3UFGA

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc in complex with atp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 96
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3ufgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ufgA01
1PYSA 2DU7A 1PYSB 4OP0A 3A32A 4G84A 2E5AA 1E1TA 3HXXA 3RL6A 3QNEA 1N9WA 3LSSA 1J5WA 4DQ2A 2ZZGA 2ALYA 3NENA 4P75C 3MF1A 4YRCA 1KMNA 2ZT5A 1KOGA 3LSQA 3VQXA 2Q7GA 4HWRA 1YFRA 1EIYA 1EIYB 1YGBA 4YRGA 2ZZEA 2Q5IA 1B8AA 2ZNJA 2C8MA 4TVYA 4YRPA 2ZINA 3L1AA 3QO7A 4YCVA 1SERA 1X56A 1WPYA 5K1PA 4YRIA 4K86A 4TTVA 5C51B 3VQVA 3MF2A 3RKXA 4H2WA 1H4TA 4YRSA 2ZNIA 4P3PA 3W3SA 3QO5A 1L0WA 1WLEA 1LYLA 4P71C 2ODRC 4WJ3M 4RMFA 2ZIMA 3EFRA 4UP7A 3RKWA 2J3MA 1NYRA 4CH5A 3DSQA 4KR3A 1USYA 4P3NA 5K1XA 12ASA 3LC0A 4H2TA 4XTUA 1E22A 4TQFA 1B7YA 1WYDA 2G4CA 2QHTA 1WU7A 4P72A 4P73A 4XU0A 4RQFA 3KFUA 1RIQA 2EJGA 2CJ9A 2P5IA 2DTOA 3L2ZA 2ZT6A 4XU3A 1HTTA 1NJ1A 1G5IA 1X2HA 2I4LA 2ZT8A 4H2VA 5HGQA 3M4QA 4HWOA 1E24A 4CS3A 3RF1A 1X01A 1BIAA 2J3LA 2RHQA 3UGTA 2HNIA 2ZCEA 2RHQB 4HWTA 3UGQA 3BJUA 3IG2A 3V7SA 5ELNA 4CS4A 2EAYA 3IKMB 2DJZA 3V8KA 1WNLA 1BBUA 1WQ7A 4OLFA 3HRIA 3R07A 4RQEA 4Q15A 4BW9A 2ARTA 4XTYA 4YP0A 1C0AA 4XTXA 1SRYA 1YB3A 3A7RA 3I7FA 4XU2A 3V7CA 4CS2A 4HVCA 4AH6A 4E51A 4XTZA 2QHVA 2E64A 4TWAA 4WI1A 4RDXA 3A74A 3PZCA 4UP8A 4P74A 4YCUA 2RHSA 4P72C 2RHSB 1WQWA 4Q6GA 1NJ2A 4YCWA 3HXUA 2ZIOA 1ASYA 3HXYA 2QHSA 4YRJA 3HFVA 2E3CA 2E41A 2E65A 5KNNA 4ZTUB 2ODRD 3REUA 2QHUA 2DTHA 2DU5A 1X2GA 3P8TA 2I4MA 1EVLA 4XEMA 4YYEA 3M4PA 2Q5HA 4YRTA 5C53B 2CJAA 2ZGWA 4TQDA 3QO8A 2FYKA 1ADJA 3P8YA 2ARSA 3VQWA 2I4NA 1IL2A 3REXA 3OD1A 1HC7A 4WF2A 1Z7NA 4J15A 3V7RA 1H4QA 1EFWA 2CIMA 3EFSA 1E1OA 2CJBA 1JJCA 4KQEA 5ELOA 1JJCB 2E10A 3A5ZA 4UPAA 2DVEA 4YRQA 2Q7HA 1EVKA 3HTZA 2AKWA 4XU1A 3VBBA 2AKWB 4X5OA 2DTIA 2ARUA 4YRFA 1VQZA 4YPFA 5E3IA 3VQYA 3A7AA 3CMQA 4YRKA 2ZR2A 4ZTZB 1Z7MA 1ASZA 2DKGA 4H2SA 4H2UA 4CH4A 4L87A 5F5WA 1BBWA 3HXVA 3BFMA 1H4VB 4K88A 3TEGA 2AMCA 2AMCB 2ZZFA 4YRLA 1KMMA 4CH3A 2EL9A 4O2DA 1USYC 1B76A 4HA8A 3IALA 4PG3A 1ATIA 4HWSA 1FYFA 1NNHA 2C7IA 3RUXA 3UH0A 3V8JA 3NELA 2I4OA 4P73C 2ALYB 3E9HA 3PCOA 3P8VA 1SESA 3PCOB 3UFGA 3ERRA 2XGTA 1EQRA 2E1HA 3HY1A 3RKYA 3RIRA 3RGLA 4BWAA 4EO4A 4H2YA 2DXUA 1G5HA 3HFZA 4PHCA 1X54A 3HRKA 4CH6A 3HFZB 3TUPA 2ZXFA 2ZTGA 1EOVA 3A31A 2ZR3A 1YFTA 1QF6A 2DZ9A 2DXTA 2EWNA 1QE0A 4UP9A 3TEHA 2XTIA 1ADYA 3TEHB 2EJ9A 1YFSA 2Q7EA 2DDZA 1NYQA 4YRNA 1GGMA 4H2XA 1G51A 1BIBA 4H2XB 3NEMA 2EJFA 2PMEA 3IKLA 1X55A 2DEQA 2PMFA 4EX5A 2DQ3A 1H4SA 4P75A 4KR2A 3A5YA 4H02A 4YREA 3A7UA 3E9IA 3ICAA 4K87A 4XTVA 4TVWA 4YROA 1SETA 1HXDA 4DPGA 3HXWA 4YRMA 3L4GA 3L4GB 2CGHA 4WJ4A 1NJ8A 4P74C 4LNSA 2P0LA 2IY5A 1B7YB 11ASA 2IY5B 4NCXA 3NETA 4TVAA 4XEOA 2DZCA 4TVAB 3G1ZA 4G85A 3RACA 3MEYA 4HWPA 3HY0A 2DQ0A 3HXZA 3QTCA 1W66A 4XTWA 1NJ5A 4YRRA 4ZIBA 4P71A 2ZT7A 3WQZA 4P3OA 1NJ6A 3V8LA 5C52B 4YDQA 1B70A 1B70B 3FJPA
chains in the Genus database with same CATH superfamily
2NW9A 4YJ2E 3MACA 3AEFA 4LVMA 1E1TA 3HXXA 4DV6T 3KV5A 4P75C 2WY2A 1KOGA 3UUMA 3ZCJA 4U72A 5FY0A 4HWRA 2MYSA 4CQIA 1EIYB 1YGBA 2ODVA 3CQGB 3P4PA 2XQ6A 5LJNA 4AXPA 4ZI2D 2XQAA 1WPYA 3Q9DA 4AKLA 2FJAA 4KI0F 5C51B 2CHNA 5ABGA 2Y8DA 4H2WA 3O1JA 5ABFB 4YRSA 2ZNIA 2B76A 3W3SA 4DUZT 2AE9A 4ZS2A 4AIUA 3HKDE 4DV4T 1WLEA 1LYLA 4B3TT 2I0MA 4RMFA 3EFRA 3RKWA 4EZHA 2J3MA 4UVAB 5DABA 4JYAT 3GN5B 1NEKA 3F31A 4KR3A 2L3LA 5CFBA 4DV3T 3WAJA 3Q5WA 12ASA 2XY8B 4IL4A 3VKHA 3AE7A 3ZMZB 2NTYA 3PJAA 2A3DA 4XZCA 5DQVA 3N9LA 3IHRA 3PU3A 4UF0A 4DR7T 2CRBA 4HEAA 4KHPT 1W9RA 3UQ7A 2QHTA 2VURA 4IDQA 2YOEA 3TLVA 4P72A 4XU0A 2W4XA 2V5DA 2EHOA 2YU2A 4L5GA 2DTOA 4H9QC 3HR0A 2LT3A 2X0LB 5FY7A 2I4LA 4UR9A 4H2VA 2XAFB 2KT9A 4QX7B 3M4QA 1W0BA 4HWOA 3TKLB 5A1LA 4X65T 2UXXB 2X68A 1X01A 2BG9E 3AXJB 4LFAT 5KXJA 3E0ZA 3IG2A 2ZM0A 4EZ4A 4CS4A 2MAWA 2DJZA 4X1KE 4WYVA 5HXEA 1WQ7A 2BZBA 4U2ZA 1N36T 2LM2A 3CPZA 4ZI3D 4YP0A 4XTXA 3UU6A 4I0UA 2Q9QD 1J1JA 4GK5E 5HXHA 3I1AA 4QH1A 4EAHA 4HVCA 2VL0A 3K3NA 4XTZA 4PK5A 2CM0A 3PUVF 4DUYT 5EK4A 3H3AA 4YCUA 2ACXA 3P7IA 1QUUA 3EHZA 2CMRA 4AQFA 3LBXA 1KNZA 1YQ3A 3RQUA 3OTOT 4Q6GA 2IMLA 4PK4A 3RC8A 3H3MA 4YRJA 2MOZA 4TV9E 4DO0A 2V6YB 4CZZB 2QGSA 4QH5A 3ANWA 2DU5A 4HFBA 4CXXA 3PV0F 5CB4E 3CQCB 4UV9B 3RRCA 3FBZA 2FJEA 2WM9A 2X9YA 4H9NC 2H7OA 4YYEA 3UU8A 4JI6T 3ZSTA 5C53B 5M4YA 5HAXA 5FXZA 2JJ9A 4BAYB 3N2KE 2RPAA 2UUAT 2FYKA 4EV6A 3IBPA 3P8YA 3O1HA 4HKAA 2SPCA 3REXA 2J47A 3OD1A 1HC7A 3AE6A 3LG7A 4EEDA 2D5UA 1E1OA 2P9BA 2XQ7A 3BQIA 5ELOA 1D1BA 1JJCB 5JQGE 3A5ZA 2RP4A 5LGTB 5LG4A 2JRKA 3VRBA 4PJNA 2X0YA 4LF9T 1Z8UA 3HTZA 2CCQA 3AE8A 1IJ6A 2C5KT 1IZNB 4YPFA 2X66A 3A7AA 2FJDA 2J62A 3CMQA 2GK9A 2ZR2A 5J2UE 4ZTZB 1LRZA 3AEDA 4JBWF 3NRXA 4CH4A 3D0TA 5AQOB 4ILCA 2LEHA 4ISTA 5JDQA 1H4VB 4K88A 4MALA 1D0ZA 4I55E 3TEGA 2AMCA 3AA0B 4L9IA 5FXXA 3C98B 2ZZFA 1KMMA 4CH3A 2EL9A 2CBIA 4TZ4C 1B76A 4HA8A 3IALA 2NP9A 1ATIA 5LGUB 1OEDB 3PUZF 3OPCA 2C7IA 3RUXA 2N2NA 3C4WA 5IYZE 5LCYA 1CHUA 1XWMA 3N9OA 2EHOC 5AQQB 3E9HA 4PNIA 4TNWA 3P8VA 2XGTA 3ERRA 3ZC0A 2LSJA 3RKYA 2M6BA 1N34T 5LB7B 1G5HA 3R84B 5AFUL 3HRKA 5J0ZA 3HFZB 2ZXFA 3F2EA 5JDMA 2ZTGA 3A31A 3TLSA 2I59A 4UP9A 4H63V 2E5VA 4OX9T 