2E65A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, mutation d104a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
227
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 227
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e65A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e65A01
1E1TA 4P75C 3QO3A 3HXWA 4YREA 4L87A 1C0AA 4HWOA 1NJ1A 5GAN3 3P8YA 1KQ1A 3JCMd 4BW9A 3JCMh 5CAIA 1EIYB 2ZNJA 3LSQA 4M75C 4M7AD 3LC0A 3NEMA 3MF1A 1I8FA 2DU5A 5GANf 4P3OA 3NENA 4YRSA 1MGQA 1N9SA 3A5ZA 3RKWA 3PCOA 2DQ3A 5ELOA 2ZNIA 4C92A 1M8VA 4YRIA 4Q15A 5GAN6 1H641 1E24A 3FIFA 3CMQA 1B7YB 4OP0A 3V8KA 4XEMA 1NJ5A 2XGTA 3L4GB 3JCMP 2RM4A 4H2VA 1USYA 1WYDA 1X2HA 2RB6A 5LJ3j 4G85A 1J5WA 4WJ4A 1SRYA 4MMKA 1B34B 4XTVA 1E22A 1HK9A 5ELNA 4P72A 2J3LA 4X9DA 4M7DG 1WNLA 3P8VA 4RCCA 3ICAA 2XTIA 2IY5A 4HWSA 3HFVA 3JB9H 2ZZFA 2ZZGA 1N9WA 3EFRA 4K87A 2ZXFA 3HXUA 4M7DB 3E9IA 3REXA 4H2SA 1ATIA 1H4SA 1WU7A 3RGLA 3BDUA 3SWNB 4M7AA 5K1XA 1NJ2A 5GMKe 2ZCEA 3JCMc 1ADJA 3EFSA 5GAMf 5LJ5d 2E41A 2ODRC 5LJ5h 1LYLA 4M78E 4XU1A 5GANh 5GANe 1B34A 1KOGA 4YRPA 1Y96A 4M77E 4RQFA 4TVWA 1EFWA 4M78F 4A54A 1HXDA 2DVEA 3SWNC 3V7RA 5LJ3f 3GIBA 4P71C 2I4MA 4M7DA 4P73A 4YRGA 2DDZA 5C51B 3R07A 4PHCA 1YFSA 2E65A 1I4K1 3JCMJ 3JB9F 3TEHA 4M77F 4XU3A 4DQ2A 3HY1A 1WQWA 3HRKA 3DSQA 4H2XA 4TVAA 4YPFA 4CS2A 3PCOB 4C92B 2EL9A 2J3MA 3UH0A 2I4NA 4HWTA 4QVDA 2ZZEA 4ZTZB 5GMKi 4F7UE 1PYSA 3VQXA 1W66A 1D3BA 3JCMg 1I5LA 3BY7A 2DJZA 2RHQA 11ASA 4NL2A 3JCMV 1ASZA 4CH4A 3VQWA 2E5AA 5GAN2 4Y91A 3A32A 4HVCA 3JCMX 3WQZA 5GAOm 1EOVA 2EJGA 2VXFA 2ZT6A 4ZTUB 4F7UF 3BW1A 1EVKA 5E3IA 3RF1A 3JB9J 2IY5B 4M78D 4UP8A 4JRKA 3V8LA 4EX5A 4C92C 1YFRA 5GAOl 1X56A 4M7AG 2Q7HA 3V8JA 1HC7A 1H4QA 4M78G 4H2UA 5GAMj 3JB9D 4KQEA 2I2LA 3A7AA 4M77D 3BJUA 4M7AB 1X01A 4P74A 4P75A 4PJOE 2AKWA 3ERRA 4YCVA 1B70A 5LJ3e 4RDXA 4M77G 1YCYA 5GAOn 1USYC 4CH5A 4XU2A 3IKLA 4C8QE 3MEYA 1EVLA 3QNEA 4XTWA 2CJBA 5DY9A 1U1SA 4P72C 4PJOF 3MF2A 1H4VB 3PZCA 2YLBA 4UPAA 2PMFA 2QTXA 2DXUA 2JN0A 4M75E 4X5OA 1Y96B 2FB7A 4C8QF 3V7CA 3UGTA 4LNSA 3RKXA 3HRIA 4O2DA 4KR3A 4G84A 4K86A 3HFZA 4M7AC 5F5WA 3TEHB 4RMFA 1B76A 4M75F 1X54A 4Q6GA 5LJ5g 1JJCA 5GMKh 4M78A 5GANg 2DZCA 3JCMb 4J5YA 4XTZA 3NELA 4H2XB 4JUVA 4H02A 3RACA 4PG3A 4YRCA 4TVAB 2E64A 4XU0A 5HGQA 4XTXA 3A74A 5GANd 2RA2A 3PGGA 5GAOq 2ARUA 2ZIOA 4M77A 2ZT8A 4YCWA 2E1HA 5GAN8 1WPYA 1LJOA 1B8AA 3HTZA 5KNNA 2EJFA 3I7FA 1PYSB 3UGQA 1D3BB 2K57A 1NJ6A 1RIQA 2RHQB 4EMGA 1BBUA 3QO7A 4M7DC 1HTTA 4P73C 4YRRA 2DTIA 2E10A 4JLIA 3HFOA 3JCMf 4PJOD 2C7IA 3A31A 4E51A 1ADYA 4N0AA 2DQ0A 4YRQA 1KQ2A 3RUXA 4PJOG 4C8QD 3HXVA 2QHUA 2ZIMA 4YP0A 4EMKA 2AMCA 4HT9A 4WJ3M 1NYRA 1BBWA 3SB2A 4NCXA 2ZINA 4YRLA 1G5HA 4YROA 3P8TA 4F7UA 4CS4A 4M75D 2DTHA 2AKWB 1B70B 4YRTA 2ZGWA 4XTYA 2YHTA 3E9HA 2ALYA 4X9CA 3JB9I 3NETA 1SERA 4HT8A 4M7DE 2YLCA 2VC8A 4XEOA 3JCMW 2ZTGA 5GAMd 4YRKA 5GAMh 2CJAA 2ZR2A 4P3PA 4QVCA 1X2GA 2Q7GA 3INZA 5GAMe 3KFUA 5GMKm 4EMHA 1U1TA 4YDQA 3OD1A 3HXYA 4YCUA 1GGMA 2Q5IA 2ZT5A 5LJ3g 3HFZB 3W3SA 4P74C 4PJOA 4BWAA 2DXTA 5GMKl 1YGBA 4KR2A 4RCBA 5LJ3d 4C8QA 3RIRA 5LJ3h 1JJCB 2CGHA 4M78B 2ARSA 1QE0A 1ASYA 4NL3A 3JCMe 3JB9G 5GAN4 5K1PA 5LJ5f 12ASA 4CS3A 4M75A 3RL6A 4M77B 2ZT7A 1LNXA 3VQVA 3QUIA 2P5IA 1NNHA 3V7SA 3FB9A 3M4GA 3VBBA 4J6YA 4YRJA 3BFMA 2P0LA 2ODRD 4J6XA 2HNIA 4C92E 2RHSA 2ARTA 3IG2A 3HFNA 3G1ZA 5C53B 4HA8A 4M78C 3HSBA 3A7RA 2CIMA 3IALA 4CH3A 2QHSA 4K88A 4TQDA 4ZIBA 2G4CA 2DU7A 4M7DD 4EMKB 4F7UG 2AMCB 1EIYA 4PNOA 4YRMA 3VQYA 4C92F 3AHUA 2EJ9A 4XQ3A 1BIAA 1I81A 4M77C 1BIBA 4H2YA 4UP9A 1TH7A 3IKMB 4F7UB 3HXXA 2CJ9A 1G5IA 5GAOp 1JRIA 4XTUA 2Q7EA 5GAN5 4HWRA 2C8MA 4YRFA 5GAOr 5I21A 1WLEA 2ALYB 2Q5HA 3FJPA 3QO8A 3UFGA 1YB3A 1G51A 4N0AC 1X55A 4P3NA 3REUA 4NOYA 1B7YA 3VU3C 4WI1A 4DPGA 3QHSA 2VXEA 3RKYA 2Y90A 4EMKC 4M7AE 3JCMQ 1YFTA 4H2TA 3A7UA 3L4GA 1E1OA 1EQRA 3M4QA 5LJ5e 4TVYA 1QF6A 1JBMA 2DKGA 5GMKj 1L0WA 4RQEA 2RD1A 4J6WA 4C8QG 2PMEA 4M7AF 4PJOB 1H4TA 2QHVA 3L2ZA 4V2SA 2DZ9A 5LJ5j 2EAYA 5GANj 4YRNA 4A53A 5GAN7 3M4PA 4C8QB 4J15A 1SETA 2E3CA 3TUPA 1NJ8A 1KMNA 4CH6A 4C92D 4M75G 2ZR3A 2EWNA 1FYFA 4TWAA 2FYKA 1Z7MA 3SWNA 3TEGA 1LOJA 1N9RA 3QO5A 4TTVA 4OLFA 1NYQA 4P71A 5GAMg 4C92G 4MMLA 4M75B 1WQ7A 3L1AA 3QSUA 2QHTA 4UP7A 2I4LA 1Z7NA 1IL2A 4YYEA 1M5Q1 4JRIA 4EO4A 4HWPA 2DEQA 2I4OA 3A5YA 3RESA 1VQZA 4AH6A 4PJOC 3HXZA 4M7DF 3LSSA 5C52B 1SESA 2DTOA 3QTCA 4WF2A 3RERA 2RHSB 4TQFA 4H2WA 4C8QC 3HY0A 1KMMA
chains in the Genus database with same CATH superfamily
1E1TA 3G4SA 1WI7A 2IPOB 2CZ1B 1AHJB 4FL6A 1NJ1A 3P8YA 1KQ1A 3I9QA 1KHCA 2MI6A 1VQNT 4BB7A 5CIUA 1MMGA 1UGVA 2KEAA 4M7AD 1U5SA 1WJQA 2LCCA 2ED0A 4P3OA 4Y28E 3I5SA 1N9SA 3GPLA 2RPNA 4LN2A 1M4ZA 3CCQA 1I0CA 3PCOA 4IUPA 5ELOA 1M1KU 4YRIA 3I56T 4Q15A 2Y4XA 1E24A 3FIFA 3TQ7P 2G3RA 4MDXA 3M0UA 1MV0B 4N4GA 2XGTA 2RM4A 4H2VA 3J81E 1X2HA 1WYDA 5LJ3j 1I07A 1RADB 1RI9A 4G85A 2ZPFB 1SRYA 2E3HA 5KYXB 1E22A 4HKEA 3C4SA 2J3LA 2DLPA 4X9DA 1WNLA 4LUDA 4RCCA 4PJLA 2XTIA 1WXBA 1NBEB 2BKDN 2ZXFA 4M7DB 3E9IA 1PRMC 1ATIA 2P0KA 3RGLA 3BDUA 5KYUA 2O31A 1D0ZA 2DL4A 2AZSA 1NJ2A 1RAHB 2DYBA 2BZ8A 2QK0A 4J7FA 3G71A 1LYLA 2R5AA 5CKFA 5FW9A 4XU1A 2XK0A 3LWIA 1PNJA 3OYEA 1P92A 2DD5A 3OYHA 4IIMA 4MZMA 1EFWA 3X20B 2DL5A 5FU6B 3X25B 1GFCA 5LJ3f 1WHHA 2JNGA 5IH2A 4P71C 4M7DA 1YITQ 5C51B 3R07A 4PHCA 4M77F 2CUDA 5EG2A 1QQJA 3HRKA 5FRMA 3LH0A 1NG2A 3E1SA 9ATCB 4YPFA 2VVKA 1FMVA 1VOMA 4PLLA 3VS6A 2QTVA 2J3MA 2KE9A 4HWTA 3UPUA 4ZTZB 3S6WA 1D3BA 3JCMg 2DJZA 1NLOC 1QCNA 1KJWA 3HPWA 1YNZA 2E5AA 3H9NA 3U23A 1VQKQ 1Q86C 2ZT6A 4ZTUB 4HT4A 2QAZA 3R6OA 4AFSC 1YHQQ 3RF1A 1WFWA 4JRPA 2MIOA 2IY5B 4JRKA 4LVKA 3M0PA 2WSEE 1VQMQ 3CCUQ 2ATCB 1UE9A 2NWMA 1YJNT 2DIQA 2I2LA 3A7AA 4M77D 1UTIA 2HL5C 5CVIA 4M7AB 3CCST 3ERRA 4AFZC 1PG5B 3G4ST 3HHTB 3LGFA 1N5ZA 1WDXA 2RQRA 2VKNA 3HP9A 3IKLA 2GCXA 4LVJA 3QNEA 4ZTFA 2CJBA 5DY9A 4PFZA 3DB3A 3OYFA 2FEIA 2PVGB 4PJOF 3HRSA 2DM1A 4BI3A 1CKBA 2DXUA 3OYBA 2FB7A 3V7CA 4LNSA 1VQ4Q 4ZN1A 2KYBA 3HRIA 1W2BS 3VUBA 4NS5A 4J9HA 4P5NA 2L8DA 1MUZA 2EQMA 4RMFA 4M75F 2HBWA 5IHNA 1BI3A 1X54A 5CR2A 3GNGA 1AVZC 5LJ5g 1MMNA 1EFNA 4DOWA 4HXJA 4WCIA 3ME9A 5GANg 3G6EQ 4E6RA 4L59A 4H2XB 4KH0B 4JUVA 2LJ3A 3RACA 2CDTA 3OSVA 4YRCA 2PVOB 4FYWB 1BI1A 2EYQA 3A74A 5GANd 4O5VA 1B8AA 3HTZA 1HD3A 3C95A 1S1NA 1VQ8Q 1ZBXA 1NJ6A 3TREA 3UDCA 4J9FA 1BBUA 2HSEB 2ZCFB 1QVPA 2HQEA 2VV5A 3MJXA 1V29B 2DTIA 3M9QA 1NJIU 3JCMf 4PJOD 1VQ6T 1JJ2S 3A31A 2JTEA 4N0AA 4IUQA 2DQ0A 3RMQA 1KQ2A 4B6MA 1NYFA 3RUXA 1RAFB 3QKJA 3HXVA 2QHUA 3CCRT 3A8MB 3UATA 2NUTA 1G3SA 2QXFA 2DXBA 1IO6A 3G71T 1VQLA 1X69A 4PJNA 2YUNA 1YCSB 2ZINA 2W10A 1GCQC 1MMDA 2WACA 4M75D 1K73R 1IGUA 1D1CA 2FRWA 4HCBA 2DETA 4FYVB 4PLIA 4YRTA 3EGXB 4XTYA 3E9HA 4L5GA 4E7LA 7AT1B 3VS5A 4OMQA 1ABQA 2LVMA 1SERA 2LX9A 4PJMA 5CCAA 4Z89A 1ZSZC 4XEOA 4ME7A 2WSFE 2DA9A 5GAMd 4BI8B 5GAMh 4JZ3A 4ZNXA 4FT2A 2ZR2A 3O8VA 2X3WD 4A4GA 3CCVQ 3KFUA 5GMKm 2RQTA 2KVQG 4PFOA 1KD1C 1GGMA 2Q5IA 2ZT5A 3L2VA 1N27A 5CK9A 4P74C 1BU1A 1VQPQ 2DX1A 2FG0A 1UUEA 2MF2A 2RJCA 3HL8A 4BWAA 3REAB 3GF5A 3ASKA 2B86A 3EAEA 4C8QA 2P4TA 2EVRA 2KMTA 1JJCB 1UECA 2LQWA 1ASYA 2H3EB 1G8XA 1ZUKA 1AT1B 3JB9G 3NTKA 1S72Q 1OX9A 1WGSA 2E6NA 5LJ5f 12ASA 4LDWA 2F2WA 2OTLT 1LCKA 1VQ9A 1RAGB 1UFFA 3RL6A 4M77B 1YWOA 2PVDB 1LNXA 5KE2A 3QUIA 2LZ6B 2V8IA 1WHKA 2QASA 3ZFJA 2QQ9A 3BFMA 3EFOA 2P0LA 2KNBB 2RJEA 1Y07A 3EH1A 3RMSA 2QDYB 4LDXA 4OMOA 4C92E 2RHSA 2KRSA 5J3BA 3QDRB 3G1ZA 1BI0A 2OX7A 3CD6A 4CH3A 2QHSA 4K11A 4K88A 1EX4A 1YP5A 4A4FA 1K1ZA 3SFMA 2J06A 3NPFA 4EMKB 2AMCB 2K4YA 4YRMA 3VQYA 3AHUA 4GY5A 3VRYA 4E7HA 1O9SA 4XQ3A 2XD0A 2HDAA 4DEYA 4H2YA 5HK0A 2PQWA 2DBMA 1NEGA 3I56Q 1C0MA 4RTXA 3PMTA 2QA4A 3VS7A 2Q7EA 3T9NA 2F2XA 5GAN5 4HWRA 4YRFA 2KDSA 1SRLA 1BCOA 1OZ2A 2ALYB 3TVTA 3FJPA 1IZ6A 2ZPHB 3REUA 1JB0E 1H3HA 1YBYA 2JUFA 3VU3C 5J39A 3QJ6A 2QQSA 4OMLA 2KAFA 3CMAA 2KY9A 1E1OA 1EQRA 5FWCA 2DNUA 1PD1A 3WVEB 1VQ7Q 2OTJQ 1YIJA 2XDDA 1JBMA 2DKGA 1UGRB 2JW4A 4IUVA 4E47A 4J6WA 4C8QG 4PJOB 4BY6C 1W6XA 1RAAB 2EAYA 3PE0A 2YUQA 4YRNA 3OW2P 5A0DA 1YJWQ 3M4PA 1QKXA 4J15A 3MEUA 1TUCA 2E3CA 3TUPA 2EYZA 3TCJA 3EG0A 1KMNA 1TG0A 3J7AF 1AZEA 2DE0X 2XU8A 2GQVA 3CCJQ 4P71A 1Q7YR 1WHGA 4C92G 2BUDA 4JPBW 3A8GB 4M75B 3L1AA 1AD5A 3N5BB 4KRTA 2DXCA 1M5Q1 3EGDB 2DEQA 2I4OA 3RESA 4AG2C 1NZ9A 1FMKA 4M7DF 1BB9A 1SRMA 3R6NA 3RERA 2XICA 3HY0A 3QO3A 1K8AC 4X34A 1VIEA 1N8RU 4L87A 3PT9A 1C0AA 3KFVA 4HVWA 2GF7A 4D8KA 2DAQA 1M90C 2SRCA 4R56A 1IXDA 2VGNA 2L2PA 4KGZB 2ZNJA 2X51A 1FYNA 4IUTA 2JMCA 4C0FA 1QVGA 3LC0A 3O5ZA 3LYIA 2Z0WA 4RUGA 2HKQB 2M51A 3BE3A 2DU5A 3M0RA 2YWWA 5A0LA 4IURA 3A5ZA 1RI0A 2D9TA 2EGEA 4RKUE 1D1AA 3CQTA 2BZYA 4CC2A 4Q5WA 5GJVB 2GGRA 2FZGB 2F5KA 5KYYB 2IIMA 1NJ5A 4J9DA 3C94A 3L4GB 2ZPEB 3VYHB 3M4YA 2JS2A 3NHNA 2RB6A 1J5WA 4WJ4A 1QCOA 4II1A 4MMKA 3SD4A 1HK9A 1BKBA 3MQZA 4BE2A 1T0HA 2F2VA 4DBRA 3CMEA 1YJNQ 3KUFA 3ICAA 2J6FA 1VQ9T 3E2UA 