3UFGA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
total genus 96
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3ufgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ufgA01
2ZIMA 3HXVA 1WU7A 3MF2A 4AH6A 4CH3A 4YDQA 4DPGA 4OLFA 3ERRA 1X56A 3I7FA 4CS4A 3IKMB 2EJ9A 2ZXFA 2ARUA 1WQWA 2CGHA 1ADYA 2ZNIA 1WLEA 12ASA 2DTHA 2IY5B 2QHTA 2DQ0A 1X55A 3V7SA 2DZ9A 4XEOA 4RDXA 4YRQA 4UP7A 1NNHA 3RIRA 4G85A 3V8LA 1EOVA 4YRJA 2Q5IA 1Z7MA 2PMEA 1BBWA 3HXXA 4G84A 4H02A 5F5WA 3LSSA 4PG3A 3M4PA 1EVKA 2CJAA 4WJ3M 1G5HA 2P0LA 4WJ4A 2ZZFA 5K1PA 3P8VA 4YRLA 2QHUA 1E22A 4YRKA 1EIYB 2E10A 2ZZGA 3M4QA 1BIAA 4L87A 2ZR3A 5C51B 4HA8A 3NEMA 1E1OA 4H2XB 2DKGA 2ZT8A 3E9IA 4EX5A 3VQWA 4BW9A 3RKXA 1ADJA 4CS2A 1HXDA 4ZTUB 4P75A 1B76A 3LSQA 2RHQB 4H2WA 4P73C 2E5AA 5HGQA 1NJ1A 3FJPA 1QE0A 4XTWA 1YFTA 2G4CA 3P8YA 4BWAA 3ICAA 3UH0A 4J15A 4TQFA 2ARTA 2E41A 2DEQA 1YB3A 3LC0A 5KNNA 1NJ6A 4HWSA 1ASYA 4YROA 3HFZB 2E1HA 4HWOA 1H4QA 4YCWA 2ODRD 3HY1A 2ZT5A 1NYQA 4H2TA 2CJ9A 4LNSA 2XGTA 4O2DA 4E51A 2AKWB 2DTOA 1X2HA 1WNLA 4TTVA 1YFSA 1WPYA 4TVAA 4XTVA 2DXTA 4XEMA 1X54A 3R07A 1YGBA 1IL2A 4YRCA 3REXA 1HC7A 2E64A 3HRIA 1N9WA 4P75C 3WQZA 1RIQA 2I4OA 1FYFA 4ZTZB 1WYDA 4TVYA 1SESA 3V8JA 1Z7NA 2ALYB 2DXUA 2I4LA 4P3PA 3RL6A 1EVLA 3MEYA 3L4GB 4K88A 1NYRA 2Q5HA 4YRRA 3PCOB 4K86A 1E1TA 4TWAA 4YRGA 5ELOA 2ZT6A 3RKWA 4YREA 2RHQA 3UGTA 5C52B 3PZCA 5C53B 4Q6GA 1B7YA 4UPAA 3TEGA 3RKYA 1SERA 2E3CA 3HY0A 4TQDA 4YP0A 1JJCA 2ODRC 1B70A 4CS3A 4UP9A 2CIMA 4YYEA 3A74A 3REUA 3KFUA 2DTIA 4YCUA 2EL9A 1JJCB 5ELNA 3HXUA 1SRYA 1B7YB 3RUXA 5K1XA 3CMQA 3RACA 4RQEA 1KMMA 2ZT7A 3A5ZA 3VBBA 3A7RA 3A32A 2EJFA 3NETA 2AMCB 3HXWA 2XTIA 2EAYA 4H2SA 4Q15A 4XTZA 4H2VA 4CH5A 2ZTGA 5E3IA 4TVAB 3QO7A 2I4MA 3A5YA 4XU3A 1SETA 3HXZA 2FYKA 1C0AA 1NJ2A 2DDZA 2P5IA 3IKLA 1G5IA 2E65A 2RHSB 2EWNA 2QHVA 2ZINA 2IY5A 2DU7A 4KQEA 3P8TA 1NJ8A 3NENA 3E9HA 4H2YA 3QNEA 2ZIOA 3A7AA 3A7UA 3EFRA 3HXYA 3V7RA 3RGLA 11ASA 4YRPA 2EJGA 4PHCA 4KR3A 2HNIA 1X2GA 1HTTA 1ASZA 2ZZEA 3VQVA 2Q7GA 3QO8A 2DJZA 1X01A 2ZR2A 2C7IA 4XU1A 4P74C 3G1ZA 3HTZA 4YRIA 3RF1A 3NELA 3DSQA 1G51A 4ZIBA 4XU2A 3L1AA 4EO4A 4P73A 3HRKA 1WQ7A 2AKWA 4HWRA 2AMCA 1BBUA 2J3LA 3BJUA 3BFMA 2RHSA 4HWTA 3HFZA 4K87A 4YRTA 4RMFA 1H4TA 1W66A 3MF1A 4HWPA 1YFRA 1KOGA 3OD1A 1NJ5A 4WF2A 4TVWA 4YPFA 2C8MA 3A31A 2DQ3A 2DZCA 3VQXA 3QTCA 4P74A 2ALYA 4P72C 1PYSB 4P3OA 2DU5A 4OP0A 3EFSA 4X5OA 1H4SA 1GGMA 1B70B 2ZCEA 1L0WA 4P71A 4CH4A 1EFWA 1VQZA 3W3SA 3IG2A 2J3MA 4P71C 1PYSA 3HFVA 2Q7HA 4P72A 3V7CA 4HVCA 4KR2A 3TUPA 2ARSA 3IALA 4YRSA 1H4VB 4XTUA 4WI1A 3VQYA 2ZNJA 4DQ2A 3V8KA 4H2UA 1LYLA 4P3NA 2DVEA 2Q7EA 1EIYA 2ZGWA 4XTYA 1ATIA 1B8AA 2I4NA 3TEHB 3L2ZA 4YRFA 4UP8A 3UFGA 3L4GA 4YRNA 4H2XA 1EQRA 1USYA 4NCXA 4YRMA 4CH6A 3TEHA 1E24A 4XU0A 2CJBA 4RQFA 1BIBA 1KMNA 4YCVA 3PCOA 3QO5A 3UGQA 1QF6A 2PMFA 1J5WA 1USYC 2QHSA 4XTXA
chains in the Genus database with same CATH superfamily
4IDNA 3Q5DA 3NRYA 4OHFA 2XZEA 2JQQA 5HXSA 3FXEB 3N9QA 3AAIA 3AE5A 4GYSA 3RIUA 2CGHA 1ADYA 4YSXA 2DTHA 1X9BA 2QHTA 1X55A 2D0UA 2NW9A 4PNIA 4XEOA 1EZ3A 4HTEA 4RDXA 4I4TE 5AQLB 3AXJB 5JREA 1O3XA 4YRJA 4YXDA 3C98B 4IE0A 5LMNT 1Z7MA 3HXXA 3U3IA 3RYCE 3TLSA 5EK3A 5FVKA 3JCFA 3ZT5A 4LVJA 1LRZA 1Z8UA 4YRKA 2WM9A 5FYMA 3CWZB 5C51B 3LFMA 4O4JE 4CN1A 1XNRT 2BZBA 2ZT8A 5HAXA 4GYRA 2XQ4A 4TX5A 5HXCA 3AE9A 4YLHA 3A5XA 5IWAT 2I59A 4PJLA 4WYVA 3TLTA 2BVMA 5CFBA 4KI0F 1H7CA 3PUZF 3OVUA 4H9NC 2RHQB 5HCMA 3R84B 5LG4A 1UUSA 3BQIA 1ZEEA 4H63V 5HGQA 1NJ1A 4PK5A 1QE0A 5ABEA 2G4CA 2JJ9A 2HHHT 3OJAA 3ZMTB 4U72A 4HFDA 5IHYA 4TQFA 4NXMT 3H3MA 4IDOA 1S35A 4L0RA 3LC0A 3GWHA 1ASYA 3AA7B 3VRBA 2XUEA 1H4QA 4DMWA 3HY1A 1NYQA 1IBKT 5FXVA 4AQYT 4NPPA 2RP4A 2XGTA 3Q2MA 1X2HA 4PW8A 2UXDT 1BR4A 1YFSA 4K0UA 1WPYA 4XZCA 4Q25A 1X54A 3ZYMA 1HC7A 4YHHT 2WS3A 3AEBA 2CCQA 2CWYA 2CEAA 3ZSSA 1WYDA 4DV1T 4JLEA 2KMFA 2H89A 2PJQA 5JVDE 4UEMA 4A56A 1N33T 2F4VT 1NYRA 2BG9C 2Q5HA 3MKDA 2KINB 1Y01A 2NWBA 2M6BA 3C4WA 3PCOB 4TWAA 2HPLA 2HN1A 5E0OA 3RKWA 2RHQA 2XPKA 3CMLA 4HWHA 3FBZA 2DCFA 5ABFA 3RRCA 2IIUA 3TEGA 3RKYA 1SERA 5IUXA 4ZZCA 2E3CA 3HY0A 4YP0A 1OEDB 2D9DA 2CIMA 4LFAT 4YYEA 1XZYA 3C64A 4K0KT 4P0BA 5JR9B 2DTIA 1JJCB 2WSSV 2KXPB 3ZMVB 3RACA 3N5LA 4E7ZA 4UVAB 2ZT7A 2YK0A 2EJFA 3JC6D 2VKOA 2XTIA 2EAYA 4AKHA 2ACZA 2JRKA 4H2VA 4KX6A 2LM9A 4EEDA 3ZMZB 3HKDE 5LCYA 3QO7A 3ONXA 5KDMC 5AQRB 5LB7B 4XU3A 3HXZA 3RKGA 1G73A 2RPAA 2DDZA 2ZM6T 4DVDA 2P5IA 2X9WA 2XAJB 4YTMA 1AJ3A 2CM0A 4KQEA 5FXXA 5CA0E 4ASKA 1YD8G 4B3ST 3E9HA 3ZYKA 1HNZT 3QNEA 2E9XA 4L5GA 4U31A 1B7TA 5AQFB 3V7RA 5AQUB 3P4RA 4IDQA 3T1HT 3L09A 1X2GA 3ZCIA 3ZYLA 2V5DA 3QO8A 4QX7B 5HXRA 3I0OA 4P74C 4IIJE 3AAEB 2C0SA 2XQ8A 3RF1A 4PFPA 3L1AA 5L3EB 4EO4A 2LLYA 5LYJE 3AA1B 4GK5E 3F31A 1BBUA 2J3LA 5F8PA 3BJUA 1HNXT 4ANJA 5J1GA 4RMFA 2YU1A 3RC8A 1OEDE 2ZM8A 2OLTA 4HWPA 4ZI2D 4PFOA 2IDOB 4WF2A 5LHHB 2VQFT 2WAUA 2VASA 2DQ3A 2KNDA 3SOLA 3ZC0A 1OWAA 4LFCT 4P74A 4AISA 2VKHA 2W62A 1MMNA 2X67A 3RLFF 4LF7T 3X1DA 4OP0A 4TNWA 2QYWA 1HF8A 5LJNA 4X5OA 4IE7A 2V1DB 2CHNA 1GGMA 4NUUA 3LK2B 2ZCEA 4LMLA 2BKOA 5FL1A 2JQHA 3FZKB 4DR1T 2JQ9A 3IG2A 3W3SA 4P71C 2E9XC 1PYSA 2Q7HA 2HH7A 4YHJA 2V8SV 2CA5A 2MOZA 1M7KA 3RIFA 2A72A 