2Q7EA 2WSSV 4PJMA 3AE3A 2DDZA 1Y01A 1NYQA 1UX5A 5FXVA 1GGMA 4H2XB 4QXHB 3NEMA 2X51A 4V1Av 3FBLA 2JQQA 4TX5A 3ONJA 4B3MT 3Q5DA 3UFEA 4Z90A 2DEQA 4DR2T 4EX5A 4YXDA 4COFA 3PE0A 2DQ3A 4P75A 1H4SA 3A7UA 4YROA 4TVWA 5LP6E 3W15B 4H9OC 5JDFA 3RYCE 3L4GB 1W09A 2Y48B 3OVUA 2MBGA 4AQFC 11ASA 3RYFE 2PG8A 3NETA 5IWAT 3ZYMA 4XEOA 2DZCA 3AAAB 2AXDS 2BKNA 3RACA 3ABVA 5LHIB 3AAEB 5LA6E 4ILUA 3MEYA 3RHWA 3HY0A 1US7B 3HXZA 4HTEA 5IHYA 3TLTA 3QTCA 1MNEA 5ABEA 5AQUB 3AEBA 1UGOA 2W00A 3KDSE 2W0GA 2WWUA 1ZV4X 3WQZA 4YTNA 2BG9B 1B70A 3AEAA 4YY3T 3FJPA 3SS1A 3RI5A 1PYSB 5JH7E 4OP0A 3AA7B 2LJLA 3ZC1A 3J9X1 4AI6A 1L0VA 5FVKA 2E5AA 1BR1A 3RL6A 1XZYA 4GKKT 4HWIB 4DQ2A 2ZZGA 3AE2A 2ALYA 3AB3B 5L4HA 2MTQA 4YRCA 1KMNA 3MA9A 5AQVB 3VQXA 4CI3B 1KFYA 1WYCA 2LLYA 4YSYA 3NWIA 1YFRA 1UK5A 1R8IA 4PAGA 1EIYA 3CMLA 4HFHA 4GK0E 1B7TA 4YRGA 1WRDA 2Q5IA 2ZNJA 2LSGA 5HEJA 5FVLA 1FMWA 2CPTA 3QO7A 1SERA 3KFWX 3PUAA 4K86A 2E9XD 3VQVA 3RKXA 3AE9A 5ABFA 3ZMUB 2XAHB 2XQ9A 3UU4A 4JLEA 2NTXA 2XQYA 5ADXL 3HI2A 1U4QA 4LMJA 4I43B 3ZT7A 2UU9T 4B3RT 2V7JA 2CWYA 2IHR1 5HCJA 2ZIMA 4HFVA 3QB5A 3L8RA 2CEAA 3GN5A 5AQMB 4K0UA 3ZSSA 4ILBA 5AQJB 1USYA 3EDVA 5K1XA 5HCMA 3MJXA 5J2TE 1YKHB 4UXNB 4IE0A 4CXYA 2K9AA 5HEUA 1E22A 4TQFA 1B7YA 2G4CA 2WZIA 2DCFA 2CJ9A 2WS3A 1BR0A 4KBMB 1NJ1A 1G5IA 2IUBA 3CX6B 5EK2A 4I4TE 4IDZA 1MIVA 5AQHB 2BS4A 1E24A 5LYJE 4U7IA 3AXJA 3SFDA 2W66A 2X67A 3FZHB 3KV4A 2HNIA 4WW0A 4YTMA 2N1GA 1V9DA 4O4IE 3A8YC 5L3FB 2EAYA 1LVFA 1BBUA 4F6RC 1HX8A 4QXBB 3PURA 4X1YE 3SOLA 3CK6A 4TN7B 2YEVC 3K1SA 3RRWA 2CLYC 2NS6A 2WU2A 2ARTA 1C0AA 3C4XA 3RH3A 5LJMA 3I7FA 5AQPB 2XAJB 3RIUC 2QHVA 4TWAA 2YINA 3UT5E 4RDXA 2JIWA 3JAFA 1ZKEA 5L4EA 3HL6A 3AA6B 4O4JE 2RHSB 5L3BB 1CUNA 4YCWA 3UUXB 3TLWA 2KWHA 3HXYA 5IUXA 4IGUA 3I9YA 2X9WA 2NR4A 1X79A 2L8KA 2V7MA 5KNNA 3ZMTB 3IEEA 1VRBA 4X1IE 1KNPA 3K3OA 2QHUA 5LHHB 3ZYKA 1WCRA 4ZOLE 3EI0A 5JR9B 4XEMA 4AISA 1H7CA 2UXNB 4IE7A 1S94A 4Z91A 2UXCT 2Q5HA 5CGMA 3NRYA 2CJAA 4DMVA 3RLFF 3DTOA 4TQDA 2VL8A 4J2CA 3HA4A 2V7IA 2WB5A 3NZQA 2K5BB 3VQWA 1FMVA 3K3QC 4DV1T 1IL2A 1IAPA 2H89A 3I9WA 3SRZA 2BBHA 4AKHA 3N2GE 4WF2A 3ZMSB 2LKGA 4LF8T 1EFWA 2PJQA 2CA5A 4DMWA 2Q9QB 1WR6A 5TAOA 1JJCA 3N2OA 4UPAA 2DVEA 1HX1B 3L39A 1XDOA 4HN9A 2DHRA 3VBBA 1VCTA 3T8OA 4TWHA 5HEHA 2DTIA 4BA9A 5E3IA 3VQYA 2V1DB 4X5TA 4OYJA 4YRKA 1YW0A 4EYYR 2XQ3A 3ZPOA 4HE8A 2VKJA 4H2SA 5GONE 5JDLA 5DJQC 3P50A 5JR9C 4ILAA 4CI2B 4FI5A 4HGAA 4K0KT 4YRLA 1OWAA 2XM2A 2JQ9A 1USYC 1MIYA 2VASA 1W0AA 1OEDA 4HWSA 1HNXT 4DV7T 1NNHA 3NKZA 3KBTA 4YHJA 1T98A 4O8SA 4OFZA 4EB6E 3NELA 5EK3A 3ETVA 4UIGA 3AECA 3UFGA 3A7MA 2QA7A 3WAKA 4GYSA 1YD8G 1MMNA 1IBLT 3HFZA 2HPJA 5LG3A 4UVCB 5LBMA 1YFTA 1QF6A 1HFAA 3QC9A 4EIWA 3L09A 1QE0A 3JC6C 2XTIA 3TEHB 3J7Yq 2LHNA 2UXBT 4LVIA 3ZT5A 5AQFB 2WZHA 4H2XA 3U3IA 4JUYA 2EJFA 3FZLB 2ZLYA 2V7KA 2WDRA 3A5YA 1I94T 4H02A 4XTVA 3ICAA 2VKDA 2UUBT 1SETA 3NVOA 3T1YT 3CVRA 3L4GA 3FHNA 4NXMT 3ZMVB 1MIWA 4WJ4A 3SFEA 3C51A 3KINB 2W61A 4X62T 4JI2T 2IY5B 4HFIA 4NCXA 2BVMA 5FKYA 1JNZA 2V6XA 2YKSA 3FZFB 4A56A 4XBFB 4GYRA 5JDGA 3P8CD 3AVRA 3M65A 2F4VT 3FZKB 3MKDA 2E8IA 4NUVA 4ZEYA 4CN4A 2ZT7A 2YN6A 1KEYA 4LMLA 2BG9A 4H9SE 5LNKA 4ZZBA 3V7RA 1PYSA 2KINB 3GA8A 4IE4A 4JEHB 4FJOA 3A32A 4G84A 1WLXA 1JNRA 2EHOD 2LSKA 3QNEA 3ZLIA 1IBMT 4LFBT 3CQXC 4H9PC 2CBJA 3LSQA 4A5XA 2QVAA 2KZ7B 2YK0A 1G8XA 3R6NA 4X66T 1QLBA 3RQWA 4Z8XA 3OYZA 2ZZEA 3LK2B 1LVKA 5CA0E 4YRPA 5HEGA 4TV8E 3L1AA 1NWMX 3LSVA 3PUXF 4ANJA 2KMFA 4YRIA 3PUQA 4DNDA 5E0OA 2XSBA 3LK42 4EGWA 2PBIA 4HFDA 4U3CA 1L0WA 4GIWA 2ODRC 1T72A 4UP7A 4IDPA 4IT4A 2N9DA 2WDQA 1NYRA 1NENA 3TLUA 1MMDA 2VVNA 1OEDC 2JQKA 4KUMB 4P3NA 5FP3A 2V8SV 4QH4A 2BBJA 5H6QB 4B6XA 3RIUA 2M67A 3LDQB 4H2TA 3V5SA 3E08A 3LJCA 3CWZB 3CX7B 4P73A 4RQFA 3KFUA 3V5UA 2P5IA 3L2ZA 2ZT6A 1OXZA 1HTTA 2KSRA 4LF7T 1X2HA 2W62A 4NPPA 2JMHA 3K8PC 2A9UA 3EABA 5HWXA 4CS3A 3RF1A 3LK3B 3IA3A 3JADA 4JI7T 1BIAA 2K3WA 4PFPA 4YFSA 5AQIB 4JI1T 2ZCEA 2RHQB 4HWTA 3UGQA 1VCSA 3V7SA 5H6RB 3DJBA 2LOSA 2LRKA 3IKMB 3V8KA 3VR9A 2BKOA 2K24A 4OLFA 2E9XB 3OBVE 5AQSB 3OYXA 3R07A 3DP7A 1HNWT 2BDEA 4Q15A 4O4HE 4BW9A 3O4XE 2QRXA 1YB3A 1MMGA 3KVBA 3A7RA 4XU2A 2LM9A 4JEUB 1KF6A 3FZMB 4CS2A 3A74A 3PZCA 3ESLA 4P74A 2WBLA 5FL1A 2RHSA 3N9NA 4P1NA 4TUYE 4AQYT 1WQWA 3Q2MA 4BJMA 3RKOA 4HWFA 1NJ2A 3HXUA 2ZIOA 2JQHA 1S35A 4IE5A 2QHSA 3HFVA 3ZJ1A 3ZN1B 4QWNB 2OV9A 4CXWA 4WBNE 5CA1E 1X2GA 5JVDE 5JR9A 2I4MA 1EVLA 2BG9C 1DU2A 3ZCIA 3M4PA 3MK7C 4YRTA 4O2BE 3PTRB 2ZGWA 5JDHA 1WR0A 2X9XA 4DR6T 2NWBA 1IJ5A 2KLQA 5JRCB 5FXWA 1O3XA 3CX8B 3B5MA 4LF4T 2ARSA 2KNDA 2I4NA 5L2LA 3N9PA 3OKQA 2A2FX 4PJJA 3OJAA 1H4QA 3AE1A 2FJBA 4O4LE 2Q9QA 2CIMA 4DBQA 3HKBE 5AQGB 2J4GA 3RKGA 4C90A 2XSAA 3G06A 3UU5A 2CE7A 1EVKA 4U33A 3P4SA 5CJ5A 3KV6A 5HXCA 4XU1A 2AKWB 4X5OA 3AE4A 4A98A 5L3EB 2ARUA 4YRFA 3O1IA 1VQZA 3MQZA 4H9RC 2DKGA 5FNVE 4H2UA 1E7PA 4O2AE 1D0YA 3ZJ2A 1BBWA 4HT4A 5EZYE 4UELA 2X9HA 2BS2A 2BVLA 2XHEB 2HN1A 4PW8A 4E7ZA 2DL1A 4ZI7E 2CXFA 2YDRA 4O2DA 3PJAJ 3WI3A 4PG3A 3NBXX 5L3DB 2VQFT 1FYFA 4IE6A 2J1DG 1YKEB 4ASKA 2RA1A 2D0UA 2WQYA 3AA1B 5HYAA 4P73C 4G2AA 2ALYB 2LOPA 4C91A 2ACZA 2V5CA 3PCOB 3QB5K 2KWIB 1EQRA 4UV8B 3HY1A 3RIAA 3RIRA 4BWAA 3GMIA 2V6YA 4F8HA 