3FJPA

Apo structure of biotin protein ligase from aquifex aeolicus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
219
Chain Sequence
b'MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 67
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fjpA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3fjpA01
3LSQA 2ALYB 1BBUA 3JCMe 4XU1A 2ZGWA 2CJBA 3JCMQ 4C8QE 3HRKA 2E65A 1KOGA 2CJ9A 3L4GA 1Y96A 4UP7A 4C92A 2DU5A 2DJZA 1B34A 2ZT7A 4YRJA 3P8YA 3JCMX 4PJOC 5GAN5 5F5WA 4M7AC 4HT8A 1YFTA 4A54A 4HWPA 4M7DA 3QNEA 3JCMd 2EJFA 2P5IA 2P0LA 1LYLA 2IY5A 2DQ3A 2ZT5A 4KQEA 3FJPA 4C92D 4YCWA 2QHUA 4M77B 4JUVA 1KMNA 3A7AA 4YRIA 2C8MA 3JB9D 2FYKA 4M7DD 4O2DA 1I8FA 4PJOG 3JCMh 1PYSA 3IKMB 3JB9H 4J6YA 2C7IA 3UFGA 1KQ1A 4N0AA 2CJAA 3M4GA 3A7UA 3RF1A 4MMLA 4M7AA 2ZT8A 1JBMA 3IALA 3EFSA 4YCVA 4DQ2A 5K1PA 4YCUA 2ZXFA 3MF1A 4P75C 4YRQA 2RA2A 4YRGA 1HTTA 1EIYA 4M78E 3KFUA 3PCOB 5GANj 1H4VB 4EMKA 4M75B 1C0AA 4M7AD 2AKWA 1B7YB 2ZIMA 4YRCA 3SWNA 2CGHA 3HFNA 3I7FA 4P3PA 1U1TA 1EVLA 4P73A 1X01A 1KQ2A 2RM4A 4YRRA 2Q7GA 4L87A 3L4GB 3NEMA 4M77G 1Y96B 2J3LA 2RHQB 3TEGA 4C92F 5LJ3e 4C92B 2I4LA 4CS4A 1U1SA 5GAOp 4UP8A 1E1TA 1Z7MA 2RHSA 3JB9F 4H2UA 4OLFA 5GAOn 3QSUA 2JN0A 4EMGA 3ICAA 4M7DF 4PHCA 4YRKA 4JLIA 3HXZA 3HFZA 4P75A 5GMKm 4P3OA 4RMFA 2I4MA 3QHSA 4HT9A 2QTXA 3SB2A 3VBBA 3INZA 5HGQA 4C8QA 1YB3A 5LJ5e 4J15A 4TQDA 1JRIA 4C92C 1I81A 1N9WA 1EQRA 4YYEA 1JJCA 3HRIA 3R07A 1X2HA 1X55A 1NJ1A 2ARUA 4M75G 1YFSA 5LJ3h 4M7DC 2XTIA 1LJOA 1E1OA 4M7AF 5C53B 4M7AB 4H2WA 3G1ZA 4YP0A 4P3NA 3IKLA 1N9RA 5LJ5d 1H4TA 3HXYA 4M78C 3QO7A 4X5OA 2Q5HA 4X9DA 2G4CA 4OP0A 4C92G 2ZIOA 2ZZFA 1NYQA 4EX5A 1FYFA 1WYDA 5KNNA 5GAN6 3JB9I 3JB9G 4H02A 2ZTGA 1H4SA 2K57A 4M7DG 1NJ6A 4TTVA 3JCMW 4N0AC 2YLBA 5LJ5g 5LJ5h 4K87A 4M77E 2XGTA 2ARTA 4BWAA 4X9CA 3P8VA 3JCMP 3RKWA 4WF2A 4CH4A 2FB7A 3PZCA 4HWRA 2ZZGA 5GANf 2EAYA 5GAN3 4XEOA 3NELA 4YRTA 1SERA 1RIQA 1MGQA 4M78A 3WQZA 4EMKC 3HFZB 2CIMA 2QHSA 5LJ3f 5K1XA 2E64A 3QO3A 3SWNC 3V8KA 4NL2A 5GAMd 4P73C 5ELNA 2EWNA 5C52B 4M7AG 3LC0A 3HFVA 3HXUA 2YHTA 3M4QA 1TH7A 3V8LA 4M78D 4UP9A 5GAN4 4YRNA 3JB9J 1ASYA 5GAOm 4RCCA 2Y90A 2VXEA 4M75E 2ARSA 1L0WA 1YGBA 1B70A 3BY7A 1ADYA 1JJCB 5GAMg 5GAMh 2AMCA 3UGTA 4WJ4A 3VQXA 4CH3A 2ZCEA 3HXXA 2DU7A 4F7UE 1D3BA 3UH0A 1HK9A 5I21A 4TVAA 3GIBA 2ZINA 3REUA 2DXTA 4C8QC 5LJ3j 1YFRA 4YRFA 1LOJA 4P71A 4G85A 3HY0A 2DQ0A 4WJ3M 4MMKA 3FIFA 3REXA 2EL9A 3BFMA 3P8TA 3OD1A 3JCMb 4TVYA 1B34B 5GMKe 2E3CA 4XEMA 3JCMf 4YDQA 2EJGA 4TQFA 3BW1A 4Q6GA 3RUXA 2QHTA 4M7DB 2E1HA 1WNLA 3TEHA 4H2VA 2IY5B 5ELOA 4RDXA 3W3SA 2DTHA 11ASA 4M78F 4M78B 4H2XA 1G5HA 4PJOE 3LSSA 2DKGA 3QTCA 4XTVA 1HC7A 4P74C 3JCMV 4P72A 4CS2A 2YLCA 2VC8A 1PYSB 3EFRA 3TUPA 2I4NA 3E9IA 4CH6A 4M77A 4HWTA 4YPFA 2DTOA 4BW9A 4EMHA 1USYC 1BBWA 5GAOl 4KR3A 4HA8A 4CS3A 3RESA 4C8QD 5GMKh 1Z7NA 2DVEA 4PNOA 2AMCB 4YREA 1B8AA 3UGQA 4XTYA 4M77D 5GMKi 1EOVA 1ASZA 4NOYA 4TWAA 4ZTUB 1I5LA 4QVDA 5GANg 1EIYB 4JRIA 1BIBA 1D3BB 4EMKB 3V8JA 1YCYA 3RL6A 2AKWB 4K86A 4PG3A 3A32A 3SWNB 3MF2A 4P74A 4TVAB 3PGGA 4XTWA 4YRSA 5E3IA 4JRKA 2DZ9A 2VXFA 1B76A 1NJ8A 3E9HA 4RQEA 4Q15A 1GGMA 5GAMe 1USYA 4M75A 4H2SA 4XU2A 1B7YA 4M78G 2ODRD 1KMMA 2ZR3A 4YRLA 3HXWA 2Q7HA 4CH5A 2DTIA 2RHSB 1IL2A 1NNHA 3MEYA 3VQVA 1M5Q1 1X2GA 5GMKl 4J6XA 3QO8A 4M75D 4F7UA 3TEHB 3VQYA 2RHQA 1ADJA 3RERA 1E22A 1WPYA 4K88A 3JCMJ 4XTUA 2DEQA 4H2XB 1H4QA 4J5YA 4XU0A 5GAOq 1ATIA 3A74A 4P71C 4G84A 4C8QF 4C8QB 3HY1A 1G51A 3HFOA 4LNSA 1QF6A 4H2YA 3FB9A 4M77F 3L2ZA 4RCBA 1EFWA 3QUIA 5LJ5f 3JCMg 4J6WA 1BIAA 4Y91A 4C92E 1SRYA 1J5WA 4YROA 1EVKA 3DSQA 4HVCA 4PJOA 4XQ3A 2ZT6A 4QVCA 3V7CA 1QE0A 1W66A 1WU7A 5DY9A 4M7DE 5GMKj 3ERRA 4P72C 3NETA 4M77C 3V7RA 2PMFA 2E5AA 5C51B 3RIRA 1G5IA 2ALYA 3RGLA 3VQWA 2Q7EA 3IG2A 4PJOD 2EJ9A 4M75F 4NL3A 4XTXA 2ZNJA 4ZIBA 3L1AA 4V2SA 5GANe 5GAN2 2RD1A 4C8QG 4YRPA 1WQWA 4XTZA 2I2LA 5GAMf 4DPGA 5LJ5j 1H641 4F7UF 3RACA 4F7UB 1I4K1 4YRMA 1LNXA 3RKYA 3V7SA 12ASA 2ODRC 3A5ZA 4TVWA 4H2TA 1WQ7A 4M7AE 2DZCA 2DDZA 5GAOr 4A53A 1M8VA 4RQFA 2E10A 2J3MA 4EO4A 1NYRA 1E24A 5GAN7 1NJ2A 5GANd 1SESA 1HXDA 4M75C 3A31A 3HTZA 4UPAA 3A5YA 1N9SA 2Q5IA 2I4OA 4WI1A 2ZNIA 3CMQA 2E41A 1B70B 3NENA 1WLEA 3HXVA 5LJ3d 4HWOA 3M4PA 2ZR2A 1SETA 2DXUA 4NCXA 5GANh 4E51A 1X54A 3QO5A 2PMEA 4XU3A 4HWSA 4ZTZB 2QHVA 1NJ5A 3RKXA 3A7RA 5GAMj 3BDUA 3AHUA 2RB6A 3BJUA 5CAIA 5LJ3g 4PJOF 4PJOB 1VQZA 3VU3C 3JCMc 4KR2A 2ZZEA 3PCOA 3HSBA 1X56A 4AH6A 5GAN8 4F7UG 2HNIA
chains in the Genus database with same CATH superfamily
2ALYB 2FPDA 2YT6A 1WX6A 1S72T 3JCMe 4IIOA 3G71A 4XU1A 2DJQA 2ZGWA 1I1JA 2CJBA 2E65A 5KE3A 2KVQG 4E7ZA 3L4GA 2E4HA 1Y96A 1BI2A 4C92A 2DMOA 1B34A 1U3OA 4LVJA 1AD5A 2KK4A 3JCMX 5CK9A 4PJOC 1WZOA 2J06A 5F5WA 4B9XA 3OQ5A 4M7DA 1ZUUA 3LWHA 2IY5A 2LDMA 2DQ3A 4KQEA 3GP8A 3CC7A 3CMAT 2VV5A 4YCWA 4YRIA 1D0XA 2JT4A 2EYQA 3VS4A 4O2DA 1RLPC 4F17A 2JM8A 3IKMB 1AWXA 4ZGJB 3UFGA 3F70A 1KQ1A 1E6HA 4N0AA 2PVDB 5KYYA 1FMVA 3MEWA 2CJAA 3RF1A 2ZCFB 2LNVA 4OMFB 1JBMA 4YCVA 1WHGA 2P4RA 2DEUA 5GJWB 1NJIC 1YITQ 2ZXFA 2RA2A 2ROTA 4C0GA 4Z02A 1ZBXA 2C0TA 3QYGB 1WHMA 5KCHA 3HFNA 2OTJT 3QPHA 1M2VB 1RAAB 3VRZA 2QA4Q 1KQ2A 2RM4A 6AT1B 2J3LA 1WHJA 4OGCA 3TEGA 2J6FA 3M55A 3D7SB 2I4LA 5GAOp 3P8HA 4UP8A 2DO3A 3C95A 1Z7MA 4H2UA 2DYIA 1N8RR 1QQJA 5CIUA 4J9CA 2JN0A 3QSUA 2MMPA 3NHNA 2VVKA 5GMKm 4P3OA 4HT9A 2NYSA 1NM7A 2CT3A 2DAQA 4XK8E 4KUIA 2DK3A 5HGQA 1OV3A 1QMCA 2JJ9A 5L8RE 2KNBB 4TQDA 2KI7A 4LUDA 4DBFA 2RQTA 1EQRA 2PQWA 3R07A 1PRMC 1VQNA 5LJ3h 2LX7A 3A8MB 1LJOA 1VQLA 2DL5A 4FYXB 3G1ZA 4DEXA 2EGCA 4PFOA 3CBPA 2J6KA 4X9DA 2WSCE 1VQOT 2BZ8A 1SPKA 4LDVA 3MCAB 4LD6A 1VQ9A 1NYQA 2DLPA 3M0PA 1FYFA 4FW2A 2R58A 2P0KA 5GAN6 4H02A 1K0SA 1YI2T 2QYZA 2K57A 1ZA2B 2YLBA 5LJ5h 3OY9A 1Q81C 2RN8A 2ARTA 2KXDA 4J9DA 3EGXB 5J26A 3E2UA 3PZCA 1C1AA 2ZZGA 2DXBA 1OX8A 5GANf 2EAYA 2H3JA 2X3XD 3UATA 3NELA 4YRTA 5FU7C 2VUBA 3PE0A 3A98A 1ZSZC 3EG1A 3TU4K 5K1XA 2E64A 5A2QE 1BI3A 3QZ5B 5GAMd 4P73C 2EIFA 1G8XA 3QJYA 5IT9E 5KYUA 3V8LA 1XQHA 1VYUA 4FW1A 3JB9J 3QXEB 1ZSGA 4RTWA 2ARSA 1WI7A 2O4XB 4M75E 1B70A 3CCET 3UGTA 3TVTA 2L5QA 1FWZA 4WJ4A 3E9FA 1M1KU 4CH3A 2KRMA 2ZCEA 1YJWA 3VUZA 2DU7A 3EG9B 2L2PA 1D3BA 2Y4XA 2D1XA 3UH0A 1HK9A 2JW4A 5I21A 4A4FA 2CZ1B 2F2VA 1GXIE 4ZTJA 1PM3A 4RMOA 4C8QC 1MMGA 1IHVA 3VS2A 1KC8U 1AZEA 3CXCA 1UUEA 4E7JA 4WJ3M 3HTRA 4J9GA 2AKLA 3HP9A 2XDDA 2EQMA 4TVYA 2M0YA 4M4ZA 4YDQA 2EJGA 3OYCA 4Q6GA 4J9HA 4KGZB 3DKMA 1MMAA 1K8AU 1WNLA 3TEHA 3CCSQ 2NWMA 2OTLQ 4C5EA 4HCZA 4X1VA 4JJBA 3R6OA 5ELOA 4RDXA 1SEMA 2DTHA 3EAEA 2YRVA 3HRSA 2ECZA 1OEBA 1G5HA 3OW2A 2DL8A 3LGFA 3LSSA 3CCRQ 4II1A 2QQAA 2QK0A 3RMQA 2YLCA 3OYYA 3PVLA 2K6DA 2DL7A 2GGRA 2DTOA 4BW9A 4EMHA 3ZBDA 2XI9A 1UGRB 2O31A 3CC4T 3LWIA 1VQ7Q 3RESA 4C8QD 1EIFA 1Z7NA 1YJ9A 3I5RA 2DA9A 1B8AA 5J3BA 2BTTA 2HBWA 4PKCC 2HEQA 2VB6A 4NOYA 1NEBA 2VYTA 3VS7A 2FRYA 2RI5A 2GF7A 5GANg 1TOVA 2QDYB 5FU7B 2YSQA 1VQ4Q 1ZSZB 2FEIA 1YCYA 4K86A 1I07A 4PG3A 2ESWA 3A32A 1QKXA 3MF2A 5CKFA 4TVAB 3GLXA 2RJDA 4JRKA 2FZCB 2OI3A 4JZ4A 2DZ9A 5CKBA 4ANJA 4EIKA 1NJ8A 4MZMA 4Q15A 1GGMA 4LN2A 4D6WA 1VQ5T 1B7YA 1BB9A 2ODRD 4J7FA 1GCQA 1IB8A 3G71Q 2Z0WA 3A1PA 1Y07A 1MHNA 1NZ9A 4CH5A 5HY6A 3EH2A 3EH1A 4QQ6A 5FU6B 2EKHA 2KGTA 1K4US 4KT0E 4M75D 3VQYA 2RHQA 3H0IA 1ADJA 2XICA 3JV3A 4H2XB 4DOVA 2PVGB 3GNFB 3A74A 1YIJA 1IO6A 4P71C 1IZ6A 4C8QF 3CC7Q 4C8QB 5KYXB 3HFOA 1QCOA 4N4GA 4LNSA 1AT1B 4H2YA 3FB9A 3L2ZA 1JJ2P 2QGFB 1EFWA 1OULA 2DD4A 2DL4A 2LX9A 1N8RC 3OSSC 5LJ5f 2X35A 3CPWA 1MV3A 5CKEA 1WXBA 2HSEB 1AOJA 3S3MA 3MHXA 2DYBA 3FJ5A 1YITA 1BIAA 3KFVA 1OPKA 4OMLA 4C92E 2VASA 1SRYA 1DJ7B 1J5WA 2V26A 2R5AA 3JSCA 4FL6A 3VUBA 3BE3A 4XQ3A 3V7CA 2L3SA 2X51A 2NUTB 1M9SA 3NPFA 5DY9A 4M7DE 5GMKj 3ERRA 2FL7A 5IXBA 3X26B 4M77C 2BZYA 3V7RA 3GPLA 2R57A 1Q95G 1VQOA 1PCXA 1W2BS 3LW5E 4R0KA 1JU5C 9ATCB 3I56T 3TSWA 4M75F 5DLOA 2V1RA 2PNIA 3TEEA 4XTXA 3CXCS 2K3YA 3CMET 2COZA 5GANe 4C8QG 3EGDB 4JRPA 1KFZA 2I2LA 2D8JA 1I4K1 4YRMA 1D1BA 2PU9B 3RKYA 4H2TA 2QASA 3VV0A 2X4XA 4C0FA 4A53A 3MP8A 2A08A 2E3HA 3HTZA 2EYZA 3OW2S 5GJVB 3FEOA 1RLQC 1R0BG 2LVMA 2HQXA 2IPOB 1VQKT 2F5TX 2M51A 4MZPA 1WLEA 4PK4A 4DBRA 1OQKA 1B7TA 3L2QA 4IUQA 4FU6A 1TUCA 2KE9A 5KYWB 2YUOA 2F5KA 4NCXA 4E51A 2PMEA 4XU3A 1K73R 4ZTZB 1VQNQ 3RKXA 1QVPA 3A7RA 3MEVA 5GAMj 3PIOA 1VQLQ 3AHUA 1H4VB 1HYOA 5LJ3g 3UA7A 1VIFA 3VU3C 3CD6T 2X4WA 1AWOA 2A7YA 1VQ8A 3CCLT 4AH6A 3LSQA 1VQ9Q 4HT4A 2AKKA 4AFQC 4BI4A 1K8AC 1SF9A 2JS2A 3I55T 3OYGA 5CKHA 2BE9B 2DJZA 1K73U 1UTIA 4BI3A 2FZGB 4E7HA 2ABLA 1PC0A 3CCJT 3QNEA 3OYFA 1NYGA 1FYNA 4J7IA 2VGNA 3CCQT 4C92D 1H3ZA 1BCOA 4M77B 2I0NA 4DEYA 4J8OA 1UGPB 3JB9D 8AT1B 4KUDK 2W0ZA 4M7DD 4MZTA 1VYTA 1W1FA 3L2VA 1PYSA 4N4IA 4UC4A 3JB9H 4J6YA 2C0IA 3RR6A 1MNDA 4WTOB 2XDBA 2XU8A 1PKTA 3CPWS 3M4GA 1GFCA 2NUPA 1G2BA 2CH4A 3IALA 2ZT8A 2LT4A 3TSZA 4CC7A 4FSSA 1YJWQ 1AZGB 3HHTB 1BCMA 3C94A 4YCUA 3RBBB 3VS0A 1ABQA 2QEXT 4YRQA 