3V7RA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 98
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v7rA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v7rA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v7rA02
5TRDA 5GANh 1YCYA 4P9UA 4YFNF 2ZXFA 1O3TA 2YPRA 2DAOA 4E51A 3O2PE 4C8QA 2BEOA 4PGGA 4Y91A 3FXRA 4NL2A 1YW8A 3HOTA 1K6OA 1YTYA 4P75C 2C7IA 4KIGA 3KP7A 1E1TA 3ERRA 2CJAA 2OD5A 1E24A 1Z6RA 1ZRCA 2M30A 3RUXA 4PJOD 2HKOA 5DYMA 3BW1A 2PMHA 3GW2A 2HYGD 4I02A 1A04A 2LDUA 2I4LA 2MH9A 2ARUA 2A68F 3QSUA 3JCMJ 4PZJA 2QHSA 4G9YA 3J80K 1NNHA 1B34A 2ZMEB 4FX0A 3E5XA 1XSDA 1TNSA 1SESA 4NB5A 4L9JA 4UVBA 1KU7A 2F2EA 1T98A 1HW2A 2DK8A 3JB9F 5KVRA 4HYEA 1VQZA 1UCRA 2OZUA 4MQ9F 4A0ZA 2ZNYA 4Y17A 2VBWA 3RIRA 3OD1A 1MDMA 3IRQA 2E64A 4M7DB 1QPMA 1RUOA 1IN6A 1O7FA 1QGPA 3U9GA 3SWNB 4P55A 4XTWA 3PCOA 2XUBA 3QO3A 2OQGA 3FJPA 1XD7A 5LJ5j 1Z7NA 5BOXA 2ZINA 1M8VA 3ZN1A 1JHFA 1SFUA 2QQBA 4L9VA 4M77E 1M5Q1 2WC2A 2VODA 1NJ2A 2QZ8A 4KN4X 1D3BB 1SD7A 4F7ZA 4PNOA 3VB2A 4KYWA 4DNCA 1ADJA 3KP3A 3FWEA 4ETSA 1KQ1A 3GZ5A 5HS7A 2VXEA 2KJBA 2FYKA 3Q5FA 2W85A 1CF7A 3L1AA 4LG0A 3T0YA 4C92D 2NAZA 5GMKj 3TEHB 4M7AA 4BWAA 2UWMA 2PMEA 1J59A 1UFMA 4A0YA 4OIQF 3F3XA 1D8KA 3TKYA 3WTVC 1JGSA 4ZYDA 1UB9A 3LWFA 3FZVA 1D5VA 2CO5A 1MD0A 4KICA 2M1BA 5LHHA 3WTZA 3G73A 1WQ2A 3HUGA 2FU4A 5GAN4 2QLZA 1YS7A 2DQ0A 3CLOA 3BJUA 2EFNA 3CUOA 4CH3A 2HNIA 1LNWA 3F8MA 4ESBA 2PMFA 2E7WA 2Z9OA 2IA2A 4XTVA 1O3QA 5DCMA 5FD5A 2RNJA 5ERIA 1BIAA 3K9TA 4G94A 4X9DA 4P74C 2A3SA 2YR2A 1IRGA 1SAXA 4M78F 3CO7C 1EQRA 4N0AC 2IT0A 1XN7A 3L4GA 2A07F 3REUA 2DW4A 2RGVA 2HKXA 5FLXZ 5ILUA 3S2WA 5HDNA 4JBAA 3FMQA 4GXOA 4EJWA 3EQLF 3HRIA 1AOYA 3MQ0A 2EFQA 1GHCA 4B8XA 5DEQA 4EMKB 2YX7A 5GANe 4H2XB 1BM9A 3GUDA 1G3YA 4G85A 3FB9A 1ZHFA 5GAN5 4CH4A 3HSRA 1I1GA 4LLGF 1QBJA 4YPFA 4U7DA 1DPUA 3PZCA 1LOJA 3A7UA 3RKWA 3HFZB 1T2KA 1W7PB 5D4RA 4M74A 3MFKA 2HYFA 3CTAA 3V8JA 4LD5A 2M45A 3T5XA 4H2SA 1XGMA 3JB9H 2RHSA 4ENNA 1X3UA 4R1HA 2XIGA 2HQNA 3HTUA 3RTRA 3CUQB 1G51A 2QUFA 1H9GA 4HW0A 5H20A 2D2WA 3DEUA 2VBZA 4ZZDA 2AS5F 3BFMA 3BPVA 2ZXJA 1G5HA 2H6BA 1R1TA 1Q1HA 2CJ9A 4G6QA 2FNAA 3EFSA 1AWCA 3HXVA 4P5OA 2GXBA 4EGYA 2QBYB 4YRNA 3MF1A 2K27A 4AIKA 4MQVA 2RV8A 3H92A 2K7LA 4FT8A 3V8KA 3SXYA 4YRFA 2X4HA 2AMCB 4P71A 3E3VA 4KDPA 2Q7GA 1U2WA 2ALYA 2ZZFA 3I58A 2Q0OA 2DLLA 2KIMA 4A5MA 3UH0A 5D4SA 1R23A 2PLYA 4XLNF 2XGTA 2OZ6A 3SZPA 1BBYA 4AD9A 3ZP5A 4ZYGA 3LSQA 3GFIA 1P6RA 5GANd 1ASZA 2VE8A 4L9TA 4M6YA 4RAZA 2IP2A 1KQ8A 5GAMd 3J81K 1HQCA 3TUPA 4YRMA 3JCMh 4AH6A 3I59A 1OYYA 3FX3A 4MTEA 1DUXC 4P73A 3HSEA 2UXNA 3QOPA 4M77B 5GAMj 1QE0A 3F8NA 2HZTA 3GEZA 2RKHA 3JCMd 4EJOA 5LLQA 5C53B 4YIIA 3IKTA 1H4SA 1ON2A 2K57A 1N9RA 2F5CA 4ENKA 2XASA 4M7DE 2ZT6A 4H02A 4BW9A 1F4KA 3GF2A 4RGUA 4C8QG 4OOIA 4N0BA 3E6MA 5ILSA 4MMLA 4EMKC 3MZYA 5E17F 4JQFA 5LJ3e 2GWRA 4NQWA 3DV8A 3K1NA 2Z3YA 2RA2A 2DDZA 2PI0A 2EL9A 4FHTA 1WU7A 5HLGA 4WK8F 4TQDA 1EIYA 4HV5A 4QWQA 4MHGA 1HKTA 1YS6A 2DO7A 1B9NA 4OIOF 2EA4A 2F5EA 1B6AA 1F9NA 4WX9A 2ZT8A 2IY5A 3PQKA 2KJCA 3IKMB 3LC0A 2GAUA 4TVWA 4M77C 3VEPA 1KQ0A 5K1PA 4YROA 2GQQA 2FXAA 2RD1A 4I98B 2XHKA 3PQJA 4CHUA 5ILVA 4E70A 4M75G 3ZMTA 2LKPA 5GMKm 1NYRA 3KP2A 4HF1A 2YX4A 5AONA 3U1DA 2CWEA 1S29A 1YW7A 1CF7B 3UFGA 1BC8C 4KT5C 4C92G 1YFTA 5E1WA 4NHJA 3RACA 1ODDA 1C0WA 4J15A 3G1ZA 3HRSA 3HXUA 3VBBA 3P9KA 5LJ3f 1ZRFA 1J0RA 3SB2A 5IT9K 3HSBA 4M78A 5E8GA 4UNOA 2JRTA 4XEOA 4G6DA 5F64A 3QP6A 2ISZA 4PJOC 3RKYA 4BQAA 3BY7A 1E17A 5GAMh 4Y15A 4ZZLA 1GXPA 4C92E 5E20A 3B02A 1SETA 3BOQA 1EH8A 2V9VA 3RERA 1FBUA 2DZ9A 4PG3A 3K1MA 5DCFA 2DXTA 4I2OA 2HEOA 1L0WA 3JB9D 2B0LA 2FQ3A 3GXOA 5L3FA 3VODA 4C92C 4X9CA 3CUQC 5GAN6 4P72A 3LA7A 3KEQA 2ACJA 2V1UA 4A0XA 2GZWA 3HY1A 3K1PA 2NYXA 3FXUA 2P6SA 2Y75A 1IRFA 5CVIA 3RF1A 4UPAA 3IC7A 2O0YA 4YG2F 1U5TA 3DSQA 4QLCU 4YRTA 3CDHA 3VU3C 2FMLA 2ZCWA 1DDNA 2J5OA 2K86A 4XU1A 4P3OA 2V6CA 4PJOB 5CVUA 5E8IA 4PCQA 3COAC 1IW7F 3KLOA 4F7UE 3KCCA 2ZTGA 4GO1A 3KP4A 4U0VA 4Q4ZF 3M1EA 1E1OA 4P3NA 3EYYA 2J5PA 4O5VA 4EGZA 3F22A 3E5QA 4MTDA 2HDCA 4TVYA 4U0WA 4RMFA 1FYKA 1LVAA 3LAJA 5DD4A 5ICGA 4AWXB 1GXQA 3JCMg 1TW3A 4EQQA 3F23A 4I0BA 1FPQA 2DPDA 3RDIA 1BI3A 2EJ9A 5D8LB 5LJ5d 2Q7HA 2WTEA 1ZYRF 5LEJA 4EO4A 5GAOr 3LA2A 1LEBA 4P75A 3O6BB 2COMA 2BBYA 2XROA 3QHSA 3FM3A 3WGHA 3HXXA 4Z2YA 1TQPA 3L9FA 5LEKA 2P7CB 1H4QA 1XSXA 3E97A 4C8QC 2A5YB 1P92A 1U1SA 3T8TA 1FP2A 4G7OF 1JJCA 2L01A 4TTVA 3A5ZA 1EFWA 4QVDA 3KZYA 3QNEA 4IVNA 1F5TA 2ZNZA 1R58A 2IVMA 1O7LA 2DTHA 4I01A 1W4MA 1HXDA 3EUHA 4YRLA 1V4RA 2G9WA 2XAQA 4AIJA 4RS8A 1KQ9A 2MD5A 4C8QE 4I09A 4HWRA 3M4QA 4I0AA 4YRKA 2FA5A 1PP7U 2D1VA 3I59B 4M75E 3Q9VA 1G3WA 3R0JA 4GCVA 2VOOA 1G3TA 1SD6A 3P9CA 3E9HA 4M9ZA 3GVAA 4HLXA 1U1TA 3E6BA 2Y90A 3RI4A 1HSJA 4XLPF 1U6GA 5F6FA 1D3BA 4K2EA 3BZ6A 2ETHA 2HQRA 3E9IA 5K5QA 4EM2A 4YREA 2QYOA 5HLHA 1MGTA 3IL2A 4M6XA 2CJBA 1ZGJA 2A6HF 2DZCA 2YHTA 2JSCA 3RGLA 3ZMVA 3M7GA 4XTZA 3SWNC 2DI3A 5GAOm 4C92B 2NNNA 1IL2A 4M7AG 4M7DC 2XVCA 3ZQ7A 3HFVA 5FFXA 2A6EF 2GA1A 2QQ9A 2ZIOA 4RB2C 2QENA 2CW0F 5JVTA 