4YTPA 3I0OA 3N9QA 2DXUA 4EO4A 3BQKA 4IL9A 4PHCA 1HG2A 1YQ4A 3CIRA 4MHCA 4HFCA 3U78A 4DV2T 1ZP0A 2ZR3A 2R6GF 1XMQT 4HWHA 2BS3A 1KK7A 4ZI2C 3PUWF 2EWNA 3N9MA 4H63H 3TEHA 1KNRA 2EJ9A 2VWAA 2YU1A 1M62A 4YRNA 1G51A 1BIBA 2E2AA 5FYMA 3PUGA 4LVJA 1SE7A 2V26A 3UUBA 4LF6T 1X55A 2WMNA 2PMFA 4UEMA 3VU7H 3E9IA 4K87A 3AEEA 3EUHA 4X64T 3UQ4A 3RPUA 2C5JA 3HXWA 2XQ5A 4BJNA 4MLKA 2CGHA 2CWOA 3FB2A 3RYHE 4P74C 2UUCT 4LNSA 2IY5A 3NZPA 1B7YB 2H88A 5HEOA 1UUSA 4NIQA 4TVAB 3G1ZA 5LBQB 4G85A 1J5ET 1LKXA 5LMUT 2E5LT 4N78D 2DQ0A 3B57A 2WAUA 1I6ZA 4OYKA 1HTJF 5ETWA 4U31A 2XJ7A 3HKEE 4ZIBA 2ZM6T 4DV0T 3O9XA 4WZXA 4YT0A 1NJ6A 2XM1A 1WYBA 4EXTA 4YDQA 5HXSA 2JPFA 3ZN0B 3SWHA 2DU7A 4EEBA 2IW5B 5KX5E 1IBKT 5C2TA 3QNUA 2A8EA 4HFEA 2XPKA 3KBUA 1FIOA 2LKHA 4A97A 1N9WA 3LSSA 4KMCA 1J5WA 4ZI3C 3NENA 3MF1A 3ZT6A 4DR1T 2ZT5A 5BMVE 4TWDA 2XZEA 4KX6A 1BR4A 3AE5A 2Q9QC 2W63A 2M6IA 2Q7GA 1E1HB 2VKHA 1XNQT 1UCUA 2XQ8A 4P09A 3C50A 3UUNA 2WMOA 3UU3A 4ADZA 1B8AA 5F3JA 4ZZCA 4YSXA 2C8MA 4X20E 4TVYA 3P4QA 4U7YA 3JC6D 5LXTE 2ZINA 2XTLA 4YCVA 1X56A 5K1PA 4U74A 4IDOA 4TTVA 2HN2A 3MF2A 1HG5A 4JV5T 1U5PA 1H4TA 2HH7A 4P3PA 3QO5A 3MZKB 2DWKA 4TNVA 4P71C 4WJ3M 1HF8A 4G63A 4EYUA 3AVSA 3X1DA 2FBWA 3KV9A 2H3RA 4CH5A 4LVLA 3DSQA 4M1PA 1D0XA 2IIUA 1VOMA 4P0AA 3LC0A 5ABHA 4XTUA 3AAIA 4NUUA 2ZM2A 4UF0B 1WYDA 2XAQB 2Y6XA 1WU7A 4YHHT 2L9QA 1RIQA 2EJGA 2EHOB 5FL0A 3UTKA 4XU3A 4EOZB 2ZT8A 1SUMB 5AQNB 2C0SA 4AKGA 5HGQA 3Q5XA 1XNRT 4JI3T 2VKOA 2I6HA 4JI0T 2NW8A 2J3LA 5BR8T 3ONLC 4ISSA 2RHQA 2NW7A 2PFVA 3UGTA 4LF5T 3BJUA 3N5LA 4YSZA 4QXCB 5ELNA 5KMGP 2LSYA 1WNLA 1FEWA 1ZOYA 3VRAA 4JI4T 2E9XA 2X0HA 3HRIA 4RQEA 1YXRA 2LRLA 2Z6EA 1E2AA 5AQLB 4DR5T 2WDVA 3EAMA 2C5IT 4XTYA 5LHGB 3RIFA 2WU5A 4MFRA 3VR8A 4KHZF 1SRYA 3H37A 1EZ3A 3MXZA 2NOXA 1XMOT 1HNZT 2QYWA 2LE8A 3V7CA 4DVDA 4AH6A 4E51A 2E64A 4WI1A 5KDMC 3Q5EA 2JMKA 4UP8A 1SHZC 4P72C 3B13A 3LBXB 1BR2A 3BQLA 5LMNT 1ASYA 2DI4A 2D2SA 2E3CA 2E41A 2E65A 1ZEEA 5LOVE 2YDSA 4ZTUB 2ODRD 3REUA 3HKCE 2DTHA 3ANWB 3P8TA 5FY1A 5LGNB 3F57A 3PUYF 4YJ3E 4P0BA 1SA0E 3VHLA 2D0TA 2B1EA 2FUPA 4HWCA 5HXRA 2UXDT 2VQET 5JRCA 3QO8A 1ADJA 2IC6A 2DLRA 4WNKA 3PDYA 3AEGA 2VVSA 3A5XA 3ZEFB 4DR4T 4CI1B 5DQWA 4QX8B 2XUEA 2A72A 3QK6A 4QKNA 1Z7NA 4J15A 3EFSA 2OA5A 1XDPA 1Z0PA 2W67A 4OK0A 3KVAA 3FXEB 3QUJA 2CJBA 2PTFA 4KQEA 3EVYA 5C3JA 2E10A 3UULA 4MBQA 4YRQA 4L0RA 1UURA 2Q7HA 5J1GA 5AQTB 5L3CB 4QHOA 5HWYA 2LHRA 2AKWA 2MPKA 5JREA 2DNXA 3C64A 4OHFA 1N32T 1QSDA 5JTGA 1Z7MA 2OLTA 1ASZA 5AQKB 3P4WA 2IDOB 2ZM8A 3IF8B 4CN6A 2CXDA 4IIJE 5F5WA 4L87A 3HXVA 3BFMA 2G0UA 2W2UA 2BKPA 4U2YA 4GKJT 3LFMA 2H7VC 3ONXA 3QOFA 4I50E 2AMCB 1T8BA 3ZKRA 4LFCT 1MMAA 2CXLA 4PFOA 2V7LA 5L3GB 1N33T 2LSIA 2WP9A 4JI5T 4IHJE 2D9DA 1WFDA 2IC9A 4HWDA 4E7SA 3UH0A 3L3PA 3V8JA 2WCAA 2I4OA 3RC3A 4LMKA 3VKGA 2VK9A 1AJ3A 3ZYLA 2HHHT 3GWHA 3PCOA 3T1HT 1SESA 1MNDA 4DIDB 4KP3C 2YDQA 2E1HA 3RGLA 2XQ4A 4H2YA 1X54A 4CH6A 3TUPA 3JAEA 1EOVA 2VB6A 4IREA 4UVBB 3RYIE 4PK6A 2WWVA 1UX4A 1HCIA 4AKRB 2DZ9A 4Q25A 2DXTA 4ZXLA 1ZHCA 1NAFA 3RX6A 1ADYA 3FXDB 1YFSA 4ZHQE 2E9XC 3PUSA 5L47A 4PJLA 4AKIA 3I0QA 5C8YE 3P4RA 3PU8A 5F8PA 4YLHA 1HS7A 4IDNA 2PMEA 1T7SA 3IKLA 2CLYB 1X9BA 4DBRA 2HPLA 4DR3T 4JI8T 2ZMAA 3E22E 4KR2A 2IAKA 1D1AA 1M7KA 4YREA 4DPGA 1HXDA 4YRMA 3BK9A 1NJ8A 2XAGB 4ZS3A 1GQEA 2P0LA 4TVAA 4B3ST 4LVKA 2XASB 3C4ZA 5AQRB 1HR0T 3M3ZB 5JDNA 1D1CA 4NXNT 4HWPA 1G73A 4CN1A 4WBOA 3JCFA 4ERRA 1FJGT 2ES0A 4AQGA 1W66A 3CKDA 4XTWA 1NJ5A 2ODUA 1Y64B 4YRRA 2DWGA 4P71A 2K48A 4GOUA 1OEDE 4P3OA 2KXPB 4DV5T 3V8LA 3ETUA 4TWFA 4XAXB 5C52B 3EDUA 2CHOA 1B70B 5FMNA 3S4UA
chains in the Genus database with same CATH topology
1PYSA 2DU7A 1PYSB 4OP0A 3A32A 4G84A 2A8EA 4LVMA 2E5AA 1E1TA 3HXXA 3RL6A 3QNEA 1N9WA 3LSSA 1J5WA 4DQ2A 2ZZGA 2ALYA 3NENA 4P75C 3MF1A 4YRCA 1KMNA 2ZT5A 1KOGA 3LSQA 3VQXA 2Q7GA 4HWRA 1YFRA 1EIYA 1EIYB 1YGBA 4YRGA 2ZZEA 2Q5IA 1B8AA 2ZNJA 2C8MA 4TVYA 4YRPA 2ZINA 3L1AA 3QO7A 4YCVA 1SERA 1X56A 1WPYA 5K1PA 4YRIA 4K86A 4TTVA 5C51B 3VQVA 3MF2A 3RKXA 4H2WA 1H4TA 4YRSA 2ZNIA 4P3PA 3W3SA 3QO5A 1L0WA 1WLEA 1LYLA 4P71C 2ODRC 4WJ3M 4RMFA 2ZIMA 3EFRA 4UP7A 3RKWA 2J3MA 1NYRA 4CH5A 4LVLA 3DSQA 4KR3A 1USYA 4P3NA 5K1XA 12ASA 3LC0A 4H2TA 4XTUA 1E22A 4TQFA 1B7YA 1WYDA 2G4CA 2QHTA 1WU7A 4P72A 4P73A 4XU0A 4RQFA 3KFUA 1RIQA 2EJGA 2CJ9A 2P5IA 2DTOA 3L2ZA 2ZT6A 4XU3A 1HTTA 1NJ1A 1G5IA 1X2HA 2I4LA 2ZT8A 4H2VA 5HGQA 3M4QA 4HWOA 1E24A 4CS3A 3RF1A 1X01A 1BIAA 2J3LA 2RHQA 3UGTA 2HNIA 2ZCEA 2RHQB 4HWTA 3UGQA 3BJUA 3IG2A 3V7SA 5ELNA 4CS4A 2EAYA 3IKMB 2DJZA 3V8KA 1WNLA 1BBUA 1WQ7A 4OLFA 3HRIA 3R07A 4RQEA 4Q15A 2NS6A 4BW9A 2ARTA 4XTYA 4YP0A 1C0AA 4XTXA 1SRYA 1YB3A 3A7RA 3I7FA 4XU2A 3V7CA 4CS2A 4HVCA 4AH6A 4E51A 4XTZA 2QHVA 2E64A 4TWAA 4WI1A 4RDXA 3A74A 3PZCA 4UP8A 4P74A 4YCUA 2RHSA 4P72C 2RHSB 1WQWA 4Q6GA 1NJ2A 4YCWA 3HXUA 2ZIOA 1ASYA 3HXYA 2QHSA 4YRJA 3HFVA 2E3CA 2E41A 2E65A 5KNNA 4ZTUB 2ODRD 3REUA 2QHUA 2DTHA 2DU5A 1X2GA 3P8TA 2I4MA 1EVLA 4XEMA 4YYEA 3M4PA 2Q5HA 4YRTA 5C53B 2CJAA 2ZGWA 4TQDA 3QO8A 2FYKA 1ADJA 3P8YA 2ARSA 3VQWA 2I4NA 1IL2A 3REXA 3OD1A 1HC7A 4WF2A 1Z7NA 4J15A 3V7RA 1H4QA 1EFWA 2CIMA 3EFSA 1E1OA 2CJBA 1JJCA 4KQEA 5ELOA 1JJCB 2E10A 3A5ZA 4UPAA 2DVEA 4YRQA 2Q7HA 