3LSSA

Trypanosoma brucei seryl-trna synthetase in complex with atp
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
438
Chain Sequence
GSMMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEACVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seryl-tRNA synthetase
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Ligase
total genus 159
structure length 438
sequence length 470
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lssA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lssA02
2ZZFA 1EFWA 1SERA 2J3MA 1SETA 4TVAB 2G4CA 2EWNA 4H02A 3P8VA 4H2VA 4P3PA 1ATIA 4HWSA 1LYLA 5K1PA 3M4PA 2RHQA 4XU0A 4P3OA 3TUPA 1E22A 3PCOA 4HWTA 4H2XA 1NJ5A 1X55A 2ZT7A 1JJCB 2CJBA 3RKXA 5E3IA 2Q5IA 4H2SA 3A5ZA 3HY1A 1L0WA 1ADYA 1WLEA 3REXA 2I4NA 2ZIMA 4HWOA 3A7AA 4E51A 4RQFA 1X2GA 3WQZA 1HTTA 3TEHA 4WJ4A 4YROA 1WNLA 2ZZGA 3UGQA 3NEMA 4HA8A 4XTXA 4L87A 1PYSA 2CIMA 12ASA 1Z7NA 3HY0A 4P3NA 4ZTZB 1RIQA 4YRKA 2DU7A 1EIYB 2ZR3A 2QHSA 4K86A 4P73A 5ELNA 3RF1A 2RHSB 3ERRA 2XTIA 1WQWA 4YP0A 1EOVA 4P73C 1SESA 3HFVA 3HTZA 2C7IA 1X01A 3IG2A 3LC0A 1BIAA 1YFSA 3HXWA 1QF6A 3BJUA 3QNEA 2DKGA 1GGMA 4OP0A 4UP9A 2E41A 2EJ9A 2DTIA 4YYEA 1X54A 4WJ3M 2RHQB 2I4OA 3KFUA 2ZNIA 4XU2A 3PCOB 1IL2A 3UGTA 4K88A 3QTCA 1Z7MA 4G84A 2ZINA 2E5AA 1NNHA 2CJAA 1X56A 1ASYA 4P72A 5C53B 3I7FA 4BWAA 1WU7A 2I4LA 4P72C 4CH6A 3M4QA 5ELOA 2DZ9A 2IY5B 3HXVA 1YFRA 3G1ZA 3UH0A 4UP7A 2AKWA 3RUXA 3RL6A 1ADJA 4KQEA 3HRKA 3TEHB 4HWPA 4O2DA 3A7UA 1NYQA 4KR3A 4CH5A 4J15A 3L2ZA 4XEOA 1NJ1A 4YRRA 4BW9A 3W3SA 1PYSB 2EJGA 2AMCB 3RGLA 1NJ6A 5F5WA 1HC7A 4YCUA 4UPAA 4XU1A 3HFZA 1B8AA 2DJZA 4Q15A 2QHUA 1QE0A 2EJFA 4G85A 2XGTA 1EQRA 1G5IA 2I4MA 1E1OA 2CJ9A 4YRNA 5K1XA 4H2TA 2ZXFA 3RKWA 1NJ8A 2J3LA 1B7YA 2ZCEA 2ARUA 1KMMA 1E1TA 5HGQA 4TWAA 1C0AA 1VQZA 3CMQA 4PHCA 4YRJA 3RACA 2ZTGA 2ZT8A 3VQXA 3RKYA 4CS3A 1BIBA 3VQVA 4ZTUB 3L4GA 3E9IA 3VQWA 11ASA 3V8LA 2E10A 5KNNA 2ZT5A 1EVKA 3L1AA 1YFTA 2AKWB 2HNIA 1H4TA 1H4QA 4EO4A 2ZGWA 3HXXA 4H2YA 1WPYA 2DQ0A 4YREA 4YRQA 3ICAA 3IKLA 3MEYA 4YRCA 2PMFA 4DQ2A 3V7SA 1H4VB 1YGBA 4HVCA 2E65A 2P5IA 3HXYA 4EX5A 4P75A 3EFSA 2ODRC 4HWRA 1JJCA 3LSSA 4P75C 4H2XB 4H2WA 4ZIBA 2ODRD 4YRLA 2ZIOA 4YRGA 4XTYA 1H4SA 4TVYA 4XTZA 1B7YB 4P71A 2ARTA 3NELA 4P71C 1X2HA 3PZCA 4WF2A 3V7RA 4UP8A 2E1HA 1E24A 3V8JA 1EIYA 2DU5A 4XEMA 4XTWA 2CGHA 2Q7EA 1USYA 1KMNA 4YRFA 4YCVA 1USYC 3IKMB 3EFRA 4YRPA 2DDZA 2Q7GA 1NJ2A 1SRYA 1B76A 4YCWA 4YRMA 3A5YA 3VBBA 4DPGA 3QO8A 4Q6GA 4KR2A 1G5HA 2ALYA 4YRTA 3IALA 2E3CA 2Q5HA 3BFMA 3E9HA 1ASZA 3LSQA 2DTHA 3HXZA 2DVEA 4PG3A 1W66A 4CH4A 2EL9A 4P74A 5C52B 3P8YA 3NETA 4XTUA 4NCXA 4P74C 1NYRA 1B70A 2DTOA 2EAYA 1J5WA 3QO5A 3P8TA 2IY5A 2ARSA 4YRIA 1G51A 3V8KA 3V7CA 3DSQA 4CS2A 4K87A 2DXUA 2QHVA 4TVAA 3VQYA 5C51B 1HXDA 3A31A 4RDXA 4XU3A 2P0LA 3MF1A 2AMCA 3HRIA 3HXUA 3A7RA 4CS4A 2FYKA 1FYFA 4RQEA 2ZNJA 3HFZB 3A74A 2C8MA 4XTVA 1WQ7A 2E64A 2QHTA 2DQ3A 4YRSA 1YB3A 4RMFA 3NENA 2ZR2A 2DXTA 4TVWA 3RIRA 3REUA 4WI1A 2ALYB 1N9WA 4YDQA 2ZZEA 4YPFA 2DZCA 4TTVA 1BBUA 3MF2A 3R07A 1BBWA 2Q7HA 2PMEA 1WYDA 3OD1A 4X5OA 3UFGA 2DEQA 4TQFA 1KOGA 1B70B 3QO7A 4H2UA 3L4GB 4TQDA 4CH3A 1EVLA 4AH6A 2RHSA 3TEGA 4OLFA 3FJPA 2ZT6A 4LNSA 3A32A
chains in the Genus database with same CATH superfamily
1SERA 2ITCC 3CMEV 2JJ1G 1NZ6A 1Y76A 2KB1A 4I9WA 4DV6O 5JCOA 2DE0X 1LYLA 4UB6Z 1EM1A 2H3OA 4DR1B 2ZXWC 1OCZB 2UUBO 1R3KC 1LR1A 4X1IB 4DV6B 1QHTA 2BTQB 2AGAA 3GB7C 4H2XA 2VQEO 3AK2A 4XDLA 1FAFA 4WCEV 2X6AA 2UUBB 4HYOA 4NB5A 5IE9A 4NTYA 2CJBA 1AJPA 4B7EA 4X1YB 3ABLC 2KSDA 1ROPA 2UUCO 3REXA 1FS0G 1XMOB 5H9CA 5LP6A 2IH3C 3T1HO 5FPRA 1HTTA 2Z3YA 3TEHA 3ZRSA 3BFRA 2ATKC 4YROA 2P22C 4OPHA 2P7TC 2LGWA 3RYIA 5H6RA 3ABTA 4PHZA 1K5SA 1TA8A 4HA8A 4XTXA 2X0LA 1VEWA 3T1HB 4FZ0A 12ASA 5LOVA 4WFHA 5JQGB 4YRKA 2YXLA 2HP8A 4K86A 5ELNA 5LMUO 3P3NA 3UT5B 5LXTB 2EIMB 2HJFC 1WQWA 1M1KW 4F4LA 1EOVA 5EBMC 3AG4B 3HFVA 1G6UA 5IYZA 5EC2C 1AR5A 5LMUB 1W2BU 1YFSA 2WPDG 3BEHA 1HNZO 3TGUH 1J95A 5IJ9A 1GN6A 2ADPA 5L3EA 4LC1A 4UP9A 2E41A 4D7SA 5KHGA 4YYEA 3BCCH 1HNZB 3OEEG 1S3JA 4ZI7B 2ZNIA 2GBOA 5KHKA 4XU2A 4DV2O 4X64O 5JWPA 5EC1C 1Z7MA 1GAXA 1YEWA 5HFLA 3CRCA 2YEVB 1GK9A 4DR5O 3AG2C 1D5NA 1CXZB 4JZGA 2Y69B 4BWAA 1J5EO 2A8EA 5ELOA 3RBZA 2OCCC 1YFRA 3OTOO 4DV4O 2EIMC 2GUZB 1J5EB 1ADJA 3AG4C 1BHBA 1S0VA 2YI9A 4HWPA 4DR2O 2QA4V 3A7UA 1IX9A 1NYQA 3CCRV 4DV4B 3ABMC 3SPJA 4KR3A 2BE3A 1NH2D 3L2ZA 4XEOA 4LFCB 2EJGA 4YJ2B 2YDEA 1NR7A 2OCHA 3CCVV 5F5WA 4YIOA 4X65O 4LF6O 4YCUA 4BIOA 4J42A 1B8AA 5LYJA 1Q7YW 4Q15A 2QHUA 2A9HA 2ODMA 4TT3G 1JJ2U 1AJQA 3SPGA 3G6BA 1NQTA 1QR9A 3RYFA 4B3SO 1Q5OA 1COWG 4X65B 4GKKB 2XNDG 1BSMA 3JALB 3JD3A 1V54B 4LF5B 2OIGA 1Z2GA 4H2TA 3RT3C 1JA8A 3RKWA 2JIZG 5LGTA 1M57B 1BT8A 4DV1B 3MDSA 3H9VA 1EN4A 2ZCEA 4K8ZA 5B1BB 5IDJA 4X20B 2GSMB 2EILC 4JPRA 5HGQA 4EFEA 1KMIZ 3DGEA 5HFMA 1FYJA 3ZMZA 4JI8B 1VQZA 4FFBA 4LVKA 4DO2A 3ZX6A 3W7UA 3J81N 1YTFD 1B06A 2ZT8A 3RKYA 3VQVA 2CE4A 5D5QA 4QPKA 1VQ4V 3B4SA 3J80N 1M5IA 2ZM6B 3N2GB 5KNNA 4EFBA 2ZT5A 4FLVA 3LSUA 1VF6C 1IBMB 1VQ9V 2QJ1A 1YFTA 4Z1MG 2ZDIA 4H44B 2ZKOA 3CCMV 2F4VO 2QM4A 4XDJA 1R73A 5BR8B 3UO2A 4IHJA 2ZGWA 2R9AA 4H2YA 5IWAO 4P9PA 3RYHB 3JAWB 5JJNB 2RJZA 2JS3A 2F4VB 3UKMA 1F4MA 1M4UA 4X1IA 1YGBA 1SA0A 4HVCA 5IWAB 4EX5A 3EFSA 3WG7C 2ODRC 1TVKA 1JQ0A 1V55B 4JAVA 4LVLA 2X6BA 1AROP 3JATA 5EYPB 4HNAA 3K0DA 2QKAA 2ODRD 3N2KB 4X1YA 4JYBA 5EBLC 4YRGA 3WFVA 4XTYA 1BL8A 1JVMA 3B09A 3CC2V 4XTZA 2ETNA 4WFEA 4NTXA 3SJCC 3NXSA 4X8AA 4P71C 3ZMUA 3MHSC 4WBNA 2PY5A 2NLJC 1VQLV 3RYCB 4UP8A 1IXMA 3F5WC 2RCVA 1JOYA 1L0NH 3FD9A 1D2DA 1E24A 2VS0A 1S77D 3L72H 3HKDA 2UU9O 2EIKC 2DU5A 4MVZA 4FLUA 3K9AA 3EFFK 4K0KO 3IGAC 1ENVA 4D6TH 1KMNA 4ZKIA 4YRFA 2QKSA 3ZHVA 1THZA 3K59A 3EFRA 1V55C 1EZJA 1Z5VA 2R9RB 4KXRA 2Q7GA 1NJ2A 2HVKC 2AZ2A 4JI1O 2AHZA 1G5HA 3DXRB 2CTQA 2M6YA 5IT9N 3G67A 1Q86W 2DVEA 4KHPB 4IL6Z 2HVJC 2WWWA 1I5YA 1W66A 2Y4TA 4LVIA 3LDDA 4TUYB 2PI5A 5KHIA 4B3TB 3P8YA 3NETA 2IH1C 2XAJA 4J9YB 3GWOA 4X66O 1CEZA 2A0LA 3HR0A 3TCUA 1B70A 4PA9A 4O4LB 5B1AC 3Q4HB 3CCSV 1ZLZA 1MNGA 2WLJA 2WLMA 1SZTA 3E35A 3SJBC 3SJQC 1WPXA 2ARSA 1E79G 4X66B 3G71V 2F43G 3CPWU 2XUMA 4TV8B 2AXTZ 3I56V 3OE7G 4DV5O 1DF4A 5BXZA 3SYPA 4OX9B 5EK0A 4TVAA 1K5QA 5DEDA 5CBGA 2K9PA 4X62O 2CGNA 4ZHQB 5C51B 3ASNC 4Q20A 4RDXA 1XMQO 3KCXA 4A5UB 4DV5B 3DC5A 2LW1A 3SGIA 4P2ZA 3WB1A 4H0LB 3HXUA 1W0JG 1NVPD 1Q90D 3K9SA 3A8TA 4YJ3B 4DUZB 1XMQB 3CCQV 4HAMA 5EZYB 4K8XA 1VQ7V 5F2VO 3JALA 5ITZB 2QHTA 2BSKB 1YB3A 2YIDA 3CSXA 5JVDB 5J2TB 4TVWA 1FXVA 3RIRA 4PA6A 3SYCA 4UCUA 2YUAA 2ALYB 4YDQA 3KG2A 5B66Z 2E76B 4OPAA 4MTFA 2ARHA 4YPFA 4TTVA 5FPOA 1BBUA 4JZ2A 1BBWA 5LBQA 4B7KA 2PMEA 4MVQA 3OD1A 5LHHA 2IBZH 3MD0A 3OR7C 1WPBA 4JI4O 3LDCA 5KA6A 1OZ0A 3F7VC 2VQFB 3B2EE 2HKOA 3S3XA 4DR3B 1HDJA 4TQDA 2BCCH 4CH3A 3L4GB 4UVAA 3AG7A 1AI4A 3FB5C 4TSFG 2RHSA 3ICXA 1VQ8V 4LNSA 3DTUB 4CZZA 3QG5A 4DRXB 3ZEDA 2WA4A 1EFWA 3CE2A 1SETA 2G4CA 2L35A 2EWNA 3K0GA 4PV1B 3K03A 3P8VA 1ATIA 4HWSA 3SYAA 5JCOC 1PP9H 3M4PA 3IAYA 4P3OA 4FJCC 5LGNA 2GTAA 1CP9A 2MK3A 1N32B 1GM7A 4UCRA 4LF9O 2ZT7A 2KG7B 3L70H 3T1CA 5FNVB 3HKEA 3N2KA 1E1QG 3R66A 2Q5IA 3CCUV 3T1YO 1X59A 2QWOB 1F7YA 1L0WA 4LF9B 1ADYA 2I4NA 1HNXO 3F7YC 2ZIMA 4B3MB 1SQPH 3OGCC 1JFFA 1VQ5V 5CB4B 1OCCC 4HWOA 2B5UA 2EIJB 1ZX3A 1B3QA 1X2GA 5LP6C 3SYQA 3BRCA 3BA9A 2Q0OC 2IM9A 1HNXB 3CXHF 1WNLA 2ZZGA 1HR0B 4I50B 1P84F 2CH7A 3OUFA 1PYSA 3HY0A 1Z7NA 2F66C 1GH6A 5E79Z 3AG3B 1N34O 2JRIA 1H38A 3ABKB 1I94B 4LF4O 5KMGB 2AHYA 1VP7A 2JGDB 3LC0A 4JYYA 3TXQA 3HXWA 2JEXA 1QF6A 4LF4B 1R6KA 1H2SB 1PL4A 2IU0A 2GHYA 3BJUA 4CC6A 4X1KB 2ZXWB 1Q82W 4DW1A 4OP0A 4WF9V 4IGGA 2EBOA 5FL7G 