3UFGA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 96
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3ufgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ufgA01
2PMEA 1ADJA 4BWAA 1HC7A 3L2ZA 4XTUA 2E41A 1KMMA 4J15A 3PZCA 3I7FA 4XEOA 1QE0A 3G1ZA 4TVAA 4TVAB 4XU2A 2QHSA 4P72C 1X2HA 4XTXA 3MF1A 3IKLA 4P72A 1BIBA 4CS3A 1RIQA 3ICAA 1EOVA 2Q7EA 5KNNA 5F5WA 1IL2A 2ZT7A 3TEGA 1YB3A 2QHVA 4YP0A 3A31A 2DQ0A 2ALYA 3RF1A 3FJPA 1QF6A 3PCOB 2CJBA 2ZR3A 2I4LA 2ZT8A 1X56A 1HXDA 3ERRA 4YROA 4K86A 2EJFA 3HXYA 4G85A 4O2DA 1Z7MA 3TEHB 3A5ZA 4YREA 4EO4A 1J5WA 4LNSA 1NYRA 2ZR2A 4P74C 1X2GA 3NENA 4P75C 2C8MA 4H2UA 3MEYA 3IKMB 4P74A 4PG3A 4P75A 2DXUA 3RKYA 4XU0A 3M4QA 4TVYA 2E5AA 4XTWA 1SETA 4WJ4A 1B7YA 3NELA 1EIYA 1EIYB 1B70B 3HXVA 4H2WA 1EFWA 1USYC 3E9HA 1USYA 1PYSB 12ASA 3A32A 4H2SA 5K1XA 2RHSB 4YCVA 3A74A 3QTCA 4L87A 1NJ5A 4RMFA 2Q7GA 3NEMA 4UP7A 3REXA 3V7SA 4K87A 3HFVA 4YRIA 2I4MA 2ZNIA 4X5OA 4PHCA 4TWAA 3A7UA 3V8KA 2Q5IA 3W3SA 3VQYA 3HRIA 2Q5HA 4YRTA 11ASA 3A7AA 2E64A 1L0WA 2RHQB 4H2TA 3V8JA 3UFGA 3EFSA 4G84A 4K88A 4HA8A 2AMCA 2AMCB 4YRQA 2EJGA 1N9WA 2ZZGA 1NJ8A 4HWPA 2J3MA 4YRJA 3RGLA 1WQ7A 2EJ9A 4TVWA 3RKXA 4OP0A 2XTIA 2ARTA 1G51A 1H4TA 1ASZA 4WJ3M 2ARSA 1E22A 2AKWB 4CS2A 3L4GA 3L4GB 4UP8A 2DTHA 3RUXA 3PCOA 4H2XB 1NNHA 1C0AA 3HXWA 3RACA 1X54A 4P73C 2ARUA 3DSQA 3QO8A 2C7IA 3EFRA 4H2YA 3QO7A 2CJAA 3TEHA 4RDXA 4P73A 2ZT5A 1BBUA 4YRLA 2CJ9A 3IG2A 2HNIA 1NYQA 3NETA 3HXXA 2ZINA 1LYLA 3WQZA 2E65A 5C51B 4P3OA 2DZ9A 4WF2A 1B76A 1ATIA 4YRMA 2IY5B 3M4PA 2QHUA 1E1TA 2J3LA 2QHTA 1YFTA 4CH4A 4CH5A 1B70A 4AH6A 3REUA 1X01A 2DQ3A 2ZIOA 3HRKA 1EVLA 3IALA 2XGTA 4NCXA 5HGQA 3HXUA 1PYSA 2ZZEA 1WYDA 4XEMA 4YDQA 2DKGA 4P3NA 2RHSA 4WI1A 2ZTGA 1VQZA 5C52B 1EVKA 1G5HA 2ZXFA 1KMNA 4DPGA 4TQFA 2ZT6A 1SRYA 1Z7NA 3LC0A 2DTOA 5K1PA 2CGHA 3HTZA 1EQRA 4XTVA 4XTYA 4EX5A 4HVCA 1WU7A 2ODRD 3RIRA 4CH3A 3BFMA 2EAYA 2DEQA 2EWNA 3VQVA 1JJCB 4YPFA 3QO5A 1BBWA 4YCWA 3KFUA 2DU5A 2RHQA 3HFZA 2DZCA 3HFZB 4YRNA 3P8YA 1H4VB 2ZZFA 3R07A 4BW9A 2EL9A 4P3PA 5C53B 2G4CA 1NJ2A 1NJ1A 2E1HA 1E24A 1WLEA 5ELOA 2P0LA 4ZTUB 1X55A 2DU7A 4DQ2A 2ZIMA 4HWOA 2AKWA 2ZNJA 1ADYA 2DVEA 1HTTA 4UP9A 4XU3A 4H2XA 2E10A 4H2VA 4Q6GA 4YRGA 3CMQA 1YGBA 3V7CA 4YRCA 4ZTZB 3HY1A 1B8AA 4HWTA 4KQEA 4UPAA 3BJUA 2I4NA 4YRPA 3RKWA 3V8LA 2DXTA 4E51A 4HWRA 2ALYB 4HWSA 4YCUA 2I4OA 4TQDA 3A7RA 1SESA 1YFSA 3TUPA 4YRKA 5ELNA 1BIAA 3RL6A 4CS4A 3UGQA 2E3CA 2IY5A 3HY0A 3P8TA 4YRSA 1H4SA 2ODRC 1WPYA 3QNEA 2DJZA 2DDZA 4Q15A 1W66A 3UH0A 2PMFA 3A5YA 3VBBA 1G5IA 3P8VA 3UGTA 3OD1A 1WQWA 4CH6A 5E3IA 4XTZA 1WNLA 3VQXA 1SERA 4H02A 2CIMA 1YFRA 1FYFA 1B7YB 3E9IA 2FYKA 4OLFA 4YRRA 4XU1A 4RQFA 1E1OA 4YYEA 4TTVA 2Q7HA 2DTIA 4P71C 4YRFA 3MF2A 3V7RA 1ASYA 2ZGWA 4P71A 1JJCA 1H4QA 4ZIBA 3LSQA 4KR2A 4RQEA 1KOGA 3LSSA 1GGMA 3L1AA 2P5IA 2ZCEA 1NJ6A 3HXZA 4KR3A 3VQWA
chains in the Genus database with same CATH superfamily
4N78D 1HC7A 4XTUA 4CN6A 4XEOA 5JDGA 2VKJA 4AQYT 3G1ZA 2NS6A 2QHSA 4OYJA 1X2HA 5HYAA 4XTXA 3MF1A 1GQEA 5AQQB 2ZM2A 2CLYB 4P72A 4B3ST 2YINA 4MBQA 2XAGB 2Q9QC 1EOVA 5FKYA 4B3MT 1IL2A 4DBQA 5LYJE 3L8RA 3K3QC 2XQ3A 2E9XB 2PTFA 4XAXB 4YP0A 4EGWA 2IUBA 3RF1A 5LOVE 2CJBA 4Q25A 2ZR3A 1SUMB 4PW8A 2CXLA 4A56A 3K1SA 4HN9A 3JC6D 3FXDB 3ZSTA 3HXYA 4U2YA 3TEHB 4HFIA 4P0BA 5DQVA 5JRCB 5JTGA 2V6YB 2QGSA 1NYRA 4LNSA 3K3NA 3VR9A 2MOZA 5LBQB 3NENA 4P75C 4LVLA 2H3RA 3MK7C 4O4HE 3MEYA 4B6XA 2IC9A 2DXUA 3PUQA 3RKYA 4XU0A 3SWHA 5ABGA 2E5AA 1VOMA 1SETA 3C50A 2K3WA 2VVNA 1B7YA 2W00A 4PK4A 4TX5A 1YQ4A 3HXVA 2N9DA 3C64A 2AE9A 2KMFA 2CEAA 1USYC 1EFWA 3RIUA 4U33A 3H3AA 5LGUB 4H63V 5LA6E 2CPTA 4U74A 1WR6A 3A74A 4U3CA 2LHRA 4L87A 4B3TT 4LVMA 5LNKA 3FZHB 3HL6A 5ABEA 5JR9C 3SFEA 4FJOA 5TAOA 4K87A 3U78A 2PBIA 2EHOC 4EOZB 4MLKA 3V8KA 3KV4A 4ZZCA 4ISTA 5LGNB 3ZCIA 1FIOA 4YRTA 1VRBA 11ASA 4H9SE 5AQGB 1L0WA 2RHQB 1NENA 3RIAA 1ZEEA 2AMCA 1N9WA 2D0UA 2OLTA 4HWPA 4YRJA 2EJ9A 5L3EB 3Q5DA 4DR7T 1UX5A 1IJ6A 4I4TE 2C5JA 5FY7A 1G51A 3C4ZA 1ASZA 4WJ3M 4I55E 2ARSA 1E22A 4X66T 4EAHA 5AFUL 2MAWA 3L4GB 4EEBA 4H2XB 2W62A 2KSRA 5AQKB 2YKSA 4HWFA 4U72A 4DR3T 3UU5A 4EZHA 4DV6T 3ZT6A 1V9DA 4P73A 3EDUA 1QSDA 2PG8A 4LMKA 3ZYMA 1HG5A 5ABFB 1FJGT 4LMJA 4HKAA 3IG2A 5KXJA 1NYQA 2LRLA 3SS1A 2BKNA 4NXMT 4OHFA 3Q5WA 1UK5A 1LVKA 3FZLB 5AQIB 2DZ9A 1SE7A 4WZXA 5AQLB 1HTJF 2XHEB 2J3LA 2WAUA 2CXDA 2V5CA 2ZIOA 4AKGA 3I9YA 4CI3B 4EB6E 3P4PA 3I9WA 2VL8A 3HXUA 4LVIA 2HHHT 2JQ9A 4XEMA 4YDQA 2RHSA 5AQRB 5LXTE 1N34T 3AEDA 1G5HA 5FVLA 4IDNA 1KMNA 5FXWA 4AQFA 4MFRA 3EABA 4GOUA 2I0MA 3BK9A 3FZMB 4EX5A 2N1GA 4HVCA 4YFSA 5LHGB 5LP6E 3RIRA 3UTKA 2HH7A 3RX6A 4JI1T 2XQ4A 3RPUA 2KT9A 3L3PA 2JPFA 1JJCB 3PUZF 3CVRA 2IDOB 4YPFA 3O1HA 2RPAA 3AECA 3IF8B 4H9PC 5ADXL 4JUYA 4ILBA 4G63A 1VCTA 1D0ZA 2ZZFA 3R07A 4JYAT 2IIUA 1NJ2A 2G4CA 4AI6A 4U2ZA 3PURA 4HT4A 1WLEA 1IBLT 2XASB 5C2TA 3VU7H 4ZTUB 2DU7A 3F57A 4ZI7E 3N9OA 1IZNB 5HXHA 2ZIMA 4KX6A 3BQIA 1FEWA 3NZPA 5JVDE 3I1AA 3UUMA 5DABA 2X9HA 2XQ6A 2LKHA 1ZV4X 2SPCA 2BG9E 4DUYT 4Q6GA 3V7CA 2UUBT 4H9QC 1W0AA 2LSGA 2Q9QB 4P0AA 4KP3C 4LF7T 4NPPA 4UPAA 5J2TE 2UXBT 3H3MA 4LF5T 4BAYB 4HWRA 2I4OA 4LF9T 3AE1A 3J9X1 3KVAA 4HTEA 3A7RA 5FL1A 2W67A 2DWGA 1BIAA 3FBLA 4WW0A 