3V7RA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7rA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7rA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7rA02
3WGGA 3LQRA 5CLSA 1IN4A 2QHTA 1O3QA 3FZVA 4WWCA 2RHQA 1ASYA 2FNAA 4Q48A 3N4MA 5F5WA 4NL2A 4GCVA 4HAMA 3KP5A 2BYVE 5BOXA 2QENA 2VT2A 3QU6A 3MFKA 5LJ5h 5GMKl 1H4TA 3N97A 2F5DA 1A04A 4K88A 3T5XA 3J7AO 3ZQ7A 3R07A 5JI6A 1SETA 1G3WA 1MJ9A 5FFXA 4RGXA 1J5WA 4TVWA 4MMKA 5LJ5e 2ZFWA 3RIRA 3G1ZA 5E1WA 4AIJA 4WXHA 2CGPA 3QSUA 2I4NA 1Z1DA 2L4MA 2HR3A 3V7RA 2IT0A 2DU7A 1USYC 11ASA 2IP2A 1UHMA 1YQAA 4OU0A 4XSXF 5LRRA 4M77G 1IN6A 3WU1B 2DVEA 4WXCA 3HFVA 2NRAC 4L5JA 4YREA 1R5GA 2ETHA 6PAXA 5GAOn 2Q2EA 2F5CA 1SD4A 3SB2A 2CJAA 4J6WA 4OP0A 4HV5A 4UPAA 3LSQA 4CDGA 2QBYB 3HOTA 4P9UA 1YLFA 3GVAA 4ENNA 3SWNB 5CVVA 3J80Z 2I4LA 5FD5A 2Q5HA 2A68F 3L00A 5K5QA 1IL2A 2J5OA 1NNHA 3NEUA 4H2TA 1XD7A 1XMKA 2DXUA 3EETA 5LHHA 2ISZA 1MKMA 3GW2A 4PCQA 4RB3C 4PJOE 3O3KA 2KIUA 1ADJA 3HXWA 3RF1A 3KP7A 5DD4A 3IALA 1D3BA 4YRNA 3F6OA 1YO5C 1SD6A 2G7HA 4CS4A 3NELA 1EH8A 4EJUA 4TVYA 1EQRA 5GANj 3GXOA 3HFNA 4M75G 1U5TC 2KJBA 2M87A 3L7WA 4MQVA 4L9NA 1P4WA 5LGUA 4JLIA 2VXEA 5DD8A 3LA7A 1D8JA 5KNNA 5GMKm 4TVAA 1QBJA 1Z91A 3DKWA 5DUKA 4IRIA 4G6QA 2QZ8A 5LJ3j 1EH6A 1HKQA 3M4PA 3CUQB 1GHCA 4A12A 2XAQA 4H02A 4XTWA 5ICGA 4XLPF 1FBQA 4M7DE 2RB6A 3FHZA 4P73C 4YIFA 5LEJA 4KN7X 1RZ4A 3WODF 1QQIA 2VE9A 1YW7A 4ESJA 4EMKA 4HLXA 4KFCA 2EV6A 1B1BA 4F7UF 1G3TA 2E10A 3BWGA 3HXYA 1IN7A 2RDPA 3M7GA 3SQNA 1TBXA 3FMRA 2XAFA 4YRTA 4BXUA 2O61A 1Z7NA 3VBBA 2HTJA 4BNCA 3GFMA 2OZUA 1K6OA 3KETA 3Q9SA 3IWFA 4IF4A 3A31A 2PG4A 4P3NA 3I71A 1QE0A 4C92E 5L3FA 2DQLA 4IJAA 5FLXZ 4LLNA 3KE2A 3F21A 2P5LC 3WTUC 3CDHA 3GX4X 3TO6A 1ON1A 3OD1A 4R1HA 5E3IA 4M78F 1XSVA 4M7DC 3IRRA 2FOKA 2HTSA 2EJFA 4N9HA 3ZMTA 3ZP5A 1EIYA 3FM5A 4RB2C 2XKPA 2ZMEB 4M77F 4C8QC 3QTCA 3TOAA 1OMIA 4M7AC 5BS6A 1XCBA 4U0VA 2ZR3A 1HK9A 4HYEA 4ESBA 3IWZA 1HW5A 4LG0B 1IN5A 1B9NA 4KR2A 4G84A 2C8MA 4YPFA 3G3ZA 3CJNA 2L54A 2EFNA 1MGTA 4L87A 3SZPA 1F4KA 2RQPA 2PI0A 2ZZEA 1TW3A 3PCOA 1XCVA 5AIQA 2BBYA 1YTYA 3BY6A 4ZZDA 2VXFA 5LJ3d 1RNLA 5KVRA 3A7RA 1KOGA 3MEYA 1SRYA 2CIMA 2B0LA 4RGRA 5GANh 4HF1A 1X55A 4J6YA 2BV6A 3ZN1A 5A2QZ 4N0AA 3ELKA 1XGSA 3VQXA 1SMYF 5CAIA 2PBIA 2D45A 2E65A 4YYEA 1FC3A 4PNOA 2A61A 1GXPA 3JB9I 3WTWC 2YLBA 4GXOA 3HSBA 4PJOG 2DXTA 4O2DA 4WCGA 2CGHA 3P8YA 3HY1A 3K1NA 5GANe 5GAOl 1IW7F 3QU3A 2RHSB 4M75F 2AKWA 4K86A 3P9KA 3CTAA 5D4SA 4DQ2A 5LJ3h 1WRJA 3H3UA 3W6JB 3PFIA 3M8FA 2GA1A 3R60A 4BYYA 4XEMA 4BHCA 4KQEA 1N9SA 4OIQF 2P5IA 4YRGA 2PN6A 1FX7A 1ZYRF 1Z7UA 5LJ3e 1ADYA 1U6GA 1I8FA 3E97A 4XTXA 1Y0UA 3BP8A 4OMZA 4QLCU 1HSTA 3BW1A 3F8CA 2XAJA 2COMA 4S04A 4TTVA 4JUVA 1IXCA 4NOYA 3F8NA 3HXUA 3BDDA 3FMSA 3QP5A 1TQMA 1WYDA 4A54A 3JAMZ 4Z2YA 3HTZA 4AH6A 5JHUA 1HXDA 4WI1A 5J8CA 2QLZA 2OD5A 1N9WA 3KZYA 2K4JA 1FYLA 3MCZA 1XGOA 3ECHA 2OZ6A 3I58A 2UWMA 2DPUA 1TNSA 3HFZA 4I2OA 4LD5A 4H2XA 2XUBA 3BFMA 4IRHA 1YCYA 5LLQA 3EUHA 2HKOA 1Z05A 2LKPA 4EM2A 1W7PA 5HDKA 5GAMj 5IT3A 2G4CA 2ZIOA 1SESA 4B09A 1RI7A 1L0OC 4IXAA 4I01A 2A6HF 3TOBA 3RDIA 4IPAA 2E41A 2GWRA 4ZIBA 4HBLA 5DDGA 5HVQC 1ODDA 1K7AA 2W85A 5DCFA 3BOQA 2DQRA 2KKOA 3BJ6A 1LJOA 3ZMDA 2YSRA 1KU7A 3DP7A 2P8TA 1WQ2A 4DPGA 1YFTA 4MHGA 1RIOH 4GO1A 2L4AA 2ZT8A 4KUMA 3GZ5A 3SZTA 1REPC 1OR7A 3AHUA 4XEOA 4M7DD 4YRJA 4HF2A 2ZTGA 4I02A 1EV7A 2RV8A 3KLOA 4C8QD 1KA8A 2YX4A 1KGSA 4M7AD 5LHGA 1T2KA 1PDNC 5LJ5f 4LB6B 3T0YA 3C18A 3K1PA 5EEGA 4XQ3A 5FB2A 2ESHA 4RB1A 4H2VA 4X5OA 3JTGA 4X9DA 3LA2A 4U7DA 4J6XA 1EFWA 2JPCA 3COAC 1F9NA 1U5TB 4M78E 1J7KA 3IL2A 5HS7A 3QO8A 3J81K 2Q7HA 3R61A 4CH4A 3E5QA 2UZKA 4M77E 4O6JA 1FPQA 4PJOA 5LEKA 1I5ZA 1FT9A 1I4K1 4EGZA 3C3WA 3F22A 1G4DA 4M74A 2FBIA 3TKYA 4BHBA 1SMTA 2NYXA 2O03A 2NNNA 2XASA 1J9IA 4PG3A 3KFWX 2VC1A 1PYSA 5GAN2 4PGGA 2EFOA 2AS5F 3HXVA 4U7BA 2O6GE 1B70B 4M73A 4EMKC 3JCMd 5C52B 3LQQA 3T8TA 5K5OA 4EMHA 2V9VA 5GMKj 1PP7U 1PUEE 1VTNC 2AMCB 4FT8A 1NHAA 3DFGA 4HOBA 3BPVA 3DSQA 4HX8A 3HSRA 3ZPLA 2Z99A 1HKSA 4RGUA 4HVCA 4A5MA 5GAMd 3VU3C 1GGMA 1X3UA 4NHJA 4CO8A 4H0EA 3ERRA 4AVPA 4NL3A 2Y90A 1G3YA 2LDUA 2C6YA 3M4QA 4UP9A 4MNUA 1HSJA 5E1ZB 2QWWA 2KRFA 4M75E 4LK0F 1G5HA 1E1TA 4Y15A 2Q0OA 1HW1A 4BAYA 2IVMA 3HRUA 3WGIA 2DTHA 2ALYB 2VBZA 3OOPA 4CXFA 2ARSA 4XSZF 1JXSA 1WNLA 5GAMh 1EOVA 3HRIA 4HF0A 1WQWA 5D8LB 1H4QA 1E17A 3JCMP 4OIRF 3MQ0A 4M7DB 2HKXA 2CO5A 5F6FA 3WQZA 2PMHA 3DXJF 3JCMQ 4C8QB 4TWAA 1L3LA 3E9IA 4M7AB 1LEBA 2ADUA 4J15A 4C92A 1ZG1A 4C8QF 3DPLC 3HRKA 2ZNZA 3RJPA 3I7FA 4PGHA 3K0LA 2PJPA 2K4BA 3JTHA 1P92A 4UV9A 2DU5A 1J59A 1ZG3A 3QO3A 2K86A 2L3DA 4N0AC 2A6EF 3BPXA 2HDCA 1W5SA 5K1XA 2DLLA 1Z7MA 4B8XA 4E70A 4ZYHA 1TQIA 2FMLA 2E3CA 2YPRA 4CH3A 4WX9A 1LVAA 3MEXA 2ZNIA 2M1BA 5L3CA 4F7UG 3WTXC 3LSSA 2V1DA 3T1BA 4CHUA 4WK8F 1XGMA 2BE5F 2HQRA 4JBAA 5BPDA 2IRFG 1HC7A 1Y96B 1K79A 2O0YA 2CYYA 1ZHFA 4WF2A 1KMNA 2EFQA 5GAN8 1NJ2A 2RHQB 2DI3A 2DZCA 2W25A 1R00A 4YFNF 4EM1A 1IUYA 4N9IA 1K78A 3U1DA 2DK5A 3K2ZA 4G7OF 5AIPA 2ZZGA 2GAUA 2RGVA 2Y48A 4M78G 1BM9A 1FSHA 5GMKh 