3UFGA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
total genus 96
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3ufgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ufgA01
1NYQA 3L2ZA 3CMQA 3TUPA 4YRJA 4CH6A 4LNSA 1B70A 4Q15A 4XU2A 2DTOA 1HXDA 3QO7A 4E51A 4G84A 3FJPA 3MF1A 1ASZA 3UGTA 2DZ9A 1IL2A 3HTZA 3HRKA 4CS2A 1ASYA 4TQDA 4P74A 11ASA 1G5HA 1C0AA 3IKLA 3QO8A 3REXA 2XTIA 4YRQA 3VQWA 1J5WA 3ICAA 3P8TA 2AMCB 4XU0A 4K86A 2DXTA 4UP7A 3IG2A 3RACA 1B70B 1H4TA 1Z7MA 4KR3A 4H2VA 3L4GA 4DPGA 1PYSB 3ERRA 1EQRA 4TVAA 4RQEA 2CJ9A 2Q7HA 4K87A 4TVWA 4H2WA 1HTTA 2HNIA 4XTZA 4OLFA 4P75A 1G51A 3BJUA 4P75C 2EJFA 4AH6A 4X5OA 3VQXA 2E10A 4CS4A 5ELOA 1NYRA 3E9IA 1HC7A 2CJBA 2ZNJA 3P8YA 4H2XA 2E5AA 3G1ZA 1QE0A 3PCOB 4K88A 5KNNA 4P71C 2ZINA 2RHSA 4NCXA 1USYC 1NJ6A 3A32A 4YYEA 2ODRC 4XTVA 4Q6GA 5ELNA 2E64A 3TEHB 2PMEA 4WJ3M 1ADJA 2ZIOA 3HY0A 3E9HA 4ZIBA 1NNHA 4XU3A 3EFRA 1NJ5A 2DTHA 4YCVA 2AKWB 3M4QA 1H4QA 4ZTZB 4BW9A 1E1TA 2CGHA 2I4NA 3P8VA 1SETA 4P72C 1SERA 2Q7EA 4EX5A 2ALYA 3RUXA 1LYLA 2ZT6A 4YRLA 3I7FA 3HRIA 3QTCA 5F5WA 4YPFA 2QHVA 4RMFA 1GGMA 4P71A 1KMNA 4P3OA 3W3SA 1BIAA 3QNEA 4YRSA 1B7YB 1E24A 1WU7A 1EVKA 5E3IA 1JJCB 3HFZA 3RIRA 3PZCA 2DZCA 2Q7GA 3V8LA 3HXZA 4HWTA 2I4OA 2Q5IA 4YRRA 2ZR2A 2DU5A 3VQYA 3VBBA 1EIYA 2CIMA 1WQWA 3VQVA 1EIYB 3EFSA 3HXXA 2E3CA 1E1OA 4CH5A 3TEHA 4YREA 3V7SA 4DQ2A 3TEGA 2ZT7A 1JJCA 2RHQB 2ALYB 3UH0A 4YRFA 3HFZB 4HWOA 2QHTA 3A7RA 3HFVA 4YRKA 4XEOA 1RIQA 1YB3A 3IALA 2DXUA 1B8AA 2C8MA 4XTWA 3KFUA 1WQ7A 3RKXA 1B7YA 3HY1A 1YFTA 1ADYA 2ODRD 3A74A 4WI1A 2E1HA 2DDZA 1X55A 3MF2A 1X54A 1SESA 4YRIA 3NENA 4H2YA 1BIBA 2RHQA 2ARTA 4TVAB 4UPAA 3RGLA 4H02A 1FYFA 1PYSA 5K1XA 2ZZGA 4P3PA 4RDXA 3BFMA 3RKYA 4PHCA 2Q5HA 3HXVA 4P74C 2ZNIA 1X01A 2ARSA 4H2UA 2ZCEA 3IKMB 1KOGA 4WJ4A 3UGQA 3NETA 2J3MA 3NELA 3V8KA 3A7UA 4YRPA 2ZGWA 3LSSA 3LSQA 4CS3A 2XGTA 2I4MA 4PG3A 4TTVA 2ZIMA 2DQ3A 3NEMA 1SRYA 3WQZA 3HXYA 2ZZFA 4CH3A 3DSQA 2QHUA 3A7AA 3HXUA 1L0WA 2C7IA 1X2GA 1BBUA 2PMFA 2QHSA 1NJ2A 1VQZA 4P73C 12ASA 2ZXFA 2EJGA 1EFWA 2ZTGA 1NJ8A 2P5IA 4RQFA 3A5YA 3PCOA 2AMCA 2EJ9A 4H2XB 3RKWA 1Z7NA 1USYA 4BWAA 2AKWA 4YP0A 2CJAA 4G85A 1ATIA 3MEYA 3RL6A 3REUA 1N9WA 3V8JA 2G4CA 5C52B 4XTUA 1WPYA 4YRMA 4YROA 4HVCA 3A31A 2E41A 4UP8A 2P0LA 4KR2A 4P72A 1EVLA 5C53B 3R07A 4YRNA 1H4SA 4YDQA 1E22A 2EL9A 3LC0A 4ZTUB 2DVEA 1WYDA 2J3LA 3A5ZA 4P3NA 1EOVA 2RHSB 1WLEA 4WF2A 1YGBA 4YCWA 4EO4A 4TVYA 1NJ1A 4XTXA 2EWNA 1H4VB 1W66A 5K1PA 4HWRA 3M4PA 4TQFA 3L4GB 2ZT8A 4YCUA 3UFGA 3OD1A 1BBWA 2ARUA 3HXWA 1WNLA 4P73A 1YFRA 4YRGA 4OP0A 4XEMA 2DTIA 2DQ0A 4YRTA 2IY5A 4O2DA 4XU1A 2DEQA 4YRCA 3V7CA 3V7RA 2ZZEA 1G5IA 4H2TA 4L87A 4KQEA 4CH4A 1B76A 2DKGA 2FYKA 2DJZA 4TWAA 3L1AA 4HWSA 2EAYA 4J15A 1QF6A 3RF1A 1X2HA 2E65A 2ZT5A 4XTYA 4UP9A 5C51B 4H2SA 2ZR3A 1X56A 4HWPA 5HGQA 2I4LA 3QO5A 1YFSA 2DU7A 2IY5B 1KMMA 4HA8A
chains in the Genus database with same CATH superfamily
3L2ZA 2CXFA 5AQHB 2JJ9A 3FZMB 2EHOC 4CH6A 3C64A 2HN2A 5AQRB 4XU2A 3IEEA 1SHZC 4JBWF 1HXDA 2ZM2A 4CI1B 4E51A 2SPCA 1BR1A 2XQ7A 3FJPA 3PU8A 2WQYA 4L5GA 5FYMA 3UGTA 1KNZA 5FKYA 4TNVA 3AA6B 4YSXA 3MQZA 2A72A 3ZJ2A 4P74A 2YN6A 11ASA 4HGAA 1H7CA 3KDSE 3QO8A 2MYSA 3VKHA 3REXA 2XTIA 4AISA 2CMRA 3JAFA 3VQWA 4PK4A 3ICAA 1MMNA 3P8TA 4ILCA 2AMCB 4XU0A 2E2AA 3IG2A 4G2AA 3SRZA 1B70B 3AE1A 1Z7MA 1N34T 2YOEA 2MTQA 4H2VA 1YKHB 4DO0A 5IHYA 2VVNA 4K87A 4H2WA 3AEAA 4XTZA 4OLFA 3I1AA 4IDOA 4P0BA 4EEBA 3AE2A 4P75C 1J1JA 3LBXA 3VQXA 2E10A 1WLXA 3PUAA 2DNXA 2R6GF 4DIDB 3HKEE 3V5SA 2K3WA 2XQ6A 3LSVA 2V6XA 2NS6A 2E9XB 4NUVA 3ZC1A 2RHSA 4LF8T 4AQFC 1V9DA 4YYEA 2ODRC 2LSGA 1W0AA 4BA9A 5ELNA 3N9NA 4ZZCA 2PMEA 4DVDA 4GYSA 1ADJA 4WJ3M 3HY0A 5LMNT 3P4WA 3LFMA 2LRKA 4ZIBA 4XU3A 1NJ5A 2DTHA 2XUEA 4HWIB 2UUBT 1MNEA 3BK9A 4KX6A 1I6ZA 4CN4A 2H3RA 4LFAT 2BVLA 4C90A 2G0UA 4B3ST 2LJLA 1SETA 4P72C 2C5JA 4IDZA 4MBQA 2XJ7A 3VRBA 1OWAA 2ZT6A 4NPPA 2JQ9A 3UULA 2CRBA 3UT5E 1B7TA 1YQ3A 4ZI3D 1GGMA 2V7MA 4MALA 5IYZE 2CM0A 4JI3T 2WBLA 2Q9QD 1WR6A 1U5PA 2W0GA 2B1EA 4DR3T 5E3IA 1MMGA 3I9YA 2XM1A 4U2ZA 3N2KE 3O1JA 3SOLA 2V5CA 5AQSB 1OXZA 3P4SA 5EK4A 4PK6A 4EYYR 5HEHA 5L3GB 4V1Av 3V8LA 3N9LA 3AEBA 3WAJA 4A98A 2I4OA 2Q5IA 1HR0T 2UXXB 3HI2A 1E1HB 4EB6E 1HX1B 3PV0F 4K0UA 2CLYB 1EIYB 3AE9A 3ETUA 2BS4A 3UTKA 1NWMX 2CXLA 3ESLA 5LGUB 5AQJB 2UUAT 4DQ2A 2UUCT 4X65T 2ALYB 3UH0A 2XM2A 3HFZB 2BBJA 4NUUA 2BKOA 3BQLA 5JDNA 4XEOA 5LNKA 4KHZF 1W0BA 1X9BA 5JRCA 2KSRA 4I0UA 4UV9B 3ZSSA 3TLWA 2E5LT 5LB7B 3E22E 1B8AA 2C8MA 5LBMA 4DV2T 3ZYLA 2H89A 1MMAA 3J9X1 3UQ7A 3H37A 3HY1A 1M62A 1KNPA 5DQVA 2UXNB 4CXXA 3MF2A 2D0UA 5JDLA 3O1HA 2VL8A 3HA4A 3NENA 2NW7A 4BJMA 4H2YA 2ARTA 4JI2T 3RGLA 1BR0A 4H02A 1PYSA 1UX5A 3RRWA 3A5XA 3JC6C 4GOUA 1NAFA 4JI5T 4RDXA 4JI1T 4PHCA 2XQAA 3HXVA 4CI3B 3ZMUB 2BG9A 3C4XA 3RRCA 4H2UA 3NRXA 1KOGA 2XAQB 3NELA 2LOSA 3AAEB 3A7UA 3ZC0A 2LRLA 2ZGWA 3ZLIA 2NTYA 2YDSA 5FY1A 4CS3A 2XGTA 4HE8A 4TTVA 5JDMA 1WYBA 5A1LA 3QC9A 3SWHA 2DCFA 2Q9QB 5LYJE 2KNDA 2JQQA 3WQZA 2BG9B 2UU9T 4DV3T 2Y48B 4KI0F 1NJ2A 2B76A 1UX4A 4YXDA 4P73C 1EFWA 1S35A 1NJ8A 2P5IA 1IJ5A 4RQFA 1IJ6A 2X9WA 3A5YA 4GK5E 2LSIA 2WDRA 4H63V 4UIGA 3RKWA 4AQFA 4BWAA 4YP0A 1CHUA 3PUZF 1MIWA 3ONXA 4UF0B 