2AXLA 2DPUA 1HW1A 5LJ5e 4JLIA 1USSA 1S7AA 3R0AA 4K87A 1P2FA 2IA1A 4WXDA 3P7NA 3ROUA 3F72A 5GANj 2ZZGA 1FYLA 4F7UG 2HGCA 5BQTA 4HDVA 4XSXF 3R4KA 3HXWA 1RIQA 4OMZA 1WQ7A 4TVAB 3TEHA 4YDQA 1B34B 4M78E 5DY9A 5GAOl 1B4AA 2EJGA 1VTNC 3FIFA 2IRFG 1SD5A 1ZGAA 4RB3C 5LRSA 3L4GB 1B70B 2ZNIA 6PAXA 5K1XA 2Y48A 2ESNA 2FOKA 3HSFA 1R36A 2V1DA 1YGBA 4HV6A 4UXNA 2PFBA 1H641 3HIFA 4UV8A 5J6XA 3WTYC 1R5HA 5GAOp 2R3SA 4AIHA 4O2DA 1BJAA 2E65A 1IXRC 4OLFA 1EH7A 2Q5IA 2ARTA 3C3WA 4M78G 2QWWA 3MZHA 1U78A 4LB6B 3BWGA 2KRFA 1OYWA 2DXUA 3A5YA 5GAMg 3VQXA 3J81Z 5GAN2 4GYIA 4ZYEA 5C51B 5L3GA 1U5TC 4J6WA 3E6CC 4H2TA 3KFWX 1WQWA 1XMKA 3RESA 2I2LA 2CIMA 1KYWA 4U0YA 2MLGA 1I81A 3L7WA 4YRCA 1IAWA 2IA0A 1QF6A 3V7CA 3RKXA 1PP8F 3VQWA 3CUQA 4C92A 4XTXA 4Q6GA 1IN5A 1H9TA 2M5WA 5DDGA 5H6RA 1FBSA 3MAJA 1R00A 5CJ9A 3KP5A 3JAMK 2P0LA 4HLYA 2ODRC 1HKSA 4WJ3M 3VFZA 2XAHA 2A69F 3PFIA 1ZLKA 3I53A 1W66A 1R22A 5CAIA 2KIUA 3AHUA 3HRMA 3JCMf 2CQKA 4CS3A 5BPDA 1TNTA 2XGXA 3WTWC 3KFUA 4HWTA 2WV0A 1B7YA 1N9SA 3UGQA 3WODF 2VC0A 2MH2A 3JCMX 4PJOA 2R7DA 1WLEA 4LG0B 5D5XB 1UHWA 4RB0A 2AKWB 3P8VA 1KOGA 4C8QB 4CICA 2W84A 3P8YA 1IUYA 2ZBKA 5FD6A 1MJAA 1JE8A 1ZH5A 5DUKA 4A12A 1KU9A 1JBMA 4HX8A 5JI6A 1ZRDA 3GFMA 4HOBA 2XTIA 4KIFA 4LB5A 5GAN3 3IALA 2E41A 1SFXA 1EVKA 2EV5A 3HTSB 2YLBA 4K88A 4HBLA 3BDUA 4LGWA 5CLSA 4I7HA 2RC4A 1H0MA 3TOAA 3TOBA 2GIVA 5FO5A 4EVIA 1J5WA 4BAYA 4F7UB 2ZCEA 2HOEA 4M7DF 2VOPA 4M75A 1Z05A 1NJ8A 2GA2A 5JHUA 1SD4A 3GWZA 4WCGA 2A61A 4WF2A 3WTUC 4M77A 2VN2A 4ZH4F 4CO8A 1J2XA 1T6SA 4HQEA 3JB9G 3BJOA 1K78A 5GAOq 4L9NA 4L5IA 3I7FA 1RI7A 3D5LA 3REXA 1ADYA 3D0SA 4RCBA 3PGGA 1OMIA 1E22A 3I4PA 1TH7A 1X55A 1ULYA 3NEUA 4N9IA 1R7JA 5H6QA 2EV6A 4ZYHA 2H09A 4RB1A 1JRIA 1B9MA 3NQOA 4M75C 1GGMA 3LQQA 2AMCA 4G7HF 3SZTA 3TDZC 1I8FA 1N9WA 2ZNJA 3FXQA 3GZ6A 1LDDA 4J6YA 4PDKA 4N0AA 1UHMA 4UV9A 2LSOA 1LJOA 1P4WA 5CVVA 4KQEA 1R5GA 2FBKA 1XB4A 4P9FA 5BS6A 2WWYA 2ADUA 3HOSA 1R1UA 4OP0A 2BGCA 2DVEA 3A31A 4RGRA 3JSOA 1FZPB 2JPCA 4KN7X 5HVQC 4H2XA 2DK5A 4RQFA 4IHTA 4M9XA 1L3LA 4M7AD 1PUEE 3IG2A 4U88A 1YFRA 5L3CA 2HWVA 4HWOA 2W24A 1NYQA 3A7AA 1K79A 4CH5A 1DP7P 2TDXA 1T38A 4WXCA 2RN7A 1XDSA 4PJOE 4QVCA 3N97A 2NS0A 3BPXA 3TO9A 1YO5C 3KP6A 3MEYA 4YP0A 4Q48A 4F7UA 2OBPA 2Z33A 4M75B 4M7AC 4XU2A 3F8FA 2BV6A 4WWCA 1JXSA 4YRQA 3BY6A 5GMKe 4GGGA 3NEMA 2DU5A 2IPQX 3JB9J 2PG4A 1U3EM 1G6NA 3ERED 2Q7EA 1Z1DA 3IKLA 3JCMV 1KU2A 2OQRA 2DQRA 2RQPA 3WGIA 1W5SA 2V1XA 3I0TA 2W57A 3EDPA 3J80Z 3ELKA 1T0FA 4BHCA 1G4DA 2FBHA 3MCZA 1LEAA 1IN8A 2CG4A 4LFUA 3RJPA 3DKWA 4MGRA 4JUVA 2DQ3A 3M8EA 1USTA 4ZTUB 4PJOF 3TEGA 4Q47A 4CS2A 4YCWA 1FC3A 3A7RA 2IY5B 4BHBA 2FNPA 4CXFA 3NETA 2PJPA 4A6EA 2K4JA 4ASNA 4JRIA 2G7HA 3JTGA 5E3IA 3HYIA 4MEYF 1GVJA 1Y96A 1I1SA 2EFWA 4HT9A 4IF4A 1J9IA 2DTOA 1LB2A 1U8RA 3DP7A 5LJ3h 5D5UB 4O3MA 4KMFA 1FY7A 4EX5A 5C52B 1DPRA 3C18A 1FLIA 1NJ6A 4HWPA 5LJ3j 4UVCA 5E1XA 4C8QF 2EFOA 4JK1X 3LAPA 3IWZA 5AIQA 3M9AA 1ZG1A 1IN7A 2RDPA 3IWFA 3NELA 5IT9Z 3JCMQ 4B09A 1PYSB 3WQZA 4BH9A 3GLXA 1X54A 3QP5A 4HX4A 1WSUA 4YYEA 2RB6A 2G4CA 3F21A 4P74A 3QU3A 3KEOA 4ENJA 1IN4A 2HTJA 2VT3A 4A6DA 3WTSC 2V79A 1J75A 4M7AB 4XEMA 3FM5A 2EFPA 1B7YB 1STZA 3GO5A 1BI2A 2FMYA 4A53A 2IW5A 1XSVA 4BHPA 1B8AA 11ASA 1Z7MA 4M77F 5FLXK 5L3DA 1JJCB 3MF2A 3A74A 4LJZF 3K0LA 5A2QK 2L4MA 2IJLA 1W7PD 4M7DA 2QHUA 3QO7A 4KR3A 4H0EA 5HOOA 3WE2A 2DQLA 3SWNA 2EB7A 1BIBA 2J3MA 3PCOB 5LJ3g 2DKGA 4A2UA 5HS8A 2DFIA 2F5DA 2STTA 3VQVA 2I4NA 3MWMA 4LLNA 2EK5A 3JTHA 5HGQA 4N9HA 3L09A 2LF8A 4CGZA 1YIOA 4MMKA 2MLKA 2ZIMA 1XGSA 4G7ZF 2CGPA 2QHVA 5GMKl 4LMYA 3HHGA 4YRPA 1ZN2A 1REPC 1O57A 1W5TA 4EJTA 2DEQA 3NRVA 1S3JA 3QRFF 1TQIA 1FSHA 3IRRA 3OV8A 4KIBA 2F5FA 1K7AA 2E1HA 1ZLJA 2JN0A 1Y96B 4JRKA 5KK1A 3T8RA 3L00A 2VE9A 4M78B 3L2CA 2VC8A 1J7KA 1ZARA 4HT8A 1EIYB 4HZFA 2ZZEA 4OU0A 2VC1A 4ZTZB 2PQ8A 4PJOG 1HK9A 2UXXA 4FX4A 4A54A 4HVCA 4UVAA 4S05A 4H2WA 1XCVA 3JCMW 4A5NA 4ON0A 4NOYA 1YB3A 4YCUA 1IF1A 3A32A 3HFZA 1W7PA 3H3ZA 4M7DD 1Y0UA 4L5JA 2ZKZA 1TLHB 1OKRA 2H94A 5LBQA 2H27A 4IRHA 1O3RA 5L3EA 4C92F 5I21A 3HY0A 2P4WA 1X01A 2YLCA 1IXSB 5HDGA 2MA3A 3W3SA 3DPTA 3QPTA 3FF5A 1LDJA 1MJBA 5LJ5h 2DBBA 3NENA 2L54A 5K5RA 2NNYA 5GMKi 5ICEA 4XU3A 3FHZA 1JHHA 4H2UA 4RQEA 3F6VA 2E3CA 2EWNA 4XBFA 2YSRA 2FBIA 1KMMA 4M75F 1HKQA 3TO7A 2QBYA 4Y13A 2M87A 3SFZA 1B70A 4TWAA 4RGXA 3AAFA 3JCMb 5D6FA 1LQ1A 3ZMSA 4RAYA 1X2HA 3KE2A 4KNYA 5IT3A 2P5KA 1L0OC 2FE3A 2EAYA 1S8NA 1WWXA 1NHAA 5D6EA 1Z6TA 4G8XA 1FYMA 2CGHA 2G7UA 3QU6A 1HSTA 1S6LA 3HXZA 1P4XA 5FFZA 4TVAA 1QQIA 1CGPA 4EM0B 4L0YB 2MC3A 2P5LC 2E5AA 5HDKA 1E2XA 1KMNA 4XQ3A 2Y0MA 1FYFA 3ICAA 3JCMP 3L2ZA 4TQFA 4K86A 3LSTA 2QHTA 2O6GE 3J7AO 4M7DG 4WXHA 3QAHA 2OU2A 3LFKA 4EM1A 4M7AE 4Q5SF 1X2GA 1SMYF 2DTRA 4P72C 4HQMA 2Q5HA 1ZAOA 5BMZA 1USYC 1ON1A 5LJ5f 2ZGWA 3LSSA 4C8QD 3SQNA 4KFCA 5ICFA 2DTIA 3QPHA 2ZMEA 5EEHA 5DCMB 1Z91A 4HF2A 1I5LA 3U2RA 3WE3A 2VBYA 1QNTA 2R7FA 3HHHA 4V2SA 1YFHA 1U5TB 4M73A 4KA4A 3DPLC 4IHSA 3GFJA 3T1BA 2D45A 4IRGA 3ML6A 4EMHA 1LJ9A 1SMTA 5F5WA 12ASA 4CYDA 4NL3A 2I4OA 5ELNA 5J8FA 5GMKh 1YYVA 