4MTDA 2FMYA 2JPBA 3JB9H 3MF1A 4YRKA 2DTIA 1AOYA 2K57A 1BC7C 4RCCA 5LBQA 4E51A 1YW9A 2EJ9A 3E6CC 5K5RA 1BI3A 1NYRA 4M6YA 1S7AA 4LLLA 3LA3A 2XAHA 2CW0F 1LNXA 4HX4A 3WG9A 1I81A 3BDUA 4IRGA 3HRSA 1ZGJA 4EJTA 5GMKe 3P8VA 4UVCA 1SD5A 3K1MA 1ASZA 4Y91A 1UCRA 4PDKA 2R7FA 4YRIA 3K9TA 2EL9A 1DP7P 5IT9K 2X0LA 1CGPA 2H27A 4HT8A 3UFGA 2EWNA 4UVAA 3F6VA 1AWCA 2RN7A 3HSEA 3TDUC 3J80K 4PHCA 2PLYA 3OV8A 1X2HA 3ML6A 1U2WA 3RYPA 3HSFA 1Z9CA 3HHGA 5GANf 1DPRA 4OIOF 3V8LA 4LGWA 4M71A 2VBYA 2KIMA 2EB7A 4S05A 2P7CB 2O8XA 1R58A 3REXA 4DNCA 4XU1A 1ZARA 5GANg 1ZLKA 3JCMc 5ILUA 2RA2A 1HKTA 3HFOA 1X54A 4HDUA 3ZMUA 3GUDA 2IA2A 1YYVA 2DDZA 5LJ3f 1G5IA 5F1RA 2CJ9A 1D3BB 3WE3A 1KMMA 3TDZC 1RIQA 3MWMA 2A3SA 4RS8A 2KJCA 4UP8A 4A53A 4HT9A 4P75A 2EFWA 4RAYA 1JJCA 1B34A 3ROUA 1TQPA 4F7UA 4PJOC 2HGCA 2ZCEA 1Q1HA 3GF2A 4KMUX 3P7NA 2ZXFA 1FZPB 4O5VA 2EV5A 4P3OA 1YW8A 4I98B 4BHPA 4KDPA 2IA1A 5ED4A 4TVAB 4A0XA 4U0YA 4EJVA 3KZZA 1ZREA 2QM3A 2HYGD 1ONVA 1B7YA 3LAJA 1UFMA 4H2UA 1GXQA 4CS3A 4A6DA 1DUXC 5GAN4 2Y0MA 4M78A 5C51B 1MGQA 4EMKB 1KU3A 1S7OA 2ELHA 2YHTA 3INZA 2XGXA 2BGCA 1T38A 4G7HF 1L0WA 3R6SA 2EV0A 4A5NA 2ZZFA 3RI4A 2E1HA 4M77A 2FF4A 2P6TA 2NS0A 3VEPA 1R1TA 1MJBA 3RESA 4G85A 3MZHA 4HZFA 1O3TA 3T8RA 3IRQA 5FLXK 3UGTA 5HDNA 1QGPA 3JSOA 2PMFA 1E2XA 2QYOA 3I4PA 5CVIA 5HLHA 1FYFA 3QO5A 4I7HA 2GA2A 2CFXA 1BJAA 2RM4A 1QNTA 1YB3A 4YRQA 1EH7A 2DW4A 1ULYA 1TNTA 2OAZA 2W57A 3P9CA 4YCUA 3NETA 2XIGA 1CF7A 4P55A 1H0MA 1TH7A 2MD5A 1EIYB 3VFZA 2A07F 3AAFA 3IC7A 4HV6A 4KIGA 4C92C 1Z6RA 2RNJA 3B73A 3E5XA 4ZYGA 1T0FA 3M1EA 5DYMA 1T39A 3L4GA 2QQBA 4FX0A 2R3SA 3FB9A 4M75A 4Q6GA 5ERIA 5KK1A 1FP2A 5ILSA 2ACJA 4KA4A 3FXRA 2QQ9A 3GYHX 1W7PD 3PZCA 12ASA 3V7CA 1D5VA 3PCOB 5FO5A 4TQDA 4BQAA 5A2QK 4V2SA 4ZYEA 3F23A 2DT5A 2MLGA 4QVCA 2QHSA 2E1CA 2RVCA 1P6RA 4GYIA 3RGLA 2Q7EA 1TLHB 2WV0A 2MH9A 4NQWA 4XTVA 2IY5A 1GVJA 2E7XA 1LQ1A 1E24A 3BJAA 1NYQA 3HY0A 1B76A 5GAOq 1M5Q1 1XB4A 2MH2A 2F5EA 1XN7A 2FBKA 1OYYA 4CZZA 2WTEA 4P74A 3RPUA 1R23A 1YS6A 4RQEA 3R0AA 2OU2A 5HS8A 3FJPA 2GIVA 1E1OA 2MLKA 1IZ1A 2AKWB 4YDQA 1D8KA 1G6NA 2HWVA 3CLOA 4F7ZA 1TW2A 5ILVA 4YRPA 1JE8A 2WC2A 3VQYA 4HW0A 3JSPA 3B02A 3QNEA 1C0AA 4HQEA 4RCBA 4IVNA 4J5YA 3IHUA 3MAJA 5GMKi 5FGMA 1ZN2A 5BMZA 4EX5A 4EGYA 4QVDA 2FNPA 4PJOD 3JW4A 1T6SA 2UXNA 5LGTA 2PQ8A 3JCMJ 2EA2A 3RYRA 2W24A 3RL6A 5FD6A 1QPMA 2HZTA 4M9ZA 2DPDA 3RTRA 5GAMf 2XV4S 4G94A 5E8GA 1J2XA 5D5UB 3SHFA 3JAMK 4WJ3M 2ZBKA 3PQJA 4C8QG 5K1YA 5D6EA 2TDXA 4U88A 2H6BA 2IW5A 2Z9OA 4R79A 4A2UA 3DQVC 2J3LA 3ECOA 4M6XA 3BJOA 5DCMA 5GAN6 3VQWA 2ARUA 2YU3A 2NNYA 4F7UE 4X9CA 3SFZA 3HFZB 1XMAA 2FSWA 2YLCA 4H2XB 4EQQA 2J3MA 4ENKA 2GZWA 5GAOr 1ZRFA 2MBFA 1DDNA 4RDXA 2FRHA 5J6XA 4WJ4A 1W7PB 5TJJA 2VN2A 3D5LA 2ARTA 1KQ9A 5GAOm 1U3EM 4YRSA 4Q5SF 3UH0A 4P3PA 4JRKA 2VBWA 4L5IA 1F5TA 4EO4A 3E6BA 2D1HA 1B6AA 4HWPA 3FWEA 4K87A 4LFUA 1MDMA 2Z3YA 2OQRA 4H2YA 5LJ5g 3QP6A 2QHUA 2XKOA 3BZ6A 1O3RA 4P75C 3A7AA 2ZINA 2FEZA 3FXQA 4K2EA 5HLGA 3JB9D 1FBUA 3H92A 1IF1A 3FM3A 4D0PA 2ISYA 4CS2A 3V4GA 4I09A 4C92D 2ZT7A 1OYIA 4ZZLA 2XGTA 1BI2A 3ZMSA 1S6LA 1LJ9A 3QAHA 3I0TA 3IKLA 3A7UA 2OA4A 4TV7A 1JGSA 3UGQA 4IHTA 3P8TA 4YROA 2C7IA 2VODA 5ELNA 1G3SA 4PJOB 4JRIA 1KQ1A 2DTOA 2GXBA 3REOA 3D0SA 4KN4X 3TEHA 1U78A 1OYWA 1KQ8A 1HW2A 1TTYA 3I59A 5ICEA 1PYSB 4M78C 2G9WA 3TQNA 1ZGAA 3JCMh 4M77C 2DU9A 3PQKA 3U9GA 3A5YA 2STTA 3IKTA 1R5HA 2DKGA 2JZYA 3WTZA 2K27A 3E9HA 3W3SA 2Q7GA 4MGRA 5E20A 4OINF 4I0BA 1JRIA 3QRFF 2XHKA 2NAZA 1QO0D 3ULQB 4AIHA 4KIFA 4HX7A 2E1NA 4JK1X 4LNSA 5H6RA 1KU9A 5JVTA 3JCMe 1V3FA 1KQ0A 2LNBA 4MMLA 1S3JA 4NCXA 2Z5UA 3I5UA 1W4MA 4M7DF 2XTIA 4P5OA 4A6EA 2YX7A 5C53B 1U1SA 1FNNA 2Y75A 4JQFA 3I53A 3HYIA 5GAMe 2QQAA 4XU0A 1P4AA 2OQGA 4M7AF 1UB9A 2FYKA 1R7JA 3VQVA 1J0RA 4KYWA 3REUA 4YFKF 4CYDA 4LMYA 4UVBA 1XSXA 2QUFA 2PFBA 4CGZA 4M75C 1OKRA 4M9XA 5GAN5 2K7LA 3QUIA 4YRCA 3RKXA 5D5VB 2CJBA 2EFPA 3R4KA 1B9MA 3L2CA 3VB2A 2MC3A 1WQ7A 3ZMVA 4C92B 4KT5C 2ODRC 1BBWA 4N0BA 2ZNJA 2LF7A 4R8HA 4OMYA 4KIBA 3VOEA 1QF6A 2Q8KA 1O7FA 4HWRA 3TO9A 1SERA 2E64A 4O3MA 1S8NA 1R36A 3KFUA 3GWZA 2J5PA 3JCMX 4OIPF 1NJ8A 4P74C 3DV8A 2D1VA 4XTZA 2ZJ2A 4ENMA 1KYWA 2Q5IA 1KYZA 4LK1F 5CVRA 3MZYA 4RAZA 1BBUA 4HDVA 1WKMA 2K02A 2F2EA 4L0ZB 2F5FA 4CICA 5ICCA 2A69F 1LEAA 3KP3A 3RERA 1G51A 5JR3A 4AWXB 4ZYDA 1XGNA 3G73A 2R7DA 2JSCA 2QBYA 2X4HA 4AIKA 1IN8A 3HIFA 3WTVC 1K78B 3SWNA 4HWTA 4Q47A 2DBBA 4UNOA 2YR2A 1BN5A 2D2WA 3I64A 2M30A 2VC0A 3KP6A 1BBYA 4BH9A 3TUPA 3KCCA 1ON2A 1ZRCA 2DEQA 2RKHA 3BJUA 4G6DA 4Q4ZF 4AD9A 4ZTUB 5IT9Z 2L02A 5TRDA 1LDJA 1XDSA 2XVCA 4YCVA 4LB5A 1R1VA 2FE3A 2ZIMA 4G8XA 3IG2A 1FBSA 4GGGA 1H4VB 2HS5A 3LC0A 4M78D 3S2WA 2P6SA 2H6CA 4YRLA 4UHTA 3KEQA 2JRTA 4M77D 4P71A 3HTSB 4XU2A 2DTRA 5I21A 1ZG5A 3JCMb 1HQCA 3HOSA 1LDKB 3U2RA 4XRFA 1P2FA 1N9RA 2EJGA 3CUQA 1YFRA 4YRRA 2I4OA 1IAWA 1USTA 2FU4A 3F72A 4EM0B 2VE8A 3BROA 2V1UA 3PGGA 3Q9VA 2HFHA 1WWXA 1EVLA 5LJ3g 2CWEA 2HNIA 3EYIA 1RUOA 3L1AA 4M9SA 5ICFA 5E17F 3M4GA 4H2WA 1JHFA 1IRFA 4HLYA 1BI1A 5EEHA 1E22A 4MTEA 3JCMV 3C7JA 3RKWA 4LJZF 3LAPA 