3RQUA 2BVLA 1YQ4A 4LVMA 3RIUC 2E9XD 2DVEA 2VKDA 3UUNA 5TAOA 1NAFA 2ZGWA 3LK42 3AEEA 2I4NA 3ZT6A 5HXEA 2K3WA 4KHPT 5JDMA 3FZHB 5C8YE 4H2XA 5FXWA 3SS1A 1EQRA 4NCXA 4YRMA 3FZFB 4CH6A 3CX6B 2WWVA 3OYXA 1MNEA 3Q5XA 1T8BA 2FJDA 3N9LA 1KMNA 4X64T 2XQ6A 3PCOA 4O4IE 1Z0PA 2QHSA 3AE8A 4XTXA 3HXVA 1FEWA 1WU7A 4AH6A 4CH3A 1FMWA 4QXBB 4DPGA 4XBFB 4OLFA 3ERRA 2V7MA 4MHCA 2EJ9A 1VCSA 1WQWA 3M3ZB 4JI7T 2WQYA 2IY5B 2DQ0A 2DZ9A 2Y8DA 1Y64B 5JDFA 4IT4A 1NNHA 4G85A 1EOVA 5HEOA 3PUXF 3KV9A 4JV5T 2XQ5A 3HKEE 4IL9A 2Q5IA 4ADZA 2PMEA 2VVSA 4HFVA 3PUAA 5F5WA 3LSSA 3M4PA 1EVKA 4WJ3M 3AE1A 1W0BA 2ZZFA 4EAHA 3TLVA 2A3DA 3P8VA 2UXNB 3UULA 5JDQA 1KFYA 1EIYB 2ZZGA 3JAFA 4UF0A 3KFWX 2QGSA 3MACA 4HA8A 4CZZB 3QNUA 4GKKT 1E1OA 1W9RA 2X9YA 2X66A 5FY7A 2BBHA 3E9IA 3NKZA 2EHOA 4GIWA 3RKXA 4L9IA 4CS2A 4P0AA 1JNRA 3ANWB 3P8CD 1XMOT 2VQET 3IEEA 2W66A 4KBMB 1UX4A 1YKEB 4H2WA 4P73C 4YTPA 3KV6A 1XNQT 3SRZA 3BQLA 1HX1B 4EZ4A 3GMIA 1VRBA 3UUXB 4BWAA 1J1JA 3R6NA 2E41A 4LF9T 2EHOD 3VR8A 2C5KT 3MXZA 4UR9A 2W67A 2VL8A 1NJ6A 3DJBA 2JMHA 4HFHA 5AQVB 3HFZB 4DV4T 4HWOA 3AA6B 1WYCA 3K3QC 4O2DA 5EK4A 3V5UA 2UUAT 5CGMA 4GOUA 1MIVA 2YKSA 2DXTA 4XEMA 2WWUA 4LMKA 1WR0A 2M6IA 5HYAA 3H3AA 3WQZA 5LJMA 4ZTZB 2LEHA 2V6XA 1SESA 3CIRA 3ZEFB 4ERRA 3CPZA 4HE8A 5LHIB 4P3PA 2NP9A 1ZKEA 5LHGB 3MEYA 4K88A 2IW5B 3RH3A 4J2CA 5ABHA 1N36T 3HI2A 5CA1E 1IBLT 3PU8A 4YRRA 4DUYT 3ONJA 1E1TA 3JC6C 5ELOA 2CXDA 4YREA 3UGTA 2OA5A 4O4LE 4IE4A 1MMDA 5C2TA 2Q9QB 2OV9A 5AQMB 4JI4T 2CE7A 3RQWA 2IAKA 3PUYF 4MLKA 5JQGE 4X66T 2ACXA 2ODRC 4CS3A 1T7SA 1SHZC 4UVCB 1IJ6A 4X5TA 2ZM0A 4ZS2A 1D1AA 2WU5A 2K24A 3RUXA 3UFEA 3K8PC 3RYHE 3RC3A 1KMMA 5F3JA 5KXJA 3VBBA 5AQKB 5FMNA 3A32A 3RKOA 2AMCB 5L3GB 3PUVF 5L3DB 3W15B 1MMGA 2FJBA 4UV9B 3SFEA 4YSZA 2ZTGA 3O1HA 5E3IA 4FI5A 4EYUA 4TVAB 2LSYA 3LK3B 2LKGA 3C51A 3VU7H 3ABVA 3PUQA 1D1CA 3GN5B 5HCJA 3C4XA 2MBGA 1QLBA 5AQHB 3BK9A 2FYKA 4YJ2E 4CXXA 4QHOA 2A8EA 3IKLA 1ZV4X 1G5IA 1YW0A 2E5VA 2QRXA 2EWNA 4P09A 2WDVA 2IMLA 4JEHB 4WNKA 3AAAB 4A97A 5ADXL 3ZMUB 4H2YA 3NWIA 5DABA 3ZSTA 2Q9QA 3I9WA 2XAFB 2KWIB 4ILAA 2ZLYA 3ESLA 4X1IE 3RGLA 2EJGA 4PHCA 3VHLA 2HNIA 3FXDB 4IHJE 4HWFA 2Q7GA 4ZI2C 4YT0A 3RYFE 3HTZA 3UUMA 1G51A 5FP3A 1HG5A 4ZIBA 4AQFC 2ES0A 3HRKA 2J47A 3ZN0B 1WQ7A 4DR4T 2AKWA 4EEBA 5J2UE 1I94T 2V6YA 5AQPB 4HN9A 2LKHA 2DL1A 1DU2A 4KP3C 3I1AA 1YFRA 1KOGA 3OD1A 3Q5WA 2C8MA 3A31A 2PBIA 1UK5A 3T8OA 1NEKA 3ZLIA 2IUBA 2LSGA 2NS6A 3UT5E 2CRBA 3U78A 2NOXA 4DR2T 4KHZF 3FZLB 4UF0B 4CN4A 3VRAA 1KK7A 3UTKA 3CQGB 4HEAA 1H4SA 2QA7A 4E7SA 4BA9A 2XSBA 4P71A 1XDOA 3UU6A 2JMKA 3ONLC 4O4HE 4U7YA 2J3MA 2HPJA 3ZMSB 3IALA 4DIDB 2FJAA 4WI1A 3VQYA 2LE8A 3NRXA 3KVBA 5LGUB 3F2EA 2WZIA 4XTYA 1ATIA 2EHOB 3TEHB 4AQGA 5LP6E 3LG7A 2PFVA 3AECA 3TEHA 4TNVA 4B3MT 4XU0A 2CJBA 1BIBA 4IREA 5LG3A 1QF6A 2BDEA 1USYC 3O4XE 4PJMA 2ZIMA 1LVFA 2K5BB 3EDUA 3SWHA 4YDQA 1KEYA 2J1DG 2V7LA 2ZM2A 3F57A 1I6ZA 1X56A 3I7FA 3ETUA 4CS4A 3KV4A 2ZXFA 2CMRA 2ARUA 3MA9A 5BMVE 4OX9T 4JUYA 3V7SA 2W61A 4ZXLA 1FJGT 4YRQA 4UP7A 2LRKA 3EDVA 4HFCA 3RIRA 5LGTB 3PUSA 3IF8B 4TV9E 2YU2A 4WW0A 1WR6A 2BKNA 2WU2A 3OKQA 2CJAA 1LVKA 4DV6T 1G5HA 2KWHA 3JADA 2P0LA 4WJ4A 5K1PA 4FJOA 3ZT7A 2KZ7B 4YRLA 2XY8B 1E22A 2DWKA 3KVAA 4GKJT 3PURA 4EOZB 4P1NA 5HWXA 3GN5A 1BIAA 4L87A 1HG2A 4UELA 4IE5A 3NEMA 2WCAA 2E2AA 4H2XB 3HKBE 2DKGA 4LVIA 5A1LA 1OEDC 4EX5A 5FXZA 4JI5T 1QSDA 1ADJA 4X1KE 3FHNA 3RI5A 4HKAA 3E0ZA 1HXDA 4ZTUB 1B76A 3LSQA 3PUGA 1N34T 1UURA 3D0TA 4B3TT 1NENA 4DV0T 4AKGA 2E5AA 3VKHA 5LGNB 2YN6A 4OK0A 1IZNB 4LF4T 1YFTA 2VKJA 3P8YA 5JRCA 3UH0A 2WMOA 4J15A 2KT9A 1YKHB 2VK9A 5JRCB 2ARTA 4DNDA 2DEQA 4DBRA 1YB3A 5KNNA 1HX8A 4HWSA 4YROA 2E1HA 5HXHA 2ODRD 4BAYB 1U5PA 4H2TA 3PDYA 2CJ9A 4LNSA 3GA8A 4E51A 3PUWF 2AKWB 3N9MA 1WNLA 4TTVA 2MAWA 2ODVA 4U74A 4TVAA 4XTVA 4EV6A 4A98A 2UXCT 1BR0A 1YGBA 5CB4E 1IL2A 2BG9A 4YRCA 4B3RT 2XQAA 2N2NA 4ZOLE 4EYYR 2I4OA 2I0MA 1YXRA 5H6RB 5IYZE 5KX5E 4TVYA 3QB5A 2CHOA 1LKXA 2XM2A 3AEAA 5ABGA 3EABA 1Z7NA 3RIAA 4JI2T 4QX8B 3K3OA 2LHRA 2DXUA 3RL6A 3L3PA 3DTOA 1MMAA 3SFDA 3C50A 2E8IA 2CPTA 4O2AE 4AKLA 2KSRA 1R8IA 3IA3A 4H63H 4K86A 4XAXB 4HWIB 5LOVE 1BR1A 1W09A 2ZT6A 5L3BB 2YDSA 4H9RC 4I50E 5C52B 2D0TA 5C53B 4CXYA 2XAQB 5LNKA 3OPCA 3B5MA 3C4ZA 4WZXA 1JJCA 1T98A 2LJLA 5AQQB 1U4QA 1D1BA 5FKYA 4DR3T 4PK4A 3M65A 2EL9A 3IBPA 1UGOA 2V26A 1SRYA 1OXZA 2FJEA 5K1XA 1WLXA 2CLYB 3P4QA 5ABFB 3EVYA 4TUYE 4RQEA 2FBWA 4UIGA 4CQIA 3A5ZA 1WYBA 3UU8A 5JDLA 4QH5A 3A7RA 5FVLA 5HEHA 3NETA 5DJQC 5ETWA 3TLUA 1UX5A 2GK9A 3HXWA 3AA0B 5EZYE 1HR0T 4H2SA 4GK0E 4CI1B 3I9YA 4Q15A 3A8YC 4BJMA 5LBQB 3ZCJA 4COFA 2XASB 4C90A 4NXNT 1M62A 2LOPA 4HFIA 1C0AA 2LSIA 3PJAJ 3N9PA 4PJJA 2Q9QD 2WDRA 2E65A 2RHSB 3RX6A 2X0HA 2QHVA 2EHOC 2ZINA 1W0AA 2DU7A 5JH7E 3P8TA 1NJ8A 2YDRA 2ZIOA 2RA1A 3A7AA 3CK6A 2XQYA 3EFRA 4MFRA 2YEVC 3JAEA 3TKLB 3PTRB 2XAHB 3O9XA 2X68A 2ZZEA 2YDQA 4YSYA 2DJZA 3N9OA 1XMQT 2C7IA 3G1ZA 2NR4A 5L4EA 4YRIA 4WBNE 4LF5T 2XQ7A 4IE6A 3ZPOA 4QH4A 2Q9QC 2J62A 3MK7C 4HT4A 1HNWT 3HA4A 3AVSA 2WP9A 4H9OC 1FIOA 4TV8E 3CX8B 3BFMA 2W00A 3PE0A 4HWTA 3HFZA 3UUBA 5L47A 4K87A 3UU5A 4YRTA 3CX7B 2XQ9A 2W63A 4X62T 3OBVE 3ZJ1A 1H4TA 4F8HA 2BS2A 2P9BA 3RPUA 4WBOA 1NJ5A 2UU9T 4TVWA 4TZ4C 