3LSSA

Trypanosoma brucei seryl-trna synthetase in complex with atp
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
438
Chain Sequence
GSMMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEACVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
total genus 159
structure length 438
sequence length 470
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lssA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lssA02
2ALYA 1H4SA 4RMFA 3E9IA 4HA8A 3LC0A 3A74A 3HXWA 2AKWB 4KR2A 1SESA 2EL9A 4YCUA 4Q6GA 1B7YA 4XTUA 3UGTA 4YYEA 1WNLA 2ZT7A 3TEHB 3WQZA 3TUPA 1EVLA 3PCOA 3EFSA 4UP7A 1B7YB 2I4OA 2DKGA 1ADYA 4LNSA 3UFGA 2DEQA 1WQ7A 5K1XA 4HWOA 2HNIA 1H4VB 4OLFA 1NJ1A 1LYLA 2CJAA 1HTTA 4XTXA 1G5IA 1L0WA 3NEMA 3M4QA 4CH3A 5K1PA 2I4NA 1BBUA 3BJUA 3MF2A 1SETA 3HY0A 2DZ9A 4PG3A 4TTVA 4O2DA 4WJ3M 3MEYA 2DJZA 2DZCA 3P8YA 4X5OA 2EJFA 1B70B 2QHUA 4HWTA 3MF1A 4CS3A 4AH6A 3QNEA 3E9HA 2ZR2A 2Q7EA 3IG2A 2Q5HA 3L4GA 2DQ3A 1HC7A 1USYA 4CS4A 4H2YA 2DVEA 5E3IA 4K86A 2FYKA 3L4GB 4XTYA 4CH6A 2QHTA 1IL2A 1KMMA 1ASYA 2CJBA 2RHQB 4DPGA 4TQFA 2RHSA 1ATIA 4P73C 4P3OA 5ELNA 4P75A 3HFVA 2E10A 3I7FA 1EOVA 4UPAA 2ZXFA 1YB3A 2EAYA 1E22A 4OP0A 2EJ9A 4P75C 4P3PA 3R07A 2C7IA 3P8TA 2ZCEA 3V7RA 2CJ9A 2ARTA 3A31A 2DTIA 3NENA 2I4MA 4XEMA 2XGTA 3OD1A 3V7CA 1X56A 1C0AA 2AKWA 2ODRD 2ODRC 1H4QA 2E3CA 3TEHA 1NJ8A 4TWAA 5C53B 4ZIBA 1VQZA 4YRSA 2ARSA 3HXVA 3A5YA 2AMCA 2QHVA 4BW9A 2E5AA 4CS2A 2I4LA 2EJGA 4YRQA 4TVYA 4YREA 1WYDA 2AMCB 3IALA 4H2UA 3QO8A 4J15A 1YFRA 4P74A 4G85A 3VQWA 4K88A 3EFRA 4P71A 4YRLA 2XTIA 4Q15A 1HXDA 5C51B 2DXTA 2PMEA 2E65A 4YRCA 1B70A 4P74C 1Z7MA 1E24A 1YFSA 4ZTZB 2DU5A 1WU7A 1H4TA 4P71C 4TVAA 1J5WA 4XTVA 2QHSA 2ZZEA 1RIQA 4H2WA 2CIMA 2ZT8A 4XTZA 4TVAB 1PYSB 4NCXA 1E1OA 2ZT5A 4YCVA 1X2GA 2G4CA 3A7AA 3HXYA 3G1ZA 4WI1A 4P72A 1N9WA 4YRGA 4RQEA 4HVCA 4YRIA 11ASA 2ARUA 4EO4A 4YRNA 3A7RA 2RHQA 4WF2A 2ZT6A 5F5WA 1USYC 4P72C 2ZZFA 4H2XA 3RL6A 3RUXA 3V8KA 4YPFA 3M4PA 1X2HA 2ZIMA 2IY5A 4XU0A 3UGQA 12ASA 3A32A 5ELOA 3RACA 4H2XB 4RQFA 4K87A 1NNHA 1EFWA 3RKWA 3NELA 2DTOA 3RKYA 1B76A 3ERRA 4YRKA 2IY5B 1EIYB 4H2TA 4RDXA 3VBBA 2DXUA 3LSQA 1BIAA 1KOGA 3V7SA 4YP0A 1W66A 2ZNJA 2Q7GA 2P0LA 2PMFA 3W3SA 4YRFA 1QE0A 4E51A 1JJCB 2C8MA 4KQEA 4UP9A 4YROA 1E1TA 3L2ZA 2ZZGA 4WJ4A 1ADJA 3TEGA 1KMNA 3HRIA 3CMQA 4ZTUB 1BBWA 3NETA 3V8JA 4HWRA 5KNNA 3HTZA 3RKXA 4XU3A 3HFZB 3PZCA 4YRRA 4HWPA 4H2VA 4XU2A 4CH4A 4CH5A 2ZTGA 2ALYB 3FJPA 3P8VA 2DDZA 1G5HA 3A7UA 3QO5A 4L87A 1FYFA 5HGQA 3KFUA 1WLEA 2ZGWA 2DTHA 3BFMA 3HXXA 1PYSA 4UP8A 3HRKA 3PCOB 1ASZA 4PHCA 3RF1A 3IKLA 4YDQA 4H2SA 3VQXA 1NJ5A 3QO7A 4H02A 4TVWA 4KR3A 2P5IA 3UH0A 1B8AA 2J3LA 2CGHA 2E41A 3RGLA 1YGBA 3DSQA 1WQWA 4P3NA 2Q5IA 1NYQA 4EX5A 1X54A 3REUA 3HY1A 2ZIOA 1NYRA 3RIRA 2ZR3A 4TQDA 2ZNIA 5C52B 3V8LA 4XEOA 3LSSA 3A5ZA 1EIYA 4G84A 4YRPA 3VQYA 4XU1A 4P73A 4XTWA 3L1AA 3REXA 3HXUA 3IKMB 1X01A 4YCWA 2E64A 2Q7HA 1EQRA 4YRMA 2J3MA 1NJ6A 1JJCA 1SRYA 4YRTA 2RHSB 1NJ2A 1WPYA 1G51A 1QF6A 1X55A 1SERA 3VQVA 2DU7A 1GGMA 1Z7NA 4HWSA 1EVKA 3HFZA 1BIBA 2ZINA 4YRJA 3QTCA 2E1HA 2DQ0A 1YFTA 2EWNA 3HXZA 4DQ2A 4BWAA 3ICAA
chains in the Genus database with same CATH superfamily
2EIKB 2CTWA 4GX2A 3E9IA 3TXSA 3LC0A 3E22B 3A74A 2A9HA 3MD0A 4H37A 3SPHA 4L8JA 1B7YA 4XTUA 3UGTA 3CCRV 2ZT7A 4NYKA 4IL6Z 3OR6C 1EVLA 3CPWU 3QG5A 3PCOA 1X59A 5JQGB 2Q67A 3W7UA 1AJNA 1ADYA 1D5NA 3CCLV 1WB8A 5EZYB 4DV0B 4JI5O 1IXMA 2C2AA 4HWOA 4PDMA 3CMAV 1LYLA 3SPGA 3JARB 2XAJA 2EIMC 4LF6B 1WA8A 2OT5A 2IH3C 2X7RB 2I4NA 3MF2A 2MK3A 2QE7G 2A8EA 5LMUO 4HZ3A 1TUBA 2UXCO 5CA0B 2B9ZA 2UXBB 1AR1B 3CXHF 4U7NA 3P8YA 4QIWF 4FZ1A 2LGWA 5CBHA 4LNUB 2QHUA 4HWTA 4W4LA 4CS3A 5LOVB 4UCOA 1Y76A 4DR3B 4MSWC 2Y4TA 3B8NA 2Q7EA 3RVZA 1HNZB 2Q5HA 4UUJC 4BW5A 4DRXA 1J5EB 3S3XA 2DQ3A 3P3NA 4KUMA 1USYA 4FVMA 4FFKA 1QCEA 2E74B 5A9GA 4K86A 4DR4B 2YIBD 3N2GB 2FKXA 3PJSK 2OYQA 2H8PC 1CEZA 3L4GB 5EBWC 1R6KA 4U3JB 4FM0A 4DK0A 3OAAG 2E5LB 1IL2A 1SZTA 2RNBA 4XDKA 4WBNA 1FYJA 1VQ4V 1SS3A 2GSMB 3G6BA 4QE9A 1NQTA 3K9AA 4F6EA 4MVUA 4NXNB 2CJBA 3SPCA 3ZRWB 2P4KA 2RQ6A 1ATIA 4JI1O 4CC6A 4FM1A 2QA4V 1M4UA 3JATA 2HR3A 3I7FA 4Z2WA 3SJAC 4UPAA 4PA7A 5GTIZ 1VF6C 2ZXFA 2R9RB 2A79B 1YB3A 3B4SA 1SZXA 2LW1A 1BHBA 4YJ2A 4PV1B 1EZVH 1GTOA 3HB3B 4X65O 5HFMA 4P75C 1GN2A 4P3PA 2C7IA 3K5OA 3QVNA 5LA6A 2QKCA 1BE3H 3V7RA 4R6ZA 3UO2A 3A31A 4FLUA 3U10A 4J7JA 3ZMUA 2I4MA 3X2QC 5LGTA 1VIBA 2XGTA 3OD1A 1IZ3A 4JI4O 1IBMO 2ODRD 4X66O 4EB6A 4O4JA 3T2MA 4X20B 2ADPA 3OD4A 4JI3O 2E76B 1NBMG 1K4DC 3SGIA 2UUBO 4TWAA 2ILMA 3JD4A 2DYSB 4MW3A 1XMQB 4JTAB 1IBKO 1VEWA 4I55A 1N36B 2ETNA 1H38A 3OTFA 4ZOLA 3AK1A 3D36C 1ZLZA 2HVJC 1JPXA 5H2FZ 3ZMTA 1FFTB 3A2FA 2ARHA 2OTJV 5CA1B 2EILB 1VQOV 2JRIA 2ZM6O 2QKSA 3B09A 1LNQA 4UVBA 4JI6B 4YRLA 4PI0A 2EINC 5BR8O 2YIDA 3AG4B 4GX0A 4DV7B 3L73H 1B70A 1G1XB 4P74C 4GCZA 4GX5A 1NU1H 1YFSA 1N33O 3KKYA 1FAFA 1QLEC 4P71C 4WFHA 1JCHA 2D2CB 4I4TA 4I9QA 4JI7O 1Q6HA 1WJZA 2CH7B 1PL0A 1MZEA 3A0BZ 4QE7A 2ZT8A 5LMNO 4NCXA 1E1OA 4YCVA 3A7AA 1H2KA 5EYPB 4WI1A 3LSUA 1PL4A 3UCSC 4YRGA 4AI8A 3OMNB 11ASA 4YRNA 5L3DA 1JFFA 2DWEC 3R66A 4I50A 3CXCU 2HLDG 4LWSA 5KA5A 1USYC 1IDSA 2QWOB 4AILC 5FLXN 2Y0IA 3FD9A 3ZIAG 1PP9H 3RL6A 1R6NA 3RUXA 1Q81W 3V8KA 1Q43A 4O2AA 3FB7C 1X2HA 3M4PA 3CRAA 1PNMA 2IY5A 3GWOA 1S77D 12ASA 2EBOA 2Z0AA 4JPRA 1UJWB 5GONB 5ELOA 1JOYA 4H2XB 3ZEDA 3IFXA 3LUTB 3CX5F 3S3WA 2JGUA 4OPHA 3W7SA 2AGAA 5DEDA 4DR7B 5J2TA 1RP3B 4OX9O 3RYCA 1EIYB 2UXDB 3VBBA 3LSQA 5JJNB 4YJ3A 4KL1A 2JJ2G 3SYCA 3E8FA 4YP0A 1LUVA 1DK1A 4IT5A 1W66A 3OGCC 4WFGA 2DYRC 1Y66A 5IYZB 2CGNA 2K1EA 4R50A 2P0LA 2PMFA 4JI8O 1QE0A 5BY1A 2OIEA 4KQEA 4UP9A 3ABMC 4JZ2A 1GMGA 2IW5A 3X2QB 1XHXA 4MW8A 5J2UA 1H2GA 3H1KH 3HKBB 3APQA 3CCQV 4LF4O 4GLXA 4WJ4A 1KMNA 4LVJA 1SF9A 2LFRA 3HRIA 2KSDA 5B1BB 1BBWA 2M7WA 5JJEB 3DC6A 1WPXA 1QU7A 3LNMB 1Y74B 3HFZB 2DN9A 4BR6A 5KHIA 4TUYB 1CXZB 1I08A 2ZTGA 3FJPA 2OTLV 2JS3A 4DR1O 1G4YB 2UXNA 3H01A 2QWPB 4KXRA 1ZTEA 4CC5A 5D5QA 1YCIA 2KQXA 4K8ZA 2X6AA 4FMTA 4B3SO 1Q90D 1WLEA 3LDCA 2DTHA 2ZGWA 4YIOA 1I94O 3HRKA 3PCOB 2ITCC 1NTKH 1SA0A 2PF4E 4DV6B 1VARA 3QO7A 4H02A 1WA8B 4IGGA 3QF7A 1QVGU 1VQ7V 3E83A 2OCHA 2YXYA 3UH0A 4FFBB 4LVLA 1B8AA 1JQ0A 3CWBH 4DV5B 1JX9A 1KMIZ 2E41A 1F4NA 1M57C 4O4IA 2PGGA 4MT8A 1WQWA 2GTSA 4P3NA 3H1HH 4EX5A 4EFEA 3GWKC 2F4VO 2Q69A 3FYEB 1Y76B 2ZIOA 3FKSG 1NYRA 3RIRA 4DR2O 1JA8A 5D5PA 5ITZA 1P49A 3V8LA 2YXHA 4DRXB 3OUSA 4JTCB 5L3EA 3Q4HA 4BIOA 1W0KG 4AQYO 1OCCB 2E75B 4DR5O 1VQKV 2YDEA 3VQYA 3REXA 3HXUA 3JAKB 4JAUA 2IM9A 4JASA 3JD3A 5KHGA 1Q6UA 1M9NA 2IU0A 1N34O 2E64A 4WBNB 4MTOA 3SR2C 1V9PA 1JR9A 4LFAO 4JI0B 1JJCA 3HR0A 1NJ2A 2P67A 4YY3B 4JYBA 3CE2A 3DTUB 4DV2B 3JATB 3ABKB 4J41A 1R6TA 5KHKA 2YIAA 1WN7A 5LP6A 1M90W 1SERA 3SJQC 2AZ2A 3VQVA 1Q7YW 3L72H 3G6EV 1GGMA 4I0XB 2BOCC 2Z3YA 4HWSA 1RPOA 3AG3B 3RT3C 1R1BA 5LA6B 4OPAA 1NR7A 1XNRB 1K8AW 3ZN1A 2Y4UA 2FTKA 1ORQC 4HA8A 1L8DA 2KG7B 2OCCC 1SESA 4WF9V 2EL9A 1OHHG 1BT8A 4UVCA 5E79Z 2WLKA 4O4JB 4EB6B 3ETEA 2PZSA 3WQZA 5FPOA 4PD4F 2LW7A 3TUPA 3KCYA 5CN0A 5IDJA 1AR4A 2HHHB 3T1HO 3OTOB 4UP7A 4F4LA 3CJHA 3D8CA 2Y0PA 1WQ7A 3ZMVA 4LH6A 4QGPA 1NZ6A 5GTHZ 2VQFO 4OLFA 5IY5C 3G80A 2CJAA 2V1DA 4KP4A 3BVOA 3M4QA 1Z5WA 3ZHSA 4LFBO 1GM8A 4GKKB 1BBUA 4JI2O 3E89A 3BJUA 2EJRA 1RFYA 4LVKA 3MAQA 2ZE5A 4GKJO 2BSKA 4IIJB 1N0NA 4TTVA 3FX7A 4O2DA 1SQFA 4DUYO 1FFXA 2EIJC 2G38A 3MEYA 2DJZA 3ABTA 1B70B 1SQXH 5LHHA 1OV9A 3QNEA 1Q6IA 4EFBA 4XDJA 3T4ZA 4I4TB 3ZRSA 1THZA 1VQ9V 1HC7A 2NLJC 4CS4A 4H2YA 5E3IA 2FYKA 3ABLB 1ZL8A 4UCVA 1P4RA 2JGDA 4XTYA 5TISZ 3RN4A 1MOFA 4K8XA 1HR0B 2QHTA 3TGUH 3CRRA 5IYCO 1KMMA 4NVPA 2NN4A 1FXKB 1ASYA 2WLMA 