3IKLA

Crystal structure of pol gb delta-i4.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
388
structure length
364
Chain Sequence
b'SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRGGRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-2, mitochondrial
publication title Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 364
sequence length 388
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3iklA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3iklA02
2I4OA 4YRJA 2Q5HA 1KOGA 4TVAB 2C7IA 2CJBA 4XU2A 2ZZFA 2DEQA 2RHSA 2Q7GA 2I4MA 2Q5IA 3UGQA 3I7FA 3EFRA 4P75C 2ZT7A 4RQFA 1H4QA 2ARUA 4P74A 3E9HA 1WU7A 2CGHA 2PMEA 4YRQA 2XTIA 1JJCB 4OLFA 3LSSA 3RF1A 4OP0A 3IKLA 3L4GB 4UP8A 3VQXA 1BBWA 3HFZB 2CJAA 4TQFA 2DXUA 2RHQB 3V7RA 4P3OA 2ALYA 4UP7A 3VQWA 3HXZA 2IY5B 3HXXA 2ZIMA 2CJ9A 1E1TA 1Z7NA 3CMQA 2EJ9A 1ADYA 3TEHA 2DU7A 4O2DA 4TVWA 1V95A 1EVKA 4K87A 4ZTZB 3QO8A 3HY0A 4CH6A 1YGBA 4P75A 1B70A 3VBBA 3NEMA 3PCOA 4YRCA 2AKWB 3HXVA 1HC7A 3PZCA 1N9WA 2ZNJA 1E24A 1WQ7A 4CH3A 3UH0A 1KMNA 1PYSB 4XEOA 3HRKA 2QHSA 3HXUA 1B8AA 1W66A 3RL6A 4CH4A 3MEYA 4P74C 2E10A 2QHUA 2ZT6A 2DZCA 1G51A 1YFRA 4XTYA 3BFMA 3L2ZA 1H4SA 4E51A 1E22A 3RGLA 1L0WA 1Z7MA 1ATIA 3V8KA 4K86A 4TVYA 2I4NA 1WLEA 4TQDA 3P8TA 4YYEA 2EAYA 4TTVA 3FJPA 3MF2A 2ALYB 4YRLA 4YRPA 2ZNIA 4YCVA 2AMCB 1HTTA 1NNHA 2ODRC 2DU5A 1WQWA 2ODRD 2ZTGA 1BBUA 3LC0A 3HY1A 5ELOA 3TUPA 2DTIA 3TEHB 4H2TA 4K88A 2ARTA 1EQRA 4YRFA 3NETA 3OD1A 2XGTA 3RUXA 3A7AA 1WPYA 2ZR2A 3EFSA 2E3CA 5C51B 2ZINA 1X54A 2DZ9A 1ADJA 4H2YA 3NENA 2E41A 3IG2A 4YP0A 4BW9A 1X55A 4L87A 3A7RA 3V7CA 1USYC 3L1AA 2CIMA 2DQ3A 2ZR3A 4KQEA 1C0AA 3WQZA 3HXYA 5C53B 1EIYA 1NJ1A 1WYDA 1EVLA 3ICAA 3V8JA 2Q7HA 1B7YA 4WJ4A 4XU1A 3QNEA 1EFWA 1QE0A 1SESA 4BWAA 1X01A 1X2GA 4RQEA 1IL2A 4XU3A 1BIBA 1YFTA 2DXTA 3HRIA 4H2XA 4H2VA 4P71C 3A5YA 2J3MA 4Q15A 4EX5A 2RHSB 12ASA 4AH6A 4TVAA 4ZTUB 2ZT8A 3E9IA 4YROA 4CS4A 3RKXA 1YB3A 2PMFA 1QF6A 4LNSA 3G1ZA 3HFVA 4XTUA 4PG3A 4KR2A 3REXA 4CH5A 1USYA 3VQVA 2ARSA 2FYKA 2P5IA 3IKMB 4YPFA 4ZIBA 1JJCA 2J3LA 4RDXA 4YRIA 4PHCA 2ZXFA 3RACA 1NJ8A 5K1PA 3L4GA 4XTZA 4YRSA 1H4TA 4X5OA 2EJGA 4P73C 4TWAA 3HFZA 1LYLA 1B7YB 1NYQA 2C8MA 4P71A 4H02A 4YRRA 3V7SA 3A32A 2IY5A 1RIQA 2ZT5A 2QHTA 4YRNA 3QTCA 2E65A 5F5WA 1B70B 1HXDA 3A7UA 4HWSA 2DTHA 3PCOB 4CS2A 4P3NA 3R07A 1NYRA 3M4PA 2ZGWA 1SRYA 4EO4A 1G5HA 3QO7A 2AKWA 3TEGA 4CS3A 4P72C 4G85A 1J5WA 4DQ2A 2DQ0A 1NJ6A 2DTOA 3RKWA 3QO5A 3UFGA 1PYSA 4H2UA 5K1XA 1KMMA 4P3PA 4P73A 1ASYA 4H2WA 3RKYA 4UPAA 4XU0A 2ZZEA 2I4LA 4HVCA 4HWPA 5ELNA 3RIRA 1G5IA 1FYFA 3NELA 2DJZA 4KR3A 4YCWA 4WI1A 1X2HA 4YDQA 4HWOA 3A74A 11ASA 2P0LA 4H2SA 3REUA 2ZIOA 2ZZGA 5C52B 2E64A 3KFUA 3BJUA 3ERRA 3P8YA 4UP9A 2E5AA 2AMCA 3W3SA 3HXWA 2EL9A 2HNIA 3LSQA 2LW7A 4G84A 4NCXA 4XEMA 4DPGA 1NJ5A 1X56A 2G4CA 2QHVA 4YRMA 4P72A 4XTXA 1NJ2A 1WNLA 3UGTA 4Q6GA 1B76A 2DVEA 4RMFA 4YCUA 1SETA 3MF1A 4YREA 3P8VA 4YRKA 4XTWA 4WF2A 1E1OA 4YRGA 1GGMA 4YRTA 1BIAA 3IALA 3A5ZA 2ZCEA 4WJ3M 4XTVA 1YFSA 1ASZA 2DKGA 5HGQA 3V8LA 1EIYB 1SERA 2EWNA 2E1HA 2DDZA 4HWTA 2RHQA 1EOVA 4HA8A 4HWRA 2Q7EA 5E3IA 3M4QA 3HTZA 4J15A 1VQZA 2EJFA 1H4VB 4H2XB 3DSQA 5KNNA 3VQYA 3A31A
chains in the Genus database with same CATH superfamily
4ND8B 3DE5X 5HJ7A 4G89A 4UAJA 2O52A 3CLKA 3PSHA 3KB6A 5EJAA 4YAUA 4ZOLF 3ZG6A 4C88A 3PD0A 4DLVA 4TVAB 3PF8A 2P8JA 4JUIA 4ZVKA 2Q7DA 1CUDA 2PX6A 4E12A 4XH9B 2BTQB 4BQQA 5DLYA 3IFSA 1NP7A 5HIMA 5AWFC 4R01A 3WWDA 3LL7A 3LUAA 4LJKA 5DGCA 1QGED 2XGSA 1JSXA 1HPLA 2XAUA 3RHSA 1N5DA 3GLIB 4AJ4A 2YRFA 1WTAA 4W99A 5COBA 1RVV1 3R4CA 1VSVA 1Y4UA 1GAJA 2WJZB 3HKEB 1FUKA 4QHTA 5AKIA 3VZQA 3ICOA 3W5DA 4KI0A 3PI7A 2GM4A 4M1WA 4Q7MB 1R6VA 4R1OA 4HY3A 1IJFA 1W1UA 3AYZB 1PFQA 4XASA 1UJCA 4E5DA 2GA8A 5IWCA 4QXAA 3CTPA 1ZNYA 3T7RA 2GILA 4XB6B 4ZZ0A 2SICE 3VDRA 3U7GA 1DQRA 1JEQA 2WYUA 2REBA 4YK7A 5FTMA 1EK1A 2MDTA 2EG5A 3CS3A 3LW8A 3RF1A 1CEXA 3GJ6A 5GY7A 1WHSB 3HA2A 1KZGB 3B2EA 2VA9A 3FBTA 4L7QA 2GHTA 2EZ8A 1NFQA 1JNXX 1KH2A 1VCMA 2B4RO 3Q9UA 4P38A 4C4XA 4TMXA 1QG0A 1KH1A 1O5OA 3MT0A 3UAYA 1JFLA 4O8ZA 3HXQA 4AY2A 3UGKA 1V8PA 1RWOA 1WD5A 3K2EA 5F4ZA 3HUFA 5KB3A 5F1OA 1NATA 1E20A 3GRAA 4I9HA 5K0ZA 4V02A 1USKA 3EZNA 2Q4OA 4JYBA 5DHUA 4W5TA 1PJCA 1XPRA 5JCPA 3RTAA 1Y7TA 2IZ5A 3R8XA 1NIJA 4MUNA 5K6AA 3SNKA 4FDUA 1BCSB 4BNWA 3CNLA 3PVCA 2OZKA 3IUQA 1BEUB 1YFJA 2ZW9A 3AFIA 4B44A 4HEQA 4YT8A 4MW5A 4C6HA 4GZMA 3SZGA 2ZB4A 3C5VA 1O58A 4JEIA 1L7AA 3UV7A 3CVVA 3DHYA 4LY0A 2OHJA 1ZQ1A 2W2OA 4S35A 3MJHA 3I72A 3K9FC 1Z8HA 2NAFA 4JT2A 5BVGA 3GJQA 1W8DA 1NNLA 5JQWA 5IAJA 2H4FA 2IELA 3OZBA 1FTWA 4KN6A 1ORVA 3HU5A 5AJUA 1N5OX 4F97A 4NE9A 2P75A 1D2HA 5EPOA 4RLHA 1DC8A 1T6YA 1V6CA 3V9AA 5D00A 3OZVA 5TNXA 1AGYA 2CZQA 2IPMA 4P4LA 4ZT3A 3S2EA 3T52A 3UJPA 1YE5A 3DL2A 1M1YB 3M4YA 1TLTA 2GN4A 5F4BA 2QRLA 2XKAA 4Y67A 2PSJA 2H0AA 5LZ7A 2PG3A 3KO8A 3RUEA 4BE7B 1QHGA 2IIBA 1Q15A 2IC5A 1CUVA 1HC7A 1K2VN 5EFZA 5FQNA 2ZNJA 2DBYA 3L7OA 5AFSA 1Z6TA 3WWEA 2OGZA 1TT7A 4X66B 1WMAA 2NPFA 3UMGA 2W6JD 3X3HA 4F3KA 4R7GA 1JQ3A 4HNQA 2VH1A 1BA3A 2BM0A 1N5MA 3K73O 