3IKLA

Crystal structure of pol gb delta-i4.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
388
structure length
364
Chain Sequence
SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRGGRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA polymerase subunit gamma-2, mitochondrial
total genus 78
structure length 364
sequence length 388
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3iklA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3iklA02
1B76A 3HXZA 3NELA 1E22A 1FYFA 4UPAA 1X2GA 4CS4A 2ALYA 4YRTA 1W66A 2C8MA 1J5WA 11ASA 1EQRA 5E3IA 4NCXA 2ZNJA 1Z7MA 2DEQA 5K1PA 4H02A 2Q5IA 2ZINA 4ZTUB 1BBUA 3M4QA 3VBBA 2E41A 3FJPA 4UP9A 3HY1A 1WPYA 3RL6A 4XTWA 1SETA 2ZZGA 4YRCA 4XTYA 2ZT6A 2ODRC 4HWPA 4CH4A 2DU5A 2ZXFA 1YFTA 2J3MA 2Q7EA 3A32A 1JJCB 4HWRA 4YRRA 2FYKA 1ATIA 1ASYA 3IKLA 3A31A 4H2UA 4YCUA 1QF6A 2AKWA 4P73A 4P74A 1H4QA 4XU2A 2PMEA 3NEMA 3REXA 1KOGA 4KR2A 2CJAA 5C52B 2ZT7A 5K1XA 2AMCA 4H2XA 4K88A 4EO4A 4P71C 4TTVA 3L1AA 1X56A 1X55A 3EFSA 4DQ2A 4E51A 2P0LA 4YRKA 3TEHB 1LYLA 2DVEA 2ZTGA 2ZZEA 4ZIBA 1WQWA 2QHUA 2DDZA 3TEGA 2ARTA 3RIRA 3ERRA 3HXUA 1NYQA 2Q7GA 3HFZA 4YRMA 2P5IA 1BIBA 4H2YA 2ZIOA 2DQ3A 2ZT8A 4RMFA 3RKXA 2ZNIA 2AMCB 2J3LA 4H2XB 3HY0A 2Q7HA 4YCVA 1NNHA 4H2SA 1H4TA 2DTOA 4TVWA 3WQZA 4J15A 2ZR3A 3NETA 4KR3A 1USYA 4XTXA 3RF1A 3RKWA 3HXWA 3P8VA 3MF1A 3VQYA 3A5ZA 1G5IA 2EJ9A 2E64A 4P3OA 4HWOA 1NJ2A 4XU1A 3A7RA 1BBWA 4UP8A 3VQXA 3V7CA 4XEOA 3W3SA 2ARSA 2ZT5A 4CH5A 1YFRA 3QO5A 4XTVA 4TQFA 4P73C 1HXDA 4YRQA 2Q5HA 1EVKA 3LSQA 4RQEA 1QE0A 5HGQA 1KMNA 2ZIMA 4YREA 3A5YA 1WQ7A 3MF2A 12ASA 3HRIA 4P74C 2DXTA 4CS3A 2C7IA 4KQEA 3HXXA 3IG2A 2XGTA 2AKWB 4CH3A 3TUPA 2ALYB 2EAYA 2DZ9A 2E3CA 2RHQB 4P75A 2RHSB 2ZCEA 3IKMB 2XTIA 2DU7A 1ADJA 2RHSA 1RIQA 3UGQA 3MEYA 3L2ZA 4YCWA 1E1OA 4G84A 1WNLA 1X54A 1L0WA 2QHSA 4H2TA 3BFMA 3P8TA 2EWNA 2ZGWA 4Q15A 3VQVA 3PCOA 1YGBA 1PYSB 4H2WA 5ELOA 2ZZFA 4YROA 1NJ8A 1EVLA 3V8JA 1B70B 1EFWA 1E1TA 3UFGA 4BW9A 1C0AA 1SRYA 4YP0A 3REUA 1G51A 2QHTA 2DQ0A 4XTZA 3LC0A 1JJCA 3V7SA 3HXYA 4P72A 1WLEA 3V8KA 4XTUA 4L87A 3QO8A 3V8LA 4HWTA 3HXVA 1EOVA 2I4MA 1PYSA 4HA8A 2HNIA 2CGHA 4HWSA 4UP7A 2QHVA 4YRFA 1WYDA 1SERA 3V7RA 4YRGA 4P3NA 4P72C 4YRLA 3HFVA 1E24A 4AH6A 4YPFA 2RHQA 3EFRA 2ZR2A 3TEHA 4CS2A 3L4GA 3RKYA 1G5HA 4O2DA 4P75C 2DTIA 2EJGA 2IY5B 2CIMA 3HRKA 3ICAA 1NYRA 3L4GB 4XU3A 4YRNA 4WJ3M 2E1HA 4TVYA 5C51B 3UH0A 1ADYA 3E9IA 1B7YB 4TVAB 4YRJA 4ZTZB 1B7YA 1BIAA 4TVAA 3DSQA 4WF2A 1GGMA 1NJ1A 3A74A 3R07A 4TWAA 4G85A 3OD1A 1EIYA 4XEMA 2IY5A 2DZCA 3G1ZA 3PCOB 3IALA 4Q6GA 2I4LA 4YRPA 4HVCA 1IL2A 4PHCA 4P71A 4YRSA 3RGLA 1N9WA 3M4PA 1HC7A 1VQZA 4YDQA 4X5OA 2CJBA 4YYEA 3UGTA 2I4NA 1USYC 4K87A 4P3PA 4BWAA 2ODRD 1HTTA 4CH6A 1SESA 4TQDA 1KMMA 1YFSA 4OLFA 2E65A 3PZCA 3P8YA 3QO7A 1ASZA 4WJ4A 3RACA 2DXUA 2DTHA 5KNNA 4LNSA 1WU7A 1B8AA 1YB3A 2CJ9A 3E9HA 1NJ6A 1Z7NA 4DPGA 2EL9A 1EIYB 2EJFA 3A7UA 3HTZA 2DKGA 1X2HA 2E5AA 4XU0A 1NJ5A 1H4SA 4RQFA 2I4OA 3A7AA 2DJZA 4WI1A 1X01A 2E10A 1B70A 4YRIA 2ARUA 3CMQA 1V95A 3QTCA 4H2VA 4RDXA 1H4VB 4EX5A 4K86A 3QNEA 3I7FA 2G4CA 3LSSA 5F5WA 4OP0A 2PMFA 3NENA 5C53B 3HFZB 5ELNA 3RUXA 3BJUA 2LW7A 3VQWA 4PG3A 3KFUA
chains in the Genus database with same CATH superfamily
1W0JD 2XMQA 4Y6GB 5FWXA 4RK5A 1B76A 2FYTA 2UYGA 3GMTA 3L1UA 2EC5A 2OFFA 5E2AA 4YQFA 3EG5A 5LMZA 1N36B 2JFOA 5BSMA 2WICA 4HBGA 4KR0A 4OX9Y 4P8RA 1P31A 3PUYA 2ZBFA 4QYIB 4A16A 3K5PA 1OXMA 1Z36A 2EVWX 2O7NA 3PC2A 3QKSB 3Q3IA 3FCOA 2AYYA 3Q9UA 4Q7KA 5T3UA 3GLVA 3GLGA 1SIBE 3AUKA 4O8ZA 1UXKA 5EGNA 3UTCA 1UBMS 1IRIA 4MVCA 4U2EA 1Y98A 3NNNA 5J5AA 2BCEA 3QI2A 3CHYA 1O97C 2VHQA 3HDJA 3FNRA 1GZ7A 1M0TA 2CL7X 3AR2A 1ZKDA 3K9CA 4OU5A 1QP7A 5D5PA 3QKRA 3OP4A 1D09A 4B3RB 4WW0A 4Z4EA 1DINA 1OBFO 2XHEA 3A4YA 4B8YA 1VSQA 2LRHA 3OKAA 2XV1A 3AR9A 3BXGA 2PGOA 2OM6A 1DHRA 2H6EA 1ST3A 3BC1A 4P4NA 3DUFB 4Y2XA 3I37X 2W00A 1RLJA 2H17A 3FPSA 3UHJA 4HWKA 5FI3A 3PXGA 4MR8B 1COWA 3DEYX 4XTWA 2VZ8A 4UREA 1XYGA 4OK3A 2WM2A 3MFQA 4EPVA 1YU6A 1PDVA 4FT4A 1D8AA 2WHPA 3EZFA 2BJWA 1F60A 3Q7SA 4Y6OA 3G9TA 1H2ZA 4ZVMA 1B73A 2OCYC 3FRHA 1WB9A 4MLDA 1M1UA 1GTL1 4QVKA 3OPYB 2DPHA 3F4LA 3RAJA 1ZOIA 2PRZA 4CH4A 1J9GA 5A04A 1M75A 2JJ2D 4TPKA 3LKVA 4WFKA 3TMYA 2PKYX 3T0GA 4C2UA 1IWBB 1K97A 3NT4A 1V16A 5MDHA 3PX7A 3IMEA 4RXTA 1H3FA 2GBLA 3LLMA 3TE7A 2Q7EA 4WX2B 4F3TA 5IHXA 4UUMA 3A32A 3LV8A 4JU9A 3IUPA 2UXCB 4Q7MB 4R6XA 3ONWA 1YR8A 1U9IC 3QUTA 1DRUA 2X19A 4X61A 2EBFX 4N6OA 2WP0A 4M8KA 3PDUA 3OAAD 2RH9B 4HS4A 4QOHA 1JDBC 3VYTB 2O5EA 4JP8A 5JARA 3GZNA 3IDAA 2CEAA 3OTWA 4MYRA 2BISA 3LQ1A 4HN4B 4M6WA 5LJIA 2X2OA 3IOCA 1UM9B 1IZ8A 2BMAA 3AY0A 5EFOA 3GL9A 2HA3A 3VH1A 5B57C 4Y9UA 4FEYA 1BRMA 1ZAYA 3LQRA 3VYRB 1KOGA 5I9BA 3ZDZB 4HUTA 2C8KA 1RWOA 2P35A 3JARA 1F4VA 2XODA 3ITKA 2HHAA 3KZVA 3LG2A 2Y0DA 4ZQHA 1X77A 4ZV9A 1ZD3A 3DOHA 2AJTA 1PGPA 4E09A 4ER5A 4MPRA 4MLZA 2AMCA 1RQ7A 3K9LA 4ZT2A 2RKWA 4FE7A 2Z6UA 2WFMA 2XQFA 3RVPA 1ZJ4A 1D0VA 1RAIA 3CZAA 1RWNA 1X55A 2WVAA 3DAHA 3G5TA 4OV6B 3ROFA 2P0LA 4F45A 5LOVA 2AMFA 4Y6SA 3KS9A 3WLFA 3GLFA 2L69A 4URHA 4GW3A 3NBFA 3GEPA 