3FJPA

Apo structure of biotin protein ligase from aquifex aeolicus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
total genus 67
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fjpA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3fjpA01
4P73C 4M78D 1SRYA 3RIRA 2ARUA 2Y90A 3P8VA 2DU5A 4J6YA 3NEMA 3PCOB 4C8QF 4ZIBA 3HXYA 2IY5A 4M75B 2PMFA 4YRJA 4YYEA 4M75A 3RKYA 5KNNA 3A7UA 3JCMX 4M78E 4YDQA 4K87A 2I4MA 2QHSA 5DY9A 2Q7EA 5CAIA 4JRKA 3VQVA 2E1HA 4M7AB 1Y96A 1I81A 3HSBA 2XTIA 4C8QE 4XQ3A 2RHSB 3L4GA 3PZCA 3LC0A 3JCMb 4CH4A 1HXDA 1HK9A 5GANd 4H2YA 3ERRA 4TQFA 1LOJA 5C53B 5LJ5d 3V7RA 4C92A 1B70B 3P8YA 3TEGA 4YRNA 2EJGA 4EMKA 4UPAA 4XTZA 3JCMd 3FB9A 4P72A 4TVWA 4G85A 2E65A 3QHSA 1NJ8A 2QHTA 2ZZGA 2YHTA 4JLIA 4TTVA 3RF1A 4YRFA 2AMCB 2Q7GA 2E10A 1QF6A 4NCXA 5LJ5e 4J5YA 3JCMQ 1NJ6A 5GANe 2ZR2A 2RD1A 1WU7A 4F7UE 3L2ZA 2QHVA 3RL6A 1WLEA 1RIQA 2I2LA 4P72C 4M75F 4M77F 1KOGA 1B34A 4NOYA 1E22A 4PJOC 2ALYB 4EMHA 2E3CA 2RHSA 5GMKl 3HXUA 3R07A 3BJUA 3QNEA 5ELNA 4HWTA 4ZTUB 1LJOA 4M77E 1I4K1 3E9IA 4P71C 4YCWA 2C8MA 3VQWA 4M75G 3SWNC 4M77G 4C92G 4WJ3M 2DKGA 1EVKA 2ZZEA 3JB9F 3BW1A 1PYSA 1YFRA 2ZIOA 2EWNA 4N0AA 4C92E 4M78F 5GAN8 1J5WA 5GAMf 3VU3C 1YCYA 1JJCB 4PHCA 5GAOm 4M7AA 3A31A 3G1ZA 4XU1A 4O2DA 4X9CA 4EMKC 3P8TA 2DXTA 1I5LA 5F5WA 1USYA 2ZNIA 5I21A 4C92F 3UFGA 3JB9G 5LJ3g 5LJ3d 4EO4A 1YFSA 4M78G 1X2HA 2G4CA 1IL2A 3BFMA 5GAOl 2E5AA 3QTCA 2DXUA 4J6XA 4M78C 1B7YA 3HFNA 3A7RA 1WQ7A 4RCBA 3HFZA 1H4VB 1E24A 3HFOA 1KMMA 4C92C 3OD1A 1H4QA 4RCCA 2VXEA 1ATIA 4X5OA 3V7CA 3JCMP 2P0LA 2ZZFA 5GAMd 4HVCA 3RACA 2RHQB 1JJCA 3RESA 1EQRA 1B76A 1JBMA 5K1PA 2QTXA 4XU3A 4BWAA 3L1AA 3JB9H 1BBWA 3JCMJ 4L87A 5LJ3h 2K57A 4CS2A 4MMKA 1X54A 1SERA 4RMFA 3REXA 4KQEA 2ZT7A 3FJPA 3IKMB 3BDUA 4JUVA 3A7AA 3PGGA 4H2SA 4HWOA 4YRKA 4H2WA 4CH5A 3REUA 1NJ1A 3IKLA 4Q6GA 4CS3A 4C8QA 4AH6A 4XEMA 4XTUA 2ZIMA 3SWNA 3V8KA 3QO8A 1X2GA 4M7DB 4H02A 4P75C 3JCMe 1ASZA 4V2SA 3RERA 4JRIA 1QE0A 2JN0A 1YGBA 2EAYA 2RM4A 1B34B 2ZNJA 1KQ1A 1BIBA 3VBBA 5C52B 1D3BB 3L4GB 4YRRA 4RDXA 1G51A 2ZT8A 4HWSA 2E41A 4H2XA 1ADJA 4CH3A 2P5IA 1MGQA 3SB2A 4TVAA 2Q7HA 1EVLA 1SESA 4PG3A 1BIAA 2YLBA 3JCMf 4M7DE 4X9DA 4PJOD 3KFUA 4KR3A 3IG2A 2YLCA 3AHUA 3LSSA 2QHUA 2ZTGA 4C92D 4TQDA 1USYC 1FYFA 3DSQA 4H2UA 5E3IA 3NENA 1B70A 4YP0A 4OP0A 4UP9A 1E1TA 5K1XA 3A5YA 3VQXA 4EMGA 2DZCA 3RKWA 4YROA 3RKXA 3FIFA 2RB6A 4N0AC 4RQFA 3LSQA 3RUXA 2Q5IA 4M7DA 1LYLA 3I7FA 3IALA 4XTWA 4YRGA 2VC8A 2ODRC 5GMKj 3JB9I 1D3BA 4F7UF 1WNLA 4CS4A 2I4NA 3HXWA 4P3OA 3CMQA 2ZGWA 1LNXA 1X56A 4CH6A 3A74A 2DVEA 4YRQA 1U1TA 4M75E 4C92B 3HY1A 4K86A 1M5Q1 2J3LA 1KQ2A 1SETA 4P74A 1EIYA 2ALYA 1Z7NA 1WPYA 1B7YB 4PJOB 5GAN6 1U1SA 2DQ0A 1NJ5A 4M77C 3E9HA 4F7UG 4HT8A 2CJ9A 4YCVA 4XTVA 4Q15A 1PYSB 1N9WA 2ZR3A 3MF2A 3M4PA 3WQZA 1YFTA 3UGTA 2RA2A 3W3SA 4ZTZB 2FB7A 4YRSA 1Y96B 4NL2A 2C7IA 3MF1A 5GAN5 1NYQA 2EJFA 2AKWA 2J3MA 5LJ5g 3HTZA 1JRIA 5GAN2 1H4TA 1HC7A 5GANg 2CGHA 2XGTA 3EFRA 5LJ3f 5GAOn 2DDZA 2RHQA 5HGQA 4BW9A 4TVAB 1NNHA 4QVCA 4XU2A 4M78A 4M7AG 2I4OA 2ODRD 3V8LA 4WF2A 4HA8A 3JCMV 5GAMg 4M7AE 4C8QD 3SWNB 1W66A 2DTIA 3HFVA 5LJ3e 3HRIA 3QO7A 4K88A 1EIYB 11ASA 3A5ZA 5C51B 2CJBA 4PJOA 4YCUA 4A53A 4M7AD 5LJ3j 2ZXFA 2IY5B 4YRLA 5GMKe 4J6WA 2AKWB 4P75A 4M7AF 1VQZA 4PJOF 4NL3A 1Z7MA 4E51A 4YRPA 4YRCA 3GIBA 1H4SA 12ASA 2DZ9A 3NETA 3RGLA 4P71A 2ZT5A 5GAMj 1EFWA 3VQYA 3JCMg 3M4QA 3JB9D 2CIMA 1M8VA 3HXVA 4KR2A 4M7DD 4G84A 4PJOE 4DPGA 2CJAA 1G5HA 1YB3A 3HY0A 4H2XB 5GAN3 4P73A 3TEHB 4PJOG 4M7DC 1NYRA 4TVYA 1X55A 4F7UA 2ARSA 4M7AC 4XTXA 4M7DG 4XU0A 3V7SA 4MMLA 3JCMh 4C8QB 3ICAA 4YRIA 2E64A 2AMCA 1E1OA 3V8JA 4WJ4A 3M4GA 3JB9J 3UH0A 1N9RA 3NELA 2DU7A 3QO5A 4HWPA 4UP8A 5GAOp 4XEOA 2DJZA 4EMKB 4HWRA 4YRMA 1HTTA 3INZA 4PNOA 4EX5A 3HRKA 3HXXA 1GGMA 4M77A 5GAOr 4M7DF 1WYDA 4M77B 3JCMc 5LJ5f 5GANf 1B8AA 3JCMW 3QO3A 5GAMh 1G5IA 4H2TA 1I8FA 3BY7A 4M75C 1N9SA 4LNSA 4WI1A 2VXFA 3TUPA 2EL9A 4J15A 4OLFA 4P3PA 5GMKh 2EJ9A 4H2VA 2ZINA 1BBUA 2ZT6A 1ADYA 4M78B 3HFZB 3QUIA 4YRTA 5GAMe 5GAOq 3MEYA 1ASYA 4TWAA 4YPFA 2ARTA 4YREA 4XTYA 4M77D 3QSUA 3EFSA 2ZCEA 3A32A 1L0WA 3PCOA 2DQ3A 4UP7A 1C0AA 4M75D 3UGQA 5GAN4 5LJ5j 1TH7A 4Y91A 2DTHA 1X01A 5GANj 4HT9A 2Q5HA 1KMNA 4C8QC 4RQEA 1NJ2A 2HNIA 5GMKm 4P3NA 4A54A 3HXZA 4QVDA 3TEHA 4F7UB 4C8QG 4P74C 2FYKA 2DTOA 2DEQA 1H641 2I4LA 1WQWA 5GMKi 2PMEA 5GANh 5LJ5h 5ELOA 5GAN7 4DQ2A 1EOVA
chains in the Genus database with same CATH superfamily
5CK9A 5CQYA 4MDWA 1SRYA 2DU5A 3M56A 3PCOB 1VQ4T 4ZIBA 5CCAA 1I0CA 1VYUA 4M75B 4YYEA 1BI3A 4M75A 3OYKA 5A2QE 3A7UA 4A4GA 2I4MA 2E1HA 4QQ6A 5IXBA 5IAYA 2XTIA 1PNJA 3BDLA 1SPKA 3OBYA 3WVEB 2KR3A 5CO7A 1QKWA 2DRMA 1KQSS 2A08A 2CP2A 3UWNA 3ME9A 3I55A 2FZCB 5LJ5d 3V7RA 1UG1A 3G4ST 1UE9A 4RTVA 2RJCA 1VQMQ 2DL5A 2GFUA 1K0XA 2EJGA 1BYMA 3FB9A 4LVIA 3QHSA 2EYWA 2QHTA 2ZZGA 2YHTA 1CKAA 4YRFA 2AMCB 1QVGP 2GNCA 2E70A 2PUOB 5GANe 4A4KA 2V8KA 2L3RA 4FM4B 2HCKA 4XAXB 4RTXA 2QHVA 2ED1A 5KYXB 1WLEA 1AWOA 1RIQA 4Y92A 4P72C 3REAB 4LD6A 4M77F 2QQ9A 4LUEA 4N4HA 2RHSA 4RTTA 1AEYA 2CP6A 2CT4A 5CVIA 1BB9A 4ZGEB 1XJWB 5ELNA 4OMNA 1OOTA 4HWTA 4C0GA 5CQXA 1D1AA 1QVPA 1Q81C 4RTZA 3VQWA 1TWBA 3SWNC 1Q82C 3E2UA 4M77G 4IURA 4WJ3M 1KC8R 3QXEB 1PKSA 3JV3A 5KCHA 3BW1A 1JXMA 1PYSA 1YFRA 1TSFA 3X26B 3PTAA 4C92E 1GBRA 4AMCA 1OU9A 3NTKA 3TCJA 4FSSA 1JJCB 2KQWA 2V8IA 3RDVA 5KYWB 3EGUA 1VQNQ 1HJDA 4JDSA 3IQLA 3MEUA 2LJ0A 2JS0A 4EO4A 1PSEA 4M78G 1K8AC 1V1CA 3PMTA 1K0SA 3HRUA 4AT1B 3LWHA 4M78C 2A0FB 4UC4A 2VUBA 3CMAA 1K9AA 4RUGA 3ZEHA 1YWOA 3GNGA 2VGNA 3HFOA 1KMMA 1QVFP 3CXCS 5KH6A 4RCCA 3QDFA 5HK0A 3EGXB 2QDLA 4X5OA 1MHNA 3JCMP 2L8DA 3KFVA 1OULA 2P84A 4O5VA 4HVCA 3CCVA 5IXFA 1SF9A 4ELYC 3RESA 1EQRA 4LVLA 1B76A 1JBMA 4Z02A 2QTXA 2NS6A 1NEBA 2F69A 3CCSQ 1UHCA 3OYLA 2LCCA 1MUZA 4MMKA 1X54A 2ZT7A 4RTWA 1NBEB 3BDUA 3CQTA 4H2SA 4HWOA 1OX8A 3M53A 1WJRA 2JTEA 3JAME 3REUA 1FMWA 1VQ4Q 4JZ4A 4II1A 3CC2T 3QPHA 1IZ6A 4CS3A 2Y4YA 4C8QA 4BE0A 3QO8A 4AFSC 4P75C 3JCMe 1ASZA 4IKFA 4V2SA 3VS4A 2JN0A 1IGQA 4F16A 2EAYA 1B34B 4CI0C 4PFPA 3QIIA 4KUDK 4H2XA 2LQ8A 1UGPB 2CKKA 3EFOB 1FX7A 2B86A 3JCMf 2M9UA 5IN1A 2ESWA 1NE8A 2NUPB 5KYNA 4M7DE 3VS0A 3OYGA 4KR3A 1K73R 1R0BG 1VQ4A 3A8OB 1XNIA 3M0SA 3LSSA 4C92D 1USYC 1KC8C 1G3YA 3A5ZB 2HBPA 4KT0E 4UP9A 1VQOQ 2RO0A 5K1XA 1OX9A 2FO0A 3VQXA 1JU5C 4RG8A 2DZCA 4YROA 3CCQA 1YJ9Q 2RB6A 2CYZB 2GF7A 4M7DA 3E1SA 4HVWA 4J9GA 3CCUA 2QA4T 4ESRA 2BZYA 3JB9I 1D3BA 3H0IA 1M90U 2J06A 3OW2S 1VQ5T 3MPUB 1BBZA 4IUQA 1XQHA 4CH6A 4YRQA 3HY1A 2K5IA 4CC4B 2KAFA 1KQ2A 1D09B 1AWJA 2F2XA 4HKEA 3NTIA 1EIYA 4HXJA 2ALYA 2RNAA 2KT8A 4Z8AA 4C0ZA 2DQ0A 4PJMA 5FWCA 4DOWA 2RMOA 3QYGB 2FHDA 4IIOA 4J9FA 1PYSB 1M3AA 5FU6B 3X24B 3E9FA 3M4PA 3G6EA 1FMKA 1KJWA 3CCLA 3W3SA 3E19A 2FB7A 1OEBA 1S72Q 3MF1A 5GAN5 5KYWA 2CS7A 1VQ8Q 1G5VA 4BD3A 2CGHA 1VUBA 2O4XB 2DPPB 5GAOn 3MP6A 2DDZA 2ZZDA 2K4YA 1PM3A 4TVAB 4FCYA 1VQPA 4QVCA 2MOXA 1F1BB 1GFCA 2H3JA 4ZNXA 2I4OA 2E5QA 3V8LA 5IHKA 2P4RA 1YJNT 4RG2A 3OS1A 3I55Q 5FU7C 3SWNB 4BY6C 2EQMA 3LX7A 1AZGB 2RK1A 4LXCA 5C51B 3GBQA 3M59A 3CCRT 5LJ3j 1ZHIA 4P75A 4M7AF 2YRVA 4PJOF 2YWWA 4NL3A 1D0ZA 2WSEE 1H4SA 4E7IA 4B6MA 3TU4K 3RGLA 3VYGA 2LQWA 2R57A 2M51A 3VQYA 1G2BA 3PNWC 2F5KA 3WVDB 1YJWT 2DYIA 4AFZC 5J3BA 1M8VA 2DE0X 1QP3A 4F04B 3META 3G4SQ 1YB3A 1ZA1B 5GAN3 1VQKT 4PJOG 5J39A 1PSFA 2LTOA 4M7DC 1NJIR 1NPPA 5CIUA 1NJIU 1QVGS 4J83A 4C0DB 2E64A 1OPLA 2AMCA 3V8JA 3QZ5B 2WACA 4LD9K 1LVKA 2PQWA 3CCET 2VKNA 2DU7A 3QO5A 2BZXA 3VS7A 3MQZA 1Q82R 1UDLA 3QG1A 2AHJB 1K8AU 3LGLA 1HTTA 4PNOA 3CMAT 1Q7YR 4RMOA 2HSPA 2JTMA 1V76A 3R6OA 1IB8A 3QKJA 3JCMc 1Y57A 5LJ5f 5CKFA 2KEAA 2PVGB 2VYTA 2L5QA 3M0QA 5HCKA 2CZ6B 1B8AA 2EYXA 1IHVA 1CSKA 4LDXA 1PRLC 3EFOA 2K2VA 1MMAA 2HBWA 3HKSA 3OS5A 2RI2A 3I35A 1QLYA 2CH4A 1OPKA 3PIOA 2EL9A 1SKUB 1OU8A 1RAEB 2I0NA 1ADYA 4M78B 2XK0A 3QUIA 3ZFJA 4YREA 4XTYA 1Q86C 4N4IA 2AZVA 2RJDA 4CC2A 3A32A 2DFUA 2XIDA 1UEBA 4CC7A 2COWA 4UP7A 1M8MA 2BIVA 5LJ5j 1N27A 4LDWA 4BDZA 5GANj 2Q5HA 1KMNA 3OYNA 5GMKm 2L89A 4A54A 4F14A 1WHMA 3VUBA 1YIJQ 4QKUA 4C8QG 1VA7A 2MWOA 1W2BA 2FYKA 3CCSA 5I11A 2K5LA 2I4LA 1WQWA 2PMEA 4O6JA 2XMFA 3CXCA 4DBFA 1K9MU 1U06A 3CCVQ 4OMQA 2HAXA 1G83A 2EKHA 4M78D 2QQSA 2ARUA 3P8VA 3UPUA 1AWWA 2COYA 4C8QF 3PIPA 2IY5A 4YRJA 5KNNA 3TQ7P 4YDQA 2X4XA 4M78E 4K87A 3CPWS 1YI2Q 5DY9A 5CAIA 2RQTA 2GFAA 4M7AB 1VQPT 2M0OA 4BI3A 1EZZB 2X4WA 1JJ2P 4XQ3A 3S3NA 2BTTA 3JCMb 4RTUA 1M1KC 2E3IA 1K73C 3ERRA 3CCUT 2XD0A 4C92A 1B70B 2COZA 2QQAA 4C0DC 3P8YA 4YRNA 1SSHA 2CUBA 4EMKA 4XTZA 3CC2Q 4UPAA 1R8OB 3JCMd 4P72A 4J9HA 1NJ8A 1HD3A 2CREA 2F5TX 2HL5C 4A4FA 1YI2T 3A8LB 2JXBA 2NUZA 5LJ5e 3TVTA 3CCMA 4NCXA 1TUGB 2E5KA 2K7AA 5GJWB 1AOJA 1I1JA 4DBHA 1Q95G 1ZSZB 2CP3A 3HRTA 5CKHA 3H9NA 4LNPA 3A8MB 5I2MA 4JRPA 2DILA 2X9HA 1KD1R 1B34A 2E3CA 2OI3A 2F2WA 2FRWA 2W10A 1QQJA 1NYGA 2IIMA 3BJUA 3QNEA 4PL6A 3CCEQ 2WSFE 1P92A 2D9TA 3JRZA 1IXDA 2X35A 