1HTTA 3NTIA 1EIYA 3Q1JA 3CC2T 1M2OA 4EMKA 1YJNT 2DE0X 2CT4A 2K9GA 4P3PA 3M57A 1EVLA 2HSPA 1V1CA 1UFFA 1BI0A 1OYXA 1Y0MA 4Z8AA 5C6SA 3L4GB 2JNGA 2BUDA 4M77G 1Y96B 2CP6A 4C92F 5LJ3e 4C92B 2AT1B 4CS4A 4P5NA 4ZGDB 4D8KA 3PTAA 5D6YA 4PJLA 3JB9F 4F16A 5GAOn 4PJMA 2DRMA 3J80E 4M7DF 1PNJA 3PMIA 3HXZA 4P75A 3O5ZA 2I4MA 2M02A 2KY9A 2ZPEB 1IXDA 1QCFA 3KBGA 3SB2A 2CP7A 3CMAQ 2KRNA 1YB3A 4RTYA 5LJ5e 1JRIA 3MP6A 3OS2A 2KT8A 2BKDN 3M0RA 1YFNA 2F2WA 2KYBA 1JJCA 3NTKA 3CCMT 3KXTA 2A8EA 1K9AA 2K5FA 1YJ9Q 1YHQT 2GNCA 1E1OA 1UEBA 4Y28E 5I2MA 2IG0A 2BZXA 2JZ2A 1M90R 3TQ7P 1W6XA 2G4CA 4C92G 2K3XA 2LZ6B 4E6RA 4EX5A 1QVGP 3JB9I 2L3PA 3JB9G 1H4SA 4M7DG 1NJ6A 1KSWA 2QDLA 3JCMW 3S3OA 3P8VA 3PVQA 4FYYB 3RDVA 1UGSB 2RK1A 4HWRA 4LXCA 4QW2A 1NLOC 3CMEA 1Q82U 4HCKA 3ZL7C 4FM4B 1WJSA 1RI0A 3M0UA 3IQLA 1UECA 1SERA 1H92A 4M78A 1M90U 2RNAA 3QO3A 3V8KA 3SWNC 1ACMB 4AFUC 1YIJQ 2EWNA 3LC0A 1TG0A 3UPUA 1NYFA 1RAHB 2IIMA 4UP9A 3CCVT 4YRNA 5I2SA 5GAOm 3NTHA 2VXEA 2Y90A 1VQKA 4QKUA 4BE2A 3BY7A 1ADYA 1YN8A 5GAMh 2AMCA 2V1QA 1N5ZA 2YUPA 2E5QA 2K2MA 2VKNA 2VWFA 1Y7XA 3VQXA 2GTOA 1UGVA 1TUDA 4AMCA 1WXTA 3P8DA 2LJ3A 1NLPC 4QVZA 3CBMA 5CKDA 3OYNA 3GF5A 4LDUA 3GIBA 1UJ0A 1RL2A 3REUA 2EQIA 3CD6A 5HKCA 2MF2A 4ELZC 1KG1A 4YRFA 1LOJA 4G85A 1VQOQ 3N5BB 1K73C 2IVWA 3REXA 1EZZB 2E3CA 4KH1B 1YI2Q 3I55A 1M1FA 2LQKA 3BW1A 2QI2A 3RUXA 3A8OB 2HAXA 2E1HA 4BB7A 2A0FB 5HK0A 1NBEB 2EYWA 1Z9ZA 1UGQB 2DERA 3QDRB 2ZPGB 1BKBA 1R0CB 1T0HA 1YBYA 2EGEA 3G6EA 3PFSA 2CUBA 4P72A 4LVLA 1Q86R 2O01E 4CH6A 4YPFA 1OU8A 1WGSA 4JS4A 4HKEA 3HPWA 4O5VA 5KE2A 4PNOA 3UGQA 2DVJA 1WLPB 2KDSA 2LCLA 4FSXA 1UHCA 2JTMA 1VUBA 4ZTUB 1PSEA 4LDXA 4E7KA 3M0TA 3H9NA 1VIEA 2RJCA 1KD1U 1D3BB 2X3WD 3OMGA 2AKWB 4GY5A 2YRDA 3SWNB 4P74A 3PGGA 4PL6A 2QEXA 1VQ8Q 1GL5A 1Q86U 2M1HA 1B76A 3E9HA 4BDZA 2RI2A 1RABB 2QA4T 1YJNA 4LNPA 1M3AA 2DRKA 4H2SA 3VYHB 4ZTFA 3HKSA 2ZR3A 1M1KR 1PWTA 1M2VA 2DTIA 2RHSB 1IL2A 3VQVA 1X2GA 1D0YA 4J6XA 3QO8A 2E12A 4F7UA 3TEHB 5KCOA 4BE1A 4K88A 3G4ST 1OZ3A 4XTUA 1WFWA 2DEQA 2EVRA 3X25B 2QQSA 4EPCA 1KC8R 1MMNA 4MDWA 3PIPA 2FO0A 1IHWA 4G84A 2D6FA 2DBMA 4JZ3A 2HCKA 4OMMA 4Z89A 3HY1A 2HKNA 5IN1A 4RCBA 5FU6C 4ESRA 4HCBA 1UE9A 3OBYA 3QUIA 1K8AR 1JO8A 1SG5A 1JEGA 4RTZA 3E9GA 3BDLA 4QT7A 4BD3A 1N27A 1EX4A 3X28B 3CC4Q 3CCUA 4R56A 3CCMA 4TVRA 5IHIA 4YROA 1QP2A 1EVKA 3DSQA 4Q5WA 4E7LA 4HVCA 4PJOA 4QVCA 1W66A 1QE0A 2ZPHB 4IKFA 3M56A 3NETA 3EFOA 4YTLA 2SEMA 3RIRA 1G5IA 3EG2A 4ME7A 1S72A 1Q82C 3WVDB 2JXBA 1WA7A 1N6AA 2JTFA 4V2SA 1OZ2A 2HD0A 1RACB 1M90C 2OAUA 1WQWA 1W2BP 4C0ZA 1RI9A 5GAMf 1R77A 2PZ1A 3EHQA 3OYKA 1X75C 2ODRC 4TVWA 2M9UA 3V7SA 3A5ZA 1WQ7A 1YP5A 3ME9A 2PTKA 3CMAA 1GFDA 2V8KA 2DDZA 5GAOr 1M8VA 1PKSA 2ZZDA 4WCIA 2JMAA 2GFAA 1NYRA 1E24A 1NPPA 3FRNA 3M59A 4A4EA 1HXDA 4M75C 4UPAA 1N9SA 3OYAA 2RK2A 4WI1A 4OF1A 1D09B 3NENA 1SRLA 1QP3A 3HXVA 5LJ3d 3CQTA 3OA6A 2E5KA 2PUOB 5EG2A 2V8JA 3A8HB 2P0QA 5CVIA 3C0CA 2HDAA 2RPNA 3L2RA 3QO5A 4HWSA 1SRMA 4AT1B 4DBQA 1RAEB 1VQMT 1NJ5A 1SKUB 2RJFA 2KROA 2J7IA 3NGPA 4J83A 4BY6C 2RB6A 1KIKA 3BJUA 2COYA 2XIDA 4RUGA 1G83A 3HL8A 1HD3A 1QWEA 3VYGA 1F1BB 4KR2A 2ZZEA 3PCOA 4LD9K 4B9WA 2AZSA 1AVZC 2EKOA 5GAN8 2HNIA 4CC4B 2OTJA 2P0LA 4E47A 3QJ6A 2EYYA 3MJXA 2CJ9A 1D0ZA 1QVFP 4BACA 1PD1A 5HCKA 3I35A 2CSIA 2A28A 2ZT7A 2C0OA 3P8YA 3CCST 3ASKA 3CMEQ 4HT8A 2L3QA 4A54A 4HWPA 2DL3A 2C06A 4LE9A 2RMOA 3JCMd 1GRIA 2EJFA 4CI0C 1JJ2A 2P5IA 2ZT5A 1NG2A 1QKWA 2XMFA 1Q7YU 3A7AA 1KMNA 2C8MA 2MK5A 1UJYA 2L0AA 1X43A 2FYKA 4BDYA 1I8FA 4DBHA 3SHWA 1VQ7T 2C7IA 3L2UA 3SD4A 1PSFA 2Y4YA 3H0HA 1VQKQ 5FRMA 2RF0A 2WSEE 3QIIA 3QBYA 4MMLA 4M7AA 1KQSP 2B86A 3EFSA 4LVMA 1Q86C 4LUEA 1VQ4T 5I11A 2MAMA 3QYHB 2CREA 3TCJA 2YRCA 3MF1A 4P75C 1OOTA 4LVIA 4ELYC 4M78E 3RMSA 1VYVA 4AG1C 1GBRA 2RQWA 1IREB 1FX7A 2LQNA 5GANj 2RI3A 3S6WA 3OYMA 1ZSZA 4M75B 2O88A 1A0NB 2ED0A 2ZIMA 4YRCA 4K11A 4PFZA 1YI2A 3CD6Q 3I7FA 5C0MA 4P73A 1Y71A 2EFIA 4Y92A 3OYEA 2M16A 4HVWA 5D6WA 3G71T 1GCPA 2Q7GA 3NEMA 2BIVA 2RQRA 3I55Q 2L8DA 1E1TA 3A8GB 4BE0A 4OLFA 2GFUA 4BY6B 3ICAA 4PHCA 1M27C 3HFZA 1TS9A 3QHSA 5KYNA 3G4SA 2GTJA 3CCJQ 4A4HA 4F14A 1M1KC 3G6EQ 1RADB 3INZA 3GOXA 4C8QA 4NS5A 3AT1B 2KT1A 4C92C 1NPRA 1TTHB 1I81A 1N9WA 4YYEA 1G3YA 3CCEA 3M54A 1X55A 4J9FA 4M75G 2L89A 1YFSA 2MWPA 1KC8C 4M7DC 2MWOA 2NUPB 1FXXA 4H2WA 4EDUA 1VQPT 3QZ9B 1TUGB 1XJWB 3C12A 1N9RA 3HXYA 1H4TA 4M78C 2Q5HA 2OJ2A 2YUNA 1LPLA 2ZZFA 1WYDA 5KNNA 4L5GA 2NUZA 1ZUYA 4OMNA 5J39A 2QEXQ 4JJNK 2ZTGA 1WJQA 4N0AC 5LJ5g 2ED1A 2F1LA 1K0XA 4BWAA 1YJNQ 1X2QA 3JCMP 4D8DA 1X6GA 2EQKA 2JTEA 1MUZA 1T3SA 2VGMA 3VKIA 2J05A 5GAN3 4XEOA 3I5SA 4ZN3A 1BU1A 1OPLA 1RIQA 1PHTA 5FW9A 2EQUA 2JS0A 3QWYA 2CIMA 2QHSA 2RH2A 2CDTA 4NL2A 1JJ2S 3CBOA 1W4SA 5ELNA 2RHUA 4OB1B 3OS0A 1G3SA 4E7SA 2YHTA 3M4QA 1TH7A 4M78D 2EGAA 2A37A 2RHXA 5GAN4 2P84A 4HXJA 3CC4A 1ASYA 4IUPA 2AIRB 3VS5A 3FLGA 1L0WA 3P8BB 4KULA 1JJCB 1W70A 2CP0A 3L42A 2K3BA 1FMKA 3CCUQ 2LNHB 1VQLT 3CCMQ 3H41A 2W10A 4F7UE 1LVKA 3EHRA 1VQMA 1XOVA 1YHQQ 4AFZC 1SHGA 2CYZB 2MPXC 1GBQA 3MQZA 2ZINA 2DXTA 2EYXA 2PVOB 5CCAA 2CZ0B 5LJ3j 2A3LA 1V76A 1M1GA 2LQWA 1VQ9T 1M4ZA 1ARKA 4P71A 1VQ5A 1VQ6T 3HY0A 5A0LA 3OYLA 5A0GA 1S72Q 1C6VX 5FROA 3BFMA 3OD1A 1B34B 1KHIA 5AT1B 2JVVA 2QHTA 2DIGA 4M7DB 4ZNXA 4C5HA 1ZA1B 4H2VA 3UWNA 2IY5B 2OAWA 1M8MA 2KQWA 4M78F 3REBB 4M78B 4ATOA 5CQYA 3H8ZA 4ORZA 5KH6A 4OGEA 4PJOE 3SDZA 2DKGA 3QTCA 4XTVA 4P74C 3JCMV 2VC8A 4HVVA 2O2OA 2E3IA 3EFRA 3TUPA 2I4NA 1CKBA 5FWBA 4M77A 4HWTA 4KR3A 1Q82R 4CS3A 3GBQA 5ECAA 1AWJA 2LMJA 5KYYB 3SFMA 1M3BA 5GMKh 1I0CA 1OX9A 4E7IA 2AMCB 4RG8A 1BYMA 4YREA 4PFPA 2WACA 4JDSA 1ASZA 3ULRB 3C4SA 1NE8A 1QVGA 2E6NA 1U06A 4QVDA 1YJWT 4JRIA 2KXCA 3V8JA 3RL6A 1QWFA 3HRTA 2LJ1A 2RHZA 4YRSA 4FCYA 1Z9QA 2QAZA 2VXFA 3I56A 2RHYA 3KUFA 4XAXB 1USYA 1WXUA 2OTJQ 2RJEA 2P4TA 4M78G 3X20B 1KMMA 3UT1A 4Z88A 4YRLA 3HXWA 2Q7HA 4OVAA 1M5Q1 2LTOA 3LGLA 3J81E 1RAIB 5CR2A 3LH5A 3JCMJ 4J5YA 3OMCA 5FRNA 1ATIA 4RG2A 1G51A 5IXFA 4IIMA 2MOXA 1TXQA 2CZ7B 1U5SA 1O9SA 1ZBJA 1MNEA 1YNZA 5M9OA 1ZUKA 2HKQB 1YJ9T 4J6WA 2LT1A 3M9QA 4RTVA 4DA4A 4FT2A 2ZT6A 1NEGA 1C0MA 1VQPA 4R55A 2CH4W 3CCLA 1QLYA 2HQEA 4JJCA 1WIEA 5C51B 2JOYA 2ALYA 2ROLA 3IG2A 4PJOD 2EJ9A 3ZFJA 4BI8B 1B3QA 1FMWA 4NL3A 1AHJB 3OBWA 5GAN2 2LC4A 1E6GA 3DLLA 4GLMA 4DPGA 1KD1R 2D0QB 3PNWC 4F7UF 4F7UB 3CCJA 2K5LA 1LNXA 4M7AE 3NFCA 3CCQA 3ER0A 2O9VA 4CRIA 2E10A 2J3MA 4EO4A 5KYUB 5GAN7 1YIJT 3G4SQ 5GANd 1SESA 3A31A 1G5VA 3A5YA 2Q5IA 2QQ9A 2COWA 2HZYA 1GCQC 3CMQA 2E41A 5IH2A 1B70B 2FZKB 3OS1A 3M5AA 3DLMA 1SHFA 1B07A 2CZ6B 3QWXX 5IHNA 3M4PA 3UF4A 2ZR2A 1SETA 3M53A 2DXUA 1KHCA 3CCEQ 3G1JA 2CUDA 1YITT 2RQVA 2QHVA 2QTVA 3BDUA 5CAIA 2GBQA 2JM9A 4PJOF 4PJOB 1UB4A 1QVGS 4O6JA 1RAGB 1N8RU 3CC2A 3JCMc 3LYIA 3HSBA 1K1ZA 1WHHA 3EFOB 1X56A 3EGUA 2H8HA 4ZN1A 1QCNA 1T3LA 4GBQA 4F7UG 1K76A 1IGQA 2FVUA 3QKJA 1BBUA 2ENMA 5AYFA 4C5GA 4C0DC 3JCMQ 4C8QE 2CKKA 1VQ6A 3HRKA 1KOGA 2XDPA 2PUKB 3EG0A 2DX1A 1H8KA 4CC3A 1T0JA 2KR3A 1WYXA 2K4YA 2KBTA 4MDXA 4UP7A 2SRCA 2DU5A 3MEUA 3ZEHA 4YRJA 1YWPA 3TREA 3M0SA 5GAN5 4JS5A 4M7AC 3OYDA 4A4GA 1YFTA 3FDRA 3A5ZB 2OX7A 2RQUA 3PT9A 4OMOA 1V29B 1LYLA 2YXYA 2V8IA 3VS1A 3FJPA 1AWWA 2XKOC 2GQVA 2QHUA 4JUVA 2JMCA 3I9QA 2QQRA 1SSHA 2HMAA 2DFUA 3J7AF 5CQXA 3NMZC 1IGUA 4PJOG 3JCMh 2LJ0A 4OB3B 4L6V5 2CP5A 1J3TA 3E19A 5FWCA 1YHQA 3S3NA 4X34A 3A7UA 1LCKA 3LLRA 1WDXA 4KRTA 1TWBA 4DQ2A 3OSVA 2FHDA 1WJRA 3MO8A 2X4YA 4GLKA 4E2FB 5K1PA 3WXMB 4J9IA 1VQMQ 3GNGA 4AFSC 4YRGA 3KFUA 3PCOB 3FC3A 1BBZA 1VQ8T 1Y57A 3MEAA 3UDCA 2B8AA 2F69A 4M7AD 1C0AA 2AKWA 2DIQA 1B7YB 2KEAA 2KRSA 1W2BA 3SWNA 2CGHA 3O8VA 1U1TA 2KYMA 3L2WA 1VQ5Q 2LP5A 1X01A 4YRRA 3EGXA 4IUTA 4L87A 2LCCA 3OB9A 2DNUA 2EPDA 2RHQB 2ATCB 4OMQA 3CXCP 1U1SA 2G6FX 2RHSA 1EFNA 2GCXA 4EMGA 4YRKA 1SSFA 3H0FA 4JLIA 2ZPIB 4KGXB 8ATCB 4RMFA 2MYSA 2RHIA 2DETA 2R5MA 2QTXA 2AK5A 1X69A 3VBBA 1M30A 4VUBA 4CC2A 3CCVA 4IUUA 4A63B 4C0DB 4J15A 3OW2P 5CO7A 2O4XA 4OB0B 4RTUA 2K79A 3HRIA 1X2HA 1NJ1A 2ARUA 4AG2C 2DPPB 4J9BA 1CSKA 2XTIA 1G3TA 2P0PA 4N4HA 1UDLA 2FG0A 4M7AB 3RNJA 4M7AF 2XK0A 5C53B 1RUWA 4YP0A 1OU9A 3EG9A 5IHKA 3IKLA 4P3NA 2DXCA 1Q7YR 5LJ5d 5D6XA 3QO7A 4X5OA 3M58A 3THKA 4OP0A 3G7ZA 2ZIOA 2MIOA 1QVFA 1TSFA 2MCNA 3CPFA 2J6OA 2QXFA 5D7UA 2HL5C 3I56Q 4TTVA 4K87A 4A4KA 4M77E 2XGTA 2QQBA 4X9CA 1VOMA 3RKWA 4WF2A 2OTLT 4CH4A 2FB7A 2EW3A 3JRZA 2DD5A 1K9MR 3CCRT 1MGQA 3WQZA 1X6BA 2XD0A 4EMKC 3HFZB 4PLIA 5LJ3f 1HSQA 2AZVA 1JB0E 5C52B 4LDWA 4M7AG 3HFVA 2EBPA 2E6ZA 3HXUA 4FT4A 1KD1C 1KQSA 5DLQE 1UG1A 4RCCA 1YGBA 3URGA 1KJWA 1PRLC 2M0OA 5GAMg 4LVKA 1ZX6A 1K9MU 2ZPBB 1M3CA 7AT1B 3HXXA 2RO0A 3M0QA 3CPWP 2CP2A 2A36A 3VS6A 1OI1A 4TVAA 5DM7R 1VQPQ 5IAYA 3CCLQ 2YWWA 3WVEB 4ZGEB 1YFRA 2LRQA 1YWOA 2NS6A 2D0NA 2QA4A 2DQ0A 4MMKA 3FIFA 2EL9A 2DBKA 2L3RA 1D1CA 2HBPA 2QG9B 3P8TA 3JCMb 5GMKe 4XEMA 3JCMf 3H6ZA 2CS7A 4TQFA 2DILA 4OB2B 2QGGA 2KSSA 3CEYA 1U8RA 4OMPA 1RAFB 4JJDA 3CC7T 1H3HA 1ZLMA 