3N27A 5B1AB 3I56V 4LVMA 3ML0A 3PN1A 1PPJH 2JVDA 4X88A 3THOA 5ELNA 4NR1A 4P75A 5FL7G 4O2AB 1EOVA 1N0JA 1IXBA 1YIJV 1AP5A 3ZMSA 4LF7B 2EAYA 3LDEA 1E22A 4X64B 2EJ9A 3JYCA 2ZXWC 3RBZA 5J2TB 3P8TA 4O4HA 3E86A 3RYCB 1K5SA 3NENA 4XEMA 3V7CA 5B66Z 3ZJZA 2F43G 1NH2B 2AKWA 3UT5B 4P30A 1VQ5V 5KX5B 5LP6C 1GM7A 1AVMA 3WB0A 1YZBA 3D36A 2XT9A 1Z5VA 2GTAA 1HNWB 4ZIBA 4YRSA 3K0GA 4X1IB 1EN6A 3OMAB 5HFLA 2AMCA 1OCZB 5B3SB 3HKEA 3VOUA 4DV4O 5BMVA 4CS2A 5J2UB 2I4LA 1N8RW 1WNSA 2Y69C 1WYDA 4LVIA 3JALA 3ZHVA 1KC8W 1HNXO 2UUAB 1YITV 1YFRA 4LF9B 4P74A 5E1AC 3JASA 3EFRA 2Z5UA 3OM3B 4P71A 4FPPA 1SQPH 3BPZA 1X4TA 4J10A 2PMEA 5FPRA 2E65A 2JK5C 2WLJA 4UXNA 4B08A 3ASOC 5IY5B 1V55C 2DU5A 2AZ0A 1H4TA 1COWG 2R9AA 4TVAA 1J5WA 4XTVA 3ETDA 2QHSA 1AR5A 4IHJA 4LR3A 1RIQA 4H2WA 5JCOC 5LBQA 4UFZA 4QNHB 2HP8A 2K9PA 4MVRA 3HKCB 3C90A 1X2GA 3HXYA 3CB2A 3HKDA 2A3QA 2RDCA 4MTGA 4TV9A 2Q4PA 4DXWA 3STZC 1SA0B 1ZAUA 1ROPA 4O2BB 4RQEA 3JD1A 1OJHA 4LF5O 1XDCA 2RCVA 3SYAA 4YHHB 4TOIA 4WF2A 4J7ZA 5F5WA 2XOKG 4O4LA 5F2VO 3J7AU 1P7GA 3H9VA 5L3FA 1TGOA 3WG7C 1KP3A 2ZKOA 4HNAB 2ZIMA 1MZFA 4XU0A 3TETA 3UGQA 4X89A 3L75H 2V7QG 4K87A 1S76D 1NNHA 3ZHUA 1SQBH 3RKYA 2GDSA 1KUQA 4GT1A 4JI5B 3Q4HB 1GH6A 4TV8A 3N2KA 1BIAA 1KOGA 1Y67A 1W2BU 1V54B 3OT7A 1M56C 2ITDC 3AG1C 2IJJA 1VQ8V 2X6CA 4LP8A 1O9GA 4BIUA 3I55V 3JD0A 3BA9A 1QNMA 1NH2D 2N05A 5LMUB 3IC7A 3W3SA 2UXCB 1N32O 2ZXWB 2D3OW 2JS5A 2DWDC 1JJCB 2C8MA 4X1KA 4JZGA 5KMGB 1E1TA 2ZZGA 1ADJA 1XREA 3TEGA 2WAMA 3E35A 4D7TA 2XAGA 3HPLC 3ZCCA 5L3CA 1YF2A 4OGQB 5EIBD 3F5WC 3V8JA 2O57A 3RGBA 5KNNA 1GK9A 1H2MA 3RKXA 4XU3A 2JDIG 1KB9F 3PZCA 4ZI7A 4MTFA 1YI2V 3AG7A 2W6JG 4RO2A 4CH4A 3OE7G 4P2ZA 4CH5A 1K92A 5KLVH 4FIPC 3P8VA 5JVDA 3ZS8C 1G5HA 3A7UA 1YVWA 4N21A 4X62O 3EFFK 1ENVA 3QO5A 1S5HC 3CCSV 1HW7A 1VF7A 4DUZO 4LF8O 2BOBC 1FYFA 3KFUA 1FXHA 4F6RA 2EIMB 1A32A 1PYSA 4JI1B 2YEVA 1XNQO 1E1RG 5H9CA 1TVKB 2CE4A 3SPJA 1MG1A 3ETGA 3IKLA 3TK1A 1URFA 4R8CA 1QR9A 3STLC 1MSWD 1IX9A 4LC1A 1V55B 1K9MW 2UU9O 1YDXA 2YICA 5KAFZ 4X65B 1DF5A 4KR3A 1OCRC 2P5IA 1MMMA 1I0HA 3ZRVA 3E8HA 3RGLA 2VQEO 1YGBA 2BSKB 3L70H 1NYQA 4JI4B 1FFXB 1IBMB 2YIBA 4OXSA 3FAVA 4YXWG 1L0LH 4X66B 4UV8A 5B1NA 1S0VA 1D2DA 3LNNA 3REUA 4B7KA 4JI3B 4AHCA 2HEPA 4UB8Z 1BQ0A 3P3PA 2UUBB 2WPDG 2ZR3A 1MA1A 1N4CA 4ZHQA 2ZNIA 4XEOA 3A5ZA 3K59A 4TSFG 1KBHA 1IBKB 1K34A 4FLXA 1WPBA 3DGEA 1XL6A 1RSOA 2CUGA 4LFCO 1CPYA 1B6QA 4B3RO 3K58A 2ODMA 2P4VA 5L3GA 1SQQH 2XAQA 2IJHA 2JGDB 2B5UA 2F66C 3FB6C 2BCCH 1F51A 5FNVA 3DC5A 2A7WA 4YCWA 2EZOA 2XTAA 5A2QN 3DXRB 3D3IA 2Q7HA 2PI4A 4KHPO 4YRMA 5BR8B 2J3MA 1NJ6A 1SRYA 1HP8A 1R73A 1XI1A 4JYAO 1W0JG 4RWUA 3F7YC 1N33B 5LYJA 3O9OA 3CMEV 1RM1C 5C8YA 1Q82W 4NXMO 1X55A 2HKOA 2P06A 2YXLA 4JI7B 2DU7A 4IYHA 1GAXA 4JAVA 2ZT9B 2WLLA 4K3AA 3G4SV 1Z7NA 1GN4A 3E22A 5KHJA 1AROP 2ZQMA 5LMNB 1XMOB 1BIBA 5B1OA 3UM7A 2H94A 4O4HB 1US6A 2E1HA 2DQ0A 4DV1O 3HXZA 1Y6XA 1YHQV 1YXBA 2CK3G 3HXWA 2AKWB 1E79G 1EZJA 4MVOA 3AG2C 4Q6GA 5JWPA 5JQGA 2EJ7A 3SYPA 4YYEA 5EZYA 3MHHC 4Z1VA 4DW1A 3H1JH 4PA6A 4YIPA 1B7YB 2I4OA 2DKGA 4FK5C 1KECA 2Q0AA 1UPGA 4WFEA 2IJKA 2DEQA 3IAYA 3ZHRA 1H4VB 1JMKC 2QTSA 4K35A 1HTTA 4P9OA 5IWAO 1G5IA 4K0KO 3ASNC 1DTOA 4BAYA 1T5EA 2EINB 2WSSG 3JALB 5K1PA 1AILA 4BIZA 4OX9B 4J80A 1XBLA 1VQNV 3RYHA 1SETA 1NT2B 4E4EA 3JASB 4U7OA 5C93A 2QEXV 1QLEB 4PG3A 2ZE8A 4X5OA 4UV9A 2EJFA 4MTXA 3U11A 3JSNA 3MF1A 5J9PC 1TUBB 3D3QA 3TXQA 4FLVA 4E2LA 1K33A 3E9HA 2NR5A 4UCUA 4ABMA 2YI9A 2EZPA 4JI8B 1I5YA 3N2GA 4IHJB 3L4GA 4FLWA 2WA4A 1QLNA 1FJGO 2W0FC 2DVEA 4LF4B 1BCCH 4PJ0Z 5IYDO 1FPOA 2QGNA 1WP7A 4I7ZB 4TV9B 1UFIA 2R9IA 2Q68A 3UO3A 3I5DA 2KB1A 3ZRWA 2Q6AA 4DR6O 3ZBHA 4FLZA 1NTMH 3CRCA 3E8GA 4HT4A 4B3MO 2RHSA 4WFBV 1XOUA 4P3OA 2HFEC 4GYCB 4DR1B 3HFVA 1XL4A 2F23A 1R3JC 4NKGB 1TUEB 4UCSA 1KQSU 5LGUA 3GVMA 3BFRA 4B3SB 3MQZA 5KUMA 1I94B 1U97A 3OGIB 2ZCEA 2DYRB 3T1YO 2HVKC 2DTIA 4X20A 1CP9A 4TV8B 3BA8A 4QPJA 4YJ2B 2F95B 1X56A 2Q8VA 1C0AA 3EXAA 2ODRC 5IJ9A 3U0ZA 2P5OA 3FYIB 4DV3O 3TEHA 3ABMB 1Q8IA 2EIKC 3ICXA 1NJ8A 2IU3A 1D5AA 1DGSA 2N04A 4PDVA 2QHVA 2WA3A 5JJJB 4U3FH 1XILA 1OCOC 4X1KB 4H0LB 5CA1A 2A06H 2EJGA 4YRQA 4TVYA 4YREA 3JD2A 2P22C 3UQ8A 4H2UA 4I55B 4DR2B 3APOA 2LQTA 4J15A 4ZOLB 2PUSA 3K79A 3ZMZA 4JV5O 3VQWA 4AQYB 4WFAV 2UXXA 4DR5B 2XNDG 2M6YA 4ZI7B 4EEQA 2DXTA 5JCOA 1BSMA 4YRCA 1Z7MA 5H5NA 2YS8A 5JVDB 1WU7A 1N34B 1LUWA 4UCTA 4LFAB 3O65A 4B3TO 4F6RB 1PYSB 1TA8A 2FL4A 1HWYA 2G4CA 4J11A 4J7KA 2PTMA 5KHHA 2IJIA 2R70A 3G1ZA 3JSLA 3W7WA 1K4CC 1N9WA 3CCUV 1VQMV 3AK2A 4HVCA 1M57B 3W7TA 3A7RA 5AG2A 2RHQA 2L6LA 2PI5A 2CAZC 4P72C 1NI8A 3UKMA 1KKDA 5EBLC 4G2KA 3W7XA 5GONA 2F1MA 4DW0A 4H2XA 1JFFB 4JYYA 3CCJV 4DV0O 2WLNA 3AK3A 1SQGA 4I50B 4P9PA 5B5EZ 2R72A 3A8TA 4LWSB 3FAVB 2DW4A 4X1YA 3CC4V 3A32A 3RACA 4LF6O 4RQFA 1EFWA 3B2EE 2DTOA 2GUZA 3T1HB 1Q3EA 4ZHQB 3ERRA 2ADQB 4YRKA 2UUCB 1ZX3A 3OEHG 2IY5B 3OUFA 3CRMA 4RDXA 5LHGA 3J81N 5IYZA 2VQFB 5BXZA 2UXBO 4QJFB 4LBEC 1P7BA 1KKCA 4FZ0A 4LFBB 1S3JA 3WB2A 4DR3O 4JI2B 2Q73A 4YJ3B 2Q7GA 2CDYA 3HKBA 1HNZO 4GKJB 2W0XA 1J5EO 4YRFA 4MS2A 4DUYB 5EC1C 1U96A 3CCMV 4B7EA 4YROA 4PA9A 4DR4O 1K73W 3FB5C 4J9ZB 2DYSC 1JJOA 5LYJB 3CMQA 1Y74A 4ZTUB 4TT3G 3NETA 5C8YB 1DF4A 1VF5B 4XBFA 1VMGA 5DM6V 3K5MA 4R7CA 2E5LO 3EVKA 4RAIA 2A0LA 4TUYA 3P30A 4MVSA 1SKVA 2WLLB 2OCCB 3SJBC 4X9QA 4NXNO 3E2EA 3SYQA 2OIGA 1NKDA 4HWPA 3RFRA 4PHZA 2EILC 1OCOB 4JGSA 2RJZA 5IE9A 3K06A 1OZ0A 3B8MA 5IJ0A 4WFFA 1IBLB 3CRQA 2RN9A 5JH7A 3IC9A 3AG4C 3G71V 3FFQA 4A5UB 5HGQA 3BFMA 1YTFB 2JEXA 3HXXA 2HJDA 1FXVA 4MVZA 5IT9N 4PHCA 3RF1A 2YSUB 4KFMA 4YDQA 4FJCC 5LGNA 4FFBA 3VQXA 1NJ5A 1YJWV 4GZRB 2Q9LA 1AJPA 1L0NH 2EIJB 1BQZA 3ZN0A 3AEIA 1M93A 3RYHB 4NTYA 1AI5A 3K9SA 1XMQO 1AI7A 2AHYA 2Q5IA 1BGYH 1YJNV 1N36O 3JAMN 2VRZA 2H3OA 5KAIZ 4O4IB 3HY1A 3BEHA 1I7FA 1MSDA 3B77A 1VP7A 3K3WA 3A0RA 3LSSA 4JYCA 4LH7A 3JAKA 3SPIA 3LDDA 2LFSA 5DN6G 1PNKA 4JI6O 4G84A 4YRPA 1EBOA 4DV4B 3JCUZ 4P73A 4UVAA 4GX1A 4DK1A 5ITZB 4XTWA 3L1AA 4DV7O 2DOSA 1IVSA 1HNXB 2QM4A 1X01A 2QWQB 2V4DA 1BMFG 1EFRG 5CA3A 3K08A 2PY5A 2QWRB 1JVMA 1XUQA 3OR7C 1R3LC 3BCCH 2RHSB 2XUMA 3CC7V 1WPYA 1G51A 4I0XA 1LR1A 2AXTZ 1WAZA 1ZWIC 3H1IH 4CZZA 2WLIA 3G67A 1EVKA 2KG7A 2ZINA 5LP6B 5B1BC 1QHTA 1YFTA 5H6RA 2EWNA 1KYOF 4BWAA 3ICAA 2ALYA 1H4SA 4RMFA 3EHBB 3WFVA 1WB7A 1IURA 2DJVA 3BAAA 4KR2A 4YCUA 4LF5B 1P84F 2B1GA 3OEEG 2EULA 3CC2V 2QTOA 5IJ9B 1FKAO 4D6TH 1WNLA 2Q0OC 3CYOA 3TEHB 3H1LH 1QQCA 5LXTA 3OMIB 1GKFA 3L9DA 2Y69B 4DR7O 1GN6A 3EFSA 2JIZG 1PV0A 1R3KC 4LNSA 3UFGA 2GBOA 5K1XA 2UXDO 2HNIA 1BL8A 3L71H 4XDLA 1NJ1A 3CEIA 3RVYA 4I9WA 3ZRXA 1YTFD 4H33A 4XTXA 1L0WA 3NEMA 3K0DA 3CJHB 4IIJA 4CH3A 3JAWA 5EBMC 3KCXA 1K3EA 4G27B 3HY0A 2DZ9A 4PA4A 3ASOB 2IBZH 3RWRD 4WJ3M 1YEWA 3C3TA 2DZCA 2ZD9A 4Q20A 3NXSA 3L2ZA 4AH6A 2ZR2A 2WLHA 3IG2A 1XMOO 2QSAA 1AJQA 1N32B 2QM7A 2BTQA 5CBGA 1FS0G 2XASA 4JAAA 2P90A 1FXKA 4GUNA 4CH6A 1Y4MA 1MNGA 1GM9A 1OCCC 1Z2GA 1ZL8B 3WG7B 2NS6A 2GHYA 2QR4A 2RHQB 4DPGA 2FYUH 4TQFA 2ZM6B 4P73C 1W59A 3RYFA 5CMUA 3ZHQA 2E10A 4X62B 1H2LA 2DMXA 1L1FA 5CB4A 1NR1A 4DUZB 3RYIA 4LF8B 3L74H 4DV6O 2Q5ZA 4X1YB 2YUAA 4OP0A 1VQLV 1S5JA 1EN5A 1ZSPA 1M56B 3ABKC 3UT5A 3R07A 1G8MA 2GUZB 2VS0A 1XNQB 1O9HA 3AG1B 5KX5A 2CJ9A 2ARTA 1GO3F 4DV5O 1PD3A 3SYOA 3TCUA 3AG3C 2AW9A 4X1IA 2UU9B 1GN3A 2Y48A 1H4QA 2CTRA 2E3CA 4LCUC 1I5XA 3A0HZ 5C53B 1VQZA 2ARSA 3BHPA 3HXVA 5L3BA 3A5YA 2VQEB 3IGAC 2DE0X 2QKAA 3J80N 2LJ2A 1S5LZ 1RPRA 4BW9A 2JEUA 1TAEA 2N74A 2E5AA 3CS5A 3JARA 4I5SA 5H6QA 1DLBA 1BZKA 2AMCB 3IALA 1BS3A 3QO8A 1BHAA 4H13B 4RUEA 2ATKC 3F7VC 3JCZA 3HKEB 4QPKA 5BMVB 4G85A 4K88A 4LFCB 3CD6V 5CA0A 4B3RB 2XTIA 1F7YA 4Q15A 3CCEV 1HXDA 