3UFGA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
b'NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 96
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3ufgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ufgA01
2P0LA 4WJ4A 3UH0A 2C7IA 1LYLA 1EVLA 4H2XA 2IY5B 2XGTA 3P8VA 3KFUA 2QHUA 1HXDA 1QF6A 4HWSA 4TQDA 4YRFA 1IL2A 1EIYA 2J3LA 1PYSB 1X54A 3A7UA 1X2GA 4G84A 3CMQA 3NELA 1BBWA 4YDQA 4XTYA 3M4QA 1JJCB 4XTVA 4TWAA 1NJ8A 3RGLA 3QNEA 1KOGA 3MF2A 2ODRC 4PHCA 1G5HA 3RF1A 2FYKA 3QO8A 4Q6GA 4TVWA 4Q15A 2ZZGA 2PMFA 3PCOA 1X01A 3TEHA 1NYRA 4CS4A 1H4QA 4KR2A 3V8KA 1SESA 2ZIMA 4HWTA 4P3NA 3BJUA 2ODRD 3E9IA 1B70B 4TVAB 4P72A 4AH6A 2I4MA 3RL6A 1YB3A 3V8LA 3IKLA 2HNIA 1WQWA 1X2HA 3L1AA 3VQYA 5KNNA 4HWPA 4P73A 3IG2A 3HXXA 4WF2A 3L2ZA 5HGQA 3OD1A 2RHQB 3HFZA 3VQVA 3NEMA 2E1HA 4UP8A 4OLFA 4XU1A 1USYA 4KR3A 3FJPA 1WYDA 4TTVA 5ELOA 1ATIA 2P5IA 4XTWA 3HXWA 4CH5A 4EO4A 2ZTGA 2ARTA 1ASZA 1H4TA 1G51A 2ZR2A 2ZT7A 2AKWB 3LC0A 3L4GB 2Q7EA 3ICAA 1NJ5A 2DQ3A 2XTIA 3P8YA 4UP9A 1WLEA 2IY5A 2AMCA 4J15A 2DKGA 1RIQA 3RKWA 5C51B 2ZCEA 2EL9A 4L87A 4XU3A 2CJBA 3QTCA 5ELNA 4XEOA 4P74C 4YCWA 4YYEA 1PYSA 4YPFA 2DJZA 3A5YA 2QHSA 4CS3A 1KMMA 4HWRA 4WJ3M 2G4CA 2DEQA 4K87A 4YCVA 4RMFA 1EFWA 3WQZA 4YRCA 2CJ9A 1E1TA 1ADJA 1SETA 4NCXA 1YFSA 2QHTA 1N9WA 2PMEA 4P71C 2EWNA 3NETA 4WI1A 1YFRA 1NNHA 4XTUA 3UFGA 4XTXA 4ZTUB 11ASA 4CH3A 1VQZA 1BIBA 3A32A 2E41A 2ARUA 4UP7A 4DQ2A 1WQ7A 1ASYA 4YCUA 3NENA 2DU5A 1SERA 3A7RA 1WU7A 4YRGA 4YRMA 4LNSA 4TVAA 3RIRA 4YRSA 1B70A 4H2YA 3MEYA 2DTIA 3LSQA 4YREA 2ZIOA 4YRJA 3A5ZA 4P75C 2CJAA 3IALA 4H2WA 2ZNIA 1FYFA 1QE0A 4CH4A 4YRRA 2EJFA 3HXUA 4YRKA 4H2UA 3VQXA 2RHQA 2E10A 2DDZA 1NJ1A 2ZZFA 1YFTA 2I4OA 1Z7MA 4XU2A 1EVKA 3HRIA 3MF1A 4K86A 1WPYA 5C52B 4XU0A 4P71A 1NJ2A 1X56A 4YRIA 3EFSA 3V7RA 2E3CA 4ZIBA 4YRQA 3A31A 2AKWA 2Q7GA 2ZXFA 2DVEA 4YP0A 2ZT6A 1BIAA 1GGMA 4HWOA 3V8JA 1B76A 1NYQA 2QHVA 3RKYA 1KMNA 3V7SA 4K88A 3QO7A 1E22A 3P8TA 2ARSA 2DZ9A 2C8MA 3HRKA 1E24A 3VBBA 3HFZB 3TEGA 4YRPA 1B7YB 2E65A 3DSQA 1X55A 3HXVA 2ZT8A 4YRLA 3W3SA 2CIMA 1ADYA 2DZCA 4H02A 1H4SA 3EFRA 2ALYB 4H2TA 1JJCA 2I4NA 3A7AA 2I4LA 3I7FA 2E64A 2RHSB 5F5WA 1NJ6A 4P72C 2E5AA 4CS2A 2AMCB 3BFMA 2DTHA 2Q7HA 4XTZA 2EJ9A 1W66A 2Q5IA 4P73C 2DXUA 4RQFA 4KQEA 4H2XB 3HY1A 3ERRA 4HA8A 3TUPA 3HY0A 3R07A 4P3OA 1C0AA 1SRYA 3QO5A 3HTZA 5K1XA 1USYC 1EIYB 2ZZEA 4TQFA 4ZTZB 3M4PA 4YRTA 4G85A 4P74A 4RDXA 2DU7A 3LSSA 4PG3A 4P3PA 4XEMA 2DTOA 2ZGWA 1J5WA 1EOVA 1YGBA 4OP0A 12ASA 3VQWA 3REUA 4O2DA 4TVYA 3G1ZA 1HC7A 1WNLA 2DQ0A 2DXTA 3PCOB 3TEHB 1HTTA 3HFVA 3V7CA 4YROA 3L4GA 3REXA 3RUXA 3HXZA 4RQEA 4X5OA 4CH6A 1BBUA 2ZR3A 1G5IA 4BW9A 4EX5A 5E3IA 1Z7NA 1L0WA 4DPGA 2J3MA 3E9HA 4BWAA 3UGQA 4E51A 1EQRA 1B7YA 5C53B 4P75A 1B8AA 2ZT5A 2EAYA 4H2VA 4UPAA 2ZINA 3UGTA 4H2SA 3RACA 2ALYA 3IKMB 1E1OA 2CGHA 2RHSA 2Q5HA 2EJGA 3RKXA 4YRNA 4HVCA 3HXYA 3PZCA 2ZNJA 1H4VB 3A74A 5K1PA
chains in the Genus database with same CATH superfamily
3F2EA 5ADXL 1VCTA 4ISTA 4AKHA 3CQGB 2LSIA 2XGTA 4CI3B 4A98A 4QXBB 5GONE 2B1EA 5L3DB 5KXJA 2MTQA 4TQDA 1IL2A 2MBGA 2XQ4A 3A7UA 5L3GB 4KBMB 3G06A 4J2CA 3NELA 2PJQA 4ASKA 2W66A 3EAMA 3TLSA 4DVDA 3RYCE 4TX5A 4IIJE 3MJXA 2ZM8A 4TWAA 1KNZA 4DMVA 4IDNA 5LBQB 4KX6A 1XNQT 2L9QA 3MF2A 2LHNA 2D0UA 1G5HA 2WZIA 3RF1A 1JNRA 2BS3A 2X9HA 4EEBA 3UU4A 2CXDA 1NYRA 4ZOLE 3CIRA 4Z8XA 4HWTA 4P3NA 3E9IA 1B70B 3RKGA 1VRBA 2XHEB 2LEHA 2ZMAA 3PJAA 3UU6A 3JCFA 3V8LA 4YHJA 1X2HA 4HFCA 3P4SA 4IDQA 4P73A 3IG2A 4JI6T 3HXXA 1BR1A 3NVOA 2GK9A 2Q9QB 3L2ZA 4UV9B 1QLBA 2WS3A 3VQVA 2E1HA 4UP8A 4XBFB 4YY3T 1USYA 3TLWA 3DJBA 4TTVA 5ELOA 3RYIE 3GN5A 3HXWA 2ZTGA 3OYXA 1YXRA 5ABFB 1ASZA 2EHOD 2ZR2A 5HAXA 2ZT7A 3FZKB 3LC0A 3KBUA 1MNDA 4TZ4C 5HEOA 2WM9A 4EV6A 4DV4T 2DWKA 2CJBA 3P50A 4XEOA 1U4QA 2W67A 2NW9A 3PUVF 4IGUA 2YINA 1WRDA 4YPFA 3IBPA 2LT3A 4UIGA 1KMMA 4WJ3M 3AECA 4K87A 3IHRA 2X0HA 3WQZA 3AE2A 3CMLA 2LHRA 2CPTA 2ZM6T 1ADJA 1SETA 2QHTA 4UV8B 2JQQA 1HNXT 3H37A 3SRZA 3JADA 3QC9A 2W2UA 2VURA 4XTXA 2J4GA 5AQOB 5JTGA 2IIUA 4K0UA 3OPCA 3A8YC 2ARUA 5F8PA 1WQ7A 1KFYA 3CKDA 2FJDA 4DBQA 2DU5A 1SERA 3RHWA 4X5TA 1WU7A 5AFUL 2IAKA 1B70A 2ZM2A 4OX9T 4OYKA 2K9AA 3C4ZA 5FL1A 4AKGA 3LSQA 3OVUA 4UR9A 4I4TE 2ODUA 3J7Yq 3T8OA 2V5CA 4CN1A 4JI2T 2X51A 2I0MA 2XJ7A 3OBVE 2X0YA 2DNXA 4PJNA 2Q9QA 3RI5A 4H2UA 5AQVB 3ZJ1A 4LFBT 4JEHB 5KMGP 4YSXA 2ZZFA 1YFTA 1WLXA 4PJJA 2C0SA 1WPYA 2CM0A 2A72A 4KHZF 4P71A 3ZSTA 2VKHA 5ABFA 3V7RA 1D0YA 2CEAA 2EHOC 3KV9A 3A31A 4NUUA 2LM2A 2WU2A 4O4IE 4HFBA 1ZKEA 4MBQA 2DVEA 4YP0A 2PBIA 4ZS3A 4LVIA 2NTYA 2BVLA 1BIAA 1QSDA 3OYZA 2E5LT 4HWOA 3JAFA 2CRBA 2QHVA 3L39A 3RKYA 3JAEA 4K88A 4DV7T 4B3MT 2LKHA 5AQFB 5HEGA 3UQ7A 3QO7A 3AXJA 2DZ9A 3QK6A 2IMLA 3SFDA 3UULA 1HTJF 4GK5E 1XMOT 3R6NA 3N5LA 3ZLIA 2WAUA 1X55A 4YRLA 2KT9A 1X9BA 3W3SA 2X9XA 2I6HA 4LF4T 2L8KA 2XUEA 5JDHA 4PK5A 4H02A 1H4SA 4DR7T 2ALYB 2XQ5A 1N32T 5KX5E 4JBWF 2I4NA 2I4LA 3A7AA 3SS1A 1YQ3A 2E64A 1YD8G 4PK4A 3AEGA 3MXZA 1NEKA 5FXVA 2YK0A 2Q7HA 4JEUB 4XTZA 5LXTE 5FXWA 4ANJA 3ZMVB 5EK2A 2ACZA 4TNVA 4WZXA 5AQRB 4DV6T 3UUNA 3HTZA 1XMQT 1HFAA 5K1XA 4KI0F 3AVSA 4COFA 5LNKA 3NRYA 4LFAT 4LVMA 4ZTZB 2XSBA 1YKHB 4G85A 4P74A 2WMNA 3AA1B 4AQFA 1FEWA 