2X0LB 1W0BA 4CXWA 1H4SA 2ODRC 3QNEA 1OEDE 3ETUA 5C3JA 4E7SA 3AE5A 1UUSA 4O2AE 3A5YA 5FP3A 2V5DA 4TV9E 5L3GB 5L47A 3KDSE 5F3JA 2WQYA 5LMNT 3C4XA 3VHLA 4XTZA 4DV3T 3P4SA 4H02A 2NP9A 2CIMA 5GONE 5HEGA 4DR2T 5FNVE 5IYZE 4IDQA 5EK4A 2J47A 4PK5A 2LSJA 3PDYA 5KDMC 4DV1T 4H9NC 1E1OA 1UURA 2KNDA 3CQGB 3C98B 1N33T 4IE4A 1NWMX 4PJLA 1OEDA 3KVBA 4UF0B 4UELA 4YRFA 3N2GE 3MF2A 3V7RA 3M65A 4P71A 4YHHT 4DV2T 1IBMT 5JR9B 4TNVA 2VK9A 4DV5T 3RKGA 4LFAT 4I43B 4TN7B 2EHOB 5L4EA 1YKHB 3L1AA 2XAQB 1HG2A 1SHZC 3ONLC 1B7TA 3UUNA 3IBPA 3ANWB 2CA5A 2PMEA 4BWAA 3L2ZA 2BS2A 2E41A 1KMMA 3RQUA 1WFDA 2BVMA 2VQFT 1QE0A 4YTMA 1QUUA 3LDQB 2CBIA 4XU2A 4P72C 2NTYA 3AAEB 3IKLA 2XM2A 2I59A 4ISSA 4TWDA 4A97A 4DVDA 4HFEA 4JI5T 5HCJA 3ICAA 3PJAA 5JH7E 2P9BA 5F5WA 4EV6A 4QX7B 4DIDB 2ZT7A 5CB4E 3VKHA 3PUSA 5FYMA 3FHNA 1W09A 3PUWF 2X0YA 3PUYF 3A31A 1QF6A 3PCOB 3AEGA 2XQ9A 4ZI3D 3ZT5A 2DL1A 2H7VC 4YROA 4O2DA 3IHRA 2JMHA 1Z7MA 4YREA 3O1IA 3DTOA 5AQMB 4EIWA 2QRXA 3AVRA 1X2GA 2E9XD 4I0UA 2VL0A 4H9OC 4PG3A 3R6NA 2J4GA 2V7KA 1WRDA 4IE0A 4YT0A 3TLTA 4TVYA 4YSZA 4WJ4A 2XM1A 4ZI2C 1B70B 4KMCA 3S4UA 3Q5EA 4H2WA 3E9HA 3RIUC 2JMKA 4PFOA 3NKZA 4ILAA 1PYSB 5AQFB 3T1HT 4H2SA 2VURA 4YCVA 2A2FX 2PJQA 4YTNA 2XQ5A 1NJ5A 1IJ5A 2YK0A 1ZHCA 1W9RA 2DWKA 4WYVA 3ZT7A 3NEMA 3LK42 4UP7A 3REXA 4X1KE 4YRIA 2LE8A 3LBXA 4A5XA 5AQNB 4PHCA 4TWAA 1ZOYA 4UVCB 4AISA 3OKQA 4E7ZA 4CZZB 4CXYA 3W3SA 2YN6A 1LKXA 2YU1A 4YY3T 1OXZA 3HRIA 2UXCT 3VQYA 5LJMA 4DV0T 2B76A 4EYUA 4O4LE 2M6BA 2WS3A 2V26A 1HF8A 3AXJA 4X62T 4H2TA 3EFSA 4K88A 5JDFA 4UR9A 2EJGA 2Y8DA 3CQXC 2ZZGA 1NJ8A 3UT5E 3RGLA 1WQ7A 4QKNA 1BR1A 4IL9A 4TVWA 3J7Yq 1J1JA 3RKXA 2LM9A 4YTPA 3GN5A 2NOXA 2WZHA 4CXXA 2CCQA 1Z0PA 1MIYA 2AKWB 4CS2A 3L4GA 3EHZA 3JADA 4PJJA 3N9MA 2XAJB 4DBRA 4PK6A 1NNHA 4AKRB 1C0AA 5LCYA 4YJ2E 3ZC0A 3RACA 4P73C 2JIWA 4IT4A 2ES0A 5J2UE 4YXDA 2ZT5A 4YRLA 5ABFA 2LT3A 2NW8A 1T98A 3HKDE 5JDHA 4IGUA 3CMLA 2AXDS 4PJMA 2E65A 4Z8XA 1BR4A 1HNWT 3ZMVB 3QK6A 1B76A 2H89A 4YRMA 2QHUA 4CH4A 4CH5A 2XSAA 2DQ3A 3HRKA 3IALA 3T1YT 3AA1B 2D0TA 3QB5A 2JRKA 4K0KT 1R8IA 5LMUT 2DKGA 2YU2A 4KHZF 3AE9A 4AQFC 2ZXFA 3HR0A 3ZLIA 3F31A 4TQFA 4DPGA 4JV5T 1Z7NA 2DTOA 4QXCB 1EQRA 1XMQT 4O8SA 4AIUA 3TLVA 3JAEA 2NWBA 4HFVA 2RP4A 4O4JE 2V8SV 5C8YE 4CH3A 3GWHA 1EZ3A 4GIWA 3AE2A 3LSVA 4LF4T 4I50E 4IREA 1JNRA 4FI5A 4JI6T 3BQLA 3VQVA 2NR4A 2L8KA 5J0ZA 4YCWA 4YLHA 2DU5A 3OBVE 3HFZB 4YRNA 3P8YA 4UXNB 1H4VB 2JJ9A 4BW9A 2FJDA 4IHJE 3GA8A 4P3PA 5C53B 4IE6A 3EVYA 3IA3A 3QB5K 1NJ1A 4JI3T 5L4HA 3MXZA 1XDOA 2XQ7A 4IIJE 3O4XE 2J1DG 2ZLYA 5IHYA 2WDVA 4KUMB 2C5IT 2MBGA 4EZ4A 3TLWA 5JREA 1T72A 2Y6XA 4HWOA 2WP9A 3KBUA 3WI3A 2A8EA 2XPKA 2E5LT 4UP9A 2WB5A 2KXPB 1XDPA 1G73A 3E22E 4YRGA 3CMQA 2V6XA 4YRCA 4ZTZB 3ZYLA 2Q9QA 3KV6A 3HY1A 2A3DA 4HWTA 1WLXA 4BJNA 3AVSA 3ZYKA 3OTOT 4GKKT 4YRPA 4E51A 2ZM6T 3KFWX 3CX6B 4HWSA 1UGOA 1HX8A 2W4XA 2BVLA 5J1GA 4TQDA 4YRKA 2WDRA 3RL6A 2VKOA 2E3CA 2BG9C 2IY5A 3HY0A 3P8TA 4YRSA 2L3LA 2Q9QD 4XZCA 2BBJA 1W66A 1UCUA 5HEOA 3T8OA 1M7KA 3P8VA 3OD1A 1E2AA 3O1JA 4ILUA 4CH6A 2A9UA 1CHUA 1WR0A 1NAFA 4X1YE 3PTRB 4TZ4C 4OK0A 1B7YB 1D1BA 2ODVA 3E9IA 2WWUA 2FYKA 2HN1A 2WY2A 3ABVA 4RQFA 3JAFA 2M67A 1OEDC 3ZEFB 5FMNA 3UQ4A 4TTVA 3LK2B 3CKDA 3RQWA 1U5PA 2H88A 4P71C 1AJ3A 5AQTB 1HR0T 1XNRT 5A1LA 2QYWA 4U31A 4ZIBA 4G2AA 5JR9A 3LSQA 3QNUA 5LHIB 4RQEA 4KR2A 1D0XA 3UUXB 1HNXT 5DJQC 3B5MA 5M4YA 1KOGA 2K24A 1GGMA 2WWVA 1OWAA 4ZZBA 1BR2A 1NJ6A 3HXZA 3ZMSB 2LKGA 4P1NA 2KINB 2UUCT 2Y48B 4J15A 3HA4A 3I7FA 2NTXA 2BS4A 4TVAB 4M1PA 2RA1A 3UUBA 3VRBA 5AQVB 3HKCE 2EHOD 3OVUA 5E0OA 4CS3A 2Q7EA 2WMOA 5KNNA 3RYCE 2BZBA 3RC8A 2LSKA 3NVOA 2MTQA 3PJAJ 4L9IA 2X51A 1T8BA 2IHR1 5AQSB 3SFDA 5HXSA 1E7PA 2ALYA 3FJPA 2ZT8A 1X56A 1HXDA 3ERRA 1MMDA 3RYFE 2N2NA 2EJFA 2CE7A 3PU3A 3I0OA 3UFEA 3MKDA 4KBMB 3TLUA 1J5WA 2HPLA 3OPCA 2E2AA 3NWIA 2ZR2A 2XQAA 4LMLA 3MZKB 3SOLA 2R6GF 4CN1A 2DNXA 3MACA 2XY8B 4P74A 2CHNA 2ZM0A 3IEEA 5JQGE 4IE5A 1IAPA 2ZMAA 2C5KT 4JI0T 1HFAA 3M4QA 3FZKB 3H37A 5AQHB 1LVFA 1EIYB 3C4WA 3R84B 2C0SA 3P4QA 12ASA 2CBJA 4HFDA 5LG3A 5K1XA 3O9XA 2FBWA 4WBOA 2RHSB 4GYRA 5LB7B 2K48A 3QTCA 2WCAA 4PNIA 5FXVA 3EI0A 5ABHA 1T7SA 5FXZA 2OV9A 3V7SA 4CQIA 4DMWA 3HFVA 2HPJA 2I4MA 3AEFA 2ZNIA 2LJLA 3A7MA 3V5UA 3A7UA 2CRBA 2L9QA 4HGAA 3SRZA 5AQOB 3OJAA 3N2KE 3AE8A 1FMWA 3A7AA 1HCIA 5KMGP 1YXRA 2J62A 3JC6C 3V8JA 4HA8A 4YRQA 2XQYA 3AEBA 5F8PA 4YJ3E 1SA0E 4ZEYA 2NW7A 2OA5A 3KINB 5CA1E 4OP0A 2XTIA 1QLBA 2E9XA 4YSYA 2JQKA 1G8XA 1S94A 4UP8A 3RRCA 3W15B 3HXWA 3PUAA 2F4VT 5IUXA 2KWHA 5AQPB 3ZSSA 3EFRA 4F6RC 2CJAA 3TEHA 2FUPA 3AEEA 4AKLA 2KLQA 5CGMA 1HNZT 5JRCA 2V6YA 3MQZA 3PE0A 2HNIA 4ANJA 2ZINA 4NIQA 3WQZA 5C51B 4P3OA 4LFBT 3PUGA 1LRZA 2ODUA 1U4QA 2CM0A 3M4PA 1E1TA 2WU5A 2V7LA 3QUJA 2BG9B 4KI0F 4AH6A 3ZJ1A 3AAIA 2VASA 1EVLA 2XGTA 1YW0A 2VQET 4NXNT 3RYHE 4NCXA 5HGQA 5H6QB 2ZZEA 1WYDA 3MA9A 2ZTGA 1UX4A 5C52B 1EVKA 4LF6T 2XAFB 3ZMUB 2ZT6A 3LC0A 2XZEA 3WAKA 4AKIA 4PFPA 1WU7A 2ODRD 2UUAT 3ZCJA 3AE4A 4DV4T 1KF6A 1OEDB 2EAYA 5CJ5A 5AQJB 2BKPA 3FB2A 2D5UA 3K3OA 4LFCT 2EWNA 2QA7A 5FY1A 5HEHA 4ZS2A 3RKOA 3E08A 4TWHA 2E5VA 1BBWA 3KFUA 2RHQA 3HFZA 5HEJA 3PUVF 3KV5A 2VB6A 4HFBA 2K9AA 4QH1A 2EL9A 4AKHA 3AAAB 3KV9A 4HFCA 