3V7RA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7rA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7rA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7rA02
2HTSA 5ELNA 1EIYB 4I02A 4RQFA 4L9JA 1S7AA 5GANh 1GXQA 1K7AA 1FZPB 3MEYA 4M77D 4O3MA 1WQ7A 2EAYA 4IJAA 3LAJA 4YRLA 1O7FA 3JCMf 4ON0A 2JTVA 4M9ZA 3HXVA 5KVRA 2W24A 4MNUA 3TEHB 3R4KA 4YIFA 4KA4A 2ODRC 3O6BB 4YFNF 4BW9A 4OIOF 1ONVA 1R1VA 2NS0A 1IAWA 3TGNA 2BV6A 1LB2A 2HQNA 2P6SA 5D8LB 3FZVA 3DXJF 5GANe 1BI0A 5TRDA 3MWMA 3CMQA 3KZZA 3IG2A 1J5WA 1G3SA 1G3YA 1UHWA 4NHJA 4M7AB 5LJ5j 2VXZA 2AMCB 4EMGA 3ECHA 4WXHA 1NYQA 3GZ5A 1ZG5A 4C8QG 4BHPA 2FMLA 1QO0D 4EV0A 2PG4A 1NJ5A 4P72C 3E5XA 4F7ZA 2FSWA 4HF1A 3E9IA 4IHTA 4XU2A 1P2FA 2FMYA 6PAXA 3OD1A 3GX4X 1FWZA 4G9YA 3RL6A 4IF4A 4U88A 1D8KA 5A2QZ 1TTYA 4OIPF 1FYLA 1M5Q1 2L4AA 4RGXA 4PJOF 4TTVA 1J5YA 3RESA 2QBYB 2I4LA 3HRUA 1ZRDA 1HXDA 2KIUA 5GAMj 4YPFA 2MH9A 2RN7A 4M78A 1W66A 1QF6A 3TOBA 2M5WA 3JCMP 3EFSA 1BC8C 1O3RA 5GAOp 1NJ6A 2X0LA 1T39A 3EDPA 4YRSA 3IHUA 3ZQ7A 2ZCEA 1MJ9A 4CICA 5D6EA 3WTWC 5GMKm 3DKWA 4K87A 4AD9A 3VQVA 3DPLC 2AKWA 2QHTA 3R07A 1O3TA 1PDNC 4P9FA 2CWEA 4K88A 1EOVA 2L02A 3E6DA 1P92A 2Z3YA 4ESFA 4H2XB 1F1ZA 4TWAA 5HGQA 4ZYEA 1B34B 4A0ZA 2C8MA 3F23A 1T2KA 2FXAA 3KETA 4XU3A 3M8EA 1C0AA 4F7UB 5D5XB 3DF8A 2IP2A 5HLIA 1R1TA 4YCVA 5C53B 2Y75A 5HLHA 1ZREA 3IWFA 4P3NA 1U2WA 5IT3A 4P73C 5E1ZB 2IW5A 2I2LA 3T8RA 4FHTA 4JRIA 1QBJA 5LBQA 1S7OA 4CS3A 2EJ9A 1H9TA 2HTJA 4QVDA 2ZIOA 2ZINA 3WU0A 1MJBA 2DQRA 2W57A 3P9CA 3MFKA 5GAN6 4YRRA 2IA1A 5LHHA 4M75G 3ZP5A 5D5UB 2FYKA 4IHSA 1YB3A 3KFWX 3TO7A 2VXFA 1KQ8A 1JRIA 3EETA 1R5HA 3RKXA 4BYYA 5E3IA 3FF5A 1PP7U 2OA4A 4HV6A 1K78A 4PGGA 2ZZEA 1DUXC 5CVRA 3JCMc 1IL2A 4BHBA 3WGGA 3O2PE 1YW7A 2DTRA 2HNIA 4ZZLA 4G7OF 2ARUA 3GEZA 2E7XA 5F64A 4XTUA 2VT2A 2ZR2A 3A5YA 3TQNA 5LJ5f 1ZGJA 2EA2A 3OOPA 4JBAA 1HW5A 1B9NA 4XSXF 3J80Z 2P8TA 4ENKA 2IA2A 1ZG3A 2DQLA 4FT8A 1MDMA 2V9VA 2YSRA 4L18B 3HY1A 4M75B 2YX4A 1IXSB 2QYOA 1LEBA 1BC7C 3J7AO 2DU5A 3JCMg 5AIQA 5ILVA 2A61A 2RQPA 4PJOE 3I59A 1LNXA 1K6OA 1ZLKA 1HKQA 3GFIA 4PDKA 3KP6A 1FSEA 1OYIA 1P4XA 5GAMf 2UXXA 4OOIA 5BPIA 4M7DD 4WF2A 1XDUA 4UHTA 2OAZA 4CH6A 1W7PD 2XAJA 2E1CA 5GMKh 3VU3C 3HSFA 2LKPA 4KIFA 3WG9A 4PJOA 2GZWA 5HS7A 4L0YB 2D2WA 3JW4A 1ZYRF 2UXNA 4YROA 3IWZA 4M77E 3LA2A 1LYLA 4ZIBA 1KQ0A 3FMSA 5ICFA 1X2GA 2M45A 4PZJA 1N9SA 2HFHA 4YRPA 3KEQA 1HW2A 2HYFA 1I1SA 4Z2YA 3ULQB 5GMKe 3HFZA 4L9NA 3MAJA 4G7HF 4C92G 3V8KA 1H0MA 2YLCA 3KP7A 3FJPA 2VE9A 1USTA 2Q5HA 2XHKA 5DY9A 5CVUA 4UUVA 3MF2A 4M77A 3K1MA 1U5TC 2RD1A 4XU0A 1FSHA 3NEMA 2CJ9A 4Q47A 2ISZA 4L5JA 3HYIA 2GXBA 4R79A 1BN5A 3P8VA 2CG4A 2OZ6A 4IXAA 2FBIA 4IVNA 3V8JA 5BS6A 1JBMA 3W6JB 3QU6A 1QQIA 3O3KA 4EMKA 1REPC 4PJOC 5CYVA 3SXYA 2QHSA 5GANd 5LHGA 3P7NA 1J59A 1SERA 1GVJA 2CYYA 5FLXZ 1Y96B 3BFMA 4C92B 3JCMW 1R23A 3KP5A 5BPDA 2ZZGA 3E6CC 4K86A 1E24A 3I7FA 1FX7A 3QPTA 3INZA 5K1YA 3K2ZA 4M7DF 3IALA 3IKLA 2DT5A 2P6TA 1XMAA 3HOTA 2W25A 5H6RA 4GYGA 1BI2A 2ZNIA 4P55A 2NRAC 3QO3A 5ERIA 1K79A 1TNTA 3TUPA 1JXSA 3JSOA 1R36A 2JT1A 1TW3A 3F8BA 3PQKA 1KU2A 5DD4A 2ZT8A 4UVAA 4MHGA 4M77C 2K7LA 4MEYF 5I21A 5KNNA 4TVAA 4N0AC 5D5VB 4BNCA 2ZXFA 2TDXA 4M78D 5GAOl 3I64A 3PZCA 2K02A 4P3PA 1W4MA 3QHSA 5GAN7 3PQJA 4Y13A 3WQZA 3GVAA 3GFLA 1BIAA 1S29A 5C52B 1P4WA 4EMKC 4CS2A 1EIYA 5ILSA 3SWNB 3DP7A 2Y90A 1X54A 4YRCA 5JVTA 2DLLA 1B9MA 1IXCA 5HLGA 3T8TA 5LJ5g 3GIBA 4H0EA 5LRRA 3TEHA 3QP6A 1R22A 2DQ3A 5J8FA 4M71A 1FT9A 4BH9A 2QVOA 1P6RA 5L3CA 2ALYA 1KU9A 4YDQA 3EQLF 3K0LA 3SHFA 3RTRA 5GAOr 4UV9A 2GXGA 4HLYA 1HBXG 3U2RA 3HXZA 3UH0A 5D4SA 2H94A 1FNNA 4HWOA 4YREA 1LJ9A 2MLKA 3F22A 5L3DA 1XGNA 2ZGWA 4M7AA 1XB4A 3HY0A 2JSCA 5LGUA 2EV6A 4J5YA 2AMCA 3LC0A 1BBWA 5IT9Z 3L2ZA 1IXRC 3E97A 1J0RA 2I4OA 5HDGA 2G7HA 4RQEA 4KFCA 2L3DA 1YW8A 2PMHA 3FB9A 2K4BA 2YR2A 1H4QA 2X4HA 5DUKA 1V4RA 4X9CA 3H3ZA 4HWTA 5KK1A 12ASA 4EMHA 2R3SA 3M7GA 3K69A 1KA8A 2RHQA 2ZMEB 4MTDA 2PLYA 4CH3A 5LLQA 4ESBA 2QBYA 3ZMTA 3HFVA 4U7DA 3CO6C 4M78F 2QUFA 1KU3A 1ATIA 2K27A 1JJCB 2HGCA 2XAFA 3BW1A 4OP0A 1SESA 1ON2A 3CUQC 2O61A 4XU1A 3E6BA 2Z99A 2I4NA 1B8AA 4F7UE 3FMRA 1GXPA 4EJWA 5BMZA 4V2SA 3LQRA 1ZN2A 4M7DE 4P71C 1ZH5A 3NETA 4HWRA 3VBBA 1ADJA 4O5VA 1SRYA 3JSPA 2E10A 2IY5B 4UVCA 4HDVA 3KLOA 2BEOA 1XGMA 2ZNYA 2WV0A 4P3OA 2PQ8A 2K4JA 4ZTZB 2RA2A 2E65A 3KP2A 1Z05A 4IRHA 2LF8A 1KQ9A 3F3XA 4XTZA 4F7UA 1QE0A 1TLHB 1YS7A 3KEOA 3WTZA 3F72A 3ZMVA 2QHUA 2ZZFA 2FOKA 4M72A 1U3EM 3QOPA 2CSOA 5CVIA 2YU3A 3MQ0A 2QQBA 2UZKA 2UWMA 1BI1A 2NNNA 2EV5A 3IRQA 3WTSC 3HSBA 1XCVA 2M8EA 2O8XA 3B02A 3REOA 5L3FA 4G84A 1I4K1 1R5GA 2RVCA 2VBXA 3KP4A 4RCCA 3JCMh 2QZ8A 2P5LC 4Y91A 5E1XA 4LMYA 2DAOA 5CVJA 3U9GA 1SMTA 3W6KB 4G6QA 3NQOA 5J8CA 4L0ZB 3BROA 4QWQA 4A53A 2PMUA 3HRKA 1OKRA 2VODA 2BGCA 2RV8A 4EJVA 4UV8A 3HOSA 1SD4A 1B70B 2CGHA 1IRFA 3SQNA 3RF1A 1Z1DA 4XEMA 2KIFA 3LFKA 3DFGA 4D0PA 3HXWA 1H641 3FWEA 3Q5FA 3JCMe 2FEZA 5EEGA 4EGYA 4MEXF 4Q15A 1FBQA 3SFZA 3JCMV 4M7DC 4EGZA 2MD5A 3D5LA 4M74A 4YFXF 3FIFA 2EFOA 1XMKA 2OQGA 4XRFA 4E70A 3M4PA 2CO5A 3GO5A 