3EYYA 1F1ZA 1FSEA 2DFIA 1U8RA 2XAGA 4M75D 2M5WA 1JJCB 1I27A 1YFHA 4C8QE 1B34B 4F7UB 1XDUA 4M7AE 3IKMB 3V7SA 1BOAA 3F8FA 1B4AA 4UXNA 2ODRD 4G9YA 3HXZA 2IPQX 4L18B 1DPUA 3QPTA 5DEQA 4EMGA 5FFZA 2DZ9A 5BPIA 3BY7A 2DAOA 2VONA 1O7LA 3GFIA 2AXLA 1YFSA 3O2PE 3NENA 2ZMEA 5F64A 2A5YB 4P96A 1B7YB 4TQFA 4IHSA 1H4SA 5L3EA 5CVJA 1LYLA 4MQ9F 1VQZA 1C0WA 1ZLJA 4YG2F 2I2LA 5L3DA 4LG0A 4M78B 4BW9A 3E6DA 3O6BB 2JTVA 4YP0A 1YIOA 1MD0A 3L9FA 3F8MA 4M77B 1O57A 2XROA 3GZ6A 2H09A 4ENJA 3GFJA 5HS9A 5LGNA 3RPQA 1Z6TA 3GIBA 5GAN7 3L09A 5GANd 3QOPA 1V4RA 5H20A 2P5VA 1HBXG 1XSDA 1PP8F 3EDPA 1IXSB 5D4RA 2M8EA 3F8BA 5LRSA 2P0LA 3ZN0A 4KR3A 2OBPA 1SD7A 2VT3A 4YCWA 1O3SA 1I6XA 4P72C 1ZRDA 5HDGA 3CO7C 5D5WB 1I1GA 4HWOA 3QO7A 4KMFA 3CUOA 2W84A 2ESNA 2ZT6A 2RHSA 1CF7B 4OLFA 4A0ZA 4XLNF 3CMQA 5HGQA 3FX3A 3GLXA 4Y17A 3IKVA 5LHIA 4L0YB 3DPTA 2GQQA 1R1UA 5HOOA 1D3YA 2HEOA 4PZJA 3EFRA 2WWYA 4NB5A 2FXAA 2FB7A 3NQOA 1HTTA 5D5XB 3ISPA 4EV0A 4L9VA 3L4GB 5CYVA 1IXRC 3W6KB 3E3VA 4M75B 4P9FA 2ZT5A 4UP7A 1WSUA 1QZYA 4H2SA 4HQMA 4EJWA 3RUXA 5D6FA 1BIAA 2IJLA 3RKYA 5JFRA 5E8IA 5CJ9A 5CVUA 3TGNA 1S29A 3KP4A 4ZTZB 3LWFA 3WE2A 1BC8C 1SFXA 2EJRA 2ZXJA 2IY5B 3E6MA 1ZAOA 2JT1A 2VOOA 1LNWA 2H94A 4MEXF 4BWAA 2DO7A 3FXUA 2CSOA 3JCMf 5DUIA 2QTXA 3L2ZA 2HYFA 2ZR2A 3GEZA 4ETSA 2ZO4A 4RGSA 1USYA 4KICA 1IRGA 2IA0A 3KLNA 1YG2A 1SAXA 2DJZA 3SWNC 3WTYC 3JCMg 5J8FA 2FQ3A 5H6QA 2VBXA 1J75A 3A32A 3EQLF 3HHHA 4M7DG 2I4MA 2EAYA 2P5KA 4EVIA 2JN0A 1NJ1A 3ERED 4M7AG 2HOEA 4Y13A 1FYMA 2E7WA 1NJ6A 5GAMg 4HA8A 2O3FA 2STWA 1LB2A 2Z33A 2EA4A 2UXXA 3CO6C 2DK8A 4YFXF 3QPHA 3LFKA 4FX4A 1BIBA 1ATIA 4WXDA 4XBFA 3FIFA 1LOJA 1SFUA 5GAN3 3JB9G 5ELOA 3JB9J 1P4XA 5L3BA 4M72A 1BI0A 4ZH4F 4C92G 2ZGWA 1RUNA 2PEXA 4P71C 2HQNA 3VODA 3M8EA 4HWSA 1T98A 1YS7A 5DCMB 3WU0A 1X2GA 3ABUA 3V8KA 1U5TA 4OOIA 3HTUA 4CH5A 2P7VB 1STZA 3CUQC 3P9IA 3R0JA 4YRFA 1EVKA 4CH6A 2KIFA 1FOKA 4YRMA 2G7UA 2E5AA 2EK5A 3ZMZA 3J81Z 2P4WA 3FMQA 1JHHA 4YIIA 4XTYA 5E1XA 1B70A 1WU7A 5DY9A 3A5ZA 1B59A 2PMEA 5LJ5j 2LSOA 3NRVA 2CQKA 4KNYA 2RC4A 5GAOp 1X01A 1WLEA 4UUVA 1R22A 1W5TA 2AMCA 2DQ0A 4P73A 2BEOA 4U0WA 1MZBA 5D8KB 1MDMB 2VOPA 4RB0A 4Q15A 2ZNYA 3MF2A 3WTSC 4ON0A 2DQ3A 4PJOF 3LSTA 2V6CA 3KP2A 3ICAA 3NEMA 2GXGA 1JBMA 1I1SA 5BQTA 3Q5FA 4A0YA 1NJ5A 5AONA 4L9TA 4L9JA 2MA3A 3SXYA 1X56A 5L3GA 1MJAA 2ALYA 3H3ZA 1U1TA 1W66A 2RD1A 2M45A 3DF8A 3TEHB 2FA5A 3GFLA 4FHTA 3E5UA 2VC8A 1I5LA 1J5YA 1FY7A 3I59B 4I0AA 4ASNA 3KEOA 2XRNA 3V8JA 1FLIA 4M7DA 1LDDA 1QZZA 2V1XA 2ZKZA 3HUGA 2V79A 4G7ZF 3C1DA 1WI9A 3F3XA 1KU2A 1USSA 3DEUA 3TO7A 4C8QA 3TEGA 4M7AA 1UHWA 2LF8A 3FF5A 3GO5A 5E18F 4ESFA 2CG4A 1WPYA 3HRTA 3EFSA 2L01A 3I54A 4RMFA 1H9GA 1YGBA 4P72A 2VXZA 1M8VA 5DV5A 4XU3A 3M9AA 2ZCWA 3A74A 5K1PA 3JCMW 3WGHA 4EMSA 4GYGA 1KQ2A 2FBHA 1H9TA 4XTUA 4RQFA 3RACA 3HRMA 3QHSA 5LJ5d 1FWZA 4MEYF 3WTTC 4QWQA 1H641 2QVOA 4LLGF 1OPCA 1FYKA 3JB9F 2PMUA 5HLIA 1Y96A 3ABTA 2QHVA 3HXXA 4UV8A 4EJOA 1FP1D 1ZH5A 4C92F 1SFEA 1B8AA 3K69A
chains in the Genus database with same CATH superfamily
4II3A 3WGGA 3LQRA 2CS7A 1OEBA 4JJCA 2QHTA 1O3QA 3OW2P 3FZVA 3M0RA 1I1JA 5C3EJ 3IUOA 4HKEA 1KJWA 3KP5A 4LNPA 2QENA 2R7RA 1JKQC 3QU6A 5LJ5h 3G4SQ 5GMKl 2F5DA 3GPLA 1WJEA 3EGUA 1IREB 3T5XA 4C5HA 1ZHIA 2A5WA 3KEYA 5FFXA 1J5WA 2VB6A 3DLMA 2Z16A 5LJ5e 2K2VA 2CGPA 2I4NA 1Z1DA 2HDAA 3V7RA 2IT0A 2DODA 2DTZA 2CUFA 2OTJA 1IDZA 2IP2A 1ETQA 2ZPHB 2L3QA 3VYRB 6PAXA 1SD4A 2CJAA 4J6WA 4HV5A 4UPAA 1ZA1B 2CS3A 4AYBN 2X6OA 1YJ9A 1H3ZA 2QBYB 5F0FA 1YLFA 3GVAA 2GFAA 4ENNA 4CC3A 1VYTA 2X4YA 2Q5HA 2WAEA 3CCMQ 1IL2A 2J5OA 1NNHA 1XMKA 2MSYA 5LHHA 2ISZA 1WJRA 2ENMA 2HU9A 4ZDPA 4PCQA 4RB3C 2LX9A 4PJOE 1QHHD 2DFFA 4N4NB 4CC7A 5DD4A 3IALA 1MBEA 2JVHA 2J05A 2G7HA 4TVYA 2QA4A 1SSHA 3VS4A 3M0SA 4M75G 2KJBA 4L9NA 4FW2A 4JLIA 1VQ8Q 1AEYA 2VXEA 2YRCA 2IG0A 5DD8A 1ZSZB 1OCCH 4BS9A 4F52A 1YITQ 1D8JA 5KNNA 1NJIR 1JT6A 3FLGA 4G6QA 3CPWA 3LGLA 3WHCA 3M4PA 3CUQB 3LSKA 4QPOA 4A12A 2CT3A 3WVEB 2IEKA 4A3KJ 1VUBA 4XN3A 5LEJA 4KN7X 3WODF 1W5CC 4ESJA 4EMKA 4HLXA 1UG1A 6AT1B 2QSHX 5FROA 3BWGA 2XAFA 5F0HA 1OOTA 3VUZA 4BUPA 2OZUA 3KETA 3IWFA 2KT0A 4JX4A 3A31A 3I71A 4AM3A 5L3FA 4IJAA 1FTZA 3JAME 2P5LC 5M5XJ 2CH0A 2RI3A 2FD5A 1ON1A 4M3EA 1VIFA 3URGA 1XSVA 1AHDP 5I2MA 2FOKA 2HTSA 1VQNQ 1Z21A 4C8QC 1OMIA 4U0VA 1M30A 3AL0B 4DBHA 2ZR3A 4HYEA 4FT4A 3JRAA 1N78A 1MBFA 4LG0B 2C8MA 1IHVA 4YPFA 3G3ZA 4KULA 3CJNA 2ROTA 1MGTA 4L87A 2PI0A 2GTOA 3PCOA 4MDXA 1YTYA 1RL2A 4ZZDA 2VXFA 3A7RA 2R93J 2UUZA 2FEIA 1JJ2P 4J19A 3EG3A 3DB4A 1X55A 1Z3YA 1S1NA 2H8HA 2D45A 4YYEA 2MD0A 3G71A 3HSBA 3K1NA 1IW7F 2RHSB 4M75F 3DLLF 2O9SA 4DQ2A 4Y7NJ 4MZPA 3G4SI 3CC7T 1QVGP 4KQEA 2ZPBB 5CKFA 1ZELA 2DJQA 5EG0A 2R7QA 2Y4XA 1X4PA 4OIQF 1JB0E 1Z7UA 2ROLA 1I8FA 3E97A 1R4NB 3BP8A 2COMA 4S04A 4JUVA 1IXCA 4NOYA 4EIKA 2LKSA 2HPMA 3UATA 3QP5A 1TQMA 1D09B 4A54A 3EH1A 3JAMZ 4AH6A 5J8CA 2QLZA 3KZYA 2DVJA 2UWMA 1TNSA 3BCBA 3BFMA 5LLQA 4XONA 3EUHA 1W0UA 1Z05A 2LKPA 4EM2A 5IT3A 4B09A 4CC2A 1L0OC 2DDAA 3RDIA 2YDLA 2KRMA 1HDDC 3CXCS 2EQJA 1K8AR 4AT1B 2ZSIB 2W85A 5DCFA 