4DR4T 4BJMA 4CI1B 3Q9DA 3P4RA 4JI4T 2CHOA 2D2SA 1L0VA 4CI2B 1N36T 5HAXA 2WBLA 5HXRA 1ADYA 1HTTA 4H2XA 3U3IA 2YDRA 2E10A 4UIGA 1DU2A 4KHPT 4ZXLA 1YGBA 3NZQA 1B8AA 3AA7B 4DR5T 4KQEA 5FXXA 3BJUA 3RC3A 4X20E 5EZYE 2I4NA 3RKWA 3V8LA 3CIRA 3N9QA 2ZM8A 5L3DB 3CX7B 3EUHA 4ADZA 3CK6A 2QVAA 1NEKA 2LSIA 3TUPA 4Z90A 2G0UA 4HWIB 4X5TA 5HWYA 5ELNA 4NUVA 1XZYA 1WPYA 4MALA 3ONJA 2DJZA 2DDZA 4Q15A 3UH0A 2PMFA 1MMNA 3Q5XA 5CFBA 1WQWA 4O4IE 3QOFA 3RIFA 5E3IA 1WNLA 2V7IA 2W0GA 2LEHA 2KZ7B 1YFRA 3AE3A 4LF8T 5HWXA 4YHJA 2V7JA 4XU1A 5HEUA 2XTLA 4DNDA 3JCFA 4O2BE 2BS3A 3UU6A 1WYCA 5FY0A 4YYEA 1O3XA 2LHNA 1YKEB 3ZMTB 3UULA 1HS7A 2LOPA 5BR8T 3WAJA 3AA0B 2DTIA 4PAGA 3OYXA 2ZGWA 4QXHB 2YOEA 4JI8T 3EDVA 1JJCA 1H4QA 1HX1B 2JQHA 3VRAA 2VKHA 1MIWA 5HXEA 3LBXB 4ZI2D 3A8YC 1KFYA 4F8HA 1KEYA 2P5IA 3P4WA 3VQWA 5BMVE 4BA9A 3V5SA 1ADJA 3PZCA 5JDQA 2JQQA 3AXJB 2BBHA 4QXBB 5FL0A 4EEDA 4TVAA 2X9WA 3E0ZA 2X66A 5LGTB 3DJBA 3K8PC 4EXTA 3P7IA 4HE8A 1MNEA 3D0TA 3TLSA 3LJCA 2IC6A 1BIBA 1VCSA 1RIQA 1D1AA 4EYYR 3GN5B 1FMVA 1IBKT 4DR1T 4OFZA 3EAMA 4IDOA 3TEGA 4JLEA 1YB3A 1Y64B 2W66A 2QHVA 2BKOA 3AB3B 2CWOA 2WZIA 3GMIA 1WYBA 2DQ0A 3HI2A 2X67A 4JI7T 3MJXA 2I4LA 3OYZA 2CWYA 2X9XA 3LK3B 2LM2A 2GK9A 4K86A 4G85A 4JBWF 1XMOT 3G06A 3A5ZA 3N5LA 3AEAA 4EO4A 5HCMA 2KWIB 3DP7A 3FBZA 3NRXA 1Z8UA 4P74C 2B1EA 2D9DA 4HFHA 3CX8B 4U7YA 3LFMA 2C8MA 4H2UA 3ZPOA 3IKMB 4P75A 4IL4A 4DO0A 2DCFA 3NRYA 4GK5E 2VWAA 5IWAT 1KNZA 3C51A 4XTWA 3ZN1B 2UXDT 3NELA 4QH4A 2I6HA 1EIYA 4UVBB 5FVKA 4X1IE 1USYA 4WNKA 5DQWA 3A32A 3B57A 4UF0A 4C90A 5HXCA 3FZFB 2PFVA 4RMFA 2BDEA 2Q7GA 3ETVA 3PV0F 2HN2A 4TWFA 1KNRA 1JNZA 4UVAB 3N9NA 3KBTA 5EK3A 4IE7A 1MNDA 4X5OA 5JDNA 2XQ8A 2EHOA 1YD8G 2X0HA 3UU8A 2DI4A 2Q5IA 4H63H 3RHWA 4X64T 4DMVA 3ANWA 2Q5HA 2WSSV 1US7B 2E64A 2IAKA 1D0YA 4ZI3C 3BQKA 3N9LA 1XNQT 3UFGA 4L5GA 2CLYC 4G84A 3N9PA 2AMCB 2IMLA 2J3MA 2FJBA 5LBMA 4COFA 2LSYA 4DV7T 4DUZT 1MMGA 2E9XC 4K0UA 2ARTA 1H4TA 3UU4A 4Z91A 2DTHA 3RUXA 4OYKA 3PCOA 3PU8A 4B3RT 2H7OA 4V1Av 1X54A 2M6IA 2ARUA 4J2CA 3DSQA 4WBNE 2C7IA 3QO8A 4H2YA 3QO7A 4RDXA 2W2UA 5L3BB 1BBUA 2WDQA 2CJ9A 3ZMZB 3NETA 1MMAA 3HXXA 5L3CB 3CPZA 5KX5E 3TKLB 3Q2MA 1LYLA 2A72A 4WF2A 2LOSA 4MHCA 4L0RA 4GKJT 4TNWA 3RLFF 1ATIA 3HKEE 2DHRA 2IY5B 3RH3A 2QHTA 1YFTA 4LVJA 2BG9A 1B70A 3UQ7A 3REUA 1X01A 2XUEA 1PYSA 2VVSA 2Z6EA 3NBXX 5CA0E 4QX8B 2LRKA 5AQUB 3PUXF 4GK0E 4P3NA 4WI1A 4IDPA 1VQZA 2ACXA 4CN4A 2W63A 4ERRA 2YDSA 3A5XA 4ILCA 4AQGA 1SRYA 2VKDA 4H9RC 5K1PA 3AE7A 4UV8B 2CGHA 3HTZA 4XTVA 1WCRA 4XTYA 4JEUB 1ZP0A 3BFMA 4TUYE 2V1DB 3ZN0B 5LG4A 4OX9T 2DEQA 5LHHB 4ASKA 3M3ZB 3AA6B 4JI2T 3QO5A 1XWMA 3VR8A 2DZCA 5L3FB 2XAHB 3VKGA 2K5BB 2YDQA 3L39A 4AXPA 2E1HA 4QH5A 2CMRA 2LLYA 1E24A 4DR6T 5ELOA 2P0LA 2WMNA 1X55A 1E1HB 3X1DA 2W61A 3HKBE 4DQ2A 2AKWA 2ZNJA 4C91A 4HWCA 2DVEA 3ZC1A 1KK7A 4XU3A 3ZJ2A 5LJNA 3CQCB 4XBFB 2FJAA 4H2VA 2XJ7A 5L2LA 4QHOA 4A98A 5JDLA 2V7MA 2NW9A 3B13A 4U7IA 3P50A 1D1CA 1M62A 2ACZA 3F2EA 2DXTA 3P8CD 2ALYB 2UXNB 4TV8E 2UU9T 4YCUA 4X65T 1I6ZA 1CUNA 3RI5A 1SESA 4HWHA 1YFSA 4GYSA 3AE6A 4CS4A 3UGQA 2X68A 4P09A 4UEMA 2IW5B 3I0QA 3LG7A 1N32T 3VBBA 1G5IA 3UGTA 4UV9B 3FXEB 4NUUA 3L09A 3VQXA 3ZKRA 1SERA 4QWNB 1J5ET 4ZHQE 1FYFA 2MPKA 4HWDA 2XSBA 4IDZA 5H6RB 3RYIE 2E8IA 2WM9A 3N2OA 4OLFA 4YRRA 1H7CA 1ZKEA 5EK2A 3ONXA 4ZOLE 4JEHB 5JDMA 3CWZB 2Q7HA 3ESLA 1X9BA 3RRWA 4HEAA 2YEVC 1BR0A 1ASYA 4LVKA 1X79A 4PJNA 4YSXA 1YQ3A 2FJEA 2MYSA 3QC9A 2WU2A 1Y01A 3UU3A 2UXXB 1I94T 3LSSA 2CXFA 1S35A 2DLRA 2ZCEA 4ZS3A 1KNPA 2X9YA 5ETWA 4KR3A 1MIVA
chains in the Genus database with same CATH topology
2PMEA 1ADJA 4BWAA 1HC7A 3L2ZA 4XTUA 2E41A 1KMMA 4J15A 3PZCA 3I7FA 4XEOA 1QE0A 3G1ZA 4TVAA 2NS6A 4TVAB 4XU2A 2QHSA 4P72C 1X2HA 4XTXA 3MF1A 3IKLA 4P72A 1BIBA 4CS3A 1RIQA 3ICAA 1EOVA 2Q7EA 5KNNA 5F5WA 1IL2A 2ZT7A 3TEGA 1YB3A 2QHVA 4YP0A 3A31A 2DQ0A 2ALYA 3RF1A 3FJPA 1QF6A 3PCOB 2CJBA 2ZR3A 2I4LA 2ZT8A 1X56A 1HXDA 3ERRA 4YROA 4K86A 2EJFA 3HXYA 4G85A 4O2DA 1Z7MA 3TEHB 3A5ZA 4YREA 4EO4A 1J5WA 4LNSA 1NYRA 2ZR2A 4P74C 1X2GA 3NENA 4P75C 2C8MA 4LVLA 4H2UA 3MEYA 3IKMB 4P74A 4PG3A 4P75A 2DXUA 3RKYA 4XU0A 3M4QA 4TVYA 2E5AA 4XTWA 1SETA 4WJ4A 1B7YA 3NELA 1EIYA 1EIYB 1B70B 3HXVA 4H2WA 1EFWA 1USYC 3E9HA 1USYA 1PYSB 12ASA 3A32A 4H2SA 5K1XA 2RHSB 4YCVA 3A74A 3QTCA 4L87A 1NJ5A 4LVMA 4RMFA 2Q7GA 3NEMA 4UP7A 3REXA 3V7SA 4K87A 3HFVA 4YRIA 2I4MA 2ZNIA 4X5OA 4PHCA 4TWAA 3A7UA 3V8KA 2Q5IA 3W3SA 3VQYA 3HRIA 2Q5HA 4YRTA 11ASA 3A7AA 2E64A 1L0WA 2RHQB 4H2TA 3V8JA 3UFGA 3EFSA 4G84A 4K88A 4HA8A 2AMCA 2AMCB 4YRQA 2EJGA 1N9WA 2ZZGA 1NJ8A 4HWPA 2J3MA 4YRJA 3RGLA 1WQ7A 2EJ9A 4TVWA 3RKXA 4OP0A 2XTIA 2ARTA 1G51A 1H4TA 1ASZA 4WJ3M 2ARSA 1E22A 2AKWB 4CS2A 3L4GA 3L4GB 4UP8A 2DTHA 3RUXA 3PCOA 4H2XB 1NNHA 1C0AA 3HXWA 3RACA 1X54A 4P73C 2ARUA 3DSQA 3QO8A 2C7IA 3EFRA 4H2YA 3QO7A 2CJAA 3TEHA 4RDXA 4P73A 2ZT5A 1BBUA 4YRLA 3MQZA 2CJ9A 3IG2A 2HNIA 1NYQA 3NETA 3HXXA 2ZINA 1LYLA 3WQZA 2E65A 5C51B 4P3OA 2DZ9A 4WF2A 1B76A 1ATIA 4YRMA 2IY5B 3M4PA 2QHUA 1E1TA 2J3LA 2QHTA 1YFTA 4CH4A 4LVJA 4CH5A 1B70A 4AH6A 3REUA 1X01A 2DQ3A 2ZIOA 3HRKA 1EVLA 3IALA 2XGTA 4NCXA 5HGQA 3HXUA 4LVIA 1PYSA 2ZZEA 1WYDA 4XEMA 4YDQA 2DKGA 4P3NA 2RHSA 4WI1A 2ZTGA 1VQZA 