4P71C 4YCWA 2QQRA 4M75G 1M90R 1EVKA 2ZZEA 5EC7A 3EH1A 4N0AA 5IH2A 4M78F 1RABB 3VU3C 1VQ6A 5GAOm 2NYSA 2FRYA 3G1ZA 2ZPEB 2FPFA 3P8TA 2H8HA 3CPFA 2J6KA 2CP7A 3JB9G 2EIFA 3OS0A 4OB1B 1WXBA 1O75A 2EVRA 1IL2A 2CUDA 3PVLA 3CD6T 3OYYA 2DM1A 5FU6C 3G7ZA 2E5AA 1GCPA 2DXUA 2J05A 3SHWA 5FRMA 4JPBW 1OQKA 4FYYB 4RCBA 2LX9A 4L5GA 3HFZA 1VQKA 3VS2A 1YHQT 1SG5A 3CMEA 1YJNA 2DXCA 2FVUA 3OD1A 3ASKA 1X6OA 5GJVB 2RF0A 5LL6S 2EQUA 1J3TA 5KE3A 4E7JA 5EG2A 2VASA 1ZSZA 1UGQB 3RACA 1YJ9T 3CCST 5K1PA 3OYMA 1W6XA 4LVJA 1GCQC 4ZTFA 1FWZA 2DK3A 2XI9A 2QI2A 4GLMA 4B9XA 4ELZC 1YJWA 4CS2A 3H6ZA 4RMFA 1U3OA 4BACA 4E6RA 1ZBJA 3J81E 3LWIA 2LCLA 3DLMA 3C12A 3LLRA 3SWNA 3J7AF 1X2KA 4JLGA 1BI2A 3EHRA 3A1PA 4JRIA 4F17A 1YGBA 4QT7A 3CC7T 1KQ1A 4JJDA 1BIBA 2KYBA 5C52B 4PLIA 4RDXA 2VWFA 1WXUA 5KYXA 1G51A 2ZT8A 1Q86U 4HWSA 1AWXA 2O4XA 3FRNA 3SB2A 1WA7A 1EVLA 1BIAA 2JJ9A 2YLBA 1N5ZA 1PC0A 3KFUA 3IG2A 3AHUA 2NWMA 2QHUA 4H2UA 1RL2A 1FYFA 3TSZA 2JMCA 1B70A 2MK5A 1NEGA 4YP0A 1QCNA 1E1TA 1U5SA 2JOYA 4EMGA 3FLGA 1KHIA 2V8JA 3CBPA 4N0AC 2VGMA 3LSQA 3RUXA 2MWPA 4X34A 2V1RA 1VQ7A 1SSFA 1LYLA 3I7FA 4OVAA 1BI1A 1TXQA 3IALA 4YRGA 2VC8A 2RQVA 2DAQA 1C1AA 1VYVA 5GMKj 2RQWA 3ER0A 2L3PA 4CS4A 2I4NA 1ZUYA 3CMQA 2ZGWA 4FL6A 3X20B 3OYJA 2EQJA 4K86A 1QKXA 2XG8D 4L59A 2CH4W 2RHUA 1Z7NA 3TREA 1VQKQ 1B7YB 2FZKB 2YUNA 3UA7A 2K9GA 1U1SA 2DL3A 7AT1B 2VVKA 1HYOA 1BKBA 3CBMA 4Q15A 1T3SA 2BKDN 2ZR3A 3MF2A 1S1NA 3GP8A 4JJCA 2E12A 1D1CA 3M9QA 3P8DA 1Y96B 1W70A 2C7IA 1YP5A 2P0PA 4CC3A 2XDDA 2AKWA 5LJ5g 1JRIA 1HC7A 4Y28E 2XGTA 5LJ3f 1UJYA 5HGQA 2XKOC 4BW9A 2YRDA 5CKDA 4IUPA 4FYXB 1G3WA 2X3XD 3TSWA 4M7AG 6AT1B 1R77A 2J6FA 1YHQA 3C94A 3M0UA 2JM9A 2DTIA 2EGAA 3UA6A 5AYFA 4PFOA 5L23A 2NUTA 5LJ3e 4K88A 3I55T 2JVVA 2RQUA 2CJBA 4YCUA 4IUVA 2ZXFA 3O8VA 2J7IA 5AT1B 2J6OA 2GTOA 1RAFB 2CP0A 1VQZA 1Z7MA 1YI2A 1JJ2S 4YRPA 2MCNA 2V1QA 2DZ9A 2K3YA 1I5OB 1XOVA 2K5FA 2SRCA 1IREB 3M4QA 2CIMA 4G84A 2EKOA 2CJAA 1JO8A 2F2VA 4P73A 3KUFA 3L42A 3OS2A 3TEHB 2GQIA 1E6HA 1VQ8T 3G6EQ 4MDXA 2LMJA 1X55A 4FIBA 4M7AC 3OB9A 4XTXA 2CZ7B 2EGCA 2QDYB 4XU0A 2PZ1A 2DL7A 4YRIA 1E1OA 4OMPA 2JMAA 4N4GA 2IG0A 1NLOC 3CC4T 2OTJT 4E2FB 3NELA 3HL8A 2DIGA 5GAOp 4UP8A 5FU7B 4EMKB 3CMAQ 2D0NA 1VQ9T 4EX5A 3I56T 4EPCA 3M57A 3HRKA 1VQOT 2LX7A 3HXXA 1GGMA 3M55A 5GAOr 4M7DF 3CMET 2QASA 1HSQA 4FT2A 1EIFA 2ECZA 2KXCA 1G5IA 4H2TA 1KD1C 2D0QB 1JQQA 1PKTA 1WHLA 4AG1C 3TEEA 2Y4XA 1UHFA 4M75C 4DEXA 3CCVT 1H8KA 4WI1A 2VXFA 2A36A 4QVZA 2AKKA 2DBKA 1BU1A 3O5ZA 3TUPA 3CCRQ 4LUDA 1X43A 5GMKh 1WLPB 2LVMA 4H2VA 5D6YA 3CPWP 2ZT6A 1RAIB 1C6VX 3HFZB 4J9BA 5GAOq 3MEYA 1KG1A 2ARTA 2C06A 4M77D 3QSUA 1L0WA 1WX6A 4DEYA 4VUBA 2QEXQ 4YTLA 4M75D 2QGFB 1OI1A 4MZTA 3CCUQ 2YSQA 3LW5E 4Y91A 3M0RA 4HT9A 5KE2A 2ZPFB 2HL3A 4J9DA 4C8QC 1GL5A 2HNIA 3TEHA 4QVDA 3CCQQ 1YJ9A 1GCQA 4P74C 2PTKA 1T0JA 1VQ6Q 1PWTA 2KVQG 1M2VB 3RMQA 3DB4A 1OZ3A 1VQMT 2XHCA 2Y90A 1ZA2B 4E47A 2OTLQ 5DLOA 3HXYA 1M1GA 3VJPA 2KNBB 2DETA 3QJYA 1QMCA 2O9SA 3EG9A 1Z9QA 3NGPA 4JRKA 4FSXA 1EX4A 3EGDA 1Y96A 3LH5A 3HSBA 1R0CB 3VYHB 4C8QE 4JS4A 3L4GA 2JW4A 1OV3A 3LC0A 3WXMB 1HXDA 1VQ7T 3UT1A 3RR6A 1CKBA 5GANd 4TQFA 1LOJA 1C0MA 4PFZA 2M02A 4E7ZA 1BCOA 1SHFA 4LVMA 3TEGA 3OYHA 4WCIA 1O9SA 1VQ5A 4KGVB 2E65A 2LJ3A 1ZUUA 4JLIA 3RBBB 4TTVA 3RF1A 5A0DA 4BI4A 4JJNK 2E10A 4J5YA 4HCZA 3JCMQ 1SEMA 2L3SA 1KFZA 2A28A 4R0KA 4F7UE 1V29B 1TUCA 3EG0A 3ZL7C 3QWXX 4A63B 2I2LA 3MEAA 3VRYA 3LH0A 4M75F 3S6WA 3QYHB 2FPDA 3EGDB 4NOYA 2ALYB 1E22A 4PJOC 2YUOA 3SEMA 1YITT 5GMKl 2XDBA 2GBQA 3UDCA 3FEOA 3EG3A 3CCRA 4ZTUB 3QZ9B 9ATCB 4M77E 3E9IA 1MV0B 1ABQA 2C8MA 2EYYA 4J9IA 4B9WA 2MPXC 2CSIA 5DLQE 4C92G 1PD0A 3JB9F 2KRSA 4E7SA 1U8RA 1VQPQ 5GAN8 3OMGA 1A0NB 1BCMA 1YCYA 3I5SA 1LPLA 2R58A 3QWYA 2O31A 5D6XA 4M7AA 4J7FA 4Q5WA 4O2DA 4X9CA 1YIJA 4EMKC 3A8HB 2ZNIA 1I5LA 2KGTA 5KYYB 1USYA 4C92F 3UFGA 2HMAA 1K1ZA 1YFSA 1QVGA 2G4CA 1X2HA 2NUTB 1UFFA 5GAOl 3QTCA 1TG0A 2ZPBB 3NTHA 5KCOA 2OJ2A 1RAHB 2DX1A 2E4HA 1VQ8A 3BE3A 1YJNQ 1E24A 1YHQQ 5HKCA 4HVUA 1H4QA 2P0QA 4D8DA 4C5HA 1ZSGA 3MEVA 2JTFA 2VXEA 5KYYA 1ATIA 2YXYA 5ECAA 4GY5A 2ZZFA 1JB0E 2EYZA 5GAMd 3A98A 2DIQA 3H0HA 1JJCA 2HQEA 2ROLA 3OBWA 1RLQC 1Y71A 3HTRA 1UTIA 1Y07A 3JSCA 4XU3A 4BWAA 3L1AA 2P0KA 1BBWA 2ROTA 4DBRA 3MKDA 5LJ3h 2HSEB 4ME7A 3PVQA 3MHXA 1SERA 3REXA 1NZ9A 3FJPA 1M27C 3A7AA 4OB0B 2L3QA 1M3BA 3U23A 4GLKA 3SDZA 3SFMA 3IKLA 4Q6GA 4QQDA 3Q1JA 2CDTA 3OY9A 1N8RC 1MV3A 4XEMA 2QTVA 4XTUA 2ZIMA 3HHTB 1D0YA 5M9OA 3V8KA 1VQLT 2OTLA 4M7DB 4H02A 1YITQ 1PHTA 3VKIA 3CCEA 2RM4A 1QWEA 2QAZA 2RJEA 4MZMA 3VBBA 3L4GB 2K3XA 3I56A 2MMPA 3L2RA 4BDYA 3SD4A 3G4SA 2E41A 1ADJA 4CH3A 2P5IA 3G71Q 5FW9A 3OYIA 2Q7HA 1GXIE 1SESA 3C95A 4KGZB 1E6GA 4OB2B 1RAGB 4X9DA 2EPDA 3CCJQ 4PJOD 1GBQA 5FROA 1VIFA 2LQNA 2QEXT 4TQDA 5E3IA 4A4HA 1OYXA 2DNUA 2VV5A 3KXTA 4OP0A 3CPWA 4C5GA 2PUKB 3A5YA 1KC8U 4JRQA 1TU0B 4RQFA 4QW2A 5CR2A 4XTWA 2K3BA 2BE9B 2IVWA 2KI7A 2HQHA 4LDYA 3OYEA 1WNLA 3NHNA 1ZUKA 2AZSA 3UATA 2ABLA 3HP9A 4ZN3A 1AZEA 1LNXA 2RHYA 2KXDA 1X56A 2O2OA 1U1TA 4M75E 4C92B 2J3LA 5HK3A 1YCSB 4P74A 1WPYA 2DVJA 4PJOB 3CD6Q 3OSSC 1K4US 1NJ5A 1IHWA 1WJSA 3E9HA 4F7UG 2CJ9A 2HEQA 4XTVA 1N9WA 3X28B 3WQZA 2RA2A 8ATCB 2KDSA 1VQNT 3QBYA 4YRSA 5CKEA 1NYQA 4LDVA 3EHQA 3HTZA 2KK4A 2AIRB 5GAN2 5C6SA 5GANg 2G3RA 4OMOA 2RHQA 1M90C 1NNHA 1W1FA 1UB4A 1X2QA 4M78A 3OA6A 4WF2A 1UECA 1NJIC 3CC4Q 2OTJQ 5GAMg 1PRMC 3HFVA 3QO7A 3HRIA 1EIYB 11ASA 3A5ZA 1UGSB 4KUIA 4KH1B 2WSCE 4R56A 1JEGA 4PJOA 4A53A 1YFNA 2IY5B 1YIJT 1X27A 1WYXA 4HCBA 2C0OA 4JZ3A 4E51A 1VOMA 4YRCA 1Q7YC 12ASA 5IT9E 2K2MA 2MI6A 4EDUA 5GAMj 1E7OA 2V26A 3REBB 3OYAA 3JCMg 3CD6A 3JB9D 4AFQC 3HXVA 4J9CA 3CC7Q 1KD1U 4PJOE 4DPGA 1G5HA 4H2XB 3AT1B 4ORZA 3URGA 2D8HA 2CP5A 1D1BA 2MIOA 1NYRA 1WGSA 4TVYA 2ARSA 4HCKA 3OYBA 2RHZA 3I9QA 1M30A 4M7DG 4BI8B 1YITA 3V7SA 4MMLA 1YBYA 1SRMA 3QDRB 3ICAA 3LGFA 3MO8A 1KIKA 5IHNA 3M4GA 3X25B 2DJQA 3JB9J 3UH0A 1N9RA 2D6FA 1ACMB 1Y0MA 3I56Q 4XEOA 2DJZA 4HWRA 4IUUA 4YRMA 3INZA 3GNFB 2NLUA 3S3MA 2AK5A 2EW3A 3VS5A 5GANf 1Q86R 2KRMA 3CCJA 1VQ6T 1ZQ1A 4E7HA 5CKBA 1I8FA 1WFWA 4LNSA 4KRTA 4IUTA 1RACB 2M1HA 2BE7D 4J15A 1S72T 1UJ0A 1VQLA 2EJ9A 2OTLT 1SRLA 2ZINA 1BBUA 2PNIA 4YRTA 1WXTA 4TWAA 4YPFA 2YDLA 2ZCEA 3EFSA 2GCXA 1UGRB 4LVKA 3CEYA 1WHKA 1KQSP 2GQVA 3PCOA 2DQ3A 1RI0A 1C0AA 2ZPIB 1Q82U 5GAN4 2CSQA 1TUDA 1TH7A 1WHHA 2DRKA 4J9EA 2QEXA 1NJ2A 3L2VA 4Z89A 4RQEA 3CBOA 3H41A 1ZLMA 4FT4A 4F7UB 2R5MA 2E3HA 2VB6A 1TOVA 2QGGA 4A4EA 2DEQA 2ENMA 3M5AA 8AT1B 5GMKi 4HCCA 5GANh 2EYQA 2RHIA 3CCLT 5GAN7 4DQ2A 1QVFS 4FU6A 1X6BA 1EOVA 3DLLA 4ZGDB 4P73C 2LQKA 1FYNA 1ARKA 3RIRA 3F70A 1X69A 4ZGJB 2QA4A 3MP1A 2ZAEA 2A3LA 1MNDA 4J6YA 3NEMA 2X4JA 2PMFA 4QQGA 3RKYA 3J80E 3CC2A 3N5BB 3G71T 3GOXA 2MAMA 3JCMX 2DERA 1PG5B 2QHSA 3FJ5A 2Q7EA 2G6FX 3VQVA 2EQKA 2AKLA 3OYCA 1I81A 2LJ1A 1N8RR 1RI9A 2GTJA 2RHSB 1IO6A 2DL8A 4FYVB 3PZCA 2OAUA 4CH4A 4KH0B 1HK9A 4TVRA 1UGVA 4OF1A 3P8BB 4H2YA 5C53B 2OAWA 2RQRA 3FC3A 4PLLA 3NMZC 3G6ET 1Y7XA 4TVWA 4G85A 3KBGA 1VQNA 1G8XA 1QCFA 1WJQA 4J8OA 4JS5A 4BE2A 4FW1A 4PJLA 1MMDA 2LCSA 2Q7GA 1QF6A 1XTDA 1K73U 5KYUA 5J26A 4R55A 2DEUA 5I22A 2FEIA 2ZCFB 1I07A 1QW1A 1NJ6A 2ZR2A 2LP5A 4X1VA 2QYZA 5D7UA 1VQ5Q 2RD1A 2ZPHB 3C0CA 1Q7YU 1WU7A 1AVZC 4DBQA 3L2ZA 4OMFB 3OYFA 2KMTA 1FMVA 3CCQT 2EFIA 2MYSA 1B7TA 2XU8A 3RL6A 1G3SA 1MMGA 3OMCA 5FWBA 1KOGA 4EMHA 1QVFA 3HXUA 2NUPA 4K11A 3R07A 1ABOA 1DJ7B 1LJOA 1KSWA 1I4K1 3PE0A 2L0AA 3M54A 4LDUA 2RK2A 1VQOA 2DA9A 1JJ2A 2XICA 4OB3B 2DKGA 2ZIOA 1G3TA 1WZOA 2EWNA 3VV0A 1J5WA 5GAMf 4DA4A 4PHCA 1T0HA 3A31A 4XU1A 3E9GA 1M1KR 2LDMA 2SEMA 3ULRB 2DXTA 3EGXA 5F5WA 5I21A 2FG0A 2CZ1B 3M58A 3EG9B 5LJ3g 5LJ3d 1Q81R 2KT1A 4HVVA 3CCMQ 2FL7A 1NYFA 3GPLA 3BFMA 2DD4A 1W2BP 2L2PA 3R6NA 5C0MA 4J6XA 3VUZA 1LCKA 1B7YA 1K76A 3HFNA 2P4TA 3M0TA 3A7RA 1WQ7A 2GGRA 2RN8A 4AFUC 3EG2A 2M0YA 1TTHB 4AG2C 2F1LA 3FDRA 1H4VB 1WI7A 2DXBA 4C0FA 4C92C 3EG1A 4DOVA 1UUEA 2X51A 3V7CA 1WHJA 2P0LA 1H3ZA 1B3QA 4D6WA 3L2QA 1M2OA 2JNGA 2KRNA 2CZ0B 2RHQB 2YUPA 1WIEA 3H8ZA 1M4ZA 4C5EA 2Z0WA 1S72A 2ZPGB 4LN2A 3JB9H 3JCMJ 2OX7A 2C0TA 4L87A 2K57A 3CCLQ 2QXFA 1QCOA 1GRIA 2JS2A 2DBMA 4KQEA 2BUDA 3IKMB 4JUVA 1RLPC 3PGGA 3GF5A 1M3CA 2K6DA 1NM7A 4KGXB 4PK4A 4YRKA 4H2WA 4CH5A 1W4SA 1Z9ZA 1NJ1A 2HQXA 3DB3A 1IRXA 3RNJA 3NFCA 2LT1A 4AH6A 1AD5A 2O01E 4XK8E 2KROA 3MEWA 1QP2A 3G1JA 1X2GA 4E7KA 3M0PA 1BK2A 5DM7R 1N6AA 2JZ2A 3OW2P 2JUFA 3T9NA 3RERA 1QE0A 1ZSZC 3CC4A 2OTJA 4L6V5 2ZNJA 3M4YA 4C5IA 1RADB 1D3BB 1JXOA 1VQ9A 3PT9A 4YRRA 3CXCP 3MJXA 5HY6A 2M16A 3C4SA 2LZ6B 2A8EA 1MGQA 4Z88A 4ZN1A 4FW2A 3S3OA 4GBQA 4TVAA 2YRCA 4PG3A 2K79A 2KYMA 3DKMA 4OGCA 3CCJT 3HPWA 2RI5A 4M4ZA 2YLCA 2LNHB 2ZTGA 1H3HA 3DSQA 4BY6B 3NENA 4FYWB 2RH2A 3OSVA 2HD0A 2YUQA 1M1KU 1KHCA 3RKWA 3RKXA 3VS6A 1ZBXA 4JJBA 3FIFA 2Q5IA 3MCAB 1QWFA 2C0IA 2JT4A 2W0ZA 4PJJA 3EH2A 2ODRC 1VQLQ 4BE1A 1NG2A 3PFSA 2QA4Q 4F7UF 2LC4A 4LE9A 3HXWA 2KE9A 4P3OA 4D8KA 