1QVRA 3SEAA 3CJQA 4KFTA 4LHVA 2PWAA 2J3IA 3DYIA 4AKEA 4B48A 1JHAA 2J6IA 3CIOA 4BFZA 4R0MA 1EJ6A 3NVKI 2D1RA 2ZIXA 1RBMA 1XZMA 2CFIA 5E4YA 4F4JA 1X77A 4BB9A 4DA6A 3B6ZA 3DZHA 4PIPA 1PQPA 2VNJA 2BF4A 1S2MA 2M9MA 3FUUA 1PJ8A 1RI3A 1YL6A 3NZEA 4DMLA 2C7QA 1A8HA 3FWYA 3R23A 5JS6A 5EIEA 4Y2GA 4JZKA 1ATIA 1RAAA 2DU8A 4TL9A 4PC6A 2FPGB 4MZXA 1HR0B 3JQPA 5A1TA 4RK4A 5CNKA 3FCUB 3A1CA 4B1FA 4HTFB 4U39A 1SRRA 2CBGA 1MAAA 1JSCA 1NY5A 4HTAA 1OZGA 3UJ9A 1D03A 2B2XA 3FPJA 3L8DA 4UE2A 4EJSC 4MRAA 4EKIA 4EBFA 5AQ1A 5E0KB 5M34A 1IZ0A 5JOQA 1GU0A 2XUGA 2XMZA 4R9VA 4D9FA 5JS8A 1BDIA 3ENKA 4UREA 3DKKA 5FOUA 2AMCB 1XAGA 2Q4BA 1W0JD 2OG2A 1XTSA 3NNDA 1EX1A 5K0BA 2BGKA 3X1MA 2NVWA 2V7UA 3GNSA 5H5JA 4CG1A 1CZRA 1B15A 2D2FA 3K9BA 3ZBTA 5IDWA 1UAAA 4RNDB 3CG0A 3BPSA 1K5PA 1F1BA 1HTBA 2GM5A 3TLAA 2WSSA 4J1TC 4C0HA 4K88A 4ND3A 2J8ZA 4PS1A 1YS4A 3KSAC 1ODLA 1OH8A 2LXNA 1XZJA 1QKJA 3ABRB 4I3FA 4C89A 4CIWA 1S8NA 4FFOA 1MNAA 3ZVMA 4LZLA 3T4XA 5B5SA 4P3KA 1NT2A 3EULA 2H4XA 3G2NA 1P18A 2HWYA 5DBFA 1ZGCA 5EMMA 1FFYA 5JAZA 4OA5A 2F17A 1E6EA 2OD7A 1E60A 5HIJA 3WKAA 1YBFA 4E1AA 1XG5A 1WKVA 1GLGA 2OCBA 5KDLA 3RIMA 4PFKA 3UENA 3T5TA 3TXYA 1Z33A 3CUSA 3W5VA 4Y7DA 3T5BA 1HI9A 621PA 2OHHA 4QG7A 5AESA 4NARA 1FTSA 2E41A 3V2GA 5AIAA 1WZIA 3U26A 1R0KA 4NJOA 4J7UA 4Y0VA 4CIVA 1KJNA 1N9GB 2AYZA 4TRNA 4BW9A 2AI2A 3M6AA 3W8EA 4BBJA 5A03A 5JI2E 4DIBA 4BNFA 3V7CA 3CZPA 3OX2A 4CIXA 3L1AA 2Y99A 3W9UA 4Y2RA 3NPMA 4CKWA 2ZR3A 5BY2A 4IUYA 4XWOA 2FMXA 2ZYRA 3EN0A 1I7NA 4S0ZA 3RRJA 3T0FA 1MC1A 4CCAA 3NYRA 3V46A 1NVKA 1A0OA 2NXWA 3AONB 4JLVA 1SZCA 1WR8A 3BM5A 4DLRA 2V0GA 1JAXA 1F9EA 4M53A 3V48A 4BO8A 3PJEA 1K06A 3PS9A 4O4HF 2ZEJA 2I3ZA 4BO9A 4OJKA 3IJEB 4EPVA 3UV6A 2XRFA 5KTRA 4BAGA 4PNHA 5F2OA 2FW9A 3OP4A 3BMXA 5K3FB 1K0FA 1AUOA 1FRNA 3KKMA 3D4LA 4OHRA 4Z7NB 5AH0A 2JI9A 4L8LA 4D43A 5KHOC 2IYYA 1IHOA 3ELBA 3FRIA 2G77B 5BPHA 2I0FA 3EHEA 3ESCA 3I05A 3UANA 4AY4A 4EG6A 3IQIX 2YJTD 2CXNA 2WPNA 5I7WA 4RWZA 1XVLA 4H2VA 4Y18A 1TAGA 3R74A 1B8UA 4AJNA 3LT5A 4ARZA 2ZAMA 3DWGA 1QPBA 2EP8A 1KYTA 3EBOA 4QJ3A 1KDVA 4PANA 1P31A 2SKEA 4RMJA 1L3IA 4B47A 3HFJA 3HHEA 4C7JA 4JLKA 1K4MA 4FVTA 2DYKA 1VIYA 3T4UA 3FBGA 3H05A 3IT3A 2VSXA 4WY2A 3TEMA 5FR1A 4ZTUB 4YROA 5JS2A 1ZX1A 4Y2YA 3O1JC 1BXGB 1W581 4YJFB 5DHAA 1KFKB 3TGWA 1Z0JA 1FU4A 2IYXA 3DZBA 3G0OA 3Q40A 2AFHE 3EGVA 4GM0A 4UMEA 1EZZA 3PRYA 1ODFA 1YUMA 3R3UA 3TDKA 4YLYA 2AVNA 5AVSA 1R00A 1S96A 1DAOA 5CPFA 5DXFA 4JR2A 1Q1ZA 5EUMA 2Q9BA 1G7SA 3D8TA 1KY4A 1CQIA 2NUAB 4GDMA 1GTJ1 4BXOA 5TEWA 3G9XA 4AMGA 2ZJFA 2LWIA 3M6UA 4FEYA 3X43A 4GGOA 1PQYA 4KLNA 4C3UA 2IBTA 4GMDA 3KU4A 1L1RA 2I54A 3C3AA 2ZXFA 4U6SA 3OPYB 4Q9JA 3VYWA 2Y9MB 3GYBA 2I33A 2JFUA 3DMHA 1B8OA 4K6HA 3VR3D 3LWNA 2EHDA 1IFXA 2P5SA 3C74A 2XUJA 3G2IA 2EJGA 1D0SA 3LKVA 3OZCA 4BS9A 2WQZA 5KTMA 1UADA 3PWSA 2UYGA 3I2HA 3QSYA 1XP8A 2X5XA 4AJ2A 2BTEA 1UFVA 3MSCA 3KETA 2O7QA 1IWPB 2QK4A 2WAAA 3QV2A 4FMCF 4FNMA 4R16A 3RC7A 1E7YA 2VHXA 4IJWA 2XA1A 4RD1A 4CDGA 3BJRA 4YRRA 3O2SB 1LI7A 5JWRA 3CX6A 4UHDA 1X1TA 2PSHA 3L6RA 2IUUA 3HSSA 4INJA 2QVXX 4AUMA 1JLLB 5JNVA 1I1HA 2ONKA 2Q9UA 5DX0A 2YWGA 3VGPA 1AZLA 1U1IA 5EPUA 4IRXA 4QL3A 2IS6A 4KIWA 4IUDS 5KQGA 4IH9A 4QFMA 1P1IA 1DIRA 1E3MA 4XD7A 3IHLA 2YYYA 3LIPA 1PR9A 3AXSA 2IP1A 1MORA 4HNUA 4EY6A 5GZ3A 1B8PA 1WB6A 3H5AA 1MH9A 3E4DA 4IDFA 2ZE7A 5GZ6A 5BT8A 1W0KD 5BSEA 4PZUA 4D0NA 1NONA 2KBFA 3O2NA 1Y0BA 2C3MA 4LWZA 4OQZA 3RVKA 5GZ1A 5EKUA 1BAPA 1EFPA 3QO7A 2P6MA 4HDSA 3SM9A 3OU2A 1XRNA 3LUBA 3I01A 4MRVA 4MPRA 3Q98A 4P72C 1JBQA 3TMYA 4L9WA 1OZ0A 4Y6PA 1PJ2A 1EDDA 3JZIA 4GZ5A 1XEXB 4IQ8A 4WBSA 5ENZA 5IDXA 5IUJC 3DW3X 2R5NA 4ITVA 2BSAA 2FSIA 4LYGA 5C1DA 3OBIA 2BH9A 2FFRA 5CX4A 4JJ4A 4ZU6X 1JXMA 3SXUB 3Q41A 4KMSA 3RROA 5KVVA 5F3WB 4LHXA 5ALPA 1FSSA 1S2LA 1V1RB 4Q9KA 4X7BA 4EHHA 4I8DA 3ECSA 4GL2A 4TTPA 2VJMB 1JG3A 3T1QA 4DKXA 2M6SA 2YZMA 2A14A 4F4CA 3L0SA 3DJFA 3QYPA 4CHTA 4F72A 5CBKA 2AOUA 4IEIA 1EP2B 2Y66A 1ZQ9A 4U7JA 3OE4A 1F38A 5HX7A 1CF9A 3I5UA 3WWCA 3E70C 4URWR 1L5KA 2C4HA 3VMMA 1X2HA 1Y8AA 3GLKA 4UVGA 3KKLA 2VSFA 3OWHA 3EVCA 1YS6A 2I1QA 3KU1A 1IEWA 4GGMX 5FUYA 3BKWA 1Z2NX 2GM9A 1EGVB 1PDWA 1M6VB 5EXEA 4Q3AA 2XNSA 4M54A 1J9ZA 2AOVA 2CMDA 2HEGA 3EUEA 3FJYA 1JYEA 3GHYA 4P3YA 3UC9A 5C4MA 2Y9PB 2EATA 4G09A 4Q16A 3TIFA 2N9UA 1AU9A 3SX2A 5T8KA 4RVOA 1EFVA 5AVQA 3U19A 421PA 1YT5A 3PUWA 4O4HB 4TMVA 3JYOA 5ALQA 1LCIA 1QRDA 3LQ2A 4ML3A 1YK1A 1ADCA 3NM5A 5B2FA 4KIUA 1PG2A 1FDOA 3QLUC 4IGIA 4MA5A 3HCEA 3D0RA 4TLEA 1WVMA 1NXWA 1QGUB 3PITA 1I4WA 1UBNA 3R7LA 3KEMA 2P3SA 5HCUA 3LT4A 1I7LA 2QRNA 5CDTA 2BBSA 4C78A 2XMSA 3JQ7A 1YE3A 5EWMA 5JSQA 2X14A 4IOLA 3L7JA 3TW8B 1CLEA 2HY7A 1IATA 1S7CA 2PH5A 3D5QA 4UDOA 3WLHA 1GM5A 3EZLA 2K4MA 4TV8F 2O8NA 3P0JA 2QX6A 5ERXA 2HZ7A 4A03A 2I8AA 2PSDA 5CIYA 1LK0A 3OPVA 5TQ2A 4FR0A 4PO1A 4MCAA 3AY7A 3SZUA 3LDUA 1UFKA 2GJSA 1E3WA 1QZXA 1U0HC 1YVRA 2DVEA 4P4NA 5HZGA 1HE2A 3LFHA 4BO6A 4LV6A 3KOWA 1ZLYA 2R11A 1FEZA 3IBTA 1FDSA 5DDIP 3EFOA 4YRKA 3A1SA 4XDGA 1TFUA 2C9MA 4IF6A 2I99A 4W9RA 4PBSA 1CUWA 4RYLA 1SOUA 1NX9A 4MNTA 3UOWA 1NBOA 1TIPA 3FF4A 4X60A 