4PG3A 4ERRA 1LVKA 5AQUB 3QNUA 3PUAA 2JQKA 2DTOA 1WYCA 2WQYA 3PUZF 2N9DA 1X79A 3K3QC 3WAKA 1KF6A 1L0VA 4TVYA 5HWYA 2XQ7A 1HC7A 1OXZA 3HL6A 3RQWA 5JDLA 3UU5A 3TEHB 5LJMA 3IF8B 5AQKB 2XAFB 2W4XA 3RUXA 3HXZA 2KWHA 2Y48B 3ZMSB 2ZR3A 2K48A 1US7B 1KEYA 4PW8A 4LF9T 1L0WA 3KINB 4DPGA 4BWAA 3UGQA 2YDSA 5HXHA 1JNZA 2XSAA 1QUUA 4LF7T 4LVLA 2J62A 2FJBA 1CHUA 2JMHA 5HYAA 2ZINA 3KVBA 2WWUA 2ALYA 3Q5DA 1J5ET 2CXFA 4U2ZA 2CCQA 3CQCB 1ZOYA 1H4VB 3C50A 2QRXA 4LVKA 2XTLA 4P1NA 3UH0A 2CLYC 1LYLA 1EVLA 3DP7A 2M6BA 2X9WA 5LG4A 4CI2B 3OTOT 4X64T 3T1HT 1VCSA 2VB6A 5AQLB 4EXTA 3P8VA 2JJ9A 5AQNB 3PUYF 5HXCA 2C5IT 2QHUA 3KFUA 1QF6A 2FJAA 4OK0A 1ZEEA 3Q9DA 4Z91A 4U7IA 1PYSB 4EGWA 2YEVC 4H9RC 3CX8B 3AB3B 4WNKA 4DNDA 1V9DA 2IC6A 3AE1A 3CMQA 1Z0PA 2RA1A 4P0AA 2JIWA 1D0ZA 4IE5A 1W09A 4B3ST 4ZI7E 4YDQA 3RIUA 5FL0A 3N9NA 4XTVA 3I9WA 4HEAA 4HWDA 1NJ8A 2M6IA 3QNEA 3WI3A 2QVAA 3QO8A 4OFZA 4V1Av 2X0LB 5LBMA 4AKRB 4HN9A 2ZZGA 4JI3T 3TEHA 1AJ3A 3O1HA 4KR2A 2E9XC 3ONXA 3V8KA 5FY7A 3N2OA 1D0XA 4QHOA 2N1GA 1WR6A 2G0UA 1YB3A 2VKOA 1E7PA 5FYMA 3N9QA 1M62A 4WF2A 2UU9T 2XAQB 5DQVA 3L3PA 2Z6EA 3LG7A 5HGQA 3OD1A 1UURA 4H9OC 3HFZA 4O4JE 4P09A 4IREA 2MYSA 4KR3A 3LK3B 3FJPA 3ZMUB 1WYDA 2P5IA 1XDOA 4XTWA 3EVYA 1IJ6A 3I0QA 3QUJA 5L3BB 4EO4A 3C64A 2V7IA 1H4TA 1G51A 4U72A 3L4GB 3ICAA 1H7CA 2YU1A 5L2LA 2XTIA 2V6XA 3O1JA 2AMCA 4O2BE 1HX1B 3RKWA 3RKOA 1HS7A 5ELNA 4YCWA 3ABVA 4IDZA 4YYEA 2KWIB 2CWOA 3ZYKA 3AE8A 1PYSA 3FZHB 2DJZA 2QHSA 3A5YA 4HWRA 4ZXLA 3E22E 5AQMB 5JR9B 2DEQA 4E7SA 3AEBA 4RMFA 2DL1A 3UFEA 3C98B 4EZHA 1EFWA 1BR2A 5DABA 5HEUA 1YQ4A 4H63V 3N9OA 3ANWB 4A5XA 4LMJA 2HN1A 2CJ9A 1XDPA 4EZ4A 4NCXA 3ZT6A 4TWDA 4YJ3E 3ZEFB 2BG9C 3NETA 1FIOA 5CGMA 1T72A 5L4EA 2P9BA 3UFGA 11ASA 5JREA 5L4HA 1VQZA 4HFVA 1Y64B 3A32A 2H88A 3LSVA 3PDYA 2OV9A 5LMNT 4O4LE 4UP7A 2KSRA 4DQ2A 2IUBA 4YCUA 3NENA 2K24A 2E8IA 3PTRB 1MMDA 1Z8UA 4YRSA 5LGNB 2W61A 4AQYT 4YHHT 3MEYA 2XM1A 3MZKB 4YREA 3KFWX 5CJ5A 3HR0A 3P4RA 4YRJA 5C2TA 2CJAA 3PUGA 1OEDC 5LGUB 2DWGA 4GYSA 1HG5A 4YFSA 4YRRA 4BA9A 2EJFA 4YRKA 2C5KT 4AQGA 1KNRA 2NP9A 3VR9A 2BKOA 2RP4A 2I4OA 1Z7MA 4XU2A 3HRIA 4NPPA 4HFDA 5C52B 5CA0E 3KBTA 4K0KT 4QH1A 1NJ2A 4YRIA 2KXPB 2UXDT 4YRQA 3E08A 3UU3A 3TLTA 4Q25A 4ZS2A 5LCYA 1W0AA 1N34T 4DR4T 2ZT6A 3T1YT 2BBHA 3SFEA 4DUYT 3DTOA 4QX8B 2I59A 4U3CA 2FUPA 2RPAA 3NBXX 5JR9A 5TAOA 2C8MA 2DHRA 1E24A 3ANWA 5J2TE 3ZYLA 2CHOA 2W0GA 1E1HB 3PJAJ 5H6QB 1R8IA 3HXVA 4JI7T 4HKAA 1I6ZA 1NENA 2IC9A 5LA6E 4GKKT 1T8BA 1SHZC 4H2TA 2WU5A 5JVDE 5BR8T 2WBLA 3ZPOA 1G73A 5F5WA 4BAYB 4IE6A 3N2KE 1IAPA 1UCUA 2HN2A 3CWZB 4CQIA 1D1AA 3PUXF 4EAHA 5HXSA 2DTHA 4QX7B 1B7TA 2LM9A 1BR4A 2BVMA 4P73C 2VVSA 2NWBA 2Y6XA 3HY1A 2E5VA 4A56A 3ERRA 4HA8A 3TUPA 3HY0A 2XQ8A 2X9YA 3R07A 3AA0B 4YTNA 1HCIA 1IJ5A 3FBLA 4YXDA 1USYC 1EIYB 2ZZEA 4TQFA 2XQ9A 1ZP0A 1J1JA 4RDXA 3HKCE 3J9X1 4HT4A 4ZZBA 3LSSA 4HWIB 4LFCT 3AEDA 3AE4A 4XEMA 1EOVA 4HGAA 1SUMB 3ZCIA 3AAEB 12ASA 1IBKT 3REUA 3G1ZA 4HE8A 3D0TA 4IDOA 2X67A 3M3ZB 1VOMA 3Q5WA 5LB7B 1HTTA 3V7CA 4RQEA 2CLYB 4X5OA 2L3LA 3FHNA 2A3DA 2R6GF 2WB5A 1BBUA 2E2AA 1ZHCA 4JI5T 4YTMA 1Z7NA 3O4XE 2N2NA 3QOFA 2J3MA 3RIAA 3ETVA 4DR3T 5DQWA 4PFOA 4TWFA 2CWYA 4ISSA 5C53B 5L3EB 4P75A 2BS4A 3RX6A 2XQYA 4H2VA 3UGTA 4H2SA 5J2UE 3RACA 2XQ6A 2D9DA 3IKMB 3RKXA 1G8XA 3SWHA 2YN6A 5EZYE 3AE7A 3ONLC 2XQ3A 2CA5A 4WJ4A 3EABA 4G63A 3ZN0B 2Q9QC 5CB4E 2A9UA 5L3CB 3AEAA 3NWIA 4AIUA 4PAGA 3LK42 4HWSA 1FMVA 4HWHA 4YRFA 2ACXA 1EIYA 4EYUA 2J3LA 1X54A 3F31A 2K3WA 2K5BB 5LGTB 3S4UA 1X2GA 4G84A 4HFHA 1BBWA 2LSKA 3FBZA 4IE4A 4X1KE 4NXMT 4ZI2C 3P8CD 1JJCB 4DV0T 2XY8B 1N33T 3K1SA 4U7YA 4L9IA 3ESLA 2LSGA 2VASA 4IE0A 3RGLA 1KOGA 1XWMA 2ODRC 3PE0A 3KV4A 3LJCA 4BJMA 3HI2A 2FYKA 2V7JA 4Q6GA 2HHHT 2BG9E 1FMWA 4TVWA 5CFBA 4CN4A 2XAJB 4UF0B 1NWMX 1LRZA 2QA7A 4JLEA 4X1IE 4CS4A 2YU2A 4GKJT 2ZIMA 3BJUA 2YDQA 4P72A 3RL6A 3IKLA 2HNIA 1WQWA 3R84B 4EB6E 2XZEA 5KNNA 4HWPA 2E9XD 2H3RA 3LDQB 3FXDB 3FZLB 2BKNA 3CPZA 1OEDE 3ZMTB 2OA5A 4ZZCA 3NEMA 3EUHA 2KLQA 1W0BA 2ARTA 2BG9B 4LF6T 2UUBT 2WCAA 4UVBB 2FJEA 2AKWB 3ZSSA 5FP3A 3U3IA 1HG2A 2Q7EA 2LLYA 1NJ5A 2DQ3A 3MQZA 3P8YA 4UP9A 1MMAA 1WLEA 3O1IA 2CBJA 1D1CA 4J15A 3CQXC 4CI1B 3FB2A 3ZT7A 4L87A 2IDOB 4XU3A 3QTCA 4P74C 3RIFA 4CN6A 2BKPA 2X68A 4CS3A 2W63A 1KK7A 3Q5EA 2VKDA 1O3XA 4X20E 2PG8A 2QYWA 3AVRA 2WDVA 4AI6A 4YRCA 5HEJA 4X1YE 3VKGA 1NAFA 2PMEA 4JUYA 5FXXA 2EWNA 2M67A 1YFRA 3H3AA 3FZFB 1NNHA 4H9SE 5LYJE 4CH3A 1DU2A 5LJNA 4E7ZA 1BIBA 3ONJA 4TWHA 2E41A 3AE5A 1KNPA 3ZMZB 5J1GA 1ASYA 4LMLA 3A7RA 1YW0A 3KV6A 2CMRA 4YRMA 4LNSA 4CXWA 3B13A 1HR0T 4KUMB 4H2YA 2W00A 2ZIOA 5FMNA 3A5ZA 4H2WA 2ZNIA 4O8SA 1FYFA 4QWNB 1IZNB 2LSYA 4XZCA 2WMOA 2NS6A 2DDZA 1BR0A 3I1AA 4IHJE 1UX4A 4K86A 1FJGT 5AQGB 2OLTA 2BG9A 3EFSA 4IL9A 5AQPB 2D2SA 4GIWA 4EEDA 4A97A 2AKWA 2LJLA 3JC6C 4PFPA 5LG3A 4DV3T 4QKNA 3GWHA 4IDPA 1GGMA 2JMKA 2BDEA 5L47A 1NYQA 1IBMT 5FNVE 1SE7A 4O4HE 1KMNA 3V7SA 4JV5T 5H6RB 3GMIA 3E0ZA 4KMCA 3L8RA 3P8TA 2A2FX 5IHYA 2ARSA 3UU8A 4YSZA 4UEMA 1IBLT 4DR2T 3VBBA 1MMNA 4C90A 3TEGA 1B7YB 2E65A 3DSQA 4GYRA 4AKIA 2KINB 3P7IA 3KVAA 4U74A 5IYZE 2CIMA 1ADYA 5FVKA 2LE8A 2DZCA 3EHZA 4I55E 5IWAT 3EFRA 3N9PA 3RH3A 2VL8A 1NJ6A 2XPKA 2E5AA 5HXRA 4ILAA 2VQFT 