2DQRA 1LJOA 3DP7A 1RIOH 2L9RA 1IHWA 3CCEQ 2O7OA 2ZT8A 2KHMA 1IG7A 4PUSA 1OR7A 1VQPT 4YRJA 2GBQA 3OYKA 1EV7A 4C8QD 2XDPA 1KA8A 1KGSA 2LDMA 3C18A 3HDDA 3MQZA 3OQ5A 4L6V5 1XNIA 2JPCA 1U5TB 3UF4A 5HS7A 3QO8A 1QKWA 1MNEA 4PLLA 3E5QA 2UZKA 4O6JA 1ZQ3P 5LEKA 1I5ZA 1I4K1 1VQLQ 1O75A 3C3WA 3P8DA 1NEBA 1SMTA 3CCVT 2O03A 2NNNA 2QG9B 3KFWX 3HEFA 1NLOC 1PYSA 2O6GE 1B70B 1JT0A 3OYEA 5GMKj 1VTNC 4FT8A 2VJ4A 3DFGA 3BPVA 3EG9B 3DSQA 4HX8A 2F4IA 4GLKA 3C94A 2JW4A 3VU3C 4NC6A 4J8OA 4RA2A 4AVPA 3MKYB 3BTLA 1G3YA 2JXBA 2LDUA 3M4QA 4UP9A 1HSJA 5E1ZB 4M75E 4LK0F 1G5HA 5KYNA 1VQKQ 3HOWJ 1HW1A 2IVMA 3VYUB 3L2WA 1OI1A 2VBZA 2ARSA 4XSZF 1JXSA 2ABLA 3HRIA 2VPRA 3JCMP 2F2XA 2HKXA 2CO5A 2I8DA 2LVSA 3JCMQ 4J15A 5CKTA 2WAQA 1KQSS 2K4BA 3JTHA 1KC8R 1ZG3A 4C2MJ 2X6XA 1AHJB 3HPGA 3BPXA 1UGVA 4LXCA 1Z7MA 1A35A 2YPRA 4CH3A 2ZNIA 5L3CA 4F7UG 1D1BA 3WTXC 2BE5F 4JBAA 5A0LA 2B7EA 1UGQB 1WJQA 1HC7A 3EHQA 4A63B 1Y96B 3WU2C 4DA4A 3A0HC 3OL4A 3A0BC 2J06A 2EFQA 3ZQGA 2DL3A 1WJ5A 1R00A 2KYMA 2ZZGA 3P8BB 5FKLA 4M78G 1FSHA 5KYYA 2OTJT 2ZZDA 2JPBA 4YRKA 4E51A 4BDZA 4TVRA 4BU2A 5EC7A 2PZ1A 1IB8A 4LLLA 2DJNA 2CW0F 1NH3A 3TSZA 1T08B 1LNXA 4IHVA 3HRSA 2I10A 1YJ9T 1ASZA 1AWJA 1RI9A 3TEEA 4PDKA 2V1RA 3M4OJ 2AIRB 5IT9K 3CCSQ 1QA6A 2EWNA 5M9OA 3F6VA 2BOLA 3VYSB 2RN7A 4DEYA 3J80K 2W0ZA 3EGXA 3RDVA 4PHCA 1UGPB 2F5VA 1Q86R 1ETXA 3BG6A 1U2WA 1TUCA 2JRMA 5GANf 2ECZA 4AVZA 3CCEI 2EZHA 2QA4T 5KH6A 3GZNB 2KIMA 2P7CB 1AWXA 1R58A 3CBOA 3JCMc 3CCQQ 1HKTA 1X54A 3BTJA 4GY5A 3CBPA 5LJ3f 5A0GA 1KMMA 3TDZC 1ZUUA 3TL4X 5K7FA 3ZFJA 4RS8A 1MNMC 2KJCA 4KGVB 2XD0A 2C06A 2ZXIA 3ROUA 4PJOC 1EA3A 2IGOA 2ZXFA 4I98B 5ED4A 4LVMA 1WHMA 4U0YA 1XC5A 4EJVA 1ZREA 2KSSA 3H6ZA 3HOYJ 2HKNA 1UFMA 3PL8A 2DEUA 1KIKA 1DUXC 5GAN4 1SHGA 5C51B 2K4YA 1DQUA 2X1EA 4EMKB 2V8IA 4G7HF 1L0WA 3R6SA 1VQ4A 4LDVA 4M77A 3S93A 1E3PA 5L8RE 1EKEA 3RESA 3VS3A 3MZHA 1O3TA 2FO0A 3M55A 3BZCA 1QGPA 3JSOA 2A37A 4IEJA 2QYOA 3I4PA 5CVIA 1X6BA 1FYFA 4QQGA 3QO5A 4QQ6A 1K0XA 2GA2A 1BJAA 2KZVA 1QNTA 4YRQA 3VS0A 1TNTA 2LX7A 3P9CA 3OR1C 3H5RA 5JLXA 2NS7A 3BC8A 3B73A 2P0WA 4ZYGA 1OQYA 2VLAA 5DYMA 2CT4A 1T39A 1P7JA 4Q6GA 5ERIA 4LIUA 2DX1A 3Q1JA 4CC4B 3G71T 3MKDA 1RC9A 1D5VA 3PCOB 4FTHA 4TQDA 1AKHA 4A4KA 3F23A 2QHSA 4GYIA 3M9QA 2CP7A 5GAEJ 2BXZA 3BJAA 1RLPC 4Z8AA 3H9JA 1OYYA 2WTEA 1M90R 4RQEA 1YS6A 1KC8U 2OU2A 1E1OA 4XQFA 4FSSA 4P5NA 2RNAA 1A36A 4YDQA 2HWVA 4F7ZA 1TW2A 5ILVA 2DO3A 2WC2A 3B02A 1CSKA 1JJ2S 5EG0B 5BMZA 2A08A 2B8AA 4QVDA 4PJOD 3IAS2 3JW4A 2HL3A 1T56A 3QDFA 3S3MA 1QPMA 2DPDA 3OMCA 5GAMf 5E8GA 5D5UB 4G6TB 3E9FA 3R6OA 2ZBKA 4U88A 2IW5A 4R79A 4A2UA 4BJ6C 3DQVC 1QVGS 4ZYAA 1N6AA 3I56Q 1Q7YC 3Q0WA 2RQTA 3ECOA 2OTLA 1IGUA 2NNYA 4F7UE 3J7AF 3CMEI 2FSWA 1NK3P 2PMZN 2DRKA 1W6XA 4ENKA 2GZWA 1ZRFA 1UTIA 2FRHA 1WZOA 2A28A 1KQ9A 2R0QC 2FUG2 5GAOm 3CCQI 4M6VA 3GMEA 2O2OA 4RG2A 3ABLH 4HWPA 3CMYA 3FWEA 4LFUA 2DBMA 1VQ6Q 5M5WJ 2Z3YA 3JRHA 4D1QA 7AT1B 5JHFA 4P75C 3FXQA 5GP9A 3S1RJ 3JB9D 3H92A 1NPRA 4C9YA 3FM3A 2DYRH 4PLIA 1OYIA 3HXLA 3ZBDA 1BI2A 1TL8A 3QAHA 2E70A 2OA4A 2FZGB 1VQOI 4KRTA 2DM1A 4RMOA 4YEJA 2VODA 3VJPA 2JJ9A 3NTHA 3M59A 3TEHA 4FU6A 2E6NA 3VYHB 4D7MA 5D6YA 1PYSB 1KZHA 3ZCOA 1M27C 3TQNA 2DL7A 3EG0A 2F48A 2STTA 2DKGA 2XK0A 3WTZA 4I0BA 5FKKA 4AIHA 1JKOC 4JK1X 3DCFA 3A98A 3BG9A 3OS5A 2LNBA 4MMLA 3Q0UA 3X20B 3CCUQ 4NCXA 1QVFP 2NLUA 2CFOA 4M7DF 2E6ZA 2K6DA 3O5ZA 1FNNA 4JQFA 2D9TA 3HYIA 2QQAA 3EGDA 2VIXA 2DOAA 2OQGA 3OW2A 3BCAA 3GTPJ 4M4ZA 1UB9A 2M0OA 1J0RA 4YFKF 4CYDA 3X26B 1J3TA 4A69C 1CKAA 2IGKA 2PFBA 4M75C 1XX5A 1WVRA 4YRCA 1XOVA 3I5RA 2CJBA 2DD4A 1A0NB 4F16A 3L2CA 3VB2A 3C2HA 3HOXJ 2R4GA 1DP3A 4J9HA 3QG1A 1Q1VA 4OMYA 4XRSG 4KIBA 1NPPA 1K73C 3QYHB 1QF6A 2KROA 2DA6A 3TO9A 1SERA 2E64A 4O3MA 1YJNA 1RETA 2D1VA 4XTZA 2Q5IA 3CCJI 1PNJA 3MZYA 4RAZA 1BBUA 2BZTA 4HDVA 1HA8A 2F2EA 1WFWA 2A69F 3CCMA 4DBFA 1BJZA 3HIFA 2PVDB 2F4OB 2DA2A 2DBBA 2YR2A 4RG8A 2WSEE 2VUMJ 3LOCA 5KYYB 3TUPA 2DEQA 3BJUA 2COBA 4ZTUB 2DXBA 3HPHA 4ZC3A 2GNCA 2L02A 1LDJA 2XVCA 3ZGKA 4YCVA 4LB5A 2JUGA 3DWLE 2EQIA 1VQ8A 2ZSHB 2HDWA 3HP9A 1YITA 3L2VA 3LC0A 3SJMA 3MKLA 2V6EA 4YRLA 2JVGA 3KEQA 3A02A 5E3LA 4P71A 3S14J 4WCIA 4J7IA 4NBQA 4IUVA 3EGXB 4JJBA 3LW5E 1RKWA 1N75A 3JCMb 2DDBA 3HOSA 1N9RA 4XRFA 1P2FA 1IAWA 1USTA 2V1UA 5D6WA 3HGYA 3DBLB 3CF2A 3CMAI 5A2QE 5GPAA 3GTGJ 1EVLA 1Z7LA 2DL4A 3I55I 5ICFA 1JHFA 1IRFA 4X0GA 4C2TA 2JN6A 3C7JA 1RAFB 4LJZF 1ZK8A 3LAPA 1KK7A 1BR4A 3EYYA 2DFIA 3X25B 1U8RA 4M75D 4A3FJ 1I27A 1W1FA 1FOWA 4B4CA 3CEYA 1VQNA 3V7SA 1GVDA 3RZDJ 3S1NJ 3HXZA 4XNFA 4IOCF 1NE8A 2KK4A 2ZC2A 2LG4A 3NWTA 3BY7A 4DYCA 1O7LA 1VQ4T 1H3HA 4AFSC 1YFSA 1R77A 3L42A 3MPUB 1PUFA 2A5YB 4E7ZA 5CVJA 2OAUA 3S3NA 3QPSA 2XI9A 4XL9A 3FKJA 5AT1B 4YP0A 1ETKA 3W2VA 1MD0A 3D7SB 3L9FA 2YUOA 4M77B 3QJYA 1JJ2A 2JMWA 5HS9A 2ATCB 1AT1B 3P5JA 3NMZC 3GIBA 3TP3A 1ITYA 3OIOA 3L09A 2KP6A 3I9V2 3HTRA 1V4RA 2VKVA 1NG7A 4Y3OA 2YUPA 3F8BA 2ZPFB 2OC6A 3ZN0A 3WXMB 2VT3A 4P72C 1Y57A 1ZRDA 4L5GA 3CO7C 2ESNA 2ZT6A 4OLFA 2XF6A 1R9TJ 1MNDA 1QVGA 5CCAA 1Z77A 5FKNA 3IKVA 2IS6A 2M02A 4L0YB 2GQQA 