3W3SA 3OS5A 11ASA 2YDLA 4H2XA 3MP1A 3CCQQ 1HC7A 3DB3A 5KYXA 3PMTA 5A0DA 2NLUA 4CS2A 1PYSB 2KAFA 3E9IA 1NJIR 1USYC 2F2XA 1BBWA 5GAOl 4HA8A 2EQJA 4HCCA 3UA6A 1P92A 2H3EB 2DVEA 4IUVA 2DF6A 2MI6A 4HVUA 3LH0A 1PD0A 3OYIA 2E70A 4XTYA 4M77D 4PJJA 5GMKi 1G3WA 1O75A 1EOVA 2KMTA 4TWAA 2LCSA 1BK2A 1I5LA 1X27A 1EIYB 4RTXA 3VJPA 1BIBA 4FIBA 4EMKB 2NUTA 4LDYA 2AHJB 3LX7A 2CP3A 3A8LB 3CC2Q 4XTWA 3VRYA 3HRUA 5E3IA 2FPEA 2JUFA 2DM1A 4RQEA 4QQDA 1D1AA 1NJIU 5GAMe 1QVFS 4M75A 4XU2A 2XHCA 1ZQ1A 1X6OA 1VA7A 1VQ6Q 2XG8D 1TU0B 3EGDA 4JRQA 1NNHA 3REAB 3MEYA 4JPBW 5GMKl 3JAME 4RTTA 3SEMA 4JLGA 3RERA 1E22A 1WPYA 2X9HA 2K5IA 4BUGA 3E1SA 1H4QA 1WHKA 4XU0A 3MPUB 2WSFE 1UHFA 5EC7A 5GAOq 4PLLA 3OYJA 1HJDA 2D8HA 3G6ET 1QF6A 2D9TA 4M77F 4DOWA 1VQNT 2K7AA 5KYWA 1KQSS 3JCMg 2YUQA 1ZHIA 4Y91A 1Q81R 3M4YA 5FLXE 1JXOA 1IRXA 3OYHA 2HQHA 1WU7A 3VS3A 2BE7D 1PG5B 3MKDA 4P72C 1I5OB 5L23A 2CSQA 4KBMB 1CKAA 1JXMA 4IURA 2PMFA 2E5AA 4KH0B 1E7OA 3RGLA 3VQWA 5I22A 2Q7EA 3T9NA 3QDFA 2ZNJA 3QG1A 4ZIBA 1JQQA 3L1AA 4PJNA 1Q7YC 2RD1A 2FPFA 4YRPA 1XTDA 4XTZA 1BI1A 3CCSA 5LJ5j 1R8OB 1H641 2OTLA 1Q81U 3RACA 5HK3A 2O9SA 12ASA 1MMDA 1QW1A 3OYBA 1AEYA 4QQGA 2DZCA 1ABOA 4RQFA 3CCRA 3DB4A 1NJ2A 1X2KA 2FRWA 1XNIA 2GQIA 4FYWB 2I4OA 1YCSB 2ZNIA 2HL3A 4C5IA 4L59A 1K9MC 1KK7A 3CCVQ 4B6MA 1WHLA 1VQ7A 4HWOA 3META 4J9EA 3X24B 5GANh 1X54A 2X4JA 3R6NA 2ZAEA 3U23A 3CCUT 1VQ4A 4RKUE 1MV0B 4F04B 1VQZA 2G3RA 2ZPFB 2K2VA 4FYVB 3EG3A 1S1NA 4KGVB 5LL6S 2LQ8A
chains in the Genus database with same CATH topology
2ALYB 1S72T 3JCMe 3G71A 4XU1A 2ZGWA 2CJBA 2E65A 5KE3A 2KVQG 3L4GA 1Y96A 1BI2A 4C92A 1B34A 4LVJA 2KK4A 3JCMX 5CK9A 4PJOC 5F5WA 4B9XA 3OQ5A 4M7DA 3LWHA 2IY5A 2LDMA 2DQ3A 4KQEA 3GP8A 3CC7A 3CMAT 2VV5A 4YCWA 4YRIA 2EYQA 4O2DA 3IKMB 4ZGJB 3UFGA 3F70A 1KQ1A 4N0AA 2PVDB 3MEWA 2CJAA 3RF1A 2ZCFB 2LNVA 4OMFB 1JBMA 4YCVA 1NJIC 2ZXFA 2RA2A 4C0GA 4Z02A 1ZBXA 3QYGB 5KCHA 3HFNA 2OTJT 3QPHA 1KQ2A 2RM4A 2J3LA 4OGCA 3TEGA 3M55A 2I4LA 5GAOp 3P8HA 4UP8A 2DO3A 3C95A 1Z7MA 4H2UA 5CIUA 3QSUA 2JN0A 2MMPA 5GMKm 4P3OA 4HT9A 2DAQA 4XK8E 4KUIA 2DK3A 5HGQA 5L8RE 4TQDA 1EQRA 2PQWA 3R07A 1VQNA 5LJ3h 3A8MB 1LJOA 1VQLA 3G1ZA 3CBPA 4X9DA 2WSCE 1VQOT 4LDVA 3MCAB 4LD6A 1VQ9A 1NYQA 1FYFA 2R58A 2P0KA 5GAN6 4H02A 1YI2T 2K57A 1Q81C 2YLBA 5LJ5h 3OY9A 2ARTA 5J26A 3PZCA 2ZZGA 2DXBA 5GANf 2EAYA 2H3JA 3NELA 4YRTA 5FU7C 2VUBA 3TU4K 5K1XA 2E64A 5A2QE 1BI3A 3QZ5B 5GAMd 4P73C 2EIFA 3QJYA 5IT9E 3V8LA 1XQHA 3JB9J 3QXEB 2ARSA 4M75E 2O4XB 1B70A 3CCET 3UGTA 2L5QA 1FWZA 4WJ4A 3E9FA 1M1KU 4CH3A 2ZCEA 1YJWA 3VUZA 2DU7A 1D3BA 2Y4XA 3UH0A 1HK9A 5I21A 1GXIE 4A4FA 2CZ1B 4ZTJA 4RMOA 4C8QC 1KC8U 3CXCA 4E7JA 4WJ3M 3HP9A 2XDDA 2EQMA 4TVYA 4YDQA 2EJGA 3OYCA 4Q6GA 3DKMA 1K8AU 1WNLA 3TEHA 4C5EA 4HCZA 5ELOA 4RDXA 3R6OA 2DTHA 3EAEA 2YRVA 3HRSA 1G5HA 3OW2A 3LGFA 3LSSA 4II1A 2QQAA 3RMQA 2YLCA 3OYYA 2DTOA 4BW9A 4EMHA 3ZBDA 2XI9A 1UGRB 3CC4T 3LWIA 3RESA 4C8QD 1EIFA 1Z7NA 1YJ9A 1B8AA 5J3BA 4PKCC 4NOYA 2VYTA 2RI5A 2GF7A 5GANg 2QDYB 5FU7B 1YCYA 4K86A 4PG3A 3A32A 3MF2A 5CKFA 4TVAB 3GLXA 2RJDA 4JRKA 5CKBA 2DZ9A 1NJ8A 4MZMA 4Q15A 1GGMA 4D6WA 1VQ5T 1B7YA 2ODRD 4J7FA 1Y07A 1MHNA 1NZ9A 4CH5A 5HY6A 4QQ6A 5FU6B 4KT0E 4M75D 3VQYA 2RHQA 1ADJA 2XICA 4H2XB 4DOVA 2PVGB 3GNFB 3A74A 1YIJA 4P71C 1IZ6A 4C8QF 4C8QB 3HFOA 4N4GA 4LNSA 4H2YA 3FB9A 3L2ZA 1EFWA 2DD4A 2LX9A 1N8RC 3OSSC 5LJ5f 2X35A 3CPWA 5CKEA 3S3MA 3MHXA 1YITA 1BIAA 4C92E 1SRYA 1DJ7B 1J5WA 2R5AA 3JSCA 4FL6A 3VUBA 4XQ3A 3V7CA 1M9SA 5DY9A 4M7DE 5GMKj 3ERRA 2FL7A 3X26B 4M77C 3V7RA 3GPLA 2R57A 1VQOA 1W2BS 3LW5E 3I56T 5DLOA 4M75F 3TEEA 4XTXA 3CXCS 2K3YA 3CMET 5GANe 4C8QG 4JRPA 2I2LA 1I4K1 4YRMA 2PU9B 3RKYA 4H2TA 3VV0A 2X4XA 4C0FA 4A53A 3MP8A 3HTZA 3OW2S 3FEOA 2LVMA 2HQXA 1VQKT 2F5TX 4MZPA 1WLEA 3L2QA 4IUQA 4FU6A 4NCXA 2F5KA 4E51A 2PMEA 4XU3A 4ZTZB 3RKXA 1QVPA 3A7RA 3MEVA 5GAMj 3PIOA 3AHUA 5LJ3g 1VIFA 3VU3C 3CD6T 2X4WA 2A7YA 1VQ8A 3CCLT 4AH6A 3LSQA 4HT4A 4BI4A 1K8AC 3I55T 3OYGA 5CKHA 2DJZA 1K73U 4BI3A 4E7HA 3CCJT 3QNEA 3OYFA 4J7IA 2VGNA 3CCQT 4C92D 1H3ZA 4M77B 4J8OA 1UGPB 3JB9D 4KUDK 4M7DD 4MZTA 3L2VA 1PYSA 4N4IA 4UC4A 3JB9H 4J6YA 2XDBA 2XU8A 3CPWS 3M4GA 3IALA 2ZT8A 2LT4A 3HHTB 3C94A 4YCUA 2QEXT 4YRQA 1HTTA 3NTIA 1EIYA 3Q1JA 3CC2T 4EMKA 1YJNT 4P3PA 3M57A 1EVLA 1BI0A 1OYXA 5C6SA 3L4GB 2JNGA 2BUDA 4M77G 1Y96B 4C92F 5LJ3e 4C92B 4CS4A 4P5NA 4ZGDB 3PTAA 5D6YA 3JB9F 5GAOn 3J80E 4M7DF 3PMIA 3HXZA 4P75A 2I4MA 2KY9A 2ZPEB 3KBGA 3SB2A 1YB3A 5LJ5e 1JRIA 3MP6A 3OS2A 2BKDN 1JJCA 3NTKA 3CCMT 3KXTA 2A8EA 2K5FA 1YHQT 1E1OA 1UEBA 4Y28E 5I2MA 2IG0A 2JZ2A 2G4CA 4C92G 2K3XA 4EX5A 3JB9I 3JB9G 1H4SA 4M7DG 1NJ6A 3JCMW 3S3OA 3P8VA 1UGSB 2RK1A 4HWRA 1Q82U 4QW2A 3CMEA 4FM4B 1WJSA 1RI0A 1SERA 4M78A 1M90U 3QO3A 3V8KA 3SWNC 2EWNA 3LC0A 3UPUA 4UP9A 3CCVT 4YRNA 5I2SA 5GAOm 3NTHA 2VXEA 2Y90A 1VQKA 4BE2A 3BY7A 1ADYA 5GAMh 2AMCA 2E5QA 1Y7XA 3VQXA 3P8DA 4QVZA 3CBMA 5CKDA 3OYNA 3GF5A 4LDUA 3GIBA 1RL2A 3REUA 3CD6A 5HKCA 2MF2A 4ELZC 1KG1A 4YRFA 1LOJA 4G85A 3N5BB 1K73C 2IVWA 3REXA 2E3CA 3I55A 1M1FA 2LQKA 3BW1A 2QI2A 3RUXA 3A8OB 2HAXA 2E1HA 4BB7A 5HK0A 1UGQB 3QDRB 2ZPGB 1BKBA 1YBYA 3G6EA 3PFSA 4P72A 4LVLA 2O01E 4CH6A 4YPFA 1WGSA 4JS4A 4HKEA 3HPWA 4O5VA 5KE2A 4PNOA 3UGQA 2KDSA 2LCLA 4FSXA 2JTMA 1VUBA 4ZTUB 1PSEA 4LDXA 4E7KA 1VIEA 2RJCA 1KD1U 1D3BB 3OMGA 2AKWB 4GY5A 3SWNB 4P74A 3PGGA 4PL6A 2QEXA 1Q86U 2M1HA 1B76A 3E9HA 4BDZA 2RI2A 4H2SA 2QA4T 1YJNA 3VYHB 4ZTFA 3HKSA 2ZR3A 2DTIA 2RHSB 1IL2A 3VQVA 1X2GA 4J6XA 3QO8A 2E12A 4F7UA 3TEHB 5KCOA 4BE1A 4K88A 3G4ST 1OZ3A 4XTUA 2DEQA 3X25B 2QQSA 4EPCA 4MDWA 3PIPA 4G84A 2D6FA 3HY1A 5IN1A 4RCBA 5FU6C 4HCBA 3OBYA 3QUIA 3E9GA 3BDLA 4BD3A 1N27A 3X28B 3CCUA 4R56A 3CCMA 4TVRA 4YROA 1QP2A 1EVKA 3DSQA 4Q5WA 4E7LA 4HVCA 4PJOA 4QVCA 1W66A 1QE0A 2ZPHB 4IKFA 3M56A 3NETA 4YTLA 3RIRA 1G5IA 4ME7A 1S72A 1Q82C 3WVDB 1N6AA 2JTFA 4V2SA 1OZ2A 2HD0A 1M90C 2OAUA 1WQWA 4C0ZA 5GAMf 3OYKA 1X75C 2ODRC 4TVWA 2M9UA 3V7SA 3A5ZA 1WQ7A 3ME9A 3CMAA 2DDZA 2V8KA 5GAOr 1M8VA 2ZZDA 2GFAA 1NYRA 1E24A 1NPPA 3FRNA 3M59A 4A4EA 1HXDA 4M75C 4UPAA 1N9SA 3OYAA 2RK2A 4WI1A 4OF1A 3NENA 1QP3A 3HXVA 5LJ3d 3OA6A 2PUOB 5EG2A 2V8JA 3A8HB 2P0QA 5CVIA 3L2RA 3QO5A 4HWSA 1VQMT 1NJ5A 2RJFA 4J83A 4BY6C 2RB6A 3BJUA 2XIDA 3HL8A 3VYGA 4KR2A 2ZZEA 3PCOA 4LD9K 4B9WA 2EKOA 5GAN8 2P0LA 2OTJA 2HNIA 4E47A 3QJ6A 2CJ9A 4BACA 2ZT7A 3P8YA 3CCST 3ASKA 4HT8A 4A54A 4HWPA 2C06A 3JCMd 2EJFA 4CI0C 1JJ2A 2P5IA 2ZT5A 1Q7YU 3A7AA 1KMNA 2C8MA 2FYKA 4BDYA 1I8FA 1VQ7T 2C7IA 3L2UA 3SD4A 1PSFA 2Y4YA 5FRMA 2WSEE 3QIIA 3QBYA 4MMLA 4M7AA 3EFSA 4LVMA 1Q86C 1VQ4T 2MAMA 3QYHB 3TCJA 3MF1A 4P75C 4LVIA 4ELYC 4M78E 3RMSA 1H4VB 1FX7A 1IREB 5GANj 2RI3A 3S6WA 3OYMA 4M75B 2ZIMA 4YRCA 1YI2A 3I7FA 5C0MA 4P73A 1Y71A 2EFIA 3OYEA 2M16A 5D6WA 3G71T 2Q7GA 3NEMA 2BIVA 2L8DA 1E1TA 3A8GB 4BE0A 4OLFA 2GFUA 4BY6B 3ICAA 4PHCA 3HFZA 3QHSA 3G4SA 4A4HA 1M1KC 3INZA 3GOXA 4C8QA 4NS5A 4C92C 1NPRA 1I81A 1N9WA 4YYEA 1G3YA 3CCEA 3M54A 1X55A 4M75G 2L89A 1YFSA 2MWPA 1KC8C 4M7DC 2MWOA 1FXXA 4H2WA 4EDUA 1VQPT 3QZ9B 3C12A 1N9RA 3HXYA 1H4TA 4M78C 2Q5HA 2ZZFA 1WYDA 5KNNA 4L5GA 4JJNK 5J39A 2ZTGA 1WJQA 4N0AC 5LJ5g 4BWAA 3JCMP 2EQKA 2VGMA 3VKIA 5GAN3 4XEOA 4ZN3A 1RIQA 2EQUA 2CIMA 2QHSA 2RH2A 4NL2A 1JJ2S 3CBOA 1W4SA 5ELNA 2RHUA 4OB1B 3OS0A 1G3SA 2YHTA 3M4QA 1TH7A 4M78D 2RHXA 5GAN4 3CC4A 1ASYA 4IUPA 3FLGA 1L0WA 3P8BB 4KULA 1JJCB 3L42A 1VQLT 4F7UE 1VQMA 1XOVA 2CYZB 3MQZA 2ZINA 2DXTA 5CCAA 2PVOB 2CZ0B 5LJ3j 2A3LA 1M1GA 1VQ9T 1M4ZA 4P71A 1VQ5A 1VQ6T 3HY0A 5A0LA 3OYLA 5A0GA 5FROA 3BFMA 3OD1A 1B34B 1KHIA 2JVVA 2QHTA 2DIGA 4M7DB 4C5HA 4H2VA 3UWNA 2IY5B 2KQWA 4M78F 4M78B 4ATOA 5CQYA 3H8ZA 5KH6A 4OGEA 4PJOE 3SDZA 2DKGA 3QTCA 4XTVA 4P74C 3JCMV 2VC8A 3EFRA 3TUPA 2I4NA 4M77A 4HWTA 4KR3A 4CS3A 3SFMA 5GMKh 4E7IA 2AMCB 4RG8A 1BYMA 4YREA 2WACA 4JDSA 1ASZA 3C4SA 1NE8A 1QVGA 2E6NA 4QVDA 1YJWT 4JRIA 3V8JA 3RL6A 3HRTA 2RHZA 4YRSA 2VXFA 3I56A 2RHYA 3KUFA 4XAXB 1USYA 2RJEA 2P4TA 4M78G 3X20B 1KMMA 3UT1A 4YRLA 3HXWA 2Q7HA 4OVAA 1M5Q1 2LTOA 3LGLA 3J81E 5CR2A 3JCMJ 4J5YA 3OMCA 5FRNA 1ATIA 4RG2A 1G51A 2CZ7B 1O9SA 5M9OA 1YJ9T 4J6WA 2LT1A 3M9QA 4DA4A 4FT2A 2ZT6A 1VQPA 4R55A 3CCLA 2HQEA 5C51B 2JOYA 2ALYA 3IG2A 4PJOD 2EJ9A 3ZFJA 4BI8B 4NL3A 1AHJB 3OBWA 5GAN2 2LC4A 3DLLA 4DPGA 2D0QB 3PNWC 4F7UF 4F7UB 3CCJA 2K5LA 1LNXA 4M7AE 3NFCA 3CCQA 3ER0A 4CRIA 2E10A 2J3MA 4EO4A 5GAN7 1YIJT 5GANd 1SESA 3A31A 1G5VA 3A5YA 2Q5IA 2QQ9A 3CMQA 2E41A 1B70B 3OS1A 3M5AA 3DLMA 2CZ6B 3M4PA 2ZR2A 1SETA 3M53A 2DXUA 1KHCA 1YITT 2QHVA 3BDUA 5CAIA 4PJOF 4PJOB 1UB4A 1QVGS 4O6JA 1N8RU 3CC2A 3JCMc 3LYIA 3HSBA 1X56A 4ZN1A 4F7UG 2FVUA 3QKJA 1BBUA 5AYFA 4C5GA 4C0DC 3JCMQ 4C8QE 2CKKA 1VQ6A 3HRKA 1KOGA 2XDPA 2PUKB 4UP7A 2K4YA 4MDXA 2DU5A 3MEUA 3ZEHA 4YRJA 3TREA 5GAN5 4JS5A 4M7AC 3OYDA 4A4GA 1YFTA 3FDRA 3A5ZB 3PT9A 1V29B 1LYLA 2V8IA 3FJPA 2XKOC 2GQVA 2QHUA 4JUVA 2QQRA 3J7AF 5CQXA 4PJOG 3JCMh 4OB3B 4L6V5 3E19A 1YHQA 3S3NA 4X34A 3A7UA 3LLRA 