3UFGA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
rcsb
source organism Campylobacter jejuni
total genus 96
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3ufgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ufgA01
4P71C 2ZIMA 4H02A 2PMEA 3DSQA 2CJBA 4BWAA 2QHVA 4WJ3M 1E24A 1X55A 4XTXA 1EIYA 2ZNIA 3NEMA 2QHTA 3LC0A 2E65A 3M4PA 4YDQA 3IG2A 4XTYA 3V7SA 1B76A 5C53B 2ZZGA 3V8JA 1J5WA 3ERRA 2ARTA 3QO7A 12ASA 1YFTA 3P8VA 1EQRA 4XEOA 4XU2A 3WQZA 1E1TA 3REUA 1B8AA 3HY1A 4P73C 1B7YA 1FYFA 3PCOB 1VQZA 3NETA 1Z7NA 3HTZA 1WQWA 2DTIA 11ASA 5E3IA 1N9WA 2FYKA 1IL2A 2ZTGA 3VBBA 4YRMA 4RDXA 2HNIA 2DTOA 4H2WA 3A7AA 3MF1A 4H2XA 4OLFA 3L1AA 4YRLA 4WF2A 1EIYB 2DTHA 1BBUA 4P71A 2Q7EA 1G5HA 4P3PA 1NNHA 1E1OA 4DPGA 3NENA 5KNNA 4XU3A 4WI1A 1X54A 3IKLA 2P5IA 3VQWA 4YREA 4XU1A 2ZXFA 2DVEA 4P75C 2ZCEA 2ZZFA 1ASZA 4WJ4A 4K87A 4UP7A 4EO4A 1B7YB 1NYQA 2AKWA 1HC7A 2EAYA 4KR2A 1WQ7A 4H2YA 2E3CA 2RHQA 4RQFA 2I4LA 4P73A 2ODRC 4UPAA 2ZT8A 1X2HA 3VQXA 1BBWA 4HWSA 2RHSB 4TVYA 1X2GA 4HWRA 1WPYA 4PG3A 3HXVA 3A5ZA 3HY0A 3L4GA 3UGTA 2J3LA 1NJ1A 2ALYB 2I4MA 3BJUA 4YYEA 3LSSA 1E22A 1RIQA 4ZIBA 2QHUA 4CS4A 4H2UA 3TEGA 2E1HA 1NJ5A 3A7RA 2ZZEA 1X01A 3TEHB 4TQDA 1YFSA 1WNLA 5ELNA 4P72C 2PMFA 4TVAB 4YRIA 3QO5A 4KR3A 4UP9A 4X5OA 4YPFA 1PYSA 2ZIOA 2DDZA 4O2DA 3G1ZA 4CH4A 2ZNJA 3HFZB 2EJ9A 1HTTA 1WU7A 1QE0A 4HVCA 3MF2A 4YRTA 3HRIA 3A31A 1NYRA 1JJCA 4P75A 3RIRA 1H4QA 4YRJA 2RHQB 3A32A 1EVKA 1WYDA 4DQ2A 2QHSA 2DXTA 3NELA 3REXA 4BW9A 1C0AA 5C52B 2CJAA 4G85A 3RKXA 3L2ZA 1WLEA 2DKGA 5ELOA 2ZR3A 4XTZA 1ATIA 1NJ2A 2DQ0A 1NJ8A 2I4NA 1W66A 4YRSA 1G51A 4YRCA 3RF1A 4YRGA 3HXWA 2E5AA 1ASYA 2EL9A 1ADJA 4NCXA 2C8MA 4HWOA 4P3OA 4CH6A 4ZTZB 4TVWA 4RMFA 1EVLA 4OP0A 2EWNA 3FJPA 5C51B 3RL6A 3A7UA 3PCOA 3LSQA 2AMCA 3ICAA 1L0WA 4ZTUB 1GGMA 3QNEA 2DJZA 1B70A 3IALA 4K86A 4Q15A 4YROA 3EFRA 1NJ6A 2DZ9A 4J15A 3E9IA 3QO8A 1KMNA 3RUXA 4EX5A 3UGQA 3KFUA 3V7RA 2ZR2A 3QTCA 1H4SA 3HXZA 4HA8A 3EFSA 4TQFA 3V7CA 4H2XB 4XTWA 4RQEA 1EOVA 2EJGA 3VQVA 4E51A 1SERA 3MEYA 4YRFA 4H2VA 1KOGA 3I7FA 3IKMB 4LNSA 1LYLA 4XTUA 5F5WA 3W3SA 1G5IA 4HWPA 1BIAA 2ODRD 2IY5A 4YRKA 2Q7HA 1HXDA 1Z7MA 4L87A 3A5YA 3A74A 4HWTA 4CH5A 5HGQA 4XTVA 4H2TA 3M4QA 2DU7A 2E41A 1H4VB 4G84A 3HXYA 2CGHA 4AH6A 2ARUA 4TTVA 3PZCA 3HFVA 3UH0A 2ARSA 2AKWB 1USYC 4KQEA 3RGLA 1SETA 4UP8A 2CIMA 1X56A 2AMCB 3VQYA 2G4CA 4P74C 4YP0A 2E10A 2DEQA 3HXUA 3V8LA 4YCUA 1B70B 2XGTA 3BFMA 2ZT7A 3P8TA 3HXXA 1EFWA 2RHSA 2DZCA 2Q5HA 2ZT5A 3E9HA 2E64A 3UFGA 1SESA 2P0LA 3P8YA 4H2SA 1YB3A 4YRRA 1QF6A 3L4GB 2CJ9A 3HRKA 4YCWA 2DQ3A 2ALYA 2C7IA 4YRQA 2ZINA 3CMQA 2XTIA 1ADYA 2DU5A 4CS2A 4K88A 3TEHA 5K1XA 1BIBA 2IY5B 4P3NA 4YCVA 4TVAA 2Q5IA 1KMMA 2I4OA 4PHCA 4CH3A 1YFRA 1PYSB 2J3MA 4YRPA 4P72A 2Q7GA 3RKYA 4TWAA 2DXUA 3HFZA 3RACA 3RKWA 4CS3A 4XU0A 3TUPA 4Q6GA 3V8KA 1H4TA 1JJCB 2ZGWA 4YRNA 3OD1A 3R07A 4XEMA 1YGBA 1SRYA 1USYA 5K1PA 2ZT6A 4P74A 2EJFA
chains in the Genus database with same CATH superfamily
2XASB 3KV6A 4P71C 2OV9A 3MKDA 1KNRA 2XQ5A 2CJBA 4O8SA 2LSKA 2K3WA 2QHVA 4ILBA 4O2AE 1E24A 4HN9A 5L3EB 2E9XD 1T98A 2KWHA 1R8IA 5CB4E 4HFDA 4XTYA 1FMVA 2ZM8A 4OX9T 4I0UA 3CMLA 3P50A 4JEUB 2YDRA 1SA0E 3P8VA 3KV4A 1AJ3A 1B8AA 4H9OC 1B7YA 4P73C 5FXZA 2BVLA 1OEDC 3RPUA 2LJLA 4QH4A 2XQAA 5CGMA 3HTZA 4YSZA 2WM9A 4CI2B 2IAKA 2DNXA 1N9WA 1IL2A 4IT4A 5FL1A 3ZC0A 2M67A 4EOZB 5J2UE 2DTOA 5HYAA 3BQLA 4MFRA 2QGSA 4OLFA 3TLTA 2XQ3A 2OA5A 2B76A 4WF2A 3SS1A 5IYZE 4TV9E 2Q7EA 4YLHA 3PUYF 5FP3A 5L3GB 4AIUA 4DPGA 3NENA 2EHOA 1X54A 2LHRA 4L0RA 3IKLA 3VQWA 3MXZA 4AQFA 3T1YT 5CJ5A 3AA1B 2DVEA 4IL4A 2ZCEA 2ZZFA 2WDQA 2D5UA 2BS4A 1B7YB 3P8CD 4ZI2C 1HC7A 4FJOA 4QH5A 2CHNA 1X2HA 4UV8B 4LFBT 2X9YA 1SE7A 4DV5T 2LKGA 2VKDA 3UUNA 1X2GA 4EIWA 4AISA 4U2ZA 4HWRA 3UU8A 3HXVA 3NBXX 3L4GA 3UGTA 4JYAT 2J3LA 1FEWA 3SFDA 4DMVA 1HX8A 1NJ1A 2I4MA 4YYEA 2LSIA 5LA6E 4ZIBA 3B13A 3O1IA 4CS4A 3MACA 3FXEB 2VKHA 4LMLA 2MBGA 2W62A 2E1HA 4AQGA 3O1JA 3ZSTA 2HPLA 4HWIB 2ZZEA 1X01A 4TQDA 4I4TE 1YFSA 1XMQT 2M6BA 3ETUA 3C4WA 2E5VA 2J47A 2CWYA 2XHEB 4TVAB 3PUWF 2XQ7A 4YSYA 2L8KA 4YPFA 2LM9A 4TUYE 5AQGB 2WU5A 2ZIOA 2FJDA 3FZKB 3QOFA 5LYJE 4UVAB 2ZNJA 5F3JA 2EJ9A 3MF2A 4PFOA 2HH7A 4P75A 1NYRA 2DCFA 3RIRA 4I50E 5ABFB 3V5UA 5KDMC 3ZYKA 4YFSA 1C0AA 2VK9A 4G85A 1WLEA 5ELOA 2ZR3A 2N9DA 2NR4A 1NENA 3NWIA 4GYRA 3H3MA 1I94T 2I4NA 1W66A 2BG9E 1XMOT 3SFEA 2CMRA 4H9QC 4U72A 3WI3A 3HXWA 2ZLYA 3AE7A 2V6YB 3DJBA 3LBXA 3AE3A 2V8SV 3ZMZB 3ZYLA 4IDOA 3D0TA 2D0UA 2NW8A 3KFWX 5JDLA 3LJCA 4JI2T 4CN1A 2LOSA 4V1Av 3FJPA 1SUMB 3RL6A 2E8IA 2KMFA 1FMWA 3A7UA 1L0WA 3U3IA 2JJ9A 3PU8A 5LJMA 3E9IA 3BQKA 3QO8A 4I43B 3I9WA 5JTGA 4CN4A 1XNRT 4UELA 1H4SA 3HXZA 3UUMA 1HG5A 1Y64B 2UXCT 4DV0T 1HR0T 1T7SA 4DUYT 5C2TA 4DV2T 4KHZF 4WZXA 4H2VA 1MMAA 3C98B 1MIWA 1WRDA 3N9QA 3GN5B 4ZI2D 1LYLA 3Q5DA 3N9LA 5F5WA 3AAEB 3VR8A 4PAGA 3EUHA 4IE4A 4DV3T 1J1JA 3AECA 5KMGP 4X62T 3LBXB 4PK6A 5JDNA 4H2TA 3RI5A 3M4QA 1MMNA 4NUUA 3UFEA 3DP7A 4CI3B 1D0ZA 4EAHA 2LLYA 2P9BA 4H63H 3VQYA 2G4CA 3OYXA 4YP0A 2DEQA 3ZPOA 1OEDB 2XGTA 3H3AA 3N9MA 2BKPA 1EFWA 2WZHA 4M1PA 2UXNB 4JI1T 4XZCA 5FMNA 3CQGB 2WBLA 3UULA 3ONLC 1IBLT 4ASKA 4COFA 3HRKA 3FZFB 4ISTA 1WR6A 2A2FX 4HFCA 2JMHA 3Q5EA 2W61A 