4CS2A 1CUNA 2XAHB 3BFMA 2MPKA 3PU8A 2LKGA 4ILCA 2EJ9A 1W66A 3NRXA 1MIYA 4LMKA 4DV5T 4O2AE 2YKSA 2DXUA 4UVCB 4H2XB 2EHOB 3BQLA 4P3OA 3HKDE 4OYJA 4I0UA 1SRYA 4X62T 2J1DG 4CZZB 3OJAA 5ABHA 3LBXB 2CXLA 2BS2A 3UTKA 3M4PA 2V6YB 2V5DA 3RC8A 3AAAB 4YRTA 1I94T 5FY0A 5JDNA 2DU7A 1MIVA 4H9NC 4P3PA 4B6XA 2UXXB 4YTPA 4WBNE 3V5SA 3K3OA 5JH7E 4YJ2E 3AE3A 3EI0A 2DCFA 4DBRA 4LF5T 3A5XA 1E2AA 4DIDB 1S94A 4B3RT 1YGBA 3PU3A 4BJNA 3AA7B 3RRCA 4AKLA 2QGSA 5FY1A 3FZMB 4AISA 5AQTB 3RRWA 1HX8A 2JRKA 2BBJA 1WNLA 2HH7A 4UXNB 2KMFA 3ZT5A 3PCOB 3ZKRA 3SOLA 4YROA 4F6RC 3L4GA 3REXA 1UGOA 2NW7A 3AAIA 4CH6A 3QB5A 1HF8A 4M1PA 1G5IA 4TV8E 2W62A 4EX5A 1T7SA 3O9XA 4DUZT 5E3IA 3Q2MA 2KZ7B 4PJMA 4TV9E 3E9HA 4E51A 4WBOA 3CVRA 1EQRA 1B7YA 5AQQB 2NW8A 3F57A 4CXXA 4DO0A 3ZYMA 5JQGE 4UPAA 1D1BA 3ZCJA 3C4XA 4KP3C 3P4QA 4HWFA 3NKZA 1E1OA 2CGHA 4YRNA 2EJGA 5J0ZA 4DV1T 1GQEA 4L0RA 3IEEA 2XM2A 2V7KA 2P0LA 3N9MA 2C7IA 3RYFE 5C8YE 5EK3A 4H2XA 2JQHA 1UX5A 4FI5A 2H89A 2EHOA 1HNWT 5F3JA 2IY5B 3AE6A 4PNIA 3AXJB 3RQUA 2ES0A 2WZHA 1HXDA 4ILBA 4WW0A 4F8HA 5L3FB 4TUYE 3LBXA 5LHHB 1UUSA 2V6YA 3BQKA 5AQHB 2Q9QD 5HXEA 2H7OA 4JI4T 2WDRA 5CA1E 2D0TA 3VU7H 4IE7A 3Q5XA 3UT5E 2AE9A 4EOZB 5ABEA 5LHGB 4XTYA 3M4QA 4KHPT 2DLRA 4MHCA 3RLFF 3I9YA 1WFDA 4MALA 4U2YA 3BK9A 4PHCA 3VHLA 2XQAA 2UXBT 4B3TT 5AQIB 4EYYR 4ZI2D 4Q15A 5JR9C 4TNWA 2PMFA 2KNDA 3PCOA 1X01A 1H4QA 4NXNT 2V1DB 1N36T 3UUXB 2WDQA 4ZI3D 1SESA 4TVAB 2ODRD 4DR5T 1T98A 3AEEA 2F4VT 4AH6A 2I4MA 1SA0E 4N78D 3ZC0A 3I0OA 2CHNA 3L1AA 3VQYA 3CX6B 2FBWA 1MMGA 3QB5K 3X1DA 1UK5A 3VRAA 2RHQB 3UQ4A 3U78A 4GK0E 4OLFA 4XU1A 4GOUA 5JRCB 5JDMA 1ATIA 4G2AA 4CH5A 2WY2A 4DR1T 5FVLA 2ZLYA 4I50E 3EDVA 2Y8DA 1EZ3A 5LHIB 2IY5A 2ODVA 5HEHA 2YOEA 2DKGA 1RIQA 3NZQA 5C51B 2ZCEA 2EL9A 4QXHB 2CBIA 3K8PC 3FXEB 2G4CA 4JI0T 2SPCA 4H9PC 4YCVA 4QH4A 4AXPA 4X65T 2E9XB 1E1TA 1U5PA 1YFSA 1N9WA 3K3NA 4P71C 3V5UA 5EK4A 4WI1A 3LFMA 4XTUA 3PUQA 4MLKA 5C3JA 3MK7C 4ZTUB 3TLVA 3AEFA 4FJOA 3H3MA 3EDUA 4Z90A 3L09A 4C91A 5BMVE 2PFVA 3PURA 4L5GA 3UUBA 4OHFA 4I43B 5AQJB 4QXCB 4MFRA 5KDMC 4ZI3C 4YRGA 2YDRA 4H63H 2HPLA 4TVAA 3RIRA 2UUCT 5E0OA 2DTIA 4HFEA 4P75C 4H9QC 5JDFA 5LOVE 3IALA 2IHR1 3BQIA 3TLUA 3C4WA 3P4WA 5FXZA 1XZYA 1QE0A 4CH4A 3CX7B 5DJQC 3B5MA 3HXUA 3VQXA 2BZBA 2RHQA 2VVNA 2E10A 3LK2B 4HFIA 3A7MA 1NJ1A 3WAJA 5JRCA 1EVKA 1M7KA 2V26A 3MF1A 5A1LA 3N2GE 2X66A 4XU0A 2HPJA 4JI1T 1X56A 2V7MA 5M4YA 2E3CA 4ILUA 4ZIBA 3ZJ2A 2WWVA 2NTXA 5ETWA 2Q7GA 2V7LA 3UUMA 2ZXFA 2MAWA 4PK6A 3PUWF 2VQET 3M65A 3V8JA 1B76A 2H7VC 2B76A 3HA4A 5HCMA 4DMWA 1Y01A 2IW5B 3HKBE 3GA8A 3AE9A 2CE7A 2V8SV 5IUXA 3RYHE 2UXNB 3JC6D 2ZM0A 4ZHQE 1MNEA 2D5UA 1E22A 4HTEA 2VL0A 4U33A 2UXCT 3PUSA 3HRKA 2E9XA 3IA3A 3HFZB 4AQFC 4YRPA 4DR6T 4NUVA 2ZT8A 2XASB 2AXDS 1OEDB 2DI4A 2WP9A 1MIWA 4YSYA 5JDGA 4DV2T 1JJCA 3I7FA 2RHSB 4EIWA 1HNZT 4LVJA 4P72C 2LRKA 3ZC1A 3C51A 2AMCB 2LSJA 3NZPA 3CK6A 2JQ9A 2C5JA 2VWAA 2Q5IA 2PTFA 4CXYA 4RQFA 5LP6E 4KQEA 4YT0A 4UF0A 4JI8T 4WYVA 3ZN1B 4IT4A 5HCJA 3MKDA 1C0AA 4XAXB 3PV0F 3QO5A 2JPFA 3W15B 2J47A 3B57A 4TN7B 3KV5A 3VRBA 2LRLA 1OWAA 4NIQA 2LOPA 3MA9A 5JDQA 4U31A 3RPUA 1S35A 3VR8A 2NR4A 4UELA 2ZGWA 1J5WA 3RC3A 4OP0A 3AA6B 2WSSV 4UVAB 1WYBA 3VQWA 4O2DA 5HWXA 2A8EA 4YLHA 3VKHA 2XAGB 2DQ0A 4P0BA 2DXTA 3HFVA 1W9RA 4X66T 1LVFA 1ZV4X 5ABGA 3OKQA 5FKYA 4BW9A 1XNRT 4PJLA 2LOSA 4ZEYA 2VKJA 1B8AA 3RIUC 2ZT5A 3P4PA 4HWCA 4IL4A 4ADZA 1OEDA 4QH5A 2MOZA 2EAYA 3HKEE 2UUAT 2VK9A 3ETUA 3TKLB 3N9LA 2RHSA 1WCRA 2Q5HA 4HVCA 4JYAT 3GN5B 3HXYA 3PZCA 5LMUT 1LKXA 2NOXA 4LF8T 2ZNJA 3A74A 1YKEB 3MACA 1WR0A 5K1PA 3KDSE 5AQSB
chains in the Genus database with same CATH topology
2P0LA 4WJ4A 3UH0A 2C7IA 1LYLA 1EVLA 4H2XA 2IY5B 2XGTA 3P8VA 3KFUA 2QHUA 1HXDA 1QF6A 4HWSA 4TQDA 4YRFA 1IL2A 1EIYA 2J3LA 1PYSB 1X54A 3A7UA 1X2GA 4G84A 3CMQA 3NELA 1BBWA 4YDQA 4XTYA 3M4QA 1JJCB 4XTVA 4TWAA 1NJ8A 3RGLA 3QNEA 1KOGA 3MF2A 2ODRC 4PHCA 1G5HA 3RF1A 2FYKA 3QO8A 4Q6GA 4TVWA 4Q15A 2ZZGA 2PMFA 3PCOA 1X01A 3TEHA 1NYRA 4CS4A 1H4QA 4KR2A 3V8KA 1SESA 2ZIMA 4HWTA 4P3NA 3BJUA 2ODRD 3E9IA 1B70B 4TVAB 4P72A 4AH6A 2I4MA 3RL6A 1YB3A 3V8LA 3IKLA 2HNIA 1WQWA 1X2HA 3L1AA 3VQYA 5KNNA 4HWPA 4P73A 3IG2A 3HXXA 4WF2A 3L2ZA 5HGQA 3OD1A 2RHQB 3HFZA 3VQVA 3NEMA 2E1HA 4UP8A 4OLFA 4XU1A 1USYA 4KR3A 3FJPA 1WYDA 4TTVA 5ELOA 1ATIA 2P5IA 4XTWA 3HXWA 4CH5A 4EO4A 2ZTGA 2ARTA 1ASZA 1H4TA 1G51A 2ZR2A 2ZT7A 2AKWB 3LC0A 3L4GB 2Q7EA 3ICAA 1NJ5A 2DQ3A 2XTIA 3MQZA 3P8YA 4UP9A 1WLEA 2IY5A 2AMCA 4J15A 2DKGA 1RIQA 3RKWA 5C51B 2ZCEA 2EL9A 4L87A 4XU3A 2CJBA 3QTCA 5ELNA 4XEOA 4P74C 4YCWA 4YYEA 1PYSA 4YPFA 2DJZA 3A5YA 2QHSA 4CS3A 1KMMA 4HWRA 4WJ3M 2G4CA 2DEQA 4K87A 4YCVA 4RMFA 1EFWA 3WQZA 4YRCA 2CJ9A 1E1TA 1ADJA 1SETA 4NCXA 1YFSA 2QHTA 1N9WA 2PMEA 4P71C 2EWNA 3NETA 4WI1A 1YFRA 1NNHA 4XTUA 3UFGA 4XTXA 4ZTUB 11ASA 4CH3A 1VQZA 1BIBA 3A32A 2E41A 2ARUA 4UP7A 4DQ2A 1WQ7A 1ASYA 4YCUA 3NENA 2DU5A 1SERA 3A7RA 1WU7A 4YRGA 4YRMA 4LNSA 4TVAA 3RIRA 4YRSA 1B70A 4H2YA 3MEYA 2DTIA 3LSQA 4YREA 2ZIOA 4YRJA 3A5ZA 4P75C 2CJAA 3IALA 4H2WA 2ZNIA 1FYFA 1QE0A 4CH4A 4YRRA 2EJFA 3HXUA 4YRKA 4H2UA 3VQXA 2RHQA 2E10A 2NS6A 2DDZA 1NJ1A 2ZZFA 1YFTA 2I4OA 1Z7MA 4XU2A 1EVKA 3HRIA 3MF1A 4K86A 1WPYA 5C52B 4XU0A 4P71A 1NJ2A 