3FJPA

Apo structure of biotin protein ligase from aquifex aeolicus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
total genus 67
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fjpA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3fjpA01
2E10A 4P73A 4YRIA 4M78A 5GMKl 4M7DB 1PYSA 2ZGWA 3JCMW 4RCCA 4M78G 1NNHA 2AKWB 5ELNA 4K87A 3ERRA 4YCWA 4J6YA 3V8JA 4XQ3A 3SB2A 1QE0A 3LSQA 1G51A 4ZTZB 4L87A 4XTUA 2ALYA 3JCMQ 4YRTA 4N0AA 1NJ2A 3A31A 3A7UA 2RB6A 1X2GA 4YPFA 3JCMc 2CIMA 4M75E 4DQ2A 5HGQA 4JRKA 4J5YA 5I21A 1J5WA 2J3LA 4O2DA 4TVAB 1I8FA 4M7AD 1WLEA 2DZCA 2ZT5A 4EMHA 5GAN7 3UFGA 1EFWA 1HK9A 1N9RA 2K57A 2ZCEA 3JB9F 2G4CA 4YCVA 3NENA 5GAOr 2DTHA 3VU3C 3E9IA 3RKXA 1NJ8A 4YRQA 4YRJA 1QF6A 5F5WA 1Y96B 4M7DC 3IALA 3KFUA 1VQZA 3LSSA 5CAIA 3JCMd 3FJPA 3VQVA 3G1ZA 4MMLA 4EO4A 1NYRA 5C51B 4KR3A 1SERA 3JCMe 3BDUA 4XTYA 3JCMJ 5GMKj 4CH6A 2YLCA 4M7AA 2Q7EA 4G84A 4M78B 5LJ3g 1YFTA 4F7UE 4KQEA 3TEHA 4HA8A 3BW1A 4M7AG 3V7CA 1NJ1A 3V7SA 3VQYA 4M7DA 5GMKe 4UP7A 1C0AA 4HWOA 1X55A 1D3BB 1X01A 4XTXA 1SESA 3RACA 4YYEA 1X56A 4M7DG 3MF2A 3HXYA 3RL6A 3JCMh 1I4K1 1EOVA 3NELA 4A54A 2RD1A 3SWNB 4YRCA 3REUA 4P72C 4CS3A 2AMCA 4F7UA 3JB9I 4CS2A 4HT9A 4X9CA 2RM4A 2E64A 4F7UG 5GAN6 4TVYA 3RUXA 4ZIBA 3ICAA 4ZTUB 4C8QD 3RESA 1RIQA 3HRKA 4C8QE 2ZXFA 1B70A 3HXUA 4YRGA 4AH6A 1U1TA 5K1PA 2EAYA 4RDXA 4C92D 4P73C 1M8VA 4C92E 4M78C 1LYLA 4PHCA 4K88A 3QSUA 2E41A 3M4GA 5GANj 4P72A 5GAMd 4G85A 4K86A 4LNSA 5LJ5j 1Y96A 5GANd 2YHTA 4XTWA 1WU7A 4J15A 1ASYA 1B34A 1LJOA 1ADJA 2QHVA 1H4TA 5GAMe 3GIBA 5GAOp 4NL3A 4JRIA 5GANe 1E1TA 2ZZGA 4XEMA 4M7AB 2DXUA 5LJ5e 3SWNC 4TQFA 4P3PA 3JCMP 3TEHB 4C8QA 1YCYA 2DQ3A 5ELOA 2ARSA 4HWSA 1TH7A 1W66A 4C92A 4C8QG 2RA2A 3HFOA 3LC0A 1I5LA 5E3IA 4M77D 5GMKm 2ZNIA 4C92G 3PCOB 3FB9A 4M77E 5GAMh 4PJOD 2QHTA 4PJOE 3JCMX 1D3BA 5GANh 1X2HA 2ODRD 1B76A 4P3OA 4KR2A 2DDZA 3BFMA 3HXWA 5GAN5 3DSQA 4YREA 1E22A 1JBMA 3SWNA 4PG3A 2AMCB 3JB9J 3A7RA 4F7UB 4M75D 1KOGA 4CH3A 2VXFA 4YRKA 2ZT8A 3RKYA 2DXTA 4YRNA 3M4PA 3QUIA 1B70B 4M77A 4NCXA 2EJ9A 4PJOA 4RCBA 4M7AC 5C52B 2E5AA 4YDQA 1WYDA 3HFZA 4M77G 4M78F 3IKLA 4PJOG 3A74A 3HFVA 1E1OA 1SRYA 3A5YA 1B34B 4M75A 3QTCA 1KMNA 2XTIA 1HC7A 2ZTGA 4A53A 1LNXA 1EVLA 2Q7GA 4M75G 4EMKA 3BJUA 1B8AA 1JJCA 3MEYA 4P74C 1EQRA 4C8QB 1HXDA 4RMFA 5LJ3f 4TQDA 2RHQA 1BIAA 2QHUA 2PMEA 1YB3A 4C92B 2ZINA 3HY0A 3P8VA 1YGBA 4EX5A 3UGQA 2VXEA 4CH5A 2RHSA 2IY5A 3PCOA 1WQWA 4PNOA 1IL2A 1NYQA 2EJFA 4WF2A 4P74A 4YRFA 4WJ4A 4P71C 4QVDA 4CS4A 3JCMb 5LJ3j 5GMKh 4Q15A 2Y90A 1EIYA 1YFRA 1EVKA 5GAOl 4M77B 1NJ5A 2P5IA 4H2VA 4HWPA 4XTVA 4PJOB 4P75A 4M7AF 3HFZB 5GAOm 1H4VB 3JB9H 1KQ1A 4C8QC 1Z7MA 3W3SA 1WQ7A 4C92C 3M4QA 4M7DF 4P71A 4YP0A 1H4QA 4M75B 2E65A 3I7FA 4NL2A 2P0LA 5GAN4 4JLIA 3AHUA 3HXVA 5LJ5d 4EMKB 1JJCB 3A32A 1H641 1X54A 3NEMA 4BWAA 5GAN2 2RHQB 1E24A 4V2SA 2CJAA 3JB9D 2ZZFA 3BY7A 5DY9A 3OD1A 4F7UF 3L1AA 2DTOA 4XU2A 4XU1A 3IG2A 4H2TA 5GAOn 1G5HA 3E9HA 4EMGA 2RHSB 3TUPA 2IY5B 1BBUA 4YRSA 2XGTA 4M77C 1ASZA 4PJOC 5GAOq 3P8TA 2ZIOA 5LJ5h 2ODRC 5K1XA 2ARTA 4P3NA 3NETA 2I4MA 4HVCA 4X5OA 4H02A 1B7YA 1LOJA 2Q5HA 4Y91A 3QO3A 4DPGA 4M75C 2ZR3A 1EIYB 4XU0A 12ASA 2Q7HA 3IKMB 3JB9G 2ZR2A 5KNNA 1Z7NA 4EMKC 2DU5A 3HFNA 2QTXA 2DTIA 4X9DA 1MGQA 4C8QF 3JCMf 1WPYA 3FIFA 4YRPA 2DQ0A 3JCMg 3WQZA 2DVEA 4C92F 2JN0A 2DU7A 3R07A 1ADYA 1GGMA 2FYKA 4YCUA 4XU3A 1H4SA 3HTZA 1N9WA 1NJ6A 2ZT7A 4M7AE 4NOYA 2I4LA 1I81A 3QHSA 3VQWA 2Q5IA 3RGLA 4YRLA 3A5ZA 3RKWA 4M7DD 4M7DE 2ZNJA 4J6WA 3HXZA 3QNEA 1WNLA 3HXXA 2DKGA 4H2XB 3PZCA 4OLFA 11ASA 3QO5A 2ARUA 3A7AA 2HNIA 4M77F 2I4OA 4P75C 4RQEA 2CGHA 4JUVA 4XTZA 4PJOF 4HWRA 3L2ZA 3L4GA 4OP0A 3RF1A 3HRIA 1B7YB 4XEOA 4UPAA 3VQXA 4J6XA 1HTTA 1N9SA 1PYSB 4H2UA 1BIBA 1U1SA 2FB7A 4M75F 4HT8A 2CJBA 3EFSA 4TVWA 4H2SA 2J3MA 3CMQA 5GMKi 3V8KA 5LJ3d 3RIRA 2E3CA 3TEGA 2AKWA 2EWNA 5GAMf 2ALYB 2YLBA 5GAMg 5GANf 1SETA 4YRRA 4BW9A 4CH4A 5LJ3e 5GAN8 5C53B 5GANg 2EJGA 4Q6GA 5LJ5f 1KQ2A 2C8MA 4HWTA 4UP9A 3V8LA 1BBWA 5LJ5g 2DJZA 4YROA 2I4NA 4TTVA 1G5IA 1USYC 5GAN3 2C7IA 3HY1A 2DEQA 4TWAA 4H2WA 3VBBA 3INZA 3UH0A 4UP8A 2ZT6A 3HSBA 4TVAA 1JRIA 4MMKA 5LJ3h 4YRMA 1ATIA 3EFRA 4M78D 2DZ9A 3MF1A 3QO8A 4M78E 4QVCA 5GAMj 1YFSA 4RQFA 1M5Q1 1USYA 2CJ9A 1L0WA 2ZIMA 3UGTA 2ZZEA 2VC8A 3JCMV 4H2YA 4H2XA 2QHSA 3V7RA 3PGGA 3L4GB 2PMFA 3REXA 3QO7A 2I2LA 4WJ3M 2E1HA 1KMMA 4WI1A 2EL9A 3RERA 4N0AC 3P8YA 4E51A 1FYFA
chains in the Genus database with same CATH superfamily
2JNGA 2EQUA 4FT2A 2P0KA 1NPRA 2EQMA 1VQMQ 2C0TA 2KSSA 4L59A 1QE0A 1PG5B 2JJ9A 5CKBA 3CPWA 2L3QA 1Q86U 1G51A 4ZTZB 1RI9A 3OYYA 5EC7A 2LQKA 3HTRA 1E7OA 4QQGA 1YJNQ 4YRTA 2RB6A 3JCMc 3PFSA 2DM1A 2QGFB 2MI6A 2L89A 4JRKA 4J5YA 1S72T 5HGQA 2A3LA 5I21A 2J3LA 1ZUYA 2DJQA 5FRMA 3CXCP 2ZT5A 2DD4A 5GAN7 1N9RA 4CI0C 3DLMA 2K57A 3G71Q 4YCVA 2RQUA 5GJVB 3NENA 2NUZA 1BI0A 2KEAA 4M7DC 1JEGA 5FU7B 2KAFA 3OS5A 3OYKA 1X6BA 2DIGA 4E2FB 1VQ5Q 3UDCA 2JS2A 2F5KA 3QG1A 1NYRA 4XTYA 2HQEA 3R6OA 2CSQA 3CD6A 3OSSC 2Q7EA 1Q82C 3UPUA 2DL8A 3LWHA 3BW1A 4M7AG 2CP5A 4ESRA 5CCAA 1HYOA 1N27A 3V7SA 3VQYA 3MQZA 2YUQA 1X55A 2X9HA 1SESA 1Q81U 2XDBA 4YYEA 3RL6A 4DOWA 2EW3A 3NELA 2FHDA 2PQWA 4ZGJB 4FT4A 3DLLA 3G4SQ 1JQQA 4IUQA 1ZUUA 4P72C 3M56A 4Z02A 4BE2A 2QG9B 2AMCA 4F7UA 2CP6A 2FZKB 3JB9I 2RQTA 2E64A 4FYVB 1G3TA 2LDMA 2ZPFB 1RIQA 3HRKA 2XKOC 2RHUA 4YRGA 1VQNT 5K1PA 2D6FA 2D8HA 1Z9ZA 3M5AA 4C92D 4F14A 4PHCA 1LYLA 3M4GA 3MJXA 3PT9A 4LVIA 1Y96A 2XDDA 2ATCB 1B34A 4LDVA 4DBHA 4OB1B 1G3SA 3I55T 1ZSZC 3GIBA 1WXBA 2DK3A 4JRIA 1E1TA 2JMCA 3ZFJA 2D1XA 2YRDA 2DXUA 3BDLA 2EQJA 2LZ6B 3CCQQ 1GBRA 3PTAA 2DQ3A 4OMQA 4HWSA 2DERA 1QP2A 4AFSC 1UJ0A 1W66A 4C92A 4C8QG 3CCVT 3LC0A 2BKDN 4D8KA 2RN8A 4M77E 4AFZC 1VQ7T 2JT4A 2QHTA 3EG2A 2DLPA 2J06A 2AKLA 3KXTA 1BCOA 3TQ7P 2CP2A 5J26A 3HXWA 1WHJA 1ZX6A 2QDLA 3T9NA 3EGDB 3JB9J 3A7RA 4M75D 1JXOA 2VXFA 4YRKA 2LT1A 1K9MR 2DXTA 1Q7YR 3A8LB 3HPWA 1JJ2P 1YJWQ 3EGXB 1G3YA 2ROLA 4NCXA 2W0ZA 2YXYA 1IZ6A 3FEOA 4ZN1A 2EGEA 3HFZA 1TOVA 3L42A 4PLLA 3A74A 3CCRQ 2QEXT 3M54A 2KQWA 1AT1B 2FPEA 1R0BG 2RF0A 4M75A 1PC0A 2XTIA 1S72A 1H3HA 1UDLA 1V76A 2ZTGA 4A53A 1UHFA 1EVLA 1Y57A 3G6EQ 2LQNA 1TSFA 1JJCA 3MEYA 1OPLA 1YBYA 2XMFA 3CCUQ 1YWPA 5LJ3f 2KXDA 4L6V5 3MCAB 2QHUA 1YB3A 2ZINA 1CKBA 1LVKA 3QDFA 1ZQ1A 2DD5A 2RJCA 4EX5A 1VIEA 4LDUA 2JW4A 3UGQA 2ROTA 2VVKA 1K9AA 1PD1A 3M53A 1W70A 2D9TA 4BE1A 1X69A 2LCCA 2RHZA 2IG0A 4ZNXA 2LJ3A 1IL2A 1FXXA 2IIMA 2HBPA 2K9GA 3CMEQ 3CCMQ 2GTOA 3E2UA 4QVDA 1Y71A 1TG0A 4BB7A 1VQKT 4J9CA 6AT1B 5EG2A 5M9OA 1MNDA 1ABOA 1GCQA 1NJ5A 5GAOl 4M77B 1D1BA 4XTVA 1TUGB 3EH2A 4P75A 1YJ9Q 3CBOA 2WACA 3A8OB 4RMOA 2CYZB 1VQ6Q 2QQSA 1Z7MA 1KD1C 1A0NB 1BU1A 4BE0A 4C92C 7AT1B 4YP0A 1H4QA 4PFOA 1G8XA 2BE7D 2KI7A 1WHGA 3AHUA 5LJ5d 2DA9A 3MEUA 3A32A 4DBQA 2AKKA 2RHQB 2CJAA 4VUBA 1VQNA 4ZTJA 4F7UF 3UF4A 3FJ5A 1SPKA 3LH5A 3C12A 9ATCB 2RHSB 4BDZA 3LLRA 4E7LA 1FWZA 2PU9B 1YITQ 2PUKB 1AOJA 2LCSA 3I55A 2A36A 3EG0A 5K1XA 2VASA 2QYZA 4Y28E 2HDAA 4HVCA 2AT1B 1RI0A 2V8KA 1OPKA 2JMAA 4PFZA 3FRNA 4PJJA 1FYNA 2V8IA 4M75C 3DB4A 2C0OA 12ASA 3CCVA 1YIJQ 1H92A 2ZR2A 1ZLMA 1P92A 1AWWA 3CQTA 1Z7NA 1VQ7A 1W2BS 4C0FA 1MGQA 3LX7A 3FIFA 2NUTB 2QK0A 4J9FA 3WQZA 4C92F 3TSZA 2JN0A 3MKDA 3PMIA 1PRLC 4E7SA 2CZ6B 4RG2A 4NS5A 2DPPB 4R56A 2HBWA 8ATCB 4RTTA 2KROA 2MWPA 3VYGA 2HMAA 1N9WA 4LDXA 2ZT7A 1VQLQ 3OB9A 5LL6S 2F69A 1VYUA 2EYQA 1I81A 2I4LA 4LVJA 3VQWA 2Q5IA 5KYXB 3A5ZA 1XTDA 2LX9A 2G3RA 4X1VA 1UB4A 2QEXA 1TS9A 3I5SA 2KNBB 3A7AA 4JJBA 1EIFA 2I4OA 4P75C 4RQEA 2RJFA 3OW2S 3L2ZA 2FL7A 5L8RE 5KYUA 5D6XA 4XEOA 1BBZA 1UHCA 3OYDA 1QVPA 1YI2Q 1PCXA 4J6XA 5FU6B 4DEXA 4M75F 4HT8A 1M1KR 1MMDA 3HHTB 4HCBA 2VGMA 2QASA 1VQOQ 4E6RA 2DIQA 2DMOA 2H3JA 2EWNA 3H0HA 4L5GA 1SETA 2RJDA 3JRZA 3CMAQ 4JRPA 3PNWC 4BY6C 1QMCA 1N6AA 3V8LA 4C5HA 1VQ4T 4TTVA 1G5IA 1I07A 4HKEA 1VQKA 1OU9A 2V26A 3CC7Q 2NUPA 1NJIR 4OMPA 4H2WA 4UP8A 5KCHA 2ZT6A 1WJSA 2PUOB 3HSBA 1JRIA 2P4RA 2YRVA 4J8OA 4M78D 1V1CA 2L3RA 1U8RA 5GAMj 3M55A 1YHQQ 3CC4T 4LUDA 3C0CA 1VIFA 2JXBA 3UGTA 2FPFA 3JCMV 4JPBW 5FROA 2QHSA 1M27C 3QPHA 3V7RA 2GFUA 3QO7A 3MO8A 4WI1A 1K73U 3RERA 1FYFA 2E10A 2BZYA 2L5QA 4M78A 3X28B 2QQBA 4KBMB 3GBQA 3VS5A 2IPOB 5ELNA 1NLOC 3ERRA 2I0NA 4YCWA 4DBFA 4MZTA 1TUDA 4FU6A 1RAEB 2DBMA 3LSQA 2COZA 1JB0E 4XTUA 3CCJT 1NYFA 2D8JA 1Q86R 2A37A 4N0AA 3URGA 3C95A 3A7UA 4FSXA 4WCIA 1VQ8T 4P5NA 4AG1C 2CIMA 4M75E 2RO0A 2MCNA 4PJLA 4OMNA 1BKBA 1BCMA 5KYYA 4O2DA 4TVAB 2YSQA 3OMCA 2RI5A 3GP8A 4EMHA 5J39A 3UFGA 2NYSA 1HK9A 3NPFA 4J9EA 3VU3C 4YRQA 4YRJA 1QF6A 1YNZA 1Y96B 1D1AA 1AD5A 1KQSS 2CP7A 2VV5A 2K3YA 1X43A 5IXBA 1WJQA 1MHNA 4IKFA 3G1ZA 4KR3A 1WGSA 3TVTA 3BDUA 3JCMJ 2CZ0B 1UTIA 1OX9A 4CH6A 5HK3A 4G84A 1VOMA 1KSWA 2JS0A 2F2XA 5ECAA 4M7DA 1C0AA 2X4JA 4J7IA 2EIFA 1X01A 1WFWA 3NTIA 4IUPA 3BE3A 2QQAA 3HXYA 1Q81R 2BZ8A 2DRMA 2RD1A 3S3NA 4LVMA 3EG1A 3OYBA 4YRCA 3REUA 4TVRA 2KE9A 1RABB 2DNUA 4WTOB 3VS2A 4KH0B 4CS2A 