3LSSA

Trypanosoma brucei seryl-trna synthetase in complex with atp
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
438
Chain Sequence
GSMMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEACVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
total genus 159
structure length 438
sequence length 470
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lssA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lssA02
4YROA 4XU2A 1BIAA 4G85A 2CGHA 2EJ9A 1SESA 3HXXA 4YRTA 4TVWA 4XU0A 1ADYA 3EFRA 4G84A 4Q6GA 3RKWA 4X5OA 1G5HA 1C0AA 1NYRA 4UP7A 1YFSA 2DTHA 3V7RA 1SERA 3MF2A 3NEMA 4TTVA 4WF2A 1EIYA 3UFGA 3VQXA 2QHVA 4XU3A 4YRKA 4P75C 4L87A 4YCVA 3WQZA 3P8VA 1BBWA 1YFRA 3EFSA 3RL6A 2DKGA 4HWTA 4DQ2A 4TVYA 4YRJA 4KR2A 3VQVA 3A5ZA 1WYDA 3V7CA 3CMQA 2IY5B 4HWSA 1YGBA 3VQYA 2G4CA 3A74A 3E9IA 2PMEA 5HGQA 3V8JA 2ZZFA 4J15A 1X01A 1EVLA 3TEGA 4ZIBA 4HWPA 3REXA 4OP0A 1B70A 1ASYA 3MEYA 4RDXA 2E65A 2Q5HA 1L0WA 2DZCA 1NJ1A 1E24A 3R07A 4HVCA 4ZTUB 3HXWA 3RIRA 2ARUA 3HY0A 3ICAA 2QHUA 1ATIA 3E9HA 5F5WA 4DPGA 4P72A 2E5AA 5C52B 4UPAA 1H4QA 1BIBA 3HY1A 4YRQA 1NJ6A 4O2DA 4K86A 4YP0A 4YRPA 2CJAA 1B70B 11ASA 2E41A 3V7SA 4YRNA 4XEOA 3A7UA 4TQFA 3M4PA 1NJ8A 2Q7EA 4ZTZB 2ZTGA 2EAYA 1G5IA 1YB3A 2AKWA 4XTYA 2I4NA 4YRSA 2I4MA 1H4VB 2DDZA 4P73C 3LSSA 4P71C 3P8TA 2ALYB 4Q15A 3NETA 4H2UA 1B7YA 1LYLA 1ADJA 3RKXA 2QHTA 4YCWA 5ELNA 2DQ0A 1E22A 2RHQA 2ZT7A 3A32A 3IKLA 4YYEA 1NNHA 2DJZA 4BW9A 3HXZA 4AH6A 1Z7MA 4K87A 2CJBA 3UH0A 2DU7A 4P71A 1HXDA 2EJFA 3DSQA 2J3MA 4HWOA 3KFUA 1WLEA 3HXYA 4H2XA 2ZGWA 4P3NA 2P5IA 3IKMB 3RACA 1JJCA 1EQRA 3L4GA 1B7YB 1QE0A 1GGMA 3V8KA 2I4LA 3RKYA 3A7RA 2DTIA 1NYQA 1WU7A 4H2WA 4YRRA 1X54A 2ZT5A 3VBBA 4P3OA 3NELA 4PHCA 2ZNIA 3A7AA 1H4TA 4CH5A 2Q7GA 1X55A 4XEMA 3UGQA 4H2XB 3BFMA 1X2GA 2EWNA 1B8AA 1JJCB 4KQEA 2ZIOA 2CJ9A 4YRFA 1RIQA 1FYFA 3HRIA 3PCOA 1KMMA 3V8LA 2FYKA 1WNLA 4NCXA 4P75A 3W3SA 2ZR2A 1Z7NA 1WQ7A 4CS2A 2AMCA 4HWRA 1X56A 3IG2A 5ELOA 12ASA 4BWAA 3LC0A 4TVAA 4P74A 1USYA 3REUA 5E3IA 4XTXA 2ZINA 4H2VA 4YPFA 2E3CA 4UP8A 3HRKA 2E64A 3L1AA 4WI1A 4YRMA 4YDQA 4UP9A 2RHSA 2QHSA 4PG3A 1N9WA 1B76A 2C7IA 2ZT6A 1SETA 4XTWA 4H2YA 3HXUA 3G1ZA 2AMCB 4P74C 4TWAA 4OLFA 4CS4A 1IL2A 3QO7A 4TVAB 1EVKA 2Q7HA 3M4QA 4LNSA 2ZZEA 2ARTA 3HFVA 1PYSA 1G51A 1NJ2A 4K88A 4E51A 2XGTA 5C51B 2DZ9A 2RHSB 2XTIA 2ZZGA 1SRYA 4HA8A 4XTUA 2P0LA 3RUXA 4H2TA 2EL9A 2ODRD 2ARSA 1HC7A 3RF1A 3BJUA 3RGLA 4XTVA 3QNEA 4P3PA 1USYC 4YRIA 2AKWB 3FJPA 3A5YA 5K1PA 2ZCEA 2ZNJA 2CIMA 1EIYB 4P72C 1PYSB 2DU5A 2ALYA 3ERRA 2DXTA 3TEHA 4EO4A 2ODRC 1EFWA 3QTCA 1NJ5A 4WJ3M 2E10A 3I7FA 3P8YA 4XTZA 3HTZA 2HNIA 3PZCA 4YRCA 1X2HA 3PCOB 5KNNA 3IALA 4WJ4A 2DVEA 1E1TA 3NENA 4EX5A 3HFZB 1KOGA 2C8MA 3QO5A 2IY5A 3TUPA 2PMFA 4TQDA 4H02A 2EJGA 1BBUA 3OD1A 4YREA 2RHQB 4CH6A 3L2ZA 4H2SA 3TEHB 4RQEA 2J3LA 4RQFA 1HTTA 2DQ3A 1WQWA 5C53B 4KR3A 2DEQA 3QO8A 3HXVA 1E1OA 4YRLA 3UGTA 1ASZA 1VQZA 4CH3A 2ZXFA 1EOVA 1J5WA 1KMNA 1YFTA 4CH4A 3HFZA 4P73A 1W66A 3L4GB 3LSQA 2ZT8A 5K1XA 2ZIMA 4YCUA 2DXUA 3A31A 4YRGA 2I4OA 2ZR3A 3MF1A 1H4SA 2Q5IA 2DTOA 3VQWA 1WPYA 4CS3A 1QF6A 4XU1A 4RMFA 2E1HA
chains in the Genus database with same CATH superfamily
3DTUB 5EC1C 4H44B 1YSCA 2YEVA 2L6LA 4UUJC 1BHBA 4MSWC 3ZEDA 1XL6A 4R7CA 4U3JA 3HXXA 4MVQA 2OIEA 4YRTA 3N2KA 4NVPA 4WBNA 4LBEC 4LF9O 1ADYA 4JI5B 2M6YA 1UPGA 1WPBA 1IXBA 2E74B 4PI0A 1C0AA 3R66A 5LGUA 2HFEC 4Q20A 4DR7O 1YFSA 2DTHA 2GBOA 4JAAA 3E22A 2ZKOA 2ZE5A 2WLLB 1L0LH 4I4TA 3M8AA 1NZ6A 3VQXA 2QHVA 4XU3A 1IZ3A 5J2UB 4L87A 3WQZA 3STZC 1AP6A 3CYOA 2IU0A 3SJBC 1KYOF 4X65B 3CCUV 4FFBA 2YSUB 3CXCU 1M56C 5FLXN 2ZM6B 3BCCH 5C8YA 4AILC 4BIUA 1YGBA 4G28B 3E9IA 3UT5B 5LOVA 2W6IG 3T1CA 2ZZFA 3V8JA 1X01A 1IBMO 3OUSA 4ZIBA 4PJ0Z 2N04A 4WCEV 4GX0A 2WLLA 1VQ4V 3REXA 4WFGA 4GLXA 2HR3A 2B1GA 2LQTA 1FJGO 2Q5HA 1L0WA 1N36B 2KB1A 5LYJA 3HXWA 3B8MA 3B2EE 4K8ZA 4R6ZA 1DLBA 3HY0A 1VIBA 2QHUA 3F7VC 1KB9F 3W7UA 4TV9A 1VF6C 5H6RA 4I7ZB 3FAVB 1Q5OA 5CA0A 3OTOB 1H4QA 3FFQA 1N36O 3KG2A 2V4DA 1IBMB 3B40A 4TUYB 2YIDA 2LGWA 1PNKA 4XBFA 3APOA 4K86A 2OTLV 4YP0A 1YDXA 2CJAA 1B70B 1ZWIC 2EJ7A 3SPIA 2E41A 2DYRC 5A9GA 1PV0A 1BHAA 3CMAV 1S77D 3LDDA 2Q7EA 1YF2A 5EYPB 2A79B 2ZTGA 2M7WA 1H2KA 3W7WA 2EAYA 1G5IA 4LH6A 3SYAA 1XMOB 1JFFB 4DYLA 3G6EV 2CH7A 5LA6B 4UCUA 4J7ZA 3G71V 3L75H 4EFBA 3NETA 1Y66A 4GUNA 1XNQO 4A5UB 3BA8A 3K04A 4ZOLA 1N34O 3RKXA 3SGIA 3UCSC 5JJJB 1RPRA 4JI7O 1S5JA 4LFCO 4YCWA 5ELNA 2Y69C 5LMUO 1KKDA 4J41A 3AK2A 2IH3C 1PNMA 3RYFB 1XMQB 2RJZA 2RMKB 2QR4A 1P7BA 4YJ2A 4YYEA 5KX5B 3K5MA 5KMGA 3RYHB 1VARA 1H8EG 4UVCA 3L73H 2ODMA 2R9AA 3C3SA 3C3TA 2IM9A 3UH0A 2DU7A 5LA6A 4DV3B 3AG7A 2J3MA 3KZIZ 4B3TO 1GO3F 2ZGWA 5F2VO 1M1KW 1ORQC 2JEXA 1HP8A 2WLJA 3SJCC 3K5OA 2Q4PA 4Z1VA 1EM1A 3G80A 4JTAB 4LC1A 1WA8A 3FB8C 1GGMA 1OCRC 3JAWA 1AP5A 3E8BA 2DYRB 4TOIA 1V55C 4EB6B 1X54A 5L3DA 5KHHA 5D5QA 1VF5B 4P3OA 4JI2O 1W59A 2ZNIA 4TV8B 2A06H 5KHIA 3A7AA 2JDIG 4P9PA 4MW8A 1CEZA 2IBZH 4CH5A 3STLC 2WAMA 2Q7GA 5GW7A 1NVPB 1SZTA 2VWKA 4O4JB 4K35A 2PTMA 4FZ0A 1NI8A 3JAKA 1E79G 1NT2B 1RPOA 3UKMA 4HZ3A 4H2XB 1HNZO 3JSNA 1M56B 4DR7B 2QEXV 1NH2B 1OZ0A 1B06A 1IBKB 1AR4A 4YRFA 2GTAA 1RIQA 3ZHQA 4YY3B 3RFRA 1XNRB 5KHGA 4G2KA 2W6JG 2XAFA 1N32O 5IYZB 3W3SA 1JA8A 1E1RG 4LF6B 1WQ7A 1AILA 3K0GA 2BTQB 2R72A 3ETEA 2B9ZA 1X56A 4O4IB 3ABTA 1URFA 2DE0X 3IAYA 4UCVA 3MQZA 5JH7B 2VS0A 2DJVA 1USYA 5E3IA 3M7MX 2P6JA 2ZINA 4PDLA 1P7GA 4ZKIA 4YPFA 4UP8A 2E64A 1NU1H 4JI1O 4I9WA 3CP1A 4YRMA 4UP9A 1J95A 2F23A 4PA4A 2EJRA 2QWRB 4DUYO 3AG4C 3K79A 3ZN1A 4LFBB 1N32B 1XQ8A 4JI0O 3CSXA 3HXUA 4KHPO 2AMCB 4UVAA 3RT3C 3SDLA 4X1KB 3ABLC 3ABMC 1K5QA 5KX5A 4JAVA 5CN0A 1VQ6V 2IJKA 3M99B 3T1YB 1K92A 2Q7HA 2R9IA 4AHCA 3OTFA 1K9MW 5JH7A 2ZZEA 5L3CA 2ARTA 1KUQA 5KAIZ 1VQMV 2QM7A 4I0XB 3HFVA 1KECA 4X88A 2ITDC 1G51A 4K88A 1H2MA 2XGTA 3ZN0A 5IY5C 3OFNG 1M57B 2LO1A 4U7OA 1K5SA 1SRYA 4XTUA 1R1BA 1OCZB 1N4CA 1QR9A 3JD1A 1A32A 4H2TA 1D2DA 1HC7A 2Q6AA 2ZDIC 1S3JA 1FS0G 2OCCB 4DR1B 3NR7A 3RGLA 4QJFB 4P3PA 3CRCA 1USYC 5KHKA 3E8GA 2QWNB 3F7YC 3FJPA 2QTSA 2PI4A 3E2EA 4O2AB 2XNDG 4QGPA 4DV7O 2ETNA 5LBQA 5B1BB 4NXMO 5DEDA 1BQZA 4P72C 1FFXB 3TGUH 4KL1A 1D5NA 1I5XA 3TEHA 5KHJA 2Y48A 3AEIA 5GTIZ 1FKAO 2WLNA 1Q90D 2E10A 4WJ3M 2ZE7A 5L3EA 1ZL8A 3PZCA 4YRCA 1X2HA 4PA7A 5IY5B 4QE7A 4FZ1A 3NENA 2LJ2A 3JASA 3HFZB 1AROP 4LCUC 4DR6B 1EN6A 3A2FA 2NR5A 4B3RB 1BGYH 4TQDA 1BBUA 4YXWG 1XBLA 3JYCA 1H2SB 1BE3H 4B3SB 5IYBO 1AI7A 4P9OA 1FAFA 1XUQA 1Y76A 3CMEV 4MW3A 1WNSA 3ZBHA 2A3QA 3T1YO 4DO2A 4LF8O 3H01A 2DQ3A 4KR3A 4WFAV 1E1OA 1VQ5V 1QVGU 3CC7V 3HB3B 1EOVA 1KMNA 4DV3O 3BABA 4DV0O 2RQ6A 4LF9B 1IX9A 3C90A 2IW5A 1QQCA 1Z2GA 2OWOA 5EZYB 4I50B 1AI6A 1AI5A 1XEQA 1QLEC 2AZ0A 2VWJA 1JCHA 1YVWA 4KFMA 2ZT8A 4JI1B 4PV1B 1IDSA 4FPPA 1COWG 1V54C 1AVMA 1GN3A 1O9GA 1QR8A 3RW0A 3MF1A 3MHHC 2FMLA 2YXYA 2DTOA 2PZSA 2D3OW 4X20B 2P4VA 2JEUA 2NN4A 1K4CC 3A0BZ 4XU1A 1XNQB 1K4DC 5JVDB 3Q4HA 5BR8B 3AG4B 1K33A 2ZQMA 4YROA 4B3RO 4LR3A 4XU2A 4DR2B 1BIAA 4G85A 1HR0B 2CGHA 1MZEA 2EJ9A 3JARA 4KXRA 2Q8VA 3JCZA 2BCCH 1QHTA 4I50A 4J7JA 4Q6GA 2ARHA 3RKWA 3HKEA 1HNXO 2YI8A 4MVSA 1NYRA 2Y4UA 2MW2B 2CGNA 1E1QG 4UP7A 4J9ZB 4I5SA 4LF5O 3ETDA 3E8FA 1M90W 2OYQA 3SJQC 4GX1A 3ICXA 1ZTEA 4YJ2B 1GN2A 4YCVA 5IJ0A 4MVZA 4KP4A 1EFRG 2NNUA 2BTQA 3FB6C 3P8VA 1PM9A 1YFRA 2YEVB 1WJZA 2DKGA 4HWTA 1AJQA 5CBHA 4DQ2A 4ASUG 2IJJA 4H13B 4JI6B 4KR2A 4E2LA 2HHHB 4DW0A 1IXMA 3CJHA 2WLIA 1WYDA 3CMQA 2XAGA 3O9OA 2G4CA 1V9PA 3T2MA 3A74A 5EC2C 3E8HA 1TUBB 3K9SA 2UXBO 1EVLA 2OIGA 4HWPA 1YZBA 3HKCA 1V55B 1B70A 3ZMUA 5ITZB 5IJ0B 4GZRB 2YXHA 3ASNC 4DV2O 2F43G 3N2GA 4UCTA 2DZCA 1NJ1A 1E24A 4PD4F 4J10A 4IYIA 