3LSSA

Trypanosoma brucei seryl-trna synthetase in complex with atp
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
438
Chain Sequence
GSMMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEACVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
total genus 159
structure length 438
sequence length 470
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lssA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lssA02
1WNLA 3NELA 4YRRA 1PYSA 2P5IA 4WI1A 3I7FA 2AKWA 4RQFA 1NJ5A 4TQDA 3HXZA 4L87A 4H2WA 4LNSA 3RKWA 3BJUA 1Z7MA 4OP0A 2DXUA 3V7SA 3VQWA 2ZCEA 3IKMB 1NYQA 2E41A 1USYC 2PMFA 4NCXA 2DJZA 2J3MA 2EWNA 3EFSA 3A5ZA 3L2ZA 4H2UA 4XEOA 1YFSA 3V8LA 3HXUA 4YPFA 1Z7NA 1ASZA 3G1ZA 1YB3A 2EL9A 1H4QA 4WJ3M 2ALYB 3UFGA 4KR2A 2RHQB 3MF1A 5C52B 4TVWA 2ZZEA 1J5WA 2ARTA 4YRMA 3HFVA 4YRKA 2E3CA 3HRIA 4K88A 3FJPA 2PMEA 2DTIA 2RHSA 1WPYA 4O2DA 1EVKA 2HNIA 1H4VB 3A74A 1G5HA 4P72A 3ERRA 3P8VA 2G4CA 4KQEA 2E65A 3P8YA 4YRGA 4DQ2A 4TTVA 2ZZGA 2DEQA 4PHCA 1JJCB 2ZT7A 2IY5B 2Q7HA 1B70B 1NNHA 3RGLA 2ZT5A 2J3LA 4G85A 4P3OA 2AKWB 1USYA 2ZINA 5ELOA 2ZTGA 4P74C 1SETA 4H2XA 4HWSA 1ADJA 1NJ6A 4YRSA 4YREA 1E22A 4P72C 1B7YB 1G5IA 4BWAA 4HVCA 4YRIA 1EQRA 1RIQA 4P75A 1ASYA 4HWRA 2ZGWA 1EFWA 4HWPA 2E10A 4CS4A 3LSSA 1GGMA 4K87A 5E3IA 11ASA 3L4GA 2DTHA 3QO7A 1VQZA 3IKLA 4KR3A 2CGHA 2C7IA 1X2GA 4RDXA 4YRCA 4TVAB 3KFUA 4YCVA 2XTIA 4TVAA 4AH6A 4EX5A 1W66A 3UGQA 3A7AA 3QO8A 2DZ9A 4Q6GA 2E5AA 3RKYA 2ZT6A 2IY5A 1QE0A 2XGTA 4HWTA 1E1OA 4K86A 1BBWA 2ZT8A 2AMCA 4H2YA 2E1HA 2AMCB 2I4OA 2FYKA 2I4MA 2CJAA 2ZIOA 2EJ9A 3NENA 1B7YA 1C0AA 1EVLA 2ZZFA 2Q5IA 3QNEA 1HXDA 2DVEA 3UH0A 4ZTUB 4UP8A 4YCWA 1YFRA 3TEGA 1EIYA 3PCOB 3QO5A 4YDQA 4ZTZB 3MEYA 1SRYA 2QHUA 12ASA 3L4GB 2ZIMA 2P0LA 4P3PA 2ZXFA 1B76A 4ZIBA 4XTUA 2Q7EA 3VQVA 4RQEA 2DU7A 1X55A 4PG3A 2QHTA 1WQWA 4EO4A 2ZR3A 4HA8A 2ZNIA 2EJFA 3CMQA 3REXA 3HXYA 3HY1A 4H02A 3NETA 5C51B 4H2VA 4CS3A 4CH3A 3RF1A 5K1XA 4XTVA 1BIBA 3A7RA 3HRKA 4P73A 1X56A 2Q5HA 4YRFA 1SERA 4YRQA 2ZNJA 1EIYB 3DSQA 3RACA 1YFTA 1HTTA 4YRLA 5K1PA 1G51A 3V8JA 4CH4A 3L1AA 2DQ3A 3RKXA 4YP0A 3TUPA 3VBBA 3HXWA 4YRPA 3A7UA 3WQZA 4XTYA 3HXXA 3LC0A 5F5WA 3UGTA 3HXVA 3V8KA 2I4LA 4UP9A 3TEHB 5HGQA 2DQ0A 3P8TA 1X54A 3QTCA 4P71C 1LYLA 4BW9A 3RL6A 1L0WA 1NJ2A 3REUA 3OD1A 1E1TA 2ALYA 3V7CA 1SESA 4YRTA 4YYEA 4HWOA 3M4QA 3VQYA 4P71A 3A5YA 3EFRA 4XU1A 2QHSA 4G84A 3IALA 1X2HA 3HFZB 3MF2A 2CIMA 1PYSB 3PZCA 1YGBA 3HY0A 3R07A 2EAYA 3ICAA 1KOGA 1BIAA 4P73C 5KNNA 4UP7A 4J15A 3RIRA 1FYFA 1WU7A 4P74A 1IL2A 1H4SA 1ADYA 3RUXA 4DPGA 4XTZA 4YROA 1WQ7A 4XEMA 4X5OA 4E51A 4RMFA 1B70A 1H4TA 1X01A 4UPAA 5C53B 2EJGA 3W3SA 4XTWA 2ARUA 4WJ4A 3E9HA 2DKGA 4H2SA 2C8MA 4CH6A 4P3NA 3PCOA 2E64A 1B8AA 4CS2A 2ODRC 3V7RA 4H2XB 4CH5A 3VQXA 2RHQA 1KMMA 1EOVA 4WF2A 3A31A 2CJBA 1HC7A 3E9IA 1WYDA 3NEMA 1E24A 4YRJA 2Q7GA 4XU0A 4XU2A 4XTXA 4YCUA 3BFMA 4TWAA 3TEHA 2I4NA 1NYRA 1KMNA 1NJ1A 2ODRD 3M4PA 4TVYA 2DTOA 2RHSB 2ARSA 1N9WA 4Q15A 5ELNA 1ATIA 2QHVA 4OLFA 4XU3A 1QF6A 2DZCA 2CJ9A 4YRNA 1NJ8A 2DXTA 4H2TA 3IG2A 3LSQA 1WLEA 2DDZA 1JJCA 3A32A 2DU5A 1BBUA 2ZR2A 4P75C 3HTZA 3HFZA 4TQFA
chains in the Genus database with same CATH superfamily
1B06A 2P6JA 4O4IB 5C8YA 3NELA 4YRRA 4YJ3B 3RYHB 1VQOV 3I7FA 2AKWA 5CA3A 5KHHA 1Y74A 4PA6A 1NJ5A 4LP8A 4TQDA 3HXZA 3RKWA 2EILB 1HNWO 4X64B 3BPZA 2YSUB 1CPYA 4EKWA 5H5NA 5BMVA 2ZCEA 4JYAO 1AP6A 5HFMA 1YJ9V 1W0KG 4UB8Z 1NYQA 1FFXA 2PI4A 3CCSV 3CS5A 4LVIA 4XBFA 1EFRG 2F23A 4J7KA 5LMNO 2ZDIA 1T5EA 4JAAA 3V8LA 4JZ2A 3HXUA 2HLDG 1E79G 5JQGA 2ADQB 3ETGA 4O2AA 1Z7NA 5LL6Y 3JATB 3G1ZA 1JX9A 4RUEA 3CRMA 3B77A 3F5WC 3L70H 1M93A 2BE3A 1M56C 3ASNB 3L9DA 1V55B 4Q20A 3U11A 5B3SC 4X9QA 3MF1A 4GX0A 4PA3A 1S5HC 2YXYA 1GN4A 4LFCB 2UXXA 2FYUH 5CA1B 3CCMV 4MT8A 2E3CA 1IDSA 3SYPA 1K92A 4K0KO 2CGNA 2Q0OC 2A06H 3CCVV 4I4TA 1R1BA 5CBGA 4DR5O 1XMOB 4J11A 1DF5A 1YXBA 3P8VA 2CH7A 2G4CA 5D5PA 4PA7A 3UT5B 2E65A 3P8YA 1RSOA 1CP9A 2X0LA 5IJ9B 2Y48A 4DO2A 2ZZGA 1XL4A 2Y4UA 2JGDB 1JJCB 2ZT7A 1R6KA 1Y67A 2Q7HA 3WG7B 3RN4A 3CD6V 4QIWF 1MABG 2J3LA 5L3BA 2YEVA 1PNLA 1D5AA 3BEHA 4LH7A 3RYCA 4P3OA 4X1YB 5EC2C 3R65A 2ZINA 2ZTGA 4P74C 3ZHQA 4O4JB 3OR7C 2WSSG 1U96A 5KX5B 4BR6A 4P72C 4LNUB 4BWAA 1RIQA 1FXKB 5LOVA 4B3RB 1I5YA 4LF9B 4HWPA 4I7ZB 4CS4A 3LSSA 1XEQA 1VQ5V 3IKLA 1YCIA 3T1HO 3E89A 4RDXA 2Z5UA 4E4EA 4YCVA 5IJ9A 4G2KA 1P84F 4AH6A 1W66A 1MZEA 5EC1C 2E5AA 3CWBH 2IY5A 2N05A 1DF4A 1DLBA 4GX5A 2XGTA 2Q4PA 4EEQA 2LJ2A 4K86A 1K4DC 3JAKA 4FLZA 4I50A 3ETQA 5DECA 2DYRC 4WCEV 2E1HA 4PDVA 2CTWA 5LHGA 3ASOC 1NQTA 2KG7B 1TA8A 2UUAO 2CGOA 2CTQA 5H9CA 2LFSA 3UKMA 5BY1A 4LFBB 3O65A 2CJAA 3EHBB 2QWOB 4DR7O 1B7YA 1Q8IA 5KUKA 1N36O 4JTAB 4NVPA 3ABMC 3RW0A 4Z1MG 3N2GB 2Q5IA 5B1AB 5EBLC 2QWQB 1DK1A 3KG2A 1HXDA 4AHCA 4UV9A 3UO3A 4UP8A 1R73A 1B04A 3ETEA 2M7WA 5DEDA 3QO5A 4YDQA 3MEYA 2QHUA 1OHHG 2ZIMA 2P0LA 4RWUA 3H1HH 5LP6B 1N32B 3P3PA 3BFRA 4LWSB 3JSLA 3ZBHA 2HHHO 4XTUA 4OX9O 2W6JG 2QKAA 1RP3B 1ZX3A 4DV6O 3APQA 3X2QB 1EZVH 1QU7A 1IBLB 4X66O 1V54C 1S72V 1WQWA 1BHAA 2QE7G 2F1MA 5BZBA 4FZ0A 2LGWA 3UM7A 3KCYA 1H2SB 5IY5C 4B3TO 5IYCO 4H02A 4IIJB 3S3WA 1NR7A 4N23A 3FAVA 3RYFB 4MVSA 4J41A 3WU2Z 5KMGA 3T2MA 3HKCB 4DV3B 1YVWA 3WB0A 1XL6A 2WLJA 3HRKA 4IGGA 5H6RA 4GLXA 3MQZA 3B4SA 1RM1B 4YRFA 4YRQA 4FFKA 4I9WA 1QHTA 1QLNA 3B8NA 2QKCA 2EIMC 5C8YB 2JGDA 3RACA 4KHPO 1FD9A 4YRLA 1MMMA 2AW9A 5IDJA 3K08A 4PD4F 4CH4A 2OCCC 2V7QG 3SJCC 1QQCA 2IU3A 1B3QA 5LP6C 2F95B 2YDEA 4XTYA 1NJIW 4MW8A 1IBMB 1NH2B 3SR2C 1K5QA 3V8KA 1SC5B 4DV7O 1VMGA 4UP9A 2XAFA 1OCCB 2Q5ZA 3LUTB 4MTOA 3E35A 1K97A 1N8RW 4P30A 2YC0A 4YIOA 3CCEV 5ITZA 5LMUO 4P71C 3ZX6A 4X62O 3RL6A 1XUQA 5JCOC 4DRXB 2ZE8A 4GZRB 4QJFB 4FLVA 1M57B 3JD1A 3BABA 5FPOA 2BCCH 4YHHB 2JDIG 4UCVA 2W0FC 4CZZA 3VQYA 4P71A 1BQZA 1WNSA 4K8XA 4MSWC 4XU1A 1NH2D 3LDDA 3MHHC 3IALA 2ODMA 2Z0AA 3HFZB 1SQFA 1P49A 4WFEA 4X62B 1D5NA 3T1HB 4HZ3A 4AILC 3K0GA 5D5QA 1PL4A 2P90A 4TOIA 5EIBD 4J15A 1YI2V 4P74A 1RPRA 3DXRB 4DK0A 4RO2A 1IL2A 1ADYA 2AZ2A 1GO3F 1L1FA 2QEXV 2L35A 4DV3O 1HDJA 3HKBA 4XEMA 4X5OA 5FL7G 1K9MW 4RMFA 4TT3G 3NXSA 2H3OA 2EJRA 2X6BA 1X01A 3ABTA 3MHSC 3E9HA 4JF3A 3CCJV 2YEVB 1OJHA 4JYBA 3UO2A 2IU0A 3RYHA 1IZ3A 4ZOLA 3K9AA 4J9ZB 2ZXWB 1YHQV 1J5EB 2PYJA 1KECA 4UFZA 4H37A 4O4JA 4CH5A 3JSNA 3VQXA 2RHQA 2DJVA 1KMMA 3E8GA 1PP9H 1VP7A 5J9PC 1W59A 1HC7A 4DR3B 4YRJA 5GONA 4EFEA 1W2BU 5EBWC 3J7AU 1FPOA 3OW2U 1NYRA 3IFXA 5ELNA 2QHVA 3T1YO 4XU3A 3ZRWA 1GN3A 2DZCA 3HPLC 2YIDA 5EBMC 1F23A 1MSDA 2DXTA 3IG2A 1G8MA 2EBOA 4DV6B 2QGNA 1WJZA 1GMGA 3H1IH 4B3SO 3FX7A 1Y76B 4NKGB 3TCUA 3THOA 1AROP 3R66A 2UUAB 5EK0A 4LF6B 2Y0PA 3JD4A 4UVAA 3CRCA 5KHIA 2LFRA 3E2EA 1YTFD 1PYSA 2JS5A 4WI1A 3AG2C 2Q73A 3NR7A 3OD4A 5B1NA 1Z7MA 4XDKA 2DXUA 4OP0A 3H01A 1ZL8B 3BRCA 1N0NA 2P5OA 3HKEB 1VF6C 2UU9O 5J2TB 3CC4V 1OZ0A 1GH6A 3ETDA 5KUMA 4X65B 2J3MA 3FB7C 2EWNA 2P4KA 3CMEV 3EFSA 3A5ZA 4QPKA 2WWWA 1OCOB 2HJFC 1HNXB 1S5JA 3ZRWB 4H2UA 3WB1A 4WFFA 1MA1A 5LP6A 3H1JH 2WLLA 1WP7A 2R72A 4YPFA 1J95A 1H2KA 2ZDIC 2OCCB 1H4QA 3E86A 4MS2A 4WJ3M 3UFGA 4TSFG 4KR2A 2LQTA 1VQMV 4JI7B 2RHQB 3UCSC 1OV9A 1J5WA 1G6UA 5BXZA 2A79B 3FB5C 2B5UA 3CX5F 4IIJA 3K57A 4C7UA 5EIBC 3T1CA 3FJPA 2DTIA 2QTOA 4XDJA 3JASB 1N33O 4LF8B 1WPYA 5KMGB 2F93B 3FYEB 2VS0A 1G5HA 4P72A 3ERRA 2YIAA 3K3WA 5JWPA 3WG7C 3OMIB 3SDLA 1XMOO 2HG5C 2DWDC 1EBOA 4DR5B 1Q6IA 4FZ1A 4X20A 4D7TA 4B7EA 2IY5B 3EXAA 1VIBA 4R7CA 3OGCC 4OXSA 4QNHB 1B70B 1NNHA 5TISZ 1AR5A 2AHZA 4F6RA 2ZT5A 1OCRB 5LA6A 5JH7A 2ILMA 4ICGA 3OE7G 1HNZB 1H2GA 1GRJA 3ZMVA 4KFMA 5IYDO 3ZHSA 3QVNA 4H2XA 2E74B 2X6CA 4J7ZA 1E22A 4YRIA 1ASYA 2UUBO 1EQRA 3HKEA 4P75A 2HFEC 3H1KH 5KX5A 2ZGWA 