3V8LA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotinyl-5'-amp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
molecule keywords Biotin ligase
total genus 100
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8lA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8lA02
3ZP5A 4P75A 2XKOA 1KMNA 3BDDA 2DZCA 2EV6A 4M7AB 4RCCA 2FSWA 4IHTA 1R58A 3ZMZA 1P4XA 1ODDA 2DK8A 1PYSB 1Z91A 4YRKA 1JHFA 3JCMe 2O6GE 4M75A 3PQKA 3INZA 5K1YA 4ESFA 3HRSA 4RGXA 1BI2A 2XVCA 3M9AA 2E1CA 1B7YB 4CH4A 4I09A 3L1AA 3OD1A 2K7LA 3TO6A 3FJPA 3K1PA 2EJ9A 4KN7X 4G7ZF 4UV9A 2K57A 4Q5SF 3P8TA 4TVWA 1VQZA 2IVMA 4LG0B 2FNPA 4OMZA 4Q47A 3FXRA 4EM1A 2DLLA 2ZZFA 2L4MA 5FB2A 4YRNA 3TUPA 4YRIA 1YYVA 2RD1A 1I6XA 3V7CA 4XEMA 2AKWA 2QHSA 4YIIA 1RIOH 4XU1A 3F8CA 3ROUA 2ZBKA 5LJ5h 5F5WA 2IW5A 3ECHA 2G4CA 2K02A 2D45A 3E97A 1B7YA 1X2GA 2L3DA 1N9SA 1UHMA 3JSPA 1HXDA 3G1ZA 2DQ3A 4YRTA 2GA1A 3WODF 1ZG3A 3HSEA 2PJPA 2P5VA 1D5VA 4XQ3A 4OIRF 1KQ2A 4XTVA 2EFOA 2A6EF 1LDKB 3FMRA 2C7IA 4M7AE 3W6KB 2QHVA 3QOPA 3E3VA 3VB2A 2IA1A 3M8FA 1K78A 4M78F 1WQ2A 2JRTA 3ZN1A 3REUA 3R07A 3NRVA 1I4K1 4P74C 5DD4A 4KFCA 3H3UA 2ZNYA 3ZMSA 2NRAC 3FB9A 2BBYA 2W85A 3I59A 5HDKA 1PP8F 4OMYA 2BE5F 1YFHA 3JAMZ 2XAQA 1OMIA 1U1TA 2MC3A 3R0JA 4X9CA 4UP8A 2CYYA 4EMHA 1J59A 2NYXA 4A0YA 4EQQA 1YO5C 2ZIMA 5CVIA 4M75F 1L3LA 4H0EA 3RDIA 2EK5A 2M45A 2P4WA 2Q8KA 1KGSA 3PZCA 3P9IA 1SFXA 1Y0UA 4RMFA 2F2EA 5EEGA 5LJ5g 4U0VA 4M7DA 3FXQA 3DPTA 1U5TC 4PJOE 3E5XA 1B8AA 4GYGA 3QTCA 3NEUA 1SETA 1RUNA 1P92A 1YS7A 4PJOA 1NYRA 3VQXA 2QUFA 3GFLA 2DXUA 2HDCA 4EGZA 1EOVA 2CSOA 2IRFG 3Q9VA 2Y0MA 3V7SA 2QQAA 1FP2A 5D4SA 2HFHA 4G6DA 4OINF 4J6YA 5HGQA 4OLFA 2ISYA 3R4KA 5GAOl 1CF7A 3DEUA 2VN2A 3LSQA 4GXOA 2HTJA 3SHFA 4F7UG 3K69A 5C51B 3KP5A 3L4GA 4HWSA 2LNBA 1G5IA 3UFGA 1XCBA 1XDSA 1R36A 5D5VB 2QQBA 5DUKA 4L5JA 1BI1A 2UXXA 3LC0A 5K1XA 2HNIA 4H2XA 1L0WA 4LJZF 3C3WA 2FE3A 3PQJA 1FC3A 3SWNB 1LQ1A 3A74A 1LEAA 4M7DF 2DU5A 1KQ8A 3TEHA 4YCUA 1YG2A 2ODRD 4IRGA 3LA7A 3A32A 4U7DA 2JPCA 4WJ3M 2F5EA 2HGCA 3HTUA 2D2WA 2V1DA 5H6RA 4U0YA 4KMFA 2RVCA 4IRIA 4Y15A 4S05A 5CJ9A 3HRKA 3I64A 2DO7A 4KMUX 2LF8A 1RNLA 3RPUA 2Q7GA 1YLFA 2QBYB 2DI3A 4N0AC 2OZUA 4OP0A 1MKMA 3BJAA 4YYEA 3T8RA 2ZT7A 1YIOA 1JRIA 3EQLF 1XSVA 1KYZA 1H4VB 4IPAA 3FHZA 4HF2A 3E6MA 3FM5A 4L9VA 1W7PB 4I0AA 1JJCB 1XMAA 3U2RA 3RTRA 4M78A 2KRFA 2DVEA 5GAN2 1XCVA 4HBLA 1WSUA 1B9MA 4P71C 1FY7A 4ZYHA 5GAOr 1S7AA 3JB9I 5HDNA 2BV6A 4DNCA 1U5TA 4EJTA 1T98A 4M75D 4BWAA 4LB6B 2EFQA 4K88A 4EM2A 1JE8A 1Z05A 2M30A 3QO7A 4M9ZA 4G7OF 1CF7B 2BEOA 3WU1B 4GCVA 4RAYA 2P0LA 2CFXA 4DQ2A 5JVTA 4EMKC 3W3SA 4F7UF 1R5HA 4S04A 2J3LA 3JCMd 4AH6A 2PG4A 1QF6A 1OKRA 2XROA 3HRIA 2NNNA 5GAMf 4P96A 3RI4A 2YHTA 1ASZA 4ZH4F 3SFZA 5LJ5f 1RZ4A 1XD7A 3BP8A 1TLHB 1FT9A 1KQ0A 4FX4A 5GAMg 5ELNA 3BJUA 3GXOA 2QTXA 2C8MA 2ZFWA 1DUXC 1YW9A 5JHUA 2ISZA 1H641 3HRTA 4PGHA 4I01A 1CGPA 1LJOA 3JB9H 2GXBA 2JN0A 2ZR3A 4M77F 4BNCA 4YPFA 2FMLA 1BI0A 2RN7A 1WLEA 4PJOG 4LFUA 2RQPA 1BIAA 2HEOA 3FMSA 4A0ZA 2VC8A 5GAN3 4PNOA 1XGSA 4U7BA 4TWAA 4RGUA 1NJ6A 2A07F 2Z5UA 4I02A 2YR2A 1T2KA 1W66A 4M71A 4A5MA 2DTIA 4P74A 1B70B 2VC0A 4H2SA 3CLOA 2DZ9A 2O0YA 5JI6A 4A5NA 1I1SA 4M7AC 3DP7A 3KLNA 3A7AA 2PFBA 5DCMA 1USTA 1WRJA 3ISPA 3A7RA 3F21A 2Q7EA 1WKMA 5GAOm 2XGXA 2Y48A 4UVAA 3CJNA 4PJOD 2ZTGA 5ICEA 3BPVA 4YRQA 5HS7A 2L02A 5DD8A 2MLKA 4XU0A 3P8YA 4HT9A 3RKXA 4C8QB 3M1EA 4G7HF 5CLSA 1K7AA 1O3TA 2XAGA 1J75A 1S29A 4IJAA 2ZR2A 3JB9G 3BY6A 3L2CA 3F8BA 3LSTA 1M5Q1 1UB9A 3QP6A 2WTEA 1FBQA 1C0WA 2AKWB 2EJRA 5D5UB 4IVNA 2RHSA 1F4KA 3WG9A 4KA4A 2VODA 3HY0A 1W5SA 1IN6A 1T6SA 4P73C 3T5XA 3U9GA 1H0MA 4WCGA 1NHAA 4L9TA 3P7NA 4C92C 2VT3A 2VC1A 1R00A 3MAJA 1G4DA 2XRNA 2ZMEB 4KIGA 3REOA 5JFRA 3O6BB 4WK8F 1B34A 5BS6A 1IRGA 1HSTA 1FBUA 4J15A 2AXLA 3N4MA 2ZXJA 4H2UA 4EJOA 1LOJA 4V2SA 3ELKA 4EJUA 4XTUA 3NETA 3NELA 5HDGA 3RL6A 1PDNC 4LK1F 4KQEA 1TQPA 2VXEA 4RQEA 1QE0A 2XTIA 2QENA 3PGGA 3V7RA 1SMTA 4RAZA 4NL2A 3FM3A 3IKTA 5D8LB 4A0XA 4HLYA 1SRYA 4C8QE 3C1DA 6PAXA 2XASA 2UWMA 2E64A 2EL9A 4EGYA 2ADUA 3TO9A 2VBYA 2DJZA 2EJGA 5FO5A 4RB2C 1Z7UA 2RM4A 4Y17A 1BM9A 4CO8A 5CVJA 3MZYA 5L3BA 3L2ZA 4YRFA 3LQQA 3GW2A 5GANe 1U6GA 3E6BA 3WTTC 2Z9OA 1T39A 3KEOA 2G7HA 4BHBA 2HYGD 2Y90A 4JUVA 4C92A 4ENKA 4UUVA 4M75G 1QGPA 1QZZA 1ZYRF 4CYDA 2V79A 4Z2YA 1QBJA 2NAZA 3J80Z 1IAWA 1KMMA 4YG2F 5HVQC 1OPCA 5DUIA 1XGMA 2DFIA 4ENMA 1NJ8A 4QVCA 4YRGA 1HTTA 1J7KA 2CG4A 1B59A 2PLYA 2Z99A 1W4MA 4U88A 5K1PA 2PMUA 3WTZA 1G3WA 3T0YA 2K27A 2IP2A 4ESJA 2X0LA 3IL2A 2H94A 4B09A 2D1HA 5GAOp 1Q1HA 2XAHA 1USYC 4HWRA 3MEYA 4ZIBA 5DEQA 1NJ2A 4EMSA 4X9DA 1A04A 3RKYA 4PJOB 5HS8A 4ZTUB 1BOAA 4TV7A 2FRHA 1LEBA 5GANf 3V8LA 2FQ3A 1P4WA 2V1XA 1WQWA 2FBIA 3G3ZA 3I71A 2EJFA 2HQNA 1WNLA 2F5FA 4R1HA 4RGRA 3R61A 2E10A 2P5IA 4M77A 4LK0F 4QLCU 3GFJA 2JZYA 2Q0OA 3Q9SA 4AVPA 3HSBA 3UH0A 4CH3A 1FSEA 1ZH5A 4J6WA 2MH2A 1EIYB 2M8EA 2ZZGA 1FYKA 2W84A 2LF7A 1O3SA 4BHPA 1YW8A 4C92E 2A68F 5GANj 4H2WA 2FU4A 3VQWA 5BPDA 3LWFA 3HFOA 4H2XB 3WTWC 1IXCA 4PG3A 3CUQC 5LHHA 1V3FA 1GHCA 4YDQA 2ZT8A 2QHUA 1XMKA 5E17F 