3FJPA

Apo structure of biotin protein ligase from aquifex aeolicus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
219
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 67
structure length 219
sequence length 231
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fjpA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3fjpA01
1NYQA 1WLEA 4AH6A 1JBMA 2JN0A 4H02A 4XU2A 4Q6GA 2ZT6A 2DDZA 1N9RA 4P72C 1LNXA 2CGHA 3QNEA 1BBWA 1YFTA 3RESA 2AKWB 4EX5A 4TVWA 3E9HA 1NJ1A 1EVKA 3TUPA 1B8AA 1LJOA 4F7UE 4XQ3A 3A5YA 3MEYA 5C53B 4ZTZB 3DSQA 4M7AA 1Z7MA 3JB9G 4C92B 2ZR3A 4PJOA 3HY1A 2P5IA 4DQ2A 4KR3A 2ARTA 4PHCA 4BWAA 4N0AC 5GAMj 1ADJA 4Y91A 4JUVA 4YCVA 4F7UF 3VU3C 2I4OA 4JLIA 3E9IA 1X56A 5LJ5g 1VQZA 2CJ9A 5GAN2 4P75C 2K57A 5GAN4 3QHSA 4OP0A 3JCMd 5GAOp 4H2UA 5GMKe 1KQ1A 2YLBA 4J6WA 1KMNA 3VQVA 4CS4A 5GANj 3RKWA 3JCMc 4YRQA 4G84A 1W66A 2ZT8A 3JCMQ 3QO8A 1FYFA 1E22A 1U1TA 1EFWA 3A7AA 3JB9F 4ZTUB 2Y90A 1U1SA 4CH3A 1H4QA 4LNSA 4CH6A 4RCCA 2Q5HA 1NNHA 1IL2A 2DJZA 1X01A 3JB9H 2RB6A 4C92D 4YRFA 3RL6A 4TVAA 2ZCEA 3V8JA 4HT8A 4QVDA 1N9SA 1NYRA 4P3NA 4M7AC 4XEOA 5LJ3j 4XU0A 4PJOC 4XTYA 5GAMf 4M7DB 5C51B 5LJ5e 1TH7A 2ZR2A 2RM4A 5GAOn 3LSQA 2ZINA 4YRRA 4YRCA 4H2XA 5GMKi 1KMMA 3VQWA 3HXXA 1SRYA 2DQ0A 2RHQB 2EJGA 4RCBA 1E1OA 3GIBA 3I7FA 1LYLA 4TWAA 5K1PA 5GANf 4CH5A 1H4VB 1B7YB 5E3IA 3BDUA 4PNOA 4RQEA 3IKLA 4EO4A 2DU5A 2ARUA 4YP0A 2FB7A 2QTXA 2I4NA 4C92A 1YFSA 4YRPA 1QE0A 3BW1A 2Q7EA 2VXEA 1G51A 2CJBA 5GMKm 1NJ5A 4P73C 5GAOr 2ODRD 4M77D 3FIFA 4M7AE 4RMFA 3REXA 4DPGA 3CMQA 4TVAB 2PMEA 4M7DD 4NCXA 4PJOE 5GAMh 2DU7A 4EMKA 4M78B 5LJ3f 3FB9A 1QF6A 4P74C 4UP7A 4HWPA 2FYKA 3JCMP 4UP9A 3PZCA 4M7AF 1HTTA 4Q15A 3V7CA 4PJOF 4H2XB 4OLFA 3PCOA 1NJ8A 4YRIA 2EJFA 5GANh 5LJ5d 4KQEA 4KR2A 3EFRA 3A74A 3WQZA 4C8QB 1E1TA 2DQ3A 3V7SA 4P3PA 4XEMA 1I81A 4M78G 2ZXFA 3A7UA 2YLCA 4YROA 2E41A 1G5HA 1ATIA 4M77A 2I4LA 4EMGA 2ZGWA 1YCYA 4M7DA 2QHTA 3JCMW 4L87A 4MMKA 4M78D 1EVLA 2I4MA 5LJ3g 3NELA 5LJ3h 3JCMV 3HFNA 3PGGA 3IALA 3MF2A 4EMKB 1H4TA 3BFMA 1BBUA 2EL9A 3HFVA 2RHQA 1YB3A 5ELNA 3HXZA 5GAN3 3A7RA 2ZNJA 1YFRA 3NEMA 2ZIOA 1EOVA 1B7YA 3HRKA 3JCMf 3UGQA 4C92G 3HSBA 2DTHA 3PCOB 5GAOm 4TQFA 4UPAA 1EIYA 1Z7NA 4C8QD 2IY5B 1D3BB 3JB9I 1X2HA 3UFGA 1E24A 2AMCB 2ZZEA 5GAN5 4J15A 3VQXA 3BY7A 2DXTA 4TQDA 2QHSA 4NL2A 3UH0A 2DVEA 5ELOA 3W3SA 4O2DA 3M4QA 2VXFA 4C92E 3RIRA 3HXVA 3HTZA 4M77B 4M78A 1B34B 2ODRC 2ZT5A 5LJ3e 5K1XA 1M5Q1 3QSUA 4MMLA 2E3CA 5C52B 4K88A 4M75B 3RF1A 2DTOA 4H2YA 2Q7GA 3HY0A 3ERRA 4TTVA 5HGQA 4YYEA 4JRIA 3P8YA 4C92F 3LC0A 2J3MA 4J6YA 4A54A 2DTIA 2RHSB 1SERA 4H2WA 1LOJA 3JCMb 1C0AA 3JCMh 4E51A 4WF2A 1B76A 1B70B 1BIAA 1USYA 4HT9A 4J6XA 4C8QA 4YRMA 4M77G 4TVYA 1JJCB 3VQYA 1EIYB 4M7DG 4YRSA 4M75G 4A53A 1H641 3QTCA 4YRTA 1WPYA 3A5ZA 2CIMA 1JRIA 2XTIA 2ARSA 1KQ2A 3RGLA 4YRLA 5GAMg 4NL3A 4M77E 4YRJA 2C8MA 1G5IA 4M75D 3L4GA 4F7UB 3RACA 4M7DE 4M78C 4XTUA 4XTZA 3REUA 4CS3A 2E1HA 4J5YA 2DKGA 1HC7A 3TEGA 3V8LA 3JCMX 5KNNA 3QO7A 2G4CA 4HWSA 1WNLA 4V2SA 4X5OA 5LJ3d 4P3OA 3M4GA 5GANg 3JB9J 2C7IA 4M7DF 3HFZA 5GMKl 2IY5A 3ICAA 1D3BA 4YDQA 4G85A 2Q7HA 4H2SA 1WQWA 2AMCA 2J3LA 4WJ3M 3SWNB 5LJ5f 3RERA 2QHVA 3P8TA 3L1AA 3QO5A 2EWNA 4F7UG 1I5LA 3JCMJ 4K86A 3QO3A 2ZTGA 2E65A 4YCWA 5GMKh 1SETA 1B34A 4WI1A 4C92C 5DY9A 2YHTA 4NOYA 5GAMe 1H4SA 2DZCA 4XTWA 4M75A 2DZ9A 1MGQA 3QUIA 1L0WA 4M78E 4YRKA 1GGMA 4YRNA 3G1ZA 2RHSA 3L4GB 4EMKC 1ASZA 4C8QG 2E10A 1PYSB 5I21A 2DEQA 2ZIMA 1I4K1 3SB2A 1B70A 3BJUA 5CAIA 5GANe 2EJ9A 3V8KA 3RKYA 4XU3A 3OD1A 4M78F 2ALYB 1JJCA 4YREA 4K87A 1YGBA 3HFZB 1ASYA 2VC8A 4P71A 3JB9D 5LJ5h 3RUXA 3HXYA 1Y96A 4XU1A 4C8QE 3R07A 5GMKj 3KFUA 3HFOA 4HWRA 4ZIBA 4H2TA 4HWTA 4BW9A 2XGTA 4X9DA 4YRGA 2Q5IA 1WU7A 4CH4A 3TEHA 4F7UA 1HXDA 4M77C 4XTXA 4XTVA 4C8QF 4HA8A 5GAN6 5GAN8 2DXUA 4QVCA 3RKXA 1SESA 4M7DC 5GAOl 3LSSA 4M75C 4P73A 4CS2A 3NENA 2HNIA 4X9CA 2E5AA 2I2LA 1I8FA 3L2ZA 4H2VA 4HVCA 5GAMd 3MF1A 4M7AB 1ADYA 3JCMg 2ZT7A 4PJOB 1M8VA 4P74A 3SWNA 4PG3A 5LJ5j 3NETA 4HWOA 3HXUA 3EFSA 5GAOq 2ZZGA 1X55A 3INZA 4RDXA 3HRIA 2E64A 2ZZFA 5GANd 4P71C 1X2GA 4P72A 1Y96B 1NJ6A 3UGTA 1WQ7A 3P8VA 2ZNIA 2AKWA 4YCUA 4YPFA 3AHUA 2EAYA 3IG2A 4M7AG 1N9WA 1BIBA 2QHUA 3V7RA 4PJOG 3TEHB 2P0LA 4UP8A 2CJAA 4M75E 3HXWA 1PYSA 12ASA 2RD1A 1WYDA 4N0AA 4JRKA 11ASA 4M7AD 4M77F 4EMHA 3JCMe 2PMFA 2ALYA 1NJ2A 4PJOD 1X54A 1RIQA 4WJ4A 5GAN7 1EQRA 3VBBA 4P75A 4M75F 3IKMB 3M4PA 5F5WA 2RA2A 4RQFA 1HK9A 3A32A 3SWNC 1USYC 3FJPA 1J5WA 1KOGA 4C8QC 3A31A
chains in the Genus database with same CATH superfamily
4D8DA 1ZQ1A 1JBMA 3MP6A 1K0SA 2ZT6A 3MPUB 2JTFA 1N9RA 2GNCA 4EX5A 2LQ8A 2GTJA 1NJ1A 3PFSA 4F7UE 4XQ3A 3MEYA 1YIJT 2ENMA 3DSQA 2PTKA 2QDLA 3CC7A 3JB9G 1Z7MA 4KGVB 1ADJA 2HSEB 1KQSA 2CREA 1NM7A 2PVDB 3C4SA 3E9IA 2HCKA 1X56A 2MF2A 2CJ9A 5GAN2 4IIMA 3JSCA 1KSWA 4P75C 2OX7A 2K57A 3QHSA 2VUBA 4IKFA 2XU8A 1ZBJA 2YLBA 3VQVA 4CS4A 2MPXC 2GBQA 4ZNXA 4QQ6A 1W66A 1BI3A 4C5GA 1YNZA 1G3WA 3QO8A 4OF1A 1JJ2S 3A7AA 4ZTUB 4DOWA 3G6EA 1G83A 2JJ9A 3MEVA 3VS7A 4B9XA 3CCJQ 4RCCA 2DMOA 2DJZA 1X01A 1UGVA 4C92D 4YRFA 1FXXA 5KYNA 4BDZA 4GBQA 2EQUA 3V8JA 1NYRA 4QVDA 1OI1A 1Z9QA 4M7AC 3OYKA 2B8AA 1RAGB 1OULA 4PJOC 3VYHB 1TSFA 4M7DB 5HY6A 3A1PA 2DERA 2ZR2A 1U5SA 2K3XA 1Q86U 2ZINA 1VQ4Q 1V29B 2DQ0A 3HTRA 2RHQB 1AEYA 3QZ5B 2WSCE 3LLRA 5KH6A 2DETA 3PNWC 1H4VB 1RUWA 4FW1A 3OYHA 2K6DA 5LL6S 3PT9A 3DLLA 5E3IA 1D0XA 4RQEA 2JMCA 1M2VB 4FIBA 2P0PA 2ARUA 1K76A 4C92A 3GNFB 3SFMA 2X4WA 1G51A 2CJBA 5GMKm 5GAOr 3O5ZA 2QA4T 1EX4A 4RMFA 1GCPA 1VUBA 3Q1JA 4NCXA 2DU7A 4DBRA 2NUTA 4DEXA 2K5LA 2XDDA 2DA9A 4P74C 4HWPA 2D6FA 2DXBA 1Q86R 4Q15A 3V7CA 1UG1A 2NUPB 2ZZDA 3EG1A 4H2XB 1NEGA 3H6ZA 1GCQC 4OLFA 1G8XA 4YRIA 4M4ZA 2KRSA 1VQ4T 5GANh 5LJ5d 4ZTJA 3X28B 3FLGA 2GFAA 3EFRA 3CCVA 2Z0WA 2DQ3A 1E1TA 3V7SA 3G6EQ 4P3PA 1I81A 1VYUA 1PCXA 2DIGA 2ZXFA 1RAEB 3PVLA 3IQLA 2ZCFB 4PJLA 1ATIA 2XK0A 3HRSA 2VB6A 4HCZA 2K2VA 3M56A 3A5ZB 4ESRA 4LVMA 1NPRA 4M78D 1EVLA 3CC7T 2AIRB 3NELA 1BBZA 2EKOA 1WI7A 3HFNA 2B86A 1ACMB 2DJQA 2HMAA 4LDYA 2LJ1A 4IUPA 1H4TA 2CZ6B 3BFMA 1BBUA 1QVGA 1ZUYA 1WHHA 4OMOA 1YB3A 2DRKA 5ELNA 5IXBA 2ZNJA 2V8IA 2ZIOA 2CDTA 2DTHA 2RF0A 4Z8AA 1TWBA 1U06A 4TQFA 3M4YA 5IHIA 2J6OA 1D3BB 1GBRA 4QT7A 1IB8A 2AMCB 4J9GA 2JS0A 4AFUC 5I2SA 1MV3A 3VQXA 2KRNA 4PJJA 2QHSA 4A4KA 2DVEA 3G6ET 3W3SA 2GF7A 4QVZA 2XG8D 1KQSP 3HXVA 2QQRA 2L0AA 2EGEA 4M77B 4M78A 1VQMA 1B34B 3OYBA 1VQNQ 2ODRC 3E2UA 2ZT5A 3OS2A 1I07A 2XD0A 4FYYB 2E3CA 3ASKA 4M75B 2DTOA 3REAB 4YYEA 4C92F 5D7UA 4J6YA 2X4XA 2RHSB 1YJ9Q 1VA7A 4IURA 3KUFA 2LQKA 1LOJA 5CKEA 1WJRA 3JCMb 3THKA 1SSHA 2X35A 3G1JA 3PTAA 5C0MA 2CH4W 1X2QA 1B76A 1USYA 2DNUA 3OYMA 3CBPA 2LP5A 4TVYA 2NLUA 1OX9A 1T0HA 2X4JA 1W2BS 4FCYA 4OMPA 2COWA 3CCVQ 1FMVA 3META 2QTVA 1TG0A 1FWZA 3QTCA 2OTJQ 2F69A 3HRTA 3PE0A 4DBFA 2CIMA 1GXIE 2XTIA 2ARSA 5HCKA 2LJ3A 4YRLA 2CP3A 5GAMg 1K8AC 2DYBA 3CD6T 2RHYA 4XTUA 4EDUA 3E1SA 4A4FA 3TQ7P 4BI8B 2E12A 4ATOA 4F16A 2O9VA 1HC7A 1SKUB 1ARKA 1ZA1B 1T3SA 1D1CA 2DL8A 2CP5A 3TEGA 3V8LA 4AG2C 3JCMX 3CCLA 3QO7A 3WVDB 4HWSA 1WNLA 4YTLA 2M51A 2QI2A 3JB9J 1AWWA 3VS6A 2IY5A 3ICAA 1G3TA 2Q7HA 4H2SA 4C0GA 3CPWA 4WJ3M 1X27A 3SWNB 3S3OA 1K1ZA 2RI5A 3OYCA 3DB3A 3L1AA 3JRZA 2PVOB 2ZTGA 1O75A 5C6SA 3JV3A 2LX7A 1YITA 1OU9A 4O6JA 3UT1A 3CCVT 5DY9A 3MP1A 3QPHA 1AWOA 4OMQA 5GAMe 2DZCA 3CCUA 1LVKA 1VQMQ 1M1FA 4C0ZA 3AT1B 2E5KA 3NTIA 3L4GB 1ASZA 3OYNA 2GFUA 4C8QG 1SRMA 4OMMA 2QQAA 1Y71A 2ZIMA 1KC8C 2CP2A 1Z9ZA 2NYSA 4M78F 2ALYB 1JJCA 3CCEA 1SHFA 4K87A 1TOVA 1YGBA 1ASYA 2K7AA 1RAIB 4P71A 3JB9D 1HD3A 3HXYA 4C8QE 3R07A 5GMKj 1TUGB 3KFUA 3OYDA 2P84A 1QLYA 1IRXA 2XGTA 2P0QA 4YRGA 2Q5IA 1VYVA 3TEHA 4F7UA 4M77C 1ZSGA 4HA8A 2EBPA 2ESWA 1UGQB 1QVGP 1SESA 2CSQA 4BE2A 2ZPBB 1H3HA 1AVZC 1SEMA 1BI1A 3ZBDA 1TUCA 4M75C 4HVVA 1VQMT 1V76A 3VV0A 1RABB 2EQKA 2EQIA 2HQEA 2I0NA 4PFZA 3NENA 4BI3A 2E5AA 2DE0X 2HSPA 4HVCA 3GP8A 2RI2A 1AWJA 2EYXA 1ZSZA 2AZSA 1KHIA 2HKNA 3CCLQ 1M8VA 1YWOA 4QQGA 1RI0A 3NETA 1E6GA 1OPLA 3HXUA 1X55A 2DK3A 3ZL7C 1YJWQ 4RDXA 2GTOA 1F1BB 3OMCA 5GANd 3NMZC 1Y96B 1NJ6A 2LQWA 1Q81C 3OS1A 1PG5B 2XDPA 4NS5A 3AHUA 3MEWA 2EAYA 2RHIA 4M7AG 1N9WA 2QHUA 4PJOG 4A4EA 1RAFB 3CCUQ 3EGXB 4BD3A 1B3QA 3VJPA 3OW2A 1BCOA 3QYHB 3M55A 1PYSA 1E7OA 1S72A 1VQKA 2FZCB 1C6VX 5DLQE 1WYXA 1OU8A 2EQMA 2DRMA 3QG1A 3X26B 3CCLT 4OB3B 3CCEQ 4A4HA 3S3NA 3SWNC 3JAME 3FJPA 1EIFA 1J5WA 3A31A 4P3OA 1NG2A 1K8AU 3SEMA 4JS5A 2ZPIB 4H02A 4XU2A 4Q6GA 4FW2A 3CCSQ 3CMAQ 2HL5C 2SEMA 4II1A 1TUDA 5IHKA 4P72C 1IO6A 2DX1A 3QNEA 1BBWA 1YFTA 3RESA 2HQXA 2AKWB 1YITT 3M57A 3RDVA 2JW4A 1PSEA 5EG2A 3CCUT 2LMJA 4ZTZB 1VQLA 1WA7A 4C92B 2R57A 3HY1A 1U8RA 2HBWA 5DM7R 4KR3A 2DLPA 3CC4A 1UDLA 2GQIA 4N0AC 5GAMj 4Y91A 4JUVA 3CPWP 4EIKA 1OZ3A 4F7UF 1G5VA 4JLIA 3I56A 5KYXA 4IUQA 5LJ5g 5J39A 1LPLA 2RJEA 2DVJA 1PC0A 5L8RE 3CCET 2CP6A 2DEUA 2A3LA 2AKKA 2QQBA 1KMNA 3I9QA 3L2WA 1K8AR 3RKWA 3JCMc 2A28A 3NHNA 4ZGEB 2FHDA 