3V8LA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with biotinyl-5'-amp
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase/ligase inhibitor
total genus 100
structure length 322
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8lA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8lA02
4Y13A 2H09A 4PGHA 3IKTA 1XMAA 2HZTA 2EJ9A 2VT2A 5L3FA 2VE8A 1UFMA 4BW9A 1U8RA 1R1TA 1LEAA 4G84A 3L00A 2QENA 4ON0A 3Q5FA 5D5VB 4BXUA 5HVQC 3JCMe 1USYC 2RHQB 1ZYRF 1MDMA 1Z7UA 4GO1A 5JHUA 2ETHA 1ZN2A 3KFUA 2ZTGA 4F7UB 4WF2A 1YGBA 5J6XA 4ESJA 2WTEA 4LMYA 3V8JA 2ZGWA 3RIRA 4KN4X 3Q9VA 2VC1A 1ZHFA 4L0YB 1B1BA 2AMCB 1ZRCA 1L3LA 1SESA 1OKRA 5KVRA 3RYRA 4KUMA 4LFUA 3R6SA 4ZZLA 4HT9A 4HW0A 1RUNA 2DPUA 3SWNB 4KDPA 4OIRF 2CFXA 2RHQA 1KMMA 2QQAA 1R58A 4EGZA 3F23A 1O3SA 2XGTA 4F7UA 4EJUA 4M7AD 4H2XA 5GAN5 2HQRA 4Y91A 4WJ4A 1YG2A 4M6YA 4MHGA 4QWQA 1KA8A 2PMUA 1KU2A 2NNNA 3GO5A 3GFMA 4ENMA 3JB9I 1ZH5A 2DXUA 1BI2A 1RZ4A 1EV7A 3SWNA 2X4HA 2YR2A 3QUIA 2O8XA 4HWRA 2RV8A 4OMZA 4H02A 4PDKA 5H6QA 4DPGA 1U1TA 3JAMK 1WQ7A 3T5XA 2MA3A 4P5OA 2ZT6A 1MGQA 2ZZFA 3BDUA 3HRMA 4AH6A 3L7WA 2GIVA 4P73C 1L0OC 4CH5A 1W7PB 3QPTA 3BJ6A 1G6NA 2Q7HA 1LJ9A 2ZR3A 3A31A 5ERIA 5BPDA 3B02A 3K1NA 2ISZA 2P5KA 4KICA 2B0LA 3I71A 3DP7A 4HYEA 3I7FA 1I4K1 2GXGA 4HAMA 3O2PE 2GA1A 4QVCA 2ARTA 2HQNA 2J3MA 4YRPA 1P92A 1I8FA 1F4KA 1EOVA 3JCMJ 3R0JA 3D5LA 2K57A 3JB9G 2DVEA 1QNTA 1W7PA 2QZ8A 4OU0A 2QHTA 4OLFA 3LA7A 1FY7A 3RTRA 3RKYA 4MMKA 1TQMA 3V7CA 2WV0A 4UVAA 5HLIA 1NYRA 3JCMc 4M75D 4PCQA 4XSXF 3I53A 2QLZA 3FM3A 2LNBA 2STWA 4P73A 3ULQB 2JRTA 2QTXA 1PP7U 2VE9A 3V8KA 3UGTA 3LFKA 5JI6A 4TTVA 4RS8A 2M45A 1QGPA 1IN7A 5GAN8 3E6CC 1YS6A 4BH9A 3QAHA 2D1HA 3DEUA 3I64A 1REPC 1UCRA 3GEZA 2OA4A 4Q47A 3WGGA 4V2SA 3JB9J 4IPAA 3VQWA 1ZG3A 1QBJA 3SZPA 1FC3A 2RDPA 1DPUA 1O7FA 4C92D 4RQFA 3JW4A 4JUVA 3E9IA 2MBFA 2K27A 3GVAA 5EEHA 2CG4A 4WI1A 4M77D 2Y75A 2P7VB 2KIMA 3PCOA 2I4NA 1BOAA 1TLHB 1B6AA 1B59A 4UP9A 3C1DA 3FIFA 4QVDA 3PGGA 2E1NA 1HW2A 4GGGA 4WXCA 1YFSA 3P8VA 1QF6A 2O6GE 6PAXA 2HTJA 2DBBA 3FXUA 4IRHA 4XSZF 2FMYA 2EJGA 4FT8A 4RGXA 2VC8A 1SMTA 2VXZA 5DYMA 2VBXA 4N9HA 2ESNA 3M1EA 3M4PA 2PMFA 1PYSB 1FBSA 4P9UA 4CH4A 5CJ9A 1HQCA 3ECHA 1T39A 4AIKA 2OQRA 1ULYA 4CZZA 2YHTA 2DXTA 4EJOA 3GFIA 4S05A 1XDSA 4EMSA 2K4JA 1BIAA 3A32A 4YG2F 1EFWA 1MD0A 1B9NA 4M7DF 3E97A 2EV0A 2QWWA 4Q48A 3FF5A 2E41A 4M78F 4G7OF 5IT9Z 5E8GA 1UHMA 3P8TA 1PYSA 4YFKF 4TV7A 3WGHA 1FBUA 1FWZA 3KEOA 2GA2A 1OYIA 2Y48A 3TOAA 4P71A 2RGVA 4PJOE 1KQ0A 4IJAA 4ESBA 1S3JA 2JT1A 2CGHA 4A2UA 3MF1A 1XN7A 1USTA 2P6TA 3F22A 3WODF 2C8MA 3LA2A 4KNYA 2Z33A 2DPDA 3JCMV 5LEJA 3KZYA 3QHSA 4KT5C 4PJOF 1FBQA 3A74A 2ZZGA 2CQKA 5D4RA 1V3FA 1GGMA 4C8QE 2KJBA 3QU3A 4YIIA 1YYVA 2IA2A 4L9VA 3DSQA 3WE2A 5TRDA 2FE3A 5L3CA 1H9GA 1EH8A 1ON1A 2W85A 1GVJA 1OYWA 5GAN7 4I2OA 3JCMX 2J5PA 2XAGA 4EM2A 1Y0UA 5GAN2 3TO7A 4C8QF 1B70B 2MH9A 2XIGA 1FP2A 5DUKA 4NL3A 2HFHA 5LGTA 5F6FA 3BDDA 4A54A 3JCMP 4PG3A 4U7DA 2JPBA 2ZBKA 3HRKA 1IRFA 2IA0A 1MGTA 3BY6A 4HX4A 5HS9A 2I4MA 3DV8A 5DDGA 2DQLA 2DAOA 3QO3A 3VQYA 2DU5A 3TQNA 1SFUA 1OR7A 1B70A 4LNSA 1W7PD 2KJCA 1PP8F 3JCMQ 1SD7A 1HK9A 5D8KB 4ZTUB 2QBYA 3JCMb 1BC8C 4JLIA 4TVAB 1TH7A 3QP6A 2ZT5A 5BPIA 3VEPA 1K7AA 4WCGA 3JCMg 1BBUA 3JTGA 4A0ZA 4IHTA 1MJ9A 1W5SA 3HXVA 2D45A 1IL2A 4Z2YA 1C0AA 3M8EA 3MAJA 1SRYA 1YTYA 2RM4A 1D5VA 3W3SA 2ZMEB 5AIPA 2GXBA 2P4WA 2YPRA 2E7XA 3F8BA 2R7FA 3P9IA 4XQ3A 1YFHA 4RMFA 5FFZA 4G7HF 3RERA 1OYYA 2NRAC 2G4CA 5C52B 4M7AG 2DEQA 3GIBA 3ZN1A 1HC7A 1QQIA 3MQ0A 3MZYA 4MMLA 1ODDA 2LDUA 1HW5A 3FHZA 3RPQA 3RGLA 2A6HF 4BWAA 2ZMEA 2FYKA 4RCCA 1B76A 3DKWA 5DEQA 3RJPA 4ENKA 2M8EA 4EVIA 4I7HA 4TVWA 4HWOA 2NYXA 1TW2A 5JFRA 4JRIA 2EFPA 5GAN4 3SHFA 5LJ5j 3MF2A 2DKGA 4B09A 1Y96A 3S2WA 5ICCA 1IW7F 2A6EF 1J9IA 1JJCB 2BV6A 3R07A 4U0WA 2XAJA 3V4GA 5CVIA 3RL6A 1D8KA 1K78B 5GANf 5CAIA 3KP5A 4HZFA 3CUQB 3DFGA 1YS7A 3ZQ7A 4HWPA 5ICEA 4N9IA 3BOQA 2Q8KA 3K1MA 2ZINA 4IRGA 2ZNZA 1O3RA 1FX7A 1FPQA 2FNAA 2M1BA 5K1PA 4M9ZA 4YRFA 2A69F 4A6DA 4KA4A 3E5QA 3EETA 3ROUA 2ZR2A 1BI3A 1FYKA 2V6CA 4YROA 5IT9K 4XU2A 3L2ZA 3RKWA 4O6JA 2COMA 5LJ3h 3LQRA 4M77B 4EJVA 2HR3A 3E6BA 3E9HA 1ASZA 1RI7A 1U5TB 5LHHA 2VBYA 2W57A 2Y0MA 4OIQF 3RDIA 1PUEE 2BGCA 3T0YA 1YCYA 4UP8A 3HUGA 2DZ9A 5HDKA 4XTZA 5GANd 2DTRA 3E6DA 2K02A 5HOOA 3N97A 2ISYA 4M7DB 3EFRA 1ZAOA 2FEZA 4Q4ZF 1K6OA 3VBBA 4M74A 3L4GA 5C51B 3WTUC 1ZLJA 5D8LB 4M78B 1BBYA 4MQVA 1ONVA 1R23A 5L3BA 2Q2EA 2Y90A 5LJ5g 4KR2A 1U6GA 3CJNA 4ENJA 4UV9A 3LWFA 4LGWA 1E22A 5GAMj 2XTIA 2J5OA 1FYMA 1RUOA 4PJOC 3V7RA 1QPMA 4M7DA 3KE2A 3HYIA 3FZVA 2PQ8A 4CS2A 5H20A 2EJFA 4C92G 1KQ8A 3FX3A 1SMYF 3JCMh 3A7UA 4L0ZB 3I54A 5D5XB 4M78A 4RB3C 2XKOA 1WQ2A 4M77G 4P72A 4MTEA 1BM9A 4HF2A 1K79A 2KIUA 1S6LA 3C7JA 5EEGA 1IN5A 2L4MA 4YREA 2L3DA 1WI9A 2UWMA 4C8QC 3KP3A 2ACJA 1SFEA 2M87A 3QNEA 4RQEA 2LSOA 1S8NA 4H2XB 1B8AA 2DTOA 4M7DG 1S7AA 3J81Z 2VBWA 4YRCA 3E6MA 1TW3A 3VB2A 2ZNJA 2K4BA 4J15A 1FSEA 1KQ2A 4M78G 3HY0A 3NELA 2EWNA 4H2WA 5DV5A 4PJOA 3QO7A 4P75C 1H0MA 3CO7C 1N9RA 4P96A 2A3SA 2DFIA 1TTYA 3F21A 4H2TA 