3EFOA 1JEGA 2HEOA 2XPWA 2EKOA 3VKIA 3NQOA 1IXRC 3E3VA 3BR2A 2ZT5A 4J83A 1QZYA 2YUQA 1Y39A 5D6FA 3PT9A 1BIAA 1AKHB 2IJLA 2DNUA 3ASOH 3LWFA 3WE2A 1BC8C 1O4XA 1WLPB 3A8OB 2L9SA 2H94A 3FXUA 4OAYA 2EYYA 3GEZA 4ETSA 1HC8A 2HSPA 2ZO4A 1G5VA 1IRGA 4BD3A 4LN2A 3OS1A 3FHNA 4J9FA 3WTYC 5CK9A 2LMJA 3JSCA 1J75A 3A32A 1TUDA 2P5KA 5J3BA 3REBB 3LGFA 3LSHA 2JN0A 3HB9A 2EH3A 3JRDA 2EINH 4EEFG 2E7WA 1NJ6A 2QGGA 4R55A 3AG4H 2STWA 4A4EA 4BXXJ 2OTLT 2UXXA 3CO6C 2DK8A 4YFXF 2XSJC 2CJJA 3LFKA 4FX4A 5GJWB 4C5EA 2CH4W 3K6GA 5ELOA 4AMCA 1K83J 1BI0A 4ZH4F 2HAXA 2ZGWA 3OYNA 3L2QA 3VODA 1VQLA 3G1MA 4LE9A 1SRMA 1JTXA 2P7VB 2Y0SN 3CCYA 3R0JA 2OJ2A 1EVKA 3AKZA 4CH6A 1FOKA 2FOWA 3IP4B 2BIVA 3FMQA 1JHHA 5GADJ 4JS4A 4E7IA 5E1XA 5DY9A 1W2BP 5GPCA 3NRVA 2CQKA 2RC4A 1X01A 4UUVA 2AMCA 2KQWA 2DQ0A 2WV1A 1ZTRA 5D8KB 2EBPA 3ME9A 2JM9A 2M0MA 4Q15A 4B44A 3OYMA 3MF2A 3WTSC 4GFBA 2CREA 3AT1B 4XKWA 3VRYA 3PSIA 1VQKA 5J26A 3KP2A 1ENHA 3ICAA 3NEMA 4E47A 1I1SA 3EUKL 2KGTA 1NJ5A 2PUKB 2P0QA 2ALYA 2ZMEC 4DGWB 2H1KA 2EILH 3TEHB 2FA5A 2EYWA 2CU7A 3E5UA 2CP6A 3H5NA 1J5YA 4ASNA 2XRNA 4PJJA 3V8JA 1LDDA 3ONQA 3C1DA 4C8QA 1USSA 3J80E 1D1AA 2F6CA 4BXFA 3GO5A 1AA7A 1WPYA 4CCNA 4CCMA 1XTAA 3KPHA 2A6TA 2BKDN 1CQTA 2BE7D 3M9AA 3E1SA 4KGXB 3EPZA 3LX7A 4EMSA 1ZBJA 2ZPEB 3BQZA 4MEYF 2PMUA 4KT6A 1KHIA 3ABTA 2QHVA 2EKHA 4UV8A 4EJOA 2ZPGB 3EGDB 1ZH5A 3LSGA 1RAAB 3K69A 5CKHA 4C5IA 5CLSA 4QIWN 2HVRA 2RHQA 1G2HA 1X1DA 4HAMA 1ACIA 5IYCJ 2JM8A 1YJNT 2BYVE 3CPFA 3MFKA 1YHQQ 3QOEA 2XAUA 1GDTA 5J40A 1A04A 3S2HJ 3H9NA 1DU0A 2DAQA 4TVWA 3FDRA 2R7ZJ 4LG3A 2EGEA 1QCOA 3CCMT 5E1WA 4AIJA 3M8JA 3CCSA 1YJWQ 2EYQA 2DU7A 4DOVA 2TRTA 4ZN3A 2M7AA 3WU1B 1Y0MA 1SVOA 3OWTA 4A3DJ 4YREA 5GAOn 4OP0A 3SDZA 4CDGA 3VWBA 2X4JA 4P9UA 3J80Z 2I4LA 1VQ8T 2AQFA 2BVMA 1OCOH 1Q82U 3KYCB 1PCXA 5K5QA 2DD5A 2VVKA 1U9NA 1MV0B 4H2TA 1XD7A 1YITT 1OLTA 3IV5A 1EF4A 4RTYA 1MKMA 1JXMA 4KUDK 3O3KA 2HBWA 1EIFA 3RF1A 2XRLA 1D3BA 2ZAEA 3TP0A 3NELA 2LOOA 2HZDA 1S72I 1KG1A 5CO7A 4JPBW 1R4MB 2O88A 3FXOA 1WI3A 1Q7YR 1GL5A 1V5GA 4Q5WA 1VQ5Q 2L0AA 3IH2A 4C2UA 2WADA 1EH6A 1PC0A 3DEEA 2DBKA 4XTWA 2L2PA 3G6EI 1SAUA 2NOGA 3CQZJ 4P73C 4YIFA 3HL8A 1P7IA 1RZ4A 2VASA 1VQNT 4KFCA 4AFZC 4AG2C 2FG0A 2OAWA 4FYWB 1G3TA 1MBKA 2E10A 2FRYA 3MD2A 3HXYA 1IN7A 2RDPA 3SQNA 1TBXA 4YRTA 2CYZB 2HTJA 2CZ0B 3GFMA 4I6ZA 2ECBA 4E7SA 2D1XA 4IF4A 4Y52J 2H8RA 4P3NA 2FX0A 2K5FA 3KE2A 3CDHA 2RHYA 2KY9A 5E3IA 2CUJA 3A8MB 4M7DC 3ZMTA 2HL5C 5CQGA 1EIYA 3FM5A 2XKPA 1FMWA 1PUFB 4JRPA 4IO9F 4IHWA 3IWZA 2ED0A 3W3CA 1IN5A 2YRVA 2EFNA 2MPXC 4A4GA 3SZPA 2C0IA 4DOWA 2ZZEA 1XCVA 5AIQA 1RNLA 2JNGA 3FXMA 3MEYA 2CIMA 4RUGA 1N25A 3ZN1A 5EZHA 3ELKA 1XGSA 2PBIA 1IC8A 4PNOA 1MBJA 2YLBA 1WX6A 4O2DA 1WJFA 4WCGA 3P8YA 3PO2J 4JZ4A 2KBTA 3QU3A 2WACA 1X58A 2AKWA 1WJDA 1VQ9Q 2GA1A 1YHQI 1C0MA 3EFOB 4RLQA 3CCRI 2MG4A 1A5JA 1SRLA 3PIPF 4YRGA 1WHJA 2PN6A 1FX7A 1ZYRF 1ADYA 1U6GA 4QLCU 1YJWI 3I56A 3J7ZI 1YI2Q 1M2OA 2BZ8A 4H4KC 2F5KA 1K73R 1Y56A 2LCLA 4PFOA 1M3AA 3EG2A 4JJNK 1ABQA 1Y1WJ 4Z2YA 5JHUA 2EGCA 1HXDA 1N9WA 2K4JA 1VYVA 2RK2A 3S6WA 3MCZA 4F55A 4I2OA 4LD5A 1SFOJ 2ECCA 1G8XA 3PUFA 1E6HA 2G4CA 2QK0A 2ZIOA 4OB3B 5FJ8J 3VS1A 4W1UA 3OR2C 4HBLA 5DDGA 1ODDA 4ZJZA 1VQ6A 3BOQA 2KKOA 3BJ6A 1MBHA 1YFTA 4FIBA 4GO1A 1VQLT 5K7ZA 3E9GA 1YWOA 3AHUA 3LSMA 3MO8A 3SEMA 4M7DD 1OU9A 4HF2A 2K7AA 1ZBXA 1V29B 4XMYA 3AG1H 5LHGA 5LJ5f 4JZ3A 4QVZA 3T0YA 3K1PA 5EEGA 4XQ3A 4X5OA 4RB1A 4H2VA 1VQ5I 1EFWA 2DA5A 4J6XA 2KT1A 1J7KA 5J47A 2E5QA 2Q7HA 1UUEA 4PJOA 4OB2B 1R6RA 4YELA 1K61A 4R0KA 2CSQA 4EGZA 1H88C 3F22A 4M74A 2FBIA 4BHBA 3FRNA 4C0FA 2XASA 3JRCA 1M1KU 5GAN2 4XKBA 2AS5F 4M73A 1VQKT 3OSSC 2V9VA 1UJYA 2GXAA 1PP7U 2AMCB 5E3OA 3ZPLA 3CCUA 3CC2I 3UKGA 1HKSA 3SHWA 2ELJA 1VQ7Q 4HVCA 4A5MA 5FRMA 3FXJA 2VL8A 5B3SH 1QVFA 2EVRA 5J1YA 2L0KA 1EX4A 4ZGEB 2BVLA 1S9HA 1X6OA 1NG2A 5KCHA 2KRFA 2JJ7A 4Y15A 5IHIA 1W2BS 2IAIA 2V7FA 3OS2A 3WGIA 2ALYB 4CXFA 3META 4HG2A 2ZCFB 4HF0A 1QVPA 1E17A 4OIRF 2K5IA 2YUNA 3OBYA 2RQUA 5F6FA 5B1BH 1W4SA 1AZEA 4C8QB 4NC8A 1L3LA 3E9IA 2ADUA 1ZG1A 4C8QF 1TWAJ 1YX3A 3BR3A 3I7FA 3K0LA 5I22A 2RO0A 2HOSA 3HKSA 3C2GA 4UV9A 1J59A 2HQHA 1RESA 3CCLQ 1W5SA 5KCOA 5K1XA 1UEBA 1TQIA 2FMLA 1LVAA 4OAZA 3HL2A 2KDOA 2AK5A 1I3AA 2MW8A 3W6VA 2HCKA 1ZR2A 1ZHFA 3TBIA 4DBQA 3M3YJ 4WF2A 2QTVA 2KQRA 5DM7F 1KMNA 2Y31A 5GAN8 2RHQB 2DZCA 2W25A 3JRFA 3MZ8A 4N9IA 2DK5A 1OZ3A 2XPUA 4G7OF 3CCST 2GAUA 1JJ8C 2K9MA 1BM9A 5GMKh 4MTDA 3JB9H 4QW2A 1AOYA 1BC7C 4RCCA 1QP3A 4A3BJ 3TW7A 1NYRA 1S7AA 2NUPA 3QIIA 3WG9A 1OCPA 1GBQA 2XGDA 3DU5A 4EJTA 5FU7C 5GMKe 2OF7A 4Y91A 1UCRA 2DFUA 2LJ3A 3K2AA 1X2NA 2X0LA 1CGPA 4UVAA 2RPNA 3OYGA 2R5MA 3TDUC 2VKHA 1X2HA 1K73U 3ML6A 3GTMJ 3HSFA 4HNTA 2MF2A 2LP5A 4OIOF 1PG5B 3QDRB 5D6XA 3ZQIA 4M71A 2VBYA 2WAQN 1UHSA 4S05A 2KEAA 5GAGJ 2BE9B 1T0HA 2RA2A 1GRIA 2O31A 3ZMUA 2AZVA 2EPDA 2DDZA 1G5IA 3S1QJ 1D3BB 1KSWA 1QVUA 1RIQA 3IH3A 1WGXA 2A3SA 1IRZA 1LFUP 4HT9A 4CSWA 5M3MJ 4P75A 2EFWA 2JUFA 3K4MA 1DJ7B 1TQPA 1LFPA 4Z02A 2ZCEA 3GF2A 4KMUX 1FZPB 5CKBA 4KDPA 4XR6A 1VQMA 3I35A 2LCSA 3OL3A 4RLFA 