1HNWO 3CB2A 1BL8A 3ZHSA 3JALA 3CHXA 2ARUA 1Q82W 3ICAA 1KU9A 2LW7A 1ZLZA 1HWYA 2QM4A 1ATIA 3E9HA 3ZRXA 3HKBB 2CH7B 1EN5A 5C52B 1SA0B 1WAZA 2A7WA 4R50A 4LNUB 5JWPA 3OE7G 4X1IA 3SPHA 3HY1A 4LWSB 3TK1A 1MZFA 1YI2V 3CRQA 1TUBA 2QSAA 2W0XA 4PI2A 4JAUA 1YEWA 4DRXB 5BMVB 3A7UA 3N2GB 5KUKA 3M4PA 2C2AA 3DGEA 2JGDB 1XHZA 1FXKA 2AKWA 2HVKC 1PD3A 3WB1A 4JTCB 1SQBH 2GDSA 3K9AA 4BAYA 2I4NA 2I4MA 2GHYA 2DDZA 4P73C 3LSSA 3RYCA 4P71C 3P8TA 2ALYB 4Q15A 1H2LA 1YXBA 3ZHRA 1G4YB 4JYAO 2UU9O 4LVLA 4PA6A 4W4LA 2ILMA 4CC6A 1RP3B 3BA9A 3OAAG 1NNHA 3OR6C 5DN6G 1VP7A 1N34B 4PDVA 2Q73A 1WN7A 3RVYA 4LF7B 4BW9A 3HXZA 2Z3YA 4AH6A 4I9QA 2NS6A 4K87A 2UXXA 1JJ2U 1HXDA 4O2BB 4F4LA 4HWOA 4DV0B 3KFUA 1GM8A 3CCEV 1WLEA 3RYCB 4FFKA 4E4EA 3IKMB 2QM8A 3RACA 1EN4A 3D3QA 3HKDA 3ZMSA 1B7YB 2Y0PA 1QE0A 4B3MO 4IT5A 4DV4O 1WPXA 2I4LA 5DM6V 4LF4O 3A7RA 2QKSA 1YJNV 3KCXA 3RKYA 4QNHB 2YUAA 4X8AA 2V7QG 4H2WA 4J42A 3RYIA 2ZT5A 1OCOB 4H0LB 4JI4O 5IT9N 2DWDC 3CCRV 3NELA 4X89A 1FD9A 1YITV 1JJOA 3GWKC 3JD2A 1IURA 4GKKB 1YTFD 2WA3A 4ZBMA 3SR2C 3BRCA 2QWOB 4X64B 4DR6O 2CUGA 4XEMA 4MVUA 3TJTA 4J7KA 4AQYO 2CTRA 3WB0A 5CA1B 1MA1A 2QDOA 1X2GA 3CX5F 4DV1O 1B8AA 2VQFO 2ZIOA 2G38A 1ROPA 2PY5A 2E76B 5LL6Y 1KMMA 3V8LA 3U10A 3FX7A 3X2QB 3OR7C 3A0RA 4YY3O 1SS3A 1NS1A 2HP8A 4OX9B 3THOA 2AMCA 1XMOO 4HWRA 1KP3A 1Q6IA 1YCIA 3L71H 1OCCC 5ELOA 1SQPH 2RCVA 2ZXWC 2VQEB 3DC5A 1DGSA 4BWAA 3LC0A 1HNXB 3REUA 1AR5A 2K9PA 4NKGB 2GV9A 3SYCA 2CK3G 2LFSA 5IJ9B 2ZD9A 3CJHB 2JGUA 2P5OA 4JI3B 1N33B 1XL4A 1P4RA 1HNZB 4UCOA 4WI1A 4O4LA 1Y74B 5A2QN 3O65A 4K3AA 3K03A 1B76A 3LDCA 2ZT6A 5CBGA 3JSLA 4HBNA 3HPLC 1GRJA 5DECA 2XHBA 2Q67A 2RDCA 2Q9LA 1I0HA 2QKAA 3G1ZA 2F93B 3WG7B 2OCHA 2IH1C 4P74C 3E35A 4CS4A 2YC0A 3G6BA 3UT5A 5LOVB 4LNSA 1GH6A 3ZRWA 1O9HA 1R3IC 4CC5A 3WFVA 4F6RB 1LUVA 4ABMA 1AB3A 4DV7B 4YHHB 1KKCA 5C51B 4X9QA 1BZKA 5J9PC 2P0LA 3RUXA 3JALB 4EKWA 2EL9A 5B1OA 3JAWB 3D8CA 4DRXA 5BMVA 3RF1A 1GAXA 3UO3A 3D36A 3QNEA 1B3QA 1Y6XA 5KUMA 1B04A 4YRIA 4FK5C 4QE9A 2AKWB 4L8JA 3A5YA 2Y4TA 5B66Z 1BMFG 2EIKC 2CIMA 1ENVA 2OCCC 2UUCO 3U0ZA 1NTMH 1CXZB 3ASOB 3ZHUA 3ERRA 5EIBD 1Y76B 4UCRA 3LDEA 3HR0A 3QTCA 4UV8A 3I7FA 3P8YA 3HTZA 5HFMA 2YIAA 4JI5O 3QF7A 3KCYA 2DVEA 3TXQA 2WLHA 3ZRVA 1BQ0A 1H2GA 4FM1A 4UV9A 4B3SO 4DV5B 4JI0B 1V54B 1K73W 1BSMA 3NXSA 1K7DA 2ITCC 1F23A 3APQA 4JI2B 3BAAA 1MSDA 3T1HB 4YREA 3ABMB 2Q0OC 1FFXA 1VEWA 4O2AA 3CCMV 3D36C 5JCOA 4CH6A 2XTAA 3K57A 1SQGA 5IJ9A 4H2SA 4UFZA 1HDJA 3TEHB 3IC9A 2QA4V 4NTXA 4FVMA 2EBOA 4X20A 2JVDA 5H2FZ 1HTTA 2JJ2G 3BEHA 1QNMA 3IFXA 4F6EA 4MTFA 1DK1A 2X6AA 1MG1A 4Z2WA 1RM1C 3QO8A 4YRLA 1ASZA 4LF6O 5J2TB 4CH3A 1VQZA 1U97A 1ZL8B 2ZXFA 3AG3C 1YFTA 5C93A 1KBHA 3HFZA 1UJWB 3JATA 2Z0AA 5D5PA 1I5YA 2K1EA 1SA0A 3VOUA 1W66A 1JX9A 2BSKB 3L4GB 3LSQA 5LHIA 5K1XA 2P4KA 1XMQO 3P32A 4YCUA 2VQFB 1IBLB 2YIBA 2DXUA 2H3OA 2ZDIA 2ZR3A 5KAFZ 4ZHQB 2I4OA 1H4SA 2Q5IA 5TISZ 3VQWA 1VQ8V 4W4KA 4CS3A 1QF6A 4NTYA 4FLTA 5BZBA 3ZMZA 4RMFA 4ZI7B 3L72H 2N74A 2KQXA 2RNBA 2QWQB 1G1XB 4P2ZA 4JI3O 1N33O 5LHHA 2UUBB 4TVWA 1OV9A 5B1BC 3EFRA 1L0NH 2WLIB 4X5OA 2EIKB 4NTWA 1G5HA 4O4IA 2EX3A 1IBLO 2QTOA 2UU9B 1JVMA 4B7EA 3MF2A 4QPKA 4WF2A 2HJDA 3E89A 3UFGA 3WU2Z 1YJ9V 4HNAB 2EIMB 4P75C 4X62B 4NB5A 3DXRB 3KKYA 1AJPA 3I5DA 2DYSC 1DF5A 3RL6A 3CRRA 2ZT9B 4IIJB 1JPXA 2UUAO 5GONA 1S5LZ 4DV1B 3OMIB 3K59A 3A5ZA 1M5IA 2EULA 3S3WA 3AK3A 3CRAA 4K0KB 3V7CA 2IY5B 4HWSA 3VQYA 5HGQA 4J15A 3CS5A 3BVOA 3TEGA 3ZHTA 4FM2A 4DR4B 4AI8A 1GN6A 1ASYA 4DR3B 2CGOA 3H1JH 4NXNO 1N8RW 2E65A 4TV8A 1NH2D 1VQ7V 3R07A 1Q81W 2XOKG 4FLVA 5JQGA 4HVCA 5KA6A 1FXKB 3EFFK 4LF5B 1GM9A 4IIJA 4DW1A 4B08A 1R6NA 1HNWB 2X6CA 4X65O 1KD1W 4DPGA 2QKCA 2E5AA 4UPAA 3L70H 4DV2B 3K5LA 2KKWA 3WB2A 4K8XA 2R9RB 1T5EA 3RVZA 4LF7O 4O2DA 3CCSV 4MTOA 3S3XA 4YRPA 4YRNA 2QGNA 3OGIB 4QPJA 4TQFA 4MTGA 2WPDG 4J9YB 2LW1A 3K0DA 5B1AC 1VQLV 5EBMC 1NJ8A 1ZSPA 3T4DA 1XHXA 4ZTZB 3H1KH 2P67A 4ZI7A 4LVIA 1YB3A 2PGGA 3CWBH 5IDJA 1QVFU 4OPHA 4XTYA 4YRSA 3PN1A 1H4VB 3OMNB 1XI1A 1FXVA 1G6UA 1OJHA 1F51A 1GKFA 2ADQB 1G8MA 2X6BA 1AR1B 5FL7G 4LWSA 1BT8A 1B7YA 1CPYA 1S5HC 3SPJA 1LYLA 2OTJV 3OM3B 5B1AB 5CB4B 1IBKO 1I08A 2DQ0A 4I4TB 4RO2A 2RHQA 2KG7A 1Q3EA 5JCOC 1TUEB 1OCRB 5LMUB 4G27B 5JJEB 2DJZA 4JYBA 3B8NA 1RSOB 4NXNB 1JFFA 1VQ9V 2UXCB 2FTKA 4LP8A 2CJBA 1NR7A 5FNVA 4P71A 3DSQA 1PP9H 2WWWA 4H33A 1US6A 3HXYA 3ABUA 3MAQA 1DF4A 4DK0A 4JZ2A 3CE2A 1ZUQA 4X66O 3CCJV 1JJCA 4K0KO 1EQRA 3L4GA 4X1YA 2CE4A 5EIBC 1N0JA 2F4VB 1H8HG 4JV5B 4RUEA 5J2TA 1R73A 3EXAA 4LH7A 3RYFA 4N21A 1NYQA 1VQKV 1TVKB 3VBBA 3JD4A 3IJ4A 5JQGB 1H4TA 2BSKA 4J80A 1YTFB 2EINC 1KP2A 3UGQA 3BFMA 3P3NA 2H8PC 1Q86W 2UXDO 3FAVA 1F4MA 2YIBD 3HKBA 2EWNA 2HHHO 4TSFG 2D2CB 2VRZA 4FLXA 2YDEA 3OW2U 3OEEG 3AG2C 2PUSA 3HKDB 2ADPA 2WLKA 1FYFA 3HRIA 2E75B 2UXCO 3PCOA 2PYJA 2FYKA 1WNLA 4EB6A 4NCXA 4DV5O 1H2NA 3N2KB 2ZR2A 1ZAUA 4WBNB 2KSDA 4CS2A 3IG2A 12ASA 5LGTA 2EIJC 2W0FC 4R8CA 4TVAA 4P74A 3I55V 3SYPA 4CBCA 4WF9V 4XTXA 1SQXH 3ZHVA 2AZ2A 4KUMA 4H2VA 2E3CA 2JIZG 1GTOA 3ETGA 1K8AW 2CTWA 4XDKA 4LFBO 4YHHO 1BCCH 2DW4A 5LXTA 1N9WA 1LR1A 2RN9A 2LFRA 4PELA 3J80N 4XTWA 4H2YA 2EIMC 1M93A 4UCSA 2JS5A 4LVKA 2E5LO 1R6TA 1R3LC 2B5UA 3OT7A 1L1FA 3G4SV 4OLFA 3E83A 1EVKA 3M4QA 3B4SA 3ZCCA 4RAIA 1ZX3A 3CEIA 4NXMB 4WFHA 1R3JC 3JAMN 2JS3A 1Q7YW 2XTIA 4X1IB 1RM1B 2YI9A 2ZZGA 3H1IH 5H6QA 3RN4A 4JASA 3L74H 2PI5A 3L9DA 3UM7A 3JASB 3QVNA 4JPRA 3LNNA 2ODRD 5BY1A 1GMGA 4DUZO 3OUFA 1FXHA 4QIWF 2EILC 4IYHA 3RWRD 3SJAC 4Z1MG 2LP7A 4X1KA 4D7TA 1K34A 4FIPC 4TUYA 1Z5VA 2P90A 3PJSK 1M9NA 5EBWC 3OD4A 5K1PA 5L3BA 4HYOA 1EIYB 2DU5A 4LFAO 3K5NA 4B7KA 1Q6HA 3AG3B 1MABG 1XDCA 2IJIA 2DXTA 3J7AU 2JGDA 2Y0IA 1KMIZ 1NJ5A 1S72V 2QJ1A 1YJWV 2EZOA 3IGAC 2E5LB 1IVSA 5IE9A 3TCUA 4DUZB 3IALA 4OX9O 2ZE8A 3ASOC 1E1TA 2KG7B 2WSSG 4EX5A 3SYQA 1KOGA 2YS8A 1QBZA 3P3PA 4JI8O 3FKSG 4XDJA 2IY5A 2PMFA 4H02A 3OGCC 2EJGA 2AXTZ 1XNRO 5IWAO 2RHQB 4ZHQA 4U3FH 2Q0AA 3MD0A 1AJNA 3T4ZA 1LNQA 4RQEA 2J3LA 4FLWA 2N05A 1K97A 4X64O 1I94B 3F5WC 2BOCC 5IYDO 1N0NA 3Q4HB 3CCVV 2DEQA 5EK0A 4GX5A 1J5WA 4P73A 4BW5A 3K58A 1R6KA 2F66C 3ML0A 3BFRA 1FFTB 4DXWA 4B3MB 2EIJB 4FJCC 4BIOA 4FLYA 2P7TC 1CP9A 3WG7C 4F6RA 3LNMB 3CC4V 2ZE6A 4IGGA 2BOBC 4FM0A 2E1HA 4C7UA 4JYYA 2ATKC 4UB6Z 1KQSU 1SF9A 2DOSA 2UXBB 3OTOO 3LUTB 3ABKC 1SESA 3B77A 5EZYA 1XOUA 4XU0A 4IL6Z 3UQ8A 4G84A 1SQVH 2XUMA 2CAZC 1LUWA 5C8YB 1K3EA 1MMMA 2L35A 3ZS8C 2HVJC 1S0VA 3V7RA 1SERA 2CDYA 3NEMA 4TTVA 1EZJA 4TT3G 2A8EA 1EIYA 1BS3A 1KC8W 1P49A 1R3KC 2GUZB 4YRKA 1EBOA 4WFBV 2YICA 5JVDA 5E79Z 3CRMA 1BBWA 2WLMA 3EFSA 1M57C 4HT4A 2LGQA 4GKJB 3H9VA 1WP7A 3AG2B 2DWEC 1F7YA 3AG1B 5FNVB 4TVYA 1FYJA 4YRJA 4LF4B 4TV9B 3VQVA 1JR9A 3HKEB 1FPOA 1VQOV 4P30A 1QCEA 2EINB 2XAJA 3ZMTA 4JI7B 1VQNV 1SC5B 2PF4E 3FB7C 2PMEA 1OCCB 2A9HA 3ABLB 5LGNA 4FLUA 1HR0O 1OCOC 4JTDB 4OP0A 3MEYA 4RDXA 1I94O 2IU3A 2Q5ZA 2CTQA 3CD6V 2EZPA 5AG2A 2JRIA 2V1DA 3CC2V 4ZTUB 5BXZA 3RIRA 5EYPA 3JD0A 4O4JA 3SYOA 5FPRA 2XAQA 2CTPA 4FFBB 5F5WA 4MT8A 4P72A 4KHPB 1BIBA 1M4UA 3ZJZA 5IWAB 4JGSA 4ZOLB 4YRQA 1NJ6A 1SKVA 3CXHF 5LP6A 1NQTA 2HEPA 5LMNB 1W2BU 3ETQA 11ASA 5IYZA 5CA3A 3V7SA 4JI8B 3JCUZ 3HKCB 3FYEB 4YIOA 4XEOA 2AGAA 4PA3A 4ICGA 5GTHZ 1AI4A 3FB5C 3EVKA 2X7RB 3E86A 1L8DA 2UUBO 4O2BA 3JARB 4DR4O 5EBLC 4U3JB 5B5EZ 4H2UA 5E1AC 1FXKC 5LP6B 1ADJA 2QHTA 2P22C 1E22A 4FLZA 2ZM6O 2ZT7A 2UXDB 2HJFC 1J5EB 3A32A 1TAEA 1TVKA 2NLJC 3IKLA 3GWOA 2XAHA 3RGBA 1H38A 5B3SB 1VF7A 1DTOA 1Z7MA 2HG5C 4UXNA 5BR8O 2UUCB 1MSWD 1U96A 4XDLA 2EJFA 3W7XA 3MHSC 4CZZA 4H2XA 4TWKA 5CA1A 3J81N 1VF6A 4P3NA 2P5IA 4NYKA 3FYIB 3AG1C 5LHGA 5B3SC 4LFCB 5CB4A 4X66B 3CCQV 1JOYA 1VMGA 5HFLA 3V8KA 2AHZA 2Q68A 