4WJ3M 3F8MA 3NEUA 3QTCA 4IHSA 3R61A 1X55A 1TNTA 4GCVA 1USYA 4M73A 4C8QA 3ZMZA 3LQQA 2CW0F 3GWZA 2XASA 5GAMg 1LYLA 4CXFA 2JZYA 2YX4A 3KZZA 4G6QA 4J5YA 4F7UG 2HKXA 5J8CA 4M7AE 3BPXA 3INZA 1ZGAA 3GLXA 4XEMA 3JCMf 1XMKA 4MEXF 2HEOA 3IKLA 2PMEA 2OU2A 1P6RA 1HSTA 1Z6RA 2IJLA 4YPFA 3DPTA 4P55A 1JHHA 2VN2A 3DF8A 1T2KA 1KOGA 2EK5A 1KQ9A 2H94A 4HQMA 4U0VA 2P5IA 1H4SA 4XTVA 5J8FA 4DQ2A 3MWMA 3T1BA 4LK0F 4NL2A 2LF7A 5L3GA 4NOYA 1SETA 1D3BA 4UVBA 4YRRA 3BPVA 3M7GA 2YU3A 4HWSA 2LKPA 1WYDA 1U3EM 4UUVA 1R5GA 3BP8A 4HX7A 1YFTA 3IRRA 4H2YA 4UV8A 1ZRDA 5L3DA 4XTYA 2PMHA 3KETA 4LB5A 1JRIA 2BE5F 5LEKA 2QVOA 3BW1A 1U78A 3PQKA 4YYEA 3JCMd 2E10A 5LJ5h 4U7BA 1EVLA 1Z9CA 3HFOA 3NETA 3REUA 2F5FA 2P6SA 1ADYA 5E20A 4ZTZB 4LB6B 3OOPA 2JSCA 5E18F 2V1UA 1WU7A 1MJAA 2ZIOA 4FX0A 1X56A 3LSSA 3KEQA 3PCOB 3BWGA 2XGXA 2AS5F 3VOEA 5KNNA 3K1PA 2A07F 3R60A 2RVCA 5CVRA 4UXNA 4QLCU 3GXOA 4X9CA 4RGSA 2JTVA 4M75E 1SD5A 4NCXA 3BJOA 2GAUA 4K86A 1Z05A 4HVCA 2RQPA 1H9TA 3WTTC 1N9SA 3HXWA 4CYDA 2Z99A 3QU6A 1E1TA 3F6VA 3HHGA 1E24A 4ENNA 2O61A 1V4RA 4A53A 2ZJ2A 1UHWA 5BOXA 3A5ZA 1G5IA 5FD5A 4XU1A 3CMQA 2FOKA 3ZN0A 3P9CA 2ZKZA 1SFXA 4HF0A 1EVKA 12ASA 2P5LC 4P3OA 4I0BA 1F1ZA 1F9NA 3W6JB 3HRTA 2ODRC 4M7DD 5JVTA 4HLXA 3EUHA 4C92E 5LJ3j 1X54A 2NAZA 4M78D 1XGSA 4M77E 5HGQA 1TBXA 5LJ5f 1IAWA 2HGCA 5DCFA 2A61A 1IF1A 4CICA 1XSXA 3J81K 1NJ8A 2XROA 1IXCA 1FNNA 5GAMh 4EV0A 3I4PA 1W4MA 1XGNA 3WTWC 1XGOA 3DXJF 3P9KA 2QHVA 2TDXA 2EV6A 3GYHX 5ILSA 5FLXZ 4EM0B 3Q9SA 3WG9A 2QM3A 1I27A 2E7WA 3JSOA 2ZZEA 2UXXA 3F8NA 2FMLA 2D1VA 2H6BA 1Z1DA 2IW5A 4EQQA 4YRKA 5K5RA 3TDZC 3VFZA 3PFIA 5C53B 3GW2A 1IXRC 1EQRA 3JTHA 2VOOA 3IRQA 3CUOA 3KP2A 4MGRA 4CDGA 1IZ1A 5AONA 3H3UA 4F7ZA 3K9TA 1NHAA 4XTXA 4CS3A 1DDNA 2RA2A 4O5VA 2M5WA 5LGUA 4H0EA 5DUIA 4FX4A 3FWEA 5LJ5d 3F72A 3V8LA 1NNHA 2L4AA 1BC7C 4G9YA 1OMIA 5CVVA 3JSPA 2ZT8A 3M8FA 1H4TA 4YRTA 4Q6GA 1IN4A 2XAFA 4R1HA 1USSA 2A68F 1ON2A 2JPCA 1L0WA 4EMKC 3KFWX 2DK5A 5GMKe 4XBFA 1BN5A 3SZTA 2ZCWA 4F7UE 5A2QZ 5LJ3g 3WTYC 3F8CA 4ZH4F 4J6WA 1XB4A 4RDXA 4ZZDA 1FZPB 3KLOA 2BBYA 2DTIA 2FA5A 2NNYA 1FLIA 4M72A 1BJAA 2RNJA 3MCZA 3VQVA 5GAMf 1J5YA 2Z5UA 4HA8A 3K2ZA 4BYYA 2QBYB 4LLNA 4MTDA 2XHKA 3HSBA 4M7AC 3F3XA 1J75A 2XAHA 4YCWA 2H6CA 5IT3A 4S04A 2O03A 2ZT7A 5F5WA 3WQZA 4ZYGA 1LDJA 2DQ3A 3J80Z 4UVCA 3QO5A 1KU9A 4A0YA 1ZRFA 3QP5A 2OD5A 4OINF 2DQ0A 3IWZA 3HTZA 5K1YA 3HTUA 1Z91A 1YLFA 5CVJA 5HDNA 3TGNA 2K86A 5LHGA 1AWCA 4L18B 1QZYA 3T8TA 5F1RA 5HLGA 2DI3A 3ISPA 4OP0A 3FMSA 4KIBA 2Z3YA 3I5UA 4A5NA 5LHIA 3IHUA 2HOEA 1J59A 2MLKA 1T0FA 3KP7A 2K7LA 4ASNA 4I01A 2ZIMA 3JB9F 5GAMd 3RPUA 5D6EA 1HKTA 4GYGA 3DPLC 2FXAA 2PJPA 3M4QA 2EFQA 1CGPA 5LRSA 5GANe 2W24A 3RI4A 2XUBA 4HX8A 1QO0D 3U9GA 4UHTA 5BMZA 1XD7A 3HTSB 2Q5HA 2HYGD 1M5Q1 1LQ1A 3HSRA 4MEYF 3IALA 2RC4A 2G9WA 1Y96B 1H4VB 4Q5SF 2ZCEA 1LVAA 4G94A 1G3YA 2IPQX 1HW1A 5ELNA 2OBPA 4CO8A 4BHPA 1N9WA 2HTSA 3TEGA 1ZREA 2R3SA 2F5EA 4OIOF 1ASYA 5TJJA 3L09A 4IVNA 3CO6C 2Q7GA 2VODA 1QE0A 2RKHA 4NQWA 1YIOA 4B8XA 2EFWA 4M75C 2EV5A 4RB1A 2BEOA 1U1SA 4O3MA 2VT3A 3KP6A 5L3EA 3IL2A 3RUXA 1GXPA 1JBMA 4KN7X 2DJZA 1KGSA 2CSOA 1WPYA 3IC7A 1A04A 4YRSA 4E70A 4N0AC 4HOBA 1I5ZA 1NJ5A 4P3NA 5FLXK 2DLLA 3T8RA 2PFBA 5FO5A 4ESFA 2STTA 1IRGA 3COAC 2DTHA 4YRQA 3CDHA 2I2LA 1WKMA 1YW8A 1DUXC 4C92C 5I21A 3L4GB 3E5XA 1XCBA 3LAJA 2RN7A 4HLYA 4M77C 4UNOA 3SFZA 2Z9OA 3ERRA 3ZMVA 3V7SA 4CS4A 5E1ZB 2ALYA 1LDKB 4UPAA 1D3YA 3GFJA 4HV6A 2ZNYA 1Q1HA 4MNUA 5ELOA 1KYZA 3NEMA 2FNPA 4N0BA 1WQWA 3RACA 1WRJA 4LLLA 4LD5A 2ZFWA 3VODA 3IWFA 2CJ9A 2C7IA 2RB6A 4YRLA 1J2XA 4I09A 4EMGA 1VTNC 4JRKA 3ECOA 2DQRA 4HV5A 3GZ6A 3QRFF 1ZARA 3BJAA 2YSRA 1X3UA 3C3WA 2V79A 1IXSB 4H2SA 2E64A 3HOSA 3TDUC 4XU0A 3WTVC 5A2QK 2L02A 1I1SA 3UGQA 3ML6A 1J0RA 2V1XA 3I59B 3LSQA 4G8XA 5GAOn 4KMUX 2ADUA 2PG4A 4XLPF 1Z7NA 4XU3A 5GAOr 3TO9A 2P0LA 4TVYA 2FQ3A 4AIHA 3P7NA 2I4OA 2V9VA 4A6EA 1W5TA 3C18A 5ICFA 4LK1F 3REOA 4PJOB 1BI1A 3J80K 3I59A 4H2UA 1NJ2A 1BI0A 4L9JA 4WK8F 4KFCA 4BHCA 2DK8A 5H6RA 3NRVA 2PI0A 3H3ZA 3O6BB 1R7JA 4XRFA 4M6XA 5LJ3f 4WWCA 3AAFA 3N4MA 3HXYA 2XAQA 1XGMA 4YFXF 3TOBA 3U2RA 4C8QB 1HXDA 4YRNA 3ZMUA 1EH6A 4FHTA 3HY1A 1YQAA 1KQ1A 5GMKj 1NYQA 3SWNC 4Y15A 2GZWA 3FXRA 3L2CA 1FYLA 2OZUA 5CYVA 2Q0OA 3HFZB 5CVUA 4ZYEA 2UZKA 1SERA 4JK1X 1M8VA 4ZYHA 5HS7A 2QYOA 2P7CB 3HRSA 1U2WA 2YLBA 4XTWA 3D0SA 1LOJA 5FGMA 3J7AO 5K5OA 1DP7P 1LDDA 4XLNF 3O3KA 4RCBA 4R79A 1I6XA 4PJOG 4G85A 5LJ3d 2FSWA 3MEYA 1P4XA 3QOPA 4UP7A 3BFMA 2MD5A 2AMCA 3G1ZA 2FBHA 3BY7A 4EJWA 2O0YA 2M30A 4KYWA 1D3BB 4P9FA 5GMKi 3HFZA 3HXZA 2E5AA 3OD1A 4YP0A 4A0XA 4RGRA 4HDUA 3RYPA 2R7DA 1NJ1A 3WGIA 1YFRA 1FOKA 2AXLA 4P75A 1LNWA 2IRFG 5F64A 4C8QG 1G3WA 1SD4A 1TNSA 4IRIA 4M7AF 1R5HA 3RKXA 4OOIA 2DO7A 3A5YA 2E65A 1PDNC 3ZMDA 5CLSA 3MZHA 4L9TA 2P5VA 2W84A 1FYFA 4J6XA 2FB7A 3GZ5A 1T6SA 2FU4A 1CF7B 1YO5C 5D5UB 3I0TA 3MFKA 5GANj 3WU0A 4H2VA 1O7LA 5AIQA 5LBQA 4I0AA 4JQFA 4PGGA 4I02A 3MEXA 3HRIA 1B7YB 2JN0A 2CIMA 3FXQA 4G7ZF 3ZMTA 4E51A 2CO5A 1E1OA 3R4KA 2C6YA 1RIQA 3IKMB 1STZA 3NENA 4D0PA 2RHSB 2G7UA 4PNOA 1CF7A 4HT8A 4EMHA 3HFNA 