1X54A 4WJ3M 2RHQB 1RSOA 4TUYA 1URFA 1TAEA 3PCOB 4H33A 1IL2A 4K88A 3QTCA 4LFAO 3OR6C 2NNUA 1DK1A 2JJ2G 1GO3F 2XHBA 3ML0A 1KD1W 3UCSC 2CJAA 1ASYA 3ABLB 4IIJA 4P72A 5C53B 4J10A 1Y74B 2Y48A 5H6QA 4MW8A 2I4LA 3M4QA 4LF8O 2OTLV 1KKCA 1GRJA 5LA6A 3HXVA 1N33B 1XOUA 3ZRVA 3JAKA 4UP7A 1RM1C 2AKWA 2HHHO 3RL6A 3RUXA 4YIPA 3HRKA 3PJSK 4LWSA 1XDCA 2IU3A 1XREA 1AR4A 4LVMA 4I4TA 4J15A 3E8HA 1NJ1A 1SZXA 4J11A 2HHHB 3ZHQA 1V9PA 3C3SA 4LP8A 1KP3A 1NT2B 1FD9A 4UB8Z 1DTOA 2ZD9A 4NTWA 1SKVA 3H1LH 4PDRA 2PI4A 2IJIA 4MTXA 2DJZA 1SQXH 4J41A 5ITZA 4JYAO 4G85A 4W4LA 2BSKA 3APQA 1K4DC 2XGTA 1TUBB 4GZRB 4JI0O 3A0HZ 4O2BA 2QWRB 3IFXA 2ZXFA 4Z2WA 4DXWA 2VQEB 2QTOA 1AR1B 3E22A 2J3LA 4JGSA 4UCSA 3B8MA 2UXBO 1I7FA 2QTSA 2QDOA 2WLNA 2ADQB 2O57A 4EB6A 1FFXB 2XOKG 2UUCB 3AG2B 2ZTGA 2UXBB 4FLTA 4X88A 1Y6XA 2QEXV 4LF7O 1MMMA 1VQNV 4QNHB 2DYRC 3L4GA 3K5MA 3E9IA 1X4TA 3VQWA 2A3QA 3V8LA 2OCCB 1BE3H 2F1MA 3IC7A 5CA0B 1IURA 4AHCA 3U0ZA 5L3CA 4D7TA 3DC6A 3CXCU 3AK1A 1RPOA 1YF2A 4I55A 2EZPA 3RFRA 3ABMB 4DV0O 5LMNO 4JI6O 4EO4A 1JMKC 2JGUA 1E1RG 3MEYA 4FLYA 4YRCA 2GV9A 3V7SA 4TWKA 4DV0B 4GLXA 4G27B 4GCZA 1QLEC 5L3BA 1DLBA 2E65A 4PA3A 4P75A 3D36C 1MOFA 3D3IA 4ZIBA 4H2WA 4G2KA 3CD6V 1FJGO 1ZSPA 5KHJA 1ZL8B 5A2QN 1NI8A 4DV2B 4X64B 4TV9B 1H4SA 3P30A 1B7YB 2EILB 1FJGB 1YI2V 1YTFB 3OEHG 4DR5B 1XNQO 1S76D 5CA1B 1G8MA 1X2HA 3K58A 2CTPA 1XNQB 5GTHZ 5DECA 3V8JA 3OTOB 1IBLO 1S5HC 3H1HH 2B9ZA 3JARA 1VQPV 2DMXA 1IDSA 4DR2B 3JD2A 2YIBA 1YZBA 3K57A 1UPGA 1FXHA 4JASA 1USYA 4O4JB 4GX1A 1PNLA 3FX7A 5BMVB 4YCVA 3OFNG 4YRPA 2WLHA 3ZRWB 4PD4F 1SRYA 4H13B 4YCWA 4LF6B 4NKGB 3VBBA 3QO8A 4Q6GA 2H94A 4X1KA 1PV0A 4KR2A 3E9HA 3LSQA 5B3SB 1US6A 2DTHA 4B3SB 3HXZA 3WG7B 2RMKB 2Q8VA 4FMTA 5LGUA 2QR4A 1SC5B 4C7UA 4IYIA 2LO1A 2ZT9B 1Y74A 1FXKA 4ASUG 1XHZA 2EAYA 1EZVH 4QGPA 1P49A 3LUTB 3X2QB 2EX3A 3R65A 5L3DA 3P8TA 2G38A 3K04A 2W6JG 4O4IA 4LH7A 4YRIA 4P30A 3SPHA 4ZOLA 1YHQV 2W6IG 3HKBA 5FLXN 3CJHB 4K87A 2FMLA 4YHHO 3H1IH 3M99B 3B8NA 3MQZA 4PJ0Z 4N23A 3UM7A 5JH7B 3T2MA 3ZN0A 3JASB 3JYCA 2EIKB 4UV9A 1MSDA 1Q81W 1T5EA 2JEUA 1G1XB 3A7RA 1XNRO 4CS4A 3OW2U 1FYFA 2BTQA 5IYBO 5B3SC 3W7WA 4RAIA 1WQ7A 2E64A 2PF4E 2DQ3A 2QSAA 1R3IC 4YRSA 1S5LZ 4PELA 3NENA 3ZIAG 1YJNV 5J2UB 3WB0A 3REUA 3G4SV 3K5LA 4RO2A 2RQ6A 3THOA 3X2QC 5LL6Y 1YIJV 4JV5O 3R07A 2Q7HA 2A7WA 2DOSA 3T4ZA 2UXXA 1I5XA 5KAIZ 2WSSG 5B1AB 4JV5B 3BA8A 4MVUA 2WLIB 4GYCB 1KOGA 2BOCC 5JQGA 4X9QA 5C8YB 1YVWA 1OHHG 4R50A 3WB2A 5B1NA 4I0XB 2LFSA 1EVLA 3UT5A 5LXTA 5B1OA 1KECA 1R6NA 4LNUB 1VF5B 4U7NA 1VMGA 1NKDA 3HKCB 4P9OA 2ZE8A 3A32A 2RNBA 3CS5A 3E86A 1VIBA 2UU9B 2A06H 3IC9A 3JSLA 2J3MA 1IVSA 1NBMG 4K0KB 1NVPB 3ASNB 1KP2A 1QR8A 4FZ1A 5CMUA 5CN0A 3J7AU 4H02A 1H8EG 1ZTEA 4FLZA 3TETA 4P3PA 3RN4A 4MVSA 1A32A 4F6RB 2IJHA 2UXNA 3HB3B 4ZI7A 3RW0A 3I55V 4DR6O 4XU0A 1EN5A 1E22A 1M90W 3AK3A 4JI1B 5EIBC 4FM2A 2LP7A 3FAVB 1MSWD 2YEVA 3ETEA 3I5DA 4DK0A 1MZFA 2NN4A 1X55A 1JJCB 4BW5A 1IBKO 3EVKA 5IY5C 1K92A 1WA8B 1XILA 3P32A 5EIBD 3NR7A 3CRRA 3RKXA 1XEQA 2JS5A 2KQXA 3OMNB 4J7KA 4H2SA 4PDMA 2AZ0A 3A5ZA 4LBEC 5IJ0B 1WLEA 2D2CB 5C93A 1IBKB 4FM0A 4QE9A 3BAAA 4LFBO 1YSCA 4LH6A 5EBWC 2GUZA 4RQFA 3WQZA 2DW4A 2JVDA 5DN6G 1KYOF 3EHBB 4WJ4A 3UGQA 3O65A 3NEMA 2PTMA 4L87A 4X89A 2UXCO 3S3WA 2KKWA 2CIMA 4YJ2A 1NTKH 4ZTZB 1RIQA 3A0BZ 2ZR3A 4IT5A 4DR4O 4P73A 2C2AA 1VQKV 3ERRA 2W0XA 1W59A 2XTIA 1EN6A 4X62B 2P5OA 1NTMH 5KX5B 3LNNA 1H2GA 4GKJO 2QM7A 1KC8W 2C7IA 4DR4B 1X01A 2XASA 1BIAA 4WFGA 1N0JA 1XBLA 1Y76B 1SQGA 3G80A 4MS2A 2DWDC 4NXMO 1GGMA 4H37A 4X20A 2PGGA 2DTIA 2EJ9A 3RGBA 2UXDO 2Z5UA 3CRAA 3UGTA 2GDSA 4J9ZB 2ZINA 4G84A 2E5AA 1KKDA 1UJWB 2EJRA 1X56A 2P90A 3JD1A 3CWBH 2A79B 3I7FA 4DV7O 2E5LO 1XHXA 4P72C 5BZBA 2YIAA 3N2GA 3QF7A 4YXWG 1OCCB 1JJOA 1D5AA 4JI4B 1SQVH 2F93B 3BY6A 3G1ZA 5LP6B 4NYKA 4QE7A 5KA5A 4DV7B 3TEHB 4O2DA 4MTOA 3RYIB 3RYHA 4CH5A 2WA3A 3JAWA 3W7TA 4YRRA 3W3SA 3STLC 5IYDO 1VQOV 5LOVB 4RUEA 2LJ2A 4AQYO 1K8AW 1YCIA 1Z5WA 4BR6A 3FB6C 3U11A 4BIZA 1Q3EA 5EYPA 2EJFA 2CUGA 1OCRB 5IYZB 1EQRA 1G5IA 4JI2O 2I4MA 2Q5ZA 1E1OA 3APOA 3ZMTA 1HP8A 3KZIZ 3L71H 2Q73A 5J2UA 2PYJA 3QVNA 1NJ8A 3CC4V 1F4NA 5IJ9B 2QGNA 1AJNA 2WAMA 4DR7O 2OTJV 1R3LC 1MG1A 1E1TA 4TWAA 4IYHA 4FK5C 3ZHRA 3T1YB 5GONB 1C0AA 3CMQA 2Q4PA 3VOUA 2FL4A 3RYCA 2MW2B 4PHCA 2IJJA 2X7RB 2JDIG 4I5SA 4W4KA 1RFYA 4MVMA 4CS3A 1BIBA 2Q69A 4ZTUB 2BTOA 11ASA 1PNKA 3W7SA 2CDYA 4QPJA 4YY3O 2E10A 4HZ3A 3BABA 1R3JC 3AG1C 1RM1B 1RPRA 5KAFZ 1BHAA 4GUNA 3L1AA 2HNIA 1GTOA 1H4QA 4YY3B 1N34B 1BQZA 1OCRC 4XBFA 2DQ0A 2XAGA 4YRQA 3ICAA 3DXRA 2RDCA 2N05A 1YJ9V 2PMFA 4DQ2A 2YI8A 4UXNA 1H4VB 2OYQA 1DGSA 1N36O 3HXYA 1CPYA 4HWRA 3IJ4A 2N74A 1JJCA 5LYJB 2WLKA 4P75C 1AI6A 1BS3A 1H8HG 1VQ6V 2Q9LA 4O4LA 3RYFB 2ZIOA 3Q4HA 2CK3G 3FYEB 3M7MX 2YC0A 4KFMA 4LFAB 1R1BA 1XQ8A 3FKSG 4F6EA 3UQ8A 5GW7A 4NVPA 3O9OA 3L74H 4JI7O 3C90A 3SJAC 4TV8A 3NELA 2EINB 2YSUB 3JCZA 3JAMN 4MSWC 3PZCA 4FFBB 4WF2A 3OAAG 4LF8B 1XI1A 1N4CA 4ZHQA 2ILMA 2DYRB 2ZE7A 1AP6A 3GWKC 4B08A 2E75B 4JTAB 4YJ3A 1H2LA 4XTWA 1U97A 2HJDA 1DF5A 5EZYA 3CP1A 2FTKA 3ZRXA 2E74B 5L3GA 4DR1O 1USYC 3IKMB 1B6QA 1YDXA 4BAYA 4DV3O 3WU2Z 1ORQC 2DDZA 1O9GA 2YIBD 5JVDA 5J2TA 3ASOC 1B76A 4IHJB 3A5YA 5GTIZ 2ALYA 4YRTA 3IALA 3BFMA 3SPCA 1F23A 1QLEB 4JYAB 4WFFA 4DV3B 1YXBA 1K34A 4JI0B 2DJVA 1P7BA 2P06A 4NR1A 4QIWF 3ZMVA 1SA0B 4R8CA 2EL9A 1TVKB 4P74A 5C52B 2EINC 1KUQA 1XMOO 4XTUA 3JATB 1R6TA 4HNAB 3LNMB 4U3JB 2DTOA 1J5WA 5J9PC 3D3QA 1FXKC 4MW3A 3QO5A 4I7ZB 2BOBC 3PN1A 2WLLB 1PD3A 4DK1A 4CS2A 4DRXA 2Q67A 1YITV 3OT7A 4FLWA 4LF7B 4UFZA 1NH2B 3CCEV 4WBNB 2Q68A 2QHVA 3K5OA 1K7DA 3KKYA 2CTRA 3VQYA 1LUVA 1QCEA 2ZDIC 4ZBMA 3E89A 3A0RA 4CC5A 2V7QG 3ZS8C 2DYSB 4RUFA 3OUSA 5KHHA 3HKDB 2XT9A 4JI6B 5LMNB 2FYKA 1OCZC 3SDLA 1Q43A 3H1JH 2Y4UA 2XAQA 4K3AA 4PI0A 1M56B 3HFZB 1SQFA 3A74A 4FVMA 2KG7A 2C8MA 4XTVA 1RP3B 1PPJH 5FNVA 4MT8A 1SS3A 2OIEA 4RMFA 5A9GA 2ZR2A 3CMAV 1M93A 1I0HA 2DWEC 3CYOA 2L6LA 2ZZEA 2Q0AA 5CB4A 2V4DA 3MF2A 4BIUA 2LW7A 5GONA 1P7GA 3E2EA 2QWNB 4PA4A 3ABUA 4I50A 2CTWA 4TQFA 2DEQA 4LCUC 5LHGA 4O2AB 2W0FC 1B70B 1QNMA 3QO7A 2QM8A 1K97A 3ZHUA 2QWQB 3U10A 4WFBV 3ZJZA 2R70A 2DYSC 3TEGA 4B3RO 2ZT6A 3KCYA 5KMGA 3GVMA 3TJTA 3OMAB 1IBLB 4LFCO 1Y67A 4R6ZA 2JGDA 2YXYA 2ZZFA 1M56C 2FYUH 4ICGA 1H2MA 4N21A 4PDLA 4JI3O 4B3RB 1XL4A 4TVAB 1XUQA 1Q6HA 5H5NA 4H2VA 1EBOA 5B5EZ 3K79A 4JI3B 2RN9A 5K1PA 2RHQA 2ZQMA 1WJZA 4GKKO 2B1GA 1B04A 4LF5O 3TUPA 3PCOA 4HWTA 4AI8A 3FB7C 4FLXA 2EULA 4OXSA 4DV1O 3AEIA 1NJ5A 1K4CC 2B1IA 1G4YB 1IXBA 1VF7A 3B77A 1WP8A 2HFEC 5E3IA 5KUMA 3K08A 1KU9A 4JI8O 3CCJV 3HY1A 4MVOA 1WB8A 3FFQA 1JX9A 2VWJA 2Y69C 3OM3B 1Y66A 3A7AA 1TUEB 4MVRA 4E51A 4HT4A 2P4VA 1AVMA 3BHPA 2ZM6O 2NS6A 1IBMO 1LNQA 5L3FA 4PI2A 4P3NA 4L8JA 2DU7A 1EIYB 2QHSA 4DYLA 5BR8O 4YHHB 3RF1A 2RHSB 2LQTA 4YP0A 4P73C 3ZBHA 1TGOA 2IJKA 2XAHA 1SESA 1HW7A 3HTZA 2K1EA 1TUBA 4JAAA 3IG2A 1Y4MA 1XNRB 1MABG 1EFRG 4MTGA 1V54C 1W0KG 3SYOA 3QNEA 2DKGA 1MZEA 3D36A 1M57C 4PDVA 4JTCB 5B1BC 1QLNA 2I4OA 3KFUA 1FFXA 2V1DA 1VQMV 2AW9A 2XAFA 1K73W 5TISZ 3G6EV 3E8GA 5IY5B 4U3JA 1NNHA 1KB9F 3HKEB 3CRMA 3RVZA 4PA7A 2YXHA 1WU7A 2P67A 2WLLA 4CH6A 4EKWA 3LDEA 3ETGA 5CA0A 5IYCO 1FKAO 2DZ9A 2IY5B 1JFFB 3UH0A 4GX5A 2P4KA 4KQEA 3OTFA 4FIPC 5DM6V 3ZN1A 4UV8A 1L0LH 1AB3A 3SR2C 4BW9A 2CH7B 1PYSB 2YICA 1LUWA 2AMCB 3RGLA 1NJ6A 3CX5F 4U3FH 1HC7A 4UPAA 4XU1A 3HFZA 3N27A 2IW5A 2YS8A 2HEPA 1QE0A 2HR3A 3H01A 2X6CA 4FM1A 4GX2A 1BQ0A 1ZL8A 3CCLV 2LGQA 4DR6B 4KHPO 3L73H 2CJ9A 4YRNA 5K1XA 4TV9A 4B3TO 4FPPA 1B7YA 1JR9A 1S5JA 1Q8IA 1WB7A 3ZHSA 2ARUA 3JCUZ 1GM8A 1KMMA 3EXAA 1RSOB 5CA1A 5BY1A 2FKXA 2ITDC 4JAUA 1QVFU 3JD0A 4YRJA 3RACA 4O2AA 1GN3A 1QU7A 4O4HB 3VQXA 