4B9EA 1C7RA 4KSYA 5DMHA 4ZVRA 4W7HA 3MTDA 3KOUA 2H4XA 3WLIA 3FKQA 5FLXA 4MP6A 2I4IA 2YFQA 3IP3A 3ILYA 4FYJA 3UVEA 5JNVA 1RYMA 1IEVA 3NDBB 5KYYA 4BNMA 2F62A 1GTSA 1FDVA 5FBVB 4BFWA 3RIRA 3VU1A 2ASEA 4HD8A 4HDMA 5HCUA 5TJHA 2NTVA 3RS4A 3TGWA 5E0KB 4TKUB 3U39A 4QREA 2X0EA 4K9QA 1NVUQ 1XC7A 2HCRA 3EIFA 5TXGA 1DXHA 3STHA 4KPUA 1AKUA 1H1LA 3H7AA 3KJFA 5FA6A 5I9IA 1AZLA 2DQ3A 2IP4A 2Q2QA 1X7HA 1MIOA 3AW9A 2Q07A 2OEPA 1ZOOA 3R9KA 1JGTA 3JYQA 4MR7B 4DUGD 2JGNA 1QGZA 2WF9A 4X91A 5LXTF 2NAFA 1GU0A 3GH1A 4LZNA 3R0JA 4JH0A 4LVIA 2WTXA 2AOUA 3KU1A 3NU1A 1R8XA 3G5LA 3ESQA 5KAMA 3SE7A 4KNYA 4A1FA 1LA2A 4YJ3B 3WQZA 2VHCA 3IEIA 5JBQA 5D01A 2WTMA 5TS2A 1QIMA 2PTGA 2XSZA 4PSVA 1RYEA 4ZEXA 1VB5A 1XIVA 1KY2A 3H11A 3NGLA 5BW8A 1MX3A 3QJ5A 1JQBA 2UVDA 1J99A 1G8YA 3LRPA 1LKZA 4KKXB 4K8RB 4O29A 2NXWA 3TLZA 5JAPA 1VJTA 3QUAA 2P2YA 2J31A 2J59A 2XKBA 4GVXA 4MPPA 2AD5A 2YWEA 3VQYA 5EKSA 4JQCA 4IOMA 4LJ9A 4AYTA 2NV2B 5FL7A 1PGNA 2BH9A 3GO4A 1VYTA 3KYCA 4PC3A 3QOYA 2PL3A 3LA8A 2P9FA 3RKUA 4LQDA 2VYVA 4BMPB 3HZZA 4I0WB 3UK7A 3FTCA 3SKXA 4KX5A 4V3CA 3GK3A 3NVMB 4PZDA 2VTKA 1C8BA 2C5HA 1IN6A 3IV9A 4DLUA 1WRBA 5T4EA 5T4BA 1KDVA 1XALA 2JVIA 3DE2X 1EZ1A 1X9IA 3FAZA 3PUIA 3R5SA 4WA8A 4FDLA 2FPLA 2FWPA 2FPGA 221PA 1GA4A 1V48A 4XSVA 2QMOA 2W2KA 4EG8A 2JHGA 2O2CA 3BTUA 1JR3D 1TIKA 3QQPA 1I7SB 4OIFA 3MJEA 1YVPA 3S5UA 5EP2A 3W78A 3U3JA 3FPGA 4FFWA 2A4KA 3KQKA 4HEA1 2JAPA 3OEED 3PP8A 2FQYA 2W37A 3GVXA 4UD2A 4F86A 3JALA 3KOZA 3IXMA 1FBNA 3A28A 1P2DA 4YJHB 4IDEA 4LC1A 2XGJA 4YO7A 4Y0VA 5AK3A 1XAJA 4L28A 2B1QA 2YVKA 4WNAA 2NUAB 2D0OB 2RH4A 2XCTB 2JJMA 1WXQA 1YBAA 1MN6A 3Q7RA 2WMYA 4X3CA 3WSWA 4XUDA 2JDID 2C4VA 5IJ9A 2GVNA 3IERA 5TMBA 3AFNA 4WMLA 3STVA 5JH7A 1KIAA 4UJ3A 5SZKB 3B2NA 4WLFA 3DA8A 5EIWA 4IVNA 1AUOA 1T6ZA 2DPYA 2OV1A 2Q3FA 3DUWA 2XNCA 3O1LA 4IGAA 4LMRA 1OHHD 2O1WA 4EARA 3E1GA 3FFXA 4ZT6A 1FP7A 1PWEA 2Q4TA 3GLIB 1UFKA 1QYIA 4OKIA 1HQYE 1OV6A 2SNIE 3T99A 1CU1A 3V7NA 2VIIA 1NYLA 2ASVA 1KGSA 2VEDA 3NHPA 3EBLA 2OXRA 3PDHA 3VDNB 1IZZA 2X2PA 3DHWC 3KLPX 2DULA 3R40A 1SHKA 2IIPA 2EX4A 2JBHA 3L4SO 4CMKA 1YJQA 4L0MA 1VPLA 2P3QA 3RRBA 3TCXB 2Q1UA 4NYIR 3WDLA 3BD6A 4H2TA 1EVYA 1QDUA 2NU6A 4OJNA 3WBJA 3ZD6A 4MR9A 1YC2A 1SIUA 1XYVA 2J85A 1SUAA 3JS5A 3NWJA 2GYWA 4KMRA 3GG9A 2ABWA 3QFTA 5H59A 3RNOA 4KLCA 2UVQA 4QBIA 4LKOA 3QLTA 2EERA 1X3SA 2GK3A 4MR7A 1Q15A 1ZMRA 2ZAYA 3PQEA 4NQRA 4DA6A 1QHSA 3QWAA 4CMGA 4DWVA 3TNFA 1VFNA 4D9KA 1UKBA 10MHA 5KSZA 3LF2A 1YQEA 2DHDA 2ZR8A 1QRRA 3IELA 3KEMA 4PX9A 4ESHA 2XMCA 1W48A 4YP0A 4G1EB 2C20A 5H9VA 2OP0A 2ZUUA 3F1LA 3H2HA 4QUHA 4F5WA 4BRZA 5JXJA 1N2OA 2Y4OA 3U1BA 3HZHA 3V7SA 1AQ6A 4Q1EA 2VYQA 2JGEA 3NAMA 5H4GA 5L4LA 1HF3A 4K9KA 5KVAA 3IR7A 2PSHA 3A4LA 3RU7A 3NP9A 1Z4NA 2ZZMA 2W0MA 4RD3A 3HB4X 3SS8A 1R0ZA 3GPLA 1NTRA 3INYA 2B8EA 3O4VA 4BDSA 1HDZA 4NICA 2VF4X 3FR7A 4XUGB 3RJTA 3RVOA 4NV0A 4TMKA 3V4SA 4D99A 3ENWA 2J9RA 2BFDA 3FGPA 1NXOA 4V2IA 2P11A 2B99A 4A4DA 4KKVA 1EVZA 1QLWA 2H07A 1U1DA 1UFQA 3TWOA 1FJHA 4AZTA 5B2EA 1TTTA 1GG5A 3TLCA 3BL5A 1XQ1A 2X22A 2CMKA 2YCLA 4RTPA 1PYGA 1Z26A 3G8CA 2GARA 1FVFA 4P3NA 4P72C 1Y81A 3KSUA 2IPAB 4FIZA 4G9GA 4K9DA 4NDZA 5CIQA 4AH6A 6LDHA 3JWGA 2IU6A 2W71A 2XPCA 1VPVA 4HB3A 2WM3A 4I50B 4FGZA 2QY9A 4Q34A 2O14A 4FT2A 3TIGA 2QJTA 3JQBC 1XLVA 1G20B 3NHUA 5DBGA 4UMDA 1KH1A 4LOAA 1IY9A 5DBEX 4EVSA 2DTIA 4L57A 2QA5A 3HRKA 4RPJA 2Y1LA 3TG2A 4FMDB 2NXEA 3ONDA 2A2ZA 4YJ3F 4XX0A 1SIOA 2GJKA 1RZUA 3SYTA 4TXLA 4YA6A 5DWQA 4M83A 5HRCA 3PF9A 2A9VA 1KORA 4GWLA 3P9QA 1EWTA 2KX7A 3E1KA 4EUHA 4HLNA 2CCJA 4TVYA 4J7XA 3LECA 5C1PA 1AMNA 3TJMA 1NRWA 1R0SA 4WGGA 5B6PA 1BW9A 4RQTA 1MEEA 2XYGA 4QYIA 3ED5A 1MQAA 4P1ZA 2P78A 2WMNB 4I2VA 1YZLA 2I55A 4NNOA 3QXSA 3VZQA 1T1EA 4X66B 3EFBA 1A9ZA 3VR4H 4OJTA 3SKYA 1I2AA 5A4AA 1OKKD 3QVVA 3EMBA 3RIYA 5AESA 1RHQA 1FE8A 3KC2A 4X8LA 4JFRA 4S1NA 1JU3A 3NOOA 3CN9A 1H2YA 2NO5A 3EY9A 4J1SA 4MXDA 3DE4X 4DLRA 5B36A 2M32A 5KTNA 3L6RA 3TZLA 4OH1A 1H65A 4O33A 3ST7A 1GGEA 4TVKA 2O48X 3TLGA 4FR5A 4ZV4A 1Q22A 3ESBA 1R0WA 2IY5A 3VC2A 3X1DA 3GLGE 2QSYA 5LDHA 1E3IA 1PR6A 1N2BA 1C1DB 1VYUA 3DVSX 3GRKA 4B3SB 1F20A 2JHAA 4LDRA 2PUWA 3ZZMA 3TG8A 1VA5A 4WNIA 4ZAXA 1FRFS 2PUAA 3CN7A 4FMCB 4PRYA 4BC1A 1IL2A 4XJVA 3WK5A 4HF7A 3ZHXA 3EXIA 4F4UA 1XTQA 1IIRA 4O2AB 5TMPA 3EFOA 4QAJA 4DDUA 1YQXA 1ACJA 4YRSA 1J2EA 3TNYA 4RKFA 3S81A 4RVNA 4HFMA 4MPDA 2QR2A 5IPFA 2CL0X 4XYBA 2PA3A 1EA5A 3OZTA 2W2LA 3IVAA 1W34A 1VFPA 4RXMA 3ZCXA 3D9QX 4G41A 4DQKA 1GTRA 3TR6A 3EC7A 8AT1A 5KJEA 4JJFA 2F3RA 1ZD1A 2QX6A 3AC0A 3UT0A 1N9WA 1Y9DA 3GGCA 3CZCA 3ZYCA 4DZZA 1QIFA 2FN7A 4OP3A 2OPHA 4LNUB 5BN5B 4BNYA 4LPKA 2OAP1 1TL7C 2VATA 3HI6A 3Q7PA 4X5OA 2VR1A 3CF4A 4Q4HA 1K7EB 1QGOA 5K4HA 4TV9B 2XYHA 1UKVY 2Z4TA 3BILA 4CM6A 2CJBA 1VBMA 4D5GA 5KOJA 1XT6A 5CDYA 1T4MA 1XTVA 2PX3A 1SHUX 3B1ZA 4XLTA 4X1KB 4ZYWA 1IHUA 4TKVA 3RW9A 5HZMA 2M6KA 3HA5A 5ALFA 2ORYA 3KLOA 2PZLA 4GLFA 4EM6A 3ZHQA 3KK0A 1ESDA 4UAUA 1EVIA 1CDEA 1PE0A 2Z9DA 3FMVA 3A3OA 1QPGA 1KK2A 2R86A 1PRYA 1DJPA 3HADA 2PUDA 3J81k 5BYBA 1TJNA 3W05A 4XCXA 5F9HA 3ANXA 3D02A 2XBUA 4FD2A 3KTAA 4JELA 