3TKYA 2VXFA 2I4LA 1YW9A 4IXAA 1B7YA 4EO4A 3HRUA 1B9MA 4YRMA 1TQPA 3HXUA 1EH7A 3I58A 3WTSC 3K0LA 2PLYA 1RIOH 3BJUA 2HYFA 1B4AA 2PEXA 1WLEA 1EIYB 1HTTA 1DPRA 2UXNA 4L87A 2IA1A 2CJAA 5LJ5e 2DT5A 2H27A 1P4WA 3PQJA 3OV8A 2RHSA 2CGPA 4LLGF 2KKOA 1AOYA 3EYYA 4YDQA 4OMYA 2FRHA 2EA2A 2Q5IA 2CYYA 1H641 1YB3A 3U1DA 4HWTA 5LGNA 3LA3A 1G3TA 2YX7A 5FD6A 4CH3A 4M75F 2EFOA 3QPHA 4M9XA 2FF4A 1EIYA 1UB9A 4XTUA 5GANg 1C0WA 3E3VA 3RF1A 1O57A 1ZGJA 2WWYA 3KLNA 1S7OA 2F5DA 3ICAA 4KIFA 2KRFA 1Z6TA 4HDVA 2MC3A 2CJBA 2WC2A 1YW7A 3HSFA 4YIFA 3UFGA 5ICGA 4A5MA 2DDZA 5GAN6 3JB9H 2HDCA 4LG0B 3EDPA 3FB9A 2ZXFA 3QSUA 2X0LA 4L9NA 5JR3A 4C92F 1T38A 2F5CA 4P71C 3RESA 1ADJA 5E3IA 4KQEA 2J3LA 4M77F 3GF2A 2IT0A 4M7DE 5GAOp 1BBWA 1MKMA 2L54A 2D2WA 1LEBA 4KR3A 5HDGA 1ATIA 3FJPA 1SD6A 4XEOA 4AIJA 1JXSA 1BIBA 4M78E 1G5HA 1VQZA 2HS5A 3IKVA 5DCMB 3ABUA 2NS0A 4LG0A 4PJOD 4R8HA 5FB2A 1KU3A 4HQEA 3E5UA 2XVCA 4LJZF 5GAMe 3HIFA 2O3FA 3EQLF 4HBLA 2IVMA 5HS8A 3EFSA 4CHUA 1D8JA 5D5WB 1KMNA 2MLGA 2VBZA 1MZBA 2ZO4A 5HLHA 2QQBA 3GX4X 3F8FA 4AWXB 1SAXA 1I81A 4C8QD 5GMKh 1XCVA 4BQAA 1R1UA 5DCMA 3FMRA 2FBIA 3PZCA 1KU7A 5DY9A 2ZXJA 4M9SA 4EJTA 4YRIA 5GAOq 1IUYA 3BROA 4BHBA 3JCMW 2QQ9A 2BYVE 1XSDA 4P74C 2A5YB 1W66A 2GQQA 5LRRA 2VC0A 5K5QA 4G6DA 1R22A 3IG2A 4P3PA 4I98B 4NB5A 4RB0A 3ZP5A 2F2EA 3F6OA 4EMKB 3A7RA 4M71A 2L01A 4AD9A 4L5JA 3TO6A 1I1GA 1FSHA 4CH6A 4GYIA 1HSJA 4U0YA 4F7UF 3ZPLA 2IP2A 4PHCA 1E17A 2DU7A 3TEHB 3LSTA 1QZZA 3SB2A 5E1WA 3JB9D 3WTXC 1F5TA 2EAYA 4RB2C 1ZG1A 1LB2A 3ZMSA 2OZ6A 2W25A 2CWEA 3FM5A 5GAOl 1R00A 5E8IA 4M7AB 4EMKA 4EX5A 3UH0A 4RAZA 3BZ6A 4YFNF 3CLOA 2FBKA 1WWXA 4P74A 2HWVA 1LJOA 2EA4A 5GAOm 2YLCA 2LF8A 3TEHA 5DD8A 3WU1B 2KIFA 4KIGA 3CTAA 4DNCA 5GANh 4U88A 2G7HA 3H92A 4NHJA 1OPCA 2VONA 4WXHA 5D6FA 2MH2A 4OIPF 5KK1A 2ARUA 2VXEA 2AKWB 4M7AA 2HKOA 4BNCA 4GXOA 4YCUA 1G3SA 3QO8A 3AHUA 4CGZA 4KMFA 5DD4A 3VU3C 3K69A 1RNLA 1R1VA 1P2FA 3WTZA 1H4QA 3ABTA 5ILUA 1HKQA 2ESHA 1HBXG 5E17F 3NQOA 2XV4S 1G4DA 1G51A 4YRJA 2DW4A 1LNXA 1JGSA 4IF4A 4BAYA 2AKWA 4A12A 2EL9A 1GXQA 4TVAA 1JE8A 2EJRA 3KP4A 2E3CA 1HKSA 3G3ZA 2EB7A 3HOTA 2PN6A 3HHHA 11ASA 1R36A 2OQGA 1KYWA 4HF1A 3GUDA 3JAMZ 1S29A 1P4AA 4X9DA 4EM1A 3VQXA 1XDUA 4K88A 5K1XA 3G73A 3CUQC 1MJBA 3EYIA 5FFXA 3LC0A 5BS6A 4M75B 4Q15A 2ZNIA 1TQIA 3ERED 3WE3A 2ARSA 2ALYB 2V1DA 1T98A 1Z7MA 3P8YA 2GWRA 4RGUA 4X5OA 1I5LA 4PZJA 1ZG5A 5ED4A 3M4GA 1J5WA 5D4SA 1B34B 4O2DA 3KCCA 3HXXA 4JBAA 2IY5B 5ILVA 4TQFA 3L9FA 4RAYA 5BQTA 4TWAA 2QHUA 5GAN3 4L5IA 4M75A 2DZCA 3HFVA 1U5TC 3TUPA 2Q7EA 1WNLA 1JJCA 1JHFA 2EFNA 3LAPA 2PBIA 2XRNA 4C92B 4ETSA 2E1CA 1K78A 2ODRD 2QHSA 2ELHA 1ZLKA 4YRGA 1O3QA 1B34A 3CUQA 4M7DC 5GMKl 3SXYA 1X01A 4AVPA 1J7KA 1FP1D 4TQDA 4YCVA 2IY5A 4N0AA 2E1HA 2QUFA 3B73A 5E1XA 4ZYDA 4M78C 5LJ3e 4MQ9F 2P8TA 4Y17A 2HNIA 2XKPA 5GMKm 4P72C 4M75G 1IN8A 2VOPA 3REXA 1XSVA 3M9AA 4C92A 1IN6A 2RD1A 1X2GA 4WX9A 1FT9A 1O3TA 1GHCA 4M77A 4WXDA 2OAZA 3R0AA 4J6YA 4K87A 5LLQA 3HSEA 1U5TA 4ZIBA 4K2EA 1X2HA 3SQNA 3L1AA 3ELKA 1NJ6A 4EGYA 1MDMB 3DQVC 3W6KB 3GFLA 3FMQA 1E2XA 1WSUA 3A7AA 2DU9A
chains in the Genus database with same CATH superfamily
4Y13A 2IS1A 2KBTA 2VT2A 4XK4A 2DF6A 1UFMA 3HL8A 4DEYA 3HGGA 3BTCA 4OB0B 3Q5FA 4JRPA 1UB4A 1D1CA 4RLQA 2EZIA 1WXTA 3HPGA 2RHQB 4N4IA 3VDXA 4GO1A 5JHUA 2VYTA 4E7LA 1ZN2A 2ZTGA 4F7UB 1YGBA 2DX1A 2M4GA 2Y9ZA 2IGOA 1ZHFA 1B1BA 4A3BJ 3P5JA 3B6AA 3BLYA 3ME9A 4ZZLA 5FU7C 3OB9A 4HW0A 4OIRF 2CFXA 2DILA 2FQ4A 4EJUA 4M7AD 1JJ2S 4H2XA 2DMQA 1ZHIA 4M6YA 4MHGA 3M9QA 2NNNA 4J19A 2H3JA 1ZKGA 3JB9I 1ZH5A 3CCQQ 5DTDA 1K0SA 1BI2A 2X6YA 1VQ5A 3SWNA 2X4HA 3H3VK 2VUBA 2UV1A 2KROA 4OMZA 2M2EA 1RRJA 4DPGA 1VQKQ 3VSLA 1WQ7A 4RG2A 1X75C 2MA3A 4KITB 2ZT6A 2KMUA 3MEWA 2AO9A 2HL3A 3I55A 1LJ9A 3PMTA 3GOXA 5ERIA 1ZA1B 1QKWA 2LJ3A 2P81A 3I7FA 2M0OA 1BR1A 4HAMA 3O2PE 4QVCA 4YRPA 1VUBA 4AYBN 1T0HA 1X1DA 2KRCA 2E19A 3JCMJ 2MI6A 3R0JA 3D5LA 1Z77A 4C0FA 4OU0A 4OLFA 2RPNA 1TOVA 2JS2A 4M75D 2I5UA 3FM3A 3ULQB 5IXBA 4B3AA 1A36A 3CQTA 1X19A 2VE9A 3V8KA 4A3KJ 1SRMA 4OF1A 2PVOB 3S16J 2BUDA 3DEUA 1REPC 3PUBA 2QEXI 3CD6Q 3WGGA 4V2SA 1VQOQ 2A3LA 3JB9J 4IPAA 2KDZA 2RHUA 1QBJA 3QPLA 1DPUA 3E9IA 2DMNA 5EG0B 3O8HA 4E7JA 2CG4A 3QQAA 2Y75A 2BE7D 4FETA 1BOAA 3G6EI 3FIFA 4ANJA 3PGGA 1ITYA 3A4CA 1QF6A 2O6GE 3HG9A 6PAXA 2HTJA 3FXUA 4IRHA 3QDFA 2VC8A 2K2VA 2VXZA 4N9HA 3EHRA 3CCST 4P9UA 1UMQA 1RPWA 5CKEA 1UJ0A 4A63B 4S05A 1YJNQ 1VQLA 3A32A 1EFWA 2JUCA 3M1CA 1IB8A 2EGEA 2L2PA 1FEXA 2EV0A 1T08B 2QWWA 3FF5A 4RTZA 3LSMA 4FE4A 1PSFA 2CS3A 3DBLB 1CQTA 1X43A 4JX4A 1K4SA 4R0KA 1M30A 1N5ZA 3KEOA 2GA2A 2A36A 4J9CA 3RR6A 1QVGA 1KQ0A 4IJAA 3ABKH 4E2FB 1S3JA 2CGHA 4A2UA 3MF1A 4OGEA 2JW4A 3MKYB 3WODF 4G6TB 2C8MA 3LA2A 4KNYA 3GCMA 2DPDA 3QHSA 4KT5C 2E2JJ 3RMQA 1Y1VJ 1ZTRA 4L9VA 1GL5A 5TRDA 2KK4A 4RTYA 4XLHA 2LJ1A 3EG0A 3TREA 5GAN7 3JCMX 2J5PA 4EM2A 1Y0UA 5GAN2 1B70B 3CCVI 4IHVA 5J40A 3QYGB 4NL3A 2HFHA 3C4SA 3LNQA 1QW1A 2ZBKA 2HU9A 3BTLA 4ZTJA 1N8RR 1MGTA 4II1A 2DE0X 3DV8A 2WA0A 3VQYA 1WHGA 4LNSA 2KJCA 1PP8F 1RKWA 2KR3A 3LH0A 4ORZA 2CSQA 5EC7A 4TVAB 3QP6A 4I6ZA 