2E65A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, mutation d104a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
227
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 67
structure length 227
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e65A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e65A01
2DDZA 5GANe 3JB9G 1EQRA 2ZINA 3P8YA 1H4VB 4J6XA 4UP9A 2YHTA 1H4TA 1NJ1A 3VQWA 3HFVA 4PJOA 2ZT5A 3UFGA 4M77C 1Z7NA 3FJPA 3MF1A 2IY5A 4G84A 5GAOl 4HT9A 2ARUA 1NYQA 3MEYA 4XTVA 5LJ3d 4UP7A 5LJ3f 4C92D 4M77E 2ALYA 5GANd 2ZIMA 4YREA 2FYKA 4M77D 1IL2A 4YRIA 4TQDA 2AKWA 4XTZA 3INZA 4YRLA 2RHQA 4DQ2A 3JCMX 3BJUA 1NNHA 2I4LA 3PZCA 4J6YA 3HRIA 4XEOA 4JRIA 4PJOF 1D3BA 3EFRA 4TVAB 5LJ3j 3DSQA 1ADYA 3JB9F 2ZT7A 4YRFA 1YFRA 5GAN8 4WI1A 3ICAA 5GAN5 2C8MA 4YRKA 5LJ5h 1B7YB 5GANg 2PMFA 1EIYB 4KQEA 3PGGA 5LJ5g 1BIBA 5GMKl 3L4GA 2ALYB 1U1TA 2RD1A 4M75A 2I4NA 1B76A 4X5OA 4JUVA 3RKWA 3V8JA 4EMHA 5GAN7 4M7DE 3HY1A 3UGQA 4RDXA 3A7AA 3JB9I 4RQFA 4P71C 4PNOA 4M75E 4E51A 1N9RA 4MMLA 2ZCEA 4YCWA 4V2SA 3ERRA 1X54A 4HWSA 1Y96B 3KFUA 2E64A 4C92B 4P3PA 3JCMh 5GANf 1YB3A 3QO5A 3L2ZA 1E1TA 3REXA 4M7DF 4M7AC 2DQ3A 2I4OA 1WPYA 2E1HA 1EFWA 2ZT8A 2ZT6A 4JLIA 3SWNB 1N9WA 3L4GB 4YCVA 4XQ3A 3UH0A 1N9SA 4HWOA 4C92C 4L87A 3PCOB 4F7UE 4F7UG 4EMKA 2YLCA 4H2TA 2Q7EA 1Y96A 2RHSA 3L1AA 3RKYA 3IG2A 5K1PA 5GAOm 4J6WA 4BWAA 4YRNA 4M7AF 1ADJA 4M7DC 4M77B 4XU0A 4M7DD 1E1OA 5LJ5d 4PJOG 4C8QA 3RGLA 2ZXFA 1WU7A 2DEQA 2EAYA 1WQ7A 4K88A 4A53A 2I4MA 5GMKe 1L0WA 2AMCB 1I4K1 1I81A 1QE0A 3TEGA 4YRGA 3JB9J 1GGMA 4F7UB 2EWNA 1WLEA 3SWNC 4WJ4A 4HWRA 2QHVA 4X9CA 3OD1A 4XTUA 3QUIA 4M78C 3JCMd 2DQ0A 4YRQA 1B70B 4NOYA 4DPGA 1I8FA 2DTIA 3FB9A 3HFZA 4CS3A 4TVYA 5LJ3h 12ASA 2ZR2A 4NL3A 4HWTA 3JCMg 4P75A 1WNLA 3IKMB 4H2YA 4M7AA 1I5LA 11ASA 1LNXA 1NYRA 1X55A 1NJ6A 4M7DG 1YFSA 4C8QF 4M78G 4M78E 4PJOB 3M4GA 2RM4A 4TTVA 1LOJA 2DJZA 5ELOA 3A7UA 3M4QA 4XU2A 1EVLA 4EMGA 1EIYA 5GAMg 1H4SA 3R07A 5K1XA 4N0AA 1G51A 4H02A 4M75B 3MF2A 3JB9H 3TEHA 3G1ZA 4KR2A 3QO7A 2DTOA 2Q7HA 3RUXA 5GAN2 4WF2A 4M7AB 4N0AC 2DZ9A 2K57A 5I21A 3V7RA 1E24A 1SERA 2P5IA 5GMKm 4AH6A 4C8QD 2E10A 4A54A 1G5HA 3WQZA 4UPAA 1Z7MA 4YRCA 3A5YA 2Q5HA 3BY7A 4Q6GA 3GIBA 1X56A 1USYC 4H2VA 4M77G 5HGQA 4M75F 3A5ZA 3SB2A 5GAN4 5C51B 1G5IA 4M7AE 4Q15A 1RIQA 1SESA 3E9HA 3JCMV 4H2WA 3HY0A 4EMKC 2E5AA 1E22A 3V8LA 4QVDA 4YRPA 2DZCA 4PJOD 4CH3A 3LSQA 1KQ2A 3QO3A 1LJOA 1BIAA 5GMKj 2Y90A 4TVAA 3LC0A 3HXYA 2EJFA 4M75C 3IALA 2ZTGA 1HC7A 1PYSB 2E3CA 4CH4A 1NJ8A 4Y91A 3HXVA 3BDUA 2DU7A 4M78B 2ODRD 1YCYA 2EJ9A 3VU3C 2ZZGA 3HXZA 2Q5IA 1C0AA 2DTHA 2ARSA 3VQVA 3RF1A 1BBUA 4EO4A 1EVKA 1VQZA 4M77F 5C52B 2VXEA 1B70A 2CJBA 3VQXA 1J5WA 3HXUA 1JJCB 3LSSA 4X9DA 4TVWA 2I2LA 1FYFA 5DY9A 1SETA 3NEMA 2PMEA 4P75C 3AHUA 2ZZEA 2CIMA 5CAIA 3JCMf 5GANh 4RMFA 3HTZA 2DXUA 4HT8A 3QO8A 2DKGA 3PCOA 3IKLA 2JN0A 4CS4A 1WYDA 3P8TA 1JBMA 4JRKA 4EMKB 4TWAA 1TH7A 4C92G 5E3IA 3TEHB 2HNIA 4HA8A 4ZTUB 1KOGA 1ASZA 2RHSB 3A31A 3QHSA 4O2DA 4MMKA 4M77A 2EJGA 4CH5A 4C8QB 1B34B 5KNNA 4M7DA 2FB7A 1ATIA 1H4QA 2CJ9A 4H2XB 3QNEA 4OLFA 3V8KA 2Q7GA 5ELNA 1KMNA 3CMQA 3HFNA 1M8VA 4H2SA 3QSUA 2G4CA 4XU1A 2E65A 3JCMJ 2ZIOA 5LJ5e 1HXDA 2RHQB 3HFZB 5GMKh 4YRSA 4P74A 2ZNJA 1B34A 4QVCA 4C92F 3RACA 1H641 3VQYA 4H2XA 3HSBA 1D3BB 3NETA 4XU3A 2RA2A 5GANj 5C53B 3RIRA 2ARTA 5GAOr 2ODRC 3HXXA 4P72A 4J15A 3HRKA 4P71A 2YLBA 4RCCA 2J3LA 4BW9A 1HTTA 2CJAA 1PYSA 3P8VA 4PJOE 5GAOq 3JCMe 1JRIA 2VXFA 5GAMd 3JCMc 4H2UA 2ZNIA 3RKXA 3EFSA 2ZR3A 3JCMQ 4XTXA 4RQEA 5GAMe 4CH6A 1USYA 4NCXA 4PJOC 4YRTA 3RESA 4M78D 4YP0A 1HK9A 1X01A 3V7SA 2J3MA 3VBBA 1MGQA 2QHUA 5GAMj 1KMMA 4YRJA 3JCMW 4K86A 2DVEA 2IY5B 4P3NA 4P73A 3SWNA 1U1SA 4PHCA 2E41A 4F7UF 1YGBA 3QTCA 4P3OA 4C8QE 4YRMA 1KQ1A 1X2GA 3REUA 4P73C 4M78A 1EOVA 5GAOp 2AKWB 4K87A 3RERA 4EX5A 4P74C 2VC8A 4M7AG 2QHSA 2DXTA 4C8QC 1B8AA 4YYEA 4M75G 4WJ3M 4XEMA 2RB6A 3UGTA 2CGHA 1JJCA 1NJ2A 4C92A 5LJ5f 4ZIBA 3V7CA 5GAN3 4YDQA 4M7DB 2ZZFA 1B7YA 1NJ5A 4UP8A 5LJ3e 2AMCA 5GAMh 3JCMb 3E9IA 1LYLA 1ASYA 4TQFA 4LNSA 5LJ5j 2DU5A 4C92E 2ZGWA 4M7AD 4OP0A 3FIFA 1QF6A 4J5YA 4G85A 2XGTA 4RCBA 3JB9D 3RL6A 1SRYA 4PG3A 5LJ3g 2QHTA 4C8QG 3JCMP 5GAMf 3NELA 3HXWA 2C7IA 3TUPA 1W66A 3A74A 3NENA 4YRRA 4ZTZB 2QTXA 3I7FA 5GAOn 5F5WA 4YROA 3A32A 4NL2A 4HWPA 4XTWA 2P0LA 3HFOA 4KR3A 3M4PA 4F7UA 3A7RA 2EL9A 1WQWA 5GMKi 4M75D 2XTIA 4HVCA 1X2HA 4M78F 4P72C 4YPFA 4CS2A 3BFMA 5GAN6 1BBWA 1M5Q1 4YCUA 4XTYA 3BW1A 1YFTA 3W3SA
chains in the Genus database with same CATH superfamily
1KQSS 1KFZA 2DDZA 4DBRA 3JB9G 2X51A 3EGXA 1EQRA 1UECA 2KQWA 1ZSZA 4J6XA 1NJ1A 1WZOA 5KYWA 4J9EA 1ABOA 1CKBA 4MDXA 3UA7A 1Z7NA 2CUBA 4XK8E 1YJNQ 1MNEA 4F16A 3VRZA 3MEYA 1K8AU 2QEXA 4XTVA 2QQ9A 5KYUB 2QQSA 1A0NB 3CXCP 3L2QA 3PIOA 2GTJA 2YSQA 1IL2A 2DFUA 3EGDA 2DAQA 3EHQA 1PKSA 1PSFA 3BJUA 1WXUA 1W2BP 2E4HA 2VUBA 1OULA 4IUVA 3CCMT 4JLGA 2KGTA 1E6GA 1U8RA 2FZGB 2ZT7A 2GCXA 2LX9A 3J80E 3LWIA 5GAN8 3ICAA 4LNPA 5GAN5 2EW3A 1K9MC 1OI1A 5LJ5g 3ER0A 5GMKl 4M75A 3QIIA 3HY1A 4M7DE 5GAN7 3BE3A 1D0ZA 2KEAA 2B8AA 2EYZA 5CKEA 4M75E 3HRUA 1B3QA 3H8ZA 3M5AA 5CKHA 4AFUC 2E12A 1X54A 3HTRA 4JZ3A 1Y96B 1RI9A 1QCFA 3LH0A 2OTJQ 2DD5A 2PUKB 3CMAT 4M7DF 3QXEB 1WPYA 2LJ0A 3QYGB 4JLIA 3L4GB 5IHKA 4HWOA 4C92C 3H0FA 4A63B 5KYYA 1WJSA 2QK0A 4H2TA 3M0TA 1W2BS 1Y96A 3CBOA 2R58A 3OSSC 2KVQG 3IG2A 3CBMA 2LQNA 2LQKA 3G4ST 1ADJA 1TWBA 4C0GA 2KXCA 3G4SQ 1GBRA 2EAYA 1WQ7A 4K88A 4KRTA 4A53A 3H0IA 4YRGA 4F7UB 2EWNA 3AT1B 2RJDA 2AKLA 1LCKA 1PSEA 2CUDA 1UUEA 5A0GA 1M9SA 1NPRA 2RI2A 3CMET 1HSQA 3M55A 4M78C 1M4ZA 4NOYA 4DPGA 3EH1A 4CS3A 1Q7YR 4TVYA 1MMGA 2LMJA 3IKMB 3P8DA 4M7AA 1I5LA 11ASA 1NYRA 1NJ6A 2GFAA 2DBKA 1YFSA 4C8QF 1Q7YC 2KXDA 4PJOB 2R57A 4FW2A 2RM4A 2KRNA 4OMNA 3M0UA 3TU4K 3A7UA 5K1XA 3OYJA 1D1AA 3E19A 4C5HA 3G1ZA 1I5OB 4CC3A 2D0QB 2D8HA 2H3JA 4WF2A 1IHWA 4LVIA 4J9IA 2DZ9A 3V7RA 5CCAA 2DNUA 4OMFB 1T0HA 4AH6A 2DE0X 1SSFA 4A54A 3CPWP 4QQDA 3A5YA 2D1XA 2QASA 1VQ4T 4CC4B 1VQMT 1QP3A 1M30A 1E6HA 3F70A 2K3YA 2JUFA 1K4US 2F2XA 4OGEA 2CSQA 1W6XA 2XHCA 2LJ1A 1VQ5Q 1G5IA 2HMAA 1UDLA 4B6MA 2GGRA 1OOTA 1SRMA 1BK2A 2CS7A 3PMTA 2C0IA 4H2WA 2L3PA 1G83A 4RTTA 3GLXA 5D6XA 3VS6A 1QVGS 3MP6A 6AT1B 1LJOA 3MEAA 3QG1A 1M90U 1WDXA 2C06A 3LX7A 1X43A 3LC0A 2EJFA 2V8JA 5C6SA 1VQKQ 1I1JA 4HCBA 2LQWA 2RQVA 4CH4A 2KROA 5FU6C 2RMOA 4OMMA 4M78B 2DPPB 1YCYA 1V76A 3U23A 4QW2A 2ZZGA 2DX1A 5IXFA 2P0PA 2QA4T 3PE0A 2EQMA 3HXUA 4N4IA 3M0RA 2DILA 2EFIA 3E9FA 3FEOA 4E7JA 5DY9A 1IGQA 3AHUA 1VQNA 2FL7A 1R0BG 1MMDA 5CAIA 4HXJA 3JCMf 3CC2A 2DXUA 2M02A 4HT8A 3QO8A 2DKGA 4GY5A 2EQKA 3REAB 3LGLA 3VUBA 1M3CA 1JJ2A 3TEHB 4HA8A 3H41A 4ZTUB 1KOGA 4MMKA 3L2UA 2V8KA 2EJGA 1OEBA 1YITT 3MP1A 2QG9B 2ESWA 2JTMA 2FB7A 3KXTA 4L59A 2CJ9A 3A8GB 3CCVQ 3QNEA 1YIJA 3V8KA 4PLLA 2EQJA 5ELNA 2MPXC 1KMNA 1VIFA 2ZAEA 1M1FA 1YWOA 5CKDA 2BZ8A 4H2SA 2WSEE 2BZXA 1FMKA 2JNGA 4A4EA 3OYKA 2KE9A 1HXDA 4OF1A 1M90C 5KCOA 5L8RE 5GMKh 4YRSA 1GCPA 4P74A 2AK5A 2RN8A 1M3BA 4C92F 3RACA 1XJWB 5EC7A 1K9MR 1NLOC 5J3BA 3HSBA 5KYWB 1WHJA 1MNDA 2ARTA 2CSIA 1X2QA 4WCIA 3HRKA 4BW9A 4C0DB 2EGAA 1JRIA 2ZNIA 3RKXA 4DA4A 2ZR3A 3OA6A 1OV3A 1JXOA 1NBEB 1V29B 3OBWA 1X6OA 2VB6A 4CH6A 4LDUA 1USYA 1OU8A 2XDBA 4PJOC 1T0JA 2XICA 1JU5C 4X1VA 1X01A 1XTDA 1ABQA 1TS9A 3JCMW 2PUOB 2DVEA 3CMEA 4RG8A 1AWWA 3OYBA 4OB3B 3EAEA 2JT4A 1V1CA 2JTEA 1VQPT 2LRQA 4OMPA 4YTLA 1VQOT 4M78A 1ZHIA 4A4HA 4RTZA 2NUTB 2DXTA 4C8QC 3J7AF 3CCVT 4YYEA 4HVWA 1KC8R 4WJ3M 4LN2A 3UGTA 2K4YA 3TSZA 1M2VA 3A8MB 1TU0B 3V7CA 3VKIA 1ZA2B 4C0DC 4FSSA 4M7DB 1B7YA 1D09B 3LH5A 1NJ5A 2ZZFA 3T9NA 4HVVA 1BYMA 3PNWC 4RTYA 4FT2A 3M56A 2PNIA 5J26A 1X6BA 1K0SA 1F1BB 2DU5A 4C92E 2CP2A 1Q82U 2K2VA 1UGPB 2MI6A 2DM1A 3JB9D 1YJ9Q 1SRYA 4PG3A 2XU8A 1VYUA 2QHTA 2OTLA 3HXWA 3TUPA 3M0PA 5GAOn 2LVMA 1K73C 4YROA 2HSPA 2HL5C 3CXCA 3D7SB 2HBWA 1VQ8A 3M4PA 5KYXB 2EL9A 1VQ8T 2DMOA 4B9XA 3GNFB 1X2HA 1GFCA 4EIKA 4YPFA 3RMSA 2LCSA 1S1NA 3LLRA 1M5Q1 1BI0A 2X3WD 2J6OA 2YUPA 3BW1A 4RUGA 3KFVA 3W3SA 4E2FB 1GFDA 4N4GA 2ZINA 1IZ6A 2L89A 2KR3A 2LP5A 1N8RU 2E70A 1H4TA 4PLIA 2DD4A 4DBHA 2ZT5A 2YWWA 4PFZA 1YITQ 2DETA 5FU7B 4G84A 4FYYB 5GAOl 1QVPA 4FSXA 5LJ3f 4C92D 2ALYA 5GANd 4JJBA 2ZIMA 2FYKA 4M77D 4TQDA 2PQWA 3I56Q 5FWBA 3INZA 1WJQA 3UT1A 2EPDA 4DQ2A 3JCMX 5CO7A 3MEVA 1H3ZA 2I4LA 1I0CA 3G4SA 3PZCA 2FEIA 2YXYA 8ATCB 4XEOA 3JAME 4JRIA 2RQTA 4DEXA 5FU6B 5LJ3j 4KGZB 3DSQA 5KCHA 1ADYA 3JB9F 2KT1A 4QQ6A 4YRKA 1AT1B 1EIYB 2DIGA 4P5NA 1G3YA 1BIBA 2KDSA 3RDVA 2ALYB 4ESRA 4X5OA 4EMHA 3V8JA 4RQFA 3CCMA 3JB9I 3PVQA 4P71C 4PNOA 4ELZC 4E51A 1CSKA 2ZCEA 4YCWA 3VS7A 3KBGA 2NUZA 3I56T 2LNVA 2ENMA 3KFUA 3OS0A 2CZ7B 2CDTA 2ROTA 4J83A 4P3PA 1WX6A 3HPWA 3GP8A 1YI2T 3EHRA 5GANf 3CPFA 3QO5A 4M7AC 2D9TA 2NUPA 1N9SA 2RJCA 4HCZA 3QWYA 1AZEA 2HD0A 4L87A 4JRQA 3CCUT 3EFOB 1PRMC 1X2KA 2MYSA 2Q7EA 2DLPA 1AWOA 2GQVA 1RADB 3CC2T 2CH4A 1NG2A 3RKYA 2BTTA 4XU0A 4M7DD 2J6KA 5LJ5d 