4ZOBA 5EIOA 5EZSA 2FCAA 5IKEA 1IQ0A 3OQ1A 3F1KA 3PQ6A 4WZAA 4MMZB 5CFQA 1C30A 5HF6A 1ZVQA 2H52A 1XZHA 3GCXA 1N2SA 3HJNA 4DY4A 1S7GA 4L5BA 3D4IA 3A9SA 4UVIA 1ZRMA 1QVZA 3AIKA 2AIRA 3C3EA 3QNWA 3A3KA 4HRAA 3VQTA 1YMUA 3KBBA 1Y4ZA 3A1DA 3LWNA 1B15A 4Q4LA 3WKDA 5CJPA 4JB2A 1RPZA 1MUUA 3HDVA 2QNIA 3HYNA 4A23A 1KOFA 2C9OA 1IN5A 2V6JA 3M81A 1EP1B 1CJKC 1W35A 2FX5A 1X1RA 2BGLA 3ZU5A 3NHWA 5TPZD 1ABEA 2JIBA 2ZJ2A 3H9BA 3W06A 2YIJA 3FOWA 4XWWA 1UWKA 2Z83A 1E7YA 3D8TA 5IT5A 5LQNA 4YV2A 3LW7A 4ZYZA 2I76A 1FFAA 3RU2A 4BEBA 3VAZA 2XZPA 1WVMA 1XF9A 2PN1A 3AUSA 2QRMA 4H4CA 1VPTA 1SH7A 4NG4A 4Y18A 2AF4C 2B5VA 2Y9PB 4DMFA 2N42A 4WI1A 1HFWA 1P3DA 3HCBA 2VJCA 4HATA 1ISFA 3KQVA 1NW9B 3KX2A 4PYRA 3RAFC 2XYQA 1G6OA 5AQEA 1CQIA 3AYZB 4L4RA 4MYCA 1I9GA 4UNSA 1KZ6A 1N5IA 1X3LA 3D0RA 5CFZA 1WF6A 1WHSA 2I6QA 3KJNA 2GXAA 4JR1A 2IOQA 2WD7A 3CO5A 1SKAA 5IXYA 3NANA 3PJEA 3O6VA 1X2BA 2JCSA 4W5QA 1HY3A 2JFNA 3PGKA 2HU7A 3OTGA 4YCSA 1SUDA 2I22A 4Q7QA 1ODFA 4MVJE 1U0BB 1NT2A 1TUGA 2QUAA 1RQPA 3IQDB 2HK9A 4QULA 5HCIA 5K3OA 5J2TA 2W4QA 3HCAA 3LWZA 1DIBA 4IQ4A 4X90A 3CTPA 1L3IA 3NELA 1MNQA 1G5RA 2J9GA 3PGJA 1E22A 4PO8A 4Z7OB 3L4KA 2AC7A 3ZXXA 2VAVA 3U4CA 4CKYA 1VLVA 1JMVA 1TQ2A 1DZIA 4OSOA 4WN9B 5D5HA 3MFYA 1GU7A 4F12A 2C0CA 1TI7A 3P96A 4ZVKA 3ZDRA 1BCRA 5EVCA 4EG3A 4FEAA 1EUZA 4LGMA 1COZA 3WLAA 5K09A 1U1EA 1HLPA 2B3DA 2I66A 2R1TA 3AOEA 4Y2TA 4DAOA 1Y4DE 2ZVDA 1J5WA 5FFNA 2I8AA 4FUQA 4BNXA 4BU1A 1E92A 4WUVA 2DEUA 1AB6A 2IHJA 5AMXA 1P0IA 3JQFA 1KI9A 2Y66A 3HACA 4L9AA 3KXIA 4ZZ2A 2DEQA 2O2EA 3GC6A 2H18A 3DJYA 2VH1A 3EGWA 1FPMA 5CH3A 2DUUA 3WISA 2GDJA 2GJAA 1SQSA 2WOOA 3OCCA 1D4ZA 1JZTA 4KITB 3MWEA 4LXGA 4ENTA 4PSCA 3CKMA 3J80A 1WY7A 2PSFA 2CY0A 1DOAA 2CNOA 1XVUA 4XGNA 4ZDJA 2J41A 5FOUA 2H1RA 1UANA 3KTAB 2PL5A 4CQJA 4ZVVA 5C5CA 4IIDA 2JBAA 3EE6A 3D2BA 1XTUA 5E9JA 3B70A 1SOWA 5IJZA 2RH5A 2ZT6A 2G07A 1A5TA 1QS0A 1SBIA 3DMGA 1SBNE 1NUSA 2WA2A 4Q1VA 2P2DA 4QNMA 4GR4A 5G4KA 2XUAA 3C2QA 4CDMA 3D7NA 1PN3A 3K4QA 3RADC 3CR8A 3V8QA 5A6VA 4LKRA 3LC7O 4MGYR 1MRZA 1V25A 2FWBA 3K4PA 3ICQB 4PZ0A 5F12A 4WBNB 2NSJA 4CM9A 5KYTA 2FEOA 3QEBZ 2OB2A 2QMUA 5HKOA 5HWSA 1E58A 2FGKA 5K8CA 4DDMA 3VJRA 4MVJI 3X44A 1KYZA 2YMPA 3B6ZA 5ALHA 3G82C 1O0CA 3DQZA 3I52A 3MM4A 4MAAA 1A9RA 1DKPA 1OI4A 3G85A 3GJ5A 1O6ZA 3I05A 3KHTA 4M1ZA 2MHCA 4OXRA 1LLCA 2YNMD 4C07A 3MS4A 1DQNA 3OPVA 5DHQA 2NXCA 3TPFA 4UBNA 1I30A 2ORWA 3ND8A 4G5YA 4ZGBA 2GWHA 1U1IA 1N75A 5D3KA 5D6NA 5E1MA 1E0AA 3H6HA 3ZZ0A 3TOXA 1EDEA 1GVNB 4WLUA 1SHTX 4OD0A 5B7QA 2ZYTX 5C81A 3FY4A 1FLAA 4FN5A 1ZUHA 3OJXA 3AUUA 1P4RA 4P71C 4YAOA 1LSUA 1PBNA 3UJCA 4DBVO 3EDQA 1P2GA 4ZIRB 3NHZA 1SHLA 4NOMA 4MWDA 1VZ3A 1K5HA 2Q2WA 2AOVA 4FB4A 5JNRA 2BTOA 2H2HA 3C6YA 1I10A 4K8OA 3M4ZA 2POQX 3PKIA 2C78A 2GK7A 3G0OA 1E62A 1ESCA 1FW6A 1ESNA 2LPMA 2WWRA 3U4QB 2DDZA 4FYVA 3WLEA 3FOZA 1NUPA 4HAWA 4ABYA 3ZH9B 1OGJA 4ZJPA 3TNJA 4EBFA 1W4CA 3BB3A 1E99A 3HXUA 1Y0BA 3V9PA 1CY1A 4O0MA 1QRSA 1GTJ1 1XOIA 1CDOA 1WPRA 2QN7A 2LV8A 3V32A 3WJ1A 1TUBA 3G0CA 1U7OA 1KQOA 3NYWA 1KDPA 4FYKA 4IHJB 3RC3A 4AZVA 2XGSA 1VGQA 2QQFA 4Q3NA 5IJ9B 3F6BX 3M82A 1V7CA 1DWOA 1OT3A 1HV8A 3DOFA 3FOCA 5GOZA 4DYHA 5BMVA 4B2IA 3GQBB 2PWZA 1RWVA 4Y67A 4MKIA 4M0DA 4L4UA 1I9CA 1X1AA 1P73A 1V1MB 4WL0A 4XIFA 4R68A 3UY4A 2E1PA 1QM5A 1ESEA 2W90A 1PFYA 3GFRA 3HB5X 3LOQA 2D5IA 1NMQA 2YV3A 4BO0A 3AL2A 3IODA 1EWQA 5CU7A 1C3JA 4NU5A 1U2EA 3BCRA 3NETA 4KO2S 1F2UA 4PPNA 2P9EA 4QU0A 3FSJX 3BXPA 4UVDA 2EKBA 2B20A 2JEYA 1DIOB 3R4VA 4W9NC 4RA9A 3GAMA 4Z2YA 4CN8A 4F5DA 4XRGA 5A3QA 1W0CA 3HKDB 3L8ZA 3ZG6A 1BDMA 1I1NA 1M6EX 1V1RA 1ZH6A 1E2MA 3NORA 4HNSA 2QU8A 3MF1A 1IHPA 3EOBI 1GYQA 4RLQA 5EOVA 4A36A 3A7DA 2O8FA 4FKZA 5FI5A 2XDAA 5JASA 3WK4A 1XCJA 4TN5A 5EJFA 3GGJA 3GT0A 4AU1A 1BBWA 1E2GA 4N18A 3MWFA 3SM9A 3QU2A 5E4JA 5JWHA 1CS4C 4BWYA 1PDOA 2I3AA 2JLVA 2FMTA 2IHYA 1ONNA 5K0EA 3GA0A 3WLQA 4XEUA 4TQFA 4A6EA 1BXRB 1QLHA 4Q82A 3VTZA 5DWVA 4TWIA 3KT6A 1VL8A 2V6BA 4I14A 4IINA 5AI9A 3G7NA 1HEYA 1VJDA 2CD9A 5EJ5A 3CLHA 1Z6TA 1W19A 1W46A 2PRSA 1QBGA 3ZGLA 3BL8A 4UCWA 5KKAA 3RG2A 1BWSA 5E8JA 2B7LA 1M7HA 2DT8A 3EDCA 3DLBA 2ZRMA 4D25A 3A4NA 4LAFA 2N46A 1IB6A 1US8B 2O7QA 1UBSB 4KH0A 5HGJA 2DBQA 3PKZA 1FFWA 4B87A 1K89A 2PZ8A 3QXJA 4Y2YA 3RSGA 1EG2A 5LP6A 4EJSB 4DVJA 4JENA 3DEKA 5AI0A 1GRNA 1O96A 1OLUB 4DLSA 3DLCA 3OE1A 1KDZA 2ZUDA 4E0BA 3I2GA 4L9WA 3FKSD 2IZ0A 1F12A 3W7VA 4ZDIA 3ORHA 1RAHA 2P4QA 3KL2A 4MQEA 1HH4A 4DIUA 3GT7A 4EF5A 1C2YA 5A5GA 2VTBA 1A4IA 4YO8A 3Q9LA 2RGBA 4ZOLA 4KPFC 3ZQ4A 1KRWA 4GX2A 3T06B 1CWUA 2VP0A 1VA4A 1ZL2A 4A6PA 3OBIA 3PR3A 1L0WA 2Q45A 1V7PC 3GLRA 2BR5A 4FFLA 1WOYA 3EZGA 4OHOA 5AH0A 1JZQA 2Q5EA 4I8DA 2O3SA 3T9BA 4M46A 1ZVJA 1Z82A 1UZLA 5H83A 1SUIA 4QVGA 1P7WA 1XV5A 3SZGA 2ETVA 3V6MA 4DBLC 2XTZA 1BS1A 3WGLA 1Z5OA 4PNHA 4X60A 4G2NA 3WR5A 1U4NA 4M8IA 4DMMA 2OBBA 3GRPA 1XI2A 1E20A 2X0JA 3HLYA 4G4IA 4PZUA 2XE4A 5BOVA 4LDAA 3FVTA 3HGMA 2PBRA 2QSUA 1JTFA 2DCMA 2ZJYA 2BGMA 1SQ6A 1QH8B 5CLQA 4JQOA 2AQHA 2DTEA 3K1AA 3AUXA 2GRJA 5L3SA 4WZAB 5I4BA 1OPRA 1AVTA 1G64A 4EYEA 1IAQA 1ZVVA 5ADHA 2ZQ5A 5C8YB 2WVJA 2FUEA 