2JSCA 1MJ9A 3TO7A 2PMEA 2ALYB 4XTXA 2Z99A 1X54A 4M7DD 2HZTA 2QWWA 1QE0A 2EJRA 2DU5A 3HOTA 5D4SA 1IN7A 2X0LA 4EMSA 1FBUA 3IKTA 3HRIA 5L3FA 3BY7A 2IA2A 3M8EA 4PJOF 3HUGA 2ALYA 1YW9A 5D4RA 1HSJA 3L9FA 5ERIA 3P8YA 1EIYB 3UGTA 2P5IA 2NRAC 3QRFF 1BIBA 2EFOA 1ADJA 2P4WA 4A5MA 1SFXA 4M75B 4YRPA 4X9DA 4PJOG 1KQ2A 3KZZA 1JXSA 2XAHA 3RDIA 5GAOm 4HWTA 3H3ZA 4KUMA 1FBSA 1EIYA 3P9IA 2AS5F 4P75C 4JRIA 1D8KA 2ISZA 3VU3C 2ZZFA 1FYLA 4U0YA 4M73A 1N9SA 5GAMh 2QVOA 1BI2A 4I98B 3T1BA 4M75A 3A7UA 4P73C 2G9WA 4HWOA 3HXXA 5K1XA 5GMKj 3K9TA 2DAOA 2A07F 4MHGA 3CO6C 2ZJ2A 3IRRA 4HVCA 3HXYA 1U78A 4S05A 1TNSA 5BQTA 2ESNA 3AAFA 2PLYA 1W4MA 3QAHA 3WGIA 4C8QB 4WI1A 3HFOA 3HY1A 1B7YB 4CS3A 3T0YA 1ZH5A 2DZCA 3WTZA 5KNNA 4BHPA 3Q5FA 3LC0A 1UB9A 1XD7A 3N97A 3R07A 3J7AO 3WE3A 4L9NA 5LJ5g 4C8QA 4Q6GA 3WTUC 1FYKA 1H0MA 2VODA 3EYIA 4A6EA 1B7YA 4KR3A 4KA4A 2W24A 2I2LA 1B1BA 3RTRA 1L3LA 2I4LA 4M77D 4PG3A 4M7DA 3I54A 3VB2A 2RD1A 1IRGA 3GZ6A 1WNLA 2HS5A 4OOIA 3REOA 5FD5A 3QPHA 1KQ0A 5LJ5e 1XSXA 2LF8A 3FF5A 4UV8A 5IT9Z 3A31A 2FBKA 1O57A 4Z2YA 3A5ZA 1KQ9A 1QZYA 3ECHA 1G5HA 5ELNA 1E1OA 3ZMSA 3KLNA 4LNSA 4CH6A 1P6RA 1J2XA 1J59A 4HZFA 2JPBA 2D1VA 2ARUA 3ABTA 3G73A 1ZARA 4HOBA 2F2EA 1WQ7A 4BH9A 4YRGA 3V4GA 2DI3A 2ZNIA 1U5TB 3RYPA 4RQEA 4WK8F 5GAMe 4LMYA 4U0WA 2JRTA 5C53B 4L9TA 5CJ9A 2Y75A 1IN8A 3E9HA 3IKMB 3LSTA 2EWNA 3F72A 1TNTA 1YQAA 2I4MA 4TQFA 5L3CA 4C92F 3HHHA 3JB9I 5E1XA 4H2XB 4WX9A 1U5TA 4M7AE 1MDMA 2A6HF 3JTHA 4MQ9F 3V8LA 4M78C 1H4VB 2ADUA 1WI9A 2DXUA 4KFCA 4U7DA 1FNNA 4UVBA 2XTIA 1T38A 2DW4A 3A7AA 3U9GA 3KETA 3MEYA 3IHUA 3KP5A 5GAN3 4H2XA 3L7WA 3WTYC 2PJPA 3SFZA 2RA2A 4PHCA 2VN2A 2O61A 1G3TA 2QUFA 1NJ8A 1SFEA 4MTDA 1SMYF 3ZMTA 3IKVA 4HQEA 2RHQB 3O3KA 3ERRA 2M30A 1LDJA 3HSRA 1I4K1 3JCMP 1ZRDA 3PQKA 3SXYA 1FYMA 1LB2A 4M77A 4AH6A 3IG2A 1LJ9A 1OYYA 2P8TA 1K6OA 2RB6A 2HGCA 4BHBA 2F5FA 2ZIMA 2RHQA 4KQEA 3I4PA 1VQZA 1XSVA 3K1PA 2ARTA 1T39A 5L3EA 1IF1A 2EV6A 4P9UA 1FBQA 3JAMZ 5E18F 4RB3C 1Z7NA 3NETA 1AOYA 3J81K 4J15A 3K1MA 1LOJA 4IRGA 1ZG5A 3LQQA 3FXQA 3I7FA 1MJAA 2PEXA 5D5UB 5J6XA 1MGTA 1W66A 3VQVA 2VC0A 2VXZA 4DPGA 4QVCA 2Q7HA 4MTEA 2M8EA 2Z5UA 4XTZA 2G7UA 2JPCA 1ZGAA 3LSSA 1KA8A 4GXOA 4ZYEA 1NHAA 3M4PA 2HQRA 2ZNZA 4P71A 3H3UA 1Q1HA 5GAOl 2Q7GA 4BAYA 4RB0A 2STWA 2Q5HA 2DLLA 3ZQ7A 3BWGA 3TQNA 5LJ3f 2HR3A 2UZKA 4KN7X 1Y96B 4Y17A 2KJBA 2E10A 2QHTA 1SD7A 1M8VA 2H6CA 1TBXA 3REUA 2CWEA 2FXAA 2H6BA 5ILVA 2YLCA 4AIHA 5LRSA 3BFMA 4M7DE 3EETA 2CYYA 1ON2A 2XUBA 1LNWA 3SZTA 1IZ1A 1PDNC 1Y96A 2NS0A 2STTA 3M9AA 1Z7UA 3QP6A 5HOOA 4YPFA 1ZHFA 3VQXA 3ROUA 4PJOD 4A54A 3ULQB 2OBPA 4BYYA 3PCOA 1BN5A 1X56A 1ATIA 5J8CA 2IP2A 1LDKB 4OIQF 3JSOA 2PFBA 5DY9A 2G4CA 2GA1A 4WXCA 4HLYA 1I5LA 2V1DA 1RUNA 4XEMA 4H02A 4WF2A 5GAN2 1EOVA 1XN7A 4P72C 2R3SA 4A0YA 4L0ZB 2QLZA 3JCMQ 4X5OA 1NYRA 3LSQA 4UNOA 2FOKA 4O6JA 1OYWA 2PMUA 2XAGA 4MEYF 3COAC 2EFWA 4JLIA 1TQIA 2F5DA 4BQAA 4I2OA 2GWRA 4KYWA 4M78F 2OQRA 1UHWA 2W25A 4RAYA 1E22A 3CUQA 4YP0A 3V7CA 3R0AA 4XSXF 3HTUA 3PZCA 3RERA 3QO8A 1BI3A 2EA2A 5FO5A 4CH3A 4YFKF 4YRLA 4EV0A 1V3FA 1QBJA 4M78G 4H2TA 3S2WA 3GWZA 1BI0A 5GANf 4IPAA 1FP1D 3F21A 2O8XA 1ZLJA 3HRTA 4YRKA 2CQKA 2QENA 3GZ5A 3QPTA 3T8RA 1ZG1A 4YRNA 3BP8A 2VC8A 4H0EA 2MA3A 3B02A 4OIOF 4KIBA 4K2EA 4M6YA 4YCWA 3E5XA 1HTTA 1BJAA 4LK1F 2K4JA 2GA2A 4CS2A 3GF2A 3BZ6A 2ARSA 3QO3A 4FHTA 4EM0B 4YYEA 4M77E 3FHZA 4XU3A 1X01A 1IN5A 3EDPA 3P9KA 1G5IA 3F3XA 4BW9A 4ON0A 4HX7A 2B0LA 2XAQA 4MNUA 3HRSA 5LEJA 4XU1A 5DYMA 1DUXC 4PJOA 5IT9K 5H20A 1TQPA 3DP7A 5CYVA 4TVAB 4P3NA 5F64A 1KMNA 4PNOA 5ILUA 4LD5A 2RQPA 5CLSA 5DD4A 3R0JA 3GX4X 3WG9A 4UHTA 3H92A 1RIQA 1K78B 2PMFA 2L54A 2CIMA 1SERA 2DJZA 1PYSB 5JI6A 2O03A 4TVAA 3HOSA 1HBXG 2DT5A 2YX4A 1JRIA 1K7AA 2D1HA 5D6FA 4L9VA 11ASA 1JHHA 4KR2A 4N0AA 2DQ3A 1P4AA 3QP5A 2WWYA 4YFXF 4YIFA 2V6CA 2DZ9A 4RGSA 5E8GA 2XAFA 2YR2A 4LB5A 5F6FA 3HXUA 2BV6A 1LEAA 1FYFA 2L01A 2FE3A 3VODA 3RL6A 3SWNA 1IN6A 1B9MA 4P3PA 2CW0F 3BPXA 5HS8A 2XV4S 2K02A 3MEXA 1X2HA 3GIBA 5DCMB 4HF1A 1TLHB 4G7OF 2MH9A 4WXHA 5ICCA 1ODDA 2EV0A 2RN7A 2W85A 1J0RA 1T0FA 4YRRA 3RKYA 2EFQA 2E41A 4F7ZA 