3LSSA

Trypanosoma brucei seryl-trna synthetase in complex with atp
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
470
structure length
438
Chain Sequence
GSMMVLDIQLFRDETGANIIRESQRRRFADPDIVDAIIEADKKWRRTQFLTEASKKLINICSKAVGAKKKAKEACVLQLKQLSKDLSDQVAGLAKEAQQLEEERDKLMLNVGNILHESVPIAQDEETGNTVVRTFGNTTKRAKLNHVSIMERLGMMDTSKAVTSMAGGRSYVLKGGLVQLQVALVSYSLDFLVKRGYTPFYPPFFLNRDVMGEVAQLSQFDEELYQVSGDGDKKYLIATSEMPIAAYHRGRWFTELKEPLKYAGMSTCFRKEAGAHGRDTLGIFRVHQFDKIEQFVVCSPRQEESWRHLEDMITTSEEFNKSLGLPYRVVNICSGALNNAAAKKYDLEAWFPASGAFRELVSCSNCTDYQSQSVNCRYGPNLRQNVKEYCHMLNGTLCAITRTMCCICENYQTEEGVVIPDVLRPYMMGIEMIRFENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seryl-tRNA synthetase
publication title X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
rcsb
source organism Trypanosoma brucei
molecule tags Ligase
total genus 159
structure length 438
sequence length 470
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3lssA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3lssA02
1USYC 1YFRA 4H2VA 3NELA 3P8VA 3MF2A 3R07A 2RHQB 3PZCA 4XTXA 2DQ3A 3TEGA 1ATIA 1HC7A 1SERA 4H2XB 3OD1A 2DXUA 4UPAA 1G51A 4KQEA 1ADYA 3UGQA 2DTHA 4PHCA 4CH6A 3E9HA 4HVCA 3ERRA 3M4PA 2I4NA 1EOVA 1N9WA 4YRMA 2EJ9A 4E51A 4P73A 2CJ9A 3HXUA 3HY0A 3REXA 3LC0A 1NJ5A 2P0LA 3EFSA 1EVKA 4K87A 2ODRD 5KNNA 2EAYA 3TEHA 4CS2A 3IKMB 1KMMA 2E41A 3PCOA 4RQFA 4YREA 1G5HA 2CGHA 4NCXA 3HXVA 4YRSA 4XTWA 3HFZA 1SESA 1BBUA 2E64A 1NJ1A 3MF1A 3RKWA 2ZCEA 3G1ZA 3VQWA 4WJ3M 2ZZEA 4P74C 1IL2A 4XTUA 2ZZGA 2E10A 2Q7EA 1WYDA 3BJUA 1WPYA 4AH6A 2PMFA 2ZT7A 1X55A 3DSQA 4P71A 4YCUA 4YRTA 1L0WA 5F5WA 3TEHB 2ZNIA 4XTVA 3PCOB 1W66A 1X2HA 3A31A 2ZR3A 2ZINA 2QHUA 3MEYA 4K86A 3HFZB 2C7IA 3NETA 4LNSA 4UP8A 2PMEA 1JJCA 12ASA 4J15A 1WQWA 5C52B 3QO8A 1E22A 4P75C 1BBWA 3V7CA 1G5IA 3RGLA 4P72A 1KMNA 1B7YA 3RL6A 4Q6GA 1SRYA 2ZZFA 4TVWA 2ARSA 1WNLA 1YB3A 2P5IA 3L2ZA 4G84A 2EWNA 2EL9A 4TTVA 2DXTA 1E1OA 1JJCB 3I7FA 4YRIA 1Z7NA 4RDXA 2QHSA 3HRKA 3A74A 4RQEA 4YRQA 1X54A 3RKXA 1B70A 4HWTA 2DZCA 1X56A 4YROA 2ZIMA 1B7YB 1NNHA 2J3LA 4YRJA 2Q5IA 5E3IA 4KR3A 3V8KA 2CJBA 3CMQA 1WU7A 4WJ4A 3HXWA 4P3OA 3RUXA 1WQ7A 4YRGA 5ELNA 4RMFA 3HXXA 1EIYA 4XU2A 2G4CA 4XEOA 1C0AA 1NYQA 3UH0A 3RACA 3VQXA 2RHSA 3V7RA 4TWAA 5K1PA 3A32A 1GGMA 4CH4A 2E5AA 4EO4A 2ZT8A 3HFVA 2DJZA 2Q5HA 3RIRA 1USYA 1B70B 3HRIA 1B8AA 4HWOA 4WI1A 2DU7A 1Z7MA 4CS3A 2DU5A 2DEQA 4UP7A 3LSSA 4HWSA 1EVLA 1H4SA 3REUA 3L1AA 2ZNJA 1EIYB 2E65A 4P3PA 4HWRA 3RF1A 1FYFA 2AMCA 2XGTA 1ADJA 3VBBA 1E24A 4YRPA 3IALA 4YP0A 2DDZA 4OP0A 4UP9A 1NYRA 4H02A 2DQ0A 3BFMA 4ZTZB 3HTZA 4YRLA 3WQZA 4P73C 2DTIA 4YRRA 1LYLA 2ARTA 4X5OA 2CIMA 2EJFA 2ZT6A 1BIAA 1ASYA 1BIBA 1YFTA 3V8LA 4BWAA 2EJGA 2I4OA 3A5ZA 4Q15A 2AMCB 4YDQA 2ARUA 4YCVA 4ZTUB 4P74A 1YFSA 3A7AA 2QHVA 1KOGA 2I4LA 4XTYA 4P3NA 1X2GA 1X01A 4H2UA 2C8MA 1VQZA 3HY1A 4XEMA 3FJPA 1NJ2A 2QHTA 1EQRA 1ASZA 5C53B 1HXDA 4XU0A 2E1HA 4P71C 1PYSA 4H2TA 3VQVA 3ICAA 4XU3A 2ODRC 3V8JA 4TVYA 2IY5A 3P8TA 4H2WA 3QTCA 4TQFA 4P75A 1H4VB 3IKLA 3EFRA 4ZIBA 3LSQA 1H4QA 2E3CA 2XTIA 4CH3A 3A7RA 2ZGWA 2DVEA 2AKWA 4TVAA 4H2YA 5K1XA 3UFGA 3QO7A 4YRNA 4HA8A 1QE0A 2ZXFA 4P72C 1PYSB 2ZT5A 1J5WA 3TUPA 1RIQA 4YPFA 2DKGA 4G85A 3IG2A 3L4GA 3E9IA 1WLEA 2IY5B 2ALYA 1QF6A 4XTZA 4HWPA 4CH5A 2J3MA 3NEMA 3RKYA 1HTTA 3M4QA 4CS4A 4OLFA 2RHSB 1NJ6A 4KR2A 4PG3A 1YGBA 3VQYA 2AKWB 3UGTA 1EFWA 3A5YA 5C51B 4YRKA 3NENA 4DQ2A 4K88A 4YRCA 4TVAB 11ASA 3HXYA 4BW9A 2Q7GA 2HNIA 2FYKA 2RHQA 4H2SA 4YYEA 1E1TA 3HXZA 4EX5A 4O2DA 4YRFA 1SETA 2CJAA 4L87A 4H2XA 3L4GB 3KFUA 4YCWA 5HGQA 2ZR2A 2ALYB 2I4MA 2ZIOA 3V7SA 3QO5A 1B76A 1NJ8A 5ELOA 3P8YA 4DPGA 4XU1A 2Q7HA 2ZTGA 3W3SA 4WF2A 2DZ9A 3QNEA 2DTOA 1H4TA 3A7UA 4TQDA
chains in the Genus database with same CATH superfamily
2VQFB 4MVQA 2A0LA 2K9PA 4H2VA 1TVKB 3K5LA 1TUBA 2YIBD 1NBMG 3MF2A 2EILB 4I55A 2F1MA 5EBWC 2DQ3A 1G6UA 3K03A 3TEGA 5LXTB 2DW4A 1QLEB 1TUEB 4MW3A 2V7QG 3JALB 4DV4B 1G51A 4KQEA 3J81N 5FNVB 2PI5A 1KKCA 5KUMA 4O4JB 2DTHA 3UGQA 3E22A 4IYIA 3E9HA 4HVCA 2PYLA 4DR6O 3P3NA 5BZBA 4I9WA 1F4NA 4YRMA 4JYYA 2Q4PA 4E51A 1BCCH 5LA6A 2EJ7A 2OCCC 1SQFA 4JZGA 4U7OA 5IYBO 2CJ9A 2WA3A 3REXA 3LC0A 3MAQA 1NJ5A 5JQGA 3EFSA 1EVKA 4K87A 2Q6AA 4JI3B 4WCEV 1FKAO 2E41A 3RBZA 2LFSA 4TV8B 4B3SB 5IY5B 4JI5O 1NU1H 3X2QB 2CGHA 1NQTA 1RPOA 3JAMN 4FM1A 4B3MB 1BBUA 3ETEA 2JEUA 3CMEV 4B08A 3ABKB 1HR0O 1VIBA 3VQWA 2QSAA 3HPLC 1S3JA 3CB2A 3B4SA 1OCZC 2ZZGA 2E10A 3ML0A 4KL1A 4UXNA 4DV3O 2PI4A 1GO3F 4FM0A 3MHSC 4BAYA 2AW9A 1SQBH 4GUNA 3TCUA 1MOFA 2PMFA 2ZT7A 4LF7B 4YCUA 1L0WA 4R50A 5F5WA 3TEHB 1J95A 3K58A 1W66A 4X9QA 1X2HA 2BTQB 4I50B 2ZINA 2CUGA 1N34B 2HHHO 3M99B 2QHUA 2UUCB 3LUTB 3MEYA 4MTXA 4K86A 2JGDA 2C7IA 2VS0A 4H44B 2MW2B 3EHBB 3ZMSA 3AG2C 4DR2O 2P7TC 3HKEB 4E2LA 1FXKB 4EEQA 4O4HB 1P7GA 1M57C 3BA8A 2GUZB 1VQPV 4G2KA 4P75C 4X1IA 4GX0A 4LVJA 4DR1O 3V7CA 4MVMA 3JARA 4RUFA 4JI6O 3R65A 1G5IA 1GN4A 3JD1A 4P72A 3B77A 2YDEA 5JJEB 3CRMA 2KB1A 4KFMA 1CEZA 3AG4B 1EN4A 1QQCA 1NVPB 2ZM6O 2GHYA 1WNLA 4H13B 5C8YA 2P5IA 4YJ2A 1AROP 2Z5UA 2XAFA 1R73A 4MVSA 3AG1C 3I7FA 4NYKA 4TV9B 1KKDA 3K04A 3OT7A 1R3LC 1SQQH 1Z7NA 4RDXA 3F7YC 2QHSA 3HRKA 1BQZA 4DR3O 3A74A 1IZ3A 3ZS8C 1Q43A 3ETGA 1Y4MA 3RKXA 4AI8A 2DZCA 1X56A 1PKXA 1S72V 1VQLV 1NNHA 2F43G 4CZZA 3A0HZ 3D36A 1NTKH 2R9RB 2CJBA 4IL6Z 1AP6A 5LP6A 4JV5B 2MK3A 5JH7B 3RUXA 3T4DA 2XTAA 4YRGA 1YSCA 2V4DA 3MHHC 3JAKA 1JOYA 3JSLA 5CA1A 4DR7O 2B1GA 1NKDA 2P4KA 1W0JG 3A32A 3ABLC 4EO4A 5C93A 2ZT8A 1QLNA 1MSWD 1ZX3A 4JPRA 1HWYA 1P4RA 4B7KA 2DJZA 2Q5HA 3JATA 3ZN0A 1Y76A 3N2GA 4PDMA 2DYSC 3ZRVA 4FLZA 1K4CC 2FMLA 2UXXA 2JS3A 4UP7A 1S77D 1PD3A 3LSSA 5JQGB 3OMAB 2VQEB 1EVLA 2CDYA 1AVMA 3T1CA 1A32A 1H4SA 4O4LA 1YJWV 4KXRA 4UFZA 5LOVA 4GX2A 1W2BU 1V55B 1EIYB 4HNAB 3UT5A 4FLXA 1R3JC 2F66C 1GKFA 1IXMA 2R9AA 1RSOA 4YRPA 1WNSA 4U3JA 1F23A 3N2KA 5EC2C 4KHPO 4UUJC 1IURA 1CXZB 3FB6C 2ZD9A 3ZEDA 1AI7A 1EBOA 4PV1B 1NYRA 4H02A 4I4TB 4PA3A 1N32B 4ZTZB 4LFBB 1U97A 4JI2O 4CC6A 1K5SA 4YRLA 2HR3A 1Q6IA 5IJ0B 1SQXH 3L72H 4LF6B 4FLUA 3H1KH 4JYCA 2CE4A 1BIAA 3HKDB 4DRXA 2B1IA 3ZMTA 1WA8B 4DR4B 1BIBA 2N05A 4EKWA 2OYQA 4YJ3B 1N36B 4DV1O 3L75H 5GONA 5CN0A 2IJIA 1OHHG 2JVDA 1XMOO 1Y74A 4K35A 4UVAA 4H37A 4Q15A 2AMCB 2JGDB 4YDQA 2ZKOA 2ARUA 4YCVA 2Y69C 3OR6C 2OCCB 5JVDA 2UUAB 1DGSA 5L3EA 1YCIA 4GCZA 1J5EB 4GT1A 4PDLA 4P3NA 5KHKA 1KB9F 1JVMA 1O9GA 3P3PA 1DLBA 3BAAA 4WFBV 1X01A 3SJAC 1R6NA 1VQZA 4UCOA 2VWKA 2WLLB 4D7TA 4MTGA 1EQRA 5C53B 2ZE8A 3OR7C 1AP5A 1F4MA 1HNZO 1HXDA 1Z2GA 2UU9O 1HNXB 1UPGA 2BCCH 3ICAA 2AXTZ 4X62O 5IWAB 1XL4A 3S3XA 1COWG 3LNMB 3V8JA 2KG7A 2CTRA 2RQ6A 2E74B 1OCZB 4NB5A 1P7BA 4LF7O 3ZCCA 2GV9A 3IKLA 2HVJC 3EFRA 3U11A 4WFFA 2E3CA 4GX1A 3PN1A 2KQXA 2GSMB 1VP7A 2DE0X 2F93B 4F6RB 2DJVA 1QVGU 2IJHA 5ITZA 4AILC 4B3TO 4X88A 4MSWC 1AI5A 2CGOA 5J2TA 1D5NA 3QO7A 4OPAA 2IM9A 2LW1A 3I55V 2AZ2A 3LDCA 1AR5A 5E1AC 4AQYO 4DR6B 4RO2A 4X65O 1N0NA 3AG2B 3TUPA 2XHBA 5LP6B 1RIQA 1V9PA 2QKCA 4HBNA 4G85A 3CC4V 3F5WC 3L73H 1M57B 4U3FH 4CBCA 4UCTA 2YC0A 1XDCA 4DK0A 1QF6A 2PY5A 4UCRA 1SZTA 3W7XA 3C3SA 1HTTA 4P2ZA 4ASUG 3RW0A 4LH6A 1NJ6A 1E1QG 4MT8A 3ZHTA 3VQYA 1JA8A 5EYPB 3UGTA 4JI5B 3JATB 3VOUA 4LFAO 3E83A 4K8XA 3NENA 2ODMA 3RYHB 2HNIA 4LWSB 2C2AA 2H94A 2X6CA 3BY6A 3HXZA 1HR0B 3SYQA 5LXTA 3APOA 2GDSA 2YIAA 1OCCC 3FKSG 1YXBA 3KFUA 2ALYB 2EINC 4DV3B 1AJPA 1ENVA 2ZIOA 5LOVB 3IFXA 3QO5A 1Z5WA 3CRRA 3UT5B 2P4VA 3KCYA 1H2GA 2Q7HA 1ZTEA 1VQ6V 3ZHRA 3BPZA 4WF2A 4PI0A 4U3JB 5KA5A 4NTXA 3QNEA 2EIMC 1DF5A 3J80N 2HHHB 3SPCA 1QBZA 5LMNO 4QE7A 4LVIA 5LHIA 3A7UA 4TQDA 1UFIA 1USYC 2QWRB 2WA4A 1BSMA 2ZT9B 2QWNB 3JD2A 4DR2B 3R07A 5H5NA 4FK5C 4NTWA 4DRXB 2R70A 3OAAG 2PYJA 3IAYA 1ZWIC 3SYAA 3CE2A 1KP2A 2M6YA 