3V8LA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotinyl-5'-amp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 100
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8lA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8lA02
1SD4A 3WG9A 4E70A 4S05A 2L4AA 1EIYA 3OV8A 2FU4A 4KUMA 4M9SA 2YR2A 4OIQF 4J6WA 2DTOA 1BIAA 1H4VB 2RV8A 4ZYDA 4C8QD 1XSXA 1K7AA 1SMYF 3P8TA 3E3VA 5K5OA 4IJAA 3NENA 1U3EM 1KYWA 2BV6A 2LDUA 2H94A 1OKRA 1Y0UA 3HFOA 3BJUA 1MZBA 2IPQX 5DUKA 2AKWA 4HDVA 2BBYA 3NRVA 3JB9J 5GAN3 3TO6A 1CF7B 5BOXA 2ARTA 4M73A 3J7AO 2M87A 2D1VA 2QQAA 4IPAA 1YO5C 1E17A 2D2WA 4Q47A 4HF1A 1I1SA 1U1TA 4P3NA 2DLLA 1EQRA 5K1XA 4YRQA 2Z3YA 3JAMZ 2ESHA 3BOQA 4M7AG 2Y48A 4P9UA 4PGGA 1KU7A 3KEQA 2W85A 4A6DA 4EJOA 4RQFA 3JCMd 4HT9A 4QVCA 4I01A 1E1TA 4YFKF 2Z9OA 2STWA 1BBWA 1GXQA 2RVCA 2R7FA 2B0LA 2ZTGA 4WJ4A 4J15A 3HSFA 2CFXA 4C8QB 2HOEA 2YHTA 2ISZA 4A5NA 1G3SA 5GAN7 2AKWB 3QHSA 3KZYA 3ECHA 4CS3A 4GYIA 3HYIA 1TQMA 1YLFA 2Y0MA 3ZQ7A 1XCBA 1MGTA 3ISPA 1STZA 2CW0F 3P9IA 1FOKA 5L3DA 4HBLA 3ROUA 3L9FA 4LMYA 4L18B 1IF1A 5HS8A 2JZYA 2AS5F 3TGNA 5C51B 4YG2F 3K0LA 4MQVA 3QU6A 4A54A 4Z2YA 1IL2A 5LJ3f 3HXZA 4ESFA 3DPLC 1WSUA 1QF6A 1I27A 3BY6A 4ENMA 4PCQA 3G1ZA 1OMIA 2NYXA 2IJLA 5FLXZ 1J5WA 3EYIA 2RHSA 5EEGA 3WTSC 1OYYA 3GZ6A 4RMFA 1ZG1A 2P5KA 2ZNZA 4OMZA 2DXUA 2RB6A 2XKOA 4EM0B 1IUYA 3JAMK 3HRUA 2UZKA 4AIKA 4YREA 2FOKA 3F6VA 4EJVA 1R7JA 2LNBA 1BI0A 2HYFA 5GAN4 1R00A 4XLNF 1W4MA 3SXYA 4M7DG 5ELOA 2HWVA 4EJTA 3R07A 3DV8A 3CUOA 3NETA 4M77G 4N0AC 4Y91A 4BXUA 1G5IA 3RUXA 5D4RA 5GAMg 1I5ZA 2J3LA 1XN7A 3FMRA 4F7ZA 3ZMUA 2ETHA 4G7ZF 4L9VA 4LK1F 2PMEA 3F22A 3JCMQ 3JCMc 1IXCA 5LEJA 2E1NA 3RTRA 4EJUA 3HOSA 1GGMA 3DP7A 3JCMP 3VOEA 3L2ZA 4BQAA 3JB9F 4M75F 3RGLA 1WYDA 4M77B 4KA4A 4LLNA 3MF1A 1XGMA 2ZR2A 1TQPA 3MEYA 3QTCA 1M8VA 2KIMA 5AIPA 3WTWC 2P5IA 1QGPA 1B6AA 2RHSB 3P9KA 3V8LA 4P72C 2PMHA 1YFSA 4P75A 2DXTA 3D5LA 1YYVA 4MTDA 4OIRF 2IA0A 2GWRA 2NAZA 1U8RA 4HQEA 2Q0OA 4M6XA 2JPCA 3SB2A 2KIFA 3R61A 3WTYC 5GMKj 3KP7A 4CH3A 1G4DA 2XTIA 3VQWA 2MD5A 2V1XA 1R23A 4ZYEA 4M7AE 4TVAA 4ZIBA 1B1BA 1EVLA 1N9SA 4C92G 4M7DB 5HOOA 3BJAA 4NB5A 5DCMA 5JI6A 5LJ5g 4M77C 2A6EF 2FMLA 1LJOA 4EMKA 2DFIA 3A31A 3ICAA 1LOJA 1ASYA 4GGGA 4L9NA 4CO8A 1YFTA 5LRSA 3VU3C 1F4KA 5A2QZ 5GANg 2KKOA 3GX4X 2XIGA 5L3FA 2DTIA 4ZTUB 3QO3A 4V2SA 3BFMA 3MZYA 1FYMA 5GAMj 2DU5A 4X9CA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 2FF4A 1K78A 3IALA 2VXZA 4C8QA 4LNSA 4EM2A 1I4K1 1D3YA 2Q7GA 4I98B 4P3OA 1ZRFA 2C8MA 3GVAA 2I2LA 3FWEA 2VC0A 4KIFA 1ZARA 1NJ1A 4N0BA 4P75C 3K69A 2EAYA 3QP6A 3HTZA 1U1SA 3Q9SA 4ZTZB 1BBYA 3OD1A 1EOVA 2GAUA 3TKYA 2OZ6A 1PYSB 4OP0A 1XCVA 2ZFWA 4M7AF 2FB7A 4P71A 4EMKB 3WGIA 2RKHA 2XUBA 5GAMd 3KCCA 2HQRA 2K86A 4TTVA 2EJ9A 2P6TA 1ZHFA 4BAYA 4BHPA 3FXUA 4P3PA 4YRIA 4YPFA 4MNUA 3M4PA 4KNYA 5JR3A 1O3RA 4HX8A 2E64A 1KQ0A 2M1BA 4XTYA 4M75B 1JHFA 4JLIA 2HDCA 3KEOA 1RZ4A 3T1BA 1XD7A 1KQ2A 4RB1A 1IZ1A 3R0AA 2CGPA 2I4OA 1ONVA 3DPTA 2A69F 3UH0A 4AH6A 4MEYF 4NHJA 2XAQA 1MJAA 1R58A 2E1CA 4YRJA 5GMKl 3SWNC 2ZMEB 2F5CA 5DUIA 2QHVA 4G7OF 3PZCA 3E6MA 4A2UA 4Y15A 4M77F 4XU1A 4ENNA 2XGTA 1Z91A 3FM3A 1FY7A 4LK0F 2FQ3A 2H6CA 1E2XA 2BYVE 2Q7EA 1FX7A 4TV7A 3BROA 5DDGA 3N4MA 4UVAA 3FHZA 4YYEA 3QP5A 2EJRA 4C8QF 1NJ6A 1X01A 1NJ2A 1HQCA 1XMKA 3SZPA 4NL2A 4E51A 2A07F 3WU0A 2PFBA 2E41A 2YU3A 3J81K 3RKXA 1ZAOA 1HW5A 2RM4A 2J3MA 2HYGD 4NOYA 1X54A 5GAN8 2QQ9A 5LJ5h 1R5GA 2ZMEA 5LJ5f 1YIOA 2PN6A 3DKWA 4O2DA 1N9WA 2DQ3A 4HLXA 4P96A 4J6XA 1KOGA 2OU2A 3GXOA 4HDUA 3MZHA 2CGHA 2F5EA 4HZFA 5CYVA 3VODA 2P5LC 4C8QG 4KR2A 5LJ3h 2MC3A 2W57A 4H0EA 3K1PA 1RUNA 3LSSA 3ZMSA 4IHSA 5D5UB 4C92D 2JRTA 1OR7A 4ZZLA 3JCMJ 4M77D 4H2SA 3Q5FA 3JSPA 3A5ZA 1ZRDA 4CDGA 1Z9CA 1U2WA 3REUA 3KE2A 1HC7A 4ESJA 3PQKA 3RJPA 4H2WA 3REXA 4HWTA 4H2UA 4X9DA 4LB5A 4U88A 1CGPA 4CGZA 1KYZA 3U2RA 3R60A 4HLYA 2JSCA 1R5HA 3VFZA 3I59A 4MEXF 3J80Z 2GIVA 1TW2A 4A5MA 3P8VA 1QNTA 1HSTA 3FJPA 3H3UA 4D0PA 4PG3A 2ALYA 4L0YB 5DD8A 5DYMA 4M78C 4K86A 1Z6TA 4XEOA 3TOBA 2QHUA 2O8XA 5HVQC 3IRQA 1J5YA 1C0WA 3L09A 4P9FA 3GF2A 1TBXA 4EMHA 4LG0B 2ZT7A 4XBFA 4HWPA 1IAWA 3KZZA 2F2EA 3PCOA 2ZO4A 4O3MA 3INZA 3ERRA 4A6EA 2QBYB 1PP7U 3S2WA 1J9IA 2QWWA 4KIGA 4RGXA 1D3BB 3QOPA 4DPGA 5D5XB 1HKTA 1G6NA 4RB0A 5E8IA 1SAXA 3F21A 1H4TA 1FSHA 2L01A 2ZR3A 3HUGA 1IXSB 3ERED 4MGRA 3FZVA 3RPQA 1ON2A 4IF4A 4M7DC 2XAHA 4OOIA 5ICFA 2G4CA 2XASA 2QHTA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 3G73A 4M6YA 5GAOp 5D8KB 2E7XA 2IY5B 3KP3A 3FIFA 3R0JA 3F3XA 4UHTA 3E6DA 2GQQA 5CJ9A 2ZXJA 3IKMB 4IRGA 2VE8A 3M7GA 2GZWA 2DI3A 2I4MA 2V6CA 2XAGA 3WTUC 3M4QA 5LBQA 2DQLA 4JQFA 5LHGA 1KMNA 3RL6A 1I81A 5BQTA 1UFMA 3UFGA 1T38A 3QUIA 4EMSA 4YFNF 1H9TA 4ZZDA 3WTVC 3O2PE 1KA8A 4JRIA 3JCMe 4S04A 1BOAA 2VC1A 3U9GA 4QWQA 1H9GA 5E20A 2D45A 3LSTA 1FLIA 4CH5A 3KP4A 5HLHA 5D6FA 1ZG5A 3KETA 4AVPA 4N9IA 2A3SA 3GIBA 4P73C 1AOYA 1WLEA 4TWAA 4L9TA 5ILSA 2K57A 1H4QA 1X2GA 4B09A 3JCMX 1EH7A 1T0FA 3ZPLA 1U6GA 4RAYA 3QAHA 3GLXA 2ZZGA 1YQAA 3RF1A 1KQ1A 4CH4A 1S7OA 4KMFA 3HIFA 2EFNA 4M75E 