3RF1A

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rf1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rf1A01
2ALYB 1ADJA 3PCOA 1X2GA 1WNLA 4XTXA 1NJ2A 2DU5A 2DVEA 4CH5A 2EJ9A 3UGQA 3IKLA 3HTZA 1USYC 4P75A 2EAYA 1BIBA 2ZR3A 3A74A 5ELNA 4BWAA 4YCWA 4BW9A 3HFZA 4TQDA 3P8VA 1H4QA 3MF1A 4TVAA 4HVCA 4Q15A 2ARTA 2E41A 1EIYA 1E22A 3V7CA 2DU7A 4ZIBA 4EO4A 3QTCA 4XTWA 3TEHA 2IY5A 4G85A 4J15A 2QHVA 3A32A 1NNHA 4H2TA 1WU7A 3HXZA 3NETA 4WJ4A 4XEOA 3RKYA 4E51A 4XU0A 2DEQA 2J3LA 3RUXA 1WPYA 2RHQA 4TTVA 1H4TA 2DKGA 1PYSA 2C7IA 4YRJA 1E1OA 3BJUA 4H2SA 1GGMA 2XTIA 4YRFA 1JJCA 1E1TA 4HWOA 4NCXA 1YFSA 1X56A 1SETA 2ZIMA 1VQZA 1G5HA 3RIRA 3RACA 3A5YA 3P8TA 4XEMA 3HXWA 4P75C 3MF2A 1USYA 2CJBA 5C52B 3HY1A 3QO5A 2AKWA 3NELA 4YP0A 4YRRA 1SESA 3PCOB 4YRIA 3MEYA 1NJ8A 2EJGA 1YB3A 3A5ZA 4G84A 1WYDA 2I4MA 3L4GA 2J3MA 1C0AA 2Q5HA 1BIAA 3HY0A 3NEMA 4YROA 2ZZEA 3RKWA 2G4CA 1L0WA 3CMQA 4CH3A 3P8YA 3HFZB 3UGTA 4CH4A 1BBWA 2E5AA 1HXDA 1X01A 4P72C 3RL6A 4UP9A 4WJ3M 2DQ3A 2DTIA 4UP8A 4YRKA 1X54A 3TEHB 5HGQA 4HWPA 4P3PA 3HRKA 4YPFA 2EJFA 4XTVA 4P74C 2ZTGA 2RHQB 4H2UA 3G1ZA 2AMCB 1Z7NA 4KQEA 4XU2A 3EFSA 2ZT5A 1SERA 3ICAA 1NYQA 2E3CA 2ZIOA 3A7RA 2DDZA 4LNSA 4H2WA 4K86A 4KR3A 1JJCB 4O2DA 3W3SA 2I4LA 3A31A 4HWRA 4CH6A 4YREA 1EFWA 1Z7MA 3V8LA 1YFTA 3HXXA 3V7SA 3UH0A 2CJAA 2DZ9A 1NJ1A 3L1AA 3V8KA 2QHSA 1YGBA 3RF1A 2E1HA 2AKWB 3REXA 3OD1A 2ZZGA 3IG2A 1ASYA 2RHSB 3VQWA 4H2XB 2EWNA 4DQ2A 4K88A 4YRQA 4RMFA 1LYLA 2ODRC 4P72A 1KOGA 2ALYA 2ZNIA 2ZXFA 2DTHA 2DJZA 1B70B 2EL9A 3QO8A 12ASA 1EOVA 4L87A 4YRSA 2ZR2A 2Q7GA 3BFMA 1FYFA 3ERRA 2Q5IA 3LC0A 4AH6A 2ODRD 1RIQA 3HFVA 4P74A 1EQRA 4EX5A 3QNEA 4CS3A 2ZNJA 4CS4A 5C53B 4PG3A 4ZTUB 2ZT8A 3TEGA 2DXUA 1ASZA 3HXUA 4XU3A 1N9WA 5K1XA 4RQFA 1B76A 3VBBA 4H2YA 1B8AA 3I7FA 4YYEA 1WQWA 1ATIA 4XTYA 3PZCA 3E9HA 2CGHA 3FJPA 2PMEA 2ZCEA 3EFRA 5K1PA 4TVAB 1EIYB 4P71C 1WLEA 4X5OA 4TQFA 5KNNA 1NJ5A 4YCVA 4KR2A 1G5IA 3R07A 2IY5B 4XTUA 5F5WA 2CJ9A 4YRTA 4XU1A 4YRGA 4YRCA 4RQEA 1H4SA 3WQZA 2CIMA 4HA8A 3A7UA 4YRNA 3VQYA 3VQXA 1PYSB 2QHTA 1B7YA 4Q6GA 3IKMB 1NJ6A 2DZCA 5E3IA 1KMNA 2QHUA 3LSQA 3L2ZA 2ZT7A 3NENA 4HWSA 1E24A 4PHCA 2ARUA 4RDXA 2HNIA 2FYKA 1QF6A 4YRLA 4P73C 1EVLA 2ZINA 1HC7A 3M4PA 3HXYA 2P5IA 4WF2A 2DTOA 1ADYA 3QO7A 2ZT6A 2C8MA 3RGLA 4K87A 4OLFA 2E10A 4TWAA 3UFGA 4P71A 1X55A 2DQ0A 4YDQA 3L4GB 1KMMA 3IALA 3V8JA 4DPGA 2E64A 2E65A 2XGTA 4P3NA 5ELOA 4TVYA 2AMCA 2P0LA 2I4NA 5C51B 1X2HA 3E9IA 3RKXA 4WI1A 1WQ7A 1EVKA 3M4QA 4OP0A 1J5WA 4H02A 11ASA 1HTTA 4YRMA 4P3OA 4UP7A 2ARSA 4H2VA 4P73A 3A7AA 4ZTZB 2I4OA 4CS2A 3REUA 2PMFA 2RHSA 4H2XA 2ZZFA 1B7YB 4YRPA 4YCUA 1IL2A 3TUPA 1SRYA 3KFUA 3HXVA 2Q7EA 4HWTA 1B70A 2ZGWA 4UPAA 1BBUA 3DSQA 1YFRA 3LSSA 3V7RA 1H4VB 4TVWA 1W66A 2Q7HA 2DXTA 3HRIA 1G51A 1NYRA 1QE0A 4XTZA 3VQVA
chains in the Genus database with same CATH superfamily
4LFAT 2ALYB 3L39A 3IEEA 2DU5A 4OYJA 4EAHA 2JQQA 4UEMA 3AA6B 5KDMC 1LVFA 2KMFA 2YU2A 5J1GA 1E1HB 1USYC 1BIBA 3A74A 4EOZB 2PBIA 1QUUA 3FXDB 2OLTA 1GQEA 4YHHT 4WBNE 2B76A 5IWAT 5L3CB 4YCWA 3GMIA 3C4XA 5FP3A 3Q9DA 4MLKA 4EIWA 2E41A 3MJXA 1EIYA 1JNRA 3RYCE 4EO4A 4IDQA 1H7CA 4G85A 4J15A 2D9DA 2QHVA 2Q9QA 4NIQA 4B3TT 3NWIA 3A32A 4H2TA 4WJ4A 5DQWA 5LBQB 3AA7B 4E51A 4YTMA 3ZN1B 2DEQA 2DLRA 1OEDC 2BKOA 1WR6A 3ZPOA 1HX1B 2RHQA 3OBVE 4U7IA 4TTVA 2HN1A 2HPLA 2A9UA 3T1HT 3O1IA 4X65T 5EK4A 4YRFA 2NW8A 4B6XA 3RACA 2J47A 3A5YA 3P8TA 3QB5K 2ACXA 4XEMA 3OYXA 4P75C 4F6RC 5LGUB 4B3MT 2CJBA 3CVRA 4V1Av 2A3DA 4AQGA 4MHCA 4YP0A 5HEUA 4WBOA 4YRRA 5JDLA 2H7VC 4DR7T 4XZCA 1AJ3A 1YB3A 2EJGA 4X1KE 1WYDA 4HWCA 2I4MA 2EHOA 2YDRA 4IDPA 2Q5HA 4AQFC 1FIOA 3HY0A 3NEMA 4YROA 5AQJB 2CM0A 3RH3A 2G4CA 3QB5A 3WI3A 2QYWA 3CMQA 2AXDS 3HFZB 3P8YA 5CGMA 3AE3A 2V6YA 3UUMA 3SFDA 2CHNA 4TWFA 4LMKA 2E5AA 2UXBT 1S94A 4WJ3M 4X1IE 2JQ9A 4JEHB 2XUEA 4YRKA 4HWDA 4A97A 5HGQA 2YKSA 1E7PA 4IDNA 3JADA 4EB6E 3N9LA 4KMCA 2ZTGA 2X51A 3AXJA 2NP9A 2JRKA 2E3CA 4CI3B 5AFUL 4QH1A 1X79A 1JJCB 3ZYKA 2I4LA 3A31A 1EFWA 4O2AE 5C8YE 4DR5T 2CJAA 2LKHA 5BMVE 3V8KA 2QHSA 2KNDA 1YGBA 2MOZA 2XQ6A 4KUMB 2AKWB 4FJOA 3REXA 5FY0A 3VQWA 1MIYA 4YRQA 2WY2A 5LJNA 5FXZA 4RMFA 1LYLA 2XAFB 4LFCT 2ODRC 3VRBA 1D1CA 2E9XA 3QNUA 2BG9C 2DTHA 3TLTA 1B70B 12ASA 3K8PC 1MMNA 2A8EA 4HWIB 4U31A 2Q7GA 4HFDA 5HXSA 3P4RA 3HA4A 5LMUT 3N9OA 4AH6A 1J5ET 5LHGB 3HFVA 1EQRA 4HN9A 3KV5A 4EX5A 3VKHA 4CS3A 1IJ6A 1J1JA 3HKBE 5FY7A 2VKHA 2CBJA 1LRZA 2FBWA 4ZTUB 4DV7T 1OWAA 1ASZA 2X0HA 4U33A 4XU3A 4UV8B 4YLHA 5JRCB 4ILBA 3PU3A 1N32T 3L3PA 2WB5A 3AEBA 3QK6A 2MYSA 4NXNT 3AE4A 1WQWA 1HNZT 5C3JA 2WU5A 2WQYA 3PE0A 3S4UA 2ZCEA 2CA5A 3IA3A 5A1LA 4DNDA 2WMOA 1EIYB 4P71C 4LVKA 2UUAT 3AAAB 2DL1A 1WYBA 2DI4A 4KR2A 4A56A 2LLYA 3AE7A 4KHZF 5F5WA 2CJ9A 5L3GB 1WCRA 3PTRB 3LBXB 4XU1A 1E2AA 4A5XA 3PJAJ 3OPCA 3VKGA 4RQEA 2MTQA 2PFVA 3AAEB 4KP3C 2QHTA 2KINB 5L3BB 4AI6A 4JI7T 4YJ2E 4JI1T 4PJNA 4DV0T 3EHZA 3NENA 5FKYA 2UXDT 4HFIA 3ZYMA 1KNZA 2NR4A 2HNIA 4HE8A 4QXCB 3N9PA 1EVLA 3ZC0A 3CX6B 3M4PA 2BBJA 3HXYA 2JIWA 2VKOA 3NKZA 1Y01A 4ADZA 4DMVA 2ZT6A 4F8HA 2XSBA 3V5UA 2KT9A 3RGLA 4OLFA 4PJJA 2E10A 1HF8A 2IAKA 2I59A 2LKGA 4ZZBA 2AE9A 4I4TE 2J4GA 2E64A 4HFBA 4P3NA 4IIJE 2LOSA 4X20E 4UVBB 4PK5A 