5GW7A 4JI0O 5C51B 1WP8A 4MVQA 4PDRA 4H44B 3TJTA 2EX3A 4LNUA 2VWJA 4PA3A 3CCVV 5LOVA 4YY3O 1H8EG 1E24A 4DV2O 4ZTZB 5KA6A 4ZBMA 3HKCA 3K5NA 1G6UA 5IJ0B 5KUKA 2ZZEA 4UB6Z 5JH7B 4KHPB 1XEQA 2CIMA 3T4DA 2W6IG 3SJCC 2QM8A 4XTZA 1KU9A 1AB3A 4O2BA 4TVAB 2XAHA 2WWWA 4JYAB 2ZT5A 1EN4A 3FB8C 1XNRO 1M5IA 1OCRB 1PNLA 2NNUA 4NXMB 4P72A 4U3JA 2BTOA 3ETQA 1Q86W 1KD1W 3K04A 2KKWA 4YRIA 2ARUA 4W4KA 4EO4A 1F4MA 3HKDB 4PELA 4FLTA 3ABLC 2FB5A 3B40A 2ZT6A 4HAMA 4HNAA 2ZDIA 2JJ1G 4DV1B 2ZZFA 2HHHO 3OTOO 4NB5A 1QVFU 4J42A 1F23A 1FXKC 4YPFA 5B1AC 4O4LB 2PYJA 5EC2C 2XHBA 3K5LA 3KG2A 4FLYA 3RKWA 1Q5OA 3NELA 4GKKO 1B06A 4MVMA 1B76A 1B3QA 3GB7C 1NS1A 1AI6A 4HBNA 1E1QG 3CP1A 3M99B 4H2TA 2ZE7A 2DXUA 5LHIA 1KP2A 4EKWA 4Z1MG 2L35A 2AHZA 3V7SA 5IWAB 4HYOA 4K0KB 3WB1A 2OWOA 2ZNJA 2X6BA 2YI8A 3N2KB 3NR7A 3IJ4A 2GV9A 3ABUA 1M1KW 5KMGA 3BRCA 3WU2Z 1GRJA 1RM1B 1XHZA 3K57A 4E51A 3K03A 1S72V 4DO2A 2HJFC 1VQPV 1K5QA 4G28B 1J95A 1B04A 1NVPB 2BE3A 1OCZC 2X0LA 2F4VB 5B3SC 1HR0O 4HWRA 5EIBC 1QR8A 1FJGB 3HTZA 2MW2B 2WLIB 3AG2B 3C3SA 3BABA 4YRRA 4H2VA 3MHSC 4XU2A 1QBZA 3ZHTA 4NTWA 2CGOA 2XAFA 2ALYB 2DDZA 1AI4A 3KZIZ 4DR6B 1H2SB 1K7DA 4L87A 2UUCO 4LF7O 1TVKA 2CH7A 2CTQA 3P32A 4JTDB 4X64O 1NJIW 1PKXA 2IH1C 3RW0A 5LXTB 1NTZH 4B3MB 3ASNB 1JJ2U 1VQ6V 4UP8A 5LL6Y 1ASZA 4FM2A 1MABG 3E8BA 5EYPA 2B1IA 4TWKA 2ZE6A 4UCRA 3OW2U 4H2SA 2YEVB 5BZBA 1YJ9V 4X8AA 5IYBO 3CSXA 4TVWA 3JAWB 2QWNB 3T1YB 2J3LA 1HDJA 2CGHA 1HNWO 3BY6A 3F5TA 1PM9A 5CBFA 1H8HG 3DSQA 4CBCA 1K97A 4D7SA 4ICGA 3ZX6A 1H2NA 5DECA 1X54A 4PDLA 2LP7A 3M7MX 5EK0A 2QDOA 4DV3B 2P6JA 3R65A 4NTXA 4RUFA 3T1CA 4TQDA 2UUAO 5C52B 4LF9O 1YSCA 1FD9A 1EIYA 2BTQB 2ZDIC 2RMKB 4PI2A 3MDSA 2LGQA 1SC5B 4XU1A 3DXRA 2P7TC 1IBLO 2QJ1A 3IKMB 2FMLA 4JF3A 1RSOB 2CTPA 4DYLA 2YC0A 1VF6A 2HG5C 1AP6A 4IYIA 4JV5B 2F93B 4N23A 1V54C 4ASUG 1EQRA 5FNVB 2PYLA 3CHXA 4YRTA 3OFNG 2LO1A 3RYFB 1ZUQA 1SQVH 1XQ8A 1QF6A 5CB4B 1EM1A 1R3IC 3SDLA 3RYIB 4C7UA 4WCEV 4B3TB 4J9YB 4YHHO 1NVPD 3HFZA 4YRJA 4ZKIA 3QTCA 3M8AA 4DQ2A 2VWKA
chains in the Genus database with same CATH topology
2EIKB 2ALYA 1YHQV 1H4SA 2FTKA 4GX2A 3E9IA 1ORQC 3EHBB 3WFVA 2CK3G 3LC0A 4HA8A 3A74A 3HXWA 2AKWB 2A9HA 2OCCC 4KR2A 1SESA 3MD0A 4H37A 3SPHA 4WF9V 1E79G 1EZJA 1OHHG 2B1GA 3AG2C 4MVOA 4UVCA 1B7YA 3OEEG 4Q6GA 3SYPA 4XTUA 2WLKA 3CC2V 3ETEA 3UGTA 4YYEA 2QTOA 3CCRV 3CYOA 3MHHC 1WNLA 2ZT7A 3TEHB 3WQZA 3OR6C 3OMIB 3TUPA 1EVLA 1GKFA 3CPWU 5CN0A 2Y69B 5IDJA 4PA6A 3PCOA 3EFSA 4UP7A 1B7YB 2Q67A 2I4OA 2JIZG 3W7UA 4F4LA 1AJNA 1R3KC 4FK5C 1KECA 1ADYA 3CCLV 2DKGA 4LNSA 3UFGA 2DEQA 4WFEA 2IJKA 3ZMVA 1WQ7A 5K1XA 1IXMA 2C2AA 2HNIA 4HWOA 4PDMA 3CMAV 1H4VB 1BL8A 4XDLA 4OLFA 1NJ1A 1LYLA 3RVYA 5IY5C 4I9WA 3SPGA 3ZRXA 1YTFD 4H33A 4P9OA 1G5IA 2XAJA 1HTTA 2CJAA 4XTXA 2EIMC 2V1DA 3ASNC 4KP4A 1DTOA 3K0DA 4BAYA 3NEMA 2EINB 2WSSG 3M4QA 2OT5A 4CH3A 2IH3C 2X7RB 5K1PA 2I4NA 1BBUA 1GM8A 4BIZA 5EBMC 3E89A 1K3EA 1VQNV 3BJUA 2EJRA 3MF2A 2MK3A 4G27B 1SETA 3HY0A 2DZ9A 2QE7G 4PA4A 2A8EA 4LVKA 3ASOB 4U7OA 5C93A 2QEXV 1QLEB 4HZ3A 4PG3A 4TTVA 4O2DA 4WJ3M 1AR1B 4U7NA 2EIJC 3MEYA 2DJZA 2DZCA 3P8YA 4X5OA 4UV9A 4QIWF 5CBHA 3ABTA 2EJFA 1B70B 5LHHA 2QHUA 4MTXA 4HWTA 3MF1A 4CS3A 5J9PC 2ZD9A 4Q20A 4MSWC 4E2LA 3NXSA 3L2ZA 1K33A 4AH6A 3QNEA 3E9HA 2ZR2A 4XDJA 2EZPA 3B8NA 2Q7EA 2WLHA 3RVZA 3IG2A 2Q5HA 1AJQA 1I5YA 4UUJC 3T4ZA 3ZRSA 4BW5A 3L4GA 2DQ3A 2QM7A 4KUMA 1THZA 1VQ9V 1QLNA 1HC7A 5CBGA 1USYA 1QCEA 2NLJC 4CS4A 1FS0G 2XASA 2W0FC 4H2YA 2DVEA 5E3IA 4K86A 2FYKA 2P90A 5IYDO 3ABLB 3L4GB 3PJSK 2H8PC 1P4RA 1CEZA 1FXKA 4XTYA 5EBWC 3BFMA 2R9IA 1R6KA 2Q68A 1MOFA 4CH6A 1Y4MA 3OAAG 1GM9A 1OCCC 2KB1A 2QHTA 1IL2A 1SZTA 3ZRWA 2Q6AA 4XDKA 5IYCO 1VQ4V 1KMMA 2GSMB 3WG7B 2NS6A 2GHYA 4QE9A 1FXKB 1NQTA 2WLMA 3K9AA 1ASYA 4MVUA 2CJBA 2RHQB 5B1AB 3I56V 4LVMA 3SPCA 3E8GA 4DPGA 4HT4A 3ML0A 4TQFA 3ZRWB 4X88A 2RHSA 4WFBV 1ATIA 4P73C 4P3OA 2HFEC 2QA4V 5CMUA 5ELNA 4P75A 5FL7G 3HFVA 1XL4A 2HR3A 2E10A 3I7FA 1L1FA 1R3JC 1NR1A 1EOVA 4UPAA 1TUEB 1YIJV 4PA7A 2ZXFA 2R9RB 3ZMSA 2A79B 1KQSU 1YB3A 5LGUA 2EAYA 3LDEA 1BHBA 1E22A 4OP0A 2EJ9A 1VQLV 3MQZA 5KUMA 3HB3B 1GTOA 2ZXWC 3JYCA 3RBZA 5HFMA 1M56B 4P75C 3ABKC 4P3PA 3R07A 2C7IA 1G8MA 4WJ4A 3P8TA 2ZCEA 2DYRB 3V7RA 4R6ZA 3AG1B 2HVKC 3E86A 2CJ9A 2ARTA 1GO3F 3A31A 2DTIA 1K5SA 3NENA 3ZMUA 1CP9A 2I4MA 3X2QC 4XEMA 1PD3A 5LGTA 4QPJA 2XGTA 3OD1A 3V7CA 1X56A 3SYOA 3ZJZA 2F43G 1NH2B 2AKWA 1C0AA 3TCUA 4P30A 3AG3C 1VQ5V 2ODRD 3T2MA 1GM7A 2ODRC 2Y48A 1H4QA 3FYIB 2E3CA 3TEHA 4LCUC 3ABMB 3D36A 1I5XA 1NBMG 1K4DC 2EIKC 1NJ8A 4TWAA 5C53B 3JD4A 4ZIBA 1VQZA 4YRSA 2IU3A 2ARSA 2DYSB 3K0GA 5L3BA 3HXVA 3A5YA 4MW3A 3IGAC 3OMAB 5HFLA 2AMCA 4JTAB 1OCZB 4PDVA 2QHVA 5B3SB 1H38A 1OCOC 1RPRA 3VOUA 4BW9A 2JEUA 2E5AA 4I5SA 4CS2A 2I4LA 2EJGA 2HVJC 5H6QA 1N8RW 2Y69C 3JD2A 4TVYA 1JPXA 4YRQA 4YREA 1WYDA 1DLBA 3ZMTA 1FFTB 2AMCB 3IALA 4H2UA 3QO8A 1BHAA 4LVIA 1KC8W 4RUEA 4J15A 2ATKC 3F7VC 1YITV 3JCZA 1YFRA 2OTJV 3K79A 4QPKA 2EILB 3ZMZA 1VQOV 5E1AC 4G85A 4P74A 2QKSA 3VQWA 4WFAV 4K88A 2UXXA 3EFRA 2Z5UA 3OM3B 3CD6V 1LNQA 4UVBA 2XTIA 4P71A 4YRLA 4Q15A 4FPPA 2EINC 3CCEV 1HXDA 5GW7A 2XNDG 5C51B 3AG4B 2DXTA 4MVQA 4PDRA 2PMEA 2E65A 4GX0A 2JK5C 1B70A 4YRCA 4PA3A 3CCVV 2WLJA 4GCZA 4GX5A 4UXNA 1Z7MA 4P74C 1H8EG 1E24A 3ASOC 5IY5B 1YFSA 1V55C 4ZTZB 1WU7A 2DU5A 1QLEC 5KA6A 1COWG 1H4TA 4ZBMA 4P71C 4TVAA 4WFHA 1J5WA 5KUKA 4XTVA 1JCHA 3ETDA 2QHSA 2ZZEA 1RIQA 4H2WA 2CIMA 5LBQA 3T4DA 1PL0A 2W6IG 4QE7A 2ZT8A 4QNHB 2QM8A 4XTZA 1L0WA 4MVRA 4TVAB 2XAHA 2WWWA 1PYSB 4NCXA 1E1OA 2ZT5A 3FB8C 1HWYA 4YCVA 1X2GA 2G4CA 3A7AA 3HXYA 4MTGA 2IJIA 1OCRB 3G1ZA 1PNLA 4WI1A 2NNUA 4DXWA 4P72A 3STZC 3W7WA 1K4CC 1N9WA 3CCUV 4YRGA 1KD1W 1VQMV 1Q86W 3K04A 1ROPA 4RQEA 4HVCA 4YRIA 1M57B 3OMNB 3JD1A 3W7TA 2ARUA 11ASA 4EO4A 4YRNA 1F4MA 4PELA 5L3DA 3A7RA 3SYAA 3ABLC 2DWEC 2RHQA 4WF2A 2ZT6A 4HAMA 3CXCU 2PI5A 5F5WA 2HLDG 5KA5A 1USYC 4P72C 2ZDIA 2JJ1G 2XOKG 3UKMA 2ZZFA 3ZIAG 5EBLC 4G2KA 3W7XA 1KKDA 5L3FA 1QVFU 4H2XA 3CCJV 3RL6A 1R6NA 3WG7C 1Q81W 3RUXA 3V8KA 1F23A 1FXKC 1KP3A 2WLNA 4P9PA 4YPFA 3FB7C 1X2HA 3M4PA 2ZIMA 5B1AC 1PNMA 2IY5A 3GWOA 1S77D 4XU0A 3TETA 5EC2C 4X89A 12ASA 3UGQA 2DW4A 2EBOA 3CC4V 4JPRA 1UJWB 3A32A 5ELOA 1JOYA 2V7QG 3RACA 4H2XB 4RQFA 3IFXA 3LUTB 4K87A 1S76D 1NNHA 3W7SA 3KG2A 1EFWA 3RKWA 3NELA 2DTOA 3RKYA 4MVMA 1B76A 3ERRA 4YRKA 3GB7C 3OEHG 2IY5B 1AI6A 3OUFA 1E1QG 3CP1A 3M99B 4H2TA 4RDXA 1EIYB 4GT1A 3VBBA 3LSQA 5LHIA 2DXUA 1KP2A 4EKWA 4Z1MG 5LHGA 1BIAA 1KOGA 2AHZA 3V7SA 2JJ2G 3SYCA 3E8FA 1W2BU 4HYOA 4QJFB 4YP0A 4LBEC 1P7BA 1V54B 1M56C 1W66A 3OGCC 2ITDC 4WFGA 2DYRC 2ZNJA 3AG1C 2X6BA 1S3JA 1Y66A 2IJJA 2X6CA 4LP8A 1VQ8V 4RMFA 3ABUA 2Q7GA 4BIUA 1M1KW 3I55V 2K1EA 3JD0A 1NH2D 4R50A 2P0LA 2PMFA 3IC7A 3W3SA 4YRFA 2ZXWB 4MS2A 2D3OW 1QE0A 1RM1B 5EC1C 4E51A 2DWDC 3CCMV 1JJCB 2C8MA 4KQEA 3K03A 4UP9A 1S72V 3ABMC 4YROA 1E1TA 1GMGA 2IW5A 4PA9A 3X2QB 4MW8A 4DO2A 1H2GA 3CCQV 1K73W 2HJFC 1VQPV 1K5QA 4G28B 1ADJA 3TEGA 1KMNA 3FB5C 2WAMA 3E35A 2DYSC 4J9ZB 1J95A 2LFRA 3HRIA 4LVJA 1NVPB 3NETA 5B1BB 3CMQA 2XAGA 4ZTUB 4TT3G 1OCZC 1BBWA 2X0LA 1DF4A 2M7WA 4XBFA 3HPLC 3ZCCA 5B3SC 5L3CA 2ZZGA 5DM6V 4R7CA 3F5WC 3V8JA 4HWRA 5KNNA 1QR8A 4RAIA 1WPXA 2A0LA 3P30A 1GK9A 4MVSA 3HTZA 2WLLB 3RKXA 4XU3A 2OCCB 2JDIG 3LNMB 2WLIB 3AG2B 3E2EA 3SYQA 3HFZB 3PZCA 4MTFA 1YI2V 1NKDA 4YRRA 2W6JG 4RO2A 3MHSC 4H2VA 3OE7G 4P2ZA 4HWPA 4XU2A 4CH4A 4CH5A 1QBZA 1K92A 2EILC 4FIPC 1OCOB 4JGSA 2ZTGA 2ALYB 2XAFA 3FJPA 3P8VA 2DDZA 2OTLV 1AI4A 1G4YB 3K06A 1G5HA 2UXNA 3H01A 3A7UA 4N21A 3EFFK 1OZ0A 1ENVA 3B8MA 3QO5A 4WFFA 1S5HC 3CCSV 1K7DA 4L87A 3G71V 3AG4C 2BOBC 1FYFA 3P32A 4JTDB 5HGQA 3KFUA 2X6AA 4FMTA 1NJIW 