4GCVA 1JXSA 2FSWA 2VODA 1D8KA 1TLHB 2DJZA 3GW2A 5GANh 4UXNA 1HBXG 4HT8A 1ZLJA 1S29A 4YRRA 2ELHA 2EJGA 4UUVA 1P4WA 3HXXA 4RQEA 3MWMA 2UWMA 1B9MA 2HNIA 4PJOG 4I0AA 4UV8A 3TDUC 5FD5A 1O57A 5FFZA 4UPAA 2QM3A 3GYHX 4CYDA 2DQRA 4A0YA 2KRFA 2EFOA 2E7WA 4UP8A 3KP2A 3ABTA 1T39A 3N97A 2ZNYA 2Q8KA 4K87A 5EEHA 4EM1A 5C53B 2F5DA 3HHHA 3L1AA 3KFWX 3DQVC 1FBSA 4TVYA 4TQDA 1LNWA 1MDMB 2X0LA 3HRKA 5D5WB 1R1VA 4F7UE 2QHSA 4PHCA 1U78A 2VOPA 1QZZA 1YS6A 2MH9A 3L4GA 3CTAA 5LJ5j 2VONA 2XVCA 3A7AA 1USYA 2RD1A 3VQYA 4CS2A 4PJOD 5L3CA 4M7DE 3GO5A 4M78A 4XU2A 4R1HA 2CWEA 1H641 3WQZA 4MMKA 3LWFA 1MKMA 2XHKA 3ZN0A 4WF2A 3F8BA 1H4SA 3Q9VA 5GAOm 4DQ2A 2O03A 3JW4A 4Q6GA 4PJOC 4F7UA 1JJCB 2VT3A 1BM9A 4KICA 3LQRA 1ZG3A 3VB2A 5D6EA 4UVBA 4M72A 2FBIA 1SFEA 4RGRA 2DTHA 2HKOA 2NS0A 4YRMA 11ASA 2D1HA 3HOTA 1WQ7A 2HQNA 2MLGA 4ETSA 1S7AA 4XU0A 3PCOB 4YRSA 1B4AA 5H6RA 1W7PD 3IKLA 3ZN1A 2O61A 2FBHA 2Z99A 3M1EA 3A74A 1IN4A 3TO9A 1LEBA 1S8NA 1U5TB 1NJ8A 5LJ3d 1FYLA 3VQXA 3V7CA 5IT9Z 3MF2A 4P74C 4M7AC 3LQQA 4F7UG 3KFUA 3TUPA 1FP2A 4XTWA 3HTSB 3WTXC 5D5VB 1X2HA 1ZREA 3E6BA 1OYIA 2E5AA 4HQMA 5FD6A 1Z7NA 4RAZA 3WU1B 5LGTA 3ZMTA 3EQLF 4M75A 1B70A 4KR3A 4G6DA 3T8TA 5ICCA 3E5QA 5CVJA 3F23A 4YP0A 2QQBA 2Q5HA 3QSUA 1WRJA 1GHCA 4I02A 4HYEA 4CXFA 2RDPA 4G8XA 2DTRA 1Q1HA 5LGUA 1E24A 3OOPA 4MHGA 3IL2A 3A32A 3GEZA 1ATIA 2DPDA 1YGBA 2CSOA 3HTUA 1BN5A 2QUFA 3E9HA 1K6OA 3ZMZA 3R6SA 5A2QK 2P7VB 3KLOA 2VXEA 2KJCA 3NELA 2WTEA 4KFCA 2EFPA 2A5YB 3K1NA 3PQJA 3GFLA 4XSXF 2R7DA 3CUQA 1YW9A 3W6KB 2DKGA 4M78E 3AHUA 1YB3A 2IW5A 3JCMV 4ON0A 3IC7A 5GAN6 4HF2A 3M9AA 2UXXA 2GXBA 2DK8A 4UNOA 5GANf 1K78B 2H09A 4YRKA 1O3TA 2YLCA 4AIHA 2ADUA 1KU3A 1DP7P 4XSZF 1D5VA 5F64A 5ELNA 2G7UA 1Z1DA 2RHQA 4PJOA 3RACA 4Q15A 2OQGA 3BJ6A 1F9NA 3B02A 4M77E 1VQZA 2RC4A 1LQ1A 4H2TA 1K79A 3DF8A 4OIOF 1Y96A 4LJZF 2TDXA 5ICGA 3I59B 2EK5A 2MA3A 3UGTA 1D8JA 2EV6A 2VE9A 3RKWA 1RNLA 2L54A 3F8MA 3ZMDA 3W6JB 4EO4A 2AXLA 3RI4A 3QRFF 4IRHA 1R1TA 5GAMf 3I53A 1TNTA 4L9JA 4M7DA 2Q7HA 5K1YA 3V4GA 4ENKA 4WK8F 4I2OA 4BYYA 1DUXC 4XTVA 2P4WA 4QLCU 3HRSA 1TW3A 3M8EA 4OLFA 1N9RA 1LDDA 2XAFA 4YROA 3TQNA 1YCYA 3SWNA 2COMA 5GAOl 1LNXA 1ZYRF 4G7HF 3WODF 2MBFA 1V3FA 4HVCA 4EGZA 3CUQB 4P55A 5J6XA 3E5XA 4M7AA 2RGVA 4P74A 1JGSA 1DPUA 1SFXA 3MAJA 1WPYA 4HWRA 1Y96B 3RYRA 2XROA 1Z6RA 3U1DA 3IKTA 2WC2A 5F6FA 5GANj 4EMKC 5E1ZB 3F72A 5DCFA 2PQ8A 2RNJA 2CQKA 2HZTA 4EMGA 4I0BA 1W5TA 2FA5A 4KIBA 3RKYA 3EFSA 2P8TA 2EB7A 4P71C 3FXRA 1G3WA 3FMQA 3RESA 3JTHA 5K5RA 1XGNA 1KU9A 4EV0A 3E5UA 2EWNA 2M30A 4JRKA 1UHMA 1C0AA 5GANd 4M7AD 3LAJA 1FWZA 2M45A 3AAFA 2DEQA 1KU2A 2VXFA 4O5VA 4XTZA 3ML6A 2IRFG 1O7LA 4YRGA 4LFUA 1ZLKA 2K4JA 3IKVA 2YPRA 2IA2A 3QPHA 3HXYA 3ZMVA 5L3EA 5LHIA 1A04A 4C8QC 2ZT5A 3K9TA 3FM5A 2I4LA 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3TO7A 5GAMh 3EFRA 3V7SA 4PGHA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 1B34A 1LDKB 1G5HA 4M7DF 1IW7F 4P73A 1JE8A 1NHAA 4RB3C 1J7KA 4EX5A 2EJFA 2YSRA 1SMTA 5ERIA 1YW8A 4J6YA 3BY7A 1B76A 1HKSA 2FEZA 2IP2A 3L00A 4LLGF 1YTYA 3GFIA 5L3BA 5E17F 2FE3A 2MH2A 2OZUA 2VC8A 4UP7A 3EDPA 4XTUA 4PNOA 1B7YA 1L3LA 3K2ZA 2ACJA 3UGQA 3WE3A 4R79A 2DZCA 1WQ2A 4XTXA 3CMQA 3I71A 1DPRA 3T8RA 2IY5A 1RIQA 4XRFA 3TEHB 2OBPA 5HLGA 2QYOA 1I8FA 1JHHA 4DNCA 1M5Q1 4EJWA 1XDUA 5BMZA 2DU7A 3JB9G 4U0VA 2RN7A 3SQNA 3JSOA 4XQ3A 1W7PB 1T98A 3SFZA 2K7LA 2HKXA 3I4PA 1TH7A 3HSRA 4IVNA 3VEPA 4M9ZA 3HSBA 4RGUA 4ZYGA 3FF5A 6PAXA 2ZXFA 3L2CA 1NYRA 1PYSA 5E8GA 4BHBA 2LKPA 1QPMA 3NEMA 5E3IA 5D8LB 3K1MA 1X56A 4OIPF 4NQWA 2ZZEA 2DO7A 4I7HA 4CICA 3GWZA 1WNLA 5ICEA 3VBBA 2FYKA 4ZYHA 3WTZA 4CHUA 4A0XA 2DDZA 2EV0A 5HS7A 2MLKA 2LSOA 2RA2A 2UXNA 2XKPA 5BPDA 1MGQA 4HOBA 5GMKi 4EQQA 4KN4X 3ELKA 1PP8F 3A7UA 3IHUA 4OINF 4CZZA 1JRIA 2AMCB 4N9HA 4G9YA 1HW1A 2LF7A 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 4M7DD 1B7YB 3LFKA 4JUVA 3C3WA 1J75A 3LA2A 3V8JA 3HFZA 4LLLA 1XMAA 1P6RA 4WXCA 5CVIA 2ODRD 2V1DA 1ADYA 3ECOA 2BE5F 5E1XA 2W24A 2PG4A 4CS4A 1SD5A 1KMMA 5LJ5d 1GXPA 3EUHA 3COAC 5GAMe 2O0YA 2HTJA 2NRAC 2NNNA 4O6JA 1FP1D 1WI9A 3HSEA 1FC3A 3LA7A 3FB9A 1ZGJA 3F6OA 2ISYA 3L4GB 2DT5A 1BI2A 4YCVA 1IN6A 1J2XA 1WKMA 3IWZA 2K27A 3H92A 5IT9K 3J80K 3PGGA 1HSJA 2CO5A 2IA1A 1EIYB 4H2YA 2Q5IA 1I1GA 2PMFA 4C92C 3JB9D 3KP5A 1EH6A 3RPUA 3SWNB 1O3SA 3REOA 4NCXA 3HRIA 2OQRA 2ZT6A 4P5OA 4U7DA 2BEOA 4H2VA 2O6GE 1MJ9A 2DAOA 4HAMA 2ZNJA 4G85A 4YRTA 3MQ0A 3JCMW 4KN7X 5HDKA 1SESA 1EV7A 2ZIOA 1J0RA 1EH8A 4K2EA 4IXAA 2PJPA 3V7RA 2GXGA 2P5VA 1ULYA 3DFGA 3VQVA 2P6SA 2VBXA 1NJ5A 3HY0A 4MQ9F 4M75D 1ZN2A 4YRLA 2CIMA 5GMKe 2P0LA 4PDKA 1USTA 2ZCWA 5TJJA 4MTEA 1IN7A 5JVTA 1SFUA 4HX4A 3EYYA 2V1UA 1FZPB 1UB9A 4RCCA 2YLBA 4ASNA 4RGSA 4TVWA 3F8FA 1PUEE 1L0OC 2DVEA 4FX4A 1P2FA 1HW2A 2VBZA 4RDXA 1LDJA 2AMCA 2W25A 1Z7UA 3IWFA 1X3UA 2WWYA 2ZCEA 2E10A 2W84A 3CLOA 4B8XA 2K02A 1QQIA 1FYKA 12ASA 4C8QE 2IT0A 1WU7A 2EL9A 2ZNIA 5AIQA 1IRFA 1Z7MA 5HGQA 1FT9A 2VBWA 1U5TC 1W5SA 2Y90A 4MMLA 5LJ3g 3ZP5A 4RB2C 3KLNA 2IVMA 3GFMA 3LSQA 1NYQA 3I7FA 3C7JA 5FFXA 2GA1A 4FT8A 5ILVA 2ZKZA 1SETA 