1SEMA 4F7UG 1SF9A 3CXCA 2HSPA 5GAN6 2ZPGB 1WA7A 2YDLA 4RTUA 4C8QE 2ZXFA 1IB8A 1U1TA 1K8AU 4M78C 4FL6A 3QSUA 4JZ4A 4C0ZA 4P72A 4C0DB 1VQ4A 4N4HA 3WVEB 1H4TA 4FW1A 2QA4T 1VQPT 2ZZGA 4M7AB 3SWNC 2CP3A 4CC3A 1K9MC 4TQFA 2LJ1A 3TEHB 1X6OA 1Q7YC 5ELOA 3CC4A 1I1JA 1N8RC 1I5LA 4FYYB 3EG9A 3J81E 2ZNIA 4C92G 3FB9A 5GAMh 4PJOD 3EAEA 3JCMX 1D3BA 1WXUA 2CH4W 3REAB 5GANh 1X2HA 1QQJA 1ZSZA 4P3OA 2DDZA 2A7YA 3DSQA 4FM4B 1JBMA 2QGGA 2O4XA 2XIDA 3PE0A 2BE9B 3RKYA 1MMNA 8AT1B 2ZPIB 2JM9A 2LQWA 3M4PA 3NHNA 1B70B 3QJ6A 2EJ9A 4PJOA 1T3LA 3NGPA 5C52B 3CD6Q 1U5SA 3HRSA 4IUTA 4M78F 3CCJA 4B9WA 4ZN3A 3IKLA 2F5TX 3LYIA 1EX4A 3I56T 3A5YA 2MPXC 1VQ8A 3VUZA 1RUWA 4J9GA 2OAUA 3QTCA 1IGQA 1K1ZA 3A8GB 2E5QA 2L2PA 4UC4A 1KK7A 2J6OA 3OBWA 4M75G 4OB3B 1IXDA 4J9DA 4P74C 1M9SA 4C8QB 3GLXA 1EQRA 2GF7A 3M0RA 1G5VA 2CKKA 3UWNA 2KVQG 3HY0A 4PJNA 1YGBA 5IHIA 3VS7A 2EGCA 4FYWB 5FRNA 1PM3A 4A4EA 2YUNA 4J9HA 3X24B 3QYGB 2IY5A 3G6ET 3PCOA 1AVZC 2D0QB 2KRSA 3M0UA 1NYQA 4RTYA 3G71A 2K5LA 4YRFA 4P71C 3Q1JA 1TU0B 2L3PA 4ELZC 4CS4A 1ACMB 1NEGA 4QQ6A 3JCMb 2VWFA 2ZZDA 1EIYA 2Y4YA 2O01E 5KE3A 1JJ2A 1EVKA 4H2VA 3OBYA 1KC8C 5AT1B 2LP5A 1OULA 2A0FB 4A4FA 3CCMT 2HD0A 2MOXA 4OB2B 4ZGEB 1EFNA 2XU8A 4M7DF 1AZGB 3PVQA 1ZHIA 2B8AA 2E65A 2P0LA 2VGNA 4OB0B 4LD9K 4JLIA 4EMKB 2RI2A 1YJ9T 4IURA 1H641 4BWAA 2GQVA 2KK4A 3ZEHA 5GAN2 5I22A 1E24A 3A5ZB 4KUIA 2QDYB 1ZA1B 3OYHA 3TCJA 2FZGB 3VS4A 2YRCA 2LCLA 1U3OA 2AZSA 1KHCA 4PL6A 4E7IA 4EMGA 1B07A 3TUPA 2KRNA 1BBUA 1PSEA 2M1HA 4RG8A 4YRSA 1QVGS 1VQ9T 1XOVA 4D8DA 2HL3A 4PJOC 2L3SA 3E1SA 5GAOq 2QA4A 1WLPB 1IRXA 1MV0B 1VQPA 1GXIE 4RKUE 1DJ7B 4KGXB 1AWOA 1M1FA 2O9SA 4EDUA 4RUGA 4Y91A 3QO3A 4AFUC 3GNFB 3PVLA 4F16A 1Y7XA 3IKMB 1S72Q 1YITT 2KT8A 1W2BP 3DB3A 3HFNA 3H8ZA 1RAAB 2QTXA 2EKHA 1WPYA 2K5FA 4YRPA 4XK8E 2DVEA 1M90C 2RK2A 2DU7A 1SSFA 2RHXA 5CQYA 2JTEA 4RTZA 3CCLT 2RI3A 2FYKA 3GNGA 2K5IA 2RQRA 3LH0A 4RTXA 2CZ7B 2DBKA 4B6MA 2BZXA 4LE9A 4NOYA 3OS1A 1M1KC 1QKXA 4C0GA 1OI1A 4YRLA 4FIBA 2CH4A 4M7DE 2ZNJA 1GL5A 2E6NA 4MZMA 3I56A 1KG1A 2GFAA 3PZCA 3PIPA 1SRLA 2DILA 1KIKA 2E12A 2HNIA 1SKUB 2CGHA 4JUVA 3OMGA 4LUEA 4XTZA 4PJOF 3OW2P 1VYVA 4BUGA 4OP0A 3CCST 3HRIA 2X51A 1B7YB 2JUFA 3OYIA 1NPPA 4H2UA 1TWBA 1U1SA 1M3AA 4OVAA 3S3MA 2Z0WA 5GMKi 3V8KA 4BD3A 2FRYA 2E3CA 2E3IA 3G6EA 5GAMg 4YRRA 5C53B 5GANg 3ULRB 3CC2T 2EJGA 4Q6GA 1VQNQ 1KQ2A 2C8MA 4HWTA 2LNVA 1V29B 4ANJA 4YROA 5DM7R 1USYC 2YUOA 5KYYB 4AFQC 1NLPC 2HQXA 4TWAA 3P8DA 3UH0A 5D7UA 1AEYA 3OS0A 3I55Q 3MPUB 1ATIA 2J7IA 2DZ9A 1R8OB 5CO7A 3CCMA 3CBPA 4JJDA 2EBPA 2YUPA 2NWMA 3CC7T 1HD3A 2CJ9A 3S6WA 3CCVQ 2DVJA 2CSIA 1NEBA 3S3OA 3PGGA 2XHCA 1VQ7Q 3L4GB 2I2LA 2E1HA 1KMMA 1YJ9A 4N4GA 2KRMA 2DEUA 3P8YA 3M0TA 4J7FA 1K73R 4AG2C 4P73A 4YRIA 4LN2A 1QKWA 1E6GA 4MDWA 1ZBJA 4M7DB 1IGUA 4F04B 5CKDA 1PYSA 2QAZA 2ZGWA 1NNHA 4M78G 3CCET 2AKWB 3HL8A 4K87A 2E6ZA 5HKCA 5IN1A 1VQ9A 2R5MA 2ALYA 3JCMQ 2R57A 3OY9A 1SG5A 3TU4K 1NJ2A 1W1FA 3A31A 1Y07A 3L2VA 5I11A 1X2GA 2QEXQ 4HCKA 3L2WA 5CKHA 4DQ2A 3MEVA 1H3ZA 2PNIA 2ZAEA 3SEMA 3CBMA 1RACB 1I8FA 3HKSA 1N8RU 1T0JA 2KBTA 3OYMA 4QW2A 3H6ZA 1YITA 3OYEA 2P0PA 2DZCA 2JVVA 4XAXB 1EFWA 1SSHA 2PVOB 2RJEA 3RNJA 5C6SA 3M9QA 1H8KA 1PKTA 1D0YA 2O31A 2DTHA 3E9IA 1CSKA 3RKXA 1NJ8A 1YCSB 5F5WA 3VRZA 1RAIB 3IALA 3UA6A 1KQSP 3KFUA 1Q81C 3CCLA 1VQZA 2AZVA 2VB6A 3LSSA 1AWJA 2WSEE 3FJPA 4MMLA 1SERA 3I35A 2R5AA 5GMKj 2FZCB 1NZ9A 3VV0A 4Q5WA 2YLCA 5LJ3g 4F7UE 5CR2A 5CIUA 4ATOA 4HA8A 2ZPEB 3V7CA 1VQKQ 2JTFA 5GMKe 1M8MA 2O9VA 3UA7A 1D3BB 2A28A 1VA7A 1ZSZB 2SEMA 1X56A 4M7DG 3VS3A 1M30A 3JCMh 4KT0E 1EOVA 5FW9A 1UUEA 3GF5A 1BI2A 2FVUA 2P84A 3CCSA 3NTKA 5FWCA 1QCFA 1QLYA 1RAHB 3EGDA 1Q82U 5FU7C 4HT9A 2DE0X 4X9CA 3M0QA 1WHHA 2FO0A 1WHKA 1MMAA 4TVYA 3RUXA 2K2MA 4ZIBA 1OX8A 3ICAA 3SFMA 4ZTUB 3RESA 4LNPA 3HXUA 2NLUA 4AH6A 2EAYA 4RDXA 4P73C 1NE8A 3DKMA 1M3CA 4C92E 3CC2A 2EKOA 5GANj 4HT4A 1K8AR 2M0OA 4OGEA 5GAMd 4G85A 4LNSA 5GANd 2A8EA 4XTWA 1K0SA 1OOTA 4J15A 1LJOA 2OTLT 2QHVA 4ZGDB 4DOVA 1BI3A 4Z88A 5IHNA 5GAMe 2OI3A 2OTJT 5GAOp 4NL3A 5GANe 4GLMA 2JM8A 3LWIA 3L2UA 4XEMA 3M0SA 2ED1A 1VYTA 3H9NA 3JCMP 1YCYA 1QWEA 2ARSA 3RMQA 2XK0A 2GBQA 1RLPC 3CC7A 1KD1R 3VJPA 4M77D 5GMKm 3PCOB 3QWXX 2ODRD 1G83A 2C06A 3OYNA 1YP5A 4KR2A 3BFMA 1WXTA 2K2VA 2DL7A 1S1NA 3SWNA 3A8HB 5A2QE 2AMCB 4PG3A 4F7UB 4BACA 1QVFP 1R77A 4CH3A 1MV3A 4E47A 3L2RA 1VQMT 1C0MA 3CCEA 5J3BA 4YRNA 2E3HA 5A0GA 3QUIA 4M77A 4R55A 4GY5A 2VYTA 2ESWA 2KDSA 1GRIA 2YWWA 1PRMC 2JZ2A 1YJNT 2E5AA 4YDQA 3ER0A 2LQ8A 4PJOG 5KYNA 2XD0A 5I2SA 1PD0A 2RQWA 4IIOA 1B34B 4OMOA 2PVDB 1JO8A 1KMNA 2XDPA 2LX7A 2HAXA 2ZPBB 3KFVA 1KJWA 2Q7GA 4A63B 3BJUA 5IH2A 1B8AA 3G71T 3I5RA 4CRIA 1OYXA 1ZSGA 2RHQA 3WXMB 2PMEA 4C92B 2AK5A 1QWFA 1VQ5T 2QXFA 4K11A 2DYBA 5L23A 4HVWA 4Z89A 2RHSA 5IHKA 2EGAA 4PNOA 3OYGA 1M2OA 3R6NA 1X27A 2EJFA 4WF2A 1UEBA 2RMOA 4P74A 1O75A 2DAQA 4WJ4A 1UJYA 4PK4A 4EIKA 1VQ4Q 5LJ3j 5GMKh 2Y90A 1HJDA 3OYFA 4LD6A 2HSEB 2H8HA 1TUCA 2P5IA 4HWPA 1RADB 1WHLA 2HZYA 4RTVA 4QKUA 2Y4XA 3HFZB 3G4ST 1GCPA 5GAOm 1KQ1A 3W3SA 2M0YA 3CPFA 1M2VA 1WHMA 1WQ7A 3REBB 3M4QA 1MUZA 5DLOA 3CC4Q 4JZ3A 4P71A 4M75B 3I7FA 2PVGB 2QQRA 1XNIA 3RR6A 3SDZA 1B7TA 5GAN4 1D1CA 1MNEA 1I0CA 3HXVA 1JJCB 1RLQC 3EFOA 4JS4A 3NEMA 2EFIA 2DFUA 2OJ2A 2ED0A 2ZCFB 3JB9D 1K4US 5CQXA 3BY7A 3EGUA 4HVVA 5DY9A 3L1AA 5KYXA 2DTOA 4XU2A 1TTHB 1KD1U 3IG2A 5GAOn 1G5HA 3E9HA 2V1QA 1QVGP 3SHWA 3MP1A 5AYFA 4M77C 4M4ZA 2OTLA 4ELYC 4MZPA 1JU5C 3P8TA 2OTJA 2ZIOA 4BI8B 3CCQT 5KCOA 2ODRC 2EYXA 4P3NA 3CCJQ 2PTKA 1Y0MA 4H02A 1LOJA 4IIMA 2Q5HA 2RHIA 1FX7A 2GNCA 1QVFS 1VQ8Q 4DPGA 3VS1A 1D0XA 2ENMA 5KNNA 2G6FX 4BI4A 2EYZA 3ZBDA 2BTTA 2X4XA 1UECA 2DTIA 2HEQA 1UG1A 4X9DA 3VRYA 2DQ0A 3JCMg 5DLQE 1BB9A 2MIOA 1RAGB 1QCNA 1IO6A 2KGTA 1GGMA 3N5BB 2DXCA 2LC4A 1Q95G 1VQMA 2EYYA 2BUDA 1YJWT 4XU3A 1UGRB 2M02A 1H4SA 3E9GA 1NJ6A 4EPCA 1BI1A 2JOYA 3QHSA 1G2BA 4BY6B 3RGLA 1YJNA 3CCRT 1IHVA 3FC3A 4J6WA 3HXZA 1WNLA 3HXXA 4OLFA 2ARUA 4M77F 2EYWA 2DXBA 4J83A 3QWYA 3CCUT 3RF1A 2CUBA 1HTTA 1N9SA 1UE9A 5CVIA 1PYSB 5A0DA 2CJBA 4C5EA 3EFSA 4TVWA 4H2SA 1VQ5A 3RIRA 3MHXA 5A0LA 1W2BA 3TEGA 2EQIA 3ASKA 5GAMf 2ALYB 2CP0A 2DL4A 4O6JA 5GANf 3CMET 4LXCA 3CPWP 4BW9A 5GAN8 4CH4A 1I5OB 3H41A 4IUVA 4UP9A 4HCCA 1BBWA 5LJ5g 2DRKA 3H0IA 2I4NA 1G3WA 4QVZA 5GAN3 4LDWA 2C7IA 3HY1A 2CS7A 3OS2A 3VBBA 3INZA 2X3WD 2KT1A 1K73C 2KYBA 5CKFA 4TVAA 2QA4Q 4CC2A 1VQPQ 5LJ3h 1VQ6T 4YRMA 1ARKA 2FEIA 2MYSA 1F1BB 2E4HA 3ME9A 3G4SA 3QO8A 2CT4A 4M78E 1IHWA 5D6WA 3NMZC 5D6YA 5FU6C 2J05A 3QBYA 2WSCE 1YFSA 4RQFA 4GLKA 2E70A 3MEWA 1USYA 3OQ5A 1L0WA 2FPDA 2ZIMA 4H2YA 4H2XA 1QW1A 1KFZA 3OW2A 3TSWA 2DL5A 2PMFA 5KYUB 1GFDA 1UGVA 4WJ3M 3SD4A 1M4ZA 2CT3A 2EL9A 4ORZA 2O88A 4N4IA 1WI7A 5GMKl 1NM7A 3JCMW 2M16A 4RCCA 4KRTA 1UGSB 1OZ3A 2M51A 1KHIA 5HY6A 4J6YA 4PFPA 3V8JA 4XQ3A 3SB2A 4L87A 2ZPHB 2MMPA 3QIIA 1AZEA 5HCKA 5HK0A 3CCQA 1OU8A 3QYHB 4JRQA 3PIOA 4YPFA 2NUPB 3I56Q 4A4HA 1YIJT 1J5WA 2CREA 3CXCS 4M7AD 2HCKA 1N8RR 1WLEA 2J6FA 4R0KA 2K4YA 2YT6A 4QQDA 1PNJA 3M4YA 1ABQA 3JB9F 2G4CA 2ZCEA 2LVMA 3VUBA 5GAOr 3G7ZA 3LGLA 4OF1A 1W4SA 3M59A 5KYWA 2LJ0A 5CAIA 3P8HA 3JCMd 4J9BA 3OA6A 1UFFA 3VQVA 1VQLT 1YJWA 5C51B 2KMTA 4EO4A 2LTOA 3JCMe 3RMSA 2H3EB 4M7AA 3J7AF 1NJIC 2DETA 4JDSA 4M78B 1YFTA 2V1RA 4KQEA 3CCRA 2X35A 3TEEA 2D0NA 3M57A 3TEHA 3MEAA 1AHJB 1CKAA 1NJ1A 4YTLA 3X25B 4UP7A 1OQKA 4HWOA 3F70A 4KUDK 1X2QA 2AHJB 3QZ5B 4XTXA 5FLXE 3RACA 2MAMA 1BYMA 3MF2A 5IAYA 4IUUA 1I4K1 2RPNA 4OMFB 1K8AC 2AIRB 4A54A 2O2OA 2CUDA 4FYXB 3CPWS 3SWNB 3CCUA 1YI2T 2EQKA 3UT1A 2MWOA 2E5KA 2XG8D 3KUFA 1WIEA 4CS3A 1UGPB 2RM4A 1Q82R 1VQOT 1FMVA 1OEBA 3VYHB 4JJNK 3FLGA 3TREA 4C8QD 3VS6A 1WYXA 4ZTFA 3CMAT 1B70A 3EH1A 1U06A 3CMEA 5IT9E 5C0MA 3D7SB 3OYAA 1M8VA 3EHRA 4K88A 2E41A 3O8VA 1KQSA 1FMKA 4K86A 1X6GA 4X34A 5LJ5j 3J80E 2YHTA 1WU7A 1ASYA 3E9FA 1ADJA 3PMTA 1Q86C 3QKJA 1VQ9Q 1NYGA 2QQ9A 1LPLA 2GCXA 1GBQA 4BI3A 2VUBA 3CEYA 5LJ5e 1VQ6A 1N5ZA 1YHQT 4P3PA 3RBBB 5GJWB 4C8QA 1KC8R 4LVLA 1NG2A 3MP6A 1Z9QA 1TH7A 2IVWA 4FSSA 2RA2A 3HFOA 5E3IA 4E7JA 3EHQA 2X4WA 1D09B 4PJOE 1C1AA 3X20B 1B76A 3M0PA 4HVUA 3A1PA 2K7AA 5GAN5 2L0AA 4GBQA 5IXFA 4YREA 1E22A 2P4TA 5KH6A 2DO3A 1KOGA 1K9MU 3KBGA 1ZUKA 1Q7YU 4C0DC 3H0FA 3CCLQ 2ZT8A 1M3BA 3X26B 3JV3A 2MF2A 2K6DA 2LMJA 3U23A 4HXJA 1JJ2S 4RCBA 1UGQB 4ME7A 4M7AC 1K0XA 1M2VB 1YN8A 1WYDA 4M77G 2KXCA 2C0IA 2DYIA 3HFVA 1E1OA 1SRYA 3LW5E 2FG0A 3NFCA 1YIJA 1HC7A 1QCOA 2GGRA 3EFOB 4DA4A 1LNXA 1LCKA 2WSFE 2LNHB 2V8JA 4EMKA 1YFNA 4E7ZA 1HXDA 4RMFA 3CCSQ 4Z8AA 4TQDA 1YWOA 1BIAA 3P8VA 4A4GA 3EG9B 4PKCC 2BIVA 1GCQC 2VXEA 1M90R 2SRCA 4CH5A 2RQVA 4A4KA 1WQWA 3HP9A 4KGVB 4JS5A 4RTWA 1VQLA 4MDXA 1K76A 2B86A 2XICA 2O4XB 1EZZB 3CC2Q 5I2MA 1B3QA 1X2KA 4OMLA 1QVFA 2COWA 2EPDA 3VKIA 2RHYA 2X4YA 2CDTA 2VKNA 4Q15A 2EVRA 4HCZA 4LDYA 2K79A 1YFRA 2GQIA 4JLGA 3THKA 2A08A 3GPLA 2DX1A 4PJOB 4M7AF 3EGXA 1H4VB 3JB9H 4BDYA 4C8QC 1E6HA 2P0QA 1C6VX 1T0HA 