2NXNB 1K7AA 1IL2A 4Z2YA 3KFVA 1RADB 3H41A 1D5VA 2AHQA 2GXBA 2YPRA 3S1NJ 2R7FA 4XQ3A 1E6GA 5C52B 2DEQA 3TEDA 4F3QA 2LK2A 3QOEA 3ZN1A 2NS8A 4XORA 3OMGA 3UNGC 1QQIA 3X28B 4KH1B 3FHZA 2A6HF 4BY6C 4JDSA 4BWAA 5CKFA 2ZMEA 1B76A 5DEQA 3RJPA 2E71A 3DLAA 1BR2A 4TVWA 2V6EA 4JRIA 3ZOBA 5GAN4 5LJ5j 1Y96A 1XNIA 3CCET 2XAJA 5CVIA 3S93A 5C0MA 3K2AA 3NTKA 5CAIA 1QVGS 1JEGA 3KP5A 2HZYA 3CXCS 2NVYJ 3DFGA 1YS7A 3AG1H 3ZQ7A 1CKAA 4AFQC 2Q8KA 3K1MA 2ZINA 2BOLA 4IRGA 2ZNZA 2M1BA 2DNUA 3A02A 3EETA 2K3YA 1IDYA 3KUFA 4XU2A 3BG3A 2COMA 2FUG2 1VQMI 2QYZA 3OA6A 4KT6A 1UJ8A 2BY0A 3GBGA 1U5TB 1QVTA 4BGDA 2BY1A 1VQ6I 3T0YA 4UP8A 2XGEA 2VKVA 5GANd 5FKKA 3N97A 2ISYA 2CW7A 1R8OB 3QYFA 4Q4ZF 3SEZA 1PRLC 1TT5B 2KT0A 2LQNA 4XRSG 5L3BA 2WBMA 4KR2A 3BR0A 4QW2A 4XLCA 5KYWB 2VLAA 1JUPA 4X1VA 5B3SH 2J5OA 1BU1A 2F5VA 2PQ8A 3GTOJ 1K8AR 2EJFA 1SMYF 4M78A 1KD1C 4M77G 2JTFA 4MTEA 2KIUA 5EEGA 3A8MB 2L3DA 1WI9A 3KP3A 1SFEA 2XMFA 3C2HA 5F0CA 2QSFX 3FIWA 4H2XB 2XD0A 1Y71A 2RREA 5B5EC 4M7DG 4NS5A 2VBWA 1Y07A 1M90U 1FSEA 2HYJA 2JTEA 2EWNA 1JXMA 3QJ6A 2VUMJ 4PJOA 1NPPA 3QO7A 2PUOB 4J9BA 4C3IJ 3CO7C 1V29B 3J7ZI 2HDWA 1K0XA 4MZTA 4FTHA 4HSRA 2LC4A 1TNTA 4GCVA 4M73A 3LQQA 4M3GA 2XASA 3H9GA 1JU5C 2XF7A 4CXFA 4ITVA 3I55I 3JCUC 4G6QA 3HKZN 1EKEA 4DYRA 1YHQI 4XEMA 3VS5A 3ONQA 3IKLA 2PMEA 3TU4K 5AT1B 1OX8A 1K61A 2IJLA 2PTKA 4PJLA 3RKQA 4YPFA 3DPTA 2VN2A 5JLXA 2EK5A 2OCEA 4HQMA 3JRCA 2K6DA 1H4SA 5J8FA 4DQ2A 2MMPA 1XPXA 2QSHX 3T1BA 4LK0F 2J7IA 1D3BA 4UVBA 1NK2P 2YU3A 4HWSA 3IRRA 1W70A 8AT1B 4XTYA 2PMHA 4LB5A 1JRIA 5LEKA 2CYZB 3PQKA 4YYEA 2E10A 2DMPA 1KC8U 2CRGA 1ORKA 1Z9CA 2FRWA 2F5FA 2LVSA 1ADYA 4LB6B 2JSCA 2V1UA 1SPKA 2YUNA 1NBEB 2EYYA 3VRZA 4DGWB 3KEQA 2HBWA 4JJBA 3EUHC 3FK7A 2N8GA 4Y52J 3OYIA 2E2HJ 2RVCA 2VKHA 1RKTA 2HQXA 2XGCA 3LSHA 1Y39A 1SD5A 1E7OA 4C3JJ 3GTPJ 2RQPA 3ZR8X 1N9SA 3OL3A 4HKEA 2RQUA 3LX7A 3F6VA 2O61A 2ZJ2A 1U9OA 2M7AA 3M54A 4XU1A 2HL5C 2ZKZA 1V55H 5FKOA 3HRTA 2E12A 1VQLI 1BK2A 1ETOA 3RDVA 5KYNA 1KHCA 2KRSA 2HPIA 5LJ3j 1CSKA 3DLLF 2NAZA 2CJJA 3HEFA 2J6FA 5KCHA 2V1QA 1N75A 1KJWA 1YIJA 2RI3A 4CICA 2VASA 5GAMh 4Z6YA 4EV0A 2NLUA 1XGOA 3ASKA 2QHVA 2TDXA 3GYHX 3H0DA 1K73C 4XR6A 3A1PA 2IW5A 3VFZA 3CJRB 1VQ7Q 5C53B 3CUOA 4MGRA 3A03A 5CQGA 3CQZJ 2L7ZA 2RNGA 3Q3SA 1DDNA 2BY2A 2GBYA 5IXFA 1KIKA 5IP6A 5LGUA 3I4MJ 3PVLA 3FWEA 2EFIA 2ZPGB 2XU8A 2M02A 1BC7C 1OMIA 3JSPA 4YRTA 4Q6GA 2DL8A 2F2XA 5M5XJ 2GGRA 3KFWX 4FM4B 3QWYA 2DK5A 5GMKe 3HKZA 4PJNA 2CQXA 4HCKA 3ERMA 4ZH4F 3D5RC 1XB4A 4RDXA 1HSQA 3KLOA 2BBYA 2MC4A 3W3CA 1NYFA 3MCZA 5GAMf 2Z5UA 4HA8A 4LLNA 2R4GA 3HSBA 4P1WA 1N27A 5IT3A 4S04A 1DU0A 2EBPA 2ZT7A 3RQIA 1E6HA 5F5WA 3LOCA 4OINF 5IOYA 3CCMI 1Z91A 4ME7A 1YLFA 5CVJA 4XKWA 3CC4A 4L18B 3IH2A 3QKJA 3I5UA 1W6XA 4A5NA 3H0IA 3QZ5B 2HOEA 1NH3A 1IO2A 3OY9A 2MLKA 3BC8A 3U1KA 1SVMA 3RPUA 3DPLC 3DB3A 2W24A 1QO0D 2JS0A 2Q5HA 2VQLA 3MJXA 2X85A 2G9WA 1Y96B 2ZCEA 2ID6A 2OBPA 4U87A 1SVOA 3CC2I 3JRDA 3N5BB 1N9WA 4NC6A 3MD2A 5GTIC 2R3SA 2XC7A 1ETXA 1ASYA 1AZGB 1QE0A 3CMYA 3A1YA 1ZELA 2DL7A 2EV5A 1FOXA 2JT4A 4O3MA 2VT3A 3KP6A 2CW8A 3IL2A 1GCPA 2CSOA 3KIOA 3PO3J 1A04A 1RL2A 3A8HB 3PTAA 2GIZA 4E70A 3HZJA 1WI7A 2ROTA 1I5ZA 2X35A 3BT9A 4HPQA 1Q82C 1S72A 5FO5A 4ESFA 3MZ8A 1TUCA 1YW8A 1VOMA 2OI3A 3GP8A 4JOMA 3FEOA 3ZMVA 1AT1B 4PKCC 1TWGJ 3UA6A 2RI5A 3HJEA 4MNUA 4N0BA 2LTOA 5IP9J 4LLLA 3FBIB 1Z9QA 1K9MU 2DQRA 4MDWA 3QRFF 1ZARA 3BJAA 2YSRA 4RTUA 3C3WA 4AM3A 1IXSB 2IAIA 4QPOA 3HXLA 2M16A 4OB2B 3WTVC 2XDDA 2L02A 1I1SA 1YI2A 2VQHA 2CDTA 3LSQA 2IGNA 5GAOn 4DEXA 4KMUX 3FJ5A 1Z7NA 4XU3A 4NNJA 2P0LA 1ACIA 5C3EJ 2FQ3A 2LKSA 4AIHA 1OCTC 2LDMA 4LK1F 4DIQA 3REOA 5D6YA 4PJOB 2PU9B 1X1CA 2DFFA 4OVAA 4L9JA 2KY9A 4E4HA 4KFCA 3KZIC 2NVTJ 1DU6A 1B8IA 4BQOA 4D5FA 1VQ4T 2KZGA 3AAFA 3N4MA 3HXYA 1HXDA 4YRNA 1EH6A 3E7LA 1AWOA 1UGPB 4BQQA 1NYQA 3SWNC 3HKSA 4ZGEB 1E3OC 3EH2A 2EPDA 3FXRA 1YCSB 1WVRA 4YIRX 2OTLQ 1FYLA 2DL4A 4PJ0C 1D1AA 4LUDA 2R7ZJ 5CYVA 3BDLA 4ZYEA 2UZKA 2NS6A 2X9DA 4ZYHA 2QYOA 2XAUA 3HRSA 3D0SA 5FJ8J 1O9SA 2KT1A 2GOXB 2XGDA 4G85A 3X20B 3G1ZA 4AFSC 3EFOA 2M30A 1D3BB 4P9FA 5GMKi 3M4OJ 1SVLA 4J9EA 1LNWA 3CCYA 2IRFG 3MQZA 1SD4A 1M1FA 1TNSA 2DVJA 2E3IA 4IRIA 4M7AF 2BHZA 4OOIA 2RH2A 3MP8A 2P5VA 2XB5A 2DK3A 3MEAA 5D5UB 3MFKA 5GANj 3WU0A 5AIQA 1IZ6A 4PGGA 4I02A 3MEXA 2VVKA 3GF5A 2CIMA 1T33A 3FXQA 3ZMTA 2CO5A 3NWSA 1R77A 1YJ9Q 2C0TA 3NENA 3SYTA 2VXFA 2I4LA 3P8BB 3CCEQ 1B9MA 2K9GA 3BG5A 3K70C 4PLIA 3CMAT 4AU7A 2M7BA 1WLEA 1EIYB 4IURA 2CJAA 1PKSA 2CGPA 4LLGF 2Y4XA 3Q0UA 2KRMA 4KULA 4HWTA 2XB0X 2YX7A 4M75F 1UB9A 1YIJI 1AEYA 2E5ZA 3ICAA 1Z6TA 2QGGA 1YW7A 4LD9K 3HSFA 4HNUA 3LLRA 5ICGA 4A5MA 2HDCA 3ASOH 1LCKA 4LG0B 2QA4A 4VUBA 3NFCA 4L9NA 2QQRA 2F5CA 4LVJA 2J3LA 4UY8I 4OMFB 3GF2A 1Q7YU 2X4JA 4C0DB 4XN3A 1LEBA 1GFCA 3OYBA 1SD6A 4M78E 1G5HA 5I2MA 2HS5A 2L9SA 4PJOD 5K7ZA 1KU3A 3QDRB 3I5RA 1MBFA 3H5AA 3MKZA 4GLMA 2ZJQF 4CHUA 2QEXT 1D8JA 4BEHB 2ZO4A 4XKCA 4XK8E 5HLHA 3F8FA 1SAXA 3H35A 2O2OA 1ETWA 2FBIA 1KU7A 3FDRA 2JOYA 3BROA 2W48A 1RAAB 5E3LA 2RQVA 5K5QA 4G6DA 4NB5A 4RB0A 4J00A 3MO8A 1QVUA 4EMKB 2OTJT 1IJWC 