2Y75A 1IRGA 3R4KA 5IT3A 3O3KA 1B8AA 3HY1A 2GA2A 3BDUA 5CAIA 2H6BA 5E18F 1QE0A 4X5OA 5AONA 1I6XA 4UVCA 3NEUA 1R22A 1L0WA 1RI7A 1R1UA 4ESBA 2R3SA 5ED4A 3LAPA 1WWXA 1W7PA 2JT1A 1BC7C 2Q2EA 5JHUA 4M75C 2CYYA 2X4HA 3QPTA 1ASZA 2H27A 3CDHA 2VOOA 3BPVA 4EVIA 3JCMb 2JTVA 4WXHA 2PLYA 4TVAB 3P9CA 4KQEA 4IHTA 1HXDA 5E1WA 1IN8A 3BZ6A 3JCMf 2QLZA 4YCWA 4YRCA 3MCZA 2WV0A 1P92A 5GMKm 4C92B 1OPCA 4M77A 1ON1A 4Y17A 1JJCA 1O7FA 5K1PA 2A68F 3I58A 3RERA 4CH6A 4HV5A 5KK1A 1REPC 4H2XB 3HFZB 1ADJA 2FRHA 3FX3A 2ZZFA 2HGCA 4L5IA 1YFRA 2DPUA 3QO8A 3P8YA 4P72A 2DW4A 4R8HA 4AD9A 1E1OA 4WWCA 3F8NA 1G3TA 3JCMh 1XGSA 5K5QA 2VN2A 3BP8A 1BC8C 3I54A 2E1HA 5GAOq 2HEOA 3T0YA 4WI1A 4JK1X 2L02A 5GAOn 2ESNA 4GYGA 1TQIA 2HFHA 4GXOA 1BJAA 4XU3A 2Z5UA 3QO7A 4HWSA 3H3ZA 4M9XA 3WTTC 2CJAA 3IRRA 4WJ3M 1USYC 2PMUA 5D4SA 5LRRA 5GMKh 4BH9A 5H6QA 1HKQA 1FSEA 5DD4A 2FMYA 4FHTA 4HWOA 2V79A 4IRIA 1FYFA 1ZGAA 5LGNA 1ZRCA 4M78B 4J5YA 3CUQC 2KIUA 2PBIA 5J8FA 4L87A 1BBUA 3KP6A 4LG0A 4BHCA 3GUDA 5GAN5 4YDQA 4UV9A 4KT5C 1LVAA 1ODDA 1EVKA 3I5UA 4TQFA 2EA4A 1LYLA 3BJOA 3SHFA 3GZ5A 4XEMA 2VT2A 3GFJA 1MDMA 4HW0A 3TEHA 5FO5A 1CF7A 2QTXA 3E9IA 1B9NA 3TEGA 3MFKA 4PJOF 2DQ0A 2OAZA 3CO6C 5FB2A 1FBUA 1FPQA 2ARUA 5BPIA 4WXDA 4Q4ZF 4ZH4F 1T2KA 2ZINA 2NNYA 2A61A 3HRMA 4F7UB 2YX7A 1AWCA 4M78F 2JN0A 2E65A 1FBQA 4JBAA 2ODRC 1KQ8A 1F1ZA 3SZTA 4YCUA 2ARSA 1RIOH 1OYWA 5J8CA 4YRFA 3BWGA 4M74A 1USSA 3BPXA 1BI1A 1QBJA 3IG2A 5JFRA 4OU0A 5LJ3e 3T5XA 5GAN2 2Z33A 4YRPA 5HDGA 3C18A 4LB6B 2G7HA 4ENJA 3JB9I 5ILUA 2DBBA 4NL3A 1EFWA 1YW7A 5CLSA 1LJ9A 4KMUX 4PZJA 1P4AA 2RHQB 4L0ZB 2KJBA 2F5FA 3BDDA 4YIFA 3BW1A 2M8EA 2P7CB 4I09A 1T6SA 1R36A 2XAJA 3A5YA 4H2XA 2EFQA 1MJBA 2CG4A 2RQPA 2M5WA 3HHGA 2ZBKA 5CVUA 2VBYA 1KGSA 5BS6A 3HFNA 1IXRC 4N0AA 2XRNA 2J5OA 3ULQB 1D3BA 1GVJA 2A6HF 3I64A 4Q48A 3FXQA 5LEKA 2DK5A 2FBKA 3RYPA 1JBMA 5H20A 4UP9A 1X55A 4EGYA 4L5JA 3O6BB 4KYWA 3B73A 4U0WA 4A12A 3EETA 4XLPF 3CO7C 5FLXK 1RUOA 5DCMB 1S3JA 4M71A 3I0TA 1B70B 2ZIMA 1SRYA 3FMSA 2DZ9A 4HV6A 1FNNA 4WX9A 5I21A 5LHHA 2HS5A 3NQOA 3MEXA 2J5PA 5KVRA 1YG2A 3HFVA 1LEAA 4GO1A 1VTNC 1H0MA 2QVOA 4YIIA 4C92A 1XSVA 3TDZC 3HXUA 2O3FA 4G6QA 1SD6A 2JPBA 2ALYB 3DSQA 5HDNA 1XGOA 3HXWA 2E3CA 3F8CA 5DY9A 3E6CC 1WQWA 2I4NA 1B59A 1LB2A 5LLQA 3QU3A 2EA2A 4Y13A 3G3ZA 1IN5A 2QENA 3M4GA 4BW9A 1SERA 4A0ZA 3RDIA 5KNNA 3LC0A 2C7IA 2FNPA 3QNEA 4LD5A 3HXVA 4M78D 3P7NA 1QZYA 5C52B 3J81Z 4RCBA 1J59A 2ZGWA 5DV5A 3C1DA 4HX7A 5F5WA 2ZT8A 1BIBA 5GAOr 4YRNA 3HRTA 3JTGA 2STTA 3DXJF 1F5TA 5DEQA 3V8KA 1QO0D 1UCRA 2XGXA 2XV4S 4LGWA 5FGMA 1HTTA 1PDNC 3JB9H 4AWXB 4G94A 3QO5A 1NNHA 1Z05A 1I5LA 2HR3A 3LA3A 5TRDA 5CVVA 3M8FA 2K4BA 1YS7A 1KQ9A 1UHWA 1DDNA 1B34B 1BI3A 3PFIA 1TNSA 3WE2A 4BWAA 4M78G 2OD5A 4M75G 2LF8A 1MD0A 1TTYA 1SD7A 4YFXF 2EV5A 4A53A 2PI0A 2CJBA 3E97A 2YX4A 2G9WA 2EFWA 1W66A 1XSDA 2L4MA 3JCMg 5LJ5e 2FXAA 1G51A 5L3GA 2C6YA 1XDSA 4G84A 4HF0A 4PJOB 5LJ3j 4PJOE 5CVRA 4Q5SF 2L3DA 4C92F 4QVDA 1ZH5A 3DEUA 4C92E 3W3SA 4K88A 1S6LA 4F7UF 2FNAA 3WGHA 1YFHA 1G3YA 1HK9A 5GANe 2V9VA 4M7AB 3A7RA 3TOAA 4U0YA 1E22A 4FX0A 4U7BA 3RIRA 2CJ9A 4H02A
chains in the Genus database with same CATH superfamily
4YELA 4AYBA 2R93J 4XLAA 2Y2ZA 1Z3YA 3PUFA 3QOEA 4FIBA 4DEXA 2DOAA 1SD4A 3IAS2 3OWTA 4NNJA 3WG9A 2L4AA 3ZQHA 4E70A 3OV8A 4S05A 1DU0A 1GBRA 1EIYA 1Y07A 2FU4A 3JREA 5AT1B 2GBQA 2L9SA 4GY5A 1IV8A 2L7FP 2YR2A 4KUMA 4M9SA 2DXIA 4OIQF 4J6WA 2DTOA 1BIAA 3CCRQ 1H4VB 2KQRA 2RV8A 3CCVI 2JA7J 1VQPT 4ZYDA 2GXAA 2EZLA 1OU8A 4BD3A 2Q2EB 4C8QD 1XSXA 1RAEB 1OCOH 1PVEA 1K7AA 2RMOA 1SMYF 3HOZJ 3P8TA 2IGMA 1H3ZA 3E3VA 3Q0VA 5K5OA 4IJAA 1UUEA 4HVVA 2AT1B 3NENA 4I6ZA 5GJVB 2KSSA 4I76A 1U3EM 1KYWA 2BV6A 2LDUA 2H94A 2V6EA 1OKRA 1Y0UA 3A0BC 3HFOA 2ZXHA 3BJUA 1MZBA 4J7IA 4FCYA 1QZEA 2IPQX 5DUKA 4CH7A 4Q6GA 2WSEE 2AKWA 1WJRA 2L7KA 2CQQA 5DLQE 2OJED 5J1RA 1JUSA 2BBYA 3NRVA 2WA0A 4HDVA 2OTLI 2OTJI 1SPKA 4IIOA 5GAN3 2DL7A 2DYRH 3TO6A 4BDYA 3CESA 4E7IA 5BOXA 3X2QH 1CF7B 3LSRA 2LQNA 3U23A 5DM7R 2ARTA 4M73A 8AT1B 2ID6A 3J7AO 2M87A 2D1VA 2MC4A 4F92B 5IYDJ 3DB3A 2QQAA 1OZ3A 1ZSZB 1JU5C 5HK0A 2XF5A 3J7ZI 4IPAA 2QA4I 1YO5C 2YUNA 1E17A 4OF1A 2D2WA 3GBQA 1Y0NA 4Q47A 4HF1A 3R6OA 2WAQN 1I1SA 1U1TA 1UJYA 4P3NA 1IGQA 2DLLA 1EQRA 4ELZC 2OX7A 3ZR8X 4C0GA 5K1XA 2P0PA 1VFCA 1M3BA 2L8DA 1VQ4T 4YRQA 1MNMC 2OC6A 2Z3YA 3JAMZ 2ESHA 2VJIA 3BOQA 3G71I 4M7AG 2Y48A 4HSRA 4P9UA 3T9NA 3OA6A 5IN1A 2MGQA 3LSMA 2H1LA 4PGGA 1KU7A 2ELKA 3KEQA 3M55A 3VYUB 3OYGA 2W85A 4A6DA 4DOVA 1IO2A 1RL2A 4EJOA 1JT6A 1WYXA 4JJDA 4RQFA 3JCMd 4HT9A 3CD6Q 4QVCA 4I01A 1HJDA 1E1TA 4YFKF 2EILH 2Z9OA 1KJWA 2OI3A 2QDLA 1VQNA 4HWTA 2RHIA 1QCNA 1YBYA 2STWA 2RH2A 1BBWA 2KGTA 3MEUA 1GXQA 1NTCA 2RVCA 2R7FA 2B0LA 1WH5A 4RA2A 3CCUQ 3BG9A 2LY1A 2EPDA 2ZTGA 4WJ4A 4J15A 3HSFA 2CFXA 1IO6A 4C8QB 1YJ9A 2HOEA 2KROA 1IXDA 2YHTA 2ELJA 4E7SA 4A5NA 2ISZA 1ZSGA 4J9EA 2CSQA 4E47A 3CCVQ 3SEMA 1G3SA 5GAN7 1VQKI 3GTKJ 2LBFA 4FU6A 1QKXA 3DU5A 2AKWB 3QHSA 1E0EA 2RHZA 2RNAA 3KZYA 1QLYA 3ECHA 1Y71A 2BE9B 3REBB 2E5ZA 2Z16A 1MH4A 4GYIA 2AZSA 3HYIA 3AG3H 2EQKA 1TQMA 2YUOA 2ZZDA 