1EVKA 3HTZA 2AKWA 4XU1A 3VBBA 2AKWB 4X5OA 2DTIA 2ARUA 4YRFA 1VQZA 4YPFA 5E3IA 3VQYA 3A7AA 3MQZA 3CMQA 4YRKA 2ZR2A 4ZTZB 1Z7MA 1ASZA 2DKGA 4H2SA 4H2UA 4CH4A 4L87A 5F5WA 1BBWA 4HT4A 3HXVA 3BFMA 1H4VB 4K88A 3TEGA 2AMCA 2AMCB 2ZZFA 4YRLA 1KMMA 4CH3A 2EL9A 4O2DA 1USYC 1B76A 4HA8A 3IALA 4PG3A 1ATIA 4HWSA 1FYFA 1NNHA 2C7IA 3RUXA 3UH0A 3V8JA 3NELA 2I4OA 4P73C 2ALYB 3E9HA 3PCOA 3P8VA 1SESA 3PCOB 3UFGA 3ERRA 2XGTA 1EQRA 2E1HA 3HY1A 3RKYA 3RIRA 3RGLA 4BWAA 4EO4A 4H2YA 2DXUA 1G5HA 3HFZA 4PHCA 1X54A 3HRKA 4CH6A 3HFZB 3TUPA 2ZXFA 2ZTGA 1EOVA 3A31A 2ZR3A 1YFTA 1QF6A 2DZ9A 2DXTA 2EWNA 1QE0A 4UP9A 3TEHA 2XTIA 1ADYA 3TEHB 2EJ9A 1YFSA 4LVIA 2Q7EA 2DDZA 1NYQA 4YRNA 1GGMA 4H2XA 1G51A 1BIBA 4H2XB 3NEMA 2EJFA 4LVJA 2PMEA 3IKLA 1X55A 2DEQA 2PMFA 4EX5A 2DQ3A 1H4SA 4P75A 4KR2A 3A5YA 4H02A 4YREA 3A7UA 3E9IA 3ICAA 4K87A 4XTVA 4TVWA 4YROA 1SETA 1HXDA 4DPGA 3HXWA 4YRMA 3L4GA 3L4GB 2CGHA 4WJ4A 1NJ8A 4P74C 4LNSA 2P0LA 2IY5A 1B7YB 11ASA 2IY5B 4NCXA 3NETA 4TVAA 4XEOA 2DZCA 4TVAB 3G1ZA 4LVKA 4G85A 3RACA 3MEYA 4HWPA 3HY0A 2DQ0A 3HXZA 3QTCA 1W66A 4XTWA 1NJ5A 4YRRA 4ZIBA 4P71A 2ZT7A 3WQZA 4P3OA 1NJ6A 3V8LA 5C52B 4YDQA 1B70A 1B70B 3FJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYS A;  2DU7 A;  1PYS B;  4OP0 A;  3A32 A;  4G84 A;  2E5A A;  1E1T A;  3HXX A;  3RL6 A;  3QNE A;  1N9W A;  3LSS A;  1J5W A;  4DQ2 A;  2ZZG A;  2ALY A;  3NEN A;  4P75 C;  3MF1 A;  4YRC A;  1KMN A;  2ZT5 A;  1KOG A;  3LSQ A;  3VQX A;  2Q7G A;  4HWR A;  1YFR A;  1EIY A;  1EIY B;  1YGB A;  4YRG A;  2ZZE A;  2Q5I A;  1B8A A;  2ZNJ A;  2C8M A;  4TVY A;  4YRP A;  2ZIN A;  3L1A A;  3QO7 A;  4YCV A;  1SER A;  1X56 A;  1WPY A;  5K1P A;  4YRI A;  4K86 A;  4TTV A;  5C51 B;  3VQV A;  3MF2 A;  3RKX A;  4H2W A;  1H4T A;  4YRS A;  2ZNI A;  4P3P A;  3W3S A;  3QO5 A;  1L0W A;  1WLE A;  1LYL A;  4P71 C;  2ODR C;  4WJ3 M;  4RMF A;  2ZIM A;  3EFR A;  4UP7 A;  3RKW A;  2J3M A;  1NYR A;  4CH5 A;  3DSQ A;  4KR3 A;  1USY A;  4P3N A;  5K1X A;  12AS A;  3LC0 A;  4H2T A;  4XTU A;  1E22 A;  4TQF A;  1B7Y A;  1WYD A;  2G4C A;  2QHT A;  1WU7 A;  4P72 A;  4P73 A;  4XU0 A;  4RQF A;  3KFU A;  1RIQ A;  2EJG A;  2CJ9 A;  2P5I A;  2DTO A;  3L2Z A;  2ZT6 A;  4XU3 A;  1HTT A;  1NJ1 A;  1G5I A;  1X2H A;  2I4L A;  2ZT8 A;  4H2V A;  5HGQ A;  3M4Q A;  4HWO A;  1E24 A;  4CS3 A;  3RF1 A;  1X01 A;  1BIA A;  2J3L A;  2RHQ A;  3UGT A;  2HNI A;  2ZCE A;  2RHQ B;  4HWT A;  3UGQ A;  3BJU A;  3IG2 A;  3V7S A;  5ELN A;  4CS4 A;  2EAY A;  3IKM B;  2DJZ A;  3V8K A;  1WNL A;  1BBU A;  1WQ7 A;  4OLF A;  3HRI A;  3R07 A;  4RQE A;  4Q15 A;  4BW9 A;  2ART A;  4XTY A;  4YP0 A;  1C0A A;  4XTX A;  1SRY A;  1YB3 A;  3A7R A;  3I7F A;  4XU2 A;  3V7C A;  4CS2 A;  4HVC A;  4AH6 A;  4E51 A;  4XTZ A;  2QHV A;  2E64 A;  4TWA A;  4WI1 A;  4RDX A;  3A74 A;  3PZC A;  4UP8 A;  4P74 A;  4YCU A;  2RHS A;  4P72 C;  2RHS B;  1WQW A;  4Q6G A;  1NJ2 A;  4YCW A;  3HXU A;  2ZIO A;  1ASY A;  3HXY A;  2QHS A;  4YRJ A;  3HFV A;  2E3C A;  2E41 A;  2E65 A;  5KNN A;  4ZTU B;  2ODR D;  3REU A;  2QHU A;  2DTH A;  2DU5 A;  1X2G A;  3P8T A;  2I4M A;  1EVL A;  4XEM A;  4YYE A;  3M4P A;  2Q5H A;  4YRT A;  5C53 B;  2CJA A;  2ZGW A;  4TQD A;  3QO8 A;  2FYK A;  1ADJ A;  3P8Y A;  2ARS A;  3VQW A;  2I4N A;  1IL2 A;  3REX A;  3OD1 A;  1HC7 A;  4WF2 A;  1Z7N A;  4J15 A;  3V7R A;  1H4Q A;  1EFW A;  2CIM A;  3EFS A;  1E1O A;  2CJB A;  1JJC A;  4KQE A;  5ELO A;  1JJC B;  2E10 A;  3A5Z A;  4UPA A;  2DVE A;  4YRQ A;  2Q7H A;  1EVK A;  3HTZ A;  2AKW A;  4XU1 A;  3VBB A;  2AKW B;  4X5O A;  2DTI A;  2ARU A;  4YRF A;  1VQZ A;  4YPF A;  5E3I A;  3VQY A;  3A7A A;  3CMQ A;  4YRK A;  2ZR2 A;  4ZTZ B;  1Z7M A;  1ASZ A;  2DKG A;  4H2S A;  4H2U A;  4CH4 A;  4L87 A;  5F5W A;  1BBW A;  3HXV A;  3BFM A;  1H4V B;  4K88 A;  3TEG A;  2AMC A;  2AMC B;  2ZZF A;  4YRL A;  1KMM A;  4CH3 A;  2EL9 A;  4O2D A;  1USY C;  1B76 A;  4HA8 A;  3IAL A;  4PG3 A;  1ATI A;  4HWS A;  1FYF A;  1NNH A;  2C7I A;  3RUX A;  3UH0 A;  3V8J A;  3NEL A;  2I4O A;  4P73 C;  2ALY B;  3E9H A;  3PCO A;  3P8V A;  1SES A;  3PCO B;  3UFG A;  3ERR A;  2XGT A;  1EQR A;  2E1H A;  3HY1 A;  3RKY A;  3RIR A;  3RGL A;  4BWA A;  4EO4 A;  4H2Y A;  2DXU A;  1G5H A;  3HFZ A;  4PHC A;  1X54 A;  3HRK A;  4CH6 A;  3HFZ B;  3TUP A;  2ZXF A;  2ZTG A;  1EOV A;  3A31 A;  2ZR3 A;  1YFT A;  1QF6 A;  2DZ9 A;  2DXT A;  2EWN A;  1QE0 A;  4UP9 A;  3TEH A;  2XTI A;  1ADY A;  3TEH B;  2EJ9 A;  1YFS A;  2Q7E A;  2DDZ A;  1NYQ A;  4YRN A;  1GGM A;  4H2X A;  1G51 A;  1BIB A;  4H2X B;  3NEM A;  2EJF A;  2PME A;  3IKL A;  1X55 A;  2DEQ A;  2PMF A;  4EX5 A;  2DQ3 A;  1H4S A;  4P75 A;  4KR2 A;  3A5Y A;  4H02 A;  4YRE A;  3A7U A;  3E9I A;  3ICA A;  4K87 A;  4XTV A;  4TVW A;  4YRO A;  1SET A;  1HXD A;  4DPG A;  3HXW A;  4YRM A;  3L4G A;  3L4G B;  2CGH A;  4WJ4 A;  1NJ8 A;  4P74 C;  4LNS A;  2P0L A;  2IY5 A;  1B7Y B;  11AS A;  2IY5 B;  4NCX A;  3NET A;  4TVA A;  4XEO A;  2DZC A;  4TVA B;  3G1Z A;  4G85 A;  3RAC A;  3MEY A;  4HWP A;  3HY0 A;  2DQ0 A;  3HXZ A;  3QTC A;  1W66 A;  4XTW A;  1NJ5 A;  4YRR A;  4ZIB A;  4P71 A;  2ZT7 A;  3WQZ A;  4P3O A;  1NJ6 A;  3V8L A;  5C52 B;  4YDQ A;  1B70 A;  1B70 B;  3FJP A; 
