3IKLA

Crystal structure of pol gb delta-i4.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
388
structure length
364
Chain Sequence
SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRGGRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-2, mitochondrial
publication title Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 364
sequence length 388
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3iklA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3iklA02
3HRKA 3NENA 3HY1A 1X55A 2ODRD 1EQRA 2ZCEA 2Q7HA 2P0LA 3A5ZA 1PYSB 1NYRA 2RHSA 3REUA 3L2ZA 4G84A 3RUXA 4P72A 2E5AA 2RHQB 4TVYA 4L87A 4P72C 4YRFA 1USYA 4H02A 3TEGA 4YCUA 1USYC 4CH3A 2ALYB 3E9HA 5ELNA 2IY5B 3A7UA 3P8TA 1L0WA 2ZIMA 4CS2A 4XTVA 4UPAA 4YCWA 4WJ4A 3V7SA 2QHVA 3OD1A 4P71A 3NEMA 2C8MA 1YB3A 3UGQA 4P71C 2ZGWA 2ZINA 1WYDA 1J5WA 2EJGA 3RKWA 1WQ7A 4J15A 4P73A 5C51B 1H4SA 3R07A 4P73C 4TWAA 4CH5A 1PYSA 3HTZA 3RKXA 1BBUA 4YRMA 2E3CA 1NJ8A 2RHQA 2DTOA 4OP0A 2QHSA 2PMFA 4XTWA 4YYEA 4P74A 3MF2A 4P74C 1EVLA 3L1AA 1SETA 2DTHA 1E24A 4CH6A 4YRLA 2Q5HA 3IALA 1H4TA 2RHSB 3FJPA 4E51A 4BWAA 2J3LA 2EWNA 3IKLA 3ERRA 4H2YA 3RKYA 1EFWA 2I4MA 4UP7A 3ICAA 2DKGA 3EFSA 3V8JA 1KOGA 1ADYA 1W66A 4XTYA 4HWSA 1BIAA 4XU2A 4DQ2A 2CGHA 4H2XA 4P75A 4YRKA 4YRTA 4AH6A 4P75C 3PZCA 2DZCA 4TVAB 2EJ9A 1E22A 4RQFA 2ZTGA 3W3SA 2E10A 2ZXFA 4YRNA 4WI1A 1SRYA 4O2DA 4TQFA 3NELA 4CS4A 12ASA 1HTTA 2Q7EA 3HFZA 4Q15A 3HXZA 4UP8A 1QF6A 4KR3A 2DZ9A 1X2HA 2ARTA 4YRSA 2DXUA 4XTUA 2CJ9A 4NCXA 3VBBA 3P8VA 3QO7A 4TTVA 3A7RA 2LW7A 4OLFA 1NYQA 4RMFA 1SERA 4XTXA 2QHTA 4XU3A 4YRIA 3I7FA 4TVAA 3TUPA 1NJ2A 2DU7A 4ZTZB 2E65A 1IL2A 5C53B 2ZZFA 4P3PA 3A7AA 5E3IA 3VQVA 5F5WA 1B76A 2XTIA 3VQXA 2DVEA 4TVWA 3G1ZA 4H2XB 4YRQA 3HY0A 1BBWA 3L4GB 2DJZA 3LSQA 4DPGA 1E1TA 4HVCA 4EX5A 1X2GA 3LSSA 2ARSA 4KQEA 4LNSA 3PCOA 3A31A 5KNNA 2EJFA 2ODRC 2DQ3A 1NJ5A 3RL6A 4XEMA 2AMCA 2AKWA 4H2VA 3HFZB 2J3MA 3HXUA 2DQ0A 3V8LA 1NJ1A 4PG3A 3A32A 1WQWA 3IG2A 1JJCA 3V8KA 2DTIA 4ZTUB 1EVKA 3MEYA 4XTZA 2DEQA 2ZT6A 1G5HA 1EOVA 1B7YB 1B70A 2E41A 4TQDA 3UFGA 2ZR3A 5C52B 3QO8A 1QE0A 4YP0A 4HWTA 3IKMB 4RQEA 2E64A 3L4GA 4XU0A 2I4LA 2EL9A 11ASA 3M4QA 1ASZA 3E9IA 3VQYA 2ZR2A 3WQZA 2I4NA 2CJBA 2ZZEA 3QNEA 1LYLA 2P5IA 3HFVA 1WLEA 4X5OA 3BFMA 2XGTA 5HGQA 4Q6GA 1YGBA 1HXDA 2ZZGA 3HXXA 1KMMA 1BIBA 2ZT5A 1ADJA 4RDXA 1X56A 3MF1A 3UH0A 3RGLA 3NETA 4H2TA 3PCOB 4XEOA 2FYKA 1C0AA 1B7YA 3RIRA 2C7IA 2DDZA 2CJAA 1Z7NA 2AMCB 4WF2A 2AKWB 4H2UA 4YROA 2DU5A 4YPFA 3LC0A 2I4OA 3RF1A 4KR2A 1JJCB 4K87A 1EIYA 1H4QA 3TEHA 3VQWA 4YRCA 2Q7GA 1E1OA 4P3OA 3M4PA 4YREA 1B70B 1B8AA 2ZT8A 2HNIA 2ZNIA 3DSQA 2EAYA 4YRJA 3A5YA 1WU7A 1Z7MA 1KMNA 4CH4A 3QO5A 1X54A 3BJUA 1X01A 4PHCA 2ARUA 3HXWA 5ELOA 2ZT7A 2Q5IA 4YRRA 1WNLA 2PMEA 1WPYA 4K86A 1N9WA 2CIMA 3P8YA 5K1XA 4YRPA 4BW9A 4YCVA 2ALYA 3KFUA 4H2SA 3RACA 1RIQA 2IY5A 2ZNJA 2E1HA 4HWOA 1YFRA 4HWRA 2QHUA 1YFTA 1H4VB 4H2WA 1HC7A 3HXVA 3HXYA 3EFRA 1GGMA 4ZIBA 2ZIOA 1G51A 4K88A 4EO4A 1VQZA 1NNHA 3QTCA 5K1PA 1EIYB 4HA8A 3TEHB 4YRGA 4HWPA 4YDQA 2G4CA 1SESA 4G85A 3REXA 3V7CA 1ASYA 3V7RA 3A74A 2DXTA 3CMQA 4WJ3M 4XU1A 1ATIA 1FYFA 1NJ6A 4CS3A 4UP9A 3HRIA 1YFSA 4P3NA 1V95A 3UGTA 1G5IA
chains in the Genus database with same CATH superfamily
3BWYA 1O94A 5JAQA 3SC6A 3L06A 1FYXA 5E6RA 1TNDA 4CIYA 4M3NA 4QHTA 1O94C 5LA6B 1SUSA 2QRUA 4M54A 1XCJA 4RJ2A 4F97A 2A9JA 5JANA 2FFRA 4TSFA 3RAJA 2IRWA 2QUZA 1AGRA 3IQGX 5HMLA 4O3MA 4HLUA 3ZWBA 3LCJA 3CEJA 3SE7A 4I9FA 5ICSA 1H93A 1UBUS 3FYUA 4MR9A 4MI6A 4C0KA 1N1MA 2OC9A 4HLUC 1GPWB 1E92A 2FSUA 2WAYA 2PLRA 3VC3A 1DAFA 2HRCA 2ZSIA 3FYUC 2FKAA 1FUKA 4QT0A 3W6OA 1R0YA 4BLUA 4URXR 3R4CA 2WK1A 3PUVA 1WUIS 2FDCA 4J1NA 4EL0A 1FRNA 1RIIA 3SIPA 3F6SA 3I61A 1A1VA 1FU7A 1HEYA 4YGXB 2HK7A 4R1PA 1AUQA 5AJZA 2BGNA 2CB0A 3R3HA 4B8YA 2VK8A 1KH1A 3KVYA 3OZGA 1HMPA 3T0FA 2XJ9A 3LUKA 5FUWA 1M7HA 5SICE 2P9BA 3GPDG 1WO8A 3M8KA 4LNUA 2Z9CA 2Z04A 2BLLA 1REQB 4RDIA 2HLHA 2NU7A 3E8XA 4RV5A 3QG5A 2ZIMA 1P2TA 4UHEA 2Q6LA 2QTAA 3AT1A 4WNAB 5LC1A 1ODTC 4J7XA 5EE3A 1DBSA 3V7SA 3KD2A 1L5NA 3AEYA 4DY4A 1PX2A 2XOKA 2G9QA 4G8BA 5KU1A 5TE9A 2ZULA 1N8KA 3Q1LA 4M1MA 3GARA 2Q8PA 2I0FA 1UT8A 5DFAA 3CA8A 2BL4A 3EGVA 4L8LA 1V4VA 3JV7A 2E55A 3ABIA 5IBCA 1S5PA 2QLJA 1JHZA 3NEYA 2MIIA 2YMQA 5K3AA 1E5LA 3COZA 2DETA 3D9QX 4RKFA 1JA9A 2NS6A 1JEQB 4DS3A 4GXNA 3AKZA 1JXOA 4TSKA 3K7EA 4DV3B 2VN8A 4C3OB 3D7MA 5KU7A 3OU6A 5SY6A 3B9QA 5ADUS 1G21A 2N42A 5FNVB 1N5JA 1LS6A 2UYGA 3ITDA 5JPCA 1C8VB 5JNLA 1OQAA 1P9WA 4LE2A 1BBUA 1LZLA 2BGTA 1BXZA 1K8ZB 5D5PA 4LQLA 1D9XA 1K2VN 2P62A 3FYTA 2JGJA 3FBTA 1ZK3A 1F6DA 3VR5D 1CZRA 4IFTA 2IHTA 3CNHA 1X42A 2QN7A 3IIIA 4HGOA 3U7IA 1Z4LA 5TGZA 4RMHA 3DTYA 2IF0A 4PCLA 2IYUA 4DIDA 1Z28A 2JBHA 1ADCA 3BORA 3PBKA 4EJ0A 2CSXA 2XMCA 3F2IA 4DLVA 5JH7B 3WL3A 4JBHA 1QP4A 2GYWA 3A7EA 3VKUA 4MRAA 5AYVA 2GPYA 1G63A 2SECE 4OPMA 4EABA 2WKPA 4GECA 5ICCA 5K0ZA 1DJQA 3Q1KA 2XTZA 3RWOA 4E13A 5BMVF 3U6KA 1R3UA 5KO2A 4MDFA 4B9AA 2G80A 3DHWC 2GM3A 4L28A 2JLXA 2VI5A 3AQ4A 5GOTA 4BZPA 4EFLA 4JU9A 5IDVA 1F7UA 1N5IA 5AOCA 4TMFA 4WXHA 3VVMA 2VBFA 