1YJWQ 3A74A 2DVEA 3OW2A 1M5Q1 1AT1B 1SETA 4WTOB 2RPNA 2HZYA 5D6WA 1K9MC 5GAN6 5L8RE 1K8AR 2DLPA 1FXXA 4M77C 4HT8A 4YCVA 2FPEA 4KBMB 1YFTA 3UGTA 2DF6A 4MZPA 4ZTZB 3P8HA 2D1XA 3OQ5A 3ZBDA 4RTYA 5A0LA 2D8JA 4NL2A 1VQMA 2EJFA 2CT3A 3THKA 2J3MA 1H4TA 1M1FA 2ATCB 3CCMT 2EBPA 3EFRA 3G71A 2DO3A 3VRZA 2LNVA 4RKUE 4J7IA 1EFNA 3I5RA 2DL4A 4XU2A 1PD1A 1AHJB 3OYDA 3UF4A 2ODRD 2A7YA 1B07A 2O9VA 2X4YA 1OZ2A 4HA8A 4ZTJA 1VQ7Q 3JCMV 4M7AE 4C8QD 1W66A 1RUWA 1KQSA 4CRIA 2R5AA 1RAAB 1KK7A 2DD5A 2PVOB 4P5NA 3D7SB 1N8RU 4M7AD 1TS9A 2ED0A 1BI0A 1T3LA 2MF2A 3L2UA 4YRLA 4OMLA 5GMKe 4J6WA 2AKWB 4E7LA 2RJFA 2HKNA 4BUGA 2QK0A 5KYUB 3GIBA 3NETA 1WDXA 4P71A 2ZT5A 1EFWA 2JM8A 1H92A 1D0XA 1IGUA 3PMIA 4KR2A 4M7DD 2YT6A 2KSSA 3HRSA 1M2VA 3HY0A 2IPOB 4NS5A 1WHGA 2DYBA 2O88A 4PJNA 4F7UA 1MNEA 2HDAA 5I2SA 2FZGB 3JCMh 4C8QB 4HT4A 3VS1A 2BZ8A 4WJ4A 1GFDA 5IHIA 1YN8A 2DMOA 5FRNA 4HWPA 3CC7A 1VYTA 2X3WD 2PU9B 3EAEA 4OGEA 2EQIA 1X6GA 4M77A 1WYDA 4M77B 1X75C 4ANJA 4ATOA 3JCMW 2KY9A 3QO3A 5GAMh 1PCXA 3BY7A 1SHGA 1N9SA 3LYIA 4OMMA 1NPRA 3NPFA 2PVDB 3H0FA 4OLFA 3VS3A 4P3PA 1VQ9Q 5A0GA 1NLPC 3CMEQ 2H3EB 5GAMe 1VIEA 4EIKA 1Q81U 1ASYA 2LT4A 3RMSA 3GLXA 3L2WA 3MP8A 2E6ZA 2RI3A 2QQBA 3A8GB 4PKCC 3UGQA 2RHXA 2HKQB 3QJ6A 4KULA 2XDPA 2AT1B 1ZX6A 2DTHA 1X01A 2E6NA 1YWPA 2LRQA 1YNZA 1W2BS 4BB7A 2B8AA 1M9SA 4P3NA 3HXZA 4IIMA 1K9MR 2A37A 1MMNA 2DTOA 1H641 2KBTA 5FLXE 2EGEA 2QG9B 5LJ5h 5ELOA
chains in the Genus database with same CATH topology
5CK9A 5CQYA 4MDWA 1SRYA 2DU5A 3M56A 3PCOB 1VQ4T 4ZIBA 5CCAA 4M75B 4YYEA 1BI3A 4M75A 3OYKA 5A2QE 3A7UA 4A4GA 2I4MA 2E1HA 4QQ6A 5IAYA 2XTIA 3BDLA 3OBYA 3WVEB 5CO7A 1KQSS 3UWNA 3ME9A 3I55A 5LJ5d 3V7RA 3G4ST 2RJCA 2GFUA 2EJGA 1BYMA 3FB9A 4LVIA 3QHSA 2QHTA 2ZZGA 2YHTA 4YRFA 2AMCB 2E70A 2PUOB 5GANe 4A4KA 2V8KA 2L3RA 4FM4B 4XAXB 2QHVA 1WLEA 1RIQA 4P72C 4LD6A 4M77F 2QQ9A 4N4HA 2RHSA 5CVIA 4ZGEB 5ELNA 4HWTA 4C0GA 5CQXA 1QVPA 1Q81C 3VQWA 3SWNC 1Q82C 4M77G 4IURA 4WJ3M 3QXEB 5KCHA 3BW1A 1PYSA 1YFRA 3X26B 3PTAA 4C92E 3NTKA 3TCJA 1JJCB 2KQWA 2V8IA 4JDSA 3MEUA 4EO4A 1PSEA 4M78G 1K8AC 3PMTA 3HRUA 3LWHA 4M78C 4UC4A 2VUBA 3CMAA 3ZEHA 3GNGA 2VGNA 3HFOA 1KMMA 3CXCS 5KH6A 4RCCA 5HK0A 4X5OA 1MHNA 3JCMP 2L8DA 4HVCA 4O5VA 3CCVA 4ELYC 3RESA 1EQRA 4LVLA 1B76A 1JBMA 4Z02A 2QTXA 2NS6A 2F69A 3OYLA 2LCCA 4MMKA 1X54A 2ZT7A 4H2SA 3BDUA 4HWOA 3M53A 1WJRA 3JAME 3REUA 4II1A 3CC2T 3QPHA 1IZ6A 4CS3A 2Y4YA 4C8QA 4BE0A 3QO8A 4P75C 3JCMe 1ASZA 4IKFA 4V2SA 2JN0A 2EAYA 1B34B 4CI0C 3QIIA 4KUDK 4H2XA 2LQ8A 1UGPB 2CKKA 1FX7A 3JCMf 2M9UA 5IN1A 1NE8A 4M7DE 3OYGA 4KR3A 1VQ4A 3A8OB 1XNIA 3LSSA 4C92D 1USYC 1KC8C 1G3YA 3A5ZB 2HBPA 4KT0E 4UP9A 2RO0A 5K1XA 3VQXA 4RG8A 2DZCA 4YROA 3CCQA 2RB6A 2CYZB 2GF7A 4M7DA 3E1SA 3CCUA 2QA4T 3JB9I 1D3BA 1M90U 3OW2S 1VQ5T 4IUQA 1XQHA 4CH6A 4YRQA 3HY1A 2K5IA 2KAFA 1KQ2A 4HKEA 3NTIA 1EIYA 2ALYA 4C0ZA 2DQ0A 4DOWA 3QYGB 2FHDA 1PYSB 5FU6B 3X24B 3E9FA 3M4PA 3G6EA 3CCLA 3W3SA 3E19A 2FB7A 3MF1A 5GAN5 2CS7A 1G5VA 4BD3A 2CGHA 1VUBA 2O4XB 2DPPB 5GAOn 3MP6A 2DDZA 2ZZDA 2K4YA 4TVAB 1VQPA 4QVCA 2H3JA 2I4OA 2E5QA 3V8LA 1YJNT 4RG2A 3OS1A 5FU7C 3SWNB 4BY6C 2EQMA 3LX7A 2RK1A 5C51B 3M59A 3CCRT 5LJ3j 1ZHIA 4P75A 4M7AF 2YRVA 4PJOF 4NL3A 2WSEE 1H4SA 4E7IA 3TU4K 3RGLA 3VYGA 2R57A 3VQYA 3PNWC 2F5KA 3WVDB 1YJWT 1M8VA 5J3BA 1QP3A 3META 1YB3A 5GAN3 1VQKT 4PJOG 5J39A 1PSFA 2LTOA 4M7DC 1NPPA 5CIUA 1NJIU 1QVGS 4J83A 4C0DB 2E64A 2AMCA 3V8JA 3QZ5B 2WACA 4LD9K 2PQWA 3CCET 2DU7A 3QO5A 3MQZA 3QG1A 2AHJB 1K8AU 3LGLA 1HTTA 4PNOA 3CMAT 4RMOA 2JTMA 3R6OA 3QKJA 3JCMc 5LJ5f 5CKFA 2PVGB 2VYTA 2L5QA 1B8AA 2CZ6B 4LDXA 2K2VA 3HKSA 3OS5A 2RI2A 3PIOA 2EL9A 1ADYA 4M78B 2XK0A 3QUIA 3ZFJA 4YREA 4XTYA 1Q86C 4N4IA 3A32A 2RJDA 2XIDA 1UEBA 4UP7A 2BIVA 5LJ5j 1N27A 4LDWA 4BDZA 5GANj 2Q5HA 1KMNA 3OYNA 5GMKm 2L89A 4A54A 3VUBA 4C8QG 2MWOA 1W2BA 2FYKA 3CCSA 2K5LA 2I4LA 1WQWA 2PMEA 4O6JA 3CXCA 1K9MU 2HAXA 4M78D 2QQSA 2ARUA 3P8VA 3UPUA 4C8QF 3PIPA 2IY5A 4YRJA 5KNNA 4YDQA 2X4XA 4M78E 4K87A 3CPWS 5DY9A 5CAIA 2GFAA 4M7AB 1VQPT 2M0OA 4BI3A 2X4WA 4XQ3A 3S3NA 3JCMb 1M1KC 1K73C 3ERRA 3CCUT 2XD0A 4C92A 1B70B 2QQAA 4C0DC 3P8YA 4YRNA 4EMKA 4UPAA 4XTZA 1R8OB 3JCMd 4P72A 1NJ8A 2F5TX 4A4FA 1YI2T 3A8LB 4NCXA 5LJ5e 3CCMA 3HRTA 5CKHA 3A8MB 5I2MA 4JRPA 1B34A 2E3CA 3BJUA 3QNEA 4PL6A 2WSFE 1P92A 2D9TA 3JRZA 2X35A 4P71C 4YCWA 2QQRA 4M75G 1EVKA 2ZZEA 4N0AA 4M78F 3VU3C 1VQ6A 5GAOm 3G1ZA 2ZPEB 3P8TA 3CPFA 3JB9G 2EIFA 3OS0A 4OB1B 1O75A 1IL2A 3CD6T 3OYYA 5FU6C 3G7ZA 2E5AA 2DXUA 5FRMA 4RCBA 2LX9A 4L5GA 3HFZA 1VQKA 1YHQT 3CMEA 1YJNA 2DXCA 2FVUA 3OD1A 3ASKA 1X6OA 5LL6S 2EQUA 5KE3A 4E7JA 5EG2A 1UGQB 3RACA 1YJ9T 3CCST 5K1PA 3OYMA 4LVJA 4ZTFA 1FWZA 2DK3A 2XI9A 2QI2A 4B9XA 4ELZC 1YJWA 4CS2A 3H6ZA 4RMFA 4BACA 3J81E 3LWIA 2LCLA 3DLMA 3C12A 3LLRA 3SWNA 3J7AF 4JLGA 1BI2A 4JRIA 1YGBA 3CC7T 1KQ1A 1BIBA 5C52B 4PLIA 4RDXA 1G51A 2ZT8A 4HWSA 1Q86U 2O4XA 3FRNA 3SB2A 1EVLA 1BIAA 2YLBA 3KFUA 3IG2A 3AHUA 2QHUA 4H2UA 1RL2A 1FYFA 1B70A 4YP0A 1E1TA 2JOYA 4EMGA 3FLGA 1KHIA 2V8JA 3CBPA 4N0AC 2VGMA 3LSQA 3RUXA 2MWPA 4X34A 1VQ7A 1SSFA 1LYLA 3I7FA 4OVAA 1BI1A 3IALA 4YRGA 2VC8A 2DAQA 5GMKj 3ER0A 4CS4A 2I4NA 3CMQA 2ZGWA 4FL6A 3X20B 3OYJA 2EQJA 4K86A 4L59A 2XG8D 2RHUA 1Z7NA 3TREA 1B7YB 1U1SA 1BKBA 3CBMA 4Q15A 2BKDN 2ZR3A 3MF2A 3GP8A 2E12A 3M9QA 3P8DA 1Y96B 2C7IA 2P0PA 2XDDA 2AKWA 5LJ5g 1JRIA 1HC7A 4Y28E 2XGTA 5LJ3f 5HGQA 2XKOC 4BW9A 5CKDA 4IUPA 1G3WA 4M7AG 1YHQA 3C94A 2DTIA 5AYFA 5LJ3e 4K88A 3I55T 2JVVA 2CJBA 4YCUA 4IUVA 2ZXFA 3O8VA 1VQZA 1Z7MA 1YI2A 1JJ2S 4YRPA 2DZ9A 2K3YA 1XOVA 2K5FA 1IREB 3M4QA 2CIMA 4G84A 2EKOA 2CJAA 4P73A 3KUFA 3L42A 3OS2A 3TEHB 1VQ8T 4MDXA 1X55A 4FIBA 4M7AC 3OB9A 4XTXA 2CZ7B 2QDYB 4XU0A 4YRIA 1E1OA 4N4GA 2IG0A 3CC4T 2OTJT 3NELA 3HL8A 2DIGA 5GAOp 4UP8A 5FU7B 4EMKB 1VQ9T 4EX5A 3I56T 4EPCA 3M57A 3HRKA 1VQOT 3HXXA 1GGMA 3M55A 5GAOr 4M7DF 3CMET 4FT2A 1EIFA 1G5IA 4H2TA 1KD1C 2D0QB 3TEEA 2Y4XA 4M75C 3CCVT 4WI1A 2VXFA 4QVZA 3TUPA 5GMKh 2LVMA 4H2VA 5D6YA 2ZT6A 3HFZB 5GAOq 3MEYA 1KG1A 2ARTA 2C06A 4M77D 3QSUA 1L0WA 4VUBA 4YTLA 4M75D 1OI1A 4MZTA 3LW5E 4Y91A 4HT9A 5KE2A 2ZPFB 4C8QC 2HNIA 3TEHA 4QVDA 1YJ9A 4P74C 2KVQG 3RMQA 3DB4A 1OZ3A 1VQMT 2XHCA 2Y90A 4E47A 5DLOA 3HXYA 1M1GA 3VJPA 3QJYA 4JRKA 4FSXA 1Y96A 3HSBA 3VYHB 4C8QE 4JS4A 3L4GA 3LC0A 3WXMB 1HXDA 1VQ7T 3UT1A 5GANd 4TQFA 1LOJA 4LVMA 3TEGA 3OYHA 1O9SA 1VQ5A 2E65A 4JLIA 4TTVA 3RF1A 5A0DA 4BI4A 4JJNK 2E10A 4J5YA 4HCZA 3JCMQ 4F7UE 1V29B 2I2LA 3MEAA 3LH0A 4M75F 3S6WA 3QYHB 4NOYA 2ALYB 1E22A 4PJOC 1YITT 5GMKl 2XDBA 3UDCA 3FEOA 3CCRA 4ZTUB 3QZ9B 4M77E 3E9IA 2C8MA 4B9WA 5DLQE 4C92G 3JB9F 1U8RA 5GAN8 3OMGA 1YCYA 2R58A 5D6XA 4M7AA 4J7FA 4Q5WA 4O2DA 4X9CA 1YIJA 4EMKC 3A8HB 2ZNIA 1I5LA 1USYA 4C92F 3UFGA 1YFSA 1QVGA 2G4CA 1X2HA 5GAOl 3QTCA 2ZPBB 3NTHA 5KCOA 1VQ8A 1E24A 5HKCA 1H4QA 2P0QA 4C5HA 3MEVA 2JTFA 2VXEA 1ATIA 2ZZFA 4GY5A 1JB0E 5GAMd 2DIQA 1JJCA 2HQEA 3OBWA 1Y71A 1Y07A 3JSCA 4XU3A 4BWAA 3L1AA 2P0KA 1BBWA 5LJ3h 4ME7A 3MHXA 1SERA 3REXA 1NZ9A 3FJPA 3A7AA 4OB0B 4GLKA 3SDZA 3SFMA 3IKLA 4Q6GA 4QQDA 3Q1JA 3OY9A 1N8RC 4XEMA 4XTUA 2ZIMA 3HHTB 5M9OA 3V8KA 1VQLT 2OTLA 4M7DB 4H02A 3VKIA 3CCEA 2RM4A 2RJEA 4MZMA 3VBBA 3L4GB 2K3XA 3I56A 2MMPA 3L2RA 4BDYA 3SD4A 3G4SA 2E41A 1ADJA 4CH3A 2P5IA 3OYIA 2Q7HA 1GXIE 1SESA 3C95A 4OB2B 4X9DA 4PJOD 5FROA 1VIFA 2QEXT 4TQDA 5E3IA 4A4HA 1OYXA 2VV5A 3KXTA 4OP0A 3CPWA 4C5GA 2PUKB 3A5YA 1KC8U 4JRQA 4RQFA 4QW2A 5CR2A 4XTWA 2IVWA 4LDYA 3OYEA 1WNLA 3HP9A 4ZN3A 1LNXA 2RHYA 1X56A 1U1TA 4M75E 4C92B 2J3LA 5HK3A 4P74A 1WPYA 4PJOB 3OSSC 1NJ5A 3E9HA 1WJSA 4F7UG 2CJ9A 4XTVA 1N9WA 3X28B 3WQZA 2RA2A 2KDSA 1VQNT 3QBYA 4YRSA 5CKEA 1NYQA 4LDVA 3HTZA 2KK4A 5GAN2 5C6SA 5GANg 2G3RA 2RHQA 1M90C 1NNHA 1UB4A 4M78A 3OA6A 4WF2A 1NJIC 5GAMg 3HFVA 3QO7A 3HRIA 1EIYB 11ASA 3A5ZA 1UGSB 4KUIA 2WSCE 4R56A 4PJOA 4A53A 2IY5B 1YIJT 4HCBA 4E51A 4YRCA 1Q7YC 12ASA 5IT9E 2MI6A 4EDUA 5GAMj 3OYAA 3JCMg 3CD6A 3JB9D 3HXVA 1KD1U 4PJOE 4DPGA 1G5HA 4H2XB 3URGA 1NYRA 1WGSA 4TVYA 2ARSA 3OYBA 2RHZA 4M7DG 4BI8B 1YITA 3V7SA 4MMLA 1YBYA 3QDRB 3ICAA 3LGFA 3MO8A 3M4GA 3X25B 3JB9J 3UH0A 1N9RA 2D6FA 4XEOA 2DJZA 4HWRA 4IUUA 4YRMA 3INZA 3GNFB 2NLUA 3S3MA 5GANf 3CCJA 1VQ6T 1ZQ1A 4E7HA 5CKBA 1I8FA 4LNSA 4IUTA 2M1HA 4J15A 1S72T 1VQLA 2EJ9A 2OTLT 2ZINA 1BBUA 4YRTA 4TWAA 4YPFA 2ZCEA 3EFSA 2GCXA 1UGRB 4LVKA 3CEYA 2GQVA 3PCOA 2DQ3A 1RI0A 1C0AA 2ZPIB 1Q82U 5GAN4 1TH7A 2QEXA 1NJ2A 3L2VA 4RQEA 3CBOA 4FT4A 4F7UB 2R5MA 4A4EA 2DEQA 3M5AA 5GMKi 4HCCA 5GANh 2EYQA 2RHIA 3CCLT 5GAN7 4DQ2A 1QVFS 4FU6A 1EOVA 3DLLA 4ZGDB 4P73C 2LQKA 3RIRA 3F70A 4ZGJB 2QA4A 3MP1A 2A3LA 4J6YA 3NEMA 2X4JA 2PMFA 4QQGA 3RKYA 3J80E 3CC2A 3N5BB 3G71T 3GOXA 2MAMA 3JCMX 2QHSA 2Q7EA 3VQVA 2EQKA 3OYCA 1I81A 2RHSB 3PZCA 2OAUA 4CH4A 1HK9A 4TVRA 4OF1A 3P8BB 4H2YA 5C53B 3FC3A 4PLLA 3G6ET 1Y7XA 4TVWA 4G85A 3KBGA 1VQNA 1WJQA 4J8OA 4JS5A 4BE2A 2Q7GA 1QF6A 1XTDA 1K73U 4R55A 5J26A 2ZCFB 1QW1A 1NJ6A 2ZR2A 