2ZBKA 3HXWA 4G84A 1IUYA 5DCMA 4GYGA 3VEPA 2HDCA 1PP7U 1B76A 3MAJA 2FF4A 5AIPA 3J80Z 1S6LA 2HWVA 3NEUA 4XLPF 1U8RA 3NELA 5D5VB 3JAMK 4L5JA 3BJAA 1HKQA 1ADYA 3P9CA 4M7AB 3DPLC 2MD5A 4F7UG 3JCMb 4XSZF 4G6QA 2P6TA 4RCBA 1F4KA 3TGNA 5FLXZ 3JB9J 4UVCA 2H09A 1D5VA 3C7JA 3WTVC 1FT9A 5GAN4 1BC8C 2MBFA 1UCRA 3RUXA 5E3IA 1WU7A 4ENKA 3QNEA 4KICA 5LJ5f 4K87A 2CGPA 4EGYA 1S3JA 5K5RA 4C92C 4CH4A 4R79A 1HW5A 2L4MA 1J75A 1R00A 5LHGA 3JCMV 2A6EF 3IWFA 2R7FA 2ZT7A 1D3BB 4IVNA 3JSPA 3HSFA 5HLIA 4XBFA 2Q5IA 1KQ8A 4H2VA 5L3BA 1K79A 4EJTA 4KN4X 4Q4ZF 2ZIOA 2M5WA 1BC7C 5GAMf 5E1WA 3C3WA 1IXRC 5J8FA 1ZG3A 3FIFA 2EAYA 1U1SA 1D3BA 1XB4A 2BE5F 5DUKA 3A5YA 2HTJA 4I01A 4YRFA 3GLXA 4WXDA 4PJOE 1Y0UA 1I5ZA 5BMZA 5GMKm 5GMKh 2VE8A 3TO6A 2RC4A 1EVLA 2J5OA 1R7JA 3V7RA 4P75A 4HAMA 2FEZA 4M75C 5HDNA 1IXSB 2E65A 2CFXA 1WKMA 3BDDA 2JN0A 3JW4A 3JCMc 4LK0F 3GW2A 2K7LA 1YFTA 2OQGA 1Z6RA 3MCZA 3E6BA 2ISYA 3KFWX 3EYYA 5GANd 5K1PA 4RAZA 5DCFA 2VXFA 3E6MA 4M78D 4G7HF 1LEBA 4OIRF 1R58A 5CVUA 4XU0A 4UP7A 2H27A 3TEHA 3BJOA 1R5GA 4M7DB 1UHMA 3WTXC 3NENA 3DFGA 2J5PA 4M9ZA 1CGPA 1G4DA 1YYVA 2M1BA 3I0TA 4HF0A 2UXXA 4N0BA 3F23A 2DBBA 1BIAA 3G3ZA 4A5NA 4HW0A 2KKOA 2FA5A 4LFUA 3V8KA 1N9WA 5GAN6 5GAMg 4HV6A 2O6GE 2CGHA 3N4MA 4ZH4F 3INZA 1BI1A 4A12A 1O3RA 1BBWA 3QOPA 4KMUX 3LA2A 3R4KA 3A32A 5LHIA 3FZVA 2DQRA 4PDKA
chains in the Genus database with same CATH superfamily
5JR3A 3C18A 2R0QC 3L4GA 1UGVA 4YIIA 4JQFA 3SZGA 2RJCA 4XKCA 1WHLA 1SRMA 3OB9A 1XGMA 3F0CA 1VTNC 3EUHA 1HCRA 2Z0WA 4CYDA 2ZT6A 4BDZA 3H8ZA 1OEBA 4RG2A 2KHMA 4IQ4A 1GT0C 3ZQIA 1PUEE 3G4SI 4Q5SF 3IH4A 2XK0A 5KYUA 1FY7A 4AVPA 2EIMH 3ZCOA 2BOLA 3U1DA 1G51A 4M77B 4NBQA 1W1FA 4J9EA 2DERA 1PWTA 1AHDP 3GFLA 2CT4A 5HK3A 1G59A 2DLPA 1BBYA 2LY2A 3J7AY 2K27A 3DXJF 4XLAA 1KYWA 1YW7A 1U6GA 3H6ZA 3X26B 1JKQC 4M75F 2XI9A 1X4PA 5E1ZB 1N78A 1TWHJ 4EMKB 2XASA 2PUOB 1TUGB 2OTJQ 2O8KA 2DDAA 3CCRI 1TWGJ 1MNDA 2DKGA 2EYQA 2QSFX 1QO0D 4PSWA 4AYBN 2K2VA 5CQGA 1R1VA 1H4TA 2CV1A 2JTVA 2DCEA 1MKMA 4RTZA 2EB7A 3DTKA 2QG9B 3KEQA 1J5YA 1U5SA 1JGSA 3BY6A 3VQWA 3E5UA 2VQLA 4DGWB 2YHTA 4Z88A 3V8JA 1FJLA 2TCTA 2RVCA 1VQ6T 2K9QA 3ZN1A 1USYC 2ACJA 4IEJA 3NRVA 4EJWA 1M1EB 4GGGA 2KNBB 4K11A 4OMFB 1G5VA 2CQQA 1OYIA 3E9GA 2EBPA 4G6TB 3EGXA 5JVTA 2XKPA 3WHBA 3ZMVA 1O3TA 3E19A 4IRHA 2FO0A 5IT9E 2Y4XA 3WE2A 3G6EQ 2XGXA 4OB3B 2LQKA 2M02A 2K7AA 2XGCA 1LNXA 4LD6A 3QDRB 1YE9A 4OINF 5IP6A 1X55A 1H9TA 1OCZH 1OULA 1UHCA 1NJ2A 4H2SA 2ELHA 2W82A 2Q0OA 1QF6A 4FT4A 3F8FA 4IF4A 3UATA 2DTHA 2XHKA 3KX2A 2GXGA 4J19A 3I35A 3OA6A 4YDQA 1KU7A 3BR1A 2K6DA 1IDZA 3LL7A 2O4XB 2RGVA 1VQ5T 2MC3A 5GAOn 1O3QA 2JA7J 4OP0A 3QU6A 2XG8D 1IL2A 5J47A 2EKHA 3VFZA 3VS2A 3HKZN 3DWLE 4U88A 1V1CA 4RMNA 4ZYGA 3HFNA 5E3LA 3I56Q 4AU7A 3JAME 3WGGA 3GZNB 3DQVC 3X25B 5C4JJ 3KLOA 2COMA 1SRLA 1U9NA 2XKOA 1LE8B 1S7EA 3OYLA 3A1YA 1Y71A 3A8MB 3HHGA 5K1YA 2CQNA 3M3YJ 3EUAA 2YUSA 3HPGA 4L0YB 2J3LA 3HRKA 5AONA 5TGTA 5IP7J 1XJWB 3BZCA 2XAJA 3BDLA 4B1RA 1ACMB 1OLTA 3DBLB 4JZ3A 2EPDA 3O8HA 2OV7A 4BQOA 4YG2F 1YRNA 2LQWA 2RQUA 4O5VA 3CCUT 3PNVA 3CQZJ 2XPUA 5AT1B 3CCQT 2CS3A 5J1RA 1TWCJ 3NTKA 3M57A 3K4NA 1LFBA 2GOMA 2NUTB 4JS5A 3PUFA 1RABB 1O3SA 2LF7A 1MBJA 1NG7A 1YB3A 2A05A 4DYCA 5LJ3d 3KEOA 1KU3A 2LK2A 1FOKA 1RAFB 4ESFA 2NNYA 3DF8A 1NK2P 3KXTA 1HKTA 5KE3A 3EAEA 2VJ4A 4H2UA 2O9VA 4A6DA 2TDXA 2JQ7A 2CP0A 1RRJA 2DBMA 2K4YA 3META 1M2VB 3Q0VA 2NOGA 2KIUA 5E20A 3QZ5B 4DOVA 1SEMA 2QEXQ 2FUG2 3H41A 2QTXA 1LDDA 2L7MP 4GFBA 5IN1A 4LJZF 3HTZA 3E6DA 4I0AA 1AZEA 5LGNA 2WTEA 2QHVA 3D5LA 4RBOA 1K73U 3HRUA 5F27A 3R60A 3UFGA 1XQHA 3FKJA 2VJJA 4J6XA 4P73A 8ATCB 1M90U 1IG7A 4OGEA 2FG0A 4A0XA 4KBMB 2NWMA 3GBGA 1R4MB 3BW1A 4AMCA 2JT1A 4AWXB 2FHDA 4LDYA 4TTVA 3EG9B 3P7NA 2I4OA 3I53A 1I39A 3LLRA 2O5RA 4BE1A 4B9WA 4N4NB 3MQZA 3QPLA 2YS9A 2CSOA 3KYDB 2YU3A 2NUZA 4LB6B 4QTRA 4OMYA 1M4ZA 1I1GA 3M0UA 2ODRD 3HKZA 3L4GB 3W3CA 4HDUA 3RKQA 2M45A 1IUFA 2BZXA 2C6YA 2COYA 2NVYJ 2M0CA 3CCRT 4EMHA 2PQ8A 2NYSA 4HSTA 4W97A 4HCCA 5EZGA 3RR6A 2HKOA 3RKXA 2CO5A 2RDPA 1N77A 2Y9ZA 1APLC 3I55I 2DETA 4N4GA 3LAJA 5CVIA 1BR4A 3JB9F 1MH3A 