6NULA 4U7WA 4KKXB 5CLLA 3ERRA 5AVOA 4RENA 4FFVA 4P80A 4POAA 2X7XA 3HZZA 3SJUA 1KEUA 3IQEA 1PIWA 3SBOA 4CF5A 2FMIA 4HUQB 5CR9A 2PUVA 2YC4C 4KO1S 4RM2A 3RJTA 4RCZA 1XXLA 3TKLA 3V8JA 1NBAA 3AX6A 4WZBE 3TLAA 4QATA 1G20E 3WLTA 5A2GA 4OY3A 2PGJA 3AM1A 1LF0A 4PYJA 4MVJP 3TKAA 1QBKC 3HEBA 5J23A 3ANNA 4DNQA 1W66A 4DV2B 1KBZA 1XRJA 1EWTA 5KYYB 4KEAA 4MYCA 2QD1A 2HF8A 2HLNA 4FD2A 4KVAA 4ZZIA 3GGSA 2EP7A 3T3PB 1UXJA 2E3JA 3I9LA 5LP6A 4ND3A 3B7PA 2Q5LA 1M2WA 3KAPA 4KCGA 2JLAA 5CP8A 5LP6C 1K5DA 3MWDB 2IYSA 3H9CA 2B99A 3PLRA 1QYVA 2LTAA 4E33A 4QU8A 1P18A 3O1LA 3R76A 1EHYA 3GNQA 3ECSA 4MI9A 1P60A 2DUJA 1T8PA 4AVYA 4PG5A 4F72A 3TMAA 2R2AA 4ZI7F 2ZDGA 3OPYA 5ES3A 3ZTWA 1I6WA 1HK7A 3MLBA 2ZUVA 3QU7A 2AD5A 3GZNB 4P7GA 4OQPA 4AROA 2VUTA 5IBPA 1KJ8A 3IMGA 2VDVE 3ER9A 2QPTA 4G0YA 3PEWA 2QPAA 3S29A 4UBNA 1JDVA 4MKIA 3TBHA 2OCYC 5EJAA 2OCBA 3UWSA 5F7JA 1NOJA 5CH5A 5HE9A 3WGMA 4PNEA 3Q3EA 2V7BA 4HADA 4ARIA 5LQCA 1DCFA 3FCSB 5JZVA 4CKEA 4Q9DA 4I1OA 5DDIP 1UPBA 3CSSA 3HVKA 4UFNA 2JRLA 3KJHA 3MXTA 1H3FA 2NUAB 4XD7D 1E3WA 3GJXC 1DO8A 5DNEA 5C9ZA 1HO3A 4BQIA 4Z4EA 4JAVC 1CR1A 2R8EA 4RORA 3RJMA 5KPDA 1K6XA 1QOZA 1PTJA 3M4NA 1OA0A 2FB9A 1VG0B 2J32A 2G88A 2ARTA 3DQPA 5EXDA 1DV1A 5EWLB 3IPLA 3IURA 4MUNA 1PTJC 2H1HA 4RSRA 1YVEI 2Q8NA 2QN3A 1DTWB 2BBTA 4XTUA 3TKYA 1DXHA 1HOTA 5GIOE 4Q00A 3JD0A 3IELA 1OGJA 3VQTA 1G8PA 5JO0A 5ALEA 5LZ2A 4ZAFA 1TJNA 3DMFA 1YZTA 2I22A 3KSBC 3D0QA 2PWAA 2GXAA 1NN5A 4RHXA 3WP0A 3ZE9A 2I62A 3ABRB 4XTXA 2WKQA 4TWZA 1TK9A 2NQ8A 2XKAA 5B30A 2D6FA 4KFSA 1JEDA 1H2AS 3A1TA 1F0YA 3EDCA 1EFRA 1NYLA 1U1DA 1DKOA 2CLEB 2IDZA 3DDCA 3NQ41 3LOUA 5KSZA 4PCUA 1VKHA 2FWJA 4FU0A 3SPXA 2PUHA 5AJTA 3A7AA 3I5AA 4XVUA 3JRWA 4F6RA 4KNWA 2C97A 3WQHA 1CY4A 2BTOA 5CDHA 1AGXA 3B3AA 4BNNA 4WY5A 2B83A 4CYMA 1BGXT 2YJ3A 3OSUA 4YVFA 3NRCA 3BKXA 4BP8A 4MVJH 1MRZA 3O4GA 3GRUA 4H4CA 1D03A 1JLMA 1KI6B 2IP4A 4G1UC 2XCOA 4TMVA 1PLJA 3BMOB 3CRZA 5IFLA 5JALA 4K9MA 3HEAA 5FCDA 1BBWA 1OF1A 3FWPA 2YHIA 3L4GB 3LSQA 2Q6OA 3H84A 3K9WA 1XRNA 2O8BB 1Q83A 4NVRA 4RF2A 1QE3A 4DIEA 2JDID 3D4BA 4OK5A 1UINA 2XGSA 1U0OC 2QAGA 5C31A 3ZS9A 4C08A 1IB6A 1FDTA 1UBRS 2EBWA 1OLSB 2QAGC 2O1WA 3PCOA 4B46A 4QDTA 3UK0A 4UNSA 1UMCA 1ZISA 3BMQA 3PNSA 4G0PA 3TX2A 4TL6A 4B32A 3RCBA 1ENZA 5LZ7A 1AK1A 1PX0A 2QLBA 1EHCA 4R1SA 4LDPA 4G89A 5AVZA 4ZQFA 4IRMA 2IX3A 3UGJA 3TNJA 1VP9A 3K1AA 1FFXA 2FWNA 4H2VA 3WNQA 1OILA 2FEOA 1RBYA 3OPXA 3UPUA 5DRYA 3KXPA 3PXUA 1VPWA 3E9YA 2LIPA 3TQTA 2H63A 2QSZA 1BRTA 4MVJI 4L7QA 2HIAA 4BUJA 3P4UA 2VLBA 4FYXA 4EHFA 2LP4Y 3NASA 1F2UA 4LFBB 1QS0A 1LTQA 3IAAA 4JBYA 3V8KA 4IHJA 2W9XA 2VP5A 4J75A 3CVXA 1T2CA 3LNTA 2OLEA 2FZ5A 4PVDA 4DCVA 2ALJA 1ULSA 2AEFA 4O2AB 2W93A 4LRTB 1X7XB 1Y8RB 4HCJA 2W8BA 2E41A 1ORVA 2VJBA 3ILYA 4OKNA 2DFNA 2IZ1A 3UC5A 4IIYA 4CDNA 3G5MA 3S81A 3T1TA 4W1SA 2QVXX 3JQFA 5IJ9A 5ALJA 2E1RA 4N7RA 4EI9A 3DA8A 5KVVA 2F00A 3FLMA 3JQFC 1BDIA 2GM4A 1ZUNA 4PAQA 4CKWA 5TR9A 3EEBA 3OVMA 2PUEA 2OB1A 3CGWA 3DB2A 1Q16A 1GZ3A 4J1SA 4OL9A 3UW3A 2R8XA 1WXGA 2WJJA 4HB4A 4TWIA 1Y82A 5EIBC 1IIRA 4RIIA 2WIKA 4KXXA 4YDHB 4MZDA 1G66A 3QXXA 2VSFA 1GHTA 4YCLA 4IZOA 4KWEA 4XSHA 3HEMA 4CCWA 2V45A 2D5AA 1LD3A 4NZOA 1BMDA 2PV0A 1TGYA 4FYPA 1JDSA 5K51A 5CGZA 3K72B 2PJDA 1Z8DA 5CBKA 5K8UA 1YHNA 1FNMA 4XWAA 3HO1A 3E9DA 1H9CA 1X0XA 3WV5A 1OZAA 2ZYTX 2AN3A 2JJ1A 5D8DA 1P2VA 1TO2E 3D2LA 1XV5A 2GBPA 1MH1A 4CG0A 2I3GA 2MMGA 3VR1A 2C61A 3GQVA 4R1UA 4CMCA 4DSOA 3HZHA 4GBGA 1S8NA 1VPDA 4BB0A 3WWDA 1U6JA 1HTWA 2ZIFA 1VIMA 4EHHA 4F84A 5JCZA 4TLDA 5KX5A 4PFJA 4ZVQA 5EIEA 3RC2A 3R5TA 2B9EA 3IHWA 1QCYA 1W5TA 3N1UA 4TKUA 1XELA 4DE5A 1C0AA 2N75A 3C98A 3DNFA 4G1CA 3WQBA 5HOQA 2Z2JA 2Z0MA 3IAUA 4TXHA 3GC6A 3M3DA 3DBRA 2YFYA 3FOEC 5BSMA 3NHUA 3CXRA 1I94B 4YROA 1XXHA 4QSMA 1GPAA 4A1OA 3KXLA 3ZE2B 4D5GA 3RYCA 2V7WA 3FPSA 4MOWA 2GBGA 5CFNA 3DPIA 2R68A 2OYRA 2PNFA 2JGNA 3MT9A 3ORYA 1AZTA 3OZTA 4BO0A 1E0JA 1V8OA 3AHDA 4MPDA 3WA6A 3X1DA 4ALKA 4XM2A 1M2KA 2QD4A 4LV8B 4M89A 3GQBB 5C7IO 3ORRA 3P9SA 4JROA 1VJDA 3PT9A 1BMTA 3LXRA 2JFFA 4E12A 1TU3A 4P3OA 5AKYA 2IV3A 4P83A 5EJ8A 2VKQA 1IY1A 1V1MB 2OHJA 1B70B 1Z07A 2XZDA 1VRCA 1HXHA 4C78A 4LF5B 3VPBA 3L7JA 4FQ8A 2MYPA 2YFKA 3INGA 4KV9A 5EWMB 2RHMA 3CS3A 1EFDN 2A8EA 1CU1A 2XKKA 1UJBA 1YB6A 2BEKA 2ODBA 1E1RD 1VBMA 5K2MA 4FIDA 4ND5A 2GVZC 3SU8A 1FMTA 4BLOA 2EP5A 3PNBA 1XZJA 4BP9A 3S44A 4EH1A 1YAHA 1W88A 3SI7A 1LBTA 1ZG3A 1K9SA 4GI3A 3SNKA 3UG6A 1QVRA 3TZHA 4EP1A 4CH4A 1P4JA 1DQNA 4LY6A 4AUKA 1ULHA 5HKBA 3O47A 4NMWA 2YMLA 1M1NA 3FF1A 4TZ6A 2B8EA 1P1JA 3SP1A 3ECCA 5LB4A 2WKRA 2ST1A 4PLYA 1U5BA 2CBXA 2H07A 2QP4A 3RC8A 1IY8A 3CW8X 2A9RA 1Q7RA 4IGAA 3NKFA 2NT4A 1E0DA 2PMEA 3DFMA 2Z1DA 4BO3A 1UKAA 5C18A 4U3JB 4I9UA 3GJRA 1KHHA 2A5JA 1J33A 2CIMA 1J23A 5G40A 3LPMA 4Q01A 5EZ6B 3GJQA 3Q98A 1ZVVA 2XRMA 4BS9A 1TA4A 1D2GA 2CLSA 3D3JA 3HYNA 4CM1A 3DD1A 4DLBA 1NC1A 5LJIA 3ZI0A 3ABSB 2QN9A 1KMIY 2VWPA 4G1VA 3UOGA 1FX0A 2YZKA 5E6RB 3VOTA 3OP1A 3QYJA 4Y0NA 1S3GA 1E9VA 3EZGA 1R6BX 1FBNA 2Q3MA 2DPYA 3KR1A 4HAOA 1LW6E 4R9NA 3FYSA 1W4BA 3W2IA 3REQA 2C77A 4DLYA 2X2PA 3JVUA 2QHUA 2K6GA 3CEMA 