1Q81C 1JEGA 3LSGA 1YLFA 4OB2B 2Y0MA 2F48A 2GOMA 2UV1A 3ZQ7A 1OR7C 1NLPC 1XCBA 1K6YA 5EEAA 5KYWB 1IRXA 1HYOA 3NMZC 5BNGA 2DMTA 1MGTA 1RLQC 4M3GA 2KPMA 3ISPA 3ZCOA 2R7UA 1STZA 2ZSIB 2CW0F 1IHVA 2JXBA 3KBGA 3P9IA 1YJWQ 1JQQA 1FOKA 2OTJT 1VI0A 5L3DA 4HBLA 4HNUA 2JJ7A 3ROUA 1JJ6C 3L9FA 2MABA 3OYAA 2V4JC 4LMYA 4L18B 1IF1A 2DO3A 5HS8A 2JZYA 2AS5F 2ZSHB 3TGNA 1YNZA 2LRQA 5C51B 1MBFA 2IG0A 3MQZA 4YG2F 1TL8A 2KRNA 3K0LA 1K73C 4MQVA 2ZXIA 3QU6A 4A54A 4Z2YA 1IL2A 3FXLA 5LJ3f 3HXZA 1ZTRA 2L0KA 3HM5A 4ESFA 3RCOA 3DPLC 4BL0B 1WSUA 1PKSA 1ZUKA 1QF6A 4BXXJ 3RDVA 1I27A 3BY6A 2DA2A 2NYSA 4ENMA 3QJYA 2CW7A 4PCQA 5J1YA 1T8IA 1OMIA 2NYXA 2IJLA 3RSNA 3G1ZA 2VJ5A 3HTRA 5FLXZ 2EGEA 3LH0A 1J5WA 3SFIA 1MMDA 1T33A 3EYIA 2RHSA 4J83A 4ORZA 2BY0A 4BBRJ 1RESA 5EEGA 3WTSC 2X35A 1OYYA 3GZ6A 1EX4A 3KYCB 4LN2A 4DIQA 1UZCA 1Q86R 4RMFA 2E3IA 3THKA 1ZG1A 4C3HJ 2P5KA 1YI2I 2ZNZA 2CUBA 4OMZA 2DXUA 4L5EA 2K3XA 2RB6A 2XKOA 2DA9A 3M5AA 1U8BA 1QP2A 4EM0B 1IUYA 3JRZA 4J9GA 1KD1U 4FT2A 3JAMK 3HRUA 2UZKA 3F70A 4AIKA 1D1CA 1AZGB 4YREA 2AHJB 1YJNI 5C53B 1LCKA 3TL4X 2FOKA 3MKLA 2VUBA 1VQLT 3F6VA 2G6FX 5FW9A 4EJVA 2W82A 1M3AA 1R7JA 1SANA 2LNBA 2AQEA 1BI0A 9ATCB 2HYFA 1IZ6A 5GAN4 3CPFA 1Z67A 1R00A 4XLNF 4Y7NJ 3TU4K 1W4MA 3H9JA 1K4SA 5DLOA 2HXOA 4BU2A 3SXYA 5KAFC 4M7DG 4C5GA 2VKDA 1H8KA 2X3WD 5ELOA 2HWVA 2QF7A 3EHRA 5IT9E 3RNJA 3CD6T 4PK4A 4EJTA 3REXA 1IHWA 3R07A 3BG7A 2QKLB 3DV8A 4U87A 4EIKA 1X2NA 2RQVA 3EGDB 1VQ9A 2EKHA 4IUTA 3CUOA 2IS4A 3A2KA 3OS2A 4M77G 1RKWA 4XK8E 3G7ZA 1HA8A 3H9GA 4B3AA 2W1OA 4XN0A 3VSKA 2DMUA 3RZOJ 2LCLA 2X9HA 5IHNA 1KQSA 1YITT 1WHJA 1MUZA 3G6ET 1K9MC 3K4NA 4XMYA 5J1UA 4N0AC 4Y91A 4KT6A 3SDBA 4BXUA 4IOAF 2Z2SB 2NS7A 2K3YA 1YHQA 3RUXA 2COWA 5D4RA 5GAMg 1I5ZA 1AWJA 5C3EJ 5KYNA 1T3SA 2J3LA 1O75A 2DRKA 1XPXA 5CK9A 2LY9A 1XN7A 2BHZA 3FMRA 4F7ZA 2V8KA 4QVZA 2ZPHB 3ZMUA 3CC2I 1CSKA 1G5IA 2ETHA 2EIMH 2JA5J 4G7ZF 3JRCA 1CKBA 4L9VA 4LK1F 2COZA 2PTKA 3EFOA 4RTXA 1T0FC 3HRIA 2PMEA 3PSIA 4LVIA 1JJ2S 1I50J 3F22A 1G2HA 2JTEA 3JCMQ 3JCMc 1IXCA 4CCNA 2E1NA 3RTRA 4EJUA 5LEJA 4AIDA 2V9KA 3HOSA 1LPQA 3DP7A 1GGMA 3JCMP 3VOEA 2FX0A 1F36A 3L2ZA 4BQAA 4PSXA 3JB9F 3W2AA 4M75F 3PO3J 3RGLA 3S3NA 4PLLA 1EFNA 2W0ZA 1WYDA 4M77B 1X3ZB 4KA4A 3EHQA 1UB4A 5GTIC 2JN6A 1VQ9I 1FXXA 4GRIA 5C4XJ 3IV5A 1TU0B 4C30A 4LLNA 1M27C 2JZ2A 3MF1A 2NOGA 2CV2A 4MZPA 1XGMA 3BTCA 1APLC 4X1VA 3CC2T 1ABQA 2ZMEC 2XHCA 5B3SH 3H8ZA 1TQPA 2H3EB 1PRMC 2ZR2A 3MEYA 2F5KA 3QTCA 3K4MA 2FD5A 1M8VA 3QWYA 2KIMA 5AIPA 4OB0B 3WTWC 2KISA 1SF9A 2P5IA 3ZL7C 1QGPA 3PVQA 1B6AA 2RHSB 3P9KA 3V8LA 1W2BA 4P72C 2PMHA 1YFSA 4P75A 1G59A 4I99C 2DXTA 4P5NA 4H4KC 2I0NA 3VS2A 2K9NA 4DBHA 4OMMA 3D5LA 1YYVA 4MTDA 1M90C 3CMAT 4NS5A 4CC7A 3A8OB 4OIRF 3BT9A 4LD9K 2IA0A 2BZYA 3RR6A 1M1KC 2NUTA 2LBFB 1UELB 1F43A 5FRMA 3K4CA 2GWRA 2NAZA 1SHGA 1U8RA 5KAIC 3OYBA 4HQEA 2Q0OA 4M6XA 3QG1A 2KXDA 2OJ2A 1M90U 2HU9A 2JPCA 3K70D 3SB2A 2KIFA 1K4US 3R61A 3WTYC 2CRGA 2IXSA 1M1GA 1UG2A 5GMKj 1ZUUA 4C0FA 3N5BB 3I3LA 3M0UA 1WCMJ 3KP7A 1MBEA 3CCRI 3EG2A 1G4DA 1YWPA 3CMAQ 3C0CA 2XTIA 3EFOB 1MMAA 2LJ3A 3VQWA 2CUFA 1K1ZA 2MD5A 2V1XA 3OIPA 4II2A 3SEZA 1R23A 4A4HA 4ZYEA 5F0HA 4M7AE 4E7JA 1QVFA 2D8HA 4TVAA 4ZIBA 1B1BA 5IP7J 1N9SA 4C92G 4X1EA 4M7DB 1EVLA 2F69A 3PNTA 4GDFA 3CCET 5HOOA 5EJCA 1UG0A 3BJAA 4NB5A 3KX2A 3K70C 5DCMA 2KLOA 5JI6A 1WJAA 2IVWA 5LJ5g 4M77C 3TUPA 4PLIA 1TT0A 2A6EF 2FMLA 1X75C 1LJOA 3QYEA 4EMKA 2KDZA 1OQKA 2DFIA 1D0XA 2HQEA 3A31A 1QRYA 2DYSH 2N8GA 3ICAA 1B8IA 1T0HA 1LOJA 1ASYA 4GGGA 4L5GA 4L9NA 4CO8A 2VPRA 1WLPB 5IH2A 2SEMA 2R7VA 3HOUJ 1YFTA 5LRSA 1EIFA 1GCPA 1YITQ 4ITVA 2Z0WA 3VU3C 2EZHA 3M4YA 4LD6A 1F4KA 5A2QZ 5GANg 1Z77A 2UUZA 2BHYA 2KKOA 2JK3A 3GX4X 4JLGA 2ALYA 3FXMA 2XIGA 5L3FA 2CQ7A 1Y39A 2KZGA 1AWXA 2DTIA 1QWEA 3M56A 1K0XA 4ZTUB 4PFPA 1I6HJ 1YN8A 3QO3A 3BFMA 4V2SA 1Y56A 2EYYA 4D8DA 3MZYA 2R7ZJ 5KYXB 1FYMA 2LR8A 3DKYA 3HKZA 2CP5A 2DL5A 5GAMj 1YRNB 1WJDA 1E3OC 1QMCA 2DU5A 4RLFA 3LX7A 4AYBN 2CT3A 4HEA2 3OSGA 4HPQA 3HP9A 3DU6A 2XDPA 4X9CA 2HNHA 1XB4A 4BNCA 4KDPA 4HA8A 4WCGA 2FF4A 4RDUA 4A3GJ 2CT4A 1K78A 1PJRA 4KUIA 3IALA 3H36A 2VXZA 3HOVJ 2EYQA 2LX7A 1DU6A 3EG1A 4LDVA 4WCIA 1Q7YU 1R5ID 4TVRA 2QK0A 3LW5E 5J47A 2X1CA 4C8QA 4LNSA 2GBYA 1GRIA 2KT1A 2AZVA 5CPRB 4EM2A 1I4K1 1D3YA 3A01A 2Q7GA 2CH4W 4I98B 4P3OA 4J9DA 1ZRFA 2CREA 4BI4A 2C8MA 3GVAA 3BQYA 2I2LA 3FWEA 1UG1A 2VC0A 4KIFA 1FOWA 1ZARA 4N0BA 5EGOA 1NJ1A 2LDMA 1WDXA 5F0CA 3AG2H 4P75C 3K69A 4ZDLA 1TG0A 2EAYA 2LVMA 5I2MA 2HKNA 1AVZC 3CMAA 2AIRB 2QDYB 2X4YA 2ICWG 3BR6A 1YI2Q 3QP6A 4UY8I 4E7LA 3HTZA 2JMWA 2J06A 3CQZJ 2CQXA 1B72B 1MSEC 3J7AY 1U1SA 2LZ6B 4QKUA 3Q9SA 1KD1C 4KGXB 1BBYA 1G5VA 4ZTZB 4A3LJ 3S8PA 1VQPA 1VQNT 1LPLA 2X4JA 3OD1A 2FOWA 1TUDA 1YIJI 1UECA 3FRNA 3U21A 1TXQA 2GAUA 3TKYA 1EOVA 1WJ5A 2M4GA 2OZ6A 2Y9YA 1PYSB 5FU7B 4BJ5C 4LUEA 2Z1DA 4OP0A 2HOSA 3H41A 1XCVA 2ZFWA 4RTVA 4LIVA 5HLTA 2KT0A 4M7AF 5IPAA 2FB7A 4IQJA 3M0RA 3OQ5A 4P71A 5KYUA 4EMKB 2FO0A 1OCCH 3IH3A 3WGIA 2RKHA 3NTKA 2XUBA 4BQQA 1HCRA 5GAMd 1UGPB 4PUSA 3KCCA 2HQRA 2K86A 4BQNA 2K4YA 2XICA 3PNWC 3MP6A 4EATA 3MD2A 2DL3A 4TTVA 3QQAA 2M8GX 2EJ9A 3S6WA 2P6TA 2DX1A 2R7SA 2Y30A 4OWRB 1ZGWA 1ZHFA 2EYWA 4BAYA 4BHPA 3FXUA 3CCJI 3MEVA 4P3PA 4YRIA 2VJ4A 2PVDB 1RAIB 2MD0A 2K2MA 2F1LA 4YPFA 3M53A 4MNUA 3M4PA 4KNYA 5JR3A 1O3RA 2NVTJ 4HX8A 2E64A 1KQ0A 2M1BA 4XTYA 1X4PA 1WXUA 2WAEA 1A36A 2OAUA 2RJFA 1FOYA 4M75B 1JHFA 3HOWJ 4JLIA 3CCLQ 3GBGA 2K3FA 3KEOA 2HDCA 2GTJA 1RZ4A 3T1BA 3L2WA 2MWOA 5B1BH 1ZHIA 1XD7A 2KVQG 3L2VA 2QASA 4B4CA 1KQ2A 2E2HJ 3JRAA 1QVFS 2XPWA 4RB1A 2R7RA 1IZ1A 3R0AA 1VQMI 2CGPA 2I4OA 1ONVA 3DPTA 2A69F 3UH0A 2DL8A 4AH6A 2LKSA 4MEYF 4NHJA 3ESWB 2XAQA 1MJAA 4J9IA 2LMDA 1R58A 1RC9A 2CH0A 2HVQA 3FISA 1VQOI 2E1CA 3GNGA 4Y92A 3SWNC 5GMKl 2ZMEB 1ZR2A 1Q81U 1S5LC 2F5CA 5DUIA 2QHVA 1Y8QB 4G7OF 3FXKA 3PZCA 3E6MA 4A2UA 3H35A 3LSKA 4Y15A 3E9FA 1PSFA 1FTTA 1R4MB 2BXZA 4M77F 4HG2A 4XU1A 4ENNA 2XGTA 1Z91A 3FM3A 2EIFA 2R5YB 2AO9A 3K6GA 2B9SA 1B07A 1FY7A 2DA3A 2FQ3A 4LK0F 1UDLA 2H6CA 2CYZB 1E2XA 2BYVE 2Q7EA 1FX7A 4TV7A 3BROA 5DDGA 2L9RA 3N4MA 3I35A 2I5UA 4PJ0C 4UVAA 4A3IJ 1SFKA 2BW3B 2CSIA 5A0DA 2VQHA 4A4FA 4II1A 2R7TA 1ZSZA 3FHZA 2IGKA 4CYCB 1TWBA 4YYEA 5C4JJ 3QP5A 1AU7A 4FL6A 3PSFA 2EJRA 4C8QF 3TCJA 1X01A 3P8DA 1NJ6A 1QVTA 1NJ2A 2OF7A 1HQCA 1XMKA 3SZPA 4NL2A 2O5RA 2XC7A 5FKOA 4E51A 2A07F 3WU0A 2O9VA 4A3JJ 2PFBA 4BEHA 1WHMA 2YU3A 3J81K 2DNUA 2E41A 4F14A 1PCXA 1ZAOA 1HW5A 3RKXA 2L0AA 2RM4A 4OMOA 3CC7I 2J3MA 2HYGD 4NOYA 1X54A 4E2FB 3I9QA 5GAN8 2QQ9A 1A0NB 2D0QB 2XGDA 2ZPFB 3AG4H 1R5GA 2ZMEA 3OYKA 2XF7A 2HSEB 4CC4B 5LJ5f 3J80E 1YIOA 2PN6A 3DKWA 4NC7A 2DRMA 4O2DA 2VGNA 1FIAA 5I2SA 5FLMJ 1N9WA 4HLXA 1VQKA 3AL0B 4P96A 4W1UA 3CEYA 2OU2A 4J6XA 3GXOA 4HDUA 6AT1B 1KOGA 3MZHA 2O4XA 4ATOA 2EGCA 1SG5A 2CGHA 2OTLQ 2F5EA 2X1EA 3BR3A 4HZFA 2A05A 4MIMA 2HYJA 3BTJA 3LMMA 5CYVA 3VODA 4BJTA 2P5LC 4RTZA 5LJ3h 4C8QG 2OTJA 4KR2A 3TMOA 2BVMA 2MC3A 2W57A 1C1AA 3DEEA 3CMYA 2KI7A 3QYFA 2JVHA 4H0EA 3K1PA 1RUNA 3GMEA 4XM3A 3LSSA 3ZMSA 4IHSA 5D5UB 3RMSA 4C92D 2DJIA 1VQ8Q 5I22A 2JRTA 2ME6A 2FQ4A 4PKCC 4J9BA 1OR7A 4ZZLA 3JCMJ 2E5KA 4M77D 3I55I 3M0QA 4H2SA 1Y7XA 3AG1H 3KFVA 3Q5FA 3CJRB 1GCQA 1X6BA 3JSPA 2HI3A 2XDVA 1ZRDA 2O9SA 3PIOF 4CDGA 5FU6B 3A5ZA 1Z9CA 1U2WA 4BI8B 2LCCA 5C0MA 3REUA 5ECAA 2X48A 3KE2A 1HC7A 4ESJA 3PQKA 3RJPA 1NPRA 5JLXA 1RRJA 2RI5A 5FU7C 2EGAA 4X9DA 4LB5A 2XDBA 4H2UA 2CP2A 3ASOH 2WACA 4XOTA 3BLYA 1Y6IA 4DW6A 2DFEA 1MSFC 4KRTA 3CC7A 4U88A 1CGPA 2NLUA 2EIJH 2R0QC 4CGZA 1KYZA 3U2RA 1PD1A 3HBLA 1QQJA 1VIFA 5KYYB 2V1NA 3R60A 4HLYA 3MP1A 2JSCA 2CW8A 1R5HA 2J7IA 5C6SA 3H5NA 3VFZA 1ZBXA 3I59A 3LSIA 4MEXF 2YXYA 3J80Z 3LYIA 3SWNB 5FRNA 1IUFA 2GIVA 1GXIE 1TW2A 3OYNA 4RTWA 5F0FA 2CUJA 4ZGDB 5J39A 5GAGJ 3OYIA 3MCAB 2IPOB 4LE9A 5KE3A 4A5MA 1PC0A 2JS0A 3IQLA 4FSSA 2C06A 4J01A 1QNTA 1HSTA 3FJPA 3P8VA 3GLLA 1EA3A 3ASNH 3ERMA 2CS3A 3H3UA 1AT1B 2KNBB 1ZQ1A 2GOXB 4PL6A 4QQ6A 3X20B 1OX8A 2CS7A 2LC4A 2MMPA 3PM1A 3BG3A 4D0PA 4QT7A 1LKXA 3WU2C 3E7LA 1G83A 3CPWS 4PG3A 3QYBA 3K4LA 2F6CA 1U06A 1WGSA 2IGOA 3TEDA 1OV3A 4L0YB 5DD8A 2DTZA 5DYMA 5IP6A 1VYUA 3EAEA 3JV3A 1GFDA 1TSFA 4M78C 4K86A 3DCFA 1NJIU 1Z6TA 2JOYA 4XEOA 3TOBA 1BOBA 2QHUA 2O8XA 1IB8A 5HVQC 3IRQA 1J5YA 2DA4A 4BACA 1C0WA 2K2VA 2Y0SN 4D5CA 4V2GA 2FPFA 5CQYA 2OCEA 1C0MA 5GPAA 1GBQA 3QYGB 3L09A 4NC6A 4P9FA 1XJWB 3GF2A 1TBXA 2EQMA 4EMHA 4LG0B 5FWCA 2ZT7A 1OX9A 2C0TA 1E6HA 1U9OA 2CP0A 4XBFA 3EUAA 3IP4B 1IAWA 4HWPA 3KZZA 4BEHB 2M02A 4R55A 3CCMA 2F2EA 2XPVA 4ZDOA 3PCOA 2ZO4A 1YJWA 4S0HB 4O3MA 1ARKA 3INZA 3FXOA 3ERRA 4A6EA 2QBYB 1V5GA 1PP7U 3S2WA 1J9IA 2QWWA 2HOTA 2HQXA 1JO8A 5D6XA 5LFAA 2VVKA 1WA7A 4KIGA 3A02A 4RGXA 1D3BB 4LG3A 2L7ZA 3QBYA 1X1CA 3GTMJ 1YJNA 1TOVA 3QOPA 3I55T 1P9QC 1Z7LA 5D5XB 4F04B 1VQKQ 2QGGA 4DPGA 2FUG2 1HKTA 3JB9J 5E3OA 1G6NA 4RB0A 3S2DJ 5CQGA 5FKMA 5E8IA 1QWFA 3RBBB 1SAXA 3F21A 1SVLA 1NK2P 4ZN3A 1H4TA 1FSHA 2L01A 2ZR3A 3HUGA 1IXSB 1TWAJ 3ERED 2G3RA 1Q81R 1SVMA 4H2WA 1B72A 2X3XD 4LXCA 4MGRA 3FZVA 2DODA 3RPQA 1ON2A 4IF4A 3OY9A 2K40A 4M7DC 2XAHA 4OOIA 2R5AA 5ICFA 1T08B 2G4CA 2KT8A 2XASA 2DBKA 2QHTA 1SEMA 1V4RA 3L7WA 3WGGA 4RS8A 5HLIA 2WAQA 3G73A 1ZX6A 4M6YA 3QWXX 3DLMA 4FW2A 4XOPA 3S1RJ 5GAOp 3C4SA 1Z21A 4LIUA 1KZHA 5D8KB 2E7XA 2HQHA 2HZDA 3FXJA 5CQXA 2IY5B 3KP3A 1GT0C 2LNHB 3CF2A 3FIFA 3R0JA 3F3XA 4UHTA 3E6DA 4EDUA 2AHQA 2GQQA 2LQWA 5CJ9A 2M0MA 2IIMA 2ZXJA 3DTKA 4IHYA 4IRGA 3IKMB 3UR3C 2VE8A 3M7GA 2GZWA 2DI3A 2I4MA 1RI0A 2V6CA 2XAGA 3WTUC 4C5HA 1VYVA 1T56A 3EUHC 2DQLA 4JQFA 5LBQA 4BY1J 2VJJA 2F5VA 5LHGA 2A7YA 4F16A 2WV1A 1KMNA 3RL6A 1I81A 3M1CA 1TUCA 5BQTA 2PVGB 2QTVA 3NGPA 1UFMA 3AKZA 1VQ5A 3UFGA 1T38A 1WJBA 4AM3A 2QA4Q 1IGNA 3QUIA 2OV7A 1QVPA 4FYWB 1MHNA 2Q1ZB 4EMSA 4YFNF 1RABB 3QODA 2HQAA 1JUPA 4FYYB 1H9TA 4KH0B 3DTIA 4ZZDA 2IEKA 4IURA 2NWMA 4RM2A 3WTVC 3ZQFA 3O2PE 2MFZA 1KA8A 2CDTA 3PO2J 4JRIA 3CCMI 3ABLH 1EZZB 1M8MA 5FKLA 4CI0C 3JCMe 3EG9B 1KFZA 2K9MA 4ZJZA 4S04A 1BOAA 2B8AA 2ED0A 4BE2A 2VC1A 3U9GA 1A6IA 4QWQA 1AWOA 3FIWA 1H9GA 5E20A 3K10A 3VSLA 4XLCA 1NG2A 2D45A 1TS9A 1WIEA 4Z89A 3ZQQA 3G4SI 3LSTA 2M7AA 3AL0C 1FLIA 1XTDA 3VS1A 3BR0A 3KP4A 3L42A 4CH5A 1EIYB 3LFUA 5HLHA 5D6FA 1ZG5A 3KETA 1JGGA 