3IKLA

Crystal structure of pol gb delta-i4.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
388
structure length
364
Chain Sequence
SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRGGRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-2, mitochondrial
publication title Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 364
sequence length 388
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3iklA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3iklA02
1E1OA 3HTZA 1H4VB 4YCUA 2IY5A 1X54A 4UP7A 4XTXA 2ALYB 3QO5A 1EIYA 3A31A 3LC0A 2CIMA 3IKMB 1B76A 4WJ4A 3HXZA 2G4CA 2DZCA 4EX5A 3RKYA 4CH4A 1B70B 1JJCB 3L2ZA 3NENA 5E3IA 2EAYA 4PHCA 2ZR2A 4EO4A 2ZTGA 1SESA 4YRGA 2RHQB 3A74A 2ALYA 3A5ZA 3TEHB 1IL2A 3NETA 1GGMA 4TVWA 1E22A 1EVKA 2E1HA 1YFSA 1EQRA 1N9WA 1B70A 1BIBA 1J5WA 1JJCA 3UH0A 4K87A 3QO8A 12ASA 2J3LA 3P8YA 2ZT7A 2RHQA 4CH5A 2CJBA 1KOGA 3TEHA 3PZCA 3HY0A 3RGLA 3IALA 3HXWA 3RL6A 2I4OA 3OD1A 3RKWA 5C51B 4ZTZB 3UFGA 4YRNA 3A7AA 3WQZA 2AMCB 4P75A 4P3NA 1HXDA 4WJ3M 2QHVA 2I4NA 2ZIMA 4H2TA 4WI1A 4YRMA 3ERRA 2ZT8A 4Q15A 3I7FA 2Q7GA 1B7YB 1Z7NA 2EJGA 2I4MA 1H4SA 2AMCA 2EWNA 1SRYA 4YRCA 1WNLA 4YPFA 4DQ2A 3E9IA 4HVCA 4CS2A 3A32A 5HGQA 1ADYA 4P72A 1BBWA 1YB3A 2ZT5A 3EFRA 2DU7A 1W66A 2DJZA 3TUPA 2C7IA 3P8VA 1FYFA 3HXYA 3DSQA 2LW7A 2ARTA 2DQ0A 4G85A 4P71C 3VQXA 1B7YA 1ASYA 2DQ3A 3QO7A 1G5IA 3HY1A 2QHTA 3CMQA 4CH3A 4XU0A 4HWTA 4E51A 3VBBA 4YRJA 3V8JA 1YGBA 1WU7A 1KMMA 1QE0A 4XU3A 4H2YA 4XTZA 4BWAA 3HFVA 4YRFA 4YRLA 2ZZFA 2Q7EA 3VQVA 3HRIA 2XGTA 4TTVA 1EVLA 4YCVA 5ELOA 2C8MA 2EL9A 3V8KA 4G84A 4K86A 2Q5IA 3HXXA 3IKLA 4H2VA 1WYDA 1KMNA 1PYSB 4XTYA 3RKXA 3M4QA 1USYA 3IG2A 1E1TA 2ARSA 4DPGA 4RDXA 2DKGA 2PMEA 4P73C 4OLFA 5C52B 4CH6A 3UGTA 1G5HA 5ELNA 3BJUA 3FJPA 2QHSA 2XTIA 2ODRD 3MF1A 4KR2A 1NJ8A 2CJAA 2DDZA 2I4LA 1ATIA 4XEMA 1EOVA 3P8TA 4H2UA 4RQEA 1BBUA 5KNNA 1VQZA 1X55A 1WQWA 2DEQA 5K1PA 2ZINA 1WPYA 4UP8A 4YRIA 2ZIOA 2RHSB 3V7RA 3V8LA 1ASZA 1X01A 1NYRA 3W3SA 1X2HA 2E64A 3TEGA 2ZR3A 4TWAA 4P3PA 1NJ5A 4HWOA 4Q6GA 3M4PA 3NEMA 3REXA 2DTHA 3UGQA 4WF2A 4XTVA 3HXUA 3BFMA 3V7SA 4RMFA 2RHSA 4K88A 1LYLA 4HWRA 4H2WA 1EIYB 2E5AA 1NJ1A 1V95A 2FYKA 4TVAB 2ARUA 1X56A 4KQEA 3RF1A 3L4GB 4BW9A 3LSQA 2DU5A 2Q5HA 2J3MA 4TVYA 1H4TA 2EJ9A 4YRQA 3HXVA 1C0AA 2ZXFA 1USYC 3G1ZA 1NJ2A 4HWPA 2ODRC 4CS3A 3HRKA 2QHUA 4UPAA 4P74A 2PMFA 3A5YA 4TVAA 4YP0A 4J15A 4P71A 4YRTA 1NNHA 3L4GA 4XTUA 4YREA 2ZT6A 4ZIBA 1B8AA 2DXTA 1SERA 1NYQA 2P5IA 4YRSA 1YFTA 2HNIA 2EJFA 4L87A 4AH6A 3MF2A 1RIQA 1HTTA 4XTWA 4X5OA 2ZCEA 1Z7MA 4XEOA 1WLEA 4P75C 2DTIA 3KFUA 3V7CA 2DVEA 2AKWB 3HFZB 3VQWA 1PYSA 1EFWA 2ZNIA 3L1AA 2E3CA 4YRKA 4LNSA 4H2SA 3EFSA 4P3OA 4H2XB 4TQFA 4XU2A 1E24A 2ZZEA 3RACA 4CS4A 4HWSA 3MEYA 4YDQA 3QNEA 2AKWA 3ICAA 4TQDA 3HFZA 4HA8A 4P72C 4ZTUB 1YFRA 3R07A 4YRPA 5K1XA 2P0LA 2DTOA 1SETA 4YRRA 4KR3A 4YROA 11ASA 4H2XA 4NCXA 4P73A 3RIRA 2CJ9A 4OP0A 3A7RA 4YYEA 2CGHA 4XU1A 1QF6A 3RUXA 4H02A 3NELA 4PG3A 2E10A 1HC7A 2DXUA 5F5WA 1NJ6A 5C53B 3QTCA 1L0WA 2E65A 2E41A 3PCOB 2IY5B 4O2DA 2ZZGA 2DZ9A 4UP9A 1ADJA 3LSSA 4YCWA 3REUA 3VQYA 2ZGWA 3E9HA 3A7UA 1G51A 4RQFA 2Q7HA 1WQ7A 1H4QA 1X2GA 2ZNJA 4P74C 1BIAA 3PCOA
chains in the Genus database with same CATH superfamily
2OXRA 2HA5A 3D6MA 3IT2A 5F9HA 3HTZA 2Q3LA 3AU8A 5GVRA 2FY8A 1QU2A 3TVYA 4EKDA 1T8WA 1O54A 1QFJA 1LLUA 3NKLA 1IAVA 2F2TA 5AVXA 1YB6A 1KH2A 2ZRJA 3H19A 1GU0A 4GSLA 4HJXA 1B3BA 4OQEA 3SM9A 1A88A 1NNSA 1XEWY 1SJ9A 3NT2A 1XB2A 2JB9A 5DHTA 1EDOA 4DNQA 4M22A 2QUZA 1E4OA 3V1TC 3UYKA 1B76A 3K4HA 4QVGA 3TCKA 1BDBA 1YDFA 4FGKA 4QRIA 5JD3A 4GRDA 1K3FA 3RRXA 4UVEA 3WWEA 1WVGA 4DA6A 4HFJA 4RFVA 1CP3A 3K9QO 3URKA 5AVZA 2EAUA 3A9VA 1HZZC 3M5PA 1IAQA 1VDMA 4D41A 1QRRA 4QVIA 3L2ZA 2ZR9A 2ZYGA 3ORHA 1KP2A 5HWSA 5L6MB 5J4VA 4FMPA 3U37A 3QLJA 1U1IA 4Y2GA 4PLFA 5LIPA 3F73A 1CUBA 3EZGA 4PHCA 1V8FA 2ZR2A 5ALGA 4EO4A 2ZJFA 4LXYA 4DPMA 3FWPA 3IESA 2QT0A 1QQ7A 3FOEC 1QDLB 1TJYA 2PUBA 4KEAA 3WG9A 4Q9HA 4B44A 1SKUA 1KVSA 1IL2A 1N2SA 2QTCA 3DFUA 3PEEA 4U7GA 2BMJA 1F14A 3NANA 4AZVA 3R9XA 3OIWA 2HU5A 2NXNA 4Z9FA 2C82A 5A3SA 3OHMA 1IJEA 1U0LA 1FNNA 2OHOA 1X1TA 2XNSA 1DZIA 2QZZA 3B36A 3MINA 3E27A 5TGZA 3WL4A 5J2UA 4YUZA 2V1UA 2I7VA 4GR4A 2VF5X 1CW2B 3H4TA 2LCQA 4YV0A 1SNYA 3VU0A 3A1DA 3M89A 1W29A 1S1CA 2CWWA 3LFTA 3PA6A 3BWVA 4ARZB 4B45A 2XF8A 3MUEA 3K6JA 3VM6A 2O8BB 1QGUB 4NFYA 3ZDXB 4D4GA 3VYTB 4ALJA 4AZ0A 4D0RA 4W1PA 5A3VA 5KVVA 2E5LB 3PGXA 4MGIR 2WQ6A 2OA0A 2QRPA 1LI5A 4FSHA 4HXGA 4E7PA 1NVMB 2RHQA 4CH5A 5INTA 1I8TA 3DMFA 3KQQA 4HNQA 1IEQA 1UPXA 4L5JA 2JAQA 4J0FA 4L8YA 4U0KA 4E08A 2ICAA 3TLXA 4NU5A 4FMCB 4TX1A 3NOVA 4M9RA 4QVKA 1OH8A 1KI4A 5E95A 2EFJA 5ENDA 2XCLA 1FNBA 4D0NA 1FNDA 3UWPA 4OHYA 1TRKA 3HLYA 4C7VA 1QCCA 3WGVA 4DXAA 1K06A 2XYQA 5CBPB 4MQEA 5C46F 3MNFA 2VUHB 1KPHA 4D1YA 1ESNA 1BJTA 1EVYA 2COUA 3OMWA 5G4LA 3INGA 3RYFA 4U2GA 5E1OA 1SK9A 2L19A 2BKLA 2QORA 4MQUA 3S68A 4XVCA 1RWWA 2D7CA 4JEHA 1OW3B 1YJXA 1HXDA 3WOVA 4DLRA 1MJGM 1N9KA 2V9ZA 3EX7C 1MB9A 1HYBA 4WJ3M 4G0PA 5BMVA 4ESVA 1U2ZA 4OQLA 8AT1A 3B1VA 5IZ4A 2VHCA 3PXAA 