3EGXB 5FRMA 4PJOG 4C8QA 3CCJQ 1BCOA 1WU7A 1Y57A 3S6WA 1R8OB 2M1HA 2I4MA 2GBQA 3G1JA 1L0WA 1VUBA 2JM9A 4HCKA 3JB9J 3GF5A 3SWNC 3G6EA 4WJ4A 2P4RA 2QHVA 5KYUA 4X9CA 3OD1A 2ED1A 3CCLA 2BUDA 2QEXQ 1IREB 3JCMd 2YUQA 2DTIA 3FB9A 1U5SA 5LJ3h 2E3IA 4P75A 3CEYA 2X4JA 1WNLA 4PK4A 2RHXA 1TG0A 2DYBA 4JDSA 1X55A 5FU7C 2F5TX 1UJ0A 4D8KA 1BB9A 2EVRA 4BI8B 1Q95G 3M4GA 3OYFA 1QKWA 1ZUYA 2DJZA 5ELOA 5LL6S 2EKHA 3M4QA 2X35A 4Q5WA 4EMGA 1H4SA 3R07A 1GRIA 4J9DA 3JB9H 1MHNA 3TEHA 4KR2A 4D6WA 1VQLA 3QO7A 4MZPA 4DOVA 1KQSP 2L3SA 3RUXA 2AKKA 2DVJA 2Y4YA 2IPOB 3OQ5A 2K57A 1GXIE 3FRNA 1SERA 4J8OA 3URGA 4L5GA 2R5MA 4C8QD 2E10A 3JV3A 1Y07A 2FPFA 1K73U 1KIKA 2QQRA 2LX7A 2A7YA 4UPAA 1YN8A 5DM7R 3Q1JA 4Y92A 1K0XA 2Q5HA 3TEEA 2QDYB 2FPDA 2YRDA 3GNGA 4GLKA 4BY6B 1IO6A 1YCSB 2JOYA 4Q6GA 4BD3A 4VUBA 3OB9A 2XI9A 4H2VA 4M77G 2E6ZA 4M75F 3A5ZA 3SB2A 3CCQQ 3NFCA 5C51B 3A8LB 4M7AE 4RTVA 4Q15A 1RIQA 3E9HA 2HKQB 3JCMV 1UFFA 1YITA 3WVDB 3HY0A 1E22A 4QVDA 4YRPA 3LYIA 2DZCA 4CH3A 3LSQA 1C6VX 3L42A 1I07A 1E7OA 2P0QA 5DLQE 2DL8A 4FW1A 3RBBB 2CP5A 3HXYA 1SF9A 1HD3A 1HC7A 2MK5A 4J9CA 2E3CA 2XKOC 1MMNA 2LT1A 4PFPA 4LVLA 2Q5IA 1PD0A 3I9QA 2ARSA 3CC4A 3VQVA 4F17A 1EVKA 5C52B 1X69A 1J5WA 4QQGA 1M1GA 1UHCA 2QI2A 3LSSA 4TVWA 1WXTA 1RUWA 2LCCA 3SFMA 2OTLQ 2M16A 4P75C 1OZ3A 2ZZEA 1QQJA 1YJ9A 4E7ZA 3ZBDA 1DJ7B 1WYXA 3VS4A 2L3RA 2C0OA 1VQ5T 3PCOA 2JN0A 4CS4A 2A0FB 2O88A 3P8BB 3TVTA 1KD1C 4LDVA 3UDCA 1UHFA 1AZGB 3NTKA 3P8TA 2SEMA 2HNIA 1PKTA 1ASZA 1NE8A 3C0CA 2RHSB 3QHSA 1S72T 3N5BB 3OS1A 4IURA 1T3LA 1YJWT 4UC4A 1B34B 4CH5A 4J9HA 1H4QA 1N8RR 1VQLT 3WVEB 4H2XB 4OLFA 4OMQA 4J7FA 2HCKA 2EGCA 2MWOA 2AT1B 2DF6A 2X3XD 2DL4A 1WFWA 1TOVA 3EG0A 3S3NA 5GJWB 1M8VA 2F5KA 1M90R 1WHLA 3QSUA 1SSHA 4KUIA 1RLQC 4XU1A 2O4XA 3JCMJ 2FZKB 1K76A 1X6GA 3CD6Q 1NLPC 3A8HB 2ZIOA 1Y71A 2P0KA 2QA4A 2MWPA 3CCET 2VKNA 3NMZC 2ZNJA 1B34A 1ZUKA 2DRMA 4QVCA 1H641 3VQYA 4QT7A 5ECAA 2JVVA 1FWZA 2XD0A 1AVZC 2KMTA 1SKUB 3NETA 2QGGA 2RA2A 4LD6A 2YUNA 3RIRA 5GAOr 2ODRC 1VQMA 4P71A 2YLBA 1OPLA 1QCOA 1HTTA 2LDMA 1NM7A 4ZNXA 3X24B 2VXFA 1YJ9T 5GAMd 4H2UA 3EFSA 2CP3A 2FPEA 4PKCC 2ZPHB 1K9MU 2FG0A 1VQ9T 3EG3A 1ZUUA 1VQ9A 3CCQT 1CKAA 4JS5A 2COWA 2QQAA 4OGCA 1M8MA 2K6DA 2K9GA 1MUZA 2J3MA 5GAMj 4LE9A 5HY6A 4K86A 1D0YA 3MEWA 3EG1A 4P73A 1U1SA 3P8HA 1RAFB 4IUTA 3X25B 4F7UF 4C8QE 2XG8D 1KQ1A 1NYFA 1X2GA 4P73C 2QYZA 2JJ9A 4PFOA 2AZSA 1ZBJA 2RNAA 2RJEA 1EOVA 5GAOp 3CBPA 4K87A 4ANJA 3BDLA 5L23A 2CZ6B 2F69A 2ZPBB 1VQOQ 1B8AA 2IVWA 4M75G 5KE2A 4RTWA 1M3AA 2P84A 1QVGP 2CGHA 2B86A 2K2MA 1NJ2A 4WTOB 3R6NA 5GAN3 4YDQA 2V1RA 2O9VA 4MDWA 3MCAB 1JJ2P 1ZQ1A 5LJ3e 2AMCA 3QZ5B 5GAMh 1R0CB 2QAZA 4OVAA 2DYIA 2W10A 1WHMA 4E7LA 3JCMb 3E9IA 1D1CA 1SHGA 3CCUQ 1LYLA 3VV0A 4TQFA 1UJYA 4LNSA 2XMFA 4M7AD 3OBYA 1M2VB 5CK9A 2XGTA 2A37A 2GQIA 2LQ8A 3FC3A 1VQNQ 2JZ2A 2BIVA 2RH2A 3JCMP 2HL3A 5GAMf 1ZLMA 3NELA 3A74A 2RQWA 1IXDA 2RO0A 2VV5A 3E9GA 4KGXB 3CC7Q 4HWPA 3QBYA 1JXMA 3HFOA 4KR3A 2L2PA 5FLXE 3CCRQ 4KH1B 2CKKA 1IRXA 1Q7YU 1IHVA 4BACA 1QVGA 4M78F 1EZZB 4JPBW 4P72C 3BFMA 1BBWA 2JXBA 1WHKA 4YCUA 1ZBXA 4K11A 3CMAA 2EQIA 2DL7A 2IG0A 4AG2C 5GANe 2FO0A 4XAXB 4UP9A 1HYOA 2PVGB 1AOJA 2YHTA 2F2WA 5FROA 4AT1B 3FLGA 3HFVA 3CCRA 5IHNA 1ARKA 4M77C 4LDXA 2MCNA 3FJPA 3MF1A 2IY5A 2J6FA 3CC7A 4HT9A 2XK0A 1VQ5A 1NYQA 5LJ3d 3NPFA 4UP7A 4JJDA 3L2VA 1AEYA 2KSSA 1XOVA 1RAHB 4YREA 1NPPA 1K9AA 1M2OA 4Z02A 4XTZA 4AG1C 2NUTA 3VS0A 1TUGB 1PWTA 4FYXB 1QVFP 2G6FX 2OAWA 5IHIA 3L2WA 2CP0A 3HRIA 2C0TA 4TVAB 4AFQC 2CH4W 4YRFA 1YFRA 3CCST 2DIQA 4WI1A 2NUPB 5LJ5h 1B7YB 5GANg 2V8IA 2PMFA 3PGGA 2O2OA 5GJVB 5M9OA 3OY9A 2RD1A 2I4NA 2HAXA 1B76A 4JUVA 3EG9A 3UGQA 1NYGA 3ZEHA 4LVJA 1BI3A 1KJWA 1N9RA 4FL6A 3ERRA 3M54A 3OYEA 5CKBA 3IQLA 1B7TA 1C0MA 2M0YA 1Q86U 1VQ6A 3CD6T 4C92B 2D8JA 2J05A 5I2SA 3OW2A 2XDPA 4KBMB 3SD4A 2K3BA 1YB3A 3L2ZA 3M0SA 2YUOA 1KK7A 2I4OA 4BY6C 1OX8A 2E1HA 4JRPA 1EFWA 2E5QA 2ZT8A 1N9WA 1RLPC 3UH0A 4X34A 2RHUA 2LC4A 1JJ2S 2O9SA 3PCOB 3OYYA 4F7UE 4F7UG 3ME9A 1FX7A 3JRZA 3L1AA 1PHTA 5K1PA 2V26A 5CQXA 4YRNA 2W0ZA 2KI7A 4M7DC 2KYBA 2AIRB 2HKNA 1T3SA 3M53A 1PRLC 3FJ5A 2FHDA 4J9BA 1YHQT 5GMKe 1NZ9A 1PD1A 1UGSB 1Q82C 1GGMA 5KYXA 4ZGEB 1ACMB 4E7IA 3NTIA 4HWRA 1U06A 4IKFA 2PZ1A 1OYXA 2DQ0A 2LZ6B 1Q81C 2CREA 1B70B 5I11A 4C5EA 12ASA 4HWTA 3JCMg 3OS2A 1GL5A 1YI2A 1LNXA 2AZVA 1AWXA 4HCCA 4M7DG 4M78E 2ZCFB 1TSFA 1NEGA 5A0LA 3OMGA 2R5AA 1EIYA 5I2MA 5GAMg 3ULRB 1K1ZA 1G51A 5EG2A 2QEXT 4H02A 1GBQA 1XQHA 3LW5E 2RQRA 4OB1B 4F04B 2Q7HA 2L0AA 2ZZDA 5C0MA 4LVKA 4M7AB 4N0AC 3CC4T 5I21A 1QP2A 1E24A 3QWXX 2P5IA 2DXCA 9ATCB 2DK3A 1YJWQ 1KQSA 1G5HA 1UB4A 1Z7MA 3M57A 4PL6A 4PJNA 4YRCA 2K7AA 2X4XA 4AFZC 1P92A 4IIMA 1SHFA 2CT4A 1ZX6A 1USYC 4ELYC 4E47A 5HKCA 5A2QE 5GAN4 1ZSZC 2RF0A 5IT9E 1SESA 2KRSA 2E5AA 1VQLQ 1TTHB 3PMIA 3WXMB 1WI7A 3I55Q 1KQ2A 5D6WA 1BIAA 5GMKj 2QTVA 1VYVA 4TVAA 2O31A 2OTJT 1S72A 3IALA 2M51A 1S72Q 2ZTGA 3PIPA 4FU6A 1VOMA 4M4ZA 4R56A 1NJ8A 3M58A 3HXVA 2G3RA 4DBFA 4EPCA 3A8OB 3I55A 4OMLA 2DERA 3VU3C 3HXZA 1JEGA 2VGMA 2L5QA 2DTHA 2HSEB 1YHQA 3RF1A 1BBUA 4EO4A 4IUPA 4M77F 2CJBA 5CQYA 4BDYA 4FYVB 3CCQA 3CCEA 1JJCB 1OZ2A 2E5KA 2LJ3A 2I2LA 1RABB 4BE2A 2RK1A 1H92A 2OTLT 1Y0MA 3DB4A 1J3TA 2YRVA 3RNJA 3VS1A 2WACA 5GANh 4RMFA 1X75C 3HTZA 2NWMA 1MV3A 1M1KR 1WYDA 1JBMA 3E2UA 3DLMA 4OMOA 4C92G 4EMKB 4TWAA 5E3IA 1VQMQ 3A31A 1VQKT 4IUUA 2X9HA 1PM3A 5KNNA 3MQZA 1G3SA 2K79A 3MP8A 1AD5A 1QWEA 4F14A 2KK4A 2Q7GA 4FCYA 1C1AA 2A8EA 2RI3A 2KRMA 1WHHA 4ZTFA 2G4CA 1YI2Q 2Y4XA 2E65A 4B9WA 2RQUA 5DLOA 2L3QA 2FRYA 5IH2A 3DB3A 3HFZB 4TVRA 5IXBA 2E3HA 2KYMA 1PCXA 2OJ2A 4BE0A 2NLUA 3G6EQ 1D3BB 3OSVA 4IUQA 2A28A 1IGUA 2RHZA 1G3TA 4Z89A 3PVLA 3I5RA 3HXXA 1VQ7A 2DA9A 2PTKA 4RCCA 5FW9A 3PFSA 1PYSA 4Z8AA 4PJOE 5GAOq 1VQNT 3OYHA 1KC8U 1SPKA 3VS5A 1VQ7Q 3NHNA 2EYYA 1VIEA 5GAMe 3MHXA 3I56A 2BZYA 4NCXA 1RAGB 1N6AA 3RESA 4JJNK 1HK9A 2BE9B 1ZA1B 2BKDN 3VBBA 3CCEQ 1KMMA 4YRJA 2IY5B 2H8HA 4P3NA 1K8AR 2LT4A 2OAUA 2NS6A 4PHCA 2E41A 4PJJA 3QTCA 1QWFA 2RK2A 2Z0WA 4YRMA 3MKDA 4ZGJB 5CVIA 3HP9A 2AKWB 3GOXA 1K73R 1G3WA 2QHSA 2GFUA 4AFSC 1YNZA 2FZCB 1IB8A 3OYCA 1YIJT 4A4KA 4XEMA 3VYGA 2VWFA 2ATCB 2ZPFB 2A36A 2HQHA 3H0HA 3META 4O5VA 1JJCA 1VQPQ 5LJ5f 4ZIBA 4QKUA 4FT4A 1YP5A 1KHIA 4CI0C 1VQ8Q 4UP8A 2HQXA 4LDWA 3TQ7P 3VYHB 1UGVA 1EFNA 3CC7T 1H3HA 1RACB 1KSWA 4EDUA 1TUDA 1YWPA 2O4XB 2ZGWA 3SDZA 1QF6A 4J5YA 2FVUA 1XNIA 3REBB 1NJIR 4RCBA 3RL6A 4HVUA 3VS2A 5LJ3g 1Q82R 2CT3A 1YJWA 3OYDA 4BE1A 4YRRA 3M4YA 4ZTZB 1NJIC 3I7FA 5F5WA 1ZSGA 4NL2A 2K5LA 2MIOA 1YHQQ 2F2VA 2JMAA 2JM8A 3SHWA 2P0LA 2HZYA 5KYYB 4E7SA 4OB0B 4F7UA 1FXXA 4CC2A 5GMKi 3EFOA 5IN1A 2V1QA 2XTIA 3UATA 4HVCA 4AMCA 1NEBA 4CS2A 3THKA 1D0XA 3C94A 3X20B 2ROLA 2KAFA 4XTYA 3OYLA 2COYA 1FYNA 5J39A 3HRTA 3QDRB 4DBQA 3P8YA 2YRCA 4FYWB 4QVZA 1H4VB 2WSCE 3X28B 3QKJA 2EYWA 3VQWA 2O01E 2RHYA 4PJOA 3UPUA 3UFGA 4J9GA 2QDLA 2SRCA 2NYSA 1RAIB 2ARUA 2MF2A 2CP6A 1RL2A 3CCLQ 4M77E 3HL8A 3M9QA 2EYQA 3H6ZA 3CPWA 3QZ9B 4YRIA 3PTAA 2KNBB 2AKWA 1VQ4A 3KUFA 2OX7A 4YRLA 2RHQA 2DXBA 1PG5B 1WXBA 5D7UA 2ZPGB 2GNCA 1NNHA 4ZTJA 1JB0E 4J6YA 4PJOF 1D3BA 3EFRA 1WGSA 3I35A 3CXCS 4A4GA 1EX4A 3CCSQ 1KG1A 4GLMA 2C8MA 2ZPIB 4KQEA 1QKXA 2VASA 3L4GA 4LXCA 1U1TA 4KULA 3RKWA 2YDLA 4LVMA 4L6V5 5I22A 1OU9A 3A7AA 4RDXA 1WIEA 3VS3A 4MMLA 3VRYA 4V2SA 3J81E 4HWSA 3X26B 3EGUA 3UA6A 2E64A 1QMCA 4A4FA 1VQ6Q 3JCMh 3FDRA 1E1TA 3REXA 1RAAB 2DQ3A 2VGNA 2EIFA 3S3OA 2ZT6A 3SWNB 2WSFE 4BB7A 1YIJQ 4YCVA 4XQ3A 3CMEQ 4LUEA 4MZMA 3CCMQ 1UG1A 1KC8C 3RMQA 4EMKA 2YLCA 3S3MA 3G71A 2CP7A 1N27A 2RHSA 4ZGDB 2ECZA 5GAOm 4J6WA 4BWAA 1KD1U 4R55A 4M7AF 2J7IA 4M77B 1Z9QA 1E1OA 3RR6A 3MEUA 3LWHA 1MV0B 4RKUE 3RGLA 2ZXFA 4NS5A 4RG2A 2DEQA 1M1KC 1Y7XA 3OMCA 5HK3A 4J7IA 3CC2Q 2PU9B 2AMCB 1I4K1 2QQBA 1I81A 1QE0A 3TEGA 1WLEA 1KHCA 3PT9A 1TUCA 3ZL7C 3O8VA 4DEYA 3DLLA 4XTUA 1JO8A 2MMPA 3QUIA 4YRQA 3HHTB 1I8FA 2EBPA 3MJXA 2QA4Q 3HFZA 4LDYA 4ME7A 2ZR2A 4NL3A 1VQ6T 3CD6A 4H2YA 4ZN1A 4OB2B 1QLYA 2PVOB 2ED0A 4M78G 4TTVA 3NGPA 1LOJA 2DL3A 1YFNA 3EH2A 1BCMA 3CCVA 2RI5A 4XU2A 2EYXA 1EVLA 1RAEB 4N0AA 3SEMA 1UTIA 4M75B 1H8KA 3QDFA 3MF2A 4KGVB 1N8RC 3A5ZB 2DTOA 4PJLA 5GAN2 4IIOA 1Z9ZA 3OYMA 5KE3A 1X27A 5AT1B 2BE7D 2ZPEB 4FM4B 2XDDA 5GMKm 1OX9A 3MO8A 2L8DA 3WQZA 3G71T 4FIBA 4BUGA 4LD9K 2X4YA 1BBZA 3BY7A 4LUDA 1VQ4Q 1UGRB 2EGEA 3CCJT 1VYTA 1W2BA 3GIBA 2J06A 3JSCA 1X56A 1K8AC 5HGQA 3M0QA 3MPUB 1YJNT 1OPKA 5HCKA 5AYFA 1G8XA 2M0OA 1M1KU 3CC4Q 2JS2A 4EMKC 3V8LA 1GCQC 3CPWS 2PVDB 2HDAA 4PJOD 1SEMA 4HKEA 1SRLA 2MOXA 3QO3A 3C12A 2QGFB 3G7ZA 2Y90A 1U3OA 4BI4A 1UE9A 3C4SA 2I0NA 4M75C 3OYAA 3CMAQ 3H9NA 3UWNA 1PYSB 5CIUA 1BI1A 4D8DA 1O75A 1Q81U 3M59A 1MMAA 1PNJA 4Y91A 3OW2S 3BDUA 1W1FA 2DU7A 2E6NA 2ODRD 3CCRT 4II1A 2EJ9A 2GF7A 1W70A 1C0AA 1QVFA 1M27C 2LNHB 1VQZA 2VXEA 1B70A 5A0DA 2KT8A 3VQXA 3R6OA 1Q81R 4JZ4A 4X9DA 4ORZA 1NJIU 1FYFA 1SETA 3NEMA 3L2RA 2PMEA 4E7HA 2CIMA 1KD1R 3DKMA 4C5GA 4Y28E 1EIFA 2DBMA 