1X56A 4YRIA 3EFSA 3V7RA 2E3CA 4ZIBA 4YRQA 3A31A 2AKWA 2Q7GA 2ZXFA 2DVEA 4YP0A 2ZT6A 4LVIA 1BIAA 1GGMA 4HWOA 3V8JA 1B76A 1NYQA 2QHVA 3RKYA 1KMNA 3V7SA 4K88A 3QO7A 1E22A 3P8TA 2ARSA 2DZ9A 2C8MA 3HRKA 1E24A 3VBBA 3HFZB 3TEGA 4YRPA 1B7YB 2E65A 3DSQA 1X55A 3HXVA 2ZT8A 4YRLA 3W3SA 2CIMA 1ADYA 2DZCA 4H02A 1H4SA 3EFRA 2ALYB 4H2TA 1JJCA 2I4NA 3A7AA 2I4LA 3I7FA 2E64A 2RHSB 5F5WA 1NJ6A 4LVJA 4P72C 2E5AA 4CS2A 2AMCB 3BFMA 2DTHA 2Q7HA 4XTZA 2EJ9A 1W66A 2Q5IA 4P73C 2DXUA 4RQFA 4KQEA 4H2XB 3HY1A 3ERRA 4HA8A 3TUPA 3HY0A 3R07A 4P3OA 1C0AA 1SRYA 3QO5A 3HTZA 5K1XA 1USYC 1EIYB 2ZZEA 4TQFA 4ZTZB 4LVMA 3M4PA 4YRTA 4G85A 4P74A 4RDXA 2DU7A 4HT4A 3LSSA 4PG3A 4P3PA 4XEMA 2DTOA 2ZGWA 1J5WA 1EOVA 1YGBA 4OP0A 12ASA 3VQWA 3REUA 4O2DA 4TVYA 2A8EA 3G1ZA 1HC7A 1WNLA 2DQ0A 2DXTA 3PCOB 3TEHB 1HTTA 3HFVA 3V7CA 4YROA 3L4GA 3REXA 3RUXA 3HXZA 4RQEA 4X5OA 4CH6A 1BBUA 2ZR3A 1G5IA 4BW9A 4EX5A 5E3IA 1Z7NA 1L0WA 4DPGA 2J3MA 3E9HA 4BWAA 3UGQA 4E51A 1EQRA 1B7YA 5C53B 4P75A 1B8AA 4LVLA 2ZT5A 2EAYA 4H2VA 4UPAA 2ZINA 3UGTA 4H2SA 3RACA 2ALYA 3IKMB 1E1OA 2CGHA 2RHSA 2Q5HA 2EJGA 3RKXA 4YRNA 4HVCA 3HXYA 3PZCA 2ZNJA 1H4VB 3A74A 5K1PA 4LVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0L A;  4WJ4 A;  3UH0 A;  2C7I A;  1LYL A;  1EVL A;  4H2X A;  2IY5 B;  2XGT A;  3P8V A;  3KFU A;  2QHU A;  1HXD A;  1QF6 A;  4HWS A;  4TQD A;  4YRF A;  1IL2 A;  1EIY A;  2J3L A;  1PYS B;  1X54 A;  3A7U A;  1X2G A;  4G84 A;  3CMQ A;  3NEL A;  1BBW A;  4YDQ A;  4XTY A;  3M4Q A;  1JJC B;  4XTV A;  4TWA A;  1NJ8 A;  3RGL A;  3QNE A;  1KOG A;  3MF2 A;  2ODR C;  4PHC A;  1G5H A;  3RF1 A;  2FYK A;  3QO8 A;  4Q6G A;  4TVW A;  4Q15 A;  2ZZG A;  2PMF A;  3PCO A;  1X01 A;  3TEH A;  1NYR A;  4CS4 A;  1H4Q A;  4KR2 A;  3V8K A;  1SES A;  2ZIM A;  4HWT A;  4P3N A;  3BJU A;  2ODR D;  3E9I A;  1B70 B;  4TVA B;  4P72 A;  4AH6 A;  2I4M A;  3RL6 A;  1YB3 A;  3V8L A;  3IKL A;  2HNI A;  1WQW A;  1X2H A;  3L1A A;  3VQY A;  5KNN A;  4HWP A;  4P73 A;  3IG2 A;  3HXX A;  4WF2 A;  3L2Z A;  5HGQ A;  3OD1 A;  2RHQ B;  3HFZ A;  3VQV A;  3NEM A;  2E1H A;  4UP8 A;  4OLF A;  4XU1 A;  1USY A;  4KR3 A;  3FJP A;  1WYD A;  4TTV A;  5ELO A;  1ATI A;  2P5I A;  4XTW A;  3HXW A;  4CH5 A;  4EO4 A;  2ZTG A;  2ART A;  1ASZ A;  1H4T A;  1G51 A;  2ZR2 A;  2ZT7 A;  2AKW B;  3LC0 A;  3L4G B;  2Q7E A;  3ICA A;  1NJ5 A;  2DQ3 A;  2XTI A;  3P8Y A;  4UP9 A;  1WLE A;  2IY5 A;  2AMC A;  4J15 A;  2DKG A;  1RIQ A;  3RKW A;  5C51 B;  2ZCE A;  2EL9 A;  4L87 A;  4XU3 A;  2CJB A;  3QTC A;  5ELN A;  4XEO A;  4P74 C;  4YCW A;  4YYE A;  1PYS A;  4YPF A;  2DJZ A;  3A5Y A;  2QHS A;  4CS3 A;  1KMM A;  4HWR A;  4WJ3 M;  2G4C A;  2DEQ A;  4K87 A;  4YCV A;  4RMF A;  1EFW A;  3WQZ A;  4YRC A;  2CJ9 A;  1E1T A;  1ADJ A;  1SET A;  4NCX A;  1YFS A;  2QHT A;  1N9W A;  2PME A;  4P71 C;  2EWN A;  3NET A;  4WI1 A;  1YFR A;  1NNH A;  4XTU A;  3UFG A;  4XTX A;  4ZTU B;  11AS A;  4CH3 A;  1VQZ A;  1BIB A;  3A32 A;  2E41 A;  2ARU A;  4UP7 A;  4DQ2 A;  1WQ7 A;  1ASY A;  4YCU A;  3NEN A;  2DU5 A;  1SER A;  3A7R A;  1WU7 A;  4YRG A;  4YRM A;  4LNS A;  4TVA A;  3RIR A;  4YRS A;  1B70 A;  4H2Y A;  3MEY A;  2DTI A;  3LSQ A;  4YRE A;  2ZIO A;  4YRJ A;  3A5Z A;  4P75 C;  2CJA A;  3IAL A;  4H2W A;  2ZNI A;  1FYF A;  1QE0 A;  4CH4 A;  4YRR A;  2EJF A;  3HXU A;  4YRK A;  4H2U A;  3VQX A;  2RHQ A;  2E10 A;  2DDZ A;  1NJ1 A;  2ZZF A;  1YFT A;  2I4O A;  1Z7M A;  4XU2 A;  1EVK A;  3HRI A;  3MF1 A;  4K86 A;  1WPY A;  5C52 B;  4XU0 A;  4P71 A;  1NJ2 A;  1X56 A;  4YRI A;  3EFS A;  3V7R A;  2E3C A;  4ZIB A;  4YRQ A;  3A31 A;  2AKW A;  2Q7G A;  2ZXF A;  2DVE A;  4YP0 A;  2ZT6 A;  1BIA A;  1GGM A;  4HWO A;  3V8J A;  1B76 A;  1NYQ A;  2QHV A;  3RKY A;  1KMN A;  3V7S A;  4K88 A;  3QO7 A;  1E22 A;  3P8T A;  2ARS A;  2DZ9 A;  2C8M A;  3HRK A;  1E24 A;  3VBB A;  3HFZ B;  3TEG A;  4YRP A;  1B7Y B;  2E65 A;  3DSQ A;  1X55 A;  3HXV A;  2ZT8 A;  4YRL A;  3W3S A;  2CIM A;  1ADY A;  2DZC A;  4H02 A;  1H4S A;  3EFR A;  2ALY B;  4H2T A;  1JJC A;  2I4N A;  3A7A A;  2I4L A;  3I7F A;  2E64 A;  2RHS B;  5F5W A;  1NJ6 A;  4P72 C;  2E5A A;  4CS2 A;  2AMC B;  3BFM A;  2DTH A;  2Q7H A;  4XTZ A;  2EJ9 A;  1W66 A;  2Q5I A;  4P73 C;  2DXU A;  4RQF A;  4KQE A;  4H2X B;  3HY1 A;  3ERR A;  4HA8 A;  3TUP A;  3HY0 A;  3R07 A;  4P3O A;  1C0A A;  1SRY A;  3QO5 A;  3HTZ A;  5K1X A;  1USY C;  1EIY B;  2ZZE A;  4TQF A;  4ZTZ B;  3M4P A;  4YRT A;  4G85 A;  4P74 A;  4RDX A;  2DU7 A;  3LSS A;  4PG3 A;  4P3P A;  4XEM A;  2DTO A;  2ZGW A;  1J5W A;  1EOV A;  1YGB A;  4OP0 A;  12AS A;  3VQW A;  3REU A;  4O2D A;  4TVY A;  3G1Z A;  1HC7 A;  1WNL A;  2DQ0 A;  2DXT A;  3PCO B;  3TEH B;  1HTT A;  3HFV A;  3V7C A;  4YRO A;  3L4G A;  3REX A;  3RUX A;  3HXZ A;  4RQE A;  4X5O A;  4CH6 A;  1BBU A;  2ZR3 A;  1G5I A;  4BW9 A;  4EX5 A;  5E3I A;  1Z7N A;  1L0W A;  4DPG A;  2J3M A;  3E9H A;  4BWA A;  3UGQ A;  4E51 A;  1EQR A;  1B7Y A;  5C53 B;  4P75 A;  1B8A A;  2ZT5 A;  2EAY A;  4H2V A;  4UPA A;  2ZIN A;  3UGT A;  4H2S A;  3RAC A;  2ALY A;  3IKM B;  1E1O A;  2CGH A;  2RHS A;  2Q5H A;  2EJG A;  3RKX A;  4YRN A;  4HVC A;  3HXY A;  3PZC A;  2ZNJ A;  1H4V B;  3A74 A;  5K1P A; 