3I56A 4AVPA 1Z3XA 4N9IA 5FU6C 3ZFJA 2A3SA 2FHDA 2J6KA 3GIBA 4QSHA 4F91B 4AG2C 4P73C 3DTEA 1XX5A 1AOYA 4HCCA 4HCKA 1WLEA 2W4SA 4TWAA 4Y28E 4L9TA 5ILSA 1SFOJ 2K57A 3H0FA 1ZA1B 1H4QA 3OL4A 2K79A 4B44A 1X2GA 1D1BA 4B09A 1EH7A 2HXIA 2XRLA 1NEGA 1T0FA 3ZPLA 2RI2A 1U6GA 3JCMX 4RAYA 4CS3A 3QAHA 3GLXA 3D5RC 3PFYA 2M1HA 2ZZGA 3MKYB 3GTQJ 4UUSA 1K83J 1YQAA 3RF1A 1KQ1A 4CH4A 5KYYA 1S7OA 4KMFA 1JKOC 3HIFA 2LQ8A 1YJ9T 2EFNA 2LG4A 2PVOB 2WY7Q 4M75E 2H1KA 3I5SA 4XRSA 3W2WA 1ZSZC 4GCVA 3OMGA 5A0GA 1JXSA 1OCZH 3UGQA 2FSWA 5GP9A 5K7ZA 4IHXA 4J9HA 2VODA 1D8KA 4XRSG 5KE2A 4XN3A 1TLHB 2RHXA 3FJ5A 2K3BA 2DJZA 3GW2A 3J7YJ 4RG8A 4BB7A 3DKMA 1M2VA 4QPQA 5GANh 4UXNA 1HBXG 4HT8A 1ZLJA 1BW5A 4OB1B 1S29A 5FKNA 2DF6A 4YRRA 1YIJQ 3O8VA 2ELHA 4RMOA 2EJGA 1KD1R 4UUVA 2QI2A 1P4WA 1VNDA 3D1NI 4D9JA 2WBMA 3MWMA 2LKXA 1B9MA 3K4BA 2UWMA 1BBZA 2HNIA 4I0AA 2LJ1A 4PJOG 4UV8A 3TDUC 3Q0WA 2RHYA 3Q0UA 5FD5A 2DL4A 1O57A 4BJ6C 2QGUA 5FFZA 1VQLQ 2AKLA 2FVUA 1HF0A 4UPAA 1M30A 1OQYA 4KUDK 1VQNI 3CCVA 2NUPB 2XKOC 4M4ZA 2QM3A 1UAAA 1ZA2B 3GYHX 1W1WE 4CYDA 1RAGB 1I0CA 3IUOA 2DLPA 2DQRA 4A0YA 2RHUA 3G71A 1YITI 2BOLA 1I1JA 1V29B 2LC2A 2KRFA 2EFOA 4FTHA 2E7WA 4UP8A 1UEBA 5EZHA 2E5QA 4JZ4A 3SZGA 5HY6A 3KP2A 2J6FA 3ABTA 1T39A 1H92A 3N97A 2ZNYA 2PMZA 2Q8KA 2RPNA 3VYTB 4DBFA 4K87A 5EEHA 4EM1A 1QP3A 2F5DA 3HHHA 2EW3A 1W4SA 2RO0A 1U9NA 4HNTA 3KFWX 3L1AA 1AEYA 1VQ7I 4DOWA 3CD6I 3DQVC 1FBSA 1AA7A 4TVYA 1IGUA 3MP8A 4TQDA 1LNWA 1MDMB 4AU7A 2MI6A 1AZEA 2X0LA 3HRKA 5D5WB 3ZOBA 1R1VA 4IQ4A 4F7UE 2QHSA 2VL8A 4PHCA 2KIQA 1YE9A 1U78A 2VOPA 4FM4B 1QZZA 5KYXA 3A03A 2XU8A 1V5FA 2W7NA 3CC4A 3DB4A 1YS6A 3HL8A 1E3HA 2MH9A 3EH2A 3L4GA 1ZELA 2MIOA 3CTAA 3RQ4A 4AC0A 2HDAA 1SRLA 2QAZA 5LJ5j 2VONA 1MW7A 1VQ9T 2XVCA 3A4CA 3A7AA 1YOVB 2BY1A 1TP4A 2RQRA 1USYA 2I8DA 3K7AJ 2RD1A 3VQYA 3SDGA 4D1QA 1IV6A 4CS2A 4QIWN 4C3JJ 5L3CA 1FYNA 4DZPA 2M9UA 3Q1JA 1QVGS 4PJOD 2DA5A 2X85A 2PQWA 4M7DE 3GO5A 4M78A 4XU2A 3HOXJ 1M2VB 4J00A 4R1HA 3W3CA 3CBOA 2CWEA 4LDYA 2JVGA 1H641 3X26B 4XLFA 1NH3A 4MFEA 3MPUB 3WQZA 4MMKA 3LWFA 1MKMA 1JUMA 1RR7A 2XHKA 3OIQA 1AKHA 3ZN0A 4WF2A 3F8BA 2ATCB 1H4SA 1Z0XA 3Q9VA 5GAOm 3Q3SA 4DQ2A 2HL5C 4C0DB 1KIKA 3NEMA 4XLHA 4AT1B 1VIEA 2D6FA 2O03A 3JW4A 4IUQA 2LRDA 3CBMA 1R0BG 4F7UA 5JHFA 2HAXA 2VT3A 2HVSA 4PJOC 1JJCB 3M0PA 1JXOA 3E2UA 1BM9A 2HZYA 4KICA 3NHNA 3LQRA 1ZG3A 4YEJA 2L7MP 1FEXA 2COBA 2RNGA 1DP3A 3VB2A 2EQRA 5D6EA 1MBHA 4MZMA 3HOYJ 4HT4A 4PSWA 4UVBA 4M72A 2LX9A 2FBIA 1H8AC 4OGCA 4AFSC 1SFEA 4MO7A 4RGRA 2HKOA 2BZ8A 4UB6C 2DTHA 2NS0A 2COYA 1I39A 4BDZA 4J8OA 4OMQA 4YRMA 2D1HA 3GZNB 3BG5A 3HOTA 1R9TJ 4HRIA 1WQ7A 2HQNA 4ZYAA 4OMLA 2MLGA 2PX9A 4ETSA 1KC8R 1S7AA 4XU0A 3PCOB 4YRSA 1B4AA 3IH4A 5H6RA 1HOMA 5CKDA 1YWOA 1VA7A 1W7PD 4NCXA 1QHHD 3B6CA 3IKLA 3QZ5B 3ZN1A 2O61A 4KISA 2ZPIB 1X69A 2QGFB 3JRDA 2FBHA 2Z99A 3M1EA 4WTOB 3I56I 3P5JA 2LK2A 1JJ8C 2WSFE 1N27A 3A74A 1IN4A 2YRVA 3TO9A 1LEBA 1JI8A 1S8NA 1U5TB 1XNIA 2YT6A 4HSTA 2HBWA 2X4WA 3OYYA 5LJ3d 2E35A 2BKDN 2CZ0B 1NJ8A 1SC7A 1XG1A 1FYLA 5IOZA 4C0DC 4LVKA 3VRYA 3VQXA 3A8HB 5K7FA 5CCAA 5L8RE 3V7CA 5IT9Z 2F2XA 1K8AC 3MF2A 4P74C 4M7AC 1IC8A 1QHGA 2VIXA 2IS6A 2MYSA 3LQQA 4F7UG 3KFUA 1I3QJ 3BR2A 4BS9A 2CP3A 3VJPA 2QYZA 2M0OA 4V2FA 1FP2A 1WGXA 1WJFA 2M16A 4XTWA 3HTSB 1ETOA 1WJQA 1X1DA 3SJMA 1RI9A 4RAGA 3WTXC 1VUBA 3MO8A 5D5VB 2K3PA 1ZR4A 2KYBA 2R58A 1X2HA 4JRPA 2KHMA 1QA6A 3E6BA 1ZREA 1TTHB 4RBOA 2RK2A 1OI1A 1D09B 1RAFB 1OYIA 1X1BA 4DJAA 1A5JA 1VQ7Q 1X43A 2E5AA 1SKUB 2CFOA 4HQMA 5FD6A 1Z7NA 4RAZA 4OVAA 3TSZA 4YRVA 3CCJA 3WU1B 5LGTA 3A01B 1M4ZA 2PU9B 3ZMTA 3EQLF 4M75A 3G71T 1B70A 3M4QA 4KR3A 3G6EQ 4G6DA 3T8TA 5C44J 3MKZA 3NAUA 3IH2A 3L2QA 5ICCA 1VQ8T 3E5QA 5CVJA 3F23A 2QG9B 2QQBA 3CCLT 2Q5HA 4YP0A 3FK6A 1WRJA 1GHCA 3UATA 3QSUA 2EH3A 3OL3A 4I02A 4HYEA 4CXFA 2HMAA 2RDPA 3ZBDA 4G8XA 4HVWA 2YSQA 2DTRA 3OYLA 1Q1HA 5LGUA 3C94A 1E24A 2TCTA 2R7OA 3OOPA 3L1PA 4A3DJ 1M9SA 2AQFA 1VQLI 4MHGA 3ULRB 3M4OJ 3IL2A 2ROTA 3A32A 3CZ6A 3GEZA 5HKCA 1ATIA 2DPDA 1YGBA 2CSOA 2WAFA 5CKEA 3I55Q 3HTUA 1BN5A 2QUFA 3E9HA 4DBQA 3CCQI 1K6OA 3ZMZA 1OCTC 1Q86U 3R6SA 1W36D 2JM8A 3M8JA 4JS4A 1K73R 3IG2A 3ER0A 3CXCA 5A2QK 2P7VB 1VQ8I 3O8HA 3KLOA 2VXEA 2KJCA 3NELA 2WTEA 5KH6A 8ATCB 3OR2C 1YHQT 1QVGA 3PMTA 4KFCA 2EFPA 5KCMA 2A5YB 3K1NA 4XKCA 3PQJA 3GFLA 2EQUA 4XSXF 2R7DA 2DEUA 3CUQA 1YW9A 3W6KB 2DKGA 3EG3A 2PNIA 1NG7A 4M78E 3AHUA 1YB3A 1W5CC 2IW5A 3JCMV 4ON0A 3IC7A 5GAN6 4HF2A 3TREA 1X2MA 3M9AA 2B63J 2UXXA 2GXBA 2QEXA 4XKBA 1GL5A 2VQLA 3HJEA 2HL3A 2DK8A 3HGGA 4UNOA 2JNGA 4N4HA 2GFUA 5GANf 1N8RC 1K78B 2H09A 4YRKA 4EX5A 4BKXA 3MZ8A 2ECCA 3CCSA 11ASA 2L3QA 1O3TA 2YLCA 3HUGB 4AIHA 4F3QA 2LNVA 2ADUA 3KXTA 2R5ZB 3WHBA 1GLNA 1D5YA 1KU3A 1X2KA 1DP7P 2ID3A 1LFPA 4XSZF 1WHKA 2BZXA 2IGNA 1D5VA 2HDDA 5F64A 1YITA 2CUEA 2JS2A 4IZZA 4LVJA 3FLGA 5ELNA 3M59A 3G1LA 2G7UA 1Z1DA 2RHQA 3CCEI 4A63B 1HD3A 4PJOA 4V19K 3RACA 3I55A 1YJ9I 4DA4A 3LSPA 2E2IJ 1W2BP 4Q15A 2OQGA 3BJ6A 1F9NA 3B02A 2MAMA 4M77E 3G2BA 2RC4A 1VQZA 4N4GA 1NBEB 2XD0A 3OS1A 1W6XA 1LQ1A 2VASA 3EGXB 1K79A 2R7XA 4H2TA 4E4HA 5EDNA 