5C52B 1EVKA 1G5HA 2ZXFA 1KMNA 4DPGA 4TQFA 2ZT6A 1SRYA 1Z7NA 3LC0A 2DTOA 5K1PA 2CGHA 3HTZA 1EQRA 4XTVA 4XTYA 4EX5A 4HVCA 1WU7A 2ODRD 3RIRA 4CH3A 3BFMA 2EAYA 2DEQA 2EWNA 3VQVA 1JJCB 4YPFA 3QO5A 1BBWA 4YCWA 3KFUA 2DU5A 2RHQA 3HFZA 2DZCA 3HFZB 4YRNA 3P8YA 1H4VB 2ZZFA 3R07A 4BW9A 2EL9A 4P3PA 5C53B 2G4CA 1NJ2A 1NJ1A 2E1HA 4HT4A 1E24A 1WLEA 5ELOA 2P0LA 4ZTUB 1X55A 2DU7A 4DQ2A 2ZIMA 4HWOA 2AKWA 2ZNJA 1ADYA 2A8EA 2DVEA 1HTTA 4UP9A 4XU3A 4H2XA 2E10A 4H2VA 4Q6GA 4YRGA 3CMQA 1YGBA 3V7CA 4YRCA 4ZTZB 3HY1A 1B8AA 4HWTA 4KQEA 4UPAA 3BJUA 2I4NA 4YRPA 3RKWA 3V8LA 2DXTA 4E51A 4HWRA 2ALYB 4HWSA 4YCUA 2I4OA 4TQDA 3A7RA 1SESA 1YFSA 3TUPA 4YRKA 5ELNA 1BIAA 3RL6A 4CS4A 3UGQA 2E3CA 2IY5A 3HY0A 3P8TA 4YRSA 1H4SA 2ODRC 1WPYA 3QNEA 2DJZA 2DDZA 4Q15A 1W66A 3UH0A 2PMFA 3A5YA 3VBBA 1G5IA 3P8VA 3UGTA 3OD1A 1WQWA 4CH6A 5E3IA 4XTZA 1WNLA 3VQXA 1SERA 4H02A 2CIMA 1YFRA 1FYFA 1B7YB 3E9IA 2FYKA 4OLFA 4YRRA 4XU1A 4RQFA 1E1OA 4YYEA 4TTVA 2Q7HA 2DTIA 4P71C 4YRFA 3MF2A 3V7RA 1ASYA 4LVKA 2ZGWA 4P71A 1JJCA 1H4QA 4ZIBA 3LSQA 4KR2A 4RQEA 1KOGA 3LSSA 1GGMA 3L1AA 2P5IA 2ZCEA 1NJ6A 3HXZA 4KR3A 3VQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PME A;  1ADJ A;  4BWA A;  1HC7 A;  3L2Z A;  4XTU A;  2E41 A;  1KMM A;  4J15 A;  3PZC A;  3I7F A;  4XEO A;  1QE0 A;  3G1Z A;  4TVA A;  4TVA B;  4XU2 A;  2QHS A;  4P72 C;  1X2H A;  4XTX A;  3MF1 A;  3IKL A;  4P72 A;  1BIB A;  4CS3 A;  1RIQ A;  3ICA A;  1EOV A;  2Q7E A;  5KNN A;  5F5W A;  1IL2 A;  2ZT7 A;  3TEG A;  1YB3 A;  2QHV A;  4YP0 A;  3A31 A;  2DQ0 A;  2ALY A;  3RF1 A;  3FJP A;  1QF6 A;  3PCO B;  2CJB A;  2ZR3 A;  2I4L A;  2ZT8 A;  1X56 A;  1HXD A;  3ERR A;  4YRO A;  4K86 A;  2EJF A;  3HXY A;  4G85 A;  4O2D A;  1Z7M A;  3TEH B;  3A5Z A;  4YRE A;  4EO4 A;  1J5W A;  4LNS A;  1NYR A;  2ZR2 A;  4P74 C;  1X2G A;  3NEN A;  4P75 C;  2C8M A;  4H2U A;  3MEY A;  3IKM B;  4P74 A;  4PG3 A;  4P75 A;  2DXU A;  3RKY A;  4XU0 A;  3M4Q A;  4TVY A;  2E5A A;  4XTW A;  1SET A;  4WJ4 A;  1B7Y A;  3NEL A;  1EIY A;  1EIY B;  1B70 B;  3HXV A;  4H2W A;  1EFW A;  1USY C;  3E9H A;  1USY A;  1PYS B;  12AS A;  3A32 A;  4H2S A;  5K1X A;  2RHS B;  4YCV A;  3A74 A;  3QTC A;  4L87 A;  1NJ5 A;  4RMF A;  2Q7G A;  3NEM A;  4UP7 A;  3REX A;  3V7S A;  4K87 A;  3HFV A;  4YRI A;  2I4M A;  2ZNI A;  4X5O A;  4PHC A;  4TWA A;  3A7U A;  3V8K A;  2Q5I A;  3W3S A;  3VQY A;  3HRI A;  2Q5H A;  4YRT A;  11AS A;  3A7A A;  2E64 A;  1L0W A;  2RHQ B;  4H2T A;  3V8J A;  3UFG A;  3EFS A;  4G84 A;  4K88 A;  4HA8 A;  2AMC A;  2AMC B;  4YRQ A;  2EJG A;  1N9W A;  2ZZG A;  1NJ8 A;  4HWP A;  2J3M A;  4YRJ A;  3RGL A;  1WQ7 A;  2EJ9 A;  4TVW A;  3RKX A;  4OP0 A;  2XTI A;  2ART A;  1G51 A;  1H4T A;  1ASZ A;  4WJ3 M;  2ARS A;  1E22 A;  2AKW B;  4CS2 A;  3L4G A;  3L4G B;  4UP8 A;  2DTH A;  3RUX A;  3PCO A;  4H2X B;  1NNH A;  1C0A A;  3HXW A;  3RAC A;  1X54 A;  4P73 C;  2ARU A;  3DSQ A;  3QO8 A;  2C7I A;  3EFR A;  4H2Y A;  3QO7 A;  2CJA A;  3TEH A;  4RDX A;  4P73 A;  2ZT5 A;  1BBU A;  4YRL A;  2CJ9 A;  3IG2 A;  2HNI A;  1NYQ A;  3NET A;  3HXX A;  2ZIN A;  1LYL A;  3WQZ A;  2E65 A;  5C51 B;  4P3O A;  2DZ9 A;  4WF2 A;  1B76 A;  1ATI A;  4YRM A;  2IY5 B;  3M4P A;  2QHU A;  1E1T A;  2J3L A;  2QHT A;  1YFT A;  4CH4 A;  4CH5 A;  1B70 A;  4AH6 A;  3REU A;  1X01 A;  2DQ3 A;  2ZIO A;  3HRK A;  1EVL A;  3IAL A;  2XGT A;  4NCX A;  5HGQ A;  3HXU A;  1PYS A;  2ZZE A;  1WYD A;  4XEM A;  4YDQ A;  2DKG A;  4P3N A;  2RHS A;  4WI1 A;  2ZTG A;  1VQZ A;  5C52 B;  1EVK A;  1G5H A;  2ZXF A;  1KMN A;  4DPG A;  4TQF A;  2ZT6 A;  1SRY A;  1Z7N A;  3LC0 A;  2DTO A;  5K1P A;  2CGH A;  3HTZ A;  1EQR A;  4XTV A;  4XTY A;  4EX5 A;  4HVC A;  1WU7 A;  2ODR D;  3RIR A;  4CH3 A;  3BFM A;  2EAY A;  2DEQ A;  2EWN A;  3VQV A;  1JJC B;  4YPF A;  3QO5 A;  1BBW A;  4YCW A;  3KFU A;  2DU5 A;  2RHQ A;  3HFZ A;  2DZC A;  3HFZ B;  4YRN A;  3P8Y A;  1H4V B;  2ZZF A;  3R07 A;  4BW9 A;  2EL9 A;  4P3P A;  5C53 B;  2G4C A;  1NJ2 A;  1NJ1 A;  2E1H A;  1E24 A;  1WLE A;  5ELO A;  2P0L A;  4ZTU B;  1X55 A;  2DU7 A;  4DQ2 A;  2ZIM A;  4HWO A;  2AKW A;  2ZNJ A;  1ADY A;  2DVE A;  1HTT A;  4UP9 A;  4XU3 A;  4H2X A;  2E10 A;  4H2V A;  4Q6G A;  4YRG A;  3CMQ A;  1YGB A;  3V7C A;  4YRC A;  4ZTZ B;  3HY1 A;  1B8A A;  4HWT A;  4KQE A;  4UPA A;  3BJU A;  2I4N A;  4YRP A;  3RKW A;  3V8L A;  2DXT A;  4E51 A;  4HWR A;  2ALY B;  4HWS A;  4YCU A;  2I4O A;  4TQD A;  3A7R A;  1SES A;  1YFS A;  3TUP A;  4YRK A;  5ELN A;  1BIA A;  3RL6 A;  4CS4 A;  3UGQ A;  2E3C A;  2IY5 A;  3HY0 A;  3P8T A;  4YRS A;  1H4S A;  2ODR C;  1WPY A;  3QNE A;  2DJZ A;  2DDZ A;  4Q15 A;  1W66 A;  3UH0 A;  2PMF A;  3A5Y A;  3VBB A;  1G5I A;  3P8V A;  3UGT A;  3OD1 A;  1WQW A;  4CH6 A;  5E3I A;  4XTZ A;  1WNL A;  3VQX A;  1SER A;  4H02 A;  2CIM A;  1YFR A;  1FYF A;  1B7Y B;  3E9I A;  2FYK A;  4OLF A;  4YRR A;  4XU1 A;  4RQF A;  1E1O A;  4YYE A;  4TTV A;  2Q7H A;  2DTI A;  4P71 C;  4YRF A;  3MF2 A;  3V7R A;  1ASY A;  2ZGW A;  4P71 A;  1JJC A;  1H4Q A;  4ZIB A;  3LSQ A;  4KR2 A;  4RQE A;  1KOG A;  3LSS A;  1GGM A;  3L1A A;  2P5I A;  2ZCE A;  1NJ6 A;  3HXZ A;  4KR3 A;  3VQW A; 