1B72A 5DDGA 1H9GA 2L2PA 2KISA 3BT9A 2QHSA 2QGGA 5GTHC 1DU6A 5L3DA 1NYGA 3CMAQ 2LOOA 4HF2A 2QQ9A 2EL9A 5DV5A 2KDSA 1E1TA 4M7AG 3H1CA 2W1OA 1ORKA 1M3CA 4M78A 3KP7A 1WHHA 5FLXE 1SFOJ 4WJ3M 3K70D 1VQMI 1R1UA 3UDCA 5FFZA 4ZTZB 1ERDA 2EV5A 3VYTB 2JZYA 5GJVB 3G71A 2DTRA 4GO1A 1P9QC 1TT5B 1L0WA 3S6WA 5D5WB 2E5AA 3DKWA 4LDUA 3IWZA 4Y91A 5K5QA 1ONVA 1TWBA 1M5Q1 3VS6A 4EX5A 3QIIA 3LWHA 1STZA 1YP5A 2H8HA 2RNAA 4M4ZA 1QCOA 1Q1VA 4J9DA 1YJWA 2LFBA 5JLXA 3PT9A 2WAQN 3ECOA 1SD5A 2VI6A 2I4NA 4PUSA 2IPQX 3U23A 1YHQQ 3OBYA 3HKSA 3FMSA 4P71C 1X27A 3OMGA 4RA2A 2FZKB 1WJBA 2BEOA 3TUPA 1TWFJ 1KFZA 4C8QE 1QVTA 4FTHA 3L2RA 4AIKA 3LAPA 3TP3A 3FK7A 2V9VA 2L3QA 4M7DG 1ZBJA 2MPXC 5ECAA 1W7PD 1G2HA 1QZZA 4UUTA 3I59A 3EGXB 3ZMDA 5H2FC 4HLXA 5KK1A 1TOVA 4EVIA 1QHGA 3G1LA 2JA5J 1AU7A 1XDUA 2JS2A 1DPRA 1Q7YU 1USYA 3E97A 2RHSA 3Q3SA 4CC3A 1SRYA 2DNUA 4AIJA 2OC6A 1VQ4A 4S04A 2L7ZA 4IURA 2F4MB 2VASA 5GAOr 3MKWB 5J26A 2KVQG 2D45A 4AD9A 2JRMA 3BROA 1JXOA 3QO7A 2DVJA 5CKHA 2DTIA 2FSWA 4DEXA 1FX7A 1YX5A 2ZSIB 4TQDA 1YJNQ 2F2VA 4B44A 4KGZB 4LIVA 4NL2A 2DOAA 3G7ZA 1QVPA 2JXBA 2JSPA 2L9RA 1JEGA 2M3AA 2DXTA 1QW1A 5LJ3g 4IHTA 4C9YA 1TWAJ 1ZUKA 2QZ8A 4F04B 1W0TA 3FJPA 4A3EJ 2J05A 5IHNA 3OY9A 2RI3A 4D5FA 2A5YB 3E6CC 2MLGA 4EM1A 3RKWA 2VKHA 2OJ2A 1J3TA 1RUOA 1X3WB 5C51B 4XTVA 4PJOC 3QO5A 2GQQA 1HF0A 2UXNA 3MKDA 2VQCA 4J6YA 3QTCA 1XGNA 3CCJI 2FPEA 3MQ0A 5J1YA 4NHJA 3ABLH 4BUPA 3FXUA 3NHNA 3WQZA 1XOVA 2E19A 1OQYA 1GV5A 2Q8KA 4M7AD 4II3A 1D3YA 3F6OA 4D8KA 1UGQB 4BDYA 1CSKA 2NAZA 4RS8A 5A2QK 1PYSA 4KDPA 2DJQA 5GANg 1RAIB 5EDNA 1YRNB 2R57A 2YSRA 4CS4A 2V1XA 2OI3A 3DEWA 2RN8A 1VQKQ 3QZ9B 1G6NA 3IAS2 1OPLA 1T0FC 3OSVA 1FWZA 2WAQA 2XIGA 3HTSB 4YRMA 2EBIA 3LFKA 2CYZB 2F2XA 4J01A 2KJCA 3MHXA 5DS9A 5E3OA 3GTOJ 1PRLC 2O2OA 3R6SA 2CH4A 1O4XA 3CXCP 1QMCA 1PG5B 2E3IA 2E1OA 1VQ7A 4J6WA 2LRQA 3BG6A 1OU9A 4ESRA 2NYXA 2WAFA 1XMKA 2VKEA 2AXLA 2RI5A 3L2ZA 2QDLA 9ATCB 2JA8J 4XK4A 4BACA 1WJFA 4C8QD 4KGXB 4OU0A 3L2CA 3QSUA 2F6CA 5I21A 3GXOA 1E6HA 3K4MA 2QA4Q 2JSCA 1MJ9A 2PMEA 1EJ9A 4M7DD 2A28A 4A3KJ 2DU5A 5EYRA 3K7AJ 1FBUA 3IKTA 3K4CA 3BY7A 4LDVA 4UC4A 4PJOF 3HUGA 2B8AA 5IHIA 3DLLA 3R6NA 2OTLA 2P5IA 2DL4A 3AFHA 1SFXA 1X1DA 1T3LA 4M75B 1KQ2A 4P1WA 2LY9A 3P9IA 2AS5F 4JRIA 2CMPA 1FYLA 1BI2A 4JLGA 4BD3A 3A03A 4LG3A 2DAOA 2EYYA 2A07F 3CO6C 1TNSA 2ESNA 2PLYA 3M56A 3HFOA 3PTAA 3HY1A 3OW2P 1B7YB 4CS3A 2COWA 3JRBA 1VQPQ 4FM4B 3Q5FA 2DA4A 1NH3A 3J7AO 4L9NA 2RF0A 4A3MJ 5A0GA 3EYIA 4LE9A 3CBPA 1R5ID 1GL5A 3ZL7C 4I99C 2W24A 1K4SA 1IRGA 2FPDA 1WNLA 3M0QA 3BR0A 4QPQA 5FD5A 4Y92A 1XSXA 2LCSA 2HSEB 3A31A 3ECHA 5ELNA 2LG4A 4LNSA 2O31A 3ABTA 2LX9A 3CP8A 3G73A 1KQSP 4IHWA 1Z7LA 4BH9A 3TSZA 4YRGA 3V4GA 2DI3A 2ZNIA 1RAHB 3WVEB 3CCMA 4WK8F 5IOYA 2PJRB 2L7FP 3EPZA 5L23A 5D6XA 4DYQA 4B9XA 2PZ1A 4TQFA 2FJ1A 4RDUA 4IIMA 4OAZA 2RO0A 3JB9I 1QVGP 1JTYA 4U87A 1U5TA 4C5HA 4D6WA 4MQ9F 2XGDA 1QRYA 1BK2A 2XTIA 3CD6A 1T38A 2QAZA 2XU8A 3OWTA 2RA2A 4PHCA 2O61A 2VYTA 4HQEA 3P5JA 2KR3A 3Q0UA 2DMTA 1ZTRA 2FRYA 2SEMA 5KHDA 4A4FA 2RHQA 2K85A 4LVJA 3E0JB 2EV6A 4P9UA 2E2IJ 3NETA 4QW2A 1AOYA 2KL4A 3THKA 3VKIA 4J15A 4JZ4A 3GMEA 1OPKA 5J39A 1VYVA 2PEXA 3FC3A 1ZKGA 4FETA 1ETYA 1MBKA 2M8EA 2JVVA 3G71T 2IG0A 2BIVA 3MO8A 1ZGAA 4ZYEA 2W10A 4ELYC 4CRIA 2HQRA 4P71A 3H3UA 1Q1HA 2Q7GA 2Y31A 4F93B 3QJ6A 2CP3A 2MAMA 5CQEA 5J4YA 2KJBA 1M8VA 2H6CA 1TBXA 2LJ3A 1N8RR 2H6BA 4ZGEB 2CYYA 4AT1B 3H9JA 1YJWT 2STTA 1MSFC 2M0OA 1Q86C 2X85A 2GIZA 1D5YA 2AXTC 4FYVB 3PO3J 4F17A 5IH2A 2BXZA 2CZ6B 2XHCA 5F08A 3ULQB 4BYYA 2F4OB 2IP2A 2LVMA 2MW8A 3JSOA 2DA1A 4WXCA 2IS4A 1W36D 4HPQA 3CPWA 4L0ZB 2QLZA 2GNCA 1VQ8I 5D6YA 1ENHA 4UNOA 2K5FA 2EFWA 4KITB 4I2OA 4KYWA 1Y6IA 1UHWA 4RAYA 4XSXF 3QOEA 2XIDA 3RERA 2EA2A 5FO5A 4PLLA 4CH3A 2EZIA 2OPTA 4M78G 3S2WA 1BI0A 2R7WA 4GDFA 2MGQA 2O8XA 1I50J 4YRKA 2CQKA 2QENA 4RLQA 4MLOA 1WA7A 4QIWN 2MA3A 2OCEA 4IZZA 4YCWA 3E5XA 1JJ2P 2GA2A 2ARSA 4FHTA 3FEOA 4M77E 4E2FB 4XU3A 1X6GA 1ZX6A 3LSHA 3EDPA 1G5IA 3WXMB 1W2BA 4BW9A 4HX7A 3ZQLA 4XU1A 4PJOA 1WXUA 3VSKA 2NVTJ 4LVIA 2ZPBB 3OR2C 4P3NA 3H36A 4UHTA 3H92A 2LKSA 2L54A 1I3QJ 