1KOFA 1IG0A 5BSVA 2WSLA 4KH0A 5BWLA 1ZH2A 4MB2A 2OXIA 5GJVC 1PV1A 2L2QA 3U7EB 1AMNA 1OD6A 2VP6A 2RKBA 1U7HA 3AL3A 3QFSA 4I50B 2QYHA 4QJ5A 4DWJA 2B3DA 3AEQA 4AKIA 1YB2A 1WZEA 4JP2A 4QUIA 4ZV7A 3HXOA 4QNRA 3LC2O 1CUGA 3BH7A 1HM5A 2OG2A 3FOWA 1JHRA 1Q15A 1V0JA 2PUDA 3WRYA 2Q4EA 1ZIXA 2ZW9A 1X8LA 3WRYC 3WVNA 4B44A 4K5QA 1OU0A 4ZAGA 3EZ2A 3G1WA 1GSIA 3NBKA 3LTEA 4LNUB 4GI5A 1M6WA 3T7KA 3TEHB 2O3SA 3G2JA 3ZLTA 1MU0A 3EZ9A 2G4CA 4G85A 2IBTA 3PC3A 2F8LA 4QDJA 1OGYA 2HA6A 5DXJA 4EO9A 3EVNA 5DYTA 1NVWQ 4FDTA 1AKRA 4HLQB 1FMCA 4EF6A 4BGDA 1JEOA 4ZVNA 2ODPA 4AG3A 1NAHA 3PHGA 2OBFA 1AQLA 5DPMA 3URMA 4HAIA 3VNRA 2XZOA 5SY9A 4LOKA 3U3KA 2JIQA 4MW2A 5TQ2A 3V32A 1ARZA 2AEEA 2H5LA 3V4VB 5LBUA 1MT0A 4EUEA 4FOSA 1LSSA 1KAGA 1SG0A 3MRSA 2CVPA 4IV0A 1BEUB 1EXMA 4XB1A 5REQA 5TF4A 1SHTX 1U1CA 4LSMA 3AWDA 3GLUA 2X0DA 2M6SA 5BQOA 5HBRA 1FUUA 4YMLA 2BH2A 3VMFA 4X1YA 4YUVA 1X1BA 2BR4A 2A9FA 3E9ZA 4NBUA 5KDLA 3RWBA 2G5TA 2YXBA 1EJ2A 1X74A 3MJ4A 2ZBEA 2H7YA 3FZEA 3WKCA 5IM4A 3R0IA 5T57A 4LNAA 2ARKA 1WPXA 4G25A 1XL1A 1OJ7A 4G84A 2PBFA 1SVLA 1AXRA 1N2CE 2ODEA 4RVNA 3K05A 1VJ0A 5JZ9A 3ONFA 1S3SA 1L7VC 4CHTA 2ZB4A 4L4ZA 3O8CA 3I5MA 4CGYA 2C7GA 2A2ZA 2PG3A 3DFKA 1I6LA 3OBIA 1WCV1 3GA5A 5CJ2A 3SYKA 3ZE1B 3AI2A 3UJNA 5EJFA 5KI6A 4DEYA 3U7GA 1D8AA 2IY5B 1TLLA 4F4FA 4K2AA 2GXUA 4WZAB 3S4YA 3VV2A 3RS5A 2PX0A 4IIJF 4JLKA 2WTXA 2I2AA 4TTAA 1J8QA 2XGJA 5IASA 1CE8B 4AX4A 3QUAA 1VMAA 5KSOA 3PQ3A 2FPGB 3HVIA 4ER7A 5C1BA 3RVMA 2P3LA 3ADDA 3MOSA 2NUTB 1YB3A 1MRNA 1SQSA 2QLFA 5HMMA 4C04A 2Q0HA 1IZ7A 1UH5A 3MTGA 1YQUA 2DHRA 2VG8A 2YV3A 5ULLA 4AAYA 3NUQA 1K8RA 1EA7A 4MO9A 2WMYA 2ZI9A 3MPUA 2MOKA 3EZLA 2DSNA 1FVXA 4C4PA 2BFMA 3A6EA 3B3JA 2WJ6A 1SH7A 4UEQA 1KOJA 1NKSA 5HFNA 4CDRA 3WNVA 4IDGA 1E79A 2VXCA 3ANTA 4M6WA 5IMBA 4ZCQA 4OI4A 5DNWA 2W2NA 3PYXA 4MNTA 1ONPA 3QX9A 4MDHA 1YONA 1E5VA 5HIIA 2RAVA 2QSJA 4GXRA 4D9NA 3NB0A 1DKPA 3S5UA 1B43A 1KP2A 2ACVA 1BXGA 2Z2IA 4N49A 4TYQA 1C0KA 2QHSA 1GAEO 2PMFA 1HETA 3ICWA 4BVAA 3AILA 2P1DA 4QTXA 3SQWA 1ZK2A 2QE7A 3EGDA 3F9RA 3O0TA 4MPJA 1DEOA 1SD2A 2A4MA 3BX1A 5CRIA 5A05A 2I6GA 3T9BA 4HNVA 1DLJA 2F4VB 2PO5A 2V7XA 3WAGA 3HXQA 1R6AA 3PNQA 2Z4SA 3WIVA 3FTDA 1EVLA 3NIWA 5LXTF 5DXFA 3FJ1A 1SETA 1WPQA 2E18A 2H48A 2ZRHA 1NT2A 2WHQA 4F7WA 1SBYA 1EEXB 1FUIA 1KAQA 1SCUA 1WXFA 3OOJA 1A95A 3HN7A 5AI0A 4MS3A 4B2YA 2FGKA 1N0VC 4M55A 5AD1A 2C5HA 5EN4A 3RFUA 2P40A 4JH0A 2C3YA 4CKEB 1N3YA 3GZTB 3FVVA 1IB0A 1OTHA 4LA4A 2Z56A 3HJAA 5K0EA 2ZDQA 4H2YA 2HA5A 4R05A 1KQNA 3D7NA 4J2HA 2ICAA 3QPBA 4PCAA 3KU4A 3NO4A 4YH1A 5G4LA 1EFWA 3WLMA 3KWJA 2MSKA 2FP4A 3DEZA 1I3KA 3V1LA 2BMVA 3QW4B 4W99A 2E4VA 2I3BA 8MHTA 2ZJ2A 1YASA 1GNQA 1JG7A 1Z45A 2CLOB 2BELA 3NDBB 2ZR9A 4LQ4A 4RVGA 4GOOD 4NMLA 3ULKA 1RWKA 4MICA 4TRRA 3ANYB 2WWTA 3K1ZA 1F9EA 1P9OA 3KX2A 1ZITA 3T9EA 2PJUA 3TZ6A 3M3HA 3EUEA 2G9NA 1MT3A 4C7MA 4M1TA 3BIWA 5BQ3A 3DWFA 4U4AA 4P4TA 4R6WA 5EZSA 3K9HA 5DHSA 5CEJA 1JKMA 3U60B 1E6KA 1DFIA 3QY9A 3RTDA 4BEJA 5BSRA 2YJ4A 3RK4A 2ID4A 4MLPA 4G0QA 3RVSA 4BO2A 1ZJ6A 4MGYR 3VNBA 2QD3A 5EIAA 3EGXB 3MTBA 3RAFC 1F5NA 3FJYA 1ICIA 3GDWA 3BICA 4NCJA 4INOA 1UBNA 4MB0A 1M2FA 3IIKA 3KUXA 4LMRA 4KPYA 1D8TA 1NLYA 5F4ZA 3BQMB 3NXSA 5DZSA 3C5VA 1JILA 3QEJA 5CXSA 1M73E 4ZT6A 1J2JA 2YXLA 4R9RA 2G67A 4UVGA 5EMLA 3WZLA 4F9FA 5EZ5A 5B7GA 2EG5A 3SZRA 1E77A 1KGSA 2XHEA 4WECA 3WGNA 4DCNA 5C8YB 5LYJA 1NW3A 1R6UA 4A3SA 2VDWA 4CN9A 3ND8A 1KYWA 5KNCH 4F8EA 3DWIA 4QIHA 2ZWMA 1S9DA 1GRVA 2GFIA 2HJRA 4G23A 1NLUA 1N2OA 2I76A 1G3MA 4L02A 2JFBA 3PD0A 2CUZA 5CFZA 3D4NA 5JJKA 2IC5A 1T1JA 3MT7A 3NV7A 4WE3A 1H2RS 4DLLA 3UJHA 2GCEA 4CVNA 5HUHA 5C1PA 2VUSA 1BC5A 1DO2A 4URHA 3ELBA 1VSVA 2AE1A 5BUCA 1S8AA 4NCXA 3QH4A 2V4MA 4OJMX 3VBBA 1SEVA 3IBYA 3JVDA 4EM6A 5TRTA 4CIVA 4L9SA 4Y9DA 2L69A 3S7TA 3K1AB 2EU8A 1Y80A 4KWHA 5F1OA 4X24A 2GA9A 3K0FA 4TSRA 1TRKA 2ZJ0A 5A2QA 4LJ8A 4OHMA 5CB4F 3WFJA 1DKLA 4X7BA 5LLSA 3NNDA 4XU3A 2WQZA 4J2OA 3PNPA 5TIIA 4XYEA 4HEHA 4LHEA 4JJ7A 3ADCA 1RXVA 2OBMA 2HMVA 3PSAA 3PE4A 4H35A 4K81B 2O3JA 1F2UB 1VMDA 1QS0B 1S7CA 3I6BA 1SZDA 1V5FA 3L0OA 3PCRB 3COSA 4G2NA 4IHJB 4A0HA 2QP9X 4I4TA 1JBEA 3BHIA 3S2UA 1JSRA 1Z5GA 3NM4A 1ZX1A 4HNSA 4HMQA 2PTGA 4NONA 4QA9A 4ZDWA 1Z6AA 2V4UA 1YFLA 4A1FA 2H5EA 4EUSA 1E89A 4IBOA 3S68A 2W8BB 2QRPA 5B3JA 5IKOA 4CTMA 4C22A 4JUIA 2B4YA 3FOBA 1G8FA 4YP5A 4RIEA 3O75A 5IJ9B 5B3JC 2WWXA 2BFEB 3OFKA 3K73O 4PRKA 4E22A 1ZU5A 4YJ2A 1QPBA 4YHHB 3HK2A 2CHVA 3D8HA 1ZUNB 3QNWA 5GY7A 4AZTA 4CKWB 2RD2A 4J9UE 4JENA 3AZPA 4ID3A 4JOBA 4O4LF 3R6TA 1KJIA 3TZQA 4JD5A 3ZDEA 4A16A 1OB5A 2XQFA 4XPIA 4H7HA 4BRZA 4W5NA 3LKDA 1BKSB 4DPGA 1SBCA 3I76A 5ARDA 1KI9A 1YBMA 1V9LA 2O5VA 3QPDA 2PSEA 4NYMR 4BV2A 5JHGB 4D3SA 4EGAA 3FHTA 4OQLA 2OHGA 1M34E 2WG1A 1GPLA 4KQEA 1R27A 5HCIA 3O7MA 1KR2A 2DHDA 3LA6A 3MG9A 3ZXUB 3E22A 5LMUB 5IJXA 2ZYVX 3NBQA 5K5EA 4WCVA 2W2PA 1Q21A 4L5AA 3QHAA 2GEVA 3KZOA 3OQNA 1HEIA 2C2XA 2PX3A 1VJ5A 3VFDA 1E7YA 1IQRA 2PZGA 2W11A 3V8LA 1C3OA 3W78A 5BRNA 5F5NA 3MPOA 1L4YA 3WGGA 1WW3A 1A9SA 3DWEX 3VX3A 4ENUA 5ALIA 3F1LA 4F2WA 3CC8A 2AOUB 2GPNA 5E8JA 4ZAVA 3ROPA 2OVBA 4GDFA 