#chains in the Genus database with same CATH topology
 4N78 D;  1HC7 A;  4XTU A;  4CN6 A;  4XEO A;  5JDG A;  2VKJ A;  4AQY T;  3G1Z A;  2NS6 A;  2QHS A;  4OYJ A;  1X2H A;  5HYA A;  4XTX A;  3MF1 A;  1GQE A;  5AQQ B;  2ZM2 A;  2CLY B;  4P72 A;  4B3S T;  2YIN A;  4MBQ A;  2XAG B;  2Q9Q C;  1EOV A;  5FKY A;  4B3M T;  1IL2 A;  4DBQ A;  5LYJ E;  3L8R A;  3K3Q C;  2XQ3 A;  2E9X B;  2PTF A;  4XAX B;  4YP0 A;  4EGW A;  2IUB A;  3RF1 A;  5LOV E;  2CJB A;  4Q25 A;  2ZR3 A;  1SUM B;  4PW8 A;  2CXL A;  4A56 A;  3K1S A;  4HN9 A;  3JC6 D;  3FXD B;  3ZST A;  3HXY A;  4U2Y A;  3TEH B;  4HFI A;  4P0B A;  5DQV A;  5JRC B;  5JTG A;  2V6Y B;  2QGS A;  1NYR A;  4LNS A;  3K3N A;  3VR9 A;  2MOZ A;  5LBQ B;  3NEN A;  4P75 C;  4LVL A;  2H3R A;  3MK7 C;  4O4H E;  3MEY A;  4B6X A;  2IC9 A;  2DXU A;  3PUQ A;  3RKY A;  4XU0 A;  3SWH A;  5ABG A;  2E5A A;  1VOM A;  1SET A;  3C50 A;  2K3W A;  2VVN A;  1B7Y A;  2W00 A;  4PK4 A;  4TX5 A;  1YQ4 A;  3HXV A;  2N9D A;  3C64 A;  2AE9 A;  2KMF A;  2CEA A;  1USY C;  1EFW A;  3RIU A;  4U33 A;  3H3A A;  5LGU B;  4H63 V;  5LA6 E;  2CPT A;  4U74 A;  1WR6 A;  3A74 A;  4U3C A;  2LHR A;  4L87 A;  4B3T T;  4LVM A;  5LNK A;  3FZH B;  3HL6 A;  5ABE A;  5JR9 C;  3SFE A;  4FJO A;  5TAO A;  4K87 A;  3U78 A;  2PBI A;  2EHO C;  4EOZ B;  4MLK A;  3V8K A;  3KV4 A;  4ZZC A;  4IST A;  5LGN B;  3ZCI A;  1FIO A;  4YRT A;  1VRB A;  11AS A;  4H9S E;  5AQG B;  1L0W A;  2RHQ B;  1NEN A;  3RIA A;  1ZEE A;  2AMC A;  1N9W A;  2D0U A;  2OLT A;  4HWP A;  4YRJ A;  2EJ9 A;  5L3E B;  3Q5D A;  4DR7 T;  1UX5 A;  1IJ6 A;  4I4T E;  2C5J A;  5FY7 A;  1G51 A;  3C4Z A;  1ASZ A;  4WJ3 M;  4I55 E;  2ARS A;  1E22 A;  4X66 T;  4EAH A;  5AFU L;  2MAW A;  3L4G B;  4EEB A;  4H2X B;  2W62 A;  2KSR A;  5AQK B;  2YKS A;  4HWF A;  4U72 A;  4DR3 T;  3UU5 A;  4EZH A;  4DV6 T;  3ZT6 A;  1V9D A;  4P73 A;  3EDU A;  1QSD A;  2PG8 A;  4LMK A;  3ZYM A;  1HG5 A;  5ABF B;  1FJG T;  4LMJ A;  4HKA A;  3IG2 A;  5KXJ A;  1NYQ A;  2LRL A;  3SS1 A;  2BKN A;  4NXM T;  4OHF A;  3Q5W A;  1UK5 A;  1LVK A;  3FZL B;  5AQI B;  2DZ9 A;  1SE7 A;  4WZX A;  5AQL B;  1HTJ F;  2XHE B;  2J3L A;  2WAU A;  2CXD A;  2V5C A;  2ZIO A;  4AKG A;  3I9Y A;  4CI3 B;  4EB6 E;  3P4P A;  3I9W A;  2VL8 A;  3HXU A;  4LVI A;  2HHH T;  2JQ9 A;  4XEM A;  4YDQ A;  2RHS A;  5AQR B;  5LXT E;  1N34 T;  3AED A;  1G5H A;  5FVL A;  4IDN A;  1KMN A;  5FXW A;  4AQF A;  4MFR A;  3EAB A;  4GOU A;  2I0M A;  3BK9 A;  3FZM B;  4EX5 A;  2N1G A;  4HVC A;  4YFS A;  5LHG B;  5LP6 E;  3RIR A;  3UTK A;  2HH7 A;  3RX6 A;  4JI1 T;  2XQ4 A;  3RPU A;  2KT9 A;  3L3P A;  2JPF A;  1JJC B;  3PUZ F;  3CVR A;  2IDO B;  4YPF A;  3O1H A;  2RPA A;  3AEC A;  3IF8 B;  4H9P C;  5ADX L;  4JUY A;  4ILB A;  4G63 A;  1VCT A;  1D0Z A;  2ZZF A;  3R07 A;  4JYA T;  2IIU A;  1NJ2 A;  2G4C A;  4AI6 A;  4U2Z A;  3PUR A;  4HT4 A;  1WLE A;  1IBL T;  2XAS B;  5C2T A;  3VU7 H;  4ZTU B;  2DU7 A;  3F57 A;  4ZI7 E;  3N9O A;  1IZN B;  5HXH A;  2ZIM A;  4KX6 A;  3BQI A;  1FEW A;  3NZP A;  5JVD E;  3I1A A;  3UUM A;  5DAB A;  2X9H A;  2XQ6 A;  2LKH A;  1ZV4 X;  2SPC A;  2BG9 E;  4DUY T;  4Q6G A;  3V7C A;  2UUB T;  4H9Q C;  1W0A A;  2LSG A;  2Q9Q B;  4P0A A;  4KP3 C;  4LF7 T;  4NPP A;  4UPA A;  5J2T E;  2UXB T;  3H3M A;  4LF5 T;  4BAY B;  4HWR A;  2I4O A;  4LF9 T;  3AE1 A;  3J9X 1;  3KVA A;  4HTE A;  3A7R A;  5FL1 A;  2W67 A;  2DWG A;  1BIA A;  3FBL A;  4WW0 A;  2X0L B;  1W0B A;  4CXW A;  1H4S A;  2ODR C;  3QNE A;  1OED E;  3ETU A;  5C3J A;  4E7S A;  3AE5 A;  1UUS A;  4O2A E;  3A5Y A;  5FP3 A;  2V5D A;  4TV9 E;  5L3G B;  5L47 A;  3KDS E;  5F3J A;  2WQY A;  5LMN T;  3C4X A;  3VHL A;  4XTZ A;  4DV3 T;  3P4S A;  4H02 A;  2NP9 A;  2CIM A;  5GON E;  5HEG A;  4DR2 T;  5FNV E;  5IYZ E;  4IDQ A;  5EK4 A;  2J47 A;  4PK5 A;  2LSJ A;  3PDY A;  5KDM C;  4DV1 T;  4H9N C;  1E1O A;  1UUR A;  2KND A;  3CQG B;  3C98 B;  1N33 T;  4IE4 A;  1NWM X;  4PJL A;  1OED A;  3KVB A;  4UF0 B;  4UEL A;  4YRF A;  3N2G E;  3MF2 A;  3V7R A;  3M65 A;  4P71 A;  4YHH T;  4DV2 T;  1IBM T;  5JR9 B;  4TNV A;  2VK9 A;  4DV5 T;  3RKG A;  4LFA T;  4I43 B;  4TN7 B;  2EHO B;  5L4E A;  1YKH B;  3L1A A;  2XAQ B;  1HG2 A;  1SHZ C;  3ONL C;  1B7T A;  3UUN A;  3IBP A;  3ANW B;  2CA5 A;  2PME A;  4BWA A;  3L2Z A;  2BS2 A;  2E41 A;  1KMM A;  3RQU A;  1WFD A;  2BVM A;  2VQF T;  1QE0 A;  4YTM A;  1QUU A;  3LDQ B;  2CBI A;  4XU2 A;  4P72 C;  2NTY A;  3AAE B;  3IKL A;  2XM2 A;  2I59 A;  4ISS A;  4TWD A;  4A97 A;  4DVD A;  4HFE A;  4JI5 T;  5HCJ A;  3ICA A;  3PJA A;  5JH7 E;  2P9B A;  5F5W A;  4EV6 A;  4QX7 B;  4DID B;  2ZT7 A;  5CB4 E;  3VKH A;  3PUS A;  5FYM A;  3FHN A;  1W09 A;  3PUW F;  2X0Y A;  3PUY F;  3A31 A;  1QF6 A;  3PCO B;  3AEG A;  2XQ9 A;  4ZI3 D;  3ZT5 A;  2DL1 A;  2H7V C;  4YRO A;  4O2D A;  3IHR A;  2JMH A;  1Z7M A;  4YRE A;  3O1I A;  3DTO A;  5AQM B;  4EIW A;  2QRX A;  3AVR A;  1X2G A;  2E9X D;  4I0U A;  2VL0 A;  4H9O C;  4PG3 A;  3R6N A;  2J4G A;  2V7K A;  1WRD A;  4IE0 A;  4YT0 A;  3TLT A;  4TVY A;  4YSZ A;  4WJ4 A;  2XM1 A;  4ZI2 C;  1B70 B;  4KMC A;  3S4U A;  3Q5E A;  4H2W A;  3E9H A;  3RIU C;  