1WLEA 1PKXA 2IH1C 1FXHA 3LDCA 3RW0A 1YTFB 2JEXA 2EIMB 3ASNB 2DTHA 1JJ2U 1PYSA 3HXXA 1VQ6V 4UP8A 1FXVA 2YEVA 4MVZA 3HRKA 3PCOB 1ASZA 4PHCA 1E1RG 3RF1A 5H9CA 2YSUB 3SPJA 1MG1A 1MABG 3E8BA 4KFMA 3ETGA 3IKLA 4YDQA 2B1IA 2ITCC 3TK1A 4TWKA 3OW2U 4FJCC 5LGNA 4R8CA 1QR9A 4H2SA 3STLC 1MSWD 3VQXA 2YEVB 5BZBA 1NJ5A 4YCUA 1YJ9V 3QO7A 4LC1A 1V55B 4X8AA 1YJWV 1K9MW 4H02A 5IYBO 1AJPA 2EIJB 1QVGU 3ZN0A 4TVWA 1DF5A 1VQ7V 3E83A 4KR3A 1OCRC 2P5IA 3AEIA 3UH0A 4LVLA 1B8AA 2J3LA 1JQ0A 2CGHA 3ZRVA 1JX9A 1AI5A 2E41A 1F4NA 3E8HA 1M57C 3BY6A 5CBFA 3RGLA 1YGBA 1H8HG 3DSQA 1AI7A 2AHYA 4MT8A 1K97A 4CBCA 1WQWA 2Q5IA 1YJNV 4P3NA 1NYQA 4EX5A 4OXSA 4YXWG 1X54A 4UV8A 4PDLA 2LP7A 2Q69A 5EK0A 5B1NA 1S0VA 3REUA 3FYEB 3HY1A 2ZIOA 2P6JA 3FKSG 1NYRA 2EL9A 3BEHA 3RIRA 3R65A 4RUFA 2WPDG 2ZR3A 3T1CA 4TQDA 2ZNIA 3B77A 3K3WA 3V8LA 4XEOA 5C52B 3A0RA 3LSSA 4JYCA 3A5ZA 3SPIA 4TSFG 3LDDA 3OUSA 1K34A 1YSCA 4JTCB 5L3EA 1EIYA 2ZDIC 2LFSA 3DGEA 1W0KG 1XL6A 5DN6G 1OCCB 1PNKA 2ZGWA 1CPYA 1B6QA 4G84A 4YRPA 1EBOA 1VQKV 3VQYA 4XU1A 4P73A 4UVAA 4GX1A 5L3GA 2XAQA 2IJHA 3L1AA 4XTWA 3REXA 3HXUA 2P7TC 4JAUA 3IKMB 4JASA 3JD3A 2B5UA 4JF3A 3FB6C 1F51A 1X01A 4YCWA 1M9NA 2IU0A 1BMFG 2HG5C 1EFRG 2EZOA 5CA3A 2E64A 4MTOA 4N23A 3K08A 1V54C 4ASUG 3D3IA 2Q7HA 2PI4A 1EQRA 4YRMA 1JVMA 2J3MA 1NJ6A 1JJCA 1SRYA 3OR7C 1R73A 4YRTA 1R3LC 2RHSB 3OFNG 1NJ2A 1W0JG 3CC7V 1WPYA 2P67A 3DTUB 4JYBA 3F7YC 1G51A 3ABKB 1QF6A 3CMEV 1RM1C 1Q82W 1R3IC 1M90W 1SERA 3SJQC 1Q7YW 2HKOA 1X55A 3VQVA 2DU7A 3G6EV 1ZWIC 4JAVA 1GGMA 4WCEV 2WLLA 4CZZA 4J9YB 2BOCC 3G4SV 2WLIA 2Z3YA 1Z7NA 4HWSA 1RPOA 3AG3B 1EVKA 1AROP 2ZQMA 1NVPD 1BIBA 2ZINA 4ZKIA 3HFZA 4YRJA 5B1BC 5B1OA 3UM7A 2H94A 2E1HA 3QTCA 2DQ0A 1YFTA 1NR7A 5H6RA 2EWNA 3HXZA 1K8AW 4DQ2A 3ZN1A 4BWAA 3ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALY A;  1H4S A;  4RMF A;  3E9I A;  4HA8 A;  3LC0 A;  3A74 A;  3HXW A;  2AKW B;  4KR2 A;  1SES A;  2EL9 A;  4YCU A;  4Q6G A;  1B7Y A;  4XTU A;  3UGT A;  4YYE A;  1WNL A;  2ZT7 A;  3TEH B;  3WQZ A;  3TUP A;  1EVL A;  3PCO A;  3EFS A;  4UP7 A;  1B7Y B;  2I4O A;  2DKG A;  1ADY A;  4LNS A;  3UFG A;  2DEQ A;  1WQ7 A;  5K1X A;  4HWO A;  2HNI A;  1H4V B;  4OLF A;  1NJ1 A;  1LYL A;  2CJA A;  1HTT A;  4XTX A;  1G5I A;  1L0W A;  3NEM A;  3M4Q A;  4CH3 A;  5K1P A;  2I4N A;  1BBU A;  3BJU A;  3MF2 A;  1SET A;  3HY0 A;  2DZ9 A;  4PG3 A;  4TTV A;  4O2D A;  4WJ3 M;  3MEY A;  2DJZ A;  2DZC A;  3P8Y A;  4X5O A;  2EJF A;  1B70 B;  2QHU A;  4HWT A;  3MF1 A;  4CS3 A;  4AH6 A;  3QNE A;  3E9H A;  2ZR2 A;  2Q7E A;  3IG2 A;  2Q5H A;  3L4G A;  2DQ3 A;  1HC7 A;  1USY A;  4CS4 A;  4H2Y A;  2DVE A;  5E3I A;  4K86 A;  2FYK A;  3L4G B;  4XTY A;  4CH6 A;  2QHT A;  1IL2 A;  1KMM A;  1ASY A;  2CJB A;  2RHQ B;  4DPG A;  4TQF A;  2RHS A;  1ATI A;  4P73 C;  4P3O A;  5ELN A;  4P75 A;  3HFV A;  2E10 A;  3I7F A;  1EOV A;  4UPA A;  2ZXF A;  1YB3 A;  2EAY A;  1E22 A;  4OP0 A;  2EJ9 A;  4P75 C;  4P3P A;  3R07 A;  2C7I A;  3P8T A;  2ZCE A;  3V7R A;  2CJ9 A;  2ART A;  3A31 A;  2DTI A;  3NEN A;  2I4M A;  4XEM A;  2XGT A;  3OD1 A;  3V7C A;  1X56 A;  1C0A A;  2AKW A;  2ODR D;  2ODR C;  1H4Q A;  2E3C A;  3TEH A;  1NJ8 A;  4TWA A;  5C53 B;  4ZIB A;  1VQZ A;  4YRS A;  2ARS A;  3HXV A;  3A5Y A;  2AMC A;  2QHV A;  4BW9 A;  2E5A A;  4CS2 A;  2I4L A;  2EJG A;  4YRQ A;  4TVY A;  4YRE A;  1WYD A;  2AMC B;  3IAL A;  4H2U A;  3QO8 A;  4J15 A;  1YFR A;  4P74 A;  4G85 A;  3VQW A;  4K88 A;  3EFR A;  4P71 A;  4YRL A;  2XTI A;  4Q15 A;  1HXD A;  5C51 B;  2DXT A;  2PME A;  2E65 A;  4YRC A;  1B70 A;  4P74 C;  1Z7M A;  1E24 A;  1YFS A;  4ZTZ B;  2DU5 A;  1WU7 A;  1H4T A;  4P71 C;  4TVA A;  1J5W A;  4XTV A;  2QHS A;  2ZZE A;  1RIQ A;  4H2W A;  2CIM A;  2ZT8 A;  4XTZ A;  4TVA B;  1PYS B;  4NCX A;  1E1O A;  2ZT5 A;  4YCV A;  1X2G A;  2G4C A;  3A7A A;  3HXY A;  3G1Z A;  4WI1 A;  4P72 A;  1N9W A;  4YRG A;  4RQE A;  4HVC A;  4YRI A;  11AS A;  2ARU A;  4EO4 A;  4YRN A;  3A7R A;  2RHQ A;  4WF2 A;  2ZT6 A;  5F5W A;  1USY C;  4P72 C;  2ZZF A;  4H2X A;  3RL6 A;  3RUX A;  3V8K A;  4YPF A;  3M4P A;  1X2H A;  2ZIM A;  2IY5 A;  4XU0 A;  3UGQ A;  12AS A;  3A32 A;  5ELO A;  3RAC A;  4H2X B;  4RQF A;  4K87 A;  1NNH A;  1EFW A;  3RKW A;  3NEL A;  2DTO A;  3RKY A;  1B76 A;  3ERR A;  4YRK A;  2IY5 B;  1EIY B;  4H2T A;  4RDX A;  3VBB A;  2DXU A;  3LSQ A;  1BIA A;  1KOG A;  3V7S A;  4YP0 A;  1W66 A;  2ZNJ A;  2Q7G A;  2P0L A;  2PMF A;  3W3S A;  4YRF A;  1QE0 A;  4E51 A;  1JJC B;  2C8M A;  4KQE A;  4UP9 A;  4YRO A;  1E1T A;  3L2Z A;  2ZZG A;  4WJ4 A;  1ADJ A;  3TEG A;  1KMN A;  3HRI A;  3CMQ A;  4ZTU B;  1BBW A;  3NET A;  3V8J A;  4HWR A;  5KNN A;  3HTZ A;  3RKX A;  4XU3 A;  3HFZ B;  3PZC A;  4YRR A;  4HWP A;  4H2V A;  4XU2 A;  4CH4 A;  4CH5 A;  2ZTG A;  2ALY B;  3FJP A;  3P8V A;  2DDZ A;  1G5H A;  3A7U A;  3QO5 A;  4L87 A;  1FYF A;  5HGQ A;  3KFU A;  1WLE A;  2ZGW A;  2DTH A;  3BFM A;  3HXX A;  1PYS A;  4UP8 A;  3HRK A;  3PCO B;  1ASZ A;  4PHC A;  3RF1 A;  3IKL A;  4YDQ A;  4H2S A;  3VQX A;  1NJ5 A;  3QO7 A;  4H02 A;  4TVW A;  4KR3 A;  2P5I A;  3UH0 A;  1B8A A;  2J3L A;  2CGH A;  2E41 A;  3RGL A;  1YGB A;  3DSQ A;  1WQW A;  4P3N A;  2Q5I A;  1NYQ A;  4EX5 A;  1X54 A;  3REU A;  3HY1 A;  2ZIO A;  1NYR A;  3RIR A;  2ZR3 A;  4TQD A;  2ZNI A;  5C52 B;  3V8L A;  4XEO A;  3LSS A;  3A5Z A;  1EIY A;  4G84 A;  4YRP A;  3VQY A;  4XU1 A;  4P73 A;  4XTW A;  3L1A A;  3REX A;  3HXU A;  3IKM B;  1X01 A;  4YCW A;  2E64 A;  2Q7H A;  1EQR A;  4YRM A;  2J3M A;  1NJ6 A;  1JJC A;  1SRY A;  4YRT A;  2RHS B;  1NJ2 A;  1WPY A;  1G51 A;  1QF6 A;  1X55 A;  1SER A;  3VQV A;  2DU7 A;  1GGM A;  1Z7N A;  4HWS A;  1EVK A;  3HFZ A;  1BIB A;  2ZIN A;  4YRJ A;  3QTC A;  2E1H A;  2DQ0 A;  1YFT A;  2EWN A;  3HXZ A;  4DQ2 A;  4BWA A;  3ICA A; 
#chains in the Genus database with same CATH topology
 2EIK B;  2CTW A;  4GX2 A;  3E9I A;  3TXS A;  3LC0 A;  3E22 B;  3A74 A;  2A9H A;  3MD0 A;  4H37 A;  3SPH A;  4L8J A;  1B7Y A;  4XTU A;  3UGT A;  3CCR V;  2ZT7 A;  4NYK A;  4IL6 Z;  3OR6 C;  1EVL A;  3CPW U;  3QG5 A;  3PCO A;  1X59 A;  5JQG B;  2Q67 A;  3W7U A;  1AJN A;  1ADY A;  1D5N A;  3CCL V;  1WB8 A;  5EZY B;  4DV0 B;  4JI5 O;  1IXM A;  2C2A A;  4HWO A;  4PDM A;  3CMA V;  1LYL A;  3SPG A;  3JAR B;  2XAJ A;  2EIM C;  4LF6 B;  1WA8 A;  2OT5 A;  2IH3 C;  2X7R B;  2I4N A;  3MF2 A;  2MK3 A;  2QE7 G;  2A8E A;  5LMU O;  4HZ3 A;  1TUB A;  2UXC O;  5CA0 B;  2B9Z A;  2UXB B;  1AR1 B;  3CXH F;  4U7N A;  3P8Y A;  4QIW F;  4FZ1 A;  2LGW A;  5CBH A;  4LNU B;  2QHU A;  4HWT A;  4W4L A;  4CS3 A;  5LOV B;  4UCO A;  1Y76 A;  4DR3 B;  4MSW C;  2Y4T A;  3B8N A;  2Q7E A;  3RVZ A;  1HNZ B;  2Q5H A;  4UUJ C;  4BW5 A;  4DRX A;  1J5E B;  3S3X A;  2DQ3 A;  3P3N A;  4KUM A;  1USY A;  4FVM A;  4FFK A;  1QCE A;  2E74 B;  5A9G A;  4K86 A;  4DR4 B;  2YIB D;  3N2G B;  2FKX A;  3PJS K;  2OYQ A;  2H8P C;  1CEZ A;  3L4G B;  5EBW C;  1R6K A;  4U3J B;  4FM0 A;  4DK0 A;  3OAA G;  2E5L B;  1IL2 A;  1SZT A;  2RNB A;  4XDK A;  4WBN A;  1FYJ A;  1VQ4 V;  1SS3 A;  2GSM B;  3G6B A;  4QE9 A;  1NQT A;  3K9A A;  4F6E A;  4MVU A;  4NXN B;  2CJB A;  3SPC A;  3ZRW B;  2P4K A;  2RQ6 A;  1ATI A;  4JI1 O;  4CC6 A;  4FM1 A;  2QA4 V;  1M4U A;  3JAT A;  2HR3 A;  3I7F A;  4Z2W A;  3SJA C;  4UPA A;  4PA7 A;  5GTI Z;  1VF6 C;  2ZXF A;  2R9R B;  2A79 B;  1YB3 A;  3B4S A;  1SZX A;  2LW1 A;  1BHB A;  4YJ2 A;  4PV1 B;  1EZV H;  1GTO A;  3HB3 B;  4X65 O;  5HFM A;  4P75 C;  1GN2 A;  4P3P A;  2C7I A;  3K5O A;  3QVN A;  5LA6 A;  2QKC A;  1BE3 H;  3V7R A;  4R6Z