2VYTA 3KZZA 2QSGX 5FWCA 4F04B 1B7YA 1GXQA 2DK3A 1H92A 1JUPA 2CV0A 1V76A 2EQRA 1RRJA 1XTDA 4LD6A 1KU3A 2XGXA 1GV5A 2FF4A 1FMKA 1WJCA 4ME7A 5HKCA 1HD3A 4HZFA 3T8RA 1IXDA 3IAM2 2RF0A 1E2XA 4AIDA 2CW7A 4I7HA 3I4NJ 2DW4A 1F1BB 4OF1A 4HCBA 3N05A 1NBEB 1CF7A 4P55A 1PYVA 2KNBB 2E2IJ 1EIYB 2NVQJ 2RHXA 3BR0A 4HV6A 1Z6RA 3SEQA 4FX0A 1QPIA 5FLMJ 4M75A 3DLLA 1JO8A 2CZ7B 3CCLI 1HDPA 3A8HB 2W10A 4KA4A 12ASA 5EDNA 3V7CA 5FO5A 1OISA 2COZA 2DT5A 2MLGA 2X35A 2Q7EA 2WV0A 4FYVB 1B76A 2F2VA 5GAOq 1WJAA 2F5EA 1MMSA 1XN7A 2PNIA 4CZZA 3R0AA 5HS8A 1AOJA 4ZGJB 4F92B 5F08A 2AKWB 2DT7B 2CW8A 1Y07A 2HOAA 3FK6A 2Y2ZA 3PNVA 4KT0E 4YTLA 3I56T 1JE8A 2CUBA 4GBQA 4XIDA 4RCBA 4IVNA 4VUBA 1ETYA 2XB5A 4EGYA 3CC7Q 4IKFA 4XOTA 3ESWB 2UXNA 4RTTA 3CESA 3QZ5B 4KISA 2CP5A 4M9ZA 5KHDA 4OWRB 2XV4S 2JT4A 4JP0A 1J2XA 3SHFA 4HT4A 2CQXA 3I3LA 2LVMA 2ZFUA 1UZCA 1JU5C 5DCMA 1SF9A 3VQWA 2ARUA 2KT8A 1VQ6T 1V54H 1FJLA 2RJCA 2J3MA 2MBFA 3H9QA 5KYUA 4FW1A 1MW7A 4JS5A 3SD4A 3ZQLA 1W2BA 1ABOA 4AFQC 5HCKA 4Q5SF 3UH0A 4JRKA 2VBWA 5LD2C 1G2BA 4EO4A 3QYEA 3OYFA 3TEDA 1ZA2B 1OULA 4K87A 1MDMA 1TT0A 2QHUA 1BU1A 3E7LA 4D0PA 2ISYA 3BR5A 2ZT7A 1VQPQ 1JGGA 3IKLA 3WVDB 2M7BA 4IHTA 2LT1A 2V1NA 2C7IA 1G3SA 2GGRA 4PJOB 1KQ1A 2GXBA 3CCUT 2JA5J 1Q81U 2HI3A 1OYWA 1UELB 3I59A 3HOZJ 5ICEA 1ERDA 2NUTA 3JRZA 1ZGAA 4DOZA 2EIMH 2MOXA 5M3FJ 3A5YA 2DMTA 5A0DA 2E71A 2K27A 4MGRA 2LY1A 2E35A 3S2DJ 1JRIA 2NAZA 1QO0D 3ULQB 1Z67A 4KIFA 1JXOA 2W82A 4BE0A 5H6RA 1KU9A 1V3FA 2FJ1A 2E3IA 1MH3A 2Z5UA 4ZTFA 4GLMA 4FSXA 3QBYA 2XTIA 3E0JB 5C53B 1U1SA 4RAGA 2X3WD 2DOFA 5GAMe 1YNZA 1FMVA 1P4AA 4M7AF 2FYKA 2QAZA 1T0FC 2LMDA 5GAN5 5D5VB 4RKUE 2MC3A 2E5ZA 3VDXA 3CC4A 4E7JA 2EPFA 1S8NA 1NJ8A 4PFZA 3MKWB 4P74C 2RJEA 3SFIA 2JMCA 2WB1A 5HY6A 4LK1F 2ESWA 1SVLA 1U8BA 4FM4B 4KITB 2F5FA 5ICCA 3RSNA 2EYXA 3E19A 1QWFA 2DIGA 4ZYDA 2JSCA 4AIKA 3KYLA 1UG0A 3CC7I 4UNOA 2LT4A 4A3LJ 2M30A 1K9MC 2X4XA 1BBYA 4BH9A 2R5ZA 2DOEA 1ON2A 4QPQA 5IXBA 1XPXA 2X1CA 5F0CA 1UJ0A 4CYCA 1TT5B 2FE3A 2UV1A 2NUPB 2ZIMA 1EZZB 4G8XA 4RTUA 5CR2A 2KRHA 2JA8J 3GTOJ 1MMNA 1FBSA 4GGGA 2KRSA 1NLPC 4UY8I 2ED1A 1VQ5A 2QQSA 2R7XA 2D6FA 2JRTA 3VSLA 1QCFA 3HTSB 4UUSA 2JUCA 1ZG5A 2KR3A 1WXUA 1HQCA 1LDKB 3U2RA 3HZJA 4WTOB 3PGGA 1UB4A 2HFHA 2JSPA 2DA1A 1QW1A 1JQQA 5LJ3g 1MH4A 2CWEA 1RUOA 1LVKA 4OMMA 4B9XA 2K5LA 1YIJA 4H2WA 2X6WA 2QA4Q 4HLYA 2EZIA 2HVSA 5EEHA 1OCZH 3RKQA 1RADB 1E22A 3JCMV 1VQMT 1VQPI 4X1EA 2CMPA 2LJ0A 2XAGA 1SVMA 1X2QA 1YFHA 3PFSA 5AYFA 4M7AE 3KBGA 3IKMB 4DIQA 4D5CA 1ETOA 5DEQA 1HLVA 5FFZA 1M8MA 2DZ9A 1VFCA 5ECAA 2DAOA 3GFIA 2AO9A 4MO7A 3NENA 3K70C 2ZMEA 3CCVI 5F64A 2FQ4A 1B7YB 1H4SA 1AVZC 4W97A 2E5KA 2JTMA 1LYLA 2DLPA 3RPUD 1M9SA 4AU7A 1ZLJA 4YG2F 1C1AA 4FT2A 3CD6A 3E6DA 2DPPB 3O6BB 2J6KA 2ZPIB 2H09A 2PU9B 5LGNA 1Z6TA 5GAN7 1IV8A 3QOPA 3GNGA 1LUJB 2BHZA 2PMZA 1XSDA 1PP8F 2M8EA 2PJRA 1H89C 2P0LA 4LD9K 1SD7A 1PM3A 4OGEA 3THKA 1VQ9A 2AHQA 2CRGA 1OX8A 5HDGA 4HWOA 1I1GA 3QO7A 4HXJA 1ZSGA 3CUOA 1CF7B 2W4SA 4A0ZA 3HM5A 4YIRX 3CMQA 4KGZB 4J9BA 2L7ZA 3DPTA 2IGMA 2YRDA 5HOOA 1D3YA 4PZJA 3EFRA 2CDTA 4NB5A 2FXAA 2QEXA 5D5XB 4L9VA 4LVIA 1PKSA 4M75B 9ANTA 1YI2A 3MN2A 1WSUA 5IHNA 4H2SA 1SHFA 4HEA2 3GTKJ 4EJWA 1NYGA 3RUXA 4BQNA 1TC3C 4I99C 5E8IA 2D8JA 1TWHJ 2ZXJA 3E6MA 4F14A 4MEXF 2BZXA 2DO7A 2GF7A 2CSOA 5CIUA 2JVVA 2NVYJ 2VQLA 4FYXB 3AG2H 3RNJA 3M0TA 3KLNA 4CCOA 2CH4A 1SAXA 2BUDA 5B66C 2DJZA 2NYSA 3SWNC 2R7SA 4BY1J 1B3QA 2FQ3A 2HVQA 3WG7H 1UECA 3H1CA 1MHNA 4V2GA 1OJLA 5EEAA 3ERED 3BG7A 4Y13A 2LQ8A 4IOAF 5GAMg 4HA8A 2OTJI 5FKOA 2EA4A 3QWYA 3DTEA 1BIBA 4ANJA 1I5OB 3PO3J 2M4KA 3FIFA 1LOJA 4ORZA 2XMFA 1WIEA 3K70D 1YJ9I 4C92G 2HQNA 3G1OA 4MZTA 1FEXA 1YP5A 3MP1A 3S1MJ 1PSFA 3PIOF 5DCMB 3V8KA 4OOIA 3HTUA 3G7ZA 1STZA 5IP9J 2DA7A 2VPLA 1I07A 5LFAA 5KYUB 3G1LA 4D9JA 1BK2A 2EK5A 4C0DC 4DBRA 4XTYA 2A8EA 2X3XD 1WU7A 3MP6A 1B59A 2QA4I 5IH2A 2PMEA 1VQ7A 4KNYA 3PSFA 1WLEA 1D0ZA 1R22A 4DZJA 4CCLA 5IYDJ 2VXDA 4P73A 1SG5A 5KE2A 4A93J 1MDMB 4HNUA 4ON0A 1W0TA 3LSTA 2V6CA 4BQOA 5DM6F 1NJIU 2DFHA 1OYXA 3F70A 4B9WA 2DL8A 4A4FA 3Q5FA 3LFUA 1X6GA 1TZLA 5AONA 4L9JA 2MA3A 3SXYA 3QYGB 3PM1A 2CV1A 1MJAA 3K4NA 3QODA 2E60A 2XIDA 3Q0VA 1K9AA 2Q1ZB 2VC8A 1T0JA 4LOCA 1FY7A 3I59B 3KEOA 4RAFA 4M7DA 2NUTB 3HUGA 2V79A 3MEVA 1TTHB 3F3XA 3TO7A 3DEUA 2JMAA 2DA4A 2R5AA 1I6HJ 4ESFA 2KLOA 3PJRA 3I54A 1H9GA 5CQEA 5DV5A 4XU3A 1IUFA 1YHQT 3A74A 1Z0XA 1H9TA 4XTUA 1FWZA 2ID6A 3WTTC 4MFDA 2QVOA 4LLGF 3W2WA 1OPCA 3BR1A 1FYKA 5IN1A 4RTWA 4JX6A 5IY5H 4C92F 3KXTA 3L2RA 1IN4A 3CC4T 2FNAA 3N4MA 3HBLA 5F5WA 4NL2A 2KVQG 3GBGA 4C0GA 2VT2A 2XF5A 3OMGA 4PSWA 2DCEA 4PJNA 4K88A 1OU8A 3ASNH 3ZQ7A 3R07A 5JI6A 1SETA 1G3WA 1MJ9A 4RGXA 4MMKA 4Z89A 3MP8A 3D5RC 5CKEA 2ZFWA 2D8HA 2KYBA 3QSUA 4WXHA 2MC4A 4NUBA 11ASA 3NWSA 5LL6S 1Y8RB 1YQAA 1H8AC 2CQ7A 4XSXF 5LRRA 1IN6A 2P0PA 3EAEA 2DVEA 3MJXA 2NRAC 2O9LA 3KYDB 3VS7A 1F36A 2F5CA 3SB2A 3LSQA 1X1BA 3O8HA 1WA7A 2QI2A 3OW2S 5FD5A 2A68F 3NEUA 2DXUA 3EETA 5H2FC 2R5ZB 1VQ5T 3D5SC 5E3NA 3UDCA 1R5ID 2WA0A 4CYCB 3ZQCA 2KIUA 3CMEQ 3HXWA 2B86A 2A0FB 3H0GJ 2L3SA 1YO5C 