1AOYA 3R60A 1XB4A 4EO4A 1LNXA 5D5XB 2CW0F 3WQZA 3RACA 2L4AA 4AD9A 1BBUA 4XBFA 2M5WA 4M6XA 5HLGA 3HXVA 2FA5A 3JCMf 3L7WA 1RUOA 2K4JA 3ERED 1FLIA 1I8FA 3E9HA 3IHUA 1BBYA 1N9WA 4TVAA 3ZN0A 3I53A 1IZ1A 2JTVA 4G85A 4XSZF 2CQKA 2OAZA 3MWMA 4HYEA 3S2WA 4HF1A 2GIVA 3HFNA 4CGZA 4Y91A 4C8QC 4YFNF 1YFRA 3QO5A 4KICA 4P72A 3KP6A 5FFXA 3HRUA 2YX4A 5AIPA 1F9NA 2JPBA 1G6NA 1U5TB 4ZZDA 2FYKA 3FF5A 3DKWA 4Y13A 1W7PA 4FHTA 5GMKh 4JQFA 3SXYA 3HXYA 3HTZA 2KIMA 3C18A 5HLHA 3IC7A 1ON1A 2D1VA 3KZZA 1JJCA 2L01A 1KU7A 5GMKj 5BOXA 1ZLJA 5ILSA 5DY9A 3JCMg 5DDGA 2VE8A 4F7ZA 2A61A 5LHIA 5E1ZB 2QBYA 1QZYA 4MMKA 1WYDA 1O3RA 2ZMEA 5LJ3g 3VQVA 3E9IA 4UVBA 4N0BA 4G8XA 2ZNJA 2IY5A 4KN4X 5LEKA 1HW5A 4X5OA 1WPYA 2ZCWA 4YIFA 4MNUA 4CHUA 1SMYF 2VXFA 3HHHA 2PMHA 2CGHA 3HFZA 2EFNA 3QPHA 5ED4A 1SD7A 1ZHFA 3HSFA 2J3MA 4MGRA 1R1TA 3REXA 2R7DA 2P6SA 3TEHB 3LQRA 1ZG1A 4MQVA 4YRMA 3P9CA 3WGIA 2DU7A 4YRSA 5E8IA 2IJLA 2RNJA 5GAN6 3DQVC 1LYLA 3JCMc 3KE2A 4XSXF 2MA3A 4RGSA 1OYIA 1ZREA 1U8RA 1GXPA 4YCWA 1U78A 2CIMA 4LNSA 1SFUA 1S8NA 1X01A 2J5PA 4IHSA 4Q15A 2DW4A 4TQFA 4A54A 3WGGA 5LEJA 5GAN4 3GLXA 2P8TA 3I4PA 1VTNC 2QVOA 2ZT5A 4XTZA 4FX0A 1YTYA 2RHSB 4NCXA 3TEGA 1E1OA 4UHTA 3IG2A 1JBMA 2H6CA 1K6OA 2O3FA 3KP2A 3CO6C 2W57A 3K1MA 2YX7A 1G3SA 3DPLC 2MH9A 3KP3A 4HF0A 1HW1A 2A5YB 3HYIA 4M78E 4ENNA 1U2WA 4C92G 3QP5A 3JB9F 1QNTA 5ERIA 5IT9Z 2I4NA 1EH6A 4JK1X 1P6RA 2G7UA 1B76A 3ZMDA 3A7UA 3IWZA 1NYQA 3H92A 4CXFA 1IUYA 5J8CA 4M78B 3VU3C 1R1VA 2ALYA 1TQMA 2KIUA 2CJ9A 2MLGA 2FXAA 2XKPA 4JRKA 2P5LC 3BW1A 3JCMJ 4TVAB 1ATIA 1IW7F 1LDJA 4BH9A 2VOOA 4CS4A 1KOGA 2J5OA 2OA4A 3TO7A 2RHQB 2QHTA 1G51A 2MD5A 5E1XA 4LLNA 4M7AF 5E3IA 1JGSA 1B34B 4Q4ZF 3A5YA 1ZARA 1ZG5A 5ELOA 4H02A 4P9UA 4HOBA 4EMGA 3L4GB 1G3TA 1EVLA 1WI9A 2FMYA 2P5KA 4ON0A 2OD5A 5CYVA 1ZAOA 1AWCA 3HXUA 3GO5A 1FYMA 3T1BA 1SD5A 5HLIA 4D0PA 1IRFA 4C8QF 3IRRA 2QWWA 1PP7U 2PEXA 2L54A 4L5IA 3RPQA 1N9RA 5LJ3h 2O03A 1TW3A 2DU9A 1F1ZA 5IT9K 1OYWA 3EYIA 2Z3YA 1MGTA 1J9IA 3M7GA 4M9XA 2E7WA 4YCVA 5H20A 3TKYA 4I7HA 4IF4A 2FEZA 4HVCA 2ZNZA 2K4BA 2VT2A 3HTSB 1IN7A 3B73A 1X56A 2GQQA 2AMCB 3ICAA 4C92F 3LSSA 5BMZA 1UFMA 4HX4A 1FBSA 3K9TA 4EJWA 4P3NA 3DV8A 3JCMX 4ZZLA 3P8VA 4LG0A 4LMYA 4HWPA 2BGCA 2Y75A 3HUGA 4YP0A 2ESNA 4KNYA 2I4LA 3RERA 5L3FA 4ZYEA 2RDPA 1S7OA 1EH8A 2KJBA 3SQNA 3WTYC 4QVDA 1TW2A 3E6DA 3OV8A 2VBZA 1K78B 3PFIA 3ZMVA 4N9IA 3IKVA 2STTA 5GAMj 1FP1D 4HWOA 1HQCA 4M72A 3VFZA 1O7LA 1E17A 3TDZC 1MJ9A 3JCMP 5K5OA 4HQMA 2LSOA 4M78C 3BZ6A 5D5WB 2IA0A 5GAMh 4YRPA 3M4PA 4TTVA 3K0LA 1HKQA 4XLPF 2DKGA 4M77B 2XAFA 1IXRC 2ETHA 1X3UA 4KIFA 3J7AO 2EAYA 2STWA 4IRHA 2ZT6A 5LGTA 1FNNA 2HQRA 3CUQB 4N0AA 3QRFF 1J5WA 2W25A 2DTHA 2ZJ2A 3MZHA 1WQ7A 4M7AD 4QWQA 2I2LA 4KDPA 2A3SA 2MBFA 3HFVA 1GVJA 1H9TA 3GFIA 2GXGA 4RS8A 4TQDA 4PDKA 4CDGA 3F6VA 2ALYB 5LBQA 3IKMB 1H4QA 3IALA 3KETA 5L3GA 4RB3C 3KFUA 4G9YA 3ZMTA 4P72C 2Q7HA 1X2HA 3RESA 4C8QA 4JRIA 3NENA 3F8MA 2PMFA 2XHKA 3CUOA 3GZ6A 3TOBA 1WU7A 5GMKe 3MQ0A 1BI3A 1NNHA 4A6EA 5KNNA 2KIFA 3IWFA 2GA2A 4AIHA 4Q48A 5E20A 4O6JA 2EFWA 3I7FA 3SWNC 2W24A 2HZTA 2OQRA 4M7AA 2TDXA 3ML6A 5ICFA 4K86A 2DQRA 4OIQF 3KEQA 4AWXB 4J5YA 5AONA 5GAMd 3CUQA 4R8HA 2R3SA 3VOEA 5LGUA 4F7UE 1C0AA 2DK5A 1S6LA 3RYPA 2UXNA 1T38A 4K87A 1J0RA 4DPGA 3BOQA 1Z7MA 3LAJA 3GUDA 4WX9A 1KQ1A 4A6DA 3O2PE 2G9WA 4A53A 1YQAA 4M7DC 3SZTA 3EETA 5CVVA 5D8KB 1R22A 4MTEA 1BIBA 4KUMA 1ONVA 2R7FA 5IT3A 4P3PA 2YLBA 2FOKA 1YS6A 1X54A 2E7XA 5L3CA 1HW2A 4CH6A 1XGOA 3ECOA 1I27A 3FX3A 1XDUA 1Z6RA 4UVCA 3BFMA 3KP4A 2DAOA 4P55A 2VOPA 2GWRA 3MEXA 1BJAA 3GWZA 4G6QA 3SZPA 3O3KA 3JCMW 2E1HA 5CAIA 4O3MA 4I0BA 1LDDA 4KIBA 3RYRA 1BN5A 2F5CA 2HTSA 5GMKl 3KLOA 2ZKZA 5HOOA 1TTYA 4L0YB 2CWEA 2H6BA 4HZFA 4WI1A 1KYWA 4H2TA 3HSRA 1HKSA 4RDXA 2ARUA 1D3YA 3W6JB 4G84A 2O8XA 4UNOA 4YFXF 4F7UA 2GZWA 4C8QD 1V4RA 3M8EA 5KVRA 4BXUA 4XLNF 3QUIA 1XGNA 5FFZA 4MQ9F 1E1TA 2E1NA 3P9KA 4N9HA 3HY1A 4HV5A 4HV6A 1JHHA 2O61A 2ELHA 3GVAA 2PBIA 2CJAA 4HX7A 5DV5A 4EV0A 2WWYA 3RIRA 5D4RA 2XAJA 3CDHA 3B02A 3C7JA 3HHGA 2OZ6A 4MTDA 1MZBA 2ARTA 2ACJA 4LGWA 4M74A 4WXHA 1LNWA 3F22A 1GXQA 3WTSC 4J6XA 5A2QK 4BW9A 2RGVA 4H2YA 1ULYA 3NQOA 3EFSA 2ZCEA 2ODRC 3FWEA 3R0AA 3JSOA 1IF1A 4XTWA 3EYYA 1KQ9A 3JB9D 4M6YA 1YW7A 1LJ9A 1ON2A 1HSJA 2QYOA 4NHJA 4XEOA 3H3ZA 1E22A 5ICCA 1WWXA 2CGPA 4HT8A 3ABUA 3BDUA 4EMKB 4YREA 5CVUA 3WE3A 4HQEA 2CJBA 1YFSA 3KZYA 1FX7A 2B0LA 5F64A 4EVIA 5LRRA 2C6YA 5E18F 3J81Z 4EMKA 4YROA 2I4OA 2EB7A 2IPQX 3PCOA 2ZINA 2HWVA 4M7AG 1W5TA 2HKXA 2E3CA 4E70A 1XSDA 3E6CC 2DTOA 3JCMV 4E51A 5TJJA 4UXNA 5H6QA 4EX5A 5FLXZ 2DQ0A 1IN4A 1ZGJA 1KU9A 4EM0B 2BYVE 2OU2A 5LHGA 1O57A 2A6HF 4P73A 5DCFA 3A5ZA 1Z6TA 3DSQA 3AAFA 1BC8C 4PZJA 3BWGA 3MFKA 2AMCA 4XRFA 3CTAA 3WU0A 2ESHA 3TDUC 3QO8A 2XGTA 1HBXG 1ZGAA 3T8TA 1IN5A 4K2EA 1ASYA 3JCMb 3BJ6A 5GAN7 3KCCA 3WTUC 3U1DA 5GMKi 1EVKA 3F3XA 4HDVA 3L9FA 2QM3A 3COAC 3EUHA 3K1NA 5GANd 1X55A 4CICA 2QZ8A 4CS2A 2K86A 3TGNA 4BHCA 2COMA 4M75B 3CO7C 2M87A 3QNEA 1D3BA 3F8NA 1IXSB 4BYYA 4P75C 1EFWA 1MDMB 5LJ3j 2Q5HA 4M7DG 4C92B 4BQAA 4JBAA 5FLXK 4P3OA 3ULQB 1B1BA 