2AMLA 3E22B 3GNQA 5H68A 4AZVA 2WJVA 4EJMA 2EKQA 5IJZA 3GLGE 2X5NA 3SSAA 5BMVB 1WCIA 4MDHA 3OCXA 4H15A 2V8BA 2PS1A 3D6JA 3CPHA 4YA6A 3HB9A 3TQRA 2XZOA 3KZ1E 4CMHA 3AP3A 4O4IA 3IKJA 3KT0A 2ZSBA 3ZY5A 3P20A 2WT9A 4I9GA 2RH5A 1EOVA 1C7RA 3B9PA 1OXTA 2AUNA 2IYLD 3N8NA 2VTDA 4GKAA 2GZHA 1QH8B 3OJLA 4BQIA 2A9JA 3CB4A 3FNHA 3HM2A 4L0CA 1R8YA 1S2OA 1ZMTA 3NRBA 4HDAA 5F73A 1MNQA 3ZZ0A 4YV2A 1CQXA 1N92A 1R5JA 3KEOA 2PX5A 3QLTA 2JHCA 4OK5A 5E3IA 1L8XA 3M3PA 3EXEB 1Z2OX 3L6DA 3P9ZA 3CVUA 2FMFA 2UZ0A 1M8KA 4M4SA 2WQ6A 2HIAA 3ML1A 2E5LB 1OWNA 1P5JA 5KC8A 5B12A 2KE5A 2XE6A 4FGSA 3RAPR 3EXFA 3LAWA 5I5EA 3G1WA 2W2MA 2YHIB 1MO4A 1PR4A 5JZSA 2QAGC 4IDQA 4OOEA 4AULA 5L8VA 1J33A 1J06A 3RWMB 4KNWA 1R74A 2H48A 1KWKA 1BKSB 3FCEA 3DZFA 1ODIA 3HB1A 4D6XA 3IAM6 3DKIA 3R0ZA 4OBBA 1O97D 4KQHA 3COZA 4F9TA 1HX7A 3TB6A 2R8EA 4RZQA 4KQ6A 4MJXA 2ID4A 4YCAA 1EWRA 4OQMA 5F76A 2RHSA 1V25A 2DHQA 1N8KA 5IJ9A 4M1KA 2AC2A 5LN1A 1W36B 1OWMA 3F46A 1JR3D 1NL3A 3LP8A 4DCPA 2XB4A 4Q05A 3JQAA 1ZGBA 4ZREA 5BSVA 4NABA 3FCYA 1H8HA 1NI3A 5CDYA 3EFRA 4TZ6A 4L57A 1A97A 1UXJA 4JBYA 2GEFA 4CMKA 2GCOB 5DGXA 3WLTA 3K0CA 4DV0B 1O1YA 1JHRA 4JC4A 4B2YA 1ZIDA 4RORA 1EQ2A 3Q6NA 3VV3A 3ODGA 1QDLB 3CEPB 2D2VA 1LDEA 2CCKA 1EPUA 2QL6A 3C4VA 3NXKA 4B4WA 4B40A 4OP0A 2C04A 5E2AA 3RK0A 1U2GA 2C4WA 2OBNA 1CUJA 3N8KA 1PKEA 4JI1B 4MPDA 3WGLA 2GWRA 5K0JA 2D1QA 4NBTA 4KE7A 2AJTA 3NOQA 4A6PA 5KWEA 1SO8A 1T9AA 3EISA 1ZKDA 4OXRA 2CLIB 2UUCB 3ZEAA 4BUZA 3JQEA 4CCYA 5DMXA 5A71A 4ZCRA 1ZP6A 3GPBA 1Y8ZA 2WAYA 1UP7A 3L2OB 3A9UA 2DR0A 3NWPA 3T95A 1CR6A 4X6XA 4RVHA 2ICAA 1C0PA 4JT8A 1PWZA 1E3SA 3EVNA 3FMGA 4BKPA 4JI8B 1GKUB 3SGLA 3RS8A 3OX4A 2JGDB 1FJXA 1LRLA 4PU0A 5LQSA 3VR0A 4E1BA 4IY1A 2XPCA 3N5KA 1YACA 4A16A 1OYWA 1GU1A 1P4SA 1RAIA 5T4BA 2VQ6A 4C0LA 2IDJA 4XSGA 1HYEA 3RV3A 1KEUA 2C84A 4I2NA 2I3DA 4JITA 3NONA 1FZQA 4I1IA 1I3MA 1JTFA 4YCLA 3K0HA 3N28A 1L5RA 4YI5A 5LYJF 4HLCA 1V95A 4IUCS 2IEYA 1EVKA 1QHHB 4NENB 1VMAA 4J90A 3OEED 3QO8A 2HTFA 2ZB2A 3CLHA 3L8MA 2NM0A 3RAJA 3T3DA 1ZIXA 4J75A 2ATIA 3K92A 4KV9A 5FWDA 2RHMA 3D59A 2EERA 1R37A 1EFKA 2XB8A 5DI9A 3SLGA 2CXUA 4OP3A 3LZDA 3CWZA 5HRAA 3RFCA 5JV5A 1JBEA 3FDJA 3L1HA 2JCVA 4RZUA 1JA9A 4XGQA 3M4NA 4TMTA 5GM2A 4EHBA 1JE0A 3R0VA 2BFOA 4IDNA 3EFEA 3NBXX 3SFVA 1VHJA 2QGZA 4NS1A 4RM2A 3ZXYA 1OYYA 3L1UA 2Q2OA 1ZS9A 1NQVA 2BMWA 4C08A 1OI4A 1PSWA 3HXUA 1ORHA 1TUGA 1B8AA 2HV8A 4QELA 2HW8A 3K3PA 4X65B 1MH1A 4LZJA 3BK2A 2WV7A 4TV8B 2QHUA 1IZ9A 2EGGA 1XSEA 3AT1A 4BLOA 1Z0ZA 1KXJA 4OI0A 4HUQB 1N0WA 1JKIA 4JYMA 1RPZA 1LQTA 3A3NA 2YOGA 1NDUA 4JVOA 2QPOA 4MUGA 3L1IA 2E6KA 4DF3A 3LYHA 5CB0A 4C7OA 4EI9A 1I4DD 1W4AA 1X1QA 2ZVQX 4EKDA 1JR6A 1AZTA 3D1VA 5SYMA 2VATA 1QIHA 3EYWA 1V8BA 4GZ3A 4J49A 3U3XA 3F3MA 1OQAA 3ULKA 3W2TA 1L0WA 3RRYA 2LPMA 2DR2A 3V8KA 5CG2A 3HMQA 2C42A 3NLLA 1JIVA 5G0VA 4AJEA 4DSTA 3FTCA 2XCRB 2OVBA 1COWA 3LECA 4OBWA 3UW1A 5ICGA 3G9ZA 2X22A 4K2HA 1VDMA 1MB9A 4BWGA 3DSRA 5DXAA 3DO8A 4UCXA 1IBLB 1NJSA 1PDOA 3JATA 1NN1A 1P29A 3O1HB 5E6UB 4FB4A 3VM6A 4Q3NA 4P1ZA 5DHFA 2EFDB 3TFOA 2VN8A 1BS2A 1Q0RA 2CYAA 2B2CA 4M37A 3KXKA 5BP7A 1FPMA 1OBVA 4XPIB 3V4OA 4C20A 1YZGA 1JQAA 2ODWA 5A5EA 1MO3A 3DBRB 1YQWA 4YFYA 1KAQA 5HS6A 4DAOA 1T0PA 2GN6A 4ZO4A 3JYQA 5JO9A 2CXPA 2BJVA 2L42A 3O3NB 3TUPA 2PJUA 4OHUA 4XCQA 4Y2HA 2OO5A 4BQSA 1WCWA 2XMPA 4NYMR 3ZD7A 4OB7A 2EFGA 4U7DA 1C30A 1LX7A 1VSBA 2XSZA 1P8JA 1MDFA 3EUFA 2GUGA 2QVBA 4TRRA 2JJYA 3EXIB 5EP2A 2W70A 4F2GA 3WWPA 2XZTA 3OO0A 1G5QA 1LXCA 3IQZA 4FWTA 4A10A 4UU0A 4O1IA 1VJTA 3LO8A 4I4TA 3QWBA 3P2EA 1NHGA 2YY6A 2FPUA 2YWBA 2FWBA 3URMA 1IQPA 1EAYA 1F4PA 4JDPA 2PBZA 5D8DA 1HDGO 4WZBE 4JMLA 4YV1A 2AMFA 4ZVQA 1I4OA 5CXSA 3BE4A 2RGBA 5EQJB 3TLMA 1GPMA 3EOZA 4UATA 1CQJB 1DQZA 4IHQA 3AY0A 2BZ0A 1KPIA 3FYSA 3R77A 5EIHA 5ECGC 1CRQA 2WKRA 1V8DA 3VPSA 5T3UA 1WUKS 6REQA 1E1DA 3A6KA 5AP9A 2ZJOA 4AZWA 4COOA 1QZ3A 1UBSB 4JOBA 2QM3A 3D7SA 4LZOA 3SJZA 4MS3B 2GK4A 3GEGA 1E1RA 1E9DA 3CGGA 3OQIB 3R5TA 4KOEC 1N0IA 3DL0A 3UV3A 1PS0A 2WJ4A 1XWWA 4UHCA 3UAOA 4ACBA 3R3XA 2Q5FA 2QU7A 2A1TR 5E38A 4R7ZA 3OTQA 1V0JA 4C0AC 4EYQA 1IY2A 3P9SA 4W7SA 5IWAB 5FA8A 1DKUA 1FBTA 2HJ9A 3I53A 3AKCA 1U2PA 3KB8A 1IRIA 1N1MA 1Z0DA 2BGRA 3L0BA 3FPLA 1M2NA 3V1YA 3ZWPA 3IP5A 1Z4MA 4GNKA 5G1OA 1KYXA 1O4WA 3V8JA 1OX4A 1Z26A 2ZTHA 1PFKA 3JAWA 5AK5A 4RTKA 2C88A 4RK5A 4BVAA 4DMHA 4EYGA 2PFKA 2PRYA 3LCUA 2CJWA 1T5IA 2R60A 2Y0EA 4S1WA 3P2OA 1DAIA 5JC1A 4I5GA 2JVJA 4Z4IA 1W6RA 2Z3VA 3A6GA 1PT9A 3GC6A 2R79A 3V2UA 4ETNA 1V8FA 2PCLA 1YFKA 1MKYA 1YR8A 3G0GA 1FSGA 5ALJA 1X2GA 1X7WA 2EKLA 1AOXA 3A6FA 3H2GA 3UJ7A 1CJTC 2V5AA 3GGOA 2XWJI 4M9ZA 4MKGA 4MGYR 4MW0A 3SAJA 5FAKA 3DMTC 4EBBA 1EDBA 4IV5A 3RJMA 4ER5A 3ES9A 2NU8B 4BZXA 3I28A 3L77A 2DQZA 1JDUA 5TX7A 3HTXA 4MW1A 4EZBA 3TLKA 1VIAA 2I7VA 4NWIA 1XU7A 1J20A 1UBOS 3FWPA 2J4DA 4WBXC 4BOYA 3NKVA 3JAMA 2P9FA 2NU7A 3NANA 4S2EA 5DBGA 3S1SA 3QF4A 2XD4A 5CH8A 3IP6A 1RDFA 5LYJB 1N2CE 2JLUA 2PMFA 4EABA 4K9KA 4ND7A 4DLTA 1E5QA 1U8EA 1DAGA 1MG5A 3MIIA 2XYGA 3QEKA 4GMGA 5DT2A 4C6RA 3UJ8A 1X1EA 3HNOA 3LOQA 2I5PO 5ALEA 5AVZA 1L7DA 5YASA 2IP4A 4ZCPA 