2JMK A;  4PFO A;  3NKZ A;  4ILA A;  1PYS B;  5AQF B;  3T1H T;  4H2S A;  2VUR A;  4YCV A;  2A2F X;  2PJQ A;  4YTN A;  2XQ5 A;  1NJ5 A;  1IJ5 A;  2YK0 A;  1ZHC A;  1W9R A;  2DWK A;  4WYV A;  3ZT7 A;  3NEM A;  3LK4 2;  4UP7 A;  3REX A;  4X1K E;  4YRI A;  2LE8 A;  3LBX A;  4A5X A;  5AQN B;  4PHC A;  4TWA A;  1ZOY A;  4UVC B;  4AIS A;  3OKQ A;  4E7Z A;  4CZZ B;  4CXY A;  3W3S A;  2YN6 A;  1LKX A;  2YU1 A;  4YY3 T;  1OXZ A;  3HRI A;  2UXC T;  3VQY A;  5LJM A;  4DV0 T;  2B76 A;  4EYU A;  4O4L E;  2M6B A;  2WS3 A;  2V26 A;  1HF8 A;  3AXJ A;  4X62 T;  4H2T A;  3EFS A;  4K88 A;  5JDF A;  4UR9 A;  2EJG A;  2Y8D A;  3CQX C;  2ZZG A;  1NJ8 A;  3UT5 E;  3RGL A;  1WQ7 A;  4QKN A;  1BR1 A;  4IL9 A;  4TVW A;  3J7Y q;  1J1J A;  3RKX A;  2LM9 A;  4YTP A;  3GN5 A;  2NOX A;  2WZH A;  4CXX A;  2CCQ A;  1Z0P A;  1MIY A;  2AKW B;  4CS2 A;  3L4G A;  3EHZ A;  3JAD A;  4PJJ A;  3N9M A;  2XAJ B;  4DBR A;  4PK6 A;  1NNH A;  4AKR B;  1C0A A;  5LCY A;  4YJ2 E;  3ZC0 A;  3RAC A;  4P73 C;  2JIW A;  4IT4 A;  2ES0 A;  5J2U E;  4YXD A;  2ZT5 A;  4YRL A;  5ABF A;  2LT3 A;  2NW8 A;  1T98 A;  3HKD E;  5JDH A;  4IGU A;  3CML A;  2AXD S;  4PJM A;  2E65 A;  4Z8X A;  1BR4 A;  1HNW T;  3ZMV B;  3QK6 A;  1B76 A;  2H89 A;  4YRM A;  2QHU A;  4CH4 A;  4CH5 A;  2XSA A;  2DQ3 A;  3HRK A;  3IAL A;  3T1Y T;  3AA1 B;  2D0T A;  3QB5 A;  2JRK A;  4K0K T;  1R8I A;  5LMU T;  2DKG A;  2YU2 A;  4KHZ F;  3AE9 A;  4AQF C;  2ZXF A;  3HR0 A;  3ZLI A;  3F31 A;  4TQF A;  4DPG A;  4JV5 T;  1Z7N A;  2DTO A;  4QXC B;  1EQR A;  1XMQ T;  4O8S A;  4AIU A;  3TLV A;  3JAE A;  2NWB A;  4HFV A;  2RP4 A;  4O4J E;  2V8S V;  5C8Y E;  4CH3 A;  3GWH A;  1EZ3 A;  4GIW A;  3AE2 A;  3LSV A;  4LF4 T;  4I50 E;  4IRE A;  1JNR A;  4FI5 A;  4JI6 T;  3BQL A;  3VQV A;  2NR4 A;  2L8K A;  5J0Z A;  4YCW A;  4YLH A;  2DU5 A;  3OBV E;  3HFZ B;  4YRN A;  3P8Y A;  4UXN B;  1H4V B;  2JJ9 A;  4BW9 A;  2FJD A;  4IHJ E;  3GA8 A;  4P3P A;  5C53 B;  4IE6 A;  3EVY A;  3IA3 A;  3QB5 K;  1NJ1 A;  4JI3 T;  5L4H A;  3MXZ A;  1XDO A;  2XQ7 A;  4IIJ E;  3O4X E;  2J1D G;  2ZLY A;  5IHY A;  2WDV A;  4KUM B;  2C5I T;  2MBG A;  4EZ4 A;  3TLW A;  5JRE A;  1T72 A;  2Y6X A;  4HWO A;  2WP9 A;  3KBU A;  3WI3 A;  2A8E A;  2XPK A;  2E5L T;  4UP9 A;  2WB5 A;  2KXP B;  1XDP A;  1G73 A;  3E22 E;  4YRG A;  3CMQ A;  2V6X A;  4YRC A;  4ZTZ B;  3ZYL A;  2Q9Q A;  3KV6 A;  3HY1 A;  2A3D A;  4HWT A;  1WLX A;  4BJN A;  3AVS A;  3ZYK A;  3OTO T;  4GKK T;  4YRP A;  4E51 A;  2ZM6 T;  3KFW X;  3CX6 B;  4HWS A;  1UGO A;  1HX8 A;  2W4X A;  2BVL A;  5J1G A;  4TQD A;  4YRK A;  2WDR A;  3RL6 A;  2VKO A;  2E3C A;  2BG9 C;  2IY5 A;  3HY0 A;  3P8T A;  4YRS A;  2L3L A;  2Q9Q D;  4XZC A;  2BBJ A;  1W66 A;  1UCU A;  5HEO A;  3T8O A;  1M7K A;  3P8V A;  3OD1 A;  1E2A A;  3O1J A;  4ILU A;  4CH6 A;  2A9U A;  1CHU A;  1WR0 A;  1NAF A;  4X1Y E;  3PTR B;  4TZ4 C;  4OK0 A;  1B7Y B;  1D1B A;  2ODV A;  3E9I A;  2WWU A;  2FYK A;  2HN1 A;  2WY2 A;  3ABV A;  4RQF A;  3JAF A;  2M67 A;  1OED C;  3ZEF B;  5FMN A;  3UQ4 A;  4TTV A;  3LK2 B;  3CKD A;  3RQW A;  1U5P A;  2H88 A;  4P71 C;  1AJ3 A;  5AQT B;  1HR0 T;  1XNR T;  5A1L A;  2QYW A;  4U31 A;  4ZIB A;  4G2A A;  5JR9 A;  3LSQ A;  3QNU A;  5LHI B;  4RQE A;  4KR2 A;  1D0X A;  3UUX B;  1HNX T;  5DJQ C;  3B5M A;  5M4Y A;  1KOG A;  2K24 A;  1GGM A;  2WWV A;  1OWA A;  4ZZB A;  1BR2 A;  1NJ6 A;  3HXZ A;  3ZMS B;  2LKG A;  4P1N A;  2KIN B;  2UUC T;  2Y48 B;  4J15 A;  3HA4 A;  3I7F A;  2NTX A;  2BS4 A;  4TVA B;  4M1P A;  2RA1 A;  3UUB A;  3VRB A;  5AQV B;  3HKC E;  2EHO D;  3OVU A;  5E0O A;  4CS3 A;  2Q7E A;  2WMO A;  5KNN A;  3RYC E;  2BZB A;  3RC8 A;  2LSK A;  3NVO A;  2MTQ A;  3PJA J;  4L9I A;  2X51 A;  1T8B A;  2IHR 1;  5AQS B;  3SFD A;  5HXS A;  1E7P A;  2ALY A;  3FJP A;  2ZT8 A;  1X56 A;  1HXD A;  3ERR A;  1MMD A;  3RYF E;  2N2N A;  2EJF A;  2CE7 A;  3PU3 A;  3I0O A;  3UFE A;  3MKD A;  4KBM B;  3TLU A;  1J5W A;  2HPL A;  3OPC A;  2E2A A;  3NWI A;  2ZR2 A;  2XQA A;  4LML A;  3MZK B;  3SOL A;  2R6G F;  4CN1 A;  2DNX A;  3MAC A;  2XY8 B;  4P74 A;  2CHN A;  2ZM0 A;  3IEE A;  5JQG E;  4IE5 A;  1IAP A;  2ZMA A;  2C5K T;  4JI0 T;  1HFA A;  3M4Q A;  3FZK B;  3H37 A;  5AQH B;  1LVF A;  1EIY B;  3C4W A;  3R84 B;  2C0S A;  3P4Q A;  12AS A;  2CBJ A;  4HFD A;  5LG3 A;  5K1X A;  3O9X A;  2FBW A;  4WBO A;  2RHS B;  4GYR A;  5LB7 B;  2K48 A;  3QTC A;  2WCA A;  4PNI A;  5FXV A;  3EI0 A;  5ABH A;  1T7S A;  5FXZ A;  2OV9 A;  3V7S A;  4CQI A;  4DMW A;  3HFV A;  2HPJ A;  2I4M A;  3AEF A;  2ZNI A;  2LJL A;  3A7M A;  3V5U A;  3A7U A;  2CRB A;  2L9Q A;  4HGA A;  3SRZ A;  5AQO B;  3OJA A;  3N2K E;  3AE8 A;  1FMW A;  3A7A A;  1HCI A;  5KMG P;  1YXR A;  2J62 A;  3JC6 C;  3V8J A;  4HA8 A;  4YRQ A;  2XQY A;  3AEB A;  5F8P A;  4YJ3 E;  1SA0 E;  4ZEY A;  2NW7 A;  2OA5 A;  3KIN B;  5CA1 E;  4OP0 A;  2XTI A;  1QLB A;  2E9X A;  4YSY A;  2JQK A;  1G8X A;  1S94 A;  4UP8 A;  3RRC A;  3W15 B;  3HXW A;  3PUA A;  2F4V T;  5IUX A;  2KWH A;  5AQP B;  3ZSS A;  3EFR A;  4F6R C;  2CJA A;  3TEH A;  2FUP A;  3AEE A;  4AKL A;  2KLQ A;  5CGM A;  1HNZ T;  5JRC A;  2V6Y A;  