1NW7A 1OU4A 1Q0HA 1E1QD 3ADKA 2A1TR 4V24A 4OLAA 4ZK2A 3RODA 4JWTA 4HSEA 4A0RA 5C7OO 4FVTA 1VIDA 3IBCA 3TEFA 4JI0B 1NDUA 4LVCA 4CLXA 5KOHB 3VVCA 1H65A 3A4NA 4I55F 5DT9A 5HCUA 2XNDA 3LFTA 3OTIA 4J9VA 3V3KA 5JEDA 4ZQIA 1N8NA 4MW5A 3RLIA 3M89A 1NN0A 3KTAA 3PFWO 1XPOA 1XXHB 5JV5A 4F86A 4QQ8A 4X41A 4RZQA 1ONNA 2F59A 1KK1A 1P1FA 1TLTA 2X8JA 2PLFA 4EB6A 1Q1BA 1N6NA 3PDCA 4R2IA 3QNUA 3NDPA 1JHPA 4Y1GA 4NATA 3EH2A 5LP1A 1DCKA 3OCJA 1N33B 1W0CA 2UDPA 5GONA 2RGYA 1RXUA 3TM5A 3WISA 1FYEA 3OJCA 3O8QA 3RSFA 1LYLA 1P2GA 5KCZA 3HFVA 4H7FA 4NBRA 3MILA 4XYLA 4TLEA 1C7QA 2BHTA 5BW8A 3H2IA 1KNQA 2W98A 4XUEA 4EG4A 3HH8A 4K7JA 3QUSA 5IAEA 4OHOA 4PZCA 3W0LB 1YGBA 3CTMA 3PVZA 1P7YA 3TD9A 1T6BY 1EA5A 1FVFA 4GYKA 2BE7A 2HX1A 1RRGA 4M1KA 5E4JA 1KFBB 5JXIA 1KDTA 2ZYDA 3WV4A 1O54A 5H8WA 5FWDA 2GD0A 2GHRA 1DWOA 2W2OA 3OKAA 2D0OB 2GJ4A 2YTZA 2ZIAA 3W5SA 3W7VA 4JXZA 1E61A 1NRWA 3BTSA 3FKJA 2II6A 1EZ1A 3RS4A 3WIEA 4K3VA 1W88B 1S2DA 3FBWA 2JFPA 2Z4TA 5JSQA 1EX1A 5BSWA 2IS2A 4A2PA 4OHFA 3KU1A 3PHLA 2GCOB 3B13B 3P2EA 3GL9A 1M1NB 4KE8A 4NPCA 2Q3DA 4NV0A 4MIYA 1U5BB 1VKRA 2WWGA 3UO8B 3A1WA 4FXOA 4DREA 1JECA 1WSDA 4BN4A 1AM4D 4M9ZA 1XMJA 2XJ4A 1H8EA 2BDEA 4R0NA 1E9DA 3BFXA 3KQSA 4JYCA 1U0EA 3JRNA 3SS9X 4EVRA 3GLFA 5KOIA 2SNIE 1EDDA 1FPMA 2NZ2A 2ZTLA 2IUTA 3DNPA 3LS2A 4RNCA 3VKHA 5KTPA 3CB2A 4DZTA 1JHDA 1TF5A 3ONVA 1U3UA 2AV6A 1UBTS 1X7YA 1U1IA 2WTEA 3FI9A 4RQAA 1GJRA 4P3YA 4XVCA 1FX0B 4FGWA 2XDQA 1J0AA 1E3MA 2WINI 2AXEA 4IWYA 2R1ZA 2XE8A 5F2OA 3MFQA 3TUZC 3C74A 16PKA 2ZBDA 3REQB 2DJIA 3FROA 3JD3A 3FR8A 2IP2A 2AF4C 3LDHA 1CS0B 3P2IA 2VHUA 4KIWA 2DLCX 3DE4X 1J24A 2VQ6A 3AI3A 3WTBA 3GFOA 3G5LA 1LI5A 4RHEA 4QUEA 5DM2A 4TKVA 2ZNIA 2GASA 4QXQA 4LHYA 3AEQB 2FSGA 2MSWA 1Z25A 1FFEA 1EBFA 2W71A 3MD9A 3FPJA 1EG2A 2GK6A 2IZ0A 3JWJA 3LT0A 4RY9A 3PGA1 4UTOA 1SKMA 3LLUA 1RJDA 3TTUA 1R00A 2P4QA 3NR2A 1HQYE 3MTDA 2PXAA 3PEUA 3I09A 4EVIA 3A7DA 3AY6A 1RXSA 4YAUA 1QZZA 2HSGA 3IHTA 2WJWA 2OV3A 2O2CA 1V2HE 3K1JA 1EDEA 2BFBA 2O0MA 3MM4A 4NJOA 5EE9A 1KVUA 4ZFNA 3LC1O 1HWYA 3WDLA 2C7OA 1U0SY 3HM2A 3UK1A 3FCEA 4WZZA 1LPNA 2J3KA 3SEAA 3T3NA 4Y6GB 4B09A 4BNTA 4ZOEA 5E38A 1F17A 1Y1TA 4KYUA 3ONNA 3KJNA 4RMIA 1Z4JA 2FW9A 1IXZA 5AM1A 3UOAB 2ZSHA 5TQ2B 1IOVA 2DBZA 3EGIA 1TKAA 2OZEA 3I92A 4ZOLA 3UXEA 1KU0A 1A96A 2AZTA 1UXHA 3IBGA 5EAIA 5KTOA 1V6SA 1Z83A 4I1VA 4MRPA 1V35A 1H0RA 2PL3A 3F5MA 1RU3A 2BBWA 4AJKA 3NHFA 1E2HA 1LDMA 1JEJA 4U63A 4CEJA 4F4HA 4JJIA 1KPGA 4YFYA 1QV9A 2JD2A 2WHYA 1VHTA 2RB5A 2VK1A 2GKGA 2VTDA 2YNMA 4Q4HA 1ZNQO 4R5MA 4TUYA 5EXPA 4X8HA 2YNMC 3TR6A 1KRHA 1OHHA 2QZ9A 2FWIA 2TMYA 3Q6NA 1VGVA 4M1YA 1QTQA 3DAPA 4DDMA 3K0CA 5IPFA 2B5VA 3DKKA 1ZJ5A 3BGIA 1AS2A 1X94A 3MT0A 3K0CC 5IN5A 4DUPA 1PSDA 3HKCB 3IIMA 4RQBA 4AG5A 1XAGA 3DHEA 3FFXA 4IDPA 4QFMA 4KN6A 3T94A 3N3AC 4DUGD 5JJ5A 2P2DA 3DCJA 2IS1A 4ARSA 2O1SA 1VLMA 4XH9B 2W6MA 5JBQA 1I3LA 4I66A 3IXMA 5LA6F 4Q3OA 3AFNA 4ZAWA 3A1UA 2NX2A 5A3JA 1ZH8A 4Q18A 3ZWVA 2C9DA 1LVUA 2QT9A 1N25A 4MLDA 3DDUA 1IBLB 2FWBA 4HDKB 1IN6A 4YRGA 4R7TA 4EITA 5CDGA 2PT6A 3PK0A 1SESA 3HJRA 2MINA 4PLWA 3V7RA 4XXHA 3QMPA 3G0IA 4PO9A 4G26A 4YIKA 3L7DA 4RELA 1QQ5A 1Q57A 2KWIA 2PKWA 1EWVA 4PC7A 1NFFA 3NHSA 3FHLA 1KI4A 4PHHA 4MYHA 4WH0A 1K7YA 1ZAYA 2PCLA 4BXOA 1B8NA 3HRIA 2W6PA 2ZVQX 4LSGA 2RHTA 4X1KA 5CFPA 1X8KA 2I3DA 3I8OA 1OYYA 3PCXA 3E5RA 1NVGA 4B0OA 2ZYIA 2BHNA 1OVGA 3HC7A 1W1IA 2XUIA 3C6ZA 4Q19A 1BCSA 2DC1A 3IRUA 1JTVA 2BF4A 4IQGA 2XGMA 3KLBA 2ID8A 5K0NA 3ZCSA 2ISQA 1QFMA 1B41A 2Q2WA 3DYBA 1RQXA 1Z4IA 4JUCA 2JAHA 4CQMB 2XMSA 4FHFA 4XWKA 2F55A 1VG9B 4C3ZA 2I2FA 4RF5A 1JDJA 5H68A 4FJ0A 1IULA 4E1BA 2R96A 3HFSA 4JJ4A 3HFJA 1NX9A 1IDOA 1BXGB 1KK0A 2D7JA 3HUEA 4XAQA 5EL0A 1C4OA 3H0CA 2J59A 3UT0A 3WDMA 1USYA 4MUHA 3RYTC 5F9FA 4B45A 1G0OA 2O2XA 1B1CA 2I4RA 2WILA 2C31A 1USYC 1QIDA 2RI0A 3M4YA 3C6BA 4JGIA 3MWKA 1YOBA 3A6LA 4G0VA 3PFBA 4EF5A 4LY3A 4EG3A 1NONA 1ORHA 4MVYA 1TQ4A 1CV2A 3G8DA 1PDWA 1RQRA 3UYLA 1BE6A 1DKQA 1EVJA 1P4SA 5K0FA 2ZJOA 3UUGA 3QSGA 2XZPA 2ZRMA 4D4KA 1OTXA 3BM5A 3ND6A 4A8JA 1BDMA 4G1FA 2A5YB 2B4QA 3I2KA 4I08A 4A8JC 4HVTA 4MS3B 3T7JA 1EE2A 1T4BA 3TLGA 4WW0A 1NR1A 4C0SA 1RAFA 2ABWA 3LQKA 3VV3A 2W43A 4L0MA 1W48A 5JJCA 3CO5A 2ZINA 1LLQA 3STHA 2RI1A 1PL7A 3B5EA 4JSYA 5I3CA 2V5VA 1YGYA 3F1KA 5ALYA 4UHCA 5JH7F 3GT0A 4QVKA 2FP4B 4NOMA 5AIBA 2C5FA 4D3DA 4JBXA 5DHFA 1H1LB 2FJPA 2ORVA 2DQYA 4DMMA 2GEJA 3O9MA 3MMSA 4Q7LA 1YH3A 2PKQP 3RKXA 2YVUA 2FWMX 3UFXA 1XKQA 5FWYB 4PE5B 3H75A 3U0BA 1GTRA 4G0XA 3EFEA 5B55A 1PG2A 1YJ8A 1CF9A 1IZ9A 1SURA 2M1ZA 3JQEA 5CK4A 3TR5A 2W7TA 3SBEA 3WE7A 5PNTA 4MS1A 4UU0A 2FMFA 4Y6OA 2CFRA 3VPFA 2Z1NA 2Z6UA 2DP4E 1BX3A 1ES9A 1UZUA 4Q5IA 1FSFA 2FPUA 5LSAA 4L9AA 4P74A 3L7OA 3N7AA 3V1NA 2YKGA 3C15C 3A2KA 4P74C 3PGKA 2IL1A 4Q4LA 3EPPA 3UCXA 5KHAA 1GDTA 1DUIA 1GKLA 3FN4A 2NUPA 3EQ8A 1GRRA 1J49A 3A6KA 1RYBA 2CFTA 1B2RA 5FBHA 3EVCA 4C4ZA 1RHKA 3GUHA 3GFQA 4XCQA 4P0QB 1JFVA 5LKRA 2RHSB 5AQ1A 5G1OA 3T38A 2OHVA 3HWSA 3T15A 3T5CA 2AG0A 1SB9A 3EXAA 2C4UA 1YI1A 3K9BA 4IHQA 4U2CA 3UB3A 1I2DA 3S8EA 5JVDA 4KTTE 4YY3B 5SZJA 1A7UA 2HDWA 3OHMA 4YWJA 