A;  3UO2 A;  3A31 A;  4FLU A;  3U10 A;  4J7J A;  3ZMU A;  2I4M A;  3X2Q C;  5LGT A;  1VIB A;  2XGT A;  3OD1 A;  1IZ3 A;  4JI4 O;  1IBM O;  2ODR D;  4X66 O;  4EB6 A;  4O4J A;  3T2M A;  4X20 B;  2ADP A;  3OD4 A;  4JI3 O;  2E76 B;  1NBM G;  1K4D C;  3SGI A;  2UUB O;  4TWA A;  2ILM A;  3JD4 A;  2DYS B;  4MW3 A;  1XMQ B;  4JTA B;  1IBK O;  1VEW A;  4I55 A;  1N36 B;  2ETN A;  1H38 A;  3OTF A;  4ZOL A;  3AK1 A;  3D36 C;  1ZLZ A;  2HVJ C;  1JPX A;  5H2F Z;  3ZMT A;  1FFT B;  3A2F A;  2ARH A;  2OTJ V;  5CA1 B;  2EIL B;  1VQO V;  2JRI A;  2ZM6 O;  2QKS A;  3B09 A;  1LNQ A;  4UVB A;  4JI6 B;  4YRL A;  4PI0 A;  2EIN C;  5BR8 O;  2YID A;  3AG4 B;  4GX0 A;  4DV7 B;  3L73 H;  1B70 A;  1G1X B;  4P74 C;  4GCZ A;  4GX5 A;  1NU1 H;  1YFS A;  1N33 O;  3KKY A;  1FAF A;  1QLE C;  4P71 C;  4WFH A;  1JCH A;  2D2C B;  4I4T A;  4I9Q A;  4JI7 O;  1Q6H A;  1WJZ A;  2CH7 B;  1PL0 A;  1MZE A;  3A0B Z;  4QE7 A;  2ZT8 A;  5LMN O;  4NCX A;  1E1O A;  4YCV A;  3A7A A;  1H2K A;  5EYP B;  4WI1 A;  3LSU A;  1PL4 A;  3UCS C;  4YRG A;  4AI8 A;  3OMN B;  11AS A;  4YRN A;  5L3D A;  1JFF A;  2DWE C;  3R66 A;  4I50 A;  3CXC U;  2HLD G;  4LWS A;  5KA5 A;  1USY C;  1IDS A;  2QWO B;  4AIL C;  5FLX N;  2Y0I A;  3FD9 A;  3ZIA G;  1PP9 H;  3RL6 A;  1R6N A;  3RUX A;  1Q81 W;  3V8K A;  1Q43 A;  4O2A A;  3FB7 C;  1X2H A;  3M4P A;  3CRA A;  1PNM A;  2IY5 A;  3GWO A;  1S77 D;  12AS A;  2EBO A;  2Z0A A;  4JPR A;  1UJW B;  5GON B;  5ELO A;  1JOY A;  4H2X B;  3ZED A;  3IFX A;  3LUT B;  3CX5 F;  3S3W A;  2JGU A;  4OPH A;  3W7S A;  2AGA A;  5DED A;  4DR7 B;  5J2T A;  1RP3 B;  4OX9 O;  3RYC A;  1EIY B;  2UXD B;  3VBB A;  3LSQ A;  5JJN B;  4YJ3 A;  4KL1 A;  2JJ2 G;  3SYC A;  3E8F A;  4YP0 A;  1LUV A;  1DK1 A;  4IT5 A;  1W66 A;  3OGC C;  4WFG A;  2DYR C;  1Y66 A;  5IYZ B;  2CGN A;  2K1E A;  4R50 A;  2P0L A;  2PMF A;  4JI8 O;  1QE0 A;  5BY1 A;  2OIE A;  4KQE A;  4UP9 A;  3ABM C;  4JZ2 A;  1GMG A;  2IW5 A;  3X2Q B;  1XHX A;  4MW8 A;  5J2U A;  1H2G A;  3H1K H;  3HKB B;  3APQ A;  3CCQ V;  4LF4 O;  4GLX A;  4WJ4 A;  1KMN A;  4LVJ A;  1SF9 A;  2LFR A;  3HRI A;  2KSD A;  5B1B B;  1BBW A;  2M7W A;  5JJE B;  3DC6 A;  1WPX A;  1QU7 A;  3LNM B;  1Y74 B;  3HFZ B;  2DN9 A;  4BR6 A;  5KHI A;  4TUY B;  1CXZ B;  1I08 A;  2ZTG A;  3FJP A;  2OTL V;  2JS3 A;  4DR1 O;  1G4Y B;  2UXN A;  3H01 A;  2QWP B;  4KXR A;  1ZTE A;  4CC5 A;  5D5Q A;  1YCI A;  2KQX A;  4K8Z A;  2X6A A;  4FMT A;  4B3S O;  1Q90 D;  1WLE A;  3LDC A;  2DTH A;  2ZGW A;  4YIO A;  1I94 O;  3HRK A;  3PCO B;  2ITC C;  1NTK H;  1SA0 A;  2PF4 E;  4DV6 B;  1VAR A;  3QO7 A;  4H02 A;  1WA8 B;  4IGG A;  3QF7 A;  1QVG U;  1VQ7 V;  3E83 A;  2OCH A;  2YXY A;  3UH0 A;  4FFB B;  4LVL A;  1B8A A;  1JQ0 A;  3CWB H;  4DV5 B;  1JX9 A;  1KMI Z;  2E41 A;  1F4N A;  1M57 C;  4O4I A;  2PGG A;  4MT8 A;  1WQW A;  2GTS A;  4P3N A;  3H1H H;  4EX5 A;  4EFE A;  3GWK C;  2F4V O;  2Q69 A;  3FYE B;  1Y76 B;  2ZIO A;  3FKS G;  1NYR A;  3RIR A;  4DR2 O;  1JA8 A;  5D5P A;  5ITZ A;  1P49 A;  3V8L A;  2YXH A;  4DRX B;  3OUS A;  4JTC B;  5L3E A;  3Q4H A;  4BIO A;  1W0K G;  4AQY O;  1OCC B;  2E75 B;  4DR5 O;  1VQK V;  2YDE A;  3VQY A;  3REX A;  3HXU A;  3JAK B;  4JAU A;  2IM9 A;  4JAS A;  3JD3 A;  5KHG A;  1Q6U A;  1M9N A;  2IU0 A;  1N34 O;  2E64 A;  4WBN B;  4MTO A;  3SR2 C;  1V9P A;  1JR9 A;  4LFA O;  4JI0 B;  1JJC A;  3HR0 A;  1NJ2 A;  2P67 A;  4YY3 B;  4JYB A;  3CE2 A;  3DTU B;  4DV2 B;  3JAT B;  3ABK B;  4J41 A;  1R6T A;  5KHK A;  2YIA A;  1WN7 A;  5LP6 A;  1M90 W;  1SER A;  3SJQ C;  2AZ2 A;  3VQV A;  1Q7Y W;  3L72 H;  3G6E V;  1GGM A;  4I0X B;  2BOC C;  2Z3Y A;  4HWS A;  1RPO A;  3AG3 B;  3RT3 C;  1R1B A;  5LA6 B;  4OPA A;  1NR7 A;  1XNR B;  1K8A W;  3ZN1 A;  2Y4U A;  2FTK A;  1ORQ C;  4HA8 A;  1L8D A;  2KG7 B;  2OCC C;  1SES A;  4WF9 V;  2EL9 A;  1OHH G;  1BT8 A;  4UVC A;  5E79 Z;  2WLK A;  4O4J B;  4EB6 B;  3ETE A;  2PZS A;  3WQZ A;  5FPO A;  4PD4 F;  2LW7 A;  3TUP A;  3KCY A;  5CN0 A;  5IDJ A;  1AR4 A;  2HHH B;  3T1H O;  3OTO B;  4UP7 A;  4F4L A;  3CJH A;  3D8C A;  2Y0P A;  1WQ7 A;  3ZMV A;  4LH6 A;  4QGP A;  1NZ6 A;  5GTH Z;  2VQF O;  4OLF A;  5IY5 C;  3G80 A;  2CJA A;  2V1D A;  4KP4 A;  3BVO A;  3M4Q A;  1Z5W A;  3ZHS A;  4LFB O;  1GM8 A;  4GKK B;  1BBU A;  4JI2 O;  3E89 A;  3BJU A;  2EJR A;  1RFY A;  4LVK A;  3MAQ A;  2ZE5 A;  4GKJ O;  2BSK A;  4IIJ B;  1N0N A;  4TTV A;  3FX7 A;  4O2D A;  1SQF A;  4DUY O;  1FFX A;  2EIJ C;  2G38 A;  3MEY A;  2DJZ A;  3ABT A;  1B70 B;  1SQX H;  5LHH A;  1OV9 A;  3QNE A;  1Q6I A;  4EFB A;  4XDJ A;  3T4Z A;  4I4T B;  3ZRS A;  1THZ A;  1VQ9 V;  1HC7 A;  2NLJ C;  4CS4 A;  4H2Y A;  5E3I A;  2FYK A;  3ABL B;  1ZL8 A;  4UCV A;  1P4R A;  2JGD A;  4XTY A;  5TIS Z;  3RN4 A;  1MOF A;  4K8X A;  1HR0 B;  2QHT A;  3TGU H;  3CRR A;  5IYC O;  1KMM A;  4NVP A;  2NN4 A;  1FXK B;  1ASY A;  2WLM A;  3N27 A;  5B1A B;  3I56 V;  4LVM A;  3ML0 A;  3PN1 A;  1PPJ H;  2JVD A;  4X88 A;  3THO A;  5ELN A;  4NR1 A;  4P75 A;  5FL7 G;  4O2A B;  1EOV A;  1N0J A;  1IXB A;  1YIJ V;  1AP5 A;  3ZMS A;  4LF7 B;  2EAY A;  3LDE A;  1E22 A;  4X64 B;  2EJ9 A;  3JYC A;  2ZXW C;  3RBZ A;  5J2T B;  3P8T A;  4O4H A;  3E86 A;  3RYC B;  1K5S A;  3NEN A;  4XEM A;  3V7C A;  5B66 Z;  3ZJZ A;  2F43 G;  1NH2 B;  2AKW A;  3UT5 B;  4P30 A;  1VQ5 V;  5KX5 B;  5LP6 C;  1GM7 A;  1AVM A;  3WB0 A;  1YZB A;  3D36 A;  2XT9 A;  1Z5V A;  2GTA A;  1HNW B;  4ZIB A;  4YRS A;  3K0G A;  4X1I B;  1EN6 A;  3OMA B;  5HFL A;  2AMC A;  1OCZ B;  5B3S B;  3HKE A;  3VOU A;  4DV4 O;  5BMV A;  4CS2 A;  5J2U B;  2I4L A;  1N8R W;  1WNS A;  2Y69 C;  1WYD A;  4LVI A;  3JAL A;  3ZHV A;  1KC8 W;  1HNX O;  2UUA B;  1YIT V;  1YFR A;  4LF9 B;  4P74 A;  5E1A C;  3JAS A;  3EFR A;  2Z5U A;  3OM3 B;  4P71 A;  4FPP A;  1SQP H;  3BPZ A;  1X4T A;  4J10 A;  2PME A;  5FPR A;  2E65 A;  2JK5 C;  2WLJ A;  4UXN A;  4B08 A;  3ASO C;  5IY5 B;  1V55 C;  2DU5 A;  2AZ0 A;  1H4T A;  1COW G;  2R9A A;  4TVA A;  1J5W A;  4XTV A;  3ETD A;  2QHS A;  1AR5 A;  4IHJ A;  4LR3 A;  1RIQ A;  4H2W A;  5JCO C;  5LBQ A;  4UFZ A;  4QNH B;  2HP8 A;  2K9P A;  4MVR A;  3HKC B;  3C90 A;  1X2G A;  3HXY A;  3CB2 A;  3HKD A;  2A3Q A;  2RDC A;  4MTG A;  4TV9 A;  2Q4P A;  4DXW A;  3STZ C;  1SA0 B;  1ZAU A;  1ROP A;  4O2B B;  4RQE A;  3JD1 A;  1OJH A;  4LF5 O;  1XDC A;  2RCV A;  3SYA A;  4YHH B;  4TOI A;  4WF2 A;  4J7Z A;  5F5W A;  2XOK G;  4O4L A;  5F2V O;  3J7A U;  1P7G A;  3H9V A;  5L3F A;  1TGO A;  3WG7 C;  1KP3 A;  2ZKO A;  4HNA B;  2ZIM A;  1MZF A;  4XU0 A;  3TET A;  3UGQ A;  4X89 A;  3L75 H;  2V7Q G;  4K87 A;  1S76 D;  1NNH A;  3ZHU A;  1SQB H;  3RKY A;  2GDS A;  1KUQ A;  4GT1 A;  4JI5 B;  3Q4H B;  1GH6 A;  4TV8 A;  3N2K A;  1BIA A;  1KOG A;  1Y67 A;  1W2B U;  1V54 B;  3OT7 A;  1M56 C;  2ITD C;  3AG1 C;  2IJJ A;  1VQ8 V;  2X6C A;  4LP8 A;  1O9G A;  4BIU A;  3I55 V;  3JD0 A;  3BA9 A;  1QNM A;  1NH2 D;  2N05 A;  5LMU B;  3IC7 A;  3W3S A;  2UXC B;  1N32 O;  2ZXW B;  2D3O W;  2JS5 A;  2DWD C;  1JJC B;  2C8M A;  4X1K A;  4JZG A;  5KMG B;  1E1T A;  2ZZG A;  1ADJ A;  1XRE A;  3TEG A;  2WAM A;  3E35 A;  4D7T A;  2XAG A;  3HPL C;  3ZCC A;  5L3C A;  1YF2 A;  4OGQ B;  5EIB D;  3F5W C;  3V8J A;  2O57 A;  3RGB A;  5KNN A;  1GK9 A;  1H2M A;  3RKX A;  4XU3 A;  2JDI G;  1KB9 F;  3PZC A;  4ZI7 A;  4MTF A;  1YI2 V;  3AG7 A;  2W6J G;  4RO2 A;  4CH4 A;  3OE7 G;  4P2Z A;  4CH5 A;  1K92 A;  5KLV H;  4FIP C;  3P8V A;  5JVD A;  3ZS8 C;  1G5H A;  3A7U A;  1YVW A;  4N21 A;  4X62 O;  3EFF K;  1ENV A;  3QO5 A;  1S5H C;  3CCS