3MQZ A;  3PE0 A;  2HNI A;  4ANJ A;  2ZIN A;  4NIQ A;  3WQZ A;  5C51 B;  4P3O A;  4LFB T;  3PUG A;  1LRZ A;  2ODU A;  1U4Q A;  2CM0 A;  3M4P A;  1E1T A;  2WU5 A;  2V7L A;  3QUJ A;  2BG9 B;  4KI0 F;  4AH6 A;  3ZJ1 A;  3AAI A;  2VAS A;  1EVL A;  2XGT A;  1YW0 A;  2VQE T;  4NXN T;  3RYH E;  4NCX A;  5HGQ A;  5H6Q B;  2ZZE A;  1WYD A;  3MA9 A;  2ZTG A;  1UX4 A;  5C52 B;  1EVK A;  4LF6 T;  2XAF B;  3ZMU B;  2ZT6 A;  3LC0 A;  2XZE A;  3WAK A;  4AKI A;  4PFP A;  1WU7 A;  2ODR D;  2UUA T;  3ZCJ A;  3AE4 A;  4DV4 T;  1KF6 A;  1OED B;  2EAY A;  5CJ5 A;  5AQJ B;  2BKP A;  3FB2 A;  2D5U A;  3K3O A;  4LFC T;  2EWN A;  2QA7 A;  5FY1 A;  5HEH A;  4ZS2 A;  3RKO A;  3E08 A;  4TWH A;  2E5V A;  1BBW A;  3KFU A;  2RHQ A;  3HFZ A;  5HEJ A;  3PUV F;  3KV5 A;  2VB6 A;  4HFB A;  2K9A A;  4QH1 A;  2EL9 A;  4AKH A;  3AAA B;  3KV9 A;  4HFC A;  4DR4 T;  4BJM A;  4CI1 B;  3Q9D A;  3P4R A;  4JI4 T;  2CHO A;  2D2S A;  1L0V A;  4CI2 B;  1N36 T;  5HAX A;  2WBL A;  5HXR A;  1ADY A;  1HTT A;  4H2X A;  3U3I A;  2YDR A;  2E10 A;  4UIG A;  1DU2 A;  4KHP T;  4ZXL A;  1YGB A;  3NZQ A;  1B8A A;  3AA7 B;  4DR5 T;  4KQE A;  5FXX A;  3BJU A;  3RC3 A;  4X20 E;  5EZY E;  2I4N A;  3RKW A;  3V8L A;  3CIR A;  3N9Q A;  2ZM8 A;  5L3D B;  3CX7 B;  3EUH A;  4ADZ A;  3CK6 A;  2QVA A;  1NEK A;  2LSI A;  3TUP A;  4Z90 A;  2G0U A;  4HWI B;  4X5T A;  5HWY A;  5ELN A;  4NUV A;  1XZY A;  1WPY A;  4MAL A;  3ONJ A;  2DJZ A;  2DDZ A;  4Q15 A;  3UH0 A;  2PMF A;  1MMN A;  3Q5X A;  5CFB A;  1WQW A;  4O4I E;  3QOF A;  3RIF A;  5E3I A;  1WNL A;  2V7I A;  2W0G A;  2LEH A;  2KZ7 B;  1YFR A;  3AE3 A;  4LF8 T;  5HWX A;  4YHJ A;  2V7J A;  4XU1 A;  5HEU A;  2XTL A;  4DND A;  3JCF A;  4O2B E;  2BS3 A;  3UU6 A;  1WYC A;  5FY0 A;  4YYE A;  1O3X A;  2LHN A;  1YKE B;  3ZMT B;  3UUL A;  1HS7 A;  2LOP A;  5BR8 T;  3WAJ A;  3AA0 B;  2DTI A;  4PAG A;  3OYX A;  2ZGW A;  4QXH B;  2YOE A;  4JI8 T;  3EDV A;  1JJC A;  1H4Q A;  1HX1 B;  2JQH A;  3VRA A;  2VKH A;  1MIW A;  5HXE A;  3LBX B;  4ZI2 D;  3A8Y C;  1KFY A;  4F8H A;  1KEY A;  2P5I A;  3P4W A;  3VQW A;  5BMV E;  4BA9 A;  3V5S A;  1ADJ A;  3PZC A;  5JDQ A;  2JQQ A;  3AXJ B;  2BBH A;  4QXB B;  5FL0 A;  4EED A;  4TVA A;  2X9W A;  3E0Z A;  2X66 A;  5LGT B;  3DJB A;  3K8P C;  4EXT A;  3P7I A;  4HE8 A;  1MNE A;  3D0T A;  3TLS A;  3LJC A;  2IC6 A;  1BIB A;  1VCS A;  1RIQ A;  1D1A A;  4EYY R;  3GN5 B;  1FMV A;  1IBK T;  4DR1 T;  4OFZ A;  3EAM A;  4IDO A;  3TEG A;  4JLE A;  1YB3 A;  1Y64 B;  2W66 A;  2QHV A;  2BKO A;  3AB3 B;  2CWO A;  2WZI A;  3GMI A;  1WYB A;  2DQ0 A;  3HI2 A;  2X67 A;  4JI7 T;  3MJX A;  2I4L A;  3OYZ A;  2CWY A;  2X9X A;  3LK3 B;  2LM2 A;  2GK9 A;  4K86 A;  4G85 A;  4JBW F;  1XMO T;  3G06 A;  3A5Z A;  3N5L A;  3AEA A;  4EO4 A;  5HCM A;  2KWI B;  3DP7 A;  3FBZ A;  3NRX A;  1Z8U A;  4P74 C;  2B1E A;  2D9D A;  4HFH A;  3CX8 B;  4U7Y A;  3LFM A;  2C8M A;  4H2U A;  3ZPO A;  3IKM B;  4P75 A;  4IL4 A;  4DO0 A;  2DCF A;  3NRY A;  4GK5 E;  2VWA A;  5IWA T;  1KNZ A;  3C51 A;  4XTW A;  3ZN1 B;  2UXD T;  3NEL A;  4QH4 A;  2I6H A;  1EIY A;  4UVB B;  5FVK A;  4X1I E;  1USY A;  4WNK A;  5DQW A;  3A32 A;  3B57 A;  4UF0 A;  4C90 A;  5HXC A;  3FZF B;  2PFV A;  4RMF A;  2BDE A;  2Q7G A;  3ETV A;  3PV0 F;  2HN2 A;  4TWF A;  1KNR A;  1JNZ A;  4UVA B;  3N9N A;  3KBT A;  5EK3 A;  4IE7 A;  1MND A;  4X5O A;  5JDN A;  2XQ8 A;  2EHO A;  1YD8 G;  2X0H A;  3UU8 A;  2DI4 A;  2Q5I A;  4H63 H;  3RHW A;  4X64 T;  4DMV A;  3ANW A;  2Q5H A;  2WSS V;  1US7 B;  2E64 A;  2IAK A;  1D0Y A;  4ZI3 C;  3BQK A;  3N9L A;  1XNQ T;  3UFG A;  4L5G A;  2CLY C;  4G84 A;  3N9P A;  2AMC B;  2IML A;  2J3M A;  2FJB A;  5LBM A;  4COF A;  2LSY A;  4DV7 T;  4DUZ T;  1MMG A;  2E9X C;  4K0U A;  2ART A;  1H4T A;  3UU4 A;  4Z91 A;  2DTH A;  3RUX A;  4OYK A;  3PCO A;  3PU8 A;  4B3R T;  2H7O A;  4V1A v;  1X54 A;  2M6I A;  2ARU A;  4J2C A;  3DSQ A;  4WBN E;  2C7I A;  3QO8 A;  4H2Y A;  3QO7 A;  4RDX A;  2W2U A;  5L3B B;  1BBU A;  2WDQ A;  2CJ9 A;  3ZMZ B;  3NET A;  1MMA A;  3HXX A;  5L3C B;  3CPZ A;  5KX5 E;  3TKL B;  3Q2M A;  1LYL A;  2A72 A;  4WF2 A;  2LOS A;  4MHC A;  4L0R A;  4GKJ T;  4TNW A;  3RLF F;  1ATI A;  3HKE E;  2DHR A;  2IY5 B;  3RH3 A;  2QHT A;  1YFT A;  4LVJ A;  2BG9 A;  1B70 A;  3UQ7 A;  3REU A;  1X01 A;  2XUE A;  1PYS A;  2VVS A;  2Z6E A;  3NBX X;  5CA0 E;  4QX8 B;  2LRK A;  5AQU B;  3PUX F;  4GK0 E;  4P3N A;  4WI1 A;  4IDP A;  1VQZ A;  2ACX A;  4CN4 A;  2W63 A;  4ERR A;  2YDS A;  3A5X A;  4ILC A;  4AQG A;  1SRY A;  2VKD A;  4H9R C;  5K1P A;  3AE7 A;  4UV8 B;  2CGH A;  3HTZ A;  4XTV A;  1WCR A;  4XTY A;  4JEU B;  1ZP0 A;  3BFM A;  4TUY E;  2V1D B;  3ZN0 B;  5LG4 A;  4OX9 T;  2DEQ A;  5LHH B;  4ASK A;  3M3Z B;  3AA6 B;  4JI2 T;  3QO5 A;  1XWM A;  3VR8 A;  2DZC A;  5L3F B;  2XAH B;  3VKG A;  2K5B B;  2YDQ A;  3L39 A;  4AXP A;  2E1H A;  4QH5 A;  2CMR A;  2LLY A;  1E24 A;  4DR6 T;  5ELO A;  2P0L A;  2WMN A;  1X55 A;  1E1H B;  3X1D A;  2W61 A;  3HKB E;  4DQ2 A;  2AKW A;  2ZNJ A;  4C91 A;  4HWC A;  2DVE A;  3ZC1 A;  1KK7 A;  4XU3 A;  3ZJ2 A;  5LJN A;  3CQC B;  4XBF B;  2FJA A;  4H2V A;  2XJ7 