2HNHA 3EPZA 3CC4I 2X3WD 1HSJA 4F7UF 5E3OA 2XI9A 1E17A 2DU7A 2X6OA 5BNGA 3OR1C 3K4CA 3SB2A 1OI1A 1W0UA 2OZ6A 3OYFA 1RAHB 3S32A 3WHCA 2LVMA 5E8IA 4EX5A 3UH0A 2G0EA 4LN2A 5C4XJ 3CLOA 2FBKA 1WWXA 2KQRA 4P74A 2HWVA 1LJOA 1OCRH 1KHIA 3WU1B 3IAM2 1TU0B 3CTAA 5F08A 4OMLA 2DODA 4DNCA 1UE9A 1U06A 5D6FA 1VYTA 4OIPF 2ZMEC 1W5CC 2HKOA 4BNCA 3G71I 3VRYA 3QO8A 2NWMA 2NYSA 3VU3C 1R1VA 1P2FA 1JB0E 2IPOB 2DFUA 1SEMA 3LSIA 1AHDP 2KISA 5CKBA 5KCMA 1HKQA 5KHDA 2XV4S 1QMCA 1LNXA 1JGSA 4IF4A 3J7AF 2OCCH 2AQFA 2F6CA 3CD6A 1YJWA 3KP4A 4E6KG 2J05A 4CCMA 1D09B 5CQYA 3QYHB 2RI2A 3HHHA 1S72I 1R36A 1P7JA 1EIFA 2HKNA 3MKLA 3GUDA 1S29A 1P4AA 1YX5A 4DJAA 2YSQA 4IUVA 3CUQC 1WDXA 1MJBA 3EYIA 1BA5A 4Q15A 2ZNIA 1TQIA 3CPFA 2FO0A 3Q0VA 3PL8A 2K5CA 3P8YA 2GWRA 1I39A 3S3MA 2YUQA 4CC7A 5D4SA 2SRCA 3OW2P 1R71A 4JBAA 1ZR4A 1W36D 4RAYA 2DDAA 5BQTA 3BZCA 2QHUA 4L5IA 5I2SA 3HBLA 2JNGA 1JKPC 3GPLA 1AD5A 2EFNA 4F52A 2VL8A 4C92B 2MIOA 2E1CA 4I76A 4ZDLA 2YRVA 5GPCA 1K78A 2ODRD 1YI2I 4LUEA 1OQKA 2ELHA 4XRSA 5GMKl 4JJNK 1VF9A 4YCVA 1YP5A 2E1HA 2HD0A 3B73A 2MD0A 4M78C 2EKHA 5GMKm 2HNIA 1TXQA 1EZZB 1IN8A 4J83A 2VOPA 1ABQA 1XSVA 4NDLA 2Z16A 1VQPQ 2BZXA 5HODA 1X2GA 1O3TA 5J1YA 2RHXA 3CCUA 1GHCA 4M77A 4WXDA 4B9WA 4J6YA 4K87A 5LLQA 1OX9A 2CH4W 3GFLA 3DEEA 1X2QA 3G1MA 3A7AA 3OS0A 2LCCA 3OR2C 3PIOF 2DU9A 3MP1A 4PGHA 3IKTA 4E7SA 2HZTA 3CCRQ 3I5SA 4F92B 2ZXIA 4BW9A 4G84A 3L00A 2QENA 4ON0A 1H3ZA 1X1PA 5D5VB 5HVQC 3PT9A 3CMET 1LE8A 2L2OA 2LQWA 2GOMA 1ZYRF 3TSZA 4ESJA 2WTEA 3S1RJ 3RIRA 4KN4X 1VQ9Q 3Q9VA 2JUFA 4XKBA 4LDUA 2OUMA 5KVRA 3RYRA 3EFOB 2DFHA 2R92J 4E7ZA 1VQNA 4LFUA 1QCNA 4HT9A 1RUNA 2DPUA 4JPBW 3PNVA 4KDPA 2V26A 3T9NA 3S1QJ 1KMMA 2QQAA 2JK3A 3QXEB 1R58A 2XGTA 4JX5A 1LKXA 2HQRA 1TWAJ 3H0GJ 1YG2A 2PMUA 1N8RU 1KU2A 2K3FA 1XC5A 2LRQA 3GFMA 2PNIA 4FYWB 1XTAA 1RZ4A 3OIQA 5IYDJ 2O8XA 1MMAA 4PDKA 2M0CA 1MV3A 3CCJI 1U1TA 4CC2A 2LP5A 4AIDA 4J01A 3T5XA 4P5OA 4DOZA 2BZ8A 3HRMA 2GIVA 4IX7A 4P73C 3QPTA 2GF7A 3OSSC 2EYWA 3AFHA 3LWIA 2ZR3A 2A7YA 4HYEA 3DP7A 3BZKA 3CDIA 2E1OA 1FTTA 3RCOA 4XOTA 1I8FA 4ESRA 1F4KA 4XM3A 2K57A 1W7PA 2RQQA 3LA7A 1FY7A 3RKYA 2RN8A 1TQMA 3V7CA 2AT1B 2E5QA 1VQ8Q 4M3DA 2KYMA 1NYRA 3VKIA 3CCLA 5ECAA 4B3XA 2QLZA 2LBFA 2GTOA 2DJIA 5E79C 2L7MP 1PP7U 1OEBA 2RF0A 3LFKA 5JI6A 1YHQT 4RS8A 4TTVA 1K4TA 1B3QA 3E6CC 1PG5B 3QAHA 1SFOJ 3G4SI 2JSPA 1N8RC 1ETKA 1BR4A 3QYBA 4Q47A 4D7MA 1OPKA 5IT9E 1JUMA 2DMTA 1ZG3A 1LFPA 2XDVA 1JGGA 1S9HA 1FC3A 4C92D 4RQFA 3JW4A 5IHNA 2QA4I 2K27A 2BHYA 4WI1A 2CV0A 3MPUB 4D1QA 1TLHB 2OJED 3C1DA 4GDFA 5GTHC 1YFSA 3KYDB 4BD3A 2FPFA 2X1CA 4RGXA 3TP0A 2D5VA 3UWNA 1SMTA 3M1EA 3MMYB 1U5SA 2PMFA 1PYSB 1FBSA 5CJ9A 1ZUUA 4AIKA 2JTMA 1ZSZB 4A3MJ 1TWHJ 2YHTA 3GFIA 4LDXA 1BIAA 3CZ6A 1V5FA 1SC7A 1B9NA 1Q86C 1K8AU 2ZCFB 4M4ZA 2HXIA 4A4KA 5FU6C 3A98A 1RI0A 2E41A 4G7OF 5IT9Z 1VA7A 1HF0A 3P8TA 4LVLA 3A8OB 3ZBDA 3BQYA 2Y2ZA 1MH3A 2RGVA 4GBQA 5EZGA 4ESBA 1X6GA 2JT1A 2LC2A 4QKUA 2DD4A 1UUEA 2F2VA 2LX7A 2Z33A 3C95A 1JKRC 1XTDA 5LEJA 2KXCA 2ZPHB 1FBQA 3A74A 3A8LB 4ZDPA 5CO7A 1GGMA 2KJBA 1MNMC 2HQ5A 3RSNA 3DSQA 3WE2A 5A0GA 4X34A 1UELB 2MH9A 1FP2A 1FXXA 4CRIA 5LGTA 2LT4A 3JCMP 1UECA 3VYGA 2QG9B 2R5ZA 3HRKA 4IQ4A 1IRFA 2IA0A 1QPIA 2O9SA 2CU7A 4QT7A 1Q95G 3ZFJA 1OR7A 1UGVA 1K83J 1SD7A 3JCMQ 1HK9A 2M9UA 3HOWJ 4ZTUB 2QBYA 2DL5A 3CCQT 2CT3A 5BPIA 1YJWI 1TL8A 3JTGA 4A0ZA 4IHTA 1MJ9A 1W5SA 1QCFA 2DOAA 2YUSA 1VQKT 3W3SA 2P4WA 4UB6C 1BB9A 2EH3A 3P9IA 1YFHA 5J3BA 3RERA 4HCZA 4M7AG 4FT4A 3MQ0A 3M58A 3MZYA 4CCKA 1ODDA 2LDUA 3RPQA 2FYKA 2D9TA 2M8EA 1WI3A 2R5MA 4I7HA 2NYXA 3CPWP 4B09A 4XKVA 5ICCA 3AG3H 3CCMT 2A6EF 2LD5A 1J9IA 4U0WA 3M0PA 3V4GA 3SZGA 4X0GA 3RL6A 2O31A 1D8KA 1K78B 4KGXB 5C4JJ 4HZFA 4F04B 4HWPA 4N9IA 3FXKA 3FISA 1O3RA 1FIPA 1PUFA 3TL4X 4M9ZA 4YRFA 4A6DA 2JVGA 3E5QA 3ROUA 2D0QB 5E3MA 1FYKA 1UG0A 4YROA 4H4KC 3RKWA 1I3QJ 5LJ3h 2WAEA 1VQOT 4M77B 2HR3A 3CCUI 3E9HA 1RI7A 3J81E 3C2GA 3SEMA 2Y0MA 3CC7I 4OIQF 2GM4A 2WY8Q 1PSEA 3CC2T 2BGCA 1YCYA 4XTZA 4BJ6C 2DTRA 2K02A 5HOOA 5CKTA 3UR3C 4M7DB 3BE3A 2MF2A 4M74A 2Z1DA 3F0CA 4DZJA 1ZLJA 1TWBA 3K4BA 1WPKA 1X2MA 5J1RA 3HHTB 2Q2EA 3FKJA 5LJ5g 1GCQA 3BR5A 4UV9A 3LWFA 4LGWA 2QEXQ 5GAMj 3I3LA 3ULRB 2YWWA 2CREA 5H20A 3FX3A 3JCMh 2JA5J 4QPQA 3I54A 5D5XB 1YNZA 1YJNT 1O75A 4RB3C 1WQ2A 2CQQA 4P72A 2EZHA 3C7JA 3G6EQ 1IN5A 4C30A 1VQNI 1HDDC 2DRKA 4BY1J 3LWHA 2LH9A 4XMYA 2VQGA 2LSOA 1YFNA 2LCLA 2DTOA 3J81Z 2FEIA 2GCXA 3E6MA 1PKTA 4DBQA 4M78G 3HY0A 1YITI 4H2WA 3OSGA 3GTKJ 4MO7A 4QQGA 4WCIA 1UGSB 4ZJZA 2HSPA 2A3SA 1WZOA 2DFIA 2V9PA 2YDLA 1TTYA 4WJ3M 2LNVA 3NEUA 1H88C 2R5YB 3FHNA 2LP0A 1WH5A 5FU7B 1USYA 3ZMZA 4E7IA 2ELKA 1LYLA 1V1CA 2COYA 2L3SA 2YX4A 3KZZA 4F93B 4F7UG 1RAFB 2IIMA 3EGUA 3MKDA 3JCMf 1UGRB 1A5JA 1XMKA 4MEXF 2OU2A 4CCJA 1Z6RA 3I56I 3DF8A 3IQLA 1KQ9A 2H94A 1T8IA 3X24B 2GTJA 4KGZB 4PLLA 4HCCA 2P4RA 1LFBA 2L3QA 1M9SA 2DYRH 4NL2A 5EGOA 3CCLI 1SETA 4YRRA 3M7GA 3IP4B 2KP6A 2NUPA 1I0CA 4UUVA 4KRTA 4H2YA 2EZLA 1ZRDA 2K5FA 1AHJB 2BE5F 3CCVQ 1WX6A 2X48A 1X6BA 5E20A 5FROA 1MJAA 3R6OA 2ZIOA 2ECBA 1NEBA 1ZR2A 5FLXE 3A5ZB 2X6WA 3NHNA 