4I55B 2FYUH 1SQFA 1FJGB 3K08A 2PYLA 1OHHG 3T1HO 1GK9A 1PPJH 2DTIA 4GKKO 1WU7A 4YRRA 4OPAA 2BTOA 2Y69B 1Q6UA 2P06A 4RUFA 3RYHA 4PHCA 5CMUA 2A0LA 5LP6C 4HAMA 4X62O 1RSOA 1NTZH 1X55A 5KA5A 1S76D 1NBMG 1EZVH 2GSMB 2FKXA 3A8TA 3CPWU 4IHJB 2MK3A 4U7NA 4JF3A 1JMKC 1Y67A 4N23A 1SZXA 1JJCB 1I7FA 4KQEA 4OGQB 1WP8A 4GCZA 3BHPA 3OEHG 1Y74A 2CJ9A 2GTSA 2DYSB 2IJHA 2Z5UA 3QG5A 3ASNB 4I55A 4AQYB 4DV6O 3ZIAG 1SQQH 4PDMA 4JZGA 1WB7A 4DUYB 3P30A 1Q43A 4EFEA 4P75A 4DR2O 5J2UA 1PNLA 3GVMA 1Z7NA 1Q8IA 1P84F 3DXRA 3IC7A 1W0KG 3I56V 3DC6A 2XASA 4DV4B 3K06A 1NJIW 4D6TH 3JAKB 4IHJA 4DK1A 4YJ3A 3HRKA 2GUZA 3R65A 3L1AA 4YDQA 4JYAB 1Y4MA 4B3TB 1GM7A 2RHSA 2QHSA 4PG3A 2C7IA 1SETA 5IYCO 3RBZA 4GYCB 4DR1O 2O57A 3OMAB 3ZX6A 1MNGA 3MDSA 1J5EO 3EHBB 4TWAA 4MVOA 3FD9A 1IL2A 3QO7A 2DMXA 3F5TA 3BPZA 4TVAB 2JJ1G 4BIZA 4LFAB 2HKOA 1W0JG 3AK1A 4DR3O 2R70A 1QU7A 4LVMA 4PA9A 5CA0B 4O4LB 3H1HH 4O4HA 2BE3A 1PYSA 4LVJA 4E51A 1NJ2A 2Q69A 2DZ9A 1D5AA 2RHSB 1HW7A 1GN4A 5LYJB 5H5NA 1YIJV 4HA8A 1THZA 5KLVH 5LXTB 4RWUA 1WA8B 3U11A 4WFFA 2YXLA 2ARSA 2AW9A 2VQEO 3BJUA 2F95B 4WFEA 4XTVA 3B09A 1X59A 5H9CA 4GT1A 2XT9A 1QLEB 5LMNO 4GKJO 1VQPV 3G67A 4UVBA 3E22B 2ZCEA 2ZNJA 2HLDG 3ZRWB 2DN9A 2EILB 4I0XA 1PYSB 5L3FA 4GX2A 4HNAA 3ABKB 4UB8Z 2ALYA 3TXSA 4D7SA 1UFIA 4EO4A 2ODRC 1EFWA 1TA8A 1NR1A 1NTKH 4XTZA 3GB7C 2HNIA 4OXSA 3PCOB 5KNNA 5GONB 4WJ4A 4PHZA 3ZMVA 4DR5O 2C8MA 3JATB 4JI6O 3QO5A 4NR1A 4FMTA 1NVPD 1Z5WA 1TGOA 5KMGB 1JQ0A 1PKXA 4JI4B 3TUPA 3UO2A 4DV6B 3OD1A 2AHYA 3SPGA 4MVMA 2F1MA 4H37A 3D3IA 1X4TA 4LF8B 5FPOA 1WB8A 4EEQA 3TETA 5ITZA 4YJ3B 1NKDA 4MVRA 2X0LA 2QWPB 4J11A 3L2ZA 2OT5A 4PDRA 2F4VO 4JV5O 1XREA 3ZRSA 5CBFA 4RQFA 1F4NA 3A0HZ 2FL4A 4X1YB 3JD3A 1WQWA 5C53B 2B1IA 4BR6A 1QLNA 3HXVA 1PL0A 3UGTA 1B6QA 2UXNA 5B1NA 1MOFA 4CH4A 4MTXA 3RYIB 2FB5A 3H1LH 4YIPA 4DR5B 4LNUA 1PL4A 2JK5C 4JYCA 5JJNB 2ZXWB 3W7TA 4MS2A 3K3WA 2H94A 2ZIMA 2UUAB 3A31A 4YRGA 3N27A 1RFYA 3X2QC 5L3GA 4O4HB 1WPYA 3SPCA 3BY6A 3LSUA 3CCLV 2WA4A 1XILA 1OCZC 2QE7G 3W7SA 1YHQV
chains in the Genus database with same CATH topology
2ZQMA 4YROA 3DTUB 5EC1C 2ATKC 1YSCA 4XU2A 1KQSU 2YEVA 4CH3A 1BIAA 4G85A 2CGHA 4UUJC 1BHBA 4MSWC 3LUTB 1XL6A 2EJ9A 3ABKC 4R7CA 4P2ZA 1SESA 3B77A 3JCZA 4MVQA 3HXXA 5LHHA 4YRTA 5C53B 4TVWA 4XU0A 4LBEC 5B1BC 1ADYA 3EFRA 4G84A 2WLIB 4Q6GA 3RKWA 4X5OA 2EIKB 1K3EA 4MVSA 1G5HA 1C0AA 1NYRA 5LGUA 2HFEC 2HVJC 4Q20A 1E1QG 4UP7A 1S0VA 1YFSA 2DTHA 4J9ZB 2QTOA 4I5SA 1SERA 3V7RA 1JVMA 3ETDA 3E8FA 2WLLB 3MF2A 3NEMA 1M90W 1EZJA 4QPKA 4TTVA 4TT3G 4WF2A 2A8EA 3E89A 1EIYA 3UFGA 3SJQC 4GX1A 1KC8W 2QHVA 1YJ9V 4XU3A 1R3KC 3VQXA 4YRKA 2EIMB 1EBOA 4WFBV 4P75C 4L87A 4YCVA 4MVZA 3WQZA 4KP4A 1EFRG 3STZC 2NNUA 3FB6C 3P8VA 1BBWA 2WLMA 1AJPA 2DYSC 1YFRA 1DF5A 1M57C 2YEVB 3EFSA 3RL6A 4HT4A 3CYOA 2DKGA 4HWTA 3AG2B 2IU0A 1AJQA 5CBHA 4DQ2A 2DWEC 3AG1B 4ASUG 4LVIA 1JPXA 2IJJA 3CCUV 4TVYA 4YRJA 4KR2A 2YSUB 4E2LA 3CXCU 3VQVA 3OMIB 1M56C 3A5ZA 1IXMA 1VQOV 4P30A 1QCEA 2WLIA 1WYDA 2EINB 2XAJA 3ZMTA 3CMQA 3V7CA 2IY5B 4BIUA 4HWSA 2XAGA 1VQNV 1YGBA 4G28B 2G4CA 3VQYA 3T2MA 3A74A 3FB7C 3E9IA 5EC2C 2PMEA 1OCCB 2W6IG 5HGQA 3E8HA 3T1CA 2ZZFA 1X01A 4J15A 3V8JA 2A9HA 3ABLB 3OUSA 5LGNA 1EVLA 3TEGA 4ZIBA 4HWPA 4WCEV 4GX0A 1OCOC 2WLLA 1VQ4V 3REXA 4JTDB 1V55B 4OP0A 1B70A 1ASYA 3ZMUA 4WFGA 3MEYA 4RDXA 2IU3A 1N8RW 2E65A 2HR3A 2B1GA 2Q5HA 1L0WA 3ASNC 2F43G 1NH2D 1VQ7V 2EZPA 3CD6V 2KB1A 2DZCA 1Q81W 2XOKG 1E24A 1NJ1A 3R07A 2V1DA 3UGTA 3CC2V 4HVCA 4ZTUB 3HXWA 3RIRA 3B8MA 5KA6A 1BL8A 1FXKB 3JD0A 1DLBA 4R6ZA 3SYOA 2ARUA 3EFFK 1Q82W 1GM9A 3HY0A 3ICAA 1R6NA 2XAQA 2QHUA 1ATIA 1HWYA 3F7VC 3W7UA 2X6CA 3E9HA 5H6RA 5F5WA 1KD1W 4MT8A 4P72A 4DPGA 3ZRXA 2E5AA 5C52B 4UPAA 1H4QA 1BIBA 3KG2A 3ZJZA 4R50A 4JGSA 2R9RB 3OE7G 3RVZA 3SPHA 1NJ6A 3HY1A 4YRQA 1PNKA 3TK1A 4XBFA 4O2DA 3CCSV 4MTOA 4K86A 2OTLV 1NQTA 4YP0A 1W2BU 1YI2V 4YRPA 2CJAA 1B70B 1ZWIC 11ASA 4JAUA 3SPIA 2E41A 5CA3A 3V7SA 4YRNA 2DYRC 3FYEB 4QPJA 1BHAA 3A7UA 4TQFA 4XEOA 4MTGA 2WPDG 4J9YB 3CMAV 5KUKA 3M4PA 3K0DA 4PA3A 1S77D 2C2AA 3DGEA 5B1AC 5EBMC 3LDDA 1VQLV 1NJ8A 2Q7EA 3T4DA 4ZTZB 2A79B 2ZTGA 1AI4A 2M7WA 3FB5C 2P67A 3W7WA 2EAYA 1FXKA 2X7RB 3E86A 1G5IA 1YB3A 2AKWA 2HVKC 3SYAA 1PD3A 5IDJA 4JTCB 1QVFU 3HXVA 3K9AA 4BAYA 4XTYA 1HTTA 2I4NA 4YRSA 2I4MA 2GHYA 5EBLC 1H4VB 2DDZA 4P73C 3LSSA 3OMNB 1FXVA 3G6EV 4P71C 1F51A 1GKFA 1G8MA 3G71V 2ALYB 3P8TA 4Q15A 3NETA 1Y66A 4H2UA 5E1AC 2X6BA 1AR1B 5FL7G 1B7YA 1FXKC 3K04A 1CPYA 1S5HC 3SPJA 1ADJA 1LYLA 3RKXA 1G4YB 2QHTA 2OTJV 1RPRA 3OM3B 4YCWA 5ELNA 5B1AB 2Y69C 2DQ0A 1E22A 4RO2A 1KKDA 2RHQA 4PA6A 4LVLA 2IH3C 2ZT7A 2HJFC 1PNMA 3A32A 1TUEB 2NLJC 3IKLA 1P7BA 1OCRB 3OAAG 3GWOA 1NNHA 2XAHA 3OR6C 5DN6G 4YYEA 4G27B 1H38A 4PDVA 4JYBA 2DJZA 3B8NA 5B3SB 3RVYA 1H8EG 4BW9A 1DTOA 3HXZA 2Z3YA 4UVCA 2HG5C 4UXNA 1VQ9V 1Z7MA 1MSWD 4AH6A 2FTKA 4K87A 2NS6A 4LP8A 2UXXA 1NR7A 1JJ2U 2CJBA 2DU7A 4P71A 3UH0A 4XDLA 1HXDA 2EJFA 3DSQA 4F4LA 2J3MA 3W7XA 4HWOA 2WWWA 3KFUA 1GM8A 3MHSC 4H33A 4CZZA 3CCEV 1GO3F 1WLEA 3HXYA 4H2XA 2ZGWA 3ABUA 4TWKA 1DF4A 4P3NA 2P5IA 1M1KW 3IKMB 2QM8A 3AG1C 3FYIB 5LHGA 1ORQC 2JEXA 2WLJA 3RACA 3CCJV 1JJCA 5B3SC 3ZMSA 1EQRA 3L4GA 1B7YB 1QE0A 1H8HG 4JTAB 4LC1A 3FB8C 4RUEA 1GGMA 1OCRC 3CCQV 1JOYA 1WPXA 5HFLA 3V8KA 1R73A 2AHZA 5DM6V 2I4LA 2Q68A 2QKSA 1YJNV 3A7RA 3RKYA 3K08A 4N21A 1OHHG 4X8AA 1GK9A 3E8BA 2DYRB 4QNHB 1NYQA 2DTIA 2V7QG 1V55C 1WU7A 4H2WA 1X54A 4YRRA 5L3DA 1VQKV 2ZT5A 2Y69B 1OCOB 3VBBA 4RUFA 4P3OA 2DWDC 3JD4A 3CCRV 3NELA 4X89A 4PHCA 2ZNIA 1YITV 3JD2A 5CMUA 3A7AA 2A0LA 2JDIG 4MW8A 4P9PA 1CEZA 1YTFD 1H4TA 4CH5A 3STLC 4HAMA 2WAMA 4ZBMA 1NVPB 5GW7A 2Q7GA 1SZTA 1X55A 4XEMA 1YTFB 5KA5A 2EINC 1KP2A 1E79G 1NBMG 1RPOA 2GSMB 4MVUA 1S76D 3UKMA 3CPWU 4HZ3A 3UGQA 4H2XB 2MK3A 3BFMA 4U7NA 2H8PC 1M56B 4JF3A 1Q86W 1X2GA 1F4MA 4N23A 2QEXV 2EWNA 1B8AA 4TSFG 1NH2B 1JJCB 1OZ0A 3OW2U 4KQEA 4GCZA 3OEEG 3AG2C 3OEHG 2ZIOA 2CJ9A 4YRFA 2DYSB 2WLKA 1RIQA 1FYFA 3HRIA 2IJHA 1ROPA 2Z5UA 3ASNB 3PCOA 3ZIAG 1KMMA 4PDMA 2FYKA 3V8LA 4G2KA 2W6JG 2XAFA 3P30A 3X2QB 1WNLA 4NCXA 3OR7C 3A0RA 4P75A 3W3SA 2ZR2A 1PNLA 1Z7NA 1E1RG 1WQ7A 4CS2A 2AMCA 3K0GA 4KR3A 4HWRA 1KP3A 3ETEA 3IC7A 1X56A 1OCCC 3IG2A 3ABTA 5ELOA 2ZXWC 1W0KG 12ASA 5LGTA 2EIJC 2W0FC 3I56V 4R8CA 4BWAA 3LC0A 3MQZA 4TVAA 4P74A 1USYA 3REUA 2XASA 3I55V 3K06A 3SYPA 4CBCA 4WF9V 1NJIW 4XTXA 5E3IA 3SYCA 2CK3G 2P6JA 4PDLA 4KUMA 4ZKIA 2ZINA 4H2VA 2LFSA 2E3CA 2JIZG 4UP8A 2ZD9A 4YPFA 1GTOA 3HRKA 3ETGA 1K8AW 2E64A 1XL4A 3R65A 1P4RA 4XDKA 4I9WA 3L1AA 3CP1A 4WI1A 4YRMA 4YDQA 1Y4MA 4UP9A 1GM7A 1J95A 4PA4A 2RHSA 2DW4A 2EJRA 2QHSA 4PG3A 1N9WA 3K03A 1B76A 3AG4C 3K79A 3LDCA 3ZN1A 2C7IA 2ZT6A 1SETA 2LFRA 4PELA 3RBZA 5CBGA 5IYCO 4XTWA 4H2YA 3HPLC 2EIMC 3HXUA 2Q67A 3OMAB 4LVKA 3G1ZA 2AMCB 4UVAA 3WG7B 1R3LC 2B5UA 1L1FA 3EHBB 3ABLC 2IH1C 3ABMC 1K5QA 3G4SV 4JAVA 3E35A 4MVOA 5CN0A 4OLFA 4P74C 4TWAA 3QO7A 1VQ6V 2IJKA 3M99B 3E83A 4CS4A 1IL2A 4TVAB 1K92A 2JJ1G 1EVKA 2R9IA 2Q7HA 1K9MW 3M4QA 4LNSA 3ZRWA 4BIZA 2ZZEA 3ZCCA 1R3IC 4RAIA 5L3CA 2HKOA 3WFVA 1W0JG 2ARTA 4LVMA 4PA9A 1VQMV 2QM7A 3HFVA 1PYSA 1KECA 4X88A 2ITDC 4WFHA 1G51A 1NJ2A 4K88A 4E51A 1R3JC 4LVJA 2Q69A 2XGTA 3ZN0A 1Q7YW 5IY5C 5C51B 2DZ9A 2RHSB 3OFNG 2XTIA 5J9PC 1RM1B 1M57B 4U7OA 1K5SA 2ZZGA 1SRYA 1YIJV 1THZA 4HA8A 4XTUA 1OCZB 5H6QA 2P0LA 3RUXA 1QR9A 3JD1A 4JASA 4EKWA 4H2TA 2EL9A 4WFFA 5B1OA 2PI5A 3UM7A 4JPRA 2ODRD 2ARSA 1GMGA 1HC7A 3RF1A 2Q6AA 3OUFA 3BJUA 2ZDIC 1FXHA 1FS0G 2OCCB 2EILC 1S3JA 4QIWF 4WFEA 4XTVA 3RGLA 4QJFB 1ASZA 3D36A 3QNEA 5KUMA 4P3PA 1USYC 4Z1MG 2LP7A 5H9CA 4YRIA 4GT1A 1K34A 4FK5C 4FIPC 3E8GA 4QE9A 2AKWB 1QLEB 1VQPV 3F7YC 4UVBA 3A5YA 3FJPA 2P90A 