#chains in the Genus database with same CATH topology
 2NW9 A;  4YJ2 E;  3MAC A;  3AEF A;  4LVM A;  1E1T A;  3HXX A;  4DV6 T;  3KV5 A;  4P75 C;  2WY2 A;  1KOG A;  3UUM A;  3ZCJ A;  4U72 A;  5FY0 A;  4HWR A;  2MYS A;  4CQI A;  1EIY B;  1YGB A;  2ODV A;  3CQG B;  3P4P A;  2XQ6 A;  5LJN A;  4AXP A;  4ZI2 D;  2XQA A;  1WPY A;  3Q9D A;  4AKL A;  2FJA A;  4KI0 F;  5C51 B;  2CHN A;  5ABG A;  2Y8D A;  4H2W A;  3O1J A;  5ABF B;  4YRS A;  2ZNI A;  2B76 A;  3W3S A;  4DUZ T;  2AE9 A;  4ZS2 A;  4AIU A;  3HKD E;  4DV4 T;  1WLE A;  1LYL A;  4B3T T;  2I0M A;  4RMF A;  3EFR A;  3RKW A;  4EZH A;  2J3M A;  4UVA B;  5DAB A;  4JYA T;  3GN5 B;  1NEK A;  3F31 A;  4KR3 A;  2L3L A;  5CFB A;  4DV3 T;  3WAJ A;  3Q5W A;  12AS A;  2XY8 B;  4IL4 A;  3VKH A;  3AE7 A;  3ZMZ B;  2NTY A;  3PJA A;  2A3D A;  4XZC A;  5DQV A;  3N9L A;  3IHR A;  3PU3 A;  4UF0 A;  4DR7 T;  2CRB A;  4HEA A;  4KHP T;  1W9R A;  3UQ7 A;  2QHT A;  2VUR A;  4IDQ A;  2YOE A;  3TLV A;  4P72 A;  4XU0 A;  2W4X A;  2V5D A;  2EHO A;  2YU2 A;  4L5G A;  2DTO A;  4H9Q C;  3HR0 A;  2LT3 A;  2X0L B;  5FY7 A;  2I4L A;  4UR9 A;  4H2V A;  2XAF B;  2KT9 A;  4QX7 B;  3M4Q A;  1W0B A;  4HWO A;  3TKL B;  5A1L A;  4X65 T;  2UXX B;  2X68 A;  1X01 A;  2BG9 E;  3AXJ B;  4LFA T;  5KXJ A;  3E0Z A;  3IG2 A;  2ZM0 A;  4EZ4 A;  4CS4 A;  2MAW A;  2DJZ A;  4X1K E;  4WYV A;  5HXE A;  1WQ7 A;  2BZB A;  4U2Z A;  1N36 T;  2LM2 A;  3CPZ A;  4ZI3 D;  4YP0 A;  4XTX A;  3UU6 A;  4I0U A;  2Q9Q D;  1J1J A;  4GK5 E;  5HXH A;  3I1A A;  4QH1 A;  4EAH A;  4HVC A;  2VL0 A;  3K3N A;  4XTZ A;  4PK5 A;  2CM0 A;  3PUV F;  4DUY T;  5EK4 A;  3H3A A;  4YCU A;  2ACX A;  3P7I A;  1QUU A;  3EHZ A;  2CMR A;  4AQF A;  3LBX A;  1KNZ A;  1YQ3 A;  3RQU A;  3OTO T;  4Q6G A;  2IML A;  4PK4 A;  3RC8 A;  3H3M A;  4YRJ A;  2MOZ A;  4TV9 E;  4DO0 A;  2V6Y B;  4CZZ B;  2QGS A;  4QH5 A;  3ANW A;  2DU5 A;  4HFB A;  4CXX A;  3PV0 F;  5CB4 E;  3CQC B;  4UV9 B;  3RRC A;  3FBZ A;  2FJE A;  2WM9 A;  2X9Y A;  4H9N C;  2H7O A;  4YYE A;  3UU8 A;  4JI6 T;  3ZST A;  5C53 B;  5M4Y A;  5HAX A;  5FXZ A;  2JJ9 A;  4BAY B;  3N2K E;  2RPA A;  2UUA T;  2FYK A;  4EV6 A;  3IBP A;  3P8Y A;  3O1H A;  4HKA A;  2SPC A;  3REX A;  2J47 A;  3OD1 A;  1HC7 A;  3AE6 A;  3LG7 A;  4EED A;  2D5U A;  1E1O A;  2P9B A;  2XQ7 A;  3BQI A;  5ELO A;  1D1B A;  1JJC B;  5JQG E;  3A5Z A;  2RP4 A;  5LGT B;  5LG4 A;  2JRK A;  3VRB A;  4PJN A;  2X0Y A;  4LF9 T;  1Z8U A;  3HTZ A;  2CCQ A;  3AE8 A;  1IJ6 A;  2C5K T;  1IZN B;  4YPF A;  2X66 A;  3A7A A;  2FJD A;  2J62 A;  3CMQ A;  2GK9 A;  2ZR2 A;  5J2U E;  4ZTZ B;  1LRZ A;  3AED A;  4JBW F;  3NRX A;  4CH4 A;  3D0T A;  5AQO B;  4ILC A;  2LEH A;  4IST A;  5JDQ A;  1H4V B;  4K88 A;  4MAL A;  1D0Z A;  4I55 E;  3TEG A;  2AMC A;  3AA0 B;  4L9I A;  5FXX A;  3C98 B;  2ZZF A;  1KMM A;  4CH3 A;  2EL9 A;  2CBI A;  4TZ4 C;  1B76 A;  4HA8 A;  3IAL A;  2NP9 A;  1ATI A;  5LGU B;  1OED B;  3PUZ F;  3OPC A;  2C7I A;  3RUX A;  2N2N A;  3C4W A;  5IYZ E;  5LCY A;  1CHU A;  1XWM A;  3N9O A;  2EHO C;  5AQQ B;  3E9H A;  4PNI A;  4TNW A;  3P8V A;  2XGT A;  3ERR A;  3ZC0 A;  2LSJ A;  3RKY A;  2M6B A;  1N34 T;  5LB7 B;  1G5H A;  3R84 B;  5AFU L;  3HRK A;  5J0Z A;  3HFZ B;  2ZXF A;  3F2E A;  5JDM A;  2ZTG A;  3A31 A;  3TLS A;  2I59 A;  4UP9 A;  4H63 V;  2E5V A;  4OX9 T;  2Q7E A;  2WSS V;  4PJM A;  3AE3 A;  2DDZ A;  1Y01 A;  1NYQ A;  1UX5 A;  5FXV A;  1GGM A;  4H2X B;  4QXH B;  3NEM A;  2X51 A;  4V1A v;  3FBL A;  2JQQ A;  4TX5 A;  3ONJ A;  4B3M T;  3Q5D A;  3UFE A;  4Z90 A;  2DEQ A;  4DR2 T;  4EX5 A;  4YXD A;  4COF A;  3PE0 A;  2DQ3 A;  4P75 A;  1H4S A;  3A7U A;  4YRO A;  4TVW A;  5LP6 E;  3W15 B;  4H9O C;  5JDF A;  3RYC E;  3L4G B;  1W09 A;  2Y48 B;  3OVU A;  2MBG A;  4AQF C;  11AS A;  3RYF E;  2PG8 A;  3NET A;  5IWA T;  3ZYM A;  4XEO A;  2DZC A;  3AAA B;  2AXD S;  2BKN A;  3RAC A;  3ABV A;  5LHI B;  3AAE B;  5LA6 E;  4ILU A;  3MEY A;  3RHW A;  3HY0 A;  1US7 B;  3HXZ A;  4HTE A;  5IHY A;  3TLT A;  3QTC A;  1MNE A;  5ABE A;  5AQU B;  3AEB A;  1UGO A;  2W00 A;  3KDS E;  2W0G A;  2WWU A;  1ZV4 X;  3WQZ A;  4YTN A;  2BG9 B;  1B70 A;  3AEA A;  4YY3 T;  3FJP A;  3SS1 A;  3RI5 A;  1PYS B;  5JH7 E;  4OP0 A;  3AA7 B;  2LJL A;  3ZC1 A;  3J9X 1;  4AI6 A;  1L0V A;  5FVK A;  2E5A A;  1BR1 A;  3RL6 A;  1XZY A;  4GKK T;  4HWI B;  4DQ2 A;  2ZZG A;  3AE2 A;  2ALY A;  3AB3 B;  5L4H A;  2MTQ A;  4YRC A;  1KMN A;  3MA9 A;  5AQV B;  3VQX A;  4CI3 B;  1KFY A;  1WYC A;  2LLY A;  4YSY A;  3NWI A;  1YFR A;  1UK5 A;  1R8I A;  4PAG A;  1EIY A;  3CML A;  4HFH A;  4GK0 E;  1B7T A;  4YRG A;  1WRD A;  2Q5I A;  2ZNJ A;  2LSG A;  5HEJ A;  5FVL A;  1FMW A;  2CPT A;  3QO7 A;  1SER A;  3KFW X;  3PUA A;  4K86 A;  2E9X D;  3VQV A;  3RKX A;  3AE9 A;  5ABF A;  3ZMU B;  2XAH B;  2XQ9 A;  3UU4 A;  4JLE A;  2NTX A;  2XQY A;  5ADX L;  3HI2 A;  1U4Q A;  4LMJ A;  4I43 B;  3ZT7 A;  2UU9 T;  4B3R T;  2V7J A;  2CWY A;  2IHR 1;  5HCJ A;  2ZIM A;  4HFV A;  3QB5 A;  3L8R A;  2CEA A;  3GN5 A;  5AQM B;  4K0U A;  3ZSS A;  4ILB A;  5AQJ B;  1USY A;  3EDV A;  5K1X A;  5HCM A;  3MJX A;  5J2T E;  