3CCSQ 3TEEA 3JB9H 2ZZFA 2ZZGA 3EFRA 1PC0A 1OQKA 3CC7T 4H2SA 1WU7A 2CSQA 1OULA 2J7IA 1OPKA 2JVVA 3VS0A 1KIKA 2C06A 1VYTA 1M9SA 4DBHA 3JCMc 3CD6T 3J80E 1PSEA 2RNAA 2ODRC 2B8AA 4M78E 4QQ6A 4JJCA 2NUZA 4HCZA 1NM7A 2KQWA 5GANe 3DB4A 4BDZA 1NEBA 4KT0E 1ACMB 4KGXB 5FU7B 2LNVA 4TVWA 3S3MA 3OQ5A 4ZGEB 3OMGA 2E12A 2M0OA 3SWNC 3V7RA 3PIOA 3A98A 1SSFA 1TOVA 1IGQA 2E65A 3TEHA 3JB9F 2HKNA 1PSFA 1M3BA 4X1VA 3QZ9B 3WXMB 4DQ2A 1WIEA 1F1BB 2XI9A 2CP3A 2ZAEA 3CMAT 4AFUC 1G2BA 2YSQA 3PCOB 3OYJA 3CCEQ 4KUIA 3EG2A 3OY9A 3UH0A 1VYUA 4E7IA 2CP7A 1VQ6Q 1GCQA 2QEXA 3L42A 5GMKi 1Q7YU 4F7UE 1QVFA 1K9MR 1TU0B 4BE0A 4NL2A 1IRXA 1SPKA 3CCRQ 4HVUA 5AYFA 3VQWA 5GAN2 1KQSS 4HVCA 3VYGA 2CKKA 2YRCA 2RI3A 4KH1B 1ZSZA 4UP8A 5FLXE 3MEWA 4EX5A 1WJRA 5C6SA 4C92C 1YFRA 3L2UA 1PD0A 4C5EA 5HK3A 5GAOl 1HC7A 3CC4Q 4M78G 1CKAA 1T3SA 2BIVA 1ZSGA 1X6OA 3JB9D 4KQEA 5KYUB 1IHVA 5HY6A 2K3YA 4P75A 4P74A 4LVMA 1VUBA 4YCVA 3A8OB 3LH5A 1E6GA 2O2OA 2R57A 5GAOn 4JJNK 1QVGP 1EVLA 4XTWA 4P72C 2VGMA 2W0ZA 1PRLC 2A8EA 1ZUYA 3PZCA 2HL3A 5DLQE 3CCLT 3A8LB 2OI3A 4UPAA 3OYYA 1YJ9T 3CC2Q 4ZGJB 4MZPA 1HYOA 4C8QF 3RKXA 5I11A 2MWOA 3CCMQ 2EQKA 4G84A 1UGQB 2X4YA 3HFZA 4K86A 5FWBA 2R5MA 2RQUA 1QLYA 2GTJA 2GBQA 3I35A 2OTLQ 4RMOA 4C5IA 2MMPA 5GMKh 1H92A 4J5YA 3TSWA 2CZ7B 3EHRA 4H02A 4PG3A 2E64A 5HGQA 3QYGB 4M4ZA 1NJIR 2HEQA 2RA2A 2DERA 2ARUA 4ZTJA 5KNNA 2EJFA 2L3RA 2ROTA 3UGQA 1D3BB 2AHJB 1RIQA 3MP8A 4EMGA 1ZUUA 2E6ZA 4QQGA 2M1HA 2XKOC 4ATOA 1HTTA 4P73C 2KXDA 2E10A 1SHFA 3IQLA 1ADYA 4DBQA 2DJQA 3SHWA 4C8QD 4D6WA 4YP0A 2RHZA 3MEVA 3VJPA 1X75C 4WJ3M 1BBWA 1IHWA 3RDVA 4YRLA 2E5KA 4JJBA 5IN1A 5IHKA 2H3JA 2DK3A 1JU5C 1UDLA 3ZEHA 2ZGWA 2YHTA 4EIKA 3G7ZA 3JB9I 4HT8A 4M7DE 1D09B 2E70A 3PVQA 2CT4A 2XMFA 1VQOQ 3JCMW 1IB8A 3M56A 1X2GA 1K9MU 2X4WA 1WHMA 2JJ9A 4XAXB 1U1TA 2K79A 3CBOA 4LXCA 2LX7A 4IUUA 3CXCP 2K7AA 3M0SA 1MNEA 8AT1B 1BI2A 1VIFA 2QEXT 4KR2A 1Q81C 2ARSA 1QE0A 2OJ2A 3CBPA 2PZ1A 4A4HA 4OGEA 3GBQA 2K5LA 1QKWA 1Z9ZA 2KSSA 2EGCA 3H0FA 3OB9A 2ABLA 4C0DB 2JXBA 3OW2S 3TU4K 3L2RA 1E6HA 5AT1B 3NFCA 1Q86R 3V7SA 3FB9A 3VBBA 1X6GA 2A0FB 2VB6A 2X9HA 4R0KA 1M3CA 4J6XA 3UF4A 3CCQT 6AT1B 2ARTA 3M58A 1UGPB 5D7UA 3HFNA 1UB4A 2JS0A 4M78C 4Z02A 4E7JA 3HSBA 1YITA 3IALA 2AKKA 2M9UA 2DU7A 3VS4A 2CP2A 2NUTB 2JZ2A 1EIYA 1WXTA 2PTKA 4A63B 1KC8C 1Q95G 1I81A 2IVWA 2HSPA 3EHQA 3UWNA 2AT1B 3HXXA 3I55Q 4RTYA 2JM9A 3A8HB 4D8DA 2CJ9A 3H41A 1WJSA 1G5IA 1OU9A 3PNWC 1YWPA 2LP5A 4A4KA 1JRIA 3FDRA 2C8MA 1B7TA 5I21A 2Q5HA 4FW1A 3UFGA 1YB3A 3EG9A 1B7YA 1X6BA 3QWXX 2HQHA 4M7AE 1G3YA 2RF0A 1YFTA 1K73C 1VQKA 2L3SA 2FHDA 4H2TA 3OS5A 2HCKA 3CPWS 1H3ZA 4TVYA 1QF6A 1YHQA 4RQEA 2EQJA 5CKHA 2RD1A 5KE3A 1BK2A 4QT7A 3CC7Q 1G3WA 2H8HA 3H0IA 2COWA 4L6V5 1VQMA 3CCUA 4AT1B 4WTOB 5LJ5j 1JO8A 4HCKA 4E7ZA 5GANj 2RHXA 4B9WA 2HD0A 3FEOA 4C8QB 3THKA 4FCYA 2D0QB 2K3XA 3KBGA 5I2MA 5IT9E 3OYIA 1SETA 4CH6A 4Z88A 2ZR3A 1OV3A 2FYKA 1Z7MA 3SWNA 5LL6S 2FZKB 1HJDA 4OLFA 4TTVA 5GAMg 2CSIA 1W2BA 4MMLA 2JOYA 1VQ5Q 2V8KA 4RG2A 1JEGA 1WQ7A 2KR3A 2RI2A 3QSUA 1R8OB 2A08A 2AZVA 3VV0A 1Z7NA 2L5QA 1N8RR 2M02A 1SEMA 4LNPA 1RL2A 1VQZA 2QG9B 2K6DA 3EFOB 1YI2Q 4RTZA 1VQ4A 1AZGB 3OYMA 5C52B 2DTOA 3QTCA 4JZ4A 2GQIA 1RUWA 5A0GA 2RHSB 4TQFA 3D7SB 5IXBA 2FPEA 4P75C 3QBYA 3HXWA 4YREA 1IREB 1BBZA 1OX8A 2HMAA 4HWOA 3OYDA 3DLMA 1EZZB 1RLQC 5GAN3 2GNCA 2PU9B 1Y7XA 3SEMA 3G6EA 1C1AA 1WLPB 4F14A 3NEMA 3ZL7C 4OVAA 1I8FA 5GANf 3H6ZA 2EIFA 1MGQA 4CC3A 4J9BA 1AOJA 2RMOA 2QGFB 2QQBA 4C92A 1VQ8A 1TS9A 1QP2A 1M8VA 2ZNIA 2K2MA 3JV3A 1H641 3MP1A 2XDPA 5KCHA 4JJDA 4OP0A 3M59A 4XK8E 5I22A 4QW2A 4LDVA 1KD1R 1VQNQ 2EYYA 4GBQA 3JCMP 1Q86U 2P4RA 3Q1JA 1E7OA 1B34B 1PHTA 4XTVA 1SG5A 4P72A 1PM3A 1MNDA 4HWSA 2MPXC 4J9CA 1N9WA 1KG1A 3NGPA 3GP8A 4K87A 3A1PA 4CRIA 5CKBA 5GJWB 2DBKA 2NS6A 2RHUA 1ZLMA 1LPLA 3PVLA 5C0MA 5K1XA 1WZOA 3VS1A 5FRNA 1PKSA 3HKSA 3GNFB 5GMKe 3CCLQ 1NLPC 2ZCEA 1YJ9Q 4PL6A 5GAMf 4O6JA 1Q82C 2LTOA 1M27C 1DJ7B 3CCVA 1B34A 2A37A 1RAIB 5EC7A 4YRPA 1Q7YC 4HCCA 1Y96A 2R58A 4M77E 1QVGS 1Z9QA 4JDSA 4A54A 1VQPA 3M57A 2JTFA 3C12A 2YXYA 3GIBA 1GXIE 4P73A 4YRGA 2K9GA 3OYLA 1ZHIA 2DDZA 1M1GA 1I4K1 2CH4A 1S72A 1GBQA 4XU3A 4VUBA 4BI4A 3A5ZB 4TVAA 1I5OB 2Y4YA 3QXEB 2EL9A 1FMWA 3LX7A 3NTHA 1VQLT 4BD3A 1M1KC 1G5VA 1VQMT 1AWXA 2A3LA 1PYSA 3VQXA 5FU6C 2SEMA 2RHQA 11ASA 3FLGA 2P0QA 3OBYA 1W2BP 2CZ0B 4CH4A 2GTOA 1R77A 4BDYA 2HZYA 3WQZA 3A32A 5GAOm 4QVZA 4PJJA 1FX7A 1PCXA 4A4EA 1EVKA 4LDUA 4LVIA 4OGCA 2KI7A 3I56A 1ZA1B 5KYWA 3V8JA 1H4QA 2DRMA 1KK7A 3FRNA 2LCSA 2CS7A 1QWFA 1VQ4T 3BJUA 4PJOE 1TUDA 3QZ5B 1FXXA 3VUZA 1KFZA 3DKMA 1B70A 2AKWA 1M30A 4M77G 1USYC 4CH5A 4XU2A 2LNHB 4RTUA 1K8AR 3OYNA 1OYXA 1VQ7A 2OTJA 4FYXB 3UT1A 1AWWA 1M90R 1H4VB 2YLBA 2PMFA 2JT4A 2XIDA 1M2VA 1WXUA 4M75E 1M8MA 1KD1U 3RR6A 1V76A 3DLLA 4KR3A 1WHJA 1RACB 4M7AC 1TUGB 3G4SQ 1YJWA 3EG3A 2LJ1A 3X28B 4RG8A 3TEHB 4Q6GA 4IIOA 3CCJA 1Y71A 2ZZDA 4M78A 3JCMb 4XTZA 3NELA 4LDYA 2RQWA 3CXCS 5ECAA 2L3PA 4XTXA 1U8RA 2MCNA 3PGGA 3MCAB 4YCWA 2E1HA 5GAN8 1WPYA 4MDWA 3CCQQ 2LMJA 2VWFA 3E19A 2K57A 3MPUB 2K5IA 2FRYA 3P8BB 3QO7A 4C0GA 3NTIA 2QA4T 1I1JA 2C7IA 4E51A 1ZSZB 3L2QA 2RI5A 4FM4B 2ROLA 4PJOG 1XJWB 1ABOA 2YRVA 1BYMA 2F1LA 4NCXA 1GL5A 1G5HA 3L2WA 3JSCA 4F7UA 2EQUA 4CS4A 3CCVT 3KXTA 1YIJT 2DTHA 4JS5A 2NUPA 4RTWA 8ATCB 1K0XA 4OB2B 5KYNA 1VQPT 4OB0B 2V26A 4X9CA 3NETA 1OZ3A 4F16A 1VYVA 2DVJA 2YLCA 5D6YA 5DLOA 1GFDA 3G71Q 3OYGA 1QWEA 1SSHA 4LD6A 4YRKA 1BCMA 1KSWA 1NPRA 4E2FB 4P3PA 2Q7GA 1D0XA 5GAMe 1YJNA 3BDLA 2COZA 1Y57A 2EBPA 2JMAA 3CCSA 3HXYA 2V1QA 1LVKA 1X2KA 3RNJA 5LJ3g 3HFZB 3LWHA 2FL7A 2NYSA 2DXTA 1YGBA 4RCBA 5LJ3d 2RK2A 3RIRA 5LJ3h 4C5GA 1AWOA 2DMOA 4LE9A 4B9XA 1K0SA 1OPLA 1KHIA 3EG1A 4CS3A 4GLMA 1J3TA 2CP5A 4OF1A 3MO8A 2FZCB 2LC4A 2ZT7A 2EYXA 2CUBA 3HRUA 1AWJA 3PFSA 3OS2A 4ESRA 2ODRD 2D8HA 2HNIA 1K8AU 3IG2A 3I5RA 4F04B 1NJIC 1M90U 2CIMA 3A7RA 4CC7A 1ZA2B 2DYIA 2D1XA 2LQNA 3URGA 3QPHA 4ZGDB 4F7UG 4C92F 3M0TA 1BIAA 2CREA 1UHFA 4M77C 1UG1A 1OEBA 4UP9A 3IKMB 3QIIA 3QWYA 1VQ7T 2OTJT 3CCEA 1KQSA 1SHGA 4BY6B 4OMPA 2KYMA 3CMET 5CQXA 1VQ6A 2AIRB 5CKDA 5L8RE 1WLEA 2COYA 4HVVA 2YDLA 1X55A 2LQ8A 4NOYA 1YJWT 4WI1A 2ZPIB 3OA6A 3CCRA 3UA7A 4UC4A 2KK4A 3RKYA 4LVLA 4EMKC 3JCMQ 4DOVA 3CCJT 3M4QA 4N4IA 2P84A 3WVDB 5GMKj 2MK5A 1L0WA 5KYXA 2J6OA 2PMEA 1TSFA 2QHVA 1N6AA 1NPPA 2DZ9A 2XHCA 3CC4A 4V2SA 4J8OA 1K4US 2CYZB 3LLRA 3X26B 1QP3A 1G3TA 5GAN7 4OB1B 3HTRA 2DEUA 1NJ8A 4R55A 4C92D 4OMMA 2EWNA 5CKEA 4BACA 1FYFA 4TWAA 1LOJA 1OI1A 3QO5A 4LD9K 1V1CA 5HCKA 1GCPA 2LT1A 2X3XD 2E5QA 1D1BA 4JS4A 3UA6A 1IL2A 4EO4A 3EGUA 2M0YA 4HWPA 3A5YA 3CC2A 4FU6A 1MHNA 4PJOC 3GOXA 2MAMA 2YT6A 4ANJA 2QI2A 1SESA 3CCMA 2HBPA 4WF2A 1JXOA 4MZTA 1QVFP 2L89A 4H2WA 1KMMA 3EH2A 2EKOA 4GLKA 5IXFA 3JCMd 2OTLA 3JCMh 5CAIA 4BW9A 1EIYB 5A2QE 3JRZA 1UJYA 1W4SA 3LSQA 4M75C 4FYYB 4OMNA 2EFIA 3OSSC 3MF1A 1VQLQ 5KCOA 2CT3A 3NENA 4YRSA 2VYTA 3C0CA 3RKWA 2V8JA 2DQ3A 1YFNA 5M9OA 2BE7D 2PUOB 4JRQA 5GAN6 4TVRA 3EG9B 3CMQA 2XG8D 1B7YB 4N4HA 4KGVB 3V8KA 1O75A 1QW1A 1XOVA 4FSSA 4XEMA 2RJDA 2WSCE 3REBB 1JQQA 3OMCA 4BUGA 1USYA 4JLGA 1Q81R 3PMIA 5ELNA 4M7DG 3P8VA 3OYAA 2IY5A 3HFVA 1B07A 2DF6A 3HXUA 3REXA 2VASA 2CZ6B 1H4SA 3SWNB 5IAYA 3ZBDA 4M7AA 3M5AA 5FROA 3ER0A 1ZQ1A 1UGSB 3S3OA 1SKUB 1VQOA 2RJFA 1ADJA 3HRTA 3EFSA 2E41A 5LJ5d 5LJ5h 4AMCA 2I0NA 3QDFA 1VQ9Q 2KRMA 2RO0A 5GANh 1KQSP 2DO3A 3MP6A 2DIGA 1PWTA 1UEBA 1KOGA 1KC8R 3CCET 1TWBA 4RQFA 4M78F 1HXDA 2DVEA 3OW2A 2DPPB 2KT8A 1N8RC 2I4MA 3CD6Q 1OU8A 4ELZC 1YFSA 3JCMJ 4J9IA 2A7YA 2C0IA 2DFUA 2ESWA 2EW3A 2AKLA 3HY1A 2D6FA 1NE8A 1WQWA 2KBTA 2ENMA 2BTTA 3DSQA 4H2XA 2E3IA 2V1RA 3FC3A 4CS2A 1PKTA 3RBBB 5CQYA 2YUPA 2A36A 3AT1B 2K2VA 2X4XA 4C92B 2QA4Q 5FU7C 2O9SA 2I4NA 4QVDA 4FT4A 2ZZEA 3TSZA 1K9AA 2PNIA 4J7IA 3CC4T 4RTVA 1W66A 4FW2A 1I5LA 2KROA 2X35A 3BY7A 3F70A 3E9GA 3JCMV 4J9EA 2DILA 2HQXA 1ASZA 3S3NA 4J9GA 2M16A 2ZPBB 1M1FA 4Y91A 3JCMX 1EOVA 2EJGA 2VXFA 3CMAQ 4F7UF 4EPCA 3M55A 2EGAA 3BW1A 5E3IA 1YIJQ 3JB9J 4M78D 4CI0C 3V8LA 5IHIA 3X24B 3I55A 4QQDA 1X56A 4M7AG 1JJ2A 2A28A 2FO0A 3NMZC 5KH6A 2Q7HA 2OAWA 3CC2T 4H2UA 5GAMj 3CPWA 1X01A 2BE9B 3CCMT 3H0HA 2X4JA 3M54A 3ULRB 3QJYA 2JTMA 2C0OA 5LJ3e 3EGXA 4RDXA 4F17A 2O9VA 1YCYA 2AK5A 1U06A 1G83A 4DA4A 2YUOA 1SF9A 4C8QE 3MEYA 2DL3A 2PUKB 4IKFA 1U1SA 4AFQC 3MF2A 2EYWA 2QTXA 1WA7A 2JN0A 3CC7A 2DD4A 4X5OA 1Y96B 1W70A 3UGTA 5J26A 2J6KA 4YTLA 4O2DA 5D6XA 3G1JA 2F69A 3M53A 1UHCA 5F5WA 4FIBA 1U3OA 2KRNA 4ZN3A 1RLPC 1Q81U 1B76A 3OYCA 1JJCA 2CH4W 2DZCA 1VQ5A 1YITT 4TVAB 3PTAA 4XU0A 2JM8A 1M3AA 1QCFA 2RQVA 2LCLA 2ZT8A 5GAOq 4CC4B 2ZIOA 4M77A 2KXCA 1LJOA 1YI2A 2FPDA 2XDBA 3I7FA 1PYSB 1MMAA 1RAEB 2RHQB 2QQRA 3CPFA 4M7DC 1AEYA 3M0QA 3VS3A 4YRRA 2F5TX 4JLIA 2MOXA 3HFOA 4Y92A 1HSQA 4DBFA 5HKCA 1MV3A 4E7KA 4YRQA 4FSXA 3META 3MKDA 2ZIMA 1KC8U 4EMKA 2AMCA 2BZXA 1WX6A 1VQOT 4HT9A 3FJ5A 1CSKA 3CMEQ 1X27A 1NYRA 5KYWB 1WYXA 4OB3B 1VQKT 4PFPA 3SB2A 2FVUA 4YROA 3P8TA 