1YLFA 3IKVA 4HWSA 4M78C 1NJ1A 1FT9A 3DFGA 4BNCA 5LJ3d 1ZREA 4G84A 3R61A 3HXYA 3G3ZA 1B1BA 4P3PA 5D5VB 2O3FA 4D0PA 4XTUA 1FSEA 1ZG5A 1QZYA 2XRNA 1YQAA 3JW4A 3RYRA 2O61A 1YFSA 2QM3A 5ED4A 4OIRF 1XGNA 4RDXA 2XAGA 5E1ZB 4YRRA 1MZBA 2RHSB 1BC7C 3KLNA 4UUVA 5A2QZ 1J5YA 3ULQB 2HFHA 5F1RA 2RVCA 4IJAA 2EJFA 2VT2A 2MBFA 3BJAA 3WTTC 4DPGA 2P6TA 4TV7A 2QQAA 1O3SA 1HTTA 3WGGA 4LK0F 4IXAA 2GXGA 4YRSA 2LF7A 3CJNA 2QTXA 5LGNA 4YRGA 4EMKA 1SRYA 4M9SA 4P96A 1RNLA 3R07A 3EETA 5HLIA 1WPYA 3W6KB 2JZYA 3QUIA 3HFOA 4H2VA 4UP8A 1RIOH 4UHTA 5LGTA 3DF8A 2ALYB 4WJ4A 3GIBA 4ENMA 5LJ5g 2JPBA 2XKOA 1D3YA 3JB9I 2HTSA 1X56A 4P73C 1FWZA 3EYIA 2DU7A 4YFXF 4XRFA 1K78B 2ESHA 4XTYA 2FF4A 2W25A 4HX7A 4EV0A 4S04A 1KU3A 3JCMc 4M77D 3LQRA 3HRUA 2ELHA 3FMSA 2I4MA 2K4BA 2C6YA 1LNXA 4NCXA 1EV7A 1NJ5A 3IHUA 2OAZA 3OOPA 3K69A 3B73A 2KKOA 4KUMA 3GFLA 1FBQA 4O6JA 4BXUA 1RUNA 3O3KA 3ECOA 2P5VA 1BBWA 5LHIA 1ASYA 1XDUA 1OPCA 1KGSA 1OR7A 5FGMA 3F8BA 2XAFA 4P71C 3RYPA 4OINF 5GANg 4L0ZB 3ZN0A 3WTXC 4CH6A 3I54A 5BPIA 2Z99A 4OIPF 1P4AA 1R1VA 2EJRA 3E5UA 4EMSA 2FB7A 1G5IA 2LNBA 5EEGA 2FRHA 2VXFA 4RGSA 5ICCA 1SFEA 1WI9A 4KR2A 2E1NA 5E18F 3QO5A 2M8EA 2PMUA 4LNSA 3TGNA 1OYIA 4CS4A 2JT1A 2D1HA 2VXZA 1XCBA 3Q9SA 4LLLA 2EA2A 3M4GA 4DQ2A 3HFNA 1WRJA 4MEXF 1F1ZA 4BYYA 1KQ2A 4GYGA 1IZ1A 1ZG3A 1Z9CA 3RL6A 4M77G 2ODRD 5GAMf 3GYHX 2O8XA 2P7VB 4M78D 4CDGA 1HC7A 4HF0A 1EOVA 2CFXA 2XKPA 3FMRA 4YCVA 2AKWA 2XV4S 3JCMe 4RCCA 3KETA 1MKMA 2P8TA 3TO6A 4UP7A 2DT5A 1MDMB 3ISPA 2EV0A 3P9IA 4YFKF 4L87A 3UGTA 4X5OA 4HDUA 1TQMA 3RPUA 3VQYA 3N4MA 1HW5A 2XAJA 5DV5A 3WG9A 1BOAA 2ZR2A 1D8JA 3JSPA 2PN6A 1KA8A 3HRTA 1H4TA 3VOEA 2ZJ2A 1BN5A 3C7JA 2HR3A 4M71A 2ZO4A 3QTCA 3CO6C 4EMGA 3I5UA 4PGHA 1EVLA 1IXCA 3K2ZA 4HAMA 3RPQA 1Z7UA 2VONA 5KNNA 3CMQA 4M7AF 2VBXA 1I6XA 3F6OA 1RZ4A 3EFRA 3ZMUA 2C8MA 1WKMA 2CSOA 1QZZA 1WNLA 2BE5F 4J6XA 4M72A 4ESFA 4L18B 2L4AA 4H2YA 1QO0D 1SERA 2ZT5A 3HTZA 3WU1B 2E10A 3V7SA 4WI1A 5JFRA 4J5YA 1WYDA 3C1DA 1ATIA 3GX4X 1TBXA 1I4K1 4R79A 4M75D 4F7UF 5HS9A 2Q8KA 3W6JB 5LGUA 5D5WB 4EJVA 5LHGA 4MNUA 3KZZA 5GANf 3INZA 3WU0A 2PBIA 2E1CA 1LDKB 4XSZF 1PDNC 5DD8A 4EJUA 4YRJA 1PYSA 3M8FA 1B59A 1FX7A 2X0LA 2RHQB 3LA3A 2L3DA 2BYVE 5GAN8 5ELOA 2CYYA 2KIFA 3V8LA 1MGQA 2ISYA 3H3UA 3ZMZA 4ESJA 3DXJF 5GAN7 4AVPA 1FOKA 3REOA 4YRIA 1KYZA 2RM4A 1BBUA 1XGOA 3I71A 3F8CA 1T39A 3ABUA 4Q15A 2DJZA 4LK1F 2NRAC 1FNNA 1XMAA 1TW2A 1S7OA 2FEZA 3I64A 1BI0A 5K5OA 5GAMe 2OA4A 5JR3A 3V7RA 4ZIBA 2QVOA 3BDDA 2PEXA 5AIPA 1C0AA 3HRKA 1BI1A 2FSWA 1YW9A 5K1YA 5D8KB 4OMYA 4KMUX 2JTVA 2L02A 5FB2A 2STWA 4R8HA 2Z5UA 3ZMDA 1EH6A 1I5ZA 5GAOn 1ONVA 3ECHA 2DU9A 3V4GA 1MJ9A 3ABTA 3MEXA 5CVRA 3M4PA 2P5IA 1G3SA 1V3FA 2E7XA 1YG2A 5CVJA 2ARSA 4IRIA 4PHCA 1TTYA 4YIFA 5CYVA 3TDUC 2UZKA 2J3LA 2YU3A 1H4VB 3DQVC 4HA8A 2K02A 2ZT7A 3JAMZ 5LRRA 1USYA 2Q2EA 1B76A 1LYLA 1I27A 3R6SA 4IPAA 2H6CA 5DUIA 2HS5A 3ZPLA 3TQNA 4UP9A 4XU0A 3BJ6A 3BP8A 3BROA 2ZFWA 2ZR3A 3P8TA 5L3BA 1FP1D 1HBXG 5J8CA 3E6DA 4CZZA 4U7BA 3QO8A 3R60A 2RHQA 5TJJA 3SHFA 2O03A
chains in the Genus database with same CATH superfamily
1X69A 1QVUA 5TRDA 5GANh 2M34A 1YCYA 3A2KA 4P9UA 4PLLA 1NK2P 2DOFA 4YFNF 3QDRB 1O3TA 2DIGA 2IS6A 3AL0B 3IQLA 4JLGA 2YPRA 2LVSA 2FX0A 3OSFA 4LVKA 3OBWA 1F43A 4ELYC 2VQHA 2DAOA 3MP6A 4AFSC 2DERA 2DIQA 2E4HA 3BE3A 3AG1H 3O2PE 2LNHB 3BDLA 4C8QA 1VQKT 4DYQA 3EAEA 2HNHA 4M3BA 1K83J 3OS1A 4IHXA 2BEOA 1VQOQ 1D0XA 1JKQC 2HOSA 2R5ZB 4PGGA 1RETA 3SHWA 4Y91A 3FXRA 1WJSA 4NL2A 1YW8A 2DJIA 2L2OA 1VQ5Q 3PVLA 2XDVA 1X58A 2O9SA 3HOTA 1S72Q 1T8IA 4A3DJ 1ZQ3P 2VLAA 4BEHA 3OIQA 1H8AC 1FXXA 3MN2A 4C3JJ 1YTYA 1K6OA 2CT3A 2QG9B 2QGGA 4P75C 4PFZA 2C7IA 2B7EA 4KIGA 1QWEA 4KJZA 3KP7A 1W70A 3B6AA 1E1TA 4A3IJ 2K9QA 1N8RU 3ERRA 3G1MA 2CJAA 4OAZA 2OD5A 3L1PA 1E24A 4J9FA 1Z6RA 3H9QA 4Y7NJ 4C5EA 3CMEI 1ZRCA 5DLOA 2M30A 3FBNB 3RUXA 5KYWB 4PJOD 2HKOA 3VRYA 3A5YA 1EZZB 5KYUA 3B6CA 2L3RA 1KC8C 2IPOB 5DYMA 2YRDA 1M30A 3BW1A 4QKUA 2PMHA 3GW2A 1MNDA 3DTIA 4CCMA 3LWIA 2CFOA 2HYGD 4I02A 1A04A 2LDUA 1NZ9A 2KSSA 2ELKA 2I4LA 2MH9A 2H8RA 2ARUA 2A68F 3QSUA 1SRLA 3JCMJ 2VQGA 4PZJA 2QHSA 2COZA 3KFVA 1M90C 4G9YA 3J80K 1W0TA 2AZVA 2R5YB 3FISA 1NNHA 1B34A 2J6FA 2ZMEB 3EG9A 3K4BA 4FX0A 2QASA 3E5XA 5FU7B 1XSDA 3WHBA 1TNSA 2NUTA 1XOVA 2OTLQ 1SESA 1Z3XA 2OC6A 3H5AA 1W2BA 4NB5A 3JSCA 2JMCA 3JAME 4L9JA 5KCHA 1G2HA 4B3AA 1IO2A 4UVBA 5J39A 1KU7A 2F2EA 4E7LA 3RZDJ 1T98A 1HW2A 2DK8A 3A1YA 5F04A 1BA5A 1GCQA 3BCAA 2DXCA 3JB9F 1MMDA 5KVRA 1KJWA 2QQSA 3RMQA 4HYEA 1Q82C 1VQZA 1RAEB 2PMZN 1UCRA 2OZUA 4MQ9F 4IIMA 3MCAB 1MMAA 4A0ZA 2ZNYA 4Y17A 4D7NA 4F91B 2MAMA 4FYWB 3PO2J 2VBWA 3RIRA 1TTHB 3OD1A 1S9HA 1MDMA 3CC4I 3QZ9B 3IRQA 1K4US 2E64A 3HPWA 1YRNB 4M7DB 2F5TX 1FTTA 1UJ0A 4DBFA 1QPMA 1RUOA 1HOMA 3F70A 4LVMA 4IHVA 1IN6A 1MMNA 1O7FA 1QGPA 3U9GA 1QVPA 3FDRA 4P55A 3M55A 3SWNB 4XTWA 4AG1C 3PCOA 2XUBA 4LVJA 1VIEA 2YUOA 5A0LA 4AFUC 3CCLQ 3QO3A 4YTLA 4D8DA 2OQGA 3FJPA 1PKSA 1MW7A 1XD7A 1X1PA 2BW3B 5LJ5j 1Z7NA 5BOXA 2BE7D 2ZINA 1M8VA 2QKMB 3ZN1A 1JHFA 1SFUA 2JZ2A 2QQBA 4L9VA 4M77E 4JJNK 4A3BJ 2WC2A 1M5Q1 