1BS3A 3RBZA 2E10A 1K7DA 4MVUA 2XT9A 1XHZA 4HYOA 5BR8O 1RM1C 5FNVB 5GW7A 2DTHA 3QO7A 3MD0A 2B9ZA 1XQ8A 3ML0A 1IURA 4UCTA 3CHXA 4KR3A 2CGHA 2JJ1G 2DYRB 1X2GA 2WA4A 3K79A 4YRCA 4GT1A 1RFYA 4X64O 5LXTA 4TVAA 2OYQA 1BSMA 4DR6B 3UGQA 3RKYA 2DZ9A 3Q4HA 4Q6GA 3ZHVA 4ZHQB 2RCVA 4YY3O 4DR6O 4HWTA 4OGQB 5LMNB 1XHXA 1S77D 1BBWA 2EINC 3K59A 2UXCO 2ZT8A 4DV2O 3CCRV 4DYLA 4ASUG 3I5DA 3ABKC 4JI6O 4JI2O 3CYOA 1M4UA 2ZIOA 1X4TA 3G71V 3NENA 2UXDB 2IW5A 2ZZFA 1QVFU 4KUMA 2VWKA 2ITDC 2Q67A 3UT5A 3QNEA 4ZKIA 3F5TA 3CXCU 2DVEA 1H8EG 4MTXA 4YCWA 1YFRA 1WN7A 4MTGA 1EIYA 3PCOB 3JCZA 1IX9A 12ASA 2UUCO 1BCCH 1Q6UA 2ZXFA 1B76A 3ZRVA 2RQ6A 2YXLA 3ZHUA 1CXZB 2QWRB 3BCCH 1PKXA 2E76B 2CAZC 1IVSA 4P9OA 4DR4O 3SYOA 4RQEA 5CBHA 4E2LA 3CC2V 1IXBA 2QHTA 2ADPA 2EULA 3D3IA 2ZR3A 1FKAO 4HA8A 2IJHA 3HXYA 2P67A 3HY1A 4DV5O 3RVZA 1W0JG 4H13B 3CCLV 1AILA 1L0LH 1NT2B 3N2KA 3FAVB 1SS3A 1Q81W 4JYCA 4NTXA 3AG7A 4H2VA 3A2FA 4DW0A 1VF6A 3LNMB 2Q6AA 4DW1A 5K1XA 1VQLV 5JVDB 2JK5C 1JOYA 4K8ZA 2X6AA 4DUZB 4P73A 1F4MA 4L8JA 1E1QG 2Q5HA 5GTHZ 3STLC 1ENVA 2QA4V 2RJZA 2ZNJA 1SQGA 2GTSA 1EIYB 2X7RB 3DSQA 3OEHG 1DTOA 3CJHA 1NS1A 3IJ4A 1ZWIC 3OUSA 2ZM6O 1JCHA 5DM6V 4YP0A 4F6RB 1FXKC 5LGTA 4JI0B 3HR0A 2Y69C 2CDYA 4X88A 2LGQA 3WQZA 1WAZA 4FM0A 4MVMA 2Y4TA 1JPXA 3AG1B 2AXTZ 1WPBA 4TUYB 2I4LA 4DV0B 3J80N 1AB3A 2Q0AA 2YI8A 2DQ0A 1X54A 4LF4B 3QTCA 2GV9A 2O57A 2OTJV 3AEIA 2IBZH 3JARB 4H33A 4JI3B 4FFBB 2WLIB 5KHKA 1KYOF 4PHZA 4JASA 2W6IG 4BW5A 1NJ2A 2K9PA 4ZBMA 3CXHF 1PPJH 2M6YA 1KQSU 3C3TA 2PI5A 2ALYA 4KXRA 2IJJA 1V9PA 4TV8A 3V7CA 1Y76A 2XAQA 3M7MX 4HWOA 1BGYH 4PI2A 2W0XA 4BIOA 1EM1A 1J5EO 1M5IA 3A5YA 5L3FA 3EFRA 1P7BA 5AG2A 1KU9A 1X2HA 4MVOA 3E83A 3MF2A 5H6QA 5L3CA 4B3SB 5JCOA 3HY0A 2N04A 4X1KA 1JFFB 2YXHA 2EAYA 3TJTA 1AI6A 4UVBA 3OTOB 3JAKB 1BQ0A 5IWAB 1I08A 3OFNG 1XMQB 4WF9V 1WU7A 4KP4A 3ASNC 5F2VO 2BTQA 3E8FA 1KKDA 1YIJV 4DPGA 3ZS8C 1VF7A 1L8DA 1ZLZA 4FIPC 3CB2A 3IGAC 3L71H 4MVRA 2AGAA 2PYLA 4UPAA 4LF5B 2JIZG 1KBHA 4WJ4A 2DKGA 3RGBA 3SPCA 4P3NA 5IYZA 4PA9A 4O2AB 3JATA 2AHYA 2BOCC 3DGEA 4CS2A 2B1IA 3V7RA 1WA8B 2Q9LA 4JI1O 1US6A 2Q69A 4LWSA 4YHHO 4WF2A 4UXNA 3A31A 2CJBA 4LBEC 4TV9B 1SKVA 1WYDA 4DV1O 4OPAA 3BHPA 2VQEB 1FYJA 3S3XA 3L74H 3UQ8A 2QWPB 2I4NA 4F6EA 2YICA 2DTOA 3AG3B 2RHSB 1N9WA 2VQFO 3W7TA 2ATKC 1ATIA 4OLFA 4W4KA 1QF6A 3QF7A 4YXWG 1URFA 4PDMA 1SA0A 3H1LH 4LF7B 2OIEA 1K3EA 2IH1C 2HP8A 2JVDA 2NN4A 4Z1VA 1N34O 4LF7O 1WPXA 4EFBA 1Q82W 1JMKC 5LBQA 1Q86W 3LSQA 1XNQB 3ICXA 3J81N 1TAEA 2FMLA 5IE9A 2ITCC 2VQEO 1JA8A 2WLNA 3OAAG 3P3NA 2DU5A 3E22A 3G80A 3A0RA 4DV1B 1QNMA 1XNQO 3CE2A 1I5XA 4TQFA 2G38A 4U3JA 1WNLA 4J80A 4AQYB 4IYHA 3VOUA 2P5IA 3K9SA 4L87A 2QSAA 1Y74B 1KD1W 3OR6C 4NXMO 3C90A 4QE9A 5LMUB 2ZE7A 3EVKA 1F7YA 3SYCA 5C93A 1ZAUA 3IKMB 1USYC 3LNNA 2DJZA 2Y0IA 2R9AA 4WFHA 3JAWA 4DV7B 1TGOA 2RMKB 3LDEA 4WBNA 1IBMO 2A9HA 2NS6A 2XHBA 2YI9A 3RYIA 2Y69B 2EIJC 3N27A 4GKJB 3O9OA 1ASZA 3WB2A 5B3SB 1G4YB 2XUMA 5KA5A 2EL9A 4UCOA 2ALYB 1TVKB 4OX9B 4LF5O 3AK2A 1GM7A 4TVWA 5C52B 4FLTA 2ZZEA 2OCHA 4GYCB 1FJGB 4LNUA 5CB4A 1SQXH 4YRMA 5LOVB 4IHJB 4U3JB 4K35A 5HFLA 5L3DA 4O4IA 4YJ3A 3OMNB 5IYBO 1R3LC 1XILA 4K88A 3SJAC 1PM9A 3WFVA 2GSMB 2BTOA 4UCSA 2RHSA 1K73W 3FYIB 1BZKA 1FXVA 4O2DA 4JI4O 2HNIA 1OCRC 5BMVB 4DR7B 5KA6A 1GM9A 1IBKB 5KAFZ 2CTPA 2C2AA 2WLMA 2YIBD 3OGIB 1AJNA 4GX2A 1GKFA 1FFTB 2KB1A 3ABKB 1UJWB 4NR1A 1ZUQA 4DQ2A 2LO1A 4TWKA 5CA0B 1M90W 2DEQA 5CN0A 1BE3H 3RGLA 5J2UA 3K5MA 4FLXA 3DC6A 2WLLB 4A5UB 4J9YB 4LVMA 3F7YC 2E5LB 2ZXWC 2ZKOA 1M1KW 1YTFB 3B8MA 3T4ZA 2OT5A 2ZD9A 4G85A 3D8CA 2AKWB 2NLJC 1NTKH 3AG1C 1USYA 5ELOA 5LYJA 1WB7A 4HWSA 1OCZB 1YJWV 1EZJA 1Y4MA 2R9IA 4PI0A 4N21A 4HVCA 1G5IA 4UCRA 2P4VA 4FMTA 3AG2B 4DV0O 5B1BC 1EFWA 1KP3A 3BA9A 4DR1B 1TUBA 5CBFA 2VQFB 4I55A 4DV4B 5A2QN 1GGMA 3FFQA 4I55B 4LF9O 4K87A 5E3IA 11ASA 2GHYA 4HBNA 1HW7A 1AI5A 4D7SA 1VQZA 2ZM6B 1AI7A 4UV8A 5JVDA 2PUSA 3L73H 4TVAB 2QWNB 3KFUA 2EINB 2XTIA 4EX5A 4I9QA 3A7AA 1VQ9V 2CE4A 3ZEDA 1ZSPA 4R6ZA 1S76D 3KZIZ 1AR4A 2AMCA 5KAIZ 4H2YA 3K06A 4JZGA 3ZHTA 1R3KC 1HR0B 2I4OA 2FYKA 3ZIAG 4MVQA 4PA4A 4JI8B 4GUNA 2FL4A 4HNAB 3B2EE 4TUYA 4DXWA 1QVGU 3ABUA 1C0AA 1Z2GA 2HJDA 2HEPA 1HWYA 3M8AA 1SZTA 1FXHA 3OT7A 2JGUA 4JAVA 3GWOA 1WB8A 1QR8A 1P4RA 1VEWA 3UH0A 5IWAO 5B5EZ 4ZTUB 1E1RG 1GM8A 4ZI7A 4DR4B 2DYSB 4FFBA 1GTOA 4DR2O 3EFFK 1TUEB 5EZYA 2JEXA 2XAJA 4ZTZB 3JD2A 4IL6Z 3FB6C 4P3PA 4B7KA 1WA8A 2NNUA 4JI6B 1I94B 5KHJA 5IT9N 4YJ2A 1Q6HA 2K1EA 1O9GA 1NBMG 2H94A 3D36A 4JAUA 3VQVA 1AR1B 2AZ0A 1N0JA 1THZA 1DGSA 2DU7A 1QR9A 4W4LA 1X55A 2YIBA 5LHHA 1VQ4V 1SQQH 5B66Z 4X1KB 1XBLA 4FVMA 4I50B 1OCOC 1X59A 2ZNIA 2EJFA 4JI3O 2WAMA 2ZE6A 2QJ1A 2JRIA 4MW3A 3HKCA 3PJSK 2QM4A 4JYAB 2DE0X 4DV2B 4CS3A 4CH3A 2XOKG 3LDCA 1AI4A 1S3JA 2MW2B 2PGGA 1HNWB 1LUWA 4YY3B 2BSKA 1M57C 4PDRA 1X56A 1H2MA 4MTFA 2F4VB 4FPPA 1S0VA 2UUBB 5LGUA 3Q4HB 4IYIA 2VWJA 1BT8A 3CRRA 4XDLA 1G51A 3V8JA 1VQ8V 2DQ3A 3TK1A 1PL0A 3RKXA 4ZOLB 4U3FH 1I94O 1UPGA 3HXWA 5JJEB 4DUZO 3HXXA 3LC0A 3SJBC 1B6QA 1JVMA 1H2NA 3RT3C 3UGTA 4DR2B 1Z5VA 5J2TA 3HXVA 3OTFA 4GKKB 3JAWB 3TEHB 3CMAV 1YEWA 1UFIA 5HGQA 3CCQV 1XI1A 3P8TA 3KCXA 3D36C 2ZE5A 2F43G 4ZI7B 1GN2A 3GWKC 1VQ6V 4KL1A 3REUA 3RFRA 1VF5B 3FB8C 5FPRA 1YSCA 4UCUA 5IJ0A 1SESA 1K8AW 2R9RB 4EB6A 3JYCA 4QPJA 1PV0A 2BSKB 4X1IA 2ETNA 3SPHA 5CB4B 3LSUA 3CEIA 3JALA 2DWEC 3SJQC 4IT5A 2UXBO 1PYSB 5DN6G 3R07A 3BAAA 2N74A 1BIAA 1VQPV 2EZPA 4I0XB 4P73C 3JD0A 5KNNA 4F4LA 2F4VO 3P30A 4GKKO 1N33B 2F66C 3RIRA 3JAMN 1N4CA 3FKSG 1H4SA 2WPDG 1IXMA 1GK9A 1VARA 2DOSA 3AG4B 4XTZA 4YROA 1WQ7A 2RN9A 4E51A 2Q68A 3HKBB 2ZT9B 3HKDA 1H2LA 4O4LA 3KKYA 1H4TA 2EJGA 4XTWA 1R6NA 3ABLC 3IAYA 2UXCB 2FB5A 4H2SA 4DRXA 4CH6A 3CJHB 2GDSA 4JV5B 1NZ6A 1RPOA 4O2BB 1Q7YW 3DC5A 4H2XB 2CTRA 2QKSA 1HNXO 1XNRB 3W7XA 3MAQA 4PJ0Z 4X65O 4H44B 2PY5A 4TV9A 2A7WA 2Q7GA 1PNMA 4XU2A 3ASOB 1TUBB 2Z3YA 1AVMA 4XTXA 3AK1A 1AJQA 4TWAA 3TEHA 5BR8B 1NR1A 2ODRD 4TVYA 1G1XB 4CC6A 2IM9A 2EJ7A 4K3AA 4JTCB 4Q15A 1SA0B 4FK5C 1L0NH 1XDCA 2CJ9A 1OCCC 4YRNA 1MG1A 3RYFA 3SPGA 1NJ8A 3L72H 3TGUH 4NTWA 4WFAV 4B3MO 1NVPB 4TV8B 4CC5A 1A32A 4G27B 4FLUA 2P06A 4EB6B 4NB5A 1VQNV 2DDZA 1FJGO 2PTMA 3A32A 1O9HA 5B1AC 1BBUA 4FLWA 4DUYB 1ORQC 5CA1A 4P75C 2EIKB 1LNQA 1KUQA 5LA6B 3HFZA 2EIMB 1YITV 1JFFA 1EN6A 4NXNB 4RQFA 2EIJB 4UB6Z 4BIZA 3DTUB 3T1YB 4H2WA 3JCUZ 4LNSA 3BJUA 2DW4A 3BVOA 4HAMA 3V7SA 3VQWA 2EX3A 4U7NA 2UXNA 1F51A 2A3QA 3B09A 4FLYA 1ZL8A 1ROPA 1K4CC 3CP1A 2E41A 2PMFA 3CSXA 4JI8O 3K5OA 1NVPD 3ZRXA 1NTMH 4NCXA 4LF8O 1HR0O 4DR3O 4WBNB 1YDXA 1KB9F 4X20B 3ZJZA 4DV4O 2P22C 1U97A 3L2ZA 4G28B 5ITZB 4J42A 1YFSA 5JQGB 4XEOA 3JARA 4X8AA 2FTKA 3E8BA 4BAYA 3K0DA 1JR9A 5LHIA 3W7WA 1YB3A 3AG4C 4JI7O 3SYQA 1WP8A 5LXTB 4HT4A 1PD3A 1SQBH 2ARTA 2OIGA 3TXSA 4LFAB 2E5LO 3RVYA 3HFVA 4YRKA 2B1GA 2DN9A 4H0LB 3HRIA 2PMEA 4DR1O 2D2CB 4I4TB 4HNAA 1QCEA 4DK1A 3JASA 3OM3B 5H2FZ 1EVKA 3CRAA 1H4VB 3A74A 2UU9B 4KQEA 3ABLB 3M99B 3AK3A 1P7GA 5L3EA 4YRGA 1HP8A 2ZQMA 4TTVA 1XOUA 4LVLA 1LUVA 1V54B 1S5LZ 4PHCA 2EIKC 2XTAA 1SQPH 5J2UB 3PN1A 1MNGA 3B40A 4LF6O 5IYZB 1QBZA 4X1YA 1GAXA 2V1DA 3C3SA 5LYJB 4I5SA 4FJCC 4R50A 3ZMZA 4D6TH 1SETA 5KLVH 1AP5A 1IBKO 3K5NA 2OTLV 1ADJA 1NJ6A 4YRSA 3FD9A 4YREA 2ARHA 3CRQA 4JI4B 1B7YB 4GKJO 4YIPA 1R3JC 5JJNB 2GTAA 4HWRA 5KHGA 5LGNA 1JQ0A 1M56B 2KSDA 1FAFA 1K34A 2NR5A 3N2KB 1LR1A 5B1BB 2E75B 4JI5B 3L4GA 4R8CA 1XMQO 1EN4A 3RYIB 3K03A 4U7OA 2QTSA 2LW1A 2C7IA 1OCZC 2IJIA 3SYAA 4NXMB 1COWG 3BA8A 4JTDB 5CA0A 3QO8A 4LVKA 2ZT6A 1QE0A 1YZBA 3T4DA 1E1OA 2MK3A 3A8TA 1VQ7V 3AG3C 1GN6A 5IY5B 2GUZB 4MVZA 3K04A 1NI8A 2AMCB 2HHHB 3STZC 1NTZH 3RYCB 4JI5O 4OPHA 2I4MA 2KG7A 2EJ9A 1EVLA 