1YKH B;  4UXN B;  4IE0 A;  4CXY A;  2K9A A;  5HEU A;  1E22 A;  4TQF A;  1B7Y A;  2G4C A;  2WZI A;  2DCF A;  2CJ9 A;  2WS3 A;  1BR0 A;  4KBM B;  1NJ1 A;  1G5I A;  2IUB A;  3CX6 B;  5EK2 A;  4I4T E;  4IDZ A;  1MIV A;  5AQH B;  2BS4 A;  1E24 A;  5LYJ E;  4U7I A;  3AXJ A;  3SFD A;  2W66 A;  2X67 A;  3FZH B;  3KV4 A;  2HNI A;  4WW0 A;  4YTM A;  2N1G A;  1V9D A;  4O4I E;  3A8Y C;  5L3F B;  2EAY A;  1LVF A;  1BBU A;  4F6R C;  1HX8 A;  4QXB B;  3PUR A;  4X1Y E;  3SOL A;  3CK6 A;  4TN7 B;  2YEV C;  3K1S A;  3RRW A;  2CLY C;  2NS6 A;  2WU2 A;  2ART A;  1C0A A;  3C4X A;  3RH3 A;  5LJM A;  3I7F A;  5AQP B;  2XAJ B;  3RIU C;  2QHV A;  4TWA A;  2YIN A;  3UT5 E;  4RDX A;  2JIW A;  3JAF A;  1ZKE A;  5L4E A;  3HL6 A;  3AA6 B;  4O4J E;  2RHS B;  5L3B B;  1CUN A;  4YCW A;  3UUX B;  3TLW A;  2KWH A;  3HXY A;  5IUX A;  4IGU A;  3I9Y A;  2X9W A;  2NR4 A;  1X79 A;  2L8K A;  2V7M A;  5KNN A;  3ZMT B;  3IEE A;  1VRB A;  4X1I E;  1KNP A;  3K3O A;  2QHU A;  5LHH B;  3ZYK A;  1WCR A;  4ZOL E;  3EI0 A;  5JR9 B;  4XEM A;  4AIS A;  1H7C A;  2UXN B;  4IE7 A;  1S94 A;  4Z91 A;  2UXC T;  2Q5H A;  5CGM A;  3NRY A;  2CJA A;  4DMV A;  3RLF F;  3DTO A;  4TQD A;  2VL8 A;  4J2C A;  3HA4 A;  2V7I A;  2WB5 A;  3NZQ A;  2K5B B;  3VQW A;  1FMV A;  3K3Q C;  4DV1 T;  1IL2 A;  1IAP A;  2H89 A;  3I9W A;  3SRZ A;  2BBH A;  4AKH A;  3N2G E;  4WF2 A;  3ZMS B;  2LKG A;  4LF8 T;  1EFW A;  2PJQ A;  2CA5 A;  4DMW A;  2Q9Q B;  1WR6 A;  5TAO A;  1JJC A;  3N2O A;  4UPA A;  2DVE A;  1HX1 B;  3L39 A;  1XDO A;  4HN9 A;  2DHR A;  3VBB A;  1VCT A;  3T8O A;  4TWH A;  5HEH A;  2DTI A;  4BA9 A;  5E3I A;  3VQY A;  2V1D B;  4X5T A;  4OYJ A;  4YRK A;  1YW0 A;  4EYY R;  2XQ3 A;  3ZPO A;  4HE8 A;  2VKJ A;  4H2S A;  5GON E;  5JDL A;  5DJQ C;  3P50 A;  5JR9 C;  4ILA A;  4CI2 B;  4FI5 A;  4HGA A;  4K0K T;  4YRL A;  1OWA A;  2XM2 A;  2JQ9 A;  1USY C;  1MIY A;  2VAS A;  1W0A A;  1OED A;  4HWS A;  1HNX T;  4DV7 T;  1NNH A;  3NKZ A;  3KBT A;  4YHJ A;  1T98 A;  4O8S A;  4OFZ A;  4EB6 E;  3NEL A;  5EK3 A;  3ETV A;  4UIG A;  3AEC A;  3UFG A;  3A7M A;  2QA7 A;  3WAK A;  4GYS A;  1YD8 G;  1MMN A;  1IBL T;  3HFZ A;  2HPJ A;  5LG3 A;  4UVC B;  5LBM A;  1YFT A;  1QF6 A;  1HFA A;  3QC9 A;  4EIW A;  3L09 A;  1QE0 A;  3JC6 C;  2XTI A;  3TEH B;  3J7Y q;  2LHN A;  2UXB T;  4LVI A;  3ZT5 A;  5AQF B;  2WZH A;  4H2X A;  3U3I A;  4JUY A;  2EJF A;  3FZL B;  2ZLY A;  2V7K A;  2WDR A;  3A5Y A;  1I94 T;  4H02 A;  4XTV A;  3ICA A;  2VKD A;  2UUB T;  1SET A;  3NVO A;  3T1Y T;  3CVR A;  3L4G A;  3FHN A;  4NXM T;  3ZMV B;  1MIW A;  4WJ4 A;  3SFE A;  3C51 A;  3KIN B;  2W61 A;  4X62 T;  4JI2 T;  2IY5 B;  4HFI A;  4NCX A;  2BVM A;  5FKY A;  1JNZ A;  2V6X A;  2YKS A;  3FZF B;  4A56 A;  4XBF B;  4GYR A;  5JDG A;  3P8C D;  3AVR A;  3M65 A;  2F4V T;  3FZK B;  3MKD A;  2E8I A;  4NUV A;  4ZEY A;  4CN4 A;  2ZT7 A;  2YN6 A;  1KEY A;  4LML A;  2BG9 A;  4H9S E;  5LNK A;  4ZZB A;  3V7R A;  1PYS A;  2KIN B;  3GA8 A;  4IE4 A;  4JEH B;  4FJO A;  3A32 A;  4G84 A;  1WLX A;  1JNR A;  2EHO D;  2LSK A;  3QNE A;  3ZLI A;  1IBM T;  4LFB T;  3CQX C;  4H9P C;  2CBJ A;  3LSQ A;  4A5X A;  2QVA A;  2KZ7 B;  2YK0 A;  1G8X A;  3R6N A;  4X66 T;  1QLB A;  3RQW A;  4Z8X A;  3OYZ A;  2ZZE A;  3LK2 B;  1LVK A;  5CA0 E;  4YRP A;  5HEG A;  4TV8 E;  3L1A A;  1NWM X;  3LSV A;  3PUX F;  4ANJ A;  2KMF A;  4YRI A;  3PUQ A;  4DND A;  5E0O A;  2XSB A;  3LK4 2;  4EGW A;  2PBI A;  4HFD A;  4U3C A;  1L0W A;  4GIW A;  2ODR C;  1T72 A;  4UP7 A;  4IDP A;  4IT4 A;  2N9D A;  2WDQ A;  1NYR A;  1NEN A;  3TLU A;  1MMD A;  2VVN A;  1OED C;  2JQK A;  4KUM B;  4P3N A;  5FP3 A;  2V8S V;  4QH4 A;  2BBJ A;  5H6Q B;  4B6X A;  3RIU A;  2M67 A;  3LDQ B;  4H2T A;  3V5S A;  3E08 A;  3LJC A;  3CWZ B;  3CX7 B;  4P73 A;  4RQF A;  3KFU A;  3V5U A;  2P5I A;  3L2Z A;  2ZT6 A;  1OXZ A;  1HTT A;  2KSR A;  4LF7 T;  1X2H A;  2W62 A;  4NPP A;  2JMH A;  3K8P C;  2A9U A;  3EAB A;  5HWX A;  4CS3 A;  3RF1 A;  3LK3 B;  3IA3 A;  3JAD A;  4JI7 T;  1BIA A;  2K3W A;  4PFP A;  4YFS A;  5AQI B;  4JI1 T;  2ZCE A;  2RHQ B;  4HWT A;  3UGQ A;  1VCS A;  3V7S A;  5H6R B;  3DJB A;  2LOS A;  2LRK A;  3IKM B;  3V8K A;  3VR9 A;  2BKO A;  2K24 A;  4OLF A;  2E9X B;  3OBV E;  5AQS B;  3OYX A;  3R07 A;  3DP7 A;  1HNW T;  2BDE A;  4Q15 A;  4O4H E;  4BW9 A;  3O4X E;  2QRX A;  1YB3 A;  1MMG A;  3KVB A;  3A7R A;  4XU2 A;  2LM9 A;  4JEU B;  1KF6 A;  3FZM B;  4CS2 A;  3A74 A;  3PZC A;  3ESL A;  4P74 A;  2WBL A;  5FL1 A;  2RHS A;  3N9N A;  4P1N A;  4TUY E;  4AQY T;  1WQW A;  3Q2M A;  4BJM A;  3RKO A;  4HWF A;  1NJ2 A;  3HXU A;  2ZIO A;  2JQH A;  1S35 A;  4IE5 A;  2QHS A;  3HFV A;  3ZJ1 A;  3ZN1 B;  4QWN B;  2OV9 A;  4CXW A;  4WBN E;  5CA1 E;  1X2G A;  5JVD E;  5JR9 A;  2I4M A;  1EVL A;  2BG9 C;  1DU2 A;  3ZCI A;  3M4P A;  3MK7 C;  4YRT A;  4O2B E;  3PTR B;  2ZGW A;  5JDH A;  1WR0 A;  2X9X A;  4DR6 T;  2NWB A;  1IJ5 A;  2KLQ A;  5JRC B;  5FXW A;  1O3X A;  3CX8 B;  3B5M A;  4LF4 T;  2ARS A;  2KND A;  2I4N A;  5L2L A;  3N9P A;  3OKQ A;  2A2F X;  4PJJ A;  3OJA A;  1H4Q A;  3AE1 A;  2FJB A;  4O4L E;  2Q9Q A;  2CIM A;  4DBQ A;  3HKB E;  