4PFPA 2NS6A 4YRQA 2DU5A 5JQGE 5JR9C 5JDHA 5LGTB 4HKAA 2L3LA 5K1XA 4IE7A 4ERRA 5AQFB 1HF8A 2V7JA 4JI0T 4PHCA 4CH3A 1SHZC 4IGUA 3MQZA 3OJAA 2Q7GA 3RKYA 1XNQT 4EZHA 1G73A 3KBUA 2BKOA 4HWFA 3CX6B 3V8KA 2FBWA 4YRNA 5LMNT 3JC6C 2WZIA 1YGBA 2UXBT 1SRYA 1USYA 4IL9A 2I6HA 2GK9A 2N2NA 4LF5T 4OFZA 3DSQA 1HFAA 5FXWA 4BWAA 4WJ3M 3WAJA 3ZMTB 3VR9A 2HHHT 4XTXA 2LHNA 3K3OA 1ZHCA 2EHOC 3LC0A 1IAPA 3JADA 2E65A 4O4JE 4KHPT 4F8HA 3C50A 3IEEA 5C53B 2LRLA 2A8EA 1J5WA 1S94A 2CLYC 1EQRA 3PU3A 2V7KA 2VQET 5EK4A 1ZP0A 2XQ6A 2NW7A 2Y6XA 2ZM6T 1FYFA 3PCOB 4JBWF 1VQZA 2IDOB 1Z7NA 4Z91A 5DQWA 4JI5T 2DTIA 2YN6A 4E7ZA 5E3IA 4ISSA 5CFBA 4YRMA 2LT3A 4RDXA 1KK7A 2V5CA 1UGOA 2HNIA 4DV4T 3LG7A 4H2XA 3L1AA 3RIFA 2VL8A 4YRLA 4IDQA 2NWBA 1QLBA 3MK7C 5LXTE 1BBUA 1G5HA 3MA9A 4KX6A 2W63A 4ZS3A 3CWZB 2FJBA 5JVDE 1LVKA 3TLWA 2YU1A 2UXXB 1E1OA 4OYKA 3JCFA 5KNNA 4XU3A 4WI1A 1BR1A 4YREA 4QKNA 4KP3C 4CXXA 5HXSA 4XU1A 3EDUA 1W0AA 3RYFE 3ZSSA 5LBQB 4P75C 3PV0F 1MIVA 2JPFA 2UUCT 2I59A 2MPKA 2AKWA 3VRAA 4KR2A 5C8YE 1WQ7A 4H2YA 2E3CA 4RQFA 2H7VC 3LK2B 1X79A 5FVKA 2XJ7A 3VQXA 2RHSB 2CXDA 2BVMA 2CM0A 3F2EA 3ZYMA 2BDEA 3UTKA 3VRBA 1V9DA 4CXYA 5JDFA 3A5ZA 2WS3A 2VB6A 3HY0A 4WYVA 2IW5B 4JI7T 4QXCB 3PTRB 1N34T 1IJ6A 4P0AA 2ALYB 3UU4A 4MBQA 4B3ST 3CX7B 4IHJE 4H2UA 4WBOA 3KBTA 3N9PA 5FY1A 2A72A 4LFAT 4U3CA 2YINA 1WCRA 4B3MT 3TEHB 4H9SE 3TKLB 3ABVA 4ANJA 2MAWA 5JR9A 4P72C 5J0ZA 3UQ7A 4UP9A 3CKDA 1UK5A 4GK0E 5LBMA 1PYSA 3ZT7A 3TLSA 4TWFA 1U5PA 4B3TT 5ETWA 1VCSA 2YKSA 1VCTA 3HFZB 2Y48B 2EHOD 4EEBA 2NOXA 2OLTA 1E2AA 4L9IA 4YRTA 2X68A 4LF7T 2K24A 1EVKA 2QHSA 2DXTA 3NELA 2C5JA 1GQEA 5GONE 2W66A 5HEOA 5C52B 1WR0A 4P0BA 1U4QA 5JDQA 4ZI7E 4A5XA 2XAHB 1N36T 3N2GE 4U7YA 3AE1A 2XQ8A 2E5AA 1ASYA 3M65A 2KWIB 2K5BB 4EB6E 3AE8A 5LHGB 4JI6T 3KVBA 4ILAA 2XZEA 1HNWT 2ZM2A 1S35A 3QB5K 3T8OA 4DR1T 4HWHA 4OP0A 4FI5A 1KNPA 4EZ4A 3FXDB 2AMCA 5BMVE 3K3QC 3ZC1A 2DJZA 4K86A 4Q15A 5DABA 2J62A 4J15A 1KMNA 1JNZA 2XAGB 2BS2A 4HFVA 2ZR2A 3FB2A 2X0YA 2BG9A 3TLVA 3QTCA 3Q2MA 2X67A 4JV5T 2HN1A 4IDNA 1VRBA 3F31A 2BBJA 2DL1A 4JEHB 4QX7B 3AA7B 2V7LA 4RQEA 1EOVA 3VQVA 2ACZA 5AQHB 3I7FA 4DV1T 3IKMB 2QVAA 2JRKA 3FBZA 3PUGA 3CIRA 3W3SA 2JQKA 2ACXA 1YQ3A 5LG4A 2LSYA 4YTPA 4EV6A 1BIAA 3JAFA 1G5IA 2IY5A 2EHOB 4CI1B 4PK4A 1UCUA 4DR4T 3AEBA 3A5YA 5HGQA 3AVRA 3OPCA 2A9UA 4ZOLE 4CZZB 1H4VB 3E08A 4XBFB 3UUBA 5CA0E 5E0OA 3PUZF 5HXEA 2CLYB 3V5SA 1USYC 2QYWA 2AMCB 4O4IE 4X65T 1KFYA 3HXUA 2QA7A 3V8LA 5HWYA 4GK5E 5ABEA 3P8TA 4PJNA 1IJ5A 1OWAA 3E9HA 3UQ4A 4X64T 3AA0B 4AKHA 3C4XA 1SESA 4YT0A 4A56A 2PG8A 1D1BA 5AQQB 3L4GB 3NZQA 4YCWA 2DQ3A 4G63A 3IA3A 2IUBA 4YHHT 3UU3A 3QK6A 1ADYA 4CS2A 1MMDA 2XQ4A 3I9YA 4AKIA 3RYCE 4EGWA 3SOLA 2VVNA 5FY0A 1BIBA 2IY5B 4YCVA 4YJ2E 1KMMA 3RKOA 2CRBA 2Q9QC 2IC6A 1YW0A 4P72A 3PURA 1D1AA 4AXPA 3ZMUB 2AE9A 3RACA 4KI0F 4CS3A 3QC9A 1H4TA 3RIAA 4JI4T 2ZGWA 2VURA 5AQUB 1W0BA 3AEGA 3N5LA 4GIWA 3AEAA 3L3PA 5L4HA 4LVMA 5K1PA 3HKCE 5LGUB 3A8YC 4H02A 3E0ZA 2PMEA 1OXZA 4QWNB 4EXTA 3RHWA 1X55A 3ETVA 1Z8UA 4ZS2A 3M4PA 5LHIB 5AQSB 2X9WA 4YDQA 1M7KA 3V7SA 3CQXC 5LOVE 2ZZGA 3V8JA 3ERRA 4P1NA 2CXLA 3AE6A 4MALA 1VOMA 3QO7A 12ASA 1YFTA 1D0XA 4XU2A 3JAEA 4XAXB 1E1TA 3EHZA 2RA1A 3NRXA 3GA8A 4AI6A 2DLRA 3HY1A 3K8PC 4UF0A 3NKZA 3AEDA 3RC3A 5M4YA 2CWOA 3NETA 1HNZT 2JQ9A 2H89A 1ZV4X 3ZN1B 1WQWA 11ASA 2NW9A 3PDYA 3L8RA 3VBBA 2KSRA 3LK3B 2ODVA 1E1HB 2KLQA 4H2WA 3GWHA 1OEDE 3NZPA 2WWUA 3J9X1 2CCQA 4LF9T 1UX4A 3ZMVB 5JRCA 3MJXA 2YDSA 2M6IA 5LNKA 3CX8B 3P4SA 4P3PA 4LF8T 1H7CA 3AB3B 5AQOB 4EYUA 1KEYA 4GKJT 5KXJA 3UU6A 4G2AA 5LCYA 4A98A 2P5IA 2BKNA 1O3XA 1Z0PA 2X66A 4IIJE 4K0UA 3A7MA 3ZN0B 5IUXA 5JH7E 4GOUA 2JQQA 4WJ4A 1E7PA 4K87A 1D1CA 4ZI3C 1EZ3A 2IMLA 2G0UA 3N2KE 2E9XC 2EAYA 4LFCT 4UF0B 3M3ZB 2D9DA 3AA6B 4LMKA 3AVSA 4IDPA 2RHQA 3E22E 2I4LA 2ODRC 4UPAA 4LVLA 3CK6A 3PUQA 1ZOYA 4HWSA 5AQVB 4TVYA 4JUYA 5FY7A 4HT4A 2MYSA 3AAIA 2LSGA 4MLKA 4UV9B 4YJ3E 1WPYA 4PG3A 2V26A 5HAXA 3U78A 4Z8XA 3AEFA 3LFMA 4YTNA 5C3JA 5EZYE 1RIQA 3HKDE 1ZKEA 4PJJA 1MMGA 3RRWA 3ZCIA 2W2UA 2NP9A 3RLFF 4NXNT 1WNLA 5ELNA 4YRIA 2WAUA 4KR3A 5AQJB 3ANWA 4AKRB 4E7SA 3AE2A 3ZMSB 3G1ZA 4CH4A 2PTFA 2BG9C 4DV6T 3R6NA 2Q9QA 5L2LA 2E2AA 5L3FB 4HVCA 1LVFA 3HRIA 3A31A 1JJCA 2C0SA 5AQIB 2DWGA 4YRJA 4X1YE 3UT5E 2RHQB 4U31A 1WYDA 4DQ2A 3S4UA 4MHCA 3P7IA 4NPPA 3DTOA 3J7Yq 2CJAA 3AE4A 2BS3A 3I1AA 2NTXA 3RIUA 4XTZA 1W09A 2D2SA 2DQ0A 1NJ8A 4CQIA 4YRSA 1G51A 2Z6EA 5JREA 2V6XA 4YRCA 2VWAA 1YXRA 3RF1A 4X66T 2VVSA 3LDQB 3AEEA 2LOPA 5IWAT 1ADJA 2XTLA 3R84B 4DIDB 2C8MA 4HWOA 4P3OA 4CH6A 2K9AA 2XY8B 5DJQC 4ZTZB 2XSAA 4TVWA 4RMFA 1JNRA 1EVLA 4H63V 2WSSV 1M62A 5FKYA 4TNWA 5H6QB 5L3BB 2YEVC 4IE5A 3ANWB 3LSQA 2QRXA 4HWCA 3EDVA 1GGMA 4HFHA 4GYSA 2XM2A 4U7IA 3IALA 4YROA 3EFRA 4QXBB 2Q9QB 2DZ9A 2YK0A 3P4PA 2HPJA 4IDZA 2LM2A 3O1HA 3UGQA 3RC8A 3V7RA 4BJMA 2WP9A 3NVOA 3I0QA 4HA8A 3TLUA 5HXHA 4TQFA 2WDRA 1XDPA 3HKBE 1N33T 4H2XB 4UEMA 2PFVA 1I6ZA 3GMIA 2EJGA 4YRFA 1FJGT 5HEGA 4ZI3D 3CQCB 3AXJA 3JC6D 4DBRA 3HA4A 4Q25A 4QH1A 4TWHA 4HE8A 3ZLIA 2ODRD 5AQMB 2UUAT 2Q7HA 1HXDA 1Z7MA 3K3NA 3A74A 4HWTA 4XTVA 4YXDA 3UU5A 2XPKA 4ZZBA 2WU2A 3HXYA 2IC9A 4H9NC 5EK3A 2CGHA 2ARUA 4TTVA 2WY2A 3HFVA 3PZCA 3UH0A 2KINB 3RQUA 