1O57A 1Z9CA 2W85A 4RB3C 3VODA 5E8IA 4O2DA 5D6FA 1L0WA 2JPBA 2HEOA 1DPRA 1SMYF 1IUYA 1JHHA 1Q1HA 1AOYA 1FBSA 2L01A 4HX7A 1J2XA 4M78E 2Q7EA 1OPCA 2VOPA 4RB2C 1BJAA 2DK5A 1T38A 4HA8A 2W84A 2ESHA 3A5ZA 3V7RA 4HYEA 3GW2A 3BY6A 4KNYA 5HS9A 3EYIA 1BM9A 5ICCA 4I01A 4J6WA 1I5LA 1E2XA 3REUA 1X3UA 2IVMA 4HF2A 2ZXJA 2VT3A 4ZZDA 3COAC 1I1GA 1IW7F 2CW0F 1XSDA 2QQAA 2RM4A 4CXFA 4JUVA 2DEQA 3NENA 1WRJA 3JAMZ 1XD7A 4XQ3A 4CH5A 4YRMA 3F6VA 2HDCA 3HUGA 5DCMB 3TDZC 5LJ3j 4C8QB 1FPQA 4RB1A 2IJLA 2RHSB 1HKTA 4P5OA 1B6AA 1XN7A 1NJ8A 4M77F 2YHTA 4UXNA 3A74A 3HRSA 1WQ2A 4LK1F 3GFJA 2DVEA 2EJRA 1WWXA 2I4MA 1R00A 2ETHA 4EM2A 4AIHA 1PP8F 2Y48A 3JB9I 2FE3A 4XTVA 3GF2A 3R61A 4L9TA 1PYSB 3JCMJ 4LNSA 2QM3A 3MCZA 4M7AD 2RB6A 4MQVA 1WYDA 3GZ6A 4UVBA 2P5VA 5GAN8 3TKYA 1Y96A 4EJTA 4C92A 3ZMZA 4M78C 2VBWA 3M1EA 1WNLA 3U1DA 2DK8A 2C7IA 3LQQA 3CO7C 2E1NA 4YRNA 4Y15A 4N0BA 1ZARA 1FOKA 5LJ5h 3I0TA 1E22A 2P7CB 4WK8F 1IN7A 2PN6A 3HHGA 5FO5A 4HAMA 2PI0A 5K1XA 3HTZA 3ROUA 4CHUA 1NYRA 3RYPA 5DCFA 2GA1A 5AIPA 3AHUA 1NJ2A 2A69F 2PEXA 4Q5SF 1G51A 1LDKB 4I7HA 1R58A 5H6QA 3E3VA 1U1SA 2PBIA 4C8QD 4U0WA 1I27A 4U0YA 4FX0A 5LJ5e 2FNPA 4RCBA 1ZRCA 2R7DA 1G5IA 4ENMA 1TW2A 1SAXA 3SWNA 5GAMh 3K1PA 2ZO4A 5J6XA 5GAOm 2AS5F 3WE3A 4RMFA 2LSOA 2JZYA 4PCQA 1KOGA 4P74A 4ZYGA 2K57A 2L4MA 2ZNZA 2G9WA 3ZN1A 2GWRA 2DQ0A 2V1XA 2HKXA 2ZJ2A 5D4RA 3ZN0A 1H4VB 3WTYC 2DO7A 1FYKA 1FY7A 3N4MA 3JCMQ 2D1HA 3DV8A 5GAMe 4M78G 4OIQF 3WTTC 2FBHA 2IPQX 5K5RA 5HDNA 2Q8KA 5LJ3f 1L3LA 4M7AF 3L4GB 4Q4ZF 1FP2A 4K2EA 2VONA 1YCYA 2MLGA 3WTUC 3TEGA 3F8MA 1D8JA 3DEUA 3J81K 1IN4A 3C18A 4YRQA 3UFGA 3FXRA 3LAPA 1LEAA 5FD5A 3SWNC 2RNJA 1Z7UA 4XBFA 4KT5C 4ENJA 1NNHA 3E6MA 2ELHA 5E18F 3RJPA 3JB9G 3ERRA 2HQRA 4PHCA 1B7YA 4P74C 2RKHA 1D5VA 4BHCA 2HWVA 4YP0A 4MMKA 4UP8A 1OMIA 2VC1A 2G4CA 1T98A 4HX4A 3L1AA 1ODDA 4XLPF 3JCMd 2P5IA 2V6CA 2HYGD 3G1ZA 3L9FA 2DBBA 4CH4A 4GCVA 1YFHA 3LA7A 3DPTA 1USSA 3ML6A 2C6YA 4ASNA 4M75D 2AKWB 4M9SA 5JR3A 2MBFA 1WKMA 2IT0A 2EFPA 2IY5A 4KMUX 1RUOA 1J75A 5DDGA 3QAHA 1ADYA 1LJOA 2PMFA 1EV7A 3BDUA 5K5OA 2VBZA 4F7UF 1F4KA 4QVCA 2AXLA 3VQWA 2F5CA 5DV5A 1MGQA 3HTSB 2O0YA 2QQ9A 2VBYA 3REXA 3BJ6A 1ULYA 1U78A 2EWNA 2FA5A 1UB9A 3BWGA 3ABTA 1KU7A 3GFMA 2J3MA 4HW0A 3UGQA 2M30A 1EH8A 2DTIA 4P96A 4BAYA 1Z6RA 11ASA 4HQEA 1AWCA 1G3TA 3V7SA 2WTEA 1L0OC 2VN2A 1FC3A 4EQQA 3QSUA 2H6BA 1OYYA 1N9RA 4EX5A 3C1DA 4HVCA 1LDJA 4G94A 4YRTA 1K78B 1WQWA 1BOAA 2GIVA 2ZBKA 4TV7A 4OIRF 1D3BB 2VXEA 4KN7X 4Q48A 2BE5F 3NRVA 1S8NA 4LK0F 2PJPA 4M7AE 5L3BA 5EEHA 1I81A 2DFIA 4WWCA 2WC2A 1RZ4A 3TDUC 4X5OA 1WSUA 5E17F 4PJOG 3A32A 4ETSA 2DXTA 2XGTA 4J6XA 4XEOA 2ZT7A 3ZPLA 4P75A 2XAQA 1IN5A 4LLLA 4YFKF 1GGMA 4YG2F 1HK9A 5ICGA 2OZUA 3I59B 1HW1A 2RDPA 1RUNA 4Q6GA 3BPXA 2EV0A 2A3SA 1HSJA 2FRHA 1QZYA 1U5TB 5A2QK 4C92D 1W5SA 4HWSA 3HRMA 4A0XA 2NYXA 3RDIA 5GAMg 4OU0A 4KIGA 3I5UA 2DW4A 4M77G 4GYIA 1DPUA 5LHIA 1H4TA 2ZFWA 2E64A 4C8QE 5LJ3g 4PJOB 1ZRFA 2EFNA 4RDXA 3CDHA 4A0YA 3AAFA 1SD6A 3V8LA 4KR3A 1O7LA 2EJGA 3TO9A 4A6EA 1MKMA 3SZPA 5GANj 3QP5A 1I5ZA 2EB7A 4R1HA 1WLEA 1YFSA 4LGWA 2ZT6A 3G3ZA 3RKWA 1C0WA 3QO5A 1S3JA 4RGSA 4LLNA 1I6XA 3P9KA 5DCMA 3I53A 2XROA 4P75C 5LJ5d 5FGMA 4C8QA 2RHSA 4YIIA 2KRFA 2Z33A 4I2OA 1P4AA 3ABUA 2P5KA 1Z7MA 3F8NA 4M77B 4M7AC 4HT8A 3GXOA 4KICA 1TNSA 4H2SA 5CLSA 2OQRA 3BY7A 5GMKi 4S04A 1MJAA 2VC0A 4H2XA 2FU4A 4OMYA 3HXYA 3HRTA 1B34A 2GAUA 3IKTA 1X56A 1S6LA 2HZTA 4L9VA 1PYSA 1FYMA 4WJ3M 5GAMd 5E20A 3I54A 4KYWA 1Z7NA 5TJJA 1GHCA 1CGPA 2QLZA 3RIRA 4H2WA 3FXQA 1WI9A 2EJFA 4NB5A 5HS8A 3HHHA 3HTUA 4B09A 4C92F 3KE2A 4DNCA 5FD6A 3VEPA 2XTIA 4HDUA 4KUMA 3V7CA 3I58A 2QENA 4HZFA 3KCCA 1LQ1A 4WI1A 4PGHA 1CF7B 4C8QC 4NCXA 3LSQA 2E1HA 2KKOA 2VC8A 4P9UA 4MTEA 3VB2A 1ASYA 3EUHA 1TQMA 4HLXA 4Y17A 5ED4A 1FLIA 4G85A 2CIMA 2DZCA 3J80K 1G5HA 4M75E 3LWFA 3BZ6A 3CUOA 4LB5A 3GLXA 4A5MA 5GAN3 4ESJA 5LEJA 2CJAA 4EMSA 4GO1A 1LVAA 2XV4S 4M7AG 2DXUA 2F2EA 4AVPA 4L87A 5BQTA 4TVWA 1KGSA 2L54A 3RERA 2QHVA 1KMMA 1U8RA 2OBPA 2DTHA 3L7WA 4M75A 3OV8A 1OR7A 1ZGAA 3A7RA 2JPCA 1U1TA 1SFXA 4EJOA 5F1RA 2QWWA 4EO4A 2DI3A 2MA3A 5LGTA 4LG0B 2KIMA 3CUQB 2HS5A 4I09A 2ALYB 2OU2A 5GANf 3QUIA 1YIOA 1KQ2A 3ZMUA 3UGTA 4KQEA 1J9IA 1NJ1A 3V4GA 5ILUA 4M9XA 3HFNA 1UHMA 3A31A 4J15A 1BI3A 3L4GA 4MGRA 1D3YA 5HOOA 3BJOA 1QZZA 2CGPA 2ZTGA 3RI4A 4HV5A 1IRGA 3HXXA 2DU9A 3HSEA 3IC7A 5LEKA 4DPGA 1QGPA 4GXOA 3RPUA 1EVKA 4YRFA 1UCRA 3GUDA 2RHQB 1J7KA 4ZH4F 5HDKA 4S05A 1LOJA 1PUEE 4P73A 4M75C 4CZZA 4F7UG 3RKYA 3HFOA 3HXUA 4AWXB 4M7DG 1X55A 1B1BA 3BJAA 5E8GA 1YFRA 3FXUA 4HX8A 2F5DA 3RGLA 1G3WA 2XUBA 1E1TA 4CS4A 4YCUA 2H09A 1MD0A 4C92E 2P0LA 3ELKA 4PG3A 5GAN2 1OYWA 5FLXK 2P7VB 2E41A 3GWZA 1JGSA 3ECOA 1YFTA 1XCBA 3FM3A 3CLOA 3GYHX 1YLFA 4MMLA 1YG2A 3T5XA 2PMEA 2DPDA 5GMKj 2HKOA 1ZG1A 3PFIA 3LA3A 4DQ2A 2J3LA 3E5UA 2XKPA 1EQRA 3PGGA 5CJ9A 3HSRA 5L3EA 4A12A 3C7JA 1SFEA 3Q9VA 2FQ3A 3CTAA 4M7DB 5ELOA 4WXCA 2O03A 1F5TA 3P9IA 2HOEA 3PCOB 3B73A 1W7PB 1W5TA 4HOBA 4OLFA 3VQYA 1IZ1A 2XGXA 3KZYA 3L09A 3QO7A 1RIOH 2XRNA 1HC7A 2M1BA 2B0LA 3QNEA 1FBUA 4TVYA 1KYWA 