4LFBB 2QWPB 4JF3A 4IIJB 4OX9O 1HWYA 1FPOA 1BZKA 4GX0A 4JI5O 1VF6A 1QQCA 4CBCA 4U7OA 2Z0AA 1S72V 2ZE5A 5LA6B 4O4JA 1EVKA 1JPXA 2F23A 3FB8C 2UXCB 5BMVA 3JAKB 1WP7A 2AKWB 4JYCA 3ZRWA 4JI5B 1H4TA 4UVBA 3B40A 1AI5A 1UFIA 4LWSB 5E1AC 3HXXA 3T4DA 3RVYA 4DUZO 1WPYA 4I4TB 4YREA 1SF9A 1Q6IA 4RWUA 4Z1VA 3IKLA 4GKJB 5CBFA 1PL0A 1IZ3A 1OJHA 2JK5C 2EJ7A 2P5IA 1N0NA 1PNMA 3STZC 3LSSA 4JTDB 5KLVH 4H2XB 2Q6AA 4NXMB 3M8AA 4E2LA 4HBNA 1ZWIC 4YRLA 2UUAO 2M7WA 4WFAV 1I08A 2UXDB 2GTSA 4O2BB 2OWOA 1O9HA 4GT1A 4UCVA 3ZHTA 4TVYA 3E22B 2PYLA 5CA3A 4P71A 1M9NA 4NXNO 4FFKA 1NU1H 1HNWO 4OGQB 2ARTA 4KL1A 2VQFO 2UUAB 3CJHA 3CB2A 4DR3O 2PUSA 4J80A 1K3EA 2CGOA 3OMIB 1NS1A 4EB6B 2D3OW 2E5LB 3V7RA 4LR3A 4NXNB 1QBZA 3JSNA 3E8BA 1HNWB 2ZE6A 2E1HA 5JH7A 1ZUQA 3JASA 4XDKA 1EIYA 3ETDA 1L1FA 1AILA 5D5PA 3P3PA 3AG1B 4XEMA 4UUJC 3CEIA 4UCOA 2CGHA 1P4RA 2Q7EA 1JCHA 5H2FZ 3SPIA 4I55B 3L9DA 3D8CA 4R7CA 3K5NA 1OV9A 1K9MW 4AQYB 2R72A 3OD4A 5LHIA 4YRMA 3TK1A 1GN4A 4DPGA 1N32O 2H8PC 2E3CA 2Q5HA 3BPZA 1NJIW 3C3TA 1ASZA 3E8FA 4JI2B 3A2FA 4E4EA 2VWKA 4PG3A 1NTZH 2DN9A 4CH4A 2NR5A 1MA1A 1U96A 4K35A 1F51A 3CHXA 3ETQA 3K3WA 2Y0IA 1NR1A 1GN2A 4B3MO 4DR7B 4NCXA 4P74C 1Q6UA 1KBHA 2WLIA 4AILC 1NYRA 1N8RW 2CAZC 5C8YA 2HG5C 4KUMA 4I0XA 5JJJB 2IY5A 2QKCA 4LVJA 1G51A 4I9QA 3V8KA 1OCOB 4LNUA 4DUYO 1BMFG 3W7XA 1HR0O 5AG2A 4G28B 3V7CA 3ZMSA 3K06A 3DSQA 3HKCA 1KQSU 3BVOA 5CBHA 4J7ZA 3OGIB 2HLDG 2DXUA 3CRQA 4ABMA 4DUYB 1HXDA 3UO3A 1I94O 3A31A 1PKXA 1GKFA 1FFTB 1H2NA 2F95B 3RWRD 4QJFB 4XU3A 1XL6A 3TXSA 1BCCH 2P0LA 3MF1A 3JARB 2AMCA 3HRIA 4F6RA 1AI7A 1K33A 2N04A 3JD4A 2ZNJA 4RQEA 3FAVA 1VARA 2QE7G 2Y0PA 3CC7V 4KP4A 3ASOB 3HPLC 1WA8A 3MAQA 4UVCA 2XTAA 1QVGU 1N36B 1SQBH 2DXTA 2FB5A 4UCTA 3E83A 1H2KA 5IJ0A 1L8DA 2LFRA 4WI1A 1N9WA 1WNSA 2DZCA 1GM9A 4EEQA 4DW0A 1GMGA 1OCOC 4TOIA 2EIJC 1AP5A 5JJEB 2VRZA 1WYDA 3F5TA 4O4HA 4X5OA 3UFGA 4JI7B 1N33O 1PM9A 3ZCCA 1FXKB 2EZOA 1WN7A 4H2UA 1BGYH 1YJWV 4AH6A 3L75H 4OLFA 3FJPA 2OT5A 3AG3C 4O4IB 2P6JA 1SQQH 1WAZA 2PZSA 3FYIB 4ZOLB 3MHHC 5KX5A 3HKBB 3ABKC 5KUKA 3H1KH 4J7JA 2R9IA 1ZAUA
chains in the Genus database with same CATH topology
3E86A 2ZZFA 1M56C 4N21A 1EFWA 4PDLA 1SERA 2J3MA 1XL4A 1SETA 2ITCC 1NBMG 3CMEV 4TVAB 1NVPB 3ASNB 2G4CA 2EWNA 1KP2A 1QR8A 3K0GA 2JJ1G 5CMUA 5CN0A 3K03A 3P8VA 4H02A 2KB1A 4I9WA 1H8EG 4H2VA 3TETA 4P3PA 1ATIA 4HWSA 1LYLA 1EBOA 3K79A 3SYAA 5K1PA 2ZXWC 4MVSA 3M4PA 1OCZB 2IJHA 2RHQA 2UXNA 2ZQMA 3HB3B 1R3KC 3RW0A 2B1GA 3I55V 4XU0A 4P3OA 4FJCC 5LGNA 3TUPA 1E22A 1M90W 3PCOA 4HWTA 3FB7C 3GB7C 4H2XA 1CP9A 2LP7A 2MK3A 1MSWD 4OXSA 2YEVA 3ETEA 1GM7A 3AEIA 4XDLA 1NJ5A 1K4CC 1X55A 2ZT7A 1JJCB 4BW5A 4WCEV 2X6AA 4HYOA 3T1CA 2B1IA 3X2QB 1G4YB 5IY5C 1K92A 2CJBA 1E1QG 3B77A 3P32A 3RKXA 2HFEC 3OMNB 5KUMA 2Q5IA 3K08A 3CCUV 4PDMA 1AJPA 4H2SA 5E3IA 3A5ZA 3CCJV 3ABLC 4MVOA 3HY1A 1L0WA 1ROPA 4LBEC 1ADYA 1WLEA 5C93A 1JX9A 3REXA 2Y69C 2I4NA 1FS0G 3OM3B 4QE9A 5H9CA 3F7YC 2ZIMA 3OGCC 1VQ5V 4HWOA 1YSCA 1Y66A 1OCCC 3A7AA 2IH3C 2B5UA 1TUEB 4MVRA 4E51A 2EIJB 4HT4A 5EBWC 4RQFA 1X2GA 3WQZA 1HTTA 2Z3YA 3TEHA 2DW4A 3ZRSA 3SYQA 5DN6G 2ATKC 3EHBB 4YROA 4WJ4A 2P7TC 1WNLA 2ZZGA 5H6RA 2NS6A 3ABTA 3NEMA 1K5SA 3UGQA 4HA8A 4XTXA 2X0LA 4L87A 4X89A 1LNQA 5L3FA 3OUFA 1PYSA 2CIMA 12ASA 1Z7NA 3HY0A 4P3NA 4WFHA 4ZTZB 1RIQA 4YRKA 2DU7A 1EIYB 2ZR3A 3AG3B 2QHSA 4K86A 4P73A 2C2AA 5ELNA 1VQKV 3RF1A 2RHSB 3ERRA 1H38A 2XTIA 2EIMB 2HJFC 1WQWA 3ABKB 4YP0A 1M1KW 4F4LA 1EOVA 4P73C 5EBMC 3AG4B 2IJKA 2AHYA 2XAHA 1H2GA 1SESA 3HFVA 2QM7A 2K1EA 1KC8W 3HTZA 2C7IA 1X01A 5EC2C 3IG2A 3LC0A 1W2BU 2XASA 1BIAA 1YFSA 4WFGA 2WPDG 3BEHA 1Y4MA 3HXWA 2JEXA 1QF6A 1MABG 1EFRG 1R6KA 4MTGA 1J95A 2IU0A 3BJUA 1V54C 2GHYA 1W0KG 3SYOA 3QNEA 2ZXWB 4LC1A 4MS2A 2DWDC 5L3EA 1Q82W 4H37A 1GGMA 2DKGA 4OP0A 2E41A 4UP9A 3D36A 4WF9V 1M57C 2EBOA 4PDVA 2DTIA 2EJ9A 4YYEA 5FL7G 1X54A 4JTCB 3OEEG 4WJ3M 2RHQB 5B1BC 1S3JA 1QLNA 2I4OA 3KFUA 2ZNIA 4XU2A 2V1DA 1VQMV 2Z5UA 3PCOB 4H33A 1IL2A 2XAFA 3UGTA 4K88A 1K73W 3QTCA 5EC1C 1Z7MA 5HFLA 3OR6C 4J9ZB 2ZINA 2NNUA 3G6EV 4G84A 2YEVB 3E8GA 5IY5B 2E5AA 1GK9A 2JJ2G 1GO3F 3AG2C 3ML0A 1UJWB 1KD1W 1KKDA 1NNHA 2EJRA 1X56A 2CJAA 2P90A 1ASYA 3JD1A 3ABLB 4P72A 5C53B 3RVZA 2A79B 2Y48A 4PA7A 3I7FA 5H6QA 2Y69B 4BWAA 1WU7A 4MW8A 2I4LA 2P67A 2WLLA 4EKWA 5BZBA 2A8EA 4P72C 3LDEA 3M4QA 4CH6A 5ELOA 3ETGA 4YXWG 2OTLV 1OCCB 3RBZA 5IYCO 2OCCC 2DZ9A 2IY5B 3HXVA 1YFRA 3BY6A 3ZRVA 3G1ZA 3UH0A 4UP7A 1RM1C 2AKWA 4GX5A 2EIMC 4QE7A 5KA5A 3RUXA 3RL6A 1ADJA 4KQEA 3HRKA 3AG4C 4FIPC 1BHBA 1S0VA 3TEHB 4HWPA 5DM6V 3ZN1A 3PJSK 2QA4V 2IU3A 4O2DA 4MTOA 3A7UA 4UV8A 4LVMA 1NYQA 3CCRV 3ABMC 3SPJA 4KR3A 3W7TA 4CH5A 4J15A 1NH2D 3L2ZA 4XEOA 3E8HA 1NJ1A 4YRRA 4BW9A 3W3SA 3STLC 5IYDO 1VQOV 1PYSB 2EJGA 4LP8A 2AMCB 1KP3A 4RUEA 3RGLA 1NR7A 3CCVV 1NJ6A 5F5WA 1DTOA 2ZD9A 1HC7A 4YCUA 1K8AW 4UPAA 4PDRA 4XU1A 3HFZA 2IW5A 2PI4A 1B8AA 2IJIA 3FB6C 4MTXA 1Q7YW 2DJZA 4Q15A 2QHUA 4BIZA 2A9HA 4TT3G 1QE0A 2HR3A 3H01A 2X6CA 2EJFA 4G85A 1OCRB 1JJ2U 2XGTA 1AJQA 1K4DC 1EQRA 1G5IA 3SPGA 4GX2A 2I4MA 1NQTA 1QR9A 1E1OA 3CCLV 1COWG 2XNDG 3JD3A 2CJ9A 1V54B 4YRNA 3ZMTA 5K1XA 4H2TA 3IFXA 2ZXFA 3RKWA 2JIZG 1NJ8A 5LGTA 3CC4V 1F4NA 4DXWA 4FPPA 1M57B 2QTOA 1AR1B 1AJNA 1B7YA 2J3LA 4JGSA 2ZCEA 2WAMA 5B1BB 3B8MA 5IDJA 2OTJV 1R3LC 2ARUA 2GSMB 2EILC 1GM8A 1MG1A 4JPRA 1E1TA 1KMMA 5HGQA 3DGEA 5HFMA 4TWAA 3ZMZA 2WLNA 4FK5C 2ITDC 1C0AA 1VQZA 3CMQA 3VOUA 2XOKG 4LVKA 4JAUA 3AG2B 1QVFU 4DO2A 4PHCA 3JD0A 4YRJA 3RACA 1YTFD 3W7UA 2ZTGA 2IJJA 2X7RB 2JDIG 4I5SA 4X88A 2ZT8A 4MVMA 1BIBA 3RKYA 3VQXA 2QEXV 4CS3A 2Q69A 1VQNV 4QNHB 3VQVA 4JF3A 2DYRC 3L4GA 4ZTUB 3E9IA 4QPKA 1HWYA 3VQWA 1VQ4V 11ASA 4GX0A 1PNKA 3W7SA 3V8LA 2OCCB 4QPJA 3IC7A 4CBCA 2E10A 5KNNA 4U7OA 4HZ3A 1S72V 2ZT5A 1RM1B 1R3JC 3AG1C 5L3CA 1RPRA 1EVKA 1JPXA 1VQ9V 3FB8C 1BHAA 3CXCU 3L1AA 1RPOA 1YFTA 2AKWB 4JYCA 2ZDIA 3ZRWA 4Z1MG 2HNIA 2EZPA 3CCMV 1H4TA 1GTOA 1H4QA 4UVBA 4XDJA 1R73A 3ABMB 4EO4A 1AI5A 1OCRC 5E1AC 2ZGWA 3T4DA 3RVYA 3HXXA 4H2YA 1WPYA 4P9PA 2DQ0A 2XAGA 4XBFA 4YRQA 4YREA 3ICAA 3IKLA 1E1RG 5CBFA 1PL0A 1YJ9V 3MEYA 2PMFA 3UKMA 1F4MA 4YRCA 4DQ2A 3V7SA 4TWKA 2JK5C 4G27B 4GCZA 1QLEC 4UXNA 1H4VB 1YGBA 5L3BA 4HVCA 1DLBA 2E65A 2P5IA 3HXYA 4EX5A 4PA3A 1CPYA 3EFSA 4P75A 3WG7C 2ODRC 1V55B 1JQ0A 4JAVA 1PNMA 4HWRA 4LVLA 3STZC 2X6BA 1JJCA 1MOFA 1AROP 2WLKA 3D3IA 3LSSA 4JTDB 4P75C 1AI6A 2Q6AA 4H2XB 4H2WA 4ZIBA 4E2LA 1H8HG 4G2KA 1VQ6V 3CD6V 3K0DA 1ZWIC 2ODRD 4YRLA 2ZIOA 2CK3G 4JYBA 2M7WA 4WFAV 5EBLC 4YRGA 3FYEB 3WFVA 4KFMA 4XTYA 4GT1A 1H4SA 1BL8A 1JVMA 4TVYA 3P30A 3CC2V 4XTZA 3FKSG 1B7YB 2EILB 5GW7A 5CA3A 4P71A 1YI2V 1M9NA 3OEHG 4WFEA 1YTFB 2ARTA 1S76D 3NXSA 4X8AA 3NELA 4P71C 2EINB 2YSUB 3JCZA 1K3EA 3OMIB 3ZMUA 3MHSC 1G8MA 1X2HA 4MSWC 2D3OW 3PZCA 4WF2A 2NLJC 3OAAG 3V7RA 1VQLV 4UP8A 1IXMA 3F5WC 1JOYA 1QBZA 2E1HA 3E8BA 2DYRB 1E24A 3V8JA 1S5HC 4XDKA 1VQPV 1S77D 1EIYA 3ETDA 2DU5A 2EIKC 1L1FA 4MVZA 3JD2A 3EFFK 3K9AA 3AG1B 3IGAC 4XEMA 4JTAB 4UUJC 4XTWA 1ENVA 1FXHA 1P4RA 4JASA 1USYA 1DF5A 2CGHA 2Q7EA 1JCHA 1KMNA 4ZKIA 4GX1A 2QKSA 4YRFA 1PNLA 4YCVA 1THZA 3CP1A 3OFNG 2FTKA 3SPIA 3ZRXA 5L3GA 1USYC 3IKMB 2WLHA 3EFRA 3ZRWB 1V55C 4YRPA 1B6QA 1EZJA 4BAYA 2R9RB 4R7CA 1ORQC 2DDZA 2Q7GA 1K9MW 3ASOC 1SRYA 1B76A 5LHIA 1NJ2A 4YCWA 4YRMA 3TK1A 2HVKC 3VBBA 3A5YA 4DPGA 3QO8A 4Q6GA 2H94A 4KR2A 2AHZA 1G5HA 2H8PC 2ALYA 4YRTA 3IALA 2E3CA 2Q5HA 3BFMA 3SPCA 1F23A 1QLEB 1NJIW 4WFFA 3E9HA 1ASZA 3E8FA 3LSQA 1K34A 1Q86W 5B3SB 2DTHA 3HXZA 1P7BA 4QIWF 3WG7B 2DVEA 3ZMVA 4PG3A 4FMTA 2HVJC 2WWWA 1I5YA 4R8CA 5LGUA 1W66A 4CH4A 3LDDA 4LVIA 2PI5A 2EL9A 4CH3A 4P74A 5C52B 3P8YA 1F51A 3NETA 2EINC 2IH1C 3K3WA 2XAJA 4J9YB 4XTUA 3GWOA 