3TQCA 3T61A 1V6CA 3DOFA 3PC2A 5JU6A 2G5CA 4Y9SA 1U6IA 4AZ3B 2PZFA 2FQQA 5K2MA 5E7IA 4W6QA 2GOYA 2ZYTX 1WBDA 4TMZA 4RMJA 1N2CA 3DMTC 4U7JA 4NEHB 2D8MA 3DQPA 5JQGF 1LBQA 4FE4A 5B3JA 1VIMA 4TMTA 3RS7A 1Q83A 4B6QA 1KXZA 3IR6A 3FOCA 1N32B 3TLYA 3VR3D 2Z57A 1Q19A 1MT3A 2HA3A 4I8XA 4F2GA 4G9GA 5JNSA 3F1KA 4D97A 5GZ6A 4Z53A 2BEKA 1QGYA 1ISFA 4MOWA 3O91A 4P72A 2NXJA 3L7OA 4Q24A 1N8SA 3GCGA 5FWDA 4B5LA 1M1XB 3EBPA 1H8HD 2VHZA 3LUPA 3A9TA 1CZOA 1MRNA 4BZQA 1UK7A 4X44A 1MAVA 1W66A 2CEAA 2QTTA 3AXSA 2GD0A 3LZ6A 5ESDA 1RJGA 4G41A 3CX7A 3ZKAA 4FFPA 1W4ZA 3DTVA 1RQ2A 1UDXA 3K92A 4P4SB 1R5NA 4CR6A 4CQMB 2WVGA 4R6WA 2Z3VA 2X8LA 3NTVA 4FQ5A 3RC2A 1H2HA 2AMJA 3QHAA 3H11B 3IIKA 3FVTA 5ERGB 2YBEA 5G2OA 4UU1A 1C7ZA 3SQMA 3THYA 3ZD7A 3P9YA 2QD1A 3ABSB 5IEJA 2IS6A 3HY1A 1OJ7A 2EEZA 3FPBA 2XJ4A 1Z36A 3KSAC 2VDJA 2QMEA 3EIXA 1NBIA 4G4JA 2WE8A 1XEXB 1CUAA 1KAOA 2XUQA 2DQZA 3C98A 3H5IA 2UVQA 2VAMA 2FSVA 2QI9F 2DULA 4BVKA 4JC5A 1A7AA 4BLUA 2XGOA 3QBDA 4OXNA 1F38A 2QZ9A 4IHJF 1V8ZA 1VLQA 4Z4QA 4BXOA 4OXRA 4X54A 1N2OA 1CPYA 2WSYB 3B51X 5JBQA 3VZDA 4YLEA 2BAGA 3ABOB 4CIYA 2FP3A 5MHTA 3FFBA 1D1PA 3F1LA 1IQ0A 4MUXA 4ZU1X 3QLUA 1OR8A 4FN5A 2XGTA 2JHCA 4FYMA 4RK5A 2OGSA 2YV4A 3KEOA 1WKCA 3HA2A 3L1KA 4C89A 1DUVG 1JKFA 3VR2D 3VZSA 4AKEA 4BNNA 1IHOA 2HNAA 3MF4A 4F86A 4L22A 3P2OA 3RIMA 5FOTA 4S0ZA 3KL2A 1CZRA 4Z7QB 4ZDJA 1KARA 2RHOA 1XD9A 4GI3A 4NCNA 5E7MA 1N6LA 5ER6A 1IBLB 1Z8FA 1B0PA 1M1YA 2AOUB 2NNLD 1EWQA 5FOUA 1V1MA 1UCFA 1U81A 3QX7A 4QYWA 4X7BA 4O2RA 3C3AA 1QIKA 1OB5A 1H6CA 3FI0A 2GTPA 2NNWB 4A3SA 2CHFA 2XYRA 5ENVA 4TL7A 4HNGA 4AMGA 2VPIA 3DBHA 3F97A 2DPMA 2LD4A 3PHIA 5EZYB 4MA4A 3HYTA 1E1TA 3I6BA 3Q3CA 3QTBA 3JTEA 4HRAA 3TQOA 5DCLA 1U7OA 3F9IA 2PX8A 3E3OA 1FTSA 5LU9A 4DR2B 5JADA 4M1WA 3ECSA 5ELXA 2AEFA 1O4WA 2KPOA 4KKXB 1NX6A 3NC0C 4PYLA 4QG7A 2POCA 4OLJA 4I1PA 3M6MD 2YIDA 1YR2A 1ZWKA 1QO7A 2B1JA 1ZK0A 1XA0A 2J5RA 4W7SA 1SOAA 1L4NA 1SCIA 2OORC 3C6ZA 3NGLA 5CVCA 5EHIA 3URMA 3GNSA 1AUXA 4FLFA 3H65A 2GXQA 2YFKA 4CH6A 3DE7X 3T95A 5IAJA 2Q8PA 1KR5A 1OGIA 4UBNA 3R0VA 2CFTA 1H93A 2ZSDA 1GO2A 2VQFB 3CLSC 1RHRA 1Z0IA 2XKJE 3L0BA 4AS2A 1WDKA 1L1FA 5K0EA 4TUYA 1K88A 1ADGA 1J70A 1DC6A 4Q1VA 3H3XA 3B9QA 3OPQA 3O4RA 4GW3A 4KQCA 3DV0A 4XEMA 4EB6A 2WAXA 3LUDA 1QHSA 3TL6A 2GETA 5J4LA 1TF2A 4QG3A 2RIRA 3JU3A 1P2SA 4NJOA 3P8TA 4BLTA 1VSUA 2Q5JA 2ZVPX 3FD8A 4NPCA 1DFGA 3FSEA 4KMMA 4YB8A 2VS1A 2FK8A 2FJUA 1PQUA 2FFRA 3H7IA 3JWEA 3QHPA 1U80A 2H2AA 2OFPA 2CBZA 3FI9A 3IUYA 2BN4A 3N7UA 2QG6A 4GKVA 4D25A 3EDYA 3EPPA 4S1VA 1M10A 2NYRA 4FYHA 2H7XA 4RH3A 4HXEB 2A7QA 2D1TA 2P3OA 4M4SA 3N2GB 3KJXA 4HS9A 4GVXA 5DTRA 2PLFA 3PHBE 4RV4A 1SUSA 1XZKA 4OH1A 1KRHA 1XZLA 3GDFA 4MQFB 1NSFA 4O5AA 3M6IA 5AI0A 1X01A 5ESWA 3SNKA 4D0LB 1XRSB 2WG0A 4ZAZA 2IS2A 4WDRA 5F76A 1KIFA 3P9SA 3PIDA 3GXBA 4E21A 5B6IA 1HGXA 1QIDA 1ATZA 3BGWA 4I4TF 5DYWA 4LOLA 3BCHA 3UBMA 2VHYA 2IPAB 5DWVA 2EDAA 3EZLA 3ZBTA 1FQJA 2FE1A 4LEIA 5KHAA 3DKPA 4EMBA 4AMVA 4C7OB 3UAOA 1NLZA 1XDZA 5DHPA 2ZYAA 4MCIA 1NU8A 2X4IA 3G89A 3ELBA 1BRTA 1D0SA 4EA8A 3A9WA 2INGX 1GSOA 3NRJA 4PVDA 3TTWA 3MIZA 3PX3A 3V1UA 4X97A 4TZTA 2C5HA 3W90A 3Q8XB 5EIBC 2LR0A 3DHVA 4C4XA 3A0RB 2ETXA 4FXPA 3RAJA 4MQ5A 5ICEA 1G16A 4HDNB 5ARCA 1X8KA 3H8JA 4YLGA 2ZSBA 4KE9A 2VPTA 4M1QA 1W7AA 3VU9B 1O87A 2HK6A 1D6NA 2Y9PB 1JA0A 5D5QA 2HOQA 3OZBA 1NC3A 3EC2A 3W0LB 3WV4A 1WXDA 1RE1A 1I3OA 4UZSA 1GQOA 5GOZA 4E5VA 2AOXA 4HAUA 5C18A 1ST2A 3IVMA 1WUJS 4HB4A 1WQ3A 2BRUC 2YWRA 3PXEA 3I9KA 1E79D 3LMKA 4PONA 3D7KA 3ICOA 1Y3CE 3L7MA 3RUEA 5GMOA 5C9ZA 3ADCA 2ILTA 1ZGZA 2JRCA 3DUWA 3V6MA 4HEJA 3H4MA 5DP2A 3TNLA 4LTMA 3RS0A 3UANA 4LFCB 3FW1A 4L27A 4O02B 3WIOA 3JARA 3O8OA 4MR7B 1A5BB 4D8WA 1QORA 1DO0A 3TR5A 4BNLA 2C5SA 1TW3A 1WDMA 1SQGA 4L6AA 1PZHA 2GPNA 2E1PA 4IMIB 1B8PA 2A7XA 3EOBI 4TZKA 1U2PA 4TV8A 1F6BA 1J8QA 1YQXA 2OE2A 3PIRA 3KELA 1DQZA 4PTYA 2XD9A 5EZSA 4HX2A 4PCUA 4A36A 1G64A 3B70A 3KU1A 4UHCA 2H5EA 2ZTHA 3ZGNA 3ITNA 4B2PA 4F6RA 4WHMA 1PTJC 4Z0TA 4IV8A 4H1UA 5ER9A 5HX7A 4P0PB 1J2RA 1E2IA 4N4AA 4BASA 4MMXB 2C00A 5KBYA 4D3DA 3HR7A 1G4AE 1QF7A 2B3DA 3FVVA 1VSTA 1PL7A 1NUHA 1ZX1A 2ES4A 1W52X 2JD0A 3CX6A 2XOEA 2I22A 3O8QA 3O2QB 1CHNA 2E5FA 2WWFA 4KK3A 4TKVB 5JSZA 2XT6A 5K4GA 5KTMA 3FZEA 1XEWX 5FV4A 4WIAA 4OXYA 1VA4A 1Y4UA 3CIFA 5KC8A 5A04A 4J29A 2JGAA 2AJTA 1OYYA 3VKUA 1M0EA 4LIPD 2EV9A 3C3EA 4JYZA 1TC2A 4MCHA 1U5BA 3HYLA 2COKA 2MDTA 1Y4AE 2BFNA 3HKCB 3C74A 3R4CA 4R1OA 4S2EA 5GQSA 3X1YA 1ZL0A 3FRHA 4WLFA 4CN9A 5BYAA 2IXDA 1E9AA 5IYZA 3KS9A 4PPQA 5FQNA 1K7EB 4X6UA 3COSA 1ZMRA 1YCFA 5EE1A 1BS1A 5FBWB 7YASA 5GM2A 3RM3A 3RVRA 4L9SA 4NG5A 3SOPA 3TG2A 1XPUA 1Z0UA 1E5DA 1IBCA 1J23A 4PGGA 1KNQA 1V45E 4DANA 2JLAA 3BL6A 1IEWA 1RWOA 3TOCA 3ZNNA 2Y1DA 5ALRA 2OZLA 3PFWO 2ONZA 2L42A 3TTUA 1GV0A 3NCTA 2PXCA 3IE0A 5REQB 4CS4A 1Z38A 4ND4A 3HCPA 3S4YA 5JC1A 2IYRA 2ZTVA 4C3OB 1WCYA 3L0CA 5K0BA 1VHLA 3EZNA 3GG9A 3K1JA 2RKWA 3P2IA 1H23A 3NAGA 4K6HA 5L3QB 2OLKA 3W3ZB 4WAUA 3KKNA 3GJ7A 2PBLA 4B34A 1D6MA 1D03A 2XE6A 3GYBA 2WP8J 3PE3A 4W82A 5FBHA 3KTDA 3IIMA 3H87A 4HNAA 4XDYA 3VJRA 1KJ8A 4P34A 2IHZA 