2OD5A 2YPRA 1JHFA 3H92A 3F21A 1V3FA 1YGBA 3QO8A 1BBYA 1RI7A 3HRIA 4BQAA 4PNOA 5K1PA 4JQFA 4EM1A 4M73A 3T0YA 1E1OA 5FB2A 1MZBA 2WWYA 2LDUA 3VQXA 1WU7A 2ISYA 3A7AA 5L3GA 1VTNC 1D3BA 1FYFA 2Q0OA 2RGVA 2XASA 4JK1X 1TH7A 2F5FA 4WXDA 4NQWA 4B8XA 4XSZF 3ERED 4C92C 1HQCA 4YRGA 5JFRA 5LJ3h 3WGIA 5AONA 1HKSA 2BBYA 4H02A 4TQDA 3FHZA 4BWAA 4KIBA 5IT9K 1YTYA 3BOQA 4WX9A 1BBUA 1IF1A 4KR2A 4M6XA 4BXUA 2DJZA 2Q7GA 3BPVA 4UP7A 3EYYA 2A07F 3P8YA 2P4WA 1T0FA 3DSQA 4YRKA 1SFUA 1XSXA 1TQIA 5HVQC 4A54A 1U5TA 2VOOA 2DPUA 3L00A 5LJ3e 3CJNA 1YQAA 4LFUA 1QPMA 2ARSA 2ODRD 2RC4A 1IN8A 2FF4A 1DDNA 2DKGA 2STWA 2KJCA 3I4PA 5JI6A 5GANg 4X9DA 2ARTA 4LD5A 1XSVA 1UFMA 3VFZA 1ZAOA 4WJ4A 3D0SA 2CFXA 2DZ9A 2A6EF 2YX7A 4R8HA 5LRSA 1XDSA 1KYZA 2DTOA 3MF1A 1T6SA 2ZMEA 3BP8A 2EL9A 2Y0MA 4H2UA 2XIGA 4U0VA 2O6GE 5GMKl 4HBLA 4AH6A 4YCWA 4H2YA 3K1NA 3SZTA 1RIQA 1KMNA 4M78B 4JLIA 2K86A 1YS6A 3W3SA 3ICAA 1WPYA 4YYEA 4I98B 4NL2A 1TQPA 1FP1D 1I8FA 1JJCA 2EFWA 2ZIMA 5F6FA 1B59A 4XTYA 5DUIA 4C8QF 4A2UA 3WTXC 3M4GA 2NNYA 2LF7A 3R0JA 4EJUA 5GAN4 3FM5A 2PFBA 2JRTA 4KMFA 4TQFA 1B4AA 2COMA 5FFXA 1E17A 2DDZA 3T1BA 2E3CA 4N0AA 2V1DA 3KLNA 2ZNJA 2XAHA 2E7WA 1DP7P 3RACA 3JCMX 2ZR3A 5H20A 2EK5A 1M8VA 4NL3A 3DQVC 4MQ9F 4YRJA 1MGTA 4XLNF 5FFZA 1HTTA 5DD8A 1BIBA 3M4QA 1VQZA 1EFWA 2BYVE 2ADUA 4CGZA 3TO6A 4UP9A 5DEQA 3JTHA 4KN4X 3LSSA 2LNBA 1SD5A 4N9IA 3I71A 2VE8A 1RNLA 3NELA 4QLCU 2G7UA 1CF7A 3IL2A 2ACJA 3JB9J 2F5EA 2YLBA 5CAIA 3F6OA 4A5NA 4HQMA 2ESNA 2A6HF 1ASZA 5K5QA 4UNOA 4H2VA 2J5PA 1F9NA 2XVCA 1STZA 4RB0A 2NAZA 1B70A 2XKOA 3QPHA 5ICEA 3ZMSA 1LNWA 2D1VA 2STTA 3JB9H 3WTVC 2IRFG 1ZHFA 3IKMB 4XTXA 5D8KB 4OMZA 1H4SA 1EH6A 3Q9SA 1Z91A 1R1UA 3MEXA 4LB6B 4A6DA 1JE8A 1XGSA 1X01A 1N9WA 2A5YB 3H3UA 3L2CA 1YO5C 1MDMB 4NOYA 3QRFF 1O3QA 3P8TA 2Z9OA 3MZYA 3C3WA 2M87A 3VOEA 3IRRA 4M75F 4AIKA 4JRKA 1SETA 5CVVA 2CJBA 4EVIA 3TOAA 5LGNA 5F5WA 4L5IA 2GQQA 1B76A 2MC3A 2MH2A 4G6DA 4IPAA 1XGOA 3JB9D 4LG0A 4OINF 3CUQA 3R6SA 3WODF 2HR3A 1X2HA 3JTGA 3IKVA 4HT9A 4RAYA 4P71A 3KP3A 1TBXA 3F8FA 3JCMb 1EH7A 1R7JA 3JAMK 2IA0A 2FB7A 2CQKA 3RYRA 2XAGA 4G7ZF 4LLGF 5D5WB 3QU3A 4WCGA 4HF0A 4RAZA 5E1WA 2V79A 4H2TA 2O3FA 4GGGA 3G73A 2Q5IA 1ZLJA 1A04A 2ZKZA 2J5OA 3HFZB 4IRGA 2QTXA 5GAN5 1Z6TA 4HWPA 3RPQA 3BDDA 1IN6A 2FBKA 3J81Z 2FNAA 1B7YB 1YW9A 1USYA 3EFRA 5GAOq 2EFQA 3R60A 1KQ1A 3K9TA 3WE2A 4N9HA 3FMQA 4YRIA 2Q2EA 5GAOn 3ISPA 3FX3A 4CO8A 4ZTUB 1LDDA 2ZCWA 1EVLA 2H6CA 4IRIA 4ZYHA 1NHAA 5C51B 3S2WA 4KDPA 3R0AA 1H9GA 4G8XA 4CDGA 4RGRA 1SD7A 4EMKB 5JHUA 2D45A 2E5AA 1HSTA 4XTWA 5DYMA 3SB2A 3KFUA 2JN0A 3ZMDA 2DU7A 5BOXA 3E5QA 3WGHA 3QTCA 4EM0B 2A68F 4I0AA 4M6YA 5LJ3d 4ENNA 3JB9F 4ZYDA 3A7UA 4RS8A 4FX4A 2Q7HA 2H27A 1Y0UA 4M7DA 2R7FA 1G4DA 2V1UA 3PCOA 2ZT5A 4AIJA 1W7PA 1YYVA 4PJOD 1G6NA 1O3SA 1U6GA 4LJZF 1USYC 3M8FA 3RUXA 4UPAA 3HIFA 4RGUA 1QNTA 4TVAB 4E51A 3F8CA 4U7BA 3WU1B 4P72A 4CYDA 2Z5UA 2GA2A 4J6YA 3NEUA 3N97A 4O6JA 4I0BA 3E9HA 3BJUA 2KJBA 3LSTA 2EA4A 3M9AA 3MZHA 1ON1A
chains in the Genus database with same CATH superfamily
1Y07A 5ELNA 4HSTA 4Y4RA 4L9JA 4OVAA 2E5QA 1K7AA 1FZPB 1QQJA 4O3MA 4YRLA 4ON0A 2QA4A 5KVRA 1YITI 3R4KA 5EG0A 4YFNF 4BW9A 2LRDA 2R7OA 5D8LB 4JP0A 2X51A 4BEHB 1M1GA 4AG2C 1PC0A 2XPWA 2NUTB 1NG2A 3E19A 2FPDA 2LT4A 2AMCB 2R7UA 3ABKH 4BHPA 4EV0A 2PG4A 1W36D 1K9AA 3E5XA 1OQYA 4XU2A 1KC8C 2L9SA 4A3KJ 6PAXA 2GNCA 4ZYAA 2F5TX 2AO9A 4U88A 2DRKA 4RGXA 1MSFC 5HY6A 3HRUA 3PVQA 2LH9A 2RN7A 1CSKA 1VQ6Q 2LLKA 2L9NA 5DM7F 3A8MB 1M1KU 4I99C 2NXNB 4HVWA 2CZ6B 3I55I 2KL4A 4B3AA 2K9MA 3ZQ7A 4CICA 3DLMA 3PM1A 1WJDA 3I9QA 4AD9A 3VQVA 3R07A 1VQ5T 1LKXA 3CCSI 1O3TA 5GTIC 2DBKA 1IV6A 2L02A 3IH3A 3CMEI 4DIQA 4JJNK 4ESFA 2NUPB 4TWAA 5HGQA 4A0ZA 4RTUA 4BJTA 2PMZN 3BG6A 5D5XB 4CI0C 2FO0A 3HOXJ 1Q82U 5C53B 3BLYA 2Y75A 1ZREA 4B3XA 5D6WA 4ZDOA 4P73C 2IW5A 1RRJA 2I2LA 3T8RA 4JRIA 3SYTA 2NS6A 1Z9ZA 2ZIOA 4NS5A 5FRMA 2DQRA 5LHHA 1BW6A 3AFHA 5D5UB 4IUUA 4LDXA 3KFWX 3TO7A 3QPLA 5CO7A 2VXFA 3RKXA 3FF5A 3CC4A 1K78A 2ZZEA 1ETYA 4FETA 1GFCA 1YW7A 2HNIA 3HGGA 4BB7A 2LY9A 3OYBA 2RHUA 5LJ5f 1ZGJA 3OOPA 2BZXA 2E2IJ 3J80Z 3U23A 1ZG3A 2DQLA 1MDMA 4UUTA 5CKEA 2A6TA 2YSRA 2MAMA 2YDLA 1R6RA 1VQ6T 2G6FX 5IPAA 4M75B 2QYOA 4E7ZA 4MFEA 5ILVA 1PWTA 5HKCA 1LNXA 3GFIA 4PDKA 2HQEA 3FLGA 1FSEA 3LFUA 1WIEA 1O75A 3D5RC 5GAMf 4WF2A 3HL2A 1W7PD 1DQUA 2ZB9A 2BUDA 4KIFA 4L5EA 2LQKA 1WPKA 3JW4A 1IUFA 3PFYA 4CCOA 3NAUA 3DTKA 3LA2A 1LYLA 1X2GA 4PZJA 5KYWA 5A0DA 1X19A 1NEBA 1MMNA 2FJ1A 2CV1A 3ULQB 1LFUP 5GMKe 3MAJA 1H0MA 2YLCA 3KP7A 1WXBA 1T0FC 2VE9A 2XHKA 1M90U 4UUVA 3K1MA 1JB0E 2RD1A 4XR6A 1FSHA 1VQ9Q 4B4CA 3NEMA 3GNFB 2CJ9A 4V19K 4BY1J 1UG0A 1OCPA 2ISZA 2GXBA 3QOEA 2DO3A 3HPWA 2CG4A 1AHJB 4IVNA 2XPUA 3CCJI 1AU7A 4PJOC 3SXYA 8ATCB 2LTPA 2BHZA 4BUGA 2CYYA 5GAGJ 1M3CA 3JCMW 3KP5A 2PNIA 1BR2A 2VPRA 1VQ7A 3QPTA 3IKLA 2VJ5A 2EZLA 5CPRB 1XMAA 2MYSA 4X34A 3HOTA 2W25A 1BI2A 1MNEA 4P55A 2NRAC 3QO3A 1K79A 4DYQA 1TNTA 3JRCA 3TUPA 1IO6A 3JSOA 1R36A 1KU2A 1PCXA 4MHGA 4M77C 1QKXA 4MEYF 3GTMJ 4BNCA 5HODA 2Y9ZA 1W4MA 1LUJB 3VUZA 4BD3A 2NVTJ 2M02A 