2KR3A 1YI2A 4E7HA 3A8MB 1PHTA 3LGFA 2OX7A 4NL2A 4Y92A 1VQOA 2K3XA 1J3TA 1MMGA 1X54A 3O5ZA 1KC8U 1WDXA 4V2SA 3CMAA 2ZZFA 3OD1A 2F1LA 2J6KA 1FMWA 4XU1A 4C5IA 4H2TA 4FCYA 1SRMA 3QDRB 3MP8A 2IY5B 2XI9A 3CCEQ 2XGTA 2RH2A 3P8BB 5KE2A 4E7KA 1ASZA 2HQHA 5LJ5h 1OZ2A 2LRQA 2ARTA 3NETA 2I4MA 3EG3A 4LVKA 2CZ1B 4X5OA 1B7YA 2KY9A 1AWXA 1YHQA 2OAWA 3NTHA 4C5GA 2M9UA 2ZR3A 1EIYB 2QTVA 4XU0A 1D0ZA 1OV3A 2R58A 3JB9G 2Q7HA 1RAFB 1NBEB 4EMKC 2DU5A 4C8QF 1XQHA 3JCMf 3FDRA 2FRWA 3R07A 3RDVA 1ADYA 4CC4B 4QT7A 4YCUA 4DEYA 2COYA 2RNAA 4JJCA 4DBRA 2KYMA 3IQLA 3HTZA 3L2QA 1WX6A 4M7AE 3CD6T 1TXQA 4D6WA 2W10A 4AMCA 1SHFA 3RKWA 4M7DD 1QP3A 1M90U 1VUBA 3QNEA 2X3XD 3META 3OYCA 11ASA 4H2XB 2DKGA 1QVGA 2ECZA 3C94A 3QO5A 4PJMA 2JTMA 3QZ9B 4HWRA 5CK9A 4PLIA 1R0CB 5CKEA 3WVDB 3L4GA 3HRUA 1HSQA 3HRTA 4UPAA 1GFCA 1M1KU 3VQXA 3JAME 2L8DA 1BIBA 2FB7A 1JXMA 1W6XA 4KGZB 4OMMA 2J3MA 1PKSA 1T3SA 2F2VA 3CMQA 5LJ3d 1RL2A 2AKWA 1O9SA 1XJWB 2YLBA 1ZBXA 1SHGA 3G1JA 1M1GA 1PWTA 2HKNA 5LJ3e 2DL3A 3JSCA 4OGCA 5LJ5f 2NUTA 2DJZA 1PSFA 3UATA 1X75C 1NJIU 3AT1B 3M58A 4AT1B 2DEQA 4KULA 1BK2A 3OSVA 4II1A 4CC7A 3QJYA 1WJRA 2OTLQ 1ZA2B 2NS6A 2OTJQ 4MMKA 4J9IA 1WZOA 2K3BA 3A98A 3EFRA 5FWBA 3C4SA 3MF1A 4QVCA 4KH1B 4F17A 3OYLA 3OYJA 3GOXA 5KYWB 4O5VA 2DF6A 2F2WA 1M5Q1 2RK1A 2ZZEA 2VC8A 3ZL7C 2GTJA 2HKQB 3E19A 3I9QA 3REXA 1IREB 4B9XA 2MK5A 2QI2A 2HL5C 2PZ1A 4FW2A 4N0AC 3QXEB 4E51A 3VS0A 2LT4A 2ABLA
chains in the Genus database with same CATH topology
2JNGA 2EQUA 4FT2A 2P0KA 1NPRA 2EQMA 2KSSA 4L59A 1QE0A 5CKBA 3CPWA 1Q86U 1G51A 4ZTZB 3OYYA 2LQKA 4QQGA 4YRTA 2RB6A 3JCMc 3PFSA 2MI6A 2L89A 4JRKA 4J5YA 1S72T 5HGQA 2A3LA 5I21A 2J3LA 5FRMA 2ZT5A 2DD4A 5GAN7 1N9RA 4CI0C 3DLMA 2K57A 4YCVA 3NENA 1BI0A 4M7DC 5FU7B 2KAFA 3OS5A 3OYKA 2DIGA 3UDCA 2F5KA 3QG1A 1NYRA 4XTYA 2HQEA 3R6OA 3CD6A 3OSSC 2Q7EA 1Q82C 3UPUA 3LWHA 3BW1A 4M7AG 5CCAA 1N27A 3V7SA 3VQYA 3MQZA 1X55A 1SESA 1Q81U 2XDBA 4YYEA 3RL6A 4DOWA 3NELA 2FHDA 2PQWA 4ZGJB 4FT4A 3DLLA 4IUQA 4P72C 3M56A 4Z02A 4BE2A 2AMCA 4F7UA 3JB9I 2E64A 1G3TA 2LDMA 2ZPFB 1RIQA 3HRKA 2XKOC 2RHUA 4YRGA 1VQNT 5K1PA 2D6FA 3M5AA 4C92D 4PHCA 1LYLA 3M4GA 3PT9A 4LVIA 1Y96A 2XDDA 4LDVA 1B34A 4OB1B 1G3SA 3I55T 3GIBA 2DK3A 4JRIA 1E1TA 3ZFJA 2DXUA 3BDLA 2EQJA 3PTAA 2DQ3A 4HWSA 1QP2A 1W66A 4C92A 4C8QG 3CCVT 3LC0A 2BKDN 4M77E 1VQ7T 2QHTA 3KXTA 5J26A 3HXWA 3T9NA 3JB9J 3A7RA 4M75D 2VXFA 4YRKA 2LT1A 2DXTA 3A8LB 3HPWA 1G3YA 4NCXA 1IZ6A 3FEOA 4ZN1A 3HFZA 3L42A 4PLLA 3A74A 2QEXT 3M54A 2KQWA 4M75A 2XTIA 1S72A 2ZTGA 4A53A 1EVLA 1JJCA 3MEYA 1YBYA 5LJ3f 4L6V5 3MCAB 2QHUA 1YB3A 2ZINA 1ZQ1A 2DD5A 2RJCA 4EX5A 1VIEA 4LDUA 3UGQA 3M53A 2D9TA 4BE1A 2LCCA 2RHZA 2IG0A 1IL2A 1FXXA 2HBPA 4QVDA 1Y71A 4BB7A 1VQKT 5EG2A 5M9OA 1NJ5A 5GAOl 4M77B 4XTVA 4P75A 3CBOA 2WACA 3A8OB 4RMOA 2CYZB 2QQSA 1Z7MA 1KD1C 4BE0A 4C92C 4YP0A 1H4QA 3AHUA 5LJ5d 3MEUA 3A32A 2RHQB 2CJAA 4VUBA 1VQNA 4ZTJA 4F7UF 3C12A 2RHSB 4BDZA 3LLRA 4E7LA 1FWZA 2PU9B 2PUKB 3I55A 5K1XA 4Y28E 4HVCA 1RI0A 2V8KA 3FRNA 2V8IA 4M75C 3DB4A 12ASA 3CCVA 2ZR2A 1P92A 1Z7NA 1VQ7A 1W2BS 4C0FA 1MGQA 3LX7A 3FIFA 3WQZA 4C92F 2JN0A 3PMIA 2CZ6B 4RG2A 4NS5A 2DPPB 4R56A 2MWPA 3VYGA 1N9WA 4LDXA 2ZT7A 3OB9A 5LL6S 2F69A 2EYQA 2I4LA 1I81A 4LVJA 3VQWA 2Q5IA 3A5ZA 1XTDA 2LX9A 2G3RA 1UB4A 2QEXA 3A7AA 1EIFA 2I4OA 4P75C 4RQEA 2RJFA 3OW2S 3L2ZA 2FL7A 5L8RE 5D6XA 4XEOA 3OYDA 1QVPA 4J6XA 5FU6B 4M75F 4HT8A 3HHTB 4HCBA 2VGMA 2DIQA 2H3JA 2EWNA 4L5GA 1SETA 2RJDA 3JRZA 4JRPA 3PNWC 4BY6C 1N6AA 3V8LA 4C5HA 1VQ4T 4TTVA 1G5IA 4HKEA 1VQKA 4H2WA 4UP8A 5KCHA 2ZT6A 1WJSA 2PUOB 3HSBA 1JRIA 2YRVA 4J8OA 4M78D 2L3RA 1U8RA 5GAMj 3M55A 3CC4T 1VIFA 3UGTA 3JCMV 5FROA 2QHSA 3QPHA 3V7RA 2GFUA 3QO7A 3MO8A 4WI1A 1K73U 3RERA 1FYFA 2E10A 2L5QA 4M78A 3X28B 2QQBA 4KBMB 5ELNA 3ERRA 4YCWA 4MZTA 4FU6A 3LSQA 1JB0E 4XTUA 3CCJT 4N0AA 3URGA 3C95A 3A7UA 4FSXA 1VQ8T 4P5NA 2CIMA 4M75E 2RO0A 1BKBA 4O2DA 4TVAB 3OMCA 2RI5A 3GP8A 4EMHA 5J39A 3UFGA 1HK9A 3VU3C 4YRQA 4YRJA 1QF6A 1Y96B 1KQSS 2VV5A 2K3YA 1WJQA 1MHNA 4IKFA 3G1ZA 4KR3A 1WGSA 3BDUA 3JCMJ 2CZ0B 4CH6A 5HK3A 4G84A 4M7DA 1C0AA 2X4JA 4J7IA 2EIFA 1X01A 3NTIA 4IUPA 2QQAA 3HXYA 2RD1A 3S3NA 4LVMA 3OYBA 4YRCA 3REUA 4TVRA 4CS2A 4F7UG 3CXCA 5GAN6 2ZPGB 4C8QE 2ZXFA 1U1TA 1K8AU 4M78C 4FL6A 3QSUA 4C0ZA 4P72A 4C0DB 1VQ4A 4N4HA 3WVEB 1H4TA 2QA4T 1VQPT 2ZZGA 4M7AB 3SWNC 1K9MC 4TQFA 3TEHB 1X6OA 1Q7YC 5ELOA 3CC4A 1N8RC 1I5LA 3J81E 2ZNIA 4C92G 3FB9A 5GAMh 4PJOD 3EAEA 3JCMX 1D3BA 5GANh 1X2HA 4P3OA 2DDZA 2A7YA 3DSQA 4FM4B 1JBMA 2O4XA 2XIDA 3RKYA 2ZPIB 3M4PA 1B70B 3QJ6A 2EJ9A 4PJOA 5C52B 3HRSA 4IUTA 4M78F 3CCJA 4B9WA 4ZN3A 3IKLA 2F5TX 3LYIA 3I56T 3A5YA 1VQ8A 3VUZA 2OAUA 3QTCA 3A8GB 2E5QA 4UC4A 3OBWA 4M75G 4OB3B 4P74C 1M9SA 4C8QB 3GLXA 1EQRA 2GF7A 1G5VA 2CKKA 3UWNA 2KVQG 3HY0A 1YGBA 5FRNA 4A4EA 3X24B 3QYGB 2IY5A 3G6ET 3PCOA 2D0QB 1NYQA 3G71A 2K5LA 4YRFA 4P71C 3Q1JA 4ELZC 4CS4A 4QQ6A 3JCMb 2ZZDA 1EIYA 2Y4YA 2O01E 5KE3A 1JJ2A 1EVKA 4H2VA 3OBYA 1KC8C 4A4FA 3CCMT 2HD0A 4ZGEB 4OB2B 2XU8A 4M7DF 1ZHIA 2B8AA 2E65A 2P0LA 2VGNA 4OB0B 4LD9K 4JLIA 4EMKB 2RI2A 1YJ9T 4IURA 1H641 4BWAA 2GQVA 2KK4A 3ZEHA 5GAN2 1E24A 3A5ZB 4KUIA 2QDYB 3OYHA 3TCJA 2LCLA 1KHCA 4PL6A 4E7IA 4EMGA 3TUPA 1BBUA 1PSEA 2M1HA 4RG8A 4YRSA 1QVGS 1VQ9T 1XOVA 4PJOC 5GAOq 3E1SA 2QA4A 1VQPA 1GXIE 4RKUE 1DJ7B 1M1FA 4EDUA 4Y91A 3QO3A 3GNFB 1Y7XA 3IKMB 1YITT 3DB3A 3HFNA 3H8ZA 2QTXA 1WPYA 2K5FA 4YRPA 4XK8E 2DVEA 1M90C 2RK2A 2DU7A 1SSFA 2RHXA 5CQYA 3CCLT 2RI3A 2FYKA 3GNGA 2K5IA 3LH0A 2CZ7B 4NOYA 3OS1A 1M1KC 4C0GA 1OI1A 4YRLA 4FIBA 4M7DE 2ZNJA 2E6NA 4MZMA 3I56A 1KG1A 2GFAA 3PZCA 3PIPA 2E12A 2HNIA 2CGHA 4JUVA 3OMGA 4XTZA 4PJOF 4BUGA 4OP0A 3CCST 3HRIA 1B7YB 2JUFA 3OYIA 1NPPA 4H2UA 1U1SA 4OVAA 3S3MA 5GMKi 3V8KA 4BD3A 2E3CA 3G6EA 5GAMg 4YRRA 5C53B 5GANg 3CC2T 2EJGA 4Q6GA 1KQ2A 2C8MA 4HWTA 2LNVA 1V29B 4YROA 5DM7R 1USYC 2HQXA 4TWAA 3P8DA 3UH0A 3OS0A 1ATIA 2DZ9A 1R8OB 5CO7A 3CCMA 3CBPA 3CC7T 2CJ9A 3S6WA 3S3OA 3PGGA 2XHCA 3L4GB 2I2LA 2E1HA 1KMMA 1YJ9A 4N4GA 3P8YA 4J7FA 4P73A 4YRIA 4MDWA 4M7DB 5CKDA 1PYSA 2ZGWA 1NNHA 4M78G 3CCET 2AKWB 3HL8A 4K87A 2E6ZA 5HKCA 5IN1A 1VQ9A 2R5MA 2ALYA 3JCMQ 2R57A 3OY9A 3TU4K 1NJ2A 3A31A 1Y07A 3L2VA 1X2GA 3L2WA 5CKHA 4DQ2A 3MEVA 1H3ZA 3CBMA 1I8FA 3HKSA 1N8RU 3OYMA 4QW2A 3H6ZA 1YITA 3OYEA 2P0PA 2DZCA 2JVVA 4XAXB 1EFWA 2PVOB 2RJEA 5C6SA 3M9QA 2DTHA 3E9IA 3RKXA 1NJ8A 5F5WA 3IALA 3KFUA 1Q81C 3CCLA 1VQZA 3LSSA 3FJPA 2WSEE 4MMLA 1SERA 2R5AA 5GMKj 1NZ9A 3VV0A 4Q5WA 2YLCA 5LJ3g 4F7UE 5CR2A 5CIUA 4ATOA 4HA8A 2ZPEB 3V7CA 2JTFA 5GMKe 1D3BB 1X56A 4M7DG 3JCMh 4KT0E 1EOVA 3GF5A 1BI2A 2FVUA 3CCSA 3NTKA 1Q82U 5FU7C 4HT9A 4X9CA 4TVYA 3RUXA 4ZIBA 3ICAA 3SFMA 4ZTUB 3RESA 3HXUA 2NLUA 4AH6A 2EAYA 4RDXA 4P73C 1NE8A 3DKMA 4C92E 3CC2A 2EKOA 5GANj 4HT4A 2M0OA 4OGEA 5GAMd 4G85A 4LNSA 5GANd 2A8EA 4XTWA 4J15A 1LJOA 2OTLT 2QHVA 4ZGDB 4DOVA 1BI3A 5GAMe 2OTJT 5GAOp 4NL3A 5GANe 3LWIA 3L2UA 4XEMA 3JCMP 1YCYA 2ARSA 3RMQA 2XK0A 3CC7A 3VJPA 4M77D 5GMKm 3PCOB 2ODRD 2C06A 3OYNA 4KR2A 3BFMA 2K2VA 3SWNA 3A8HB 2AMCB 5A2QE 4PG3A 4F7UB 4BACA 4CH3A 4E47A 3L2RA 1VQMT 3CCEA 5J3BA 4YRNA 5A0GA 3QUIA 4M77A 4R55A 4GY5A 2VYTA 2KDSA 1YJNT 2E5AA 2JZ2A 4YDQA 3ER0A 2LQ8A 4PJOG 2XD0A 5I2SA 1B34B 2PVDB 1KMNA 2XDPA 2HAXA 2ZPBB 2Q7GA 3BJUA 1B8AA 3G71T 4CRIA 1OYXA 2RHQA 3WXMB 2PMEA 4C92B 1VQ5T 2QXFA 2RHSA 4PNOA 3OYGA 2EJFA 4WF2A 1UEBA 4P74A 1O75A 2DAQA 4WJ4A 5LJ3j 5GMKh 2Y90A 3OYFA 4LD6A 2P5IA 4HWPA 2Y4XA 3HFZB 3G4ST 5GAOm 1KQ1A 3W3SA 3CPFA 1WQ7A 3M4QA 5DLOA 4P71A 4M75B 3I7FA 2PVGB 2QQRA 1XNIA 3SDZA 5GAN4 3HXVA 1JJCB 4JS4A 3NEMA 2EFIA 2ZCFB 3JB9D 5CQXA 3BY7A 5DY9A 3L1AA 2DTOA 4XU2A 1KD1U 3IG2A 5GAOn 1G5HA 3E9HA 3MP1A 5AYFA 4M77C 2OTLA 4ELYC 4MZPA 3P8TA 2OTJA 2ZIOA 4BI8B 3CCQT 5KCOA 2ODRC 4P3NA 4H02A 1LOJA 2Q5HA 2RHIA 1FX7A 1QVFS 4DPGA 5KNNA 4BI4A 3ZBDA 2X4XA 2DTIA 4X9DA 2DQ0A 3JCMg 5DLQE 1GGMA 3N5BB 2DXCA 2LC4A 1VQMA 2BUDA 1YJWT 4XU3A 1UGRB 1H4SA 3E9GA 1NJ6A 4EPCA 1BI1A 2JOYA 3QHSA 4BY6B 3RGLA 1YJNA 3CCRT 3FC3A 4J6WA 3HXZA 1WNLA 3HXXA 4OLFA 2ARUA 4M77F 2DXBA 4J83A 3CCUT 3RF1A 1HTTA 1N9SA 5CVIA 1PYSB 5A0DA 2CJBA 4C5EA 3EFSA 4TVWA 4H2SA 1VQ5A 3RIRA 3MHXA 5A0LA 1W2BA 3TEGA 3ASKA 5GAMf 2ALYB 4O6JA 5GANf 3CMET 4BW9A 4CH4A 5GAN8 4IUVA 4UP9A 4HCCA 1BBWA 5LJ5g 2I4NA 1G3WA 4QVZA 5GAN3 4LDWA 2C7IA 3HY1A 2CS7A 3OS2A 3VBBA 3INZA 1K73C 5CKFA 4TVAA 5LJ3h 1VQ6T 4YRMA 3G4SA 3ME9A 3QO8A 4M78E 5D6WA 5D6YA 5FU6C 3QBYA 2WSCE 1YFSA 4RQFA 4GLKA 2E70A 3MEWA 1USYA 3OQ5A 1L0WA 2ZIMA 4H2YA 4H2XA 1QW1A 3OW2A 2PMFA 4WJ3M 3SD4A 1M4ZA 2EL9A 4N4IA 5GMKl 3JCMW 2M16A 4RCCA 1UGSB 1OZ3A 1KHIA 5HY6A 4J6YA 3V8JA 4XQ3A 3SB2A 4L87A 2ZPHB 2MMPA 3QIIA 5HK0A 3CCQA 3QYHB 4JRQA 3PIOA 4YPFA 4A4HA 1YIJT 1J5WA 3CXCS 4M7AD 1WLEA 2K4YA 4QQDA 3M4YA 2ZCEA 3JB9F 2G4CA 2LVMA 3VUBA 5GAOr 3G7ZA 3LGLA 4OF1A 1W4SA 3M59A 5CAIA 3P8HA 3JCMd 3OA6A 3VQVA 1VQLT 1YJWA 5C51B 2KMTA 4EO4A 2LTOA 3JCMe 3RMSA 4M7AA 3J7AF 1NJIC 4JDSA 4M78B 