2E65A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, mutation d104a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
227
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNAVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 67
structure length 227
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e65A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e65A01
3RESA 5LJ3g 2P5IA 4M77A 2DZCA 3VU3C 4YRSA 4M7DG 3QO8A 4PJOE 4H2XA 5LJ3f 4P74A 4QVCA 3I7FA 3NELA 5E3IA 4JRIA 4P3NA 4C8QB 4XU1A 4M78D 3JCMd 3M4PA 4M7DF 4Q6GA 2DU5A 3HRKA 1YGBA 4TVAA 4H2UA 1FYFA 3RACA 4BW9A 3IKLA 4F7UB 4YCUA 4XTWA 4YRIA 2EJFA 3V8JA 5GAN8 4H2WA 4C92G 4YRQA 2E41A 2CIMA 2ZR3A 1E1TA 5GMKh 1ADJA 1WU7A 4P75C 4M7AC 4UP7A 5GANe 3MF1A 5GAOr 4C92F 4P71C 2QHSA 4H2YA 3QO5A 2I4MA 2HNIA 3FIFA 1X01A 1USYA 3BDUA 1JJCB 3HXVA 3RL6A 3SWNC 5GAOq 2DEQA 4OP0A 3NENA 3L1AA 1IL2A 1KQ2A 2RHQB 3HFNA 5GAMf 2AMCA 3RKYA 2Y90A 11ASA 3JB9G 4XEMA 3L4GA 1B34A 4PJOB 2ZIMA 2IY5B 4K86A 3HXUA 5GAOl 1WNLA 1H4TA 5C52B 2EJ9A 4K88A 4WI1A 4C8QA 2DU7A 4XTZA 4A53A 4M75A 3HXZA 4YRFA 2ZXFA 4YRRA 3HFZA 3A74A 2Q7HA 4HT9A 1QE0A 1SERA 4CS2A 4H2XB 3HY0A 5GANf 4TTVA 3LC0A 3VBBA 5LJ5e 5F5WA 3A7UA 4EO4A 5LJ5j 3RKXA 1U1SA 1LOJA 4M78C 3JCMc 2ZZEA 4A54A 2DXUA 4TVAB 3JCMh 2RB6A 4M7AG 3P8VA 2CGHA 3RUXA 1Y96B 2Q7GA 2ARSA 2E10A 1NYQA 4JRKA 3HSBA 4M7AF 1JJCA 2RHQA 1NJ6A 3IG2A 4XU2A 5ELOA 2I4LA 4XTUA 1KMNA 4MMLA 3HXYA 5GAMd 2ODRC 4M7DE 3PZCA 4C92A 2QHVA 2DQ0A 1PYSA 3M4QA 2ZZFA 5GMKe 4PJOA 1YCYA 3UGQA 4MMKA 2IY5A 1G5IA 2YLBA 4N0AC 4NL2A 1ASZA 2AMCB 5GMKl 4P3OA 5LJ5g 5GAOm 3PGGA 3JCMP 4M77C 1H4SA 4C92E 5LJ5f 3L4GB 4Q15A 1B34B 1BIAA 2EWNA 4P74C 4RMFA 3UGTA 3BFMA 3P8TA 5GAN7 2E5AA 2XGTA 3A7AA 5GANd 4YRPA 2EJGA 4NOYA 4M75B 2ZINA 3E9HA 4K87A 4KR3A 4P73A 4YROA 4TQFA 3HY1A 3LSSA 3HFZB 2J3MA 1I4K1 4RCCA 4RDXA 4M78G 4RQEA 4JLIA 3NETA 1E1OA 5GMKi 3LSQA 1Y96A 4YRCA 1B8AA 2RHSB 1ASYA 1NJ2A 4BWAA 2FYKA 4LNSA 4M78F 3RF1A 4HA8A 1NJ8A 2ZT5A 1WQ7A 4PNOA 3A5YA 1RIQA 1EIYA 1I81A 1WQWA 4TWAA 4HVCA 4UP9A 4HT8A 1USYC 2ODRD 4M7DB 5GAN5 3ERRA 1C0AA 1WPYA 1NJ5A 1X2GA 5ELNA 3HTZA 3P8YA 1VQZA 4AH6A 1LNXA 4XU0A 3V8KA 1Z7MA 1HTTA 4H2TA 1M8VA 4HWTA 2VXFA 2I2LA 1EOVA 1QF6A 3OD1A 4CS3A 5HGQA 1G51A 4M77D 5GMKm 4OLFA 1Z7NA 1H4QA 4C92B 5GAMh 2AKWA 3DSQA 4CH5A 4EMKA 4NCXA 2EAYA 1PYSB 12ASA 4M77G 4YRNA 4YRJA 4C8QC 4TQDA 3KFUA 1U1TA 4M75C 2PMEA 5K1PA 5LJ3d 3SWNA 4M7AE 4J15A 1H4VB 4M77F 3TEHA 4EMGA 1X56A 2RM4A 4P3PA 3JB9J 3UFGA 2CJ9A 2ZTGA 2P0LA 1B76A 2RHSA 2XTIA 2E65A 1E24A 5GANh 1J5WA 2ZGWA 5GAN6 4UP8A 4YREA 4ZIBA 4XTYA 1W66A 4Y91A 2ALYB 4CH4A 3V7SA 4X9CA 3TUPA 4M7DA 1LYLA 3JCMg 1M5Q1 3VQVA 2PMFA 2DKGA 3RGLA 3HFVA 5GAOp 2QHUA 3INZA 3JCMW 1EIYB 5KNNA 4WJ4A 4TVYA 1N9RA 2C7IA 4C92C 2E64A 3WQZA 2I4NA 2VC8A 2DQ3A 1JBMA 2E1HA 3BY7A 4PJOC 3PCOA 3JB9H 1HK9A 2CJBA 4YRKA 2ARTA 3L2ZA 5GAN3 4C8QD 3A7RA 3GIBA 4M75D 4HWRA 1L0WA 4P72A 1D3BA 2ARUA 1X2HA 4PG3A 4M7AB 4CH3A 4C8QG 4M78E 4J6WA 2G4CA 3VQYA 3EFSA 1N9SA 1BBUA 2AKWB 4NL3A 4EMKB 5GAN2 4YP0A 4CS4A 4F7UG 1X54A 2DTIA 2EL9A 1YB3A 3AHUA 4C8QF 1KOGA 2YLCA 3FB9A 2VXEA 4M75F 4XQ3A 1TH7A 2DDZA 3A32A 3SWNB 4P73C 4TVWA 3VQXA 4XTXA 4F7UF 4KQEA 5LJ3h 1BIBA 3TEHB 3QUIA 4WJ3M 3REXA 1ATIA 5GAOn 1YFSA 2DTOA 2ALYA 3UH0A 1HXDA 3JCMb 5GAMj 2Q5HA 3W3SA 4EMHA 4YRTA 2ZNIA 1MGQA 1YFTA 3CMQA 4XTVA 3M4GA 4RCBA 4PHCA 3IALA 4KR2A 4ZTUB 4HWPA 2J3LA 4O2DA 4YCWA 4C92D 1B70B 4M77E 4X9DA 4PJOD 1SRYA 1HC7A 3NEMA 1EFWA 4JUVA 1SETA 3QNEA 4WF2A 3FJPA 1YFRA 2Q5IA 4PJOG 4YRLA 3IKMB 3MF2A 2Q7EA 5K1XA 3QHSA 4P75A 3V7CA 3JCMe 5GANj 4M7AA 1B7YA 4M78B 4EMKC 1LJOA 4P71A 4PJOF 5CAIA 3HXWA 3PCOB 3QTCA 4G85A 3REUA 2E3CA 5LJ5d 3EFRA 4XEOA 2ZZGA 5GAMg 1D3BB 2RD1A 2ZNJA 3QO3A 3BJUA 3JCMV 1E22A 4J6YA 1NYRA 3TEGA 4YRGA 4DQ2A 3JB9D 3JCMX 1EQRA 2YHTA 2RA2A 3MEYA 4YYEA 2C8MA 4QVDA 2DZ9A 5DY9A 4YRMA 4XU3A 2DJZA 5GAN4 3HFOA 3QO7A 2ZR2A 3V7RA 3VQWA 1NNHA 1G5HA 4G84A 4DPGA 3JB9F 4X5OA 4H2VA 4J5YA 3QSUA 2I4OA 3JB9I 3A5ZA 4M7DC 5GANg 3V8LA 4EX5A 4M77B 4F7UA 1B70A 1I5LA 4J6XA 2JN0A 3JCMf 4M7AD 1BBWA 4C8QE 4H02A 4L87A 3JCMQ 3RERA 3BW1A 4M75E 5LJ3e 4HWSA 5C53B 2DTHA 5LJ3j 5C51B 4M78A 1NJ1A 1WLEA 4F7UE 2QTXA 1I8FA 2ZIOA 2K57A 5I21A 1ADYA 4YPFA 1X55A 4YDQA 4P72C 1EVLA 1KMMA 2DVEA 1JRIA 4V2SA 1EVKA 4E51A 3HRIA 1WYDA 4H2SA 1B7YB 4RQFA 1N9WA 3E9IA 4YCVA 4HWOA 4M75G 3A31A 1GGMA 3ICAA 1SESA 2CJAA 3JCMJ 3HXXA 2ZCEA 2ZT7A 5LJ5h 2ZT6A 2FB7A 3R07A 4UPAA 3RKWA 3G1ZA 4ZTZB 2ZT8A 5GMKj 1KQ1A 4N0AA 4CH6A 2DXTA 3SB2A 4M7DD 2QHTA 5GAMe 1H641 3RIRA
chains in the Genus database with same CATH superfamily
3M0RA 5LJ3g 1VQKQ 3L42A 2LJ1A 1YI2T 3QWYA 5LJ3f 4QVCA 1PG5B 1XQHA 4D8KA 5E3IA 2E12A 1W6XA 1WHKA 2V8KA 3HRKA 1YGBA 1M1KU 2NUPA 4H2UA 4J9DA 4PFZA 4BB7A 2BKDN 4YCUA 4XTWA 4FCYA 4YRIA 1NJIU 4LXCA 2EJFA 4OMLA 3V8JA 4H2WA 3NMZC 2E41A 4ZTFA 2CIMA 3HP9A 4P75C 1K0XA 3THKA 3MF1A 1OI1A 5GAOr 1G2BA 2OTJT 1Q7YR 5FW9A 1Y0MA 2Y4YA 2NYSA 2PVGB 2LQ8A 1Z9ZA 3QO5A 1ZSZA 3FIFA 3LH5A 1YJWQ 2E5KA 2JUFA 1USYA 3HXVA 1SRMA 3SWNC 2EW3A 3NENA 1HD3A 2YUQA 5CK9A 2RHQB 4LE9A 3HFNA 5KYYB 3LYIA 5GAMf 4PFPA 3O5ZA 1E6GA 2LZ6B 3MEVA 2Y90A 4XK8E 4XEMA 2RQTA 5C6SA 2JXBA 2HD0A 2GBQA 3L4GA 1B34A 2AZSA 3NFCA 3MP1A 2CP5A 3C12A 2IY5B 1OYXA 3ME9A 2K4YA 2K5IA 3HXUA 5GAOl 1BB9A 2RJDA 3CPWA 2EJ9A 1VQ5Q 2RQVA 1QP3A 4C8QA 4DBQA 5I11A 1QVGA 1OZ2A 4RTZA 4YRFA 2EYQA 3VV0A 4YRRA 2KVQG 2KNBB 3A74A 1SERA 4CS2A 3HY0A 2YUOA 2CP2A 5LJ5e 4OB1B 1IXDA 1IO6A 1TWBA 3HKSA 4ZGJB 3LX7A 5LJ5j 2GGRA 2ZZEA 3JCMh 3L2RA 2RB6A 2FRWA 2EQUA 1V1CA 5EG2A 3RUXA 1IB8A 3BE3A 4DA4A 1OX9A 2Q7GA 3CC4Q 4J9IA 2E10A 3G6EQ 3HSBA 4OMFB 5L23A 3G71T 2QTVA 2CP3A 1I0CA 1YITQ 1PSEA 1VQKA 5L8RE 2MOXA 4XU2A 1TG0A 4FYXB 3L2VA 3CCMQ 4MMLA 1KMNA 3SEMA 2A0FB 3H0IA 2ODRC 3M0TA 2ZCFB 3PIPA 3GNGA 2MK5A 2YDLA 1Q81C 1QVFA 3M4QA 3OSVA 4PJOA 4RMOA 3H6ZA 2YLBA 2QI2A 4P3OA 3CCQA 3PGGA 3PTAA 1PWTA 3OYGA 4QW2A 3VS5A 2QGFB 1BIAA 2PUKB 4P74C 2K3YA 2W10A 3BFMA 3P8TA 3M5AA 1YP5A 4ME7A 1WXBA 2XGTA 1OOTA 3A7AA 2ED1A 2EJGA 4M75B 2FZCB 2O4XA 3E9HA 4K87A 4P73A 3HFZB 1FMVA 2JVVA 1MV0B 2JTMA 4UC4A 3MHXA 4RCCA 2YUNA 8AT1B 4RQEA 4AMCA 5I22A 2RI3A 3QZ9B 2RQWA 1E1OA 4YRCA 1Y96A 1NM7A 4QT7A 4RTWA 2GTOA 3H0HA 1NJ2A 1UGRB 4KRTA 4Y92A 4LNSA 2EQKA 3WVDB 1NPPA 1M90U 3H9NA 1NZ9A 1EIFA 1T3SA 3CMET 1RIQA 4TWAA 1NYGA 4N4GA 4JZ4A 4HVCA 3C4SA 1BKBA 5CR2A 4HT8A 2ODRD 1SEMA 1WYXA 4C5HA 3ERRA 1PCXA 1R0BG 1WPYA 1VQ8T 4AH6A 2CS7A 2KDSA 1S72T 1M8VA 1NLOC 4X34A 2JTEA 1GCQA 1B07A 3ASKA 3M4YA 1UGVA 1PRMC 2BZYA 3GBQA 5GMKm 1PD1A 1Z7NA 2K7AA 1YHQT 1B3QA 4YRNA 2AZVA 4KBMB 1SRLA 4XAXB 4TQDA 1VQ7T 2CDTA 3KFUA 2PMEA 5LJ3d 3SWNA 3G6EA 1H4VB 2E6ZA 1Q86R 3PIOA 2D6FA 1YITA 4P3PA 2LVMA 2DYBA 3JB9J 1X75C 3UFGA 2FHDA 2COYA 3CCMA 2OTLT 4OGEA 2D8JA 1PKTA 2ZTGA 2P0LA 2RHSA 3M9QA 3E2UA 3JSCA 2XICA 2E65A 1E24A 1JXMA 3U23A 4IUPA 1NPRA 2EFIA 2K3XA 2GFUA 3H41A 4XTYA 1BI1A 4PLIA 5AYFA 2ESWA 3M53A 3M56A 2DFUA 3MJXA 4L6V5 4B9WA 3TUPA 4M7DA 4HVUA 4ZTJA 3VQVA 3WVEB 3HFVA 5GAOp 5A0LA 4E7KA 3CCET 2QHUA 1SKUB 1KG1A 1WXUA 5IXFA 4TVRA 1EIYB 3MP8A 1M2VB 5CCAA 1YJ9A 1LVKA 4C92C 5KYXA 4MZTA 2LMJA 1RAHB 4LDVA 1Y57A 3I5RA 3PCOA 3META 3JB9H 4BACA 2CJBA 1ZBJA 2ARTA 5IXBA 1JJ2P 1YIJQ 2JM9A 2DEUA 1N8RR 2EPDA 4PG3A 2K6DA 3EFSA 2CZ7B 3P8BB 4NL3A 2SEMA 2MIOA 3AHUA 1VYTA 4K11A 4A4GA 5I2SA 1W2BA 1TTHB 1BIBA 4WJ3M 2VB6A 2ROLA 5A2QE 3C0CA 3QZ5B 3REXA 1X6GA 2YRCA 1ATIA 1D1BA 2GCXA 2IIMA 1G5VA 1YFSA 3TVTA 1QKWA 1BCMA 2AIRB 1A0NB 1HXDA 2DA9A 3HTRA 5IH2A 2RK1A 4OGCA 4EMHA 4IUTA 4AFQC 1X43A 3GOXA 1UGQB 2HL3A 4LN2A 2HBWA 2XDBA 2AT1B 1VQNT 2QDLA 4C92D 1EFNA 2ZPGB 1RUWA 3J7AF 1SF9A 3JAME 1VQOQ 3X26B 3I55T 1PRLC 1VQPQ 5CKBA 2DIQA 4E2FB 4WF2A 4DBHA 1SETA 3QNEA 1YFRA 4QQ6A 2Q5IA 1WFWA 1S1NA 5IAYA 5HK3A 3PVLA 4M7AA 1KD1R 3RMSA 4EMKC 1LJOA 4F14A 4P71A 1U06A 3HRSA 3HXWA 3OYYA 3QTCA 4G85A 1I1JA 3ULRB 4RTTA 4JZ3A 3MQZA 2HSEB 3CCLT 4IKFA 2QA4T 3DLLA 4AFSC 4XEOA 5HY6A 2ZZGA 2RD1A 4LUDA 2LQWA 3JCMV 1E22A 1NYRA 4J9BA 4DQ2A 3JB9D 4N4HA 3JCMX 3CCRQ 2A3LA 2P0QA 2BZ8A 2CKKA 2DIGA 2C8MA 3EG9A 1QVFS 1JEGA 2LRQA 2CZ0B 1KQSS 3PMIA 2KRMA 3HFOA 5GAN4 2DD4A 4LNPA 2ROTA 2EQIA 3GF5A 5FU6B 3JB9F 4X5OA 4J5YA 3OSSC 2RNAA 2I4OA 1VQ4T 3LWIA 5GANg 1YJNT 4L59A 4E7SA 5D7UA 3OYLA 3A8MB 5FWCA 2QEXQ 5AT1B 1UB4A 4H02A 1TUDA 3JCMQ 3RERA 3BW1A 5LJ3e 3CCUT 4HWSA 4KUIA 2M51A 1FXXA 5LJ3j 1K9MC 2G6FX 2J7IA 3QG1A 2V26A 2XD0A 3HRUA 2QQ9A 2JJ9A 3FC3A 1TOVA 1YN8A 4YDQA 1UJ0A 1JRIA 3CC7A 1B7YB 3PNWC 3I56Q 4X1VA 5KYYA 1U3OA 1G8XA 2X35A 1VQKT 2AKLA 2SRCA 1K73C 2OAWA 3ICAA 1BBZA 3TSWA 3EGUA 2X9HA 5ECAA 2ZCEA 2ZT7A 1KSWA 2EVRA 2V1QA 3G1ZA 1XOVA 4ZTZB 1VQPA 3N5BB 1KQ1A 2K2VA 2PU9B 2CH4A 4P5NA 4CH6A 2DXTA 5A0GA 2D0NA 3QYHB 5GAMe 2YWWA 3OBYA 4M77A 2DZCA 2LCLA 3FEOA 4YRSA 3QO8A 4BI4A 1AWOA 3VRYA 4XU1A 2CUDA 4M78D 4HVWA 4IIMA 3A5ZB 3A8HB 2DPPB 2DU5A 2VKNA 1YJWT 3IKLA 4C92G 3E9GA 3DLMA 1D0XA 1FX7A 1E1TA 4LVJA 5GMKh 1ADJA 3UPUA 4UP7A 1X27A 