3IKLA 4C0FA 3CCUA 2JS0A 2KBTA 3GBQA 4JRKA 1TH7A 1LPLA 3O5ZA 2VVKA 3QJYA 4CRIA 4O2DA 1R77A 3OYIA 3I5SA 3ZFJA 4M77A 3G71Q 2JW4A 4KT0E 3LGFA 4C8QB 1YBYA 4KUDK 4M7DA 1ATIA 5CKFA 2DL5A 2DRKA 3HKSA 4PJMA 2DEUA 4C5IA 2YT6A 5FWCA 3OW2P 1TXQA 3GPLA 2RHIA 2K3XA 1VQOA 3CMQA 2DO3A 2MAMA 3HFNA 3ASKA 2JMCA 1UEBA 1B07A 2CZ1B 4E6RA 2XIDA 5LJ5e 1BU1A 2RHQB 1N5ZA 2EKOA 3UF4A 2K5FA 4DOWA 1W4SA 2HQEA 2IIMA 2HEQA 3C95A 2JTFA 2VYTA 4RTUA 4H2XA 4CC7A 7AT1B 4XU3A 2ABLA 4RTXA 1VQ9Q 5GANj 5C53B 2X4WA 3E1SA 2COZA 3CCSA 4P72A 3QYHB 5HK0A 4J15A 2RJFA 2J3LA 2CJAA 2FRWA 3P8VA 4R0KA 3CCJA 3JCMe 3I55T 3JCMc 5FRNA 2K5IA 1FMWA 4J9FA 2EQUA 4MZTA 3JCMQ 2QXFA 4XTXA 4RQEA 1WLPB 3EGDB 2HBPA 1WHGA 1ZSZB 4E7KA 1Q86C 4HT4A 3EG2A 4YRTA 2KY9A 1JQQA 4M78D 4YP0A 4O6JA 3V7SA 4BDZA 1MGQA 2P4TA 2QHUA 3QPHA 3CCLT 3NTHA 2RPNA 2LCLA 1QW1A 3SWNA 2A3LA 3A1PA 1YGBA 4P3OA 1FMVA 2OI3A 3REUA 4JS4A 1WA7A 5IAYA 2OTJA 3RERA 4EX5A 4P74C 2VC8A 5KH6A 4M7AG 1LVKA 2GTOA 1AHJB 1VQKA 4KH0B 1OQKA 2RB6A 1QVFS 3HRSA 2D6FA 2CZ0B 3OYGA 4ZN3A 2CYZB 1PC0A 4C92A 2LTOA 4Z88A 1WJRA 2M9UA 1BI2A 1AWJA 3OYNA 2DJQA 2F1LA 5KYNA 1Q86R 3EG9B 2AHJB 1G2BA 3TSWA 1VQ7T 1HJDA 1O9SA 1QCNA 4ATOA 3VUZA 3A98A 1ASYA 5LJ5j 4JJCA 4OP0A 3FIFA 4G85A 1BKBA 1SG5A 1D1BA 4C0ZA 1G5VA 2H3EB 4C8QG 4BI3A 8AT1B 2C7IA 2A08A 1W66A 3NENA 2QTXA 3TREA 3G6ET 5D6YA 1VA7A 3A32A 3TCJA 1YJNA 4RMOA 4XTWA 2D0NA 1UGQB 3A7RA 1RI0A 3OS5A 1WQWA 5CR2A 4M75D 3CQTA 1VQPA 5GAN6 4GBQA 1GCQA 3VJPA 3QJ6A 1YFTA 4N4HA
chains in the Genus database with same CATH topology
1KQSS 2DDZA 3JB9G 1EQRA 2KQWA 4J6XA 1NJ1A 4MDXA 1Z7NA 4XK8E 3MEYA 1K8AU 2QEXA 4XTVA 2QQ9A 2QQSA 3L2QA 3PIOA 1IL2A 2DAQA 1PSFA 3BJUA 2VUBA 4IUVA 3CCMT 4JLGA 1U8RA 2ZT7A 2GCXA 2LX9A 3J80E 3LWIA 5GAN8 3ICAA 5GAN5 1K9MC 1OI1A 5LJ5g 3ER0A 5GMKl 4M75A 3QIIA 3HY1A 4M7DE 5GAN7 2B8AA 5CKEA 4M75E 3HRUA 3H8ZA 3M5AA 5CKHA 2E12A 1X54A 1Y96B 3LH0A 2DD5A 2PUKB 3CMAT 4M7DF 3QXEB 1WPYA 3QYGB 4JLIA 3L4GB 4HWOA 4C92C 1WJSA 4H2TA 1W2BS 1Y96A 3CBOA 2R58A 3OSSC 2KVQG 3IG2A 3CBMA 2LQKA 3G4ST 1ADJA 4C0GA 2EAYA 1WQ7A 4K88A 4A53A 4YRGA 4F7UB 2EWNA 2RJDA 1PSEA 5A0GA 1M9SA 1NPRA 2RI2A 3CMET 3M55A 4M78C 1M4ZA 4NOYA 4DPGA 4CS3A 4TVYA 3IKMB 3P8DA 4M7AA 1I5LA 11ASA 1NYRA 1NJ6A 2GFAA 1YFSA 4C8QF 1Q7YC 4PJOB 2R57A 2RM4A 3TU4K 3A7UA 5K1XA 3OYJA 3E19A 4C5HA 3G1ZA 2D0QB 2H3JA 4WF2A 4LVIA 2DZ9A 3V7RA 5CCAA 4OMFB 4AH6A 1SSFA 4A54A 4QQDA 3A5YA 1VQ4T 1VQMT 1QP3A 3F70A 2K3YA 2JUFA 4OGEA 2XHCA 1G5IA 3PMTA 2CS7A 4H2WA 3GLXA 5D6XA 1QVGS 3MP6A 1LJOA 3MEAA 3QG1A 1M90U 2C06A 3LX7A 3LC0A 2EJFA 2V8JA 5C6SA 4HCBA 4CH4A 5FU6C 4M78B 2DPPB 1YCYA 4QW2A 2ZZGA 2P0PA 2QA4T 2EQMA 3HXUA 4N4IA 2EFIA 3E9FA 3FEOA 4E7JA 5DY9A 3AHUA 1VQNA 2FL7A 5CAIA 3JCMf 3CC2A 2DXUA 4HT8A 3QO8A 2DKGA 4GY5A 2EQKA 3LGLA 3VUBA 1JJ2A 3TEHB 4HA8A 4ZTUB 1KOGA 4MMKA 3L2UA 2V8KA 2EJGA 1YITT 3MP1A 2JTMA 2FB7A 3KXTA 4L59A 2CJ9A 3A8GB 3QNEA 1YIJA 3V8KA 4PLLA 2EQJA 5ELNA 1KMNA 1VIFA 1M1FA 5CKDA 4H2SA 2WSEE 2JNGA 4A4EA 3OYKA 1HXDA 1M90C 4OF1A 5KCOA 5L8RE 5GMKh 4YRSA 4P74A 4C92F 3RACA 5J3BA 3HSBA 2ARTA 3HRKA 4BW9A 4C0DB 1JRIA 2ZNIA 3RKXA 4DA4A 2ZR3A 3OA6A 1V29B 3OBWA 1X6OA 4CH6A 4LDUA 1USYA 2XDBA 4PJOC 2XICA 1X01A 1XTDA 3JCMW 2PUOB 2DVEA 3CMEA 4RG8A 3OYBA 4OB3B 3EAEA 1VQPT 2LRQA 4YTLA 1VQOT 4M78A 1ZHIA 4A4HA 2DXTA 4C8QC 3J7AF 3CCVT 4YYEA 4WJ3M 3UGTA 2K4YA 3A8MB 3V7CA 3VKIA 4C0DC 2ZZFA 4M7DB 1B7YA 1NJ5A 3T9NA 1BYMA 3PNWC 4FT2A 3M56A 5J26A 2DU5A 4C92E 1Q82U 2K2VA 1UGPB 2MI6A 3JB9D 1SRYA 4PG3A 2XU8A 2QHTA 2OTLA 3HXWA 3TUPA 5GAOn 2LVMA 1K73C 4YROA 3CXCA 1VQ8A 3M4PA 2EL9A 1VQ8T 4B9XA 3GNFB 1X2HA 4YPFA 3RMSA 3LLRA 1M5Q1 1BI0A 3BW1A 3W3SA 4N4GA 2ZINA 1IZ6A 2L89A 1N8RU 2E70A 1H4TA 4PLIA 2DD4A 2ZT5A 5FU7B 4G84A 5GAOl 1QVPA 4FSXA 5LJ3f 4C92D 2ALYA 5GANd 2ZIMA 2FYKA 4M77D 4TQDA 2PQWA 3INZA 1WJQA 3UT1A 4DQ2A 3JCMX 5CO7A 3MEVA 1H3ZA 2I4LA 3G4SA 3PZCA 4XEOA 3JAME 4JRIA 5FU6B 5LJ3j 3DSQA 5KCHA 1ADYA 3JB9F 4QQ6A 4YRKA 1EIYB 2DIGA 4P5NA 1G3YA 1BIBA 2KDSA 2ALYB 4X5OA 4EMHA 3V8JA 4RQFA 3CCMA 3JB9I 4P71C 4PNOA 4ELZC 4E51A 2ZCEA 4YCWA 3KBGA 3I56T 2LNVA 3KFUA 3OS0A 2CZ7B 4J83A 4P3PA 3HPWA 3GP8A 1YI2T 5GANf 3CPFA 3QO5A 4M7AC 2D9TA 1N9SA 2RJCA 4HCZA 4L87A 2HD0A 4JRQA 3CCUT 2Q7EA 2GQVA 3CC2T 3RKYA 4XU0A 4M7DD 5LJ5d 5FRMA 4PJOG 4C8QA 1WU7A 3S6WA 1R8OB 2M1HA 2I4MA 1L0WA 1VUBA 3JB9J 3GF5A 3SWNC 3G6EA 4WJ4A 2QHVA 4X9CA 3OD1A 3CCLA 2BUDA 1IREB 3JCMd 2DTIA 3FB9A 5LJ3h 4P75A 3CEYA 2X4JA 1WNLA 2RHXA 4JDSA 1X55A 5FU7C 2F5TX 4BI8B 3M4GA 3OYFA 2DJZA 5ELOA 5LL6S 3M4QA 2X35A 4Q5WA 4EMGA 1H4SA 3R07A 3JB9H 1MHNA 3TEHA 4KR2A 4D6WA 1VQLA 3QO7A 4MZPA 4DOVA 3RUXA 2Y4YA 3OQ5A 2K57A 1GXIE 3FRNA 1SERA 4J8OA 3URGA 4L5GA 2R5MA 4C8QD 2E10A 1Y07A 1K73U 2QQRA 2A7YA 4UPAA 5DM7R 3Q1JA 2Q5HA 3TEEA 2QDYB 3GNGA 4GLKA 4BY6B 2JOYA 4Q6GA 4BD3A 4VUBA 3OB9A 2XI9A 4H2VA 4M77G 2E6ZA 4M75F 3A5ZA 3SB2A 3NFCA 5C51B 3A8LB 4M7AE 4Q15A 1RIQA 3E9HA 3JCMV 1YITA 3WVDB 3HY0A 1E22A 4QVDA 4YRPA 3LYIA 2DZCA 4CH3A 3LSQA 3L42A 2P0QA 5DLQE 3HXYA 1HC7A 2E3CA 2XKOC 2LT1A 4LVLA 2Q5IA 2ARSA 3CC4A 3VQVA 1EVKA 5C52B 1J5WA 4QQGA 1M1GA 2QI2A 3LSSA 4TVWA 2LCCA 3SFMA 2M16A 4P75C 1OZ3A 2ZZEA 1YJ9A 3ZBDA 1DJ7B 2L3RA 1VQ5T 3PCOA 2JN0A 4CS4A 3P8BB 1KD1C 4LDVA 3UDCA 3NTKA 3P8TA 2HNIA 1ASZA 1NE8A 2RHSB 3QHSA 1S72T 3N5BB 3OS1A 4IURA 1YJWT 4UC4A 1B34B 4CH5A 1H4QA 1VQLT 3WVEB 4H2XB 4OLFA 4J7FA 2MWOA 1M8VA 3S3NA 2F5KA 3QSUA 4KUIA 2O4XA 4XU1A 3JCMJ 3A8HB 2ZIOA 1Y71A 2P0KA 2QA4A 2MWPA 3CCET 2ZNJA 1B34A 4QVCA 1H641 3VQYA 2JVVA 1FWZA 2XD0A 2KMTA 3NETA 2RA2A 4LD6A 3RIRA 5GAOr 2ODRC 1VQMA 4P71A 2YLBA 1HTTA 2LDMA 3X24B 2VXFA 1YJ9T 5GAMd 4H2UA 3EFSA 4PKCC 2ZPHB 1K9MU 1VQ9T 1VQ9A 3CCQT 4JS5A 2QQAA 4OGCA 2J3MA 5GAMj 5HY6A 4K86A 3MEWA 4P73A 1U1SA 3P8HA 4IUTA 3X25B 4F7UF 4C8QE 2XG8D 1KQ1A 1X2GA 4P73C 2RJEA 1EOVA 5GAOp 3CBPA 4K87A 3BDLA 2CZ6B 2F69A 2ZPBB 1B8AA 2IVWA 4M75G 5KE2A 2CGHA 1NJ2A 5GAN3 4YDQA 4MDWA 3MCAB 1ZQ1A 5LJ3e 2AMCA 3QZ5B 5GAMh 4OVAA 4E7LA 3JCMb 3E9IA 1LYLA 3VV0A 4TQFA 4LNSA 4M7AD 3OBYA 5CK9A 2XGTA 2LQ8A 3FC3A 2JZ2A 2BIVA 2RH2A 3JCMP 5GAMf 3NELA 3A74A 2RO0A 2VV5A 3E9GA 4HWPA 3QBYA 3HFOA 4KR3A 5FLXE 2CKKA 1Q7YU 4BACA 1QVGA 4M78F 4P72C 3BFMA 1BBWA 4YCUA 1ZBXA 3CMAA 2IG0A 5GANe 4XAXB 4UP9A 2PVGB 2YHTA 5FROA 3FLGA 3HFVA 3CCRA 4M77C 4LDXA 3FJPA 3MF1A 2IY5A 3CC7A 4HT9A 2XK0A 1VQ5A 1NYQA 5LJ3d 4UP7A 3L2VA 2KSSA 1XOVA 4YREA 1NPPA 4Z02A 4XTZA 3L2WA 3HRIA 4TVAB 4YRFA 1YFRA 3CCST 2DIQA 4WI1A 5LJ5h 1B7YB 5GANg 2V8IA 2PMFA 3PGGA 5M9OA 3OY9A 2RD1A 2I4NA 2HAXA 1B76A 4JUVA 3UGQA 3ZEHA 4LVJA 1BI3A 1N9RA 4FL6A 3ERRA 3M54A 3OYEA 5CKBA 1Q86U 1VQ6A 3CD6T 4C92B 5I2SA 3OW2A 2XDPA 4KBMB 3SD4A 1YB3A 3L2ZA 2I4OA 4BY6C 4JRPA 2E1HA 1EFWA 2E5QA 2ZT8A 1N9WA 3UH0A 4X34A 2RHUA 2LC4A 1JJ2S 3PCOB 3OYYA 4F7UE 4F7UG 3ME9A 1FX7A 3JRZA 3L1AA 5K1PA 5CQXA 4YRNA 4M7DC 3M53A 2FHDA 1YHQT 5GMKe 1NZ9A 1UGSB 1Q82C 1GGMA 4ZGEB 4E7IA 3NTIA 4HWRA 4IKFA 1OYXA 2DQ0A 1Q81C 1B70B 4C5EA 12ASA 4HWTA 3JCMg 3OS2A 1YI2A 1LNXA 4HCCA 4M7DG 4M78E 2ZCFB 5A0LA 3OMGA 2R5AA 1EIYA 5I2MA 5GAMg 1G51A 5EG2A 2QEXT 4H02A 1XQHA 3LW5E 4OB1B 2Q7HA 2ZZDA 5C0MA 4LVKA 4M7AB 4N0AC 3CC4T 5I21A 1QP2A 1E24A 2P5IA 2DXCA 2DK3A 1KQSA 1G5HA 1UB4A 1Z7MA 3M57A 4PL6A 4YRCA 2X4XA 1P92A 1USYC 4ELYC 4E47A 5HKCA 5A2QE 5GAN4 5IT9E 1SESA 2E5AA 3PMIA 3WXMB 1KQ2A 5D6WA 1BIAA 5GMKj 4TVAA 2OTJT 1S72A 3IALA 2ZTGA 3PIPA 4FU6A 4R56A 1NJ8A 3M58A 3HXVA 2G3RA 4EPCA 3A8OB 3I55A 3VU3C 3HXZA 2VGMA 2L5QA 2DTHA 1YHQA 3RF1A 1BBUA 4EO4A 4IUPA 4M77F 2CJBA 5CQYA 4BDYA 3CCQA 3CCEA 1JJCB 1OZ2A 4BE2A 2I2LA 2RK1A 2OTLT 3DB4A 2YRVA 2WACA 4RMFA 5GANh 1X75C 3HTZA 1WYDA 1JBMA 4EMKB 3DLMA 4C92G 4TWAA 5E3IA 3A31A 1VQKT 4IUUA 5KNNA 3MQZA 1G3SA 3MP8A 2KK4A 2Q7GA 2A8EA 2RI3A 4ZTFA 2G4CA 2Y4XA 2E65A 4B9WA 5DLOA 3DB3A 3HFZB 4TVRA 4BE0A 2NLUA 1D3BB 3OSVA 4IUQA 2RHZA 1G3TA 3HXXA 1VQ7A 4RCCA 3PFSA 1PYSA 4PJOE 5GAOq 1VQNT 3OYHA 1KC8U 1VIEA 5GAMe 3MHXA 3I56A 4NCXA 1N6AA 3RESA 4JJNK 1HK9A 2BKDN 3VBBA 1KMMA 4YRJA 2IY5B 4P3NA 2LT4A 2OAUA 2NS6A 4PHCA 2E41A 3QTCA 2RK2A 4YRMA 4ZGJB 5CVIA 3HP9A 2AKWB 3GOXA 1G3WA 2QHSA 2GFUA 3OYCA 1YIJT 4A4KA 4XEMA 3VYGA 2ZPFB 3META 4O5VA 1JJCA 5LJ5f 4ZIBA 4FT4A 1KHIA 4CI0C 4UP8A 2HQXA 4LDWA 3VYHB 3CC7T 4EDUA 2O4XB 2ZGWA 3SDZA 1QF6A 4J5YA 2FVUA 1XNIA 3RL6A 4RCBA 5LJ3g 1YJWA 3OYDA 4BE1A 4YRRA 3M4YA 4ZTZB 1NJIC 3I7FA 5F5WA 4NL2A 2K5LA 2P0LA 4OB0B 4F7UA 1FXXA 5GMKi 5IN1A 2XTIA 4HVCA 4CS2A 3C94A 3X20B 2KAFA 4XTYA 3OYLA 5J39A 3HRTA 3QDRB 3P8YA 4QVZA 1H4VB 2WSCE 3X28B 3QKJA 3VQWA 2O01E 2RHYA 4PJOA 3UPUA 3UFGA 2ARUA 2MF2A 1RL2A 4M77E 3HL8A 3M9QA 2EYQA 3H6ZA 3CPWA 3QZ9B 4YRIA 3PTAA 2AKWA 1VQ4A 3KUFA 4YRLA 2RHQA 2DXBA 2ZPGB 1NNHA 4ZTJA 1JB0E 4J6YA 4PJOF 1D3BA 3EFRA 1WGSA 3CXCS 4A4GA 1KG1A 2C8MA 2ZPIB 4KQEA 3L4GA 1U1TA 4KULA 3RKWA 4LVMA 4L6V5 4RDXA 3A7AA 4MMLA 4V2SA 3J81E 4HWSA 3X26B 2E64A 4A4FA 3JCMh 3FDRA 1E1TA 3REXA 2DQ3A 2VGNA 2EIFA 3S3OA 2ZT6A 3SWNB 2WSFE 4BB7A 4YCVA 4XQ3A 4MZMA 1KC8C 3RMQA 