1EWYA 1JKJB 3AERA 3HZRA 3UV7A 5K1XA 5FI1B 1SURA 3GZNB 1A2QA 3MJEA 5FULA 4EUKA 3HJAA 2I03A 3B7WA 2VJAA 3FZQA 11ASA 3U49A 3OOJA 2CUZA 2DUMA 3BC1A 2VUIB 3QFTA 4LBWA 4MS1B 5YASA 1JFFA 2YMMA 5JXJA 3THXB 4FIZA 2OBBA 1IXSB 1QF6A 1QFZA 3CC8A 3GGPA 1T36A 1WXQA 1YK1A 4H6XA 3E8XA 1UOPA 5D5PA 1Z33A 1JEJA 1GAWA 2V96A 4JIGA 3P96A 4D8TA 2XT0A 3CRW1 4PAWA 1YR9A 3LS2A 1FZTA 4GT1A 4IX9A 3KSBC 1TO6A 4LZAA 3KRTA 1YHYA 2FR8C 2JDIA 5DNWA 3ZHXA 2ET6A 4GXNA 4NNPA 4IL5A 1X80A 5GJWC 3CHYA 3ZWXA 1DHTA 3A2MA 1K9VF 3E48A 1B23P 1EJ0A 1PV2A 3CN7A 1WBJB 5EUMA 3KUDA 1Z56C 1LA2A 1JXMA 3W2EA 1C1HA 1T3SA 1VSBA 4BGUA 4TXNA 3OEHA 2ZJYA 3WAGA 3I28A 3V1LA 2JS7A 2OOSA 3UH1A 4QXPA 3VC7A 3G0DA 3G0GA 1CSEE 2WJHA 1YOVA 4Z2AA 5CCBA 4PFQA 1C3EA 3UCXA 3UJCA 4WNAA 5A3JA 5IEBA 3F3SA 4M1KA 4GKBA 5E6UA 1JHMA 4LV6A 3RO7A 2F1HA 3P26A 3JVDA 4JJ7A 4LI0A 3WB9A 2RJOA 5JIBA 2HBZA 2KX7A 1J33A 2D0IA 1UT5A 1KEVA 1LSSA 2WMYA 5FUXA 2RE8A 3NOOA 2XLBA 4R4JA 1X9IA 4QFBA 1RRMA 1JBQA 4REMA 4UAGA 1DAEA 2OCYC 4K2HA 4F3KA 4EBBA 4N76A 4S1WA 1ZO8A 1HX7A 2YH2A 4D46A 4TSRA 1UC9A 1A71A 2JAUA 1Q0RA 3AKYA 2MSWA 4K9PA 5DNEA 4CQJA 5JH7B 3UJDA 4BO8A 3CSDA 2QLNA 2OXIA 2ZJ1A 2PX0A 1LVGA 2WZBA 4F38A 5JSZB 5BT8A 3MINB 3HXZA 1AQ6A 4B4OA 1FF9A 3VMFA 3VTKA 1KO5A 2LUOA 5ECGC 4MIOA 2ZS9A 3U3MA 3BQNB 2PMCA 1I14A 1OE0A 3FDFA 4GECA 4OK5A 1XX6A 1CLUA 1T6XA 3M33A 4MUEA 4KR6A 1LRKA 1U7ZA 1WLYA 2PU7A 1Y9EA 3QJ5A 5EKXA 3RKSA 5C7YA 3NENA 3FMVA 2OQRA 1BNCA 4NMXB 4AU1A 2GHQA 3NIBA 4AZ0B 1XKTA 3RRBA 4W9MC 3ZG6A 2CK3D 4W5WA 5BSGA 4UZEA 4Y6QA 1GPYA 1U2SA 5LZ9A 4P8RA 3WMWA 2RHQB 3U4AA 1IE3A 5A4AA 4RD3A 3RDPA 4MMZB 1B2RA 1NLYA 4XM1A 1WNFA 4Q66C 4HYYA 1TM1E 1PWHA 4QA9A 1XWFA 1ORHA 1ZUIA 1X14A 1U9ZA 1UMBA 3B6KA 3L41A 4X1OA 4BO7A 2JJ8A 3T1HB 1A8SA 2QE6A 2O8CB 1NBHA 1XTSA 1USWA 2P41A 2IKSA 2FZ5A 2RHCA 2IP2A 2TMKA 2VP2A 2WU0A 3AEQA 4KSCA 4QGHA 4HGYA 3WICA 1P80A 2AN3A 5BYKA 4MQEB 4KFSA 4WZ6A 1X1RA 1TZ2A 1NRIA 2GPTA 2V6FA 2ZJ5A 3KXPA 2H2FA 4U2BA 4GKAA 3ICPA 4B3DA 3KHSA 5G0UA 4RK1A 4CYMA 2YHAA 1THTA 3VNQA 1KZ6A 2PN1A 2HUNA 2RH9B 5KSOA 1G5FA 3MPOA 4GS5A 2HIHA 1EA7A 1EG7A 1XRQA 3O3NB 4EZIA 1D7AA 1V48A 3GCWA 3HN7A 5BMVB 3ZOKA 3CSUA 3WGZA 5LP6A 1P81A 5LR6A 2ZB2A 1X7DA 4LGCA 3M4JA 4OP1A 3R75A 5CFNA 1AZSC 4ZPJA 4MVJM 4N9WA 2XCTB 3D4IA 3T1OA 4LGMA 3JQCA 3THOA 2AF4C 4G5HA 4QBGB 5H7XA 2AG6A 3ONDA 1P0IA 4PR3A 3KJZA 1U0HC 2C5FA 3H16A 3RIYA 4D99A 4B40A 1MIHA 3DNFA 2ZYHA 3GGJA 5EZQA 4J3FA 3MWDA 3KIPA 1TJNA 1J07A 5JQWA 3KNZA 4HRXA 3GB9A 2R97A 1Z7EA 2PDAA 1QHYA 5CA0F 1JP7A 3V34A 5L3RA 3M9LA 4DCSA 3UMJA 2PG3A 3SHTA 4E7OA 2FMFA 3WDKA 4UBKA 1C9MA 3FLMA 2P62A 4MDHA 5JWRA 3DHWC 4U9UA 3T41A 1FFYA 3M1AA 3NP7A 3NH9A 5ALIA 2Q62A 3FCYA 5FHRA 4X0EA 5HJ5A 1TI7A 2QQEA 1U3GA 4A6EA 3EVAA 3PV0A 5LMNB 3DO5A 1Z4QA 3F4BA 4LYGA 2C4HA 3DTVB 1OYOA 1PJRA 4RTPA 4HDKA 4PS0A 4TS4A 1Q50A 5KNBD 2Q7GA 1KVRA 2DY0A 1Z7NA 3CO0S 1C81A 4L8LA 3R9XB 2GBIA 3GAAA 2I4MA 3Q5DA 4I6EA 5JYEA 1IUOA 2YFQA 2ZYIA 3MJRA 5L4LA 4GHWA 1N9ZA 1KJZA 1V5EA 1X1CA 2BMDA 3LNCA 3PC8C 5SZKB 3VA7A 1U63A 3GGOA 1L4UA 5IAOA 4TL9A 4XE5A 4MI3A 3T4UA 1FUIA 3TOVA 2FN8A 3P97A 5J43A 2UYHA 3Q15C 3DJFA 1YZUA 3AEXA 3D0QA 5EE5B 3E6AA 1ZAYA 3AV0B 4C0WA 4X90A 2JA2A 3L6RA 4R05A 1DC8A 2G4VA 4J07A 1RIIA 2DU7A 3G02A 4TQAA 2FW8A 2Q9AA 4BXOB 2ZVDA 5C8YA 5AW1A 1FYFA 3DXZA 3NEAA 3WQBA 2GN8A 4PX5A 1PZXA 1UJBA 4GYYA 3WFJA 3LUCA 1AX9A 2HK9A 1LF5A 1Y82A 4FNOA 5DNAA 2ZW9A 4D44A 1VBKA 5A03A 5C37A 4DB2A 3BMNB 1JRLA 3ESQA 4GRAA 5FUQA 4M0MA 4OQMA 1WW2A 3NATA 3NHZA 3V2UA 2FDCA 1M1UA 2CY0A 1P4SA 3OY7A 3UW3A 5CA0A 4JOQA 5C1DA 3TBKA 2HNKA 1LFDB 1TUEA 4PW0A 3D6FA 3H1FA 5JAIA 4OGLA 4WY8A 1CETA 1M1YB 3AYZB 5JMOA 5EP3A 4EEKA 1V1MB 1XDGA 5FOSA 4JDPA 2V6JA 1L1EA 4GIBA 5BQPA 1OX4A 2AI1A 1UKCA 2OCIA 2ZR7A 1ZQ1A 1EQ2A 1ZRNA 3EXFA 3HR8A 4H1HA 4YS6A 1GRRA 5HFAA 3DE0X 5TSDA 4B80A 2F8TA 2Z8YA 1RLTA 1Z18A 3OIDA 4YRAA 3GEPA 5I45A 3PWKA 5AESA 1RXEA 3P9RA 3G1TA 4QGAA 1ESZA 3O74A 4QC2A 4GNRA 2IYQA 3P9NA 4J9VA 1M3SA 2WG1A 3ND9A 2BH9A 2FW6A 1M2JA 1FRVA 1XK7A 3M4XA 3O4JA 4OV6B 4AQYB 1L6RA 3AUSA 5B3AA 3NS7A 1VBNA 3K73O 3H99A 3WRYA 1YBAA 1JF8A 3C6MA 4IDFA 5GAJA 1OVGA 5GGXA 1ZNZA 2VL7A 2JLQA 5H83A 3ACDA 2RI0A 1XJ0A 3M82A 3FSGA 4H16A 4L15A 1SB8A 3PGLA 4BNYA 4CQMD 3PRYA 4EB8A 3OM9A 3L4BC 3VKGA 1USYA 1WHSB 4LNHA 4JP3A 3STWA 3GLUA 4JK3A 5ESRA 1D8TA 4TUYB 5D00A 3COPA 5GJCA 1DKNA 4JSTA 5ECDA 2ZSJA 3HWSA 5PGMA 3RARA 1Z8NA 4MS4B 4OQ4A 5JSFA 1QZ3A 5IU6A 3DV0B 4E1VA 4EB6B 3L8MA 1K63A 3SFZA 1QTQA 4UEOA 2WSLA 3FMIA 3FF1A 3WLOA 2GILA 1KOLA 5HUHA 3CNHA 3GUZA 1WKVA 1INLA 2YJNA 4MLZA 5AFSA 2DCMA 2P9YA 3D3QA 2QRGA 1QOPB 2ZATA 1ULSA 2PKQP 2RGBA 3AL2A 3PNOA 4CL8A 4XPIA 3UN1A 4IDNA 2B0JA 1B6SA 1GPNA 2CUTA 1C8LA 2I6UA 1K8RA 3OPYI 2PEYA 3FAZA 5J5CA 1NMXA 3A28A 3ZBPA 5CFPA 3Q7IA 4CEHB 4ZI7F 4TTAA 3CVXA 1H1TA 5JD5A 4F3RA 3ZLVA 1O89A 2VOJA 4P2BA 3AOGA 1NJ8A 3M49A 4GZ3A 4U2DA 3X44A 4QE3A 5JPCA 2VSYA 4JBIA 3E82A 1WBBA 3IBYA 3DAGA 2Q7XA 1UADA 2HMTA 2PL1A 221PA 3KKLA 1ZGGA 4MQ4A 3EH1A 3CVOA 2YCLA 2ZIZA 1WUYA 1BQ3A 1IVNA 1J5XA 2DHRA 1L6IA 4LYEA 3ZVRA 1TTTA 1UKYA 3F6PA 1QIEA 4EG0A 3ZLJA 3VMMA 