2SPCA 5C51B 3E9IA 3KBUA 2GK9A 3NRYA 2WM9A 3K3QC 1MMDA 2A72A 5L4EA 1NENA 3TKLB 1IAPA 2V7JA 3RYFE 2Y8DA 3RQWA 3I0OA 4P3OA 4UP7A 4B3ST 2ZM2A 4LMLA 1NEKA 4KHPT 1W09A 4GOUA 2C5IT 3A7AA 5FY1A 2KWHA 2NOXA 3AXJB 4YCUA 4EEDA 3TUPA 4IE6A 3KFUA 3PUXF 2ZGWA 4JEUB 2JMHA 3KVBA 3KINB 4UPAA 2L8KA 1BBUA 2PJQA 1H4VB 3FZKB 3C98B 4HFEA 5IHYA 1W66A 4OHFA 4UVCB 1OEDA 2DXTA 2XSAA 3UT5E 1NYRA 5IYZE 2G0UA 4EYYR 1QSDA 2LT3A 4GK5E 1UGOA 2E9XB 3VQVA 4GYRA 1ADJA 2WP9A 4CI1B 4XTXA 4O4LE 1NJ2A 4DIDB 3NZQA 3L09A 4EEBA 4ZEYA 1HFAA 2X67A 4YTNA 5FXVA 3ZCIA 1ZV4X 1XNQT 4P75A 3EDVA 2EAYA 2ODUA 3IBPA 2V5DA 1OEDE 1XWMA 4L0RA 3UULA 3HFZA 4HFCA 4DMWA 3P8VA 2WMNA 4HVCA 4Q15A 2ARTA 3V7CA 4HWFA 5ABEA 4TV9E 3QTCA 2XPKA 3FZMB 1O3XA 4AQFA 2W4XA 4H9OC 4XEOA 3RKYA 3ZC1A 2XAQB 4P0AA 2J3LA 3ZEFB 3FXEB 1H4TA 5F8PA 3AVRA 4YRJA 4AISA 2W63A 1E1OA 4H2SA 1GGMA 1JJCA 1E1TA 3RYIE 3PUAA 2WSSV 5HXCA 2WZHA 3RIRA 3O9XA 2UXCT 5TAOA 4YSYA 3PV0F 3HY1A 2P9BA 2AKWA 3NELA 2WS3A 3RYHE 3P4QA 3A8YC 2X68A 4TNVA 5LHIB 4DBRA 4JI8T 2V1DB 1EZ3A 4JI6T 4X1YE 4ZI7E 3A5ZA 4O4JE 4G84A 2MPKA 3L4GA 1C0AA 3P8CD 2CRBA 3VU7H 5AQRB 4WYVA 5EK2A 5CA1E 1WR0A 4ZS2A 1FJGT 3RKGA 3DJBA 4CH3A 3UGTA 2L3LA 1ZOYA 4DV6T 1BBWA 5FL0A 3P50A 4P72C 1M7KA 3RL6A 2DQ3A 2VVNA 2CWYA 2BG9A 1X54A 3P7IA 2WBLA 4O4HE 4GIWA 4BAYB 5AQFB 5AQQB 5LMNT 5JRCA 3HRKA 5ABHA 5J2UE 4YPFA 4OFZA 2LHNA 3RPUA 4K0UA 4P74C 2I6HA 4H2UA 3RHWA 3G1ZA 2IW5B 1S35A 4LF4T 4KQEA 4XU2A 2XQ4A 3ICAA 2RPAA 1KEYA 5HCJA 2RP4A 3ETVA 2FJDA 4KR3A 3Q5EA 4ZI2C 1W9RA 1HG5A 2XTLA 4O2DA 3W3SA 2BG9E 2C5KT 4HWRA 4CH6A 2K5BB 4IGUA 3TLUA 2K9AA 2K24A 3HXXA 1IBKT 3JAEA 2R6GF 1WFDA 4U72A 3UH0A 3ZMZB 4YFSA 3EI0A 5LP6E 1NJ1A 5L2LA 3JC6D 1KNPA 3LBXA 2WU2A 4EGWA 3B5MA 2EWNA 3JCFA 2X9XA 4DQ2A 4K88A 4WNKA 3MACA 4Q25A 2ZNIA 4DR4T 2EL9A 3KBTA 4YRSA 2ZR2A 3KV4A 5E0OA 1FYFA 3SFEA 1DU2A 5H6QB 2XQAA 3V5SA 1OEDB 2Z6EA 2ODRD 1I6ZA 2C0SA 3VRAA 4ILCA 4HKAA 5JR9C 1WYCA 1ZP0A 3FBZA 4TNWA 4IHJE 2DWKA 3ZMUB 4CS4A 4CI2B 5C53B 4PG3A 2KZ7B 2ZT8A 3TEGA 2DXUA 4AQYT 3HXUA 3DTOA 5K1XA 1B76A 2WDRA 3AE9A 3VBBA 3MQZA 4YYEA 1Z0PA 3HKEE 2FJBA 4IDOA 4BJMA 2N1GA 2CGHA 3JAFA 3AAIA 2B1EA 3UQ7A 2PMEA 2IC9A 2VB6A 3EFRA 5K1PA 1D0XA 4QX7B 3MZKB 1VOMA 3ZMTB 4TQFA 5KNNA 2LRLA 5AQTB 4ZS3A 5JH7E 4DV5T 3R07A 2HH7A 3ONJA 3AEAA 1MIWA 5HEGA 5EZYE 3E22E 3A7UA 1T72A 3U3IA 3VQYA 4ILAA 4X66T 3JC6C 2HPJA 4IL9A 3PUGA 1SHZC 4ERRA 2V7IA 4J2CA 3AE1A 2FYKA 4A98A 4YRLA 4P73C 1HS7A 3GN5B 3UTKA 5CA0E 2P5IA 4WF2A 4LF7T 2DTOA 4GKKT 5J0ZA 3PUVF 4DUYT 2LM9A 5JDFA 1ADYA 1BR1A 3SWHA 3KDSE 3R84B 2ZLYA 2QRXA 2FUPA 2WDVA 3NBXX 4QH5A 3C51A 5HWXA 3L4GB 1YKHB 2XHEB 2W2UA 3V8JA 1MNEA 2WCAA 2LSYA 3ZKRA 1OXZA 2NS6A 2QVAA 4TVYA 5CFBA 4DR1T 1XDOA 3BQIA 4WI1A 2I0MA 3AE5A 1EVKA 4NXMT 2UU9T 4MBQA 4H02A 5HXHA 2BG9B 3AA0B 3F31A 5AQHB 3UU4A 2LSJA 5KMGP 4YXDA 2ARSA 2WWVA 3EABA 3R6NA 3IF8B 4PK4A 2CXLA 2I4OA 4CS2A 3REUA 2PMFA 4EYUA 4H2XA 3UQ4A 2VASA 5C2TA 3UUBA 2VKJA 3E08A 3RQUA 4HWTA 5DQVA 3N9MA 4K0KT 2Q9QC 3ZMSB 3A7MA 2XM2A 2IC6A 1YFRA 3T1YT 4P1NA 2XQ7A 3LG7A 5LG3A 4QHOA 2E2AA 2E8IA 2XASB 3C4WA 2J1DG 4XTZA 5JVDE 2XZEA 1SE7A 1X2GA 5HEJA 4HTEA 2DVEA 2LRKA 4PAGA 4CH5A 3CPZA 3UGQA 3IKLA 1JNZA 4JYAT 3AE8A 2NTXA 2ZR3A 2MBGA 3F2EA 2E5LT 3AEEA 4AIUA 5ELNA 2YN6A 3TLWA 4CZZB 4TQDA 2IHR1 2H88A 2X0LB 5AQMB 2ES0A 1H4QA 3MF1A 4TVAA 4NPPA 4TZ4C 3M3ZB 1BR2A 2DU7A 1R8IA 2LOPA 4ZIBA 1XMQT 2EHOC 4PW8A 3N9QA 4IE5A 4YY3T 1HNWT 4ILUA 3QUJA 1WU7A 3NETA 2H89A 4IL4A 4XU0A 2Y6XA 3RUXA 3PJAA 1WPYA 5AQSB 2CBIA 2YDSA 2XAJB 4PJMA 2DKGA 2CXFA 4JV5T 1W0AA 3BJUA 4MFRA 2V7KA 3PUYF 1X9BA 2X9WA 4O8SA 4HWOA 2CMRA 1IZNB 1YFSA 1X56A 1VQZA 1QLBA 1MMGA 3C64A 4YSZA 2JPFA 4DR6T 5LXTE 3HXWA 1USYA 4OX9T 3ZT7A 5C52B 3J7Yq 4WZXA 3QO5A 3GA8A 1HNXT 3RRWA 3PCOB 4YRIA 1BR4A 3MEYA 1NJ8A 4DV4T 2XQ3A 2N9DA 2N2NA 3E0ZA 2CXDA 2ZZEA 4KBMB 4PK6A 2IUBA 3HI2A 4DO0A 2DWGA 4L5GA 2M6BA 3O1HA 4UP9A 4UP8A 4NUUA 3UFEA 5LGTB 2DNXA 3CX7B 3TEHB 2V6XA 2VL0A 2UXNB 3NVOA 5ADXL 2EJFA 4ISTA 4I50E 3RX6A 4HFVA 4GYSA 2KLQA 4XTVA 4P0BA 2V8SV 1UK5A 3C4ZA 3RIUC 4CXXA 5KXJA 4DV1T 5JR9A 1Z7NA 3PDYA 2ZT5A 3CIRA 4ZHQE 2D2SA 3LK2B 1SERA 1NYQA 4ZXLA 2ZIOA 3A7RA 4LNSA 4K86A 4JI5T 1VRBA 4DR3T 1YQ4A 5LA6E 4YREA 1CUNA 3V8LA 2WDQA 1YFTA 5J2TE 3V7SA 4DV3T 4YSXA 2DZ9A 2YK0A 3CK6A 3ZT6A 2W00A 3RF1A 1ZKEA 1CHUA 3OD1A 2ZZGA 1ASYA 3AEGA 2BBHA 4H2XB 4ZI2D 4KI0F 4IDZA 4QXHB 2W61A 4PJLA 5LYJE 3QO8A 4ZI3C 1EOVA 4E7ZA 5L4HA 3I9WA 3ZN0B 2C5JA 5AQNB 2Q5IA 3NZPA 1MIVA 4ASKA 3EAMA 3LC0A 2X66A 1RIQA 2JQHA 4X64T 1IJ5A 3GN5A 2PG8A 4GK0E 4AXPA 3QNEA 2LHRA 4QX8B 1M62A 4YT0A 2XQ9A 5JDGA 3L8RA 4IE7A 2CLYB 4H9QC 4LF5T 5ETWA 3N9NA 4RQFA 2JMKA 2FJEA 4H2YA 3I7FA 1Z8UA 3MK7C 1ATIA 4XTYA 3FZHB 3PZCA 3E9HA 2BVMA 3BQLA 4KX6A 1IBLT 3FJPA 2LM2A 4O2BE 3AEFA 3RRCA 4TVAB 5LG4A 3SS1A 4ISSA 3LJCA 1NJ5A 4WW0A 4AKRB 4YCVA 1G5IA 1SUMB 4ZOLE 4EZHA 4I55E 4X5TA 2NW7A 2BKNA 4YRTA 4CN1A 5CJ5A 2YINA 2BS4A 3AE6A 4LMJA 1H4SA 2V7MA 4UELA 3WQZA 3GWHA 1UCUA 4YRNA 2VKDA 2WAUA 3ONXA 1SA0E 3P4PA 3X1DA 4GKJT 3Q5DA 2DZCA 2DCFA 2QHUA 3L2ZA 2ZT7A 4LF6T 4LF9T 2E5VA 4U7YA 2ARUA 2ZM6T 4U3CA 1QF6A 4G63A 1G73A 2ZINA 2BVLA 3P4SA 3M65A 4TN7B 4COFA 4O4IE 2ODVA 3Q2MA 3CKDA 5AQGB 3QO7A 1HCIA 5L47A 2C8MA 3UUXB 