3RF1A

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
b'NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rf1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rf1A01
4YRFA 3V7CA 2PMEA 1FYFA 1KMNA 3A7UA 4HWSA 3MEYA 4BW9A 4DQ2A 3QNEA 3RF1A 4HWOA 2I4NA 2G4CA 4YCVA 4XU2A 3W3SA 4Q6GA 1ASYA 1NNHA 1X2GA 3RACA 1JJCB 1BIAA 2I4MA 3I7FA 3G1ZA 4XU3A 5E3IA 4H02A 2DZCA 3OD1A 1EOVA 3A5ZA 2I4OA 1G5HA 3HY0A 4K87A 4DPGA 4YRTA 2Q7GA 2ZR2A 3HXXA 1NYQA 4YP0A 1USYA 1L0WA 1X56A 2CJ9A 3RL6A 4BWAA 1EFWA 1YFSA 3RKWA 4XTXA 4AH6A 1B7YA 4H2UA 3P8VA 4YRCA 3VQVA 4P3NA 4CH3A 3LC0A 1IL2A 4ZTZB 4HA8A 1ASZA 2ALYA 1HTTA 1X01A 5C52B 2QHSA 4TVAA 1NJ6A 4YCWA 4YCUA 2ZINA 3IKLA 1E1OA 4O2DA 3RKXA 4YRJA 1X2HA 4YRNA 3QO7A 4P75A 1ADYA 4YRIA 1C0AA 2QHVA 2E65A 1EQRA 2XGTA 2ZCEA 2ZGWA 4K86A 1WPYA 3L2ZA 4PG3A 4XTYA 2DTOA 2ZNJA 4XTVA 4XU0A 2Q5HA 4YRPA 3TUPA 1NJ5A 4NCXA 1YGBA 3RIRA 1WLEA 3L4GA 3TEGA 3CMQA 2DVEA 1H4TA 4YREA 1WU7A 1GGMA 3RKYA 4UP7A 4YRQA 3IG2A 3LSQA 2EWNA 3V8LA 4CS4A 4WF2A 4HWPA 1HC7A 4P75C 3ERRA 2Q7HA 2CIMA 2IY5A 4PHCA 4RQEA 2E5AA 1HXDA 2EAYA 2QHUA 1WYDA 4WJ3M 1B70A 2ZT8A 2IY5B 2DTIA 3PCOA 4CH4A 4P73A 4UPAA 12ASA 3TEHA 1B70B 3A7AA 4CH6A 4RDXA 3PCOB 2DDZA 3EFSA 3P8TA 2ZT6A 2ARSA 3HFVA 4YDQA 3HXVA 3A31A 3NETA 4EO4A 1LYLA 2ZXFA 3TEHB 2ODRC 2DKGA 1X54A 1Z7NA 2FYKA 1KOGA 4CS3A 1X55A 2RHQA 1SERA 4G84A 4G85A 1YFRA 4P74A 2E1HA 1WQWA 3KFUA 1BBUA 1ADJA 1E22A 1EVKA 5ELOA 2CJAA 2E64A 4TTVA 4YRSA 4YRKA 1B7YB 4P3OA 2ZNIA 2ZTGA 5ELNA 3MF2A 4H2XA 4TWAA 1Z7MA 3NENA 1YFTA 4HVCA 2P5IA 4P73C 2Q7EA 2ALYB 3HRKA 4XTUA 4TVAB 4RMFA 1H4SA 3NEMA 4ZTUB 3QO8A 3VQWA 4P71A 3V8JA 2Q5IA 2ARTA 3EFRA 4YPFA 2XTIA 1USYC 4HWRA 2P0LA 3UGTA 2J3LA 4P74C 4EX5A 4TQDA 2DU5A 3DSQA 4K88A 3UGQA 3A5YA 1BBWA 2DTHA 3IALA 4Q15A 3WQZA 2DU7A 2ZZEA 2ARUA 2ZIMA 2EJ9A 3V7SA 4YRRA 3HXYA 2HNIA 2DQ0A 2E41A 3HFZA 3UH0A 3L4GB 4TVWA 3L1AA 3HY1A 1ATIA 3REXA 4P71C 1G5IA 2ZT7A 4H2VA 4P72A 4XU1A 3RGLA 5F5WA 4YRLA 1NJ8A 4H2YA 1EVLA 3UFGA 4ZIBA 4CS2A 3HXUA 3NELA 4KR3A 3A32A 2CGHA 3IKMB 2QHTA 1QF6A 3BFMA 3QO5A 1JJCA 3M4QA 4YRGA 1RIQA 2EL9A 4XEOA 3HTZA 4J15A 4TQFA 3VQXA 4WI1A 4UP8A 3FJPA 1B76A 3E9HA 1KMMA 4UP9A 1N9WA 4OP0A 3VBBA 4H2TA 4LNSA 4XEMA 4XTWA 1H4QA 5KNNA 1W66A 2RHQB 2PMFA 1B8AA 4P72C 4WJ4A 2AKWA 2ZIOA 1PYSA 3HXZA 4OLFA 3R07A 1QE0A 2CJBA 3P8YA 2DEQA 2AKWB 11ASA 4KQEA 1PYSB 4HWTA 2RHSA 2ZZFA 2ZZGA 2J3MA 3V7RA 1VQZA 1NJ2A 2C7IA 5C53B 5K1PA 1WNLA 5C51B 2ZT5A 4H2XB 2RHSB 