4L6V5 3JRDA 4A4KA 1KONA 1PYSB 3HOSA 2GBYA 4NNJA 1JB0E 2YX4A 3JREA 1JRIA 1K7AA 11ASA 3OYBA 1UJ8A 4KR2A 3EUKL 3I3LA 2V6CA 2DZ9A 4KT0E 1LVKA 4LB5A 2BV6A 4NC6A 2LJ0A 3W6VA 2R5ZA 9ANTA 2FE3A 4CCMA 1B9MA 2ROTA 1RR8C 4LXCA 1AZGB 2WADA 2XAUA 3MEXA 1TU0B 2VGMA 1TLHB 2KE9A 4IUPA 1OI1A 4RTYA 2IS1A 2RN7A 1GLNA 4NC8A 1T0FA 1WJRA 2E41A 1O9SA 1ABQA 1PP7U 2DO3A 1B76A 3MAJA 2QDYB 3ASOH 5AIPA 2JNGA 4HNUA 3J80Z 4XLPF 2QCOA 4Y52J 1MBGA 1QCFA 5D5VB 2ZB9A 2ZMEC 2ZXWH 3PSFA 4DZPA 3BJAA 3P9CA 3BE3A 2MD5A 1H3HA 4F7UG 4XSZF 5CIUA 2LDMA 1T0HA 2E35A 2ZXHA 1BC8C 1X2QA 2F1LA 2L3PA 1YFNA 1WU7A 1ZHIA 3HUGB 4K87A 1ETQA 5K5RA 1RI0A 2L4MA 1J75A 2A6EF 4XL9A 2CUBA 2EQRA 2IGNA 4IVNA 5HLIA 4XBFA 2Q5IA 1KQ8A 4ZGJB 4H2VA 4BUGA 4IQJA 5FU7C 3C3WA 1U1SA 5C6SA 5IY5H 1KQSA 4KUDK 3GLXA 3MKLA 4WXDA 1GBQA 1I5ZA 4Q5WA 4ORZA 5GMKh 2ZFUA 2AO9A 1K83J 1R7JA 1Z67A 1QVGA 2HSPA 1IXSB 3BDDA 3JW4A 1CQTA 1M9SA 3JCMc 1M90C 5F0HA 2OQGA 4FIBA 4NUBA 3QYGB 3CCSA 2VKDA 3E6MA 1TL8A 4M78D 1LEBA 3ZQGA 3CLQA 4E7LA 4XU0A 2OTLT 2DJIA 1NEBA 3TEHA 1R5GA 1V5FA 1IJWC 1CGPA 1G4DA 2RH2A 2KI7A 3S17J 1MUZA 2K5CA 3OYKA 3F23A 4J8OA 3VV0A 3TL4X 3TW6A 2E6NA 2K9MA 5GAMg 2QTVA 2O6GE 1G2BA 4ZH4F 3CCUQ 1O3RA 4JX6A 1PHTA 4KMUX 4M3DA 3SDBA 5LHIA 3FZVA 2E12A 2DQRA 4PDKA 4CZCA 4OAYA 3RPUA 3BG9A 3OYJA 2VE9A 2VBZA 3AG2H 3MF1A 2KRHA 3BJ6A 5HDGA 2ZZDA 5DUIA 5GMKe 4CHUA 3L42A 1MBHA 1B34B 1BM9A 4HT8A 4FISA 4YRIA 5I2SA 3AG4H 3KYLA 2RQQA 2DPUA 2BBYA 1GBRA 1WWXA 4RMOA 3MF2A 1R36A 2ZXJA 1YITI 1VQLQ 1N5ZA 3DKMA 2LSOA 2KT8A 2VC1A 3CESA 4XTUA 3REAB 4C92G 2R7ZJ 5BS6A 4AFZC 2Y48A 4A0ZA 2R7XA 3C12A 4LN2A 4GCVA 3TKYA 1WIEA 1VIFA 5CVVA 1Z1DA 5CKDA 3JRGA 2O9LA 2ZCFB 1PSEA 1UG2A 5LGUA 4TWAA 5LLQA 4BXXJ 1WRJA 2DX1A 2GM4A 1VQ8T 3CCMT 2ODRC 1FTZA 1JJ6C 1EH8A 3TOBA 1BBZA 1YIOA 4FT8A 1TTYA 3VOEA 4LLNA 2I0NA 2EA4A 2SRCA 3BCBA 1WI3A 2R5AA 1SVLA 4AFSC 5L3GA 3A98A 3G4SQ 2ETHA 4C2MJ 4NS5A 4ENNA 2JMWA 1FC3A 2L02A 3CD6T 2ELKA 4CI0C 3TVTA 3CCSI 1W2BS 1UUEA 3CMEI 1TP4A 2WY7Q 2EQIA 2DFUA 2QQ8A 2OZUA 1B8IA 1N27A 5HNHA 2P0LA 2ZZEA 3Q1JA 2HQHA 1EQRA 1WZOA 4YRJA 2ZXFA 5IYCJ 3UNGC 3M54A 4BS9A 3OYDA 1ULYA 2XD0A 1SEUA 4M72A 1JU5C 1WHMA 3TOAA 4X9CA 4BEHA 3M8FA 2LBFA 4A63B 3K70C 1QVFA 1WHKA 4ZIBA 1QZEA 2WSFE 1WI7A 1UJ0A 2HL3A 1OR7C 3B6CA 3LYIA 1C0AA 2RI2A 2M87A 4A2UA 1MNMC 3CTAA 2KLOA 2O88A 1AOJA 4NOYA 1KSWA 1TTHB 1Z91A 5FKNA 4KH1B 4MZMA 3P8DA 3A8LB 2LJ1A 1I27A 1I6XA 1DGWY 3QXEB 2VOOA 4P96A 1MMAA 5ICGA 2MFZA 1R1TA 1R6RA 4XAXB 3OOPA 4HVVA 2ZFWA 1D1AA 5EEHA 5D6EA 5F0CA 3HP9A 4YCVA 2KRFA 4XLNF 2DO7A 2CH0A 1JT6A 4PCQA 3JCMW 4WCGA 2RK1A 2E3CA 3M4OJ 2DMNA 4EGZA 1QQIA 2DA9A 2QQBA 3SEZA 3EH2A 3EG3A 4M77F 1S29A 2DXIA 2CJ9A 4B43A 2L9VA 1LYLA 4PJOB 1B8AA 2FNPA 4YTLA 2VONA 2IGMA 3PIPA 1SANA 4G94A 1OYXA 2WB1N 2DTOA 4MIMA 3ZR8X 3VQYA 2DT7B 1Z7MA 3P8BB 3FMQA 4ZZDA 4DOZA 1T95A 2E34A 1BBUA 3WTTC 2V8IA 4HT9A 3C1DA 4QLCU 1UB4A 2K3PA 2R7OA 2KIQA 1WFXA 1YG2A 2K57A 2NS6A 3CCVI 2R5ZB 5DLQE 3M58A 4F55A 2X48A 3PL8A 4OB1B 1TT0A 5CKTA 4C92D 2H3EB 3IV5A 4RQFA 5HS9A 1OCCH 2Y0SN 5FLVA 3M7GA 3KZYA 2AMCB 4RMFA 2DQ0A 1ZGJA 3E3VA 1A04A 3WVDB 3QBYA 3KP4A 1YFHA 1KOGA 4EATA 1E7OA 3MVPA 4UXNA 4FYYB 2DL3A 2OA4A 1GXQA 2CG4A 2P84A 1UJYA 5HVQC 2YUPA 1Z21A 2JK3A 4HEA2 1YJ9I 2HNIA 4HKEA 1RESA 2NVXJ 2R7DA 2R5YB 1OV3A 3CMQA 1Z9CA 3J81Z 2CKKA 2BGCA 1QU3A 6AT1B 5FKOA 4CXFA 4HA8A 1XGSA 1IV8A 3A0BC 12ASA 1N25A 4PJLA 3OV8A 2F5CA 5HS7A 5CAIA 2LNHB 3HOZJ 2DPDA 2P4TA 3EG0A 1VQNI 2K9NA 4M7AC 1HW2A 4ZNXA 2RQTA 1O75A 1Y8RB 1JKRC 4N4HA 5M5XJ 1JJCA 5BPDA 2OTJA 4H2WA 1P92A 4FU6A 4RAGA 5M5YJ 5HLTA 3QHSA 3O5ZA 1ZRFA 1YW8A 4UVAA 3FWEA 5CO7A 2AK5A 4UV9A 1IRFA 4RB1A 3H0DA 5E8IA 5H6RA 5LJ5h 5LBQA 5J1UA 4C0DC 2QYZA 1OX9A 3OYHA 5LJ5j 2XVCA 2CUEA 3FXLA 3HXVA 3GFIA 3JRFA 4NB5A 1SETA 2HYFA 2OAUA 3TEHB 4P5OA 4PSXA 2A3SA 4CYCB 1C0WA 4ZYDA 1H4QA 1UMQA 5D6WA 1ZSZC 5GAMj 3GFJA 3CO7C 2Q2EA 4E4HA 3VRZA 1NNHA 4EM2A 3ICAA 3IALA 4NCXA 1XPXA 1HDPA 3JCMJ 3N05A 1KIKA 3AHUA 3I5UA 1HC7A 4JJNK 2QQAA 4QQGA 4C8QC 3HRMA 2O9SA 2QKLB 2KXCA 5CVJA 3E9IA 3MN2A 4UUVA 4LLLA 3WTSC 4M7DC 3GYHX 2E5KA 3G6EA 2FU4A 2CJAA 3HFZB 2QBYA 