2PI4A 1BMFG 3PJSK 1M9NA 2EIKC 5EBWC 5L3BA 3E2EA 2ZCEA 5K1PA 2XNDG 2ZNJA 4HYOA 2CIMA 2HLDG 3ZRWB 5LBQA 5B1BB 1ENVA 2EILB 2OCCC 1EIYB 4P72C 1PYSB 5L3FA 4GX2A 2DU5A 3ABKB 3ASOB 2ALYA 3ERRA 3AG3B 1MABG 2IJIA 2DXTA 1I5XA 3TEHA 4EO4A 3LDEA 2ODRC 1EFWA 3QTCA 2Y48A 3AEIA 1NR1A 4UV8A 1NJ5A 2WLNA 1S72V 1YJWV 2E10A 4WJ3M 3I7FA 5L3EA 2EZOA 3HTZA 3GB7C 3P8YA 3IGAC 5HFMA 4OXSA 2HNIA 3PZCA 4XTZA 4YRCA 1X2HA 4PA7A 5IY5B 4QE7A 3TCUA 3PCOB 5KNNA 3IALA 4WJ4A 2DVEA 3ASOC 1E1TA 2WSSG 3NENA 2WLHA 3ZRVA 3ZMVA 3SYQA 1H2GA 4EX5A 4UV9A 3HFZB 1KOGA 1AROP 4LCUC 1V54B 1K73W 2C8MA 1QBZA 3QO5A 3FKSG 4FMTA 1NVPD 4XDJA 3NXSA 1K7DA 2ITCC 2IY5A 1JQ0A 1F23A 1PKXA 3TUPA 2PMFA 3W7SA 4TQDA 4H02A 3OGCC 2EJGA 1BBUA 3OD1A 4YXWG 2AHYA 3ABMB 1YHQV 4YREA 3SPGA 4YRLA 3CCMV 4MVMA 3JYCA 2RHQB 4H37A 3D3IA 5IYBO 4CH6A 3L2ZA 3TETA 1AI7A 4H2SA 1NKDA 3MD0A 2X0LA 4MVRA 4P9OA 1AJNA 4MW3A 3T4ZA 2OT5A 4PDRA 3CMEV 2QA4V 2DEQA 1LNQA 2EBOA 4RQEA 2J3LA 3ZRSA 4DO2A 5CBFA 2JJ2G 3H01A 3BEHA 1K97A 1F4NA 2DQ3A 4RQFA 3IFXA 4MTFA 2X6AA 1MG1A 2BOCC 3F5WC 3JD3A 5IYDO 2B1IA 3CCVV 1RM1C 1WQWA 3QO8A 5EK0A 4GX5A 4WFAV 1PL0A 1QLNA 1VQ5V 1QVGU 3CC7V 1E1OA 1VQZA 1B6QA 3HB3B 2ZXFA 1EOVA 2UXNA 5B1NA 1J5WA 1MOFA 3AG3C 1KMNA 1YFTA 5C93A 4CH4A 4MTXA 3HFZA 1UJWB 2IW5A 4P73A 1I5YA 2K1EA 4BW5A 1R6KA 3ML0A 3VOUA 1W66A 1AI6A 1FFTB 1AI5A 2JK5C 4JYCA 1JX9A 1QLEC 4DXWA 2EIJB 3L4GB 2ZXWB 3LSQA 3W7TA 1JCHA 4FJCC 4KFMA 3K3WA 4MS2A 2ZT8A 5LHIA 5K1XA 2H94A 2ZIMA 4FPPA 2P7TC 4YCUA 3P32A 1CP9A 1COWG 1V54C 3WG7C 2DXUA 1QR8A 3A31A 3RW0A 4YRGA 2ZDIA 2ZR3A 3LNMB 3MHHC 3CC4V 2I4OA 2Q5IA 2DTOA 3MF1A 1VQ8V 3VQWA 2D3OW 2BOBC 1H4SA 3X2QC 5L3GA 1WPYA 4CS3A 2JEUA 3SPCA 1K4CC 3BY6A 1QF6A 3CCLV 4XU1A 1OCZC 2QE7G 3ZMZA 1K4DC 5BZBA 3TEHB 4RMFA 3AG4B 2E1HA 1K33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRO A;  4XU2 A;  1BIA A;  4G85 A;  2CGH A;  2EJ9 A;  1SES A;  3HXX A;  4YRT A;  4TVW A;  4XU0 A;  1ADY A;  3EFR A;  4G84 A;  4Q6G A;  3RKW A;  4X5O A;  1G5H A;  1C0A A;  1NYR A;  4UP7 A;  1YFS A;  2DTH A;  3V7R A;  1SER A;  3MF2 A;  3NEM A;  4TTV A;  4WF2 A;  1EIY A;  3UFG A;  3VQX A;  2QHV A;  4XU3 A;  4YRK A;  4P75 C;  4L87 A;  4YCV A;  3WQZ A;  3P8V A;  1BBW A;  1YFR A;  3EFS A;  3RL6 A;  2DKG A;  4HWT A;  4DQ2 A;  4TVY A;  4YRJ A;  4KR2 A;  3VQV A;  3A5Z A;  1WYD A;  3V7C A;  3CMQ A;  2IY5 B;  4HWS A;  1YGB A;  3VQY A;  2G4C A;  3A74 A;  3E9I A;  2PME A;  5HGQ A;  3V8J A;  2ZZF A;  4J15 A;  1X01 A;  1EVL A;  3TEG A;  4ZIB A;  4HWP A;  3REX A;  4OP0 A;  1B70 A;  1ASY A;  3MEY A;  4RDX A;  2E65 A;  2Q5H A;  1L0W A;  2DZC A;  1NJ1 A;  1E24 A;  3R07 A;  4HVC A;  4ZTU B;  3HXW A;  3RIR A;  2ARU A;  3HY0 A;  3ICA A;  2QHU A;  1ATI A;  3E9H A;  5F5W A;  4DPG A;  4P72 A;  2E5A A;  5C52 B;  4UPA A;  1H4Q A;  1BIB A;  3HY1 A;  4YRQ A;  1NJ6 A;  4O2D A;  4K86 A;  4YP0 A;  4YRP A;  2CJA A;  1B70 B;  11AS A;  2E41 A;  3V7S A;  4YRN A;  4XEO A;  3A7U A;  4TQF A;  3M4P A;  1NJ8 A;  2Q7E A;  4ZTZ B;  2ZTG A;  2EAY A;  1G5I A;  1YB3 A;  2AKW A;  4XTY A;  2I4N A;  4YRS A;  2I4M A;  1H4V B;  2DDZ A;  4P73 C;  3LSS A;  4P71 C;  3P8T A;  2ALY B;  4Q15 A;  3NET A;  4H2U A;  1B7Y A;  1LYL A;  1ADJ A;  3RKX A;  2QHT A;  4YCW A;  5ELN A;  2DQ0 A;  1E22 A;  2RHQ A;  2ZT7 A;  3A32 A;  3IKL A;  4YYE A;  1NNH A;  2DJZ A;  4BW9 A;  3HXZ A;  4AH6 A;  1Z7M A;  4K87 A;  2CJB A;  3UH0 A;  2DU7 A;  4P71 A;  1HXD A;  2EJF A;  3DSQ A;  2J3M A;  4HWO A;  3KFU A;  1WLE A;  3HXY A;  4H2X A;  2ZGW A;  4P3N A;  2P5I A;  3IKM B;  3RAC A;  1JJC A;  1EQR A;  3L4G A;  1B7Y B;  1QE0 A;  1GGM A;  3V8K A;  2I4L A;  3RKY A;  3A7R A;  2DTI A;  1NYQ A;  1WU7 A;  4H2W A;  4YRR A;  1X54 A;  2ZT5 A;  3VBB A;  4P3O A;  3NEL A;  4PHC A;  2ZNI A;  3A7A A;  1H4T A;  4CH5 A;  2Q7G A;  1X55 A;  4XEM A;  3UGQ A;  4H2X B;  3BFM A;  1X2G A;  2EWN A;  1B8A A;  1JJC B;  4KQE A;  2ZIO A;  2CJ9 A;  4YRF A;  1RIQ A;  1FYF A;  3HRI A;  3PCO A;  1KMM A;  3V8L A;  2FYK A;  1WNL A;  4NCX A;  4P75 A;  3W3S A;  2ZR2 A;  1Z7N A;  1WQ7 A;  4CS2 A;  2AMC A;  4HWR A;  1X56 A;  3IG2 A;  5ELO A;  12AS A;  4BWA A;  3LC0 A;  4TVA A;  4P74 A;  1USY A;  3REU A;  5E3I A;  4XTX A;  2ZIN A;  4H2V A;  4YPF A;  2E3C A;  4UP8 A;  3HRK A;  2E64 A;  3L1A A;  4WI1 A;  4YRM A;  4YDQ A;  4UP9 A;  2RHS A;  2QHS A;  4PG3 A;  1N9W A;  1B76 A;  2C7I A;  2ZT6 A;  1SET A;  4XTW A;  4H2Y A;  3HXU A;  3G1Z A;  2AMC B;  4P74 C;  4TWA A;  4OLF A;  4CS4 A;  1IL2 A;  3QO7 A;  4TVA B;  1EVK A;  2Q7H A;  3M4Q A;  4LNS A;  2ZZE A;  2ART A;  3HFV A;  1PYS A;  1G51 A;  1NJ2 A;  4K88 A;  4E51 A;  2XGT A;  5C51 B;  2DZ9 A;  2RHS B;  2XTI A;  2ZZG A;  1SRY A;  4HA8 A;  4XTU A;  2P0L A;  3RUX A;  4H2T A;  2EL9 A;  2ODR D;  2ARS A;  1HC7 A;  3RF1 A;  3BJU A;  3RGL A;  4XTV A;  3QNE A;  4P3P A;  1USY C;  4YRI A;  2AKW B;  3FJP A;  3A5Y A;  5K1P A;  2ZCE A;  2ZNJ A;  2CIM A;  1EIY B;  4P72 C;  1PYS B;  2DU5 A;  2ALY A;  3ERR A;  2DXT A;  3TEH A;  4EO4 A;  2ODR C;  1EFW A;  3QTC A;  1NJ5 A;  4WJ3 M;  2E10 A;  3I7F A;  3P8Y A;  4XTZ A;  3HTZ A;  2HNI A;  3PZC A;  4YRC A;  1X2H A;  3PCO B;  5KNN A;  3IAL A;  4WJ4 A;  2DVE A;  1E1T A;  3NEN A;  4EX5 A;  3HFZ B;  1KOG A;  2C8M A;  3QO5 A;  2IY5 A;  3TUP A;  2PMF A;  4TQD A;  4H02 A;  2EJG A;  1BBU A;  3OD1 A;  4YRE A;  2RHQ B;  4CH6 A;  3L2Z A;  4H2S A;  3TEH B;  4RQE A;  2J3L A;  4RQF A;  1HTT A;  2DQ3 A;  1WQW A;  5C53 B;  4KR3 A;  2DEQ A;  3QO8 A;  3HXV A;  1E1O A;  4YRL A;  3UGT A;  1ASZ A;  1VQZ A;  4CH3 A;  2ZXF A;  1EOV A;  1J5W A;  1KMN A;  1YFT A;  4CH4 A;  3HFZ A;  4P73 A;  1W66 A;  3L4G B;  3LSQ A;  2ZT8 A;  5K1X A;  2ZIM A;  4YCU A;  2DXU A;  3A31 A;  4YRG A;  2I4O A;  2ZR3 A;  3MF1 A;  1H4S A;  2Q5I A;  2DTO A;  3VQW A;  1WPY A;  4CS3 A;  1QF6 A;  4XU1 A;  4RMF A;  2E1H A; 
#chains in the Genus database with same CATH topology
 3DTU B;  5EC1 C;  4H44 B;  1YSC A;  2YEV A;  2L6L A;  4UUJ C;  1BHB A;  4MSW C;  3ZED A;  1XL6 A;  4R7C A;  4U3J A;  3HXX A;  4MVQ A;  2OIE A;  4YRT A;  3N2K A;  4NVP A;  4WBN A;  4LBE C;  4LF9 O;  1ADY A;  4JI5 B;  2M6Y A;  1UPG A;  1WPB A;  1IXB A;  2E74 B;  4PI0 A;  1C0A A;  3R66 A;  5LGU A;  2HFE C;  4Q20 A;  4DR7 O;  1YFS A;  2DTH A;  2GBO A;  4JAA A;  3E22 A;  2ZKO A;  2ZE5 A;  2WLL B;  1L0L H;  4I4T A;  3M8A A;  1NZ6 A;  3VQX A;  2QHV A;  4XU3 A;  1IZ3 A;  5J2U B;  4L87 A;  3WQZ A;  3STZ C;  1AP6 A;  3CYO A;  2IU0 A;  3SJB C;  1KYO F;  4X65 B;  3CCU V;  4FFB A;  2YSU B;  3CXC U;  1M56 C;  5FLX N;  2ZM6 B;  3BCC H;  5C8Y A;  4AIL C;  4BIU A;  1YGB A;  4G28 B;  3E9I A;  3UT5 B;  5LOV A;  2W6I G;  3T1C A;  2ZZF A;  3V8J A;  1X01 A;  1IBM O;  3OUS A;  4ZIB A;  4PJ0 Z;  2N04 A;  4WCE V;  4GX0 A;  2WLL A;  1VQ4 V;  3REX A;  4WFG A;  4GLX A;  2HR3 A;  2B1G A;  2LQT A;  1FJG O;  2Q5H A;  1L0W A;  1N36 B;  2KB1 A;  5LYJ A;  3HXW A;  3B8M A;  3B2E E;  4K8Z A;  4R6Z A;  1DLB A;  3HY0 A;  1VIB A;  2QHU A;  3F7V C;  1KB9 F;  3W7U A;  4TV9 A;  1VF6 C;  5H6R A;  4I7Z B;  3FAV B;  1Q5O A;  5CA0 A;  3OTO B;  1H4Q A;  3FFQ A;  1N36 O;  3KG2 A;  2V4D A;  1IBM B;  3B40 A;  4TUY B;  2YID A;  2LGW A;  1PNK A;  4XBF A;  3APO A;  4K86 A;  2OTL V;  4YP0 A;  1YDX A;  2CJA A;  1B70 B;  1ZWI C;  2EJ7 A;  3SPI A;  2E41 A;  2DYR C;  5A9G A;  1PV0 A;  1BHA A;  3CMA V;  1S77 D;  3LDD A;  2Q7E A;  1YF2 A;  5EYP B;  2A79 B;  2ZTG A;  2M7W A;  1H2K A;  3W7W A;  2EAY A;  1G5I A;  4LH6 A;  3SYA A;  1XMO B;  1JFF B;  4DYL A;  3G6E V;  2CH7 A;  5LA6 B;  4UCU A;  4J7Z A;  3G71 V;  3L75 H;  4EFB A;  3NET A;  1Y66 A;  4GUN A;  1XNQ O;  