4YK7A 3SKXA 1U0BB 1U0JA 1XVVA 1NVMB 1ZGBA 2YV1A 4FFLA 1TMYA 1XKLA 3CZMA 2C8JA 3K8ZA 2ZXUA 1A0OA 1TMOA 4Q1EA 3B70A 4EFDA 3CVVA 2HFJA 2QQ5A 4HRAA 4L4SA 4ZA2A 4B79A 2CJFA 2J6BA 3QVTA 4KQ9A 1ESDA 3EXIA 4RTQA 1P8JA 5EOVA 3OQOA 1P1KA 4G6ZA 5CPFA 4B4VA 1S2LA 2PL1A 2ZRDA 3P2KA 5I9NA 1ZXXA 3NGXA 3W2FA 2RCYA 3AGPA 1O08A 4JP8A 2BKVA 4J7AA 4FOTA 4P9NA 2CXXA 4BUZA 4OEHA 4EBBA 3RH0A 1BS2A 1WZNA 1A82A 1TTQB 2FEWB 1P2SA 2QQ0A 3LQRA 4QXMA 1KZ6A 5T3UA 1PLKA 2IXFA 4S24A 4JX8A 1C41A 3BGSA 5ERYA 4YRKA 5LM3A 2ZJFA 4Q3EA 1A3CA 1SNYA 2H29A 4N0DA 2JEZA 4AH6A 3LE8A 3NHBA 3JTEA 4N6GA 2NO0A 4CLDA 3Q8MA 1XK7A 4JBWA 4Z0TA 1K7XB 4MUYA 1JJIA 1GDHA 1ZNYA 4UVIA 3ZY4A 2B4TO 1JG6A 4BFSA 1ZIOA 4MGKR 2FYTA 2YHBA 1AB5A 5EA2A 5MF6A 3IMEA 1KXZA 1C14A 3ZDXB 3DMTA 4EKEA 3M0EA 4KRYA 3SYNA 2C3PA 1X2BA 3B82A 1GARA 1CNEA 1MOQA 1TVEA 3DMTC 3NUGA 3UHAA 1XNJA 1U7WA 2P90A 4LGYA 1I7QB 3TSWA 5CFRA 1R16A 2RE8A 4NV1A 3WWOA 2VT3A 3TR0A 4BB9A 1FSGA 4HNAA 2VTBA 3VR5A 1XQ1A 4M8SA 4DSAA 1JQLB 2E6UX 3ZDZB 2H2GA 4FC6A 4AJNA 5IVIA 1U28A 4XPIB 1IZZA 2QI9C 3OZIA 3AR6A 2VDRB 3COPA 2OAQ1 3KB6A 4WLVA 1X2HA 1U28C 3PPYA 1NXWA 3KFXA 4FEYA 1UODA 3OIDA 3OOSA 3G0HA 2GUGA 4LZWA 3FWHA 5CHEA 4EYGA 3DAYA 1J56A 2XMQA 3I9KA 2I2DA 4CM4B 3C6YA 4Z1MD 1KKUA 3E22B 3FB1A 2PIDA 4HV4A 1IBRA 4OXIA 3F3MA 4O59O 3OE1A 4BWGA 4LQCA 2HGZA 3EZNA 4D57A 2P11A 3LSYA 2RKOA 3Q9LA 1C3OB 4NBKA 3V3TA 4YRIA 3KEMA 4KQKA 2QSUA 1BYIA 2WQ7A 1UPAA 2EFYA 1V1RB 5DV9A 2D1TA 3UMYA 2CNOA 2GBFA 2IU4A 2JLQA 2XUZA 4HVAA 4RAOA 3VAAA 1CR2A 1R1DA 5KSYA 3IUBA 4L22A 3HR8A 3KSAC 3R4VA 1C9KA 2GEUA 3BXZA 3WZ2A 1LK0A 3EPHA 2QN1A 1OLXA 2ZLBA 4IDNA 2XCIA 3KYDB 1EUZA 4B7UA 1U4SA 3GXBA 3QVGA 4EI7A 4UTNA 5K1ZA 3FHJA 3C1AA 3EQ9A 3MAGA 3ZQ4A 4DQ0A 1CY0A 1B8OA 4TWJA 4DAEA 1R8JA 4RJIA 1M6VA 2P27A 3KTAB 3TW8A 4UCFA 3QW2A 4D8WA 1PGJA 5PGMA 1J90A 1PGQA 2I3ZA 1N8SA 2F1IA 3A6DA 3L8YA 1H2HA 5KNLA 3UKJA 2DJZA 3WGKA 4C0WA 1IM5A 3AMVA 4FYKA 1QP8A 2ONZA 4X90A 2X8JB 3HS3A 1YT5A 1LJLA 4CW7A 4EB6B 4HT4A 2Q46A 1MRSA 5KWSA 4N5HX 3QWHA 1E1TA 4ONEA 1QIKA 1UC4B 3CF0A 1QYCA 3OSZA 1J39A 4B3IA 2CLLB 4O2AF 5JZBA 1P4AA 2JGRA 3O8QB 1JWBB 1Z2EA 4XD2A 2Z57A 3Q3CA 1LDNA 1NLFA 4UM8B 2OCDA 1NV9A 2RKWA 3KZMA 4KVGA 1IH8A 5HQTA 4QEKA 3R75A 2EIHA 5HZKA 3ZJVA 5JAOA 2C84A 3LBNA 4PSCA 1I2MA 3HFZB 1QYWA 5HFAA 1R0XA 3DEYX 4A6XA 1XAIA 2WIAA 4NBVA 3IFSA 2XNCA 4GMXA 2H4FA 5A3RA 4LOIA 3KXKA 4KODA 1MJFA 5EKTA 3TTWA 1YZNA 3G1TA 4V0OA 3A3OA 3ZCUA 1NQVA 2WHEA 4XD7A 1TE2A 3K9CA 1CUHA 4OG2A 1BGWA 1G7SA 1JSLA 2ZQYA 3DDOA 2DTIA 2IY7A 1WVIA 3RANA 3I37X 4MV0A 3HDHA 6YASA 2I66A 5D3MB 4Y7DA 1XU9A 1B0ZA 2MMCA 3IQWA 3CNLA 1RPJA 1IIBA 3DT9A 1QHNA 4LDNA 5DULA 2NAPA 4BYMA 1J5XA 2J9GA 3KSMA 4UU1A 1ODFA 1CUUA 2J9YB 3LUDA 5JARA 4JYBA 4TWBA 2I33A 3N28A 1Z2DA 1SOVA 2DKNA 2V9PA 3R7FA 4LYYA 4L0DA 3UFBA 1ZK1A 1PGPA 2COKA 1IUPA 4IUYA 4H7KA 4KXYA 3PGJA 4L5BA 1N6HA 4TQ9A 2BI4A 3I8SA 5B1DA 4DG8A 3GLFB 1OAAA 4XR4A 3NT5A 1ZM7A 4TM8A 3N2IA 4DJTA 4DMFA 4EY8A 5IK2D 1BDHA 2I4LA 1IN4A 3KKOA 4LRXA 1JHMA 3QBJA 1ASZA 1SXPA 2IEZA 2CXRA 4DPMA 4KLZA 3F5FA 4YIHA 1GFIA 4UHKA 3BE5A 4C5CA 2CJBA 2ZSBA 1MAVA 2Q50A 1Z08A 4CV0A 3JQGB 4PRLA 5ICGA 3IP3A 2G5GX 2FW8A 3AIMA 3QI7A 3DEAA 5SYNA 3GHYA 1UOEA 3CVYA 1ZHOA 3DFUA 1VA4A 3ON5A 4I1RA 3OF2A 2C57A 2EZUA 2PD6A 3IPCA 4N3CA 5MFPA 3RR2A 3RC3A 1QRUA 3NHAA 3UV7A 1JALA 1CUFA 1T9HA 2E5FA 2H65A 1KMMA 2I6QA 1JIJA 1WPRA 3GCGA 3OEHD 1VE6A 1JA0A 1K86A 1A04A 4IFBA 3TDMA 4ATNA 4FDLA 1J1IA 4D9KA 3FFTA 4H7IA 5BN4A 3U56A 1WR8A 1RM5A 3VYVA 3QNMA 2IV2X 5JECA 2HPAA 3BD6A 2ZUCA 2PMCA 4MWGA 2HDNB 1XLTA 2QY9A 2H1FA 2OFPA 1CR6A 3QKUA 2AEJA 2IYTA 1XLTC 3GN1A 3R5XA 4HAUA 3ENVA 2RJOA 1N7IA 3V9PA 1VYUA 1LBSA 5FPHA 3T41A 2HH9A 3LOPA 5CB8A 1EFUA 4TX1A 3ZWNA 3DEIA 4KO4S 1IVYA 5FX2A 2DDZA 3KCNA 2CJAA 4CT5A 4IZHA 4HZIA 4TYPA 4UBMA 3DZBA 2QJFA 3AETA 4UBJA 3LBHA 1JQ3A 4Y9SA 2VQFB 3C16C 3CX6A 3OZDA 4E4TA 5JXGA 2B1RA 3RS9A 1YDWA 2ZUBA 1H22A 4HKTA 4FEAA 4M1EA 1ST2A 2DOKA 1KVRA 2P68A 5GVSA 2PZBA 3Q2OA 2V96A 1V37A 1WPGA 2UVPA 2VOEA 1T3ZA 1AZSC 2C2GA 3HB9A 3GVHA 2AOWA 3DC2A 3QVKA 3HO8A 5JISA 2OTCA 2FXIA 2QROA 3DLCA 4GVPA 1F3LA 4YRCA 1OW3B 3R3WA 3LY8A 4O2RA 4Q4HB 2A0YA 3IAHA 1CHDA 2JHFA 4BZWA 1YE5A 1FP7A 2FSIA 2GVDC 3E7XA 3FGOA 5JOQA 3IE1A 1Z63A 2F64A 3HPRA 1J8FA 1SN7A 1B6RA 4MWCA 3K4HA 4BVLA 3FAKA 5A4DA 2HNIA 1QIMA 3AC0A 1HLFA 2G3YA 2JS7A 4MV9A 3ACBA 2WIFA 3Q5GA 2ZSJA 4J1TA 1WAMA 1BN6A 2W4QA 3IO5A 3OQHA 2QEQA 4J1TC 4P3KA 1VLZA 4L3OA 2KE5A 2EWVA 4H1HA 1JEEA 3MD0A 3CLUD 5GWXA 4PINA 3WHKA 5IYZB 2PXHA 3QF4A 4KXMA 1Z0AA 1YQXA 2CN1A 2Y6VA 3P32A 3CSDA 5DYGA 1UJ5A 4Y1EA 3ID6C 3BE6A 2JGEA 3KCQA 2DG2A 4LV6A 1HLGA 1UWKA 4D4LA 1NMQA 1Z22A 4FHCA 1TT5B 1Z12A 1UZNA 2Y0CA 1TQ6A 4GC9A 1FYDA 3K96A 4G0UA 1OWLA 2EEPA 2ON6A 3N2EA 4LSWA 4RPHA 5EUQB 5H16A 4LFCB 1HT2E 3UCFA 4GMDA 4MGIR 5KTNA 4GXTA 4YWHA 4RPKA 2BC9A 3ETNA 5AW6A 5P8WA 1RRVA 4BXOB 4BO5A 4QOIA 1I36A 3DDNA 3F47A 3DSRA 2IYQA 1E9RA 1VECA 4Z99A 1RI1A 3R5SA 1OXVA 4W7IA 4DA0A 1CP2A 2YZGA 1LRLA 3NAGA 3V8EA 2WBLC 4I1PA 2ERYA 3IAFA 1QGED 2E4XA 1RIQA 4D3FA 1FRZA 1SXJA 1H2FA 4MDYA 4WXPA 1M83A 1BCSB 7YASA 