2PMHA 3LMMA 1BW6A 1UFFA 2VB6A 5TRDA 1VQ9I 3S32A 5GMKi 5ED4A 2FNAA 3CCST 1WSUA 3CMET 4DBFA 4B09A 2XB0X 4BNCA 2LKPA 4RM2A 2E5QA 1KD1U 4ZZLA 3FDYA 2FBHA 1NJ6A 2E7XA 3D0SA 1K9MC 3EUHC 1IGQA 5IYBJ 4H2YA 3J80E 2MWPA 1XX5A 1U06A 1SF9A 3HEFA 4D7MA 4A3BJ 2DL8A 1KK7A 3KEYA 1Q82R 1ZRCA 2DXBA 4P5NA 4O2DA 4FX4A 4B3XA 2B86A 1EH6A 2V9KA 1XMAA 3ZN0A 4I0BA 2XB5A 5CVRA 2E1HA 4OB2B 3UPUA 1MH4A 3CCLI 4E47A 2AKLA 1Q95G 2OTJI 2OX7A 3FXMA 3I55Q 4DOWA 3W2WA 1ZYRF 3I56A 4LUEA 2F48A 1B70B 1W5CC 4CO8A 4R1HA 2H94A 4HRIA 2DFHA 4R0KA 2EQJA 2PN6A 4E6KG 1RLPC 3UWNA 4YROA 1BCOA 1NYQA 2LMJA 4E7HA 2QGFB 4M75E 2HOSA 1VQMQ 1E17A 1TH7A 4D0PA 1AVZC 4DW6A 2ZTGA 5TJJA 1X2GA 4V2SA 4DBHA 3A2KA 3D1NI 3ZQFA 2HDAA 3CC2Q 5FLXK 2B9SA 4BEHB 2DK8A 4J9IA 1YTYA 1VYTA 4V2GA 4NL3A 3JCMX 2GFUA 3J7AF 4J9CA 2QHUA 3GTLJ 5FGMA 3LWFA 1P2FA 1OMIA 3WU0A 3MPUB 1VFCA 3W6JB 3PIOF 3TEGA 1H8KA 1R9TJ 2DIGA 2ME0A 4QVDA 2EZLA 3TQ7P 4YFNF 5LJ3h 2JJ7A 2ZCWA 1OR7A 2E6ZA 4A53A 2GOXB 1F36A 3LW5E 3MMYB 3RDVA 1SKUB 1EH7A 3UF4A 3DSQA 1WZ2A 1X3ZB 1GHCA 1RLQC 2YLBA 4C5IA 4HX4A 2AKWA 1OPCA 2VUMJ 2E1CA 2Q1ZB 1BJZA 1EFWA 2RJEA 1YWPA 2QEXA 4LITA 2A61A 3CUQC 1ZA1B 3HXZA 2H8WA 1J5WA 4B47A 2JVHA 3NWSA 4BE0A 1UDLA 4P9FA 3I64A 3C2HA 2IVMA 4OMQA 2RNGA 2X1EA 4X34A 3M0RA 1OCTC 2HDWA 1WJDA 1Y56A 3MFKA 3HBLA 2VBWA 4Z8AA 2OU2A 2FL7A 1U2WA 3SHFA 5C4XJ 3ME9A 4D1QA 3TDZC 3OS0A 4PFOA 3UKGA 1QA6A 4ELZC 2JMAA 3H9GA 2ID3A 3BR2A 2ZJPF 1Y39A 3URGA 2P5KA 4J83A 1W7PA 3DTEA 5LHHA 3C94A 1W5TA 2DFFA 1B07A 1YOVB 4I7HA 5DEQA 3FMRA 2W57A 5LJ3e 2HZDA 4PKCC 1BW5A 2P5VA 1K8AU 2KIMA 1KHIA 1B7TA 1KHCA 3VBBA 3LSMA 1AKHA 1W36C 1EFNA 2G0EA 4IOAF 3PSIA 1ZN2A 2V26A 1D8JA 4GYIA 3GTGJ 1UGPB 2YUOA 4N0AC 5JHUA 2K9LA 4CC7A 1MW7A 1W5SA 1DP3A 1MD0A 4GLKA 4OMZA 4M71A 3RGLA 3S3MA 2GAUA 4L87A 1JHFA 2F4IA 2BY3A 3RF1A 5GAHJ 1IHVA 2CRGA 1KGSA 4FSSA 2JM8A 3CCJQ 2DOFA 2IY5B 2ATCB 4DNCA 1BKBA 3CMAA 4ZTUB 4OVAA 1MHNA 1P7IA 5LGTA 1ARKA 2ZMEB 1WQWA 4IO9F 3IL2A 4CGZA 1FPQA 4M9XA 1GXIE 1JBMA 2RREA 3HPWA 2BY1A 2RQVA 2HDDA 1J9IA 4U7BA 3TU4K 4XLEA 2VT3A 4IHVA 1QCNA 2KBTA 3EFOA 2VV5A 2HEOA 3K1NA 1MV3A 3FJ5A 3H9NA 1N9RA 1VQ5I 2BYVE 4Y15A 3HG9A 4M7AA 3TO7A 1X75C 5FU7B 3SEQA 3SJMA 1S72I 3VSLA 1ZLMA 1LPQA 1HA8A 3HOTA 2YSQA 2X3XD 1IN7A 4EMSA 5HODA 3FRNA 1YHQA 3M8EA 2OAWA 4QQDA 2ALYA 1SC7A 1YW9A 1HSJA 3L9FA 1P7JA 3P8YA 3UGTA 3QRFF 3TEEA 2J6KA 5CK9A 1JXSA 2XAHA 5GAOm 4HWTA 2MSYA 1FBSA 1EIYA 2Q2EB 2ZZFA 4ANJA 4M73A 2QVOA 2MMPA 4I98B 3T1BA 5EG2A 4P73C 2G9WA 3SEMA 3RQIA 2OTJT 5TISC 3GP8A 5FW9A 1U78A 3AAFA 1W4MA 2X9HA 1ZSZA 4WI1A 1TG0A 4RTWA 5EGOA 3UR3C 1XS9A 2E4HA 1IO2A 3WTZA 4PJMA 3CCQI 3SYTA 1K73R 1X6BA 3PNTA 1AT1B 3GTPJ 1ZQ3P 3LC0A 1UB9A 1YI2Q 1E3PA 1SVMA 4CH7A 2RHUA 4C8QA 4EIKA 2DF6A 4A6EA 4FE4A 4KR3A 5FU6C 1RETA 2EQMA 1LPLA 2CV0A 3GTKJ 4ZC3A 2I2LA 1PRMC 3EGDB 1L3LA 4UY8I 3CMAI 1A0NB 1JI8A 4M7DA 3VB2A 4XN0A 4FE7A 3S2HJ 1YJNA 2M4KA 3REOA 2COBA 5EEAA 4JRQA 1KQ0A 4EDUA 1X6OA 2FBKA 1O57A 5E3NA 2LC4A 4ZTJA 2RMOA 1Q82U 5KYWB 1P6RA 1I07A 2ROLA 1ITYA 1K4TA 2F2EA 3KUFA 4II1A 4RQEA 4LMYA 2JRTA 3A01A 4A93J 1RC9A 5C53B 4HT4A 3G6ET 1JJ8C 1IN8A 3FDRA 3E9HA 3IKMB 1A6QA 2C06A 2EWNA 1TNTA 3J81E 2D8HA 2RJDA 4Z89A 1TS9A 5CKFA 3FBNB 4H2XB 1MDMA 4BXFA 1K1ZA 3LSRA 4M78C 1H4VB 2RHYA 3MCAB 1CKAA 5B1AH 1WI9A 4XRSG 5E3MA 5BNGA 4U7DA 3CQTA 1X1PA 3A7AA 3U9GA 1MSEC 2XMFA 3KP5A 3L7WA 3SFZA 1G3TA 3K4KA 1YIJQ 3S3OA 2K9GA 1SG5A 1NM7A 2DFEA 2M30A 4FQGA 2JTFA 1NK3P 2X6YA 1I4K1 1ZRDA 3QWYA 2E71A 3SXYA 1TSFA 3A1PA 3CCYA 1IF1A 2BTTA 5E18F 4F14A 1Z7NA 2RQRA 4JX4A 3TMOA 3K1MA 1MBFA 3FXQA 1MJAA 1VQKA 1MGTA 2BE9B 1WJCA 3VQVA 2VXZA 3I56T 3IH3A 3BTLA 4MTEA 4XTZA 4BBSJ 1ACIA 1H89C 3QYBA 2JPCA 4AFUC 3LSSA 1KA8A 4GXOA 1UE9A 1N8RC 3ULRB 3M4PA 4Y4RA 5GAOl 3EHQA 3ZQ7A 5LJ3f 2UZKA 4JS4A 2D8JA 4G12A 4KN7X 2FPFA 1SD7A 3W2VA 4J9FA 4LVLA 5GTIC 3BFMA 2YLCA 1Y1WJ 1BR2A 1LNWA 3S8PA 1Y96A 2NS0A 3M9AA 2F2WA 3C4SA 2K3YA 2ZPEB 4A4EA 1JUPA 4XLHA 3VQXA 3RMQA 3AT1B 4IKFA 4KISA 2CW7A 2WA0A 1X56A 2QQSA 5J8CA 1LDKB 4RG8A 4HCKA 2C0TA 2RQWA 2G4CA 4HLYA 2HD0A 1I5LA 2Y9YA 4H02A 3T9NA 5GAN2 2R3SA 4A0YA 3J7YJ 4X5OA 4O6JA 