2D0QB 3SWNB 2VQCA 2KK4A 3ZCOA 1X54A 1K9MU 3FXJA 3CCQI 3OYGA 3PNTA 1S72I 3IP4B 5LRRA 3TEHA 2WACA 2NOJB 3OA6A 1FT9A 3ERMA 3KXTA 2C06A 4FM4B 2L7KA 1KU9A 2ECCA 3K0LA 3CZ6A 3GNGA 3HTRA 5GAOr 2EPFA 1HBXG 2RQWA 4YREA 2MLKA 3F22A 3OS2A 2M9UA 2ZGWA 4M7AA 2JSCA 1BBWA 3E97A 2I4OA 5HDGA 2G7HA 3A4CA 1YW8A 1NEGA 3HDDA 4CCNA 2X35A 2WAEA 2D8HA 1H4QA 2RQUA 2X4HA 4MTDA 3I35A 3HPGA 2MC4A 1N8RC 1WX6A 2JM9A 3EG2A 3TP0A 5LLQA 2F48A 2QBYA 2HQXA 3RBBB 3ZMTA 4U7DA 5IHIA 3CO6C 2QUFA 1JJCB 4QTRA 1XJWB 3LWIA 4XU1A 3E6BA 2Z99A 2I4NA 4F7UE 2D0NA 4LUEA 3G71Q 3LQRA 4YRVA 2A08A 2R5YB 4P71C 2W00A 1R77A 2CV0A 4HWRA 2ROLA 3VBBA 1SRYA 3JSPA 3J7YJ 4UVCA 3CC4Q 1RAEB 2BEOA 2ZNYA 3TL4X 5IYCJ 4P3OA 1X6OA 3DLLA 4A3GJ 2E65A 4XTZA 1QE0A 4B6MA 2VQGA 1VQPA 2QHUA 1U3EM 1WZOA 2EQKA 2AKKA 3WG7H 1AWWA 1BI1A 4CSWA 2H1KA 2M8EA 2O8XA 2YUNA 3KP4A 2P5LC 1ZR2A 2DAOA 1VQMA 5CVJA 1SMTA 3NQOA 4A53A 2QEXQ 4A3MJ 5M5WJ 2VODA 4EJVA 3HOSA 3KIOA 1B70B 1IRFA 3HXWA 1PUFA 2F4OB 2G3RA 3CCUI 1FBQA 1BK2A 3X25B 4OMNA 4M7DC 4XKCA 3DKYA 3FIFA 3KZIC 4XRFA 1NYGA 4E70A 3M4PA 1KD1C 1YITA 2DL7A 2W85A 3QJ6A 5IP9J 4O2DA 2RNAA 3H0IA 1L0WA 3UA6A 4CCLA 2V9KA 2LG4A 1SSFA 1DPRA 3CC7I 2RF0A 4J8OA 3M57A 4UB8C 4HT4A 2Q7EA 3PO2J 1OPCA 3PIPA 1BJAA 3CC4T 2W84A 1NPRA 1NG7A 3V7RA 2GFUA 4FSSA 4A3BJ 4KNYA 3CCMQ 1WHMA 4I01A 1I5LA 1I6HJ 3ZQGA 2HI3A 2WBMA 2RHYA 4ZZDA 1I1GA 3OIOA 1IW7F 3PSFA 2QQAA 4C0ZA 1WRJA 3JAMZ 3ZRGA 4NC6A 3TDZC 3EGDB 3SEZA 2JMCA 4I6ZA 4C9YA 1WI3A 2DA9A 4M77F 2DA3A 3BQZA 3G1JA 3JRIA 3HRSA 3I55A 2HDAA 3I56Q 3GFJA 5KYXA 2ETHA 4S0HB 4EM2A 2FE3A 3CCSA 3MEWA 3I4NJ 1ZGWA 3CMEA 4M7AD 4A3IJ 2RB6A 5IY5H 4MQVA 1WYDA 4UVBA 5J1YA 4EJTA 3OSSC 2LFBA 3ZMZA 4DEXA 1WNLA 1N5ZA 2C7IA 2RJEA 2QSHX 2QGGA 1FOKA 1UJ0A 3I0TA 4BQNA 1E22A 2P7CB 4RAGA 3HHGA 2PI0A 5K1XA 3HTZA 1M8MA 1X1PA 1NYRA 5AIPA 2ZXIA 2RN8A 2DK3A 1G51A 4XIDA 4I7HA 1MV3A 4U0WA 2DE0X 2GTJA 4FX0A 4BACA 3LH0A 1TW2A 1SAXA 1K4US 4AC0A 5EG2A 2K3BA 3VWBA 1KSWA 4C5HA 2LSOA 3GTLJ 2HQHA 4HCZA 1LVKA 2K57A 1LPQA 5E3NA 3WTYC 2HZDA 2CFOA 4IURA 1YFNA 2ENMA 5K5RA 5HDNA 2J7IA 3DCFA 2QKLB 2L9RA 4Q4ZF 2VVKA 1XX5A 3OYEA 2LBFB 1GXIE 1WH5A 4C5EA 4A4KA 1AHDP 4BXFA 4A3DJ 2J6FA 4XBFA 5AYFA 4ENJA 5A0LA 1AZEA 4LD6A 3ERRA 4PHCA 1WDXA 2RKHA 1R0BG 3CC2I 5HK3A 3VS0A 2G4CA 1ODDA 4XLPF 1OCTC 1PYVA 3L9FA 4GCVA 1BW5A 3ML6A 4LVLA 3ZQCA 3J80E 1IV8A 1WJBA 4PJMA 2EFPA 4KMUX 3HOYJ 1J75A 1K1ZA 1ADYA 1LJOA 4ABZA 3BDUA 5K5OA 3CCJA 5CQYA 4YTLA 2AXLA 2NWMA 2QQ9A 1LCKA 3REXA 1ULYA 1U78A 2Y31A 2EWNA 3J7AF 5FWCA 1KU7A 3P8DA 1V54H 2M30A 1KZHA 3D5SC 4BAYA 1Z6RA 2DA2A 5DLOA 2WTEA 1L0OC 3RPUD 5F04A 2A3LA 1OV3A 2H6BA 3C1DA 4CCMA 2CP7A 1BOAA 1RKTA 2GIVA 2C0IA 2EQMA 2FPEA 4KN7X 1Y0NA 2BE5F 4LK0F 1S8NA 5L3BA 2CP5A 3H5AA 3O8GA 1W2BA 2WC2A 2LP5A 2DDAA 3CCEI 3DLAA 1QVFP 2XGTA 2KI7A 1TC3C 4J6XA 1X43A 3ZPLA 3CCQA 1IN5A 4BEHA 1S72A 5ICGA 5F0HA 3THKA 3I59B 1HW1A 4BDYA 1RUNA 3HOZJ 3M0SA 5A2QK 2MCNA 5B1AH 1JUPA 1ZELA 4HWSA 1YJ9I 1VQMT 4RKUE 2VPLA 3NTKA 4OU0A 1UGSB 2LQ8A 2DW4A 2KDOA 1H4TA 4C8QE 1JTXA 4PJOB 3ZGKA 4IO9F 4LITA 3TCJA 3CCSQ 2F4MB 4A0YA 2O5RA 1VYTA 2EJGA 3TO9A 4JX6A 2C0OA 2QASA 2BZ8A 2GLOA 5DCMA 4P75C 3I53A 4XRSG 3OYHA 3S2HJ 2RHSA 1NBEB 3M4YA 3F8NA 4M77B 4FIBA 1Q1VA 5CLSA 2NVYJ 2YRVA 4S04A 1KG1A 2VC0A 1YJNQ 2HPMA 1VQKQ 1X56A 1OPLA 4GBQA 4L9VA 4WJ3M 1IC8A 5TJJA 1XOVA 3RIRA 3HTUA 4DNCA 3VEPA 4AFZC 3NWSA 1QVFS 1N27A 1TWCJ 4HZFA 3MPUB 1LQ1A 2JWTA 3QZ5B 3X2QH 3DBLB 4HLXA 4Y17A 5ED4A 2CIMA 2DZCA 1OQKA 3CUOA 4XLAA 2CJAA 2X9HA 3CCST 2DYSH 1X3WB 1LE8B 2L54A 4FU6A 3CMET 1M2OA 2VGMA 1WGSA 3ZQQA 4M75A 2M0OA 2KQRA 1OR7A 1ZGAA 1B7TA 3A7RA 2I0NA 1U1TA 4EJOA 3CCVI 1YHQQ 3CCUA 2QWWA 2ME6A 3PIOA 2OJ2A 5EJCA 2RK1A 4GLMA 1UECA 1WFXA 2KIMA 2HS5A 1HSQA 1ZUUA 3EG9B 3S2DJ 1KQ2A 3ZMUA 1NJ1A 1YJNT 4AMCA 1BI3A 1YIJI 3L4GA 4MGRA 1QZZA 3CC7A 4IOAF 2ZTGA 2GFAA 4HV5A 3HM5A 2VKEA 1IRGA 1OU8A 3IC7A 1N75A 1QGPA 2GOMA 2KAFA 3PMTA 1RR8C 1PUEE 4K11A 4F7UG 1SEMA 1T56A 3LYIA 1QVGA 3HFOA 4AWXB 1FTZA 1B1BA 1WHHA 3BJAA 2EIJH 3FXUA 4HX8A 2F5DA 1G3WA 2XUBA 1MD0A 3ELKA 4J9GA 4D8KA 3GWZA 1XCBA 1XTDA 3DKXA 2HDWA 2VB6A 2ZPIB 1YLFA 3Q0WA 1UELB 3T5XA 3CMAI 2Y4YA 1YNZA 1NM7A 1ZG1A 3PFIA 2J3LA 1YWPA 1MSEC 5CJ9A 4M7DB 3PCOB 1M1KC 3B73A 3VQYA 4XRMA 2XGXA 1YHQT 3QO7A 3OSGA 2XRNA 1RI9A 2GCXA 1TT5B 4HNUA 1S72Q 2DT7B 3CCYA 2OI3A 5DM6F 1TUGB 1Q81C 3MKYB 2W4SA 4BQAA 4A93J 2IBDA 3JAME 1N6AA 2ISYA 1NYFA 4PFOA 3MO8A 3C12A 2JJ7A 9ATCB 4NQWA 4WXDA 1YRNB 4C92C 1JKRC 5LJ3h 1AEYA 3WGIA 2NS7A 1HKSA 4H02A 3S8PA 1X6GA 4A4FA 3QPSA 5IT9K 3BOQA 4WX9A 1BBUA 1QVFA 1X4OA 4A3CJ 1MV0B 4D5CA 2A07F 4RAFA 1TWFJ 2IS4A 4A54A 1YQAA 1QPMA 4IL6C 2FF4A 2NYSA 1FIPA 2STWA 2KJCA 4LD5A 1OULA 4WJ4A 4J9IA 2DZ9A 2YX7A 1BR4A 4R8HA 2HL5C 1KYZA 5TGTA 1UG2A 1T6SA 3IAS2 3BP8A 4R55A 4U0VA 3UA7A 4AH6A 4RTYA 1RIQA 1KMNA 3HGYA 1G2HA 2X4JA 3B6AA 4JLIA 2XI9A 1U9OA 1UJYA 1FP1D 1JJCA 1S72T 4A2UA 4F52A 1WHKA 5FFXA 3CC2A 4CC7A 1XC5A 2BXYA 2LJ1A 2ZNJA 2QF7A 3RACA 3UWNA 4NL3A 2WSEE 1MGTA 2JTEA 4XLNF 2K2MA 1HTTA 2ZMEC 2EPDA 1BIBA 3K4LA 1BCOA 2KPMA 3G2BA 4OMPA 3DTIA 1T0HA 4IZZA 3H0HA 3IQLA 