3JD4A 1ADYA 4DR1B 3ABLB 2IU3A 1KU9A 2P6JA 5EZYB 4JI6B 2Q0AA 4LF4O 1ZUQA 2QM7A 4F4LA 3OGIB 1PNMA 3FYEB 2I4NA 5JVDB 2PUSA 2HEPA 2DYSB 1SQVH 4PA7A 3GVMA 1BQ0A 4YIPA 4F6EA 2A06H 5IE9A 2ZM6B 3E8HA 2P0LA 4B7EA 3P32A 3T1YB 2ODRD 5H6RA 4DK1A 3TEHA 2QDOA 1KMMA 1IBLO 2BTQA 4I50A 5AG2A 1K5QA 3LNNA 5CBGA 1G4YB 4ZI7B 3G6EV 1G5HA 4DR3B 4NCXA 3HXVA 4YRSA 2X6AA 1SESA 3G6BA 4D7SA 3W7SA 2XAHA 3CX5F 3HKEA 1DF4A 1FXKA 2YXHA 3AG3C 3MF1A 2LO1A 2ZCEA 4O4HA 3CSXA 5L3FA 2M7WA 1H8HG 2G38A 3K5OA 2GUZA 4MVZA 1JMKC 3ETDA 2HVKC 2QTOA 1EZJA 1WPYA 2ZDIA 3RN4A 3ZMZA 3DSQA 4YRTA 1I0HA 4LCUC 1Q7YW 3PCOB 4DR7B 5J2TB 5IYDO 2ZR3A 2O57A 1PL4A 4OX9O 4DV0O 2WLKA 3HFZB 3L74H 1AR1B 1RPRA 2YEVB 4QIWF 4UP8A 1NZ6A 3OTFA 2HG5C 1M9NA 5KX5A 2DMXA 1Q81W 2BE3A 1I94O 4TV9A 3AG7A 1FYJA 1WQWA 1YZBA 2XAQA 5KHJA 5C52B 4ZOLB 1QVFU 1E22A 2ZQMA 2R9IA 1GN3A 3RGBA 1BBWA 3K59A 1VMGA 3ABTA 4DV5O 4JASA 1H38A 1TGOA 3CXHF 3UKMA 4YHHO 2ITDC 3FFQA 2X6BA 2KSDA 4R6ZA 2PF4E 4Q6GA 4HYOA 1SRYA 4LVKA 1VF5B 4KHPB 5JH7A 3AK1A 4A5UB 2WWWA 4TTVA 4JI2B 4HAMA 5B5EZ 2DXTA 1JJCB 1JJOA 4TSFG 3UM7A 2NNUA 2EX3A 2L35A 1Z5VA 4RQEA 1FJGO 3N27A 4HWTA 1MABG 1EN5A 3F5TA 4DV1B 1XEQA 4YROA 2OCHA 3K9AA 1FS0G 1XMOB 2P06A 4YRJA 3UO3A 1Q6HA 3ZHSA 3V8KA 3CMQA 2IH3C 5H9CA 1GM9A 5J2UA 1WQ7A 3NXSA 3E89A 1EIYA 4HNAA 4BIZA 3E8FA 4XEOA 1C0AA 3RYFB 3UH0A 2EZOA 4LC1A 3RACA 2RHSA 4WBNA 3V7RA 1MA1A 3T2MA 3JASB 1MG1A 4UV8A 3H1IH 1HNZB 1ZL8B 3WB0A 5LGUA 2BOBC 2WSSG 2UU9B 1FXVA 3RIRA 3BA9A 4I4TA 1K3EA 2ZE6A 5L3CA 3HRIA 1OZ0A 2F23A 3ZRXA 2H8PC 4KUMA 1L1FA 5IJ0A 4X62B 2RCVA 1KC8W 3Q4HB 3OMNB 2KKWA 2P67A 4NR1A 4CS3A 1OCCB 1M1KW 1K97A 1VEWA 1K8AW 4PJ0Z 3HKDA 2A79B 2W6JG 4HWSA 4TT3G 1H2LA 1WA8A 1YJNV 2EINB 2ZE7A 1IBMO 2DWEC 1LUWA 2RJZA 4YJ3A 4DV7O 2BTOA 2YI9A 3K0GA 2WLHA 3L1AA 2ZNJA 3KG2A 3OFNG 1KECA 2YXLA 4NXNO 1H8EG 2AMCA 1MNGA 3TETA 1Q3EA 4B3TB 2EIMB 4PD4F 4YP0A 1LNQA 2V1DA 2DN9A 3FB8C 4FFBA 1GK9A 4AQYB 2DQ0A 3DC5A 5LMUO 3BFMA 3OEEG 4X65B 1SC5B 3DGEA 2HP8A 2XAJA 3WQZA 4P73C 1GMGA 1LR1A 1N0JA 3E8GA 4J7JA 2DTIA 3A2FA 2CIMA 2WLLA 2EJFA 2ZT6A 3EFFK 3OTOO 1PL0A 4GX5A 3V8LA 2EJGA 1XNRO 2WLIA 5GTIZ 4GKJO 3A5ZA 2LW7A 5KUKA 5D5PA 4NXMO 1K9MW 1AJQA 3E86A 1R6TA 4LFAB 1JJ2U 1NTMH 1PPJH 4EFEA 3T1YO 5KX5B 4O4IB 2QHVA 3HR0A 1P84F 4X1YA 3B40A 5LGNA 3HB3B 2QEXV 2AGAA 4F6RA 1N33O 4FLWA 3K08A 4XEMA 3K06A 1FFXB 1ASZA 2QGNA 2HLDG 4MTFA 4PA4A 2X7RB 1BHAA 4IIJB 4O2AB 4K3AA 2A9HA 4ICGA 2E1HA 2K1EA 5JJJB 4P71C 1QNMA 3OUSA 3RYIA 3OW2U 3AG3B 1I5YA 4G28B 2ODRC 5BMVB 4X8AA 4TVYA 4H2WA 5LMNB 3CCUV 2ATKC 1VF6C 4TQFA 4P75A 1R3KC 5GW7A 3SPGA 1DK1A 1GTOA 3EXAA 5IYZB 5FPRA 1KBHA 3LSQA 1ZAUA 3OE7G 5LYJB 4CH3A 4GLXA 3I56V 5LHHA 1NH2B 3RWRD 3CHXA 4J7ZA 3A7RA 2VWJA 3WU2Z 2ZGWA 3WB1A 3IJ4A 5EIBD 5EYPA 3T1HO 1GAXA 3SJQC 2CTWA 3U0ZA 4DUYB 1NVPD 3OGCC 2FYUH 4BIOA 5K1XA 5BR8O 4WFHA 3LSUA 4YRNA 3RYHA 4LF4B 1QE0A 3EVKA 4LWSA 1PYSB 1VQMV 1VARA 1J5WA 2HJFC 2JJ2G 3TXSA 1XILA 5J2UB 4QNHB 2ALYA 1EFRG 4CH5A 3CRQA 3B8MA 3STLC 3M4QA 5JCOC 2ZXWC 2RHSB 4OLFA 2HFEC 4WBNB 5LBQA 3K79A 1K33A 3BEHA 1IBLB 2AKWB 1YTFB 1EFWA 3WG7C 4YRKA 2EIJC 4TVAB 2XAGA 1JCHA 3HXYA 4BW9A 5F2VO 1Y67A 4I9QA 2CTQA 2P22C 2W0FC 4YYEA 4FMTA 2DYRC 2YICA 1SQPH 2NS6A 5EBLC 3L4GB 1JR9A 4YCWA 3IC7A 4NKGB 2I4MA 2OTLV 4MVOA 2Q68A 5L3GA 5ELOA 5EZYA 4QGPA 5JJNB 1JPXA 2GTAA 2N04A 2F4VO 4XU1A 4DW1A 3ICXA 5GTHZ 1R6KA 2ARHA 1NTZH 2LP7A 3K0DA 4JI8O 3OM3B 4FFBB 4OX9B 4DV0B 1PNLA 1YDXA 5KMGB 5H6QA 2A7WA 1YFRA 3P8VA 2RHQB 4N23A 4ZHQB 1FAFA 1ATIA 1I94B 1HC7A 1SERA 4H2XB 3ZRWA 3OD1A 2Y0IA 1ORQC 4ZI7A 1XQ8A 2DXUA 2WLIB 4UPAA 3B8NA 3R66A 4UCVA 3UQ8A 4PHCA 4CH6A 4DV5B 2NN4A 4LBEC 4YHHB 5B1AC 1N9WA 2EJ9A 1WB7A 2HJDA 1Q6UA 4Z1MG 5IJ9B 3CCVV 3O65A 3CS5A 4U7NA 3HY0A 5IYCO 4X1YB 1R3IC 2EULA 1G1XB 3LDDA 3K3WA 2YIBA 3IKMB 3PCOA 4XBFA 4RQFA 1VQ5V 4FM2A 1M90W 3G67A 1FPOA 3THOA 3H1JH 1FJGB 3HFZA 3RYIB 1ROPA 2YEVA 1NJ1A 1V54C 4JYAO 4WJ3M 5B1OA 1SA0B 2QKAA 4JAVA 4P74C 3GWOA 3H1HH 1IL2A 4ZOLA 2LGWA 1P49A 2CAZC 2Q7EA 4JGSA 1WYDA 1LUVA 3C90A 4AH6A 4XDKA 2P5OA 1VQ4V 1BGYH 1X55A 4W4LA 1B3QA 1YI2V 5CBFA 2QE7G 3UO2A 4XTVA 2QM4A 1M93A 2JRIA 4FZ1A 1XMQO 4X66O 2DWDC 3FAVB 3QG5A 3RT3C 4JI0O 4UVBA 3AG1B 4LNSA 2WPDG 4GKKO 2PMEA 1FD9A 3L70H 3A0BZ 1XHZA 1JJCA 4LH7A 4MW8A 4YIOA 4DR5O 5DECA 4J15A 2CK3G 1YF2A 4LFCO 4JI1O 3DC6A 1BE3H 3K5NA 3QF7A 1ZSPA 1IBMB 2R72A 3CCSV 4DV7B 1GN6A 4D6TH 4OPHA 4UB6Z 4DUZO 3LDEA 3CPWU 2X0LA 1XHXA 1BHBA 4DXWA 4NXNB 3CYOA 3D3IA 2OTJV 4IT5A 1SF9A 3RL6A 1SKVA 3ZIAG 3M8AA 4QPJA 5CB4B 2ARSA 1TAEA 1YB3A 1B6QA 3L2ZA 4G84A 2EWNA 4O2BB 5JWPA 4JF3A 2FTKA 3E2EA 5LGTA 4FZ0A 4LR3A 4H33A 5LMUB 2ZE5A 3H1LH 3RYFA 4DUYO 3GB7C 1M4UA 1OJHA 1GM8A 1KD1W 2IH1C 2NLJC 3JASA 3OTOB 4BIUA 4YRQA 1XNRB 1H2NA 1ZL8A 4X20A 4GKJB 2CTPA 5L3DA 1B7YB 3Q4HA 2J3LA 4NXMB 2QWQB 3U10A 5HFMA 1W59A 5E3IA 4KR3A 4WJ4A 3HXWA 4P3OA 3SDLA 5ELNA 3HXXA 3M7MX 5A9GA 4DV2O 3ZRWB 3H01A 4XU2A 2ZXWB 1NYQA 1UJWB 2IJJA 1NS1A 3VQXA 4J7KA 1E79G 3B2EE 1JFFB 3CCRV 1N33B 5BY1A 4X1KA 3WG7B 2E5AA 2WAMA 4GZRB 2YXYA 1T5EA 1K4DC 3KZIZ 1IX9A 1USYA 1B70B 4J80A 5KHIA 1M5IA 2DYRB 4HWOA 4WI1A 1Z7MA 1PNKA 2DEQA 3C3TA 3ASNC 3A0RA 1Y66A 3REUA 3BVOA 2Z3YA 4RUEA 4LNUB 4IHJB 3UCSC 1XNQO 1YHQV 1Q8IA 1EZVH 2W0XA 3CCMV 4HWRA 3SPJA 2Y69B 2FB5A 2CH7B 3VBBA 1AILA 1E24A 3T1HB 1FFTB 2RN9A 5H2FZ 3MQZA 1AI4A 1QHTA 5BR8B 2IBZH 4UP9A 1XOUA 4O4IA 4ABMA 1MZFA 3O9OA 3HTZA 2UXCO 3DXRB 4YRRA 1LYLA 3SGIA 4X5OA 3KCXA 3E8BA 1W0KG 3BFRA 1KP3A 1FFXA 1NJIW 2QR4A 4BWAA 1YFTA 1G8MA 4IIJA 4O2AA 3ZHQA 3W7WA 3CCJV 3RFRA 2Q8VA 1V55C 1AJNA 2IJKA 5BMVA 4KP4A 1YFSA 5KAFZ 2XNDG 1RP3B 4FLTA 2YUAA 3JCZA 1NR1A 5IYZA 3A7AA 2A3QA 3TK1A 1XI1A 3CXCU 5LYJA 1X2GA 5B1BC 1GH6A 4FLVA 3ZBHA 3BRCA 4H2UA 2C8MA 2D3OW 4JTDB 2QHTA 3B09A 4JTAB 3HKCB 1YVWA 2YS8A 3TGUH 3JAWB 3BABA 4XU0A 3ZHVA 2F4VB 1PYSA 1SS3A 3CJHB 2ADPA 4GYCB 1US6A 3VQVA 1V54B 1VQ7V 1X59A 4QPKA 1NI8A 4JI8B 1BL8A 1H4VB 5J9PC 2B5UA 1K7DA 1HP8A 2EJRA 2EZPA 2D2CB 3STZC 1S5JA 2BSKB 2DVEA 2AKWA 4X20B 1PP9H 4OGQB 1Q86W 4TVAA 3DTUB 3UFGA 2E5LO 1JQ0A 2UXDO 3IGAC 4HA8A 1HNWO 4CC5A 5HFLA 4P72C 4UVCA 4J42A 4LF5O 4WFAV 4YPFA 1WN7A 3L4GA 3E9IA 2IY5B 3HKBA 3A8TA 3BCCH 4XTZA 4YY3O 2ETNA 3ASOC 5EBMC 5L3BA 2WLNA 4CS4A 4B3RO 3CRCA 3CCEV 3G71V 4KR2A 4FVMA 1AB3A 4PG3A 4X1KB 2LQTA 4X64O 1VF7A 4FFKA 3A5YA 1VQOV 5KMGA 1BZKA 3CEIA 4YRCA 2UXBO 11ASA 2RNBA 4J9ZB 1EM1A 2Q7GA 2RHQA 5KAIZ 4H2SA 4JYAB 2VRZA 1E1TA 1IVSA 4ZHQA 5CMUA 1YJ9V 1N8RW 4EX5A 3D36C 2RMKB 1SETA 4H2XA 5LL6Y 3CWBH 1KUQA 3ABMC 5LP6C 2B9ZA 5HGQA 4BR6A 4I0XB 1OCRC 3W7TA 4NVPA 2AHZA 4G27B 3P8YA 4DPGA 1QCEA 3T4ZA 2IU0A 3FB5C 1Q5OA 1GRJA 1RFYA 2DZ9A 2LGQA 5IDJA 3K9SA 1XMQB 2DTOA 5IJ9A 4X66B 1H4TA 3WFVA 3K5MA 4JI0B 1QR9A 5EC1C 1OCOC 3NELA 4GKKB 3PZCA 4XTXA 1RM1C 5CA0B 2QA4V 2OT5A 4DR5B 3JD3A 4EFBA 2Q67A 4LFCB 4JI1B 1YITV 2EBOA 1S5LZ 4PDRA 3RVYA 2AZ0A 1KYOF 5KLVH 1H2SB 3ERRA 1IBKO 1L8DA 4DUZB 3M4PA 3SJBC 2N74A 2Q0OC 4K0KO 2QKSA 3RYCB 1EOVA 1R1BA 1SA0A 4P73A 4OXSA 1WJZA 4DV6O 1VQ9V 4WFGA 4JI7O 4C7UA 3HXUA 4LF9O 3ASNB 2UUBO 3JD0A 4EB6A 3ZN1A 4RWUA 1TUBB 1YIJV 2DOSA 1CP9A 1E1RG 5B3SC 4I55B 1MZEA 3NR7A 1B06A 1NT2B 5KNNA 2GBOA 1S76D 2EAYA 4CS2A 3S3WA 4YREA 4PA9A 3FAVA 3SPHA 4XTWA 3E22B 4LF8O 2PGGA 3MD0A 2E64A 3RKWA 3G1ZA 4MTOA 5D5QA 4YXWG 2ZZEA 5LA6B 4J41A 4XTUA 4JI4O 1O9HA 3AK2A 1D5AA 3BJUA 2QWOB 2OIEA 1WAZA 4P30A 4DV2B 4P71A 4P9OA 4XDJA 2ZNIA 4UCUA 4RAIA 2UXNA 5IT9N 3A31A 2PTMA 4UB8Z 5CB4A 4QJFB 4MS2A 2VQFO 1VF6A 1CPYA 3NETA 4O2BA 2QM8A 3CP1A 4PDVA 3HKBB 1NH2D 12ASA 4HZ3A 1WP8A 2XUMA 5B1BB 5B66Z 4PA6A 1EN6A 4ZBMA 2JS5A 3QO8A 2XOKG 1GM7A 2Q69A 4DV4O 1WP7A 4Q20A 1SQGA 2XASA 4PI2A 3OUFA 1BMFG 2IW5A 3BHPA 3SPIA 3CC7V 4W4KA 4R8CA 1XNQB 3RGLA 3TJTA 1KMNA 1B7YA 3CD6V 3W7UA 5DEDA 2Y4UA 2ZZFA 