2JLQA 1PRYA 1A27A 2VWQA 3AEZA 4B3XA 1DCFA 2FYKA 3K1AB 1UZMA 2FJPA 1LTQA 3P0HA 2IEGA 4FILA 5B1IA 4UNNA 2OYSA 2WVAA 2FSVC 1CR1A 2J87A 2OZVA 4H0NA 4X6LA 3WBJA 3ZHSA 4CUKA 2QJWA 2XH8A 2IEZA 5IPFA 4NXMB 4G0OA 1G8HA 1KPHA 1SBNE 1T34A 3FH0A 5ANRB 5FWAA 2P7IA 4CF4A 1XBTA 4MJ7A 5DISB 1DPFA 1KL7A 4LDRA 4O02B 3RT9A 4EG7A 2CV0A 3IDSA 4IJKA 1U3WA 4O3FA 2QBYA 4CIDA 1EUCA 2G0TA 1JDTA 2HJWA 1M2EA 2ZBQA 3AX6A 3HCAA 4UTXA 1YAHA 3IODA 5CEEA 1QP0A 1DG3A 1Z0FA 4BEWA 4NL4H 2KMLA 3LXRA 4OLAA 3FCOA 4UVEA 3E7WA 1J8VA 4NJEB 5REQB 3QEJA 2IHVA 1GR0A 5JH7F 4MOWA 5EQTA 1Y6JA 3KVYA 5JVDB 3ZU6A 5AVUA 3DTNA 1PU2A 3Q5GA 3RUDA 3WTBA 4NAHA 3VRHA 3KLOA 5IK2D 1KBZA 3T1TA 1GITA 1X8JA 3UFBA 1L7VC 1E64A 2YV2A 4HFRA 2A9VA 2AK2A 1O6FA 3LUGA 4P08A 4P54A 4HSGA 2P2GA 4MJ3A 4Y9RA 1RCUA 3M81A 4MCHA 4WXHA 5D86A 1R0ZA 3LVRE 3W9SA 2VT7A 3UUFA 2W6ID 4AXBA 1GT6A 2ST1A 3QTCA 1A50B 2PANA 4AY3A 2A5YB 1F4VA 4A4DA 4IVPA 4A8HA 4X8MA 3AGPA 4RULA 1QO0D 3PCOB 2C1ZA 1F3OA 2B4TO 2OXCA 4LDQA 4LOLA 4C0XA 3VU3A 5TSDA 1MT0A 4DEXA 2QPLA 1SMKA 1EUZA 3AFNA 5I4IA 3MAAC 1NSTA 3HBNA 3GZNA 3K8OE 5F7ZA 2XCQA 1YB7A 3BYZA 2WYVA 2PK3A 4E2FA 3GV0A 3N2KA 5EIWA 5AK4A 5LZ9A 3DUFA 3H8VA 3MHPA 1PW7A 2JCBA 5AI5A 3U09A 3KS9A 2AIRA 4DBLE 2B5VA 1YR7A 4DE5A 1JI3A 5HW0A 1NDHA 4R1UA 5C31A 5IX8A 2QMUA 4C6TA 4QQ8A 1ZM2A 4UEOA 5ICCA 4WOCA 1JR2A 3AFHA 1LW7A 1GVHA 3RVOA 3WMEA 3AVXA 3F49S 4LRQA 1S3GA 2G88A 3RTBA 3THSA 4ZI7A 4MV0A 3WAKA 2MSDB 4YS6A 3IEIA 3ZDXB 1C7ZA 3DF7A 1R9GA 1JZTA 2GK3A 3EIQA 2X2OA 3IOEA 4CF7A 3IDAA 3ROMA 4HH1A 1D2GA 1C3OA 1EVZA 4LGCA 3OT1A 5CA1F 4HAOA 1LWNA 2BHTA 3G8DA 3NKLA 1Z18A 2QQFA 3UJBA 3LT0A 3NELA 3GHHA 3EQ9A 4KTVE 1ZEJA 1DOAA 1OLSB 1KI7A 2EWMA 4A73A 3PNPA 1SBQA 2CVOA 2ZPTX 3VHXA 2WHPB 2GZRA 3OZDA 2ANBA 2Q1WA 4UDXX 5C52B 3KFUA 3KFXA 7MDHA 1W8IA 1E2HA 1KGSA 3LI2A 4KL8S 3TTYA 4RZIA 1EBUA 1NKSA 2HWKA 1A2KC 1GTG1 2K5UA 4I6JA 4UUMA 5IULC 4BPBA 2A5DA 3RF7A 3DWEX 4CQMD 4W4TA 1ZGJA 3ETHA 2QVZX 1WDMA 4ZHQA 5BMOA 4QVKA 3ZZ1A 3Q1LA 3NGXA 1FFSA 4CV0A 4F46A 4Z49A 5FL7A 5HUQA 2G1JA 3GA7A 3RSLA 1MQ9A 1LLDA 1VJ5A 4ECEA 3RG2A 4L27A 4MUAA 5EJIA 1TEVA 3CLVA 3KJZA 1S2NA 4M0EA 1TMYA 5D1NA 1U31A 4Q1AA 1P1BA 4DPGA 5A7GA 4POOA 4YACA 5KKAA 3LLMA 3HZHA 1X1SA 1EE1A 3SF8A 1Q12A 2DWCA 4J4BA 1R6TA 8LDHA 3DWIA 4NRDA 4O33A 5DNAA 5IC6A 1ND5A 2E9SA 1KI6B 4G0PA 4ABTA 4Q3EA 1HYBA 1LW6E 1NOJA 1Q6ZA 4OG2A 3N7UA 3P9KA 4FS3A 5ERGB 5FYQA 1XTJA 1PX2A 2XF2A 3L6UA 4J3NA 2DHEA 2IUEA 1ZNXA 2POCA 2VJOA 1M1XB 2HCJB 4IDCA 2JPDA 2IX3A 3I76A 3GJRA 2R4QA 4Q3OA 3P8VA 2HWUA 3A9RA 3WHLA 4XTWA 4D3YA 1S3FA 4ZO9A 4BDTA 1YZTA 4TYQA 2XWQA 1HDOA 2P9YA 4FWIB 5KREA 4OJNA 1G64A 2R25B 3PQEA 2XQJA 2GFIA 2ZIZA 3IHKA 1Y4DE 2UVQA 1U2RA 2ZI3A 4S1VA 1ZO8A 1TIBA 3A1WA 3U81A 4C0QC 2YY7A 4R2IA 2N46A 1VL1A 4M98A 1E7RA 3F6YA 2FVYA 4H7KA 4UHJA 1P72A 4AW9A 1Z74A 3WISA 2RKOA 5DCLA 5IC5A 1UEXC 4DSOA 3DFFA 3KUXA 1F2VA 5T6BA 1JALA 1WUTA 2J9RA 2O0JA 1LJUA 1RJ9A 2HA5A 1K6EA 1MRSA 4N0MA 4BEVA 1KR5A 2GBGA 2AW5A 5KPDA 1FTYA 3JWHA 1OC4A 2O8EB 1U1FA 3DA8A 2GYYA 5LVAA 4B32A 2HBQA 1XJWA 3GDHA 3HB0A 1MX9A 2FPKA 3EG9B 5G02A 1MG0A 2A59A 2IBMA 4HRVA 2VC2B 2DPGA 4NYJQ 4H1WA 4JUAA 5DK6A 3HUUA 2FMUA 3PGKA 2PEYA 4CHGA 1SC4A 2R8OA 1NA5A 4J15A 1QRUA 1NOIA 2GF9A 3H0EA 4JN6B 2XNKA 1TADA 4F5ZA 2ECPA 5ALUA 1P3JA 2X9VA 4G5OA 1OAOC 1ZJ6A 2A9RA 4FT4A 4HLDA 4KPUA 4PICA 3SC3A 4BYMA 1U1EA 1KJIA 2CFSA 2JC3A 3H3JA 2XJ9A 5I7OA 4HX2A 3PPYA 2OCGA 2FZGA 4OHPA 5K0TA 3S44A 5CAEA 1D1TA 3I9MA 3ZI0A 5KX5B 3RS7A 5JH7B 2BKXA 1N77A 1X74A 3W06A 7GPBA 4OBXA 3ZHQA 3CWQA 1PJAA 1OXXK 4IDGA 4ZOQI 2JIDA 2E85A 2IUTA 1EDZA 1Y6ZA 4K9DA 5A5FA 2JJQA 1YUBA 2ZTVA 1V96A 3U56A 3FNRA 1A98A 4K26A 1KNQA 4IW3B 2Q5IA 1PFWA 3BBPA 4I5FA 5I7HA 5BN3A 3UYLA 2EC5A 5IAOA 1REQA 1UOQA 4JI6B 1A04A 2FN7A 2PKQO 3NATA 4FXPA 1BWPA 1Y1TA 3EEQA 5D3KA 2OPHA 1J2EA 3RVDA 3SC2A 1D4OA 3VTFA 1OJ7A 2H4HA 3H19A 4Z8YA 1M5UA 4QICA 2WINI 1G19A 5FF9A 1T43A 1XUOA 1M6HA 3KL2A 4ZDKA 4TYWA 4GI2A 3WTCA 1XQXA 3USZA 1GA6A 1GL7A 2WWRA 4MS4A 2BW0A 3AF3A 4LNUB 1F6WA 1L1FA 2ZCVA 4JP2A 1G0NA 1Q74A 2QDXA 3BULA 1R6BX 2ZBVA 3QFFA 4H4DA 2QRGA 1G3RA 3I04M 3BF8A 5DBIA 3U48A 4DXDA 4L8VA 3HZZA 4Q7KA 4DYHA 4RJ2A 1Z8NA 3L7KA 2CXOA 1TQDA 1Q1QA 4FE7A 3EGWA 3N6RA 4GSYA 3VAAA 3TINA 5BUQA 1E96A 4C05A 1PNVA 1Z15A 5FNVB 5JAOA 2H7VA 4WLVA 3ONEA 4OMCA 2F3QA 2PBLA 4C0SA 3ROPA 2CMKA 3NHBA 3MERA 1NQXA 1UP6A 1M8FA 4N5IX 4F84A 1OBOA 4D26A 3AM4A 1Z37A 2Y6VA 5HF9A 1M67A 2AYYA 3L9XA 1A9XB 1LBEA 5JD4A 1Q0TA 2O59A 2E5FA 4MUHA 5GVRA 4UBNA 2I1WA 4RKEA 2RE8A 2HR1A 3OM8A 4BLVA 4IMIB 5B6IA 1SCNE 1NLFA 2CL7X 5CA1B 3E7DA 4F96A 4ENRA 4JENA 4D9KA 1Z7NA 4IS3A 2PLAA 1PT5A 1ULAA 1YS1X 2NACA 4B3IA 2W43A 4XUGB 1R4NB 4A15A 5DCWA 1UKZA 2NV6A 2VJKA 4C87A 1W5BA 3N8HA 4TWJA 3BE5A 1RQRA 2WY2D 5IT4A 4O2DA 3L84A 3RUCA 1DWUA 4DCVA 1IMJA 1LY1A 2OFOA 5B1SA 3U4QA 2ENUA 2XQGA 2N75A 4MR9B 5SZHB 2DULA 4MQFA 3M5WA 3W5CA 1A1SA 1Y6QA 1ZESA 3PUIA 2ZR0A 1DXOA 2NZUG 4G0MA 4V0SA 3UJAA 4FR2A 1HG0A 3TQTA 2O2XA 1E2MA 1QK4A 3C16C 4G5HA 4NBSA 4I14A 4L2IB 1MAUA 3KRTA 3ZHXA 4B7XA 4DQUA 1XGKA 3T5CA 2HL6A 1E3QA 4V1CB 1PX0A 2CNBA 1QAQA 