3H37A 4EZ4A 4B3RT 4K87A 3PUSA 3EVYA 3KV6A 3UFGA 4P71A 5LOVE 2DQ0A 3DP7A 4YDQA 3OKQA 2XM1A 3N5LA 1ZEEA 1KMMA 2JQKA 2ZM8A 4G2AA 3SOLA 2NWBA 4AKIA 4HGAA 5EK3A 2E65A 3ANWB 2J62A 3RC3A 3UUNA 5ELOA 3MKDA 1IBMT 2AMCA 2I4NA 3AA1B 3CQCB 2UXXB 4DVDA 1ZHCA 3ZSSA 4CXYA 3H3MA 4OP0A 3G06A 5FMNA 2VWAA 2M6IA 5HCMA 1KF6A 3CMLA 5LNKA 4H9RC 1G8XA 4H63H 4JI2T 3HR0A 3N2OA 3I9YA 4ZTZB 4C91A 4X62T 2Y48B 4IREA 4P09A 3ZYLA 2RHSA 5JR9B 2ZZFA 3AB3B 1B7YB 4YRPA 4HWHA 5LHHB 4OK0A 1IL2A 4I0UA 1US7B 3OVUA 3WAJA 3N2GE 5FVKA 2Q7EA 2CPTA 4IE0A 2LE8A 3BK9A 3FB2A 1D1AA 3FBLA 3DSQA 3PURA 4LFBT 4XAXB 5JQGE 3VHLA 3OJAA 3LSVA 3K1SA 5HEHA 2Q9QD 2D5UA 2IMLA 1V9DA 4IE4A 3PCOA 1WNLA 4N78D 5JDMA 3UU3A 2VVSA 3K3OA 1L0VA 4JI4T 3LK42 2EJ9A 4JLEA 2IIUA 2D0UA 2CEAA 5HXEA 4U74A 3HTZA 5AQPB 5FNVE 2LSGA 2BKPA 4BWAA 2DHRA 4HEAA 3WAKA 1VCTA 4Z90A 4BW9A 3OYZA 3ZJ2A 1D0YA 2ZM0A 3ESLA 2KXPB 1E22A 5F3JA 5ABFA 3CQGB 4ANJA 1T8BA 4XTWA 3TEHA 2IY5A 4LF8T 4PNIA 1NNHA 5FVLA 5FYMA 3HXZA 3PUWF 4TX5A 4BJNA 1FMVA 2KSRA 5ABGA 1WLXA 3UU5A 1PYSA 2C7IA 4M1PA 2EHOD 5LBMA 4PFPA 5KX5E 2BS2A 4MALA 2XTIA 2XAHB 1D1BA 5DJQC 2XQ5A 4NCXA 1SETA 3N2KE 2ZIMA 3AE2A 2QA7A 1YD8G 1G5HA 5AQVB 4DUZT 1T7SA 1UX4A 4L9IA 2ACZA 3MF2A 4EV6A 4JUYA 4I43B 2L9QA 5JDHA 3RIUA 1NAFA 4DBQA 4JI3T 1N36T 3AECA 3HL6A 4UIGA 1SESA 1YQ3A 2LJLA 3I0QA 3RIAA 3BQKA 3I1AA 3HKCE 4JBWF 2J3MA 3FHNA 2BZBA 1BIAA 2IDOB 2YU1A 2VL8A 3FZFB 2LSKA 3RKWA 1L0WA 3EDUA 2CCQA 1KFYA 1YXRA 2WWUA 3U78A 4UF0A 4CXWA 4CH4A 1U4QA 3FZLB 1HXDA 2VK9A 1X01A 4E7SA 5LB7B 1XZYA 4ZZCA 2F4VT 2DTIA 3ZCJA 4UR9A 3H3AA 2Q9QB 3ZLIA 2X9YA 4EXTA 1LKXA 3KVAA 4HWPA 1XMOT 4P3PA 2NTYA 5HXRA 1FEWA 3B57A 2E9XD 2RHQB 5JTGA 2HHHT 2AMCB 5AQIB 2D0TA 3EFSA 2W67A 4HT4A 5JDQA 1VCSA 2DDZA 4H2WA 5DABA 3KFWX 2VQFT 3KV9A 5FXWA 1N33T 2OA5A 5AQKB 1W0BA 1Z7MA 4LVMA 2RA1A 4Z91A 5L3EB 3L1AA 3PU8A 3NRXA 1KK7A 2E1HA 4TUYE 3IG2A 4TV8E 3F57A 2RHSB 2QGSA 5H6RB 1KNRA 3O4XE 4OYKA 2LSIA 2CHOA 1B7TA 4P72A 2A2FX 5GONE 1KOGA 2ALYA 2X0YA 2ZXFA 2DJZA 4H9PC 3UU6A 2EHOB 3ETUA 2NW9A 4L87A 3UU8A 1FMWA 5M4YA 1BR0A 3BFMA 3C50A 4H63V 5JDNA 2VQET 4YTPA 3ERRA 4TWHA 5HWYA 4BA9A 2KWIB 2UUBT 4UV9B 3O1JA 2V6YB 4P74A 3EUHA 5HAXA 1XDPA 3K3NA 4ZI3D 4AKGA 3PUZF 2ZNJA 4LVJA 2YOEA 3LFMA 5L3FB 2K3WA 3ZMVB 2BDEA 3MXZA 1N9WA 2V26A 4QH4A 1B8AA 3CQXC 3Q5WA 5AQLB 3ANWA 2LEHA 3AEDA 1UX5A 3LK3B 5FXXA 4PFOA 2MAWA 1N34T 3RKOA 2XAGB 1Y64B 3TLSA 2E9XC 1WLEA 1XNRT 4IT4A 4X5OA 5ABFB 3MA9A 5JREA 2IY5B 4YHJA 4XTUA 4DV2T 2ZMAA 1HG2A 3RI5A 2W66A 4FI5A 2YEVC 4YRGA 4YRCA 5AQUB 5LCYA 4LVIA 2CIMA 4HA8A 3RLFF 5FL1A 5CB4E 2JJ9A 2VURA 3P4WA 1NWMX 4YJ3E 3VQXA 1PYSB 1B7YA 4Q6GA 3IKMB 1NJ6A 3T8OA 5E3IA 3TLVA 1KMNA 3LSQA 5HYAA 3HKDE 4HWSA 3ONLC 1E24A 4PHCA 2V7LA 4RDXA 5IUXA 2UUCT 2X9HA 4H9NC 4QWNB 4AKHA 4JI0T 3VR8A 3LDQB 3AVSA 1HC7A 2V5CA 3B13A 2YDQA 5LGNB 1YW0A 1T98A 1WRDA 4QKNA 2W0GA 4QXBB 4CQIA 1I94T 2XQYA 3RC8A 1HTJF 4TWAA 3A5XA 1X55A 3IHRA 1U5PA 2FJAA 2H3RA 3IALA 4CN4A 4DPGA 3Q5XA 4Z8XA 4AKLA 2BS3A 2XGTA 4UXNB 3CX8B 2W62A 4UF0B 2P0LA 2XY8B 2OV9A 1X2HA 1YKEB 3RKXA 1MMAA 1WQ7A 3M4QA 1J5WA 11ASA 5BR8T 2CLYC 1HTTA 4UVAB 4YRMA 1LVKA 1HR0T 3VR9A 4LVLA 4H2VA 2M67A 4P73A 3ABVA 1UUSA 5AQOB 4HFHA 1D0ZA 5HEOA 3ZSTA 2CWOA 4U2YA 4DR2T 2XQ8A 1MNDA 2PTFA 4U2ZA 5L3DB 1SRYA 3HXVA 2XJ7A 3D0TA 2HN2A 1B70A 4NUVA 4TWDA 3CWZB 3W15B 2CE7A 3RIFA 4XBFB 2H7OA 2K48A 4C90A 3LSSA 3V7RA 4TVWA 3QOFA 3PUQA 1UURA 1HX8A 4CN6A 2Q7HA 3J9X1 2WZIA 3ZT5A 3SRZA 3OTOT 3HRIA 1G51A 4H9SE 3QC9A 1QE0A 3ZJ1A 5LJMA
chains in the Genus database with same CATH topology
2ALYB 1ADJA 3PCOA 1X2GA 1WNLA 4XTXA 1NJ2A 2DU5A 2DVEA 4CH5A 2EJ9A 3UGQA 3IKLA 3HTZA 1USYC 4P75A 2EAYA 1BIBA 2ZR3A 3A74A 5ELNA 4BWAA 4YCWA 4BW9A 3HFZA 4TQDA 3P8VA 1H4QA 3MF1A 4TVAA 4HVCA 4Q15A 2ARTA 2E41A 1EIYA 1E22A 3V7CA 2DU7A 4ZIBA 4EO4A 3QTCA 4XTWA 3TEHA 2IY5A 4G85A 4J15A 2QHVA 3A32A 1NNHA 4H2TA 1WU7A 3HXZA 3NETA 4WJ4A 4XEOA 3RKYA 4E51A 4XU0A 2DEQA 2J3LA 3RUXA 1WPYA 2RHQA 4TTVA 1H4TA 2DKGA 1PYSA 2C7IA 4YRJA 1E1OA 3BJUA 4H2SA 1GGMA 2XTIA 4YRFA 1JJCA 1E1TA 4HWOA 4NCXA 1YFSA 1X56A 1SETA 2ZIMA 1VQZA 1G5HA 3RIRA 3RACA 3A5YA 3P8TA 4XEMA 3HXWA 4P75C 3MF2A 1USYA 2CJBA 5C52B 3HY1A 3QO5A 2AKWA 3NELA 4YP0A 4YRRA 1SESA 3PCOB 4YRIA 3MEYA 1NJ8A 2EJGA 1YB3A 3A5ZA 4G84A 1WYDA 2I4MA 3L4GA 2J3MA 1C0AA 2Q5HA 1BIAA 3HY0A 3NEMA 4YROA 2ZZEA 3RKWA 2G4CA 1L0WA 3CMQA 4CH3A 3P8YA 3HFZB 3UGTA 4CH4A 1BBWA 2E5AA 1HXDA 1X01A 4P72C 3RL6A 4UP9A 4WJ3M 2DQ3A 2DTIA 4UP8A 4YRKA 1X54A 3TEHB 5HGQA 4HWPA 4P3PA 3HRKA 4YPFA 2EJFA 4XTVA 4P74C 2ZTGA 2RHQB 4H2UA 3G1ZA 2AMCB 1Z7NA 4KQEA 4XU2A 3EFSA 2ZT5A 4HT4A 1SERA 3ICAA 1NYQA 2E3CA 2ZIOA 3A7RA 2DDZA 4LNSA 4H2WA 4K86A 4KR3A 1JJCB 4O2DA 3W3SA 2I4LA 3A31A 4HWRA 4CH6A 4YREA 1EFWA 1Z7MA 3V8LA 4LVMA 1YFTA 3HXXA 3V7SA 3UH0A 2CJAA 2DZ9A 1NJ1A 3L1AA 3V8KA 2QHSA 1YGBA 3RF1A 2E1HA 2AKWB 3REXA 3OD1A 2ZZGA 3IG2A 1ASYA 2RHSB 3VQWA 4H2XB 2EWNA 4DQ2A 4K88A 4YRQA 4RMFA 1LYLA 2ODRC 4P72A 1KOGA 2ALYA 2ZNIA 2ZXFA 2DTHA 2DJZA 1B70B 2EL9A 3QO8A 12ASA 2A8EA 1EOVA 4L87A 4YRSA 2ZR2A 2Q7GA 3BFMA 1FYFA 3ERRA 2Q5IA 3LC0A 4AH6A 2ODRD 1RIQA 3HFVA 4P74A 1EQRA 4EX5A 3QNEA 4CS3A 2ZNJA 4CS4A 4LVJA 5C53B 4PG3A 4ZTUB 2ZT8A 3TEGA 2DXUA 1ASZA 