A;  5L2L A;  4QHO A;  4A98 A;  5JDL A;  2V7M A;  2NW9 A;  3B13 A;  4U7I A;  3P50 A;  1D1C A;  1M62 A;  2ACZ A;  3F2E A;  2DXT A;  3P8C D;  2ALY B;  2UXN B;  4TV8 E;  2UU9 T;  4YCU A;  4X65 T;  1I6Z A;  1CUN A;  3RI5 A;  1SES A;  4HWH A;  1YFS A;  4GYS A;  3AE6 A;  4CS4 A;  3UGQ A;  2X68 A;  4P09 A;  4UEM A;  2IW5 B;  3I0Q A;  3LG7 A;  1N32 T;  3VBB A;  1G5I A;  3UGT A;  4UV9 B;  3FXE B;  4NUU A;  3L09 A;  3VQX A;  3ZKR A;  1SER A;  4QWN B;  1J5E T;  4ZHQ E;  1FYF A;  2MPK A;  4HWD A;  2XSB A;  4IDZ A;  5H6R B;  3RYI E;  2E8I A;  2WM9 A;  3N2O A;  4OLF A;  4YRR A;  1H7C A;  1ZKE A;  5EK2 A;  3ONX A;  4ZOL E;  4JEH B;  5JDM A;  3CWZ B;  2Q7H A;  3ESL A;  1X9B A;  3RRW A;  4HEA A;  2YEV C;  1BR0 A;  1ASY A;  4LVK A;  1X79 A;  4PJN A;  4YSX A;  1YQ3 A;  2FJE A;  2MYS A;  3QC9 A;  2WU2 A;  1Y01 A;  3UU3 A;  2UXX B;  1I94 T;  3LSS A;  2CXF A;  1S35 A;  2DLR A;  2ZCE A;  4ZS3 A;  1KNP A;  2X9Y A;  5ETW A;  4KR3 A;  1MIV A; 
#chains in the Genus database with same CATH homology
 2PME A;  1ADJ A;  4BWA A;  1HC7 A;  3L2Z A;  4XTU A;  2E41 A;  1KMM A;  4J15 A;  3PZC A;  3I7F A;  4XEO A;  1QE0 A;  3G1Z A;  4TVA A;  2NS6 A;  4TVA B;  4XU2 A;  2QHS A;  4P72 C;  1X2H A;  4XTX A;  3MF1 A;  3IKL A;  4P72 A;  1BIB A;  4CS3 A;  1RIQ A;  3ICA A;  1EOV A;  2Q7E A;  5KNN A;  5F5W A;  1IL2 A;  2ZT7 A;  3TEG A;  1YB3 A;  2QHV A;  4YP0 A;  3A31 A;  2DQ0 A;  2ALY A;  3RF1 A;  3FJP A;  1QF6 A;  3PCO B;  2CJB A;  2ZR3 A;  2I4L A;  2ZT8 A;  1X56 A;  1HXD A;  3ERR A;  4YRO A;  4K86 A;  2EJF A;  3HXY A;  4G85 A;  4O2D A;  1Z7M A;  3TEH B;  3A5Z A;  4YRE A;  4EO4 A;  1J5W A;  4LNS A;  1NYR A;  2ZR2 A;  4P74 C;  1X2G A;  3NEN A;  4P75 C;  2C8M A;  4LVL A;  4H2U A;  3MEY A;  3IKM B;  4P74 A;  4PG3 A;  4P75 A;  2DXU A;  3RKY A;  4XU0 A;  3M4Q A;  4TVY A;  2E5A A;  4XTW A;  1SET A;  4WJ4 A;  1B7Y A;  3NEL A;  1EIY A;  1EIY B;  1B70 B;  3HXV A;  4H2W A;  1EFW A;  1USY C;  3E9H A;  1USY A;  1PYS B;  12AS A;  3A32 A;  4H2S A;  5K1X A;  2RHS B;  4YCV A;  3A74 A;  3QTC A;  4L87 A;  1NJ5 A;  4LVM A;  4RMF A;  2Q7G A;  3NEM A;  4UP7 A;  3REX A;  3V7S A;  4K87 A;  3HFV A;  4YRI A;  2I4M A;  2ZNI A;  4X5O A;  4PHC A;  4TWA A;  3A7U A;  3V8K A;  2Q5I A;  3W3S A;  3VQY A;  3HRI A;  2Q5H A;  4YRT A;  11AS A;  3A7A A;  2E64 A;  1L0W A;  2RHQ B;  4H2T A;  3V8J A;  3UFG A;  3EFS A;  4G84 A;  4K88 A;  4HA8 A;  2AMC A;  2AMC B;  4YRQ A;  2EJG A;  1N9W A;  2ZZG A;  1NJ8 A;  4HWP A;  2J3M A;  4YRJ A;  3RGL A;  1WQ7 A;  2EJ9 A;  4TVW A;  3RKX A;  4OP0 A;  2XTI A;  2ART A;  1G51 A;  1H4T A;  1ASZ A;  4WJ3 M;  2ARS A;  1E22 A;  2AKW B;  4CS2 A;  3L4G A;  3L4G B;  4UP8 A;  2DTH A;  3RUX A;  3PCO A;  4H2X B;  1NNH A;  1C0A A;  3HXW A;  3RAC A;  1X54 A;  4P73 C;  2ARU A;  3DSQ A;  3QO8 A;  2C7I A;  3EFR A;  4H2Y A;  3QO7 A;  2CJA A;  3TEH A;  4RDX A;  4P73 A;  2ZT5 A;  1BBU A;  4YRL A;  3MQZ A;  2CJ9 A;  3IG2 A;  2HNI A;  1NYQ A;  3NET A;  3HXX A;  2ZIN A;  1LYL A;  3WQZ A;  2E65 A;  5C51 B;  4P3O A;  2DZ9 A;  4WF2 A;  1B76 A;  1ATI A;  4YRM A;  2IY5 B;  3M4P A;  2QHU A;  1E1T A;  2J3L A;  2QHT A;  1YFT A;  4CH4 A;  4LVJ A;  4CH5 A;  1B70 A;  4AH6 A;  3REU A;  1X01 A;  2DQ3 A;  2ZIO A;  3HRK A;  1EVL A;  3IAL A;  2XGT A;  4NCX A;  5HGQ A;  3HXU A;  4LVI A;  1PYS A;  2ZZE A;  1WYD A;  4XEM A;  4YDQ A;  2DKG A;  4P3N A;  2RHS A;  4WI1 A;  2ZTG A;  1VQZ A;  5C52 B;  1EVK A;  1G5H A;  2ZXF A;  1KMN A;  4DPG A;  4TQF A;  2ZT6 A;  1SRY A;  1Z7N A;  3LC0 A;  2DTO A;  5K1P A;  2CGH A;  3HTZ A;  1EQR A;  4XTV A;  4XTY A;  4EX5 A;  4HVC A;  1WU7 A;  2ODR D;  3RIR A;  4CH3 A;  3BFM A;  2EAY A;  2DEQ A;  2EWN A;  3VQV A;  1JJC B;  4YPF A;  3QO5 A;  1BBW A;  4YCW A;  3KFU A;  2DU5 A;  2RHQ A;  3HFZ A;  2DZC A;  3HFZ B;  4YRN A;  3P8Y A;  1H4V B;  2ZZF A;  3R07 A;  4BW9 A;  2EL9 A;  4P3P A;  5C53 B;  2G4C A;  1NJ2 A;  1NJ1 A;  2E1H A;  4HT4 A;  1E24 A;  1WLE A;  5ELO A;  2P0L A;  4ZTU B;  1X55 A;  2DU7 A;  4DQ2 A;  2ZIM A;  4HWO A;  2AKW A;  2ZNJ A;  1ADY A;  2A8E A;  2DVE A;  1HTT A;  4UP9 A;  4XU3 A;  4H2X A;  2E10 A;  4H2V A;  4Q6G A;  4YRG A;  3CMQ A;  1YGB A;  3V7C A;  4YRC A;  4ZTZ B;  3HY1 A;  1B8A A;  4HWT A;  4KQE A;  4UPA A;  3BJU A;  2I4N A;  4YRP A;  3RKW A;  3V8L A;  2DXT A;  4E51 A;  4HWR A;  2ALY B;  4HWS A;  4YCU A;  2I4O A;  4TQD A;  3A7R A;  1SES A;  1YFS A;  3TUP A;  4YRK A;  5ELN A;  1BIA A;  3RL6 A;  4CS4 A;  3UGQ A;  2E3C A;  2IY5 A;  3HY0 A;  3P8T A;  4YRS A;  1H4S A;  2ODR C;  1WPY A;  3QNE A;  2DJZ A;  2DDZ A;  4Q15 A;  1W66 A;  3UH0 A;  2PMF A;  3A5Y A;  3VBB A;  1G5I A;  3P8V A;  3UGT A;  3OD1 A;  1WQW A;  4CH6 A;  5E3I A;  4XTZ A;  1WNL A;  3VQX A;  1SER A;  4H02 A;  2CIM A;  1YFR A;  1FYF A;  1B7Y B;  3E9I A;  2FYK A;  4OLF A;  4YRR A;  4XU1 A;  4RQF A;  1E1O A;  4YYE A;  4TTV A;  2Q7H A;  2DTI A;  4P71 C;  4YRF A;  3MF2 A;  3V7R A;  1ASY A;  4LVK A;  2ZGW A;  4P71 A;  1JJC A;  1H4Q A;  4ZIB A;  3LSQ A;  4KR2 A;  4RQE A;  1KOG A;  3LSS A;  1GGM A;  3L1A A;  2P5I A;  2ZCE A;  1NJ6 A;  3HXZ A;  4KR3 A;  3VQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...