4YHHT 3REUA 3V8JA 3EVYA 4IDNA 4XAXB 5C8YE 3AE5A 5J2UE 2X9YA 4ANJA 4DMVA 2WZHA 3N2GE 2VASA 4AKRB 5FVLA 2P0LA 4P72A 3R84B 5CB4E 3J7Yq 4TWDA 2DWGA 1E22A 3LC0A 4QHOA 4UXNB 4X1YE 2M67A 4E7ZA 4Z90A 3ZCIA 4P3NA 1EOVA 3OYZA 2LSJA 2LLYA 3KBTA 4EO4A 4EYUA 4XTXA 4EEDA 4Z8XA 2XQ9A 4HWRA 4HWDA 4QH5A 3ZMZB 3PJAJ 4HN9A 2GK9A 2ZT8A 4A56A 4QX7B 4EV6A 3AB3B 1SUMB 3OD1A 2ARUA 3RYIE 2BS3A 5JR9B 2WWVA 1HG2A 2DTIA 2HHHT 4U2YA 4TNWA 1UURA 3UFEA 4PJLA 3RLFF 1HNZT 4IDPA 3PE0A 4L87A 4U3CA 3M3ZB 2DKGA 2DJZA 4DV0T 3L1AA 5LBQB 5LHIB 4ISTA 4KMCA 4HWSA 2ZM6T 4NIQA 2N9DA 4ILAA 4ZEYA 3QNUA 5LG3A 3SFDA 4LF4T 1ZOYA 5HGQA 2I4LA 3UU4A 4U31A 5AQTB 1YFSA 2IUBA 2FJAA 4PK5A 1KMMA 3EAMA 4BJNA 4FI5A 2ODVA 3K3OA 4Q15A 3AE3A 4EOZB 1KEYA 1Z8UA 3CPZA 4AI6A 4KP3C 1WRDA 4HFDA 3U3IA 1ASZA 2XY8B 2BG9C 2JQHA 2DZ9A 4H9NC 1IL2A 5LHHB 1YD8G 3HTZA 2DLRA 3K3QC 3HRKA 3L3PA 3CX6B 5HCMA 5TAOA 4CS2A 3HR0A 4UELA 4MHCA 4TQDA 1G5HA 4LMLA 4YRQA 2YDRA 2Y6XA 2DXTA 4JEHB 5CJ5A 3ZPOA 4L9IA 1UUSA 2X51A 3OBVE 5KX5E 3ERRA 3GWHA 1EQRA 1IBKT 5LJMA 4RQEA 3HL6A 2RP4A 3AE4A 5BMVE 5LGNB 2J4GA 4X1KE 2HNIA 1HTJF 2JPFA 5EK2A 4P75A 3MACA 2XAFB 1HF8A 4GIWA 2QRXA 3K1SA 1YQ4A 3F57A 2PG8A 5ABHA 3E9IA 3UUMA 2CJBA 4PJJA 1WYCA 4AKHA 4ZI2D 3ONLC 2JMKA 1XNRT 2LEHA 2QA7A 5DJQC 1N36T 2XAJB 1QE0A 4K88A 5CA0E 5DQWA 2VWAA 4Q6GA 5ETWA 1KNRA 2E9XC 3E9HA 2XQ8A 1NNHA 1M7KA 2XHEB 1GQEA 1H4QA 4I55E 2D2SA 1X79A 4MFRA 1J5ET 4CN1A 3DTOA 1HX8A 1HNWT 2CHNA 4YSYA 5L2LA 2Q7EA 1US7B 5FXXA 3RUXA 3ZEFB 3P8CD 3PJAA 3PU3A 3FZKB 1AJ3A 3QB5K 3LBXB 2CXDA 3CX7B 4P71A 2HPJA 1ZHCA 2CE7A 3W3SA 4QH1A 4G63A 4IE0A 1B7YB 1HFAA 4IE6A 3R6NA 4ILUA 1WU7A 4GKKT 1T7SA 1JJCB 2YU2A 5LMUT 1FEWA 2XZEA 1XNQT 3PZCA 5LP6E 4P1NA 2WMNA 5HYAA 2AE9A 4HWTA 5LGTB 2K24A 3VQYA 2OA5A 3VHLA 4HWCA 2CIMA 4H9QC 2WM9A 3C50A 4AIUA 4YTPA 4CH5A 3RQUA 3KINB 3NKZA 3X1DA 3TEHA 3AVRA 2WB5A 3V7SA 3TEGA 2RHQB 3EUHA 5IUXA 4YRFA 2EHOB 4HWOA 2QHTA 4TWHA 3HFVA 4F6RC 2FJBA 5L4HA 2YKSA 1YB3A 3IALA 5F8PA 1IZNB 4UVAB 3RYHE 3AE6A 3VR9A 1XDOA 2X9HA 5ADXL 4WI1A 2DDZA 2XQYA 1X54A 2YEVC 3ZT6A 5JDQA 1FYFA 5FL0A 4OK0A 4HFCA 4DUYT 3CK6A 2VKOA 4WZXA 3ZJ1A 4U7YA 2H88A 5FL1A 1VOMA 1XWMA 4UR9A 2BZBA 2C5IT 3SFEA 2ARSA 5EK3A 3AA7B 2W4XA 4DBRA 3V8KA 3N2OA 4CXWA 2DI4A 3LSSA 3LSQA 2P9BA 5KXJA 3O9XA 2VVSA 4JI4T 2ZIMA 4PNIA 2LOPA 3VU7H 2DQ3A 4AKLA 3ZYMA 4B3MT 3ANWA 4QXBB 2ZZFA 3RC3A 4CXYA 3ZCJA 5CFBA 5LG4A 4IE7A 4PFPA 3HXUA 3M65A 1L0WA 3AE7A 3LK3B 4DV1T 3EHZA 2V6YA 5AQMB 5HEUA 3FZHB 3PUVF 5LJNA 3MA9A 4J2CA 4UVBB 2EJ9A 2DL1A 4JI7T 4H2XB 5LXTE 1USYA 3VR8A 2AKWA 3EI0A 2V7JA 4G85A 3MEYA 2DWKA 4CN6A 5L3CB 1YKEB 3PDYA 3CIRA 4TUYE 2KLQA 2JQKA 2I6HA 3IHRA 2WSSV 3A8YC 3F2EA 4DV4T 2KT9A 2LM2A 2W67A 4YROA 3B57A 3KBUA 3RQWA 4TZ4C 3UUNA 4EZ4A 2FJDA 2BS2A 4IHJE 3FBLA 4I50E 4N78D 4XBFB 4HFEA 4YRNA 2EL9A 2V7KA 3FB2A 3DJBA 2DVEA 3KV4A 2X66A 3A5ZA 2C5KT 3ABVA 2HN1A 3LJCA 2X67A 2OV9A 4WF2A 4DV5T 5JDHA 1YGBA 2D5UA 3JC6D 4TVYA 1N33T 2KMFA 5AQNB 4ZXLA 1LRZA 2FBWA 2X0LB 1W66A 1NEKA 5JQGE 2A8EA 4TQFA 3KV5A 3L4GB 3T1HT 4YCUA 3N9MA 3UFGA 3AAIA 2AXDS 1WNLA 4P73A 1YFRA 2V26A 3CVRA 3WI3A 3ZMVB 3K3NA 4HT4A 4LMJA 4AKGA 3C98B 5AQPB 5ABFB 4JI0T 3BQKA 5AFUL 2IY5A 3PUQA 4O2DA 3AA1B 4YRCA 3V7CA 3V7RA 4CH4A 4TWAA 3KVAA 4X66T 1JNZA 5L3FB 3RF1A 3RYFE 3RKGA 2E65A 3KV9A 4UP9A 4PW8A 3QOFA 5C51B 3OTOT 1X56A 3ZSTA 3RIFA 3QO5A 3PUWF 4X20E 5AQUB 2X0YA 3CMQA 3TLVA 1HS7A 4YTNA 4LNSA 1XDPA 2M6IA 2CHOA 2XAGB 3MKDA 3MK7C 4JV5T 2HH7A 1LVFA 2IW5B 1OEDB 3I0QA 2MAWA 4ZHQE 2UXBT 1ZP0A 1ASYA 1C0AA 3AECA 1J5WA 5FXVA 2IMLA 4K86A 2KWHA 2XQ5A 4DNDA 4JUYA 4I4TE 2ODUA 3L4GA 4CI2B 2D0TA 5AQQB 4LF9T 2ZM8A 4TVAA 1L0VA 2CJ9A 2Q7HA 1HTTA 3IF8B 4FJOA 5ABFA 3FZFB 1O3XA 3UU6A 4AH6A 4X5OA 4CS4A 3ZN1B 3B13A 2W00A 4H9OC 1HC7A 4O4JE 2OLTA 2ZNJA 2H7VC 3P8YA 2E5AA 4H2XA 4HFHA 3G1ZA 3V5UA 2X68A 4AKIA 1NJ6A 4LFBT 2E64A 3TEHB 5AQVB 1MMDA 4IT4A 4CZZB 2ZIOA 1BR2A 1QSDA 2ZM0A 3EFRA 5FXWA 2WZIA 3RIAA 2LHNA 2K5BB 3M4QA 4NXMT 4ZTZB 1S94A 5HAXA 4BW9A 2CGHA 5JTGA 2CLYC 2FUPA 3LK42 3P8VA 4EX5A 2J1DG 1LYLA 1ZEEA 2MBGA 2QGSA 3TLTA 1KMNA 4P3OA 3W15B 1BIAA 2NTXA 2WU2A 4YRSA 1E24A 5JR9C 2LM9A 1EVKA 3LK2B 1FIOA 4ZS3A 4JI6T 3WAKA 3GN5B 5FVKA 2X0HA 1LKXA 2DZCA 4DV6T 1CUNA 2LT3A 3C51A 4TN7B 2VB6A 3HXZA 4YRRA 2BKPA 5E0OA 4LMKA 4QWNB 3CKDA 3VBBA 2PJQA 3QK6A 5FY0A 4TV8E 1T8BA 5L3EB 1WQWA 3VQVA 4LF7T 3EFSA 2VK9A 2E3CA 1E1OA 5KMGP 4WNKA 3E08A 4QKNA 1ZV4X 1ZKEA 1G8XA 1E7PA 1QLBA 2ZT7A 1JJCA 5FNVE 4PJNA 2JRKA 3H3MA 2E9XA 2LKHA 3N5LA 3PUGA 3A7RA 2V6YB 4OHFA 1IBLT 3RH3A 2DXUA 5ABEA 2VKHA 4XTWA 3KFUA 4IL4A 5IWAT 3AAAB 4TWFA 2WU5A 3N9PA 1WQ7A 4LVKA 3RKXA 1WFDA 1B7YA 1BR4A 2L3LA 2ODRD 1FJGT 4TX5A 3D0TA 3P4QA 1X55A 3O4XE 1MIVA 3P4PA 2CPTA 4LVIA 1BIBA 2RHQA 2A2FX 3GMIA 4TVAB 3T8OA 4UPAA 4A5XA 3Q9DA 2ZZGA 2WY2A 3JCFA 4ERRA 5HEJA 3BFMA 2J47A 4NXNT 5FY7A 4P74C 3OYXA 1X01A 3PUSA 3UUXB 2ZCEA 2IAKA 3IKMB 1VRBA 4M1PA 4WJ4A 3UGQA 3PTRB 4JEUB 4X1IE 3I0OA 4YRPA 5HEOA 4HKAA 5JDFA 4B3RT 4DMWA 4PG3A 2DHRA 2Q9QC 3ZN0B 3IBPA 1SRYA 4GKJT 1YW0A 3DSQA 3A7AA 4DR6T 2C7IA 4LFCT 1W09A 4YHJA 5F3JA 1BBUA 5AQKB 2PMFA 2M6BA 4UEMA 4KUMB 12ASA 3Q5XA 2ZXFA 2EJGA 2PFVA 2ZTGA 4QXCB 4OYKA 2AMCA 3LG7A 3P7IA 4I43B 2CBJA 1Z7NA 1JNRA 3AVSA 4ZZBA 