3FRNA 5CKHA 1FYFA 2DYIA 2XICA 1EFWA 2RJFA 3JB9F 1KC8U 4HCKA 3O8VA 2KXCA 2XMFA 3CMEA 2Q5HA 3MHXA 4ELZC 4N4IA 4CI0C 2LX9A 3OYJA 2FPEA 2NS6A 1BI2A 4TVAA 4FL6A 2LDMA 2KEAA 5LJ3j 4XU0A 3QDRB 2LT4A 4XTYA 5GAMf 1WIEA 5C51B 1YCSB 1QVPA 5LJ5e 4MDXA 2RM4A 3LH0A 3NGPA 3LSQA 2JM9A 4KH1B 2VGMA 2V8KA 4YRCA 4AMCA 5GMKi 2COYA 1EFNA 3VS5A 3CBOA 1W1FA 4QKUA 4RCBA 3I7FA 1LYLA 5K1PA 4LNPA 1WXBA 2A36A 3CCJA 3CEYA 1H8KA 2CS7A 2ZPHB 1KC8R 3IKLA 1UEBA 4EO4A 2DU5A 1JB0E 2KROA 2FB7A 2QTXA 1YWPA 2A7YA 1I1JA 2KRMA 1QE0A 3BW1A 4AFQC 4RMOA 1VQLQ 1YHQQ 1S72T 1CKAA 1BKBA 3R6NA 1VQKT 1Q81U 3CC4Q 3VRZA 4EMKA 4Z02A 4M78B 5LJ3f 1RI9A 2M0OA 1QF6A 5FWCA 1TU0B 2L3QA 1VQ6A 3I56Q 3OB9A 3PZCA 1MV0B 3OSSC 4OMNA 3CBMA 2FPFA 2F2XA 3PCOA 4RKUE 1NJ8A 2O4XA 2L2PA 4LN2A 4ELYC 2HBPA 3OW2P 2CKKA 2P4RA 2CSIA 3OQ5A 1D1BA 2VASA 4XEMA 5IAYA 3A7UA 1PM3A 3QXEB 3CMEQ 1X2KA 3HPWA 2DD5A 2E41A 3L2VA 2HDAA 2D8HA 3QDFA 3REBB 1IXDA 3R6OA 2VGNA 2ATCB 2QHTA 1UUEA 3L2RA 1ZHIA 2QG9B 2BE7D 3JCMW 4MMKA 1VQLT 1Q81R 1WFWA 1ZX6A 2JOYA 4F14A 2RHXA 2EL9A 4MZMA 1R0CB 1GFDA 3TU4K 3I56T 1YP5A 1UTIA 1B7YA 4IUUA 3HRKA 2DL7A 3UGQA 5I2MA 2FZGB 3HSBA 2QQ9A 2FVUA 4FYXB 3LGFA 1EIYA 1Z7NA 2ZPGB 4C8QD 2IY5B 3J7AF 3NTKA 1X2HA 3UPUA 2K3BA 5FW9A 2ZZEA 2K2MA 4ZN3A 1K4US 2RQUA 3FC3A 3BY7A 2AT1B 4NL2A 2ABLA 4E7JA 3T9NA 5ELOA 1OEBA 2VXFA 3GNGA 3DKMA 3CMET 4XAXB 2WACA 4J9EA 3SDZA 5CVIA 5K1XA 1M5Q1 1Y57A 3M0SA 1OYXA 5J3BA 5HGQA 4CC7A 1TTHB 2V1RA 4JRIA 3CC2Q 1VQ6Q 2DTIA 2KDSA 1SERA 4H2WA 3JCMh 3QBYA 5HK3A 4WF2A 1ZBXA 4YRMA 4C8QA 2LT1A 5IHNA 1VQ8A 4WTOB 4M77G 1JJCB 3VQYA 2LJ0A 4Q5WA 2DXCA 2MCNA 4M75G 3CCJT 3EFOA 1AZEA 1WJSA 1X6BA 1VQNA 1HSQA 3RGLA 4NL3A 4YRJA 4M77E 2OJ2A 2C8MA 2CUBA 3UWNA 4F7UB 3RACA 5HK0A 4M78C 3REUA 1I0CA 2A08A 3OA6A 4ORZA 2LVMA 1UECA 1YJ9A 3G4SA 4B6MA 5CR2A 4IUVA 4V2SA 1QVFP 1VQ6T 5GANg 4JPBW 3CCRA 2FO0A 2C7IA 5GMKl 2P0KA 4YDQA 1VQ9A 4G85A 1ZSZB 4BUGA 2ECZA 2J3LA 1K0XA 4RTTA 3EG9A 3L42A 5LJ5f 3LWIA 3RERA 2QHVA 1UJ0A 3QO5A 2ZPEB 4BY6B 2OTJA 1I5LA 3N5BB 4K86A 4JJBA 2XDBA 2LQNA 3U23A 4OB0B 5GMKh 1FX7A 2HQHA 1MNEA 4WI1A 2D9TA 2ED0A 5M9OA 4AFSC 4XTWA 2HAXA 3WXMB 3QUIA 2RQRA 1GGMA 4YRNA 1UGRB 4RG2A 4LVLA 3GBQA 2A8EA 2E10A 1PYSB 1BYMA 3CXCA 1FMWA 2VVKA 4BDYA 3GLXA 1G3SA 3EG3A 5CAIA 5GANe 4LUDA 2DD4A 3RKYA 3OD1A 3EGUA 5KE3A 4N4HA 4YREA 4J9FA 3HFZB 1FMKA 2KT1A 1WDXA 1BK2A 3RUXA 1VQ8Q 1JU5C 1IZ6A 4XU1A 2KMTA 3BE3A 1W70A 4HWRA 3X25B 4C0DB 2AK5A 4FU6A 2G6FX 1AD5A 4Z89A 3OBYA 4HWTA 2JTEA 4X9DA 1OOTA 1WU7A 3CCMA 4CH4A 2RQWA 1HXDA 4XTXA 5EC7A 4XTVA 5CQYA 4C8QF 4LDVA 4HKEA 3A8HB 4QVCA 3RKXA 4M7DC 4LD6A 4D8KA 4KBMB 4L6V5 5ECAA 2YWWA 3CPWS 5CKFA 3RMSA 4X9CA 2I2LA 4H2VA 3G4SQ 2K79A 1ADYA 4P74A 4J9CA 3J81E 4RTUA 4PG3A 4DEYA 3CCRQ 2BTTA 1D09B 2PQWA 1VQ9Q 5GAOq 4PK4A 2A0FB 3INZA 3SHWA 3VS2A 1GCQA 2L3SA 2E64A 5KYUA 2CZ0B 4P71C 1VQ8T 3VS0A 2LNVA 4ZTFA 1WQ7A 1CSKA 3P8VA 3QYGB 4OGCA 4YCUA 2H3EB 4E7HA 1AOJA 2QGFB 1QP3A 1GL5A 1BIBA 2RK2A 4OMFB 3P8DA 2RNAA 2HEQA 1VQNT 1NJIC 3HXWA 2FRWA 4PLLA 1M1GA 1B7TA 2L3RA 2FG0A 3OSVA 5KYYA 4EMHA 2H3JA 4WJ4A 3MO8A 5GAN7 1YJ9T 3VBBA 3G4ST 3IKMB 3M4PA 4PFPA 1YJWA 1ZSZC 3M54A 4JDSA 4RQFA 3CCRT 1WHMA 1CKBA 4UC4A 3M0QA 1VQ9T 4BY6C 4AH6A 3H0HA 2JN0A 3E19A 1XOVA 3MP8A 3RNJA 2O31A 3QZ9B 2DDZA 1LNXA 2OTJT 2PZ1A 3P8HA 3CCMQ 5AT1B 1EVKA 1ZUKA 1R77A 1LJOA 1B8AA 4QW2A 1PWTA 2AHJB 2DM1A 2RQVA 6AT1B 3A5YA 5C53B 1SSFA 1QMCA 1PD1A 4KUDK 2CH4A 2WSFE 2ZR3A 2GCXA 3I55Q 4FT2A 2RH2A 4PHCA 2KNBB 2KGTA 2PU9B 2XI9A 1VQZA 5DLOA 1NYFA 4FT4A 4L59A 4MZTA 2F2VA 2IPOB 4OP0A 2LCSA 3JCMd 2RK1A 3CCSA 3CMAA 1KQ1A 3OW2S 4E7IA 5GANj 4YRQA 4C0DC 2DBKA 3OYLA 2BUDA 4R55A 1NEBA 2ZT8A 1WHKA 1E22A 2O4XB 5CIUA 5D6WA 2Y90A 3J80E 1UGSB 1M4ZA 2RI3A 3CCMT 3CXCP 4J83A 1NBEB 3OYFA 1IL2A 1WHGA 1I5OB 2KI7A 4KH0B 4ME7A 3JB9H 4LDUA 2EYZA 1YI2A 3RL6A 2JNGA 3MQZA 1K9MC 3I5RA 4XEOA 2QK0A 1WHLA 5KCOA 3M53A 4OGEA 3C0CA 1TH7A 2JTMA 2FEIA 5FU7B 2X51A 1BI0A 4F17A 2NUPA 4H2XA 2K9GA 1Q82C 1SRYA 2DF6A 4CC2A 2EJGA 3UA7A 2CP0A 4TWAA 3VKIA 5GANf 2K3YA 1B7YB 3TVTA 2YRCA 1VQOA 3BDUA 2BZ8A 2EW3A 4PNOA 2PUOB 4RG8A 3PIOA 4YP0A 3UA6A 2SRCA 2E4HA 2I4NA 3A8OB 4JJDA 1YFSA 3VRYA 2M16A 1J3TA 1M8MA 4HCCA 4P73C 4M77D 4M7AE 1MMDA 1VIEA 2FL7A 5D6YA 3CMQA 2BIVA 3REXA 3LWHA 4PJOE 2QYZA 2ROLA 4UP7A 2VV5A 2MYSA 1RLPC 1HTTA 1YJWT 1NJIU 4C5HA 1OV3A 3A98A 3M0PA 1LCKA 3A74A 3L2UA 2RQTA 1K73C 4C8QB 4M78G 1R0BG 2MAMA 5IH2A 3HP9A 1YHQA 4M77A 3RMQA 2I4LA 2ZGWA 1YI2Q 2MWOA 3EFOB 3H41A 1O9SA 2IG0A 4GLKA 3PMIA 1N5ZA 2EYQA 3JCMV 3PMTA 3PGGA 3IALA 4Z88A 3HKSA 1SPKA 4HVUA 4BE0A 2NUTB 1QP2A 1AZGB 2QAZA 4B9WA 1KHCA 1AHJB 3S3MA 2AZVA 3EG0A 2R5MA 3HXZA 5GAN3 2DBMA 1YFRA 3NEMA 1NJIR 4TVRA 3RR6A 1KFZA 3CCST 3CMAT 5GAOm 4LUEA 5KCHA 2DL4A 4DBHA 3UFGA 4E6RA 1VQOQ 3QWYA 2V8JA 3GF5A 1E24A 2HKQB 4J15A 3EG9B 4TQDA 3OYAA 1PRLC 5CO7A 4FSSA 2E6NA 4DA4A 4CC3A 1S1NA 3EGDA 4AT1B 1U3OA 1YI2T 3QSUA 2JT4A 1QCOA 3NTHA 4AFZC 1M2OA 3MEAA 3RF1A 4H2YA 3ERRA 2WSEE 3ZEHA 3P8YA 5FU7C 3MCAB 3LC0A 4E7ZA 2KT8A 1UJYA 2YRVA 4PKCC 1C0AA 1QCNA 2QEXA 2F1LA 2KE9A 4E51A 1QKWA 2L8DA 1X6GA 3DLMA 4DOVA 1BIAA 1QVFA 1JXOA 4HT9A 2YDLA 2C06A 2DAQA 2E70A 2MMPA 1K9MU 2XIDA 3UATA 1KQSS 4M7DG 4YRSA 3LYIA 1H3ZA 4A53A 1H641 4MZPA 5HKCA 1EZZB 1VQOT 2R58A 3CPFA 4RTYA 1D0YA 4HT4A 1Q82U 1IREB 4FM4B 4RUGA 4LE9A 3L4GA 1YIJQ 2W0ZA 3CC2A 1X75C 4M7DE 1WGSA 1WX6A 4PJMA 4XTZA 3A8GB 4CS3A 3NPFA 1BB9A 2DKGA 2RPNA 1WLPB 1N8RC 1X43A 1D0ZA 4J9HA 2NWMA 5LJ3d 2DL5A 2EYYA 1NE8A 1JEGA 4X34A 1WQWA 1KG1A 4Y92A 2YUNA 3H0IA 1W4SA 2MWPA 1K9MR 2LCLA 3P8TA 2KQWA 3C94A 4F7UG 2YRDA 3JCMJ 3QO3A 4YCWA 2M1HA 2PUKB 3E9GA 2C0IA 5KYUB 3L2QA 2LZ6B 1NLOC 4JZ3A 2C0OA 4C92C 4NOYA 4P5NA 4XK8E 1NPPA 2KXDA 2ZPFB 1M3AA 2DZ9A 1Q82R 1YHQT 1QQJA 1L0WA 3CC4T 2C0TA 5I11A 4RTVA 1VQPA 1K73U 5I21A 2DEQA 2LTOA 1Y0MA 1M3CA 3BJUA 3SB2A 1B70A 2EJ9A 1DJ7B 2EGCA 4XU3A 5KYYB 2QEXQ 3ZFJA 3OYGA 1Y96A 1G3YA 1M1KC 1Q7YC 3GPLA 2F5KA 2YUPA 4H2TA 2DO3A 1NYGA 4IIOA 1OX8A 3EGXA 3VUZA 4A63B 2ED1A 3QJ6A 5GAN6 5GAN8 1RAAB 3QJYA 4VUBA 4FSXA 1C1AA 2RHUA 4CS2A 4E7LA 3LGLA 2QA4Q 1GBQA 2HNIA 1AT1B 2GGRA 1I8FA 3MF1A 3QWXX 1K73R 3JCMg 4JS4A 2ZT7A 1PHTA 1BU1A 1ZLMA 5LJ5j 2O2OA 3OS0A 4HCBA 1IHVA 3M0RA 3EFSA 3ME9A 2QEXT 5CKDA 2OTLA 1MMNA 3HRIA 5A0DA 2ZZFA 3PVQA 2L89A 2OI3A 3EHRA 3M9QA 4LVIA 3BDLA 4JRPA 5CK9A 1QVGS 2AKWA 3CXCS 1GRIA 2M0YA 4E47A 2YUQA 3TEHB 1PRMC 1RLQC 3VS3A 2O88A 2P0LA 4J9BA 4BE1A 4UP8A 2CJAA 2FZKB 2CZ7B 4M75E 4KGZB 1UE9A 2D0QB 4J7IA 3A8LB 2RD1A 5IN1A 4PLIA 1WYDA 2EYWA 4JRKA 4LD9K 2XHCA 4M7AD 3CC2T 1JJ2A 3JCMe 3CD6A 2PMFA 3CC7Q 4PJOD 2D8JA 1VQPQ 1X54A 1EQRA 4P75A 3PIPA 2R5AA 4RTZA 5F5WA 2CUDA 4RTXA 1KD1C 3A32A 1SRLA 3FEOA 1USYC 1VYTA 1KOGA 3F70A 3EHQA 1NYQA 1ZA2B 1PKSA 1WLEA 2E3IA 7AT1B 1TS9A 2EIFA 1N8RU 3G7ZA 1E6HA 4MDWA 1RAHB 2CGHA 2EPDA 2L5QA 2E3HA 1B07A 4TVWA 3E9HA 3TUPA 3VS1A 2EGAA 3CCQA 3C12A 2VYTA 1JQQA 4M7AA 2RMOA 2M9UA 3TSZA 4PJOA 2P5IA 2K5IA 4DQ2A 2ARTA 4BWAA 4YCVA 3LW5E 3VU3C 4HXJA 2EVRA 1H92A 1VQPT 2I4OA 2DL3A 4BI4A 2PNIA 1MNDA 5FU6B 3H8ZA 5GAN4 2O9SA 2OTLQ 5GAOp 4H2UA 5GMKe 4J6WA 3EH2A 4G84A 1YJNA 1ABOA 1N8RR 3JCMQ 2X4YA 4ANJA 1U1TA 3S6WA 2RJDA 1N27A 4N4GA 1UGPB 1XQHA 1U1SA 3QKJA 8AT1B 5KYWA 4CH3A 2G3RA 4LNSA 1H4QA 4CH6A 1NNHA 1Y7XA 2MI6A 2K4YA 4OB1B 2RB6A 4C5IA 3I55A 1K9AA 1ABQA 4ZN1A 2LCCA 2QGGA 2ZCEA 4HT8A 1N9SA 4P3NA 1M1KU 2JS2A 1Q7YU 3I35A 3CD6Q 2HL3A 2BKDN 4R56A 2E6ZA 4E7SA 3X24B 2L3PA 4JJCA 2J05A 5GAOn 2GQVA 2KSSA 2CP7A 5KYXB 4CRIA 4YRRA 2HD0A 5A0LA 1KMMA 3VQWA 2LNHB 3HXXA 1M90C 2QXFA 2OTLT 1IGUA 3OYIA 3GIBA 1E1OA 3VUBA 1R8OB 4CH5A 3OS5A 2KBTA 2MOXA 2IVWA 2P4TA 4KGXB 3WVEB 3TREA 2PVGB 1WJQA 2CYZB 2EKHA 2Y4YA 4FYVB 4Y28E 1VQ5A 3H9NA 4YRPA 2DILA 1NZ9A 4KT0E 3CCQQ 5AYFA 2Q7EA 1UHCA 2VXEA 2YSQA 3I5SA 2ZAEA 4C0FA 1NJ5A 2ODRD 1M3BA 3FIFA 3P8BB 4DPGA 1Q95G 1VIFA 1X69A 2J6KA 4TVAB 3ULRB 2PMEA 4M7DD 1M1KR 5GAMh 4CC4B 1Q7YR 4LDWA 3FB9A 4J9IA 3EGDB 2LRQA 1QCFA 2FYKA 2IIMA 3JCMP 4UP9A 4GLMA 4M7AF 4J9DA 2V1QA 3M59A 3VYGA 4PFOA 4PJOF 2X3WD 2Y4XA 2DPPB 2X3XD 2A37A 2EJFA 2O01E 4KQEA 1YJNQ 1QWEA 2F5TX 4KR2A 1UB4A 3WQZA 2YXYA 2CZ1B 1JJ2P 2YLCA 1YBYA 3MJXA 1KD1U 4YROA 1G5HA 2KR3A 2CT3A 3OY9A 4EMGA 3KXTA 1KK7A 1M30A 2RHZA 1YCYA 3CCQT 4M7DA 2XKOC 2CT4A 4O5VA 4J8OA 2NUZA 4F04B 4L87A 1W2BA 2I4MA 5LJ3g 2KAFA 5LJ3h 1T0JA 3MF2A 4EMKB 3OYYA 2RJCA 5FU6C 2JUFA 3HFVA 4E2FB 2RHQA 2DFUA 5CCAA 3A7RA 2BZXA 3FJ5A 1EOVA 3M0TA 3JCMf 2OAUA 1TXQA 3KFVA 2ROTA 2J7IA 3M58A 4C92G 3PCOB 2VWFA 1M2VA 3UDCA 2KY9A 1KJWA 4UPAA 5FRNA 1WZOA 3JB9I 1YJNT 4R0KA 2YUOA 5A2QE 2QQSA 2KVQG 5GAN5 2HZYA 3EG2A 2DXTA 3UH0A 2EQJA 4A4GA 2FRYA 4HVWA 4PJNA 1VQ5Q 4O2DA 3M4QA 1KD1R 2VKNA 4C92E 3RIRA 5GJVB 3HTZA 5KE2A 2DIQA 3I55T 4WCIA 4DBQA 5LJ3e 5CQXA 4MMLA 5C52B 4JRQA 2K5FA 5J26A 4K88A 2Q7GA 1WHJA 3HY0A 4TTVA 4RTWA 2D1XA 4BB7A 2OAWA 2J3MA 3GOXA 4A54A 4IUTA 1SF9A 1PD0A 2W10A 4X1VA 2MK5A 1B70B 3UF4A 3C95A 2JM8A 2E5QA 1V1CA 4FYWB 4J6XA 4C5EA 5CKBA 1OPKA 2J06A 