2E65A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, mutation d104a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
227
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 67
structure length 227
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e65A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e65A01
4M77G 3JB9D 4C92E 5K1PA 1U1SA 3HRIA 5LJ3g 4RQEA 3BFMA 1ADJA 4ZTZB 3SWNB 4M77A 1EVKA 1WPYA 4WF2A 4H2UA 3HXUA 2DEQA 2ZZEA 1N9RA 1EIYB 4C92C 2DU5A 4OLFA 3FIFA 3JCMP 1LOJA 3EFSA 5GAOl 4PJOC 2QHVA 1X54A 3HY1A 1USYC 3HFOA 5GANg 2DTIA 2I4NA 4EMKA 1B76A 3HFZB 4BWAA 1JBMA 4NOYA 4P3OA 5LJ3f 5GAN7 4P75C 2ALYB 3HRKA 4YRLA 4CS2A 2QHTA 4M7AC 4C92F 2QTXA 1D3BA 4RQFA 2C7IA 5GAMj 2PMEA 1YFRA 1H641 1GGMA 2ZNJA 3V8LA 4C92D 1PYSB 2DKGA 4HVCA 3A31A 4YP0A 4CS4A 3BW1A 4M7AG 4TVAB 2E5AA 5GANj 1E1OA 3VQYA 1X56A 4PJOD 2QHSA 4PNOA 5LJ3d 1QF6A 5GANh 4M75C 4YRQA 4YRSA 1B7YA 3JCMJ 1X55A 5GAN4 3HSBA 5GMKj 12ASA 2EJFA 4WI1A 3A7UA 4X9DA 3RKWA 4M7DG 2DJZA 3FJPA 4M78D 5GAMh 1I4K1 5GAN8 3QTCA 1YFSA 4HT9A 4C8QE 4M7AB 2Q5HA 3VQVA 3QNEA 1H4QA 3E9IA 3JCMX 5GANf 4M78B 4XU0A 2J3MA 4EX5A 1WLEA 4TVWA 2DZCA 2DVEA 1E24A 2ODRD 3UGTA 4C8QF 3UFGA 2ZNIA 4M77F 3QUIA 3ICAA 3HFNA 1PYSA 5ELNA 2YLBA 4KR2A 1HTTA 3G1ZA 4XTXA 5LJ5h 1B7YB 3ERRA 5GAOm 3RGLA 5C53B 4H02A 3QO3A 3MF2A 4M77D 1IL2A 4XTZA 4K88A 4TQFA 2ZCEA 3P8TA 4YRFA 1QE0A 3V8KA 2AKWB 4ZTUB 5CAIA 4J6YA 2RHSB 4C8QA 2RHQB 3TEHA 3HXXA 3PGGA 3PCOB 3HFZA 4CH6A 2RM4A 4K86A 3RACA 4JUVA 4M78C 4XTUA 4JRKA 2J3LA 4P71C 1USYA 1W66A 1U1TA 4PHCA 3W3SA 4M78A 2RB6A 4M75E 3E9HA 5LJ5j 4UP8A 3MF1A 4XU3A 3A5ZA 2ZXFA 4CH3A 4PJOF 3SWNA 3P8YA 4H2XB 5GAMf 3NELA 3R07A 4YRIA 4O2DA 3LSSA 3P8VA 3JB9F 3SWNC 3JB9J 2G4CA 2VXEA 1NJ5A 1EFWA 3JCMW 4RCBA 4M7DC 2CJAA 4YCVA 3JCMd 1FYFA 2DU7A 3JCMg 4XEMA 1ASYA 4AH6A 3HXYA 3RKYA 5C51B 3EFRA 4M7AD 1NYQA 1G5HA 4P73A 2DQ0A 1Z7NA 1H4VB 4TTVA 4XTYA 5GAN2 4P73C 4JLIA 4CS3A 4X5OA 5C52B 3RUXA 3L4GA 4CH5A 2ZTGA 3IKMB 1LNXA 4M77C 2I2LA 2CJBA 1E22A 11ASA 3OD1A 4UP9A 2C8MA 2CJ9A 1L0WA 4M78F 3UGQA 1H4TA 4M7DB 4LNSA 1X2HA 3RL6A 2ZT6A 1B70A 2P5IA 2Q7EA 4C92B 4J15A 4P3NA 1WYDA 1ASZA 2I4MA 5GAMe 5GMKh 2CIMA 1WU7A 2E65A 2K57A 4P74C 1YFTA 2Q5IA 3V8JA 4RCCA 3L1AA 1KMMA 2XTIA 3BY7A 5HGQA 2RD1A 3HXZA 3GIBA 4H2YA 5GANe 2ARUA 2ZGWA 4V2SA 1HC7A 3L4GB 4XQ3A 2DTOA 2ARTA 3A7RA 4CH4A 1C0AA 4M7DE 4YRTA 4YRJA 3I7FA 4C8QC 3REUA 4N0AA 5GMKe 3JCMc 3A5YA 4UPAA 5F5WA 1VQZA 4C8QG 3RF1A 3JCMV 1B70B 2FYKA 1BBUA 3A74A 1B8AA 4F7UG 4YRKA 4RDXA 4P71A 2EL9A 3NEMA 2HNIA 1LJOA 4M7DD 3JB9G 2YLCA 4M75D 4J6XA 1BBWA 5GMKm 4M78G 3L2ZA 4XTWA 4OP0A 4DQ2A 4H2TA 1SERA 4F7UE 4YRPA 4P72A 2PMFA 2E10A 5GAOp 2P0LA 1H4SA 1JJCB 4G85A 2VXFA 4J6WA 3INZA 1E1TA 4UP7A 2RHSA 2Q7HA 3QHSA 1NJ6A 2AKWA 3TUPA 3M4GA 2YHTA 1M8VA 4M7AF 4YDQA 1B34A 5LJ3j 3SB2A 4XU1A 1TH7A 3QO8A 5GMKi 4P74A 3IKLA 4YRMA 4QVDA 5K1XA 4F7UB 1NJ1A 1N9SA 4NL2A 3TEHB 4C8QB 2RHQA 2DQ3A 3VBBA 2ARSA 1HK9A 4HWOA 1I81A 2DZ9A 1YCYA 1EOVA 4A54A 4HA8A 3IALA 3DSQA 4C8QD 4PJOA 2Q7GA 4YRRA 3TEGA 2IY5A 2AMCB 2I4LA 2E41A 3RIRA 2DDZA 2ZT7A 4PJOG 3JCMe 1I5LA 4H2XA 1WQ7A 2EWNA 1SETA 1Y96B 2ZT5A 3JCMb 3A32A 4P72C 1WQWA 2DXUA 4M7AA 3V7CA 2DXTA 2ZIOA 2E1HA 1M5Q1 2JN0A 3HY0A 4TWAA 2ZR3A 2ZT8A 4M75F 4EO4A 3JB9H 2EAYA 3BDUA 4F7UA 4KR3A 2ZINA 5LJ5g 3PCOA 4PJOB 4WJ4A 3JCMf 1NJ2A 3M4PA 4KQEA 2XGTA 2FB7A 1JRIA 1ATIA 3IG2A 4YRCA 2I4OA 4M75B 1NNHA 1BIBA 4M7AE 4MMKA 1LYLA 4NCXA 5GAOr 4YCUA 3CMQA 4EMGA 1N9WA 4M75A 5GAOq 2QHUA 4M78E 1YGBA 2CGHA 1Y96A 3JB9I 3VQWA 2ZR2A 4YCWA 2RA2A 1KQ1A 4M75G 5I21A 3V7SA 1D3BB 3JCMh 1BIAA 1NYRA 4TQDA 4PJOE 4Y91A 2IY5B 1B34B 4XU2A 5GAN3 1I8FA 4TVYA 3REXA 4HT8A 4H2WA 1WNLA 4HWRA 3FB9A 1G5IA 5GAMd 3HXVA 4J5YA 4YYEA 1X01A 1EIYA 2VC8A 3KFUA 3V7RA 1JJCA 4E51A 2EJ9A 2DTHA 4M77B 5GAN6 2EJGA 3RESA 4EMKB 3QSUA 1ADYA 2E3CA 4YREA 4EMHA 4F7UF 4JRIA 5LJ3h 1SESA 3HFVA 4YROA 3UH0A 4M7DF 1Z7MA 5GMKl 2E64A 5GANd 2AMCA 4H2SA 3VU3C 3NENA 4WJ3M 3M4QA 4A53A 4K87A 3A7AA 3NETA 3WQZA 4P3PA 3BJUA 3LSQA 4HWTA 4L87A 1EVLA 4XTVA 5LJ5d 4PG3A 4MMLA 5ELOA 2Y90A 3HTZA 4TVAA 4YRGA 2ALYA 4ZIBA 4C92G 4NL3A 1KQ2A 4M77E 1YB3A 3PZCA 1G51A 3LC0A 4N0AC 3QO7A 1MGQA 3AHUA 3VQXA 4C92A 3HXWA 1KMNA 4Q15A 4YRNA 5DY9A 5LJ5f 3MEYA 3JCMQ 1KOGA 4YPFA 4QVCA 4BW9A 4Q6GA 4EMKC 5KNNA 1J5WA 1X2GA 1EQRA 3QO5A 5GAOn 1NJ8A 1RIQA 5GAMg 5GAN5 4H2VA 4P75A 5LJ3e 2ODRC 4DPGA 4HWSA 4XEOA 4X9CA 4M7DA 5E3IA 1HXDA 4G84A 5LJ5e 4RMFA 3RKXA 2ZIMA 2ZZFA 4HWPA 2ZZGA 1SRYA 3RERA
chains in the Genus database with same CATH superfamily
1YI2Q 3CC4T 3CD6A 5CKBA 1U1SA 1M3AA 5HK0A 2PUOB 4ZTJA 3SWNB 1XNIA 2XD0A 5KYWB 1WPYA 3A5ZB 4WF2A 1YHQQ 1M90R 4H2UA 2DEQA 1SSHA 2ZZEA 2DU5A 4AG2C 3JCMP 1X27A 2LJ1A 3EFSA 5GAOl 1X54A 1X75C 1ZA2B 1WA7A 1M27C 2LCLA 1USYC 3HFOA 2GFAA 2DTIA 2LT4A 1PG5B 5FRMA 4EMKA 1JXMA 2LQWA 1B76A 4IIMA 3HFZB 1IHWA 9ATCB 1SPKA 4JDSA 1OX8A 4YRLA 1ZUKA 2CS7A 1C1AA 1KQSA 1YBYA 3EH2A 2QTXA 1KD1C 1H641 2ZNJA 3V8LA 2DKGA 2KNBB 2NUZA 4YP0A 4RTUA 4CS4A 3BW1A 2E5AA 1M2VB 5GANj 1VQ6A 4PJMA 2KR3A 1E1OA 2LP5A 5LJ3d 1QF6A 4LDVA 3JCMJ 4LD9K 2EJFA 2ZCFB 1ZSZC 4D8KA 1OX9A 2LMJA 3A7UA 4X9DA 3RKWA 5J3BA 5A2QE 2PQWA 2DJZA 3M54A 4JRPA 1ZSZA 3FJPA 2PZ1A 2DILA 3G6ET 1YWOA 3QTCA 3CCRA 2C06A 2AT1B 4KUIA 4J9CA 5L23A 1YFSA 2M9UA 2RF0A 4X1VA 2NUTA 2AZSA 2JMAA 2EIFA 4O5VA 1PWTA 2DLPA 3MEWA 3JCMX 2NUTB 1KQSP 3EGXB 1WLEA 4AFSC 4PFPA 2ODRD 1BU1A 4C8QF 3CMAQ 4M77F 1OOTA 3QUIA 3HFNA 1PYSA 2CP2A 1V29B 3A8GB 2K3BA 2YLBA 1Q82R 1HTTA 3CC7Q 4XTXA 1RAGB 4E2FB 1UGSB 1PCXA 4TQFA 2ZCEA 4J6YA 1NZ9A 1KD1U 2CT4A 2RHQB 1VQ9Q 1SHFA 4PK4A 2EYQA 2LX9A 3PCOB 2VVKA 2QTVA 4JUVA 4M78C 1QVGP 2J3LA 5I2MA 1X2QA 1W66A 2DIGA 2DE0X 2K5FA 4BUGA 1T3LA 2QK0A 4M78A 3E9HA 3EG1A 2IG0A 2MF2A 4BD3A 1QCNA 2CH4W 3O8VA 2F1LA 3D7SB 4XU3A 3A5ZA 3CPFA 1CSKA 3KBGA 4H2XB 3NELA 1Y7XA 2JM9A 4O2DA 3JB9J 2OAWA 1OI1A 2BTTA 1NJ5A 4XAXB 2QQ9A 3GNGA 3JCMW 1AWWA 1X69A 1QP3A 1FYFA 3JCMg 2LZ6B 1Q7YR 4J7IA 3RKYA 1VQ9A 1ZA1B 5I11A 2YRCA 4BI4A 5C51B 3HHTB 4LNPA 2HKNA 1NYQA 4RG2A 3R6OA 2DQ0A 1Z7NA 4TVRA 1W4SA 2WSCE 4DBHA 4JLIA 4CS3A 2A8EA 2VYTA 2BIVA 4FM4B 4ME7A 2ZTGA 2CJBA 1RI9A 1VQMA 2QEXA 2A37A 2ZPFB 3OD1A 1NM7A 4HCBA 1X6GA 2AZVA 3MJXA 1QCOA 2QQRA 4GLMA 1IZ6A 2YXYA 3FRNA 5GJVB 1T0HA 1JJ2A 1YITQ 2DJQA 4C92B 3ER0A 4JS4A 1ASZA 2XDDA 2P4RA 1G3WA 2E6ZA 5GAMe 2E65A 2K5IA 3VS3A 2HL5C 1YHQT 1YFTA 2FHDA 2A0FB 2M02A 1JB0E 3L1AA 1M1KR 2YSQA 4ANJA 2E12A 3BY7A 5D6WA 4B9XA 2CSIA 2RD1A 3HXZA 3L4GB 1VQ7Q 2COZA 4XQ3A 1YJ9A 3A7RA 1M4ZA 4FW2A 2PVDB 2L2PA 5KYNA 1UFFA 3REUA 4OMOA 3JCMc 1PM3A 1UJYA 1VQZA 2OTLQ 3JCMV 1B70B 1PKTA 4YRKA 5HK3A 4HT4A 1X2KA 2LCSA 2CUDA 1RABB 3NEMA 5FLXE 3M0SA 3OB9A 4M75D 4J6XA 1RL2A 3CCMT 2JTMA 3NFCA 1BBWA 2MPXC 3CCMQ 3P8HA 3G71Q 1SERA 4F7UE 4OMNA 1UDLA 4IIOA 5EG2A 3M58A 1H4SA 2KGTA 3MEAA 2EQJA 1VQNA 2SEMA 1VQ5A 4J6WA 3ME9A 1E1TA 2FO0A 2HKQB 2Q7HA 2RHSA 4UP7A 1BCOA 1BB9A 2VWFA 1ZSGA 3M4GA 1M8VA 3M5AA 3BDLA 2M0YA 2D9TA 1VQKQ 3OYDA 1B34A 2AK5A 4P74A 1MV3A 2DNUA 2ZPBB 5A0DA 1Q81R 2OJ2A 4J9HA 4RG8A 1U06A 2EQUA 3CC7T 4F7UB 4HXJA 4KH0B 2RHQA 3G4ST 1K0SA 1HK9A 1MMDA 1NLPC 1VA7A 3CCMA 1EZZB 3PIOA 3JAME 4PFZA 1MNEA 4ORZA 3TEGA 1RAHB 4JS5A 2WSFE 1O9SA 3LH5A 3L42A 3RIRA 1VQ5Q 1H3HA 2ZT7A 4PLLA 1Y71A 4PJOG 3E2UA 1U8RA 2EQMA 3LYIA 4II1A 3S3MA 2ZT5A 2DA9A 4FYYB 4PKCC 3REBB 5IXFA 4C5GA 3V7CA 2DXTA 4FT2A 2E1HA 2F2WA 3CMEQ 3HY0A 3M0UA 1YIJA 3VS6A 1KSWA 5DM7R 2RNAA 1T3SA 3OSSC 1S72A 4KR3A 2CSQA 3M0PA 5LJ5g 2KDSA 1K9MU 1T0JA 4WJ4A 1NJ2A 4KQEA 3OSVA 1VUBA 2KQWA 2R5MA 3IG2A 1JRIA 1PNJA 4M75B 2H3JA 2EBPA 1PKSA 2QASA 4MMKA 2R5AA 5GAOr 4OB0B 3CMQA 1W70A 1M1KC 2QHUA 4DEYA 1VQMT 3M57A 2CGHA 5CK9A 3VQWA 3EHQA 2ZR2A 4YCWA 2K5LA 4M75G 3J81E 1UEBA 5I21A 2QG9B 3V7SA 1S1NA 4HVWA 4KT0E 2ABLA 2GNCA 4C5EA 1YI2T 2IY5B 3NHNA 1I8FA 4TVYA 2DL8A 1WNLA 3HXVA 4KGXB 1X01A 2K3YA 3KFUA 4Q5WA 3V7RA 3VS2A 1VQ8A 5KYWA 4M77B 1VQMQ 4ESRA 5GAN6 3QSUA 4CI0C 3UATA 1V1CA 4EMHA 2NUPA 2ZPEB 3HFVA 1YP5A 2E64A 1H8KA 5GANd 3VU3C 3NENA 4WJ3M 1UUEA 3PMIA 2K2MA 2L3QA 3BJUA 4HWTA 4L87A 4PG3A 5ELOA 1K8AU 3RR6A 4TVAA 3VS5A 2A3LA 3QJYA 4E6RA 2ALYA 3JRZA 3VS7A 1AWJA 2FZCB 4M77E 1YB3A 2CP6A 2CZ1B 5I22A 4KGZB 2ENMA 4C92A 3M55A 4Q15A 3EG3A 5DY9A 2X3WD 3P8BB 1ZQ1A 1VQLQ 4Q6GA 2EW3A 2XDBA 1N6AA 5KNNA 3L2VA 1OEBA 1NJ8A 3X25B 2WACA 5GAMg 1RIQA 2DXCA 4RMOA 2OTLT 4HWSA 3QKJA 4A4HA 2A7YA 4M7DA 5E3IA 2QA4Q 5LJ5e 2JT4A 2V1RA 2HD0A 4RMFA 3CPWA 3RKXA 1Q81U 4HCZA 2ZIMA 2ZZFA 2MK5A 4J9EA 4JJNK 2KXCA 3OY9A 1YJ9Q 4ZN3A 3NTHA 1QP2A 4M77G 3JB9D 1RAEB 1Z9ZA 1QVFS 2F69A 3HRIA 1VYVA 2LVMA 2C0OA 1ADJA 2KBTA 3CCVQ 4J9BA 3HXUA 2EYYA 2K7AA 1YITA 1AVZC 2AKKA 3QDFA 4BY6C 2QHVA 4EPCA 2IIMA 2CP7A 4JJBA 2X4JA 4LXCA 1J3TA 4KH1B 5GANg 2I4NA 2D8JA 5FWCA 1VYUA 4P3OA 2HZYA 5GAN7 1OV3A 4E7HA 2ED1A 3UA6A 5IAYA 4CS2A 1QW1A 3TU4K 2QGGA 3CC2A 2A08A 2L3RA 4RQFA 1YFRA 3VV0A 2ZPIB 1OQKA 1W2BS 2GQVA 3VYHB 3A31A 1P92A 2EGCA 1VQNQ 4J83A 3C4SA 1K76A 