5A9GA 2XNDG 1R3IC 3A0BZ 2LP7A 1KC8W 3JD3A 4O4LB 1N34B 4X66B 4J7JA 3N2GA 1RSOB 1MOFA 2CUGA 5EZYB 1JJOA 5E1AC 4AQYO 1JJ2U 1K5SA 3TEGA 4LR3A 2JJ2G 5FNVA 3G4SV 1SRYA 2R70A 3L4GB 4P2ZA 1AJPA 4B08A 2EZOA 3GB7C 4JI0O 3SGIA 3G67A 4ZIBA 5CMUA 5JH7B 3A0HZ 2RNBA 3BY6A 4GX1A 4LH6A 1EN5A 2DMXA 2KKWA 2Q7EA 2FKXA 1K33A 3U0ZA 3OUFA 4X89A 4PG3A 1H38A 4LVJA 4EO4A 3X2QC 4FM1A 3CMQA 3REXA 1YJNV 4IHJA 5B1OA 3NETA 5C51B 4GCZA 3G6BA 2QR4A 1SQVH 3RWRD 1QLEB 4JPRA 2P7TC 1VQKV 2PZSA 3RF1A 4JYYA 4XTVA 4JI1B 2EILC 1BIBA 3A7RA 2WLHA 2CH7B 2XAGA 3HKDB 4LFAO 4J10A 3L75H 1SERA 2OWOA 2HVJC 3ABMB 3OTOO 1NU1H 1YF2A 3ZHRA 4ZHQA 3JALB 4KHPB 1YFTA 1HTTA 4DUYO 5K1PA 3L1AA 3E8HA 3D3QA 2GUZA 1Y66A 5EYPA 1KKCA 3TUPA 4I0XA 3VBBA 2YUAA 4YRPA 3A7UA 4UVCA 1Q90D 2GBOA 4B3MB 5F5WA 1FFXB 1KMIZ 2BTQB 4PELA 2WA3A 4RAIA 2V4DA 4WFGA 4WFBV 4FM2A 3G6EV 1FXKA 3IC9A 2CK3G 3SPIA 3F7VC 3H9VA 1I7FA 2JEUA 4RUFA 1LYLA 5E79Z 4B3TB 3HB3B 4BW9A 4LC1A 4PV1B 4LF4O 1L0WA 3CC7V 3OD1A 3OEEG 3W7UA 2YS8A 2A0LA 5IJ0B 3I55V 1XREA 4NXNO 3ZMSA 1E1TA 1IBLO 4P9PA 3U10A 1TVKA 3MDSA 4YRTA 4O2BA 4YYEA 4YJ2B 3K5LA 1XNRO 1F4NA 3M4QA 4O4HB 4X1IB 3CCUV 4JV5O 2A8EA 2IH3C 1N32O 2QHSA 3ZMTA 4G84A 1Z5WA 4NYKA 4NTYA 4BIUA 2QDOA 2CIMA 3PZCA 1Q3EA 3P32A 1BHBA 1YGBA 2D3OW 2DYSC 2HR3A 4JGSA 4Z2WA 3ICAA 1KOGA 5L3GA 3ZMUA 2IJKA 4UP7A 2QM7A 1FYFA 2VRZA 2Q8VA 5GTIZ 1N36B 1ZTEA 3RUXA 3ZCCA 4K0KB 3DXRA 2LW7A 5FLXN 4LFBO 3K58A 1MSWD 4LFCO 1FS0G 4QE7A 3ZN0A 1B70A 3TETA 5C53B 3OMAB 3W3SA 2ARUA 3E22B 2UXBB 2C8MA 3PCOA 1R6TA 1Q5OA 3GVMA 1HNZO 1QLEC 2E64A 2RDCA 1B8AA 1BL8A 2ODRC 1Y6XA 2KQXA 5EYPB 3QG5A 3TXQA 4QGPA 1EOVA 1CEZA 5GONB 1BMFG 3E9IA 3NEMA 2XAHA 1E24A 4XU0A 2XASA 4YCUA 3I56V 1D2DA 2WLKA 3BFMA 2UUCB 3CPWU 4DV5B 1KMNA 1MZFA 1V55C 1NJ1A 2L6LA 3M4PA 3ZN1A 2ARSA 2HVKC 1PNKA 4ABMA 2WLIA 1M9NA 2BOBC 2QM8A 4B3RO 5JJJB 3APOA 1KP2A 4H2TA 1SZXA 2HKOA 2JS3A 3IC7A 2UXDO 4LCUC 4CBCA 1WLEA 1Q43A 1NKDA 1SF9A 2PF4E 4JI2B 4O4HA 1JJCA 3W7SA 4AI8A 3ZRSA 1I0HA 4UUJC 2H8PC 2ZR2A 4PDLA 3HTZA 3SPJA 1H8HG
chains in the Genus database with same CATH topology
1WNLA 2P6JA 2EIMB 3NELA 1YITV 4YRRA 1PYSA 3VOUA 2P5IA 4WI1A 1VQOV 3I7FA 2AKWA 3AG2C 5CA3A 4RQFA 2EIJB 4BIZA 1YTFD 4PA6A 1NJ5A 3DTUB 4LP8A 3HXZA 4L87A 4TQDA 4H2WA 2EILB 4LNSA 3RKWA 5B1NA 1KD1W 3OR6C 4XDKA 1Z7MA 2DW4A 3H01A 4HAMA 2DXUA 4QE9A 4OP0A 2YSUB 1CPYA 4EKWA 3V7SA 3VQWA 4U7NA 2UXNA 2ZCEA 3SYCA 5C93A 1F51A 5HFMA 1ROPA 1YJ9V 3IKMB 1W0KG 1K4CC 1NYQA 3CP1A 1USYC 2E41A 3CC4V 2PI4A 3CCSV 2PMFA 1OZ0A 1NVPD 3ZRXA 4LVIA 4NCXA 2DJZA 4XBFA 4WFHA 3ETDA 1EFRG 5KUMA 2J3MA 3FB7C 2EWNA 3CMEV 3LDEA 3ZJZA 3EFSA 3A5ZA 4QPKA 2WWWA 1OCOB 2HJFC 3L2ZA 3ZRWB 4H2UA 2ZDIA 4G28B 2A9HA 4WFFA 1YFSA 2NS6A 3HXUA 4XEOA 3V8LA 2HLDG 4X8AA 2FTKA 2WLLA 2Y69B 3E8BA 1E79G 4BAYA 3K0DA 4YPFA 1J95A 2EIJC 3ETGA 5LHIA 2ZDIC 1Z7NA 1ASZA 5B3SB 2OCCB 3G1ZA 1G4YB 5KA5A 3W7WA 1JX9A 1YB3A 3AG4C 2EL9A 4RUEA 3SYQA 1H4QA 3E86A 3F5WC 3B77A 4MS2A 2ALYB 4WJ3M 3UFGA 4HT4A 4TSFG 1M56C 4KR2A 3ASNB 1V55B 4Q20A 1VQMV 5B3SC 1PD3A 2RHQB 3BJUA 3MF1A 4GX0A 4PA3A 1GM7A 4TVWA 1S5HC 2ZZEA 5C52B 1J5WA 2ARTA 4UP8A 2UXXA 4YRMA 3RVYA 3CCMV 3HFVA 2A79B 3FB5C 4MT8A 2B5UA 4YRKA 2E3CA 5HFLA 5L3DA 1K92A 3SYPA 2B1GA 5IYBO 3OMNB 1R3LC 3CCVV 3T1CA 3HRIA 4K88A 3FJPA 2PMEA 2DTIA 3WFVA 2GSMB 2QTOA 4XDJA 2RHSA 1K73W 1WPYA 5CBGA 1QCEA 3FYIB 1FXVA 4O2DA 3OM3B 1EVKA 2HNIA 1H4VB 3FYEB 3A74A 1DF5A 1G5HA 1OCRC 4P72A 3ERRA 5KA6A 3P8VA 1GM9A 3K3WA 2G4CA 4KQEA 3ABLB 2WLMA 2C2AA 4PA7A 3M99B 2E65A 5L3EA 3WG7C 1AJNA 4GX2A 1GKFA 1FFTB 3OMIB 3P8YA 2KB1A 3ABKB 1UJWB 4DQ2A 4YRGA 1CP9A 2X0LA 2Y48A 2ZQMA 4TWKA 4TTVA 2HG5C 4DO2A 1XL4A 1V54B 2DWDC 1EBOA 1M90W 2ZZGA 4LVLA 2DEQA 5CN0A 4PHCA 1JJCB 2ZT7A 1R6KA 2IY5B 4R7CA 2Q7HA 3OGCC 4OXSA 4QNHB 3WG7B 2EIKC 1B70B 3CD6V 1NNHA 3RGLA 4QIWF 2AHZA 1MABG 2WLLB 2ZT5A 4J9YB 2J3LA 1OCRB 4LVMA 3F7YC 2ZXWC 3OE7G 1M1KW 5L3BA 2YEVA 1YTFB 3B8MA 1QBZA 1H2GA 1PNLA 3T4ZA 2OT5A 2ZD9A 3BEHA 4KFMA 3ZMVA 2V1DA 4G85A 4P3OA 2AKWB 2NLJC 4I5SA 5IYDO 5EC2C 3AG1C 4FJCC 3R65A 4R50A 1USYA 2ZINA 5ELOA 3ZMZA 2ZTGA 4P74C 1SETA 4H2XA 2OTLV 1OCZB 1YJWV 1EZJA 1ADJA 4HWSA 1NJ6A 1Y4MA 2R9IA 2X6CA 4YRSA 4N21A 4YREA 3OR7C 1E22A 2WSSG 4P72C 1B7YB 1G5IA 4BWAA 4HVCA 4YRIA 4FMTA 1EQRA 1RIQA 1FXKB 4P75A 2HFEC 1ASYA 1R3JC 3AG2B 4HWRA 5B1BC 2ZGWA 1KP3A 1EFWA 1I5YA 5LGNA 1JQ0A 3RBZA 4Z1MG 2E10A 4HWPA 1K7DA 4MVUA 5CBFA 4CS4A 3LSSA 1GGMA 1M56B 1K34A 4K87A 5E3IA 4HYOA 11ASA 5B1BB 2GHYA 1RM1C 5GW7A 3L4GA 2DTHA 1AI5A 3QO7A 3MD0A 1VQ5V 4R8CA 1VQZA 3IKLA 1AI7A 4UV8A 3ML0A 3K03A 4KR3A 4U7OA 2CGHA 2JJ1G 2DYRB 2C7IA 1X2GA 1OCZC 2IJIA 3E89A 3K79A 3SYAA 4YRCA 4RDXA 2Z5UA 4GT1A 4TVAB 3KFUA 4YCVA 2EINB 2XTIA 4G2KA 4TVAA 1COWG 4JTDB 4AH6A 1W66A 3UGQA 4EX5A 5EC1C 3A7AA 3QO8A 2DZ9A 4Q6GA 2E5AA 1VQ9V 4LVKA 2ZT6A 3RKYA 2IY5A 1DF4A 1DLBA 4GX5A 1QE0A 2XGTA 1H8HG 3T4DA 4HWTA 4R6ZA 1E1OA 4K86A 1K4DC 2MK3A 1VQ7V 2EINC 3AG3C 1S77D 1S76D 1BBWA 5IY5B 2ZT8A 2AMCA 3CCRV 4MVZA 4H2YA 3K06A 2DYRC 3K04A 4WCEV 2E1HA 2AMCB 1R3KC 3STZC 2I4OA 2FYKA 4PDVA 3ZIAG 5LHGA 4MVQA 4PA4A 3ASOC 4ASUG 1NQTA 3ABKC 5H9CA 3UKMA 2LFSA 2I4MA 3CYOA 2CJAA 2ZIOA 2EJ9A 3EHBB 3G71V 4DXWA 3NENA 1QVGU 3ABUA 2IW5A 5KUKA 1B7YA 1C0AA 1EVLA 4JTAB 2ZZFA 1QVFU 3ABMC 3RW0A 2XNDG 1HWYA 1R3IC 1SZTA 1FXHA 2ITDC 2LP7A 4KUMA 5EBLC 2Q67A 5B1AB 3JD3A 1KC8W 3QNEA 4ZKIA 4JAVA 3GWOA 3CXCU 1QR8A 1MOFA 3KG2A 1HXDA 1P4RA 2DVEA 3UH0A 4ZTUB 1E1RG 1H8EG 4MTXA 1GM8A 4UV9A 1LNQA 1R73A 2DYSB 1GTOA 5E1AC 3ETEA 1JJ2U 3EFFK 1TUEB 4YCWA 1K5SA 1YFRA 3HFZA 2JEXA 2XAJA 2M7WA 4MTGA 2JJ2G 3TEGA 1EIYA 3PCOB 3QO5A 4YDQA 3JD2A 4ZTZB 3JCZA 3G4SV 3MEYA 1SRYA 2QHUA 12ASA 3L4GB 1OHHG 3FB6C 4P2ZA 2P0LA 1AJPA 2NNUA 2ZIMA 2EZOA 3GB7C 2ZXFA 4P3PA 1B76A 3ZRVA 4ZIBA 5CMUA 2K1EA 4XTUA 3BY6A 4GX1A 1PKXA 1NBMG 2H94A 2W6JG 3D36A 2Q7EA 4JAUA 3VQVA 1AR1B 4P9OA 3X2QB 1THZA 1K33A 3OUFA 4X89A 3SYOA 4RQEA 2DU7A 1QR9A 5CBHA 4E2LA 1VQ4V 5LHHA 3CC2V 1X55A 4PG3A 1V54C 1H38A 2QHTA 4LVJA 1S72V 1WQWA 1BHAA 4EO4A 2QE7G 2ZR3A 3D3IA 5BZBA 4HA8A 3UM7A 3X2QC 1OCOC 2IJHA 2ZNIA 5IY5C 2EJFA 3CMQA 3REXA 5IYCO 3HXYA 2WAMA 2P67A 1YJNV 3HY1A 4H02A 5B1OA 3NETA 5C51B 3RVZA 1NR7A 1W0JG 4N23A 3CCLV 4GCZA 4MVSA 2Q5IA 1QLEB 4MW3A 1Q81W 3PJSK 4JPRA 4JYCA 2P7TC 3T2MA 4H2VA 4CS3A 3LDCA 2XOKG 4CH3A 1AI4A 1S3JA 1VQKV 1XL6A 2Q6AA 3LNMB 3RF1A 5K1XA 1VQLV 4XTVA 2JK5C 2EILC 2WLJA 1JOYA 2X6AA 2WLHA 1BIBA 3A7RA 3HRKA 2XAGA 4P73A 1F4MA 5H6RA 3MQZA 1M57C 4PDRA 1E1QG 1X56A 2Q5HA 3STLC 1RM1B 4MTFA 4YRFA 1ENVA 4FPPA 2QA4V 1SERA 1S0VA 4YRQA 4I9WA 2ZNJA 5LGUA 1QLNA 2HVJC 3ABMB 3B8NA 1EIYB 2EIMC 2X7RB 3DSQA 3RACA 3OEHG 1DTOA 1YFTA 1HTTA 4YRLA 1ZWIC 5K1PA 1G51A 4XDLA 5IDJA 3K08A 3V8JA 3OUSA 1VQ8V 3L1AA 4CH4A 2DQ3A 3E8HA 3TK1A 1JCHA 1PL0A 2OCCC 2V7QG 5DM6V 4YP0A 3RKXA 1FXKC 5LGTA 1Y66A 3TUPA 2IU3A 3VBBA 3HXWA 2Y69C 4YRPA 3A7UA 4UVCA 4X88A 3WQZA 4XTYA 3HXXA 1NJIW 3LC0A 4MVMA 4MW8A 1B6QA 5F5WA 1NH2B 1JVMA 3UGTA 1JPXA 3HXVA 3AG1B 4PELA 1K5QA 3V8KA 4RAIA 2I4LA 4WFGA 4UP9A 2XAFA 1OCCB 3TEHB 3CMAV 3LUTB 4WFBV 4MTOA 3E35A 2DQ0A 5HGQA 3G6EV 1FXKA 1K97A 4P30A 3CCQV 1N8RW 2CK3G 3SPIA 1X54A 3P8TA 3F7VC 3QTCA 2F43G 3CCEV 2JEUA 4RUFA 2OTJV 3AEIA 4P71C 1LYLA 4H33A 2WLIB 3HB3B 4BW9A 3RL6A 4LC1A 1VQ6V 4JASA 2W6IG 1L0WA 4BW5A 1NJ2A 3CC7V 3REUA 4ZBMA 3OD1A 3OEEG 3W7UA 2A0LA 3FB8C 3I55V 4QJFB 1M57B 1YSCA 1KQSU 3ZMSA 2PI5A 1E1TA 2ALYA 4P9PA 2IJJA 3JD1A 3V7CA 1SESA 1K8AW 4YRTA 4YYEA 2R9RB 3JYCA 1F4NA 2XAQA 4QPJA 3M4QA 2JDIG 4HWOA 2W0FC 4CZZA 3VQYA 3SPHA 4P71A 3CCUV 3A5YA 5L3FA 3EFRA 2A8EA 2IH3C 4MSWC 2QHSA 3ZMTA 3LDDA 3MHHC 1NH2D 4G84A 3IALA 4XU1A 1X2HA 4MVOA 3E83A 4BIUA 3HFZB 3MF2A 2DWEC 5H6QA 5L3CA 4WFEA 