1P2FA 3J80K 3I5UA 1TNTA 4NQWA 1D8KA 1SD4A 4O5VA 2XV4S 4ENJA 1D8JA 3DFGA 2RHQA 3BPXA 3HRMA 1MD0A 3OOPA 3K2ZA 3V4GA 1EV7A 2RKHA 1QQIA 5GAOq 3JCMh 5LJ5e 2OBPA 4WXDA 2PI0A 4HDUA 1IL2A 4M73A 3IKLA 4LLGF 1T0FA 2EA4A 4M7DD 2OQGA 1I5LA 4WXCA 5ICGA 5F6FA 1QO0D 4YRJA 2DPDA 3QHSA 3HIFA 3M4QA 3IRQA 5LGNA 4AIKA 2ZGWA 1ZRDA 5I21A 4ESBA 4U0WA 2ZIOA 1R5GA 2M1BA 4OU0A 3G73A 3LA2A 5KK1A 3RGLA 3QU6A 4C8QG 3LAPA 4L9JA 3QU3A 2P7CB 1XSXA 2IY5B 3ZPLA 3ZMUA 1Y96A 1DPRA 3HXWA 4B8XA 3UGTA 2RC4A 5AIQA 1D3BB 3SB2A 4M7DE 4UP7A 4RCBA 4M77D 2EWNA 4M75E 3JTGA 4CH5A 2VONA 2WC2A 4ASNA 2PN6A 4P5OA 2VBWA 4KR3A 4HAMA 4HWTA 1ZN2A 1OYYA 5LJ3e 3VEPA 5GANg 5GAN5 3HOTA 2EFPA 1H4SA 2QLZA 3I59B 1PUEE 3D0SA 4M9SA 3F72A 4YFKF 1STZA 2Q2EA 3MCZA 5EEHA 3GIBA 1U1SA 4M7DB 3KP7A 2ZNIA 2H09A 1B70A 3V8JA 4MEXF 2E41A 2RB6A 2FB7A 1U3EM 1G3YA 3EDPA 2ZO4A 1GGMA 4UPAA 4PGGA 3MF2A 2LDUA 2XIGA 3F23A 1B6AA 1EIYA 3V8KA 1SFEA 3N97A 4F7UB 2P6TA 3EFRA 2V9VA 1E24A 4YRRA 4O2DA 1EQRA 4L18B 3GYHX 4KT5C 1R7JA 4PJOF 4JLIA 3UGQA 1G5HA 4WJ4A 1BBWA 1EH7A 11ASA 5A2QZ 3JB9J 4H2VA 1I81A 4KR2A 1NJ5A 3GEZA 4R79A 1O7FA 1I5ZA 2HYFA 1TH7A 3JTHA 4UP9A 1SESA 3LFKA 4YRCA 5LLQA 5ILUA 4I98B 3PCOB 1UCRA 2FNAA 1KU3A 5FD6A 5ILVA 2DTRA 2HR3A 3ABTA 3L00A 3KFWX 1J2XA 1XN7A 5FD5A 5GAMe 4M77C 1FYFA 5D6FA 1KU2A 1YGBA 1MGQA 2ARSA 5GAN8 3GFMA 2VBXA 1QPMA 3GF2A 3E5QA 3HXXA 1Z1DA 5LJ3d 4ZYDA 1YFTA 1TNSA 3J81K 2DEQA 2WV0A 4YRLA 4XU2A 3E5UA 1Z7NA 1R1UA 4L0ZB 1FPQA 3AHUA 2NNYA 3QSUA 4P71A 1USYA 5E1WA 2A69F 3WE2A 4A12A 3A31A 2V6CA 3QPTA 3ZQ7A 5J6XA 4MHGA 4C92D 5CVRA 3NEMA 2DBBA 3BJOA 1RI7A 3I0TA 4EJVA 3LA3A 2VXZA 2HKOA 3VBBA 3DXJF 1ZRCA 2DXTA 4XTXA 2IT0A 1UHWA 3SWNA 5JR3A 1L0OC 4LD5A 3HOSA 1M8VA 3FIFA 4M77G 1BC7C 1JXSA 1OR7A 3ERRA 3FXUA 1HC7A 2I4MA 1KA8A 2PQ8A 5GAOn 2Q5IA 2RA2A 3TOAA 4OIPF 1S3JA 4G94A 2FBKA 1ADJA 5FGMA 3JCMQ 3BY7A 1H4TA 4RB1A 4WF2A 1FSHA 1PYSA 3WTVC 2YPRA 4NB5A 4PCQA 1SERA 2EA2A 5HS9A 4L87A 2XUBA 4RB0A 1TQIA 5BQTA 3MF1A 1IN8A 2EV5A 1RIQA 1H9GA 1B9NA 2IA2A 3TQNA 5C52B 1P4AA 3BROA 2NS0A 3JAMK 4LLLA 3F6OA 1B4AA 3RJPA 4Q6GA 3HXZA 1LB2A 4XTYA 4TVYA 5J8FA 3VODA 2QQ9A 2EV0A 5D6EA 1FYLA 1ZRFA 3I58A 4GYIA 3WTXC 4NL3A 2GAUA 2ZZEA 2KKOA 1F5TA 4AIJA 2JSCA 5E8GA 4NOYA 2ZXFA 2HOEA 3DF8A 2V1UA 3D5LA 5LRSA 1SAXA 1E2XA 1FOKA 2PMEA 1MJAA 3L09A 1USSA 5TRDA 1O3QA 4M77E 2FF4A 4UV8A 1DDNA 1YB3A 1DP7P 4KYWA 2YU3A 4HLXA 1Z9CA 4GGGA 4FT8A 4ETSA 4M78D 4RQFA 3R6SA 2E65A 1FWZA 1R23A 4IXAA 2Z33A 2AS5F 2X4HA 4I2OA 4ZYGA 4MEYF 3WGHA 5K5QA 4A2UA 4PJOC 4WWCA 5F1RA 2LKPA 2VE9A 1MDMA 4XU3A 4MMLA 3QO3A 4PHCA 2JT1A 3F8FA 2DT5A 3RF1A 4OIOF 3I54A 1SD6A 5DCMB 4CS3A 5C53B 3VQYA 4GO1A 2YSRA 2DPUA 5LJ3f 3GZ5A 1J5YA 1Y96B 2DDZA 2H27A 3FZVA 2UZKA 5BPIA 1HKTA 1W7PD 5DYMA 4M75C 2CO5A 3QAHA 4OOIA 1NJ1A 4P9FA 5L3EA 4HA8A 3RKWA 3JW4A 5GMKm 2P7VB 3RUXA 2RV8A 3GX4X 1MJBA 2KJCA 3FMQA 5LJ5j 1ADYA 4ZTZB 2FBHA 3HFZB 5GANh 3CMQA 2F5DA 1DPUA 3M4GA 3Q5FA 1ZLKA 4LB5A 4CZZA 2E5AA 4BAYA 4HW0A 1TBXA 2YLCA 1LVAA 1HK9A 1REPC 1FZPB 4L9NA 1YCYA 5L3DA 2HS5A 12ASA 4HX8A 1I1GA 5K5RA 5LJ5d 1K79A 2DQLA 4M78G
chains in the Genus database with same CATH superfamily
3CCSQ 2F1LA 1Y57A 3TBIA 2EQMA 2MD0A 1DQUA 2Y31A 3PSFA 4LITA 3ZP5A 1S1NA 4P75A 4M3FA 4KUDK 2XKOA 3A0HC 4XRSA 1KMNA 4BY7J 1ZBXA 3GTOJ 3BDDA 4FU6A 4B6MA 4BGDA 2EV6A 4ZDLA 2DZCA 2NUZA 2Y2ZA 4M7AB 1QCFA 2JT4A 1U3OA 4RCCA 2FSWA 4J01A 4C9YA 3MKZA 2VJIA 4IHTA 2W10A 1R58A 2XPWA 3ZMZA 4KITB 5FRNA 1P4XA 1IXDA 1ODDA 2DK8A 4P71A 1PYSB 1Z91A 1E6GA 2XU8A 3HTRA 1JHFA 4HCZA 2JTEA 4J7FA 4YRKA 2K7AA 1GBQA 4B43A 5FWBA 3I9V2 2RQUA 3JCMe 2Z2SB 3OS2A 2VPRA 1W0UA 2O6GE 2L7FP 1JGGA 4M75A 3PQKA 3JRFA 2HQEA 4BQNA 1XTAA 3INZA 5K1YA 2L9RA 2EFIA 4QT7A 1SVOA 2KIQA 3HRSA 4PUSA 4ESFA 4FIBA 4OF1A 3IUOA 1AZEA 4XL9A 4RGXA 1XG1A 1BI2A 2XVCA 3M9AA 2E1CA 1JXMA 2BZYA 2XIDA 5JLWA 2FEIA 1YIJA 1B7YB 4CH4A 3LSJA 2DBMA 4I09A 2JM8A 3L1AA 4RAGA 3OD1A 1TUGB 2K7LA 5CQXA 3TO6A 3FJPA 3K1PA 3BG6A 1AWJA 1PSEA 4QW2A 3W2AA 2EJ9A 3BT9A 1X4OA 4KN7X 4G7ZF 4NUBA 1MMNA 1SRLA 5LFAA 4UV9A 1YI2Q 4JYKA 2K57A 3JRZA 4Q5SF 1P7IA 1KZHA 2QSFX 1EA3A 2LP5A 4BEHB 2XK0A 3P8TA 1VQZA 1NG2A 3ZL7C 2IVMA 3PCOA 4TVWA 4Z02A 4LG0B 2FNPA 2F48A 4OMZA 4Q47A 4HG2A 4IURA 3FXRA 4EM1A 3R6OA 2DLLA 1NJIU 2L4MA 5FB2A 1D1BA 2CW8A 4XONA 2ATCB 3C12A 1S72A 2ZZFA 4YRNA 4E4HA 3TUPA 3I55A 3DEEA 2LCCA 4YRIA 4IUUA 1YYVA 2RD1A 1I6XA 4D7NA 3P8DA 3CC7I 2LX7A 3V7CA 3CC4I 1YFNA 3HBLA 3QG1A 4LDYA 4CCJA 4XEMA 2E36A 1M2OA 1JKOC 1OQYA 3QYBA 2AKWA 5KCMA 1JT0A 1T3SA 3EGXB 2QHSA 3NTHA 4YIIA 5CQYA 1JKPC 5FLVA 3CF2A 1QU3A 1RIOH 4XU1A 3CCLA 3F8CA 2YRDA 4DGWB 3ROUA 5B1BH 2ZBKA 5IP6A 3GNGA 3CMYA 5J1RA 3KYLA 2TCTA 3HB9A 5LJ5h 5EG0A 1S72Q 5F5WA 2FZGB 2IW5A 1TZLA 3ECHA 2G4CA 2K02A 3S16J 1D1CA 4B44A 5DS9A 2D45A 5J39A 5KYWA 3KXTA 1D0XA 4XOTA 2QF7A 3E97A 3ZQQA 4RG8A 5I2MA 1MMGA 2EINH 3VRYA 3J7AY 1M1KC 4X1EA 1B7YA 3CC2Q 2E60A 2DXCA 1X2GA 2L3DA 1N9SA 1UHMA 3BR3A 3JSPA 3QJ6A 1HXDA 2Y9ZA 5F08A 2ZSHB 5KNLA 3A8HB 3G1ZA 2DQ3A 4YRTA 1UHFA 2HU9A 2GA1A 2DETA 3WODF 1K4SA 1ZG3A 2DMQA 4BJ6C 2O2OA 1MNDA 3HSEA 3M0PA 2PJPA 2P5VA 5M5YJ 