#chains in the Genus database with same CATH topology
 3F2E A;  5ADX L;  1VCT A;  4IST A;  4AKH A;  3CQG B;  2LSI A;  2XGT A;  4CI3 B;  4A98 A;  4QXB B;  5GON E;  2B1E A;  5L3D B;  5KXJ A;  2MTQ A;  4TQD A;  1IL2 A;  2MBG A;  2XQ4 A;  3A7U A;  5L3G B;  4KBM B;  3G06 A;  4J2C A;  3NEL A;  2PJQ A;  4ASK A;  2W66 A;  3EAM A;  3TLS A;  4DVD A;  3RYC E;  4TX5 A;  4IIJ E;  3MJX A;  2ZM8 A;  4TWA A;  1KNZ A;  4DMV A;  4IDN A;  5LBQ B;  4KX6 A;  1XNQ T;  2L9Q A;  3MF2 A;  2LHN A;  2D0U A;  1G5H A;  2WZI A;  3RF1 A;  1JNR A;  2BS3 A;  2X9H A;  4EEB A;  3UU4 A;  2CXD A;  1NYR A;  4ZOL E;  3CIR A;  4Z8X A;  4HWT A;  4P3N A;  3E9I A;  1B70 B;  3RKG A;  1VRB A;  2XHE B;  2LEH A;  2ZMA A;  3PJA A;  3UU6 A;  3JCF A;  3V8L A;  4YHJ A;  1X2H A;  4HFC A;  3P4S A;  4IDQ A;  4P73 A;  3IG2 A;  4JI6 T;  3HXX A;  1BR1 A;  3NVO A;  2GK9 A;  2Q9Q B;  3L2Z A;  4UV9 B;  1QLB A;  2WS3 A;  3VQV A;  2E1H A;  4UP8 A;  4XBF B;  4YY3 T;  1USY A;  3TLW A;  3DJB A;  4TTV A;  5ELO A;  3RYI E;  3GN5 A;  3HXW A;  2ZTG A;  3OYX A;  1YXR A;  5ABF B;  1ASZ A;  2EHO D;  2ZR2 A;  5HAX A;  2ZT7 A;  3FZK B;  3LC0 A;  3KBU A;  1MND A;  4TZ4 C;  5HEO A;  2WM9 A;  4EV6 A;  4DV4 T;  2DWK A;  2CJB A;  3P50 A;  4XEO A;  1U4Q A;  2W67 A;  2NW9 A;  3PUV F;  4IGU A;  2YIN A;  1WRD A;  4YPF A;  3IBP A;  2LT3 A;  4UIG A;  1KMM A;  4WJ3 M;  3AEC A;  4K87 A;  3IHR A;  2X0H A;  3WQZ A;  3AE2 A;  3CML A;  2LHR A;  2CPT A;  2ZM6 T;  1ADJ A;  1SET A;  2QHT A;  4UV8 B;  2JQQ A;  1HNX T;  3H37 A;  3SRZ A;  3JAD A;  3QC9 A;  2W2U A;  2VUR A;  4XTX A;  2J4G A;  5AQO B;  5JTG A;  2IIU A;  4K0U A;  3OPC A;  3A8Y C;  2ARU A;  5F8P A;  1WQ7 A;  1KFY A;  3CKD A;  2FJD A;  4DBQ A;  2DU5 A;  1SER A;  3RHW A;  4X5T A;  1WU7 A;  5AFU L;  2IAK A;  1B70 A;  2ZM2 A;  4OX9 T;  4OYK A;  2K9A A;  3C4Z A;  5FL1 A;  4AKG A;  3LSQ A;  3OVU A;  4UR9 A;  4I4T E;  2ODU A;  3J7Y q;  3T8O A;  2V5C A;  4CN1 A;  4JI2 T;  2X51 A;  2I0M A;  2XJ7 A;  3OBV E;  2X0Y A;  2DNX A;  4PJN A;  2Q9Q A;  3RI5 A;  4H2U A;  5AQV B;  3ZJ1 A;  4LFB T;  4JEH B;  5KMG P;  4YSX A;  2ZZF A;  1YFT A;  1WLX A;  4PJJ A;  2C0S A;  1WPY A;  2CM0 A;  2A72 A;  4KHZ F;  4P71 A;  3ZST A;  2VKH A;  5ABF A;  3V7R A;  1D0Y A;  2CEA A;  2EHO C;  3KV9 A;  3A31 A;  4NUU A;  2LM2 A;  2WU2 A;  4O4I E;  4HFB A;  1ZKE A;  4MBQ A;  2DVE A;  4YP0 A;  2PBI A;  4ZS3 A;  4LVI A;  2NTY A;  2BVL A;  1BIA A;  1QSD A;  3OYZ A;  2E5L T;  4HWO A;  3JAF A;  2CRB A;  2QHV A;  3L39 A;  3RKY A;  3JAE A;  4K88 A;  4DV7 T;  4B3M T;  2LKH A;  5AQF B;  5HEG A;  3UQ7 A;  3QO7 A;  3AXJ A;  2DZ9 A;  3QK6 A;  2IML A;  3SFD A;  3UUL A;  1HTJ F;  4GK5 E;  1XMO T;  3R6N A;  3N5L A;  3ZLI A;  2WAU A;  1X55 A;  4YRL A;  2KT9 A;  1X9B A;  3W3S A;  2X9X A;  2I6H A;  4LF4 T;  2L8K A;  2XUE A;  5JDH A;  4PK5 A;  4H02 A;  1H4S A;  4DR7 T;  2ALY B;  2XQ5 A;  1N32 T;  5KX5 E;  4JBW F;  2I4N A;  2I4L A;  3A7A A;  3SS1 A;  1YQ3 A;  2E64 A;  1YD8 G;  4PK4 A;  3AEG A;  3MXZ A;  1NEK A;  5FXV A;  2YK0 A;  2Q7H A;  4JEU B;  4XTZ A;  5LXT E;  5FXW A;  4ANJ A;  3ZMV B;  5EK2 A;  2ACZ A;  4TNV A;  4WZX A;  5AQR B;  4DV6 T;  3UUN A;  3HTZ A;  1XMQ T;  1HFA A;  5K1X A;  4KI0 F;  3AVS A;  4COF A;  5LNK A;  3NRY A;  4LFA T;  4LVM A;  4ZTZ B;  2XSB A;  1YKH B;  4G85 A;  4P74 A;  2WMN A;  3AA1 B;  4AQF A;  1FEW A;  4PG3 A;  4ERR A;  1LVK A;  5AQU B;  3QNU A;  3PUA A;  2JQK A;  2DTO A;  1WYC A;  2WQY A;  3PUZ F;  2N9D A;  1X79 A;  3K3Q C;  3WAK A;  1KF6 A;  1L0V A;  4TVY A;  5HWY A;  2XQ7 A;  1HC7 A;  1OXZ A;  3HL6 A;  3RQW A;  5JDL A;  3UU5 A;  3TEH B;  5LJM A;  3IF8 B;  5AQK B;  2XAF B;  2W4X A;  3RUX A;  3HXZ A;  2KWH A;  2Y48 B;  3ZMS B;  2ZR3 A;  2K48 A;  1US7 B;  1KEY A;  4PW8 A;  4LF9 T;  1L0W A;  3KIN B;  4DPG A;  4BWA A;  3UGQ A;  2YDS A;  5HXH A;  1JNZ A;  2XSA A;  1QUU A;  4LF7 T;  4LVL A;  2J62 A;  2FJB A;  1CHU A;  2JMH A;  5HYA A;  2ZIN A;  3KVB A;  2WWU A;  2ALY A;  3Q5D A;  1J5E T;  2CXF A;  4U2Z A;  2CCQ A;  3CQC B;  1ZOY A;  1H4V B;  3C50 A;  2QRX A;  4LVK A;  2XTL A;  4P1N A;  3UH0 A;  2CLY C;  1LYL A;  1EVL A;  3DP7 A;  2M6B A;  2X9W A;  5LG4 A;  4CI2 B;  3OTO T;  4X64 T;  3T1H T;  1VCS A;  2VB6 A;  5AQL B;  4EXT A;  3P8V A;  2JJ9 A;  5AQN B;  3PUY F;  5HXC A;  2C5I T;  2QHU A;  3KFU A;  1QF6 A;  2FJA A;  4OK0 A;  1ZEE A;  3Q9D A;  4Z91 A;  4U7I A;  1PYS B;  4EGW A;  2YEV C;  4H9R C;  3CX8 B;  3AB3 B;  4WNK A;  4DND A;  1V9D A;  2IC6 A;  3AE1 A;  3CMQ A;  1Z0P A;  2RA1 A;  4P0A A;  2JIW A;  1D0Z A;  4IE5 A;  1W09 A;  4B3S T;  4ZI7 E;  4YDQ A;  3RIU A;  5FL0 A;  3N9N A;  4XTV A;  3I9W A;  4HEA A;  4HWD A;  1NJ8 A;  2M6I A;  3QNE A;  3WI3 A;  2QVA A;  3QO8 A;  4OFZ A;  4V1A v;  2X0L B;  5LBM A;  4AKR B;  4HN9 A;  2ZZG A;  4JI3 T;  3TEH A;  1AJ3 A;  3O1H A;  4KR2 A;  2E9X C;  3ONX A;  3V8K A;  5FY7 A;  3N2O A;  1D0X A;  4QHO A;  2N1G A;  1WR6 A;  2G0U A;  1YB3 A;  2VKO A;  1E7P A;  5FYM A;  3N9Q A;  1M62 A;  4WF2 A;  2UU9 T;  2XAQ B;  5DQV A;  3L3P A;  2Z6E A;  3LG7 A;  5HGQ A;  3OD1 A;  1UUR A;  4H9O C;  3HFZ A;  4O4J E;  4P09 A;  4IRE A;  2MYS A;  4KR3 