3HXUA 4XU3A 1N9WA 5K1XA 4RQFA 1B76A 3VBBA 4H2YA 1B8AA 3MQZA 3I7FA 4YYEA 1WQWA 1ATIA 4XTYA 3PZCA 3E9HA 2CGHA 3FJPA 2PMEA 2ZCEA 3EFRA 5K1PA 4TVAB 1EIYB 4P71C 4LVKA 1WLEA 4X5OA 4TQFA 5KNNA 1NJ5A 4YCVA 4KR2A 1G5IA 3R07A 2IY5B 4XTUA 5F5WA 2CJ9A 4YRTA 4XU1A 4YRGA 4YRCA 4RQEA 1H4SA 3WQZA 4LVIA 2CIMA 4HA8A 3A7UA 4YRNA 3VQYA 3VQXA 1PYSB 2QHTA 1B7YA 4Q6GA 3IKMB 1NJ6A 2DZCA 5E3IA 1KMNA 2QHUA 3LSQA 3L2ZA 2ZT7A 3NENA 4HWSA 1E24A 4PHCA 2ARUA 4RDXA 2HNIA 2FYKA 1QF6A 4YRLA 4P73C 1EVLA 2ZINA 1HC7A 3M4PA 3HXYA 2P5IA 4WF2A 2DTOA 1ADYA 3QO7A 2ZT6A 2C8MA 3RGLA 4K87A 4OLFA 2E10A 4TWAA 3UFGA 4P71A 1X55A 2DQ0A 4YDQA 3L4GB 1KMMA 3IALA 3V8JA 4DPGA 2E64A 2E65A 2XGTA 2NS6A 4P3NA 5ELOA 4TVYA 2AMCA 2P0LA 2I4NA 5C51B 1X2HA 3E9IA 3RKXA 4WI1A 1WQ7A 1EVKA 3M4QA 4OP0A 1J5WA 4H02A 11ASA 1HTTA 4YRMA 4P3OA 4UP7A 2ARSA 4LVLA 4H2VA 4P73A 3A7AA 4ZTZB 2I4OA 4CS2A 3REUA 2PMFA 2RHSA 4H2XA 2ZZFA 1B7YB 4YRPA 4YCUA 1IL2A 3TUPA 1SRYA 3KFUA 3HXVA 2Q7EA 4HWTA 1B70A 2ZGWA 4UPAA 1BBUA 3DSQA 1YFRA 3LSSA 3V7RA 1H4VB 4TVWA 1W66A 2Q7HA 2DXTA 3HRIA 1G51A 1NYRA 1QE0A 4XTZA 3VQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALY B;  1ADJ A;  3PCO A;  1X2G A;  1WNL A;  4XTX A;  1NJ2 A;  2DU5 A;  2DVE A;  4CH5 A;  2EJ9 A;  3UGQ A;  3IKL A;  3HTZ A;  1USY C;  4P75 A;  2EAY A;  1BIB A;  2ZR3 A;  3A74 A;  5ELN A;  4BWA A;  4YCW A;  4BW9 A;  3HFZ A;  4TQD A;  3P8V A;  1H4Q A;  3MF1 A;  4TVA A;  4HVC A;  4Q15 A;  2ART A;  2E41 A;  1EIY A;  1E22 A;  3V7C A;  2DU7 A;  4ZIB A;  4EO4 A;  3QTC A;  4XTW A;  3TEH A;  2IY5 A;  4G85 A;  4J15 A;  2QHV A;  3A32 A;  1NNH A;  4H2T A;  1WU7 A;  3HXZ A;  3NET A;  4WJ4 A;  4XEO A;  3RKY A;  4E51 A;  4XU0 A;  2DEQ A;  2J3L A;  3RUX A;  1WPY A;  2RHQ A;  4TTV A;  1H4T A;  2DKG A;  1PYS A;  2C7I A;  4YRJ A;  1E1O A;  3BJU A;  4H2S A;  1GGM A;  2XTI A;  4YRF A;  1JJC A;  1E1T A;  4HWO A;  4NCX A;  1YFS A;  1X56 A;  1SET A;  2ZIM A;  1VQZ A;  1G5H A;  3RIR A;  3RAC A;  3A5Y A;  3P8T A;  4XEM A;  3HXW A;  4P75 C;  3MF2 A;  1USY A;  2CJB A;  5C52 B;  3HY1 A;  3QO5 A;  2AKW A;  3NEL A;  4YP0 A;  4YRR A;  1SES A;  3PCO B;  4YRI A;  3MEY A;  1NJ8 A;  2EJG A;  1YB3 A;  3A5Z A;  4G84 A;  1WYD A;  2I4M A;  3L4G A;  2J3M A;  1C0A A;  2Q5H A;  1BIA A;  3HY0 A;  3NEM A;  4YRO A;  2ZZE A;  3RKW A;  2G4C A;  1L0W A;  3CMQ A;  4CH3 A;  3P8Y A;  3HFZ B;  3UGT A;  4CH4 A;  1BBW A;  2E5A A;  1HXD A;  1X01 A;  4P72 C;  3RL6 A;  4UP9 A;  4WJ3 M;  2DQ3 A;  2DTI A;  4UP8 A;  4YRK A;  1X54 A;  3TEH B;  5HGQ A;  4HWP A;  4P3P A;  3HRK A;  4YPF A;  2EJF A;  4XTV A;  4P74 C;  2ZTG A;  2RHQ B;  4H2U A;  3G1Z A;  2AMC B;  1Z7N A;  4KQE A;  4XU2 A;  3EFS A;  2ZT5 A;  1SER A;  3ICA A;  1NYQ A;  2E3C A;  2ZIO A;  3A7R A;  2DDZ A;  4LNS A;  4H2W A;  4K86 A;  4KR3 A;  1JJC B;  4O2D A;  3W3S A;  2I4L A;  3A31 A;  4HWR A;  4CH6 A;  4YRE A;  1EFW A;  1Z7M A;  3V8L A;  1YFT A;  3HXX A;  3V7S A;  3UH0 A;  2CJA A;  2DZ9 A;  1NJ1 A;  3L1A A;  3V8K A;  2QHS A;  1YGB A;  3RF1 A;  2E1H A;  2AKW B;  3REX A;  3OD1 A;  2ZZG A;  3IG2 A;  1ASY A;  2RHS B;  3VQW A;  4H2X B;  2EWN A;  4DQ2 A;  4K88 A;  4YRQ A;  4RMF A;  1LYL A;  2ODR C;  4P72 A;  1KOG A;  2ALY A;  2ZNI A;  2ZXF A;  2DTH A;  2DJZ A;  1B70 B;  2EL9 A;  3QO8 A;  12AS A;  1EOV A;  4L87 A;  4YRS A;  2ZR2 A;  2Q7G A;  3BFM A;  1FYF A;  3ERR A;  2Q5I A;  3LC0 A;  4AH6 A;  2ODR D;  1RIQ A;  3HFV A;  4P74 A;  1EQR A;  4EX5 A;  3QNE A;  4CS3 A;  2ZNJ A;  4CS4 A;  5C53 B;  4PG3 A;  4ZTU B;  2ZT8 A;  3TEG A;  2DXU A;  1ASZ A;  3HXU A;  4XU3 A;  1N9W A;  5K1X A;  4RQF A;  1B76 A;  3VBB A;  4H2Y A;  1B8A A;  3I7F A;  4YYE A;  1WQW A;  1ATI A;  4XTY A;  3PZC A;  3E9H A;  2CGH A;  3FJP A;  2PME A;  2ZCE A;  3EFR A;  5K1P A;  4TVA B;  1EIY B;  4P71 C;  1WLE A;  4X5O A;  4TQF A;  5KNN A;  1NJ5 A;  4YCV A;  4KR2 A;  1G5I A;  3R07 A;  2IY5 B;  4XTU A;  5F5W A;  2CJ9 A;  4YRT A;  4XU1 A;  4YRG A;  4YRC A;  4RQE A;  1H4S A;  3WQZ A;  2CIM A;  4HA8 A;  3A7U A;  4YRN A;  3VQY A;  3VQX A;  1PYS B;  2QHT A;  1B7Y A;  4Q6G A;  3IKM B;  1NJ6 A;  2DZC A;  5E3I A;  1KMN A;  2QHU A;  3LSQ A;  3L2Z A;  2ZT7 A;  3NEN A;  4HWS A;  1E24 A;  4PHC A;  2ARU A;  4RDX A;  2HNI A;  2FYK A;  1QF6 A;  4YRL A;  4P73 C;  1EVL A;  2ZIN A;  1HC7 A;  3M4P A;  3HXY A;  2P5I A;  4WF2 A;  2DTO A;  1ADY A;  3QO7 A;  2ZT6 A;  2C8M A;  3RGL A;  4K87 A;  4OLF A;  2E10 A;  4TWA A;  3UFG A;  4P71 A;  1X55 A;  2DQ0 A;  4YDQ A;  3L4G B;  1KMM A;  3IAL A;  3V8J A;  4DPG A;  2E64 A;  2E65 A;  2XGT A;  4P3N A;  5ELO A;  4TVY A;  2AMC A;  2P0L A;  2I4N A;  5C51 B;  1X2H A;  3E9I A;  3RKX A;  4WI1 A;  1WQ7 A;  1EVK A;  3M4Q A;  4OP0 A;  1J5W A;  4H02 A;  11AS A;  1HTT A;  4YRM A;  4P3O A;  4UP7 A;  2ARS A;  4H2V A;  4P73 A;  3A7A A;  4ZTZ B;  2I4O A;  4CS2 A;  3REU A;  2PMF A;  2RHS A;  4H2X A;  2ZZF A;  1B7Y B;  4YRP A;  4YCU A;  1IL2 A;  3TUP A;  1SRY A;  3KFU A;  3HXV A;  2Q7E A;  4HWT A;  1B70 A;  2ZGW A;  4UPA A;  1BBU A;  3DSQ A;  1YFR A;  3LSS A;  3V7R A;  1H4V B;  4TVW A;  1W66 A;  2Q7H A;  2DXT A;  3HRI A;  1G51 A;  1NYR A;  1QE0 A;  4XTZ A;  3VQV A; 