3SJQC 2CIMA 1PYSB 3PZCA 3P32A 1YGBA 5DN6G 1BHBA 3HY0A 2D3OW 2DYSC 2HR3A 2EAYA 4JGSA 4HZ3A 3R07A 3K0GA 1AI6A 2P90A 4UVBA 3ICAA 1KOGA 5L3GA 1BIAA 1VQPV 2EZPA 3OFNG 4P73C 3JD0A 3ZMUA 4F4LA 2IJKA 3P30A 5KNNA 4WF9V 4UP7A 2QM7A 4J15A 3RIRA 1YI2V 1FYFA 1WU7A 4P74A 1RPRA 3ASNC 4KP4A 3FKSG 1IL2A 4RO2A 1H4SA 2WPDG 1ADYA 3RUXA 1IXMA 1GO3F 1GK9A 3E8FA 1L1FA 3ZCCA 1YIJV 2QEXV 1KKDA 3AG4B 4DPGA 4XTZA 4YROA 1WQ7A 4XEMA 4FIPC 4X5OA 4E51A 5FL7G 2Q68A 1FS0G 3IGAC 4MVRA 4QE7A 4TT3G 3ZN0A 1K9MW 1MSWD 4RMFA 1B70A 3NXSA 2EJRA 3TETA 2X6BA 1H4TA 1X01A 4UPAA 5C53B 3ABTA 2JIZG 3OMAB 2EJGA 3W3SA 4XTWA 2ARUA 3MHSC 1R6NA 3ABLC 4WJ4A 3E9HA 2DKGA 4H2SA 2C8MA 4CH6A 4JF3A 3SPCA 2YEVB 3CCJV 4PA9A 4P3NA 4JYBA 3PCOA 2AHYA 1QLEC 2BOCC 3DGEA 1B8AA 2IU0A 2E64A 4CS2A 1BL8A 2B1IA 1RPOA 2ODRC 3V7RA 1Q7YW 3K9AA 4J9ZB 2ZXWB 1YHQV 4H2XB 1KECA 4H37A 2QKSA 4CH5A 3VQXA 2RHQA 2Q69A 1KMMA 3E8GA 1EOVA 4WF2A 4UXNA 3W7XA 1CEZA 4LBEC 2CJBA 3A31A 5J9PC 1HC7A 1BMFG 1WYDA 3E9IA 3NEMA 2XAHA 1E24A 4YRJA 2Q7GA 1PNMA 2XASA 3ASOB 1W2BU 4XU2A 4XU0A 2Z3YA 4XTXA 4YCUA 3I56V 2WLKA 5EBWC 3BFMA 1AJQA 4TWAA 3TEHA 3CPWU 3OW2U 2I4NA 1NYRA 1KMNA 1V55C 1NR1A 3IFXA 1NJ1A 2ODRD 3M4PA 4TVYA 3ZN1A 2DTOA 3AG3B 2RHSB 2ARSA 2HVKC 1PNKA 4JTCB 3W7TA 1N9WA 2ATKC 1ATIA 2QHVA 4OLFA 4Q15A 5ELNA 4FK5C 4XU3A 1QF6A 3ZRWA 4YXWG 2WLIA 1M9NA 4PDMA 2CJ9A 2DZCA 1OCCC 2BOBC 2QM8A 1K3EA 2IH1C 3HPLC 4YRNA 1MG1A 3SPGA 1NJ8A 1KP2A 1F23A 1WPXA 5EBMC 1Q82W 2DXTA 4H2TA 3IG2A 1G8MA 2EBOA 2HKOA 3IC7A 4WFAV 5LBQA 1NVPB 1Q86W 4LCUC 1GMGA 4CBCA 1WLEA 3LSQA 4G27B 1NKDA 1VQNV 3TCUA 2DDZA 1AROP 1JJCA 3W7SA 2ITCC 5EK0A 3ZRSA 3A32A 3JD4A 2H8PC 4UUJC 2WLNA 4UVAA 3OAAG 5B1AC 1BBUA 2DU5A 2ZR2A 3A0RA 4PDLA 1ORQC 4P75C 3HTZA 2LFRA 3E2EA 3SPJA 2EIKB 1I5XA 4TQFA 1P7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNL A;  3NEL A;  4YRR A;  1PYS A;  2P5I A;  4WI1 A;  3I7F A;  2AKW A;  4RQF A;  1NJ5 A;  4TQD A;  3HXZ A;  4L87 A;  4H2W A;  4LNS A;  3RKW A;  3BJU A;  1Z7M A;  4OP0 A;  2DXU A;  3V7S A;  3VQW A;  2ZCE A;  3IKM B;  1NYQ A;  2E41 A;  1USY C;  2PMF A;  4NCX A;  2DJZ A;  2J3M A;  2EWN A;  3EFS A;  3A5Z A;  3L2Z A;  4H2U A;  4XEO A;  1YFS A;  3V8L A;  3HXU A;  4YPF A;  1Z7N A;  1ASZ A;  3G1Z A;  1YB3 A;  2EL9 A;  1H4Q A;  4WJ3 M;  2ALY B;  3UFG A;  4KR2 A;  2RHQ B;  3MF1 A;  5C52 B;  4TVW A;  2ZZE A;  1J5W A;  2ART A;  4YRM A;  3HFV A;  4YRK A;  2E3C A;  3HRI A;  4K88 A;  3FJP A;  2PME A;  2DTI A;  2RHS A;  1WPY A;  4O2D A;  1EVK A;  2HNI A;  1H4V B;  3A74 A;  1G5H A;  4P72 A;  3ERR A;  3P8V A;  2G4C A;  4KQE A;  2E65 A;  3P8Y A;  4YRG A;  4DQ2 A;  4TTV A;  2ZZG A;  2DEQ A;  4PHC A;  1JJC B;  2ZT7 A;  2IY5 B;  2Q7H A;  1B70 B;  1NNH A;  3RGL A;  2ZT5 A;  2J3L A;  4G85 A;  4P3O A;  2AKW B;  1USY A;  2ZIN A;  5ELO A;  2ZTG A;  4P74 C;  1SET A;  4H2X A;  4HWS A;  1ADJ A;  1NJ6 A;  4YRS A;  4YRE A;  1E22 A;  4P72 C;  1B7Y B;  1G5I A;  4BWA A;  4HVC A;  4YRI A;  1EQR A;  1RIQ A;  4P75 A;  1ASY A;  4HWR A;  2ZGW A;  1EFW A;  4HWP A;  2E10 A;  4CS4 A;  3LSS A;  1GGM A;  4K87 A;  5E3I A;  11AS A;  3L4G A;  2DTH A;  3QO7 A;  1VQZ A;  3IKL A;  4KR3 A;  2CGH A;  2C7I A;  1X2G A;  4RDX A;  4YRC A;  4TVA B;  3KFU A;  4YCV A;  2XTI A;  4TVA A;  4AH6 A;  4EX5 A;  1W66 A;  3UGQ A;  3A7A A;  3QO8 A;  2DZ9 A;  4Q6G A;  2E5A A;  3RKY A;  2ZT6 A;  2IY5 A;  1QE0 A;  2XGT A;  4HWT A;  1E1O A;  4K86 A;  1BBW A;  2ZT8 A;  2AMC A;  4H2Y A;  2E1H A;  2AMC B;  2I4O A;  2FYK A;  2I4M A;  2CJA A;  2ZIO A;  2EJ9 A;  3NEN A;  1B7Y A;  1C0A A;  1EVL A;  2ZZF A;  2Q5I A;  3QNE A;  1HXD A;  2DVE A;  3UH0 A;  4ZTU B;  4UP8 A;  4YCW A;  1YFR A;  3TEG A;  1EIY A;  3PCO B;  3QO5 A;  4YDQ A;  4ZTZ B;  3MEY A;  1SRY A;  2QHU A;  12AS A;  3L4G B;  2ZIM A;  2P0L A;  4P3P A;  2ZXF A;  1B76 A;  4ZIB A;  4XTU A;  2Q7E A;  3VQV A;  4RQE A;  2DU7 A;  1X55 A;  4PG3 A;  2QHT A;  1WQW A;  4EO4 A;  2ZR3 A;  4HA8 A;  2ZNI A;  2EJF A;  3CMQ A;  3REX A;  3HXY A;  3HY1 A;  4H02 A;  3NET A;  5C51 B;  4H2V A;  4CS3 A;  4CH3 A;  3RF1 A;  5K1X A;  4XTV A;  1BIB A;  3A7R A;  3HRK A;  4P73 A;  1X56 A;  2Q5H A;  4YRF A;  1SER A;  4YRQ A;  2ZNJ A;  1EIY B;  3DSQ A;  3RAC A;  1YFT A;  1HTT A;  4YRL A;  5K1P A;  1G51 A;  3V8J A;  4CH4 A;  3L1A A;  2DQ3 A;  3RKX A;  4YP0 A;  3TUP A;  3VBB A;  3HXW A;  4YRP A;  3A7U A;  3WQZ A;  4XTY A;  3HXX A;  3LC0 A;  5F5W A;  3UGT A;  3HXV A;  3V8K A;  2I4L A;  4UP9 A;  3TEH B;  5HGQ A;  2DQ0 A;  3P8T A;  1X54 A;  3QTC A;  4P71 C;  1LYL A;  4BW9 A;  3RL6 A;  1L0W A;  1NJ2 A;  3REU A;  3OD1 A;  1E1T A;  2ALY A;  3V7C A;  1SES A;  4YRT A;  4YYE A;  4HWO A;  3M4Q A;  3VQY A;  4P71 A;  3A5Y A;  3EFR A;  4XU1 A;  2QHS A;  4G84 A;  3IAL A;  1X2H A;  3HFZ B;  3MF2 A;  2CIM A;  1PYS B;  3PZC A;  1YGB A;  3HY0 A;  3R07 A;  2EAY A;  3ICA A;  1KOG A;  1BIA A;  4P73 C;  5KNN A;  4UP7 A;  4J15 A;  3RIR A;  1FYF A;  1WU7 A;  4P74 A;  1IL2 A;  1H4S A;  1ADY A;  3RUX A;  4DPG A;  4XTZ A;  4YRO A;  1WQ7 A;  4XEM A;  4X5O A;  4E51 A;  4RMF A;  1B70 A;  1H4T A;  1X01 A;  4UPA A;  5C53 B;  2EJG A;  3W3S A;  4XTW A;  2ARU A;  4WJ4 A;  3E9H A;  2DKG A;  4H2S A;  2C8M A;  4CH6 A;  4P3N A;  3PCO A;  2E64 A;  1B8A A;  4CS2 A;  2ODR C;  3V7R A;  4H2X B;  4CH5 A;  3VQX A;  2RHQ A;  1KMM A;  1EOV A;  4WF2 A;  3A31 A;  2CJB A;  1HC7 A;  3E9I A;  1WYD A;  3NEM A;  1E24 A;  4YRJ A;  2Q7G A;  4XU0 A;  4XU2 A;  4XTX A;  4YCU A;  3BFM A;  4TWA A;  3TEH A;  2I4N A;  1NYR A;  1KMN A;  1NJ1 A;  2ODR D;  3M4P A;  4TVY A;  2DTO A;  2RHS B;  2ARS A;  1N9W A;  4Q15 A;  5ELN A;  1ATI A;  2QHV A;  4OLF A;  4XU3 A;  1QF6 A;  2DZC A;  2CJ9 A;  4YRN A;  1NJ8 A;  2DXT A;  4H2T A;  3IG2 A;  3LSQ A;  1WLE A;  2DDZ A;  1JJC A;  3A32 A;  2DU5 A;  1BBU A;  2ZR2 A;  4P75 C;  3HTZ A;  3HFZ A;  4TQF A; 
#chains in the Genus database with same CATH topology
 1B06 A;  2P6J A;  4O4I B;  5C8Y A;  3NEL A;  4YRR A;  4YJ3 B;  3RYH B;  1VQO V;  3I7F A;  2AKW A;  5CA3 A;  5KHH A;  1Y74 A;  4PA6 A;  1NJ5 A;  4LP8 A;  4TQD A;  3HXZ A;  3RKW A;  2EIL B;  1HNW O;  4X64 B;  3BPZ A;  2YSU B;  1CPY A;  4EKW A;  5H5N A;  5BMV A;  2ZCE A;  4JYA O;  1AP6 A;  5HFM A;  1YJ9 V;  1W0K G;  4UB8 Z;  1NYQ A;  1FFX A;  2PI4 A;  3CCS V;  3CS5 A;  4LVI A;  4XBF A;  1EFR G;  2F23 A;  4J7K A;  5LMN O;  2ZDI A;  1T5E A;  4JAA A;  3V8L A;  4JZ2 A;  3HXU A;  2HLD G;  1E79 G;  5JQG A;  2ADQ B;  3ETG A;  4O2A A;  1Z7N A;  5LL6 Y;  3JAT B;  3G1Z A;  1JX9 A;  4RUE A;  3CRM A;  3B77 A;  3F5W C;  3L70 H;  1M93 A;  2BE3 A;  1M56 C;  3ASN B;  3L9D A;  1V55 B;  4Q20 A;  3U11 A;  5B3S C;  4X9Q A;  3MF1 A;  4GX0 A;  4PA3 A;  1S5H C;  2YXY A;  1GN4 A;  4LFC B;  2UXX A;  2FYU H;  5CA1 B;  3CCM V;  4MT8 A;  2E3C A;  1IDS A;  3SYP A;  1K92 A;  4K0K O;  2CGN A;  2Q0O C;  2A06 H;  3CCV V;  4I4T A;  1R1B A;  5CBG A;  4DR5 O;  1XMO B;  4J11 A;  1DF5 A;  1YXB A;  3P8V A;  2CH7 A;  2G4C A;  5D5P A;  4PA7 A;  3UT5 B;  2E65 A;  3P8Y A;  1RSO A;  1CP9 A;  2X0L A;  5IJ9 B;  2Y48 A;  4DO2 A;  2ZZG A;  1XL4 A;  2Y4U A;  2JGD B;  1JJC B;  2ZT7 A;  1R6K A;  1Y67 A;  2Q7H A;  3WG7 B;  3RN4 A;  3CD6 V;  4QIW F;  1MAB G;  2J3L A;  5L3B A;  2YEV A;  1PNL A;  1D5A A;  3BEH A;  4LH7 A;  3RYC A;  4P3O A;  4X1Y B;  5EC2 C;  3R65 A;  2ZIN A;  2ZTG A;  4P74 C;  3ZHQ A;  4O4J B;  3OR7 C;  2WSS G;  1U96 A;  5KX5 B;  4BR6 A;  4P72 C;  4LNU B;  4BWA A;  1RIQ A;  1FXK B;  5LOV A;  4B3R B;  1I5Y A;  4LF9 B;  4HWP A;  4I7Z B;  4CS4 A;  3LSS A;  1XEQ A;  1VQ5 V;  3IKL A;  1YCI A;  3T1H O;  3E89 A;  4RDX A;  2Z5U A;  4E4E A;  4YCV A;  