1OX5A 4ASUA 4LXIA 1JVNA 2PRZA 1ZUWA 5DHQA 3ZDZB 2P1ZA 3N2IA 1M67A 1PSWA 2W98A 1LGYA 3AB3A 2ZAIA 3N39C 3NIFB 2YS7A 5L4NA 2I6TA 1F2VA 1MOQA 2CJFA 4FMDF 3BULA 4O0MA 2Q99A 4YAIA 1A5TA 1JLMA 1DG1G 4RS3A 3KZOA 1N4AA 4K6KA 3CEMA 3WBBA 4Q6WA 1HSOA 3C16C 3UWDA 4EJSA 1V96A 4P35A 1KYTA 1LEHA 1N75A 1RHUA 2FLVA 3FZNA 3N0VA 4I1IA 4IHKA 4BU1A 4MVJG 4Q6GA 1MF7A 4P32A 4RS4A 2B4TO 2O59A 3JQAA 4LXUA 4XGKA 3K35A 2HSEA 1RWNA 4J43A 2GS9A 4BFSA 4M86A 2P5YA 2ONYA 3NV9A 1U9CA 2O06A 1J9EA 3KFLA 1B42A 1TK9A 3D8HA 1T4DA 4TMFA 1CJTC 1Z2AA 5GONA 3WRVA 1UDWA 1JHVA 4AX4A 3BJEA 4OMFG 3FYTA 2XAAA 4EHDA 5FNZA 3BHMA 4DDUA 2RHBA 5CVDA 1YVUA 3JARB 3O8OB 1TU0A 3A9SA 4PSKA 3TIIA 4IXNA 2CB9A 1CJMA 1AGRA 2CXRA 4UXIA 3UJNA 4G5FA 1SWVA 4FKZA 1F17A 1L4GA 4M99A 3A10A 4RFLA 1EG2A 3K3PA 4M0CA 1DQSA 3LY8A 4TV8B 2ZUEA 1M34E 2GNAA 3RREA 1HWYA 4RHTA 2P79A 1R6AA 1BWQA 3CVJA 2DPLA 5GOTA 2IDMA 4C3ZA 4IXWA 1AQIA 1HE5A 1LPSA 1M76A 3MTQA 4MKGA 3OFJA 4EITA 4UQPA 1M6VA 1JDTA 3GARA 4NBUA 4F6RB 3DQQA 3H83A 2V7XA 2GPYA 1W1IA 4GUDA 3IELA 1CUUA 4EFMA 3BAZA 2NTEA 3IUJA 5GPBA 1TGVA 1F1BA 3CF2A 3TLGB 3W05A 3I4CA 2NPIA 2W6IA 3QF4B 2XNHA 2EJ9A 1Q7GA 5SYNA 2PYZA 3C97A 4LDZA 4BKOA 1VECA 4QPNA 1KQOA 1NVTA 1T9GR 5AKXA 4ZFNA 3KT6A 3SXUA 4EF6A 4R41A 5D8DA 1D9XA 1C7QA 2ORED 3GNQA 4AJLA 4BFXA 4M0LA 3BXXA 4N49A 3PJEA 4Q1FA 5I01A 4KDRA 3SFTA 5LSAA 4QJ5A 2Y93A 5CH8A 3VC2A 4CDNA 1XTUA 5DTIA 3AY6A 4PCVA 3TVDA 1U5BB 3IOMA 1ZSYA 3F7OA 1N77A 2E18A 3FJYA 1YI8A 4KE7A 4M9QA 4CLRA 3PR3A 3DZGA 2JH3A 2ZSEA 2ZUUA 4C2AA 5IYZB 3Q7SA 1B6TA 4XTUA 1HEIA 4AWAA 4CKCA 5JCPA 1B8AA 2DXTA 2GPBA 3UWOA 1FU8A 2HLNA 2JAWA 5J23A 1EP9A 1U0GA 4QO7A 4ZZ2A 3I6YA 3WYAA 4RTSA 1ISMA 4L8VA 2EU8A 3K30A 2DWOA 5ADVA 5K45A 5KJFA 2JLUA 3Q1KA 4NMWA 3S40A 4PNEA 4MICA 4OXQA 4EEZA 5KX5B 2OZLB 1IN5A 4ZAVA 1KY2A 5K1ZA 1NOIA 3LX5A 8ABPA 2AZ4A 1NW4A 2D62A 4X5OA 1GZ7A 2PHZA 2ZTLA 4Q03A 2JG3A 1LUAA 1JQKA 4TWIA 1WR8A 1DFIA 2BC9A 4GR5A 5KWVA 3D31A 4XSGA 4C5CA 2BWJA 4MSUA 1KQNA 4CUKA 2IY8A 4JHXA 4LNAA 4TVKA 1DKPA 4CMEC 4AIRA 1JXOA 1KETA 1OXVA 2GRUA 2J7PD 4Q48A 2VTEA 1KS2A 5M3BA 3OQBA 4AY2A 4RW0A 2PNJA 4UD2A 1E2KA 1ZOPA 2UZ3A 3L1AA 1PFKA 3RW9A 1NU6A 4CQNA 4DADA 5AKEA 2OP1A 4MRRA 1EFKA 1UF9A 3L7DA 5FNVF 1U4NA 3MB8A 4YAOA 3WLTA 4KL8S 1P7YA 5I3ZA 1EVZA 3PHHA 1ZMBA 1WUKS 3BE6A 4UQLA 4A6DA 4CM1A 1P6QA 1NUPA 1M74A 2IBMA 4HWSA 1Z26A 3MLAA 3I12A 2JFGA 1JMKC 3F9CA 4BE4A 1X1EA 2H1LA 4K9KA 2J6CA 4HRYA 3NT4A 4NICA 1MO4A 5CU7A 3LK6A 5BN1A 4YAWA 3D4LA 4A8HA 2FWIA 1LNZA 1V5FA 3I73A 4MAMA 1Z0ZA 5F77A 4TQDA 1Z5ZA 5GY7A 3ZYZA 3UXHA 3L9XA 1G8FA 1AF4A 1F8FA 1L9XA 3U0BA 2Z8ZA 3NDIA 2PVCA 4JLWA 2J45A 1C9NA 1QIJA 3RVPA 3X1WA 1OFVA 3EPLA 3ZU4A 1HLPA 1AN9A 2BMAA 2ZOSA 3O4VA 5AM0A 4JSRA 5EGNA 3V80A 1NPYA 4P83A 2IC5A 3LT2A 3OSUA 4XU1A 3F9RA 4LZZA 5A6SA 4KKVA 1MAHA 2HA6A 1EUCA 2P8JA 5EAIA 5JJLA 5THKA 3O3MB 3BK2A 3DR5A 2RCNA 4ICIA 4J0QA 4AJEA 2X5KO 4Q3LA 4WNAB 2AVDA 3TFWA 2XCSB 2WT4A 4UPDA 1LI4A 1QNFA 3EBOA 5K9ZA 5E6UB 1W85A 1XTBA 4G0UA 1ZVMA 1FMFA 1E2MA 1ZJZA 4R8MA 4QWWA 2GBFA 4XARA 2F8MA 2XNDD 1JAZA 3HKEA 1NY6A 1XELA 1SQSA 4OP3A 1GOTA 1OPRA 5JNRA 2XUZA 1T29A 2REXB 4J2OA 4LVNA 4LCBA 3CH5A 4FHGA 2DZ9A 1VMEA 1PJZA 3BB3A 4DMRA 4BB5A 2G1AA 4YCWA 4NHOA 5F3RA 3REUA 1UPFA 4EHNA 1P2GA 5EHGA 1TA0A 3EIOA 5T8KC 3VZCA 4CDMA 4M0PA 5CURA 4B7XA 4YUWA 3ZHCA 1A2OA 2QL7A 4G26A 1PZFA 2WU8A 3GF4A 3LPLA 3CKLA 1P60A 4P33A 3H1GA 2IBTA 3O75A 2TS1A 4LSWA 7REQB 3CR3C 1WQ1R 4UFPA 3UUEA 5DEIA 1SKYE 1JL3A 1BHQ1 1IN8A 1S2MA 2IA5A 2GM5A 2JIRA 3ADKA 1IJFA 4US0R 1VP9A 4UZFA 3RSOA 3ZGXA 4AY5A 4RORA 4WE3A 2BEJA 5E4JA 1QK4A 1JALA 3E2MA 1HXHA 2QZJA 2EJVA 1KO7A 2VQ3A 4LJ4A 4PFJA 4HNVA 1E0AA 4GVPA 5ARBA 1J2YA 4MH0R 4YDRA 3VH4A 4F6CA 4LVIA 1CUEA 1MT0A 4HQRA 2RDMA 2B9EA 2D8AA 3GAZA 2FEMA 1L3CA 4BRWA 2N0SA 3REFA 2A0YA 3IKMB 3U3OA 1CEXA 2QKYA 4E13A 1UMBB 1GFZA 2NU7B 3D4BA 3FG9A 3WIUA 1X13A 4KZKA 2WIGA 4AO7A 5D86A 3DKRA 3RKYA 3AEQB 3W2FA 1N7HA 2IEIA 1BD4A 2QN9A 3QEBZ 5IT5A 5JWOA 1ZLXA 2R25B 3D3JA 3AUYA 4LN1A 2QTGA 4JVNA 1X7GA 4BLVA 3AKEA 3AP1A 1I2ZA 5H80A 4FCCA 5HCUA 2XDWA 3SU8A 4ESOA 1PK7A 3HI4A 1ICEA 3VNAA 3IQXA 4DUPA 4FZ5A 3SXJA 4I7EA 2RBKA 2QVCA 3A74A 3SQWA 3CUUA 3A5ZA 4FXOA 3V55A 1GHTA 4ROTA 1G5TA 5LP6B 3ANXA 4DG9A 2GA8A 3IODA 2FW1A 1NULA 3W5SA 1A4IA 5JVDA 1HUQA 1XZIA 2VT2A 4ZYZA 3NAMA 3ZVKA 4TTQA 2K87A 4KN6A 4LHYA 4CTOA 4IMRA 3TAHA 3COJA 2YZ7A 1PWXA 5EYPA 4BHTA 1P2DA 2XB9A 3PHLA 1XQXA 3C4QA 4NI5A 3BB1A 4QTXA 3OC6A 1S89A 3OURA 3O7MA 5AR1A 2Z08A 3TKAA 3H6GA 3MWDB 2VXOA 3K1YA 1XMXA 4X92A 1NN0A 4BX0A 2CLSA 5H59A 1V7CA 1QAOA 1E2PA 1IEVA 1JYEA 3KP1A 3QU7A 4OMCA 3TDNA 4QYXA 3UJ3X 1LPNA 1DBRA 3ZQ6A 3IEPA 2WQZA 1I13A 4HL6A 4OKIA 3GVPA 5SICE 1Y8CA 1PFVA 2G82A 2O0KA 2QRVA 3HV0A 4IGFA 1V7QA 3FR8A 1E2NA 5AVVA 1P2UA 1Z2PX 4RVOA 1V6AA 1VL0A 2QXYA 3H0EA 2J0SA 1CJKC 3HQ4O 5GZ1A 1LH0A 2ZRDA 4YEDA 3CF6R 2IYYA 2OD7A 5IJWA 5CTJA 1EE2A 4E22A 2Z8XA 3DS8A 2HWYA 3LFUA 1MTOA 1JPJA 1SC9A 1VYTA 4MVWA 4W1QA 3P5BA 3PNSA 1MEOA 1L5NA 1IOVA 1U2GC 1GXSA 1Q16A 2A5DA 1WOYA 1D6SA 1N4DA 4R2JA 1U1GA 1WUHS 4OM7A 3T9DA 2O7QA 5FPQA 4Q21A 1NQAO 4LECA 4FX2A 