2D8JA 3P8DA 1Q82R 1YHQT 2J05A 2O4XB 2LJ0A 3H8ZA 2CP0A 2AKWB 1B70B 2LDMA 3CCUT 2ALYA 1VQNA 2O88A 3CBMA 2VC8A 1Y0MA 2O01E 1K73U 3PIPA 2L0AA 2ZTGA 2EPDA 2L3QA 1M2VB 2CJAA 3MHXA 4QVCA 5DM7R 3INZA 3OS1A 2GFAA 2RN8A 1NYGA 4EMHA 4KBMB 3LGLA 4YDQA 2ECZA 3OD1A 4YCUA 2GFUA 1X43A 3W3SA 4EDUA 4C0ZA 2DL8A 5D6WA 1WHLA 4PJOA 2MYSA 2RK1A 3QG1A 2NLUA 5GMKl 4LUEA 2K5FA 1VA7A 2O4XA 4PK4A 1GBRA 2CGHA 4M78B 2RH2A 4NL3A 3JCMe 3MEAA 1M1KR 1W1FA 5GAN4 3CCLA 5K1PA 1YJ9A 1OOTA 2EKHA 1X2QA 2QGGA 4KUDK 4M75A 2RHYA 1JJ2P 2KGTA 1TXQA 4OMFB 3G6ET 3VQVA 2P5IA 1H8KA 3EGDA 1NNHA 3M4GA 2C0TA 2IG0A 3CPWP 1TTHB 4J6YA 5L23A 3I55T 4YRJA 4BE1A 2QEXQ 5I2SA 2QQAA 2YRDA 2MWPA 1K76A 1ARKA 3VKIA 5C53B 1VQ8T 4HA8A 4RTTA 4DEXA 4TQDA 4PKCC 4ZIBA 3VS2A 2G4CA 4M7DD 2LQKA 4PNOA 1UJ0A 2LT4A 4C0DC 2EJ9A 1XQHA 1QVFS 1BIBA 1GRIA 1TH7A 4F7UB 1QMCA 2DL7A 4ORZA 2EQIA 1B3QA 2OAUA 2NUPB 5GAOp 3LW5E 4XTUA 5GAOr 4J83A 3QO8A 1JXMA 4KULA 1A0NB 1G51A 2P0PA 2VUBA 2CP6A 4N0AC 1M2OA 4ELYC 4DPGA 1R0BG 3E9FA 3QHSA 1XTDA 2VXEA 3OS0A 2Y90A 5KYYA 4AG1C 1T0JA 2DRKA 1ZBJA 3CEYA 4C5HA 3A7UA 3L4GA 5LJ5e 2RHIA 3P8HA 3VRZA 1VQ5T 1FWZA 3GLXA 1T3LA 1RABB 3OYKA 4QKUA 1K9MC 2QDLA 4M7AF 1H4TA 2D0NA 3L2ZA 4E7SA 3JAME 1YI2T 1EIFA 2KT1A 4A53A 1YN8A 3OBWA 1ZX6A 4M75G 5CO7A 3TEGA 1XNIA 1N9RA 1NYQA 1C6VX 2HAXA 3QYHB 2G6FX 2FPFA 1Q82U 2QHTA 4UP7A 2I4LA 2ED1A 2ZPGB 3SDZA 4YYEA 1S72T 4Z8AA 2K3BA 4JRIA 2QYZA 4AH6A 2E4HA 3HXZA 1R0CB 3LSSA 2LRQA 3CXCA 4P3NA 4C8QC 1D0YA
chains in the Genus database with same CATH topology
1E1TA 3G4SA 2CZ1B 1AHJB 4FL6A 1NJ1A 3P8YA 1KQ1A 1KHCA 2MI6A 1VQNT 4BB7A 5CIUA 4M7AD 1WJQA 2LCCA 4P3OA 4Y28E 1N9SA 3GPLA 1M4ZA 3CCQA 3PCOA 4IUPA 5ELOA 1M1KU 4YRIA 3I56T 4Q15A 2Y4XA 1E24A 3FIFA 2G3RA 4MDXA 4N4GA 2XGTA 2RM4A 4H2VA 3J81E 1X2HA 1WYDA 5LJ3j 4G85A 2ZPFB 1SRYA 1E22A 4HKEA 3C4SA 2J3LA 4X9DA 1WNLA 4RCCA 2XTIA 2BKDN 2ZXFA 4M7DB 3E9IA 1ATIA 2P0KA 3RGLA 3BDUA 1NJ2A 4J7FA 3G71A 1LYLA 2R5AA 5CKFA 4XU1A 2XK0A 3LWIA 3OYEA 1P92A 2DD5A 3OYHA 4MZMA 1EFWA 3X20B 5FU6B 3X25B 5LJ3f 2JNGA 4P71C 4M7DA 5C51B 3R07A 4PHCA 4M77F 5EG2A 3HRKA 5FRMA 3LH0A 3E1SA 4YPFA 4PLLA 2J3MA 4HWTA 3UPUA 4ZTZB 3S6WA 1D3BA 3JCMg 2DJZA 3HPWA 2E5AA 2ZT6A 4ZTUB 1Q86C 4HT4A 3R6OA 3RF1A 4JRPA 2IY5B 4JRKA 4LVKA 2WSEE 1YJNT 2DIQA 2I2LA 3A7AA 4M77D 4M7AB 5CVIA 3CCST 3ERRA 3G4ST 3HHTB 3LGFA 3HP9A 3IKLA 4LVJA 2GCXA 3QNEA 4ZTFA 2CJBA 5DY9A 3DB3A 3OYFA 2PVGB 4PJOF 3HRSA 4BI3A 2DXUA 3OYBA 2FB7A 3V7CA 4LNSA 4ZN1A 3HRIA 1W2BS 3VUBA 4NS5A 4P5NA 2L8DA 2EQMA 4RMFA 4M75F 1X54A 1BI3A 5CR2A 3GNGA 5LJ5g 4DOWA 4C8QC 3ME9A 5GANg 4L59A 4H2XB 4JUVA 3RACA 3OSVA 4YRCA 2PVOB 1BI1A 2EYQA 3A74A 5GANd 4O5VA 1B8AA 3HTZA 3C95A 1ZBXA 1NJ6A 3TREA 3UDCA 1BBUA 2ZCFB 1QVPA 2HQEA 2VV5A 1V29B 2DTIA 3M9QA 1NJIU 3JCMf 4PJOD 1VQ6T 1JJ2S 3A31A 4N0AA 4IUQA 2DQ0A 3RMQA 1KQ2A 3RUXA 3QKJA 3HXVA 2QHUA 3CCRT 3A8MB 1G3SA 2QXFA 2DXBA 3G71T 1VQLA 2ZINA 2WACA 4M75D 4HCBA 4PLIA 4YRTA 4XTYA 3E9HA 4L5GA 4E7LA 2LVMA 1SERA 2LX9A 5CCAA 4XEOA 4ME7A 2WSFE 5GAMd 4BI8B 5GAMh 2ZR2A 4FT2A 3O8VA 4A4GA 3KFUA 5GMKm 2KVQG 1KD1C 1GGMA 2Q5IA 2ZT5A 3L2VA 1N27A 5CK9A 4P74C 2MF2A 2RJCA 3HL8A 4BWAA 3GF5A 3ASKA 3EAEA 4C8QA 2P4TA 2KMTA 1JJCB 1ASYA 3JB9G 3NTKA 2E6NA 1WGSA 5LJ5f 12ASA 4LDWA 2OTLT 1VQ9A 3RL6A 4M77B 2PVDB 1LNXA 5KE2A 3QUIA 2V8IA 3ZFJA 2QQ9A 3BFMA 2P0LA 2RJEA 1Y07A 3RMSA 2QDYB 4LDXA 4C92E 2RHSA 5J3BA 3QDRB 3G1ZA 1BI0A 3CD6A 4CH3A 2QHSA 4K88A 4A4FA 3SFMA 4EMKB 2AMCB 2K4YA 4YRMA 3VQYA 3AHUA 4GY5A 4E7HA 1O9SA 4XQ3A 2XD0A 4H2YA 5HK0A 2PQWA 3PMTA 2QA4A 2Q7EA 3T9NA 5GAN5 4HWRA 4YRFA 2KDSA 1OZ2A 2ALYB 3FJPA 1IZ6A 2ZPHB 3REUA 1JB0E 1YBYA 2JUFA 3VU3C 5J39A 3QJ6A 2QQSA 2KAFA 3CMAA 2KY9A 1E1OA 1EQRA 3WVEB 1YIJA 2XDDA 1JBMA 2DKGA 1UGRB 4IUVA 4E47A 4J6WA 4C8QG 4PJOB 4BY6C 2EAYA 4YRNA 5A0DA 3M4PA 4J15A 3MEUA 3TUPA 2E3CA 1KMNA 3TCJA 3J7AF 2XU8A 2GQVA 4P71A 4C92G 2BUDA 3A8GB 4M75B 3L1AA 3N5BB 2DXCA 1M5Q1 2DEQA 2I4OA 3RESA 1NZ9A 4M7DF 3RERA 2XICA 3HY0A 3QO3A 1K8AC 4X34A 1VIEA 1N8RU 4L87A 3PT9A 1C0AA 2GF7A 2DAQA 1M90C 4R56A 2VGNA 2ZNJA 4IUTA 4C0FA 1QVGA 3LC0A 3LYIA 2DU5A 5A0LA 4IURA 3A5ZA 1RI0A 2D9TA 4RKUE 4Q5WA 2F5KA 1NJ5A 3C94A 3L4GB 2ZPEB 3VYHB 3M4YA 2RB6A 1J5WA 4WJ4A 4II1A 4MMKA 3SD4A 1HK9A 1BKBA 3MQZA 4BE2A 3CMEA 3KUFA 3ICAA 1VQ9T 3TEEA 3JB9H 2ZZFA 2ZZGA 3EFRA 3CC7T 4H2SA 1WU7A 2JVVA 2C06A 1M9SA 3JCMc 3CD6T 3J80E 1PSEA 2ODRC 2B8AA 4M78E 4QQ6A 4HCZA 2KQWA 5GANe 3DB4A 4BDZA 4KT0E 5FU7B 2LNVA 4TVWA 3S3MA 3OQ5A 4ZGEB 3OMGA 2E12A 2M0OA 3SWNC 3V7RA 3PIOA 1SSFA 3TEHA 2E65A 3JB9F 1PSFA 3WXMB 3QZ9B 4DQ2A 2XI9A 3CMAT 3PCOB 3OYJA 4KUIA 3OY9A 3UH0A 4E7IA 2QEXA 3L42A 5GMKi 1Q7YU 4F7UE 1QVFA 4BE0A 4NL2A 5AYFA 3VQWA 5GAN2 1KQSS 4HVCA 3VYGA 2CKKA 2RI3A 4UP8A 5FLXE 3MEWA 4EX5A 1WJRA 5C6SA 4C92C 1YFRA 3L2UA 4C5EA 5GAOl 5HK3A 1HC7A 4M78G 2BIVA 1X6OA 3JB9D 4KQEA 5HY6A 2K3YA 4P75A 4P74A 4LVMA 1VUBA 4YCVA 3A8OB 2R57A 5GAOn 4JJNK 1EVLA 4XTWA 4P72C 2VGMA 2A8EA 3PZCA 5DLQE 3CCLT 3A8LB 4UPAA 3OYYA 1YJ9T 4ZGJB 4MZPA 4C8QF 3RKXA 2MWOA 2EQKA 4G84A 1UGQB 2X4YA 3HFZA 4K86A 2R5MA 4RMOA 4C5IA 2MMPA 5GMKh 4J5YA 4H02A 2CZ7B 4PG3A 2E64A 5HGQA 3QYGB 2RA2A 2ARUA 4ZTJA 5KNNA 2EJFA 2L3RA 3UGQA 1D3BB 2AHJB 1RIQA 3MP8A 4EMGA 2E6ZA 2M1HA 4QQGA 4ATOA 2XKOC 1HTTA 4P73C 2E10A 1ADYA 4C8QD 4D6WA 4YP0A 2RHZA 3MEVA 3VJPA 1X75C 4WJ3M 1BBWA 4YRLA 5IN1A 2H3JA 2DK3A 3ZEHA 2ZGWA 2YHTA 3G7ZA 3JB9I 4HT8A 4M7DE 2E70A 3JCMW 3M56A 1X2GA 1K9MU 2X4WA 4XAXB 1U1TA 3CBOA 4IUUA 1BI2A 1VIFA 2QEXT 4KR2A 1Q81C 2ARSA 1QE0A 3CBPA 4A4HA 4OGEA 2K5LA 2KSSA 3OB9A 4C0DB 3OW2S 3L2RA 3NFCA 3V7SA 3FB9A 3VBBA 4J6XA 3CCQT 2ARTA 3M58A 1UGPB 3HFNA 1UB4A 4M78C 4Z02A 4E7JA 3HSBA 1YITA 3IALA 2M9UA 2DU7A 1EIYA 2JZ2A 1KC8C 1I81A 2IVWA 3UWNA 3HXXA 3A8HB 2CJ9A 1WJSA 1G5IA 3PNWC 4A4KA 1JRIA 3FDRA 2C8MA 5I21A 2Q5HA 3UFGA 1YB3A 1B7YA 4M7AE 1G3YA 1YFTA 1K73C 1VQKA 4H2TA 2FHDA 3OS5A 1H3ZA 3CPWS 4TVYA 1QF6A 1YHQA 4RQEA 2EQJA 5CKHA 2RD1A 5KE3A 1G3WA 4L6V5 1VQMA 3CCUA 5LJ5j 5GANj 2RHXA 4B9WA 2HD0A 3FEOA 4C8QB 2D0QB 2K3XA 3KBGA 5I2MA 5IT9E 3OYIA 1SETA 4CH6A 2ZR3A 2FYKA 1Z7MA 3SWNA 5LL6S 4TTVA 4OLFA 5GAMg 1W2BA 4MMLA 2JOYA 2V8KA 4RG2A 1WQ7A 2RI2A 3QSUA 1R8OB 3VV0A 1Z7NA 2L5QA 1RL2A 1VQZA 1VQ4A 5C52B 3OYMA 2DTOA 3QTCA 5A0GA 2RHSB 4TQFA 4P75C 3QBYA 3HXWA 4YREA 1IREB 4HWOA 3OYDA 3DLMA 5GAN3 2PU9B 1Y7XA 3G6EA 3NEMA 4OVAA 1I8FA 5GANf 3H6ZA 2EIFA 1MGQA 2QQBA 4C92A 1VQ8A 2ZNIA 1QP2A 1M8VA 1H641 3MP1A 2XDPA 5KCHA 4OP0A 3M59A 4XK8E 4QW2A 4LDVA 3JCMP 1Q86U 3Q1JA 1B34B 4XTVA 4P72A 4HWSA 1N9WA 1KG1A 3GP8A 4K87A 4CRIA 5CKBA 2NS6A 2RHUA 5C0MA 5K1XA 5FRNA 3HKSA 3GNFB 5GMKe 2ZCEA 4PL6A 5GAMf 4O6JA 1Q82C 2LTOA 1DJ7B 3CCVA 1B34A 4YRPA 1Q7YC 4HCCA 1Y96A 2R58A 4M77E 1QVGS 4JDSA 4A54A 1VQPA 3M57A 2JTFA 3C12A 3GIBA 1GXIE 4P73A 4YRGA 3OYLA 2DDZA 1ZHIA 1M1GA 1I4K1 1S72A 4XU3A 4VUBA 4BI4A 3A5ZB 4TVAA 2Y4YA 3QXEB 2EL9A 3LX7A 3NTHA 1VQLT 4BD3A 1M1KC 1G5VA 1VQMT 2A3LA 1PYSA 3VQXA 5FU6C 2RHQA 11ASA 3FLGA 2P0QA 3OBYA 2CZ0B 4CH4A 4BDYA 3WQZA 3A32A 5GAOm 4QVZA 1FX7A 4A4EA 1EVKA 4LDUA 4LVIA 4OGCA 3I56A 3V8JA 1H4QA 3FRNA 2CS7A 1VQ4T 3BJUA 4PJOE 3QZ5B 2AKWA 1FXXA 3VUZA 3DKMA 1B70A 4M77G 1USYC 4CH5A 4XU2A 3OYNA 1OYXA 1VQ7A 2OTJA 3UT1A 1H4VB 2YLBA 2PMFA 2XIDA 4M75E 1KD1U 3DLLA 4KR3A 4M7AC 1YJWA 3X28B 4RG8A 3TEHB 4Q6GA 3CCJA 1Y71A 2ZZDA 4M78A 3JCMb 4XTZA 3NELA 4LDYA 3CXCS 4XTXA 1U8RA 3PGGA 3MCAB 4YCWA 2E1HA 5GAN8 1WPYA 4MDWA 3E19A 2K57A 2K5IA 3P8BB 3QO7A 4C0GA 3NTIA 2QA4T 2C7IA 4E51A 3L2QA 2RI5A 4FM4B 4PJOG 2YRVA 1BYMA 4NCXA 1G5HA 3L2WA 3JSCA 4F7UA 2EQUA 4CS4A 3CCVT 3KXTA 1YIJT 2DTHA 4JS5A 4OB2B 1VQPT 4OB0B 4X9CA 3NETA 1OZ3A 2YLCA 5D6YA 5DLOA 3OYGA 4YRKA 4LD6A 1NPRA 4P3PA 2Q7GA 5GAMe 1YJNA 3BDLA 3CCSA 3HXYA 5LJ3g 3HFZB 3LWHA 2FL7A 2DXTA 1YGBA 4RCBA 5LJ3d 2RK2A 3RIRA 5LJ3h 4C5GA 4B9XA 1KHIA 4CS3A 4OF1A 3MO8A 2LC4A 2ZT7A 3HRUA 3PFSA 3OS2A 2ODRD 2HNIA 1K8AU 3IG2A 1NJIC 1M90U 2CIMA 3A7RA 3URGA 3QPHA 4ZGDB 4F7UG 4C92F 1BIAA 4M77C 4UP9A 3IKMB 3QIIA 1VQ7T 2OTJT 3CCEA 1KQSA 4BY6B 3CMET 5CQXA 1VQ6A 5CKDA 5L8RE 1WLEA 1X55A 2LQ8A 4NOYA 1YJWT 4WI1A 2ZPIB 3OA6A 3CCRA 4UC4A 2KK4A 3RKYA 4LVLA 4EMKC 3JCMQ 4DOVA 3CCJT 3M4QA 4N4IA 3WVDB 5GMKj 1L0WA 2PMEA 2QHVA 1N6AA 1NPPA 2DZ9A 2XHCA 3CC4A 4V2SA 4J8OA 2CYZB 3LLRA 3X26B 1QP3A 1G3TA 5GAN7 4OB1B 1NJ8A 4R55A 4C92D 5CKEA 2EWNA 4BACA 1FYFA 4TWAA 1LOJA 1OI1A 3QO5A 4LD9K 2LT1A 2E5QA 4JS4A 1IL2A 4EO4A 4HWPA 3A5YA 3CC2A 4FU6A 1MHNA 4PJOC 3GOXA 2MAMA 1SESA 2QI2A 3CCMA 2HBPA 4WF2A 4MZTA 2L89A 4H2WA 1KMMA 2EKOA 4GLKA 3JCMd 2OTLA 3JCMh 5CAIA 4BW9A 1EIYB 5A2QE 3JRZA 1W4SA 3LSQA 4M75C 2EFIA 3OSSC 3MF1A 5KCOA 3NENA 4YRSA 2VYTA 3RKWA 2V8JA 2DQ3A 5M9OA 2PUOB 4JRQA 5GAN6 4TVRA 3CMQA 2XG8D 1B7YB 4N4HA 3V8KA 1O75A 1QW1A 1XOVA 4XEMA 2RJDA 2WSCE 3OMCA 4BUGA 1USYA 4JLGA 3PMIA 5ELNA 4M7DG 3P8VA 3OYAA 2IY5A 3HFVA 3HXUA 3REXA 2CZ6B 1H4SA 3SWNB 5IAYA 3ZBDA 4M7AA 3M5AA 5FROA 3ER0A 1ZQ1A 1UGSB 3S3OA 1VQOA 2RJFA 1ADJA 3HRTA 3EFSA 2E41A 5LJ5d 5LJ5h 