2CJAA 3RL6A 1N9WA 5L3DB 2A9UA 1XMQT 4HEAA 5C52B 4KHPT 4XTUA 1WPYA 4HTEA 5L3BB 4JI8T 3NVOA 4HVCA 3C4ZA 3A31A 3Q5EA 4UP8A 2CWOA 3GN5A 4WBOA 3CMLA 4OFZA 5CGMA 4DR7T 2NW8A 2V7IA 2YINA 4UV8B 5C53B 2WDVA 3R07A 5HXSA 4YDQA 4LVLA 4ZTUB 1MNDA 3OPCA 1VCSA 3S4UA 5LA6E 1QUUA 2IC6A 2FJEA 4EZHA 4DBQA 2QVAA 1UCUA 2IIUA 2QYWA 5H6QB 4AQYT 4OYJA 1NJ1A 1W9RA 1KFYA 2EWNA 1H4VB 2WWUA 3QUJA 3AE8A 4DR5T 1FMWA 4QXHB 2NWBA 4IDQA 1SE7A 3ZMTB 3M4PA 2KZ7B 3AXJB 3P50A 3N9OA 2V7LA 4ILBA 3OVUA 1T72A 5JVDE 3IA3A 3HXWA 3DP7A 3RX6A 2ZMAA 2L9QA 3NZQA 4YRGA 5JREA 1Y01A 1FMVA 2XTLA 1DU2A 2N1GA 3ONJA 1D0YA 2W61A 4YRTA 2LKGA 5AQOB 4XU1A 2W63A 2ZZEA 1G5IA 4H2TA 4KQEA 4H63H 2FYKA 3A7MA 3OJAA 1HNXT 3G06A 2EAYA 4J15A 1QF6A 2W66A 1X2HA 2WS3A 4CQIA 2ZT5A 4XTYA 3TLUA 2ZR3A 3RKOA 4HWPA 4WBNE 1Y64B 4IE4A 4IE5A 2PBIA 3MZKB 5HXRA 4HFIA 3FHNA 5AQLB 2IY5B 1NYQA 3O1IA 2UXDT 5JDGA 4YFSA 3TUPA 5GONE 3AA0B 4YRJA 4WYVA 1B70A 3AEGA 2A3DA 2DTOA 3QO7A 4HWHA 4ZI3C 3ANWB 4G84A 3RYCE 3RI5A 3MF1A 3EDVA 2E8IA 3T1YT 3AEEA 4IGUA 1U4QA 1D0XA 5J0ZA 2BVMA 1OEDA 3L09A 1R8IA 4H9SE 4PAGA 2CA5A 3F31A 1LVKA 3RIUA 4GK0E 2K48A 2L8KA 3IKLA 1VCTA 1N32T 3PUXF 2XPKA 3VRAA 3MJXA 4P09A 4UP7A 2Y8DA 3RACA 4GYRA 1H4TA 4KR3A 4JLEA 4DPGA 1PYSB 2RA1A 2HPLA 2XQ4A 4YT0A 3FXDB 4TVWA 1SA0E 1G51A 2IDOB 1T98A 4PJMA 3BJUA 4ZOLE 2EJFA 4IL9A 2NP9A 5ELOA 3UU3A 1NYRA 4Q25A 2CEAA 3UU5A 2I0MA 3PCOB 5HCJA 5AQGB 1OEDE 5KNNA 4P71C 2ZINA 4JYAT 5H6RB 4NCXA 1USYC 3A32A 4XTVA 4ZI7E 2E5VA 4LVMA 3RC8A 2D9DA 2RPAA 2XASB 5HWYA 4L0RA 2BKNA 2CCQA 3AXJA 4YCVA 5C3JA 2AKWB 4X5TA 1E1TA 2JIWA 2I4NA 3Q5DA 1KK7A 1HCIA 4B3TT 3ETVA 4AXPA 1SERA 5LOVE 2BBHA 2ALYA 4YTMA 2YDQA 3P4RA 2K9AA 2UXCT 4YRLA 3I7FA 3HRIA 3QTCA 5F5WA 4YPFA 4O8SA 5AQIB 2KXPB 1YXRA 4O2AE 2QHVA 4RMFA 5FP3A 5JR9A 2KINB 1WR0A 2WMOA 3QB5A 3MXZA 5L47A 3QNEA 3AEFA 4DV7T 2MOZA 4XZCA 4HFVA 3CWZB 3NRYA 4B6XA 3ZMSB 4E7SA 4QH4A 3HFZA 3RIRA 1OEDC 2V1DB 2NR4A 4U72A 2Q7GA 4U33A 2XSAA 4O4IE 3N9QA 2ZR2A 3CX8B 2DU5A 3L8RA 4YJ3E 1D1BA 1EIYA 5EZYE 2CBIA 3HXXA 1MIYA 4YY3T 2XAHB 4F8HA 4A97A 4YREA 4K0KT 2ZLYA 2F4VT 3CQGB 3UUBA 3CQCB 1UK5A 2V8SV 4YRKA 4ASKA 4EIWA 4LF6T 4U7IA 1RIQA 3B5MA 3PUYF 4YSZA 2W2UA 4TV9E 1YFTA 1ADYA 1HG5A 3A74A 4PFOA 3NWIA 2E1HA 3C4WA 1SESA 4YRIA 3NZPA 4DR4T 2YK0A 2N2NA 5M4YA 5BR8T 2LSKA 5ABGA 3TLSA 4ADZA 5K1XA 2C0SA 4P3PA 3HKCE 2VKJA 4EGWA 5HXHA 1Z0PA 3EDUA 3JADA 3RKYA 2Q5HA 3UU8A 2ZNIA 4UF0A 4DR1T 2VQET 2X9XA 4UVCB 3NETA 2E9XD 5FMNA 2J3MA 5C2TA 4EAHA 1XZYA 2WP9A 2I4MA 3HKBE 3FXEB 2CWYA 3U78A 3NEMA 4IREA 2LE8A 3ZKRA 2H7OA 2NOXA 5DABA 2NW9A 3HXYA 1D1CA 4CH3A 3H3AA 4OX9T 1IBMT 2QHUA 3PURA 5LCYA 2VL0A 4EXTA 3AEDA 2LSYA 1X2GA 4HFBA 1EZ3A 2QHSA 4O2BE 1VQZA 4AQGA 2EHOD 2LHRA 2MPKA 3K8PC 3JAEA 3RIUC 3PCOA 5JH7E 2I59A 3CQXC 3ZT7A 3Q2MA 4Z91A 4C91A 1ATIA 2ACXA 4WW0A 5LHGB 3SS1A 5J1GA 4O4HE 4H9PC 3EABA 1D1AA 3LDQB 2ES0A 2G4CA 3FBZA 3KVBA 4LF5T 3FZLB 4YRMA 5HXCA 4ISSA 3ZT5A 2KWIB 2E41A 4HWFA 3RPUA 4KR2A 2XQ3A 2IHR1 2Z6EA 3KV6A 1EVLA 3UQ4A 1H4SA 2IC9A 1KF6A 5HWXA 2JMHA 4QX8B 1WYDA 2J3LA 1E2AA 3L39A 2Q9QA 2RHSB 1WLEA 2J62A 4P0AA 5AQFB 3BQIA 5CA1E 4DUZT 4YCWA 1D0ZA 4MLKA 3OKQA 1WCRA 2VQFT 1UGOA 4X64T 4LVJA 3NBXX 3VKGA 5K1PA 4YJ2E 3Q5WA 1BBWA 2WCAA 1G73A 2WDQA 4IIJE 3ZYKA 4YLHA 4OP0A 5KDMC 2BG9E 4X62T 4XEMA 1I94T 2DQ0A 4COFA 2EHOA 2W62A 4KBMB 2XSBA 4ZI2C 5L4EA 3E0ZA 2DEQA 4H9RC 2PTFA 2BDEA 3KFWX 3RHWA 1B76A 3HKDE 3I9WA 2WAUA 3GA8A 3TKLB 5HXEA 1IAPA 4H2SA 5JRCB 5J2TE 4DR2T 2V5DA 1XMOT 5FXZA 2VKDA 1NENA 2YU1A 4ZS2A 4O4LE 2VURA 2ACZA 4BAYB 2DU7A 5HEGA 4U74A 4HA8A
chains in the Genus database with same CATH topology
1NYQA 3L2ZA 3CMQA 3TUPA 4YRJA 4CH6A 4LNSA 1B70A 4Q15A 4XU2A 2DTOA 1HXDA 3QO7A 4E51A 4G84A 3FJPA 3MF1A 1ASZA 3UGTA 2DZ9A 1IL2A 3HTZA 3MQZA 3HRKA 4CS2A 1ASYA 4TQDA 4P74A 11ASA 1G5HA 1C0AA 3IKLA 3QO8A 3REXA 2XTIA 4YRQA 3VQWA 1J5WA 3ICAA 3P8TA 2AMCB 4XU0A 4K86A 2DXTA 4UP7A 3IG2A 3RACA 1B70B 1H4TA 1Z7MA 4KR3A 4H2VA 3L4GA 4DPGA 1PYSB 3ERRA 1EQRA 4TVAA 4RQEA 2CJ9A 2Q7HA 4K87A 4TVWA 4H2WA 1HTTA 2HNIA 4XTZA 4OLFA 4P75A 1G51A 3BJUA 4P75C 2EJFA 4AH6A 4X5OA 3VQXA 2E10A 4CS4A 5ELOA 1NYRA 3E9IA 1HC7A 2CJBA 2ZNJA 3P8YA 4H2XA 2E5AA 3G1ZA 1QE0A 3PCOB 4K88A 2NS6A 5KNNA 4P71C 2ZINA 2RHSA 4NCXA 1USYC 1NJ6A 3A32A 4YYEA 2ODRC 4XTVA 4Q6GA 5ELNA 2E64A 3TEHB 4LVMA 2PMEA 4WJ3M 1ADJA 2ZIOA 3HY0A 3E9HA 4ZIBA 1NNHA 4XU3A 3EFRA 1NJ5A 2DTHA 4YCVA 2AKWB 3M4QA 1H4QA 4ZTZB 4BW9A 1E1TA 2CGHA 2I4NA 3P8VA 1SETA 4P72C 1SERA 2Q7EA 4EX5A 2ALYA 3RUXA 1LYLA 2ZT6A 4YRLA 3I7FA 3HRIA 3QTCA 5F5WA 4YPFA 2QHVA 4RMFA 1GGMA 4P71A 1KMNA 4P3OA 3W3SA 1BIAA 3QNEA 4YRSA 1B7YB 1E24A 1WU7A 1EVKA 5E3IA 1JJCB 3HFZA 3RIRA 3PZCA 2DZCA 2Q7GA 3V8LA 3HXZA 4HWTA 2I4OA 2Q5IA 4YRRA 2ZR2A 2DU5A 3VQYA 3VBBA 1EIYA 2CIMA 1WQWA 3VQVA 1EIYB 3EFSA 3HXXA 2E3CA 1E1OA 4CH5A 3TEHA 4YREA 3V7SA 4DQ2A 3TEGA 2ZT7A 1JJCA 2RHQB 2ALYB 3UH0A 4YRFA 3HFZB 4HWOA 2QHTA 3A7RA 3HFVA 4YRKA 4XEOA 1RIQA 1YB3A 3IALA 2DXUA 1B8AA 2C8MA 4XTWA 3KFUA 1WQ7A 4LVKA 3RKXA 1B7YA 3HY1A 1YFTA 1ADYA 2ODRD 3A74A 4WI1A 2E1HA 2DDZA 1X55A 3MF2A 1X54A 1SESA 4YRIA 3NENA 4LVIA 4H2YA 1BIBA 2RHQA 2ARTA 4TVAB 4UPAA 3RGLA 4H02A 1FYFA 1PYSA 5K1XA 2ZZGA 4P3PA 4RDXA 3BFMA 3RKYA 4PHCA 2Q5HA 3HXVA 