3CLRD 4EVSA 4HPXB 2A78A 2PKYX 4O63O 5C8VA 4CU2A 4IJVA 2MJLA 3F98A 2GZDA 3IAS6 5C8YB 4PN3A 3TRDA 1HNWB 2F3SA 4FHFA 1FS4A 4B6RA 2H17A 3L92A 3C6YA 3O4GA 1GCIA 1DQNA 2N75A 1C0KA 1JJVA 5LUBA 5KTYA 2E6KA 3A2KA 5A05A 1XDDA 3CWZA 1LDGA 2ZJ0A 5CLIA 1ECFA 1JE0A 3FCOA 5EMNA 3U7EB 4MNTA 1ZXXA 1H5QA 1K75A 1MO5A 1BQ4A 1D7OA 1QBGA 2D0OB 3QVKA 1SRYA 2AK2A 1QTRA 1W8DA 2WKQA 2Z83A 5HIIA 4A8JC 1SRQA 4AFNA 4BX2A 4U9HS 1AQNA 3BSFA 3IPYA 3LUGA 4PEVA 4WASA 2BHNA 2G7MC 2MIIA 3IP5A 3O95A 5BSUA 4C4PA 3TD6A 5FDFA 3A6JA 5IHXA 2PX6A 1T1IA 3OFNA 1V3VA 4JA0A 4MUYA 3ICCA 5CUQA 2WHXA 4RLHA 2EERA 3HNRA 1DXHA 4UPEA 3ZJVA 1FL9A 4BEWA 2C7IA 3VSAA 3S8MA 2A58A 3EXFB 3H18A 4TSFA 1GSHA 1Y1PA 4A27A 3QTTA 1KC1A 2MU1A 3BMQA 3KQMA 2F4NA 4OIFA 2C59A 1YVEI 4LQDA 5DE3A 1B7YA 3BXFA 2X0RA 1Y9ZA 2GM9A 2RG1A 3RV4A 4EB3A 2H3EA 1MPXA 4C5AA 4B6GA 1AY0A 2HA4A 2ZI7A 3TAXA 2XZOA 3ZDDA 5ICSA 3UQYS 3EPRA 4UW9A 1XEFA 3MYRA 1QYDA 2YWHA 2ECKA 4N18A 2R6ZA 2VYVA 5D3KA 3RVBA 1ZHOA 1E0SA 3FLBA 6PFKA 3KKPA 2H2DA 1THGA 2EGUA 2HU8A 1MEJA 4D5EA 4CHTA 1Y5MA 3M4NA 3Q9UA 3X1XA 2H6EA 3EB9A 3JQ9A 2JKZA 1QE0A 1SBIA 3QI2A 6ADHA 1IVYA 1YFJA 2JI4A 4H2YA 3DTVD 2AIRA 3KZCA 4E2FA 4CLOA 2QVBA 5TB5A 1MRZA 1VSQA 1EXMA 2VK1A 1R6BX 3GPDG 3ABQB 3PT9A 4OQXA 3I61A 4JGBA 1DCKA 1BMFA 2V6BA 2BZ0A 2FPGB 2HA2A 3RFXA 4N0PA 4LBYA 4X1KA 1V11A 3MCUA 1UC4B 1EBBA 3KWMA 3OKAA 1BHSA 3PE6A 2XUDA 2BFPA 3HNPA 4HI0E 1B0UA 1WSWA 2ZE6A 3OHSX 3TCNA 2QTFA 1UMCA 2J5XA 4FK8A 5DNYB 1XCBA 3DONA 3PQ2A 3PLRA 5EIHA 3L6BA 3UPDA 4ZCRA 2PANA 3E5MA 4RZIA 5JY1A 1R8QA 5LZ7A 4JJAA 4JYMA 2PR2A 2EKLA 2BT4A 4XPIB 3FYSA 3MOSA 3REQB 1I4LD 4UM5A 2QMUA 4CTNA 1L4YA 1GL9B 4FGSA 3DEKA 3LF2A 4EA6A 1P1CA 2Q6TA 1XROA 3R2JA 3NIWA 4RKEA 1NF2A 1QG6A 3KLNA 4WKPA 1C2TA 4O2BF 2JIZA 2QYHA 1LXCA 1N2JA 4LXGA 5FJIA 3RVKA 3AP2A 2WU3A 5AOVA 4J7UA 4W63A 4NU0A 3TGWA 1WSBA 3LKZA 1BDJA 2JKYA 1JJFA 3UHFA 4IJWA 2HMWA 3AL3A 2BR4A 3GT0A 1H2AS 3KB2A 4OLFA 2WWXA 2WYWA 1GZVA 6LDHA 4KE6A 1UT6A 4D92A 1JFLA 4R54A 1BXKA 3CBGA 1X70A 2J9XB 5BOVA 1TC1A 5E9JA 1XAJA 4BVHA 3O2JA 2DOKA 3UB3A 3B3AA 4KLAA 2Q6LA 4DVGA 1EFCA 2PH5A 1AA6A 3GVXA 1ZNYA 4O4HA 2C5EA 3UMRA 2K6GA 2NTJA 5F21A 5EC8A 4C3VA 1IDOA 2XGJA 4N0QA 4EJSB 1Q1EA 1J7KA 2QP4A 3H2ZA 4KB5A 1EFRA 2QDKA 4EQ6B 4JC8A 5H68A 4XVQA 3SJAA 3TE7A 3V2IA 2BFBB 3GLVA 1CY8A 1N9GB 2RARA 3HH8A 4H2UA 4WCVA 4R71A 1E0DA 2WHPA 4IUDS 2AMLA 4LYFA 1HH4A 2O50A 3IQDB 1DTSA 5CLFA 1Y42X 5CA1A 5F35A 3QA3E 1KEKA 4K46A 1R4ZA 3PNKA 2FEKA 5ILQA 1T9DA 5GONB 3R7NA 3OWOA 3A4YA 3ZU3A 2CYBA 1ONBA 4RQUA 4OM8A 4H6VA 3ENWA 1LFAA 1FBNA 2FSPA 3L8ZA 5FFFA 5I4BA 5DB4A 3UV3A 2HK8A 3Q5EA 2GKOA 3KT8A 4ZZ1A 1CRWG 3A06A 3FHTA 3TEGA 2GM4A 1U94A 5CEJA 2ZR3A 4Q00A 1ZJ5A 3PYMA 1WZNA 3O1JC 4H08A 4AJ9A 4XXHA 1X7XB 2PE5A 3JD0A 3DG9A 4IS2A 4PYMA 4DA9A 2OZVA 3L8CA 3MIIA 2JH9A 5IK2A 2ZRHA 3JTMA 1J6UA 1GUFA 1M6VB 4DHEA 2PSHA 3C24A 4MV3A 2J33A 3E1KA 4OAPA 1NF9A 2X2EA 5CYPA 1YS9A 4MEBA 3I2JA 4DLTA 4ERXA 3C2QA 3ZWBA 3L7AA 5BURA 3TKYA 3K9LA 4BNJA 4P84A 4NVRA 3TTVA 1R1DA 1H0SA 5HCIA 3VDRA 1UIMA 4E31A 4WOCA 1CUCA 1FLAA 1XAHA 2YHSA 2E2WA 3M34A 2PD6A 1P5ZB 2UYOA 5FP0A 2G9UA 3LBAA 3E3MA 1DV1A 3ZQ4A 3ZZMA 4ACAA 1E64A 3CZ5A 3IOEA 4EDHA 2BLNA 5GM1A 3HRHA 5JV5A 3OPYB 1X1SA 3S2EA 1ZNQO 4I5EA 5KDLA 3BERA 3I6MA 3PUJA 5EP4A 3WGLA 5IJXA 3G8CA 2MSEB 3BVPA 1U0BB 3MK31 2ZK7A 4QHSA 3IP8A 4JKIA 1KI7A 1VPLA 2QB5A 4BLOA 4CLRB 3DZBA 1HMYA 3SF8A 1GJRA 2C7QA 3LPDA 2FG7C 4CLEA 1UC5B 1XZFA 2NLOA 1F4VA 1V7ZA 2V59A 4B84A 1QK3A 4I55A 4B8WA 2BEVA 2PL5A 3RR2A 1P7WA 2CXNA 1L8OA 4G0QA 3DDSA 4NU6A 3B7PA 1UXOA 4AG3A 3AFHA 4ZI3A 3IQHX 2YW2A 1X1QA 4HYTA 1M8JA 2DECA 3CXRA 4RFSA 5DX0A 3ROTA 3TZEA 4DLZA 1P4GA 3MC1A 3ZHRA 3D6AA 2JIBA 2AKYA 3G13A 1AE1A 2CDBA 4ZCSA 2H11A 4CM9A 5A3RA 5M04A 3PEYA 5B36A 4CS3A 2VRNA 4R98A 3HRKA 3LBIA 1E0JA 2BE9A 1B7GO 2X6TA 2B7CA 1VBMA 2VTBA 5K6AA 2V8OA 3JYLA 4P74A 2Q41A 1ZRHA 4TRJA 4NFSA 3SKVA 3ZIAA 4CM5A 4BKRA 4YRTA 3DLCA 3AJAA 3N0XA 1L5GB 3I6ZA 3P9XA 3GIDA 4M76B 2H1IA 3GLGA 2PX4A 3JRXA 4N7JA 3U81A 4MINA 1YMQA 1W36B 3GJXC 3H8SA 3M6LA 1NDQA 3HSSA 3QENA 2I2BA 1I32A 2JIOA 2RGUA 2VH5R 5AI8A 3S8EA 1XCJA 1ZOIA 3BXOA 1HRDA 4GGOA 2FWNA 3EFBA 3UG7A 2X7HA 2R7NA 3AY3A 2XRZA 4MJ3A 1O9HA 5KWEA 3CVVA 5AKLA 1SKQA 3A1TA 3GLQA 4QU5A 4KHPB 1DXOA 4L87A 4J0HA 5BW6B 3UMMA 3LW7A 3D54D 3W06A 1CYEA 3UIEA 5CDFA 4F60A 1AJEA 1XTKA 5K0CA 1NP7A 5LIRA 5K6RA 2VAVA 4Y98A 4BO6A 2CD9A 2XQGA 2HF2A 3B6IA 3EAQA 1US8A 4P75C 1DHRA 2ATEA 3V7CA 3JD4A 3C4JA 2X5OA 3K94A 3BB4A 4JUDX 2JFNA 4TMVA 4ILKA 2R4TA 1HK7A 4XOIA 2PUVA 4D9EA 4U00A 1LSJA 3QPWA 4PQFA 2X23A 2FETA 3GFTA 5EJ6A 4B48A 5IZCA 1EFWA 1NM5C 3THYB 1TK3A 2R6AA 4LYHA 5HK9A 4FR0A 3RTDA 4EUSA 4IOLA 1BKYA 5FLYA 3C3DA 5I4CA 1NN1A 4P3OA 5DISB 5KSYA 1GVHA 1OWPA 4GPIB 4EG5A 2X9GA 4O33A 2WYUA 4WW0A 1IK6A 2R7MA 4HB0A 4GP9A 5A6SB 1LSOA 2CVFA 1EUCB 1XU9A 2I2FA 2APJA 3A3NA 2FA9A 3MRSA 2XT9A 1O0SA 2FWRA 3H9QA 3NHWA 4UVGA 1G41A 1N0UA 3UJAA 5B2EA 3F47A 2ADOA 1U8TA 4C0KA 2LPMA 1QWOA 1XRMA 1W85B 2NTVA 2QJOA 2W2XA 1A5AB 3S5JA 1PL0A 4MUHA 2P9ZA 4HA8A 3DW1X 1U2EA 4JZYA 1YFRA 1TYDE 1O6FA 1T91A 3HKEB 1N1MA 4AL4A 