4TVWA 2A8EA 3D8CA 4J11A 3OEHG 1AI6A 1M56C 2F95B 4BW5A 1F7YA 2EL9A 5JCOA 2UXCB 5KA6A 3E35A 1E1OA 4JI3O 5KHGA 2YIDA 3KKYA 1S0VA 4N21A 4B3SO 1JFFA 4YRIA 1YTFD 3SYCA 3L9DA 4JYBA 4X1IB 2JEXA 3CMAV 4B3MO 3JARB 4TWKA 1IDSA 4R7CA 1X54A 1B70A 1HW7A 1MSDA 2ZIMA 2JDIG 4TOIA 1XREA 2JGUA 2Q5IA 3F7VC 2EIKC 4HT4A 1WPXA 1BS3A 1N4CA 4P9PA 1WU7A 4PELA 1VQNV 1SZXA 5C8YB 1F51A 4LNUA 4YJ2B 3H9VA 2EILC 4DO2A 4RMFA 3ASOB 1DTOA 4IHJA 3ABUA 3TXQA 2G4CA 1QLEC 1HDJA 3SYPA 2ILMA 2OIGA 2CH7A 1N34O 1URFA 1FXHA 4TWAA 3CRAA 5K1PA 2UUCO 4IGGA 1GGMA 4CH4A 4FJCC 3HFVA 1MMMA 1QU7A 3ZHUA 1B8AA 4NTYA 1BT8A 2W6IG 4TUYA 2DU7A 3DXRA 2DU5A 1NR7A 4EB6B 3SYOA 3L71H 3P30A 1I5XA 3ABMB 2Y48A 1OCRB 3WB2A 2YSUB 2E65A 4P3PA 4ZKIA 3OMIB 3JAKB 3RF1A 3J7AU 2QWPB 3OD4A 5CA1B 1FYFA 5IY5C 4K8ZA 3X2QC 2XGTA 2WLJA 1ADJA 4IYHA 5DN6G 1TA8A 2FKXA 3IALA 1THZA 5FL7G 2ADQB 3FB7C 4UV9A 2DDZA 2E5LB 4OP0A 2UXDB 2FL4A 1Y76B 2H3OA 1HNWB 4J9YB 5LHGA 3ABKC 2QJ1A 1OCOB 3N2GB 4I7ZB 4H0LB 4FPPA 4L8JA 5EK0A 1TVKA 4XDLA 1RM1B 4LF5B 4Z2WA 2ARTA 2RDCA 4JTCB 1XBLA 5CBHA 1Q82W 4FLYA 1ASYA 2NR5A 4YY3B 3HKCA 1PM9A 5E79Z 4J10A 4O4LB 3JAWA 1JX9A 2I4OA 3JALA 4PHZA 4B3RB 5FNVA 3CJHA 4O4JA 2Q73A 2P90A 4WFEA 3PJSK 3ZJZA 2JK5C 4FIPC 4X64B 1L0LH 4ZTUB 4P74A 1KQSU 1RSOB 4I5SA 4X89A 4MVRA 3N2KB 1QR8A 4JV5O 2UXBB 5A2QN 3CCQV 1FXKC 1U96A 1KOGA 2I4LA 2CGNA 4XTYA 2Y4TA 2XT9A 1VQ8V 5B3SB 1XUQA 3CCLV 2BSKA 5DM6V 1KMIZ 3HY1A 3FJPA 5CA3A 1NJ2A 2LFRA 2GTSA 1WB8A 1Q90D 2ZDIC 4TV8A 1XL6A 1VQKV 1PV0A 4MVUA 5GONB 2JJ1G 1X4TA 3FD9A 4H2TA 3ZX6A 4LVMA 5EIBC 4XU3A 3K57A 1Y74B 2ITCC 2E75B 3AG4C 3RVZA 3QVNA 2BOCC 2IY5A 2E76B 3P8TA 3QTCA 1D2DA 2VQEO 4LVLA 1K34A 2QTSA 1K73W 4DW0A 4ZIBA 3MDSA 1H4QA 1L0NH 2XTIA 1I7FA 5FPOA 3APQA 4DYLA 2EIJB 1WPBA 2Q9LA 1H2KA 3ZRSA 3JSNA 1B04A 1Y6XA 4H2YA 1S5HC 1K92A 4LP8A 2Y0PA 3G80A 3ZMUA 1N32O 2ZXFA 2ZT5A 1IBKB 4LFBO 2OWOA 4K0KB 4LF6O 2DKGA 3IG2A 2PZSA 1WLEA 2KG7B 4DV6B 1ZLZA 2WLMA 4I0XA 4JI7B 4LF9B 4DR4O 2UUBB 4HWPA 4JZ2A 1YEWA 2J3MA 5KHHA 3NEMA 3RKYA 2Q5ZA 1GN2A 1IXBA 1N36O 1OV9A 3FYIB 3I5DA 3ZMVA 1YGBA 3D3QA 4UCSA 2HKOA 2JIZG 3JCUZ 3AK3A 3JYCA 5ITZB 5C51B 3ETQA 2UUAO 4DQ2A 4K88A 2AHYA 3AEIA 5TISZ 3G4SV 5B1NA 4LF8B 4Z1VA 2L6LA 4TUYB 3IC9A 1M56B 2FYKA 4E4EA 1J5EO 1AR4A 5CA0A 4O2DA 4YRFA 2YI8A 4L87A 2CJAA 2LJ2A 5BXZA 2ZR2A 1I08A 4JI4B 3V7SA 1B76A 1NJ8A 4JAUA 5FLXN 1H2MA 2Z0AA 3GWKC 4QE9A 1HNXO 5B1AB 2ZTGA 3SJCC 3W3SA 3CC2V 3RYCA 5IWAO 4JAAA 2EIKB 3FX7A 4AHCA 4WF9V 3SR2C
chains in the Genus database with same CATH topology
4MVQA 1USYC 1YFRA 2A0LA 1QR9A 5EC1C 4H2VA 1OCOC 3NELA 3P8VA 3JD2A 1NBMG 3MF2A 3R07A 2EILB 2RHQB 3PZCA 4FK5C 4XTXA 5EBWC 2DQ3A 4N23A 3K03A 1RM1C 3TEGA 1ATIA 2QA4V 2OT5A 2DW4A 1QLEB 1TUEB 3JD3A 3OAAG 1SERA 1HC7A 4H2XB 4MW3A 1ZWIC 3SYAA 3ZRWA 3OD1A 1KP2A 2Q67A 1ORQC 2V7QG 1YITV 2EBOA 2DXUA 3JD4A 2WLIB 4UPAA 1G51A 4KQEA 4PDRA 3B8NA 2PI5A 5KUMA 1ADYA 2DTHA 4PHCA 3UGQA 3ABLB 2IU3A 4CH6A 2P6JA 3RVYA 3E9HA 4HVCA 3ERRA 2QM7A 4F4LA 3M4PA 1PNMA 5BZBA 3FYEB 4LBEC 2I4NA 4I9WA 2QKSA 1EOVA 1F4NA 5B1AC 2DYSB 1N9WA 2EJ9A 4E51A 4P73A 4YRMA 4PA7A 4Z1MG 4OXSA 2OCCC 1VQ9V 4U7OA 3CCVV 4WFGA 5IYBO 2CJ9A 3HXUA 3ASNB 4U7NA 3HY0A 5IYCO 3E8HA 3JD0A 3REXA 3LC0A 3ZN1A 1NJ5A 2P0LA 1YIJV 1R3IC 1CP9A 1E1RG 3EFSA 5B3SC 3P32A 1EVKA 4K87A 2ODRD 5H6RA 3LDDA 1S76D 2Q6AA 2EAYA 3K3WA 3TEHA 4CS2A 5KNNA 4WCEV 3IKMB 1KMMA 2E41A 3PCOA 4XBFA 3RBZA 4RQFA 1VQ5V 2LFSA 1M90W 4YREA 4PA9A 4EO4A 1K5QA 5IY5B 5CBGA 1G4YB 3G6EV 3X2QB 1G5HA 2CGHA 1NQTA 1RPOA 4NCXA 3SPHA 3HXVA 4YRSA 4XTWA 3HFZA 2X6AA 1SESA 3W7SA 1BBUA 2XAHA 3ETEA 1ROPA 3MD0A 2YEVA 2E64A 2JEUA 3CMEV 1DF4A 1NJ1A 1FXKA 1V54C 3AG3C 3MF1A 2ZCEA 3G1ZA 3ABKB 4MTOA 3RKWA 3VQWA 4WJ3M 4YXWG 2ZZEA 3HPLC 5B1OA 5L3FA 2M7WA 1H8HG 1S3JA 4JAVA 4P74C 3GWOA 1IL2A 1OCZC 4MVZA 3ETDA 4XTUA 2HVKC 2ZZGA 2E10A 2QTOA 3ML0A 4UXNA 2PI4A 2Q7EA 1GO3F 4JGSA 1WYDA 3MHSC 1EZJA 4BAYA 3BJUA 1WPYA 2ZDIA 4AH6A 4XDKA 1MOFA 4P30A 3TCUA 2PMFA 2ZT7A 1VQ4V 1X55A 3ZMZA 3DSQA 4P71A 1YI2V 4YCUA 4P9OA 4YRTA 4XDJA 4R50A 5F5WA 1L0WA 5CBFA 2QE7G 3TEHB 4LCUC 1Q7YW 4XTVA 1J95A 3PCOB 2ZNIA 4RAIA 2UXNA 1W66A 1X2HA 5IYDO 3A31A 2ZR3A 2ZINA 3M99B 2QHUA 3LUTB 2DWDC 2WLKA 3MEYA 4MTXA 4QJFB 4K86A 4MS2A 3HFZB 2C7IA 1CPYA 3NETA 4UVBA 1AR1B 1RPRA 3EHBB 3AG1B 3ZMSA 4LNSA 3AG2C 2YEVB 2QM8A 2WPDG 4QIWF 2P7TC 4UP8A 4E2LA 3CP1A 4PDVA 1FXKB 2HG5C 2PMEA 1M9NA 1NH2D 1JJCA 12ASA 1Q81W 4MW8A 4HZ3A 1M57C 5B1BB 4J15A 4PA6A 4ZBMA 1WQWA 2CK3G 2XAQA 5C52B 3QO8A 2XOKG 3A7UA 1VQPV 1QVFU 1GM7A 1E22A 2Q69A 4G2KA 2ZQMA 4P75C 2R9IA 4Q20A 4GX0A 2XASA 1BBWA 3OUFA 1BMFG 3V7CA 2IW5A 4LVJA 4MVMA 3ABTA 3CCSV 4JASA 4RUFA 1H38A 3R65A 3SPIA 1G5IA 3CC7V 3UKMA 4R8CA 3LDEA 3CPWU 3RGLA 2X0LA 3JD1A 4P72A 3B77A 1KMNA 1BHBA 4DXWA 2ITDC 3CYOA 3D3IA 1B7YA 2OTJV 3CD6V 3W7UA 2KB1A 4KFMA 1CEZA 3RL6A 2X6BA 3AG4B 4R6ZA 3ZIAG 4Q6GA 4HYOA 1SRYA 2ZZFA 4TVWA 4LVKA 2A8EA 1NVPB 4QPJA 3WFVA 2GHYA 2ARSA 1WNLA 3OEHG 1AI6A 1B6QA 1M56C 1YB3A 2P5IA 3L2ZA 2EWNA 4G84A 4JF3A 1AROP 2FTKA 3E2EA 2Z5UA 5LGTA 2WWWA 4BW5A 2EL9A 4H33A 2XAFA 4TTVA 1R73A 4MVSA 5KA6A 3AG1C 4HAMA 2DXTA 3E35A 3GB7C 1E1OA 1JJCB 3I7FA 1KKDA 4TSFG 3K04A 1S0VA 1GM8A 4N21A 3UM7A 1R3LC 1KD1W 2IH1C 2NNUA 2NLJC 4YRIA 1YTFD 1Z7NA 4RDXA 3F7YC 2QHSA 3HRKA 3SYCA 3A74A 4JYBA 2JEXA 4BIUA 4RQEA 3CMAV 4YRQA 4TWKA 3ETGA 4R7CA 1X54A 1Y4MA 3RKXA 1B70A 4HWTA 1MABG 2DZCA 1X56A 1PKXA 4YROA 1S72V 1VQLV 5L3DA 3K9AA 1FS0G 1B7YB 2ZIMA 2JDIG 1NNHA 2J3LA 2F43G 4YRJA 4CZZA 2Q5IA 5HFMA 3D36A 3F7VC 2EIKC 5E3IA 1WPXA 4HT4A 4KR3A 2R9RB 3V8KA 2CJBA 3CMQA 4P9PA 1WU7A 4WJ4A 2IH3C 5H9CA 3HXWA 2MK3A 4PELA 1VQNV 1GM9A 4P3OA 3RUXA 3T4DA 1F51A 1WQ7A 4YRGA 2EILC 3NXSA 4DO2A 5ELNA 3E89A 4RMFA 3HXXA 3ASOB 1DTOA 3ABUA 1YSCA 1EIYA 3ZRWB 3H01A 4BIZA 3MHHC 3E8FA 2G4CA 4XEOA 1QLEC 2ZXWB 1NYQA 4XU2A 1UJWB 2IJJA 1JOYA 1C0AA 3UH0A 3SYPA 2EZOA 2B1GA 4LC1A 3RACA 3VQXA 2RHSA 1E79G 1NKDA 3CCRV 1FXHA 3V7RA 4TWAA 3T2MA 1W0JG 5K1PA 3A32A 1MG1A 3ABLC 4UV8A 3WG7B 1GGMA 4FJCC 2E5AA 5C93A 4CH4A 2ZT8A 2WAMA 1QLNA 1MSWD 3HFVA 1HWYA 1P4RA 4JPRA 2DJZA 2Q5HA 3ZN0A 1K4DC 5LGUA 3RIRA 2BOBC 2WSSG 1FXVA 1USYA 1K3EA 1B70B 5L3CA 3HRIA 1B8AA 1OZ0A 4PDMA 3ZRXA 2H8PC 2DYSC 4KUMA 3ZRVA 1L1FA 2DYRB 2W6IG 1KC8W 4HWOA 1K4CC 1Z7MA 1PNKA 3OMNB 2DU7A 2P67A 2UXXA 4WI1A 4CS3A 2DU5A 1NR7A 2DEQA 3SYOA 4UP7A 1OCCB 1M1KW 1K97A 1K8AW 1S77D 1PD3A 3ASNC 1I5XA 3A0RA 2Y48A 3ABMB 2A79B 2W6JG 3LSSA 3OMAB 4TT3G 1EVLA 1Y66A 1YJNV 2EINB 3T1CA 4HWSA 1H4SA 1OCRB 3REUA 2DWEC 2Z3YA 4RUEA 2YSUB 1YJWV 3K0GA 2WLHA 1W2BU 3L1AA 4GX2A 2ZNJA 1V55B 3KG2A 2E65A 4P3PA 1YHQV 1EIYB 3CCMV 4ZKIA 3OMIB 4HWRA 3SPJA 3OFNG 1KECA 3RF1A 1H8EG 2Y69B 1FYFA 5IY5C 2AMCA 1R3JC 1GKFA 1IXMA 3X2QC 2WLJA 3VBBA 5DN6G 1ADJA 1E24A 1FFTB 3TETA 2XGTA 4YRPA 3IALA 1THZA 2EIMB 5FL7G 3MQZA 1F23A 1AI4A 3FB7C 5EC2C 4UV9A 4YP0A 1LNQA 2V1DA 4UUJC 3FB8C 3FB6C 2DDZA 2ZD9A 4OP0A 4UP9A 1AI7A 1GK9A 1EBOA 4J9YB 5LHGA 1NYRA 2DQ0A 4H02A 4PA3A 3ABKC 3BFMA 3OEEG 1OCOB 4ZTZB 3DGEA 3HTZA 1K5SA 2XAJA 4FPPA 4YRLA 3WQZA 2HR3A 5EK0A 4P73C 1GMGA 4XDLA 1RM1B 3E8GA 2DTIA 4YRRA 1LYLA 4JYCA 2ARTA 4X5OA 4JTCB 2CIMA 2WLLA 2EJFA 2ZT6A 3EFFK 3E8BA 1W0KG 1BIAA 5CBHA 1Q82W 1PL0A 2B1IA 1KP3A 4GX5A 1ASYA 1NJIW 3ZMTA 1BIBA 1YFTA 3V8LA 4EKWA 1G8MA 2EJGA 4BWAA 1JX9A 2I4OA 2WLIA 3W7WA 3CCJV 5CN0A 3A5ZA 2IJIA 1OHHG 2P90A 4WFEA 3PJSK 3ZJZA 2JK5C 5KUKA 4FIPC 4UVAA 4LVIA 1V55C 4H37A 1AJNA 4Q15A 2AMCB 2IJKA 4YDQA 1K9MW 1AJQA 2ARUA 4YCVA 3E86A 4ZTUB 2Y69C 4P74A 3OR6C 4KP4A 4I5SA 4X89A 1KQSU 1JJ2U 2OCCB 4MVRA 1YFSA 1QR8A 2XNDG 3JCZA 5L3EA 1NR1A 3CCQV 3A7AA 3TK1A 4GCZA 1FXKC 2QHVA 1KOGA 3CXCU 2I4LA 4XTYA 4GT1A 4PDLA 4P3NA 1X2GA 1JVMA 1VQ8V 5B1BC 5B3SB 1DLBA 5LGNA 3CCLV 4WFBV 5DM6V 3HB3B 2QEXV 1X01A 4H2UA 