1C1AA 1QWFA 2LMDA 3M56A 4QLCU 4X9CA 3GXOA 2FZGB 3OBWA 3CCSA 1Y0MA 4K86A 2YUPA 3WTTC 3S15J 2Z99A 3TMOA 4MZPA 2JMCA 1E1TA 1FOWA 5BOXA 4B44A 2FOKA 3ZN0A 4HF0A 4LDWA 1EVKA 1M27C 1BL0A 4P3OA 2IXSA 4DBHA 4M7DD 1CKBA 4E6RA 3EUHA 3PNYA 2R5AA 4ABZA 5A2QE 1H92A 4M77E 5FLMJ 1IAWA 4AFZC 4C0GA 3OYYA 2VWFA 1W4MA 1XGNA 3GTLJ 3P9KA 4C3HJ 2OJ2A 1M1GA 5FLXZ 4YTLA 2UXXA 2DMOA 2FMLA 2D1VA 2GFUA 4RG8A 4PK4A 4EQQA 4UUSA 2LFBA 3PFIA 3JTHA 5JLWA 4CYCA 3IRQA 1IZ1A 5AONA 1NK3P 1M1KC 2L7KA 2KL4A 4BU2A 2LT1A 4DZPA 3BCBA 5LJ5d 1VQMQ 1BW6A 3LFUA 2L4AA 4G9YA 5CVVA 2ZT8A 2R93J 3M8FA 2XAFA 3BR3A 4R1HA 1ON2A 3L1PA 1VQ6Q 3FXJA 4B1RA 2HVRA 1KQSA 1ZQ1A 4ZGJB 4PFOA 2CP7A 3VS3A 1BN5A 2E2IJ 2ZCWA 5A2QZ 2R5ZB 5LJ3g 3WTYC 3F8CA 1GV2A 2CT4A 4IOCF 3ZGKA 4ZZDA 3PO2J 2FA5A 2NNYA 4M72A 1BJAA 3DKXA 2F1LA 1WGXA 1RAEB 1SSFA 2QBYB 3DU6A 4AFUC 2L9NA 3FXOA 4YCWA 2H6CA 2IS2A 3M5AA 3VS2A 1E3PA 3KYLA 4M6VA 5E3NA 1WJ5A 1Q81C 1ZRFA 2OD5A 2P4TA 3HTZA 3IWZA 1IV6A 1AWWA 3TGNA 2K86A 5LHGA 3T8TA 5HLGA 2DI3A 3HDDA 1ETVA 2P0KA 1JQQA 4KIBA 4B6MA 3KP7A 2MWPA 3QPSA 3GBQA 2BE9B 1HKTA 4OB1B 2EFQA 1CGPA 5GJVB 3CCEA 2QI2A 5LRSA 5GANe 4IIOA 3RI4A 3U9GA 3FK6A 1XD7A 5BMZA 2HYGD 1M5Q1 1TP4A 1Y8RB 1LQ1A 3IALA 4PL6A 4Q5SF 4A3GJ 2QF7A 5ELNA 4CO8A 3AL0C 1M2VA 4IHYA 2K7AA 3OMYA 4MZMA 3L09A 2Q7GA 4J9FA 3I55Q 1PUFB 4RB1A 1YHQQ 4E7KA 1IREB 4BY6B 2XPVA 2AKLA 5TGTA 2TCTA 3EGXA 2RHZA 3BG9A 1MBKA 1I5OB 4HOBA 2DLLA 1KFZA 4YELA 2MCNA 3VYUB 1KQSS 1A6QA 3SHWA 4YRQA 3G71T 3CDHA 1WKMA 5DLOA 2HVQA 5I21A 3E5XA 4HLYA 4GFBA 4M77C 1S7EA 2Z9OA 3PJRA 4DYQA 5B1AH 4CS4A 1LDKB 5CCAA 5IHKA 2IGMA 1D3YA 1Q1HA 5ELOA 1KYZA 3NEMA 2XRLA 2GBQA 5FW9A 8ATCB 4I09A 2Q1ZB 4EMGA 3DLLA 2JRMA 2X4XA 1WHHA 4LD6A 3ECOA 3Q0WA 2DIQA 4IUUA 1WJFA 2V79A 2PZ1A 2BZYA 1YN8A 3EAEA 1OISA 3TDUC 2CSIA 2HDAA 3I59B 3TW7A 2P0QA 5FWBA 2Y9YA 2BW3A 2BVLA 4XLPF 1R49A 2CMPA 4XL9A 3TO9A 4RKUE 6AT1B 2DJNA 5C44J 2IEKA 2LOOA 2V9VA 1W5TA 3C18A 3VUBA 3J80K 2CZ1B 3ZQIA 2OAWA 1BI0A 1VQ7T 1OPLA 2QKLB 2PI0A 3CESA 1R7JA 4XRFA 1VQLQ 4M6XA 3OYKA 3DBRB 2E1MC 2JMWA 2CP5A 1XGMA 3CXCP 2W0ZA 4FHTA 3ZEHA 1RABB 1KQ1A 5KNLA 1MHNA 5CPRB 1R0CB 2Q0OA 3HFZB 5CVUA 1SERA 1TSFA 3U21A 2HSEB 2P7CB 2YLBA 1RLPC 5FGMA 2KI7A 4XLNF 2DA7A 4D6WA 4R79A 5LJ3d 2NVXJ 3DTIA 3BFMA 2AMCA 2JUGA 2FBHA 3BY7A 2O0YA 4KYWA 2MABA 3HXZA 2E5AA 3OD1A 3RYPA 2M3AA 2KQWA 4KGVB 1ETQA 5IY5H 2AXLA 4P75A 5HCKA 3GTJJ 2EILH 2LJ0A 2F4MB 3A5YA 3CF2A 2ICWG 5J47A 1FYFA 2MGQA 2FB7A 3GZ5A 1WJSA 2K9LA 2EIMH 4H2VA 2F2WA 2CZ0B 2DT7B 4XLAA 5KAIC 4E51A 2V8JA 3R4KA 1O4XA 1RIQA 3IKMB 1STZA 2RHSB 3QZ9B 1CF7A 3FKIJ 3CCSI 3HFNA 1VFCA 1RI9A 3RNJA 1G59A 2CP6A 4JLGA 3CCMQ 1B7YA 2VQCA 1QHGA 3EUAA 1B4AA 2PEXA 1A35A 2AIRB 2UXNA 1M3CA 1KD1R 2GLOA 2H27A 1P4WA 3PQJA 1AOYA 5IYCJ 1Z7LA 2V1RA 3CCJT 4OMYA 2FRHA 5AYFA 3U1DA 3ZCOA 3OOUA 2WACA 3EGDA 3A01B 1ZBJA 5GANg 2DA3A 1C0WA 2H3EB 2DXCA 3CC2Q 3HP9A 3KLNA 1S7OA 2F5DA 2QDLA 2MC3A 2LZ6B 2CV2A 4YIFA 3UFGA 4XAXB 4CYCB 1D5YA 3FB9A 2ZXFA 4C92F 3E9GA 3WU2C 1T38A 3M8JA 1GRIA 2QDYB 1MKMA 1A0NB 3VJPA 4KR3A 3VYRB 3O5ZA 1JXSA 1FOYA 1VQZA 1WA7A 4OMNA 3E9FA 4R8HA 4HQEA 3E5UA 4LJZF 3S8PA 4AUXA 3HIFA 2O3FA 3G4ST 3EFSA 2ABLA 1IHVA 1QU3A 5B66C 4FU6A 1MZBA 2L9VA 2YS9A 4BQAA 1R1UA 5DCMA 1NM7A 3PZCA 1FYNA 2PUKB 1Z3YA 1T56A 1GV5A 4HVUA 3JCMW 2A5YB 1SHGA 2GQQA 5CKHA 2VC0A 4FISA 4P3PA 1LPLA 3S3OA 2QAZA 4I98B 1XG1A 2P0WA 3OYNA 1OR7C 1M8MA 3TO6A 2HCKA 1FSHA 4CH6A 3ZPLA 3JSCA 4PHCA 2V4JC 4HEA2 3PFSA 2DMUA 2K5IA 4JS5A 3W2VA 3JB9D 2OTLT 5M5WJ 2KRNA 1H3HA 5FWCA 2W25A 1NJIR 3LSRA 4RAZA 4YFNF 2EA4A 4AYBA 5KYXB 3W6VA 2YXYA 3TEHA 4Y4RA 2DRMA 4U88A 3JRBA 4WXHA 1HOMA 4XRMA 2VXEA 4M7AA 2HPMA 5FRNA 4LDVA 3ZQFA 3PMIA 2EPFA 5E17F 4IZZA 4W1UA 1QCOA 4IKFA 2NUTA 2IVWA 5K7FA 2WB1N 4AVZA 2AKWA 2EL9A 2WSEE 2XSJC 2B7EA 3UF4A 3OWTA 1JE8A 4DW6A 1IC8A 2QTVA 2EB7A 3HOTA 2FX0A 2F4OB 4A4GA 1DJ7B 3JREA 1YJ9T 4EM1A 2F69A 4CC3A 1XDUA 1R6RA 1GDTA 4K88A 2HOTA 1QP3A 3VYHB 3WE3A 2V1DA 1BOBA 2R7QA 4XLFA 2K4YA 2KT8A 1J5WA 2AZSA 2VJIA 4O2DA 3ZQLA 2VJ5A 1TWFJ 3CLQA 1R5ID 2ZAEA 3H9QA 4M75A 3HFVA 3M57A 1WNLA 1GCQC 2WADA 3SJMA 1JJCA 1NEGA 3LAPA 4F14A 1LVKA 4D8KA 4ETSA 4Y28E 1YOVB 3UPUA 1B34A 3CUQA 3FBNB 3K10A 2LREA 2IY5A 4N0AA 4ZYDA 2ZPEB 4P72C 2P8TA 4ZTFA 2VPRA 3IUOA 1VQ4A 1OCOH 2X4WA 1JJ8C 2PX9A 4W97A 1IN6A 2CUEA 1FT9A 3PIPF 2OAZA 3DKMA 3R0AA 1ZQ3P 3HSEA 4ZIBA 4ATOA 3QYEA 3SQNA 3L1AA 4EGYA 1GBQA 3FMQA 3D7SB 2NOGA 3H0FA 3HTRA 1J09A 1YIJQ 5EF6A 2H09A 1XMAA 5L3FA 2VE8A 3PM1A 2J6KA 4CZCA 4FT2A 2RQTA 1AKHA 1USYC 1MDMA 4LMYA 2ZGWA 1NLOC 3CC7T 2VC1A 1IDZA 2M51A 2AMCB 3X26B 1L3LA 4BJ5C 2VPLA 2A05A 3SWNB 1VQ5I 2RHQA 3CP8A 3F23A 1VI0A 4F7UA 5GAN5 3URGA 4Y91A 4Q5WA 4WJ4A 1V5EA 4XQFA 3JRIA 4QWQA 3GO5A 4ENMA 1PD1A 1TG0A 1Q82R 1EV7A 2BZTA 3QUIA 4HWRA 1TWCJ 3OYEA 3DB4A 2RV8A 4H02A 4MFEA 2GFAA 5H6QA 1DP3A 3JAMK 3RMSA 1IGUA 3CMAA 1MGQA 2ZZFA 4AH6A 1L0OC 4CH5A 3BJ6A 2Q7HA 3CBOA 5CQEA 2BIVA 3A31A 4KICA 3CC4Q 3OYAA 2GXGA 2VIXA 2HQNA 1YITT 1JT0A 5HKCA 1V5GA 2QHTA 3CPWA 1OU8A 3RTRA 4MMKA 4PSWA 1M90C 4UVAA 1OFCX 3JRAA 2ECCA 4PCQA 4XSXF 2E60A 2STWA 4P73A 3G7ZA 1MH4A 