4P74C 2ZNIA 1X01A 2ARSA 4H2UA 2ZCEA 3IKMB 1KOGA 4WJ4A 3UGQA 3NETA 2J3MA 3NELA 3V8KA 3A7UA 4YRPA 2ZGWA 3LSSA 3LSQA 4CS3A 2XGTA 2I4MA 4PG3A 4TTVA 2ZIMA 2DQ3A 3NEMA 1SRYA 3WQZA 3HXYA 2ZZFA 4CH3A 3DSQA 2QHUA 3A7AA 3HXUA 1L0WA 2C7IA 1X2GA 1BBUA 2PMFA 2QHSA 1NJ2A 1VQZA 4P73C 12ASA 2ZXFA 2EJGA 1EFWA 2ZTGA 1NJ8A 2P5IA 4RQFA 3A5YA 3PCOA 2AMCA 2EJ9A 4H2XB 3RKWA 1Z7NA 1USYA 4BWAA 2AKWA 4YP0A 2CJAA 4G85A 1ATIA 3MEYA 3RL6A 3REUA 1N9WA 3V8JA 2G4CA 5C52B 4XTUA 1WPYA 4YRMA 4YROA 4HVCA 3A31A 2E41A 4UP8A 2P0LA 4KR2A 4P72A 1EVLA 5C53B 3R07A 4YRNA 1H4SA 4YDQA 1E22A 2EL9A 3LC0A 4LVLA 4ZTUB 2DVEA 1WYDA 2J3LA 3A5ZA 4P3NA 1EOVA 2RHSB 1WLEA 4WF2A 1YGBA 4YCWA 4EO4A 4TVYA 1NJ1A 4XTXA 2EWNA 1H4VB 4LVJA 1W66A 5K1PA 4HWRA 2A8EA 3M4PA 4TQFA 3L4GB 2ZT8A 4YCUA 3UFGA 3OD1A 1BBWA 2ARUA 3HXWA 1WNLA 4P73A 1YFRA 4YRGA 4OP0A 4XEMA 2DTIA 4HT4A 2DQ0A 4YRTA 2IY5A 4O2DA 4XU1A 2DEQA 4YRCA 3V7CA 3V7RA 2ZZEA 1G5IA 4H2TA 4L87A 4KQEA 4CH4A 1B76A 2DKGA 2FYKA 2DJZA 4TWAA 3L1AA 4HWSA 2EAYA 4J15A 1QF6A 3RF1A 1X2HA 2E65A 2ZT5A 4XTYA 4UP9A 5C51B 4H2SA 2ZR3A 1X56A 4HWPA 5HGQA 2I4LA 3QO5A 1YFSA 2DU7A 2IY5B 1KMMA 4HA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYQ A;  3L2Z A;  3CMQ A;  3TUP A;  4YRJ A;  4CH6 A;  4LNS A;  1B70 A;  4Q15 A;  4XU2 A;  2DTO A;  1HXD A;  3QO7 A;  4E51 A;  4G84 A;  3FJP A;  3MF1 A;  1ASZ A;  3UGT A;  2DZ9 A;  1IL2 A;  3HTZ A;  3HRK A;  4CS2 A;  1ASY A;  4TQD A;  4P74 A;  11AS A;  1G5H A;  1C0A A;  3IKL A;  3QO8 A;  3REX A;  2XTI A;  4YRQ A;  3VQW A;  1J5W A;  3ICA A;  3P8T A;  2AMC B;  4XU0 A;  4K86 A;  2DXT A;  4UP7 A;  3IG2 A;  3RAC A;  1B70 B;  1H4T A;  1Z7M A;  4KR3 A;  4H2V A;  3L4G A;  4DPG A;  1PYS B;  3ERR A;  1EQR A;  4TVA A;  4RQE A;  2CJ9 A;  2Q7H A;  4K87 A;  4TVW A;  4H2W A;  1HTT A;  2HNI A;  4XTZ A;  4OLF A;  4P75 A;  1G51 A;  3BJU A;  4P75 C;  2EJF A;  4AH6 A;  4X5O A;  3VQX A;  2E10 A;  4CS4 A;  5ELO A;  1NYR A;  3E9I A;  1HC7 A;  2CJB A;  2ZNJ A;  3P8Y A;  4H2X A;  2E5A A;  3G1Z A;  1QE0 A;  3PCO B;  4K88 A;  5KNN A;  4P71 C;  2ZIN A;  2RHS A;  4NCX A;  1USY C;  1NJ6 A;  3A32 A;  4YYE A;  2ODR C;  4XTV A;  4Q6G A;  5ELN A;  2E64 A;  3TEH B;  2PME A;  4WJ3 M;  1ADJ A;  2ZIO A;  3HY0 A;  3E9H A;  4ZIB A;  1NNH A;  4XU3 A;  3EFR A;  1NJ5 A;  2DTH A;  4YCV A;  2AKW B;  3M4Q A;  1H4Q A;  4ZTZ B;  4BW9 A;  1E1T A;  2CGH A;  2I4N A;  3P8V A;  1SET A;  4P72 C;  1SER A;  2Q7E A;  4EX5 A;  2ALY A;  3RUX A;  1LYL A;  2ZT6 A;  4YRL A;  3I7F A;  3HRI A;  3QTC A;  5F5W A;  4YPF A;  2QHV A;  4RMF A;  1GGM A;  4P71 A;  1KMN A;  4P3O A;  3W3S A;  1BIA A;  3QNE A;  4YRS A;  1B7Y B;  1E24 A;  1WU7 A;  1EVK A;  5E3I A;  1JJC B;  3HFZ A;  3RIR A;  3PZC A;  2DZC A;  2Q7G A;  3V8L A;  3HXZ A;  4HWT A;  2I4O A;  2Q5I A;  4YRR A;  2ZR2 A;  2DU5 A;  3VQY A;  3VBB A;  1EIY A;  2CIM A;  1WQW A;  3VQV A;  1EIY B;  3EFS A;  3HXX A;  2E3C A;  1E1O A;  4CH5 A;  3TEH A;  4YRE A;  3V7S A;  4DQ2 A;  3TEG A;  2ZT7 A;  1JJC A;  2RHQ B;  2ALY B;  3UH0 A;  4YRF A;  3HFZ B;  4HWO A;  2QHT A;  3A7R A;  3HFV A;  4YRK A;  4XEO A;  1RIQ A;  1YB3 A;  3IAL A;  2DXU A;  1B8A A;  2C8M A;  4XTW A;  3KFU A;  1WQ7 A;  3RKX A;  1B7Y A;  3HY1 A;  1YFT A;  1ADY A;  2ODR D;  3A74 A;  4WI1 A;  2E1H A;  2DDZ A;  1X55 A;  3MF2 A;  1X54 A;  1SES A;  4YRI A;  3NEN A;  4H2Y A;  1BIB A;  2RHQ A;  2ART A;  4TVA B;  4UPA A;  3RGL A;  4H02 A;  1FYF A;  1PYS A;  5K1X A;  2ZZG A;  4P3P A;  4RDX A;  3BFM A;  3RKY A;  4PHC A;  2Q5H A;  3HXV A;  4P74 C;  2ZNI A;  1X01 A;  2ARS A;  4H2U A;  2ZCE A;  3IKM B;  1KOG A;  4WJ4 A;  3UGQ A;  3NET A;  2J3M A;  3NEL A;  3V8K A;  3A7U A;  4YRP A;  2ZGW A;  3LSS A;  3LSQ A;  4CS3 A;  2XGT A;  2I4M A;  4PG3 A;  4TTV A;  2ZIM A;  2DQ3 A;  3NEM A;  1SRY A;  3WQZ A;  3HXY A;  2ZZF A;  4CH3 A;  3DSQ A;  2QHU A;  3A7A A;  3HXU A;  1L0W A;  2C7I A;  1X2G A;  1BBU A;  2PMF A;  2QHS A;  1NJ2 A;  1VQZ A;  4P73 C;  12AS A;  2ZXF A;  2EJG A;  1EFW A;  2ZTG A;  1NJ8 A;  2P5I A;  4RQF A;  3A5Y A;  3PCO A;  2AMC A;  2EJ9 A;  4H2X B;  3RKW A;  1Z7N A;  1USY A;  4BWA A;  2AKW A;  4YP0 A;  2CJA A;  4G85 A;  1ATI A;  3MEY A;  3RL6 A;  3REU A;  1N9W A;  3V8J A;  2G4C A;  5C52 B;  4XTU A;  1WPY A;  4YRM A;  4YRO A;  4HVC A;  3A31 A;  2E41 A;  4UP8 A;  2P0L A;  4KR2 A;  4P72 A;  1EVL A;  5C53 B;  3R07 A;  4YRN A;  1H4S A;  4YDQ A;  1E22 A;  2EL9 A;  3LC0 A;  4ZTU B;  2DVE A;  1WYD A;  2J3L A;  3A5Z A;  4P3N A;  1EOV A;  2RHS B;  1WLE A;  4WF2 A;  1YGB A;  4YCW A;  4EO4 A;  4TVY A;  1NJ1 A;  4XTX A;  2EWN A;  1H4V B;  1W66 A;  5K1P A;  4HWR A;  3M4P A;  4TQF A;  3L4G B;  2ZT8 A;  4YCU A;  3UFG A;  3OD1 A;  1BBW A;  2ARU A;  3HXW A;  1WNL A;  4P73 A;  1YFR A;  4YRG A;  4OP0 A;  4XEM A;  2DTI A;  2DQ0 A;  4YRT A;  2IY5 A;  4O2D A;  4XU1 A;  2DEQ A;  4YRC A;  3V7C A;  3V7R A;  2ZZE A;  1G5I A;  4H2T A;  4L87 A;  4KQE A;  4CH4 A;  1B76 A;  2DKG A;  2FYK A;  2DJZ A;  4TWA A;  3L1A A;  4HWS A;  2EAY A;  4J15 A;  1QF6 A;  3RF1 A;  1X2H A;  2E65 A;  2ZT5 A;  4XTY A;  4UP9 A;  5C51 B;  4H2S A;  2ZR3 A;  1X56 A;  4HWP A;  5HGQ A;  2I4L A;  3QO5 A;  1YFS A;  2DU7 A;  2IY5 B;  1KMM A;  4HA8 A; 