2VODA 1NJ2A 1TWHJ 2QZ8A 3OYJA 4KN4X 3CCVQ 1D3BB 1SD7A 1TG0A 3ZCOA 4F7ZA 2XK0A 2XC7A 2DRMA 3M54A 3VB2A 4PNOA 4HNUA 4KYWA 3G1JA 3S32A 3M8JA 4DNCA 5J47A 2LT1A 3PIOA 4UUTA 4KT6A 5CPRB 2QYZA 4NS5A 1ADJA 3KP3A 2YWWA 3FWEA 4ETSA 2J7IA 4E51A 1G59A 4A3JJ 1DU6A 1KQ1A 3GZ5A 3I55Q 1WX6A 1BJZA 1X1DA 5HS7A 2VXEA 3PSFA 2KJBA 2M9HA 3HHTB 4LITA 2E2JJ 3DEWA 3FXOA 3Q5FA 2W85A 1CF7A 2FYKA 2O9VA 4LG0A 2JWTA 3T0YA 3L1AA 4C92D 4Y4RA 3CCMA 2NAZA 3DBRB 5J1YA 3ZL7C 1N25A 5GMKj 4F17A 3TEHB 2I10A 4M7AA 3K6GA 4BWAA 2UWMA 2PMEA 1J59A 3C2BA 1UFMA 2VQLA 3CD6Q 2LY1A 3WVDB 4A0YA 2LD5A 1W4SA 5LL6S 4PFOA 4OIQF 3F3XA 5FWCA 1D8KA 1PM3A 3TKYA 3LH5A 3WTVC 1JGSA 4ZYDA 2Y9ZA 1UB9A 1UHCA 1KD1U 1VQ5A 3BQYA 3LWFA 1Z7LA 2FOWA 1WHJA 1K0SA 2EILH 4XN0A 3FZVA 1W6XA 4KGZB 3QWLA 2L5QA 1V5GA 2DJNA 2CO5A 1D5VA 1MD0A 1OCPA 3JCUC 2M1BA 4KICA 5LHHA 3QJYA 1ETWA 3CCET 3WTZA 3G73A 1DGRM 1WQ2A 4XLHA 3E7LA 3HM5A 3HUGA 1A5JA 1M1KR 2FU4A 5GAN4 2QLZA 3CCJQ 1YS7A 2BXZA 1E3HA 4DGWB 2DQ0A 2XG8D 2R7SA 1IB8A 3A01A 3S6WA 3CLOA 9ANTA 3M0TA 3BJUA 2EFNA 3CUOA 3K7AJ 4MO7A 2LK2A 4CH3A 5M5WJ 2HNIA 1LNWA 1Z3YA 3F8MA 4NC6A 1WI7A 3H6ZA 3G71I 4ESBA 3K70C 1NLPC 1TXQA 3BZKA 3IV5A 2E7WA 4PJ0C 2PMFA 2Z9OA 2JS0A 1PUFB 2IA2A 2O7OA 4XTVA 1O3QA 1I07A 5DCMA 2RNJA 5FD5A 5ERIA 2M3AA 1PWTA 4XONA 1BIAA 1V1CA 3RNJA 1F1BB 3K9TA 4G94A 3J7ZI 4X9DA 4P74C 2A3SA 2YR2A 1IRGA 1QP3A 2Y4XA 1SAXA 3VPRA 4M78F 3CO7C 2CW7A 2H3EB 2LX7A 1ETKA 4IO9F 1M1FA 2NUZA 2V8JA 4N0AC 1UELB 2C06A 1RL2A 4ZN1A 1EQRA 2IT0A 3PMTA 1XN7A 1O4XA 3L4GA 2XF6A 4D9JA 3BTCA 2ZPIB 2A07F 1FIPA 2Y4YA 3REUA 3VRZA 4DA4A 1M1KU 1DP3A 4ORZA 2DW4A 2RGVA 3AT1B 3FC3A 1IJWC 2W4SA 2HKXA 2WV1A 2X9HA 4FU6A 5IHIA 1UMQA 4EATA 5FLXZ 2AQEA 2EIFA 2WADA 5ILUA 3CXCS 1YIJT 1V54H 2HSPA 4Z88A 3S2WA 3HXLA 5HDNA 3DEEA 4JBAA 5IP9J 1ZTRA 2ID6A 4RTTA 3FMQA 1HLVA 4GXOA 4D5CA 4EJWA 3EQLF 1IC8A 3HRIA 1AOYA 4IKFA 3MQ0A 2EFQA 3W2AA 1XC5A 4Y52J 1FTZA 3S1MJ 1GHCA 5CR2A 2JVHA 4B8XA 5DEQA 4EMKB 4HXJA 2YX7A 5GANe 1R5ID 4PSXA 1UB4A 3OS5A 4BI3A 4H2XB 3NWTA 1BM9A 3GUDA 2XHCA 3X24B 2HDWA 3ASNH 4DJAA 3QDFA 4QT7A 1LFBA 1G3YA 2ENMA 1NBEB 4G85A 1AWWA 2L7KA 3FB9A 4AFZC 1ZHFA 4RAGA 2JSPA 1B72A 4XL9A 2BW3A 1I1GA 3HSRA 1M9SA 2EYZA 3HTRA 4LLGF 1QBJA 4YPFA 2JTMA 3EG3A 4U7DA 1DPUA 2QKLB 4CYCB 4QQ6A 3CC7T 4LD9K 3PZCA 1LOJA 5CCAA 3OMYA 3RKWA 2RJCA 1T2KA 1W7PB 2HQHA 5D4RA 3A7UA 4M74A 2CV0A 3MFKA 4HNVA 2HYFA 3CTAA 1Q86U 3OQ5A 3CCEA 3V8JA 2ZJPF 4LD5A 2D0NA 3HEFA 1KC8R 2M45A 3T5XA 4ZC3A 3DLLF 4H2SA 1VQPI 3OYIA 3HPGA 1XGMA 3JB9H 2RHSA 3S15J 4ENNA 3TREA 3OYAA 7AT1B 1X3UA 4R1HA 5EJCA 4GBQA 1VQ6A 1XTAA 4IHWA 4N0AA 4ZTZB 2XIGA 2DMTA 2HQNA 3HTUA 3RTRA 1K4TA 3CUQB 4PJNA 4V19K 1IRZA 4BACA 1G51A 3OWTA 3MEVA 3QG1A 1QVGA 2QUFA 1H9GA 4HW0A 1ACIA 5H20A 2D2WA 3DEUA 4YEJA 2VBZA 3A0HC 4ZZDA 2AS5F 3BFMA 3IH3A 3BPVA 3LH0A 5FKKA 2JA2A 2ZXJA 1HA8A 1G5HA 2H6BA 1R1TA 5EF6A 4XKCA 2RK1A 1Q1HA 2C0OA 4AG2C 2CJ9A 4G6QA 2FNAA 2JUGA 3EFSA 3NTHA 1AWCA 4C2TA 4P5OA 5J1UA 2GXBA 3FJ5A 5KAFC 4EGYA 2QBYB 1WJDA 3FBIB 2ROTA 4XTUA 2NYSA 4YRNA 2NXNB 1YJNQ 4N4NB 3MF1A 4PKCC 2K27A 4AIKA 4MQVA 2VKDA 2WSEE 2ZCFB 2RV8A 3H92A 3WXMB 2K7LA 5J4YA 2YXYA 4JZ3A 2NVQJ 2HZDA 2M2EA 2KL4A 4FT8A 1R71A 4J9EA 3NWSA 3V8KA 1AVZC 3I9QA 2EGEA 3SXYA 2OCEA 3PFYA 4YRFA 1MHNA 2X4HA 2DDBA 2CMPA 2DNUA 2AMCB 1NPPA 4P71A 2W48A 2EBIA 3E3VA 1UGSB 3ONQA 1YI2A 3H35A 2L89A 3HY0A 5HLTA 4KDPA 2DPPB 2Q7GA 1U2WA 3JRIA 5KE2A 2EIJH 2ALYA 2ZZFA 2MYSA 2CW8A 2F5VA 3I58A 1X75C 2VGMA 1K9MU 2Q0OA 2CV2A 2ESWA 3QIIA 5JLXA 2DLLA 2DE0X 2KIMA 4KITB 4A5MA 4PJMA 1SKUB 2LTOA 3H3VK 3UH0A 1OU9A 4XK8E 2QA4Q 3DU5A 2VWFA 5B3SH 5D4SA 2HKQB 4N4IA 4XLAA 2D6FA 1R23A 2PLYA 3L2RA 3CP8A 4XLNF 2R7XA 2C0TA 2XMFA 2B8AA 3QBYA 3HFZB 2CP5A 2XGTA 3CPWP 4AYBA 2OZ6A 1K9AA 3OSSC 4YELA 3SZPA 1JKRC 1BBYA 1B3QA 2OCCH 4AD9A 5EG2A 3ZP5A 2R5ZA 5IYDJ 4ZYGA 2KQWA 3LSQA 5BNGA 1NLOC 3JRBA 1DGWY 3GFIA 1P6RA 2F5KA 1Q81R 5GANd 1ASZA 1ORKA 2HPMA 3A8HB 2VE8A 1TU0B 4L9TA 1PG5B 3G71A 3CCLA 4M6YA 4RAZA 2IP2A 1KQ8A 5GAMd 3J81K 3PTAA 3GBGA 2XICA 1XG1A 1VQ6I 4RTYA 1HQCA 3TUPA 4YRMA 2JJ9A 1YFNA 3JCMh 4J9HA 2MOXA 1SEUA 3G4ST 4AH6A 3I59A 1ZGWA 3TU4K 1VQPA 2R93J 1OYYA 4J01A 2A37A 3FX3A 1K9MR 4XRSA 2OPTA 3MO8A 2BOLA 2YRVA 4MTEA 1DUXC 4P73A 4ATOA 3MKWB 3HSEA 2UXNA 2EKOA 3LSGA 2HQ5A 3QOPA 2XKOC 2EW3A 2F48A 2RQRA 2ZPHB 3F8NA 2K85A 4M77B 5FU6B 5GAMj 2HZTA 1QE0A 1K1ZA 5KH6A 3GEZA 2RKHA 5FKLA 4D1QA 4I99C 1IDZA 3JCMd 1U06A 4EJOA 4LVIA 5LLQA 5C53B 4HRIA 2GM4A 1IUFA 4YIIA 1UECA 3EG9B 2E6ZA 2Z16A 3ZFJA 2QGUA 4LVLA 2JVGA 3IKTA 2OTLT 1VQPT 1JB0E 1TZLA 3TP0A 2JM8A 2O88A 1H4SA 1ON2A 1RADB 2K57A 1N9RA 2KE9A 1PYVA 3QOEA 3JRDA 2F5CA 4ENKA 2XASA 2WB1A 2XU8A 3OYDA 4M7DE 2ZT6A 4A93J 4H02A 5IH2A 1VI0A 4P1WA 1X6BA 1F4KA 3GF2A 4RGUA 2XDPA 4C8QG 2VV5A 1S72T 4OOIA 4QW2A 3D5RC 1A31A 4N0BA 3E6MA 5ILSA 4MMLA 3OIOA 2OAUA 3MZYA 4EMKC 4J9GA 3ZGKA 2DA5A 5F08A 5M5YJ 3CCQI 3BR0A 5E17F 4JQFA 2L3SA 1T95A 5LJ3e 4N4GA 2GWRA 2JXBA 1VQKA 4NQWA 1X43A 3DV8A 1RAHB 3EG2A 4JS4A 4J7FA 2WAFA 3K1NA 5GPAA 2Z3YA 1IREB 2RA2A 1YRNA 1RUWA 2OX7A 1MMGA 2PI0A 1JJ2A 2DDZA 2EL9A 4FHTA 