2AXDS 4YPFA 1FMVA 3J7Yq 4EGWA 4AXPA 4KUMB 3VQXA 1IJ5A 1D0XA 5AQTB 3KBTA 3AE6A 4ZS3A 3WAKA 2ALYA 4ILUA 1D0YA 1PYSB 3K3NA 2DU5A 1KNPA 5KMGP 3B13A 5FY1A 4EIWA 3ANWA 2D2SA 1HS7A 1B70B 3AE3A 4CH4A 4LF8T 3V7CA 3UU3A 4XTUA 5LMUT 3CVRA 3RRWA 4ZHQE 5CJ5A 1E2AA 4UVBB 2ZNJA 4DQ2A 5EK2A 2J4GA 2JQKA 4H2UA 1EIYA 2W0GA 1NWMX 2M67A 3FB2A 4O8SA 2LSJA 2MTQA 2Y48B 4CI2B 4YRFA 4UP8A 3UFGA 3L4GA 4YRNA 1WCRA 2VWAA 5J0ZA 4JEUB 1USYA 2CWOA 1XWMA 1HFAA 2X9XA 1D0ZA 2QVAA 3CKDA 5JDGA 2IC9A 3NZQA 5DQVA 5L2LA 1ZOYA 5JDHA 4YCVA 4AIUA 3AVRA 4X65T 2LSKA 3UGQA 3E08A 1J5WA 4ISTA 2IC6A 1MIWA 2JPFA 3LBXB 4ZI3C 2ODUA 4DR6T 2A9UA 3Q5EA 4V1Av 3MF2A 3FZMB 2XAGB 2DWGA 4JI3T 4U7IA 4X1YE 1KNRA 3NZPA 3IKMB 5HEUA 3AE4A 2PTFA 3EHZA 3AE2A 1L0VA 3OTOT 12ASA 1WLEA 2ZNIA 2PG8A 4DBQA 3N2KE 4C91A 3PV0F 5FNVE 4N78D 2XTLA 3UU4A 4AKIA 1X79A 3NBXX 4U2YA 3V8LA 2X0YA 2UUBT 2B76A 5LA6E 4DV7T 4TWDA 5LXTE 1BBWA 5JDNA 4G84A 4H02A 3TLWA 4YFSA 1VOMA 4PG3A 3G06A 3LJCA 3P4PA 2AE9A 4QKNA 2QHUA 1IAPA 1CHUA 2UXBT 2E10A 4DV3T 5GONE 3M4QA 5L3CB 3T1YT 3A7MA 3B57A 3V5SA 3S4UA 2ZR3A 5JR9C 1MNDA 3QB5K 5AQSB 2FUPA 4NIQA 2CLYC 2B1EA 4PK6A 2YOEA 3PU3A 4DO0A 3VQWA 4BW9A 4ILCA 2C5IT 2A2FX 3N9NA 2CBJA 3EI0A 5DQWA 4P75A 2E5LT 4HWDA 4IGUA 2L3LA 3BQKA 5AFUL 4I43B 3LBXA 4AQFA 3QOFA 3PJAA 4JI1T 2V7JA 3ZKRA 5L4HA 2XQ3A 3LSVA 3FJPA 4XTWA 1V9DA 1J5ET 3O1IA 2HN2A 2CXFA 1QUUA 2LRLA 4YY3T 3ICAA 2CXLA 2E9XB 3NVOA 2D5UA 2ZMAA 2NTYA 2X0LB 1SE7A 3I0QA 2H7VC 2NW8A 4IDPA 4YCWA 2ZT5A 2WB5A 5HEJA 4DV2T 2DTOA 3AE7A 2N1GA 4CXWA 2IHR1 4EZHA 5AQNB 3R07A 3OYZA 3AEDA 4MALA 4Z90A 3ETVA 3HL6A 3REXA 3HRIA 4G2AA 2E64A 1N9WA 1WFDA 3AEFA 4P75C 3EAMA 1RIQA 2KLQA 2LT3A 4JI0T 1FYFA 3V8JA 3KBUA 2ALYB 4HWCA 3AEGA 2I4LA 1EVLA 5AQJB 4EXTA 3L4GB 2G0UA 4U2ZA 3MJXA 5JR9A 4QXHB 1GQEA 4YJ3E 1ZP0A 4TWHA 4O2BE 1OEDA 2DNXA 4YRGA 4NUVA 5AQOB 4ISSA 3Q9DA 4LFBT 4UV8B 1HCIA 1MIYA 3PZCA 2BBJA 1B7YA 2LHNA 3P4SA 4Q6GA 4Z91A 2L8KA 2WZHA 2N9DA 4UPAA 1BR2A 5JTGA 4OYJA 2VL0A 4TQDA 3MZKB 5L3FB 1B70A 2WMNA 4UP9A 2V5CA 3A74A 3REUA 4ZI3D 2BKPA 4LF6T 3KFUA 4YCUA 4QH1A 5AQIB 5ELNA 3HR0A 5LBMA 3HXUA 2VURA 1B7YB 3KDSE 4QXCB 3EUHA 3CMQA 4CI3B 4ZEYA 4ZI7E 1G8XA 5FY0A 4JI8T 3MQZA 2UUCT 4U3CA 5HWYA 4DUZT 1KF6A 2H88A 4LVKA 4TWFA 4XTZA 4CH5A 2Y6XA 4DMVA 2X9HA 2X51A 2I4MA 2WY2A 3A5YA 2V7KA 2R6GF 4H9SE 5J2TE 3IHRA 1SETA 3K1SA 4AKRB 5M4YA 1NJ2A 3AB3B 2YINA 2IY5A 4Z8XA 2BG9E 2LM2A 4G63A 3NENA 2W4XA 4DR7T 2DI4A 3P4WA 4UXNB 4AI6A 4KMCA 3VKGA 3ZJ2A 3CQCB 3A7UA 3HXYA 4MBQA 4JBWF 2UXXB 3HKCE 4BJNA 2C5JA 3WI3A 11ASA 4YRPA 3VR9A 4I0UA 3LDQB 3RYIE 4KR3A 2LOSA 2H7OA 1HTTA 1ASZA 4JI6T 3VQVA 3E22E 1X01A 2ZR2A 2DLRA 2XJ7A 4XU1A 4DR5T 3ZC1A 4CN6A 3P50A 3NELA 1SUMB 1VCTA 2NTXA 3DSQA 4XU2A 2H3RA 3QK6A 2XSAA 2JIWA 3L8RA 3UQ7A 4P73A 2K48A 4ZZBA 4HWRA 1WRDA 2AMCA 3FBLA 4QWNB 3ZN1B 1UCUA 4U33A 4ILBA 2RHSA 2WDQA 2MPKA 4PAGA 5HEGA 3QC9A 4LMJA 2MYSA 4IL4A 4M1PA 1US7B 1W66A 3MF1A 4F6RC 5H6QB 4DV5T 5FL0A 4PJNA 2NW7A 2WBLA 2Z6EA 1YQ3A 1KNZA 2VB6A 1JNZA 1N32T 2DZCA 2W2UA 4LVLA 3CQXC 4TN7B 2CBIA 3N2GE 3J9X1 3QUJA 4HFBA 1T72A 3WAJA 3QTCA 4HFEA 4YTNA 4P72C 3AXJA 1E1HB 2V6YB 4OFZA 2SPCA 4HGAA 4P3OA 3P7IA 2DHRA 3UQ4A 3EFSA 5C3JA 1HTJF 4OYKA 4JYAT 2BG9B 3O1JA 3DP7A 1L0WA 4IDZA 2BS3A 1EFWA 1VQZA 1XDPA 4I55E 2XHEB 3HFVA 4P72A 4HVCA 4KR2A 1ZHCA 4H9QC 2ARSA 4X20E 1S94A 4YRSA 3TUPA 2BS4A 1H4VB 3H37A 3KV5A 4EB6E 3V8KA 1LYLA 1E7PA 4P3NA 3N2OA 5AQGB 2Q7EA 4B6XA 1CUNA 3L39A 2V7IA 2L9QA 5BR8T 1B8AA 3KINB 3L2ZA 2K9AA 4H9PC 1E24A 2I6HA 1IBMT 3RHWA 4A5XA 4RQFA 3QO5A 2XM1A 2PMFA 1SA0E 2VVNA
chains in the Genus database with same CATH topology
2ZIMA 3HXVA 1WU7A 3MF2A 4AH6A 4CH3A 4YDQA 4DPGA 4OLFA 3ERRA 1X56A 3I7FA 4CS4A 3IKMB 2EJ9A 2ZXFA 2ARUA 1WQWA 2CGHA 1ADYA 2ZNIA 1WLEA 12ASA 2DTHA 2IY5B 2QHTA 2DQ0A 1X55A 3V7SA 2DZ9A 4XEOA 4RDXA 4YRQA 4UP7A 1NNHA 3RIRA 4G85A 3V8LA 1EOVA 4YRJA 2Q5IA 1Z7MA 2PMEA 1BBWA 3HXXA 4G84A 4H02A 5F5WA 3LSSA 4PG3A 3M4PA 1EVKA 2CJAA 4WJ3M 1G5HA 2P0LA 4WJ4A 2ZZFA 5K1PA 3P8VA 4YRLA 2QHUA 4LVJA 1E22A 4YRKA 1EIYB 2E10A 2ZZGA 3M4QA 1BIAA 4L87A 2ZR3A 5C51B 4HA8A 3NEMA 1E1OA 4H2XB 2DKGA 4LVIA 2ZT8A 3E9IA 4EX5A 3VQWA 4BW9A 3RKXA 1ADJA 4CS2A 1HXDA 4ZTUB 4P75A 1B76A 3LSQA 2RHQB 4H2WA 4P73C 2E5AA 5HGQA 1NJ1A 3FJPA 1QE0A 4XTWA 1YFTA 2G4CA 3P8YA 4BWAA 3ICAA 3UH0A 4J15A 4TQFA 2ARTA 2E41A 2DEQA 1YB3A 3LC0A 5KNNA 1NJ6A 4HWSA 1ASYA 4YROA 3HFZB 2E1HA 4HWOA 1H4QA 4YCWA 2ODRD 3HY1A 2ZT5A 1NYQA 4H2TA 2CJ9A 4LNSA 2XGTA 4O2DA 4E51A 2AKWB 2DTOA 1X2HA 1WNLA 4TTVA 1YFSA 1WPYA 4TVAA 4XTVA 2DXTA 4XEMA 1X54A 3R07A 1YGBA 1IL2A 4YRCA 3REXA 1HC7A 2E64A 3HRIA 1N9WA 4P75C 3WQZA 1RIQA 2I4OA 1FYFA 4ZTZB 1WYDA 4TVYA 1SESA 3V8JA 1Z7NA 2ALYB 2DXUA 2I4LA 4P3PA 3RL6A 1EVLA 3MEYA 3L4GB 4K88A 1NYRA 2Q5HA 4YRRA 3PCOB 4K86A 1E1TA 4TWAA 4YRGA 5ELOA 2ZT6A 3RKWA 4YREA 2RHQA 3UGTA 5C52B 3PZCA 5C53B 4Q6GA 1B7YA 4UPAA 3TEGA 3RKYA 1SERA 2E3CA 3HY0A 4TQDA 4YP0A 1JJCA 2ODRC 1B70A 4CS3A 4UP9A 2CIMA 4YYEA 3A74A 3REUA 3KFUA 2DTIA 4YCUA 2EL9A 1JJCB 5ELNA 3HXUA 1SRYA 1B7YB 3RUXA 5K1XA 3CMQA 3RACA 4RQEA 1KMMA 2ZT7A 3A5ZA 3VBBA 3A7RA 3A32A 2EJFA 3NETA 2AMCB 3MQZA 3HXWA 2XTIA 2EAYA 4H2SA 4LVKA 4Q15A 4XTZA 4H2VA 4CH5A 2ZTGA 5E3IA 4TVAB 3QO7A 2I4MA 3A5YA 