1K88A 3BWXA 1SXJC 2JF0A 3U9LA 4EBFA 4QO7A 5KPJA 5EHIA 4N3AA 1KJYA 2H3HA 4TS4A 3VR6D 1Z7BA 5KCMA 3ZWAA 4RD3A 3RBXA 3PZRA 2ZI5A 2H54A 3DNMA 4Z4QA 1NXOA 2VP3A 5ECDA 2D2FA 3TEMA 4C07A 3KUDA 1JG4A 2QXUA 1FFAA 5F2EA 1W2WB 1ZD9A 3FXAA 3PE6A 4HD8A 4X71A 4YB8A 4BGUA 5H3HA 1FFHA 1RWOA 5A9RA 3GP8A 3TAHA 1X9IA 3A6GA 2PY6A 3O92A 1CF2O 2GTHA 2C2KA 1BVUA 4YJGA 1CERA 1YS1X 4ZU3A 2WKSA 5IM5A 3CZRA 4YA6A 3U7QA 4CI9A 2NMVA 2COUA 2XTMA 1VBKA 3N58A 3GAMA 2C4VA 2XR1A 3NS7A 2QZ4A 3Q5DA 4J4TA 5LQAA 2ZJ5A 3QE3A 3X0DA 1ASYA 2FVYA 2NWQA 4ZVKA 4UU7A 5JLJA 2Y1LA 3PI6A 2EQAA 1E9SA 3TLGB 4BPRA 4FK8A 4CU5A 1GN8A 3WL6A 4BNJA 2SHKA 3CBQA 3U7HB 4FINA 4LF8B 2H85A 1LC3A 4W1PA 1VMKA 5FA8A 3RYIA 4D96A 5HF8A 3A4YA 3JQPA 2J5XA 3PT5A 1KJQA 4QO8A 3C6QA 3BXHA 2RH5A 3K20A 4I1IA 3QEKA 4WJKB 5EIXA 3EDOA 4GHWA 1Y7HA 4B5KA 3LP6A 2Y1FA 3ZJ5A 5IVHA 1AQYA 3QV2A 1FJGB 2WE8A 3HY1A 2TECE 3ASUA 3DR5A 1KTIA 2ODRD 1WDWB 4GLLA 2ILVA 4LZJA 4DG9A 2R4TA 4FGKA 3M4JA 2Q7OE 4JSTA 3T61A 1QG6A 1Z4QA 4CFYA 4K0RA 2ZM5A 2FLVA 2IGBA 3UFXB 1XIVA 4GNRA 3REUA 4LOLA 4DHEA 5THQA 221PA 4DARA 3CRW1 1A8HA 5DWQA 4DDVA 4DV4B 1T5IA 1X7DA 3FIJA 4CKCB 2GPJA 5A0VA 2FN9A 4YJ3B 5JYDA 4CETA 1G21E 2X1HA 3VO9A 5BN5A 1ZVJA 3VAZA 1N7GA 1JLLA 2C3UA 2GWRA 3EVTA 1SGWA 3FNHA 3VH1A 2WU4A 3LWZA 3HYCA 3JVIA 2A1UA 3ILHA 2ATCA 3OFJA 1UBMS 2DF8A 3CX8A 3Q8XB 1GDDA 4UQPA 4XQGA 2NUPB 5EINA 5LUAA 4RAQA 2VF7A 4M1SA 4YMVA 1I5EA 2FOLA 2JGDA 3HLKA 3VPGA 2XE6A 4DKJA 2X41A 2EP8A 5LP6F 4WJ4A 4K6FA 3BHJA 4MQ6A 4HXEB 4JVLA 3EVBA 4HYYA 5I4KA 5CYPA 5JVDB 5H80A 3MINB 4D3XA 4DIFA 5AM0A 2D1RA 2H4HA 4RABA 2W8ZA 5BP7A 2UKDA 1A9PA 1CEXA 1MFPA 2R7AA 3B12A 1FLNA 2J33A 2VJKA 2W2MA 2YRWA 3WYFA 4DIBA 4DIOA 1CR4A 1IBMB 3UJCA 3WLPA 3LLSA 1KPIA 3TEJA 1FZTA 1GT6A 2HJSA 3RTCA 3BQNB 2HY7A 3U48A 3B7WA 1DZIA 1XZGA 4JP1A 4AMVA 3U9TA 3V4OA 2MWMA 4DVJA 2FX2A 3F8SA 1ESZA 4HQOA 3RVJA 1IAVA 3UBMA 4PRYA 1GZ7A 5TNXA 4BCBA 4TGLA 2H2HA 2WR8A 1KS2A 2EARA 2O7NA 4GM4A 3BH6A 5HKAA 5BSHA 3BD7A 1BOFA 5HUQA 1T6YA 4IIVA 2TMDA 4MS4A 5BWOA 4M36A 1FP2A 3JYNA 1I2AA 3O95A 5DBHX 3IDQA 3H2JA 3LQ1A 4FMDF 4DXHA 5EPOA 1ZD2P 2AQKA 4DNFA 5KTRA 4D5EA 1KFEB 2RJNA 4L08A 3I2YX 3RUHA 3B1WA 2O54A 1L1EA 1X7ZA 1JSCA 4AP5A 4KJZA 1K3UB 5BSTA 3HG7A 2VPQA 2WW8A 1C8BA 2PGIA 2RGAA 3D8TA 3PX3A 4XUDA 4CMEA 1JG2A 1JR6A 2XDYA 4EI2A 2AX3A 1GTZA 1B7GO 1XMVA 2XQGA 4UAGA 1GFSA 2UXCB 1I4DD 3G49A 1X7HA 5EP2A 1XVLA 1F8YA 4KXUA 1QGDA 3VO2A 4C0QC 4JNCA 3GH1A 4C6TA 3UMMA 1ZOLA 4BMSA 4HNAB 1XZCA 3ZLVA 2VTBB 2C7VA 2UZIR 3H2YA 4HXGA 4ZWNA 4G8CA 4LHSA 1Q0ZA 5EEHA 3OUZA 3ICOA 4HS4A 4ZOCA 4ZOQI 1HDGO 3Q40A 4RX1A 1OPXA 4Q3KA 3RVDA 1ODIA 4UP7A 5IUJC 1NG9A 1XRLA 5TT0A 2DKGA 2ZRAA 1EP9A 4D45A 4UUOA 4RF3A 2GHTA 1ULBA 1UWVA 2JKVA 2L0XA 4RHCA 3PE3A 5CBPA 2OV6A 4PQGA 4QODA 4HG2A 1ADYA 1LEHA 2AKYA 5IABA 1JRLA 1PFVA 5GOZA 3E8SA 1XTUA 4UUAA 3WGTA 4Z4GA 3FDIA 4IWNA 1KSHA 2B69A 5C8YF 3A0UA 4DVGA 1PQUA 5CA0A 4EQZA 1W35A 4JI4B 4F04A 2YN2A 2UZ1A 5EG5A 4BFZA 3WBBA 2F3PA 2QNBA 2XYHA 3WXBA 2PS3A 1PT8A 1Z4KA 3F3SA 4YRTA 1RXCA 3E70C 1UBOS 2R7NA 5G53C 1T5SA 4JASB 2DZCA 4GP6A 5DN9A 1TQDA 4IH9A 4MGEA 3VC7A 3RSHA 3HFGA 3UHOA 4CBVA 4EHJA 1UKBA 2R6CA 4AY4A 4FFPA 5LPNA 4PGFA 2PSSA 1O89A 1RHRA 1TVCA 1MHTA 3JAKA 3RVQA 4Q1VA 4Y2XA 5EZYA 1RQ7A 2R7KA 4EZEA 2GN6A 3RIEA 1OLXB 4JMLA 4H7DA 5C7YA 3ABQB 4FLEA 4EG5A 3QVGB 3QMVA 3SC2A 3NELA 4IF6A 1DJNA 2PX4A 4GF5A 4O2LA 4TYYA 3EB9A 3FYCA 4GYWA 3FF4A 4FHGA 3SF0A 2VFAA 2WMOB 1Q1AA 3CH6A 4DABA 2PH7A 1CS4C 1M6VB 2CNLA 1RPNA 3OPYI 1Y8AA 3I2FA 3ZQ6A 3TW8B 4UTRA 5IJWA 3O26A 4H3KB 4U6NA 3WRVA 1Z74A 1ENYA 1ORWA 2B34A 2OOKA 1E8MA 4ZVOA 4DWVA 4OA8A 3TTXA 4IHJF 1UDBA 3MUFA 1WDTA 4OFBA 3ZDYB 4G5XA 1ZH4A 4GPEA 1SCKA 5IC5A 4PFSA 3TF5A 4LJ4A 5AKIA 4CKYA 5KNDA 1N2BA 3SY8A 1E0AA 3EK2A 4OYRA 5ALVA 4U2FA 3WYCA 5CUQA 1U7DA 3GT4A 2CJ9A 1QBGA 2ZJAA 1BFDA 3HHPA 3PWKA 1T5DX 4ZCLA 3E35A 4X63A 4E15A 5GJWC 3AY7A 4JJKA 1GYRA 4EAAA 4KDFA 2ODAA 1JDNA 3DE7X 5AXCA 4KOEC 4PLHA 3L0DA 4ZMBA 3KJGA 1VMEA 2Y1KA 4NC9A 4OHBA 2GPBA 1J22A 2OPBA 3H2GA 5FBVB 2QHTA 1R4NB 1U3GA 4DB2A 4J0DA 3EARA 3RSZA 3O03A 2GNAA 4S2EA 2FETA 3TUPA 4V0SA 1C9MA 5FV4A 3T9FA 3ZU6A 1M8GA 3H7IA 1O95A 2YJGA 3KSDO 2YDXA 1O1YA 2J3IA 4PSDA 3RFVA 3U26A 3ZY3A 4RTSA 2P4UA 1O95C 2JAPA 4LE0A 1TYCA 2XECA 3Q9SA 1FRVA 1NBIA 2PRSA 3H5RA 3I9V6 3AEXA 4FZVA 2F48A 3EMDA 3ICCA 2VH5R 4KSBA 3TPZA 3OQIB 4FNGA 4LYDA 5EI5A 1FS5A 1IEQA 2LDBA 5BQPA 4AB1A 1PI3A 2VDKB 5JQWA 3BDAA 2N1BA 1B76A 4CCYA 3PIRA 4ZRNA 4PS1A 1HNWB 1GCOA 1HKUA 3OCVA 4KFTA 1SBQA 3T5MA 3G8CA 1YMUA 4LWZA 4YMWA 1ZJJA 4IDDA 3B9BA 4YPOA 1FW6A 2OBLA 3TRFA 3PV0A 2WQ6A 4HB2A 2AOXA 4L4XA 4RY0A 5KX5F 3EX7C 4ARCA 2I2WA 4E7PA 3WOHA 5HGXA 1EI9A 4BNUA 3I42A 1Q92A 5HUJA 2W2VA 3IXLA 5CCXA 1WDMA 5DTJA 4ZD6A 1KI8A 3A31A 3RIMA 4A5SA 2X4GA 4ZKEA 1U3WA 4B74A 2B35A 4ARZA 1I0LA 5HKKD 1VGRA 3OLWA 3OTWA 2F17A 1MV8A 1JFRA 3H5TA 3RC7A 4AXXA 3P94A 4YT2A 4MVJM 2IEDA 1NJ5A 1KQFA 4Q1BA 4UULA 3FGNA 3HPQA 4UBKA 3U3XA 4C29A 4TN5A 2Y92A 1QR2A 4OQFA 1NJ1A 2GXSA 2PS1A 3A04A 2PWBA 2ZTHA 5FTMA 1VA5A 2IIBA 4F5YA 5BORA 1H3NA 4FD3A 1EGVB 5BN4B 4F2PA 1SC3A 1I4TD 1G6Q1 