3BTIA 1SD6A 3QWLA 4BBRJ 1T3SA 4EJUA 1EQRA 5GANj 3HFNA 1D5YA 3H3VK 2M87A 3L7WA 4MQVA 2CZ6B 3K4KA 1P4WA 2DETA 5LGUA 3FISA 4R56A 1O9SA 5C0MA 4UUSB 1YIJT 4TVAA 2LC2A 4JRQA 1Z91A 2LK2A 2DE0X 2NS8A 2E36A 1LPQA 1K8AU 2FHDA 4IRIA 2QZ8A 5LJ3j 4XRSA 1SPKA 1ORKA 4H02A 1FBQA 3HGGA 1N8RR 4IL6C 2LTOA 3FHZA 2AQEA 2AKKA 2EV6A 5HLTA 4F7UF 1VQOQ 1IRXA 1U0JA 3M7GA 4B48A 2LRQA 3VBBA 4BNCA 5DLQE 1Y6IA 5CQXA 4EDUA 2PG4A 1Z9QA 4FQGA 2MI6A 2YXYA 2VI6A 4C92E 2DQLA 2IVWA 4LLNA 3CD6T 3GNFB 2OX7A 3GX4X 1PJRA 3OD1A 2PQWA 1CKBA 4M78F 1K4US 1JUMA 3IRRA 2EJFA 1BW6A 4XLCA 3ZP5A 4A3GJ 4RB2C 2ZMEB 1TU0B 3QTCA 3TOAA 4M7AC 1XCBA 4FISA 2GTJA 5IPAA 1JKRC 2HNHA 4ESBA 1B9NA 3H35A 3X28B 3NTKA 2QASA 1VQ9T 1TW3A 2BBYA 2VJJA 5LJ3d 5GTHC 4BKXA 1SRYA 2LBFA 4RGRA 3Q3SA 2Y0SA 3ABMH 2BV6A 1RAIB 3FBNB 2PJRB 4A3JJ 3ZEHA 3DTIA 3VQXA 1WDXA 2QEXT 1GXPA 3WTWC 2J6OA 4PJOG 3A1YA 1F43A 2CGHA 1YI2T 2EQMA 3HY1A 1TSFA 1BYMA 1JTYA 5JVGF 3CTAA 5D4SA 5EF6A 1WRJA 3W6JB 3PFIA 3M8FA 1UJ8A 3CXCP 4XEMA 1Y8QB 1ZQ1A 3M1CA 1N9SA 2DIQA 3VV0A 4BACA 3CCJQ 4XTXA 1Y0UA 2XB0X 2JQ7A 1VYUA 1VF9A 4TTVA 2EQKA 1K1ZA 3F8NA 3JRIA 2VKNA 2MYSA 3BDDA 3DEWA 3FMSA 4FETA 3RMSA 3ECHA 2OZ6A 3I58A 2QDYB 2M34A 1WYXA 3NPFA 2XUBA 3SYTA 3RBBB 2OUMA 5GAMj 1BOBA 4XKVA 3PNWC 1SESA 1RI7A 4JYKA 4IXAA 2PUOB 3TOBA 3DB3A 4ZGDB 4IPAA 2E41A 5HVQC 1D1CA 1IO6A 3M0PA 1TWCJ 3ZMDA 2E2HJ 2P8TA 4DPGA 3K4CA 2WAFA 2L4AA 4RBOA 1GUUA 4HNVA 1K9MR 2HD0A 3BQYA 4A3IJ 3X2QH 2OTLQ 2ZTGA 2RV8A 3KLOA 1RACB 3F9KA 2HMAA 4M7AD 2RJFA 1HOMA 1T2KA 3DKMA 4LB6B 4X34A 3RQIA 4I76A 2ESHA 1IJWC 1PHTA 3JTGA 4X9DA 4U7DA 4C30A 1Q86U 3COAC 1F9NA 4M78E 2K3BA 1VQ7T 1M4ZA 3IL2A 3MEUA 3CMAQ 3VYGA 4CH4A 1FPQA 3I55Q 4PFPA 3CZ6A 4IURA 1G4DA 5IOZA 3TKYA 2NYXA 1NG6A 4PG3A 1EFNA 2EFOA 3HXVA 4U7BA 3C2BA 2EIFA 1D0XA 1T3LA 3LQQA 3T8TA 5K5OA 1PUEE 4XN0A 4II2A 1RPWA 1S5LC 1BB9A 4DEXA 4RGUA 4J00A 3OYBA 5GAMd 2RJDA 1GGMA 1X3UA 4CO8A 3OBWA 3MVPA 2R92J 2Y90A 1XMXA 4B3XA 5CQYA 4MNUA 1E1TA 2NOJB 3DKXA 3PVQA 4U87A 3MCAB 2R7WA 1QKXA 4UB8C 2Y9ZA 1VQ4I 1EOVA 3BZKA 3MQ0A 4M7DB 1ZUKA 3BT9A 2HSEB 3HUGB 2PMHA 2K5CA 3DXJF 1E6GA 1TWGJ 1LEBA 3M0UA 3SZGA 3HRKA 2ZNZA 2CP3A 2FVUA 4PGHA 2PJPA 3G4SA 2DU5A 3H9GA 3QO3A 2G0EA 2RQVA 2L3DA 4N0AC 2HDCA 2DLLA 4RTXA 3GOXA 2A36A 4E70A 2HYJA 5I11A 4WX9A 3LSSA 2V1DA 4CHUA 4J9CA 4WK8F 2IRFG 5KAIC 1OZ2A 2XF7A 2O0YA 4XLAA 1C6VX 1NJ2A 3QZ9B 3QYFA 1HF0A 2C0OA 2FMYA 5DM7R 1YJNQ 5LBQA 2EJ9A 3E6CC 5K5RA 1BI3A 1PRMC 1SFKA 3NHNA 3BDUA 4IRGA 2O5RA 4DZPA 2AKLA 2QXFA 3P8VA 4IHXA 1M3CA 1M90U 1XS9A 2R7FA 1J09A 3JV3A 4IUTA 4YRIA 2EL9A 2NUZA 4LDUA 2FRWA 4RDUA 1LCKA 3OYHA 2H27A 4HT8A 1AWCA 2K3XA 1VNDA 2LRDA 4JDSA 2PLYA 1ZX6A 3LNQA 3HKZA 1AD5A 4B47A 2K9QA 4HCZA 1Z9CA 1B8IA 1RAHB 2V8JA 3V8LA 4HCKA 2JA2A 1ZLMA 4DYQA 2EB7A 3O8VA 2KXCA 4DNCA 2MK5A 3V42A 4HDUA 2OTLI 4BE1A 2RN8A 2L9NA 2MAMA 3H0DA 2DF6A 1ARKA 3MWMA 2B9SA 4UP8A 2XDDA 1JJCA 1V5FA 1B34A 2HGCA 1K9MU 1YE9A 4PK4A 4O5VA 4LUDA 1YW8A 4BHPA 4TVAB 4A0XA 2QM3A 2R7OA 1ONVA 2YU9J 4JX5A 3TVTA 2QQ8A 2EIJH 3NARA 1MGQA 1S7OA 2ELHA 2YHTA 2BGCA 2ME0A 2EV0A 4A5NA 2KMTA 3M07A 2WY7Q 2NS0A 1FYNA 4NDLA 3VEPA 4B3AA 3OSGA 4AG1C 5FLXK 3UGTA 3ERMA 2PMFA 4F91B 3TQ7P 1EH7A 1ULYA 2IXSA 1X1PA 4FE7A 1WPKA 3S15J 2OAZA 4YCUA 4A3CJ 2G6FX 2HQAA 1TH7A 2MD5A 3AAFA 4BQQA 2CSIA 4C92C 4MIMA 1T0FA 3M1EA 2E34A 1JKPC 1OCTC 2JA7J 1QU3A 1EJ9A 5KK1A 2M0CA 5ILSA 2ACJA 2I0NA 3FXRA 3GYHX 1W7PD 3M4YA 1E7OA 5A2QK 4M3BA 4QVCA 3M56A 4X1VA 2RVCA 3P8HA 3H41A 2LBFB 3PIPA 2GIZA 2RQQA 4NQWA 1E24A 1NYQA 4N4HA 1M5Q1 1XB4A 1E3HA 2MH2A 1MMGA 1YBYA 3KZIC 3A03A 2HXIA 3U1KA 4P74A 2OV7A 3RPUA 4D7NA 1KONA 3FJPA 3DPUA 2EBIA 1ZR4A 1D8KA 4LUEA 3CLOA 2XG8D 2EIKH 1UGRB 3JR9A 2OPTA 3VQYA 5E3MA 1C0AA 4A3MJ 1YJNI 4IQ4A 1ZN2A 4EX5A 2CV2A 1AWWA 1T6SA 5LGTA 2PQ8A 3RYRA 2W24A 4ZNXA 2HZTA 1V1CA 2XU8A 3RTRA 4IIOA 2LNHB 4G94A 4N4GA 1OPKA 3CCEA 3CCMI 3PQJA 1DU6A 3EUAA 2TDXA 3N5BB 4Y33A 3GP8A 4UB6C 5FU7B 2J3LA 5J1UA 4M6XA 5GAN6 2FPEA 2E1MC 2RREA 3DKYA 3SFZA 4AUXA 2YLCA 3DBHB 5GAOr 1MUZA 5J6XA 4BBSJ 2IPOB 4WJ4A 4B43A 2KIQA 2ARTA 4M3FA 1JI8A 3QPLA 1VQ8I 1K4SA 3GLLA 3LSIA 3M57A 2ZJRF 1YITI 1S72Q 2HPIA 2GCXA 3E6BA 1B6AA 3HC7A 5LJ5g 3QP6A 5KCMA 1O3RA 2COWA 3A7AA 1YN8A 5HLGA 1FBUA 1IF1A 2ICWG 2JS0A 1AWOA 4CS2A 4C92D 4I09A 2XGTA 3ZMSA 1S6LA 1B72A 2XDBA 3UGQA 3G6EQ 1V5EA 4YROA 5ELNA 2AHJB 1Z9ZA 4JRIA 2KDZA 2LTPA 2XHCA 3REOA 3D0SA 4KN4X 3OS0A 1U78A 1KQ8A 1HW2A 5FLVA 4M78C 2G9WA 2VKEA 3JCMh 3FEOA 2DU9A 3U9GA 1RKTA 1R5HA 2EZLA 2JZYA 5M5YJ 3W3SA 5E20A 1VQNI 3QRFF 3FXLA 2E1NA 3EH2A 2C0TA 3SEZA 3FDYA 5JVTA 3G2BA 3GCMA 3JCMe 5IT9E 1KQ0A 1S3JA 1GCQC 2L9VA 3I5UA 5FU6C 1W4MA 5C4XJ 3EG1A 4NS5A 1U5SA 1R7JA 4KYWA 3G4ST 3FKIJ 3REUA 1QHGA 3FJ5A 4UVBA 2CP2A 1XSXA 2LQWA 4N4IA 4CGZA 2LH9A 1OKRA 4M9XA 2K3YA 2K7LA 1Q82C 3RKXA 3JREA 2EFPA 3R4KA 1B9MA 2V1QA 3QQAA 2RHUA 4L59A 4KT5C 2ODRC 1BBWA 2L5QA 2HQXA 2ZNJA 2LF7A 3F0CA 3OSVA 2XICA 3VOEA 3L2UA 1O7FA 1FXXA 2E4HA 1T33A 3CP2A 3IH4A 3KFUA 3JCMX 3OSFA 4OIPF 2P4TA 3DV8A 4ENMA 3T9NA 1TOVA 1QVFS 3CCRQ 4AC0A 1MMAA 1WKMA 1W36C 2JTFA 4L0ZB 1LEAA 3KP3A 1G51A 