1N5ZA 2LT4A 4JDSA 2L3QA 1T3LA 1Q81U 2QHSA 1V29B 2A8EA 2GQIA 4H2YA 2P0PA 2AHJB 3SHWA 1VQ5T 1RAGB 3BDUA 1ZSGA 4QKUA 1VQ6A 1JJCB 5GAOq 1RAEB 3L1AA 1IL2A 3M0SA 4OMOA 1VQLA 1PD0A 4OB3B 1ACMB 2ECZA 3D7SB 1M27C 3RKYA 3OYBA 11ASA 3JB9G 1HSQA 3OS2A 2M0YA 2DK3A 1AWXA 2X4JA 3X20B 2V8IA 2VUBA 1YNZA 4K86A 4FYYB 1H4TA 4K88A 2DU7A 2COWA 3UT1A 4M75A 3HXZA 3CC4T 2KY9A 3EGDB 1SG5A 3KFVA 1G83A 3HFZA 1OV3A 2M02A 4HT9A 2O01E 1YITT 1W2BS 2J6KA 1M1KR 4JJCA 5F5WA 1NJIR 4HCKA 4EO4A 2M1HA 3RKXA 3DB4A 4ZGEB 4KH1B 3OYHA 4A54A 2DXUA 4TVAB 1TUCA 3P8VA 3C94A 4J9HA 4JS5A 2FPDA 5I2MA 3RNJA 1MMAA 1VQMA 1KC8C 4CC3A 5KCOA 1KJWA 2NLUA 3IG2A 1IREB 2R58A 2I4LA 3OW2A 2DXBA 2GNCA 2GF7A 2L5QA 2OJ2A 2ZZFA 1K8AC 5FU6C 1YCYA 2DYIA 2RJFA 3I35A 2M16A 4RG2A 5GAOm 3E9FA 4C92E 4C0DC 2ZPBB 3J80E 2JS0A 3OMCA 3UGTA 2RHXA 2H3EB 4R55A 2VASA 2D8HA 2MF2A 3CPWP 3QJ6A 5GANd 1QVGP 3CCSQ 2ZINA 2XDDA 3NTHA 3FJ5A 3KXTA 1MNDA 1SSFA 3HY1A 3HL8A 1N8RC 3LSSA 4TQFA 4M78G 4E7JA 2O88A 1XTDA 4ZN1A 2JW4A 4JRQA 3NETA 5GMKi 3LSQA 3G4SQ 2HBPA 5CO7A 1ASYA 3CCQQ 4BWAA 2FYKA 4C5EA 3OYCA 3CC2Q 4HA8A 1AWJA 1QMCA 2H3JA 1UGPB 4PNOA 1EIYA 1I81A 2RJEA 4LVMA 4UP9A 3GPLA 2DMOA 1C0AA 1X2GA 3P8YA 3OYFA 3KUFA 1VQZA 4XU0A 3V8KA 1Z7MA 4H2TA 4FW2A 4PL6A 2I2LA 2VXFA 3OD1A 3OBWA 1H4QA 4C92B 5GAMh 3CXCA 2NUZA 2V1RA 3Q1JA 3WXMB 4DEXA 4NCXA 2R5AA 1GRIA 3MEAA 2MWPA 1GXIE 4YRJA 5GJWB 2JZ2A 4EIKA 1U1TA 1TUGB 4MZMA 5KYUB 1AVZC 4BI3A 4ANJA 1X2QA 1QCOA 2RM4A 2RO0A 2KAFA 2DAQA 2JTFA 2YRVA 1QCNA 3A98A 2KE9A 1GCPA 2FVUA 2XTIA 4OVAA 4A4HA 2L3RA 1W1FA 1J5WA 1R8OB 5GAN6 3M0UA 4Y91A 2ALYB 4ORZA 1RABB 5KE2A 4X9CA 1M90R 1YIJT 1ABQA 1LYLA 3JCMg 4HT4A 1Q82R 2PMFA 1PKSA 2EGEA 2FZGB 1PM3A 2G3RA 1WJRA 2RI2A 5KNNA 4NS5A 2E64A 4J7IA 3WQZA 3RR6A 3CCSA 3EH2A 2VC8A 2DQ3A 2QQSA 2E1HA 3MKDA 2K5LA 2KYBA 5GAN3 1KQSA 3HHTB 5KYWB 2KRSA 3GIBA 2JMAA 1L0WA 2J05A 1SHFA 2ARUA 1X2HA 5D6YA 3G4SA 3EFOA 2CP6A 4C8QG 4M78E 4CRIA 2G4CA 3CC2A 1N9SA 2AKWB 2RHIA 4EMKB 2ATCB 3AT1B 2YLCA 5J26A 2GFAA 1E7OA 2VXEA 4R56A 1YJ9Q 2FZKB 3CD6T 1TH7A 1R0CB 4Y28E 3A32A 3VQXA 2A28A 3H8ZA 3TU4K 4E7HA 4KQEA 3OYIA 3TEHB 1VQOT 1MHNA 3QUIA 2GTJA 3LH0A 4PFOA 2QQAA 1MMGA 5D6WA 5GAOn 2L2PA 2LX7A 2JOYA 4E7IA 4KGZB 4DBFA 4JJNK 3W3SA 2JMCA 3CCJQ 1K9MU 2CT3A 2ZNIA 2DM1A 4RCBA 4PHCA 1NG2A 2DL5A 4KR2A 2KEAA 3M54A 4DOWA 4O2DA 1V76A 1G3YA 3M59A 2EQJA 3EGXB 4AG2C 1B70B 4FT4A 4OB2B 4X9DA 2DL4A 4N4IA 3VS7A 1K73U 3OYJA 2PVOB 1ZA1B 1WHGA 3CCRT 3G7ZA 4RG8A 4PJOG 3FRNA 2HCKA 3IKMB 1SPKA 4P75A 3V7CA 2BZXA 4KGXB 5GANj 1B7YA 2VGNA 4GLKA 1G3WA 4M78B 1VOMA 2KBTA 2A36A 1WIEA 2DX1A 2X3XD 2F5TX 3REUA 2E3CA 1T0JA 3EFRA 2X51A 1D3BB 3VS0A 3OW2S 1U8RA 2ZNJA 3CMAQ 2QASA 3QO3A 3ZEHA 1PC0A 3EHQA 1QQJA 1M30A 2RK2A 4KULA 4R0KA 2NUTA 1YCSB 2FPFA 8ATCB 4YYEA 4FSXA 2YSQA 3CBPA 4QVDA 2QEXT 2DZ9A 4YRMA 2OTJQ 4XU3A 2DJZA 4FU6A 2MI6A 2LJ3A 4RTUA 2IG0A 2XG8D 4JJBA 1M8MA 1WHHA 3OS0A 2FRYA 1M2OA 3A5ZA 3PE0A 3NHNA 3OYMA 3V8LA 1I5LA 4J6XA 2BE7D 3I56T 4MDWA 2JN0A 2JNGA 3GNFB 4M7AD 4C8QE 1UHCA 1C6VX 2NUPB 2DTHA 1F1BB 2E4HA 2OI3A 2PZ1A 3CCVA 4JJDA 2C0OA 2QYZA 1ADYA 3RBBB 4YPFA 1NLPC 3SDZA 4P72C 1EVLA 1EVKA 1W4SA 2EKHA 4V2SA 3X24B 1R77A 3EG2A 2CSIA 1N9WA 2XK0A 2PNIA 1M4ZA 3CCJA 4HWOA 2CREA 5FRMA 3A31A 2E6NA 2HKQB 2C0TA 1ZSZB 3VUBA 1SESA 2MAMA 1YWOA 2CJAA 3JCMJ 3PVQA 3RMQA 5LJ5h 2ZT6A 1ARKA 2YXYA 1VYUA 1WHLA 2ZT8A 5GMKj 3CXCS 1VQ9A 4Q5WA 3X28B 2PVDB 3G71Q 4LD9K 4CC2A 1H641 2ZXFA 3EGDA 2E70A 3M55A 3CC7Q 1OU9A 2RH2A 1YI2A 2P5IA 1NBEB 3VU3C 1IRXA 4II1A 4M7DG 4PJOE 4MZPA 3L2UA 1Q86U 4P74A 2LQNA 3I7FA 4AFUC 1KC8U 4JRIA 4C8QB 3QIIA 3JCMd 4PJMA 3M4PA 3JV3A 4Q6GA 2D0QB 3QPHA 3ZBDA 4TVAA 1FYFA 3TQ7P 2E3HA 3CMAA 4BW9A 2WSEE 4ELZC 5FROA 4DBRA 5GAN8 4KUDK 1OULA 5J39A 2ZR3A 4J83A 3A8OB 4MDXA 2OTJA 1OU8A 4C92F 2A08A 1K8AU 3MEUA 2DO3A 3VS2A 2KGTA 2HNIA 1X01A 3EH1A 3VUZA 3G1JA 4OP0A 3MO8A 1D09B 4BDZA 2XKOC 4DOVA 1KFZA 1JJ2A 5CQXA 2RJCA 1Q7YC 4J9GA 2MMPA 2RI5A 3RDVA 3CMEQ 1N8RU 2MPXC 3X25B 1QVPA 5KE3A 4PJOB 2LT1A 2ZIMA 3TSZA 1U5SA 1WNLA 2P84A 1JXOA 4RUGA 4LUEA 2QQBA 4A53A 1VQ8Q 2CSQA 1VQ6Q 1S72Q 5DLOA 1GFDA 2Q7HA 4QQDA 1QE0A 3R6NA 1VQLQ 4C0DB 2M9UA 4H2XB 5GANf 3LC0A 2K5FA 1C0MA 3QYGB 3A7UA 1NEGA 4J7FA 1U1SA 1LOJA 1M9SA 5KCHA 2O4XB 4M78C 3REAB 9ATCB 5C0MA 2DL8A 4M7AG 3M0PA 4LDYA 2R57A 1VQ7Q 1BI0A 4FW1A 4ZNXA 2XIDA 1AZEA 1Y96B 3G71A 1XNIA 1MV3A 2ARSA 4JRKA 1KHIA 2X3WD 1UECA 1ZHIA 2QQRA 2MCNA 1NJ6A 2RHQA 2OTLQ 5ELOA 2QXFA 1B7TA 4XTUA 4BY6B 3HXYA 3O8VA 4M7DE 3PZCA 4C92A 2KRNA 2DQ0A 2K9GA 2KR3A 5FLXE 1IGUA 3OQ5A 4ELYC 1Q82C 3UGQA 4MMKA 2IY5A 4N0AC 1ASZA 2AMCB 1VQMQ 1E6HA 1K0SA 3JCMP 1H4SA 3CCQT 2CZ6B 2FL7A 4Q15A 1K4US 2PUOB 4RMFA 1PHTA 3MP6A 1UDLA 2P0KA 2E5AA 4YRPA 4JS4A 2K79A 4C5GA 4KR3A 1FMKA 4JRPA 1I4K1 4D8DA 4Z89A 2DJQA 3OY9A 5J3BA 5CKHA 5GJVB 2KK4A 1B8AA 2RHSB 1UEBA 1O9SA 4L5GA 2I0NA 4M78F 1JO8A 1NE8A 4FL6A 1NJ8A 3CMEA 2ZT5A 1WQ7A 1ZBXA 3A5YA 1ZSZC 1WQWA 1USYC 4M7DB 2KT1A 1VQ8A 1S72A 4F16A 1LNXA 1HTTA 1MNEA 3TREA 5CKDA 1IGQA 4KGVB 2B86A 5KYXB 1G51A 1JB0E 4OLFA 1NYFA 3QDRB 3VS4A 2AKWA 4CH5A 1YHQA 4EMKA 2EAYA 1PYSB 2L3PA 2JM8A 12ASA 2DL7A 4M77G 4E7LA 1VQ7A 1H3HA 4C8QC 2DERA 1Y7XA 4M7AE 1UUEA 4C0FA 4J15A 3TEHA 3G6ET 5KYNA 1X56A 1EX4A 2M0OA 3KBGA 2OTLA 4A4FA 4J9EA 2DRKA 3CCMT 1BK2A 2LNVA 1RAAB 5DLQE 3TEEA 3GP8A 5IHIA 2KMTA 4PLLA 2LP5A 2ZGWA 3OA6A 2QA4Q 1CKBA 4PJLA 4UP8A 4ZIBA 1Q86C 1OEBA 4CH4A 3EGXA 4FYVB 3CCEA 4F17A 1M5Q1 3RGLA 2L8DA 1UGSB 5HKCA 3UATA 2ZPIB 2YUPA 3INZA 1OPKA 1VIFA 4WJ4A 2C7IA 4B6MA 1H92A 2QDYB 1YJ9T 2L3SA 3QKJA 3BY7A 4PJOC 2FEIA 1FWZA 5CVIA 2XHCA 4OB0B 4C0ZA 1VQ4Q 2QHTA 4HKEA 3VYGA 4YRKA 3L2ZA 1N6AA 1RI9A 4C8QD 3OS5A 2CP7A 4HWRA 1D3BA 1GFCA 2HSPA 4M7AB 4CH3A 2AK5A 2FO0A 3CCJT 5GAN2 4YP0A 3EG1A 4BI8B 4F7UG 2EL9A 1YB3A 4C8QF 1HJDA 5EC7A 1KOGA 1AWWA 1JJ2S 2DDZA 4TVWA 4P73C 1OZ3A 3E1SA 4XTXA 5LJ3h 3LLRA 4BD3A 3EG9B 1WHMA 2FG0A 2ABLA 2F1LA 2DNUA 4YRTA 3EHRA 1MGQA 3UWNA 2J6OA 1YFTA 1VQNA 3M4GA 3IALA 1ZUYA 4BY6C 3CQTA 3S3MA 4HWPA 1KK7A 1M2VA 3CBMA 2J3LA 3I55A 4M77E 3CMAT 4PJOD 2HZYA 3A8LB 2DILA 3FJPA 3OYKA 4LD6A 2EGCA 1OPLA 1GCQC 3VJPA 5K1XA 1KIKA 3UA6A 2DETA 4E6RA 4GY5A 4O6JA 2BTTA 2RHZA 1LPLA 3M57A 2BE9B 4PJOF 3CCLA 1GL5A 1ZA2B 2QA4A 1QVFP 3QDFA 1IHVA 1KQSP 3J81E 3A8GB 3URGA 4PKCC 3CBOA 5GAMg 2EBPA 3DKMA 3BJUA 4J6YA 3TEGA 4YRGA 1UHFA 1VYVA 5CQYA 2CYZB 4FYWB 3MEYA 5M9OA 1KD1C 1PNJA 3S3NA 2EQMA 2RN8A 3ER0A 1D0ZA 3ZL7C 4E7ZA 1UFFA 5IT9E 4HVVA 5A0DA 2O2OA 3QWXX 1C1AA 1G5HA 4DPGA 1P92A 3EAEA 1ABOA 4H2VA 2DL3A 1VQ4A 3QSUA 2HL5C 1K9MR 1M3CA 1YJNA 4M7DC 1FYNA 2XMFA 1BI2A 1O75A 4M77B 4FSSA 1Y07A 3JCMf 4A63B 3CCUA 1BBWA 4L87A 4O5VA 4M75E 1K73R 5C51B 4OMPA 1NJ1A 1W70A 4F7UE 3CEYA 4KT0E 1UTIA 2RQRA 2QTXA 1I8FA 2HQHA 2K57A 5I21A 3QBYA 1G3SA 2XI9A 1Q7YU 4OMNA 1DJ7B 2P4RA 2HEQA 3E19A 1KMMA 4HCBA 3HRIA 1WYDA 4RQFA 3CC7T 3E9IA 4YCVA 1QCFA 4AT1B 2RPNA 4FIBA 2K2MA 4UPAA 1ZQ1A 4IUVA 1M1FA 3CCVQ 1RLQC 4A4EA 2EYWA 1VQPT 2JS2A 3SB2A 4M7DD 3RIRA 3RESA 2HDAA 2ENMA 5FU7B 2DVJA 4LVKA 2IVWA 3P8HA 4H2XA 4ZN3A 2VGMA 3PT9A 2X4WA 3NELA 1WJQA 4P3NA 1OX8A 1YJWA 3DB3A 1T0HA 4M7DF 2K3BA 1TS9A 3JRZA 3RACA 3I5SA 4F7UB 2OAUA 5CKEA 1M3AA 4IURA 2ZPHB 3MPUB 2X4XA 3S3OA 4YRQA 2ED0A 1VQ9Q 1G3TA 4LVLA 1WU7A 4M7AC 5GANe 5CKFA 2KSSA 4EPCA 2EGAA 3T9NA 1YI2Q 1AT1B 4P71C 1Q82U 1VA7A 2EKOA 2I4MA 3OYEA 1VQ5A 4YTLA 2YT6A 2VYTA 1RACB 3RL6A 3H0FA 4CC4B 2DEQA 1QW1A 4E47A 1QWFA 1VQ6T 3S6WA 1KQ2A 2A7YA 2E3IA 2AMCA 1VQLT 2L89A 2H8HA 1X2KA 4BUGA 3L2QA 2KQWA 5KH6A 1MUZA 1WGSA 4J8OA 4F04B 4OF1A 2LX9A 1W2BP 4RTXA 4AFZC 3P8DA 4CI0C 2YRDA 2J06A 5C52B 3CC4A 2NS6A 4WI1A 1WLPB 4HCZA 4LDXA 2FPEA 2IPOB 3C95A 3HPWA 4XTZA 2LCSA 4QQGA 4WCIA 1NEBA 1KC8R 1M3BA 3MCAB 4TTVA 3VBBA 3OB9A 4PJNA 2R5MA 4HXJA 2LQKA 3JCMc 2KI7A 2KT8A 3SD4A 2CGHA 1UE9A 1K76A 1AZGB 1QWEA 4FM4B 2KROA 2QG9B 5DM7R 1NYQA 1K8AR 4CC7A 2HMAA 1VQMT 4M7AF 1JJCA 2C06A 1M1KC 4BDYA 3VS3A 4D6WA 3LGFA 1NJIC 2F2WA 3OYNA 5IHKA 5GAMd 4IIOA 5HK0A 2LCCA 2COZA 2QHVA 3NGPA 2MWOA 2ZAEA 3QXEB 2QK0A 2EYZA 2KXCA 1PYSA 1GBRA 5GMKe 6AT1B 2DRMA 1G5IA 4NL2A 1YFNA 5GMKl 5LJ5g 4M77C 1H8KA 5LJ5f 3L4GB 1B34B 2EWNA 2LTOA 2L0AA 1YBYA 3NTIA 5GAN7 1RLPC 4NOYA 2RF0A 2VV5A 3VKIA 1D1AA 4YROA 3R6OA 4B9XA 2J3MA 1ZUKA 4RDXA 2O9SA 4JLIA 2F5KA 1UJYA 2ZPFB 3CPWS 2EIFA 3RF1A 2F69A 1QVGS 1GBQA 3VS6A 3OMGA 1BU1A 1K9AA 4FT2A 3VYHB 3CD6Q 2V8JA 2W0ZA 1QKXA 4KH0B 1CKAA 5GAN5 3F70A 1TU0B 2BUDA 1NJ5A 5ELNA 3HTZA 4Z8AA 3GLXA 2CH4W 2VVKA 4HWTA 1QF6A 2OX7A 1EOVA 4CS3A 5HGQA 2HQXA 3LGLA 4M77D 1RI0A 1WA7A 5FU7C 1CSKA 3DSQA 1IZ6A 2J6FA 1Q95G 3IQLA 3MEWA 3ZFJA 3OYAA 3UF4A 3EG3A 1N27A 5IHNA 1WXTA 4M75C 3EFOB 5K1PA 1XJWB 1Y71A 1OQKA 2XDPA 4M77F 4OMQA 2MYSA 4EMGA 2HKNA 1IHWA 1EZZB 1SHGA 7AT1B 2CJ9A 1TSFA 1VIEA 2EYYA 1B76A 1QLYA 3VS1A 1AHJB 5GANh 1X6OA 3OYDA 1YHQQ 1TXQA 2D1XA 1WJSA 2RHYA 4YREA 1W66A 1YIJA 2RMOA 1QP2A 3V7SA 1Q81R 1HYOA 1KHCA 4GBQA 3EG0A 2DBMA 2DKGA 2XU8A 1JQQA 4LVIA 1J3TA 2O31A 4J9CA 3JCMW 2AKKA 4TVYA 