1RWQA 1FU4A 1SQ0A 1NATA 1ABEA 5E2AA 1IY0A 2HPZA 2OB1A 3DM9B 5EQFA 4F1JA 4NJEA 1BEZA 5B7GA 3U0VA 2RGDA 2IZ0A 3EVBA 4P4TA 5A1JA 4K26A 2R1TA 2PRKA 2J9YB 4P73A 2C8LA 3RIRA 2EJUA 2ID4A 2EVWX 2ZCUA 3JSXA 4IDHA 4QGGA 2QT1A 1FRZA 1KMHA 3I2FA 4H02A 3PJGA 4BMDA 3AF0A 5CDHA 4IQ4A 4C2UA 4Q9KA 2H59A 2I2AA 2ZBRA 4JVSB 1SCNE 4U63A 3VNRA 4LJ6A 2WTEA 5DHFA 4GLFA 1DBQA 4NBSA 3T34A 1ZSVA 3Q98A 2LCIA 1Z68A 2ST1A 3FUXA 4R1SA 3R74A 2YICA 3B20A 1V4NA 4FC6A 121PA 4DDVA 4ZICA 5AKZA 4XD7A 4FT4A 3SYLA 1GAQA 5JDIC 1ACLA 1TUBA 1R9JA 2WAMA 3LSSA 4HZIA 4UBJA 2QE7A 1OKKA 2GUWA 4M8KA 2CHGA 2ISCA 2ZYVX 5T5QA 2VNSA 3SQDA 1NLFA 1G51A 3MGCA 4ND6A 1P91A 1RHMA 4JCOA 2OZPA 4LV5B 3HBNA 1PUXA 5JO9A 2NZJA 4WCFA 1K68A 1QR2A 1HT3A 4Q47A 3AEYA 3RVSA 3PQDA 2VC2B 2PWYA 4EPWA 2P1RA 3EK2A 1BFDA 1G21A 1ZD4A 4CPDA 5KKCA 2OG1A 2VDPB 3T35A 1T35A 2B94A 1GTMA 1UP7A 9LDBA 1PX2A 3R20A 1QCDA 3RRZA 3MWYW 1YZGA 1AV7A 3MMPA 4RZ2A 4TVBA 2MYPA 3OEHD 4MI9A 4RVNA 4AF6A 1KU0A 5JMWA 2QJWA 3G9XA 3VI4B 1Z07A 1I24A 1Z7BA 3Q0IA 3FUUA 5I6DA 1AGNA 3HL4A 2V3CC 1IG3A 1CY0A 5IM5A 5JVDB 4BV9A 4DOMA 3KPYA 1Z4MA 5FR2A 4WJ4A 1JH8A 2VHJA 3NC1C 4IJ5A 4R8LA 4EUHA 4S04A 3GUCA 1EXWA 5EYPB 2Y99A 1PNVA 1UKBA 4MGZR 3L02A 4IFIA 4IEEA 1AK2A 1DAPA 1DX9A 2C5BA 3GVCA 1RFGE 4RPJA 5JPIA 2DQKA 1CHDA 3U4GA 4DCCA 2MSDB 2ZE7A 4YI3A 4G1BA 3FH0A 5I5GA 3ZI0A 3AOEA 1U5CA 1X15A 2AI3A 2FN4A 3T0IA 2PO7A 2YWXA 3W77A 2ZTGA 3NBMA 4JGGA 3WZLA 2XUFA 4YMTA 2D74A 4OU4A 3SEZA 4IFTA 1HBJA 5IABA 3KVVA 4CE6A 2GEKA 2QRVB 5FWYA 1R0RE 1UWKA 1I01A 4AP5A 1JWAB 1QE5A 1XA4A 3U60B 4TRNA 5HNKA 1NHGA 2E1HA 5CG1A 3VU8A 3EPKA 1GKUB 3T7JA 2IEDA 5J2TF 4GL2A 4RKQA 5FYQA 4C29A 2C4UA 5EPOA 3WTBA 2XX3A 1DZ3A 1B70A 1CEEA 2QJFA 1SGWA 3G5UA 1TM7E 4LHSA 4RDHA 4XDGA 4ZQHA 2JL1A 2W4QA 5AWFC 1LV7A 1YT5A 5LA6A 4O8ZA 4E14A 4L4SA 3UH0A 3V5NA 2COEA 2CWDA 2GUGA 4KLRA 3HDGA 3L0ZA 2UVPB 2Y0BA 3MTEA 1E2HA 1GXSB 1Z4KA 1ZH2A 2LDBA 3SDBA 3ZXXA 1KYZA 2SKDA 1HDCA 4MYSA 3WZMA 1L5VA 1ORIA 2DBZA 4OFBA 2G08A 2GEBA 2P9QA 3JAWA 3QG1A 4D3YA 1IPHA 2A33A 1KOGA 3I9LA 3K4PA 4I99A 3HY0A 2C4NA 4YJDA 3VFDA 4IMPA 4I19A 4JI6B 1Q7EA 4NQZA 5DBEX 3FUWA 1JJAA 1TQHA 1KOFA 4XWWA 1FVXA 2FH5B 1Z15A 2FPOA 2X2FA 1W88A 1ODIA 1WTAA 5IKOA 3R3WA 4ZGBA 2AUTA 1ZY2A 2WSBA 2NP7A 3BL8A 1XEAA 2NAFA 2AQIA 3IBSA 2AG5A 4XVUA 7GPBA 3WSVA 2Q1SA 1K6MA 3TOXA 1G60A 1EE9A 1VLMA 5CD1A 1NRJB 3OLZA 1ADCA 1CT9A 2Y67A 2Q50A 1VA5A 4Q7MB 4I9NA 4N39A 4ZMRA 1WDTA 1YZ3A 3AEZA 3ZE6A 3NGXA 4CM4A 4NBLA 4FWTA 3PHGA 4E2WA 1NA5A 3TG8A 2JHPA 4G2TA 4G97A 1F20A 4JX8A 4M36A 2Q3EA 4JP2A 1YC5A 2Q1YA 1VCIA 3P71T 4Z9AA 3NO4A 1C4WA 1NV9A 2YJ5A 2BI8A 3HBFA 2ZRBA 3QUQA 2XRMA 4S0XA 4QASA 3EQ9A 4TLBA 4D7AA 5FO1A 1HT1E 4XVRA 3I32A 3HDTA 4HN9A 2W4IA 1TVMA 5DCWA 2DHDA 4HMOA 2I4NA 2FPWA 5AJWA 4NDNE 2H65A 3BQ9A 1WW8A 2ZPAA 1X39A 2NZXA 3FVQA 1LC0A 3NDJA 2DPXA 2IU4A 1U3DA 4UC0A 2P6NA 3WISA 3LW8A 1GTL1 3BMQB 5J2TA 4TZ6A 3RIXA 4B6JA 1VL6A 1EGQA 1PVVA 1B7YB 1SVIA 4LSMA 4WH0A 2GVZC 3WNZA 4PBSA 1UBFA 5FEMA 4BRZA 2AMCA 2RGEA 2YIJA 3ZQUA 3U16A 1WNLA 1KAHA 1AVTA 1E66A 1FU7A 3E9IA 1P4JA 4EYEA 5ICCA 3F6BX 5C31A 1UBSB 3R8FA 5IJ9A 4LUCA 5EJEA 1U7TA 4PBRA 4Q7QA 2YTZA 1O9BA 1X8LA 3GYGA 4WKNA 5CFZA 4CL2A 4C05A 5I7FA 2NZYA 4B79A 1LDYA 1LU9A 1IXKA 2CD7A 4Q1EA 4YALA 2WICA 1YZKA 1L7QA 4WXPA 4PYJA 2XDYA 1TCCA 4R40A 5TQVA 4KX3A 1UP6A 3EFRA 3VQTA 1KOJA 1OFUX 2IHKA 1ONSA 4Z3KA 3T9BA 4CLOB 1BU5A 1Q84A 3I30X 3Q41A 721PA 1MN6A 1BROA 2WZDA 3OZEA 4P7KA 5G0WA 5AI6A 1NXPA 3TUZC 1TAUA 3S8YA 2EFGA 4PYKA 4K6GA 4R1PA 1YASA 2GCIA 4RHFA 2Z0MA 8LDHA 2HPHA 2FN3A 4U5XA 4RJKA 1M7HA 1NXSA 1P7ZA 3KOWA 3DLTA 3QSGA 1V11B 3ETGA 3GR6A 4L78A 4TSKA 4X1KB 2X76A 4H15A 4D4MA 4JBLA 5AKKA 5CAEA 4C4OA 3O0TA 4TKUA 1J20A 4ANFA 3SEAA 4CH3A 2IPOA 1SD1A 4XU0A 2VSXA 4OATA 4BX3A 3O31A 5ILGA 3W2TA 4YRJA 1YFZA 2EX1A 1Q3KA 3PKJA 1EM6A 2PYIA 4WNIA 3L7LA 4J0GA 1FS5A 1TU3A 2EKBA 1RJ9A 1CJUC 1J0CA 1JHXA 1HQKA 2QUAA 3LDHA 1IM2A 4NYJR 5ADHA 2CLIB 1BN7A 2GN0A 2DUJA 3FN4A 1Y4DE 3ES9A 1ANKA 3LQ2A 3STXA 3C6BA 3EYAA 1IHDA 2AMYA 2DBVO 2QW1A 2ZDGA 4V0OA 3KOYA 2XECA 2ZI6A 4JS0A 3ZHZA 5EEGA 1OF1A 5JRJA 4Y2XA 3BEOA 3GEHA 1GRVA 1SBQA 2VDUE 1Y8ZA 1CS0B 1P45A 2RGNA 1YUNA 2C8MA 3OM8A 2PIAA 4DM3A 2WMDA 2PV0A 2ORVA 4G84A 1TYAE 4P4GA 3WR5A 5TDHA 2I91A 1SCKA 4B75A 3HXXA 2BBWA 4RE6A 4ZXFA 3ER9A 4GYWA 3MGKA 4QARA 1E2DA 3AILA 1I2CA 5JAZA 4UPVA 4H7PA 1UAYA 4WJZA 2UV8A 2PUEA 5LU8A 3KB8A 2EF1A 1Y7IA 1L3IA 1M2FA 1POXA 2OD2A 1P3DA 1EUDA 1Z34A 2JH8A 4HP8A 4ECEA 2ZBQA 4X91A 3GEDA 4KPEC 3BWCA 4O4HB 4ARBA 2W83A 1TFRA 3JQGA 4AJ4A 3HO8A 4MW1A 4DPGA 4AXXA 2I1QA 4ODIA 4RDXA 5LZ8A 2C84A 2HHHB 4ZOLF 2VWPA 1EIZA 3PQCA 2BCGY 3C6KA 3DSRA 2Q4TA 4LJ7A 2VA9A 3ND8A 1XPOA 2VZEA 1G7CA 4A16A 1I6MA 3RVOA 4RY0A 4EMSA 4XJXA 4DJFC 1HZZA 2C4VA 1EDBA 2GKGA 2HA7A 1BS2A 3IL2A 4C07A 1U3VA 1AS0A 4IDOA 1CLEA 1PS8A 2P2YA 1CRLA 1JBKA 5CLGA 3UCFA 5CA1B 3K6SA 1L9KA 1QM5A 3KSUA 3M70A 4KDFA 1E1MA 3DD5A 3FSGD 1HFWA 2Q6VA 1XNRB 2OENG 4DBZA 1RPZA 4U7DA 5I7UA 4FYPA 3OU2A 4DCOA 3EY4A 3K8OE 3V2HA 4XVHA 2X0KA 1E1QA 1M2HA 4A2PA 5JYDA 2R79A 5B7PA 5KTKA 3QE2A 5ALMA 1DEKA 3MSCA 5BYBA 4ZZIA 