1F2UB 4MW2A 1P6XA 4V2UA 1NKVA 2VWQA 1G66A 3R41A 5DI3B 4ENPA 5AM4A 4L3WA 1VPEA 1PNQA 2XKKA 4P72A 3E5NA 5LA6A 2RGNC 1UIRA 3OQIB 4BGUA 5CDFE 3ICEA 2PX8A 4OJKA 1AKMA 5HNKA 1S1MA 2C5LA 3ZW7A 1JB1A 4D81A 3ER6A 3M9WA 5L4SA 4HWTA 4GSKA 4MIOA 1EOVA 4RA6A 4A0GA 4GZ6A 2NTNA 1LH0A 3OCXA 4RX1A 4FWIB 3DMYA 1S8OA 2WF7A 3TD6A 4EKDA 3WRXC 2XNSA 3BKXA 2WB2A 2ZUBA 1FYWA 4L72A 2IGTA 5ECYA 3KQHA 1YMQA 3HCCA 1WJGA 3PIIA 1AZSC 1QFSA 1TYAE 1TF2A 2Q62A 2W93A 1A8SA 2WHPB 4FYYA 4B8WA 4BPRA 4FGKA 4NEHB 2FFHA 1BROA 4KLNA 2EJTA 3LHDA 1XMXA 2O0KA 3LUDA 2NU9B 2TMYA 1UODA 2A5LA 2OYSA 3ROEA 1BIFA 3GP8A 4E21A 4GSYA 1YAHA 1G7TA 3M1AA 5JTUA 4UEJA 4ZO9A 3TTWA 2QDXA 1L4EA 5IJAA 4YCCA 1UJBA 3E22A 4EBBA 5HKAA 5JNTA 1IXSB 4UM5A 3SYKA 1VJRA 4A0RA 4X45A 1LU9A 2YXPX 3DZJA 1US8A 4RGQA 3U17A 1QORA 2OLKA 4EQ6A 3P7MA 4M0CA 1BN7A 2QYTA 4Z4FA 1JYEA 1UEJA 5DT9A 5NULA 1KTIA 4OFWA 5FKJA 2NIPA 5BWMA 2QX8A 4JN6B 5GGXA 2FPOA 2XEDA 3F49S 2QW1A 4YY3B 3ZWOA 4RDCA 4TYYA 4U5XA 1ZXXA 2PSSA 3UF0A 3NTLA 3CB2A 5DTRA 1Q7TA 5LQCA 3E9IA 1GFZA 4KU4A 2IW1A 1J06A 1T2NA 1C30B 1L6RA 5DIZA 5TQVA 4Y1RB 3SC2A 2PLWA 2I99A 3HUTA 3S2YA 1QV9A 4JSYA 4MB0A 3HJGA 4TQAA 3FDZA 4BVLA 3RVDA 2PMDA 1REQB 2ARKA 3T3NA 4V0QA 4N1AA 3IT3A 1BX3A 2QAIA 2WT9A 2H16A 4DLXA 5ITVA 3OFSA 3Q87B 4TWAA 3H9QA 3RYFA 4D02A 1KBQA 5J58A 1MA0A 2D1RA 2N75A 5EYPB 4WD3A 4FHEA 1U2TA 1STOA 3GJYA 5ITSA 3ZOZA 2A3NA 1G3RA 3JSAA 1AU9A 2WILA 4N0PA 2BKAA 2GOYA 2YWHA 2ZUWA 1MLDA 1U0FA 4RVGA 3UW3A 2P1RA 4YRPA 4DXAA 3QELA 1KE1A 2IDMA 2XE6A 4TV9F 2I4RA 5KQPA 1SWVA 3ENNA 3KB1A 5COQA 1C7FA 1E8MA 1UJ5A 1UMDB 5FUQA 3ZS9A 4FMPA 4P5PA 2HA6A 4HJXA 4U6SA 1H2FA 5FBWB 1E79A 3LBYA 4AZ3B 2J09A 2FFQA 4C6HA 5AHOA 3SN6A 1SPXA 4MRVA 2X8JB 2ZKLA 4JT9A 2VT7A 5H5JA 3DTVB 3AOGA 1PSDA 3TQQA 1NNLA 1GZ5A 1P60A 2VRBA 2XB8A 2V9PA 3DOIA 4MLCA 5DYGA 2EJUA 3MEQA 3PICA 1A95A 2QT9A 1RYHA 3BJMA 3DAPA 3OFKA 1HE4A 2HK7A 4M21A 4XYEA 3ZI7A 4KYTA 5EAIA 5IUKC 4M36A 5HVNA 1YS7A 3D6FA 1T4DA 3ETHA 2FRDA 3G02A 2F48A 3DTTA 3I92A 3KOMA 1KVTA 3JY6A 4N7JA 2B6HA 3GZTB 4U0KA 1PX0A 5EIHA 1AO0A 4PICA 3N2EA 1TZCA 2HBYA 1XZJA 5JSQA 3PPWA 1QCZA 1TM7E 3L8EA 1JLMA 4HAUA 1DIAA 2X15A 2C77A 3PQ7A 3QWIA 4JC8A 3C5WP 4KVFA 1RR6A 4KP7A 5DRTA 1SD5A 2SHKA 2WJIA 4WN9A 4TQDA 5E7IA 2AV6A 3LUJA 4EG1A 1OHHA 3EXHA 2HRZA 4F3NA 2WJ4A 3LT2A 1GV1A 1PL0A 4M8NE 5ALOA 3K53A 2QIPA 2R7KA 5FUVA 3W5SA 4PN3A 2IXTA 3B52X 4M0KA 5I5GA 3DE3X 3ZGYA 1PHPA 3QXCA 3CLTC 3VR6A 1ZO8A 4C4AA 1Z5WA 2Z5FA 5A1JA 1CJSA 3FPCA 4FNAA 3RWBA 4QOFA 1KAHA 3MIIA 1BVRA 1U0TA 1Q83A 2VZ9A 1FOEB 1RC1A 3QG1A 2A0YA 5LYJB 5F5LA 4F4IA 1JQEA 2D3TA 4B0PA 1J5PA 2FP3A 3DT8A 5KINB 4DR1B 2A5DA 4UMFA 3BVPA 1EIYB 1ZOPA 5JMPA 1F06A 1DSSG 5BRNA 4FB5A 5AR1A 4PQFA 1Z12A 2PO7A 4QJ3A 2ZRJA 3CONA 4R2JA 1R0BA 5ER9A 3VVMA 1SB8A 3EVAA 3JRNA 5CITA 1BYUA 1ZHFA 1NU6A 2OVBA 3I28A 2NVWA 3FCXA 4Z0HO 4UUAA 5DVZA 4ZODA 1KIMA 1LBQA 3UHAA 2PPLA 4W5HA 1GAWA 2IF0A 4Y1RA 1YB1A 3BA1A 5JSKA 1MABA 4CLOB 1KDYA 2ZUTA 1Q14A 3EISA 3WYGA 1ZZEA 2AC2A 4JLDA 2XDQB 1EH5A 2FLKA 3ZGNA 2Y27A 4P3KA 4RQBA 2ZRCA 2GBPA 1OPXA 4EYGA 3R74A 4GZLA 3V9AA 1JDSA 2G80A 1LBIA 1ZGCA 5I4KA 1NOJA 2PKXA 4LOKA 4B6SA 1SU8A 3QX8A 1KFBB 3AR4A 4G5SA 4RMGA 1V2HE 4EMUA 2C7RA 4BPBA 1E1NA 1UF9A 3DE0X 1PJAA 2PBFA 3ZCQA 2HT6A 2G4CA 5F5WA 3L0CA 1E2BA 2I2DA 2PMFA 3GYGA 1A9OA 4LE0A 5CMLA 4R7GA 3X1XA 4GPD1 2QJFA 4AMVA 3MD0A 1YBHA 2YBEA 1C50A 1N5LA 2H7VA 4J91A 4OL9A 3G0IA 4KPUB 2AOTB 2HA5A 1GNVA 1N6HA 3LC0A 3LDHA 4PLGA 2ONCA 4XIGS 3RNLA 4CQMD 1L1RA 1Y7TA 1IC6A 3V2IA 5CA1A 1NMXA 2WWWA 3VAAA 4Q3LA 2D1QA 1FDSA 1DCKA 1NNSA 3IGFA 4DMHA 2E7ZA 4Q3EA 4PNEA 3R5TA 1RABA 3WAJA 1UBUS 4KOAA 2FWRA 4CF7A 2IUSA 1N1DA 1XZAA 4HI0E 4OXKA 5CCDA 1XAHA 1R10A 3R0VA 4JB8A 2B78A 1DPGA 3RUPA 1XEAA 1FYDA 4RTSA 3SJZA 1IM8A 1EQRA 1T8PA 3MF4A 4MB2A 4DILA 3E82A 3T34A 4B76A 3SNKA 3ZLJA 3U9SA 1H9BA 1KZGB 1QIJA 2J6HA 3AV3A 3PUJA 2P6NA 5K1PA 3ABSB 2QL9A 4XFJA 2Q5IA 3CEPB 2CFCA 2ZINA 3OU6A 4DUGA 3WMEA 1IN7A 2QD3A 3IV6A 3N0RA 4GEGA 4A1OA 3TVDA 5LR6A 4HTFA 3U3XA 3RR2A 2X40A 2RBEA 3GLHB 1E9EA 3ZGOA 4N76A 1NN3A 3W6PA 1EVEA 2ZYUX 2RHLA 3O26A 3VNUA 2CL6X 3EOZA 4I4TA 2PANA 2Y2UA 1F3OA 1W2WB 4XGQA 5IBPA 1XP5A 4EKGA 3NIWA 3WA7A 5K6RA 5ILQA 1KHHA 2XMBA 1ZXLA 5EJAA 3RC9A 3VR5D 2PUEA 3WGMA 5EIXA 1C8VB 4XOUA 3MJFA 4EX7A 4OHBA 3ROTA 2H0AA 5FQOA 1D4FA 5FLKA 4R2KA 3B5IA 1SKQA 1F6WA 3L8CA 5I7HA 1YR9A 1PS9A 1RHKA 4Q6WA 3AX6A 4XFDA 2O8DA 1K6JA 2HD4A 1P2UA 4G0QA 4HWRA 1KKUA 2ZBGA 4C5BA 1YB7A 3RHFA 5B1EA 1P72A 5LDDC 1JJ7A 3AF6A 4RJJA 3JQ7B 4I50A 3ZXIA 5EY5B 1QANA 3E3LA 1JYSA 4BX3A 3FTNA 3SJAA 4R16A 4O02B 2BEWB 3MWKA 4JITA 4XGRA 3S2SA 4CM4B 5IUNC 4INPA 1PR3A 5SZJA 3ZXYA 1SG9A 5F2NA 4HQKA 3CINA 1UM8A 1P5FA 1SKBA 1NKSA 1TK3A 2A58A 3JD3A 2J0VA 4GR9A 4MUXA 1MXHA 1N5OX 4OAOA 5THQA 3TOCA 3ZCPA 1BS9A 1FXWF 2WSLA 2PSJA 1D2AA 2Q5FA 3BSFA 4JNCA 4NC9A 4P36A 1TZ2A 5TVGA 2C2HA 3QEKA 3TCNA 3GVIA 1AXEA 2OCAA 4LDZA 4OSPA 2EWMA 1KPHA 3T5CA 4H2XA 2XKJE 6REQA 1N7IA 4HX5A 1WSAA 2MJLA 3GVCA 2QTAA 1MVNA 2V0NA 3QYPA 3K70D 4K9OA 4MB6A 3PBKA 3L1IA 2PWAA 2Q6KA 1P29A 1WULS 2BUAA 2VUIB 3BQ9A 4RETA 4ZALA 4KR6A 