1MNMC 4OMMA 3VSLA 5C4JJ 3OYHA 1WU7A 5HLGA 4WK8F 3RCOA 2CSQA 1KQSS 4TQDA 1EIYA 4HV5A 1KG1A 2J06A 5EC7A 3UT1A 3ZQCA 1WJBA 2BZXA 4QWQA 2JMWA 4MHGA 1OCOH 1MH4A 1YS6A 1HKTA 2D8JA 2JTFA 2JN6A 2RQVA 3M4YA 5IP7J 2DO7A 1B9NA 4OIOF 3LWHA 2LC2A 2EA4A 2F5EA 3K4LA 1ZUKA 1B6AA 4IUTA 3CC2T 2KNBB 2XF7A 2Z2SB 5IXBA 2M4KA 2AHQA 1F9NA 4WX9A 2ZT8A 1MBHA 2IY5A 3PQKA 3HKZN 2KJCA 5HNFA 1WJQA 4OMNA 2LT4A 3IKMB 3LC0A 1YJWA 2GAUA 1VFCA 4TVWA 2LMJA 4HVUA 3FDYA 1KQ0A 3VEPA 4M77C 2RAEA 2XDDA 2GQQA 2FXAA 2RD1A 1Q7YU 4I98B 4YROA 2XHKA 3PQJA 1YITI 4CHUA 2H1KA 1X2MA 2LRQA 5ILVA 2K40A 3MEUA 4E70A 1U0JA 2G0EA 4NBQA 3ZMTA 5JVGF 1PC0A 2GF7A 4M75G 2LKPA 3H5NA 4II3A 5GMKm 1NYRA 3KP2A 2M8GX 4M3DA 4XKVA 5TGTA 4HF1A 1B7TA 2YX4A 1VQLI 5AONA 1A36A 4LDUA 2DXBA 2DETA 3U1DA 3J7AY 2CWEA 1S29A 1YW7A 1CF7B 3DU6A 1BOBA 2GIZA 2H1LA 2Y31A 3CDIA 1UJYA 2RQUA 3THKA 1GV2A 2KDSA 3DLMA 2OTJI 3EHQA 3UFGA 4C2MJ 3DBHB 1BC8C 4KT5C 3A98A 2EQIA 4C92G 1YFTA 2VB6A 5E1WA 1Z77A 4NHJA 3RACA 1ODDA 4LDWA 1C0WA 4J15A 1ZQ1A 1SHFA 4NUBA 3DKMA 3G1ZA 1AEYA 2D8HA 2GQVA 4LIUA 3HRSA 4ZDLA 1RI0A 1NK3P 2CYZB 3HXUA 3OS0A 3VBBA 2E1MB 3P9KA 3ZQFA 5CQGA 5LJ3f 2CP2A 3QJ6A 1ZRFA 1MV3A 3BG7A 1J0RA 3RPUD 2OJ2A 3DKXA 5HNHA 3E19A 5IT9K 3SB2A 4JX6A 3OB9A 3HSBA 4M78A 2F1LA 5E8GA 5IT9E 3G2BA 4UNOA 1M4ZA 2PZ1A 2JRTA 2CH4W 4XEOA 1NYGA 3OIPA 1HYOA 1E0EA 2XPWA 4ITVA 1C0MA 4G6DA 1W36C 5F64A 3QP6A 2ISZA 1PJRA 2DBMA 1SANA 4PJOC 3ZQGA 4GLKA 1VOMA 1UG0A 3RKYA 4BQAA 4CCJA 2OI3A 3I55T 5A0GA 3S8PA 2LFBA 1W36D 4BW9A 4IQJA 2EQRA 3GLLA 2PUKB 1D1AA 2G6FX 3BY7A 3E9GA 1E17A 3QODA 2PVOB 4CCLA 2LMDA 1I0CA 4XAXB 5GAMh 1OCRH 4Y15A 4ZZLA 1GXPA 4J83A 4C92E 1Q86R 5E20A 2BVLA 3B02A 3RQ4A 1SETA 3BOQA 1EH8A 1QZEA 1ZELA 2E35A 2V9VA 5EDNA 3KZIC 4LUEA 3CCUT 3RERA 1FBUA 2LNVA 2K9NA 2ZMEC 3OA6A 2E2IJ 2DZ9A 2HDAA 2MIOA 4PG3A 3K1MA 2HYJA 1V76A 4IUPA 4FISA 5DCFA 2A6TA 2M0OA 2DXTA 1QCNA 4I2OA 1Y7XA 2VVKA 3H0HA 3X2QH 3CCVI 2HEOA 4ESRA 1L0WA 4A3EJ 4IX7A 2E70A 3M53A 3VS5A 4RTZA 2QK0A 4FSXA 3CC4A 1Q82U 3OBYA 3JB9D 2B0LA 2VJ5A 1X1AA 2LTPA 2FQ3A 3GXOA 2FRYA 2ELJA 5L3FA 3VODA 4GDFA 2ZPEB 2CQ7A 4X9CA 4C92C 3CUQC 5GAN6 4P72A 3LA7A 1XQHA 1AZEA 3KIOA 1WZOA 3KEQA 2ACJA 2DL4A 2V1UA 1X4OA 4A0XA 2CREA 3S3OA 5GJWB 2GZWA 3HY1A 2MK5A 4PJLA 3OYNA 2IIMA 3K1PA 2NYXA 4C5IA 3IUOA 2Q2EB 3FXUA 2P6SA 2Y75A 1IRFA 3LSJA 5CVIA 3PIOF 2HKNA 1Y07A 3GF5A 4F52A 3RF1A 4UPAA 3IC7A 2O0YA 1Y6IA 1QPIA 5F0FA 4YG2F 2X4YA 2HVSA 3TBIA 3CC2I 1U5TA 1T56A 2GTJA 3MJXA 2KZVA 4QLCU 1GRIA 1I5OB 3DSQA 3AG2H 4YRTA 3CDHA 1NM7A 1UHFA 3VU3C 3H9GA 3SJMA 2D5VA 3V42A 2FMLA 2ZCWA 1DDNA 2J5OA 2K86A 1ZBXA 2W10A 3CPFA 3LGLA 2V6CA 3GTMJ 4XU1A 4P3OA 3PVQA 1YWOA 4PJOB 4ZJZA 2K9SA 3EPZA 5CVUA 5E8IA 3ABLH 4PCQA 1VQ7A 1DQUA 3COAC 1IW7F 1WHGA 2FL7A 2CS3A 2O01E 1PVEA 1YOVB 2ZXHA 3KLOA 4YRVA 3KCCA 2K3YA 4F7UE 2ZTGA 3RKQA 4GO1A 2JT4A 3KP4A 4U0VA 4Q4ZF 4UC4A 1PRLC 5D7UA 1X2NA 3C2GA 3CMAA 1XJWB 2EINH 1ZUUA 2RHUA 4J19A 1VQNQ 2R0QC 1JEGA 3SFMA 2K5IA 4B3XA 1JKOC 3M1EA 1KQSP 3HP9A 4UUSB 1E1OA 4P3NA 3EYYA 2J5PA 4O5VA 4EGZA 5FLXE 4C0FA 3F22A 3E5QA 1UTIA 3OYFA 1VQOA 3T9NA 4F55A 1KC8U 4MTDA 2HDCA 1HCRA 4TVYA 3VYGA 3LMMA 4U0WA 4RMFA 4D8KA 4NC8A 1FYKA 1LVAA 3LAJA 5DD4A 5ICGA 4AWXB 1KHIA 3ZR8X 1MUZA 4L5EA 1GXQA 1RC9A 3JCMg 3TSWA 1TW3A 2ZC2A 3FXKA 1JJ8C 3CC7A 2BY3A 1Y1WJ 4BGDA 4EQQA 3W6VA 1OPKA 2Z1DA 3F23A 2CUFA 4I0BA 1FPQA 4RM2A 2DPDA 1PNJA 3RDIA 1BI3A 2CH0A 5IOZA 3L2QA 2DA9A 4BB7A 2EJ9A 1AA7A 1E3PA 5D8LB 2K79A 2LVMA 2WTEA 1ZYRF 3OL4A 3QYBA 5LJ5d 5LEJA 3FEOA 2Q7HA 1TL8A 3A02A 2A0FB 4EO4A 2EIMH 1VQOT 5GAOr 1RKTA 3LA2A 1LEBA 2CRGA 5KYUB 4P75A 3K10A 4IZZA 2RHQB 2A28A 3O6BB 2COMA 2BBYA 3U1KA 2XROA 3QHSA 3TSZA 3FM3A 3UA6A 3WGHA 1RPWA 3KEYA 2AHJB 3OW2S 4Z2YA 3HXXA 1TQPA 3L9FA 5LEKA 4OMFB 2P7CB 1CQTA 2WSFE 3MQZA 2ZT7A 4CCKA 1XSXA 1GLNA 2DYIA 3SD4A 3M0RA 1K8AU 3E97A 1KZHA 4C8QC 2A5YB 4FE4A 4AM3A 2X6YA 1P92A 1RAFB 2M9UA 3NMZC 2ZJRF 2BHYA 1ABOA 2PJRA 2WAQA 1U1SA 3T8TA 2QGFB 3OYYA 2OUMA 4A4EA 1FP2A 3MZ8A 4G7OF 2L01A 2PVGB 3MPUB 4MZMA 1JJCA 3JRAA 4QVDA 3KZYA 3A5ZA 4IVNA 3QNEA 1EFWA 4C0ZA 2OJED 1F5TA 2ZNZA 3K4CA 1R58A 2IVMA 3F9KA 2ZPBB 1D0YA 1O7LA 5DLQE 3VS2A 3A8OB 4PJJA 2DTHA 4I01A 1W4MA 2A5WA 2RI5A 1HXDA 2LYCA 3EUHA 4V2GA 1ZSZA 2QI2A 2VUBA 4YRLA 1V4RA 2G9WA 2XAQA 1GBRA 4AIJA 1M27C 4RS8A 4GFBA 1KQ9A 1OX8A 2MD5A 2W0ZA 1MH3A 2DCEA 4C5GA 4C8QE 3BG5A 4I09A 3CEYA 4HWRA 1W2BS 3M4QA 3CCJA 1MBEA 1ENHA 3U23A 1YI2Q 1VQ7T 1T3SA 3GNFB 2GTOA 4CC4B 4CC2A 1T08B 2XAUA 4I0AA 4V2FA 4BY6C 1X4PA 5GAHJ 2QQRA 2FA5A 2ZJQF 1PP7U 1I6HJ 4YRKA 1WI3A 5FU7C 3SZGA 1WJCA 2D1VA 2X9DA 3I59B 4M75E 1MIJA 3Q9VA 1G3WA 3R0JA 4GCVA 2VOOA 1Y0MA 2R92J 1AHDP 1G3TA 2HOTA 1SD6A 3P9CA 5GJVB 3VYHB 2LLKA 3E9HA 4M9ZA 2X4WA 3GVAA 5FKNA 4ZYAA 4HLXA 3SYTA 3E6BA 4B47A 1LKXA 1U1TA 2Y90A 3RI4A 1HSJA 4XLPF 1U6GA 5F6FA 1D3BA 4M4ZA 4K2EA 2QEXA 3ZOBA 2ED1A 3BZ6A 2ETHA 2HQRA 3E9IA 4OGEA 3BZCA 5K5QA 2X3XD 2PMZA 4EM2A 3PIPF 4YREA 2QYOA 5HLHA 1JJ2P 1M3CA 1MGTA 3IL2A 4M6XA 2EQJA 2O2OA 1ZGJA 2QSFX 1WA7A 2F69A 2CJBA 2A6HF 2XPUA 3CF2A 4FYYB 1H3HA 2DZCA 2YHTA 4FCYA 2JSCA 2W00A 