1N9RA 4DEYA 4IUUA 1ZX6A 2WSCE 1UG1A 2I4NA 4RTYA 1JBMA 1RAFB 3CCST 1M90C 4AG1C 4RKUE 1HK9A 3I9QA 1KD1U 3A7RA 4M75D 4P72A 4WTOB 5KYUA 2D9TA 2GQVA 4EDUA 3CCEQ 4J6WA 3G4ST 3VQYA 3NPFA 1BBUA 1M1GA 3CC2T 4CS4A 4BE1A 4VUBA 1D0YA 5HCKA 5FRNA 1X54A 2DE0X 2DTIA 3CD6A 4HCCA 3FB9A 4M75F 1BYMA 1SSHA 2EYXA 4XQ3A 3SWNB 1VQOA 2B8AA 5D6XA 4F7UF 2NUTB 1Z9QA 3M58A 5IN1A 3REBB 2KYMA 2DTOA 1AEYA 2ALYA 3UH0A 1RL2A 3JCMb 5GAMj 2Q5HA 2P4TA 4OMMA 1RAIB 3UDCA 2LJ0A 4Z88A 2LNHB 3NTKA 3CMQA 1X6BA 4XTVA 3TCJA 4ZTUB 2ZPEB 4YCWA 1VUBA 4JPBW 1MMNA 4C0GA 3A1PA 4BE0A 2LDMA 4ESRA 1SRYA 1HC7A 3NEMA 3CCRA 4PK4A 1EFWA 4JUVA 2DBKA 2DF6A 5LL6S 3SFMA 1BCOA 2HAXA 3FDRA 1MMDA 4YRLA 5KYWA 3OW2P 3MF2A 2Q7EA 3QHSA 3JCMe 1LCKA 1H3ZA 3LWHA 1AOJA 2NWMA 3VRZA 2DXCA 3CPFA 5CAIA 3PCOB 1VQNQ 1WDXA 5LJ5d 2PQWA 2F2XA 2RQUA 4IUQA 1PSFA 3I55Q 1ZUUA 4Z02A 3M0QA 1I5OB 3QJYA 2QGGA 2QEXA 2Y4XA 2RA2A 2YHTA 1EQRA 4PJJA 5DY9A 4ATOA 1WHJA 1I07A 2A37A 1WX6A 3V7RA 4A4KA 2ZR2A 1BI3A 3QO7A 3VQWA 2Z0WA 1NNHA 1D1CA 4G84A 3CCLQ 2PTKA 2CT4A 3JB9I 2F2VA 4M4ZA 4ZGDB 4GLMA 1WI7A 4EX5A 3I56A 4F7UA 1B70A 2DLPA 3UA7A 4J9FA 2KXDA 3BDLA 4BE2A 1K1ZA 1ZLMA 4JLGA 2QAZA 4QVZA 2O9VA 5C53B 2BIVA 1FMWA 4M78A 1WLEA 2WACA 5CIUA 2ZIOA 2LC4A 4C5IA 3CCVT 1X55A 3HRTA 3OS1A 2X4YA 1YWPA 2E5QA 2DVEA 4E51A 1YJNQ 2CP0A 3FLGA 4H2SA 3L2WA 2DD5A 4LDWA 3CXCP 4M75G 1GGMA 1RADB 2CUBA 3CCUQ 4RTVA 2VWFA 3HXXA 2HQEA 2RHUA 5FWBA 2FB7A 3R07A 2WSFE 3RKWA 1AD5A 2C0IA 2JT4A 3PMTA 2CZ1B 2ZZDA 3LW5E 4N0AA 1X69A 1JU5C 4LDUA 1VQ9T 1WZOA 3PFSA
chains in the Genus database with same CATH topology
5LJ3g 3L42A 1YI2T 5LJ3f 4QVCA 1XQHA 5E3IA 2E12A 2V8KA 3HRKA 1YGBA 1M1KU 4H2UA 4BB7A 2BKDN 4YCUA 4XTWA 4YRIA 1NJIU 2EJFA 3V8JA 4H2WA 2E41A 4ZTFA 2CIMA 3HP9A 4P75C 3MF1A 1OI1A 5GAOr 2OTJT 2Y4YA 2PVGB 2LQ8A 3QO5A 3FIFA 2JUFA 1USYA 3HXVA 3SWNC 3NENA 5CK9A 2RHQB 3HFNA 3LYIA 5GAMf 3MEVA 2Y90A 4XK8E 4XEMA 5C6SA 2HD0A 3L4GA 1B34A 3NFCA 3MP1A 3C12A 2IY5B 1OYXA 3ME9A 2K4YA 2K5IA 3HXUA 5GAOl 2RJDA 3CPWA 2EJ9A 1QP3A 4C8QA 1QVGA 1OZ2A 4YRFA 2EYQA 3VV0A 4YRRA 2KVQG 3A74A 1SERA 4CS2A 3HY0A 5LJ5e 4OB1B 3HKSA 4ZGJB 3LX7A 5LJ5j 2ZZEA 3JCMh 3L2RA 2RB6A 2EQUA 5EG2A 3RUXA 4DA4A 2Q7GA 2E10A 3HSBA 4OMFB 3G71T 1PSEA 1VQKA 5L8RE 4XU2A 3L2VA 1KMNA 4MMLA 2ODRC 3PIPA 2ZCFB 3GNGA 1Q81C 1QVFA 3M4QA 3OSVA 4PJOA 4RMOA 3H6ZA 2YLBA 2QI2A 4P3OA 3CCQA 3PGGA 3PTAA 3OYGA 4QW2A 1BIAA 2PUKB 4P74C 2K3YA 3BFMA 3P8TA 3M5AA 4ME7A 2XGTA 3A7AA 2EJGA 4M75B 2O4XA 3E9HA 4K87A 4P73A 3HFZB 2JVVA 4UC4A 2JTMA 3MHXA 4RCCA 4RQEA 2RI3A 3QZ9B 1E1OA 4YRCA 1Y96A 1NJ2A 1UGRB 4LNSA 2EQKA 3WVDB 1NPPA 1M90U 1NZ9A 1EIFA 1RIQA 3CMET 4TWAA 4N4GA 4HVCA 3C4SA 1BKBA 5CR2A 4HT8A 2ODRD 4C5HA 3ERRA 1WPYA 1VQ8T 4AH6A 2CS7A 2KDSA 1S72T 1M8VA 4X34A 3ASKA 3M4YA 5GMKm 1Z7NA 1YHQT 4YRNA 4KBMB 4XAXB 4TQDA 1VQ7T 3KFUA 2PMEA 5LJ3d 3SWNA 3G6EA 1H4VB 2E6ZA 2D6FA 3PIOA 1YITA 4P3PA 2LVMA 3JB9J 1X75C 3UFGA 2FHDA 3CCMA 2OTLT 4OGEA 2ZTGA 2P0LA 2RHSA 3M9QA 3JSCA 2XICA 2E65A 1E24A 4IUPA 1NPRA 2EFIA 2K3XA 2GFUA 4XTYA 1BI1A 4PLIA 5AYFA 3M53A 3M56A 4L6V5 4B9WA 3TUPA 4M7DA 4ZTJA 3VQVA 3WVEB 3HFVA 5GAOp 5A0LA 4E7KA 3CCET 2QHUA 1KG1A 4TVRA 1EIYB 3MP8A 5CCAA 1YJ9A 4C92C 4MZTA 4LDVA 3PCOA 3META 3JB9H 4BACA 2CJBA 2ARTA 4PG3A 3EFSA 2CZ7B 3P8BB 4NL3A 3AHUA 4A4GA 5I2SA 1W2BA 1BIBA 4WJ3M 5A2QE 3QZ5B 3REXA 1ATIA 1YFSA 2GCXA 1G5VA 1HXDA 2RK1A 4OGCA 4EMHA 4IUTA 3GOXA 1UGQB 2XDBA 1VQNT 4C92D 2ZPGB 3J7AF 3JAME 3X26B 3I55T 5CKBA 2DIQA 1SETA 4WF2A 3QNEA 1YFRA 4QQ6A 2Q5IA 5IAYA 5HK3A 4M7AA 3RMSA 4EMKC 1LJOA 4P71A 3HRSA 3HXWA 3OYYA 3QTCA 4G85A 3MQZA 3CCLT 4IKFA 2QA4T 3DLLA 4XEOA 5HY6A 2ZZGA 2RD1A 3JCMV 1E22A 1NYRA 4DQ2A 3JB9D 4N4HA 3JCMX 2A3LA 2P0QA 2DIGA 2CKKA 2C8MA 1QVFS 2LRQA 2CZ0B 1KQSS 3PMIA 5GAN4 3HFOA 2DD4A 3GF5A 5FU6B 3JB9F 4X5OA 4J5YA 3OSSC 2I4OA 1VQ4T 3LWIA 5GANg 1YJNT 4L59A 3OYLA 3A8MB 1UB4A 4H02A 3JCMQ 3RERA 3BW1A 5LJ3e 3CCUT 4HWSA 4KUIA 1FXXA 5LJ3j 1K9MC 3QG1A 2XD0A 3HRUA 2QQ9A 3FC3A 4YDQA 1JRIA 3CC7A 1B7YB 3PNWC 2X35A 1VQKT 1K73C 3ICAA 2ZCEA 2ZT7A 3G1ZA 1XOVA 4ZTZB 1VQPA 3N5BB 1KQ1A 2K2VA 2PU9B 4P5NA 4CH6A 2DXTA 5A0GA 5GAMe 3QYHB 3OBYA 4M77A 2DZCA 2LCLA 3FEOA 4YRSA 3QO8A 4BI4A 4XU1A 4M78D 3A5ZB 3A8HB 2DPPB 2DU5A 1YJWT 3IKLA 4C92G 3E9GA 3DLMA 1E1TA 1FX7A 4LVJA 5GMKh 1ADJA 3UPUA 4UP7A 2LT4A 4JDSA 1Q81U 2QHSA 1V29B 2A8EA 4H2YA 2P0PA 2AHJB 1VQ5T 3BDUA 1VQ6A 1JJCB 5GAOq 3L1AA 1IL2A 1VQLA 4OB3B 3RKYA 3OYBA 11ASA 3JB9G 3OS2A 2DK3A 2X4JA 3X20B 2V8IA 2VUBA 4K86A 1H4TA 4K88A 2DU7A 3UT1A 4M75A 3HXZA 3CC4T 2KY9A 3HFZA 4HT9A 2O01E 1YITT 1W2BS 5F5WA 4EO4A 2M1HA 3RKXA 3DB4A 4ZGEB 3OYHA 4A54A 2DXUA 4TVAB 3P8VA 3C94A 4JS5A 5I2MA 1VQMA 1KC8C 5KCOA 2NLUA 3IG2A 1IREB 2R58A 2I4LA 3OW2A 2DXBA 2GF7A 2L5QA 2ZZFA 1K8AC 5FU6C 1YCYA 2RJFA 2M16A 4RG2A 5GAOm 3E9FA 4C92E 4C0DC 2ZPBB 3J80E 3OMCA 3UGTA 2RHXA 4R55A 2MF2A 3QJ6A 5GANd 2ZINA 2XDDA 3NTHA 3KXTA 3HY1A 1SSFA 3LSSA 4TQFA 3HL8A 1N8RC 4M78G 4E7JA 1XTDA 4ZN1A 4JRQA 3NETA 5GMKi 3LSQA 2HBPA 5CO7A 1ASYA 4BWAA 2FYKA 4C5EA 3OYCA 4HA8A 2H3JA 1UGPB 4PNOA 1EIYA 1I81A 2RJEA 4LVMA 4UP9A 3GPLA 1C0AA 1X2GA 3P8YA 3OYFA 3KUFA 1VQZA 4XU0A 3V8KA 1Z7MA 4H2TA 4PL6A 2I2LA 2VXFA 3OD1A 3OBWA 1H4QA 4C92B 5GAMh 3CXCA 3Q1JA 3WXMB 4NCXA 2R5AA 3MEAA 2MWPA 1GXIE 4YRJA 2JZ2A 1U1TA 4MZMA 4BI3A 2RM4A 2RO0A 2KAFA 2DAQA 2JTFA 2YRVA 2FVUA 2XTIA 4OVAA 4A4HA 2L3RA 1J5WA 1R8OB 5GAN6 4Y91A 2ALYB 5KE2A 4X9CA 1YIJT 1LYLA 3JCMg 4HT4A 2PMFA 2G3RA 1WJRA 2RI2A 5KNNA 4NS5A 2E64A 4J7IA 3WQZA 3CCSA 2VC8A 2DQ3A 2QQSA 2E1HA 2K5LA 5GAN3 1KQSA 3HHTB 3GIBA 1L0WA 2ARUA 1X2HA 5D6YA 3G4SA 4C8QG 4M78E 4CRIA 2G4CA 3CC2A 1N9SA 2AKWB 2RHIA 4EMKB 2YLCA 5J26A 2GFAA 2VXEA 4R56A 3CD6T 1TH7A 4Y28E 3A32A 3VQXA 3H8ZA 3TU4K 4E7HA 4KQEA 3OYIA 3TEHB 1VQOT 1MHNA 3QUIA 3LH0A 2QQAA 5GAOn 5D6WA 2JOYA 4E7IA 4JJNK 3W3SA 1K9MU 2ZNIA 4RCBA 4PHCA 4KR2A 3M54A 4DOWA 4O2DA 1G3YA 3M59A 2EQJA 1B70B 4FT4A 4OB2B 4X9DA 1K73U 4N4IA 3OYJA 2PVOB 3CCRT 3G7ZA 4RG8A 4PJOG 3FRNA 3IKMB 4P75A 3V7CA 5GANj 1B7YA 2VGNA 4GLKA 1G3WA 4M78B 2F5TX 3REUA 2E3CA 3EFRA 1D3BB 3OW2S 1U8RA 2ZNJA 3QO3A 3ZEHA 2RK2A 4KULA 4YYEA 4FSXA 3CBPA 4QVDA 2QEXT 2DZ9A 4YRMA 4XU3A 2DJZA 4FU6A 2MI6A 2IG0A 2XG8D 3OS0A 3A5ZA 3OYMA 3V8LA 1I5LA 4J6XA 3I56T 4MDWA 2JN0A 2JNGA 3GNFB 4M7AD 4C8QE 2DTHA 3CCVA 1ADYA 4YPFA 3SDZA 4P72C 1EVLA 1EVKA 1W4SA 4V2SA 3X24B 1N9WA 2XK0A 1M4ZA 3CCJA 4HWOA 5FRMA 3A31A 2E6NA 3VUBA 1SESA 2MAMA 2CJAA 3JCMJ 3RMQA 5LJ5h 2ZT6A 2ZT8A 5GMKj 3CXCS 1VQ9A 4Q5WA 3X28B 2PVDB 4LD9K 2ZXFA 1H641 2E70A 3M55A 2RH2A 1YI2A 2P5IA 3VU3C 4II1A 4M7DG 4PJOE 4MZPA 3L2UA 1Q86U 4P74A 3I7FA 1KC8U 4JRIA 4C8QB 3QIIA 3JCMd 3M4PA 4Q6GA 2D0QB 3QPHA 3ZBDA 4TVAA 1FYFA 3CMAA 4BW9A 2WSEE 4ELZC 5FROA 5GAN8 4KUDK 5J39A 2ZR3A 4J83A 3A8OB 4MDXA 2OTJA 4C92F 1K8AU 3MEUA 2DO3A 2HNIA 1X01A 3VUZA 4OP0A 3MO8A 4BDZA 2XKOC 4DOVA 1JJ2A 5CQXA 2RJCA 1Q7YC 2MMPA 2RI5A 1N8RU 3X25B 1QVPA 5KE3A 4PJOB 2LT1A 2ZIMA 1WNLA 2QQBA 4A53A 5DLOA 2Q7HA 4QQDA 1QE0A 4C0DB 2M9UA 4H2XB 5GANf 3LC0A 2K5FA 3QYGB 3A7UA 4J7FA 1U1SA 1LOJA 1M9SA 5KCHA 2O4XB 4M78C 5C0MA 4M7AG 4LDYA 2R57A 1BI0A 2XIDA 1Y96B 3G71A 1XNIA 2ARSA 4JRKA 1KHIA 1ZHIA 2QQRA 2RHQA 1NJ6A 5ELOA 2QXFA 4XTUA 4BY6B 3HXYA 3O8VA 4M7DE 3PZCA 4C92A 2DQ0A 5FLXE 3OQ5A 4ELYC 1Q82C 3UGQA 4MMKA 2IY5A 4N0AC 1ASZA 2AMCB 3JCMP 1H4SA 3CCQT 2CZ6B 2FL7A 4Q15A 2PUOB 4RMFA 3MP6A 2P0KA 2E5AA 4YRPA 4JS4A 4C5GA 4KR3A 4JRPA 1I4K1 3OY9A 5J3BA 5CKHA 2KK4A 1B8AA 2RHSB 1UEBA 1O9SA 4L5GA 4M78F 1NE8A 4FL6A 1NJ8A 3CMEA 2ZT5A 1WQ7A 1ZBXA 3A5YA 1WQWA 1USYC 4M7DB 1VQ8A 1S72A 1LNXA 1HTTA 3TREA 5CKDA 1G51A 1JB0E 4OLFA 3QDRB 2AKWA 4CH5A 1YHQA 4EMKA 2EAYA 1PYSB 12ASA 4M77G 4E7LA 1VQ7A 4C8QC 1Y7XA 4M7AE 4C0FA 4J15A 3TEHA 3G6ET 1X56A 2M0OA 3KBGA 2OTLA 4A4FA 3CCMT 2LNVA 5DLQE 3GP8A 3TEEA 2KMTA 4PLLA 2ZGWA 3OA6A 4UP8A 4ZIBA 1Q86C 4CH4A 3CCEA 1M5Q1 3RGLA 2L8DA 1UGSB 5HKCA 2ZPIB 3INZA 1VIFA 4WJ4A 2C7IA 2QDYB 1YJ9T 3QKJA 3BY7A 4PJOC 1FWZA 5CVIA 2XHCA 4OB0B 4C0ZA 4HKEA 3VYGA 4YRKA 3L2ZA 1N6AA 4C8QD 3OS5A 4HWRA 1D3BA 4M7AB 4CH3A 3CCJT 5GAN2 4YP0A 4BI8B 4F7UG 2EL9A 1YB3A 4C8QF 1KOGA 1JJ2S 2DDZA 4TVWA 4P73C 1OZ3A 3E1SA 4XTXA 5LJ3h 3LLRA 4BD3A 4YRTA 1MGQA 3UWNA 1YFTA 1VQNA 3M4GA 3IALA 4BY6C 3S3MA 4HWPA 3CBMA 2J3LA 3I55A 4M77E 3CMAT 4PJOD 3A8LB 3FJPA 3OYKA 4LD6A 3VJPA 5K1XA 4GY5A 4O6JA 2RHZA 3M57A 4PJOF 3CCLA 2QA4A 3J81E 3A8GB 3URGA 4PKCC 3CBOA 5GAMg 3DKMA 3BJUA 4J6YA 3TEGA 4YRGA 5CQYA 2CYZB 3MEYA 5M9OA 1KD1C 3S3NA 2EQMA 3ER0A 5IT9E 5A0DA 1G5HA 4DPGA 1P92A 3EAEA 4H2VA 1VQ4A 3QSUA 1YJNA 4M7DC 1BI2A 1O75A 4M77B 1Y07A 3JCMf 3CCUA 1BBWA 4L87A 4O5VA 4M75E 5C51B 1NJ1A 4F7UE 3CEYA 4KT0E 2QTXA 1I8FA 2K57A 5I21A 3QBYA 1G3SA 2XI9A 1Q7YU 1DJ7B 3E19A 1KMMA 4HCBA 3HRIA 1WYDA 4RQFA 3CC7T 3E9IA 4YCVA 4FIBA 4UPAA 1ZQ1A 4IUVA 1M1FA 4A4EA 1VQPT 3SB2A 4M7DD 3RIRA 3RESA 5FU7B 4LVKA 2IVWA 3P8HA 4H2XA 4ZN3A 2VGMA 3PT9A 2X4WA 3NELA 1WJQA 4P3NA 1YJWA 3DB3A 4M7DF 3JRZA 3RACA 4F7UB 2OAUA 5CKEA 4IURA 2ZPHB 2X4XA 