3G71A 1EIYB 1MHNA 3MEUA 2BZYA 2COZA 4YRTA 1WPYA 4EPCA 3A5ZA 1JRIA 3H0FA 4KULA 1YITQ 1MMGA 1VQ5T 1KQ2A 1M90U 3ER0A 1QWFA 4JLGA 3HHTB 3M5AA 1G5IA 4M75D 3EAEA 3OMGA 2E1HA 4J5YA 3VS4A 1VQ7A 5D6XA 2JZ2A 4PL6A 3LX7A 4ZGJB 5KNNA 2G4CA 4OMLA 4X5OA 1P92A 4LVKA 3M4GA 4K11A 4M7DF 3HFZA 1D1AA 3TEEA 1Y07A 1D3BA 1ZUUA 2AMCA 4GY5A 1YFNA 5GJWB 5FLXE 3TCJA 1XJWB 2YT6A 1C0MA 2AKLA 4LDXA 1HYOA 1W6XA 2EWNA 4KUIA 1SG5A 3EH1A 2E65A 1FYNA 1SETA 1B34A 5IXFA 2YHTA 3RBBB 1H4SA 1YIJA 4M75A 1AWXA 1MGQA 1M90R 4M78E 1PSFA 4YRKA 1QVFS 3G1ZA 2RHSA 4JZ4A 4KRTA 4EMKC 2FPDA 1RL2A 1WXUA 3OBWA 2KYMA 5FRMA 1YN8A 1M27C 5FWBA 1I4K1 1IGQA 1PKTA 3X20B 5I22A 3V8KA 4ZGDB 1KIKA 1RACB 2V26A 5FROA 1T3LA 1QKXA 2VC8A 8ATCB 1JO8A 5LJ5h 3HRUA 3CQTA 4AG1C 2MIOA 3G71Q 1M9SA 4E7KA 3HFOA 4ZIBA 1OQKA 1NLPC 4J7FA 1XTDA 3FDRA 1W2BP 1N6AA 4BW9A 5A0GA 2KK4A 4LVJA 1QW1A 1BCMA 1SHGA 2JMAA 1Q86C 1WXTA 2DXUA 1UFFA 2QASA 1PNJA 5GAOl 3LSSA 2X9HA 1MUZA 2D0NA 3NFCA 4P73A 4OVAA 2JXBA 3TSWA 1MMAA 4JJNK 1VQ7Q 1X6OA 3L2ZA 1S72Q 1VQKQ 5GAMd 2RN8A 3MKDA 3LH5A 4M7AB 3OYEA 1VOMA 4C8QC 1JXMA 3HL8A 3M0UA 4LXCA 4PJOB 2H8HA 3SWNA 5L23A 2EFIA 4HWOA 4QQDA 1IHWA 2ZZGA 3URGA 2J6FA 4OB2B 1X2GA 4P72A 3SD4A 3UGTA 9ATCB 2ZNIA 5IT9E 3G71T 1GFCA 4YPFA 3IG2A 4D6WA 3D7SB 3V7RA 1A0NB 2RO0A 2QA4A 1XNIA 3A8MB 4BACA 12ASA 5KYWB 4N0AA 2JVVA 11ASA 3DB4A 1OZ2A 1UHFA 4M77F 1HJDA 2F2WA 1NJ2A 2ALYA 1RIQA 1VQ7T 2BE9B 2LC4A 1G2BA 4L5GA 4M75F 1RADB 2M02A 3E9FA 2RA2A 1HK9A 1VQ4A 2QDYB 3KBGA 2KYBA 3QIIA
chains in the Genus database with same CATH topology
1ZQ1A 1JBMA 3MP6A 2ZT6A 2JTFA 1N9RA 4EX5A 2LQ8A 1NJ1A 3PFSA 4F7UE 4XQ3A 3MEYA 1YIJT 3DSQA 3CC7A 3JB9G 1Z7MA 1ADJA 1KQSA 2PVDB 3C4SA 3E9IA 1X56A 2MF2A 2CJ9A 5GAN2 3JSCA 4P75C 2K57A 3QHSA 2VUBA 4IKFA 2XU8A 2YLBA 3VQVA 4CS4A 4QQ6A 1W66A 1BI3A 4C5GA 1G3WA 3QO8A 4OF1A 1JJ2S 3A7AA 4ZTUB 4DOWA 3G6EA 3MEVA 4B9XA 4RCCA 2DJZA 1X01A 4C92D 4YRFA 1FXXA 4BDZA 2EQUA 3V8JA 1NYRA 4QVDA 1OI1A 4M7AC 3OYKA 2B8AA 4PJOC 3VYHB 4M7DB 5HY6A 2ZR2A 2K3XA 1Q86U 2ZINA 1V29B 2DQ0A 2RHQB 3QZ5B 2WSCE 3LLRA 5KH6A 3PNWC 1H4VB 3OYHA 5LL6S 3PT9A 3DLLA 5E3IA 4RQEA 4FIBA 2P0PA 2ARUA 4C92A 3GNFB 3SFMA 2X4WA 1G51A 2CJBA 5GMKm 5GAOr 2QA4T 4RMFA 1VUBA 3Q1JA 4NCXA 2DU7A 2K5LA 2XDDA 4P74C 4HWPA 2D6FA 2DXBA 4Q15A 3V7CA 2ZZDA 4H2XB 3H6ZA 4OLFA 4YRIA 1VQ4T 5GANh 5LJ5d 4ZTJA 3X28B 3FLGA 2GFAA 3EFRA 3CCVA 2DQ3A 1E1TA 3V7SA 4P3PA 1I81A 2DIGA 2ZXFA 2ZCFB 1ATIA 2XK0A 3HRSA 4HCZA 2K2VA 3M56A 3A5ZB 4LVMA 1NPRA 1EVLA 4M78D 3CC7T 3NELA 2EKOA 3HFNA 4LDYA 4IUPA 1H4TA 2CZ6B 3BFMA 1BBUA 1QVGA 1YB3A 5ELNA 2ZNJA 2V8IA 2ZIOA 2DTHA 4TQFA 3M4YA 1D3BB 2AMCB 5I2SA 3VQXA 2QHSA 4A4KA 2DVEA 3G6ET 3W3SA 2GF7A 4QVZA 2XG8D 3HXVA 2QQRA 4M77B 4M78A 1VQMA 1B34B 3OYBA 2ODRC 2ZT5A 3OS2A 2E3CA 2XD0A 3ASKA 4M75B 2DTOA 4YYEA 4C92F 4J6YA 2X4XA 2RHSB 4IURA 3KUFA 2LQKA 1LOJA 5CKEA 1WJRA 3JCMb 2X35A 3PTAA 5C0MA 1B76A 1USYA 3OYMA 3CBPA 4TVYA 2NLUA 2X4JA 1W2BS 3META 1FWZA 3QTCA 2F69A 3HRTA 2CIMA 1GXIE 2XTIA 2ARSA 4YRLA 5GAMg 1K8AC 3CD6T 2RHYA 4XTUA 4EDUA 3E1SA 4A4FA 4BI8B 4ATOA 2E12A 1HC7A 3TEGA 3V8LA 3JCMX 3CCLA 3QO7A 3WVDB 4HWSA 1WNLA 4YTLA 2QI2A 3JB9J 2IY5A 3ICAA 1G3TA 2Q7HA 4H2SA 4C0GA 3CPWA 4WJ3M 3SWNB 3S3OA 2RI5A 3OYCA 3DB3A 3L1AA 3JRZA 2PVOB 2ZTGA 1O75A 5C6SA 1YITA 4O6JA 3UT1A 3CCVT 5DY9A 3MP1A 3QPHA 5GAMe 2DZCA 3CCUA 1M1FA 4C0ZA 3NTIA 3L4GB 1ASZA 3OYNA 2GFUA 4C8QG 2QQAA 1Y71A 2ZIMA 1KC8C 4M78F 2ALYB 1JJCA 3CCEA 4K87A 1YGBA 1ASYA 4P71A 3JB9D 3HXYA 4C8QE 3R07A 5GMKj 3KFUA 3OYDA 2XGTA 2P0QA 4YRGA 2Q5IA 3TEHA 4F7UA 4M77C 4HA8A 1UGQB 1SESA 4BE2A 2ZPBB 3ZBDA 1BI1A 4M75C 1VQMT 3VV0A 2EQKA 2HQEA 3NENA 4BI3A 2E5AA 4HVCA 3GP8A 2RI2A 1KHIA 1M8VA 4QQGA 1RI0A 3NETA 3HXUA 1X55A 2DK3A 4RDXA 3OMCA 5GANd 1Y96B 1NJ6A 1Q81C 3OS1A 2XDPA 4NS5A 3AHUA 3MEWA 2EAYA 2RHIA 4M7AG 1N9WA 2QHUA 4PJOG 4A4EA 4BD3A 3VJPA 3OW2A 3QYHB 3M55A 1PYSA 1S72A 1VQKA 5DLQE 2EQMA 3QG1A 3X26B 3CCLT 4OB3B 4A4HA 3S3NA 3SWNC 3JAME 3FJPA 1EIFA 1J5WA 3A31A 4P3OA 1K8AU 4JS5A 2ZPIB 4H02A 4XU2A 4Q6GA 4II1A 4P72C 3QNEA 1BBWA 1YFTA 3RESA 2HQXA 2AKWB 1YITT 3M57A 1PSEA 5EG2A 3CCUT 4ZTZB 1VQLA 4C92B 2R57A 3HY1A 1U8RA 5DM7R 4KR3A 3CC4A 4N0AC 5GAMj 4Y91A 4JUVA 1OZ3A 4F7UF 1G5VA 4JLIA 3I56A 5LJ5g 4IUQA 5J39A 2RJEA 5L8RE 3CCET 2A3LA 2QQBA 1KMNA 3L2WA 3RKWA 3JCMc 4ZGEB 2FHDA 3FRNA 5CKHA 1FYFA 2XICA 1EFWA 3JB9F 2RJFA 1KC8U 3O8VA 3CMEA 2Q5HA 3MHXA 4ELZC 4N4IA 4CI0C 2LX9A 3OYJA 2NS6A 1BI2A 4TVAA 4FL6A 2LDMA 5LJ3j 4XU0A 3QDRB 2LT4A 4XTYA 5GAMf 5C51B 1QVPA 5LJ5e 4MDXA 2RM4A 3LH0A 3LSQA 2VGMA 2V8KA 4YRCA 5GMKi 3CBOA 4RCBA 3I7FA 1LYLA 5K1PA 3CCJA 3CEYA 2CS7A 2ZPHB 3IKLA 1UEBA 4EO4A 2DU5A 1JB0E 2FB7A 2QTXA 2A7YA 1QE0A 3BW1A 4RMOA 1S72T 1VQKT 1BKBA 1Q81U 4EMKA 4Z02A 4M78B 5LJ3f 2M0OA 1QF6A 1VQ6A 3OB9A 3PZCA 3OSSC 3CBMA 3PCOA 4RKUE 1NJ8A 2O4XA 4ELYC 2HBPA 2CKKA 3OQ5A 4XEMA 5IAYA 3A7UA 3QXEB 3HPWA 2DD5A 2E41A 3L2VA 3R6OA 2VGNA 2QHTA 3L2RA 1ZHIA 3JCMW 4MMKA 1VQLT 2JOYA 2RHXA 2EL9A 4MZMA 3TU4K 3I56T 1B7YA 4IUUA 3HRKA 3UGQA 5I2MA 3HSBA 2QQ9A 2FVUA 3LGFA 1EIYA 1Z7NA 2ZPGB 4C8QD 2IY5B 3J7AF 3NTKA 1X2HA 3UPUA 2ZZEA 4ZN3A 3FC3A 3BY7A 4NL2A 4E7JA 3T9NA 5ELOA 3GNGA 2VXFA 3DKMA 3CMET 4XAXB 2WACA 3SDZA 5CVIA 5K1XA 1M5Q1 1OYXA 5J3BA 5HGQA 4JRIA 2DTIA 2KDSA 1SERA 4H2WA 3JCMh 3QBYA 5HK3A 4WF2A 1ZBXA 4YRMA 4C8QA 2LT1A 1VQ8A 4M77G 1JJCB 3VQYA 4Q5WA 2DXCA 4M75G 3CCJT 1WJSA 1VQNA 3RGLA 4NL3A 4YRJA 4M77E 2C8MA 3UWNA 4F7UB 3RACA 5HK0A 4M78C 3REUA 3OA6A 2LVMA 1YJ9A 3G4SA 5CR2A 4IUVA 4V2SA 1VQ6T 5GANg 3CCRA 2C7IA 5GMKl 2P0KA 4YDQA 1VQ9A 4G85A 4BUGA 2J3LA 3L42A 5LJ5f 3LWIA 3RERA 2QHVA 3QO5A 2ZPEB 2OTJA 4BY6B 1I5LA 3N5BB 4K86A 2XDBA 4OB0B 5GMKh 1FX7A 4WI1A 2D9TA 5M9OA 4XTWA 2HAXA 3WXMB 3QUIA 1GGMA 4YRNA 1UGRB 4RG2A 4LVLA 2A8EA 2E10A 1PYSB 1BYMA 3CXCA 4BDYA 3GLXA 1G3SA 5CAIA 5GANe 2DD4A 3RKYA 3OD1A 5KE3A 4N4HA 4YREA 3HFZB 3RUXA 1IZ6A 4XU1A 2KMTA 4HWRA 3X25B 4C0DB 4FU6A 3OBYA 4HWTA 4X9DA 1WU7A 3CCMA 4CH4A 1HXDA 4XTXA 4XTVA 5CQYA 4C8QF 4LDVA 4HKEA 3A8HB 4QVCA 3RKXA 4M7DC 4LD6A 4KBMB 4L6V5 3CPWS 5CKFA 3RMSA 4X9CA 2I2LA 4H2VA 1ADYA 4P74A 3J81E 4PG3A 2PQWA 5GAOq 3INZA 2E64A 2CZ0B 4P71C 1VQ8T 2LNVA 4ZTFA 1WQ7A 3P8VA 3QYGB 4OGCA 4YCUA 4E7HA 1QP3A 1BIBA 2RK2A 4OMFB 3P8DA 1VQNT 1NJIC 3HXWA 4PLLA 1M1GA 2L3RA 3OSVA 4EMHA 2H3JA 4WJ4A 3MO8A 5GAN7 1YJ9T 3VBBA 3G4ST 3IKMB 3M4PA 1YJWA 3M54A 4JDSA 4RQFA 3CCRT 4UC4A 1VQ9T 4BY6C 4AH6A 2JN0A 3E19A 1XOVA 3MP8A 3QZ9B 2DDZA 1LNXA 2OTJT 3P8HA 1EVKA 1B8AA 1LJOA 4QW2A 2AHJB 3A5YA 5C53B 1SSFA 4KUDK 2WSFE 2ZR3A 2GCXA 4FT2A 2RH2A 4PHCA 2PU9B 2XI9A 1VQZA 5DLOA 4FT4A 4L59A 4MZTA 4OP0A 3JCMd 2RK1A 3CCSA 3CMAA 1KQ1A 3OW2S 4E7IA 5GANj 4YRQA 4C0DC 3OYLA 2BUDA 4R55A 2ZT8A 1E22A 2O4XB 5CIUA 5D6WA 2Y90A 3J80E 1UGSB 1M4ZA 2RI3A 3CCMT 4J83A 3OYFA 1IL2A 4ME7A 3JB9H 4LDUA 1YI2A 3RL6A 2JNGA 3MQZA 1K9MC 4XEOA 5KCOA 3M53A 4OGEA 1TH7A 2JTMA 5FU7B 1BI0A 4H2XA 1Q82C 1SRYA 2EJGA 4TWAA 3VKIA 5GANf 2K3YA 1B7YB 1VQOA 3BDUA 4PNOA 2PUOB 4RG8A 3PIOA 4YP0A 2I4NA 3A8OB 1YFSA 2M16A 4HCCA 4P73C 4M77D 4M7AE 1VIEA 2FL7A 5D6YA 3CMQA 2BIVA 3REXA 3LWHA 4PJOE 4UP7A 2VV5A 1HTTA 1YJWT 1NJIU 4C5HA 3A74A 3L2UA 1K73C 4C8QB 4M78G 2MAMA 3HP9A 1YHQA 4M77A 3RMQA 2I4LA 2ZGWA 2MWOA 1O9SA 2IG0A 4GLKA 3PMIA 2EYQA 3JCMV 3PMTA 3PGGA 3IALA 3HKSA 4BE0A 1QP2A 4B9WA 1KHCA 1AHJB 3S3MA 2R5MA 3HXZA 5GAN3 1YFRA 3NEMA 4TVRA 3CCST 3CMAT 5GAOm 5KCHA 3UFGA 1E24A 2V8JA 3GF5A 4J15A 4TQDA 3OYAA 5CO7A 2E6NA 4DA4A 1YI2T 3QSUA 3NTHA 3MEAA 3RF1A 4H2YA 3ERRA 2WSEE 3ZEHA 3P8YA 5FU7C 3MCAB 3LC0A 2YRVA 4PKCC 1C0AA 2QEXA 4E51A 2L8DA 3DLMA 4DOVA 1BIAA 1QVFA 4HT9A 2C06A 2DAQA 2E70A 2MMPA 1K9MU 2XIDA 1KQSS 4M7DG 4YRSA 3LYIA 1H3ZA 4A53A 1H641 4MZPA 5HKCA 1VQOT 2R58A 3CPFA 4HT4A 1Q82U 1IREB 4FM4B 3L4GA 3CC2A 1X75C 4M7DE 1WGSA 4XTZA 3A8GB 4CS3A 2DKGA 1N8RC 5LJ3d 1NE8A 4X34A 1WQWA 1KG1A 1W4SA 2MWPA 2LCLA 3P8TA 2KQWA 3C94A 4F7UG 3JCMJ 3QO3A 4YCWA 2M1HA 2PUKB 3E9GA 3L2QA 4C92C 4NOYA 4P5NA 4XK8E 1NPPA 2ZPFB 2DZ9A 1YHQT 1L0WA 3CC4T 1VQPA 1K73U 5I21A 2DEQA 2LTOA 3BJUA 3SB2A 1B70A 2EJ9A 1DJ7B 4XU3A 3ZFJA 3OYGA 1Y96A 1G3YA 1M1KC 1Q7YC 3GPLA 2F5KA 4H2TA 2DO3A 3VUZA 3QJ6A 5GAN6 5GAN8 3QJYA 4VUBA 4FSXA 2RHUA 4CS2A 4E7LA 3LGLA 2HNIA 1I8FA 3MF1A 3JCMg 4JS4A 2ZT7A 5LJ5j 3OS0A 4HCBA 3EFSA 3ME9A 2QEXT 5CKDA 2OTLA 3HRIA 5A0DA 2ZZFA 2L89A 3M9QA 4LVIA 3BDLA 4JRPA 5CK9A 1QVGS 2AKWA 3CXCS 4E47A 3TEHB 2P0LA 4BE1A 4UP8A 2CJAA 2CZ7B 4M75E 2D0QB 4J7IA 3A8LB 2RD1A 5IN1A 4PLIA 1WYDA 4JRKA 4LD9K 2XHCA 4M7AD 3CC2T 1JJ2A 3JCMe 3CD6A 2PMFA 4PJOD 1X54A 1EQRA 4P75A 3PIPA 2R5AA 5F5WA 1KD1C 3A32A 3FEOA 1USYC 1KOGA 3F70A 1NYQA 1WLEA 2EIFA 1N8RU 3G7ZA 4MDWA 2CGHA 2L5QA 4TVWA 3E9HA 3TUPA 3CCQA 3C12A 2VYTA 4M7AA 2M9UA 4PJOA 2P5IA 2K5IA 4DQ2A 2ARTA 4BWAA 4YCVA 3LW5E 3VU3C 2I4OA 1VQPT 4BI4A 5FU6B 3H8ZA 5GAN4 5GAOp 4H2UA 5GMKe 4J6WA 4G84A 1YJNA 3JCMQ 2X4YA 1U1TA 3S6WA 2RJDA 1N27A 4N4GA 1UGPB 1XQHA 1U1SA 3QKJA 4CH3A 2G3RA 4LNSA 1H4QA 4CH6A 1NNHA 1Y7XA 2MI6A 