#chains in the Genus database with same CATH topology
 4LFA T;  2ALY B;  3L39 A;  3IEE A;  2DU5 A;  4OYJ A;  4EAH A;  2JQQ A;  4UEM A;  3AA6 B;  5KDM C;  1LVF A;  2KMF A;  2YU2 A;  5J1G A;  1E1H B;  1USY C;  1BIB A;  3A74 A;  4EOZ B;  2PBI A;  1QUU A;  3FXD B;  2OLT A;  1GQE A;  4YHH T;  4WBN E;  2B76 A;  5IWA T;  5L3C B;  4YCW A;  3GMI A;  3C4X A;  5FP3 A;  3Q9D A;  4MLK A;  4EIW A;  2E41 A;  3MJX A;  1EIY A;  1JNR A;  3RYC E;  4EO4 A;  4IDQ A;  1H7C A;  4G85 A;  4J15 A;  2D9D A;  2QHV A;  2Q9Q A;  4NIQ A;  4B3T T;  3NWI A;  3A32 A;  4H2T A;  4WJ4 A;  5DQW A;  5LBQ B;  3AA7 B;  4E51 A;  4YTM A;  3ZN1 B;  2DEQ A;  2DLR A;  1OED C;  2BKO A;  1WR6 A;  3ZPO A;  1HX1 B;  2RHQ A;  3OBV E;  4U7I A;  4TTV A;  2HN1 A;  2HPL A;  2A9U A;  3T1H T;  3O1I A;  4X65 T;  5EK4 A;  4YRF A;  2NW8 A;  4B6X A;  3RAC A;  2J47 A;  3A5Y A;  3P8T A;  3QB5 K;  2ACX A;  4XEM A;  3OYX A;  4P75 C;  4F6R C;  5LGU B;  4B3M T;  2CJB A;  3CVR A;  4V1A v;  2A3D A;  4AQG A;  4MHC A;  4YP0 A;  5HEU A;  4WBO A;  4YRR A;  5JDL A;  2H7V C;  4DR7 T;  4XZC A;  1AJ3 A;  1YB3 A;  2EJG A;  4X1K E;  1WYD A;  4HWC A;  2I4M A;  2EHO A;  2YDR A;  4IDP A;  2Q5H A;  4AQF C;  1FIO A;  3HY0 A;  3NEM A;  4YRO A;  5AQJ B;  2CM0 A;  3RH3 A;  2G4C A;  3QB5 A;  3WI3 A;  2QYW A;  3CMQ A;  2AXD S;  3HFZ B;  3P8Y A;  5CGM A;  3AE3 A;  2V6Y A;  3UUM A;  3SFD A;  2CHN A;  4TWF A;  4LMK A;  2E5A A;  2UXB T;  1S94 A;  4WJ3 M;  4X1I E;  2JQ9 A;  4JEH B;  2XUE A;  4YRK A;  4HWD A;  4A97 A;  5HGQ A;  2YKS A;  1E7P A;  4IDN A;  3JAD A;  4EB6 E;  3N9L A;  4KMC A;  2ZTG A;  2X51 A;  3AXJ A;  2NP9 A;  2JRK A;  2E3C A;  4CI3 B;  5AFU L;  4QH1 A;  1X79 A;  1JJC B;  3ZYK A;  2I4L A;  3A31 A;  1EFW A;  4O2A E;  5C8Y E;  4DR5 T;  2CJA A;  2LKH A;  5BMV E;  3V8K A;  2QHS A;  2KND A;  1YGB A;  2MOZ A;  2XQ6 A;  4KUM B;  2AKW B;  4FJO A;  3REX A;  5FY0 A;  3VQW A;  1MIY A;  4YRQ A;  2WY2 A;  5LJN A;  5FXZ A;  4RMF A;  1LYL A;  2XAF B;  4LFC T;  2ODR C;  3VRB A;  1D1C A;  2E9X A;  3QNU A;  2BG9 C;  2DTH A;  3TLT A;  1B70 B;  12AS A;  3K8P C;  1MMN A;  2A8E A;  4HWI B;  4U31 A;  2Q7G A;  4HFD A;  5HXS A;  3P4R A;  3HA4 A;  5LMU T;  3N9O A;  4AH6 A;  1J5E T;  5LHG B;  3HFV A;  1EQR A;  4HN9 A;  3KV5 A;  4EX5 A;  3VKH A;  4CS3 A;  1IJ6 A;  1J1J A;  3HKB E;  5FY7 A;  2VKH A;  2CBJ A;  1LRZ A;  2FBW A;  4ZTU B;  4DV7 T;  1OWA A;  1ASZ A;  2X0H A;  4U33 A;  4XU3 A;  4UV8 B;  4YLH A;  5JRC B;  4ILB A;  3PU3 A;  1N32 T;  3L3P A;  2WB5 A;  3AEB A;  3QK6 A;  2MYS A;  4NXN T;  3AE4 A;  1WQW A;  1HNZ T;  5C3J A;  2WU5 A;  2WQY A;  3PE0 A;  3S4U A;  2ZCE A;  2CA5 A;  3IA3 A;  5A1L A;  4DND A;  2WMO A;  1EIY B;  4P71 C;  4LVK A;  2UUA T;  3AAA B;  2DL1 A;  1WYB A;  2DI4 A;  4KR2 A;  4A56 A;  2LLY A;  3AE7 A;  4KHZ F;  5F5W A;  2CJ9 A;  5L3G B;  1WCR A;  3PTR B;  3LBX B;  4XU1 A;  1E2A A;  4A5X A;  3PJA J;  3OPC A;  3VKG A;  4RQE A;  2MTQ A;  2PFV A;  3AAE B;  4KP3 C;  2QHT A;  2KIN B;  5L3B B;  4AI6 A;  4JI7 T;  4YJ2 E;  4JI1 T;  4PJN A;  4DV0 T;  3EHZ A;  3NEN A;  5FKY A;  2UXD T;  4HFI A;  3ZYM A;  1KNZ A;  2NR4 A;  2HNI A;  4HE8 A;  4QXC B;  3N9P A;  1EVL A;  3ZC0 A;  3CX6 B;  3M4P A;  2BBJ A;  3HXY A;  2JIW A;  2VKO A;  3NKZ A;  1Y01 A;  4ADZ A;  4DMV A;  2ZT6 A;  4F8H A;  2XSB A;  3V5U A;  2KT9 A;  3RGL A;  4OLF A;  4PJJ A;  2E10 A;  1HF8 A;  2IAK A;  2I59 A;  2LKG A;  4ZZB A;  2AE9 A;  4I4T E;  2J4G A;  2E64 A;  4HFB A;  4P3N A;  4IIJ E;  2LOS A;  4X20 E;  4UVB B;  4PK5 A;  2SPC A;  5C51 B;  3E9I A;  3KBU A;  2GK9 A;  3NRY A;  2WM9 A;  3K3Q C;  1MMD A;  2A72 A;  5L4E A;  1NEN A;  3TKL B;  1IAP A;  2V7J A;  3RYF E;  2Y8D A;  3RQW A;  3I0O A;  4P3O A;  4UP7 A;  4B3S T;  2ZM2 A;  4LML A;  1NEK A;  4KHP T;  1W09 A;  4GOU A;  2C5I T;  3A7A A;  5FY1 A;  2KWH A;  2NOX A;  3AXJ B;  4YCU A;  4EED A;  3TUP A;  4IE6 A;  3KFU A;  3PUX F;  2ZGW A;  4JEU B;  2JMH A;  3KVB A;  3KIN B;  4UPA A;  2L8K A;  1BBU A;  2PJQ A;  1H4V B;  3FZK B;  3C98 B;  4HFE A;  5IHY A;  1W66 A;  4OHF A;  4UVC B;  1OED A;  2DXT A;  2XSA A;  3UT5 E;  1NYR A;  5IYZ E;  2G0U A;  4EYY R;  1QSD A;  2LT3 A;  4GK5 E;  1UGO A;  2E9X B;  3VQV A;  4GYR A;  1ADJ A;  2WP9 A;  4CI1 B;  4XTX A;  4O4L E;  1NJ2 A;  4DID B;  3NZQ A;  3L09 A;  4EEB A;  4ZEY A;  1HFA A;  2X67 A;  4YTN A;  5FXV A;  3ZCI A;  1ZV4 X;  1XNQ T;  4P75 A;  3EDV A;  2EAY A;  2ODU A;  3IBP A;  2V5D A;  1OED E;  1XWM A;  4L0R A;  3UUL A;  3HFZ A;  4HFC A;  4DMW A;  3P8V A;  2WMN A;  4HVC A;  4Q15 A;  2ART A;  3V7C A;  4HWF A;  5ABE A;  4TV9 E;  3QTC A;  2XPK A;  3FZM B;  1O3X A;  4AQF A;  2W4X A;  4H9O C;  4XEO A;  3RKY A;  3ZC1 A;  2XAQ B;  4P0A A;  2J3L A;  3ZEF B;  3FXE B;  1H4T A;  5F8P A;  3AVR A;  4YRJ A;  4AIS A;  2W63 A;  1E1O A;  4H2S A;  1GGM A;  1JJC A;  1E1T A;  3RYI E;  3PUA A;  2WSS V;  5HXC A;  2WZH A;  3RIR A;  3O9X A;  2UXC T;  5TAO A;  4YSY A;  3PV0 F;  3HY1 A;  2P9B A;  2AKW A;  3NEL A;  2WS3 A;  3RYH E;  3P4Q A;  3A8Y C;  2X68 A;  4TNV A;  5LHI B;  4DBR A;  4JI8 T;  2V1D B;  1EZ3 A;  4JI6 T;  4X1Y E;  4ZI7 E;  3A5Z A;  4O4J E;  4G84 A;  2MPK A;  3L4G A;  1C0A A;  3P8C D;  2CRB A;  3VU7 