2RD1A 2ZPHB 1Q7YU 1WU7A 3L2ZA 4OMFB 3OYFA 2KMTA 3CCQT 2EFIA 2XU8A 3RL6A 1G3SA 3OMCA 1KOGA 4EMHA 1QVFA 3HXUA 3R07A 1DJ7B 1LJOA 1I4K1 3M54A 4LDUA 2RK2A 1VQOA 1JJ2A 2XICA 4OB3B 2DKGA 2ZIOA 1G3TA 2EWNA 3VV0A 1J5WA 5GAMf 4DA4A 4PHCA 3A31A 4XU1A 3E9GA 2LDMA 2DXTA 5F5WA 5I21A 2CZ1B 3M58A 5LJ3g 5LJ3d 2FL7A 3GPLA 3BFMA 2DD4A 5C0MA 4J6XA 3VUZA 1B7YA 3HFNA 2P4TA 3A7RA 1WQ7A 3FDRA 1H4VB 2DXBA 4C0FA 4C92C 4DOVA 3V7CA 2P0LA 1H3ZA 4D6WA 3L2QA 2JNGA 2CZ0B 2RHQB 3H8ZA 1M4ZA 4C5EA 1S72A 2ZPGB 3JB9H 3JCMJ 4L87A 2K57A 2QXFA 4KQEA 2BUDA 3IKMB 4JUVA 3PGGA 3GF5A 4YRKA 4H2WA 4CH5A 1W4SA 1NJ1A 2HQXA 3DB3A 3NFCA 2LT1A 4AH6A 2O01E 4XK8E 3MEWA 1QP2A 1X2GA 4E7KA 5DM7R 1N6AA 2JZ2A 3RERA 2JUFA 3T9NA 1QE0A 3CC4A 2OTJA 4L6V5 2ZNJA 3M4YA 4C5IA 1D3BB 1VQ9A 3PT9A 4YRRA 5HY6A 2M16A 3C4SA 2A8EA 1MGQA 4ZN1A 3S3OA 4TVAA 4PG3A 3DKMA 4OGCA 3CCJT 3HPWA 2RI5A 2YLCA 2ZTGA 3DSQA 4BY6B 3NENA 2RH2A 3OSVA 2HD0A 1M1KU 1KHCA 3RKWA 3RKXA 1ZBXA 3FIFA 2Q5IA 3MCAB 2ODRC 4BE1A 3PFSA 4F7UF 2LC4A 3HXWA 4P3OA 3A74A 2DVEA 3OW2A 1M5Q1 1SETA 5D6WA 1K9MC 5GAN6 5L8RE 1FXXA 4M77C 4HT8A 4YCVA 4KBMB 1YFTA 3UGTA 4MZPA 4ZTZB 3P8HA 3OQ5A 3ZBDA 5A0LA 4NL2A 1VQMA 2EJFA 2J3MA 1H4TA 1M1FA 3CCMT 3EFRA 3G71A 2DO3A 2LNVA 4RKUE 4J7IA 4XU2A 1AHJB 3OYDA 2ODRD 2A7YA 2X4YA 1OZ2A 4HA8A 4ZTJA 3JCMV 4M7AE 4C8QD 1W66A 1KQSA 4CRIA 2R5AA 2DD5A 2PVOB 1N8RU 4P5NA 4M7AD 1BI0A 2MF2A 3L2UA 4YRLA 5GMKe 4J6WA 2AKWB 4E7LA 2RJFA 4BUGA 3GIBA 3NETA 4P71A 2ZT5A 1EFWA 3PMIA 4KR2A 4M7DD 2KSSA 3HRSA 3HY0A 4NS5A 4F7UA 5I2SA 3JCMh 4C8QB 4HT4A 4WJ4A 5FRNA 4HWPA 3CC7A 2PU9B 3EAEA 4OGEA 4M77A 1WYDA 4M77B 1X75C 4ATOA 3JCMW 2KY9A 3QO3A 5GAMh 3BY7A 1N9SA 3LYIA 1NPRA 2PVDB 4OLFA 4P3PA 5A0GA 5GAMe 1VIEA 1Q81U 1ASYA 2LT4A 3RMSA 3GLXA 3L2WA 3MP8A 2E6ZA 2RI3A 2QQBA 3A8GB 4PKCC 3UGQA 2RHXA 3QJ6A 4KULA 2XDPA 2DTHA 1X01A 2E6NA 2LRQA 1W2BS 4BB7A 2B8AA 1M9SA 4P3NA 3HXZA 2DTOA 1H641 5FLXE 5LJ5h 5ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P73 C;  4M78 D;  1SRY A;  3RIR A;  2ARU A;  2Y90 A;  3P8V A;  2DU5 A;  4J6Y A;  3NEM A;  3PCO B;  4C8Q F;  4ZIB A;  3HXY A;  2IY5 A;  4M75 B;  2PMF A;  4YRJ A;  4YYE A;  4M75 A;  3RKY A;  5KNN A;  3A7U A;  3JCM X;  4M78 E;  4YDQ A;  4K87 A;  2I4M A;  2QHS A;  5DY9 A;  2Q7E A;  5CAI A;  4JRK A;  3VQV A;  2E1H A;  4M7A B;  1Y96 A;  1I81 A;  3HSB A;  2XTI A;  4C8Q E;  4XQ3 A;  2RHS B;  3L4G A;  3PZC A;  3LC0 A;  3JCM b;  4CH4 A;  1HXD A;  1HK9 A;  5GAN d;  4H2Y A;  3ERR A;  4TQF A;  1LOJ A;  5C53 B;  5LJ5 d;  3V7R A;  4C92 A;  1B70 B;  3P8Y A;  3TEG A;  4YRN A;  2EJG A;  4EMK A;  4UPA A;  4XTZ A;  3JCM d;  3FB9 A;  4P72 A;  4TVW A;  4G85 A;  2E65 A;  3QHS A;  1NJ8 A;  2QHT A;  2ZZG A;  2YHT A;  4JLI A;  4TTV A;  3RF1 A;  4YRF A;  2AMC B;  2Q7G A;  2E10 A;  1QF6 A;  4NCX A;  5LJ5 e;  4J5Y A;  3JCM Q;  1NJ6 A;  5GAN e;  2ZR2 A;  2RD1 A;  1WU7 A;  4F7U E;  3L2Z A;  2QHV A;  3RL6 A;  1WLE A;  1RIQ A;  2I2L A;  4P72 C;  4M75 F;  4M77 F;  1KOG A;  1B34 A;  4NOY A;  1E22 A;  4PJO C;  2ALY B;  4EMH A;  2E3C A;  2RHS A;  5GMK l;  3HXU A;  3R07 A;  3BJU A;  3QNE A;  5ELN A;  4HWT A;  4ZTU B;  1LJO A;  4M77 E;  1I4K 1;  3E9I A;  4P71 C;  4YCW A;  2C8M A;  3VQW A;  4M75 G;  3SWN C;  4M77 G;  4C92 G;  4WJ3 M;  2DKG A;  1EVK A;  2ZZE A;  3JB9 F;  3BW1 A;  1PYS A;  1YFR A;  2ZIO A;  2EWN A;  4N0A A;  4C92 E;  4M78 F;  5GAN 8;  1J5W A;  5GAM f;  3VU3 C;  1YCY A;  1JJC B;  4PHC A;  5GAO m;  4M7A A;  3A31 A;  3G1Z A;  4XU1 A;  4O2D A;  4X9C A;  4EMK C;  3P8T A;  2DXT A;  1I5L A;  5F5W A;  1USY A;  2ZNI A;  5I21 A;  4C92 F;  3UFG A;  3JB9 G;  5LJ3 g;  5LJ3 d;  4EO4 A;  1YFS A;  4M78 G;  1X2H A;  2G4C A;  1IL2 A;  3BFM A;  5GAO l;  2E5A A;  3QTC A;  2DXU A;  4J6X A;  4M78 C;  1B7Y A;  3HFN A;  3A7R A;  1WQ7 A;  4RCB A;  3HFZ A;  1H4V B;  1E24 A;  3HFO A;  1KMM A;  4C92 C;  3OD1 A;  1H4Q A;  4RCC A;  2VXE A;  1ATI A;  4X5O A;  3V7C A;  3JCM P;  2P0L A;  2ZZF A;  5GAM d;  4HVC A;  3RAC A;  2RHQ B;  1JJC A;  3RES A;  1EQR A;  1B76 A;  1JBM A;  5K1P A;  2QTX A;  4XU3 A;  4BWA A;  3L1A A;  3JB9 H;  1BBW A;  3JCM J;  4L87 A;  5LJ3 h;  2K57 A;  4CS2 A;  4MMK A;  1X54 A;  1SER A;  4RMF A;  3REX A;  4KQE A;  2ZT7 A;  3FJP A;  3IKM B;  3BDU A;  4JUV A;  3A7A A;  3PGG A;  4H2S A;  4HWO A;  4YRK A;  4H2W A;  4CH5 A;  3REU A;  1NJ1 A;  3IKL A;  4Q6G A;  4CS3 A;  4C8Q A;  4AH6 A;  4XEM A;  4XTU A;  2ZIM A;  3SWN A;  3V8K A;  3QO8 A;  1X2G A;  4M7D B;  4H02 A;  4P75 C;  3JCM e;  1ASZ A;  4V2S A;  3RER A;  4JRI A;  1QE0 A;  2JN0 A;  1YGB A;  2EAY A;  2RM4 A;  1B34 B;  2ZNJ A;  1KQ1 A;  1BIB A;  3VBB A;  5C52 B;  1D3B B;  3L4G B;  4YRR A;  4RDX A;  1G51 A;  2ZT8 A;  4HWS A;  2E41 A;  4H2X A;  1ADJ A;  4CH3 A;  2P5I A;  1MGQ A;  3SB2 A;  4TVA A;  2Q7H A;  1EVL A;  1SES A;  4PG3 A;  1BIA A;  2YLB A;  3JCM f;  4M7D E;  4X9D A;  4PJO D;  3KFU A;  4KR3 A;  3IG2 A;  2YLC A;  3AHU A;  3LSS A;  2QHU A;  2ZTG A;  4C92 D;  4TQD A;  1USY C;  1FYF A;  3DSQ A;  4H2U A;  5E3I A;  3NEN A;  1B70 A;  4YP0 A;  4OP0 A;  4UP9 A;  1E1T A;  5K1X A;  3A5Y A;  3VQX A;  4EMG A;  2DZC A;  3RKW A;  4YRO A;  3RKX A;  3FIF A;  2RB6 A;  4N0A C;  4RQF A;  3LSQ A;  3RUX A;  2Q5I A;  4M7D A;  1LYL A;  3I7F A;  3IAL A;  4XTW A;  4YRG A;  2VC8 A;  2ODR C;  5GMK j;  3JB9 I;  1D3B A;  4F7U F;  1WNL A;  4CS4 A;  2I4N A;  3HXW A;  4P3O A;  3CMQ A;  2ZGW A;  1LNX A;  1X56 A;  4CH6 A;  3A74 A;  2DVE A;  4YRQ A;  1U1T A;  4M75 E;  4C92 B;  3HY1 A;  4K86 A;  1M5Q 1;  2J3L A;  1KQ2 A;  1SET A;  4P74 A;  1EIY A;  2ALY A;  1Z7N A;  1WPY A;  1B7Y B;  4PJO B;  5GAN 6;  1U1S A;  2DQ0 A;  1NJ5 A;  4M77 C;  3E9H A;  4F7U G;  4HT8 A;  2CJ9 A;  4YCV A;  4XTV A;  4Q15 A;  1PYS B;  1N9W A;  2ZR3 A;  3MF2 A;  3M4P A;  3WQZ A;  1YFT A;  3UGT A;  2RA2 A;  3W3S A;  4ZTZ B;  2FB7 A;  4YRS A;  1Y96 B;  4NL2 A;  2C7I A;  3MF1 A;  5GAN 5;  1NYQ A;  2EJF A;  2AKW A;  2J3M A;  5LJ5 g;  3HTZ A;  1JRI A;  5GAN 2;  1H4T A;  1HC7 A;  5GAN g;  2CGH A;  2XGT A;  3EFR A;  5LJ3 f;  5GAO n;  2DDZ A;  2RHQ A;  5HGQ A;  4BW9 A;  4TVA B;  1NNH A;  4QVC A;  4XU2 A;  4M78 A;  4M7A G;  2I4O A;  2ODR D;  3V8L A;  4WF2 A;  4HA8 A;  3JCM V;  5GAM g;  4M7A E;  4C8Q D;  3SWN B;  1W66 A;  2DTI A;  3HFV A;  5LJ3 e;  3HRI A;  3QO7 A;  4K88 A;  1EIY B;  11AS A;  3A5Z A;  5C51 B;  2CJB A;  4PJO A;  4YCU A;  4A53 A;  4M7A D;  5LJ3 j;  2ZXF A;  2IY5 B;  4YRL A;  5GMK e;  4J6W A;  2AKW B;  4P75 A;  4M7A F;  1VQZ A;  4PJO F;  4NL3 A;  1Z7M A;  4E51 A;  4YRP A;  4YRC A;  3GIB A;  1H4S A;  12AS A;  2DZ9 A;  3NET A;  3RGL A;  4P71 A;  2ZT5 A;  5GAM j;  1EFW A;  3VQY A;  3JCM g;  3M4Q A;  3JB9 D;  2CIM A;  1M8V A;  3HXV A;  4KR2 A;  4M7D D;  4G84 A;  4PJO E;  4DPG A;  2CJA A;  1G5H A;  1YB3 A;  3HY0 A;  4H2X B;  5GAN 3;  4P73 A;  3TEH B;  4PJO G;  4M7D C;  1NYR A;  4TVY A;  1X55 A;  4F7U A;  2ARS A;  4M7A C;  4XTX A;  4M7D G;  4XU0 A;  3V7S A;  4MML A;  3JCM h;  4C8Q B;  3ICA A;  4YRI A;  2E64 A;  2AMC A;  1E1O A;  3V8J A;  4WJ4 A;  3M4G A;  3JB9 J;  3UH0 A;  1N9R A;  3NEL A;  2DU7 A;  3QO5 A;  4HWP A;  4UP8 A;  5GAO p;  4XEO A;  2DJZ A;  4EMK B;  4HWR A;  4YRM A;  1HTT A;  3INZ A;  4PNO A;  4EX5 A;  3HRK A;  3HXX A;  1GGM A;  4M77 A;  5GAO r;  4M7D F;  1WYD A;  4M77 B;  3JCM c;  5LJ5 f;  5GAN f;  1B8A A;  3JCM W;  3QO3 A;  5GAM h;  1G5I A;  4H2T A;  1I8F A;  3BY7 A;  4M75 C;  1N9S A;  4LNS A;  4WI1 A;  2VXF A;  3TUP A;  2EL9 A;  4J15 A;  4OLF A;  4P3P A;  5GMK h;  2EJ9 A;  4H2V A;  2ZIN A;  1BBU A;  2ZT6 A;  1ADY A;  4M78 B;  3HFZ B;  3QUI A;  4YRT A;  5GAM e;  5GAO q;  3MEY A;  1ASY A;  4TWA A;  4YPF A;  2ART A;  4YRE A;  4XTY A;  4M77 D;  3QSU A;  3EFS A;  2ZCE A;  3A32 A;  1L0W A;  3PCO A;  2DQ3 A;  4UP7 A;  1C0A A;  4M75 D;  3UGQ A;  5GAN 4;  5LJ5 j;  1TH7 A;  4Y91 A;  2DTH A;  1X01 A;  5GAN j;  4HT9 A;  2Q5H A;  1KMN A;  4C8Q C;  4RQE A;  1NJ2 A;  2HNI A;  5GMK m;  4P3N A;  4A54 A;  3HXZ A;  4QVD A;  3TEH A;  4F7U B;  4C8Q G;  4P74 C;  2FYK A;  2DTO A;  2DEQ A;  1H64 1;  2I4L A;  1WQW A;  5GMK i;  2PME A;  5GAN h;  5LJ5 h;  5ELO A;  5GAN 7;  4DQ2 A;  1EOV A; 
#chains in the Genus database with same CATH topology