4XU3A 1SETA 3HXZA 2FYKA 1C0AA 2A8EA 1NJ2A 2DDZA 2P5IA 3IKLA 1G5IA 2E65A 2RHSB 2EWNA 2QHVA 2ZINA 2IY5A 2DU7A 4KQEA 3P8TA 1NJ8A 3NENA 3E9HA 4H2YA 3QNEA 2ZIOA 3A7AA 3A7UA 3EFRA 3HXYA 3V7RA 3RGLA 11ASA 4YRPA 2EJGA 4PHCA 4KR3A 2HNIA 1X2GA 1HTTA 1ASZA 2ZZEA 3VQVA 2Q7GA 3QO8A 2DJZA 1X01A 2ZR2A 2C7IA 4XU1A 4P74C 3G1ZA 3HTZA 4YRIA 3RF1A 3NELA 3DSQA 1G51A 4ZIBA 4XU2A 3L1AA 4HT4A 4EO4A 4P73A 3HRKA 1WQ7A 2AKWA 4HWRA 2AMCA 1BBUA 2J3LA 3BJUA 3BFMA 2RHSA 4HWTA 3HFZA 4K87A 4YRTA 4RMFA 1H4TA 1W66A 3MF1A 4HWPA 1YFRA 1KOGA 3OD1A 1NJ5A 4WF2A 4TVWA 4YPFA 2C8MA 3A31A 2DQ3A 2DZCA 4LVLA 2NS6A 3VQXA 3QTCA 4P74A 2ALYA 4P72C 1PYSB 4P3OA 2DU5A 4OP0A 3EFSA 4X5OA 1H4SA 1GGMA 1B70B 2ZCEA 1L0WA 4P71A 4CH4A 1EFWA 1VQZA 3W3SA 3IG2A 2J3MA 4P71C 1PYSA 3HFVA 2Q7HA 4P72A 3V7CA 4HVCA 4KR2A 3TUPA 2ARSA 3IALA 4YRSA 1H4VB 4XTUA 4WI1A 3VQYA 2ZNJA 4DQ2A 3V8KA 4H2UA 1LYLA 4LVMA 4P3NA 2DVEA 2Q7EA 1EIYA 2ZGWA 4XTYA 1ATIA 1B8AA 2I4NA 3TEHB 3L2ZA 4YRFA 4UP8A 3UFGA 3L4GA 4YRNA 4H2XA 1EQRA 1USYA 4NCXA 4YRMA 4CH6A 3TEHA 1E24A 4XU0A 2CJBA 4RQFA 1BIBA 1KMNA 4YCVA 3PCOA 3QO5A 3UGQA 1QF6A 2PMFA 1J5WA 1USYC 2QHSA 4XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIM A;  3HXV A;  1WU7 A;  3MF2 A;  4AH6 A;  4CH3 A;  4YDQ A;  4DPG A;  4OLF A;  3ERR A;  1X56 A;  3I7F A;  4CS4 A;  3IKM B;  2EJ9 A;  2ZXF A;  2ARU A;  1WQW A;  2CGH A;  1ADY A;  2ZNI A;  1WLE A;  12AS A;  2DTH A;  2IY5 B;  2QHT A;  2DQ0 A;  1X55 A;  3V7S A;  2DZ9 A;  4XEO A;  4RDX A;  4YRQ A;  4UP7 A;  1NNH A;  3RIR A;  4G85 A;  3V8L A;  1EOV A;  4YRJ A;  2Q5I A;  1Z7M A;  2PME A;  1BBW A;  3HXX A;  4G84 A;  4H02 A;  5F5W A;  3LSS A;  4PG3 A;  3M4P A;  1EVK A;  2CJA A;  4WJ3 M;  1G5H A;  2P0L A;  4WJ4 A;  2ZZF A;  5K1P A;  3P8V A;  4YRL A;  2QHU A;  1E22 A;  4YRK A;  1EIY B;  2E10 A;  2ZZG A;  3M4Q A;  1BIA A;  4L87 A;  2ZR3 A;  5C51 B;  4HA8 A;  3NEM A;  1E1O A;  4H2X B;  2DKG A;  2ZT8 A;  3E9I A;  4EX5 A;  3VQW A;  4BW9 A;  3RKX A;  1ADJ A;  4CS2 A;  1HXD A;  4ZTU B;  4P75 A;  1B76 A;  3LSQ A;  2RHQ B;  4H2W A;  4P73 C;  2E5A A;  5HGQ A;  1NJ1 A;  3FJP A;  1QE0 A;  4XTW A;  1YFT A;  2G4C A;  3P8Y A;  4BWA A;  3ICA A;  3UH0 A;  4J15 A;  4TQF A;  2ART A;  2E41 A;  2DEQ A;  1YB3 A;  3LC0 A;  5KNN A;  1NJ6 A;  4HWS A;  1ASY A;  4YRO A;  3HFZ B;  2E1H A;  4HWO A;  1H4Q A;  4YCW A;  2ODR D;  3HY1 A;  2ZT5 A;  1NYQ A;  4H2T A;  2CJ9 A;  4LNS A;  2XGT A;  4O2D A;  4E51 A;  2AKW B;  2DTO A;  1X2H A;  1WNL A;  4TTV A;  1YFS A;  1WPY A;  4TVA A;  4XTV A;  2DXT A;  4XEM A;  1X54 A;  3R07 A;  1YGB A;  1IL2 A;  4YRC A;  3REX A;  1HC7 A;  2E64 A;  3HRI A;  1N9W A;  4P75 C;  3WQZ A;  1RIQ A;  2I4O A;  1FYF A;  4ZTZ B;  1WYD A;  4TVY A;  1SES A;  3V8J A;  1Z7N A;  2ALY B;  2DXU A;  2I4L A;  4P3P A;  3RL6 A;  1EVL A;  3MEY A;  3L4G B;  4K88 A;  1NYR A;  2Q5H A;  4YRR A;  3PCO B;  4K86 A;  1E1T A;  4TWA A;  4YRG A;  5ELO A;  2ZT6 A;  3RKW A;  4YRE A;  2RHQ A;  3UGT A;  5C52 B;  3PZC A;  5C53 B;  4Q6G A;  1B7Y A;  4UPA A;  3TEG A;  3RKY A;  1SER A;  2E3C A;  3HY0 A;  4TQD A;  4YP0 A;  1JJC A;  2ODR C;  1B70 A;  4CS3 A;  4UP9 A;  2CIM A;  4YYE A;  3A74 A;  3REU A;  3KFU A;  2DTI A;  4YCU A;  2EL9 A;  1JJC B;  5ELN A;  3HXU A;  1SRY A;  1B7Y B;  3RUX A;  5K1X A;  3CMQ A;  3RAC A;  4RQE A;  1KMM A;  2ZT7 A;  3A5Z A;  3VBB A;  3A7R A;  3A32 A;  2EJF A;  3NET A;  2AMC B;  3HXW A;  2XTI A;  2EAY A;  4H2S A;  4Q15 A;  4XTZ A;  4H2V A;  4CH5 A;  2ZTG A;  5E3I A;  4TVA B;  3QO7 A;  2I4M A;  3A5Y A;  4XU3 A;  1SET A;  3HXZ A;  2FYK A;  1C0A A;  1NJ2 A;  2DDZ A;  2P5I A;  3IKL A;  1G5I A;  2E65 A;  2RHS B;  2EWN A;  2QHV A;  2ZIN A;  2IY5 A;  2DU7 A;  4KQE A;  3P8T A;  1NJ8 A;  3NEN A;  3E9H A;  4H2Y A;  3QNE A;  2ZIO A;  3A7A A;  3A7U A;  3EFR A;  3HXY A;  3V7R A;  3RGL A;  11AS A;  4YRP A;  2EJG A;  4PHC A;  4KR3 A;  2HNI A;  1X2G A;  1HTT A;  1ASZ A;  2ZZE A;  3VQV A;  2Q7G A;  3QO8 A;  2DJZ A;  1X01 A;  2ZR2 A;  2C7I A;  4XU1 A;  4P74 C;  3G1Z A;  3HTZ A;  4YRI A;  3RF1 A;  3NEL A;  3DSQ A;  1G51 A;  4ZIB A;  4XU2 A;  3L1A A;  4EO4 A;  4P73 A;  3HRK A;  1WQ7 A;  2AKW A;  4HWR A;  2AMC A;  1BBU A;  2J3L A;  3BJU A;  3BFM A;  2RHS A;  4HWT A;  3HFZ A;  4K87 A;  4YRT A;  4RMF A;  1H4T A;  1W66 A;  3MF1 A;  4HWP A;  1YFR A;  1KOG A;  3OD1 A;  1NJ5 A;  4WF2 A;  4TVW A;  4YPF A;  2C8M A;  3A31 A;  2DQ3 A;  2DZC A;  3VQX A;  3QTC A;  4P74 A;  2ALY A;  4P72 C;  1PYS B;  4P3O A;  2DU5 A;  4OP0 A;  3EFS A;  4X5O A;  1H4S A;  1GGM A;  1B70 B;  2ZCE A;  1L0W A;  4P71 A;  4CH4 A;  1EFW A;  1VQZ A;  3W3S A;  3IG2 A;  2J3M A;  4P71 C;  1PYS A;  3HFV A;  2Q7H A;  4P72 A;  3V7C A;  4HVC A;  4KR2 A;  3TUP A;  2ARS A;  3IAL A;  4YRS A;  1H4V B;  4XTU A;  4WI1 A;  3VQY A;  2ZNJ A;  4DQ2 A;  3V8K A;  4H2U A;  1LYL A;  4P3N A;  2DVE A;  2Q7E A;  1EIY A;  2ZGW A;  4XTY A;  1ATI A;  1B8A A;  2I4N A;  3TEH B;  3L2Z A;  4YRF A;  4UP8 A;  3UFG A;  3L4G A;  4YRN A;  4H2X A;  1EQR A;  1USY A;  4NCX A;  4YRM A;  4CH6 A;  3TEH A;  1E24 A;  4XU0 A;  2CJB A;  4RQF A;  1BIB A;  1KMN A;  4YCV A;  3PCO A;  3QO5 A;  3UGQ A;  1QF6 A;  2PMF A;  1J5W A;  1USY C;  2QHS A;  4XTX A; 