5IJ9 A;  4G2K A;  1P84 F;  4AH6 A;  1W66 A;  1MZE A;  5EC1 C;  2E5A A;  3CWB H;  2IY5 A;  2N05 A;  1DF4 A;  1DLB A;  4GX5 A;  2XGT A;  2Q4P A;  4EEQ A;  2LJ2 A;  4K86 A;  1K4D C;  3JAK A;  4FLZ A;  4I50 A;  3ETQ A;  5DEC A;  2DYR C;  4WCE V;  2E1H A;  4PDV A;  2CTW A;  5LHG A;  3ASO C;  1NQT A;  2KG7 B;  1TA8 A;  2UUA O;  2CGO A;  2CTQ A;  5H9C A;  2LFS A;  3UKM A;  5BY1 A;  4LFB B;  3O65 A;  2CJA A;  3EHB B;  2QWO B;  4DR7 O;  1B7Y A;  1Q8I A;  5KUK A;  1N36 O;  4JTA B;  4NVP A;  3ABM C;  3RW0 A;  4Z1M G;  3N2G B;  2Q5I A;  5B1A B;  5EBL C;  2QWQ B;  1DK1 A;  3KG2 A;  1HXD A;  4AHC A;  4UV9 A;  3UO3 A;  4UP8 A;  1R73 A;  1B04 A;  3ETE A;  2M7W A;  5DED A;  3QO5 A;  4YDQ A;  3MEY A;  2QHU A;  1OHH G;  2ZIM A;  2P0L A;  4RWU A;  3H1H H;  5LP6 B;  1N32 B;  3P3P A;  3BFR A;  4LWS B;  3JSL A;  3ZBH A;  2HHH O;  4XTU A;  4OX9 O;  2W6J G;  2QKA A;  1RP3 B;  1ZX3 A;  4DV6 O;  3APQ A;  3X2Q B;  1EZV H;  1QU7 A;  1IBL B;  4X66 O;  1V54 C;  1S72 V;  1WQW A;  1BHA A;  2QE7 G;  2F1M A;  5BZB A;  4FZ0 A;  2LGW A;  3UM7 A;  3KCY A;  1H2S B;  5IY5 C;  4B3T O;  5IYC O;  4H02 A;  4IIJ B;  3S3W A;  1NR7 A;  4N23 A;  3FAV A;  3RYF B;  4MVS A;  4J41 A;  3WU2 Z;  5KMG A;  3T2M A;  3HKC B;  4DV3 B;  1YVW A;  3WB0 A;  1XL6 A;  2WLJ A;  3HRK A;  4IGG A;  5H6R A;  4GLX A;  3MQZ A;  3B4S A;  1RM1 B;  4YRF A;  4YRQ A;  4FFK A;  4I9W A;  1QHT A;  1QLN A;  3B8N A;  2QKC A;  2EIM C;  5C8Y B;  2JGD A;  3RAC A;  4KHP O;  1FD9 A;  4YRL A;  1MMM A;  2AW9 A;  5IDJ A;  3K08 A;  4PD4 F;  4CH4 A;  2OCC C;  2V7Q G;  3SJC C;  1QQC A;  2IU3 A;  1B3Q A;  5LP6 C;  2F95 B;  2YDE A;  4XTY A;  1NJI W;  4MW8 A;  1IBM B;  1NH2 B;  3SR2 C;  1K5Q A;  3V8K A;  1SC5 B;  4DV7 O;  1VMG A;  4UP9 A;  2XAF A;  1OCC B;  2Q5Z A;  3LUT B;  4MTO A;  3E35 A;  1K97 A;  1N8R W;  4P30 A;  2YC0 A;  4YIO A;  3CCE V;  5ITZ A;  5LMU O;  4P71 C;  3ZX6 A;  4X62 O;  3RL6 A;  1XUQ A;  5JCO C;  4DRX B;  2ZE8 A;  4GZR B;  4QJF B;  4FLV A;  1M57 B;  3JD1 A;  3BAB A;  5FPO A;  2BCC H;  4YHH B;  2JDI G;  4UCV A;  2W0F C;  4CZZ A;  3VQY A;  4P71 A;  1BQZ A;  1WNS A;  4K8X A;  4MSW C;  4XU1 A;  1NH2 D;  3LDD A;  3MHH C;  3IAL A;  2ODM A;  2Z0A A;  3HFZ B;  1SQF A;  1P49 A;  4WFE A;  4X62 B;  1D5N A;  3T1H B;  4HZ3 A;  4AIL C;  3K0G A;  5D5Q A;  1PL4 A;  2P90 A;  4TOI A;  5EIB D;  4J15 A;  1YI2 V;  4P74 A;  1RPR A;  3DXR B;  4DK0 A;  4RO2 A;  1IL2 A;  1ADY A;  2AZ2 A;  1GO3 F;  1L1F A;  2QEX V;  2L35 A;  4DV3 O;  1HDJ A;  3HKB A;  4XEM A;  4X5O A;  5FL7 G;  1K9M W;  4RMF A;  4TT3 G;  3NXS A;  2H3O A;  2EJR A;  2X6B A;  1X01 A;  3ABT A;  3MHS C;  3E9H A;  4JF3 A;  3CCJ V;  2YEV B;  1OJH A;  4JYB A;  3UO2 A;  2IU0 A;  3RYH A;  1IZ3 A;  4ZOL A;  3K9A A;  4J9Z B;  2ZXW B;  1YHQ V;  1J5E B;  2PYJ A;  1KEC A;  4UFZ A;  4H37 A;  4O4J A;  4CH5 A;  3JSN A;  3VQX A;  2RHQ A;  2DJV A;  1KMM A;  3E8G A;  1PP9 H;  1VP7 A;  5J9P C;  1W59 A;  1HC7 A;  4DR3 B;  4YRJ A;  5GON A;  4EFE A;  1W2B U;  5EBW C;  3J7A U;  1FPO A;  3OW2 U;  1NYR A;  3IFX A;  5ELN A;  2QHV A;  3T1Y O;  4XU3 A;  3ZRW A;  1GN3 A;  2DZC A;  3HPL C;  2YID A;  5EBM C;  1F23 A;  1MSD A;  2DXT A;  3IG2 A;  1G8M A;  2EBO A;  4DV6 B;  2QGN A;  1WJZ A;  1GMG A;  3H1I H;  4B3S O;  3FX7 A;  1Y76 B;  4NKG B;  3TCU A;  3THO A;  1ARO P;  3R66 A;  2UUA B;  5EK0 A;  4LF6 B;  2Y0P A;  3JD4 A;  4UVA A;  3CRC A;  5KHI A;  2LFR A;  3E2E A;  1YTF D;  1PYS A;  2JS5 A;  4WI1 A;  3AG2 C;  2Q73 A;  3NR7 A;  3OD4 A;  5B1N A;  1Z7M A;  4XDK A;  2DXU A;  4OP0 A;  3H01 A;  1ZL8 B;  3BRC A;  1N0N A;  2P5O A;  3HKE B;  1VF6 C;  2UU9 O;  5J2T B;  3CC4 V;  1OZ0 A;  1GH6 A;  3ETD A;  5KUM A;  4X65 B;  2J3M A;  3FB7 C;  2EWN A;  2P4K A;  3CME V;  3EFS A;  3A5Z A;  4QPK A;  2WWW A;  1OCO B;  2HJF C;  1HNX B;  1S5J A;  3ZRW B;  4H2U A;  3WB1 A;  4WFF A;  1MA1 A;  5LP6 A;  3H1J H;  2WLL A;  1WP7 A;  2R72 A;  4YPF A;  1J95 A;  1H2K A;  2ZDI C;  2OCC B;  1H4Q A;  3E86 A;  4MS2 A;  4WJ3 M;  3UFG A;  4TSF G;  4KR2 A;  2LQT A;  1VQM V;  4JI7 B;  2RHQ B;  3UCS C;  1OV9 A;  1J5W A;  1G6U A;  5BXZ A;  2A79 B;  3FB5 C;  2B5U A;  3CX5 F;  4IIJ A;  3K57 A;  4C7U A;  5EIB C;  3T1C A;  3FJP A;  2DTI A;  2QTO A;  4XDJ A;  3JAS B;  1N33 O;  4LF8 B;  1WPY A;  5KMG B;  2F93 B;  3FYE B;  2VS0 A;  1G5H A;  4P72 A;  3ERR A;  2YIA A;  3K3W A;  5JWP A;  3WG7 C;  3OMI B;  3SDL A;  1XMO O;  2HG5 C;  2DWD C;  1EBO A;  4DR5 B;  1Q6I A;  4FZ1 A;  4X20 A;  4D7T A;  4B7E A;  2IY5 B;  3EXA A;  1VIB A;  4R7C A;  3OGC C;  4OXS A;  4QNH B;  1B70 B;  1NNH A;  5TIS Z;  1AR5 A;  2AHZ A;  4F6R A;  2ZT5 A;  1OCR B;  5LA6 A;  5JH7 A;  2ILM A;  4ICG A;  3OE7 G;  1HNZ B;  1H2G A;  1GRJ A;  3ZMV A;  4KFM A;  5IYD O;  3ZHS A;  3QVN A;  4H2X A;  2E74 B;  2X6C A;  4J7Z A;  1E22 A;  4YRI A;  1ASY A;  2UUB O;  1EQR A;  3HKE A;  4P75 A;  2HFE C;  3H1K H;  5KX5 A;  2ZGW A;  1BS3 A;  3RBZ A;  2E10 A;  1K7D A;  4MVU A;  2XT9 A;  1XHZ A;  4HYO A;  5BR8 O;  1RM1 C;  5FNV B;  5GW7 A;  2DTH A;  3QO7 A;  3MD0 A;  2B9Z A;  1XQ8 A;  3ML0 A;  1IUR A;  4UCT A;  3CHX A;  4KR3 A;  2CGH A;  2JJ1 G;  2DYR B;  1X2G A;  2WA4 A;  3K79 A;  4YRC A;  4GT1 A;  1RFY A;  4X64 O;  5LXT A;  4TVA A;  2OYQ A;  1BSM A;  4DR6 B;  3UGQ A;  3RKY A;  2DZ9 A;  3Q4H A;  4Q6G A;  3ZHV A;  4ZHQ B;  2RCV A;  4YY3 O;  4DR6 O;  4HWT A;  4OGQ B;  5LMN B;  1XHX A;  1S77 D;  1BBW A;  2EIN C;  3K59 A;  2UXC O;  2ZT8 A;  4DV2 O;  3CCR V;  4DYL A;  4ASU G;  3I5D A;  3ABK C;  4JI6 O;  4JI2 O;  3CYO A;  1M4U A;  2ZIO A;  1X4T A;  3G71 V;  3NEN A;  2UXD B;  2IW5 A;  2ZZF A;  1QVF U;  4KUM A;  2VWK A;  2ITD C;  2Q67 A;  3UT5 A;  3QNE A;  4ZKI A;  3F5T A;  3CXC U;  2DVE A;  1H8E G;  4MTX A;  4YCW A;  1YFR A;  1WN7 A;  4MTG A;  1EIY A;  3PCO B;  3JCZ A;  1IX9 A;  12AS A;  2UUC O;  1BCC H;  1Q6U A;  2ZXF A;  1B76 A;  3ZRV A;  2RQ6 A;  2YXL A;  3ZHU A;  1CXZ B;  2QWR B;  3BCC H;  1PKX A;  2E76 B;  2CAZ C;  1IVS A;  4P9O A;  4DR4 O;  3SYO A;  4RQE A;  5CBH A;  4E2L A;  3CC2 V;  1IXB A;  2QHT A;  2ADP A;  2EUL A;  3D3I A;  2ZR3 A;  1FKA O;  4HA8 A;  2IJH A;  3HXY A;  2P67 A;  3HY1 A;  4DV5 O;  3RVZ A;  1W0J G;  4H13 B;  3CCL V;  1AIL A;  1L0L H;  1NT2 B;  3N2K A;  3FAV B;  1SS3 A;  1Q81 W;  4JYC A;  4NTX A;  3AG7 A;  4H2V A;  3A2F A;  4DW0 A;  1VF6 A;  3LNM B;  2Q6A A;  4DW1 A;  5K1X A;  1VQL V;  5JVD B;  2JK5 C;  1JOY A;  4K8Z A;  2X6A A;  4DUZ B;  4P73 A;  1F4M A;  4L8J A;  1E1Q G;  2Q5H A;  5GTH Z;  3STL C;  1ENV A;  2QA4 V;  2RJZ A;  2ZNJ A;  1SQG A;  2GTS A;  1EIY B;  2X7R B;  3DSQ A;  3OEH G;  1DTO A;  3CJH A;  1NS1 A;  3IJ4 A;  1ZWI C;  3OUS A;  2ZM6 O;  1JCH A;  5DM6 V;  4YP0 A;  4F6R B;  1FXK C;  5LGT A;  4JI0 B;  3HR0 A;  2Y69 C;  2CDY A;  4X88 A;  2LGQ A;  3WQZ A;  1WAZ A;  4FM0 A;  4MVM A;  2Y4T A;  1JPX A;  3AG1 B;  2AXT Z;  1WPB A;  4TUY B;  2I4L A;  4DV0 B;  3J80 N;  1AB3 A;  2Q0A A;  2YI8 A;  2DQ0 A;  1X54 A;  4LF4 B;  3QTC A;  2GV9 A;  2O57 A;  2OTJ V;  3AEI A;  2IBZ H;  3JAR B;  4H33 A;  4JI3 B;  4FFB B;  2WLI B;  5KHK A;  1KYO F;  4PHZ A;  4JAS A;  2W6I G;  4BW5 A;  1NJ2 A;  2K9P A;  4ZBM A;  3CXH F;  1PPJ H;  2M6Y A;  1KQS U;  3C3T A;  2PI5 A;  2ALY A;  4KXR A;  2IJJ A;  1V9P A;  4TV8 A;  3V7C A;  1Y76 A;  2XAQ A;  3M7M X;  4HWO A;  1BGY H;  4PI2 A;  2W0X A;  4BIO A;  1EM1 A;  1J5E O;  1M5I A;  3A5Y A;  5L3F A;  3EFR A;  1P7B A;  5AG2 A;  1KU9 A;  1X2H A;  4MVO A;  3E83 A;  3MF2 A;  5H6Q A;  5L3C A;  4B3S B;  5JCO A;  3HY0 A;  2N04 A;  4X1K A;  1JFF B;  2YXH A;  2EAY A;  3TJT A;  1AI6 A;  4UVB A;  3OTO B;  