2WSSD 1A88A 5E1DA 3I9OA 5I5GA 1Q92A 4Q1CA 3EVGA 3W04A 4ZI2A 1HORA 1MRNA 1YRYE 1ZJZA 2PL3A 3B82A 2FWMX 3GJ0A 3KZVA 2D8AA 2O0MA 4NHEA 3RJZA 3AF1A 3VR6A 3ZE2B 2OXFA 5JSFA 4A6XA 1IM5A 4AKGA 3NRJA 1W66A 1OT5A 1TD1A 2CDNA 2R7MA 1II0A 4ZVVA 1FZTA 4CH4A 4MARA 4UAVA 1NF9A 1TMGE 4TXHA 1PZXA 3V9PA 4AZ3A 1NNEA 3CYFA 2FF5A 3FOFC 3U61B 2BP7A 3TIVA 2IPXA 4DR1B 1ZL2A 3OF5A 1PT6A 2C5AA 3LRTA 5SZKB 3H17A 4GKKB 1Y1RA 2OMEA 3VO9A 1DE0A 1U1CA 1UBCA 3GJ3A 1SBYA 1AN0A 4DV2B 5F98A 5L40A 5G0UA 4B9AA 3LC1O 4R68A 5L7YA 5FI3A 2D13A 1NLUA 4GX1A 4MW9A 1TJNA 4PG8A 1IK4A 1GKKA 1AQJA 3KQTA 4E09A 3ZHOA 4DMFA 3MMNA 2OK8A 3OIVA 4MLDA 1W29A 1VGVA 1HBJA 1U8AA 2HTEA 2OYRA 3VR4H 1M6YA 2VSNA 5B4TA 1NQOA 3O03A 1NUQA 1KEPA 1SY7A 3H1EA 1P2GA 2F8TA 3A3YA 1QTNA 2FR8A 1TM2A 4TN5A 5HMMA 1BXRA 2XYHA 5E9AA 2J5BA 1UDRA 2VRBA 3GG9A 4MVYA 3LC0A 3KTAB 1KY3A 4WKNA 2X0FA 2QF7A 1MO2A 3VSEA 4OQQA 4IFIA 5ALFA 3R7DA 4IAOA 1XJCA 2A9QA 4Q4CA 3IEUA 2XTMA 4ZALA 3TBKA 2VHJA 3FKQA 1DQPA 1MC8A 2NYRA 3MINB 3UMSA 5K6RA 3AF5A 3JWEA 1NQWA 1BU5A 1I01A 3D6UA 3WFZA 4BE4A 5CFNA 4Z1OA 4YRFA 2AFRA 3TEJA 3H5WA 1FYDA 1QQ5A 4C6SA 1Y42X 4RH1A 3DEAA 1I13A 1V3TA 2CDAA 2QT9A 3H9UA 4XVQA 4FC6A 3GPIA 3OWXA 4KIJA 4DZRA 3OD1A 4UD2A 3H9QA 2XEXA 3IOBA 4UARA 1L4LA 4ZZIA 3HJUA 4EUFA 1GG2A 2XOKA 4O8CA 1GQ2A 2DUJA 1NLMA 5KYNA 4LWOA 1BW9A 3EZFA 3O8QB 1KO8A 4HRXA 4K9PA 1KOLA 4KR7A 3HL4A 4ZPXA 3OIFA 5EZQA 4BO5A 10MHA 5H59A 4AJPA 1AHNA 4KN9S 5L4SA 1OH6A 4RD0A 1G6HA 1FUIA 1W36C 4WDRA 4FYIA 2YMLA 3KEQA 5K05A 1JFRA 3QSGA 4WINA 3ZIAA 2GSWA 4L87A 1SH7A 1SVKA 2Y6UA 3FOCA 4HOYA 1CE8B 3MTEA 4JT9A 3NRCA 1XEWY 4I36A 3HY3A 4NMWA 4Q19A 1ONNA 4URUR 1U80A 4GI3A 2AFIE 1T8SA 5K3CA 2NU9B 1UAYA 1HE5A 2OKGA 2PL9A 4HRAA 3QXGA 4HBGA 1P5HA 4D4KA 1JLHA 4FUQA 1XVTA 1H66A 1OIVA 2VK2A 1AG9A 1PG5A 3LX6A 3E27A 5IKEA 1JQBA 1JIUA 5HKBA 5AUNB 1FP7A 2GEKA 1Z34A 2B1GA 4YCBA 2WA2A 3RIXA 4RYDA 4AZSA 4IXTA 5K7SA 3S7TA 1QVWA 3ESAA 3ONNA 4RJLA 1XDGA 3WGIA 2SKCA 2H5EA 2RC6A 2O5CA 1TTHA 2ZYVX 2QX8A 4IQGA 2OL4A 4B09A 4BNNA 1T2EA 4M83A 1IRXA 2XVYA 4OHVA 4D46A 1YA8A 3BXZA 1F5SA 4LYHA 3UXYA 3V4VB 3ER9A 4NLLA 4TUYA 3OZRA 3IP1A 4CM3A 5KNDA 3CVOA 3R3HA 5CYOA 3VNVA 2AG5A 3TJZA 3I73A 2XUIA 3OFJA 3VZBA 4CNBA 1C1DA 1J0XO 3K20A 2FP3A 3M3HA 4XGKA 1QRTA 3P0EA 13PKA 5G41A 1RCTE 3WL8A 1JDJA 4Z51A 2CXRA 1JAZA 3TTSA 1NAHA 1KRXA 4R1TA 3ZQ6A 3HSYA 3SMVA 3TJMA 4EDHA 2BD0A 2MSCB 4D6YA 3MW8A 1JHVA 4JC8A 1I1OA 2ZVDA 4P92A 1US8A 3RLIA 2YUTA 3ZLUA 5BV2P 4HVAA 3ELUA 1RPTA 2J59A 1J0BA 2RBKA 2G5GX 4LY3A 1UMBB 3F67A 1WZCA 3D3JA 3HP4A 3KZMA 3ADOA 5DSZA 4OIFA 3RS4A 1DIOB 4OJYA 4CI9A 2Q49A 3O2JA 2FUG1 5D87A 5KSYA 3TRIA 2HSZA 2D3WA 3B6JA 5KNCA 4XD7D 1E2NA 3QE3A 5LP6F 1KERA 1NXQA 3G1ZA 1NFFA 3RHFA 4V0KA 3HCBA 4BWYA 2AKYA 4KR2A 4NCJA 1Z56C 3HQ4O 1U04A 4CH5A 3W4JA 1PZMA 2YNMA 3DL7A 3W4IA 4Q7QA 1JPUA 3N1UA 3HXMA 1W59A 1HE8B 1K08A 1M2GA 2IEAA 4LX0A 4B4UA 5F52A 2JL1A 1LB1B 2D74A 1NXOA 4DMRA 1NR7A 2O2CA 2QDKA 3E1KA 4HX5A 3UYKA 3S99A 1T9GS 3V7WA 1SJ9A 2OHFA 3EW7A 5AVXA 4YRIA 4TLDA 1L7PA 2AN1A 5JJCA 2YFQA 2Z08A 3CKKA 5KVAA 2W2XA 3S28A 4DV1B 4DCOA 4EHAA 3TKYA 4PFJA 4Q82A 2UVPB 4EPWA 1Z5UA 4B3GA 1UWLA 3U7JA 1R7RA 2DG2A 3FFXA 4XI9A 3WLJA 3UGJA 2C58A 3NOXA 1W34A 1TCBA 2ZB3A 1UOOA 4D4MA 3QY0A 2I55A 4MI1A 3WLAA 4F0JA 3G0CA 2CHFA 3BTVA 2RHJA 4ESEA 4R2HA 3KYJB 1H9BA 2NYAA 2YFYA 5EP1A 4KFUA 3WGZA 3ZCSA 2DF8A 3CPEA 3MYRA 5I47A 1WXIA 2H51A 1KSJA 1BROA 1Z4PX 4P5PA 3V8NA 2F43A 4XFKA 4ARCA 5IZCA 2IDZA 4WXPA 2JHFA 4BGVA 5JMWA 1WXDA 2O2IA 3LKBA 5JALA 1ENYA 2CMGA 2Z58A 4NFHA 2XUOA 3E35A 1CJSA 2NXJA 1YS9A 4INPA 3BL5A 2CSUA 2WEKA 3ANTA 2WSIA 2ZUBA 3EA4A 4HDCA 5HQTA 4XD2A 1NSFA 4ZYWA 4BKOA 4M0MA 3GLQA 3PV0A 1KRHA 1V11A 3PBKA 1HXDA 3R0XA 1TW2A 2DTDA 4FFNA 4FN5A 4MVCA 4Q9HA 8AT1A 2R1ZA 4J0HA 4OSOA 4F4UA 2ID8A 4IBOA 1R10A 3R9WA 4EYSA 3R6WA 3WJAA 2Q2VA 1JMKC 3OM9A 5LZ5A 4ZAZA 3UUWA 1MGOA 4QQFA 1ZA1A 1Z88A 1EE2A 4BC0A 1FP1D 2ZGWA 3PI6A 4K6FA 4X61A 4EHIA 2NTJA 3N2EA 2DMRA 2XCOA 2GASA 5ECDA 5AW2A 1XPJA 2FPPB 3TEGA 1KVQA 1G41A 1A9PA 4CS3A 4H18A 2PZ8A 1GV1A 3BEDA 1T4BA 2CVHA 2DERA 2IUSA 4KOAA 4YQFA 2IIVA 1INLA 3VJKA 3T9BA 4C4AA 1JLMA 3KQMA 4YUZA 1GGEA 5EKTA 3LBHA 2VXYA 3P9IA 4BB6A 5DH9A 1XN4A 2FXIA 3ZYZA 3GGCA 3V8MA 4DIOA 1T1RA 3PHIA 1V3UA 4E46A 4OXYA 1ZI9A 2H1FA 4XU0A 4C4RA 1LLCA 1A7AA 1J39A 2C4KA 1T9ZA 2JAHA 3LPMA 4RPLA 2HUNA 3RSFA 1IOVA 4IXDA 4KTTE 3ZWOA 4NZMA 2OLKA 4GRDA 3ER6A 4ITUA 4TWBA 4DIEA 1SKUA 4Z0PA 3SE0A 4MVJH 4JUDX 4KP7A 3LDHA 1YVDA 2PMBA 3K8QA 1IZ8A 4RK0A 4ZT4A 3BGSA 4YAEA 2I87A 3H18A 3MUNA 1VBNA 3BRCA 1M5TA 2DWQA 1W85A 1ORWA 2HCTA 4HH3C 2EEZA 5CDGA 4C7MA 1BFKA 5JZOA 3GGPA 1KEEA 5IW8A 4RFSB 4MHTA 2G70A 2WNIA 3ORHA 1M2FA 5B4VA 4X1KA 3OKFA 5FOXA 4MVJA 3IR5A 1G6Q1 4U8GA 1NBAA 3O8OB 4G4IA 1QHXA 5HGXA 4DFDA 4KH0A 2J41A 1KMHB 4IO0A 2R00C 4NI5A 3EEOA 2YUIA 5AKLA 2WM3A 2Q1UA 5C3MA 1KQOA 2XB6A 1TMOA 3BXHA 4X41A 3VSBA 3FFWA 3WLLA 1QAOA 4JEUA 5CVCA 4JX8A 2PMKA 4MI6A 4BECA 2FQWA 4Q6WA 2CT8A 2ZUCA 5JNUA 5FOVA 2UYOA 2I6XA 3PUZA 4PBTA 3W3ZB 3DAPA 1SFRA 1PL0A 1QVAA 2X77A 4LBYA 5KKCA 1WBBA 2HXYA 2IK8A 1KK3A 1AGPA 1R16A 1WUIS 