4EMKA 2YLCA 3S3MA 3G71A 1N27A 2RHSA 4ZGDB 5GAOm 4J6WA 4BWAA 1KD1U 4R55A 4M7AF 4M77B 1E1OA 3MEUA 3LWHA 4RKUE 3RGLA 2ZXFA 4NS5A 4RG2A 2DEQA 1M1KC 1Y7XA 3OMCA 5HK3A 4J7IA 2PU9B 2AMCB 1I4K1 2QQBA 1I81A 1QE0A 3TEGA 1WLEA 1KHCA 3PT9A 3O8VA 3DLLA 4XTUA 2MMPA 3QUIA 4YRQA 3HHTB 1I8FA 3HFZA 4LDYA 4ME7A 2ZR2A 4NL3A 1VQ6T 3CD6A 4H2YA 4ZN1A 4OB2B 2PVOB 4M78G 4TTVA 1LOJA 3CCVA 2RI5A 4XU2A 1EVLA 4N0AA 4M75B 3MF2A 1N8RC 3A5ZB 2DTOA 5GAN2 3OYMA 5KE3A 2ZPEB 4FM4B 2XDDA 5GMKm 3MO8A 2L8DA 3WQZA 3G71T 4FIBA 4BUGA 4LD9K 2X4YA 3BY7A 1UGRB 3CCJT 1W2BA 3GIBA 3JSCA 1X56A 1K8AC 5HGQA 1YJNT 5AYFA 2M0OA 1M1KU 4EMKC 3V8LA 3CPWS 2PVDB 4PJOD 4HKEA 3QO3A 3C12A 3G7ZA 2Y90A 4BI4A 3C4SA 4M75C 3OYAA 3UWNA 1PYSB 5CIUA 1BI1A 1Q81U 1O75A 3M59A 4Y91A 3OW2S 3BDUA 2DU7A 2E6NA 2ODRD 3CCRT 4II1A 2EJ9A 2GF7A 1C0AA 1QVFA 1VQZA 2VXEA 1B70A 5A0DA 3VQXA 3R6OA 4X9DA 1NJIU 1FYFA 1SETA 3NEMA 3L2RA 2PMEA 4E7HA 2CIMA 3DKMA 4C5GA 4Y28E 1EIFA 3IKLA 4C0FA 3CCUA 4JRKA 1TH7A 3QJYA 4CRIA 4O2DA 3OYIA 3ZFJA 4M77A 4KT0E 3LGFA 4C8QB 1YBYA 4KUDK 4M7DA 1ATIA 5CKFA 3HKSA 4C5IA 3GPLA 2RHIA 2K3XA 1VQOA 3CMQA 2DO3A 2MAMA 3HFNA 3ASKA 1UEBA 2CZ1B 2XIDA 5LJ5e 2RHQB 2EKOA 2K5FA 4DOWA 1W4SA 2HQEA 3C95A 2JTFA 2VYTA 4H2XA 4XU3A 5GANj 5C53B 2X4WA 3E1SA 3CCSA 4P72A 3QYHB 5HK0A 4J15A 2RJFA 2J3LA 2CJAA 3P8VA 3CCJA 3JCMe 3I55T 3JCMc 5FRNA 2K5IA 2EQUA 4MZTA 3JCMQ 2QXFA 4XTXA 4RQEA 2HBPA 1Q86C 4E7KA 4HT4A 4YRTA 2KY9A 4M78D 4YP0A 4O6JA 3V7SA 4BDZA 1MGQA 2P4TA 2QHUA 3QPHA 3CCLT 3NTHA 2LCLA 1QW1A 3SWNA 2A3LA 1YGBA 4P3OA 3REUA 4JS4A 5IAYA 2OTJA 3RERA 4EX5A 4P74C 2VC8A 4M7AG 5KH6A 1AHJB 1VQKA 2RB6A 1QVFS 3HRSA 2D6FA 2CZ0B 3OYGA 4ZN3A 2CYZB 4C92A 2LTOA 1WJRA 2M9UA 1BI2A 3OYNA 2AHJB 1VQ7T 1O9SA 4ATOA 3VUZA 1ASYA 5LJ5j 4OP0A 3FIFA 4G85A 1BKBA 4C0ZA 1G5VA 4C8QG 4BI3A 2C7IA 1W66A 3NENA 2QTXA 3TREA 3G6ET 5D6YA 3A32A 3TCJA 1YJNA 4RMOA 4XTWA 1UGQB 3A7RA 1RI0A 3OS5A 1WQWA 5CR2A 4M75D 1VQPA 5GAN6 3VJPA 3QJ6A 1YFTA 4N4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DDZ A;  5GAN e;  3JB9 G;  1EQR A;  2ZIN A;  3P8Y A;  1H4V B;  4J6X A;  4UP9 A;  2YHT A;  1H4T A;  1NJ1 A;  3VQW A;  3HFV A;  4PJO A;  2ZT5 A;  3UFG A;  4M77 C;  1Z7N A;  3FJP A;  3MF1 A;  2IY5 A;  4G84 A;  5GAO l;  4HT9 A;  2ARU A;  1NYQ A;  3MEY A;  4XTV A;  5LJ3 d;  4UP7 A;  5LJ3 f;  4C92 D;  4M77 E;  2ALY A;  5GAN d;  2ZIM A;  4YRE A;  2FYK A;  4M77 D;  1IL2 A;  4YRI A;  4TQD A;  2AKW A;  4XTZ A;  3INZ A;  4YRL A;  2RHQ A;  4DQ2 A;  3JCM X;  3BJU A;  1NNH A;  2I4L A;  3PZC A;  4J6Y A;  3HRI A;  4XEO A;  4JRI A;  4PJO F;  1D3B A;  3EFR A;  4TVA B;  5LJ3 j;  3DSQ A;  1ADY A;  3JB9 F;  2ZT7 A;  4YRF A;  1YFR A;  5GAN 8;  4WI1 A;  3ICA A;  5GAN 5;  2C8M A;  4YRK A;  5LJ5 h;  1B7Y B;  5GAN g;  2PMF A;  1EIY B;  4KQE A;  3PGG A;  5LJ5 g;  1BIB A;  5GMK l;  3L4G A;  2ALY B;  1U1T A;  2RD1 A;  4M75 A;  2I4N A;  1B76 A;  4X5O A;  4JUV A;  3RKW A;  3V8J A;  4EMH A;  5GAN 7;  4M7D E;  3HY1 A;  3UGQ A;  4RDX A;  3A7A A;  3JB9 I;  4RQF A;  4P71 C;  4PNO A;  4M75 E;  4E51 A;  1N9R A;  4MML A;  2ZCE A;  4YCW A;  4V2S A;  3ERR A;  1X54 A;  4HWS A;  1Y96 B;  3KFU A;  2E64 A;  4C92 B;  4P3P A;  3JCM h;  5GAN f;  1YB3 A;  3QO5 A;  3L2Z A;  1E1T A;  3REX A;  4M7D F;  4M7A C;  2DQ3 A;  2I4O A;  1WPY A;  2E1H A;  1EFW A;  2ZT8 A;  2ZT6 A;  4JLI A;  3SWN B;  1N9W A;  3L4G B;  4YCV A;  4XQ3 A;  3UH0 A;  1N9S A;  4HWO A;  4C92 C;  4L87 A;  3PCO B;  4F7U E;  4F7U G;  4EMK A;  2YLC A;  4H2T A;  2Q7E A;  1Y96 A;  2RHS A;  3L1A A;  3RKY A;  3IG2 A;  5K1P A;  5GAO m;  4J6W A;  4BWA A;  4YRN A;  4M7A F;  1ADJ A;  4M7D C;  4M77 B;  4XU0 A;  4M7D D;  1E1O A;  5LJ5 d;  4PJO G;  4C8Q A;  3RGL A;  2ZXF A;  1WU7 A;  2DEQ A;  2EAY A;  1WQ7 A;  4K88 A;  4A53 A;  2I4M A;  5GMK e;  1L0W A;  2AMC B;  1I4K 1;  1I81 A;  1QE0 A;  3TEG A;  4YRG A;  3JB9 J;  1GGM A;  4F7U B;  2EWN A;  1WLE A;  3SWN C;  4WJ4 A;  4HWR A;  2QHV A;  4X9C A;  3OD1 A;  4XTU A;  3QUI A;  4M78 C;  3JCM d;  2DQ0 A;  4YRQ A;  1B70 B;  4NOY A;  4DPG A;  1I8F A;  2DTI A;  3FB9 A;  3HFZ A;  4CS3 A;  4TVY A;  5LJ3 h;  12AS A;  2ZR2 A;  4NL3 A;  4HWT A;  3JCM g;  4P75 A;  1WNL A;  3IKM B;  4H2Y A;  4M7A A;  1I5L A;  11AS A;  1LNX A;  1NYR A;  1X55 A;  1NJ6 A;  4M7D G;  1YFS A;  4C8Q F;  4M78 G;  4M78 E;  4PJO B;  3M4G A;  2RM4 A;  4TTV A;  1LOJ A;  2DJZ A;  5ELO A;  3A7U A;  3M4Q A;  4XU2 A;  1EVL A;  4EMG A;  1EIY A;  5GAM g;  1H4S A;  3R07 A;  5K1X A;  4N0A A;  1G51 A;  4H02 A;  4M75 B;  3MF2 A;  3JB9 H;  3TEH A;  3G1Z A;  4KR2 A;  3QO7 A;  2DTO A;  2Q7H A;  3RUX A;  5GAN 2;  4WF2 A;  4M7A B;  4N0A C;  2DZ9 A;  2K57 A;  5I21 A;  3V7R A;  1E24 A;  1SER A;  2P5I A;  5GMK m;  4AH6 A;  4C8Q D;  2E10 A;  4A54 A;  1G5H A;  3WQZ A;  4UPA A;  1Z7M A;  4YRC A;  3A5Y A;  2Q5H A;  3BY7 A;  4Q6G A;  3GIB A;  1X56 A;  1USY C;  4H2V A;  4M77 G;  5HGQ A;  4M75 F;  3A5Z A;  3SB2 A;  5GAN 4;  5C51 B;  1G5I A;  4M7A E;  4Q15 A;  1RIQ A;  1SES A;  3E9H A;  3JCM V;  4H2W A;  3HY0 A;  4EMK C;  2E5A A;  1E22 A;  3V8L A;  4QVD A;  4YRP A;  2DZC A;  4PJO D;  4CH3 A;  3LSQ A;  1KQ2 A;  3QO3 A;  1LJO A;  1BIA A;  5GMK j;  2Y90 A;  4TVA A;  3LC0 A;  3HXY A;  2EJF A;  4M75 C;  3IAL A;  2ZTG A;  1HC7 A;  1PYS B;  2E3C A;  4CH4 A;  1NJ8 A;  4Y91 A;  3HXV A;  3BDU A;  2DU7 A;  4M78 B;  2ODR D;  1YCY A;  2EJ9 A;  3VU3 C;  2ZZG A;  3HXZ A;  2Q5I A;  1C0A A;  2DTH A;  2ARS A;  3VQV A;  3RF1 A;  1BBU A;  4EO4 A;  1EVK A;  1VQZ A;  4M77 F;  5C52 B;  2VXE A;  1B70 A;  2CJB A;  3VQX A;  1J5W A;  3HXU A;  1JJC B;  3LSS A;  4X9D A;  4TVW A;  2I2L A;  1FYF A;  5DY9 A;  1SET A;  3NEM A;  2PME A;  4P75 C;  3AHU A;  2ZZE A;  2CIM A;  5CAI A;  3JCM f;  5GAN h;  4RMF A;  3HTZ A;  2DXU A;  4HT8 A;  3QO8 A;  2DKG A;  3PCO A;  3IKL A;  2JN0 A;  4CS4 A;  1WYD A;  3P8T A;  1JBM A;  4JRK A;  4EMK B;  4TWA A;  1TH7 A;  4C92 G;  5E3I A;  3TEH B;  2HNI A;  4HA8 A;  4ZTU B;  1KOG A;  1ASZ A;  2RHS B;  3A31 A;  3QHS A;  4O2D A;  4MMK A;  4M77 A;  2EJG A;  4CH5 A;  4C8Q B;  1B34 B;  5KNN A;  4M7D A;  2FB7 A;  1ATI A;  1H4Q A;  2CJ9 A;  4H2X B;  3QNE A;  4OLF A;  3V8K A;  2Q7G A;  5ELN A;  1KMN A;  3CMQ A;  3HFN A;  1M8V A;  4H2S A;  3QSU A;  2G4C A;  4XU1 A;  2E65 A;  3JCM J;  2ZIO A;  5LJ5 e;  1HXD A;  2RHQ B;  3HFZ B;  5GMK h;  4YRS A;  4P74 A;  2ZNJ A;  1B34 A;  4QVC A;  4C92 F;  3RAC A;  1H64 1;  3VQY A;  4H2X A;  3HSB A;  1D3B B;  3NET A;  4XU3 A;  2RA2 A;  5GAN j;  5C53 B;  3RIR A;  2ART A;  5GAO r;  2ODR C;  3HXX A;  4P72 A;  4J15 A;  3HRK A;  4P71 A;  2YLB A;  4RCC A;  2J3L A;  4BW9 A;  1HTT A;  2CJA A;  1PYS A;  3P8V A;  4PJO E;  5GAO q;  3JCM e;  1JRI A;  2VXF A;  5GAM d;  3JCM c;  4H2U A;  2ZNI A;  3RKX A;  3EFS A;  2ZR3 A;  3JCM Q;  4XTX A;  4RQE A;  5GAM e;  4CH6 A;  1USY A;  4NCX A;  4PJO C;  4YRT A;  3RES A;  4M78 D;  4YP0 A;  1HK9 A;  1X01 A;  3V7S A;  2J3M A;  3VBB A;  1MGQ A;  2QHU A;  5GAM j;  1KMM A;  4YRJ A;  3JCM W;  4K86 A;  2DVE A;  2IY5 B;  4P3N A;  4P73 A;  3SWN A;  1U1S A;  4PHC A;  2E41 A;  4F7U F;  1YGB A;  3QTC A;  4P3O A;  4C8Q E;  4YRM A;  1KQ1 A;  1X2G A;  3REU A;  4P73 C;  4M78 A;  1EOV A;  5GAO p;  2AKW B;  4K87 A;  3RER A;  4EX5 A;  4P74 C;  2VC8 A;  4M7A G;  2QHS A;  2DXT A;  4C8Q C;  1B8A A;  4YYE A;  4M75 G;  4WJ3 M;  4XEM A;  2RB6 A;  3UGT A;  2CGH A;  1JJC A;  1NJ2 A;  4C92 A;  5LJ5 f;  4ZIB A;  3V7C A;  5GAN 3;  4YDQ A;  4M7D B;  2ZZF A;  1B7Y A;  1NJ5 A;  4UP8 A;  5LJ3 e;  2AMC A;  5GAM h;  3JCM b;  3E9I A;  1LYL A;  1ASY A;  4TQF A;  4LNS A;  5LJ5 j;  2DU5 A;  4C92 E;  2ZGW A;  4M7A D;  4OP0 A;  3FIF A;  1QF6 A;  4J5Y A;  4G85 A;  2XGT A;  4RCB A;  3JB9 D;  3RL6 A;  1SRY A;  4PG3 A;  5LJ3 g;  2QHT A;  4C8Q G;  3JCM P;  5GAM f;  3NEL A;  3HXW A;  2C7I A;  3TUP A;  1W66 A;  3A74 A;  3NEN A;  4YRR A;  4ZTZ B;  2QTX A;  3I7F A;  5GAO n;  5F5W A;  4YRO A;  3A32 A;  4NL2 A;  4HWP A;  4XTW A;  2P0L A;  3HFO A;  4KR3 A;  3M4P A;  4F7U A;  3A7R A;  2EL9 A;  1WQW A;  5GMK i;  4M75 D;  2XTI A;  4HVC A;  1X2H A;  4M78 F;  4P72 C;  4YPF A;  4CS2 A;  3BFM A;  5GAN 6;  1BBW A;  1M5Q 1;  4YCU A;  4XTY A;  3BW1 A;  1YFT A;  3W3S A; 
#chains in the Genus database with same CATH topology