3JAK B;  1BQ0 A;  5IWA B;  1I08 A;  3OFN G;  1XMQ B;  4WF9 V;  1WU7 A;  4KP4 A;  3ASN C;  5F2V O;  2BTQ A;  3E8F A;  1KKD A;  1YIJ V;  4DPG A;  3ZS8 C;  1VF7 A;  1L8D A;  1ZLZ A;  4FIP C;  3CB2 A;  3IGA C;  3L71 H;  4MVR A;  2AGA A;  2PYL A;  4UPA A;  4LF5 B;  2JIZ G;  1KBH A;  4WJ4 A;  2DKG A;  3RGB A;  3SPC A;  4P3N A;  5IYZ A;  4PA9 A;  4O2A B;  3JAT A;  2AHY A;  2BOC C;  3DGE A;  4CS2 A;  2B1I A;  3V7R A;  1WA8 B;  2Q9L A;  4JI1 O;  1US6 A;  2Q69 A;  4LWS A;  4YHH O;  4WF2 A;  4UXN A;  3A31 A;  2CJB A;  4LBE C;  4TV9 B;  1SKV A;  1WYD A;  4DV1 O;  4OPA A;  3BHP A;  2VQE B;  1FYJ A;  3S3X A;  3L74 H;  3UQ8 A;  2QWP B;  2I4N A;  4F6E A;  2YIC A;  2DTO A;  3AG3 B;  2RHS B;  1N9W A;  2VQF O;  3W7T A;  2ATK C;  1ATI A;  4OLF A;  4W4K A;  1QF6 A;  3QF7 A;  4YXW G;  1URF A;  4PDM A;  1SA0 A;  3H1L H;  4LF7 B;  2OIE A;  1K3E A;  2IH1 C;  2HP8 A;  2JVD A;  2NN4 A;  4Z1V A;  1N34 O;  4LF7 O;  1WPX A;  4EFB A;  1Q82 W;  1JMK C;  5LBQ A;  1Q86 W;  3LSQ A;  1XNQ B;  3ICX A;  3J81 N;  1TAE A;  2FML A;  5IE9 A;  2ITC C;  2VQE O;  1JA8 A;  2WLN A;  3OAA G;  3P3N A;  2DU5 A;  3E22 A;  3G80 A;  3A0R A;  4DV1 B;  1QNM A;  1XNQ O;  3CE2 A;  1I5X A;  4TQF A;  2G38 A;  4U3J A;  1WNL A;  4J80 A;  4AQY B;  4IYH A;  3VOU A;  2P5I A;  3K9S A;  4L87 A;  2QSA A;  1Y74 B;  1KD1 W;  3OR6 C;  4NXM O;  3C90 A;  4QE9 A;  5LMU B;  2ZE7 A;  3EVK A;  1F7Y A;  3SYC A;  5C93 A;  1ZAU A;  3IKM B;  1USY C;  3LNN A;  2DJZ A;  2Y0I A;  2R9A A;  4WFH A;  3JAW A;  4DV7 B;  1TGO A;  2RMK B;  3LDE A;  4WBN A;  1IBM O;  2A9H A;  2NS6 A;  2XHB A;  2YI9 A;  3RYI A;  2Y69 B;  2EIJ C;  3N27 A;  4GKJ B;  3O9O A;  1ASZ A;  3WB2 A;  5B3S B;  1G4Y B;  2XUM A;  5KA5 A;  2EL9 A;  4UCO A;  2ALY B;  1TVK B;  4OX9 B;  4LF5 O;  3AK2 A;  1GM7 A;  4TVW A;  5C52 B;  4FLT A;  2ZZE A;  2OCH A;  4GYC B;  1FJG B;  4LNU A;  5CB4 A;  1SQX H;  4YRM A;  5LOV B;  4IHJ B;  4U3J B;  4K35 A;  5HFL A;  5L3D A;  4O4I A;  4YJ3 A;  3OMN B;  5IYB O;  1R3L C;  1XIL A;  4K88 A;  3SJA C;  1PM9 A;  3WFV A;  2GSM B;  2BTO A;  4UCS A;  2RHS A;  1K73 W;  3FYI B;  1BZK A;  1FXV A;  4O2D A;  4JI4 O;  2HNI A;  1OCR C;  5BMV B;  4DR7 B;  5KA6 A;  1GM9 A;  1IBK B;  5KAF Z;  2CTP A;  2C2A A;  2WLM A;  2YIB D;  3OGI B;  1AJN A;  4GX2 A;  1GKF A;  1FFT B;  2KB1 A;  3ABK B;  1UJW B;  4NR1 A;  1ZUQ A;  4DQ2 A;  2LO1 A;  4TWK A;  5CA0 B;  1M90 W;  2DEQ A;  5CN0 A;  1BE3 H;  3RGL A;  5J2U A;  3K5M A;  4FLX A;  3DC6 A;  2WLL B;  4A5U B;  4J9Y B;  4LVM A;  3F7Y C;  2E5L B;  2ZXW C;  2ZKO A;  1M1K W;  1YTF B;  3B8M A;  3T4Z A;  2OT5 A;  2ZD9 A;  4G85 A;  3D8C A;  2AKW B;  2NLJ C;  1NTK H;  3AG1 C;  1USY A;  5ELO A;  5LYJ A;  1WB7 A;  4HWS A;  1OCZ B;  1YJW V;  1EZJ A;  1Y4M A;  2R9I A;  4PI0 A;  4N21 A;  4HVC A;  1G5I A;  4UCR A;  2P4V A;  4FMT A;  3AG2 B;  4DV0 O;  5B1B C;  1EFW A;  1KP3 A;  3BA9 A;  4DR1 B;  1TUB A;  5CBF A;  2VQF B;  4I55 A;  4DV4 B;  5A2Q N;  1GGM A;  3FFQ A;  4I55 B;  4LF9 O;  4K87 A;  5E3I A;  11AS A;  2GHY A;  4HBN A;  1HW7 A;  1AI5 A;  4D7S A;  1VQZ A;  2ZM6 B;  1AI7 A;  4UV8 A;  5JVD A;  2PUS A;  3L73 H;  4TVA B;  2QWN B;  3KFU A;  2EIN B;  2XTI A;  4EX5 A;  4I9Q A;  3A7A A;  1VQ9 V;  2CE4 A;  3ZED A;  1ZSP A;  4R6Z A;  1S76 D;  3KZI Z;  1AR4 A;  2AMC A;  5KAI Z;  4H2Y A;  3K06 A;  4JZG A;  3ZHT A;  1R3K C;  1HR0 B;  2I4O A;  2FYK A;  3ZIA G;  4MVQ A;  4PA4 A;  4JI8 B;  4GUN A;  2FL4 A;  4HNA B;  3B2E E;  4TUY A;  4DXW A;  1QVG U;  3ABU A;  1C0A A;  1Z2G A;  2HJD A;  2HEP A;  1HWY A;  3M8A A;  1SZT A;  1FXH A;  3OT7 A;  2JGU A;  4JAV A;  3GWO A;  1WB8 A;  1QR8 A;  1P4R A;  1VEW A;  3UH0 A;  5IWA O;  5B5E Z;  4ZTU B;  1E1R G;  1GM8 A;  4ZI7 A;  4DR4 B;  2DYS B;  4FFB A;  1GTO A;  4DR2 O;  3EFF K;  1TUE B;  5EZY A;  2JEX A;  2XAJ A;  4ZTZ B;  3JD2 A;  4IL6 Z;  3FB6 C;  4P3P A;  4B7K A;  1WA8 A;  2NNU A;  4JI6 B;  1I94 B;  5KHJ A;  5IT9 N;  4YJ2 A;  1Q6H A;  2K1E A;  1O9G A;  1NBM G;  2H94 A;  3D36 A;  4JAU A;  3VQV A;  1AR1 B;  2AZ0 A;  1N0J A;  1THZ A;  1DGS A;  2DU7 A;  1QR9 A;  4W4L A;  1X55 A;  2YIB A;  5LHH A;  1VQ4 V;  1SQQ H;  5B66 Z;  4X1K B;  1XBL A;  4FVM A;  4I50 B;  1OCO C;  1X59 A;  2ZNI A;  2EJF A;  4JI3 O;  2WAM A;  2ZE6 A;  2QJ1 A;  2JRI A;  4MW3 A;  3HKC A;  3PJS K;  2QM4 A;  4JYA B;  2DE0 X;  4DV2 B;  4CS3 A;  4CH3 A;  2XOK G;  3LDC A;  1AI4 A;  1S3J A;  2MW2 B;  2PGG A;  1HNW B;  1LUW A;  4YY3 B;  2BSK A;  1M57 C;  4PDR A;  1X56 A;  1H2M A;  4MTF A;  2F4V B;  4FPP A;  1S0V A;  2UUB B;  5LGU A;  3Q4H B;  4IYI A;  2VWJ A;  1BT8 A;  3CRR A;  4XDL A;  1G51 A;  3V8J A;  1VQ8 V;  2DQ3 A;  3TK1 A;  1PL0 A;  3RKX A;  4ZOL B;  4U3F H;  1I94 O;  1UPG A;  3HXW A;  5JJE B;  4DUZ O;  3HXX A;  3LC0 A;  3SJB C;  1B6Q A;  1JVM A;  1H2N A;  3RT3 C;  3UGT A;  4DR2 B;  1Z5V A;  5J2T A;  3HXV A;  3OTF A;  4GKK B;  3JAW B;  3TEH B;  3CMA V;  1YEW A;  1UFI A;  5HGQ A;  3CCQ V;  1XI1 A;  3P8T A;  3KCX A;  3D36 C;  2ZE5 A;  2F43 G;  4ZI7 B;  1GN2 A;  3GWK C;  1VQ6 V;  4KL1 A;  3REU A;  3RFR A;  1VF5 B;  3FB8 C;  5FPR A;  1YSC A;  4UCU A;  5IJ0 A;  1SES A;  1K8A W;  2R9R B;  4EB6 A;  3JYC A;  4QPJ A;  1PV0 A;  2BSK B;  4X1I A;  2ETN A;  3SPH A;  5CB4 B;  3LSU A;  3CEI A;  3JAL A;  2DWE C;  3SJQ C;  4IT5 A;  2UXB O;  1PYS B;  5DN6 G;  3R07 A;  3BAA A;  2N74 A;  1BIA A;  1VQP V;  2EZP A;  4I0X B;  4P73 C;  3JD0 A;  5KNN A;  4F4L A;  2F4V O;  3P30 A;  4GKK O;  1N33 B;  2F66 C;  3RIR A;  3JAM N;  1N4C A;  3FKS G;  1H4S A;  2WPD G;  1IXM A;  1GK9 A;  1VAR A;  2DOS A;  3AG4 B;  4XTZ A;  4YRO A;  1WQ7 A;  2RN9 A;  4E51 A;  2Q68 A;  3HKB B;  2ZT9 B;  3HKD A;  1H2L A;  4O4L A;  3KKY A;  1H4T A;  2EJG A;  4XTW A;  1R6N A;  3ABL C;  3IAY A;  2UXC B;  2FB5 A;  4H2S A;  4DRX A;  4CH6 A;  3CJH B;  2GDS A;  4JV5 B;  1NZ6 A;  1RPO A;  4O2B B;  1Q7Y W;  3DC5 A;  4H2X B;  2CTR A;  2QKS A;  1HNX O;  1XNR B;  3W7X A;  3MAQ A;  4PJ0 Z;  4X65 O;  4H44 B;  2PY5 A;  4TV9 A;  2A7W A;  2Q7G A;  1PNM A;  4XU2 A;  3ASO B;  1TUB B;  2Z3Y A;  1AVM A;  4XTX A;  3AK1 A;  1AJQ A;  4TWA A;  3TEH A;  5BR8 B;  1NR1 A;  2ODR D;  4TVY A;  1G1X B;  4CC6 A;  2IM9 A;  2EJ7 A;  4K3A A;  4JTC B;  4Q15 A;  1SA0 B;  4FK5 C;  1L0N H;  1XDC A;  2CJ9 A;  1OCC C;  4YRN A;  1MG1 A;  3RYF A;  3SPG A;  1NJ8 A;  3L72 H;  3TGU H;  4NTW A;  4WFA V;  4B3M O;  1NVP B;  4TV8 B;  4CC5 A;  1A32 A;  4G27 B;  4FLU A;  2P06 A;  4EB6 B;  4NB5 A;  1VQN V;  2DDZ A;  1FJG O;  2PTM A;  3A32 A;  1O9H A;  5B1A C;  1BBU A;  4FLW A;  4DUY B;  1ORQ C;  5CA1 A;  4P75 C;  2EIK B;  1LNQ A;  1KUQ A;  5LA6 B;  3HFZ A;  2EIM B;  1YIT V;  1JFF A;  1EN6 A;  4NXN B;  4RQF A;  2EIJ B;  4UB6 Z;  4BIZ A;  3DTU B;  3T1Y B;  4H2W A;  3JCU Z;  4LNS A;  3BJU A;  2DW4 A;  3BVO A;  4HAM A;  3V7S A;  3VQW A;  2EX3 A;  4U7N A;  2UXN A;  1F51 A;  2A3Q A;  3B09 A;  4FLY A;  1ZL8 A;  1ROP A;  1K4C C;  3CP1 A;  2E41 A;  2PMF A;  3CSX A;  4JI8 O;  3K5O A;  1NVP D;  3ZRX A;  1NTM H;  4NCX A;  4LF8 O;  1HR0 O;  4DR3 O;  4WBN B;  1YDX A;  1KB9 F;  4X20 B;  3ZJZ A;  4DV4 O;  2P22 C;  1U97 A;  3L2Z A;  4G28 B;  5ITZ B;  4J42 A;  1YFS A;  5JQG B;  4XEO A;  3JAR A;  4X8A A;  2FTK A;  3E8B A;  4BAY A;  3K0D A;  1JR9 A;  5LHI A;  3W7W A;  1YB3 A;  3AG4 C;  4JI7 O;  3SYQ A;  1WP8 A;  5LXT B;  4HT4 A;  1PD3 A;  1SQB H;  2ART A;  2OIG A;  3TXS A;  4LFA B;  2E5L O;  3RVY A;  3HFV A;  4YRK A;  2B1G A;  2DN9 A;  4H0L B;  3HRI A;  2PME A;  4DR1 O;  2D2C B;  4I4T B;  4HNA A;  1QCE A;  4DK1 A;  3JAS A;  3OM3 B;  5H2F Z;  1EVK A;  3CRA A;  1H4V B;  3A74 