1PC0A 3E1SA 4LD6A 3L2UA 2JW4A 1FXXA 2QHSA 2KRSA 1OZ3A 4CC2A 1IREB 2FPEA 5A0GA 3I55T 3H0FA 4BB7A 2RHUA 1AWXA 3G7ZA 4M7DG 1ZSZB 3H9NA 3CCQA 3E9GA 1I4K1 5GAN8 2YUQA 3CXCP 4HT9A 4HCKA 3QNEA 1H4QA 4HVUA 2ZAEA 5GANf 4XU0A 4EX5A 4Z88A 2GF7A 4C5IA 1E24A 1ARKA 4F16A 3UGTA 3QYHB 4AFQC 3UFGA 2O9VA 1X6OA 2DL5A 1S72Q 4XK8E 1V76A 2F5TX 1X43A 4EDUA 1TUDA 3MP8A 2JJ9A 5GAOm 1UECA 1YJNA 4H02A 2ATCB 1IL2A 1UHFA 1NE8A 1Q86U 1MNDA 4ELZC 3CC2T 2J06A 1QE0A 4ZTUB 5CAIA 3L2WA 3CBMA 4CH6A 1NJIR 5KYXA 1YWPA 2NS6A 2GGRA 4JRKA 1KG1A 1GXIE 3PMTA 4QQ6A 3ZBDA 3W3SA 2C0TA 3H0HA 5LJ5j 1VQ4A 3MF1A 2ECZA 4WTOB 3HRSA 2ZXFA 1NYGA 4PJOF 5KCOA 3P8YA 5GAMf 4R55A 1BYMA 3P8VA 1G3SA 1JU5C 3JB9F 2L3PA 1K73C 4QQDA 2VXEA 4ATOA 2G4CA 1EFWA 3RDVA 1B07A 4M7DC 2CJAA 1QVFP 2KRNA 1W2BA 2DU7A 3H41A 3HXYA 1WXTA 3OYLA 3ASKA 3OA6A 1NPPA 5KH6A 1G5HA 3G4SQ 4BDZA 2LNHB 2GCXA 1H4VB 4TTVA 5KCHA 2MI6A 1WLPB 1MMNA 2ZPGB 1ZUUA 4X34A 2NLUA 1WHLA 2DBMA 1VQPA 2QGFB 1N8RU 3L4GA 3IKMB 1LNXA 2I2LA 3UDCA 4E7SA 1E22A 11ASA 2DVJA 1VQOT 1CKAA 3I56A 1BI3A 4UP9A 2RJEA 1RI0A 3QWXX 3NGPA 1H4TA 1UGPB 3QYGB 4LNSA 3E9FA 1VQOA 2HBWA 2KYMA 1M2OA 4J15A 4P3NA 4NS5A 2IPOB 1WU7A 4MDWA 1R8OB 2Q5IA 3V8JA 2HBPA 2PUKB 5CKFA 3OS2A 1BBZA 1M90U 1AZEA 4H2YA 5GANe 2ARUA 3PIPA 1HC7A 1XJWB 2VV5A 2DETA 2ARTA 5FW9A 4RTZA 4C8QC 1AZGB 4N0AA 4B9WA 3M53A 1VQ8Q 2KVQG 5ECAA 5F5WA 1ZHIA 3S3OA 4C8QG 3EG9B 4VUBA 2FYKA 1YJWA 1K1ZA 2EL9A 1K0XA 1NG2A 1ZUYA 1YHQA 1TS9A 4BI8B 1LJOA 4M7DD 1VIEA 2YLCA 3LWIA 4C0GA 1OZ2A 1U3OA 5GMKm 4H2TA 4P72A 1N8RC 2J6FA 4DBRA 1OULA 3CCST 1NJ6A 2AKWA 2YHTA 3MKDA 2BE7D 1RLQC 2LQKA 4XU1A 5GMKi 1D0ZA 2OTJQ 3OS5A 1MV0B 4J9GA 4WCIA 2X4XA 1I07A 3TEHB 2K9GA 1M90C 4KBMB 4DEXA 5KE3A 3QG1A 2XG8D 2VGNA 4AT1B 1IB8A 5FU7C 4A54A 4C5HA 3ZFJA 3IALA 1Q86R 1QWFA 1WXBA 2MOXA 2Q7GA 4YRRA 1VQ6T 1GL5A 1GBRA 2IY5A 4LVLA 2ZZDA 2OTLA 2AMCB 2FVUA 4RKUE 4FIBA 1O75A 2RHZA 2DDZA 3S6WA 1E6HA 1QLYA 2K2VA 4LVJA 1R0BG 1LVKA 2LQ8A 2CP5A 2EWNA 5CR2A 4OMPA 1Z9QA 2DXUA 2LQNA 3TREA 1KD1R 1M2VA 3FEOA 1M5Q1 4OMMA 2JN0A 4TWAA 1NLOC 1TG0A 4M75F 2LX7A 2ESWA 3VUZA 4EO4A 3JB9H 3OBYA 2EAYA 2NYSA 2ZINA 3TSWA 3M4PA 2MCNA 1ATIA 2MWPA 2P0PA 2I4OA 1EIFA 4E7JA 2P0KA 4LDUA 2LTOA 1LYLA 3C0CA 4YCUA 1NEGA 2EGAA 5IH2A 4M78E 1C6VX 3CCQQ 1Y96A 3JB9I 4FSSA 1JQQA 1GRIA 2RA2A 3X26B 1VQNT 4ELYC 4LVMA 5AYFA 1BI2A 3JCMh 3CBPA 5HY6A 4PJOE 1B34B 2V8KA 2YWWA 1Y07A 4XU2A 2M16A 4QW2A 5KYUA 4LUDA 3F70A 4HWRA 1G5IA 4PJJA 3M4YA 2FPDA 1SRLA 2L89A 3QZ5B 1WHMA 1JJ2S 3VS1A 7AT1B 2E3CA 4C0ZA 1FMKA 4F7UF 4JRIA 5LJ3h 2YUNA 1Q7YC 5GMKl 2FPFA 4H2SA 1HYOA 5C6SA 1PHTA 1UJ0A 4ZGDB 3CD6Q 3NETA 3CD6T 3CCEA 2ZPHB 1KHIA 1TUCA 3HL8A 3G71A 3HTZA 2DL7A 3OYJA 2MWOA 2RN8A 2DK3A 4NL3A 1KQ2A 5A0LA 2E70A 4HCCA 2GBQA 4N0AC 3URGA 2RJDA 4LE9A 3EGUA 5IXBA 4FYWB 1GCPA 5LJ5f 2L8DA 3MEYA 2F2XA 4QVCA 2E5QA 1YJWT 1JEGA 1WXUA 3UF4A 1UHCA 2VKNA 5GAOn 1KFZA 3TEEA 4DA4A 5GAN5 1KIKA 4H2VA 4P75A 2X4YA 2H8HA 3PTAA 1YI2A 2Y4XA 1U5SA 4F17A 3I55A 2R58A 4OGCA 4XEOA 2LJ0A 3I35A 5D6YA 4X9CA 1ABOA 2KXDA 2IVWA 4P5NA 1BCMA 1BK2A 1E7OA 1RUWA 3I56Q 2JTEA 1Q7YU 2CUBA 2RHYA 3PNWC 1UGRB 2ZZGA 3RERA 3EHRA 2ROTA 2DX1A 4C92E 5K1PA 1UGQB 2XHCA 2K4YA 5LJ3g 3BFMA 1E6GA 2RI5A 4M77A 1EVKA 4MZTA 4PJNA 1SG5A 2EFIA 1EIYB 1N9RA 4C92C 3FIFA 3VUBA 3NTKA 1M1FA 1K9AA 2CKKA 2DPPB 3JSCA 3QJ6A 3ZL7C 2LCCA 1JBMA 2COYA 1GCQC 4NOYA 4JJDA 4BE1A 2ALYB 3QBYA 3LWHA 2QHTA 1Q95G 1AOJA 3G1JA 1QKWA 1D3BA 2C7IA 1VQLA 2L5QA 3OYAA 2PMEA 1YJNT 4JPBW 2G3RA 1YJ9T 4C92D 4YTLA 1VQ4T 1YFNA 1PYSB 2KE9A 2QA4T 4A63B 3U23A 1KJWA 1QVFA 3CMET 4PJOD 4PNOA 1D1AA 5GANh 2MAMA 1M3CA 1TXQA 4BE2A 1X55A 2KEAA 5GAN4 3HSBA 12ASA 1YNZA 1WX6A 2V8JA 3M0QA 2QDYB 3MP6A 3QZ9B 4M78D 1PRLC 1R77A 2JVVA 3WXMB 4C8QE 5EC7A 4E7KA 2Q5HA 5HCKA 4KUDK 4KRTA 3OQ5A 1M9SA 3CC4Q 5CKDA 3E9IA 3PE0A 4M78B 1ABQA 2J3MA 3EAEA 4PJLA 4TVWA 2DZCA 2DVEA 5CCAA 1TSFA 2GTOA 4AFUC 1YIJQ 3ICAA 1B7TA 5ELNA 4KGVB 1QWEA 4KR2A 2KT8A 3G1ZA 3M9QA 5LJ5h 1G2BA 3QO3A 3TQ7P 4XTZA 4K88A 3OYHA 1FX7A 4YRFA 5AT1B 3V8KA 2AKWB 3RMSA 2DD5A 2RHSB 4C8QA 1X6BA 3MQZA 3HXXA 3PGGA 1OPKA 2WSEE 3OYCA 1K73R 3OBWA 3HTRA 2BKDN 5CO7A 3RACA 3RBBB 2M51A 4XTUA 3H6ZA 5CIUA 3META 4IUVA 4RTVA 1Q82C 1WGSA 1VOMA 2QXFA 1U1TA 4BDYA 3CXCS 1VQ7A 2D0QB 4M75E 2J05A 3OYYA 4AFZC 3CCUA 3CCUQ 5D6XA 3TVTA 3VYGA 3DLLA 4R56A 2BUDA 3R07A 4YRIA 5CKHA 3PFSA 2RMOA 3SEMA 1WFWA 2O2OA 3JCMd 1IO6A 1CKBA 4XEMA 2HDAA 1C0MA 1K9MR 5J26A 3G6EQ 4QKUA 1RAAB 2P4TA 2PVOB 3EFRA 4OMQA 1K4US 4IURA 4P73A 4CC4B 2VASA 4XTYA 5CKEA 4P73C 2RH2A 4GY5A 5C52B 4X5OA 3QWYA 2EGEA 2F5KA 4CH5A 3I9QA 4M77C 1PD1A 2OAUA 2P84A 1IGUA 1RAFB 2YRDA 1VQ5T 3RNJA 3SFMA 2CJ9A 4M78F 4BI3A 4J9DA 4N4HA 1VQKA 2QI2A 3SD4A 2QEXT 1M30A 1B70A 3VRZA 1Q82U 1H3ZA 4OB3B 1WYDA 3QIIA 3MP1A 2RQUA 2RI3A 2I4MA 2KROA 4OVAA 5L8RE 3VKIA 1F1BB 1GCQA 2K57A 3FLGA 2HMAA 4Y28E 3UWNA 1KMMA 3LX7A 2YRVA 2LNVA 3DKMA 4OB1B 4LVKA 1LCKA 3J7AF 2ZGWA 4V2SA 1JO8A 2AHJB 1EFNA 4CH4A 2QDLA 4YRTA 5GJWB 4YRJA 3I7FA 2QQAA 1LPLA 4ZGEB 3IQLA 6AT1B 3Q1JA 3RF1A 3EFOA 1BBUA 2FEIA 1B8AA 2KI7A 2CREA 3CCVA 4RDXA 2CP0A 4P71A 1JXOA 2XKOC 2CH4A 2HNIA 1IHVA 4RTTA 4M78G 3L2ZA 4XTWA 2PVGB 4YRPA 1QVGA 4ZNXA 5I2SA 2YDLA 5GAOp 2L3SA 4FYXB 1OYXA 3JV3A 4LN2A 1JJCB 2VXFA 4AMCA 3CCET 1K9MC 1D1CA 1UG1A 4M7AF 4YDQA 5LJ3j 2E4HA 1RAIB 2SRCA 1TH7A 3QO8A 4HVVA 2EKHA 2QEXQ 3LH0A 4QVDA 5K1XA 4PLIA 5IN1A 2RJFA 1N9SA 4NL2A 1PD0A 2EYWA 4Z8AA 2W10A 4C8QB 2EVRA 4CRIA 4E47A 4PL6A 3I56T 1QVGS 2DQ3A 2AIRB 2XI9A 1YIJT 4F04B 1I81A 2DZ9A 1YCYA 4B6MA 1KK7A 1EOVA 4Z02A 3NMZC 4C8QD 4PJOA 5J39A 2I4LA 2P0QA 1TWBA 4JZ4A 1AEYA 3X20B 1AD5A 3OYNA 4H2XA 4OB2B 2M0OA 1TOVA 1Y96B 4FT4A 3JCMb 3A32A 3EG0A 3MCAB 4P72C 1NPRA 1WQWA 3CQTA 4M7AA 4ZN1A 2ZIOA 1BKBA 3CPWP 2ZR3A 2JUFA 3CMAA 2D1XA 3M59A 1FMWA 4RTXA 3BDUA 3G4SA 4F7UA 1UE9A 2X35A 2DD4A 3CCUT 3R6NA 3JCMf 1VQ8T 3LLRA 4MZPA 3KUFA 4IUPA 5IHIA 1BIBA 1BI1A 4M7AE 1NJIC 4FU6A 4NCXA 1SKUB 3HP9A 2Z0WA 4M75A 2X9HA 4J8OA 2JMCA 4LDYA 2EQKA 3OS0A 1KQ1A 4DBQA 2M1HA 3O5ZA 5GAN3 3REXA 4ZGJB 4C0DB 3FB9A 4J5YA 4YYEA 2VC8A 1SHGA 1G3YA 1JJCA 4IUUA 4E51A 2DTHA 1ZBXA 1IGQA 4EMKB 2V8IA 1ADYA 2CZ7B 1M3BA 4C0FA 4YREA 2L0AA 1WIEA 3UH0A 4L59A 4M7DF 2BE9B 2GFUA 2GQIA 2K79A 4A53A 3EGDB 4OGEA 2XICA 4DOWA 3CCLA 2NWMA 4UC4A 3LSQA 3OYIA 1EVLA 5LJ5d 2GTJA 4MMLA 4JLGA 4Z89A 2E6NA 2C0IA 2RK1A 4YRGA 1N5ZA 4ZIBA 4PFOA 1MUZA 3WVEB 3PZCA 1VQ6Q 1G51A 3LC0A 3VQXA 2D0NA 3HXWA 1KMNA 4YRNA 3MPUB 1NJIU 1KOGA 3SHWA 1Y0MA 4J9IA 1M1KU 4EMKC 1AWOA 1UTIA 1X2GA 1QCFA 3WVDB 1EQRA 3QO5A 4QQGA 2J7IA 2RPNA 2AKLA 5FU6C 2BZXA 4N4IA 4DPGA 5LL6S 4BACA 4AG1C 2KMTA 1OU8A 1SSFA 4G84A 1N8RR 4FYVB 5CQXA 4FL6A 3PVQA 2XU8A 3OYFA 3NTIA 3J80E 2F2VA 1N27A 3UT1A 2FZGB 3CXCA 1NBEB 3X28B 3HRTA 2XDPA 2BZ8A 3CBOA 2LC4A 4QVZA 3CCRQ 1M8MA 3OW2A 4F14A 3UA7A 2HSEB 1SRYA 1R0CB 3GF5A 2DXBA 3CC2Q 3GOXA 3CCEQ 2VGMA 1WHGA 4RQEA 1K8AC 4A4GA 4ZTZB 1NEBA 2PU9B 4C0DC 4J7FA 1VQPT 3TCJA 4OLFA 5KYUB 5IHNA 1TTHB 4IKFA 3LGFA 1LOJA 2J6OA 3CCJQ 4PJOC 2O01E 2BZYA 4D8DA 1KHCA 2Y4YA 4IUTA 2JZ2A 2QA4A 3REAB 3HY1A 2A28A 3OMCA 2NUPB 1HD3A 3GBQA 2FZKB 2QYZA 2JS2A 2LJ3A 4BWAA 5LJ3f 2HEQA 4P75C 3A8HB 3HRKA 2CP3A 5FRNA 4M7AC 2J6KA 4C92F 1Q86C 2JM8A 2D8HA 2EQIA 1UGVA 5GAMj 3C95A 1VYTA 1GGMA 1WJRA 2RK2A 8AT1B 2DFUA 4LVIA 4HVCA 2RHIA 1Q81C 4IUQA 3A8OB 4M7AG 4TVAB 3PT9A 3VQYA 1X56A 3I5SA 3GLXA 3GPLA 3CCLT 3OYGA 3E19A 4M75C 4YRQA 4YRSA 1B7YA 1XOVA 5GMKj 4WI1A 5FU6B 1TU0B 2XK0A 3EG2A 1WHKA 4JRQA 5GAMh 2D6FA 4LDXA 3EGXA 1VQOQ 4BE0A 4LDWA 4M7AB 2V1QA 5M9OA 3VQVA 4FSXA 3CMAT 3OYKA 1HJDA 1WI7A 2DRMA 2COWA 2H3EB 3CCJT 3CCVT 2ZNIA 2HAXA 1XQHA 1W1FA 1B7YB 1G83A 3ERRA 3RGLA 5C53B 1YJNQ 3RMQA 3MF2A 4LUEA 2ED0A 4M77D 2EPDA 1KC8U 1G3TA 3A98A 1A0NB 4ZTFA 3P8TA 3HPWA 5IHKA 2DRKA 3TEHA 2VB6A 2MMPA 2FL7A 3HFZA 2G6FX 2RM4A 1TUGB 5IT9E 4K86A 3LW5E 1NYFA 2CZ6B 2JS0A 2RQVA 2FG0A 4P71C 1USYA 3S3NA 8ATCB 4PHCA 2RB6A 3CCRT 3M0RA 4GLKA 4UP8A 1HSQA 2KRMA 2X4WA 3OW2S 3VRYA 2QQBA 4CH3A 3SWNA 2A36A 4K11A 4M4ZA 3LSSA 2DF6A 3SWNC 2I0NA 4EIKA 4RCBA 1VIFA 4YCVA 5HKCA 1WYXA 1ASYA 4AH6A 4RTYA 1VQKT 2FRYA 2RI2A 4N4GA 2DYIA 3A1PA 3MHXA 2X51A 4M7AD 3VS4A 3EFOB 2DEUA 2RQWA 1FMVA 3G71T 2K6DA 5GAN2 1M1GA 1KC8C 3RUXA 2JNGA 1WJQA 2ROLA 1ZBJA 5FWBA 2QAZA 1ACMB 3UPUA 2C8MA 1L0WA 4QT7A 3A8MB 3G6EA 1GFDA 3UGQA 4M7DB 3NPFA 1H92A 3AT1B 1X2HA 2DERA 3RL6A 2ZT6A 2LRQA 2P5IA 2Q7EA 1B3QA 4BY6B 3H0IA 3P8DA 5GMKh 2CIMA 4L5GA 3H8ZA 1W2BP 1G5VA 4P74C 1VQPQ 4OF1A 1K8AR 2XMFA 4RCCA 2CYZB 2XTIA 3SDZA 2OTJT 5HGQA 3GIBA 1MMAA 1JJ2P 1QMCA 2X3XD 4CC3A 2EYZA 2DTOA 1K73U 3X24B 1C0AA 2RHXA 1YCSB 4M7DE 1SRMA 1I0CA 5GMKe 3A5YA 4J9FA 4UPAA 2RO0A 3TSZA 1I5OB 3A74A 4F7UG 2K3XA 3CEYA 1XTDA 3JB9G 4RTWA 1SEMA 2EYXA 3C12A 3OS1A 3EGDA 1OU9A 1ZLMA 3CC7A 4HKEA 4OP0A 4DQ2A 2PMFA 1FYNA 2E10A 2PNIA 2P0LA 5CQYA 4KULA 2KT1A 4G85A 4E7IA 1S72T 3INZA 3QHSA 2HCKA 3TUPA 1GFCA 2DBKA 4L6V5 3CPWS 3SB2A 2RQRA 3C94A 3CC4A 3IKLA 2B86A 1WHJA 4YRMA 2FRWA 1SF9A 