2XAGA 3COAC 4JLIA 1TQIA 4BQAA 4M78F 2GWRA 2OQRA 3OW2S 1E22A 3CUQA 3PE0A 3V7CA 3R0AA 3HTUA 1Q7YR 3S1NJ 4RTTA 3QO8A 4XIDA 1V3FA 3V42A 1W6XA 3GWZA 4UB8C 5GANf 1FP1D 3UT1A 3HRTA 3QPTA 3T8RA 3L2UA 4YRNA 3BP8A 2VC8A 3B02A 4KIBA 1VQ8Q 1HTTA 2QEXT 3KFVA 4CS2A 3BZ6A 2WV1A 3QO3A 3QYFA 3FHZA 4XK8E 1ZR2A 1PD0A 3H3VK 1VQPA 1IN5A 3ZQQA 4DEYA 1T8IA 4ON0A 4F16A 3ESWB 3AG1H 1FOYA 5DYMA 1DUXC 1X1BA 2V7FA 2A37A 1VQKI 5F64A 3H0HA 1KMNA 2HVSA 4PNOA 5DD4A 2R7SA 3R0JA 2IGOA 3GX4X 4R55A 1S72T 3OS1A 2PMFA 2CIMA 1SERA 4TVRA 2GCXA 1VUBA 1D0ZA 4TVAA 1SFKA 2XSJC 2D1HA 5D6FA 4N0AA 2DQ3A 1P4AA 3QP5A 1MMSA 2X4YA 4YELA 2R7UA 4YIFA 3M8JA 2KQRA 2D0NA 3E1SA 3HXUA 3VUBA 1LEAA 4HVWA 4M3FA 1FYFA 3OYYA 5F04A 3RL6A 4CC2A 4P3PA 1EZZB 2XF6A 2CW0F 5HS8A 4IUVA 2XV4S 2K02A 3DKYA 1X2HA 1V76A 4DIQA 2ZSHB 3H0IA 5ICCA 3MEUA 1WGXA 2LC2A 4F7ZA 3HXWA 5DCMA 2VVKA 4IL6C 2JM9A 3ERMA 3EFOB 3NEUA 4AYBA 1KC8R 1HLVA 3DU6A 4IHYA 4M7AB 3QDFA 3OIQA 2Y4YA 3CP2A 4RCBA 4M3GA 1F4KA 3TGNA 3DLMA 2V8JA 3JB9J 4UVCA 2NUPA 2H09A 3WTVC 1FT9A 3CMAT 3QQAA 5GAN4 5B1BH 3CDLA 1WH7A 1Y1VJ 3SHWA 3PJRA 1ZELA 4ZDOA 1S3JA 2VGNA 2LTOA 3ZEHA 4C92C 4CH4A 1A31A 3KPHA 3JCMV 5DM6F 4PK4A 3IWFA 2DIQA 3KIOA 3EH1A 1D3BB 4RTXA 4C0DB 3JSPA 1HSQA 2X1CA 4EJTA 1BC7C 2X6OA 2AHQA 1IXRC 1H92A 5DUKA 3A5YA 5KCHA 4YRFA 3BZKA 1NJIR 4PJOE 1GFDA 5BMZA 2LZ6B 5GMKm 1WGSA 2RC4A 1ZSZB 4OWRB 2J5OA 1GV2A 4HAMA 2FEZA 3AL0C 2K79A 5HDNA 2ICWG 2JN0A 1YHQT 1Z6RA 3JRAA 1H8AC 3CJTB 5GANd 3G1JA 5DCFA 4Z6YA 3GF5A 4G7HF 1NE8A 2H27A 3BJOA 4M7DB 1UHMA 1WH5A 3DFGA 1YYVA 2J6OA 2UXXA 2FZCB 4N0BA 1C1AA 3BG7A 2NLUA 4HCZA 1NEGA 4A5NA 4HW0A 2KKOA 1N9WA 5GAN6 2YRVA 3VS3A 4DA4A 1YBYA 2KDZA 1QWFA 2CGHA 2QK0A 3WG7H 3O8VA 1BBWA 2V9PA 2HQXA 1FMVA 4F91B 3OS5A 3A01B 1TUCA 1GXPA 2QGUA 4LDXA 2UWMA 4XQFA 3RESA 1SPKA 2XF7A 3ISPA 5ELOA 3ZOBA 5D5XB 1ASZA 2RAEA 2D0QB 2RV8A 1Z05A 1MDMB 4FASD 5D7UA 3MZHA 5HDKA 1X43A 4HG2A 1YLFA 3DV8A 5KYUB 4GLMA 3CC7Q 4G6DA 3IAM2 4CA0A 1U5TC 1HSTA 4P74A 1WCMJ 2W4SA 4M74A 1QP2A 1QWEA 1FOWA 3RIRA 1M1KC 3CC4Q 3QODA 3A7RA 4B8XA 3DLLF 5CPRB 2PI0A 1YCSB 4NDLA 2CJBA 5KCMA 3M5AA 4A3GJ 3KP3A 4XONA 5EF6A 1HD3A 4Y28E 4CC4B 2L8DA 2KGTA 1YNZA 3A4CA 3H5NA 3JCMd 1QVUA 2OAZA 1YITQ 5EEGA 2L2OA 3HOXJ 3ZQCA 3BQYA 4DYRA 3EQLF 2P7VB 1PP8F 1OISA 5IYDJ 3ZP5A 1RIOH 1KZHA 1RZ4A 1WHJA 2VXEA 1S1NA 3OR1C 4ZDLA 3DU5A 2GIVA 1ASYA 5FKMA 1O7FA 3F22A 2ZO4A 4YCUA 4EMKA 1RKWA 2HPIA 2MIOA 2J06A 3PFIA 3EFRA 3F8BA 1LUJB 5J4VA 2G7HA 5K5OA 3S14J 1YO5C 1FYNA 3K2ZA 4LLGF 1ETXA 2CSIA 3VYUB 5GMKl 3NQOA 3QPSA 3VDXA 2ZKZA 2KXDA 1NPRA 4C8QG 4J9GA 1MIJA 3RYRA 1W70A 4IHXA 1R0CB 2P81A 3JR9A 3TO9A 1VQKT 3JTGA 1H641 4BQNA 4L9JA 1E3OC 3AKZA 4CCJA 3VS5A 1XCVA 3CMEQ 8AT1B 5ILSA 4BI8B 5LL6S 3CCEQ 1JGGA 3M1EA 1Q86R 4K88A 3CUQB 5AIQA 1I1SA 1OU8A 2IS6A 2DU7A 5IT3A 2ESHA 3HGYA 4BQQA 4QWQA 4OF1A 1XGOA 2JMCA 1RI7A 1ZUYA 2HVRA 1ZREA 2DA7A 2YRDA 1E3HA 2P6SA 4O3MA 5HLGA 2WY8Q 4F7UA 4WTOB 2ZNJA 2A7YA 2CREA 1NPPA 3DB3A 4DJAA 3KE2A 4BB7A 2M34A 3PM1A 4Y7NJ 2MWOA 4NQWA 2HXOA 4RGUA 2VBYA 2E3HA 2CUFA 3A8HB 3MEWA 4P55A 3CMMA 2CZ0B 3FK6A 4DBQA 3G71I 3VUZA 3HHTB 3PO2J 2FB7A 4HNVA 2VBXA 3BPVA 3QJYA 2LMDA 3JSCA 2EK5A 1V54H 3CDHA 1VQOQ 1XTAA 2BVMA 1R5HA 2M2EA 1YJWI 1CF7A 2FZGB 1AWCA 3UGQA 3E5QA 5KCOA 2W00A 2KT0A 3CCUA 2K5IA 3O6BB 3GTJJ 4HWSA 2AQFA 2M16A 2YX7A 1Q81C 1VQPT 3CPWP 5DM7R 3OYCA 1ZAOA 4FX0A 4XOPA 3FM5A 1PKSA 1YFRA 4XTYA 4KGVB 1KJWA 5EJCA 5JHFA 3JRIA 5FD6A 4L59A 3UH0A 3GOXA 1LE8A 3BTCA 1PUFA 1KC8U 5KYNA 2CQXA 4UUSA 2ECBA 1M1FA 1IXCA 2JTMA 3K69A 2Z3YA 3JCUC 1VQLA 1MMNA 1X3UA 3CCVQ 2FQ3A 3NMZC 3L1AA 1Z3YA 2DA6A 2DMQA 2XGTA 2NUPB 1VQ4I 4JUVA 3IKLA 3TSWA 1VA7A 3BJUA 3OSGA 1R77A 3H0FA 3ML6A 4CDGA 1NLOC 1EVKA 1DDNA 1W2BP 1E2XA 1UG0A 5KAIC 2L89A 2A68F 3H9QA 2NS7A 5IPAA 3RZDJ 1OZ3A 3G4SA 4U0VA 1YJ9Q 1ZR4A 1UZCA 2R4GA 3ZPLA 5GAGJ 1NJIU 4C92A 5GAN8 2EQUA 3OIOA 2IGKA 2RPNA 1T98A 1GVJA 3E9FA 1V5EA 1GDTA 4WWCA 4Q47A 1Y07A 4PFPA 4LDWA 2ZINA 2DEQA 5KYXA 1K6YA 1VQNQ 3DEUA 3PNYA 2WBMA 1KG1A 2KYBA 2QF7A 3JCMg 4XRMA 4OMPA 3A74A 1FSHA 4KIGA 4RLFA 3K0LA 1UECA 3HPHA 1TQMA 4R8HA 3I5SA 5FU6B 4IHSA 1I5OB 