4DQ2A 3OSVA 2FHDA 1WJRA 3MO8A 2X4YA 4GLKA 5K1PA 3WXMB 3GNGA 4YRGA 3KFUA 3PCOB 3FC3A 1VQ8T 3MEAA 3UDCA 2B8AA 2F69A 4M7AD 1C0AA 2AKWA 2DIQA 1B7YB 1W2BA 3SWNA 2CGHA 3O8VA 1U1TA 3L2WA 1X01A 4YRRA 4L87A 4IUTA 2LCCA 3OB9A 2RHQB 1U1SA 2RHSA 2GCXA 4EMGA 4YRKA 1SSFA 4JLIA 2ZPIB 4RMFA 2RHIA 2R5MA 2QTXA 3VBBA 4VUBA 3CCVA 4IUUA 4C0DB 4J15A 5CO7A 2O4XA 4OB0B 3HRIA 1X2HA 1NJ1A 2ARUA 2DPPB 2XTIA 1G3TA 2P0PA 4N4HA 4M7AB 4M7AF 5C53B 2XK0A 4YP0A 4P3NA 3IKLA 2DXCA 5LJ5d 5D6XA 3QO7A 4X5OA 3M58A 4OP0A 3G7ZA 2ZIOA 1QVFA 3CPFA 2QXFA 4TTVA 4K87A 4A4KA 4M77E 2XGTA 2QQBA 4X9CA 3RKWA 4WF2A 2OTLT 4CH4A 2FB7A 3JRZA 2DD5A 3CCRT 1MGQA 3WQZA 2XD0A 4EMKC 3HFZB 4PLIA 5LJ3f 1JB0E 5C52B 4LDWA 4M7AG 3HFVA 3HXUA 2E6ZA 4FT4A 1KD1C 1KQSA 5DLQE 4RCCA 1YGBA 3URGA 2M0OA 5GAMg 4LVKA 1K9MU 2ZPBB 3HXXA 2RO0A 1OI1A 4TVAA 5DM7R 5IAYA 3WVEB 4ZGEB 1YFRA 2LRQA 2NS6A 2DQ0A 2QA4A 4MMKA 3FIFA 2EL9A 2L3RA 2HBPA 3P8TA 3JCMb 5GMKe 4XEMA 3JCMf 3H6ZA 2CS7A 4TQFA 4OB2B 2KSSA 3CEYA 1U8RA 3CC7T 3W3SA 3OS5A 11ASA 4H2XA 3MP1A 1HC7A 3DB3A 3PMTA 5A0DA 2NLUA 4CS2A 1PYSB 2KAFA 3E9IA 1USYC 1BBWA 5GAOl 4HA8A 2EQJA 4HCCA 1P92A 2DVEA 4IUVA 2MI6A 3LH0A 3OYIA 2E70A 4XTYA 4M77D 1EOVA 5GMKi 1O75A 1G3WA 2KMTA 4TWAA 1I5LA 1EIYB 3VJPA 1BIBA 4FIBA 4EMKB 4LDYA 2AHJB 3LX7A 3A8LB 4XTWA 3HRUA 5E3IA 2JUFA 4RQEA 4QQDA 1NJIU 5GAMe 1QVFS 4M75A 4XU2A 2XHCA 1ZQ1A 1X6OA 2XG8D 4JRQA 1NNHA 3MEYA 5GMKl 3JAME 4JLGA 3RERA 1E22A 1WPYA 2K5IA 4BUGA 3E1SA 1H4QA 4XU0A 2WSFE 5GAOq 4PLLA 3OYJA 3G6ET 1QF6A 2D9TA 4M77F 4DOWA 1VQNT 1KQSS 3JCMg 1ZHIA 4Y91A 3M4YA 5FLXE 3OYHA 1WU7A 4P72C 4KBMB 4IURA 2PMFA 2E5AA 3RGLA 3VQWA 2Q7EA 3T9NA 2ZNJA 3QG1A 4ZIBA 3L1AA 1Q7YC 2RD1A 4YRPA 1XTDA 4XTZA 1BI1A 3CCSA 5LJ5j 1R8OB 1H641 2OTLA 1Q81U 3RACA 5HK3A 12ASA 1QW1A 3OYBA 4QQGA 2DZCA 4RQFA 3CCRA 3DB4A 1NJ2A 1XNIA 2I4OA 2ZNIA 4C5IA 4L59A 1K9MC 1VQ7A 4HWOA 3META 3X24B 5GANh 1X54A 2X4JA 3CCUT 1VQ4A 4RKUE 1VQZA 2G3RA 2ZPFB 2K2VA 5LL6S 2LQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSQ A;  2ALY B;  1BBU A;  3JCM e;  4XU1 A;  2ZGW A;  2CJB A;  3JCM Q;  4C8Q E;  3HRK A;  2E65 A;  1KOG A;  2CJ9 A;  3L4G A;  1Y96 A;  4UP7 A;  4C92 A;  2DU5 A;  2DJZ A;  1B34 A;  2ZT7 A;  4YRJ A;  3P8Y A;  3JCM X;  4PJO C;  5GAN 5;  5F5W A;  4M7A C;  4HT8 A;  1YFT A;  4A54 A;  4HWP A;  4M7D A;  3QNE A;  3JCM d;  2EJF A;  2P5I A;  2P0L A;  1LYL A;  2IY5 A;  2DQ3 A;  2ZT5 A;  4KQE A;  3FJP A;  4C92 D;  4YCW A;  2QHU A;  4M77 B;  4JUV A;  1KMN A;  3A7A A;  4YRI A;  2C8M A;  3JB9 D;  2FYK A;  4M7D D;  4O2D A;  1I8F A;  4PJO G;  3JCM h;  1PYS A;  3IKM B;  3JB9 H;  4J6Y A;  2C7I A;  3UFG A;  1KQ1 A;  4N0A A;  2CJA A;  3M4G A;  3A7U A;  3RF1 A;  4MML A;  4M7A A;  2ZT8 A;  1JBM A;  3IAL A;  3EFS A;  4YCV A;  4DQ2 A;  5K1P A;  4YCU A;  2ZXF A;  3MF1 A;  4P75 C;  4YRQ A;  2RA2 A;  4YRG A;  1HTT A;  1EIY A;  4M78 E;  3KFU A;  3PCO B;  5GAN j;  1H4V B;  4EMK A;  4M75 B;  1C0A A;  4M7A D;  2AKW A;  1B7Y B;  2ZIM A;  4YRC A;  3SWN A;  2CGH A;  3HFN A;  3I7F A;  4P3P A;  1U1T A;  1EVL A;  4P73 A;  1X01 A;  1KQ2 A;  2RM4 A;  4YRR A;  2Q7G A;  4L87 A;  3L4G B;  3NEM A;  4M77 G;  1Y96 B;  2J3L A;  2RHQ B;  3TEG A;  4C92 F;  5LJ3 e;  4C92 B;  2I4L A;  4CS4 A;  1U1S A;  5GAO p;  4UP8 A;  1E1T A;  1Z7M A;  2RHS A;  3JB9 F;  4H2U A;  4OLF A;  5GAO n;  3QSU A;  2JN0 A;  4EMG A;  3ICA A;  4M7D F;  4PHC A;  4YRK A;  4JLI A;  3HXZ A;  3HFZ A;  4P75 A;  5GMK m;  4P3O A;  4RMF A;  2I4M A;  3QHS A;  4HT9 A;  2QTX A;  3SB2 A;  3VBB A;  3INZ A;  5HGQ A;  4C8Q A;  1YB3 A;  5LJ5 e;  4J15 A;  4TQD A;  1JRI A;  4C92 C;  1I81 A;  1N9W A;  1EQR A;  4YYE A;  1JJC A;  3HRI A;  3R07 A;  1X2H A;  1X55 A;  1NJ1 A;  2ARU A;  4M75 G;  1YFS A;  5LJ3 h;  4M7D C;  2XTI A;  1LJO A;  1E1O A;  4M7A F;  5C53 B;  4M7A B;  4H2W A;  3G1Z A;  4YP0 A;  4P3N A;  3IKL A;  1N9R A;  5LJ5 d;  1H4T A;  3HXY A;  4M78 C;  3QO7 A;  4X5O A;  2Q5H A;  4X9D A;  2G4C A;  4OP0 A;  4C92 G;  2ZIO A;  2ZZF A;  1NYQ A;  4EX5 A;  1FYF A;  1WYD A;  5KNN A;  5GAN 6;  3JB9 I;  3JB9 G;  4H02 A;  2ZTG A;  1H4S A;  2K57 A;  4M7D G;  1NJ6 A;  4TTV A;  3JCM W;  4N0A C;  2YLB A;  5LJ5 g;  5LJ5 h;  4K87 A;  4M77 E;  2XGT A;  2ART A;  4BWA A;  4X9C A;  3P8V A;  3JCM P;  3RKW A;  4WF2 A;  4CH4 A;  2FB7 A;  3PZC A;  4HWR A;  2ZZG A;  5GAN f;  2EAY A;  5GAN 3;  4XEO A;  3NEL A;  4YRT A;  1SER A;  1RIQ A;  1MGQ A;  4M78 A;  3WQZ A;  4EMK C;  3HFZ B;  2CIM A;  2QHS A;  5LJ3 f;  5K1X A;  2E64 A;  3QO3 A;  3SWN C;  3V8K A;  4NL2 A;  5GAM d;  4P73 C;  5ELN A;  2EWN A;  5C52 B;  4M7A G;  3LC0 A;  3HFV A;  3HXU A;  2YHT A;  3M4Q A;  1TH7 A;  3V8L A;  4M78 D;  4UP9 A;  5GAN 4;  4YRN A;  3JB9 J;  1ASY A;  5GAO m;  4RCC A;  2Y90 A;  2VXE A;  4M75 E;  2ARS A;  1L0W A;  1YGB A;  1B70 A;  3BY7 A;  1ADY A;  1JJC B;  5GAM g;  5GAM h;  2AMC A;  3UGT A;  4WJ4 A;  3VQX A;  4CH3 A;  2ZCE A;  3HXX A;  2DU7 A;  4F7U E;  1D3B A;  3UH0 A;  1HK9 A;  5I21 A;  4TVA A;  3GIB A;  2ZIN A;  3REU A;  2DXT A;  4C8Q C;  5LJ3 j;  1YFR A;  4YRF A;  1LOJ A;  4P71 A;  4G85 A;  3HY0 A;  2DQ0 A;  4WJ3 M;  4MMK A;  3FIF A;  3REX A;  2EL9 A;  3BFM A;  3P8T A;  3OD1 A;  3JCM b;  4TVY A;  1B34 B;  5GMK e;  2E3C A;  4XEM A;  3JCM f;  4YDQ A;  2EJG A;  4TQF A;  3BW1 A;  4Q6G A;  3RUX A;  2QHT A;  4M7D B;  2E1H A;  1WNL A;  3TEH A;  4H2V A;  2IY5 B;  5ELO A;  4RDX A;  3W3S A;  2DTH A;  11AS A;  4M78 F;  4M78 B;  4H2X A;  1G5H A;  4PJO E;  3LSS A;  2DKG A;  3QTC A;  4XTV A;  1HC7 A;  4P74 C;  3JCM V;  4P72 A;  4CS2 A;  2YLC A;  2VC8 A;  1PYS B;  3EFR A;  3TUP A;  2I4N A;  3E9I A;  4CH6 A;  4M77 A;  4HWT A;  4YPF A;  2DTO A;  4BW9 A;  4EMH A;  1USY C;  1BBW A;  5GAO l;  4KR3 A;  4HA8 A;  4CS3 A;  3RES A;  4C8Q D;  5GMK h;  1Z7N A;  2DVE A;  4PNO A;  2AMC B;  4YRE A;  1B8A A;  3UGQ A;  4XTY A;  4M77 D;  5GMK i;  1EOV A;  1ASZ A;  4NOY A;  4TWA A;  4ZTU B;  1I5L A;  4QVD A;  5GAN g;  1EIY B;  4JRI A;  1BIB A;  1D3B B;  4EMK B;  3V8J A;  1YCY A;  3RL6 A;  2AKW B;  4K86 A;  4PG3 A;  3A32 A;  3SWN B;  3MF2 A;  4P74 A;  4TVA B;  3PGG A;  4XTW A;  4YRS A;  5E3I A;  4JRK A;  2DZ9 A;  2VXF A;  1B76 A;  1NJ8 A;  3E9H A;  4RQE A;  4Q15 A;  1GGM A;  5GAM e;  1USY A;  4M75 A;  4H2S A;  4XU2 A;  1B7Y A;  4M78 G;  2ODR D;  1KMM A;  2ZR3 A;  4YRL A;  3HXW A;  2Q7H A;  4CH5 A;  2DTI A;  2RHS B;  1IL2 A;  1NNH A;  3MEY A;  3VQV A;  1M5Q 1;  1X2G A;  5GMK l;  4J6X A;  3QO8 A;  4M75 D;  4F7U A;  3TEH B;  3VQY A;  2RHQ A;  1ADJ A;  3RER A;  1E22 A;  1WPY A;  4K88 A;  3JCM J;  4XTU A;  2DEQ A;  4H2X B;  1H4Q A;  4J5Y A;  4XU0 A;  5GAO q;  1ATI A;  3A74 A;  4P71 C;  4G84 A;  4C8Q F;  4C8Q B;  3HY1 A;  1G51 A;  3HFO A;  4LNS A;  1QF6 A;  4H2Y A;  3FB9 A;  4M77 F;  3L2Z A;  4RCB A;  1EFW A;  3QUI A;  5LJ5 f;  3JCM g;  4J6W A;  1BIA A;  4Y91 A;  4C92 E;  1SRY A;  1J5W A;  4YRO A;  1EVK A;  3DSQ A;  4HVC A;  4PJO A;  4XQ3 A;  2ZT6 A;  4QVC A;  3V7C A;  1QE0 A;  1W66 A;  1WU7 A;  5DY9 A;  4M7D E;  5GMK j;  3ERR A;  4P72 C;  3NET A;  4M77 C;  3V7R A;  2PMF A;  2E5A A;  5C51 B;  3RIR A;  1G5I A;  2ALY A;  3RGL A;  3VQW A;  2Q7E A;  3IG2 A;  4PJO D;  2EJ9 A;  4M75 F;  4NL3 A;  4XTX A;  2ZNJ A;  4ZIB A;  3L1A A;  4V2S A;  5GAN e;  5GAN 2;  2RD1 A;  4C8Q G;  4YRP A;  1WQW A;  4XTZ A;  2I2L A;  5GAM f;  4DPG A;  5LJ5 j;  1H64 1;  4F7U F;  3RAC A;  4F7U B;  1I4K 1;  4YRM A;  1LNX A;  3RKY A;  3V7S A;  12AS A;  2ODR C;  3A5Z A;  4TVW A;  4H2T A;  1WQ7 A;  4M7A E;  2DZC A;  2DDZ A;  5GAO r;  4A53 A;  1M8V A;  4RQF A;  2E10 A;  2J3M A;  4EO4 A;  1NYR A;  1E24 A;  5GAN 7;  1NJ2 A;  5GAN d;  1SES A;  1HXD A;  4M75 C;  3A31 A;  3HTZ A;  4UPA A;  3A5Y A;  1N9S A;  2Q5I A;  2I4O A;  4WI1 A;  2ZNI A;  3CMQ A;  2E41 A;  1B70 B;  3NEN A;  1WLE A;  3HXV A;  5LJ3 d;  4HWO A;  3M4P A;  2ZR2 A;  1SET A;  2DXU A;  4NCX A;  5GAN h;  4E51 A;  1X54 A;  3QO5 A;  2PME A;  4XU3 A;  4HWS A;  4ZTZ B;  2QHV A;  1NJ5 A;  3RKX A;  3A7R A;  5GAM j;  3BDU A;  3AHU A;  2RB6 A;  3BJU A;  5CAI A;  5LJ3 g;  4PJO F;  4PJO B;  1VQZ A;  3VU3 C;  3JCM c;  4KR2 A;  2ZZE A;  3PCO A;  3HSB A;  1X56 A;  4AH6 A;  5GAN 8;  4F7U G;  2HNI A; 
#chains in the Genus database with same CATH topology