3S3OA 4YRQA 1G3TA 4LVLA 1WU7A 4M7AC 5GANe 5CKFA 2KSSA 4EPCA 3T9NA 4P71C 1Q82U 2EKOA 2I4MA 3OYEA 1VQ5A 4YTLA 2VYTA 3RL6A 2DEQA 1QW1A 4E47A 1VQ6T 3S6WA 1KQ2A 2A7YA 2AMCA 1VQLT 2L89A 4BUGA 3L2QA 2KQWA 5KH6A 1WGSA 4J8OA 4OF1A 2LX9A 3P8DA 4CI0C 5C52B 3CC4A 2NS6A 4WI1A 4HCZA 4LDXA 3C95A 3HPWA 4XTZA 4QQGA 3MCAB 4TTVA 3VBBA 3OB9A 2R5MA 2LQKA 3JCMc 3SD4A 2CGHA 4FM4B 5DM7R 1NYQA 4M7AF 1VQMT 1JJCA 2C06A 1M1KC 4BDYA 4D6WA 3LGFA 1NJIC 3OYNA 5GAMd 5HK0A 2LCCA 2QHVA 2MWOA 3QXEB 1PYSA 5GMKe 1G5IA 4NL2A 5GMKl 5LJ5g 4M77C 5LJ5f 3L4GB 1B34B 2EWNA 2LTOA 1YBYA 3NTIA 5GAN7 4NOYA 2VV5A 3VKIA 4YROA 3R6OA 4B9XA 2J3MA 4RDXA 4JLIA 2F5KA 2ZPFB 3CPWS 2EIFA 3RF1A 2F69A 1QVGS 3OMGA 4FT2A 3VYHB 2V8JA 5GAN5 3F70A 2BUDA 1NJ5A 5ELNA 3HTZA 3GLXA 4HWTA 1QF6A 1EOVA 4CS3A 5HGQA 2HQXA 3LGLA 4M77D 1RI0A 5FU7C 3DSQA 1IZ6A 3MEWA 3ZFJA 3OYAA 1N27A 4M75C 5K1PA 1Y71A 2XDPA 4M77F 4EMGA 2CJ9A 1VIEA 1B76A 1AHJB 5GANh 1X6OA 3OYDA 1WJSA 2RHYA 4YREA 1W66A 1YIJA 1QP2A 3V7SA 1KHCA 2DKGA 2XU8A 4LVIA 3JCMW 4TVYA 1N9RA 4IUUA 2WSCE 2I4NA 1JBMA 3CCST 1M90C 4RKUE 1HK9A 1KD1U 3A7RA 4M75D 4P72A 2D9TA 2GQVA 4EDUA 4J6WA 3G4ST 3VQYA 1BBUA 1M1GA 3CC2T 4CS4A 4BE1A 4VUBA 5FRNA 1X54A 2DTIA 3CD6A 4HCCA 3FB9A 4M75F 1BYMA 4XQ3A 3SWNB 1VQOA 2B8AA 5D6XA 4F7UF 3M58A 5IN1A 2DTOA 2ALYA 3UH0A 1RL2A 3JCMb 5GAMj 2Q5HA 2P4TA 3UDCA 3NTKA 3CMQA 4XTVA 3TCJA 4ZTUB 2ZPEB 4YCWA 1VUBA 4C0GA 4BE0A 2LDMA 1SRYA 1HC7A 3NEMA 3CCRA 1EFWA 4JUVA 5LL6S 3SFMA 2HAXA 3FDRA 4YRLA 3MF2A 2Q7EA 3QHSA 3JCMe 1H3ZA 3LWHA 2DXCA 3CPFA 5CAIA 3PCOB 5LJ5d 2PQWA 4IUQA 1PSFA 4Z02A 3QJYA 2QEXA 2Y4XA 2RA2A 2YHTA 1EQRA 5DY9A 4ATOA 4A4KA 3QO7A 2ZR2A 3V7RA 3VQWA 1BI3A 1NNHA 4G84A 3JB9I 4ZGDB 4EX5A 3I56A 4F7UA 1B70A 4BE2A 3BDLA 4JLGA 4QVZA 5C53B 2BIVA 4M78A 1WLEA 2WACA 5CIUA 2ZIOA 2LC4A 4C5IA 3CCVT 1X55A 3HRTA 3OS1A 2X4YA 2E5QA 2DVEA 4E51A 3FLGA 4H2SA 3L2WA 2DD5A 4LDWA 4M75G 1GGMA 3HXXA 2HQEA 2RHUA 2FB7A 3R07A 2WSFE 3RKWA 3PMTA 2CZ1B 2ZZDA 3LW5E 4N0AA 4LDUA 2QHTA 1VQ9T 3PFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RES A;  5LJ3 g;  2P5I A;  4M77 A;  2DZC A;  3VU3 C;  4YRS A;  4M7D G;  3QO8 A;  4PJO E;  4H2X A;  5LJ3 f;  4P74 A;  4QVC A;  3I7F A;  3NEL A;  5E3I A;  4JRI A;  4P3N A;  4C8Q B;  4XU1 A;  4M78 D;  3JCM d;  3M4P A;  4M7D F;  4Q6G A;  2DU5 A;  3HRK A;  1YGB A;  4TVA A;  4H2U A;  1FYF A;  3RAC A;  4BW9 A;  3IKL A;  4F7U B;  4YCU A;  4XTW A;  4YRI A;  2EJF A;  3V8J A;  5GAN 8;  4H2W A;  4C92 G;  4YRQ A;  2E41 A;  2CIM A;  2ZR3 A;  1E1T A;  5GMK h;  1ADJ A;  1WU7 A;  4P75 C;  4M7A C;  4UP7 A;  5GAN e;  3MF1 A;  5GAO r;  4C92 F;  4P71 C;  2QHS A;  4H2Y A;  3QO5 A;  2I4M A;  2HNI A;  3FIF A;  1X01 A;  1USY A;  3BDU A;  1JJC B;  3HXV A;  3RL6 A;  3SWN C;  5GAO q;  2DEQ A;  4OP0 A;  3NEN A;  3L1A A;  1IL2 A;  1KQ2 A;  2RHQ B;  3HFN A;  5GAM f;  2AMC A;  3RKY A;  2Y90 A;  11AS A;  3JB9 G;  4XEM A;  3L4G A;  1B34 A;  4PJO B;  2ZIM A;  2IY5 B;  4K86 A;  3HXU A;  5GAO l;  1WNL A;  1H4T A;  5C52 B;  2EJ9 A;  4K88 A;  4WI1 A;  4C8Q A;  2DU7 A;  4XTZ A;  4A53 A;  4M75 A;  3HXZ A;  4YRF A;  2ZXF A;  4YRR A;  3HFZ A;  3A74 A;  2Q7H A;  4HT9 A;  1QE0 A;  1SER A;  4CS2 A;  4H2X B;  3HY0 A;  5GAN f;  4TTV A;  3LC0 A;  3VBB A;  5LJ5 e;  5F5W A;  3A7U A;  4EO4 A;  5LJ5 j;  3RKX A;  1U1S A;  1LOJ A;  4M78 C;  3JCM c;  2ZZE A;  4A54 A;  2DXU A;  4TVA B;  3JCM h;  2RB6 A;  4M7A G;  3P8V A;  2CGH A;  3RUX A;  1Y96 B;  2Q7G A;  2ARS A;  2E10 A;  1NYQ A;  4JRK A;  3HSB A;  4M7A F;  1JJC A;  2RHQ A;  1NJ6 A;  3IG2 A;  4XU2 A;  5ELO A;  2I4L A;  4XTU A;  1KMN A;  4MML A;  3HXY A;  5GAM d;  2ODR C;  4M7D E;  3PZC A;  4C92 A;  2QHV A;  2DQ0 A;  1PYS A;  3M4Q A;  2ZZF A;  5GMK e;  4PJO A;  1YCY A;  3UGQ A;  4MMK A;  2IY5 A;  1G5I A;  2YLB A;  4N0A C;  4NL2 A;  1ASZ A;  2AMC B;  5GMK l;  4P3O A;  5LJ5 g;  5GAO m;  3PGG A;  3JCM P;  4M77 C;  1H4S A;  4C92 E;  5LJ5 f;  3L4G B;  4Q15 A;  1B34 B;  1BIA A;  2EWN A;  4P74 C;  4RMF A;  3UGT A;  3BFM A;  3P8T A;  5GAN 7;  2E5A A;  2XGT A;  3A7A A;  5GAN d;  4YRP A;  2EJG A;  4NOY A;  4M75 B;  2ZIN A;  3E9H A;  4K87 A;  4KR3 A;  4P73 A;  4YRO A;  4TQF A;  3HY1 A;  3LSS A;  3HFZ B;  2J3M A;  1I4K 1;  4RCC A;  4RDX A;  4M78 G;  4RQE A;  4JLI A;  3NET A;  1E1O A;  5GMK i;  3LSQ A;  1Y96 A;  4YRC A;  1B8A A;  2RHS B;  1ASY A;  1NJ2 A;  4BWA A;  2FYK A;  4LNS A;  4M78 F;  3RF1 A;  4HA8 A;  1NJ8 A;  2ZT5 A;  1WQ7 A;  4PNO A;  3A5Y A;  1RIQ A;  1EIY A;  1I81 A;  1WQW A;  4TWA A;  4HVC A;  4UP9 A;  4HT8 A;  1USY C;  2ODR D;  4M7D B;  5GAN 5;  3ERR A;  1C0A A;  1WPY A;  1NJ5 A;  1X2G A;  5ELN A;  3HTZ A;  3P8Y A;  1VQZ A;  4AH6 A;  1LNX A;  4XU0 A;  3V8K A;  1Z7M A;  1HTT A;  4H2T A;  1M8V A;  4HWT A;  2VXF A;  2I2L A;  1EOV A;  1QF6 A;  3OD1 A;  4CS3 A;  5HGQ A;  1G51 A;  4M77 D;  5GMK m;  4OLF A;  1Z7N A;  1H4Q A;  4C92 B;  5GAM h;  2AKW A;  3DSQ A;  4CH5 A;  4EMK A;  4NCX A;  2EAY A;  1PYS B;  12AS A;  4M77 G;  4YRN A;  4YRJ A;  4C8Q C;  4TQD A;  3KFU A;  1U1T A;  4M75 C;  2PME A;  5K1P A;  5LJ3 d;  3SWN A;  4M7A E;  4J15 A;  1H4V B;  4M77 F;  3TEH A;  4EMG A;  1X56 A;  2RM4 A;  4P3P A;  3JB9 J;  3UFG A;  2CJ9 A;  2ZTG A;  2P0L A;  1B76 A;  2RHS A;  2XTI A;  2E65 A;  1E24 A;  5GAN h;  1J5W A;  2ZGW A;  5GAN 6;  4UP8 A;  4YRE A;  4ZIB A;  4XTY A;  1W66 A;  4Y91 A;  2ALY B;  4CH4 A;  3V7S A;  4X9C A;  3TUP A;  4M7D A;  1LYL A;  3JCM g;  1M5Q 1;  3VQV A;  2PMF A;  2DKG A;  3RGL A;  3HFV A;  5GAO p;  2QHU A;  3INZ A;  3JCM W;  1EIY B;  5KNN A;  4WJ4 A;  4TVY A;  1N9R A;  2C7I A;  4C92 C;  2E64 A;  3WQZ A;  2I4N A;  2VC8 A;  2DQ3 A;  1JBM A;  2E1H A;  3BY7 A;  4PJO C;  3PCO A;  3JB9 H;  1HK9 A;  2CJB A;  4YRK A;  2ART A;  3L2Z A;  5GAN 3;  4C8Q D;  3A7R A;  3GIB A;  4M75 D;  4HWR A;  1L0W A;  4P72 A;  1D3B A;  2ARU A;  1X2H A;  4PG3 A;  4M7A B;  4CH3 A;  4C8Q G;  4M78 E;  4J6W A;  2G4C A;  3VQY A;  3EFS A;  1N9S A;  1BBU A;  2AKW B;  4NL3 A;  4EMK B;  5GAN 2;  4YP0 A;  4CS4 A;  4F7U G;  1X54 A;  2DTI A;  2EL9 A;  1YB3 A;  3AHU A;  4C8Q F;  1KOG A;  2YLC A;  3FB9 A;  2VXE A;  4M75 F;  4XQ3 A;  1TH7 A;  2DDZ A;  3A32 A;  3SWN B;  4P73 C;  4TVW A;  3VQX A;  4XTX A;  4F7U F;  4KQE A;  5LJ3 h;  1BIB A;  3TEH B;  3QUI A;  4WJ3 M;  3REX A;  1ATI A;  5GAO n;  1YFS A;  2DTO A;  2ALY A;  3UH0 A;  1HXD A;  3JCM b;  5GAM j;  2Q5H A;  3W3S A;  4EMH A;  4YRT A;  2ZNI A;  1MGQ A;  1YFT A;  3CMQ A;  4XTV A;  3M4G A;  4RCB A;  4PHC A;  3IAL A;  4KR2 A;  4ZTU B;  4HWP A;  2J3L A;  4O2D A;  4YCW A;  4C92 D;  1B70 B;  4M77 E;  4X9D A;  4PJO D;  1SRY A;  1HC7 A;  3NEM A;  1EFW A;  4JUV A;  1SET A;  3QNE A;  4WF2 A;  3FJP A;  1YFR A;  2Q5I A;  4PJO G;  4YRL A;  3IKM B;  3MF2 A;  2Q7E A;  5K1X A;  3QHS A;  4P75 A;  3V7C A;  3JCM e;  5GAN j;  4M7A A;  1B7Y A;  4M78 B;  4EMK C;  1LJO A;  4P71 A;  4PJO F;  5CAI A;  3HXW A;  3PCO B;  3QTC A;  4G85 A;  3REU A;  2E3C A;  5LJ5 d;  3EFR A;  4XEO A;  2ZZG A;  5GAM g;  1D3B B;  2RD1 A;  2ZNJ A;  3QO3 A;  3BJU A;  3JCM V;  1E22 A;  4J6Y A;  1NYR A;  3TEG A;  4YRG A;  4DQ2 A;  3JB9 D;  3JCM X;  1EQR A;  2YHT A;  2RA2 A;  3MEY A;  4YYE A;  2C8M A;  4QVD A;  2DZ9 A;  5DY9 A;  4YRM A;  4XU3 A;  2DJZ A;  5GAN 4;  3HFO A;  3QO7 A;  2ZR2 A;  3V7R A;  3VQW A;  1NNH A;  1G5H A;  4G84 A;  4DPG A;  3JB9 F;  4X5O A;  4H2V A;  4J5Y A;  3QSU A;  2I4O A;  3JB9 I;  3A5Z A;  4M7D C;  5GAN g;  3V8L A;  4EX5 A;  4M77 B;  4F7U A;  1B70 A;  1I5L A;  4J6X A;  2JN0 A;  3JCM f;  4M7A D;  1BBW A;  4C8Q E;  4H02 A;  4L87 A;  3JCM Q;  3RER A;  3BW1 A;  4M75 E;  5LJ3 e;  4HWS A;  5C53 B;  2DTH A;  5LJ3 j;  5C51 B;  4M78 A;  1NJ1 A;  1WLE A;  4F7U E;  2QTX A;  1I8F A;  2ZIO A;  2K57 A;  5I21 A;  1ADY A;  4YPF A;  1X55 A;  4YDQ A;  4P72 C;  1EVL A;  1KMM A;  2DVE A;  1JRI A;  4V2S A;  1EVK A;  4E51 A;  3HRI A;  1WYD A;  4H2S A;  1B7Y B;  4RQF A;  1N9W A;  3E9I A;  4YCV A;  4HWO A;  4M75 G;  3A31 A;  1GGM A;  3ICA A;  1SES A;  2CJA A;  3JCM J;  3HXX A;  2ZCE A;  2ZT7 A;  5LJ5 h;  2ZT6 A;  2FB7 A;  3R07 A;  4UPA A;  3RKW A;  3G1Z A;  4ZTZ B;  2ZT8 A;  5GMK j;  1KQ1 A;  4N0A A;  4CH6 A;  2DXT A;  3SB2 A;  4M7D D;  2QHT A;  5GAM e;  1H64 1;  3RIR A; 
#chains in the Genus database with same CATH topology