2K4YA 4OB1B 2RB6A 4C5IA 3I55A 4ZN1A 2LCCA 2ZCEA 4HT8A 1N9SA 4P3NA 1M1KU 1Q7YU 2BKDN 4R56A 2E6ZA 3X24B 5GAOn 2GQVA 2KSSA 4CRIA 4YRRA 2HD0A 5A0LA 1KMMA 3VQWA 3HXXA 1M90C 2QXFA 2OTLT 3OYIA 3GIBA 1E1OA 3VUBA 1R8OB 4CH5A 3OS5A 2IVWA 2P4TA 3WVEB 3TREA 2PVGB 1WJQA 2CYZB 2Y4YA 4Y28E 1VQ5A 4YRPA 1NZ9A 4KT0E 2Q7EA 5AYFA 2VXEA 1NJ5A 4C0FA 2ODRD 3FIFA 3P8BB 4DPGA 1VIFA 4TVAB 2PMEA 4M7DD 5GAMh 4LDWA 3FB9A 2LRQA 2FYKA 3JCMP 4UP9A 4M7AF 3M59A 3VYGA 4PJOF 2Y4XA 2DPPB 2EJFA 2O01E 4KQEA 2F5TX 4KR2A 1UB4A 3WQZA 2CZ1B 2YLCA 1YBYA 1KD1U 4YROA 1G5HA 3OY9A 4EMGA 3KXTA 2RHZA 1YCYA 3CCQT 4M7DA 2XKOC 4O5VA 4J8OA 4L87A 1W2BA 2I4MA 5LJ3g 2KAFA 5LJ3h 3MF2A 4EMKB 3OYYA 2RJCA 5FU6C 2JUFA 3HFVA 2RHQA 5CCAA 3A7RA 1EOVA 3JCMf 2OAUA 3M58A 4C92G 3PCOB 3UDCA 2KY9A 4UPAA 5FRNA 3JB9I 1YJNT 5A2QE 2QQSA 2KVQG 5GAN5 2DXTA 3UH0A 2EQJA 4A4GA 4O2DA 3M4QA 4C92E 3RIRA 3HTZA 5KE2A 2DIQA 3I55T 5LJ3e 5CQXA 4MMLA 5C52B 4JRQA 2K5FA 5J26A 4K88A 2Q7GA 3HY0A 4TTVA 4BB7A 2J3MA 3GOXA 4A54A 4IUTA 1B70B 3C95A 2E5QA 4J6XA 4C5EA 5CKBA 3G71A 1EIYB 1MHNA 3MEUA 4YRTA 1WPYA 4EPCA 3A5ZA 1JRIA 4KULA 1KQ2A 1VQ5T 1M90U 3ER0A 4JLGA 3HHTB 3M5AA 1G5IA 4M75D 3EAEA 3OMGA 2E1HA 4J5YA 1VQ7A 5D6XA 2JZ2A 4PL6A 3LX7A 4ZGJB 5KNNA 2G4CA 4LVKA 4X5OA 1P92A 3M4GA 4M7DF 3HFZA 3TEEA 1Y07A 1D3BA 2AMCA 4GY5A 5FLXE 3TCJA 4LDXA 2EWNA 4KUIA 2E65A 1SETA 1B34A 2YHTA 1H4SA 1YIJA 4M75A 1MGQA 4M78E 1PSFA 4YRKA 1QVFS 3G1ZA 2RHSA 4EMKC 1RL2A 3OBWA 5FRMA 1I4K1 3X20B 3V8KA 4ZGDB 5FROA 2VC8A 5LJ5h 3HRUA 1M9SA 4E7KA 3HFOA 4ZIBA 4J7FA 1XTDA 3FDRA 1N6AA 4BW9A 5A0GA 2KK4A 4LVJA 1QW1A 1Q86C 2DXUA 5GAOl 3LSSA 3NFCA 4P73A 4OVAA 4JJNK 1X6OA 3L2ZA 5GAMd 4M7AB 3OYEA 3HL8A 4PJOB 3SWNA 2EFIA 4HWOA 4QQDA 2ZZGA 3URGA 4OB2B 1X2GA 4P72A 3SD4A 3UGTA 2ZNIA 5IT9E 3G71T 4YPFA 3IG2A 4D6WA 3V7RA 2RO0A 2QA4A 1XNIA 3A8MB 4BACA 12ASA 4N0AA 2JVVA 11ASA 3DB4A 1OZ2A 4M77F 2ALYA 1NJ2A 1RIQA 1VQ7T 2LC4A 4L5GA 4M75F 3E9FA 2RA2A 1HK9A 1VQ4A 2QDYB 3KBGA 4C8QC 3QIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYQ A;  1WLE A;  4AH6 A;  1JBM A;  2JN0 A;  4H02 A;  4XU2 A;  4Q6G A;  2ZT6 A;  2DDZ A;  1N9R A;  4P72 C;  1LNX A;  2CGH A;  3QNE A;  1BBW A;  1YFT A;  3RES A;  2AKW B;  4EX5 A;  4TVW A;  3E9H A;  1NJ1 A;  1EVK A;  3TUP A;  1B8A A;  1LJO A;  4F7U E;  4XQ3 A;  3A5Y A;  3MEY A;  5C53 B;  4ZTZ B;  3DSQ A;  4M7A A;  1Z7M A;  3JB9 G;  4C92 B;  2ZR3 A;  4PJO A;  3HY1 A;  2P5I A;  4DQ2 A;  4KR3 A;  2ART A;  4PHC A;  4BWA A;  4N0A C;  5GAM j;  1ADJ A;  4Y91 A;  4JUV A;  4YCV A;  4F7U F;  3VU3 C;  2I4O A;  4JLI A;  3E9I A;  1X56 A;  5LJ5 g;  1VQZ A;  2CJ9 A;  5GAN 2;  4P75 C;  2K57 A;  5GAN 4;  3QHS A;  4OP0 A;  3JCM d;  5GAO p;  4H2U A;  5GMK e;  1KQ1 A;  2YLB A;  4J6W A;  1KMN A;  3VQV A;  4CS4 A;  5GAN j;  3RKW A;  3JCM c;  4YRQ A;  4G84 A;  1W66 A;  2ZT8 A;  3JCM Q;  3QO8 A;  1FYF A;  1E22 A;  1U1T A;  1EFW A;  3A7A A;  3JB9 F;  4ZTU B;  2Y90 A;  1U1S A;  4CH3 A;  1H4Q A;  4LNS A;  4CH6 A;  4RCC A;  2Q5H A;  1NNH A;  1IL2 A;  2DJZ A;  1X01 A;  3JB9 H;  2RB6 A;  4C92 D;  4YRF A;  3RL6 A;  4TVA A;  2ZCE A;  3V8J A;  4HT8 A;  4QVD A;  1N9S A;  1NYR A;  4P3N A;  4M7A C;  4XEO A;  5LJ3 j;  4XU0 A;  4PJO C;  4XTY A;  5GAM f;  4M7D B;  5C51 B;  5LJ5 e;  1TH7 A;  2ZR2 A;  2RM4 A;  5GAO n;  3LSQ A;  2ZIN A;  4YRR A;  4YRC A;  4H2X A;  5GMK i;  1KMM A;  3VQW A;  3HXX A;  1SRY A;  2DQ0 A;  2RHQ B;  2EJG A;  4RCB A;  1E1O A;  3GIB A;  3I7F A;  1LYL A;  4TWA A;  5K1P A;  5GAN f;  4CH5 A;  1H4V B;  1B7Y B;  5E3I A;  3BDU A;  4PNO A;  4RQE A;  3IKL A;  4EO4 A;  2DU5 A;  2ARU A;  4YP0 A;  2FB7 A;  2QTX A;  2I4N A;  4C92 A;  1YFS A;  4YRP A;  1QE0 A;  3BW1 A;  2Q7E A;  2VXE A;  1G51 A;  2CJB A;  5GMK m;  1NJ5 A;  4P73 C;  5GAO r;  2ODR D;  4M77 D;  3FIF A;  4M7A E;  4RMF A;  3REX A;  4DPG A;  3CMQ A;  4TVA B;  2PME A;  4M7D D;  4NCX A;  4PJO E;  5GAM h;  2DU7 A;  4EMK A;  4M78 B;  5LJ3 f;  3FB9 A;  1QF6 A;  4P74 C;  4UP7 A;  4HWP A;  2FYK A;  3JCM P;  4UP9 A;  3PZC A;  4M7A F;  1HTT A;  4Q15 A;  3V7C A;  4PJO F;  4H2X B;  4OLF A;  3PCO A;  1NJ8 A;  4YRI A;  2EJF A;  5GAN h;  5LJ5 d;  4KQE A;  4KR2 A;  3EFR A;  3A74 A;  3WQZ A;  4C8Q B;  1E1T A;  2DQ3 A;  3V7S A;  4P3P A;  4XEM A;  1I81 A;  4M78 G;  2ZXF A;  3A7U A;  2YLC A;  4YRO A;  2E41 A;  1G5H A;  1ATI A;  4M77 A;  2I4L A;  4EMG A;  2ZGW A;  1YCY A;  4M7D A;  2QHT A;  3JCM W;  4L87 A;  4MMK A;  4M78 D;  1EVL A;  2I4M A;  5LJ3 g;  3NEL A;  5LJ3 h;  3JCM V;  3HFN A;  3PGG A;  3IAL A;  3MF2 A;  4EMK B;  1H4T A;  3BFM A;  1BBU A;  2EL9 A;  3HFV A;  2RHQ A;  1YB3 A;  5ELN A;  3HXZ A;  5GAN 3;  3A7R A;  2ZNJ A;  1YFR A;  3NEM A;  2ZIO A;  1EOV A;  1B7Y A;  3HRK A;  3JCM f;  3UGQ A;  4C92 G;  3HSB A;  2DTH A;  3PCO B;  5GAO m;  4TQF A;  4UPA A;  1EIY A;  1Z7N A;  4C8Q D;  2IY5 B;  1D3B B;  3JB9 I;  1X2H A;  3UFG A;  1E24 A;  2AMC B;  2ZZE A;  5GAN 5;  4J15 A;  3VQX A;  3BY7 A;  2DXT A;  4TQD A;  2QHS A;  4NL2 A;  3UH0 A;  2DVE A;  5ELO A;  3W3S A;  4O2D A;  3M4Q A;  2VXF A;  4C92 E;  3RIR A;  3HXV A;  3HTZ A;  4M77 B;  4M78 A;  1B34 B;  2ODR C;  2ZT5 A;  5LJ3 e;  5K1X A;  1M5Q 1;  3QSU A;  4MML A;  2E3C A;  5C52 B;  4K88 A;  4M75 B;  3RF1 A;  2DTO A;  4H2Y A;  2Q7G A;  3HY0 A;  3ERR A;  4TTV A;  5HGQ A;  4YYE A;  4JRI A;  3P8Y A;  4C92 F;  3LC0 A;  2J3M A;  4J6Y A;  4A54 A;  2DTI A;  2RHS B;  1SER A;  4H2W A;  1LOJ A;  3JCM b;  1C0A A;  3JCM h;  4E51 A;  4WF2 A;  1B76 A;  1B70 B;  1BIA A;  1USY A;  4HT9 A;  4J6X A;  4C8Q A;  4YRM A;  4M77 G;  4TVY A;  1JJC B;  3VQY A;  1EIY B;  4M7D G;  4YRS A;  4M75 G;  4A53 A;  1H64 1;  3QTC A;  4YRT A;  1WPY A;  3A5Z A;  2CIM A;  1JRI A;  2XTI A;  2ARS A;  1KQ2 A;  3RGL A;  4YRL A;  5GAM g;  4NL3 A;  4M77 E;  4YRJ A;  2C8M A;  1G5I A;  4M75 D;  3L4G A;  4F7U B;  3RAC A;  4M7D E;  4M78 C;  4XTU A;  4XTZ A;  3REU A;  4CS3 A;  2E1H A;  4J5Y A;  2DKG A;  1HC7 A;  3TEG A;  3V8L A;  3JCM X;  5KNN A;  3QO7 A;  2G4C A;  4HWS A;  1WNL A;  4V2S A;  4X5O A;  5LJ3 d;  4P3O A;  3M4G A;  5GAN g;  3JB9 J;  2C7I A;  4M7D F;  3HFZ A;  5GMK l;  2IY5 A;  3ICA A;  1D3B A;  4YDQ A;  4G85 A;  2Q7H A;  4H2S A;  1WQW A;  2AMC A;  2J3L A;  4WJ3 M;  3SWN B;  5LJ5 f;  3RER A;  2QHV A;  3P8T A;  3L1A A;  3QO5 A;  2EWN A;  4F7U G;  1I5L A;  3JCM J;  4K86 A;  3QO3 A;  2ZTG A;  2E65 A;  4YCW A;  5GMK h;  1SET A;  1B34 A;  4WI1 A;  4C92 C;  5DY9 A;  2YHT A;  4NOY A;  5GAM e;  1H4S A;  2DZC A;  4XTW A;  4M75 A;  2DZ9 A;  1MGQ A;  3QUI A;  1L0W A;  4M78 E;  4YRK A;  1GGM A;  4YRN A;  3G1Z A;  2RHS A;  3L4G B;  4EMK C;  1ASZ A;  4C8Q G;  2E10 A;  1PYS B;  5I21 A;  2DEQ A;  2ZIM A;  1I4K 1;  3SB2 A;  1B70 A;  3BJU A;  5CAI A;  5GAN e;  2EJ9 A;  3V8K A;  3RKY A;  4XU3 A;  3OD1 A;  4M78 F;  2ALY B;  1JJC A;  4YRE A;  4K87 A;  1YGB A;  3HFZ B;  1ASY A;  2VC8 A;  4P71 A;  3JB9 D;  5LJ5 h;  3RUX A;  3HXY A;  1Y96 A;  4XU1 A;  4C8Q E;  3R07 A;  5GMK j;  3KFU A;  3HFO A;  4HWR A;  4ZIB A;  4H2T A;  4HWT A;  4BW9 A;  2XGT A;  4X9D A;  4YRG A;  2Q5I A;  1WU7 A;  4CH4 A;  3TEH A;  4F7U A;  1HXD A;  4M77 C;  4XTX A;  4XTV A;  4C8Q F;  4HA8 A;  5GAN 6;  5GAN 8;  2DXU A;  4QVC A;  3RKX A;  1SES A;  4M7D C;  5GAO l;  3LSS A;  4M75 C;  4P73 A;  4CS2 A;  3NEN A;  2HNI A;  4X9C A;  2E5A A;  2I2L A;  1I8F A;  3L2Z A;  4H2V A;  4HVC A;  5GAM d;  3MF1 A;  4M7A B;  1ADY A;  3JCM g;  2ZT7 A;  4PJO B;  1M8V A;  4P74 A;  3SWN A;  4PG3 A;  5LJ5 j;  3NET A;  4HWO A;  3HXU A;  3EFS A;  5GAO q;  2ZZG A;  1X55 A;  3INZ A;  4RDX A;  3HRI A;  2E64 A;  2ZZF A;  5GAN d;  4P71 C;  1X2G A;  4P72 A;  1Y96 B;  1NJ6 A;  3UGT A;  1WQ7 A;  3P8V A;  2ZNI A;  2AKW A;  4YCU A;  4YPF A;  3AHU A;  2EAY A;  3IG2 A;  4M7A G;  1N9W A;  1BIB A;  2QHU A;  3V7R A;  4PJO G;  3TEH B;  2P0L A;  4UP8 A;  2CJA A;  4M75 E;  3HXW A;  1PYS A;  12AS A;  2RD1 A;  1WYD A;  4N0A A;  4JRK A;  11AS A;  4M7A D;  4M77 F;  4EMH A;  3JCM e;  2PMF A;  2ALY A;  1NJ2 A;  4PJO D;  1X54 A;  1RIQ A;  4WJ4 A;  5GAN 7;  1EQR A;  3VBB A;  4P75 A;  4M75 F;  3IKM B;  3M4P A;  5F5W A;  2RA2 A;  4RQF A;  1HK9 A;  3A32 A;  3SWN C;  1USY C;  3FJP A;  1J5W A;  1KOG A;  4C8Q C;  3A31 A; 
#chains in the Genus database with same CATH topology