4IZIA 5HJ7A 1HDEA 4V0KA 3A25A 2W2KA 4NXNB 1BYUA 1CUSA 1LJ8A 3BHJA 4K6FA 4LC1A 3AUAA 1OXSC 4MV8A 5DTJA 5B3JC 4KNVA 8ATCA 3Q7PA 3WLMA 3I62A 1NR1A 4MARA 5EERA 1VIYA 5KDOA 1Q7TA 4YMWA 1JSXA 2BKUA 2V55B 3W5UA 1UKAA 2GQ0A 3PQ7A 1GPJA 4ZJUA 2V03A 1DG9A 1LTHR 1A9PA 4YV1A 2ZSAA 5C8DA 1K4YA 1UBCA 3C5EA 3I4LA 2ZINA 3RTBA 3DOJA 1RXUA 3EMKA 2W2TA 3NBFA 3DD1A 1OU4A 3Q12A 4HZUA 2AGVA 4KQ9A 3G0OA 4H17A 2V6GA 2RHHA 3BK7A 3I09A 4XYGA 4ZCLA 1I9GA 4O3FA 3U4MA 2AV6A 3IO5A 4ZD6A 4DR7B 1PN3A 2FUG6 4ADSG 5LMUB 4DCJA 3LQKA 1T2EA 4KCGA 1NOKA 4XCXA 3A1UA 3LWDA 4YT4A 1EESA 4ZOLA 3M2PA 1HKHA 4WEOA 2X6RA 4CT0A 4ZVKA 1W0CA 4DLBA 3T3GA 3AG5A 3CR8A 3GI1A 2IS4A 2NT4A 3TW0A 4AT1A 4ND1A 3C8UA 5CNJA 2QHXA 4ZPXA 4XGRA 5A9SA 3R1IA 2TSYB 4ASUD 1E5TA 3B8EA 3GRRA 4NJMA 2FSVC 2J87A 1XMSA 3I58A 1N2IA 2BEVB 3B89A 5FI5A 1KQGA 3RU9A 4EY4A 1TYBE 4PLHA 1DDIA 3A6EA 2R7AA 4MULA 4D9KA 4RFSB 3LI2A 4DSAA 2B83A 1YL7A 2J09A 2AT1A 4DMMA 2XBUA 4P3XA 6GPBA 4RKFA 1W75A 3JYHA 3L0OA 2ZEJA 4IMJB 4EI2A 1EIYB 4F8EA 3QLUC 1DEXA 1VHWA 1N5OX 1JTFA 4ID3A 2IHYA 1U0NA 1ZICA 4BGIA 3ACCA 5JSQA 2VTBB 2I6FA 1PJ4A 2JI6A 3CLTD 1TLLA 2BJWA 1E5VA 4Q4JA 4L28A 1XZPA 1Z22A 1DEHA 2XCOA 2O2DA 4NTZA 5AM1A 1KKMA 3X1MA 3GDHA 3AWDA 3HJTA 3CV3A 4OBBA 5E4TA 1DX4A 1JIKA 5DM4A 3JV7A 5K0JA 3OPNA 3S1SA 1VPDA 1WZUA 5BRNA 1L7DA 3FOFC 2IXFA 2GI4A 4TVYA 3EIWA 1T0PA 5F4ZA 4BDTA 1SIWA 5AUPB 4JMLA 1C7RA 2GD6A 4C0SA 4UTOA 1M0SA 2FG5A 3WK9A 5F2KA 4PGFA 4JLSA 3VKHA 4QEZA 2YBDA 2FZLA 1E9CA 1R16A 1US8B 4HGPA 3QYFA 3PD7A 4IDEA 4RD4A 2XWJI 4POOA 4LHEA 2J85A 1A9XA 4MA0A 3A5YA 1U65A 4DSUA 3U1BA 4YJ3A 3HXQA 5HK8A 2X0EA 2NSJA 1Y1SA 1PG2A 1F6DA 2QSYA 3HFGA 3WIBA 4LWQA 3FB4A 1M54A 2ZIAA 1YR1A 4PZUA 1G8HA 4R2XA 3IMGA 2PXHA 5HS4A 1HYHA 4MVJF 4LTDA 1ZG3A 2XZDA 3B9BA 2W6ID 2OV6A 2Z9BA 3HHPA 4P4NA 3F0TA 2E7ZA 4IIXA 4JNKA 1GPLA 3NNNA 2Q6OA 1E4VA 1M8KA 2DFTA 2BL4A 3C15C 4GE0A 5SZHB 3T7TA 3TCXB 4A0HA 2Y0DA 3JY6A 3FPEA 1GYPA 3H5AA 3U9LA 1X7WA 1HY3A 1RRFA 4I50A 2HF7A 3HMKA 2XQFA 3H5NA 3OU7A 4NCIA 1U4OA 4QOIA 4G89A 1JB1A 2ESRA 3LHKA 2FKNA 1JQEA 1RLMA 2YV5A 1YHNA 4AUNA 4LVKA 4FOPA 3AF1A 4GPEA 2ORYA 4CG1A 1S96A 1W94A 1GEEA 4K0RA 2E6UX 2VP9A 3JPYA 4AMYA 1H2FA 1RAFA 3B13B 3G0CA 2F64A 4B3XA 4YPVA 1SU4A 4YJKA 3H42B 1XQ6A 5DDIP 2OPHA 4P98A 4GI1A 1K6JA 1KO4A 4KQWA 3DBLA 4NJEB 1W46A 2OYSA 4W5RA 1V2HE 2R1TB 4TN1A 4JJ4A 4ETIA 1USGA 3ETDA 3SBXA 4N01A 3ROFA 1LPMA 1KMHB 4B46A 1VJDA 2DU8A 2BM1A 3IAFA 4JU8A 4M87A 3RYHA 3HB4X 5K3AA 5JEDA 3N5CA 4DRXA 1KAMA 1Z0SA 4MPTA 2G7ZA 4KV7A 4Q4LA 1PK8A 1M1NA 1QYWA 4UD6A 2H63A 4H7EA 4JODA 5HR5A 3ZLBA 1ZR2A 2ZFUA 2FPMA 3A05A 1I0LA 3ICAA 3EXIA 2VUSA 3C5VA 3PHCA 5BW4A 3AIOA 1W36D 1NXVA 4RNCA 2CSUA 2VSOA 2EHDA 4UEJA 2IOFA 2P77A 4V38A 1TQ2A 1YJ5A 1RBYA 3CKMA 5EI5A 2NXWA 2QRKA 3UENA 1CE8A 4PNZA 4M0UA 2JGFA 3ZJYA 4NBVA 3UA4A 5JSHA 2IYNA 3M1IA 4OUDA 3QMPA 3JZFA 2G8LA 1TUBB 3QU9A 4G1EB 4IQFA 2XXJA 4MIKA 3H04A 4JHLA 4RPGA 4Z4CA 2QIPA 4J3JA 5DF1A 2XMSA 2BY4A 2EW1A 2JI7A 2E4WA 2P5SA 4OFZA 2QV7A 1M6WA 2KBFA 1XOIA 4XQ9A 1FUUA 4YNBA 4KWIA 3EG5A 4WCFB 3WO0A 5DK4A 3IA7A 2O8DA 2KW5A 1XPJA 2OHGA 1FLVA 5DYNA 2CW5A 1ZFNA 1P31A 2EW8A 1WD5A 3FHLA 3MMXA 1X8JA 4LBVA 5A9TA 4BRUA 3GFVA 1VFPA 3MCWA 1XV5A 1ECLA 3MTGA 2DUUA 2PKEA 2OSBA 4JXJA 3IDQA 1WAMA 1EP1B 2CVZA 2OECA 3HJCA 1NJGA 3DE4X 5AXDA 2WLSA 5H02A 2O5CA 5F7XA 4DR6B 2Q3DA 4IOMA 2AR7A 1KEUA 2OM2A 4A15A 1ZBDA 2CHQA 2OLEA 4UEWA 3WK5A 2P6OA 3J81A 3IBCA 5DGTA 1JIUA 3OE4A 1BCSA 7MDHA 1XF9A 2CYAA 2VO1A 3I2KA 2IRWA 5FR1A 4B2IA 1QGDA 4D79A 4HYQA 2C78A 2Y1EA 3WFIA 1P8JA 2AX3A 3ZWKA 1FFHA 1JPNA 1UMDB 1CUYA 3PUYA 3AKDA 4UE6A 3R41A 4XQGA 4F45A 1GDTA 4I36A 4IJ6A 4U8HA 4XYMA 1DELA 1EEHA 5AKGA 3EASA 4HPJB 1TW2A 2YWBA 3L18A 3ZN2A 2VTVA 4V0QA 4CJXA 4A23A 1SXPA 1T4CA 4E3WA 4RPHA 1DJQA 4KXLA 4RPIA 4EVIA 3G59A 3I64A 2O5RA 4XTXA 1GZ5A 1E2UA 3FWKA 3NORA 5FWYB 1NXXA 3W8FA 3WL7A 5I51A 4BJ1A 3O8BA 2HDNB 3OLYA 4YHBA 1RADA 1XCMA 4M1TA 4JSYA 1KKUA 5ALJA 5ES3A 4F21A 4QUAA 3L8FA 2HW8A 1OCEA 1GAEO 5BQOA 5FFNA 3L7YA 3E2IA 2IYPA 3FTNA 4KO4S 2EF0A 1B70B 1QV6A 2WU4A 1DKQA 1R4AA 5BW8A 2POQX 5D7BA 3KR9A 3BZWA 3NKFA 3CW8X 3NJ4A 3QMWA 5CT9A 1V47A 5LA6B 1M8FA 1NYLA 3I83A 4NLLA 1JQLB 1YVDA 2HB6A 4IFEA 1A8HA 1KSFX 3OE7D 4WZAA 1KU6A 5SY4A 3SQNA 4J75A 2CVHA 3PI6A 1YAHA 5SY9A 3U48A 3V8EA 1BRMA 1WDWB 1NTOA 4I0WB 4WADA 3MA0A 3BH0A 1FFXA 1R0WA 3GRPA 1UMKA 1XL0A 3L1VA 1E2GA 3QKWA 4LZJA 1CDOA 5IH3A 2JFBA 5ALWA 3JAWB 3SJBA 3HM9A 2NS6A 5K99A 1M73E 3T7AA 2CNNA 4H27A 4FQ8A 3QU5A 5TV2A 3U4DA 3D8TA 5H82A 3VYSB 4F85A 1BGWA 4MWBA 1W88B 4RTRA 2IUYA 3ZHUA 3MD0A 4RHCA 1MZPA 1KDYA 4RJLA 4ZTBA 5KKNB 3C41J 3LUKA 2IYEA 1JDUA 3L1IA 1BIBA 1X7HA 5A4MS 3QI7A 1N33B 3U80A 3RC3A 3VDMA 3FOWA 1IEXA 4RABA 5FF9A 1CZLA 4X6XA 3FRJA 4DDTA 5IC4A 1V43A 3HJUA 5EQDA 3GAMA 1QZZA 1QANA 4K87A 4D9GA 2PZEA 2C9ZA 4YK7A 1JYFA 4B4KA 3H3FA 3TECE 4NEQA 3TX6A 3KVYA 3WIDA 3OQNA 2O1XA 3ZDQA 4D9MA 4MW6A 3GFSA 1FFWA 1PLJA 3HY4A 4E15A 1Q0QA 2CJBA 2BFFA 4HX9A 1W4RA 3MQ4A 3SC4A 4HAIA 4EMUA 2AEJA 4HY3A 3DWIA 3V4LA 2AJDA 3LGAA 5KAPA 3HBAA 3WGKA 4BNDA 3RRMA 3F4LA 1RQRA 4CFSA 4U7TB 1OVMA 4JP8A 