1NR1A 4NCXA 4P74C 1CEZA 2A0LA 2WLIA 3TCUA 3LNMB 1NYRA 1B70A 1FXKA 4PA9A 5B1AC 4ASUG 1N8RW 2DTOA 2EAYA 3CCSV 2HG5C 1J5WA 4KUMA 5J9PC 1FXKC 3LUTB 3R65A 5L3DA 4MW3A 2WLJA 2WLMA 1SZTA 2BOBC 3QO5A 3E35A 3K04A 3SJQC 2W6JG 3P8TA 2IY5A 1WPXA 2WLLB 1E79G 2ARSA 4YRIA 4P30A 1G51A 4LVJA 3V8KA 1OCOB 1BMFG 1PD3A 3SPHA 2F43G 3W7XA 4G28B 2W6IG 3G71V 3CPWU 1YHQV 3ZMSA 3V7CA 3K06A 3DSQA 4CS2A 1KQSU 2Q67A 1YITV 3I56V 1NH2B 4K87A 3OE7G 3CCEV 5CBHA 1DF4A 3SYPA 2HLDG 5EK0A 2Q68A 2DXUA 2QHVA 4TVAA 1K5QA 1K7DA 5CBGA 3VQYA 1QCEA 2ZDIC 5C51B 1HXDA 3M99B 3B8NA 4ZBMA 1PKXA 1GKFA 1FFTB 3A31A 3MQZA 3ASNC 3E89A 4N23A 4Q20A 3UM7A 3A0RA 3T2MA 3ZN0A 1XL6A 2V7QG 3JYCA 4QJFB 4XU3A 4RDXA 2P0LA 2EIKB 3MF1A 4UV9A 2AMCA 2DYSB 3HRIA 4RUFA 3OUSA 1AI7A 4P2ZA 1Q81W 1K33A 3HXUA 2JEUA 1W0JG 1NVPD 3A7RA 3OW2U 4CS4A 2FYKA 1OCZC 1FYFA 5IYBO 3JD4A 4RQEA 2ZNJA 5B3SC 3W7WA 4HAMA 3CCQV 2XAQA 1M56B 3HFZB 3A74A 2QE7G 4RAIA 3CC7V 2C8MA 1VQ7V 4XTVA 1WQ7A 2E64A 4KP4A 3ASOB 3HPLC 4MT8A 2QHTA 4UVCA 2DQ3A 1R3IC 4YRSA 1YB3A 4RMFA 1QVGU 3NENA 4PELA 2ZR2A 3CMAV 2DXTA 3ZIAG 4TVWA 1FXVA 3E83A 3RIRA 4PA6A 3SYCA 2DWEC 1YJNV 3REUA 2LFRA 3CYOA 3G4SV 2ALYB 4WI1A 4RO2A 1N9WA 4YDQA 3KG2A 2ZZEA 4MTFA 4YPFA 3X2QC 2DZCA 4TTVA 1YIJV 1BBUA 3MF2A 1GM9A 4BIUA 3R07A 1BBWA 5LBQA 3E2EA 1GMGA 1OCOC 2Q7HA 3A32A 2EIJC 3T4ZA 2UXXA 4MVQA 2PMEA 1I5XA 1WYDA 3OD1A 5LHHA 4PA4A 3MD0A 3OR7C 4X5OA 2WSSG 3UFGA 3ABUA 5B1AB 3LDCA 5KA6A 2DEQA 4LCUC 5LHGA 4TQFA 1OZ0A 4MVUA 2WLIB 3F7VC 2W0FC 2BOCC 2HKOA 3ZCCA 1B70B 1KOGA 1FXKB 3QO7A 2EZOA 4H2UA 2QM8A 1K97A 1OHHG 4R50A 5B1NA 3L4GB 4WFBV 4TQDA 2LFSA 4UVAA 3ZJZA 1AI4A 1YJWV 3FB5C 4TSFG 1EVLA 2RHSA 2DYSC 4OLFA 3TEGA 4AH6A 3FJPA 2ZT6A 2OT5A 3AG3C 5B1OA 2P6JA 1VQ8V 4LNSA 1KECA 1R6NA 3DTUB 4CZZA 3FYIB 3OMAB 3MHHC 4U7NA 3ABKC 5KUKA 1NKDA 4P9OA 4R6ZA 2R9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZF A;  1EFW A;  1SER A;  2J3M A;  1SET A;  4TVA B;  2G4C A;  2EWN A;  4H02 A;  3P8V A;  4H2V A;  4P3P A;  1ATI A;  4HWS A;  1LYL A;  5K1P A;  3M4P A;  2RHQ A;  4XU0 A;  4P3O A;  3TUP A;  1E22 A;  3PCO A;  4HWT A;  4H2X A;  1NJ5 A;  1X55 A;  2ZT7 A;  1JJC B;  2CJB A;  3RKX A;  5E3I A;  2Q5I A;  4H2S A;  3A5Z A;  3HY1 A;  1L0W A;  1ADY A;  1WLE A;  3REX A;  2I4N A;  2ZIM A;  4HWO A;  3A7A A;  4E51 A;  4RQF A;  1X2G A;  3WQZ A;  1HTT A;  3TEH A;  4WJ4 A;  4YRO A;  1WNL A;  2ZZG A;  3UGQ A;  3NEM A;  4HA8 A;  4XTX A;  4L87 A;  1PYS A;  2CIM A;  12AS A;  1Z7N A;  3HY0 A;  4P3N A;  4ZTZ B;  1RIQ A;  4YRK A;  2DU7 A;  1EIY B;  2ZR3 A;  2QHS A;  4K86 A;  4P73 A;  5ELN A;  3RF1 A;  2RHS B;  3ERR A;  2XTI A;  1WQW A;  4YP0 A;  1EOV A;  4P73 C;  1SES A;  3HFV A;  3HTZ A;  2C7I A;  1X01 A;  3IG2 A;  3LC0 A;  1BIA A;  1YFS A;  3HXW A;  1QF6 A;  3BJU A;  3QNE A;  2DKG A;  1GGM A;  4OP0 A;  4UP9 A;  2E41 A;  2EJ9 A;  2DTI A;  4YYE A;  1X54 A;  4WJ3 M;  2RHQ B;  2I4O A;  3KFU A;  2ZNI A;  4XU2 A;  3PCO B;  1IL2 A;  3UGT A;  4K88 A;  3QTC A;  1Z7M A;  4G84 A;  2ZIN A;  2E5A A;  1NNH A;  2CJA A;  1X56 A;  1ASY A;  4P72 A;  5C53 B;  3I7F A;  4BWA A;  1WU7 A;  2I4L A;  4P72 C;  4CH6 A;  3M4Q A;  5ELO A;  2DZ9 A;  2IY5 B;  3HXV A;  1YFR A;  3G1Z A;  3UH0 A;  4UP7 A;  2AKW A;  3RUX A;  3RL6 A;  1ADJ A;  4KQE A;  3HRK A;  3TEH B;  4HWP A;  4O2D A;  3A7U A;  1NYQ A;  4KR3 A;  4CH5 A;  4J15 A;  3L2Z A;  4XEO A;  1NJ1 A;  4YRR A;  4BW9 A;  3W3S A;  1PYS B;  2EJG A;  2AMC B;  3RGL A;  1NJ6 A;  5F5W A;  1HC7 A;  4YCU A;  4UPA A;  4XU1 A;  3HFZ A;  1B8A A;  2DJZ A;  4Q15 A;  2QHU A;  1QE0 A;  2EJF A;  4G85 A;  2XGT A;  1EQR A;  1G5I A;  2I4M A;  1E1O A;  2CJ9 A;  4YRN A;  5K1X A;  4H2T A;  2ZXF A;  3RKW A;  1NJ8 A;  2J3L A;  1B7Y A;  2ZCE A;  2ARU A;  1KMM A;  1E1T A;  5HGQ A;  4TWA A;  1C0A A;  1VQZ A;  3CMQ A;  4PHC A;  4YRJ A;  3RAC A;  2ZTG A;  2ZT8 A;  3VQX A;  3RKY A;  4CS3 A;  1BIB A;  3VQV A;  4ZTU B;  3L4G A;  3E9I A;  3VQW A;  11AS A;  3V8L A;  2E10 A;  5KNN A;  2ZT5 A;  1EVK A;  3L1A A;  1YFT A;  2AKW B;  2HNI A;  1H4T A;  1H4Q A;  4EO4 A;  2ZGW A;  3HXX A;  4H2Y A;  1WPY A;  2DQ0 A;  4YRE A;  4YRQ A;  3ICA A;  3IKL A;  3MEY A;  4YRC A;  2PMF A;  4DQ2 A;  3V7S A;  1H4V B;  1YGB A;  4HVC A;  2E65 A;  2P5I A;  3HXY A;  4EX5 A;  4P75 A;  3EFS A;  2ODR C;  4HWR A;  1JJC A;  3LSS A;  4P75 C;  4H2X B;  4H2W A;  4ZIB A;  2ODR D;  4YRL A;  2ZIO A;  4YRG A;  4XTY A;  1H4S A;  4TVY A;  4XTZ A;  1B7Y B;  4P71 A;  2ART A;  3NEL A;  4P71 C;  1X2H A;  3PZC A;  4WF2 A;  3V7R A;  4UP8 A;  2E1H A;  1E24 A;  3V8J A;  1EIY A;  2DU5 A;  4XEM A;  4XTW A;  2CGH A;  2Q7E A;  1USY A;  1KMN A;  4YRF A;  4YCV A;  1USY C;  3IKM B;  3EFR A;  4YRP A;  2DDZ A;  2Q7G A;  1NJ2 A;  1SRY A;  1B76 A;  4YCW A;  4YRM A;  3A5Y A;  3VBB A;  4DPG A;  3QO8 A;  4Q6G A;  4KR2 A;  1G5H A;  2ALY A;  4YRT A;  3IAL A;  2E3C A;  2Q5H A;  3BFM A;  3E9H A;  1ASZ A;  3LSQ A;  2DTH A;  3HXZ A;  2DVE A;  4PG3 A;  1W66 A;  4CH4 A;  2EL9 A;  4P74 A;  5C52 B;  3P8Y A;  3NET A;  4XTU A;  4NCX A;  4P74 C;  1NYR A;  1B70 A;  2DTO A;  2EAY A;  1J5W A;  3QO5 A;  3P8T A;  2IY5 A;  2ARS A;  4YRI A;  1G51 A;  3V8K A;  3V7C A;  3DSQ A;  4CS2 A;  4K87 A;  2DXU A;  2QHV A;  4TVA A;  3VQY A;  5C51 B;  1HXD A;  3A31 A;  4RDX A;  4XU3 A;  2P0L A;  3MF1 A;  2AMC A;  3HRI A;  3HXU A;  3A7R A;  4CS4 A;  2FYK A;  1FYF A;  4RQE A;  2ZNJ A;  3HFZ B;  3A74 A;  2C8M A;  4XTV A;  1WQ7 A;  2E64 A;  2QHT A;  2DQ3 A;  4YRS A;  1YB3 A;  4RMF A;  3NEN A;  2ZR2 A;  2DXT A;  4TVW A;  3RIR A;  3REU A;  4WI1 A;  2ALY B;  1N9W A;  4YDQ A;  2ZZE A;  4YPF A;  2DZC A;  4TTV A;  1BBU A;  3MF2 A;  3R07 A;  1BBW A;  2Q7H A;  2PME A;  1WYD A;  3OD1 A;  4X5O A;  3UFG A;  2DEQ A;  4TQF A;  1KOG A;  1B70 B;  3QO7 A;  4H2U A;  3L4G B;  4TQD A;  4CH3 A;  1EVL A;  4AH6 A;  2RHS A;  3TEG A;  4OLF A;  3FJP A;  2ZT6 A;  4LNS A;  3A32 A; 
#chains in the Genus database with same CATH topology
 1SER A;  2ITC C;  3CME V;  2JJ1 G;  1NZ6 A;  1Y76 A;  2KB1 A;  4I9W A;  4DV6 O;  5JCO A;  2DE0 X;  1LYL A;  4UB6 Z;  1EM1 A;  2H3O A;  4DR1 B;  2ZXW C;  1OCZ B;  2UUB O;  1R3K C;  1LR1 A;  4X1I B;  4DV6 B;  1QHT A;  2BTQ B;  2AGA A;  3GB7 C;  4H2X A;  2VQE O;  3AK2 A;  4XDL A;  1FAF A;  4WCE V;  2X6A A;  2UUB B;  4HYO A;  4NB5 A;  5IE9 A;  4NTY A;  2CJB A;  1AJP A;  4B7E A;  4X1Y B;  3ABL C;  2KSD A;  1ROP A;  2UUC O;  3REX A;  1FS0 G;  1XMO B;  5H9C A;  5LP6 A;  2IH3 C;  3T1H O;  5FPR A;  1HTT A;  2Z3Y A;  3TEH A;  3ZRS A;  3BFR A;  2ATK C;  4YRO A;  2P22 C;  4OPH A;  2P7T C;  2LGW A;  3RYI A;  5H6R A;  3ABT A;  4PHZ A;  1K5S A;  1TA8 A;  4HA8 A;  4XTX A;  2X0L A;  1VEW A;  3T1H B;  4FZ0 A;  12AS A;  5LOV A;  4WFH A;  5JQG B;  4YRK A;  2YXL A;  2HP8 A;  4K86 A;  5ELN A;  5LMU O;  3P3N A;  3UT5 B;  5LXT B;  2EIM B;  2HJF C;  1WQW A;  1M1K W;  4F4L A;  1EOV A;  5EBM C;  3AG4 B;  3HFV A;  1G6U A;  5IYZ A;  5EC2 C;  1AR5 A;  5LMU B;  1W2B U;  1YFS A;  2WPD G;  3BEH A;  1HNZ O;  3TGU H;  1J95 A;  5IJ9 A;  1GN6 A;  2ADP A;  5L3E A;  4LC1 A;  4UP9 A;  2E41 A;  4D7S A;  5KHG A;  4YYE A;  3BCC H;  1HNZ B;  3OEE G;  1S3J A;  4ZI7 B;  2ZNI A;  2GBO A;  5KHK A;  4XU2 A;  4DV2 O;  4X64 O;  5JWP A;  5EC1 C;  1Z7M A;  1GAX A;  1YEW A;  5HFL A;  3CRC A;  2YEV B;  1GK9 A;  4DR5 O;  3AG2 C;  1D5N A;  1CXZ B;  4JZG A;  2Y69 B;  4BWA A;  1J5E O;  2A8E A;  5ELO A;  3RBZ A;  2OCC C;  1YFR A;  3OTO O;  4DV4 O;  2EIM C;  2GUZ B;  1J5E B;  1ADJ A;  3AG4 C;  1BHB A;  1S0V A;  2YI9 A;  4HWP A;  4DR2 O;  2QA4 V;  3A7U A;  1IX9 A;  1NYQ A;  3CCR V;  4DV4 B;  3ABM C;  3SPJ A;  4KR3 A;  2BE3 