3L7BA 3MVEA 1XRPA 4GGOA 4MQMA 1E1RD 3TEMA 4Z86A 1L5MA 1MQSA 2MR5A 3NM5A 2ST1A 1KAQA 4G26A 4UQLA 1ZRNA 2YNMC 2HV9A 4GI3A 1XF1A 4QPJC 3H1FA 3F5SA 4GXTA 1NURA 4MVJH 3LNCA 1GUZA 3F47A 1KAEA 3TDKA 5IS2A 3HI4A 4PLPA 3DL7A 3GAAA 1BEUB 3QWFA 1XTTA 4BBPA 2B1GA 4M8SA 3O1HB 4OQZA 3U13A 4G8BA 4LDNA 1OLUA 1T15A 4IDCA 4RMFA 4NR0A 1IYZA 4UARA 4ZZIA 1K7XB 4XTCS 5CT9A 2EKPA 3RVMA 5CXSA 3TMAA 4EX6A 4F1KA 5HJ7A 1A9XA 4M1QA 4QLOA 3BGDA 2MSEB 3M5PA 4KQJA 5SY6A 2P9QA 4PO1A 2Y1WA 5BW5A 3INTA 3WQRA 4BVFA 1MB3A 2JLXA 1H4TA 1U7UA 2ZYSA 3T7JA 3GRRA 1E18A 3ZWPA 2OECA 2NU9A 1PX2A 1ESZA 2CLKB 2K2WA 3LT1A 4N47A 1M83A 1MDBA 4MZDA 3WO1A 5CFRA 5DP1A 3DR5A 2X5JO 5IKOA 3K1YA 2JIRA 3IQIX 1C3EA 4WERA 5H81A 3TK1A 3TS1A 4ZAFA 2FPRA 3WYFA 3K05A 3DNPA 2PMKA 3DVAB 4TTRA 1FY2A 5E6SB 4EO7A 1Q84A 2PFGA 3QEJA 1SPBS 4RMNA 3COJA 4F3CA 3BE8A 1JJAA 5DYWA 3RF1A 2I3GA 3HXWA 1HZJA 4OXQA 3OHSX 4JVOA 3OJCA 3ETCA 1RZVA 5JNUA 4HWOA 1T2FA 2R60A 1SZPA 3MD9A 3EVFA 4IEEA 5HIAA 3KETA 2B9VA 3G68A 3AKEA 4I6EA 4WZBE 4K0RA 2B30A 3OQBA 3T7SA 4CETA 1MU0A 2AFHA 4R2WA 1SUWA 3WIOA 1TA9A 2C3UA 2Q5CA 3CH5A 4JOCA 2CFRA 2A3RA 4NQZA 4HFRA 5CGZA 1R0RE 2JIDA 1Q3KA 1NMYA 1QUFA 3HHPA 3PQCA 1VCMA 3H5AA 4O4LA 1GNQA 5ENZA 1BJTA 4MDYA 3I53A 3QEMB 2YXDA 5LB4A 3N58A 3VYSB 4LI3X 1YQWA 4HQOA 1S1CA 3ASUA 2PRIA 3KVOA 3SQWA 2B21A 4IG4A 1LPOA 3DBIA 2ODTX 1M66A 3KXKA 1EJBA 5SYMA 3O2NA 3IMCA 3GUUA 4IGFA 4JSRA 2E6KA 1P5JA 3DMTA 3VR5H 3HCDA 3HXLA 1VRVA 1FTWA 3EQ9A 3P71T 4YREA 5E1BA 5JAMA 5ADWA 5JAHA 1Z8FA 4RLSA 5B58C 4YIKA 4BTEA 2GCNA 2JDIA 4E46A 4FD3A 3BHIA 3UK0A 1AA6A 2VWGA 5K99A 3DTNA 3CW2A 3H6GA 4MUGA 2YZKA 3ICVA 4NOKA 3VVLA 4B75A 5HK9A 6ADHA 3O8QB 4UHKA 5AVSA 3FYHA 2JFUA 5JVDB 1SQGA 4R1TA 3UAZA 1ZP6A 4JA2A 3BZWA 1U0SY 4KXUA 1S3GA 1LNZA 1T0JB 2BONA 4PIVA 3UWDA 1NBMA 1OVMA 3CNQS 3WJAA 3G5MA 3FHLA 4IHKA 4B6FA 5A1TA 4EZBA 2SCUA 1FXWA 3MEYA 4G1VA 4XX1A 2OV8A 3L6BA 4H6PA 2VZLA 3WGVA 2M98A 1MC5A 1P1FA 3X1YA 5C80A 3GUYA 3KB2A 4BX9A 4DUPA 4JJZA 5F5XA 2AVNA 2HBRA 4BFCA 4C87A 5CDSA 1U9YA 1KWGA 5KDOA 1R9NA 3MMXA 3LS2A 2HF8A 2OV2A 2Q7XA 1GLVA 2OFWA 3DOEA 3K8YA 1VDMA 2BCJQ 2JGRA 4URUR 3OF2A 3ZV7A 1DIRA 1PHRA 4U7DA 4H60A 3VHXA 1B16A 4BNGA 2A14A 5K9ZA 5MN5A 2ZR9A 3W5HA 2C2KA 1R3DA 4BO1A 4JJKA 2GTIA 1A8PA 2C5FA 2G0NA 4DL9A 4J03A 4Q7LA 5BNWA 2JLBA 3NBUA 4AO8A 4FHZA 2EU8A 4OQMA 1RBMA 2VYND 2ODBA 4BW9A 1IH8A 4PFSA 1C0AA 1PWHA 1PTKA 3FVWA 2BT4A 3N7AA 1SVNA 4LV6A 1G51A 3W5VA 1EUCB 5HKBA 2CLSA 1JAIA 3H6KA 3IMFA 3AHCA 2WVGA 1UPXA 3BJEA 3GJXC 3EVBA 2CVZA 2WFLB 2DVMA 3R09A 1OX4A 5ECGC 3PL5A 5IYZA 2DFKB 2GVDC 3V1NA 1U63A 4WLVA 4JP3A 3EW7A 4LXXA 4R8RA 1PZHA 4HUQB 1T3ZA 1O77A 5DCUA 1BHJA 2OTCA 4YPVA 4NECA 4Z4CA 2GN1A 1OJLA 1YZGA 3IJEB 4R9SA 2PZAA 1WD5A 4URYR 2PZMA 1N7JA 2YX1A 3CMCO 3Q41A 2IXDA 3WXBA 4TLLB 4X97A 2XUKA 1T5SA 2FEAA 2XNDA 2NW6A 4WN3A 4ZXPA 4KBYA 4ZA2A 1GRQA 2VT6A 5HOQA 3IEPA 3FSEA 4JL8A 4YXWA 1E0SA 4E15A 1LJLA 2MINA 3ICOA 3OPYI 4L3OA 1J1IA 2IBMA 2OZEA 1NF3A 2JBAB 1DCFA 1VHJA 3KKZA 5ALWA 3HEAA 5K3BA 3WICA 3KKNA 3ZY6A 5KTTA 5ER6A 3ONNA 1XVTA 3MBOA 3QWBA 4ME6A 4YRGA 1MTZA 3WK6A 1P4JA 1RWKA 3TKAA 4BC0A 1AF7A 4ERNA 2OYCA 4L15A 4A8PA 5FTLA 3LCRA 2E4XA 3FZQA 1CFZA 1FNBA 1IOZA 3F9CA 3RO7A 4DJFC 1GNPA 1XMOB 2HPHA 5DOVA 5IMBA 3CCCA 3FPEA 3OPQA 4JC4A 3EMVA 1NQVA 2BI4A 1VL5A 1Y5RA 3AY7A 3E70C 5AJYA 1ZL0A 1ZEMA 3FKJA 3LWDA 4Z0TA 1MAWA 3VC7A 1UAYA 3DD5A 2H5LA 4JJGA 1VMDA 4D0LB 1O54A 1BXKA 3H04A 2BFEA 1OAKA 1WF3A 3A4IA 4DNFA 1DTWB 1NBOA 1LK0A 3NR2A 2R1ZA 2C5BA 1V3QE 4IDQA 1Y9ZA 1SXJC 1GR1A 1KJYA 1U3CA 1B7YB 1VJ5A 1Q1BA 3KVYA 2QQEA 3KAQA 1CVRA 2C4KA 1J22A 1JXOA 2V98A 5CX1A 2FUG1 3FUWA 4ZT3A 1TD1A 3D4LA 4BFXA 4K3UA 5HJEA 1Z6AA 4ZTZB 3KJZA 4ZEOA 1CEEA 1BIAA 5K3AA 3A7EA 5KNBH 2UUPA 4WF2A 2PH1A 3ILHA 3MGCA 1ZLXA 3DD1A 3BXHA 2F9MA 1TUEA 3HBFA 3KE9A 4L4YA 1JEQB 4PCUA 5K0NA 1SXJE 4V38A 2D2VA 4HDKB 1FMTA 2BKVA 4A2QA 3R6WA 2IOHA 3HCWA 2YV4A 4ALLA 1XHEA 2EX1A 5HQTA 3E9ZA 3O8OB 3FHJA 4W6QA 3GV0A 5JU6A 1JG4A 1Y3DE 4ZHQA 5A5FA 4Z1MA 4MW5A 2P90A 1Z0DA 3TW6A 3CUWA 3T61A 3NAZA 3WGIA 5I47A 5K7SA 3GI1A 3CEJA 3N87A 4ND5A 1CR6A 4QLAA 1Y9EA 1Z33A 1JQKA 2HPAA 2LVBA 3R6LA 4FX2A 2QAJA 4I4TB 3PDJA 5DXAA 1MABB 2NU8B 3ZBUA 1DHTA 3GFPA 4GC9A 3M5WA 4C08A 1J09A 2ZK7A 3ET5A 4Y7DA 3RTGA 2OXFA 4P86A 1I7LA 1L5HA 4W8HA 2HY7A 5K3FB 5HM6A 4IVPA 4J76A 2A5JA 2JZOA 3H1BA 4G65A 2F55A 5LQAA 1XTZA 1E7WA 2HC9A 4H0CA 4BO6A 2DWCA 1C3OB 4HT4A 1HC7A 2FZ5A 4V0SA 1SQ0A 2BGJA 3TZBA 5MGNA 2F1HA 3QPBA 4BO4A 3D4OA 3L7JA 2X1LA 2I9KA 3HJHA 4K6OA 1WNTA 4I5FA 3O4GA 5LLDA 3AVUA 2P4HX 1U2PA 4DCOA 2QUIA 1L5NA 2R3SA 3OJEA 2AA3A 3C6MA 4D44A 1B8PA 3MCVA 1USYC 4BLTA 3S2EA 4DPMA 3FOEC 1IBKB 4P3PA 1PS0A 1BDJA 4MH0R 3UMYA 2NUBA 3A6KA 4F60A 1PFWA 2JLCA 1EEHA 1G8MA 4TLEA 4UAGA 2CXXA 7MHTA 1EFVA 4OYYA 4XJXA 5HDQA 3OWXA 4DCNA 1ZR2A 2R6DA 2GD0A 5IN5A 2WU0A 3RIGA 1PLKA 5B3LA 4DLAA 5C9ZA 4F8YA 1J33A 1JMYA 3OUUA 4QBFA 4I1YA 3WX0A 1WP9A 3LC1O 4UOEA 5LNK1 1NUHA 3DVLA 3L0IB 1HE2A 1D5WA 2K87A 1ECBA 3KUDA 4A92A 3VTFA 1Q7BA 3QY0A 3T1VA 1GQSA 2EL7A 3TDMA 3WIDA 1FQJA 5AVRA 3MZ0A 1W75A 3KIPA 1DKUA 4ZT5A 1CP2A 1KO7A 4JA0A 