 3M0R A;  5LJ3 g;  1VQK Q;  3L42 A;  2LJ1 A;  1YI2 T;  3QWY A;  5LJ3 f;  4QVC A;  1PG5 B;  1XQH A;  4D8K A;  5E3I A;  2E12 A;  1W6X A;  1WHK A;  2V8K A;  3HRK A;  1YGB A;  1M1K U;  2NUP A;  4H2U A;  4J9D A;  4PFZ A;  4BB7 A;  2BKD N;  4YCU A;  4XTW A;  4FCY A;  4YRI A;  1NJI U;  4LXC A;  2EJF A;  4OML A;  3V8J A;  4H2W A;  3NMZ C;  2E41 A;  4ZTF A;  2CIM A;  3HP9 A;  4P75 C;  1K0X A;  3THK A;  3MF1 A;  1OI1 A;  5GAO r;  1G2B A;  2OTJ T;  1Q7Y R;  5FW9 A;  1Y0M A;  2Y4Y A;  2NYS A;  2PVG B;  2LQ8 A;  1Z9Z A;  3QO5 A;  1ZSZ A;  3FIF A;  3LH5 A;  1YJW Q;  2E5K A;  2JUF A;  1USY A;  3HXV A;  1SRM A;  3SWN C;  2EW3 A;  3NEN A;  1HD3 A;  2YUQ A;  5CK9 A;  2RHQ B;  4LE9 A;  3HFN A;  5KYY B;  3LYI A;  5GAM f;  4PFP A;  3O5Z A;  1E6G A;  2LZ6 B;  3MEV A;  2Y90 A;  4XK8 E;  4XEM A;  2RQT A;  5C6S A;  2JXB A;  2HD0 A;  2GBQ A;  3L4G A;  1B34 A;  2AZS A;  3NFC A;  3MP1 A;  2CP5 A;  3C12 A;  2IY5 B;  1OYX A;  3ME9 A;  2K4Y A;  2K5I A;  3HXU A;  5GAO l;  1BB9 A;  2RJD A;  3CPW A;  2EJ9 A;  1VQ5 Q;  2RQV A;  1QP3 A;  4C8Q A;  4DBQ A;  5I11 A;  1QVG A;  1OZ2 A;  4RTZ A;  4YRF A;  2EYQ A;  3VV0 A;  4YRR A;  2KVQ G;  2KNB B;  3A74 A;  1SER A;  4CS2 A;  3HY0 A;  2YUO A;  2CP2 A;  5LJ5 e;  4OB1 B;  1IXD A;  1IO6 A;  1TWB A;  3HKS A;  4ZGJ B;  3LX7 A;  5LJ5 j;  2GGR A;  2ZZE A;  3JCM h;  3L2R A;  2RB6 A;  2FRW A;  2EQU A;  1V1C A;  5EG2 A;  3RUX A;  1IB8 A;  3BE3 A;  4DA4 A;  1OX9 A;  2Q7G A;  3CC4 Q;  4J9I A;  2E10 A;  3G6E Q;  3HSB A;  4OMF B;  5L23 A;  3G71 T;  2QTV A;  2CP3 A;  1I0C A;  1YIT Q;  1PSE A;  1VQK A;  5L8R E;  2MOX A;  4XU2 A;  1TG0 A;  4FYX B;  3L2V A;  3CCM Q;  4MML A;  1KMN A;  3SEM A;  2A0F B;  3H0I A;  2ODR C;  3M0T A;  2ZCF B;  3PIP A;  3GNG A;  2MK5 A;  2YDL A;  1Q81 C;  1QVF A;  3M4Q A;  3OSV A;  4PJO A;  4RMO A;  3H6Z A;  2YLB A;  2QI2 A;  4P3O A;  3CCQ A;  3PGG A;  3PTA A;  1PWT A;  3OYG A;  4QW2 A;  3VS5 A;  2QGF B;  1BIA A;  2PUK B;  4P74 C;  2K3Y A;  2W10 A;  3BFM A;  3P8T A;  3M5A A;  1YP5 A;  4ME7 A;  1WXB A;  2XGT A;  1OOT A;  3A7A A;  2ED1 A;  2EJG A;  4M75 B;  2FZC B;  2O4X A;  3E9H A;  4K87 A;  4P73 A;  3HFZ B;  1FMV A;  2JVV A;  1MV0 B;  2JTM A;  4UC4 A;  3MHX A;  4RCC A;  2YUN A;  8AT1 B;  4RQE A;  4AMC A;  5I22 A;  2RI3 A;  3QZ9 B;  2RQW A;  1E1O A;  4YRC A;  1Y96 A;  1NM7 A;  4QT7 A;  4RTW A;  2GTO A;  3H0H A;  1NJ2 A;  1UGR B;  4KRT A;  4Y92 A;  4LNS A;  2EQK A;  3WVD B;  1NPP A;  1M90 U;  3H9N A;  1NZ9 A;  1EIF A;  1T3S A;  3CME T;  1RIQ A;  4TWA A;  1NYG A;  4N4G A;  4JZ4 A;  4HVC A;  3C4S A;  1BKB A;  5CR2 A;  4HT8 A;  2ODR D;  1SEM A;  1WYX A;  4C5H A;  3ERR A;  1PCX A;  1R0B G;  1WPY A;  1VQ8 T;  4AH6 A;  2CS7 A;  2KDS A;  1S72 T;  1M8V A;  1NLO C;  4X34 A;  2JTE A;  1GCQ A;  1B07 A;  3ASK A;  3M4Y A;  1UGV A;  1PRM C;  2BZY A;  3GBQ A;  5GMK m;  1PD1 A;  1Z7N A;  2K7A A;  1YHQ T;  1B3Q A;  4YRN A;  2AZV A;  4KBM B;  1SRL A;  4XAX B;  4TQD A;  1VQ7 T;  2CDT A;  3KFU A;  2PME A;  5LJ3 d;  3SWN A;  3G6E A;  1H4V B;  2E6Z A;  1Q86 R;  3PIO A;  2D6F A;  1YIT A;  4P3P A;  2LVM A;  2DYB A;  3JB9 J;  1X75 C;  3UFG A;  2FHD A;  2COY A;  3CCM A;  2OTL T;  4OGE A;  2D8J A;  1PKT A;  2ZTG A;  2P0L A;  2RHS A;  3M9Q A;  3E2U A;  3JSC A;  2XIC A;  2E65 A;  1E24 A;  1JXM A;  3U23 A;  4IUP A;  1NPR A;  2EFI A;  2K3X A;  2GFU A;  3H41 A;  4XTY A;  1BI1 A;  4PLI A;  5AYF A;  2ESW A;  3M53 A;  3M56 A;  2DFU A;  3MJX A;  4L6V 5;  4B9W A;  3TUP A;  4M7D A;  4HVU A;  4ZTJ A;  3VQV A;  3WVE B;  3HFV A;  5GAO p;  5A0L A;  4E7K A;  3CCE T;  2QHU A;  1SKU B;  1KG1 A;  1WXU A;  5IXF A;  4TVR A;  1EIY B;  3MP8 A;  1M2V B;  5CCA A;  1YJ9 A;  1LVK A;  4C92 C;  5KYX A;  4MZT A;  2LMJ A;  1RAH B;  4LDV A;  1Y57 A;  3I5R A;  3PCO A;  3MET A;  3JB9 H;  4BAC A;  2CJB A;  1ZBJ A;  2ART A;  5IXB A;  1JJ2 P;  1YIJ Q;  2JM9 A;  2DEU A;  1N8R R;  2EPD A;  4PG3 A;  2K6D A;  3EFS A;  2CZ7 B;  3P8B B;  4NL3 A;  2SEM A;  2MIO A;  3AHU A;  1VYT A;  4K11 A;  4A4G A;  5I2S A;  1W2B A;  1TTH B;  1BIB A;  4WJ3 M;  2VB6 A;  2ROL A;  5A2Q E;  3C0C A;  3QZ5 B;  3REX A;  1X6G A;  2YRC A;  1ATI A;  1D1B A;  2GCX A;  2IIM A;  1G5V A;  1YFS A;  3TVT A;  1QKW A;  1BCM A;  2AIR B;  1A0N B;  1HXD A;  2DA9 A;  3HTR A;  5IH2 A;  2RK1 A;  4OGC A;  4EMH A;  4IUT A;  4AFQ C;  1X43 A;  3GOX A;  1UGQ B;  2HL3 A;  4LN2 A;  2HBW A;  2XDB A;  2AT1 B;  1VQN T;  2QDL A;  4C92 D;  1EFN A;  2ZPG B;  1RUW A;  3J7A F;  1SF9 A;  3JAM E;  1VQO Q;  3X26 B;  3I55 T;  1PRL C;  1VQP Q;  5CKB A;  2DIQ A;  4E2F B;  4WF2 A;  4DBH A;  1SET A;  3QNE A;  1YFR A;  4QQ6 A;  2Q5I A;  1WFW A;  1S1N A;  5IAY A;  5HK3 A;  3PVL A;  4M7A A;  1KD1 R;  3RMS A;  4EMK C;  1LJO A;  4F14 A;  4P71 A;  1U06 A;  3HRS A;  3HXW A;  3OYY A;  3QTC A;  4G85 A;  1I1J A;  3ULR B;  4RTT A;  4JZ3 A;  3MQZ A;  2HSE B;  3CCL T;  4IKF A;  2QA4 T;  3DLL A;  4AFS C;  4XEO A;  5HY6 A;  2ZZG A;  2RD1 A;  4LUD A;  2LQW A;  3JCM V;  1E22 A;  1NYR A;  4J9B A;  4DQ2 A;  3JB9 D;  4N4H A;  3JCM X;  3CCR Q;  2A3L A;  2P0Q A;  2BZ8 A;  2CKK A;  2DIG A;  2C8M A;  3EG9 A;  1QVF S;  1JEG A;  2LRQ A;  2CZ0 B;  1KQS S;  3PMI A;  2KRM A;  3HFO A;  5GAN 4;  2DD4 A;  4LNP A;  2ROT A;  2EQI A;  3GF5 A;  5FU6 B;  3JB9 F;  4X5O A;  4J5Y A;  3OSS C;  2RNA A;  2I4O A;  1VQ4 T;  3LWI A;  5GAN g;  1YJN T;  4L59 A;  4E7S A;  5D7U A;  3OYL A;  3A8M B;  5FWC A;  2QEX Q;  5AT1 B;  1UB4 A;  4H02 A;  1TUD A;  3JCM Q;  3RER A;  3BW1 A;  5LJ3 e;  3CCU T;  4HWS A;  4KUI A;  2M51 A;  1FXX A;  5LJ3 j;  1K9M C;  2G6F X;  2J7I A;  3QG1 A;  2V26 A;  2XD0 A;  3HRU A;  2QQ9 A;  2JJ9 A;  3FC3 A;  1TOV A;  1YN8 A;  4YDQ A;  1UJ0 A;  1JRI A;  3CC7 A;  1B7Y B;  3PNW C;  3I56 Q;  4X1V A;  5KYY A;  1U3O A;  1G8X A;  2X35 A;  1VQK T;  2AKL A;  2SRC A;  1K73 C;  2OAW A;  3ICA A;  1BBZ A;  3TSW A;  3EGU A;  2X9H A;  5ECA A;  2ZCE A;  2ZT7 A;  1KSW A;  2EVR A;  2V1Q A;  3G1Z A;  1XOV A;  4ZTZ B;  1VQP A;  3N5B B;  1KQ1 A;  2K2V A;  2PU9 B;  2CH4 A;  4P5N A;  4CH6 A;  2DXT A;  5A0G A;  2D0N A;  3QYH B;  5GAM e;  2YWW A;  3OBY A;  4M77 A;  2DZC A;  2LCL A;  3FEO A;  4YRS A;  3QO8 A;  4BI4 A;  1AWO A;  3VRY A;  4XU1 A;  2CUD A;  4M78 D;  4HVW A;  4IIM A;  3A5Z B;  3A8H B;  2DPP B;  2DU5 A;  2VKN A;  1YJW T;  3IKL A;  4C92 G;  3E9G A;  3DLM A;  1D0X A;  1FX7 A;  1E1T A;  4LVJ A;  5GMK h;  1ADJ A;  3UPU A;  4UP7 A;  1X27 A;  1N5Z A;  2LT4 A;  4JDS A;  2L3Q A;  1T3L A;  1Q81 U;  2QHS A;  1V29 B;  2A8E A;  2GQI A;  4H2Y A;  2P0P A;  2AHJ B;  3SHW A;  1VQ5 T;  1RAG B;  3BDU A;  1ZSG A;  4QKU A;  1VQ6 A;  1JJC B;  5GAO q;  1RAE B;  3L1A A;  1IL2 A;  3M0S A;  4OMO A;  1VQL A;  1PD0 A;  4OB3 B;  1ACM B;  2ECZ A;  3D7S B;  1M27 C;  3RKY A;  3OYB A;  11AS A;  3JB9 G;  1HSQ A;  3OS2 A;  2M0Y A;  2DK3 A;  1AWX A;  2X4J A;  3X20 B;  2V8I A;  2VUB A;  1YNZ A;  4K86 A;  4FYY B;  1H4T A;  4K88 A;  2DU7 A;  2COW A;  3UT1 A;  4M75 A;  3HXZ A;  3CC4 T;  2KY9 A;  3EGD B;  1SG5 A;  3KFV A;  1G83 A;  3HFZ A;  1OV3 A;  2M02 A;  4HT9 A;  2O01 E;  1YIT T;  1W2B S;  2J6K A;  1M1K R;  4JJC A;  5F5W A;  1NJI R;  4HCK A;  4EO4 A;  2M1H A;  3RKX A;  3DB4 A;  4ZGE B;  4KH1 B;  3OYH A;  4A54 A;  2DXU A;  4TVA B;  1TUC A;  3P8V A;  3C94 A;  4J9H A;  4JS5 A;  2FPD A;  5I2M A;  3RNJ A;  1MMA A;  1VQM A;  1KC8 C;  4CC3 A;  5KCO A;  1KJW A;  2NLU A;  3IG2 A;  1IRE B;  2R58 A;  2I4L A;  3OW2 A;  2DXB A;  2GNC A;  2GF7 A;  2L5Q A;  2OJ2 A;  2ZZF A;  1K8A C;  5FU6 C;  1YCY A;  2DYI A;  2RJF A;  3I35 A;  2M16 A;  4RG2 A;  5GAO m;  3E9F A;  4C92 E;  4C0D C;  2ZPB B;  3J80 E;  2JS0 A;  3OMC A;  3UGT A;  2RHX A;  2H3E B;  4R55 A;  2VAS A;  2D8H A;  2MF2 A;  3CPW P;  3QJ6 A;  5GAN d;  1QVG P;  3CCS Q;  2ZIN A;  2XDD A;  3NTH A;  3FJ5 A;  3KXT A;  1MND A;  1SSF A;  3HY1 A;  3HL8 A;  1N8R C;  3LSS A;  4TQF A;  4M78 G;  4E7J A;  2O88 A;  1XTD A;  4ZN1 A;  2JW4 A;  4JRQ A;  3NET A;  5GMK i;  3LSQ A;  3G4S Q;  2HBP A;  5CO7 A;  1ASY A;  3CCQ Q;  4BWA A;  2FYK A;  4C5E A;  3OYC A;  3CC2 Q;  4HA8 A;  1AWJ A;  1QMC A;  2H3J A;  1UGP B;  4PNO A;  1EIY A;  1I81 A;  2RJE A;  4LVM A;  4UP9 A;  3GPL A;  2DMO A;  1C0A A;  1X2G A;  3P8Y A;  3OYF A;  3KUF A;  1VQZ A;  4XU0 A;  3V8K A;  1Z7M A;  4H2T A;  4FW2 A;  4PL6 A;  2I2L A;  2VXF A;  3OD1 A;  3OBW A;  1H4Q A;  4C92 B;  5GAM h;  3CXC A;  2NUZ A;  2V1R A;  3Q1J A;  3WXM B;  4DEX A;  4NCX A;  2R5A A;  1GRI A;  3MEA A;  2MWP A;  1GXI E;  4YRJ A;  5GJW B;  2JZ2 A;  4EIK A;  1U1T A;  1TUG B;  4MZM A;  5KYU B;  1AVZ C;  4BI3 A;  4ANJ A;  1X2Q A;  1QCO A;  2RM4 A;  2RO0 A;  2KAF A;  2DAQ A;  2JTF A;  2YRV A;  1QCN A;  3A98 A;  2KE9 A;  1GCP A;  2FVU A;  2XTI A;  4OVA A;  4A4H A;  2L3R A;  1W1F A;  1J5W A;  1R8O B;  5GAN 6;  3M0U A;  4Y91 A;  2ALY B;  4ORZ A;  1RAB B;  5KE2 A;  4X9C A;  1M90 R;  1YIJ T;  1ABQ A;  1LYL A;  3JCM g;  4HT4 A;  1Q82 R;  2PMF A;  1PKS A;  2EGE A;  2FZG B;  1PM3 A;  2G3R A;  1WJR A;  2RI2 A;  5KNN A;  4NS5 A;  2E64 A;  4J7I A;  3WQZ A;  3RR6 A;  3CCS A;  3EH2 A;  2VC8 A;  2DQ3 A;  2QQS A;  2E1H A;  3MKD A;  2K5L A;  2KYB A;  5GAN 3;  1KQS A;  3HHT B;  5KYW B;  2KRS A;  3GIB A;  2JMA A;  1L0W A;  2J05 A;  1SHF A;  2ARU A;  1X2H A;  5D6Y A;  3G4S A;  3EFO A;  2CP6 A;  4C8Q G;  4M78 E;  4CRI A;  2G4C A;  3CC2 A;  1N9S A;  2AKW B;  2RHI A;  4EMK B;  2ATC B;  3AT1 B;  2YLC A;  5J26 A;  2GFA A;  1E7O A;  2VXE A;  4R56 