3V8LA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotinyl-5'-amp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 100
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8lA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8lA02
3F6VA 1LNWA 5GANf 3CTAA 1QNTA 1J5WA 1P2FA 1K6OA 4M7AG 3E3VA 3GWZA 1FYFA 4AIKA 1UHWA 1H0MA 2UWMA 1HK9A 3JCMP 1USSA 2GXGA 4MMKA 5AONA 4CXFA 1Z91A 5BQTA 2ZR3A 4F7UE 1OR7A 2GQQA 2PEXA 2E1CA 4MMLA 4MGRA 3QU3A 1SD7A 2ELHA 3HTSB 4KICA 3LSSA 4P74C 5JHUA 2QZ8A 4I0BA 5A2QK 3RL6A 3CUQB 3WU0A 2PMUA 3CUQC 2K27A 2WTEA 3B02A 1E24A 3V7CA 3E6DA 2CFXA 2AKWB 1KU7A 2Z3YA 1X2GA 4CS3A 1UHMA 3F8MA 5LJ5f 4EV0A 3GW2A 2RA2A 3K1PA 3QPTA 2P5KA 4M77F 1BI1A 3HOTA 4AH6A 1D3BB 1DP7P 1O57A 3HY0A 4ZIBA 5GAOr 4A54A 5L3GA 4M6XA 2I2LA 3WE2A 1ADJA 2ZBKA 3HXVA 4YRSA 1QPMA 1JJCB 4M77A 4M78C 1TW3A 2W57A 1ZREA 1OYIA 3RF1A 4Q47A 3L4GA 5LJ3f 1GHCA 4RGUA 2NS0A 2MD5A 3RESA 2PI0A 3R0AA 1NHAA 4YRRA 4CH5A 4RDXA 3TUPA 2QYOA 2WV0A 4G7OF 4J6XA 4QVDA 3M8FA 1KQ2A 4ESFA 1OPCA 1G3SA 3A5ZA 3QPHA 1TNSA 1K78B 5GMKe 4BHBA 2HOEA 2V1UA 4M7AF 3HRKA 4TVAA 5C52B 1U1TA 2ZTGA 1NNHA 1TQPA 2XKPA 2DEQA 5E18F 4HWTA 4YFKF 1DPRA 2STTA 3DF8A 4P3OA 2XASA 5FLXZ 1X55A 2FSWA 2I4LA 5LHIA 1F9NA 4LD5A 1P4WA 4HVCA 4XEOA 3EYIA 3COAC 2XGTA 1WI9A 2KIUA 1EQRA 4YCWA 2KIMA 1BN5A 3JCMf 1LNXA 1USYA 5C51B 3Q5FA 2X0LA 5EEHA 4YRLA 1HXDA 3J80Z 1RUOA 2K4BA 2ZNJA 4G6DA 2LKPA 2XVCA 4UV8A 1C0WA 1EH8A 4UP9A 3HSFA 1I1SA 4ENKA 1XSDA 1W5SA 1ZGAA 3UGTA 4I01A 4BWAA 3P7NA 2DQ0A 1HSTA 3WTSC 1AOYA 4N0AA 5DCMB 5KNNA 3JAMZ 1Z6TA 3RKXA 5FLXK 4ENJA 3KETA 3TEHA 1USTA 1XDUA 4FT8A 4WCGA 4BHCA 2G9WA 5LJ3g 1EH7A 4EQQA 2A3SA 4G85A 4KIGA 1Z7NA 4PGGA 2ZGWA 2OD5A 4I98B 1IN6A 4MTDA 2CG4A 5DY9A 2VODA 3HXUA 2CW0F 4R8HA 3J80K 4Z2YA 4KYWA 2VT3A 4M77E 2EJGA 4XU1A 2O03A 1FT9A 1QQIA 5BPIA 4HX7A 4LGWA 3V4GA 3SWNB 3TEGA 2XAQA 4EJUA 2RM4A 1KYWA 2EFPA 5LHHA 4UP7A 2ESNA 2DDZA 2EA2A 1O3QA 1B7YB 2EFOA 3FHZA 5ERIA 4OU0A 5ICGA 3JAMK 3PCOB 2OQRA 4HF2A 4P9UA 2ZZGA 1ZRCA 4IHSA 4KFCA 1IUYA 2KJCA 4EX5A 3L1AA 2RKHA 4ESJA 2E7XA 3I54A 3TKYA 3JCMg 1BIBA 3SHFA 3QTCA 2IY5A 1OKRA 4UVBA 2IT0A 2H94A 2H09A 3RIRA 2AS5F 2XIGA 4P96A 4M7AE 1EFWA 3OOPA 2DLLA 4RB2C 2F5CA 3EFRA 3F8BA 3KCCA 1KQ1A 1YYVA 1XGOA 5ED4A 4HF0A 4LJZF 1IL2A 4EM1A 3RACA 1FSHA 3DP7A 2Y90A 1DDNA 1NJ1A 2FU4A 5GANd 4C8QF 4M78G 4CS4A 2QWWA 5CLSA 3BPVA 4LG0B 4XTXA 5LJ3j 1UFMA 1WQ2A 4LB6B 3GYHX 5DYMA 4KMFA 2E10A 1XCBA 1YFSA 3LQQA 4CH4A 5FD6A 2BGCA 3MFKA 2M87A 2OBPA 3R4KA 2RHQB 1YQAA 2A69F 2FBKA 3QO8A 3WGGA 3ZQ7A 1PP8F 4J6YA 1UB9A 2LNBA 3QOPA 3G1ZA 5ILVA 4P9FA 2HTSA 5LEJA 4HT9A 3LQRA 2P6SA 2V1XA 4C92B 2EFNA 2D45A 4TTVA 3RTRA 3M4QA 1ASYA 2YX4A 5LJ5d 1PDNC 2I4MA 2AXLA 1E2XA 4XSZF 6PAXA 5HS9A 3KZZA 4PJOB 3HYIA 4YRQA 1Y96B 4OIOF 1XMAA 1I8FA 1U5TB 2RDPA 1I81A 5EEGA 2DVEA 4MQVA 1QZZA 4H2SA 2GA2A 3GFMA 1R1TA 4M75B 2P4WA 2HR3A 2A07F 5BMZA 2O8XA 2OU2A 3CUQA 1SD4A 1YW8A 3I4PA 3I0TA 3L09A 4K86A 3GX4X 5LJ3d 1S7AA 1NJ5A 5LGUA 2NYXA 4M73A 1T98A 3GXOA 1B1BA 2AKWA 2ZZEA 1BJAA 3R0JA 4EGYA 2EB7A 1S3JA 3BDDA 5D4RA 3P8YA 4GYIA 3DPTA 5GMKh 2Z99A 4M78F 3EQLF 4CHUA 2XKOA 1D3BA 3K1NA 1FLIA 4BXUA 2W24A 4A2UA 4PNOA 4KR2A 1L3LA 2E41A 4Y13A 3I58A 1IN7A 1ZHFA 4CZZA 2EFQA 1SFUA 2Q2EA 3VFZA 3UGQA 1G5IA 2FNAA 4H2YA 1JJCA 4WXCA 3RI4A 3IC7A 3RYRA 2FNPA 3HRUA 1LEAA 5K1YA 1I5ZA 1KQ8A 2HKXA 1L0OC 5DD4A 4M7DB 1NJ2A 3ERRA 3ABTA 3MZHA 3JCMc 2ZNIA 4I2OA 4E51A 2VT2A 1MZBA 5E8GA 1IN8A 3IKMB 4N9IA 4IRIA 4ZYDA 1P92A 1WU7A 4YRGA 1USYC 5FO5A 3JCMd 3V8LA 3AHUA 5GANe 3W3SA 4LLGF 3HFVA 3MCZA 1K78A 4EJVA 2DK5A 4HLYA 1RIQA 4C8QE 4I0AA 4PG3A 4K88A 3KZYA 4K87A 2A61A 3V7SA 1X3UA 4XRFA 2ZNZA 2IA0A 2ARUA 2LDUA 3BROA 5GAN8 4DQ2A 4ZYEA 3P8TA 1MD0A 1O3TA 2Y0MA 3J81Z 4HZFA 1Z1DA 3HIFA 4C92D 4A53A 1P6RA 3JCMW 3ZMTA 1ULYA 1ATIA 5D8LB 3E9HA 5GMKj 2J5PA 5LJ5e 2ZIMA 4YRJA 1W5TA 3FJPA 1EOVA 2ZT8A 5AIPA 2DZCA 2C7IA 1WKMA 1YS7A 3M1EA 3ZP5A 4WI1A 2FBHA 4HQMA 4IJAA 3MEXA 2L3DA 4PJOD 3DSQA 4H2TA 3I71A 2EJFA 3U9GA 1B34B 4MEYF 1J0RA 2IJLA 2ZNYA 4KT5C 1O3RA 2ZMEB 4S04A 2PMEA 2JPCA 1R1VA 1G4DA 5J6XA 4ZTUB 3B73A 2XRNA 4M75D 1R5GA 5DCMA 1N9SA 1TLHB 5GAN3 1D8JA 1YFRA 1V4RA 4LLLA 5HOOA 1E1OA 3BFMA 3J81K 1FNNA 4DPGA 3QHSA 3EDPA 3ZPLA 2P5IA 4C92G 5K1XA 2VOPA 3ML6A 2EFWA 5D8KB 2QHTA 4PDKA 1ZLJA 5HDNA 2F5DA 4M78E 4XU3A 1R58A 1D3YA 1ZH5A 3O2PE 5D5UB 3ZN1A 4PJOG 3ZMVA 1H4VB 2JZYA 2JN0A 2E7WA 3V7RA 4XBFA 2DPDA 3SWNA 4YCVA 2XTIA 3F22A 2DPUA 5HLGA 1V3FA 4O3MA 1B7YA 4NHJA 4EMSA 1XB4A 3Q9SA 4M75G 3PCOA 4M7DD 1H9TA 5GMKm 3LSQA 4G94A 2VN2A 2ADUA 2FE3A 4ZZLA 3SFZA 1U3EM 1YLFA 3A5YA 4YCUA 1SFEA 1JHHA 1IRFA 2YU3A 2XUBA 3F8NA 3QUIA 4TV7A 4EM0B 1B70B 2G7HA 1MGTA 1IW7F 1JRIA 4PHCA 4X9CA 2QHSA 3L9FA 3R60A 3I7FA 3VU3C 1S8NA 4UV9A 5JVTA 4WX9A 3A31A 1SMTA 3BY7A 3KP7A 1WWXA 4RCCA 1RI7A 5GAMe 4R1HA 4HYEA 2QTXA 3JB9H 1M8VA 2V1DA 2HYFA 3D0SA 4KMUX 2YHTA 2FF4A 1WYDA 4X5OA 2WWYA 4HT8A 1E22A 4LG0A 4BW9A 4Y15A 2DTHA 4J15A 2VC1A 5GAN6 4YP0A 4YRMA 4M7DG 4F7ZA 5D6EA 2RHQA 3F21A 2XHKA 1PYSB 1GXQA 1FSEA 2H6CA 4EMGA 2RB6A 1RIOH 5F1RA 4P72A 3RGLA 3D5LA 2YX7A 