1O6ZA 2EOAA 4JR0A 1ABBA 4G0ZA 3LPCA 4HDKA 5T67A 3AOEA 3HVUA 1AQIA 1U7PA 3G85A 3U4MA 5I3CA 1LDMA 2R8PA 1EHCA 3CH6A 4KXFB 4N7RA 4U2DA 2BHNA 3VU1A 4MR8A 3P7MA 3F78A 4OP2A 1MB0A 2LIVA 2ZKIA 3CTMA 3UIEA 2JH8A 4J94A 1N2GA 4RX1A 1TM4E 3D9QX 1L5NA 3ZHBA 1P75A 1U8CB 4R8KA 5AYVA 1O08A 4EL0A 1NQTA 4JJ7A 3LQKA 1IU9A 1Y9AA 5SICE 1C4OA 4DQXA 521PA 2DB3A 4LJ8A 1GQFA 2APJA 3JQAD 2VJYA 4K05A 5LP6B 1H8HD 4XB2A 1YRAA 4OL0A 1SCBA 4AMZA 3VSDA 3CF4A 3L02A 1I2MA 1PWEA 1OU0A 5DJ5A 4GQAA 1ZA2A 1RC0A 4LS3A 4MUBA 1YV9A 2J09A 4LDJA 1G4AE 2DHRA 5KI6A 1VLVA 4H7FA 1FUUA 1ZK2A 1GDTA 4J8PA 1W49A 4W5WA 4J9VA 1M9NA 3UXEA 4AWBA 4NCIA 4OHMA 3CRRA 3TXAA 3EQ6A 1Z35A 1YB2A 4FIZA 1MGPA 1VA5A 1ESZA 2GO7A 4O2BF 4EJFA 1XHLA 4X8LA 1SG6A 4OHOA 3AI1A 1GEGA 2OV8A 2PQMA 4HMQA 2ISSD 3MTDA 4MUJA 5HKKA 3EVTA 2XNCA 4D9NA 5JSYA 1C3JA 2BEVA 4BZWA 1G21A 1N8SA 2WJPA 2UVDA 3DM9B 4P93A 3INNA 2WK1A 1ISIA 3LDAA 3LG2A 4RY9A 4TVBA 1UBMS 4TWZA 2ODPA 4PZCA 1NE7A 1Z38A 4CODB 4C29A 1DC3A 4IINA 2HB6A 3V6MA 2HDWA 5DX1A 3NUQA 4GOMD 1GLVA 4OJMX 2EDCA 5CLGA 4ZJYA 2D7JA 3GDWA 3A2NA 1HQCA 1O54A 3F5QA 4TOIA 4CM4B 3W5HA 3OTGA 4JQCA 1UZAA 1DX6A 2ECFA 3Q8WA 4UHKA 2HRBA 5MN5A 4N48A 2P9ZA 1T5TA 3CNHA 4KB5A 3VVMA 4NU8X 5CCBA 5LQNA 4QYSA 1XV5A 4MWBA 3BB1A 5IVIA 3ETCA 4H59A 5BR8B 2DEQA 3KHSA 2A33A 2B9EA 2HMWA 4GOKA 5HJEA 2B98A 4RCYA 2BZSA 4NV0A 1T9KA 3BQMB 1LVUA 3AESB 4B3HA 2XAAA 3U16A 2A92A 4WGFA 5MFZA 1YI8A 1Z8DA 2JDIA 1OVMA 3EZ7A 3JQRA 1B74A 4KBYA 4ZT6A 5DF1A 3S2IA 2D1SA 2QUIA 1N57A 1ZITA 2BCEA 3GW8A 4UHHA 2O8CB 4G1CA 4D98A 1FL9A 3R0JA 2ZRLA 5HF5A 2J85A 2FRDA 3CKMA 2P6OA 2H2GA 3P9RA 3WB0A 2JKZA 3H2YA 1P6UA 1W5FA 1TX4B 2Q1SA 4KPGA 4D92A 1E6MA 3K30A 3B1WA 4DSNA 1DDIA 1F7UA 1KP3A 4YUXA 3J7TA 1VJ0A 3BSWA 1VRWA 2DKNA 3LSSA 2J3DA 2Z8XA 2AN5A 2X9NA 1FUEA 4D9CA 2NVOA 3FB1A 2YYSA 4IIYA 4XM0A 3T5GA 1E1CB 3PLAE 4DOMA 5TMEA 2WHQA 1KOJA 1E2UA 1AK2A 1ZFNA 2G28A 5IBPA 4KRXA 3THRA 3TL2A 3MJCA 3R6GA 3VQXA 1H1DA 5LQRA 4GSLA 3G82C 2GXAA 4A3SA 4GZLA 4NMXB 2FFJA 1R4MB 2C83A 3IA7A 1F8UA 2PIDA 2XVAA 5AHOA 1J1UA 4M60A 5FA6A 1XYYA 4MKRA 3MC1A 4M55A 4B46A 3ZCVA 3SJCA 3VDNB 3HGMA 5IXYA 3VU8A 5AW8A 4EO7A 1M2OA 3VQWA 1YQUA 1T2CA 1ZBDA 2UV8A 3R3VA 1ZJYA 3H1FA 2ZIMA 2BBTA 4LG1A 4BKRA 3HCPA 1VGQA 5A9TA 3UNXA 4Z7QB 1RTKA 5ILQA 2IH5A 1COWD 4BIMA 2EEPA 2QMZA 1EA5A 3L0OA 2ESRA 1XNHA 3PUJA 1SC3A 2QP3A 2ASVA 3ET5A 4EVQA 1TPYA 1ADYA 4NOKA 2QR5A 3GGJA 2CLLB 3QE2A 1EK5A 2FEOA 2GZMA 4OYHA 4EH1A 2P27A 1D2NA 2FWPA 3R75A 4A27A 4J0QA 3E5HA 3ZWMA 2ZE8A 3ZCTA 3PEFA 2PE5A 3ONDA 4V2IA 4KE9A 2JFQA 3I4LA 3PQ6A 1DOHA 1JFFA 2C3OA 1Y8QB 2EXXA 5FJIA 3UB4A 3KZCA 1T6BY 2E1PA 5BSUA 2X4LA 1QBGA 2WFLA 3IVMA 4OU4A 3JD3A 3GJZA 3T34A 2NO0A 4AYWA 3KR2A 1SU6A 3ACCA 3EQ8A 3FVQA 1UF9A 3Q7RA 3HACA 3EGXA 4F45A 1KKUA 1FQOA 2XSZD 1ZVVA 1DCMA 1ZWKA 1WPRA 4G97A 1EDEA 4B34A 3A6EA 3PSAA 1Y3HA 1WQ7A 2MTBA 2NLOA 1X7YA 1TPZA 2CLCX 2HA4A 5K01A 1X9GA 1OFGA 2JIRA 3SI7A 3HRKA 3TUJC 2BKUA 2Z9DA 3T4PA 1BQ4A 4M1OA 2Y76A 3UF0A 1JWBB 4BBPA 1Q57A 1XXLA 3A28A 3ZV7A 1FRZA 2JIZA 2V7WA 4QNNA 3AU9A 3BFMA 4OQLA 1XTKA 4E51A 4HDNA 1B23P 4UEQA 3ELWA 4RQUA 3S5JA 1TI7A 1EVQA 2ERYA 3I9JA 4MRPA 3R7BA 2Q5QA 4WOJA 5GONA 3MELA 1OTYA 4OX9Y 4ZYXA 1D2AA 2Y05A 4DJJA 3CZQA 2CD9A 1FDIA 3GJ8A 2XB2A 1R0BA 1J1IA 2RI6A 2JLYA 1PK8A 1WEKA 2WIBA 1SA0A 1U2ZA 3OSZA 3PF9A 4WLUA 2GTIA 1E1RD 2Z30A 4BRSA 4EW3A 5IKXA 4GMXA 4IX9A 1UQUA 2J9GA 3EIFA 1XL0A 1M0SA 2VDKB 4Q0MA 2H52A 3OQMA 4X64B 2PGLA 2JLAA 3MBKA 4D9IA 4OK3A 1CJKC 2DU5A 4HXGA 4D79A 3PC3A 1ZJJA 2ZWAA 3UKJA 1Q21A 2JANA 4GH5A 3QMVA 4JASB 3W5UA 4DR5B 2CLMB 2HPAA 1MDBA 3L8YA 1C7JA 3RRXA 4WFIA 3RVSA 4D97A 3BORA 3OTWA 1Q44A 4K9OA 1SUFA 4O2BB 3OM1A 3LLUA 3W90A 1Q3HA 2OK7A 1GTRA 1VTKA 4JCCA 2HQSA 1PWHA 4FGUA 3D8NA 3PQ3A 1H0RA 2BR4A 5I9TA 3ZWXA 1TT5A 2M1XA 3DV0B 4FGKA 5JATA 4GLOA 1KI2A 1O6GA 2AB0A 4R83A 4YJ2F 2IYZA 3MNFA 4MWOA 5ADVA 3NETA 2QN8A 1Y1PA 3A1TA 3V4SA 1M75A 1X9IA 3ZCXA 4EHLA 4KWEA 2LGJA 4ID3A 5D3MA 5HR5A 2X58A 4PX3A 1N7JA 4XWWA 4GMFA 821PA 1CFZA 3SEFA 2O8FB 2FW6A 4DZZA 2Z1NA 3QNWA 5AW7A 4PZAA 4ZQBA 3T12A 4G5FA 4DXHA 2O9JA 4X91A 3ADPA 1S4QA 3IMKA 3EA5A 1OV4A 4WJKB 3K0AA 1CG6A 4ISCA 3RV4A 3DXYA 3HEMA 3HR7A 4PPFA 4H3SA 2HQRA 4YP1A 2M1ZA 5A3SA 5PGMA 5JTTA 5CD1A 2ZB7A 4J1QA 1NF2A 4UUPA 1HETA 1XDWA 2QD3A 2YX1A 1CRZA 1ZGGA 4NH0A 4ZQIA 4EHJA 4TS1A 3FSGA 3AY6A 2BPOA 3P5SA 4F8YA 1F2UA 1OLUB 1TM3E 2PZGA 3QU5A 4OATA 4R8SA 4LVCA 2CNOA 1RLJA 4U00A 5KQMA 1M76A 2XDWA 2DQ3A 3K5HA 3B7PA 3LHSA 3SIPA 1MMFB 4RGYA 4FU0A 1GU7A 3M9WA 4CQMB 5GOZA 5IKMA 2QN2A 3V1NA 2FETA 2LR0A 1C9JA 3MPOA 3WQZA 4MINA 4IXNA 2G0NA 2VLBA 3UG6A 1LPOA 5BSTA 2ZWOA 4M0FA 1P0MA 4B3CA 3MGGA 4E13A 1AUPA 3GZTB 4QVIA 3C7AA 4KAAA 2NZWA 4KDFA 3WZLA 2AN4A 1E1YA 3ZDZB 1I2ZA 1G3MA 1ZVMA 3BTOA 3FSEA 4DJFC 3GLGB 2IHZA 3CEJA 5ALLA 3BWCA 3F3KA 3WRYC 3ZHCA 3VX3A 3GCWA 4XOUA 1RJGA 2FQQA 1CTQA 4U6NA 4O5AA 1G55A 5AJVB 3M49A 1YWGO 2ZRGA 1K7YA 4MYCA 1ZU5A 4V0LA 5EE3A 4PTZA 1DRJA 3QPCA 4EF6A 4BWAA 3S0JA 2GRUA 4WZ6A 3UAGA 4DPMA 3RC2A 1JILA 4XU3A 5KOIA 3RYHA 5FWYA 1FP4B 3IT2A 2JBHA 1PN3A 1UKCA 1GGNA 1RXYA 1CUXA 1EP3B 2JI8A 3HDTA 