A;  1YJ9 Q;  2FZK B;  3CD6 T;  1TH7 A;  1R0C B;  4Y28 E;  3A32 A;  3VQX A;  2A28 A;  3H8Z A;  3TU4 K;  4E7H A;  4KQE A;  3OYI A;  3TEH B;  1VQO T;  1MHN A;  3QUI A;  2GTJ A;  3LH0 A;  4PFO A;  2QQA A;  1MMG A;  5D6W A;  5GAO n;  2L2P A;  2LX7 A;  2JOY A;  4E7I A;  4KGZ B;  4DBF A;  4JJN K;  3W3S A;  2JMC A;  3CCJ Q;  1K9M U;  2CT3 A;  2ZNI A;  2DM1 A;  4RCB A;  4PHC A;  1NG2 A;  2DL5 A;  4KR2 A;  2KEA A;  3M54 A;  4DOW A;  4O2D A;  1V76 A;  1G3Y A;  3M59 A;  2EQJ A;  3EGX B;  4AG2 C;  1B70 B;  4FT4 A;  4OB2 B;  4X9D A;  2DL4 A;  4N4I A;  3VS7 A;  1K73 U;  3OYJ A;  2PVO B;  1ZA1 B;  1WHG A;  3CCR T;  3G7Z A;  4RG8 A;  4PJO G;  3FRN A;  2HCK A;  3IKM B;  1SPK A;  4P75 A;  3V7C A;  2BZX A;  4KGX B;  5GAN j;  1B7Y A;  2VGN A;  4GLK A;  1G3W A;  4M78 B;  1VOM A;  2KBT A;  2A36 A;  1WIE A;  2DX1 A;  2X3X D;  2F5T X;  3REU A;  2E3C A;  1T0J A;  3EFR A;  2X51 A;  1D3B B;  3VS0 A;  3OW2 S;  1U8R A;  2ZNJ A;  3CMA Q;  2QAS A;  3QO3 A;  3ZEH A;  1PC0 A;  3EHQ A;  1QQJ A;  1M30 A;  2RK2 A;  4KUL A;  4R0K A;  2NUT A;  1YCS B;  2FPF A;  8ATC B;  4YYE A;  4FSX A;  2YSQ A;  3CBP A;  4QVD A;  2QEX T;  2DZ9 A;  4YRM A;  2OTJ Q;  4XU3 A;  2DJZ A;  4FU6 A;  2MI6 A;  2LJ3 A;  4RTU A;  2IG0 A;  2XG8 D;  4JJB A;  1M8M A;  1WHH A;  3OS0 A;  2FRY A;  1M2O A;  3A5Z A;  3PE0 A;  3NHN A;  3OYM A;  3V8L A;  1I5L A;  4J6X A;  2BE7 D;  3I56 T;  4MDW A;  2JN0 A;  2JNG A;  3GNF B;  4M7A D;  4C8Q E;  1UHC A;  1C6V X;  2NUP B;  2DTH A;  1F1B B;  2E4H A;  2OI3 A;  2PZ1 A;  3CCV A;  4JJD A;  2C0O A;  2QYZ A;  1ADY A;  3RBB B;  4YPF A;  1NLP C;  3SDZ A;  4P72 C;  1EVL A;  1EVK A;  1W4S A;  2EKH A;  4V2S A;  3X24 B;  1R77 A;  3EG2 A;  2CSI A;  1N9W A;  2XK0 A;  2PNI A;  1M4Z A;  3CCJ A;  4HWO A;  2CRE A;  5FRM A;  3A31 A;  2E6N A;  2HKQ B;  2C0T A;  1ZSZ B;  3VUB A;  1SES A;  2MAM A;  1YWO A;  2CJA A;  3JCM J;  3PVQ A;  3RMQ A;  5LJ5 h;  2ZT6 A;  1ARK A;  2YXY A;  1VYU A;  1WHL A;  2ZT8 A;  5GMK j;  3CXC S;  1VQ9 A;  4Q5W A;  3X28 B;  2PVD B;  3G71 Q;  4LD9 K;  4CC2 A;  1H64 1;  2ZXF A;  3EGD A;  2E70 A;  3M55 A;  3CC7 Q;  1OU9 A;  2RH2 A;  1YI2 A;  2P5I A;  1NBE B;  3VU3 C;  1IRX A;  4II1 A;  4M7D G;  4PJO E;  4MZP A;  3L2U A;  1Q86 U;  4P74 A;  2LQN A;  3I7F A;  4AFU C;  1KC8 U;  4JRI A;  4C8Q B;  3QII A;  3JCM d;  4PJM A;  3M4P A;  3JV3 A;  4Q6G A;  2D0Q B;  3QPH A;  3ZBD A;  4TVA A;  1FYF A;  3TQ7 P;  2E3H A;  3CMA A;  4BW9 A;  2WSE E;  4ELZ C;  5FRO A;  4DBR A;  5GAN 8;  4KUD K;  1OUL A;  5J39 A;  2ZR3 A;  4J83 A;  3A8O B;  4MDX A;  2OTJ A;  1OU8 A;  4C92 F;  2A08 A;  1K8A U;  3MEU A;  2DO3 A;  3VS2 A;  2KGT A;  2HNI A;  1X01 A;  3EH1 A;  3VUZ A;  3G1J A;  4OP0 A;  3MO8 A;  1D09 B;  4BDZ A;  2XKO C;  4DOV A;  1KFZ A;  1JJ2 A;  5CQX A;  2RJC A;  1Q7Y C;  4J9G A;  2MMP A;  2RI5 A;  3RDV A;  3CME Q;  1N8R U;  2MPX C;  3X25 B;  1QVP A;  5KE3 A;  4PJO B;  2LT1 A;  2ZIM A;  3TSZ A;  1U5S A;  1WNL A;  2P84 A;  1JXO A;  4RUG A;  4LUE A;  2QQB A;  4A53 A;  1VQ8 Q;  2CSQ A;  1VQ6 Q;  1S72 Q;  5DLO A;  1GFD A;  2Q7H A;  4QQD A;  1QE0 A;  3R6N A;  1VQL Q;  4C0D B;  2M9U A;  4H2X B;  5GAN f;  3LC0 A;  2K5F A;  1C0M A;  3QYG B;  3A7U A;  1NEG A;  4J7F A;  1U1S A;  1LOJ A;  1M9S A;  5KCH A;  2O4X B;  4M78 C;  3REA B;  9ATC B;  5C0M A;  2DL8 A;  4M7A G;  3M0P A;  4LDY A;  2R57 A;  1VQ7 Q;  1BI0 A;  4FW1 A;  4ZNX A;  2XID A;  1AZE A;  1Y96 B;  3G71 A;  1XNI A;  1MV3 A;  2ARS A;  4JRK A;  1KHI A;  2X3W D;  1UEC A;  1ZHI A;  2QQR A;  2MCN A;  1NJ6 A;  2RHQ A;  2OTL Q;  5ELO A;  2QXF A;  1B7T A;  4XTU A;  4BY6 B;  3HXY A;  3O8V A;  4M7D E;  3PZC A;  4C92 A;  2KRN A;  2DQ0 A;  2K9G A;  2KR3 A;  5FLX E;  1IGU A;  3OQ5 A;  4ELY C;  1Q82 C;  3UGQ A;  4MMK A;  2IY5 A;  4N0A C;  1ASZ A;  2AMC B;  1VQM Q;  1E6H A;  1K0S A;  3JCM P;  1H4S A;  3CCQ T;  2CZ6 B;  2FL7 A;  4Q15 A;  1K4U S;  2PUO B;  4RMF A;  1PHT A;  3MP6 A;  1UDL A;  2P0K A;  2E5A A;  4YRP A;  4JS4 A;  2K79 A;  4C5G A;  4KR3 A;  1FMK A;  4JRP A;  1I4K 1;  4D8D A;  4Z89 A;  2DJQ A;  3OY9 A;  5J3B A;  5CKH A;  5GJV B;  2KK4 A;  1B8A A;  2RHS B;  1UEB A;  1O9S A;  4L5G A;  2I0N A;  4M78 F;  1JO8 A;  1NE8 A;  4FL6 A;  1NJ8 A;  3CME A;  2ZT5 A;  1WQ7 A;  1ZBX A;  3A5Y A;  1ZSZ C;  1WQW A;  1USY C;  4M7D B;  2KT1 A;  1VQ8 A;  1S72 A;  4F16 A;  1LNX A;  1HTT A;  1MNE A;  3TRE A;  5CKD A;  1IGQ A;  4KGV B;  2B86 A;  5KYX B;  1G51 A;  1JB0 E;  4OLF A;  1NYF A;  3QDR B;  3VS4 A;  2AKW A;  4CH5 A;  1YHQ A;  4EMK A;  2EAY A;  1PYS B;  2L3P A;  2JM8 A;  12AS A;  2DL7 A;  4M77 G;  4E7L A;  1VQ7 A;  1H3H A;  4C8Q C;  2DER A;  1Y7X A;  4M7A E;  1UUE A;  4C0F A;  4J15 A;  3TEH A;  3G6E T;  5KYN A;  1X56 A;  1EX4 A;  2M0O A;  3KBG A;  2OTL A;  4A4F A;  4J9E A;  2DRK A;  3CCM T;  1BK2 A;  2LNV A;  1RAA B;  5DLQ E;  3TEE A;  3GP8 A;  5IHI A;  2KMT A;  4PLL A;  2LP5 A;  2ZGW A;  3OA6 A;  2QA4 Q;  1CKB A;  4PJL A;  4UP8 A;  4ZIB A;  1Q86 C;  1OEB A;  4CH4 A;  3EGX A;  4FYV B;  3CCE A;  4F17 A;  1M5Q 1;  3RGL A;  2L8D A;  1UGS B;  5HKC A;  3UAT A;  2ZPI B;  2YUP A;  3INZ A;  1OPK A;  1VIF A;  4WJ4 A;  2C7I A;  4B6M A;  1H92 A;  2QDY B;  1YJ9 T;  2L3S A;  3QKJ A;  3BY7 A;  4PJO C;  2FEI A;  1FWZ A;  5CVI A;  2XHC A;  4OB0 B;  4C0Z A;  1VQ4 Q;  2QHT A;  4HKE A;  3VYG A;  4YRK A;  3L2Z A;  1N6A A;  1RI9 A;  4C8Q D;  3OS5 A;  2CP7 A;  4HWR A;  1D3B A;  1GFC A;  2HSP A;  4M7A B;  4CH3 A;  2AK5 A;  2FO0 A;  3CCJ T;  5GAN 2;  4YP0 A;  3EG1 A;  4BI8 B;  4F7U G;  2EL9 A;  1YB3 A;  4C8Q F;  1HJD A;  5EC7 A;  1KOG A;  1AWW A;  1JJ2 S;  2DDZ A;  4TVW A;  4P73 C;  1OZ3 A;  3E1S A;  4XTX A;  5LJ3 h;  3LLR A;  4BD3 A;  3EG9 B;  1WHM A;  2FG0 A;  2ABL A;  2F1L A;  2DNU A;  4YRT A;  3EHR A;  1MGQ A;  3UWN A;  2J6O A;  1YFT A;  1VQN A;  3M4G A;  3IAL A;  1ZUY A;  4BY6 C;  3CQT A;  3S3M A;  4HWP A;  1KK7 A;  1M2V A;  3CBM A;  2J3L A;  3I55 A;  4M77 E;  3CMA T;  4PJO D;  2HZY A;  3A8L B;  2DIL A;  3FJP A;  3OYK A;  4LD6 A;  2EGC A;  1OPL A;  1GCQ C;  3VJP A;  5K1X A;  1KIK A;  3UA6 A;  2DET A;  4E6R A;  4GY5 A;  4O6J A;  2BTT A;  2RHZ A;  1LPL A;  3M57 A;  2BE9 B;  4PJO F;  3CCL A;  1GL5 A;  1ZA2 B;  2QA4 A;  1QVF P;  3QDF A;  1IHV A;  1KQS P;  3J81 E;  3A8G B;  3URG A;  4PKC C;  3CBO A;  5GAM g;  2EBP A;  3DKM A;  3BJU A;  4J6Y A;  3TEG A;  4YRG A;  1UHF A;  1VYV A;  5CQY A;  2CYZ B;  4FYW B;  3MEY A;  5M9O A;  1KD1 C;  1PNJ A;  3S3N A;  2EQM A;  2RN8 A;  3ER0 A;  1D0Z A;  3ZL7 C;  4E7Z A;  1UFF A;  5IT9 E;  4HVV A;  5A0D A;  2O2O A;  3QWX X;  1C1A A;  1G5H A;  4DPG A;  1P92 A;  3EAE A;  1ABO A;  4H2V A;  2DL3 A;  1VQ4 A;  3QSU A;  2HL5 C;  1K9M R;  1M3C A;  1YJN A;  4M7D C;  1FYN A;  2XMF A;  1BI2 A;  1O75 A;  4M77 B;  4FSS A;  1Y07 A;  3JCM f;  4A63 B;  3CCU A;  1BBW A;  4L87 A;  4O5V A;  4M75 E;  1K73 R;  5C51 B;  4OMP A;  1NJ1 A;  1W70 A;  4F7U E;  3CEY A;  4KT0 E;  1UTI A;  2RQR A;  2QTX A;  1I8F A;  2HQH A;  2K57 A;  5I21 A;  3QBY A;  1G3S A;  2XI9 A;  1Q7Y U;  4OMN A;  1DJ7 B;  2P4R A;  2HEQ A;  3E19 A;  1KMM A;  4HCB A;  3HRI A;  1WYD A;  4RQF A;  3CC7 T;  3E9I A;  4YCV A;  1QCF A;  4AT1 B;  2RPN A;  4FIB A;  2K2M A;  4UPA A;  1ZQ1 A;  4IUV A;  1M1F A;  3CCV Q;  1RLQ C;  4A4E A;  2EYW A;  1VQP T;  2JS2 A;  3SB2 A;  4M7D D;  3RIR A;  3RES A;  2HDA A;  2ENM A;  5FU7 B;  2DVJ A;  4LVK A;  2IVW A;  3P8H A;  4H2X A;  4ZN3 A;  2VGM A;  3PT9 A;  2X4W A;  3NEL A;  1WJQ A;  4P3N A;  1OX8 A;  1YJW A;  3DB3 A;  1T0H A;  4M7D F;  2K3B A;  1TS9 A;  3JRZ A;  3RAC A;  3I5S A;  4F7U B;  2OAU A;  5CKE A;  1M3A A;  4IUR A;  2ZPH B;  3MPU B;  2X4X A;  3S3O A;  4YRQ A;  2ED0 A;  1VQ9 Q;  1G3T A;  4LVL A;  1WU7 A;  4M7A C;  5GAN e;  5CKF A;  2KSS A;  4EPC A;  2EGA A;  3T9N A;  1YI2 Q;  1AT1 B;  4P71 C;  1Q82 U;  1VA7 A;  2EKO A;  2I4M A;  3OYE A;  1VQ5 A;  4YTL A;  2YT6 A;  2VYT A;  1RAC B;  3RL6 A;  3H0F A;  4CC4 B;  2DEQ A;  1QW1 A;  4E47 A;  1QWF A;  1VQ6 T;  3S6W A;  1KQ2 A;  2A7Y A;  2E3I A;  2AMC A;  1VQL T;  2L89 A;  2H8H A;  1X2K A;  4BUG A;  3L2Q A;  2KQW A;  5KH6 A;  1MUZ A;  1WGS A;  4J8O A;  4F04 B;  4OF1 A;  2LX9 A;  1W2B P;  4RTX A;  4AFZ C;  3P8D A;  4CI0 C;  2YRD A;  2J06 A;  5C52 B;  3CC4 A;  2NS6 A;  4WI1 A;  1WLP B;  4HCZ A;  4LDX A;  2FPE A;  2IPO B;  3C95 A;  3HPW A;  4XTZ A;  2LCS A;  4QQG A;  4WCI A;  1NEB A;  1KC8 R;  1M3B A;  3MCA B;  4TTV A;  3VBB A;  3OB9 A;  4PJN A;  2R5M A;  4HXJ A;  2LQK A;  3JCM c;  2KI7 A;  2KT8 A;  3SD4 A;  2CGH A;  1UE9 A;  1K76 A;  1AZG B;  1QWE A;  4FM4 B;  2KRO A;  2QG9 B;  5DM7 R;  1NYQ A;  1K8A R;  4CC7 A;  2HMA A;  1VQM T;  4M7A F;  1JJC A;  2C06 A;  1M1K C;  4BDY A;  3VS3 A;  4D6W A;  3LGF A;  1NJI C;  2F2W A;  3OYN A;  5IHK A;  5GAM d;  4IIO A;  5HK0 A;  2LCC A;  2COZ A;  2QHV A;  3NGP A;  2MWO A;  2ZAE A;  3QXE B;  2QK0 A;  2EYZ A;  2KXC A;  1PYS A;  1GBR A;  5GMK e;  6AT1 B;  2DRM A;  1G5I A;  4NL2 A;  1YFN A;  5GMK l;  5LJ5 g;  4M77 C;  1H8K A;  5LJ5 f;  3L4G B;  1B34 B;  2EWN A;  2LTO A;  2L0A A;  1YBY A;  3NTI A;  5GAN 7;  1RLP C;  4NOY A;  2RF0 A;  2VV5 A;  3VKI A;  1D1A A;  4YRO A;  3R6O A;  4B9X A;  2J3M A;  1ZUK A;  4RDX A;  2O9S A;  4JLI A;  2F5K A;  1UJY A;  2ZPF B;  3CPW S;  2EIF A;  3RF1 A;  2F69 A;  1QVG S;  1GBQ A;  3VS6 A;  3OMG A;  1BU1 A;  1K9A A;  4FT2 A;  3VYH B;  3CD6 Q;  2V8J A;  2W0Z A;  1QKX A;  4KH0 B;  1CKA A;  5GAN 5;  3F70 A;  1TU0 B;  2BUD A;  1NJ5 A;  5ELN A;  3HTZ A;  4Z8A A;  3GLX A;  2CH4 W;  2VVK A;  4HWT A;  1QF6 A;  2OX7 A;  1EOV A;  4CS3 A;  5HGQ A;  2HQX A;  3LGL A;  4M77 D;  1RI0 A;  1WA7 A;  5FU7 C;  1CSK A;  3DSQ A;  1IZ6 A;  2J6F A;  1Q95 G;  3IQL A;  3MEW A;  3ZFJ A;  3OYA A;  3UF4 A;  3EG3 A;  1N27 A;  5IHN A;  1WXT A;  4M75 C;  3EFO B;  5K1P A;  1XJW B;  1Y71 A;  1OQK A;  2XDP A;  4M77 F;  4OMQ A;  2MYS A;  4EMG A;  2HKN A;  1IHW A;  1EZZ B;  1SHG A;  7AT1 B;  2CJ9 A;  1TSF A;  1VIE A;  2EYY A;  1B76 A;  1QLY A;  3VS1 A;  1AHJ B;  5GAN h;  1X6O A;  3OYD A;  1YHQ Q;  1TXQ A;  2D1X A;  1WJS A;  2RHY A;  4YRE A;  1W66 A;  1YIJ A;  2RMO A;  1QP2 A;  3V7S A;  1Q81 R;  1HYO A;  1KHC A;  4GBQ A;  3EG0 A;  2DBM A;  2DKG A;  2XU8 A;  1JQQ A;  4LVI A;  1J3T A;  2O31 A;  4J9C A;  3JCM W;  2AKK A;  4TVY A;  1N9R A;  4DEY A;  4IUU A;  1ZX6 A;  2WSC E;  1UG1 A;  2I4N A;  4RTY A;  1JBM A;  1RAF B;  3CCS T;  1M90 C;  4AG1 C;  4RKU E;  1HK9 A;  3I9Q A;  1KD1 U;  3A7R A;  4M75 D;  4P72 A;  4WTO B;  5KYU A;  2D9T A;  2GQV A;  4EDU A;  3CCE Q;  4J6W A;  3G4S T;  3VQY A;  3NPF A;  1BBU A;  1M1G A;  3CC2 T;  4CS4 A;  4BE1 A;  4VUB A;  1D0Y A;  5HCK A;  5FRN A;  1X54 A;  2DE0 X;  2DTI A;  3CD6 A;  4HCC A;  3FB9 A;  4M75 F;  1BYM A;  1SSH A;  2EYX A;  4XQ3 A;  3SWN B;  1VQO A;  2B8A A;  5D6X A;  4F7U F;  2NUT B;  1Z9Q A;  3M58 A;  5IN1 A;  3REB B;  2KYM A;  2DTO A;  1AEY A;  2ALY A;  3UH0 A;  1RL2 A;  3JCM b;  5GAM j;  2Q5H A;  2P4T A;  4OMM A;  1RAI B;  3UDC A;  2LJ0 A;  4Z88 A;  2LNH B;  3NTK A;  3CMQ A;  1X6B A;  4XTV A;  3TCJ A;  4ZTU B;  2ZPE B;  4YCW A;  1VUB A;  4JPB W;  1MMN A;  4C0G A;  3A1P A;  4BE0 A;  2LDM A;  4ESR A;  1SRY A;  1HC7 A;  3NEM A;  3CCR A;  4PK4 A;  1EFW A;  4JUV A;  2DBK A;  2DF6 A;  5LL6 S;  3SFM A;  1BCO A;  2HAX A;  3FDR A;  1MMD A;  4YRL A;  5KYW A;  3OW2 P;  3MF2 A;  2Q7E A;  3QHS A;  3JCM e;  1LCK A;  1H3Z A;  3LWH A;  1AOJ A;  2NWM A;  3VRZ A;  2DXC A;  3CPF A;  5CAI A;  3PCO B;  1VQN Q;  1WDX A;  5LJ5 d;  2PQW A;  2F2X A;  2RQU A;  4IUQ A;  1PSF A;  3I55 Q;  1ZUU A;  4Z02 A;  3M0Q A;  1I5O B;  3QJY A;  2QGG A;  2QEX A;  2Y4X A;  2RA2 A;  2YHT A;  1EQR A;  4PJJ A;  5DY9 A;  4ATO A;  1WHJ A;  1I07 A;  2A37 A;  1WX6 A;  3V7R A;  4A4K A;  2ZR2 A;  1BI3 A;  3QO7 A;  3VQW A;  2Z0W A;  1NNH A;  1D1C A;  4G84 A;  3CCL Q;  2PTK A;  2CT4 A;  3JB9 I;  2F2V A;  4M4Z A;  4ZGD B;  4GLM A;  1WI7 A;  4EX5 A;  3I56 A;  4F7U A;  1B70 A;  2DLP A;  3UA7 A;  4J9F A;  2KXD A;  3BDL A;  4BE2 A;  1K1Z A;  1ZLM A;  4JLG A;  2QAZ A;  4QVZ A;  2O9V A;  5C53 B;  2BIV A;  1FMW A;  4M78 A;  1WLE A;  2WAC A;  5CIU A;  2ZIO A;  2LC4 A;  4C5I A;  3CCV T;  1X55 A;  3HRT A;  3OS1 A;  2X4Y A;  1YWP A;  2E5Q A;  2DVE A;  4E51 A;  1YJN Q;  2CP0 A;  3FLG A;  4H2S A;  3L2W A;  2DD5 A;  4LDW A;  3CXC P;  4M75 G;  1GGM A;  1RAD B;  2CUB A;  3CCU Q;  4RTV A;  2VWF A;  3HXX A;  2HQE A;  2RHU A;  5FWB A;  2FB7 A;  3R07 A;  2WSF E;  3RKW A;  1AD5 A;  2C0I A;  2JT4 A;  3PMT A;  2CZ1 B;  2ZZD A;  3LW5 E;  4N0A A;  1X69 A;  1JU5 C;  4LDU A;  1VQ9 T;  1WZO A;  3PFS A; 
#chains in the Genus database with same CATH homology
 5LJ3 g;  3L42 A;  1YI2 T;  5LJ3 f;  4QVC A;  1XQH A;  5E3I A;  2E12 A;  2V8K A;  3HRK A;  1YGB A;  1M1K U;  4H2U A;  4BB7 A;  2BKD N;  4YCU A;  4XTW A;  4YRI A;  1NJI U;  2EJF A;  3V8J A;  4H2W A;  2E41 A;  4ZTF A;  2CIM A;  3HP9 A;  4P75 C;  3MF1 A;  1OI1 A;  5GAO r;  2OTJ T;  2Y4Y A;  2PVG B;  2LQ8 A;  3QO5 A;  3FIF A;  2JUF A;  1USY A;  3HXV A;  3SWN C;  3NEN A;  5CK9 A;  2RHQ B;  3HFN A;  3LYI A;  5GAM f;  3MEV A;  2Y90 A;  4XK8 E;  4XEM A;  5C6S A;  2HD0 A;  3L4G A;  1B34 A;  3NFC A;  3MP1 A;  3C12 A;  2IY5 B;  1OYX A;  3ME9 A;  2K4Y A;  2K5I A;  3HXU A;  5GAO l;  2RJD A;  3CPW A;  2EJ9 A;  1QP3 A;  4C8Q A;  1QVG A;  1OZ2 A;  4YRF A;  2EYQ A;  3VV0 A;  4YRR A;  2KVQ G;  3A74 A;  1SER A;  4CS2 A;  3HY0 A;  5LJ5 e;  4OB1 B;  3HKS A;  4ZGJ B;  3LX7 A;  5LJ5 j;  2ZZE A;  3JCM h;  3L2R A;  2RB6 A;  2EQU A;  5EG2 A;  3RUX A;  4DA4 A;  2Q7G A;  2E10 A;  3HSB A;  4OMF B;  3G71 T;  1PSE A;  1VQK A;  5L8R E;  4XU2 A;  3L2V A;  1KMN A;  4MML A;  2ODR C;  3PIP A;  2ZCF B;  3GNG A;  1Q81 C;  1QVF A;  3M4Q A;  3OSV A;  4PJO A;  4RMO A;  3H6Z A;  2YLB A;  2QI2 A;  4P3O A;  3CCQ A;  3PGG A;  3PTA A;  3OYG A;  4QW2 A;  1BIA A;  2PUK B;  4P74 C;  2K3Y A;  3BFM A;  3P8T A;  3M5A A;  4ME7 A;  2XGT A;  3A7A A;  2EJG A;  4M75 B;  2O4X A;  3E9H A;  4K87 A;  4P73 A;  3HFZ B;  2JVV A;  4UC4 A;  2JTM A;  3MHX A;  4RCC A;  4RQE A;  2RI3 A;  3QZ9 B;  1E1O A;  4YRC A;  1Y96 A;  1NJ2 A;  1UGR B;  4LNS A;  2EQK A;  3WVD B;  1NPP A;  1M90 U;  1NZ9 A;  1EIF A;  1RIQ A;  3CME T;  4TWA A;  4N4G A;  4HVC A;  3C4S A;  1BKB A;  5CR2 A;  4HT8 A;  2ODR D;  4C5H A;  3ERR A;  1WPY A;  1VQ8 T;  4AH6 A;  2CS7 A;  2KDS A;  1S72 T;  1M8V A;  4X34 A;  3ASK A;  3M4Y A;  5GMK m;  1Z7N A;  1YHQ T;  4YRN A;  4KBM B;  4XAX B;  4TQD A;  1VQ7 T;  3KFU A;  2PME A;  5LJ3 d;  3SWN A;  3G6E A;  1H4V B;  2E6Z A;  2D6F A;  3PIO A;  1YIT A;  4P3P A;  2LVM A;  3JB9 J;  1X75 C;  3UFG A;  2FHD A;  3CCM A;  2OTL T;  4OGE A;  2ZTG A;  2P0L A;  2RHS A;  3M9Q A;  3JSC A;  2XIC A;  2E65 A;  1E24 A;  4IUP A;  1NPR A;  2EFI A;  2K3X A;  2GFU A;  4XTY A;  1BI1 A;  4PLI A;  5AYF A;  3M53 A;  3M56 A;  4L6V 5;  4B9W A;  3TUP A;  4M7D A;  4ZTJ A;  3VQV A;  3WVE B;  3HFV A;  5GAO p;  5A0L A;  4E7K A;  3CCE T;  2QHU A;  1KG1 A;  4TVR A;  1EIY B;  3MP8 A;  5CCA A;  1YJ9 A;  4C92 C;  4MZT A;  4LDV A;  3PCO A;  3MET A;  3JB9 H;  4BAC A;  2CJB A;  2ART A;  4PG3 A;  3EFS A;  2CZ7 B;  3P8B B;  4NL3 A;  3AHU A;  4A4G A;  5I2S A;  1W2B A;  1BIB A;  4WJ3 M;  5A2Q E;  3QZ5 B;  3REX A;  1ATI A;  1YFS A;  2GCX A;  1G5V A;  1HXD A;  2RK1 A;  4OGC A;  4EMH A;  4IUT A;  3GOX A;  1UGQ B;  2XDB A;  1VQN T;  4C92 D;  2ZPG B;  3J7A F;  3JAM E;  3X26 B;  3I55 T;  5CKB A;  2DIQ A;  1SET A;  4WF2 A;  3QNE A;  1YFR A;  4QQ6 A;  2Q5I A;  5IAY A;  5HK3 A;  4M7A A;  3RMS A;  4EMK C;  1LJO A;  4P71 A;  3HRS A;  3HXW A;  3OYY A;  3QTC A;  4G85 A;  3MQZ A;  3CCL T;  4IKF A;  2QA4 T;  3DLL A;  4XEO A;  5HY6 A;  2ZZG A;  2RD1 A;  3JCM V;  1E22 A;  1NYR A;  4DQ2 A;  3JB9 D;  4N4H A;  3JCM X;  2A3L A;  2P0Q A;  2DIG A;  2CKK A;  2C8M A;  1QVF S;  2LRQ A;  2CZ0 B;  1KQS S;  3PMI A;  5GAN 4;  3HFO A;  2DD4 A;  3GF5 A;  5FU6 B;  3JB9 F;  4X5O A;  4J5Y A;  3OSS C;  2I4O A;  1VQ4 T;  3LWI A;  5GAN g;  1YJN T;  4L59 A;  3OYL A;  3A8M B;  1UB4 A;  4H02 A;  3JCM Q;  3RER A;  3BW1 A;  5LJ3 e;  3CCU T;  4HWS A;  4KUI A;  1FXX A;  5LJ3 j;  1K9M C;  3QG1 A;  2XD0 A;  3HRU A;  2QQ9 A;  3FC3 A;  4YDQ A;  1JRI A;  3CC7 A;  1B7Y B;  3PNW C;  2X35 A;  1VQK T;  1K73 C;  3ICA A;  2ZCE A;  2ZT7 A;  3G1Z A;  1XOV A;  4ZTZ B;  1VQP A;  3N5B B;  1KQ1 A;  2K2V A;  2PU9 B;  4P5N A;  4CH6 A;  2DXT A;  5A0G A;  5GAM e;  3QYH B;  3OBY A;  4M77 A;  2DZC A;  2LCL A;  3FEO A;  4YRS A;  3QO8 A;  4BI4 A;  4XU1 A;  4M78 D;  3A5Z B;  3A8H B;  2DPP B;  2DU5 A;  1YJW T;  3IKL A;  4C92 G;  3E9G A;  3DLM A;  1E1T A;  1FX7 A;  4LVJ A;  5GMK h;  1ADJ A;  3UPU A;  4UP7 A;  2LT4 A;  4JDS A;  1Q81 U;  2QHS A;  1V29 B;  2A8E A;  4H2Y A;  2P0P A;  2AHJ B;  1VQ5 T;  3BDU A;  1VQ6 A;  1JJC B;  5GAO q;  3L1A A;  1IL2 A;  1VQL A;  4OB3 B;  3RKY A;  3OYB A;  11AS A;  3JB9 G;  3OS2 A;  2DK3 A;  2X4J A;  3X20 B;  2V8I A;  2VUB A;  4K86 A;  1H4T A;  4K88 A;  2DU7 A;  3UT1 A;  4M75 A;  3HXZ A;  3CC4 T;  2KY9 A;  3HFZ A;  4HT9 A;  2O01 E;  1YIT T;  1W2B S;  5F5W A;  4EO4 A;  2M1H A;  3RKX A;  3DB4 A;  4ZGE B;  3OYH A;  4A54 A;  2DXU A;  4TVA B;  3P8V A;  3C94 A;  4JS5 A;  5I2M A;  1VQM A;  1KC8 C;  5KCO A;  2NLU A;  3IG2 A;  1IRE B;  2R58 A;  2I4L A;  3OW2 A;  2DXB A;  2GF7 A;  2L5Q A;  2ZZF A;  1K8A C;  5FU6 C;  1YCY A;  2RJF A;  2M16 A;  4RG2 A;  5GAO m;  3E9F A;  4C92 E;  4C0D C;  2ZPB B;  3J80 E;  3OMC A;  3UGT A;  2RHX A;  4R55 A;  2MF2 A;  3QJ6 A;  5GAN d;  2ZIN A;  2XDD A;  3NTH A;  3KXT A;  3HY1 A;  1SSF A;  3LSS A;  4TQF A;  3HL8 A;  1N8R C;  4M78 G;  4E7J A;  1XTD A;  4ZN1 A;  4JRQ A;  3NET A;  5GMK i;  3LSQ A;  2HBP A;  5CO7 A;  1ASY A;  4BWA A;  2FYK A;  4C5E A;  3OYC A;  4HA8 A;  