2M9HA 2BY0A 1OCOH 2VE8A 3VUBA 3NELA 4RBOA 3A03A 1FMVA 1B72B 1UUEA 1D1CA 2YLBA 3M0RA 5CAIA 4PJJA 4A5NA 4HQMA 1WHJA 2ESNA 2QSGX 4A69C 4RB0A 3G1LA 1EFNA 1B70A 2KZGA 3QPHA 2LD5A 1SRMA 3WTVC 4XTXA 3CF2A 2E2JJ 4UC4A 3UPUA 3Q9SA 1Z91A 1JE8A 3OYAA 3L2CA 3P8TA 2Z9OA 4BE2A 2BOLA 1Y1WJ 3M59A 4BI4A 3GF5A 4JRKA 1EZZB 2KRMA 4EVIA 2LY1A 1YI2I 2GQQA 1B76A 3CCEA 2MH2A 2M0MA 1IO2A 4LG0A 4OINF 2DXIA 5D6XA 2X4WA 3JTGA 4AG1C 3IKVA 2X4YA 2E6NA 4RAYA 3KP3A 3F8FA 2EQJA 2HYJA 2IA0A 3HEFA 3RYRA 3IH2A 1YJ9A 2OPTA 2K5LA 3ZBDA 1GCQA 4MIMA 1K9MC 1B8IB 4RAZA 5E1WA 2V79A 4OMQA 1SANA 5B3SH 1KHCA 3HFZB 3RMQA 1FXXA 3EGDA 3RPQA 1MMAA 5KCHA 3CCUT 3EFRA 2EFQA 3R60A 1KQ1A 1QHGA 3P8BB 3BDLA 2WSCE 1OZ2A 3FX3A 4AIDA 1JI8A 5C51B 4J01A 3R0AA 1H9GA 1SD7A 3CC7T 1HSTA 1JKQC 2DNUA 1FOYA 3PTAA 2BW3A 4I0AA 2LYCA 3JB9F 4FX4A 3MEAA 3EH1A 1G4DA 1YYVA 1VUBA 3I5SA 4AUXA 1O3SA 3OIPA 3M8FA 4RUGA 3M3YJ 3ABMH 1YP5A 4UPAA 3HIFA 4RGUA 4TVAB 1BJZA 3C94A 4XAXB 1UGQB 4OF1A 3TSZA 4RTTA 3N97A 2XSDC 5EC7A 2HTSA 2MF2A 1EIYB 1Z21A 3A0HC 5GANh 1GXQA 2KROA 2X48A 2DF6A 4B47A 2OV7A 2YUOA 1K0XA 4MNUA 4KA4A 1Y57A 3O6BB 2LCSA 2IGKA 1LB2A 2HQNA 2E5KA 1R9TJ 4M3BA 3FZVA 3MWMA 1J5WA 1G3SA 3CCVA 1RETA 2VXZA 2SEMA 4C8QG 3CC2Q 2RREA 4IHTA 2LBFA 2V1QA 2KFDA 1CQTA 5FJ8J 5A2QZ 1YIJA 1M3BA 2F6CA 5CQGA 1M5Q1 1QVTA 4TTVA 1J5YA 3SD4A 3RESA 5IHNA 1VYUA 3VYTB 1S7EA 3JCMP 3BR2A 4E7HA 1NJ6A 2X0LA 2M0YA 2K9NA 5D6EA 3WTWC 3LNQA 1R4MB 3S32A 5B5EC 1PDNC 4RTVA 3SDZA 2K40A 4E2FB 2MGQA 1A36A 4F7UB 1UGVA 3VDXA 3DF8A 5HLIA 4OB1B 1WJFA 1X4PA 2R5MA 3CMAA 4FHTA 4X1EA 5LBQA 4LIUA 1H9TA 1W1FA 2HTJA 4QVDA 3WU0A 1MJBA 2W57A 3MFKA 5GAN6 4YRRA 2IA1A 3ZP5A 4HG2A 4BL0B 3SEMA 1VF9A 1YB3A 1JRIA 2DMUA 4HEA2 5E3IA 3CC2T 3KFVA 4HV6A 2AKLA 2ME0A 3OQ5A 3JCMc 3F0CA 3O2PE 2IS2A 4ZZLA 4HVUA 3F9KA 2E7XA 5F64A 2ZR2A 3A5YA 2EYYA 1F1BB 4JBAA 2HU9A 2LX7A 1B9NA 4XSXF 1ENHA 4ENKA 2IA2A 4IUVA 4FT8A 1ZUKA 3HY1A 2YX4A 2XB5A 1BC7C 2CP2A 4CH7A 1UAAA 2DU5A 3JCMg 2NVXJ 5AIQA 1QLYA 2ECBA 1SHFA 3I59A 4C3JJ 3HKZA 3KP6A 1OOTA 2J06A 3CP8A 1TSFA 2UXXA 4OOIA 5AT1B 2K79A 5J39A 3VU3C 2LKPA 4P1WA 3WG9A 4PJOA 1APLC 2V8KA 2GZWA 3PJRA 1NPPA 5HS7A 3IH4A 2D2WA 1ZYRF 2NVUB 3AT1B 2B7EA 1GL5A 1WCMJ 4KT0E 1I1SA 3RCOA 2CREA 2CQQA 3FJPA 1USTA 4M77A 1U5TC 4BQOA 2E2HJ 1SVMA 3M07A 4Q47A 1XPXA 2YRDA 3QODA 4IHXA 2FBIA 3V8JA 1NK2P 3QU6A 1A6IA 2KYMA 1REPC 1DJ7B 2QHSA 3BR6A 2VLAA 1J59A 3DLLF 4C92B 1R23A 2ZZGA 3E6CC 4K86A 1E24A 5IP7J 3CQZJ 4PL6A 1PJRA 2QQSA 2ZNIA 1YN8A 5ERIA 2DFUA 3HKZN 4V2GA 4RG8A 4MFDA 2JT1A 1TW3A 5DD4A 2UV1A 4UVAA 5KAIC 2K7LA 4CRIA 3CCVQ 4NC8A 3I64A 3PE0A 4FASD 3PQJA 3RNJA 3WQZA 3O8HA 1P4WA 4EMKC 4CS2A 2PX9A 1LE8A 3DP7A 1YIJQ 4C3IJ 1HOMA 1IXCA 1C0MA 2H1LA 3H5NA 1ITYA 4IIMA 1WI7A 1Q7YC 2K5IA 3CCLQ 1W36C 5J8FA 3MZ8A 2RMOA 4BH9A 3VS4A 1DU6A 2QVOA 4ZGEB 5L3CA 3BCAA 3EG9A 3SHFA 1BKBA 3RTRA 4UV9A 2JMWA 2GXGA 3UNGC 1YI2A 1I1JA 1XGNA 2EV6A 4J5YA 5IT9Z 1J0RA 1K61A 4KFCA 2PMHA 1PSFA 4X9CA 5KYYA 3M7GA 1KA8A 2ZMEB 2YUPA 4M6VA 2PLYA 3N05A 3HFVA 4LD9K 4GRIA 4M78F 3X26B 2Y4XA 2CQ7A 1ATIA 5F1JA 2HGCA 4IOCF 3CUQC 2XG8D 2O61A 1JUMA 1KONA 2R5ZB 2IAIA 1GXPA 3CCVT 5EYRA 3S1NJ 3H6ZA 1ZH5A 2XGEA 2BHYA 2IY5B 4IQJA 4F93B 1T33A 1XGMA 2A0FB 5J4VA 2K4JA 4OMLA 2AQEA 1VQLI 1YIJT 3F3XA 3WTZA 2FOKA 2MMPA 1Q7YR 4OAZA 2DERA 2H8HA 2HD0A 4EPCA 2NNNA 5CK9A 3PL8A 4A3FJ 1I39A 4RCCA 4LMYA 1W0UA 2JA8J 5M9OA 1HC8A 3BROA 3HRKA 1OKRA 4UV8A 1SD4A 3P5JA 2TCTA 3SQNA 4BI8B 4XEMA 3G6EI 4D0PA 3Q5FA 1Q86C 2AQFA 4ZN1A 3JCMe 1YRNA 2LDMA 1PHTA 3FEOA 3CPWP 4H4KC 2DL5A 2KT0A 3LGFA 4EGZA 3A8OB 1WJCA 3D5LA 2NLUA 5FKLA 2K3XA 4M74A 4BJ6C 1KQSP 1TU0B 1Z9CA 4IHVA 4RB3C 5E8IA 3QYGB 3REAB 3HOWJ 5IH2A 1JHHA 3M54A 4IHYA 1Q1HA 4HX7A 1J2XA 4M78E 4RB2C 2LKSA 2CH0A 3GW2A 1P7JA 1K8AC 5HS9A 5C4XJ 2A28A 5ICCA 1BCMA 4J6WA 2FRWA 1WA7A 1E3PA 1X3UA 5KHDA 2DPPB 4HF2A 2VT3A 3COAC 2EKHA 1ZA1B 2RM4A 4JUVA 1XD7A 2EBPA 2MG4A 3F6VA 4YRMA 3FDYA 3HUGA 4LIVA 3JR9A 3OYYA 4A3JJ 4C8QB 3U1KA 3E0JB 4RB1A 1LFBA 1WHUA 2P0QA 5FLMJ 2Z1DA 2BXZA 2CW8A 1B6AA 1XN7A 1NJ8A 2YHTA 4UXNA 2DVEA 2LOOA 2DVJA 2MK5A 2E70A 4AIHA 1PP8F 3JB9I 1SEUA 3MKLA 4XTVA 3OW2P 1ORKA 2WV1A 3LSRA 3JCMJ 3TU4K 4HKEA 2WA0A 4LNSA 9ANTA 3MCZA 3OB9A 3TKYA 1Y96A 3NWTA 3JRHA 5C0MA 3CPWS 3U1DA 2DK8A 2F1LA 1RPWA 3CO7C 1UJ8A 1ZARA 3H1CA 5LJ5h 3ZL7C 1KQSS 2HOAA 2PN6A 5I2SA 5FO5A 4HAMA 1VQNI 1GDTA 4KUDK 3ROUA 2L7ZA 5DCFA 1YI2Q 1MMSA 3AHUA 4P5NA 4BE0A 2PEXA 4BJ5C 4Q5SF 1K8AR 4A4HA 1UTIA 3E3VA 1NJIC 4FSXA 4C8QD 4U0YA 3ABLH 4RCBA 1ZRCA 4BUPA 5HNHA 1G5IA 4ENMA 2BKDN 4OGEA 3W3CA 5GAMh 4JX4A 5J6XA 2VIXA 3CQTA 4D8DA 2JS0A 1KOGA 2DTZA 2J05A 1X1CA 3W2VA 5C3EJ 2DQ0A 4IUPA 3TREA 3AG2H 5D4RA 2JNGA 4IQ4A 1OEBA 3N4MA 2BIVA 3JCMQ 2XB0X 4NC7A 2KLOA 4I76A 2F69A 2Q8KA 1L3LA 2OTJQ 3QDRB 5B66C 2MLGA 4PLLA 4PK4A 2QGFB 3DEUA 1FMWA 2O88A 1B8IA 2F2XA 2FQ4A 1YBYA 3OW2S 1LEAA 3K4JA 3K4KA 3SWNC 1NNHA 1Z7UA 4KT5C 5EGOB 2KSSA 2Z2SB 4JJBA 4XK4A 2ABLA 3RJPA 3JB9G 2YU9J 1S1NA 4KRTA 2HQRA 2JA5J 4P74C 4C2MJ 2FG0A 4BHCA 1D1BA 4X6AJ 4YP0A 4UP8A 1QKWA 1OMIA 2VC1A 4HX4A 2WAQA 3JCMd 2V6CA 2DBBA 4CH4A 