#chains in the Genus database with same CATH topology
 3L2Z A;  2CXF A;  5AQH B;  2JJ9 A;  3FZM B;  2EHO C;  4CH6 A;  3C64 A;  2HN2 A;  5AQR B;  4XU2 A;  3IEE A;  1SHZ C;  4JBW F;  1HXD A;  2ZM2 A;  4CI1 B;  4E51 A;  2SPC A;  1BR1 A;  2XQ7 A;  3FJP A;  3PU8 A;  2WQY A;  4L5G A;  5FYM A;  3UGT A;  1KNZ A;  5FKY A;  4TNV A;  3AA6 B;  4YSX A;  3MQZ A;  2A72 A;  3ZJ2 A;  4P74 A;  2YN6 A;  11AS A;  4HGA A;  1H7C A;  3KDS E;  3QO8 A;  2MYS A;  3VKH A;  3REX A;  2XTI A;  4AIS A;  2CMR A;  3JAF A;  3VQW A;  4PK4 A;  3ICA A;  1MMN A;  3P8T A;  4ILC A;  2AMC B;  4XU0 A;  2E2A A;  3IG2 A;  4G2A A;  3SRZ A;  1B70 B;  3AE1 A;  1Z7M A;  1N34 T;  2YOE A;  2MTQ A;  4H2V A;  1YKH B;  4DO0 A;  5IHY A;  2VVN A;  4K87 A;  4H2W A;  3AEA A;  4XTZ A;  4OLF A;  3I1A A;  4IDO A;  4P0B A;  4EEB A;  3AE2 A;  4P75 C;  1J1J A;  3LBX A;  3VQX A;  2E10 A;  1WLX A;  3PUA A;  2DNX A;  2R6G F;  4DID B;  3HKE E;  3V5S A;  2K3W A;  2XQ6 A;  3LSV A;  2V6X A;  2NS6 A;  2E9X B;  4NUV A;  3ZC1 A;  2RHS A;  4LF8 T;  4AQF C;  1V9D A;  4YYE A;  2ODR C;  2LSG A;  1W0A A;  4BA9 A;  5ELN A;  3N9N A;  4ZZC A;  2PME A;  4DVD A;  4GYS A;  1ADJ A;  4WJ3 M;  3HY0 A;  5LMN T;  3P4W A;  3LFM A;  2LRK A;  4ZIB A;  4XU3 A;  1NJ5 A;  2DTH A;  2XUE A;  4HWI B;  2UUB T;  1MNE A;  3BK9 A;  4KX6 A;  1I6Z A;  4CN4 A;  2H3R A;  4LFA T;  2BVL A;  4C90 A;  2G0U A;  4B3S T;  2LJL A;  1SET A;  4P72 C;  2C5J A;  4IDZ A;  4MBQ A;  2XJ7 A;  3VRB A;  1OWA A;  2ZT6 A;  4NPP A;  2JQ9 A;  3UUL A;  2CRB A;  3UT5 E;  1B7T A;  1YQ3 A;  4ZI3 D;  1GGM A;  2V7M A;  4MAL A;  5IYZ E;  2CM0 A;  4JI3 T;  2WBL A;  2Q9Q D;  1WR6 A;  1U5P A;  2W0G A;  2B1E A;  4DR3 T;  5E3I A;  1MMG A;  3I9Y A;  2XM1 A;  4U2Z A;  3N2K E;  3O1J A;  3SOL A;  2V5C A;  5AQS B;  1OXZ A;  3P4S A;  5EK4 A;  4PK6 A;  4EYY R;  5HEH A;  5L3G B;  4V1A v;  3V8L A;  3N9L A;  3AEB A;  3WAJ A;  4A98 A;  2I4O A;  2Q5I A;  1HR0 T;  2UXX B;  3HI2 A;  1E1H B;  4EB6 E;  1HX1 B;  3PV0 F;  4K0U A;  2CLY B;  1EIY B;  3AE9 A;  3ETU A;  2BS4 A;  3UTK A;  1NWM X;  2CXL A;  3ESL A;  5LGU B;  5AQJ B;  2UUA T;  4DQ2 A;  2UUC T;  4X65 T;  2ALY B;  3UH0 A;  2XM2 A;  3HFZ B;  2BBJ A;  4NUU A;  2BKO A;  3BQL A;  5JDN A;  4XEO A;  5LNK A;  4KHZ F;  1W0B A;  1X9B A;  5JRC A;  2KSR A;  4I0U A;  4UV9 B;  3ZSS A;  3TLW A;  2E5L T;  5LB7 B;  3E22 E;  1B8A A;  2C8M A;  5LBM A;  4DV2 T;  3ZYL A;  2H89 A;  1MMA A;  3J9X 1;  3UQ7 A;  3H37 A;  3HY1 A;  1M62 A;  1KNP A;  5DQV A;  2UXN B;  4CXX A;  3MF2 A;  2D0U A;  5JDL A;  3O1H A;  2VL8 A;  3HA4 A;  3NEN A;  2NW7 A;  4BJM A;  4H2Y A;  2ART A;  4JI2 T;  3RGL A;  1BR0 A;  4H02 A;  1PYS A;  1UX5 A;  3RRW A;  3A5X A;  3JC6 C;  4GOU A;  1NAF A;  4JI5 T;  4RDX A;  4JI1 T;  4PHC A;  2XQA A;  3HXV A;  4CI3 B;  3ZMU B;  2BG9 A;  3C4X A;  3RRC A;  4H2U A;  3NRX A;  1KOG A;  2XAQ B;  3NEL A;  2LOS A;  3AAE B;  3A7U A;  3ZC0 A;  2LRL A;  2ZGW A;  3ZLI A;  2NTY A;  2YDS A;  5FY1 A;  4CS3 A;  2XGT A;  4HE8 A;  4TTV A;  5JDM A;  1WYB A;  5A1L A;  3QC9 A;  3SWH A;  2DCF A;  2Q9Q B;  5LYJ E;  2KND A;  2JQQ A;  3WQZ A;  2BG9 B;  2UU9 T;  4DV3 T;  2Y48 B;  4KI0 F;  1NJ2 A;  2B76 A;  1UX4 A;  4YXD A;  4P73 C;  1EFW A;  1S35 A;  1NJ8 A;  2P5I A;  1IJ5 A;  4RQF A;  1IJ6 A;  2X9W A;  3A5Y A;  4GK5 E;  2LSI A;  2WDR A;  4H63 V;  4UIG A;  3RKW A;  4AQF A;  4BWA A;  4YP0 A;  1CHU A;  3PUZ F;  1MIW A;  3ONX A;  4UF0 B;  4YHH T;  3REU A;  3V8J A;  3EVY A;  4IDN A;  4XAX B;  5C8Y E;  3AE5 A;  5J2U E;  2X9Y A;  4ANJ A;  4DMV A;  2WZH A;  3N2G E;  2VAS A;  4AKR B;  5FVL A;  2P0L A;  4P72 A;  3R84 B;  5CB4 E;  3J7Y q;  4TWD A;  2DWG A;  1E22 A;  3LC0 A;  4QHO A;  4UXN B;  4X1Y E;  2M67 A;  4E7Z A;  4Z90 A;  3ZCI A;  4P3N A;  1EOV A;  3OYZ A;  2LSJ A;  2LLY A;  3KBT A;  4EO4 A;  4EYU A;  4XTX A;  4EED A;  4Z8X A;  2XQ9 A;  4HWR A;  4HWD A;  4QH5 A;  3ZMZ B;  3PJA J;  4HN9 A;  2GK9 A;  2ZT8 A;  4A56 A;  4QX7 B;  4EV6 A;  3AB3 B;  1SUM B;  3OD1 A;  2ARU A;  3RYI E;  2BS3 A;  5JR9 B;  2WWV A;  1HG2 A;  2DTI A;  2HHH T;  4U2Y A;  4TNW A;  1UUR A;  3UFE A;  4PJL A;  3RLF F;  1HNZ T;  4IDP A;  3PE0 A;  4L87 A;  4U3C A;  3M3Z B;  2DKG A;  2DJZ A;  4DV0 T;  3L1A A;  5LBQ B;  5LHI B;  4IST A;  4KMC A;  4HWS A;  2ZM6 T;  4NIQ A;  2N9D A;  4ILA A;  4ZEY A;  3QNU A;  5LG3 A;  3SFD A;  4LF4 T;  1ZOY A;  5HGQ A;  2I4L A;  3UU4 A;  4U31 A;  5AQT B;  1YFS A;  2IUB A;  2FJA A;  4PK5 A;  1KMM A;  3EAM A;  4BJN A;  4FI5 A;  2ODV A;  3K3O A;  4Q15 A;  3AE3 A;  4EOZ B;  1KEY A;  1Z8U A;  3CPZ A;  4AI6 A;  4KP3 C;  1WRD A;  4HFD A;  3U3I A;  1ASZ A;  2XY8 B;  2BG9 C;  2JQH A;  2DZ9 A;  4H9N C;  1IL2 A;  5LHH B;  1YD8 G;  3HTZ A;  2DLR A;  3K3Q C;  3HRK A;  3L3P A;  3CX6 B;  5HCM A;  5TAO A;  4CS2 A;  3HR0 A;  4UEL A;  4MHC A;  4TQD A;  1G5H A;  4LML A;  4YRQ A;  2YDR A;  2Y6X A;  2DXT A;  4JEH B;  5CJ5 A;  3ZPO A;  4L9I A;  1UUS A;  2X51 A;  3OBV E;  5KX5 E;  3ERR A;  3GWH A;  1EQR A;  1IBK T;  5LJM A;  4RQE A;  3HL6 A;  2RP4 A;  3AE4 A;  5BMV E;  5LGN B;  2J4G A;  4X1K E;  2HNI A;  1HTJ F;  2JPF A;  5EK2 A;  4P75 A;  3MAC A;  2XAF B;  1HF8 A;  4GIW A;  2QRX