1W9RA 2AKWB 4KQEA 3QB5A 3RGLA 1SETA 2CIMA 3UUXB 2VKJA 3RQWA 4PW8A 4YCUA 2E9XA 4DR2T 3FZMB 5AQPB 3BFMA 2ZT7A 2WMOA 3I0OA 4HFIA 2NTYA 4CN6A 3VKGA 2ZT5A 4ADZA 3AE5A 5DQVA 4OHFA 2UUBT 2E64A 3RRCA 1CUNA 2N1GA 5FL0A 2P0LA 4YSXA 4H2SA 1YB3A 1QF6A 3ONJA 3VKHA 2WMNA 2XAFB 2CJ9A 2LKHA 3WAKA 4YHJA 4BJNA 2DHRA 4LF6T 2LSJA 3P4RA 3O9XA 3C64A 2C7IA 2ZINA 4DR3T 2XTIA 2X51A 3OVUA 3BQIA 5HEHA 4X1IE 3AXJB 2X9HA 1UUSA 4CXWA 3FZHB 1MIYA 2CBJA 1YKEB 5JR9B 4TVAA 4QXHB 4KUMB 3RH3A 4BA9A 1PYSB 2J3MA 3C51A 5AQRB 4LF4T 4UVCB 2PBIA 5KX5E 4U2YA 5LG3A 2DXUA 5J2TE 4A97A 2W0GA 3EVYA 4XU0A 3TUPA 3A5XA 3NRYA 4Q6GA 4AQYT 3RYHE 3R07A 3ZT6A 4H9RC 1WFDA 5L47A 3RYIE 4TX5A 5ABFA 3C4ZA 4XEMA 4LVKA 2VASA 2BZBA 2E9XB 4EEDA 5LHHB 3Q5XA 4WNKA 2ZT6A 4NIQA 4P74A 1IBKT 2EJFA 4DO0A 3Q5WA 2ZIMA 3ZCJA 2F4VT 4UIGA 2YU2A 4O4LE 1EIYA 2ZNIA 3NEMA 4KBMB 5FVLA 2QHTA 5FYMA 1QSDA 3IG2A 4IE6A 1BR4A 1B76A 3EABA 2SPCA 3ZJ2A 1MNDA 2V6YA 3X1DA 5H6RB 3ZKRA 2ARTA 3CVRA 4WW0A 3N2OA 2H3RA 3KVAA 4XEOA 4UXNB 3WQZA 2AXDS 4TZ4C 3REUA 3PUVF 1YKHB 3IF8B 3Q9DA 4DMWA 2VQFT 2XQ9A 2J1DG 3IBPA 3KDSE 3W15B 5LJNA 4PJMA 4HEAA 2X9XA 5HWXA 2R6GF 5FXXA 3EAMA 3RKGA 2W00A 2JMKA 4LVJA 5EK2A 1X9BA 2BG9B 3L09A 2FYKA 2ZTGA 4O4HE 1L0VA 4JI3T 4JLEA 3ZT5A 1WYCA 2V7MA 2UU9T 3A7AA 2XAJB 4DBQA 3MF1A 3H37A 4QX8B 3L39A 2L9QA 2A3DA 1HX1B 4OYJA 1XDOA 2WCAA 2VL0A 3VU7H 2K48A 4BAYB 1EIYB 3GN5A 2DTHA 4P71A 3PUSA 5AQLB 1NNHA 1HCIA 5TAOA 5HEUA 2WB5A 5HEJA 1G8XA 2V7IA 5L3DB 1HNXT 2ZXFA 3QUJA 1ASZA 3OBVE 4UP7A 4EO4A 4HFEA 1NYQA 3PJAJ 4ZZCA 2J4GA 2W67A 1Y01A 4P73A 1OEDA 2ZT8A 4YY3T 4HWDA 4F6RC 3SWHA 1BBWA 3RIUC 1CHUA 5BR8T 2I0MA 3B5MA 5JDGA 5HXCA 5FNVE 4ZHQE 5AFUL 1LKXA 1YQ4A 2WDVA 3VHLA 3PE0A 1HTJF 3BJUA 3IHRA 5ABGA 1XZYA 1E22A 3LSSA 4TNVA 2X0HA 2QHUA 4ZEYA 3TEGA 5HCMA 1NJ5A 3A7RA 4UVBB 4DR5T 2FJEA 3ZEFB 2D0TA 1US7B 3FHNA 1BR2A 2CHOA 4DV7T 4DNDA 2CPTA 2H88A 3AAAB 4JI8T 5ABHA 2PMFA 3LSVA 3QO5A 4TN7B 1HS7A 4X5OA 2WQYA 2HN2A 2KNDA 2YDQA 3P4WA 1KNZA 4K0KT 2DDZA 4O2DA 4ZXLA 5LP6E 1KF6A 3QNUA 1IBMT 4L5GA 1HTTA 1WU7A 1QE0A 4X5TA 2LE8A 3FZLB 4EYYR 1H4QA 3RX6A 3A32A 1UURA 5J1GA 4P09A 4H9PC 2BBHA 2JIWA 1HG2A 2JQHA 3PUAA 2WWVA 3REXA 2V1DB 2XM1A 4NXMT 4BW9A 3HKEE 2FJAA 1NWMX 1T72A 3RKXA 3KV9A 3L2ZA 2IIUA 2DKGA 3N9NA 1FIOA 2ZMAA 5LGNB 1ATIA 1NJ2A 3ONXA 2ODUA 2CE7A 1D0YA 3PUXF 4YRGA 4X20E 4DR6T 3KV5A 3O4XE 2EL9A 4NCXA 4HTEA 2XAQB 2CEAA 4ILCA 2YOEA 2EWNA 5FXVA 5C51B 2CBIA 5CA1E 3PCOA 3ICAA 4ZTUB 1T8BA 3QNEA 1J5ET 1B70A 2MTQA 1NJ6A 2X0LB 3PJAA 3HR0A 5ADXL 3RUXA 3T1HT 4DVDA 1YD8G 4EX5A 3KFUA 2W4XA 3MZKB 5F8PA 2RP4A 2PJQA 2C5KT 5L4EA 3FBLA 4C91A 3EFSA 2Q9QD 5HCJA 3V7CA 4HGAA 5IHYA 5A1LA 2MOZA 3B57A 4XTWA 4E51A 3LK42 4C90A 1SERA 3MEYA 1DU2A 1KOGA 2E5LT 1XWMA 1B7TA 4LNSA 3P4QA 5JRCB 4HFBA 4XTUA 4YTMA 2B1EA 4HWPA 3KINB 4YRKA 4AQFC 2VKOA 4TV8E 4KMCA 3EI0A 3K1SA 3ZJ1A 4GKKT 4DUZT 2XQYA 4L87A 1NEKA 4CH5A 5LB7B 2V5DA 2DU7A 1IZNB 2XSBA 2E41A 4G84A 2CA5A 1NAFA 4LVIA 3N9OA 4AH6A 4WBNE 1WYBA 5AQNB 2ARSA 4Z90A 4UP8A 3F57A 1X56A 4P74C 4AKGA 1ZEEA 3OYZA 2E10A 1QUUA 5AQTB 1B70B 4U74A 5JDMA 3HXXA 2RHSA 2DZCA 2CXFA 5LMUT 2Q5HA 1UX5A 2RPAA 3UFGA 2DI4A 4O2BE 4QHOA 3BK9A 3P8YA 4YRRA 3HI2A 1WLXA 1BR0A 4X1KE 2ALYA 3OKQA 4UR9A 2ES0A 3CMQA 4DR7T 3AE9A 4J2CA 4TWDA 2C5IT 4K88A 2IHR1 2LEHA 5L3CB 3TEHA 5HXRA 4I55E 4P3NA 4AKLA 1LRZA 2Q5IA 2I4OA 3G06A 4PJLA 4PNIA 1YFRA 4LMJA 4N78D 4YRPA 4PK5A 4B3RT 2UXDT 2XUEA 4TWAA 4NUVA 4U33A 4ILUA 3CPZA 3HFZA 3RKWA 3HL6A 4B6XA 1N32T 1MNEA 3OTOT 1JJCB 2FUPA 3OD1A 3ESLA 5AQKB 2KZ7B 4IE0A 2KT9A 2H7OA 4IREA 2ZM0A 2Y8DA 2DWKA 2KXPB 4OK0A 3SRZA 2LRKA
chains in the Genus database with same CATH topology
4P71C 2ZIMA 4H02A 2PMEA 3DSQA 2CJBA 4BWAA 2QHVA 4WJ3M 1E24A 1X55A 4XTXA 1EIYA 2ZNIA 3NEMA 2QHTA 3LC0A 2E65A 3M4PA 4YDQA 3IG2A 4XTYA 3V7SA 1B76A 5C53B 2A8EA 2ZZGA 3V8JA 1J5WA 3ERRA 2ARTA 3QO7A 12ASA 1YFTA 3P8VA 1EQRA 4XEOA 4XU2A 3WQZA 1E1TA 3REUA 1B8AA 3HY1A 4P73C 1B7YA 1FYFA 3PCOB 1VQZA 3NETA 1Z7NA 3HTZA 4LVJA 1WQWA 2DTIA 11ASA 5E3IA 1N9WA 2FYKA 1IL2A 2ZTGA 3VBBA 4YRMA 4RDXA 2HNIA 2DTOA 4H2WA 3A7AA 3MF1A 4H2XA 4OLFA 3L1AA 4YRLA 4WF2A 1EIYB 2DTHA 1BBUA 4P71A 2Q7EA 1G5HA 4P3PA 1NNHA 1E1OA 4DPGA 3NENA 5KNNA 4XU3A 4WI1A 1X54A 3IKLA 2P5IA 3VQWA 4YREA 4XU1A 2ZXFA 2DVEA 4P75C 2ZCEA 2ZZFA 1ASZA 4WJ4A 4K87A 4UP7A 4EO4A 1B7YB 1NYQA 2AKWA 1HC7A 2EAYA 4KR2A 1WQ7A 4H2YA 2E3CA 2RHQA 4RQFA 2I4LA 4P73A 2ODRC 4UPAA 4LVLA 2ZT8A 1X2HA 3VQXA 1BBWA 4HWSA 2RHSB 4TVYA 4HT4A 1X2GA 4HWRA 1WPYA 4PG3A 3HXVA 3A5ZA 3HY0A 3L4GA 3UGTA 2J3LA 1NJ1A 2ALYB 2I4MA 3BJUA 4YYEA 3LSSA 1E22A 1RIQA 4ZIBA 2QHUA 4CS4A 4H2UA 3TEGA 2E1HA 1NJ5A 3A7RA 2ZZEA 1X01A 3TEHB 4TQDA 1YFSA 1WNLA 5ELNA 4P72C 2PMFA 4TVAB 4YRIA 3QO5A 4KR3A 4UP9A 4X5OA 4YPFA 1PYSA 2ZIOA 2DDZA 4O2DA 3G1ZA 4CH4A 2ZNJA 3HFZB 2EJ9A 1HTTA 1WU7A 1QE0A 4HVCA 3MF2A 4YRTA 3HRIA 3A31A 1NYRA 1JJCA 4P75A 3RIRA 1H4QA 4YRJA 2RHQB 3A32A 1EVKA 1WYDA 4DQ2A 2QHSA 2DXTA 3NELA 3REXA 4BW9A 1C0AA 5C52B 2CJAA 4G85A 3RKXA 3L2ZA 1WLEA 2DKGA 5ELOA 2ZR3A 4XTZA 1ATIA 1NJ2A 2DQ0A 1NJ8A 2I4NA 1W66A 4YRSA 1G51A 4YRCA 3RF1A 4YRGA 3HXWA 2E5AA 1ASYA 2EL9A 1ADJA 4NCXA 2C8MA 4HWOA 4P3OA 4CH6A 4ZTZB 4TVWA 4RMFA 1EVLA 4OP0A 2EWNA 3FJPA 5C51B 3RL6A 3A7UA 3PCOA 