2QQ8A 1YFHA 2PJRB 1YI2T 1A0NB 4M9SA 5TISC 4PJNA 2IT0A 2LRQA 1NJIR 4YELA 3M0UA 2WB1A 1LPLA 3H5RA 1EV7A 1WGXA 4XOPA 2FVUA 2VBZA 2B9SA 4QVCA 3VQWA 3HTSB 2KT1A 2VBYA 2ZPFB 3HZJA 3ABTA 4XNFA 3KYDB 4XN3A 2KIQA 11ASA 1G3TA 3OS0A 2QKMB 1BU1A 2KQWA 1FC3A 5KYUB 1QWFA 1N9RA 4G94A 1WQWA 4OIRF 4TV7A 1D3BB 4Q48A 3DU5A 1AKHB 2PJPA 5EEHA 2KY9A 1UGPB 1RZ4A 3TDUC 1WSUA 4A4GA 3A32A 1WZ2A 2DXTA 5CKTA 3CPWA 5M3FJ 2FZKB 4P75A 4LVMA 2COBA 4YG2F 1VZ0A 2VJ4A 3I4MJ 2OZUA 1JKOC 4FYVB 2RDPA 4L59A 4Q6GA 3QWXX 2FRHA 1U5TB 2EZKA 3FDRA 3TSWA 1CKBA 2VKHA 2NYXA 5GAMg 2R7RA 3M1CA 1RC9A 4GYIA 1G8XA 5LHIA 2F2WA 1H3ZA 1K73C 3SDBA 2HQ5A 3KPHA 4RDXA 1AZGB 5GADJ 4RG2A 3AAFA 1TWHJ 4KR3A 1U8BA 2DD5A 2DOEA 4A6EA 3CXCP 1ZLMA 1I5ZA 2EB7A 4LGWA 3T9NA 3K6GA 1RUWA 1C0WA 1AD5A 1S3JA 4RGSA 1I6XA 3S6WA 2XROA 5DM7R 3HG9A 3OY9A 4YIIA 1P4AA 3WU2C 4M7AC 1Z7MA 3PUFA 4HT8A 3GXOA 1C1AA 1TNSA 2OQRA 1G59A 1W1WE 2I10A 3HXYA 1Y39A 3HRTA 2GAUA 2K2VA 3PMIA 3CJTB 1PYSA 1FYMA 1ETKA 5E20A 1X1BA 4LVJA 4LN2A 1VQ4I 3MKZA 3FXQA 2DJNA 2UUZA 3Q0VA 1VQLA 4HDUA 5IT9E 4KUMA 1V55H 3K10A 2JVVA 2A05A 2QENA 4W97A 4BBSJ 3KCCA 4WI1A 4PGHA 2CV2A 4NCXA 2VC8A 4P9UA 3VB2A 1ASYA 3EH2A 2GQIA 1VQOQ 3BG9A 2JTMA 3EGXA 4M75E 3VSLA 2OCEA 3X28B 2CH4W 1A5JA 3BZ6A 1M9SA 4LUDA 1VQ5Q 5GAN3 4EMSA 3I3LA 4GO1A 4XQFA 4M7AG 4AVPA 2PMZA 4TVWA 2QHVA 1KMMA 5FKKA 2OBPA 3LGLA 4FW1A 3G6EA 3C2HA 3EFOB 2H3EB 3E9GA 3CXCS 2EQIA 2DI3A 1OPKA 5LGTA 1YX3A 2O31A 3CUQB 4W1UA 4XK8E 1YIOA 4KQEA 2L3PA 3BG5A 1Z7LA 3EUHC 3GPLA 3GZNB 1OISA 3V4GA 1UHMA 1Y1VJ 2YWWA 2CZ7B 3DEEA 1D3YA 3FXKA 2CGPA 1W0TA 5KCOA 2OTLI 3RI4A 3SZGA 4J9CA 5LEKA 1HDDC 2K9LA 1UCRA 2HSPA 3M9QA 4ZH4F 5HDKA 4D7NA 3G4SI 3RKYA 4KT6A 3H3VK 3HXUA 2E34A 3RGLA 2Q2EB 2JRMA 3OBYA 4A63B 4RLQA 2P0LA 1VQOT 5FLXK 1JGSA 2R57A 2X3WD 4KBMB 2X4XA 3GYHX 4X1VA 1YG2A 5GJWB 2DPDA 2EYXA 3DPUA 2W48A 4DQ2A 4C0GA 3S3OA 4N4NB 4NBQA 2XKPA 3L2RA 1JQQA 1QVUA 1ZX6A 1WVRA 3OMCA 3QDFA 5ELOA 3VS5A 4EDUA 3M0PA 1W7PB 2EGEA 4F3QA 1N78A 3L09A 3BC8A 1HC7A 2LVSA 2B0LA 2L0AA 5J1RA 4KITB 4V2FA 1H8KA 1FEXA 1X1DA 3GTGJ 2E5NA 2DJQA 3BTJA 4EM1A 1AOJA 1VQNA 3VQXA 2RNGA 1WU7A 1Q95G 4Z6YA 2PVGB 1KC8R 4J9FA 4HNTA 1VTNC 1FYFA 2ROTA 2LX9A 4BY7J 2F5FA 1X75C 4KJZA 4XSZF 5AONA 1TUCA 4JYKA 2R92J 2M4GA 1YTYA 2L0KA 4KR2A 3BPVA 4UP7A 3P8YA 4AT1B 2P4WA 3IUOA 2IIMA 4YRKA 1SFUA 1Y0MA 2BZYA 2ARSA 2ODRD 2RC4A 1DDNA 3A5ZB 1XSVA 3D0SA 4BGDA 2A6EF 3MF1A 1KJWA 2ZMEA 4H2UA 2XIGA 5GAEJ 4HBLA 3K1NA 3NARA 1YS6A 3W3SA 2KRCA 3CXCA 1VQLQ 4I98B 4NL2A 2VGNA 2ZIMA 2JJ9A 2D9TA 3WTXC 1AT1B 4FQGA 1VQ8Q 3R0JA 2O9LA 4KMFA 1RR7A 4Z88A 1X6BA 4N0AA 4E47A 1OCZH 1PG5B 2XAHA 1MNMC 4ZTFA 4II1A 1DP7P 4LDWA 1DGWY 4ZC3A 2ZR3A 1EX4A 5I11A 2E1MC 1K83J 4YRJA 5DD8A 3W6VA 4OAYA 2DMTA 1VQZA 2BYVE 2PUOB 2ID3A 1J09A 5DEQA 4KN4X 5BNGA 3G6EQ 3LSSA 1Y71A 2QA4Q 3META 2COYA 3FK7A 1JKPC 2HCKA 3ZFJA 1UB4A 4QLCU 2G7UA 1CF7A 3IL2A 1Y56A 3JB9J 2COZA 5K5QA 4H2VA 2V8JA 2X9DA 2NAZA 4IEJA 5ICEA 1LNWA 1IRXA 2HVRA 4Q5WA 4KULA 2RJFA 3JB9H 2IGOA 2FUG2 1OU9A 2QGUA 1TXQA 5D8KB 1D0YA 1EH6A 4A6DA 1N9WA 1X01A 1N8RU 1YO5C 3DKMA 1MDMB 1O3QA 3MZYA 2DL3A 4LXCA 3VOEA 2XGDA 3RSNA 4XLHA 4AIKA 1VQLT 2W7NA 5CVVA 5LL6S 5GPCA 1FIAA 3WVDB 1XGOA 3JB9D 3MP1A 1VQ8T 2DIQA 1N25A 4HPQA 1WXUA 3URGA 1TBXA 3JCMb 4HCCA 3VYHB 2JN6A 5CKDA 2XAGA 2GBQA 4LLGF 2XPVA 2V7FA 3LWHA 5KYWB 4HF0A 2KRNA 4H2TA 3MEUA 3VYRB 1A04A 2ZKZA 2J5OA 2QTXA 3G6ET 5FKOA 1IGNA 2QA4T 3K7AJ 5GAOq 3K9TA 4N9HA 5C4JJ 3ISPA 3EAEA 2HVQA 4CO8A 4DW6A 1LDDA 1H3HA 1EVLA 3A1PA 1NHAA 3S2WA 2LJ3A 4XTWA 5DYMA 3SB2A 3KFUA 3ZMDA 1ERDA 3QTCA 1K4TA 5FW9A 2LCCA 4M6YA 4ENNA 2DX1A 4RS8A 1VQ9I 3C4SA 3HKSA 2CS3A 2M7BA 2ZT5A 1KD1U 1D09B 1VQ4A 1G6NA 1P7IA 4J9BA 1USYC 2TRTA 3RUXA 4FCYA 1D1AA 4FYYB 1QNTA 2QSFX 4BI3A 3WU1B 4CYDA 3L2WA 3GTKJ 3NEUA 2GGRA 4O6JA 1XTAA 3DWLE 3M9AA 1ON1A 2W82A 2L3RA 4I02A 4KGXB 4RQFA 1S7AA 3OMGA 1A35A 2OJED 4IJAA 3LAJA 3JCMf 1W2BP 2JA2A 3HXVA 2W24A 3TEHB 3A8LB 2JA6J 2RK2A 1N8RR 5JLXA 2VV5A 1ONVA 2NS0A 1KK7A 3TGNA 2P6SA 3DXJF 1VYVA 1BI0A 3H9JA 3CMQA 3KZZA 3IG2A 2ZFUA 1NLOC 1UHWA 4M7AB 3JV3A 3ECHA 1NYQA 2FMLA 1QO0D 1NJ5A 4P72C 2EIKH 2DBMA 1GFDA 1W5CC 4F7ZA 4PFZA 2FSWA 4HF1A 1P2FA 2FMYA 3H0DA 1MHNA 3J7AY 4A3EJ 2CUFA 1D8KA 3TW7A 2L5QA 3OWTA 1FYLA 2P84A 4PJOF 1EIFA 2OTLA 2QBYB 4Y3OA 2I4LA 1ZRDA 1HXDA 2AT1B 4YPFA 2MH9A 4M78A 3TOBA 3EHQA 1WJEA 2IG0A 1XNIA 3EFSA 5GAOp 2ZAEA 1VQ7Q 1T39A 2R7WA 1HYOA 3REBB 4UUSB 2X6XA 2KGTA 4LVIA 2ZCEA 1MJ9A 3G4SA 4E7JA 3DKWA 4K87A 1DP3A 5IN1A 3DPLC 4P9FA 4F17A 4K88A 4RTWA 1JUSA 4UY8I 1P92A 2Z3YA 4H2XB 4ZYEA 2N8GA 3G1OA 3QKJA 3G7ZA 2FXAA 5LD2C 2HZYA 4II3A 2E19A 3CLQA 1R1TA 4YCVA 5IYDJ 2EH3A 4L5GA 2DOAA 1U2WA 3G71I 2LVMA 3BTLA 1QBJA 1W2BS 1S7OA 4CS3A 2EJ9A 4ZNXA 3UDCA 3CC4I 1W4SA 2ZINA 3P9CA 2ICWG 1KD1R 2LY2A 2C0TA 4M75G 5KYNA 1WFWA 2FYKA 3HHTB 5I22A 1KQ8A 1G5VA 1R5HA 2OA4A 1ZHIA 1RADB 1DUXC 5CVRA 2HPIA 1RL2A 2PUKB 1IL2A 2RQVA 4BHBA 3WGGA 2L89A 3GEZA 3BR5A 4XORA 1AKHA 4PJLA 1HW5A 3BE3A 1RKWA 3VSKA 3OYLA 4L18B 1AWJA 2ZCFB 3J7AO 2GTOA 3V42A 1X2MA 2RQPA 2QEXI 4PJOE 1TUDA 1VQ7T 4PUSA 2CYZB 