1YFTA 4KQEA 3CCRA 2X35A 3TEEA 3TEHA 3M57A 3MEAA 1AHJB 1NJ1A 4YTLA 3X25B 4UP7A 4HWOA 3F70A 4KUDK 2AHJB 3QZ5B 4XTXA 5FLXE 3RACA 2MAMA 1BYMA 3MF2A 5IAYA 4IUUA 1I4K1 4OMFB 1K8AC 4A54A 3CPWS 3SWNB 3CCUA 1YI2T 2EQKA 3UT1A 2MWOA 2XG8D 3KUFA 4CS3A 1UGPB 2RM4A 1VQOT 3VYHB 4JJNK 3FLGA 3TREA 4C8QD 4ZTFA 3CMAT 1B70A 3CMEA 5IT9E 5C0MA 3OYAA 1M8VA 4K88A 2E41A 3O8VA 1KQSA 4K86A 4X34A 5LJ5j 3J80E 2YHTA 1WU7A 1ASYA 3E9FA 1ADJA 3PMTA 1Q86C 3QKJA 2QQ9A 2GCXA 4BI3A 2VUBA 3CEYA 5LJ5e 1VQ6A 1YHQT 4P3PA 4C8QA 4LVLA 3MP6A 1TH7A 2IVWA 2RA2A 3HFOA 5E3IA 4E7JA 2X4WA 4PJOE 3X20B 1B76A 5GAN5 4YREA 1E22A 2P4TA 5KH6A 2DO3A 1KOGA 1K9MU 3KBGA 1Q7YU 4C0DC 2ZT8A 3X26B 2MF2A 1JJ2S 4RCBA 1UGQB 4ME7A 4M7AC 1WYDA 4M77G 3HFVA 1E1OA 1SRYA 3LW5E 3NFCA 1YIJA 1HC7A 4DA4A 1LNXA 2WSFE 2V8JA 4EMKA 1HXDA 4RMFA 4TQDA 1BIAA 3P8VA 4A4GA 4PKCC 2BIVA 2VXEA 4CH5A 4A4KA 1WQWA 3HP9A 4JS5A 1VQLA 4MDXA 2XICA 2O4XB 5I2MA 1QVFA 3VKIA 2RHYA 2X4YA 4Q15A 4HCZA 4LDYA 1YFRA 4JLGA 3GPLA 4PJOB 4M7AF 1H4VB 3JB9H 4BDYA 4C8QC 2P0QA 1YI2A 4E7HA 3A8MB 3LGFA 4NL2A 1VQOA 2K3XA 1X54A 1KC8U 4V2SA 3CMAA 2ZZFA 3OD1A 4XU1A 4C5IA 4H2TA 3QDRB 3MP8A 2IY5B 2XI9A 2XGTA 2RH2A 3P8BB 5KE2A 4E7KA 1ASZA 5LJ5h 1OZ2A 2LRQA 2ARTA 3NETA 2I4MA 4LVKA 2CZ1B 4X5OA 1B7YA 2KY9A 1YHQA 3NTHA 4C5GA 2M9UA 2ZR3A 1EIYB 4XU0A 2R58A 2Q7HA 3JB9G 4EMKC 2DU5A 4C8QF 1XQHA 3JCMf 3FDRA 3R07A 1ADYA 4YCUA 3HTZA 3L2QA 4M7AE 3CD6T 4D6WA 3RKWA 4M7DD 1QP3A 1M90U 1VUBA 3QNEA 3META 3OYCA 11ASA 4H2XB 2DKGA 1QVGA 3C94A 3QO5A 2JTMA 3QZ9B 4HWRA 5CK9A 4PLIA 5CKEA 3WVDB 3L4GA 3HRUA 3HRTA 4UPAA 1M1KU 3VQXA 3JAME 2L8DA 1BIBA 2FB7A 2J3MA 3CMQA 5LJ3d 1RL2A 2AKWA 1O9SA 2YLBA 1ZBXA 1M1GA 5LJ3e 3JSCA 4OGCA 5LJ5f 2DJZA 1PSFA 1X75C 1NJIU 3M58A 2DEQA 4KULA 3OSVA 4II1A 3QJYA 1WJRA 2NS6A 4MMKA 3EFRA 3C4SA 3MF1A 4QVCA 3OYLA 3OYJA 3GOXA 4O5VA 1M5Q1 2RK1A 2ZZEA 2VC8A 3E19A 3REXA 1IREB 4B9XA 2QI2A 4N0AC 3QXEB 4E51A 2LT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E10 A;  4P73 A;  4YRI A;  4M78 A;  5GMK l;  4M7D B;  1PYS A;  2ZGW A;  3JCM W;  4RCC A;  4M78 G;  1NNH A;  2AKW B;  5ELN A;  4K87 A;  3ERR A;  4YCW A;  4J6Y A;  3V8J A;  4XQ3 A;  3SB2 A;  1QE0 A;  3LSQ A;  1G51 A;  4ZTZ B;  4L87 A;  4XTU A;  2ALY A;  3JCM Q;  4YRT A;  4N0A A;  1NJ2 A;  3A31 A;  3A7U A;  2RB6 A;  1X2G A;  4YPF A;  3JCM c;  2CIM A;  4M75 E;  4DQ2 A;  5HGQ A;  4JRK A;  4J5Y A;  5I21 A;  1J5W A;  2J3L A;  4O2D A;  4TVA B;  1I8F A;  4M7A D;  1WLE A;  2DZC A;  2ZT5 A;  4EMH A;  5GAN 7;  3UFG A;  1EFW A;  1HK9 A;  1N9R A;  2K57 A;  2ZCE A;  3JB9 F;  2G4C A;  4YCV A;  3NEN A;  5GAO r;  2DTH A;  3VU3 C;  3E9I A;  3RKX A;  1NJ8 A;  4YRQ A;  4YRJ A;  1QF6 A;  5F5W A;  1Y96 B;  4M7D C;  3IAL A;  3KFU A;  1VQZ A;  3LSS A;  5CAI A;  3JCM d;  3FJP A;  3VQV A;  3G1Z A;  4MML A;  4EO4 A;  1NYR A;  5C51 B;  4KR3 A;  1SER A;  3JCM e;  3BDU A;  4XTY A;  3JCM J;  5GMK j;  4CH6 A;  2YLC A;  4M7A A;  2Q7E A;  4G84 A;  4M78 B;  5LJ3 g;  1YFT A;  4F7U E;  4KQE A;  3TEH A;  4HA8 A;  3BW1 A;  4M7A G;  3V7C A;  1NJ1 A;  3V7S A;  3VQY A;  4M7D A;  5GMK e;  4UP7 A;  1C0A A;  4HWO A;  1X55 A;  1D3B B;  1X01 A;  4XTX A;  1SES A;  3RAC A;  4YYE A;  1X56 A;  4M7D G;  3MF2 A;  3HXY A;  3RL6 A;  3JCM h;  1I4K 1;  1EOV A;  3NEL A;  4A54 A;  2RD1 A;  3SWN B;  4YRC A;  3REU A;  4P72 C;  4CS3 A;  2AMC A;  4F7U A;  3JB9 I;  4CS2 A;  4HT9 A;  4X9C A;  2RM4 A;  2E64 A;  4F7U G;  5GAN 6;  4TVY A;  3RUX A;  4ZIB A;  3ICA A;  4ZTU B;  4C8Q D;  3RES A;  1RIQ A;  3HRK A;  4C8Q E;  2ZXF A;  1B70 A;  3HXU A;  4YRG A;  4AH6 A;  1U1T A;  5K1P A;  2EAY A;  4RDX A;  4C92 D;  4P73 C;  1M8V A;  4C92 E;  4M78 C;  1LYL A;  4PHC A;  4K88 A;  3QSU A;  2E41 A;  3M4G A;  5GAN j;  4P72 A;  5GAM d;  4G85 A;  4K86 A;  4LNS A;  5LJ5 j;  1Y96 A;  5GAN d;  2YHT A;  4XTW A;  1WU7 A;  4J15 A;  1ASY A;  1B34 A;  1LJO A;  1ADJ A;  2QHV A;  1H4T A;  5GAM e;  3GIB A;  5GAO p;  4NL3 A;  4JRI A;  5GAN e;  1E1T A;  2ZZG A;  4XEM A;  4M7A B;  2DXU A;  5LJ5 e;  3SWN C;  4TQF A;  4P3P A;  3JCM P;  3TEH B;  4C8Q A;  1YCY A;  2DQ3 A;  5ELO A;  2ARS A;  4HWS A;  1TH7 A;  1W66 A;  4C92 A;  4C8Q G;  2RA2 A;  3HFO A;  3LC0 A;  1I5L A;  5E3I A;  4M77 D;  5GMK m;  2ZNI A;  4C92 G;  3PCO B;  3FB9 A;  4M77 E;  5GAM h;  4PJO D;  2QHT A;  4PJO E;  3JCM X;  1D3B A;  5GAN h;  1X2H A;  2ODR D;  1B76 A;  4P3O A;  4KR2 A;  2DDZ A;  3BFM A;  3HXW A;  5GAN 5;  3DSQ A;  4YRE A;  1E22 A;  1JBM A;  3SWN A;  4PG3 A;  2AMC B;  3JB9 J;  3A7R A;  4F7U B;  4M75 D;  1KOG A;  4CH3 A;  2VXF A;  4YRK A;  2ZT8 A;  3RKY A;  2DXT A;  4YRN A;  3M4P A;  3QUI A;  1B70 B;  4M77 A;  4NCX A;  2EJ9 A;  4PJO A;  4RCB A;  4M7A C;  5C52 B;  2E5A A;  4YDQ A;  1WYD A;  3HFZ A;  4M77 G;  4M78 F;  3IKL A;  4PJO G;  3A74 A;  3HFV A;  1E1O A;  1SRY A;  3A5Y A;  1B34 B;  4M75 A;  3QTC A;  1KMN A;  2XTI A;  1HC7 A;  2ZTG A;  4A53 A;  1LNX A;  1EVL A;  2Q7G A;  4M75 G;  4EMK A;  3BJU A;  1B8A A;  1JJC A;  3MEY A;  4P74 C;  1EQR A;  4C8Q B;  1HXD A;  4RMF A;  5LJ3 f;  4TQD A;  2RHQ A;  1BIA A;  2QHU A;  2PME A;  1YB3 A;  4C92 B;  2ZIN A;  3HY0 A;  3P8V A;  1YGB A;  4EX5 A;  3UGQ A;  2VXE A;  4CH5 A;  2RHS A;  2IY5 A;  3PCO A;  1WQW A;  4PNO A;  1IL2 A;  1NYQ A;  2EJF A;  4WF2 A;  4P74 A;  4YRF A;  4WJ4 A;  4P71 C;  4QVD A;  4CS4 A;  3JCM b;  5LJ3 j;  5GMK h;  4Q15 A;  2Y90 A;  1EIY A;  1YFR A;  1EVK A;  5GAO l;  4M77 B;  1NJ5 A;  2P5I A;  4H2V A;  4HWP A;  4XTV A;  4PJO B;  4P75 A;  4M7A F;  3HFZ B;  5GAO m;  1H4V B;  3JB9 H;  1KQ1 A;  4C8Q C;  1Z7M A;  3W3S A;  1WQ7 A;  4C92 C;  3M4Q A;  4M7D F;  4P71 A;  4YP0 A;  1H4Q A;  4M75 B;  2E65 A;  3I7F A;  4NL2 A;  2P0L A;  5GAN 4;  4JLI A;  3AHU A;  3HXV A;  5LJ5 d;  4EMK B;  1JJC B;  3A32 A;  1H64 1;  1X54 A;  3NEM A;  4BWA A;  5GAN 2;  2RHQ B;  1E24 A;  4V2S A;  2CJA A;  3JB9 D;  2ZZF A;  3BY7 A;  5DY9 A;  3OD1 A;  4F7U F;  3L1A A;  2DTO A;  4XU2 A;  4XU1 A;  3IG2 A;  4H2T A;  5GAO n;  1G5H A;  3E9H A;  4EMG A;  2RHS B;  3TUP A;  2IY5 B;  1BBU A;  4YRS A;  2XGT A;  4M77 C;  1ASZ A;  4PJO C;  5GAO q;  3P8T A;  2ZIO A;  5LJ5 h;  2ODR C;  5K1X A;  2ART A;  4P3N A;  3NET A;  2I4M A;  4HVC A;  4X5O A;  4H02 A;  1B7Y A;  1LOJ A;  2Q5H A;  4Y91 A;  3QO3 A;  4DPG A;  4M75 C;  2ZR3 A;  1EIY B;  4XU0 A;  12AS A;  2Q7H A;  3IKM B;  3JB9 G;  2ZR2 A;  5KNN A;  1Z7N A;  4EMK C;  2DU5 A;  3HFN A;  2QTX A;  2DTI A;  4X9D A;  1MGQ A;  4C8Q F;  3JCM f;  1WPY A;  3FIF A;  4YRP A;  2DQ0 A;  3JCM g;  3WQZ A;  2DVE A;  4C92 F;  2JN0 A;  2DU7 A;  3R07 A;  1ADY A;  1GGM A;  2FYK A;  4YCU A;  4XU3 A;  1H4S A;  3HTZ A;  1N9W A;  1NJ6 A;  2ZT7 A;  4M7A E;  4NOY A;  2I4L A;  1I81 A;  3QHS A;  3VQW A;  2Q5I A;  3RGL A;  4YRL A;  3A5Z A;  3RKW A;  4M7D D;  4M7D E;  2ZNJ A;  4J6W A;  3HXZ A;  3QNE A;  1WNL A;  3HXX A;  2DKG A;  4H2X B;  3PZC A;  4OLF A;  11AS A;  3QO5 A;  2ARU A;  3A7A A;  2HNI A;  4M77 F;  2I4O A;  4P75 C;  4RQE A;  2CGH A;  4JUV A;  4XTZ A;  4PJO F;  4HWR A;  3L2Z A;  3L4G A;  4OP0 A;  3RF1 A;  3HRI A;  1B7Y B;  4XEO A;  4UPA A;  3VQX A;  4J6X A;  1HTT A;  1N9S A;  1PYS B;  4H2U A;  1BIB A;  1U1S A;  2FB7 A;  4M75 F;  4HT8 A;  2CJB A;  3EFS A;  4TVW A;  4H2S A;  2J3M A;  3CMQ A;  5GMK i;  3V8K A;  5LJ3 d;  3RIR A;  2E3C A;  3TEG A;  2AKW A;  2EWN A;  5GAM f;  2ALY B;  2YLB A;  5GAM g;  5GAN f;  1SET A;  4YRR A;  4BW9 A;  4CH4 A;  5LJ3 e;  5GAN 8;  5C53 B;  5GAN g;  2EJG A;  4Q6G A;  5LJ5 f;  1KQ2 A;  2C8M A;  4HWT A;  4UP9 A;  3V8L A;  1BBW A;  5LJ5 g;  2DJZ A;  4YRO A;  2I4N A;  4TTV A;  1G5I A;  1USY C;  5GAN 3;  2C7I A;  3HY1 A;  2DEQ A;  4TWA A;  4H2W A;  3VBB A;  3INZ A;  3UH0 A;  4UP8 A;  2ZT6 A;  3HSB A;  4TVA A;  1JRI A;  4MMK A;  5LJ3 h;  4YRM A;  1ATI A;  3EFR A;  4M78 D;  2DZ9 A;  3MF1 A;  3QO8 A;  4M78 E;  4QVC A;  5GAM j;  1YFS A;  4RQF A;  1M5Q 1;  1USY A;  2CJ9 A;  1L0W A;  2ZIM A;  3UGT A;  2ZZE A;  2VC8 A;  3JCM V;  4H2Y A;  4H2X A;  2QHS A;  3V7R A;  3PGG A;  3L4G B;  2PMF A;  3REX A;  3QO7 A;  2I2L A;  4WJ3 M;  2E1H A;  1KMM A;  4WI1 A;  2EL9 A;  3RER A;  4N0A C;  3P8Y A;  4E51 A;  1FYF A; 
#chains in the Genus database with same CATH topology