1NJ1A 1KC8R 2KSSA 2MYSA 4JJCA 1AHJB 3VBBA 2DL4A 2ARSA 2LT1A 3M0TA 2KK4A 4HWOA 1WDXA 3DB3A 1MMGA 2DO3A 5KYYB 2RQTA 2O9SA 3QPHA 1ZX6A 4HA8A 3DSQA 2LDMA 1OPLA 2RJCA 2CDTA 2E41A 4RUGA 2DMOA 1YJWQ 3I5RA 3LGLA 3ZEHA 5FROA 4OMFB 3VJPA 5KYXB 3JCMe 1I5LA 4MDXA 1VQ9T 1W6XA 1WQ7A 1SETA 1VQLT 1YN8A 1RACB 1WJSA 2XIDA 4JZ3A 3A8LB 3MO8A 2HQEA 1BI0A 5CVIA 4DOVA 2ZT8A 5D7UA 4D6WA 2CT3A 3CCSA 1WZOA 3PCOA 1D1BA 2MIOA 5FU7B 4PJOB 3FDRA 2E5KA 2XGTA 2O88A 2FB7A 2PTKA 4YRCA 2DYBA 1NNHA 1MHNA 1Y57A 2E3IA 1EX4A 1YITT 2QQSA 4EMGA 1FWZA 5DLQE 3OYBA 3I55Q 5GAOq 1N9WA 1RLPC 1YGBA 5C0MA 2JXBA 4O6JA 3CMEA 1PSEA 2E3HA 2OI3A 1PSFA 4R0KA 2HSPA 3M56A 2DL3A 2EKOA 1D3BB 1BIAA 4A4EA 1NYRA 4TQDA 4FCYA 4A4FA 1GBQA 2V26A 2JTFA 4Y91A 3GNFB 3QDRB 3ULRB 3DLMA 2YT6A 4CC7A 2YUOA 4HT8A 4H2WA 4FW1A 5GAMd 1EIYA 4DBFA 5KYYA 3FJ5A 2EJ9A 1D0XA 3EH1A 3CCSQ 2R57A 1G8XA 2EJGA 3RESA 2DM1A 3THKA 4YROA 1SESA 2VUBA 1Z7MA 1QKXA 2DAQA 3OYEA 3DB4A 2AMCA 3MEVA 1IRXA 3HKSA 2O31A 4A4KA 3M4QA 2KY9A 3FC3A 4K87A 1WHHA 3A7AA 1D0YA 1DJ7B 3WQZA 4P3PA 1I1JA 3L2RA 3OYMA 4XTVA 1KQSS 2Y90A 3BE3A 5KE2A 1VQ4Q 3L2QA 4C92G 4Y92A 3KXTA 3CCJA 4E7LA 2KYBA 5DLOA 2CZ0B 3HRUA 3MEUA 3QO7A 1MGQA 3PVLA 3N5BB 4GBQA 3AHUA 2OX7A 2B8AA 2DIQA 2HL3A 2O4XA 3JCMQ 4YPFA 4BW9A 4OMLA 2KAFA 2HQHA 1D09B 4E7ZA 1QVPA 2YUPA 1IXDA 1J5WA 1RADB 1QQJA 1AT1B 4MZMA 3CCLQ 5LJ3e 3QXEB 3EG9A 3VS0A 1VQ7T 2ODRC 2OTJA 1UB4A 1HXDA 3KFVA 2W0ZA 2HQXA 3T9NA 3OW2P 2O4XB 1PRMC 3GP8A 4HWPA 3CCQT 2JOYA 3OMGA
chains in the Genus database with same CATH topology
3CC4T 3CD6A 5CKBA 1U1SA 5HK0A 2PUOB 4ZTJA 3SWNB 1XNIA 2XD0A 1WPYA 3A5ZB 4WF2A 4H2UA 2DEQA 2ZZEA 2DU5A 3JCMP 3EFSA 5GAOl 1X54A 1X75C 2LCLA 1USYC 3HFOA 2GFAA 2DTIA 2LT4A 5FRMA 4EMKA 1B76A 3HFZB 4JDSA 4YRLA 2CS7A 1KQSA 1YBYA 2QTXA 1KD1C 1H641 2ZNJA 3V8LA 2DKGA 4YP0A 4CS4A 3BW1A 2E5AA 5GANj 1VQ6A 1E1OA 5LJ3d 1QF6A 4LDVA 3JCMJ 4LD9K 2EJFA 2ZCFB 3A7UA 4X9DA 3RKWA 5J3BA 5A2QE 2PQWA 2DJZA 3M54A 4JRPA 3FJPA 3G6ET 3QTCA 3CCRA 2C06A 4KUIA 1YFSA 2M9UA 2EIFA 4O5VA 3MEWA 3JCMX 1WLEA 2ODRD 4C8QF 4M77F 3QUIA 3HFNA 1PYSA 1V29B 3A8GB 2YLBA 1HTTA 4XTXA 1UGSB 4TQFA 2ZCEA 4J6YA 1NZ9A 1KD1U 2RHQB 3PCOB 2EYQA 2LX9A 4JUVA 4M78C 2J3LA 5I2MA 1W66A 2DIGA 2K5FA 4BUGA 4M78A 3E9HA 2IG0A 2MF2A 4BD3A 3O8VA 4XU3A 3A5ZA 3CPFA 3KBGA 4H2XB 3NELA 1Y7XA 4O2DA 3JB9J 1OI1A 1NJ5A 4XAXB 2QQ9A 3GNGA 3JCMW 1QP3A 1FYFA 3JCMg 4J7IA 3RKYA 1VQ9A 4BI4A 5C51B 3HHTB 1NYQA 4RG2A 3R6OA 2DQ0A 1Z7NA 4TVRA 1W4SA 2WSCE 4JLIA 4CS3A 2A8EA 2VYTA 2BIVA 4FM4B 4ME7A 2ZTGA 2CJBA 1VQMA 2QEXA 2ZPFB 3OD1A 4HCBA 2QQRA 1IZ6A 3FRNA 1JJ2A 4C92B 3ER0A 4JS4A 1ASZA 2XDDA 5GAMe 1G3WA 2E6ZA 2E65A 2K5IA 1YHQT 1YFTA 2FHDA 1JB0E 3L1AA 2E12A 3BY7A 5D6WA 4B9XA 2RD1A 3HXZA 3L4GB 4XQ3A 1YJ9A 3A7RA 1M4ZA 2PVDB 3REUA 3JCMc 1VQZA 3JCMV 1B70B 4YRKA 5HK3A 4HT4A 3NEMA 5FLXE 3OB9A 4M75D 4J6XA 1RL2A 3CCMT 2JTMA 3NFCA 1BBWA 3P8HA 1SERA 4F7UE 5EG2A 3M58A 1H4SA 3MEAA 2EQJA 1VQNA 1VQ5A 4J6WA 3ME9A 1E1TA 4UP7A 2RHSA 2Q7HA 3M4GA 1M8VA 3M5AA 3BDLA 2D9TA 3OYDA 1B34A 4P74A 2ZPBB 5A0DA 4RG8A 2EQUA 3CC7T 4F7UB 2RHQA 3G4ST 1HK9A 3CCMA 3PIOA 3JAME 3TEGA 4JS5A 2WSFE 1O9SA 3L42A 3RIRA 2ZT7A 4PLLA 1Y71A 4PJOG 1U8RA 2EQMA 3LYIA 4II1A 3S3MA 2ZT5A 4PKCC 4C5GA 3V7CA 2DXTA 4FT2A 2E1HA 3HY0A 1YIJA 5DM7R 3OSSC 1S72A 4KR3A 5LJ5g 2KDSA 1K9MU 4WJ4A 1NJ2A 4KQEA 1VUBA 2KQWA 3OSVA 2R5MA 3IG2A 1JRIA 4M75B 2H3JA 4MMKA 2R5AA 5GAOr 4OB0B 3CMQA 1M1KC 2QHUA 1VQMT 3M57A 2CGHA 5CK9A 3VQWA 2ZR2A 4YCWA 2K5LA 4M75G 3J81E 1UEBA 5I21A 3V7SA 4KT0E 4C5EA 1YI2T 2IY5B 1I8FA 4TVYA 1WNLA 3HXVA 1X01A 2K3YA 3KFUA 4Q5WA 3V7RA 1VQ8A 4M77B 5GAN6 3QSUA 4CI0C 4EMHA 2ZPEB 3HFVA 2E64A 5GANd 3VU3C 3NENA 4WJ3M 3PMIA 3BJUA 4HWTA 4L87A 4PG3A 5ELOA 1K8AU 4TVAA 2A3LA 3QJYA 2ALYA 3JRZA 4M77E 1YB3A 2CZ1B 4C92A 3M55A 4Q15A 5DY9A 3P8BB 1ZQ1A 4Q6GA 2XDBA 1N6AA 5KNNA 3L2VA 1NJ8A 3X25B 2WACA 5GAMg 1RIQA 2DXCA 4RMOA 2OTLT 4HWSA 3QKJA 4A4HA 2A7YA 4M7DA 5E3IA 5LJ5e 2HD0A 4RMFA 3CPWA 3RKXA 1Q81U 4HCZA 2ZIMA 2ZZFA 4JJNK 3OY9A 4ZN3A 3NTHA 1QP2A 4M77G 3JB9D 1QVFS 2F69A 3HRIA 2LVMA 1ADJA 3HXUA 1YITA 4BY6C 2QHVA 4EPCA 2X4JA 5GANg 2I4NA 4P3OA 5GAN7 4E7HA 4CS2A 5IAYA 1QW1A 3TU4K 3CC2A 2L3RA 4RQFA 1YFRA 3VV0A 2ZPIB 1W2BS 2GQVA 3VYHB 3A31A 1P92A 4J83A 3C4SA 3E1SA 4LD6A 3L2UA 1FXXA 2QHSA 1OZ3A 1IREB 5A0GA 3I55T 4BB7A 2RHUA 3G7ZA 4M7DG 3CCQA 3E9GA 1I4K1 5GAN8 4HT9A 3QNEA 1H4QA 5GANf 4XU0A 4EX5A 2GF7A 4C5IA 1E24A 3UGTA 3QYHB 3UFGA 1X6OA 4XK8E 2F5TX 4EDUA 3MP8A 5GAOm 1YJNA 4H02A 1IL2A 1NE8A 1Q86U 4ELZC 3CC2T 1QE0A 4ZTUB 5CAIA 3L2WA 3CBMA 4CH6A 2NS6A 4JRKA 1KG1A 1GXIE 3PMTA 4QQ6A 3ZBDA 3W3SA 5LJ5j 1VQ4A 3MF1A 3HRSA 2ZXFA 4PJOF 5KCOA 3P8YA 5GAMf 4R55A 1BYMA 3P8VA 1G3SA 3JB9F 1K73C 4QQDA 2VXEA 4ATOA 2G4CA 1EFWA 4M7DC 2CJAA 1W2BA 2DU7A 3HXYA 3OYLA 3ASKA 3OA6A 1NPPA 5KH6A 1G5HA 4BDZA 1H4VB 2GCXA 4TTVA 5KCHA 2MI6A 2ZPGB 2NLUA 4X34A 1VQPA 1N8RU 3L4GA 3IKMB 1LNXA 2I2LA 3UDCA 1E22A 11ASA 1VQOT 3I56A 1BI3A 4UP9A 2RJEA 1RI0A 1H4TA 1UGPB 3QYGB 4LNSA 3E9FA 1VQOA 4J15A 4P3NA 4NS5A 1WU7A 4MDWA 1R8OB 2Q5IA 3V8JA 2HBPA 2PUKB 5CKFA 3OS2A 1M90U 4H2YA 5GANe 2ARUA 3PIPA 1HC7A 2VV5A 2ARTA 4C8QC 4N0AA 4B9WA 3M53A 2KVQG 5F5WA 1ZHIA 3S3OA 4C8QG 4VUBA 2FYKA 1YJWA 2EL9A 1YHQA 4BI8B 1LJOA 4M7DD 1VIEA 2YLCA 3LWIA 4C0GA 1OZ2A 5GMKm 4H2TA 4P72A 1N8RC 3CCST 1NJ6A 2AKWA 2YHTA 2LQKA 4XU1A 5GMKi 3OS5A 2X4XA 3TEHB 1M90C 4KBMB 5KE3A 3QG1A 2XG8D 2VGNA 5FU7C 4A54A 4C5HA 3ZFJA 3IALA 2Q7GA 4YRRA 1VQ6T 2IY5A 4LVLA 2ZZDA 2OTLA 2AMCB 2FVUA 4RKUE 4FIBA 1O75A 2RHZA 2DDZA 3S6WA 2K2VA 4LVJA 2LQ8A 2EWNA 5CR2A 2DXUA 3TREA 3FEOA 1M5Q1 2JN0A 4TWAA 4M75F 4EO4A 3VUZA 3JB9H 3OBYA 2EAYA 2ZINA 3M4PA 1ATIA 2MWPA 2P0PA 2I4OA 1EIFA 4E7JA 2P0KA 4LDUA 2LTOA 1LYLA 4YCUA 4M78E 1Y96A 3JB9I 2RA2A 3X26B 1VQNT 4ELYC 4LVMA 5AYFA 1BI2A 3JCMh 3CBPA 5HY6A 4PJOE 1B34B 2V8KA 4XU2A 1Y07A 2M16A 4QW2A 3F70A 4HWRA 1G5IA 3M4YA 2L89A 3QZ5B 1JJ2S 2E3CA 4C0ZA 4F7UF 4JRIA 5LJ3h 1Q7YC 5GMKl 4H2SA 5C6SA 4ZGDB 3NETA 3CD6T 3CCEA 2ZPHB 1KHIA 3HL8A 3G71A 3HTZA 3OYJA 2MWOA 2DK3A 4NL3A 1KQ2A 5A0LA 2E70A 4HCCA 4N0AC 3URGA 2RJDA 5LJ5f 2L8DA 3MEYA 4QVCA 2E5QA 1YJWT 5GAOn 3TEEA 4DA4A 5GAN5 4H2VA 4P75A 2X4YA 3PTAA 1YI2A 2Y4XA 3I55A 2R58A 4OGCA 4XEOA 5D6YA 4X9CA 2IVWA 4P5NA 1Q7YU 2RHYA 3PNWC 1UGRB 2ZZGA 3RERA 4C92E 5K1PA 1UGQB 2XHCA 2K4YA 5LJ3g 3BFMA 2RI5A 4M77A 1EVKA 4MZTA 2EFIA 1EIYB 1N9RA 4C92C 3FIFA 3VUBA 3NTKA 1M1FA 2CKKA 2DPPB 3JSCA 3QJ6A 2LCCA 1JBMA 4NOYA 4BE1A 2ALYB 3QBYA 3LWHA 2QHTA 1D3BA 2C7IA 1VQLA 2L5QA 3OYAA 2PMEA 1YJNT 2G3RA 1YJ9T 4C92D 4YTLA 1VQ4T 1PYSB 2QA4T 1QVFA 3CMET 4PJOD 4PNOA 5GANh 2MAMA 4BE2A 1X55A 5GAN4 3HSBA 12ASA 2V8JA 2QDYB 3MP6A 3QZ9B 4M78D 2JVVA 3WXMB 4C8QE 4E7KA 2Q5HA 4KUDK 3OQ5A 1M9SA 5CKDA 3E9IA 4M78B 2J3MA 3EAEA 4TVWA 2DZCA 2DVEA 5CCAA 3ICAA 5ELNA 4KR2A 3G1ZA 3M9QA 5LJ5h 3QO3A 4XTZA 4K88A 3OYHA 1FX7A 4YRFA 3V8KA 2AKWB 3RMSA 2DD5A 2RHSB 4C8QA 3MQZA 3HXXA 3PGGA 3OYCA 2WSEE 3OBWA 2BKDN 5CO7A 3RACA 3H6ZA 3META 4XTUA 5CIUA 4IUVA 1Q82C 1WGSA 2QXFA 1U1TA 4BDYA 3CXCS 1VQ7A 2D0QB 4M75E 3OYYA 3CCUA 5D6XA 3VYGA 3DLLA 4R56A 2BUDA 3R07A 4YRIA 5CKHA 3PFSA 3JCMd 4XEMA 5J26A 3EFRA 2P4TA 2PVOB 4IURA 4P73A 4XTYA 5CKEA 4P73C 2RH2A 4GY5A 5C52B 4X5OA 2F5KA 4CH5A 4M77C 2OAUA 1VQ5T 3SFMA 2CJ9A 4M78F 4BI3A 4N4HA 1VQKA 2QI2A 3SD4A 2QEXT 1B70A 1Q82U 1H3ZA 4OB3B 1WYDA 3QIIA 3MP1A 2RI3A 2I4MA 4OVAA 5L8RE 3VKIA 2K57A 3FLGA 4Y28E 3UWNA 1KMMA 3LX7A 2YRVA 2LNVA 3DKMA 4OB1B 4LVKA 3J7AF 2ZGWA 4V2SA 2AHJB 4CH4A 4YRTA 4YRJA 3I7FA 2QQAA 4ZGEB 3Q1JA 3RF1A 1BBUA 1B8AA 3CCVA 4RDXA 4P71A 2XKOC 2HNIA 4M78G 3L2ZA 4XTWA 2PVGB 4YRPA 1QVGA 5I2SA 5GAOp 1OYXA 1JJCB 2VXFA 3CCET 1K9MC 4M7AF 4YDQA 5LJ3j 1TH7A 3QO8A 3LH0A 4QVDA 5K1XA 4PLIA 5IN1A 2RJFA 1N9SA 4NL2A 4CRIA 4C8QB 3I56T 4E47A 2DQ3A 4PL6A 1QVGS 2XI9A 1YIJT 1I81A 2DZ9A 1YCYA 1EOVA 4Z02A 4C8QD 4PJOA 5J39A 2I4LA 2P0QA 3X20B 3OYNA 4H2XA 4OB2B 2M0OA 1Y96B 4FT4A 3JCMb 3A32A 3MCAB 4P72C 1NPRA 1WQWA 4M7AA 4ZN1A 2ZIOA 1BKBA 2ZR3A 2JUFA 3CMAA 3M59A 3BDUA 3G4SA 4F7UA 2X35A 2DD4A 3CCUT 3JCMf 1VQ8T 3LLRA 4MZPA 3KUFA 4IUPA 1BIBA 1BI1A 4M7AE 1NJIC 4FU6A 4NCXA 3HP9A 4M75A 4J8OA 4LDYA 2EQKA 3OS0A 1KQ1A 2M1HA 5GAN3 3REXA 4ZGJB 4C0DB 3FB9A 4J5YA 4YYEA 2VC8A 1G3YA 1JJCA 4IUUA 4E51A 2DTHA 1ZBXA 4EMKB 2V8IA 1ADYA 2CZ7B 4C0FA 4YREA 3UH0A 4L59A 4M7DF 2GFUA 4A53A 4OGEA 2XICA 4DOWA 3CCLA 4UC4A 3LSQA 3OYIA 1EVLA 5LJ5d 4MMLA 4JLGA 2E6NA 2RK1A 4YRGA 4ZIBA 3WVEB 3PZCA 1G51A 3LC0A 3VQXA 3HXWA 1KMNA 4YRNA 1NJIU 1KOGA 1M1KU 4EMKC 1X2GA 3QO5A 3WVDB 1EQRA 4QQGA 5FU6C 4N4IA 4DPGA 5LL6S 4BACA 2KMTA 1SSFA 4G84A 5CQXA 4FL6A 2XU8A 3OYFA 3NTIA 3J80E 1N27A 3UT1A 3CXCA 3X28B 3HRTA 2XDPA 3CBOA 2LC4A 4QVZA 3OW2A 1SRYA 3GF5A 2DXBA 3GOXA 2VGMA 4RQEA 1K8AC 4A4GA 4ZTZB 2PU9B 4C0DC 4J7FA 1VQPT 3TCJA 4OLFA 4IKFA 3LGFA 1LOJA 4PJOC 2O01E 1KHCA 2Y4YA 4IUTA 2JZ2A 2QA4A 3HY1A 3OMCA 4BWAA 5LJ3f 4P75C 3A8HB 3HRKA 5FRNA 4M7AC 4C92F 1Q86C 5GAMj 3C95A 1GGMA 1WJRA 2RK2A 4LVIA 4HVCA 