5AQG B;  2J4G A;  3RKG A;  4C90 A;  2XSA A;  3G06 A;  3UU5 A;  2CE7 A;  1EVK A;  4U33 A;  3P4S A;  5CJ5 A;  3KV6 A;  5HXC A;  4XU1 A;  2AKW B;  4X5O A;  3AE4 A;  4A98 A;  5L3E B;  2ARU A;  4YRF A;  3O1I A;  1VQZ A;  3MQZ A;  4H9R C;  2DKG A;  5FNV E;  4H2U A;  1E7P A;  4O2A E;  1D0Y A;  3ZJ2 A;  1BBW A;  4HT4 A;  5EZY E;  4UEL A;  2X9H A;  2BS2 A;  2BVL A;  2XHE B;  2HN1 A;  4PW8 A;  4E7Z A;  2DL1 A;  4ZI7 E;  2CXF A;  2YDR A;  4O2D A;  3PJA J;  3WI3 A;  4PG3 A;  3NBX X;  5L3D B;  2VQF T;  1FYF A;  4IE6 A;  2J1D G;  1YKE B;  4ASK A;  2RA1 A;  2D0U A;  2WQY A;  3AA1 B;  5HYA A;  4P73 C;  4G2A A;  2ALY B;  2LOP A;  4C91 A;  2ACZ A;  2V5C A;  3PCO B;  3QB5 K;  2KWI B;  1EQR A;  4UV8 B;  3HY1 A;  3RIA A;  3RIR A;  4BWA A;  3GMI A;  2V6Y A;  4F8H A;  4YTP A;  3I0O A;  3N9Q A;  2DXU A;  4EO4 A;  3BQK A;  4IL9 A;  4PHC A;  1HG2 A;  1YQ4 A;  3CIR A;  4MHC A;  4HFC A;  3U78 A;  4DV2 T;  1ZP0 A;  2ZR3 A;  2R6G F;  1XMQ T;  4HWH A;  2BS3 A;  1KK7 A;  4ZI2 C;  3PUW F;  2EWN A;  3N9M A;  4H63 H;  3TEH A;  1KNR A;  2EJ9 A;  2VWA A;  2YU1 A;  1M62 A;  4YRN A;  1G51 A;  1BIB A;  2E2A A;  5FYM A;  3PUG A;  4LVJ A;  1SE7 A;  2V26 A;  3UUB A;  4LF6 T;  1X55 A;  2WMN A;  2PMF A;  4UEM A;  3VU7 H;  3E9I A;  4K87 A;  3AEE A;  3EUH A;  4X64 T;  3UQ4 A;  3RPU A;  2C5J A;  3HXW A;  2XQ5 A;  4BJN A;  4MLK A;  2CGH A;  2CWO A;  3FB2 A;  3RYH E;  4P74 C;  2UUC T;  4LNS A;  2IY5 A;  3NZP A;  1B7Y B;  2H88 A;  5HEO A;  1UUS A;  4NIQ A;  4TVA B;  3G1Z A;  5LBQ B;  4G85 A;  1J5E T;  1LKX A;  5LMU T;  2E5L T;  4N78 D;  2DQ0 A;  3B57 A;  2WAU A;  1I6Z A;  4OYK A;  1HTJ F;  5ETW A;  4U31 A;  2XJ7 A;  3HKE E;  4ZIB A;  2ZM6 T;  4DV0 T;  3O9X A;  4WZX A;  4YT0 A;  1NJ6 A;  2XM1 A;  1WYB A;  4EXT A;  4YDQ A;  5HXS A;  2JPF A;  3ZN0 B;  3SWH A;  2DU7 A;  4EEB A;  2IW5 B;  5KX5 E;  1IBK T;  5C2T A;  3QNU A;  2A8E A;  4HFE A;  2XPK A;  3KBU A;  1FIO A;  2LKH A;  4A97 A;  1N9W A;  3LSS A;  4KMC A;  1J5W A;  4ZI3 C;  3NEN A;  3MF1 A;  3ZT6 A;  4DR1 T;  2ZT5 A;  5BMV E;  4TWD A;  2XZE A;  4KX6 A;  1BR4 A;  3AE5 A;  2Q9Q C;  2W63 A;  2M6I A;  2Q7G A;  1E1H B;  2VKH A;  1XNQ T;  1UCU A;  2XQ8 A;  4P09 A;  3C50 A;  3UUN A;  2WMO A;  3UU3 A;  4ADZ A;  1B8A A;  5F3J A;  4ZZC A;  4YSX A;  2C8M A;  4X20 E;  4TVY A;  3P4Q A;  4U7Y A;  3JC6 D;  5LXT E;  2ZIN A;  2XTL A;  4YCV A;  1X56 A;  5K1P A;  4U74 A;  4IDO A;  4TTV A;  2HN2 A;  3MF2 A;  1HG5 A;  4JV5 T;  1U5P A;  1H4T A;  2HH7 A;  4P3P A;  3QO5 A;  3MZK B;  2DWK A;  4TNV A;  4P71 C;  4WJ3 M;  1HF8 A;  4G63 A;  4EYU A;  3AVS A;  3X1D A;  2FBW A;  3KV9 A;  2H3R A;  4CH5 A;  4LVL A;  3DSQ A;  4M1P A;  1D0X A;  2IIU A;  1VOM A;  4P0A A;  3LC0 A;  5ABH A;  4XTU A;  3AAI A;  4NUU A;  2ZM2 A;  4UF0 B;  1WYD A;  2XAQ B;  2Y6X A;  1WU7 A;  4YHH T;  2L9Q A;  1RIQ A;  2EJG A;  2EHO B;  5FL0 A;  3UTK A;  4XU3 A;  4EOZ B;  2ZT8 A;  1SUM B;  5AQN B;  2C0S A;  4AKG A;  5HGQ A;  3Q5X A;  1XNR T;  4JI3 T;  2VKO A;  2I6H A;  4JI0 T;  2NW8 A;  2J3L A;  5BR8 T;  3ONL C;  4ISS A;  2RHQ A;  2NW7 A;  2PFV A;  3UGT A;  4LF5 T;  3BJU A;  3N5L A;  4YSZ A;  4QXC B;  5ELN A;  5KMG P;  2LSY A;  1WNL A;  1FEW A;  1ZOY A;  3VRA A;  4JI4 T;  2E9X A;  2X0H A;  3HRI A;  4RQE A;  1YXR A;  2LRL A;  2Z6E A;  1E2A A;  5AQL B;  4DR5 T;  2WDV A;  3EAM A;  2C5I T;  4XTY A;  5LHG B;  3RIF A;  2WU5 A;  4MFR A;  3VR8 A;  4KHZ F;  1SRY A;  3H37 A;  1EZ3 A;  3MXZ A;  2NOX A;  1XMO T;  1HNZ T;  2QYW A;  2LE8 A;  3V7C A;  4DVD A;  4AH6 A;  4E51 A;  2E64 A;  4WI1 A;  5KDM C;  3Q5E A;  2JMK A;  4UP8 A;  1SHZ C;  4P72 C;  3B13 A;  3LBX B;  1BR2 A;  3BQL A;  5LMN T;  1ASY A;  2DI4 A;  2D2S A;  2E3C A;  2E41 A;  2E65 A;  1ZEE A;  5LOV E;  2YDS A;  4ZTU B;  2ODR D;  3REU A;  3HKC E;  2DTH A;  3ANW B;  3P8T A;  5FY1 A;  5LGN B;  3F57 A;  3PUY F;  4YJ3 E;  4P0B A;  1SA0 E;  3VHL A;  2D0T A;  2B1E A;  2FUP A;  4HWC A;  5HXR A;  2UXD T;  2VQE T;  5JRC A;  3QO8 A;  1ADJ A;  2IC6 A;  2DLR A;  4WNK A;  3PDY A;  3AEG A;  2VVS A;  3A5X A;  3ZEF B;  4DR4 T;  4CI1 B;  5DQW A;  4QX8 B;  2XUE A;  2A72 A;  3QK6 A;  4QKN A;  1Z7N A;  4J15 A;  3EFS A;  2OA5 A;  1XDP A;  1Z0P A;  2W67 A;  4OK0 A;  3KVA A;  3FXE B;  3QUJ A;  2CJB A;  2PTF A;  4KQE A;  3EVY A;  5C3J A;  2E10 A;  3UUL A;  4MBQ A;  4YRQ A;  4L0R A;  1UUR A;  2Q7H A;  5J1G A;  5AQT B;  5L3C B;  4QHO A;  5HWY A;  2LHR A;  2AKW A;  2MPK A;  5JRE A;  2DNX A;  3C64 A;  4OHF A;  1N32 T;  1QSD A;  5JTG A;  1Z7M A;  2OLT A;  1ASZ A;  5AQK B;  3P4W A;  2IDO B;  2ZM8 A;  3IF8 B;  4CN6 A;  2CXD A;  4IIJ E;  5F5W A;  4L87 A;  3HXV A;  3BFM A;  2G0U A;  2W2U A;  2BKP A;  4U2Y A;  4GKJ T;  3LFM A;  2H7V C;  3ONX A;  3QOF A;  4I50 E;  2AMC B;  1T8B A;  3ZKR A;  4LFC T;  1MMA A;  2CXL A;  4PFO A;  2V7L A;  5L3G B;  1N33 T;  2LSI A;  2WP9 A;  4JI5 T;  4IHJ E;  2D9D A;  1WFD A;  2IC9 A;  4HWD A;  4E7S A;  3UH0 A;  3L3P A;  3V8J A;  2WCA A;  2I4O A;  3RC3 A;  4LMK A;  3VKG A;  2VK9 A;  1AJ3 A;  3ZYL A;  2HHH T;  3GWH A;  3PCO A;  3T1H T;  1SES A;  1MND A;  4DID B;  4KP3 C;  2YDQ A;  2E1H A;  3RGL A;  2XQ4 A;  4H2Y A;  1X54 A;  4CH6 A;  3TUP A;  3JAE