4A5U B;  3BA8 A;  3K04 A;  4ZOL A;  1N34 O;  3RKX A;  3SGI A;  3UCS C;  5JJJ B;  1RPR A;  4JI7 O;  1S5J A;  4LFC O;  4YCW A;  5ELN A;  2Y69 C;  5LMU O;  1KKD A;  4J41 A;  3AK2 A;  2IH3 C;  1PNM A;  3RYF B;  1XMQ B;  2RJZ A;  2RMK B;  2QR4 A;  1P7B A;  4YJ2 A;  4YYE A;  5KX5 B;  3K5M A;  5KMG A;  3RYH B;  1VAR A;  1H8E G;  4UVC A;  3L73 H;  2ODM A;  2R9A A;  3C3S A;  3C3T A;  2IM9 A;  3UH0 A;  2DU7 A;  5LA6 A;  4DV3 B;  3AG7 A;  2J3M A;  3KZI Z;  4B3T O;  1GO3 F;  2ZGW A;  5F2V O;  1M1K W;  1ORQ C;  2JEX A;  1HP8 A;  2WLJ A;  3SJC C;  3K5O A;  2Q4P A;  4Z1V A;  1EM1 A;  3G80 A;  4JTA B;  4LC1 A;  1WA8 A;  3FB8 C;  1GGM A;  1OCR C;  3JAW A;  1AP5 A;  3E8B A;  2DYR B;  4TOI A;  1V55 C;  4EB6 B;  1X54 A;  5L3D A;  5KHH A;  5D5Q A;  1VF5 B;  4P3O A;  4JI2 O;  1W59 A;  2ZNI A;  4TV8 B;  2A06 H;  5KHI A;  3A7A A;  2JDI G;  4P9P A;  4MW8 A;  1CEZ A;  2IBZ H;  4CH5 A;  3STL C;  2WAM A;  2Q7G A;  5GW7 A;  1NVP B;  1SZT A;  2VWK A;  4O4J B;  4K35 A;  2PTM A;  4FZ0 A;  1NI8 A;  3JAK A;  1E79 G;  1NT2 B;  1RPO A;  3UKM A;  4HZ3 A;  4H2X B;  1HNZ O;  3JSN A;  1M56 B;  4DR7 B;  2QEX V;  1NH2 B;  1OZ0 A;  1B06 A;  1IBK B;  1AR4 A;  4YRF A;  2GTA A;  1RIQ A;  3ZHQ A;  4YY3 B;  3RFR A;  1XNR B;  5KHG A;  4G2K A;  2W6J G;  2XAF A;  1N32 O;  5IYZ B;  3W3S A;  1JA8 A;  1E1R G;  4LF6 B;  1WQ7 A;  1AIL A;  3K0G A;  2BTQ B;  2R72 A;  3ETE A;  2B9Z A;  1X56 A;  4O4I B;  3ABT A;  1URF A;  2DE0 X;  3IAY A;  4UCV A;  3MQZ A;  5JH7 B;  2VS0 A;  2DJV A;  1USY A;  5E3I A;  3M7M X;  2P6J A;  2ZIN A;  4PDL A;  1P7G A;  4ZKI A;  4YPF A;  4UP8 A;  2E64 A;  1NU1 H;  4JI1 O;  4I9W A;  3CP1 A;  4YRM A;  4UP9 A;  1J95 A;  2F23 A;  4PA4 A;  2EJR A;  2QWR B;  4DUY O;  3AG4 C;  3K79 A;  3ZN1 A;  4LFB B;  1N32 B;  1XQ8 A;  4JI0 O;  3CSX A;  3HXU A;  4KHP O;  2AMC B;  4UVA A;  3RT3 C;  3SDL A;  4X1K B;  3ABL C;  3ABM C;  1K5Q A;  5KX5 A;  4JAV A;  5CN0 A;  1VQ6 V;  2IJK A;  3M99 B;  3T1Y B;  1K92 A;  2Q7H A;  2R9I A;  4AHC A;  3OTF A;  1K9M W;  5JH7 A;  2ZZE A;  5L3C A;  2ART A;  1KUQ A;  5KAI Z;  1VQM V;  2QM7 A;  4I0X B;  3HFV A;  1KEC A;  4X88 A;  2ITD C;  1G51 A;  4K88 A;  1H2M A;  2XGT A;  3ZN0 A;  5IY5 C;  3OFN G;  1M57 B;  2LO1 A;  4U7O A;  1K5S A;  1SRY A;  4XTU A;  1R1B A;  1OCZ B;  1N4C A;  1QR9 A;  3JD1 A;  1A32 A;  4H2T A;  1D2D A;  1HC7 A;  2Q6A A;  2ZDI C;  1S3J A;  1FS0 G;  2OCC B;  4DR1 B;  3NR7 A;  3RGL A;  4QJF B;  4P3P A;  3CRC A;  1USY C;  5KHK A;  3E8G A;  2QWN B;  3F7Y C;  3FJP A;  2QTS A;  2PI4 A;  3E2E A;  4O2A B;  2XND G;  4QGP A;  4DV7 O;  2ETN A;  5LBQ A;  5B1B B;  4NXM O;  5DED A;  1BQZ A;  4P72 C;  1FFX B;  3TGU H;  4KL1 A;  1D5N A;  1I5X A;  3TEH A;  5KHJ A;  2Y48 A;  3AEI A;  5GTI Z;  1FKA O;  2WLN A;  1Q90 D;  2E10 A;  4WJ3 M;  2ZE7 A;  5L3E A;  1ZL8 A;  3PZC A;  4YRC A;  1X2H A;  4PA7 A;  5IY5 B;  4QE7 A;  4FZ1 A;  3NEN A;  2LJ2 A;  3JAS A;  3HFZ B;  1ARO P;  4LCU C;  4DR6 B;  1EN6 A;  3A2F A;  2NR5 A;  4B3R B;  1BGY H;  4TQD A;  1BBU A;  4YXW G;  1XBL A;  3JYC A;  1H2S B;  1BE3 H;  4B3S B;  5IYB O;  1AI7 A;  4P9O A;  1FAF A;  1XUQ A;  1Y76 A;  3CME V;  4MW3 A;  1WNS A;  3ZBH A;  2A3Q A;  3T1Y O;  4DO2 A;  4LF8 O;  3H01 A;  2DQ3 A;  4KR3 A;  4WFA V;  1E1O A;  1VQ5 V;  1QVG U;  3CC7 V;  3HB3 B;  1EOV A;  1KMN A;  4DV3 O;  3BAB A;  4DV0 O;  2RQ6 A;  4LF9 B;  1IX9 A;  3C90 A;  2IW5 A;  1QQC A;  1Z2G A;  2OWO A;  5EZY B;  4I50 B;  1AI6 A;  1AI5 A;  1XEQ A;  1QLE C;  2AZ0 A;  2VWJ A;  1JCH A;  1YVW A;  4KFM A;  2ZT8 A;  4JI1 B;  4PV1 B;  1IDS A;  4FPP A;  1COW G;  1V54 C;  1AVM A;  1GN3 A;  1O9G A;  1QR8 A;  3RW0 A;  3MF1 A;  3MHH C;  2FML A;  2YXY A;  2DTO A;  2PZS A;  2D3O W;  4X20 B;  2P4V A;  2JEU A;  2NN4 A;  1K4C C;  3A0B Z;  4XU1 A;  1XNQ B;  1K4D C;  5JVD B;  3Q4H A;  5BR8 B;  3AG4 B;  1K33 A;  2ZQM A;  4YRO A;  4B3R O;  4LR3 A;  4XU2 A;  4DR2 B;  1BIA A;  4G85 A;  1HR0 B;  2CGH A;  1MZE A;  2EJ9 A;  3JAR A;  4KXR A;  2Q8V A;  3JCZ A;  2BCC H;  1QHT A;  4I50 A;  4J7J A;  4Q6G A;  2ARH A;  3RKW A;  3HKE A;  1HNX O;  2YI8 A;  4MVS A;  1NYR A;  2Y4U A;  2MW2 B;  2CGN A;  1E1Q G;  4UP7 A;  4J9Z B;  4I5S A;  4LF5 O;  3ETD A;  3E8F A;  1M90 W;  2OYQ A;  3SJQ C;  4GX1 A;  3ICX A;  1ZTE A;  4YJ2 B;  1GN2 A;  4YCV A;  5IJ0 A;  4MVZ A;  4KP4 A;  1EFR G;  2NNU A;  2BTQ A;  3FB6 C;  3P8V A;  1PM9 A;  1YFR A;  2YEV B;  1WJZ A;  2DKG A;  4HWT A;  1AJQ A;  5CBH A;  4DQ2 A;  4ASU G;  2IJJ A;  4H13 B;  4JI6 B;  4KR2 A;  4E2L A;  2HHH B;  4DW0 A;  1IXM A;  3CJH A;  2WLI A;  1WYD A;  3CMQ A;  2XAG A;  3O9O A;  2G4C A;  1V9P A;  3T2M A;  3A74 A;  5EC2 C;  3E8H A;  1TUB B;  3K9S A;  2UXB O;  1EVL A;  2OIG A;  4HWP A;  1YZB A;  3HKC A;  1V55 B;  1B70 A;  3ZMU A;  5ITZ B;  5IJ0 B;  4GZR B;  2YXH A;  3ASN C;  4DV2 O;  2F43 G;  3N2G A;  4UCT A;  2DZC A;  1NJ1 A;  1E24 A;  4PD4 F;  4J10 A;  4IYI A;  1HNW O;  3CB2 A;  1BL8 A;  3ZHS A;  3JAL A;  3CHX A;  2ARU A;  1Q82 W;  3ICA A;  1KU9 A;  2LW7 A;  1ZLZ A;  1HWY A;  2QM4 A;  1ATI A;  3E9H A;  3ZRX A;  3HKB B;  2CH7 B;  1EN5 A;  5C52 B;  1SA0 B;  1WAZ A;  2A7W A;  4R50 A;  4LNU B;  5JWP A;  3OE7 G;  4X1I A;  3SPH A;  3HY1 A;  4LWS B;  3TK1 A;  1MZF A;  1YI2 V;  3CRQ A;  1TUB A;  2QSA A;  2W0X A;  4PI2 A;  4JAU A;  1YEW A;  4DRX B;  5BMV B;  3A7U A;  3N2G B;  5KUK A;  3M4P A;  2C2A A;  3DGE A;  2JGD B;  1XHZ A;  1FXK A;  2AKW A;  2HVK C;  1PD3 A;  3WB1 A;  4JTC B;  1SQB H;  2GDS A;  3K9A A;  4BAY A;  2I4N A;  2I4M A;  2GHY A;  2DDZ A;  4P73 C;  3LSS A;  3RYC A;  4P71 C;  3P8T A;  2ALY B;  4Q15 A;  1H2L A;  1YXB A;  3ZHR A;  1G4Y B;  4JYA O;  2UU9 O;  4LVL A;  4PA6 A;  4W4L A;  2ILM A;  4CC6 A;  1RP3 B;  3BA9 A;  3OAA G;  1NNH A;  3OR6 C;  5DN6 G;  1VP7 A;  1N34 B;  4PDV A;  2Q73 A;  1WN7 A;  3RVY A;  4LF7 B;  4BW9 A;  3HXZ A;  2Z3Y A;  4AH6 A;  4I9Q A;  2NS6 A;  4K87 A;  2UXX A;  1JJ2 U;  1HXD A;  4O2B B;  4F4L A;  4HWO A;  4DV0 B;  3KFU A;  1GM8 A;  3CCE V;  1WLE A;  3RYC B;  4FFK A;  4E4E A;  3IKM B;  2QM8 A;  3RAC A;  1EN4 A;  3D3Q A;  3HKD A;  3ZMS A;  1B7Y B;  2Y0P A;  1QE0 A;  4B3M O;  4IT5 A;  4DV4 O;  1WPX A;  2I4L A;  5DM6 V;  4LF4 O;  3A7R A;  2QKS A;  1YJN V;  3KCX A;  3RKY A;  4QNH B;  2YUA A;  4X8A A;  2V7Q G;  4H2W A;  4J42 A;  3RYI A;  2ZT5 A;  1OCO B;  4H0L B;  4JI4 O;  5IT9 N;  2DWD C;  3CCR V;  3NEL A;  4X89 A;  1FD9 A;  1YIT V;  1JJO A;  3GWK C;  3JD2 A;  1IUR A;  4GKK B;  1YTF D;  2WA3 A;  4ZBM A;  3SR2 C;  3BRC A;  2QWO B;  4X64 B;  4DR6 O;  2CUG A;  4XEM A;  4MVU A;  3TJT A;  4J7K A;  4AQY O;  2CTR A;  3WB0 A;  5CA1 B;  1MA1 A;  2QDO A;  1X2G A;  3CX5 F;  4DV1 O;  1B8A A;  2VQF O;  2ZIO A;  2G38 A;  1ROP A;  2PY5 A;  2E76 B;  5LL6 Y;  1KMM A;  3V8L A;  3U10 A;  3FX7 A;  3X2Q B;  3OR7 C;  3A0R A;  4YY3 O;  1SS3 A;  1NS1 A;  2HP8 A;  4OX9 B;  3THO A;  2AMC A;  1XMO O;  4HWR A;  1KP3 A;  1Q6I A;  1YCI A;  3L71 H;  1OCC C;  5ELO A;  1SQP H;  2RCV A;  2ZXW C;  2VQE B;  3DC5 A;  1DGS A;  4BWA A;  3LC0 A;  1HNX B;  3REU A;  1AR5 A;  2K9P A;  4NKG B;  2GV9 A;  3SYC A;  2CK3 G;  2LFS A;  5IJ9 B;  2ZD9 A;  3CJH B;  2JGU A;  2P5O A;  4JI3 B;  1N33 B;  1XL4 A;  1P4R A;  1HNZ B;  4UCO A;  4WI1 A;  4O4L A;  1Y74 B;  5A2Q N;  3O65 A;  4K3A A;  3K03 A;  1B76 A;  3LDC A;  2ZT6 A;  5CBG A;  3JSL A;  4HBN A;  3HPL C;  1GRJ A;  5DEC A;  2XHB A;  2Q67 A;  2RDC A;  2Q9L A;  1I0H A;  2QKA A;  3G1Z A;  2F93 B;  3WG7 B;  2OCH A;  2IH1 C;  4P74 C;  3E35 A;  4CS4 A;  2YC0 A;  3G6B A;  3UT5 A;  5LOV B;  4LNS A;  1GH6 A;  3ZRW A;  1O9H A;  1R3I C;  4CC5 A;  