 1KQS S;  1KFZ A;  2DDZ A;  4DBR A;  3JB9 G;  2X51 A;  3EGX A;  1EQR A;  1UEC A;  2KQW A;  1ZSZ A;  4J6X A;  1NJ1 A;  1WZO A;  5KYW A;  4J9E A;  1ABO A;  1CKB A;  4MDX A;  3UA7 A;  1Z7N A;  2CUB A;  4XK8 E;  1YJN Q;  1MNE A;  4F16 A;  3VRZ A;  3MEY A;  1K8A U;  2QEX A;  4XTV A;  2QQ9 A;  5KYU B;  2QQS A;  1A0N B;  3CXC P;  3L2Q A;  3PIO A;  2GTJ A;  2YSQ A;  1IL2 A;  2DFU A;  3EGD A;  2DAQ A;  3EHQ A;  1PKS A;  1PSF A;  3BJU A;  1WXU A;  1W2B P;  2E4H A;  2VUB A;  1OUL A;  4IUV A;  3CCM T;  4JLG A;  2KGT A;  1E6G A;  1U8R A;  2FZG B;  2ZT7 A;  2GCX A;  2LX9 A;  3J80 E;  3LWI A;  5GAN 8;  3ICA A;  4LNP A;  5GAN 5;  2EW3 A;  1K9M C;  1OI1 A;  5LJ5 g;  3ER0 A;  5GMK l;  4M75 A;  3QII A;  3HY1 A;  4M7D E;  5GAN 7;  3BE3 A;  1D0Z A;  2KEA A;  2B8A A;  2EYZ A;  5CKE A;  4M75 E;  3HRU A;  1B3Q A;  3H8Z A;  3M5A A;  5CKH A;  4AFU C;  2E12 A;  1X54 A;  3HTR A;  4JZ3 A;  1Y96 B;  1RI9 A;  1QCF A;  3LH0 A;  2OTJ Q;  2DD5 A;  2PUK B;  3CMA T;  4M7D F;  3QXE B;  1WPY A;  2LJ0 A;  3QYG B;  4JLI A;  3L4G B;  5IHK A;  4HWO A;  4C92 C;  3H0F A;  4A63 B;  5KYY A;  1WJS A;  2QK0 A;  4H2T A;  3M0T A;  1W2B S;  1Y96 A;  3CBO A;  2R58 A;  3OSS C;  2KVQ G;  3IG2 A;  3CBM A;  2LQN A;  2LQK A;  3G4S T;  1ADJ A;  1TWB A;  4C0G A;  2KXC A;  3G4S Q;  1GBR A;  2EAY A;  1WQ7 A;  4K88 A;  4KRT A;  4A53 A;  3H0I A;  4YRG A;  4F7U B;  2EWN A;  3AT1 B;  2RJD A;  2AKL A;  1LCK A;  1PSE A;  2CUD A;  1UUE A;  5A0G A;  1M9S A;  1NPR A;  2RI2 A;  3CME T;  1HSQ A;  3M55 A;  4M78 C;  1M4Z A;  4NOY A;  4DPG A;  3EH1 A;  4CS3 A;  1Q7Y R;  4TVY A;  1MMG A;  2LMJ A;  3IKM B;  3P8D A;  4M7A A;  1I5L A;  11AS A;  1NYR A;  1NJ6 A;  2GFA A;  2DBK A;  1YFS A;  4C8Q F;  1Q7Y C;  2KXD A;  4PJO B;  2R57 A;  4FW2 A;  2RM4 A;  2KRN A;  4OMN A;  3M0U A;  3TU4 K;  3A7U A;  5K1X A;  3OYJ A;  1D1A A;  3E19 A;  4C5H A;  3G1Z A;  1I5O B;  4CC3 A;  2D0Q B;  2D8H A;  2H3J A;  4WF2 A;  1IHW A;  4LVI A;  4J9I A;  2DZ9 A;  3V7R A;  5CCA A;  2DNU A;  4OMF B;  1T0H A;  4AH6 A;  2DE0 X;  1SSF A;  4A54 A;  3CPW P;  4QQD A;  3A5Y A;  2D1X A;  2QAS A;  1VQ4 T;  4CC4 B;  1VQM T;  1QP3 A;  1M30 A;  1E6H A;  3F70 A;  2K3Y A;  2JUF A;  1K4U S;  2F2X A;  4OGE A;  2CSQ A;  1W6X A;  2XHC A;  2LJ1 A;  1VQ5 Q;  1G5I A;  2HMA A;  1UDL A;  4B6M A;  2GGR A;  1OOT A;  1SRM A;  1BK2 A;  2CS7 A;  3PMT A;  2C0I A;  4H2W A;  2L3P A;  1G83 A;  4RTT A;  3GLX A;  5D6X A;  3VS6 A;  1QVG S;  3MP6 A;  6AT1 B;  1LJO A;  3MEA A;  3QG1 A;  1M90 U;  1WDX A;  2C06 A;  3LX7 A;  1X43 A;  3LC0 A;  2EJF A;  2V8J A;  5C6S A;  1VQK Q;  1I1J A;  4HCB A;  2LQW A;  2RQV A;  4CH4 A;  2KRO A;  5FU6 C;  2RMO A;  4OMM A;  4M78 B;  2DPP B;  1YCY A;  1V76 A;  3U23 A;  4QW2 A;  2ZZG A;  2DX1 A;  5IXF A;  2P0P A;  2QA4 T;  3PE0 A;  2EQM A;  3HXU A;  4N4I A;  3M0R A;  2DIL A;  2EFI A;  3E9F A;  3FEO A;  4E7J A;  5DY9 A;  1IGQ A;  3AHU A;  1VQN A;  2FL7 A;  1R0B G;  1MMD A;  5CAI A;  4HXJ A;  3JCM f;  3CC2 A;  2DXU A;  2M02 A;  4HT8 A;  3QO8 A;  2DKG A;  4GY5 A;  2EQK A;  3REA B;  3LGL A;  3VUB A;  1M3C A;  1JJ2 A;  3TEH B;  4HA8 A;  3H41 A;  4ZTU B;  1KOG A;  4MMK A;  3L2U A;  2V8K A;  2EJG A;  1OEB A;  1YIT T;  3MP1 A;  2QG9 B;  2ESW A;  2JTM A;  2FB7 A;  3KXT A;  4L59 A;  2CJ9 A;  3A8G B;  3CCV Q;  3QNE A;  1YIJ A;  3V8K A;  4PLL A;  2EQJ A;  5ELN A;  2MPX C;  1KMN A;  1VIF A;  2ZAE A;  1M1F A;  1YWO A;  5CKD A;  2BZ8 A;  4H2S A;  2WSE E;  2BZX A;  1FMK A;  2JNG A;  4A4E A;  3OYK A;  2KE9 A;  1HXD A;  4OF1 A;  1M90 C;  5KCO A;  5L8R E;  5GMK h;  4YRS A;  1GCP A;  4P74 A;  2AK5 A;  2RN8 A;  1M3B A;  4C92 F;  3RAC A;  1XJW B;  5EC7 A;  1K9M R;  1NLO C;  5J3B A;  3HSB A;  5KYW B;  1WHJ A;  1MND A;  2ART A;  2CSI A;  1X2Q A;  4WCI A;  3HRK A;  4BW9 A;  4C0D B;  2EGA A;  1JRI A;  2ZNI A;  3RKX A;  4DA4 A;  2ZR3 A;  3OA6 A;  1OV3 A;  1JXO A;  1NBE B;  1V29 B;  3OBW A;  1X6O A;  2VB6 A;  4CH6 A;  4LDU A;  1USY A;  1OU8 A;  2XDB A;  4PJO C;  1T0J A;  2XIC A;  1JU5 C;  4X1V A;  1X01 A;  1XTD A;  1ABQ A;  1TS9 A;  3JCM W;  2PUO B;  2DVE A;  3CME A;  4RG8 A;  1AWW A;  3OYB A;  4OB3 B;  3EAE A;  2JT4 A;  1V1C A;  2JTE A;  1VQP T;  2LRQ A;  4OMP A;  4YTL A;  1VQO T;  4M78 A;  1ZHI A;  4A4H A;  4RTZ A;  2NUT B;  2DXT A;  4C8Q C;  3J7A F;  3CCV T;  4YYE A;  4HVW A;  1KC8 R;  4WJ3 M;  4LN2 A;  3UGT A;  2K4Y A;  3TSZ A;  1M2V A;  3A8M B;  1TU0 B;  3V7C A;  3VKI A;  1ZA2 B;  4C0D C;  4FSS A;  4M7D B;  1B7Y A;  1D09 B;  3LH5 A;  1NJ5 A;  2ZZF A;  3T9N A;  4HVV A;  1BYM A;  3PNW C;  4RTY A;  4FT2 A;  3M56 A;  2PNI A;  5J26 A;  1X6B A;  1K0S A;  1F1B B;  2DU5 A;  4C92 E;  2CP2 A;  1Q82 U;  2K2V A;  1UGP B;  2MI6 A;  2DM1 A;  3JB9 D;  1YJ9 Q;  1SRY A;  4PG3 A;  2XU8 A;  1VYU A;  2QHT A;  2OTL A;  3HXW A;  3TUP A;  3M0P A;  5GAO n;  2LVM A;  1K73 C;  4YRO A;  2HSP A;  2HL5 C;  3CXC A;  3D7S B;  2HBW A;  1VQ8 A;  3M4P A;  5KYX B;  2EL9 A;  1VQ8 T;  2DMO A;  4B9X A;  3GNF B;  1X2H A;  1GFC A;  4EIK A;  4YPF A;  3RMS A;  2LCS A;  1S1N A;  3LLR A;  1M5Q 1;  1BI0 A;  2X3W D;  2J6O A;  2YUP A;  3BW1 A;  4RUG A;  3KFV A;  3W3S A;  4E2F B;  1GFD A;  4N4G A;  2ZIN A;  1IZ6 A;  2L89 A;  2KR3 A;  2LP5 A;  1N8R U;  2E70 A;  1H4T A;  4PLI A;  2DD4 A;  4DBH A;  2ZT5 A;  2YWW A;  4PFZ A;  1YIT Q;  2DET A;  5FU7 B;  4G84 A;  4FYY B;  5GAO l;  1QVP A;  4FSX A;  5LJ3 f;  4C92 D;  2ALY A;  5GAN d;  4JJB A;  2ZIM A;  2FYK A;  4M77 D;  4TQD A;  2PQW A;  3I56 Q;  5FWB A;  3INZ A;  1WJQ A;  3UT1 A;  2EPD A;  4DQ2 A;  3JCM X;  5CO7 A;  3MEV A;  1H3Z A;  2I4L A;  1I0C A;  3G4S A;  3PZC A;  2FEI A;  2YXY A;  8ATC B;  4XEO A;  3JAM E;  4JRI A;  2RQT A;  4DEX A;  5FU6 B;  5LJ3 j;  4KGZ B;  3DSQ A;  5KCH A;  1ADY A;  3JB9 F;  2KT1 A;  4QQ6 A;  4YRK A;  1AT1 B;  1EIY B;  2DIG A;  4P5N A;  1G3Y A;  1BIB A;  2KDS A;  3RDV A;  2ALY B;  4ESR A;  4X5O A;  4EMH A;  3V8J A;  4RQF A;  3CCM A;  3JB9 I;  3PVQ A;  4P71 C;  4PNO A;  4ELZ C;  4E51 A;  1CSK A;  2ZCE A;  4YCW A;  3VS7 A;  3KBG A;  2NUZ A;  3I56 T;  2LNV A;  2ENM A;  3KFU A;  3OS0 A;  2CZ7 B;  2CDT A;  2ROT A;  4J83 A;  4P3P A;  1WX6 A;  3HPW A;  3GP8 A;  1YI2 T;  3EHR A;  5GAN f;  3CPF A;  3QO5 A;  4M7A C;  2D9T A;  2NUP A;  1N9S A;  2RJC A;  4HCZ A;  3QWY A;  1AZE A;  2HD0 A;  4L87 A;  4JRQ A;  3CCU T;  3EFO B;  1PRM C;  1X2K A;  2MYS A;  2Q7E A;  2DLP A;  1AWO A;  2GQV A;  1RAD B;  3CC2 T;  2CH4 A;  1NG2 A;  3RKY A;  2BTT A;  4XU0 A;  4M7D D;  2J6K A;  5LJ5 d;  3EGX B;  5FRM A;  4PJO G;  4C8Q A;  3CCJ Q;  1BCO A;  1WU7 A;  1Y57 A;  3S6W A;  1R8O B;  2M1H A;  2I4M A;  2GBQ A;  3G1J A;  1L0W A;  1VUB A;  2JM9 A;  4HCK A;  3JB9 J;  3GF5 A;  3SWN C;  3G6E A;  4WJ4 A;  2P4R A;  2QHV A;  5KYU A;  4X9C A;  3OD1 A;  2ED1 A;  3CCL A;  2BUD A;  2QEX Q;  1IRE B;  3JCM d;  2YUQ A;  2DTI A;  3FB9 A;  1U5S A;  5LJ3 h;  2E3I A;  4P75 A;  3CEY A;  2X4J A;  1WNL A;  4PK4 A;  2RHX A;  1TG0 A;  2DYB A;  4JDS A;  1X55 A;  5FU7 C;  2F5T X;  1UJ0 A;  4D8K A;  1BB9 A;  2EVR A;  4BI8 B;  1Q95 G;  3M4G A;  3OYF A;  1QKW A;  1ZUY A;  2DJZ A;  5ELO A;  5LL6 S;  2EKH A;  3M4Q A;  2X35 A;  4Q5W A;  4EMG A;  1H4S A;  3R07 A;  1GRI A;  4J9D A;  3JB9 H;  1MHN A;  3TEH A;  4KR2 A;  4D6W A;  1VQL A;  3QO7 A;  4MZP A;  4DOV A;  1KQS P;  2L3S A;  3RUX A;  2AKK A;  2DVJ A;  2Y4Y A;  2IPO B;  3OQ5 A;  2K57 A;  1GXI E;  3FRN A;  1SER A;  4J8O A;  3URG A;  4L5G A;  2R5M A;  4C8Q D;  2E10 A;  3JV3 A;  1Y07 A;  2FPF A;  1K73 U;  1KIK A;  2QQR A;  2LX7 A;  2A7Y A;  4UPA A;  1YN8 A;  5DM7 R;  3Q1J A;  4Y92 A;  1K0X A;  2Q5H A;  3TEE A;  2QDY B;  2FPD A;  2YRD A;  3GNG A;  4GLK A;  4BY6 B;  1IO6 A;  1YCS B;  2JOY A;  4Q6G A;  4BD3 A;  4VUB A;  3OB9 A;  2XI9 A;  4H2V A;  4M77 G;  2E6Z A;  4M75 F;  3A5Z A;  3SB2 A;  3CCQ Q;  3NFC A;  5C51 B;  3A8L B;  4M7A E;  4RTV A;  4Q15 A;  1RIQ A;  3E9H A;  2HKQ B;  3JCM V;  1UFF A;  1YIT A;  3WVD B;  3HY0 A;  1E22 A;  4QVD A;  4YRP A;  3LYI A;  2DZC A;  4CH3 A;  3LSQ A;  1C6V X;  3L42 A;  1I07 A;  1E7O A;  2P0Q A;  5DLQ E;  2DL8 A;  4FW1 A;  3RBB B;  2CP5 A;  3HXY A;  1SF9 A;  1HD3 A;  1HC7 A;  2MK5 A;  4J9C A;  2E3C A;  2XKO C;  1MMN A;  2LT1 A;  4PFP A;  4LVL A;  2Q5I A;  1PD0 A;  3I9Q A;  2ARS A;  3CC4 A;  3VQV A;  4F17 A;  1EVK A;  5C52 B;  1X69 A;  1J5W A;  4QQG A;  1M1G A;  1UHC A;  2QI2 A;  3LSS A;  4TVW A;  1WXT A;  1RUW A;  2LCC A;  3SFM A;  2OTL Q;  2M16 A;  4P75 C;  1OZ3 A;  2ZZE A;  1QQJ A;  1YJ9 A;  4E7Z A;  3ZBD A;  1DJ7 B;  1WYX A;  3VS4 A;  2L3R A;  2C0O A;  1VQ5 T;  3PCO A;  2JN0 A;  4CS4 A;  2A0F B;  2O88 A;  3P8B B;  3TVT A;  1KD1 C;  4LDV A;  3UDC A;  1UHF A;  1AZG B;  3NTK A;  3P8T A;  2SEM A;  2HNI A;  1PKT A;  1ASZ A;  1NE8 A;  3C0C A;  2RHS B;  3QHS A;  1S72 T;  3N5B B;  3OS1 A;  4IUR A;  1T3L A;  1YJW T;  4UC4 A;  1B34 B;  4CH5 A;  4J9H A;  1H4Q A;  1N8R R;  1VQL T;  3WVE B;  4H2X B;  4OLF A;  4OMQ A;  4J7F A;  2HCK A;  2EGC A;  2MWO A;  2AT1 B;  2DF6 A;  2X3X D;  2DL4 A;  1WFW A;  1TOV A;  3EG0 A;  3S3N A;  5GJW B;  1M8V A;  2F5K A;  1M90 R;  1WHL A;  3QSU A;  1SSH A;  4KUI A;  1RLQ C;  4XU1 A;  2O4X A;  3JCM J;  2FZK B;  1K76 A;  1X6G A;  3CD6 Q;  1NLP C;  3A8H B;  2ZIO A;  1Y71 A;  2P0K A;  2QA4 A;  2MWP A;  3CCE T;  2VKN A;  3NMZ C;  2ZNJ A;  1B34 A;  1ZUK A;  2DRM A;  4QVC A;  1H64 1;  3VQY A;  4QT7 A;  5ECA A;  2JVV A;  1FWZ A;  2XD0 A;  1AVZ C;  2KMT A;  1SKU B;  3NET A;  2QGG A;  2RA2 A;  