 5CK9 A;  5CQY A;  4MDW A;  1SRY A;  2DU5 A;  3M56 A;  3PCO B;  1VQ4 T;  4ZIB A;  5CCA A;  1I0C A;  1VYU A;  4M75 B;  4YYE A;  1BI3 A;  4M75 A;  3OYK A;  5A2Q E;  3A7U A;  4A4G A;  2I4M A;  2E1H A;  4QQ6 A;  5IXB A;  5IAY A;  2XTI A;  1PNJ A;  3BDL A;  1SPK A;  3OBY A;  3WVE B;  2KR3 A;  5CO7 A;  1QKW A;  2DRM A;  1KQS S;  2A08 A;  2CP2 A;  3UWN A;  3ME9 A;  3I55 A;  2FZC B;  5LJ5 d;  3V7R A;  1UG1 A;  3G4S T;  1UE9 A;  4RTV A;  2RJC A;  1VQM Q;  2DL5 A;  2GFU A;  1K0X A;  2EJG A;  1BYM A;  3FB9 A;  4LVI A;  3QHS A;  2EYW A;  2QHT A;  2ZZG A;  2YHT A;  1CKA A;  4YRF A;  2AMC B;  1QVG P;  2GNC A;  2E70 A;  2PUO B;  5GAN e;  4A4K A;  2V8K A;  2L3R A;  4FM4 B;  2HCK A;  4XAX B;  4RTX A;  2QHV A;  2ED1 A;  5KYX B;  1WLE A;  1AWO A;  1RIQ A;  4Y92 A;  4P72 C;  3REA B;  4LD6 A;  4M77 F;  2QQ9 A;  4LUE A;  4N4H A;  2RHS A;  4RTT A;  1AEY A;  2CP6 A;  2CT4 A;  5CVI A;  1BB9 A;  4ZGE B;  1XJW B;  5ELN A;  4OMN A;  1OOT A;  4HWT A;  4C0G A;  5CQX A;  1D1A A;  1QVP A;  1Q81 C;  4RTZ A;  3VQW A;  1TWB A;  3SWN C;  1Q82 C;  3E2U A;  4M77 G;  4IUR A;  4WJ3 M;  1KC8 R;  3QXE B;  1PKS A;  3JV3 A;  5KCH A;  3BW1 A;  1JXM A;  1PYS A;  1YFR A;  1TSF A;  3X26 B;  3PTA A;  4C92 E;  1GBR A;  4AMC A;  1OU9 A;  3NTK A;  3TCJ A;  4FSS A;  1JJC B;  2KQW A;  2V8I A;  3RDV A;  5KYW B;  3EGU A;  1VQN Q;  1HJD A;  4JDS A;  3IQL A;  3MEU A;  2LJ0 A;  2JS0 A;  4EO4 A;  1PSE A;  4M78 G;  1K8A C;  1V1C A;  3PMT A;  1K0S A;  3HRU A;  4AT1 B;  3LWH A;  4M78 C;  2A0F B;  4UC4 A;  2VUB A;  3CMA A;  1K9A A;  4RUG A;  3ZEH A;  1YWO A;  3GNG A;  2VGN A;  3HFO A;  1KMM A;  1QVF P;  3CXC S;  5KH6 A;  4RCC A;  3QDF A;  5HK0 A;  3EGX B;  2QDL A;  4X5O A;  1MHN A;  3JCM P;  2L8D A;  3KFV A;  1OUL A;  2P84 A;  4O5V A;  4HVC A;  3CCV A;  5IXF A;  1SF9 A;  4ELY C;  3RES A;  1EQR A;  4LVL A;  1B76 A;  1JBM A;  4Z02 A;  2QTX A;  2NS6 A;  1NEB A;  2F69 A;  3CCS Q;  1UHC A;  3OYL A;  2LCC A;  1MUZ A;  4MMK A;  1X54 A;  2ZT7 A;  4RTW A;  1NBE B;  3BDU A;  3CQT A;  4H2S A;  4HWO A;  1OX8 A;  3M53 A;  1WJR A;  2JTE A;  3JAM E;  3REU A;  1FMW A;  1VQ4 Q;  4JZ4 A;  4II1 A;  3CC2 T;  3QPH A;  1IZ6 A;  4CS3 A;  2Y4Y A;  4C8Q A;  4BE0 A;  3QO8 A;  4AFS C;  4P75 C;  3JCM e;  1ASZ A;  4IKF A;  4V2S A;  3VS4 A;  2JN0 A;  1IGQ A;  4F16 A;  2EAY A;  1B34 B;  4CI0 C;  4PFP A;  3QII A;  4KUD K;  4H2X A;  2LQ8 A;  1UGP B;  2CKK A;  3EFO B;  1FX7 A;  2B86 A;  3JCM f;  2M9U A;  5IN1 A;  2ESW A;  1NE8 A;  2NUP B;  5KYN A;  4M7D E;  3VS0 A;  3OYG A;  4KR3 A;  1K73 R;  1R0B G;  1VQ4 A;  3A8O B;  1XNI A;  3M0S A;  3LSS A;  4C92 D;  1USY C;  1KC8 C;  1G3Y A;  3A5Z B;  2HBP A;  4KT0 E;  4UP9 A;  1VQO Q;  2RO0 A;  5K1X A;  1OX9 A;  2FO0 A;  3VQX A;  1JU5 C;  4RG8 A;  2DZC A;  4YRO A;  3CCQ A;  1YJ9 Q;  2RB6 A;  2CYZ B;  2GF7 A;  4M7D A;  3E1S A;  4HVW A;  4J9G A;  3CCU A;  2QA4 T;  4ESR A;  2BZY A;  3JB9 I;  1D3B A;  3H0I A;  1M90 U;  2J06 A;  3OW2 S;  1VQ5 T;  3MPU B;  1BBZ A;  4IUQ A;  1XQH A;  4CH6 A;  4YRQ A;  3HY1 A;  2K5I A;  4CC4 B;  2KAF A;  1KQ2 A;  1D09 B;  1AWJ A;  2F2X A;  4HKE A;  3NTI A;  1EIY A;  4HXJ A;  2ALY A;  2RNA A;  2KT8 A;  4Z8A A;  4C0Z A;  2DQ0 A;  4PJM A;  5FWC A;  4DOW A;  2RMO A;  3QYG B;  2FHD A;  4IIO A;  4J9F A;  1PYS B;  1M3A A;  5FU6 B;  3X24 B;  3E9F A;  3M4P A;  3G6E A;  1FMK A;  1KJW A;  3CCL A;  3W3S A;  3E19 A;  2FB7 A;  1OEB A;  1S72 Q;  3MF1 A;  5GAN 5;  5KYW A;  2CS7 A;  1VQ8 Q;  1G5V A;  4BD3 A;  2CGH A;  1VUB A;  2O4X B;  2DPP B;  5GAO n;  3MP6 A;  2DDZ A;  2ZZD A;  2K4Y A;  1PM3 A;  4TVA B;  4FCY A;  1VQP A;  4QVC A;  2MOX A;  1F1B B;  1GFC A;  2H3J A;  4ZNX A;  2I4O A;  2E5Q A;  3V8L A;  5IHK A;  2P4R A;  1YJN T;  4RG2 A;  3OS1 A;  3I55 Q;  5FU7 C;  3SWN B;  4BY6 C;  2EQM A;  3LX7 A;  1AZG B;  2RK1 A;  4LXC A;  5C51 B;  3GBQ A;  3M59 A;  3CCR T;  5LJ3 j;  1ZHI A;  4P75 A;  4M7A F;  2YRV A;  4PJO F;  2YWW A;  4NL3 A;  1D0Z A;  2WSE E;  1H4S A;  4E7I A;  4B6M A;  3TU4 K;  3RGL A;  3VYG A;  2LQW A;  2R57 A;  2M51 A;  3VQY A;  1G2B A;  3PNW C;  2F5K A;  3WVD B;  1YJW T;  2DYI A;  4AFZ C;  5J3B A;  1M8V A;  2DE0 X;  1QP3 A;  4F04 B;  3MET A;  3G4S Q;  1YB3 A;  1ZA1 B;  5GAN 3;  1VQK T;  4PJO G;  5J39 A;  1PSF A;  2LTO A;  4M7D C;  1NJI R;  1NPP A;  5CIU A;  1NJI U;  1QVG S;  4J83 A;  4C0D B;  2E64 A;  1OPL A;  2AMC A;  3V8J A;  3QZ5 B;  2WAC A;  4LD9 K;  1LVK A;  2PQW A;  3CCE T;  2VKN A;  2DU7 A;  3QO5 A;  2BZX A;  3VS7 A;  3MQZ A;  1Q82 R;  1UDL A;  3QG1 A;  2AHJ B;  1K8A U;  3LGL A;  1HTT A;  4PNO A;  3CMA T;  1Q7Y R;  4RMO A;  2HSP A;  2JTM A;  1V76 A;  3R6O A;  1IB8 A;  3QKJ A;  3JCM c;  1Y57 A;  5LJ5 f;  5CKF A;  2KEA A;  2PVG B;  2VYT A;  2L5Q A;  3M0Q A;  5HCK A;  2CZ6 B;  1B8A A;  2EYX A;  1IHV A;  1CSK A;  4LDX A;  1PRL C;  3EFO A;  2K2V A;  1MMA A;  2HBW A;  3HKS A;  3OS5 A;  2RI2 A;  3I35 A;  1QLY A;  2CH4 A;  1OPK A;  3PIO A;  2EL9 A;  1SKU B;  1OU8 A;  1RAE B;  2I0N A;  1ADY A;  4M78 B;  2XK0 A;  3QUI A;  3ZFJ A;  4YRE A;  4XTY A;  1Q86 C;  4N4I A;  2AZV A;  2RJD A;  4CC2 A;  3A32 A;  2DFU A;  2XID A;  1UEB A;  4CC7 A;  2COW A;  4UP7 A;  1M8M A;  2BIV A;  5LJ5 j;  1N27 A;  4LDW A;  4BDZ A;  5GAN j;  2Q5H A;  1KMN A;  3OYN A;  5GMK m;  2L89 A;  4A54 A;  4F14 A;  1WHM A;  3VUB A;  1YIJ Q;  4QKU A;  4C8Q G;  1VA7 A;  2MWO A;  1W2B A;  2FYK A;  3CCS A;  5I11 A;  2K5L A;  2I4L A;  1WQW A;  2PME A;  4O6J A;  2XMF A;  3CXC A;  4DBF A;  1K9M U;  1U06 A;  3CCV Q;  4OMQ A;  2HAX A;  1G83 A;  2EKH A;  4M78 D;  2QQS A;  2ARU A;  3P8V A;  3UPU A;  1AWW A;  2COY A;  4C8Q F;  3PIP A;  2IY5 A;  4YRJ A;  5KNN A;  3TQ7 P;  4YDQ A;  2X4X A;  4M78 E;  4K87 A;  3CPW S;  1YI2 Q;  5DY9 A;  5CAI A;  2RQT A;  2GFA A;  4M7A B;  1VQP T;  2M0O A;  4BI3 A;  1EZZ B;  2X4W A;  1JJ2 P;  4XQ3 A;  3S3N A;  2BTT A;  3JCM b;  4RTU A;  1M1K C;  2E3I A;  1K73 C;  3ERR A;  3CCU T;  2XD0 A;  4C92 A;  1B70 B;  2COZ A;  2QQA A;  4C0D C;  3P8Y A;  4YRN A;  1SSH A;  2CUB A;  4EMK A;  4XTZ A;  3CC2 Q;  4UPA A;  1R8O B;  3JCM d;  4P72 A;  4J9H A;  1NJ8 A;  1HD3 A;  2CRE A;  2F5T X;  2HL5 C;  4A4F A;  1YI2 T;  3A8L B;  2JXB A;  2NUZ A;  5LJ5 e;  3TVT A;  3CCM A;  4NCX A;  1TUG B;  2E5K A;  2K7A A;  5GJW B;  1AOJ A;  1I1J A;  4DBH A;  1Q95 G;  1ZSZ B;  2CP3 A;  3HRT A;  5CKH A;  3H9N A;  4LNP A;  3A8M B;  5I2M A;  4JRP A;  2DIL A;  2X9H A;  1KD1 R;  1B34 A;  2E3C A;  2OI3 A;  2F2W A;  2FRW A;  2W10 A;  1QQJ A;  1NYG A;  2IIM A;  3BJU A;  3QNE A;  4PL6 A;  3CCE Q;  2WSF E;  1P92 A;  2D9T A;  3JRZ A;  1IXD A;  2X35 A;  4P71 C;  4YCW A;  2QQR A;  4M75 G;  1M90 R;  1EVK A;  2ZZE A;  5EC7 A;  3EH1 A;  4N0A A;  5IH2 A;  4M78 F;  1RAB B;  3VU3 C;  1VQ6 A;  5GAO m;  2NYS A;  2FRY A;  3G1Z A;  2ZPE B;  2FPF A;  3P8T A;  2H8H A;  3CPF A;  2J6K A;  2CP7 A;  3JB9 G;  2EIF A;  3OS0 A;  4OB1 B;  1WXB A;  1O75 A;  2EVR A;  1IL2 A;  2CUD A;  3PVL A;  3CD6 T;  3OYY A;  2DM1 A;  5FU6 C;  3G7Z A;  2E5A A;  1GCP A;  2DXU A;  2J05 A;  3SHW A;  5FRM A;  4JPB W;  1OQK A;  4FYY B;  4RCB A;  2LX9 A;  4L5G A;  3HFZ A;  1VQK A;  3VS2 A;  1YHQ T;  1SG5 A;  3CME A;  1YJN A;  2DXC A;  2FVU A;  3OD1 A;  3ASK A;  1X6O A;  5GJV B;  2RF0 A;  5LL6 S;  2EQU A;  1J3T A;  5KE3 A;  4E7J A;  5EG2 A;  2VAS A;  1ZSZ A;  1UGQ B;  3RAC A;  1YJ9 T;  3CCS T;  5K1P A;  3OYM A;  1W6X A;  4LVJ A;  1GCQ C;  4ZTF A;  1FWZ A;  2DK3 A;  2XI9 A;  2QI2 A;  4GLM A;  4B9X A;  4ELZ C;  1YJW A;  4CS2 A;  3H6Z A;  4RMF A;  1U3O A;  4BAC A;  4E6R A;  1ZBJ A;  3J81 E;  3LWI A;  2LCL A;  3DLM A;  3C12 A;  3LLR A;  3SWN A;  3J7A F;  1X2K A;  4JLG A;  1BI2 A;  3EHR A;  3A1P A;  4JRI A;  4F17 A;  1YGB A;  4QT7 A;  3CC7 T;  1KQ1 A;  4JJD A;  1BIB A;  2KYB A;  5C52 B;  4PLI A;  4RDX A;  2VWF A;  1WXU A;  5KYX A;  1G51 A;  2ZT8 A;  1Q86 U;  4HWS A;  1AWX A;  2O4X A;  3FRN A;  3SB2 A;  1WA7 A;  1EVL A;  1BIA A;  2JJ9 A;  2YLB A;  1N5Z A;  1PC0 A;  3KFU A;  3IG2 A;  3AHU A;  2NWM A;  2QHU A;  4H2U A;  1RL2 A;  1FYF A;  3TSZ A;  2JMC A;  1B70 A;  2MK5 A;  1NEG A;  4YP0 A;  1QCN A;  1E1T A;  1U5S A;  2JOY A;  4EMG A;  3FLG A;  1KHI A;  2V8J A;  3CBP A;  4N0A C;  2VGM A;  3LSQ A;  3RUX A;  2MWP A;  4X34 A;  2V1R A;  1VQ7 A;  1SSF A;  1LYL A;  3I7F A;  4OVA A;  1BI1 A;  1TXQ A;  3IAL A;  4YRG A;  2VC8 A;  2RQV A;  2DAQ A;  1C1A A;  1VYV A;  5GMK j;  2RQW A;  3ER0 A;  2L3P A;  4CS4 A;  2I4N A;  1ZUY A;  3CMQ A;  2ZGW A;  4FL6 A;  3X20 B;  3OYJ A;  2EQJ A;  4K86 A;  1QKX A;  2XG8 D;  4L59 A;  2CH4 W;  2RHU A;  1Z7N A;  3TRE A;  1VQK Q;  1B7Y B;  2FZK B;  2YUN A;  3UA7 A;  2K9G A;  1U1S A;  2DL3 A;  7AT1 B;  2VVK A;  1HYO A;  1BKB A;  3CBM A;  4Q15 A;  1T3S A;  2BKD N;  2ZR3 A;  3MF2 A;  1S1N A;  3GP8 A;  4JJC A;  2E12 A;  1D1C A;  3M9Q A;  3P8D A;  1Y96 B;  1W70 A;  2C7I A;  1YP5 A;  2P0P A;  4CC3 A;  2XDD A;  2AKW A;  5LJ5 g;  1JRI A;  1HC7 A;  4Y28 E;  2XGT A;  5LJ3 f;  1UJY A;  5HGQ A;  2XKO C;  4BW9 A;  2YRD A;  5CKD A;  4IUP A;  4FYX B;  1G3W A;  2X3X D;  3TSW A;  4M7A G;  6AT1 B;  1R77 A;  2J6F A;  1YHQ A;  3C94 A;  3M0U A;  2JM9 A;  2DTI A;  2EGA A;  3UA6 A;  5AYF A;  4PFO A;  5L23 A;  2NUT A;  5LJ3 e;  4K88 A;  3I55 T;  2JVV A;  2RQU A;  2CJB A;  4YCU A;  4IUV A;  2ZXF A;  3O8V A;  2J7I A;  5AT1 B;  2J6O A;  2GTO A;  1RAF B;  2CP0 A;  1VQZ A;  1Z7M A;  1YI2 A;  1JJ2 S;  4YRP A;  2MCN A;  2V1Q A;  2DZ9 A;  2K3Y A;  1I5O B;  1XOV A;  2K5F A;  2SRC A;  1IRE B;  3M4Q A;  