1IZ6A 4OMPA 3RGLA 3ZMVA 3M7GA 3GTKJ 4XTZA 3SWNC 2DI3A 2DFFA 2DT7B 2L0KA 4I6ZA 4C92B 5GAOm 3OYMA 4RA2A 2NNNA 1JGGA 2GFAA 1IL2A 1F36A 2WSCE 3VYSB 4M7AG 3LFUA 1FMKA 3A1PA 2L9VA 2ZPGB 4M7DC 1NG7A 2XVCA 3JV3A 5HCKA 2QEXT 3TP3A 1UGRB 9ATCB 3ZQ7A 3OSVA 3LNQA 3REAB 1K8AC 3HFVA 5FFXA 5CQXA 4CI0C 1HSQA 2A6EF 2GA1A 2VIXA 5M3MJ 2QQ9A 4B9WA 2ZIOA 1ZSZC 4E6RA 3HKZA 4RB2C 2DFHA 3CCVA 3G1OA 2QENA 2CW0F 3TEDA 4FYVB 2V1RA 5JVTA 2AXLA 2DPUA 2DL5A 1HW1A 5LJ5e 4JLIA 1USSA 1S7AA 4LE9A 3CCYA 3R0AA 1LFUP 3GTPJ 2DBKA 2EKHA 5F27A 2JRMA 1P2FA 2IA1A 2V9PA 3SEQA 3UKGA 1JQQA 4GLMA 2BZYA 2EFIA 3H8ZA 2CKKA 3E1SA 3P7NA 4WXDA 3ROUA 1MV0B 1J3TA 3OMGA 1Z9QA 1G5VA 3F72A 4RM3A 2DOAA 1OU8A 4E2FB 5GANj 4GRIA 1FYLA 2ZZGA 1SFKA 4XORA 2HGCA 3WG7H 5BQTA 3MMYB 2LQ8A 4HDVA 4F7UG 3PNTA 4XSXF 3R4KA 3CESA 1VQOI 1FIAA 3JRGA 1WHMA 3HXWA 2O31A 4BJ6C 1FMVA 2Q1ZB 1RIQA 2R7OA 1P9QC 4OMZA 1AKHA 3UA7A 3SDZA 4F16A 1WQ7A 5GTIC 4TVAB 3M9QA 3TEHA 4YDQA 1B34B 4M78E 4ZGJB 2KBTA 5K7HA 4E7JA 2B9SA 4L5GA 2WY8Q 5DY9A 5GAOl 1B4AA 1QRYA 1RLQC 2J05A 2EJGA 2RQTA 1K61A 2WB1N 4HSRA 2Y30A 4DBRA 1VTNC 3FIFA 2IRFG 1CSKA 1SD5A 4UY8I 1ZGAA 4RB3C 3CPWA 4IIOA 3FIWA 4CZCA 2EH3A 3MKLA 5LRSA 2E71A 1OZ2A 2E5ZA 3CDLA 1GFCA 2CUJA 1Q7YR 1B70B 6PAXA 2DA3A 3L4GB 4B4CA 2ZNIA 3U21A 4F93B 5K1XA 4B9XA 2Y48A 2ESNA 2FOKA 3HSFA 2M0MA 1R36A 1TWGJ 2V1DA 1YGBA 5J4VA 4HV6A 4UXNA 3CC2A 2WAEA 1B8IA 2PFBA 1H641 2HU9A 3HIFA 1TOVA 4UV8A 3HJEA 2CSIA 1UJ8A 2CP0A 1JUMA 5J6XA 5C6SA 3WTYC 3H1CA 4B48A 3Q0VA 3G6EI 2X4XA 5EGOB 3PT9A 1R5HA 1YJNA 5GAOp 1WVRA 2R3SA 3KYDB 4M3EA 4AIHA 1BL0A 1EJ9A 3ASOH 1GCPA 1NG2A 4WCIA 1BJAA 4O2DA 2E65A 1IXRC 1X2KA 4FASD 1GBQA 4OLFA 4C0DB 1EH7A 4E7HA 3REBB 3S1QJ 2KGTA 2FD5A 3G71T 2Q5IA 3EH1A 3H0FA 4ANJA 5I2SA 2ARTA 3C3WA 4M78G 3P8BB 2FJ1A 2QWWA 3MZHA 1U78A 2BKDN 5FJ8J 3BTLA 5L23A 2M7BA 4LDVA 4R56A 4A4GA 3ERMA 1QCOA 4RAFA 3BWGA 3LSKA 4LB6B 4ZDOA 2KRFA 3I9V2 5GTHC 2BUDA 3G4SA 1OYWA 2DXUA 4L6V5 1E3OC 2W7NA 3J81Z 5HKCA 3OSGA 5GAMg 5GAN2 1ARKA 4GYIA 1SEMA 3LLRA 4ZYEA 5C51B 2CQXA 5L3GA 1U5TC 4J6WA 2E36A 5B66C 3E6CC 3A03A 2XD0A 4H2TA 3KFWX 1BW6A 1AD5A 3MEAA 1WQWA 1XMKA 5KHDA 4N4HA 3RESA 2I2LA 2CIMA 5JLWA 4PL6A 1IRXA 1KYWA 4U0YA 2MLGA 4CUGA 3L7WA 1Y8RB 3L2UA 1N77A 1AT1B 1I81A 1R77A 4YRCA 1IAWA 4KUDK 1JO8A 4RG2A 3PUBA 2GBYA 3S2HJ 1AWOA 2IA0A 1Z67A 1QF6A 3V7CA 2KT1A 1YJ9Q 3RKXA 1PP8F 2QDLA 1VQKI 3CUQA 3DPUA 3CC7Q 1WYDA 4C92A 3VQWA 1FEXA 4XTXA 3CCEI 3PIPA 1NE8A 4Q6GA 3PMIA 4JPBW 2KRCA 3BC8A 3CCMI 1IN5A 2LY9A 1H9TA 2M5WA 5DDGA 5H6RA 1ETVA 1M1GA 4FTHA 1RR8C 2BE9B 1FBSA 3P8DA 1NJIR 3MAJA 2X48A 3CCRI 2NUPA 3I55A 1XPXA 1R00A 5CJ9A 3KP5A 2X6XA 1K73U 3JAMK 2QF7A 1UFFA 2DAQA 1VIFA 2P0LA 4HLYA 3BG3A 2ODRC 4DZPA 1HKSA 3LGFA 2EGAA 4WJ3M 3VFZA 2XAHA 2LRDA 3EUKL 2A69F 2QSHX 1Q82R 2RJEA 1QVGS 1P7IA 3ME9A 1V55H 3PFIA 1ZLKA 3I53A 4OAYA 1W66A 4QIWN 1R22A 5CAIA 2KIUA 3AHUA 4BQOA 2TCTA 5DM6F 1R8OB 4OF1A 3HRMA 3JCMf 2CQKA 4CS3A 1PUFA 5FW9A 1VQ6Q 3X28B 5BPDA 5E3LA 3PFSA 1TNTA 2VKVA 3HGGA 1TWFJ 2XGXA 3WTWC 1YNZA 4LUDA 5KYYB 4HWTA 2WV0A 2NLUA 1B7YA 1X1CA 1N9SA 3M0SA 3NTKA 1VQMA 1HDPA 3UGQA 1T33A 3WODF 2VC0A 3EG1A 2KISA 2MH2A 3JCMX 2ABLA 4Y92A 4PJOA 2R7DA 3S93A 1WLEA 4LG0B 5D5XB 1UHWA 4RB0A 2CS7A 2AKWB 1YJNT 3P8VA 2IGMA 1KOGA 4C8QB 2HQAA 1Q86C 4CICA 2W84A 2DODA 1SG5A 3P8YA 1IUYA 2ZBKA 2XF5A 2JOYA 4BQQA 2E5QA 5FD6A 1SVMA 1QKWA 1MJAA 1GV5A 1JE8A 3KFUA 4BUPA 1ZH5A 4CH7A 3HOVJ 3FHNA 5DUKA 1UGQB 2LY2A 4A12A 1KU9A 1JBMA 2C0IA 4HX8A 5JI6A 1ZRDA 2HDDA 2IS4A 1AHJB 3SEMA 1TS9A 1TWAJ 3GFMA 1U9NA 4HOBA 5B1BH 2XTIA 1LCKA 4KIFA 4LB5A 3VS6A 5GAN3 5H2FC 3IALA 1LE8A 2YS9A 4HCBA 1NEGA 2E41A 1SVLA 1SFXA 3CC4T 1EVKA 2EV5A 3HTSB 2JA8J 1VQ7I 2YLBA 1XNIA 2ID3A 5IN1A 1Y39A 5IHNA 1YITQ 4A3CJ 4A3KJ 4MDXA 2RI2A 3UR3C 4K88A 4HBLA 3BDUA 1WFXA 4LGWA 5CLSA 4I7HA 2DFEA 2RC4A 4MLOA 3HL2A 1POGA 1H0MA 1JXMA 3TOAA 3TOBA 2GIVA 4AIDA 2CZ1B 2NOJB 5FO5A 4EVIA 2X85A 1J5WA 3ZQHA 4BAYA 4F7UB 2ZCEA 2HOEA 2LG4A 4M7DF 1GVDA 2VOPA 4M75A 3EH2A 1YJNI 1Z05A 1NJ8A 2GA2A 5KCMA 1FOYA 5JHUA 5CQEA 2EPDA 2YSQA 3EG0A 4A4FA 1SD4A 2QA4A 3RDVA 3GWZA 4WCGA 2A61A 3S3NA 4I76A 1VQMI 4WF2A 3WTUC 1IG7A 2NUTB 2RJFA 3EGDA 4M77A 2VN2A 2CUDA 2DVJA 1YHQA 5D6XA 4ZH4F 1OQYA 3A4CA 4R55A 1NEBA 1WIEA 4CO8A 4LN2A 3A0BC 2RHIA 1J2XA 1YE9A 1T6SA 1ZA1B 3ZRGA 4HQEA 3JB9G 4RBOA 3BJOA 5IYCJ 1K78A 3LW5E 4L9NA 4RKUE 5GAOq 2ECBA 3CCQQ 1T0HA 4L5IA 3I7FA 1RI7A 5DS9A 4JRPA 2KHMA 4N4OB 4J9CA 3D5LA 3REXA 5FKOA 2NVYJ 1ADYA 3D0SA 1UDLA 3O8VA 3PSIA 4RCBA 1VQ8A 1Y71A 2CU7A 3FK7A 1OMIA 3PGGA 2KLOA 1IGQA 5ECAA 3CCRA 1E22A 3I4PA 5K7ZA 1K76A 4CSWA 3KUFA 1Z9ZA 3J81E 1TH7A 1X55A 1ULYA 1X3ZB 4XNFA 4QQDA 3X26B 2ROLA 1VQKQ 1MBKA 3NEUA 4N9IA 1UEBA 2CT4A 3VS4A 3ZQLA 1KIKA 1MSFC 1R7JA 2K5LA 5H6QA 2OV7A 2IG0A 3FXJA 3D7SB 4F3QA 2O8KA 2IS1A 1UGPB 2CP6A 1BR1A 3GNGA 4RDUA 2EV6A 4ZYHA 1QHGA 2H09A 4A3LJ 1EX4A 1SC7A 2R7QA 1A6QA 4RB1A 3FLGA 2EIKH 1VQ5T 2DRKA 2E1OA 1JRIA 1B9MA 3DLAA 8AT1B 3NQOA 1WHKA 4M75C 1GGMA 3LQQA 2AMCA 1M3BA 2K9LA 1VQ8I 4G7HF 2PU9B 3SZTA 3TDZC 3GOXA 3HOUJ 4MZTA 1I8FA 3GBQA 2DFUA 3VSKA 5HK3A 3G4SI 3DKYA 