H;  5AQR B;  4WYV A;  5EK2 A;  5CA1 E;  1WR0 A;  4ZS2 A;  1FJG T;  3RKG A;  3DJB A;  4CH3 A;  3UGT A;  2L3L A;  1ZOY A;  4DV6 T;  1BBW A;  5FL0 A;  3P50 A;  4P72 C;  1M7K A;  3RL6 A;  2DQ3 A;  2VVN A;  2CWY A;  2BG9 A;  1X54 A;  3P7I A;  2WBL A;  4O4H E;  4GIW A;  4BAY B;  5AQF B;  5AQQ B;  5LMN T;  5JRC A;  3HRK A;  5ABH A;  5J2U E;  4YPF A;  4OFZ A;  2LHN A;  3RPU A;  4K0U A;  4P74 C;  2I6H A;  4H2U A;  3RHW A;  3G1Z A;  2IW5 B;  1S35 A;  4LF4 T;  4KQE A;  4XU2 A;  2XQ4 A;  3ICA A;  2RPA A;  1KEY A;  5HCJ A;  2RP4 A;  3ETV A;  2FJD A;  4KR3 A;  3Q5E A;  4ZI2 C;  1W9R A;  1HG5 A;  2XTL A;  4O2D A;  3W3S A;  2BG9 E;  2C5K T;  4HWR A;  4CH6 A;  2K5B B;  4IGU A;  3TLU A;  2K9A A;  2K24 A;  3HXX A;  1IBK T;  3JAE A;  2R6G F;  1WFD A;  4U72 A;  3UH0 A;  3ZMZ B;  4YFS A;  3EI0 A;  5LP6 E;  1NJ1 A;  5L2L A;  3JC6 D;  1KNP A;  3LBX A;  2WU2 A;  4EGW A;  3B5M A;  2EWN A;  3JCF A;  2X9X A;  4DQ2 A;  4K88 A;  4WNK A;  3MAC A;  4Q25 A;  2ZNI A;  4DR4 T;  2EL9 A;  3KBT A;  4YRS A;  2ZR2 A;  3KV4 A;  5E0O A;  1FYF A;  3SFE A;  1DU2 A;  5H6Q B;  2XQA A;  3V5S A;  1OED B;  2Z6E A;  2ODR D;  1I6Z A;  2C0S A;  3VRA A;  4ILC A;  4HKA A;  5JR9 C;  1WYC A;  1ZP0 A;  3FBZ A;  4TNW A;  4IHJ E;  2DWK A;  3ZMU B;  4CS4 A;  4CI2 B;  5C53 B;  4PG3 A;  2KZ7 B;  2ZT8 A;  3TEG A;  2DXU A;  4AQY T;  3HXU A;  3DTO A;  5K1X A;  1B76 A;  2WDR A;  3AE9 A;  3VBB A;  3MQZ A;  4YYE A;  1Z0P A;  3HKE E;  2FJB A;  4IDO A;  4BJM A;  2N1G A;  2CGH A;  3JAF A;  3AAI A;  2B1E A;  3UQ7 A;  2PME A;  2IC9 A;  2VB6 A;  3EFR A;  5K1P A;  1D0X A;  4QX7 B;  3MZK B;  1VOM A;  3ZMT B;  4TQF A;  5KNN A;  2LRL A;  5AQT B;  4ZS3 A;  5JH7 E;  4DV5 T;  3R07 A;  2HH7 A;  3ONJ A;  3AEA A;  1MIW A;  5HEG A;  5EZY E;  3E22 E;  3A7U A;  1T72 A;  3U3I A;  3VQY A;  4ILA A;  4X66 T;  3JC6 C;  2HPJ A;  4IL9 A;  3PUG A;  1SHZ C;  4ERR A;  2V7I A;  4J2C A;  3AE1 A;  2FYK A;  4A98 A;  4YRL A;  4P73 C;  1HS7 A;  3GN5 B;  3UTK A;  5CA0 E;  2P5I A;  4WF2 A;  4LF7 T;  2DTO A;  4GKK T;  5J0Z A;  3PUV F;  4DUY T;  2LM9 A;  5JDF A;  1ADY A;  1BR1 A;  3SWH A;  3KDS E;  3R84 B;  2ZLY A;  2QRX A;  2FUP A;  2WDV A;  3NBX X;  4QH5 A;  3C51 A;  5HWX A;  3L4G B;  1YKH B;  2XHE B;  2W2U A;  3V8J A;  1MNE A;  2WCA A;  2LSY A;  3ZKR A;  1OXZ A;  2NS6 A;  2QVA A;  4TVY A;  5CFB A;  4DR1 T;  1XDO A;  3BQI A;  4WI1 A;  2I0M A;  3AE5 A;  1EVK A;  4NXM T;  2UU9 T;  4MBQ A;  4H02 A;  5HXH A;  2BG9 B;  3AA0 B;  3F31 A;  5AQH B;  3UU4 A;  2LSJ A;  5KMG P;  4YXD A;  2ARS A;  2WWV A;  3EAB A;  3R6N A;  3IF8 B;  4PK4 A;  2CXL A;  2I4O A;  4CS2 A;  3REU A;  2PMF A;  4EYU A;  4H2X A;  3UQ4 A;  2VAS A;  5C2T A;  3UUB A;  2VKJ A;  3E08 A;  3RQU A;  4HWT A;  5DQV A;  3N9M A;  4K0K T;  2Q9Q C;  3ZMS B;  3A7M A;  2XM2 A;  2IC6 A;  1YFR A;  3T1Y T;  4P1N A;  2XQ7 A;  3LG7 A;  5LG3 A;  4QHO A;  2E2A A;  2E8I A;  2XAS B;  3C4W A;  2J1D G;  4XTZ A;  5JVD E;  2XZE A;  1SE7 A;  1X2G A;  5HEJ A;  4HTE A;  2DVE A;  2LRK A;  4PAG A;  4CH5 A;  3CPZ A;  3UGQ A;  3IKL A;  1JNZ A;  4JYA T;  3AE8 A;  2NTX A;  2ZR3 A;  2MBG A;  3F2E A;  2E5L T;  3AEE A;  4AIU A;  5ELN A;  2YN6 A;  3TLW A;  4CZZ B;  4TQD A;  2IHR 1;  2H88 A;  2X0L B;  5AQM B;  2ES0 A;  1H4Q A;  3MF1 A;  4TVA A;  4NPP A;  4TZ4 C;  3M3Z B;  1BR2 A;  2DU7 A;  1R8I A;  2LOP A;  4ZIB A;  1XMQ T;  2EHO C;  4PW8 A;  3N9Q A;  4IE5 A;  4YY3 T;  1HNW T;  4ILU A;  3QUJ A;  1WU7 A;  3NET A;  2H89 A;  4IL4 A;  4XU0 A;  2Y6X A;  3RUX A;  3PJA A;  1WPY A;  5AQS B;  2CBI A;  2YDS A;  2XAJ B;  4PJM A;  2DKG A;  2CXF A;  4JV5 T;  1W0A A;  3BJU A;  4MFR A;  2V7K A;  3PUY F;  1X9B A;  2X9W A;  4O8S A;  4HWO A;  2CMR A;  1IZN B;  1YFS A;  1X56 A;  1VQZ A;  1QLB A;  1MMG A;  3C64 A;  4YSZ A;  2JPF A;  4DR6 T;  5LXT E;  3HXW A;  1USY A;  4OX9 T;  3ZT7 A;  5C52 B;  3J7Y q;  4WZX A;  3QO5 A;  3GA8 A;  1HNX T;  3RRW A;  3PCO B;  4YRI A;  1BR4 A;  3MEY A;  1NJ8 A;  4DV4 T;  2XQ3 A;  2N9D A;  2N2N A;  3E0Z A;  2CXD A;  2ZZE A;  4KBM B;  4PK6 A;  2IUB A;  3HI2 A;  4DO0 A;  2DWG A;  4L5G A;  2M6B A;  3O1H A;  4UP9 A;  4UP8 A;  4NUU A;  3UFE A;  5LGT B;  2DNX A;  3CX7 B;  3TEH B;  2V6X A;  2VL0 A;  2UXN B;  3NVO A;  5ADX L;  2EJF A;  4IST A;  4I50 E;  3RX6 A;  4HFV A;  4GYS A;  2KLQ A;  4XTV A;  4P0B A;  2V8S V;  1UK5 A;  3C4Z A;  3RIU C;  4CXX A;  5KXJ A;  4DV1 T;  5JR9 A;  1Z7N A;  3PDY A;  2ZT5 A;  3CIR A;  4ZHQ E;  2D2S A;  3LK2 B;  1SER A;  1NYQ A;  4ZXL A;  2ZIO A;  3A7R A;  4LNS A;  4K86 A;  4JI5 T;  1VRB A;  4DR3 T;  1YQ4 A;  5LA6 E;  4YRE A;  1CUN A;  3V8L A;  2WDQ A;  1YFT A;  5J2T E;  3V7S A;  4DV3 T;  4YSX A;  2DZ9 A;  2YK0 A;  3CK6 A;  3ZT6 A;  2W00 A;  3RF1 A;  1ZKE A;  1CHU A;  3OD1 A;  2ZZG A;  1ASY A;  3AEG A;  2BBH A;  4H2X B;  4ZI2 D;  4KI0 F;  4IDZ A;  4QXH B;  2W61 A;  4PJL A;  5LYJ E;  3QO8 A;  4ZI3 C;  1EOV A;  4E7Z A;  5L4H A;  3I9W A;  3ZN0 B;  2C5J A;  5AQN B;  2Q5I A;  3NZP A;  1MIV A;  4ASK A;  3EAM A;  3LC0 A;  2X66 A;  1RIQ A;  2JQH A;  4X64 T;  1IJ5 A;  3GN5 A;  2PG8 A;  4GK0 E;  4AXP A;  3QNE A;  2LHR A;  4QX8 B;  1M62 A;  4YT0 A;  2XQ9 A;  5JDG A;  3L8R