 2JNG A;  2EQU A;  4FT2 A;  2P0K A;  1NPR A;  2EQM A;  1VQM Q;  2C0T A;  2KSS A;  4L59 A;  1QE0 A;  1PG5 B;  2JJ9 A;  5CKB A;  3CPW A;  2L3Q A;  1Q86 U;  1G51 A;  4ZTZ B;  1RI9 A;  3OYY A;  5EC7 A;  2LQK A;  3HTR A;  1E7O A;  4QQG A;  1YJN Q;  4YRT A;  2RB6 A;  3JCM c;  3PFS A;  2DM1 A;  2QGF B;  2MI6 A;  2L89 A;  4JRK A;  4J5Y A;  1S72 T;  5HGQ A;  2A3L A;  5I21 A;  2J3L A;  1ZUY A;  2DJQ A;  5FRM A;  3CXC P;  2ZT5 A;  2DD4 A;  5GAN 7;  1N9R A;  4CI0 C;  3DLM A;  2K57 A;  3G71 Q;  4YCV A;  2RQU A;  5GJV B;  3NEN A;  2NUZ A;  1BI0 A;  2KEA A;  4M7D C;  1JEG A;  5FU7 B;  2KAF A;  3OS5 A;  3OYK A;  1X6B A;  2DIG A;  4E2F B;  1VQ5 Q;  3UDC A;  2JS2 A;  2F5K A;  3QG1 A;  1NYR A;  4XTY A;  2HQE A;  3R6O A;  2CSQ A;  3CD6 A;  3OSS C;  2Q7E A;  1Q82 C;  3UPU A;  2DL8 A;  3LWH A;  3BW1 A;  4M7A G;  2CP5 A;  4ESR A;  5CCA A;  1HYO A;  1N27 A;  3V7S A;  3VQY A;  3MQZ A;  2YUQ A;  1X55 A;  2X9H A;  1SES A;  1Q81 U;  2XDB A;  4YYE A;  3RL6 A;  4DOW A;  2EW3 A;  3NEL A;  2FHD A;  2PQW A;  4ZGJ B;  4FT4 A;  3DLL A;  3G4S Q;  1JQQ A;  4IUQ A;  1ZUU A;  4P72 C;  3M56 A;  4Z02 A;  4BE2 A;  2QG9 B;  2AMC A;  4F7U A;  2CP6 A;  2FZK B;  3JB9 I;  2RQT A;  2E64 A;  4FYV B;  1G3T A;  2LDM A;  2ZPF B;  1RIQ A;  3HRK A;  2XKO C;  2RHU A;  4YRG A;  1VQN T;  5K1P A;  2D6F A;  2D8H A;  1Z9Z A;  3M5A A;  4C92 D;  4F14 A;  4PHC A;  1LYL A;  3M4G A;  3MJX A;  3PT9 A;  4LVI A;  1Y96 A;  2XDD A;  2ATC B;  1B34 A;  4LDV A;  4DBH A;  4OB1 B;  1G3S A;  3I55 T;  1ZSZ C;  3GIB A;  1WXB A;  2DK3 A;  4JRI A;  1E1T A;  2JMC A;  3ZFJ A;  2D1X A;  2YRD A;  2DXU A;  3BDL A;  2EQJ A;  2LZ6 B;  3CCQ Q;  1GBR A;  3PTA A;  2DQ3 A;  4OMQ A;  4HWS A;  2DER A;  1QP2 A;  4AFS C;  1UJ0 A;  1W66 A;  4C92 A;  4C8Q G;  3CCV T;  3LC0 A;  2BKD N;  4D8K A;  2RN8 A;  4M77 E;  4AFZ C;  1VQ7 T;  2JT4 A;  2QHT A;  3EG2 A;  2DLP A;  2J06 A;  2AKL A;  3KXT A;  1BCO A;  3TQ7 P;  2CP2 A;  5J26 A;  3HXW A;  1WHJ A;  1ZX6 A;  2QDL A;  3T9N A;  3EGD B;  3JB9 J;  3A7R A;  4M75 D;  1JXO A;  2VXF A;  4YRK A;  2LT1 A;  1K9M R;  2DXT A;  1Q7Y R;  3A8L B;  3HPW A;  1JJ2 P;  1YJW Q;  3EGX B;  1G3Y A;  2ROL A;  4NCX A;  2W0Z A;  2YXY A;  1IZ6 A;  3FEO A;  4ZN1 A;  2EGE A;  3HFZ A;  1TOV A;  3L42 A;  4PLL A;  3A74 A;  3CCR Q;  2QEX T;  3M54 A;  2KQW A;  1AT1 B;  2FPE A;  1R0B G;  2RF0 A;  4M75 A;  1PC0 A;  2XTI A;  1S72 A;  1H3H A;  1UDL A;  1V76 A;  2ZTG A;  4A53 A;  1UHF A;  1EVL A;  1Y57 A;  3G6E Q;  2LQN A;  1TSF A;  1JJC A;  3MEY A;  1OPL A;  1YBY A;  2XMF A;  3CCU Q;  1YWP A;  5LJ3 f;  2KXD A;  4L6V 5;  3MCA B;  2QHU A;  1YB3 A;  2ZIN A;  1CKB A;  1LVK A;  3QDF A;  1ZQ1 A;  2DD5 A;  2RJC A;  4EX5 A;  1VIE A;  4LDU A;  2JW4 A;  3UGQ A;  2ROT A;  2VVK A;  1K9A A;  1PD1 A;  3M53 A;  1W70 A;  2D9T A;  4BE1 A;  1X69 A;  2LCC A;  2RHZ A;  2IG0 A;  4ZNX A;  2LJ3 A;  1IL2 A;  1FXX A;  2IIM A;  2HBP A;  2K9G A;  3CME Q;  3CCM Q;  2GTO A;  3E2U A;  4QVD A;  1Y71 A;  1TG0 A;  4BB7 A;  1VQK T;  4J9C A;  6AT1 B;  5EG2 A;  5M9O A;  1MND A;  1ABO A;  1GCQ A;  1NJ5 A;  5GAO l;  4M77 B;  1D1B A;  4XTV A;  1TUG B;  3EH2 A;  4P75 A;  1YJ9 Q;  3CBO A;  2WAC A;  3A8O B;  4RMO A;  2CYZ B;  1VQ6 Q;  2QQS A;  1Z7M A;  1KD1 C;  1A0N B;  1BU1 A;  4BE0 A;  4C92 C;  7AT1 B;  4YP0 A;  1H4Q A;  4PFO A;  1G8X A;  2BE7 D;  2KI7 A;  1WHG A;  3AHU A;  5LJ5 d;  2DA9 A;  3MEU A;  3A32 A;  4DBQ A;  2AKK A;  2RHQ B;  2CJA A;  4VUB A;  1VQN A;  4ZTJ A;  4F7U F;  3UF4 A;  3FJ5 A;  1SPK A;  3LH5 A;  3C12 A;  9ATC B;  2RHS B;  4BDZ A;  3LLR A;  4E7L A;  1FWZ A;  2PU9 B;  1YIT Q;  2PUK B;  1AOJ A;  2LCS A;  3I55 A;  2A36 A;  3EG0 A;  5K1X A;  2VAS A;  2QYZ A;  4Y28 E;  2HDA A;  4HVC A;  2AT1 B;  1RI0 A;  2V8K A;  1OPK A;  2JMA A;  4PFZ A;  3FRN A;  4PJJ A;  1FYN A;  2V8I A;  4M75 C;  3DB4 A;  2C0O A;  12AS A;  3CCV A;  1YIJ Q;  1H92 A;  2ZR2 A;  1ZLM A;  1P92 A;  1AWW A;  3CQT A;  1Z7N A;  1VQ7 A;  1W2B S;  4C0F A;  1MGQ A;  3LX7 A;  3FIF A;  2NUT B;  2QK0 A;  4J9F A;  3WQZ A;  4C92 F;  3TSZ A;  2JN0 A;  3MKD A;  3PMI A;  1PRL C;  4E7S A;  2CZ6 B;  4RG2 A;  4NS5 A;  2DPP B;  4R56 A;  2HBW A;  8ATC B;  4RTT A;  2KRO A;  2MWP A;  3VYG A;  2HMA A;  1N9W A;  4LDX A;  2ZT7 A;  1VQL Q;  3OB9 A;  5LL6 S;  2F69 A;  1VYU A;  2EYQ A;  1I81 A;  2I4L A;  4LVJ A;  3VQW A;  2Q5I A;  5KYX B;  3A5Z A;  1XTD A;  2LX9 A;  2G3R A;  4X1V A;  1UB4 A;  2QEX A;  1TS9 A;  3I5S A;  2KNB B;  3A7A A;  4JJB A;  1EIF A;  2I4O A;  4P75 C;  4RQE A;  2RJF A;  3OW2 S;  3L2Z A;  2FL7 A;  5L8R E;  5KYU A;  5D6X A;  4XEO A;  1BBZ A;  1UHC A;  3OYD A;  1QVP A;  1YI2 Q;  1PCX A;  4J6X A;  5FU6 B;  4DEX A;  4M75 F;  4HT8 A;  1M1K R;  1MMD A;  3HHT B;  4HCB A;  2VGM A;  2QAS A;  1VQO Q;  4E6R A;  2DIQ A;  2DMO A;  2H3J A;  2EWN A;  3H0H A;  4L5G A;  1SET A;  2RJD A;  3JRZ A;  3CMA Q;  4JRP A;  3PNW C;  4BY6 C;  1QMC A;  1N6A A;  3V8L A;  4C5H A;  1VQ4 T;  4TTV A;  1G5I A;  1I07 A;  4HKE A;  1VQK A;  1OU9 A;  2V26 A;  3CC7 Q;  2NUP A;  1NJI R;  4OMP A;  4H2W A;  4UP8 A;  5KCH A;  2ZT6 A;  1WJS A;  2PUO B;  3HSB A;  1JRI A;  2P4R A;  2YRV A;  4J8O A;  4M78 D;  1V1C A;  2L3R A;  1U8R A;  5GAM j;  3M55 A;  1YHQ Q;  3CC4 T;  4LUD A;  3C0C A;  1VIF A;  2JXB A;  3UGT A;  2FPF A;  3JCM V;  4JPB W;  5FRO A;  2QHS A;  1M27 C;  3QPH A;  3V7R A;  2GFU A;  3QO7 A;  3MO8 A;  4WI1 A;  1K73 U;  3RER A;  1FYF A;  2E10 A;  2BZY A;  2L5Q A;  4M78 A;  3X28 B;  2QQB A;  4KBM B;  3GBQ A;  3VS5 A;  2IPO B;  5ELN A;  1NLO C;  3ERR A;  2I0N A;  4YCW A;  4DBF A;  4MZT A;  1TUD A;  4FU6 A;  1RAE B;  2DBM A;  3LSQ A;  2COZ A;  1JB0 E;  4XTU A;  3CCJ T;  1NYF A;  2D8J A;  1Q86 R;  2A37 A;  4N0A A;  3URG A;  3C95 A;  3A7U A;  4FSX A;  4WCI A;  1VQ8 T;  4P5N A;  4AG1 C;  2CIM A;  4M75 E;  2RO0 A;  2MCN A;  4PJL A;  4OMN A;  1BKB A;  1BCM A;  5KYY A;  4O2D A;  4TVA B;  2YSQ A;  3OMC A;  2RI5 A;  3GP8 A;  4EMH A;  5J39 A;  3UFG A;  2NYS A;  1HK9 A;  3NPF A;  4J9E A;  3VU3 C;  4YRQ A;  4YRJ A;  1QF6 A;  1YNZ A;  1Y96 B;  1D1A A;  1AD5 A;  1KQS S;  2CP7 A;  2VV5 A;  2K3Y A;  1X43 A;  5IXB A;  1WJQ A;  1MHN A;  4IKF A;  3G1Z A;  4KR3 A;  1WGS A;  3TVT A;  3BDU A;  3JCM J;  2CZ0 B;  1UTI A;  1OX9 A;  4CH6 A;  5HK3 A;  4G84 A;  1VOM A;  1KSW A;  2JS0 A;  2F2X A;  5ECA A;  4M7D A;  1C0A A;  2X4J A;  4J7I A;  2EIF A;  1X01 A;  1WFW A;  3NTI A;  4IUP A;  3BE3 A;  2QQA A;  3HXY A;  1Q81 R;  2BZ8 A;  2DRM A;  2RD1 A;  3S3N A;  4LVM A;  3EG1 A;  3OYB A;  4YRC A;  3REU A;  4TVR A;  2KE9 A;  1RAB B;  2DNU A;  4WTO B;  3VS2 A;  4KH0 B;  4CS2 A;  1SEM A;  4F7U G;  1SF9 A;  3CXC A;  2HSP A;  5GAN 6;  2ZPG B;  1WA7 A;  2YDL A;  4RTU A;  4C8Q E;  2ZXF A;  1IB8 A;  1U1T A;  1K8A U;  4M78 C;  4FL6 A;  3QSU A;  4JZ4 A;  4C0Z A;  4P72 A;  4C0D B;  1VQ4 A;  4N4H A;  3WVE B;  1H4T A;  4FW1 A;  2QA4 T;  1VQP T;  2ZZG A;  4M7A B;  3SWN C;  2CP3 A;  4CC3 A;  1K9M C;  4TQF A;  2LJ1 A;  3TEH B;  1X6O A;  1Q7Y C;  5ELO A;  3CC4 A;  1I1J A;  1N8R C;  1I5L A;  4FYY B;  3EG9 A;  3J81 E;  2ZNI A;  4C92 G;  3FB9 A;  5GAM h;  4PJO D;  3EAE A;  3JCM X;  1D3B A;  1WXU A;  2CH4 W;  3REA B;  5GAN h;  1X2H A;  1QQJ A;  1ZSZ A;  4P3O A;  2DDZ A;  2A7Y A;  3DSQ A;  4FM4 B;  1JBM A;  2QGG A;  2O4X A;  2XID A;  3PE0 A;  2BE9 B;  3RKY A;  1MMN A;  8AT1 B;  2ZPI B;  2JM9 A;  2LQW A;  3M4P A;  3NHN A;  1B70 B;  3QJ6 A;  2EJ9 A;  4PJO A;  1T3L A;  3NGP A;  5C52 B;  3CD6 Q;  1U5S A;  3HRS A;  4IUT A;  4M78 F;  3CCJ A;  4B9W A;  4ZN3 A;  3IKL A;  2F5T X;  3LYI A;  1EX4 A;  3I56 T;  3A5Y A;  2MPX C;  1VQ8 A;  3VUZ A;  1RUW A;  4J9G A;  2OAU A;  3QTC A;  1IGQ A;  1K1Z A;  3A8G B;  2E5Q A;  2L2P A;  4UC4 A;  1KK7 A;  2J6O A;  3OBW A;  4M75 G;  4OB3 B;  1IXD A;  4J9D A;  4P74 C;  1M9S A;  4C8Q B;  3GLX A;  1EQR A;  2GF7 A;  3M0R A;  1G5V A;  2CKK A;  3UWN A;  2KVQ G;  3HY0 A;  4PJN A;  1YGB A;  5IHI A;  3VS7 A;  2EGC A;  4FYW B;  5FRN A;  1PM3 A;  4A4E A;  2YUN A;  4J9H A;  3X24 B;  3QYG B;  2IY5 A;  3G6E T;  3PCO A;  1AVZ C;  2D0Q B;  2KRS A;  3M0U A;  1NYQ A;  4RTY A;  3G71 A;  2K5L A;  4YRF A;  4P71 C;  3Q1J A;  1TU0 B;  2L3P A;  4ELZ C;  4CS4 A;  1ACM B;  1NEG A;  4QQ6 A;  3JCM b;  2VWF A;  2ZZD A;  1EIY A;  2Y4Y A;  2O01 E;  5KE3 A;  1JJ2 A;  1EVK A;  4H2V A;  3OBY A;  1KC8 C;  5AT1 B;  2LP5 A;  1OUL A;  2A0F B;  4A4F A;  3CCM T;  2HD0 A;  2MOX A;  4OB2 B;  4ZGE B;  1EFN A;  2XU8 A;  4M7D F;  1AZG B;  3PVQ A;  1ZHI A;  2B8A A;  2E65 A;  2P0L A;  2VGN A;  4OB0 B;  4LD9 K;  4JLI A;  4EMK B;  2RI2 A;  1YJ9 T;  4IUR A;  1H64 1;  4BWA A;  2GQV A;  2KK4 A;  3ZEH A;  5GAN 2;  5I22 A;  1E24 A;  3A5Z B;  4KUI A;  2QDY B;  1ZA1 B;  3OYH A;  3TCJ A;  2FZG B;  3VS4 A;  2YRC A;  2LCL A;  1U3O A;  2AZS A;  1KHC A;  4PL6 A;  4E7I A;  4EMG A;  1B07 A;  3TUP A;  2KRN A;  1BBU A;  1PSE A;  2M1H A;  4RG8 A;  4YRS A;  1QVG S;  1VQ9 T;  1XOV A;  4D8D A;  2HL3 A;  4PJO C;  2L3S A;  3E1S A;  5GAO q;  2QA4 A;  1WLP B;  1IRX A;  1MV0 B;  1VQP A;  1GXI E;  4RKU E;  1DJ7 B;  4KGX B;  1AWO A;  1M1F A;  2O9S A;  4EDU A;  4RUG A;  4Y91 A;  3QO3 A;  4AFU C;  3GNF B;  3PVL A;  4F16 A;  1Y7X A;  3IKM B;  1S72 Q;  1YIT T;  2KT8 A;  1W2B P;  3DB3 A;  3HFN A;  3H8Z A;  1RAA B;  2QTX A;  2EKH A;  1WPY A;  2K5F A;  4YRP A;  4XK8 E;  2DVE A;  1M90 C;  2RK2 A;  2DU7 A;  1SSF A;  2RHX A;  5CQY A;  2JTE A;  4RTZ A;  3CCL T;  2RI3 A;  2FYK A;  3GNG A;  2K5I A;  2RQR A;  3LH0 A;  4RTX A;  2CZ7 B;  2DBK A;  