#chains in the Genus database with same CATH topology
 4IDN A;  3Q5D A;  3NRY A;  4OHF A;  2XZE A;  2JQQ A;  5HXS A;  3FXE B;  3N9Q A;  3AAI A;  3AE5 A;  4GYS A;  3RIU A;  2CGH A;  1ADY A;  4YSX A;  2DTH A;  1X9B A;  2QHT A;  1X55 A;  2D0U A;  2NW9 A;  4PNI A;  4XEO A;  1EZ3 A;  4HTE A;  4RDX A;  4I4T E;  5AQL B;  3AXJ B;  5JRE A;  1O3X A;  4YRJ A;  4YXD A;  3C98 B;  4IE0 A;  5LMN T;  1Z7M A;  3HXX A;  3U3I A;  3RYC E;  3TLS A;  5EK3 A;  5FVK A;  3JCF A;  3ZT5 A;  4LVJ A;  1LRZ A;  1Z8U A;  4YRK A;  2WM9 A;  5FYM A;  3CWZ B;  5C51 B;  3LFM A;  4O4J E;  4CN1 A;  1XNR T;  2BZB A;  2ZT8 A;  5HAX A;  4GYR A;  2XQ4 A;  4TX5 A;  5HXC A;  3AE9 A;  4YLH A;  3A5X A;  5IWA T;  2I59 A;  4PJL A;  4WYV A;  3TLT A;  2BVM A;  5CFB A;  4KI0 F;  1H7C A;  3PUZ F;  3OVU A;  4H9N C;  2RHQ B;  5HCM A;  3R84 B;  5LG4 A;  1UUS A;  3BQI A;  1ZEE A;  4H63 V;  5HGQ A;  1NJ1 A;  4PK5 A;  1QE0 A;  5ABE A;  2G4C A;  2JJ9 A;  2HHH T;  3OJA A;  3ZMT B;  4U72 A;  4HFD A;  5IHY A;  4TQF A;  4NXM T;  3H3M A;  4IDO A;  1S35 A;  4L0R A;  3LC0 A;  3GWH A;  1ASY A;  3AA7 B;  3VRB A;  2XUE A;  1H4Q A;  4DMW A;  3HY1 A;  1NYQ A;  1IBK T;  5FXV A;  4AQY T;  4NPP A;  2RP4 A;  2XGT A;  3Q2M A;  1X2H A;  4PW8 A;  2UXD T;  1BR4 A;  1YFS A;  4K0U A;  1WPY A;  4XZC A;  4Q25 A;  1X54 A;  3ZYM A;  1HC7 A;  4YHH T;  2WS3 A;  3AEB A;  2CCQ A;  2CWY A;  2CEA A;  3ZSS A;  1WYD A;  4DV1 T;  4JLE A;  2KMF A;  2H89 A;  2PJQ A;  5JVD E;  4UEM A;  4A56 A;  1N33 T;  2F4V T;  1NYR A;  2BG9 C;  2Q5H A;  3MKD A;  2KIN B;  1Y01 A;  2NWB A;  2M6B A;  3C4W A;  3PCO B;  4TWA A;  2HPL A;  2HN1 A;  5E0O A;  3RKW A;  2RHQ A;  2XPK A;  3CML A;  4HWH A;  3FBZ A;  2DCF A;  5ABF A;  3RRC A;  2IIU A;  3TEG A;  3RKY A;  1SER A;  5IUX A;  4ZZC A;  2E3C A;  3HY0 A;  4YP0 A;  1OED B;  2D9D A;  2CIM A;  4LFA T;  4YYE A;  1XZY A;  3C64 A;  4K0K T;  4P0B A;  5JR9 B;  2DTI A;  1JJC B;  2WSS V;  2KXP B;  3ZMV B;  3RAC A;  3N5L A;  4E7Z A;  4UVA B;  2ZT7 A;  2YK0 A;  2EJF A;  3JC6 D;  2VKO A;  2XTI A;  2EAY A;  4AKH A;  2ACZ A;  2JRK A;  4H2V A;  4KX6 A;  2LM9 A;  4EED A;  3ZMZ B;  3HKD E;  5LCY A;  3QO7 A;  3ONX A;  5KDM C;  5AQR B;  5LB7 B;  4XU3 A;  3HXZ A;  3RKG A;  1G73 A;  2RPA A;  2DDZ A;  2ZM6 T;  4DVD A;  2P5I A;  2X9W A;  2XAJ B;  4YTM A;  1AJ3 A;  2CM0 A;  4KQE A;  5FXX A;  5CA0 E;  4ASK A;  1YD8 G;  4B3S T;  3E9H A;  3ZYK A;  1HNZ T;  3QNE A;  2E9X A;  4L5G A;  4U31 A;  1B7T A;  5AQF B;  3V7R A;  5AQU B;  3P4R A;  4IDQ A;  3T1H T;  3L09 A;  1X2G A;  3ZCI A;  3ZYL A;  2V5D A;  3QO8 A;  4QX7 B;  5HXR A;  3I0O A;  4P74 C;  4IIJ E;  3AAE B;  2C0S A;  2XQ8 A;  3RF1 A;  4PFP A;  3L1A A;  5L3E B;  4EO4 A;  2LLY A;  5LYJ E;  3AA1 B;  4GK5 E;  3F31 A;  1BBU A;  2J3L A;  5F8P A;  3BJU A;  1HNX T;  4ANJ A;  5J1G A;  4RMF A;  2YU1 A;  3RC8 A;  1OED E;  2ZM8 A;  2OLT A;  4HWP A;  4ZI2 D;  4PFO A;  2IDO B;  4WF2 A;  5LHH B;  2VQF T;  2WAU A;  2VAS A;  2DQ3 A;  2KND A;  3SOL A;  3ZC0 A;  1OWA A;  4LFC T;  4P74 A;  4AIS A;  2VKH A;  2W62 A;  1MMN A;  2X67 A;  3RLF F;  4LF7 T;  3X1D A;  4OP0 A;  4TNW A;  2QYW A;  1HF8 A;  5LJN A;  4X5O A;  4IE7 A;  2V1D B;  2CHN A;  1GGM A;  4NUU A;  3LK2 B;  2ZCE A;  4LML A;  2BKO A;  5FL1 A;  2JQH A;  3FZK B;  4DR1 T;  2JQ9 A;  3IG2 A;  3W3S A;  4P71 C;  2E9X C;  1PYS A;  2Q7H A;  2HH7 A;  4YHJ A;  2V8S V;  2CA5 A;  2MOZ A;  1M7K A;  3RIF A;  2A72 A;  3RQU A;  2BVL A;  1YQ4 A;  4LVM A;  3RIU C;  2E9X D;  2DVE A;  2VKD A;  3UUN A;  5TAO A;  1NAF A;  2ZGW A;  3LK4 2;  3AEE A;  2I4N A;  3ZT6 A;  5HXE A;  2K3W A;  4KHP T;  5JDM A;  3FZH B;  5C8Y E;  4H2X A;  5FXW A;  3SS1 A;  1EQR A;  4NCX A;  4YRM A;  3FZF B;  4CH6 A;  3CX6 B;  2WWV A;  3OYX A;  1MNE A;  3Q5X A;  1T8B A;  2FJD A;  3N9L A;  1KMN A;  4X64 T;  2XQ6 A;  3PCO A;  4O4I E;  1Z0P A;  2QHS A;  3AE8 A;  4XTX A;  3HXV A;  1FEW A;  1WU7 A;  4AH6 A;  4CH3 A;  1FMW A;  4QXB B;  4DPG A;  4XBF B;  4OLF A;  3ERR A;  2V7M A;  4MHC A;  2EJ9 A;  1VCS A;  1WQW A;  3M3Z B;  4JI7 T;  2WQY A;  2IY5 B;  2DQ0 A;  2DZ9 A;  2Y8D A;  1Y64 B;  5JDF A;  4IT4 A;  1NNH A;  4G85 A;  1EOV A;  5HEO A;  3PUX F;  3KV9 A;  4JV5 T;  2XQ5 A;  3HKE E;  4IL9 A;  2Q5I A;  4ADZ A;  2PME A;  2VVS A;  4HFV A;  3PUA A;  5F5W A;  3LSS A;  3M4P A;  1EVK A;  4WJ3 M;  3AE1 A;  1W0B A;  2ZZF A;  4EAH A;  3TLV A;  2A3D A;  3P8V A;  2UXN B;  3UUL A;  5JDQ A;  1KFY A;  1EIY B;  2ZZG A;  3JAF A;  4UF0 A;  3KFW X;  2QGS A;  3MAC A;  4HA8 A;  4CZZ B;  3QNU A;  4GKK T;  1E1O A;  1W9R A;  2X9Y A;  2X66 A;  5FY7 A;  2BBH A;  3E9I A;  3NKZ A;  2EHO A;  4GIW A;  3RKX A;  4L9I A;  4CS2 A;  4P0A A;  1JNR A;  3ANW B;  3P8C D;  1XMO T;  2VQE T;  3IEE A;  2W66 A;  4KBM B;  1UX4 A;  1YKE B;  4H2W A;  4P73 C;  4YTP A;  3KV6 A;  1XNQ T;  3SRZ A;  3BQL A;  1HX1 B;  4EZ4 A;  3GMI A;  1VRB A;  3UUX B;  4BWA A;  1J1J A;  3R6N A;  2E41 A;  4LF9 T;  2EHO D;  3VR8 A;  2C5K T;  3MXZ A;  4UR9 A;  2W67 A;  2VL8 A;  1NJ6 A;  3DJB A;  2JMH A;  4HFH A;  5AQV B;  3HFZ B;  4DV4 T;  4HWO A;  3AA6 B;  1WYC A;  3K3Q C;  4O2D A;  5EK4 A;  3V5U A;  2UUA T;  5CGM A;  4GOU A;  1MIV A;  2YKS