1RKQA 2PX8A 4PVDA 2J31A 4N41A 2NO5A 3TZQA 3JQDA 4H08A 3AM5A 4QIHA 3GUCA 5BUSA 5KSZA 1RRPA 2P1DA 3MAJA 1M8GA 4KRFA 1E1NA 5FX2A 1HKHA 2B6NA 3WQHA 4MPJA 1ACMA 1NIPA 4TSKA 1ZD4A 5BR7A 1X8XA 1H93A 2QUZA 2QJFA 3ED5A 4AJLA 3GN1A 1RQ2A 1B00A 3NVDA 3U4GA 2F9FA 1SD2A 3HCNA 3IIKA 1QIDA 1V3QE 3DE7X 3GUZA 3OUUA 4POAA 1X42A 2R84A 3BXOA 3DVAB 4GBGA 3LU1A 4OHYA 2XV1A 3SY8A 5J4KA 4FYPA 4QECA 3BWXA 1IHXA 2CHVA 2R1UA 1BHSA 1I5EA 3EZ9A 3QY9A 4Z0TA 1Y98A 4AO6A 3REXA 3ETNA 3NIDB 3PR2B 1KQGA 1QYIA 1Q0LA 1ID8A 1TTTA 2C3YA 1BVUA 2QAIA 3THXA 4X62B 4W9MC 4KFCA 1NQ5A 2VJDA 1PD1A 4PWZA 5LLTA 4ISBA 4IUBS 4EUNA 1NUUA 3CMCO 4LRUA 5HBRA 3G23A 4QOEA 4BEBA 4MHSA 4FX2A 1MJGM 1PBTA 3FKJA 1K9SA 1DKMA 2GPWA 4DC1A 2BUAA 5CVJA 2R8RA 1U7ZA 2EDAA 2IXFA 1L8QA 2E49A 5CDFE 5IANA 1QRSA 2XZDA 2O3TA 1SKYE 3DKVA 4ETWA 4ZOEA 2ETVA 3T15A 5JU6A 5FAXA 3RE1A 2P0EA 1NJFA 2FFQA 2LDXA 1H4TA 2DWPA 3DMRA 5TQVA 3LY7A 3GLUA 3HA3A 3JX9A 5JAMA 1YZFA 3ILVA 1YQQA 1TECE 1QCCA 1F6DA 1GIAA 1K63A 1QIIA 3VPAA 3R8FA 2GT1A 4CEHB 4YMTA 3V7NA 4XDHA 5A2GA 4ER6A 1ZW6A 2R0QC 2IOHA 2UXBB 4N9QA 5JZBA 1RAEA 3GARA 3IQFA 1VPTA 4IX1A 3TL3A 3B48A 1RHQA 3I9V1 1H3FA 4H7JA 1KIFA 2D2EA 4RD2A 1HH4A 4RJKA 3I6IA 3QEBZ 4WVFA 5FFMA 3RU9A 2K7ZA 3ZHVA 4GKBA 1YB6A 2BRUC 4HNSA 2CYBA 3S8YA 4WW0A 3BCSA 3CUUA 3DZIA 5FL7D 1YBVA 4KREA 1S1MA 3KM0A 3O3OB 3CQ9A 3B1YA 4MZDA 1Y89A 3V97A 3BB4A 4N5NA 1WZ2A 5T4EA 4JL5A 4ZMBA 3COPA 3HABA 1LH0A 5EJ6A 2ZR7A 2MOKA 1A8SA 2WTEA 3TG8A 1QORA 4HAZA 3C3WA 3IKTA 2CVFA 1J90A 4MA0A 3HJRA 3IAUA 3ROTA 3H1AA 2PMWB 1PD0A 2GESA 3R7FA 4D4IA 3O4FA 3WL4A 1U0TA 3FDZA 5HRUA 1QSGA 3PDHA 4HAIA 4Q3BA 3UFGA 1M2WA 1P2UA 1RU3A 1EAMA 4H2UA 2GS9A 1NKVA 4B5KA 2HFKA 3F3SA 4EECA 1B73A 4CV2A 1TKBA 2GWHA 4WOBA 4DCUA 2CF6A 4D4LA 2MCFA 4M8SA 4OTZA 3QWFA 1UBLS 1C8LA 1DVRA 3HI6A 3LA6A 4MVJE 1MU0A 5EQDA 2G9VA 5K3BA 1Y5NA 3WIVA 4GRAA 1OH7A 1K5HA 1RRFA 2CHGA 3N58A 5E6SA 4BNGA 1BE8A 1WOMA 3CPJB 4I3GA 3AR6A 5FBKA 4CKXA 4QTYA 1L4NA 3QGMA 4HVCA 4V0MA 1X39A 5ALOA 3H1PA 3Q2OA 4KR3A 2VVTA 1U8FO 3RJ5A 1X1AA 2I3BA 5DHPA 5L4LA 3BE6A 1WD7A 2EJVA 3LVBA 4DIKA 4Z53A 1MF7A 2FRXA 3KZKA 4LFCB 4ACAA 3U62A 1X1BA 3X0DA 2NPIA 2GR9A 3ZLVA 4A36A 3Q3EA 5FH9A 2F9MA 4QT0A 4UP9A 3CC8A 1JT9A 4FFSA 1D2RA 2X41A 3AEKA 1E8MA 2D5CA 5FPPA 3O91A 3V1UA 1U3GA 3GEDA 4CWAA 3Q8XB 2GMWA 1Y3BE 2EL9A 3GT7A 1Q0HA 4ARAA 4AT1A 4M9XA 2EBUA 2IYEA 1AQLA 4HPJB 3ZE0B 3VTZA 2JFGA 4G84A 2PXHA 3W78A 4BJ3A 3SF0A 1L5HA 1WEHA 3GH3A 3CRZA 4LF9B 2V3CC 4RKRA 4XEMA 4F6RA 3M6WA 4RD6A 5M5BA 1WCXA 2BGUA 4CFSA 1SCAA 2CD7A 3L7YA 1AO3A 1F12A 1OREA 1EUDB 2HPZA 2OV2A 3ZK9A 4DEVA 4YRMA 5H9WA 3GD7A 4XTXA 2NP6A 1CRLA 3OEHA 1DBRA 1CVRA 3H99A 3MILA 4FOSA 2X5KO 3LY5A 4Q48A 2TMYA 3ZDFA 3UHAA 3RS3A 1BN7A 4WA8A 3RSGA 3PPXA 5ELMA 3HWRA 4DLLA 1GRRA 2PGDA 4RZ2A 2QR2A 4A2CA 1LUAA 1TVEA 3AI7A 4BLPA 2HRCA 1C8KA 4RMFA 2B4AA 3L05A 2BUBA 2E82A 3F9CA 1L1QA 3G2PA 3K0FB 1T36A 3CXRA 2ZITA 3WYNA 4WZAA 4CLRA 4P81A 4WF2A 2GERA 4YJGA 1CUUA 4EP1A 4Y9DA 4ILEA 1JNYA 2GAFA 4W7HA 1S0UA 2F4NA 1WHTA 3ZGZA 2PWPA 5FOWA 4O2AA 1SUIA 4CKWB 3NMUF 2XYQA 4P80A 2Q45A 4Y2JA 4YTEA 2HX1A 2PZFA 5C1IA 3WFJA 4B6GA 4EAAA 1G21E 3GT4A 2AEEA 4Q7LA 3U1VA 1AHIA 3GJ4A 1D7OA 4FXOA 2ZZKA 5EWJB 3V8LA 5AHWA 4A82A 1NZDA 3BXGA 2JFYA 3G5MA 3PZBA 5CDHA 4CQLA 3GRUA 1DJLA 2V7BA 3E9EA 2GBLC 3KJNA 3PG5A 3IVRA 4G65A 4BIIA 3KXDA 1W2HA 1KETA 2YWXA 4BLQA 3HHPA 4LUCA 3IEXA 2ZXUA 4DMGA 4G0XA 2V3VA 4EKEA 2ANCA 4UUAA 2DPHA 4JUCA 4OHZA 2N3ZA 2HCRA 4YT2A 4KVAA 3FHOA 1TM7E 1T1IA 1V41E 2C3UA 3K05A 4I4LA 4NCNA 4PX2A 1AQUA 1EB8A 1ETUA 4OQEA 4QPJC 5IAKA 4RIGA 3S5UA 1JHYA 3UTDA 4F1WA 1U9YA 5C1PA 1VQZA 3G2QA 2FCRA 1AQYA 3TLBA 2BE9A 4ARZB 4BNJA 2QLNA 3DHNA 2J0EA 4HVTA 3I32A 4JI3B 4RLSA 3N59A 3GP3A 2RK6A 3RANA 1TAUA 1CC1S 3A14A 3R5XA 3L8ZA 4LBWA 1QPZA 1TVCA 1O97C 3U7QB 5AVYA 2CUTA 4JK3A 3AF6A 4MEAA 2IYUA 3FNGA 1KMQA 2QW1A 3U1BA 4KFRA 3K0SA 3LCVB 1OH5A 4P0PB 2GCNA 3GJXC 4B8ZA 3GWGA 2D6FA 2D5AA 1EB9A 3KLNA 3EEYA 4E4TA 1PHPA 1PSDA 2V9CA 2DQKA 2GX6A 3B70A 3L7BA 4F06A 1BVHA 3JAKA 3S2FA 4KQMA 3ZGNA 1KWGA 1JI0A 5F35A 4FZJA 4JJIA 1ZRMA 1HKUA 4DHWA 1UEIA 4AK9A 1YA6A 3GEPA 2IIPA 3CZ4A 3KCNA 1I1NA 1W94A 3ILHA 4NU0A 4WIAA 4DIFA 3V32A 1GLNA 4GRIA 4I55A 4O4IF 4DCJA 2ZP1A 3OJFA 2F59A 4N82A 3FCXA 3KQYA 4B2IA 4CT5A 3KSRA 4CEIB 2H07A 1CQIB 4WXMA 4ZAVA 4ZCLA 5A7FA 1VB3A 3B6IA 3VDMA 4BXOB 4CLHA 1P7ZA 3Q7QA 2G40A 1GDHA 3IGFA 3IV6A 2OCPA 2P62A 2XR1A 4FYXA 3HY4A 2JS7A 1AKTA 2XMGA 3GRVA 3LKZA 4GX0A 3HI4A 3R6DA 2RGEA 3VH3A 4DMCA 3LY8A 2IYTA 3VR6D 3AJRA 4GP9A 2AX4A 3NAMA 3TUIC 3LMKA 5K3SA 1NXTA 1KZ1A 1BMQA 1WE2A 1H0HA 5FULA 3QX8A 5JCXA 5I01A 2FW7A 3JTEA 1DBQA 1ORIA 1THGA 4N7MA 4ZU1X 1G20E 2BMEA 4DR2B 4P53A 2QRJA 4GEGA 3SVZA 1O2DA 1VLJA 3D8HA 1EZ4A 3TH5A 1SUAA 5FWNA 4KPEC 1G7CA 4J03A 1VECA 1RQPA 4UDYX 3BGVA 3RSCA 4Y6RA 1FW6A 2BVNA 3ASVA 4XXHA 4ARIA 3HXZA 4OUDB 4WHMA 1IIBA 3JQ9C 3K5IA 4MAMA 4HL6A 4WNAA 5DVZA 1YJBA 3ZWQA 2JFVA 3FYHA 1SQFA 1U9IA 3OJOA 4Y6LA 2WJWA 2WF9A 4I19A 1LKZA 3A37A 1T2AA 3VZPA 2VHZA 2YIJA 4LTNA 1M73E 2O0HA 2W2LA 3MM4A 4BNVA 3ER8A 2HMUA 3U0BA 1XQ9A 3N0XA 1NKTA 5CM9C 1MFPA 1TEZA 