4CKXA 4HYTA 5KQSA 5G0SA 3Q3JB 3D6AA 3JQ9C 4YHBA 1PP4A 1FDWA 5E95A 2QLLA 4R2XA 5JUWA 1SGWA 3B9BA 2XUPA 1AX9A 2WBLC 3CSDA 2JCXA 1RCTE 1YRLA 2V9ZA 3IS3A 4BMDA 4C6TA 3E5RA 1JWAB 2C97A 2XUOA 5ENVA 4C05A 5I48A 3BREA 2C84A 4RF4A 1JA0A 2G3YA 2VP4A 5CAEB 5KVSA 4J75A 3W9YA 5PNTA 2C2OA 2YWDA 3W3AH 4II3A 3CG4A 3P9RA 3FSGA 4TXJA 5AKGA 1XDZA 3W2IA 3MILA 4LFAB 2ZFUA 4UNQA 2Q2OA 2J1LA 3LT4A 5CM9C 1WHTA 5T8KA 4EATA 4O5AA 4D80A 5TGDA 3KSRA 3E7PA 4MV0A 1CUFA 2I4OA 1NE7A 3T52A 5IXJA 4NBNA 2TMKA 2CV0A 4GNKA 2OBFA 2YXLA 3U1VA 4C0SA 4HEQA 4NHEA 1EDZA 2FR8A 2OMEA 3CVYA 3PDCA 2HMWA 4CF4A 5IF3A 2C7OA 2BSQA 3K2EA 5CYGA 4RDXA 1JU4A 4FYPA 2XEXA 4LOJA 3KQYA 4X9XA 4AD8A 4D43A 1CK4A 5BWOA 4JGIA 3LSTA 1MGPA 1RKBA 2EFGA 1NX9A 3IIJA 4REMA 1CEQA 3QNEA 1GIAA 1UC4B 3ONVA 1B00A 4HDRA 4DZRA 5B3KA 5FT9A 2M6RA 3T7RA 3WNQA 5KJCA 1E79D 4YV0A 4Q05A 5E7JA 5E9WA 3RSCA 4EF6A 4YHHB 3BAFA 2ZS9A 4P4GA 1PZMA 4TUYB 2FSIA 1M7BA 3K4HA 2QM7A 3KWJA 1VG0B 3OOHA 5DGCA 1CJTC 2FUNB 4CM4A 1BQ4A 5B12A 1DVRA 1Q3TA 4RV5A 4AUEA 5FTWA 4TRRA 1YVRA 2AVDA 2P68A 1NLZA 3KOOA 3HFJA 3VKGA 3KVRA 3NAQA 1DB3A 3B60A 2GBLC 5C8ZA 2CF5A 5D6OA 3RFCA 2CNNA 4BFVA 2NMVA 1GG2A 1R6TA 2FPMA 3ENKA 4OM8A 2B4QA 4R2MA 2PKWA 1GT6A 2WM8A 4CS4A 3MTIA 4HMOA 3C7TA 4YJFA 1DT5A 3AF2A 2C8MA 2VJMA 4YV1A 4OYRA 3JQ9A 3CQ9A 1QV7A 4MGZR 2ROQA 3TZHA 3PVZA 3LBNA 3MWLA 3CH6A 3OTIA 1D2GA 1OTYA 3C85A 3AEZA 4KCGA 4M1EA 4QBTA 2OCKA 1TU0A 1Z7MA 2X77A 1V4NA 3TTTA 4L78A 4KNWA 3HXKA 2EV9A 5F7OA 3WLNA 1N6OA 4I1SA 3UO8B 3VJKA 4C5CA 5LZ2A 2LCFA 3A9WA 4G8DA 3EIOA 1L7XA 1ODTC 4MUNA 5IBCA 1HSZA 1L5WA 3VR6D 2EEPA 4GPAA 1XDBA 1CXZA 3BOSA 1OX5A 4LGCA 1VMEA 4UXIA 1EBBA 1LBSA 4EHJA 3HY1A 1JT2A 3EEYA 4IIJF 4ZYUA 4G0YA 4G1BA 1YS2X 1G3IA 1CF4A 1C3VA 3LCCA 4BL5A 2VYFA 5LA6F 3FHTA 2PUJA 2ZSKA 4XTYA 4P3XA 3ZNNA 2VDJA 4LZJA 3T5GA 2H48A 2XXBA 3QE4A 2XQJA 5IAKA 4DJDC 2JFGA 1J9EA 4YP5A 3ZD9A 1T5BA 3GWZA 2WAAA 5C1DA 5IVKA 5JG7A 4OBEA 4YT8A 3OOSA 1QU3A 1F2VA 1U5BA 2GYUA 4F3YA 4BWGA 5ALDA 3ABZA 2HFKA 5K0CA 1OI3A 4N5NA 2ZYHA 1J1ZA 3AEUA 1WETA 1ZJWA 1L4KA 4F6RA 3I45A 1WUJS 3E7DA 3GP3A 4GYKA 3DVAA 1UUFA 1XBTA 4H77A 5DXJA 5BSEA 5KTKA 4DV0B 3I8OA 3DV0B 1K6IA 4KRXA 2JLAA 3LXRA 2WJHA 4PINA 2HMAA 3RTDA 4MP8A 1VHWA 3HJAA 3WIBA 1FEZA 3EYAA 3LHFA 4ZV7A 3N8GA 2A1IA 3DC2A 2IUTA 1ETHA 2P9JA 2BKUA 3I4CA 4LV5B 2AJ8A 4OREX 3TKLA 3A2KA 3ZIDA 5BY2A 2HJSA 2IHTA 3OMXA 1XEWY 4YUZA 1RXCA 1FUIA 1GP2A 3K70C 4PEVA 4DCGA 4OOFA 4JLKA 3VZRA 4B73A 3BHJA 3KE8A 2EWWA 2ZT7A 1I4OA 1L1QA 1QV6A 4KGZA 4A8JC 5M7EA 2HBZA 1PKXA 3RF6A 5C5EA 4EYSA 1QHYA 1NI4A 4B7AA 4N3NA 4WOJA 2WWIA 5DGTA 3PNMA 1KSHA 4ZT7A 1EUQA 3MTJA 2O50A 4DQ2A 1X1DA 1ILWA 2PS3A 2VAWA 3HCNA 2ES4A 1B1AA 3FDZB 4BKOA 3NBMA 1WQWA 2FV8A 2ZREA 3F8TA 1KERA 3NJ4A 1PCXA 2AN3A 3JQDA 3OKPA 1R1DA 4TL7A 1FUYB 3L7KA 4C0WA 1T43A 4KQ6A 2VRCD 2VPZA 3KAKA 5JCXA 2FWJA 1SVSA 4Y30A 4ETWA 1AJEA 1CIVA 2P69A 4NOLA 1NP6A 5HFJA 1A8QA 3E5HA 3THRA 5HBRA 1ZIDA 3GXOA 2Q6TA 1F1BA 1V8OA 1SKYB 4MKXA 1E66A 5CNMA 2AR0A 3NYRA 4XDZA 3RS0A 2HWXA 4ENSA 4CCAA 1XAIA 2GM4A 1LI4A 4W5OA 4B34A 3RKXA 5E4TA 1JSZA 1GQYA 3ZHZA 2WSBA 3KEQA 1ZBDA 3DP7A 5DASA 4ZVTA 3QVOA 5F1KA 1W36D 1E6MA 2V0CA 3MJDA 4ZC1A 1QWOA 4BXOA 1CUXA 2GBIA 3CUUA 1CV2A 1TTQB 5HIJA 1GGJA 5DF1A 1TO2E 2XWSA 4FFRA 4N5DA 4PVCA 2N1BA 4GWGA 1VB3A 4M37A 1MX5A 2JJYA 1OFVA 2KLBA 5CLHA 5KTSA 3FUCA 3JQ8B 1T8RA 1R6UA 1AT1A 1V4VA 1G3MA 2H06A 4PV7A 4J2HA 2FTKE 1JU9A 4GXQA 4JVNA 4JJEA 3OEWA 2HIHA 2WWVD 3QF7A 1DLIA 2C98A 4KK4A 3A6LA 2JI4A 2BFEB 4LS3A 1G5IA 2VXBA 3DFKA 4RPIA 1MIHA 4BCDA 2B34A 3NJRA 4XU1A 3A7RA 4YCMA 3RV4A 4U7JA 4G8CA 2AL7A 2OFXA 4K9PA 4WCVA 2CLOB 5DGHA 4D8UA 5KTRA 2WINI 2QZ9A 2C3YA 2VDRB 1SHZA 4G5GA 3LL7A 2C99A 2EZ4A 1KA9H 4CHTA 2EHJA 3U6KA 3QO5A 4M9SA 4YIHA 3SF8B 1PD1A 2PDAA 2WFLA 1HDRA 1OI7A 4AMBA 2EBUA 4AVYA 1NDHA 3AJ9A 3DZFA 4K6FA 2P3OA 3HYSA 1U2DA 3ZWVA 2ECOA 3O4FA 5LYJF 2VZ0A 3SBEA 3C7KA 2AI3A 3TCKA 2C07A 1OR8A 4F9GA 1E6LA 2E85A 2Y1GA 4CLXA 3NDJA 4E1VA 3LPCA 3F3KA 2X8BA 5E4FA 2QTBA 1E3TA 3RT9A 2YN0A 3WP0A 3ETEA 1RPNA 4BP9A 2VT3A 4FM9A 1TLTA 5GMOA 2E55A 2X1VA 3GGGA 4NL4H 3WWOA 3PNPA 4CMBA 4NARA 5A9TA 1E2KA 1FU4A 1QK4A 5CBPA 3FHCB 4DR2B 3SJ7A 4JOBA 3HXXA 4HB0A 2FVYA 1UR5A 4UUPA 4C29A 2D54A 3IG2A 5BXQC 2JK1A 3I4LA 1AS0A 3IBCA 1MIOB 4O4LF 5AM3A 1YA6A 3IIIA 4PRZA 5EZYA 3TF5A 1LQTA 1XSEA 4IJKA 1U6JA 4RD0A 3ZZ1A 2DZ9A 5ABPA 3G9UA 1WMBA 3AT1A 4P75A 4J1QA 3INGA 4R0NA 3VBCA 5GV7A 4DG9A 2GI4A 1ZNZA 3BD9A 3KOYA 1K4MA 1QDLB 5CRIA 2C4HA 4KI7A 1KFEB 4AMZA 4TTIA 2R0QC 3CZPA 4RFVA 4AQ7A 4PSDA 1USIA 2CWDA 4KV9A 1HX7A 3L2ZA 1H8ED 4WXHA 1XXHE 1HRKA 5ALZA 1E63A 1W0KD 4G84A 1WNLA 3VGJA 2LR0A 2MIIA 2RGYA 3GFFA 3HP7A 2HIMA 1YE3A 3M6AA 3MUOA 4QYWA 3TQCA 3ZW9A 2QVYX 4JI8B 1N78A 1U8TA 3NJ8A 3P8TA 5EKUA 3FPAA 1E2DA 5CDFA 1AXRA 4JJ6A 1JH9A 3RQSA 5B1DA 3PCOA 1WW2A 1II0A 1JPUA 2ILTA 1PQUA 4J49A 3P9XA 2Z1MA 2CNWA 1T3LA 2HPZA 2ZZFA 3BXEA 1Q21A 5B1SA 2CFSA 4RADA 2ZKIA 3HMQA 3KYCB 1JYFA 1LTQA 5A9RA 4LDPA 3WZLA 4ZI3A 3CLTD 2ZIXB 2P2LA 3WBKA 3F4BA 5GZ3A 2F43B 4QHSA 1Q7GA 4ED9A 4AROA 1XCPA 4LVLA 4M9ZA 5FJIA 3VKWA 3T9CA 3R3JA 4FNMA 1M34A 