2C8MA 2D3OW 1R6NA 1VQZA 3HY1A 2WLLB 3K08A 3FJPA 4XEMA 5CA3A 4JTDB 1NJ2A 2QHTA 2LFRA 4MTGA 3K06A 4JTAB 1EQRA 1ASZA 2HLDG 5C53B 4MTFA 3OR7C 4PA4A 2X7RB 1F4MA 2ZDIC 1BHAA 1XL6A 1HXDA 2A9HA 4XU0A 1VQKV 2E1HA 2K1EA 4P71C 4MVUA 1PYSA 2JJ1G 4H2TA 3VQVA 3OUSA 3ICAA 4LVMA 1V54B 3OW2U 3AG3B 4XU3A 2ITCC 1I5YA 3AG4C 4G28B 1XL4A 3RVZA 2ODRC 1VQ7V 1COWG 4QPKA 2BOCC 3LNMB 4X8AA 4TVYA 3V8JA 2IY5A 3P8TA 1BL8A 4H2WA 3QTCA 4LVLA 1OCZB 3CCUV 2ATKC 1P7BA 4P75A 4TQFA 1R3KC 1K34A 3ZCCA 5GW7A 2B5UA 1K7DA 5J9PC 3SPGA 1H4VB 3IKLA 2EJRA 2HVJC 1K73W 1GTOA 2EZPA 3EFRA 4ZIBA 4WFFA 3LSQA 1H4QA 2E3CA 3STZC 4GX1A 3OE7G 2XTIA 4CH3A 3I56V 5LHHA 2GSMB 1NH2B 3A7RA 2ZGWA 2EIJB 2DVEA 2AKWA 1QVGU 2IJHA 3SJQC 4X88A 3ZRSA 1Q86W 4MSWC 1AI5A 1NVPD 4TVAA 3OGCC 1S5HC 1K92A 3DTUB 4LP8A 4H2YA 3QO7A 3UFGA 4WFHA 1JQ0A 5K1XA 3IGAC 4YRNA 4HA8A 3I55V 3LDCA 5E1AC 3ZMUA 5HFLA 1QE0A 2ZXFA 4P72C 1PYSB 4UVCA 4RO2A 1VQMV 2ZT5A 1J5WA 2HJFC 3AG2B 2JJ2G 3TUPA 1RIQA 4WFAV 4YPFA 2DKGA 4G85A 3CC4V 3IG2A 3F5WC 3L4GA 3E9IA 1M57B 1WLEA 2IY5B 4CBCA 4QNHB 2ALYA 2WLMA 1EFRG 1QF6A 4XTZA 4HWPA 4CH5A 3B8MA 3STLC 2J3MA 1SZTA 3ASOC 5EBMC 5L3BA 3NEMA 3RKYA 3W7XA 1HTTA 2WLNA 4P2ZA 3M4QA 4CS4A 2ZXWC 3FYIB 4ASUG 2RHSB 3RW0A 2HFEC 4OLFA 3CCEV 5LBQA 3G71V 1NJ6A 3K79A 1K33A 1E1QG 4MT8A 3ZMVA 4PG3A 1YGBA 4KR2A 2HKOA 3VQYA 3BEHA 2JIZG 2AKWB 1YTFB 3UGTA 3JYCA 3VOUA 1EFWA 3WG7C 3A5YA 5C51B 3E83A 1VQOV 2EIJC 3NENA 4YRKA 4DQ2A 4K88A 2AHYA 4YRCA 4TVAB 3AEIA 11ASA 3G4SV 2XAGA 1JCHA 5B1NA 3HXYA 4BW9A 4J9ZB 2Q7GA 2HNIA 1M56B 2FYKA 2RHQA 2W0FC 2C2AA 4H2SA 2H94A 2X6CA 3BY6A 2DYRC 4FMTA 1E1TA 3HXZA 4YYEA 5CMUA 1YJ9V 3SYQA 1N8RW 4EX5A 4O2DA 2NS6A 4YRFA 1OCCC 1SETA 2CJAA 4L87A 3P30A 4H2XA 5EBLC 3L4GB 3ABMC 3FKSG 3KFUA 4YCWA 5HGQA 2ZR2A 3IC7A 2EINC 2ALYB 1OCRC 2I4MA 1AJPA 3W7TA 1ENVA 2OTLV 2ZIOA 4MVOA 2Q68A 3IFXA 3V7SA 5L3GA 3QO5A 1B76A 4JAUA 1NJ8A 5ELOA 2AHZA 4G27B 3P8YA 1H2GA 4DPGA 1JPXA 1QCEA 4QE9A 3T4ZA 2IU0A 3FB5C 4XU1A 2Q7HA 5B1AB 1VQ6V 2ZTGA 1R6KA 3W3SA 4WF2A 3CC2V 2DZ9A 5IDJA 5KA5A 2LP7A 3K0DA 3QNEA 2EIMC 1DF5A 3OM3B 2DTOA 3SPCA 1QBZA 4WF9V 2EIKB 1PNLA 4QE7A 1H4TA 5H6QA 5LHIA 4TQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USY C;  1YFR A;  4H2V A;  3NEL A;  3P8V A;  3MF2 A;  3R07 A;  2RHQ B;  3PZC A;  4XTX A;  2DQ3 A;  3TEG A;  1ATI A;  1HC7 A;  1SER A;  4H2X B;  3OD1 A;  2DXU A;  4UPA A;  1G51 A;  4KQE A;  1ADY A;  3UGQ A;  2DTH A;  4PHC A;  4CH6 A;  3E9H A;  4HVC A;  3ERR A;  3M4P A;  2I4N A;  1EOV A;  1N9W A;  4YRM A;  2EJ9 A;  4E51 A;  4P73 A;  2CJ9 A;  3HXU A;  3HY0 A;  3REX A;  3LC0 A;  1NJ5 A;  2P0L A;  3EFS A;  1EVK A;  4K87 A;  2ODR D;  5KNN A;  2EAY A;  3TEH A;  4CS2 A;  3IKM B;  1KMM A;  2E41 A;  3PCO A;  4RQF A;  4YRE A;  1G5H A;  2CGH A;  4NCX A;  3HXV A;  4YRS A;  4XTW A;  3HFZ A;  1SES A;  1BBU A;  2E64 A;  1NJ1 A;  3MF1 A;  3RKW A;  2ZCE A;  3G1Z A;  3VQW A;  4WJ3 M;  2ZZE A;  4P74 C;  1IL2 A;  4XTU A;  2ZZG A;  2E10 A;  2Q7E A;  1WYD A;  3BJU A;  1WPY A;  4AH6 A;  2PMF A;  2ZT7 A;  1X55 A;  3DSQ A;  4P71 A;  4YCU A;  4YRT A;  1L0W A;  5F5W A;  3TEH B;  2ZNI A;  4XTV A;  3PCO B;  1W66 A;  1X2H A;  3A31 A;  2ZR3 A;  2ZIN A;  2QHU A;  3MEY A;  4K86 A;  3HFZ B;  2C7I A;  3NET A;  4LNS A;  4UP8 A;  2PME A;  1JJC A;  12AS A;  4J15 A;  1WQW A;  5C52 B;  3QO8 A;  1E22 A;  4P75 C;  1BBW A;  3V7C A;  1G5I A;  3RGL A;  4P72 A;  1KMN A;  1B7Y A;  3RL6 A;  4Q6G A;  1SRY A;  2ZZF A;  4TVW A;  2ARS A;  1WNL A;  1YB3 A;  2P5I A;  3L2Z A;  4G84 A;  2EWN A;  2EL9 A;  4TTV A;  2DXT A;  1E1O A;  1JJC B;  3I7F A;  4YRI A;  1Z7N A;  4RDX A;  2QHS A;  3HRK A;  3A74 A;  4RQE A;  4YRQ A;  1X54 A;  3RKX A;  1B70 A;  4HWT A;  2DZC A;  1X56 A;  4YRO A;  2ZIM A;  1B7Y B;  1NNH A;  2J3L A;  4YRJ A;  2Q5I A;  5E3I A;  4KR3 A;  3V8K A;  2CJB A;  3CMQ A;  1WU7 A;  4WJ4 A;  3HXW A;  4P3O A;  3RUX A;  1WQ7 A;  4YRG A;  5ELN A;  4RMF A;  3HXX A;  1EIY A;  4XU2 A;  2G4C A;  4XEO A;  1C0A A;  1NYQ A;  3UH0 A;  3RAC A;  3VQX A;  2RHS A;  3V7R A;  4TWA A;  5K1P A;  3A32 A;  1GGM A;  4CH4 A;  2E5A A;  4EO4 A;  2ZT8 A;  3HFV A;  2DJZ A;  2Q5H A;  3RIR A;  1USY A;  1B70 B;  3HRI A;  1B8A A;  4HWO A;  4WI1 A;  2DU7 A;  1Z7M A;  4CS3 A;  2DU5 A;  2DEQ A;  4UP7 A;  3LSS A;  4HWS A;  1EVL A;  1H4S A;  3REU A;  3L1A A;  2ZNJ A;  1EIY B;  2E65 A;  4P3P A;  4HWR A;  3RF1 A;  1FYF A;  2AMC A;  2XGT A;  1ADJ A;  3VBB A;  1E24 A;  4YRP A;  3IAL A;  4YP0 A;  2DDZ A;  4OP0 A;  4UP9 A;  1NYR A;  4H02 A;  2DQ0 A;  3BFM A;  4ZTZ B;  3HTZ A;  4YRL A;  3WQZ A;  4P73 C;  2DTI A;  4YRR A;  1LYL A;  2ART A;  4X5O A;  2CIM A;  2EJF A;  2ZT6 A;  1BIA A;  1ASY A;  1BIB A;  1YFT A;  3V8L A;  4BWA A;  2EJG A;  2I4O A;  3A5Z A;  4Q15 A;  2AMC B;  4YDQ A;  2ARU A;  4YCV A;  4ZTU B;  4P74 A;  1YFS A;  3A7A A;  2QHV A;  1KOG A;  2I4L A;  4XTY A;  4P3N A;  1X2G A;  1X01 A;  4H2U A;  2C8M A;  1VQZ A;  3HY1 A;  4XEM A;  3FJP A;  1NJ2 A;  2QHT A;  1EQR A;  1ASZ A;  5C53 B;  1HXD A;  4XU0 A;  2E1H A;  4P71 C;  1PYS A;  4H2T A;  3VQV A;  3ICA A;  4XU3 A;  2ODR C;  3V8J A;  4TVY A;  2IY5 A;  3P8T A;  4H2W A;  3QTC A;  4TQF A;  4P75 A;  1H4V B;  3IKL A;  3EFR A;  4ZIB A;  3LSQ A;  1H4Q A;  2E3C A;  2XTI A;  4CH3 A;  3A7R A;  2ZGW A;  2DVE A;  2AKW A;  4TVA A;  4H2Y A;  5K1X A;  3UFG A;  3QO7 A;  4YRN A;  4HA8 A;  1QE0 A;  2ZXF A;  4P72 C;  1PYS B;  2ZT5 A;  1J5W A;  3TUP A;  1RIQ A;  4YPF A;  2DKG A;  4G85 A;  3IG2 A;  3L4G A;  3E9I A;  1WLE A;  2IY5 B;  2ALY A;  1QF6 A;  4XTZ A;  4HWP A;  4CH5 A;  2J3M A;  3NEM A;  3RKY A;  1HTT A;  3M4Q A;  4CS4 A;  4OLF A;  2RHS B;  1NJ6 A;  4KR2 A;  4PG3 A;  1YGB A;  3VQY A;  2AKW B;  3UGT A;  1EFW A;  3A5Y A;  5C51 B;  4YRK A;  3NEN A;  4DQ2 A;  4K88 A;  4YRC A;  4TVA B;  11AS A;  3HXY A;  4BW9 A;  2Q7G A;  2HNI A;  2FYK A;  2RHQ A;  4H2S A;  4YYE A;  1E1T A;  3HXZ A;  4EX5 A;  4O2D A;  4YRF A;  1SET A;  2CJA A;  4L87 A;  4H2X A;  3L4G B;  3KFU A;  4YCW A;  5HGQ A;  2ZR2 A;  2ALY B;  2I4M A;  2ZIO A;  3V7S A;  3QO5 A;  1B76 A;  1NJ8 A;  5ELO A;  3P8Y A;  4DPG A;  4XU1 A;  2Q7H A;  2ZTG A;  3W3S A;  4WF2 A;  2DZ9 A;  3QNE A;  2DTO A;  1H4T A;  3A7U A;  4TQD A; 
#chains in the Genus database with same CATH topology
 2VQF B;  4MVQ A;  2A0L A;  2K9P A;  4H2V A;  1TVK B;  3K5L A;  1TUB A;  2YIB D;  1NBM G;  3MF2 A;  2EIL B;  4I55 A;  2F1M A;  5EBW C;  2DQ3 A;  1G6U A;  3K03 A;  3TEG A;  5LXT B;  2DW4 A;  1QLE B;  1TUE B;  4MW3 A;  2V7Q G;  3JAL B;  4DV4 B;  1G51 A;  4KQE A;  3J81 N;  5FNV B;  2PI5 A;  1KKC A;  5KUM A;  4O4J B;  2DTH A;  3UGQ A;  3E22 A;  4IYI A;  3E9H A;  4HVC A;  2PYL A;  4DR6 O;  3P3N A;  5BZB A;  4I9W A;  1F4N A;  4YRM A;  4JYY A;  2Q4P A;  4E51 A;  1BCC H;  5LA6 A;  2EJ7 A;  2OCC C;  1SQF A;  4JZG A;  4U7O A;  5IYB O;  2CJ9 A;  2WA3 A;  3REX A;  3LC0 A;  3MAQ A;  1NJ5 A;  5JQG A;  3EFS A;  1EVK A;  4K87 A;  2Q6A A;  4JI3 B;  4WCE V;  1FKA O;  2E41 A;  3RBZ A;  2LFS A;  4TV8 B;  4B3S B;  5IY5 B;  4JI5 O;  1NU1 H;  3X2Q B;  2CGH A;  1NQT A;  1RPO A;  3JAM N;  4FM1 A;  4B3M B;  1BBU A;  3ETE A;  2JEU A;  3CME V;  4B08 A;  3ABK B;  1HR0 O;  1VIB A;  3VQW A;  2QSA A;  3HPL C;  1S3J A;  3CB2 A;  3B4S A;  1OCZ C;  2ZZG A;  2E10 A;  3ML0 A;  4KL1 A;  4UXN A;  4DV3 O;  2PI4 A;  1GO3 F;  4FM0 A;  3MHS C;  4BAY A;  2AW9 A;  1SQB H;  4GUN A;  3TCU A;  1MOF A;  2PMF A;  2ZT7 A;  4LF7 B;  4YCU A;  1L0W A;  4R50 A;  5F5W A;  3TEH B;  1J95 A;  3K58 A;  1W66 A;  4X9Q A;  1X2H A;  2BTQ B;  4I50 B;  2ZIN A;  2CUG A;  1N34 B;  2HHH O;  3M99 B;  2QHU A;  2UUC B;  3LUT B;  3MEY A;  4MTX A;  4K86 A;  2JGD A;  2C7I A;  2VS0 A;  4H44 B;  2MW2 B;  