 4D8D A;  1ZQ1 A;  1JBM A;  3MP6 A;  1K0S A;  2ZT6 A;  3MPU B;  2JTF A;  1N9R A;  2GNC A;  4EX5 A;  2LQ8 A;  2GTJ A;  1NJ1 A;  3PFS A;  4F7U E;  4XQ3 A;  3MEY A;  1YIJ T;  2ENM A;  3DSQ A;  2PTK A;  2QDL A;  3CC7 A;  3JB9 G;  1Z7M A;  4KGV B;  1ADJ A;  2HSE B;  1KQS A;  2CRE A;  1NM7 A;  2PVD B;  3C4S A;  3E9I A;  2HCK A;  1X56 A;  2MF2 A;  2CJ9 A;  5GAN 2;  4IIM A;  3JSC A;  1KSW A;  4P75 C;  2OX7 A;  2K57 A;  3QHS A;  2VUB A;  4IKF A;  2XU8 A;  1ZBJ A;  2YLB A;  3VQV A;  4CS4 A;  2MPX C;  2GBQ A;  4ZNX A;  4QQ6 A;  1W66 A;  1BI3 A;  4C5G A;  1YNZ A;  1G3W A;  3QO8 A;  4OF1 A;  1JJ2 S;  3A7A A;  4ZTU B;  4DOW A;  3G6E A;  1G83 A;  2JJ9 A;  3MEV A;  3VS7 A;  4B9X A;  3CCJ Q;  4RCC A;  2DMO A;  2DJZ A;  1X01 A;  1UGV A;  4C92 D;  4YRF A;  1FXX A;  5KYN A;  4BDZ A;  4GBQ A;  2EQU A;  3V8J A;  1NYR A;  4QVD A;  1OI1 A;  1Z9Q A;  4M7A C;  3OYK A;  2B8A A;  1RAG B;  1OUL A;  4PJO C;  3VYH B;  1TSF A;  4M7D B;  5HY6 A;  3A1P A;  2DER A;  2ZR2 A;  1U5S A;  2K3X A;  1Q86 U;  2ZIN A;  1VQ4 Q;  1V29 B;  2DQ0 A;  3HTR A;  2RHQ B;  1AEY A;  3QZ5 B;  2WSC E;  3LLR A;  5KH6 A;  2DET A;  3PNW C;  1H4V B;  1RUW A;  4FW1 A;  3OYH A;  2K6D A;  5LL6 S;  3PT9 A;  3DLL A;  5E3I A;  1D0X A;  4RQE A;  2JMC A;  1M2V B;  4FIB A;  2P0P A;  2ARU A;  1K76 A;  4C92 A;  3GNF B;  3SFM A;  2X4W A;  1G51 A;  2CJB A;  5GMK m;  5GAO r;  3O5Z A;  2QA4 T;  1EX4 A;  4RMF A;  1GCP A;  1VUB A;  3Q1J A;  4NCX A;  2DU7 A;  4DBR A;  2NUT A;  4DEX A;  2K5L A;  2XDD A;  2DA9 A;  4P74 C;  4HWP A;  2D6F A;  2DXB A;  1Q86 R;  4Q15 A;  3V7C A;  1UG1 A;  2NUP B;  2ZZD A;  3EG1 A;  4H2X B;  1NEG A;  3H6Z A;  1GCQ C;  4OLF A;  1G8X A;  4YRI A;  4M4Z A;  2KRS A;  1VQ4 T;  5GAN h;  5LJ5 d;  4ZTJ A;  3X28 B;  3FLG A;  2GFA A;  3EFR A;  3CCV A;  2Z0W A;  2DQ3 A;  1E1T A;  3V7S A;  3G6E Q;  4P3P A;  1I81 A;  1VYU A;  1PCX A;  2DIG A;  2ZXF A;  1RAE B;  3PVL A;  3IQL A;  2ZCF B;  4PJL A;  1ATI A;  2XK0 A;  3HRS A;  2VB6 A;  4HCZ A;  2K2V A;  3M56 A;  3A5Z B;  4ESR A;  4LVM A;  1NPR A;  4M78 D;  1EVL A;  3CC7 T;  2AIR B;  3NEL A;  1BBZ A;  2EKO A;  1WI7 A;  3HFN A;  2B86 A;  1ACM B;  2DJQ A;  2HMA A;  4LDY A;  2LJ1 A;  4IUP A;  1H4T A;  2CZ6 B;  3BFM A;  1BBU A;  1QVG A;  1ZUY A;  1WHH A;  4OMO A;  1YB3 A;  2DRK A;  5ELN A;  5IXB A;  2ZNJ A;  2V8I A;  2ZIO A;  2CDT A;  2DTH A;  2RF0 A;  4Z8A A;  1TWB A;  1U06 A;  4TQF A;  3M4Y A;  5IHI A;  2J6O A;  1D3B B;  1GBR A;  4QT7 A;  1IB8 A;  2AMC B;  4J9G A;  2JS0 A;  4AFU C;  5I2S A;  1MV3 A;  3VQX A;  2KRN A;  4PJJ A;  2QHS A;  4A4K A;  2DVE A;  3G6E T;  3W3S A;  2GF7 A;  4QVZ A;  2XG8 D;  1KQS P;  3HXV A;  2QQR A;  2L0A A;  2EGE A;  4M77 B;  4M78 A;  1VQM A;  1B34 B;  3OYB A;  1VQN Q;  2ODR C;  3E2U A;  2ZT5 A;  3OS2 A;  1I07 A;  2XD0 A;  4FYY B;  2E3C A;  3ASK A;  4M75 B;  2DTO A;  3REA B;  4YYE A;  4C92 F;  5D7U A;  4J6Y A;  2X4X A;  2RHS B;  1YJ9 Q;  1VA7 A;  4IUR A;  3KUF A;  2LQK A;  1LOJ A;  5CKE A;  1WJR A;  3JCM b;  3THK A;  1SSH A;  2X35 A;  3G1J A;  3PTA A;  5C0M A;  2CH4 W;  1X2Q A;  1B76 A;  1USY A;  2DNU A;  3OYM A;  3CBP A;  2LP5 A;  4TVY A;  2NLU A;  1OX9 A;  1T0H A;  2X4J A;  1W2B S;  4FCY A;  4OMP A;  2COW A;  3CCV Q;  1FMV A;  3MET A;  2QTV A;  1TG0 A;  1FWZ A;  3QTC A;  2OTJ Q;  2F69 A;  3HRT A;  3PE0 A;  4DBF A;  2CIM A;  1GXI E;  2XTI A;  2ARS A;  5HCK A;  2LJ3 A;  4YRL A;  2CP3 A;  5GAM g;  1K8A C;  2DYB A;  3CD6 T;  2RHY A;  4XTU A;  4EDU A;  3E1S A;  4A4F A;  3TQ7 P;  4BI8 B;  2E12 A;  4ATO A;  4F16 A;  2O9V A;  1HC7 A;  1SKU B;  1ARK A;  1ZA1 B;  1T3S A;  1D1C A;  2DL8 A;  2CP5 A;  3TEG A;  3V8L A;  4AG2 C;  3JCM X;  3CCL A;  3QO7 A;  3WVD B;  4HWS A;  1WNL A;  4YTL A;  2M51 A;  2QI2 A;  3JB9 J;  1AWW A;  3VS6 A;  2IY5 A;  3ICA A;  1G3T A;  2Q7H A;  4H2S A;  4C0G A;  3CPW A;  4WJ3 M;  1X27 A;  3SWN B;  3S3O A;  1K1Z A;  2RI5 A;  3OYC A;  3DB3 A;  3L1A A;  3JRZ A;  2PVO B;  2ZTG A;  1O75 A;  5C6S A;  3JV3 A;  2LX7 A;  1YIT A;  1OU9 A;  4O6J A;  3UT1 A;  3CCV T;  5DY9 A;  3MP1 A;  3QPH A;  1AWO A;  4OMQ A;  5GAM e;  2DZC A;  3CCU A;  1LVK A;  1VQM Q;  1M1F A;  4C0Z A;  3AT1 B;  2E5K A;  3NTI A;  3L4G B;  1ASZ A;  3OYN A;  2GFU A;  4C8Q G;  1SRM A;  4OMM A;  2QQA A;  1Y71 A;  2ZIM A;  1KC8 C;  2CP2 A;  1Z9Z A;  2NYS A;  4M78 F;  2ALY B;  1JJC A;  3CCE A;  1SHF A;  4K87 A;  1TOV A;  1YGB A;  1ASY A;  2K7A A;  1RAI B;  4P71 A;  3JB9 D;  1HD3 A;  3HXY A;  4C8Q E;  3R07 A;  5GMK j;  1TUG B;  3KFU A;  3OYD A;  2P84 A;  1QLY A;  1IRX A;  2XGT A;  2P0Q A;  4YRG A;  2Q5I A;  1VYV A;  3TEH A;  4F7U A;  4M77 C;  1ZSG A;  4HA8 A;  2EBP A;  2ESW A;  1UGQ B;  1QVG P;  1SES A;  2CSQ A;  4BE2 A;  2ZPB B;  1H3H A;  1AVZ C;  1SEM A;  1BI1 A;  3ZBD A;  1TUC A;  4M75 C;  4HVV A;  1VQM T;  1V76 A;  3VV0 A;  1RAB B;  2EQK A;  2EQI A;  2HQE A;  2I0N A;  4PFZ A;  3NEN A;  4BI3 A;  2E5A A;  2DE0 X;  2HSP A;  4HVC A;  3GP8 A;  2RI2 A;  1AWJ A;  2EYX A;  1ZSZ A;  2AZS A;  1KHI A;  2HKN A;  3CCL Q;  1M8V A;  1YWO A;  4QQG A;  1RI0 A;  3NET A;  1E6G A;  1OPL A;  3HXU A;  1X55 A;  2DK3 A;  3ZL7 C;  1YJW Q;  4RDX A;  2GTO A;  1F1B B;  3OMC A;  5GAN d;  3NMZ C;  1Y96 B;  1NJ6 A;  2LQW A;  1Q81 C;  3OS1 A;  1PG5 B;  2XDP A;  4NS5 A;  3AHU A;  3MEW A;  2EAY A;  2RHI A;  4M7A G;  1N9W A;  2QHU A;  4PJO G;  4A4E A;  1RAF B;  3CCU Q;  3EGX B;  4BD3 A;  1B3Q A;  3VJP A;  3OW2 A;  1BCO A;  3QYH B;  3M55 A;  1PYS A;  1E7O A;  1S72 A;  1VQK A;  2FZC B;  1C6V X;  5DLQ E;  1WYX A;  1OU8 A;  2EQM A;  2DRM A;  3QG1 A;  3X26 B;  3CCL T;  4OB3 B;  3CCE Q;  4A4H A;  3S3N A;  3SWN C;  3JAM E;  3FJP A;  1EIF A;  1J5W A;  3A31 A;  4P3O A;  1NG2 A;  1K8A U;  3SEM A;  4JS5 A;  2ZPI B;  4H02 A;  4XU2 A;  4Q6G A;  4FW2 A;  3CCS Q;  3CMA Q;  2HL5 C;  2SEM A;  4II1 A;  1TUD A;  5IHK A;  4P72 C;  1IO6 A;  2DX1 A;  3QNE A;  1BBW A;  1YFT A;  3RES A;  2HQX A;  2AKW B;  1YIT T;  3M57 A;  3RDV A;  2JW4 A;  1PSE A;  5EG2 A;  3CCU T;  2LMJ A;  4ZTZ B;  1VQL A;  1WA7 A;  4C92 B;  2R57 A;  3HY1 A;  1U8R A;  2HBW A;  5DM7 R;  4KR3 A;  2DLP A;  3CC4 A;  1UDL A;  2GQI A;  4N0A C;  5GAM j;  4Y91 A;  4JUV A;  3CPW P;  4EIK A;  1OZ3 A;  4F7U F;  1G5V A;  4JLI A;  3I56 A;  5KYX A;  4IUQ A;  5LJ5 g;  5J39 A;  1LPL A;  2RJE A;  2DVJ A;  1PC0 A;  5L8R E;  3CCE T;  2CP6 A;  2DEU A;  2A3L A;  2AKK A;  2QQB A;  1KMN A;  3I9Q A;  3L2W A;  1K8A R;  3RKW A;  3JCM c;  2A28 A;  3NHN A;  4ZGE B;  2FHD A;  3FRN A;  5CKH A;  1FYF A;  2DYI A;  2XIC A;  1EFW A;  2RJF A;  3JB9 F;  1KC8 U;  4HCK A;  3O8V A;  2KXC A;  2XMF A;  3CME A;  2Q5H A;  3MHX A;  4ELZ C;  4N4I A;  4CI0 C;  2LX9 A;  3OYJ A;  2FPE A;  2NS6 A;  1BI2 A;  4TVA A;  4FL6 A;  2LDM A;  2KEA A;  5LJ3 j;  4XU0 A;  3QDR B;  2LT4 A;  4XTY A;  5GAM f;  1WIE A;  5C51 B;  1YCS B;  1QVP A;  5LJ5 e;  4MDX A;  2RM4 A;  3LH0 A;  3NGP A;  3LSQ A;  2JM9 A;  4KH1 B;  2VGM A;  2V8K A;  4YRC A;  4AMC A;  5GMK i;  2COY A;  1EFN A;  3VS5 A;  3CBO A;  1W1F A;  4QKU A;  4RCB A;  3I7F A;  1LYL A;  5K1P A;  4LNP A;  1WXB A;  2A36 A;  3CCJ A;  3CEY A;  1H8K A;  2CS7 A;  2ZPH B;  1KC8 R;  3IKL A;  1UEB A;  4EO4 A;  2DU5 A;  1JB0 E;  2KRO A;  2FB7 A;  2QTX A;  1YWP A;  2A7Y A;  1I1J A;  2KRM A;  1QE0 A;  3BW1 A;  4AFQ C;  4RMO A;  1VQL Q;  1YHQ Q;  1S72 T;  1CKA A;  1BKB A;  3R6N A;  1VQK T;  1Q81 U;  3CC4 Q;  3VRZ A;  4EMK A;  4Z02 A;  4M78 B;  5LJ3 f;  1RI9 A;  2M0O A;  1QF6 A;  5FWC A;  1TU0 B;  2L3Q A;  1VQ6 A;  3I56 Q;  3OB9 A;  3PZC A;  1MV0 B;  3OSS C;  4OMN A;  3CBM A;  2FPF A;  2F2X A;  3PCO A;  4RKU E;  1NJ8 A;  2O4X A;  2L2P A;  4LN2 A;  4ELY C;  2HBP A;  3OW2 P;  2CKK A;  2P4R A;  2CSI A;  3OQ5 A;  1D1B A;  2VAS A;  4XEM A;  5IAY A;  3A7U A;  1PM3 A;  3QXE B;  3CME Q;  1X2K A;  3HPW A;  2DD5 A;  2E41 A;  3L2V A;  2HDA A;  2D8H A;  3QDF A;  3REB B;  1IXD A;  3R6O A;  2VGN A;  2ATC B;  2QHT A;  1UUE A;  3L2R A;  1ZHI A;  2QG9 B;  2BE7 D;  3JCM W;  4MMK A;  1VQL T;  1Q81 R;  1WFW A;  1ZX6 A;  2JOY A;  4F14 A;  2RHX A;  2EL9 A;  4MZM A;  1R0C B;  1GFD A;  3TU4 K;  3I56 T;  1YP5 A;  1UTI A;  1B7Y A;  4IUU A;  3HRK A;  2DL7 A;  3UGQ A;  5I2M A;  2FZG B;  3HSB A;  2QQ9 A;  2FVU A;  4FYX B;  3LGF A;  1EIY A;  1Z7N A;  2ZPG B;  4C8Q D;  2IY5 B;  3J7A F;  3NTK A;  1X2H A;  3UPU A;  2K3B A;  5FW9 A;  2ZZE A;  2K2M A;  4ZN3 A;  1K4U S;  2RQU A;  3FC3 A;  3BY7 A;  2AT1 B;  4NL2 A;  2ABL A;  4E7J A;  3T9N A;  5ELO A;  1OEB A;  2VXF A;  3GNG A;  3DKM A;  3CME T;  4XAX B;  2WAC A;  4J9E A;  3SDZ A;  5CVI A;  5K1X A;  1M5Q 1;  1Y57 A;  3M0S A;  1OYX A;  5J3B A;  5HGQ A;  4CC7 A;  1TTH B;  2V1R A;  4JRI A;  3CC2 Q;  1VQ6 Q;  2DTI A;  2KDS A;  1SER A;  4H2W A;  3JCM h;  3QBY A;  5HK3 A;  4WF2 A;  1ZBX A;  4YRM A;  4C8Q A;  2LT1 A;  5IHN A;  1VQ8 A;  4WTO B;  4M77 G;  1JJC B;  3VQY A;  2LJ0 A;  4Q5W A;  2DXC A;  2MCN A;  4M75 G;  3CCJ T;  3EFO A;  1AZE A;  1WJS A;  1X6B A;  1VQN A;  1HSQ A;  3RGL A;  4NL3 A;  4YRJ A;  4M77 E;  2OJ2 A;  2C8M A;  2CUB A;  3UWN A;  4F7U B;  3RAC A;  5HK0 A;  4M78 C;  3REU A;  1I0C A;  2A08 A;  3OA6 A;  4ORZ A;  2LVM A;  1UEC A;  1YJ9 A;  3G4S A;  4B6M A;  5CR2 A;  4IUV A;  4V2S A;  1QVF P;  1VQ6 T;  5GAN g;  4JPB W;  3CCR A;  2FO0 A;  2C7I A;  5GMK l;  2P0K A;  4YDQ A;  1VQ9 A;  4G85 A;  1ZSZ B;  4BUG A;  2ECZ A;  2J3L A;  1K0X A;  4RTT A;  3EG9 A;  3L42 A;  5LJ5 f;  3LWI A;  3RER A;  2QHV A;  1UJ0 A;  3QO5 A;  2ZPE