3LSQA 2AMCA 3ICAA 1L0WA 4ZTUB 1GGMA 3QNEA 2DJZA 1B70A 3IALA 4K86A 4Q15A 4YROA 3EFRA 1NJ6A 2DZ9A 4J15A 3E9IA 3QO8A 1KMNA 3RUXA 4EX5A 3UGQA 3KFUA 3V7RA 2ZR2A 3QTCA 1H4SA 3HXZA 4HA8A 3EFSA 4TQFA 3V7CA 4H2XB 4XTWA 4RQEA 1EOVA 2EJGA 3VQVA 4E51A 1SERA 3MEYA 4YRFA 4H2VA 1KOGA 3I7FA 3IKMB 4LNSA 1LYLA 4XTUA 5F5WA 3W3SA 1G5IA 4HWPA 1BIAA 2ODRD 2IY5A 4YRKA 2Q7HA 1HXDA 1Z7MA 4L87A 3A5YA 3A74A 4HWTA 4CH5A 5HGQA 4XTVA 4H2TA 3M4QA 2DU7A 2E41A 1H4VB 4G84A 3HXYA 4LVIA 2CGHA 4AH6A 2ARUA 4TTVA 3PZCA 3HFVA 3UH0A 2ARSA 2AKWB 1USYC 4KQEA 3RGLA 1SETA 4UP8A 2CIMA 1X56A 2AMCB 3VQYA 2G4CA 4P74C 4YP0A 2E10A 2DEQA 3HXUA 3V8LA 4YCUA 1B70B 2XGTA 3BFMA 2ZT7A 3P8TA 3HXXA 1EFWA 2RHSA 2DZCA 2Q5HA 2ZT5A 3E9HA 2E64A 3UFGA 1SESA 2P0LA 3P8YA 4H2SA 1YB3A 4YRRA 1QF6A 3L4GB 2CJ9A 3HRKA 4YCWA 2DQ3A 2ALYA 2C7IA 2NS6A 4YRQA 2ZINA 3CMQA 2XTIA 1ADYA 2DU5A 4CS2A 4K88A 3TEHA 5K1XA 1BIBA 2IY5B 4P3NA 4YCVA 4TVAA 2Q5IA 1KMMA 2I4OA 4PHCA 4CH3A 1YFRA 1PYSB 2J3MA 3MQZA 4YRPA 4P72A 2Q7GA 3RKYA 4TWAA 2DXUA 3HFZA 3RACA 3RKWA 4CS3A 4XU0A 3TUPA 4Q6GA 3V8KA 1H4TA 1JJCB 2ZGWA 4YRNA 3OD1A 3R07A 4XEMA 1YGBA 4LVKA 1SRYA 1USYA 4LVMA 5K1PA 2ZT6A 4P74A 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P71 C;  2ZIM A;  4H02 A;  2PME A;  3DSQ A;  2CJB A;  4BWA A;  2QHV A;  4WJ3 M;  1E24 A;  1X55 A;  4XTX A;  1EIY A;  2ZNI A;  3NEM A;  2QHT A;  3LC0 A;  2E65 A;  3M4P A;  4YDQ A;  3IG2 A;  4XTY A;  3V7S A;  1B76 A;  5C53 B;  2ZZG A;  3V8J A;  1J5W A;  3ERR A;  2ART A;  3QO7 A;  12AS A;  1YFT A;  3P8V A;  1EQR A;  4XEO A;  4XU2 A;  3WQZ A;  1E1T A;  3REU A;  1B8A A;  3HY1 A;  4P73 C;  1B7Y A;  1FYF A;  3PCO B;  1VQZ A;  3NET A;  1Z7N A;  3HTZ A;  1WQW A;  2DTI A;  11AS A;  5E3I A;  1N9W A;  2FYK A;  1IL2 A;  2ZTG A;  3VBB A;  4YRM A;  4RDX A;  2HNI A;  2DTO A;  4H2W A;  3A7A A;  3MF1 A;  4H2X A;  4OLF A;  3L1A A;  4YRL A;  4WF2 A;  1EIY B;  2DTH A;  1BBU A;  4P71 A;  2Q7E A;  1G5H A;  4P3P A;  1NNH A;  1E1O A;  4DPG A;  3NEN A;  5KNN A;  4XU3 A;  4WI1 A;  1X54 A;  3IKL A;  2P5I A;  3VQW A;  4YRE A;  4XU1 A;  2ZXF A;  2DVE A;  4P75 C;  2ZCE A;  2ZZF A;  1ASZ A;  4WJ4 A;  4K87 A;  4UP7 A;  4EO4 A;  1B7Y B;  1NYQ A;  2AKW A;  1HC7 A;  2EAY A;  4KR2 A;  1WQ7 A;  4H2Y A;  2E3C A;  2RHQ A;  4RQF A;  2I4L A;  4P73 A;  2ODR C;  4UPA A;  2ZT8 A;  1X2H A;  3VQX A;  1BBW A;  4HWS A;  2RHS B;  4TVY A;  1X2G A;  4HWR A;  1WPY A;  4PG3 A;  3HXV A;  3A5Z A;  3HY0 A;  3L4G A;  3UGT A;  2J3L A;  1NJ1 A;  2ALY B;  2I4M A;  3BJU A;  4YYE A;  3LSS A;  1E22 A;  1RIQ A;  4ZIB A;  2QHU A;  4CS4 A;  4H2U A;  3TEG A;  2E1H A;  1NJ5 A;  3A7R A;  2ZZE A;  1X01 A;  3TEH B;  4TQD A;  1YFS A;  1WNL A;  5ELN A;  4P72 C;  2PMF A;  4TVA B;  4YRI A;  3QO5 A;  4KR3 A;  4UP9 A;  4X5O A;  4YPF A;  1PYS A;  2ZIO A;  2DDZ A;  4O2D A;  3G1Z A;  4CH4 A;  2ZNJ A;  3HFZ B;  2EJ9 A;  1HTT A;  1WU7 A;  1QE0 A;  4HVC A;  3MF2 A;  4YRT A;  3HRI A;  3A31 A;  1NYR A;  1JJC A;  4P75 A;  3RIR A;  1H4Q A;  4YRJ A;  2RHQ B;  3A32 A;  1EVK A;  1WYD A;  4DQ2 A;  2QHS A;  2DXT A;  3NEL A;  3REX A;  4BW9 A;  1C0A A;  5C52 B;  2CJA A;  4G85 A;  3RKX A;  3L2Z A;  1WLE A;  2DKG A;  5ELO A;  2ZR3 A;  4XTZ A;  1ATI A;  1NJ2 A;  2DQ0 A;  1NJ8 A;  2I4N A;  1W66 A;  4YRS A;  1G51 A;  4YRC A;  3RF1 A;  4YRG A;  3HXW A;  2E5A A;  1ASY A;  2EL9 A;  1ADJ A;  4NCX A;  2C8M A;  4HWO A;  4P3O A;  4CH6 A;  4ZTZ B;  4TVW A;  4RMF A;  1EVL A;  4OP0 A;  2EWN A;  3FJP A;  5C51 B;  3RL6 A;  3A7U A;  3PCO A;  3LSQ A;  2AMC A;  3ICA A;  1L0W A;  4ZTU B;  1GGM A;  3QNE A;  2DJZ A;  1B70 A;  3IAL A;  4K86 A;  4Q15 A;  4YRO A;  3EFR A;  1NJ6 A;  2DZ9 A;  4J15 A;  3E9I A;  3QO8 A;  1KMN A;  3RUX A;  4EX5 A;  3UGQ A;  3KFU A;  3V7R A;  2ZR2 A;  3QTC A;  1H4S A;  3HXZ A;  4HA8 A;  3EFS A;  4TQF A;  3V7C A;  4H2X B;  4XTW A;  4RQE A;  1EOV A;  2EJG A;  3VQV A;  4E51 A;  1SER A;  3MEY A;  4YRF A;  4H2V A;  1KOG A;  3I7F A;  3IKM B;  4LNS A;  1LYL A;  4XTU A;  5F5W A;  3W3S A;  1G5I A;  4HWP A;  1BIA A;  2ODR D;  2IY5 A;  4YRK A;  2Q7H A;  1HXD A;  1Z7M A;  4L87 A;  3A5Y A;  3A74 A;  4HWT A;  4CH5 A;  5HGQ A;  4XTV A;  4H2T A;  3M4Q A;  2DU7 A;  2E41 A;  1H4V B;  4G84 A;  3HXY A;  2CGH A;  4AH6 A;  2ARU A;  4TTV A;  3PZC A;  3HFV A;  3UH0 A;  2ARS A;  2AKW B;  1USY C;  4KQE A;  3RGL A;  1SET A;  4UP8 A;  2CIM A;  1X56 A;  2AMC B;  3VQY A;  2G4C A;  4P74 C;  4YP0 A;  2E10 A;  2DEQ A;  3HXU A;  3V8L A;  4YCU A;  1B70 B;  2XGT A;  3BFM A;  2ZT7 A;  3P8T A;  3HXX A;  1EFW A;  2RHS A;  2DZC A;  2Q5H A;  2ZT5 A;  3E9H A;  2E64 A;  3UFG A;  1SES A;  2P0L A;  3P8Y A;  4H2S A;  1YB3 A;  4YRR A;  1QF6 A;  3L4G B;  2CJ9 A;  3HRK A;  4YCW A;  2DQ3 A;  2ALY A;  2C7I A;  4YRQ A;  2ZIN A;  3CMQ A;  2XTI A;  1ADY A;  2DU5 A;  4CS2 A;  4K88 A;  3TEH A;  5K1X A;  1BIB A;  2IY5 B;  4P3N A;  4YCV A;  4TVA A;  2Q5I A;  1KMM A;  2I4O A;  4PHC A;  4CH3 A;  1YFR A;  1PYS B;  2J3M A;  4YRP A;  4P72 A;  2Q7G A;  3RKY A;  4TWA A;  2DXU A;  3HFZ A;  3RAC A;  3RKW A;  4CS3 A;  4XU0 A;  3TUP A;  4Q6G A;  3V8K A;  1H4T A;  1JJC B;  2ZGW A;  4YRN A;  3OD1 A;  3R07 A;  4XEM A;  1YGB A;  1SRY A;  1USY A;  5K1P A;  2ZT6 A;  4P74 A;  2EJF A; 