4B6M A;  2BZX A;  4LE9 A;  4NOY A;  3OS1 A;  1M1K C;  1QKX A;  4C0G A;  1OI1 A;  4YRL A;  4FIB A;  2CH4 A;  4M7D E;  2ZNJ A;  1GL5 A;  2E6N A;  4MZM A;  3I56 A;  1KG1 A;  2GFA A;  3PZC A;  3PIP A;  1SRL A;  2DIL A;  1KIK A;  2E12 A;  2HNI A;  1SKU B;  2CGH A;  4JUV A;  3OMG A;  4LUE A;  4XTZ A;  4PJO F;  3OW2 P;  1VYV A;  4BUG A;  4OP0 A;  3CCS T;  3HRI A;  2X51 A;  1B7Y B;  2JUF A;  3OYI A;  1NPP A;  4H2U A;  1TWB A;  1U1S A;  1M3A A;  4OVA A;  3S3M A;  2Z0W A;  5GMK i;  3V8K A;  4BD3 A;  2FRY A;  2E3C A;  2E3I A;  3G6E A;  5GAM g;  4YRR A;  5C53 B;  5GAN g;  3ULR B;  3CC2 T;  2EJG A;  4Q6G A;  1VQN Q;  1KQ2 A;  2C8M A;  4HWT A;  2LNV A;  1V29 B;  4ANJ A;  4YRO A;  5DM7 R;  1USY C;  2YUO A;  5KYY B;  4AFQ C;  1NLP C;  2HQX A;  4TWA A;  3P8D A;  3UH0 A;  5D7U A;  1AEY A;  3OS0 A;  3I55 Q;  3MPU B;  1ATI A;  2J7I A;  2DZ9 A;  1R8O B;  5CO7 A;  3CCM A;  3CBP A;  4JJD A;  2EBP A;  2YUP A;  2NWM A;  3CC7 T;  1HD3 A;  2CJ9 A;  3S6W A;  3CCV Q;  2DVJ A;  2CSI A;  1NEB A;  3S3O A;  3PGG A;  2XHC A;  1VQ7 Q;  3L4G B;  2I2L A;  2E1H A;  1KMM A;  1YJ9 A;  4N4G A;  2KRM A;  2DEU A;  3P8Y A;  3M0T A;  4J7F A;  1K73 R;  4AG2 C;  4P73 A;  4YRI A;  4LN2 A;  1QKW A;  1E6G A;  4MDW A;  1ZBJ A;  4M7D B;  1IGU A;  4F04 B;  5CKD A;  1PYS A;  2QAZ A;  2ZGW A;  1NNH A;  4M78 G;  3CCE T;  2AKW B;  3HL8 A;  4K87 A;  2E6Z A;  5HKC A;  5IN1 A;  1VQ9 A;  2R5M A;  2ALY A;  3JCM Q;  2R57 A;  3OY9 A;  1SG5 A;  3TU4 K;  1NJ2 A;  1W1F A;  3A31 A;  1Y07 A;  3L2V A;  5I11 A;  1X2G A;  2QEX Q;  4HCK A;  3L2W A;  5CKH A;  4DQ2 A;  3MEV A;  1H3Z A;  2PNI A;  2ZAE A;  3SEM A;  3CBM A;  1RAC B;  1I8F A;  3HKS A;  1N8R U;  1T0J A;  2KBT A;  3OYM A;  4QW2 A;  3H6Z A;  1YIT A;  3OYE A;  2P0P A;  2DZC A;  2JVV A;  4XAX B;  1EFW A;  1SSH A;  2PVO B;  2RJE A;  3RNJ A;  5C6S A;  3M9Q A;  1H8K A;  1PKT A;  1D0Y A;  2O31 A;  2DTH A;  3E9I A;  1CSK A;  3RKX A;  1NJ8 A;  1YCS B;  5F5W A;  3VRZ A;  1RAI B;  3IAL A;  3UA6 A;  1KQS P;  3KFU A;  1Q81 C;  3CCL A;  1VQZ A;  2AZV A;  2VB6 A;  3LSS A;  1AWJ A;  2WSE E;  3FJP A;  4MML A;  1SER A;  3I35 A;  2R5A A;  5GMK j;  2FZC B;  1NZ9 A;  3VV0 A;  4Q5W A;  2YLC A;  5LJ3 g;  4F7U E;  5CR2 A;  5CIU A;  4ATO A;  4HA8 A;  2ZPE B;  3V7C A;  1VQK Q;  2JTF A;  5GMK e;  1M8M A;  2O9V A;  3UA7 A;  1D3B B;  2A28 A;  1VA7 A;  1ZSZ B;  2SEM A;  1X56 A;  4M7D G;  3VS3 A;  1M30 A;  3JCM h;  4KT0 E;  1EOV A;  5FW9 A;  1UUE A;  3GF5 A;  1BI2 A;  2FVU A;  2P84 A;  3CCS A;  3NTK A;  5FWC A;  1QCF A;  1QLY A;  1RAH B;  3EGD A;  1Q82 U;  5FU7 C;  4HT9 A;  2DE0 X;  4X9C A;  3M0Q A;  1WHH A;  2FO0 A;  1WHK A;  1MMA A;  4TVY A;  3RUX A;  2K2M A;  4ZIB A;  1OX8 A;  3ICA A;  3SFM A;  4ZTU B;  3RES A;  4LNP A;  3HXU A;  2NLU A;  4AH6 A;  2EAY A;  4RDX A;  4P73 C;  1NE8 A;  3DKM A;  1M3C A;  4C92 E;  3CC2 A;  2EKO A;  5GAN j;  4HT4 A;  1K8A R;  2M0O A;  4OGE A;  5GAM d;  4G85 A;  4LNS A;  5GAN d;  2A8E A;  4XTW A;  1K0S A;  1OOT A;  4J15 A;  1LJO A;  2OTL T;  2QHV A;  4ZGD B;  4DOV A;  1BI3 A;  4Z88 A;  5IHN A;  5GAM e;  2OI3 A;  2OTJ T;  5GAO p;  4NL3 A;  5GAN e;  4GLM A;  2JM8 A;  3LWI A;  3L2U A;  4XEM A;  3M0S A;  2ED1 A;  1VYT A;  3H9N A;  3JCM P;  1YCY A;  1QWE A;  2ARS A;  3RMQ A;  2XK0 A;  2GBQ A;  1RLP C;  3CC7 A;  1KD1 R;  3VJP A;  4M77 D;  5GMK m;  3PCO B;  3QWX X;  2ODR D;  1G83 A;  2C06 A;  3OYN A;  1YP5 A;  4KR2 A;  3BFM A;  1WXT A;  2K2V A;  2DL7 A;  1S1N A;  3SWN A;  3A8H B;  5A2Q E;  2AMC B;  4PG3 A;  4F7U B;  4BAC A;  1QVF P;  1R77 A;  4CH3 A;  1MV3 A;  4E47 A;  3L2R A;  1VQM T;  1C0M A;  3CCE A;  5J3B A;  4YRN A;  2E3H A;  5A0G A;  3QUI A;  4M77 A;  4R55 A;  4GY5 A;  2VYT A;  2ESW A;  2KDS A;  1GRI A;  2YWW A;  1PRM C;  2JZ2 A;  1YJN T;  2E5A A;  4YDQ A;  3ER0 A;  2LQ8 A;  4PJO G;  5KYN A;  2XD0 A;  5I2S A;  1PD0 A;  2RQW A;  4IIO A;  1B34 B;  4OMO A;  2PVD B;  1JO8 A;  1KMN A;  2XDP A;  2LX7 A;  2HAX A;  2ZPB B;  3KFV A;  1KJW A;  2Q7G A;  4A63 B;  3BJU A;  5IH2 A;  1B8A A;  3G71 T;  3I5R A;  4CRI A;  1OYX A;  1ZSG A;  2RHQ A;  3WXM B;  2PME A;  4C92 B;  2AK5 A;  1QWF A;  1VQ5 T;  2QXF A;  4K11 A;  2DYB A;  5L23 A;  4HVW A;  4Z89 A;  2RHS A;  5IHK A;  2EGA A;  4PNO A;  3OYG A;  1M2O A;  3R6N A;  1X27 A;  2EJF A;  4WF2 A;  1UEB A;  2RMO A;  4P74 A;  1O75 A;  2DAQ A;  4WJ4 A;  1UJY A;  4PK4 A;  4EIK A;  1VQ4 Q;  5LJ3 j;  5GMK h;  2Y90 A;  1HJD A;  3OYF A;  4LD6 A;  2HSE B;  2H8H A;  1TUC A;  2P5I A;  4HWP A;  1RAD B;  1WHL A;  2HZY A;  4RTV A;  4QKU A;  2Y4X A;  3HFZ B;  3G4S T;  1GCP A;  5GAO m;  1KQ1 A;  3W3S A;  2M0Y A;  3CPF A;  1M2V A;  1WHM A;  1WQ7 A;  3REB B;  3M4Q A;  1MUZ A;  5DLO A;  3CC4 Q;  4JZ3 A;  4P71 A;  4M75 B;  3I7F A;  2PVG B;  2QQR A;  1XNI A;  3RR6 A;  3SDZ A;  1B7T A;  5GAN 4;  1D1C A;  1MNE A;  1I0C A;  3HXV A;  1JJC B;  1RLQ C;  3EFO A;  4JS4 A;  3NEM A;  2EFI A;  2DFU A;  2OJ2 A;  2ED0 A;  2ZCF B;  3JB9 D;  1K4U S;  5CQX A;  3BY7 A;  3EGU A;  4HVV A;  5DY9 A;  3L1A A;  5KYX A;  2DTO A;  4XU2 A;  1TTH B;  1KD1 U;  3IG2 A;  5GAO n;  1G5H A;  3E9H A;  2V1Q A;  1QVG P;  3SHW A;  3MP1 A;  5AYF A;  4M77 C;  4M4Z A;  2OTL A;  4ELY C;  4MZP A;  1JU5 C;  3P8T A;  2OTJ A;  2ZIO A;  4BI8 B;  3CCQ T;  5KCO A;  2ODR C;  2EYX A;  4P3N A;  3CCJ Q;  2PTK A;  1Y0M A;  4H02 A;  1LOJ A;  4IIM A;  2Q5H A;  2RHI A;  1FX7 A;  2GNC A;  1QVF S;  1VQ8 Q;  4DPG A;  3VS1 A;  1D0X A;  2ENM A;  5KNN A;  2G6F X;  4BI4 A;  2EYZ A;  3ZBD A;  2BTT A;  2X4X A;  1UEC A;  2DTI A;  2HEQ A;  1UG1 A;  4X9D A;  3VRY A;  2DQ0 A;  3JCM g;  5DLQ E;  1BB9 A;  2MIO A;  1RAG B;  1QCN A;  1IO6 A;  2KGT A;  1GGM A;  3N5B B;  2DXC A;  2LC4 A;  1Q95 G;  1VQM A;  2EYY A;  2BUD A;  1YJW T;  4XU3 A;  1UGR B;  2M02 A;  1H4S A;  3E9G A;  1NJ6 A;  4EPC A;  1BI1 A;  2JOY A;  3QHS A;  1G2B A;  4BY6 B;  3RGL A;  1YJN A;  3CCR T;  1IHV A;  3FC3 A;  4J6W A;  3HXZ A;  1WNL A;  3HXX A;  4OLF A;  2ARU A;  4M77 F;  2EYW A;  2DXB A;  4J83 A;  3QWY A;  3CCU T;  3RF1 A;  2CUB A;  1HTT A;  1N9S A;  1UE9 A;  5CVI A;  1PYS B;  5A0D A;  2CJB A;  4C5E A;  3EFS A;  4TVW A;  4H2S A;  1VQ5 A;  3RIR A;  3MHX A;  5A0L A;  1W2B A;  3TEG A;  2EQI A;  3ASK A;  5GAM f;  2ALY B;  2CP0 A;  2DL4 A;  4O6J A;  5GAN f;  3CME T;  4LXC A;  3CPW P;  4BW9 A;  5GAN 8;  4CH4 A;  1I5O B;  3H41 A;  4IUV A;  4UP9 A;  4HCC A;  1BBW A;  5LJ5 g;  2DRK A;  3H0I A;  2I4N A;  1G3W A;  4QVZ A;  5GAN 3;  4LDW A;  2C7I A;  3HY1 A;  2CS7 A;  3OS2 A;  3VBB A;  3INZ A;  2X3W D;  2KT1 A;  1K73 C;  2KYB A;  5CKF A;  4TVA A;  2QA4 Q;  4CC2 A;  1VQP Q;  5LJ3 h;  1VQ6 T;  4YRM A;  1ARK A;  2FEI A;  2MYS A;  1F1B B;  2E4H A;  3ME9 A;  3G4S A;  3QO8 A;  2CT4 A;  4M78 E;  1IHW A;  5D6W A;  3NMZ C;  5D6Y A;  5FU6 C;  2J05 A;  3QBY A;  2WSC E;  1YFS A;  4RQF A;  4GLK A;  2E70 A;  3MEW A;  1USY A;  3OQ5 A;  1L0W A;  2FPD A;  2ZIM A;  4H2Y A;  4H2X A;  1QW1 A;  1KFZ A;  3OW2 A;  3TSW A;  2DL5 A;  2PMF A;  5KYU B;  1GFD A;  1UGV A;  4WJ3 M;  3SD4 A;  1M4Z A;  2CT3 A;  2EL9 A;  4ORZ A;  2O88 A;  4N4I A;  1WI7 A;  5GMK l;  1NM7 A;  3JCM W;  2M16 A;  4RCC A;  4KRT A;  1UGS B;  1OZ3 A;  2M51 A;  1KHI A;  5HY6 A;  4J6Y A;  4PFP A;  3V8J A;  4XQ3 A;  3SB2 A;  4L87 A;  2ZPH B;  2MMP A;  3QII A;  1AZE A;  5HCK A;  5HK0 A;  3CCQ A;  1OU8 A;  3QYH B;  4JRQ A;  3PIO A;  4YPF A;  2NUP B;  3I56 Q;  4A4H A;  1YIJ T;  1J5W A;  2CRE A;  3CXC S;  4M7A D;  2HCK A;  1N8R R;  1WLE A;  2J6F A;  4R0K A;  2K4Y A;  2YT6 A;  4QQD A;  1PNJ A;  3M4Y A;  1ABQ A;  3JB9 F;  2G4C A;  2ZCE A;  2LVM A;  3VUB A;  5GAO r;  3G7Z A;  3LGL A;  4OF1 A;  1W4S A;  3M59 A;  5KYW A;  2LJ0 A;  5CAI A;  3P8H A;  3JCM d;  4J9B A;  3OA6 A;  1UFF A;  3VQV A;  1VQL T;  1YJW A;  5C51 B;  2KMT A;  4EO4 A;  2LTO A;  3JCM e;  3RMS A;  2H3E B;  4M7A A;  3J7A F;  1NJI C;  2DET A;  4JDS A;  4M78 B;  1YFT A;  2V1R A;  4KQE A;  3CCR A;  2X35 A;  3TEE A;  2D0N A;  3M57 A;  3TEH A;  3MEA A;  1AHJ B;  1CKA A;  1NJ1 A;  4YTL A;  3X25 B;  4UP7 A;  1OQK A;  4HWO A;  3F70 A;  4KUD K;  1X2Q A;  2AHJ B;  3QZ5 B;  4XTX A;  5FLX E;  3RAC A;  2MAM A;  1BYM A;  3MF2 A;  5IAY A;  4IUU A;  1I4K 1;  2RPN A;  4OMF B;  1K8A C;  2AIR B;  4A54 A;  2O2O A;  2CUD A;  4FYX B;  3CPW S;  3SWN B;  3CCU A;  1YI2 T;  2EQK A;  3UT1 A;  2MWO A;  2E5K A;  2XG8 D;  3KUF A;  1WIE A;  4CS3 A;  1UGP B;  2RM4 A;  1Q82 R;  1VQO T;  1FMV A;  1OEB A;  3VYH B;  4JJN K;  3FLG A;  3TRE A;  4C8Q D;  3VS6 A;  1WYX A;  4ZTF A;  3CMA T;  1B70 A;  3EH1 A;  1U06 A;  3CME A;  5IT9 E;  5C0M A;  3D7S B;  3OYA A;  1M8V A;  3EHR A;  4K88 A;  2E41 A;  3O8V A;  1KQS A;  1FMK A;  4K86 A;  1X6G A;  4X34 A;  5LJ5 j;  3J80 E;  2YHT A;  1WU7 A;  1ASY A;  3E9F A;  1ADJ A;  3PMT A;  1Q86 C;  3QKJ A;  1VQ9 Q;  1NYG A;  2QQ9 A;  1LPL A;  2GCX A;  