3WFV A;  4F6R B;  1LUV A;  4ABM A;  1AB3 A;  4DV7 B;  4YHH B;  1KKC A;  5C51 B;  4X9Q A;  1BZK A;  5J9P C;  2P0L A;  3RUX A;  3JAL B;  4EKW A;  2EL9 A;  5B1O A;  3JAW B;  3D8C A;  4DRX A;  5BMV A;  3RF1 A;  1GAX A;  3UO3 A;  3D36 A;  3QNE A;  1B3Q A;  1Y6X A;  5KUM A;  1B04 A;  4YRI A;  4FK5 C;  4QE9 A;  2AKW B;  4L8J A;  3A5Y A;  2Y4T A;  5B66 Z;  1BMF G;  2EIK C;  2CIM A;  1ENV A;  2OCC C;  2UUC O;  3U0Z A;  1NTM H;  1CXZ B;  3ASO B;  3ZHU A;  3ERR A;  5EIB D;  1Y76 B;  4UCR A;  3LDE A;  3HR0 A;  3QTC A;  4UV8 A;  3I7F A;  3P8Y A;  3HTZ A;  5HFM A;  2YIA A;  4JI5 O;  3QF7 A;  3KCY A;  2DVE A;  3TXQ A;  2WLH A;  3ZRV A;  1BQ0 A;  1H2G A;  4FM1 A;  4UV9 A;  4B3S O;  4DV5 B;  4JI0 B;  1V54 B;  1K73 W;  1BSM A;  3NXS A;  1K7D A;  2ITC C;  1F23 A;  3APQ A;  4JI2 B;  3BAA A;  1MSD A;  3T1H B;  4YRE A;  3ABM B;  2Q0O C;  1FFX A;  1VEW A;  4O2A A;  3CCM V;  3D36 C;  5JCO A;  4CH6 A;  2XTA A;  3K57 A;  1SQG A;  5IJ9 A;  4H2S A;  4UFZ A;  1HDJ A;  3TEH B;  3IC9 A;  2QA4 V;  4NTX A;  4FVM A;  2EBO A;  4X20 A;  2JVD A;  5H2F Z;  1HTT A;  2JJ2 G;  3BEH A;  1QNM A;  3IFX A;  4F6E A;  4MTF A;  1DK1 A;  2X6A A;  1MG1 A;  4Z2W A;  1RM1 C;  3QO8 A;  4YRL A;  1ASZ A;  4LF6 O;  5J2T B;  4CH3 A;  1VQZ A;  1U97 A;  1ZL8 B;  2ZXF A;  3AG3 C;  1YFT A;  5C93 A;  1KBH A;  3HFZ A;  1UJW B;  3JAT A;  2Z0A A;  5D5P A;  1I5Y A;  2K1E A;  1SA0 A;  3VOU A;  1W66 A;  1JX9 A;  2BSK B;  3L4G B;  3LSQ A;  5LHI A;  5K1X A;  2P4K A;  1XMQ O;  3P32 A;  4YCU A;  2VQF B;  1IBL B;  2YIB A;  2DXU A;  2H3O A;  2ZDI A;  2ZR3 A;  5KAF Z;  4ZHQ B;  2I4O A;  1H4S A;  2Q5I A;  5TIS Z;  3VQW A;  1VQ8 V;  4W4K A;  4CS3 A;  1QF6 A;  4NTY A;  4FLT A;  5BZB A;  3ZMZ A;  4RMF A;  4ZI7 B;  3L72 H;  2N74 A;  2KQX A;  2RNB A;  2QWQ B;  1G1X B;  4P2Z A;  4JI3 O;  1N33 O;  5LHH A;  2UUB B;  4TVW A;  1OV9 A;  5B1B C;  3EFR A;  1L0N H;  2WLI B;  4X5O A;  2EIK B;  4NTW A;  1G5H A;  4O4I A;  2EX3 A;  1IBL O;  2QTO A;  2UU9 B;  1JVM A;  4B7E A;  3MF2 A;  4QPK A;  4WF2 A;  2HJD A;  3E89 A;  3UFG A;  3WU2 Z;  1YJ9 V;  4HNA B;  2EIM B;  4P75 C;  4X62 B;  4NB5 A;  3DXR B;  3KKY A;  1AJP A;  3I5D A;  2DYS C;  1DF5 A;  3RL6 A;  3CRR A;  2ZT9 B;  4IIJ B;  1JPX A;  2UUA O;  5GON A;  1S5L Z;  4DV1 B;  3OMI B;  3K59 A;  3A5Z A;  1M5I A;  2EUL A;  3S3W A;  3AK3 A;  3CRA A;  4K0K B;  3V7C A;  2IY5 B;  4HWS A;  3VQY A;  5HGQ A;  4J15 A;  3CS5 A;  3BVO A;  3TEG A;  3ZHT A;  4FM2 A;  4DR4 B;  4AI8 A;  1GN6 A;  1ASY A;  4DR3 B;  2CGO A;  3H1J H;  4NXN O;  1N8R W;  2E65 A;  4TV8 A;  1NH2 D;  1VQ7 V;  3R07 A;  1Q81 W;  2XOK G;  4FLV A;  5JQG A;  4HVC A;  5KA6 A;  1FXK B;  3EFF K;  4LF5 B;  1GM9 A;  4IIJ A;  4DW1 A;  4B08 A;  1R6N A;  1HNW B;  2X6C A;  4X65 O;  1KD1 W;  4DPG A;  2QKC A;  2E5A A;  4UPA A;  3L70 H;  4DV2 B;  3K5L A;  2KKW A;  3WB2 A;  4K8X A;  2R9R B;  1T5E A;  3RVZ A;  4LF7 O;  4O2D A;  3CCS V;  4MTO A;  3S3X A;  4YRP A;  4YRN A;  2QGN A;  3OGI B;  4QPJ A;  4TQF A;  4MTG A;  2WPD G;  4J9Y B;  2LW1 A;  3K0D A;  5B1A C;  1VQL V;  5EBM C;  1NJ8 A;  1ZSP A;  3T4D A;  1XHX A;  4ZTZ B;  3H1K H;  2P67 A;  4ZI7 A;  4LVI A;  1YB3 A;  2PGG A;  3CWB H;  5IDJ A;  1QVF U;  4OPH A;  4XTY A;  4YRS A;  3PN1 A;  1H4V B;  3OMN B;  1XI1 A;  1FXV A;  1G6U A;  1OJH A;  1F51 A;  1GKF A;  2ADQ B;  1G8M A;  2X6B A;  1AR1 B;  5FL7 G;  4LWS A;  1BT8 A;  1B7Y A;  1CPY A;  1S5H C;  3SPJ A;  1LYL A;  2OTJ V;  3OM3 B;  5B1A B;  5CB4 B;  1IBK O;  1I08 A;  2DQ0 A;  4I4T B;  4RO2 A;  2RHQ A;  2KG7 A;  1Q3E A;  5JCO C;  1TUE B;  1OCR B;  5LMU B;  4G27 B;  5JJE B;  2DJZ A;  4JYB A;  3B8N A;  1RSO B;  4NXN B;  1JFF A;  1VQ9 V;  2UXC B;  2FTK A;  4LP8 A;  2CJB A;  1NR7 A;  5FNV A;  4P71 A;  3DSQ A;  1PP9 H;  2WWW A;  4H33 A;  1US6 A;  3HXY A;  3ABU A;  3MAQ A;  1DF4 A;  4DK0 A;  4JZ2 A;  3CE2 A;  1ZUQ A;  4X66 O;  3CCJ V;  1JJC A;  4K0K O;  1EQR A;  3L4G A;  4X1Y A;  2CE4 A;  5EIB C;  1N0J A;  2F4V B;  1H8H G;  4JV5 B;  4RUE A;  5J2T A;  1R73 A;  3EXA A;  4LH7 A;  3RYF A;  4N21 A;  1NYQ A;  1VQK V;  1TVK B;  3VBB A;  3JD4 A;  3IJ4 A;  5JQG B;  1H4T A;  2BSK A;  4J80 A;  1YTF B;  2EIN C;  1KP2 A;  3UGQ A;  3BFM A;  3P3N A;  2H8P C;  1Q86 W;  2UXD O;  3FAV A;  1F4M A;  2YIB D;  3HKB A;  2EWN A;  2HHH O;  4TSF G;  2D2C B;  2VRZ A;  4FLX A;  2YDE A;  3OW2 U;  3OEE G;  3AG2 C;  2PUS A;  3HKD B;  2ADP A;  2WLK A;  1FYF A;  3HRI A;  2E75 B;  2UXC O;  3PCO A;  2PYJ A;  2FYK A;  1WNL A;  4EB6 A;  4NCX A;  4DV5 O;  1H2N A;  3N2K B;  2ZR2 A;  1ZAU A;  4WBN B;  2KSD A;  4CS2 A;  3IG2 A;  12AS A;  5LGT A;  2EIJ C;  2W0F C;  4R8C A;  4TVA A;  4P74 A;  3I55 V;  3SYP A;  4CBC A;  4WF9 V;  4XTX A;  1SQX H;  3ZHV A;  2AZ2 A;  4KUM A;  4H2V A;  2E3C A;  2JIZ G;  1GTO A;  3ETG A;  1K8A W;  2CTW A;  4XDK A;  4LFB O;  4YHH O;  1BCC H;  2DW4 A;  5LXT A;  1N9W A;  1LR1 A;  2RN9 A;  2LFR A;  4PEL A;  3J80 N;  4XTW A;  4H2Y A;  2EIM C;  1M93 A;  4UCS A;  2JS5 A;  4LVK A;  2E5L O;  1R6T A;  1R3L C;  2B5U A;  3OT7 A;  1L1F A;  3G4S V;  4OLF A;  3E83 A;  1EVK A;  3M4Q A;  3B4S A;  3ZCC A;  4RAI A;  1ZX3 A;  3CEI A;  4NXM B;  4WFH A;  1R3J C;  3JAM N;  2JS3 A;  1Q7Y W;  2XTI A;  4X1I B;  1RM1 B;  2YI9 A;  2ZZG A;  3H1I H;  5H6Q A;  3RN4 A;  4JAS A;  3L74 H;  2PI5 A;  3L9D A;  3UM7 A;  3JAS B;  3QVN A;  4JPR A;  3LNN A;  2ODR D;  5BY1 A;  1GMG A;  4DUZ O;  3OUF A;  1FXH A;  4QIW F;  2EIL C;  4IYH A;  3RWR D;  3SJA C;  4Z1M G;  2LP7 A;  4X1K A;  4D7T A;  1K34 A;  4FIP C;  4TUY A;  1Z5V A;  2P90 A;  3PJS K;  1M9N A;  5EBW C;  3OD4 A;  5K1P A;  5L3B A;  4HYO A;  1EIY B;  2DU5 A;  4LFA O;  3K5N A;  4B7K A;  1Q6H A;  3AG3 B;  1MAB G;  1XDC A;  2IJI A;  2DXT A;  3J7A U;  2JGD A;  2Y0I A;  1KMI Z;  1NJ5 A;  1S72 V;  2QJ1 A;  1YJW V;  2EZO A;  3IGA C;  2E5L B;  1IVS A;  5IE9 A;  3TCU A;  4DUZ B;  3IAL A;  4OX9 O;  2ZE8 A;  3ASO C;  1E1T A;  2KG7 B;  2WSS G;  4EX5 A;  3SYQ A;  1KOG A;  2YS8 A;  1QBZ A;  3P3P A;  4JI8 O;  3FKS G;  4XDJ A;  2IY5 A;  2PMF A;  4H02 A;  3OGC C;  2EJG A;  2AXT Z;  1XNR O;  5IWA O;  2RHQ B;  4ZHQ A;  4U3F H;  2Q0A A;  3MD0 A;  1AJN A;  3T4Z A;  1LNQ A;  4RQE A;  2J3L A;  4FLW A;  2N05 A;  1K97 A;  4X64 O;  1I94 B;  3F5W C;  2BOC C;  5IYD O;  1N0N A;  3Q4H B;  3CCV V;  2DEQ A;  5EK0 A;  4GX5 A;  1J5W A;  4P73 A;  4BW5 A;  3K58 A;  1R6K A;  2F66 C;  3ML0 A;  3BFR A;  1FFT B;  4DXW A;  4B3M B;  2EIJ B;  4FJC C;  4BIO A;  4FLY A;  2P7T C;  1CP9 A;  3WG7 C;  4F6R A;  3LNM B;  3CC4 V;  2ZE6 A;  4IGG A;  2BOB C;  4FM0 A;  2E1H A;  4C7U A;  4JYY A;  2ATK C;  4UB6 Z;  1KQS U;  1SF9 A;  2DOS A;  2UXB B;  3OTO O;  3LUT B;  3ABK C;  1SES A;  3B77 A;  5EZY A;  1XOU A;  4XU0 A;  4IL6 Z;  3UQ8 A;  4G84 A;  1SQV H;  2XUM A;  2CAZ C;  1LUW A;  5C8Y B;  1K3E A;  1MMM A;  2L35 A;  3ZS8 C;  2HVJ C;  1S0V A;  3V7R A;  1SER A;  2CDY A;  3NEM A;  4TTV A;  1EZJ A;  4TT3 G;  2A8E A;  1EIY A;  1BS3 A;  1KC8 W;  1P49 A;  1R3K C;  2GUZ B;  4YRK A;  1EBO A;  4WFB V;  2YIC A;  5JVD A;  5E79 Z;  3CRM A;  1BBW A;  2WLM A;  3EFS A;  1M57 C;  4HT4 A;  2LGQ A;  4GKJ B;  3H9V A;  1WP7 A;  3AG2 B;  2DWE C;  1F7Y A;  3AG1 B;  5FNV B;  4TVY A;  1FYJ A;  4YRJ A;  4LF4 B;  4TV9 B;  3VQV A;  1JR9 A;  3HKE B;  1FPO A;  1VQO V;  4P30 A;  1QCE A;  2EIN B;  2XAJ A;  3ZMT A;  4JI7 B;  1VQN V;  1SC5 B;  2PF4 E;  3FB7 C;  2PME A;  1OCC B;  2A9H A;  3ABL B;  5LGN A;  4FLU A;  1HR0 O;  1OCO C;  4JTD B;  4OP0 A;  3MEY A;  4RDX A;  1I94 O;  2IU3 A;  2Q5Z A;  2CTQ A;  3CD6 V;  2EZP A;  5AG2 A;  2JRI A;  2V1D A;  3CC2 V;  4ZTU B;  