3NS7A 1NDQA 4BO3A 2R00C 5HG0A 1ICIA 4PS1A 4OP1A 4EDFA 3V00A 3ZDAA 4R9UC 4UZFA 4JJIA 4CIXA 3LPMA 2IC5A 3GUCA 3HXYA 1CE8B 1LLQA 3E8SA 3II6X 1WXIA 4GS5A 3S70A 3WGYA 1WLEA 3G59A 3L0YA 3BWYA 4ID3A 4KE6A 3UB4A 6PFKA 1E1DA 5IU6A 2W2PA 1E0DA 3EPRA 4YCJA 2WE7A 1X87A 4PTLA 5HE9A 3ZHBA 5B55A 3FWYA 2HJHA 1D0SA 5IDYA 2M9MA 3F71A 3L79A 5TPWB 4CLHA 4QGAA 4BP3A 1DRJA 1E6WA 2P41A 4HYEA 1Z2DA 2XNJA 1CULC 1P1IA 1UJ2A 2YFYA 3TBKA 1PJQA 1EK1A 4RQUA 5LUAA 3OY2A 1T9HA 2MMCA 3DULA 4M99A 1A1VA 4TWJA 4G4GA 4GLBA 3QE0A 4GU5A 1VSUA 1E1RA 1OD6A 2OO5C 4DXDA 1A5ZA 3IJ5A 3MPUA 2VDWA 1E1CA 1H42A 1L1EA 1LPAB 1YS4A 2PAAA 2QYOA 3I6MA 3ME5A 3O8LA 3V4ZA 3HXMA 2ZR2A 3Q0EA 3TE6A 3U4GA 4I9FA 5DM1A 1J70A 3G2IA 4PZCA 3OZRA 2WW8A 3LTNC 5AKEA 1NATA 1Q7RA 3W8RA 4MZXA 2WTAA 5DCWA 3W8NA 4CS2A 1BFDA 3RKYA 1S4QA 2O8DB 4JBLA 2A78A 5FEMA 3NVKI 2ZJBA 1B7GO 2FCRA 3CRQA 3E7XA 4Q1FA 3UN1A 4J9UE 2XOKA 1NYRA 3NP7A 4B2YA 3FTEA 1Z4PX 2QL5A 4KV7A 1THTA 3VH4A 1NBMD 4W8GA 2A1UA 3ACDA 2XWJI 1ZESA 2AMVA 2QPTA 2ZBEA 3FYSA 2JEZA 4K81B 5J1TB 5LDGA 3T7DA 1I4DD 4ZRDA 5FOTA 3BSYA 1JEAA 3VNBA 4CLRB 1Q2UA 2Z04A 1KJJA 1M2VA 2R7NA 3UH0A 4RY8A 3WWEA 3O8RA 3A9CA 3GAFA 5JQWA 5AVUA 3GD7A 2OLJA 3O3CA 4PZYA 2IH4A 1HDXA 4DADA 2Q1SA 1V3UA 4DF3A 3K73O 3WKEA 5L95A 1U1GA 2CZCA 4V1CA 3CYFA 4F4CA 3R07A 4LBWA 2C83A 1TO1E 5MHTA 5LCXA 4Q21A 1QX3A 4MVXA 1NTOA 3MLBA 3ASVA 3F0TA 3T1TA 4PCAA 2UAGA 4OQ4A 2D5LA 4A8JA 3ZDCA 1OMOA 3HUFA 4IG9A 2Q9AA 3DZDA 3E3NA 3L77A 1T2VA 1X1EA 2FW9A 4PCLA 3VU9B 5B7GA 2V5AA 4JQZA 4EHKA 4ARSA 4DDWA 4IH9A 4UUBA 2F67A 4P71A 2BZ1A 1E6UA 2PAFA 2PBLA 4QOJA 1QRTA 1NR1A 4FYIA 4FX5A 3F5DA 2C7PA 5ES4B 2OHVA 1GHTA 4R1PA 3PGVA 1ZD4A 3JW8A 2I8CA 1OA1A 2GNOA 4JLPA 4COOA 3BE5A 2NVBA 2PMBA 4UCXA 3A06A 4DCVA 4IS2A 4JZKA 2C4MA 1TGVA 2Q3CA 3WC4A 5JJCA 3H1TA 3I6YA 6YASA 1PFUA 4JDPA 1ULZA 1KY3A 1YA4A 3RLIA 4ALJA 4Y3UA 5JXIA 2PUBA 2Y1CA 2GT1A 4N49A 3PWZA 1JFLA 3EMKA 3Q7TA 4QDXA 2BEUA 3HY3A 4KIWA 2AG0A 1G8SA 1J8MF 4EVRA 5A6SB 2I4NA 1KF0A 3DKVA 3PNQA 2BF4A 4KK3A 4KWCA 1OZ0A 3UFBA 3R7BA 1R64A 3LYLA 5G3ZA 3U16A 4IGEA 5J2UF 1SESA 3GRUA 4X8OA 2QAGA 2DPLA 5EWLB 2Q2NA 1V9SA 4UOQA 1HTBA 4HLDA 5H3CA 5P8WA 3DHYA 4XA8A 3ZLTA 4ZCTA 2VWPA 3PC8A 4TMTA 1E1CB 2CK3D 4X64B 3E9CA 2E82A 1BW9B 4B5LA 3H97A 4RTNA 4BO9A 2XQVA 2OP1A 1LDMA 4KUHA 2H4HA 1DRVA 4M0FA 3GHHA 3B2QA 3EDRA 4MIEA 3SHFA 5I6DA 3U9TA 5B3JA 3KHUA 4ITUA 2JK0A 3E9NA 3VR2D 4JL5A 1E2NA 4D57A 3NIBA 1PJZA 2W83A 3OPNA 1F5NA 1IULA 3GLTA 2Z0MA 3BXXA 4E70A 3UUWA 4Q3CA 2OCPA 1I1HA 1M6HA 2V8BA 1K8ZB 1YGPA 1LEHA 1IHXA 1MFZA 4MUIA 3SC4A 1TQDA 4D98A 1UPCA 4ZMBA 3ZE8A 4IUDS 5HKKD 2Y6VA 4PX2A 3UCEA 5KNBD 4D3FA 1OWPA 1LW7A 2IU3A 2ZYDA 3P0EA 1DC5A 1DJNA 1TYZA 1XFDA 2CJWB 5KYGA 4CKBB 4EW1A 4LSMA 3NBAA 3E3MA 1KK3A 5FORA 1ONOA 3SYNA 5DXFA 5HE8A 3SZUA 2LTAA 1JPVA 4UHCA 5CG1A 1DC6A 5ICFA 3L02A 2Z1NA 3L2OB 1XU4A 3PVSA 1IY1A 5DYNA 4YUYA 1V6AA 4Q4CA 2YCBA 2G1KA 1UXGA 4XVHA 2A57A 2VNIA 3UMVA 1QGYA 2ANCA 1IXKA 4EX5A 1XJ0A 3PR2B 1WCWA 1P9LA 1PR1A 2YBDA 4YBZA 2IEGA 4XQGA 4D1YA 4C7JA 5JMOA 3T3HA 4I4CA 5C37A 1DFIA 3NXKA 3AI2A 2VCEA 4FS8A 4OQPA 5D3MA 5AJUA 5JJLA 3HFZB 2O3UA 2PX6A 1PFKA 4NI5A 2ISCA 5A71A 3VYUB 4FYHA 2XHZA 1HOTA 1WOMA 3VQWA 4Q03A 1DTEA 1NHWA 2PYIA 2X1MA 4IEFB 2DR0A 2RHBA 4MVJG 4PS0A 4QJBA 4YP9A 3WAKA 2IYTA 2HXYA 4HDQB 1XQYA 3A8TA 4P31A 4UPAA 2FKAA 1XQ6A 5K20A 2G63A 1WU8A 4JI6B 1QYVA 4JXXA 3K92A 4KDRA 3U4HA 4RZ3A 5F3WB 3CLSC 5I51A 2PGNA 1NI4B 1I7QB 2I91A 3R9XA 2WU1A 3CR3C 2QE7A 3HN6A 2C1ZA 2LIVA 4J7CA 4MINA 4XB1A 3V1KA 3EODA 2BEUB 5DTJA 5GVSA 2R1TB 4CQLA 5E3IA 1MRNA 3W9BA 2VQFB 1HXHA 4QYXA 1Z16A 2R25B 2XB9A 3DCJA 2BMFA 4UU0A 2CJFA 1KO1A 4H0NA 4K1LA 3HVIA 4CVNA 4WZBB 2J9FA 5A3RA 4OCZA 3AM5A 1OX4B 1JJBA 1GUAA 1IG0A 5HIMA 3G2PA 3GHYA 4OHMA 2W6CX 3TZCA 4TN1A 1H0KA 1FQKA 2B98A 2V7XA 2HFJA 3C70A 5EERA 1TEZA 3QU7A 1QE3A 4D8VA 3TJZA 3IDOA 4G5HA 2ZJ8A 3ZNQA 3SVTA 3E3OA 4HMPA 3DV2A 3TOZA 4N40A 1T8TA 1NM5A 4EWLA 4IBOA 1IU9A 1O6GA 4LVNA 1N6PA 3OIUA 1YZFA 3WRYC 1NVDA 4OXYA 4KTVE 2R79A 3ZBTA 1BA2A 4DLKA 3QA3E 4HQLA 4KRFA 4P92A 2D5BA 1VSTA 2MT9A 1GKKA 2R6ZA 3JYNA 5T41A 2EG5A 2RI1A 1ODCA 1M76A 3EAFA 4MKHA 1DC4A 1LDBA 3LQQA 2WF5A 5JPIA 4YQYA 2BDUA 3WLMA 2AXEA 2EF0A 1KYYA 1ESMA 5TQ2B 2EYQA 3IVMA 4OHUA 1NVFA 3ND5A 2HWYA 2LIPA 1WUIS 1FDUA 1T4GA 4W63A 5K8VA 3RODA 1WKVA 4N01A 3CNBA 1GUYA 1R8QA 1TK9A 2C88A 2GEVA 4HPXB 1TMYA 4YT4A 4QQFA 2HXGA 4PIPA 5DCYA 4FU0A 5FP0A 4D3DA 4MR8A 4YCUA 2HCFA 1XU7A 4P4UA 3S1LA 4FKBA 4WY8A 2FWNA 1BKDR 3E4CA 3EIHA 4W5RA 4UNIA 1XKLA 4G0PA 2AKWA 5GPBA 4NEQA 4CMAA 5IM4A 4DLPA 2RG7A 1ZJYA 4HFNA 2R4TA 3N0XA 4FFBB 1JDVA 3IDSA 4G5OA 5H02A 2C82A 3WLRA 1U3UA 2HCJB 2IU4A 4MI1A 2B69A 1KYVA 4INJA 1ZH0A 1CRLA 1J0XO 2GN9A 3K70B 1E7MA 1ZC4A 2R8BA 1ECCA 1GDDA 2B25A 3PHJA 3OTQA 1C1XB 3BE4A 1U28A 2Q4RA 5HUJA 5GIPE 1J23A 3QPAA 4AG5A 5JH7F 2QS9A 2BFBB 3EF0A 4LF5B 1O6BA 4PAGA 4HT3B 2TRSB 1O3YA 3IE0A 3L4BC 3BCSA 3VOAA 4C6RA 1ZOLA 1JAZA 1A88A 4JJ4A 4BV3A 2VDPB 4GRIA 1RXSA 3OF5A 3WGHA 2YHSA 3AY3A 5IDWA 4ND8B 3VC1A 2RB4A 3E61A 2Q7GA 3LLSA 3R1IA 3ZE0B 5ERGB 2O2ZA 2QRZA 2P5IA 3ZE7A 1ZIPA 4AW9A 