1GBQ A;  4BI3 A;  2VUB A;  3CEY A;  5LJ5 e;  1VQ6 A;  1N5Z A;  1YHQ T;  4P3P A;  3RBB B;  5GJW B;  4C8Q A;  1KC8 R;  4LVL A;  1NG2 A;  3MP6 A;  1Z9Q A;  1TH7 A;  2IVW A;  4FSS A;  2RA2 A;  3HFO A;  5E3I A;  4E7J A;  3EHQ A;  2X4W A;  1D09 B;  4PJO E;  1C1A A;  3X20 B;  1B76 A;  3M0P A;  4HVU A;  3A1P A;  2K7A A;  5GAN 5;  2L0A A;  4GBQ A;  5IXF A;  4YRE A;  1E22 A;  2P4T A;  5KH6 A;  2DO3 A;  1KOG A;  1K9M U;  3KBG A;  1ZUK A;  1Q7Y U;  4C0D C;  3H0F A;  3CCL Q;  2ZT8 A;  1M3B A;  3X26 B;  3JV3 A;  2MF2 A;  2K6D A;  2LMJ A;  3U23 A;  4HXJ A;  1JJ2 S;  4RCB A;  1UGQ B;  4ME7 A;  4M7A C;  1K0X A;  1M2V B;  1YN8 A;  1WYD A;  4M77 G;  2KXC A;  2C0I A;  2DYI A;  3HFV A;  1E1O A;  1SRY A;  3LW5 E;  2FG0 A;  3NFC A;  1YIJ A;  1HC7 A;  1QCO A;  2GGR A;  3EFO B;  4DA4 A;  1LNX A;  1LCK A;  2WSF E;  2LNH B;  2V8J A;  4EMK A;  1YFN A;  4E7Z A;  1HXD A;  4RMF A;  3CCS Q;  4Z8A A;  4TQD A;  1YWO A;  1BIA A;  3P8V A;  4A4G A;  3EG9 B;  4PKC C;  2BIV A;  1GCQ C;  2VXE A;  1M90 R;  2SRC A;  4CH5 A;  2RQV A;  4A4K A;  1WQW A;  3HP9 A;  4KGV B;  4JS5 A;  4RTW A;  1VQL A;  4MDX A;  1K76 A;  2B86 A;  2XIC A;  2O4X B;  1EZZ B;  3CC2 Q;  5I2M A;  1B3Q A;  1X2K A;  4OML A;  1QVF A;  2COW A;  2EPD A;  3VKI A;  2RHY A;  2X4Y A;  2CDT A;  2VKN A;  4Q15 A;  2EVR A;  4HCZ A;  4LDY A;  2K79 A;  1YFR A;  2GQI A;  4JLG A;  3THK A;  2A08 A;  3GPL A;  2DX1 A;  4PJO B;  4M7A F;  3EGX A;  1H4V B;  3JB9 H;  4BDY A;  4C8Q C;  1E6H A;  2P0Q A;  1C6V X;  1T0H A;  2KR3 A;  1YI2 A;  4E7H A;  3A8M B;  1PHT A;  3LGF A;  2OX7 A;  4NL2 A;  4Y92 A;  1VQO A;  2K3X A;  1J3T A;  1MMG A;  1X54 A;  3O5Z A;  1KC8 U;  1WDX A;  4V2S A;  3CMA A;  2ZZF A;  3OD1 A;  2F1L A;  2J6K A;  1FMW A;  4XU1 A;  4C5I A;  4H2T A;  4FCY A;  1SRM A;  3QDR B;  3MP8 A;  2IY5 B;  2XI9 A;  3CCE Q;  2XGT A;  2RH2 A;  3P8B B;  5KE2 A;  4E7K A;  1ASZ A;  2HQH A;  5LJ5 h;  1OZ2 A;  2LRQ A;  2ART A;  3NET A;  2I4M A;  3EG3 A;  4LVK A;  2CZ1 B;  4X5O A;  1B7Y A;  2KY9 A;  1AWX A;  1YHQ A;  2OAW A;  3NTH A;  4C5G A;  2M9U A;  2ZR3 A;  1EIY B;  2QTV A;  4XU0 A;  1D0Z A;  1OV3 A;  2R58 A;  3JB9 G;  2Q7H A;  1RAF B;  1NBE B;  4EMK C;  2DU5 A;  4C8Q F;  1XQH A;  3JCM f;  3FDR A;  2FRW A;  3R07 A;  3RDV A;  1ADY A;  4CC4 B;  4QT7 A;  4YCU A;  4DEY A;  2COY A;  2RNA A;  4JJC A;  4DBR A;  2KYM A;  3IQL A;  3HTZ A;  3L2Q A;  1WX6 A;  4M7A E;  3CD6 T;  1TXQ A;  4D6W A;  2W10 A;  4AMC A;  1SHF A;  3RKW A;  4M7D D;  1QP3 A;  1M90 U;  1VUB A;  3QNE A;  2X3X D;  3MET A;  3OYC A;  11AS A;  4H2X B;  2DKG A;  1QVG A;  2ECZ A;  3C94 A;  3QO5 A;  4PJM A;  2JTM A;  3QZ9 B;  4HWR A;  5CK9 A;  4PLI A;  1R0C B;  5CKE A;  3WVD B;  3L4G A;  3HRU A;  1HSQ A;  3HRT A;  4UPA A;  1GFC A;  1M1K U;  3VQX A;  3JAM E;  2L8D A;  1BIB A;  2FB7 A;  1JXM A;  1W6X A;  4KGZ B;  4OMM A;  2J3M A;  1PKS A;  1T3S A;  2F2V A;  3CMQ A;  5LJ3 d;  1RL2 A;  2AKW A;  1O9S A;  1XJW B;  2YLB A;  1ZBX A;  1SHG A;  3G1J A;  1M1G A;  1PWT A;  2HKN A;  5LJ3 e;  2DL3 A;  3JSC A;  4OGC A;  5LJ5 f;  2NUT A;  2DJZ A;  1PSF A;  3UAT A;  1X75 C;  1NJI U;  3AT1 B;  3M58 A;  4AT1 B;  2DEQ A;  4KUL A;  1BK2 A;  3OSV A;  4II1 A;  4CC7 A;  3QJY A;  1WJR A;  2OTL Q;  1ZA2 B;  2NS6 A;  2OTJ Q;  4MMK A;  4J9I A;  1WZO A;  2K3B A;  3A98 A;  3EFR A;  5FWB A;  3C4S A;  3MF1 A;  4QVC A;  4KH1 B;  4F17 A;  3OYL A;  3OYJ A;  3GOX A;  5KYW B;  4O5V A;  2DF6 A;  2F2W A;  1M5Q 1;  2RK1 A;  2ZZE A;  2VC8 A;  3ZL7 C;  2GTJ A;  2HKQ B;  3E19 A;  3I9Q A;  3REX A;  1IRE B;  4B9X A;  2MK5 A;  2QI2 A;  2HL5 C;  2PZ1 A;  4FW2 A;  4N0A C;  3QXE B;  4E51 A;  3VS0 A;  2LT4 A;  2ABL A; 
#chains in the Genus database with same CATH homology
 2JNG A;  2EQU A;  4FT2 A;  2P0K A;  1NPR A;  2EQM A;  2KSS A;  4L59 A;  1QE0 A;  5CKB A;  3CPW A;  1Q86 U;  1G51 A;  4ZTZ B;  3OYY A;  2LQK A;  4QQG A;  4YRT A;  2RB6 A;  3JCM c;  3PFS A;  2MI6 A;  2L89 A;  4JRK A;  4J5Y A;  1S72 T;  5HGQ A;  2A3L A;  5I21 A;  2J3L A;  5FRM A;  2ZT5 A;  2DD4 A;  5GAN 7;  1N9R A;  4CI0 C;  3DLM A;  2K57 A;  4YCV A;  3NEN A;  1BI0 A;  4M7D C;  5FU7 B;  2KAF A;  3OS5 A;  3OYK A;  2DIG A;  3UDC A;  2F5K A;  3QG1 A;  1NYR A;  4XTY A;  2HQE A;  3R6O A;  3CD6 A;  3OSS C;  2Q7E A;  1Q82 C;  3UPU A;  3LWH A;  3BW1 A;  4M7A G;  5CCA A;  1N27 A;  3V7S A;  3VQY A;  3MQZ A;  1X55 A;  1SES A;  1Q81 U;  2XDB A;  4YYE A;  3RL6 A;  4DOW A;  3NEL A;  2FHD A;  2PQW A;  4ZGJ B;  4FT4 A;  3DLL A;  4IUQ A;  4P72 C;  3M56 A;  4Z02 A;  4BE2 A;  2AMC A;  4F7U A;  3JB9 I;  2E64 A;  1G3T A;  2LDM A;  2ZPF B;  1RIQ A;  3HRK A;  2XKO C;  2RHU A;  4YRG A;  1VQN T;  5K1P A;  2D6F A;  3M5A A;  4C92 D;  4PHC A;  1LYL A;  3M4G A;  3PT9 A;  4LVI A;  1Y96 A;  2XDD A;  4LDV A;  1B34 A;  4OB1 B;  1G3S A;  3I55 T;  3GIB A;  2DK3 A;  4JRI A;  1E1T A;  3ZFJ A;  2DXU A;  3BDL A;  2EQJ A;  3PTA A;  2DQ3 A;  4HWS A;  1QP2 A;  1W66 A;  4C92 A;  4C8Q G;  3CCV T;  3LC0 A;  2BKD N;  4M77 E;  1VQ7 T;  2QHT A;  3KXT A;  5J26 A;  3HXW A;  3T9N A;  3JB9 J;  3A7R A;  4M75 D;  2VXF A;  4YRK A;  2LT1 A;  2DXT A;  3A8L B;  3HPW A;  1G3Y A;  4NCX A;  1IZ6 A;  3FEO A;  4ZN1 A;  3HFZ A;  3L42 A;  4PLL A;  3A74 A;  2QEX T;  3M54 A;  2KQW A;  4M75 A;  2XTI A;  1S72 A;  2ZTG A;  4A53 A;  1EVL A;  1JJC A;  3MEY A;  1YBY A;  5LJ3 f;  4L6V 5;  3MCA B;  2QHU A;  1YB3 A;  2ZIN A;  1ZQ1 A;  2DD5 A;  2RJC A;  4EX5 A;  1VIE A;  4LDU A;  3UGQ A;  3M53 A;  2D9T A;  4BE1 A;  2LCC A;  2RHZ A;  2IG0 A;  1IL2 A;  1FXX A;  2HBP A;  4QVD A;  1Y71 A;  4BB7 A;  1VQK T;  5EG2 A;  5M9O A;  1NJ5 A;  5GAO l;  4M77 B;  4XTV A;  4P75 A;  3CBO A;  2WAC A;  3A8O B;  4RMO A;  2CYZ B;  2QQS A;  1Z7M A;  1KD1 C;  4BE0 A;  4C92 C;  4YP0 A;  1H4Q A;  3AHU A;  5LJ5 d;  3MEU A;  3A32 A;  2RHQ B;  2CJA A;  4VUB A;  1VQN A;  4ZTJ A;  4F7U F;  3C12 A;  2RHS B;  4BDZ A;  3LLR A;  4E7L A;  1FWZ A;  2PU9 B;  2PUK B;  3I55 A;  5K1X A;  4Y28 E;  4HVC A;  1RI0 A;  2V8K A;  3FRN A;  2V8I A;  4M75 C;  3DB4 A;  12AS A;  3CCV A;  2ZR2 A;  1P92 A;  1Z7N A;  1VQ7 A;  1W2B S;  4C0F A;  1MGQ A;  3LX7 A;  3FIF A;  3WQZ A;  4C92 F;  2JN0 A;  3PMI A;  2CZ6 B;  4RG2 A;  4NS5 A;  2DPP B;  4R56 A;  2MWP A;  3VYG A;  1N9W A;  4LDX A;  2ZT7 A;  3OB9 A;  5LL6 S;  2F69 A;  2EYQ A;  2I4L A;  1I81 A;  4LVJ A;  3VQW A;  2Q5I A;  3A5Z A;  1XTD A;  2LX9 A;  2G3R A;  1UB4 A;  2QEX A;  3A7A A;  1EIF A;  2I4O A;  4P75 C;  4RQE A;  2RJF A;  3OW2 S;  3L2Z A;  2FL7 A;  5L8R E;  5D6X A;  4XEO A;  3OYD A;  1QVP A;  4J6X A;  5FU6 B;  4M75 F;  4HT8 A;  3HHT B;  4HCB A;  2VGM A;  2DIQ A;  2H3J A;  2EWN A;  4L5G A;  1SET A;  2RJD A;  3JRZ A;  4JRP A;  3PNW C;  4BY6 C;  1N6A A;  3V8L A;  4C5H A;  1VQ4 T;  4TTV A;  1G5I A;  4HKE A;  1VQK A;  4H2W A;  4UP8 A;  5KCH A;  2ZT6 A;  1WJS A;  2PUO B;  3HSB A;  1JRI A;  2YRV A;  4J8O A;  4M78 D;  2L3R A;  1U8R A;  5GAM j;  3M55 A;  3CC4 T;  1VIF A;  3UGT A;  3JCM V;  5FRO A;  2QHS A;  3QPH A;  3V7R A;  2GFU A;  3QO7 A;  3MO8 A;  4WI1 A;  1K73 U;  3RER A;  1FYF A;  2E10 A;  2L5Q A;  4M78 A;  3X28 B;  2QQB A;  4KBM B;  5ELN A;  3ERR A;  4YCW A;  4MZT A;  4FU6 A;  3LSQ A;  1JB0 E;  4XTU A;  3CCJ T;  4N0A A;  3URG A;  3C95 A;  3A7U A;  4FSX A;  1VQ8 T;  4P5N A;  2CIM A;  4M75 E;  2RO0 A;  1BKB A;  4O2D A;  4TVA B;  3OMC A;  2RI5 A;  3GP8 A;  4EMH A;  5J39 A;  3UFG A;  1HK9 A;  3VU3 C;  4YRQ A;  4YRJ A;  1QF6 A;  1Y96 B;  1KQS S;  2VV5 A;  2K3Y A;  1WJQ A;  1MHN A;  4IKF A;  3G1Z A;  4KR3 A;  1WGS A;  3BDU A;  3JCM J;  2CZ0 B;  4CH6 A;  5HK3 A;  4G84 A;  4M7D A;  1C0A A;  2X4J A;  4J7I A;  2EIF A;  1X01 A;  3NTI A;  4IUP A;  2QQA A;  3HXY A;  2RD1 A;  3S3N A;  4LVM A;  3OYB A;  4YRC A;  3REU A;  4TVR A;  4CS2 A;  4F7U G;  3CXC A;  5GAN 6;  2ZPG B;  4C8Q E;  2ZXF A;  1U1T A;  1K8A U;  4M78 C;  4FL6 A;  3QSU A;  4C0Z A;  4P72 A;  4C0D B;  1VQ4 A;  4N4H A;  3WVE B;  1H4T A;  2QA4 T;  1VQP T;  2ZZG A;  4M7A B;  3SWN C;  1K9M C;  4TQF A;  3TEH B;  1X6O A;  1Q7Y C;  5ELO A;  3CC4 A;  1N8R C;  1I5L A;  3J81 E;  2ZNI A;  4C92 G;  3FB9 A;  5GAM h;  4PJO D;  3EAE A;  3JCM X;  1D3B A;  5GAN h;  1X2H A;  4P3O A;  2DDZ A;  2A7Y A;  3DSQ A;  4FM4 B;  1JBM A;  2O4X A;  2XID A;  3RKY A;  2ZPI B;  3M4P A;  1B70 B;  3QJ6 A;  2EJ9 A;  4PJO A;  5C52 B;  3HRS A;  4IUT A;  4M78 F;  3CCJ A;  4B9W A;  4ZN3 A;  3IKL A;  2F5T X;  3LYI A;  3I56 T;  3A5Y A;  1VQ8 A;  3VUZ A;  2OAU A;  3QTC A;  3A8G B;  2E5Q A;  4UC4 A;  3OBW A;  4M75 G;  4OB3 B;  4P74 C;  1M9S A;  4C8Q B;  3GLX A;  1EQR A;  2GF7 A;  1G5V A;  2CKK A;  3UWN A;  2KVQ G;  3HY0 A;  1YGB A;  5FRN A;  4A4E A;  3X24 B;  3QYG B;  2IY5 A;  3G6E T;  3PCO A;  2D0Q B;  1NYQ A;  3G71 A;  2K5L A;  4YRF A;  4P71 C;  3Q1J A;  4ELZ C;  4CS4 A;  4QQ6 A;  3JCM b;  2ZZD A;  1EIY A;  2Y4Y A;  2O01 