B;  4BY6 B;  2OTJ A;  1I5L A;  3N5B B;  4K86 A;  4JJB A;  2XDB A;  2LQN A;  3U23 A;  4OB0 B;  5GMK h;  1FX7 A;  2HQH A;  1MNE A;  4WI1 A;  2D9T A;  2ED0 A;  5M9O A;  4AFS C;  4XTW A;  2HAX A;  3WXM B;  3QUI A;  2RQR A;  1GGM A;  4YRN A;  1UGR B;  4RG2 A;  4LVL A;  3GBQ A;  2A8E A;  2E10 A;  1PYS B;  1BYM A;  3CXC A;  1FMW A;  2VVK A;  4BDY A;  3GLX A;  1G3S A;  3EG3 A;  5CAI A;  5GAN e;  4LUD A;  2DD4 A;  3RKY A;  3OD1 A;  3EGU A;  5KE3 A;  4N4H A;  4YRE A;  4J9F A;  3HFZ B;  1FMK A;  2KT1 A;  1WDX A;  1BK2 A;  3RUX A;  1VQ8 Q;  1JU5 C;  1IZ6 A;  4XU1 A;  2KMT A;  3BE3 A;  1W70 A;  4HWR A;  3X25 B;  4C0D B;  2AK5 A;  4FU6 A;  2G6F X;  1AD5 A;  4Z89 A;  3OBY A;  4HWT A;  2JTE A;  4X9D A;  1OOT A;  1WU7 A;  3CCM A;  4CH4 A;  2RQW A;  1HXD A;  4XTX A;  5EC7 A;  4XTV A;  5CQY A;  4C8Q F;  4LDV A;  4HKE A;  3A8H B;  4QVC A;  3RKX A;  4M7D C;  4LD6 A;  4D8K A;  4KBM B;  4L6V 5;  5ECA A;  2YWW A;  3CPW S;  5CKF A;  3RMS A;  4X9C A;  2I2L A;  4H2V A;  3G4S Q;  2K79 A;  1ADY A;  4P74 A;  4J9C A;  3J81 E;  4RTU A;  4PG3 A;  4DEY A;  3CCR Q;  2BTT A;  1D09 B;  2PQW A;  1VQ9 Q;  5GAO q;  4PK4 A;  2A0F B;  3INZ A;  3SHW A;  3VS2 A;  1GCQ A;  2L3S A;  2E64 A;  5KYU A;  2CZ0 B;  4P71 C;  1VQ8 T;  3VS0 A;  2LNV A;  4ZTF A;  1WQ7 A;  1CSK A;  3P8V A;  3QYG B;  4OGC A;  4YCU A;  2H3E B;  4E7H A;  1AOJ A;  2QGF B;  1QP3 A;  1GL5 A;  1BIB A;  2RK2 A;  4OMF B;  3P8D A;  2RNA A;  2HEQ A;  1VQN T;  1NJI C;  3HXW A;  2FRW A;  4PLL A;  1M1G A;  1B7T A;  2L3R A;  2FG0 A;  3OSV A;  5KYY A;  4EMH A;  2H3J A;  4WJ4 A;  3MO8 A;  5GAN 7;  1YJ9 T;  3VBB A;  3G4S T;  3IKM B;  3M4P A;  4PFP A;  1YJW A;  1ZSZ C;  3M54 A;  4JDS A;  4RQF A;  3CCR T;  1WHM A;  1CKB A;  4UC4 A;  3M0Q A;  1VQ9 T;  4BY6 C;  4AH6 A;  3H0H A;  2JN0 A;  3E19 A;  1XOV A;  3MP8 A;  3RNJ A;  2O31 A;  3QZ9 B;  2DDZ A;  1LNX A;  2OTJ T;  2PZ1 A;  3P8H A;  3CCM Q;  5AT1 B;  1EVK A;  1ZUK A;  1R77 A;  1LJO A;  1B8A A;  4QW2 A;  1PWT A;  2AHJ B;  2DM1 A;  2RQV A;  6AT1 B;  3A5Y A;  5C53 B;  1SSF A;  1QMC A;  1PD1 A;  4KUD K;  2CH4 A;  2WSF E;  2ZR3 A;  2GCX A;  3I55 Q;  4FT2 A;  2RH2 A;  4PHC A;  2KNB B;  2KGT A;  2PU9 B;  2XI9 A;  1VQZ A;  5DLO A;  1NYF A;  4FT4 A;  4L59 A;  4MZT A;  2F2V A;  2IPO B;  4OP0 A;  2LCS A;  3JCM d;  2RK1 A;  3CCS A;  3CMA A;  1KQ1 A;  3OW2 S;  4E7I A;  5GAN j;  4YRQ A;  4C0D C;  2DBK A;  3OYL A;  2BUD A;  4R55 A;  1NEB A;  2ZT8 A;  1WHK A;  1E22 A;  2O4X B;  5CIU A;  5D6W A;  2Y90 A;  3J80 E;  1UGS B;  1M4Z A;  2RI3 A;  3CCM T;  3CXC P;  4J83 A;  1NBE B;  3OYF A;  1IL2 A;  1WHG A;  1I5O B;  2KI7 A;  4KH0 B;  4ME7 A;  3JB9 H;  4LDU A;  2EYZ A;  1YI2 A;  3RL6 A;  2JNG A;  3MQZ A;  1K9M C;  3I5R A;  4XEO A;  2QK0 A;  1WHL A;  5KCO A;  3M53 A;  4OGE A;  3C0C A;  1TH7 A;  2JTM A;  2FEI A;  5FU7 B;  2X51 A;  1BI0 A;  4F17 A;  2NUP A;  4H2X A;  2K9G A;  1Q82 C;  1SRY A;  2DF6 A;  4CC2 A;  2EJG A;  3UA7 A;  2CP0 A;  4TWA A;  3VKI A;  5GAN f;  2K3Y A;  1B7Y B;  3TVT A;  2YRC A;  1VQO A;  3BDU A;  2BZ8 A;  2EW3 A;  4PNO A;  2PUO B;  4RG8 A;  3PIO A;  4YP0 A;  3UA6 A;  2SRC A;  2E4H A;  2I4N A;  3A8O B;  4JJD A;  1YFS A;  3VRY A;  2M16 A;  1J3T A;  1M8M A;  4HCC A;  4P73 C;  4M77 D;  4M7A E;  1MMD A;  1VIE A;  2FL7 A;  5D6Y A;  3CMQ A;  2BIV A;  3REX A;  3LWH A;  4PJO E;  2QYZ A;  2ROL A;  4UP7 A;  2VV5 A;  2MYS A;  1RLP C;  1HTT A;  1YJW T;  1NJI U;  4C5H A;  1OV3 A;  3A98 A;  3M0P A;  1LCK A;  3A74 A;  3L2U A;  2RQT A;  1K73 C;  4C8Q B;  4M78 G;  1R0B G;  2MAM A;  5IH2 A;  3HP9 A;  1YHQ A;  4M77 A;  3RMQ A;  2I4L A;  2ZGW A;  1YI2 Q;  2MWO A;  3EFO B;  3H41 A;  1O9S A;  2IG0 A;  4GLK A;  3PMI A;  1N5Z A;  2EYQ A;  3JCM V;  3PMT A;  3PGG A;  3IAL A;  4Z88 A;  3HKS A;  1SPK A;  4HVU A;  4BE0 A;  2NUT B;  1QP2 A;  1AZG B;  2QAZ A;  4B9W A;  1KHC A;  1AHJ B;  3S3M A;  2AZV A;  3EG0 A;  2R5M A;  3HXZ A;  5GAN 3;  2DBM A;  1YFR A;  3NEM A;  1NJI R;  4TVR A;  3RR6 A;  1KFZ A;  3CCS T;  3CMA T;  5GAO m;  4LUE A;  5KCH A;  2DL4 A;  4DBH A;  3UFG A;  4E6R A;  1VQO Q;  3QWY A;  2V8J A;  3GF5 A;  1E24 A;  2HKQ B;  4J15 A;  3EG9 B;  4TQD A;  3OYA A;  1PRL C;  5CO7 A;  4FSS A;  2E6N A;  4DA4 A;  4CC3 A;  1S1N A;  3EGD A;  4AT1 B;  1U3O A;  1YI2 T;  3QSU A;  2JT4 A;  1QCO A;  3NTH A;  4AFZ C;  1M2O A;  3MEA A;  3RF1 A;  4H2Y A;  3ERR A;  2WSE E;  3ZEH A;  3P8Y A;  5FU7 C;  3MCA B;  3LC0 A;  4E7Z A;  2KT8 A;  1UJY A;  2YRV A;  4PKC C;  1C0A A;  1QCN A;  2QEX A;  2F1L A;  2KE9 A;  4E51 A;  1QKW A;  2L8D A;  1X6G A;  3DLM A;  4DOV A;  1BIA A;  1QVF A;  1JXO A;  4HT9 A;  2YDL A;  2C06 A;  2DAQ A;  2E70 A;  2MMP A;  1K9M U;  2XID A;  3UAT A;  1KQS S;  4M7D G;  4YRS A;  3LYI A;  1H3Z A;  4A53 A;  1H64 1;  4MZP A;  5HKC A;  1EZZ B;  1VQO T;  2R58 A;  3CPF A;  4RTY A;  1D0Y A;  4HT4 A;  1Q82 U;  1IRE B;  4FM4 B;  4RUG A;  4LE9 A;  3L4G A;  1YIJ Q;  2W0Z A;  3CC2 A;  1X75 C;  4M7D E;  1WGS A;  1WX6 A;  4PJM A;  4XTZ A;  3A8G B;  4CS3 A;  3NPF A;  1BB9 A;  2DKG A;  2RPN A;  1WLP B;  1N8R C;  1X43 A;  1D0Z A;  4J9H A;  2NWM A;  5LJ3 d;  2DL5 A;  2EYY A;  1NE8 A;  1JEG A;  4X34 A;  1WQW A;  1KG1 A;  4Y92 A;  2YUN A;  3H0I A;  1W4S A;  2MWP A;  1K9M R;  2LCL A;  3P8T A;  2KQW A;  3C94 A;  4F7U G;  2YRD A;  3JCM J;  3QO3 A;  4YCW A;  2M1H A;  2PUK B;  3E9G A;  2C0I A;  5KYU B;  3L2Q A;  2LZ6 B;  1NLO C;  4JZ3 A;  2C0O A;  4C92 C;  4NOY A;  4P5N A;  4XK8 E;  1NPP A;  2KXD A;  2ZPF B;  1M3A A;  2DZ9 A;  1Q82 R;  1YHQ T;  1QQJ A;  1L0W A;  3CC4 T;  2C0T A;  5I11 A;  4RTV A;  1VQP A;  1K73 U;  5I21 A;  2DEQ A;  2LTO A;  1Y0M A;  1M3C A;  3BJU A;  3SB2 A;  1B70 A;  2EJ9 A;  1DJ7 B;  2EGC A;  4XU3 A;  5KYY B;  2QEX Q;  3ZFJ A;  3OYG A;  1Y96 A;  1G3Y A;  1M1K C;  1Q7Y C;  3GPL A;  2F5K A;  2YUP A;  4H2T A;  2DO3 A;  1NYG A;  4IIO A;  1OX8 A;  3EGX A;  3VUZ A;  4A63 B;  2ED1 A;  3QJ6 A;  5GAN 6;  5GAN 8;  1RAA B;  3QJY A;  4VUB A;  4FSX A;  1C1A A;  2RHU A;  4CS2 A;  4E7L A;  3LGL A;  2QA4 Q;  1GBQ A;  2HNI A;  1AT1 B;  2GGR A;  1I8F A;  3MF1 A;  3QWX X;  1K73 R;  3JCM g;  4JS4 A;  2ZT7 A;  1PHT A;  1BU1 A;  1ZLM A;  5LJ5 j;  2O2O A;  3OS0 A;  4HCB A;  1IHV A;  3M0R A;  3EFS A;  3ME9 A;  2QEX T;  5CKD A;  2OTL A;  1MMN A;  3HRI A;  5A0D A;  2ZZF A;  3PVQ A;  2L89 A;  2OI3 A;  3EHR A;  3M9Q A;  4LVI A;  3BDL A;  4JRP A;  5CK9 A;  1QVG S;  2AKW A;  3CXC S;  1GRI A;  2M0Y A;  4E47 A;  2YUQ A;  3TEH B;  1PRM C;  1RLQ C;  3VS3 A;  2O88 A;  2P0L A;  4J9B A;  4BE1 A;  4UP8 A;  2CJA A;  2FZK B;  2CZ7 B;  4M75 E;  4KGZ B;  1UE9 A;  2D0Q B;  4J7I A;  3A8L B;  2RD1 A;  5IN1 A;  4PLI A;  1WYD A;  2EYW A;  4JRK A;  4LD9 K;  2XHC A;  4M7A D;  3CC2 T;  1JJ2 A;  3JCM e;  3CD6 A;  2PMF A;  3CC7 Q;  4PJO D;  2D8J A;  1VQP Q;  1X54 A;  1EQR A;  4P75 A;  3PIP A;  2R5A A;  4RTZ A;  5F5W A;  2CUD A;  4RTX A;  1KD1 C;  3A32 A;  1SRL A;  3FEO A;  1USY C;  1VYT A;  1KOG A;  3F70 A;  3EHQ A;  1NYQ A;  1ZA2 B;  1PKS A;  1WLE A;  2E3I A;  7AT1 B;  1TS9 A;  2EIF A;  1N8R U;  3G7Z A;  1E6H A;  4MDW A;  1RAH B;  2CGH A;  2EPD A;  2L5Q A;  2E3H A;  1B07 A;  4TVW A;  3E9H A;  3TUP A;  3VS1 A;  2EGA A;  3CCQ A;  3C12 A;  2VYT A;  1JQQ A;  4M7A A;  2RMO A;  2M9U A;  3TSZ A;  4PJO A;  2P5I A;  2K5I A;  4DQ2 A;  2ART A;  4BWA A;  4YCV A;  3LW5 E;  3VU3 C;  4HXJ A;  2EVR A;  1H92 A;  1VQP T;  2I4O A;  2DL3 A;  4BI4 A;  2PNI A;  1MND A;  5FU6 B;  3H8Z A;  5GAN 4;  2O9S A;  2OTL Q;  5GAO p;  4H2U A;  5GMK e;  4J6W A;  3EH2 A;  4G84 A;  1YJN A;  1ABO A;  1N8R R;  3JCM Q;  2X4Y A;  4ANJ A;  1U1T A;  3S6W A;  2RJD A;  1N27 A;  4N4G A;  1UGP B;  1XQH A;  1U1S A;  3QKJ A;  8AT1 B;  5KYW A;  4CH3 A;  2G3R A;  4LNS A;  1H4Q A;  4CH6 A;  1NNH A;  1Y7X A;  2MI6 A;  2K4Y A;  4OB1 B;  2RB6 A;  4C5I A;  3I55 A;  1K9A A;  1ABQ A;  4ZN1 A;  2LCC A;  2QGG A;  2ZCE A;  4HT8 A;  1N9S A;  4P3N A;  1M1K U;  2JS2 A;  1Q7Y U;  3I35 A;  3CD6 Q;  2HL3 A;  2BKD N;  4R56 A;  2E6Z A;  4E7S A;  3X24 B;  2L3P A;  4JJC A;  2J05 A;  5GAO n;  2GQV A;  2KSS A;  2CP7 A;  5KYX B;  4CRI A;  4YRR A;  2HD0 A;  5A0L A;  1KMM A;  3VQW A;  2LNH B;  3HXX A;  1M90 C;  2QXF A;  2OTL T;  1IGU A;  3OYI A;  3GIB A;  1E1O A;  3VUB A;  1R8O B;  4CH5 A;  3OS5 A;  2KBT A;  2MOX A;  2IVW A;  2P4T A;  4KGX B;  3WVE B;  3TRE A;  2PVG B;  1WJQ A;  2CYZ B;  2EKH A;  2Y4Y A;  4FYV B;  4Y28 E;  1VQ5 A;  3H9N A;  4YRP A;  2DIL A;  1NZ9 A;  4KT0 E;  3CCQ Q;  5AYF A;  2Q7E A;  1UHC A;  2VXE A;  2YSQ A;  3I5S A;  2ZAE A;  4C0F A;  1NJ5 A;  2ODR D;  1M3B A;  3FIF A;  3P8B B;  4DPG A;  1Q95 G;  1VIF A;  1X69 A;  2J6K A;  4TVA B;  3ULR B;  2PME A;  4M7D D;  1M1K R;  5GAM h;  4CC4 B;  1Q7Y R;  4LDW A;  3FB9 A;  4J9I A;  3EGD B;  2LRQ A;  1QCF A;  2FYK A;  2IIM A;  3JCM P;  4UP9 A;  4GLM A;  4M7A F;  4J9D A;  2V1Q