2RHIA 1Q81C 4IUQA 3A8OB 4M7AG 4TVAB 3PT9A 3VQYA 1X56A 3GLXA 3GPLA 3CCLT 3OYGA 3E19A 4M75C 4YRQA 4YRSA 1B7YA 1XOVA 5GMKj 4WI1A 5FU6B 2XK0A 4JRQA 5GAMh 2D6FA 4LDXA 4BE0A 4LDWA 4M7AB 5M9OA 3VQVA 4FSXA 3CMAT 3OYKA 3CCJT 3CCVT 2ZNIA 2HAXA 1XQHA 1B7YB 3ERRA 3RGLA 5C53B 3RMQA 3MF2A 4M77D 1KC8U 1G3TA 4ZTFA 3P8TA 3HPWA 3TEHA 2MMPA 2FL7A 3HFZA 2RM4A 5IT9E 4K86A 3LW5E 2CZ6B 4P71C 1USYA 3S3NA 4PHCA 2RB6A 3CCRT 4GLKA 4UP8A 2X4WA 3OW2S 2QQBA 4CH3A 3SWNA 3LSSA 3SWNC 4RCBA 1VIFA 4YCVA 5HKCA 1ASYA 4AH6A 1VQKT 2RI2A 4N4GA 3MHXA 4M7AD 3G71T 5GAN2 1M1GA 1KC8C 3RUXA 2JNGA 1WJQA 3UPUA 2C8MA 1L0WA 3A8MB 3G6EA 3UGQA 4M7DB 1X2HA 3RL6A 2ZT6A 2LRQA 2P5IA 2Q7EA 4BY6B 3P8DA 5GMKh 2CIMA 4L5GA 3H8ZA 1G5VA 4P74C 4OF1A 4RCCA 2CYZB 2XTIA 3SDZA 2OTJT 5HGQA 3GIBA 2DTOA 1K73U 3X24B 1C0AA 2RHXA 4M7DE 5GMKe 3A5YA 4UPAA 2RO0A 3A74A 4F7UG 2K3XA 3CEYA 1XTDA 3JB9G 3C12A 3OS1A 3CC7A 4HKEA 4OP0A 4DQ2A 2PMFA 2E10A 2P0LA 5CQYA 4KULA 4G85A 4E7IA 1S72T 3INZA 3QHSA 3TUPA 4L6V5 3CPWS 3SB2A 3C94A 3CC4A 3IKLA 4YRMA 1NJ1A 2KSSA 1AHJB 3VBBA 2ARSA 2LT1A 2KK4A 4HWOA 3DB3A 2DO3A 3QPHA 4HA8A 3DSQA 2LDMA 2RJCA 2E41A 3LGLA 3ZEHA 5FROA 4OMFB 3VJPA 3JCMe 1I5LA 4MDXA 1VQ9T 1WQ7A 1SETA 1VQLT 1WJSA 2XIDA 3A8LB 3MO8A 2HQEA 1BI0A 5CVIA 4DOVA 2ZT8A 4D6WA 3CCSA 3PCOA 5FU7B 4PJOB 3FDRA 2XGTA 2FB7A 4YRCA 1NNHA 1MHNA 1YITT 2QQSA 1N9WA 4EMGA 1FWZA 5DLQE 3OYBA 5GAOq 1YGBA 5C0MA 4O6JA 3CMEA 1PSEA 1PSFA 3M56A 2EKOA 1D3BB 1BIAA 4A4EA 1NYRA 4TQDA 4A4FA 2JTFA 4Y91A 3GNFB 3QDRB 3DLMA 4HT8A 4H2WA 5GAMd 1EIYA 2EJ9A 2R57A 2EJGA 3RESA 4YROA 1SESA 2VUBA 1Z7MA 2DAQA 3OYEA 3DB4A 2AMCA 3MEVA 3HKSA 4A4KA 3M4QA 2KY9A 3FC3A 4K87A 3A7AA 3WQZA 1DJ7B 4P3PA 3L2RA 3OYMA 4XTVA 1KQSS 2Y90A 5KE2A 3L2QA 4C92G 3KXTA 3CCJA 4E7LA 5DLOA 2CZ0B 3HRUA 3MEUA 3QO7A 1MGQA 3AHUA 3N5BB 2B8AA 2DIQA 2O4XA 3JCMQ 4YPFA 4BW9A 2KAFA 1QVPA 1J5WA 4MZMA 5LJ3e 3QXEB 1VQ7T 2ODRC 2OTJA 1UB4A 1HXDA 2HQXA 3T9NA 2O4XB 3GP8A 4HWPA 3CCQT 2JOYA 3OMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 G;  3JB9 D;  4C92 E;  5K1P A;  1U1S A;  3HRI A;  5LJ3 g;  4RQE A;  3BFM A;  1ADJ A;  4ZTZ B;  3SWN B;  4M77 A;  1EVK A;  1WPY A;  4WF2 A;  4H2U A;  3HXU A;  2DEQ A;  2ZZE A;  1N9R A;  1EIY B;  4C92 C;  2DU5 A;  4OLF A;  3FIF A;  3JCM P;  1LOJ A;  3EFS A;  5GAO l;  4PJO C;  2QHV A;  1X54 A;  3HY1 A;  1USY C;  3HFO A;  5GAN g;  2DTI A;  2I4N A;  4EMK A;  1B76 A;  3HFZ B;  4BWA A;  1JBM A;  4NOY A;  4P3O A;  5LJ3 f;  5GAN 7;  4P75 C;  2ALY B;  3HRK A;  4YRL A;  4CS2 A;  2QHT A;  4M7A C;  4C92 F;  2QTX A;  1D3B A;  4RQF A;  2C7I A;  5GAM j;  2PME A;  1YFR A;  1H64 1;  1GGM A;  2ZNJ A;  3V8L A;  4C92 D;  1PYS B;  2DKG A;  4HVC A;  3A31 A;  4YP0 A;  4CS4 A;  3BW1 A;  4M7A G;  4TVA B;  2E5A A;  5GAN j;  1E1O A;  3VQY A;  1X56 A;  4PJO D;  2QHS A;  4PNO A;  5LJ3 d;  1QF6 A;  5GAN h;  4M75 C;  4YRQ A;  4YRS A;  1B7Y A;  3JCM J;  1X55 A;  5GAN 4;  3HSB A;  5GMK j;  12AS A;  2EJF A;  4WI1 A;  3A7U A;  4X9D A;  3RKW A;  4M7D G;  2DJZ A;  3FJP A;  4M78 D;  5GAM h;  1I4K 1;  5GAN 8;  3QTC A;  1YFS A;  4HT9 A;  4C8Q E;  4M7A B;  2Q5H A;  3VQV A;  3QNE A;  1H4Q A;  3E9I A;  3JCM X;  5GAN f;  4M78 B;  4XU0 A;  2J3M A;  4EX5 A;  1WLE A;  4TVW A;  2DZC A;  2DVE A;  1E24 A;  2ODR D;  3UGT A;  4C8Q F;  3UFG A;  2ZNI A;  4M77 F;  3QUI A;  3ICA A;  3HFN A;  1PYS A;  5ELN A;  2YLB A;  4KR2 A;  1HTT A;  3G1Z A;  4XTX A;  5LJ5 h;  1B7Y B;  3ERR A;  5GAO m;  3RGL A;  5C53 B;  4H02 A;  3QO3 A;  3MF2 A;  4M77 D;  1IL2 A;  4XTZ A;  4K88 A;  4TQF A;  2ZCE A;  3P8T A;  4YRF A;  1QE0 A;  3V8K A;  2AKW B;  4ZTU B;  5CAI A;  4J6Y A;  2RHS B;  4C8Q A;  2RHQ B;  3TEH A;  3HXX A;  3PGG A;  3PCO B;  3HFZ A;  4CH6 A;  2RM4 A;  4K86 A;  3RAC A;  4JUV A;  4M78 C;  4XTU A;  4JRK A;  2J3L A;  4P71 C;  1USY A;  1W66 A;  1U1T A;  4PHC A;  3W3S A;  4M78 A;  2RB6 A;  4M75 E;  3E9H A;  5LJ5 j;  4UP8 A;  3MF1 A;  4XU3 A;  3A5Z A;  2ZXF A;  4CH3 A;  4PJO F;  3SWN A;  3P8Y A;  4H2X B;  5GAM f;  3NEL A;  3R07 A;  4YRI A;  4O2D A;  3LSS A;  3P8V A;  3JB9 F;  3SWN C;  3JB9 J;  2G4C A;  2VXE A;  1NJ5 A;  1EFW A;  3JCM W;  4RCB A;  4M7D C;  2CJA A;  4YCV A;  3JCM d;  1FYF A;  2DU7 A;  3JCM g;  4XEM A;  1ASY A;  4AH6 A;  3HXY A;  3RKY A;  5C51 B;  3EFR A;  4M7A D;  1NYQ A;  1G5H A;  4P73 A;  2DQ0 A;  1Z7N A;  1H4V B;  4TTV A;  4XTY A;  5GAN 2;  4P73 C;  4JLI A;  4CS3 A;  4X5O A;  5C52 B;  3RUX A;  3L4G A;  4CH5 A;  2ZTG A;  3IKM B;  1LNX A;  4M77 C;  2I2L A;  2CJB A;  1E22 A;  11AS A;  3OD1 A;  4UP9 A;  2C8M A;  2CJ9 A;  1L0W A;  4M78 F;  3UGQ A;  1H4T A;  4M7D B;  4LNS A;  1X2H A;  3RL6 A;  2ZT6 A;  1B70 A;  2P5I A;  2Q7E A;  4C92 B;  4J15 A;  4P3N A;  1WYD A;  1ASZ A;  2I4M A;  5GAM e;  5GMK h;  2CIM A;  1WU7 A;  2E65 A;  2K57 A;  4P74 C;  1YFT A;  2Q5I A;  3V8J A;  4RCC A;  3L1A A;  1KMM A;  2XTI A;  3BY7 A;  5HGQ A;  2RD1 A;  3HXZ A;  3GIB A;  4H2Y A;  5GAN e;  2ARU A;  2ZGW A;  4V2S A;  1HC7 A;  3L4G B;  4XQ3 A;  2DTO A;  2ART A;  3A7R A;  4CH4 A;  1C0A A;  4M7D E;  4YRT A;  4YRJ A;  3I7F A;  4C8Q C;  3REU A;  4N0A A;  5GMK e;  3JCM c;  3A5Y A;  4UPA A;  5F5W A;  1VQZ A;  4C8Q G;  3RF1 A;  3JCM V;  1B70 B;  2FYK A;  1BBU A;  3A74 A;  1B8A A;  4F7U G;  4YRK A;  4RDX A;  4P71 A;  2EL9 A;  3NEM A;  2HNI A;  1LJO A;  4M7D D;  3JB9 G;  2YLC A;  4M75 D;  4J6X A;  1BBW A;  5GMK m;  4M78 G;  3L2Z A;  4XTW A;  4OP0 A;  4DQ2 A;  4H2T A;  1SER A;  4F7U E;  4YRP A;  4P72 A;  2PMF A;  2E10 A;  5GAO p;  2P0L A;  1H4S A;  1JJC B;  4G85 A;  2VXF A;  4J6W A;  3INZ A;  1E1T A;  4UP7 A;  2RHS A;  2Q7H A;  3QHS A;  1NJ6 A;  2AKW A;  3TUP A;  3M4G A;  2YHT A;  1M8V A;  4M7A F;  4YDQ A;  1B34 A;  5LJ3 j;  3SB2 A;  4XU1 A;  1TH7 A;  3QO8 A;  5GMK i;  4P74 A;  3IKL A;  4YRM A;  4QVD A;  5K1X A;  4F7U B;  1NJ1 A;  1N9S A;  4NL2 A;  3TEH B;  4C8Q B;  2RHQ A;  2DQ3 A;  3VBB A;  2ARS A;  1HK9 A;  4HWO A;  1I81 A;  2DZ9 A;  1YCY A;  1EOV A;  4A54 A;  4HA8 A;  3IAL A;  3DSQ A;  4C8Q D;  4PJO A;  2Q7G A;  4YRR A;  3TEG A;  2IY5 A;  2AMC B;  2I4L A;  2E41 A;  3RIR A;  2DDZ A;  2ZT7 A;  4PJO G;  3JCM e;  1I5L A;  4H2X A;  1WQ7 A;  2EWN A;  1SET A;  1Y96 B;  2ZT5 A;  3JCM b;  3A32 A;  4P72 C;  1WQW A;  2DXU A;  4M7A A;  3V7C A;  2DXT A;  2ZIO A;  2E1H A;  1M5Q 1;  2JN0 A;  3HY0 A;  4TWA A;  2ZR3 A;  2ZT8 A;  4M75 F;  4EO4 A;  3JB9 H;  2EAY A;  3BDU A;  4F7U A;  4KR3 A;  2ZIN A;  5LJ5 g;  3PCO A;  4PJO B;  4WJ4 A;  3JCM f;  1NJ2 A;  3M4P A;  4KQE A;  2XGT A;  2FB7 A;  1JRI A;  1ATI A;  3IG2 A;  4YRC A;  2I4O A;  4M75 B;  1NNH A;  1BIB A;  4M7A E;  4MMK A;  1LYL A;  4NCX A;  5GAO r;  4YCU A;  3CMQ A;  4EMG A;  1N9W A;  4M75 A;  5GAO q;  2QHU A;  4M78 E;  1YGB A;  2CGH A;  1Y96 A;  3JB9 I;  3VQW A;  2ZR2 A;  4YCW A;  2RA2 A;  1KQ1 A;  4M75 G;  5I21 A;  3V7S A;  1D3B B;  3JCM h;  1BIA A;  1NYR A;  4TQD A;  4PJO E;  4Y91 A;  2IY5 B;  1B34 B;  4XU2 A;  5GAN 3;  1I8F A;  4TVY A;  3REX A;  4HT8 A;  4H2W A;  1WNL A;  4HWR A;  3FB9 A;  1G5I A;  5GAM d;  3HXV A;  4J5Y A;  4YYE A;  1X01 A;  1EIY A;  2VC8 A;  3KFU A;  3V7R A;  1JJC A;  4E51 A;  2EJ9 A;  2DTH A;  4M77 B;  5GAN 6;  2EJG A;  3RES A;  4EMK B;  3QSU A;  1ADY A;  2E3C A;  4YRE A;  4EMH A;  4F7U F;  4JRI A;  5LJ3 h;  1SES A;  3HFV A;  4YRO A;  3UH0 A;  4M7D F;  1Z7M A;  5GMK l;  2E64 A;  5GAN d;  2AMC A;  4H2S A;  3VU3 C;  3NEN A;  4WJ3 M;  3M4Q A;  4A53 A;  4K87 A;  3A7A A;  3NET A;  3WQZ A;  4P3P A;  3BJU A;  3LSQ A;  4HWT A;  4L87 A;  1EVL A;  4XTV A;  5LJ5 d;  4PG3 A;  4MML A;  5ELO A;  2Y90 A;  3HTZ A;  4TVA A;  4YRG A;  2ALY A;  4ZIB A;  4C92 G;  4NL3 A;  1KQ2 A;  4M77 E;  1YB3 A;  3PZC A;  1G51 A;  3LC0 A;  4N0A C;  3QO7 A;  1MGQ A;  3AHU A;  3VQX A;  4C92 A;  3HXW A;  1KMN A;  4Q15 A;  4YRN A;  5DY9 A;  5LJ5 f;  3MEY A;  3JCM Q;  1KOG A;  4YPF A;  4QVC A;  4BW9 A;  4Q6G A;  4EMK C;  5KNN A;  1J5W A;  1X2G A;  1EQR A;  3QO5 A;  5GAO n;  1NJ8 A;  1RIQ A;  5GAM g;  5GAN 5;  4H2V A;  4P75 A;  5LJ3 e;  2ODR C;  4DPG A;  4HWS A;  4XEO A;  4X9C A;  4M7D A;  5E3I A;  1HXD A;  4G84 A;  5LJ5 e;  4RMF A;  3RKX A;  2ZIM A;  2ZZF A;  4HWP A;  2ZZG A;  1SRY A;  3RER A; 
#chains in the Genus database with same CATH topology