A;  1EOV A;  2VB6 A;  4IRE A;  4UVB B;  3RYI E;  4PK6 A;  2WWV A;  1UX4 A;  1HCI A;  4AKR B;  2DZ9 A;  4Q25 A;  2DXT A;  4ZXL A;  1ZHC A;  1NAF A;  3RX6 A;  1ADY A;  3FXD B;  1YFS A;  4ZHQ E;  2E9X C;  3PUS A;  5L47 A;  4PJL A;  4AKI A;  3I0Q A;  5C8Y E;  3P4R A;  3PU8 A;  5F8P A;  4YLH A;  1HS7 A;  4IDN A;  2PME A;  1T7S A;  3IKL A;  2CLY B;  1X9B A;  4DBR A;  2HPL A;  4DR3 T;  4JI8 T;  2ZMA A;  3E22 E;  4KR2 A;  2IAK A;  1D1A A;  1M7K A;  4YRE A;  4DPG A;  1HXD A;  4YRM A;  3BK9 A;  1NJ8 A;  2XAG B;  4ZS3 A;  1GQE A;  2P0L A;  4TVA A;  4B3S T;  4LVK A;  2XAS B;  3C4Z A;  5AQR B;  1HR0 T;  3M3Z B;  5JDN A;  1D1C A;  4NXN T;  4HWP A;  1G73 A;  4CN1 A;  4WBO A;  3JCF A;  4ERR A;  1FJG T;  2ES0 A;  4AQG A;  1W66 A;  3CKD A;  4XTW A;  1NJ5 A;  2ODU A;  1Y64 B;  4YRR A;  2DWG A;  4P71 A;  2K48 A;  4GOU A;  1OED E;  4P3O A;  2KXP B;  4DV5 T;  3V8L A;  3ETU A;  4TWF A;  4XAX B;  5C52 B;  3EDU A;  2CHO A;  1B70 B;  5FMN A;  3S4U A; 
#chains in the Genus database with same CATH homology
 1PYS A;  2DU7 A;  1PYS B;  4OP0 A;  3A32 A;  4G84 A;  2A8E A;  4LVM A;  2E5A A;  1E1T A;  3HXX A;  3RL6 A;  3QNE A;  1N9W A;  3LSS A;  1J5W A;  4DQ2 A;  2ZZG A;  2ALY A;  3NEN A;  4P75 C;  3MF1 A;  4YRC A;  1KMN A;  2ZT5 A;  1KOG A;  3LSQ A;  3VQX A;  2Q7G A;  4HWR A;  1YFR A;  1EIY A;  1EIY B;  1YGB A;  4YRG A;  2ZZE A;  2Q5I A;  1B8A A;  2ZNJ A;  2C8M A;  4TVY A;  4YRP A;  2ZIN A;  3L1A A;  3QO7 A;  4YCV A;  1SER A;  1X56 A;  1WPY A;  5K1P A;  4YRI A;  4K86 A;  4TTV A;  5C51 B;  3VQV A;  3MF2 A;  3RKX A;  4H2W A;  1H4T A;  4YRS A;  2ZNI A;  4P3P A;  3W3S A;  3QO5 A;  1L0W A;  1WLE A;  1LYL A;  4P71 C;  2ODR C;  4WJ3 M;  4RMF A;  2ZIM A;  3EFR A;  4UP7 A;  3RKW A;  2J3M A;  1NYR A;  4CH5 A;  4LVL A;  3DSQ A;  4KR3 A;  1USY A;  4P3N A;  5K1X A;  12AS A;  3LC0 A;  4H2T A;  4XTU A;  1E22 A;  4TQF A;  1B7Y A;  1WYD A;  2G4C A;  2QHT A;  1WU7 A;  4P72 A;  4P73 A;  4XU0 A;  4RQF A;  3KFU A;  1RIQ A;  2EJG A;  2CJ9 A;  2P5I A;  2DTO A;  3L2Z A;  2ZT6 A;  4XU3 A;  1HTT A;  1NJ1 A;  1G5I A;  1X2H A;  2I4L A;  2ZT8 A;  4H2V A;  5HGQ A;  3M4Q A;  4HWO A;  1E24 A;  4CS3 A;  3RF1 A;  1X01 A;  1BIA A;  2J3L A;  2RHQ A;  3UGT A;  2HNI A;  2ZCE A;  2RHQ B;  4HWT A;  3UGQ A;  3BJU A;  3IG2 A;  3V7S A;  5ELN A;  4CS4 A;  2EAY A;  3IKM B;  2DJZ A;  3V8K A;  1WNL A;  1BBU A;  1WQ7 A;  4OLF A;  3HRI A;  3R07 A;  4RQE A;  4Q15 A;  2NS6 A;  4BW9 A;  2ART A;  4XTY A;  4YP0 A;  1C0A A;  4XTX A;  1SRY A;  1YB3 A;  3A7R A;  3I7F A;  4XU2 A;  3V7C A;  4CS2 A;  4HVC A;  4AH6 A;  4E51 A;  4XTZ A;  2QHV A;  2E64 A;  4TWA A;  4WI1 A;  4RDX A;  3A74 A;  3PZC A;  4UP8 A;  4P74 A;  4YCU A;  2RHS A;  4P72 C;  2RHS B;  1WQW A;  4Q6G A;  1NJ2 A;  4YCW A;  3HXU A;  2ZIO A;  1ASY A;  3HXY A;  2QHS A;  4YRJ A;  3HFV A;  2E3C A;  2E41 A;  2E65 A;  5KNN A;  4ZTU B;  2ODR D;  3REU A;  2QHU A;  2DTH A;  2DU5 A;  1X2G A;  3P8T A;  2I4M A;  1EVL A;  4XEM A;  4YYE A;  3M4P A;  2Q5H A;  4YRT A;  5C53 B;  2CJA A;  2ZGW A;  4TQD A;  3QO8 A;  2FYK A;  1ADJ A;  3P8Y A;  2ARS A;  3VQW A;  2I4N A;  1IL2 A;  3REX A;  3OD1 A;  1HC7 A;  4WF2 A;  1Z7N A;  4J15 A;  3V7R A;  1H4Q A;  1EFW A;  2CIM A;  3EFS A;  1E1O A;  2CJB A;  1JJC A;  4KQE A;  5ELO A;  1JJC B;  2E10 A;  3A5Z A;  4UPA A;  2DVE A;  4YRQ A;  2Q7H A;  1EVK A;  3HTZ A;  2AKW A;  4XU1 A;  3VBB A;  2AKW B;  4X5O A;  2DTI A;  2ARU A;  4YRF A;  1VQZ A;  4YPF A;  5E3I A;  3VQY A;  3A7A A;  3MQZ A;  3CMQ A;  4YRK A;  2ZR2 A;  4ZTZ B;  1Z7M A;  1ASZ A;  2DKG A;  4H2S A;  4H2U A;  4CH4 A;  4L87 A;  5F5W A;  1BBW A;  4HT4 A;  3HXV A;  3BFM A;  1H4V B;  4K88 A;  3TEG A;  2AMC A;  2AMC B;  2ZZF A;  4YRL A;  1KMM A;  4CH3 A;  2EL9 A;  4O2D A;  1USY C;  1B76 A;  4HA8 A;  3IAL A;  4PG3 A;  1ATI A;  4HWS A;  1FYF A;  1NNH A;  2C7I A;  3RUX A;  3UH0 A;  3V8J A;  3NEL A;  2I4O A;  4P73 C;  2ALY B;  3E9H A;  3PCO A;  3P8V A;  1SES A;  3PCO B;  3UFG A;  3ERR A;  2XGT A;  1EQR A;  2E1H A;  3HY1 A;  3RKY A;  3RIR A;  3RGL A;  4BWA A;  4EO4 A;  4H2Y A;  2DXU A;  1G5H A;  3HFZ A;  4PHC A;  1X54 A;  3HRK A;  4CH6 A;  3HFZ B;  3TUP A;  2ZXF A;  2ZTG A;  1EOV A;  3A31 A;  2ZR3 A;  1YFT A;  1QF6 A;  2DZ9 A;  2DXT A;  2EWN A;  1QE0 A;  4UP9 A;  3TEH A;  2XTI A;  1ADY A;  3TEH B;  2EJ9 A;  1YFS A;  4LVI A;  2Q7E A;  2DDZ A;  1NYQ A;  4YRN A;  1GGM A;  4H2X A;  1G51 A;  1BIB A;  4H2X B;  3NEM A;  2EJF A;  4LVJ A;  2PME A;  3IKL A;  1X55 A;  2DEQ A;  2PMF A;  4EX5 A;  2DQ3 A;  1H4S A;  4P75 A;  4KR2 A;  3A5Y A;  4H02 A;  4YRE A;  3A7U A;  3E9I A;  3ICA A;  4K87 A;  4XTV A;  4TVW A;  4YRO A;  1SET A;  1HXD A;  4DPG A;  3HXW A;  4YRM A;  3L4G A;  3L4G B;  2CGH A;  4WJ4 A;  1NJ8 A;  4P74 C;  4LNS A;  2P0L A;  2IY5 A;  1B7Y B;  11AS A;  2IY5 B;  4NCX A;  3NET A;  4TVA A;  4XEO A;  2DZC A;  4TVA B;  3G1Z A;  4LVK A;  4G85 A;  3RAC A;  3MEY A;  4HWP A;  3HY0 A;  2DQ0 A;  3HXZ A;  3QTC A;  1W66 A;  4XTW A;  1NJ5 A;  4YRR A;  4ZIB A;  4P71 A;  2ZT7 A;  3WQZ A;  4P3O A;  1NJ6 A;  3V8L A;  5C52 B;  4YDQ A;  1B70 A;  1B70 B;  3FJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...