1K6OA 1HKQA 1BB9A 1OYIA 1M1EB 1P4XA 3E1SA 4UHTA 1SRLA 4CH6A 4DBHA 2R7SA 2IPOB 3M56A 2E1CA 4KUIA 4FT4A 5GMKh 4B9WA 2IGMA 3HSFA 1UHFA 2LKXA 1SVOA 2X1CA 2UXNA 4YROA 5J1UA 3IWZA 4M77E 4ZIBA 3FMSA 2M45A 1N9SA 2HFHA 4B44A 4YRPA 3KEQA 1HW2A 2HYFA 4TVRA 1VQPQ 3GTOJ 1V5FA 1QVGP 1BYMA 5L8RE 3FISA 3CCMI 1VQ4Q 1VNDA 4IUQA 2R7VA 3ASKA 4R79A 5F0CA 2ZZDA 4IXAA 1VQMQ 2RAEA 5BS6A 1JBMA 4ANJA 1QQIA 4EMKA 1LFPA 3QBYA 2LREA 3GTQJ 5CYVA 3KEYA 2XDBA 1ZQ1A 2XK0A 1SERA 5FLXZ 3K2AA 1ETWA 3OYKA 5CQEA 5BPDA 4RTXA 1X2NA 3I56I 3I7FA 3INZA 5K1YA 1E3OC 3K2ZA 4M7DF 3A8GB 3CPFA 4D7MA 5H6RA 1JXSA 4IHWA 1VOMA 3F8BA 3PQKA 2XRLA 2ZT8A 2X1EA 2DD4A 2QK0A 1GT0C 1YITQ 5KNNA 1UMQA 2ZXFA 4M78D 2EQRA 4P3PA 2CJJA 3QHSA 5GAN7 3M53A 4Y13A 3FIWA 2XMFA 3VRZA 3GFLA 1BIAA 2M3AA 3M8JA 2BE7D 1S29A 5C52B 4B48A 4XLEA 2K5CA 1IZ6A 5ILSA 2E36A 2Y90A 1MBFA 3BZKA 5JVTA 2Y0SN 3T8TA 3EG0A 2OTLQ 2HOSA 3EFOA 3AG4H 4H0EA 1VQPT 1AWOA 1R22A 2DQ3A 2JMAA 2VJIA 4Y28E 4F16A 1VQ4T 1VI0A 1P6RA 3LH5A 3LX7A 4YDQA 3EQLF 1YOVB 2DL8A 1QVGS 4HNVA 3O8VA 1O9SA 3HXZA 2DA4A 5D4SA 2H94A 2CW7A 1Y8QB 4YEJA 4HWOA 1LJ9A 2NUTA 3G4SQ 3BTCA 5L3DA 3CDIA 2AMCA 3LC0A 3L2ZA 3OSFA 2CMPA 3I55Q 4RQEA 1P9QC 2VUMJ 3FB9A 3EUAA 3UT1A 5H2FC 2G0EA 2YR2A 2E1MB 3OL3A 5DUKA 3H3ZA 1F43A 4EMHA 2R3SA 5M5XJ 3SHWA 1HA8A 2HVSA 2E5ZA 3CMEQ 4LDUA 4RM2A 3WHBA 2K27A 2XAFA 4OP0A 1ON2A 2LMJA 1YITT 3FMRA 1NZ9A 4JLGA 5BMZA 1ZQ3P 4V2SA 4M7DE 1V5EA 2V6EA 3W2WA 3NETA 1ADJA 3RQIA 2E10A 2PVDB 1WHLA 4HDVA 3KLOA 1ZR4A 3KUFA 2NUPA 2WV0A 3LW5E 3MQZA 1I50J 1MBKA 2BE9B 3KP2A 1Z05A 1KQ9A 1JT0A 2P0KA 3ZQFA 3KEOA 2ZZFA 2XC7A 3NTHA 2OTLT 3QOPA 2CSOA 3MQ0A 2F4IA 2UZKA 5FKMA 1FJLA 2X3XD 1RAAB 3IRQA 4XKWA 3WTSC 1VQ9A 3HSBA 4C5GA 1I4K1 1R5GA 2VBXA 3G4ST 2ZPHB 3ZOBA 3W6KB 4G6QA 4F55A 3TMOA 2EGAA 3C2BA 3UR3C 1T0JA 4QWQA 3I55T 2GBYA 2BGCA 3F70A 2KEAA 3RF1A 1Z1DA 1MW7A 2KIFA 2LMDA 3KX2A 1D0XA 1H641 3FWEA 2FEZA 4EGYA 4MEXF 2XHCA 3K4BA 1QCNA 3JCMV 2MD5A 5KH6A 4Z89A 1JJ6C 3VS6A 1R5ID 1XMKA 2OQGA 1O57A 3GTJJ 5D6FA 1FOXA 3QIIA 1HD3A 2HKQB 1AOYA 1FBSA 2L01A 3ESWB 3LMMA 4HA8A 4KH0B 3A5ZA 2YUQA 3ULRB 3FHNA 4HYEA 2OCCH 2KRHA 3D1NI 1BM9A 3BCBA 3OS1A 4B9XA 2R93J 3REUA 2A36A 4PKCC 1JXMA 2IVMA 4FL6A 2CW0F 1XSDA 3MP8A 4CXFA 2DEQA 3NENA 1RACB 4XQ3A 4CH5A 3CCJQ 4GY5A 2K3PA 5DCMB 5HNFA 5LJ3j 1PNJA 2HXIA 1FPQA 3EHRA 3UF4A 2RHSB 1HKTA 4J00A 1Q81U 4N4IA 1PRMC 1IJWC 1S5LC 1WQ2A 4LK1F 2E3IA 3MMYB 3MKDA 2OF7A 1WWXA 2I4MA 1R00A 1TWBA 2R0QC 2Y48A 3VKIA 4DYRA 3GF2A 3R61A 3I5RA 2EQUA 4LNPA 1U3OA 2QM3A 1SF9A 3FXOA 2P5VA 2X85A 1WHGA 3M1EA 2P0WA 3LQQA 1YJNI 5ECAA 4YRNA 1UE9A 1VQKI 3G71A 1ZK8A 1ETOA 3C95A 4XLCA 1YCSB 3CCQQ 4FT2A 1Z67A 2D5VA 1RAFB 2GA1A 3JCUC 2A69F 3CESA 1MBHA 2XGCA 1LDKB 1EKEA 1R58A 5H6QA 4NDLA 1U1SA 1Z3YA 3OIQA 2PBIA 1I27A 2R7DA 4HSRA 4DBFA 4HVVA 1ACIA 3SWNA 3K1PA 1Q82C 2ZO4A 5GAOm 4N4GA 2JUFA 4RMFA 5GJVB 3CCJT 2JZYA 2NOGA 4P74A 4ZYGA 2L4MA 3BG7A 3MEVA 3ZN1A 4XOTA 3QQAA 2DMOA 3S14J 3ZN0A 2DO7A 3EG1A 1FYKA 1FY7A 3VYGA 3PNWC 3CF5F 3S1MJ 2QEXA 3WTTC 2IPQX 4ZJZA 3K70D 2K7AA 3L4GB 5FROA 3AG1H 4K2EA 3RR6A 1YCYA 3TEGA 1D8JA 2WAFA 1YHQI 3J81K 4YRQA 2EILH 3MVPA 4BDZA 3PO3J 2XF7A 3FXRA 3BR0A 2LC2A 5HK0A 4HXJA 2ELHA 3NPFA 3ZQHA 1IXDA 7AT1B 1M1KR 1UHCA 1DGRM 5GAHJ 5DS9A 1AVZC 4MMKA 5D7UA 1JJ8C 3JRZA 3CCQT 2P5IA 3SFMA 3OS5A 3J7ZI 3DPTA 1USSA 3CCMA 3JREA 4DBRA 4ASNA 4M75D 2AKWB 2R5YA 2EW3A 2LC4A 5JR3A 2DMNA 1Q81R 2MBFA 4LVKA 4PLIA 2YXYA 1SVLA 2XDDA 2JM8A 2K3YA 3FKIJ 3K4NA 5DDGA 3QAHA 2LJ0A 4DBQA 4Z8AA 4DOVA 1MMGA 2XD0A 1Q82R 1OYXA 4F7UF 1WJRA 4OB3B 1MGQA 3H0FA 1QP2A 3BJ6A 4D6WA 2FA5A 1UB9A 3GFMA 2J3MA 3UGQA 3FJ5A 2DTIA 4P96A 3S93A 3PT9A 3I56A 4ESRA 5IHKA 1M90C 3CCUQ 1AWCA 4OMMA 2VN2A 3OYNA 2DL4A 2M7AA 2Y30A 2E35A 1OYYA 2KT8A 4EX5A 4YRTA 4J7IA 2VXEA 3KBGA 1X3ZB 4NQWB 3CC7Q 2AZSA 2DFIA 4X5OA 4PJOG 3H9QA 4XEOA 2KHMA 2ZT7A 2ESWA 2K3FA 4YFKF 1GGMA 3DTEA 2W10A 1HK9A 1WJQA 4JOMA 1VQ9T 3LSMA 1HSJA 1QZYA 2LNVA 4ITVA 1X1AA 3HRMA 5FLXE 4A0XA 1IB8A 3RDIA 2R4GA 3I5UA 4M77G 1PM3A 2ZFWA 5LJ3g 1R4NB 2EYQA 3V8LA 3A2KA 1MKMA 3S3NA 3SZPA 2HL3A 5GANj 3QP5A 4R1HA 1YFSA 1WLEA 2RQRA 2ZT6A 3G3ZA 3RKWA 2CP3A 1IHVA 3O5ZA 4LLNA 2QQRA 3P9KA 2J6OA 5FGMA 4UUSA 1R49A 4C3HJ 1M90R 4FW2A 1U9NA 2KRFA 2Z33A 2P5KA 2JZ2A 3BR1A 2HBPA 1YE9A 1JXOA 3BY7A 1N77A 4H2XA 2FU4A 4OMYA 1OCCH 3IKTA 1S6LA 3CMMA 5GPAA 1ZA2B 3AL0B 3EUKL 3JRBA 1T95A 2DM1A 2EGCA 4XKBA 3I54A 4KYWA 2QLZA 2EJFA 5HS8A 4M3DA 1ZBJA 4QKUA 4B09A 4C92F 3KE2A 2XIDA 3A1YA 3HP9A 4C8QC 3LSQA 1OFCX 2E1HA 4BBRJ 2KKOA 4MTEA 4WTOB 3EUHA 1JT6A 3SEQA 4JRPA 1VIEA 2KXCA 5K7FA 2KVQG 1G5HA 4CUGA 3LWFA 3FRNA 4LB5A 3GLXA 4AM3A 3CP2A 4RM3A 1LVAA 2XV4S 2VQLA 2DXUA 1QRYA 2F2EA 1QHHD 2JQ7A 4QQGA 4G12A 2RHIA 3RERA 3Q3SA 1U8RA 1K9MR 2DTHA 1RAHB 3A01B 4BE1A 1A6QA 1K4SA 5JLWA 4BQQA 1SFXA 3BTIA 5F1RA 1AA7A 4EO4A 5CKFA 2MA3A 2XU8A 4LG0B 3G71T 4ZTJA 3K4MA 4I09A 2ALYB 2EIMH 1NE8A 2DCEA 3UGTA 3L2QA 1J9IA 4NUBA 1X58A 4M9XA 2BTTA 4XN0A 4J9HA 3JRGA 3BJOA 1PSEA 3HXXA 2DU9A 3HSEA 1GV2A 4DPGA 4GXOA 3RPUA 1EVKA 3GUDA 2RHQB 4S05A 5EEAA 2MW8A 3Q1JA 4P73A 2F5KA 4CZZA 1TZLA 