4LD6 A;  2YUN A;  3RIR A;  5GAO r;  2ODR C;  1VQM A;  4P71 A;  2YLB A;  1OPL A;  1QCO A;  1HTT A;  2LDM A;  1NM7 A;  4ZNX A;  3X24 B;  2VXF A;  1YJ9 T;  5GAM d;  4H2U A;  3EFS A;  2CP3 A;  2FPE A;  4PKC C;  2ZPH B;  1K9M U;  2FG0 A;  1VQ9 T;  3EG3 A;  1ZUU A;  1VQ9 A;  3CCQ T;  1CKA A;  4JS5 A;  2COW A;  2QQA A;  4OGC A;  1M8M A;  2K6D A;  2K9G A;  1MUZ A;  2J3M A;  5GAM j;  4LE9 A;  5HY6 A;  4K86 A;  1D0Y A;  3MEW A;  3EG1 A;  4P73 A;  1U1S A;  3P8H A;  1RAF B;  4IUT A;  3X25 B;  4F7U F;  4C8Q E;  2XG8 D;  1KQ1 A;  1NYF A;  1X2G A;  4P73 C;  2QYZ A;  2JJ9 A;  4PFO A;  2AZS A;  1ZBJ A;  2RNA A;  2RJE A;  1EOV A;  5GAO p;  3CBP A;  4K87 A;  4ANJ A;  3BDL A;  5L23 A;  2CZ6 B;  2F69 A;  2ZPB B;  1VQO Q;  1B8A A;  2IVW A;  4M75 G;  5KE2 A;  4RTW A;  1M3A A;  2P84 A;  1QVG P;  2CGH A;  2B86 A;  2K2M A;  1NJ2 A;  4WTO B;  3R6N A;  5GAN 3;  4YDQ A;  2V1R A;  2O9V A;  4MDW A;  3MCA B;  1JJ2 P;  1ZQ1 A;  5LJ3 e;  2AMC A;  3QZ5 B;  5GAM h;  1R0C B;  2QAZ A;  4OVA A;  2DYI A;  2W10 A;  1WHM A;  4E7L A;  3JCM b;  3E9I A;  1D1C A;  1SHG A;  3CCU Q;  1LYL A;  3VV0 A;  4TQF A;  1UJY A;  4LNS A;  2XMF A;  4M7A D;  3OBY A;  1M2V B;  5CK9 A;  2XGT A;  2A37 A;  2GQI A;  2LQ8 A;  3FC3 A;  1VQN Q;  2JZ2 A;  2BIV A;  2RH2 A;  3JCM P;  2HL3 A;  5GAM f;  1ZLM A;  3NEL A;  3A74 A;  2RQW A;  1IXD A;  2RO0 A;  2VV5 A;  3E9G A;  4KGX B;  3CC7 Q;  4HWP A;  3QBY A;  1JXM A;  3HFO A;  4KR3 A;  2L2P A;  5FLX E;  3CCR Q;  4KH1 B;  2CKK A;  1IRX A;  1Q7Y U;  1IHV A;  4BAC A;  1QVG A;  4M78 F;  1EZZ B;  4JPB W;  4P72 C;  3BFM A;  1BBW A;  2JXB A;  1WHK A;  4YCU A;  1ZBX A;  4K11 A;  3CMA A;  2EQI A;  2DL7 A;  2IG0 A;  4AG2 C;  5GAN e;  2FO0 A;  4XAX B;  4UP9 A;  1HYO A;  2PVG B;  1AOJ A;  2YHT A;  2F2W A;  5FRO A;  4AT1 B;  3FLG A;  3HFV A;  3CCR A;  5IHN A;  1ARK A;  4M77 C;  4LDX A;  2MCN A;  3FJP A;  3MF1 A;  2IY5 A;  2J6F A;  3CC7 A;  4HT9 A;  2XK0 A;  1VQ5 A;  1NYQ A;  5LJ3 d;  3NPF A;  4UP7 A;  4JJD A;  3L2V A;  1AEY A;  2KSS A;  1XOV A;  1RAH B;  4YRE A;  1NPP A;  1K9A A;  1M2O A;  4Z02 A;  4XTZ A;  4AG1 C;  2NUT A;  3VS0 A;  1TUG B;  1PWT A;  4FYX B;  1QVF P;  2G6F X;  2OAW A;  5IHI A;  3L2W A;  2CP0 A;  3HRI A;  2C0T A;  4TVA B;  4AFQ C;  2CH4 W;  4YRF A;  1YFR A;  3CCS T;  2DIQ A;  4WI1 A;  2NUP B;  5LJ5 h;  1B7Y B;  5GAN g;  2V8I A;  2PMF A;  3PGG A;  2O2O A;  5GJV B;  5M9O A;  3OY9 A;  2RD1 A;  2I4N A;  2HAX A;  1B76 A;  4JUV A;  3EG9 A;  3UGQ A;  1NYG A;  3ZEH A;  4LVJ A;  1BI3 A;  1KJW A;  1N9R A;  4FL6 A;  3ERR A;  3M54 A;  3OYE A;  5CKB A;  3IQL A;  1B7T A;  1C0M A;  2M0Y A;  1Q86 U;  1VQ6 A;  3CD6 T;  4C92 B;  2D8J A;  2J05 A;  5I2S A;  3OW2 A;  2XDP A;  4KBM B;  3SD4 A;  2K3B A;  1YB3 A;  3L2Z A;  3M0S A;  2YUO A;  1KK7 A;  2I4O A;  4BY6 C;  1OX8 A;  2E1H A;  4JRP A;  1EFW A;  2E5Q A;  2ZT8 A;  1N9W A;  1RLP C;  3UH0 A;  4X34 A;  2RHU A;  2LC4 A;  1JJ2 S;  2O9S A;  3PCO B;  3OYY A;  4F7U E;  4F7U G;  3ME9 A;  1FX7 A;  3JRZ A;  3L1A A;  1PHT A;  5K1P A;  2V26 A;  5CQX A;  4YRN A;  2W0Z A;  2KI7 A;  4M7D C;  2KYB A;  2AIR B;  2HKN A;  1T3S A;  3M53 A;  1PRL C;  3FJ5 A;  2FHD A;  4J9B A;  1YHQ T;  5GMK e;  1NZ9 A;  1PD1 A;  1UGS B;  1Q82 C;  1GGM A;  5KYX A;  4ZGE B;  1ACM B;  4E7I A;  3NTI A;  4HWR A;  1U06 A;  4IKF A;  2PZ1 A;  1OYX A;  2DQ0 A;  2LZ6 B;  1Q81 C;  2CRE A;  1B70 B;  5I11 A;  4C5E A;  12AS A;  4HWT A;  3JCM g;  3OS2 A;  1GL5 A;  1YI2 A;  1LNX A;  2AZV A;  1AWX A;  4HCC A;  4M7D G;  4M78 E;  2ZCF B;  1TSF A;  1NEG A;  5A0L A;  3OMG A;  2R5A A;  1EIY A;  5I2M A;  5GAM g;  3ULR B;  1K1Z A;  1G51 A;  5EG2 A;  2QEX T;  4H02 A;  1GBQ A;  1XQH A;  3LW5 E;  2RQR A;  4OB1 B;  4F04 B;  2Q7H A;  2L0A A;  2ZZD A;  5C0M A;  4LVK A;  4M7A B;  4N0A C;  3CC4 T;  5I21 A;  1QP2 A;  1E24 A;  3QWX X;  2P5I A;  2DXC A;  9ATC B;  2DK3 A;  1YJW Q;  1KQS A;  1G5H A;  1UB4 A;  1Z7M A;  3M57 A;  4PL6 A;  4PJN A;  4YRC A;  2K7A A;  2X4X A;  4AFZ C;  1P92 A;  4IIM A;  1SHF A;  2CT4 A;  1ZX6 A;  1USY C;  4ELY C;  4E47 A;  5HKC A;  5A2Q E;  5GAN 4;  1ZSZ C;  2RF0 A;  5IT9 E;  1SES A;  2KRS A;  2E5A A;  1VQL Q;  1TTH B;  3PMI A;  3WXM B;  1WI7 A;  3I55 Q;  1KQ2 A;  5D6W A;  1BIA A;  5GMK j;  2QTV A;  1VYV A;  4TVA A;  2O31 A;  2OTJ T;  1S72 A;  3IAL A;  2M51 A;  1S72 Q;  2ZTG A;  3PIP A;  4FU6 A;  1VOM A;  4M4Z A;  4R56 A;  1NJ8 A;  3M58 A;  3HXV A;  2G3R A;  4DBF A;  4EPC A;  3A8O B;  3I55 A;  4OML A;  2DER A;  3VU3 C;  3HXZ A;  1JEG A;  2VGM A;  2L5Q A;  2DTH A;  2HSE B;  1YHQ A;  3RF1 A;  1BBU A;  4EO4 A;  4IUP A;  4M77 F;  2CJB A;  5CQY A;  4BDY A;  4FYV B;  3CCQ A;  3CCE A;  1JJC B;  1OZ2 A;  2E5K A;  2LJ3 A;  2I2L A;  1RAB B;  4BE2 A;  2RK1 A;  1H92 A;  2OTL T;  1Y0M A;  3DB4 A;  1J3T A;  2YRV A;  3RNJ A;  3VS1 A;  2WAC A;  5GAN h;  4RMF A;  1X75 C;  3HTZ A;  2NWM A;  1MV3 A;  1M1K R;  1WYD A;  1JBM A;  3E2U A;  3DLM A;  4OMO A;  4C92 G;  4EMK B;  4TWA A;  5E3I A;  1VQM Q;  3A31 A;  1VQK T;  4IUU A;  2X9H A;  1PM3 A;  5KNN A;  3MQZ A;  1G3S A;  2K79 A;  3MP8 A;  1AD5 A;  1QWE A;  4F14 A;  2KK4 A;  2Q7G A;  4FCY A;  1C1A A;  2A8E A;  2RI3 A;  2KRM A;  1WHH A;  4ZTF A;  2G4C A;  1YI2 Q;  2Y4X A;  2E65 A;  4B9W A;  2RQU A;  5DLO A;  2L3Q A;  2FRY A;  5IH2 A;  3DB3 A;  3HFZ B;  4TVR A;  5IXB A;  2E3H A;  2KYM A;  1PCX A;  2OJ2 A;  4BE0 A;  2NLU A;  3G6E Q;  1D3B B;  3OSV A;  4IUQ A;  2A28 A;  1IGU A;  2RHZ A;  1G3T A;  4Z89 A;  3PVL A;  3I5R A;  3HXX A;  1VQ7 A;  2DA9 A;  2PTK A;  4RCC A;  5FW9 A;  3PFS A;  1PYS A;  4Z8A A;  4PJO E;  5GAO q;  1VQN T;  3OYH A;  1KC8 U;  1SPK A;  3VS5 A;  1VQ7 Q;  3NHN A;  2EYY A;  1VIE A;  5GAM e;  3MHX A;  3I56 A;  2BZY A;  4NCX A;  1RAG B;  1N6A A;  3RES A;  4JJN K;  1HK9 A;  2BE9 B;  1ZA1 B;  2BKD N;  3VBB A;  3CCE Q;  1KMM A;  4YRJ A;  2IY5 B;  2H8H A;  4P3N A;  1K8A R;  2LT4 A;  2OAU A;  2NS6 A;  4PHC A;  2E41 A;  4PJJ A;  3QTC A;  1QWF A;  2RK2 A;  2Z0W A;  4YRM A;  3MKD A;  4ZGJ B;  5CVI A;  3HP9 A;  2AKW B;  3GOX A;  1K73 R;  1G3W A;  2QHS A;  2GFU A;  4AFS C;  1YNZ A;  2FZC B;  1IB8 A;  3OYC A;  1YIJ T;  4A4K A;  4XEM A;  3VYG A;  2VWF A;  2ATC B;  2ZPF B;  2A36 A;  2HQH A;  3H0H A;  3MET A;  4O5V A;  1JJC A;  1VQP Q;  5LJ5 f;  4ZIB A;  4QKU A;  4FT4 A;  1YP5 A;  1KHI A;  4CI0 C;  1VQ8 Q;  4UP8 A;  2HQX A;  4LDW A;  3TQ7 P;  3VYH B;  1UGV A;  1EFN A;  3CC7 T;  1H3H A;  1RAC B;  1KSW A;  4EDU A;  1TUD A;  1YWP A;  2O4X B;  2ZGW A;  3SDZ A;  1QF6 A;  4J5Y A;  2FVU A;  1XNI A;  3REB B;  1NJI R;  4RCB A;  3RL6 A;  4HVU A;  3VS2 A;  5LJ3 g;  1Q82 R;  2CT3 A;  1YJW A;  3OYD A;  4BE1 A;  4YRR A;  3M4Y A;  4ZTZ B;  1NJI C;  3I7F A;  5F5W A;  1ZSG A;  4NL2 A;  2K5L A;  2MIO A;  1YHQ Q;  2F2V A;  2JMA A;  2JM8 A;  3SHW A;  2P0L A;  2HZY A;  5KYY B;  4E7S A;  4OB0 B;  4F7U A;  1FXX A;  4CC2 A;  5GMK i;  3EFO A;  5IN1 A;  2V1Q A;  2XTI A;  3UAT A;  4HVC A;  4AMC A;  1NEB A;  4CS2 A;  3THK A;  1D0X A;  3C94 A;  3X20 B;  2ROL A;  2KAF A;  4XTY A;  3OYL A;  2COY A;  1FYN A;  5J39 A;  3HRT A;  3QDR B;  4DBQ A;  3P8Y A;  2YRC A;  4FYW B;  4QVZ A;  1H4V B;  2WSC E;  3X28 B;  3QKJ A;  2EYW A;  3VQW A;  2O01 E;  2RHY A;  4PJO A;  3UPU A;  3UFG A;  4J9G A;  2QDL A;  2SRC A;  2NYS A;  1RAI B;  2ARU A;  2MF2 A;  2CP6 A;  1RL2 A;  3CCL Q;  4M77 E;  3HL8 A;  3M9Q A;  2EYQ A;  3H6Z A;  3CPW A;  3QZ9 B;  4YRI A;  3PTA A;  2KNB B;  2AKW A;  1VQ4 A;  3KUF A;  2OX7 A;  4YRL A;  2RHQ A;  2DXB A;  1PG5 B;  1WXB A;  5D7U A;  2ZPG B;  2GNC A;  1NNH A;  4ZTJ A;  1JB0 E;  4J6Y A;  4PJO F;  1D3B A;  3EFR A;  1WGS A;  3I35 A;  3CXC S;  4A4G A;  1EX4 A;  3CCS Q;  1KG1 A;  4GLM A;  2C8M A;  2ZPI B;  4KQE A;  1QKX A;  2VAS A;  3L4G A;  4LXC A;  1U1T A;  4KUL A;  3RKW A;  2YDL A;  4LVM A;  4L6V 5;  5I22 A;  1OU9 A;  3A7A A;  4RDX A;  1WIE A;  3VS3 A;  4MML A;  3VRY A;  4V2S A;  3J81 E;  4HWS A;  3X26 B;  3EGU A;  3UA6 A;  2E64 A;  1QMC A;  4A4F A;  1VQ6 Q;  3JCM h;  3FDR A;  1E1T A;  3REX A;  1RAA B;  2DQ3 A;  2VGN A;  2EIF A;  3S3O A;  2ZT6 A;  3SWN B;  2WSF E;  4BB7 A;  1YIJ Q;  4YCV A;  4XQ3 A;  3CME Q;  4LUE A;  4MZM A;  3CCM Q;  1UG1 A;  1KC8 C;  3RMQ A;  4EMK A;  2YLC A;  3S3M A;  3G71 A;  2CP7 A;  1N27 A;  2RHS A;  4ZGD B;  2ECZ A;  5GAO m;  4J6W A;  4BWA A;  1KD1 U;  4R55 A;  4M7A F;  2J7I A;  4M77 B;  1Z9Q A;  1E1O A;  3RR6 A;  3MEU A;  3LWH A;  1MV0 B;  4RKU E;  3RGL A;  2ZXF A;  4NS5 A;  4RG2 A;  2DEQ A;  1M1K C;  1Y7X A;  3OMC A;  5HK3 A;  4J7I A;  3CC2 Q;  2PU9 B;  2AMC B;  1I4K 1;  2QQB A;  1I81 A;  1QE0 A;  3TEG A;  1WLE A;  1KHC A;  3PT9 A;  1TUC A;  3ZL7 C;  3O8V A;  4DEY A;  3DLL A;  4XTU A;  1JO8 A;  2MMP A;  3QUI A;  4YRQ A;  3HHT B;  1I8F A;  2EBP A;  3MJX A;  2QA4 Q;  3HFZ A;  4LDY A;  4ME7 A;  2ZR2 A;  4NL3 A;  1VQ6 T;  3CD6 A;  4H2Y A;  