1JXSA 4U88A 3L2ZA 4YRFA 4YFNF 4WWCA 4H0EA 4C92A 5GAOn 2XGXA 5E1XA 5HDGA 3HRTA 2QBYB 3KFUA 3INZA 3FM5A 2JT1A 3A74A 5GAOm 3IL2A 1SFXA 2FRHA 4Q5SF 5F64A 3KEQA 4WXDA 3IRRA 1LDDA 3QSUA 1YGBA 4PJOA 4R79A 1Y96A 5D5VB 4J5YA 3PFIA 4KNYA 1G3YA 2XAHA 1U5TA 3WE3A 2FXAA 1CF7B 2DT5A 3JCMV 3MAJA 1YG2A 4A5MA 4HOBA 4M75A 4HA8A 4XLPF 1KOGA 2IVMA 2WC2A 2XAFA 1PP7U 3NELA 1YCYA 3GZ5A 4HDVA 3WTWC 4XTWA 3M9AA 3HXWA 1YW9A 2HWVA 5GANg 3HHHA 3I5UA 1HW5A 4IF4A 1B9NA 3WGIA 3T1BA 5JFRA 2PLYA 1HW1A 4ZTZB 4YROA 4HWRA 1NYQA 3REOA 3QNEA 4H2WA 1B4AA 3GFIA 5GAOq 3TOAA 3RYPA 2YPRA 3SZTA 4L9TA 1FP1D 2I4NA 1R23A 3HXYA 4L5JA 4XU2A 4XQ3A 5CVRA 4B09A 1D5VA 5CVJA 3F3XA 2R7DA 4BYYA 4IVNA 1MDMB 2L4MA 5CVUA 4BAYA 4G9YA 1U2WA 4WK8F 1WRJA 4UXNA 2XAGA 4NOYA 4I7HA 4M7DA 3QU6A 3QO5A 5H20A 3CJNA 2K7LA 4EM2A 1BBWA 5LJ5g 2DQ3A 4M9SA 2FMLA 1FZPB 1YFTA 4UUVA 1T39A 1FYMA 1P4AA 1W7PB 3HTZA 2DQRA 4CH6A 1MJ9A 1IZ1A 4RB0A 2O6GE 5CVVA 4QWQA 5K5OA 4RGRA 3VBBA 1T6SA 11ASA 2ZINA 5GAMf 2Q5HA 1RUNA 1HTTA 5ICCA 1NYRA 3M7GA 1TTYA 3WTXC 1TQMA 5ICEA 2EV0A 4ENMA 1HKTA 1QGPA 4F7UB 2RQPA 1FP2A 3CO6C 1VQZA 1YIOA 2M8EA 2TDXA 5LJ3h 3UFGA 4V2SA 5DDGA 2Z9OA 2IRFG 5GANj 2VXEA 4LMYA 5LHGA 3K69A 3WTYC 2ZO4A 4MQ9F 3NQOA 4G7ZF 1C0AA 1R5HA 4UHTA 2ZT5A 5LLQA 4OMYA 2DKGA 1B34A 4KN4X 1G51A 3SWNC 4GCVA 2ARSA 2DQLA 4CDGA 4HLXA 2ZMEA 1QF6A 5J8FA 3FM3A 1Y0UA 4XSXF 3WU1B 4RAZA 1FC3A 1KU3A 1RZ4A 1Z7UA 3HRMA 1H9GA 5DUIA 2VONA 4BNCA 4Y17A 4OINF 5LJ5j 4M74A 4E70A 5LBQA 4AIHA 4UNOA 4P73A 3JB9D 1K7AA 3JCMh 3J7AO 3IKVA 4TWAA 3ECHA 2VXZA 3DV8A 2BE5F 3HFZB 4IPAA 4K2EA 4I09A 1X54A 3JB9I 3HSBA 3CUOA 1D8KA 4CICA 4X9DA 4Y91A 4A6EA 2RVCA 5GAMg 4L5IA 3NRVA 4M9XA 2HNIA 3ZN0A 3T8TA 3FF5A 2CJ9A 1ZG3A 1J9IA 4NL2A 3BOQA 1ZRFA 3U2RA 2QVOA 3REXA 5GMKl 2RV8A 3NETA 2IA2A 2AMCB 1QBJA 2DTIA 4CH3A 2PN6A 4EVIA 3FXRA 1VTNC 1W7PD 2ZXJA 3DXJF 1B70A 1F5TA 2FYKA 4HAMA 3ABUA 4P72C 4LK0F 3HY1A 5GAN4 2D2WA 2P5LC 2MLKA 1Z9CA 3QP6A 3LA2A 3EETA 1IF1A 4C92C 1B6AA 2VC8A 3LA3A 3ISPA 3FXQA 4RCBA 4JK1X 3IRQA 3RERA 4RB1A 4FX0A 5HVQC 4P71A 2DTOA 2VXFA 4PJOC 2EA4A 3IWFA 2HTJA 2IA1A 5DCFA 1XCVA 2EV5A 5LRRA 4NB5A 5DD8A 2H27A 1J75A 5CAIA 1U5TC 3E97A 4GO1A 2L01A 3F8FA 1PYSA 4M75C 4LNSA 1BC8C 4H02A 2DW4A 2VE8A 1S6LA 2QLZA 3MF1A 5GAN7 2B0LA 1JHFA 3IHUA 5GAMj 2BEOA 4GXOA 3JSPA 2L02A 4M72A 5E1WA 3KP6A 5K5RA 3UH0A 5FFZA 2QBYA 2YLCA 2ALYB 4YRIA 2EWNA 2QQAA 3BY6A 1J7KA 3QP5A 2L4AA 2DO7A 3RDIA 1WLEA 5GAOl 4F7UG 1YW7A 2HEOA 2STWA 1G5HA 4WXHA 3WGHA 4H2UA 4KIBA 2ESHA 1OYYA 3H92A 2M5WA 4ZZDA 5E20A 2ZFWA 2P7CB 5L3FA 1CF7A 3HSRA 2EL9A 1G3TA 2V9VA 2P5VA 3NEMA 4MEXF 2CWEA 1SETA 1NJ6A 5LGTA 4M7DC 4KDPA 3P9KA 1WQWA 4TQDA 4KUMA 1JBMA 3ZMSA 3T8RA 3VOEA 5D5WB 2HQNA 1F1ZA 2DK8A 2ZKZA 4M7AB 4YRCA 2BBYA 3S2WA 2A5YB 4WJ3M 4OIRF 2XAJA 3ELKA 4UP8A 4BHPA 2D1VA 4Q4ZF 4TVYA 4B8XA 4GGGA 4Q15A 4P55A 4O2DA 1B59A 3EYYA 2D1HA 1U8RA 2EAYA 5CYVA 4QLCU 3R6SA 2DBBA 1T2KA 1P4XA 5GAMd 2GZWA 1HC7A 1IN4A 4A0ZA 2A6HF 3V8KA 2JSCA 1I5LA 4AIJA 1MDMA 2HKOA 1S7OA 3QO7A 2ISZA 2DFIA 2MH9A 3IWZA 2XV4S 1JGSA 3KEOA 2J3LA 1FBSA 4OIQF 3JTGA 3IALA 5F5WA 2E65A 4JRIA 2L54A 4N0BA 5IT3A 2PQ8A 3JCMb 2W25A 4EMHA 2UXXA 3BZ6A 3KP3A 3RPUA 1W7PA 1KA8A 1SESA 2FOKA 2HZTA 5JR3A 1KQ9A 2PFBA 5ELOA 4A0XA 1OYWA 2JPBA 2ZZFA 3I59B 3QRFF 4UPAA 3MF2A 4FX4A 4RGSA 1FBQA 1FX7A 4OLFA 2ZXFA 1BOAA 2J5OA 4HBLA 2I4OA 4L87A 4RB3C 2K86A 2ZR2A 3A32A 4F7UA 2ODRD 3KE2A 4M77D 3VB2A 4P73C 4UVCA 4P3PA 4U0WA 4M6YA 1G3WA 2QHVA 3M8EA 1ZG5A 4EMKB 1H641 3HRSA 3HFNA 1YO5C 1IAWA 4U0VA 5DUKA 2DXUA 1XSXA 4XTUA 1YB3A 2GA1A 5C53B 1MJBA 3CDHA 2ARTA 2PG4A 4N9HA 2MC3A 2KKOA 2FEZA 3DEUA 5BOXA 1M5Q1 4NL3A 2OQGA 2C8MA 5BPDA 4MTEA 2OAZA 5ILUA 1J2XA 1GVJA 2RN7A 1G6NA 4YIFA 3KFWX 4L9VA 2CQKA 5L3EA 2QENA 4M7AD 3K0LA 1BM9A 3GIBA 2F5FA 2R7FA 4ZH4F 1BBYA 3HFZA 4IHTA 2NAZA 2DTRA 2ZCEA 4HF1A 3HFOA 4KIFA 3BWGA 1T38A 5HLHA 4XTYA 1EIYB 2HQRA 5ICFA 5HS8A 3OV8A 4CO8A 5BS6A 3GO5A 1YS6A 2M30A 4C8QB 1MJAA 3LFKA 3LAJA 2M1BA 1SD6A 4G8XA 3LSTA 2HS5A 2VBYA 4XLNF 4P71C 4HX8A 2MBFA 3HSEA 3KLOA 4IRGA 1FBUA 3L2CA 2NNYA 1EV7A 1IXSB 3N4MA 1W4MA 1J5YA 3BW1A 2AMCA 4WJ4A 4AD9A 4C92F 3FX3A 3ROUA 2K57A 4HWPA 1FOKA 1U1SA 1HKSA 1XGMA 4G84A 1SAXA 1ZGJA 3JCMX 1Z6RA 4AWXB 1KU2A 4LK1F 5GAOp 1TNTA 3VQWA 4Q6GA 2VBWA 4RS8A 1IXRC 3JTHA 3WTUC 1STZA 3L00A 2V6CA 4PJOF 3VODA 3C3WA 4ASNA 1DPUA 3Q9VA 3QO3A 2PBIA 2DI3A 3SXYA 4KN7X 3PZCA 3GLXA 5CJ9A 5L3DA 3RPQA 4M75F 4EJTA 1U78A 2A68F 3HRIA 1W66A 4YRKA 3F23A 3FB9A 3VQYA 3G3ZA 5H6QA 2W85A 2EJ9A 2YSRA 5L3CA 2ZT7A 2KIFA 1KMNA 1ZLKA 1ONVA 3WODF 4A5NA 3BJOA 4XTVA 4CYDA 3T0YA 1Q1HA 2KRFA 4EGZA 4JQFA 4CS2A 5H6RA 3LA7A 2OZUA 3HOSA 4JUVA 3A7UA 1H4QA 1TW2A 5GANh 4M78B 4G6QA 5FD5A 1K79A 3M4PA 1T0FA 2ALYA 2E5AA 3E5QA 2E64A 3MZYA 4L0ZB 1GXPA 4M7DF 2ZT6A 1O7LA 3RKYA 4YDQA 3IKTA 1I1GA 3TDUC 3REUA 2VBZA 2IP2A 5ELNA 1OMIA 4JRKA 2IW5A 2P0LA 1R1UA 2GXBA 5HGQA 3ZMZA 4C8QD 4H2XB 4A0YA 2NRAC 3RUXA 5LJ5h 1S29A 3DQVC 3ZMUA 1FWZA 4M7AA 2P8TA 3E6MA 1XGNA 5TRDA 1ADYA 1LJOA 2UXNA 1AWCA 2PJPA 2Q7GA 2F5EA 1EH6A 1E17A 2YR2A 4HDUA 3C7JA 4P3NA 4C92E 4A6DA 1QZYA 4JBAA 1BI0A 