A;  3LK3 B;  3FJP A;  3ZMU B;  1WYD A;  2P5I A;  1XDO A;  4XTW A;  3EVY A;  1IJ6 A;  3I0Q A;  3QUJ A;  5L3B B;  4EO4 A;  3C64 A;  2V7I A;  1H4T A;  1G51 A;  4U72 A;  3L4G B;  3ICA A;  1H7C A;  2YU1 A;  5L2L A;  2XTI A;  2V6X A;  3O1J A;  2AMC A;  4O2B E;  1HX1 B;  3RKW A;  3RKO A;  1HS7 A;  5ELN A;  4YCW A;  3ABV A;  4IDZ A;  4YYE A;  2KWI B;  2CWO A;  3ZYK A;  3AE8 A;  1PYS A;  3FZH B;  2DJZ A;  2QHS A;  3A5Y A;  4HWR A;  4ZXL A;  3E22 E;  5AQM B;  5JR9 B;  2DEQ A;  4E7S A;  3AEB A;  4RMF A;  2DL1 A;  3UFE A;  3C98 B;  4EZH A;  1EFW A;  1BR2 A;  5DAB A;  5HEU A;  1YQ4 A;  4H63 V;  3N9O A;  3ANW B;  4A5X A;  4LMJ A;  2HN1 A;  2CJ9 A;  1XDP A;  4EZ4 A;  4NCX A;  3ZT6 A;  4TWD A;  4YJ3 E;  3ZEF B;  2BG9 C;  3NET A;  1FIO A;  5CGM A;  1T72 A;  5L4E A;  2P9B A;  3UFG A;  11AS A;  5JRE A;  5L4H A;  1VQZ A;  4HFV A;  1Y64 B;  3A32 A;  2H88 A;  3LSV A;  3PDY A;  2OV9 A;  5LMN T;  4O4L E;  4UP7 A;  2KSR A;  4DQ2 A;  2IUB A;  4YCU A;  3NEN A;  2K24 A;  2E8I A;  3PTR B;  1MMD A;  1Z8U A;  4YRS A;  5LGN B;  2W61 A;  4AQY T;  4YHH T;  3MEY A;  2XM1 A;  3MZK B;  4YRE A;  3KFW X;  5CJ5 A;  3HR0 A;  3P4R A;  4YRJ A;  5C2T A;  2CJA A;  3PUG A;  1OED C;  5LGU B;  2DWG A;  4GYS A;  1HG5 A;  4YFS A;  4YRR A;  4BA9 A;  2EJF A;  4YRK A;  2C5K T;  4AQG A;  1KNR A;  2NP9 A;  3VR9 A;  2BKO A;  2RP4 A;  2I4O A;  1Z7M A;  4XU2 A;  3HRI A;  4NPP A;  4HFD A;  5C52 B;  5CA0 E;  3KBT A;  4K0K T;  4QH1 A;  1NJ2 A;  4YRI A;  2KXP B;  2UXD T;  4YRQ A;  3E08 A;  3UU3 A;  3TLT A;  4Q25 A;  4ZS2 A;  5LCY A;  1W0A A;  1N34 T;  4DR4 T;  2ZT6 A;  3T1Y T;  2BBH A;  3SFE A;  4DUY T;  3DTO A;  4QX8 B;  2I59 A;  4U3C A;  2FUP A;  2RPA A;  3NBX X;  5JR9 A;  5TAO A;  2C8M A;  2DHR A;  1E24 A;  3ANW A;  5J2T E;  3ZYL A;  2CHO A;  2W0G A;  1E1H B;  3PJA J;  5H6Q B;  1R8I A;  3HXV A;  4JI7 T;  4HKA A;  1I6Z A;  1NEN A;  2IC9 A;  5LA6 E;  4GKK T;  1T8B A;  1SHZ C;  4H2T A;  2WU5 A;  5JVD E;  5BR8 T;  2WBL A;  3ZPO A;  1G73 A;  5F5W A;  4BAY B;  4IE6 A;  3N2K E;  1IAP A;  1UCU A;  2HN2 A;  3CWZ B;  4CQI A;  1D1A A;  3PUX F;  4EAH A;  5HXS A;  2DTH A;  4QX7 B;  1B7T A;  2LM9 A;  1BR4 A;  2BVM A;  4P73 C;  2VVS A;  2NWB A;  2Y6X A;  3HY1 A;  2E5V A;  4A56 A;  3ERR A;  4HA8 A;  3TUP A;  3HY0 A;  2XQ8 A;  2X9Y A;  3R07 A;  3AA0 B;  4YTN A;  1HCI A;  1IJ5 A;  3FBL A;  4YXD A;  1USY C;  1EIY B;  2ZZE A;  4TQF A;  2XQ9 A;  1ZP0 A;  1J1J A;  4RDX A;  3HKC E;  3J9X 1;  4HT4 A;  4ZZB A;  3LSS A;  4HWI B;  4LFC T;  3AED A;  3AE4 A;  4XEM A;  1EOV A;  4HGA A;  1SUM B;  3ZCI A;  3AAE B;  12AS A;  1IBK T;  3REU A;  3G1Z A;  4HE8 A;  3D0T A;  4IDO A;  2X67 A;  3M3Z B;  1VOM A;  3Q5W A;  5LB7 B;  1HTT A;  3V7C A;  4RQE A;  2CLY B;  4X5O A;  2L3L A;  3FHN A;  2A3D A;  2R6G F;  2WB5 A;  1BBU A;  2E2A A;  1ZHC A;  4JI5 T;  4YTM A;  1Z7N A;  3O4X E;  2N2N A;  3QOF A;  2J3M A;  3RIA A;  3ETV A;  4DR3 T;  5DQW A;  4PFO A;  4TWF A;  2CWY A;  4ISS A;  5C53 B;  5L3E B;  4P75 A;  2BS4 A;  3RX6 A;  2XQY A;  4H2V A;  3UGT A;  4H2S A;  5J2U E;  3RAC A;  2XQ6 A;  2D9D A;  3IKM B;  3RKX A;  1G8X A;  3SWH A;  2YN6 A;  5EZY E;  3AE7 A;  3ONL C;  2XQ3 A;  2CA5 A;  4WJ4 A;  3EAB A;  4G63 A;  3ZN0 B;  2Q9Q C;  5CB4 E;  2A9U A;  5L3C B;  3AEA A;  3NWI A;  4AIU A;  4PAG A;  3LK4 2;  4HWS A;  1FMV A;  4HWH A;  4YRF A;  2ACX A;  1EIY A;  4EYU A;  2J3L A;  1X54 A;  3F31 A;  2K3W A;  2K5B B;  5LGT B;  3S4U A;  1X2G A;  4G84 A;  4HFH A;  1BBW A;  2LSK A;  3FBZ A;  4IE4 A;  4X1K E;  4NXM T;  4ZI2 C;  3P8C D;  1JJC B;  4DV0 T;  2XY8 B;  1N33 T;  3K1S A;  4U7Y A;  4L9I A;  3ESL A;  2LSG A;  2VAS A;  4IE0 A;  3RGL A;  1KOG A;  1XWM A;  2ODR C;  3PE0 A;  3KV4 A;  3LJC A;  4BJM A;  3HI2 A;  2FYK A;  2V7J A;  4Q6G A;  2HHH T;  2BG9 E;  1FMW A;  4TVW A;  5CFB A;  4CN4 A;  2XAJ B;  4UF0 B;  1NWM X;  1LRZ A;  2QA7 A;  4JLE A;  4X1I E;  4CS4 A;  2YU2 A;  4GKJ T;  2ZIM A;  3BJU A;  2YDQ A;  4P72 A;  3RL6 A;  3IKL A;  2HNI A;  1WQW A;  3R84 B;  4EB6 E;  2XZE A;  5KNN A;  4HWP A;  2E9X D;  2H3R A;  3LDQ B;  3FXD B;  3FZL B;  2BKN A;  3CPZ A;  1OED E;  3ZMT B;  2OA5 A;  4ZZC A;  3NEM A;  3EUH A;  2KLQ A;  1W0B A;  2ART A;  2BG9 B;  4LF6 T;  2UUB T;  2WCA A;  4UVB B;  2FJE A;  2AKW B;  3ZSS A;  5FP3 A;  3U3I A;  1HG2 A;  2Q7E A;  2LLY A;  1NJ5 A;  2DQ3 A;  3MQZ A;  3P8Y A;  4UP9 A;  1MMA A;  1WLE A;  3O1I A;  2CBJ A;  1D1C A;  4J15 A;  3CQX C;  4CI1 B;  3FB2 A;  3ZT7 A;  4L87 A;  2IDO B;  4XU3 A;  3QTC A;  4P74 C;  3RIF A;  4CN6 A;  2BKP A;  2X68 A;  4CS3 A;  2W63 A;  1KK7 A;  3Q5E A;  2VKD A;  1O3X A;  4X20 E;  2PG8 A;  2QYW A;  3AVR A;  2WDV A;  4AI6 A;  4YRC A;  5HEJ A;  4X1Y E;  3VKG A;  1NAF A;  2PME A;  4JUY A;  5FXX A;  2EWN A;  2M67 A;  1YFR A;  3H3A A;  3FZF B;  1NNH A;  4H9S E;  5LYJ E;  4CH3 A;  1DU2 A;  5LJN A;  4E7Z A;  1BIB A;  3ONJ A;  4TWH A;  2E41 A;  3AE5 A;  1KNP A;  3ZMZ B;  5J1G A;  1ASY A;  4LML A;  3A7R A;  1YW0 A;  3KV6 A;  2CMR A;  4YRM A;  4LNS A;  4CXW A;  3B13 A;  1HR0 T;  4KUM B;  4H2Y A;  2W00 A;  2ZIO A;  5FMN A;  3A5Z A;  4H2W A;  2ZNI A;  4O8S A;  1FYF A;  4QWN B;  1IZN B;  2LSY A;  4XZC A;  2WMO