2RO0A 5GANh 2DO3A 3MP6A 2DIGA 1UEBA 1KOGA 3CCET 4RQFA 4M78F 1HXDA 2DVEA 3OW2A 2DPPB 1N8RC 2I4MA 4ELZC 1YFSA 3JCMJ 2A7YA 3HY1A 2D6FA 1NE8A 1WQWA 3DSQA 4H2XA 3FC3A 4CS2A 5CQYA 4C92B 2K2VA 2X4XA 5FU7C 2I4NA 4QVDA 4FT4A 2ZZEA 4J7IA 3CC4T 1W66A 1I5LA 3BY7A 2X35A 3F70A 3E9GA 3JCMV 1ASZA 2HQXA 3S3NA 2M16A 2ZPBB 1M1FA 4Y91A 3JCMX 1EOVA 2EJGA 2VXFA 4F7UF 4EPCA 3M55A 3BW1A 5E3IA 3JB9J 4M78D 4CI0C 3V8LA 3X24B 3I55A 4QQDA 1X56A 4M7AG 1JJ2A 2Q7HA 5KH6A 3CC2T 4H2UA 5GAMj 3CPWA 1X01A 3CCMT 2X4JA 3M54A 3QJYA 2JTMA 5LJ3e 4RDXA 1YCYA 4DA4A 4C8QE 3MEYA 2PUKB 4IKFA 1U1SA 3MF2A 2QTXA 2JN0A 3CC7A 2DD4A 4X5OA 1Y96B 3UGTA 5J26A 4YTLA 4O2DA 5D6XA 2F69A 3M53A 5F5WA 4FIBA 4ZN3A 1Q81U 1B76A 3OYCA 1JJCA 2DZCA 1VQ5A 1YITT 4TVAB 3PTAA 4XU0A 2LCLA 2ZT8A 5GAOq 2ZIOA 4M77A 1LJOA 1YI2A 2XDBA 3I7FA 1PYSB 2RHQB 2QQRA 3CPFA 4M7DC 4YRRA 2F5TX 4JLIA 3HFOA 5HKCA 4E7KA 4YRQA 4FSXA 3META 2ZIMA 1KC8U 4EMKA 2AMCA 1VQOT 4HT9A 1NYRA 4OB3B 1VQKT 3SB2A 2FVUA 4YROA 3P8TA 3P8DA 1YHQT 2O4XB 3H8ZA 2AKWB 1B70B 2LDMA 3CCUT 2ALYA 1VQNA 3CBMA 2VC8A 2O01E 1K73U 3PIPA 2ZTGA 2CJAA 3MHXA 4QVCA 5DM7R 3INZA 3OS1A 2GFAA 4EMHA 4KBMB 3LGLA 4YDQA 3OD1A 4YCUA 2GFUA 3W3SA 4EDUA 4C0ZA 5D6WA 4PJOA 2RK1A 3QG1A 2NLUA 5GMKl 2K5FA 2O4XA 2CGHA 4M78B 2RH2A 4NL3A 3JCMe 3MEAA 5GAN4 3CCLA 5K1PA 1YJ9A 4KUDK 4M75A 2RHYA 4OMFB 3G6ET 3VQVA 2P5IA 1NNHA 3M4GA 2IG0A 4J6YA 3I55T 4YRJA 4BE1A 5I2SA 2QQAA 2MWPA 3VKIA 5C53B 1VQ8T 4HA8A 4TQDA 4PKCC 4ZIBA 2G4CA 4M7DD 2LQKA 4PNOA 2LT4A 4C0DC 2EJ9A 1XQHA 1QVFS 1BIBA 1TH7A 4F7UB 2OAUA 5GAOp 3LW5E 4XTUA 5GAOr 4J83A 3QO8A 4KULA 1G51A 2P0PA 2VUBA 4N0AC 4ELYC 4DPGA 3E9FA 3QHSA 1XTDA 2VXEA 3OS0A 2Y90A 3CEYA 4C5HA 3A7UA 3L4GA 5LJ5e 2RHIA 3P8HA 1VQ5T 1FWZA 3GLXA 3OYKA 1K9MC 4M7AF 1H4TA 3L2ZA 3JAME 1YI2T 1EIFA 4A53A 3OBWA 4M75G 5CO7A 3TEGA 1XNIA 1N9RA 1NYQA 2HAXA 3QYHB 1Q82U 2QHTA 4UP7A 2I4LA 2ZPGB 3SDZA 4YYEA 1S72T 4JRIA 4AH6A 3HXZA 3LSSA 2LRQA 3CXCA 4P3NA 3TU4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1T A;  4P75 C;  3QO3 A;  3HXW A;  4YRE A;  4L87 A;  1C0A A;  4HWO A;  1NJ1 A;  5GAN 3;  3P8Y A;  1KQ1 A;  3JCM d;  4BW9 A;  3JCM h;  5CAI A;  1EIY B;  2ZNJ A;  3LSQ A;  4M75 C;  4M7A D;  3LC0 A;  3NEM A;  3MF1 A;  1I8F A;  2DU5 A;  5GAN f;  4P3O A;  3NEN A;  4YRS A;  1MGQ A;  1N9S A;  3A5Z A;  3RKW A;  3PCO A;  2DQ3 A;  5ELO A;  2ZNI A;  4C92 A;  1M8V A;  4YRI A;  4Q15 A;  5GAN 6;  1H64 1;  1E24 A;  3FIF A;  3CMQ A;  1B7Y B;  4OP0 A;  3V8K A;  4XEM A;  1NJ5 A;  2XGT A;  3L4G B;  3JCM P;  2RM4 A;  4H2V A;  1USY A;  1WYD A;  1X2H A;  2RB6 A;  5LJ3 j;  4G85 A;  1J5W A;  4WJ4 A;  1SRY A;  4MMK A;  1B34 B;  4XTV A;  1E22 A;  1HK9 A;  5ELN A;  4P72 A;  2J3L A;  4X9D A;  4M7D G;  1WNL A;  3P8V A;  4RCC A;  3ICA A;  2XTI A;  2IY5 A;  4HWS A;  3HFV A;  3JB9 H;  2ZZF A;  2ZZG A;  1N9W A;  3EFR A;  4K87 A;  2ZXF A;  3HXU A;  4M7D B;  3E9I A;  3REX A;  4H2S A;  1ATI A;  1H4S A;  1WU7 A;  3RGL A;  3BDU A;  3SWN B;  4M7A A;  5K1X A;  1NJ2 A;  5GMK e;  2ZCE A;  3JCM c;  1ADJ A;  3EFS A;  5GAM f;  5LJ5 d;  2E41 A;  2ODR C;  5LJ5 h;  1LYL A;  4M78 E;  4XU1 A;  5GAN h;  5GAN e;  1B34 A;  1KOG A;  4YRP A;  1Y96 A;  4M77 E;  4RQF A;  4TVW A;  1EFW A;  4M78 F;  4A54 A;  1HXD A;  2DVE A;  3SWN C;  3V7R A;  5LJ3 f;  3GIB A;  4P71 C;  2I4M A;  4M7D A;  4P73 A;  4YRG A;  2DDZ A;  5C51 B;  3R07 A;  4PHC A;  1YFS A;  2E65 A;  1I4K 1;  3JCM J;  3JB9 F;  3TEH A;  4M77 F;  4XU3 A;  4DQ2 A;  3HY1 A;  1WQW A;  3HRK A;  3DSQ A;  4H2X A;  4TVA A;  4YPF A;  4CS2 A;  3PCO B;  4C92 B;  2EL9 A;  2J3M A;  3UH0 A;  2I4N A;  4HWT A;  4QVD A;  2ZZE A;  4ZTZ B;  5GMK i;  4F7U E;  1PYS A;  3VQX A;  1W66 A;  1D3B A;  3JCM g;  1I5L A;  3BY7 A;  2DJZ A;  2RHQ A;  11AS A;  4NL2 A;  3JCM V;  1ASZ A;  4CH4 A;  3VQW A;  2E5A A;  5GAN 2;  4Y91 A;  3A32 A;  4HVC A;  3JCM X;  3WQZ A;  5GAO m;  1EOV A;  2EJG A;  2VXF A;  2ZT6 A;  4ZTU B;  4F7U F;  3BW1 A;  1EVK A;  5E3I A;  3RF1 A;  3JB9 J;  2IY5 B;  4M78 D;  4UP8 A;  4JRK A;  3V8L A;  4EX5 A;  4C92 C;  1YFR A;  5GAO l;  1X56 A;  4M7A G;  2Q7H A;  3V8J A;  1HC7 A;  1H4Q A;  4M78 G;  4H2U A;  5GAM j;  3JB9 D;  4KQE A;  2I2L A;  3A7A A;  4M77 D;  3BJU A;  4M7A B;  1X01 A;  4P74 A;  4P75 A;  4PJO E;  2AKW A;  3ERR A;  4YCV A;  1B70 A;  5LJ3 e;  4RDX A;  4M77 G;  1YCY A;  5GAO n;  1USY C;  4CH5 A;  4XU2 A;  3IKL A;  4C8Q E;  3MEY A;  1EVL A;  3QNE A;  4XTW A;  2CJB A;  5DY9 A;  1U1S A;  4P72 C;  4PJO F;  3MF2 A;  1H4V B;  3PZC A;  2YLB A;  4UPA A;  2PMF A;  2QTX A;  2DXU A;  2JN0 A;  4M75 E;  4X5O A;  1Y96 B;  2FB7 A;  4C8Q F;  3V7C A;  3UGT A;  4LNS A;  3RKX A;  3HRI A;  4O2D A;  4KR3 A;  4G84 A;  4K86 A;  3HFZ A;  4M7A C;  5F5W A;  3TEH B;  4RMF A;  1B76 A;  4M75 F;  1X54 A;  4Q6G A;  5LJ5 g;  1JJC A;  5GMK h;  4M78 A;  5GAN g;  2DZC A;  3JCM b;  4J5Y A;  4XTZ A;  3NEL A;  4H2X B;  4JUV A;  4H02 A;  3RAC A;  4PG3 A;  4YRC A;  4TVA B;  2E64 A;  4XU0 A;  5HGQ A;  4XTX A;  3A74 A;  5GAN d;  2RA2 A;  3PGG A;  5GAO q;  2ARU A;  2ZIO A;  4M77 A;  2ZT8 A;  4YCW A;  2E1H A;  5GAN 8;  1WPY A;  1LJO A;  1B8A A;  3HTZ A;  5KNN A;  2EJF A;  3I7F A;  1PYS B;  3UGQ A;  1D3B B;  2K57 A;  1NJ6 A;  1RIQ A;  2RHQ B;  4EMG A;  1BBU A;  3QO7 A;  4M7D C;  1HTT A;  4P73 C;  4YRR A;  2DTI A;  2E10 A;  4JLI A;  3HFO A;  3JCM f;  4PJO D;  2C7I A;  3A31 A;  4E51 A;  1ADY A;  4N0A A;  2DQ0 A;  4YRQ A;  1KQ2 A;  3RUX A;  4PJO G;  4C8Q D;  3HXV A;  2QHU A;  2ZIM A;  4YP0 A;  4EMK A;  2AMC A;  4HT9 A;  4WJ3 M;  1NYR A;  1BBW A;  3SB2 A;  4NCX A;  2ZIN A;  4YRL A;  1G5H A;  4YRO A;  3P8T A;  4F7U A;  4CS4 A;  4M75 D;  2DTH A;  2AKW B;  1B70 B;  4YRT A;  2ZGW A;  4XTY A;  2YHT A;  3E9H A;  2ALY A;  4X9C A;  3JB9 I;  3NET A;  1SER A;  4HT8 A;  4M7D E;  2YLC A;  2VC8 A;  4XEO A;  3JCM W;  2ZTG A;  5GAM d;  4YRK A;  5GAM h;  2CJA A;  2ZR2 A;  4P3P A;  4QVC A;  1X2G A;  2Q7G A;  3INZ A;  5GAM e;  3KFU A;  5GMK m;  4EMH A;  1U1T A;  4YDQ A;  3OD1 A;  3HXY A;  4YCU A;  1GGM A;  2Q5I A;  2ZT5 A;  5LJ3 g;  3HFZ B;  3W3S A;  4P74 C;  4PJO A;  4BWA A;  2DXT A;  5GMK l;  1YGB A;  4KR2 A;  4RCB A;  5LJ3 d;  4C8Q A;  3RIR A;  5LJ3 h;  1JJC B;  2CGH A;  4M78 B;  2ARS A;  1QE0 A;  1ASY A;  4NL3 A;  3JCM e;  3JB9 G;  5GAN 4;  5K1P A;  5LJ5 f;  12AS A;  4CS3 A;  4M75 A;  3RL6 A;  4M77 B;  2ZT7 A;  1LNX A;  3VQV A;  3QUI A;  2P5I A;  1NNH A;  3V7S A;  3FB9 A;  3M4G A;  3VBB A;  4J6Y A;  4YRJ A;  3BFM A;  2P0L A;  2ODR D;  4J6X A;  2HNI A;  4C92 E;  2RHS A;  2ART A;  3IG2 A;  3HFN A;  3G1Z A;  5C53 B;  4HA8 A;  4M78 C;  3HSB A;  3A7R A;  2CIM A;  3IAL A;  4CH3 A;  2QHS A;  4K88 A;  4TQD A;  4ZIB A;  2G4C A;  2DU7 A;  4M7D D;  4EMK B;  4F7U G;  2AMC B;  1EIY A;  4PNO A;  4YRM A;  3VQY A;  4C92 F;  3AHU A;  2EJ9 A;  4XQ3 A;  1BIA A;  1I81 A;  4M77 C;  1BIB A;  4H2Y A;  4UP9 A;  1TH7 A;  3IKM B;  4F7U B;  3HXX A;  2CJ9 A;  1G5I A;  5GAO p;  1JRI A;  4XTU A;  2Q7E A;  5GAN 5;  4HWR A;  2C8M A;  4YRF A;  5GAO r;  5I21 A;  1WLE A;  2ALY B;  2Q5H A;  3FJP A;  3QO8 A;  3UFG A;  1YB3 A;  1G51 A;  4N0A C;  1X55 A;  4P3N A;  3REU A;  4NOY A;  1B7Y A;  3VU3 C;  4WI1 A;  4DPG A;  3QHS A;  2VXE A;  3RKY A;  2Y90 A;  4EMK C;  4M7A E;  3JCM Q;  1YFT A;  4H2T A;  3A7U A;  3L4G A;  1E1O A;  1EQR A;  3M4Q A;  5LJ5 e;  4TVY A;  1QF6 A;  1JBM A;  2DKG A;  5GMK j;  1L0W A;  4RQE A;  2RD1 A;  4J6W A;  4C8Q G;  2PME A;  4M7A F;  4PJO B;  1H4T A;  2QHV A;  3L2Z A;  4V2S A;  2DZ9 A;  5LJ5 j;  2EAY A;  5GAN j;  4YRN A;  4A53 A;  5GAN 7;  3M4P A;  4C8Q B;  4J15 A;  1SET A;  2E3C A;  3TUP A;  1NJ8 A;  1KMN A;  4CH6 A;  4C92 D;  4M75 G;  2ZR3 A;  2EWN A;  1FYF A;  4TWA A;  2FYK A;  1Z7M A;  3SWN A;  3TEG A;  1LOJ A;  1N9R A;  3QO5 A;  4TTV A;  4OLF A;  1NYQ A;  4P71 A;  5GAM g;  4C92 G;  4MML A;  4M75 B;  1WQ7 A;  3L1A A;  3QSU A;  2QHT A;  4UP7 A;  2I4L A;  1Z7N A;  1IL2 A;  4YYE A;  1M5Q 1;  4JRI A;  4EO4 A;  4HWP A;  2DEQ A;  2I4O A;  3A5Y A;  3RES A;  1VQZ A;  4AH6 A;  4PJO C;  3HXZ A;  4M7D F;  3LSS A;  5C52 B;  1SES A;  2DTO A;  3QTC A;  4WF2 A;  3RER A;  2RHS B;  4TQF A;  4H2W A;  4C8Q C;  3HY0 A;  1KMM A; 
#chains in the Genus database with same CATH topology