2O61A 5L3BA 3KP4A 2LF7A 1REPC 2FQ3A 5E1ZB 3LWFA 2DU5A 4HWOA 2CJBA 3H3ZA 2GAUA 4BQAA 1LOJA 4PJOE 3EFSA 1F4KA 3HTUA 3BJUA 2ZIOA 1SERA 4C8QG 2EJRA 2EV6A 3FXUA 1R22A 4L9NA 5E17F 3CMQA 3GEZA 1YTYA 4OIPF 1ZRDA 4M75E 3KP2A 4XEMA 3WQZA 5FB2A 3HHGA 3GVAA 2RGVA 3TDZC 4LB5A 2DZ9A 3FZVA 3I59A 3RJPA 3JCMJ 2K02A 2MH2A 2VE9A 2EK5A 3FMSA 5GAN2 1ZN2A 4P75A 4GYGA 4ZYHA 3PQJA 4KA4A 1FYLA 2KJBA 3G73A 5E8IA 2ACJA 2COMA 2M45A 3I53A 4DNCA 5GMKi 1B76A 1X56A 3A7RA 3R07A 4A12A 1XGSA 1BBUA 2OZ6A 4LLNA 4ON0A 3E6CC 4L0YB 3JCMQ 3TO9A 1O3SA 2W84A 4YPFA 2MLGA 1ZYRF 4M78D 3DFGA 1Z7MA 3MWMA 1ZG1A 3HUGA 5LEKA 4HW0A 3M4GA 1BI3A 3WG9A 4EO4A 3GUDA 5AIQA 4EMKA 3HXXA 3WTTC 2RHSB 2VOOA 1LJ9A 3CO7C 3HXZA 3FWEA 3K9TA 4M7DE 5KK1A 1SRYA 5GAMh 2DU9A 1N9RA 1LYLA 1TH7A 1CGPA 1RNLA 5IT9Z 3WTVC 4L18B 4NCXA 2O0YA 5D6FA 1ON2A 1LEBA 1HQCA 4OMZA 2Q7EA 4YYEA 3N97A 3T5XA 2LF8A 5DV5A 1R7JA 5ILSA 2IPQX 1WPYA 2P6TA 2V79A 4YRTA 2Z5UA 3JW4A 3JB9G 4HWSA 12ASA 2E3CA 2HGCA 4H2VA 2JRTA 3AAFA 4LFUA 3W6KB 5HS7A 1MGQA 1KMMA 2LSOA 3TOBA 3K2ZA 2JTVA 1XMKA 5GAN5 1EVKA 1H4SA 1EIYA 1A04A 4I02A 4HV5A 3ICAA 2C6YA 2PMFA 3OD1A 4C8QA 3DKWA 4OOIA 3WTZA 5IT9K 2H6BA 4MHGA 4KR3A 3FMRA 4U0YA 4YRPA 1FPQA 1YFHA 1KYZA 5HDKA 2XROA 4AVPA 3GZ6A 3IG2A 1TQIA 1B9MA 3NEUA 4HV6A 3TGNA 2FB7A 3EUHA 3E5XA 1XDSA 1ASZA 1IXCA 1J59A 1R00A 5I21A 1H4TA 2ZJ2A 2CYYA 4U7BA 2CGHA 1KU9A 4UVAA 2Y75A 4RMFA 2ODRC 4M71A 2DAOA 1ZARA 2QQBA 4M77B 1XSVA 4QVCA 4M77C 2YLBA 2Q0OA 2NNNA 4P74A 1FY7A 1R36A 3C1DA 3VQVA 4MNUA 1LVAA 3W6JB 1I4K1 3L4GB 1WQ7A 3JB9J 1NJ8A 4YRNA 3PGGA 1BIAA 3L7WA 5E3IA 1BC7C 2DU7A 1LQ1A 4XU0A 2CJAA 3JB9F 4TVAB 4G7HF 4HX4A 4XTZA 3TO6A 5LGNA 2HDCA 1JE8A 1ON1A 1IN5A 5K5QA 2FMYA 4U7DA 4WF2A 1KQ0A 4JLIA 3O6BB 1FYKA 3SB2A 3BJAA 2Z33A 4TVWA 1I6XA 5J8CA 3SQNA 4TQFA 3BP8A 4M7AC 5CVIA 4FHTA 4M78A 1B8AA 3A7AA 3E9IA 3P8VA 3LC0A 5D4SA 1Z05A 3F8CA 4L9JA 2Q8KA 2R3SA 3P9CA 4OP0A 2P7VB 3NENA 1LDKB 4EJWA 1WNLA 1O7FA 1MKMA 3KLNA 5F6FA 4PCQA 4YREA 2PMHA 2HFHA 5HLIA 2OA4A 2CIMA 3VQXA 3MEYA 3K1MA 3P9IA 4ESBA 2DXTA 4PZJA 3ULQB 1HW2A 1LDJA 1XD7A 2ZCWA 1IRGA 4S05A 3F72A 4BH9A 3DPLC 4N0AC 4H2XA 2MA3A 2FA5A 4O5VA 2GIVA 1E1TA 3TEHB 3ERED 3BJ6A 2O3FA 2HYGD 2CO5A 3GF2A 3LAPA 4Q48A 1HKQA 2VC0A 3SZPA 4F7UF 3FIFA 2J3MA 3RKWA 2A6EF 1GGMA 3IKLA 5KVRA 3O3KA 2BYVE 2E1HA 4P75C 3BDUA 5DEQA 4EJOA 2QM3A 4IRHA 1DUXC 5TJJA 1X01A 4J6WA 3H3UA 3I64A 3C18A 3V8JA 2GWRA 2Y48A 1KGSA 1TBXA 3JSOA 1SMYF 2CSOA 2X4HA 1L0WA 3CLOA 4M9ZA 4YFXF 4RGXA 2RNJA 4EMKC 3ZMDA 5K1PA 4IXAA 5LJ3e 4NQWA 3E5UA 1I27A 5JI6A 2IY5B 1PUEE 1XN7A 3MQ0A 4RQFA 3E6BA 3FMQA 3PQKA 2BV6A 3VEPA 2G4CA 5FGMA 4RQEA 2G7UA 3R61A 1HBXG 1QO0D 2ETHA 1EVLA 4YG2F 2Q7HA 4RAYA 2VBXA 2F2EA 3TQNA 2ISYA 3BPXA 1SD5A 5FFXA 2K4JA 4PGHA 4M77G 1N9WA 2FBIA 5D5XB 4YIIA 2QQ9A 3GFJA 1LB2A 4HQEA 2CGPA 1WSUA 3TO7A 2QHUA 1BI2A 2RC4A 4D0PA 2RHSA 4P5OA 3KP5A 2UZKA 3JCMe 1U6GA 1ZAOA 4O6JA 4ETSA 1X2HA 2E1NA 3QAHA 4KQEA 4C8QC 5A2QZ 1HSJA 3ECOA 1QE0A 3F6OA 5LRSA 4ENNA 2Q5IA 1UCRA 2RD1A 4ZYGA 2DJZA 2QUFA 3U1DA 3GFLA 1ODDA 4CGZA
chains in the Genus database with same CATH superfamily
1LNWA 2HSEB 3E3VA 1FYFA 1UHWA 1QW1A 2X35A 1GL5A 4XKWA 1USSA 5AONA 5KYNA 1Z91A 5BQTA 3EHRA 3EG9A 4MGRA 4DYQA 3M56A 1UAAA 3HTSB 1VQ6I 3CC2T 1VQ5T 2QZ8A 4I0BA 3VRYA 5CQYA 1KC8C 1QPIA 3CCJA 1VF9A 2WTEA 1VQLI 3DKXA 2COZA 2CFXA 3ASKA 4OB1B 2AKWB 2Z3YA 2KDSA 1OEBA 3F8MA 2DMPA 3GW2A 3TVTA 4E4HA 3K1PA 1BI1A 3LWIA 2R7SA 1D3BB 1O57A 4ZIBA 4N4IA 1JI8A 2E2IJ 3A4CA 1JJCB 2QGUA 2RO0A 5H2FC 1UJ8A 4Q47A 3L4GA 1WJAA 4RGUA 2NS0A 4RDXA 2PI0A 2WAQN 1ZK8A 4ZDOA 2QYOA 3PIPF 3BC8A 5EGOB 5GMKe 2ID3A 4M7AF 4OMLA 1QVTA 1QZEA 1O4XA 1TQPA 5E18F 1WVRA 2STTA 3DF8A 4P3OA 2XASA 2FSWA 5LHIA 1F9NA 4LD5A 4J9IA 4J83A 4HVCA 5IP7J 4AIDA 2RI2A 4I76A 1OQKA 1LNXA 3JRHA 4RTUA 1P7IA 5AYFA 1RUOA 5M3MJ 3VS3A 4LIUA 1W5SA 2B9SA 1U06A 1AKHA 1LPQA 1W5CC 1NEGA 1AOYA 3RKXA 2ENMA 3A2KA 3KETA 1AT1B 1IDYA 1MBJA 1AHDP 4BHCA 2OAWA 2RHUA 5LJ3g 2E35A 3G4SA 3CCQA 2A3SA 1OQYA 4KIGA 1Z7NA 1IN6A 2CG4A 5FLMJ 4RTWA 3ZXSA 2CSIA 4Z2YA 1TS9A 2VT3A 4NS5A 4M77E 4XU1A 2CV1A 1FT9A 1QQIA 2DT6A 1X3WB 2EGEA 4LGWA 2VJIA 3S3NA 3TEGA 1A36A 4JX4A 4EDUA 2RM4A 1EX4A 2E1MB 2ESNA 3DLAA 2EA2A 1O3QA 3CCMT 4OU0A 4JJBA 3E7LA 4BEHB 4KFCA 5KAIC 1JKQC 5B1AH 3EH2A 3CC7A 3JCMg 2IY5A 1OKRA 3ULRB 2ROLA 1YHQI 2CQNA 1G83A 2H94A 3HDDA 3G71T 3RIRA 4P96A 2DLLA 3CESA 3EFRA 5ED4A 1IL2A 4EM1A 2ECCA 2FU4A 5GANd 4S0HB 2QWWA 3SJMA 4LG0B 1LE8A 1UFMA 2L3PA 1XCBA 2MSYA 1Q81C 3Q0UA 9ANTA 2MFZA 2O01E 2MC4A 3TSWA 2FBKA 2GTJA 3WGGA 2KISA 1PP8F 3RPUD 1PNJA 3QOPA 3RNJA 1S7EA 2HTSA 3EG2A 2E5ZA 1KJWA 3GOXA 2EFNA 3SEZA 3M4QA 2KI7A 2VQLA 5LJ5d 2KAFA 1ETXA 3JRBA 3CMET 4PJOB 2K40A 4Y28E 4OIOF 1XMAA 3FJ5A 2RDPA 3I35A 1ETOA 1R1TA 4M75B 2VLAA 4A93J 1UDLA 1Z67A 3H9JA 3CUQA 1WYXA 5CK9A 3HC7A 3I0TA 3L09A 3GX4X 1S7AA 2OTLQ 1BJAA 2CQXA 4EGYA 3P8YA 2JNGA 4GYIA 1VQ4Q 3DPTA 2Z99A 5IHNA 4M78F 3EG3A 2A36A 1B8IA 5FU7C 4Z89A 4QTRA 3I58A 4CZZA 2OUMA 1SFUA 3HKZA 1W36C 3PT9A 2VL8A 2W1OA 5JLXA 2BXZA 3HRUA 3CCJT 1LEAA 3CZ6A 5K1YA 3QG1A 1YJ9Q 2HDDA 1I3QJ 1I5ZA 