1D5VA 4XQ3A 4OIRF 5HK0A 1KQ2A 1MNMC 2BE9B 4S0HB 2FZCB 2FJ1A 4XTVA 2EFOA 2A6EF 1LDKB 2KXDA 3FMRA 2E4HA 2XGDA 3A01A 2C7IA 1I0CA 1JU5C 1RI0A 4M7AE 1POGA 3W6KB 2QHVA 5D6WA 4JJNK 2BZ8A 3QOPA 1SHGA 2VGMA 2VUBA 2DVJA 3E3VA 3VB2A 3CCMQ 2EZLA 2J05A 5AYFA 2IA1A 3M8FA 1K78A 4M78F 4QQGA 3ABLH 3TEDA 1QVFP 2M7BA 5HNHA 3GTGJ 1WQ2A 2JRTA 3ZN1A 2X1DA 5J4VA 3R07A 3NRVA 1I4K1 4N4NB 4P74C 5DD4A 3REUA 5GTHC 3KBGA 2JUCA 4KFCA 3NTKA 2HYJA 3H3UA 3VS3A 1ORKA 3NFCA 5DTDA 2ZJRF 4PSXA 4E7SA 2ZNYA 4NQWB 3QJYA 3H9QA 3ZMSA 2NRAC 3FB9A 3HG9A 2BBYA 4KISA 3VSKA 2E1MC 1OPKA 3ER0A 2C0TA 3EHQA 4MZMA 2W85A 3I59A 2R0QC 3DLLA 5HDKA 3OL4A 1U0JA 3DBLB 3L2UA 1PP8F 4OMYA 2BE5F 1YFHA 1PKTA 1BK2A 3JAMZ 3MEAA 2XAQA 1OMIA 3BC8A 1U1TA 1FTTA 2MC3A 3R0JA 1VQMT 3FIWA 4CCLA 4X9CA 4ZN3A 4CC3A 2EQJA 2BVMA 4UP8A 3A4CA 2CP7A 2F2XA 2CYYA 4EMHA 1Z0XA 2QA4Q 1J59A 1MV3A 2NUPB 4F16A 5FKMA 2NYXA 1IRZA 2DNUA 2J6FA 3NAUA 4A0YA 2EQIA 4P1WA 3HGYA 4EQQA 3OYDA 1YO5C 2A05A 2ZIMA 2VQHA 4FE7A 5CVIA 4M75F 3G71A 2ED1A 1L3LA 3SHWA 2LFBA 4H0EA 3RDIA 1RAAB 4HKEA 1UZCA 3A02A 2CDTA 2EK5A 2M45A 2P4WA 4KH1B 4OMMA 3LSRA 2JM9A 2LYCA 2Q8KA 1KGSA 3OYMA 3RZDJ 2B9SA 3PZCA 2MF2A 3P9IA 2QGGA 1SFXA 1Y0UA 2OTLI 4MZPA 4AG2C 1M3CA 2OTJA 2DPPB 3CCMI 3PE0A 1QLYA 1K9MU 4RMFA 1Z9QA 2F2EA 3LMMA 5EEGA 3RCOA 4U0VA 4A69C 5LJ5g 3S1MJ 1FOWA 4M7DA 2JW4A 3FXQA 3DPTA 5C3EJ 1K9MR 1U5TC 1FIPA 4PJOE 1IUFA 3E5XA 3W2WA 1B8AA 4GYGA 3QTCA 3NEUA 3ESWB 4XORA 2Y4YA 3MCAB 3DBRB 1SETA 2XF5A 3ABMH 3JREA 3MZ8A 4BI3A 1QA6A 1RUNA 2VJJA 3M07A 1P92A 3CC7Q 3UA6A 1YS7A 4PJOA 2LH9A 1OX9A 1NYRA 3VQXA 3CD6I 2QUFA 3GFLA 2DXUA 2HDCA 4EGZA 1EOVA 2EYYA 5IAYA 1P9QC 3QYHB 1Y6IA 2CSOA 4JRQA 4ZTZB 4BDZA 2IRFG 2ZXIA 2Y0MA 3Q9VA 3V7SA 3J7YJ 2QQAA 1FP2A 5D4SA 2HFHA 4G6DA 4OINF 3IH4A 1RL2A 4C5EA 2ZAEA 4J6YA 2OTLT 4OLFA 1ZK8A 2M9HA 3K7AJ 1R49A 1OU8A 1PCXA 5HGQA 3JAME 1UDLA 2ISYA 2MABA 3R4KA 5GAOl 1M30A 1CF7A 3PUFA 2PNIA 4BUPA 4RMOA 3DEUA 2QA4I 2VN2A 1SEMA 1S72I 3VS6A 2CUFA 3LSQA 4GXOA 2HTJA 3H9NA 3KYCB 1GV2A 3SHFA 4J9IA 4F7UG 4ZGEB 3K69A 1KD1R 1WYXA 3CC2A 5C51B 2MMPA 3KP5A 1ZSGA 3L4GA 1U9OA 3QQAA 4HWSA 4BY6C 2LNBA 1X6GA 2HMAA 1G5IA 1A6IA 3OYJA 3UFGA 1M90U 3A8GB 1XCBA 3PO2J 1XDSA 1R36A 3QPLA 5D5VB 1M1KU 2JSPA 2QQBA 1X58A 4L5JA 5DUKA 1BI1A 1IV8A 2KT0A 2UXXA 3SJMA 1VA7A 2COZA 2HNIA 3LC0A 3HOWJ 4H2XA 4LJZF 1L0WA 3HDDA 4PKCC 3C3WA 4KGZB 2FE3A 2DA5A 4NC8A 2UV1A 1BW5A 3PQJA 2LVMA 1OX8A 1QMCA 1FC3A 4N4HA 3SWNB 1LQ1A 3A74A 1LFPA 1LEAA 2X4JA 4M7DF 3JRDA 4BQQA 5CKHA 2DU5A 1KQ8A 3TEHA 4YCUA 1GFCA 1YG2A 2WAQA 2ODRD 4IRGA 2IIMA 3LA7A 5F04A 3A32A 4U7DA 2JPCA 1NYFA 2F5EA 1MHNA 2MOXA 4WJ3M 2HGCA 3HTUA 3FDRA 2D2WA 2V1DA 4LG3A 5H6RA 3JRCA 3VS7A 4U0YA 4KMFA 2RVCA 4IRIA 4Y15A 2DT6A 4S05A 5CJ9A 2EGCA 1GXIE 3HRKA 2XDDA 3I64A 1VQPI 2DO7A 1Y39A 2NVTJ 2VQCA 2VJ4A 4A3CJ 4KMUX 3V42A 1ABOA 4J9BA 2KEAA 4MDXA 2F6CA 2RPNA 3W3CA 1JQQA 2LF8A 5F0FA 4UB6C 2A7YA 4FYWB 3PIOF 1RNLA 3RPUA 5I11A 2Q7GA 1YLFA 3BZKA 2V4JC 1ZA1B 1FMVA 5IOZA 2ECZA 1Q82C 2DD5A 3FBIB 4ZTJA 3QDFA 2QBYB 1RLQC 2CKKA 4EPCA 3QWXX 2DI3A 4N0AC 5CKBA 1R77A 1KD1C 1B3QA 4V2GA 3UA7A 2AHQA 2OZUA 1YJWQ 4RTZA 2R93J 1GVDA 4OP0A 1MKMA 2IAIA 1PD0A 4Y4RA 2O7OA 1V1CA 2FZKB 3L42A 3BJAA 4YYEA 3T8RA 4Y28E 2ZT7A 1YIOA 1JRIA 3EQLF 3B6AA 1MW7A 4AIDA 4BE2A 3MKYB 1RR7A 1XSVA 4RTXA 3OMCA 1KYZA 1H4VB 4IPAA 3FHZA 4HF2A 2YSQA 3QZ5B 3E6MA 1X69A 1SC7A 1QVTA 3FM5A 4L9VA 4RTWA 1Z67A 2HQAA 1W7PB 4I0AA 1JJCB 3X20B 2KQRA 1XMAA 1VQ9T 2YXYA 3U2RA 5CKDA 4KJZA 3RTRA 1VYVA 2KRFA 2D0QB 2DVEA 4M78A 2QEXA 5GAN2 1XCVA 2VASA 4HBLA 2ZJQF 2FVUA 4IOCF 3CC2T 3NHNA 4M6VA 4I99C 4J9FA 3LSPA 3GOXA 4LVIA 1WSUA 1B9MA 1OYXA 4P71C 1FY7A 1ETVA 4ZYHA 5GAOr 1S7AA 3CMEI 3JB9I 5HDNA 4J9DA 1AOJA 4CRIA 3GTJJ 4DBRA 3MJXA 1VQOQ 4J19A 2BV6A 4DNCA 4Z88A 2AQEA 1U5TA 2E5ZA 4EJTA 1T98A 2PJRA 1TT0A 1PRMC 4M75D 1X19A 4BWAA 4LB6B 5FU6C 2EFQA 3FXLA 1F1BB 4K88A 4EM2A 1VQ8I 1QVGS 5M3MJ 1JE8A 1Z05A 2M30A 1AVZC 3QO7A 4M9ZA 4G7OF 4XK4A 2DMNA 4N4GA 4PLIA 1CF7B 2JJ7A 2BEOA 3L2WA 3WU1B 3IH2A 4GCVA 4RAYA 5HKCA 3OW2P 3AT1B 2P0LA 2CFXA 2X48A 2BTTA 4DQ2A 2YUOA 5JVTA 4EMKC 3W3SA 2VQGA 4F7UF 1R5HA 4ZTFA 1OZ2A 4S04A 2J3LA 1U9NA 2L3PA 1TL8A 3JCMd 2VKNA 3GMEA 4AH6A 2PG4A 1QF6A 4Q5WA 1OKRA 2EVRA 1ZR2A 4QIWN 2XROA 3HRIA 2WY7Q 2JK3A 1QVGA 2NNNA 3FK6A 2L5QA 4BQOA 4RTYA 4OWRB 2BKDN 2DF6A 5GAMf 1M1EB 4P96A 3RI4A 2YHTA 4AG1C 1BA5A 1ASZA 3I4MJ 4ZH4F 3VUBA 1GRIA 3HUGB 3SDBA 1VQ9Q 2RQQA 4PSWA 3SFZA 4A3GJ 1WJFA 2Y9YA 1P7JA 2V1RA 2ZCFB 1AWOA 5LJ5f 1VQ7I 1RZ4A 1XD7A 4AUXA 5GTIC 3CCSI 3BP8A 1TLHB 1FT9A 1KQ0A 3CJTB 4FX4A 2QA4T 4H4KC 2ZPIB 1M2VB 3DBHB 5GAMg 3S1NJ 1KIKA 3H5NA 3CCUA 5ELNA 3BTCA 2FL7A 3BJUA 1N77A 2A5WA 3FXKA 3Q1JA 3J7AF 3GXOA 2RQTA 2QTXA 2C8MA 1V5FA 2ZFWA 1TWFJ 1DUXC 1YW9A 3EAEA 4B3AA 1M90C 5JHUA 3CCMA 3X28B 1HJDA 2OF7A 2ISZA 2OAWA 3ASKA 2R5YA 2CUJA 3HRTA 1H641 3G6ET 3L2RA 2GXAA 4PGHA 4I01A 2DJQA 2ENMA 1IREB 1N6AA 1CGPA 1LJOA 5EG2A 3I56Q 2LZ6B 2GXBA 3JB9H 2JN0A 2ZR3A 2DJIA 1YJ9Q 3OW2S 4M77F 3EGUA 5IP7J 4BNCA 1UB4A 2AK5A 2RJCA 4YPFA 4F52A 1VQMQ 1YJNQ 2FMLA 1BI0A 1GBRA 1QVUA 2LP0A 4A3MJ 2RN7A 