 2ALY B;  2FPD A;  2YT6 A;  1WX6 A;  1S72 T;  3JCM e;  4IIO A;  3G71 A;  4XU1 A;  2DJQ A;  2ZGW A;  1I1J A;  2CJB A;  2E65 A;  5KE3 A;  2KVQ G;  4E7Z A;  3L4G A;  2E4H A;  1Y96 A;  1BI2 A;  4C92 A;  2DMO A;  1B34 A;  1U3O A;  4LVJ A;  1AD5 A;  2KK4 A;  3JCM X;  5CK9 A;  4PJO C;  1WZO A;  2J06 A;  5F5W A;  4B9X A;  3OQ5 A;  4M7D A;  1ZUU A;  3LWH A;  2IY5 A;  2LDM A;  2DQ3 A;  4KQE A;  3GP8 A;  3CC7 A;  3CMA T;  2VV5 A;  4YCW A;  4YRI A;  1D0X A;  2JT4 A;  2EYQ A;  3VS4 A;  4O2D A;  1RLP C;  4F17 A;  2JM8 A;  3IKM B;  1AWX A;  4ZGJ B;  3UFG A;  3F70 A;  1KQ1 A;  1E6H A;  4N0A A;  2PVD B;  5KYY A;  1FMV A;  3MEW A;  2CJA A;  3RF1 A;  2ZCF B;  2LNV A;  4OMF B;  1JBM A;  4YCV A;  1WHG A;  2P4R A;  2DEU A;  5GJW B;  1NJI C;  1YIT Q;  2ZXF A;  2RA2 A;  2ROT A;  4C0G A;  4Z02 A;  1ZBX A;  2C0T A;  3QYG B;  1WHM A;  5KCH A;  3HFN A;  2OTJ T;  3QPH A;  1M2V B;  1RAA B;  3VRZ A;  2QA4 Q;  1KQ2 A;  2RM4 A;  6AT1 B;  2J3L A;  1WHJ A;  4OGC A;  3TEG A;  2J6F A;  3M55 A;  3D7S B;  2I4L A;  5GAO p;  3P8H A;  4UP8 A;  2DO3 A;  3C95 A;  1Z7M A;  4H2U A;  2DYI A;  1N8R R;  1QQJ A;  5CIU A;  4J9C A;  2JN0 A;  3QSU A;  2MMP A;  3NHN A;  2VVK A;  5GMK m;  4P3O A;  4HT9 A;  2NYS A;  1NM7 A;  2CT3 A;  2DAQ A;  4XK8 E;  4KUI A;  2DK3 A;  5HGQ A;  1OV3 A;  1QMC A;  2JJ9 A;  5L8R E;  2KNB B;  4TQD A;  2KI7 A;  4LUD A;  4DBF A;  2RQT A;  1EQR A;  2PQW A;  3R07 A;  1PRM C;  1VQN A;  5LJ3 h;  2LX7 A;  3A8M B;  1LJO A;  1VQL A;  2DL5 A;  4FYX B;  3G1Z A;  4DEX A;  2EGC A;  4PFO A;  3CBP A;  2J6K A;  4X9D A;  2WSC E;  1VQO T;  2BZ8 A;  1SPK A;  4LDV A;  3MCA B;  4LD6 A;  1VQ9 A;  1NYQ A;  2DLP A;  3M0P A;  1FYF A;  4FW2 A;  2R58 A;  2P0K A;  5GAN 6;  4H02 A;  1K0S A;  1YI2 T;  2QYZ A;  2K57 A;  1ZA2 B;  2YLB A;  5LJ5 h;  3OY9 A;  1Q81 C;  2RN8 A;  2ART A;  2KXD A;  4J9D A;  3EGX B;  5J26 A;  3E2U A;  3PZC A;  1C1A A;  2ZZG A;  2DXB A;  1OX8 A;  5GAN f;  2EAY A;  2H3J A;  2X3X D;  3UAT A;  3NEL A;  4YRT A;  5FU7 C;  2VUB A;  3PE0 A;  3A98 A;  1ZSZ C;  3EG1 A;  3TU4 K;  5K1X A;  2E64 A;  5A2Q E;  1BI3 A;  3QZ5 B;  5GAM d;  4P73 C;  2EIF A;  1G8X A;  3QJY A;  5IT9 E;  5KYU A;  3V8L A;  1XQH A;  1VYU A;  4FW1 A;  3JB9 J;  3QXE B;  1ZSG A;  4RTW A;  2ARS A;  1WI7 A;  2O4X B;  4M75 E;  1B70 A;  3CCE T;  3UGT A;  3TVT A;  2L5Q A;  1FWZ A;  4WJ4 A;  3E9F A;  1M1K U;  4CH3 A;  2KRM A;  2ZCE A;  1YJW A;  3VUZ A;  2DU7 A;  3EG9 B;  2L2P A;  1D3B A;  2Y4X A;  2D1X A;  3UH0 A;  1HK9 A;  2JW4 A;  5I21 A;  4A4F A;  2CZ1 B;  2F2V A;  1GXI E;  4ZTJ A;  1PM3 A;  4RMO A;  4C8Q C;  1MMG A;  1IHV A;  3VS2 A;  1KC8 U;  1AZE A;  3CXC A;  1UUE A;  4E7J A;  4WJ3 M;  3HTR A;  4J9G A;  2AKL A;  3HP9 A;  2XDD A;  2EQM A;  4TVY A;  2M0Y A;  4M4Z A;  4YDQ A;  2EJG A;  3OYC A;  4Q6G A;  4J9H A;  4KGZ B;  3DKM A;  1MMA A;  1K8A U;  1WNL A;  3TEH A;  3CCS Q;  2NWM A;  2OTL Q;  4C5E A;  4HCZ A;  4X1V A;  4JJB A;  3R6O A;  5ELO A;  4RDX A;  1SEM A;  2DTH A;  3EAE A;  2YRV A;  3HRS A;  2ECZ A;  1OEB A;  1G5H A;  3OW2 A;  2DL8 A;  3LGF A;  3LSS A;  3CCR Q;  4II1 A;  2QQA A;  2QK0 A;  3RMQ A;  2YLC A;  3OYY A;  3PVL A;  2K6D A;  2DL7 A;  2GGR A;  2DTO A;  4BW9 A;  4EMH A;  3ZBD A;  2XI9 A;  1UGR B;  2O31 A;  3CC4 T;  3LWI A;  1VQ7 Q;  3RES A;  4C8Q D;  1EIF A;  1Z7N A;  1YJ9 A;  3I5R A;  2DA9 A;  1B8A A;  5J3B A;  2BTT A;  2HBW A;  4PKC C;  2HEQ A;  2VB6 A;  4NOY A;  1NEB A;  2VYT A;  3VS7 A;  2FRY A;  2RI5 A;  2GF7 A;  5GAN g;  1TOV A;  2QDY B;  5FU7 B;  2YSQ A;  1VQ4 Q;  1ZSZ B;  2FEI A;  1YCY A;  4K86 A;  1I07 A;  4PG3 A;  2ESW A;  3A32 A;  1QKX A;  3MF2 A;  5CKF A;  4TVA B;  3GLX A;  2RJD A;  4JRK A;  2FZC B;  2OI3 A;  4JZ4 A;  2DZ9 A;  5CKB A;  4ANJ A;  4EIK A;  1NJ8 A;  4MZM A;  4Q15 A;  1GGM A;  4LN2 A;  4D6W A;  1VQ5 T;  1B7Y A;  1BB9 A;  2ODR D;  4J7F A;  1GCQ A;  1IB8 A;  3G71 Q;  2Z0W A;  3A1P A;  1Y07 A;  1MHN A;  1NZ9 A;  4CH5 A;  5HY6 A;  3EH2 A;  3EH1 A;  4QQ6 A;  5FU6 B;  2EKH A;  2KGT A;  1K4U S;  4KT0 E;  4M75 D;  3VQY A;  2RHQ A;  3H0I A;  1ADJ A;  2XIC A;  3JV3 A;  4H2X B;  4DOV A;  2PVG B;  3GNF B;  3A74 A;  1YIJ A;  1IO6 A;  4P71 C;  1IZ6 A;  4C8Q F;  3CC7 Q;  4C8Q B;  5KYX B;  3HFO A;  1QCO A;  4N4G A;  4LNS A;  1AT1 B;  4H2Y A;  3FB9 A;  3L2Z A;  1JJ2 P;  2QGF B;  1EFW A;  1OUL A;  2DD4 A;  2DL4 A;  2LX9 A;  1N8R C;  3OSS C;  5LJ5 f;  2X35 A;  3CPW A;  1MV3 A;  5CKE A;  1WXB A;  2HSE B;  1AOJ A;  3S3M A;  3MHX A;  2DYB A;  3FJ5 A;  1YIT A;  1BIA A;  3KFV A;  1OPK A;  4OML A;  4C92 E;  2VAS A;  1SRY A;  1DJ7 B;  1J5W A;  2V26 A;  2R5A A;  3JSC A;  4FL6 A;  3VUB A;  3BE3 A;  4XQ3 A;  3V7C A;  2L3S A;  2X51 A;  2NUT B;  1M9S A;  3NPF A;  5DY9 A;  4M7D E;  5GMK j;  3ERR A;  2FL7 A;  5IXB A;  3X26 B;  4M77 C;  2BZY A;  3V7R A;  3GPL A;  2R57 A;  1Q95 G;  1VQO A;  1PCX A;  1W2B S;  3LW5 E;  4R0K A;  1JU5 C;  9ATC B;  3I56 T;  3TSW A;  4M75 F;  5DLO A;  2V1R A;  2PNI A;  3TEE A;  4XTX A;  3CXC S;  2K3Y A;  3CME T;  2COZ A;  5GAN e;  4C8Q G;  3EGD B;  4JRP A;  1KFZ A;  2I2L A;  2D8J A;  1I4K 1;  4YRM A;  1D1B A;  2PU9 B;  3RKY A;  4H2T A;  2QAS A;  3VV0 A;  2X4X A;  4C0F A;  4A53 A;  3MP8 A;  2A08 A;  2E3H A;  3HTZ A;  2EYZ A;  3OW2 S;  5GJV B;  3FEO A;  1RLQ C;  1R0B G;  2LVM A;  2HQX A;  2IPO B;  1VQK T;  2F5T X;  2M51 A;  4MZP A;  1WLE A;  4PK4 A;  4DBR A;  1OQK A;  1B7T A;  3L2Q A;  4IUQ A;  4FU6 A;  1TUC A;  2KE9 A;  5KYW B;  2YUO A;  2F5K A;  4NCX A;  4E51 A;  2PME A;  4XU3 A;  1K73 R;  4ZTZ B;  1VQN Q;  3RKX A;  1QVP A;  3A7R A;  3MEV A;  5GAM j;  3PIO A;  1VQL Q;  3AHU A;  1H4V B;  1HYO A;  5LJ3 g;  3UA7 A;  1VIF A;  3VU3 C;  3CD6 T;  2X4W A;  1AWO A;  2A7Y A;  1VQ8 A;  3CCL T;  4AH6 A;  3LSQ A;  1VQ9 Q;  4HT4 A;  2AKK A;  4AFQ C;  4BI4 A;  1K8A C;  1SF9 A;  2JS2 A;  3I55 T;  3OYG A;  5CKH A;  2BE9 B;  2DJZ A;  1K73 U;  1UTI A;  4BI3 A;  2FZG B;  4E7H A;  2ABL A;  1PC0 A;  3CCJ T;  3QNE A;  3OYF A;  1NYG A;  1FYN A;  4J7I A;  2VGN A;  3CCQ T;  4C92 D;  1H3Z A;  1BCO A;  4M77 B;  2I0N A;  4DEY A;  4J8O A;  1UGP B;  3JB9 D;  8AT1 B;  4KUD K;  2W0Z A;  4M7D D;  4MZT A;  1VYT A;  1W1F A;  3L2V A;  1PYS A;  4N4I A;  4UC4 A;  3JB9 H;  4J6Y A;  2C0I A;  3RR6 A;  1MND A;  4WTO B;  2XDB A;  2XU8 A;  1PKT A;  3CPW S;  3M4G A;  1GFC A;  2NUP A;  1G2B A;  2CH4 A;  3IAL A;  2ZT8 A;  2LT4 A;  3TSZ A;  4CC7 A;  4FSS A;  1YJW Q;  1AZG B;  3HHT B;  1BCM A;  3C94 A;  4YCU A;  3RBB B;  3VS0 A;  1ABQ A;  2QEX T;  4YRQ A;  1HTT A;  3NTI A;  1EIY A;  3Q1J A;  3CC2 T;  1M2O A;  4EMK A;  1YJN T;  2DE0 X;  2CT4 A;  2K9G A;  4P3P A;  3M57 A;  1EVL A;  2HSP A;  1V1C A;  1UFF A;  1BI0 A;  1OYX A;  1Y0M A;  4Z8A A;  5C6S A;  3L4G B;  2JNG A;  2BUD A;  4M77 G;  1Y96 B;  2CP6 A;  4C92 F;  5LJ3 e;  4C92 B;  2AT1 B;  4CS4 A;  4P5N A;  4ZGD B;  4D8K A;  3PTA A;  5D6Y A;  4PJL A;  3JB9 F;  4F16 A;  5GAO n;  4PJM A;  2DRM A;  3J80 E;  4M7D F;  1PNJ A;  3PMI A;  3HXZ A;  4P75 A;  3O5Z A;  2I4M A;  2M02 A;  2KY9 A;  2ZPE B;  1IXD A;  1QCF A;  3KBG A;  3SB2 A;  2CP7 A;  3CMA Q;  2KRN A;  1YB3 A;  4RTY A;  5LJ5 e;  1JRI A;  3MP6 A;  3OS2 A;  2KT8 A;  2BKD N;  3M0R A;  1YFN A;  2F2W A;  2KYB A;  1JJC A;  3NTK A;  3CCM T;  3KXT A;  2A8E A;  1K9A A;  2K5F A;  1YJ9 Q;  1YHQ T;  2GNC A;  1E1O A;  1UEB A;  4Y28 E;  5I2M A;  2IG0 A;  2BZX A;  2JZ2 A;  1M90 R;  3TQ7 P;  1W6X A;  2G4C A;  4C92 G;  2K3X A;  2LZ6 B;  4E6R A;  4EX5 A;  1QVG P;  3JB9 I;  2L3P A;  3JB9 G;  1H4S A;  4M7D G;  1NJ6 A;  1KSW A;  2QDL A;  3JCM W;  3S3O A;  3P8V A;  3PVQ A;  4FYY B;  3RDV A;  1UGS B;  2RK1 A;  4HWR A;  4LXC A;  4QW2 A;  1NLO C;  3CME A;  1Q82 U;  4HCK A;  3ZL7 C;  4FM4 B;  1WJS A;  1RI0 A;  3M0U A;  3IQL A;  1UEC A;  1SER A;  1H92 A;  4M78 A;  1M90 U;  2RNA A;  3QO3 A;  3V8K A;  3SWN C;  1ACM B;  4AFU C;  1YIJ Q;  2EWN A;  3LC0 A;  1TG0 A;  3UPU A;  1NYF A;  1RAH B;  2IIM A;  4UP9 A;  3CCV T;  4YRN A;  5I2S A;  5GAO m;  3NTH A;  2VXE A;  2Y90 A;  1VQK A;  4QKU A;  4BE2 A;  3BY7 A;  1ADY A;  1YN8 A;  5GAM h;  2AMC A;  2V1Q A;  1N5Z A;  2YUP A;  2E5Q A;  2K2M A;  2VKN A;  2VWF A;  1Y7X A;  3VQX A;  2GTO A;  1UGV A;  1TUD A;  4AMC A;  1WXT A;  3P8D A;  2LJ3 A;  1NLP C;  4QVZ A;  3CBM A;  5CKD A;  3OYN A;  3GF5 A;  4LDU A;  3GIB A;  1UJ0 A;  1RL2 A;  3REU A;  2EQI A;  3CD6 A;  5HKC A;  2MF2 A;  4ELZ C;  1KG1 A;  4YRF A;  1LOJ A;  4G85 A;  1VQO Q;  3N5B B;  1K73 C;  2IVW A;  3REX A;  1EZZ B;  2E3C A;  4KH1 B;  1YI2 Q;  3I55 A;  1M1F A;  2LQK A;  3BW1 A;  2QI2 A;  3RUX A;  3A8O B;  2HAX A;  2E1H A;  4BB7 A;  2A0F B;  5HK0 A;  1NBE B;  2EYW A;  1Z9Z A;  1UGQ B;  2DER A;  3QDR B;  2ZPG B;  1BKB A;  1R0C B;  1T0H A;  1YBY A;  2EGE A;  3G6E A;  3PFS A;  2CUB A;  4P72 A;  4LVL A;  1Q86 R;  2O01 E;  4CH6 A;  4YPF A;  1OU8 A;  1WGS A;  4JS4 A;  4HKE A;  3HPW A;  4O5V A;  5KE2 A;  4PNO A;  3UGQ A;  2DVJ A;  1WLP B;  2KDS A;  2LCL A;  4FSX A;  1UHC A;  2JTM A;  1VUB A;  4ZTU B;  1PSE A;  4LDX A;  4E7K A;  3M0T A;  3H9N A;  1VIE A;  2RJC A;  1KD1 U;  1D3B B;  2X3W D;  3OMG A;  2AKW B;  4GY5 A;  2YRD A;  3SWN B;  4P74 A;  3PGG A;  4PL6 A;  2QEX A;  1VQ8 Q;  1GL5 A;  1Q86 U;  2M1H A;  1B76 A;  3E9H A;  4BDZ A;  2RI2 A;  1RAB B;  2QA4 T;  1YJN A;  4LNP A;  1M3A A;  2DRK A;  4H2S A;  3VYH B;  4ZTF A;  3HKS A;  2ZR3 A;  1M1K R;  1PWT A;  1M2V A;  2DTI A;  2RHS B;  1IL2 A;  3VQV A;  1X2G A;  1D0Y A;  4J6X A;  3QO8 A;  2E12 A;  4F7U