#chains in the Genus database with same CATH topology
 2XAS B;  3KV6 A;  4P71 C;  2OV9 A;  3MKD A;  1KNR A;  2XQ5 A;  2CJB A;  4O8S A;  2LSK A;  2K3W A;  2QHV A;  4ILB A;  4O2A E;  1E24 A;  4HN9 A;  5L3E B;  2E9X D;  1T98 A;  2KWH A;  1R8I A;  5CB4 E;  4HFD A;  4XTY A;  1FMV A;  2ZM8 A;  4OX9 T;  4I0U A;  3CML A;  3P50 A;  4JEU B;  2YDR A;  1SA0 E;  3P8V A;  3KV4 A;  1AJ3 A;  1B8A A;  4H9O C;  1B7Y A;  4P73 C;  5FXZ A;  2BVL A;  1OED C;  3RPU A;  2LJL A;  4QH4 A;  2XQA A;  5CGM A;  3HTZ A;  4YSZ A;  2WM9 A;  4CI2 B;  2IAK A;  2DNX A;  1N9W A;  1IL2 A;  4IT4 A;  5FL1 A;  3ZC0 A;  2M67 A;  4EOZ B;  5J2U E;  2DTO A;  5HYA A;  3BQL A;  4MFR A;  2QGS A;  4OLF A;  3TLT A;  2XQ3 A;  2OA5 A;  2B76 A;  4WF2 A;  3SS1 A;  5IYZ E;  4TV9 E;  2Q7E A;  4YLH A;  3PUY F;  5FP3 A;  5L3G B;  4AIU A;  4DPG A;  3NEN A;  2EHO A;  1X54 A;  2LHR A;  4L0R A;  3IKL A;  3VQW A;  3MXZ A;  4AQF A;  3T1Y T;  5CJ5 A;  3AA1 B;  2DVE A;  4IL4 A;  2ZCE A;  2ZZF A;  2WDQ A;  2D5U A;  2BS4 A;  1B7Y B;  3P8C D;  4ZI2 C;  1HC7 A;  4FJO A;  4QH5 A;  2CHN A;  1X2H A;  4UV8 B;  4LFB T;  2X9Y A;  1SE7 A;  4DV5 T;  2LKG A;  2VKD A;  3UUN A;  1X2G A;  4EIW A;  4AIS A;  4U2Z A;  4HWR A;  3UU8 A;  3HXV A;  3NBX X;  3L4G A;  3UGT A;  4JYA T;  2J3L A;  1FEW A;  3SFD A;  4DMV A;  1HX8 A;  1NJ1 A;  2I4M A;  4YYE A;  2LSI A;  5LA6 E;  4ZIB A;  3B13 A;  3O1I A;  4CS4 A;  3MAC A;  3FXE B;  2VKH A;  4LML A;  2MBG A;  2W62 A;  2E1H A;  4AQG A;  3O1J A;  3ZST A;  2HPL A;  4HWI B;  2ZZE A;  1X01 A;  4TQD A;  4I4T E;  1YFS A;  1XMQ T;  2M6B A;  3ETU A;  3C4W A;  2E5V A;  2J47 A;  2CWY A;  2XHE B;  4TVA B;  3PUW F;  2XQ7 A;  4YSY A;  2L8K A;  4YPF A;  2LM9 A;  4TUY E;  5AQG B;  2WU5 A;  2ZIO A;  2FJD A;  3FZK B;  3QOF A;  5LYJ E;  4UVA B;  2ZNJ A;  5F3J A;  2EJ9 A;  3MF2 A;  4PFO A;  2HH7 A;  4P75 A;  1NYR A;  2DCF A;  3RIR A;  4I50 E;  5ABF B;  3V5U A;  5KDM C;  3ZYK A;  4YFS A;  1C0A A;  2VK9 A;  4G85 A;  1WLE A;  5ELO A;  2ZR3 A;  2N9D A;  2NR4 A;  1NEN A;  3NWI A;  4GYR A;  3H3M A;  1I94 T;  2I4N A;  1W66 A;  2BG9 E;  1XMO T;  3SFE A;  2CMR A;  4H9Q C;  4U72 A;  3WI3 A;  3HXW A;  2ZLY A;  3AE7 A;  2V6Y B;  3DJB A;  3LBX A;  3AE3 A;  2V8S V;  3ZMZ B;  3ZYL A;  4IDO A;  3D0T A;  2D0U A;  2NW8 A;  3KFW X;  5JDL A;  3LJC A;  4JI2 T;  4CN1 A;  2LOS A;  4V1A v;  3FJP A;  1SUM B;  3RL6 A;  2E8I A;  2KMF A;  1FMW A;  3A7U A;  1L0W A;  3U3I A;  2JJ9 A;  3PU8 A;  5LJM A;  3E9I A;  3BQK A;  3QO8 A;  4I43 B;  3I9W A;  5JTG A;  4CN4 A;  1XNR T;  4UEL A;  1H4S A;  3HXZ A;  3UUM A;  1HG5 A;  1Y64 B;  2UXC T;  4DV0 T;  1HR0 T;  1T7S A;  4DUY T;  5C2T A;  4DV2 T;  4KHZ F;  4WZX A;  4H2V A;  1MMA A;  3C98 B;  1MIW A;  1WRD A;  3N9Q A;  3GN5 B;  4ZI2 D;  1LYL A;  3Q5D A;  3N9L A;  5F5W A;  3AAE B;  3VR8 A;  4PAG A;  3EUH A;  4IE4 A;  4DV3 T;  1J1J A;  3AEC A;  5KMG P;  4X62 T;  3LBX B;  4PK6 A;  5JDN A;  4H2T A;  3RI5 A;  3M4Q A;  1MMN A;  4NUU A;  3UFE A;  3DP7 A;  4CI3 B;  1D0Z A;  4EAH A;  2LLY A;  2P9B A;  4H63 H;  3VQY A;  2G4C A;  3OYX A;  4YP0 A;  2DEQ A;  3ZPO A;  1OED B;  2XGT A;  3H3A A;  3N9M A;  2BKP A;  1EFW A;  2WZH A;  4M1P A;  2UXN B;  4JI1 T;  4XZC A;  5FMN A;  3CQG B;  2WBL A;  3UUL A;  3ONL C;  1IBL T;  4ASK A;  4COF A;  3HRK A;  3FZF B;  4IST A;  1WR6 A;  2A2F X;  4HFC A;  2JMH A;  3Q5E A;  2W61 A;  4PFP A;  2NS6 A;  4YRQ A;  2DU5 A;  5JQG E;  5JR9 C;  5JDH A;  5LGT B;  4HKA A;  2L3L A;  5K1X A;  4IE7 A;  4ERR A;  5AQF B;  1HF8 A;  2V7J A;  4JI0 T;  4PHC A;  4CH3 A;  1SHZ C;  4IGU A;  3MQZ A;  3OJA A;  2Q7G A;  3RKY A;  1XNQ T;  4EZH A;  1G73 A;  3KBU A;  2BKO A;  4HWF A;  3CX6 B;  3V8K A;  2FBW A;  4YRN A;  5LMN T;  3JC6 C;  2WZI A;  1YGB A;  2UXB T;  1SRY A;  1USY A;  4IL9 A;  2I6H A;  2GK9 A;  2N2N A;  4LF5 T;  4OFZ A;  3DSQ A;  1HFA A;  5FXW A;  4BWA A;  4WJ3 M;  3WAJ A;  3ZMT B;  3VR9 A;  2HHH T;  4XTX A;  2LHN A;  3K3O A;  1ZHC A;  2EHO C;  3LC0 A;  1IAP A;  3JAD A;  2E65 A;  4O4J E;  4KHP T;  4F8H A;  3C50 A;  3IEE A;  5C53 B;  2LRL A;  2A8E A;  1J5W A;  1S94 A;  2CLY C;  1EQR A;  3PU3 A;  2V7K A;  2VQE T;  5EK4 A;  1ZP0 A;  2XQ6 A;  2NW7 A;  2Y6X A;  2ZM6 T;  1FYF A;  3PCO B;  4JBW F;  1VQZ A;  2IDO B;  1Z7N A;  4Z91 A;  5DQW A;  4JI5 T;  2DTI A;  2YN6 A;  4E7Z A;  5E3I A;  4ISS A;  5CFB A;  4YRM A;  2LT3 A;  4RDX A;  1KK7 A;  2V5C A;  1UGO A;  2HNI A;  4DV4 T;  3LG7 A;  4H2X A;  3L1A A;  3RIF A;  2VL8 A;  4YRL A;  4IDQ A;  2NWB A;  1QLB A;  3MK7 C;  5LXT E;  1BBU A;  1G5H A;  3MA9 A;  4KX6 A;  2W63 A;  4ZS3 A;  3CWZ B;  2FJB A;  5JVD E;  1LVK A;  3TLW A;  2YU1 A;  2UXX B;  1E1O A;  4OYK A;  3JCF A;  5KNN A;  4XU3 A;  4WI1 A;  1BR1 A;  4YRE A;  4QKN A;  4KP3 C;  4CXX A;  5HXS A;  4XU1 A;  3EDU A;  1W0A A;  3RYF E;  3ZSS A;  5LBQ B;  4P75 C;  3PV0 F;  1MIV A;  2JPF A;  2UUC T;  2I59 A;  2MPK A;  2AKW A;  3VRA A;  4KR2 A;  5C8Y E;  1WQ7 A;  4H2Y A;  2E3C A;  4RQF A;  2H7V C;  3LK2 B;  1X79 A;  5FVK A;  2XJ7 A;  3VQX A;  2RHS B;  2CXD A;  2BVM A;  2CM0 A;  3F2E A;  3ZYM A;  2BDE A;  3UTK A;  3VRB A;  1V9D A;  4CXY A;  5JDF A;  3A5Z A;  2WS3 