1L0OC 1NJ2A 1YWOA 3JCMc 4E51A 3HHTB 5E8GA 1IN8A 4N9IA 1T08B 5LL6S 1USYC 3V8LA 3H8ZA 1W2BP 1K78A 2DK5A 1BBZA 2CUBA 3F9KA 4Y33A 4NBQA 1M90C 4DBFA 2AZSA 4MZMA 2XG8D 2YUOA 1GBQA 2Y0MA 3J81Z 3OSGA 1Z1DA 4C92D 4F3QA 4YRJA 2DZCA 3M1EA 4IJAA 3MEXA 3DSQA 2WA0A 2EJFA 1B34B 3VUBA 2ZMEB 2JPCA 2E5QA 4L5GA 1PSEA 4WTOB 1R5GA 2M9HA 1UGPB 1QCFA 1QCOA 1VZ0A 3JAME 3BCBA 1ETKA 3J81K 1FNNA 3K6GA 2RJDA 3EDPA 3ZPLA 5K1XA 3RCOA 4D7NA 3I55I 4A3IJ 2QHTA 1ZLJA 3DB3A 4LVLA 4XU3A 4KT0E 1D3YA 1ZH5A 4C2UA 4FSSA 3ZMVA 1H4VB 2JZYA 4ORZA 2JN0A 3V7RA 4YCVA 2DPDA 3CEYA 2JUGA 5HLGA 3IAS2 1FOYA 3PSIA 4NHJA 3JR9A 4B6MA 2GLOA 1AWJA 2ADUA 2FE3A 4YTLA 3SFZA 2VGNA 2DA9A 1SG5A 1JT0A 2XUBA 3X26B 3QUIA 2X85A 1IW7F 1JRIA 2NUTA 2E1OA 2QHSA 3R60A 3I7FA 2E2JJ 4UV9A 4QT7A 1VQ9I 2QASA 3VYHB 1WJSA 2QEXT 1M8VA 2HYFA 4KH0B 2HL5C 4RAGA 3EGUA 4HT8A 2EKHA 3M4OJ 3QWYA 4BW9A 1K83J 2LCLA 2O8KA 4PFPA 1S1NA 4YP0A 4YRMA 3IH4A 4RLQA 5D6EA 4PKCC 1GXQA 2H6CA 3ONQA 4P72A 3D5LA 3EGDA 1JXSA 2JT4A 4YRFA 2FD5A 2L2PA 2JM8A 4H0EA 1VQ8A 3M57A 4C92A 2XGXA 3OYNA 3HRTA 2VASA 4JX6A 3FM5A 2JT1A 5F08A 2BKDN 1SFXA 3J7AY 3QXEB 3GTKJ 3KEQA 1QMCA 3QSUA 1YGBA 1Y96A 5D5VB 3HKSA 2X4YA 1U5TA 3WE3A 4JJCA 1QVFS 3MAJA 2RHZA 2WC2A 1PP7U 3NELA 1PUFA 3HXWA 4YIRX 3ZCOA 5GANg 2QA4A 3T1BA 3PO3J 3LSHA 4YROA 4AG2C 4HWRA 4H2WA 2OAUA 3PUFA 1HF0A 3RYPA 2I4NA 3HXYA 1MH3A 5CVRA 2R7DA 1W0UA 4BAYA 3CCVQ 1WRJA 3X2QH 4I7HA 3CJNA 1CQTA 5LJ5g 3NMZC 4CH6A 2K5FA 4RB0A 3W2VA 4X1VA 1B72B 2Q5HA 4FE7A 1TQMA 3CO6C 4DZPA 5DDGA 5E3MA 4LMYA 2BZYA 2XB5A 5LHGA 3AL0B 3K69A 3WTYC 2ZO4A 3K4KA 4BD3A 2RQTA 5LLQA 2Z2SB 3LGFA 1K76A 2FRWA 4KN4X 1JT6A 3CCET 3ZL7C 2ZAEA 4RG2A 2E1MC 3H6ZA 1Y0UA 1DU0A 1GFDA 5F0FA 1Z7UA 3HRMA 1VQ5Q 2HOAA 1XPXA 5CKTA 2BW3B 4P73A 4X1EA 2JWTA 4C5GA 1Y39A 2JTEA 1JJ2P 4K2EA 2WADA 4I09A 2EYXA 1YJNT 3JB9I 4CICA 4X9DA 1MMAA 4HNTA 4Y91A 3LSIA 4A6EA 2X6XA 1WA7A 2HPIA 4CCLA 4M9XA 2LRDA 3OW2P 2KSSA 3ZN0A 2PX9A 2NVUB 1J9IA 4D1QA 1M2OA 1SVOA 3A01A 5FU6B 3Q1JA 2QVOA 3REXA 5GMKl 2RV8A 3NETA 2IA2A 2FVUA 2ZSIB 2DTIA 2PN6A 4V2GA 1VTNC 3KXTA 5KYWB 4F55A 3ABUA 3S16J 5D6WA 3HY1A 3LA2A 4AC0A 2RJFA 1B6AA 3HG9A 2DA4A 1ZR4A 1R5ID 4FX0A 5KCHA 2VXFA 2D9TA 4PJOC 3DB4A 3E97A 3CMMA 2YUNA 1MMSA 4M75C 1BC8C 3HOZJ 2QLZA 3MF1A 2R7QA 3IHUA 2ELJA 1K9MC 4P5NA 2L02A 1YN8A 3JSCA 1Q81R 4M72A 3UR3C 2QBYA 1UGRB 4YRIA 4FASD 2QQAA 1J7KA 3QP5A 3RDIA 1ACMB 1BYMA 2VPLA 2HEOA 5KYUA 1G5HA 2MF2A 4WXHA 3WGHA 4H2UA 4KIBA 2M51A 2EQKA 5E20A 3BG6A 2ZFWA 2DPPB 5L3FA 1CF7A 3HSRA 3ASOH 4BY7J 2EL9A 3PJRA 1G3TA 4M3EA 3K7AJ 4A3GJ 1IHWA 2CWEA 5LGTA 4DBHA 3S6WA 1MNDA 1VQ8T 4TQDA 3VOEA 2CUJA 4Y92A 2DK8A 4YRCA 2BBYA 4II3A 3S2WA 1KD1C 2VUBA 2XAJA 2IS1A 3ZQQA 1GBRA 2D1VA 1Y6IA 4TVYA 4B8XA 1TG0A 3CCMQ 2DFFA 2D1HA 5CYVA 2GZWA 4OWRB 3ZFJA 4A0ZA 5FLXE 3BCAA 2PUOB 3EGXB 2RK2A 1JGSA 1NK3P 4L6V5 1FBSA 1QA6A 1T0HA 2QA4T 2L54A 5IT3A 4MDWA 4JRQA 4EMHA 2HZYA 3P8DA 1R71A 1KD1U 1SESA 1ZUKA 4A0XA 2GQVA 1OV3A 2ZMEC 3K4JA 4ESRA 3MF2A 2MABA 3PMIA 4RGSA 1FBQA 1FX7A 4OLFA 2J5OA 2M02A 2I4OA 3OIOA 2COWA 3K4CA 2XU8A 3VS5A 3HUGB 1M90R 2XI9A 1HYOA 2DL8A 1ZG5A 4ZDPA 1TP4A 3I56Q 1M2VB 2L8DA 4XTUA 1TT0A 3H9NA 5M3FJ 2GA1A 2ARTA 1KIKA 2LD5A 3I56A 4N9HA 2KKOA 1JEGA 3LSPA 3ER0A 3I9V2 5ILUA 3FBNB 3JRAA 1H8KA 1G6NA 4YIFA 3KFWX 5L3EA 2FUG2 2PJRA 4DYRA 2KE9A 5KNLA 4Q5WA 1XS9A 3DU5A 3M8JA 1ZR2A 3J7ZI 2GGRA 1FOWA 1AU7A 1RADB 5HLHA 1VQKA 2HQRA 2MMPA 3OV8A 3GO5A 2M9UA 2KT8A 2M1BA 3QYEA 4G8XA 4RM2A 2HS5A 5C4XJ 4AT1B 5E3NA 2DA2A 2NLUA 1MNEA 3FX3A 2K5LA 4G84A 3IH3A 4XRMA 3GF5A 4PK4A 1KU2A 1E6GA 4E7HA 1GVDA 2O4XA 1A6IA 1GUUA 4GLMA 4EEFG 1ENHA 2V6CA 2VYTA 3ZQGA 3Q9VA 3G4SI 2PBIA 2DA3A 2ZPEB 3CCQI 3GLXA 4CYCA 2A68F 1W66A 5H6QA 2ZT7A 4LD6A 4X34A 5FW9A 2KIFA 1ZSZB 4GRIA 3L2QA 2IS6A 4MZTA 4M3FA 4XTVA 1FJLA 2CSQA 1WJFA 4ZN1A 2E19A 1Q1HA 1NM7A 4X6AJ 5H6RA 3MN2A 2V1RA 3A7UA 1K0SA 3CC7I 1B7TA 3M4PA 4GLKA 3I9QA 2E5AA 2L3SA 2GTOA 2HD0A 4L0ZB 1FTTA 1GXPA 2V8KA 1AWWA 2BUDA 1S72Q 2M7BA 5CKFA 4C2TA 2VBZA 1WIEA 4XKCA 2IW5A 2P0LA 4C2MJ 2GXBA 3AG1H 1M4ZA 3OSSC 4C8QD 4H2XB 3SDGA 4A0YA 5F0CA 4FT4A 3DQVC 3ZMUA 4PFZA 3VV0A 3VS1A 3DPUA 2UXNA 2C0IA 2AO9A 2YRCA 1AWCA 1LFUP 2K9QA 1EH6A 4C92E 4LN2A 3VPRA 4E7SA 1BI0A 1YJWA 2LF7A 1REPC 2KLOA 2ZPHB 2RI3A 2GAUA 3FC3A 1LOJA 1YI2A 3K70C 3AL0C 4E7ZA 3H36A 1QKXA 3GEZA 3VYSB 2QEXQ 3WQZA 3GTQJ 3TDZC 2LRQA 4LB5A 3I59A 3RJPA 1TWFJ 2MH2A 2VE9A 4P75A 1NYFA 3MKYB 3PQJA 1NEBA 2IXSA 3VSKA 2KJBA 2ACJA 3I53A 4DNCA 3R07A 3FXLA 2OZ6A 2XPWA 2OTLI 4XK8E 2EKOA 3TO9A 3EG1A 1O3SA 1NJIU 2MLGA 3CDIA 1H3HA 3M0RA 1Z7MA 3TSZA 5LEKA 3M4GA 2L89A 3LMMA 5DM7R 3IV5A 1IGNA 2RHSB 1YRNA 1BB9A 1SRYA 1ITYA 2DU9A 4IUVA 1RNLA 3OYKA 4B43A 1R6RA 2O0YA 3BG5A 3W2AA 1YJ9I 1HQCA 5FU6C 5J3BA 5ILSA 1OULA 2P6TA 4LIVA 1QWEA 2L2OA 2LNHB 2JA7J 3UDCA 3JB9G 1HD3A 5IOZA 12ASA 4H2VA 1WJ5A 2JRTA 3AAFA 3W6KB 4C3JJ 4XNFA 3TOBA 3K2ZA 1XMKA 3GBQA 1EIYA 3H0FA 3ICAA 2PMFA 3OD1A 4C8QA 4OMPA 3DKWA 2DA7A 1F43A 2LJ3A 3AT1B 4KR3A 2HQAA 2CP6A 3BG9A 1SEMA 4U0YA 2K3BA 1YFHA 1X75C 2XROA 3GZ6A 1B9MA 3TGNA 1K9AA 2FB7A 3E5XA 1ACIA 5I21A 1MV3A 1H4TA 2NYSA 