A;  4IE7 A;  2CLY B;  4H9Q C;  4LF5 T;  5ETW A;  3N9N A;  4RQF A;  2JMK A;  2FJE A;  4H2Y A;  3I7F A;  1Z8U A;  3MK7 C;  1ATI A;  4XTY A;  3FZH B;  3PZC A;  3E9H A;  2BVM A;  3BQL A;  4KX6 A;  1IBL T;  3FJP A;  2LM2 A;  4O2B E;  3AEF A;  3RRC A;  4TVA B;  5LG4 A;  3SS1 A;  4ISS A;  3LJC A;  1NJ5 A;  4WW0 A;  4AKR B;  4YCV A;  1G5I A;  1SUM B;  4ZOL E;  4EZH A;  4I55 E;  4X5T A;  2NW7 A;  2BKN A;  4YRT A;  4CN1 A;  5CJ5 A;  2YIN A;  2BS4 A;  3AE6 A;  4LMJ A;  1H4S A;  2V7M A;  4UEL A;  3WQZ A;  3GWH A;  1UCU A;  4YRN A;  2VKD A;  2WAU A;  3ONX A;  1SA0 E;  3P4P A;  3X1D A;  4GKJ T;  3Q5D A;  2DZC A;  2DCF A;  2QHU A;  3L2Z A;  2ZT7 A;  4LF6 T;  4LF9 T;  2E5V A;  4U7Y A;  2ARU A;  2ZM6 T;  4U3C A;  1QF6 A;  4G63 A;  1G73 A;  2ZIN A;  2BVL A;  3P4S A;  3M65 A;  4TN7 B;  4COF A;  4O4I E;  2ODV A;  3Q2M A;  3CKD A;  5AQG B;  3QO7 A;  1HCI A;  5L47 A;  2C8M A;  3UUX B;  3H37 A;  4EZ4 A;  4B3R T;  4K87 A;  3PUS A;  3EVY A;  3KV6 A;  3UFG A;  4P71 A;  5LOV E;  2DQ0 A;  3DP7 A;  4YDQ A;  3OKQ A;  2XM1 A;  3N5L A;  1ZEE A;  1KMM A;  2JQK A;  2ZM8 A;  4G2A A;  3SOL A;  2NWB A;  4AKI A;  4HGA A;  5EK3 A;  2E65 A;  3ANW B;  2J62 A;  3RC3 A;  3UUN A;  5ELO A;  3MKD A;  1IBM T;  2AMC A;  2I4N A;  3AA1 B;  3CQC B;  2UXX B;  4DVD A;  1ZHC A;  3ZSS A;  4CXY A;  3H3M A;  4OP0 A;  3G06 A;  5FMN A;  2VWA A;  2M6I A;  5HCM A;  1KF6 A;  3CML A;  5LNK A;  4H9R C;  1G8X A;  4H63 H;  4JI2 T;  3HR0 A;  3N2O A;  3I9Y A;  4ZTZ B;  4C91 A;  4X62 T;  2Y48 B;  4IRE A;  4P09 A;  3ZYL A;  2RHS A;  5JR9 B;  2ZZF A;  3AB3 B;  1B7Y B;  4YRP A;  4HWH A;  5LHH B;  4OK0 A;  1IL2 A;  4I0U A;  1US7 B;  3OVU A;  3WAJ A;  3N2G E;  5FVK A;  2Q7E A;  2CPT A;  4IE0 A;  2LE8 A;  3BK9 A;  3FB2 A;  1D1A A;  3FBL A;  3DSQ A;  3PUR A;  4LFB T;  4XAX B;  5JQG E;  3VHL A;  3OJA A;  3LSV A;  3K1S A;  5HEH A;  2Q9Q D;  2D5U A;  2IML A;  1V9D A;  4IE4 A;  3PCO A;  1WNL A;  4N78 D;  5JDM A;  3UU3 A;  2VVS A;  3K3O A;  1L0V A;  4JI4 T;  3LK4 2;  2EJ9 A;  4JLE A;  2IIU A;  2D0U A;  2CEA A;  5HXE A;  4U74 A;  3HTZ A;  5AQP B;  5FNV E;  2LSG A;  2BKP A;  4BWA A;  2DHR A;  4HEA A;  3WAK A;  1VCT A;  4Z90 A;  4BW9 A;  3OYZ A;  3ZJ2 A;  1D0Y A;  2ZM0 A;  3ESL A;  2KXP B;  1E22 A;  5F3J A;  5ABF A;  3CQG B;  4ANJ A;  1T8B A;  4XTW A;  3TEH A;  2IY5 A;  4LF8 T;  4PNI A;  1NNH A;  5FVL A;  5FYM A;  3HXZ A;  3PUW F;  4TX5 A;  4BJN A;  1FMV A;  2KSR A;  5ABG A;  1WLX A;  3UU5 A;  1PYS A;  2C7I A;  4M1P A;  2EHO D;  5LBM A;  4PFP A;  5KX5 E;  2BS2 A;  4MAL A;  2XTI A;  2XAH B;  1D1B A;  5DJQ C;  2XQ5 A;  4NCX A;  1SET A;  3N2K E;  2ZIM A;  3AE2 A;  2QA7 A;  1YD8 G;  1G5H A;  5AQV B;  4DUZ T;  1T7S A;  1UX4 A;  4L9I A;  2ACZ A;  3MF2 A;  4EV6 A;  4JUY A;  4I43 B;  2L9Q A;  5JDH A;  3RIU A;  1NAF A;  4DBQ A;  4JI3 T;  1N36 T;  3AEC A;  3HL6 A;  4UIG A;  1SES A;  1YQ3 A;  2LJL A;  3I0Q A;  3RIA A;  3BQK A;  3I1A A;  3HKC E;  4JBW F;  2J3M A;  3FHN A;  2BZB A;  1BIA A;  2IDO B;  2YU1 A;  2VL8 A;  3FZF B;  2LSK A;  3RKW A;  1L0W A;  3EDU A;  2CCQ A;  1KFY A;  1YXR A;  2WWU A;  3U78 A;  4UF0 A;  4CXW A;  4CH4 A;  1U4Q A;  3FZL B;  1HXD A;  2VK9 A;  1X01 A;  4E7S A;  5LB7 B;  1XZY A;  4ZZC A;  2F4V T;  2DTI A;  3ZCJ A;  4UR9 A;  3H3A A;  2Q9Q B;  3ZLI A;  2X9Y A;  4EXT A;  1LKX A;  3KVA A;  4HWP A;  1XMO T;  4P3P A;  2NTY A;  5HXR A;  1FEW A;  3B57 A;  2E9X D;  2RHQ B;  5JTG A;  2HHH T;  2AMC B;  5AQI B;  2D0T A;  3EFS A;  2W67 A;  4HT4 A;  5JDQ A;  1VCS A;  2DDZ A;  4H2W A;  5DAB A;  3KFW X;  2VQF T;  3KV9 A;  5FXW A;  1N33 T;  2OA5 A;  5AQK B;  1W0B A;  1Z7M A;  4LVM A;  2RA1 A;  4Z91 A;  5L3E B;  3L1A A;  3PU8 A;  3NRX A;  1KK7 A;  2E1H A;  4TUY E;  3IG2 A;  4TV8 E;  3F57 A;  2RHS B;  2QGS A;  5H6R B;  1KNR A;  3O4X E;  4OYK A;  2LSI A;  2CHO A;  1B7T A;  4P72 A;  2A2F X;  5GON E;  1KOG A;  2ALY A;  2X0Y A;  2ZXF A;  2DJZ A;  4H9P C;  3UU6 A;  2EHO B;  3ETU A;  2NW9 A;  4L87 A;  3UU8 A;  1FMW A;  5M4Y A;  1BR0 A;  3BFM A;  3C50 A;  4H63 V;  5JDN A;  2VQE T;  4YTP A;  3ERR A;  4TWH A;  5HWY A;  4BA9 A;  2KWI B;  2UUB T;  4UV9 B;  3O1J A;  2V6Y B;  4P74 A;  3EUH A;  5HAX A;  1XDP A;  3K3N A;  4ZI3 D;  4AKG A;  3PUZ F;  2ZNJ A;  4LVJ A;  2YOE A;  3LFM A;  5L3F B;  2K3W A;  3ZMV B;  2BDE A;  3MXZ A;  1N9W A;  2V26 A;  4QH4 A;  1B8A A;  3CQX C;  3Q5W A;  5AQL B;  3ANW A;  2LEH A;  3AED A;  1UX5 A;  3LK3 B;  5FXX A;  4PFO A;  2MAW A;  1N34 T;  3RKO A;  2XAG B;  1Y64 B;  3TLS A;  2E9X C;  1WLE A;  1XNR T;  4IT4 A;  4X5O A;  5ABF B;  3MA9 A;  5JRE A;  2IY5 B;  4YHJ A;  4XTU A;  4DV2 T;  2ZMA A;  1HG2 A;  3RI5 A;  2W66 A;  4FI5 A;  2YEV C;  4YRG A;  4YRC A;  5AQU B;  5LCY A;  4LVI A;  2CIM A;  4HA8 A;  3RLF F;  5FL1 A;  5CB4 E;  2JJ9 A;  2VUR A;  3P4W A;  1NWM X;  4YJ3 E;  3VQX A;  1PYS B;  1B7Y A;  4Q6G A;  3IKM B;  1NJ6 A;  3T8O A;  5E3I A;  3TLV A;  1KMN A;  3LSQ A;  5HYA A;  3HKD E;  4HWS A;  3ONL C;  1E24 A;  4PHC A;  2V7L A;  4RDX A;  5IUX A;  2UUC T;  2X9H A;  4H9N C;  4QWN B;  4AKH A;  4JI0 T;  3VR8 A;  3LDQ B;  3AVS A;  1HC7 A;  2V5C A;  3B13 A;  2YDQ A;  5LGN B;  1YW0 A;  1T98 A;  