1D0YA 1NEBA 2X9HA 4A3IJ 1WLEA 4PJOG 2LKSA 2BZXA 3AG4H 4LFUA 2ED0A 3IH3A 2O4XA 2RQPA 1VQ8Q 5EC7A 1BIAA 2HEOA 2KBTA 3FMSA 2AZVA 4A0ZA 2VC8A 1K4US 2KE9A 5GAN3 1ZA2B 2DXIA 4PNOA 1XGSA 4U7BA 3AFHA 4TWAA 4RGUA 2MWPA 2XICA 2DDBA 2A07F 1BR4A 2Z5UA 3KIOA 2CZ7B 3GNFB 1NJ6A 4I02A 2VLAA 2YR2A 1T2KA 1W66A 4M71A 4A5MA 2DTIA 4P74A 1B70B 2VC0A 1TS9A 1QZEA 3FDYA 3JCUC 2DYSH 3E2UA 4MO7A 5IXFA 4H2SA 3CLOA 3A0BC 1PJRA 4CSWA 2O0YA 1B72B 5JI6A 4A5NA 1I1SA 2DZ9A 3DP7A 2EYXA 2R57A 3KLNA 3NTIA 1WIEA 4NL2A 3PIPA 4M7AC 1I3AA 3A7AA 3PUBA 2PFBA 5DCMA 1USTA 1YNZA 1WRJA 4JOMA 3CPWS 2P4RA 2BY3A 3ISPA 2JTMA 2DFFA 3F21A 1OEBA 2RHIA 5GAGJ 1WKMA 3A7RA 2Q7EA 2RJEA 2GTOA 5GAOm 2L3RA 1D09B 1K8AC 2XGXA 2HQHA 2CH0A 2Y48A 3QYGB 2JA2A 4I76A 2HL3A 4UVAA 1VQNT 3CJNA 4PJOD 2DJNA 1I5OB 1VYTA 2ZTGA 3M56A 2Z16A 5ICEA 3BPVA 4YRQA 1YJ9I 5HS7A 1K0SA 3OB9A 3TMOA 2L02A 2NOGA 3MKLA 4IIOA 1HA8A 5DD8A 2FQ4A 2MLKA 1YJNI 3H1CA 3META 3QYEA 4XU0A 3G1OA 3E9FA 1VQKI 3P8YA 2V8IA 1E3HA 1YCSB 5EGOB 4HT9A 3RKXA 1PD1A 3M1EA 4G7HF 4C8QB 5CLSA 2K6DA 3G6EQ 2IGNA 1K7AA 1O3TA 4ANJA 2YU9J 2OI3A 1ETYA 2XAGA 1I50J 1J75A 1W4SA 5CIUA 2XDBA 1S29A 4IJAA 1UGPB 2ZR2A 3JB9G 2BW3B 1WI3A 2BOLA 2X9DA 3BY6A 3L2CA 3F8BA 1YI2T 2DMPA 5CR2A 3HC7A 1FMWA 3LSTA 2LT1A 1WGXA 2LMDA 1UB9A 2CS3A 1M5Q1 5EGOA 1C0MA 1N8RU 1VIFA 1BL0A 4R55A 4GRIA 2P81A 2Q2EB 3QP6A 2WTEA 2OTLQ 1FBQA 2L2OA 1C0WA 2LNVA 3C94A 2AKWB 1NH3A 1Q86C 1T0JA 1S72T 2EJRA 1OISA 1PC0A 5D5UB 4IVNA 2RHSA 1F4KA 3WG9A 4KA4A 3EFOB 3OSFA 1RRJA 2P0WA 2VODA 2IS6A 1VQLQ 1VQMI 4RMNA 2LQNA 4XLFA 3ZXSA 1QVGP 3HY0A 2BVLA 4V2FA 1VQ4Q 4RTVA 1W5SA 1IN6A 2E6NA 1VUBA 1T6SA 4P73C 3E0JB 3T5XA 3OQ5A 2OTJI 2ROTA 1BU1A 3FKJA 2E12A 4XLEA 3U9GA 1H0MA 3EGDB 4WCGA 1RADB 1NHAA 4L9TA 3P7NA 4LDXA 4C92C 3CCJA 4A4FA 6AT1B 2R5AA 3MEVA 3RR6A 2HBPA 2VT3A 1SG5A 3TSWA 3VKIA 3A5ZB 2VC1A 2MG4A 1R00A 3MAJA 1FJLA 3CQZJ 3BG9A 1W5CC 2KYMA 2XRNA 3REOA 2ZMEB 4KIGA 5JFRA 1G4DA 3O6BB 2N8GA 4WK8F 1B34A 5BS6A 1UGVA 1WPKA 1HSTA 1IRGA 3HL2A 2EBPA 4F7UE 3OBYA 2WB1A 4JP0A 5LL6S 2MI6A 1FBUA 4J15A 2AXLA 4F93B 2CP2A 2FD5A 5JVGF 2A6TA 3N4MA 3CXCP 2ZXJA 2JA7J 3G71Q 4H2UA 4RTUA 3OWTA 1CQTA 4EJOA 1LOJA 2DL3A 1UGRB 4V2SA 3ELKA 5J40A 2E5QA 2Q1ZB 4EJUA 1G8XA 4C5GA 4XTUA 2X4WA 1QWEA 1T08B 3NETA 3G1MA 3CCVI 4G85A 4XLHA 3M1CA 5HDGA 3NELA 2E19A 2ID3A 3RL6A 1WA7A 2KGTA 2F4IA 4E7LA 3DKXA 1PDNC 4LK1F 3CCQQ 2DBKA 1W70A 1X1PA 1TQPA 3S3OA 4BY1J 2VXEA 3M0TA 1X2KA 4KQEA 3H0HA 3LH0A 4RQEA 4YEJA 2ZSIB 2F2WA 3VS0A 1QE0A 5I22A 4X1VA 2XTIA 2QENA 3I3LA 4CA0A 3PGGA 1ZR4A 1IZ6A 2R7QA 1R4NB 1SMTA 3HXLA 4RAZA 3V7RA 2DXBA 3FM3A 2GQIA 1I39A 2WSCE 3IKTA 4JPBW 1ETQA 2YUNA 3K4CA 5D8LB 4A0XA 4HLYA 1EX4A 2J6KA 3VPRA 2ZXHA 1RI9A 4J9GA 4C8QE 4ZN1A 3C1DA 4XM3A 2JN6A 2C0OA 4F91B 6PAXA 2XASA 1N25A 4IKFA 2UWMA 2E64A 5B3SH 2EL9A 3NWSA 1TOVA 4EGYA 4E6RA 3PTAA 1OULA 2ADUA 3TO9A 2VBYA 1ZQ1A 2IVWA 2DJZA 1Q95G 2RMOA 1SPKA 1HDPA 2EJGA 3DEWA 5FO5A 4RB2C 1Z7UA 3JSCA 2RM4A 4Y17A 1BM9A 4CO8A 4XQFA 2DIGA 1JJ2S 5CVJA 3MZYA 1UG0A 5L3BA 3L2ZA 4YRFA 3LQQA 5CQEA 3GW2A 3U23A 1TUDA 5GANe 1U6GA 2B7EA 3E6BA 3WTTC 2Z9OA 1T39A 5GPCA 4A4EA 3KEOA 3ZQCA 4CC4B 1BR1A 4XIDA 5CKFA 3G6EA 2G7HA 4BHBA 2HYGD 2EYWA 2Y90A 1JJ8C 3CBMA 4ENKA 4UUVA 2JQ7A 4JUVA 4C92A 1YP5A 4BJ5C 4M75G 1QGPA 1QZZA 1ZYRF 4CYDA 2V79A 4Z2YA 1QBJA 1KC8C 2NAZA 3J80Z 3QWLA 1IAWA 1KMMA 3PO3J 4YG2F 4RDUA 1A5JA 2Y0SN 5HVQC 2JOYA 3X2QH 1OPCA 2D9TA 2H8RA 1YWOA 2L7KA 1RAFB 4DOVA 2LMJA 4DOZA 5DUIA 3CDIA 1XGMA 2DFIA 3CJQB 4ENMA 3OSGA 1NJ8A 3CCQI 4QVCA 3VYRB 1IDZA 1J7KA 2YRCA 2JNGA 2CG4A 1YJNT 1MIJA 5KCHA 1HTTA 1XPXA 1B59A 1M90R 2PLYA 2MWOA 2Z99A 1G59A 3A1PA 3OYYA 1W4MA 4U88A 4LN2A 2YDLA 2CSIA 1ZSZA 2KDOA 1NG7A 5K1PA 2PMUA 3WTZA 1G3WA 5CKTA 1Y7XA 3MP8A 2YS9A 1AKHB 3LGLA 3T0YA 2K27A 3M4OJ 2IP2A 2R58A 3H5RA 3LSKA 5DM6F 1X6OA 2DYRH 1OPLA 2EZHA 4ESJA 2M4KA 2LQWA 3VV0A 3HGGA 2X0LA 1KONA 3I55Q 2MGQA 4C2TA 1K0XA 1QVPA 1G5VA 3IL2A 3HOXJ 2JRMA 4BE0A 1VQOI 3D5SC 2H94A 4UB8C 4DJAA 4B09A 2D1HA 2MYSA 5FWCA 3ASNH 2W82A 2CRGA 3PIPF 5GAOp 1Q1HA 2XAHA 2CV0A 4HRIA 4BBRJ 3KFVA 2YUSA 1USYC 4HWRA 5FU6B 2KZGA 3BR2A 3PL8A 3S32A 2AIRB 3MEYA 4ZIBA 5DEQA 1YI2A 4EMSA 4PJJA 1NJ2A 4IEJA 4X9DA 1A04A 3H0GJ 3SFMA 2L2PA 3CPWA 3OYKA 3AL0B 3RKYA 5IYBJ 1J3TA 2WB1N 2UUZA 2CQQA 1I6HJ 3CC7T 5HS8A 4PJOB 4ZTUB 4PFZA 1BOAA 2H1LA 4TV7A 4ELZC 2QEXT 2FRHA 1LEBA 5GANf 2BHYA 1YJNA 3V8LA 1VI0A 2FQ3A 5IXBA 5TGTA 2PTKA 4XAXB 1P4WA 2V1XA 1WQWA 2FBIA 2JMWA 2KMUA 3CMAT 3G3ZA 3I71A 2EJFA 2HQNA 1R9TJ 2F4MB 2W4SA 2F5FA 4R1HA 4RGRA 1WNLA 3MKDA 3R61A 2E10A 3KYDB 4FW1A 2OX7A 2P5IA 4M77A 4LK0F 4QLCU 4CZCA 1APLC 3GFJA 1FXXA 2JZYA 5CCAA 2XAUA 2Q0OA 3Q9SA 4AVPA 2DE0X 2VYTA 5FW9A 3HSBA 3UH0A 5KH6A 4CH3A 3ZQFA 1FSEA 1Q1VA 1PRLC 1ZH5A 2QI2A 3OYNA 4A3LJ 1O75A 2L7MP 4J6WA 3VUZA 5GAEJ 3T9NA 1MBEA 2MH2A 4B48A 3PFYA 2F4OB 1W36D 5HY6A 1MBGA 3THKA 1EIYB 1RAIB 2H3JA 2M8EA 2ZZGA 1FYKA 2W84A 2LF7A 2L9NA 4RLQA 4BHPA 1YW8A 1YIJI 1O3SA 1M3BA 4AFZC 4C92E 3CCVT 2A68F 1NPRA 3MO8A 5FKKA 3TQ7P 5JLXA 1IHWA 5GANj 3ABKH 4H2WA 2FU4A 2AXTC 3VQWA 3LSGA 5BPDA 2KXCA 3E1SA 1UELB 1HOMA 3LWFA 