A;  2DXT A;  4XEM A;  2WWU A;  4LMK A;  1WR0 A;  2M6I A;  5HYA A;  3H3A A;  3WQZ A;  5LJM A;  4ZTZ B;  2LEH A;  2V6X A;  1SES A;  3CIR A;  3ZEF B;  4ERR A;  3CPZ A;  4HE8 A;  5LHI B;  4P3P A;  2NP9 A;  1ZKE A;  5LHG B;  3MEY A;  4K88 A;  2IW5 B;  3RH3 A;  4J2C A;  5ABH A;  1N36 T;  3HI2 A;  5CA1 E;  1IBL T;  3PU8 A;  4YRR A;  4DUY T;  3ONJ A;  1E1T A;  3JC6 C;  5ELO A;  2CXD A;  4YRE A;  3UGT A;  2OA5 A;  4O4L E;  4IE4 A;  1MMD A;  5C2T A;  2Q9Q B;  2OV9 A;  5AQM B;  4JI4 T;  2CE7 A;  3RQW A;  2IAK A;  3PUY F;  4MLK A;  5JQG E;  4X66 T;  2ACX A;  2ODR C;  4CS3 A;  1T7S A;  1SHZ C;  4UVC B;  1IJ6 A;  4X5T A;  2ZM0 A;  4ZS2 A;  1D1A A;  2WU5 A;  2K24 A;  3RUX A;  3UFE A;  3K8P C;  3RYH E;  3RC3 A;  1KMM A;  5F3J A;  5KXJ A;  3VBB A;  5AQK B;  5FMN A;  3A32 A;  3RKO A;  2AMC B;  5L3G B;  3PUV F;  5L3D B;  3W15 B;  1MMG A;  2FJB A;  4UV9 B;  3SFE A;  4YSZ A;  2ZTG A;  3O1H A;  5E3I A;  4FI5 A;  4EYU A;  4TVA B;  2LSY A;  3LK3 B;  2LKG A;  3C51 A;  3VU7 H;  3ABV A;  3PUQ A;  1D1C A;  3GN5 B;  5HCJ A;  3C4X A;  2MBG A;  1QLB A;  5AQH B;  3BK9 A;  2FYK A;  4YJ2 E;  4CXX A;  4QHO A;  2A8E A;  3IKL A;  1ZV4 X;  1G5I A;  1YW0 A;  2E5V A;  2QRX A;  2EWN A;  4P09 A;  2WDV A;  2IML A;  4JEH B;  4WNK A;  3AAA B;  4A97 A;  5ADX L;  3ZMU B;  4H2Y A;  3NWI A;  5DAB A;  3ZST A;  2Q9Q A;  3I9W A;  2XAF B;  2KWI B;  4ILA A;  2ZLY A;  3ESL A;  4X1I E;  3RGL A;  2EJG A;  4PHC A;  3VHL A;  2HNI A;  3FXD B;  4IHJ E;  4HWF A;  2Q7G A;  4ZI2 C;  4YT0 A;  3RYF E;  3HTZ A;  3UUM A;  1G51 A;  5FP3 A;  1HG5 A;  4ZIB A;  4AQF C;  2ES0 A;  3HRK A;  2J47 A;  3ZN0 B;  1WQ7 A;  4DR4 T;  2AKW A;  4EEB A;  5J2U E;  1I94 T;  2V6Y A;  5AQP B;  4HN9 A;  2LKH A;  2DL1 A;  1DU2 A;  4KP3 C;  3I1A A;  1YFR A;  1KOG A;  3OD1 A;  3Q5W A;  2C8M A;  3A31 A;  2PBI A;  1UK5 A;  3T8O A;  1NEK A;  3ZLI A;  2IUB A;  2LSG A;  2NS6 A;  3UT5 E;  2CRB A;  3U78 A;  2NOX A;  4DR2 T;  4KHZ F;  3FZL B;  4UF0 B;  4CN4 A;  3VRA A;  1KK7 A;  3UTK A;  3CQG B;  4HEA A;  1H4S A;  2QA7 A;  4E7S A;  4BA9 A;  2XSB A;  4P71 A;  1XDO A;  3UU6 A;  2JMK A;  3ONL C;  4O4H E;  4U7Y A;  2J3M A;  2HPJ A;  3ZMS B;  3IAL A;  4DID B;  2FJA A;  4WI1 A;  3VQY A;  2LE8 A;  3NRX A;  3KVB A;  5LGU B;  3F2E A;  2WZI A;  4XTY A;  1ATI A;  2EHO B;  3TEH B;  4AQG A;  5LP6 E;  3LG7 A;  2PFV A;  3AEC A;  3TEH A;  4TNV A;  4B3M T;  4XU0 A;  2CJB A;  1BIB A;  4IRE A;  5LG3 A;  1QF6 A;  2BDE A;  1USY C;  3O4X E;  4PJM A;  2ZIM A;  1LVF A;  2K5B B;  3EDU A;  3SWH A;  4YDQ A;  1KEY A;  2J1D G;  2V7L A;  2ZM2 A;  3F57 A;  1I6Z A;  1X56 A;  3I7F A;  3ETU A;  4CS4 A;  3KV4 A;  2ZXF A;  2CMR A;  2ARU A;  3MA9 A;  5BMV E;  4OX9 T;  4JUY A;  3V7S A;  2W61 A;  4ZXL A;  1FJG T;  4YRQ A;  4UP7 A;  2LRK A;  3EDV A;  4HFC A;  3RIR A;  5LGT B;  3PUS A;  3IF8 B;  4TV9 E;  2YU2 A;  4WW0 A;  1WR6 A;  2BKN A;  2WU2 A;  3OKQ A;  2CJA A;  1LVK A;  4DV6 T;  1G5H A;  2KWH A;  3JAD A;  2P0L A;  4WJ4 A;  5K1P A;  4FJO A;  3ZT7 A;  2KZ7 B;  4YRL A;  2XY8 B;  1E22 A;  2DWK A;  3KVA A;  4GKJ T;  3PUR A;  4EOZ B;  4P1N A;  5HWX A;  3GN5 A;  1BIA A;  4L87 A;  1HG2 A;  4UEL A;  4IE5 A;  3NEM A;  2WCA A;  2E2A A;  4H2X B;  3HKB E;  2DKG A;  4LVI A;  5A1L A;  1OED C;  4EX5 A;  5FXZ A;  4JI5 T;  1QSD A;  1ADJ A;  4X1K E;  3FHN A;  3RI5 A;  4HKA A;  3E0Z A;  1HXD A;  4ZTU B;  1B76 A;  3LSQ A;  3PUG A;  1N34 T;  1UUR A;  3D0T A;  4B3T T;  1NEN A;  4DV0 T;  4AKG A;  2E5A A;  3VKH A;  5LGN B;  2YN6 A;  4OK0 A;  1IZN B;  4LF4 T;  1YFT A;  2VKJ A;  3P8Y A;  5JRC A;  3UH0 A;  2WMO A;  4J15 A;  2KT9 A;  1YKH B;  2VK9 A;  5JRC B;  2ART A;  4DND A;  2DEQ A;  4DBR A;  1YB3 A;  5KNN A;  1HX8 A;  4HWS A;  4YRO A;  2E1H A;  5HXH A;  2ODR D;  4BAY B;  1U5P A;  4H2T A;  3PDY A;  2CJ9 A;  4LNS A;  3GA8 A;  4E51 A;  3PUW F;  2AKW B;  3N9M A;  1WNL A;  4TTV A;  2MAW A;  2ODV A;  4U74 A;  4TVA A;  4XTV A;  4EV6 A;  4A98 A;  2UXC T;  1BR0 A;  1YGB A;  5CB4 E;  1IL2 A;  2BG9 A;  4YRC A;  4B3R T;  2XQA A;  2N2N A;  4ZOL E;  4EYY R;  2I4O A;  2I0M A;  1YXR A;  5H6R B;  5IYZ E;  5KX5 E;  4TVY A;  3QB5 A;  2CHO A;  1LKX A;  2XM2 A;  3AEA A;  5ABG A;  3EAB A;  1Z7N A;  3RIA A;  4JI2 T;  4QX8 B;  3K3O A;  2LHR A;  2DXU A;  3RL6 A;  3L3P A;  3DTO A;  1MMA A;  3SFD A;  3C50 A;  2E8I A;  2CPT A;  4O2A E;  4AKL A;  2KSR A;  1R8I A;  3IA3 A;  4H63 H;  4K86 A;  4XAX B;  4HWI B;  5LOV E;  1BR1 A;  1W09 A;  2ZT6 A;  5L3B B;  2YDS A;  4H9R C;  4I50 E;  5C52 B;  2D0T A;  5C53 B;  4CXY A;  2XAQ B;  5LNK A;  3OPC A;  3B5M A;  3C4Z A;  4WZX A;  1JJC A;  1T98 A;  2LJL A;  5AQQ B;  1U4Q A;  1D1B A;  5FKY A;  4DR3 T;  4PK4 A;  3M65 A;  2EL9 A;  3IBP A;  1UGO A;  2V26 A;  1SRY A;  1OXZ A;  2FJE A;  5K1X A;  1WLX A;  2CLY B;  3P4Q A;  5ABF B;  3EVY A;  4TUY E;  4RQE A;  2FBW A;  4UIG A;  4CQI A;  3A5Z A;  1WYB A;  3UU8 A;  5JDL A;  4QH5 A;  3A7R A;  5FVL A;  5HEH A;  3NET A;  5DJQ C;  5ETW A;  3TLU A;  1UX5 A;  2GK9 A;  3HXW A;  3AA0 B;  5EZY E;  1HR0 T;  4H2S A;  4GK0 E;  4CI1 B;  3I9Y A;  4Q15 A;  3A8Y C;  4BJM A;  5LBQ B;  3ZCJ A;  4COF A;  2XAS B;  4C90 A;  4NXN T;  1M62 A;  2LOP A;  