5BXZ A;  3RIR A;  5EYP A;  3JD0 A;  4O4J A;  3SYO A;  5FPR A;  2XAQ A;  2CTP A;  4FFB B;  5F5W A;  4MT8 A;  4P72 A;  4KHP B;  1BIB A;  1M4U A;  3ZJZ A;  5IWA B;  4JGS A;  4ZOL B;  4YRQ A;  1NJ6 A;  1SKV A;  3CXH F;  5LP6 A;  1NQT A;  2HEP A;  5LMN B;  1W2B U;  3ETQ A;  11AS A;  5IYZ A;  5CA3 A;  3V7S A;  4JI8 B;  3JCU Z;  3HKC B;  3FYE B;  4YIO A;  4XEO A;  2AGA A;  4PA3 A;  4ICG A;  5GTH Z;  1AI4 A;  3FB5 C;  3EVK A;  2X7R B;  3E86 A;  1L8D A;  2UUB O;  4O2B A;  3JAR B;  4DR4 O;  5EBL C;  4U3J B;  5B5E Z;  4H2U A;  5E1A C;  1FXK C;  5LP6 B;  1ADJ A;  2QHT A;  2P22 C;  1E22 A;  4FLZ A;  2ZM6 O;  2ZT7 A;  2UXD B;  2HJF C;  1J5E B;  3A32 A;  1TAE A;  1TVK A;  2NLJ C;  3IKL A;  3GWO A;  2XAH A;  3RGB A;  1H38 A;  5B3S B;  1VF7 A;  1DTO A;  1Z7M A;  2HG5 C;  4UXN A;  5BR8 O;  2UUC B;  1MSW D;  1U96 A;  4XDL A;  2EJF A;  3W7X A;  3MHS C;  4CZZ A;  4H2X A;  4TWK A;  5CA1 A;  3J81 N;  1VF6 A;  4P3N A;  2P5I A;  4NYK A;  3FYI B;  3AG1 C;  5LHG A;  5B3S C;  4LFC B;  5CB4 A;  4X66 B;  3CCQ V;  1JOY A;  1VMG A;  5HFL A;  3V8K A;  2AHZ A;  2Q68 A;  4I55 B;  2FYU H;  1SQF A;  1FJG B;  3K08 A;  2PYL A;  1OHH G;  3T1H O;  1GK9 A;  1PPJ H;  2DTI A;  4GKK O;  1WU7 A;  4YRR A;  4OPA A;  2BTO A;  2Y69 B;  1Q6U A;  2P06 A;  4RUF A;  3RYH A;  4PHC A;  5CMU A;  2A0L A;  5LP6 C;  4HAM A;  4X62 O;  1RSO A;  1NTZ H;  1X55 A;  5KA5 A;  1S76 D;  1NBM G;  1EZV H;  2GSM B;  2FKX A;  3A8T A;  3CPW U;  4IHJ B;  2MK3 A;  4U7N A;  4JF3 A;  1JMK C;  1Y67 A;  4N23 A;  1SZX A;  1JJC B;  1I7F A;  4KQE A;  4OGQ B;  1WP8 A;  4GCZ A;  3BHP A;  3OEH G;  1Y74 A;  2CJ9 A;  2GTS A;  2DYS B;  2IJH A;  2Z5U A;  3QG5 A;  3ASN B;  4I55 A;  4AQY B;  4DV6 O;  3ZIA G;  1SQQ H;  4PDM A;  4JZG A;  1WB7 A;  4DUY B;  3P30 A;  1Q43 A;  4EFE A;  4P75 A;  4DR2 O;  5J2U A;  1PNL A;  3GVM A;  1Z7N A;  1Q8I A;  1P84 F;  3DXR A;  3IC7 A;  1W0K G;  3I56 V;  3DC6 A;  2XAS A;  4DV4 B;  3K06 A;  1NJI W;  4D6T H;  3JAK B;  4IHJ A;  4DK1 A;  4YJ3 A;  3HRK A;  2GUZ A;  3R65 A;  3L1A A;  4YDQ A;  4JYA B;  1Y4M A;  4B3T B;  1GM7 A;  2RHS A;  2QHS A;  4PG3 A;  2C7I A;  1SET A;  5IYC O;  3RBZ A;  4GYC B;  4DR1 O;  2O57 A;  3OMA B;  3ZX6 A;  1MNG A;  3MDS A;  1J5E O;  3EHB B;  4TWA A;  4MVO A;  3FD9 A;  1IL2 A;  3QO7 A;  2DMX A;  3F5T A;  3BPZ A;  4TVA B;  2JJ1 G;  4BIZ A;  4LFA B;  2HKO A;  1W0J G;  3AK1 A;  4DR3 O;  2R70 A;  1QU7 A;  4LVM A;  4PA9 A;  5CA0 B;  4O4L B;  3H1H H;  4O4H A;  2BE3 A;  1PYS A;  4LVJ A;  4E51 A;  1NJ2 A;  2Q69 A;  2DZ9 A;  1D5A A;  2RHS B;  1HW7 A;  1GN4 A;  5LYJ B;  5H5N A;  1YIJ V;  4HA8 A;  1THZ A;  5KLV H;  5LXT B;  4RWU A;  1WA8 B;  3U11 A;  4WFF A;  2YXL A;  2ARS A;  2AW9 A;  2VQE O;  3BJU A;  2F95 B;  4WFE A;  4XTV A;  3B09 A;  1X59 A;  5H9C A;  4GT1 A;  2XT9 A;  1QLE B;  5LMN O;  4GKJ O;  1VQP V;  3G67 A;  4UVB A;  3E22 B;  2ZCE A;  2ZNJ A;  2HLD G;  3ZRW B;  2DN9 A;  2EIL B;  4I0X A;  1PYS B;  5L3F A;  4GX2 A;  4HNA A;  3ABK B;  4UB8 Z;  2ALY A;  3TXS A;  4D7S A;  1UFI A;  4EO4 A;  2ODR C;  1EFW A;  1TA8 A;  1NR1 A;  1NTK H;  4XTZ A;  3GB7 C;  2HNI A;  4OXS A;  3PCO B;  5KNN A;  5GON B;  4WJ4 A;  4PHZ A;  3ZMV A;  4DR5 O;  2C8M A;  3JAT B;  4JI6 O;  3QO5 A;  4NR1 A;  4FMT A;  1NVP D;  1Z5W A;  1TGO A;  5KMG B;  1JQ0 A;  1PKX A;  4JI4 B;  3TUP A;  3UO2 A;  4DV6 B;  3OD1 A;  2AHY A;  3SPG A;  4MVM A;  2F1M A;  4H37 A;  3D3I A;  1X4T A;  4LF8 B;  5FPO A;  1WB8 A;  4EEQ A;  3TET A;  5ITZ A;  4YJ3 B;  1NKD A;  4MVR A;  2X0L A;  2QWP B;  4J11 A;  3L2Z A;  2OT5 A;  4PDR A;  2F4V O;  4JV5 O;  1XRE A;  3ZRS A;  5CBF A;  4RQF A;  1F4N A;  3A0H Z;  2FL4 A;  4X1Y B;  3JD3 A;  1WQW A;  5C53 B;  2B1I A;  4BR6 A;  1QLN A;  3HXV A;  1PL0 A;  3UGT A;  1B6Q A;  2UXN A;  5B1N A;  1MOF A;  4CH4 A;  4MTX A;  3RYI B;  2FB5 A;  3H1L H;  4YIP A;  4DR5 B;  4LNU A;  1PL4 A;  2JK5 C;  4JYC A;  5JJN B;  2ZXW B;  3W7T A;  4MS2 A;  3K3W A;  2H94 A;  2ZIM A;  2UUA B;  3A31 A;  4YRG A;  3N27 A;  1RFY A;  3X2Q C;  5L3G A;  4O4H B;  1WPY A;  3SPC A;  3BY6 A;  3LSU A;  3CCL V;  2WA4 A;  1XIL A;  1OCZ C;  2QE7 G;  3W7S A;  1YHQ V; 
#chains in the Genus database with same CATH homology
 2ZQM A;  4YRO A;  3DTU B;  5EC1 C;  2ATK C;  1YSC A;  4XU2 A;  1KQS U;  2YEV A;  4CH3 A;  1BIA A;  4G85 A;  2CGH A;  4UUJ C;  1BHB A;  4MSW C;  3LUT B;  1XL6 A;  2EJ9 A;  3ABK C;  4R7C A;  4P2Z A;  1SES A;  3B77 A;  3JCZ A;  4MVQ A;  3HXX A;  5LHH A;  4YRT A;  5C53 B;  4TVW A;  4XU0 A;  4LBE C;  5B1B C;  1ADY A;  3EFR A;  4G84 A;  2WLI B;  4Q6G A;  3RKW A;  4X5O A;  2EIK B;  1K3E A;  4MVS A;  1G5H A;  1C0A A;  1NYR A;  5LGU A;  2HFE C;  2HVJ C;  4Q20 A;  1E1Q G;  4UP7 A;  1S0V A;  1YFS A;  2DTH A;  4J9Z B;  2QTO A;  4I5S A;  1SER A;  3V7R A;  1JVM A;  3ETD A;  3E8F A;  2WLL B;  3MF2 A;  3NEM A;  1M90 W;  1EZJ A;  4QPK A;  4TTV A;  4TT3 G;  4WF2 A;  2A8E A;  3E89 A;  1EIY A;  3UFG A;  3SJQ C;  4GX1 A;  1KC8 W;  2QHV A;  1YJ9 V;  4XU3 A;  1R3K C;  3VQX A;  4YRK A;  2EIM B;  1EBO A;  4WFB V;  4P75 C;  4L87 A;  4YCV A;  4MVZ A;  3WQZ A;  4KP4 A;  1EFR G;  3STZ C;  2NNU A;  3FB6 C;  3P8V A;  1BBW A;  2WLM A;  1AJP A;  2DYS C;  1YFR A;  1DF5 A;  1M57 C;  2YEV B;  3EFS A;  3RL6 A;  4HT4 A;  3CYO A;  2DKG A;  4HWT A;  3AG2 B;  2IU0 A;  1AJQ A;  5CBH A;  4DQ2 A;  2DWE C;  3AG1 B;  4ASU G;  4LVI A;  1JPX A;  2IJJ A;  3CCU V;  4TVY A;  4YRJ A;  4KR2 A;  2YSU B;  4E2L A;  3CXC U;  3VQV A;  3OMI B;  1M56 C;  3A5Z A;  1IXM A;  1VQO V;  4P30 A;  1QCE A;  2WLI A;  1WYD A;  2EIN B;  2XAJ A;  3ZMT A;  3CMQ A;  3V7C A;  2IY5 B;  4BIU A;  4HWS A;  2XAG A;  1VQN V;  1YGB A;  4G28 B;  2G4C A;  3VQY A;  3T2M A;  3A74 A;  3FB7 C;  3E9I A;  5EC2 C;  2PME A;  1OCC B;  2W6I G;  5HGQ A;  3E8H A;  3T1C A;  2ZZF A;  1X01 A;  4J15 A;  3V8J A;  2A9H A;  3ABL B;  3OUS A;  5LGN A;  1EVL A;  3TEG A;  4ZIB A;  4HWP A;  4WCE V;  4GX0 A;  1OCO C;  2WLL A;  1VQ4 V;  3REX A;  4JTD B;  1V55 B;  4OP0 A;  1B70 A;  1ASY A;  3ZMU A;  4WFG A;  3MEY A;  4RDX A;  2IU3 A;  1N8R W;  2E65 A;  2HR3 A;  2B1G A;  2Q5H A;  1L0W A;  3ASN C;  2F43 G;  1NH2 D;  1VQ7 V;  2EZP A;  3CD6 V;  2KB1 A;  2DZC A;  1Q81 W;  2XOK G;  1E24 A;  1NJ1 A;  3R07 A;  2V1D A;  3UGT A;  3CC2 V;  4HVC A;  4ZTU B;  3HXW A;  3RIR A;  3B8M A;  5KA6 A;  1BL8 A;  1FXK B;  3JD0 A;  1DLB A;  4R6Z A;  3SYO A;  2ARU A;  3EFF K;  1Q82 W;  1GM9 A;  3HY0 A;  3ICA A;  1R6N A;  2XAQ A;  2QHU A;  1ATI A;  1HWY A;  3F7V C;  3W7U A;  2X6C A;  3E9H A;  5H6R A;  5F5W A;  1KD1 W;  4MT8 A;  4P72 A;  4DPG A;  3ZRX A;  2E5A A;  5C52 B;  4UPA A;  1H4Q A;  1BIB A;  3KG2 A;  3ZJZ A;  4R50 A;  4JGS A;  2R9R B;  3OE7 G;  3RVZ A;  3SPH A;  1NJ6 A;  3HY1 A;  4YRQ A;  1PNK A;  3TK1 A;  4XBF A;  4O2D A;  3CCS V;  4MTO A;  4K86 A;  2OTL V;  1NQT A;  4YP0 A;  1W2B U;  1YI2 V;  4YRP A;  2CJA A;  1B70 B;  1ZWI C;  11AS A;  4JAU A;  3SPI A;  2E41 A;  5CA3 A;  3V7S A;  4YRN A;  2DYR C;  3FYE B;  4QPJ A;  1BHA A;  3A7U A;  4TQF A;  4XEO A;  4MTG A;  2WPD G;  4J9Y B;  3CMA V;  5KUK A;  3M4P A;  3K0D A;  4PA3 A;  1S77 D;  2C2A A;  3DGE A;  5B1A C;  5EBM C;  3LDD A;  1VQL V;  1NJ8 A;  2Q7E A;  3T4D A;  4ZTZ B;  2A79 B;  2ZTG A;  1AI4 A;  2M7W A;  3FB5 C;  2P67 A;  3W7W A;  2EAY A;  1FXK A;  2X7R B;  3E86 A;  1G5I A;  1YB3 A;  2AKW A;  2HVK C;  3SYA A;  1PD3 A;  5IDJ A;  4JTC B;  1QVF U;  3HXV A;  3K9A A;  4BAY A;  4XTY A;  1HTT A;  2I4N A;  4YRS A;  2I4M A;  2GHY A;  5EBL C;  1H4V B;  2DDZ A;  4P73 C;  3LSS A;  3OMN B;  1FXV A;  3G6E V;  4P71 C;  1F51 A;  1GKF A;  1G8M