A;  3TEH B;  5KCO A;  4BE1 A;  4K88 A;  3G4S T;  1OZ3 A;  4XTU A;  1WFW A;  2DEQ A;  2EVR A;  3X25 B;  2QQS A;  4EPC A;  1KC8 R;  1MMN A;  4MDW A;  3PIP A;  2FO0 A;  1IHW A;  4G84 A;  2D6F A;  2DBM A;  4JZ3 A;  2HCK A;  4OMM A;  4Z89 A;  3HY1 A;  2HKN A;  5IN1 A;  4RCB A;  5FU6 C;  4ESR A;  4HCB A;  1UE9 A;  3OBY A;  3QUI A;  1K8A R;  1JO8 A;  1SG5 A;  1JEG A;  4RTZ A;  3E9G A;  3BDL A;  4QT7 A;  4BD3 A;  1N27 A;  1EX4 A;  3X28 B;  3CC4 Q;  3CCU A;  4R56 A;  3CCM A;  4TVR A;  5IHI A;  4YRO A;  1QP2 A;  1EVK A;  3DSQ A;  4Q5W A;  4E7L A;  4HVC A;  4PJO A;  4QVC A;  1W66 A;  1QE0 A;  2ZPH B;  4IKF A;  3M56 A;  3NET A;  3EFO A;  4YTL A;  2SEM A;  3RIR A;  1G5I A;  3EG2 A;  4ME7 A;  1S72 A;  1Q82 C;  3WVD B;  2JXB A;  1WA7 A;  1N6A A;  2JTF A;  4V2S A;  1OZ2 A;  2HD0 A;  1RAC B;  1M90 C;  2OAU A;  1WQW A;  1W2B P;  4C0Z A;  1RI9 A;  5GAM f;  1R77 A;  2PZ1 A;  3EHQ A;  3OYK A;  1X75 C;  2ODR C;  4TVW A;  2M9U A;  3V7S A;  3A5Z A;  1WQ7 A;  1YP5 A;  3ME9 A;  2PTK A;  3CMA A;  1GFD A;  2V8K A;  2DDZ A;  5GAO r;  1M8V A;  1PKS A;  2ZZD A;  4WCI A;  2JMA A;  2GFA A;  1NYR A;  1E24 A;  1NPP A;  3FRN A;  3M59 A;  4A4E A;  1HXD A;  4M75 C;  4UPA A;  1N9S A;  3OYA A;  2RK2 A;  4WI1 A;  4OF1 A;  1D09 B;  3NEN A;  1SRL A;  1QP3 A;  3HXV A;  5LJ3 d;  3CQT A;  3OA6 A;  2E5K A;  2PUO B;  5EG2 A;  2V8J A;  3A8H B;  2P0Q A;  5CVI A;  3C0C A;  2HDA A;  2RPN A;  3L2R A;  3QO5 A;  4HWS A;  1SRM A;  4AT1 B;  4DBQ A;  1RAE B;  1VQM T;  1NJ5 A;  1SKU B;  2RJF A;  2KRO A;  2J7I A;  3NGP A;  4J83 A;  4BY6 C;  2RB6 A;  1KIK A;  3BJU A;  2COY A;  2XID A;  4RUG A;  1G83 A;  3HL8 A;  1HD3 A;  1QWE A;  3VYG A;  1F1B B;  4KR2 A;  2ZZE A;  3PCO A;  4LD9 K;  4B9W A;  2AZS A;  1AVZ C;  2EKO A;  5GAN 8;  2HNI A;  4CC4 B;  2OTJ A;  2P0L A;  4E47 A;  3QJ6 A;  2EYY A;  3MJX A;  2CJ9 A;  1D0Z A;  1QVF P;  4BAC A;  1PD1 A;  5HCK A;  3I35 A;  2CSI A;  2A28 A;  2ZT7 A;  2C0O A;  3P8Y A;  3CCS T;  3ASK A;  3CME Q;  4HT8 A;  2L3Q A;  4A54 A;  4HWP A;  2DL3 A;  2C06 A;  4LE9 A;  2RMO A;  3JCM d;  1GRI A;  2EJF A;  4CI0 C;  1JJ2 A;  2P5I A;  2ZT5 A;  1NG2 A;  1QKW A;  2XMF A;  1Q7Y U;  3A7A A;  1KMN A;  2C8M A;  2MK5 A;  1UJY A;  2L0A A;  1X43 A;  2FYK A;  4BDY A;  1I8F A;  4DBH A;  3SHW A;  1VQ7 T;  2C7I A;  3L2U A;  3SD4 A;  1PSF A;  2Y4Y A;  3H0H A;  1VQK Q;  5FRM A;  2RF0 A;  2WSE E;  3QII A;  3QBY A;  4MML A;  4M7A A;  1KQS P;  2B86 A;  3EFS A;  4LVM A;  1Q86 C;  4LUE A;  1VQ4 T;  5I11 A;  2MAM A;  3QYH B;  2CRE A;  3TCJ A;  2YRC A;  3MF1 A;  4P75 C;  1OOT A;  4LVI A;  4ELY C;  4M78 E;  3RMS A;  1VYV A;  4AG1 C;  1GBR A;  2RQW A;  1IRE B;  1FX7 A;  2LQN A;  5GAN j;  2RI3 A;  3S6W A;  3OYM A;  1ZSZ A;  4M75 B;  2O88 A;  1A0N B;  2ED0 A;  2ZIM A;  4YRC A;  4K11 A;  4PFZ A;  1YI2 A;  3CD6 Q;  3I7F A;  5C0M A;  4P73 A;  1Y71 A;  2EFI A;  4Y92 A;  3OYE A;  2M16 A;  4HVW A;  5D6W A;  3G71 T;  1GCP A;  2Q7G A;  3NEM A;  2BIV A;  2RQR A;  3I55 Q;  2L8D A;  1E1T A;  3A8G B;  4BE0 A;  4OLF A;  2GFU A;  4BY6 B;  3ICA A;  4PHC A;  1M27 C;  3HFZ A;  1TS9 A;  3QHS A;  5KYN A;  3G4S A;  2GTJ A;  3CCJ Q;  4A4H A;  4F14 A;  1M1K C;  3G6E Q;  1RAD B;  3INZ A;  3GOX A;  4C8Q A;  4NS5 A;  3AT1 B;  2KT1 A;  4C92 C;  1NPR A;  1TTH B;  1I81 A;  1N9W A;  4YYE A;  1G3Y A;  3CCE A;  3M54 A;  1X55 A;  4J9F A;  4M75 G;  2L89 A;  1YFS A;  2MWP A;  1KC8 C;  4M7D C;  2MWO A;  2NUP B;  1FXX A;  4H2W A;  4EDU A;  1VQP T;  3QZ9 B;  1TUG B;  1XJW B;  3C12 A;  1N9R A;  3HXY A;  1H4T A;  4M78 C;  2Q5H A;  2OJ2 A;  2YUN A;  1LPL A;  2ZZF A;  1WYD A;  5KNN A;  4L5G A;  2NUZ A;  1ZUY A;  4OMN A;  5J39 A;  2QEX Q;  4JJN K;  2ZTG A;  1WJQ A;  4N0A C;  5LJ5 g;  2ED1 A;  2F1L A;  1K0X A;  4BWA A;  1YJN Q;  1X2Q A;  3JCM P;  4D8D A;  1X6G A;  2EQK A;  2JTE A;  1MUZ A;  1T3S A;  2VGM A;  3VKI A;  2J05 A;  5GAN 3;  4XEO A;  3I5S A;  4ZN3 A;  1BU1 A;  1OPL A;  1RIQ A;  1PHT A;  5FW9 A;  2EQU A;  2JS0 A;  3QWY A;  2CIM A;  2QHS A;  2RH2 A;  2CDT A;  4NL2 A;  1JJ2 S;  3CBO A;  1W4S A;  5ELN A;  2RHU A;  4OB1 B;  3OS0 A;  1G3S A;  4E7S A;  2YHT A;  3M4Q A;  1TH7 A;  4M78 D;  2EGA A;  2A37 A;  2RHX A;  5GAN 4;  2P84 A;  4HXJ A;  3CC4 A;  1ASY A;  4IUP A;  2AIR B;  3VS5 A;  3FLG A;  1L0W A;  3P8B B;  4KUL A;  1JJC B;  1W70 A;  2CP0 A;  3L42 A;  2K3B A;  1FMK A;  3CCU Q;  2LNH B;  1VQL T;  3CCM Q;  3H41 A;  2W10 A;  4F7U E;  1LVK A;  3EHR A;  1VQM A;  1XOV A;  1YHQ Q;  4AFZ C;  1SHG A;  2CYZ B;  2MPX C;  1GBQ A;  3MQZ A;  2ZIN A;  2DXT A;  2EYX A;  2PVO B;  5CCA A;  2CZ0 B;  5LJ3 j;  2A3L A;  1V76 A;  1M1G A;  2LQW A;  1VQ9 T;  1M4Z A;  1ARK A;  4P71 A;  1VQ5 A;  1VQ6 T;  3HY0 A;  5A0L A;  3OYL A;  5A0G A;  1S72 Q;  1C6V X;  5FRO A;  3BFM A;  3OD1 A;  1B34 B;  1KHI A;  5AT1 B;  2JVV A;  2QHT A;  2DIG A;  4M7D B;  4ZNX A;  4C5H A;  1ZA1 B;  4H2V A;  3UWN A;  2IY5 B;  2OAW A;  1M8M A;  2KQW A;  4M78 F;  3REB B;  4M78 B;  4ATO A;  5CQY A;  3H8Z A;  4ORZ A;  5KH6 A;  4OGE A;  4PJO E;  3SDZ A;  2DKG A;  3QTC A;  4XTV A;  4P74 C;  3JCM V;  2VC8 A;  4HVV A;  2O2O A;  2E3I A;  3EFR A;  3TUP A;  2I4N A;  1CKB A;  5FWB A;  4M77 A;  4HWT A;  4KR3 A;  1Q82 R;  4CS3 A;  3GBQ A;  5ECA A;  1AWJ A;  2LMJ A;  5KYY B;  3SFM A;  1M3B A;  5GMK h;  1I0C A;  1OX9 A;  4E7I A;  2AMC B;  4RG8 A;  1BYM A;  4YRE A;  4PFP A;  2WAC A;  4JDS A;  1ASZ A;  3ULR B;  3C4S A;  1NE8 A;  1QVG A;  2E6N A;  1U06 A;  4QVD A;  1YJW T;  4JRI A;  2KXC A;  3V8J A;  3RL6 A;  1QWF A;  3HRT A;  2LJ1 A;  2RHZ A;  4YRS A;  4FCY A;  1Z9Q A;  2QAZ A;  2VXF A;  3I56 A;  2RHY A;  3KUF A;  4XAX B;  1USY A;  1WXU A;  2OTJ Q;  2RJE A;  2P4T A;  4M78 G;  3X20 B;  1KMM A;  3UT1 A;  4Z88 A;  4YRL A;  3HXW A;  2Q7H A;  4OVA A;  1M5Q 1;  2LTO A;  3LGL A;  3J81 E;  1RAI B;  5CR2 A;  3LH5 A;  3JCM J;  4J5Y A;  3OMC A;  5FRN A;  1ATI A;  4RG2 A;  1G51 A;  5IXF A;  4IIM A;  2MOX A;  1TXQ A;  2CZ7 B;  1U5S A;  1O9S A;  1ZBJ A;  1MNE A;  1YNZ A;  5M9O A;  1ZUK A;  2HKQ B;  1YJ9 T;  4J6W A;  2LT1 A;  3M9Q A;  4RTV A;  4DA4 A;  4FT2 A;  2ZT6 A;  1NEG A;  1C0M A;  1VQP A;  4R55 A;  2CH4 W;  3CCL A;  1QLY A;  2HQE A;  4JJC A;  1WIE A;  5C51 B;  2JOY A;  2ALY A;  2ROL A;  3IG2 A;  4PJO D;  2EJ9 A;  3ZFJ A;  4BI8 B;  1B3Q A;  1FMW A;  4NL3 A;  1AHJ B;  3OBW A;  5GAN 2;  2LC4 A;  1E6G A;  3DLL A;  4GLM A;  4DPG A;  1KD1 R;  2D0Q B;  3PNW C;  4F7U F;  4F7U B;  3CCJ A;  2K5L A;  1LNX A;  4M7A E;  3NFC A;  3CCQ A;  3ER0 A;  2O9V A;  4CRI A;  2E10 A;  2J3M A;  4EO4 A;  5KYU B;  5GAN 7;  1YIJ T;  3G4S Q;  5GAN d;  1SES A;  3A31 A;  1G5V A;  3A5Y A;  2Q5I A;  2QQ9 A;  2COW A;  2HZY A;  1GCQ C;  3CMQ A;  2E41 A;  5IH2 A;  1B70 B;  2FZK B;  3OS1 A;  3M5A A;  3DLM A;  1SHF A;  1B07 A;  2CZ6 B;  3QWX X;  5IHN A;  3M4P A;  3UF4 A;  2ZR2 A;  1SET A;  3M53 A;  2DXU A;  1KHC A;  3CCE Q;  3G1J A;  2CUD A;  1YIT T;  2RQV A;  2QHV A;  2QTV A;  3BDU A;  5CAI A;  2GBQ A;  2JM9 A;  4PJO F;  4PJO B;  1UB4 A;  1QVG S;  4O6J A;  1RAG B;  1N8R U;  3CC2 A;  3JCM c;  3LYI A;  3HSB A;  1K1Z A;  1WHH A;  3EFO B;  1X56 A;  3EGU A;  2H8H A;  4ZN1 A;  1QCN A;  1T3L A;  4GBQ A;  4F7U G;  1K76 A;  1IGQ A;  2FVU A;  3QKJ A;  1BBU A;  2ENM A;  5AYF A;  4C5G A;  4C0D C;  3JCM Q;  4C8Q E;  2CKK A;  1VQ6 A;  3HRK A;  1KOG A;  2XDP A;  2PUK B;  3EG0 A;  2DX1 A;  1H8K A;  4CC3 A;  1T0J A;  2KR3 A;  1WYX A;  2K4Y A;  2KBT A;  4MDX A;  4UP7 A;  2SRC A;  2DU5 A;  3MEU A;  3ZEH A;  4YRJ A;  1YWP A;  3TRE A;  3M0S A;  5GAN 5;  4JS5 A;  4M7A C;  3OYD A;  4A4G A;  1YFT A;  3FDR A;  3A5Z B;  2OX7 A;  2RQU A;  3PT9 A;  4OMO A;  1V29 B;  1LYL A;  2YXY A;  2V8I A;  3VS1 A;  3FJP A;  1AWW A;  2XKO C;  2GQV A;  2QHU A;  4JUV A;  2JMC A;  3I9Q A;  2QQR A;  1SSH A;  2HMA A;  2DFU A;  3J7A F;  5CQX A;  3NMZ C;  1IGU A;  4PJO G;  3JCM h;  2LJ0 A;  4OB3 B;  4L6V 5;  2CP5 A;  1J3T A;  3E19 A;  5FWC A;  1YHQ A;  3S3N A;  4X34 A;  3A7U A;  1LCK A;  3LLR A;  1WDX A;  4KRT A;  1TWB A;  4DQ2 A;  3OSV A;  2FHD A;  1WJR A;  3MO8 A;  2X4Y A;  4GLK A;  4E2F B;  5K1P A;  3WXM B;  4J9I A;  1VQM Q;  3GNG A;  4AFS C;  4YRG A;  3KFU A;  3PCO B;  3FC3 A;  1BBZ A;  1VQ8 T;  1Y57 A;  3MEA A;  3UDC A;  2B8A A;  2F69 A;  4M7A D;  1C0A A;  2AKW A;  2DIQ A;  1B7Y B;  2KEA A;  2KRS A;  1W2B A;  3SWN A;  2CGH A;  3O8V A;  1U1T A;  2KYM A;  3L2W A;  1VQ5 Q;  2LP5 A;  1X01 A;  4YRR A;  3EGX A;  4IUT A;  4L87 A;  2LCC A;  3OB9 A;  2DNU A;  2EPD A;  2RHQ B;  2ATC B;  4OMQ A;  3CXC P;  1U1S A;  2G6F X;  2RHS A;  1EFN A;  2GCX A;  4EMG A;  4YRK A;  1SSF A;  3H0F A;  4JLI A;  2ZPI B;  4KGX B;  8ATC B;  4RMF A;  2MYS A;  2RHI A;  2DET A;  2R5M A;  2QTX A;  2AK5 A;  1X69 A;  3VBB A;  1M30 A;  4VUB A;  4CC2 A;  3CCV A;  4IUU A;  4A63 B;  4C0D B;  4J15 A;  3OW2 P;  5CO7 A;  2O4X A;  