2CIM A;  4G84 A;  2EKO A;  2CJA A;  1JO8 A;  2F2V A;  4P73 A;  3KUF A;  3L42 A;  3OS2 A;  3TEH B;  2GQI A;  1E6H A;  1VQ8 T;  3G6E Q;  4MDX A;  2LMJ A;  1X55 A;  4FIB A;  4M7A C;  3OB9 A;  4XTX A;  2CZ7 B;  2EGC A;  2QDY B;  4XU0 A;  2PZ1 A;  2DL7 A;  4YRI A;  1E1O A;  4OMP A;  2JMA A;  4N4G A;  2IG0 A;  1NLO C;  3CC4 T;  2OTJ T;  4E2F B;  3NEL A;  3HL8 A;  2DIG A;  5GAO p;  4UP8 A;  5FU7 B;  4EMK B;  3CMA Q;  2D0N A;  1VQ9 T;  4EX5 A;  3I56 T;  4EPC A;  3M57 A;  3HRK A;  1VQO T;  2LX7 A;  3HXX A;  1GGM A;  3M55 A;  5GAO r;  4M7D F;  3CME T;  2QAS A;  1HSQ A;  4FT2 A;  1EIF A;  2ECZ A;  2KXC A;  1G5I A;  4H2T A;  1KD1 C;  2D0Q B;  1JQQ A;  1PKT A;  1WHL A;  4AG1 C;  3TEE A;  2Y4X A;  1UHF A;  4M75 C;  4DEX A;  3CCV T;  1H8K A;  4WI1 A;  2VXF A;  2A36 A;  4QVZ A;  2AKK A;  2DBK A;  1BU1 A;  3O5Z A;  3TUP A;  3CCR Q;  4LUD A;  1X43 A;  5GMK h;  1WLP B;  2LVM A;  4H2V A;  5D6Y A;  3CPW P;  2ZT6 A;  1RAI B;  1C6V X;  3HFZ B;  4J9B A;  5GAO q;  3MEY A;  1KG1 A;  2ART A;  2C06 A;  4M77 D;  3QSU A;  1L0W A;  1WX6 A;  4DEY A;  4VUB A;  2QEX Q;  4YTL A;  4M75 D;  2QGF B;  1OI1 A;  4MZT A;  3CCU Q;  2YSQ A;  3LW5 E;  4Y91 A;  3M0R A;  4HT9 A;  5KE2 A;  2ZPF B;  2HL3 A;  4J9D A;  4C8Q C;  1GL5 A;  2HNI A;  3TEH A;  4QVD A;  3CCQ Q;  1YJ9 A;  1GCQ A;  4P74 C;  2PTK A;  1T0J A;  1VQ6 Q;  1PWT A;  2KVQ G;  1M2V B;  3RMQ A;  3DB4 A;  1OZ3 A;  1VQM T;  2XHC A;  2Y90 A;  1ZA2 B;  4E47 A;  2OTL Q;  5DLO A;  3HXY A;  1M1G A;  3VJP A;  2KNB B;  2DET A;  3QJY A;  1QMC A;  2O9S A;  3EG9 A;  1Z9Q A;  3NGP A;  4JRK A;  4FSX A;  1EX4 A;  3EGD A;  1Y96 A;  3LH5 A;  3HSB A;  1R0C B;  3VYH B;  4C8Q E;  4JS4 A;  3L4G A;  2JW4 A;  1OV3 A;  3LC0 A;  3WXM B;  1HXD A;  1VQ7 T;  3UT1 A;  3RR6 A;  1CKB A;  5GAN d;  4TQF A;  1LOJ A;  1C0M A;  4PFZ A;  2M02 A;  4E7Z A;  1BCO A;  1SHF A;  4LVM A;  3TEG A;  3OYH A;  4WCI A;  1O9S A;  1VQ5 A;  4KGV B;  2E65 A;  2LJ3 A;  1ZUU A;  4JLI A;  3RBB B;  4TTV A;  3RF1 A;  5A0D A;  4BI4 A;  4JJN K;  2E10 A;  4J5Y A;  4HCZ A;  3JCM Q;  1SEM A;  2L3S A;  1KFZ A;  2A28 A;  4R0K A;  4F7U E;  1V29 B;  1TUC A;  3EG0 A;  3ZL7 C;  3QWX X;  4A63 B;  2I2L A;  3MEA A;  3VRY A;  3LH0 A;  4M75 F;  3S6W A;  3QYH B;  2FPD A;  3EGD B;  4NOY A;  2ALY B;  1E22 A;  4PJO C;  2YUO A;  3SEM A;  1YIT T;  5GMK l;  2XDB A;  2GBQ A;  3UDC A;  3FEO A;  3EG3 A;  3CCR A;  4ZTU B;  3QZ9 B;  9ATC B;  4M77 E;  3E9I A;  1MV0 B;  1ABQ A;  2C8M A;  2EYY A;  4J9I A;  4B9W A;  2MPX C;  2CSI A;  5DLQ E;  4C92 G;  1PD0 A;  3JB9 F;  2KRS A;  4E7S A;  1U8R A;  1VQP Q;  5GAN 8;  3OMG A;  1A0N B;  1BCM A;  1YCY A;  3I5S A;  1LPL A;  2R58 A;  3QWY A;  2O31 A;  5D6X A;  4M7A A;  4J7F A;  4Q5W A;  4O2D A;  4X9C A;  1YIJ A;  4EMK C;  3A8H B;  2ZNI A;  1I5L A;  2KGT A;  5KYY B;  1USY A;  4C92 F;  3UFG A;  2HMA A;  1K1Z A;  1YFS A;  1QVG A;  2G4C A;  1X2H A;  2NUT B;  1UFF A;  5GAO l;  3QTC A;  1TG0 A;  2ZPB B;  3NTH A;  5KCO A;  2OJ2 A;  1RAH B;  2DX1 A;  2E4H A;  1VQ8 A;  3BE3 A;  1YJN Q;  1E24 A;  1YHQ Q;  5HKC A;  4HVU A;  1H4Q A;  2P0Q A;  4D8D A;  4C5H A;  1ZSG A;  3MEV A;  2JTF A;  2VXE A;  5KYY A;  1ATI A;  2YXY A;  5ECA A;  4GY5 A;  2ZZF A;  1JB0 E;  2EYZ A;  5GAM d;  3A98 A;  2DIQ A;  3H0H A;  1JJC A;  2HQE A;  2ROL A;  3OBW A;  1RLQ C;  1Y71 A;  3HTR A;  1UTI A;  1Y07 A;  3JSC A;  4XU3 A;  4BWA A;  3L1A A;  2P0K A;  1BBW A;  2ROT A;  4DBR A;  3MKD A;  5LJ3 h;  2HSE B;  4ME7 A;  3PVQ A;  3MHX A;  1SER A;  3REX A;  1NZ9 A;  3FJP A;  1M27 C;  3A7A A;  4OB0 B;  2L3Q A;  1M3B A;  3U23 A;  4GLK A;  3SDZ A;  3SFM A;  3IKL A;  4Q6G A;  4QQD A;  3Q1J A;  2CDT A;  3OY9 A;  1N8R C;  1MV3 A;  4XEM A;  2QTV A;  4XTU A;  2ZIM A;  3HHT B;  1D0Y A;  5M9O A;  3V8K A;  1VQL T;  2OTL A;  4M7D B;  4H02 A;  1YIT Q;  1PHT A;  3VKI A;  3CCE A;  2RM4 A;  1QWE A;  2QAZ A;  2RJE A;  4MZM A;  3VBB A;  3L4G B;  2K3X A;  3I56 A;  2MMP A;  3L2R A;  4BDY A;  3SD4 A;  3G4S A;  2E41 A;  1ADJ A;  4CH3 A;  2P5I A;  3G71 Q;  5FW9 A;  3OYI A;  2Q7H A;  1GXI E;  1SES A;  3C95 A;  4KGZ B;  1E6G A;  4OB2 B;  1RAG B;  4X9D A;  2EPD A;  3CCJ Q;  4PJO D;  1GBQ A;  5FRO A;  1VIF A;  2LQN A;  2QEX T;  4TQD A;  5E3I A;  4A4H A;  1OYX A;  2DNU A;  2VV5 A;  3KXT A;  4OP0 A;  3CPW A;  4C5G A;  2PUK B;  3A5Y A;  1KC8 U;  4JRQ A;  1TU0 B;  4RQF A;  4QW2 A;  5CR2 A;  4XTW A;  2K3B A;  2BE9 B;  2IVW A;  2KI7 A;  2HQH A;  4LDY A;  3OYE A;  1WNL A;  3NHN A;  1ZUK A;  2AZS A;  3UAT A;  2ABL A;  3HP9 A;  4ZN3 A;  1AZE A;  1LNX A;  2RHY A;  2KXD A;  1X56 A;  2O2O A;  1U1T A;  4M75 E;  4C92 B;  2J3L A;  5HK3 A;  1YCS B;  4P74 A;  1WPY A;  2DVJ A;  4PJO B;  3CD6 Q;  3OSS C;  1K4U S;  1NJ5 A;  1IHW A;  1WJS A;  3E9H A;  4F7U G;  2CJ9 A;  2HEQ A;  4XTV A;  1N9W A;  3X28 B;  3WQZ A;  2RA2 A;  8ATC B;  2KDS A;  1VQN T;  3QBY A;  4YRS A;  5CKE A;  1NYQ A;  4LDV A;  3EHQ A;  3HTZ A;  2KK4 A;  2AIR B;  5GAN 2;  5C6S A;  5GAN g;  2G3R A;  4OMO A;  2RHQ A;  1M90 C;  1NNH A;  1W1F A;  1UB4 A;  1X2Q A;  4M78 A;  3OA6 A;  4WF2 A;  1UEC A;  1NJI C;  3CC4 Q;  2OTJ Q;  5GAM g;  1PRM C;  3HFV A;  3QO7 A;  3HRI A;  1EIY B;  11AS A;  3A5Z A;  1UGS B;  4KUI A;  4KH1 B;  2WSC E;  4R56 A;  1JEG A;  4PJO A;  4A53 A;  1YFN A;  2IY5 B;  1YIJ T;  1X27 A;  1WYX A;  4HCB A;  2C0O A;  4JZ3 A;  4E51 A;  1VOM A;  4YRC A;  1Q7Y C;  12AS A;  5IT9 E;  2K2M A;  2MI6 A;  4EDU A;  5GAM j;  1E7O A;  2V26 A;  3REB B;  3OYA A;  3JCM g;  3CD6 A;  3JB9 D;  4AFQ C;  3HXV A;  4J9C A;  3CC7 Q;  1KD1 U;  4PJO E;  4DPG A;  1G5H A;  4H2X B;  3AT1 B;  4ORZ A;  3URG A;  2D8H A;  2CP5 A;  1D1B A;  2MIO A;  1NYR A;  1WGS A;  4TVY A;  2ARS A;  4HCK A;  3OYB A;  2RHZ A;  3I9Q A;  1M30 A;  4M7D G;  4BI8 B;  1YIT A;  3V7S A;  4MML A;  1YBY A;  1SRM A;  3QDR B;  3ICA A;  3LGF A;  3MO8 A;  1KIK A;  5IHN A;  3M4G A;  3X25 B;  2DJQ A;  3JB9 J;  3UH0 A;  1N9R A;  2D6F A;  1ACM B;  1Y0M A;  3I56 Q;  4XEO A;  2DJZ A;  4HWR A;  4IUU A;  4YRM A;  3INZ A;  3GNF B;  2NLU A;  3S3M A;  2AK5 A;  2EW3 A;  3VS5 A;  5GAN f;  1Q86 R;  2KRM A;  3CCJ A;  1VQ6 T;  1ZQ1 A;  4E7H A;  5CKB A;  1I8F A;  1WFW A;  4LNS A;  4KRT A;  4IUT A;  1RAC B;  2M1H A;  2BE7 D;  4J15 A;  1S72 T;  1UJ0 A;  1VQL A;  2EJ9 A;  2OTL T;  1SRL A;  2ZIN A;  1BBU A;  2PNI A;  4YRT A;  1WXT A;  4TWA A;  4YPF A;  2YDL A;  2ZCE A;  3EFS A;  2GCX A;  1UGR B;  4LVK A;  3CEY A;  1WHK A;  1KQS P;  2GQV A;  3PCO A;  2DQ3 A;  1RI0 A;  1C0A A;  2ZPI B;  1Q82 U;  5GAN 4;  2CSQ A;  1TUD A;  1TH7 A;  1WHH A;  2DRK A;  4J9E A;  2QEX A;  1NJ2 A;  3L2V A;  4Z89 A;  4RQE A;  3CBO A;  3H41 A;  1ZLM A;  4FT4 A;  4F7U B;  2R5M A;  2E3H A;  2VB6 A;  1TOV A;  2QGG A;  4A4E A;  2DEQ A;  2ENM A;  3M5A A;  8AT1 B;  5GMK i;  4HCC A;  5GAN h;  2EYQ A;  2RHI A;  3CCL T;  5GAN 7;  4DQ2 A;  1QVF S;  4FU6 A;  1X6B A;  1EOV A;  3DLL A;  4ZGD B;  4P73 C;  2LQK A;  1FYN A;  1ARK A;  3RIR A;  3F70 A;  1X69 A;  4ZGJ B;  2QA4 A;  3MP1 A;  2ZAE A;  2A3L A;  1MND A;  4J6Y A;  3NEM A;  2X4J A;  2PMF A;  4QQG A;  3RKY A;  3J80 E;  3CC2 A;  3N5B B;  3G71 T;  3GOX A;  2MAM A;  3JCM X;  2DER A;  1PG5 B;  2QHS A;  3FJ5 A;  2Q7E A;  2G6F X;  3VQV A;  2EQK A;  2AKL A;  3OYC A;  1I81 A;  2LJ1 A;  1N8R R;  1RI9 A;  2GTJ A;  2RHS B;  1IO6 A;  2DL8 A;  4FYV B;  3PZC A;  2OAU A;  4CH4 A;  4KH0 B;  1HK9 A;  4TVR A;  1UGV A;  4OF1 A;  3P8B B;  4H2Y A;  5C53 B;  2OAW A;  2RQR A;  3FC3 A;  4PLL A;  3NMZ C;  3G6E T;  1Y7X A;  4TVW A;  4G85 A;  3KBG A;  1VQN A;  1G8X A;  1QCF A;  1WJQ A;  4J8O A;  4JS5 A;  4BE2 A;  4FW1 A;  4PJL A;  1MMD A;  2LCS A;  2Q7G A;  1QF6 A;  1XTD A;  1K73 U;  5KYU A;  5J26 A;  4R55 A;  2DEU A;  5I22 A;  2FEI A;  2ZCF B;  1I07 A;  1QW1 A;  1NJ6 A;  2ZR2 A;  2LP5 A;  4X1V A;  2QYZ A;  5D7U A;  1VQ5 Q;  2RD1 A;  2ZPH B;  3C0C A;  1Q7Y U;  1WU7 A;  1AVZ C;  4DBQ A;  3L2Z A;  4OMF B;  3OYF A;  2KMT A;  1FMV A;  3CCQ T;  2EFI A;  2MYS A;  1B7T A;  2XU8 A;  3RL6 A;  1G3S A;  1MMG A;  3OMC A;  5FWB A;  1KOG A;  4EMH A;  1QVF A;  3HXU A;  2NUP A;  4K11 A;  3R07 A;  1ABO A;  1DJ7 B;  1LJO A;  1KSW A;  1I4K 1;  3PE0 A;  2L0A A;  3M54 A;  4LDU A;  2RK2 A;  1VQO A;  2DA9 A;  1JJ2 A;  2XIC A;  4OB3 B;  2DKG A;  2ZIO A;  1G3T A;  1WZO A;  2EWN A;  3VV0 A;  1J5W A;  5GAM f;  4DA4 A;  4PHC A;  1T0H A;  3A31 A;  4XU1 A;  3E9G A;  1M1K R;  2LDM A;  2SEM A;  3ULR B;  2DXT A;  3EGX A;  5F5W A;  5I21 A;  2FG0 A;  2CZ1 B;  3M58 A;  3EG9 B;  5LJ3 g;  5LJ3 d;  1Q81 R;  2KT1 A;  4HVV A;  3CCM Q;  2FL7 A;  1NYF A;  3GPL A;  3BFM A;  2DD4 A;  1W2B P;  2L2P A;  3R6N A;  5C0M A;  4J6X A;  3VUZ A;  1LCK A;  1B7Y A;  1K76 A;  3HFN A;  2P4T A;  3M0T A;  3A7R A;  1WQ7 A;  2GGR A;  2RN8 A;  4AFU C;  3EG2 A;  2M0Y A;  1TTH B;  4AG2 C;  2F1L A;  3FDR A;  1H4V B;  1WI7 A;  2DXB A;  