3EHB B;  3ZMS A;  3AG2 C;  4DR2 O;  2P7T C;  3HKE B;  4E2L A;  1FXK B;  4EEQ A;  4O4H B;  1P7G A;  1M57 C;  3BA8 A;  2GUZ B;  1VQP V;  4G2K A;  4P75 C;  4X1I A;  4GX0 A;  4LVJ A;  4DR1 O;  3V7C A;  4MVM A;  3JAR A;  4RUF A;  4JI6 O;  3R65 A;  1G5I A;  1GN4 A;  3JD1 A;  4P72 A;  3B77 A;  2YDE A;  5JJE B;  3CRM A;  2KB1 A;  4KFM A;  1CEZ A;  3AG4 B;  1EN4 A;  1QQC A;  1NVP B;  2ZM6 O;  2GHY A;  1WNL A;  4H13 B;  5C8Y A;  2P5I A;  4YJ2 A;  1ARO P;  2Z5U A;  2XAF A;  1R73 A;  4MVS A;  3AG1 C;  3I7F A;  4NYK A;  4TV9 B;  1KKD A;  3K04 A;  3OT7 A;  1R3L C;  1SQQ H;  1Z7N A;  4RDX A;  3F7Y C;  2QHS A;  3HRK A;  1BQZ A;  4DR3 O;  3A74 A;  1IZ3 A;  3ZS8 C;  1Q43 A;  3ETG A;  1Y4M A;  3RKX A;  4AI8 A;  2DZC A;  1X56 A;  1PKX A;  1S72 V;  1VQL V;  1NNH A;  2F43 G;  4CZZ A;  3A0H Z;  3D36 A;  1NTK H;  2R9R B;  2CJB A;  4IL6 Z;  1AP6 A;  5LP6 A;  4JV5 B;  2MK3 A;  5JH7 B;  3RUX A;  3T4D A;  2XTA A;  4YRG A;  1YSC A;  2V4D A;  3MHH C;  3JAK A;  1JOY A;  3JSL A;  5CA1 A;  4DR7 O;  2B1G A;  1NKD A;  2P4K A;  1W0J G;  3A32 A;  3ABL C;  4EO4 A;  5C93 A;  2ZT8 A;  1QLN A;  1MSW D;  1ZX3 A;  4JPR A;  1HWY A;  1P4R A;  4B7K A;  2DJZ A;  2Q5H A;  3JAT A;  3ZN0 A;  1Y76 A;  3N2G A;  4PDM A;  2DYS C;  3ZRV A;  4FLZ A;  1K4C C;  2FML A;  2UXX A;  2JS3 A;  4UP7 A;  1S77 D;  1PD3 A;  3LSS A;  5JQG B;  3OMA B;  2VQE B;  1EVL A;  2CDY A;  1AVM A;  3T1C A;  1A32 A;  1H4S A;  4O4L A;  1YJW V;  4KXR A;  4UFZ A;  5LOV A;  4GX2 A;  1W2B U;  1V55 B;  1EIY B;  4HNA B;  3UT5 A;  4FLX A;  1R3J C;  2F66 C;  1GKF A;  1IXM A;  2R9A A;  1RSO A;  4YRP A;  1WNS A;  4U3J A;  1F23 A;  3N2K A;  5EC2 C;  4KHP O;  4UUJ C;  1IUR A;  1CXZ B;  3FB6 C;  2ZD9 A;  3ZED A;  1AI7 A;  1EBO A;  4PV1 B;  1NYR A;  4H02 A;  4I4T B;  4PA3 A;  1N32 B;  4ZTZ B;  4LFB B;  1U97 A;  4JI2 O;  4CC6 A;  1K5S A;  4YRL A;  2HR3 A;  1Q6I A;  5IJ0 B;  1SQX H;  3L72 H;  4LF6 B;  4FLU A;  3H1K H;  4JYC A;  2CE4 A;  1BIA A;  3HKD B;  4DRX A;  2B1I A;  3ZMT A;  1WA8 B;  4DR4 B;  1BIB A;  2N05 A;  4EKW A;  2OYQ A;  4YJ3 B;  1N36 B;  4DV1 O;  3L75 H;  5GON A;  5CN0 A;  2IJI A;  1OHH G;  2JVD A;  1XMO O;  1Y74 A;  4K35 A;  4UVA A;  4H37 A;  4Q15 A;  2AMC B;  2JGD B;  4YDQ A;  2ZKO A;  2ARU A;  4YCV A;  2Y69 C;  3OR6 C;  2OCC B;  5JVD A;  2UUA B;  1DGS A;  5L3E A;  1YCI A;  4GCZ A;  1J5E B;  4GT1 A;  4PDL A;  4P3N A;  5KHK A;  1KB9 F;  1JVM A;  1O9G A;  3P3P A;  1DLB A;  3BAA A;  4WFB V;  1X01 A;  3SJA C;  1R6N A;  1VQZ A;  4UCO A;  2VWK A;  2WLL B;  4D7T A;  4MTG A;  1EQR A;  5C53 B;  2ZE8 A;  3OR7 C;  1AP5 A;  1F4M A;  1HNZ O;  1HXD A;  1Z2G A;  2UU9 O;  1HNX B;  1UPG A;  2BCC H;  3ICA A;  2AXT Z;  4X62 O;  5IWA B;  1XL4 A;  3S3X A;  1COW G;  3LNM B;  3V8J A;  2KG7 A;  2CTR A;  2RQ6 A;  2E74 B;  1OCZ B;  4NB5 A;  1P7B A;  4LF7 O;  3ZCC A;  2GV9 A;  3IKL A;  2HVJ C;  3EFR A;  3U11 A;  4WFF A;  2E3C A;  4GX1 A;  3PN1 A;  2KQX A;  2GSM B;  1VP7 A;  2DE0 X;  2F93 B;  4F6R B;  2DJV A;  1QVG U;  2IJH A;  5ITZ A;  4AIL C;  4B3T O;  4X88 A;  4MSW C;  1AI5 A;  2CGO A;  5J2T A;  1D5N A;  3QO7 A;  4OPA A;  2IM9 A;  2LW1 A;  3I55 V;  2AZ2 A;  3LDC A;  1AR5 A;  5E1A C;  4AQY O;  4DR6 B;  4RO2 A;  4X65 O;  1N0N A;  3AG2 B;  3TUP A;  2XHB A;  5LP6 B;  1RIQ A;  1V9P A;  2QKC A;  4HBN A;  4G85 A;  3CC4 V;  3F5W C;  3L73 H;  1M57 B;  4U3F H;  4CBC A;  4UCT A;  2YC0 A;  1XDC A;  4DK0 A;  1QF6 A;  2PY5 A;  4UCR A;  1SZT A;  3W7X A;  3C3S A;  1HTT A;  4P2Z A;  4ASU G;  3RW0 A;  4LH6 A;  1NJ6 A;  1E1Q G;  4MT8 A;  3ZHT A;  3VQY A;  1JA8 A;  5EYP B;  3UGT A;  4JI5 B;  3JAT B;  3VOU A;  4LFA O;  3E83 A;  4K8X A;  3NEN A;  2ODM A;  3RYH B;  2HNI A;  4LWS B;  2C2A A;  2H94 A;  2X6C A;  3BY6 A;  3HXZ A;  1HR0 B;  3SYQ A;  5LXT A;  3APO A;  2GDS A;  2YIA A;  1OCC C;  3FKS G;  1YXB A;  3KFU A;  2ALY B;  2EIN C;  4DV3 B;  1AJP A;  1ENV A;  2ZIO A;  5LOV B;  3IFX A;  3QO5 A;  1Z5W A;  3CRR A;  3UT5 B;  2P4V A;  3KCY A;  1H2G A;  2Q7H A;  1ZTE A;  1VQ6 V;  3ZHR A;  3BPZ A;  4WF2 A;  4PI0 A;  4U3J B;  5KA5 A;  4NTX A;  3QNE A;  2EIM C;  1DF5 A;  3J80 N;  2HHH B;  3SPC A;  1QBZ A;  5LMN O;  4QE7 A;  4LVI A;  5LHI A;  3A7U A;  4TQD A;  1UFI A;  1USY C;  2QWR B;  2WA4 A;  1BSM A;  2ZT9 B;  2QWN B;  3JD2 A;  4DR2 B;  3R07 A;  5H5N A;  4FK5 C;  4NTW A;  4DRX B;  2R70 A;  3OAA G;  2PYJ A;  3IAY A;  1ZWI C;  3SYA A;  3CE2 A;  1KP2 A;  2M6Y A;  3JD4 A;  1ADY A;  4DR1 B;  3ABL B;  2IU3 A;  1KU9 A;  2P6J A;  5EZY B;  4JI6 B;  2Q0A A;  4LF4 O;  1ZUQ A;  2QM7 A;  4F4L A;  3OGI B;  1PNM A;  3FYE B;  2I4N A;  5JVD B;  2PUS A;  2HEP A;  2DYS B;  1SQV H;  4PA7 A;  3GVM A;  1BQ0 A;  4YIP A;  4F6E A;  2A06 H;  5IE9 A;  2ZM6 B;  3E8H A;  2P0L A;  4B7E A;  3P32 A;  3T1Y B;  2ODR D;  5H6R A;  4DK1 A;  3TEH A;  2QDO A;  1KMM A;  1IBL O;  2BTQ A;  4I50 A;  5AG2 A;  1K5Q A;  3LNN A;  5CBG A;  1G4Y B;  4ZI7 B;  3G6E V;  1G5H A;  4DR3 B;  4NCX A;  3HXV A;  4YRS A;  2X6A A;  1SES A;  3G6B A;  4D7S A;  3W7S A;  2XAH A;  3CX5 F;  3HKE A;  1DF4 A;  1FXK A;  2YXH A;  3AG3 C;  3MF1 A;  2LO1 A;  2ZCE A;  4O4H A;  3CSX A;  5L3F A;  2M7W A;  1H8H G;  2G38 A;  3K5O A;  2GUZ A;  4MVZ A;  1JMK C;  3ETD A;  2HVK C;  2QTO A;  1EZJ A;  1WPY A;  2ZDI A;  3RN4 A;  3ZMZ A;  3DSQ A;  4YRT A;  1I0H A;  4LCU C;  1Q7Y W;  3PCO B;  4DR7 B;  5J2T B;  5IYD O;  2ZR3 A;  2O57 A;  1PL4 A;  4OX9 O;  4DV0 O;  2WLK A;  3HFZ B;  3L74 H;  1AR1 B;  1RPR A;  2YEV B;  4QIW F;  4UP8 A;  1NZ6 A;  3OTF A;  2HG5 C;  1M9N A;  5KX5 A;  2DMX A;  1Q81 W;  2BE3 A;  1I94 O;  4TV9 A;  3AG7 A;  1FYJ A;  1WQW A;  1YZB A;  2XAQ A;  5KHJ A;  5C52 B;  4ZOL B;  1QVF U;  1E22 A;  2ZQM A;  2R9I A;  1GN3 A;  3RGB A;  1BBW A;  3K59 A;  1VMG A;  3ABT A;  4DV5 O;  4JAS A;  1H38 A;  1TGO A;  3CXH F;  3UKM A;  4YHH O;  2ITD C;  3FFQ A;  2X6B A;  2KSD A;  4R6Z A;  2PF4 E;  4Q6G A;  4HYO A;  1SRY A;  4LVK A;  1VF5 B;  4KHP B;  5JH7 A;  3AK1 A;  4A5U B;  2WWW A;  4TTV A;  4JI2 B;  4HAM A;  5B5E Z;  2DXT A;  1JJC B;  1JJO A;  4TSF G;  3UM7 A;  2NNU A;  2EX3 A;  2L35 A;  1Z5V A;  4RQE A;  1FJG O;  3N27 A;  4HWT A;  1MAB G;  1EN5 A;  3F5T A;  4DV1 B;  1XEQ A;  4YRO A;  2OCH A;  3K9A A;  1FS0 G;  1XMO B;  2P06 A;  4YRJ A;  3UO3 A;  1Q6H A;  3ZHS A;  3V8K A;  3CMQ A;  2IH3 C;  5H9C A;  1GM9 A;  5J2U A;  1WQ7 A;  3NXS A;  3E89 A;  1EIY A;  4HNA A;  4BIZ A;  3E8F A;  4XEO A;  1C0A A;  3RYF B;  3UH0 A;  2EZO A;  4LC1 A;  3RAC A;  2RHS A;  4WBN A;  3V7R A;  1MA1 A;  3T2M A;  3JAS B;  1MG1 A;  4UV8 A;  3H1I H;  1HNZ B;  1ZL8 B;  3WB0 A;  5LGU A;  2BOB C;  2WSS G;  2UU9 B;  1FXV A;  3RIR A;  3BA9 A;  4I4T A;  1K3E A;  2ZE6 A;  5L3C A;  3HRI A;  1OZ0 A;  2F23 A;  3ZRX A;  2H8P C;  4KUM A;  1L1F A;  5IJ0 A;  4X62 B;  2RCV A;  1KC8 W;  3Q4H B;  3OMN B;  2KKW A;  2P67 A;  4NR1 A;  4CS3 A;  1OCC B;  1M1K W;  1K97 A;  1VEW A;  1K8A W;  4PJ0 Z;  3HKD A;  2A79 B;  2W6J G;  4HWS A;  4TT3 G;  1H2L A;  1WA8 A;  1YJN V;  2EIN B;  2ZE7 A;  1IBM O;  2DWE C;  1LUW A;  2RJZ A;  4YJ3 A;  4DV7 O;  2BTO A;  2YI9 A;  3K0G A;  2WLH A;  3L1A A;  2ZNJ A;  3KG2 A;  3OFN G;  1KEC A;  2YXL A;  4NXN O;  1H8E G;  2AMC A;  1MNG A;  3TET A;  1Q3E A;  4B3T B;  2EIM B;  4PD4 F;  4YP0 A;  1LNQ A;  2V1D A;  2DN9 A;  3FB8 C;  4FFB A;  1GK9 A;  4AQY B;  2DQ0 A;  3DC5 A;  5LMU O;  3BFM A;  3OEE G;  4X65 B;  1SC5 B;  3DGE A;  2HP8 A;  2XAJ A;  3WQZ A;  4P73 C;  1GMG A;  1LR1 A;  1N0J A;  3E8G A;  4J7J A;  2DTI A;  3A2F A;  2CIM A;  2WLL A;  2EJF A;  2ZT6 A;  3EFF K;  3OTO O;  1PL0 A;  4GX5 A;  3V8L A;  2EJG A;  1XNR O;  2WLI A;  5GTI Z;  4GKJ O;  3A5Z A;  2LW7 A;  5KUK A;  5D5P