 1E1T A;  3G4S A;  1WI7 A;  2IPO B;  2CZ1 B;  1AHJ B;  4FL6 A;  1NJ1 A;  3P8Y A;  1KQ1 A;  3I9Q A;  1KHC A;  2MI6 A;  1VQN T;  4BB7 A;  5CIU A;  1MMG A;  1UGV A;  2KEA A;  4M7A D;  1U5S A;  1WJQ A;  2LCC A;  2ED0 A;  4P3O A;  4Y28 E;  3I5S A;  1N9S A;  3GPL A;  2RPN A;  4LN2 A;  1M4Z A;  3CCQ A;  1I0C A;  3PCO A;  4IUP A;  5ELO A;  1M1K U;  4YRI A;  3I56 T;  4Q15 A;  2Y4X A;  1E24 A;  3FIF A;  3TQ7 P;  2G3R A;  4MDX A;  3M0U A;  1MV0 B;  4N4G A;  2XGT A;  2RM4 A;  4H2V A;  3J81 E;  1X2H A;  1WYD A;  5LJ3 j;  1I07 A;  1RAD B;  1RI9 A;  4G85 A;  2ZPF B;  1SRY A;  2E3H A;  5KYX B;  1E22 A;  4HKE A;  3C4S A;  2J3L A;  2DLP A;  4X9D A;  1WNL A;  4LUD A;  4RCC A;  4PJL A;  2XTI A;  1WXB A;  1NBE B;  2BKD N;  2ZXF A;  4M7D B;  3E9I A;  1PRM C;  1ATI A;  2P0K A;  3RGL A;  3BDU A;  5KYU A;  2O31 A;  1D0Z A;  2DL4 A;  2AZS A;  1NJ2 A;  1RAH B;  2DYB A;  2BZ8 A;  2QK0 A;  4J7F A;  3G71 A;  1LYL A;  2R5A A;  5CKF A;  5FW9 A;  4XU1 A;  2XK0 A;  3LWI A;  1PNJ A;  3OYE A;  1P92 A;  2DD5 A;  3OYH A;  4IIM A;  4MZM A;  1EFW A;  3X20 B;  2DL5 A;  5FU6 B;  3X25 B;  1GFC A;  5LJ3 f;  1WHH A;  2JNG A;  5IH2 A;  4P71 C;  4M7D A;  1YIT Q;  5C51 B;  3R07 A;  4PHC A;  4M77 F;  2CUD A;  5EG2 A;  1QQJ A;  3HRK A;  5FRM A;  3LH0 A;  1NG2 A;  3E1S A;  9ATC B;  4YPF A;  2VVK A;  1FMV A;  1VOM A;  4PLL A;  3VS6 A;  2QTV A;  2J3M A;  2KE9 A;  4HWT A;  3UPU A;  4ZTZ B;  3S6W A;  1D3B A;  3JCM g;  2DJZ A;  1NLO C;  1QCN A;  1KJW A;  3HPW A;  1YNZ A;  2E5A A;  3H9N A;  3U23 A;  1VQK Q;  1Q86 C;  2ZT6 A;  4ZTU B;  4HT4 A;  2QAZ A;  3R6O A;  4AFS C;  1YHQ Q;  3RF1 A;  1WFW A;  4JRP A;  2MIO A;  2IY5 B;  4JRK A;  4LVK A;  3M0P A;  2WSE E;  1VQM Q;  3CCU Q;  2ATC B;  1UE9 A;  2NWM A;  1YJN T;  2DIQ A;  2I2L A;  3A7A A;  4M77 D;  1UTI A;  2HL5 C;  5CVI A;  4M7A B;  3CCS T;  3ERR A;  4AFZ C;  1PG5 B;  3G4S T;  3HHT B;  3LGF A;  1N5Z A;  1WDX A;  2RQR A;  2VKN A;  3HP9 A;  3IKL A;  2GCX A;  4LVJ A;  3QNE A;  4ZTF A;  2CJB A;  5DY9 A;  4PFZ A;  3DB3 A;  3OYF A;  2FEI A;  2PVG B;  4PJO F;  3HRS A;  2DM1 A;  4BI3 A;  1CKB A;  2DXU A;  3OYB A;  2FB7 A;  3V7C A;  4LNS A;  1VQ4 Q;  4ZN1 A;  2KYB A;  3HRI A;  1W2B S;  3VUB A;  4NS5 A;  4J9H A;  4P5N A;  2L8D A;  1MUZ A;  2EQM A;  4RMF A;  4M75 F;  2HBW A;  5IHN A;  1BI3 A;  1X54 A;  5CR2 A;  3GNG A;  1AVZ C;  5LJ5 g;  1MMN A;  1EFN A;  4DOW A;  4HXJ A;  4WCI A;  3ME9 A;  5GAN g;  3G6E Q;  4E6R A;  4L59 A;  4H2X B;  4KH0 B;  4JUV A;  2LJ3 A;  3RAC A;  2CDT A;  3OSV A;  4YRC A;  2PVO B;  4FYW B;  1BI1 A;  2EYQ A;  3A74 A;  5GAN d;  4O5V A;  1B8A A;  3HTZ A;  1HD3 A;  3C95 A;  1S1N A;  1VQ8 Q;  1ZBX A;  1NJ6 A;  3TRE A;  3UDC A;  4J9F A;  1BBU A;  2HSE B;  2ZCF B;  1QVP A;  2HQE A;  2VV5 A;  3MJX A;  1V29 B;  2DTI A;  3M9Q A;  1NJI U;  3JCM f;  4PJO D;  1VQ6 T;  1JJ2 S;  3A31 A;  2JTE A;  4N0A A;  4IUQ A;  2DQ0 A;  3RMQ A;  1KQ2 A;  4B6M A;  1NYF A;  3RUX A;  1RAF B;  3QKJ A;  3HXV A;  2QHU A;  3CCR T;  3A8M B;  3UAT A;  2NUT A;  1G3S A;  2QXF A;  2DXB A;  1IO6 A;  3G71 T;  1VQL A;  1X69 A;  4PJN A;  2YUN A;  1YCS B;  2ZIN A;  2W10 A;  1GCQ C;  1MMD A;  2WAC A;  4M75 D;  1K73 R;  1IGU A;  1D1C A;  2FRW A;  4HCB A;  2DET A;  4FYV B;  4PLI A;  4YRT A;  3EGX B;  4XTY A;  3E9H A;  4L5G A;  4E7L A;  7AT1 B;  3VS5 A;  4OMQ A;  1ABQ A;  2LVM A;  1SER A;  2LX9 A;  4PJM A;  5CCA A;  4Z89 A;  1ZSZ C;  4XEO A;  4ME7 A;  2WSF E;  2DA9 A;  5GAM d;  4BI8 B;  5GAM h;  4JZ3 A;  4ZNX A;  4FT2 A;  2ZR2 A;  3O8V A;  2X3W D;  4A4G A;  3CCV Q;  3KFU A;  5GMK m;  2RQT A;  2KVQ G;  4PFO A;  1KD1 C;  1GGM A;  2Q5I A;  2ZT5 A;  3L2V A;  1N27 A;  5CK9 A;  4P74 C;  1BU1 A;  1VQP Q;  2DX1 A;  2FG0 A;  1UUE A;  2MF2 A;  2RJC A;  3HL8 A;  4BWA A;  3REA B;  3GF5 A;  3ASK A;  2B86 A;  3EAE A;  4C8Q A;  2P4T A;  2EVR A;  2KMT A;  1JJC B;  1UEC A;  2LQW A;  1ASY A;  2H3E B;  1G8X A;  1ZUK A;  1AT1 B;  3JB9 G;  3NTK A;  1S72 Q;  1OX9 A;  1WGS A;  2E6N A;  5LJ5 f;  12AS A;  4LDW A;  2F2W A;  2OTL T;  1LCK A;  1VQ9 A;  1RAG B;  1UFF A;  3RL6 A;  4M77 B;  1YWO A;  2PVD B;  1LNX A;  5KE2 A;  3QUI A;  2LZ6 B;  2V8I A;  1WHK A;  2QAS A;  3ZFJ A;  2QQ9 A;  3BFM A;  3EFO A;  2P0L A;  2KNB B;  2RJE A;  1Y07 A;  3EH1 A;  3RMS A;  2QDY B;  4LDX A;  4OMO A;  4C92 E;  2RHS A;  2KRS A;  5J3B A;  3QDR B;  3G1Z A;  1BI0 A;  2OX7 A;  3CD6 A;  4CH3 A;  2QHS A;  4K11 A;  4K88 A;  1EX4 A;  1YP5 A;  4A4F A;  1K1Z A;  3SFM A;  2J06 A;  3NPF A;  4EMK B;  2AMC B;  2K4Y A;  4YRM A;  3VQY A;  3AHU A;  4GY5 A;  3VRY A;  4E7H A;  1O9S A;  4XQ3 A;  2XD0 A;  2HDA A;  4DEY A;  4H2Y A;  5HK0 A;  2PQW A;  2DBM A;  1NEG A;  3I56 Q;  1C0M A;  4RTX A;  3PMT A;  2QA4 A;  3VS7 A;  2Q7E A;  3T9N A;  2F2X A;  5GAN 5;  4HWR A;  4YRF A;  2KDS A;  1SRL A;  1BCO A;  1OZ2 A;  2ALY B;  3TVT A;  3FJP A;  1IZ6 A;  2ZPH B;  3REU A;  1JB0 E;  1H3H A;  1YBY A;  2JUF A;  3VU3 C;  5J39 A;  3QJ6 A;  2QQS A;  4OML A;  2KAF A;  3CMA A;  2KY9 A;  1E1O A;  1EQR A;  5FWC A;  2DNU A;  1PD1 A;  3WVE B;  1VQ7 Q;  2OTJ Q;  1YIJ A;  2XDD A;  1JBM A;  2DKG A;  1UGR B;  2JW4 A;  4IUV A;  4E47 A;  4J6W A;  4C8Q G;  4PJO B;  4BY6 C;  1W6X A;  1RAA B;  2EAY A;  3PE0 A;  2YUQ A;  4YRN A;  3OW2 P;  5A0D A;  1YJW Q;  3M4P A;  1QKX A;  4J15 A;  3MEU A;  1TUC A;  2E3C A;  3TUP A;  2EYZ A;  3TCJ A;  3EG0 A;  1KMN A;  1TG0 A;  3J7A F;  1AZE A;  2DE0 X;  2XU8 A;  2GQV A;  3CCJ Q;  4P71 A;  1Q7Y R;  1WHG A;  4C92 G;  2BUD A;  4JPB W;  3A8G B;  4M75 B;  3L1A A;  1AD5 A;  3N5B B;  4KRT A;  2DXC A;  1M5Q 1;  3EGD B;  2DEQ A;  2I4O A;  3RES A;  4AG2 C;  1NZ9 A;  1FMK A;  4M7D F;  1BB9 A;  1SRM A;  3R6N A;  3RER A;  2XIC A;  3HY0 A;  3QO3 A;  1K8A C;  4X34 A;  1VIE A;  1N8R U;  4L87 A;  3PT9 A;  1C0A A;  3KFV A;  4HVW A;  2GF7 A;  4D8K A;  2DAQ A;  1M90 C;  2SRC A;  4R56 A;  1IXD A;  2VGN A;  2L2P A;  4KGZ B;  2ZNJ A;  2X51 A;  1FYN A;  4IUT A;  2JMC A;  4C0F A;  1QVG A;  3LC0 A;  3O5Z A;  3LYI A;  2Z0W A;  4RUG A;  2HKQ B;  2M51 A;  3BE3 A;  2DU5 A;  3M0R A;  2YWW A;  5A0L A;  4IUR A;  3A5Z A;  1RI0 A;  2D9T A;  2EGE A;  4RKU E;  1D1A A;  3CQT A;  2BZY A;  4CC2 A;  4Q5W A;  5GJV B;  2GGR A;  2FZG B;  2F5K A;  5KYY B;  2IIM A;  1NJ5 A;  4J9D A;  3C94 A;  3L4G B;  2ZPE B;  3VYH B;  3M4Y A;  2JS2 A;  3NHN A;  2RB6 A;  1J5W A;  4WJ4 A;  1QCO A;  4II1 A;  4MMK A;  3SD4 A;  1HK9 A;  1BKB A;  3MQZ A;  4BE2 A;  1T0H A;  2F2V A;  4DBR A;  3CME A;  1YJN Q;  3KUF A;  3ICA A;  2J6F A;  1VQ9 T;  3E2U A;  3CCS Q;  3TEE A;  3JB9 H;  2ZZF A;  2ZZG A;  3EFR A;  1PC0 A;  1OQK A;  3CC7 T;  4H2S A;  1WU7 A;  2CSQ A;  1OUL A;  2J7I A;  1OPK A;  2JVV A;  3VS0 A;  1KIK A;  2C06 A;  1VYT A;  1M9S A;  4DBH A;  3JCM c;  3CD6 T;  3J80 E;  1PSE A;  2RNA A;  2ODR C;  2B8A A;  4M78 E;  4QQ6 A;  4JJC A;  2NUZ A;  4HCZ A;  1NM7 A;  2KQW A;  5GAN e;  3DB4 A;  4BDZ A;  1NEB A;  4KT0 E;  1ACM B;  4KGX B;  5FU7 B;  2LNV A;  4TVW A;  3S3M A;  3OQ5 A;  4ZGE B;  3OMG A;  2E12 A;  2M0O A;  3SWN C;  3V7R A;  3PIO A;  3A98 A;  1SSF A;  1TOV A;  1IGQ A;  2E65 A;  3TEH A;  3JB9 F;  2HKN A;  1PSF A;  1M3B A;  4X1V A;  3QZ9 B;  3WXM B;  4DQ2 A;  1WIE A;  1F1B B;  2XI9 A;  2CP3 A;  2ZAE A;  3CMA T;  4AFU C;  1G2B A;  2YSQ A;  3PCO B;  3OYJ A;  3CCE Q;  4KUI A;  3EG2 A;  3OY9 A;  3UH0 A;  1VYU A;  4E7I A;  2CP7 A;  1VQ6 Q;  1GCQ A;  2QEX A;  3L42 A;  5GMK i;  1Q7Y U;  4F7U E;  1QVF A;  1K9M R;  1TU0 B;  4BE0 A;  4NL2 A;  1IRX A;  1SPK A;  3CCR Q;  4HVU A;  5AYF A;  3VQW A;  5GAN 2;  1KQS S;  4HVC A;  3VYG A;  2CKK A;  2YRC A;  2RI3 A;  4KH1 B;  1ZSZ A;  4UP8 A;  5FLX E;  3MEW A;  4EX5 A;  1WJR A;  5C6S A;  4C92 C;  1YFR A;  3L2U A;  1PD0 A;  4C5E A;  5HK3 A;  5GAO l;  1HC7 A;  3CC4 Q;  4M78 G;  1CKA A;  1T3S A;  2BIV A;  1ZSG A;  1X6O A;  3JB9 D;  4KQE A;  5KYU B;  1IHV A;  5HY6 A;  2K3Y A;  4P75 A;  4P74 A;  4LVM A;  1VUB A;  4YCV A;  3A8O B;  3LH5 A;  1E6G A;  2O2O A;  2R57 A;  5GAO n;  4JJN K;  1QVG P;  1EVL A;  4XTW A;  4P72 C;  2VGM A;  2W0Z A;  1PRL C;  2A8E A;  1ZUY A;  3PZC A;  2HL3 A;  5DLQ E;  3CCL T;  3A8L B;  2OI3 A;  4UPA A;  3OYY A;  1YJ9 T;  3CC2 Q;  4ZGJ B;  4MZP A;  1HYO A;  4C8Q F;  3RKX A;  5I11 A;  2MWO A;  3CCM Q;  2EQK A;  4G84 A;  1UGQ B;  2X4Y A;  3HFZ A;  4K86 A;  5FWB A;  2R5M A;  2RQU A;  1QLY A;  2GTJ A;  2GBQ A;  3I35 A;  2OTL Q;  4RMO A;  4C5I A;  2MMP A;  5GMK h;  1H92 A;  4J5Y A;  3TSW A;  2CZ7 B;  3EHR A;  4H02 A;  4PG3 A;  2E64 A;  5HGQ A;  3QYG B;  4M4Z A;  1NJI R;  2HEQ A;  2RA2 A;  2DER A;  2ARU A;  4ZTJ A;  5KNN A;  2EJF A;  2L3R A;  2ROT A;  3UGQ A;  1D3B B;  2AHJ B;  1RIQ A;  3MP8 A;  4EMG A;  1ZUU A;  2E6Z A;  4QQG A;  2M1H A;  2XKO C;  4ATO A;  1HTT A;  4P73 C;  2KXD A;  2E10 A;  1SHF A;  3IQL A;  1ADY A;  4DBQ A;  2DJQ A;  3SHW A;  4C8Q D;  4D6W A;  4YP0 A;  2RHZ A;  3MEV A;  3VJP A;  1X75 C;  4WJ3 M;  1BBW A;  1IHW A;  3RDV A;  4YRL A;  2E5K A;  4JJB A;  5IN1 A;  5IHK A;  2H3J A;  2DK3 A;  1JU5 C;  1UDL A;  3ZEH A;  2ZGW A;  2YHT A;  4EIK A;  3G7Z A;  3JB9 I;  4HT8 A;  4M7D E;  1D09 B;  2E70 A;  3PVQ A;  2CT4 A;  2XMF A;  1VQO Q;  3JCM W;  1IB8 A;  3M56 A;  1X2G A;  1K9M U;  2X4W A;  1WHM A;  2JJ9 A;  4XAX B;  1U1T A;  2K79 A;  3CBO A;  4LXC A;  2LX7 A;  4IUU A;  3CXC P;  2K7A A;  3M0S A;  1MNE A;  8AT1 B;  1BI2 A;  1VIF A;  2QEX T;  4KR2 A;  1Q81 C;  2ARS A;  1QE0 A;  2OJ2 A;  3CBP A;  2PZ1 A;  4A4H A;  4OGE A;  3GBQ A;  2K5L A;  