A;  3K1S A;  1YQ4 A;  3F57 A;  2PG8 A;  5ABH A;  3E9I A;  3UUM A;  2CJB A;  4PJJ A;  1WYC A;  4AKH A;  4ZI2 D;  3ONL C;  2JMK A;  1XNR T;  2LEH A;  2QA7 A;  5DJQ C;  1N36 T;  2XAJ B;  1QE0 A;  4K88 A;  5CA0 E;  5DQW A;  2VWA A;  4Q6G A;  5ETW A;  1KNR A;  2E9X C;  3E9H A;  2XQ8 A;  1NNH A;  1M7K A;  2XHE B;  1GQE A;  1H4Q A;  4I55 E;  2D2S A;  1X79 A;  4MFR A;  1J5E T;  4CN1 A;  3DTO A;  1HX8 A;  1HNW T;  2CHN A;  4YSY A;  5L2L A;  2Q7E A;  1US7 B;  5FXX A;  3RUX A;  3ZEF B;  3P8C D;  3PJA A;  3PU3 A;  3FZK B;  1AJ3 A;  3QB5 K;  3LBX B;  2CXD A;  3CX7 B;  4P71 A;  2HPJ A;  1ZHC A;  2CE7 A;  3W3S A;  4QH1 A;  4G63 A;  4IE0 A;  1B7Y B;  1HFA A;  4IE6 A;  3R6N A;  4ILU A;  1WU7 A;  4GKK T;  1T7S A;  1JJC B;  2YU2 A;  5LMU T;  1FEW A;  2XZE A;  1XNQ T;  3PZC A;  5LP6 E;  4P1N A;  2WMN A;  5HYA A;  2AE9 A;  4HWT A;  5LGT B;  2K24 A;  3VQY A;  2OA5 A;  3VHL A;  4HWC A;  2CIM A;  4H9Q C;  2WM9 A;  3C50 A;  4AIU A;  4YTP A;  4CH5 A;  3RQU A;  3KIN B;  3NKZ A;  3X1D A;  3TEH A;  3AVR A;  2WB5 A;  3V7S A;  3TEG A;  2RHQ B;  3EUH A;  5IUX A;  4YRF A;  2EHO B;  4HWO A;  2QHT A;  4TWH A;  3HFV A;  4F6R C;  2FJB A;  5L4H A;  2YKS A;  1YB3 A;  3IAL A;  5F8P A;  1IZN B;  4UVA B;  3RYH E;  3AE6 A;  3VR9 A;  1XDO A;  2X9H A;  5ADX L;  4WI1 A;  2DDZ A;  2XQY A;  1X54 A;  2YEV C;  3ZT6 A;  5JDQ A;  1FYF A;  5FL0 A;  4OK0 A;  4HFC A;  4DUY T;  3CK6 A;  2VKO A;  4WZX A;  3ZJ1 A;  4U7Y A;  2H88 A;  5FL1 A;  1VOM A;  1XWM A;  4UR9 A;  2BZB A;  2C5I T;  3SFE A;  2ARS A;  5EK3 A;  3AA7 B;  2W4X A;  4DBR A;  3V8K A;  3N2O A;  4CXW A;  2DI4 A;  3LSS A;  3LSQ A;  2P9B A;  5KXJ A;  3O9X A;  2VVS A;  4JI4 T;  2ZIM A;  4PNI A;  2LOP A;  3VU7 H;  2DQ3 A;  4AKL A;  3ZYM A;  4B3M T;  3ANW A;  4QXB B;  2ZZF A;  3RC3 A;  4CXY A;  3ZCJ A;  5CFB A;  5LG4 A;  4IE7 A;  4PFP A;  3HXU A;  3M65 A;  1L0W A;  3AE7 A;  3LK3 B;  4DV1 T;  3EHZ A;  2V6Y A;  5AQM B;  5HEU A;  3FZH B;  3PUV F;  5LJN A;  3MA9 A;  4J2C A;  4UVB B;  2EJ9 A;  2DL1 A;  4JI7 T;  4H2X B;  5LXT E;  1USY A;  3VR8 A;  2AKW A;  3EI0 A;  2V7J A;  4G85 A;  3MEY A;  2DWK A;  4CN6 A;  5L3C B;  1YKE B;  3PDY A;  3CIR A;  4TUY E;  2KLQ A;  2JQK A;  2I6H A;  3IHR A;  2WSS V;  3A8Y C;  3F2E A;  4DV4 T;  2KT9 A;  2LM2 A;  2W67 A;  4YRO A;  3B57 A;  3KBU A;  3RQW A;  4TZ4 C;  3UUN A;  4EZ4 A;  2FJD A;  2BS2 A;  4IHJ E;  3FBL A;  4I50 E;  4N78 D;  4XBF B;  4HFE A;  4YRN A;  2EL9 A;  2V7K A;  3FB2 A;  3DJB A;  2DVE A;  3KV4 A;  2X66 A;  3A5Z A;  2C5K T;  3ABV A;  2HN1 A;  3LJC A;  2X67 A;  2OV9 A;  4WF2 A;  4DV5 T;  5JDH A;  1YGB A;  2D5U A;  3JC6 D;  4TVY A;  1N33 T;  2KMF A;  5AQN B;  4ZXL A;  1LRZ A;  2FBW A;  2X0L B;  1W66 A;  1NEK A;  5JQG E;  2A8E A;  4TQF A;  3KV5 A;  3L4G B;  3T1H T;  4YCU A;  3N9M A;  3UFG A;  3AAI A;  2AXD S;  1WNL A;  4P73 A;  1YFR A;  2V26 A;  3CVR A;  3WI3 A;  3ZMV B;  3K3N A;  4HT4 A;  4LMJ A;  4AKG A;  3C98 B;  5AQP B;  5ABF B;  4JI0 T;  3BQK A;  5AFU L;  2IY5 A;  3PUQ A;  4O2D A;  3AA1 B;  4YRC A;  3V7C A;  3V7R A;  4CH4 A;  4TWA A;  3KVA A;  4X66 T;  1JNZ A;  5L3F B;  3RF1 A;  3RYF E;  3RKG A;  2E65 A;  3KV9 A;  4UP9 A;  4PW8 A;  3QOF A;  5C51 B;  3OTO T;  1X56 A;  3ZST A;  3RIF A;  3QO5 A;  3PUW F;  4X20 E;  5AQU B;  2X0Y A;  3CMQ A;  3TLV A;  1HS7 A;  4YTN A;  4LNS A;  1XDP A;  2M6I A;  2CHO A;  2XAG B;  3MKD A;  3MK7 C;  4JV5 T;  2HH7 A;  1LVF A;  2IW5 B;  1OED B;  3I0Q A;  2MAW A;  4ZHQ E;  2UXB T;  1ZP0 A;  1ASY A;  1C0A A;  3AEC A;  1J5W A;  5FXV A;  2IML A;  4K86 A;  2KWH A;  2XQ5 A;  4DND A;  4JUY A;  4I4T E;  2ODU A;  3L4G A;  4CI2 B;  2D0T A;  5AQQ B;  4LF9 T;  2ZM8 A;  4TVA A;  1L0V A;  2CJ9 A;  2Q7H A;  1HTT A;  3IF8 B;  4FJO A;  5ABF A;  3FZF B;  1O3X A;  3UU6 A;  4AH6 A;  4X5O A;  4CS4 A;  3ZN1 B;  3B13 A;  2W00 A;  4H9O C;  1HC7 A;  4O4J E;  2OLT A;  2ZNJ A;  2H7V C;  3P8Y A;  2E5A A;  4H2X A;  4HFH A;  3G1Z A;  3V5U A;  2X68 A;  4AKI A;  1NJ6 A;  4LFB T;  2E64 A;  3TEH B;  5AQV B;  1MMD A;  4IT4 A;  4CZZ B;  2ZIO A;  1BR2 A;  1QSD A;  2ZM0 A;  3EFR A;  5FXW A;  2WZI A;  3RIA A;  2LHN A;  2K5B B;  3M4Q A;  4NXM T;  4ZTZ B;  1S94 A;  5HAX A;  4BW9 A;  2CGH A;  5JTG A;  2CLY C;  2FUP A;  3LK4 2;  3P8V A;  4EX5 A;  2J1D G;  1LYL A;  1ZEE A;  2MBG A;  2QGS A;  3TLT A;  1KMN A;  4P3O A;  3W15 B;  1BIA A;  2NTX A;  2WU2 A;  4YRS A;  1E24 A;  5JR9 C;  2LM9 A;  1EVK A;  3LK2 B;  1FIO A;  4ZS3 A;  4JI6 T;  3WAK A;  3GN5 B;  5FVK A;  2X0H A;  1LKX A;  2DZC A;  4DV6 T;  1CUN A;  2LT3 A;  3C51 A;  4TN7 B;  2VB6 A;  3HXZ A;  4YRR A;  2BKP A;  5E0O A;  4LMK A;  4QWN B;  3CKD A;  3VBB A;  2PJQ A;  3QK6 A;  5FY0 A;  4TV8 E;  1T8B A;  5L3E B;  1WQW A;  3VQV A;  4LF7 T;  3EFS A;  2VK9 A;  2E3C A;  1E1O A;  5KMG P;  4WNK A;  3E08 A;  4QKN A;  1ZV4 X;  1ZKE A;  1G8X A;  1E7P A;  1QLB A;  2ZT7 A;  1JJC A;  5FNV E;  4PJN A;  2JRK A;  3H3M A;  2E9X A;  2LKH A;  3N5L A;  3PUG A;  3A7R A;  2V6Y B;  4OHF A;  1IBL T;  3RH3 A;  2DXU A;  5ABE A;  2VKH A;  4XTW A;  3KFU A;  4IL4 A;  5IWA T;  3AAA B;  4TWF A;  2WU5 A;  3N9P A;  1WQ7 A;  4LVK A;  3RKX A;  1WFD A;  1B7Y A;  1BR4 A;  2L3L A;  