1WRD A;  4QKN A;  2W0G A;  4QXB B;  4CQI A;  1I94 T;  2XQY A;  3RC8 A;  1HTJ F;  4TWA A;  3A5X A;  1X55 A;  3IHR A;  1U5P A;  2FJA A;  2H3R A;  3IAL A;  4CN4 A;  4DPG A;  3Q5X A;  4Z8X A;  4AKL A;  2BS3 A;  2XGT A;  4UXN B;  3CX8 B;  2W62 A;  4UF0 B;  2P0L A;  2XY8 B;  2OV9 A;  1X2H A;  1YKE B;  3RKX A;  1MMA A;  1WQ7 A;  3M4Q A;  1J5W A;  11AS A;  5BR8 T;  2CLY C;  1HTT A;  4UVA B;  4YRM A;  1LVK A;  1HR0 T;  3VR9 A;  4LVL A;  4H2V A;  2M67 A;  4P73 A;  3ABV A;  1UUS A;  5AQO B;  4HFH A;  1D0Z A;  5HEO A;  3ZST A;  2CWO A;  4U2Y A;  4DR2 T;  2XQ8 A;  1MND A;  2PTF A;  4U2Z A;  5L3D B;  1SRY A;  3HXV A;  2XJ7 A;  3D0T A;  2HN2 A;  1B70 A;  4NUV A;  4TWD A;  3CWZ B;  3W15 B;  2CE7 A;  3RIF A;  4XBF B;  2H7O A;  2K48 A;  4C90 A;  3LSS A;  3V7R A;  4TVW A;  3QOF A;  3PUQ A;  1UUR A;  1HX8 A;  4CN6 A;  2Q7H A;  3J9X 1;  2WZI A;  3ZT5 A;  3SRZ A;  3OTO T;  3HRI A;  1G51 A;  4H9S E;  3QC9 A;  1QE0 A;  3ZJ1 A;  5LJM A; 
#chains in the Genus database with same CATH homology
 2ALY B;  1ADJ A;  3PCO A;  1X2G A;  1WNL A;  4XTX A;  1NJ2 A;  2DU5 A;  2DVE A;  4CH5 A;  2EJ9 A;  3UGQ A;  3IKL A;  3HTZ A;  1USY C;  4P75 A;  2EAY A;  1BIB A;  2ZR3 A;  3A74 A;  5ELN A;  4BWA A;  4YCW A;  4BW9 A;  3HFZ A;  4TQD A;  3P8V A;  1H4Q A;  3MF1 A;  4TVA A;  4HVC A;  4Q15 A;  2ART A;  2E41 A;  1EIY A;  1E22 A;  3V7C A;  2DU7 A;  4ZIB A;  4EO4 A;  3QTC A;  4XTW A;  3TEH A;  2IY5 A;  4G85 A;  4J15 A;  2QHV A;  3A32 A;  1NNH A;  4H2T A;  1WU7 A;  3HXZ A;  3NET A;  4WJ4 A;  4XEO A;  3RKY A;  4E51 A;  4XU0 A;  2DEQ A;  2J3L A;  3RUX A;  1WPY A;  2RHQ A;  4TTV A;  1H4T A;  2DKG A;  1PYS A;  2C7I A;  4YRJ A;  1E1O A;  3BJU A;  4H2S A;  1GGM A;  2XTI A;  4YRF A;  1JJC A;  1E1T A;  4HWO A;  4NCX A;  1YFS A;  1X56 A;  1SET A;  2ZIM A;  1VQZ A;  1G5H A;  3RIR A;  3RAC A;  3A5Y A;  3P8T A;  4XEM A;  3HXW A;  4P75 C;  3MF2 A;  1USY A;  2CJB A;  5C52 B;  3HY1 A;  3QO5 A;  2AKW A;  3NEL A;  4YP0 A;  4YRR A;  1SES A;  3PCO B;  4YRI A;  3MEY A;  1NJ8 A;  2EJG A;  1YB3 A;  3A5Z A;  4G84 A;  1WYD A;  2I4M A;  3L4G A;  2J3M A;  1C0A A;  2Q5H A;  1BIA A;  3HY0 A;  3NEM A;  4YRO A;  2ZZE A;  3RKW A;  2G4C A;  1L0W A;  3CMQ A;  4CH3 A;  3P8Y A;  3HFZ B;  3UGT A;  4CH4 A;  1BBW A;  2E5A A;  1HXD A;  1X01 A;  4P72 C;  3RL6 A;  4UP9 A;  4WJ3 M;  2DQ3 A;  2DTI A;  4UP8 A;  4YRK A;  1X54 A;  3TEH B;  5HGQ A;  4HWP A;  4P3P A;  3HRK A;  4YPF A;  2EJF A;  4XTV A;  4P74 C;  2ZTG A;  2RHQ B;  4H2U A;  3G1Z A;  2AMC B;  1Z7N A;  4KQE A;  4XU2 A;  3EFS A;  2ZT5 A;  4HT4 A;  1SER A;  3ICA A;  1NYQ A;  2E3C A;  2ZIO A;  3A7R A;  2DDZ A;  4LNS A;  4H2W A;  4K86 A;  4KR3 A;  1JJC B;  4O2D A;  3W3S A;  2I4L A;  3A31 A;  4HWR A;  4CH6 A;  4YRE A;  1EFW A;  1Z7M A;  3V8L A;  4LVM A;  1YFT A;  3HXX A;  3V7S A;  3UH0 A;  2CJA A;  2DZ9 A;  1NJ1 A;  3L1A A;  3V8K A;  2QHS A;  1YGB A;  3RF1 A;  2E1H A;  2AKW B;  3REX A;  3OD1 A;  2ZZG A;  3IG2 A;  1ASY A;  2RHS B;  3VQW A;  4H2X B;  2EWN A;  4DQ2 A;  4K88 A;  4YRQ A;  4RMF A;  1LYL A;  2ODR C;  4P72 A;  1KOG A;  2ALY A;  2ZNI A;  2ZXF A;  2DTH A;  2DJZ A;  1B70 B;  2EL9 A;  3QO8 A;  12AS A;  2A8E A;  1EOV A;  4L87 A;  4YRS A;  2ZR2 A;  2Q7G A;  3BFM A;  1FYF A;  3ERR A;  2Q5I A;  3LC0 A;  4AH6 A;  2ODR D;  1RIQ A;  3HFV A;  4P74 A;  1EQR A;  4EX5 A;  3QNE A;  4CS3 A;  2ZNJ A;  4CS4 A;  4LVJ A;  5C53 B;  4PG3 A;  4ZTU B;  2ZT8 A;  3TEG A;  2DXU A;  1ASZ A;  3HXU A;  4XU3 A;  1N9W A;  5K1X A;  4RQF A;  1B76 A;  3VBB A;  4H2Y A;  1B8A A;  3MQZ A;  3I7F A;  4YYE A;  1WQW A;  1ATI A;  4XTY A;  3PZC A;  3E9H A;  2CGH A;  3FJP A;  2PME A;  2ZCE A;  3EFR A;  5K1P A;  4TVA B;  1EIY B;  4P71 C;  4LVK A;  1WLE A;  4X5O A;  4TQF A;  5KNN A;  1NJ5 A;  4YCV A;  4KR2 A;  1G5I A;  3R07 A;  2IY5 B;  4XTU A;  5F5W A;  2CJ9 A;  4YRT A;  4XU1 A;  4YRG A;  4YRC A;  4RQE A;  1H4S A;  3WQZ A;  4LVI A;  2CIM A;  4HA8 A;  3A7U A;  4YRN A;  3VQY A;  3VQX A;  1PYS B;  2QHT A;  1B7Y A;  4Q6G A;  3IKM B;  1NJ6 A;  2DZC A;  5E3I A;  1KMN A;  2QHU A;  3LSQ A;  3L2Z A;  2ZT7 A;  3NEN A;  4HWS A;  1E24 A;  4PHC A;  2ARU A;  4RDX A;  2HNI A;  2FYK A;  1QF6 A;  4YRL A;  4P73 C;  1EVL A;  2ZIN A;  1HC7 A;  3M4P A;  3HXY A;  2P5I A;  4WF2 A;  2DTO A;  1ADY A;  3QO7 A;  2ZT6 A;  2C8M A;  3RGL A;  4K87 A;  4OLF A;  2E10 A;  4TWA A;  3UFG A;  4P71 A;  1X55 A;  2DQ0 A;  4YDQ A;  3L4G B;  1KMM A;  3IAL A;  3V8J A;  4DPG A;  2E64 A;  2E65 A;  2XGT A;  2NS6 A;  4P3N A;  5ELO A;  4TVY A;  2AMC A;  2P0L A;  2I4N A;  5C51 B;  1X2H A;  3E9I A;  3RKX A;  4WI1 A;  1WQ7 A;  1EVK A;  3M4Q A;  4OP0 A;  1J5W A;  4H02 A;  11AS A;  1HTT A;  4YRM A;  4P3O A;  4UP7 A;  2ARS A;  4LVL A;  4H2V A;  4P73 A;  3A7A A;  4ZTZ B;  2I4O A;  4CS2 A;  3REU A;  2PMF A;  2RHS A;  4H2X A;  2ZZF A;  1B7Y B;  4YRP A;  4YCU A;  1IL2 A;  3TUP A;  1SRY A;  3KFU A;  3HXV A;  2Q7E A;  4HWT A;  1B70 A;  2ZGW A;  4UPA A;  1BBU A;  3DSQ A;  1YFR A;  3LSS A;  3V7R A;  1H4V B;  4TVW A;  1W66 A;  2Q7H A;  2DXT A;  3HRI A;  1G51 A;  1NYR A;  1QE0 A;  4XTZ A;  3VQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...