2GBCA 3WYGA 3GF4A 1PWYE 3OIYA 3QVJA 4DQKA 3PNKA 5JSYA 5FULA 1N2SA 2PVCA 4L6IA 4HP8A 3X1XA 4YCJA 4TTIA 1KY3A 4XTZA 1MAHA 3Q88A 3EMBA 4EMTA 2XRZA 2P65A 3EPJA 1NBWB 1D04A 2IE0A 3R5KA 3SDBA 3H16A 4B6GA 4OFZA 2TS1A 3HYRA 2YS7A 4EA6A 3USCS 4IIHA 4BCCA 1E2JA 2O8FA 3BRCA 3VU9A 2A94A 5K3SA 3R9XA 5CCEA 2DTDA 5B1IA 3ZW7A 1BGVA 4KV7A 2QVCA 3AETB 2R0QC 5AQEA 1N6PA 1ZGZA 4JUDX 5L95A 1V26A 4PLTA 2OXRA 3MTQA 3V2GA 4CKBA 4YUWA 1YOVA 3KDAA 4R9UC 4XCVA 3LQYA 4WL0A 4DT1A 5KJ6A 3KJEA 2ZR2A 1FVHA 1EEHA 2VT2A 4JUFA 2PZFA 3KQQA 1F8FA 2UYYA 2D2IA 1FP4B 1XXHE 2FUCA 4G5FA 3ZGXA 4XRGA 1ECPA 4YAGA 1MW8X 4PG6A 5D3KA 3L46A 3V4RA 4MWZA 3C0KA 4OK6A 3ZNQA 3KHKA 1P2UA 2GEDA 3KBOA 3CLSC 1P7ZA 3R7SA 4J16A 2X8LA 4NEHB 2G1PA 3I6YA 3TRJA 4FZ3A 2A0WA 2Q4OA 1HXDA 4QU9A 5E4FA 1JHAA 4J16C 3DZCA 3W2GA 4PEVA 1ZINA 2B4AA 2Q1UA 1EIWA 5E9QA 3OEED 2WM8A 2V7GA 1JJ7A 5ECWA 2I7XA 5GQSA 4RYLA 5AW1A 1R9JA 4D4MA 1KFJB 2DZDA 3QF4B 1PL6A 4UCQA 3BBLA 2WUDA 2XH8A 4EY3A 3QYAA 1AKUA 2IZ6A 4KQCA 1ELOA 4OAQA 2VZEA 4PONA 3DE1X 3UKDA 4CWAA 3T54A 5KNDH 1HT1E 4LBVA 4TMZA 2SCUA 3DT8A 5DW0A 3LH5A 4C4AA 1DIHA 3AVTA 1TCCA 5E6UA 4D7AA 4OK3A 5GV8A 3Q6MA 3E61A 1ZH0A 3WB1A 2IUSA 3G88A 3MN1A 1GSHA 3H1EA 2BGMA 1E2EA 2VATA 2OFFA 4E31A 2VYVD 3G17A 3H9EO 4H08A 3H5IA 3P9KA 3LC0A 5AXAA 3L05A 4CMBA 4IDAA 1XX6A 4I6EA 1UFKA 1GITA 4ZZ1A 1C3EA 4N40A 1GPH1 1ZZGA 1N1EA 1QHFA 3KWMA 4GC5A 3THSA 1SXJB 3ET4A 4NK5A 1FK8A 2QQEA 3EGOA 1EWRA 2A0FA 1DELA 2PUBA 2AFRA 1W0KA 4LXUA 4H18A 4UPVA 1I2CA 4FSXA 1IJBA 1AE1A 2G63A 1UJCA 2Q7GA 2DWQA 4CMGA 1JBQA 3OZCA 3R44A 1J20A 3L0YA 2KBFA 2Y4OA 1T5LA 4LHVA 5IUKC 4DQVA 2FY8A 3AV3A 5BQ5A 4HDCA 4ZGGA 2HQ1A 5L7TA 3ZGVA 1KDPA 1UMBB 4B48A 1AKMA 2VNHA 3RB8A 2CVOA 8OHMA 2HTEA 4ZVRA 1NG1A 2QU8A 3H18A 4M0PA 1ZD5A 2P8JA 2CZGA 4C06A 4C0LA 4YCSA 5LU8A 3L82B 4O4HA 4Z3OA 4ZI3A 2J41A 1LSOA 2A84A 2E4ZA 2FK8A 3OFND 4YAWA 3RYFA 1L3CA 3OQVA 3H4IA 4OQNA 5AKGA 3INYA 2ZI4A 3KHTA 5G41A 2C1ZA 5IP5A 4BQPA 1NP3A 2QTFA 5LD2C 2R8OA 2PSDA 2H2AA 1JZSA 2CV1A 4I46A 5ES4B 1BDBA 3I9V1 3UAGA 5IM4F 4M99A 1WB4A 2OGZA 4R9VA 3VX4A 3W9UA 5IG2A 1PT7A 1BS9A 2FRXA 5DX8A 2GTPA 3VDNB 1OX4A 5E7QA 5EP3A 4KDRA 4M1OA 4FUTA 1UBJS 3R7BA 5I4IA 1VCIA 1DB3A 2VZLA 1UEXC 2XCTB 1Y8QB 1RKBA 4L15A 3RYIB 1YXMA 4W5RA 2E5WA 5DVZA 1ZPDA 3Q4GA 3RRJA 5IXJA 5B4VA 1D09A 1TK3A 4CL2A 4JI8B 1ZW6A 4BW9A 2R6GA 3GA7A 13PKA 1E99A 3VC1A 4FDAA 4NU5A 4KI7A 1ZLXA 3PLNA 2REQA 1G4AE 1R5OA 3K31A 3NMUF 4B6JA 4C5AA 4DNXA 2BBOA 4M37A 3G23A 4M0FA 1K08A 2Q3HA 3VTZA 2WSBA 5H3LA 4H1TA 4HYEA 5DISB 2CMFA 3HL0A 3Q7SA 4OHRA 3ONEA 3HI4A 3TNLA 3R8XA 3QU2A 3GGOA 1OKKA 4PY2A 1HYGA 1E7WA 3OM1A 1KQPA 2ZAYA 4JC8A 4D6PA 2X0EA 4QOGA 4O33A 3BCRA 1GD1O 1BXKA 5UKDA 1IM8A 1XOIA 2V59A 2H0QA 5CLHA 5CLQA 2XUJA 5FRDA 1XA3A 3K0BA 1OBHA 2Q45A 3V55A 4HGRA 4IOMA 3F7OA 3W7BA 5J4HA 1PVDA 4BLQA 1RCUA 1DQPA 5CURA 2GXQA 2P6OA 4K88A 2V65A 1XMPA 2IEIA 2ZDHA 3M6VA 4QNNA 3UJDA 5KYUA 3BB1A 2A1UB 2B0JA 3UMFA 1VL0A 5TDHA 1ODSA 1OLUA 4AMZA 3EQ6A 1IQ0A 2FZCA 3LF1A 3F9IA 4HGNA 2H0AA 4QGBA 3C8DA 1O6GA 5DGXA 5ALRA 1Z2PX 4OB8A 2H9IA 2XVZA 4GQBA 5FT9A 3RRFA 4O4IA 1U3VA 5TQJA 1DKMA 4DW8A 3A74A 4EYSA 1U7TA 2O7SA 1SC9A 5BO5A 2IYAA 1B8PA 3HSSA 3MIZA 5T64A 1GPJA 2WDZA 3KVNA 4J49A 1M33A 1BN7A 1GKUB 4W5WA 3BEDA 2ZB3A 2JARA 2YZ2A 2REBA 4P3XA 3ER8A 4EVSA 2H6EA 1IVSA 4BZZA 5KKNB 2ODNA 3S70A 4WESA 4UHBA 2P7IA 3EF3A 4Q4CA 4TT3D 1DAPA 4EB3A 3AL0C 3ESQA 4F1JA 4EGQA 3NEJA 3ZDBA 2ZBUA 4LKRA 2AZMA 4D0RA 3EPRA 4JLOA 3U4QA 2LGJA 1JAIA 1DHRA 3OZXA 4RSGA 4UMDA 4D1YA 2OKCA 3TX6A 1I1NA 3U3ZA 4HXYA 5FB3A 3IP7A 1Z75A 1AKTA 1MCZA 2GZ2A 1CIPA 4A9AA 3H8WA 2IPNA 4UHFA 4BEVA 2XODA 2YRXA 3QVLA 3TLZA 3A6PC 3I0ZA 2Q3EA 2QXTA 1WUKS 2J4FA 3ML1A 1HPLA 1R8YA 5J5AA 1VHDA 3WSWA 3IOBA 2WSIA 3UTDA 1XRSB 5I3ZA 2JIBA 2GILA 5L9AA 1UAGA 3KEGA 3RYHA 2DY1A 4ND8B 3QFCA 5IXSA 2R44A 3AVPA 1N5DA 2G6BA 5HF5A 3GLGA 2OCLA 4NZZA 3A06A 5L4SA 1JLSA 4M8NE 1R0LA 1X7ZB 2HSEA 2ZROA 3A7UA 2ZYWX 1PNVA 4QREA 521PA 1UAAA 4LK2A 4LISA 3WBJA 4JC5A 5CLJA 3CWCA 4LIPD 1TVKA 2EQBA 1SY7A 3BF7A 3LD9A 2TYSB 3R6DA 1VE9A 3ONDA 4UPAA 1YB4A 2V1XA 5DB4A 2H7CA 4BLSA 4EB8A 2PUGA 4L0CA 3EFOB 2PS9A 3VI3B 3H5NA 4E5KA 1CRQA 2IPOA 3CG0A 1THMA 1U3FA 5AVJA 1ZONA 1PJQA 3VZQA 1UK8A 1V6AA 4FMCB 2QBYB 1NFQA 2CJWA 4C6TB 1M2EA 4QBHA 1P77A 1B0PA 2HEIA 2MSLA 2GM5A 4BMDA 1XZMA 1ZSNA 1V5GA 2QRZA 4HFMA 4UAVA 3ZGYA 3ZEIA 4MVWA 1RKUA 1LLFA 3WLQA 4MA5A 1Q0QA 2ATEA 3UMJA 4YDRA 4EYQA 2ZUTA 4GM1A 5CDFA 1KAMA 1AQIA 4V0MA 4KN8A 1LI7A 1P5JA 1VL1A 2G70A 1H6BA 1HDRA 2PZEA 2IU3A 5CBPB 4J7CA 2B8WA 3ESXA 4GPBA 1YC5A 3PDIA 4OP1A 2FUNB 3GFPA 4R51A 1HG0A 2QRLA 3VKFA 4FONA 4ZGBA 1W36B 4BKMA 2IOQA 3CINA 3JQCA 5LYJF 3VZCA 5CA0B 1X13A 1CFJA 3A70A 1H1TA 4I2VA 4KFUA 2UZ1B 1CP3A 2DTOA 4M46A 2PE5A 1Z5WA 3RQSA 4FYMA 1J6UA 3IPYA 2CEKA 1XA4A 3E53A 4H77A 2ZBVA 4XTWA 2UZAA 3SF8A 2AOTB 2ZM6B 1QR6A 1G4HA 3MGCA 4OJQA 1U9CA 3TTSA 1Q0UA 3UQYS 1ZCZA 2P6NA 2AR7A 3LI2A 1ZRMA 3LY5A 3E8MA 3FVTA 4C88A 1T4CA 1W5FA 3NP9A 4FX5A 4HR7A 1HX7A 3WRWA 5T7BA 3DB1A 1L5WA 4MKRA 1UKYA 3L1AA 5EE5B 5EZYB 3DXZA 4KK3A 4H7PA 1ECGA 1Z3CA 5A0TA 1EESA 4WMLA 5EJ9A 