E;  5KE3 A;  1JJ2 A;  1EVK A;  4H2V A;  3OBY A;  1KC8 C;  4A4F A;  3CCM T;  2HD0 A;  4ZGE B;  4OB2 B;  2XU8 A;  4M7D F;  1ZHI A;  2B8A A;  2E65 A;  2P0L A;  2VGN A;  4OB0 B;  4LD9 K;  4JLI A;  4EMK B;  2RI2 A;  1YJ9 T;  4IUR A;  1H64 1;  4BWA A;  2GQV A;  2KK4 A;  3ZEH A;  5GAN 2;  1E24 A;  3A5Z B;  4KUI A;  2QDY B;  3OYH A;  3TCJ A;  2LCL A;  1KHC A;  4PL6 A;  4E7I A;  4EMG A;  3TUP A;  1BBU A;  1PSE A;  2M1H A;  4RG8 A;  4YRS A;  1QVG S;  1VQ9 T;  1XOV A;  4PJO C;  5GAO q;  3E1S A;  2QA4 A;  1VQP A;  1GXI E;  4RKU E;  1DJ7 B;  1M1F A;  4EDU A;  4Y91 A;  3QO3 A;  3GNF B;  1Y7X A;  3IKM B;  1YIT T;  3DB3 A;  3HFN A;  3H8Z A;  2QTX A;  1WPY A;  2K5F A;  4YRP A;  4XK8 E;  2DVE A;  1M90 C;  2RK2 A;  2DU7 A;  1SSF A;  2RHX A;  5CQY A;  3CCL T;  2RI3 A;  2FYK A;  3GNG A;  2K5I A;  3LH0 A;  2CZ7 B;  4NOY A;  3OS1 A;  1M1K C;  4C0G A;  1OI1 A;  4YRL A;  4FIB A;  4M7D E;  2ZNJ A;  2E6N A;  4MZM A;  3I56 A;  1KG1 A;  2GFA A;  3PZC A;  3PIP A;  2E12 A;  2HNI A;  2CGH A;  4JUV A;  3OMG A;  4XTZ A;  4PJO F;  4BUG A;  4OP0 A;  3CCS T;  3HRI A;  1B7Y B;  2JUF A;  3OYI A;  1NPP A;  4H2U A;  1U1S A;  4OVA A;  3S3M A;  5GMK i;  3V8K A;  4BD3 A;  2E3C A;  3G6E A;  5GAM g;  4YRR A;  5C53 B;  5GAN g;  3CC2 T;  2EJG A;  4Q6G A;  1KQ2 A;  2C8M A;  4HWT A;  2LNV A;  1V29 B;  4YRO A;  5DM7 R;  1USY C;  2HQX A;  4TWA A;  3P8D A;  3UH0 A;  3OS0 A;  1ATI A;  2DZ9 A;  1R8O B;  5CO7 A;  3CCM A;  3CBP A;  3CC7 T;  2CJ9 A;  3S6W A;  3S3O A;  3PGG A;  2XHC A;  3L4G B;  2I2L A;  2E1H A;  1KMM A;  1YJ9 A;  4N4G A;  3P8Y A;  4J7F A;  4P73 A;  4YRI A;  4MDW A;  4M7D B;  5CKD A;  1PYS A;  2ZGW A;  1NNH A;  4M78 G;  3CCE T;  2AKW B;  3HL8 A;  4K87 A;  2E6Z A;  5HKC A;  5IN1 A;  1VQ9 A;  2R5M A;  2ALY A;  3JCM Q;  2R57 A;  3OY9 A;  3TU4 K;  1NJ2 A;  3A31 A;  1Y07 A;  3L2V A;  1X2G A;  3L2W A;  5CKH A;  4DQ2 A;  3MEV A;  1H3Z A;  3CBM A;  1I8F A;  3HKS A;  1N8R U;  3OYM A;  4QW2 A;  3H6Z A;  1YIT A;  3OYE A;  2P0P A;  2DZC A;  2JVV A;  4XAX B;  1EFW A;  2PVO B;  2RJE A;  5C6S A;  3M9Q A;  2DTH A;  3E9I A;  3RKX A;  1NJ8 A;  5F5W A;  3IAL A;  3KFU A;  1Q81 C;  3CCL A;  1VQZ A;  3LSS A;  3FJP A;  2WSE E;  4MML A;  1SER A;  2R5A A;  5GMK j;  1NZ9 A;  3VV0 A;  4Q5W A;  2YLC A;  5LJ3 g;  4F7U E;  5CR2 A;  5CIU A;  4ATO A;  4HA8 A;  2ZPE B;  3V7C A;  2JTF A;  5GMK e;  1D3B B;  1X56 A;  4M7D G;  3JCM h;  4KT0 E;  1EOV A;  3GF5 A;  1BI2 A;  2FVU A;  3CCS A;  3NTK A;  1Q82 U;  5FU7 C;  4HT9 A;  4X9C A;  4TVY A;  3RUX A;  4ZIB A;  3ICA A;  3SFM A;  4ZTU B;  3RES A;  3HXU A;  2NLU A;  4AH6 A;  2EAY A;  4RDX A;  4P73 C;  1NE8 A;  3DKM A;  4C92 E;  3CC2 A;  2EKO A;  5GAN j;  4HT4 A;  2M0O A;  4OGE A;  5GAM d;  4G85 A;  4LNS A;  5GAN d;  2A8E A;  4XTW A;  4J15 A;  1LJO A;  2OTL T;  2QHV A;  4ZGD B;  4DOV A;  1BI3 A;  5GAM e;  2OTJ T;  5GAO p;  4NL3 A;  5GAN e;  3LWI A;  3L2U A;  4XEM A;  3JCM P;  1YCY A;  2ARS A;  3RMQ A;  2XK0 A;  3CC7 A;  3VJP A;  4M77 D;  5GMK m;  3PCO B;  2ODR D;  2C06 A;  3OYN A;  4KR2 A;  3BFM A;  2K2V A;  3SWN A;  3A8H B;  2AMC B;  5A2Q E;  4PG3 A;  4F7U B;  4BAC A;  4CH3 A;  4E47 A;  3L2R A;  1VQM T;  3CCE A;  5J3B A;  4YRN A;  5A0G A;  3QUI A;  4M77 A;  4R55 A;  4GY5 A;  2VYT A;  2KDS A;  1YJN T;  2E5A A;  2JZ2 A;  4YDQ A;  3ER0 A;  2LQ8 A;  4PJO G;  2XD0 A;  5I2S A;  1B34 B;  2PVD B;  1KMN A;  2XDP A;  2HAX A;  2ZPB B;  2Q7G A;  3BJU A;  1B8A A;  3G71 T;  4CRI A;  1OYX A;  2RHQ A;  3WXM B;  2PME A;  4C92 B;  1VQ5 T;  2QXF A;  2RHS A;  4PNO A;  3OYG A;  2EJF A;  4WF2 A;  1UEB A;  4P74 A;  1O75 A;  2DAQ A;  4WJ4 A;  5LJ3 j;  5GMK h;  2Y90 A;  3OYF A;  4LD6 A;  2P5I A;  4HWP A;  2Y4X A;  3HFZ B;  3G4S T;  5GAO m;  1KQ1 A;  3W3S A;  3CPF A;  1WQ7 A;  3M4Q A;  5DLO A;  4P71 A;  4M75 B;  3I7F A;  2PVG B;  2QQR A;  1XNI A;  3SDZ A;  5GAN 4;  3HXV A;  1JJC B;  4JS4 A;  3NEM A;  2EFI A;  2ZCF B;  3JB9 D;  5CQX A;  3BY7 A;  5DY9 A;  3L1A A;  2DTO A;  4XU2 A;  1KD1 U;  3IG2 A;  5GAO n;  1G5H A;  3E9H A;  3MP1 A;  5AYF A;  4M77 C;  2OTL A;  4ELY C;  4MZP A;  3P8T A;  2OTJ A;  2ZIO A;  4BI8 B;  3CCQ T;  5KCO A;  2ODR C;  4P3N A;  4H02 A;  1LOJ A;  2Q5H A;  2RHI A;  1FX7 A;  1QVF S;  4DPG A;  5KNN A;  4BI4 A;  3ZBD A;  2X4X A;  2DTI A;  4X9D A;  2DQ0 A;  3JCM g;  5DLQ E;  1GGM A;  3N5B B;  2DXC A;  2LC4 A;  1VQM A;  2BUD A;  1YJW T;  4XU3 A;  1UGR B;  1H4S A;  3E9G A;  1NJ6 A;  4EPC A;  1BI1 A;  2JOY A;  3QHS A;  4BY6 B;  3RGL A;  1YJN A;  3CCR T;  3FC3 A;  4J6W A;  3HXZ A;  1WNL A;  3HXX A;  4OLF A;  2ARU A;  4M77 F;  2DXB A;  4J83 A;  3CCU T;  3RF1 A;  1HTT A;  1N9S A;  5CVI A;  1PYS B;  5A0D A;  2CJB A;  4C5E A;  3EFS A;  4TVW A;  4H2S A;  1VQ5 A;  3RIR A;  3MHX A;  5A0L A;  1W2B A;  3TEG A;  3ASK A;  5GAM f;  2ALY B;  4O6J A;  5GAN f;  3CME T;  4BW9 A;  4CH4 A;  5GAN 8;  4IUV A;  4UP9 A;  4HCC A;  1BBW A;  5LJ5 g;  2I4N A;  1G3W A;  4QVZ A;  5GAN 3;  4LDW A;  2C7I A;  3HY1 A;  2CS7 A;  3OS2 A;  3VBB A;  3INZ A;  1K73 C;  5CKF A;  4TVA A;  5LJ3 h;  1VQ6 T;  4YRM A;  3G4S A;  3ME9 A;  3QO8 A;  4M78 E;  5D6W A;  5D6Y A;  5FU6 C;  3QBY A;  2WSC E;  1YFS A;  4RQF A;  4GLK A;  2E70 A;  3MEW A;  1USY A;  3OQ5 A;  1L0W A;  2ZIM A;  4H2Y A;  4H2X A;  1QW1 A;  3OW2 A;  2PMF A;  4WJ3 M;  3SD4 A;  1M4Z A;  2EL9 A;  4N4I A;  5GMK l;  3JCM W;  2M16 A;  4RCC A;  1UGS B;  1OZ3 A;  1KHI A;  5HY6 A;  4J6Y A;  3V8J A;  4XQ3 A;  3SB2 A;  4L87 A;  2ZPH B;  2MMP A;  3QII A;  5HK0 A;  3CCQ A;  3QYH B;  4JRQ A;  3PIO A;  4YPF A;  4A4H A;  1YIJ T;  1J5W A;  3CXC S;  4M7A D;  1WLE A;  2K4Y A;  4QQD A;  3M4Y A;  2ZCE A;  3JB9 F;  2G4C A;  2LVM A;  3VUB A;  5GAO r;  3G7Z A;  3LGL A;  4OF1 A;  1W4S A;  3M59 A;  5CAI A;  3P8H A;  3JCM d;  3OA6 A;  3VQV A;  1VQL T;  1YJW A;  5C51 B;  2KMT A;  4EO4 A;  2LTO A;  3JCM e;  3RMS A;  4M7A A;  3J7A F;  1NJI C;  4JDS A;  4M78 B;  1YFT A;  4KQE A;  3CCR A;  2X35 A;  3TEE A;  3TEH A;  3M57 A;  3MEA A;  1AHJ B;  1NJ1 A;  4YTL A;  3X25 B;  4UP7 A;  4HWO A;  3F70 A;  4KUD K;  2AHJ B;  3QZ5 B;  4XTX A;  5FLX E;  3RAC A;  2MAM A;  1BYM A;  3MF2 A;  5IAY A;  4IUU A;  1I4K 1;  4OMF B;  1K8A C;  4A54 A;  3CPW S;  3SWN B;  3CCU A;  1YI2 T;  2EQK A;  3UT1 A;  2MWO A;  2XG8 D;  3KUF A;  4CS3 A;  1UGP B;  2RM4 A;  1VQO T;  3VYH B;  4JJN K;  3FLG A;  3TRE A;  4C8Q D;  4ZTF A;  3CMA T;  1B70 A;  3CME A;  5IT9 E;  5C0M A;  3OYA A;  1M8V A;  4K88 A;  2E41 A;  3O8V A;  1KQS A;  4K86 A;  4X34 A;  5LJ5 j;  3J80 E;  2YHT A;  1WU7 A;  1ASY A;  3E9F A;  1ADJ A;  3PMT A;  1Q86 C;  3QKJ A;  2QQ9 A;  2GCX A;  4BI3 A;  2VUB A;  3CEY A;  5LJ5 e;  1VQ6 A;  1YHQ T;  4P3P A;  4C8Q A;  4LVL A;  3MP6 A;  1TH7 A;  2IVW A;  2RA2 A;  3HFO A;  5E3I A;  4E7J A;  2X4W A;  4PJO E;  3X20 B;  1B76 A;  5GAN 5;  4YRE A;  1E22 A;  2P4T A;  5KH6 A;  2DO3 A;  1KOG A;  1K9M U;  3KBG A;  1Q7Y U;  4C0D C;  2ZT8 A;  3X26 B;  2MF2 A;  1JJ2 S;  4RCB A;  1UGQ B;  4ME7 A;  4M7A C;  1WYD A;  4M77 G;  3HFV A;  1E1O A;  1SRY A;  3LW5 E;  3NFC A;  1YIJ A;  1HC7 A;  4DA4 A;  1LNX A;  2WSF E;  2V8J A;  4EMK A;  1HXD A;  4RMF A;  4TQD A;  1BIA A;  3P8V A;  4A4G A;  4PKC C;  2BIV A;  2VXE A;  4CH5 A;  4A4K A;  1WQW A;  3HP9 A;  4JS5 A;  1VQL A;  4MDX A;  2XIC A;  2O4X B;  5I2M A;  1QVF A;  3VKI A;  2RHY A;  2X4Y A;  4Q15 A;  4HCZ A;  4LDY A;  1YFR A;  4JLG A;  3GPL A;  4PJO B;  4M7A F;  1H4V B;  3JB9 H;  4BDY A;  4C8Q C;  2P0Q A;  1YI2 A;  4E7H A;  3A8M B;  3LGF A;  4NL2 A;  1VQO A;  2K3X A;  1X54 A;  1KC8 U;  4V2S A;  3CMA A;  2ZZF A;  3OD1 A;  4XU1 A;  4C5I A;  4H2T A;  3QDR B;  3MP8 A;  2IY5 B;  2XI9 A;  2XGT A;  2RH2 A;  3P8B B;  5KE2 A;  4E7K A;  1ASZ A;  5LJ5 h;  1OZ2 A;  2LRQ A;  2ART A;  3NET A;  2I4M A;  4LVK A;  2CZ1 B;  4X5O A;  1B7Y A;  2KY9 A;  1YHQ A;  3NTH A;  4C5G A;  2M9U A;  2ZR3 A;  1EIY B;  4XU0 A;  2R58 A;  2Q7H A;  3JB9 G;  4EMK C;  2DU5 A;  4C8Q F;  1XQH A;  3JCM f;  3FDR A;  3R07 A;  1ADY A;  4YCU A;  3HTZ A;  3L2Q A;  4M7A E;  3CD6 T;  4D6W A;  3RKW A;  4M7D D;  1QP3 A;  1M90 U;  1VUB A;  3QNE A;  3MET A;  3OYC A;  11AS A;  4H2X B;  2DKG A;  1QVG A;  3C94 A;  3QO5 A;  2JTM A;  3QZ9 B;  4HWR A;  5CK9 A;  4PLI A;  5CKE A;  3WVD B;  3L4G A;  3HRU A;  3HRT A;  4UPA A;  1M1K U;  3VQX A;  3JAM E;  2L8D A;  1BIB A;  2FB7 A;  2J3M A;  3CMQ A;  5LJ3 d;  1RL2 A;  2AKW A;  1O9S A;  2YLB A;  1ZBX A;  1M1G A;  5LJ3 e;  3JSC A;  4OGC A;  5LJ5 f;  2DJZ A;  1PSF A;  1X75 C;  1NJI U;  3M58 A;  2DEQ A;  4KUL A;  3OSV A;  4II1 A;  3QJY A;  1WJR A;  2NS6 A;  4MMK A;  3EFR A;  3C4S A;  3MF1 A;  4QVC A;  3OYL A;  3OYJ A;  3GOX A;  4O5V A;  1M5Q 1;  2RK1 A;  2ZZE A;  2VC8 A;  3E19 A;  3REX A;  1IRE B;  4B9X A;  2QI2 A;  4N0A C;  3QXE B;  4E51 A;  2LT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...