2L7FP 2X6WA 4M7DG 5E8GA 1YFRA 1E1TA 4YCUA 2MPXC 3AKZA 4C92E 5FU6C 5DTDA 4PG3A 2QEXT 1OYWA 3SDGA 2E41A 1YFTA 3IAM2 3HPHA 1SAUA 3NTIA 2V1NA 4B43A 1QA6A 2MWPA 1A31A 2PMEA 2HKOA 4FYXB 3NFCA 2BW3B 2CH4A 3PGGA 2JUCA 1Z77A 3C7JA 2BY3A 3Q9VA 1M30A 3PSIA 4WXCA 2O03A 3P9IA 4E7LA 2HOEA 2BVMA 2DMPA 1OX8A 3KZYA 1V1CA 2F2VA 5C44J 4TVYA 1GVDA 2BY1A 2A37A 2OD5A 4XONA 3H92A 1YJNA 3LSIA 3SFIA 1IREB 3CCEQ 1VQKA 1YGBA 3QO8A 1BBYA 3CCMT 1RI7A 3HRIA 3C2GA 5K1PA 3QZ9B 4M73A 1E1OA 5FB2A 2ECZA 3GLLA 3A7AA 5L3GA 2X6OA 2K9QA 1TH7A 2RGVA 2XASA 4JK1X 1KIKA 1XG1A 3X20B 1YJ9Q 3ERED 1HQCA 4YRGA 5JFRA 2R7XA 2BBYA 2P4TA 4BWAA 1POGA 4KIBA 1IF1A 3OR2C 4M6XA 2EZIA 4L6V5 1VA7A 2O9SA 3I56T 4QSHA 3EYYA 2EZHA 1XS9A 1T0FA 3DSQA 2ZC2A 1ZBXA 3ZR8X 2DXCA 1TQIA 3GTPJ 2DPUA 3L00A 5LJ3e 3CJNA 4LFUA 3CMYA 2CU7A 1U06A 4QIWN 1IN8A 2DKGA 2I5UA 4AU7A 1TG0A 4OMFB 3I4PA 4EATA 5GANg 3GBQA 2I8DA 1MNDA 3VFZA 1ZAOA 1TOVA 4C2UA 2K6DA 2CFXA 5LRSA 2CKKA 1XDSA 2DTOA 2EL9A 1RI0A 2O6GE 1YHQA 4H2YA 3SZTA 2ZXHA 1OJLA 1K6YA 1HLVA 1QMCA 1TQPA 1I8FA 5F6FA 1B59A 4XTYA 4FYWB 4C8QF 2CZ1B 4KGVB 2LF7A 3CCET 3QYHB 4EJUA 1AWXA 5GAN4 4TQFA 4HCKA 3MCAB 2BZTA 3T1BA 2KBTA 2JW4A 2E3CA 4J19A 4C2TA 5IOYA 2E7WA 2E71A 1ZSZC 4KH1B 3JCMX 3BG3A 2EK5A 1M8VA 3DQVC 4MQ9F 1YJ9T 2DXBA 5FFZA 2IVWA 3LSPA 2DODA 3BQYA 3VJPA 4EIKA 2DYRH 1Q7YU 5LFAA 1ETQA 1EFWA 2KDSA 2DMQA 3TO6A 4UP9A 3JTHA 2M4KA 1JJ2P 2LNBA 2LK2A 4N9IA 4IKFA 2O8KA 1RNLA 2WADA 2CT3A 1E0EA 4D5FA 3RKQA 2ACJA 2COWA 3F6OA 3OYCA 1ASZA 4UNOA 2J5PA 1SFKA 2FOWA 1ABQA 4DYCA 2STTA 2E1OA 4ZGDB 2LT1A 2IRFG 1ZHFA 3IKMB 3MEXA 1R1UA 4LB6B 1XGSA 2A5YB 1RAIB 5J4YA 3QRFF 2EYWA 1EJ9A 3OYDA 2E12A 3C3WA 3IRRA 3M0QA 2P81A 5F27A 3RQ4A 2CJBA 2O7OA 5LGNA 5F5WA 2QDYB 4HRIA 2MC3A 2KMUA 2ID6A 4G6DA 5IP6A 3ER0A 2QI2A 1I5OB 3R6SA 2O4XB 2M2EA 2DA1A 3WODF 3NHNA 4HT9A 4P71A 3PFSA 2B8AA 1I07A 2CQKA 2CP0A 4G7ZF 2XKOC 2EBIA 5CR2A 3NMZC 1V29B 8AT1B 2Q5IA 2L2OA 2ZXWH 1B3QA 2RI3A 3B6CA 2HEQA 4PFPA 2JSPA 4HWPA 1WXTA 3BDDA 2WY7Q 1IN6A 4MLOA 3J81Z 2FNAA 3CMAQ 1B7YB 1YW9A 1USYA 2OX7A 1JJ2S 4YRIA 5GAOn 3UATA 5JVGF 5K7HA 1QCFA 4AFSC 4KDPA 5K7ZA 2HNHA 4RGRA 1W70A 2JN0A 1BR1A 3VS2A 5BOXA 3WGHA 1Q86U 2A68F 5EZGA 2OAWA 3M55A 5LJ3d 3A7UA 1WJAA 4ZGJB 2H27A 4M7DA 2RI2A 2V1UA 3PCOA 4AIJA 4DA4A 2EFIA 4PJOD 2YSQA 1U6GA 5CKHA 1Z9QA 2VKNA 3M5AA 3H9NA 3F8CA 1WH7A 2PTKA 4P72A 2Z5UA 4ZDPA 1K8AU 3W2AA 4I0BA 3BJUA 1QZEA 2EA4A 3MZHA 1MBGA 2A7YA 1F36A 3MEYA 4M77D 2JT4A 1WQ7A 2EAYA 1O7FA 4JDSA 2JTVA 4M9ZA 3S3MA 4MZMA 2MSYA 4YIFA 2ODRC 1IG7A 2ED0A 1DU0A 4OIOF 4Y33A 1R1VA 3CMAT 1IAWA 2BV6A 3S16J 4JX5A 5GANe 5TRDA 1G3YA 4NHJA 5LJ5j 4GFBA 2VXDA 2AZVA 4EMGA 1VQKT 2HOTA 4WXHA 3GZ5A 1ZG5A 1Y7XA 2D1XA 3E9IA 2EVRA 2KZVA 3CCLI 4N4HA 3OD1A 3GX4X 3HL8A 1FWZA 4G9YA 3RL6A 4IF4A 3JRFA 5IAYA 1TTYA 4OIPF 5KYYB 2L4AA 4BY6C 5FU7C 2AHQA 2KIUA 5GAMj 2QG9B 1W66A 3FC3A 4F14A 1QF6A 3VS7A 2M5WA 4E7IA 1BC8C 1O3RA 3EDPA 3GMEA 4YRSA 3IHUA 1K76A 4DZPA 4UB6C 5GMKm 2PZ1A 2AKWA 2QHTA 2F5VA 2BY2A 2CWEA 1IGUA 2JVHA 2CDTA 1EOVA 3E6DA 1H92A 1NJIU 5FLVA 1F1ZA 1B34B 2C8MA 3F23A 1E7OA 3VS3A 1T2KA 4M4ZA 2B63J 3KETA 4XU3A 3M8EA 1C0AA 2YS9A 1PVEA 1C6VX 2IP2A 5HLHA 3IWFA 1Q86R 2W0ZA 4P3NA 3S1RJ 5IT3A 5E1ZB 1X27A 2GIZA 2ZJPF 4ELZC 4DOWA 4OB2B 1JJ2A 2VKDA 1BBZA 4IHSA 1B72A 2CZ0B 3EETA 2LZ6B 2MFZA 4BYYA 1PP7U 4PGGA 2V9PA 1SPKA 2E6ZA 2VI6A 3TW6A 2DTRA 2ARUA 4G7OF 4ELYC 4XTUA 2VT2A 2V1RA 3TQNA 3HBLA 2EA2A 3KYCB 2MI6A 4F92B 2P8TA 3DB3A 1UG1A 1H88C 2V9VA 3QWLA 3OOUA 1M2VB 1IXSB 1LEBA 3QWYA 3CD6I 2A61A 1ZLKA 1WJSA 2XAUA 5JHFA 2YUSA 1E6HA 3BZCA 2VJJA 5FU6B 5BPIA 4M7DD 1XDUA 2OAZA 2XAJA 1ZTRA 4AYBA 5KE3A 4L0YB 3DEWA 2EINH 2NVQJ 1KQ0A 5ICFA 4QQ6A 4Z2YA 2HDDA 3HUGB 3HFZA 3HOUJ 4L9NA 2DILA 4G7HF 4C92G 3V8KA 1J3TA 2Q5HA 4JPBW 5DY9A 5J3BA 5CVUA 3MF2A 2IGNA 4XU0A 4ZN3A 3QYBA 1TS9A 4L5JA 3HYIA 1BN5A 2LQWA 3P8VA 2OZ6A 3W6JB 3TVTA 3O3KA 3HJEA 3TEDA 2R7TA 4AFUC 5GANd 2XICA 5LHGA 1JGGA 3P7NA 5HLTA 1GVJA 1Y96B 5CKBA 3BFMA 3MHXA 4XRSA 3HXLA 2DA7A 2K9SA 1FX7A 1VFCA 1UEBA 4II2A 3IALA 2DT5A 2P6TA 1GCPA 2BVLA 4GYGA 3RZOJ 1RAGB 3U21A 2L8DA 1QP3A 5I21A 2FZGB 4TVAA 2KISA 4N0AC 5D5VB 2TDXA 5GAOl 3Q0UA 2KDZA 1MUZA 3PZCA 2K02A 5A0GA 2QDLA 3MD2A 1SKUB 1M27C 3GVAA 4RA2A 1TTHB 1K73U 2QAZA 4AYBN 3FK6A 1EIYA 1OLTA 2OAUA 3A01A 4YRCA 3I9V2 4DZJA 2DLLA 1B9MA 4D1QA 5HLGA 5LJ5g 3GIBA 4CYCB 3BR3A 4N4OB 3QP6A 1WYXA 2H8RA 2RH2A 2VASA 4M71A 4IX7A 2X6YA 2ALYA 4HCBA 2FPFA 2V4JC 4CC3A 5IXBA 5IXFA 4HLYA 3U2RA 3UH0A 1FNNA 4RLFA 2FRYA 4KGZB 3HY0A 1XB4A 5LGUA 2E3HA 1IXRC 2RHXA 1ZSZB 2L3DA 4XMYA 2K4BA 1RESA 5FWBA 5J26A 1V4RA 3TEEA 2DYBA 4HWTA 5KK1A 5IYBJ 12ASA 3K69A 2RHQA 2WSFE 1CKAA 2H3JA 4DJAA 3CCRI 4CH3A 4ESBA 3QYEA 1UZCA 2OTJI 1KU3A 2VWFA 3BW1A 1SESA 3WXMB 1NTCA 4RDUA 1B8AA 3MP6A 4EJWA 1YX5A 4CC2A 1ZN2A 2RQTA 3OBWA 1HJDA 5M3MJ 4O5VA 2QTVA 3L42A 4IUTA 3OR1C 2ZJRF 2QCOA 2HKNA 2PQ8A 4ZTZB 2RA2A 2OC6A 2K85A 4IRHA 2LF8A 1GV5A 4F7UA 4BS9A 1TLHB 3FXLA 1YS7A 3F72A 3ZMVA 4M72A 3M4OJ 1EF4A 2CT4A 1GBQA 4LDVA 5CVIA 2YU3A 5KCMA 2YT6A 2QQBA 2UWMA 2GF7A 2EV5A 5GTHC 1XCVA 3B02A 3REOA