1M3BA 3ZQHA 2QTXA 4C2MJ 4BB7A 1QGPA 2RHYA 5GAN8 2XPUA 4BH9A 2D1HA 3G71Q 3H8ZA 3I64A 2DOFA 3GEZA 3I56T 1BCMA 3FRNA 3S2HJ 2NUZA 3SZPA 1Z0XA 1O7FA 3TSWA 3G1OA 2MBFA 4QQ6A 2K3XA 1PCXA 3GMEA 5F0HA 2KIMA 5EYRA 2DT6A 2C06A 1B6AA 2QEXA 4QVDA 1SANA 3J7AY 1HW2A 1W1WE 2OAUA 1S72Q 2C0IA 4XSZF 2FMYA 5EG0A 2QK0A 2ESNA 4M3EA 1QVPA 1W1FA 4IUTA 3ECHA 1T39A 2OQRA 1ULYA 4EJOA 1XDSA 4PJJA 1QVFA 1IGQA 4YG2F 5LD2C 1MD0A 4M7DF 1WXUA 3E97A 2OTJA 1WFXA 1KC8C 3DLMA 1VQPT 4XONA 5E8GA 4Z88A 5HNHA 4D5CA 4KH0B 3PIOA 2EQJA 1X1BA 4OMQA 4N4OB 3NWTA 2KHMA 4P71A 2QQ8A 3HOYJ 1YI2Q 2E36A 4BQNA 5F27A 2BTTA 2DYIA 2XDPA 1USTA 3CCRT 2B9SA 3WXMB 2LQKA 3K4NA 2HKQB 3KZYA 1GBRA 5D4RA 1XS9A 4ZDOA 1V3FA 5EJCA 4C8QE 1YYVA 4LIVA 2ZSIB 1H9GA 3OSVA 2W85A 2Y69H 1VQ9T 2XAGA 3PVQA 1X3ZB 2DEUA 4C8QF 4A3DJ 2XIGA 2EQRA 5DUKA 4KISA 3JRHA 2RJEA 1X1AA 3KEYA 4U7DA 1MMDA 2JPBA 2ESWA 2LRDA 1ETYA 1RC9A 1HD3A 3BY6A 4HX4A 5HS9A 5DDGA 2DQLA 2E6ZA 1BW5A 1T3LA 3TQNA 1SFUA 2E70A 1B70A 4AC0A 4G12A 3JCMb 4BY7J 1BC8C 3P8DA 3O8VA 5L8RE 3EG2A 2ZT5A 3DTKA 1BBUA 1MUZA 1C0AA 3M8EA 3MAJA 3PNWC 3VWBA 2RM4A 3NTIA 2ZMEB 5AIPA 1X2KA 4IUPA 2ZXHA 2VB6A 3E0JB 2E7XA 4RMFA 5FFZA 2HOAA 1OYYA 2NRAC 1WZ2A 1HC7A 1QVFS 4RTVA 1HW5A 3RGLA 3E1SA 2GQIA 4RCCA 2Y4YA 4PSXA 4ENKA 5IPAA 4LIUA 4EVIA 4HWOA 2XIDA 2RJDA 4ZGDB 3SHFA 3CCJQ 4A3JJ 3MF2A 2DKGA 3S2WA 5IP7J 1IW7F 3I35A 1VQ8T 1JJCB 3R07A 2LMJA 5GANf 1MBGA 2HI3A 4CSWA 3CUQB 5ICEA 3BOQA 2BXZA 1FPQA 4NBQA 1OZ3A 5K1PA 1WHUA 4KA4A 1VQ4I 4LDYA 4BL0B 4JJDA 2EYZA 2RK2A 5M9OA 2R7XA 2V6CA 1EA3A 3L2ZA 2WSCE 2EZKA 3LQRA 1NLPC 2FL7A 4EJVA 4B4CA 1ASZA 5LHHA 2M0YA 2A28A 2ZC2A 1T3SA 3HUGA 4XNFA 2KSSA 3ZXSA 3BG6A 3CMEA 2EVRA 1ZAOA 2FEZA 3VBBA 3TW6A 3WTUC 1SFKA 4L6V5 3L2WA 4M78B 1BBYA 4MQVA 3DTEA 1R23A 3I9QA 2NVUB 2Y90A 3G4SQ 4EIKA 2DTZA 3CJNA 3JRZA 9ANTA 3M59A 1FYMA 3V7RA 1QPMA 3KE2A 4CS2A 2LG4A 1FMVA 1XOVA 4C92G 1KQ8A 2QA4Q 3D1NI 4HF2A 1S6LA 4QIWN 2L4MA 5KYWA 3X2QH 1ENHA 2UWMA 4C8QC 1QP2A 3HM5A 2ACJA 2H8HA 2JVHA 2M87A 4RQEA 2K85A 1B8AA 1S7AA 4RM3A 5F1JA 2JMAA 3A2KA 4YRCA 1TW3A 3VB2A 2ZNJA 2K4BA 4J15A 2BXYA 4Z8AA 4FW1A 2W1OA 2PVDB 5A0DA 1UHCA 2DOEA 1KK7A 4BBRJ 1XMXA 4P75C 1N9RA 4P96A 3VS7A 1TTHB 3PSFA 3F21A 3F8MA 3REBB 3QTCA 3D5SC 2KDSA 3CMAI 2CW0F 4BI4A 4A93J 4E47A 2E6NA 5GAMg 4D8DA 2JZYA 2MSYA 1K9MC 3U23A 3A0HC 3UDCA 4J5YA 3GNGA 4M7AE 3GLXA 2MWOA 2HEOA 1P6RA 2LNHB 1HSTA 1JHHA 1W2BP 1X69A 3M0RA 2CH0A 4F16A 1YHQA 5IAYA 2LF7A 4I99C 5L3GA 1MIJA 1FIAA 2LKPA 1U3EM 4HX7A 2FJ1A 1D0ZA 3HC7A 3QG1A 3KETA 2EGCA 3BW1A 1U78A 5FLVA 1ZGWA 4YEJA 2WY7Q 2R7OA 5KYYA 3HFOA 3NETA 3REUA 2P6SA 2M0MA 2H1KA 4ZTZB 3NAUA 2XICA 1HLVA 1E3HA 4FX0A 1X56A 3OYHA 3LSSA 3VS1A 3BWGA 2XGXA 4BUPA 2X4YA 3VOEA 4FYVB 4ELZC 2B86A 4II3A 5KNNA 3VS6A 3K1PA 2A07F 3R60A 4UXNA 1YJWQ 4RLFA 4J9IA 2JTVA 4M75E 1H9TA 2LKXA 5GADJ 1WHLA 3C2BA 3QU6A 3HHGA 1E24A 1V4RA 2F4IA 5IHIA 5LFAA 2QQSA 1G5IA 1VYUA 1S1NA 3ABLH 1AWXA 2A0FB 2LLKA 3P9CA 2ZPFB 2F5TX 5CKDA 12ASA 4I0BA 1F1ZA 4A4FA 3W6JB 4XIDA 2JA8J 2CP3A 4HLXA 3M4YA 4TVRA 2YRDA 2OTJI 1X54A 4M78D 1XGSA 2RO0A 1TBXA 2HGCA 5DCFA 2ED0A 1BKBA 2A61A 2CUJA 4UUTA 1NJ8A 2XROA 1IXCA 3JRGA 1V54H 4EM0B 3Q9SA 3WG9A 1I27A 2E7WA 1X3WB 1APLC 2F5KA 3QODA 1Z1DA 5K5RA 3GW2A 2O9LA 4CDGA 4F7ZA 4XTXA 2RA2A 2ROLA 3FXMA 5FU6B 2KNBB 2M5WA 5DUIA 2ZJRF 3EH1A 1B7TA 3CXCA 1NYGA 3V8LA 3CCUQ 3SEQA 5GAEJ 1UAAA 2TRTA 4BBSJ 2O4XA 2G3RA 5HNFA 3CC7Q 1IN4A 2A68F 1UDLA 3LL7A 1MMSA 2JPCA 1L0WA 1Q1VA 1OJLA 4BE2A 1Z3XA 3G6ET 1WH7A 5CQXA 4F7UE 3CCQA 2FHDA 2AKKA 4AT1B 1T0FC 1FZPB 2W10A 2H8RA 1EFNA 1FLIA 3VQVA 1J5YA 4ZC3A 3K2ZA 1VQKA 2XHKA 4M7AC 3F3XA 1J75A 2XAHA 3QIIA 1PD0A 4ZYGA 2DQ3A 4UVCA 3QO5A 1KU9A 2X1DA 3H9NA 1HYOA 2DQ0A 5K1YA 2EKOA 1VQNQ 5HDNA 1AWCA 2VGNA 2L89A 1N6AA 5F1RA 1Q7YC 3ISPA 4JS4A 3FMSA 2Z3YA 1TUDA 4HXJA 5KH6A 5LHIA 3IHUA 4HVVA 3GTGJ 3JB9F 5GAMd 4N4GA 3CCMA 4GYGA 2FXAA 2PJPA 1YITQ 5HK0A 3PSIA 4GLKA 1HCRA 2JWTA 2QSGX 4HX8A 1H89C 1UG1A 4UHTA 3HTSB 2LYCA 1B72A 3HSRA 3BG7A 2M8GX 1LVAA 2L9RA 3TEGA 2R58A 1ZREA 1IHWA 9ATCB 2CP2A 3PUFA 5TJJA 1JT6A 5DLQE 2RKHA 1Q86R 1VQOA 1VNDA 4NQWA 1YIOA 2P0PA 2EFWA 4M75C 2RAEA 3CCVT 3OYMA 3S2DJ 1KD1U 3ER0A 4II2A 1U1SA 4N4NB 3CC2A 3RUXA 2MPXC 1GXPA 2O01E 3H36A 1JBMA 2DCEA 4KN7X 5GP9A 3I56Q 3OYDA 1KGSA 1WPYA 1K4US 4YRSA 2JN6A 4FSXA 3S14J 4N4HA 4N0AC 4HSTA 1JXOA 2KGTA 1NJ5A 4P3NA 3HUGB 3N05A 3T8RA 2PFBA 2DAQA 2IG0A 2STTA 3CCLQ 3COAC 2DTHA 3CMEI 2I2LA 1K9AA 1DUXC 2E35A 3LAJA 1M4ZA 1PVEA 2CFOA 3SFZA 2KEAA 2DO3A 1Y6IA 3V7SA 1SF9A 3IV5A 1YJNA 2VGMA 4HV6A 2ZNYA 1WCMJ 2FNPA 1WQWA 3RACA 1VIEA 1WRJA 1ACMB 3VODA 3IWFA 3VYSB 4OAZA 4YRLA 1J2XA 5IN1A 1Z21A 1VTNC 4JRKA 4HV5A 2CUDA 1X3UA 2B8AA 1G8XA 3L42A 1Z67A 4NC8A 3DU5A 2E64A 3HOSA 3UGQA 3BTIA 1J0RA 2AXTC 3LSGA 5KAFC 1Y1WJ 2ADUA 2PG4A 1B8IB 1Y56A 3VV0A 4RAFA 1XQHA 5GAGJ 3VSKA 3P7NA 4A6EA 4H2UA 1NJ2A 4WK8F 2DK8A 3NRVA 3H3ZA 1HC8A 2CZ6B 3META 4WWCA 2XAQA 4OMMA 5JVGF 3ZMUA 1VQMT 3HY1A 1YQAA 3M0UA 1MBJA 1I3AA 1X2NA 1VQ6T 3L2CA 2MK5A 4OGCA 1MMNA 2K9MA 5KE2A 3ZRGA 4RTTA 5M5YJ 2KVQG 5HS7A 4OMOA 3VS4A 1ZA2B 1RR8C 4AG1C 2ME6A 3RPUD 4B47A 