A;  4NXM O;  1K9M W;  1AJQ A;  3E86 A;  1R6T A;  4LFA B;  1JJ2 U;  1NTM H;  1PPJ H;  4EFE A;  3T1Y O;  5KX5 B;  4O4I B;  2QHV A;  3HR0 A;  1P84 F;  4X1Y A;  3B40 A;  5LGN A;  3HB3 B;  2QEX V;  2AGA A;  4F6R A;  1N33 O;  4FLW A;  3K08 A;  4XEM A;  3K06 A;  1FFX B;  1ASZ A;  2QGN A;  2HLD G;  4MTF A;  4PA4 A;  2X7R B;  1BHA A;  4IIJ B;  4O2A B;  4K3A A;  2A9H A;  4ICG A;  2E1H A;  2K1E A;  5JJJ B;  4P71 C;  1QNM A;  3OUS A;  3RYI A;  3OW2 U;  3AG3 B;  1I5Y A;  4G28 B;  2ODR C;  5BMV B;  4X8A A;  4TVY A;  4H2W A;  5LMN B;  3CCU V;  2ATK C;  1VF6 C;  4TQF A;  4P75 A;  1R3K C;  5GW7 A;  3SPG A;  1DK1 A;  1GTO A;  3EXA A;  5IYZ B;  5FPR A;  1KBH A;  3LSQ A;  1ZAU A;  3OE7 G;  5LYJ B;  4CH3 A;  4GLX A;  3I56 V;  5LHH A;  1NH2 B;  3RWR D;  3CHX A;  4J7Z A;  3A7R A;  2VWJ A;  3WU2 Z;  2ZGW A;  3WB1 A;  3IJ4 A;  5EIB D;  5EYP A;  3T1H O;  1GAX A;  3SJQ C;  2CTW A;  3U0Z A;  4DUY B;  1NVP D;  3OGC C;  2FYU H;  4BIO A;  5K1X A;  5BR8 O;  4WFH A;  3LSU A;  4YRN A;  3RYH A;  4LF4 B;  1QE0 A;  3EVK A;  4LWS A;  1PYS B;  1VQM V;  1VAR A;  1J5W A;  2HJF C;  2JJ2 G;  3TXS A;  1XIL A;  5J2U B;  4QNH B;  2ALY A;  1EFR G;  4CH5 A;  3CRQ A;  3B8M A;  3STL C;  3M4Q A;  5JCO C;  2ZXW C;  2RHS B;  4OLF A;  2HFE C;  4WBN B;  5LBQ A;  3K79 A;  1K33 A;  3BEH A;  1IBL B;  2AKW B;  1YTF B;  1EFW A;  3WG7 C;  4YRK A;  2EIJ C;  4TVA B;  2XAG A;  1JCH A;  3HXY A;  4BW9 A;  5F2V O;  1Y67 A;  4I9Q A;  2CTQ A;  2P22 C;  2W0F C;  4YYE A;  4FMT A;  2DYR C;  2YIC A;  1SQP H;  2NS6 A;  5EBL C;  3L4G B;  1JR9 A;  4YCW A;  3IC7 A;  4NKG B;  2I4M A;  2OTL V;  4MVO A;  2Q68 A;  5L3G A;  5ELO A;  5EZY A;  4QGP A;  5JJN B;  1JPX A;  2GTA A;  2N04 A;  2F4V O;  4XU1 A;  4DW1 A;  3ICX A;  5GTH Z;  1R6K A;  2ARH A;  1NTZ H;  2LP7 A;  3K0D A;  4JI8 O;  3OM3 B;  4FFB B;  4OX9 B;  4DV0 B;  1PNL A;  1YDX A;  5KMG B;  5H6Q A;  2A7W A;  1YFR A;  3P8V A;  2RHQ B;  4N23 A;  4ZHQ B;  1FAF A;  1ATI A;  1I94 B;  1HC7 A;  1SER A;  4H2X B;  3ZRW A;  3OD1 A;  2Y0I A;  1ORQ C;  4ZI7 A;  1XQ8 A;  2DXU A;  2WLI B;  4UPA A;  3B8N A;  3R66 A;  4UCV A;  3UQ8 A;  4PHC A;  4CH6 A;  4DV5 B;  2NN4 A;  4LBE C;  4YHH B;  5B1A C;  1N9W A;  2EJ9 A;  1WB7 A;  2HJD A;  1Q6U A;  4Z1M G;  5IJ9 B;  3CCV V;  3O65 A;  3CS5 A;  4U7N A;  3HY0 A;  5IYC O;  4X1Y B;  1R3I C;  2EUL A;  1G1X B;  3LDD A;  3K3W A;  2YIB A;  3IKM B;  3PCO A;  4XBF A;  4RQF A;  1VQ5 V;  4FM2 A;  1M90 W;  3G67 A;  1FPO A;  3THO A;  3H1J H;  1FJG B;  3HFZ A;  3RYI B;  1ROP A;  2YEV A;  1NJ1 A;  1V54 C;  4JYA O;  4WJ3 M;  5B1O A;  1SA0 B;  2QKA A;  4JAV A;  4P74 C;  3GWO A;  3H1H H;  1IL2 A;  4ZOL A;  2LGW A;  1P49 A;  2CAZ C;  2Q7E A;  4JGS A;  1WYD A;  1LUV A;  3C90 A;  4AH6 A;  4XDK A;  2P5O A;  1VQ4 V;  1BGY H;  1X55 A;  4W4L A;  1B3Q A;  1YI2 V;  5CBF A;  2QE7 G;  3UO2 A;  4XTV A;  2QM4 A;  1M93 A;  2JRI A;  4FZ1 A;  1XMQ O;  4X66 O;  2DWD C;  3FAV B;  3QG5 A;  3RT3 C;  4JI0 O;  4UVB A;  3AG1 B;  4LNS A;  2WPD G;  4GKK O;  2PME A;  1FD9 A;  3L70 H;  3A0B Z;  1XHZ A;  1JJC A;  4LH7 A;  4MW8 A;  4YIO A;  4DR5 O;  5DEC A;  4J15 A;  2CK3 G;  1YF2 A;  4LFC O;  4JI1 O;  3DC6 A;  1BE3 H;  3K5N A;  3QF7 A;  1ZSP A;  1IBM B;  2R72 A;  3CCS V;  4DV7 B;  1GN6 A;  4D6T H;  4OPH A;  4UB6 Z;  4DUZ O;  3LDE A;  3CPW U;  2X0L A;  1XHX A;  1BHB A;  4DXW A;  4NXN B;  3CYO A;  3D3I A;  2OTJ V;  4IT5 A;  1SF9 A;  3RL6 A;  1SKV A;  3ZIA G;  3M8A A;  4QPJ A;  5CB4 B;  2ARS A;  1TAE A;  1YB3 A;  1B6Q A;  3L2Z A;  4G84 A;  2EWN A;  4O2B B;  5JWP A;  4JF3 A;  2FTK A;  3E2E A;  5LGT A;  4FZ0 A;  4LR3 A;  4H33 A;  5LMU B;  2ZE5 A;  3H1L H;  3RYF A;  4DUY O;  3GB7 C;  1M4U A;  1OJH A;  1GM8 A;  1KD1 W;  2IH1 C;  2NLJ C;  3JAS A;  3OTO B;  4BIU A;  4YRQ A;  1XNR B;  1H2N A;  1ZL8 A;  4X20 A;  4GKJ B;  2CTP A;  5L3D A;  1B7Y B;  3Q4H A;  2J3L A;  4NXM B;  2QWQ B;  3U10 A;  5HFM A;  1W59 A;  5E3I A;  4KR3 A;  4WJ4 A;  3HXW A;  4P3O A;  3SDL A;  5ELN A;  3HXX A;  3M7M X;  5A9G A;  4DV2 O;  3ZRW B;  3H01 A;  4XU2 A;  2ZXW B;  1NYQ A;  1UJW B;  2IJJ A;  1NS1 A;  3VQX A;  4J7K A;  1E79 G;  3B2E E;  1JFF B;  3CCR V;  1N33 B;  5BY1 A;  4X1K A;  3WG7 B;  2E5A A;  2WAM A;  4GZR B;  2YXY A;  1T5E A;  1K4D C;  3KZI Z;  1IX9 A;  1USY A;  1B70 B;  4J80 A;  5KHI A;  1M5I A;  2DYR B;  4HWO A;  4WI1 A;  1Z7M A;  1PNK A;  2DEQ A;  3C3T A;  3ASN C;  3A0R A;  1Y66 A;  3REU A;  3BVO A;  2Z3Y A;  4RUE A;  4LNU B;  4IHJ B;  3UCS C;  1XNQ O;  1YHQ V;  1Q8I A;  1EZV H;  2W0X A;  3CCM V;  4HWR A;  3SPJ A;  2Y69 B;  2FB5 A;  2CH7 B;  3VBB A;  1AIL A;  1E24 A;  3T1H B;  1FFT B;  2RN9 A;  5H2F Z;  3MQZ A;  1AI4 A;  1QHT A;  5BR8 B;  2IBZ H;  4UP9 A;  1XOU A;  4O4I A;  4ABM A;  1MZF A;  3O9O A;  3HTZ A;  2UXC O;  3DXR B;  4YRR A;  1LYL A;  3SGI A;  4X5O A;  3KCX A;  3E8B A;  1W0K G;  3BFR A;  1KP3 A;  1FFX A;  1NJI W;  2QR4 A;  4BWA A;  1YFT A;  1G8M A;  4IIJ A;  4O2A A;  3ZHQ A;  3W7W A;  3CCJ V;  3RFR A;  2Q8V A;  1V55 C;  1AJN A;  2IJK A;  5BMV A;  4KP4 A;  1YFS A;  5KAF Z;  2XND G;  1RP3 B;  4FLT A;  2YUA A;  3JCZ A;  1NR1 A;  5IYZ A;  3A7A A;  2A3Q A;  3TK1 A;  1XI1 A;  3CXC U;  5LYJ A;  1X2G A;  5B1B C;  1GH6 A;  4FLV A;  3ZBH A;  3BRC A;  4H2U A;  2C8M A;  2D3O W;  4JTD B;  2QHT A;  3B09 A;  4JTA B;  3HKC B;  1YVW A;  2YS8 A;  3TGU H;  3JAW B;  3BAB A;  4XU0 A;  3ZHV A;  2F4V B;  1PYS A;  1SS3 A;  3CJH B;  2ADP A;  4GYC B;  1US6 A;  3VQV A;  1V54 B;  1VQ7 V;  1X59 A;  4QPK A;  1NI8 A;  4JI8 B;  1BL8 A;  1H4V B;  5J9P C;  2B5U A;  1K7D A;  1HP8 A;  2EJR A;  2EZP A;  2D2C B;  3STZ C;  1S5J A;  2BSK B;  2DVE A;  2AKW A;  4X20 B;  1PP9 H;  4OGQ B;  1Q86 W;  4TVA A;  3DTU B;  3UFG A;  2E5L O;  1JQ0 A;  2UXD O;  3IGA C;  4HA8 A;  1HNW O;  4CC5 A;  5HFL A;  4P72 C;  4UVC A;  4J42 A;  4LF5 O;  4WFA V;  4YPF A;  1WN7 A;  3L4G A;  3E9I A;  2IY5 B;  3HKB A;  3A8T A;  3BCC H;  4XTZ A;  4YY3 O;  2ETN A;  3ASO C;  5EBM C;  5L3B A;  2WLN A;  4CS4 A;  4B3R O;  3CRC A;  3CCE V;  3G71 V;  4KR2 A;  4FVM A;  1AB3 A;  4PG3 A;  4X1K B;  2LQT A;  4X64 O;  1VF7 A;  4FFK A;  3A5Y A;  1VQO V;  5KMG A;  1BZK A;  3CEI A;  4YRC A;  2UXB O;  11AS A;  2RNB A;  4J9Z B;  1EM1 A;  2Q7G A;  2RHQ A;  5KAI Z;  4H2S A;  4JYA B;  2VRZ A;  1E1T A;  1IVS A;  4ZHQ A;  5CMU A;  1YJ9 V;  1N8R W;  4EX5 A;  3D36 C;  2RMK B;  1SET A;  4H2X A;  5LL6 Y;  3CWB H;  1KUQ A;  3ABM C;  5LP6 C;  2B9Z A;  5HGQ A;  4BR6 A;  4I0X B;  1OCR C;  3W7T A;  4NVP A;  2AHZ A;  4G27 B;  3P8Y A;  4DPG A;  1QCE A;  3T4Z A;  2IU0 A;  3FB5 C;  1Q5O A;  1GRJ A;  1RFY A;  2DZ9 A;  2LGQ A;  5IDJ A;  3K9S A;  1XMQ B;  2DTO A;  5IJ9 A;  4X66 B;  1H4T A;  3WFV A;  3K5M A;  4JI0 B;  1QR9 A;  5EC1 C;  1OCO C;  3NEL A;  4GKK B;  3PZC A;  4XTX A;  1RM1 C;  5CA0 B;  2QA4 V;  2OT5 A;  4DR5 B;  3JD3 A;  4EFB A;  2Q67 A;  4LFC B;  4JI1 B;  1YIT V;  2EBO A;  1S5L Z;  4PDR A;  3RVY A;  2AZ0 A;  1KYO F;  5KLV H;  1H2S B;  3ERR A;  1IBK O;  1L8D A;  4DUZ B;  3M4P A;  3SJB C;  2N74 A;  2Q0O C;  4K0K O;  2QKS A;  3RYC B;  1EOV A;  1R1B A;  1SA0 A;  4P73 A;  4OXS A;  1WJZ A;  4DV6 O;  1VQ9 V;  4WFG A;  4JI7 O;  4C7U A;  3HXU A;  4LF9 O;  3ASN B;  2UUB O;  3JD0 A;  4EB6 A;  3ZN1 A;  4RWU A;  1TUB B;  1YIJ V;  2DOS A;  1CP9 A;  1E1R G;  5B3S C;  4I55 B;  1MZE A;  3NR7 A;  1B06 A;  1NT2 B;  5KNN A;  2GBO A;  1S76 D;  2EAY A;  4CS2 A;  3S3W A;  4YRE A;  4PA9 A;  3FAV A;  3SPH A;  4XTW A;  3E22 B;  4LF8 O;  2PGG A;  3MD0 A;  2E64 A;  3RKW A;  3G1Z A;  4MTO A;  5D5Q A;  4YXW G;  2ZZE A;  5LA6 B;  4J41 A;  4XTU A;  4JI4 O;  1O9H A;  3AK2 A;  1D5A A;  3BJU A;  2QWO B;  2OIE A;  1WAZ A;  4P30 