4AWXB 1XGNA 1ZKGA 2J7IA 1R8OB 1WXBA 3A8GB 1RR7A 1RAGB 3SWNA 2NVTJ 2D2WA 3I64A 2BY3A 3ZQQA 2VC0A 3KP6A 2CUEA 5IHKA 3CMEA 2ELKA 3KCCA 4BE2A 4G6DA 4AD9A 2LR8A 1LKXA 5IT9Z 3ZL7C 3LH5A 1YWPA 3CCQA 3MHXA 1QLYA 3UPUA 1W70A 5KNLA 4M78D 4G12A 2P6SA 3K4BA 3K10A 2VWFA 2LP0A 4XU2A 1A31A 4BY6C 2DTRA 4BJ5C 5I21A 5L23A 1R49A 1OCRH 1E0EA 1TG0A 2EJGA 1YFRA 1B8IB 4YRRA 2GBYA 2KAFA 2FU4A 3F72A 4EM0B 2VE8A 2A3LA 3C95A 1VQOA 2O8KA 1WWXA 4RTZA 3EYIA 4Y28E 2XKOC 1VQLI 3MMYB 1XQHA 2LY9A 2AXTC 1SEMA 4MTEA 2QQRA 2BTTA 3OMYA 2KZGA 2WB1N 1FSEA 2SRCA 1JJCB 1B34B 1M1FA 1XDUA 4XAXB 3ZRGA 2BY2A 4OMFB 1TWBA 4AFUC 1BOAA 1U9OA 4PKCC 2L7FP 1B4AA 2ODRD 4G9YA 4L18B 3ULRB 2X6YA 1DPUA 3QPTA 1X75C 2VONA 2QKLB 3CC2Q 1QMCA 3O2PE 2EZKA 4P96A 1YCSB 4L5EA 1PKTA 1VQZA 2OJED 1VQKI 5L3DA 1E3OC 2JTVA 1QCNA 4XOPA 5F27A 2FPDA 3F8MA 4V2FA 1W36D 3GZ6A 4CUGA 2ZB9A 3RPQA 4F93B 1FTTA 4CRIA 1NYFA 2P5VA 1RABB 3EDPA 5D4RA 4KR3A 1GLNA 2OBPA 2ME6A 4YCWA 3PNTA 3E2UA 5D5WB 3PFYA 4KMFA 4Z6YA 4IQJA 3CJRB 5HGQA 3QYBA 3CXCA 3BE3A 4Y17A 5LHIA 2O4XA 1R1UA 3VS5A 3CCJA 2L89A 2R7TA 1GT0C 1G59A 1HTTA 4BUGA 3ISPA 4EV0A 1UHFA 5CYVA 2LQKA 3W6KB 1SANA 2DFEA 4UP7A 4HQMA 3CMMA 1GFCA 3RKYA 5CVUA 1BKBA 5FRNA 1SFXA 2V26A 1OPLA 4NQWB 1X2MA 2JT1A 2VOOA 2M9HA 1HCRA 5DUIA 4KJZA 3L2ZA 2HYFA 4XLHA 4KICA 2IA0A 1UE9A 1YG2A 3K4JA 5KYWA 8ATCB 4RMNA 2RI5A 3JCMg 1SSFA 4ZTJA 5H6QA 2VBXA 4D8KA 3HHHA 4M7DG 4RTVA 2I4MA 3MEWA 4EVIA 3CCET 1WFXA 1M1KC 3CCSI 2X4WA 2HOEA 5EJCA 3S3OA 1TWFJ 3G1JA 3OYJA 4DW6A 1LB2A 1ATIA 4CCKA 4WXDA 1DGRM 1M2VA 1V55H 4J9IA 1P4XA 5L3BA 4M72A 3CMAA 1WCMJ 2EYZA 1ZSZC 3I55A 3M8EA 3OY9A 3ABUA 2AT1B 2HXOA 4CH5A 5J3LA 1VI0A 3U21A 3CUQC 1RR8C 2KIFA 4YRMA 2G7UA 2VJIA 4J01A 3ZMZA 1R71A 4YIIA 1UG2A 4LVLA 2I5UA 1LFBA 2LCCA 2PX9A 3ABKH 3A5ZA 4OB0B 1KQSA 2NVUB 5LJ5j 1VA7A 2LSOA 1I39A 3UNGC 3OA6A 2DMOA 4RM3A 2ZJPF 1MZBA 3O8GA 2VOPA 4RB0A 2ZNYA 2WBMA 5IP6A 3DTKA 2DQ3A 2CQNA 2M3AA 4JJDA 1Q7YU 2VQGA 1B72B 2N8GA 1JBMA 5TISC 5BQTA 4A0YA 2DA9A 4L9TA 3IQLA 1A6IA 2JWTA 4LVKA 1U1TA 3CBMA 2RD1A 2DMUA 2M45A 3AL0C 2FPFA 1I5LA 2PVGB 4HPQA 3I4MJ 2X9DA 1IGNA 4AYBA 1FLIA 1QZZA 2V1XA 2ZKZA 1OQKA 3J7AY 1WI9A 2BY1A 3OYAA 2FL7A 3OYYA 2BW3A 3TEGA 1DGWY 4M7AA 1UHWA 3FF5A 5E18F 2CG4A 3PMTA 2VV5A 1APLC 2M8GX 2ZCWA 2BZYA 4GYGA 2HDDA 1KQ2A 2FBHA 1AU7A 3QHSA 5LJ5d 2LQNA 2KPMA 4QWQA 1H641 1MSEC 5HLIA 2GOMA 3JRBA 3HXXA 2JS2A 3ZOBA 2VUBA 3VS6A 3CF5F 4WWCA 1ASYA 4Q48A 4GCVA 1LE8A 4JLGA 4C0ZA 2QF7A 5BOXA 2Z2SB 2P0KA 2K9SA 1H4TA 2LNVA 3NAUA 3N97A 4KBMB 1VOMA 2Y4YA 3J7AO 3NFCA 1OV3A 5C6SA 1B07A 3RMQA 2LLKA 3OYDA 3RIRA 3G1ZA 3EHRA 3QKJA 3CJTB 1MMDA 2L4MA 2HR3A 2GOXB 1USYC 3AFHA 3L1PA 1UHMA 1B7TA 4OU0A 4M77G 3CMET 4WXCA 3HFVA 5GTIC 4L5JA 1R5GA 2ETHA 2Q2EA 2CQQA 5FLXE 1M3BA 4PJ0C 3HOTA 3W2AA 3KX2A 3SWNB 5CVVA 3I56I 1MIJA 3CCQT 1NM7A 2F5TX 3L00A 4OMQA 3GW2A 1TP4A 5HK0A 2MWPA 2R5YA 3OYIA 4E6RA 5FW9A 1ADJA 3KP7A 4YRNA 3F6OA 4K11A 4CS4A 1EH8A 5J4YA 3GXOA 1U5TC 4XLFA 3GBQA 4ZDLA 2KRCA 4HSTA 2Z0WA 3LYIA 1VQOT 1VQ6I 3LA7A 5GMKm 1QBJA 3S32A 2V9PA 3A8LB 3DKWA 2KE9A 5DUKA 5DLOA 1R0BG 3S16J 1HKQA 1GHCA 3M54A 2XAQA 5EYRA 1UFFA 5ICGA 4XLPF 4M7DE 2RB6A 4C0DB 1Y7XA 3I9QA 2M51A 3QXEB 1QQIA 2VE9A 1YW7A 2IS4A 3LSPA 5EGOA 2RHZA 4CA0A 1B1BA 2BY0A 3FMRA 3OYCA 4BXUA 2O61A 1Z7NA 1POGA 3WHBA 1K6OA 3GTQJ 3Q9SA 1VQMQ 1X1AA 1QE0A 5FLXZ 4OMOA 2CP0A 2XDVA 1RUWA 3F21A 1KFZA 3WTUC 1PWTA 3TO6A 2KFDA 4R1HA 1WZ2A 3X24B 1K4TA 4N9HA 4IUPA 3CCUI 2PTKA 1GV2A 3TW6A 4M77F 4UUTA 5BS6A 1FOXA 1OX9A 4E2FB 4YRVA 4D8DA 1HK9A 5HK3A 1HW5A 3RZOJ 4KR2A 4G84A 2F4MB 2RQRA 2L54A 2HEQA 1F4KA 2RQPA 1TS9A 3BY6A 5KVRA 2JZ2A 1KOGA 1RI0A 2B0LA 5GANh 4HF1A 4J6YA 5A2QZ 4N0AA 3CCJT 1BCOA 2L7KA 1SMYF 5CAIA 3UR3C 2E65A 4PL6A 1FC3A 5KYXA 2A61A 3BR6A 2QGFB 3JB9I 4GXOA 2DXTA 5GANe 5GAOl 3BTCA 4K86A 3P9KA 4J7FA 5LJ3h 3J7YJ 4FCYA 3H3UA 3REAB 2O4XB 3R60A 2H1LA 4BYYA 4BHCA 2EW3A 5IYBJ 2EFIA 2IS1A 2P5IA 5IXFA 2RNGA 5LJ3e 4LVJA 1Q82R 1UDLA 4OMZA 4BI3A 1HSTA 3BW1A 2GFUA 3F8CA 2XAJA 3A1PA 1YFNA 2K3FA 2HKQB 2DMQA 3HXUA 1T8IA 1WYDA 2QCOA 4KH1B 3HTZA 2KMUA 4WI1A 4F17A 2OD5A 2LREA 4IZZA 1FYLA 1P9QC 2KXDA 3HHTB 1XGOA 4JOMA 2DPUA 3HFZA 4H2XA 5KYWB 3VSKA 1KD1C 4IRHA 5JLWA 1YCYA 1JUSA 1QVTA 2HKOA 1W7PA 5HDKA 1S72A 1Q81C 3PIOA 4I01A 2VJ5A 2A6HF 3TU4K 4HRIA 2GWRA 1WXTA 4EPCA 3HJEA 4ZIBA 1K7AA 2O9VA 3CMAT 2DMPA 1ETWA 4IHYA 1W1WE 3HPWA 2K85A 2YSRA 1KU7A 2FZKB 3I55T 1WQ2A 4MHGA 3K4LA 5BNGA 4KUMA 4OB1B 3GZ5A 3SZTA 1G83A 2V4JC 1REPC 5C4JJ 1WHGA 1N8RC 4XEOA 1M2VB 4IUUA 4I02A 2YUSA 2JA6J 3G6EA 2YX4A 1WHLA 1XG1A 1PDNC 5FB2A 3LA2A 1ACMB 4E6KG 2RQWA 4IX7A 3HG9A 3J81K 3R61A 3ASKA 4M77E 1BL0A 2QKMB 1FT9A 1AZGB 1J9IA 4BY7J 2WSCE 2VC1A 4PGGA 2BHYA 3A5ZB 4EMKC 3JCMd 3A01A 5C52B 4EMHA 4E4HA 3ZQFA 5GAHJ 1NHAA 4HOBA 3PNYA 3HSRA 3H0HA 4DJAA 2Z99A 1X19A 1VQMI 1A6QA 2QSFX 3D1NI 2VGMA 4NHJA 2EQUA 4P1WA 4H0EA 3ERRA 4NL3A 2C6YA 3H5AA 2L2OA 3CCVQ 2MGQA 3QJ6A 2QWWA 4ZN1A 4E7HA 3ER0A 2Q0OA 1YX5A 4BAYA 2V9KA 3HRUA 2DTHA 4QT7A 3OOPA 5HNHA 1ETVA 3H36A 1WNLA 5GAMh 2DERA 4ELZC 2OCCH 1WQWA 5D8LB 1H4QA 2DYSH 2DL5A 2KL4A