4HFI A;  1C0A A;  2LSI A;  3PJA J;  3N9P A;  4PJJ A;  2Q9Q D;  2WDR A;  2E65 A;  2RHS B;  3RX6 A;  2X0H A;  2QHV A;  2EHO C;  2ZIN A;  1W0A A;  2DU7 A;  5JH7 E;  3P8T A;  1NJ8 A;  2YDR A;  2ZIO A;  2RA1 A;  3A7A A;  3CK6 A;  2XQY A;  3EFR A;  4MFR A;  2YEV C;  3JAE A;  3TKL B;  3PTR B;  2XAH B;  3O9X A;  2X68 A;  2ZZE A;  2YDQ A;  4YSY A;  2DJZ A;  3N9O A;  1XMQ T;  2C7I A;  3G1Z A;  2NR4 A;  5L4E A;  4YRI A;  4WBN E;  4LF5 T;  2XQ7 A;  4IE6 A;  3ZPO A;  4QH4 A;  2Q9Q C;  2J62 A;  3MK7 C;  4HT4 A;  1HNW T;  3HA4 A;  3AVS A;  2WP9 A;  4H9O C;  1FIO A;  4TV8 E;  3CX8 B;  3BFM A;  2W00 A;  3PE0 A;  4HWT A;  3HFZ A;  3UUB A;  5L47 A;  4K87 A;  3UU5 A;  4YRT A;  3CX7 B;  2XQ9 A;  2W63 A;  4X62 T;  3OBV E;  3ZJ1 A;  1H4T A;  4F8H A;  2BS2 A;  2P9B A;  3RPU A;  4WBO A;  1NJ5 A;  2UU9 T;  4TVW A;  4TZ4 C;  2AXD S;  4YPF A;  1FMV A;  3J7Y q;  4EGW A;  4AXP A;  4KUM B;  3VQX A;  1IJ5 A;  1D0X A;  5AQT B;  3KBT A;  3AE6 A;  4ZS3 A;  3WAK A;  2ALY A;  4ILU A;  1D0Y A;  1PYS B;  3K3N A;  2DU5 A;  1KNP A;  5KMG P;  3B13 A;  5FY1 A;  4EIW A;  3ANW A;  2D2S A;  1HS7 A;  1B70 B;  3AE3 A;  4CH4 A;  4LF8 T;  3V7C A;  3UU3 A;  4XTU A;  5LMU T;  3CVR A;  3RRW A;  4ZHQ E;  5CJ5 A;  1E2A A;  4UVB B;  2ZNJ A;  4DQ2 A;  5EK2 A;  2J4G A;  2JQK A;  4H2U A;  1EIY A;  2W0G A;  1NWM X;  2M67 A;  3FB2 A;  4O8S A;  2LSJ A;  2MTQ A;  2Y48 B;  4CI2 B;  4YRF A;  4UP8 A;  3UFG A;  3L4G A;  4YRN A;  1WCR A;  2VWA A;  5J0Z A;  4JEU B;  1USY A;  2CWO A;  1XWM A;  1HFA A;  2X9X A;  1D0Z A;  2QVA A;  3CKD A;  5JDG A;  2IC9 A;  3NZQ A;  5DQV A;  5L2L A;  1ZOY A;  5JDH A;  4YCV A;  4AIU A;  3AVR A;  4X65 T;  2LSK A;  3UGQ A;  3E08 A;  1J5W A;  4IST A;  2IC6 A;  1MIW A;  2JPF A;  3LBX B;  4ZI3 C;  2ODU A;  4DR6 T;  2A9U A;  3Q5E A;  4V1A v;  3MF2 A;  3FZM B;  2XAG B;  2DWG A;  4JI3 T;  4U7I A;  4X1Y E;  1KNR A;  3NZP A;  3IKM B;  5HEU A;  3AE4 A;  2PTF A;  3EHZ A;  3AE2 A;  1L0V A;  3OTO T;  12AS A;  1WLE A;  2ZNI A;  2PG8 A;  4DBQ A;  3N2K E;  4C91 A;  3PV0 F;  5FNV E;  4N78 D;  2XTL A;  3UU4 A;  4AKI A;  1X79 A;  3NBX X;  4U2Y A;  3V8L A;  2X0Y A;  2UUB T;  2B76 A;  5LA6 E;  4DV7 T;  4TWD A;  5LXT E;  1BBW A;  5JDN A;  4G84 A;  4H02 A;  3TLW A;  4YFS A;  1VOM A;  4PG3 A;  3G06 A;  3LJC A;  3P4P A;  2AE9 A;  4QKN A;  2QHU A;  1IAP A;  1CHU A;  2UXB T;  2E10 A;  4DV3 T;  5GON E;  3M4Q A;  5L3C B;  3T1Y T;  3A7M A;  3B57 A;  3V5S A;  3S4U A;  2ZR3 A;  5JR9 C;  1MND A;  3QB5 K;  5AQS B;  2FUP A;  4NIQ A;  2CLY C;  2B1E A;  4PK6 A;  2YOE A;  3PU3 A;  4DO0 A;  3VQW A;  4BW9 A;  4ILC A;  2C5I T;  2A2F X;  3N9N A;  2CBJ A;  3EI0 A;  5DQW A;  4P75 A;  2E5L T;  4HWD A;  4IGU A;  2L3L A;  3BQK A;  5AFU L;  4I43 B;  3LBX A;  4AQF A;  3QOF A;  3PJA A;  4JI1 T;  2V7J A;  3ZKR A;  5L4H A;  2XQ3 A;  3LSV A;  3FJP A;  4XTW A;  1V9D A;  1J5E T;  3O1I A;  2HN2 A;  2CXF A;  1QUU A;  2LRL A;  4YY3 T;  3ICA A;  2CXL A;  2E9X B;  3NVO A;  2D5U A;  2ZMA A;  2NTY A;  2X0L B;  1SE7 A;  3I0Q A;  2H7V C;  2NW8 A;  4IDP A;  4YCW A;  2ZT5 A;  2WB5 A;  5HEJ A;  4DV2 T;  2DTO A;  3AE7 A;  2N1G A;  4CXW A;  2IHR 1;  4EZH A;  5AQN B;  3R07 A;  3OYZ A;  3AED A;  4MAL A;  4Z90 A;  3ETV A;  3HL6 A;  3REX A;  3HRI A;  4G2A A;  2E64 A;  1N9W A;  1WFD A;  3AEF A;  4P75 C;  3EAM A;  1RIQ A;  2KLQ A;  2LT3 A;  4JI0 T;  1FYF A;  3V8J A;  3KBU A;  2ALY B;  4HWC A;  3AEG A;  2I4L A;  1EVL A;  5AQJ B;  4EXT A;  3L4G B;  2G0U A;  4U2Z A;  3MJX A;  5JR9 A;  4QXH B;  1GQE A;  4YJ3 E;  1ZP0 A;  4TWH A;  4O2B E;  1OED A;  2DNX A;  4YRG A;  4NUV A;  5AQO B;  4ISS A;  3Q9D A;  4LFB T;  4UV8 B;  1HCI A;  1MIY A;  3PZC A;  2BBJ A;  1B7Y A;  2LHN A;  3P4S A;  4Q6G A;  4Z91 A;  2L8K A;  2WZH A;  2N9D A;  4UPA A;  1BR2 A;  5JTG A;  4OYJ A;  2VL0 A;  4TQD A;  3MZK B;  5L3F B;  1B70 A;  2WMN A;  4UP9 A;  2V5C A;  3A74 A;  3REU A;  4ZI3 D;  2BKP A;  4LF6 T;  3KFU A;  4YCU A;  4QH1 A;  5AQI B;  5ELN A;  3HR0 A;  5LBM A;  3HXU A;  2VUR A;  1B7Y B;  3KDS E;  4QXC B;  3EUH A;  3CMQ A;  4CI3 B;  4ZEY A;  4ZI7 E;  1G8X A;  5FY0 A;  4JI8 T;  3MQZ A;  2UUC T;  4U3C A;  5HWY A;  4DUZ T;  1KF6 A;  2H88 A;  4LVK A;  4TWF A;  4XTZ A;  4CH5 A;  2Y6X A;  4DMV A;  2X9H A;  2X51 A;  2I4M A;  2WY2 A;  3A5Y A;  2V7K A;  2R6G F;  4H9S E;  5J2T E;  3IHR A;  1SET A;  3K1S A;  4AKR B;  5M4Y A;  1NJ2 A;  3AB3 B;  2YIN A;  2IY5 A;  4Z8X A;  2BG9 E;  2LM2 A;  4G63 A;  3NEN A;  2W4X A;  4DR7 T;  2DI4 A;  3P4W A;  4UXN B;  4AI6 A;  4KMC A;  3VKG A;  3ZJ2 A;  3CQC B;  3A7U A;  3HXY A;  4MBQ A;  4JBW F;  2UXX B;  3HKC E;  4BJN A;  2C5J A;  3WI3 A;  11AS A;  4YRP A;  3VR9 A;  4I0U A;  3LDQ B;  3RYI E;  4KR3 A;  2LOS A;  2H7O A;  1HTT A;  1ASZ A;  4JI6 T;  3VQV A;  3E22 E;  1X01 A;  2ZR2 A;  2DLR A;  2XJ7 A;  4XU1 A;  4DR5 T;  3ZC1 A;  4CN6 A;  3P50 A;  3NEL A;  1SUM B;  1VCT A;  2NTX A;  3DSQ A;  4XU2 A;  2H3R A;  3QK6 A;  2XSA A;  2JIW A;  3L8R A;  3UQ7 A;  4P73 A;  2K48 A;  4ZZB A;  4HWR A;  1WRD A;  2AMC A;  3FBL A;  4QWN B;  3ZN1 B;  1UCU A;  4U33 A;  4ILB A;  2RHS A;  2WDQ A;  2MPK A;  4PAG A;  5HEG A;  3QC9 A;  4LMJ A;  2MYS A;  4IL4 A;  