1VQKT 4U7BA 1TWCJ 2CGHA 1KU9A 2EH3A 4M77B 4QVCA 2NNNA 3FK7A 3I4MJ 3OBYA 3VQVA 4MNUA 1LVAA 3M59A 1WQ7A 2A7YA 1NG2A 8AT1B 2KP6A 4YRNA 1R77A 3CJTB 1BIAA 1IC8A 1GLNA 5E3IA 1BC7C 2E60A 3A5ZB 1LQ1A 2GOXB 1VQNT 4TVAB 4HX4A 4XTZA 2BY3A 2OPTA 4UY8I 4KBMB 2RHYA 5K5QA 4B48A 4QSHA 4U7DA 1KQ0A 4JLIA 2YDLA 1FYKA 4TVWA 1PD0A 5J3LA 5J8CA 3CCEQ 2W0ZA 4UB8C 2C0TA 3F8CA 2CUZA 4L9JA 1UB4A 3A8LB 2X6OA 2VQCA 4AFUC 3C2GA 3ABMH 1UG0A 1K9MR 1WHKA 1O7FA 2LBFA 1I0CA 1ARKA 4BQQA 2R5YA 5F6FA 4C3IJ 1WFWA 3PSFA 3HOVJ 3VQXA 3MEYA 4BI8B 3D5RC 3K1MA 4ESBA 1VNDA 4CCMA 2ZCWA 2DL5A 4S05A 3SFIA 3DPLC 2MA3A 1YJNQ 2GFAA 1DQUA 1OCZH 4CC2A 2HYGD 2CO5A 1U9OA 5C0MA 2QKLB 2DO3A 2OI3A 1GGMA 1M1FA 3BDUA 2NS6A 3PUBA 3BR0A 3ZQHA 4RBOA 5CKHA 4J6WA 3C18A 3V8JA 2GWRA 2Y48A 3QPSA 1E3OC 2I5UA 3CCST 4RM3A 2CSOA 2X4HA 3EUKL 4M9ZA 2NVYJ 1PKSA 4RGXA 1IHVA 5E79C 5LJ3e 1SFKA 3PIOA 2CZ0B 2IGNA 3PNTA 1I27A 2V9KA 2DOFA 1UJYA 3VEPA 3SHWA 5FGMA 4RQEA 1HBXG 3OL4A 1QCNA 2SEMA 1UHCA 3CP2A 1YJWT 1Q1VA 1X6GA 2RQQA 4YG2F 2FHDA 5CQGA 3RQIA 2ZXHA 3BPXA 3HPGA 2A5WA 1E3HA 1N9WA 1YITT 4YIIA 1LB2A 1CSKA 3G2BA 3TO7A 1BI2A 2JMWA 2RNGA 1ZLMA 1UELB 5EC7A 2RQUA 3MP8A 3JCMe 2VQHA 2PMZA 3QAHA 2J6KA 1I1JA 5A2QZ 1P9QC 2JA5J 1QE0A 2FQ4A 3CCVI 3F6OA 2Q5IA 2DJZA 1KSWA 1W1FA 4B3XA 1RI0A 4AIKA 2WSEE 1ZUYA 4OGCA 1H3ZA 3DBLB 2GXGA 1YIJT 1U3OA 1UJ0A 2ZR3A 4ZGEB 3CCYA 3K4NA 1N6AA 3MEVA 1SD7A 4HNVA 4P74C 5A2QK 1Z7LA 3WU0A 3CUQC 2KGTA 3V7CA 3E6DA 2DA5A 1X2GA 4OB0B 1GV5A 3LYIA 3N5BB 1ZSZC 4M77F 4AH6A 1X1BA 2BE9B 1ZA1B 1SRMA 5GAOr 4FU6A 2LYCA 3O8GA 2I2LA 2F1LA 3BE3A 2Q2EB 3CCRQ 2KPMA 3KBGA 4GFBA 2PU9B 2W57A 3MVPA 5LJ3f 3RESA 4YRRA 4QVZA 4QVDA 4ESFA 1VQMT 2EZKA 2VQGA 1Z77A 1SKUB 2EW3A 2COBA 2CRGA 3BR2A 2ZTGA 1DPRA 4A4EA 5FLXZ 2ZPBB 3PIPA 2I4LA 2J7IA 1P4WA 1HLVA 2R7RA 2M8GX 4XEOA 3COAC 1MW7A 3PE0A 2ELKA 2M0YA 2X6WA 4YCWA 5J1RA 5KE3A 2W00A 3JCMf 2QKMB 1USYA 5C51B 3Q5FA 2X0LA 1HXDA 2K4BA 2HCKA 2ZNJA 4G6DA 2XF5A 1C0WA 1EH8A 1V76A 1I1SA 4ENKA 1XSDA 1ERDA 8ATCB 3UGTA 4I01A 4BWAA 3P7NA 2E4HA 3WTSC 1BOBA 3PNVA 3R6OA 5CPRB 5FLXK 4ENJA 3TEHA 4WCGA 2E3IA 4JJDA 2Y69H 1VQ6A 3KYLA 1EH7A 2K5IA 4G85A 2OD5A 1V54H 2VODA 3HXUA 3FIWA 4R8HA 4KYWA 3CF2A 4BB7A 2MD0A 5CCAA 5B3SH 1X4PA 3BR1A 5BPIA 2JUFA 4ITVA 3M54A 3SWNB 2GM4A 1KYWA 5LHHA 4OB3B 2DDZA 4LVKA 4XLHA 4CZCA 3PCOB 4P9UA 3ZGKA 1ZRCA 2E2HJ 2KJCA 4EX5A 2KEAA 2RKHA 4ESJA 2E7XA 3TQ7P 3HTRA 1HA8A 1BIBA 1PVEA 1SANA 2Y9YA 1ETWA 1FIAA 2P4RA 3OOPA 2DFHA 2VKDA 3S1MJ 3KCCA 3VYGA 3UF4A 1MSFC 1V55H 3MEWA 3DP7A 1NJ1A 5A0DA 4LB6B 3GYHX 3NAUA 2OJED 1U5SA 2G3RA 1NBEB 2DL4A 5FD6A 2G0EA 3OYCA 2M87A 3R4KA 2RHQB 3QBYA 1YQAA 5B1BH 2R7WA 3OS0A 3LL7A 1HOMA 1ZHIA 5ILVA 4P9FA 4A3JJ 3DCFA 4PSXA 3LQRA 3ABLH 4LG3A 1B3QA 4TTVA 1LKXA 2YX4A 1PDNC 4KJZA 2AXLA 2MYSA 3IUOA 5DM6F 4U87A 3PFSA 1I8FA 1Q7YU 2DVEA 1QZZA 3GFMA 3H5AA 2R7ZJ 3TCJA 2HR3A 4B9XA 2O8XA 4QPOA 1YW8A 3OS5A 3CMAQ 2Y30A 2HDWA 2AKWA 4FQGA 2LK2A 2GXAA 1QVGA 3BDDA 1N8RC 3EQLF 1D3BA 5CIUA 3K1NA 2LT4A 3I56I 2QK0A 2E41A 1IN7A 1ZHFA 1VQOQ 2FJ1A 4ZDLA 2QI2A 4H2YA 1JJCA 4WXCA 3O5ZA 2PMZN 1VIFA 1BA5A 1VQOA 2CH4A 4M7DB 3ABTA 2K3XA 1YHQA 2R93J 2ZNIA 2VT2A 3IKMB 1WU7A 4YRGA 4ZYDA 1BR4A 1UGSB 5GANe 3HFVA 3MCZA 5EGOA 1IREB 4FETA 4II2A 4C8QE 3S1RJ 4K88A 1VYTA 2JW4A 2QSGX 1NPRA 3FXOA 1M1EB 5JVGF 1X3UA 3GMEA 1IJWC 2CYZB 1JJ6C 4DQ2A 3P8TA 4A53A 3JCMW 4A3MJ 5GMKj 4BJTA 5LJ5e 2ZIMA 1H8AC 5B66C 1W5TA 2DMTA 2VKEA 1K8AR 4Z88A 3ZP5A 3CCUT 2FBHA 3EUAA 4PJOD 3GTPJ 4H2TA 3U9GA 1S5LC 2EIFA 1WZOA 4NC6A 2ZNYA 4KT5C 3Q0WA 2KDZA 2PMEA 1R1VA 3B73A 4M75D 1WGXA 1HCRA 3BTLA 3OW2A 1TLHB 2V9PA 1D8JA 4BQOA 4CC4B 4LLLA 5HOOA 1E1OA 3HPHA 3QHSA 2DRKA 3MKZA 1M27C 1BKBA 2ID6A 4C92G 3RQ4A 2VOPA 5D7UA 3ZN1A 4OMFB 2GBYA 2QQSA 2LZ6B 3QOEA 2M1HA 2XTIA 3F22A 3GP8A 1V3FA 1IG7A 4O3MA 3MD2A 1JXOA 1XMXA 1VQPQ 1ZQ1A 2D8JA 2E6NA 1VQ6T 2V8JA 2X1DA 1FMWA 1GT0C 1S72I 1VQLT 3G1JA 1IRFA 2YU3A 4TV7A 1B70B 2A3LA 2RH2A 3PVQA 4PHCA 4OVAA 2RN8A 1VQNQ 3A31A 3KP7A 4ZNXA 5CKEA 4R1HA 4HYEA 1EIFA 2V1DA 4AUXA 9ATCB 1PHTA 4X5OA 2WWYA 2L7ZA 2P4TA 4LG0A 2DTHA 1MMDA 4J15A 2VC1A 2IGOA 5GAN6 4FW1A 2HQ5A 4DOVA 1QLYA 1ETYA 1UFFA 3W6VA 1A5JA 3F21A 1I50J 1Z3XA 2JZ2A 4AFSC 2W10A 1YI2I 3GTMJ 1RIOH 2O9SA 2GCXA 4U88A 3L1PA 1TZLA 1GFCA 3L2ZA 4WWCA 1WI7A 1K0XA 3G6EQ 3INZA 4G12A 3CBPA 5GAOm 2XKOC 2CP7A 4ZGJB 2JJ9A 4WXDA 1Q86C 4N4OB 3IRRA 3G6EA 1LDDA 1YFNA 4PJOA 1IDZA 2F4IA 1QVFP 2PZ1A 2MGQA 2FXAA 3RR6A 2DT5A 1YG2A 2DTZA 4A5MA 2GFUA 4M75A 4HA8A 2O2OA 1ORKA 2IVMA 5CKDA 3GZ5A 2KRMA 4XTWA 3K10A 5J26A 2MIOA 4LDYA 1AHJB 2DDAA 3HHHA 3I5UA 4FW2A 4IF4A 1B9NA 3WHCA 3CCSQ 2VKVA 5JFRA 4CUGA 4C0ZA 1HW1A 2CH0A 2ED1A 4V2FA 3SZTA 1FP1D 1G59A 1R23A 2UV1A 2W7NA 4XQ3A 4B09A 3F3XA 3KFVA 5CVUA 4G9YA 1NPPA 1U2WA 2P0WA 5E3LA 4NOYA 4PLIA 3GTGJ 5FKLA 3QU6A 1RUWA 1FZPB 1YFTA 4IHYA 2JA8J 1FYMA 2DRMA 2NUZA 1W7PB 3HTZA 2O6GE 5CVVA 2W82A 5K5OA 3VBBA 11ASA 1S9HA 2L9RA 2ZINA 1VYVA 1HSQA 1NYRA 3WTXC 2EV0A 1HKTA 4J9BA 4F7UB 1Y8QB 2RQPA 3OY9A 1VQZA 1YHQT 2M8EA 5LJ3h 2Z9OA 2IRFG 3RZOJ 5IHIA 2VXEA 3J81E 5A0GA 3HP9A 4MQ9F 3NQOA 1OPKA 1R5HA 1RAIB 2R58A 