A;  2NS6 A;  2DDZ A;  1BR0 A;  3I1A A;  4IHJ E;  1UX4 A;  4K86 A;  1FJG T;  5AQG B;  2OLT A;  2BG9 A;  3EFS A;  4IL9 A;  5AQP B;  2D2S A;  4GIW A;  4EED A;  4A97 A;  2AKW A;  2LJL A;  3JC6 C;  4PFP A;  5LG3 A;  4DV3 T;  4QKN A;  3GWH A;  4IDP A;  1GGM A;  2JMK A;  2BDE A;  5L47 A;  1NYQ A;  1IBM T;  5FNV E;  1SE7 A;  4O4H E;  1KMN A;  3V7S A;  4JV5 T;  5H6R B;  3GMI A;  3E0Z A;  4KMC A;  3L8R A;  3P8T A;  2A2F X;  5IHY A;  2ARS A;  3UU8 A;  4YSZ A;  4UEM A;  1IBL T;  4DR2 T;  3VBB A;  1MMN A;  4C90 A;  3TEG A;  1B7Y B;  2E65 A;  3DSQ A;  4GYR A;  4AKI A;  2KIN B;  3P7I A;  3KVA A;  4U74 A;  5IYZ E;  2CIM A;  1ADY A;  5FVK A;  2LE8 A;  2DZC A;  3EHZ A;  4I55 E;  5IWA T;  3EFR A;  3N9P A;  3RH3 A;  2VL8 A;  1NJ6 A;  2XPK A;  2E5A A;  5HXR A;  4ILA A;  2VQF T;  4CS2 A;  1CUN A;  2XAH B;  3BFM A;  2MPK A;  3PU8 A;  2LKG A;  4ILC A;  2EJ9 A;  1W66 A;  3NRX A;  1MIY A;  4LMK A;  4DV5 T;  4O2A E;  2YKS A;  2DXU A;  4UVC B;  4H2X B;  2EHO B;  3BQL A;  4P3O A;  3HKD E;  4OYJ A;  4I0U A;  1SRY A;  4X62 T;  2J1D G;  4CZZ B;  3OJA A;  5ABH A;  3LBX B;  2CXL A;  2BS2 A;  3UTK A;  3M4P A;  2V6Y B;  2V5D A;  3RC8 A;  3AAA B;  4YRT A;  1I94 T;  5FY0 A;  5JDN A;  2DU7 A;  1MIV A;  4H9N C;  4P3P A;  4B6X A;  2UXX B;  4YTP A;  4WBN E;  3V5S A;  3K3O A;  5JH7 E;  4YJ2 E;  3AE3 A;  3EI0 A;  2DCF A;  4DBR A;  4LF5 T;  3A5X A;  1E2A A;  4DID B;  1S94 A;  4B3R T;  1YGB A;  3PU3 A;  4BJN A;  3AA7 B;  3RRC A;  4AKL A;  2QGS A;  5FY1 A;  3FZM B;  4AIS A;  5AQT B;  3RRW A;  1HX8 A;  2JRK A;  2BBJ A;  1WNL A;  2HH7 A;  4UXN B;  2KMF A;  3ZT5 A;  3PCO B;  3ZKR A;  3SOL A;  4YRO A;  4F6R C;  3L4G A;  3REX A;  1UGO A;  2NW7 A;  3AAI A;  4CH6 A;  3QB5 A;  1HF8 A;  4M1P A;  1G5I A;  4TV8 E;  2W62 A;  4EX5 A;  1T7S A;  3O9X A;  4DUZ T;  5E3I A;  3Q2M A;  2KZ7 B;  4PJM A;  4TV9 E;  3E9H A;  4E51 A;  4WBO A;  3CVR A;  1EQR A;  1B7Y A;  5AQQ B;  2NW8 A;  3F57 A;  4CXX A;  4DO0 A;  3ZYM A;  5JQG E;  4UPA A;  1D1B A;  3ZCJ A;  3C4X A;  4KP3 C;  3P4Q A;  4HWF A;  3NKZ A;  1E1O A;  2CGH A;  4YRN A;  2EJG A;  5J0Z A;  4DV1 T;  1GQE A;  4L0R A;  3IEE A;  2XM2 A;  2V7K A;  2P0L A;  3N9M A;  2C7I A;  3RYF E;  5C8Y E;  5EK3 A;  4H2X A;  2JQH A;  1UX5 A;  4FI5 A;  2H89 A;  2EHO A;  1HNW T;  5F3J A;  2IY5 B;  3AE6 A;  4PNI A;  3AXJ B;  3RQU A;  2ES0 A;  2WZH A;  1HXD A;  4ILB A;  4WW0 A;  4F8H A;  5L3F B;  4TUY E;  3LBX A;  5LHH B;  1UUS A;  2V6Y A;  3BQK A;  5AQH B;  2Q9Q D;  5HXE A;  2H7O A;  4JI4 T;  2WDR A;  5CA1 E;  2D0T A;  3VU7 H;  4IE7 A;  3Q5X A;  3UT5 E;  2AE9 A;  4EOZ B;  5ABE A;  5LHG B;  4XTY A;  3M4Q A;  4KHP T;  2DLR A;  4MHC A;  3RLF F;  3I9Y A;  1WFD A;  4MAL A;  4U2Y A;  3BK9 A;  4PHC A;  3VHL A;  2XQA A;  2UXB T;  4B3T T;  5AQI B;  4EYY R;  4ZI2 D;  4Q15 A;  5JR9 C;  4TNW A;  2PMF A;  2KND A;  3PCO A;  1X01 A;  1H4Q A;  4NXN T;  2V1D B;  1N36 T;  3UUX B;  2WDQ A;  4ZI3 D;  1SES A;  4TVA B;  2ODR D;  4DR5 T;  1T98 A;  3AEE A;  2F4V T;  4AH6 A;  2I4M A;  1SA0 E;  4N78 D;  3ZC0 A;  3I0O A;  2CHN A;  3L1A A;  3VQY A;  3CX6 B;  2FBW A;  1MMG A;  3QB5 K;  3X1D A;  1UK5 A;  3VRA A;  2RHQ B;  3UQ4 A;  3U78 A;  4GK0 E;  4OLF A;  4XU1 A;  4GOU A;  5JRC B;  5JDM A;  1ATI A;  4G2A A;  4CH5 A;  2WY2 A;  4DR1 T;  5FVL A;  2ZLY A;  4I50 E;  3EDV A;  2Y8D A;  1EZ3 A;  5LHI B;  2IY5 A;  2ODV A;  5HEH A;  2YOE A;  2DKG A;  1RIQ A;  3NZQ A;  5C51 B;  2ZCE A;  2EL9 A;  4QXH B;  2CBI A;  3K8P C;  3FXE B;  2G4C A;  4JI0 T;  2SPC A;  4H9P C;  4YCV A;  4QH4 A;  4AXP A;  4X65 T;  2E9X B;  1E1T A;  1U5P A;  1YFS A;  1N9W A;  3K3N A;  4P71 C;  3V5U A;  5EK4 A;  4WI1 A;  3LFM A;  4XTU A;  3PUQ A;  4MLK A;  5C3J A;  3MK7 C;  4ZTU B;  3TLV A;  3AEF A;  4FJO A;  3H3M A;  3EDU A;  4Z90 A;  3L09 A;  4C91 A;  5BMV E;  2PFV A;  3PUR A;  4L5G A;  3UUB A;  4OHF A;  4I43 B;  5AQJ B;  4QXC B;  4MFR A;  5KDM C;  4ZI3 C;  4YRG A;  2YDR A;  4H63 H;  2HPL A;  4TVA A;  3RIR A;  2UUC T;  5E0O A;  2DTI A;  4HFE A;  4P75 C;  4H9Q C;  5JDF A;  5LOV E;  3IAL A;  2IHR 1;  3BQI A;  3TLU A;  3C4W A;  3P4W A;  5FXZ A;  1XZY A;  1QE0 A;  4CH4 A;  3CX7 B;  5DJQ C;  3B5M A;  3HXU A;  3VQX A;  2BZB A;  2RHQ A;  2VVN A;  2E10 A;  3LK2 B;  4HFI A;  3A7M A;  1NJ1 A;  3WAJ A;  5JRC A;  1EVK A;  1M7K A;  2V26 A;  3MF1 A;  5A1L A;  3N2G E;  2X66 A;  4XU0 A;  2HPJ A;  4JI1 T;  1X56 A;  2V7M A;  5M4Y A;  2E3C A;  4ILU A;  4ZIB A;  3ZJ2 A;  2WWV A;  2NTX A;  5ETW A;  2Q7G A;  2V7L A;  3UUM A;  2ZXF A;  2MAW A;  4PK6 A;  3PUW F;  2VQE T;  3M65 A;  3V8J A;  1B76 A;  2H7V C;  2B76 A;  3HA4 A;  5HCM A;  4DMW A;  1Y01 A;  2IW5 B;  3HKB E;  3GA8 A;  3AE9 A;  2CE7 A;  2V8S V;  5IUX A;  3RYH E;  2UXN B;  3JC6 D;  2ZM0 A;  4ZHQ E;  1MNE A;  2D5U A;  1E22 A;  4HTE A;  2VL0 A;  4U33 A;  2UXC T;  3PUS A;  3HRK A;  2E9X A;  3IA3 A;  3HFZ B;  4AQF C;  4YRP A;  4DR6 T;  4NUV A;  2ZT8 A;  2XAS B;  2AXD S;  1OED B;  2DI4 A;  2WP9 A;  1MIW A;  4YSY A;  5JDG A;  4DV2 T;  1JJC A;  3I7F A;  2RHS B;  4EIW A;  1HNZ T;  4LVJ A;  4P72 C;  2LRK A;  3ZC1 A;  3C51 A;  2AMC B;  2LSJ A;  3NZP A;  3CK6 A;  2JQ9 A;  2C5J A;  2VWA A;  2Q5I A;  2PTF