A;  2VB6 A;  3HY0 A;  4WYV A;  2IW5 B;  4JI7 T;  4QXC B;  3PTR B;  1N34 T;  1IJ6 A;  4P0A A;  2ALY B;  3UU4 A;  4MBQ A;  4B3S T;  3CX7 B;  4IHJ E;  4H2U A;  4WBO A;  3KBT A;  3N9P A;  5FY1 A;  2A72 A;  4LFA T;  4U3C A;  2YIN A;  1WCR A;  4B3M T;  3TEH B;  4H9S E;  3TKL B;  3ABV A;  4ANJ A;  2MAW A;  5JR9 A;  4P72 C;  5J0Z A;  3UQ7 A;  4UP9 A;  3CKD A;  1UK5 A;  4GK0 E;  5LBM A;  1PYS A;  3ZT7 A;  3TLS A;  4TWF A;  1U5P A;  4B3T T;  5ETW A;  1VCS A;  2YKS A;  1VCT A;  3HFZ B;  2Y48 B;  2EHO D;  4EEB A;  2NOX A;  2OLT A;  1E2A A;  4L9I A;  4YRT A;  2X68 A;  4LF7 T;  2K24 A;  1EVK A;  2QHS A;  2DXT A;  3NEL A;  2C5J A;  1GQE A;  5GON E;  2W66 A;  5HEO A;  5C52 B;  1WR0 A;  4P0B A;  1U4Q A;  5JDQ A;  4ZI7 E;  4A5X A;  2XAH B;  1N36 T;  3N2G E;  4U7Y A;  3AE1 A;  2XQ8 A;  2E5A A;  1ASY A;  3M65 A;  2KWI B;  2K5B B;  4EB6 E;  3AE8 A;  5LHG B;  4JI6 T;  3KVB A;  4ILA A;  2XZE A;  1HNW T;  2ZM2 A;  1S35 A;  3QB5 K;  3T8O A;  4DR1 T;  4HWH A;  4OP0 A;  4FI5 A;  1KNP A;  4EZ4 A;  3FXD B;  2AMC A;  5BMV E;  3K3Q C;  3ZC1 A;  2DJZ A;  4K86 A;  4Q15 A;  5DAB A;  2J62 A;  4J15 A;  1KMN A;  1JNZ A;  2XAG B;  2BS2 A;  4HFV A;  2ZR2 A;  3FB2 A;  2X0Y A;  2BG9 A;  3TLV A;  3QTC A;  3Q2M A;  2X67 A;  4JV5 T;  2HN1 A;  4IDN A;  1VRB A;  3F31 A;  2BBJ A;  2DL1 A;  4JEH B;  4QX7 B;  3AA7 B;  2V7L A;  4RQE A;  1EOV A;  3VQV A;  2ACZ A;  5AQH B;  3I7F A;  4DV1 T;  3IKM B;  2QVA A;  2JRK A;  3FBZ A;  3PUG A;  3CIR A;  3W3S A;  2JQK A;  2ACX A;  1YQ3 A;  5LG4 A;  2LSY A;  4YTP A;  4EV6 A;  1BIA A;  3JAF A;  1G5I A;  2IY5 A;  2EHO B;  4CI1 B;  4PK4 A;  1UCU A;  4DR4 T;  3AEB A;  3A5Y A;  5HGQ A;  3AVR A;  3OPC A;  2A9U A;  4ZOL E;  4CZZ B;  1H4V B;  3E08 A;  4XBF B;  3UUB A;  5CA0 E;  5E0O A;  3PUZ F;  5HXE A;  2CLY B;  3V5S A;  1USY C;  2QYW A;  2AMC B;  4O4I E;  4X65 T;  1KFY A;  3HXU A;  2QA7 A;  3V8L A;  5HWY A;  4GK5 E;  5ABE A;  3P8T A;  4PJN A;  1IJ5 A;  1OWA A;  3E9H A;  3UQ4 A;  4X64 T;  3AA0 B;  4AKH A;  3C4X A;  1SES A;  4YT0 A;  4A56 A;  2PG8 A;  1D1B A;  5AQQ B;  3L4G B;  3NZQ A;  4YCW A;  2DQ3 A;  4G63 A;  3IA3 A;  2IUB A;  4YHH T;  3UU3 A;  3QK6 A;  1ADY A;  4CS2 A;  1MMD A;  2XQ4 A;  3I9Y A;  4AKI A;  3RYC E;  4EGW A;  3SOL A;  2VVN A;  5FY0 A;  1BIB A;  2IY5 B;  4YCV A;  4YJ2 E;  1KMM A;  3RKO A;  2CRB A;  2Q9Q C;  2IC6 A;  1YW0 A;  4P72 A;  3PUR A;  1D1A A;  4AXP A;  3ZMU B;  2AE9 A;  3RAC A;  4KI0 F;  4CS3 A;  3QC9 A;  1H4T A;  3RIA A;  4JI4 T;  2ZGW A;  2VUR A;  5AQU B;  1W0B A;  3AEG A;  3N5L A;  4GIW A;  3AEA A;  3L3P A;  5L4H A;  4LVM A;  5K1P A;  3HKC E;  5LGU B;  3A8Y C;  4H02 A;  3E0Z A;  2PME A;  1OXZ A;  4QWN B;  4EXT A;  3RHW A;  1X55 A;  3ETV A;  1Z8U A;  4ZS2 A;  3M4P A;  5LHI B;  5AQS B;  2X9W A;  4YDQ A;  1M7K A;  3V7S A;  3CQX C;  5LOV E;  2ZZG A;  3V8J A;  3ERR A;  4P1N A;  2CXL A;  3AE6 A;  4MAL A;  1VOM A;  3QO7 A;  12AS A;  1YFT A;  1D0X A;  4XU2 A;  3JAE A;  4XAX B;  1E1T A;  3EHZ A;  2RA1 A;  3NRX A;  3GA8 A;  4AI6 A;  2DLR A;  3HY1 A;  3K8P C;  4UF0 A;  3NKZ A;  3AED A;  3RC3 A;  5M4Y A;  2CWO A;  3NET A;  1HNZ T;  2JQ9 A;  2H89 A;  1ZV4 X;  3ZN1 B;  1WQW A;  11AS A;  2NW9 A;  3PDY A;  3L8R A;  3VBB A;  2KSR A;  3LK3 B;  2ODV A;  1E1H B;  2KLQ A;  4H2W A;  3GWH A;  1OED E;  3NZP A;  2WWU A;  3J9X 1;  2CCQ A;  4LF9 T;  1UX4 A;  3ZMV B;  5JRC A;  3MJX A;  2YDS A;  2M6I A;  5LNK A;  3CX8 B;  3P4S A;  4P3P A;  4LF8 T;  1H7C A;  3AB3 B;  5AQO B;  4EYU A;  1KEY A;  4GKJ T;  5KXJ A;  3UU6 A;  4G2A A;  5LCY A;  4A98 A;  2P5I A;  2BKN A;  1O3X A;  1Z0P A;  2X66 A;  4IIJ E;  4K0U A;  3A7M A;  3ZN0 B;  5IUX A;  5JH7 E;  4GOU A;  2JQQ A;  4WJ4 A;  1E7P A;  4K87 A;  1D1C A;  4ZI3 C;  1EZ3 A;  2IML A;  2G0U A;  3N2K E;  2E9X C;  2EAY A;  4LFC T;  4UF0 B;  3M3Z B;  2D9D A;  3AA6 B;  4LMK A;  3AVS A;  4IDP A;  2RHQ A;  3E22 E;  2I4L A;  2ODR C;  4UPA A;  4LVL A;  3CK6 A;  3PUQ A;  1ZOY A;  4HWS A;  5AQV B;  4TVY A;  4JUY A;  5FY7 A;  4HT4 A;  2MYS A;  3AAI A;  2LSG A;  4MLK A;  4UV9 B;  4YJ3 E;  1WPY A;  4PG3 A;  2V26 A;  5HAX A;  3U78 A;  4Z8X A;  3AEF A;  3LFM A;  4YTN A;  5C3J A;  5EZY E;  1RIQ A;  3HKD E;  1ZKE A;  4PJJ A;  1MMG A;  3RRW A;  3ZCI A;  2W2U A;  2NP9 A;  3RLF F;  4NXN T;  1WNL A;  5ELN A;  4YRI A;  2WAU A;  4KR3 A;  5AQJ B;  3ANW A;  4AKR B;  4E7S A;  3AE2 A;  3ZMS B;  3G1Z A;  4CH4 A;  2PTF A;  2BG9 C;  4DV6 T;  3R6N A;  2Q9Q A;  5L2L A;  2E2A A;  5L3F B;  4HVC A;  1LVF A;  3HRI A;  3A31 A;  1JJC A;  2C0S A;  5AQI B;  2DWG A;  4YRJ A;  4X1Y E;  3UT5 E;  2RHQ B;  4U31 A;  1WYD A;  4DQ2 A;  3S4U A;  4MHC A;  3P7I A;  4NPP A;  3DTO A;  3J7Y q;  2CJA A;  3AE4 A;  2BS3 A;  3I1A A;  2NTX A;  3RIU A;  4XTZ A;  1W09 A;  2D2S A;  2DQ0 A;  1NJ8 A;  4CQI A;  4YRS A;  1G51 A;  2Z6E A;  5JRE A;  2V6X A;  4YRC A;  2VWA A;  1YXR A;  3RF1 A;  4X66 T;  2VVS A;  3LDQ B;  3AEE A;  2LOP A;  5IWA T;  1ADJ A;  2XTL A;  3R84 B;  4DID B;  2C8M A;  4HWO A;  4P3O A;  4CH6 A;  2K9A A;  2XY8 B;  5DJQ C;  4ZTZ B;  2XSA A;  4TVW A;  4RMF A;  1JNR A;  1EVL A;  4H63 V;  2WSS V;  1M62 A;  5FKY A;  4TNW A;  5H6Q B;  5L3B B;  2YEV C;  