2A05A 1N9WA 1BK2A 2ZNJA 4RMOA 3META 1D5YA 2YUSA 2FPDA 3FXQA 3HG9A 1LDDA 3GZ6A 2Y9YA 3IAS2 1UHMA 4PDKA 3D1NI 4UV9A 2LSOA 1LJOA 1P4WA 1ZBJA 2RI3A 3L42A 1OFCX 5CVVA 1JI8A 1SSHA 1R5GA 4KQEA 2FBKA 1XB4A 2XB5A 4P9FA 5BS6A 5E3MA 2WWYA 1ZR2A 3DLLA 2ADUA 3HOSA 2DA6A 3EGXA 1R1UA 1IDYA 4IUUA 4OP0A 2BGCA 2CUEA 2DVEA 3WVEB 3A31A 1YIJA 3M3YJ 4RGRA 3JSOA 2OAWA 4X1EA 5J3LA 1FZPB 2KT8A 1HJDA 2JPCA 2ZB9A 4KN7X 5HVQC 2RO0A 4OMQA 4H2XA 2GQIA 1M1KC 2DK5A 2QA4I 4RQFA 3Q0UA 2OTJA 4IHTA 4M9XA 1L3LA 2DA2A 1YI2T 1VQ7Q 4M7AD 4B6MA 1PUEE 2O5RA 4JOMA 1ZR4A 3IG2A 4U88A 3UNGC 1QHHD 1YFRA 5L3CA 2HWVA 2ZZEA 3ASKA 1K8AR 2AQFA 3CJRB 3DCFA 2W24A 1OCTC 4KH1B 4RG8A 1NYQA 4HWOA 4EIKA 3M07A 2K7AA 1K79A 4KT0E 5AYFA 2MC4A 3LSRA 1AOJA 5TISC 1X6OA 4CRIA 2VASA 1DP7P 4JDSA 4CH5A 1VYUA 2TDXA 4BDYA 1T38A 4WXCA 2M1HA 2RN7A 5C3EJ 2E5NA 1XDSA 2ED0A 1Q81C 2ME6A 5K7FA 2KK4A 4TVRA 4PJOE 1R0BG 4QVCA 3N97A 4E7IA 1IGNA 2NS0A 3BPXA 3TO9A 1YP5A 2RQWA 1YO5C 1M2VB 4A69C 3KP6A 3BCBA 1VA7A 2P0QA 2VI6A 3MEYA 4YP0A 5A2QE 4Q48A 2LKXA 4F7UA 2OBPA 2HBWA 2Z33A 4M75B 3CCLT 4M7AC 1QVFS 4XU2A 4ZGDB 3F8FA 3WHCA 1JKPC 3UWNA 2BV6A 4DEYA 4FT4A 3DB3A 4KGVB 4WWCA 4ZTJA 1JXSA 4YRQA 4LIVA 3BY6A 1HD3A 3EGDB 3VV0A 5GMKe 4GGGA 3NEMA 4AT1B 2DU5A 5EEAA 3CP2A 1M3AA 2IPQX 1WGSA 3JB9J 4JJDA 2PG4A 1YJ9A 1U3EM 5KYXB 3ZBDA 2OTJQ 1RKWA 3CCQA 1G6NA 4BU2A 3ERED 2X6OA 2VUMJ 3EUAA 3MP1A 2L7ZA 3ABKH 2DL7A 1JT6A 1Z1DA 1ITYA 2FPEA 3VS1A 2Q7EA 4NDLA 5C4XJ 3IKLA 4EPCA 3JCMV 1VQ4T 1KU2A 4BDZA 1TT0A 1OV3A 2OQRA 2DQRA 1RLPC 5CKBA 3CCUI 2RQPA 3WGIA 3CCRQ 2MABA 1W5SA 2W1OA 3CCMT 1LPLA 2M4GA 2V1XA 3K4MA 3I0TA 5DTDA 3MKZA 2LCLA 2MSYA 2W57A 3EDPA 2JUFA 3OYEA 3J80Z 2LC4A 2LKSA 3ELKA 1TUCA 3CCMQ 1T0FA 1RABB 4BHCA 3CMMA 1G4DA 2FBHA 3MCZA 1LEAA 5FROA 1IN8A 2CG4A 4LFUA 4HG2A 2DD4A 2OTLA 3RJPA 3DKWA 4BE0A 3UF4A 4MGRA 4JUVA 2DQ3A 4IL6C 3M8EA 1USTA 4PUSA 2DILA 3CD6T 4ZTUB 4X6AJ 1OYXA 1QQJA 3EFOA 4PJOF 2ZSHB 3IAM2 1VQ9A 3TEGA 2NVUB 3FK6A 4Q47A 4CS2A 2FZKB 4YCWA 1FC3A 3A7RA 5C0MA 3SFIA 5HK0A 2IY5B 3CCJT 4BHBA 2R57A 2FNPA 3DTKA 2GBQA 2KI7A 2XI9A 1ASYA 4Q5WA 4CXFA 3H36A 3C2HA 2OTJT 3E9FA 3NETA 4DYRA 4B43A 2PJPA 4A6EA 3UATA 2K4JA 3H9NA 4XKBA 4ASNA 2G7HA 4IOAF 4FSSA 4JRIA 2PTKA 3JTGA 2QSGX 2MI6A 3LOCA 5E3IA 3M57A 2E12A 3HYIA 4MEYF 4ABZA 1VQ9T 1G83A 1GVJA 2KQRA 2R7RA 1Y96A 2DA1A 3LYIA 1I1SA 3GTJJ 2LR8A 2EFWA 4HT9A 4IF4A 2LX9A 1J9IA 2DTOA 1LB2A 1U8RA 3DP7A 2KMUA 3IH2A 5D5UB 4O3MA 1SSFA 2K9GA 2P4RA 3M59A 5LJ3h 2FO0A 4MFEA 2KVQG 1UGVA 1ZA2B 4KMFA 5CKTA 4BJ5C 1FY7A 2WY7Q 4EX5A 5C52B 1DPRA 3C18A 1FLIA 1SVOA 1RESA 3PUFA 2CZ6B 2L0AA 3DB4A 5FU6C 3WU2C 1ACMB 1NJ6A 1K4SA 2LCSA 3N05A 4BEHB 4UVCA 5E1XA 4UB8C 4BS9A 2YUPA 5LJ3j 1YJWT 4C8QF 2E3IA 2EFOA 4JK1X 3LAPA 2JW4A 3CJQB 3IWZA 1TP4A 5AIQA 3BQZA 3M9AA 1ZG1A 1IN7A 2RDPA 1HC8A 1P7JA 3IWFA 3NELA 5IT9Z 1ZX6A 4B09A 2LP0A 2O4XB 3JCMQ 1PYSB 1XMXA 1WHUA 1W1WE 4YRPA 3WQZA 1D1CA 4BH9A 4D6WA 3X25B 3HOYJ 2KYBA 3NTIA 3GLXA 3P5JA 1X54A 3NENA 3QP5A 1OOTA 1VQNT 4IURA 4HX4A 2E19A 1WSUA 3TVTA 4YYEA 2RPNA 1M1EB 1YIJQ 2RB6A 1VYVA 1Z0XA 3H41A 2G4CA 4RTUA 3F21A 3CPWS 1QP2A 1PD1A 4P74A 3QU3A 3KEOA 3W2VA 2KMTA 2L3QA 1GT0C 4ENJA 1VQ9I 4MDWA 3NFCA 1IN4A 2HTJA 2VT3A 4A6DA 3WTSC 2R5YA 2V79A 1J75A 1WGXA 1VYTA 3FKIJ 4M7AB 4XEMA 3FM5A 1A6IA 2EFPA 2E5KA 2L8DA 4Z02A 1STZA 1B7YB 2IXSA 3GO5A 1BI2A 2FMYA 4A53A 2LDMA 4Z6YA 3CCSI 3CMEA 2IW5A 4JYKA 1XSVA 1NH3A 5IHKA 4BHPA 2VPRA 4K87A 1B8AA 2MPXC 2AIRB 11ASA 4UUSA 4II1A 1FYNA 3PE0A 4G6TB 1Z7MA 2EZHA 4M77F 5FLXK 5I2MA 2NWMA 5L3DA 4M3FA 2NS6A 2MMPA 1JJCB 3A74A 4LJZF 3MF2A 3K0LA 5A2QK 2L4MA 3BR2A 2LQNA 2R5MA 1C6VX 2IJLA 2DD5A 2L3PA 1W7PD 5KYXA 4M7DA 4FT2A 3OW2A 2QHUA 3QO7A 2LH9A 4M3GA 2XGCA 4H0EA 4KR3A 5HOOA 2F2VA 3VUBA 2NOGA 3WE2A 2DQLA 1WH7A 5CQYA 2EB7A 3SWNA 4UB6C 1BIBA 3RSNA 4E7KA 3MVPA 2J3MA 5LJ3g 3PCOB 4E47A 1APLC 2DKGA 4A2UA 5HS8A 2DFIA 2F5DA 2KDZA 2STTA 2OF7A 3S1NJ 1OULA 2FVUA 3VQVA 3TEEA 1V29B 2I4NA 3MWMA 2SEMA 4LLNA 2PX9A 2EK5A 2ZZDA 3JTHA 4OB0B 5HGQA 3NARA 4N9HA 4XMYA 3L09A 2LF8A 4D5FA 3S3MA 4CGZA 1ERDA 3CXCA 3SDBA 3Q0WA 5IY5H 1YIOA 2KY9A 4MMKA 2WAQN 2MWOA 3I56T 2MLKA 1I3QJ 2ZIMA 4OVAA 5DM7F 1XGSA 4G7ZF 2XIDA 2CGPA 2QHVA 3CZ6A 3KYCB 4LMYA 3OY9A 5GMKl 1NPRA 2L9SA 3HHGA 4XRMA 1ZN2A 5FLMJ 2O9LA 1I1JA 1IHVA 1REPC 1X27A 2COYA 4WTOB 1O57A 1W5TA 2LOOA 3OYCA 6AT1B 1WXBA 3R6OA 4EJTA 2DEQA 1HDDC 1T3LA 3NRVA 2LJ1A 1S3JA 1H88C 2M02A 1TC3C 3HOXJ 3QRFF 3I4NJ 1IO6A 1JXOA 1KQSA 2HSEB 4HT4A 4AC0A 1TQIA 4FETA 2ECZA 2K4YA 2IGKA 4EEFG 1FSHA 2K6DA 1BYMA 3IRRA 1A0NB 1SFOJ 3OV8A 4KIBA 1N78A 2Y69H 1OCCH 5IYBJ 2F5FA 1JUPA 1K7AA 2AO9A 1Z21A 1S5LC 2E1HA 1ZLJA 2JN0A 1Y96B 4JRKA 5KK1A 3T8RA 1CKAA 3RBBB 2BHZA 3L00A 2VE9A 3TW6A 2F2XA 4M78B 3L2CA 3VS0A 4JRQA 1VQLA 4B44A 2VC8A 1J7KA 1ZARA 2VJ4A 1EIFA 2RHZA 1YN8A 4P5NA 4HT8A 3X20B 1EIYB 4HZFA 4NC7A 4A3MJ 4OU0A 1YITT 2VC1A 1AU7A 1BCOA 3PL8A 2PQ8A 2FZCB 3H9JA 3K2AA 4R0KA 4PJOG 1HK9A 2UXXA 4FX4A 4A54A 4HVCA 3R6NA 2X1DA 2YU9J 1O75A 4UVAA 4S05A 2NVTJ 3I4MJ 2RMOA 4H2WA 1XCVA 2ZFUA 3JCMW 4A5NA 3QYGB 4JZ4A 2DMPA 4ON0A 1N5ZA 4NOYA 1NJIC 2QCOA 