A;  1NH2 D;  3L2Z A;  4XEO A;  4LFC B;  2EJG A;  4YJ2 B;  2YDE A;  1NR7 A;  2OCH A;  3CCV V;  5F5W A;  4YIO A;  4X65 O;  4LF6 O;  4YCU A;  4BIO A;  4J42 A;  1B8A A;  5LYJ A;  1Q7Y W;  4Q15 A;  2QHU A;  2A9H A;  2ODM A;  4TT3 G;  1JJ2 U;  1AJQ A;  3SPG A;  3G6B A;  1NQT A;  1QR9 A;  3RYF A;  4B3S O;  1Q5O A;  1COW G;  4X65 B;  4GKK B;  2XND G;  1BSM A;  3JAL B;  3JD3 A;  1V54 B;  4LF5 B;  2OIG A;  1Z2G A;  4H2T A;  3RT3 C;  1JA8 A;  3RKW A;  2JIZ G;  5LGT A;  1M57 B;  1BT8 A;  4DV1 B;  3MDS A;  3H9V A;  1EN4 A;  2ZCE A;  4K8Z A;  5B1B B;  5IDJ A;  4X20 B;  2GSM B;  2EIL C;  4JPR A;  5HGQ A;  4EFE A;  1KMI Z;  3DGE A;  5HFM A;  1FYJ A;  3ZMZ A;  4JI8 B;  1VQZ A;  4FFB A;  4LVK A;  4DO2 A;  3ZX6 A;  3W7U A;  3J81 N;  1YTF D;  1B06 A;  2ZT8 A;  3RKY A;  3VQV A;  2CE4 A;  5D5Q A;  4QPK A;  1VQ4 V;  3B4S A;  3J80 N;  1M5I A;  2ZM6 B;  3N2G B;  5KNN A;  4EFB A;  2ZT5 A;  4FLV A;  3LSU A;  1VF6 C;  1IBM B;  1VQ9 V;  2QJ1 A;  1YFT A;  4Z1M G;  2ZDI A;  4H44 B;  2ZKO A;  3CCM V;  2F4V O;  2QM4 A;  4XDJ A;  1R73 A;  5BR8 B;  3UO2 A;  4IHJ A;  2ZGW A;  2R9A A;  4H2Y A;  5IWA O;  4P9P A;  3RYH B;  3JAW B;  5JJN B;  2RJZ A;  2JS3 A;  2F4V B;  3UKM A;  1F4M A;  1M4U A;  4X1I A;  1YGB A;  1SA0 A;  4HVC A;  5IWA B;  4EX5 A;  3EFS A;  3WG7 C;  2ODR C;  1TVK A;  1JQ0 A;  1V55 B;  4JAV A;  4LVL A;  2X6B A;  1ARO P;  3JAT A;  5EYP B;  4HNA A;  3K0D A;  2QKA A;  2ODR D;  3N2K B;  4X1Y A;  4JYB A;  5EBL C;  4YRG A;  3WFV A;  4XTY A;  1BL8 A;  1JVM A;  3B09 A;  3CC2 V;  4XTZ A;  2ETN A;  4WFE A;  4NTX A;  3SJC C;  3NXS A;  4X8A A;  4P71 C;  3ZMU A;  3MHS C;  4WBN A;  2PY5 A;  2NLJ C;  1VQL V;  3RYC B;  4UP8 A;  1IXM A;  3F5W C;  2RCV A;  1JOY A;  1L0N H;  3FD9 A;  1D2D A;  1E24 A;  2VS0 A;  1S77 D;  3L72 H;  3HKD A;  2UU9 O;  2EIK C;  2DU5 A;  4MVZ A;  4FLU A;  3K9A A;  3EFF K;  4K0K O;  3IGA C;  1ENV A;  4D6T H;  1KMN A;  4ZKI A;  4YRF A;  2QKS A;  3ZHV A;  1THZ A;  3K59 A;  3EFR A;  1V55 C;  1EZJ A;  1Z5V A;  2R9R B;  4KXR A;  2Q7G A;  1NJ2 A;  2HVK C;  2AZ2 A;  4JI1 O;  2AHZ A;  1G5H A;  3DXR B;  2CTQ A;  2M6Y A;  5IT9 N;  3G67 A;  1Q86 W;  2DVE A;  4KHP B;  4IL6 Z;  2HVJ C;  2WWW A;  1I5Y A;  1W66 A;  2Y4T A;  4LVI A;  3LDD A;  4TUY B;  2PI5 A;  5KHI A;  4B3T B;  3P8Y A;  3NET A;  2IH1 C;  2XAJ A;  4J9Y B;  3GWO A;  4X66 O;  1CEZ A;  2A0L A;  3HR0 A;  3TCU A;  1B70 A;  4PA9 A;  4O4L B;  5B1A C;  3Q4H B;  3CCS V;  1ZLZ A;  1MNG A;  2WLJ A;  2WLM A;  1SZT A;  3E35 A;  3SJB C;  3SJQ C;  1WPX A;  2ARS A;  1E79 G;  4X66 B;  3G71 V;  2F43 G;  3CPW U;  2XUM A;  4TV8 B;  2AXT Z;  3I56 V;  3OE7 G;  4DV5 O;  1DF4 A;  5BXZ A;  3SYP A;  4OX9 B;  5EK0 A;  4TVA A;  1K5Q A;  5DED A;  5CBG A;  2K9P A;  4X62 O;  2CGN A;  4ZHQ B;  5C51 B;  3ASN C;  4Q20 A;  4RDX A;  1XMQ O;  3KCX A;  4A5U B;  4DV5 B;  3DC5 A;  2LW1 A;  3SGI A;  4P2Z A;  3WB1 A;  4H0L B;  3HXU A;  1W0J G;  1NVP D;  1Q90 D;  3K9S A;  3A8T A;  4YJ3 B;  4DUZ B;  1XMQ B;  3CCQ V;  4HAM A;  5EZY B;  4K8X A;  1VQ7 V;  5F2V O;  3JAL A;  5ITZ B;  2QHT A;  2BSK B;  1YB3 A;  2YID A;  3CSX A;  5JVD B;  5J2T B;  4TVW A;  1FXV A;  3RIR A;  4PA6 A;  3SYC A;  4UCU A;  2YUA A;  2ALY B;  4YDQ A;  3KG2 A;  5B66 Z;  2E76 B;  4OPA A;  4MTF A;  2ARH A;  4YPF A;  4TTV A;  5FPO A;  1BBU A;  4JZ2 A;  1BBW A;  5LBQ A;  4B7K A;  2PME A;  4MVQ A;  3OD1 A;  5LHH A;  2IBZ H;  3MD0 A;  3OR7 C;  1WPB A;  4JI4 O;  3LDC A;  5KA6 A;  1OZ0 A;  3F7V C;  2VQF B;  3B2E E;  2HKO A;  3S3X A;  4DR3 B;  1HDJ A;  4TQD A;  2BCC H;  4CH3 A;  3L4G B;  4UVA A;  3AG7 A;  1AI4 A;  3FB5 C;  4TSF G;  2RHS A;  3ICX A;  1VQ8 V;  4LNS A;  3DTU B;  4CZZ A;  3QG5 A;  4DRX B;  3ZED A;  2WA4 A;  1EFW A;  3CE2 A;  1SET A;  2G4C A;  2L35 A;  2EWN A;  3K0G A;  4PV1 B;  3K03 A;  3P8V A;  1ATI A;  4HWS A;  3SYA A;  5JCO C;  1PP9 H;  3M4P A;  3IAY A;  4P3O A;  4FJC C;  5LGN A;  2GTA A;  1CP9 A;  2MK3 A;  1N32 B;  1GM7 A;  4UCR A;  4LF9 O;  2ZT7 A;  2KG7 B;  3L70 H;  3T1C A;  5FNV B;  3HKE A;  3N2K A;  1E1Q G;  3R66 A;  2Q5I A;  3CCU V;  3T1Y O;  1X59 A;  2QWO B;  1F7Y A;  1L0W A;  4LF9 B;  1ADY A;  2I4N A;  1HNX O;  3F7Y C;  2ZIM A;  4B3M B;  1SQP H;  3OGC C;  1JFF A;  1VQ5 V;  5CB4 B;  1OCC C;  4HWO A;  2B5U A;  2EIJ B;  1ZX3 A;  1B3Q A;  1X2G A;  5LP6 C;  3SYQ A;  3BRC A;  3BA9 A;  2Q0O C;  2IM9 A;  1HNX B;  3CXH F;  1WNL A;  2ZZG A;  1HR0 B;  4I50 B;  1P84 F;  2CH7 A;  3OUF A;  1PYS A;  3HY0 A;  1Z7N A;  2F66 C;  1GH6 A;  5E79 Z;  3AG3 B;  1N34 O;  2JRI A;  1H38 A;  3ABK B;  1I94 B;  4LF4 O;  5KMG B;  2AHY A;  1VP7 A;  2JGD B;  3LC0 A;  4JYY A;  3TXQ A;  3HXW A;  2JEX A;  1QF6 A;  4LF4 B;  1R6K A;  1H2S B;  1PL4 A;  2IU0 A;  2GHY A;  3BJU A;  4CC6 A;  4X1K B;  2ZXW B;  1Q82 W;  4DW1 A;  4OP0 A;  4WF9 V;  4IGG A;  2EBO A;  5FL7 G;  1X54 A;  4WJ3 M;  2RHQ B;  1RSO A;  4TUY A;  1URF A;  1TAE A;  3PCO B;  4H33 A;  1IL2 A;  4K88 A;  3QTC A;  4LFA O;  3OR6 C;  2NNU A;  1DK1 A;  2JJ2 G;  1GO3 F;  2XHB A;  3ML0 A;  1KD1 W;  3UCS C;  2CJA A;  1ASY A;  3ABL B;  4IIJ A;  4P72 A;  5C53 B;  4J10 A;  1Y74 B;  2Y48 A;  5H6Q A;  4MW8 A;  2I4L A;  3M4Q A;  4LF8 O;  2OTL V;  1KKC A;  1GRJ A;  5LA6 A;  3HXV A;  1N33 B;  1XOU A;  3ZRV A;  3JAK A;  4UP7 A;  1RM1 C;  2AKW A;  2HHH O;  3RL6 A;  3RUX A;  4YIP A;  3HRK A;  3PJS K;  4LWS A;  1XDC A;  2IU3 A;  1XRE A;  1AR4 A;  4LVM A;  4I4T A;  4J15 A;  3E8H A;  1NJ1 A;  1SZX A;  4J11 A;  2HHH B;  3ZHQ A;  1V9P A;  3C3S A;  4LP8 A;  1KP3 A;  1NT2 B;  1FD9 A;  4UB8 Z;  1DTO A;  2ZD9 A;  4NTW A;  1SKV A;  3H1L H;  4PDR A;  2PI4 A;  2IJI A;  4MTX A;  2DJZ A;  1SQX H;  4J41 A;  5ITZ A;  4JYA O;  4G85 A;  4W4L A;  2BSK A;  3APQ A;  1K4D C;  2XGT A;  1TUB B;  4GZR B;  4JI0 O;  3A0H Z;  4O2B A;  2QWR B;  3IFX A;  2ZXF A;  4Z2W A;  4DXW A;  2VQE B;  2QTO A;  1AR1 B;  3E22 A;  2J3L A;  4JGS A;  4UCS A;  3B8M A;  2UXB O;  1I7F A;  2QTS A;  2QDO A;  2WLN A;  2ADQ B;  2O57 A;  4EB6 A;  1FFX B;  2XOK G;  2UUC B;  3AG2 B;  2ZTG A;  2UXB B;  4FLT A;  4X88 A;  1Y6X A;  2QEX V;  4LF7 O;  1MMM A;  1VQN V;  4QNH B;  2DYR C;  3L4G A;  3K5M A;  3E9I A;  1X4T A;  3VQW A;  2A3Q A;  3V8L A;  2OCC B;  1BE3 H;  2F1M A;  3IC7 A;  5CA0 B;  1IUR A;  4AHC A;  3U0Z A;  5L3C A;  4D7T A;  3DC6 A;  3CXC U;  3AK1 A;  1RPO A;  1YF2 A;  4I55 A;  2EZP A;  3RFR A;  3ABM B;  4DV0 O;  5LMN O;  4JI6 O;  4EO4 A;  1JMK C;  2JGU A;  1E1R G;  3MEY A;  4FLY A;  4YRC A;  2GV9 A;  3V7S A;  4TWK A;  4DV0 B;  4GLX A;  4G27 B;  4GCZ A;  1QLE C;  5L3B A;  1DLB A;  2E65 A;  4PA3 A;  4P75 A;  3D36 C;  1MOF A;  3D3I A;  4ZIB A;  4H2W A;  4G2K A;  3CD6 V;  1FJG O;  1ZSP A;  5KHJ A;  1ZL8 B;  5A2Q N;  1NI8 A;  4DV2 B;  4X64 B;  4TV9 B;  1H4S A;  3P30 A;  1B7Y B;  2EIL B;  1FJG B;  1YI2 V;  1YTF B;  3OEH G;  4DR5 B;  1XNQ O;  1S76 D;  5CA1 B;  1G8M A;  1X2H A;  3K58 A;  2CTP A;  1XNQ B;  5GTH Z;  5DEC A;  3V8J A;  3OTO B;  1IBL O;  1S5H C;  3H1H H;  2B9Z A;  3JAR A;  1VQP V;  2DMX A;  1IDS A;  4DR2 B;  3JD2 A;  2YIB A;  1YZB A;  3K57 A;  1UPG A;  1FXH A;  4JAS A;  1USY A;  4O4J B;  4GX1 A;  1PNL A;  3FX7 A;  5BMV B;  4YCV A;  3OFN G;  4YRP A;  2WLH A;  3ZRW B;  4PD4 F;  1SRY A;  4H13 B;  4YCW A;  4LF6 B;  4NKG B;  3VBB A;  3QO8 A;  4Q6G A;  2H94 A;  4X1K A;  1PV0 A;  4KR2 A;  3E9H A;  3LSQ A;  5B3S B;  1US6 A;  2DTH A;  4B3S B;  3HXZ A;  3WG7 B;  2RMK B;  2Q8V A;  4FMT A;  5LGU A;  2QR4 A;  1SC5 B;  4C7U A;  4IYI A;  2LO1 A;  2ZT9 B;  1Y74 A;  1FXK A;  4ASU G;  1XHZ A;  2EAY A;  1EZV H;  4QGP A;  1P49 A;  3LUT B;  3X2Q B;  2EX3 A;  3R65 