2ODR D;  1FJG T;  4TX5 A;  3D0T A;  3P4Q A;  1X55 A;  3O4X E;  1MIV A;  3P4P A;  2CPT A;  4LVI A;  1BIB A;  2RHQ A;  2A2F X;  3GMI A;  4TVA B;  3T8O A;  4UPA A;  4A5X A;  3Q9D A;  2ZZG A;  2WY2 A;  3JCF A;  4ERR A;  5HEJ A;  3BFM A;  2J47 A;  4NXN T;  5FY7 A;  4P74 C;  3OYX A;  1X01 A;  3PUS A;  3UUX B;  2ZCE A;  2IAK A;  3IKM B;  1VRB A;  4M1P A;  4WJ4 A;  3UGQ A;  3PTR B;  4JEU B;  4X1I E;  3I0O A;  4YRP A;  5HEO A;  4HKA A;  5JDF A;  4B3R T;  4DMW A;  4PG3 A;  2DHR A;  2Q9Q C;  3ZN0 B;  3IBP A;  1SRY A;  4GKJ T;  1YW0 A;  3DSQ A;  3A7A A;  4DR6 T;  2C7I A;  4LFC T;  1W09 A;  4YHJ A;  5F3J A;  1BBU A;  5AQK B;  2PMF A;  2M6B A;  4UEM A;  4KUM B;  12AS A;  3Q5X A;  2ZXF A;  2EJG A;  2PFV A;  2ZTG A;  4QXC B;  4OYK A;  2AMC A;  3LG7 A;  3P7I A;  4I43 B;  2CBJ A;  1Z7N A;  1JNR A;  3AVS A;  4ZZB A;  2CJA A;  3RL6 A;  1N9W A;  5L3D B;  2A9U A;  1XMQ T;  4HEA A;  5C52 B;  4KHP T;  4XTU A;  1WPY A;  4HTE A;  5L3B B;  4JI8 T;  3NVO A;  4HVC A;  3C4Z A;  3A31 A;  3Q5E A;  4UP8 A;  2CWO A;  3GN5 A;  4WBO A;  3CML A;  4OFZ A;  5CGM A;  4DR7 T;  2NW8 A;  2V7I A;  2YIN A;  4UV8 B;  5C53 B;  2WDV A;  3R07 A;  5HXS A;  4YDQ A;  4LVL A;  4ZTU B;  1MND A;  3OPC A;  1VCS A;  3S4U A;  5LA6 E;  1QUU A;  2IC6 A;  2FJE A;  4EZH A;  4DBQ A;  2QVA A;  1UCU A;  2IIU A;  2QYW A;  5H6Q B;  4AQY T;  4OYJ A;  1NJ1 A;  1W9R A;  1KFY A;  2EWN A;  1H4V B;  2WWU A;  3QUJ A;  3AE8 A;  4DR5 T;  1FMW A;  4QXH B;  2NWB A;  4IDQ A;  1SE7 A;  3ZMT B;  3M4P A;  2KZ7 B;  3AXJ B;  3P50 A;  3N9O A;  2V7L A;  4ILB A;  3OVU A;  1T72 A;  5JVD E;  3IA3 A;  3HXW A;  3DP7 A;  3RX6 A;  2ZMA A;  2L9Q A;  3NZQ A;  4YRG A;  5JRE A;  1Y01 A;  1FMV A;  2XTL A;  1DU2 A;  2N1G A;  3ONJ A;  1D0Y A;  2W61 A;  4YRT A;  2LKG A;  5AQO B;  4XU1 A;  2W63 A;  2ZZE A;  1G5I A;  4H2T A;  4KQE A;  4H63 H;  2FYK A;  3A7M A;  3OJA A;  1HNX T;  3G06 A;  2EAY A;  4J15 A;  1QF6 A;  2W66 A;  1X2H A;  2WS3 A;  4CQI A;  2ZT5 A;  4XTY A;  3TLU A;  2ZR3 A;  3RKO A;  4HWP A;  4WBN E;  1Y64 B;  4IE4 A;  4IE5 A;  2PBI A;  3MZK B;  5HXR A;  4HFI A;  3FHN A;  5AQL B;  2IY5 B;  1NYQ A;  3O1I A;  2UXD T;  5JDG A;  4YFS A;  3TUP A;  5GON E;  3AA0 B;  4YRJ A;  4WYV A;  1B70 A;  3AEG A;  2A3D A;  2DTO A;  3QO7 A;  4HWH A;  4ZI3 C;  3ANW B;  4G84 A;  3RYC E;  3RI5 A;  3MF1 A;  3EDV A;  2E8I A;  3T1Y T;  3AEE A;  4IGU A;  1U4Q A;  1D0X A;  5J0Z A;  2BVM A;  1OED A;  3L09 A;  1R8I A;  4H9S E;  4PAG A;  2CA5 A;  3F31 A;  1LVK A;  3RIU A;  4GK0 E;  2K48 A;  2L8K A;  3IKL A;  1VCT A;  1N32 T;  3PUX F;  2XPK A;  3VRA A;  3MJX A;  4P09 A;  4UP7 A;  2Y8D A;  3RAC A;  4GYR A;  1H4T A;  4KR3 A;  4JLE A;  4DPG A;  1PYS B;  2RA1 A;  2HPL A;  2XQ4 A;  4YT0 A;  3FXD B;  4TVW A;  1SA0 E;  1G51 A;  2IDO B;  1T98 A;  4PJM A;  3BJU A;  4ZOL E;  2EJF A;  4IL9 A;  2NP9 A;  5ELO A;  3UU3 A;  1NYR A;  4Q25 A;  2CEA A;  3UU5 A;  2I0M A;  3PCO B;  5HCJ A;  5AQG B;  1OED E;  5KNN A;  4P71 C;  2ZIN A;  4JYA T;  5H6R B;  4NCX A;  1USY C;  3A32 A;  4XTV A;  4ZI7 E;  2E5V A;  4LVM A;  3RC8 A;  2D9D A;  2RPA A;  2XAS B;  5HWY A;  4L0R A;  2BKN A;  2CCQ A;  3AXJ A;  4YCV A;  5C3J A;  2AKW B;  4X5T A;  1E1T A;  2JIW A;  2I4N A;  3Q5D A;  1KK7 A;  1HCI A;  4B3T T;  3ETV A;  4AXP A;  1SER A;  5LOV E;  2BBH A;  2ALY A;  4YTM A;  2YDQ A;  3P4R A;  2K9A A;  2UXC T;  4YRL A;  3I7F A;  3HRI A;  3QTC A;  5F5W A;  4YPF A;  4O8S A;  5AQI B;  2KXP B;  1YXR A;  4O2A E;  2QHV A;  4RMF A;  5FP3 A;  5JR9 A;  2KIN B;  1WR0 A;  2WMO A;  3QB5 A;  3MXZ A;  5L47 A;  3QNE A;  3AEF A;  4DV7 T;  2MOZ A;  4XZC A;  4HFV A;  3CWZ B;  3NRY A;  4B6X A;  3ZMS B;  4E7S A;  4QH4 A;  3HFZ A;  3RIR A;  1OED C;  2V1D B;  2NR4 A;  4U72 A;  2Q7G A;  4U33 A;  2XSA A;  4O4I E;  3N9Q A;  2ZR2 A;  3CX8 B;  2DU5 A;  3L8R A;  4YJ3 E;  1D1B A;  1EIY A;  5EZY E;  2CBI A;  3HXX A;  1MIY A;  4YY3 T;  2XAH B;  4F8H A;  4A97 A;  4YRE A;  4K0K T;  2ZLY A;  2F4V T;  3CQG B;  3UUB A;  3CQC B;  1UK5 A;  2V8S V;  4YRK A;  4ASK A;  4EIW A;  4LF6 T;  4U7I A;  1RIQ A;  3B5M A;  3PUY F;  4YSZ A;  2W2U A;  4TV9 E;  1YFT A;  1ADY A;  1HG5 A;  3A74 A;  4PFO A;  3NWI A;  2E1H A;  3C4W A;  1SES A;  4YRI A;  3NZP A;  4DR4 T;  2YK0 A;  2N2N A;  5M4Y A;  5BR8 T;  2LSK A;  5ABG A;  3TLS A;  4ADZ A;  5K1X A;  2C0S A;  4P3P A;  3HKC E;  2VKJ A;  4EGW A;  5HXH A;  1Z0P A;  3EDU A;  3JAD A;  3RKY A;  2Q5H A;  3UU8 A;  2ZNI A;  4UF0 A;  4DR1 T;  2VQE T;  2X9X A;  4UVC B;  3NET A;  2E9X D;  5FMN A;  2J3M A;  5C2T A;  4EAH A;  1XZY A;  2WP9 A;  2I4M A;  3HKB E;  3FXE B;  2CWY A;  3U78 A;  3NEM A;  4IRE A;  2LE8 A;  3ZKR A;  2H7O A;  2NOX A;  5DAB A;  2NW9 A;  3HXY A;  1D1C A;  4CH3 A;  3H3A A;  4OX9 T;  1IBM T;  2QHU A;  3PUR A;  5LCY A;  2VL0 A;  4EXT A;  3AED A;  2LSY A;  1X2G A;  4HFB A;  1EZ3 A;  2QHS A;  4O2B E;  1VQZ A;  4AQG A;  2EHO D;  2LHR A;  2MPK A;  3K8P C;  3JAE A;  3RIU C;  3PCO A;  5JH7 E;  2I59 A;  3CQX C;  3ZT7 A;  3Q2M A;  4Z91 A;  4C91 A;  1ATI A;  2ACX A;  4WW0 A;  5LHG B;  3SS1 A;  5J1G A;  4O4H E;  4H9P C;  3EAB A;  1D1A A;  3LDQ B;  2ES0 A;  2G4C A;  3FBZ A;  3KVB A;  4LF5 T;  