4C0F A;  4C92 C;  3EG1 A;  4DOV A;  1UUE A;  2X51 A;  3V7C A;  1WHJ A;  2P0L A;  1H3Z A;  1B3Q A;  4D6W A;  3L2Q A;  1M2O A;  2JNG A;  2KRN A;  2CZ0 B;  2RHQ B;  2YUP A;  1WIE A;  3H8Z A;  1M4Z A;  4C5E A;  2Z0W A;  1S72 A;  2ZPG B;  4LN2 A;  3JB9 H;  3JCM J;  2OX7 A;  2C0T A;  4L87 A;  2K57 A;  3CCL Q;  2QXF A;  1QCO A;  1GRI A;  2JS2 A;  2DBM A;  4KQE A;  2BUD A;  3IKM B;  4JUV A;  1RLP C;  3PGG A;  3GF5 A;  1M3C A;  2K6D A;  1NM7 A;  4KGX B;  4PK4 A;  4YRK A;  4H2W A;  4CH5 A;  1W4S A;  1Z9Z A;  1NJ1 A;  2HQX A;  3DB3 A;  1IRX A;  3RNJ A;  3NFC A;  2LT1 A;  4AH6 A;  1AD5 A;  2O01 E;  4XK8 E;  2KRO A;  3MEW A;  1QP2 A;  3G1J A;  1X2G A;  4E7K A;  3M0P A;  1BK2 A;  5DM7 R;  1N6A A;  2JZ2 A;  3OW2 P;  2JUF A;  3T9N A;  3RER A;  1QE0 A;  1ZSZ C;  3CC4 A;  2OTJ A;  4L6V 5;  2ZNJ A;  3M4Y A;  4C5I A;  1RAD B;  1D3B B;  1JXO A;  1VQ9 A;  3PT9 A;  4YRR A;  3CXC P;  3MJX A;  5HY6 A;  2M16 A;  3C4S A;  2LZ6 B;  2A8E A;  1MGQ A;  4Z88 A;  4ZN1 A;  4FW2 A;  3S3O A;  4GBQ A;  4TVA A;  2YRC A;  4PG3 A;  2K79 A;  2KYM A;  3DKM A;  4OGC A;  3CCJ T;  3HPW A;  2RI5 A;  4M4Z A;  2YLC A;  2LNH B;  2ZTG A;  1H3H A;  3DSQ A;  4BY6 B;  3NEN A;  4FYW B;  2RH2 A;  3OSV A;  2HD0 A;  2YUQ A;  1M1K U;  1KHC A;  3RKW A;  3RKX A;  3VS6 A;  1ZBX A;  4JJB A;  3FIF A;  2Q5I A;  3MCA B;  1QWF A;  2C0I A;  2JT4 A;  2W0Z A;  4PJJ A;  3EH2 A;  2ODR C;  1VQL Q;  4BE1 A;  1NG2 A;  3PFS A;  2QA4 Q;  4F7U F;  2LC4 A;  4LE9 A;  3HXW A;  2KE9 A;  4P3O A;  4D8K A;  1YJW Q;  3A74 A;  2DVE A;  3OW2 A;  1M5Q 1;  1AT1 B;  1SET A;  4WTO B;  2RPN A;  2HZY A;  5D6W A;  1K9M C;  5GAN 6;  5L8R E;  1K8A R;  2DLP A;  1FXX A;  4M77 C;  4HT8 A;  4YCV A;  2FPE A;  4KBM B;  1YFT A;  3UGT A;  2DF6 A;  4MZP A;  4ZTZ B;  3P8H A;  2D1X A;  3OQ5 A;  3ZBD A;  4RTY A;  5A0L A;  2D8J A;  4NL2 A;  1VQM A;  2EJF A;  2CT3 A;  3THK A;  2J3M A;  1H4T A;  1M1F A;  2ATC B;  3CCM T;  2EBP A;  3EFR A;  3G71 A;  2DO3 A;  3VRZ A;  2LNV A;  4RKU E;  4J7I A;  1EFN A;  3I5R A;  2DL4 A;  4XU2 A;  1PD1 A;  1AHJ B;  3OYD A;  3UF4 A;  2ODR D;  2A7Y A;  1B07 A;  2O9V A;  2X4Y A;  1OZ2 A;  4HA8 A;  4ZTJ A;  1VQ7 Q;  3JCM V;  4M7A E;  4C8Q D;  1W66 A;  1RUW A;  1KQS A;  4CRI A;  2R5A A;  1RAA B;  1KK7 A;  2DD5 A;  2PVO B;  4P5N A;  3D7S B;  1N8R U;  4M7A D;  1TS9 A;  2ED0 A;  1BI0 A;  1T3L A;  2MF2 A;  3L2U A;  4YRL A;  4OML A;  5GMK e;  4J6W A;  2AKW B;  4E7L A;  2RJF A;  2HKN A;  4BUG A;  2QK0 A;  5KYU B;  3GIB A;  3NET A;  1WDX A;  4P71 A;  2ZT5 A;  1EFW A;  2JM8 A;  1H92 A;  1D0X A;  1IGU A;  3PMI A;  4KR2 A;  4M7D D;  2YT6 A;  2KSS A;  3HRS A;  1M2V A;  3HY0 A;  2IPO B;  4NS5 A;  1WHG A;  2DYB A;  2O88 A;  4PJN A;  4F7U A;  1MNE A;  2HDA A;  5I2S A;  2FZG B;  3JCM h;  4C8Q B;  4HT4 A;  3VS1 A;  2BZ8 A;  4WJ4 A;  1GFD A;  5IHI A;  1YN8 A;  2DMO A;  5FRN A;  4HWP A;  3CC7 A;  1VYT A;  2X3W D;  2PU9 B;  3EAE A;  4OGE A;  2EQI A;  1X6G A;  4M77 A;  1WYD A;  4M77 B;  1X75 C;  4ANJ A;  4ATO A;  3JCM W;  2KY9 A;  3QO3 A;  5GAM h;  1PCX A;  3BY7 A;  1SHG A;  1N9S A;  3LYI A;  4OMM A;  1NPR A;  3NPF A;  2PVD B;  3H0F A;  4OLF A;  3VS3 A;  4P3P A;  1VQ9 Q;  5A0G A;  1NLP C;  3CME Q;  2H3E B;  5GAM e;  1VIE A;  4EIK A;  1Q81 U;  1ASY A;  2LT4 A;  3RMS A;  3GLX A;  3L2W A;  3MP8 A;  2E6Z A;  2RI3 A;  2QQB A;  3A8G B;  4PKC C;  3UGQ A;  2RHX A;  2HKQ B;  3QJ6 A;  4KUL A;  2XDP A;  2AT1 B;  1ZX6 A;  2DTH A;  1X01 A;  2E6N A;  1YWP A;  2LRQ A;  1YNZ A;  1W2B S;  4BB7 A;  2B8A A;  1M9S A;  4P3N A;  3HXZ A;  4IIM A;  1K9M R;  2A37 A;  1MMN A;  2DTO A;  1H64 1;  2KBT A;  5FLX E;  2EGE A;  2QG9 B;  5LJ5 h;  5ELO A; 
#chains in the Genus database with same CATH homology
 5CK9 A;  5CQY A;  4MDW A;  1SRY A;  2DU5 A;  3M56 A;  3PCO B;  1VQ4 T;  4ZIB A;  5CCA A;  4M75 B;  4YYE A;  1BI3 A;  4M75 A;  3OYK A;  5A2Q E;  3A7U A;  4A4G A;  2I4M A;  2E1H A;  4QQ6 A;  5IAY A;  2XTI A;  3BDL A;  3OBY A;  3WVE B;  5CO7 A;  1KQS S;  3UWN A;  3ME9 A;  3I55 A;  5LJ5 d;  3V7R A;  3G4S T;  2RJC A;  2GFU A;  2EJG A;  1BYM A;  3FB9 A;  4LVI A;  3QHS A;  2QHT A;  2ZZG A;  2YHT A;  4YRF A;  2AMC B;  2E70 A;  2PUO B;  5GAN e;  4A4K A;  2V8K A;  2L3R A;  4FM4 B;  4XAX B;  2QHV A;  1WLE A;  1RIQ A;  4P72 C;  4LD6 A;  4M77 F;  2QQ9 A;  4N4H A;  2RHS A;  5CVI A;  4ZGE B;  5ELN A;  4HWT A;  4C0G A;  5CQX A;  1QVP A;  1Q81 C;  3VQW A;  3SWN C;  1Q82 C;  4M77 G;  4IUR A;  4WJ3 M;  3QXE B;  5KCH A;  3BW1 A;  1PYS A;  1YFR A;  3X26 B;  3PTA A;  4C92 E;  3NTK A;  3TCJ A;  1JJC B;  2KQW A;  2V8I A;  4JDS A;  3MEU A;  4EO4 A;  1PSE A;  4M78 G;  1K8A C;  3PMT A;  3HRU A;  3LWH A;  4M78 C;  4UC4 A;  2VUB A;  3CMA A;  3ZEH A;  3GNG A;  2VGN A;  3HFO A;  1KMM A;  3CXC S;  5KH6 A;  4RCC A;  5HK0 A;  4X5O A;  1MHN A;  3JCM P;  2L8D A;  4HVC A;  4O5V A;  3CCV A;  4ELY C;  3RES A;  1EQR A;  4LVL A;  1B76 A;  1JBM A;  4Z02 A;  2QTX A;  2NS6 A;  2F69 A;  3OYL A;  2LCC A;  4MMK A;  1X54 A;  2ZT7 A;  4H2S A;  3BDU A;  4HWO A;  3M53 A;  1WJR A;  3JAM E;  3REU A;  4II1 A;  3CC2 T;  3QPH A;  1IZ6 A;  4CS3 A;  2Y4Y A;  4C8Q A;  4BE0 A;  3QO8 A;  4P75 C;  3JCM e;  1ASZ A;  4IKF A;  4V2S A;  2JN0 A;  2EAY A;  1B34 B;  4CI0 C;  3QII A;  4KUD K;  4H2X A;  2LQ8 A;  1UGP B;  2CKK A;  1FX7 A;  3JCM f;  2M9U A;  5IN1 A;  1NE8 A;  4M7D E;  3OYG A;  4KR3 A;  1VQ4 A;  3A8O B;  1XNI A;  3LSS A;  4C92 D;  1USY C;  1KC8 C;  1G3Y A;  3A5Z B;  2HBP A;  4KT0 E;  4UP9 A;  2RO0 A;  5K1X A;  3VQX A;  4RG8 A;  2DZC A;  4YRO A;  3CCQ A;  2RB6 A;  2CYZ B;  2GF7 A;  4M7D A;  3E1S A;  3CCU A;  2QA4 T;  3JB9 I;  1D3B A;  1M90 U;  3OW2 S;  1VQ5 T;  4IUQ A;  1XQH A;  4CH6 A;  4YRQ A;  3HY1 A;  2K5I A;  2KAF A;  1KQ2 A;  4HKE A;  3NTI A;  1EIY A;  2ALY A;  4C0Z A;  2DQ0 A;  4DOW A;  3QYG B;  2FHD A;  1PYS B;  5FU6 B;  3X24 B;  3E9F A;  3M4P A;  3G6E A;  3CCL A;  3W3S A;  3E19 A;  2FB7 A;  3MF1 A;  5GAN 5;  2CS7 A;  1G5V A;  4BD3 A;  2CGH A;  1VUB A;  2O4X B;  2DPP B;  5GAO n;  3MP6 A;  2DDZ A;  2ZZD A;  2K4Y A;  4TVA B;  1VQP A;  4QVC A;  2H3J A;  2I4O A;  2E5Q A;  3V8L A;  1YJN T;  4RG2 A;  3OS1 A;  5FU7 C;  3SWN B;  4BY6 C;  2EQM A;  3LX7 A;  2RK1 A;  5C51 B;  3M59 A;  3CCR T;  5LJ3 j;  1ZHI A;  4P75 A;  4M7A F;  2YRV A;  4PJO F;  4NL3 A;  2WSE E;  1H4S A;  4E7I A;  3TU4 K;  3RGL A;  3VYG A;  2R57 A;  3VQY A;  3PNW C;  2F5K A;  3WVD B;  1YJW T;  1M8V A;  5J3B A;  1QP3 A;  3MET A;  1YB3 A;  5GAN 3;  1VQK T;  4PJO G;  5J39 A;  1PSF A;  2LTO A;  4M7D C;  1NPP A;  5CIU A;  1NJI U;  1QVG S;  4J83 A;  4C0D B;  2E64 A;  2AMC A;  3V8J A;  3QZ5 B;  2WAC A;  4LD9 K;  2PQW A;  3CCE T;  2DU7 A;  3QO5 A;  3MQZ A;  3QG1 A;  2AHJ B;  1K8A U;  3LGL A;  1HTT A;  4PNO A;  3CMA T;  4RMO A;  2JTM A;  3R6O A;  3QKJ A;  3JCM c;  5LJ5 f;  5CKF A;  2PVG B;  2VYT A;  2L5Q A;  1B8A A;  2CZ6 B;  4LDX A;  2K2V A;  3HKS A;  3OS5 A;  2RI2 A;  3PIO A;  2EL9 A;  1ADY A;  4M78 B;  2XK0 A;  3QUI A;  3ZFJ A;  4YRE A;  4XTY A;  1Q86 C;  4N4I A;  3A32 A;  2RJD A;  2XID A;  1UEB A;  4UP7 A;  2BIV A;  5LJ5 j;  1N27 A;  4LDW A;  4BDZ A;  5GAN j;  2Q5H A;  1KMN A;  3OYN A;  5GMK m;  2L89 A;  4A54 A;  3VUB A;  4C8Q G;  2MWO A;  1W2B A;  2FYK A;  3CCS A;  2K5L A;  2I4L A;  1WQW A;  2PME A;  4O6J A;  3CXC A;  1K9M U;  2HAX A;  4M78 D;  2QQS A;  2ARU A;  3P8V A;  3UPU A;  4C8Q F;  3PIP A;  2IY5 A;  4YRJ A;  5KNN A;  4YDQ A;  2X4X A;  4M78 E;  4K87 A;  3CPW S;  5DY9 A;  5CAI A;  2GFA A;  4M7A B;  1VQP T;  2M0O A;  4BI3 A;  2X4W A;  4XQ3 A;  3S3N A;  3JCM b;  1M1K C;  1K73 C;  3ERR A;  3CCU T;  2XD0 A;  4C92 A;  1B70 B;  2QQA A;  4C0D C;  3P8Y A;  4YRN A;  4EMK A;  4UPA A;  4XTZ A;  1R8O B;  3JCM d;  4P72 A;  1NJ8 A;  2F5T X;  4A4F A;  1YI2 T;  3A8L B;  4NCX A;  5LJ5 e;  3CCM A;  3HRT A;  5CKH A;  3A8M B;  5I2M A;  4JRP A;  1B34 A;  2E3C A;  3BJU A;  3QNE A;  4PL6 A;  2WSF E;  1P92 A;  2D9T A;  3JRZ A;  2X35 A;  4P71 C;  4YCW A;  2QQR A;  4M75 G;  1EVK A;  2ZZE A;  4N0A A;  4M78 F;  3VU3 C;  1VQ6 A;  5GAO m;  3G1Z A;  2ZPE B;  3P8T A;  3CPF A;  3JB9 G;  2EIF A;  3OS0 A;  4OB1 B;  1O75 A;  1IL2 A;  3CD6 T;  3OYY A;  5FU6 C;  3G7Z A;  2E5A A;  2DXU A;  5FRM A;  4RCB A;  2LX9 A;  4L5G A;  3HFZ A;  1VQK A;  1YHQ T;  3CME A;  1YJN A;  2DXC A;  2FVU A;  3OD1 A;  3ASK A;  1X6O A;  5LL6 S;  2EQU A;  5KE3 A;  4E7J A;  5EG2 A;  1UGQ B;  3RAC A;  1YJ9 T;  3CCS T;  5K1P A;  3OYM A;  4LVJ A;  4ZTF A;  1FWZ A;  2DK3 A;  2XI9 A;  2QI2 A;  4B9X A;  4ELZ C;  1YJW A;  4CS2 A;  3H6Z A;  4RMF A;  4BAC A;  3J81 E;  3LWI A;  2LCL A;  3DLM A;  3C12 A;  3LLR A;  3SWN A;  3J7A F;  4JLG A;  1BI2 A;  4JRI A;  1YGB A;  3CC7 T;  1KQ1 A;  1BIB A;  5C52 B;  4PLI A;  4RDX A;  1G51 A;  2ZT8 A;  4HWS A;  1Q86 U;  2O4X A;  3FRN A;  3SB2 A;  1EVL A;  1BIA A;  2YLB A;  3KFU