4OB0 B;  4RTU A;  2K79 A;  3HRI A;  1X2H A;  1NJ1 A;  2ARU A;  4AG2 C;  2DPP B;  4J9B A;  1CSK A;  2XTI A;  1G3T A;  2P0P A;  4N4H A;  1UDL A;  2FG0 A;  4M7A B;  3RNJ A;  4M7A F;  2XK0 A;  5C53 B;  1RUW A;  4YP0 A;  1OU9 A;  3EG9 A;  5IHK A;  3IKL A;  4P3N A;  2DXC A;  1Q7Y R;  5LJ5 d;  5D6X A;  3QO7 A;  4X5O A;  3M58 A;  3THK A;  4OP0 A;  3G7Z A;  2ZIO A;  2MIO A;  1QVF A;  1TSF A;  2MCN A;  3CPF A;  2J6O A;  2QXF A;  5D7U A;  2HL5 C;  3I56 Q;  4TTV A;  4K87 A;  4A4K A;  4M77 E;  2XGT A;  2QQB A;  4X9C A;  1VOM A;  3RKW A;  4WF2 A;  2OTL T;  4CH4 A;  2FB7 A;  2EW3 A;  3JRZ A;  2DD5 A;  1K9M R;  3CCR T;  1MGQ A;  3WQZ A;  1X6B A;  2XD0 A;  4EMK C;  3HFZ B;  4PLI A;  5LJ3 f;  1HSQ A;  2AZV A;  1JB0 E;  5C52 B;  4LDW A;  4M7A G;  3HFV A;  2EBP A;  2E6Z A;  3HXU A;  4FT4 A;  1KD1 C;  1KQS A;  5DLQ E;  1UG1 A;  4RCC A;  1YGB A;  3URG A;  1KJW A;  1PRL C;  2M0O A;  5GAM g;  4LVK A;  1ZX6 A;  1K9M U;  2ZPB B;  1M3C A;  7AT1 B;  3HXX A;  2RO0 A;  3M0Q A;  3CPW P;  2CP2 A;  2A36 A;  3VS6 A;  1OI1 A;  4TVA A;  5DM7 R;  1VQP Q;  5IAY A;  3CCL Q;  2YWW A;  3WVE B;  4ZGE B;  1YFR A;  2LRQ A;  1YWO A;  2NS6 A;  2D0N A;  2QA4 A;  2DQ0 A;  4MMK A;  3FIF A;  2EL9 A;  2DBK A;  2L3R A;  1D1C A;  2HBP A;  2QG9 B;  3P8T A;  3JCM b;  5GMK e;  4XEM A;  3JCM f;  3H6Z A;  2CS7 A;  4TQF A;  2DIL A;  4OB2 B;  2QGG A;  2KSS A;  3CEY A;  1U8R A;  4OMP A;  1RAF B;  4JJD A;  3CC7 T;  1H3H A;  1ZLM A;  3W3S A;  3OS5 A;  11AS A;  2YDL A;  4H2X A;  3MP1 A;  3CCQ Q;  1HC7 A;  3DB3 A;  5KYX A;  3PMT A;  5A0D A;  2NLU A;  4CS2 A;  1PYS B;  2KAF A;  3E9I A;  1NJI R;  1USY C;  2F2X A;  1BBW A;  5GAO l;  4HA8 A;  2EQJ A;  4HCC A;  3UA6 A;  1P92 A;  2H3E B;  2DVE A;  4IUV A;  2DF6 A;  2MI6 A;  4HVU A;  3LH0 A;  1PD0 A;  3OYI A;  2E70 A;  4XTY A;  4M77 D;  4PJJ A;  5GMK i;  1G3W A;  1O75 A;  1EOV A;  2KMT A;  4TWA A;  2LCS A;  1BK2 A;  1I5L A;  1X27 A;  1EIY B;  4RTX A;  3VJP A;  1BIB A;  4FIB A;  4EMK B;  2NUT A;  4LDY A;  2AHJ B;  3LX7 A;  2CP3 A;  3A8L B;  3CC2 Q;  4XTW A;  3VRY A;  3HRU A;  5E3I A;  2FPE A;  2JUF A;  2DM1 A;  4RQE A;  4QQD A;  1D1A A;  1NJI U;  5GAM e;  1QVF S;  4M75 A;  4XU2 A;  2XHC A;  1ZQ1 A;  1X6O A;  1VA7 A;  1VQ6 Q;  2XG8 D;  1TU0 B;  3EGD A;  4JRQ A;  1NNH A;  3REA B;  3MEY A;  4JPB W;  5GMK l;  3JAM E;  4RTT A;  3SEM A;  4JLG A;  3RER A;  1E22 A;  1WPY A;  2X9H A;  2K5I A;  4BUG A;  3E1S A;  1H4Q A;  1WHK A;  4XU0 A;  3MPU B;  2WSF E;  1UHF A;  5EC7 A;  5GAO q;  4PLL A;  3OYJ A;  1HJD A;  2D8H A;  3G6E T;  1QF6 A;  2D9T A;  4M77 F;  4DOW A;  1VQN T;  2K7A A;  5KYW A;  1KQS S;  3JCM g;  2YUQ A;  1ZHI A;  4Y91 A;  1Q81 R;  3M4Y A;  5FLX E;  1JXO A;  1IRX A;  3OYH A;  2HQH A;  1WU7 A;  3VS3 A;  2BE7 D;  1PG5 B;  3MKD A;  4P72 C;  1I5O B;  5L23 A;  2CSQ A;  4KBM B;  1CKA A;  1JXM A;  4IUR A;  2PMF A;  2E5A A;  4KH0 B;  1E7O A;  3RGL A;  3VQW A;  5I22 A;  2Q7E A;  3T9N A;  3QDF A;  2ZNJ A;  3QG1 A;  4ZIB A;  1JQQ A;  3L1A A;  4PJN A;  1Q7Y C;  2RD1 A;  2FPF A;  4YRP A;  1XTD A;  4XTZ A;  1BI1 A;  3CCS A;  5LJ5 j;  1R8O B;  1H64 1;  2OTL A;  1Q81 U;  3RAC A;  5HK3 A;  2O9S A;  12AS A;  1MMD A;  1QW1 A;  3OYB A;  1AEY A;  4QQG A;  2DZC A;  1ABO A;  4RQF A;  3CCR A;  3DB4 A;  1NJ2 A;  1X2K A;  2FRW A;  1XNI A;  2GQI A;  4FYW B;  2I4O A;  1YCS B;  2ZNI A;  2HL3 A;  4C5I A;  4L59 A;  1K9M C;  1KK7 A;  3CCV Q;  4B6M A;  1WHL A;  1VQ7 A;  4HWO A;  3MET A;  4J9E A;  3X24 B;  5GAN h;  1X54 A;  2X4J A;  3R6N A;  2ZAE A;  3U23 A;  3CCU T;  1VQ4 A;  4RKU E;  1MV0 B;  4F04 B;  1VQZ A;  2G3R A;  2ZPF B;  2K2V A;  4FYV B;  3EG3 A;  1S1N A;  4KGV B;  5LL6 S;  2LQ8 A; 
#chains in the Genus database with same CATH homology
 2ALY B;  1S72 T;  3JCM e;  3G71 A;  4XU1 A;  2ZGW A;  2CJB A;  2E65 A;  5KE3 A;  2KVQ G;  3L4G A;  1Y96 A;  1BI2 A;  4C92 A;  1B34 A;  4LVJ A;  2KK4 A;  3JCM X;  5CK9 A;  4PJO C;  5F5W A;  4B9X A;  3OQ5 A;  4M7D A;  3LWH A;  2IY5 A;  2LDM A;  2DQ3 A;  4KQE A;  3GP8 A;  3CC7 A;  3CMA T;  2VV5 A;  4YCW A;  4YRI A;  2EYQ A;  4O2D A;  3IKM B;  4ZGJ B;  3UFG A;  3F70 A;  1KQ1 A;  4N0A A;  2PVD B;  3MEW A;  2CJA A;  3RF1 A;  2ZCF B;  2LNV A;  4OMF B;  1JBM A;  4YCV A;  1NJI C;  2ZXF A;  2RA2 A;  4C0G A;  4Z02 A;  1ZBX A;  3QYG B;  5KCH A;  3HFN A;  2OTJ T;  3QPH A;  1KQ2 A;  2RM4 A;  2J3L A;  4OGC A;  3TEG A;  3M55 A;  2I4L A;  5GAO p;  3P8H A;  4UP8 A;  2DO3 A;  3C95 A;  1Z7M A;  4H2U A;  5CIU A;  3QSU A;  2JN0 A;  2MMP A;  5GMK m;  4P3O A;  4HT9 A;  2DAQ A;  4XK8 E;  4KUI A;  2DK3 A;  5HGQ A;  5L8R E;  4TQD A;  1EQR A;  2PQW A;  3R07 A;  1VQN A;  5LJ3 h;  3A8M B;  1LJO A;  1VQL A;  3G1Z A;  3CBP A;  4X9D A;  2WSC E;  1VQO T;  4LDV A;  3MCA B;  4LD6 A;  1VQ9 A;  1NYQ A;  1FYF A;  2R58 A;  2P0K A;  5GAN 6;  4H02 A;  1YI2 T;  2K57 A;  1Q81 C;  2YLB A;  5LJ5 h;  3OY9 A;  2ART A;  5J26 A;  3PZC A;  2ZZG A;  2DXB A;  5GAN f;  2EAY A;  2H3J A;  3NEL A;  4YRT A;  5FU7 C;  2VUB A;  3TU4 K;  5K1X A;  2E64 A;  5A2Q E;  1BI3 A;  3QZ5 B;  5GAM d;  4P73 C;  2EIF A;  3QJY A;  5IT9 E;  3V8L A;  1XQH A;  3JB9 J;  3QXE B;  2ARS A;  4M75 E;  2O4X B;  1B70 A;  3CCE T;  3UGT A;  2L5Q A;  1FWZ A;  4WJ4 A;  3E9F A;  1M1K U;  4CH3 A;  2ZCE A;  1YJW A;  3VUZ A;  2DU7 A;  1D3B A;  2Y4X A;  3UH0 A;  1HK9 A;  5I21 A;  1GXI E;  4A4F A;  2CZ1 B;  4ZTJ A;  4RMO A;  4C8Q C;  1KC8 U;  3CXC A;  4E7J A;  4WJ3 M;  3HP9 A;  2XDD A;  2EQM A;  4TVY A;  4YDQ A;  2EJG A;  3OYC A;  4Q6G A;  3DKM A;  1K8A U;  1WNL A;  3TEH A;  4C5E A;  4HCZ A;  5ELO A;  4RDX A;  3R6O A;  2DTH A;  3EAE A;  2YRV A;  3HRS A;  1G5H A;  3OW2 A;  3LGF A;  3LSS A;  4II1 A;  2QQA A;  3RMQ A;  2YLC A;  3OYY A;  2DTO A;  4BW9 A;  4EMH A;  3ZBD A;  2XI9 A;  1UGR B;  3CC4 T;  3LWI A;  3RES A;  4C8Q D;  1EIF A;  1Z7N A;  1YJ9 A;  1B8A A;  5J3B A;  4PKC C;  4NOY A;  2VYT A;  2RI5 A;  2GF7 A;  5GAN g;  2QDY B;  5FU7 B;  1YCY A;  4K86 A;  4PG3 A;  3A32 A;  3MF2 A;  5CKF A;  4TVA B;  3GLX A;  2RJD A;  4JRK A;  5CKB A;  2DZ9 A;  1NJ8 A;  4MZM A;  4Q15 A;  1GGM A;  4D6W A;  1VQ5 T;  1B7Y A;  2ODR D;  4J7F A;  1Y07 A;  1MHN A;  1NZ9 A;  4CH5 A;  5HY6 A;  4QQ6 A;  5FU6 B;  4KT0 E;  4M75 D;  3VQY A;  2RHQ A;  1ADJ A;  2XIC A;  4H2X B;  4DOV A;  2PVG B;  3GNF B;  3A74 A;  1YIJ A;  4P71 C;  1IZ6 A;  4C8Q F;  4C8Q B;  3HFO A;  4N4G A;  4LNS A;  4H2Y A;  3FB9 A;  3L2Z A;  1EFW A;  2DD4 A;  2LX9 A;  1N8R C;  3OSS C;  5LJ5 f;  2X35 A;  3CPW A;  5CKE A;  3S3M A;  3MHX A;  1YIT A;  1BIA A;  4C92 E;  1SRY A;  1DJ7 B;  1J5W A;  2R5A A;  3JSC A;  4FL6 A;  3VUB A;  4XQ3 A;  3V7C A;  1M9S A;  5DY9 A;  4M7D E;  5GMK j;  3ERR A;  2FL7 A;  3X26 B;  4M77 C;  3V7R A;  3GPL A;  2R57 A;  1VQO A;  1W2B S;  3LW5 E;  3I56 T;  5DLO A;  4M75 F;  3TEE A;  4XTX A;  3CXC S;  2K3Y A;  3CME T;  5GAN e;  4C8Q G;  4JRP A;  2I2L A;  1I4K 1;  4YRM A;  2PU9 B;  3RKY A;  4H2T A;  3VV0 A;  2X4X A;  4C0F A;  4A53 A;  3MP8 A;  3HTZ A;  3OW2 S;  3FEO A;  2LVM A;  2HQX A;  1VQK T;  2F5T X;  4MZP A;  1WLE A;  3L2Q A;  4IUQ A;  4FU6 A;  4NCX A;  2F5K A;  4E51 A;  2PME A;  4XU3 A;  4ZTZ B;  3RKX A;  1QVP A;  3A7R A;  3MEV A;  5GAM j;  3PIO A;  3AHU A;  5LJ3 g;  1VIF A;  3VU3 C;  3CD6 T;  2X4W A;  2A7Y A;  1VQ8 A;  3CCL T;  4AH6 A;  3LSQ A;  4HT4 A;  4BI4 A;  1K8A C;  3I55 T;  3OYG A;  5CKH A;  2DJZ A;  1K73 U;  4BI3 A;  4E7H A;  3CCJ T;  3QNE A;  3OYF A;  4J7I A;  2VGN A;  3CCQ T;  4C92 D;  1H3Z A;  4M77 B;  4J8O A;  1UGP B;  3JB9 D;  4KUD K;  4M7D D;  4MZT A;  3L2V A;  1PYS A;  4N4I A;  4UC4 A;  3JB9 H;  4J6Y A;  2XDB A;  2XU8 A;  3CPW S;  3M4G A;  3IAL A;  2ZT8 A;  2LT4 A;  3HHT B;  3C94 A;  4YCU A;  2QEX T;  4YRQ A;  1HTT A;  3NTI A;  1EIY A;  3Q1J A;  3CC2 T;  4EMK A;  1YJN T;  4P3P A;  3M57 A;  1EVL A;  1BI0 A;  1OYX A;  5C6S A;  3L4G B;  2JNG A;  2BUD A;  4M77 G;  1Y96 B;  4C92 F;  5LJ3 e;  4C92 B;  4CS4 A;  4P5N A;  4ZGD B;  3PTA A;  5D6Y A;  3JB9 F;  5GAO n;  3J80 E;  4M7D F;  3PMI A;  3HXZ A;  4P75 A;  2I4M A;  2KY9 A;  2ZPE B;  3KBG A;  3SB2 A;  1YB3 A;  5LJ5 e;  1JRI A;  3MP6 A;  3OS2 A;  2BKD N;  1JJC A;  3NTK A;  3CCM T;  3KXT A;  2A8E A;  2K5F A;  1YHQ T;  1E1O A;  1UEB A;  4Y28 E;  5I2M A;  2IG0 A;  2JZ2 A;  2G4C A;  4C92 G;  2K3X A;  4EX5 A;  3JB9 I;  3JB9 G;  1H4S A;  4M7D G;  1NJ6 A;  3JCM W;  3S3O A;  3P8V A;  1UGS B;  2RK1 A;  4HWR A;  1Q82 U;  4QW2 A;  3CME A;  4FM4 B;  1WJS A;  1RI0 A;  1SER A;  4M78 A;  1M90 U;  3QO3 A;  3V8K A;  3SWN C;  2EWN A;  3LC0 A;  3UPU A;  4UP9 A;  3CCV T;  4YRN A;  5I2S A;  5GAO m;  3NTH A;  2VXE A;  2Y90 A;  1VQK A;  4BE2 A;  3BY7 A;  1ADY A;  5GAM h;  2AMC A;  2E5Q A;  1Y7X A;  3VQX A;  3P8D A;  4QVZ A;  3CBM A;  5CKD A;  3OYN A;  3GF5 A;  4LDU A;  3GIB A;  1RL2 A;  3REU A;  3CD6 A;  5HKC A;  2MF2 A;  4ELZ C;  1KG1 A;  