2H3J A;  1UGP B;  4PNO A;  1EIY A;  1I81 A;  2RJE A;  4LVM A;  4UP9 A;  3GPL A;  1C0A A;  1X2G A;  3P8Y A;  3OYF A;  3KUF A;  1VQZ A;  4XU0 A;  3V8K A;  1Z7M A;  4H2T A;  4PL6 A;  2I2L A;  2VXF A;  3OD1 A;  3OBW A;  1H4Q A;  4C92 B;  5GAM h;  3CXC A;  3Q1J A;  3WXM B;  4NCX A;  2R5A A;  3MEA A;  2MWP A;  1GXI E;  4YRJ A;  2JZ2 A;  1U1T A;  4MZM A;  4BI3 A;  2RM4 A;  2RO0 A;  2KAF A;  2DAQ A;  2JTF A;  2YRV A;  2FVU A;  2XTI A;  4OVA A;  4A4H A;  2L3R A;  1J5W A;  1R8O B;  5GAN 6;  4Y91 A;  2ALY B;  5KE2 A;  4X9C A;  1YIJ T;  1LYL A;  3JCM g;  4HT4 A;  2PMF A;  2G3R A;  1WJR A;  2RI2 A;  5KNN A;  4NS5 A;  2E64 A;  4J7I A;  3WQZ A;  3CCS A;  2VC8 A;  2DQ3 A;  2QQS A;  2E1H A;  2K5L A;  5GAN 3;  1KQS A;  3HHT B;  3GIB A;  1L0W A;  2ARU A;  1X2H A;  5D6Y A;  3G4S A;  4C8Q G;  4M78 E;  4CRI A;  2G4C A;  3CC2 A;  1N9S A;  2AKW B;  2RHI A;  4EMK B;  2YLC A;  5J26 A;  2GFA A;  2VXE A;  4R56 A;  3CD6 T;  1TH7 A;  4Y28 E;  3A32 A;  3VQX A;  3H8Z A;  3TU4 K;  4E7H A;  4KQE A;  3OYI A;  3TEH B;  1VQO T;  1MHN A;  3QUI A;  3LH0 A;  2QQA A;  5GAO n;  5D6W A;  2JOY A;  4E7I A;  4JJN K;  3W3S A;  1K9M U;  2ZNI A;  4RCB A;  4PHC A;  4KR2 A;  3M54 A;  4DOW A;  4O2D A;  1G3Y A;  3M59 A;  2EQJ A;  1B70 B;  4FT4 A;  4OB2 B;  4X9D A;  1K73 U;  4N4I A;  3OYJ A;  2PVO B;  3CCR T;  3G7Z A;  4RG8 A;  4PJO G;  3FRN A;  3IKM B;  4P75 A;  3V7C A;  5GAN j;  1B7Y A;  2VGN A;  4GLK A;  1G3W A;  4M78 B;  2F5T X;  3REU A;  2E3C A;  3EFR A;  1D3B B;  3OW2 S;  1U8R A;  2ZNJ A;  3QO3 A;  3ZEH A;  2RK2 A;  4KUL A;  4YYE A;  4FSX A;  3CBP A;  4QVD A;  2QEX T;  2DZ9 A;  4YRM A;  4XU3 A;  2DJZ A;  4FU6 A;  2MI6 A;  2IG0 A;  2XG8 D;  3OS0 A;  3A5Z A;  3OYM A;  3V8L A;  1I5L A;  4J6X A;  3I56 T;  4MDW A;  2JN0 A;  2JNG A;  3GNF B;  4M7A D;  4C8Q E;  2DTH A;  3CCV A;  1ADY A;  4YPF A;  3SDZ A;  4P72 C;  1EVL A;  1EVK A;  1W4S A;  4V2S A;  3X24 B;  1N9W A;  2XK0 A;  1M4Z A;  3CCJ A;  4HWO A;  5FRM A;  3A31 A;  2E6N A;  3VUB A;  1SES A;  2MAM A;  2CJA A;  3JCM J;  3RMQ A;  5LJ5 h;  2ZT6 A;  2ZT8 A;  5GMK j;  3CXC S;  1VQ9 A;  4Q5W A;  3X28 B;  2PVD B;  4LD9 K;  2ZXF A;  1H64 1;  2E70 A;  3M55 A;  2RH2 A;  1YI2 A;  2P5I A;  3VU3 C;  4II1 A;  4M7D G;  4PJO E;  4MZP A;  3L2U A;  1Q86 U;  4P74 A;  3I7F A;  1KC8 U;  4JRI A;  4C8Q B;  3QII A;  3JCM d;  3M4P A;  4Q6G A;  2D0Q B;  3QPH A;  3ZBD A;  4TVA A;  1FYF A;  3CMA A;  4BW9 A;  2WSE E;  4ELZ C;  5FRO A;  5GAN 8;  4KUD K;  5J39 A;  2ZR3 A;  4J83 A;  3A8O B;  4MDX A;  2OTJ A;  4C92 F;  1K8A U;  3MEU A;  2DO3 A;  2HNI A;  1X01 A;  3VUZ A;  4OP0 A;  3MO8 A;  4BDZ A;  2XKO C;  4DOV A;  1JJ2 A;  5CQX A;  2RJC A;  1Q7Y C;  2MMP A;  2RI5 A;  1N8R U;  3X25 B;  1QVP A;  5KE3 A;  4PJO B;  2LT1 A;  2ZIM A;  1WNL A;  2QQB A;  4A53 A;  5DLO A;  2Q7H A;  4QQD A;  1QE0 A;  4C0D B;  2M9U A;  4H2X B;  5GAN f;  3LC0 A;  2K5F A;  3QYG B;  3A7U A;  4J7F A;  1U1S A;  1LOJ A;  1M9S A;  5KCH A;  2O4X B;  4M78 C;  5C0M A;  4M7A G;  4LDY A;  2R57 A;  1BI0 A;  2XID A;  1Y96 B;  3G71 A;  1XNI A;  2ARS A;  4JRK A;  1KHI A;  1ZHI A;  2QQR A;  2RHQ A;  1NJ6 A;  5ELO A;  2QXF A;  4XTU A;  4BY6 B;  3HXY A;  3O8V A;  4M7D E;  3PZC A;  4C92 A;  2DQ0 A;  5FLX E;  3OQ5 A;  4ELY C;  1Q82 C;  3UGQ A;  4MMK A;  2IY5 A;  4N0A C;  1ASZ A;  2AMC B;  3JCM P;  1H4S A;  3CCQ T;  2CZ6 B;  2FL7 A;  4Q15 A;  2PUO B;  4RMF A;  3MP6 A;  2P0K A;  2E5A A;  4YRP A;  4JS4 A;  4C5G A;  4KR3 A;  4JRP A;  1I4K 1;  3OY9 A;  5J3B A;  5CKH A;  2KK4 A;  1B8A A;  2RHS B;  1UEB A;  1O9S A;  4L5G A;  4M78 F;  1NE8 A;  4FL6 A;  1NJ8 A;  3CME A;  2ZT5 A;  1WQ7 A;  1ZBX A;  3A5Y A;  1WQW A;  1USY C;  4M7D B;  1VQ8 A;  1S72 A;  1LNX A;  1HTT A;  3TRE A;  5CKD A;  1G51 A;  1JB0 E;  4OLF A;  3QDR B;  2AKW A;  4CH5 A;  1YHQ A;  4EMK A;  2EAY A;  1PYS B;  12AS A;  4M77 G;  4E7L A;  1VQ7 A;  4C8Q C;  1Y7X A;  4M7A E;  4C0F A;  4J15 A;  3TEH A;  3G6E T;  1X56 A;  2M0O A;  3KBG A;  2OTL A;  4A4F A;  3CCM T;  2LNV A;  5DLQ E;  3GP8 A;  3TEE A;  2KMT A;  4PLL A;  2ZGW A;  3OA6 A;  4UP8 A;  4ZIB A;  1Q86 C;  4CH4 A;  3CCE A;  1M5Q 1;  3RGL A;  2L8D A;  1UGS B;  5HKC A;  2ZPI B;  3INZ A;  1VIF A;  4WJ4 A;  2C7I A;  2QDY B;  1YJ9 T;  3QKJ A;  3BY7 A;  4PJO C;  1FWZ A;  5CVI A;  2XHC A;  4OB0 B;  4C0Z A;  4HKE A;  3VYG A;  4YRK A;  3L2Z A;  1N6A A;  4C8Q D;  3OS5 A;  4HWR A;  1D3B A;  4M7A B;  4CH3 A;  3CCJ T;  5GAN 2;  4YP0 A;  4BI8 B;  4F7U G;  2EL9 A;  1YB3 A;  4C8Q F;  1KOG A;  1JJ2 S;  2DDZ A;  4TVW A;  4P73 C;  1OZ3 A;  3E1S A;  4XTX A;  5LJ3 h;  3LLR A;  4BD3 A;  4YRT A;  1MGQ A;  3UWN A;  1YFT A;  1VQN A;  3M4G A;  3IAL A;  4BY6 C;  3S3M A;  4HWP A;  3CBM A;  2J3L A;  3I55 A;  4M77 E;  3CMA T;  4PJO D;  3A8L B;  3FJP A;  3OYK A;  4LD6 A;  3VJP A;  5K1X A;  4GY5 A;  4O6J A;  2RHZ A;  3M57 A;  4PJO F;  3CCL A;  2QA4 A;  3J81 E;  3A8G B;  3URG A;  4PKC C;  3CBO A;  5GAM g;  3DKM A;  3BJU A;  4J6Y A;  3TEG A;  4YRG A;  5CQY A;  2CYZ B;  3MEY A;  5M9O A;  1KD1 C;  3S3N A;  2EQM A;  3ER0 A;  5IT9 E;  5A0D A;  1G5H A;  4DPG A;  1P92 A;  3EAE A;  4H2V A;  1VQ4 A;  3QSU A;  1YJN A;  4M7D C;  1BI2 A;  1O75 A;  4M77 B;  1Y07 A;  3JCM f;  3CCU A;  1BBW A;  4L87 A;  4O5V A;  4M75 E;  5C51 B;  1NJ1 A;  4F7U E;  3CEY A;  4KT0 E;  2QTX A;  1I8F A;  2K57 A;  5I21 A;  3QBY A;  1G3S A;  2XI9 A;  1Q7Y U;  1DJ7 B;  3E19 A;  1KMM A;  4HCB A;  3HRI A;  1WYD A;  4RQF A;  3CC7 T;  3E9I A;  4YCV A;  4FIB A;  4UPA A;  1ZQ1 A;  4IUV A;  1M1F A;  4A4E A;  1VQP T;  3SB2 A;  4M7D D;  3RIR A;  3RES A;  5FU7 B;  4LVK A;  2IVW A;  3P8H A;  4H2X A;  4ZN3 A;  2VGM A;  3PT9 A;  2X4W A;  3NEL A;  1WJQ A;  4P3N A;  1YJW A;  3DB3 A;  4M7D F;  3JRZ A;  3RAC A;  4F7U B;  2OAU A;  5CKE A;  4IUR A;  2ZPH B;  2X4X A;  3S3O A;  4YRQ A;  1G3T A;  4LVL A;  1WU7 A;  4M7A C;  5GAN e;  5CKF A;  2KSS A;  4EPC A;  3T9N A;  4P71 C;  1Q82 U;  2EKO A;  2I4M A;  3OYE A;  1VQ5 A;  4YTL A;  2VYT A;  3RL6 A;  2DEQ A;  1QW1 A;  4E47 A;  1VQ6 T;  3S6W A;  1KQ2 A;  2A7Y A;  2AMC A;  1VQL T;  2L89 A;  4BUG A;  3L2Q A;  2KQW A;  5KH6 A;  1WGS A;  4J8O A;  4OF1 A;  2LX9 A;  3P8D A;  4CI0 C;  5C52 B;  3CC4 A;  2NS6 A;  4WI1 A;  4HCZ A;  4LDX A;  3C95 A;  3HPW A;  4XTZ A;  4QQG A;  3MCA B;  4TTV A;  3VBB A;  3OB9 A;  2R5M A;  2LQK A;  3JCM c;  3SD4 A;  2CGH A;  4FM4 B;  5DM7 R;  1NYQ A;  4M7A F;  1VQM T;  1JJC A;  2C06 A;  1M1K C;  4BDY A;  4D6W A;  3LGF A;  1NJI C;  3OYN A;  5GAM d;  5HK0 A;  2LCC A;  2QHV A;  2MWO A;  3QXE B;  1PYS A;  5GMK e;  1G5I A;  4NL2 A;  5GMK l;  5LJ5 g;  4M77 C;  5LJ5 f;  3L4G B;  1B34 B;  2EWN A;  2LTO A;  1YBY A;  3NTI A;  5GAN 7;  4NOY A;  2VV5 A;  3VKI A;  4YRO A;  3R6O A;  4B9X A;  2J3M A;  4RDX A;  4JLI A;  2F5K A;  2ZPF B;  3CPW S;  2EIF A;  3RF1 A;  2F69 A;  1QVG S;  3OMG A;  4FT2 A;  3VYH B;  2V8J A;  5GAN 5;  3F70 A;  2BUD A;  1NJ5 A;  5ELN A;  3HTZ A;  3GLX A;  4HWT A;  1QF6 A;  1EOV A;  4CS3 A;  5HGQ A;  2HQX A;  3LGL A;  4M77 D;  1RI0 A;  5FU7 C;  3DSQ A;  1IZ6 A;  3MEW A;  3ZFJ A;  3OYA A;  1N27 A;  4M75 C;  5K1P A;  1Y71 A;  2XDP A;  4M77 F;  4EMG A;  2CJ9 A;  1VIE A;  1B76 A;  1AHJ B;  5GAN h;  1X6O A;  3OYD A;  1WJS A;  2RHY A;  4YRE A;  1W66 A;  1YIJ A;  1QP2 A;  3V7S A;  1KHC A;  2DKG A;  2XU8 A;  4LVI A;  3JCM W;  4TVY A;  1N9R A;  4IUU A;  2WSC E;  2I4N A;  1JBM A;  3CCS T;  1M90 C;  4RKU E;  1HK9 A;  1KD1 U;  3A7R A;  4M75 D;  4P72 A;  2D9T A;  2GQV A;  4EDU A;  4J6W A;  3G4S T;  3VQY A;  1BBU A;  1M1G A;  3CC2 T;  4CS4 A;  4BE1 A;  4VUB A;  5FRN A;  1X54 A;  2DTI A;  3CD6 A;  4HCC A;  3FB9 A;  4M75 F;  1BYM A;  4XQ3 A;  3SWN B;  1VQO A;  2B8A A;  5D6X A;  4F7U F;  3M58 A;  5IN1 A;  2DTO A;  2ALY A;  3UH0 A;  1RL2 A;  3JCM b;  5GAM j;  2Q5H A;  2P4T A;  3UDC A;  3NTK A;  3CMQ A;  4XTV A;  3TCJ A;  4ZTU B;  2ZPE B;  4YCW A;  1VUB A;  4C0G A;  4BE0 A;  2LDM A;  1SRY A;  1HC7 A;  3NEM A;  3CCR A;  1EFW A;  4JUV A;  5LL6 S;  3SFM A;  2HAX A;  3FDR A;  4YRL A;  3MF2 A;  2Q7E A;  3QHS A;  3JCM e;  1H3Z A;  3LWH A;  2DXC A;  3CPF A;  5CAI A;  3PCO B;  5LJ5 d;  2PQW A;  4IUQ A;  1PSF A;  4Z02 A;  3QJY A;  2QEX A;  2Y4X A;  2RA2 A;  2YHT A;  1EQR A;  5DY9 A;  4ATO A;  4A4K A;  3QO7 A;  2ZR2 A;  3V7R A;  3VQW A;  1BI3 A;  1NNH A;  4G84 A;  3JB9 I;  4ZGD B;  4EX5 A;  3I56 A;  4F7U A;  1B70 A;  4BE2 A;  3BDL A;  4JLG A;  4QVZ A;  5C53 B;  2BIV A;  4M78 A;  1WLE A;  2WAC A;  5CIU A;  2ZIO A;  2LC4 A;  4C5I A;  3CCV T;  1X55 A;  3HRT A;  3OS1 A;  2X4Y A;  2E5Q A;  2DVE A;  4E51 A;  3FLG A;  4H2S A;  3L2W A;  2DD5 A;  4LDW A;  4M75 G;  1GGM A;  3HXX A;  2HQE A;  2RHU A;  2FB7 A;  3R07 A;  2WSF E;  3RKW A;  3PMT A;  2CZ1 B;  2ZZD A;  3LW5 E;  4N0A A;  4LDU A;  2QHT A;  1VQ9 T;  3PFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...