A;  2UU9 B;  4KQE A;  3ABL B;  3M99 B;  3AK3 A;  1P7G A;  5L3E A;  4YRG A;  1HP8 A;  2ZQM A;  4TTV A;  1XOU A;  4LVL A;  1LUV A;  1V54 B;  1S5L Z;  4PHC A;  2EIK C;  2XTA A;  1SQP H;  5J2U B;  3PN1 A;  1MNG A;  3B40 A;  4LF6 O;  5IYZ B;  1QBZ A;  4X1Y A;  1GAX A;  2V1D A;  3C3S A;  5LYJ B;  4I5S A;  4FJC C;  4R50 A;  3ZMZ A;  4D6T H;  1SET A;  5KLV H;  1AP5 A;  1IBK O;  3K5N A;  2OTL V;  1ADJ A;  1NJ6 A;  4YRS A;  3FD9 A;  4YRE A;  2ARH A;  3CRQ A;  4JI4 B;  1B7Y B;  4GKJ O;  4YIP A;  1R3J C;  5JJN B;  2GTA A;  4HWR A;  5KHG A;  5LGN A;  1JQ0 A;  1M56 B;  2KSD A;  1FAF A;  1K34 A;  2NR5 A;  3N2K B;  1LR1 A;  5B1B B;  2E75 B;  4JI5 B;  3L4G A;  4R8C A;  1XMQ O;  1EN4 A;  3RYI B;  3K03 A;  4U7O A;  2QTS A;  2LW1 A;  2C7I A;  1OCZ C;  2IJI A;  3SYA A;  4NXM B;  1COW G;  3BA8 A;  4JTD B;  5CA0 A;  3QO8 A;  4LVK A;  2ZT6 A;  1QE0 A;  1YZB A;  3T4D A;  1E1O A;  2MK3 A;  3A8T A;  1VQ7 V;  3AG3 C;  1GN6 A;  5IY5 B;  2GUZ B;  4MVZ A;  3K04 A;  1NI8 A;  2AMC B;  2HHH B;  3STZ C;  1NTZ H;  3RYC B;  4JI5 O;  4OPH A;  2I4M A;  2KG7 A;  2EJ9 A;  1EVL A;  5A9G A;  2XND G;  1R3I C;  3A0B Z;  2LP7 A;  1KC8 W;  3JD3 A;  4O4L B;  1N34 B;  4X66 B;  4J7J A;  3N2G A;  1RSO B;  1MOF A;  2CUG A;  5EZY B;  1JJO A;  5E1A C;  4AQY O;  1JJ2 U;  1K5S A;  3TEG A;  4LR3 A;  2JJ2 G;  5FNV A;  3G4S V;  1SRY A;  2R70 A;  3L4G B;  4P2Z A;  1AJP A;  4B08 A;  2EZO A;  3GB7 C;  4JI0 O;  3SGI A;  3G67 A;  4ZIB A;  5CMU A;  5JH7 B;  3A0H Z;  2RNB A;  3BY6 A;  4GX1 A;  4LH6 A;  1EN5 A;  2DMX A;  2KKW A;  2Q7E A;  2FKX A;  1K33 A;  3U0Z A;  3OUF A;  4X89 A;  4PG3 A;  1H38 A;  4LVJ A;  4EO4 A;  3X2Q C;  4FM1 A;  3CMQ A;  3REX A;  1YJN V;  4IHJ A;  5B1O A;  3NET A;  5C51 B;  4GCZ A;  3G6B A;  2QR4 A;  1SQV H;  3RWR D;  1QLE B;  4JPR A;  2P7T C;  1VQK V;  2PZS A;  3RF1 A;  4JYY A;  4XTV A;  4JI1 B;  2EIL C;  1BIB A;  3A7R A;  2WLH A;  2CH7 B;  2XAG A;  3HKD B;  4LFA O;  4J10 A;  3L75 H;  1SER A;  2OWO A;  2HVJ C;  3ABM B;  3OTO O;  1NU1 H;  1YF2 A;  3ZHR A;  4ZHQ A;  3JAL B;  4KHP B;  1YFT A;  1HTT A;  4DUY O;  5K1P A;  3L1A A;  3E8H A;  3D3Q A;  2GUZ A;  1Y66 A;  5EYP A;  1KKC A;  3TUP A;  4I0X A;  3VBB A;  2YUA A;  4YRP A;  3A7U A;  4UVC A;  1Q90 D;  2GBO A;  4B3M B;  5F5W A;  1FFX B;  1KMI Z;  2BTQ B;  4PEL A;  2WA3 A;  4RAI A;  2V4D A;  4WFG A;  4WFB V;  4FM2 A;  3G6E V;  1FXK A;  3IC9 A;  2CK3 G;  3SPI A;  3F7V C;  3H9V A;  1I7F A;  2JEU A;  4RUF A;  1LYL A;  5E79 Z;  4B3T B;  3HB3 B;  4BW9 A;  4LC1 A;  4PV1 B;  4LF4 O;  1L0W A;  3CC7 V;  3OD1 A;  3OEE G;  3W7U A;  2YS8 A;  2A0L A;  5IJ0 B;  3I55 V;  1XRE A;  4NXN O;  3ZMS A;  1E1T A;  1IBL O;  4P9P A;  3U10 A;  1TVK A;  3MDS A;  4YRT A;  4O2B A;  4YYE A;  4YJ2 B;  3K5L A;  1XNR O;  1F4N A;  3M4Q A;  4O4H B;  4X1I B;  3CCU V;  4JV5 O;  2A8E A;  2IH3 C;  1N32 O;  2QHS A;  3ZMT A;  4G84 A;  1Z5W A;  4NYK A;  4NTY A;  4BIU A;  2QDO A;  2CIM A;  3PZC A;  1Q3E A;  3P32 A;  1BHB A;  1YGB A;  2D3O W;  2DYS C;  2HR3 A;  4JGS A;  4Z2W A;  3ICA A;  1KOG A;  5L3G A;  3ZMU A;  2IJK A;  4UP7 A;  2QM7 A;  1FYF A;  2VRZ A;  2Q8V A;  5GTI Z;  1N36 B;  1ZTE A;  3RUX A;  3ZCC A;  4K0K B;  3DXR A;  2LW7 A;  5FLX N;  4LFB O;  3K58 A;  1MSW D;  4LFC O;  1FS0 G;  4QE7 A;  3ZN0 A;  1B70 A;  3TET A;  5C53 B;  3OMA B;  3W3S A;  2ARU A;  3E22 B;  2UXB B;  2C8M A;  3PCO A;  1R6T A;  1Q5O A;  3GVM A;  1HNZ O;  1QLE C;  2E64 A;  2RDC A;  1B8A A;  1BL8 A;  2ODR C;  1Y6X A;  2KQX A;  5EYP B;  3QG5 A;  3TXQ A;  4QGP A;  1EOV A;  1CEZ A;  5GON B;  1BMF G;  3E9I A;  3NEM A;  2XAH A;  1E24 A;  4XU0 A;  2XAS A;  4YCU A;  3I56 V;  1D2D A;  2WLK A;  3BFM A;  2UUC B;  3CPW U;  4DV5 B;  1KMN A;  1MZF A;  1V55 C;  1NJ1 A;  2L6L A;  3M4P A;  3ZN1 A;  2ARS A;  2HVK C;  1PNK A;  4ABM A;  2WLI A;  1M9N A;  2BOB C;  2QM8 A;  4B3R O;  5JJJ B;  3APO A;  1KP2 A;  4H2T A;  1SZX A;  2HKO A;  2JS3 A;  3IC7 A;  2UXD O;  4LCU C;  4CBC A;  1WLE A;  1Q43 A;  1NKD A;  1SF9 A;  2PF4 E;  4JI2 B;  4O4H A;  1JJC A;  3W7S A;  4AI8 A;  3ZRS A;  1I0H A;  4UUJ C;  2H8P C;  2ZR2 A;  4PDL A;  3HTZ A;  3SPJ A;  1H8H G; 
#chains in the Genus database with same CATH homology
 1WNL A;  2P6J A;  2EIM B;  3NEL A;  1YIT V;  4YRR A;  1PYS A;  3VOU A;  2P5I A;  4WI1 A;  1VQO V;  3I7F A;  2AKW A;  3AG2 C;  5CA3 A;  4RQF A;  2EIJ B;  4BIZ A;  1YTF D;  4PA6 A;  1NJ5 A;  3DTU B;  4LP8 A;  3HXZ A;  4L87 A;  4TQD A;  4H2W A;  2EIL B;  4LNS A;  3RKW A;  5B1N A;  1KD1 W;  3OR6 C;  4XDK A;  1Z7M A;  2DW4 A;  3H01 A;  4HAM A;  2DXU A;  4QE9 A;  4OP0 A;  2YSU B;  1CPY A;  4EKW A;  3V7S A;  3VQW A;  4U7N A;  2UXN A;  2ZCE A;  3SYC A;  5C93 A;  1F51 A;  5HFM A;  1ROP A;  1YJ9 V;  3IKM B;  1W0K G;  1K4C C;  1NYQ A;  3CP1 A;  1USY C;  2E41 A;  3CC4 V;  2PI4 A;  3CCS V;  2PMF A;  1OZ0 A;  1NVP D;  3ZRX A;  4LVI A;  4NCX A;  2DJZ A;  4XBF A;  4WFH A;  3ETD A;  1EFR G;  5KUM A;  2J3M A;  3FB7 C;  2EWN A;  3CME V;  3LDE A;  3ZJZ A;  3EFS A;  3A5Z A;  4QPK A;  2WWW A;  1OCO B;  2HJF C;  3L2Z A;  3ZRW B;  4H2U A;  2ZDI A;  4G28 B;  2A9H A;  4WFF A;  1YFS A;  2NS6 A;  3HXU A;  4XEO A;  3V8L A;  2HLD G;  4X8A A;  2FTK A;  2WLL A;  2Y69 B;  3E8B A;  1E79 G;  4BAY A;  3K0D A;  4YPF A;  1J95 A;  2EIJ C;  3ETG A;  5LHI A;  2ZDI C;  1Z7N A;  1ASZ A;  5B3S B;  2OCC B;  3G1Z A;  1G4Y B;  5KA5 A;  3W7W A;  1JX9 A;  1YB3 A;  3AG4 C;  2EL9 A;  4RUE A;  3SYQ A;  1H4Q A;  3E86 A;  3F5W C;  3B77 A;  4MS2 A;  2ALY B;  4WJ3 M;  3UFG A;  4HT4 A;  4TSF G;  1M56 C;  4KR2 A;  3ASN B;  1V55 B;  4Q20 A;  1VQM V;  5B3S C;  1PD3 A;  2RHQ B;  3BJU A;  3MF1 A;  4GX0 A;  4PA3 A;  1GM7 A;  4TVW A;  1S5H C;  2ZZE A;  5C52 B;  1J5W A;  2ART A;  4UP8 A;  2UXX A;  4YRM A;  3RVY A;  3CCM V;  3HFV A;  2A79 B;  3FB5 C;  4MT8 A;  2B5U A;  4YRK A;  2E3C A;  5HFL A;  5L3D A;  1K92 A;  3SYP A;  2B1G A;  5IYB O;  3OMN B;  1R3L C;  3CCV V;  3T1C A;  3HRI A;  4K88 A;  3FJP A;  2PME A;  2DTI A;  3WFV A;  2GSM B;  2QTO A;  4XDJ A;  2RHS A;  1K73 W;  1WPY A;  5CBG A;  1QCE A;  3FYI B;  1FXV A;  4O2D A;  3OM3 B;  1EVK A;  2HNI A;  1H4V B;  3FYE B;  3A74 A;  1DF5 A;  1G5H A;  1OCR C;  4P72 A;  3ERR A;  5KA6 A;  3P8V A;  1GM9 A;  3K3W A;  2G4C A;  4KQE A;  3ABL B;  2WLM A;  2C2A A;  4PA7 A;  3M99 B;  2E65 A;  5L3E A;  3WG7 C;  1AJN A;  4GX2 A;  1GKF A;  1FFT B;  3OMI B;  3P8Y A;  2KB1 A;  3ABK B;  1UJW B;  4DQ2 A;  4YRG A;  1CP9 A;  2X0L A;  2Y48 A;  2ZQM A;  4TWK A;  4TTV A;  2HG5 C;  4DO2 A;  1XL4 A;  1V54 B;  2DWD C;  1EBO A;  1M90 W;  2ZZG A;  4LVL A;  2DEQ A;  5CN0 A;  4PHC A;  1JJC B;  2ZT7 A;  1R6K A;  2IY5 B;  4R7C A;  2Q7H A;  3OGC C;  4OXS A;  4QNH B;  3WG7 B;  2EIK C;  1B70 B;  3CD6 V;  1NNH A;  3RGL A;  4QIW F;  2AHZ A;  1MAB G;  2WLL B;  2ZT5 A;  4J9Y B;  2J3L A;  1OCR B;  4LVM A;  3F7Y C;  2ZXW C;  3OE7 G;  1M1K W;  5L3B A;  2YEV A;  1YTF B;  3B8M A;  1QBZ A;  1H2G A;  1PNL A;  3T4Z A;  2OT5 A;  2ZD9 A;  3BEH A;  4KFM A;  3ZMV A;  2V1D A;  4G85 A;  4P3O A;  2AKW B;  2NLJ C;  4I5S A;  5IYD O;  5EC2 C;  3AG1 C;  4FJC C;  3R65 A;  4R50 A;  1USY A;  2ZIN A;  5ELO A;  3ZMZ A;  2ZTG A;  4P74 C;  1SET A;  4H2X A;  2OTL V;  1OCZ B;  1YJW V;  1EZJ A;  1ADJ A;  4HWS A;  1NJ6 A;  1Y4M A;  2R9I A;  2X6C A;  4YRS A;  4N21 A;  4YRE A;  3OR7 C;  1E22 A;  2WSS G;  4P72 C;  1B7Y B;  1G5I A;  4BWA A;  4HVC A;  4YRI A;  4FMT A;  1EQR A;  1RIQ A;  1FXK B;  4P75 A;  2HFE C;  1ASY A;  1R3J C;  3AG2 B;  4HWR A;  5B1B C;  2ZGW A;  1KP3 A;  1EFW A;  1I5Y A;  5LGN A;  1JQ0 A;  3RBZ A;  4Z1M G;  2E10 A;  4HWP