4YRF A;  1LOJ A;  4G85 A;  3N5B B;  1K73 C;  2IVW A;  3REX A;  2E3C A;  3I55 A;  1M1F A;  2LQK A;  3BW1 A;  2QI2 A;  3RUX A;  3A8O B;  2HAX A;  2E1H A;  4BB7 A;  5HK0 A;  1UGQ B;  3QDR B;  2ZPG B;  1BKB A;  1YBY A;  3G6E A;  3PFS A;  4P72 A;  4LVL A;  2O01 E;  4CH6 A;  4YPF A;  1WGS A;  4JS4 A;  4HKE A;  3HPW A;  4O5V A;  5KE2 A;  4PNO A;  3UGQ A;  2KDS A;  2LCL A;  4FSX A;  2JTM A;  1VUB A;  4ZTU B;  1PSE A;  4LDX A;  4E7K A;  1VIE A;  2RJC A;  1KD1 U;  1D3B B;  3OMG A;  2AKW B;  4GY5 A;  3SWN B;  4P74 A;  3PGG A;  4PL6 A;  2QEX A;  1Q86 U;  2M1H A;  1B76 A;  3E9H A;  4BDZ A;  2RI2 A;  4H2S A;  2QA4 T;  1YJN A;  3VYH B;  4ZTF A;  3HKS A;  2ZR3 A;  2DTI A;  2RHS B;  1IL2 A;  3VQV A;  1X2G A;  4J6X A;  3QO8 A;  2E12 A;  4F7U A;  3TEH B;  5KCO A;  4BE1 A;  4K88 A;  3G4S T;  1OZ3 A;  4XTU A;  2DEQ A;  3X25 B;  2QQS A;  4EPC A;  4MDW A;  3PIP A;  4G84 A;  2D6F A;  3HY1 A;  5IN1 A;  4RCB A;  5FU6 C;  4HCB A;  3OBY A;  3QUI A;  3E9G A;  3BDL A;  4BD3 A;  1N27 A;  3X28 B;  3CCU A;  4R56 A;  3CCM A;  4TVR A;  4YRO A;  1QP2 A;  1EVK A;  3DSQ A;  4Q5W A;  4E7L A;  4HVC A;  4PJO A;  4QVC A;  1W66 A;  1QE0 A;  2ZPH B;  4IKF A;  3M56 A;  3NET A;  4YTL A;  3RIR A;  1G5I A;  4ME7 A;  1S72 A;  1Q82 C;  3WVD B;  1N6A A;  2JTF A;  4V2S A;  1OZ2 A;  2HD0 A;  1M90 C;  2OAU A;  1WQW A;  4C0Z A;  5GAM f;  3OYK A;  1X75 C;  2ODR C;  4TVW A;  2M9U A;  3V7S A;  3A5Z A;  1WQ7 A;  3ME9 A;  3CMA A;  2DDZ A;  2V8K A;  5GAO r;  1M8V A;  2ZZD A;  2GFA A;  1NYR A;  1E24 A;  1NPP A;  3FRN A;  3M59 A;  4A4E A;  1HXD A;  4M75 C;  4UPA A;  1N9S A;  3OYA A;  2RK2 A;  4WI1 A;  4OF1 A;  3NEN A;  1QP3 A;  3HXV A;  5LJ3 d;  3OA6 A;  2PUO B;  5EG2 A;  2V8J A;  3A8H B;  2P0Q A;  5CVI A;  3L2R A;  3QO5 A;  4HWS A;  1VQM T;  1NJ5 A;  2RJF A;  4J83 A;  4BY6 C;  2RB6 A;  3BJU A;  2XID A;  3HL8 A;  3VYG A;  4KR2 A;  2ZZE A;  3PCO A;  4LD9 K;  4B9W A;  2EKO A;  5GAN 8;  2P0L A;  2OTJ A;  2HNI A;  4E47 A;  3QJ6 A;  2CJ9 A;  4BAC A;  2ZT7 A;  3P8Y A;  3CCS T;  3ASK A;  4HT8 A;  4A54 A;  4HWP A;  2C06 A;  3JCM d;  2EJF A;  4CI0 C;  1JJ2 A;  2P5I A;  2ZT5 A;  1Q7Y U;  3A7A A;  1KMN A;  2C8M A;  2FYK A;  4BDY A;  1I8F A;  1VQ7 T;  2C7I A;  3L2U A;  3SD4 A;  1PSF A;  2Y4Y A;  5FRM A;  2WSE E;  3QII A;  3QBY A;  4MML A;  4M7A A;  3EFS A;  4LVM A;  1Q86 C;  1VQ4 T;  2MAM A;  3QYH B;  3TCJ A;  3MF1 A;  4P75 C;  4LVI A;  4ELY C;  4M78 E;  3RMS A;  1H4V B;  1FX7 A;  1IRE B;  5GAN j;  2RI3 A;  3S6W A;  3OYM A;  4M75 B;  2ZIM A;  4YRC A;  1YI2 A;  3I7F A;  5C0M A;  4P73 A;  1Y71 A;  2EFI A;  3OYE A;  2M16 A;  5D6W A;  3G71 T;  2Q7G A;  3NEM A;  2BIV A;  2L8D A;  1E1T A;  3A8G B;  4BE0 A;  4OLF A;  2GFU A;  4BY6 B;  3ICA A;  4PHC A;  3HFZ A;  3QHS A;  3G4S A;  4A4H A;  1M1K C;  3INZ A;  3GOX A;  4C8Q A;  4NS5 A;  4C92 C;  1NPR A;  1I81 A;  1N9W A;  4YYE A;  1G3Y A;  3CCE A;  3M54 A;  1X55 A;  4M75 G;  2L89 A;  1YFS A;  2MWP A;  1KC8 C;  4M7D C;  2MWO A;  1FXX A;  4H2W A;  4EDU A;  1VQP T;  3QZ9 B;  3C12 A;  1N9R A;  3HXY A;  1H4T A;  4M78 C;  2Q5H A;  2ZZF A;  1WYD A;  5KNN A;  4L5G A;  4JJN K;  5J39 A;  2ZTG A;  1WJQ A;  4N0A C;  5LJ5 g;  4BWA A;  3JCM P;  2EQK A;  2VGM A;  3VKI A;  5GAN 3;  4XEO A;  4ZN3 A;  1RIQ A;  2EQU A;  2CIM A;  2QHS A;  2RH2 A;  4NL2 A;  1JJ2 S;  3CBO A;  1W4S A;  5ELN A;  2RHU A;  4OB1 B;  3OS0 A;  1G3S A;  2YHT A;  3M4Q A;  1TH7 A;  4M78 D;  2RHX A;  5GAN 4;  3CC4 A;  1ASY A;  4IUP A;  3FLG A;  1L0W A;  3P8B B;  4KUL A;  1JJC B;  3L42 A;  1VQL T;  4F7U E;  1VQM A;  1XOV A;  2CYZ B;  3MQZ A;  2ZIN A;  2DXT A;  5CCA A;  2PVO B;  2CZ0 B;  5LJ3 j;  2A3L A;  1M1G A;  1VQ9 T;  1M4Z A;  4P71 A;  1VQ5 A;  1VQ6 T;  3HY0 A;  5A0L A;  3OYL A;  5A0G A;  5FRO A;  3BFM A;  3OD1 A;  1B34 B;  1KHI A;  2JVV A;  2QHT A;  2DIG A;  4M7D B;  4C5H A;  4H2V A;  3UWN A;  2IY5 B;  2KQW A;  4M78 F;  4M78 B;  4ATO A;  5CQY A;  3H8Z A;  5KH6 A;  4OGE A;  4PJO E;  3SDZ A;  2DKG A;  3QTC A;  4XTV A;  4P74 C;  3JCM V;  2VC8 A;  3EFR A;  3TUP A;  2I4N A;  4M77 A;  4HWT A;  4KR3 A;  4CS3 A;  3SFM A;  5GMK h;  4E7I A;  2AMC B;  4RG8 A;  1BYM A;  4YRE A;  2WAC A;  4JDS A;  1ASZ A;  3C4S A;  1NE8 A;  1QVG A;  2E6N A;  4QVD A;  1YJW T;  4JRI A;  3V8J A;  3RL6 A;  3HRT A;  2RHZ A;  4YRS A;  2VXF A;  3I56 A;  2RHY A;  3KUF A;  4XAX B;  1USY A;  2RJE A;  2P4T A;  4M78 G;  3X20 B;  1KMM A;  3UT1 A;  4YRL A;  3HXW A;  2Q7H A;  4OVA A;  1M5Q 1;  2LTO A;  3LGL A;  3J81 E;  5CR2 A;  3JCM J;  4J5Y A;  3OMC A;  5FRN A;  1ATI A;  4RG2 A;  1G51 A;  2CZ7 B;  1O9S A;  5M9O A;  1YJ9 T;  4J6W A;  2LT1 A;  3M9Q A;  4DA4 A;  4FT2 A;  2ZT6 A;  1VQP A;  4R55 A;  3CCL A;  2HQE A;  5C51 B;  2JOY A;  2ALY A;  3IG2 A;  4PJO D;  2EJ9 A;  3ZFJ A;  4BI8 B;  4NL3 A;  1AHJ B;  3OBW A;  5GAN 2;  2LC4 A;  3DLL A;  4DPG A;  2D0Q B;  3PNW C;  4F7U F;  4F7U B;  3CCJ A;  2K5L A;  1LNX A;  4M7A E;  3NFC A;  3CCQ A;  3ER0 A;  4CRI A;  2E10 A;  2J3M A;  4EO4 A;  5GAN 7;  1YIJ T;  5GAN d;  1SES A;  3A31 A;  1G5V A;  3A5Y A;  2Q5I A;  2QQ9 A;  3CMQ A;  2E41 A;  1B70 B;  3OS1 A;  3M5A A;  3DLM A;  2CZ6 B;  3M4P A;  2ZR2 A;  1SET A;  3M53 A;  2DXU A;  1KHC A;  1YIT T;  2QHV A;  3BDU A;  5CAI A;  4PJO F;  4PJO B;  1UB4 A;  1QVG S;  4O6J A;  1N8R U;  3CC2 A;  3JCM c;  3LYI A;  3HSB A;  1X56 A;  4ZN1 A;  4F7U G;  2FVU A;  3QKJ A;  1BBU A;  5AYF A;  4C5G A;  4C0D C;  3JCM Q;  4C8Q E;  2CKK A;  1VQ6 A;  3HRK A;  1KOG A;  2XDP A;  2PUK B;  4UP7 A;  2K4Y A;  4MDX A;  2DU5 A;  3MEU A;  3ZEH A;  4YRJ A;  3TRE A;  5GAN 5;  4JS5 A;  4M7A C;  3OYD A;  4A4G A;  1YFT A;  3FDR A;  3A5Z B;  3PT9 A;  1V29 B;  1LYL A;  2V8I A;  3FJP A;  2XKO C;  2GQV A;  2QHU A;  4JUV A;  2QQR A;  3J7A F;  5CQX A;  4PJO G;  3JCM h;  4OB3 B;  4L6V 5;  3E19 A;  1YHQ A;  3S3N A;  4X34 A;  3A7U A;  3LLR A;  4DQ2 A;  3OSV A;  2FHD A;  1WJR A;  3MO8 A;  2X4Y A;  4GLK A;  5K1P A;  3WXM B;  3GNG A;  4YRG A;  3KFU A;  3PCO B;  3FC3 A;  1VQ8 T;  3MEA A;  3UDC A;  2B8A A;  2F69 A;  4M7A D;  1C0A A;  2AKW A;  2DIQ A;  1B7Y B;  1W2B A;  3SWN A;  2CGH A;  3O8V A;  1U1T A;  3L2W A;  1X01 A;  4YRR A;  4L87 A;  4IUT A;  2LCC A;  3OB9 A;  2RHQ B;  1U1S A;  2RHS A;  2GCX A;  4EMG A;  4YRK A;  1SSF A;  4JLI A;  2ZPI B;  4RMF A;  2RHI A;  2R5M A;  2QTX A;  3VBB A;  4VUB A;  3CCV A;  4IUU A;  4C0D B;  4J15 A;  5CO7 A;  2O4X A;  4OB0 B;  3HRI A;  1X2H A;  1NJ1 A;  2ARU A;  2DPP B;  2XTI A;  1G3T A;  2P0P A;  4N4H A;  4M7A B;  4M7A F;  5C53 B;  2XK0 A;  4YP0 A;  4P3N A;  3IKL A;  2DXC A;  5LJ5 d;  5D6X A;  3QO7 A;  4X5O A;  3M58 A;  4OP0 A;  3G7Z A;  2ZIO A;  1QVF A;  3CPF A;  2QXF A;  4TTV A;  4K87 A;  4A4K A;  4M77 E;  2XGT A;  2QQB A;  4X9C A;  3RKW A;  4WF2 A;  2OTL T;  4CH4 A;  2FB7 A;  3JRZ A;  2DD5 A;  3CCR T;  1MGQ A;  3WQZ A;  2XD0 A;  4EMK C;  3HFZ B;  4PLI A;  5LJ3 f;  1JB0 E;  5C52 B;  4LDW A;  4M7A G;  3HFV A;  3HXU A;  2E6Z A;  4FT4 A;  1KD1 C;  1KQS A;  5DLQ E;  4RCC A;  1YGB A;  3URG A;  2M0O A;  5GAM g;  4LVK A;  1K9M U;  2ZPB B;  3HXX A;  2RO0 A;  1OI1 A;  4TVA A;  5DM7 R;  5IAY A;  3WVE B;  4ZGE B;  1YFR A;  2LRQ A;  2NS6 A;  2DQ0 A;  2QA4 A;  4MMK A;  3FIF A;  2EL9 A;  2L3R A;  2HBP A;  3P8T A;  3JCM b;  5GMK e;  4XEM A;  3JCM f;  3H6Z A;  2CS7 A;  4TQF A;  4OB2 B;  2KSS A;  3CEY A;  1U8R A;  3CC7 T;  3W3S A;  3OS5 A;  11AS A;  4H2X A;  3MP1 A;  1HC7 A;  3DB3 A;  3PMT A;  5A0D A;  2NLU A;  4CS2 A;  1PYS B;  2KAF A;  3E9I A;  1USY C;  1BBW A;  5GAO l;  4HA8 A;  2EQJ A;  4HCC A;  1P92 A;  2DVE A;  4IUV A;  2MI6 A;  3LH0 A;  3OYI A;  2E70 A;  4XTY A;  4M77 D;  1EOV A;  5GMK i;  1O75 A;  1G3W A;  2KMT A;  4TWA A;  1I5L A;  1EIY B;  3VJP A;  1BIB A;  4FIB A;  4EMK B;  4LDY A;  2AHJ B;  3LX7 A;  3A8L B;  4XTW A;  3HRU A;  5E3I A;  2JUF A;  4RQE A;  4QQD A;  1NJI U;  5GAM e;  1QVF S;  4M75 A;  4XU2 A;  2XHC A;  1ZQ1 A;  1X6O A;  2XG8 D;  4JRQ A;  1NNH A;  3MEY A;  5GMK l;  3JAM E;  4JLG A;  3RER A;  1E22 A;  1WPY A;  2K5I A;  4BUG A;  3E1S A;  1H4Q A;  4XU0 A;  2WSF E;  5GAO q;  4PLL A;  3OYJ A;  3G6E T;  1QF6 A;  2D9T A;  4M77 F;  4DOW A;  1VQN T;  1KQS S;  3JCM g;  1ZHI A;  4Y91 A;  3M4Y A;  5FLX E;  3OYH A;  1WU7 A;  4P72 C;  4KBM B;  4IUR A;  2PMF A;  2E5A A;  3RGL A;  3VQW A;  2Q7E A;  3T9N A;  2ZNJ A;  3QG1 A;  4ZIB A;  3L1A A;  1Q7Y C;  2RD1 A;  4YRP A;  1XTD A;  4XTZ A;  1BI1 A;  3CCS A;  5LJ5 j;  1R8O B;  1H64 1;  2OTL A;  1Q81 U;  3RAC A;  5HK3 A;  12AS A;  1QW1 A;  3OYB A;  4QQG A;  2DZC A;  4RQF A;  3CCR A;  3DB4 A;  1NJ2 A;  1XNI A;  2I4O A;  2ZNI A;  4C5I A;  4L59 A;  1K9M C;  1VQ7 A;  4HWO A;  3MET A;  3X24 B;  5GAN h;  1X54 A;  2X4J A;  3CCU T;  1VQ4 A;  4RKU E;  1VQZ A;  2G3R A;  2ZPF B;  2K2V A;  5LL6 S;  2LQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...