4ZN1 A;  4OB2 B;  1QLY A;  2PVO B;  2ED0 A;  4M78 G;  4TTV A;  3NGP A;  1LOJ A;  2DL3 A;  1YFN A;  3EH2 A;  1BCM A;  3CCV A;  2RI5 A;  4XU2 A;  2EYX A;  1EVL A;  1RAE B;  4N0A A;  3SEM A;  1UTI A;  4M75 B;  1H8K A;  3QDF A;  3MF2 A;  4KGV B;  1N8R C;  3A5Z B;  2DTO A;  4PJL A;  5GAN 2;  4IIO A;  1Z9Z A;  3OYM A;  5KE3 A;  1X27 A;  5AT1 B;  2BE7 D;  2ZPE B;  4FM4 B;  2XDD A;  5GMK m;  1OX9 A;  3MO8 A;  2L8D A;  3WQZ A;  3G71 T;  4FIB A;  4BUG A;  4LD9 K;  2X4Y A;  1BBZ A;  3BY7 A;  4LUD A;  1VQ4 Q;  1UGR B;  2EGE A;  3CCJ T;  1VYT A;  1W2B A;  3GIB A;  2J06 A;  3JSC A;  1X56 A;  1K8A C;  5HGQ A;  3M0Q A;  3MPU B;  1YJN T;  1OPK A;  5HCK A;  5AYF A;  1G8X A;  2M0O A;  1M1K U;  3CC4 Q;  2JS2 A;  4EMK C;  3V8L A;  1GCQ C;  3CPW S;  2PVD B;  2HDA A;  4PJO D;  1SEM A;  4HKE A;  1SRL A;  2MOX A;  3QO3 A;  3C12 A;  2QGF B;  3G7Z A;  2Y90 A;  1U3O A;  4BI4 A;  1UE9 A;  3C4S A;  2I0N A;  4M75 C;  3OYA A;  3CMA Q;  3H9N A;  3UWN A;  1PYS B;  5CIU A;  1BI1 A;  4D8D A;  1O75 A;  1Q81 U;  3M59 A;  1MMA A;  1PNJ A;  4Y91 A;  3OW2 S;  3BDU A;  1W1F A;  2DU7 A;  2E6N A;  2ODR D;  3CCR T;  4II1 A;  2EJ9 A;  2GF7 A;  1W70 A;  1C0A A;  1QVF A;  1M27 C;  2LNH B;  1VQZ A;  2VXE A;  1B70 A;  5A0D A;  2KT8 A;  3VQX A;  3R6O A;  1Q81 R;  4JZ4 A;  4X9D A;  4ORZ A;  1NJI U;  1FYF A;  1SET A;  3NEM A;  3L2R A;  2PME A;  4E7H A;  2CIM A;  1KD1 R;  3DKM A;  4C5G A;  4Y28 E;  1EIF A;  2DBM A;  3IKL A;  4C0F A;  3CCU A;  2JS0 A;  2KBT A;  3GBQ A;  4JRK A;  1TH7 A;  1LPL A;  3O5Z A;  2VVK A;  3QJY A;  4CRI A;  4O2D A;  1R77 A;  3OYI A;  3I5S A;  3ZFJ A;  4M77 A;  3G71 Q;  2JW4 A;  4KT0 E;  3LGF A;  4C8Q B;  1YBY A;  4KUD K;  4M7D A;  1ATI A;  5CKF A;  2DL5 A;  2DRK A;  3HKS A;  4PJM A;  2DEU A;  4C5I A;  2YT6 A;  5FWC A;  3OW2 P;  1TXQ A;  3GPL A;  2RHI A;  2K3X A;  1VQO A;  3CMQ A;  2DO3 A;  2MAM A;  3HFN A;  3ASK A;  2JMC A;  1UEB A;  1B07 A;  2CZ1 B;  4E6R A;  2XID A;  5LJ5 e;  1BU1 A;  2RHQ B;  1N5Z A;  2EKO A;  3UF4 A;  2K5F A;  4DOW A;  1W4S A;  2HQE A;  2IIM A;  2HEQ A;  3C95 A;  2JTF A;  2VYT A;  4RTU A;  4H2X A;  4CC7 A;  7AT1 B;  4XU3 A;  2ABL A;  4RTX A;  1VQ9 Q;  5GAN j;  5C53 B;  2X4W A;  3E1S A;  2COZ A;  3CCS A;  4P72 A;  3QYH B;  5HK0 A;  4J15 A;  2RJF A;  2J3L A;  2CJA A;  2FRW A;  3P8V A;  4R0K A;  3CCJ A;  3JCM e;  3I55 T;  3JCM c;  5FRN A;  2K5I A;  1FMW A;  4J9F A;  2EQU A;  4MZT A;  3JCM Q;  2QXF A;  4XTX A;  4RQE A;  1WLP B;  3EGD B;  2HBP A;  1WHG A;  1ZSZ B;  4E7K A;  1Q86 C;  4HT4 A;  3EG2 A;  4YRT A;  2KY9 A;  1JQQ A;  4M78 D;  4YP0 A;  4O6J A;  3V7S A;  4BDZ A;  1MGQ A;  2P4T A;  2QHU A;  3QPH A;  3CCL T;  3NTH A;  2RPN A;  2LCL A;  1QW1 A;  3SWN A;  2A3L A;  3A1P A;  1YGB A;  4P3O A;  1FMV A;  2OI3 A;  3REU A;  4JS4 A;  1WA7 A;  5IAY A;  2OTJ A;  3RER A;  4EX5 A;  4P74 C;  2VC8 A;  5KH6 A;  4M7A G;  1LVK A;  2GTO A;  1AHJ B;  1VQK A;  4KH0 B;  1OQK A;  2RB6 A;  1QVF S;  3HRS A;  2D6F A;  2CZ0 B;  3OYG A;  4ZN3 A;  2CYZ B;  1PC0 A;  4C92 A;  2LTO A;  4Z88 A;  1WJR A;  2M9U A;  1BI2 A;  1AWJ A;  3OYN A;  2DJQ A;  2F1L A;  5KYN A;  1Q86 R;  3EG9 B;  2AHJ B;  1G2B A;  3TSW A;  1VQ7 T;  1HJD A;  1O9S A;  1QCN A;  4ATO A;  3VUZ A;  3A98 A;  1ASY A;  5LJ5 j;  4JJC A;  4OP0 A;  3FIF A;  4G85 A;  1BKB A;  1SG5 A;  1D1B A;  4C0Z A;  1G5V A;  2H3E B;  4C8Q G;  4BI3 A;  8AT1 B;  2C7I A;  2A08 A;  1W66 A;  3NEN A;  2QTX A;  3TRE A;  3G6E T;  5D6Y A;  1VA7 A;  3A32 A;  3TCJ A;  1YJN A;  4RMO A;  4XTW A;  2D0N A;  1UGQ B;  3A7R A;  1RI0 A;  3OS5 A;  1WQW A;  5CR2 A;  4M75 D;  3CQT A;  1VQP A;  5GAN 6;  4GBQ A;  1GCQ A;  3VJP A;  3QJ6 A;  1YFT A;  4N4H A; 
#chains in the Genus database with same CATH homology
 1KQS S;  2DDZ A;  3JB9 G;  1EQR A;  2KQW A;  4J6X A;  1NJ1 A;  4MDX A;  1Z7N A;  4XK8 E;  3MEY A;  1K8A U;  2QEX A;  4XTV A;  2QQ9 A;  2QQS A;  3L2Q A;  3PIO A;  1IL2 A;  2DAQ A;  1PSF A;  3BJU A;  2VUB A;  4IUV A;  3CCM T;  4JLG A;  1U8R A;  2ZT7 A;  2GCX A;  2LX9 A;  3J80 E;  3LWI A;  5GAN 8;  3ICA A;  5GAN 5;  1K9M C;  1OI1 A;  5LJ5 g;  3ER0 A;  5GMK l;  4M75 A;  3QII A;  3HY1 A;  4M7D E;  5GAN 7;  2B8A A;  5CKE A;  4M75 E;  3HRU A;  3H8Z A;  3M5A A;  5CKH A;  2E12 A;  1X54 A;  1Y96 B;  3LH0 A;  2DD5 A;  2PUK B;  3CMA T;  4M7D F;  3QXE B;  1WPY A;  3QYG B;  4JLI A;  3L4G B;  4HWO A;  4C92 C;  1WJS A;  4H2T A;  1W2B S;  1Y96 A;  3CBO A;  2R58 A;  3OSS C;  2KVQ G;  3IG2 A;  3CBM A;  2LQK A;  3G4S T;  1ADJ A;  4C0G A;  2EAY A;  1WQ7 A;  4K88 A;  4A53 A;  4YRG A;  4F7U B;  2EWN A;  2RJD A;  1PSE A;  5A0G A;  1M9S A;  1NPR A;  2RI2 A;  3CME T;  3M55 A;  4M78 C;  1M4Z A;  4NOY A;  4DPG A;  4CS3 A;  4TVY A;  3IKM B;  3P8D A;  4M7A A;  1I5L A;  11AS A;  1NYR A;  1NJ6 A;  2GFA A;  1YFS A;  4C8Q F;  1Q7Y C;  4PJO B;  2R57 A;  2RM4 A;  3TU4 K;  3A7U A;  5K1X A;  3OYJ A;  3E19 A;  4C5H A;  3G1Z A;  2D0Q B;  2H3J A;  4WF2 A;  4LVI A;  2DZ9 A;  3V7R A;  5CCA A;  4OMF B;  4AH6 A;  1SSF A;  4A54 A;  4QQD A;  3A5Y A;  1VQ4 T;  1VQM T;  1QP3 A;  3F70 A;  2K3Y A;  2JUF A;  4OGE A;  2XHC A;  1G5I A;  3PMT A;  2CS7 A;  4H2W A;  3GLX A;  5D6X A;  1QVG S;  3MP6 A;  1LJO A;  3MEA A;  3QG1 A;  1M90 U;  2C06 A;  3LX7 A;  3LC0 A;  2EJF A;  2V8J A;  5C6S A;  4HCB A;  4CH4 A;  5FU6 C;  4M78 B;  2DPP B;  1YCY A;  4QW2 A;  2ZZG A;  2P0P A;  2QA4 T;  2EQM A;  3HXU A;  4N4I A;  2EFI A;  3E9F A;  3FEO A;  4E7J A;  5DY9 A;  3AHU A;  1VQN A;  2FL7 A;  5CAI A;  3JCM f;  3CC2 A;  2DXU A;  4HT8 A;  3QO8 A;  2DKG A;  4GY5 A;  2EQK A;  3LGL A;  3VUB A;  1JJ2 A;  3TEH B;  4HA8 A;  4ZTU B;  1KOG A;  4MMK A;  3L2U A;  2V8K A;  2EJG A;  1YIT T;  3MP1 A;  2JTM A;  2FB7 A;  3KXT A;  4L59 A;  2CJ9 A;  3A8G B;  3QNE A;  1YIJ A;  3V8K A;  4PLL A;  2EQJ A;  5ELN A;  1KMN A;  1VIF A;  1M1F A;  5CKD A;  4H2S A;  2WSE E;  2JNG A;  4A4E A;  3OYK A;  1HXD A;  1M90 C;  4OF1 A;  5KCO A;  5L8R E;  5GMK h;  4YRS A;  4P74 A;  4C92 F;  3RAC A;  5J3B A;  3HSB A;  2ART A;  3HRK A;  4BW9 A;  4C0D B;  1JRI A;  2ZNI A;  3RKX A;  4DA4 A;  2ZR3 A;  3OA6 A;  1V29 B;  3OBW A;  1X6O A;  4CH6 A;  4LDU A;  1USY A;  2XDB A;  4PJO C;  2XIC A;  1X01 A;  1XTD A;  3JCM W;  2PUO B;  2DVE A;  3CME A;  4RG8 A;  3OYB A;  4OB3 B;  3EAE A;  1VQP T;  2LRQ A;  4YTL A;  1VQO T;  4M78 A;  1ZHI A;  4A4H A;  2DXT A;  4C8Q C;  3J7A F;  3CCV T;  4YYE A;  4WJ3 M;  3UGT A;  2K4Y A;  3A8M B;  3V7C A;  3VKI A;  4C0D C;  2ZZF A;  4M7D B;  1B7Y A;  1NJ5 A;  3T9N A;  1BYM A;  3PNW C;  4FT2 A;  3M56 A;  5J26 A;  2DU5 A;  4C92 E;  1Q82 U;  2K2V A;  1UGP B;  2MI6 A;  3JB9 D;  1SRY A;  4PG3 A;  2XU8 A;  2QHT A;  2OTL A;  3HXW A;  3TUP A;  5GAO n;  2LVM A;  1K73 C;  4YRO A;  3CXC A;  1VQ8 A;  3M4P A;  2EL9 A;  1VQ8 T;  4B9X A;  3GNF B;  1X2H A;  4YPF A;  3RMS A;  3LLR A;  1M5Q 1;  1BI0 A;  3BW1 A;  3W3S A;  4N4G A;  2ZIN A;  1IZ6 A;  2L89 A;  1N8R U;  2E70 A;  1H4T A;  4PLI A;  2DD4 A;  2ZT5 A;  5FU7 B;  4G84 A;  5GAO l;  1QVP A;  4FSX A;  5LJ3 f;  4C92 D;  2ALY A;  5GAN d;  2ZIM A;  2FYK A;  4M77 D;  4TQD A;  2PQW A;  3INZ A;  1WJQ A;  3UT1 A;  4DQ2 A;  3JCM X;  5CO7 A;  3MEV A;  1H3Z A;  2I4L A;  3G4S A;  3PZC A;  4XEO A;  3JAM E;  4JRI A;  5FU6 B;  5LJ3 j;  3DSQ A;  5KCH A;  1ADY A;  3JB9 F;  4QQ6 A;  4YRK A;  1EIY B;  2DIG A;  4P5N A;  1G3Y A;  1BIB A;  2KDS A;  2ALY B;  4X5O A;  4EMH A;  3V8J A;  4RQF A;  3CCM A;  3JB9 I;  4P71 C;  4PNO A;  4ELZ C;  4E51 A;  2ZCE A;  4YCW A;  3KBG A;  3I56 T;  2LNV A;  3KFU A;  3OS0 A;  2CZ7 B;  4J83 A;  4P3P A;  3HPW A;  3GP8 A;  1YI2 T;  5GAN f;  3CPF A;  3QO5 A;  4M7A C;  2D9T A;  1N9S A;  2RJC A;  4HCZ A;  4L87 A;  2HD0 A;  4JRQ A;  3CCU T;  2Q7E A;  2GQV A;  3CC2 T;  3RKY A;  4XU0 A;  4M7D D;  5LJ5 d;  5FRM A;  4PJO G;  4C8Q A;  1WU7 A;  3S6W A;  1R8O B;  2M1H A;  2I4M A;  1L0W A;  1VUB A;  3JB9 J;  3GF5 A;  3SWN C;  3G6E A;  4WJ4 A;  2QHV A;  4X9C A;  3OD1 A;  3CCL A;  2BUD A;  1IRE B;  3JCM d;  2DTI A;  3FB9 A;  5LJ3 h;  4P75 A;  3CEY A;  2X4J A;  1WNL A;  2RHX A;  4JDS A;  1X55 A;  5FU7 C;  2F5T X;  4BI8 B;  3M4G A;  3OYF A;  2DJZ A;  5ELO A;  5LL6 S;  3M4Q A;  2X35 A;  4Q5W A;  4EMG A;  1H4S A;  3R07 A;  3JB9 H;  1MHN A;  3TEH A;  4KR2 A;  4D6W A;  1VQL A;  3QO7 A;  4MZP A;  4DOV A;  3RUX A;  2Y4Y A;  3OQ5 A;  2K57 A;  1GXI E;  3FRN A;  1SER A;  4J8O A;  3URG A;  4L5G A;  2R5M A;  4C8Q D;  2E10 A;  1Y07 A;  1K73 U;  2QQR A;  2A7Y A;  4UPA A;  5DM7 R;  3Q1J A;  2Q5H A;  3TEE A;  2QDY B;  3GNG A;  4GLK A;  4BY6 B;  2JOY A;  4Q6G A;  4BD3 A;  4VUB A;  3OB9 A;  2XI9 A;  4H2V A;  4M77 G;  2E6Z A;  4M75 F;  3A5Z A;  3SB2 A;  3NFC A;  5C51 B;  3A8L B;  4M7A E;  4Q15 A;  1RIQ A;  3E9H A;  3JCM V;  1YIT A;  3WVD B;  3HY0 A;  1E22 A;  4QVD A;  4YRP A;  3LYI A;  2DZC A;  4CH3 A;  3LSQ A;  3L42 A;  2P0Q