V;  1HW7 A;  1VF7 A;  4DUZ O;  4LF8 O;  2BOB C;  1FYF A;  3KFU A;  1FXH A;  4F6R A;  2EIM B;  1A32 A;  1PYS A;  4JI1 B;  2YEV A;  1XNQ O;  1E1R G;  5H9C A;  1TVK B;  2CE4 A;  3SPJ A;  1MG1 A;  3ETG A;  3IKL A;  3TK1 A;  1URF A;  4R8C A;  1QR9 A;  3STL C;  1MSW D;  1IX9 A;  4LC1 A;  1V55 B;  1K9M W;  2UU9 O;  1YDX A;  2YIC A;  5KAF Z;  4X65 B;  1DF5 A;  4KR3 A;  1OCR C;  2P5I A;  1MMM A;  1I0H A;  3ZRV A;  3E8H A;  3RGL A;  2VQE O;  1YGB A;  2BSK B;  3L70 H;  1NYQ A;  4JI4 B;  1FFX B;  1IBM B;  2YIB A;  4OXS A;  3FAV A;  4YXW G;  1L0L H;  4X66 B;  4UV8 A;  5B1N A;  1S0V A;  1D2D A;  3LNN A;  3REU A;  4B7K A;  4JI3 B;  4AHC A;  2HEP A;  4UB8 Z;  1BQ0 A;  3P3P A;  2UUB B;  2WPD G;  2ZR3 A;  1MA1 A;  1N4C A;  4ZHQ A;  2ZNI A;  4XEO A;  3A5Z A;  3K59 A;  4TSF G;  1KBH A;  1IBK B;  1K34 A;  4FLX A;  1WPB A;  3DGE A;  1XL6 A;  1RSO A;  2CUG A;  4LFC O;  1CPY A;  1B6Q A;  4B3R O;  3K58 A;  2ODM A;  2P4V A;  5L3G A;  1SQQ H;  2XAQ A;  2IJH A;  2JGD B;  2B5U A;  2F66 C;  3FB6 C;  2BCC H;  1F51 A;  5FNV A;  3DC5 A;  2A7W A;  4YCW A;  2EZO A;  2XTA A;  5A2Q N;  3DXR B;  3D3I A;  2Q7H A;  2PI4 A;  4KHP O;  4YRM A;  5BR8 B;  2J3M A;  1NJ6 A;  1SRY A;  1HP8 A;  1R73 A;  1XI1 A;  4JYA O;  1W0J G;  4RWU A;  3F7Y C;  1N33 B;  5LYJ A;  3O9O A;  3CME V;  1RM1 C;  5C8Y A;  1Q82 W;  4NXM O;  1X55 A;  2HKO A;  2P06 A;  2YXL A;  4JI7 B;  2DU7 A;  4IYH A;  1GAX A;  4JAV A;  2ZT9 B;  2WLL A;  4K3A A;  3G4S V;  1Z7N A;  1GN4 A;  3E22 A;  5KHJ A;  1ARO P;  2ZQM A;  5LMN B;  1XMO B;  1BIB A;  5B1O A;  3UM7 A;  2H94 A;  4O4H B;  1US6 A;  2E1H A;  2DQ0 A;  4DV1 O;  3HXZ A;  1Y6X A;  1YHQ V;  1YXB A;  2CK3 G;  3HXW A;  2AKW B;  1E79 G;  1EZJ A;  4MVO A;  3AG2 C;  4Q6G A;  5JWP A;  5JQG A;  2EJ7 A;  3SYP A;  4YYE A;  5EZY A;  3MHH C;  4Z1V A;  4DW1 A;  3H1J H;  4PA6 A;  4YIP A;  1B7Y B;  2I4O A;  2DKG A;  4FK5 C;  1KEC A;  2Q0A A;  1UPG A;  4WFE A;  2IJK A;  2DEQ A;  3IAY A;  3ZHR A;  1H4V B;  1JMK C;  2QTS A;  4K35 A;  1HTT A;  4P9O A;  5IWA O;  1G5I A;  4K0K O;  3ASN C;  1DTO A;  4BAY A;  1T5E A;  2EIN B;  2WSS G;  3JAL B;  5K1P A;  1AIL A;  4BIZ A;  4OX9 B;  4J80 A;  1XBL A;  1VQN V;  3RYH A;  1SET A;  1NT2 B;  4E4E A;  3JAS B;  4U7O A;  5C93 A;  2QEX V;  1QLE B;  4PG3 A;  2ZE8 A;  4X5O A;  4UV9 A;  2EJF A;  4MTX A;  3U11 A;  3JSN A;  3MF1 A;  5J9P C;  1TUB B;  3D3Q A;  3TXQ A;  4FLV A;  4E2L A;  1K33 A;  3E9H A;  2NR5 A;  4UCU A;  4ABM A;  2YI9 A;  2EZP A;  4JI8 B;  1I5Y A;  3N2G A;  4IHJ B;  3L4G A;  4FLW A;  2WA4 A;  1QLN A;  1FJG O;  2W0F C;  2DVE A;  4LF4 B;  1BCC H;  4PJ0 Z;  5IYD O;  1FPO A;  2QGN A;  1WP7 A;  4I7Z B;  4TV9 B;  1UFI A;  2R9I A;  2Q68 A;  3UO3 A;  3I5D A;  2KB1 A;  3ZRW A;  2Q6A A;  4DR6 O;  3ZBH A;  4FLZ A;  1NTM H;  3CRC A;  3E8G A;  4HT4 A;  4B3M O;  2RHS A;  4WFB V;  1XOU A;  4P3O A;  2HFE C;  4GYC B;  4DR1 B;  3HFV A;  1XL4 A;  2F23 A;  1R3J C;  4NKG B;  1TUE B;  4UCS A;  1KQS U;  5LGU A;  3GVM A;  3BFR A;  4B3S B;  3MQZ A;  5KUM A;  1I94 B;  1U97 A;  3OGI B;  2ZCE A;  2DYR B;  3T1Y O;  2HVK C;  2DTI A;  4X20 A;  1CP9 A;  4TV8 B;  3BA8 A;  4QPJ A;  4YJ2 B;  2F95 B;  1X56 A;  2Q8V A;  1C0A A;  3EXA A;  2ODR C;  5IJ9 A;  3U0Z A;  2P5O A;  3FYI B;  4DV3 O;  3TEH A;  3ABM B;  1Q8I A;  2EIK C;  3ICX A;  1NJ8 A;  2IU3 A;  1D5A A;  1DGS A;  2N04 A;  4PDV A;  2QHV A;  2WA3 A;  5JJJ B;  4U3F H;  1XIL A;  1OCO C;  4X1K B;  4H0L B;  5CA1 A;  2A06 H;  2EJG A;  4YRQ A;  4TVY A;  4YRE A;  3JD2 A;  2P22 C;  3UQ8 A;  4H2U A;  4I55 B;  4DR2 B;  3APO A;  2LQT A;  4J15 A;  4ZOL B;  2PUS A;  3K79 A;  3ZMZ A;  4JV5 O;  3VQW A;  4AQY B;  4WFA V;  2UXX A;  4DR5 B;  2XND G;  2M6Y A;  4ZI7 B;  4EEQ A;  2DXT A;  5JCO A;  1BSM A;  4YRC A;  1Z7M A;  5H5N A;  2YS8 A;  5JVD B;  1WU7 A;  1N34 B;  1LUW A;  4UCT A;  4LFA B;  3O65 A;  4B3T O;  4F6R B;  1PYS B;  1TA8 A;  2FL4 A;  1HWY A;  2G4C A;  4J11 A;  4J7K A;  2PTM A;  5KHH A;  2IJI A;  2R70 A;  3G1Z A;  3JSL A;  3W7W A;  1K4C C;  1N9W A;  3CCU V;  1VQM V;  3AK2 A;  4HVC A;  1M57 B;  3W7T A;  3A7R A;  5AG2 A;  2RHQ A;  2L6L A;  2PI5 A;  2CAZ C;  4P72 C;  1NI8 A;  3UKM A;  1KKD A;  5EBL C;  4G2K A;  3W7X A;  5GON A;  2F1M A;  4DW0 A;  4H2X A;  1JFF B;  4JYY A;  3CCJ V;  4DV0 O;  2WLN A;  3AK3 A;  1SQG A;  4I50 B;  4P9P A;  5B5E Z;  2R72 A;  3A8T A;  4LWS B;  3FAV B;  2DW4 A;  4X1Y A;  3CC4 V;  3A32 A;  3RAC A;  4LF6 O;  4RQF A;  1EFW A;  3B2E E;  2DTO A;  2GUZ A;  3T1H B;  1Q3E A;  4ZHQ B;  3ERR A;  2ADQ B;  4YRK A;  2UUC B;  1ZX3 A;  3OEH G;  2IY5 B;  3OUF A;  3CRM A;  4RDX A;  5LHG A;  3J81 N;  5IYZ A;  2VQF B;  5BXZ A;  2UXB O;  4QJF B;  4LBE C;  1P7B A;  1KKC A;  4FZ0 A;  4LFB B;  1S3J A;  3WB2 A;  4DR3 O;  4JI2 B;  2Q73 A;  4YJ3 B;  2Q7G A;  2CDY A;  3HKB A;  1HNZ O;  4GKJ B;  2W0X A;  1J5E O;  4YRF A;  4MS2 A;  4DUY B;  5EC1 C;  1U96 A;  3CCM V;  4B7E A;  4YRO A;  4PA9 A;  4DR4 O;  1K73 W;  3FB5 C;  4J9Z B;  2DYS C;  1JJO A;  5LYJ B;  3CMQ A;  1Y74 A;  4ZTU B;  4TT3 G;  3NET A;  5C8Y B;  1DF4 A;  1VF5 B;  4XBF A;  1VMG A;  5DM6 V;  3K5M A;  4R7C A;  2E5L O;  3EVK A;  4RAI A;  2A0L A;  4TUY A;  3P30 A;  4MVS A;  1SKV A;  2WLL B;  2OCC B;  3SJB C;  4X9Q A;  4NXN O;  3E2E A;  3SYQ A;  2OIG A;  1NKD A;  4HWP A;  3RFR A;  4PHZ A;  2EIL C;  1OCO B;  4JGS A;  2RJZ A;  5IE9 A;  3K06 A;  1OZ0 A;  3B8M A;  5IJ0 A;  4WFF A;  1IBL B;  3CRQ A;  2RN9 A;  5JH7 A;  3IC9 A;  3AG4 C;  3G71 V;  3FFQ A;  4A5U B;  5HGQ A;  3BFM A;  1YTF B;  2JEX A;  3HXX A;  2HJD A;  1FXV A;  4MVZ A;  5IT9 N;  4PHC A;  3RF1 A;  2YSU B;  4KFM A;  4YDQ A;  4FJC C;  5LGN A;  4FFB A;  3VQX A;  1NJ5 A;  1YJW V;  4GZR B;  2Q9L A;  1AJP A;  1L0N H;  2EIJ B;  1BQZ A;  3ZN0 A;  3AEI A;  1M93 A;  3RYH B;  4NTY A;  1AI5 A;  3K9S A;  1XMQ O;  1AI7 A;  2AHY A;  2Q5I A;  1BGY H;  1YJN V;  1N36 O;  3JAM N;  2VRZ A;  2H3O A;  5KAI Z;  4O4I B;  3HY1 A;  3BEH A;  1I7F A;  1MSD A;  3B77 A;  1VP7 A;  3K3W A;  3A0R A;  3LSS A;  4JYC A;  4LH7 A;  3JAK A;  3SPI A;  3LDD A;  2LFS A;  5DN6 G;  1PNK A;  4JI6 O;  4G84 A;  4YRP A;  1EBO A;  4DV4 B;  3JCU Z;  4P73 A;  4UVA A;  4GX1 A;  4DK1 A;  5ITZ B;  4XTW A;  3L1A A;  4DV7 O;  2DOS A;  1IVS A;  1HNX B;  2QM4 A;  1X01 A;  2QWQ B;  2V4D A;  1BMF G;  1EFR G;  5CA3 A;  3K08 A;  2PY5 A;  2QWR B;  1JVM A;  1XUQ A;  3OR7 C;  1R3L C;  3BCC H;  2RHS B;  2XUM A;  3CC7 V;  1WPY A;  1G51 A;  4I0X A;  1LR1 A;  2AXT Z;  1WAZ A;  1ZWI C;  3H1I H;  4CZZ A;  2WLI A;  3G67 A;  1EVK A;  2KG7 A;  2ZIN A;  5LP6 B;  5B1B C;  1QHT A;  1YFT A;  5H6R A;  2EWN A;  1KYO F;  4BWA A;  3ICA A;  2ALY A;  1H4S A;  4RMF A;  3EHB B;  3WFV A;  1WB7 A;  1IUR A;  2DJV A;  3BAA A;  4KR2 A;  4YCU A;  4LF5 B;  1P84 F;  2B1G A;  3OEE G;  2EUL A;  3CC2 V;  2QTO A;  5IJ9 B;  1FKA O;  4D6T H;  1WNL A;  2Q0O C;  3CYO A;  3TEH B;  3H1L H;  1QQC A;  5LXT A;  3OMI B;  1GKF A;  3L9D A;  2Y69 B;  4DR7 O;  1GN6 A;  3EFS A;  2JIZ G;  1PV0 A;  1R3K C;  4LNS A;  3UFG A;  2GBO A;  5K1X A;  2UXD O;  2HNI A;  1BL8 A;  3L71 H;  4XDL A;  1NJ1 A;  3CEI A;  3RVY A;  4I9W A;  3ZRX A;  1YTF D;  4H33 A;  4XTX A;  1L0W A;  3NEM A;  3K0D A;  3CJH B;  4IIJ A;  4CH3 A;  3JAW A;  5EBM C;  3KCX A;  1K3E A;  4G27 B;  3HY0 A;  2DZ9 A;  4PA4 A;  3ASO B;  2IBZ H;  3RWR D;  4WJ3 M;  1YEW A;  3C3T A;  2DZC A;  2ZD9 A;  4Q20 A;  3NXS A;  3L2Z A;  4AH6 A;  2ZR2 A;  2WLH A;  3IG2 A;  1XMO O;  2QSA A;  1AJQ A;  1N32 B;  2QM7 A;  2BTQ A;  5CBG A;  1FS0 G;  2XAS A;  4JAA A;  2P90 A;  1FXK A;  4GUN A;  4CH6 A;  1Y4M A;  1MNG A;  1GM9 