1NM7A 3HFOA 4UP7A 1FTZA 4H2XB 3WTWC 1IXCA 4X34A 3UPUA 3CUQC 5LHHA 4IZZA 1AWWA 4PG3A 2HEQA 1V3FA 2JZ2A 1GHCA 4D1QA 4YDQA 3FISA 3EHRA 3QBYA 2ZT8A 2QHUA 3ZOBA 1XMKA 5E17F 1AOYA 1X27A 3R60A 1XB4A 1VQ7T 3OYHA 4ZYAA 2HOTA 4EO4A 1LNXA 5D5XB 4FW2A 3ONQA 2H3EB 1GLNA 2CW0F 4BDYA 5CQGA 2E70A 1W2BS 4Y52J 3ZFJA 4UPAA 3WQZA 3RACA 2L4AA 1X2NA 4LD9K 5GP9A 3L2QA 2FRWA 4AD9A 1BBUA 4XBFA 2PZ1A 2M5WA 4M6XA 5IOYA 5HLGA 2GNCA 2K5FA 4IL6C 2FA5A 3HXVA 3JCMf 3L7WA 2LTPA 4XLAA 2K4JA 1RUOA 3ERED 4CC2A 1FLIA 3SDGA 1I8FA 3E9HA 3IHUA 4HEA2 1K8AR 1BBYA 1M8MA 2HKQB 2GFUA 3ZN0A 3I53A 1VQPT 4PK4A 3HL8A 1N9WA 2WAEA 4BXFA 2R5ZA 1NZ9A 2CT4A 2K5IA 1IZ1A 2JTVA 2M16A 3MEWA 2QEXQ 3CCYA 4XSZF 2CQKA 2OAZA 4AVZA 3CCVA 1DP3A 2JVVA 3MWMA 4HYEA 3S2WA 4E7KA 4HF1A 3S15J 1EF4A 2KP6A 2GIVA 2QDLA 3HFNA 1WGSA 4CGZA 4Y91A 4C8QC 4YFNF 1YFRA 1YHQQ 1U06A 3QO5A 4KICA 4P72A 1JUMA 2F69A 3BR6A 3KP6A 5FFXA 3HRUA 1OOTA 2FPDA 2V8KA 4RKUE 1D5YA 3GLLA 4MFEA 2GFAA 2CZ6B 2YX4A 5AIPA 1F9NA 2JPBA 2V1QA 1G6NA 1U5TB 2IGMA 4ZZDA 2LTOA 3HEFA 1VQKQ 2CQXA 2M0OA 2WAFA 1XOVA 2G6FX 4XKBA 1IHVA 2FYKA 4OGCA 3FF5A 2LY1A 3DKWA 2HDAA 3NMZC 4LIUA 4Y13A 4JLGA 3I55T 1W7PA 4FHTA 4XMYA 4JQFA 5GMKh 3CPWP 3SXYA 1VZ0A 3HXYA 4J8OA 2KIMA 3HTZA 3C18A 5TISC 4F17A 5HLHA 1VQ6I 3IC7A 1MBFA 1ON1A 2D1VA 3CCRA 3KZZA 3H8ZA 3BG5A 2FOWA 2XPUA 2KL4A 1ZSZC 1JJCA 2V26A 3S3MA 5C44J 2L01A 2J7IA 1KU7A 5GMKj 5BOXA 4HVWA 4C0ZA 1ZLJA 1VQ6Q 1Y56A 5ILSA 1GDTA 5DY9A 3WG7H 1VQOT 3QXEB 3JCMg 1JJ6C 5DDGA 3MKWB 2CP3A 3QIIA 4RM3A 2VE8A 2XMFA 2YT6A 2MCNA 1ZBJA 3LL7A 4F7ZA 3FC3A 1ZTRA 2A61A 2PMZN 5LHIA 5E1ZB 2NXNB 2QBYA 2LCSA 1QZYA 3Q0WA 4D5CA 4MMKA 1WYDA 2CMPA 5A0DA 3P8BB 1O3RA 2V1NA 2ZMEA 5LJ3g 1VYUA 3LNQA 1UE9A 4M7AD 5K7FA 2LBFB 3VQVA 3C2BA 4FT4A 2EW3A 3E9IA 3JV3A 1JKRC 4UVBA 4IHXA 1K9MC 1FOYA 3BLYA 4JZ3A 4N0BA 2VWFA 1ACMB 4G8XA 1EKEA 3P8HA 5IH2A 1KK7A 2QTVA 2ZNJA 5IN1A 5F0CA 1OCRH 1WJQA 4KN4X 2RQVA 5LEKA 1H92A 3GF5A 4J83A 1HW5A 2LOOA 3H9JA 3LFUA 4X5OA 2XGCA 4A93J 1MH3A 1PWTA 3K10A 2VIXA 1JXOA 2QSHX 1WPYA 2CZ1B 2ZCWA 4YIFA 4XK8E 2LRDA 2V7FA 3BQYA 4MNUA 3OYIA 3HPWA 1SMYF 4CHUA 5E3OA 3H6ZA 3W2VA 2VXFA 2DMTA 4II2A 3HHHA 2PMHA 3S17J 2CGHA 2EFNA 3QPHA 3J81E 1VQ9A 3HFZA 2K85A 2LC2A 1SSHA 2HAXA 1F43A 5ED4A 1SHFA 1SD7A 1ZHFA 3HSFA 4A4KA 2OTLA 4MGRA 2J3MA 4D8KA 1R1TA 1WJBA 2R7DA 2P6SA 3CLQA 3REXA 3LWHA 3LQRA 3OIQA 4A3JJ 3TEHB 1ZG1A 4MQVA 4YRMA 2Z1DA 3P9CA 3WGIA 2M0MA 1IJWC 3SEZA 2E2IJ 3PVQA 1VQNQ 4M3GA 3TW7A 5E8IA 2DU7A 4YRSA 2KMTA 2L89A 1OLTA 1ENHA 1TP4A 2IJLA 4NC6A 5H2FC 2K5LA 3F70A 2RNJA 5GAN6 1Y1WJ 3DQVC 3OMYA 3PT9A 1YHQT 1LYLA 3JCMc 4D5FA 3KE2A 4XSXF 2XB5A 3I55I 2MA3A 2LDMA 4P5NA 2CQNA 2RREA 4RGSA 1X1BA 2ESWA 2D6FA 2CJAA 2O9SA 1OYIA 1ZREA 3PFSA 2LD5A 3CC7A 1U8RA 2NS8A 1GXPA 3BCBA 2KYBA 2KRCA 4YCWA 4I6ZA 1U78A 2X4XA 2CIMA 3BG3A 1SFUA 4LNSA 1S8NA 1X01A 2J5PA 4IHSA 4Q15A 1IDYA 2QQ8A 2DW4A 2OC6A 4JJBA 1OFCX 1R71A 1YJWT 4TQFA 4XR6A 2QASA 3M0QA 3HPHA 4B3XA 1WHKA 4MZTA 2KT8A 4LIVA 2RF0A 4ZNXA 4NDLA 3VSLA 3WGGA 5LEJA 4A54A 3GLXA 2P8TA 5GAN4 3I4PA 2ECBA 2I10A 4C5IA 2OTJQ 3QODA 3VYTB 1AWXA 2DA3A 1Z77A 2QVOA 4BJTA 1VTNC 1WZ2A 3X25B 4ZGJB 3DWLE 2ZT5A 1EIFA 1YHQI 2JA8J 4XTZA 4FX0A 1YTYA 1A35A 2RHSB 2EPDA 4LUEA 3X24B 4NCXA 3TEGA 1E1OA 4UHTA 3IG2A 1JBMA 2ZB9A 2H6CA 1K6OA 2O3FA 2HD0A 2L0AA 1MBKA 2E3IA 3S2HJ 3KP2A 3CO6C 2W57A 4OMLA 5AT1B 3VYHB 3K1MA 3CCMT 1WJAA 2YX7A 1G3SA 1RAGB 4D9JA 2IS1A 3DPLC 2K5CA 2MH9A 3H0FA 3KP3A 4HF0A 2DYIA 3FXJA 1I07A 3AG2H 1HW1A 3FBNB 1MH4A 3OA6A 2A5YB 3HKZN 1WJDA 3HYIA 4M78E 5KE2A 1BCMA 3CCLT 3PMIA 2BW3A 1WJ5A 5EEAA 4II3A 4ENNA 1E7OA 1U2WA 1QCOA 4C92G 2QA4A 1WJCA 2LBFA 3QP5A 3ZQLA 3HOUJ 3JB9F 2RHXA 1QNTA 1LPQA 4QPQA 2IXSA 3UWNA 5ERIA 5IT9Z 1DJ7B 2HNHA 2DL7A 1IV6A 4OMFB 2I4NA 3K2AA 1E3PA 5EF6A 1X6BA 1EH6A 4FE4A 4JK1X 1P6RA 1JJ2P 2CU7A 2DA7A 1K9AA 1K73C 2G7UA 2VPLA 4ATOA 1B76A 2DOFA 4M3DA 3ZMDA 2ZMEC 3A7UA 3M53A 3IWZA 1NYQA 4HCKA 3H92A 4KT0E 4CXFA 1IUYA 1QPIA 1N8RR 5M3FJ 5J8CA 4M78B 1F36A 1R1VA 3VU3C 2ALYA 3QZ9B 2Y69H 1TQMA 4FTHA 1UUEA 2KIUA 1WXBA 2CJ9A 2MLGA 3ZQGA 2FXAA 2XKPA 4JRKA 2P5LC 3BW1A 3I56A 3JCMJ 4R0KA 4TVAB 5M9OA 2WSEE 1D1AA 1IW7F 2BE7D 3CCRI 1LDJA 5KE3A 1NJIC 4BH9A 4Y92A 1VQ5T 2VOOA 4G12A 4CS4A 1KOGA 2J5OA 2OA4A 3TO7A 1WFXA 3M5AA 2RHQB 3EUKL 3G4SI 2DL5A 1HCRA 2QQRA 2QHTA 1X2QA 1G51A 2MD5A 2M3AA 5E1XA 4LLNA 4M7AF 5E3IA 4OB0B 4ZDOA 3OYAA 1JGSA 1B34B 4Q4ZF 2M8GX 2FG0A 3C4SA 3QOEA 3MPUB 3A5YA 1X4PA 1ZARA 3G2BA 2P0PA 1ZG5A 5ELOA 4H02A 4HNUA 5HODA 4P9UA 4VUBA 1VNDA 4HOBA 1KC8R 4EMGA 3L4GB 3G71I 2ABLA 2E5KA 1G3TA 5FU7B 1EVLA 1WI9A 2FMYA 5KYYB 2P5KA 3A1YA 1WCMJ 4ON0A 1UG1A 2OD5A 2DOEA 5CYVA 1ZAOA 4UUSB 1AWCA 1NE8A 2YRVA 3HXUA 2MFZA 2MW8A 3GO5A 1FYMA 1UEBA 2A08A 3T1BA 2CH4A 3TREA 2IGOA 2X1CA 1SD5A 4A3KJ 3CCUT 2O8KA 1VOMA 4J9CA 5HLIA 2O9LA 2EIMH 1RABB 1VQ5Q 2HI3A 1TSFA 4D0PA 2XSDC 1IRFA 1IGQA 4KULA 3IRRA 2K4YA 4C8QF 3MHXA 3N05A 1ETWA 2NVUB 2QWWA 1PP7U 2E1OA 1T56A 2VUMJ 2DD4A 4YIRX 4GFBA 3BR5A 2NUTA 1BB9A 2PEXA 2DAQA 1RPWA 3JRHA 1FYNA 1EJ9A 2EKOA 3SEMA 3X26B 7AT1B 3CCLQ 3ZQIA 1WH5A 2BY2A 2L54A 5J47A 2GQVA 3WHBA 