A;  3IG2 A;  3AHU A;  2QHU A;  4H2U A;  1RL2 A;  1FYF A;  1B70 A;  4YP0 A;  1E1T A;  2JOY A;  4EMG A;  3FLG A;  1KHI A;  2V8J A;  3CBP A;  4N0A C;  2VGM A;  3LSQ A;  3RUX A;  2MWP A;  4X34 A;  1VQ7 A;  1SSF A;  1LYL A;  3I7F A;  4OVA A;  1BI1 A;  3IAL A;  4YRG A;  2VC8 A;  2DAQ A;  5GMK j;  3ER0 A;  4CS4 A;  2I4N A;  3CMQ A;  2ZGW A;  4FL6 A;  3X20 B;  3OYJ A;  2EQJ A;  4K86 A;  4L59 A;  2XG8 D;  2RHU A;  1Z7N A;  3TRE A;  1B7Y B;  1U1S A;  1BKB A;  3CBM A;  4Q15 A;  2BKD N;  2ZR3 A;  3MF2 A;  3GP8 A;  2E12 A;  3M9Q A;  3P8D A;  1Y96 B;  2C7I A;  2P0P A;  2XDD A;  2AKW A;  5LJ5 g;  1JRI A;  1HC7 A;  4Y28 E;  2XGT A;  5LJ3 f;  5HGQ A;  2XKO C;  4BW9 A;  5CKD A;  4IUP A;  1G3W A;  4M7A G;  1YHQ A;  3C94 A;  2DTI A;  5AYF A;  5LJ3 e;  4K88 A;  3I55 T;  2JVV A;  2CJB A;  4YCU A;  4IUV A;  2ZXF A;  3O8V A;  1VQZ A;  1Z7M A;  1YI2 A;  1JJ2 S;  4YRP A;  2DZ9 A;  2K3Y A;  1XOV A;  2K5F A;  1IRE B;  3M4Q A;  2CIM A;  4G84 A;  2EKO A;  2CJA A;  4P73 A;  3KUF A;  3L42 A;  3OS2 A;  3TEH B;  1VQ8 T;  4MDX A;  1X55 A;  4FIB A;  4M7A C;  3OB9 A;  4XTX A;  2CZ7 B;  2QDY B;  4XU0 A;  4YRI A;  1E1O A;  4N4G A;  2IG0 A;  3CC4 T;  2OTJ T;  3NEL A;  3HL8 A;  2DIG A;  5GAO p;  4UP8 A;  5FU7 B;  4EMK B;  1VQ9 T;  4EX5 A;  3I56 T;  4EPC A;  3M57 A;  3HRK A;  1VQO T;  3HXX A;  1GGM A;  3M55 A;  5GAO r;  4M7D F;  3CME T;  4FT2 A;  1EIF A;  1G5I A;  4H2T A;  1KD1 C;  2D0Q B;  3TEE A;  2Y4X A;  4M75 C;  3CCV T;  4WI1 A;  2VXF A;  4QVZ A;  3TUP A;  5GMK h;  2LVM A;  4H2V A;  5D6Y A;  2ZT6 A;  3HFZ B;  5GAO q;  3MEY A;  1KG1 A;  2ART A;  2C06 A;  4M77 D;  3QSU A;  1L0W A;  4VUB A;  4YTL A;  4M75 D;  1OI1 A;  4MZT A;  3LW5 E;  4Y91 A;  4HT9 A;  5KE2 A;  2ZPF B;  4C8Q C;  2HNI A;  3TEH A;  4QVD A;  1YJ9 A;  4P74 C;  2KVQ G;  3RMQ A;  3DB4 A;  1OZ3 A;  1VQM T;  2XHC A;  2Y90 A;  4E47 A;  5DLO A;  3HXY A;  1M1G A;  3VJP A;  3QJY A;  4JRK A;  4FSX A;  1Y96 A;  3HSB A;  3VYH B;  4C8Q E;  4JS4 A;  3L4G A;  3LC0 A;  3WXM B;  1HXD A;  1VQ7 T;  3UT1 A;  5GAN d;  4TQF A;  1LOJ A;  4LVM A;  3TEG A;  3OYH A;  1O9S A;  1VQ5 A;  2E65 A;  4JLI A;  4TTV A;  3RF1 A;  5A0D A;  4BI4 A;  4JJN K;  2E10 A;  4J5Y A;  4HCZ A;  3JCM Q;  4F7U E;  1V29 B;  2I2L A;  3MEA A;  3LH0 A;  4M75 F;  3S6W A;  3QYH B;  4NOY A;  2ALY B;  1E22 A;  4PJO C;  1YIT T;  5GMK l;  2XDB A;  3UDC A;  3FEO A;  3CCR A;  4ZTU B;  3QZ9 B;  4M77 E;  3E9I A;  2C8M A;  4B9W A;  5DLQ E;  4C92 G;  3JB9 F;  1U8R A;  5GAN 8;  3OMG A;  1YCY A;  2R58 A;  5D6X A;  4M7A A;  4J7F A;  4Q5W A;  4O2D A;  4X9C A;  1YIJ A;  4EMK C;  3A8H B;  2ZNI A;  1I5L A;  1USY A;  4C92 F;  3UFG A;  1YFS A;  1QVG A;  2G4C A;  1X2H A;  5GAO l;  3QTC A;  2ZPB B;  3NTH A;  5KCO A;  1VQ8 A;  1E24 A;  5HKC A;  1H4Q A;  2P0Q A;  4C5H A;  3MEV A;  2JTF A;  2VXE A;  1ATI A;  2ZZF A;  4GY5 A;  1JB0 E;  5GAM d;  2DIQ A;  1JJC A;  2HQE A;  3OBW A;  1Y71 A;  1Y07 A;  3JSC A;  4XU3 A;  4BWA A;  3L1A A;  2P0K A;  1BBW A;  5LJ3 h;  4ME7 A;  3MHX A;  1SER A;  3REX A;  1NZ9 A;  3FJP A;  3A7A A;  4OB0 B;  4GLK A;  3SDZ A;  3SFM A;  3IKL A;  4Q6G A;  4QQD A;  3Q1J A;  3OY9 A;  1N8R C;  4XEM A;  4XTU A;  2ZIM A;  3HHT B;  5M9O A;  3V8K A;  1VQL T;  2OTL A;  4M7D B;  4H02 A;  3VKI A;  3CCE A;  2RM4 A;  2RJE A;  4MZM A;  3VBB A;  3L4G B;  2K3X A;  3I56 A;  2MMP A;  3L2R A;  4BDY A;  3SD4 A;  3G4S A;  2E41 A;  1ADJ A;  4CH3 A;  2P5I A;  3OYI A;  2Q7H A;  1GXI E;  1SES A;  3C95 A;  4OB2 B;  4X9D A;  4PJO D;  5FRO A;  1VIF A;  2QEX T;  4TQD A;  5E3I A;  4A4H A;  1OYX A;  2VV5 A;  3KXT A;  4OP0 A;  3CPW A;  4C5G A;  2PUK B;  3A5Y A;  1KC8 U;  4JRQ A;  4RQF A;  4QW2 A;  5CR2 A;  4XTW A;  2IVW A;  4LDY A;  3OYE A;  1WNL A;  3HP9 A;  4ZN3 A;  1LNX A;  2RHY A;  1X56 A;  1U1T A;  4M75 E;  4C92 B;  2J3L A;  5HK3 A;  4P74 A;  1WPY A;  4PJO B;  3OSS C;  1NJ5 A;  3E9H A;  1WJS A;  4F7U G;  2CJ9 A;  4XTV A;  1N9W A;  3X28 B;  3WQZ A;  2RA2 A;  2KDS A;  1VQN T;  3QBY A;  4YRS A;  5CKE A;  1NYQ A;  4LDV A;  3HTZ A;  2KK4 A;  5GAN 2;  5C6S A;  5GAN g;  2G3R A;  2RHQ A;  1M90 C;  1NNH A;  1UB4 A;  4M78 A;  3OA6 A;  4WF2 A;  1NJI C;  5GAM g;  3HFV A;  3QO7 A;  3HRI A;  1EIY B;  11AS A;  3A5Z A;  1UGS B;  4KUI A;  2WSC E;  4R56 A;  4PJO A;  4A53 A;  2IY5 B;  1YIJ T;  4HCB A;  4E51 A;  4YRC A;  1Q7Y C;  12AS A;  5IT9 E;  2MI6 A;  4EDU A;  5GAM j;  3OYA A;  3JCM g;  3CD6 A;  3JB9 D;  3HXV A;  1KD1 U;  4PJO E;  4DPG A;  1G5H A;  4H2X B;  3URG A;  1NYR A;  1WGS A;  4TVY A;  2ARS A;  3OYB A;  2RHZ A;  4M7D G;  4BI8 B;  1YIT A;  3V7S A;  4MML A;  1YBY A;  3QDR B;  3ICA A;  3LGF A;  3MO8 A;  3M4G A;  3X25 B;  3JB9 J;  3UH0 A;  1N9R A;  2D6F A;  4XEO A;  2DJZ A;  4HWR A;  4IUU A;  4YRM A;  3INZ A;  3GNF B;  2NLU A;  3S3M A;  5GAN f;  3CCJ A;  1VQ6 T;  1ZQ1 A;  4E7H A;  5CKB A;  1I8F A;  4LNS A;  4IUT A;  2M1H A;  4J15 A;  1S72 T;  1VQL A;  2EJ9 A;  2OTL T;  2ZIN A;  1BBU A;  4YRT A;  4TWA A;  4YPF A;  2ZCE A;  3EFS A;  2GCX A;  1UGR B;  4LVK A;  3CEY A;  2GQV A;  3PCO A;  2DQ3 A;  1RI0 A;  1C0A A;  2ZPI B;  1Q82 U;  5GAN 4;  1TH7 A;  2QEX A;  1NJ2 A;  3L2V A;  4RQE A;  3CBO A;  4FT4 A;  4F7U B;  2R5M A;  4A4E A;  2DEQ A;  3M5A A;  5GMK i;  4HCC A;  5GAN h;  2EYQ A;  2RHI A;  3CCL T;  5GAN 7;  4DQ2 A;  1QVF S;  4FU6 A;  1EOV A;  3DLL A;  4ZGD B;  4P73 C;  2LQK A;  3RIR A;  3F70 A;  4ZGJ B;  2QA4 A;  3MP1 A;  2A3L A;  4J6Y A;  3NEM A;  2X4J A;  2PMF A;  4QQG A;  3RKY A;  3J80 E;  3CC2 A;  3N5B B;  3G71 T;  3GOX A;  2MAM A;  3JCM X;  2QHS A;  2Q7E A;  3VQV A;  2EQK A;  3OYC A;  1I81 A;  2RHS B;  3PZC A;  2OAU A;  4CH4 A;  1HK9 A;  4TVR A;  4OF1 A;  3P8B B;  4H2Y A;  5C53 B;  3FC3 A;  4PLL A;  3G6E T;  1Y7X A;  4TVW A;  4G85 A;  3KBG A;  1VQN A;  1WJQ A;  4J8O A;  4JS5 A;  4BE2 A;  2Q7G A;  1QF6 A;  1XTD A;  1K73 U;  4R55 A;  5J26 A;  2ZCF B;  1QW1 A;  1NJ6 A;  2ZR2 A;  2RD1 A;  2ZPH B;  1Q7Y U;  1WU7 A;  3L2Z A;  4OMF B;  3OYF A;  2KMT A;  3CCQ T;  2EFI A;  2XU8 A;  3RL6 A;  1G3S A;  3OMC A;  1KOG A;  4EMH A;  1QVF A;  3HXU A;  3R07 A;  1DJ7 B;  1LJO A;  1I4K 1;  3M54 A;  4LDU A;  2RK2 A;  1VQO A;  1JJ2 A;  2XIC A;  4OB3 B;  2DKG A;  2ZIO A;  1G3T A;  2EWN A;  3VV0 A;  1J5W A;  5GAM f;  4DA4 A;  4PHC A;  3A31 A;  4XU1 A;  3E9G A;  2LDM A;  2DXT A;  5F5W A;  5I21 A;  2CZ1 B;  3M58 A;  5LJ3 g;  5LJ3 d;  2FL7 A;  3GPL A;  3BFM A;  2DD4 A;  5C0M A;  4J6X A;  3VUZ A;  1B7Y A;  3HFN A;  2P4T A;  3A7R A;  1WQ7 A;  3FDR A;  1H4V B;  2DXB A;  4C0F A;  4C92 C;  4DOV A;  3V7C A;  2P0L A;  1H3Z A;  4D6W A;  3L2Q A;  2JNG A;  2CZ0 B;  2RHQ B;  3H8Z A;  1M4Z A;  4C5E A;  1S72 A;  2ZPG B;  3JB9 H;  3JCM J;  4L87 A;  2K57 A;  2QXF A;  4KQE A;  2BUD A;  3IKM B;  4JUV A;  3PGG A;  3GF5 A;  4YRK A;  4H2W A;  4CH5 A;  1W4S A;  1NJ1 A;  2HQX A;  3DB3 A;  3NFC A;  2LT1 A;  4AH6 A;  2O01 E;  4XK8 E;  3MEW A;  1QP2 A;  1X2G A;  4E7K A;  5DM7 R;  1N6A A;  2JZ2 A;  3RER A;  2JUF A;  3T9N A;  1QE0 A;  3CC4 A;  2OTJ A;  4L6V 5;  2ZNJ A;  3M4Y A;  4C5I A;  1D3B B;  1VQ9 A;  3PT9 A;  4YRR A;  5HY6 A;  2M16 A;  3C4S A;  2A8E A;  1MGQ A;  4ZN1 A;  3S3O A;  4TVA A;  4PG3 A;  3DKM A;  4OGC A;  3CCJ T;  3HPW A;  2RI5 A;  2YLC A;  2ZTG A;  3DSQ A;  4BY6 B;  3NEN A;  2RH2 A;  3OSV A;  2HD0 A;  1M1K U;  1KHC A;  3RKW A;  3RKX A;  1ZBX A;  3FIF A;  2Q5I A;  3MCA B;  2ODR C;  4BE1 A;  3PFS A;  4F7U F;  2LC4 A;  3HXW A;  4P3O A;  3A74 A;  2DVE A;  3OW2 A;  1M5Q 1;  1SET A;  5D6W A;  1K9M C;  5GAN 6;  5L8R E;  1FXX A;  4M77 C;  4HT8 A;  4YCV A;  4KBM B;  1YFT A;  3UGT A;  4MZP A;  4ZTZ B;  3P8H A;  3OQ5 A;  3ZBD A;  5A0L A;  4NL2 A;  1VQM A;  2EJF A;  2J3M A;  1H4T A;  1M1F A;  3CCM T;  3EFR A;  3G71 A;  2DO3 A;  2LNV A;  4RKU E;  4J7I A;  4XU2 A;  1AHJ B;  3OYD A;  2ODR D;  2A7Y A;  2X4Y A;  1OZ2 A;  4HA8 A;  4ZTJ A;  3JCM V;  4M7A E;  4C8Q D;  1W66 A;  1KQS A;  4CRI A;  2R5A A;  2DD5 A;  2PVO B;  1N8R U;  4P5N A;  4M7A D;  1BI0 A;  2MF2 A;  3L2U A;  4YRL A;  5GMK e;  4J6W A;  2AKW B;  4E7L A;  2RJF A;  4BUG A;  3GIB A;  3NET A;  4P71 A;  2ZT5 A;  1EFW A;  3PMI A;  4KR2 A;  4M7D D;  2KSS A;  3HRS A;  3HY0 A;  4NS5 A;  4F7U A;  5I2S A;  3JCM h;  4C8Q B;  4HT4 A;  4WJ4 A;  5FRN A;  4HWP A;  3CC7 A;  2PU9 B;  3EAE A;  4OGE A;  4M77 A;  1WYD A;  4M77 B;  1X75 C;  4ATO A;  3JCM W;  2KY9 A;  3QO3 A;  5GAM h;  3BY7 A;  1N9S A;  3LYI A;  1NPR A;  2PVD B;  4OLF A;  4P3P A;  5A0G A;  5GAM e;  1VIE A;  1Q81 U;  1ASY A;  2LT4 A;  3RMS A;  3GLX A;  3L2W A;  3MP8 A;  2E6Z A;  2RI3 A;  2QQB A;  3A8G B;  4PKC C;  3UGQ A;  2RHX A;  3QJ6 A;  4KUL A;  2XDP A;  2DTH A;  1X01 A;  2E6N A;  2LRQ A;  1W2B S;  4BB7 A;  2B8A A;  1M9S A;  4P3N A;  3HXZ A;  2DTO A;  1H64 1;  5FLX E;  5LJ5 h;  5ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...