4RTUA 1RL2A 3K4BA 5F1RA 3WU2C 5H6QA 4E51A 1ZQ1A 1KU9A 3TP0A 2Z9OA 3JB9H 1ON1A 2L9NA 2OF7A 1E6GA 3CLOA 3O2PE 4PGGA 2ZPGB 1WPKA 1S7OA 2VPRA 2LREA 2XICA 3H0GJ 4EEFG 2EH3A 1VQLI 1FSEA 2L3RA 1QPIA 2QKMB 2FMLA 3OQ5A 2L3DA 4XEOA 1SD6A 5DTDA 2JUFA 2O3FA 3ASNH 1W0UA 2PG4A 3R61A 3QUIA 2WAEA 3ZQHA 2JTEA 1B72B 2E60A 2C0IA 2LRDA 1Q82C 3W3SA 5GAOq 3ZXSA 1BL0A 4RGXA 4KRTA 2DXCA 2YU9J 1VQ7I 4Z02A 2QM3A 4M78B 2ZCEA 4ZN1A 3BG3A 2LP5A 5JFRA 4HV5A 1VQ9Q 2KFDA 3CBOA 3M07A 3RCOA 4XQ3A 3TCJA 1YFSA 4BKXA 1QPMA 4ESBA 4XOTA 1NJ5A 3BQZA 4JJCA 3S3NA 2A0FB 1YS7A 3SQNA 4PJ0C 1RAAB 4YEJA 1K76A 2R7VA 2EJGA 4BE2A 2WC2A 2MK5A 3DCFA 4CH5A 4XKVA 1R22A 2OTLI 4DZJA 4KJZA 2LP0A 2BZTA 2EIKH 1ETKA 5K7FA 3J80K 2G3RA 1OJLA 2XDBA 1J7KA 2P0PA 3CCLQ 1JUSA 3RJPA 2EFNA 5A0DA 3F70A 1OCRH 2L0AA 3FX3A 2HU9A 5LJ5d 2MH2A 4Q48A 4JK1X 3Q9SA 3RACA 2GXBA 2A5WA 1S9HA 4ABZA 5I11A 2HFHA 2NNNA 1UGRB 4B3AA 1UFMA 4BGDA 3MP6A 3TBIA 4HQMA 3I59B 1U9OA 5GAMd 1QGPA 2L0KA 1OKRA 5BOXA 3M9QA 2WSCE 4XU2A 2M9HA 1Q86U 1IB8A 4BY6C 1ZK8A 2DL7A 2P4RA 5C0MA 1C0MA 2RHSB 2ZJRF 2DFIA 3HJEA 4Q15A 2MF2A 3QYEA 2FBIA 1MJBA 2EILH 3HYIA 4BXUA 2CP6A 4CCOA 1XSDA 2VLAA 4F7UB 1AWOA 3BLYA 4P72A 3BTJA 3A0HC 2EPFA 2DK5A 2YWWA 2R58A 1QNTA 2DYRH 1XCBA 4YRQA 1BOAA 3GBQA 2YUQA 4NQWB 3CCMI 1XNIA 2NVUB 4C2TA 5B3SH 2DYIA 4PZJA 2P7CB 2DDZA 2IA1A 2DQLA 3F8NA 4JRKA 1MMGA 2IW5A 5FFXA 2VL8A 2LH9A 2IEKA 4YRTA 1G3YA 4CZZA 2E36A 3CD6I 2AKKA 1WLEA 3TEDA 2ZZGA 3WTWC 1R0BG 1IRZA 1VQ4T 2KMTA 3FXRA 2IIMA 1B6AA 3M1CA 3HSEA 3DEEA 4M77G 2BHZA 2FYKA 4KIFA 3IUOA 2RHXA 4HVUA 3FM3A 3VS7A 1CF7B 4JBAA 1ABOA 3JV3A 1ZGWA 3P8TA 2HL5C 1VYUA 3PFYA 1X2MA 1M3BA 4MQVA 1QVFP 1XC5A 5CQXA 3GVAA 2HYGD 4XNFA 2E64A 1WPYA 2EJ9A 2HOTA 1J09A 2VPLA 4EJVA 2XC7A 1S7AA 4KNYA 1I0CA 2FRHA 3FKIJ 4ENMA 4IIOA 3RQ4A 3S93A 4RGRA 1PUFB 2QYOA 3OL4A 1KQ1A 4UUSB 1WVRA 1U3EM 1LVAA 3HZJA 1D0YA 3SWNC 3CMYA 1TZLA 3PFSA 1X2NA 4HWRA 4EMGA 1X1AA 4RCCA 3L2WA 2EINH 1NJ1A 3M4QA 3NEMA 3C2BA 4A69C 4I09A 5M5WJ 4A3CJ 1T33A 1DU0A 1N6AA 1VQ6Q 2O7OA 2XROA 2YPRA 2P0KA 1S8NA 3MP8A 1EV7A 2XDPA 3CEYA 2ZR3A 2I5UA 1JTXA 3P8VA 2V8KA 3OSFA 2M8GX 2R92J 3I55A 2Y90A 5LRRA 2KIFA 3ZFJA 2LLKA 4ZN3A 3MZYA 2KPMA 5IHKA 4L5EA 4RUGA 1TW2A 2PX9A 4XTWA 3B73A 4C92B 2R7TA 3OYGA 1VQLT 2IS2A 5DD8A 3ZGKA 3OSSC 4XM3A 2KDOA 1SHGA 2CZ1B 2JVGA 1PC0A 1X54A 3OOUA 5I22A 2HZTA 4QVZA 1VQMA 4XLFA 4MDXA 5FLMJ 3PIPF 2EJRA 5KYXB 2X0LA 3N5BB 3HRIA 2E1MC 5L3FA 2IA2A 3O8GA 3CC2A 4GRIA 1OZ2A 2NRAC 1VQ7T 2VKNA 2ESWA 1AWWA 1BIBA 4XORA 3D7SB 4V19K 3AL0B 3RDIA 1VQ5Q 3G1OA 3RMSA 3G4ST 4P75C 4KULA 1MNEA 1S72Q 3E2UA 2DYBA 3A7UA 3HB9A 4M75A 3A8GB 1K73C 2L9SA 5GMKj 3K9TA 4MHGA 2ZJ2A 4BU2A 3IRRA 4FL6A 4RAFA 5BQTA 3QAHA 3LSIA 2ME6A 1GCQA 2I10A 2EKOA 1ZH5A 2DZCA 4KH0B 3M53A 4BHPA 1FMKA 3CBMA 4BI3A 4E6RA 2JUCA 4GY5A 5LJ5g 1H0MA 1JXMA 2DRKA 1B7YA 1A36A 4Y33A 1UHSA 3NTIA 2P0QA 1B1BA 2XRLA 3RTRA 3EG2A 2I4LA 4M77D 4PG3A 3I54A 2G6FX 2RD1A 4M6VA 1IGNA 1V5GA 3FF5A 2EYZA 2RHZA 2KZVA 3CCQQ 1G5HA 1IV6A 1E1OA 4CH6A 2MD0A 4HZFA 2JPBA 2LCCA 2KRMA 4VUBA 1WQ7A 2HXIA 2TRTA 1U5TB 3RYPA 1PD1A 2Y2ZA 4L9TA 2Y75A 2ABLA 3F72A 2VUBA 2I4MA 5L3CA 4XR6A 2XDDA 1K9MR 5E1XA 4WX9A 4M7AE 2A6HF 3V8LA 2PJRA 2ADUA 1Y0NA 1K4US 2DXUA 1FNNA 1R8OB 5FROA 4UVBA 1M30A 1KD1R 1IO6A 3WTYC 3D5RC 2D6FA 2QUFA 3CC2I 1NJ8A 1SMYF 3IKVA 2RHQB 3L2QA 3IH2A 4FT2A 4C30A 3PQKA 1FYMA 1LB2A 3IG2A 1LJ9A 2P8TA 2AT1B 2RB6A 4H4KC 4BHBA 4KQEA 1VQZA 1XSVA 3K1PA 2ARTA 1T39A 4RB3C 2EYWA 4ZJZA 2DE0X 2F5VA 3J81K 3CCJA 1BOBA 4IRGA 2RHIA 1ZG5A 3LQQA 3I7FA 2HQ5A 2PMZN 5D5UB 5JVGF 5J6XA 1RUWA 2GLOA 2VC0A 4LNPA 2Q7HA 2DD4A 4DBRA 3R6OA 3VYGA 4EPCA 5HY6A 2LVSA 2DDBA 1HYOA 4RB0A 2STWA 4AIDA 3BWGA 3K2AA 4Y17A 2E10A 3KZIC 3JRZA 2MABA 3REUA 1NG6A 2CWEA 2FXAA 5ILVA 4AIHA 4M7DE 3EETA 2BZYA 2W48A 1NZ9A 2XUBA 3SZTA 4JJDA 1FEXA 1IZ1A 1PDNC 2E70A 1FOXA 1UEBA 4YPFA 1AWXA 1ZHFA 3CCRQ 4A54A 3PCOA 1ATIA 2YT6A 1NBEB 4OIQF 2A36A 2PFBA 2IXSA 1Q7YC 2V1DA 1RUNA 4XKBA 3JCMQ 2OCCH 3LSQA 2CQ7A 2YUNA 1OYWA 1GVDA 1K0XA 4MEYF 5K7ZA 2RJFA 3LH5A 2HAXA 4CUGA 1SVOA 2F5DA 5GPAA 4YP0A 4MO7A 2HYJA 4CSWA 3LGFA 1BI3A 4BL0B 3S1RJ 