1QKW A;  1Z9Z A;  2KSS A;  2EGC A;  3H0F A;  3OB9 A;  2ABL A;  4C0D B;  2JXB A;  3OW2 S;  3TU4 K;  3L2R A;  1E6H A;  5AT1 B;  3NFC A;  1Q86 R;  3V7S A;  3FB9 A;  3VBB A;  1X6G A;  2A0F B;  2VB6 A;  2X9H A;  4R0K A;  1M3C A;  4J6X A;  3UF4 A;  3CCQ T;  6AT1 B;  2ART A;  3M58 A;  1UGP B;  5D7U A;  3HFN A;  1UB4 A;  2JS0 A;  4M78 C;  4Z02 A;  4E7J A;  3HSB A;  1YIT A;  3IAL A;  2AKK A;  2M9U A;  2DU7 A;  3VS4 A;  2CP2 A;  2NUT B;  2JZ2 A;  1EIY A;  1WXT A;  2PTK A;  4A63 B;  1KC8 C;  1Q95 G;  1I81 A;  2IVW A;  2HSP A;  3EHQ A;  3UWN A;  2AT1 B;  3HXX A;  3I55 Q;  4RTY A;  2JM9 A;  3A8H B;  4D8D A;  2CJ9 A;  3H41 A;  1WJS A;  1G5I A;  1OU9 A;  3PNW C;  1YWP A;  2LP5 A;  4A4K A;  1JRI A;  3FDR A;  2C8M A;  1B7T A;  5I21 A;  2Q5H A;  4FW1 A;  3UFG A;  1YB3 A;  3EG9 A;  1B7Y A;  1X6B A;  3QWX X;  2HQH A;  4M7A E;  1G3Y A;  2RF0 A;  1YFT A;  1K73 C;  1VQK A;  2L3S A;  2FHD A;  4H2T A;  3OS5 A;  2HCK A;  3CPW S;  1H3Z A;  4TVY A;  1QF6 A;  1YHQ A;  4RQE A;  2EQJ A;  5CKH A;  2RD1 A;  5KE3 A;  1BK2 A;  4QT7 A;  3CC7 Q;  1G3W A;  2H8H A;  3H0I A;  2COW A;  4L6V 5;  1VQM A;  3CCU A;  4AT1 B;  4WTO B;  5LJ5 j;  1JO8 A;  4HCK A;  4E7Z A;  5GAN j;  2RHX A;  4B9W A;  2HD0 A;  3FEO A;  4C8Q B;  3THK A;  4FCY A;  2D0Q B;  2K3X A;  3KBG A;  5I2M A;  5IT9 E;  3OYI A;  1SET A;  4CH6 A;  4Z88 A;  2ZR3 A;  1OV3 A;  2FYK A;  1Z7M A;  3SWN A;  5LL6 S;  2FZK B;  1HJD A;  4OLF A;  4TTV A;  5GAM g;  2CSI A;  1W2B A;  4MML A;  2JOY A;  1VQ5 Q;  2V8K A;  4RG2 A;  1JEG A;  1WQ7 A;  2KR3 A;  2RI2 A;  3QSU A;  1R8O B;  2A08 A;  2AZV A;  3VV0 A;  1Z7N A;  2L5Q A;  1N8R R;  2M02 A;  1SEM A;  4LNP A;  1RL2 A;  1VQZ A;  2QG9 B;  2K6D A;  3EFO B;  1YI2 Q;  4RTZ A;  1VQ4 A;  1AZG B;  3OYM A;  5C52 B;  2DTO A;  3QTC A;  4JZ4 A;  2GQI A;  1RUW A;  5A0G A;  2RHS B;  4TQF A;  3D7S B;  5IXB A;  2FPE A;  4P75 C;  3QBY A;  3HXW A;  4YRE A;  1IRE B;  1BBZ A;  1OX8 A;  2HMA A;  4HWO A;  3OYD A;  3DLM A;  1EZZ B;  1RLQ C;  5GAN 3;  2GNC A;  2PU9 B;  1Y7X A;  3SEM A;  3G6E A;  1C1A A;  1WLP B;  4F14 A;  3NEM A;  3ZL7 C;  4OVA A;  1I8F A;  5GAN f;  3H6Z A;  2EIF A;  1MGQ A;  4CC3 A;  4J9B A;  1AOJ A;  2RMO A;  2QGF B;  2QQB A;  4C92 A;  1VQ8 A;  1TS9 A;  1QP2 A;  1M8V A;  2ZNI A;  2K2M A;  3JV3 A;  1H64 1;  3MP1 A;  2XDP A;  5KCH A;  4JJD A;  4OP0 A;  3M59 A;  4XK8 E;  5I22 A;  4QW2 A;  4LDV A;  1KD1 R;  1VQN Q;  2EYY A;  4GBQ A;  3JCM P;  1Q86 U;  2P4R A;  3Q1J A;  1E7O A;  1B34 B;  1PHT A;  4XTV A;  1SG5 A;  4P72 A;  1PM3 A;  1MND A;  4HWS A;  2MPX C;  4J9C A;  1N9W A;  1KG1 A;  3NGP A;  3GP8 A;  4K87 A;  3A1P A;  4CRI A;  5CKB A;  5GJW B;  2DBK A;  2NS6 A;  2RHU A;  1ZLM A;  1LPL A;  3PVL A;  5C0M A;  5K1X A;  1WZO A;  3VS1 A;  5FRN A;  1PKS A;  3HKS A;  3GNF B;  5GMK e;  3CCL Q;  1NLP C;  2ZCE A;  1YJ9 Q;  4PL6 A;  5GAM f;  4O6J A;  1Q82 C;  2LTO A;  1M27 C;  1DJ7 B;  3CCV A;  1B34 A;  2A37 A;  1RAI B;  5EC7 A;  4YRP A;  1Q7Y C;  4HCC A;  1Y96 A;  2R58 A;  4M77 E;  1QVG S;  1Z9Q A;  4JDS A;  4A54 A;  1VQP A;  3M57 A;  2JTF A;  3C12 A;  2YXY A;  3GIB A;  1GXI E;  4P73 A;  4YRG A;  2K9G A;  3OYL A;  1ZHI A;  2DDZ A;  1M1G A;  1I4K 1;  2CH4 A;  1S72 A;  1GBQ A;  4XU3 A;  4VUB A;  4BI4 A;  3A5Z B;  4TVA A;  1I5O B;  2Y4Y A;  3QXE B;  2EL9 A;  1FMW A;  3LX7 A;  3NTH A;  1VQL T;  4BD3 A;  1M1K C;  1G5V A;  1VQM T;  1AWX A;  2A3L A;  1PYS A;  3VQX A;  5FU6 C;  2SEM A;  2RHQ A;  11AS A;  3FLG A;  2P0Q A;  3OBY A;  1W2B P;  2CZ0 B;  4CH4 A;  2GTO A;  1R77 A;  4BDY A;  2HZY A;  3WQZ A;  3A32 A;  5GAO m;  4QVZ A;  4PJJ A;  1FX7 A;  1PCX A;  4A4E A;  1EVK A;  4LDU A;  4LVI A;  4OGC A;  2KI7 A;  3I56 A;  1ZA1 B;  5KYW A;  3V8J A;  1H4Q A;  2DRM A;  1KK7 A;  3FRN A;  2LCS A;  2CS7 A;  1QWF A;  1VQ4 T;  3BJU A;  4PJO E;  1TUD A;  3QZ5 B;  1FXX A;  3VUZ A;  1KFZ A;  3DKM A;  1B70 A;  2AKW A;  1M30 A;  4M77 G;  1USY C;  4CH5 A;  4XU2 A;  2LNH B;  4RTU A;  1K8A R;  3OYN A;  1OYX A;  1VQ7 A;  2OTJ A;  4FYX B;  3UT1 A;  1AWW A;  1M90 R;  1H4V B;  2YLB A;  2PMF A;  2JT4 A;  2XID A;  1M2V A;  1WXU A;  4M75 E;  1M8M A;  1KD1 U;  3RR6 A;  1V76 A;  3DLL A;  4KR3 A;  1WHJ A;  1RAC B;  4M7A C;  1TUG B;  3G4S Q;  1YJW A;  3EG3 A;  2LJ1 A;  3X28 B;  4RG8 A;  3TEH B;  4Q6G A;  4IIO A;  3CCJ A;  1Y71 A;  2ZZD A;  4M78 A;  3JCM b;  4XTZ A;  3NEL A;  4LDY A;  2RQW A;  3CXC S;  5ECA A;  2L3P A;  4XTX A;  1U8R A;  2MCN A;  3PGG A;  3MCA B;  4YCW A;  2E1H A;  5GAN 8;  1WPY A;  4MDW A;  3CCQ Q;  2LMJ A;  2VWF A;  3E19 A;  2K57 A;  3MPU B;  2K5I A;  2FRY A;  3P8B B;  3QO7 A;  4C0G A;  3NTI A;  2QA4 T;  1I1J A;  2C7I A;  4E51 A;  1ZSZ B;  3L2Q A;  2RI5 A;  4FM4 B;  2ROL A;  4PJO G;  1XJW B;  1ABO A;  2YRV A;  1BYM A;  2F1L A;  4NCX A;  1GL5 A;  1G5H A;  3L2W A;  3JSC A;  4F7U A;  2EQU A;  4CS4 A;  3CCV T;  3KXT A;  1YIJ T;  2DTH A;  4JS5 A;  2NUP A;  4RTW A;  8ATC B;  1K0X A;  4OB2 B;  5KYN A;  1VQP T;  4OB0 B;  2V26 A;  4X9C A;  3NET A;  1OZ3 A;  4F16 A;  1VYV A;  2DVJ A;  2YLC A;  5D6Y A;  5DLO A;  1GFD A;  3G71 Q;  3OYG A;  1QWE A;  1SSH A;  4LD6 A;  4YRK A;  1BCM A;  1KSW A;  1NPR A;  4E2F B;  4P3P A;  2Q7G A;  1D0X A;  5GAM e;  1YJN A;  3BDL A;  2COZ A;  1Y57 A;  2EBP A;  2JMA A;  3CCS A;  3HXY A;  2V1Q A;  1LVK A;  1X2K A;  3RNJ A;  5LJ3 g;  3HFZ B;  3LWH A;  2FL7 A;  2NYS A;  2DXT A;  1YGB A;  4RCB A;  5LJ3 d;  2RK2 A;  3RIR A;  5LJ3 h;  4C5G A;  1AWO A;  2DMO A;  4LE9 A;  4B9X A;  1K0S A;  1OPL A;  1KHI A;  3EG1 A;  4CS3 A;  4GLM A;  1J3T A;  2CP5 A;  4OF1 A;  3MO8 A;  2FZC B;  2LC4 A;  2ZT7 A;  2EYX A;  2CUB A;  3HRU A;  1AWJ A;  3PFS A;  3OS2 A;  4ESR A;  2ODR D;  2D8H A;  2HNI A;  1K8A U;  3IG2 A;  3I5R A;  4F04 B;  1NJI C;  1M90 U;  2CIM A;  3A7R A;  4CC7 A;  1ZA2 B;  2DYI A;  2D1X A;  2LQN A;  3URG A;  3QPH A;  4ZGD B;  4F7U G;  4C92 F;  3M0T A;  1BIA A;  2CRE A;  1UHF A;  4M77 C;  1UG1 A;  1OEB A;  4UP9 A;  3IKM B;  3QII A;  3QWY A;  1VQ7 T;  2OTJ T;  3CCE A;  1KQS A;  1SHG A;  4BY6 B;  4OMP A;  2KYM A;  3CME T;  5CQX A;  1VQ6 A;  2AIR B;  5CKD A;  5L8R E;  1WLE A;  2COY A;  4HVV A;  2YDL A;  1X55 A;  2LQ8 A;  4NOY A;  1YJW T;  4WI1 A;  2ZPI B;  3OA6 A;  3CCR A;  3UA7 A;  4UC4 A;  2KK4 A;  3RKY A;  4LVL A;  4EMK C;  3JCM Q;  4DOV A;  3CCJ T;  3M4Q A;  4N4I A;  2P84 A;  3WVD B;  5GMK j;  2MK5 A;  1L0W A;  5KYX A;  2J6O A;  2PME A;  1TSF A;  2QHV A;  1N6A A;  1NPP A;  2DZ9 A;  2XHC A;  3CC4 A;  4V2S A;  4J8O A;  1K4U S;  2CYZ B;  3LLR A;  3X26 B;  1QP3 A;  1G3T A;  5GAN 7;  4OB1 B;  3HTR A;  2DEU A;  1NJ8 A;  4R55 A;  4C92 D;  4OMM A;  2EWN A;  5CKE A;  4BAC A;  1FYF A;  4TWA A;  1LOJ A;  1OI1 A;  3QO5 A;  4LD9 K;  1V1C A;  5HCK A;  1GCP A;  2LT1 A;  2X3X D;  2E5Q A;  1D1B A;  4JS4 A;  3UA6 A;  1IL2 A;  4EO4 A;  3EGU A;  2M0Y A;  4HWP A;  3A5Y A;  3CC2 A;  4FU6 A;  1MHN A;  4PJO C;  3GOX A;  2MAM A;  2YT6 A;  4ANJ A;  2QI2 A;  1SES A;  3CCM A;  2HBP A;  4WF2 A;  1JXO A;  4MZT A;  1QVF P;  2L89 A;  4H2W A;  1KMM A;  3EH2 A;  2EKO A;  4GLK A;  5IXF A;  3JCM d;  2OTL A;  3JCM h;  5CAI A;  4BW9 A;  1EIY B;  5A2Q E;  3JRZ A;  1UJY A;  1W4S A;  3LSQ A;  4M75 C;  4FYY B;  4OMN A;  2EFI A;  3OSS C;  3MF1 A;  1VQL Q;  5KCO A;  2CT3 A;  3NEN A;  4YRS A;  2VYT A;  3C0C A;  3RKW A;  2V8J A;  2DQ3 A;  1YFN A;  5M9O A;  2BE7 D;  2PUO B;  4JRQ A;  5GAN 6;  4TVR A;  3EG9 B;  3CMQ A;  2XG8 D;  1B7Y B;  4N4H A;  4KGV B;  3V8K A;  1O75 A;  1QW1 A;  1XOV A;  4FSS A;  4XEM A;  2RJD A;  2WSC E;  3REB B;  1JQQ A;  3OMC A;  4BUG A;  1USY A;  4JLG A;  1Q81 R;  3PMI A;  5ELN A;  4M7D G;  3P8V A;  3OYA A;  2IY5 A;  3HFV A;  1B07 A;  2DF6 A;  3HXU A;  3REX A;  2VAS A;  2CZ6 B;  1H4S A;  3SWN B;  5IAY A;  3ZBD A;  4M7A A;  3M5A A;  5FRO A;  3ER0 A;  1ZQ1 A;  1UGS B;  3S3O A;  1SKU B;  1VQO A;  2RJF A;  1ADJ A;  3HRT A;  3EFS A;  2E41 A;  5LJ5 d;  5LJ5 h;  4AMC A;  2I0N A;  3QDF A;  1VQ9 Q;  2KRM A;  2RO0 A;  5GAN h;  1KQS P;  2DO3 A;  3MP6 A;  2DIG A;  1PWT A;  1UEB A;  1KOG A;  1KC8 R;  3CCE T;  1TWB A;  4RQF A;  4M78 F;  1HXD A;  2DVE A;  3OW2 A;  2DPP B;  2KT8 A;  1N8R C;  2I4M A;  3CD6 Q;  1OU8 A;  4ELZ C;  1YFS A;  3JCM J;  4J9I A;  2A7Y A;  2C0I A;  2DFU A;  2ESW A;  2EW3 A;  2AKL A;  3HY1 A;  2D6F A;  1NE8 A;  1WQW A;  2KBT A;  2ENM A;  2BTT A;  3DSQ A;  4H2X A;  2E3I A;  2V1R A;  3FC3 A;  4CS2 A;  1PKT A;  3RBB B;  5CQY A;  2YUP A;  2A36 A;  3AT1 B;  2K2V A;  2X4X A;  4C92 B;  2QA4 Q;  5FU7 C;  2O9S A;  2I4N A;  4QVD A;  4FT4 A;  2ZZE A;  3TSZ A;  1K9A A;  2PNI A;  4J7I A;  3CC4 T;  4RTV A;  1W66 A;  4FW2 A;  1I5L A;  2KRO A;  2X35 A;  3BY7 A;  3F70 A;  3E9G A;  3JCM V;  4J9E A;  2DIL A;  2HQX A;  1ASZ A;  3S3N A;  4J9G A;  2M16 A;  2ZPB B;  1M1F A;  4Y91 A;  3JCM X;  1EOV A;  2EJG A;  2VXF A;  3CMA Q;  4F7U F;  4EPC