 1YI2 Q;  3CC4 T;  3CD6 A;  5CKB A;  1U1S A;  1M3A A;  5HK0 A;  2PUO B;  4ZTJ A;  3SWN B;  1XNI A;  2XD0 A;  5KYW B;  1WPY A;  3A5Z B;  4WF2 A;  1YHQ Q;  1M90 R;  4H2U A;  2DEQ A;  1SSH A;  2ZZE A;  2DU5 A;  4AG2 C;  3JCM P;  1X27 A;  2LJ1 A;  3EFS A;  5GAO l;  1X54 A;  1X75 C;  1ZA2 B;  1WA7 A;  1M27 C;  2LCL A;  1USY C;  3HFO A;  2GFA A;  2DTI A;  2LT4 A;  1PG5 B;  5FRM A;  4EMK A;  1JXM A;  2LQW A;  1B76 A;  4IIM A;  3HFZ B;  1IHW A;  9ATC B;  1SPK A;  4JDS A;  1OX8 A;  4YRL A;  1ZUK A;  2CS7 A;  1C1A A;  1KQS A;  1YBY A;  3EH2 A;  2QTX A;  1KD1 C;  1H64 1;  2ZNJ A;  3V8L A;  2DKG A;  2KNB B;  2NUZ A;  4YP0 A;  4RTU A;  4CS4 A;  3BW1 A;  2E5A A;  1M2V B;  5GAN j;  1VQ6 A;  4PJM A;  2KR3 A;  1E1O A;  2LP5 A;  5LJ3 d;  1QF6 A;  4LDV A;  3JCM J;  4LD9 K;  2EJF A;  2ZCF B;  1ZSZ C;  4D8K A;  1OX9 A;  2LMJ A;  3A7U A;  4X9D A;  3RKW A;  5J3B A;  5A2Q E;  2PQW A;  2DJZ A;  3M54 A;  4JRP A;  1ZSZ A;  3FJP A;  2PZ1 A;  2DIL A;  3G6E T;  1YWO A;  3QTC A;  3CCR A;  2C06 A;  2AT1 B;  4KUI A;  4J9C A;  5L23 A;  1YFS A;  2M9U A;  2RF0 A;  4X1V A;  2NUT A;  2AZS A;  2JMA A;  2EIF A;  4O5V A;  1PWT A;  2DLP A;  3MEW A;  3JCM X;  2NUT B;  1KQS P;  3EGX B;  1WLE A;  4AFS C;  4PFP A;  2ODR D;  1BU1 A;  4C8Q F;  3CMA Q;  4M77 F;  1OOT A;  3QUI A;  3HFN A;  1PYS A;  2CP2 A;  1V29 B;  3A8G B;  2K3B A;  2YLB A;  1Q82 R;  1HTT A;  3CC7 Q;  4XTX A;  1RAG B;  4E2F B;  1UGS B;  1PCX A;  4TQF A;  2ZCE A;  4J6Y A;  1NZ9 A;  1KD1 U;  2CT4 A;  2RHQ B;  1VQ9 Q;  1SHF A;  4PK4 A;  2EYQ A;  2LX9 A;  3PCO B;  2VVK A;  2QTV A;  4JUV A;  4M78 C;  1QVG P;  2J3L A;  5I2M A;  1X2Q A;  1W66 A;  2DIG A;  2DE0 X;  2K5F A;  4BUG A;  1T3L A;  2QK0 A;  4M78 A;  3E9H A;  3EG1 A;  2IG0 A;  2MF2 A;  4BD3 A;  1QCN A;  2CH4 W;  3O8V A;  2F1L A;  3D7S B;  4XU3 A;  3A5Z A;  3CPF A;  1CSK A;  3KBG A;  4H2X B;  3NEL A;  1Y7X A;  2JM9 A;  4O2D A;  3JB9 J;  2OAW A;  1OI1 A;  2BTT A;  1NJ5 A;  4XAX B;  2QQ9 A;  3GNG A;  3JCM W;  1AWW A;  1X69 A;  1QP3 A;  1FYF A;  3JCM g;  2LZ6 B;  1Q7Y R;  4J7I A;  3RKY A;  1VQ9 A;  1ZA1 B;  5I11 A;  2YRC A;  4BI4 A;  5C51 B;  3HHT B;  4LNP A;  2HKN A;  1NYQ A;  4RG2 A;  3R6O A;  2DQ0 A;  1Z7N A;  4TVR A;  1W4S A;  2WSC E;  4DBH A;  4JLI A;  4CS3 A;  2A8E A;  2VYT A;  2BIV A;  4FM4 B;  4ME7 A;  2ZTG A;  2CJB A;  1RI9 A;  1VQM A;  2QEX A;  2A37 A;  2ZPF B;  3OD1 A;  1NM7 A;  4HCB A;  1X6G A;  2AZV A;  3MJX A;  1QCO A;  2QQR A;  4GLM A;  1IZ6 A;  2YXY A;  3FRN A;  5GJV B;  1T0H A;  1JJ2 A;  1YIT Q;  2DJQ A;  4C92 B;  3ER0 A;  4JS4 A;  1ASZ A;  2XDD A;  2P4R A;  1G3W A;  2E6Z A;  5GAM e;  2E65 A;  2K5I A;  3VS3 A;  2HL5 C;  1YHQ T;  1YFT A;  2FHD A;  2A0F B;  2M02 A;  1JB0 E;  3L1A A;  1M1K R;  2YSQ A;  4ANJ A;  2E12 A;  3BY7 A;  5D6W A;  4B9X A;  2CSI A;  2RD1 A;  3HXZ A;  3L4G B;  1VQ7 Q;  2COZ A;  4XQ3 A;  1YJ9 A;  3A7R A;  1M4Z A;  4FW2 A;  2PVD B;  2L2P A;  5KYN A;  1UFF A;  3REU A;  4OMO A;  3JCM c;  1PM3 A;  1UJY A;  1VQZ A;  2OTL Q;  3JCM V;  1B70 B;  1PKT A;  4YRK A;  5HK3 A;  4HT4 A;  1X2K A;  2LCS A;  2CUD A;  1RAB B;  3NEM A;  5FLX E;  3M0S A;  3OB9 A;  4M75 D;  4J6X A;  1RL2 A;  3CCM T;  2JTM A;  3NFC A;  1BBW A;  2MPX C;  3CCM Q;  3P8H A;  3G71 Q;  1SER A;  4F7U E;  4OMN A;  1UDL A;  4IIO A;  5EG2 A;  3M58 A;  1H4S A;  2KGT A;  3MEA A;  2EQJ A;  1VQN A;  2SEM A;  1VQ5 A;  4J6W A;  3ME9 A;  1E1T A;  2FO0 A;  2HKQ B;  2Q7H A;  2RHS A;  4UP7 A;  1BCO A;  1BB9 A;  2VWF A;  1ZSG A;  3M4G A;  1M8V A;  3M5A A;  3BDL A;  2M0Y A;  2D9T A;  1VQK Q;  3OYD A;  1B34 A;  2AK5 A;  4P74 A;  1MV3 A;  2DNU A;  2ZPB B;  5A0D A;  1Q81 R;  2OJ2 A;  4J9H A;  4RG8 A;  1U06 A;  2EQU A;  3CC7 T;  4F7U B;  4HXJ A;  4KH0 B;  2RHQ A;  3G4S T;  1K0S A;  1HK9 A;  1MMD A;  1NLP C;  1VA7 A;  3CCM A;  1EZZ B;  3PIO A;  3JAM E;  4PFZ A;  1MNE A;  4ORZ A;  3TEG A;  1RAH B;  4JS5 A;  2WSF E;  1O9S A;  3LH5 A;  3L42 A;  3RIR A;  1VQ5 Q;  1H3H A;  2ZT7 A;  4PLL A;  1Y71 A;  4PJO G;  3E2U A;  1U8R A;  2EQM A;  3LYI A;  4II1 A;  3S3M A;  2ZT5 A;  2DA9 A;  4FYY B;  4PKC C;  3REB B;  5IXF A;  4C5G A;  3V7C A;  2DXT A;  4FT2 A;  2E1H A;  2F2W A;  3CME Q;  3HY0 A;  3M0U A;  1YIJ A;  3VS6 A;  1KSW A;  5DM7 R;  2RNA A;  1T3S A;  3OSS C;  1S72 A;  4KR3 A;  2CSQ A;  3M0P A;  5LJ5 g;  2KDS A;  1K9M U;  1T0J A;  4WJ4 A;  1NJ2 A;  4KQE A;  3OSV A;  1VUB A;  2KQW A;  2R5M A;  3IG2 A;  1JRI A;  1PNJ A;  4M75 B;  2H3J A;  2EBP A;  1PKS A;  2QAS A;  4MMK A;  2R5A A;  5GAO r;  4OB0 B;  3CMQ A;  1W70 A;  1M1K C;  2QHU A;  4DEY A;  1VQM T;  3M57 A;  2CGH A;  5CK9 A;  3VQW A;  3EHQ A;  2ZR2 A;  4YCW A;  2K5L A;  4M75 G;  3J81 E;  1UEB A;  5I21 A;  2QG9 B;  3V7S A;  1S1N A;  4HVW A;  4KT0 E;  2ABL A;  2GNC A;  4C5E A;  1YI2 T;  2IY5 B;  3NHN A;  1I8F A;  4TVY A;  2DL8 A;  1WNL A;  3HXV A;  4KGX B;  1X01 A;  2K3Y A;  3KFU A;  4Q5W A;  3V7R A;  3VS2 A;  1VQ8 A;  5KYW A;  4M77 B;  1VQM Q;  4ESR A;  5GAN 6;  3QSU A;  4CI0 C;  3UAT A;  1V1C A;  4EMH A;  2NUP A;  2ZPE B;  3HFV A;  1YP5 A;  2E64 A;  1H8K A;  5GAN d;  3VU3 C;  3NEN A;  4WJ3 M;  1UUE A;  3PMI A;  2K2M A;  2L3Q A;  3BJU A;  4HWT A;  4L87 A;  4PG3 A;  5ELO A;  1K8A U;  3RR6 A;  4TVA A;  3VS5 A;  2A3L A;  3QJY A;  4E6R A;  2ALY A;  3JRZ A;  3VS7 A;  1AWJ A;  2FZC B;  4M77 E;  1YB3 A;  2CP6 A;  2CZ1 B;  5I22 A;  4KGZ B;  2ENM A;  4C92 A;  3M55 A;  4Q15 A;  3EG3 A;  5DY9 A;  2X3W D;  3P8B B;  1ZQ1 A;  1VQL Q;  4Q6G A;  2EW3 A;  2XDB A;  1N6A A;  5KNN A;  3L2V A;  1OEB A;  1NJ8 A;  3X25 B;  2WAC A;  5GAM g;  1RIQ A;  2DXC A;  4RMO A;  2OTL T;  4HWS A;  3QKJ A;  4A4H A;  2A7Y A;  4M7D A;  5E3I A;  2QA4 Q;  5LJ5 e;  2JT4 A;  2V1R A;  2HD0 A;  4RMF A;  3CPW A;  3RKX A;  1Q81 U;  4HCZ A;  2ZIM A;  2ZZF A;  2MK5 A;  4J9E A;  4JJN K;  2KXC A;  3OY9 A;  1YJ9 Q;  4ZN3 A;  3NTH A;  1QP2 A;  4M77 G;  3JB9 D;  1RAE B;  1Z9Z A;  1QVF S;  2F69 A;  3HRI A;  1VYV A;  2LVM A;  2C0O A;  1ADJ A;  2KBT A;  3CCV Q;  4J9B A;  3HXU A;  2EYY A;  2K7A A;  1YIT A;  1AVZ C;  2AKK A;  3QDF A;  4BY6 C;  2QHV A;  4EPC A;  2IIM A;  2CP7 A;  4JJB A;  2X4J A;  4LXC A;  1J3T A;  4KH1 B;  5GAN g;  2I4N A;  2D8J A;  5FWC A;  1VYU A;  4P3O A;  2HZY A;  5GAN 7;  1OV3 A;  4E7H A;  2ED1 A;  3UA6 A;  5IAY A;  4CS2 A;  1QW1 A;  3TU4 K;  2QGG A;  3CC2 A;  2A08 A;  2L3R A;  4RQF A;  1YFR A;  3VV0 A;  2ZPI B;  1OQK A;  1W2B S;  2GQV A;  3VYH B;  3A31 A;  1P92 A;  2EGC A;  1VQN Q;  4J83 A;  3C4S A;  1K76 A;  1PC0 A;  3E1S A;  4LD6 A;  3L2U A;  2JW4 A;  1FXX A;  2QHS A;  2KRS A;  1OZ3 A;  4CC2 A;  1IRE B;  2FPE A;  5A0G A;  3I55 T;  3H0F A;  4BB7 A;  2RHU A;  1AWX A;  3G7Z A;  4M7D G;  1ZSZ B;  3H9N A;  3CCQ A;  3E9G A;  1I4K 1;  5GAN 8;  2YUQ A;  3CXC P;  4HT9 A;  4HCK A;  3QNE A;  1H4Q A;  4HVU A;  2ZAE A;  5GAN f;  4XU0 A;  4EX5 A;  4Z88 A;  2GF7 A;  4C5I A;  1E24 A;  1ARK A;  4F16 A;  3UGT A;  3QYH B;  4AFQ C;  3UFG A;  2O9V A;  1X6O A;  2DL5 A;  1S72 Q;  4XK8 E;  1V76 A;  2F5T X;  1X43 A;  4EDU A;  1TUD A;  3MP8 A;  2JJ9 A;  5GAO m;  1UEC A;  1YJN A;  4H02 A;  2ATC B;  1IL2 A;  1UHF A;  1NE8 A;  1Q86 U;  1MND A;  4ELZ C;  3CC2 T;  2J06 A;  1QE0 A;  4ZTU B;  5CAI A;  3L2W A;  3CBM A;  4CH6 A;  1NJI R;  5KYX A;  1YWP A;  2NS6 A;  2GGR A;  4JRK A;  1KG1 A;  1GXI E;  3PMT A;  4QQ6 A;  3ZBD A;  3W3S A;  2C0T A;  3H0H A;  5LJ5 j;  1VQ4 A;  3MF1 A;  2ECZ A;  4WTO B;  3HRS A;  2ZXF A;  1NYG A;  4PJO F;  5KCO A;  3P8Y A;  5GAM f;  4R55 A;  1BYM A;  3P8V A;  1G3S A;  1JU5 C;  3JB9 F;  2L3P A;  1K73 C;  4QQD A;  2VXE A;  4ATO A;  2G4C A;  1EFW A;  3RDV A;  1B07 A;  4M7D C;  2CJA A;  1QVF P;  2KRN A;  1W2B A;  2DU7 A;  3H41 A;  3HXY A;  1WXT A;  3OYL A;  3ASK A;  3OA6 A;  1NPP A;  5KH6 A;  1G5H A;  3G4S Q;  4BDZ A;  2LNH B;  2GCX A;  1H4V B;  4TTV A;  5KCH A;  2MI6 A;  1WLP B;  1MMN A;  2ZPG B;  1ZUU A;  4X34 A;  2NLU A;  1WHL A;  2DBM A;  1VQP A;  2QGF B;  1N8R U;  3L4G A;  3IKM B;  1LNX A;  2I2L A;  3UDC A;  4E7S A;  1E22 A;  11AS A;  2DVJ A;  1VQO T;  1CKA A;  3I56 A;  1BI3 A;  4UP9 A;  2RJE A;  1RI0 A;  3QWX X;  3NGP A;  1H4T A;  1UGP B;  3QYG B;  4LNS A;  3E9F A;  1VQO A;  2HBW A;  2KYM A;  1M2O A;  4J15 A;  4P3N A;  4NS5 A;  2IPO B;  1WU7 A;  4MDW A;  1R8O B;  2Q5I A;  3V8J A;  2HBP A;  2PUK B;  5CKF A;  3OS2 A;  1BBZ A;  1M90 U;  1AZE A;  4H2Y A;  5GAN e;  2ARU A;  3PIP A;  1HC7 A;  1XJW B;  2VV5 A;  2DET A;  2ART A;  5FW9 A;  4RTZ A;  4C8Q C;  1AZG B;  4N0A A;  4B9W A;  3M53 A;  1VQ8 Q;  2KVQ G;  5ECA A;  5F5W A;  1ZHI A;  3S3O A;  4C8Q G;  3EG9 B;  4VUB A;  2FYK A;  1YJW A;  1K1Z A;  2EL9 A;  1K0X A;  1NG2 A;  1ZUY A;  1YHQ A;  1TS9 A;  4BI8 B;  1LJO A;  4M7D D;  1VIE A;  2YLC A;  3LWI A;  4C0G A;  1OZ2 A;  1U3O A;  5GMK m;  4H2T A;  4P72 A;  1N8R C;  2J6F A;  4DBR A;  1OUL A;  3CCS T;  1NJ6 A;  2AKW A;  2YHT A;  3MKD A;  2BE7 D;  1RLQ C;  2LQK A;  4XU1 A;  5GMK i;  1D0Z A;  2OTJ Q;  3OS5 A;  1MV0 B;  4J9G A;  4WCI A;  2X4X A;  1I07 A;  3TEH B;  2K9G A;  1M90 C;  4KBM B;  4DEX A;  5KE3 A;  3QG1 A;  2XG8 D;  2VGN A;  4AT1 B;  1IB8 A;  5FU7 C;  4A54 A;  4C5H A;  3ZFJ A;  3IAL A;  1Q86 R;  1QWF A;  1WXB A;  2MOX A;  2Q7G A;  4YRR A;  1VQ6 T;  1GL5 A;  1GBR A;  2IY5 A;  4LVL A;  2ZZD A;  2OTL A;  2AMC B;  2FVU A;  4RKU E;  4FIB A;  1O75 A;  2RHZ A;  2DDZ A;  3S6W A;  1E6H A;  1QLY A;  2K2V A;  4LVJ A;  1R0B G;  1LVK A;  2LQ8 A;  2CP5 A;  2EWN A;  5CR2 A;  4OMP A;  