4IE5 A;  3ANW B;  3LSQ A;  2QRX A;  4HWC A;  3EDV A;  1GGM A;  4HFH A;  4GYS A;  2XM2 A;  4U7I A;  3IAL A;  4YRO A;  3EFR A;  4QXB B;  2Q9Q B;  2DZ9 A;  2YK0 A;  3P4P A;  2HPJ A;  4IDZ A;  2LM2 A;  3O1H A;  3UGQ A;  3RC8 A;  3V7R A;  4BJM A;  2WP9 A;  3NVO A;  3I0Q A;  4HA8 A;  3TLU A;  5HXH A;  4TQF A;  2WDR A;  1XDP A;  3HKB E;  1N33 T;  4H2X B;  4UEM A;  2PFV A;  1I6Z A;  3GMI A;  2EJG A;  4YRF A;  1FJG T;  5HEG A;  4ZI3 D;  3CQC B;  3AXJ A;  3JC6 D;  4DBR A;  3HA4 A;  4Q25 A;  4QH1 A;  4TWH A;  4HE8 A;  3ZLI A;  2ODR D;  5AQM B;  2UUA T;  2Q7H A;  1HXD A;  1Z7M A;  3K3N A;  3A74 A;  4HWT A;  4XTV A;  4YXD A;  3UU5 A;  2XPK A;  4ZZB A;  2WU2 A;  3HXY A;  2IC9 A;  4H9N C;  5EK3 A;  2CGH A;  2ARU A;  4TTV A;  2WY2 A;  3HFV A;  3PZC A;  3UH0 A;  2KIN B;  3RQU A;  1W9R A;  2AKW B;  4KQE A;  3QB5 A;  3RGL A;  1SET A;  2CIM A;  3UUX B;  2VKJ A;  3RQW A;  4PW8 A;  4YCU A;  2E9X A;  4DR2 T;  3FZM B;  5AQP B;  3BFM A;  2ZT7 A;  2WMO A;  3I0O A;  4HFI A;  2NTY A;  4CN6 A;  3VKG A;  2ZT5 A;  4ADZ A;  3AE5 A;  5DQV A;  4OHF A;  2UUB T;  2E64 A;  3RRC A;  1CUN A;  2N1G A;  5FL0 A;  2P0L A;  4YSX A;  4H2S A;  1YB3 A;  1QF6 A;  3ONJ A;  3VKH A;  2WMN A;  2XAF B;  2CJ9 A;  2LKH A;  3WAK A;  4YHJ A;  4BJN A;  2DHR A;  4LF6 T;  2LSJ A;  3P4R A;  3O9X A;  3C64 A;  2C7I A;  2ZIN A;  4DR3 T;  2XTI A;  2X51 A;  3OVU A;  3BQI A;  5HEH A;  4X1I E;  3AXJ B;  2X9H A;  1UUS A;  4CXW A;  3FZH B;  1MIY A;  2CBJ A;  1YKE B;  5JR9 B;  4TVA A;  4QXH B;  4KUM B;  3RH3 A;  4BA9 A;  1PYS B;  2J3M A;  3C51 A;  5AQR B;  4LF4 T;  4UVC B;  2PBI A;  5KX5 E;  4U2Y A;  5LG3 A;  2DXU A;  5J2T E;  4A97 A;  2W0G A;  3EVY A;  4XU0 A;  3TUP A;  3A5X A;  3NRY A;  4Q6G A;  4AQY T;  3RYH E;  3R07 A;  3ZT6 A;  4H9R C;  1WFD A;  5L47 A;  3RYI E;  4TX5 A;  5ABF A;  3C4Z A;  4XEM A;  4LVK A;  2VAS A;  2BZB A;  2E9X B;  4EED A;  5LHH B;  3Q5X A;  4WNK A;  2ZT6 A;  4NIQ A;  4P74 A;  1IBK T;  2EJF A;  4DO0 A;  3Q5W A;  2ZIM A;  3ZCJ A;  2F4V T;  4UIG A;  2YU2 A;  4O4L E;  1EIY A;  2ZNI A;  3NEM A;  4KBM B;  5FVL A;  2QHT A;  5FYM A;  1QSD A;  3IG2 A;  4IE6 A;  1BR4 A;  1B76 A;  3EAB A;  2SPC A;  3ZJ2 A;  1MND A;  2V6Y A;  3X1D A;  5H6R B;  3ZKR A;  2ART A;  3CVR A;  4WW0 A;  3N2O A;  2H3R A;  3KVA A;  4XEO A;  4UXN B;  3WQZ A;  2AXD S;  4TZ4 C;  3REU A;  3PUV F;  1YKH B;  3IF8 B;  3Q9D A;  4DMW A;  2VQF T;  2XQ9 A;  2J1D G;  3IBP A;  3KDS E;  3W15 B;  5LJN A;  4PJM A;  4HEA A;  2X9X A;  5HWX A;  2R6G F;  5FXX A;  3EAM A;  3RKG A;  2W00 A;  2JMK A;  4LVJ A;  5EK2 A;  1X9B A;  2BG9 B;  3L09 A;  2FYK A;  2ZTG A;  4O4H E;  1L0V A;  4JI3 T;  4JLE A;  3ZT5 A;  1WYC A;  2V7M A;  2UU9 T;  3A7A A;  2XAJ B;  4DBQ A;  3MF1 A;  3H37 A;  4QX8 B;  3L39 A;  2L9Q A;  2A3D A;  1HX1 B;  4OYJ A;  1XDO A;  2WCA A;  2VL0 A;  3VU7 H;  2K48 A;  4BAY B;  1EIY B;  3GN5 A;  2DTH A;  4P71 A;  3PUS A;  5AQL B;  1NNH A;  1HCI A;  5TAO A;  5HEU A;  2WB5 A;  5HEJ A;  1G8X A;  2V7I A;  5L3D B;  1HNX T;  2ZXF A;  3QUJ A;  1ASZ A;  3OBV E;  4UP7 A;  4EO4 A;  4HFE A;  1NYQ A;  3PJA J;  4ZZC A;  2J4G A;  2W67 A;  1Y01 A;  4P73 A;  1OED A;  2ZT8 A;  4YY3 T;  4HWD A;  4F6R C;  3SWH A;  1BBW A;  3RIU C;  1CHU A;  5BR8 T;  2I0M A;  3B5M A;  5JDG A;  5HXC A;  5FNV E;  4ZHQ E;  5AFU L;  1LKX A;  1YQ4 A;  2WDV A;  3VHL A;  3PE0 A;  1HTJ F;  3BJU A;  3IHR A;  5ABG A;  1XZY A;  1E22 A;  3LSS A;  4TNV A;  2X0H A;  2QHU A;  4ZEY A;  3TEG A;  5HCM A;  1NJ5 A;  3A7R A;  4UVB B;  4DR5 T;  2FJE A;  3ZEF B;  2D0T A;  1US7 B;  3FHN A;  1BR2 A;  2CHO A;  4DV7 T;  4DND A;  2CPT A;  2H88 A;  3AAA B;  4JI8 T;  5ABH A;  2PMF A;  3LSV A;  3QO5 A;  4TN7 B;  1HS7 A;  4X5O A;  2WQY A;  2HN2 A;  2KND A;  2YDQ A;  3P4W A;  1KNZ A;  4K0K T;  2DDZ A;  4O2D A;  4ZXL A;  5LP6 E;  1KF6 A;  3QNU A;  1IBM T;  4L5G A;  1HTT A;  1WU7 A;  1QE0 A;  4X5T A;  2LE8 A;  3FZL B;  4EYY R;  1H4Q A;  3RX6 A;  3A32 A;  1UUR A;  5J1G A;  4P09 A;  4H9P C;  2BBH A;  2JIW A;  1HG2 A;  2JQH A;  3PUA A;  2WWV A;  3REX A;  2V1D B;  2XM1 A;  4NXM T;  4BW9 A;  3HKE E;  2FJA A;  1NWM X;  1T72 A;  3RKX A;  3KV9 A;  3L2Z A;  2IIU A;  2DKG A;  3N9N A;  1FIO A;  2ZMA A;  5LGN B;  1ATI A;  1NJ2 A;  3ONX A;  2ODU A;  2CE7 A;  1D0Y A;  3PUX F;  4YRG A;  4X20 E;  4DR6 T;  3KV5 A;  3O4X E;  2EL9 A;  4NCX A;  4HTE A;  2XAQ B;  2CEA A;  4ILC A;  2YOE A;  2EWN A;  5FXV A;  5C51 B;  2CBI A;  5CA1 E;  3PCO A;  3ICA A;  4ZTU B;  1T8B A;  3QNE A;  1J5E T;  1B70 A;  2MTQ A;  1NJ6 A;  2X0L B;  3PJA A;  3HR0 A;  5ADX L;  3RUX A;  3T1H T;  4DVD A;  1YD8 G;  4EX5 A;  3KFU A;  2W4X A;  3MZK B;  5F8P A;  2RP4 A;  2PJQ A;  2C5K T;  5L4E A;  3FBL A;  4C91 A;  3EFS A;  2Q9Q D;  5HCJ A;  3V7C A;  4HGA A;  5IHY A;  5A1L A;  2MOZ A;  3B57 A;  4XTW A;  4E51 A;  3LK4 2;  4C90 A;  1SER A;  3MEY A;  1DU2 A;  1KOG A;  2E5L T;  1XWM A;  1B7T A;  4LNS A;  3P4Q A;  5JRC B;  4HFB A;  4XTU A;  4YTM A;  2B1E A;  4HWP A;  3KIN B;  4YRK A;  4AQF C;  2VKO A;  4TV8 E;  4KMC A;  3EI0 A;  3K1S A;  3ZJ1 A;  4GKK T;  4DUZ T;  2XQY A;  4L87 A;  1NEK A;  4CH5 A;  5LB7 B;  2V5D A;  2DU7 A;  1IZN B;  2XSB A;  2E41 A;  