A;  1OCC C;  1Z2G A;  1ZL8 B;  3WG7 B;  2NS6 A;  2GHY A;  2QR4 A;  2RHQ B;  4DPG A;  2FYU H;  4TQF A;  2ZM6 B;  4P73 C;  1W59 A;  3RYF A;  5CMU A;  3ZHQ A;  2E10 A;  4X62 B;  1H2L A;  2DMX A;  1L1F A;  5CB4 A;  1NR1 A;  4DUZ B;  3RYI A;  4LF8 B;  3L74 H;  4DV6 O;  2Q5Z A;  4X1Y B;  2YUA A;  4OP0 A;  1VQL V;  1S5J A;  1EN5 A;  1ZSP A;  1M56 B;  3ABK C;  3UT5 A;  3R07 A;  1G8M A;  2GUZ B;  2VS0 A;  1XNQ B;  1O9H A;  3AG1 B;  5KX5 A;  2CJ9 A;  2ART A;  1GO3 F;  4DV5 O;  1PD3 A;  3SYO A;  3TCU A;  3AG3 C;  2AW9 A;  4X1I A;  2UU9 B;  1GN3 A;  2Y48 A;  1H4Q A;  2CTR A;  2E3C A;  4LCU C;  1I5X A;  3A0H Z;  5C53 B;  1VQZ A;  2ARS A;  3BHP A;  3HXV A;  5L3B A;  3A5Y A;  2VQE B;  3IGA C;  2DE0 X;  2QKA A;  3J80 N;  2LJ2 A;  1S5L Z;  1RPR A;  4BW9 A;  2JEU A;  1TAE A;  2N74 A;  2E5A A;  3CS5 A;  3JAR A;  4I5S A;  5H6Q A;  1DLB A;  1BZK A;  2AMC B;  3IAL A;  1BS3 A;  3QO8 A;  1BHA A;  4H13 B;  4RUE A;  2ATK C;  3F7V C;  3JCZ A;  3HKE B;  4QPK A;  5BMV B;  4G85 A;  4K88 A;  4LFC B;  3CD6 V;  5CA0 A;  4B3R B;  2XTI A;  1F7Y A;  4Q15 A;  3CCE V;  1HXD A;  5GW7 A;  4JI0 O;  5C51 B;  1WP8 A;  4MVQ A;  4PDR A;  4H44 B;  3TJT A;  2EX3 A;  4LNU A;  2VWJ A;  4PA3 A;  3CCV V;  5LOV A;  4YY3 O;  1H8E G;  1E24 A;  4DV2 O;  4ZTZ B;  5KA6 A;  4ZBM A;  3HKC A;  3K5N A;  1G6U A;  5IJ0 B;  5KUK A;  2ZZE A;  4UB6 Z;  5JH7 B;  4KHP B;  1XEQ A;  2CIM A;  3T4D A;  2W6I G;  3SJC C;  2QM8 A;  4XTZ A;  1KU9 A;  1AB3 A;  4O2B A;  4TVA B;  2XAH A;  2WWW A;  4JYA B;  2ZT5 A;  1EN4 A;  3FB8 C;  1XNR O;  1M5I A;  1OCR B;  1PNL A;  2NNU A;  4NXM B;  4P72 A;  4U3J A;  2BTO A;  3ETQ A;  1Q86 W;  1KD1 W;  3K04 A;  2KKW A;  4YRI A;  2ARU A;  4W4K A;  4EO4 A;  1F4M A;  3HKD B;  4PEL A;  4FLT A;  3ABL C;  2FB5 A;  3B40 A;  2ZT6 A;  4HAM A;  4HNA A;  2ZDI A;  2JJ1 G;  4DV1 B;  2ZZF A;  2HHH O;  3OTO O;  4NB5 A;  1QVF U;  4J42 A;  1F23 A;  1FXK C;  4YPF A;  5B1A C;  4O4L B;  2PYJ A;  5EC2 C;  2XHB A;  3K5L A;  3KG2 A;  4FLY A;  3RKW A;  1Q5O A;  3NEL A;  4GKK O;  1B06 A;  4MVM A;  1B76 A;  1B3Q A;  3GB7 C;  1NS1 A;  1AI6 A;  4HBN A;  1E1Q G;  3CP1 A;  3M99 B;  4H2T A;  2ZE7 A;  2DXU A;  5LHI A;  1KP2 A;  4EKW A;  4Z1M G;  2L35 A;  2AHZ A;  3V7S A;  5IWA B;  4HYO A;  4K0K B;  3WB1 A;  2OWO A;  2ZNJ A;  2X6B A;  2YI8 A;  3N2K B;  3NR7 A;  3IJ4 A;  2GV9 A;  3ABU A;  1M1K W;  5KMG A;  3BRC A;  3WU2 Z;  1GRJ A;  1RM1 B;  1XHZ A;  3K57 A;  4E51 A;  3K03 A;  1S72 V;  4DO2 A;  2HJF C;  1VQP V;  1K5Q A;  4G28 B;  1J95 A;  1B04 A;  1NVP B;  2BE3 A;  1OCZ C;  2X0L A;  2F4V B;  5B3S C;  1HR0 O;  4HWR A;  5EIB C;  1QR8 A;  1FJG B;  3HTZ A;  2MW2 B;  2WLI B;  3AG2 B;  3C3S A;  3BAB A;  4YRR A;  4H2V A;  3MHS C;  4XU2 A;  1QBZ A;  3ZHT A;  4NTW A;  2CGO A;  2XAF A;  2ALY B;  2DDZ A;  1AI4 A;  3KZI Z;  4DR6 B;  1H2S B;  1K7D A;  4L87 A;  2UUC O;  4LF7 O;  1TVK A;  2CH7 A;  2CTQ A;  3P32 A;  4JTD B;  4X64 O;  1NJI W;  1PKX A;  2IH1 C;  3RW0 A;  5LXT B;  1NTZ H;  4B3M B;  3ASN B;  1JJ2 U;  1VQ6 V;  4UP8 A;  5LL6 Y;  1ASZ A;  4FM2 A;  1MAB G;  3E8B A;  5EYP A;  2B1I A;  4TWK A;  2ZE6 A;  4UCR A;  3OW2 U;  4H2S A;  2YEV B;  5BZB A;  1YJ9 V;  4X8A A;  5IYB O;  3CSX A;  4TVW A;  3JAW B;  2QWN B;  3T1Y B;  2J3L A;  1HDJ A;  2CGH A;  1HNW O;  3BY6 A;  3F5T A;  1PM9 A;  5CBF A;  1H8H G;  3DSQ A;  4CBC A;  1K97 A;  4D7S A;  4ICG A;  3ZX6 A;  1H2N A;  5DEC A;  1X54 A;  4PDL A;  2LP7 A;  3M7M X;  5EK0 A;  2QDO A;  4DV3 B;  2P6J A;  3R65 A;  4NTX A;  4RUF A;  3T1C A;  4TQD A;  2UUA O;  5C52 B;  4LF9 O;  1YSC A;  1FD9 A;  1EIY A;  2BTQ B;  2ZDI C;  2RMK B;  4PI2 A;  3MDS A;  2LGQ A;  1SC5 B;  4XU1 A;  3DXR A;  2P7T C;  1IBL O;  2QJ1 A;  3IKM B;  2FML A;  4JF3 A;  1RSO B;  2CTP A;  4DYL A;  2YC0 A;  1VF6 A;  2HG5 C;  1AP6 A;  4IYI A;  4JV5 B;  2F93 B;  4N23 A;  1V54 C;  4ASU G;  1EQR A;  5FNV B;  2PYL A;  3CHX A;  4YRT A;  3OFN G;  2LO1 A;  3RYF B;  1ZUQ A;  1SQV H;  1XQ8 A;  1QF6 A;  5CB4 B;  1EM1 A;  1R3I C;  3SDL A;  3RYI B;  4C7U A;  4WCE V;  4B3T B;  4J9Y B;  4YHH O;  1NVP D;  3HFZ A;  4YRJ A;  4ZKI A;  3QTC A;  3M8A A;  4DQ2 A;  2VWK A; 
#chains in the Genus database with same CATH homology
 2EIK B;  2ALY A;  1YHQ V;  1H4S A;  2FTK A;  4GX2 A;  3E9I A;  1ORQ C;  3EHB B;  3WFV A;  2CK3 G;  3LC0 A;  4HA8 A;  3A74 A;  3HXW A;  2AKW B;  2A9H A;  2OCC C;  4KR2 A;  1SES A;  3MD0 A;  4H37 A;  3SPH A;  4WF9 V;  1E79 G;  1EZJ A;  1OHH G;  2B1G A;  3AG2 C;  4MVO A;  4UVC A;  1B7Y A;  3OEE G;  4Q6G A;  3SYP A;  4XTU A;  2WLK A;  3CC2 V;  3ETE A;  3UGT A;  4YYE A;  2QTO A;  3CCR V;  3CYO A;  3MHH C;  1WNL A;  2ZT7 A;  3TEH B;  3WQZ A;  3OR6 C;  3OMI B;  3TUP A;  1EVL A;  1GKF A;  3CPW U;  5CN0 A;  2Y69 B;  5IDJ A;  4PA6 A;  3PCO A;  3EFS A;  4UP7 A;  1B7Y B;  2Q67 A;  2I4O A;  2JIZ G;  3W7U A;  4F4L A;  1AJN A;  1R3K C;  4FK5 C;  1KEC A;  1ADY A;  3CCL V;  2DKG A;  4LNS A;  3UFG A;  2DEQ A;  4WFE A;  2IJK A;  3ZMV A;  1WQ7 A;  5K1X A;  1IXM A;  2C2A A;  2HNI A;  4HWO A;  4PDM A;  3CMA V;  1H4V B;  1BL8 A;  4XDL A;  4OLF A;  1NJ1 A;  1LYL A;  3RVY A;  5IY5 C;  4I9W A;  3SPG A;  3ZRX A;  1YTF D;  4H33 A;  4P9O A;  1G5I A;  2XAJ A;  1HTT A;  2CJA A;  4XTX A;  2EIM C;  2V1D A;  3ASN C;  4KP4 A;  1DTO A;  3K0D A;  4BAY A;  3NEM A;  2EIN B;  2WSS G;  3M4Q A;  2OT5 A;  4CH3 A;  2IH3 C;  2X7R B;  5K1P A;  2I4N A;  1BBU A;  1GM8 A;  4BIZ A;  5EBM C;  3E89 A;  1K3E A;  1VQN V;  3BJU A;  2EJR A;  3MF2 A;  2MK3 A;  4G27 B;  1SET A;  3HY0 A;  2DZ9 A;  2QE7 G;  4PA4 A;  2A8E A;  4LVK A;  3ASO B;  4U7O A;  5C93 A;  2QEX V;  1QLE B;  4HZ3 A;  4PG3 A;  4TTV A;  4O2D A;  4WJ3 M;  1AR1 B;  4U7N A;  2EIJ C;  3MEY A;  2DJZ A;  2DZC A;  3P8Y A;  4X5O A;  4UV9 A;  4QIW F;  5CBH A;  3ABT A;  2EJF A;  1B70 B;  5LHH A;  2QHU A;  4MTX A;  4HWT A;  3MF1 A;  4CS3 A;  5J9P C;  2ZD9 A;  4Q20 A;  4MSW C;  4E2L A;  3NXS A;  3L2Z A;  1K33 A;  4AH6 A;  3QNE A;  3E9H A;  2ZR2 A;  4XDJ A;  2EZP A;  3B8N A;  2Q7E A;  2WLH A;  3RVZ A;  3IG2 A;  2Q5H A;  1AJQ A;  1I5Y A;  4UUJ C;  3T4Z A;  3ZRS A;  4BW5 A;  3L4G A;  2DQ3 A;  2QM7 A;  4KUM A;  1THZ A;  1VQ9 V;  1QLN A;  1HC7 A;  5CBG A;  1USY A;  1QCE A;  2NLJ C;  4CS4 A;  1FS0 G;  2XAS A;  2W0F C;  4H2Y A;  2DVE A;  5E3I A;  4K86 A;  2FYK A;  2P90 A;  5IYD O;  3ABL B;  3L4G B;  3PJS K;  2H8P C;  1P4R A;  1CEZ A;  1FXK A;  4XTY A;  5EBW C;  3BFM A;  2R9I A;  1R6K A;  2Q68 A;  1MOF A;  4CH6 A;  1Y4M A;  3OAA G;  1GM9 A;  1OCC C;  2KB1 A;  2QHT A;  1IL2 A;  1SZT A;  3ZRW A;  2Q6A A;  4XDK A;  5IYC O;  1VQ4 V;  1KMM A;  2GSM B;  3WG7 B;  2NS6 A;  2GHY A;  4QE9 A;  1FXK B;  1NQT A;  2WLM A;  3K9A A;  1ASY A;  4MVU A;  2CJB A;  2RHQ B;  5B1A B;  3I56 V;  4LVM A;  3SPC A;  3E8G A;  4DPG A;  4HT4 A;  3ML0 A;  4TQF A;  3ZRW B;  4X88 A;  2RHS A;  4WFB V;  1ATI A;  4P73 C;  4P3O A;  2HFE C;  2QA4 V;  5CMU A;  5ELN A;  4P75 A;  5FL7 G;  3HFV A;  1XL4 A;  2HR3 A;  2E10 A;  3I7F A;  1L1F A;  1R3J C;  1NR1 A;  1EOV A;  4UPA A;  1TUE B;  1YIJ V;  4PA7 A;  2ZXF A;  2R9R B;  3ZMS A;  2A79 B;  1KQS U;  1YB3 A;  5LGU A;  2EAY A;  3LDE A;  1BHB A;  1E22 A;  4OP0 A;  2EJ9 A;  1VQL V;  3MQZ A;  5KUM A;  3HB3 B;  1GTO A;  2ZXW C;  3JYC A;  3RBZ A;  5HFM A;  1M56 B;  4P75 C;  3ABK C;  4P3P A;  3R07 A;  2C7I A;  1G8M A;  4WJ4 A;  3P8T A;  2ZCE A;  2DYR B;  3V7R A;  4R6Z A;  3AG1 B;  2HVK C;  3E86 A;  2CJ9 A;  2ART A;  1GO3 F;  3A31 A;  2DTI A;  1K5S A;  3NEN A;  3ZMU A;  1CP9 A;  2I4M A;  3X2Q C;  4XEM A;  1PD3 A;  5LGT A;  4QPJ A;  2XGT A;  3OD1 A;  3V7C A;  1X56 