A;  3G71 V;  2ALY B;  3P8T A;  4Q15 A;  3NET A;  1Y66 A;  4H2U A;  5E1A C;  2X6B A;  1AR1 B;  5FL7 G;  1B7Y A;  1FXK C;  3K04 A;  1CPY A;  1S5H C;  3SPJ A;  1ADJ A;  1LYL A;  3RKX A;  1G4Y B;  2QHT A;  2OTJ V;  1RPR A;  3OM3 B;  4YCW A;  5ELN A;  5B1A B;  2Y69 C;  2DQ0 A;  1E22 A;  4RO2 A;  1KKD A;  2RHQ A;  4PA6 A;  4LVL A;  2IH3 C;  2ZT7 A;  2HJF C;  1PNM A;  3A32 A;  1TUE B;  2NLJ C;  3IKL A;  1P7B A;  1OCR B;  3OAA G;  3GWO A;  1NNH A;  2XAH A;  3OR6 C;  5DN6 G;  4YYE A;  4G27 B;  1H38 A;  4PDV A;  4JYB A;  2DJZ A;  3B8N A;  5B3S B;  3RVY A;  1H8E G;  4BW9 A;  1DTO A;  3HXZ A;  2Z3Y A;  4UVC A;  2HG5 C;  4UXN A;  1VQ9 V;  1Z7M A;  1MSW D;  4AH6 A;  2FTK A;  4K87 A;  2NS6 A;  4LP8 A;  2UXX A;  1NR7 A;  1JJ2 U;  2CJB A;  2DU7 A;  4P71 A;  3UH0 A;  4XDL A;  1HXD A;  2EJF A;  3DSQ A;  4F4L A;  2J3M A;  3W7X A;  4HWO A;  2WWW A;  3KFU A;  1GM8 A;  3MHS C;  4H33 A;  4CZZ A;  3CCE V;  1GO3 F;  1WLE A;  3HXY A;  4H2X A;  2ZGW A;  3ABU A;  4TWK A;  1DF4 A;  4P3N A;  2P5I A;  1M1K W;  3IKM B;  2QM8 A;  3AG1 C;  3FYI B;  5LHG A;  1ORQ C;  2JEX A;  2WLJ A;  3RAC A;  3CCJ V;  1JJC A;  5B3S C;  3ZMS A;  1EQR A;  3L4G A;  1B7Y B;  1QE0 A;  1H8H G;  4JTA B;  4LC1 A;  3FB8 C;  4RUE A;  1GGM A;  1OCR C;  3CCQ V;  1JOY A;  1WPX A;  5HFL A;  3V8K A;  1R73 A;  2AHZ A;  5DM6 V;  2I4L A;  2Q68 A;  2QKS A;  1YJN V;  3A7R A;  3RKY A;  3K08 A;  4N21 A;  1OHH G;  4X8A A;  1GK9 A;  3E8B A;  2DYR B;  4QNH B;  1NYQ A;  2DTI A;  2V7Q G;  1V55 C;  1WU7 A;  4H2W A;  1X54 A;  4YRR A;  5L3D A;  1VQK V;  2ZT5 A;  2Y69 B;  1OCO B;  3VBB A;  4RUF A;  4P3O A;  2DWD C;  3JD4 A;  3CCR V;  3NEL A;  4X89 A;  4PHC A;  2ZNI A;  1YIT V;  3JD2 A;  5CMU A;  3A7A A;  2A0L A;  2JDI G;  4MW8 A;  4P9P A;  1CEZ A;  1YTF D;  1H4T A;  4CH5 A;  3STL C;  4HAM A;  2WAM A;  4ZBM A;  1NVP B;  5GW7 A;  2Q7G A;  1SZT A;  1X55 A;  4XEM A;  1YTF B;  5KA5 A;  2EIN C;  1KP2 A;  1E79 G;  1NBM G;  1RPO A;  2GSM B;  4MVU A;  1S76 D;  3UKM A;  3CPW U;  4HZ3 A;  3UGQ A;  4H2X B;  2MK3 A;  3BFM A;  4U7N A;  2H8P C;  1M56 B;  4JF3 A;  1Q86 W;  1X2G A;  1F4M A;  4N23 A;  2QEX V;  2EWN A;  1B8A A;  4TSF G;  1NH2 B;  1JJC B;  1OZ0 A;  3OW2 U;  4KQE A;  4GCZ A;  3OEE G;  3AG2 C;  3OEH G;  2ZIO A;  2CJ9 A;  4YRF A;  2DYS B;  2WLK A;  1RIQ A;  1FYF A;  3HRI A;  2IJH A;  1ROP A;  2Z5U A;  3ASN B;  3PCO A;  3ZIA G;  1KMM A;  4PDM A;  2FYK A;  3V8L A;  4G2K A;  2W6J G;  2XAF A;  3P30 A;  3X2Q B;  1WNL A;  4NCX A;  3OR7 C;  3A0R A;  4P75 A;  3W3S A;  2ZR2 A;  1PNL A;  1Z7N A;  1E1R G;  1WQ7 A;  4CS2 A;  2AMC A;  3K0G A;  4KR3 A;  4HWR A;  1KP3 A;  3ETE A;  3IC7 A;  1X56 A;  1OCC C;  3IG2 A;  3ABT A;  5ELO A;  2ZXW C;  1W0K G;  12AS A;  5LGT A;  2EIJ C;  2W0F C;  3I56 V;  4R8C A;  4BWA A;  3LC0 A;  3MQZ A;  4TVA A;  4P74 A;  1USY A;  3REU A;  2XAS A;  3I55 V;  3K06 A;  3SYP A;  4CBC A;  4WF9 V;  1NJI W;  4XTX A;  5E3I A;  3SYC A;  2CK3 G;  2P6J A;  4PDL A;  4KUM A;  4ZKI A;  2ZIN A;  4H2V A;  2LFS A;  2E3C A;  2JIZ G;  4UP8 A;  2ZD9 A;  4YPF A;  1GTO A;  3HRK A;  3ETG A;  1K8A W;  2E64 A;  1XL4 A;  3R65 A;  1P4R A;  4XDK A;  4I9W A;  3L1A A;  3CP1 A;  4WI1 A;  4YRM A;  4YDQ A;  1Y4M A;  4UP9 A;  1GM7 A;  1J95 A;  4PA4 A;  2RHS A;  2DW4 A;  2EJR A;  2QHS A;  4PG3 A;  1N9W A;  3K03 A;  1B76 A;  3AG4 C;  3K79 A;  3LDC A;  3ZN1 A;  2C7I A;  2ZT6 A;  1SET A;  2LFR A;  4PEL A;  3RBZ A;  5CBG A;  5IYC O;  4XTW A;  4H2Y A;  3HPL C;  2EIM C;  3HXU A;  2Q67 A;  3OMA B;  4LVK A;  3G1Z A;  2AMC B;  4UVA A;  3WG7 B;  1R3L C;  2B5U A;  1L1F A;  3EHB B;  3ABL C;  2IH1 C;  3ABM C;  1K5Q A;  3G4S V;  4JAV A;  3E35 A;  4MVO A;  5CN0 A;  4OLF A;  4P74 C;  4TWA A;  3QO7 A;  1VQ6 V;  2IJK A;  3M99 B;  3E83 A;  4CS4 A;  1IL2 A;  4TVA B;  1K92 A;  2JJ1 G;  1EVK A;  2R9I A;  2Q7H A;  1K9M W;  3M4Q A;  4LNS A;  3ZRW A;  4BIZ A;  2ZZE A;  3ZCC A;  1R3I C;  4RAI A;  5L3C A;  2HKO A;  3WFV A;  1W0J G;  2ART A;  4LVM A;  4PA9 A;  1VQM V;  2QM7 A;  3HFV A;  1PYS A;  1KEC A;  4X88 A;  2ITD C;  4WFH A;  1G51 A;  1NJ2 A;  4K88 A;  4E51 A;  1R3J C;  4LVJ A;  2Q69 A;  2XGT A;  3ZN0 A;  1Q7Y W;  5IY5 C;  5C51 B;  2DZ9 A;  2RHS B;  3OFN G;  2XTI A;  5J9P C;  1RM1 B;  1M57 B;  4U7O A;  1K5S A;  2ZZG A;  1SRY A;  1YIJ V;  1THZ A;  4HA8 A;  4XTU A;  1OCZ B;  5H6Q A;  2P0L A;  3RUX A;  1QR9 A;  3JD1 A;  4JAS A;  4EKW A;  4H2T A;  2EL9 A;  4WFF A;  5B1O A;  2PI5 A;  3UM7 A;  4JPR A;  2ODR D;  2ARS A;  1GMG A;  1HC7 A;  3RF1 A;  2Q6A A;  3OUF A;  3BJU A;  2ZDI C;  1FXH A;  1FS0 G;  2OCC B;  2EIL C;  1S3J A;  4QIW F;  4WFE A;  4XTV A;  3RGL A;  4QJF B;  1ASZ A;  3D36 A;  3QNE A;  5KUM A;  4P3P A;  1USY C;  4Z1M G;  2LP7 A;  5H9C A;  4YRI A;  4GT1 A;  1K34 A;  4FK5 C;  4FIP C;  3E8G A;  4QE9 A;  2AKW B;  1QLE B;  1VQP V;  3F7Y C;  4UVB A;  3A5Y A;  3FJP A;  2P90 A;  2PI4 A;  1BMF G;  3PJS K;  1M9N A;  2EIK C;  5EBW C;  5L3B A;  3E2E A;  2ZCE A;  5K1P A;  2XND G;  2ZNJ A;  4HYO A;  2CIM A;  2HLD G;  3ZRW B;  5LBQ A;  5B1B B;  1ENV A;  2EIL B;  2OCC C;  1EIY B;  4P72 C;  1PYS B;  5L3F A;  4GX2 A;  2DU5 A;  3ABK B;  3ASO B;  2ALY A;  3ERR A;  3AG3 B;  1MAB G;  2IJI A;  2DXT A;  1I5X A;  3TEH A;  4EO4 A;  3LDE A;  2ODR C;  1EFW A;  3QTC A;  2Y48 A;  3AEI A;  1NR1 A;  4UV8 A;  1NJ5 A;  2WLN A;  1S72 V;  1YJW V;  2E10 A;  4WJ3 M;  3I7F A;  5L3E A;  2EZO A;  3HTZ A;  3GB7 C;  3P8Y A;  3IGA C;  5HFM A;  4OXS A;  2HNI A;  3PZC A;  4XTZ A;  4YRC A;  1X2H A;  4PA7 A;  5IY5 B;  4QE7 A;  3TCU A;  3PCO B;  5KNN A;  3IAL A;  4WJ4 A;  2DVE A;  3ASO C;  1E1T A;  2WSS G;  3NEN A;  2WLH A;  3ZRV A;  3ZMV A;  3SYQ A;  1H2G A;  4EX5 A;  4UV9 A;  3HFZ B;  1KOG A;  1ARO P;  4LCU C;  1V54 B;  1K73 W;  2C8M A;  1QBZ A;  3QO5 A;  3FKS G;  4FMT A;  1NVP D;  4XDJ A;  3NXS A;  1K7D A;  2ITC C;  2IY5 A;  1JQ0 A;  1F23 A;  1PKX A;  3TUP A;  2PMF A;  3W7S A;  4TQD A;  4H02 A;  3OGC C;  2EJG A;  1BBU A;  3OD1 A;  4YXW G;  2AHY A;  3ABM B;  1YHQ V;  4YRE A;  3SPG A;  4YRL A;  3CCM V;  4MVM A;  3JYC A;  2RHQ B;  4H37 A;  3D3I A;  5IYB O;  4CH6 A;  3L2Z A;  3TET A;  1AI7 A;  4H2S A;  1NKD A;  3MD0 A;  2X0L A;  4MVR A;  4P9O A;  1AJN A;  4MW3 A;  3T4Z A;  2OT5 A;  4PDR A;  3CME V;  2QA4 V;  2DEQ A;  1LNQ A;  2EBO A;  4RQE A;  2J3L A;  3ZRS A;  4DO2 A;  5CBF A;  2JJ2 G;  3H01 A;  3BEH A;  1K97 A;  1F4N A;  2DQ3 A;  4RQF A;  3IFX A;  4MTF A;  2X6A A;  1MG1 A;  2BOC C;  3F5W C;  3JD3 A;  5IYD O;  2B1I A;  3CCV V;  1RM1 C;  1WQW A;  3QO8 A;  5EK0 A;  4GX5 A;  4WFA V;  1PL0 A;  1QLN A;  1VQ5 V;  1QVG U;  3CC7 V;  1E1O A;  1VQZ A;  1B6Q A;  3HB3 B;  2ZXF A;  1EOV A;  2UXN A;  5B1N A;  1J5W A;  1MOF A;  3AG3 C;  1KMN A;  1YFT A;  5C93 A;  4CH4 A;  4MTX A;  3HFZ A;  1UJW B;  2IW5 A;  4P73 A;  1I5Y A;  2K1E A;  4BW5 A;  1R6K A;  3ML0 A;  3VOU A;  1W66 A;  1AI6 A;  1FFT B;  1AI5 A;  2JK5 C;  4JYC A;  1JX9 A;  1QLE C;  4DXW A;  2EIJ B;  3L4G B;  2ZXW B;  3LSQ A;  3W7T A;  1JCH A;  4FJC C;  4KFM A;  3K3W A;  4MS2 A;  2ZT8 A;  5LHI A;  5K1X A;  2H94 A;  2ZIM A;  4FPP A;  2P7T C;  4YCU A;  3P32 A;  1CP9 A;  1COW G;  1V54 C;  3WG7 C;  2DXU A;  1QR8 A;  3A31 A;  3RW0 A;  4YRG A;  2ZDI A;  2ZR3 A;  3LNM B;  3MHH C;  3CC4 V;  2I4O A;  2Q5I A;  2DTO A;  3MF1 A;  1VQ8 V;  3VQW A;  2D3O W;  2BOB C;  1H4S A;  3X2Q C;  5L3G A;  1WPY A;  4CS3 A;  2JEU A;  3SPC A;  1K4C C;  3BY6 A;  1QF6 A;  3CCL V;  4XU1 A;  1OCZ C;  2QE7 G;  3ZMZ A;  1K4D C;  5BZB A;  3TEH B;  4RMF A;  3AG4 B;  2E1H A;  1K33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...