4M1P A;  1US7 B;  1W66 A;  3MF1 A;  4F6R C;  5H6Q B;  4DV5 T;  5FL0 A;  4PJN A;  2NW7 A;  2WBL A;  2Z6E A;  1YQ3 A;  1KNZ A;  2VB6 A;  1JNZ A;  1N32 T;  2DZC A;  2W2U A;  4LVL A;  3CQX C;  4TN7 B;  2CBI A;  3N2G E;  3J9X 1;  3QUJ A;  4HFB A;  1T72 A;  3WAJ A;  3QTC A;  4HFE A;  4YTN A;  4P72 C;  3AXJ A;  1E1H B;  2V6Y B;  4OFZ A;  2SPC A;  4HGA A;  4P3O A;  3P7I A;  2DHR A;  3UQ4 A;  3EFS A;  5C3J A;  1HTJ F;  4OYK A;  4JYA T;  2BG9 B;  3O1J A;  3DP7 A;  1L0W A;  4IDZ A;  2BS3 A;  1EFW A;  1VQZ A;  1XDP A;  4I55 E;  2XHE B;  3HFV A;  4P72 A;  4HVC A;  4KR2 A;  1ZHC A;  4H9Q C;  2ARS A;  4X20 E;  1S94 A;  4YRS A;  3TUP A;  2BS4 A;  1H4V B;  3H37 A;  3KV5 A;  4EB6 E;  3V8K A;  1LYL A;  1E7P A;  4P3N A;  3N2O A;  5AQG B;  2Q7E A;  4B6X A;  1CUN A;  3L39 A;  2V7I A;  2L9Q A;  5BR8 T;  1B8A A;  3KIN B;  3L2Z A;  2K9A A;  4H9P C;  1E24 A;  2I6H A;  1IBM T;  3RHW A;  4A5X A;  4RQF A;  3QO5 A;  2XM1 A;  2PMF A;  1SA0 E;  2VVN A; 
#chains in the Genus database with same CATH homology
 2ZIM A;  3HXV A;  1WU7 A;  3MF2 A;  4AH6 A;  4CH3 A;  4YDQ A;  4DPG A;  4OLF A;  3ERR A;  1X56 A;  3I7F A;  4CS4 A;  3IKM B;  2EJ9 A;  2ZXF A;  2ARU A;  1WQW A;  2CGH A;  1ADY A;  2ZNI A;  1WLE A;  12AS A;  2DTH A;  2IY5 B;  2QHT A;  2DQ0 A;  1X55 A;  3V7S A;  2DZ9 A;  4XEO A;  4RDX A;  4YRQ A;  4UP7 A;  1NNH A;  3RIR A;  4G85 A;  3V8L A;  1EOV A;  4YRJ A;  2Q5I A;  1Z7M A;  2PME A;  1BBW A;  3HXX A;  4G84 A;  4H02 A;  5F5W A;  3LSS A;  4PG3 A;  3M4P A;  1EVK A;  2CJA A;  4WJ3 M;  1G5H A;  2P0L A;  4WJ4 A;  2ZZF A;  5K1P A;  3P8V A;  4YRL A;  2QHU A;  4LVJ A;  1E22 A;  4YRK A;  1EIY B;  2E10 A;  2ZZG A;  3M4Q A;  1BIA A;  4L87 A;  2ZR3 A;  5C51 B;  4HA8 A;  3NEM A;  1E1O A;  4H2X B;  2DKG A;  4LVI A;  2ZT8 A;  3E9I A;  4EX5 A;  3VQW A;  4BW9 A;  3RKX A;  1ADJ A;  4CS2 A;  1HXD A;  4ZTU B;  4P75 A;  1B76 A;  3LSQ A;  2RHQ B;  4H2W A;  4P73 C;  2E5A A;  5HGQ A;  1NJ1 A;  3FJP A;  1QE0 A;  4XTW A;  1YFT A;  2G4C A;  3P8Y A;  4BWA A;  3ICA A;  3UH0 A;  4J15 A;  4TQF A;  2ART A;  2E41 A;  2DEQ A;  1YB3 A;  3LC0 A;  5KNN A;  1NJ6 A;  4HWS A;  1ASY A;  4YRO A;  3HFZ B;  2E1H A;  4HWO A;  1H4Q A;  4YCW A;  2ODR D;  3HY1 A;  2ZT5 A;  1NYQ A;  4H2T A;  2CJ9 A;  4LNS A;  2XGT A;  4O2D A;  4E51 A;  2AKW B;  2DTO A;  1X2H A;  1WNL A;  4TTV A;  1YFS A;  1WPY A;  4TVA A;  4XTV A;  2DXT A;  4XEM A;  1X54 A;  3R07 A;  1YGB A;  1IL2 A;  4YRC A;  3REX A;  1HC7 A;  2E64 A;  3HRI A;  1N9W A;  4P75 C;  3WQZ A;  1RIQ A;  2I4O A;  1FYF A;  4ZTZ B;  1WYD A;  4TVY A;  1SES A;  3V8J A;  1Z7N A;  2ALY B;  2DXU A;  2I4L A;  4P3P A;  3RL6 A;  1EVL A;  3MEY A;  3L4G B;  4K88 A;  1NYR A;  2Q5H A;  4YRR A;  3PCO B;  4K86 A;  1E1T A;  4TWA A;  4YRG A;  5ELO A;  2ZT6 A;  3RKW A;  4YRE A;  2RHQ A;  3UGT A;  5C52 B;  3PZC A;  5C53 B;  4Q6G A;  1B7Y A;  4UPA A;  3TEG A;  3RKY A;  1SER A;  2E3C A;  3HY0 A;  4TQD A;  4YP0 A;  1JJC A;  2ODR C;  1B70 A;  4CS3 A;  4UP9 A;  2CIM A;  4YYE A;  3A74 A;  3REU A;  3KFU A;  2DTI A;  4YCU A;  2EL9 A;  1JJC B;  5ELN A;  3HXU A;  1SRY A;  1B7Y B;  3RUX A;  5K1X A;  3CMQ A;  3RAC A;  4RQE A;  1KMM A;  2ZT7 A;  3A5Z A;  3VBB A;  3A7R A;  3A32 A;  2EJF A;  3NET A;  2AMC B;  3MQZ A;  3HXW A;  2XTI A;  2EAY A;  4H2S A;  4LVK A;  4Q15 A;  4XTZ A;  4H2V A;  4CH5 A;  2ZTG A;  5E3I A;  4TVA B;  3QO7 A;  2I4M A;  3A5Y A;  4XU3 A;  1SET A;  3HXZ A;  2FYK A;  1C0A A;  2A8E A;  1NJ2 A;  2DDZ A;  2P5I A;  3IKL A;  1G5I A;  2E65 A;  2RHS B;  2EWN A;  2QHV A;  2ZIN A;  2IY5 A;  2DU7 A;  4KQE A;  3P8T A;  1NJ8 A;  3NEN A;  3E9H A;  4H2Y A;  3QNE A;  2ZIO A;  3A7A A;  3A7U A;  3EFR A;  3HXY A;  3V7R A;  3RGL A;  11AS A;  4YRP A;  2EJG A;  4PHC A;  4KR3 A;  2HNI A;  1X2G A;  1HTT A;  1ASZ A;  2ZZE A;  3VQV A;  2Q7G A;  3QO8 A;  2DJZ A;  1X01 A;  2ZR2 A;  2C7I A;  4XU1 A;  4P74 C;  3G1Z A;  3HTZ A;  4YRI A;  3RF1 A;  3NEL A;  3DSQ A;  1G51 A;  4ZIB A;  4XU2 A;  3L1A A;  4HT4 A;  4EO4 A;  4P73 A;  3HRK A;  1WQ7 A;  2AKW A;  4HWR A;  2AMC A;  1BBU A;  2J3L A;  3BJU A;  3BFM A;  2RHS A;  4HWT A;  3HFZ A;  4K87 A;  4YRT A;  4RMF A;  1H4T A;  1W66 A;  3MF1 A;  4HWP A;  1YFR A;  1KOG A;  3OD1 A;  1NJ5 A;  4WF2 A;  4TVW A;  4YPF A;  2C8M A;  3A31 A;  2DQ3 A;  2DZC A;  4LVL A;  2NS6 A;  3VQX A;  3QTC A;  4P74 A;  2ALY A;  4P72 C;  1PYS B;  4P3O A;  2DU5 A;  4OP0 A;  3EFS A;  4X5O A;  1H4S A;  1GGM A;  1B70 B;  2ZCE A;  1L0W A;  4P71 A;  4CH4 A;  1EFW A;  1VQZ A;  3W3S A;  3IG2 A;  2J3M A;  4P71 C;  1PYS A;  3HFV A;  2Q7H A;  4P72 A;  3V7C A;  4HVC A;  4KR2 A;  3TUP A;  2ARS A;  3IAL A;  4YRS A;  1H4V B;  4XTU A;  4WI1 A;  3VQY A;  2ZNJ A;  4DQ2 A;  3V8K A;  4H2U A;  1LYL A;  4LVM A;  4P3N A;  2DVE A;  2Q7E A;  1EIY A;  2ZGW A;  4XTY A;  1ATI A;  1B8A A;  2I4N A;  3TEH B;  3L2Z A;  4YRF A;  4UP8 A;  3UFG A;  3L4G A;  4YRN A;  4H2X A;  1EQR A;  1USY A;  4NCX A;  4YRM A;  4CH6 A;  3TEH A;  1E24 A;  4XU0 A;  2CJB A;  4RQF A;  1BIB A;  1KMN A;  4YCV A;  3PCO A;  3QO5 A;  3UGQ A;  1QF6 A;  2PMF A;  1J5W A;  1USY C;  2QHS A;  4XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...