A;  3M59 A;  3VYG A;  4PFO A;  4PJO F;  2X3W D;  2Y4X A;  2DPP B;  2X3X D;  2A37 A;  2EJF A;  2O01 E;  4KQE A;  1YJN Q;  1QWE A;  2F5T X;  4KR2 A;  1UB4 A;  3WQZ A;  2YXY A;  2CZ1 B;  1JJ2 P;  2YLC A;  1YBY A;  3MJX A;  1KD1 U;  4YRO A;  1G5H A;  2KR3 A;  2CT3 A;  3OY9 A;  4EMG A;  3KXT A;  1KK7 A;  1M30 A;  2RHZ A;  1YCY A;  3CCQ T;  4M7D A;  2XKO C;  2CT4 A;  4O5V A;  4J8O A;  2NUZ A;  4F04 B;  4L87 A;  1W2B A;  2I4M A;  5LJ3 g;  2KAF A;  5LJ3 h;  1T0J A;  3MF2 A;  4EMK B;  3OYY A;  2RJC A;  5FU6 C;  2JUF A;  3HFV A;  4E2F B;  2RHQ A;  2DFU A;  5CCA A;  3A7R A;  2BZX A;  3FJ5 A;  1EOV A;  3M0T A;  3JCM f;  2OAU A;  1TXQ A;  3KFV A;  2ROT A;  2J7I A;  3M58 A;  4C92 G;  3PCO B;  2VWF A;  1M2V A;  3UDC A;  2KY9 A;  1KJW A;  4UPA A;  5FRN A;  1WZO A;  3JB9 I;  1YJN T;  4R0K A;  2YUO A;  5A2Q E;  2QQS A;  2KVQ G;  5GAN 5;  2HZY A;  3EG2 A;  2DXT A;  3UH0 A;  2EQJ A;  4A4G A;  2FRY A;  4HVW A;  4PJN A;  1VQ5 Q;  4O2D A;  3M4Q A;  1KD1 R;  2VKN A;  4C92 E;  3RIR A;  5GJV B;  3HTZ A;  5KE2 A;  2DIQ A;  3I55 T;  4WCI A;  4DBQ A;  5LJ3 e;  5CQX A;  4MML A;  5C52 B;  4JRQ A;  2K5F A;  5J26 A;  4K88 A;  2Q7G A;  1WHJ A;  3HY0 A;  4TTV A;  4RTW A;  2D1X A;  4BB7 A;  2OAW A;  2J3M A;  3GOX A;  4A54 A;  4IUT A;  1SF9 A;  1PD0 A;  2W10 A;  4X1V A;  2MK5 A;  1B70 B;  3UF4 A;  3C95 A;  2JM8 A;  2E5Q A;  1V1C A;  4FYW B;  4J6X A;  4C5E A;  5CKB A;  1OPK A;  2J06 A;  3G71 A;  1EIY B;  1MHN A;  3MEU A;  2BZY A;  2COZ A;  4YRT A;  1WPY A;  4EPC A;  3A5Z A;  1JRI A;  3H0F A;  4KUL A;  1YIT Q;  1MMG A;  1VQ5 T;  1KQ2 A;  1M90 U;  3ER0 A;  1QWF A;  4JLG A;  3HHT B;  3M5A A;  1G5I A;  4M75 D;  3EAE A;  3OMG A;  2E1H A;  4J5Y A;  3VS4 A;  1VQ7 A;  5D6X A;  2JZ2 A;  4PL6 A;  3LX7 A;  4ZGJ B;  5KNN A;  2G4C A;  4OML A;  4X5O A;  1P92 A;  4LVK A;  3M4G A;  4K11 A;  4M7D F;  3HFZ A;  1D1A A;  3TEE A;  1Y07 A;  1D3B A;  1ZUU A;  2AMC A;  4GY5 A;  1YFN A;  5GJW B;  5FLX E;  3TCJ A;  1XJW B;  2YT6 A;  1C0M A;  2AKL A;  4LDX A;  1HYO A;  1W6X A;  2EWN A;  4KUI A;  1SG5 A;  3EH1 A;  2E65 A;  1FYN A;  1SET A;  1B34 A;  5IXF A;  2YHT A;  3RBB B;  1H4S A;  1YIJ A;  4M75 A;  1AWX A;  1MGQ A;  1M90 R;  4M78 E;  1PSF A;  4YRK A;  1QVF S;  3G1Z A;  2RHS A;  4JZ4 A;  4KRT A;  4EMK C;  2FPD A;  1RL2 A;  1WXU A;  3OBW A;  2KYM A;  5FRM A;  1YN8 A;  1M27 C;  5FWB A;  1I4K 1;  1IGQ A;  1PKT A;  3X20 B;  5I22 A;  3V8K A;  4ZGD B;  1KIK A;  1RAC B;  2V26 A;  5FRO A;  1T3L A;  1QKX A;  2VC8 A;  8ATC B;  1JO8 A;  5LJ5 h;  3HRU A;  3CQT A;  4AG1 C;  2MIO A;  3G71 Q;  1M9S A;  4E7K A;  3HFO A;  4ZIB A;  1OQK A;  1NLP C;  4J7F A;  1XTD A;  3FDR A;  1W2B P;  1N6A A;  4BW9 A;  5A0G A;  2KK4 A;  4LVJ A;  1QW1 A;  1BCM A;  1SHG A;  2JMA A;  1Q86 C;  1WXT A;  2DXU A;  1UFF A;  2QAS A;  1PNJ A;  5GAO l;  3LSS A;  2X9H A;  1MUZ A;  2D0N A;  3NFC A;  4P73 A;  4OVA A;  2JXB A;  3TSW A;  1MMA A;  4JJN K;  1VQ7 Q;  1X6O A;  3L2Z A;  1S72 Q;  1VQK Q;  5GAM d;  2RN8 A;  3MKD A;  3LH5 A;  4M7A B;  3OYE A;  1VOM A;  4C8Q C;  1JXM A;  3HL8 A;  3M0U A;  4LXC A;  4PJO B;  2H8H A;  3SWN A;  5L23 A;  2EFI A;  4HWO A;  4QQD A;  1IHW A;  2ZZG A;  3URG A;  2J6F A;  4OB2 B;  1X2G A;  4P72 A;  3SD4 A;  3UGT A;  9ATC B;  2ZNI A;  5IT9 E;  3G71 T;  1GFC A;  4YPF A;  3IG2 A;  4D6W A;  3D7S B;  3V7R A;  1A0N B;  2RO0 A;  2QA4 A;  1XNI A;  3A8M B;  4BAC A;  12AS A;  5KYW B;  4N0A A;  2JVV A;  11AS A;  3DB4 A;  1OZ2 A;  1UHF A;  4M77 F;  1HJD A;  2F2W A;  1NJ2 A;  2ALY A;  1RIQ A;  1VQ7 T;  2BE9 B;  2LC4 A;  1G2B A;  4L5G A;  4M75 F;  1RAD B;  2M02 A;  3E9F A;  2RA2 A;  1HK9 A;  1VQ4 A;  2QDY B;  3KBG A;  2KYB A;  3QII A; 
#chains in the Genus database with same CATH homology
 1ZQ1 A;  1JBM A;  3MP6 A;  2ZT6 A;  2JTF A;  1N9R A;  4EX5 A;  2LQ8 A;  1NJ1 A;  3PFS A;  4F7U E;  4XQ3 A;  3MEY A;  1YIJ T;  3DSQ A;  3CC7 A;  3JB9 G;  1Z7M A;  1ADJ A;  1KQS A;  2PVD B;  3C4S A;  3E9I A;  1X56 A;  2MF2 A;  2CJ9 A;  5GAN 2;  3JSC A;  4P75 C;  2K57 A;  3QHS A;  2VUB A;  4IKF A;  2XU8 A;  2YLB A;  3VQV A;  4CS4 A;  4QQ6 A;  1W66 A;  1BI3 A;  4C5G A;  1G3W A;  3QO8 A;  4OF1 A;  1JJ2 S;  3A7A A;  4ZTU B;  4DOW A;  3G6E A;  3MEV A;  4B9X A;  4RCC A;  2DJZ A;  1X01 A;  4C92 D;  4YRF A;  1FXX A;  4BDZ A;  2EQU A;  3V8J A;  1NYR A;  4QVD A;  1OI1 A;  4M7A C;  3OYK A;  2B8A A;  4PJO C;  3VYH B;  4M7D B;  5HY6 A;  2ZR2 A;  2K3X A;  1Q86 U;  2ZIN A;  1V29 B;  2DQ0 A;  2RHQ B;  3QZ5 B;  2WSC E;  3LLR A;  5KH6 A;  3PNW C;  1H4V B;  3OYH A;  5LL6 S;  3PT9 A;  3DLL A;  5E3I A;  4RQE A;  4FIB A;  2P0P A;  2ARU A;  4C92 A;  3GNF B;  3SFM A;  2X4W A;  1G51 A;  2CJB A;  5GMK m;  5GAO r;  2QA4 T;  4RMF A;  1VUB A;  3Q1J A;  4NCX A;  2DU7 A;  2K5L A;  2XDD A;  4P74 C;  4HWP A;  2D6F A;  2DXB A;  4Q15 A;  3V7C A;  2ZZD A;  4H2X B;  3H6Z A;  4OLF A;  4YRI A;  1VQ4 T;  5GAN h;  5LJ5 d;  4ZTJ A;  3X28 B;  3FLG A;  2GFA A;  3EFR A;  3CCV A;  2DQ3 A;  1E1T A;  3V7S A;  4P3P A;  1I81 A;  2DIG A;  2ZXF A;  2ZCF B;  1ATI A;  2XK0 A;  3HRS A;  4HCZ A;  2K2V A;  3M56 A;  3A5Z B;  4LVM A;  1NPR A;  1EVL A;  4M78 D;  3CC7 T;  3NEL A;  2EKO A;  3HFN A;  4LDY A;  4IUP A;  1H4T A;  2CZ6 B;  3BFM A;  1BBU A;  1QVG A;  1YB3 A;  5ELN A;  2ZNJ A;  2V8I A;  2ZIO A;  2DTH A;  4TQF A;  3M4Y A;  1D3B B;  2AMC B;  5I2S A;  3VQX A;  2QHS A;  4A4K A;  2DVE A;  3G6E T;  3W3S A;  2GF7 A;  4QVZ A;  2XG8 D;  3HXV A;  2QQR A;  4M77 B;  4M78 A;  1VQM A;  1B34 B;  3OYB A;  2ODR C;  2ZT5 A;  3OS2 A;  2E3C A;  2XD0 A;  3ASK A;  4M75 B;  2DTO A;  4YYE A;  4C92 F;  4J6Y A;  2X4X A;  2RHS B;  4IUR A;  3KUF A;  2LQK A;  1LOJ A;  5CKE A;  1WJR A;  3JCM b;  2X35 A;  3PTA A;  5C0M A;  1B76 A;  1USY A;  3OYM A;  3CBP A;  4TVY A;  2NLU A;  2X4J A;  1W2B S;  3MET A;  1FWZ A;  3QTC A;  2F69 A;  3HRT A;  2CIM A;  1GXI E;  2XTI A;  2ARS A;  4YRL A;  5GAM g;  1K8A C;  3CD6 T;  2RHY A;  4XTU A;  4EDU A;  3E1S A;  4A4F A;  4BI8 B;  4ATO A;  2E12 A;  1HC7 A;  3TEG A;  3V8L A;  3JCM X;  3CCL A;  3QO7 A;  3WVD B;  4HWS A;  1WNL A;  4YTL A;  2QI2 A;  3JB9 J;  2IY5 A;  3ICA A;  1G3T A;  2Q7H A;  4H2S A;  4C0G A;  3CPW A;  4WJ3 M;  3SWN B;  3S3O A;  2RI5 A;  3OYC A;  3DB3 A;  3L1A A;  3JRZ A;  2PVO B;  2ZTG A;  1O75 A;  5C6S A;  1YIT A;  4O6J A;  3UT1 A;  3CCV T;  5DY9 A;  3MP1 A;  3QPH A;  5GAM e;  2DZC A;  3CCU A;  1M1F A;  4C0Z A;  3NTI A;  3L4G B;  1ASZ A;  3OYN A;  2GFU A;  4C8Q G;  2QQA A;  1Y71 A;  2ZIM A;  1KC8 C;  4M78 F;  2ALY B;  1JJC A;  3CCE A;  4K87 A;  1YGB A;  1ASY A;  4P71 A;  3JB9 D;  3HXY A;  4C8Q E;  3R07 A;  5GMK j;  3KFU A;  3OYD A;  2XGT A;  2P0Q A;  4YRG A;  2Q5I A;  3TEH A;  4F7U A;  4M77 C;  4HA8 A;  1UGQ B;  1SES A;  4BE2 A;  2ZPB B;  3ZBD A;  1BI1 A;  4M75 C;  1VQM T;  3VV0 A;  2EQK A;  2HQE A;  3NEN A;  4BI3 A;  2E5A A;  4HVC A;  3GP8 A;  2RI2 A;  1KHI A;  1M8V A;  4QQG A;  1RI0 A;  3NET A;  3HXU A;  1X55 A;  2DK3 A;  4RDX A;  3OMC A;  5GAN d;  1Y96 B;  1NJ6 A;  1Q81 C;  3OS1 A;  2XDP A;  4NS5 A;  3AHU A;  3MEW A;  2EAY A;  2RHI A;  4M7A G;  1N9W A;  2QHU A;  4PJO G;  4A4E A;  4BD3 A;  3VJP A;  3OW2 A;  3QYH B;  3M55 A;  1PYS A;  1S72 A;  1VQK A;  5DLQ E;  2EQM A;  3QG1 A;  3X26 B;  3CCL T;  4OB3 B;  4A4H A;  3S3N A;  3SWN C;  3JAM E;  3FJP A;  1EIF A;  1J5W A;  3A31 A;  4P3O A;  1K8A U;  4JS5 A;  2ZPI B;  4H02 A;  4XU2 A;  4Q6G A;  4II1 A;  4P72 C;  3QNE A;  1BBW A;  1YFT A;  3RES A;  2HQX A;  2AKW B;  1YIT T;  3M57 A;  1PSE A;  5EG2 A;  3CCU T;  4ZTZ B;  1VQL A;  4C92 B;  2R57 A;  3HY1 A;  1U8R A;  5DM7 R;  4KR3 A;  3CC4 A;  4N0A C;  5GAM j;  4Y91 A;  4JUV A;  1OZ3 A;  4F7U F;  1G5V A;  4JLI A;  3I56 A;  5LJ5 g;  4IUQ A;  5J39 A;  2RJE A;  5L8R E;  3CCE T;  2A3L A;  2QQB A;  1KMN A;  3L2W A;  3RKW A;  3JCM c;  4ZGE B;  2FHD A;  3FRN A;  5CKH A;  1FYF A;  2XIC A;  1EFW A;  3JB9 F;  2RJF A;  1KC8 U;  3O8V A;  3CME A;  2Q5H A;  3MHX A;  4ELZ C;  4N4I A;  4CI0 C;  2LX9 A;  3OYJ A;  2NS6 A;  1BI2 A;  4TVA A;  4FL6 A;  2LDM A;  5LJ3 j;  4XU0 A;  3QDR B;  2LT4 A;  4XTY A;  5GAM f;  5C51 B;  1QVP A;  5LJ5 e;  4MDX A;  2RM4 A;  3LH0 A;  3LSQ A;  2VGM A;  2V8K A;  4YRC A;  5GMK i;  3CBO A;  4RCB A;  3I7F A;  1LYL A;  5K1P A;  3CCJ A;  3CEY A;  2CS7 A;  2ZPH B;  3IKL A;  1UEB A;  4EO4 A;  2DU5 A;  1JB0 E;  2FB7 A;  2QTX A;  2A7Y A;  1QE0 A;  3BW1 A;  4RMO A;  1S72 T;  1VQK T;  1BKB A;  1Q81 U;  4EMK A;  4Z02 A;  4M78 B;  5LJ3 f;  2M0O A;  1QF6 A;  1VQ6 A;  3OB9 A;  3PZC A;  3OSS C;  3CBM A;  3PCO A;  4RKU E;  1NJ8 A;  2O4X A;  4ELY C;  2HBP A;  2CKK A;  3OQ5 A;  4XEM A;  5IAY A;  3A7U A;  3QXE B;  3HPW A;  2DD5 A;  2E41 A;  3L2V A;  3R6O A;  2VGN A;  2QHT A;  3L2R A;  1ZHI A;  3JCM W;  4MMK A;  1VQL T;  2JOY A;  2RHX A;  2EL9 A;  4MZM A;  3TU4 K;  3I56 T;  1B7Y A;  4IUU A;  3HRK