3CPWP 2QQ8A 3DPUA 1WHHA 2YWWA 1A35A 3DF8A 4OIOF 4UUTA 1Y96A 1VQ4A 2BY3A 2BE7D 2NOJB 2EQIA 2LP5A 4LJZF 2TDXA 1KSWA 4RKUE 1N77A 5ICGA 5J26A 3BG6A 5EG0A 2O8KA 2ZXFA 2GTOA 3I59B 2EK5A 4XNFA 2QEXT 2MA3A 2P4TA 1JKRC 1PM3A 2X6OA 2OPTA 2ZB9A 3ZQCA 4JJBA 3KEYA 1R8OB 2KE9A 4B9WA 1D8JA 1K9MR 3UGTA 1Y8RB 2QSHX 1XQHA 2EV6A 2NXNB 2VE9A 3RKWA 2FRWA 4M3FA 1VQ7A 1RNLA 2L54A 3F8MA 1NG6A 4C3IJ 3ZMDA 3H0HA 3W6JB 1FTZA 1RAHB 4EO4A 2AXLA 3RI4A 3QRFF 2F2VA 4IRHA 2X4XA 4Z02A 1R1TA 1GVDA 1ZKGA 1X1AA 3BZKA 4FE7A 3I53A 4NC8A 1MMSA 4RAFA 1B7TA 2XI9A 5GAMf 3CCRA 1K9AA 1TNTA 4L9JA 2KAFA 4M7DA 5E3LA 4FW1A 2Q7HA 5K1YA 2A28A 3V4GA 4CH3A 1OEBA 3KZIC 1Q82C 3OS0A 3FEOA 4ENKA 4WK8F 1RR8C 4B6MA 4I2OA 2X6XA 4BYYA 2OTLA 1DUXC 2YDLA 4XTVA 2P4WA 4BE0A 4QLCU 4ZGJB 3HRSA 1TW3A 3M8EA 3E9GA 2DERA 4OLFA 2B7EA 1N9RA 1LDDA 2XAFA 5B5EC 4YROA 3TQNA 1YCYA 3SWNA 3OYHA 2COMA 4FISA 2BZTA 5GAOl 5HNFA 1LNXA 5FROA 3MN2A 1ZYRF 4G7HF 3WODF 2EKOA 2MBFA 1V3FA 4HVCA 3REAB 2QA4T 3CCLA 3EUKL 2IS1A 3ZQLA 3A8LB 3I4NJ 4EGZA 1WI7A 3CUQB 4YIRX 5CIUA 4P55A 5J6XA 2DA6A 5J4VA 4J7FA 4BUGA 3E5XA 4XIDA 3VYGA 4M7AA 3UT1A 2RGVA 4P74A 1JGSA 1DPUA 2A08A 3A8MB 2H8HA 1LVKA 1SFXA 3MAJA 1WPYA 3BR1A 2ZJQF 1BW6A 2QCOA 2HQ5A 3MVPA 1Y96B 3RYRA 2JMCA 4HWRA 4KBMB 1VQMA 3CPWA 1M90R 2XROA 2L5QA 3IAM2 3SEQA 1RETA 1Z6RA 2K9GA 2P0QA 4C5IA 2PJRA 3U1DA 3IKTA 2WC2A 2EZIA 3BQZA 5F6FA 3TQ7P 3I4MJ 4ANJA 4EMKC 5E1ZB 5GANj 3F72A 1AOJA 5DCFA 2PQ8A 2D9TA 2RQTA 3OSVA 2RNJA 4BGDA 2CQKA 3A0HC 1W0TA 2HZTA 1N8RR 4EMGA 4I0BA 2DYIA 5FKKA 4A4KA 1W5TA 2FA5A 4KIBA 3RKYA 3EFSA 2ED1A 5GJWB 2P8TA 4LVMA 2EB7A 1X1PA 4P71C 3FXRA 1JJ2P 2X9DA 1G3WA 1AHJB 3FMQA 3RESA 3JTHA 5K5RA 2DXBA 4E6RA 1XGNA 2YUQA 4M3BA 1KU9A 2LTPA 4EV0A 2QSFX 1D1AA 3E5UA 3HG9A 1HSQA 1YP5A 2KR3A 2L3PA 2EWNA 1VQPQ 2M30A 2HVRA 4JRKA 4C2UA 2E2JJ 2NS6A 2F4MB 1UHMA 2LD5A 1C0AA 3QXEB 5GANd 2HOAA 4Y33A 4M7AD 3C2HA 3LAJA 1FWZA 2M45A 2OTLT 4KGVB 5FWBA 3AAFA 2DEQA 1KU2A 3E19A 1S72Q 2VXFA 2VV5A 2Y0SA 2YUSA 1K8AU 4O5VA 4XTZA 1K8AR 3W3SA 3B6AA 4DGWB 3ML6A 2IRFG 1QVGP 1O7LA 4YRGA 4LFUA 2HDWA 1ZLKA 2K4JA 3IKVA 1V1CA 2YPRA 2IA2A 3QPHA 1W0UA 1WHLA 2E6ZA 3ZMVA 1RADB 5L3EA 2C0IA 5LHIA 1A04A 3VUBA 2EBPA 1YIJT 1KQSP 2P0WA 1R0CB 4C8QC 2ZT5A 3K9TA 1YX5A 3FM5A 5CKTA 2I4LA 2ZJ2A 3ABUA 2HTSA 2OA4A 1P4XA 3O8GA 3TO7A 2WADA 3EFRA 1G2BA 3V7SA 4HKEA 5GAMh 1HC8A 4PGHA 3PUBA 1O3QA 2DU9A 3D0SA 2BGCA 1U5TA 2PEXA 3G6EI 4F52A 1QPIA 1EKEA 4E7ZA 3NWTA 1LDKB 1B34A 1RLPC 1UHSA 3OS5A 3CJTB 1G5HA 1OYXA 4M7DF 5B1AH 4BI3A 2ZJRF 1O4XA 1IW7F 2E70A 3QIIA 4P73A 2XSDC 3OYFA 1JE8A 3GTGJ 1V54H 3GNFB 1VF9A 3AT1B 1NHAA 3LGFA 4RB3C 1ACIA 1J7KA 2A36A 2CUZA 4PJMA 2YSRA 1SMTA 5ERIA 1YW8A 2ABLA 2EJFA 2HEQA 4J6YA 1OPKA 3BY7A 2R5YA 4AG1C 1VQ6Q 4IKFA 5LL6S 1B76A 1HKSA 2FEZA 2IP2A 3L00A 1BU1A 4LLGF 2I10A 3WG7H 1YTYA 3GFIA 2M2EA 5L3BA 2JT4A 2KDSA 5E17F 2FE3A 2MH2A 2OZUA 4OB3B 2VC8A 4UP7A 3EDPA 4XTUA 4PNOA 1B7YA 1L3LA 3K2ZA 1WX6A 1LUJB 1UTIA 2OUMA 4MDXA 2ACJA 2X6YA 4II3A 1IJWC 3CCSQ 3WE3A 4R79A 4IEJA 1PSEA 2DZCA 1M2OA 4RTTA 3TP3A 2DK3A 2YRCA 3URGA 1YIJA 1WQ2A 2RJEA 4XTXA 1VQPI 3CCVT 3CMQA 3K4JA 4L6V5 3I71A 1DPRA 3T8RA 2IY5A 1RIQA 1ETXA 2KDOA 1RPWA 2E34A 4XRFA 3TEHB 2KL4A 4Q5WA 2OBPA 2RREA 4A4EA 5GADJ 5HLGA 2QYOA 4CCOA 3PJRA 1BYMA 3VS7A 1I8FA 3G4SQ 1JHHA 4DNCA 1M5Q1 4IUPA 4EJWA 1XDUA 5BMZA 2DU7A 3JB9G 1ERDA 2ME0A 3FBNB 4U0VA 1FJLA 2RN7A 3SQNA 3JSOA 3PIOA 1UGQB 4XQ3A 2DIQA 3UA7A 4N4OB 4DOZA 3EH1A 2WB1A 1W7PB 3M57A 3I56T 1T98A 3SFZA 2FG0A 2K7LA 3A98A 1X19A 1Q95G 3CD6A 1IDYA 4AMCA 2HKXA 4QQGA 1GUUA 3I4PA 1H88C 1F1BB 2O88A 3ZQGA 3MJXA 1EJ9A 1NYFA 3HSRA 1TH7A 3CMEA 2DCEA 4IVNA 3VEPA 2DT6A 4M9ZA 2M51A 5CKFA 4ABZA 3WXMB 4LDWA 2A8EA 5KYWA 2KRCA 3HSBA 4RGUA 2LYCA 4ZYGA 4QPOA 1ETVA 3FF5A 3H5AA 6PAXA 3L2CA 2XIDA 1NYRA 1OCRH 5E8GA 4BHBA 2LKPA 1QPMA 1OULA 5B66C 1PYSA 5D8LB 3K1MA 5FJ8J 3VYSB 3A5ZB 1X56A 5E3IA 5EYRA 3HPGA 1GDTA 4OIPF 4NQWA 1RUWA 4GBQA 1YI2T 1AWWA 2DO7A 4GLKA 4I7HA 4CICA 3GWZA 4MDWA 1MV0B 5D7UA 2LFBA 2JRMA 2XG8D 3CBPA 4HXJA 1WNLA 3VS0A 3S3OA 5ICEA 3VBBA 4N4NB 2FYKA 3C95A 4F17A 3PNVA 3FC3A 4MLOA 2CP6A 4ZYHA 4C2TA 3WTZA 4CCJA 4CHUA 1KK7A 3TVTA 4A0XA 2ZPBB 2DM1A 2HSPA 1S72A 1KG1A 2DDZA 2EV0A 1VQOQ 3MHXA 5HS7A 2MLKA 5LJ5h 2JVVA 2LSOA 2RA2A 4JP0A 2UXNA 2VQGA 5EG2A 2LREA 2XKPA 5BPDA 1MGQA 2M34A 5F1JA 1ACMB 2TRTA 4HOBA 5GMKi 4EQQA 4KN4X 4ZNXA 3ELKA 1ETKA 3CMEI 1PP8F 2BIVA 1Y57A 4YRJA 5A2QE 3A7UA 3IHUA 2PUOB 2CUDA 2JUFA 1R4NB 4OINF 4FQGA 1ETQA 2VKHA 4CZZA 3OYJA 1JRIA 3FBIB 4GLMA 4Z8AA 4N9HA 3TW6A 2AMCB 4X34A 4G9YA 4RMNA 3UNGC 1HW1A 4OAZA 3V42A 2DFFA 2LF7A 3LSJA 2QZ8A 2QBYA 4AIJA 4OMYA 3CJNA 5F1RA 5HS9A 2NVUB 3KUFA 2P0KA 1XC5A 4M7DD 2V1RA 1B7YB 4CSWA 3LFKA 4JUVA 3C3WA 1J75A 2CMPA 3LA2A 3V8JA 4LLLA 3HFZA 1MNDA 1XMAA 3P8HA 2VWFA 3H0GJ 1P6RA 4WXCA 5CVIA 1GFCA 1AKHB 2ODRD 2OAWA 1VQMQ 2V1DA 4ZDPA 3S17J 1XS9A 4PJNA 1ZLMA 1PUFB 1ADYA 4A93J 2YUPA 3ECOA 2BE5F 5E1XA 3VS3A 2W24A 4ZC3A 2PG4A 1BR1A 1BCMA 3LLRA 1SD5A 1Z9ZA 3CCEQ 3HXXA 4CS4A 2Y69H 2VKEA 3H6ZA 3OW2P 5M3FJ 5LJ5d 1GXPA 1K61A 1N6AA 2VKNA 1KMMA 3EUHA 3COAC 5GAMe 2O0YA 2HTJA 2XB5A 