2ZT5A 1Y7XA 1W1WE 1XTDA 2DKGA 1B34A 3SWNC 4GCVA 2DQLA 5JHFA 4HLXA 2ZMEA 3S2DJ 1OLTA 3FM3A 1YIJQ 2DK3A 1KU3A 4C5IA 4M3BA 3QYHB 5DUIA 4OMQA 4Y17A 4A4FA 4OINF 4RTYA 1PRLC 2CU7A 4E70A 5LBQA 4AIHA 4UNOA 3FEOA 3JB9D 3JCMh 3IKVA 4F14A 2VXZA 1V1CA 2MI6A 2M34A 5DLQE 1WJEA 2BE5F 3CC4Q 3A8MB 2QYZA 1JGGA 5GAMg 4L5IA 3CC4A 2HQHA 3FF5A 1X6BA 1ETQA 3H35A 2CT4A 1ZRFA 3U2RA 4ABZA 1QBJA 2X1EA 2GNCA 2MWOA 3DLLA 2LC4A 3X24B 4LNPA 1LCKA 2FYKA 2M0CA 4HAMA 1KHCA 5GAN4 2D2WA 3EETA 1NE8A 4D9JA 2EBIA 2V1QA 7AT1B 1QVPA 1VOMA 2BHZA 4DYCA 3IRQA 3RERA 3VYUB 4RB1A 2XIDA 3K70D 2EA4A 3IWFA 2OTJQ 1ZBXA 1RLPC 4AFZC 2L01A 3F8FA 5J47A 5L23A 1K73C 2CFOA 2DW4A 4A4GA 1S6LA 3GBGA 4KH1B 4GXOA 3JSPA 4ME7A 5E1WA 3X25B 2JOYA 2ALYB 1G5VA 4M3DA 2DO7A 2KYBA 1YW7A 2HVQA 1X2KA 2ESHA 1LFBA 3OB9A 1X1PA 2V9VA 3NEMA 3OMYA 4HSTA 1NJ6A 3AG2H 4M7DC 4KDPA 3P9KA 1WQWA 2KR3A 2Q1ZB 2GBQA 5D5WB 2HQNA 4A4HA 2ZKZA 4M7AB 4UP8A 4BHPA 3SEMA 4Q15A 4O2DA 3HGGA 1B59A 3M5AA 4ZC3A 2DMQA 2A08A 3CCLA 2EAYA 3R6SA 2YSQA 3V8KA 2JSCA 3REBB 4C5HA 2LREA 3NPFA 1I5LA 4IUPA 4AIJA 1QKWA 2ISZA 3IH2A 2COYA 1N8RR 2XV4S 2ZPIB 1DP3A 2J3LA 3IALA 4BKXA 4JRIA 2JRMA 4N0BA 4C0FA 4BXXJ 2W25A 1KA8A 2PFBA 2M3AA 4DEYA 3QRFF 4YRVA 1M3BA 4UPAA 1BCMA 4JLGA 1B72A 1A31A 5GTIC 4FX4A 4HBLA 4RB3C 3MEUA 1AA7A 4RUGA 2HXOA 3VB2A 2XGCA 3SD4A 4DIQA 2QHVA 5DTDA 1H641 1VQ9T 2PUKB 1Y1VJ 3HXLA 4FTHA 4TVRA 3HRSA 1YO5C 4U0VA 1SRLA 2DXUA 2L3QA 1NYGA 2BZ8A 1EJ9A 4L59A 2KQWA 4W97A 3CCRI 2WB1N 3I4NJ 1TWBA 1MJBA 2DLPA 4LDXA 2KIQA 2O7OA 2NUPB 2MC3A 5A0LA 2FEZA 1M1KR 1M5Q1 2B7EA 3X28B 2OAZA 4PJLA 1GVJA 2XDDA 2BW3A 2QENA 3K0LA 2LX9A 1JXMA 2CMPA 2KRNA 4RTTA 3GIBA 2F5FA 2R7FA 4ZH4F 1XC5A 5FKOA 5L8RE 4KIFA 2YWWA 4XTYA 5ICFA 5HS8A 3QDRB 3JRFA 4IUTA 5BS6A 1YS6A 2M30A 3LAJA 2RREA 4J9FA 2VBYA 2VB6A 4XLNF 2MBFA 3HSEA 2NNYA 3N4MA 1W4MA 1J5YA 4AD9A 4C92F 2VKHA 1HKSA 2R7TA 3JCMX 5KYWA 4PLLA 1WHJA 5GAOp 3VQWA 3MKDA 2VBWA 3ZOBA 1IXRC 3VODA 2ZCFB 1HC8A 1CKBA 1YP5A 3QO3A 1RKWA 1G2BA 2LMDA 5CJ9A 5L3DA 3RPQA 1X4OA 2DJQA 3HRIA 4YRKA 3F23A 3E2UA 2P81A 3GTLJ 3G3ZA 2W85A 2EJ9A 3G1OA 4D8KA 2VWFA 4Y3OA 4ZTFA 4AG1C 4FSXA 3HGYA 4CYDA 2DCEA 2HOTA 2KRFA 4EGZA 4JQFA 1YNZA 3REAB 4CS2A 4ATOA 1RRJA 3HOSA 2BXYA 2LFBA 2M4KA 2UUZA 3C4SA 4JUVA 1TW2A 3IP4B 5GANh 4M78B 4G6QA 3X20B 3BT9A 1ZKGA 3E5QA 3NHNA 3CF5F 3MZYA 3H1CA 2RJEA 1Y0NA 2EYYA 1I1GA 1DU6A 4IKFA 2IP2A 5ELNA 4JRKA 2AT1B 1NLPC 4E47A 2NXNB 4GDFA 1R1UA 5HGQA 4LITA 1Q86R 1EKEA 2HBPA 3RUXA 5LJ5h 1S29A 2KQRA 1QVGS 4D7MA 2P8TA 3E19A 5GAGJ 3WXMB 2WV1A 2PJPA 3E0JB 1BL0A 2B86A 2Y9ZA 4OAZA 1E17A 2HQXA 2HZDA 3C7JA 2F2WA 1MBKA 3C94A 1WJQA 2ICWG 4A6DA 4JBAA 5L3BA 1XJWB 3KP4A 2L0AA 3EGXA 2EYWA 3TP0A 4PJOE 3EFSA 2EIKH 2BY1A 4C8QG 4EPCA 1R22A 4OIPF 4M75E 4FYVB 3A98A 5FB2A 2DZ9A 3FZVA 4RKUE 1A6QA 2L0KA 4XRSA 1D1BA 3CXCA 2Y2ZA 2X9HA 2EK5A 2ABLA 3FMSA 5FRNA 5GAN2 4ZYHA 1FYLA 1Y56A 4FL6A 2COMA 2M45A 5GMKi 1B76A 4A12A 1XGSA 1BBUA 4LLNA 4ON0A 2DX1A 4L0YB 1ZYRF 5EG0B 3MWMA 3HUGA 4BY6B 4CCOA 1IRXA 2LC2A 2VOOA 3GNFB 3CO7C 3L42A 1M2VA 3FWEA 4HT4A 1VQOI 2EYZA 3LW5E 1TH7A 1C6VX 2K4YA 5D6FA 1ON2A 4OMZA 2IEKA 2DOEA 4YYEA 4LE9A 3T5XA 3N97A 3MMYB 2TRTA 1R7JA 2IPQX 1WPYA 2Z0WA 2Z5UA 3JW4A 2E3CA 3THKA 3A1PA 4LFUA 3MHXA 2LQ8A 1MGQA 1KMMA 2AXTC 5C6SA 2JTVA 1IO6A 3OSVA 1EVKA 4XMYA 5IYDJ 4HV5A 3HL2A 1W0TA 4XORA 3WTZA 1WCMJ 4MHGA 2KBTA 4RTVA 3NFCA 5HDKA 5FROA 2L9NA 1TQIA 2HOSA 3NEUA 5HODA 4A63B 1X27A 4VUBA 1RACB 1R00A 5EDNA 3ASNH 4UVAA 4M71A 2DAOA 3B6AA 4MZPA 2RMOA 4P74A 1FY7A 4BJ6C 3KIOA 3C1DA 3TW7A 1WHUA 1OCTC 2CW7A 2F6CA 4RMOA 4DEXA 2VI6A 4Z6YA 3CD6Q 2WSCE 5EG2A 3CQTA 3I3LA 3OYBA 1T56A 1ZSZA 3CD6A 2CJAA 2L7FP 3HPWA 3TO6A 2DILA 2OTLA 1OX9A 2HDCA 1ON1A 1IN5A 1VQ4A 3IAM2 4C0GA 3O6BB 2F5KA 3SB2A 3UA6A 1I6XA 3SQNA 4TQFA 3LLRA 4M7AC 5CVIA 4FHTA 3QYGB 5CR2A 3A7AA 3P8VA 1VQPI 3LC0A 5D4SA 3L2VA 4AVZA 1Z05A 1K73R 2RAEA 2B63J 1GCPA 3NENA 1YJ9A 4EJWA 1WNLA 3MCAB 1MKMA 3KLNA 2ZPFB 2C06A 3P9IA 4JP0A 1HW2A 4BDZA 3AKZA 1WXTA 2JS2A 1IRGA 4HRIA 4AYBA 4BH9A 4H2XA 1OOTA 3M3YJ 1BJZA 3BJ6A 1X3ZB 1V5EA 3LAPA 4Q48A 1HKQA 2LVSA 3SZPA 3M0TA 2A6EF 4HXJA 1OZ3A 3O3KA 2BYVE 2E1HA 1P7JA 1TWGJ 2FOWA 2XPUA 2J05A 4IRHA 1U8BA 1X01A 3S93A 5EYRA 1VQ7Q 4J7FA 3E9FA 2EIMH 3G6EI 4YFXF 1WJDA 1VQ7A 2PVGB 5K1PA 4IXAA 3E5UA 1Z9ZA 1XN7A 3MQ0A 3TL4X 2QAZA 2E5NA 3E6BA 4RQFA 1Q82R 2X4XA 2G7UA 3VS2A 2ROTA 1JKRC 3H3VK 4JJNK 3OYDA 2MK5A 1I3AA 4IZZA 1SD5A 2WY7Q 2QTVA 2LY9A 1VA7A 2CGPA 2QHUA 4D0PA 3G4ST 2VGMA 2RHSA 2LP5A 3CCQT 2FZGB 1OCCH 4XLCA 5F27A 5DS9A 2NVTJ 1X2NA 1U6GA 1ZAOA 4O6JA 2MCNA 4ETSA 1G8XA 1X2HA 2E1NA 3CDLA 5C44J 5FLVA 1OU8A 5LRSA 4RAFA 4QQGA 4ZYGA 2QUFA 3SEQA 3UKGA 2IAIA 5GADJ 3GFLA 5KYXB 3F6VA 4CGZA 3JRZA 3CTAA 1QNTA 1J5WA 1K6OA 4M7AG 5IOYA 1H0MA 3JCMP 3EUHC 2MAMA 3RSNA 3CC7T 2GQQA 4HSRA 2PEXA 4MMLA 4QQ6A 3QU3A 4KICA 3LSSA 2WAEA 5JHUA 3RL6A 4XKBA 2PMUA 1E24A 4XM3A 2YXYA 2NVQJ 1X2MA 2BY0A 1KU7A 1IV8A 3QWXX 1UHMA 2QQ8A 2P5KA 3I55Q 2LJ1A 1DP7P 3HY0A 3DKMA 4A54A 4M6XA 2HL3A 3WE2A 2V4JC 4YRSA 2FPFA 1QPMA 4M77A 3DU6A 4M78C 1TW3A 5FJ8J 5F0HA 2OX7A 1ZELA 3LX7A 3KX2A 