4G84 A;  2CA5 A;  1NAF A;  4LVI A;  3N9O A;  4AH6 A;  4WBN E;  1WYB A;  5AQN B;  2ARS A;  4Z90 A;  4UP8 A;  3F57 A;  1X56 A;  4P74 C;  4AKG A;  1ZEE A;  3OYZ A;  2E10 A;  1QUU A;  5AQT B;  1B70 B;  4U74 A;  5JDM A;  3HXX A;  2RHS A;  2DZC A;  2CXF A;  5LMU T;  2Q5H A;  1UX5 A;  2RPA A;  3UFG A;  2DI4 A;  4O2B E;  4QHO A;  3BK9 A;  3P8Y A;  4YRR A;  3HI2 A;  1WLX A;  1BR0 A;  4X1K E;  2ALY A;  3OKQ A;  4UR9 A;  2ES0 A;  3CMQ A;  4DR7 T;  3AE9 A;  4J2C A;  4TWD A;  2C5I T;  4K88 A;  2IHR 1;  2LEH A;  5L3C B;  3TEH A;  5HXR A;  4I55 E;  4P3N A;  4AKL A;  1LRZ A;  2Q5I A;  2I4O A;  3G06 A;  4PJL A;  4PNI A;  1YFR A;  4LMJ A;  4N78 D;  4YRP A;  4PK5 A;  4B3R T;  2UXD T;  2XUE A;  4TWA A;  4NUV A;  4U33 A;  4ILU A;  3CPZ A;  3HFZ A;  3RKW A;  3HL6 A;  4B6X A;  1N32 T;  1MNE A;  3OTO T;  1JJC B;  2FUP A;  3OD1 A;  3ESL A;  5AQK B;  2KZ7 B;  4IE0 A;  2KT9 A;  2H7O A;  4IRE A;  2ZM0 A;  2Y8D A;  2DWK A;  2KXP B;  4OK0 A;  3SRZ A;  2LRK A; 
#chains in the Genus database with same CATH homology
 4P71 C;  2ZIM A;  4H02 A;  2PME A;  3DSQ A;  2CJB A;  4BWA A;  2QHV A;  4WJ3 M;  1E24 A;  1X55 A;  4XTX A;  1EIY A;  2ZNI A;  3NEM A;  2QHT A;  3LC0 A;  2E65 A;  3M4P A;  4YDQ A;  3IG2 A;  4XTY A;  3V7S A;  1B76 A;  5C53 B;  2A8E A;  2ZZG A;  3V8J A;  1J5W A;  3ERR A;  2ART A;  3QO7 A;  12AS A;  1YFT A;  3P8V A;  1EQR A;  4XEO A;  4XU2 A;  3WQZ A;  1E1T A;  3REU A;  1B8A A;  3HY1 A;  4P73 C;  1B7Y A;  1FYF A;  3PCO B;  1VQZ A;  3NET A;  1Z7N A;  3HTZ A;  4LVJ A;  1WQW A;  2DTI A;  11AS A;  5E3I A;  1N9W A;  2FYK A;  1IL2 A;  2ZTG A;  3VBB A;  4YRM A;  4RDX A;  2HNI A;  2DTO A;  4H2W A;  3A7A A;  3MF1 A;  4H2X A;  4OLF A;  3L1A A;  4YRL A;  4WF2 A;  1EIY B;  2DTH A;  1BBU A;  4P71 A;  2Q7E A;  1G5H A;  4P3P A;  1NNH A;  1E1O A;  4DPG A;  3NEN A;  5KNN A;  4XU3 A;  4WI1 A;  1X54 A;  3IKL A;  2P5I A;  3VQW A;  4YRE A;  4XU1 A;  2ZXF A;  2DVE A;  4P75 C;  2ZCE A;  2ZZF A;  1ASZ A;  4WJ4 A;  4K87 A;  4UP7 A;  4EO4 A;  1B7Y B;  1NYQ A;  2AKW A;  1HC7 A;  2EAY A;  4KR2 A;  1WQ7 A;  4H2Y A;  2E3C A;  2RHQ A;  4RQF A;  2I4L A;  4P73 A;  2ODR C;  4UPA A;  4LVL A;  2ZT8 A;  1X2H A;  3VQX A;  1BBW A;  4HWS A;  2RHS B;  4TVY A;  4HT4 A;  1X2G A;  4HWR A;  1WPY A;  4PG3 A;  3HXV A;  3A5Z A;  3HY0 A;  3L4G A;  3UGT A;  2J3L A;  1NJ1 A;  2ALY B;  2I4M A;  3BJU A;  4YYE A;  3LSS A;  1E22 A;  1RIQ A;  4ZIB A;  2QHU A;  4CS4 A;  4H2U A;  3TEG A;  2E1H A;  1NJ5 A;  3A7R A;  2ZZE A;  1X01 A;  3TEH B;  4TQD A;  1YFS A;  1WNL A;  5ELN A;  4P72 C;  2PMF A;  4TVA B;  4YRI A;  3QO5 A;  4KR3 A;  4UP9 A;  4X5O A;  4YPF A;  1PYS A;  2ZIO A;  2DDZ A;  4O2D A;  3G1Z A;  4CH4 A;  2ZNJ A;  3HFZ B;  2EJ9 A;  1HTT A;  1WU7 A;  1QE0 A;  4HVC A;  3MF2 A;  4YRT A;  3HRI A;  3A31 A;  1NYR A;  1JJC A;  4P75 A;  3RIR A;  1H4Q A;  4YRJ A;  2RHQ B;  3A32 A;  1EVK A;  1WYD A;  4DQ2 A;  2QHS A;  2DXT A;  3NEL A;  3REX A;  4BW9 A;  1C0A A;  5C52 B;  2CJA A;  4G85 A;  3RKX A;  3L2Z A;  1WLE A;  2DKG A;  5ELO A;  2ZR3 A;  4XTZ A;  1ATI A;  1NJ2 A;  2DQ0 A;  1NJ8 A;  2I4N A;  1W66 A;  4YRS A;  1G51 A;  4YRC A;  3RF1 A;  4YRG A;  3HXW A;  2E5A A;  1ASY A;  2EL9 A;  1ADJ A;  4NCX A;  2C8M A;  4HWO A;  4P3O A;  4CH6 A;  4ZTZ B;  4TVW A;  4RMF A;  1EVL A;  4OP0 A;  2EWN A;  3FJP A;  5C51 B;  3RL6 A;  3A7U A;  3PCO A;  3LSQ A;  2AMC A;  3ICA A;  1L0W A;  4ZTU B;  1GGM A;  3QNE A;  2DJZ A;  1B70 A;  3IAL A;  4K86 A;  4Q15 A;  4YRO A;  3EFR A;  1NJ6 A;  2DZ9 A;  4J15 A;  3E9I A;  3QO8 A;  1KMN A;  3RUX A;  4EX5 A;  3UGQ A;  3KFU A;  3V7R A;  2ZR2 A;  3QTC A;  1H4S A;  3HXZ A;  4HA8 A;  3EFS A;  4TQF A;  3V7C A;  4H2X B;  4XTW A;  4RQE A;  1EOV A;  2EJG A;  3VQV A;  4E51 A;  1SER A;  3MEY A;  4YRF A;  4H2V A;  1KOG A;  3I7F A;  3IKM B;  4LNS A;  1LYL A;  4XTU A;  5F5W A;  3W3S A;  1G5I A;  4HWP A;  1BIA A;  2ODR D;  2IY5 A;  4YRK A;  2Q7H A;  1HXD A;  1Z7M A;  4L87 A;  3A5Y A;  3A74 A;  4HWT A;  4CH5 A;  5HGQ A;  4XTV A;  4H2T A;  3M4Q A;  2DU7 A;  2E41 A;  1H4V B;  4G84 A;  3HXY A;  4LVI A;  2CGH A;  4AH6 A;  2ARU A;  4TTV A;  3PZC A;  3HFV A;  3UH0 A;  2ARS A;  2AKW B;  1USY C;  4KQE A;  3RGL A;  1SET A;  4UP8 A;  2CIM A;  1X56 A;  2AMC B;  3VQY A;  2G4C A;  4P74 C;  4YP0 A;  2E10 A;  2DEQ A;  3HXU A;  3V8L A;  4YCU A;  1B70 B;  2XGT A;  3BFM A;  2ZT7 A;  3P8T A;  3HXX A;  1EFW A;  2RHS A;  2DZC A;  2Q5H A;  2ZT5 A;  3E9H A;  2E64 A;  3UFG A;  1SES A;  2P0L A;  3P8Y A;  4H2S A;  1YB3 A;  4YRR A;  1QF6 A;  3L4G B;  2CJ9 A;  3HRK A;  4YCW A;  2DQ3 A;  2ALY A;  2C7I A;  2NS6 A;  4YRQ A;  2ZIN A;  3CMQ A;  2XTI A;  1ADY A;  2DU5 A;  4CS2 A;  4K88 A;  3TEH A;  5K1X A;  1BIB A;  2IY5 B;  4P3N A;  4YCV A;  4TVA A;  2Q5I A;  1KMM A;  2I4O A;  4PHC A;  4CH3 A;  1YFR A;  1PYS B;  2J3M A;  3MQZ A;  4YRP A;  4P72 A;  2Q7G A;  3RKY A;  4TWA A;  2DXU A;  3HFZ A;  3RAC A;  3RKW A;  4CS3 A;  4XU0 A;  3TUP A;  4Q6G A;  3V8K A;  1H4T A;  1JJC B;  2ZGW A;  4YRN A;  3OD1 A;  3R07 A;  4XEM A;  1YGB A;  4LVK A;  1SRY A;  1USY A;  4LVM A;  5K1P A;  2ZT6 A;  4P74 A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...