4CYCA 2K9MA 1YB3A 4YCUA 3QWXX 1IF1A 1PSEA 3A32A 3HFZA 1W7PA 3H3ZA 2JA7J 1JJ2S 4M7DD 1Y0UA 3K4JA 4Y3OA 3CMAT 1D1BA 4L5JA 1NYFA 2F4MB 2ZKZA 2ZPFB 4RUGA 4DOVA 1TLHB 1OKRA 2H94A 5LBQA 4IRHA 5L3EA 4XIDA 1O3RA 2H27A 2E1MC 2KYMA 4C92F 5I21A 2HOAA 2P4WA 1QLYA 2AXTC 2R7UA 2EPFA 2K3FA 4DBHA 3HXVA 1Y8QB 1X01A 2YLCA 1IXSB 2KEAA 5HDGA 2R5AA 1R0CB 4BXFA 2MA3A 3W3SA 3DPTA 3QPTA 1WH5A 3FF5A 1LDJA 1MJBA 4F92B 2MFZA 1QMCA 2K3BA 5LJ5h 2DBBA 3M58A 3O5ZA 2L54A 4XLFA 5K5RA 1VQ8T 2DEUA 1R4NB 2NNYA 2P0KA 5GMKi 5ICEA 4J8OA 4XU3A 3FHZA 3NGPA 1YHQT 1JHHA 2QDYB 4H2UA 4RQEA 3GCMA 4DBQA 1VQ5I 3F6VA 5D6YA 2E3CA 1QU3A 2EWNA 4XBFA 3NAUA 2EYXA 2YSRA 1WJEA 2FBIA 2HXOA 3M5AA 1KMMA 4M75F 2V26A 4DIQA 2JVVA 4C9YA 1TWCJ 4H4KC 2OTLI 1YX3A 1KFZA 2QXFA 1HKQA 2DA7A 3AFHA 3TO7A 2QBYA 4Y13A 2M87A 2GGRA 3SFZA 1B70A 4HVWA 3CLQA 2KRHA 4TWAA 4RGXA 3AAFA 2DO3A 3JCMb 2JK3A 5D6FA 4MZPA 1LQ1A 3ZMSA 4RAYA 1MMSA 1X2HA 3KE2A 4KNYA 1MNEA 2ME0A 5IT3A 2AKLA 1RRJA 1S7EA 2P5KA 1L0OC 5GAGJ 2RH2A 1YHQI 2WA0A 3CQZJ 2FE3A 2EAYA 1S8NA 1WWXA 2V4JC 2VYTA 4DOWA 1NHAA 1MSEC 1H4QA 5D6EA 1Z6TA 4G8XA 1FYMA 2I5UA 2CGHA 2JA6J 2G7UA 3QU6A 2RQQA 3Q1JA 1HSTA 1S6LA 1ZHIA 4A63B 3FXLA 1A35A 1WCMJ 2BVMA 4II2A 2YRCA 1VQNI 2KPMA 4FE7A 5M9OA 3HXZA 3M1CA 1B72B 1XX5A 1P4XA 2CQQA 1G2BA 5J3BA 5FFZA 4Z89A 1VQLQ 4TVAA 1QQIA 1PD0A 1CGPA 2G3RA 1J09A 2XB0X 4EM0B 1M2VA 4ZN3A 4L0YB 2MC3A 2P5LC 5CK9A 4BE1A 2RNAA 2E5AA 3S16J 2JMAA 2DX1A 5HDKA 2GXAA 1E2XA 1KMNA 4XQ3A 2Y0MA 2FZGB 2UUZA 4BKXA 1FYFA 3JCMP 3ICAA 2KRMA 3L2ZA 5EYRA 4TQFA 4K86A 4DZJA 3LSTA 1E6GA 3HBLA 3LSPA 2QHTA 2O6GE 5EG0B 4KBMB 3Q3SA 3J7AO 4M7DG 4WXHA 3QAHA 2OU2A 3LFKA 2LZ6B 4EM1A 4M7AE 3VKIA 3LL7A 3CC2Q 4Q5SF 4LD6A 1GL5A 1X2GA 3OYKA 2DM1A 1SMYF 2DTRA 2DXIA 4HQMA 4BY6B 2Q5HA 4P72C 4A3GJ 1NTCA 2KDOA 1ZAOA 2X1EA 3AG3H 3GZNB 5BMZA 2SRCA 1USYC 2D0QB 2DF6A 2EYYA 1UHSA 1ON1A 1TUDA 4W97A 5LJ5f 1TWBA 3N5BB 4FW2A 1OX9A 2ZGWA 3LSSA 1ZUYA 2DMQA 3CQTA 1KK7A 3G1LA 2BY1A 2IVWA 1I50J 3SQNA 3HZJA 4KFCA 1YBYA 3MKDA 2JUCA 2R7VA 4C8QD 2UV1A 2MG4A 2ZSIB 5ICFA 2DTIA 3PO3J 2AKKA 1OI1A 3QPHA 2EQKA 3JRZA 2JS2A 3CJTB 3KX2A 2CZ0B 2ZMEA 2KT0A 2DJQA 5EEHA 2HCKA 2TRTA 4G12A 2KRSA 5DCMB 2LQWA 3NPFA 2ZXFA 1M90R 1Z91A 1H89C 4KH0B 3GP8A 4IQ4A 4HF2A 1AZGB 1M8MA 3U2RA 3WE3A 5J26A 1I5LA 2VBYA 2H8WA 2VL8A 1QNTA 2R7FA 3HHHA 3RQIA 1YFHA 4V2SA 1U5TB 4C3HJ 2FRWA 2HI3A 3M56A 2HQEA 3S1RJ 4DEXA 4M73A 2MWPA 4KA4A 3DPLC 3GFJA 2D45A 3T1BA 4IHSA 4IRGA 3RMSA 3ML6A 2PJRB 4EMHA 5KE3A 2IS2A 1LJ9A 1VQ4A 3SDGA 1SMTA 5GADJ 2CZ7B 5F5WA 12ASA 4CYDA 1RR7A 1AKHB 4NL3A 3NHNA 5AT1B 3CCVT 2I4OA 5ELNA 3K4KA 3PNYA 5J8FA 3L2WA 5GMKh 1YYVA 1N75A 1R49A 1YLFA 3IKVA 1VNDA 2RJDA 2M0CA 4HWSA 2F6CA 4M78C 2BZTA 1NJ1A 1FT9A 3DFGA 1WDXA 1XTDA 2K5FA 4BNCA 2CP7A 4XKWA 4Z8AA 5LJ3d 4F14A 3OMCA 4BI4A 2D1XA 1ZREA 4G84A 2X35A 4JX4A 1K73C 3R61A 1Y1VJ 3HXYA 2RK2A 2XPVA 3G3ZA 1B1BA 1RAIB 4B1RA 1WPKA 2KIQA 4S0HB 4TTVA 4P3PA 5EZHA 5D5VB 2XRLA 1OJLA 4X34A 1SHGA 3CCUQ 2O3FA 1VQ6T 3HUGB 4D0PA 3KYLA 1MBJA 2WBMA 5J40A 1C1AA 2DL8A 3C12A 4J9BA 2JJ7A 4KULA 1FSEA 5LFAA 4HPQA 2FPFA 4HCCA 1ZG5A 2RREA 1M2OA 2E6NA 1QZYA 1T0FC 2XRNA 3K4NA 1VQ4I 2RN8A 3A01B 1EF4A 1YQAA 3JW4A 5EZGA 2BY0A 3RYRA 3CMAI 1LPQA 2O61A 4BBRJ 3GTLJ 1YFSA 4JJBA 4AUXA 2QM3A 4ME7A 4FQGA 1UZCA 3OYBA 1W2BP 5J1RA 1SF9A 3DTEA 5ED4A 4YIRX 3MKYB 5B1AH 4OIRF 3QYFA 3MHXA 3CCST 3VYUB 4CA0A 1PHTA 1XGNA 3M0QA 2M7AA 2XAGA 2HMAA 4RDXA 5E1ZB 1UE9A 4YRRA 5CKEA 1MZBA 5GPCA 2A8EA 3CXCP 5KYNA 2RHSB 2P84A 2DOEA 3ESWB 3QQAA 2PQWA 3H5RA 3CD6A 1BC7C 3KLNA 4UUVA 2VXDA 2DYSH 3OR2C 4HSTA 1KHCA 5A2QZ 4BY1J 1J5YA 3ULQB 2HFHA 5F1RA 2GFUA 4CC3A 4J7IA 2RVCA 1VQ9Q 4IJAA 1WZ2A 3K70D 2EJFA 4FW1A 1Y57A 2VT2A 2A36A 2MBFA 1SPKA 3BJAA 3WTTC 2BY2A 2P6TA 4BL0B 2CUBA 3G6EA 4DPGA 4TV7A 1YX5A 1H92A 2M0YA 3F0CA 1YIJI 1JJ6C 2QQAA 5D6WA 3KBGA 1O3SA 4HKEA 1QVTA 1MBGA 4AVZA 5B5EC 1OR7C 1HTTA 1OEBA 1MBFA 3WGGA 4LK0F 4C0GA 4IXAA 5E3NA 2GXGA 4YRSA 2LF7A 3FKJA 4BY7J 1YJWQ 3CJNA 2QTXA 3MD2A 5LGNA 2E60A 2H3JA 2DTZA 5IOYA 3BTIA 2DMOA 2MGQA 4ZNXA 4YRGA 4CCOA 4EMKA 4A4HA 3M4OJ 1M90U 4M9SA 3G6ET 2V1QA 1SRYA 3PM1A 4P96A 3QPLA 1RNLA 2R58A 3R07A 5M3FJ 2E34A 2JQ7A 4LDXA 3W2WA 3I56I 2XSJC 3BR6A 3BLYA 3EETA 1WJAA 5HLIA 2V9KA 1WPYA 3W6KB 2RHXA 3EGUA 2JZYA 4EDUA 1XS9A 3QUIA 2KFDA 1JTXA 3HFOA 2EVRA 4H2VA 4UP8A 1RIOH 4UHTA 2L9RA 1JTYA 2BZ8A 5LGTA 1ZSGA 3TQ7P 4XOTA 3DF8A 4BBSJ 3TCJA 2AT1B 2ALYB 3TW7A 5DM7R 4WJ4A 3DBLB 3GIBA 4ENMA 2QTVA 1LVKA 3OR1C 2H8HA 4DW6A 3GTGJ 3CMET 3ABMH 4E7ZA 1QVFP 5FLVA 5LJ5g 4CH4A 4D7MA 2JPBA 2XKOA 1D3YA 3SHFA 1PCXA 3LX7A 3JB9I 2HTSA 3PNVA 1X56A 1EFNA 4Y33A 5I11A 4P73C 3IP4B 1FWZA 1FOWA 3EYIA 2DU7A 4YFXF 3FXMA 1GXIE 4XRFA 8ATCB 3PJRA 1K78B 2ESHA 3HDDA 4XTYA 3HGYA 2VJJA 1UAAA 2FF4A 2W25A 4HX7A 4EV0A 4C5HA 2V6EA 4XM3A 2R4GA 4NQWB 4S04A 1W0UA 2VPLA 1BB9A 5E3OA 4RTWA 1KU3A 2A7YA 3JCMc 4M77D 3LQRA 1U8BA 5E79C 2V8IA 1WJRA 4IUVA 3HRUA 1B8IB 3FRNA 3ULRB 3CCSA 2HD0A 3CF5F 2ELHA 3FMSA 1WHHA 1X1BA 4L59A 1ETYA 2I4MA 2K4BA 2C6YA 1ETOA 1LNXA 4NCXA 1EV7A 1NJ5A 3QZ5B 3CMYA 4QVZA 2FQ4A 4JJCA 4QPQA 3IHUA 1Q7YC 3I5RA