1Z9Q A;  2DXU A;  2LQN A;  3TRE A;  1KD1 R;  1M2V A;  3FEO A;  1M5Q 1;  4OMM A;  2JN0 A;  4TWA A;  1NLO C;  1TG0 A;  4M75 F;  2LX7 A;  2ESW A;  3VUZ A;  4EO4 A;  3JB9 H;  3OBY A;  2EAY A;  2NYS A;  2ZIN A;  3TSW A;  3M4P A;  2MCN A;  1ATI A;  2MWP A;  2P0P A;  2I4O A;  1EIF A;  4E7J A;  2P0K A;  4LDU A;  2LTO A;  1LYL A;  3C0C A;  4YCU A;  1NEG A;  2EGA A;  5IH2 A;  4M78 E;  1C6V X;  3CCQ Q;  1Y96 A;  3JB9 I;  4FSS A;  1JQQ A;  1GRI A;  2RA2 A;  3X26 B;  1VQN T;  4ELY C;  4LVM A;  5AYF A;  1BI2 A;  3JCM h;  3CBP A;  5HY6 A;  4PJO E;  1B34 B;  2V8K A;  2YWW A;  1Y07 A;  4XU2 A;  2M16 A;  4QW2 A;  5KYU A;  4LUD A;  3F70 A;  4HWR A;  1G5I A;  4PJJ A;  3M4Y A;  2FPD A;  1SRL A;  2L89 A;  3QZ5 B;  1WHM A;  1JJ2 S;  3VS1 A;  7AT1 B;  2E3C A;  4C0Z A;  1FMK A;  4F7U F;  4JRI A;  5LJ3 h;  2YUN A;  1Q7Y C;  5GMK l;  2FPF A;  4H2S A;  1HYO A;  5C6S A;  1PHT A;  1UJ0 A;  4ZGD B;  3CD6 Q;  3NET A;  3CD6 T;  3CCE A;  2ZPH B;  1KHI A;  1TUC A;  3HL8 A;  3G71 A;  3HTZ A;  2DL7 A;  3OYJ A;  2MWO A;  2RN8 A;  2DK3 A;  4NL3 A;  1KQ2 A;  5A0L A;  2E70 A;  4HCC A;  2GBQ A;  4N0A C;  3URG A;  2RJD A;  4LE9 A;  3EGU A;  5IXB A;  4FYW B;  1GCP A;  5LJ5 f;  2L8D A;  3MEY A;  2F2X A;  4QVC A;  2E5Q A;  1YJW T;  1JEG A;  1WXU A;  3UF4 A;  1UHC A;  2VKN A;  5GAO n;  1KFZ A;  3TEE A;  4DA4 A;  5GAN 5;  1KIK A;  4H2V A;  4P75 A;  2X4Y A;  2H8H A;  3PTA A;  1YI2 A;  2Y4X A;  1U5S A;  4F17 A;  3I55 A;  2R58 A;  4OGC A;  4XEO A;  2LJ0 A;  3I35 A;  5D6Y A;  4X9C A;  1ABO A;  2KXD A;  2IVW A;  4P5N A;  1BCM A;  1BK2 A;  1E7O A;  1RUW A;  3I56 Q;  2JTE A;  1Q7Y U;  2CUB A;  2RHY A;  3PNW C;  1UGR B;  2ZZG A;  3RER A;  3EHR A;  2ROT A;  2DX1 A;  4C92 E;  5K1P A;  1UGQ B;  2XHC A;  2K4Y A;  5LJ3 g;  3BFM A;  1E6G A;  2RI5 A;  4M77 A;  1EVK A;  4MZT A;  4PJN A;  1SG5 A;  2EFI A;  1EIY B;  1N9R A;  4C92 C;  3FIF A;  3VUB A;  3NTK A;  1M1F A;  1K9A A;  2CKK A;  2DPP B;  3JSC A;  3QJ6 A;  3ZL7 C;  2LCC A;  1JBM A;  2COY A;  1GCQ C;  4NOY A;  4JJD A;  4BE1 A;  2ALY B;  3QBY A;  3LWH A;  2QHT A;  1Q95 G;  1AOJ A;  3G1J A;  1QKW A;  1D3B A;  2C7I A;  1VQL A;  2L5Q A;  3OYA A;  2PME A;  1YJN T;  4JPB W;  2G3R A;  1YJ9 T;  4C92 D;  4YTL A;  1VQ4 T;  1YFN A;  1PYS B;  2KE9 A;  2QA4 T;  4A63 B;  3U23 A;  1KJW A;  1QVF A;  3CME T;  4PJO D;  4PNO A;  1D1A A;  5GAN h;  2MAM A;  1M3C A;  1TXQ A;  4BE2 A;  1X55 A;  2KEA A;  5GAN 4;  3HSB A;  12AS A;  1YNZ A;  1WX6 A;  2V8J A;  3M0Q A;  2QDY B;  3MP6 A;  3QZ9 B;  4M78 D;  1PRL C;  1R77 A;  2JVV A;  3WXM B;  4C8Q E;  5EC7 A;  4E7K A;  2Q5H A;  5HCK A;  4KUD K;  4KRT A;  3OQ5 A;  1M9S A;  3CC4 Q;  5CKD A;  3E9I A;  3PE0 A;  4M78 B;  1ABQ A;  2J3M A;  3EAE A;  4PJL A;  4TVW A;  2DZC A;  2DVE A;  5CCA A;  1TSF A;  2GTO A;  4AFU C;  1YIJ Q;  3ICA A;  1B7T A;  5ELN A;  4KGV B;  1QWE A;  4KR2 A;  2KT8 A;  3G1Z A;  3M9Q A;  5LJ5 h;  1G2B A;  3QO3 A;  3TQ7 P;  4XTZ A;  4K88 A;  3OYH A;  1FX7 A;  4YRF A;  5AT1 B;  3V8K A;  2AKW B;  3RMS A;  2DD5 A;  2RHS B;  4C8Q A;  1X6B A;  3MQZ A;  3HXX A;  3PGG A;  1OPK A;  2WSE E;  3OYC A;  1K73 R;  3OBW A;  3HTR A;  2BKD N;  5CO7 A;  3RAC A;  3RBB B;  2M51 A;  4XTU A;  3H6Z A;  5CIU A;  3MET A;  4IUV A;  4RTV A;  1Q82 C;  1WGS A;  1VOM A;  2QXF A;  1U1T A;  4BDY A;  3CXC S;  1VQ7 A;  2D0Q B;  4M75 E;  2J05 A;  3OYY A;  4AFZ C;  3CCU A;  3CCU Q;  5D6X A;  3TVT A;  3VYG A;  3DLL A;  4R56 A;  2BUD A;  3R07 A;  4YRI A;  5CKH A;  3PFS A;  2RMO A;  3SEM A;  1WFW A;  2O2O A;  3JCM d;  1IO6 A;  1CKB A;  4XEM A;  2HDA A;  1C0M A;  1K9M R;  5J26 A;  3G6E Q;  4QKU A;  1RAA B;  2P4T A;  2PVO B;  3EFR A;  4OMQ A;  1K4U S;  4IUR A;  4P73 A;  4CC4 B;  2VAS A;  4XTY A;  5CKE A;  4P73 C;  2RH2 A;  4GY5 A;  5C52 B;  4X5O A;  3QWY A;  2EGE A;  2F5K A;  4CH5 A;  3I9Q A;  4M77 C;  1PD1 A;  2OAU A;  2P84 A;  1IGU A;  1RAF B;  2YRD A;  1VQ5 T;  3RNJ A;  3SFM A;  2CJ9 A;  4M78 F;  4BI3 A;  4J9D A;  4N4H A;  1VQK A;  2QI2 A;  3SD4 A;  2QEX T;  1M30 A;  1B70 A;  3VRZ A;  1Q82 U;  1H3Z A;  4OB3 B;  1WYD A;  3QII A;  3MP1 A;  2RQU A;  2RI3 A;  2I4M A;  2KRO A;  4OVA A;  5L8R E;  3VKI A;  1F1B B;  1GCQ A;  2K57 A;  3FLG A;  2HMA A;  4Y28 E;  3UWN A;  1KMM A;  3LX7 A;  2YRV A;  2LNV A;  3DKM A;  4OB1 B;  4LVK A;  1LCK A;  3J7A F;  2ZGW A;  4V2S A;  1JO8 A;  2AHJ B;  1EFN A;  4CH4 A;  2QDL A;  4YRT A;  5GJW B;  4YRJ A;  3I7F A;  2QQA A;  1LPL A;  4ZGE B;  3IQL A;  6AT1 B;  3Q1J A;  3RF1 A;  3EFO A;  1BBU A;  2FEI A;  1B8A A;  2KI7 A;  2CRE A;  3CCV A;  4RDX A;  2CP0 A;  4P71 A;  1JXO A;  2XKO C;  2CH4 A;  2HNI A;  1IHV A;  4RTT A;  4M78 G;  3L2Z A;  4XTW A;  2PVG B;  4YRP A;  1QVG A;  4ZNX A;  5I2S A;  2YDL A;  5GAO p;  2L3S A;  4FYX B;  1OYX A;  3JV3 A;  4LN2 A;  1JJC B;  2VXF A;  4AMC A;  3CCE T;  1K9M C;  1D1C A;  1UG1 A;  4M7A F;  4YDQ A;  5LJ3 j;  2E4H A;  1RAI B;  2SRC A;  1TH7 A;  3QO8 A;  4HVV A;  2EKH A;  2QEX Q;  3LH0 A;  4QVD A;  5K1X A;  4PLI A;  5IN1 A;  2RJF A;  1N9S A;  4NL2 A;  1PD0 A;  2EYW A;  4Z8A A;  2W10 A;  4C8Q B;  2EVR A;  4CRI A;  4E47 A;  4PL6 A;  3I56 T;  1QVG S;  2DQ3 A;  2AIR B;  2XI9 A;  1YIJ T;  4F04 B;  1I81 A;  2DZ9 A;  1YCY A;  4B6M A;  1KK7 A;  1EOV A;  4Z02 A;  3NMZ C;  4C8Q D;  4PJO A;  5J39 A;  2I4L A;  2P0Q A;  1TWB A;  4JZ4 A;  1AEY A;  3X20 B;  1AD5 A;  3OYN A;  4H2X A;  4OB2 B;  2M0O A;  1TOV A;  1Y96 B;  4FT4 A;  3JCM b;  3A32 A;  3EG0 A;  3MCA B;  4P72 C;  1NPR A;  1WQW A;  3CQT A;  4M7A A;  4ZN1 A;  2ZIO A;  1BKB A;  3CPW P;  2ZR3 A;  2JUF A;  3CMA A;  2D1X A;  3M59 A;  1FMW A;  4RTX A;  3BDU A;  3G4S A;  4F7U A;  1UE9 A;  2X35 A;  2DD4 A;  3CCU T;  3R6N A;  3JCM f;  1VQ8 T;  3LLR A;  4MZP A;  3KUF A;  4IUP A;  5IHI A;  1BIB A;  1BI1 A;  4M7A E;  1NJI C;  4FU6 A;  4NCX A;  1SKU B;  3HP9 A;  2Z0W A;  4M75 A;  2X9H A;  4J8O A;  2JMC A;  4LDY A;  2EQK A;  3OS0 A;  1KQ1 A;  4DBQ A;  2M1H A;  3O5Z A;  5GAN 3;  3REX A;  4ZGJ B;  4C0D B;  3FB9 A;  4J5Y A;  4YYE A;  2VC8 A;  1SHG A;  1G3Y A;  1JJC A;  4IUU A;  4E51 A;  2DTH A;  1ZBX A;  1IGQ A;  4EMK B;  2V8I A;  1ADY A;  2CZ7 B;  1M3B A;  4C0F A;  4YRE A;  2L0A A;  1WIE A;  3UH0 A;  4L59 A;  4M7D F;  2BE9 B;  2GFU A;  2GQI A;  2K79 A;  4A53 A;  3EGD B;  4OGE A;  2XIC A;  4DOW A;  3CCL A;  2NWM A;  4UC4 A;  3LSQ A;  3OYI A;  1EVL A;  5LJ5 d;  2GTJ A;  4MML A;  4JLG A;  4Z89 A;  2E6N A;  2C0I A;  2RK1 A;  4YRG A;  1N5Z A;  4ZIB A;  4PFO A;  1MUZ A;  3WVE B;  3PZC A;  1VQ6 Q;  1G51 A;  3LC0 A;  3VQX A;  2D0N A;  3HXW A;  1KMN A;  4YRN A;  3MPU B;  1NJI U;  1KOG A;  3SHW A;  1Y0M A;  4J9I A;  1M1K U;  4EMK C;  1AWO A;  1UTI A;  1X2G A;  1QCF A;  3WVD B;  1EQR A;  3QO5 A;  4QQG A;  2J7I A;  2RPN A;  2AKL A;  5FU6 C;  2BZX A;  4N4I A;  4DPG A;  5LL6 S;  4BAC A;  4AG1 C;  2KMT A;  1OU8 A;  1SSF A;  4G84 A;  1N8R R;  4FYV B;  5CQX A;  4FL6 A;  3PVQ A;  2XU8 A;  3OYF A;  3NTI A;  3J80 E;  2F2V A;  1N27 A;  3UT1 A;  2FZG B;  3CXC A;  1NBE B;  3X28 B;  3HRT A;  2XDP A;  2BZ8 A;  3CBO A;  2LC4 A;  4QVZ A;  3CCR Q;  1M8M A;  3OW2 A;  4F14 A;  3UA7 A;  2HSE B;  1SRY A;  1R0C B;  3GF5 A;  2DXB A;  3CC2 Q;  3GOX A;  3CCE Q;  2VGM A;  1WHG A;  4RQE A;  1K8A C;  4A4G A;  4ZTZ B;  1NEB A;  2PU9 B;  4C0D C;  4J7F A;  1VQP T;  3TCJ A;  4OLF A;  5KYU B;  5IHN A;  1TTH B;  4IKF A;  3LGF A;  1LOJ A;  2J6O A;  3CCJ Q;  4PJO C;  2O01 E;  2BZY A;  4D8D A;  1KHC A;  2Y4Y A;  4IUT A;  2JZ2 A;  2QA4 A;  3REA B;  3HY1 A;  2A28 A;  3OMC A;  2NUP B;  1HD3 A;  3GBQ A;  2FZK B;  2QYZ A;  2JS2 A;  2LJ3 A;  4BWA A;  5LJ3 f;  2HEQ A;  4P75 C;  3A8H B;  3HRK A;  2CP3 A;  5FRN A;  4M7A C;  2J6K A;  4C92 F;  1Q86 C;  2JM8 A;  2D8H A;  2EQI A;  1UGV A;  5GAM j;  3C95 A;  1VYT A;  1GGM A;  1WJR A;  2RK2 A;  8AT1 B;  2DFU A;  4LVI A;  4HVC A;  2RHI A;  1Q81 C;  4IUQ A;  3A8O B;  4M7A G;  4TVA B;  3PT9 A;  3VQY A;  1X56 A;  3I5S A;  3GLX A;  3GPL A;  3CCL T;  3OYG A;  3E19 A;  4M75 C;  4YRQ A;  4YRS A;  1B7Y A;  1XOV A;  5GMK j;  4WI1 A;  5FU6 B;  1TU0 B;  2XK0 A;  3EG2 A;  1WHK A;  4JRQ A;  5GAM h;  2D6F A;  4LDX A;  3EGX A;  1VQO Q;  4BE0 A;  4LDW A;  4M7A B;  2V1Q A;  5M9O A;  3VQV A;  4FSX A;  3CMA T;  3OYK A;  1HJD A;  1WI7 A;  2DRM A;  2COW A;  2H3E B;  3CCJ T;  3CCV T;  2ZNI A;  2HAX A;  1XQH A;  1W1F A;  1B7Y B;  1G83 A;  3ERR A;  3RGL A;  5C53 B;  1YJN Q;  3RMQ A;  3MF2 A;  4LUE A;  2ED0 A;  4M77 D;  2EPD A;  1KC8 U;  1G3T A;  3A98 A;  1A0N B;  4ZTF A;  3P8T A;  3HPW A;  5IHK A;  2DRK A;  3TEH A;  2VB6 A;  2MMP A;  2FL7 A;  3HFZ A;  2G6F X;  2RM4 A;  1TUG B;  5IT9 E;  4K86 A;  3LW5 E;  1NYF A;  2CZ6 B;  2JS0 A;  2RQV A;  2FG0 A;  4P71 C;  1USY A;  3S3N A;  8ATC B;  4PHC A;  2RB6 A;  3CCR T;  3M0R A;  4GLK A;  4UP8 A;  1HSQ A;  2KRM A;  2X4W A;  3OW2 S;  3VRY A;  2QQB A;  4CH3 A;  