2NRAC 2NNNA 2EYZA 2JM9A 3JRBA 3CCEA 4O6JA 1FP1D 1WI9A 4FT4A 2VB6A 4AVZA 3HSEA 3ME9A 1ORKA 2V1QA 1FC3A 3LA7A 2HBPA 3FB9A 3OYMA 1ZGJA 3F6OA 2ISYA 3BTLA 3FKJA 2D5VA 2KRSA 2KXCA 2DT5A 3L4GB 3ZGKA 4PFOA 4DBRA 1R77A 3R6NA 2VYTA 1BI2A 1WPKA 2L2PA 1YJNQ 1Q7YR 3K4KA 4UB8C 3TBIA 4YCVA 1IN6A 5J4YA 1J2XA 4E6KG 3ZRGA 2LJ0A 1WKMA 1X58A 1H89C 3IWZA 2ZJPF 1BK2A 2K27A 3H92A 1VQMT 5IT9K 3J80K 1UJ0A 1SVOA 3PGGA 1HSJA 1X6OA 4B1RA 2CO5A 2IA1A 4DYRA 2P81A 2DMNA 1WVRA 2Q5IA 4H2YA 1I1GA 2PMFA 4XKVA 1N8RU 2F4OB 2M0YA 1QCFA 4C92C 3JB9D 3KP5A 1EH6A 2DBMA 3C2BA 1ZUYA 5IHIA 4CC3A 1J09A 3RPUA 4R0KA 1OPLA 1O3SA 3REOA 4IHWA 1T0JA 5HCKA 2GCXA 3EG9A 2DVJA 3QDFA 3FKIJ 3CCRT 1WHUA 2LT4A 2OQRA 2ECBA 2HD0A 4ZN1A 1YJNT 2ZT6A 4P5OA 4U7DA 3VPRA 2KZVA 2MOXA 1JXMA 2BEOA 3BZCA 4H2VA 3HB9A 2O6GE 1MJ9A 2DAOA 4HAMA 2GM4A 5DM7F 4BBSJ 1YI2A 1K0SA 2ZNJA 2BXYA 3MQ0A 4G85A 2M9HA 4KN7X 3JCMW 3OBYA 4YRTA 5CO7A 3M07A 3GTPJ 1NJIC 2DA7A 4C9YA 5HDKA 2F2WA 1IG7A 3OMCA 3VS5A 1BB9A 3CDIA 2QSGX 1SESA 2NVYJ 4CZCA 4A3CJ 3S1QJ 1EV7A 5GAHJ 2ZIOA 1J0RA 2CZ6B 4ESRA 3NTHA 1VQ4Q 1EH8A 3BCAA 2BW3A 2E60A 4K2EA 3G1JA 1N25A 4IXAA 3OW2S 2PJPA 4CUGA 3V7RA 5IYCJ 2GXGA 3VYRB 2CQNA 3SFMA 2P5VA 1ULYA 3DFGA 2X6WA 1SHFA 2P6SA 2VBXA 4C2MJ 1NJ5A 3VQVA 3HY0A 4MQ9F 2ZAEA 2A6TA 2CZ1B 4EPCA 4M75D 3NETA 1ZN2A 4YRLA 2CIMA 2K5CA 2MF2A 4L59A 5GMKe 4PDKA 2P0LA 1NLOC 1USTA 2ZCWA 2FZKB 3CCUT 5TJJA 4MTEA 1QVUA 1IN7A 5JVTA 3ZXSA 2XPUA 1SFUA 1PKTA 4PFZA 5HK3A 2DA1A 4HX4A 3EYYA 4N4IA 2V1UA 1VQ5I 1FZPB 1MIJA 1UB9A 2DDAA 4OMFB 4BXFA 3G71Q 4RCCA 2YLBA 3F9KA 3HDDA 4DZJA 4ASNA 4RGSA 2O4XB 4TVWA 3RQIA 1MMGA 3H5RA 2KK4A 1FMWA 3GTOJ 4NBQA 3F8FA 2RQWA 4FSXA 4CRIA 1PUEE 1L0OC 1S7EA 1PWTA 4NQWB 1P2FA 4FX4A 2DVEA 3M54A 5IHKA 1HW2A 2VBZA 4RDXA 1LDJA 2RAEA 2AMCA 4QQDA 1Q82R 2W25A 4G12A 3DEWA 1Z7UA 4VUBA 2AXTC 2X1DA 3IWFA 1X3UA 2FZGB 2WWYA 5TISC 2VQCA 2ZCEA 3I56Q 2E6NA 3GOXA 1WHGA 1RKTA 3META 3VUZA 1TWHJ 5KYUB 5GPCA 3A1YA 4IOCF 1HDDC 2E10A 2KMUA 2W84A 3SD4A 3CLOA 3MKDA 4B8XA 2K02A 2OTJQ 1QQIA 1FYKA 1PRLC 3KPHA 4C8QE 2YS9A 12ASA 4YCUA 2MW8A 3OIOA 2IT0A 2V8JA 2X51A 1LFUP 1WFWA 4JPBW 1WU7A 2EL9A 5AIQA 1NZ9A 2ZNIA 1QVFP 1IRFA 2GQIA 2DAQA 5EG0B 1BL0A 1FT9A 3DBLB 1VOMA 2VBWA 2DMOA 2ESWA 3OSSC 4HVUA 5HGQA 4KJZA 1U5TC 1UJ8A 1W5SA 4RM3A 3CMAI 2Y90A 4MMLA 2CU7A 4XRMA 1LE8B 3WVDB 2RQUA 3O5ZA 2DMPA 5LJ3g 4A3FJ 3ZP5A 4RB2C 3HXYA 3KLNA 2IVMA 3DBHB 3GFMA 1I3AA 1X2QA 3LSQA 4MZTA 5L23A 2AK5A 2EINH 1NPPA 1NYQA 3I7FA 2XGEA 5E3NA 3C7JA 3CQTA 2JTMA 2H8WA 5EC7A 2NUPA 2R7QA 1VQ5Q 1CQTA 3CXCS 3PTAA 2CP7A 4BY6B 5FFXA 1YJ9Q 1YJWI 2KFDA 2HPMA 3QYHB 5KCOA 5CQEA 2GA1A 2DFUA 1XTAA 2JQ7A 4IUUA 4BY7J 2ENMA 3P8BB 2DN0A 4XAXB 2ZCFB 4LNPA 4FT8A 5ILVA 2ZKZA 3HGYA 2Y75A 1GV5A 1I5OB 3VV0A 4GFBA 1IRGA 3S16J 1SETA 2Y31A 4CCKA 5KNLA 3R4KA 3JAME 3GCMA 5IT3A 2PMZN 3O3KA 2RI3A 3J81E 1W36C 1TZLA 2YU9J 1YX3A 2GA2A 1C6VX 4RG2A 1B8AA 3HY1A 5M3MJ 3VKIA 3CC2Q 3BDUA 5J3BA 5CAIA 2H6BA 5E18F 4Y52J 4UC4A 4B47A 3S1NJ 1UGRB 5J3LA 1QE0A 1DQUA 1UFFA 3PFSA 4X5OA 2E1OA 2L9NA 3DLAA 1A6QA 5AONA 4IO9F 1VQ4I 1I6XA 1XOVA 4FETA 5IXBA 4UVCA 3NEUA 2L89A 2R4GA 4XLEA 1X3WB 1OZ2A 2O2OA 1R22A 1Q1VA 2E4HA 4E7KA 1ITYA 2CJJA 2XAUA 1X27A 1VQOT 1L0WA 3G1OA 4ZTFA 1RI7A 3W6VA 1B3QA 1SAUA 1HDPA 4KT0E 1R1UA 3BDLA 4ESBA 3AFHA 5K7HA 5DTDA 2R3SA 1BR2A 3QZ9B 5ED4A 4M3EA 3LAPA 1WWXA 1W7PA 2JT1A 1BC7C 2JA6J 1Z7MA 1Y1WJ 2Q2EA 5JHUA 4J9CA 4CCLA 4M75C 2CYYA 2X4HA 3OOUA 3QPTA 5J40A 1IDZA 2RN8A 5IAYA 5TGTA 1ASZA 2H27A 2BVLA 1WZOA 1NK3P 3CDHA 2CKKA 2RQQA 2VOOA 2BTTA 3BPVA 4EVIA 3JCMb 3SDZA 4A4GA 2DJNA 2JTVA 2Y4YA 1NM7A 3PE0A 4WXHA 4AFQC 3TW7A 3LWHA 1TC3C 2PLYA 5EGOB 3CCSI 2V8IA 4TVAB 2W48A 3P9CA 4JYKA 3OR1C 5DM6F 2GNCA 2J05A 9ANTA 4KQEA 4IHTA 1QCOA 1HXDA 1P7IA 3CDLA 5E1WA 1KC8U 1IN8A 2LQKA 3PIPA 2B86A 2FPEA 4C5EA 1FMVA 2EPFA 3BZ6A 4A3KJ 2QLZA 4KULA 1OCPA 3JCMf 2EVRA 3ZEHA 4YCWA 4YRCA 3MCZA 4IL6C 2ZXWH 3U1KA 1I07A 2DYBA 3DKXA 4QTRA 2J6OA 2WV0A 4LDUA 1Y0MA 1GV2A 2DOFA 1POGA 2JJ9A 3BE3A 2DJQA 1S72I 1P92A 4LITA 3H9QA 5GMKm 4ZGEB 4JX6A 4C92B 1VQ7T 1ZK8A 3EPZA 3CCMT 3CCQQ 1OPCA 3CC4T 4M77A 1OFCX 1ON1A 4Y17A 2ECZA 1T95A 4EEFG 2RJDA 1YHQI 3NFCA 4RTYA 3HC7A 1JJCA 1BA5A 1H3HA 1O7FA 5K1PA 3BTIA 5HODA 2A68F 3I58A 1OU9A 2RJCA 3UKGA 3RERA 1A31A 1W2BS 4D7MA 2WSCE 4A3EJ 4CH6A 5JLWA 2NUTB 4HV5A 3VS4A 4KH1B 2NVQJ 3UPUA 5KK1A 2SRCA 2V7FA 1REPC 1HLVA 4PJLA 3QDRB 3HFZB 4H2XB 2VXDA 1ADJA 1JB0E 2MWPA 2FRHA 2IAIA 3CP8A 1N78A 2OCCH 3FX3A 1N75A 2ZZFA 2HGCA 4NUBA 4L5IA 1VYTA 2BUDA 1YFRA 3JR9A 1Q82U 3JRGA 2DPUA 3QO8A 1PD0A 3P8YA 1X4OA 2DW4A 4R8HA 4AD9A 2W10A 1E1OA 4P72A 4WWCA 2D0NA 1N5ZA 3F8NA 1PYVA 3OMYA 3S15J 3QKJA 1G3TA 3GTJJ 3CC7Q 3JCMh 1XGSA 1ZBJA 3QPSA 2P4RA 4B9XA 1DGWY 5K5QA 2VN2A 3CCMQ 3CCQT 3BP8A 1BC8C 1BR4A 3I54A 2NVXJ 2E1HA 5F04A 5GAOq 2DMQA 4DYQA 2HEOA 5HNHA 1B8IB 1QU3A 2MCNA 1PG5B 2RF0A 3T0YA 2R5MA 4WI1A 4JK1X 2L02A 3NARA 5GAOn 2ESNA 4GYGA 1TQIA 2HFHA 4GXOA 2JTFA 4OMPA 1BJAA 2ZC2A 4A69C 1Q86C 1NEBA 4HCBA 4XU3A 2Z5UA 3QO7A 4HWSA 3H3ZA 4M9XA 5CKBA 1WJCA 3HZJA 3MEAA 1VQ8A 1Z9QA 4BY6C 3WTTC 2L3SA 2M0CA 2CJAA 3WVEB 3IRRA 1IREB