3FZL B;  4YRM A;  5HXC A;  4ISS A;  3ZT5 A;  2KWI B;  2E41 A;  4HWF A;  3RPU A;  4KR2 A;  2XQ3 A;  2IHR 1;  2Z6E A;  3KV6 A;  1EVL A;  3UQ4 A;  1H4S A;  2IC9 A;  1KF6 A;  5HWX A;  2JMH A;  4QX8 B;  1WYD A;  2J3L A;  1E2A A;  3L39 A;  2Q9Q A;  2RHS B;  1WLE A;  2J62 A;  4P0A A;  5AQF B;  3BQI A;  5CA1 E;  4DUZ T;  4YCW A;  1D0Z A;  4MLK A;  3OKQ A;  1WCR A;  2VQF T;  1UGO A;  4X64 T;  4LVJ A;  3NBX X;  3VKG A;  5K1P A;  4YJ2 E;  3Q5W A;  1BBW A;  2WCA A;  1G73 A;  2WDQ A;  4IIJ E;  3ZYK A;  4YLH A;  4OP0 A;  5KDM C;  2BG9 E;  4X62 T;  4XEM A;  1I94 T;  2DQ0 A;  4COF A;  2EHO A;  2W62 A;  4KBM B;  2XSB A;  4ZI2 C;  5L4E A;  3E0Z A;  2DEQ A;  4H9R C;  2PTF A;  2BDE A;  3KFW X;  3RHW A;  1B76 A;  3HKD E;  3I9W A;  2WAU A;  3GA8 A;  3TKL B;  5HXE A;  1IAP A;  4H2S A;  5JRC B;  5J2T E;  4DR2 T;  2V5D A;  1XMO T;  5FXZ A;  2VKD A;  1NEN A;  2YU1 A;  4ZS2 A;  4O4L E;  2VUR A;  2ACZ A;  4BAY B;  2DU7 A;  5HEG A;  4U74 A;  4HA8 A; 
#chains in the Genus database with same CATH homology
 1NYQ A;  3L2Z A;  3CMQ A;  3TUP A;  4YRJ A;  4CH6 A;  4LNS A;  1B70 A;  4Q15 A;  4XU2 A;  2DTO A;  1HXD A;  3QO7 A;  4E51 A;  4G84 A;  3FJP A;  3MF1 A;  1ASZ A;  3UGT A;  2DZ9 A;  1IL2 A;  3HTZ A;  3MQZ A;  3HRK A;  4CS2 A;  1ASY A;  4TQD A;  4P74 A;  11AS A;  1G5H A;  1C0A A;  3IKL A;  3QO8 A;  3REX A;  2XTI A;  4YRQ A;  3VQW A;  1J5W A;  3ICA A;  3P8T A;  2AMC B;  4XU0 A;  4K86 A;  2DXT A;  4UP7 A;  3IG2 A;  3RAC A;  1B70 B;  1H4T A;  1Z7M A;  4KR3 A;  4H2V A;  3L4G A;  4DPG A;  1PYS B;  3ERR A;  1EQR A;  4TVA A;  4RQE A;  2CJ9 A;  2Q7H A;  4K87 A;  4TVW A;  4H2W A;  1HTT A;  2HNI A;  4XTZ A;  4OLF A;  4P75 A;  1G51 A;  3BJU A;  4P75 C;  2EJF A;  4AH6 A;  4X5O A;  3VQX A;  2E10 A;  4CS4 A;  5ELO A;  1NYR A;  3E9I A;  1HC7 A;  2CJB A;  2ZNJ A;  3P8Y A;  4H2X A;  2E5A A;  3G1Z A;  1QE0 A;  3PCO B;  4K88 A;  2NS6 A;  5KNN A;  4P71 C;  2ZIN A;  2RHS A;  4NCX A;  1USY C;  1NJ6 A;  3A32 A;  4YYE A;  2ODR C;  4XTV A;  4Q6G A;  5ELN A;  2E64 A;  3TEH B;  4LVM A;  2PME A;  4WJ3 M;  1ADJ A;  2ZIO A;  3HY0 A;  3E9H A;  4ZIB A;  1NNH A;  4XU3 A;  3EFR A;  1NJ5 A;  2DTH A;  4YCV A;  2AKW B;  3M4Q A;  1H4Q A;  4ZTZ B;  4BW9 A;  1E1T A;  2CGH A;  2I4N A;  3P8V A;  1SET A;  4P72 C;  1SER A;  2Q7E A;  4EX5 A;  2ALY A;  3RUX A;  1LYL A;  2ZT6 A;  4YRL A;  3I7F A;  3HRI A;  3QTC A;  5F5W A;  4YPF A;  2QHV A;  4RMF A;  1GGM A;  4P71 A;  1KMN A;  4P3O A;  3W3S A;  1BIA A;  3QNE A;  4YRS A;  1B7Y B;  1E24 A;  1WU7 A;  1EVK A;  5E3I A;  1JJC B;  3HFZ A;  3RIR A;  3PZC A;  2DZC A;  2Q7G A;  3V8L A;  3HXZ A;  4HWT A;  2I4O A;  2Q5I A;  4YRR A;  2ZR2 A;  2DU5 A;  3VQY A;  3VBB A;  1EIY A;  2CIM A;  1WQW A;  3VQV A;  1EIY B;  3EFS A;  3HXX A;  2E3C A;  1E1O A;  4CH5 A;  3TEH A;  4YRE A;  3V7S A;  4DQ2 A;  3TEG A;  2ZT7 A;  1JJC A;  2RHQ B;  2ALY B;  3UH0 A;  4YRF A;  3HFZ B;  4HWO A;  2QHT A;  3A7R A;  3HFV A;  4YRK A;  4XEO A;  1RIQ A;  1YB3 A;  3IAL A;  2DXU A;  1B8A A;  2C8M A;  4XTW A;  3KFU A;  1WQ7 A;  4LVK A;  3RKX A;  1B7Y A;  3HY1 A;  1YFT A;  1ADY A;  2ODR D;  3A74 A;  4WI1 A;  2E1H A;  2DDZ A;  1X55 A;  3MF2 A;  1X54 A;  1SES A;  4YRI A;  3NEN A;  4LVI A;  4H2Y A;  1BIB A;  2RHQ A;  2ART A;  4TVA B;  4UPA A;  3RGL A;  4H02 A;  1FYF A;  1PYS A;  5K1X A;  2ZZG A;  4P3P A;  4RDX A;  3BFM A;  3RKY A;  4PHC A;  2Q5H A;  3HXV A;  4P74 C;  2ZNI A;  1X01 A;  2ARS A;  4H2U A;  2ZCE A;  3IKM B;  1KOG A;  4WJ4 A;  3UGQ A;  3NET A;  2J3M A;  3NEL A;  3V8K A;  3A7U A;  4YRP A;  2ZGW A;  3LSS A;  3LSQ A;  4CS3 A;  2XGT A;  2I4M A;  4PG3 A;  4TTV A;  2ZIM A;  2DQ3 A;  3NEM A;  1SRY A;  3WQZ A;  3HXY A;  2ZZF A;  4CH3 A;  3DSQ A;  2QHU A;  3A7A A;  3HXU A;  1L0W A;  2C7I A;  1X2G A;  1BBU A;  2PMF A;  2QHS A;  1NJ2 A;  1VQZ A;  4P73 C;  12AS A;  2ZXF A;  2EJG A;  1EFW A;  2ZTG A;  1NJ8 A;  2P5I A;  4RQF A;  3A5Y A;  3PCO A;  2AMC A;  2EJ9 A;  4H2X B;  3RKW A;  1Z7N A;  1USY A;  4BWA A;  2AKW A;  4YP0 A;  2CJA A;  4G85 A;  1ATI A;  3MEY A;  3RL6 A;  3REU A;  1N9W A;  3V8J A;  2G4C A;  5C52 B;  4XTU A;  1WPY A;  4YRM A;  4YRO A;  4HVC A;  3A31 A;  2E41 A;  4UP8 A;  2P0L A;  4KR2 A;  4P72 A;  1EVL A;  5C53 B;  3R07 A;  4YRN A;  1H4S A;  4YDQ A;  1E22 A;  2EL9 A;  3LC0 A;  4LVL A;  4ZTU B;  2DVE A;  1WYD A;  2J3L A;  3A5Z A;  4P3N A;  1EOV A;  2RHS B;  1WLE A;  4WF2 A;  1YGB A;  4YCW A;  4EO4 A;  4TVY A;  1NJ1 A;  4XTX A;  2EWN A;  1H4V B;  4LVJ A;  1W66 A;  5K1P A;  4HWR A;  2A8E A;  3M4P A;  4TQF A;  3L4G B;  2ZT8 A;  4YCU A;  3UFG A;  3OD1 A;  1BBW A;  2ARU A;  3HXW A;  1WNL A;  4P73 A;  1YFR A;  4YRG A;  4OP0 A;  4XEM A;  2DTI A;  4HT4 A;  2DQ0 A;  4YRT A;  2IY5 A;  4O2D A;  4XU1 A;  2DEQ A;  4YRC A;  3V7C A;  3V7R A;  2ZZE A;  1G5I A;  4H2T A;  4L87 A;  4KQE A;  4CH4 A;  1B76 A;  2DKG A;  2FYK A;  2DJZ A;  4TWA A;  3L1A A;  4HWS A;  2EAY A;  4J15 A;  1QF6 A;  3RF1 A;  1X2H A;  2E65 A;  2ZT5 A;  4XTY A;  4UP9 A;  5C51 B;  4H2S A;  2ZR3 A;  1X56 A;  4HWP A;  5HGQ A;  2I4L A;  3QO5 A;  1YFS A;  2DU7 A;  2IY5 B;  1KMM A;  4HA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...