5FDFA 2P0EA 2XWQA 2E48A 3CLUD 4XWKA 3ZWBA 4PYIA 1OXXK 3VNSA 1V11B 3CUYA 3UHOA 4CF5A 2VP6A 1EFKA 4D6YA 1N8SA 1ZRSA 2JHPA 2VSXA 4ISBA 3VPXA 2WYIA 3C3MA 1DIHA 1S9DA 3FB4A 3K0CC 4FEGA 2R97A 1HFEL 3EUEA 1RLUA 1W4LA 4JU8A 5HF5A 2BFWA 4IHJA 5JRJA 3A1UA 1NNHA 1T3TA 2QX4A 2W2MA 3FTDA 4Q9AA 3RFXA 2J3KA 5IYZB 3KQLA 4FS3A 2QN9A 3GJRA 1CY8A 1HQDA 1N2CB 5HYVA 3WO0A 3CW8X 4N3AA 4J16A 3UC9A 1NV9A 1NXPA 4JYMA 4B31A 2YV5A 2UZIR 1OLXA 2H11A 1RS0A 4R3WA 4DCCA 1OX6A 2RAFA 4KW7A 3FSGD 4KR3A 2XECA 1MC8A 2VNJA 1H2XA 1Y82A 4L2IB 5F35A 2FEWB 1U6KA 1RC8A 1TYEB 3NATA 1H6CA 4Q93A 4YDHB 1HE5A 3EZ7A 3BMNA 3GLSA 5BOSB 5AI4A 2MINB 1Y34E 3DB1A 3DTYA 3EA0A 1E61A 5KX5A 1R6BX 3GEMA 3CF0A 1VE5A 2R68A 2RGNA 3PITA 1CUVA 2DFNA 4LFCB 1FXUA 3W6NA 4GPZA 3FLBA 3NT2A 2CNKA 2KYRA 2GCIA 4C01A 5AUPB 3W5CA 5HRUA 2Y77A 4M9CA 4D0NA 2ARSA 3KT0A 3O4IA 1C8KA 4NFYA 3MJ4A 2YYYA 3BTSA 1GV0A 1GFWA 3IB3A 4NTZA 2JCGA 3V55A 1ODIA 2BBSA 4XTVA 3IAM6 3IA2A 3AKCA 3ML1A 2WKWA 5LP6F 2C4UA 1NF2A 5F64A 1AN0A 4F93B 1IEQA 3GDGA 5JAIA 3VO1A 3LDGA 4LYAA 4RQEA 3CVJA 1XQWA 2FN9A 1UK7A 3D1LA 3D3QA 1BXRA 2CKDA 3G7UA 3O0TA 4BIMA 4CE6A 3N28A 3K0KA 3KV3O 3ADKA 4D8XA 4QX6A 4BS9A 2QLJA 4ZDKA 4MS1B 4NAUA 2ZSHA 4AIRA 2DQSA 1M67A 3HCPA 1VGVA 2YVUA 2WQZA 5ANRB 3UMBA 3HRIA 3WB0A 5B1YA 5CAEA 3FYCA 4DV7B 2A0WA 2ZRGA 4UE2A 1BO6A 3SQDA 4GDFA 1E3WB 1AURA 3UJPA 1GAQA 5G3YA 4ACAA 1B26A 2JAQA 3GZJA 2AQKA 1A8HA 1LK5A 2FNAA 1M2GA 2GSWA 2N1MA 4ZI5A 2W8ZA 4A8TA 3K5HA 3WTCA 4QYMA 4E4TA 5A2QA 3EJWA 2QG9A 3GIWA 4Q4DA 3TL3A 1CUYA 4MRAA 2C0QA 3NTVA 3KZNA 4RM3A 4C22A 1ZICA 1P62B 2F2TA 2HNKA 1W5AA 2QN6A 4NKRA 5ALRA 3TEFA 5FOQA 1MB9A 3IKMB 3W4JA 2FPGB 4IOJA 1WLSA 2DU7A 4JKOA 5KYYB 2R6FA 1BOFA 4W82A 3SBXA 4MJXA 4MQEB 3RUDA 3MXTA 3DCNA 1BXZA 4IXDA 4JYAB 4LVOA 4CM8A 4ZQFA 1FP2A 4YLGA 5E8RA 5L9AA 4KODA 4QXPA 5A6SA 2FE1A 3QG5A 3SR0A 2EWNA 1EQUA 5LPNA 2X9NA 4Q4JB 2A1UB 4LYHA 3MA0A 5FWYB 4Q1DA 1LI7A 4IZOA 4NV3A 4BNHA 4EQZA 1XFAA 5SYAA 1WZUA 1JLSA 4Q02A 4EHBA 5EE5B 4MDFA 3USCS 4ZI2A 2O8FB 3VYWA 1SU6A 1NJ8A 1I6MA 2QP4A 4RHEA 1ECPA 1B41A 1CJVC 4NULA 3C3DA 4R1OA 1E94E 4G1UC 4Q9HA 1JBQA 4C0JA 5CIYA 1C3OA 1U99A 2ACEA 1RWWA 1U1FA 3C1UA 3O91A 1SOVA 3N0TA 4HVTA 4JX8A 3H4MA 1YR3A 4PRLA 1X15A 4HXFB 5U4QA 2OV4A 4N8DA 1HE1C 1VCNA 3SLRA 4TVBA 3GLIA 4NCBA 3WKAA 2EIHA 1XK7A 1PGOA 1QZXA 1GILA 2A67A 3OQJA 4L5IA 1UH5A 3URKA 1ZMTA 3UGJA 3B85A 4C30A 1X70A 3F96A 3NDIA 1OXBB 4CTKA 1JJCA 2PZFA 4D9MA 4ECEA 1ZSNA 1JBEA 2R8PA 3CRW1 4QM7A 5BUZA 1WWKA 1MAUA 2DQKA 2P4EA 4FZVA 2DQYA 2H3EA 3GVHA 1QCYA 4FFPA 4BMSA 1GPYA 5DGIA 3RYHB 5I7FA 1TECE 1SZDA 5ALKA 2WI8A 2GAOA 5KX5B 3GIDA 3QFFA 2VA9A 4IW3B 4IM7A 4S0ZA 1BE0A 2DKOA 2UYQA 3GMDA 3IAFA 4X62B 2EATA 3K9NA 1Z8DA 1OH7A 1SEPA 3VTKA 2VH5R 2AJDA 1DAFA 1YOVB 2REOA 4RGBA 4F06A 4JBYA 1SIWA 2NTYC 5GV8A 3ESCA 1LV8A 3N8KA 3KUUA 4J43A 1KMQA 4OI4A 1FU8A 3JZIA 4GF5A 2Z3VA 3CVOA 3HWX1 4IDGA 3JAKB 4PLZA 1EMDA 1LWNA 3N8DA 3K7EA 3EFRA 3JWIA 4BOYA 3ZVNA 4QUBA 4MAMA 3K9FC 3FUUA 4PYJA 2PJUA 1BN6A 1QAOA 4LGVA 4MW1A 2VTBB 1BD4A 2AN5A 4O1IA 4AICA 2ZRBA 3BDIA 3SR3A 3KDAA 4BQPA 1P4GA 2B7BA 5A03A 1GAEO 2FPUA 1PNTA 1WV0A 2X7JA 3UWSA 4G0XA 4YUVA 3AUYA 4CG1A 1PJBA 5I7RA 2VO1A 3OJFA 3L82B 3E23A 1C4XA 1G20E 5K6AC 2BIFA 4IUBS 4NE7A 3WNZA 1MAVA 3N75A 3R76A 5EWMB 1ZUD1 3FB1A 5CNKA 3LVFO 5GZ6A 2GSDA 4URFA 1RMTA 4A8JB 2Z6QA 4OI2A 2HMVA 2ZZNA 4TSRA 5FOWA 4Y2GA 2O9JA 1FLDA 1GNTA 2DHCA 3GRCA 3R0IA 4EAQA 5JHGB 1Z35A 3K96A 4MWOA 4AJOA 4Q24A 2BR4A 2P5SA 3L4JA 3GBSA 4W5TA 4EPWA 2C7BA 2BGKA 3EXFB 1CQXA 2ZDQA 3NUGA 2J0SA 4JKYA 2JW5A 1GPNA 2J9ZB 3ZDFA 3FX2A 2BN4A 3PF8A 1HI9A 2IYYA 2RKBA 3SX2A 3UMFA 4EL5A 4ZVLA 1YRHA 3WJ7A 4ETMA 1RE0A 4LWPA 2J7PA 4IF6A 2BHSA 2OORA 1OBVA 3TSOA 3OZWA 2I67A 2IHVA 3NTXA 4IQ8A 2XITA 3H19A 1TC2A 3AESA 3QKRB 2BFCA 4RKRA 1TCVA 5AVYA 1XRNA 3K5WA 1AM4D 4Q4JA 5C1IA 1KQGA 2EKDA 1N57A 2ZSJA 1I7DA 2PLRA 1P6UA 2WF8A 1GM5A 2ID7A 4Z9BA 4B82A 1KDTA 1DG9A 3EXEB 3TIFA 2GM3A 3F5MA 3NUQA 4XQ0A 3HK2A 5LU9A 1GPLA 2EP7A 1Z0FA 4NU6A 5E0OA 1QWSA 3K6RA 2VPPA 1PFVA 3O8DA 1ZH4A 3FDIA 3P4XA 5D5QA 1B0UA 2J4DA 4TLAA 3ZE2B 2HSEA 5DM0A 4EAAA 4FSDA 4L1KA 1HMYA 3O1IC 2AWNA 3WBFA 2ZUFA 1QIDA 5KYKA 3Q8XB 1WABA 5EHGA 3BF7A 1DUSA 2XQKA 2FDXA 4LCBA 3JWPA 3D2AA 3NLLA 1L8OA 4P7KA 5JNWA 1JDJA 4C7BA 2AUNA 1WEKA 2NSYA 2VK8A 3MIZA 4I3GA 3AVYA 3E53A 1TT7A 2QUBA 4AKGA 2GPJA 4IL5A 2PGJA 4KQ9A 2EIXA 3C3BA 3NQ41 1J8FA 5AW3A 5T67A 2QW0X 1V7ZA 3A25A 1RJEA 4BXOB 3NFRA 5DTQA 1YB6A 1V8DA 2NZWA 1RLIA 3CKYA 5D3MB 3ZU3A 2O1EA 4BYMA 5ELXA 2OGZA 4R81A 1VTKA 3TTYA 3AHGA 3AM4A 3E22B 3MGKA 1Z4MA 4MO2A 5FPQA 5EJ9A 1W9MA 3L93A 2RHTA 2PJRA 2XIJA 1WKBA 3RGGA 1GNSA 4KG7A 4JS0A 4M1MA 1T4BA 4XPIB 4DZTA 4OLHA 3P5BA 4JCOA 4FMBB 1P7ZA 3LRXA 4KFSA 1I4TD 2GN4A 1HTTA 1JECA 2C5SA 3OZXA 4LEIA 2ZSEA 1N33B 4EI2A 4KPGA 4H6WA 4WQMA 2XTJA 4D6PA 2JFXA 3SHVA 3D5TA 1GVHA 1QKKA 5ESDA 2A5GA 3PRKE 1ZZGA 1TQ4A 3T9AA 1GARA 2FR1A 1JHQA 1VOTA 1UBJS 4XD7D 3ZJUA 4W5JA 3QMMA 1BE6A 4IXMA 5KBYA 3LGAA 3PJRA 4JQSA 1THGA 1GPAA 5KHLB 2BP7B 1P5ZB 5U9CA 2K7FA 1NF8A 4O4HB 3BMQB 4ASUD 2BY4A 1U4SA 4R6WA 1EXWA 1QVVA 1L8QA 3RC7A 5LOVB <