1FS5A 3TWOA 2WE8A 4LOHA 4RCVA 3ESDA 4B6FA 1H22A 3GLIE 5FTNA 1ODJA 1RI2A 4CM8A 5JSHA 1B6RA 5FQOA 1JDBB 4ZYVA 1CVLA 3FFAA 3GP5A 4C4PA 2ENWA 1D07A 2F1RA 2MYTA 4EF5A 3B13B 3IUSA 2AHRA 2H85A 1LBHA 3ONFA 5DP1A 4E30A 4FBLA 1FNDA 4N54A 2A84A 5JE8A 1EFPB 3QEMB 4HDSB 1VLHA 2VZ8A 3TVDA 1G1MA 3PZCA 3FPAA 2DKFA 3TEFA 2QNBA 3TN7A 3VSAA 3NTLA 4BV8A 3M6XA 1KNXA 1K4YA 3WKBA 4EYOA 3L6BA 1O6CA 2R7NA 2OZLA 1CR0A 2IODA 1GN9A 4MV6A 1KMNA 1OBHA 4ALKA 2ZSFA 3DFMA 2BFBB 2CV2A 3O5AA 4PLPA 4PLHA 3PNYA 4HQRA 4KQWA 4FE3A 5C37A 2KX7A 3V33A 1FB5A 5JYDA 1YZVA 1CHNA 2NXNA 2XOKD 3LE8A 4TTSA 3SPXA 2H3HA 5AJYA 3ABIA 4ZRNA 4CV3A 2HD4A 4DCMA 1R88A 2YL2A 2AOUB 1YB5A 1E22A 2WZBA 2ZBFA 3NV9A 1XK6A 2PM8A 1P9RA 3G3EA 3M33A 2FZKA 3Q7IA 5CXUA 2C5SA 3JVEA 4BKMA 1N6HA 2IX9A 1Z7MA 1GJRA 4CN8A 2V5UA 4QGSA 4MCJA 5ICEA 2BGTA 3GFGA 5G1NA 3PNMA 3ZIAD 1SHJA 2E4YA 4QOFA 2UYHA 5D01A 5JD5A 1U0NA 1WMDA 2Y68A 2VDWA 1UXOA 1TM1E 4QO7A 4WKGA 5LP6C 4EY3A 2JGLA 1DG1G 3C14C 2ISQA 1NVVR 3CN9A 2M98A 1KY2A 4GKVA 5K8TA 3L43A 3MF2A 4BP8A 4I9NA 3IHWA 1DJNA 1R3DA 1HTTA 1ZZEA 3UW3A 4G0YA 3SHTA 4FFMA 4BLSA 2H1WA 1EFVB 1KIMA 4ER3A 1HL3A 3SBEA 2ZJBA 3TD2A 3FSJX 3KJXA 1USVA 4NBLA 3C3PA 3LQ4A 3OETA 1SELA 1XZBA 2PX2A 4IGFA 3HY1A 1D0IA 1JIJA 1WMFA 2XTNA 3MAGA 3OOSA 4R98A 4XOIA 3EK2A 4RK7A 5EWMB 5T4HA 2R4TA 2D1TA 1YK0A 4TRMA 2IYFA 5DEOA 1E61A 1L7OA 4NCHA 3OSUA 3W4KA 4PG6A 3WWYA 2X1VA 2R86A 3D0QA 5CM8B 4WLNA 2AXNA 4WCDA 5KNDD 2O5EA 2PU5A 1CZKA 3KQSA 4Z6KA 5KYYA 4OX9B 2P9EA 3Q10A 3K5PA 3TZ6A 3L7NA 1O57A 2FZ5A 1ECJA 4LISA 5TQ2B 1R8XA 2JLVA 1G291 4IGEA 4PLWA 1ADGA 1EG2A 4UM9D 1GP2A 3C7TA 1TUBB 1M2VA 3M9XA 3Q7PA 4FMBB 4MKFA 3SYLA 3ZE9A 3N2GB 4WERA 3SSMA 2VBGA 1N8TA 5K5EA 5ECWA 1KZ6A 2EP7A 3A7AA 4HI0E 4LYJA 4K3UA 4DA4A 5CJJA 3EFOB 4H7DA 4F8EA 4ZVPA 1YZYA 3F9IA 5FV7A 1SXJC 1YA4A 3ENVA 4MYUA 5JD3A 3PT9A 3ZU2A 1E8DA 1MAVA 2C2OA 2GFHA 3LC2O 3A6HA 4LE1A 3BRWA 2PQ2A 1EYZA 2J4FA 2GZDA 4KW7A 4DIMA 3KB2A 2EZ4A 4AJ9A 3KAJA 5KNCD 1WCIB 5BNTA 3FNBA 2ON6A 3FTDA 3GRCA 4UMFA 5A3QA 1G5PA 1PJLA 1USYC 1NXSA 2F3UA 4QDKA 4EW1A 3VSCA 1Y9ZA 3LOPA 4O4IB 3WL3A 4NPCA 2YNMD 3QVSA 5HVNA 1GZDA 2AMVA 4NZYA 5F5XA 3GY0A 1JQJC 2BBWA 3G13A 1Y5MA 2AQKA 2BI7A 3V8BA 1T8WA 5LQMA 3H86A 3MD0A 1SCUA 4RY8A 4Y6QA 3WBFA 3WY9A 2NTYC 2O2ZA 3PQ5A 2OY0A 1O95C 2GK7A 4NMLA 3RYIA 5LQDA 1O0CA 2QTGA 1T3SA 3DCIA 2Q7HA 4Y1GA 1TQ8A 2Q1XA 2WYIA 1TOAA 3ISTA 2GLUA 1J0EA 2INGX 1BHO1 2V0CA 3ABQB 4I1RA 4GAEA 4RQAA 4NICA 3AUYA 1PYDA 2NXCA 3FAKA 3HA7A 3L0DA 4QYIA 3PPIA 4BQFA 2YXNA 1M2HA 4M3NA 4X3OA 5IBQA 1MOZA 4I4TF 3EXFB 5LSAA 2B7LA 2J1LA 3CB2A 3VGJA 1SU7A 3CNBA 3W5JA 2ADOA 4HGNA 4PNEA 1ONBA 1U28A 2P2YA 1E9VA 3DFKA 1WDKA 3QKRA 5B37A 1X01A 5I9BA 2VRCA 1A7KA 1YMQA 1OZFA 1FJHA 1ZOOA 4CMGA 5J5CA 2BELA 4IKEA 4FHEA 1KE1A 4CLXA 5C1OA 2BLNA 1RIIA 1DSSG 2BR3A 4E0BA 3V3KA 3WLFA 5ES3A 3U3MA 2HYIC 5MF6A 1CDOA 4DJTA 2MSNA 3V8QA 2R2GA 1JV2B 2RHSB 4L4RA 4DREA 5CFZA 2F3SA 4YAGA 5CURA 5IJ9B 3MWFA 4ZO6A 1X7HA 1IYZA 5JJ5A 1TW3A 4QYWA 5JCJA 4DDMA 3AKEA 3IAAA 3JQAB 5AVRA 4YCCA 2CVPA 3PJRA 3JQBA 2EJTA 1U3FA 3QE4A 3J80A 1MJHA 5J5VA 4MQ5A 3CWCA 4QXMA 1M54A 3CUTA 2J08A 2J6BA 2NO1A 5GAJA 1H2XA 5FA5A 1ECCA 3H2JA 4QJBA 2CKDA 4H0FA 4OGFA 1PJBA 4OXNA 5HEKA 3TZHA 1J5PA 2VDQB 4V1CI 1T25A 3BIJA 4QTXA 3RS5A 3I6MA 3REGA 1X1DA 2EW1A 1GSIA 2F48A 3NJ4A 4G8JA 1ISJA 4NX2A 2W6CX 5GTDA 2JGIA 2GD6A 1OPXA 3KXIA 2H7XA 4KRGA 2P5IA 1XVUA 4OHKA 4A5SA 1K8XB 3U9SA 5ALIA 3I9FA 4RTRA 3NH9A 2PAAA 4RDXA 2OV6A 4KG7A 3TW0A 4CCYB 3ORQA 1A8QA 3OI7A 4MWEA 3WIBA 4MV3A 3FDIA 2PJZA 3FFBA 3QLEA 2IXTA 5BQOA 1YL5A 3FI9A 3OCYA 1EVEA 1J0AA 1GGVA 1Z5ZA 2X23A 1AKYA 2F1IA 3L4SO 4OL9A 3X1WA 3UXMA 4IIVA 3WNBA 2A5FA 2ADMA 5C9ZA 1XRSB 1BO6A 3LHDA 1UDXA 4PHFA 3W6PA 5ES4B 3U5TA 2AXEA 1AV6A 2QSZA 4Z4EA 2X13A 2C8MA 1JDZA 4HGRA 7MHTA 2JFXA 3C48A 5BSRA 3ZS9A 3TIGA 1IVYA 3WNVA 1TZ2A 1MO5A 1SN7A 2R00A 2GF0A 3PCTA 3ITEA 3PC6A 1LPPA 1TUEA 2GEUA 1AMUA 4Q9AA 2QW0X 1UK7A 2QP9X 1NVWQ 2OCXA 1KQNA 4FFVA 5CK4A 2AZMA 4OMDA 2NX2A 2JD0A 2W6OA 4EKNB 4EI7A 4HNVA 4OFWA 4J0KA 4MVJD 3C41J 4FGJA 2AYXA 3G68A 4NEGA 1X13A 2ZI4A 2YZ7A 3AR4A 4FJ1A 4ND4A 4J9UE 1DAFA 1TVKA 2DQ4A 3NG1A 5GADl 3RYCA 4P3NA 1JEJA 3FYUA 3RGWS 3R07A 1XFDA 2A4KA 3T38A 4BVGA 4FR5A 5B58C 1DV1A 4WKPA 1NVVQ 5HQJA 5LA6A 3OEWA 4YALA 2IEIA 3H4TA 1DTSA 2HHAA 2WOJA 3E58A 4DQ2A 1P9LA 1NJ6A 4EVRA 4MX8A 3N76A 4CIAA 2XUPA 2ZLBA 1BE1A 3BWDD 4BZPA 4QOHA 1DELA 2GKGA 1E3EA 2O48X 3B52X 3I9NA 2J6HA 4C7OB 2PGNA 3CSUA 1ZCJA 3RTGA 1WZEA 1KMMA 5ALRA 1PJTA 2DOKA 3W5AA 2RAUA 3EC7A 3A4NA 4EG5A 3IB3A 3B3GA 2FSGA 5B2ZA 1AHHA 3C8DA 4PFQA 3IMEA 4B5LA 4UPEA 1TLLA 5ISMA 4GU5A 3AV0B 2Z2JA 2EYQA 3UA4A 1M72A 5KDDA 4JQYA 3AQIA 4PG5A 3UMRA 3PCRB 2CL5A 4JEMA 3EPLA 4XSHA 1QQTA 2CJXA 4E2WA 1N25A 1JHMA 1PYGA 3K09A 4YCWA 1HMPA 3DDWA 3MVEA 2B8EA 4JB2A 3EWNA 3IPLA 4UM8B 1FJGB 1TK2A 3BEOA 1J8DA 1QE3A 3H8WA 5K0LA 2VQDA 3C6XA 1H5NA 1ZUIA 5I7FA 5IHXA 1XZAA 3NHRA 5IM4A 2DJIA 5NLLA 3RVPA 2C99A 2P6NA 3GEBA 2QUAA 2I29A 1E8NA 5DNYB 2AN9A 1M74A 3ME5A 1WB9A 4G24A 5I6DA 3SVTA 1T5HX 3Q9LA 4LJSA 1C30B 3AKYA 1PIWA 3OO1A 4R8LA 4B6RA 4YQEA 5BSWA 5TLSA