A;  5L3D A;  3P8T A;  2G38 A;  3K04 A;  2W6J G;  4O4I A;  4LH7 A;  4YRI A;  4P30 A;  3SPH A;  4ZOL A;  1YHQ V;  2W6I G;  3HKB A;  5FLX N;  3CJH B;  4K87 A;  2FML A;  4YHH O;  3H1I H;  3M99 B;  3B8N A;  3MQZ A;  4PJ0 Z;  4N23 A;  3UM7 A;  5JH7 B;  3T2M A;  3ZN0 A;  3JAS B;  3JYC A;  2EIK B;  4UV9 A;  1MSD A;  1Q81 W;  1T5E A;  2JEU A;  1G1X B;  3A7R A;  1XNR O;  4CS4 A;  3OW2 U;  1FYF A;  2BTQ A;  5IYB O;  5B3S C;  3W7W A;  4RAI A;  1WQ7 A;  2E64 A;  2PF4 E;  2DQ3 A;  2QSA A;  1R3I C;  4YRS A;  1S5L Z;  4PEL A;  3NEN A;  3ZIA G;  1YJN V;  5J2U B;  3WB0 A;  3REU A;  3G4S V;  3K5L A;  4RO2 A;  2RQ6 A;  3THO A;  3X2Q C;  5LL6 Y;  1YIJ V;  4JV5 O;  3R07 A;  2Q7H A;  2A7W A;  2DOS A;  3T4Z A;  2UXX A;  1I5X A;  5KAI Z;  2WSS G;  5B1A B;  4JV5 B;  3BA8 A;  4MVU A;  2WLI B;  4GYC B;  1KOG A;  2BOC C;  5JQG A;  4X9Q A;  5C8Y B;  1YVW A;  1OHH G;  4R50 A;  3WB2 A;  5B1N A;  4I0X B;  2LFS A;  1EVL A;  3UT5 A;  5LXT A;  5B1O A;  1KEC A;  1R6N A;  4LNU B;  1VF5 B;  4U7N A;  1VMG A;  1NKD A;  3HKC B;  4P9O A;  2ZE8 A;  3A32 A;  2RNB A;  3CS5 A;  3E86 A;  1VIB A;  2UU9 B;  2A06 H;  3IC9 A;  3JSL A;  2J3M A;  1IVS A;  1NBM G;  4K0K B;  1NVP B;  3ASN B;  1KP2 A;  1QR8 A;  4FZ1 A;  5CMU A;  5CN0 A;  3J7A U;  4H02 A;  1H8E G;  1ZTE A;  4FLZ A;  3TET A;  4P3P A;  3RN4 A;  4MVS A;  1A32 A;  4F6R B;  2IJH A;  2UXN A;  3HB3 B;  4ZI7 A;  3RW0 A;  3I55 V;  4DR6 O;  4XU0 A;  1EN5 A;  1E22 A;  1M90 W;  3AK3 A;  4JI1 B;  5EIB C;  4FM2 A;  2LP7 A;  3FAV B;  1MSW D;  2YEV A;  3ETE A;  3I5D A;  4DK0 A;  1MZF A;  2NN4 A;  1X55 A;  1JJC B;  4BW5 A;  1IBK O;  3EVK A;  5IY5 C;  1K92 A;  1WA8 B;  1XIL A;  3P32 A;  5EIB D;  3NR7 A;  3CRR A;  3RKX A;  1XEQ A;  2JS5 A;  2KQX A;  3OMN B;  4J7K A;  4H2S A;  4PDM A;  2AZ0 A;  3A5Z A;  4LBE C;  5IJ0 B;  1WLE A;  2D2C B;  5C93 A;  1IBK B;  4FM0 A;  4QE9 A;  3BAA A;  4LFB O;  1YSC A;  4LH6 A;  5EBW C;  2GUZ A;  4RQF A;  3WQZ A;  2DW4 A;  2JVD A;  5DN6 G;  1KYO F;  3EHB B;  4WJ4 A;  3UGQ A;  3O65 A;  3NEM A;  2PTM A;  4L87 A;  4X89 A;  2UXC O;  3S3W A;  2KKW A;  2CIM A;  4YJ2 A;  1NTK H;  4ZTZ B;  1RIQ A;  3A0B Z;  2ZR3 A;  4IT5 A;  4DR4 O;  4P73 A;  2C2A A;  1VQK V;  3ERR A;  2W0X A;  1W59 A;  2XTI A;  1EN6 A;  4X62 B;  2P5O A;  1NTM H;  5KX5 B;  3LNN A;  1H2G A;  4GKJ O;  2QM7 A;  1KC8 W;  2C7I A;  4DR4 B;  1X01 A;  2XAS A;  1BIA A;  4WFG A;  1N0J A;  1XBL A;  1Y76 B;  1SQG A;  3G80 A;  4MS2 A;  2DWD C;  4NXM O;  1GGM A;  4H37 A;  4X20 A;  2PGG A;  2DTI A;  2EJ9 A;  3RGB A;  2UXD O;  2Z5U A;  3CRA A;  3UGT A;  2GDS A;  4J9Z B;  2ZIN A;  4G84 A;  2E5A A;  1KKD A;  1UJW B;  2EJR A;  1X56 A;  2P90 A;  3JD1 A;  3CWB H;  2A79 B;  3I7F A;  4DV7 O;  2E5L O;  1XHX A;  4P72 C;  5BZB A;  2YIA A;  3N2G A;  3QF7 A;  4YXW G;  1OCC B;  1JJO A;  1D5A A;  4JI4 B;  1SQV H;  2F93 B;  3BY6 A;  3G1Z A;  5LP6 B;  4NYK A;  4QE7 A;  5KA5 A;  4DV7 B;  3TEH B;  4O2D A;  4MTO A;  3RYI B;  3RYH A;  4CH5 A;  2WA3 A;  3JAW A;  3W7T A;  4YRR A;  3W3S A;  3STL C;  5IYD O;  1VQO V;  5LOV B;  4RUE A;  2LJ2 A;  4AQY O;  1K8A W;  1YCI A;  1Z5W A;  4BR6 A;  3FB6 C;  3U11 A;  4BIZ A;  1Q3E A;  5EYP A;  2EJF A;  2CUG A;  1OCR B;  5IYZ B;  1EQR A;  1G5I A;  4JI2 O;  2I4M A;  2Q5Z A;  1E1O A;  3APO A;  3ZMT A;  1HP8 A;  3KZI Z;  3L71 H;  2Q73 A;  5J2U A;  2PYJ A;  3QVN A;  1NJ8 A;  3CC4 V;  1F4N A;  5IJ9 B;  2QGN A;  1AJN A;  2WAM A;  4DR7 O;  2OTJ V;  1R3L C;  1MG1 A;  1E1T A;  4TWA A;  4IYH A;  4FK5 C;  3ZHR A;  3T1Y B;  5GON B;  1C0A A;  3CMQ A;  2Q4P A;  3VOU A;  2FL4 A;  3RYC A;  2MW2 B;  4PHC A;  2IJJ A;  2X7R B;  2JDI G;  4I5S A;  4W4K A;  1RFY A;  4MVM A;  4CS3 A;  1BIB A;  2Q69 A;  4ZTU B;  2BTO A;  11AS A;  1PNK A;  3W7S A;  2CDY A;  4QPJ A;  4YY3 O;  2E10 A;  4HZ3 A;  3BAB A;  1R3J C;  3AG1 C;  1RM1 B;  1RPR A;  5KAF Z;  1BHA A;  4GUN A;  3L1A A;  2HNI A;  1GTO A;  1H4Q A;  4YY3 B;  1N34 B;  1BQZ A;  1OCR C;  4XBF A;  2DQ0 A;  2XAG A;  4YRQ A;  3ICA A;  3DXR A;  2RDC A;  2N05 A;  1YJ9 V;  2PMF A;  4DQ2 A;  2YI8 A;  4UXN A;  1H4V B;  2OYQ A;  1DGS A;  1N36 O;  3HXY A;  1CPY A;  4HWR A;  3IJ4 A;  2N74 A;  1JJC A;  5LYJ B;  2WLK A;  4P75 C;  1AI6 A;  1BS3 A;  1H8H G;  1VQ6 V;  2Q9L A;  4O4L A;  3RYF B;  2ZIO A;  3Q4H A;  2CK3 G;  3FYE B;  3M7M X;  2YC0 A;  4KFM A;  4LFA B;  1R1B A;  1XQ8 A;  3FKS G;  4F6E A;  3UQ8 A;  5GW7 A;  4NVP A;  3O9O A;  3L74 H;  4JI7 O;  3C90 A;  3SJA C;  4TV8 A;  3NEL A;  2EIN B;  2YSU B;  3JCZ A;  3JAM N;  4MSW C;  3PZC A;  4FFB B;  4WF2 A;  3OAA G;  4LF8 B;  1XI1 A;  1N4C A;  4ZHQ A;  2ILM A;  2DYR B;  2ZE7 A;  1AP6 A;  3GWK C;  4B08 A;  2E75 B;  4JTA B;  4YJ3 A;  1H2L A;  4XTW A;  1U97 A;  2HJD A;  1DF5 A;  5EZY A;  3CP1 A;  2FTK A;  3ZRX A;  2E74 B;  5L3G A;  4DR1 O;  1USY C;  3IKM B;  1B6Q A;  1YDX A;  4BAY A;  4DV3 O;  3WU2 Z;  1ORQ C;  2DDZ A;  1O9G A;  2YIB D;  5JVD A;  5J2T A;  3ASO C;  1B76 A;  4IHJ B;  3A5Y A;  5GTI Z;  2ALY A;  4YRT A;  3IAL A;  3BFM A;  3SPC A;  1F23 A;  1QLE B;  4JYA B;  4WFF A;  4DV3 B;  1YXB A;  1K34 A;  4JI0 B;  2DJV A;  1P7B A;  2P06 A;  4NR1 A;  4QIW F;  3ZMV A;  1SA0 B;  4R8C A;  2EL9 A;  1TVK B;  4P74 A;  5C52 B;  2EIN C;  1KUQ A;  1XMO O;  4XTU A;  3JAT B;  1R6T A;  4HNA B;  3LNM B;  4U3J B;  2DTO A;  1J5W A;  5J9P C;  3D3Q A;  1FXK C;  4MW3 A;  3QO5 A;  4I7Z B;  2BOB C;  3PN1 A;  2WLL B;  1PD3 A;  4DK1 A;  4CS2 A;  4DRX A;  2Q67 A;  1YIT V;  3OT7 A;  4FLW A;  4LF7 B;  4UFZ A;  1NH2 B;  3CCE V;  4WBN B;  2Q68 A;  2QHV A;  3K5O A;  1K7D A;  3KKY A;  2CTR A;  3VQY A;  1LUV A;  1QCE A;  2ZDI C;  4ZBM A;  3E89 A;  3A0R A;  4CC5 A;  2V7Q G;  3ZS8 C;  2DYS B;  4RUF A;  3OUS A;  5KHH A;  3HKD B;  2XT9 A;  4JI6 B;  5LMN B;  2FYK A;  1OCZ C;  3SDL A;  1Q43 A;  3H1J H;  2Y4U A;  2XAQ A;  4K3A A;  4PI0 A;  1M56 B;  3HFZ B;  1SQF A;  3A74 A;  4FVM A;  2KG7 A;  2C8M A;  4XTV A;  1RP3 B;  1PPJ H;  5FNV A;  4MT8 A;  1SS3 A;  2OIE A;  4RMF A;  5A9G A;  2ZR2 A;  3CMA V;  1M93 A;  1I0H A;  2DWE C;  3CYO A;  2L6L A;  2ZZE A;  2Q0A A;  5CB4 A;  2V4D A;  3MF2 A;  4BIU A;  2LW7 A;  5GON A;  1P7G A;  3E2E A;  2QWN B;  4PA4 A;  3ABU A;  4I50 A;  2CTW A;  4TQF A;  2DEQ A;  4LCU C;  5LHG A;  4O2A B;  2W0F C;  1B70 B;  1QNM A;  3QO7 A;  2QM8 A;  1K97 A;  3ZHU A;  2QWQ B;  3U10 A;  4WFB V;  3ZJZ A;  2R70 A;  2DYS C;  3TEG A;  4B3R O;  2ZT6 A;  3KCY A;  5KMG A;  3GVM A;  3TJT A;  3OMA B;  1IBL B;  4LFC O;  1Y67 A;  4R6Z A;  2JGD A;  2YXY A;  2ZZF A;  1M56 C;  2FYU H;  4ICG A;  1H2M A;  4N21 A;  4PDL A;  4JI3 O;  4B3R B;  1XL4 A;  4TVA B;  1XUQ A;  1Q6H A;  5H5N A;  4H2V A;  1EBO A;  5B5E Z;  3K79 A;  4JI3 B;  2RN9 A;  5K1P A;  2RHQ A;  2ZQM A;  1WJZ A;  4GKK O;  2B1G A;  1B04 A;  4LF5 O;  3TUP A;  3PCO A;  4HWT A;  4AI8 A;  3FB7 C;  4FLX A;  2EUL A;  4OXS A;  4DV1 O;  3AEI A;  1NJ5 A;  1K4C C;  2B1I A;  1G4Y B;  1IXB A;  1VF7 A;  3B77 A;  1WP8 A;  2HFE C;  5E3I A;  5KUM A;  3K08 A;  1KU9 A;  4JI8 O;  3CCJ V;  3HY1 A;  4MVO A;  1WB8 A;  3FFQ A;  1JX9 A;  2VWJ A;  2Y69 C;  3OM3 B;  1Y66 A;  3A7A A;  1TUE B;  4MVR A;  4E51 A;  4HT4 A;  2P4V A;  1AVM A;  3BHP A;  2ZM6 O;  2NS6 A;  1IBM O;  1LNQ A;  5L3F A;  4PI2 A;  4P3N A;  4L8J A;  2DU7 A;  1EIY B;  2QHS A;  4DYL A;  5BR8 O;  4YHH B;  3RF1 A;  2RHS B;  2LQT A;  4YP0 A;  4P73 C;  3ZBH A;  1TGO A;  2IJK A;  2XAH A;  1SES A;  1HW7 A;  3HTZ A;  2K1E A;  1TUB A;  4JAA A;  3IG2 A;  1Y4M A;  1XNR B;  1MAB G;  1EFR G;  4MTG A;  1V54 C;  1W0K G;  3SYO A;  3QNE A;  2DKG A;  1MZE A;  3D36 A;  1M57 C;  4PDV A;  4JTC B;  5B1B