A;  3M55 A;  2EGA A;  3BW1 A;  5E3I A;  1YIJ Q;  3JB9 J;  4M78 D;  4CI0 C;  3V8L A;  5IHI A;  3X24 B;  3I55 A;  4QQD A;  1X56 A;  4M7A G;  1JJ2 A;  2A28 A;  2FO0 A;  3NMZ C;  5KH6 A;  2Q7H A;  2OAW A;  3CC2 T;  4H2U A;  5GAM j;  3CPW A;  1X01 A;  2BE9 B;  3CCM T;  3H0H A;  2X4J A;  3M54 A;  3ULR B;  3QJY A;  2JTM A;  2C0O A;  5LJ3 e;  3EGX A;  4RDX A;  4F17 A;  2O9V A;  1YCY A;  2AK5 A;  1U06 A;  1G83 A;  4DA4 A;  2YUO A;  1SF9 A;  4C8Q E;  3MEY A;  2DL3 A;  2PUK B;  4IKF A;  1U1S A;  4AFQ C;  3MF2 A;  2EYW A;  2QTX A;  1WA7 A;  2JN0 A;  3CC7 A;  2DD4 A;  4X5O A;  1Y96 B;  1W70 A;  3UGT A;  5J26 A;  2J6K A;  4YTL A;  4O2D A;  5D6X A;  3G1J A;  2F69 A;  3M53 A;  1UHC A;  5F5W A;  4FIB A;  1U3O A;  2KRN A;  4ZN3 A;  1RLP C;  1Q81 U;  1B76 A;  3OYC A;  1JJC A;  2CH4 W;  2DZC A;  1VQ5 A;  1YIT T;  4TVA B;  3PTA A;  4XU0 A;  2JM8 A;  1M3A A;  1QCF A;  2RQV A;  2LCL A;  2ZT8 A;  5GAO q;  4CC4 B;  2ZIO A;  4M77 A;  2KXC A;  1LJO A;  1YI2 A;  2FPD A;  2XDB A;  3I7F A;  1PYS B;  1MMA A;  1RAE B;  2RHQ B;  2QQR A;  3CPF A;  4M7D C;  1AEY A;  3M0Q A;  3VS3 A;  4YRR A;  2F5T X;  4JLI A;  2MOX A;  3HFO A;  4Y92 A;  1HSQ A;  4DBF A;  5HKC A;  1MV3 A;  4E7K A;  4YRQ A;  4FSX A;  3MET A;  3MKD A;  2ZIM A;  1KC8 U;  4EMK A;  2AMC A;  2BZX A;  1WX6 A;  1VQO T;  4HT9 A;  3FJ5 A;  1CSK A;  3CME Q;  1X27 A;  1NYR A;  5KYW B;  1WYX A;  4OB3 B;  1VQK T;  4PFP A;  3SB2 A;  2FVU A;  4YRO A;  3P8T A;  2D8J A;  3P8D A;  1Q82 R;  1YHQ T;  2J05 A;  2O4X B;  2LJ0 A;  3H8Z A;  2CP0 A;  2AKW B;  1B70 B;  2LDM A;  3CCU T;  2ALY A;  1VQN A;  2O88 A;  3CBM A;  2VC8 A;  1Y0M A;  2O01 E;  1K73 U;  3PIP A;  2L0A A;  2ZTG A;  2EPD A;  2L3Q A;  1M2V B;  2CJA A;  3MHX A;  4QVC A;  5DM7 R;  3INZ A;  3OS1 A;  2GFA A;  2RN8 A;  1NYG A;  4EMH A;  4KBM B;  3LGL A;  4YDQ A;  2ECZ A;  3OD1 A;  4YCU A;  2GFU A;  1X43 A;  3W3S A;  4EDU A;  4C0Z A;  2DL8 A;  5D6W A;  1WHL A;  4PJO A;  2MYS A;  2RK1 A;  3QG1 A;  2NLU A;  5GMK l;  4LUE A;  2K5F A;  1VA7 A;  2O4X A;  4PK4 A;  1GBR A;  2CGH A;  4M78 B;  2RH2 A;  4NL3 A;  3JCM e;  3MEA A;  1M1K R;  1W1F A;  5GAN 4;  3CCL A;  5K1P A;  1YJ9 A;  1OOT A;  2EKH A;  1X2Q A;  2QGG A;  4KUD K;  4M75 A;  2RHY A;  1JJ2 P;  2KGT A;  1TXQ A;  4OMF B;  3G6E T;  3VQV A;  2P5I A;  1H8K A;  3EGD A;  1NNH A;  3M4G A;  2C0T A;  2IG0 A;  3CPW P;  1TTH B;  4J6Y A;  5L23 A;  3I55 T;  4YRJ A;  4BE1 A;  2QEX Q;  5I2S A;  2QQA A;  2YRD A;  2MWP A;  1K76 A;  1ARK A;  3VKI A;  5C53 B;  1VQ8 T;  4HA8 A;  4RTT A;  4DEX A;  4TQD A;  4PKC C;  4ZIB A;  3VS2 A;  2G4C A;  4M7D D;  2LQK A;  4PNO A;  1UJ0 A;  2LT4 A;  4C0D C;  2EJ9 A;  1XQH A;  1QVF S;  1BIB A;  1GRI A;  1TH7 A;  4F7U B;  1QMC A;  2DL7 A;  4ORZ A;  2EQI A;  1B3Q A;  2OAU A;  2NUP B;  5GAO p;  3LW5 E;  4XTU A;  5GAO r;  4J83 A;  3QO8 A;  1JXM A;  4KUL A;  1A0N B;  1G51 A;  2P0P A;  2VUB A;  2CP6 A;  4N0A C;  1M2O A;  4ELY C;  4DPG A;  1R0B G;  3E9F A;  3QHS A;  1XTD A;  2VXE A;  3OS0 A;  2Y90 A;  5KYY A;  4AG1 C;  1T0J A;  2DRK A;  1ZBJ A;  3CEY A;  4C5H A;  3A7U A;  3L4G A;  5LJ5 e;  2RHI A;  3P8H A;  3VRZ A;  1VQ5 T;  1FWZ A;  3GLX A;  1T3L A;  1RAB B;  3OYK A;  4QKU A;  1K9M C;  2QDL A;  4M7A F;  1H4T A;  2D0N A;  3L2Z A;  4E7S A;  3JAM E;  1YI2 T;  1EIF A;  2KT1 A;  4A53 A;  1YN8 A;  3OBW A;  1ZX6 A;  4M75 G;  5CO7 A;  3TEG A;  1XNI A;  1N9R A;  1NYQ A;  1C6V X;  2HAX A;  3QYH B;  2G6F X;  2FPF A;  1Q82 U;  2QHT A;  4UP7 A;  2I4L A;  2ED1 A;  2ZPG B;  3SDZ A;  4YYE A;  1S72 T;  4Z8A A;  2K3B A;  4JRI A;  2QYZ A;  4AH6 A;  2E4H A;  3HXZ A;  1R0C B;  3LSS A;  2LRQ A;  3CXC A;  4P3N A;  4C8Q C;  1D0Y A; 
#chains in the Genus database with same CATH homology
 1E1T A;  3G4S A;  2CZ1 B;  1AHJ B;  4FL6 A;  1NJ1 A;  3P8Y A;  1KQ1 A;  1KHC A;  2MI6 A;  1VQN T;  4BB7 A;  5CIU A;  4M7A D;  1WJQ A;  2LCC A;  4P3O A;  4Y28 E;  1N9S A;  3GPL A;  1M4Z A;  3CCQ A;  3PCO A;  4IUP A;  5ELO A;  1M1K U;  4YRI A;  3I56 T;  4Q15 A;  2Y4X A;  1E24 A;  3FIF A;  2G3R A;  4MDX A;  4N4G A;  2XGT A;  2RM4 A;  4H2V A;  3J81 E;  1X2H A;  1WYD A;  5LJ3 j;  4G85 A;  2ZPF B;  1SRY A;  1E22 A;  4HKE A;  3C4S A;  2J3L A;  4X9D A;  1WNL A;  4RCC A;  2XTI A;  2BKD N;  2ZXF A;  4M7D B;  3E9I A;  1ATI A;  2P0K A;  3RGL A;  3BDU A;  1NJ2 A;  4J7F A;  3G71 A;  1LYL A;  2R5A A;  5CKF A;  4XU1 A;  2XK0 A;  3LWI A;  3OYE A;  1P92 A;  2DD5 A;  3OYH A;  4MZM A;  1EFW A;  3X20 B;  5FU6 B;  3X25 B;  5LJ3 f;  2JNG A;  4P71 C;  4M7D A;  5C51 B;  3R07 A;  4PHC A;  4M77 F;  5EG2 A;  3HRK A;  5FRM A;  3LH0 A;  3E1S A;  4YPF A;  4PLL A;  2J3M A;  4HWT A;  3UPU A;  4ZTZ B;  3S6W A;  1D3B A;  3JCM g;  2DJZ A;  3HPW A;  2E5A A;  2ZT6 A;  4ZTU B;  1Q86 C;  4HT4 A;  3R6O A;  3RF1 A;  4JRP A;  2IY5 B;  4JRK A;  4LVK A;  2WSE E;  1YJN T;  2DIQ A;  2I2L A;  3A7A A;  4M77 D;  4M7A B;  5CVI A;  3CCS T;  3ERR A;  3G4S T;  3HHT B;  3LGF A;  3HP9 A;  3IKL A;  4LVJ A;  2GCX A;  3QNE A;  4ZTF A;  2CJB A;  5DY9 A;  3DB3 A;  3OYF A;  2PVG B;  4PJO F;  3HRS A;  4BI3 A;  2DXU A;  3OYB A;  2FB7 A;  3V7C A;  4LNS A;  4ZN1 A;  3HRI A;  1W2B S;  3VUB A;  4NS5 A;  4P5N A;  2L8D A;  2EQM A;  4RMF A;  4M75 F;  1X54 A;  1BI3 A;  5CR2 A;  3GNG A;  5LJ5 g;  4DOW A;  4C8Q C;  3ME9 A;  5GAN g;  4L59 A;  4H2X B;  4JUV A;  3RAC A;  3OSV A;  4YRC A;  2PVO B;  1BI1 A;  2EYQ A;  3A74 A;  5GAN d;  4O5V A;  1B8A A;  3HTZ A;  3C95 A;  1ZBX A;  1NJ6 A;  3TRE A;  3UDC A;  1BBU A;  2ZCF B;  1QVP A;  2HQE A;  2VV5 A;  1V29 B;  2DTI A;  3M9Q A;  1NJI U;  3JCM f;  4PJO D;  1VQ6 T;  1JJ2 S;  3A31 A;  4N0A A;  4IUQ A;  2DQ0 A;  3RMQ A;  1KQ2 A;  3RUX A;  3QKJ A;  3HXV A;  2QHU A;  3CCR T;  3A8M B;  1G3S A;  2QXF A;  2DXB A;  3G71 T;  1VQL A;  2ZIN A;  2WAC A;  4M75 D;  4HCB A;  4PLI A;  4YRT A;  4XTY A;  3E9H A;  4L5G A;  4E7L A;  2LVM A;  1SER A;  2LX9 A;  5CCA A;  4XEO A;  4ME7 A;  2WSF E;  5GAM d;  4BI8 B;  5GAM h;  2ZR2 A;  4FT2 A;  3O8V A;  4A4G A;  3KFU A;  5GMK m;  2KVQ G;  1KD1 C;  1GGM A;  2Q5I A;  2ZT5 A;  3L2V A;  1N27 A;  5CK9 A;  4P74 C;  2MF2 A;  2RJC A;  3HL8 A;  4BWA A;  3GF5 A;  3ASK A;  3EAE A;  4C8Q A;  2P4T A;  2KMT A;  1JJC B;  1ASY A;  3JB9 G;  3NTK A;  2E6N A;  1WGS A;  5LJ5 f;  12AS A;  4LDW A;  2OTL T;  1VQ9 A;  3RL6 A;  4M77 B;  2PVD B;  1LNX A;  5KE2 A;  3QUI A;  2V8I A;  3ZFJ A;  2QQ9 A;  3BFM A;  2P0L A;  2RJE A;  1Y07 A;  3RMS A;  2QDY B;  4LDX A;  4C92 E;  2RHS A;  5J3B A;  3QDR B;  3G1Z A;  1BI0 A;  3CD6 A;  4CH3 A;  2QHS A;  4K88 A;  4A4F A;  3SFM A;  4EMK B;  2AMC B;  2K4Y A;  4YRM A;  3VQY A;  3AHU A;  4GY5 A;  4E7H A;  1O9S A;  4XQ3 A;  2XD0 A;  4H2Y A;  5HK0 A;  2PQW A;  3PMT A;  2QA4 A;  2Q7E A;  3T9N A;  5GAN 5;  4HWR A;  4YRF A;  2KDS A;  1OZ2 A;  2ALY B;  3FJP A;  1IZ6 A;  2ZPH B;  3REU A;  1JB0 E;  1YBY A;  2JUF A;  3VU3 C;  5J39 A;  3QJ6 A;  2QQS A;  2KAF A;  3CMA A;  2KY9 A;  1E1O A;  1EQR A;  3WVE B;  1YIJ A;  2XDD A;  1JBM A;  2DKG A;  1UGR B;  4IUV A;  4E47 A;  4J6W A;  4C8Q G;  4PJO B;  4BY6 C;  2EAY A;  4YRN A;  5A0D A;  3M4P A;  4J15 A;  3MEU A;  3TUP A;  2E3C A;  1KMN A;  3TCJ A;  3J7A F;  2XU8 A;  2GQV A;  4P71 A;  4C92 G;  2BUD A;  3A8G B;  4M75 B;  3L1A A;  3N5B B;  2DXC A;  1M5Q 1;  2DEQ A;  2I4O A;  3RES A;  1NZ9 A;  4M7D F;  3RER A;  2XIC A;  3HY0 A;  3QO3 A;  1K8A C;  4X34 A;  1VIE A;  1N8R U;  4L87 A;  3PT9 A;  1C0A A;  2GF7 A;  2DAQ A;  1M90 C;  4R56 A;  2VGN A;  2ZNJ A;  4IUT A;  4C0F A;  1QVG A;  3LC0 A;  3LYI A;  2DU5 A;  5A0L A;  4IUR A;  3A5Z A;  1RI0 A;  2D9T A;  4RKU E;  4Q5W A;  2F5K A;  1NJ5 A;  3C94 A;  3L4G B;  2ZPE B;  3VYH B;  3M4Y A;  2RB6 A;  1J5W A;  4WJ4 A;  4II1 A;  4MMK A;  3SD4 A;  1HK9 A;  1BKB A;  3MQZ A;  4BE2 A;  3CME A;  3KUF A;  3ICA A;  1VQ9 T;  3TEE A;  3JB9 H;  2ZZF A;  2ZZG A;  3EFR A;  3CC7 T;  4H2S A;  1WU7 A;  2JVV A;  2C06 A;  1M9S A;  3JCM c;  3CD6 T;  3J80 E;  1PSE A;  2ODR C;  2B8A A;  4M78 E;  4QQ6 A;  4HCZ A;  2KQW A;  5GAN e;  3DB4 A;  4BDZ A;  4KT0 E;  5FU7 B;  2LNV A;  4TVW A;  3S3M A;  3OQ5 A;  4ZGE B;  3OMG A;  2E12 A;  2M0O A;  3SWN C;  3V7R A;  3PIO A;  1SSF A;  3TEH A;  2E65 A;  3JB9 F;  1PSF A;  3WXM B;  3QZ9 B;  4DQ2 A;  2XI9 A;  3CMA T;  3PCO B;  3OYJ A;  4KUI A;  3OY9 A;  3UH0 A;  4E7I A;  2QEX A;  3L42 A;  5GMK i;  1Q7Y U;  4F7U E;  1QVF A;  4BE0 A;  4NL2 A;  5AYF A;  3VQW A;  5GAN 2;  1KQS S;  4HVC A;  3VYG A;  2CKK A;  2RI3 A;  4UP8 A;  5FLX E;  3MEW A;  4EX5 A;  1WJR A;  5C6S A;  4C92 C;  1YFR A;  3L2U A;  4C5E A;  5GAO l;  5HK3 A;  1HC7 A;  4M78 G;  2BIV A;  1X6O A;  3JB9 D;  4KQE A;  5HY6 A;  2K3Y A;  4P75 A;  4P74 A;  4LVM A;  1VUB A;  4YCV A;  3A8O B;  2R57 A;  5GAO n;  4JJN K;  1EVL A;  4XTW A;  4P72 C;  2VGM A;  2A8E A;  3PZC A;  5DLQ E;  3CCL T;  3A8L B;  4UPA A;  3OYY A;  