3R0AA 4CH5A 3S3OA 2WV0A 4G7OF 4B44A 1GXIE 3A5ZA 1G3SA 3QPHA 1NH3A 2HOEA 2V1UA 3HRKA 2DM1A 4TVAA 5C52B 5EZHA 1SPKA 3CC4I 1U1TA 1KC8R 2DEQA 3TMOA 4YFKF 2I8DA 1VQ9Q 1T95A 1UG1A 2GOMA 5IHKA 2ZPGB 3CP8A 2XGTA 2KIUA 3OYFA 2LTPA 2XF7A 3CJRB 5EEHA 3CCVA 3J80Z 3JREA 4I99C 4UV8A 5FKMA 2OTLT 4XAXB 1ZA2B 2BY2A 1NG7A 4FYXB 2DQ0A 1HSTA 2DT7B 5DCMB 1Z6TA 4CCNA 2DYBA 1USTA 1XDUA 1MIJA 1JU5C 4XKVA 1H89C 4EQQA 2ZGWA 2CZ1B 2HKNA 4I98B 3M55A 1YJ9T 3H9QA 2CZ6B 3J80K 4A3CJ 1SHFA 3V4GA 3UT1A 2OJ2A 3UPUA 2EFPA 4UP7A 1B7YB 2EFOA 3FHZA 3HKZN 5ERIA 5ICGA 2LP0A 2DETA 2H3EB 4A3DJ 2DOAA 4KISA 3CC2Q 2K3FA 1IUYA 2A0FB 5FKKA 2CKKA 3L1AA 5GJWB 1GDTA 3TKYA 3SHFA 2IT0A 2JA2A 2CV0A 1VQ5A 2NS7A 2H09A 2XIGA 4RB2C 2F5CA 2WAQA 4MFEA 3F8BA 3A02A 2KRHA 1KQ1A 2PNIA 1T8IA 4UUSB 5TISC 1DDNA 2Y90A 2E6ZA 4C8QF 3CPWA 3CCLI 4M78G 5IAYA 5CLSA 5LJ3j 1Y1WJ 1FTZA 3FXMA 1C1AA 2W48A 1UHFA 2RQRA 1OR7C 3MFKA 5CKBA 1OJLA 1CKAA 1QVFA 3QO8A 4FYYB 3ZQ7A 3ZBDA 3NWSA 4J6YA 3A0HC 1MHNA 3G1ZA 3SDZA 5A2QE 5LEJA 5IP6A 2C0OA 2HVRA 2D45A 3RTRA 2XB0X 3E1SA 2I4MA 2ZJRF 1E2XA 4IIOA 3BZKA 2F2XA 4B4CA 2ZZDA 4C3HJ 5HS9A 1Y8RB 3KZZA 3HYIA 4YRQA 5EEGA 4MQVA 3P8HA 2P4WA 5D6XA 1AZEA 3LH0A 1OX8A 4IUUA 5BMZA 3VS7A 2H3JA 2OU2A 3I4PA 4DBRA 2V6EA 5LJ3d 1NJ5A 5LGUA 1NZ9A 2NYXA 4M73A 5GJVB 3R0JA 1WH5A 2EB7A 1S3JA 2AKLA 2QSFX 5GMKh 2GIZA 2JVHA 4CHUA 2XKOA 2X4JA 4AU7A 3MKLA 4BXUA 4PNOA 1L3LA 4Y13A 1JUSA 5TGTA 2Q2EA 3VFZA 1T33A 3UGQA 1G5IA 2SRCA 3JCUC 2FNPA 2DD4A 1KQ8A 2HKXA 5DD4A 1N5ZA 1POGA 1MZBA 4IRIA 4FISA 3W2WA 5FO5A 3JCMd 3AHUA 3W3SA 1R8OB 4LLGF 4EJVA 4HLYA 1JKPC 4I0AA 2VXDA 4JS4A 4E7JA 4M6VA 1M30A 3KZYA 2A61A 4BQNA 3V7SA 3TP3A 2BE7D 3H0GJ 2IA0A 3RBBB 3CCMA 4FYWB 2ARUA 2LDUA 3LSMA 3BROA 4ZYEA 1APLC 4HZFA 3HIFA 1DJ7B 3G71Q 1ULYA 5D8LB 5IYBJ 2J06A 2DN0A 4XLFA 3FJPA 2QG9B 4FT2A 5AIPA 2CS3A 4WI1A 4HQMA 4A3EJ 2L3DA 4DJAA 1TT5B 3I71A 2M2EA 5J1YA 1J0RA 3C95A 5F04A 3ABKH 5K7HA 1G4DA 4ZTUB 4DGWB 1N9SA 5GAN3 1Q82U 1IZ6A 1V4RA 4RG8A 3BFMA 1QVUA 2DFUA 2P5IA 1Z0XA 3OIQA 4F52A 2CUFA 3ML6A 2LR8A 3CCVT 2R7UA 4KGVB 2L7KA 4PDKA 1AD5A 1YX3A 4P1WA 2R5ZB 2F5DA 2O9LA 5D5UB 4PJOG 1PWTA 3DTIA 2VJ4A 3SWNA 4XBFA 3CMEQ 5GTHC 4KITB 4M75G 3KPHA 3PCOA 4M7DD 1H9TA 1SSHA 4G94A 2LDMA 1U3EM 1YLFA 3A5YA 3I5SA 2FRYA 2ATCB 1JHHA 3CXCS 3LNQA 4L5EA 1QU3A 2DYRH 3HOXJ 2XD0A 1MGTA 3I5RA 3K2AA 3L9FA 5IT9E 1S8NA 5JVTA 4WX9A 1SMTA 2WY8Q 5GAMe 3OYEA 4Y4RA 4BDYA 3EFOB 2QTXA 5KAFC 3D0SA 3PFYA 3HEFA 2YHTA 2FF4A 1WYDA 2XAUA 1E22A 4C5EA 3OS1A 2R0QC 4IQJA 3DKYA 4F7ZA 3CCJQ 4IX7A 2RHQA 5IXBA 2XHKA 4ELZC 1PYSB 4KT6A 2JMCA 1JJ8C 1KHIA 4EMGA 2RB6A 4PUSA 2RJCA 4YFNF 5I11A 2K9SA 5GAOn 3BG3A 4RMNA 2ZFUA 3IL2A 4Q5SF 5F64A 2K9NA 2J6FA 2LT1A 4UC4A 3VRZA 4J5YA 4F04B 1G3YA 2XAHA 4PJ0C 1I39A 3JCMV 1QP3A 4HOBA 3S15J 1KOGA 2ZXWH 2XK0A 1YCYA 1KC8U 3QZ9B 1X1DA 1YW9A 1KQSA 2DFEA 2E36A 2PLYA 2EINH 4ZTZB 2NWMA 3QNEA 4KGZB 4WCIA 1B4AA 5AT1B 5GAOq 3TOAA 2YPRA 4XU2A 5CVJA 4BYYA 3QYFA 4IVNA 1MDMB 3RZDJ 1NK2P 1M1GA 3LFUA 4UXNA 2XAGA 1S72A 4M7DA 2LY2A 2YRDA 2K9LA 2X6YA 2K7LA 3J7YJ 3FISA 2EVRA 2FMLA 2E70A 4UUVA 1T39A 1P4AA 4RTXA 1MJ9A 1IZ1A 3CMYA 1Y0MA 2EZHA 3H5NA 1D1AA 5GAMf 3BQYA 2RQVA 3G4SQ 3LSKA 3CCQQ 1HTTA 1FOXA 3P8BB 2DA1A 3M7GA 1TTYA 2IVWA 4ENMA 5ICEA 1W6XA 1NJIC 1YIOA 4V2SA 2DF6A 5GANj 1JTXA 3ME9A 1C0MA 2R7OA 4OMYA 3OMGA 1G51A 2ARSA 2XF6A 5J8FA 3MQZA 2KFDA 2QEXA 3WU1B 3WG7H 2JQ7A 2D5VA 1FC3A 3CC7Q 3NGPA 1TTHB 2XSDC 1H9GA 3FRNA 3CD6I 3GCMA 1TUCA 3QJ6A 5LJ5j 4M74A 3EG0A 2KROA 1K7AA 3ECHA 1VQ4I 3BR5A 4N4GA 3DV8A 3HFZB 4IPAA 3HSBA 3CUOA 3RMQA 1D8KA 2XGDA 2RVCA 1WX6A 1FEXA 4QIWN 2HNIA 4J19A 3MKWB 1I07A 1ZG3A 3OL3A 4NL2A 3BOQA 2CP3A 2AQFA 2ZC2A 2Y0SA 2BZTA 2AMCB 2H8RA 4CH3A 5J4VA 1N75A 1W7PD 3SYTA 2P84A 3DXJF 1B70A 5GPCA 2P5LC 2MLKA 4D5FA 4LVMA 4J9GA 3K4MA 3C2HA 2VC8A 4ZN3A 3LA3A 3I56T 3ISPA 3FXQA 4RCBA 4JK1X 3QIIA 3SDBA 4CCKA 5HVQC 2PVDB 1BW5A 2XSJC 5LRRA 5KYYB 1ABQA 2ZXIA 1Q81U 2EYQA 1I5OB 1E7OA 2VE8A 2LG4A 4JOMA 5GAN7 1YE9A 3ZR8X 2BEOA 1VQ7I 3OA6A 3KP6A 5K5RA 3UH0A 3QYBA 4Z02A 3U21A 2YLCA 2EWNA 3BY6A 5ECAA 3UATA 1RAFB 5GAOl 2STWA 4DA4A 2A37A 1FIPA 1OYYA 3H92A 2M5WA 4RA2A 4HCCA 2P7CB 4IHVA 1Z9QA 1PSFA 2P5VA 3MJXA 2VPRA 4MEXF 2MPXC 1SETA 2JXBA 3HJEA 3M07A 3HL8A 2NS8A 4KUMA 1JBMA 1NTCA 1RAHB 4WJ3M 3ELKA 1WXBA 4Q4ZF 4HNUA 4GGGA 3HOYJ 1IXDA 4DBQA 1U8RA 3CCEA 2QGFB 1T2KA 1P4XA 2L7MP 2A6HF 5DLOA 2HKOA 1S7OA 1XNIA 2H8WA 2K5CA 2DFIA 3KEOA 3L2UA 4OIQF 2E65A 5DM7F 2E5KA 3BZ6A 3KP3A 3RPUA 1W7PA 4C0DB 5JR3A 1YJNA 5ELOA 2A6TA 2FZKB 2RHIA 2JPBA 2X51A 1A35A 4MFDA 2R92J 3DTKA 2Z16A 1M90U 2VUMJ 1SF9A 2LCCA 2ZXFA 1BOAA 4L87A 3EPZA 1KD1R 4B9WA 2K86A 2ZR2A 4F7UA 1S72T 4C30A 2KRSA 4P3PA 4U0WA 2IS2A 4M6YA 4EMKB 4OGEA 1RABB 1SVMA 1IAWA 5DUKA 3WHBA 1XSXA 1UE9A 3BR6A 4OMNA 1YB3A 5C53B 1U9NA 2PG4A 2JM9A 5E3OA 2OQGA 2C8MA 1XQHA 4MTEA 2IPOB 3DBRB 1WHGA 3OYLA 2P0PA 1W36D 1YI2T 4L9VA 3TW6A 4M7AD 2LVMA 2BHYA 2DJNA 1EA3A 2NAZA 3LWHA 3DLMA 2DTRA 1OYXA 4HF1A 3HFOA 5I2MA 1UG2A 5C4JJ 1K61A 1SD6A 4LVJA 1WPKA 4P71C 3KLOA 1FBUA 1IXSB 2FG0A 2QCOA 1Z3YA 3Q0VA 1SC7A 3H0DA 2K2MA 4LVIA 3ZRGA 