A;  3UGQ A;  5I2M A;  3HSB A;  2QQ9 A;  2FVU A;  3LGF A;  1EIY A;  1Z7N A;  2ZPG B;  4C8Q D;  2IY5 B;  3J7A F;  3NTK A;  1X2H A;  3UPU A;  2ZZE A;  4ZN3 A;  3FC3 A;  3BY7 A;  4NL2 A;  4E7J A;  3T9N A;  5ELO A;  3GNG A;  2VXF A;  3DKM A;  3CME T;  4XAX B;  2WAC A;  3SDZ A;  5CVI A;  5K1X A;  1M5Q 1;  1OYX A;  5J3B A;  5HGQ A;  4JRI A;  2DTI A;  2KDS A;  1SER A;  4H2W A;  3JCM h;  3QBY A;  5HK3 A;  4WF2 A;  1ZBX A;  4YRM A;  4C8Q A;  2LT1 A;  1VQ8 A;  4M77 G;  1JJC B;  3VQY A;  4Q5W A;  2DXC A;  4M75 G;  3CCJ T;  1WJS A;  1VQN A;  3RGL A;  4NL3 A;  4YRJ A;  4M77 E;  2C8M A;  3UWN A;  4F7U B;  3RAC A;  5HK0 A;  4M78 C;  3REU A;  3OA6 A;  2LVM A;  1YJ9 A;  3G4S A;  5CR2 A;  4IUV A;  4V2S A;  1VQ6 T;  5GAN g;  3CCR A;  2C7I A;  5GMK l;  2P0K A;  4YDQ A;  1VQ9 A;  4G85 A;  4BUG A;  2J3L A;  3L42 A;  5LJ5 f;  3LWI A;  3RER A;  2QHV A;  3QO5 A;  2ZPE B;  2OTJ A;  4BY6 B;  1I5L A;  3N5B B;  4K86 A;  2XDB A;  4OB0 B;  5GMK h;  1FX7 A;  4WI1 A;  2D9T A;  5M9O A;  4XTW A;  2HAX A;  3WXM B;  3QUI A;  1GGM A;  4YRN A;  1UGR B;  4RG2 A;  4LVL A;  2A8E A;  2E10 A;  1PYS B;  1BYM A;  3CXC A;  4BDY A;  3GLX A;  1G3S A;  5CAI A;  5GAN e;  2DD4 A;  3RKY A;  3OD1 A;  5KE3 A;  4N4H A;  4YRE A;  3HFZ B;  3RUX A;  1IZ6 A;  4XU1 A;  2KMT A;  4HWR A;  3X25 B;  4C0D B;  4FU6 A;  3OBY A;  4HWT A;  4X9D A;  1WU7 A;  3CCM A;  4CH4 A;  1HXD A;  4XTX A;  4XTV A;  5CQY A;  4C8Q F;  4LDV A;  4HKE A;  3A8H B;  4QVC A;  3RKX A;  4M7D C;  4LD6 A;  4KBM B;  4L6V 5;  3CPW S;  5CKF A;  3RMS A;  4X9C A;  2I2L A;  4H2V A;  1ADY A;  4P74 A;  3J81 E;  4PG3 A;  2PQW A;  5GAO q;  3INZ A;  2E64 A;  2CZ0 B;  4P71 C;  1VQ8 T;  2LNV A;  4ZTF A;  1WQ7 A;  3P8V A;  3QYG B;  4OGC A;  4YCU A;  4E7H A;  1QP3 A;  1BIB A;  2RK2 A;  4OMF B;  3P8D A;  1VQN T;  1NJI C;  3HXW A;  4PLL A;  1M1G A;  2L3R A;  3OSV A;  4EMH A;  2H3J A;  4WJ4 A;  3MO8 A;  5GAN 7;  1YJ9 T;  3VBB A;  3G4S T;  3IKM B;  3M4P A;  1YJW A;  3M54 A;  4JDS A;  4RQF A;  3CCR T;  4UC4 A;  1VQ9 T;  4BY6 C;  4AH6 A;  2JN0 A;  3E19 A;  1XOV A;  3MP8 A;  3QZ9 B;  2DDZ A;  1LNX A;  2OTJ T;  3P8H A;  1EVK A;  1B8A A;  1LJO A;  4QW2 A;  2AHJ B;  3A5Y A;  5C53 B;  1SSF A;  4KUD K;  2WSF E;  2ZR3 A;  2GCX A;  4FT2 A;  2RH2 A;  4PHC A;  2PU9 B;  2XI9 A;  1VQZ A;  5DLO A;  4FT4 A;  4L59 A;  4MZT A;  4OP0 A;  3JCM d;  2RK1 A;  3CCS A;  3CMA A;  1KQ1 A;  3OW2 S;  4E7I A;  5GAN j;  4YRQ A;  4C0D C;  3OYL A;  2BUD A;  4R55 A;  2ZT8 A;  1E22 A;  2O4X B;  5CIU A;  5D6W A;  2Y90 A;  3J80 E;  1UGS B;  1M4Z A;  2RI3 A;  3CCM T;  4J83 A;  3OYF A;  1IL2 A;  4ME7 A;  3JB9 H;  4LDU A;  1YI2 A;  3RL6 A;  2JNG A;  3MQZ A;  1K9M C;  4XEO A;  5KCO A;  3M53 A;  4OGE A;  1TH7 A;  2JTM A;  5FU7 B;  1BI0 A;  4H2X A;  1Q82 C;  1SRY A;  2EJG A;  4TWA A;  3VKI A;  5GAN f;  2K3Y A;  1B7Y B;  1VQO A;  3BDU A;  4PNO A;  2PUO B;  4RG8 A;  3PIO A;  4YP0 A;  2I4N A;  3A8O B;  1YFS A;  2M16 A;  4HCC A;  4P73 C;  4M77 D;  4M7A E;  1VIE A;  2FL7 A;  5D6Y A;  3CMQ A;  2BIV A;  3REX A;  3LWH A;  4PJO E;  4UP7 A;  2VV5 A;  1HTT A;  1YJW T;  1NJI U;  4C5H A;  3A74 A;  3L2U A;  1K73 C;  4C8Q B;  4M78 G;  2MAM A;  3HP9 A;  1YHQ A;  4M77 A;  3RMQ A;  2I4L A;  2ZGW A;  2MWO A;  1O9S A;  2IG0 A;  4GLK A;  3PMI A;  2EYQ A;  3JCM V;  3PMT A;  3PGG A;  3IAL A;  3HKS A;  4BE0 A;  1QP2 A;  4B9W A;  1KHC A;  1AHJ B;  3S3M A;  2R5M A;  3HXZ A;  5GAN 3;  1YFR A;  3NEM A;  4TVR A;  3CCS T;  3CMA T;  5GAO m;  5KCH A;  3UFG A;  1E24 A;  2V8J A;  3GF5 A;  4J15 A;  4TQD A;  3OYA A;  5CO7 A;  2E6N A;  4DA4 A;  1YI2 T;  3QSU A;  3NTH A;  3MEA A;  3RF1 A;  4H2Y A;  3ERR A;  2WSE E;  3ZEH A;  3P8Y A;  5FU7 C;  3MCA B;  3LC0 A;  2YRV A;  4PKC C;  1C0A A;  2QEX A;  4E51 A;  2L8D A;  3DLM A;  4DOV A;  1BIA A;  1QVF A;  4HT9 A;  2C06 A;  2DAQ A;  2E70 A;  2MMP A;  1K9M U;  2XID A;  1KQS S;  4M7D G;  4YRS A;  3LYI A;  1H3Z A;  4A53 A;  1H64 1;  4MZP A;  5HKC A;  1VQO T;  2R58 A;  3CPF A;  4HT4 A;  1Q82 U;  1IRE B;  4FM4 B;  3L4G A;  3CC2 A;  1X75 C;  4M7D E;  1WGS A;  4XTZ A;  3A8G B;  4CS3 A;  2DKG A;  1N8R C;  5LJ3 d;  1NE8 A;  4X34 A;  1WQW A;  1KG1 A;  1W4S A;  2MWP A;  2LCL A;  3P8T A;  2KQW A;  3C94 A;  4F7U G;  3JCM J;  3QO3 A;  4YCW A;  2M1H A;  2PUK B;  3E9G A;  3L2Q A;  4C92 C;  4NOY A;  4P5N A;  4XK8 E;  1NPP A;  2ZPF B;  2DZ9 A;  1YHQ T;  1L0W A;  3CC4 T;  1VQP A;  1K73 U;  5I21 A;  2DEQ A;  2LTO A;  3BJU A;  3SB2 A;  1B70 A;  2EJ9 A;  1DJ7 B;  4XU3 A;  3ZFJ A;  3OYG A;  1Y96 A;  1G3Y A;  1M1K C;  1Q7Y C;  3GPL A;  2F5K A;  4H2T A;  2DO3 A;  3VUZ A;  3QJ6 A;  5GAN 6;  5GAN 8;  3QJY A;  4VUB A;  4FSX A;  2RHU A;  4CS2 A;  4E7L A;  3LGL A;  2HNI A;  1I8F A;  3MF1 A;  3JCM g;  4JS4 A;  2ZT7 A;  5LJ5 j;  3OS0 A;  4HCB A;  3EFS A;  3ME9 A;  2QEX T;  5CKD A;  2OTL A;  3HRI A;  5A0D A;  2ZZF A;  2L89 A;  3M9Q A;  4LVI A;  3BDL A;  4JRP A;  5CK9 A;  1QVG S;  2AKW A;  3CXC S;  4E47 A;  3TEH B;  2P0L A;  4BE1 A;  4UP8 A;  2CJA A;  2CZ7 B;  4M75 E;  2D0Q B;  4J7I A;  3A8L B;  2RD1 A;  5IN1 A;  4PLI A;  1WYD A;  4JRK A;  4LD9 K;  2XHC A;  4M7A D;  3CC2 T;  1JJ2 A;  3JCM e;  3CD6 A;  2PMF A;  4PJO D;  1X54 A;  1EQR A;  4P75 A;  3PIP A;  2R5A A;  5F5W A;  1KD1 C;  3A32 A;  3FEO A;  1USY C;  1KOG A;  3F70 A;  1NYQ A;  1WLE A;  2EIF A;  1N8R U;  3G7Z A;  4MDW A;  2CGH A;  2L5Q A;  4TVW A;  3E9H A;  3TUP A;  3CCQ A;  3C12 A;  2VYT A;  4M7A A;  2M9U A;  4PJO A;  2P5I A;  2K5I A;  4DQ2 A;  2ART A;  4BWA A;  4YCV A;  3LW5 E;  3VU3 C;  2I4O A;  1VQP T;  4BI4 A;  5FU6 B;  3H8Z A;  5GAN 4;  5GAO p;  4H2U A;  5GMK e;  4J6W A;  4G84 A;  1YJN A;  3JCM Q;  2X4Y A;  1U1T A;  3S6W A;  2RJD A;  1N27 A;  4N4G A;  1UGP B;  1XQH A;  1U1S A;  3QKJ A;  4CH3 A;  2G3R A;  4LNS A;  1H4Q A;  4CH6 A;  1NNH A;  1Y7X A;  2MI6 A;  2K4Y A;  4OB1 B;  2RB6 A;  4C5I A;  3I55 A;  4ZN1 A;  2LCC A;  2ZCE A;  4HT8 A;  1N9S A;  4P3N A;  1M1K U;  1Q7Y U;  2BKD N;  4R56 A;  2E6Z A;  3X24 B;  5GAO n;  2GQV A;  2KSS A;  4CRI A;  4YRR A;  2HD0 A;  5A0L A;  1KMM A;  3VQW A;  3HXX A;  1M90 C;  2QXF A;  2OTL T;  3OYI A;  3GIB A;  1E1O A;  3VUB A;  1R8O B;  4CH5 A;  3OS5 A;  2IVW A;  2P4T A;  3WVE B;  3TRE A;  2PVG B;  1WJQ A;  2CYZ B;  2Y4Y A;  4Y28 E;  1VQ5 A;  4YRP A;  1NZ9 A;  4KT0 E;  2Q7E A;  5AYF A;  2VXE A;  1NJ5 A;  4C0F A;  2ODR D;  3FIF A;  3P8B B;  4DPG A;  1VIF A;  4TVA B;  2PME A;  4M7D D;  5GAM h;  4LDW A;  3FB9 A;  2LRQ A;  2FYK A;  3JCM P;  4UP9 A;  4M7A F;  3M59 A;  3VYG A;  4PJO F;  2Y4X A;  2DPP B;  2EJF A;  2O01 E;  4KQE A;  2F5T X;  4KR2 A;  1UB4 A;  3WQZ A;  2CZ1 B;  2YLC A;  1YBY A;  1KD1 U;  4YRO A;  1G5H A;  3OY9 A;  4EMG A;  3KXT A;  2RHZ A;  1YCY A;  3CCQ T;  4M7D A;  2XKO C;  4O5V A;  4J8O A;  4L87 A;  1W2B A;  2I4M A;  5LJ3 g;  2KAF A;  5LJ3 h;  3MF2 A;  4EMK B;  3OYY A;  2RJC A;  5FU6 C;  2JUF A;  3HFV A;  2RHQ A;  5CCA A;  3A7R A;  1EOV A;  3JCM f;  2OAU A;  3M58 A;  4C92 G;  3PCO B;  3UDC A;  2KY9 A;  4UPA A;  5FRN A;  3JB9 I;  1YJN T;  5A2Q E;  2QQS A;  2KVQ G;  5GAN 5;  2DXT A;  3UH0 A;  2EQJ A;  4A4G A;  4O2D A;  3M4Q A;  4C92 E;  3RIR A;  3HTZ A;  5KE2 A;  2DIQ A;  3I55 T;  5LJ3 e;  5CQX A;  4MML A;  5C52 B;  4JRQ A;  2K5F A;  5J26 A;  4K88 A;  2Q7G A;  3HY0 A;  4TTV A;  4BB7 A;  2J3M A;  3GOX A;  4A54 A;  4IUT A;  1B70 B;  3C95 A;  2E5Q A;  4J6X A;  4C5E A;  5CKB A;  3G71 A;  1EIY B;  1MHN A;  3MEU A;  4YRT A;  1WPY A;  4EPC A;  3A5Z A;  1JRI A;  4KUL A;  1KQ2 A;  1VQ5 T;  1M90 U;  3ER0 A;  4JLG A;  3HHT B;  3M5A A;  1G5I A;  4M75 D;  3EAE A;  3OMG A;  2E1H A;  4J5Y A;  1VQ7 A;  5D6X A;  2JZ2 A;  4PL6 A;  3LX7 A;  4ZGJ B;  5KNN A;  2G4C A;  4LVK A;  4X5O A;  1P92 A;  3M4G A;  4M7D F;  3HFZ A;  3TEE A;  1Y07 A;  1D3B A;  2AMC A;  4GY5 A;  5FLX E;  3TCJ A;  4LDX A;  2EWN A;  4KUI A;  2E65 A;  1SET A;  1B34 A;  2YHT A;  1H4S A;  1YIJ A;  4M75 A;  1MGQ A;  4M78 E;  1PSF A;  4YRK A;  1QVF S;  3G1Z A;  2RHS A;  4EMK C;  1RL2 A;  3OBW A;  5FRM A;  1I4K 1;  3X20 B;  3V8K A;  4ZGD B;  5FRO A;  2VC8 A;  5LJ5 h;  3HRU A;  1M9S A;  4E7K A;  3HFO A;  4ZIB A;  4J7F A;  1XTD A;  3FDR A;  1N6A A;  4BW9 A;  5A0G A;  2KK4 A;  4LVJ A;  1QW1 A;  1Q86 C;  2DXU A;  5GAO l;  3LSS A;  3NFC A;  4P73 A;  4OVA A;  4JJN K;  1X6O A;  3L2Z A;  5GAM d;  4M7A B;  3OYE A;  3HL8 A;  4PJO B;  3SWN A;  2EFI A;  4HWO A;  4QQD A;  2ZZG A;  3URG A;  4OB2 B;  1X2G A;  4P72 A;  3SD4 A;  3UGT A;  2ZNI A;  5IT9 E;  3G71 T;  4YPF A;  3IG2 A;  4D6W A;  3V7R A;  2RO0 A;  2QA4 A;  1XNI A;  3A8M B;  4BAC A;  12AS A;  4N0A A;  2JVV A;  11AS A;  3DB4 A;  1OZ2 A;  4M77 F;  2ALY A;  1NJ2 A;  1RIQ A;  1VQ7 T;  2LC4 A;  4L5G A;  4M75 F;  3E9F A;  2RA2 A;  1HK9 A;  1VQ4 A;  2QDY B;  3KBG A;  4C8Q C;  3QII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...