C;  1QLN A;  2I4O A;  3KFU A;  1FFX A;  2V1D A;  1VQM V;  2AW9 A;  2XAF A;  1K73 W;  5TIS Z;  3G6E V;  3E8G A;  5IY5 B;  4U3J A;  1NNH A;  1KB9 F;  3HKE B;  3CRM A;  3RVZ A;  4PA7 A;  2YXH A;  1WU7 A;  2P67 A;  2WLL A;  4CH6 A;  4EKW A;  3LDE A;  3ETG A;  5CA0 A;  5IYC O;  1FKA O;  2DZ9 A;  2IY5 B;  1JFF B;  3UH0 A;  4GX5 A;  2P4K A;  4KQE A;  3OTF A;  4FIP C;  5DM6 V;  3ZN1 A;  4UV8 A;  1L0L H;  1AB3 A;  3SR2 C;  4BW9 A;  2CH7 B;  1PYS B;  2YIC A;  1LUW A;  2AMC B;  3RGL A;  1NJ6 A;  3CX5 F;  4U3F H;  1HC7 A;  4UPA A;  4XU1 A;  3HFZ A;  3N27 A;  2IW5 A;  2YS8 A;  2HEP A;  1QE0 A;  2HR3 A;  3H01 A;  2X6C A;  4FM1 A;  4GX2 A;  1BQ0 A;  1ZL8 A;  3CCL V;  2LGQ A;  4DR6 B;  4KHP O;  3L73 H;  2CJ9 A;  4YRN A;  5K1X A;  4TV9 A;  4B3T O;  4FPP A;  1B7Y A;  1JR9 A;  1S5J A;  1Q8I A;  1WB7 A;  3ZHS A;  2ARU A;  3JCU Z;  1GM8 A;  1KMM A;  3EXA A;  1RSO B;  5CA1 A;  5BY1 A;  2FKX A;  2ITD C;  4JAU A;  1QVF U;  3JD0 A;  4YRJ A;  3RAC A;  4O2A A;  1GN3 A;  1QU7 A;  4O4H B;  3VQX A;  4LFB B;  2QWP B;  4JF3 A;  4IIJ B;  4OX9 O;  1HWY A;  1FPO A;  1BZK A;  4GX0 A;  4JI5 O;  1VF6 A;  1QQC A;  4CBC A;  4U7O A;  2Z0A A;  1S72 V;  2ZE5 A;  5LA6 B;  4O4J A;  1EVK A;  1JPX A;  2F23 A;  3FB8 C;  2UXC B;  5BMV A;  3JAK B;  1WP7 A;  2AKW B;  4JYC A;  3ZRW A;  4JI5 B;  1H4T A;  4UVB A;  3B40 A;  1AI5 A;  1UFI A;  4LWS B;  5E1A C;  3HXX A;  3T4D A;  3RVY A;  4DUZ O;  1WPY A;  4I4T B;  4YRE A;  1SF9 A;  1Q6I A;  4RWU A;  4Z1V A;  3IKL A;  4GKJ B;  5CBF A;  1PL0 A;  1IZ3 A;  1OJH A;  2JK5 C;  2EJ7 A;  2P5I A;  1N0N A;  1PNM A;  3STZ C;  3LSS A;  4JTD B;  5KLV H;  4H2X B;  2Q6A A;  4NXM B;  3M8A A;  4E2L A;  4HBN A;  1ZWI C;  4YRL A;  2UUA O;  2M7W A;  4WFA V;  1I08 A;  2UXD B;  2GTS A;  4O2B B;  2OWO A;  1O9H A;  4GT1 A;  4UCV A;  3ZHT A;  4TVY A;  3E22 B;  2PYL A;  5CA3 A;  4P71 A;  1M9N A;  4NXN O;  4FFK A;  1NU1 H;  1HNW O;  4OGQ B;  2ART A;  4KL1 A;  2VQF O;  2UUA B;  3CJH A;  3CB2 A;  4DR3 O;  2PUS A;  4J80 A;  1K3E A;  2CGO A;  3OMI B;  1NS1 A;  4EB6 B;  2D3O W;  2E5L B;  3V7R A;  4LR3 A;  4NXN B;  1QBZ A;  3JSN A;  3E8B A;  1HNW B;  2ZE6 A;  2E1H A;  5JH7 A;  1ZUQ A;  3JAS A;  4XDK A;  1EIY A;  3ETD A;  1L1F A;  1AIL A;  5D5P A;  3P3P A;  3AG1 B;  4XEM A;  4UUJ C;  3CEI A;  4UCO A;  2CGH A;  1P4R A;  2Q7E A;  1JCH A;  5H2F Z;  3SPI A;  4I55 B;  3L9D A;  3D8C A;  4R7C A;  3K5N A;  1OV9 A;  1K9M W;  4AQY B;  2R72 A;  3OD4 A;  5LHI A;  4YRM A;  3TK1 A;  1GN4 A;  4DPG A;  1N32 O;  2H8P C;  2E3C A;  2Q5H A;  3BPZ A;  1NJI W;  3C3T A;  1ASZ A;  3E8F A;  4JI2 B;  3A2F A;  4E4E A;  2VWK A;  4PG3 A;  1NTZ H;  2DN9 A;  4CH4 A;  2NR5 A;  1MA1 A;  1U96 A;  4K35 A;  1F51 A;  3CHX A;  3ETQ A;  3K3W A;  2Y0I A;  1NR1 A;  1GN2 A;  4B3M O;  4DR7 B;  4NCX A;  4P74 C;  1Q6U A;  1KBH A;  2WLI A;  4AIL C;  1NYR A;  1N8R W;  2CAZ C;  5C8Y A;  2HG5 C;  4KUM A;  4I0X A;  5JJJ B;  2IY5 A;  2QKC A;  4LVJ A;  1G51 A;  4I9Q A;  3V8K A;  1OCO B;  4LNU A;  4DUY O;  1BMF G;  3W7X A;  1HR0 O;  5AG2 A;  4G28 B;  3V7C A;  3ZMS A;  3K06 A;  3DSQ A;  3HKC A;  1KQS U;  3BVO A;  5CBH A;  4J7Z A;  3OGI B;  2HLD G;  2DXU A;  3CRQ A;  4ABM A;  4DUY B;  1HXD A;  3UO3 A;  1I94 O;  3A31 A;  1PKX A;  1GKF A;  1FFT B;  1H2N A;  2F95 B;  3RWR D;  4QJF B;  4XU3 A;  1XL6 A;  3TXS A;  1BCC H;  2P0L A;  3MF1 A;  3JAR B;  2AMC A;  3HRI A;  4F6R A;  1AI7 A;  1K33 A;  2N04 A;  3JD4 A;  2ZNJ A;  4RQE A;  3FAV A;  1VAR A;  2QE7 G;  2Y0P A;  3CC7 V;  4KP4 A;  3ASO B;  3HPL C;  1WA8 A;  3MAQ A;  4UVC A;  2XTA A;  1QVG U;  1N36 B;  1SQB H;  2DXT A;  2FB5 A;  4UCT A;  3E83 A;  1H2K A;  5IJ0 A;  1L8D A;  2LFR A;  4WI1 A;  1N9W A;  1WNS A;  2DZC A;  1GM9 A;  4EEQ A;  4DW0 A;  1GMG A;  1OCO C;  4TOI A;  2EIJ C;  1AP5 A;  5JJE B;  2VRZ A;  1WYD A;  3F5T A;  4O4H A;  4X5O A;  3UFG A;  4JI7 B;  1N33 O;  1PM9 A;  3ZCC A;  1FXK B;  2EZO A;  1WN7 A;  4H2U A;  1BGY H;  1YJW V;  4AH6 A;  3L75 H;  4OLF A;  3FJP A;  2OT5 A;  3AG3 C;  4O4I B;  2P6J A;  1SQQ H;  1WAZ A;  2PZS A;  3FYI B;  4ZOL B;  3MHH C;  5KX5 A;  3HKB B;  3ABK C;  5KUK A;  3H1K H;  4J7J A;  2R9I A;  1ZAU A; 
#chains in the Genus database with same CATH homology
 3E86 A;  2ZZF A;  1M56 C;  4N21 A;  1EFW A;  4PDL A;  1SER A;  2J3M A;  1XL4 A;  1SET A;  2ITC C;  1NBM G;  3CME V;  4TVA B;  1NVP B;  3ASN B;  2G4C A;  2EWN A;  1KP2 A;  1QR8 A;  3K0G A;  2JJ1 G;  5CMU A;  5CN0 A;  3K03 A;  3P8V A;  4H02 A;  2KB1 A;  4I9W A;  1H8E G;  4H2V A;  3TET A;  4P3P A;  1ATI A;  4HWS A;  1LYL A;  1EBO A;  3K79 A;  3SYA A;  5K1P A;  2ZXW C;  4MVS A;  3M4P A;  1OCZ B;  2IJH A;  2RHQ A;  2UXN A;  2ZQM A;  3HB3 B;  1R3K C;  3RW0 A;  2B1G A;  3I55 V;  4XU0 A;  4P3O A;  4FJC C;  5LGN A;  3TUP A;  1E22 A;  1M90 W;  3PCO A;  4HWT A;  3FB7 C;  3GB7 C;  4H2X A;  1CP9 A;  2LP7 A;  2MK3 A;  1MSW D;  4OXS A;  2YEV A;  3ETE A;  1GM7 A;  3AEI A;  4XDL A;  1NJ5 A;  1K4C C;  1X55 A;  2ZT7 A;  1JJC B;  4BW5 A;  4WCE V;  2X6A A;  4HYO A;  3T1C A;  2B1I A;  3X2Q B;  1G4Y B;  5IY5 C;  1K92 A;  2CJB A;  1E1Q G;  3B77 A;  3P32 A;  3RKX A;  2HFE C;  3OMN B;  5KUM A;  2Q5I A;  3K08 A;  3CCU V;  4PDM A;  1AJP A;  4H2S A;  5E3I A;  3A5Z A;  3CCJ V;  3ABL C;  4MVO A;  3HY1 A;  1L0W A;  1ROP A;  4LBE C;  1ADY A;  1WLE A;  5C93 A;  1JX9 A;  3REX A;  2Y69 C;  2I4N A;  1FS0 G;  3OM3 B;  4QE9 A;  5H9C A;  3F7Y C;  2ZIM A;  3OGC C;  1VQ5 V;  4HWO A;  1YSC A;  1Y66 A;  1OCC C;  3A7A A;  2IH3 C;  2B5U A;  1TUE B;  4MVR A;  4E51 A;  2EIJ B;  4HT4 A;  5EBW C;  4RQF A;  1X2G A;  3WQZ A;  1HTT A;  2Z3Y A;  3TEH A;  2DW4 A;  3ZRS A;  3SYQ A;  5DN6 G;  2ATK C;  3EHB B;  4YRO A;  4WJ4 A;  2P7T C;  1WNL A;  2ZZG A;  5H6R A;  2NS6 A;  3ABT A;  3NEM A;  1K5S A;  3UGQ A;  4HA8 A;  4XTX A;  2X0L A;  4L87 A;  4X89 A;  1LNQ A;  5L3F A;  3OUF A;  1PYS A;  2CIM A;  12AS A;  1Z7N A;  3HY0 A;  4P3N A;  4WFH A;  4ZTZ B;  1RIQ A;  4YRK A;  2DU7 A;  1EIY B;  2ZR3 A;  3AG3 B;  2QHS A;  4K86 A;  4P73 A;  2C2A A;  5ELN A;  1VQK V;  3RF1 A;  2RHS B;  3ERR A;  1H38 A;  2XTI A;  2EIM B;  2HJF C;  1WQW A;  3ABK B;  4YP0 A;  1M1K W;  4F4L A;  1EOV A;  4P73 C;  5EBM C;  3AG4 B;  2IJK A;  2AHY A;  2XAH A;  1H2G A;  1SES A;  3HFV A;  2QM7 A;  2K1E A;  1KC8 W;  3HTZ A;  2C7I A;  1X01 A;  5EC2 C;  3IG2 A;  3LC0 A;  1W2B U;  2XAS A;  1BIA A;  1YFS A;  4WFG A;  2WPD G;  3BEH A;  1Y4M A;  3HXW A;  2JEX A;  1QF6 A;  1MAB G;  1EFR G;  1R6K A;  4MTG A;  1J95 A;  2IU0 A;  3BJU A;  1V54 C;  2GHY A;  1W0K G;  3SYO A;  3QNE A;  2ZXW B;  4LC1 A;  4MS2 A;  2DWD C;  5L3E A;  1Q82 W;  4H37 A;  1GGM A;  2DKG A;  4OP0 A;  2E41 A;  4UP9 A;  3D36 A;  4WF9 V;  1M57 C;  2EBO A;  4PDV A;  2DTI A;  2EJ9 A;  4YYE A;  5FL7 G;  1X54 A;  4JTC B;  3OEE G;  4WJ3 M;  2RHQ B;  5B1B C;  1S3J A;  1QLN A;  2I4O A;  3KFU A;  2ZNI A;  4XU2 A;  2V1D A;  1VQM V;  2Z5U A;  3PCO B;  4H33 A;  1IL2 A;  2XAF A;  3UGT A;  4K88 A;  1K73 W;  3QTC A;  5EC1 C;  1Z7M A;  5HFL A;  3OR6 C;  4J9Z B;  2ZIN A;  2NNU A;  3G6E V;  4G84 A;  2YEV B;  3E8G A;  5IY5 B;  2E5A A;  1GK9 A;  2JJ2 G;  1GO3 F;  3AG2 C;  3ML0 A;  1UJW B;  1KD1 W;  1KKD A;  1NNH A;  2EJR A;  1X56 A;  2CJA A;  2P90 A;  1ASY A;  3JD1 A;  3ABL B;  4P72 A;  5C53 B;  3RVZ A;  2A79 B;  2Y48 A;  4PA7 A;  3I7F A;  5H6Q A;  2Y69 B;  4BWA A;  1WU7 A;  4MW8 A;  2I4L A;  2P67 A;  2WLL A;  4EKW A;  5BZB A;  2A8E A;  4P72 C;  3LDE A;  3M4Q A;  4CH6 A;  5ELO A;  3ETG A;  4YXW G;  2OTL V;  1OCC B;  3RBZ A;  5IYC O;  2OCC C;  2DZ9 A;  2IY5 B;  3HXV A;  1YFR A;  3BY6 A;  3ZRV A;  3G1Z