3ZQKA 2MYTA 2PGNA 3D8UA 1Z73A 4PAQA 2O0LA 3FAKA 1CDZA 1JLKA 1V4BA 1V8OA 3FR7A 4O3MA 4KYIB 1LV8A 5FQOA 5KYGA 2H3HA 4AJOA 3P27A 3KQHA 2AMCB 1IHXA 2Y77A 4OAOA 4ACBA 5L3SA 1E8DA 3K8QA 3A6ZA 1P8AA 4CR7A 1Y1KE 5IJ9B 2BMVA 2Q3BA 2I3ZA 1P77A 1PV4A 4DZRA 1U3CA 3JASA 5LXTF 5EE3A 3LV8A 4KE8A 5M34A 4NV3A 5K8LA 2EX0A 1MQSA 4HLQB 4OMDA 1BJRE 1N2GA 4IF4A 4ARCA 1WVIA 1HM5A 2VZ8A 3IAS1 1OFHA 4FNGA 1W4BA 3DO6A 3K1TA 4IIFA 5HKLA 4GU5A 1T34A 2HYIC 1XJWA 1A04A 4Q9AA 4OB8A 1SCUA 3MJFA 1TEXA 2C9DA 5DEOA 3H5VA 3CF4A 1GN9A 3QVWA 1Q74A 2G1KA 2B8NA 4DXHA 4TLCA 1N6KA 5CAEB 3CEAA 2BCJQ 4TKUB 1N3BA 4FGUA 1YZVA 4DQ2A 1MZVA 1ZJ4A 3K7EA 4JT2A 2XDQB 4ZOAA 1R8XA 3WLKX 5U1PA 3A32A 4RVGA 1M72A 3BUSA 5DULA 1RVDA 1YRLA 3R6GA 4FMBB 4F93B 4GR9A 3WL6A 2EWWA 1TZCA 1KY4A 1P1IA 4FKMA 1GR0A 3CLUD 5EHNA 1POWA 2WJ6A 4XKJA 1YRAA 3TLEA 3DNMA 1G291 2FN9A 2VRBA 5BSRA 3I05A 1RJ9B 5FUMA 4KO8A 1EFPB 1P0PA 1U1EA 2YXNA 1E94E 3IUMA 4BMYA 4ZO4A 1MAAA 2IHBA 3OJOA 4K03A 5AXCA 4RPCA 4UHDA 1EINA 5KWSA 3KVOA 2H4XA 4NWIA 2P6PA 1JR3A 2C2OA 2RAVA 1XL1A 2R1ZA 5TARA 3OZUA 4US2R 4GX5A 1RQLA 2RH4A 5FI3A 3EPHA 3RGGA 4OJYA 1QYVA 4D45A 3TD2A 3HU2A 3QVGA 1Z63A 4GWKA 1FNCA 1C3XA 2DBQA 2PS9A 3OFND 4A6XA 4BFVA 5EINA 3OAAA 3UHPA 2P90A 4PLVA 4XTCS 2Z4TA 1PQWA 2R66A 5LXTA 4HOYA 1FSFA 1YIAA 4CMCA 1IXRC 2A9RA 3AF2A 3OZAA 3QLTA 2QM7A 4OHOA 3RS9A 2XIQA 4EQZA 2Z30A 3K6RA 3CUYA 5UKDA 4A5SA 3HFVA 3RFUA 1EUDB 1O3YA 3PTZA 4RK7A 1B14A 3K0CA 1DLIA 2M6RA 3QKSA 3FNFA 2P9GA 3DE1X 3JQGB 1ZU4A 5AW7A 5K0GA 5FTMA 1Q7RA 3IS3A 5MN5A 3AGQA 4GL4A 5LDDC 2ZR8A 3ECAA 2RGXA 4YCVA 3B48A 5GP1A 3V4SA 4AJIA 3U6KA 3TW8A 5JNWA 3ZD6A 2OSVA 1HDYA 4XA8A 2IP4A 2VYVD 1Q22A 4B76A 3LUFA 2ENUA 2VR1A 1NDUA 3A14A 4XWGA 1N8TA 4IJUA 3WS7A 4EM6A 2NO4A 1NPTO 3ZE1B 1A8IA 3KFXA 3CTPA 3A7DA 2C2XA 2JIQA 2B4AA 1HT0A 3MZ0A 4KFUA 1H1DA 3QIVA 2JFHA 2EZUA 2RGCA 1PJ3A 3K6SB 3UY4A 1IQPA 3IIJA 5F2EA 1PX0A 1AMNA 4BPBA 3IIIA 4N5NA 3GJ0A 5F7ZA 5IAEA 3RKXA 3TYXA 2H7VA 5JS7A 5KVAA 2A1UA 5K3DA 3H2IA 4Z4IA 1QTIA 2XMGA 3LT0A 3T52A 3UAGA 3H97A 5ANRB 4UOZA 2YDYA 1YTUA 3TIGA 3B3GA 1C50A 2QY6A 2FI1A 4UNQA 1GP2A 2JCBA 3FUCA 4UUBA 2SHKA 2F8SA 1B15A 2YJ3A 1R9GA 3BE4A 3NDRA 4MW9A 4MUFA 5FPPA 1XRPA 2W2KB 5IT9A 3D0OA 4S1TA 1JPUA 4ENVA 3G2KA 1P72A 1Z13A 1ZQ9A 3GA0A 3MRVA 2VPQA 1JDBC 1UJCA 3OF3A 3A2NA 3QWBA 4J7CA 1QZTA 4DNFA 3Q3HA 1IHUA 1JV2B 2JHFA 3Q2KA 4GMKA 5K03A 3OEEA 4CETA 3HYRA 1K7XB 5C2JB 1H9BA 3UT6A 1FQKA 3HVRA 2AB0A 2H1VA 4TS3A 4EG6A 3DJYA 1GT91 2YV3A 2ZIGA 3GLIE 5DI3A 2OUKA 2WOOA 4LZPA 1RWXA 1KO8A 1S8AA 3PQFA 2PWZA 4EHBA 2JKVA 4HZUB 2W7TA 4XUCA 2ALJA 4LRTB 3AM3A 2CXXA 1EI9A 2FOLA 1XZBA 1MQ9A 2W48A 3QWHA 2JIZD 1Q0PA 2Z6QA 3U7QA 2X6QA 3ELWA 4RTJA 2AVNA 3O8RA 4G5GA 4LMPA 3CWCA 2HRQA 4NAVA 1HLGA 3V1YA 4C4RA 4ZCIA 5IBCA 1HE4A 2PBRA 2GHTA 4QJ3A 3AKZA 2G40A 4DWOA 4MCJA 1I7LA 4YT8A 2BZSA 1HE2A 1JDVA 4HRVA 4RDIA 4C0LA 1KZYC 3TLCA 2YVUA 3HUUA 1H2RS 2R6GA 4ENWA 3O03A 3ED5A 3QKRB 3TLMA 5PNTA 1YDGA 3RPEA 4XB1A 4KAAA 4IEIA 1RMYA 5FAXA 4JJ6A 2B6HA 5IARA 5I7SA 1NVDA 2XWBF 1D1TA 4M55A 4QBKA 1WPYA 1LWOA 1RYBA 3K72B 3RS2A 2QBYB 3HMQA 1KYVA 3NALA 3N8NA 4JN6B 4PZ0A 3R76A 2WUEA 2ZUSA 1XKQA 4CU5A 5HDQA 3OT1B 1G8SA 2WVHA 4G36A 5K3OA 2W6QA 3FM9A 1EFAA 1DRJA 1EFRD 2W8BA 2TMYA 3DMPA 2C03A 1G18A 3H3JA 3HA3A 3KAPA 1XRJA 1V8BA 1T5DX 4HWOA 1CRZA 1BG6A 1KHTA 3NHSA 3ONEA 3PGJA 2VG8A 4Q4JB 4YAFA 4DDWA 1GG5A 4FHZA 5I47A 5IN5A 1YNOA 3LLUA 4PANA 5JISA 3GK3A 2D2VA 1K5HA 2BOVA 2P9HA 1XU7A 4OI4A 3UGQA 4N5IX 1D6JA 1G20E 2HGSA 3EEIA 3RTEA 3VUEA 2P2ZA 1TUIA 2GLXA 1FFGA 4GOMD 4LVJA 2CL6X 4F7DA 1PFGA 4L0MA 2HD4A 4NOJA 1GV1A 2IYXA 2VH2A 4G25A 1E32A 4JBGA 3FY4A 1YE3A 2O4CA 5ADUS 3T1YB 5IMBA 1TADA 2FCRA 3OVMA 4Q7EA 3KKQA 1KI6A 1LQUA 5AUOB 5DXAA 4GZ6A 1C5KA 4IYJA 4ZO6A 3CNQS 3V7WA 2BUBA 3W2HA 1KVUA 3UAVA 4EG3A 4L85A 1CIJA 3JATA 3G2JA 1W25A 1Y7HA 4GPTA 2WKRA 1UZNA 4EX7A 3R5HA 2HIGA 1A9XB 3BKWA 4L8GA 3RI3A 1VFNA 1R0SA 5IK2D 3AP3A 3EUWA 1A72A 4YJ3B 2ZJ4A 4KQEA 3PA8A 1XBTA 3G1UA 1Q92A 3DEIA 3WRYC 3ZV6A 1NRXA 2XUOA 3NYQA 4ER5A 2KS6A 4XQCA 3ROQA 2O1SA 5TS3A 2VIIA 3FXAA 2WZQA 1JE1A 3M6VA 2UUAB 1C9JA 1N8NA 2CNWA 2Y3IA 4FGWA 3N86A 1H69A 2HCTA 4MUKA 3ZHOA 2BGMA 2V7TA 3VR5D 1USYC 1YKSA 1WZCA 3ET4A 1X7WB 3THRA 4I50B 5BWBA 3ME5A 4QBIA 1AKMA 1MOPA 1AUQA 2IUSA 1GYQA 2AK3A 3DVRX 1WB4A 3TB4A 2AH5A 3EMDA 1YDWA 3AEUA 2J6IA 4WY2A 2GJAA 1KJNA 1UEJA 1RHQA 2GCEA 3DLPX 1IZ8A 1VXRA 4P36A 3W8NA 4BRSA 5H9WA 3MMNA 5BT9A 3O82A 4H59A 2XB8A 1HOTA 2IEYA 3DBLB 4A82A 5I7WA 2AS0A 3IILA 1FRQA 1GGEA 3P19A 2VFAA 3OQIA 3RTAA 3E84A 1CZUA 4B6FA 1LBHA 1JHAA 3K09A 4BVBA 5CEFA 4RWEA 1GTRA 3IEVA 3I4FA 3AVYA 2ZM6B 2PZLA 3RG8A 4HQOA 5HE8A 1ZW1A 3JYPA 4DRXB 1XTIA 4KIJA 3SD7A 1YRBA 3MCZA 3HP4A 4PSVA 2VQSA 2ZWMA 1PR4A 1P5JA 1P9LA 4PE5B 4HNUA 4IRXA 2G09A 2DVEA 3ZIAD 5IDXA 2DR2A 4JWKA 3AGPA 4B82A 1NVGA 4LI3X 1HDZA 2C0CA 3WY9A 1X19A 1Y8QA 2FPIA 2ZULA 3HK2A 3E22A 3RK1A 3ZWPA 4O2AA 4JMPA 3I9FA 2IZ1A 1O6ZA 1YJ8A 3LLCA 4JEUA 2ODBA 1JZQA 1MB3A 3FFXA 1CE8B 1H05A 1OLSA 1T9CA 3EQ7A 3G2OA 4BGVA 2QN8A 3BD9A 4OUDB 2EHJA 1AKVA 3NNDA 2FW7A 1CUHA 3OZCA 1PRYA 4PV7A 2A35A 5I7