A;  5DLQ E;  3HXY A;  1HC7 A;  2E3C A;  2XKO C;  2LT1 A;  4LVL A;  2Q5I A;  2ARS A;  3CC4 A;  3VQV A;  1EVK A;  5C52 B;  1J5W A;  4QQG A;  1M1G A;  2QI2 A;  3LSS A;  4TVW A;  2LCC A;  3SFM A;  2M16 A;  4P75 C;  1OZ3 A;  2ZZE A;  1YJ9 A;  3ZBD A;  1DJ7 B;  2L3R A;  1VQ5 T;  3PCO A;  2JN0 A;  4CS4 A;  3P8B B;  1KD1 C;  4LDV A;  3UDC A;  3NTK A;  3P8T A;  2HNI A;  1ASZ A;  1NE8 A;  2RHS B;  3QHS A;  1S72 T;  3N5B B;  3OS1 A;  4IUR A;  1YJW T;  4UC4 A;  1B34 B;  4CH5 A;  1H4Q A;  1VQL T;  3WVE B;  4H2X B;  4OLF A;  4J7F A;  2MWO A;  1M8V A;  3S3N A;  2F5K A;  3QSU A;  4KUI A;  2O4X A;  4XU1 A;  3JCM J;  3A8H B;  2ZIO A;  1Y71 A;  2P0K A;  2QA4 A;  2MWP A;  3CCE T;  2ZNJ A;  1B34 A;  4QVC A;  1H64 1;  3VQY A;  2JVV A;  1FWZ A;  2XD0 A;  2KMT A;  3NET A;  2RA2 A;  4LD6 A;  3RIR A;  5GAO r;  2ODR C;  1VQM A;  4P71 A;  2YLB A;  1HTT A;  2LDM A;  3X24 B;  2VXF A;  1YJ9 T;  5GAM d;  4H2U A;  3EFS A;  4PKC C;  2ZPH B;  1K9M U;  1VQ9 T;  1VQ9 A;  3CCQ T;  4JS5 A;  2QQA A;  4OGC A;  2J3M A;  5GAM j;  5HY6 A;  4K86 A;  3MEW A;  4P73 A;  1U1S A;  3P8H A;  4IUT A;  3X25 B;  4F7U F;  4C8Q E;  2XG8 D;  1KQ1 A;  1X2G A;  4P73 C;  2RJE A;  1EOV A;  5GAO p;  3CBP A;  4K87 A;  3BDL A;  2CZ6 B;  2F69 A;  2ZPB B;  1B8A A;  2IVW A;  4M75 G;  5KE2 A;  2CGH A;  1NJ2 A;  5GAN 3;  4YDQ A;  4MDW A;  3MCA B;  1ZQ1 A;  5LJ3 e;  2AMC A;  3QZ5 B;  5GAM h;  4OVA A;  4E7L A;  3JCM b;  3E9I A;  1LYL A;  3VV0 A;  4TQF A;  4LNS A;  4M7A D;  3OBY A;  5CK9 A;  2XGT A;  2LQ8 A;  3FC3 A;  2JZ2 A;  2BIV A;  2RH2 A;  3JCM P;  5GAM f;  3NEL A;  3A74 A;  2RO0 A;  2VV5 A;  3E9G A;  4HWP A;  3QBY A;  3HFO A;  4KR3 A;  5FLX E;  2CKK A;  1Q7Y U;  4BAC A;  1QVG A;  4M78 F;  4P72 C;  3BFM A;  1BBW A;  4YCU A;  1ZBX A;  3CMA A;  2IG0 A;  5GAN e;  4XAX B;  4UP9 A;  2PVG B;  2YHT A;  5FRO A;  3FLG A;  3HFV A;  3CCR A;  4M77 C;  4LDX A;  3FJP A;  3MF1 A;  2IY5 A;  3CC7 A;  4HT9 A;  2XK0 A;  1VQ5 A;  1NYQ A;  5LJ3 d;  4UP7 A;  3L2V A;  2KSS A;  1XOV A;  4YRE A;  1NPP A;  4Z02 A;  4XTZ A;  3L2W A;  3HRI A;  4TVA B;  4YRF A;  1YFR A;  3CCS T;  2DIQ A;  4WI1 A;  5LJ5 h;  1B7Y B;  5GAN g;  2V8I A;  2PMF A;  3PGG A;  5M9O A;  3OY9 A;  2RD1 A;  2I4N A;  2HAX A;  1B76 A;  4JUV A;  3UGQ A;  3ZEH A;  4LVJ A;  1BI3 A;  1N9R A;  4FL6 A;  3ERR A;  3M54 A;  3OYE A;  5CKB A;  1Q86 U;  1VQ6 A;  3CD6 T;  4C92 B;  5I2S A;  3OW2 A;  2XDP A;  4KBM B;  3SD4 A;  1YB3 A;  3L2Z A;  2I4O A;  4BY6 C;  4JRP A;  2E1H A;  1EFW A;  2E5Q A;  2ZT8 A;  1N9W A;  3UH0 A;  4X34 A;  2RHU A;  2LC4 A;  1JJ2 S;  3PCO B;  3OYY A;  4F7U E;  4F7U G;  3ME9 A;  1FX7 A;  3JRZ A;  3L1A A;  5K1P A;  5CQX A;  4YRN A;  4M7D C;  3M53 A;  2FHD A;  1YHQ T;  5GMK e;  1NZ9 A;  1UGS B;  1Q82 C;  1GGM A;  4ZGE B;  4E7I A;  3NTI A;  4HWR A;  4IKF A;  1OYX A;  2DQ0 A;  1Q81 C;  1B70 B;  4C5E A;  12AS A;  4HWT A;  3JCM g;  3OS2 A;  1YI2 A;  1LNX A;  4HCC A;  4M7D G;  4M78 E;  2ZCF B;  5A0L A;  3OMG A;  2R5A A;  1EIY A;  5I2M A;  5GAM g;  1G51 A;  5EG2 A;  2QEX T;  4H02 A;  1XQH A;  3LW5 E;  4OB1 B;  2Q7H A;  2ZZD A;  5C0M A;  4LVK A;  4M7A B;  4N0A C;  3CC4 T;  5I21 A;  1QP2 A;  1E24 A;  2P5I A;  2DXC A;  2DK3 A;  1KQS A;  1G5H A;  1UB4 A;  1Z7M A;  3M57 A;  4PL6 A;  4YRC A;  2X4X A;  1P92 A;  1USY C;  4ELY C;  4E47 A;  5HKC A;  5A2Q E;  5GAN 4;  5IT9 E;  1SES A;  2E5A A;  3PMI A;  3WXM B;  1KQ2 A;  5D6W A;  1BIA A;  5GMK j;  4TVA A;  2OTJ T;  1S72 A;  3IAL A;  2ZTG A;  3PIP A;  4FU6 A;  4R56 A;  1NJ8 A;  3M58 A;  3HXV A;  2G3R A;  4EPC A;  3A8O B;  3I55 A;  3VU3 C;  3HXZ A;  2VGM A;  2L5Q A;  2DTH A;  1YHQ A;  3RF1 A;  1BBU A;  4EO4 A;  4IUP A;  4M77 F;  2CJB A;  5CQY A;  4BDY A;  3CCQ A;  3CCE A;  1JJC B;  1OZ2 A;  4BE2 A;  2I2L A;  2RK1 A;  2OTL T;  3DB4 A;  2YRV A;  2WAC A;  4RMF A;  5GAN h;  1X75 C;  3HTZ A;  1WYD A;  1JBM A;  4EMK B;  3DLM A;  4C92 G;  4TWA A;  5E3I A;  3A31 A;  1VQK T;  4IUU A;  5KNN A;  3MQZ A;  1G3S A;  3MP8 A;  2KK4 A;  2Q7G A;  2A8E A;  2RI3 A;  4ZTF A;  2G4C A;  2Y4X A;  2E65 A;  4B9W A;  5DLO A;  3DB3 A;  3HFZ B;  4TVR A;  4BE0 A;  2NLU A;  1D3B B;  3OSV A;  4IUQ A;  2RHZ A;  1G3T A;  3HXX A;  1VQ7 A;  4RCC A;  3PFS A;  1PYS A;  4PJO E;  5GAO q;  1VQN T;  3OYH A;  1KC8 U;  1VIE A;  5GAM e;  3MHX A;  3I56 A;  4NCX A;  1N6A A;  3RES A;  4JJN K;  1HK9 A;  2BKD N;  3VBB A;  1KMM A;  4YRJ A;  2IY5 B;  4P3N A;  2LT4 A;  2OAU A;  2NS6 A;  4PHC A;  2E41 A;  3QTC A;  2RK2 A;  4YRM A;  4ZGJ B;  5CVI A;  3HP9 A;  2AKW B;  3GOX A;  1G3W A;  2QHS A;  2GFU A;  3OYC A;  1YIJ T;  4A4K A;  4XEM A;  3VYG A;  2ZPF B;  3MET A;  4O5V A;  1JJC A;  5LJ5 f;  4ZIB A;  4FT4 A;  1KHI A;  4CI0 C;  4UP8 A;  2HQX A;  4LDW A;  3VYH B;  3CC7 T;  4EDU A;  2O4X B;  2ZGW A;  3SDZ A;  1QF6 A;  4J5Y A;  2FVU A;  1XNI A;  3RL6 A;  4RCB A;  5LJ3 g;  1YJW A;  3OYD A;  4BE1 A;  4YRR A;  3M4Y A;  4ZTZ B;  1NJI C;  3I7F A;  5F5W A;  4NL2 A;  2K5L A;  2P0L A;  4OB0 B;  4F7U A;  1FXX A;  5GMK i;  5IN1 A;  2XTI A;  4HVC A;  4CS2 A;  3C94 A;  3X20 B;  2KAF A;  4XTY A;  3OYL A;  5J39 A;  3HRT A;  3QDR B;  3P8Y A;  4QVZ A;  1H4V B;  2WSC E;  3X28 B;  3QKJ A;  3VQW A;  2O01 E;  2RHY A;  4PJO A;  3UPU A;  3UFG A;  2ARU A;  2MF2 A;  1RL2 A;  4M77 E;  3HL8 A;  3M9Q A;  2EYQ A;  3H6Z A;  3CPW A;  3QZ9 B;  4YRI A;  3PTA A;  2AKW A;  1VQ4 A;  3KUF A;  4YRL A;  2RHQ A;  2DXB A;  2ZPG B;  1NNH A;  4ZTJ A;  1JB0 E;  4J6Y A;  4PJO F;  1D3B A;  3EFR A;  1WGS A;  3CXC S;  4A4G A;  1KG1 A;  2C8M A;  2ZPI B;  4KQE A;  3L4G A;  1U1T A;  4KUL A;  3RKW A;  4LVM A;  4L6V 5;  4RDX A;  3A7A A;  4MML A;  4V2S A;  3J81 E;  4HWS A;  3X26 B;  2E64 A;  4A4F A;  3JCM h;  3FDR A;  1E1T A;  3REX A;  2DQ3 A;  2VGN A;  2EIF A;  3S3O A;  2ZT6 A;  3SWN B;  2WSF E;  4BB7 A;  4YCV A;  4XQ3 A;  4MZM A;  1KC8 C;  3RMQ A;  4EMK A;  2YLC A;  3S3M A;  3G71 A;  1N27 A;  2RHS A;  4ZGD B;  5GAO m;  4J6W A;  4BWA A;  1KD1 U;  4R55 A;  4M7A F;  4M77 B;  1E1O A;  3MEU A;  3LWH A;  4RKU E;  3RGL A;  2ZXF A;  4NS5 A;  4RG2 A;  2DEQ A;  1M1K C;  1Y7X A;  3OMC A;  5HK3 A;  4J7I A;  2PU9 B;  2AMC B;  1I4K 1;  2QQB A;  1I81 A;  1QE0 A;  3TEG A;  1WLE A;  1KHC A;  3PT9 A;  3O8V A;  3DLL A;  4XTU A;  2MMP A;  3QUI A;  4YRQ A;  3HHT B;  1I8F A;  3HFZ A;  4LDY A;  4ME7 A;  2ZR2 A;  4NL3 A;  1VQ6 T;  3CD6 A;  4H2Y A;  4ZN1 A;  4OB2 B;  2PVO B;  4M78 G;  4TTV A;  1LOJ A;  3CCV A;  2RI5 A;  4XU2 A;  1EVL A;  4N0A A;  4M75 B;  3MF2 A;  1N8R C;  3A5Z B;  2DTO A;  5GAN 2;  3OYM A;  5KE3 A;  2ZPE B;  4FM4 B;  2XDD A;  5GMK m;  3MO8 A;  2L8D A;  3WQZ A;  3G71 T;  4FIB A;  4BUG A;  4LD9 K;  2X4Y A;  3BY7 A;  1UGR B;  3CCJ T;  1W2B A;  3GIB A;  3JSC A;  1X56 A;  1K8A C;  5HGQ A;  1YJN T;  5AYF A;  2M0O A;  1M1K U;  4EMK C;  3V8L A;  3CPW S;  2PVD B;  4PJO D;  4HKE A;  3QO3 A;  3C12 A;  3G7Z A;  2Y90 A;  4BI4 A;  3C4S A;  4M75 C;  3OYA A;  3UWN A;  1PYS B;  5CIU A;  1BI1 A;  1Q81 U;  1O75 A;  3M59 A;  4Y91 A;  3OW2 S;  3BDU A;  2DU7 A;  2E6N A;  2ODR D;  3CCR T;  4II1 A;  2EJ9 A;  2GF7 A;  1C0A A;  1QVF A;  1VQZ A;  2VXE A;  1B70 A;  5A0D A;  3VQX A;  3R6O A;  4X9D A;  1NJI U;  1FYF A;  1SET A;  3NEM A;  3L2R A;  2PME A;  4E7H A;  2CIM A;  3DKM A;  4C5G A;  4Y28 E;  1EIF A;  3IKL A;  4C0F A;  3CCU A;  4JRK A;  1TH7 A;  3QJY A;  4CRI A;  4O2D A;  3OYI A;  3ZFJ A;  4M77 A;  4KT0 E;  3LGF A;  4C8Q B;  1YBY A;  4KUD K;  4M7D A;  1ATI A;  5CKF A;  3HKS A;  4C5I A;  3GPL A;  2RHI A;  2K3X A;  1VQO A;  3CMQ A;  2DO3 A;  2MAM A;  3HFN A;  3ASK A;  1UEB A;  2CZ1 B;  2XID A;  5LJ5 e;  2RHQ B;  2EKO A;  2K5F A;  4DOW A;  1W4S A;  2HQE A;  3C95 A;  2JTF A;  2VYT A;  4H2X A;  4XU3 A;  5GAN j;  5C53 B;  2X4W A;  3E1S A;  3CCS A;  4P72 A;  3QYH B;  5HK0 A;  4J15 A;  2RJF A;  2J3L A;  2CJA A;  3P8V A;  3CCJ A;  3JCM e;  3I55 T;  3JCM c;  5FRN A;  2K5I A;  2EQU A;  4MZT A;  3JCM Q;  2QXF A;  4XTX A;  4RQE A;  2HBP A;  1Q86 C;  4E7K A;  4HT4 A;  4YRT A;  2KY9 A;  4M78 D;  4YP0 A;  4O6J A;  3V7S A;  4BDZ A;  1MGQ A;  2P4T A;  2QHU A;  3QPH A;  3CCL T;  3NTH A;  2LCL A;  1QW1 A;  3SWN A;  2A3L A;  1YGB A;  4P3O A;  3REU A;  4JS4 A;  5IAY A;  2OTJ A;  3RER A;  4EX5 A;  4P74 C;  2VC8 A;  4M7A G;  5KH6 A;  1AHJ B;  1VQK A;  2RB6 A;  1QVF S;  3HRS A;  2D6F A;  2CZ0 B;  3OYG A;  4ZN3 A;  2CYZ B;  4C92 A;  2LTO A;  1WJR A;  2M9U A;  1BI2 A;  3OYN A;  2AHJ B;  1VQ7 T;  1O9S A;  4ATO A;  3VUZ A;  1ASY A;  5LJ5 j;  4OP0 A;  3FIF A;  4G85 A;  1BKB A;  4C0Z A;  1G5V A;  4C8Q G;  4BI3 A;  2C7I A;  1W66 A;  3NEN A;  2QTX A;  3TRE A;  3G6E T;  5D6Y A;  3A32 A;  3TCJ A;  1YJN A;  4RMO A;  4XTW A;  1UGQ B;  3A7R A;  1RI0 A;  3OS5 A;  1WQW A;  5CR2 A;  4M75 D;  1VQP A;  5GAN 6;  3VJP A;  3QJ6 A;  1YFT A;  4N4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...