1D6JA 3OIGA 2B1IA 5FPPA 2H00A 4E51A 2XZTA 2CYCA 2P2LA 2XA2A 3EBLA 3T9AA 1RABA 2VEOA 3TS1A 4CMIB 3O8RA 1RJ9A 4MIKA 2Q1TA 3G5UA 3IC5A 3PXEA 4RZ3A 5DLQC 1Y63A 3F78A 3LHDA 3WMGA 2POQX 4PBSA 4B4UA 1AF7A 1B8UA 2JASA 1VIYA 1T13A 3CUTA 3IVCA 3C7TA 4L07A 1GLVA 1TQ8A 3ICAA 3ZVLA 4I4TF 5JWRA 3EFSA 3ANSA 3QUTA 1KOGA 4JFAA 3DZ8A 4S0ZA 1CRZA 3I62A 3GJ6A 3K0AB 4RH3A 4NYIQ 5KYKA 3OWHA 5AW4A 1NXVA 3R3VA 1QH8B 2C42A 5JMPA 2RONA 2OT3B 2PAAA 2J7PD 1Q1GA 2ZJ1A 1L8AA 3SX4A 1C29B 1UWCA 4LXYA 2H3EA 4PNZA 1LRJA 1HA3A 5F9HA 4OCZA 1LB1B 1GO2A 3HBAA 3JQBA 1GEGA 2ZYRA 1WS6A 2GJ8A 1ZUD1 9LDBA 3JQBC 2I6UA 5KYGA 1RAAA 4X92A 4IJMA 4LUCA 1YFKA 3FKSD 3O38A 1ZMXA 3C6XA 5ARBA 5K99A 3PR3A 2V54A 1E22A 4RQFA 4QDXA 5ALOA 4Q9AA 3AW9A 4PZ0A 5ALQA 2JIMA 3Q7IA 1IN5A 2X1MA 3EN0A 3HCWA 4N82A 2AH5A 1DU4A 4OA5A 2HI0A 2XTAA 2CLHB 3SCZA 3FUXA 3H04A 4WXMA 4GX2A 2HIHA 1SRYA 5JJIA 1PR3A 4BO6A 3NBAA 3DJYA 4ENSA 1UAYA 2PRIA 3AR4A 2F62A 2CB9A 3OJFA 1WA5A 1YR7A 2YOFA 2QT0A 3L93A 3M49A 4KUGA 1KETA 1K2WA 2V7QA 2AFIA 1R66A 2FA9A 1KERA 1OI2A 2N46A 2R8BA 2ZBRA 3GEPA 3JSXA 3NHJA 3NONA 5CJPA 2D8MA 3A10A 5K6AA 2C58A 3KOYA 4RD2A 1GTL1 4HS9A 4BJ6A 2Z30A 5K6AC 3JVVA 1VL8A 2WJVA 4LC9A 4RK7A 2YWCA 3VDRA 2BN4A 5EMNA 4GGMX 4D99A 4N76A 4JLMA 5ED0A 1RXWA 3DGFC 5CVEA 5AW9A 1PRYA 3A27A 1H85A 1KK2A 2W6ID 3U5TA 4KX5A 5FOVA 2Q27A 2PA0A 2ZJ7A 3C3PA 3AIKA 4BMZA 1C1DA 1O7JA 3HJNA 3DL2A 4LMAA 5A5FA 1YVPA 1XCLA 3RHZA 1JVBA 1YQ9A 1NUSA 5F5XA 3KQHA 3A7RA 1EM8A 2XMRA 2GCIA 4UAJA 721PA 5KAMA 4CV1A 4QXPA 4B31A 4EDFA 3L8ZA 4L9RA 1AU9A 2WWFA 2H51A 2XD9A 4NTZA 4F3RA 2AKEA 1KKLA 1X1DA 2GJ9A 4K1XA 3GB9A 1ZC3A 2DU7A 1XJCA 4FGLA 4O4JA 4OM8A 2IYPA 5BWMA 1R8QA 5GONF 1D07A 5KJEA 2XUOA 2FKNA 2X5JO 4GPIB 1XDBA 2OXCA 4HH0A 2XQKA 3HE3A 1II0A 3CF4A 4OVKA 4XCXA 3UNXA 3ZD9A 3TW0A 4AICA 2G82A 2D5IA 3JR7A 3LZCA 3U4HA 1IEVA 3AF1A 2GZRA 5DYIA 1R4MA 3FCCA 1J2YA 1LBEA 1U99A 4D80A 1SUWA 3LHFA 3TINA 1CJCA 1HL3A 3CUVA 3C3WA 5JU6A 3PNLA 4D9GA 1FMJA 1F60A 4KVZA 2FG5A 1O94D 1UC5B 1NUTA 5FO0A 3WFIA 1EWKA 2CHEA 1FSZA 1YOVB 4DT1B 1FTWA 2WJAA 1N5MA 3EWAA 4XUGB 1A2BA 4I6JA 5ALKA 4LVIA 1ZYUA 5FDFA 1ORTA 4HH3C 1L4BA 2XUAA 5I7SA 3WLAA 4BWYA 1ECLA 3LSSA 1UXGA 1D4AA 2BDTA 4MV7A 1UQUA 4OO3A 2XYVA 4JSRA 1YUNA 5AW7A 1CNFA 4Z1OA 4G4SO 1U2SA 4IQ0A 3BERA 1IDN1 1DADA 4X97A 2IXTA 2YWEA 1G59A 1JQKA 1BG6A 2UZ3A 3D6HA 3OJ0A 4OGKA 1FTSA 1O2DA 1EZZA 1GXSB 1ANKA 2JAOA 2QR5A 3GD5A 121PA 1XLUA 1SQ0A 5K8LA 3ZGLA 3UJPA 3RABA 1V3UA 2OXEA 4LY9A 1ZWLA 1O03A 2JL1A 1P0FA 1S9HA 1Y33E 4M88A 3HLYA 2NXNA 1I4LD 4LRQA 3HB4X 3R0QA 1ZAKA 2NV6A 4UXHA 2AI1A 2Z3WA 5F52A 4RH0A 1G9SA 2BKXA 2WV7A 2P35A 4FNAA 2P2YA 2ZT6A 3QOXA 4IEIA 4JKOA 4N7JA 2PKYX 4UPEA 1GUZA 1T9ZA 4Z1MA 3F4LA 3W1EA 4A23A 5E6UB 1DE0A 3K71B 4G0MA 3JQ8A 3NCHA 4CF7A 3MBOA 2R8YA 3D7LA 3MMXA 4KUHA 2FMTA 2VEDA 3PLAE 1LQTA 3L8MA 4XRRA 4IOKA 4FBGA 3ZS8A 1CJVC 4QTTB 2ZJ3A 3V97A 3OAAD 3PX2A 2AVDA 3N0XA 2DBYA 4DLZA 3IV7A 1O6ZA 2EZ4A 1G19A 3MLEA 1L8QA 2XIJA 3TO5A 3M4QA 3ZZNA 4C5BA 2FW7A 1CEYA 1GZ4A 1QHHA 2V6GA 2WZCA 5CT8A 2WSMA 1PFKA 3T7DA 1AVTA 3ZZTA 3DBOB 1RYYA 3A3PA 4U5XA 4MVJD 4MRMA 1GGJA 1W76A 3GLFE 1KRWA 5BV7A 1O0BA 1B8VA 1SCNE 5DJ5A 4Y3UA 4IDHA 4ZCRA 3RHTA 2QM7A 4HRYA 3S7ZA 3TNYA 4AYWA 4XR9A 4WOPA 1V3QE 4OMDA 3GRRA 3ET5A 4IICA 2N0SA 3Q3IA 5F1YA 4ZOLF 4MTCA 5CFLA 1H2EA 4S1VA 4HY3A 1VKOA 4O4HB 1OWOA 1RJWA 4ZOAA 5DASA 5EVCA 2CWWA 4KAFA 2AQHA 2WY2D 1Y9JA 4Y2HA 3HKDA 3ADPA 2FOIA 3RYFB 4TZ0A 3N2NA 5ALSA 3UH0A 2RK4A 3SX0A 3QOFA 3KQLA 1E4EA 1KNXA 3C4JA 4AMUA 4F1WA 3K3PA 3N2GA 4MRNA 4Q4DA 5KAPA 3IXQA 4TUYF 1RC0A 4JI5B 4Y18A 4B3SB 1QFZA 4H2TA 1P31A 3H8JA 5AK6A 4DJAA 4FP9A 5JSZA 2WWHA 1R0WA 4KW7A 2YV5A 5E0OA 4GRAA 3U2QA 1L9KA 3PKIA 1DBRA 4KN5A 3EGCA 3OQBA 3H4MA 3H5AA 2VIIA 2WU1A 1BNCA 2GNOA 3FDJA 1QVAA 1XAJA 2VHYA 2IEYA 2VJQA 1CZLA 2EL7A 4N12A 4Q1DA 4RZUA 2H4WA 4UUMA 1LK7A 3EWIA 1TKRA 1TECE 3IAXA 3AY0A 3ZWDA 4LF7B 3AVYA 2DQZA 2I4OA 3BWBA 4YRZA 3RF1A 1MOZA 1GYQA 2REQB 3FOCA 3GFFA 1MJGM 5TSDA 1AUVA 2O07A 1JJCB 2NTNA 3I0MA 3NVDA 1MV5A 1A8UA 3E7WA 4TOIA 1W5BA 3VH4A 2JVKA 4TTRA 3ZQKA 4DAOA 4DSNA 5LL6P 2VQ3A 1VQ1A 2Q3BA 2E37A 1PK7A 1K8QA 1UPCA 4ENWA 1ZIPA 4MWSA 3QKTA 4KQ2A 1CUBA 2BJHA 5K0LA 2ZT8A 5U4XA 4JYAB 5LMZA 3PNVA 4N3BA 1M7GA 3AEKA 2V58A 3K6KA 3GBSA 3UCEA 3IEKA 2VRNA 4OD0A 1E2UA 3D6NB 3II6X 2QL6A 5DX0A 2ZZKA 5AVXA 4MQLA 1KORA 2N1MA 3GP5A 4F06A 2RHGB 2W22A 1GIAA 3M3PA 4Z3DA 4JB2A 1EWYA 1I14A 1MPTA 2PGAA 2Q9AA 1Y5RA 2O1XA 4N4AA 4R3WA 5IK2A 5I8WA 1JTFA 3F71A 3ZKAA 5KYUB 1Y3IA 5H9WA 3ZJUA 2ZTMA 1OLUB 3HCOA 3WYBA 1R0SA 3B2EA 2G6TA 1Z0JA 3O0DA 2RHDA 4L5YA 5IULC 5JNWA 2HRDA 3PXDA 3UMGA 3N2ZB 2Q5IA 3LK7A 4B73A 1N4AA 3T5GA 3AUAA 2Q0QA 2BJWA 3NI2A 4XGNA 5IHXA 2QMUA 3VHLB 2AW5A 4RM3A 4ZANA 1XZFA 3G79A 1ULAA 1TGVA 2G5CA 1B42A 2KYRA 3P8YA 1NMYA 3H9BA 4KLNA 2VP9A 3SQOA 1ZSYA 2R8PA 3EEIA 3V4LA 4FXPA 4QECA 2RHOA 4YCVA 2ALYA 3KJIA 3OM0A 3OEHA 4RDCA 2WJIA 4ML3A 1QG2A 2F3SA 3GCWA 4OJTA 2EKBA 2J46A 4QFBA 4MW1A 3FE2A 4DRXA 2JI6A 2QXYA 5MGNA 4FILA 3CTPA 1SUFA 2PR7A 4KK4A 4L8YA 1MX3A 2JCVA 3ASZA 1X3LA 1V9SA 3BGVA 3QWBA 3QVSA 2GZDA 4YNBA 2DUWA 3IU