A;  4DV2 B;  4P71 A;  4P9O A;  4XDJ A;  2ZNI A;  4UCU A;  4RAI A;  2UXN A;  5IT9 N;  3A31 A;  2PTM A;  4UB8 Z;  5CB4 A;  4QJF B;  4MS2 A;  2VQF O;  1VF6 A;  1CPY A;  3NET A;  4O2B A;  2QM8 A;  3CP1 A;  4PDV A;  3HKB B;  1NH2 D;  12AS A;  4HZ3 A;  1WP8 A;  2XUM A;  5B1B B;  5B66 Z;  4PA6 A;  1EN6 A;  4ZBM A;  2JS5 A;  3QO8 A;  2XOK G;  1GM7 A;  2Q69 A;  4DV4 O;  1WP7 A;  4Q20 A;  1SQG A;  2XAS A;  4PI2 A;  3OUF A;  1BMF G;  2IW5 A;  3BHP A;  3SPI A;  3CC7 V;  4W4K A;  4R8C A;  1XNQ B;  3RGL A;  3TJT A;  1KMN A;  1B7Y A;  3CD6 V;  3W7U A;  5DED A;  2Y4U A;  2ZZF A;  4TVW A;  2A8E A;  3D8C A;  4J11 A;  3OEH G;  1AI6 A;  1M56 C;  2F95 B;  4BW5 A;  1F7Y A;  2EL9 A;  5JCO A;  2UXC B;  5KA6 A;  3E35 A;  1E1O A;  4JI3 O;  5KHG A;  2YID A;  3KKY A;  1S0V A;  4N21 A;  4B3S O;  1JFF A;  4YRI A;  1YTF D;  3SYC A;  3L9D A;  4JYB A;  4X1I B;  2JEX A;  3CMA V;  4B3M O;  3JAR B;  4TWK A;  1IDS A;  4R7C A;  1X54 A;  1B70 A;  1HW7 A;  1MSD A;  2ZIM A;  2JDI G;  4TOI A;  1XRE A;  2JGU A;  2Q5I A;  3F7V C;  2EIK C;  4HT4 A;  1WPX A;  1BS3 A;  1N4C A;  4P9P A;  1WU7 A;  4PEL A;  1VQN V;  1SZX A;  5C8Y B;  1F51 A;  4LNU A;  4YJ2 B;  3H9V A;  2EIL C;  4DO2 A;  4RMF A;  3ASO B;  1DTO A;  4IHJ A;  3ABU A;  3TXQ A;  2G4C A;  1QLE C;  1HDJ A;  3SYP A;  2ILM A;  2OIG A;  2CH7 A;  1N34 O;  1URF A;  1FXH A;  4TWA A;  3CRA A;  5K1P A;  2UUC O;  4IGG A;  1GGM A;  4CH4 A;  4FJC C;  3HFV A;  1MMM A;  1QU7 A;  3ZHU A;  1B8A A;  4NTY A;  1BT8 A;  2W6I G;  4TUY A;  2DU7 A;  3DXR A;  2DU5 A;  1NR7 A;  4EB6 B;  3SYO A;  3L71 H;  3P30 A;  1I5X A;  3ABM B;  2Y48 A;  1OCR B;  3WB2 A;  2YSU B;  2E65 A;  4P3P A;  4ZKI A;  3OMI B;  3JAK B;  3RF1 A;  3J7A U;  2QWP B;  3OD4 A;  5CA1 B;  1FYF A;  5IY5 C;  4K8Z A;  3X2Q C;  2XGT A;  2WLJ A;  1ADJ A;  4IYH A;  5DN6 G;  1TA8 A;  2FKX A;  3IAL A;  1THZ A;  5FL7 G;  2ADQ B;  3FB7 C;  4UV9 A;  2DDZ A;  2E5L B;  4OP0 A;  2UXD B;  2FL4 A;  1Y76 B;  2H3O A;  1HNW B;  4J9Y B;  5LHG A;  3ABK C;  2QJ1 A;  1OCO B;  3N2G B;  4I7Z B;  4H0L B;  4FPP A;  4L8J A;  5EK0 A;  1TVK A;  4XDL A;  1RM1 B;  4LF5 B;  4Z2W A;  2ART A;  2RDC A;  4JTC B;  1XBL A;  5CBH A;  1Q82 W;  4FLY A;  1ASY A;  2NR5 A;  4YY3 B;  3HKC A;  1PM9 A;  5E79 Z;  4J10 A;  4O4L B;  3JAW A;  1JX9 A;  2I4O A;  3JAL A;  4PHZ A;  4B3R B;  5FNV A;  3CJH A;  4O4J A;  2Q73 A;  2P90 A;  4WFE A;  3PJS K;  3ZJZ A;  2JK5 C;  4FIP C;  4X64 B;  1L0L H;  4ZTU B;  4P74 A;  1KQS U;  1RSO B;  4I5S A;  4X89 A;  4MVR A;  3N2K B;  1QR8 A;  4JV5 O;  2UXB B;  5A2Q N;  3CCQ V;  1FXK C;  1U96 A;  1KOG A;  2I4L A;  2CGN A;  4XTY A;  2Y4T A;  2XT9 A;  1VQ8 V;  5B3S B;  1XUQ A;  3CCL V;  2BSK A;  5DM6 V;  1KMI Z;  3HY1 A;  3FJP A;  5CA3 A;  1NJ2 A;  2LFR A;  2GTS A;  1WB8 A;  1Q90 D;  2ZDI C;  4TV8 A;  1XL6 A;  1VQK V;  1PV0 A;  4MVU A;  5GON B;  2JJ1 G;  1X4T A;  3FD9 A;  4H2T A;  3ZX6 A;  4LVM A;  5EIB C;  4XU3 A;  3K57 A;  1Y74 B;  2ITC C;  2E75 B;  3AG4 C;  3RVZ A;  3QVN A;  2BOC C;  2IY5 A;  2E76 B;  3P8T A;  3QTC A;  1D2D A;  2VQE O;  4LVL A;  1K34 A;  2QTS A;  1K73 W;  4DW0 A;  4ZIB A;  3MDS A;  1H4Q A;  1L0N H;  2XTI A;  1I7F A;  5FPO A;  3APQ A;  4DYL A;  2EIJ B;  1WPB A;  2Q9L A;  1H2K A;  3ZRS A;  3JSN A;  1B04 A;  1Y6X A;  4H2Y A;  1S5H C;  1K92 A;  4LP8 A;  2Y0P A;  3G80 A;  3ZMU A;  1N32 O;  2ZXF A;  2ZT5 A;  1IBK B;  4LFB O;  2OWO A;  4K0K B;  4LF6 O;  2DKG A;  3IG2 A;  2PZS A;  1WLE A;  2KG7 B;  4DV6 B;  1ZLZ A;  2WLM A;  4I0X A;  4JI7 B;  4LF9 B;  4DR4 O;  2UUB B;  4HWP A;  4JZ2 A;  1YEW A;  2J3M A;  5KHH A;  3NEM A;  3RKY A;  2Q5Z A;  1GN2 A;  1IXB A;  1N36 O;  1OV9 A;  3FYI B;  3I5D A;  3ZMV A;  1YGB A;  3D3Q A;  4UCS A;  2HKO A;  2JIZ G;  3JCU Z;  3AK3 A;  3JYC A;  5ITZ B;  5C51 B;  3ETQ A;  2UUA O;  4DQ2 A;  4K88 A;  2AHY A;  3AEI A;  5TIS Z;  3G4S V;  5B1N A;  4LF8 B;  4Z1V A;  2L6L A;  4TUY B;  3IC9 A;  1M56 B;  2FYK A;  4E4E A;  1J5E O;  1AR4 A;  5CA0 A;  4O2D A;  4YRF A;  2YI8 A;  4L87 A;  2CJA A;  2LJ2 A;  5BXZ A;  2ZR2 A;  1I08 A;  4JI4 B;  3V7S A;  1B76 A;  1NJ8 A;  4JAU A;  5FLX N;  1H2M A;  2Z0A A;  3GWK C;  4QE9 A;  1HNX O;  5B1A B;  2ZTG A;  3SJC C;  3W3S A;  3CC2 V;  3RYC A;  5IWA O;  4JAA A;  2EIK B;  3FX7 A;  4AHC A;  4WF9 V;  3SR2 C; 
#chains in the Genus database with same CATH homology
 4MVQ A;  1USY C;  1YFR A;  2A0L A;  1QR9 A;  5EC1 C;  4H2V A;  1OCO C;  3NEL A;  3P8V A;  3JD2 A;  1NBM G;  3MF2 A;  3R07 A;  2EIL B;  2RHQ B;  3PZC A;  4FK5 C;  4XTX A;  5EBW C;  2DQ3 A;  4N23 A;  3K03 A;  1RM1 C;  3TEG A;  1ATI A;  2QA4 V;  2OT5 A;  2DW4 A;  1QLE B;  1TUE B;  3JD3 A;  3OAA G;  1SER A;  1HC7 A;  4H2X B;  4MW3 A;  1ZWI C;  3SYA A;  3ZRW A;  3OD1 A;  1KP2 A;  2Q67 A;  1ORQ C;  2V7Q G;  1YIT V;  2EBO A;  2DXU A;  3JD4 A;  2WLI B;  4UPA A;  1G51 A;  4KQE A;  4PDR A;  3B8N A;  2PI5 A;  5KUM A;  1ADY A;  2DTH A;  4PHC A;  3UGQ A;  3ABL B;  2IU3 A;  4CH6 A;  2P6J A;  3RVY A;  3E9H A;  4HVC A;  3ERR A;  2QM7 A;  4F4L A;  3M4P A;  1PNM A;  5BZB A;  3FYE B;  4LBE C;  2I4N A;  4I9W A;  2QKS A;  1EOV A;  1F4N A;  5B1A C;  2DYS B;  1N9W A;  2EJ9 A;  4E51 A;  4P73 A;  4YRM A;  4PA7 A;  4Z1M G;  4OXS A;  2OCC C;  1VQ9 V;  4U7O A;  3CCV V;  4WFG A;  5IYB O;  2CJ9 A;  3HXU A;  3ASN B;  4U7N A;  3HY0 A;  5IYC O;  3E8H A;  3JD0 A;  3REX A;  3LC0 A;  3ZN1 A;  1NJ5 A;  2P0L A;  1YIJ V;  1R3I C;  1CP9 A;  1E1R G;  3EFS A;  5B3S C;  3P32 A;  1EVK A;  4K87 A;  2ODR D;  5H6R A;  3LDD A;  1S76 D;  2Q6A A;  2EAY A;  3K3W A;  3TEH A;  4CS2 A;  5KNN A;  4WCE V;  3IKM B;  1KMM A;  2E41 A;  3PCO A;  4XBF A;  3RBZ A;  4RQF A;  1VQ5 V;  2LFS A;  1M90 W;  4YRE A;  4PA9 A;  4EO4 A;  1K5Q A;  5IY5 B;  5CBG A;  1G4Y B;  3G6E V;  3X2Q B;  1G5H A;  2CGH A;  1NQT A;  1RPO A;  4NCX A;  3SPH A;  3HXV A;  4YRS A;  4XTW A;  3HFZ A;  2X6A A;  1SES A;  3W7S A;  1BBU A;  2XAH A;  3ETE A;  1ROP A;  3MD0 A;  2YEV A;  2E64 A;  2JEU A;  3CME V;  1DF4 A;  1NJ1 A;  1FXK A;  1V54 C;  3AG3 C;  3MF1 A;  2ZCE A;  3G1Z A;  3ABK B;  4MTO A;  3RKW A;  3VQW A;  4WJ3 M;  4YXW G;  2ZZE A;  3HPL C;  5B1O A;  5L3F A;  2M7W A;  1H8H G;  1S3J A;  4JAV A;  4P74 C;  3GWO A;  1IL2 A;  1OCZ C;  4MVZ A;  3ETD A;  4XTU A;  2HVK C;  2ZZG A;  2E10 A;  2QTO A;  3ML0 A;  4UXN A;  2PI4 A;  2Q7E A;  1GO3 F;  4JGS A;  1WYD A;  3MHS C;  1EZJ A;  4BAY A;  3BJU A;  1WPY A;  2ZDI A;  4AH6 A;  4XDK A;  1MOF A;  4P30 A;  3TCU A;  2PMF A;  2ZT7 A;  1VQ4 V;  1X55 A;  3ZMZ A;  3DSQ A;  4P71 A;  1YI2 V;  4YCU A;  4P9O A;  4YRT A;  4XDJ A;  4R50 A;  5F5W A;  1L0W A;  5CBF A;  2QE7 G;  3TEH B;  4LCU C;  1Q7Y W;  4XTV A;  1J95 A;  3PCO B;  2ZNI A;  4RAI A;  2UXN A;  1W66 A;  1X2H A;  5IYD O;  3A31 A;  2ZR3 A;  2ZIN A;  3M99 B;  2QHU A;  3LUT B;  2DWD C;  2WLK A;  3MEY A;  4MTX A;  4QJF B;  4K86 A;  4MS2 A;  3HFZ B;  2C7I A;  1CPY A;  3NET A;  4UVB A;  1AR1 B;  1RPR A;  3EHB B;  3AG1 B;  3ZMS A;  4LNS A;  3AG2 C;  2YEV B;  2QM8 A;  2WPD G;  4QIW F;  2P7T C;  4UP8 A;  4E2L A;  3CP1 A;  4PDV A;  1FXK B;  2HG5 C;  2PME A;  1M9N A;  1NH2 D;  1JJC A;  12AS A;  1Q81 W;  4MW8 A;  4HZ3 A;  1M57 C;  5B1B B;  4J15 A;  4PA6 A;  4ZBM A;  1WQW A;  2CK3 G;  2XAQ A;  5C52 B;  3QO8 A;  2XOK G;  3A7U A;  1VQP V;  1QVF U;  1GM7 A;  1E22 A;  2Q69 A;  4G2K A;  2ZQM A;  4P75 C;  2R9I A;  4Q20 A;  4GX0 A;  2XAS A;  1BBW A;  3OUF A;  1BMF G;  3V7C A;  2IW5 A;  4LVJ A;  4MVM A;  3ABT A;  3CCS V;  4JAS A;  4RUF A;  1H38 A;  3R65 A;  3SPI A;  1G5I A;  3CC7 V;  3UKM A;  4R8C A;  3LDE A;  3CPW U;  3RGL A;  2X0L A;  3JD1 A;  4P72 A;  3B77 A;  1KMN A;  1BHB A;  4DXW A;  2ITD C;  3CYO A;  