A;  1K7D A;  4MVU A;  5CBF A;  4CS4 A;  3LSS A;  1GGM A;  1M56 B;  1K34 A;  4K87 A;  5E3I A;  4HYO A;  11AS A;  5B1B B;  2GHY A;  1RM1 C;  5GW7 A;  3L4G A;  2DTH A;  1AI5 A;  3QO7 A;  3MD0 A;  1VQ5 V;  4R8C A;  1VQZ A;  3IKL A;  1AI7 A;  4UV8 A;  3ML0 A;  3K03 A;  4KR3 A;  4U7O A;  2CGH A;  2JJ1 G;  2DYR B;  2C7I A;  1X2G A;  1OCZ C;  2IJI A;  3E89 A;  3K79 A;  3SYA A;  4YRC A;  4RDX A;  2Z5U A;  4GT1 A;  4TVA B;  3KFU A;  4YCV A;  2EIN B;  2XTI A;  4G2K A;  4TVA A;  1COW G;  4JTD B;  4AH6 A;  1W66 A;  3UGQ A;  4EX5 A;  5EC1 C;  3A7A A;  3QO8 A;  2DZ9 A;  4Q6G A;  2E5A A;  1VQ9 V;  4LVK A;  2ZT6 A;  3RKY A;  2IY5 A;  1DF4 A;  1DLB A;  4GX5 A;  1QE0 A;  2XGT A;  1H8H G;  3T4D A;  4HWT A;  4R6Z A;  1E1O A;  4K86 A;  1K4D C;  2MK3 A;  1VQ7 V;  2EIN C;  3AG3 C;  1S77 D;  1S76 D;  1BBW A;  5IY5 B;  2ZT8 A;  2AMC A;  3CCR V;  4MVZ A;  4H2Y A;  3K06 A;  2DYR C;  3K04 A;  4WCE V;  2E1H A;  2AMC B;  1R3K C;  3STZ C;  2I4O A;  2FYK A;  4PDV A;  3ZIA G;  5LHG A;  4MVQ A;  4PA4 A;  3ASO C;  4ASU G;  1NQT A;  3ABK C;  5H9C A;  3UKM A;  2LFS A;  2I4M A;  3CYO A;  2CJA A;  2ZIO A;  2EJ9 A;  3EHB B;  3G71 V;  4DXW A;  3NEN A;  1QVG U;  3ABU A;  2IW5 A;  5KUK A;  1B7Y A;  1C0A A;  1EVL A;  4JTA B;  2ZZF A;  1QVF U;  3ABM C;  3RW0 A;  2XND G;  1HWY A;  1R3I C;  1SZT A;  1FXH A;  2ITD C;  2LP7 A;  4KUM A;  5EBL C;  2Q67 A;  5B1A B;  3JD3 A;  1KC8 W;  3QNE A;  4ZKI A;  4JAV A;  3GWO A;  3CXC U;  1QR8 A;  1MOF A;  3KG2 A;  1HXD A;  1P4R A;  2DVE A;  3UH0 A;  4ZTU B;  1E1R G;  1H8E G;  4MTX A;  1GM8 A;  4UV9 A;  1LNQ A;  1R73 A;  2DYS B;  1GTO A;  5E1A C;  3ETE A;  1JJ2 U;  3EFF K;  1TUE B;  4YCW A;  1K5S A;  1YFR A;  3HFZ A;  2JEX A;  2XAJ A;  2M7W A;  4MTG A;  2JJ2 G;  3TEG A;  1EIY A;  3PCO B;  3QO5 A;  4YDQ A;  3JD2 A;  4ZTZ B;  3JCZ A;  3G4S V;  3MEY A;  1SRY A;  2QHU A;  12AS A;  3L4G B;  1OHH G;  3FB6 C;  4P2Z A;  2P0L A;  1AJP A;  2NNU A;  2ZIM A;  2EZO A;  3GB7 C;  2ZXF A;  4P3P A;  1B76 A;  3ZRV A;  4ZIB A;  5CMU A;  2K1E A;  4XTU A;  3BY6 A;  4GX1 A;  1PKX A;  1NBM G;  2H94 A;  2W6J G;  3D36 A;  2Q7E A;  4JAU A;  3VQV A;  1AR1 B;  4P9O A;  3X2Q B;  1THZ A;  1K33 A;  3OUF A;  4X89 A;  3SYO A;  4RQE A;  2DU7 A;  1QR9 A;  5CBH A;  4E2L A;  1VQ4 V;  5LHH A;  3CC2 V;  1X55 A;  4PG3 A;  1V54 C;  1H38 A;  2QHT A;  4LVJ A;  1S72 V;  1WQW A;  1BHA A;  4EO4 A;  2QE7 G;  2ZR3 A;  3D3I A;  5BZB A;  4HA8 A;  3UM7 A;  3X2Q C;  1OCO C;  2IJH A;  2ZNI A;  5IY5 C;  2EJF A;  3CMQ A;  3REX A;  5IYC O;  3HXY A;  2WAM A;  2P67 A;  1YJN V;  3HY1 A;  4H02 A;  5B1O A;  3NET A;  5C51 B;  3RVZ A;  1NR7 A;  1W0J G;  4N23 A;  3CCL V;  4GCZ A;  4MVS A;  2Q5I A;  1QLE B;  4MW3 A;  1Q81 W;  3PJS K;  4JPR A;  4JYC A;  2P7T C;  3T2M A;  4H2V A;  4CS3 A;  3LDC A;  2XOK G;  4CH3 A;  1AI4 A;  1S3J A;  1VQK V;  1XL6 A;  2Q6A A;  3LNM B;  3RF1 A;  5K1X A;  1VQL V;  4XTV A;  2JK5 C;  2EIL C;  2WLJ A;  1JOY A;  2X6A A;  2WLH A;  1BIB A;  3A7R A;  3HRK A;  2XAG A;  4P73 A;  1F4M A;  5H6R A;  3MQZ A;  1M57 C;  4PDR A;  1E1Q G;  1X56 A;  2Q5H A;  3STL C;  1RM1 B;  4MTF A;  4YRF A;  1ENV A;  4FPP A;  2QA4 V;  1SER A;  1S0V A;  4YRQ A;  4I9W A;  2ZNJ A;  5LGU A;  1QLN A;  2HVJ C;  3ABM B;  3B8N A;  1EIY B;  2EIM C;  2X7R B;  3DSQ A;  3RAC A;  3OEH G;  1DTO A;  1YFT A;  1HTT A;  4YRL A;  1ZWI C;  5K1P A;  1G51 A;  4XDL A;  5IDJ A;  3K08 A;  3V8J A;  3OUS A;  1VQ8 V;  3L1A A;  4CH4 A;  2DQ3 A;  3E8H A;  3TK1 A;  1JCH A;  1PL0 A;  2OCC C;  2V7Q G;  5DM6 V;  4YP0 A;  3RKX A;  1FXK C;  5LGT A;  1Y66 A;  3TUP A;  2IU3 A;  3VBB A;  3HXW A;  2Y69 C;  4YRP A;  3A7U A;  4UVC A;  4X88 A;  3WQZ A;  4XTY A;  3HXX A;  1NJI W;  3LC0 A;  4MVM A;  4MW8 A;  1B6Q A;  5F5W A;  1NH2 B;  1JVM A;  3UGT A;  1JPX A;  3HXV A;  3AG1 B;  4PEL A;  1K5Q A;  3V8K A;  4RAI A;  2I4L A;  4WFG A;  4UP9 A;  2XAF A;  1OCC B;  3TEH B;  3CMA V;  3LUT B;  4WFB V;  4MTO A;  3E35 A;  2DQ0 A;  5HGQ A;  3G6E V;  1FXK A;  1K97 A;  4P30 A;  3CCQ V;  1N8R W;  2CK3 G;  3SPI A;  1X54 A;  3P8T A;  3F7V C;  3QTC A;  2F43 G;  3CCE V;  2JEU A;  4RUF A;  2OTJ V;  3AEI A;  4P71 C;  1LYL A;  4H33 A;  2WLI B;  3HB3 B;  4BW9 A;  3RL6 A;  4LC1 A;  1VQ6 V;  4JAS A;  2W6I G;  1L0W A;  4BW5 A;  1NJ2 A;  3CC7 V;  3REU A;  4ZBM A;  3OD1 A;  3OEE G;  3W7U A;  2A0L A;  3FB8 C;  3I55 V;  4QJF B;  1M57 B;  1YSC A;  1KQS U;  3ZMS A;  2PI5 A;  1E1T A;  2ALY A;  4P9P A;  2IJJ A;  3JD1 A;  3V7C A;  1SES A;  1K8A W;  4YRT A;  4YYE A;  2R9R B;  3JYC A;  1F4N A;  2XAQ A;  4QPJ A;  3M4Q A;  2JDI G;  4HWO A;  2W0F C;  4CZZ A;  3VQY A;  3SPH A;  4P71 A;  3CCU V;  3A5Y A;  5L3F A;  3EFR A;  2A8E A;  2IH3 C;  4MSW C;  2QHS A;  3ZMT A;  3LDD A;  3MHH C;  1NH2 D;  4G84 A;  3IAL A;  4XU1 A;  1X2H A;  4MVO A;  3E83 A;  4BIU A;  3HFZ B;  3MF2 A;  2DWE C;  5H6Q A;  5L3C A;  4WFE A;  3SJQ C;  2CIM A;  1PYS B;  3PZC A;  3P32 A;  1YGB A;  5DN6 G;  1BHB A;  3HY0 A;  2D3O W;  2DYS C;  2HR3 A;  2EAY A;  4JGS A;  4HZ3 A;  3R07 A;  3K0G A;  1AI6 A;  2P90 A;  4UVB A;  3ICA A;  1KOG A;  5L3G A;  1BIA A;  1VQP V;  2EZP A;  3OFN G;  4P73 C;  3JD0 A;  3ZMU A;  4F4L A;  2IJK A;  3P30 A;  5KNN A;  4WF9 V;  4UP7 A;  2QM7 A;  4J15 A;  3RIR A;  1YI2 V;  1FYF A;  1WU7 A;  4P74 A;  1RPR A;  3ASN C;  4KP4 A;  3FKS G;  1IL2 A;  4RO2 A;  1H4S A;  2WPD G;  1ADY A;  3RUX A;  1IXM A;  1GO3 F;  1GK9 A;  3E8F A;  1L1F A;  3ZCC A;  1YIJ V;  2QEX V;  1KKD A;  3AG4 B;  4DPG A;  4XTZ A;  4YRO A;  1WQ7 A;  4XEM A;  4FIP C;  4X5O A;  4E51 A;  5FL7 G;  2Q68 A;  1FS0 G;  3IGA C;  4MVR A;  4QE7 A;  4TT3 G;  3ZN0 A;  1K9M W;  1MSW D;  4RMF A;  1B70 A;  3NXS A;  2EJR A;  3TET A;  2X6B A;  1H4T A;  1X01 A;  4UPA A;  5C53 B;  3ABT A;  2JIZ G;  3OMA B;  2EJG A;  3W3S A;  4XTW A;  2ARU A;  3MHS C;  1R6N A;  3ABL C;  4WJ4 A;  3E9H A;  2DKG A;  4H2S A;  2C8M A;  4CH6 A;  4JF3 A;  3SPC A;  2YEV B;  3CCJ V;  4PA9 A;  4P3N A;  4JYB A;  3PCO A;  2AHY A;  1QLE C;  2BOC C;  3DGE A;  1B8A A;  2IU0 A;  2E64 A;  4CS2 A;  1BL8 A;  2B1I A;  1RPO A;  2ODR C;  3V7R A;  1Q7Y W;  3K9A A;  4J9Z B;  2ZXW B;  1YHQ V;  4H2X B;  1KEC A;  4H37 A;  2QKS A;  4CH5 A;  3VQX A;  2RHQ A;  2Q69 A;  1KMM A;  3E8G A;  1EOV A;  4WF2 A;  4UXN A;  3W7X A;  1CEZ A;  4LBE C;  2CJB A;  3A31 A;  5J9P C;  1HC7 A;  1BMF G;  1WYD A;  3E9I A;  3NEM A;  2XAH A;  1E24 A;  4YRJ A;  2Q7G A;  1PNM A;  2XAS A;  3ASO B;  1W2B U;  4XU2 A;  4XU0 A;  2Z3Y A;  4XTX A;  4YCU A;  3I56 V;  2WLK A;  5EBW C;  3BFM A;  1AJQ A;  4TWA A;  3TEH A;  3CPW U;  3OW2 U;  2I4N A;  1NYR A;  1KMN A;  1V55 C;  1NR1 A;  3IFX A;  1NJ1 A;  2ODR D;  3M4P A;  4TVY A;  3ZN1 A;  2DTO A;  3AG3 B;  2RHS B;  2ARS A;  2HVK C;  1PNK A;  4JTC B;  3W7T A;  1N9W A;  2ATK C;  1ATI A;  2QHV A;  4OLF A;  4Q15 A;  5ELN A;  4FK5 C;  4XU3 A;  1QF6 A;  3ZRW A;  4YXW G;  2WLI A;  1M9N A;  4PDM A;  2CJ9 A;  2DZC A;  1OCC C;  2BOB C;  2QM8 A;  1K3E A;  2IH1 C;  3HPL C;  4YRN A;  1MG1 A;  3SPG A;  1NJ8 A;  1KP2 A;  1F23 A;  1WPX A;  5EBM C;  1Q82 W;  2DXT A;  4H2T A;  3IG2 A;  1G8M A;  2EBO A;  2HKO A;  3IC7 A;  4WFA V;  5LBQ A;  1NVP B;  1Q86 W;  4LCU C;  1GMG A;  4CBC A;  1WLE A;  3LSQ A;  4G27 B;  1NKD A;  1VQN V;  3TCU A;  2DDZ A;  1ARO P;  1JJC A;  3W7S A;  2ITC C;  5EK0 A;  3ZRS A;  3A32 A;  3JD4 A;  2H8P C;  4UUJ C;  2WLN A;  4UVA A;  3OAA G;  5B1A C;  1BBU A;  2DU5 A;  2ZR2 A;  3A0R A;  4PDL A;  1ORQ C;  4P75 C;  3HTZ A;  2LFR A;  3E2E A;  3SPJ A;  2EIK B;  1I5X A;  4TQF A;  1P7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...