1YJ9 T;  4ZGJ B;  4MZP A;  4C8Q F;  3RKX A;  2MWO A;  2EQK A;  4G84 A;  1UGQ B;  2X4Y A;  3HFZ A;  4K86 A;  2R5M A;  4RMO A;  4C5I A;  2MMP A;  5GMK h;  4J5Y A;  4H02 A;  2CZ7 B;  4PG3 A;  2E64 A;  5HGQ A;  3QYG B;  2RA2 A;  2ARU A;  4ZTJ A;  5KNN A;  2EJF A;  2L3R A;  3UGQ A;  1D3B B;  2AHJ B;  1RIQ A;  3MP8 A;  4EMG A;  2E6Z A;  2M1H A;  4QQG A;  4ATO A;  2XKO C;  1HTT A;  4P73 C;  2E10 A;  1ADY A;  4C8Q D;  4D6W A;  4YP0 A;  2RHZ A;  3MEV A;  3VJP A;  1X75 C;  4WJ3 M;  1BBW A;  4YRL A;  5IN1 A;  2H3J A;  2DK3 A;  3ZEH A;  2ZGW A;  2YHT A;  3G7Z A;  3JB9 I;  4HT8 A;  4M7D E;  2E70 A;  3JCM W;  3M56 A;  1X2G A;  1K9M U;  2X4W A;  4XAX B;  1U1T A;  3CBO A;  4IUU A;  1BI2 A;  1VIF A;  2QEX T;  4KR2 A;  1Q81 C;  2ARS A;  1QE0 A;  3CBP A;  4A4H A;  4OGE A;  2K5L A;  2KSS A;  3OB9 A;  4C0D B;  3OW2 S;  3L2R A;  3NFC A;  3V7S A;  3FB9 A;  3VBB A;  4J6X A;  3CCQ T;  2ART A;  3M58 A;  1UGP B;  3HFN A;  1UB4 A;  4M78 C;  4Z02 A;  4E7J A;  3HSB A;  1YIT A;  3IAL A;  2M9U A;  2DU7 A;  1EIY A;  2JZ2 A;  1KC8 C;  1I81 A;  2IVW A;  3UWN A;  3HXX A;  3A8H B;  2CJ9 A;  1WJS A;  1G5I A;  3PNW C;  4A4K A;  1JRI A;  3FDR A;  2C8M A;  5I21 A;  2Q5H A;  3UFG A;  1YB3 A;  1B7Y A;  4M7A E;  1G3Y A;  1YFT A;  1K73 C;  1VQK A;  4H2T A;  2FHD A;  3OS5 A;  1H3Z A;  3CPW S;  4TVY A;  1QF6 A;  1YHQ A;  4RQE A;  2EQJ A;  5CKH A;  2RD1 A;  5KE3 A;  1G3W A;  4L6V 5;  1VQM A;  3CCU A;  5LJ5 j;  5GAN j;  2RHX A;  4B9W A;  2HD0 A;  3FEO A;  4C8Q B;  2D0Q B;  2K3X A;  3KBG A;  5I2M A;  5IT9 E;  3OYI A;  1SET A;  4CH6 A;  2ZR3 A;  2FYK A;  1Z7M A;  3SWN A;  5LL6 S;  4TTV A;  4OLF A;  5GAM g;  1W2B A;  4MML A;  2JOY A;  2V8K A;  4RG2 A;  1WQ7 A;  2RI2 A;  3QSU A;  1R8O B;  3VV0 A;  1Z7N A;  2L5Q A;  1RL2 A;  1VQZ A;  1VQ4 A;  5C52 B;  3OYM A;  2DTO A;  3QTC A;  5A0G A;  2RHS B;  4TQF A;  4P75 C;  3QBY A;  3HXW A;  4YRE A;  1IRE B;  4HWO A;  3OYD A;  3DLM A;  5GAN 3;  2PU9 B;  1Y7X A;  3G6E A;  3NEM A;  4OVA A;  1I8F A;  5GAN f;  3H6Z A;  2EIF A;  1MGQ A;  2QQB A;  4C92 A;  1VQ8 A;  2ZNI A;  1QP2 A;  1M8V A;  1H64 1;  3MP1 A;  2XDP A;  5KCH A;  4OP0 A;  3M59 A;  4XK8 E;  4QW2 A;  4LDV A;  3JCM P;  1Q86 U;  3Q1J A;  1B34 B;  4XTV A;  4P72 A;  4HWS A;  1N9W A;  1KG1 A;  3GP8 A;  4K87 A;  4CRI A;  5CKB A;  2NS6 A;  2RHU A;  5C0M A;  5K1X A;  5FRN A;  3HKS A;  3GNF B;  5GMK e;  2ZCE A;  4PL6 A;  5GAM f;  4O6J A;  1Q82 C;  2LTO A;  1DJ7 B;  3CCV A;  1B34 A;  4YRP A;  1Q7Y C;  4HCC A;  1Y96 A;  2R58 A;  4M77 E;  1QVG S;  4JDS A;  4A54 A;  1VQP A;  3M57 A;  2JTF A;  3C12 A;  3GIB A;  1GXI E;  4P73 A;  4YRG A;  3OYL A;  2DDZ A;  1ZHI A;  1M1G A;  1I4K 1;  1S72 A;  4XU3 A;  4VUB A;  4BI4 A;  3A5Z B;  4TVA A;  2Y4Y A;  3QXE B;  2EL9 A;  3LX7 A;  3NTH A;  1VQL T;  4BD3 A;  1M1K C;  1G5V A;  1VQM T;  2A3L A;  1PYS A;  3VQX A;  5FU6 C;  2RHQ A;  11AS A;  3FLG A;  2P0Q A;  3OBY A;  2CZ0 B;  4CH4 A;  4BDY A;  3WQZ A;  3A32 A;  5GAO m;  4QVZ A;  1FX7 A;  4A4E A;  1EVK A;  4LDU A;  4LVI A;  4OGC A;  3I56 A;  3V8J A;  1H4Q A;  3FRN A;  2CS7 A;  1VQ4 T;  3BJU A;  4PJO E;  3QZ5 B;  2AKW A;  1FXX A;  3VUZ A;  3DKM A;  1B70 A;  4M77 G;  1USY C;  4CH5 A;  4XU2 A;  3OYN A;  1OYX A;  1VQ7 A;  2OTJ A;  3UT1 A;  1H4V B;  2YLB A;  2PMF A;  2XID A;  4M75 E;  1KD1 U;  3DLL A;  4KR3 A;  4M7A C;  1YJW A;  3X28 B;  4RG8 A;  3TEH B;  4Q6G A;  3CCJ A;  1Y71 A;  2ZZD A;  4M78 A;  3JCM b;  4XTZ A;  3NEL A;  4LDY A;  3CXC S;  4XTX A;  1U8R A;  3PGG A;  3MCA B;  4YCW A;  2E1H A;  5GAN 8;  1WPY A;  4MDW A;  3E19 A;  2K57 A;  2K5I A;  3P8B B;  3QO7 A;  4C0G A;  3NTI A;  2QA4 T;  2C7I A;  4E51 A;  3L2Q A;  2RI5 A;  4FM4 B;  4PJO G;  2YRV A;  1BYM A;  4NCX A;  1G5H A;  3L2W A;  3JSC A;  4F7U A;  2EQU A;  4CS4 A;  3CCV T;  3KXT A;  1YIJ T;  2DTH A;  4JS5 A;  4OB2 B;  1VQP T;  4OB0 B;  4X9C A;  3NET A;  1OZ3 A;  2YLC A;  5D6Y A;  5DLO A;  3OYG A;  4YRK A;  4LD6 A;  1NPR A;  4P3P A;  2Q7G A;  5GAM e;  1YJN A;  3BDL A;  3CCS A;  3HXY A;  5LJ3 g;  3HFZ B;  3LWH A;  2FL7 A;  2DXT A;  1YGB A;  4RCB A;  5LJ3 d;  2RK2 A;  3RIR A;  5LJ3 h;  4C5G A;  4B9X A;  1KHI A;  4CS3 A;  4OF1 A;  3MO8 A;  2LC4 A;  2ZT7 A;  3HRU A;  3PFS A;  3OS2 A;  2ODR D;  2HNI A;  1K8A U;  3IG2 A;  1NJI C;  1M90 U;  2CIM A;  3A7R A;  3URG A;  3QPH A;  4ZGD B;  4F7U G;  4C92 F;  1BIA A;  4M77 C;  4UP9 A;  3IKM B;  3QII A;  1VQ7 T;  2OTJ T;  3CCE A;  1KQS A;  4BY6 B;  3CME T;  5CQX A;  1VQ6 A;  5CKD A;  5L8R E;  1WLE A;  1X55 A;  2LQ8 A;  4NOY A;  1YJW T;  4WI1 A;  2ZPI B;  3OA6 A;  3CCR A;  4UC4 A;  2KK4 A;  3RKY A;  4LVL A;  4EMK C;  3JCM Q;  4DOV A;  3CCJ T;  3M4Q A;  4N4I A;  3WVD B;  5GMK j;  1L0W A;  2PME A;  2QHV A;  1N6A A;  1NPP A;  2DZ9 A;  2XHC A;  3CC4 A;  4V2S A;  4J8O A;  2CYZ B;  3LLR A;  3X26 B;  1QP3 A;  1G3T A;  5GAN 7;  4OB1 B;  1NJ8 A;  4R55 A;  4C92 D;  5CKE A;  2EWN A;  4BAC A;  1FYF A;  4TWA A;  1LOJ A;  1OI1 A;  3QO5 A;  4LD9 K;  2LT1 A;  2E5Q A;  4JS4 A;  1IL2 A;  4EO4 A;  4HWP A;  3A5Y A;  3CC2 A;  4FU6 A;  1MHN A;  4PJO C;  3GOX A;  2MAM A;  1SES A;  2QI2 A;  3CCM A;  2HBP A;  4WF2 A;  4MZT A;  2L89 A;  4H2W A;  1KMM A;  2EKO A;  4GLK A;  3JCM d;  2OTL A;  3JCM h;  5CAI A;  4BW9 A;  1EIY B;  5A2Q E;  3JRZ A;  1W4S A;  3LSQ A;  4M75 C;  2EFI A;  3OSS C;  3MF1 A;  5KCO A;  3NEN A;  4YRS A;  2VYT A;  3RKW A;  2V8J A;  2DQ3 A;  5M9O A;  2PUO B;  4JRQ A;  5GAN 6;  4TVR A;  3CMQ A;  2XG8 D;  1B7Y B;  4N4H A;  3V8K A;  1O75 A;  1QW1 A;  1XOV A;  4XEM A;  2RJD A;  2WSC E;  3OMC A;  4BUG A;  1USY A;  4JLG A;  3PMI A;  5ELN A;  4M7D G;  3P8V A;  3OYA A;  2IY5 A;  3HFV A;  3HXU A;  3REX A;  2CZ6 B;  1H4S A;  3SWN B;  5IAY A;  3ZBD A;  4M7A A;  3M5A A;  5FRO A;  3ER0 A;  1ZQ1 A;  1UGS B;  3S3O A;  1VQO A;  2RJF A;  1ADJ A;  3HRT A;  3EFS A;  2E41 A;  5LJ5 d;  5LJ5 h;  2RO0 A;  5GAN h;  2DO3 A;  3MP6 A;  2DIG A;  1UEB A;  1KOG A;  3CCE T;  4RQF A;  4M78 F;  1HXD A;  2DVE A;  3OW2 A;  2DPP B;  1N8R C;  2I4M A;  4ELZ C;  1YFS A;  3JCM J;  2A7Y A;  3HY1 A;  2D6F A;  1NE8 A;  1WQW A;  3DSQ A;  4H2X A;  3FC3 A;  4CS2 A;  5CQY A;  4C92 B;  2K2V A;  2X4X A;  5FU7 C;  2I4N A;  4QVD A;  4FT4 A;  2ZZE A;  4J7I A;  3CC4 T;  1W66 A;  1I5L A;  3BY7 A;  2X35 A;  3F70 A;  3E9G A;  3JCM V;  1ASZ A;  2HQX A;  3S3N A;  2M16 A;  2ZPB B;  1M1F A;  4Y91 A;  3JCM X;  1EOV A;  2EJG A;  2VXF A;  4F7U F;  4EPC A;  3M55 A;  3BW1 A;  5E3I A;  3JB9 J;  4M78 D;  4CI0 C;  3V8L A;  3X24 B;  3I55 A;  4QQD A;  1X56 A;  4M7A G;  1JJ2 A;  2Q7H A;  5KH6 A;  3CC2 T;  4H2U A;  5GAM j;  3CPW A;  1X01 A;  3CCM T;  2X4J A;  3M54 A;  3QJY A;  2JTM A;  5LJ3 e;  4RDX A;  1YCY A;  4DA4 A;  4C8Q E;  3MEY A;  2PUK B;  4IKF A;  1U1S A;  3MF2 A;  2QTX A;  2JN0 A;  3CC7 A;  2DD4 A;  4X5O A;  1Y96 B;  3UGT A;  5J26 A;  4YTL A;  4O2D A;  5D6X A;  2F69 A;  3M53 A;  5F5W A;  4FIB A;  4ZN3 A;  1Q81 U;  1B76 A;  3OYC A;  1JJC A;  2DZC A;  1VQ5 A;  1YIT T;  4TVA B;  3PTA A;  4XU0 A;  2LCL A;  2ZT8 A;  5GAO q;  2ZIO A;  4M77 A;  1LJO A;  1YI2 A;  2XDB A;  3I7F A;  1PYS B;  2RHQ B;  2QQR A;  3CPF A;  4M7D C;  4YRR A;  2F5T X;  4JLI A;  3HFO A;  5HKC A;  4E7K A;  4YRQ A;  4FSX A;  3MET A;  2ZIM A;  1KC8 U;  4EMK A;  2AMC A;  1VQO T;  4HT9 A;  1NYR A;  4OB3 B;  1VQK T;  3SB2 A;  2FVU A;  4YRO A;  3P8T A;  3P8D A;  1YHQ T;  2O4X B;  3H8Z A;  2AKW B;  1B70 B;  2LDM A;  3CCU T;  2ALY A;  1VQN A;  3CBM A;  2VC8 A;  2O01 E;  1K73 U;  3PIP A;  2ZTG A;  2CJA A;  3MHX A;  4QVC A;  5DM7 R;  3INZ A;  3OS1 A;  2GFA A;  4EMH A;  4KBM B;  3LGL A;  4YDQ A;  3OD1 A;  4YCU A;  2GFU A;  3W3S A;  4EDU A;  4C0Z A;  5D6W A;  4PJO A;  2RK1 A;  3QG1 A;  2NLU A;  5GMK l;  2K5F A;  2O4X A;  2CGH A;  4M78 B;  2RH2 A;  4NL3 A;  3JCM e;  3MEA A;  5GAN 4;  3CCL A;  5K1P A;  1YJ9 A;  4KUD K;  4M75 A;  2RHY A;  4OMF B;  3G6E T;  3VQV A;  2P5I A;  1NNH A;  3M4G A;  2IG0 A;  4J6Y A;  3I55 T;  4YRJ A;  4BE1 A;  5I2S A;  2QQA A;  2MWP A;  3VKI A;  5C53 B;  1VQ8 T;  4HA8 A;  4TQD A;  4PKC C;  4ZIB A;  2G4C A;  4M7D D;  2LQK A;  4PNO A;  2LT4 A;  4C0D C;  2EJ9 A;  1XQH A;  1QVF S;  1BIB A;  1TH7 A;  4F7U B;  2OAU A;  5GAO p;  3LW5 E;  4XTU A;  5GAO r;  4J83 A;  3QO8 A;  4KUL A;  1G51 A;  2P0P A;  2VUB A;  4N0A C;  4ELY C;  4DPG A;  3E9F A;  3QHS A;  1XTD A;  2VXE A;  3OS0 A;  2Y90 A;  3CEY A;  4C5H A;  3A7U A;  3L4G A;  5LJ5 e;  2RHI A;  3P8H A;  1VQ5 T;  1FWZ A;  3GLX A;  3OYK A;  1K9M C;  4M7A F;  1H4T A;  3L2Z A;  3JAM E;  1YI2 T;  1EIF A;  4A53 A;  3OBW A;  4M75 G;  5CO7 A;  3TEG A;  1XNI A;  1N9R A;  1NYQ A;  2HAX A;  3QYH B;  1Q82 U;  2QHT A;  4UP7 A;  2I4L A;  2ZPG B;  3SDZ A;  4YYE A;  1S72 T;  4JRI A;  4AH6 A;  3HXZ A;  3LSS A;  2LRQ A;  3CXC A;  4P3N A;  3TU4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...