3D3I A;  1B7Y A;  2OTJ V;  3CD6 V;  3W7U A;  2KB1 A;  4KFM A;  1CEZ A;  3RL6 A;  2X6B A;  3AG4 B;  4R6Z A;  3ZIA G;  4Q6G A;  4HYO A;  1SRY A;  2ZZF A;  4TVW A;  4LVK A;  2A8E A;  1NVP B;  4QPJ A;  3WFV A;  2GHY A;  2ARS A;  1WNL A;  3OEH G;  1AI6 A;  1B6Q A;  1M56 C;  1YB3 A;  2P5I A;  3L2Z A;  2EWN A;  4G84 A;  4JF3 A;  1ARO P;  2FTK A;  3E2E A;  2Z5U A;  5LGT A;  2WWW A;  4BW5 A;  2EL9 A;  4H33 A;  2XAF A;  4TTV A;  1R73 A;  4MVS A;  5KA6 A;  3AG1 C;  4HAM A;  2DXT A;  3E35 A;  3GB7 C;  1E1O A;  1JJC B;  3I7F A;  1KKD A;  4TSF G;  3K04 A;  1S0V A;  1GM8 A;  4N21 A;  3UM7 A;  1R3L C;  1KD1 W;  2IH1 C;  2NNU A;  2NLJ C;  4YRI A;  1YTF D;  1Z7N A;  4RDX A;  3F7Y C;  2QHS A;  3HRK A;  3SYC A;  3A74 A;  4JYB A;  2JEX A;  4BIU A;  4RQE A;  3CMA V;  4YRQ A;  4TWK A;  3ETG A;  4R7C A;  1X54 A;  1Y4M A;  3RKX A;  1B70 A;  4HWT A;  1MAB G;  2DZC A;  1X56 A;  1PKX A;  4YRO A;  1S72 V;  1VQL V;  5L3D A;  3K9A A;  1FS0 G;  1B7Y B;  2ZIM A;  2JDI G;  1NNH A;  2J3L A;  2F43 G;  4YRJ A;  4CZZ A;  2Q5I A;  5HFM A;  3D36 A;  3F7V C;  2EIK C;  5E3I A;  1WPX A;  4HT4 A;  4KR3 A;  2R9R B;  3V8K A;  2CJB A;  3CMQ A;  4P9P A;  1WU7 A;  4WJ4 A;  2IH3 C;  5H9C A;  3HXW A;  2MK3 A;  4PEL A;  1VQN V;  1GM9 A;  4P3O A;  3RUX A;  3T4D A;  1F51 A;  1WQ7 A;  4YRG A;  2EIL C;  3NXS A;  4DO2 A;  5ELN A;  3E89 A;  4RMF A;  3HXX A;  3ASO B;  1DTO A;  3ABU A;  1YSC A;  1EIY A;  3ZRW B;  3H01 A;  4BIZ A;  3MHH C;  3E8F A;  2G4C A;  4XEO A;  1QLE C;  2ZXW B;  1NYQ A;  4XU2 A;  1UJW B;  2IJJ A;  1JOY A;  1C0A A;  3UH0 A;  3SYP A;  2EZO A;  2B1G A;  4LC1 A;  3RAC A;  3VQX A;  2RHS A;  1E79 G;  1NKD A;  3CCR V;  1FXH A;  3V7R A;  4TWA A;  3T2M A;  1W0J G;  5K1P A;  3A32 A;  1MG1 A;  3ABL C;  4UV8 A;  3WG7 B;  1GGM A;  4FJC C;  2E5A A;  5C93 A;  4CH4 A;  2ZT8 A;  2WAM A;  1QLN A;  1MSW D;  3HFV A;  1HWY A;  1P4R A;  4JPR A;  2DJZ A;  2Q5H A;  3ZN0 A;  1K4D C;  5LGU A;  3RIR A;  2BOB C;  2WSS G;  1FXV A;  1USY A;  1K3E A;  1B70 B;  5L3C A;  3HRI A;  1B8A A;  1OZ0 A;  4PDM A;  3ZRX A;  2H8P C;  2DYS C;  4KUM A;  3ZRV A;  1L1F A;  2DYR B;  2W6I G;  1KC8 W;  4HWO A;  1K4C C;  1Z7M A;  1PNK A;  3OMN B;  2DU7 A;  2P67 A;  2UXX A;  4WI1 A;  4CS3 A;  2DU5 A;  1NR7 A;  2DEQ A;  3SYO A;  4UP7 A;  1OCC B;  1M1K W;  1K97 A;  1K8A W;  1S77 D;  1PD3 A;  3ASN C;  1I5X A;  3A0R A;  2Y48 A;  3ABM B;  2A79 B;  2W6J G;  3LSS A;  3OMA B;  4TT3 G;  1EVL A;  1Y66 A;  1YJN V;  2EIN B;  3T1C A;  4HWS A;  1H4S A;  1OCR B;  3REU A;  2DWE C;  2Z3Y A;  4RUE A;  2YSU B;  1YJW V;  3K0G A;  2WLH A;  1W2B U;  3L1A A;  4GX2 A;  2ZNJ A;  1V55 B;  3KG2 A;  2E65 A;  4P3P A;  1YHQ V;  1EIY B;  3CCM V;  4ZKI A;  3OMI B;  4HWR A;  3SPJ A;  3OFN G;  1KEC A;  3RF1 A;  1H8E G;  2Y69 B;  1FYF A;  5IY5 C;  2AMC A;  1R3J C;  1GKF A;  1IXM A;  3X2Q C;  2WLJ A;  3VBB A;  5DN6 G;  1ADJ A;  1E24 A;  1FFT B;  3TET A;  2XGT A;  4YRP A;  3IAL A;  1THZ A;  2EIM B;  5FL7 G;  3MQZ A;  1F23 A;  1AI4 A;  3FB7 C;  5EC2 C;  4UV9 A;  4YP0 A;  1LNQ A;  2V1D A;  4UUJ C;  3FB8 C;  3FB6 C;  2DDZ A;  2ZD9 A;  4OP0 A;  4UP9 A;  1AI7 A;  1GK9 A;  1EBO A;  4J9Y B;  5LHG A;  1NYR A;  2DQ0 A;  4H02 A;  4PA3 A;  3ABK C;  3BFM A;  3OEE G;  1OCO B;  4ZTZ B;  3DGE A;  3HTZ A;  1K5S A;  2XAJ A;  4FPP A;  4YRL A;  3WQZ A;  2HR3 A;  5EK0 A;  4P73 C;  1GMG A;  4XDL A;  1RM1 B;  3E8G A;  2DTI A;  4YRR A;  1LYL A;  4JYC A;  2ART A;  4X5O A;  4JTC B;  2CIM A;  2WLL A;  2EJF A;  2ZT6 A;  3EFF K;  3E8B A;  1W0K G;  1BIA A;  5CBH A;  1Q82 W;  1PL0 A;  2B1I A;  1KP3 A;  4GX5 A;  1ASY A;  1NJI W;  3ZMT A;  1BIB A;  1YFT A;  3V8L A;  4EKW A;  1G8M A;  2EJG A;  4BWA A;  1JX9 A;  2I4O A;  2WLI A;  3W7W A;  3CCJ V;  5CN0 A;  3A5Z A;  2IJI A;  1OHH G;  2P90 A;  4WFE A;  3PJS K;  3ZJZ A;  2JK5 C;  5KUK A;  4FIP C;  4UVA A;  4LVI A;  1V55 C;  4H37 A;  1AJN A;  4Q15 A;  2AMC B;  2IJK A;  4YDQ A;  1K9M W;  1AJQ A;  2ARU A;  4YCV A;  3E86 A;  4ZTU B;  2Y69 C;  4P74 A;  3OR6 C;  4KP4 A;  4I5S A;  4X89 A;  1KQS U;  1JJ2 U;  2OCC B;  4MVR A;  1YFS A;  1QR8 A;  2XND G;  3JCZ A;  5L3E A;  1NR1 A;  3CCQ V;  3A7A A;  3TK1 A;  4GCZ A;  1FXK C;  2QHV A;  1KOG A;  3CXC U;  2I4L A;  4XTY A;  4GT1 A;  4PDL A;  4P3N A;  1X2G A;  1JVM A;  1VQ8 V;  5B1B C;  5B3S B;  1DLB A;  5LGN A;  3CCL V;  4WFB V;  5DM6 V;  3HB3 B;  2QEX V;  1X01 A;  4H2U A;  2C8M A;  2D3O W;  1R6N A;  1VQZ A;  3HY1 A;  2WLL B;  3K08 A;  3FJP A;  4XEM A;  5CA3 A;  4JTD B;  1NJ2 A;  2QHT A;  2LFR A;  4MTG A;  3K06 A;  4JTA B;  1EQR A;  1ASZ A;  2HLD G;  5C53 B;  4MTF A;  3OR7 C;  4PA4 A;  2X7R B;  1F4M A;  2ZDI C;  1BHA A;  1XL6 A;  1HXD A;  2A9H A;  4XU0 A;  1VQK V;  2E1H A;  2K1E A;  4P71 C;  4MVU A;  1PYS A;  2JJ1 G;  4H2T A;  3VQV A;  3OUS A;  3ICA A;  4LVM A;  1V54 B;  3OW2 U;  3AG3 B;  4XU3 A;  2ITC C;  1I5Y A;  3AG4 C;  4G28 B;  1XL4 A;  3RVZ A;  2ODR C;  1VQ7 V;  1COW G;  4QPK A;  2BOC C;  3LNM B;  4X8A A;  4TVY A;  3V8J A;  2IY5 A;  3P8T A;  1BL8 A;  4H2W A;  3QTC A;  4LVL A;  1OCZ B;  3CCU V;  2ATK C;  1P7B A;  4P75 A;  4TQF A;  1R3K C;  1K34 A;  3ZCC A;  5GW7 A;  2B5U A;  1K7D A;  5J9P C;  3SPG A;  1H4V B;  3IKL A;  2EJR A;  2HVJ C;  1K73 W;  1GTO A;  2EZP A;  3EFR A;  4ZIB A;  4WFF A;  3LSQ A;  1H4Q A;  2E3C A;  3STZ C;  4GX1 A;  3OE7 G;  2XTI A;  4CH3 A;  3I56 V;  5LHH A;  2GSM B;  1NH2 B;  3A7R A;  2ZGW A;  2EIJ B;  2DVE A;  2AKW A;  1QVG U;  2IJH A;  3SJQ C;  4X88 A;  3ZRS A;  1Q86 W;  4MSW C;  1AI5 A;  1NVP D;  4TVA A;  3OGC C;  1S5H C;  1K92 A;  3DTU B;  4LP8 A;  4H2Y A;  3QO7 A;  3UFG A;  4WFH A;  1JQ0 A;  5K1X A;  3IGA C;  4YRN A;  4HA8 A;  3I55 V;  3LDC A;  5E1A C;  3ZMU A;  5HFL A;  1QE0 A;  2ZXF A;  4P72 C;  1PYS B;  4UVC A;  4RO2 A;  1VQM V;  2ZT5 A;  1J5W A;  2HJF C;  3AG2 B;  2JJ2 G;  3TUP A;  1RIQ A;  4WFA V;  4YPF A;  2DKG A;  4G85 A;  3CC4 V;  3IG2 A;  3F5W C;  3L4G A;  3E9I A;  1M57 B;  1WLE A;  2IY5 B;  4CBC A;  4QNH B;  2ALY A;  2WLM A;  1EFR G;  1QF6 A;  4XTZ A;  4HWP A;  4CH5 A;  3B8M A;  3STL C;  2J3M A;  1SZT A;  3ASO C;  5EBM C;  5L3B A;  3NEM A;  3RKY A;  3W7X A;  1HTT A;  2WLN A;  4P2Z A;  3M4Q A;  4CS4 A;  2ZXW C;  3FYI B;  4ASU G;  2RHS B;  3RW0 A;  2HFE C;  4OLF A;  3CCE V;  5LBQ A;  3G71 V;  1NJ6 A;  3K79 A;  1K33 A;  1E1Q G;  4MT8 A;  3ZMV A;  4PG3 A;  1YGB A;  4KR2 A;  2HKO A;  3VQY A;  3BEH A;  2JIZ G;  2AKW B;  1YTF B;  3UGT A;  3JYC A;  3VOU A;  1EFW A;  3WG7 C;  3A5Y A;  5C51 B;  3E83 A;  1VQO V;  2EIJ C;  3NEN A;  4YRK A;  4DQ2 A;  4K88 A;  2AHY A;  4YRC A;  4TVA B;  3AEI A;  11AS A;  3G4S V;  2XAG A;  1JCH A;  5B1N A;  3HXY A;  4BW9 A;  4J9Z B;  2Q7G A;  2HNI A;  1M56 B;  2FYK A;  2RHQ A;  2W0F C;  2C2A A;  4H2S A;  2H94 A;  2X6C A;  3BY6 A;  2DYR C;  4FMT A;  1E1T A;  3HXZ A;  4YYE A;  5CMU A;  1YJ9 V;  3SYQ A;  1N8R W;  4EX5 A;  4O2D A;  2NS6 A;  4YRF A;  1OCC C;  1SET A;  2CJA A;  4L87 A;  3P30 A;  4H2X A;  5EBL C;  3L4G B;  3ABM C;  3FKS G;  3KFU A;  4YCW A;  5HGQ A;  2ZR2 A;  3IC7 A;  2EIN C;  2ALY B;  1OCR C;  2I4M A;  1AJP A;  3W7T A;  1ENV A;  2OTL V;  2ZIO A;  4MVO A;  2Q68 A;  3IFX A;  3V7S A;  5L3G A;  3QO5 A;  1B76 A;  4JAU A;  1NJ8 A;  5ELO A;  2AHZ A;  4G27 B;  3P8Y A;  1H2G A;  4DPG A;  1JPX A;  1QCE A;  4QE9 A;  3T4Z A;  2IU0 A;  3FB5 C;  4XU1 A;  2Q7H A;  5B1A B;  1VQ6 V;  2ZTG A;  1R6K A;  3W3S A;  4WF2 A;  3CC2 V;  2DZ9 A;  5IDJ A;  5KA5 A;  2LP7 A;  3K0D A;  3QNE A;  2EIM C;  1DF5 A;  3OM3 B;  2DTO A;  3SPC A;  1QBZ A;  4WF9 V;  2EIK B;  1PNL A;  4QE7 A;  1H4T A;  5H6Q A;  5LHI A;  4TQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...