3KXTA 4JZ3A 1NJIU 1DP7P 3BCAA 3MEYA 4UP7A 1X27A 4A3CJ 2VXDA 5M3MJ 4XLEA 2L3PA 3TEEA 4A0XA 4RGRA 4KBMB 1SKUB 1AA7A 1W0TA 5HLTA 2R7DA 1NJ1A 4A3FJ 1MSFC 3WGIA 4V2GA 1FOKA 3K6GA 4C8QG 2VKEA 2XSDC 3K4JA 3VS0A 3RKXA 2DO7A 3ZMDA 2X51A 2KDOA 5CLSA 2HQHA 5KYYB 4HRIA 2BY3A 1T6SA 2FU4A 4FL6A 4BACA 3I0TA 3IAS2 1O7LA 5FKNA 3I4NJ 4JQFA 1GXIE 3OIPA 3L2RA 2VJJA 2JN0A 1TC3C 4G7ZF 4Y3OA 2ZFUA 2J06A 1K73U 4C2TA 1VQ5T 1ZK8A 1H8AC 1D1BA 2G7UA 1T0JA 4PNOA 4HT8A 4BXXJ 2QGFB 3TKYA 4CI0C 2FPDA 2RQRA 1HDPA 4EO4A 3LW5E 4YRMA 1TQPA 1EH7A 3WHBA 3WTSC 3BJUA 2OF7A 4DBRA 2K79A 1POGA 4L87A 2IA1A 1BCOA 5LJ5e 2DT5A 3S6WA 3I55T 1NJIC 2R7RA 2A8EA 3EYYA 4YDQA 2AZVA 3LA3A 1G3TA 5FD6A 2ZZDA 4CH3A 4LE9A 1EIYA 4XTUA 1EJ9A 2O5RA 3E3VA 1ZX6A 3RF1A 1O57A 3KX2A 3CDLA 5DS9A 2KRFA 4HDVA 2CJBA 3OYGA 2WC2A 2W7NA 4RTXA 4XICA 4Y33A 4P71C 3RESA 4KQEA 1NTCA 2IT0A 2E4HA 2CS7A 2ECZA 4AIJA 2FVUA 2O4XB 3BTJA 2DA4A 1YWOA 2NS0A 3KBGA 4LG0A 5FB2A 3EQLF 2A6TA 4HBLA 3H5NA 1I1JA 1QWEA 5D5WB 3CCQI 2MLGA 2VBZA 4B9XA 1I81A 5GMKh 2YU9J 1XCVA 3DWLE 2CH4A 4R55A 4IOAF 2ZXJA 4YRIA 1VQKI 1ZSGA 2QQ9A 2BYVE 2HEQA 1W66A 3IG2A 4BEHA 3ZP5A 2F2EA 1VQLT 4DOVA 3RZDJ 4M71A 2L01A 2DA2A 4AD9A 4L5JA 1I1GA 1OCPA 3NMZC 4U0YA 3UATA 2IP2A 2EIKH 3LSTA 2V1NA 2H1LA 4LVKA 3K4LA 2EAYA 1LB2A 4BE1A 1Q82U 3FM5A 5GAOl 5FRMA 4EMKA 1YRNA 1RUWA 5GAOm 2YLCA 1B72B 2KIFA 2M9HA 4KIGA 1N25A 1J3TA 1PWTA 4NHJA 1OPCA 1PRMC 2K3PA 5KK1A 1K8AC 1ABOA 1G3SA 1IXDA 1RNLA 2KIQA 3CD6I 4M3FA 4NQWB 1VQOI 3WTZA 1H4QA 5J1UA 5ILUA 4JRQA 2KLOA 2ESHA 3NQOA 1G4DA 2CP0A 1G51A 4YRJA 1GT0C 3LGFA 1JTYA 3G71A 3W2WA 2EJRA 2E3CA 3PNTA 3HOXJ 4ZNXA 1YWPA 3AL0B 11ASA 5FKLA 2E5NA 4HF1A 4X9DA 1NE8A 1UGQB 3VQXA 1M1KR 2O88A 3G73A 2LX9A 5BS6A 2DLPA 2JA6J 3ERED 2ARSA 1Z7MA 1RR7A 2EYQA 4RGUA 1YJNI 4X5OA 3HPHA 4PZJA 5ED4A 3M4GA 1JTXA 1D0XA 2LR8A 4HCBA 4J8OA 3A8GB 4S0HB 4CUGA 5GAN3 1NZ9A 1U5TC 2DN0A 3C12A 2KXDA 2EQUA 2AQEA 2Y0SN 3M0QA 3OS5A 3CCSQ 3GTQJ 1ZLKA 2H8WA 4AG2C 1X01A 1U0JA 4AVPA 1J7KA 1FP1D 3PE0A 1VQ7A 3W2AA 5LJ3e 1Y8QB 4MQ9F 2W4SA 1RESA 4M75G 3REXA 1Q81R 3M9AA 4C92A 3AG2H 3OSFA 2DIGA 2Z2SB 3UKGA 1AU7A 3OYLA 4L5GA 1KZHA 4K2EA 1LE8B 1X2HA 3DKYA 3S17J 3NARA 3DQVC 3W6KB 1HJDA 1E2XA 1WSUA 1AWJA 1E0EA 3M3YJ 2EJ9A 2QXFA 2L0KA 1U8RA 1R1TA 1LEAA 4BXUA 3JCMe 1JJ6C 1Z7UA 2ETHA 1LPQA 1R9TJ 3KFUA 4WF2A 5J6XA 2DA9A 3V8JA 2RQWA 2E1MB 2EIFA 4L0YB 1ZRCA 1KQSP 4IQJA 4JZ4A 1SESA 1OKRA 4F55A 1M2OA 1MSEC 4KUMA 3R6SA 1XX5A 1NPRA 1FMKA 3OL4A 4EGZA 1O3SA 3SD4A 2M34A 1EF4A 3RBBB 1KA8A 1QRYA 2DD5A 1DGWY 2DXUA 4IEJA 2YR2A 4Y92A 3OYJA 3UA7A 4IL6C 3LSJA 2LY1A 2CKKA 3H0HA 4A4HA 2X9HA 1RAGB 2MAMA 3JV3A 3IH4A 3G1JA 3TVTA 1LFUP 3BDUA 3L7WA 1WLPB 4FIBA 4M3BA 1W7PB 2JQ7A 1G6NA 1U3OA 5BPDA 3B02A 3K1NA 2ISZA 2P5KA 3CCJA 2B0LA 3I71A 3F9KA 1I4K1 2ARTA 2GA1A 3BR2A 2J3MA 2LBFB 5CIUA 1QZEA 1P92A 5DM7R 2CQ7A 1EOVA 5CK9A 2JVVA 3JB9G 2HDDA 1QNTA 2DVEA 3F70A 2QZ8A 3C94A 3OS1A 2WV0A 5HLIA 3JCMc 2GNCA 2FOWA 2NOJB 3I53A 1WJEA 2Y0SA 2JXBA 2LNBA 4JX6A 1H8KA 4C5EA 2JRTA 3CEYA 3UGTA 4HG2A 2R7WA 3H5RA 2M45A 2MYSA 1IN7A 1YS6A 4GY5A 1WJCA 2RJCA 3G2BA 3MVPA 1I6HJ 3TQ7P 2NS7A 2UUZA 2D6FA 1UCRA 2OA4A 4MFDA 3VQWA 1JJ2P 2K9QA 2RDPA 5FKMA 2KE9A 4JUVA 4IUQA 4KUIA 3GVAA 5EEHA 4M77D 1JI8A 2P7VB 3PCOA 2I4NA 3G4SA 2QKMB 1B59A 4UP9A 4MDXA 2E1NA 4GGGA 4WXCA 1G2HA 3P8VA 4DYCA 2FG0A 2A08A 5GPAA 2DBBA 2AK5A 2EJGA 4ZN3A 2ZSHB 2DL3A 4FT8A 5DYMA 2VBXA 4A69C 3M4PA 2R57A 2V8KA 4CH4A 1HQCA 4CZZA 3M0SA 2DXTA 2EQIA 1UFFA 2KAFA 4EMSA 2K4JA 3GTMJ 2QCOA 3PIPA 2VJ4A 1SG5A 4UC4A 3K4KA 5LL6S 4Q48A 4M78F 2ZPIB 1SAUA 1UHMA 1PYSA 5I11A 4YFKF 4QVZA 4TV7A 3WGHA 2XHCA 1FBUA 7AT1B 1ZSZA 1FWZA 2OTLA 4EEFG 1OYIA 2Y48A 3TOAA 2A37A 2WAFA 4PJOE 3L2UA 3P8HA 1PM3A 1YIJT 1SEUA 1XN7A 2SEMA 2P6TA 3CF5F 3F22A 4LVIA 3JCMV 2K40A 2M4KA 4PJOF 2ZZGA 2CQKA 1YRNB 3QU3A 4YIIA 5GJWB 2ZPBB 2IA2A 2WV1A 2FE3A 5L3CA 1EH8A 1ON1A 3FC3A 1GVJA 1OYWA 3AKZA 3QWXX 4A3LJ 1C0MA 4I2OA 5EZHA 2JM9A 3TO7A 2K5LA 3SFMA 3DCFA 5F6FA 1VZ0A 3BDDA 4A54A 4PG3A 2W82A 3OIOA 1BBZA 1W2BA 2CUZA 2I4MA 1D0YA 2KYBA 2DAOA 3QO3A 2DU5A 1W7PD 5D8KB 4LVMA 3H9JA 5H2FC 4FW2A 4CCLA 2HOSA 4JLIA 1TH7A 4J9GA 1YJ9A 3WG7H 4C9YA 1QA6A 5B1BH 3VEPA 3JCMg 4WCGA 4V19K 3HXVA 2D45A 3H1CA 1SRYA 1YTYA 4C2UA 4KJZA 2K2MA 1ARKA 1VQ5Q 3F8BA 2HVSA 4G7HF 2IGKA 2G4CA 2CQNA 2FZKB 2HMAA 2V9KA 3GIBA 4XN0A 4DA4A 3WVEB 4MMLA 3CC4T 1YBYA 1G5VA 2F48A 3DKWA 2RK1A 2DA1A 2L0AA 4OMPA 2J6OA 1TW2A 5JFRA 2ELJA 2EFPA 3TBIA 1A31A 2IS6A 2BV6A 3LGLA 3S1MJ 3CBMA 1A6IA 1AZEA 4DOWA 5J4YA 2I8DA 1FX7A 1VQ7I 4BS9A 3CJQB 2FNAA 2A69F 3H6ZA 5EDNA 2ZR2A 1BI3A 5IT9K 1N77A 1XJWB 1QLYA 4O6JA 3EG9A 5KCOA 1T95A 1TUGB 3E6BA 3MEVA 2VBYA 2W57A 2Q2EB 3RDIA 1PUEE 2DA5A 4EATA 2DZ9A 4HVWA 5HDKA 2VKNA 1OOTA 2MFZA 3E6DA 3QJYA 3IH3A 3AT1B 3EFRA 2PVGB 1P9QC 1K6OA 3L4GA 5C51B 5D8LB 1W2BS 1ONVA 1S72T 1WYXA 1S5LC 3CC7A 2RMOA 1U6GA 2VI6A 4ENJA 1E22A 2XTIA 1RUOA 4PJOC 4M7DA 3HYIA 1WJRA 3FZVA 1Y57A 2DA6A 3A7UA 3DBHB 4L0ZB 2B63J 2HQEA 2XKOA 5K7HA 2XDBA 3L2VA 1Y7XA 2KMTA 3EHQA 1BM9A 1K79A 4YREA 3JR9A 3JRFA 2EQMA 3QNEA 1S8NA 4BXFA 2X1EA 1R4NB 1FTZA 2FZCB