A;  4CXY A;  4RQF A;  5LP6 E;  4KQE A;  4YT0 A;  4UF0 A;  4JI8 T;  4WYV A;  3ZN1 B;  4IT4 A;  5HCJ A;  3MKD A;  1C0A A;  4XAX B;  3PV0 F;  3QO5 A;  2JPF A;  3W15 B;  2J47 A;  3B57 A;  4TN7 B;  3KV5 A;  3VRB A;  2LRL A;  1OWA A;  4NIQ A;  2LOP A;  3MA9 A;  5JDQ A;  4U31 A;  3RPU A;  1S35 A;  3VR8 A;  2NR4 A;  4UEL A;  2ZGW A;  1J5W A;  3RC3 A;  4OP0 A;  3AA6 B;  2WSS V;  4UVA B;  1WYB A;  3VQW A;  4O2D A;  5HWX A;  2A8E A;  4YLH A;  3VKH A;  2XAG B;  2DQ0 A;  4P0B A;  2DXT A;  3HFV A;  1W9R A;  4X66 T;  1LVF A;  1ZV4 X;  5ABG A;  3OKQ A;  5FKY A;  4BW9 A;  1XNR T;  4PJL A;  2LOS A;  4ZEY A;  2VKJ A;  1B8A A;  3RIU C;  2ZT5 A;  3P4P A;  4HWC A;  4IL4 A;  4ADZ A;  1OED A;  4QH5 A;  2MOZ A;  2EAY A;  3HKE E;  2UUA T;  2VK9 A;  3ETU A;  3TKL B;  3N9L A;  2RHS A;  1WCR A;  2Q5H A;  4HVC A;  4JYA T;  3GN5 B;  3HXY A;  3PZC A;  5LMU T;  1LKX A;  2NOX A;  4LF8 T;  2ZNJ A;  3A74 A;  1YKE B;  3MAC A;  1WR0 A;  5K1P A;  3KDS E;  5AQS B; 
#chains in the Genus database with same CATH homology
 2P0L A;  4WJ4 A;  3UH0 A;  2C7I A;  1LYL A;  1EVL A;  4H2X A;  2IY5 B;  2XGT A;  3P8V A;  3KFU A;  2QHU A;  1HXD A;  1QF6 A;  4HWS A;  4TQD A;  4YRF A;  1IL2 A;  1EIY A;  2J3L A;  1PYS B;  1X54 A;  3A7U A;  1X2G A;  4G84 A;  3CMQ A;  3NEL A;  1BBW A;  4YDQ A;  4XTY A;  3M4Q A;  1JJC B;  4XTV A;  4TWA A;  1NJ8 A;  3RGL A;  3QNE A;  1KOG A;  3MF2 A;  2ODR C;  4PHC A;  1G5H A;  3RF1 A;  2FYK A;  3QO8 A;  4Q6G A;  4TVW A;  4Q15 A;  2ZZG A;  2PMF A;  3PCO A;  1X01 A;  3TEH A;  1NYR A;  4CS4 A;  1H4Q A;  4KR2 A;  3V8K A;  1SES A;  2ZIM A;  4HWT A;  4P3N A;  3BJU A;  2ODR D;  3E9I A;  1B70 B;  4TVA B;  4P72 A;  4AH6 A;  2I4M A;  3RL6 A;  1YB3 A;  3V8L A;  3IKL A;  2HNI A;  1WQW A;  1X2H A;  3L1A A;  3VQY A;  5KNN A;  4HWP A;  4P73 A;  3IG2 A;  3HXX A;  4WF2 A;  3L2Z A;  5HGQ A;  3OD1 A;  2RHQ B;  3HFZ A;  3VQV A;  3NEM A;  2E1H A;  4UP8 A;  4OLF A;  4XU1 A;  1USY A;  4KR3 A;  3FJP A;  1WYD A;  4TTV A;  5ELO A;  1ATI A;  2P5I A;  4XTW A;  3HXW A;  4CH5 A;  4EO4 A;  2ZTG A;  2ART A;  1ASZ A;  1H4T A;  1G51 A;  2ZR2 A;  2ZT7 A;  2AKW B;  3LC0 A;  3L4G B;  2Q7E A;  3ICA A;  1NJ5 A;  2DQ3 A;  2XTI A;  3MQZ A;  3P8Y A;  4UP9 A;  1WLE A;  2IY5 A;  2AMC A;  4J15 A;  2DKG A;  1RIQ A;  3RKW A;  5C51 B;  2ZCE A;  2EL9 A;  4L87 A;  4XU3 A;  2CJB A;  3QTC A;  5ELN A;  4XEO A;  4P74 C;  4YCW A;  4YYE A;  1PYS A;  4YPF A;  2DJZ A;  3A5Y A;  2QHS A;  4CS3 A;  1KMM A;  4HWR A;  4WJ3 M;  2G4C A;  2DEQ A;  4K87 A;  4YCV A;  4RMF A;  1EFW A;  3WQZ A;  4YRC A;  2CJ9 A;  1E1T A;  1ADJ A;  1SET A;  4NCX A;  1YFS A;  2QHT A;  1N9W A;  2PME A;  4P71 C;  2EWN A;  3NET A;  4WI1 A;  1YFR A;  1NNH A;  4XTU A;  3UFG A;  4XTX A;  4ZTU B;  11AS A;  4CH3 A;  1VQZ A;  1BIB A;  3A32 A;  2E41 A;  2ARU A;  4UP7 A;  4DQ2 A;  1WQ7 A;  1ASY A;  4YCU A;  3NEN A;  2DU5 A;  1SER A;  3A7R A;  1WU7 A;  4YRG A;  4YRM A;  4LNS A;  4TVA A;  3RIR A;  4YRS A;  1B70 A;  4H2Y A;  3MEY A;  2DTI A;  3LSQ A;  4YRE A;  2ZIO A;  4YRJ A;  3A5Z A;  4P75 C;  2CJA A;  3IAL A;  4H2W A;  2ZNI A;  1FYF A;  1QE0 A;  4CH4 A;  4YRR A;  2EJF A;  3HXU A;  4YRK A;  4H2U A;  3VQX A;  2RHQ A;  2E10 A;  2NS6 A;  2DDZ A;  1NJ1 A;  2ZZF A;  1YFT A;  2I4O A;  1Z7M A;  4XU2 A;  1EVK A;  3HRI A;  3MF1 A;  4K86 A;  1WPY A;  5C52 B;  4XU0 A;  4P71 A;  1NJ2 A;  1X56 A;  4YRI A;  3EFS A;  3V7R A;  2E3C A;  4ZIB A;  4YRQ A;  3A31 A;  2AKW A;  2Q7G A;  2ZXF A;  2DVE A;  4YP0 A;  2ZT6 A;  4LVI A;  1BIA A;  1GGM A;  4HWO A;  3V8J A;  1B76 A;  1NYQ A;  2QHV A;  3RKY A;  1KMN A;  3V7S A;  4K88 A;  3QO7 A;  1E22 A;  3P8T A;  2ARS A;  2DZ9 A;  2C8M A;  3HRK A;  1E24 A;  3VBB A;  3HFZ B;  3TEG A;  4YRP A;  1B7Y B;  2E65 A;  3DSQ A;  1X55 A;  3HXV A;  2ZT8 A;  4YRL A;  3W3S A;  2CIM A;  1ADY A;  2DZC A;  4H02 A;  1H4S A;  3EFR A;  2ALY B;  4H2T A;  1JJC A;  2I4N A;  3A7A A;  2I4L A;  3I7F A;  2E64 A;  2RHS B;  5F5W A;  1NJ6 A;  4LVJ A;  4P72 C;  2E5A A;  4CS2 A;  2AMC B;  3BFM A;  2DTH A;  2Q7H A;  4XTZ A;  2EJ9 A;  1W66 A;  2Q5I A;  4P73 C;  2DXU A;  4RQF A;  4KQE A;  4H2X B;  3HY1 A;  3ERR A;  4HA8 A;  3TUP A;  3HY0 A;  3R07 A;  4P3O A;  1C0A A;  1SRY A;  3QO5 A;  3HTZ A;  5K1X A;  1USY C;  1EIY B;  2ZZE A;  4TQF A;  4ZTZ B;  4LVM A;  3M4P A;  4YRT A;  4G85 A;  4P74 A;  4RDX A;  2DU7 A;  4HT4 A;  3LSS A;  4PG3 A;  4P3P A;  4XEM A;  2DTO A;  2ZGW A;  1J5W A;  1EOV A;  1YGB A;  4OP0 A;  12AS A;  3VQW A;  3REU A;  4O2D A;  4TVY A;  2A8E A;  3G1Z A;  1HC7 A;  1WNL A;  2DQ0 A;  2DXT A;  3PCO B;  3TEH B;  1HTT A;  3HFV A;  3V7C A;  4YRO A;  3L4G A;  3REX A;  3RUX A;  3HXZ A;  4RQE A;  4X5O A;  4CH6 A;  1BBU A;  2ZR3 A;  1G5I A;  4BW9 A;  4EX5 A;  5E3I A;  1Z7N A;  1L0W A;  4DPG A;  2J3M A;  3E9H A;  4BWA A;  3UGQ A;  4E51 A;  1EQR A;  1B7Y A;  5C53 B;  4P75 A;  1B8A A;  4LVL A;  2ZT5 A;  2EAY A;  4H2V A;  4UPA A;  2ZIN A;  3UGT A;  4H2S A;  3RAC A;  2ALY A;  3IKM B;  1E1O A;  2CGH A;  2RHS A;  2Q5H A;  2EJG A;  3RKX A;  4YRN A;  4HVC A;  3HXY A;  3PZC A;  2ZNJ A;  1H4V B;  3A74 A;  5K1P A;  4LVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...