3S2HJ 2K57A 3ZQCA 1XGMA 1SAXA 1ZGJA 4AWXB 1VQ8Q 2DL7A 3CPFA 4LK1F 1TNTA 3HZJA 4RS8A 3B6CA 3L00A 4PJOF 3C3WA 1DPUA 1RL2A 2BIVA 4AMCA 3BTCA 4KN7X 3PZCA 4M75F 1UHSA 3CPWS 5FWCA 3FB9A 3VQYA 2ECZA 5L3CA 1V5GA 2EILH 2HDAA 4HCKA 1KMNA 1FXXA 1LPLA 2M0MA 1W2BA 1ZLKA 2QA4Q 1UGQB 2ME0A 3T0YA 4XRSG 2AQEA 3LA7A 2OZUA 1X6OA 4CA0A 5FD5A 1K79A 2ALYA 2DBMA 1SSFA 3CC2I 3CCRA 3BTJA 1VQ5I 2PVOB 2H8HA 1O7LA 2Y0SN 3RKYA 1WXUA 2RQWA 3REUA 1X19A 1AWXA 1RLQC 3VWBA 2NRAC 1OCOH 1QVGP 5GP9A 2W4SA 3M0PA 4M7AA 1M9SA 3E6MA 1XGNA 1ADYA 5J40A 2VV5A 1D0XA 1LJOA 2F69A 3S1NJ 2Q7GA 4GY5A 1GCQC 2YR2A 4OF1A 3TREA 5IPAA 1QZYA 1K1ZA 3DEEA 2IIMA 2FQ3A 3IQLA 5E1ZB 4JRPA 1OISA 3LWFA 2DU5A 4HWOA 3H3ZA 4BQAA 2FZCB 2X3XD 3BJUA 2ZIOA 1SERA 2EJRA 2EV6A 4L9NA 3CMQA 1YTYA 3KUFA 3VYRB 4NQWB 3HHGA 5IYCJ 3GVAA 4A3FJ 3LOCA 2Y31A 2K6DA 3JCMJ 2K02A 1VI0A 4KA4A 2DEUA 1JB0E 4IIMA 5E8IA 3A7RA 4A3BJ 1OI1A 2YT6A 2I0NA 3JCMQ 2W84A 4M78D 3BDLA 3OWTA 4IQ4A 4B3AA 3WG9A 2KT1A 3GUDA 5AIQA 3WTTC 1LJ9A 5HNFA 3MZ8A 2HI3A 1NJIR 4M7DE 5GAMh 4EIKA 3DLLF 1CGPA 5IT9Z 4L18B 2NUPA 2K3YA 1LEBA 2ESWA 4F16A 4HPQA 3BG7A 3D7SB 2LF8A 4OAYA 2RPNA 3FXJA 3LSGA 2DAQA 4MLOA 4G6TB 4HWSA 4IHWA 1ZQ3P 3A1YA 2QDLA 2K2VA 1BU1A 2LSOA 3CCMI 4HG2A 1Q7YC 5M5YJ 5GAN5 1TWHJ 3EG9B 3S32A 3DEWA 4ZYAA 2JVGA 1E6HA 1A04A 4I02A 1W70A 5KE2A 5IT9K 1RETA 3BZCA 2XPVA 3FBIB 4DW6A 3FMRA 3G71I 2PTKA 2D1XA 1PM3A 4YRPA 1FPQA 1KYZA 1LUJB 3UNGC 4AVPA 4A4KA 3IG2A 3KZIC 1Y71A 3HOUJ 4QW2A 2AIRB 3EUHA 1XDSA 4BACA 1TL8A 4XOTA 1J59A 4JDSA 4J9HA 2ZJ2A 2X3WD 1QP2A 2ODRC 4RMFA 4IUQA 1ZARA 4M77C 2YLBA 2Q0OA 1T0FC 2L3RA 3L4GB 4PJNA 5I2SA 4LUEA 3PGGA 3L7WA 3RDVA 1TSFA 1ZUUA 3CMAA 4HCZA 3JB9F 4G7HF 3H9GA 4YEJA 4UB6C 3PVLA 1BCOA 2FMYA 2EQMA 5B5EC 3CMEI 2KK4A 1K9MU 5CQEA 4M78A 1B8AA 5HLTA 2Q8KA 2R3SA 4OP0A 2P7VB 3V42A 3JRIA 2O5RA 2CZ7B 1LDKB 2V1NA 2IG0A 4YREA 2DODA 4PCQA 2PMHA 2OA4A 2CIMA 2F2VA 2DXTA 2LH9A 3ULQB 1AKHB 1LDJA 2OF7A 1K4TA 3OS2A 2FA5A 4N4NB 4O5VA 3ZQLA 2GIVA 1E1TA 1KQSS 2LNVA 3ERED 1HDPA 4IOCF 3CCRT 1V29B 3M9QA 1X69A 2VC0A 4C0DC 2J3MA 3RKWA 3CCJI 3PNYA 4NDLA 3GTOJ 4BI4A 2MWPA 1JJ2A 5DEQA 4EJOA 1DUXC 5TJJA 3H3UA 3F70A 3JRDA 2DIQA 2QGGA 1TBXA 3PO2J 3M0QA 1SMYF 3CLOA 2RNJA 2XDPA 4EMKC 3ZMDA 4JPBW 5JI6A 2IY5B 1PUEE 3PQKA 3FMQA 2BV6A 1WLPB 2D0NA 3R61A 2KXDA 1QO0D 1EVLA 2Q7HA 4XONA 4RAYA 1MH4A 2IGKA 1AVZC 2VBXA 4IURA 3TQNA 3HOWJ 5FFXA 4PGHA 4M77G 5EG0A 5D5XB 5JLWA 2HSPA 1VQKQ 1LE8B 3GFJA 1WSUA 1O9SA 4UUTA 4BEHA 4F17A 2M7AA 2UZKA 2X48A 1VQPA 4BXFA 3ZEHA 2HVSA 1FYNA 1R49A 1UCRA 2X9DA 1IGQA 1OCRH 3U1DA 1RAEB 5GANf 5K7FA 1P2FA 3FXKA 3VS4A 3GWZA 2O31A 1VQNA 2UWMA 1HK9A 2RI5A 2F4MB 1I6HJ 4MMKA 4CXFA 4M4ZA 4F7UE 1OR7A 1IRZA 2E1CA 1VFCA 2ELHA 2FO0A 2HQEA 2ZJQF 3CUQB 5GPAA 2K27A 3B02A 2AHQA 1XOVA 4CS3A 5LJ5f 4EV0A 2RA2A 1WDXA 3QPTA 4OMMA 3HOTA 1PC0A 2QEXI 2CQQA 1B8IB 3META 5L3GA 4XL9A 2CQ7A 3M58A 4LUDA 1ADJA 2ZBKA 3HXVA 4V19K 2CW8A 2X4WA 4J7IA 2EBPA 1ZREA 1OZ2A 1OYIA 3RF1A 1GHCA 1MUZA 4BUPA 2MD5A 1NHAA 3TUPA 4XN0A 3JV3A 4J6XA 3M8FA 2RHXA 1KQ2A 1OPCA 4IHXA 1TNSA 1K78B 4BHBA 1UTIA 1X1CA 2E71A 2LTOA 3VYTB 2HYJA 2K9MA 1WHMA 1NNHA 2K9GA 2KVQG 2XKPA 1KZHA 4HWTA 4LXCA 2DL3A 3CCSA 1X55A 2M4GA 2I10A 4E6KG 2YU9J 4MDXA 3M4YA 3CQZJ 2FPDA 3EYIA 1WI9A 3VS0A 2CUEA 3OYIA 1EQRA 1D1CA 2KIMA 1YJWQ 1BN5A 3GZNB 4YRLA 3VJPA 3RKQA 3CMAT 2LKPA 2XVCA 2CP2A 2YUSA 1YI2Q 4UP9A 5HCKA 3HSFA 1ZGAA 3OR2C 1YITQ 2E3HA 4N0AA 1MV0B 5KNNA 3JAMZ 3OYAA 1YITA 2MW8A 4FT8A 1VQOT 2G9WA 3OIPA 1X58A 3W3CA 1N77A 2L9SA 4PGGA 3BQZA 4MTDA 2DXBA 3TEEA 1QHGA 5DY9A 2CW0F 1TOVA 1JUPA 4F91B 2EJGA 2O03A 3OR1C 4HX7A 2AHJB 2XAQA 4EJUA 2P0KA 5LD2C 4ZTJA 1SFOJ 1K4US 3DWLE 3JAMK 4LDWA 1UGVA 1WH7A 2OQRA 2IGMA 4HF2A 2ZZGA 2DBKA 1U0JA 5EEAA 3CJQB 4IHSA 1YIJA 3I54A 3BLYA 1RESA 3QTCA 4UVBA 2HNHA 4JZ3A 1D0ZA 1TUDA 2HU9A 2NUTB 1M3AA 2OC6A 3MEAA 2AS5F 4M7AE 1EFWA 4BE2A 5C3EJ 1VYUA 1YYVA 1XGOA 4HF0A 3F0CA 4LJZF 2DMNA 1FSHA 3RACA 1MMGA 2H1KA 4CS4A 2KXCA 3BPVA 3CCEI 3U1KA 1ZTRA 4XTXA 1WQ2A 5DYMA 4KMFA 2E10A 1YFSA 3LQQA 3QQAA 4CH4A 3QZ5B 1EZZB 2BGCA 4FCYA 2R7VA 2OBPA 2A69F 4NUBA 3MP6A 4BE1A 1UB9A 2LNBA 2MOXA 3EGDB 1VQMQ 3AG4H 2DERA 4HT9A 4HVVA 4J00A 2P6SA 2V1XA 4I6ZA 4C92B 2BOLA 4PFOA 1ASYA 1YJNI 5KYXA 2NOJB 1VQMA 2D6FA 4XSZF 6PAXA 2JTMA 2MG4A 3LSRA 2V8IA 1Y96B 2D0QB 2AK5A 1U5TB 1LVKA 1VQPT 1I81A 4H2SA 2GA2A 1RAAB 2A07F 2OTJA 1H92A 3OMCA 1FMKA 1SD4A 1PUFB 4J9CA 5HK0A 4K86A 3OSFA 1T98A 3GXOA 1B1BA 2ZZEA 1Q7YR 3EHQA 2LLKA 2DE0X 5D4RA 4QKUA 4E7LA 1FLIA 1PRMC 2W24A 3M1CA 4RDUA 4A2UA 4KR2A 5KCOA 1DGRM 1DGWY 1K8AC 2EFQA 1ABOA 3H41A 2FNAA 2EPFA 3RI4A 3IC7A 3RYRA 2K85A 4LD9K 3ERRA 3MZHA 4I2OA 5EJCA 4EATA 1P92A 2DYIA 3G7ZA 1RIQA 4KUDK 4PG3A 1W2BS 2QDYB 3G6ET 2EGAA 4K87A 2FL7A 4NC7A 1EF4A 1ZGWA 4XRFA 2ZNZA 3ZQFA 1K8AU 3UWNA 1D0YA 5GAN8 2KZGA 1MD0A 1O3TA 4FIBA 2V7FA 3C12A 1MBFA 1OFCX 3HB9A 1P6RA 3S1QJ 2VJ5A 3ZMTA 4KULA 1ATIA 3E9HA 2J5PA 1YBYA 4ZGDB 1EOVA 2DVJA 2ZT8A 2C7IA 1WKMA 1YS7A 1W4SA 1VQ8I 3J80E 4PJMA 2FEIA 3FK6A 2KZVA 2CT3A 4MEYF 2IJLA 2XDBA 1O3RA 4S04A 1E0EA 5J6XA 1PKTA 2WAFA 2XRNA 5DCMA 2XICA 2XGEA