A;  3SYO A;  3ZJZ A;  2F43 G;  1NH2 B;  2AKW A;  1C0A A;  3TCU A;  4P30 A;  3AG3 C;  1VQ5 V;  2ODR D;  3T2M A;  1GM7 A;  2ODR C;  2Y48 A;  1H4Q A;  3FYI B;  2E3C A;  3TEH A;  4LCU C;  3ABM B;  3D36 A;  1I5X A;  1NBM G;  1K4D C;  2EIK C;  1NJ8 A;  4TWA A;  5C53 B;  3JD4 A;  4ZIB A;  1VQZ A;  4YRS A;  2IU3 A;  2ARS A;  2DYS B;  3K0G A;  5L3B A;  3HXV A;  3A5Y A;  4MW3 A;  3IGA C;  3OMA B;  5HFL A;  2AMC A;  4JTA B;  1OCZ B;  4PDV A;  2QHV A;  5B3S B;  1H38 A;  1OCO C;  1RPR A;  3VOU A;  4BW9 A;  2JEU A;  2E5A A;  4I5S A;  4CS2 A;  2I4L A;  2EJG A;  2HVJ C;  5H6Q A;  1N8R W;  2Y69 C;  3JD2 A;  4TVY A;  1JPX A;  4YRQ A;  4YRE A;  1WYD A;  1DLB A;  3ZMT A;  1FFT B;  2AMC B;  3IAL A;  4H2U A;  3QO8 A;  1BHA A;  4LVI A;  1KC8 W;  4RUE A;  4J15 A;  2ATK C;  3F7V C;  1YIT V;  3JCZ A;  1YFR A;  2OTJ V;  3K79 A;  4QPK A;  2EIL B;  3ZMZ A;  1VQO V;  5E1A C;  4G85 A;  4P74 A;  2QKS A;  3VQW A;  4WFA V;  4K88 A;  2UXX A;  3EFR A;  2Z5U A;  3OM3 B;  3CD6 V;  1LNQ A;  4UVB A;  2XTI A;  4P71 A;  4YRL A;  4Q15 A;  4FPP A;  2EIN C;  3CCE V;  1HXD A;  5GW7 A;  2XND G;  5C51 B;  3AG4 B;  2DXT A;  4MVQ A;  4PDR A;  2PME A;  2E65 A;  4GX0 A;  2JK5 C;  1B70 A;  4YRC A;  4PA3 A;  3CCV V;  2WLJ A;  4GCZ A;  4GX5 A;  4UXN A;  1Z7M A;  4P74 C;  1H8E G;  1E24 A;  3ASO C;  5IY5 B;  1YFS A;  1V55 C;  4ZTZ B;  1WU7 A;  2DU5 A;  1QLE C;  5KA6 A;  1COW G;  1H4T A;  4ZBM A;  4P71 C;  4TVA A;  4WFH A;  1J5W A;  5KUK A;  4XTV A;  1JCH A;  3ETD A;  2QHS A;  2ZZE A;  1RIQ A;  4H2W A;  2CIM A;  5LBQ A;  3T4D A;  1PL0 A;  2W6I G;  4QE7 A;  2ZT8 A;  4QNH B;  2QM8 A;  4XTZ A;  1L0W A;  4MVR A;  4TVA B;  2XAH A;  2WWW A;  1PYS B;  4NCX A;  1E1O A;  2ZT5 A;  3FB8 C;  1HWY A;  4YCV A;  1X2G A;  2G4C A;  3A7A A;  3HXY A;  4MTG A;  2IJI A;  1OCR B;  3G1Z A;  1PNL A;  4WI1 A;  2NNU A;  4DXW A;  4P72 A;  3STZ C;  3W7W A;  1K4C C;  1N9W A;  3CCU V;  4YRG A;  1KD1 W;  1VQM V;  1Q86 W;  3K04 A;  1ROP A;  4RQE A;  4HVC A;  4YRI A;  1M57 B;  3OMN B;  3JD1 A;  3W7T A;  2ARU A;  11AS A;  4EO4 A;  4YRN A;  1F4M A;  4PEL A;  5L3D A;  3A7R A;  3SYA A;  3ABL C;  2DWE C;  2RHQ A;  4WF2 A;  2ZT6 A;  4HAM A;  3CXC U;  2PI5 A;  5F5W A;  2HLD G;  5KA5 A;  1USY C;  4P72 C;  2ZDI A;  2JJ1 G;  2XOK G;  3UKM A;  2ZZF A;  3ZIA G;  5EBL C;  4G2K A;  3W7X A;  1KKD A;  5L3F A;  1QVF U;  4H2X A;  3CCJ V;  3RL6 A;  1R6N A;  3WG7 C;  1Q81 W;  3RUX A;  3V8K A;  1F23 A;  1FXK C;  1KP3 A;  2WLN A;  4P9P A;  4YPF A;  3FB7 C;  1X2H A;  3M4P A;  2ZIM A;  5B1A C;  1PNM A;  2IY5 A;  3GWO A;  1S77 D;  4XU0 A;  3TET A;  5EC2 C;  4X89 A;  12AS A;  3UGQ A;  2DW4 A;  2EBO A;  3CC4 V;  4JPR A;  1UJW B;  3A32 A;  5ELO A;  1JOY A;  2V7Q G;  3RAC A;  4H2X B;  4RQF A;  3IFX A;  3LUT B;  4K87 A;  1S76 D;  1NNH A;  3W7S A;  3KG2 A;  1EFW A;  3RKW A;  3NEL A;  2DTO A;  3RKY A;  4MVM A;  1B76 A;  3ERR A;  4YRK A;  3GB7 C;  3OEH G;  2IY5 B;  1AI6 A;  3OUF A;  1E1Q G;  3CP1 A;  3M99 B;  4H2T A;  4RDX A;  1EIY B;  4GT1 A;  3VBB A;  3LSQ A;  5LHI A;  2DXU A;  1KP2 A;  4EKW A;  4Z1M G;  5LHG A;  1BIA A;  1KOG A;  2AHZ A;  3V7S A;  2JJ2 G;  3SYC A;  3E8F A;  1W2B U;  4HYO A;  4QJF B;  4YP0 A;  4LBE C;  1P7B A;  1V54 B;  1M56 C;  1W66 A;  3OGC C;  2ITD C;  4WFG A;  2DYR C;  2ZNJ A;  3AG1 C;  2X6B A;  1S3J A;  1Y66 A;  2IJJ A;  2X6C A;  4LP8 A;  1VQ8 V;  4RMF A;  3ABU A;  2Q7G A;  4BIU A;  1M1K W;  3I55 V;  2K1E A;  3JD0 A;  1NH2 D;  4R50 A;  2P0L A;  2PMF A;  3IC7 A;  3W3S A;  4YRF A;  2ZXW B;  4MS2 A;  2D3O W;  1QE0 A;  1RM1 B;  5EC1 C;  4E51 A;  2DWD C;  3CCM V;  1JJC B;  2C8M A;  4KQE A;  3K03 A;  4UP9 A;  1S72 V;  3ABM C;  4YRO A;  1E1T A;  1GMG A;  2IW5 A;  4PA9 A;  3X2Q B;  4MW8 A;  4DO2 A;  1H2G A;  3CCQ V;  1K73 W;  2HJF C;  1VQP V;  1K5Q A;  4G28 B;  1ADJ A;  3TEG A;  1KMN A;  3FB5 C;  2WAM A;  3E35 A;  2DYS C;  4J9Z B;  1J95 A;  2LFR A;  3HRI A;  4LVJ A;  1NVP B;  3NET A;  5B1B B;  3CMQ A;  2XAG A;  4ZTU B;  4TT3 G;  1OCZ C;  1BBW A;  2X0L A;  1DF4 A;  2M7W A;  4XBF A;  3HPL C;  3ZCC A;  5B3S C;  5L3C A;  2ZZG A;  5DM6 V;  4R7C A;  3F5W C;  3V8J A;  4HWR A;  5KNN A;  1QR8 A;  4RAI A;  1WPX A;  2A0L A;  3P30 A;  1GK9 A;  4MVS A;  3HTZ A;  2WLL B;  3RKX A;  4XU3 A;  2OCC B;  2JDI G;  3LNM B;  2WLI B;  3AG2 B;  3E2E A;  3SYQ A;  3HFZ B;  3PZC A;  4MTF A;  1YI2 V;  1NKD A;  4YRR A;  2W6J G;  4RO2 A;  3MHS C;  4H2V A;  3OE7 G;  4P2Z A;  4HWP A;  4XU2 A;  4CH4 A;  4CH5 A;  1QBZ A;  1K92 A;  2EIL C;  4FIP C;  1OCO B;  4JGS A;  2ZTG A;  2ALY B;  2XAF A;  3FJP A;  3P8V A;  2DDZ A;  2OTL V;  1AI4 A;  1G4Y B;  3K06 A;  1G5H A;  2UXN A;  3H01 A;  3A7U A;  4N21 A;  3EFF K;  1OZ0 A;  1ENV A;  3B8M A;  3QO5 A;  4WFF A;  1S5H C;  3CCS V;  1K7D A;  4L87 A;  3G71 V;  3AG4 C;  2BOB C;  1FYF A;  3P32 A;  4JTD B;  5HGQ A;  3KFU A;  2X6A A;  4FMT A;  1NJI W;  1WLE A;  1PKX A;  2IH1 C;  1FXH A;  3LDC A;  3RW0 A;  1YTF B;  2JEX A;  2EIM B;  3ASN B;  2DTH A;  1JJ2 U;  1PYS A;  3HXX A;  1VQ6 V;  4UP8 A;  1FXV A;  2YEV A;  4MVZ A;  3HRK A;  3PCO B;  1ASZ A;  4PHC A;  1E1R G;  3RF1 A;  5H9C A;  2YSU B;  3SPJ A;  1MG1 A;  1MAB G;  3E8B A;  4KFM A;  3ETG A;  3IKL A;  4YDQ A;  2B1I A;  2ITC C;  3TK1 A;  4TWK A;  3OW2 U;  4FJC C;  5LGN A;  4R8C A;  1QR9 A;  4H2S A;  3STL C;  1MSW D;  3VQX A;  2YEV B;  5BZB A;  1NJ5 A;  4YCU A;  1YJ9 V;  3QO7 A;  4LC1 A;  1V55 B;  4X8A A;  1YJW V;  1K9M W;  4H02 A;  5IYB O;  1AJP A;  2EIJ B;  1QVG U;  3ZN0 A;  4TVW A;  1DF5 A;  1VQ7 V;  3E83 A;  4KR3 A;  1OCR C;  2P5I A;  3AEI A;  3UH0 A;  4LVL A;  1B8A A;  2J3L A;  1JQ0 A;  2CGH A;  3ZRV A;  1JX9 A;  1AI5 A;  2E41 A;  1F4N A;  3E8H A;  1M57 C;  3BY6 A;  5CBF A;  3RGL A;  1YGB A;  1H8H G;  3DSQ A;  1AI7 A;  2AHY A;  4MT8 A;  1K97 A;  4CBC A;  1WQW A;  2Q5I A;  1YJN V;  4P3N A;  1NYQ A;  4EX5 A;  4OXS A;  4YXW G;  1X54 A;  4UV8 A;  4PDL A;  2LP7 A;  2Q69 A;  5EK0 A;  5B1N A;  1S0V A;  3REU A;  3FYE B;  3HY1 A;  2ZIO A;  2P6J A;  3FKS G;  1NYR A;  2EL9 A;  3BEH A;  3RIR A;  3R65 A;  4RUF A;  2WPD G;  2ZR3 A;  3T1C A;  4TQD A;  2ZNI A;  3B77 A;  3K3W A;  3V8L A;  4XEO A;  5C52 B;  3A0R A;  3LSS A;  4JYC A;  3A5Z A;  3SPI A;  4TSF G;  3LDD A;  3OUS A;  1K34 A;  1YSC A;  4JTC B;  5L3E A;  1EIY A;  2ZDI C;  2LFS A;  3DGE A;  1W0K G;  1XL6 A;  5DN6 G;  1OCC B;  1PNK A;  2ZGW A;  1CPY A;  1B6Q A;  4G84 A;  4YRP A;  1EBO A;  1VQK V;  3VQY A;  4XU1 A;  4P73 A;  4UVA A;  4GX1 A;  5L3G A;  2XAQ A;  2IJH A;  3L1A A;  4XTW A;  3REX A;  3HXU A;  2P7T C;  4JAU A;  3IKM B;  4JAS A;  3JD3 A;  2B5U A;  4JF3 A;  3FB6 C;  1F51 A;  1X01 A;  4YCW A;  1M9N A;  2IU0 A;  1BMF G;  2HG5 C;  1EFR G;  2EZO A;  5CA3 A;  2E64 A;  4MTO A;  4N23 A;  3K08 A;  1V54 C;  4ASU G;  3D3I A;  2Q7H A;  2PI4 A;  1EQR A;  4YRM A;  1JVM A;  2J3M A;  1NJ6 A;  1JJC A;  1SRY A;  3OR7 C;  1R73 A;  4YRT A;  1R3L C;  2RHS B;  3OFN G;  1NJ2 A;  1W0J G;  3CC7 V;  1WPY A;  2P67 A;  3DTU B;  4JYB A;  3F7Y C;  1G51 A;  3ABK B;  1QF6 A;  3CME V;  1RM1 C;  1Q82 W;  1R3I C;  1M90 W;  1SER A;  3SJQ C;  1Q7Y W;  2HKO A;  1X55 A;  3VQV A;  2DU7 A;  3G6E V;  1ZWI C;  4JAV A;  1GGM A;  4WCE V;  2WLL A;  4CZZ A;  4J9Y B;  2BOC C;  3G4S V;  2WLI A;  2Z3Y A;  1Z7N A;  4HWS A;  1RPO A;  3AG3 B;  1EVK A;  1ARO P;  2ZQM A;  1NVP D;  1BIB A;  2ZIN A;  4ZKI A;  3HFZ A;  4YRJ A;  5B1B C;  5B1O A;  3UM7 A;  2H94 A;  2E1H A;  3QTC A;  2DQ0 A;  1YFT A;  1NR7 A;  5H6R A;  2EWN A;  3HXZ A;  1K8A W;  4DQ2 A;  3ZN1 A;  4BWA A;  3ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...