4L5IA 3IAS2 3RPQA 1N27A 3H3VK 1MMDA 2JVGA 2X85A 3OR2C 1N9RA 5LJ3h 2O03A 4IUQA 1TW3A 1TC3C 2DU9A 1KSWA 1F1ZA 5IT9K 2CZ0B 1YITA 2PUOB 1OYWA 3EYIA 3LGFA 1UJ0A 1MBHA 1MGTA 2Z3YA 1J9IA 2O9VA 1PUFB 1MSFC 4LVLA 1ZHIA 3CXCS 2WBMA 1ACIA 3M7GA 4M9XA 2E7WA 5E3MA 1HD3A 4BE1A 3ME9A 2RHYA 1BKBA 4IUPA 4LE9A 3C95A 4KH0B 4YCVA 1C0AA 5H20A 2KR3A 3S6WA 3TKYA 4I7HA 4W1UA 1VQLA 4IF4A 2FEZA 5HCKA 2ZNZA 5IYDJ 3K4NA 2KRSA 4QKUA 4HVCA 4XKCA 3MEUA 2OV7A 1ZQ3P 5FJ8J 2SEMA 2HKNA 2K4BA 2VT2A 5HNFA 3HTSB 1JT6A 1WI7A 1DGRM 1IN7A 1RKTA 1M27C 3GTLJ 2M2EA 4MLOA 3B73A 1X56A 2GQQA 5J1UA 2AMCB 2GLOA 2XSJC 2KNBB 4A3FJ 2X6YA 3ICAA 4C92F 3WXMB 2ID6A 3LSSA 5BMZA 1UFMA 4HX4A 1W36C 1FBSA 3K9TA 4JX6A 2LREA 4EJWA 2FPFA 3EG2A 3DV8A 3JCMX 4ZZLA 2CUDA 3P8VA 4P3NA 4LG0A 3TSZA 4J9EA 1S5LC 5CK9A 2OCEA 1XC5A 1ABQA 1TXQA 3H36A 3G1JA 4LMYA 2LK2A 5A2QE 2R7SA 2J6OA 4HWPA 1T33A 2BGCA 3LSIA 2Y75A 4IHWA 3HUGA 3K70D 4B9XA 4YP0A 2ESNA 4KNYA 2CS7A 1LPLA 2HSPA 2KSSA 2I4LA 3G4SQ 3RERA 5L3FA 1YRNB 3J7ZI 2JS0A 4ZYEA 2RDPA 1S7OA 3MP1A 1VQ4T 3D7SB 1EH8A 2KJBA 3U21A 3CCUI 3SQNA 2VJ5A 3HHTB 3VYUB 3WTYC 4QVDA 1TW2A 2AHJB 2YWWA 3O8VA 3J80E 5CPRB 2HVQA 3WHCA 5DM7R 3E6DA 3OV8A 2VBZA 5B1AH 4QQ6A 1K78B 1N8RC 3PFIA 3ZMVA 4CCKA 2DX1A 4OMOA 1V76A 1UHSA 4N9IA 3IKVA 2KHMA 2QKLB 4W97A 1I3QJ 4XICA 4HXJA 1X2MA 2STTA 2ICWG 5GAMj 1FP1D 4HWOA 1HQCA 4M72A 2L8DA 4K11A 2KPMA 3VFZA 1O7LA 1E17A 3TDZC 1MJ9A 3JCMP 2GBQA 5K5OA 2DOAA 3UT1A 4DYCA 4HQMA 2LSOA 4M78C 4A4HA 3WU2C 3BZ6A 3IQLA 1AKHA 1LUJB 5D5WB 1WXUA 5L23A 2DLPA 1PG5B 2HOAA 2DM1A 2IA0A 2AZSA 5GAMh 4YRPA 3M4PA 1BW6A 4PJNA 4TTVA 3RSNA 3K0LA 1HKQA 2D8HA 2X3WD 1N75A 3MVPA 4XLPF 2DKGA 4M77B 2XAFA 1HF0A 1J09A 4OMQA 1IXRC 4JX5A 3RMQA 2ETHA 4HNTA 1JKQC 1JI8A 3LSMA 1VQ6A 1X3UA 1YX5A 1I1JA 4KIFA 3H41A 2XF6A 3NWTA 1VQ5A 1BJZA 2CFOA 4DZJA 5M5XJ 3J7AO 2K3BA 2DA6A 3FXMA 2EAYA 2XKOC 1M9SA 1QVFS 2STWA 1QP2A 2HBWA 2CREA 1NYGA 4IRHA 2OJED 3M58A 4QQDA 2ZT6A 1W2BP 3RPUD 1X1DA 3LSHA 1FNNA 2HQRA 3DU5A 5LGTA 4EDUA 1OQKA 2BY0A 4AFUC 3CUQB 3EH1A 4N0AA 1FEXA 3QRFF 1O4XA 1RAEB 1SF9A 1WJRA 4F55A 2M0CA 1J5WA 2W25A 1QP3A 2DTHA 9ATCB 2EH3A 2ZJ2A 3MZHA 2CQ7A 1HLVA 4QWQA 2Y30A 1JB0E 1WQ7A 3G1LA 3ZQHA 2HSEB 4AT1B 3BTIA 3CJRB 4CCMA 2A3SA 4KDPA 2I2LA 1VQKA 2MBFA 2L9SA 4BACA 2R7ZJ 3HFVA 1GVJA 1H9TA 2F5KA 3GFIA 2GXGA 4XOPA 4X6AJ 1K1ZA 4RS8A 4TQDA 2RO0A 3CMAA 4PDKA 3VWBA 2VV5A 2M34A 5FROA 4CDGA 4A3EJ 3F6VA 4OAYA 4L5GA 3K4JA 3NARA 2ALYB 5LBQA 5KYNA 2A37A 3IKMB 1H4QA 2K40A 3JRIA 2ZPHB 2FRYA 3IALA 3KETA 5L3GA 2DA1A 4RB3C 1Z9ZA 4G9YA 1KHIA 4WCIA 3REAB 3KFUA 3VRZA 5JHFA 3ZMTA 2RNAA 4C3JJ 1LVKA 1ZUYA 4P72C 2Q7HA 1X2HA 3RESA 2IS2A 4C8QA 1MBJA 3RZOJ 4JRIA 3NENA 3F8MA 2E2JJ 2EPFA 4A3BJ 4ELYC 5HK3A 3EUHC 2X1EA 1UG2A 2KRHA 3OSSC 1YRNA 4ORZA 2PMFA 2XHKA 3CUOA 3GZ6A 1YITI 3A8MB 1YJWI 4BKXA 3TOBA 1WU7A 3GTKJ 1Y8RB 3MQ0A 3GTPJ 5GMKe 1BI3A 3CMEQ 1Q82U 1DGWY 3H0DA 2HQ5A 1NNHA 1QHGA 4A6EA 5KNNA 2KIFA 3IWFA 2GA2A 2PVDB 4AIHA 4NNJA 3C0CA 2QK0A 4C2MJ 1XQHA 3URGA 2R7UA 4L59A 2DFHA 4Q48A 5E20A 4O6JA 2EFWA 1K4TA 1WHJA 1KQSA 3SWNC 3I7FA 2W24A 1RC9A 2HZTA 4DYRA 2OQRA 3SYTA 2TDXA 1WFWA 3EFOA 4PLLA 3CD6Q 2NS7A 3ML6A 4M7AA 1OU9A 5ICFA 2GTJA 2P84A 2B63J 1GL5A 2TRTA 4K86A 1KC8U 1XTDA 2DQRA 4OIQF 3KEQA 4AWXB 3A2KA 4DZPA 4RM2A 3KUFA 1TWGJ 4J5YA 2BHZA 2K3PA 2COWA 3VS2A 3L2VA 5AONA 3F9KA 3S3NA 2QGFB 5GAMd 3CUQA 4R8HA 5M5WJ 3I4NJ 2R3SA 3BR1A 3VOEA 5LGUA 1WXTA 1Y8QB 3E19A 2DK5A 1S6LA 3CP2A 3RYPA 2RK1A 1B7TA 2R7XA 2UXNA 1T38A 1H8AC 4K87A 1J0RA 4DPGA 3BOQA 1B8IA 2W48A 1H3HA 3LAJA 1Z7MA 4OB3B 2EQUA 1SFOJ 3GUDA 4WX9A 1H89C 1WH7A 2E3HA 1KQ1A 3G7ZA 2M9UA 2DYBA 2GOXB 4A6DA 2LQ8A 3O2PE 2Y0SA 2OCCH 4E7IA 1HSQA 5FRMA 3CBOA 5CKEA 2G9WA 4A53A 1YQAA 4L5EA 3DPUA 5E3LA 2EYZA 3SZTA 4M7DC 1RUWA 3EETA 1LE8A 5CVVA 5D8KB 4NC7A 1TG0A 1BYMA 1ZX6A 1R22A 4MTEA 4OB1B 2QG9B 2V9PA 2PVOB 1BIBA 3FXOA 4KUMA 4XKWA 1ONVA 2R7FA 5IT3A 4P3PA 2YLBA 2FOKA 3JRGA 3CCJT 1OCPA 3CMMA 1SAUA 1YS6A 4AYBN 2DN0A 2F2VA 5L8RE 4DOWA 1X54A 1WHGA 2E7XA 2X35A 1VIEA 5L3CA 5GJWB 4LNPA 1HW2A 3A98A 2L0KA 4BI8B 4CH6A 1XGOA 3ECOA 3M3YJ 2NYSA 2LQKA 3QKJA 4GLMA 2HPMA 1R4MB 4CI0C 3TP0A 3OY9A 1I27A 1TWHJ 3FX3A 1XDUA 1Z6RA 4UVCA 3BFMA 1A36A 5CO7A 3KP4A 2DAOA 2HXOA 4P55A 2K3YA 4JRPA 4DBQA 2VOPA 2RNGA 4CC7A 1YITT 2D5VA 3GTQJ 2DILA 3CBPA 5KYYA 2GWRA 3MEXA 1BJAA 3DB3A 3GWZA 1W1FA 4JJDA 4G6QA 4LVMA 1WX6A 2H1KA 1IGUA 2ZPGB 4IHVA 2RK2A 5IHIA 2HVRA 3SZPA 3H9GA 1Q86U 3O3KA 3JCMW 2E1HA 3MD2A 5CAIA 4O3MA 4I0BA 3OS1A 1LDDA 4KIBA 3RYRA 1YITQ 2KDZA 1BN5A 2F5CA 1K6YA 2HTSA 2OUMA 5GMKl 3KLOA 2ZKZA 5HOOA 2BY1A 1TTYA 2DDAA 4L0YB 2LJ3A 2RQRA 2CWEA 2H6BA 4FYVB 2E1MB 3K4MA 2ELJA 3OL3A 4HZFA 1GCQA 2W0ZA 4WI1A 5IYCJ 1KYWA 3CESA 4FYXB 4H2TA 3HSRA 1HKSA 2R7VA 3HM5A 4RDXA 2ARUA 1D3YA 1OCCH 3W6JB 1G83A 3LLRA 4G84A 2O8XA 1W6XA 2LVSA 4UNOA 2VKHA 4YFXF 2LJ1A 2GZWA 4GBQA 4C8QD 1V4RA 2K9SA 4LDVA 4F7UA 1HDDC 3M8EA 2VXDA 2A28A 5KVRA 4JZ4A 5C6SA 4OAZA 4C0GA 4JDSA 4BXUA 3HOZJ 5HLTA 1TWBA 4XLNF 3QUIA 2K2MA 1KQSS 1XGNA 5FFZA 4MQ9F 2R5YB 2BXZA 3OR1C 3M55A 2LNHB 1TWAJ 2E1NA 4PL6A 3P9KA 1E1TA 4C2UA 2A3LA 