4EV0A 1GUUA 3GPLA 3KBGA 4D5CA 3PMIA 5K7HA 2GQVA 3F21A 5B66C 2LKXA 1VNDA 1ZG1A 2MC4A 4H0EA 2E2HJ 1E0EA 1M2OA 1BJAA 4LK1F 2K4JA 2X3WD 1U0JA 4EM0B 2DM1A 4YYEA 2LQ8A 2K2MA 2CJJA 3NPFA 1YI2A 2B0LA 4PJJA 5LEJA 5IT9K 1MMDA 1TQPA 3DP7A 3BC8A 2LNVA 1RKTA 4F52A 4C5EA 2RQPA 5CLSA 4GBQA 3M59A 1RIQA 2X4WA 3F9KA 2DJZA 5F1JA 2O03A 5JI6A 3IP4B 2DT5A 3MEAA 3ONQA 4L9VA 2CP2A 2M9UA 2WWYA 2ECCA 1WHGA 1K8AR 4RGSA 2XAFA 1D0XA 5F6FA 2VIXA 5GP9A 2L01A 4C0FA 1X19A 1NLPC 3VODA 2GGRA 3SWNA 3ASKA 3BPXA 1VOMA 2HQAA 1AHJB 1KC8C 1ETWA 5FJ8J 4WXHA 1DGRM 2PMZA 3LFUA 1ODDA 4A3FJ 4ZDPA 2CV2A 1J0RA 3NTHA 2PQWA 3OBWA 5KYYA 1IUYA 3HL8A 5GPCA 2FRWA 3OL3A 1QHHD 4GYGA 3VEPA 3RZOJ 2AIRB 4XLCA 1IXDA 1S6LA 2HWVA 1SHFA 1NTCA 3GTQJ 1EIFA 2L7KA 4KUIA 4X6AJ 4HXJA 3JAMK 2MI6A 4L5JA 1YIJA 2DMPA 2HQEA 2JN6A 3P8HA 3OIPA 3MD2A 3JCMb 1FMWA 2LQNA 3C7JA 2W0ZA 1ZSGA 4PL6A 4N4OB 3GTMJ 5E3IA 4BBRJ 3QNEA 4KICA 2EFIA 2CGPA 4XN3A 1T08B 1C6VX 2X51A 2JUGA 1HW5A 3NWTA 4C5GA 5LHGA 1YN8A 2R7FA 3I55T 4X1EA 3NFCA 4XRSA 2ZT7A 1NJIC 1IHWA 1ETVA 3S1QJ 2HKNA 2DILA 5L3BA 3BR3A 3HL2A 4AVZA 4KN4X 4Q4ZF 2ELJA 3MEVA 5CKBA 5E1WA 2HNHA 2DN0A 1I6HJ 2EAYA 3KYCB 1WJSA 2BE5F 1YI2I 4CCNA 2HTJA 1EA3A 2FEIA 1ZBXA 1Y0UA 2VE8A 3TO6A 1M3AA 4QPOA 4P75A 1VQMT 2E65A 2CFXA 2D5VA 5KAFC 4LK0F 2JA6J 2HPMA 2NS8A 1LCKA 2KRCA 3LNQA 1YFTA 3CC2T 5CCAA 3W2AA 3E6BA 2VXFA 4OIRF 1BU1A 5CVUA 4UP7A 1Z9QA 3CF2A 2A08A 3LSPA 1LKXA 3WTXC 1YWOA 3NENA 3MJXA 4M9ZA 3FLGA 2M1BA 1M1GA 2H8RA 2WB1A 3G3ZA 2PUKB 2FA5A 4LFUA 4HV6A 2VQHA 2LD5A 2F5KA 3N4MA 3INZA 2Y30A 1GRIA 3LA2A 4UB6C 1N75A 3I9QA 4JOMA 4OMNA 2QWWA 2CSQA 2KSSA 3F8CA 1CKBA 1K9MU 1YIJI 1PSFA 3BR5A 2EGCA 1S5LC 3M4GA 2O0YA 4PJNA 1VQ8A 1BR1A 3GLLA 1HW1A 1IC8A 2FD5A 2Y0SA 3MKZA 2E5ZA 1HXDA 4I02A 1Y7XA 4M7AF 1RR7A 2ZT8A 2A69F 5FWBA 3CDIA 1B34A 4OMOA 4PLIA 4ETSA 1ZLKA 3CUOA 3I4MJ 5A2QZ 3QWXX 1JKPC 3BTIA 3BR6A 3GO5A 3CF5F 4B6MA 4QQ6A 2HKXA 2VT2A 3IC7A 3OS2A 4LD9K 2IJLA 1G3WA 3K4LA 1TUDA 4R56A 1JUMA 4MFDA 4C3HJ 2LT4A 2PNIA 4OMLA 2ID6A 4J9BA 1DQUA 4AC0A 4G9YA 4XMYA 3G1ZA 4M75G 2YRCA 3K10A 1B8IB 4M3EA 5F5WA 4G85A 1SAUA 5E17F 3L1PA 2A3LA 1YCYA 3OYEA 3VS1A 4L18B 2HBWA 1OCOH 1IAWA 4YREA 4C8QF 3LSKA 1Y57A 4TVYA 3FXJA 5FB2A 4BY6B 1WXTA 2CUJA 2WV0A 4KT6A 1QLYA 2R5MA 2LBFB 2M7BA 4OGCA 4M7DF 1V4RA 2CU7A 4WJ4A 4IJAA 2D2WA 3PCOB 1QQJA 1F1ZA 4D7NA 3CCJT 3OD1A 2HQNA 1FP2A 2DA3A 2K3FA 3G6EI 2EZKA 4BWAA 5M3MJ 1B9NA 1SSHA 5EZHA 2I8DA 2F5TX 4LVMA 1SFUA 3T8TA 1F9NA 4N9IA 5F0FA 1P4WA 2X35A 3DPTA 1WX6A 1Z6TA 5LJ3j 4WCIA 2ECZA 5LD2C 5GAOp 2FX0A 2L4AA 3PUBA 1FTTA 3RSNA 4A3IJ 1REPC 3RBBB 2QQRA 2NXNB 3F6VA 2LR8A 1SMTA 2OD5A 2X4HA 4HBLA 4JJBA 3DBRB 2ZAEA 1DP7P 4UP8A 2EJFA 4AM3A 1IZ6A 3M4YA 2BY0A 2JT4A 3Q9VA 4M78E 4E7SA 1RNLA 1WYDA 1YX3A 1LJOA 3DPUA 1TW3A 2K86A 4ENJA 3OMCA 4ASNA 4RM3A 1PM3A 1MBEA 1USTA 4HDVA 3I56I 1NYFA 3CXCA 2W84A 2K5LA 2C0OA 3L2VA 1OQKA 4C3IJ 4X1VA 2B7EA 5FWCA 2DPPB 5J3BA 2GZWA 3MZ8A 1WXBA 5GANh 3HM5A 2JW4A 2ZPHB 3UA7A 3L00A 4BI4A 5I2MA 3HC7A 4AFQC 3IQLA 5GANj 4J7IA 2K4BA 3W6KB 4ZYHA 3RI4A 2DEUA 2BXYA 4PGHA 4A3JJ 3KP2A 3K6GA 3F8MA 1HQCA 1JKOC 5HKCA 4ITVA 3G71Q 2WACA 1EF4A 1XMXA 3BDUA 3L09A 4ATOA 1DPUA 3SWNB 2EW3A 1GFCA 2IT0A 1B4AA 2Z33A 2PU9B 2OZ6A 4FCYA 4RB2C 2XDVA 1YI2T 2X4JA 1KYZA 3I58A 2AZVA 5HLHA 5KYYB 1G3SA 2EGAA 4MDWA 5FKLA 2ZC2A 2EFPA 2PVDB 2HZYA 6PAXA 4KT5C 4LGWA 3VJPA 1YJWQ 2AMCA 3HY0A 3CC7A 2OJED 4M6XA 1HC8A 3VWBA 1AA7A 3WGHA 2E1NA 1X4OA 4EO4A 4IUQA 1WJAA 2X9DA 3PGGA 2YDLA 4FYWB 5C52B 2MYSA 3CC4A 4HWPA 3OW2A 5GANe 2E5NA 3X20B 4M75D 4FW1A 4JDSA 1T56A 1JE8A 3GFMA 1Z9ZA 4RDXA 1X1CA 2QEXI 3A02A 4N4IA 2IRFG 2KT1A 1XG1A 2DBKA 2B63J 3ERED 2C8MA 3WU1B 4F7UE 1OCPA 2R5YA 1E24A 4I6ZA 5C3EJ 2FMYA 4LG0A 4L5GA 1YITA 3JCMh 1JJCB 4L5IA 3FXKA 2CS7A 4F3QA 5B5EC 2PVGB 2Z1DA 2RKHA 2E1MB 4NC7A 4ZYAA 3CZ6A 3HSBA 1BB9A 3MWMA 1VQ4Q 3DTIA 1Y8QB 4E7KA 1YIJT 2OUMA 5KNLA 3HOYJ 1F5TA 1OFCX 1WLPB 2KMUA 4ESJA 2DOEA 1KU2A 2JJ9A 5CQYA 4N9HA 3NGPA 5KE2A 3K4JA 3ZRGA 3KP6A 5DM7F 4EJUA 3Q0WA 1BA5A 3TW7A 2HKQB 3M0TA 3EFSA 1G83A 2KK4A 5HK0A 4JP0A 5D8LB 4OIPF 1Y0MA 3CMEA 4IXAA 2M7AA 1UHFA 1MGQA 2VJ5A