3SWN A;  2A36 A;  4K11 A;  4M4Z A;  3LSS A;  2DF6 A;  3SWN C;  2I0N A;  4EIK A;  4RCB A;  1VIF A;  4YCV A;  5HKC A;  1WYX A;  1ASY A;  4AH6 A;  4RTY A;  1VQK T;  2FRY A;  2RI2 A;  4N4G A;  2DYI A;  3A1P A;  3MHX A;  2X51 A;  4M7A D;  3VS4 A;  3EFO B;  2DEU A;  2RQW A;  1FMV A;  3G71 T;  2K6D A;  5GAN 2;  1M1G A;  1KC8 C;  3RUX A;  2JNG A;  1WJQ A;  2ROL A;  1ZBJ A;  5FWB A;  2QAZ A;  1ACM B;  3UPU A;  2C8M A;  1L0W A;  4QT7 A;  3A8M B;  3G6E A;  1GFD A;  3UGQ A;  4M7D B;  3NPF A;  1H92 A;  3AT1 B;  1X2H A;  2DER A;  3RL6 A;  2ZT6 A;  2LRQ A;  2P5I A;  2Q7E A;  1B3Q A;  4BY6 B;  3H0I A;  3P8D A;  5GMK h;  2CIM A;  4L5G A;  3H8Z A;  1W2B P;  1G5V A;  4P74 C;  1VQP Q;  4OF1 A;  1K8A R;  2XMF A;  4RCC A;  2CYZ B;  2XTI A;  3SDZ A;  2OTJ T;  5HGQ A;  3GIB A;  1MMA A;  1JJ2 P;  1QMC A;  2X3X D;  4CC3 A;  2EYZ A;  2DTO A;  1K73 U;  3X24 B;  1C0A A;  2RHX A;  1YCS B;  4M7D E;  1SRM A;  1I0C A;  5GMK e;  3A5Y A;  4J9F A;  4UPA A;  2RO0 A;  3TSZ A;  1I5O B;  3A74 A;  4F7U G;  2K3X A;  3CEY A;  1XTD A;  3JB9 G;  4RTW A;  1SEM A;  2EYX A;  3C12 A;  3OS1 A;  3EGD A;  1OU9 A;  1ZLM A;  3CC7 A;  4HKE A;  4OP0 A;  4DQ2 A;  2PMF A;  1FYN A;  2E10 A;  2PNI A;  2P0L A;  5CQY A;  4KUL A;  2KT1 A;  4G85 A;  4E7I A;  1S72 T;  3INZ A;  3QHS A;  2HCK A;  3TUP A;  1GFC A;  2DBK A;  4L6V 5;  3CPW S;  3SB2 A;  2RQR A;  3C94 A;  3CC4 A;  3IKL A;  2B86 A;  1WHJ A;  4YRM A;  2FRW A;  1SF9 A;  1NJ1 A;  1KC8 R;  2KSS A;  2MYS A;  4JJC A;  1AHJ B;  3VBB A;  2DL4 A;  2ARS A;  2LT1 A;  3M0T A;  2KK4 A;  4HWO A;  1WDX A;  3DB3 A;  1MMG A;  2DO3 A;  5KYY B;  2RQT A;  2O9S A;  3QPH A;  1ZX6 A;  4HA8 A;  3DSQ A;  2LDM A;  1OPL A;  2RJC A;  2CDT A;  2E41 A;  4RUG A;  2DMO A;  1YJW Q;  3I5R A;  3LGL A;  3ZEH A;  5FRO A;  4OMF B;  3VJP A;  5KYX B;  3JCM e;  1I5L A;  4MDX A;  1VQ9 T;  1W6X A;  1WQ7 A;  1SET A;  1VQL T;  1YN8 A;  1RAC B;  1WJS A;  2XID A;  4JZ3 A;  3A8L B;  3MO8 A;  2HQE A;  1BI0 A;  5CVI A;  4DOV A;  2ZT8 A;  5D7U A;  4D6W A;  2CT3 A;  3CCS A;  1WZO A;  3PCO A;  1D1B A;  2MIO A;  5FU7 B;  4PJO B;  3FDR A;  2E5K A;  2XGT A;  2O88 A;  2FB7 A;  2PTK A;  4YRC A;  2DYB A;  1NNH A;  1MHN A;  1Y57 A;  2E3I A;  1EX4 A;  1YIT T;  2QQS A;  4EMG A;  1FWZ A;  5DLQ E;  3OYB A;  3I55 Q;  5GAO q;  1N9W A;  1RLP C;  1YGB A;  5C0M A;  2JXB A;  4O6J A;  3CME A;  1PSE A;  2E3H A;  2OI3 A;  1PSF A;  4R0K A;  2HSP A;  3M56 A;  2DL3 A;  2EKO A;  1D3B B;  1BIA A;  4A4E A;  1NYR A;  4TQD A;  4FCY A;  4A4F A;  1GBQ A;  2V26 A;  2JTF A;  4Y91 A;  3GNF B;  3QDR B;  3ULR B;  3DLM A;  2YT6 A;  4CC7 A;  2YUO A;  4HT8 A;  4H2W A;  4FW1 A;  5GAM d;  1EIY A;  4DBF A;  5KYY A;  3FJ5 A;  2EJ9 A;  1D0X A;  3EH1 A;  3CCS Q;  2R57 A;  1G8X A;  2EJG A;  3RES A;  2DM1 A;  3THK A;  4YRO A;  1SES A;  2VUB A;  1Z7M A;  1QKX A;  2DAQ A;  3OYE A;  3DB4 A;  2AMC A;  3MEV A;  1IRX A;  3HKS A;  2O31 A;  4A4K A;  3M4Q A;  2KY9 A;  3FC3 A;  4K87 A;  1WHH A;  3A7A A;  1D0Y A;  1DJ7 B;  3WQZ A;  4P3P A;  1I1J A;  3L2R A;  3OYM A;  4XTV A;  1KQS S;  2Y90 A;  3BE3 A;  5KE2 A;  1VQ4 Q;  3L2Q A;  4C92 G;  4Y92 A;  3KXT A;  3CCJ A;  4E7L A;  2KYB A;  5DLO A;  2CZ0 B;  3HRU A;  3MEU A;  3QO7 A;  1MGQ A;  3PVL A;  3N5B B;  4GBQ A;  3AHU A;  2OX7 A;  2B8A A;  2DIQ A;  2HL3 A;  2O4X A;  3JCM Q;  4YPF A;  4BW9 A;  4OML A;  2KAF A;  2HQH A;  1D09 B;  4E7Z A;  1QVP A;  2YUP A;  1IXD A;  1J5W A;  1RAD B;  1QQJ A;  1AT1 B;  4MZM A;  3CCL Q;  5LJ3 e;  3QXE B;  3EG9 A;  3VS0 A;  1VQ7 T;  2ODR C;  2OTJ A;  1UB4 A;  1HXD A;  3KFV A;  2W0Z A;  2HQX A;  3T9N A;  3OW2 P;  2O4X B;  1PRM C;  3GP8 A;  4HWP A;  3CCQ T;  2JOY A;  3OMG A; 
#chains in the Genus database with same CATH homology
 3CC4 T;  3CD6 A;  5CKB A;  1U1S A;  5HK0 A;  2PUO B;  4ZTJ A;  3SWN B;  1XNI A;  2XD0 A;  1WPY A;  3A5Z B;  4WF2 A;  4H2U A;  2DEQ A;  2ZZE A;  2DU5 A;  3JCM P;  3EFS A;  5GAO l;  1X54 A;  1X75 C;  2LCL A;  1USY C;  3HFO A;  2GFA A;  2DTI A;  2LT4 A;  5FRM A;  4EMK A;  1B76 A;  3HFZ B;  4JDS A;  4YRL A;  2CS7 A;  1KQS A;  1YBY A;  2QTX A;  1KD1 C;  1H64 1;  2ZNJ A;  3V8L A;  2DKG A;  4YP0 A;  4CS4 A;  3BW1 A;  2E5A A;  5GAN j;  1VQ6 A;  1E1O A;  5LJ3 d;  1QF6 A;  4LDV A;  3JCM J;  4LD9 K;  2EJF A;  2ZCF B;  3A7U A;  4X9D A;  3RKW A;  5J3B A;  5A2Q E;  2PQW A;  2DJZ A;  3M54 A;  4JRP A;  3FJP A;  3G6E T;  3QTC A;  3CCR A;  2C06 A;  4KUI A;  1YFS A;  2M9U A;  2EIF A;  4O5V A;  3MEW A;  3JCM X;  1WLE A;  2ODR D;  4C8Q F;  4M77 F;  3QUI A;  3HFN A;  1PYS A;  1V29 B;  3A8G B;  2YLB A;  1HTT A;  4XTX A;  1UGS B;  4TQF A;  2ZCE A;  4J6Y A;  1NZ9 A;  1KD1 U;  2RHQ B;  3PCO B;  2EYQ A;  2LX9 A;  4JUV A;  4M78 C;  2J3L A;  5I2M A;  1W66 A;  2DIG A;  2K5F A;  4BUG A;  4M78 A;  3E9H A;  2IG0 A;  2MF2 A;  4BD3 A;  3O8V A;  4XU3 A;  3A5Z A;  3CPF A;  3KBG A;  4H2X B;  3NEL A;  1Y7X A;  4O2D A;  3JB9 J;  1OI1 A;  1NJ5 A;  4XAX B;  2QQ9 A;  3GNG A;  3JCM W;  1QP3 A;  1FYF A;  3JCM g;  4J7I A;  3RKY A;  1VQ9 A;  4BI4 A;  5C51 B;  3HHT B;  1NYQ A;  4RG2 A;  3R6O A;  2DQ0 A;  1Z7N A;  4TVR A;  1W4S A;  2WSC E;  4JLI A;  4CS3 A;  2A8E A;  2VYT A;  2BIV A;  4FM4 B;  4ME7 A;  2ZTG A;  2CJB A;  1VQM A;  2QEX A;  2ZPF B;  3OD1 A;  4HCB A;  2QQR A;  1IZ6 A;  3FRN A;  1JJ2 A;  4C92 B;  3ER0 A;  4JS4 A;  1ASZ A;  2XDD A;  5GAM e;  1G3W A;  2E6Z A;  2E65 A;  2K5I A;  1YHQ T;  1YFT A;  2FHD A;  1JB0 E;  3L1A A;  2E12 A;  3BY7 A;  5D6W A;  4B9X A;  2RD1 A;  3HXZ A;  3L4G B;  4XQ3 A;  1YJ9 A;  3A7R A;  1M4Z A;  2PVD B;  3REU A;  3JCM c;  1VQZ A;  3JCM V;  1B70 B;  4YRK A;  5HK3 A;  4HT4 A;  3NEM A;  5FLX E;  3OB9 A;  4M75 D;  4J6X A;  1RL2 A;  3CCM T;  2JTM A;  3NFC A;  1BBW A;  3P8H A;  1SER A;  4F7U E;  5EG2 A;  3M58 A;  1H4S A;  3MEA A;  2EQJ A;  1VQN A;  1VQ5 A;  4J6W A;  3ME9 A;  1E1T A;  4UP7 A;  2RHS A;  2Q7H A;  3M4G A;  1M8V A;  3M5A A;  3BDL A;  2D9T A;  3OYD A;  1B34 A;  4P74 A;  2ZPB B;  5A0D A;  4RG8 A;  2EQU A;  3CC7 T;  4F7U B;  2RHQ A;  3G4S T;  1HK9 A;  3CCM A;  3PIO A;  3JAM E;  3TEG A;  4JS5 A;  2WSF E;  1O9S A;  3L42 A;  3RIR A;  2ZT7 A;  4PLL A;  1Y71 A;  4PJO G;  1U8R A;  2EQM A;  3LYI A;  4II1 A;  3S3M A;  2ZT5 A;  4PKC C;  4C5G A;  3V7C A;  2DXT A;  4FT2 A;  2E1H A;  3HY0 A;  1YIJ A;  5DM7 R;  3OSS C;  1S72 A;  4KR3 A;  5LJ5 g;  2KDS A;  1K9M U;  4WJ4 A;  1NJ2 A;  4KQE A;  1VUB A;  2KQW A;  3OSV A;  2R5M A;  3IG2 A;  1JRI A;  4M75 B;  2H3J A;  4MMK A;  2R5A A;  5GAO r;  4OB0 B;  3CMQ A;  1M1K C;  2QHU A;  1VQM T;  3M57 A;  2CGH A;  5CK9 A;  3VQW A;  2ZR2 A;  4YCW A;  2K5L A;  4M75 G;  3J81 E;  1UEB A;  5I21 A;  3V7S A;  4KT0 E;  4C5E A;  1YI2 T;  2IY5 B;  1I8F A;  4TVY A;  1WNL A;  3HXV A;  1X01 A;  2K3Y A;  3KFU A;  4Q5W A;  3V7R A;  1VQ8 A;  4M77 B;  5GAN 6;  3QSU A;  4CI0 C;  4EMH A;  2ZPE B;  3HFV A;  2E64 A;  5GAN d;  3VU3 C;  3NEN A;  4WJ3 M;  3PMI A;  3BJU A;  4HWT A;  4L87 A;  4PG3 A;  5ELO A;  1K8A U;  4TVA A;  2A3L A;  3QJY A;  2ALY A;  3JRZ A;  4M77 E;  1YB3 A;  2CZ1 B;  4C92 A;  3M55 A;  4Q15 A;  5DY9 A;  3P8B B;  1ZQ1 A;  4Q6G A;  2XDB A;  1N6A A;  5KNN A;  3L2V A;  1NJ8 A;  3X25 B;  2WAC A;  5GAM g;  1RIQ A;  2DXC A;  4RMO A;  2OTL T;  4HWS A;  3QKJ A;  4A4H A;  2A7Y A;  4M7D A;  5E3I A;  5LJ5 e;  2HD0 A;  4RMF A;  3CPW A;  3RKX A;  1Q81 U;  4HCZ A;  2ZIM A;  2ZZF A;  4JJN K;  3OY9 A;  4ZN3 A;  3NTH A;  1QP2 A;  4M77 G;  3JB9 D;  1QVF S;  2F69 A;  3HRI A;  2LVM A;  1ADJ A;  3HXU A;  1YIT A;  4BY6 C;  2QHV A;  4EPC A;  2X4J A;  5GAN g;  2I4N A;  4P3O A;  5GAN 7;  4E7H A;  4CS2 A;  5IAY A;  1QW1 A;  3TU4 K;  3CC2 A;  2L3R A;  4RQF A;  1YFR A;  3VV0 A;  2ZPI B;  1W2B S;  2GQV A;  3VYH B;  3A31 A;  1P92 A;  4J83 A;  3C4S A;  3E1S A;  4LD6 A;  3L2U A;  1FXX A;  2QHS A;  1OZ3 A;  1IRE B;  5A0G A;  3I55 T;  4BB7 A;  2RHU A;  3G7Z A;  4M7D G;  3CCQ A;  3E9G A;  1I4K 1;  5GAN 8;  4HT9 A;  3QNE A;  1H4Q A;  5GAN f;  4XU0 A;  4EX5 A;  2GF7 A;  4C5I A;  1E24 A;  3UGT A;  3QYH B;  3UFG A;  1X6O A;  4XK8 E;  2F5T X;  4EDU A;  3MP8 A;  5GAO m;  1YJN A;  4H02 A;  1IL2 A;  1NE8 A;  1Q86 U;  4ELZ C;  3CC2 T;  1QE0 A;  4ZTU B;  5CAI A;  3L2W A;  3CBM A;  4CH6 A;  2NS6 A;  4JRK A;  1KG1 A;  1GXI E;  3PMT A;  4QQ6 A;  3ZBD A;  3W3S A;  5LJ5 j;  1VQ4 A;  3MF1 A;  3HRS A;  2ZXF A;  4PJO F;  5KCO A;  3P8Y A;  5GAM f;  4R55 A;  1BYM A;  3P8V A;  1G3S A;  3JB9 F;  1K73 C;  4QQD A;  2VXE A;  4ATO A;  2G4C A;  1EFW A;  4M7D C;  2CJA A;  1W2B A;  2DU7 A;  3HXY A;  3OYL A;  3ASK A;  3OA6 A;  1NPP A;  5KH6 A;  1G5H A;  4BDZ A;  1H4V B;  2GCX A;  4TTV A;  5KCH A;  2MI6 A;  2ZPG B;  2NLU A;  4X34 A;  1VQP A;  1N8R U;  3L4G A;  3IKM B;  1LNX A;  2I2L A;  3UDC A;  1E22 A;  11AS A;  1VQO T;  3I56 A;  1BI3 A;  4UP9 A;  2RJE A;  1RI0 A;  1H4T A;  1UGP B;  3QYG B;  4LNS