1VQMA 4N9HA 3HY1A 1PKSA 1TU0B 4HV5A 4HV6A 4RTTA 1JHHA 2O61A 2ELHA 5IHKA 3GVAA 3CMET 2PBIA 2XD0A 4HX7A 5DV5A 4EV0A 3EG9B 3RIRA 2WWYA 4AMCA 5D4RA 3OYBA 2EILH 2XAJA 5LD2C 4X0GA 3CDHA 3B02A 3C7JA 1OJLA 3CP8A 3HHGA 2OZ6A 3SZGA 4BL0B 3RKQA 4MTDA 4IQJA 3UATA 1MZBA 3DCFA 2ARTA 1OR7C 2ACJA 4LGWA 4M74A 3K6GA 1GT0C 2W7NA 4WXHA 1LNWA 1NG6A 3GTMJ 4IUVA 1OV3A 4DA4A 4KBMB 1YHQA 4YROA 2GIZA 2K9MA 3ZGKA 3F22A 3CCET 4HT4A 2RI2A 1GXQA 4PJMA 3HJEA 3WTSC 2PVGB 4J6XA 3CCQT 5A2QK 4UY8I 2JXBA 1W2BA 4BW9A 1GCPA 2ME6A 1MV0B 2QDYB 2X4YA 2SRCA 2RGVA 3I56T 1ULYA 4V19K 4H2YA 4UUSA 4BUGA 3NQOA 3MN2A 4BY6B 4MIMA 1NK2P 3MP6A 2DO3A 3EFSA 2ZCEA 1ZKGA 3JR9A 1N5ZA 3M0UA 2LC4A 2K3FA 2ODRC 3FWEA 3R0AA 3JSOA 1KG1A 2D1XA 1IF1A 4XTWA 3EYYA 3UKGA 2CJJA 1ARKA 2XGEA 4CCOA 1KQ9A 2Z0WA 5KYUB 3JB9D 4M6YA 1YW7A 1LJ9A 1ON2A 4AU7A 1QCNA 2XI9A 5KYXA 1HSJA 3KPHA 3D5RC 1WHLA 2QYOA 4NHJA 2A36A 2JUFA 3DLMA 1Z3YA 4XEOA 3H3ZA 1ZSZB 2NLUA 1E22A 4M3EA 5ICCA 3EG3A 1WWXA 4ZC3A 2CGPA 2VKEA 4RLFA 3TL4X 3FK7A 1IGNA 4HT8A 3OS5A 3ABUA 3JRBA 3BDUA 3QDRB 4EMKB 2H8WA 1IRXA 5CVUA 1RETA 2QSGX 4YREA 4AC0A 3WE3A 4RBOA 3A01B 4HQEA 4KGXB 3CCJQ 2CJBA 1WJSA 3LOCA 2RQWA 3MMYB 3KZYA 1VQ6T 1YFSA 2DMUA 2FHDA 1FX7A 4RAFA 2B0LA 5F64A 4EVIA 5LRRA 2C6YA 2KRNA 2LR8A 5E18F 4B1RA 2X3XD 1TUCA 3OIOA 3J81Z 1MNEA 1OCOH 2CP6A 4EMKA 2Y4XA 2EB7A 2IPQX 2I4OA 3UNGC 3IAM2 1TWCJ 5B5EC 2HWVA 1YOVB 3S1RJ 2ZINA 1NPPA 4M7AG 1W5TA 5EJCA 3EUAA 4EIKA 2HKXA 2E3CA 3SFIA 4LVJA 4E70A 3IP4B 2XF7A 3CEYA 2O88A 1FMKA 5KYWB 1XSDA 3E6CC 2DTOA 3JCMV 4E51A 5TJJA 4UXNA 5H6QA 3AKZA 5C0MA 4EX5A 4J7IA 2RI5A 2KI7A 3F0CA 5FLXZ 2EQRA 4DIQA 2DQ0A 1IN4A 3KEYA 1ZGJA 2CP5A 1KU9A 2WACA 1T3LA 2ZPFB 1K73R 3DB4A 2ZPEB 2LJ0A 2I0NA 4EM0B 2BYVE 2OU2A 3PNYA 3S8PA 1O57A 5LHGA 2A6HF 4P73A 3JRAA 2L3SA 3Q0UA 3FHNA 5DCFA 2BUDA 1Z6TA 3I5RA 3TEEA 3UF4A 3A5ZA 3DSQA 3AAFA 3I5SA 1YIJT 1TT5B 1BC8C 4PZJA 3BWGA 2QGUA 1LKXA 1ERDA 2MC4A 4C0FA 3MFKA 3KZIC 1YWPA 1Y0NA 2DEUA 1MMSA 4XRFA 2AMCA 3CTAA 2KRMA 3WU0A 2ESHA 1M4ZA 4WTOB 4A3DJ 1M1FA 3TW6A 3TDUC 2JJ9A 1JJ2A 2XGTA 1M1KR 1HBXG 4HVVA 2GF7A 3QO8A 5KAFC 4YRVA 4B47A 3FRNA 1SRYA 1ZGAA 3GCMA 3T8TA 4GDFA 1IN5A 3M8JA 4K2EA 5FKNA 1DU6A 1ASYA 4XRMA 3S1QJ 3JCMb 1Z21A 3BJ6A 2KDSA 5GAN7 4FYYB 2LG4A 3GZNB 3CCEQ 4TVAA 4OGEA 3HP9A 3KCCA 4RUGA 2CW7A 3U1DA 3WTUC 1AU7A 2R7TA 2HZYA 1VQKT 3TVTA 5GMKi 2M02A 3I35A 3OYLA 1EVKA 3F3XA 4HDVA 3PSIA 2DL4A 5A0GA 3PM1A 2AO9A 3L9FA 2QM3A 3BTJA 1Y0MA 1YI2I 4FASD 2KISA 4IOAF 1QWFA 4B4CA 3COAC 1C6VX 3EUHA 1ZUUA 3K1NA 2K9GA 5GANd 1D0ZA 1CKBA 4XNFA 1X55A 2ZPBB 4CICA 2QZ8A 4CS2A 1R0CB 3BE3A 3CD6A 2K86A 2XDVA 3TGNA 4BHCA 4IHYA 5D6YA 1X75C 3QYFA 2PU9B 2COMA 2AQFA 1QKWA 4M75B 3QPSA 2OJ2A 3O8GA 3CO7C 4QSHA 2M4GA 2M87A 3QNEA 1D3BA 3M57A 3F8NA 1IXSB 4BYYA 4P75C 1EFWA 2K9QA 4YRGA 1MDMB 3DTIA 5LJ3j 3CCRT 5E79C 2E71A 1ATIA 1NTCA 3BQZA 3CMEA 4PJLA 4M7DG 4C92B 2Q5HA 4BQAA 3HPGA 2ZJPF 3G4ST 4JBAA 1E0EA 2EGAA 3ULRB 5FLXK 1YJ9A 4P3OA 3M9QA 3ULQB 3S2DJ 3CCRQ 1B1BA 4E6KG 1T0HA 1VQ8A 2NVYJ 4CYCA 1P2FA 2VL8A 1MMAA 3J80K 3I5UA 2WADA 1TNTA 2HXIA 4NQWA 1D8KA 2HPIA 1SD4A 3S93A 2MIOA 4O5VA 4EATA 2COBA 2XV4S 4ENJA 1D8JA 2PUKB 3DFGA 1K8AU 1A0NB 2RHQA 3HZJA 3BPXA 3HRMA 2RH2A 1X1CA 2MSYA 1A6QA 5GPAA 1MD0A 2EIFA 3OOPA 1OI1A 4FSSA 3K2ZA 2LY2A 3V4GA 3H35A 1AD5A 1EV7A 2RKHA 4BS9A 5I2SA 2EBIA 1QQIA 2GM4A 5GAOq 3CCVQ 3JCMh 2HL5C 5LJ5e 2OBPA 1O9SA 3PNTA 4WXDA 2E34A 2PI0A 1SVLA 2KK4A 1EFNA 3CCUQ 3D1NI 4HDUA 4FL6A 2O4XB 3CCSA 1IL2A 3W6VA 3RBBB 4M73A 2DA4A 2B86A 1RAHB 3IKLA 1AT1B 4LLGF 1T0FA 9ANTA 2EA4A 1M1GA 4HVUA 1KJWA 4M7DD 2OQGA 1A31A 1JO8A 1I5LA 5J1YA 2JVHA 4YTLA 4WXCA 5ICGA 5F6FA 1VQPA 4BXXJ 1QO0D 1VFCA 2JUGA 1UGQB 4YRJA 2DPDA 2K3XA 2OPTA 3QHSA 3HIFA 3VDXA 3M4QA 1T0FC 3IRQA 5LGNA 4AIKA 2ZGWA 1GFDA 1ZRDA 2KZVA 5I21A 4C3HJ 1KHCA 1ZLMA 2QAZA 4ESBA 2P4TA 4U0WA 1Q81U 2D8JA 2M0YA 2ZIOA 1XJWB 1R5GA 2O5RA 2J06A 2M1BA 2ELKA 4OU0A 3G73A 4BBSJ 3LA2A 3OYGA 5KK1A 1XX5A 3P5JA 4JS4A 3RGLA 2MK5A 3QU6A 1CSKA 1G2BA 1KQSP 4C8QG 3LAPA 1M2VA 1ETXA 4L9JA 5C4JJ 3LW5E 3QU3A 5KYUA 1K76A 2P7CB 1K73U 3OYCA 1VQLT 4AFSC 1XSXA 2IY5B 2I5UA 4Y7NJ 1B72A 3ZPLA 3ZMUA 1PVEA 2NVXJ 1Y96A 1DPRA 3FLGA 3HXWA 4B8XA 1VQ7Q 2XC7A 4N4IA 3UGTA 2RC4A 1SSFA 5AIQA 3L1PA 1D3BB 3SB2A 4M7DE 4RCBA 4ESRA 1R0BG 3FKIJ 2DRKA 4M77D 4M4ZA 1NLOC 2BZTA 2QCOA 5FKOA 1SANA 2KLOA 2EWNA 5EZHA 5EDNA 1X3ZB 3JTGA 2D0NA 4M75E 4R56A 4CH5A 3NGPA 2VONA 2A8EA 2WC2A 4ASNA 2PN6A 3A8OB 2EIKH 4P5OA 2I8DA 3OMGA 4BB7A 2VBWA 4KR3A 4HAMA 4BEHA 2LKXA 4HWTA 1ZN2A 2CUEA 1OYYA 2QEXI 5LJ3e 3BZCA 3VEPA 4UUTA 1HC8A 2P0QA 5GANg 3HOTA 2AKKA 2EFPA 5GJVB 5GAN5 2QLZA 3I59B 4PJ0C 3D0SA 1PUEE 2KY9A 3CC4A 1H4SA 3C2HA 4M9SA 4PFPA 5EYRA 3F72A 2VKDA 3K4KA 4YFKF 4BI4A 1STZA 3BTLA 3RMSA 2Q2EA 1WHHA 3VJPA 3MCZA 1QRYA 5EEHA 3GIBA 1X1AA 4E7JA 3E7LA 4FETA 1G2HA 1U1SA 2NWMA 1U5SA 3N5BB 4LDUA 3ZEHA 4M7DB 5J3LA 3KP7A 2RHUA 3CCEI 3M59A 1E6HA 2ZNIA 2H09A 2RAEA 3NPFA 4FM4B 4D8DA 3MQZA 1B70A 1Y1VJ 1N78A 3V8JA 4MEXF 2V8JA 2ZC2A 1H88C 2E41A 3E9GA 1YJWA 1R5ID 1DU0A 2FB7A 2RB6A 1VQNA 1U3EM 2HDDA 1YN8A 1G3YA 3EDPA 4KGVB 2ZO4A 1H8KA