A;  3UH0 A;  4UP7 A;  1RM1 C;  2AKW A;  4GX5 A;  2EIM C;  4QE7 A;  5KA5 A;  3RUX A;  3RL6 A;  1ADJ A;  4KQE A;  3HRK A;  3AG4 C;  4FIP C;  1BHB A;  1S0V A;  3TEH B;  4HWP A;  5DM6 V;  3ZN1 A;  3PJS K;  2QA4 V;  2IU3 A;  4O2D A;  4MTO A;  3A7U A;  4UV8 A;  4LVM A;  1NYQ A;  3CCR V;  3ABM C;  3SPJ A;  4KR3 A;  3W7T A;  4CH5 A;  4J15 A;  1NH2 D;  3L2Z A;  4XEO A;  3E8H A;  1NJ1 A;  4YRR A;  4BW9 A;  3W3S A;  3STL C;  5IYD O;  1VQO V;  1PYS B;  2EJG A;  4LP8 A;  2AMC B;  1KP3 A;  4RUE A;  3RGL A;  1NR7 A;  3CCV V;  1NJ6 A;  5F5W A;  1DTO A;  2ZD9 A;  1HC7 A;  4YCU A;  1K8A W;  4UPA A;  4PDR A;  4XU1 A;  3HFZ A;  2IW5 A;  2PI4 A;  1B8A A;  2IJI A;  3FB6 C;  4MTX A;  1Q7Y W;  2DJZ A;  4Q15 A;  2QHU A;  4BIZ A;  2A9H A;  4TT3 G;  1QE0 A;  2HR3 A;  3H01 A;  2X6C A;  2EJF A;  4G85 A;  1OCR B;  1JJ2 U;  2XGT A;  1AJQ A;  1K4D C;  1EQR A;  1G5I A;  3SPG A;  4GX2 A;  2I4M A;  1NQT A;  1QR9 A;  1E1O A;  3CCL V;  1COW G;  2XND G;  3JD3 A;  2CJ9 A;  1V54 B;  4YRN A;  3ZMT A;  5K1X A;  4H2T A;  3IFX A;  2ZXF A;  3RKW A;  2JIZ G;  1NJ8 A;  5LGT A;  3CC4 V;  1F4N A;  4DXW A;  4FPP A;  1M57 B;  2QTO A;  1AR1 B;  1AJN A;  1B7Y A;  2J3L A;  4JGS A;  2ZCE A;  2WAM A;  5B1B B;  3B8M A;  5IDJ A;  2OTJ V;  1R3L C;  2ARU A;  2GSM B;  2EIL C;  1GM8 A;  1MG1 A;  4JPR A;  1E1T A;  1KMM A;  5HGQ A;  3DGE A;  5HFM A;  4TWA A;  3ZMZ A;  2WLN A;  4FK5 C;  2ITD C;  1C0A A;  1VQZ A;  3CMQ A;  3VOU A;  2XOK G;  4LVK A;  4JAU A;  3AG2 B;  1QVF U;  4DO2 A;  4PHC A;  3JD0 A;  4YRJ A;  3RAC A;  1YTF D;  3W7U A;  2ZTG A;  2IJJ A;  2X7R B;  2JDI G;  4I5S A;  4X88 A;  2ZT8 A;  4MVM A;  1BIB A;  3RKY A;  3VQX A;  2QEX V;  4CS3 A;  2Q69 A;  1VQN V;  4QNH B;  3VQV A;  4JF3 A;  2DYR C;  3L4G A;  4ZTU B;  3E9I A;  4QPK A;  1HWY A;  3VQW A;  1VQ4 V;  11AS A;  4GX0 A;  1PNK A;  3W7S A;  3V8L A;  2OCC B;  4QPJ A;  3IC7 A;  4CBC A;  2E10 A;  5KNN A;  4U7O A;  4HZ3 A;  1S72 V;  2ZT5 A;  1RM1 B;  1R3J C;  3AG1 C;  5L3C A;  1RPR A;  1EVK A;  1JPX A;  1VQ9 V;  3FB8 C;  1BHA A;  3CXC U;  3L1A A;  1RPO A;  1YFT A;  2AKW B;  4JYC A;  2ZDI A;  3ZRW A;  4Z1M G;  2HNI A;  2EZP A;  3CCM V;  1H4T A;  1GTO A;  1H4Q A;  4UVB A;  4XDJ A;  1R73 A;  3ABM B;  4EO4 A;  1AI5 A;  1OCR C;  5E1A C;  2ZGW A;  3T4D A;  3RVY A;  3HXX A;  4H2Y A;  1WPY A;  4P9P A;  2DQ0 A;  2XAG A;  4XBF A;  4YRQ A;  4YRE A;  3ICA A;  3IKL A;  1E1R G;  5CBF A;  1PL0 A;  1YJ9 V;  3MEY A;  2PMF A;  3UKM A;  1F4M A;  4YRC A;  4DQ2 A;  3V7S A;  4TWK A;  2JK5 C;  4G27 B;  4GCZ A;  1QLE C;  4UXN A;  1H4V B;  1YGB A;  5L3B A;  4HVC A;  1DLB A;  2E65 A;  2P5I A;  3HXY A;  4EX5 A;  4PA3 A;  1CPY A;  3EFS A;  4P75 A;  3WG7 C;  2ODR C;  1V55 B;  1JQ0 A;  4JAV A;  1PNM A;  4HWR A;  4LVL A;  3STZ C;  2X6B A;  1JJC A;  1MOF A;  1ARO P;  2WLK A;  3D3I A;  3LSS A;  4JTD B;  4P75 C;  1AI6 A;  2Q6A A;  4H2X B;  4H2W A;  4ZIB A;  4E2L A;  1H8H G;  4G2K A;  1VQ6 V;  3CD6 V;  3K0D A;  1ZWI C;  2ODR D;  4YRL A;  2ZIO A;  2CK3 G;  4JYB A;  2M7W A;  4WFA V;  5EBL C;  4YRG A;  3FYE B;  3WFV A;  4KFM A;  4XTY A;  4GT1 A;  1H4S A;  1BL8 A;  1JVM A;  4TVY A;  3P30 A;  3CC2 V;  4XTZ A;  3FKS G;  1B7Y B;  2EIL B;  5GW7 A;  5CA3 A;  4P71 A;  1YI2 V;  1M9N A;  3OEH G;  4WFE A;  1YTF B;  2ART A;  1S76 D;  3NXS A;  4X8A A;  3NEL A;  4P71 C;  2EIN B;  2YSU B;  3JCZ A;  1K3E A;  3OMI B;  3ZMU A;  3MHS C;  1G8M A;  1X2H A;  4MSW C;  2D3O W;  3PZC A;  4WF2 A;  2NLJ C;  3OAA G;  3V7R A;  1VQL V;  4UP8 A;  1IXM A;  3F5W C;  1JOY A;  1QBZ A;  2E1H A;  3E8B A;  2DYR B;  1E24 A;  3V8J A;  1S5H C;  4XDK A;  1VQP V;  1S77 D;  1EIY A;  3ETD A;  2DU5 A;  2EIK C;  1L1F A;  4MVZ A;  3JD2 A;  3EFF K;  3K9A A;  3AG1 B;  3IGA C;  4XEM A;  4JTA B;  4UUJ C;  4XTW A;  1ENV A;  1FXH A;  1P4R A;  4JAS A;  1USY A;  1DF5 A;  2CGH A;  2Q7E A;  1JCH A;  1KMN A;  4ZKI A;  4GX1 A;  2QKS A;  4YRF A;  1PNL A;  4YCV A;  1THZ A;  3CP1 A;  3OFN G;  2FTK A;  3SPI A;  3ZRX A;  5L3G A;  1USY C;  3IKM B;  2WLH A;  3EFR A;  3ZRW B;  1V55 C;  4YRP A;  1B6Q A;  1EZJ A;  4BAY A;  2R9R B;  4R7C A;  1ORQ C;  2DDZ A;  2Q7G A;  1K9M W;  3ASO C;  1SRY A;  1B76 A;  5LHI A;  1NJ2 A;  4YCW A;  4YRM A;  3TK1 A;  2HVK C;  3VBB A;  3A5Y A;  4DPG A;  3QO8 A;  4Q6G A;  2H94 A;  4KR2 A;  2AHZ A;  1G5H A;  2H8P C;  2ALY A;  4YRT A;  3IAL A;  2E3C A;  2Q5H A;  3BFM A;  3SPC A;  1F23 A;  1QLE B;  1NJI W;  4WFF A;  3E9H A;  1ASZ A;  3E8F A;  3LSQ A;  1K34 A;  1Q86 W;  5B3S B;  2DTH A;  3HXZ A;  1P7B A;  4QIW F;  3WG7 B;  2DVE A;  3ZMV A;  4PG3 A;  4FMT A;  2HVJ C;  2WWW A;  1I5Y A;  4R8C A;  5LGU A;  1W66 A;  4CH4 A;  3LDD A;  4LVI A;  2PI5 A;  2EL9 A;  4CH3 A;  4P74 A;  5C52 B;  3P8Y A;  1F51 A;  3NET A;  2EIN C;  2IH1 C;  3K3W A;  2XAJ A;  4J9Y B;  4XTU A;  3GWO A;  1NR1 A;  4NCX A;  4P74 C;  1CEZ A;  2A0L A;  2WLI A;  3TCU A;  3LNM B;  1NYR A;  1B70 A;  1FXK A;  4PA9 A;  5B1A C;  4ASU G;  1N8R W;  2DTO A;  2EAY A;  3CCS V;  2HG5 C;  1J5W A;  4KUM A;  5J9P C;  1FXK C;  3LUT B;  3R65 A;  5L3D A;  4MW3 A;  2WLJ A;  2WLM A;  1SZT A;  2BOB C;  3QO5 A;  3E35 A;  3K04 A;  3SJQ C;  2W6J G;  3P8T A;  2IY5 A;  1WPX A;  2WLL B;  1E79 G;  2ARS A;  4YRI A;  4P30 A;  1G51 A;  4LVJ A;  3V8K A;  1OCO B;  1BMF G;  1PD3 A;  3SPH A;  2F43 G;  3W7X A;  4G28 B;  2W6I G;  3G71 V;  3CPW U;  1YHQ V;  3ZMS A;  3V7C A;  3K06 A;  3DSQ A;  4CS2 A;  1KQS U;  2Q67 A;  1YIT V;  3I56 V;  1NH2 B;  4K87 A;  3OE7 G;  3CCE V;  5CBH A;  1DF4 A;  3SYP A;  2HLD G;  5EK0 A;  2Q68 A;  2DXU A;  2QHV A;  4TVA A;  1K5Q A;  1K7D A;  5CBG A;  3VQY A;  1QCE A;  2ZDI C;  5C51 B;  1HXD A;  3M99 B;  3B8N A;  4ZBM A;  1PKX A;  1GKF A;  1FFT B;  3A31 A;  3MQZ A;  3ASN C;  3E89 A;  4N23 A;  4Q20 A;  3UM7 A;  3A0R A;  3T2M A;  3ZN0 A;  1XL6 A;  2V7Q G;  3JYC A;  4QJF B;  4XU3 A;  4RDX A;  2P0L A;  2EIK B;  3MF1 A;  4UV9 A;  2AMC A;  2DYS B;  3HRI A;  4RUF A;  3OUS A;  1AI7 A;  4P2Z A;  1Q81 W;  1K33 A;  3HXU A;  2JEU A;  1W0J G;  1NVP D;  3A7R A;  3OW2 U;  4CS4 A;  2FYK A;  1OCZ C;  1FYF A;  5IYB O;  3JD4 A;  4RQE A;  2ZNJ A;  5B3S C;  3W7W A;  4HAM A;  3CCQ V;  2XAQ A;  1M56 B;  3HFZ B;  3A74 A;  2QE7 G;  4RAI A;  3CC7 V;  2C8M A;  1VQ7 V;  4XTV A;  1WQ7 A;  2E64 A;  4KP4 A;  3ASO B;  3HPL C;  4MT8 A;  2QHT A;  4UVC A;  2DQ3 A;  1R3I C;  4YRS A;  1YB3 A;  4RMF A;  1QVG U;  3NEN A;  4PEL A;  2ZR2 A;  3CMA V;  2DXT A;  3ZIA G;  4TVW A;  1FXV A;  3E83 A;  3RIR A;  4PA6 A;  3SYC A;  2DWE C;  1YJN V;  3REU A;  2LFR A;  3CYO A;  3G4S V;  2ALY B;  4WI1 A;  4RO2 A;  1N9W A;  4YDQ A;  3KG2 A;  2ZZE A;  4MTF A;  4YPF A;  3X2Q C;  2DZC A;  4TTV A;  1YIJ V;  1BBU A;  3MF2 A;  1GM9 A;  4BIU A;  3R07 A;  1BBW A;  5LBQ A;  3E2E A;  1GMG A;  1OCO C;  2Q7H A;  3A32 A;  2EIJ C;  3T4Z A;  2UXX A;  4MVQ A;  2PME A;  1I5X A;  1WYD A;  3OD1 A;  5LHH A;  4PA4 A;  3MD0 A;  3OR7 C;  4X5O A;  2WSS G;  3UFG A;  3ABU A;  5B1A B;  3LDC A;  5KA6 A;  2DEQ A;  4LCU C;  5LHG A;  4TQF A;  1OZ0 A;  4MVU A;  2WLI B;  3F7V C;  2W0F C;  2BOC C;  2HKO A;  3ZCC A;  1B70 B;  1KOG A;  1FXK B;  3QO7 A;  2EZO A;  4H2U A;  2QM8 A;  1K97 A;  1OHH G;  4R50 A;  5B1N A;  3L4G B;  4WFB V;  4TQD A;  2LFS A;  4UVA A;  3ZJZ A;  1AI4 A;  1YJW V;  3FB5 C;  4TSF G;  1EVL A;  2RHS A;  2DYS C;  4OLF A;  3TEG A;  4AH6 A;  3FJP A;  2ZT6 A;  2OT5 A;  3AG3 C;  5B1O A;  2P6J A;  1VQ8 V;  4LNS A;  1KEC A;  1R6N A;  3DTU B;  4CZZ A;  3FYI B;  3OMA B;  3MHH C;  4U7N A;  3ABK C;  5KUK A;  1NKD A;  4P9O A;  4R6Z A;  2R9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...