A;  3E9F A;  1VQO A;  4J15 A;  4P3N A;  4NS5 A;  1WU7 A;  4MDW A;  1R8O B;  2Q5I A;  3V8J A;  2HBP A;  2PUK B;  5CKF A;  3OS2 A;  1M90 U;  4H2Y A;  5GAN e;  2ARU A;  3PIP A;  1HC7 A;  2VV5 A;  2ART A;  4C8Q C;  4N0A A;  4B9W A;  3M53 A;  2KVQ G;  5F5W A;  1ZHI A;  3S3O A;  4C8Q G;  4VUB A;  2FYK A;  1YJW A;  2EL9 A;  1YHQ A;  4BI8 B;  1LJO A;  4M7D D;  1VIE A;  2YLC A;  3LWI A;  4C0G A;  1OZ2 A;  5GMK m;  4H2T A;  4P72 A;  1N8R C;  3CCS T;  1NJ6 A;  2AKW A;  2YHT A;  2LQK A;  4XU1 A;  5GMK i;  3OS5 A;  2X4X A;  3TEH B;  1M90 C;  4KBM B;  5KE3 A;  3QG1 A;  2XG8 D;  2VGN A;  5FU7 C;  4A54 A;  4C5H A;  3ZFJ A;  3IAL A;  2Q7G A;  4YRR A;  1VQ6 T;  2IY5 A;  4LVL A;  2ZZD A;  2OTL A;  2AMC B;  2FVU A;  4RKU E;  4FIB A;  1O75 A;  2RHZ A;  2DDZ A;  3S6W A;  2K2V A;  4LVJ A;  2LQ8 A;  2EWN A;  5CR2 A;  2DXU A;  3TRE A;  3FEO A;  1M5Q 1;  2JN0 A;  4TWA A;  4M75 F;  4EO4 A;  3VUZ A;  3JB9 H;  3OBY A;  2EAY A;  2ZIN A;  3M4P A;  1ATI A;  2MWP A;  2P0P A;  2I4O A;  1EIF A;  4E7J A;  2P0K A;  4LDU A;  2LTO A;  1LYL A;  4YCU A;  4M78 E;  1Y96 A;  3JB9 I;  2RA2 A;  3X26 B;  1VQN T;  4ELY C;  4LVM A;  5AYF A;  1BI2 A;  3JCM h;  3CBP A;  5HY6 A;  4PJO E;  1B34 B;  2V8K A;  4XU2 A;  1Y07 A;  2M16 A;  4QW2 A;  3F70 A;  4HWR A;  1G5I A;  3M4Y A;  2L89 A;  3QZ5 B;  1JJ2 S;  2E3C A;  4C0Z A;  4F7U F;  4JRI A;  5LJ3 h;  1Q7Y C;  5GMK l;  4H2S A;  5C6S A;  4ZGD B;  3NET A;  3CD6 T;  3CCE A;  2ZPH B;  1KHI A;  3HL8 A;  3G71 A;  3HTZ A;  3OYJ A;  2MWO A;  2DK3 A;  4NL3 A;  1KQ2 A;  5A0L A;  2E70 A;  4HCC A;  4N0A C;  3URG A;  2RJD A;  5LJ5 f;  2L8D A;  3MEY A;  4QVC A;  2E5Q A;  1YJW T;  5GAO n;  3TEE A;  4DA4 A;  5GAN 5;  4H2V A;  4P75 A;  2X4Y A;  3PTA A;  1YI2 A;  2Y4X A;  3I55 A;  2R58 A;  4OGC A;  4XEO A;  5D6Y A;  4X9C A;  2IVW A;  4P5N A;  1Q7Y U;  2RHY A;  3PNW C;  1UGR B;  2ZZG A;  3RER A;  4C92 E;  5K1P A;  1UGQ B;  2XHC A;  2K4Y A;  5LJ3 g;  3BFM A;  2RI5 A;  4M77 A;  1EVK A;  4MZT A;  2EFI A;  1EIY B;  1N9R A;  4C92 C;  3FIF A;  3VUB A;  3NTK A;  1M1F A;  2CKK A;  2DPP B;  3JSC A;  3QJ6 A;  2LCC A;  1JBM A;  4NOY A;  4BE1 A;  2ALY B;  3QBY A;  3LWH A;  2QHT A;  1D3B A;  2C7I A;  1VQL A;  2L5Q A;  3OYA A;  2PME A;  1YJN T;  2G3R A;  1YJ9 T;  4C92 D;  4YTL A;  1VQ4 T;  1PYS B;  2QA4 T;  1QVF A;  3CME T;  4PJO D;  4PNO A;  5GAN h;  2MAM A;  4BE2 A;  1X55 A;  5GAN 4;  3HSB A;  12AS A;  2V8J A;  2QDY B;  3MP6 A;  3QZ9 B;  4M78 D;  2JVV A;  3WXM B;  4C8Q E;  4E7K A;  2Q5H A;  4KUD K;  3OQ5 A;  1M9S A;  5CKD A;  3E9I A;  4M78 B;  2J3M A;  3EAE A;  4TVW A;  2DZC A;  2DVE A;  5CCA A;  3ICA A;  5ELN A;  4KR2 A;  3G1Z A;  3M9Q A;  5LJ5 h;  3QO3 A;  4XTZ A;  4K88 A;  3OYH A;  1FX7 A;  4YRF A;  3V8K A;  2AKW B;  3RMS A;  2DD5 A;  2RHS B;  4C8Q A;  3MQZ A;  3HXX A;  3PGG A;  3OYC A;  2WSE E;  3OBW A;  2BKD N;  5CO7 A;  3RAC A;  3H6Z A;  3MET A;  4XTU A;  5CIU A;  4IUV A;  1Q82 C;  1WGS A;  2QXF A;  1U1T A;  4BDY A;  3CXC S;  1VQ7 A;  2D0Q B;  4M75 E;  3OYY A;  3CCU A;  5D6X A;  3VYG A;  3DLL A;  4R56 A;  2BUD A;  3R07 A;  4YRI A;  5CKH A;  3PFS A;  3JCM d;  4XEM A;  5J26 A;  3EFR A;  2P4T A;  2PVO B;  4IUR A;  4P73 A;  4XTY A;  5CKE A;  4P73 C;  2RH2 A;  4GY5 A;  5C52 B;  4X5O A;  2F5K A;  4CH5 A;  4M77 C;  2OAU A;  1VQ5 T;  3SFM A;  2CJ9 A;  4M78 F;  4BI3 A;  4N4H A;  1VQK A;  2QI2 A;  3SD4 A;  2QEX T;  1B70 A;  1Q82 U;  1H3Z A;  4OB3 B;  1WYD A;  3QII A;  3MP1 A;  2RI3 A;  2I4M A;  4OVA A;  5L8R E;  3VKI A;  2K57 A;  3FLG A;  4Y28 E;  3UWN A;  1KMM A;  3LX7 A;  2YRV A;  2LNV A;  3DKM A;  4OB1 B;  4LVK A;  3J7A F;  2ZGW A;  4V2S A;  2AHJ B;  4CH4 A;  4YRT A;  4YRJ A;  3I7F A;  2QQA A;  4ZGE B;  3Q1J A;  3RF1 A;  1BBU A;  1B8A A;  3CCV A;  4RDX A;  4P71 A;  2XKO C;  2HNI A;  4M78 G;  3L2Z A;  4XTW A;  2PVG B;  4YRP A;  1QVG A;  5I2S A;  5GAO p;  1OYX A;  1JJC B;  2VXF A;  3CCE T;  1K9M C;  4M7A F;  4YDQ A;  5LJ3 j;  1TH7 A;  3QO8 A;  3LH0 A;  4QVD A;  5K1X A;  4PLI A;  5IN1 A;  2RJF A;  1N9S A;  4NL2 A;  4CRI A;  4C8Q B;  3I56 T;  4E47 A;  2DQ3 A;  4PL6 A;  1QVG S;  2XI9 A;  1YIJ T;  1I81 A;  2DZ9 A;  1YCY A;  1EOV A;  4Z02 A;  4C8Q D;  4PJO A;  5J39 A;  2I4L A;  2P0Q A;  3X20 B;  3OYN A;  4H2X A;  4OB2 B;  2M0O A;  1Y96 B;  4FT4 A;  3JCM b;  3A32 A;  3MCA B;  4P72 C;  1NPR A;  1WQW A;  4M7A A;  4ZN1 A;  2ZIO A;  1BKB A;  2ZR3 A;  2JUF A;  3CMA A;  3M59 A;  3BDU A;  3G4S A;  4F7U A;  2X35 A;  2DD4 A;  3CCU T;  3JCM f;  1VQ8 T;  3LLR A;  4MZP A;  3KUF A;  4IUP A;  1BIB A;  1BI1 A;  4M7A E;  1NJI C;  4FU6 A;  4NCX A;  3HP9 A;  4M75 A;  4J8O A;  4LDY A;  2EQK A;  3OS0 A;  1KQ1 A;  2M1H A;  5GAN 3;  3REX A;  4ZGJ B;  4C0D B;  3FB9 A;  4J5Y A;  4YYE A;  2VC8 A;  1G3Y A;  1JJC A;  4IUU A;  4E51 A;  2DTH A;  1ZBX A;  4EMK B;  2V8I A;  1ADY A;  2CZ7 B;  4C0F A;  4YRE A;  3UH0 A;  4L59 A;  4M7D F;  2GFU A;  4A53 A;  4OGE A;  2XIC A;  4DOW A;  3CCL A;  4UC4 A;  3LSQ A;  3OYI A;  1EVL A;  5LJ5 d;  4MML A;  4JLG A;  2E6N A;  2RK1 A;  4YRG A;  4ZIB A;  3WVE B;  3PZC A;  1G51 A;  3LC0 A;  3VQX A;  3HXW A;  1KMN A;  4YRN A;  1NJI U;  1KOG A;  1M1K U;  4EMK C;  1X2G A;  3QO5 A;  3WVD B;  1EQR A;  4QQG A;  5FU6 C;  4N4I A;  4DPG A;  5LL6 S;  4BAC A;  2KMT A;  1SSF A;  4G84 A;  5CQX A;  4FL6 A;  2XU8 A;  3OYF A;  3NTI A;  3J80 E;  1N27 A;  3UT1 A;  3CXC A;  3X28 B;  3HRT A;  2XDP A;  3CBO A;  2LC4 A;  4QVZ A;  3OW2 A;  1SRY A;  3GF5 A;  2DXB A;  3GOX A;  2VGM A;  4RQE A;  1K8A C;  4A4G A;  4ZTZ B;  2PU9 B;  4C0D C;  4J7F A;  1VQP T;  3TCJ A;  4OLF A;  4IKF A;  3LGF A;  1LOJ A;  4PJO C;  2O01 E;  1KHC A;  2Y4Y A;  4IUT A;  2JZ2 A;  2QA4 A;  3HY1 A;  3OMC A;  4BWA A;  5LJ3 f;  4P75 C;  3A8H B;  3HRK A;  5FRN A;  4M7A C;  4C92 F;  1Q86 C;  5GAM j;  3C95 A;  1GGM A;  1WJR A;  2RK2 A;  4LVI A;  4HVC A;  2RHI A;  1Q81 C;  4IUQ A;  3A8O B;  4M7A G;  4TVA B;  3PT9 A;  3VQY A;  1X56 A;  3GLX A;  3GPL A;  3CCL T;  3OYG A;  3E19 A;  4M75 C;  4YRQ A;  4YRS A;  1B7Y A;  1XOV A;  5GMK j;  4WI1 A;  5FU6 B;  2XK0 A;  4JRQ A;  5GAM h;  2D6F A;  4LDX A;  4BE0 A;  4LDW A;  4M7A B;  5M9O A;  3VQV A;  4FSX A;  3CMA T;  3OYK A;  3CCJ T;  3CCV T;  2ZNI A;  2HAX A;  1XQH A;  1B7Y B;  3ERR A;  3RGL A;  5C53 B;  3RMQ A;  3MF2 A;  4M77 D;  1KC8 U;  1G3T A;  4ZTF A;  3P8T A;  3HPW A;  3TEH A;  2MMP A;  2FL7 A;  3HFZ A;  2RM4 A;  5IT9 E;  4K86 A;  3LW5 E;  2CZ6 B;  4P71 C;  1USY A;  3S3N A;  4PHC A;  2RB6 A;  3CCR T;  4GLK A;  4UP8 A;  2X4W A;  3OW2 S;  2QQB A;  4CH3 A;  3SWN A;  3LSS A;  3SWN C;  4RCB A;  1VIF A;  4YCV A;  5HKC A;  1ASY A;  4AH6 A;  1VQK T;  2RI2 A;  4N4G A;  3MHX A;  4M7A D;  3G71 T;  5GAN 2;  1M1G A;  1KC8 C;  3RUX A;  2JNG A;  1WJQ A;  3UPU A;  2C8M A;  1L0W A;  3A8M B;  3G6E A;  3UGQ A;  4M7D B;  1X2H A;  3RL6 A;  2ZT6 A;  2LRQ A;  2P5I A;  2Q7E A;  4BY6 B;  3P8D A;  5GMK h;  2CIM A;  4L5G A;  3H8Z A;  1G5V A;  4P74 C;  4OF1 A;  4RCC A;  2CYZ B;  2XTI A;  3SDZ A;  2OTJ T;  5HGQ A;  3GIB A;  2DTO A;  1K73 U;  3X24 B;  1C0A A;  2RHX A;  4M7D E;  5GMK e;  3A5Y A;  4UPA A;  2RO0 A;  3A74 A;  4F7U G;  2K3X A;  3CEY A;  1XTD A;  3JB9 G;  3C12 A;  3OS1 A;  3CC7 A;  4HKE A;  4OP0 A;  4DQ2 A;  2PMF A;  2E10 A;  2P0L A;  5CQY A;  4KUL A;  4G85 A;  4E7I A;  1S72 T;  3INZ A;  3QHS A;  3TUP A;  4L6V 5;  3CPW S;  3SB2 A;  3C94 A;  3CC4 A;  3IKL A;  4YRM A;  1NJ1 A;  2KSS A;  1AHJ B;  3VBB A;  2ARS A;  2LT1 A;  2KK4 A;  4HWO A;  3DB3 A;  2DO3 A;  3QPH A;  4HA8 A;  3DSQ A;  2LDM A;  2RJC A;  2E41 A;  3LGL A;  3ZEH A;  5FRO A;  4OMF B;  3VJP A;  3JCM e;  1I5L A;  4MDX A;  1VQ9 T;  1WQ7 A;  1SET A;  1VQL T;  1WJS A;  2XID A;  3A8L B;  3MO8 A;  2HQE A;  1BI0 A;  5CVI A;  4DOV A;  2ZT8 A;  4D6W A;  3CCS A;  3PCO A;  5FU7 B;  4PJO B;  3FDR A;  2XGT A;  2FB7 A;  4YRC A;  1NNH A;  1MHN A;  1YIT T;  2QQS A;  1N9W A;  4EMG A;  1FWZ A;  5DLQ E;  3OYB A;  5GAO q;  1YGB A;  5C0M A;  4O6J A;  3CME A;  1PSE A;  1PSF A;  3M56 A;  2EKO A;  1D3B B;  1BIA A;  4A4E A;  1NYR A;  4TQD A;  4A4F A;  2JTF A;  4Y91 A;  3GNF B;  3QDR B;  3DLM A;  4HT8 A;  4H2W A;  5GAM d;  1EIY A;  2EJ9 A;  2R57 A;  2EJG A;  3RES A;  4YRO A;  1SES A;  2VUB A;  1Z7M A;  2DAQ A;  3OYE A;  3DB4 A;  2AMC A;  3MEV A;  3HKS A;  4A4K A;  3M4Q A;  2KY9 A;  3FC3 A;  4K87 A;  3A7A A;  3WQZ A;  1DJ7 B;  4P3P A;  3L2R A;  3OYM A;  4XTV A;  1KQS S;  2Y90 A;  5KE2 A;  3L2Q A;  4C92 G;  3KXT A;  3CCJ A;  4E7L A;  5DLO A;  2CZ0 B;  3HRU A;  3MEU A;  3QO7 A;  1MGQ A;  3AHU A;  3N5B B;  2B8A A;  2DIQ A;  2O4X A;  3JCM Q;  4YPF A;  4BW9 A;  2KAF A;  1QVP A;  1J5W A;  4MZM A;  5LJ3 e;  3QXE B;  1VQ7 T;  2ODR C;  2OTJ A;  1UB4 A;  1HXD A;  2HQX A;  3T9N A;  2O4X B;  3GP8 A;  4HWP A;  3CCQ T;  2JOY A;  3OMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...