2E10A 4YRMA 4H2WA 5HGQA 1EIYA 2DJZA 3PZCA 3A74A 2I4LA 3RUXA 4YYEA 1SRYA 3ICAA 1E1TA 1SESA 1H4VB 1EIYB 4KR2A 1WQ7A 2DXUA 3VQYA 3MF1A 3A7RA 4XTZA 1E24A 2DXTA 4P3PA 3BJUA 4E51A 4TVYA 1SETA 3HRIA 1NJ1A 2DZ9A 3HXWA 2EJFA 3QTCA 3M4PA 4YROA 4X5OA 1G51A 4CH5A 2ZR3A 2AMCA 2ODRD 4RQFA 3LSSA 1J5WA 2C8MA 1NYRA 3HFZB 1YB3A 2E3CA 4L87A 4H2SA 2AMCB 2EJGA 3V8KA 3REUA 1BIBA 5K1XA 3E9IA 2DQ3A
chains in the Genus database with same CATH superfamily
2DI4A 3UUXB 2DHRA 4HWSA 2CLYB 3I9WA 3AE1A 5JDFA 4UEMA 4HWOA 4ZS3A 1NAFA 5L2LA 3K8PC 4XU2A 3W3SA 4DO0A 2BS2A 1HNXT 1JJCB 2LOPA 2I4MA 3I7FA 5C3JA 4AKLA 4WYVA 2Y6XA 4H02A 2RPAA 2V7KA 4HTEA 1EOVA 3SFEA 5ABEA 5CFBA 2JPFA 1N33T 4UVBB 2J1DG 4CN6A 2UXNB 4LF7T 5JR9B 3CIRA 2RA1A 1LRZA 1NYQA 1GQEA 1X56A 4IT4A 2ZMAA 4ANJA 3OYXA 5FKYA 2E9XB 3RPUA 2UXBT 5FXXA 4XTXA 1B7YA 4H2UA 4ZZCA 2HPJA 4ILAA 2MBGA 4CH3A 4JI1T 1IL2A 2YINA 3RLFF 3KVAA 3HKEE 2VWAA 1WFDA 4TVAA 5LG4A 3UFEA 5ETWA 5FXWA 4O2DA 4PFPA 3RKXA 2CXDA 5JDGA 3AEAA 4MBQA 3LBXA 4YRNA 2CHNA 5LGTB 1M7KA 5HXHA 2M6IA 1ADYA 4YRIA 2HHHT 3ABVA 2VVSA 4HFDA 2ZCEA 4IREA 2ZGWA 4K86A 3ZJ1A 4XTYA 3V5UA 4YRPA 3NRXA 1ZP0A 2B76A 4U7IA 1D1BA 4H9PC 4LF8T 3RIRA 4GKJT 1UURA 4HWFA 4YREA 2EHOA 3RKYA 4UP7A 1I94T 3ETUA 3LSQA 1SE7A 2XY8B 2VASA 4HFEA 4JV5T 3RC8A 3ERRA 3QOFA 2CIMA 3I0QA 2V1DB 4DV4T 3O1JA 1WYDA 4OK0A 1B70A 4LVLA 5L4EA 1KFYA 2DTIA 3PCOA 2W63A 2E2AA 3TLTA 4CH4A 5HEHA 4P73A 12ASA 2W00A 2G0UA 4C91A 5LCYA 2ARSA 3RYCE 3UULA 3A31A 3HXVA 1V9DA 1HG2A 2BG9E 1X55A 4AKIA 1D1AA 1OXZA 4ZZBA 4JI0T 1SERA 2LM9A 3MJXA 3ZT6A 1YFRA 2L8KA 3UU8A 4IIJE 4XAXB 2Y8DA 2LEHA 4KX6A 4HFCA 3QK6A 4YRSA 2E64A 3RYIE 4V1Av 5C2TA 3CK6A 4QWNB 3BQKA 3TLSA 5LHHB 3UQ7A 2JQ9A 1X9BA 3C51A 3MF2A 4TWAA 5AQUB 2LHRA 3DP7A 4BJNA 1YFTA 2P5IA 4CI3B 5FVLA 2YN6A 2Q7EA 2MAWA 4QXHB 3T8OA 2ALYB 4YSZA 3ZLIA 4DR3T 2NW8A 2Q5IA 1U5PA 4QH5A 2J4GA 3EFRA 4OHFA 3TKLB 2VB6A 2P0LA 4JEUB 1KK7A 4EXTA 2DNXA 3N2OA 3DSQA 1KEYA 3TLWA 5L3CB 3ZMZB 1S35A 3LK2B 5IUXA 1BBWA 5AQIB 2V7JA 3UT5E 3L39A 3V7SA 1HCIA 4UR9A 2UUBT 3IEEA 3HFZA 2YOEA 2NS6A 3UH0A 3EUHA 3CQCB 3P50A 3LDQB 2B1EA 1FEWA 3L1AA 1IJ5A 3C4ZA 4EEDA 4UV9B 3PUVF 4DR4T 3GN5A 2K5BB 1N32T 2WAUA 2J47A 2WDRA 4I4TE 2BZBA 1XNRT 4ISTA 2A72A 2L3LA 3BQIA 4YXDA 4TWFA 1MIVA 4CS2A 2LJLA 3HXUA 4KR3A 2LLYA 5HXSA 3CX8B 3A32A 5L4HA 3FZLB 4CXYA 1RIQA 4AQYT 5CA1E 2H88A 1HF8A 1HG5A 3AE3A 3ANWB 3QB5A 2NP9A 4P0BA 3E9HA 5M4YA 2V8SV 3W15B 4DR7T 2RHQB 5KMGP 3Q5DA 2FJDA 4X1YE 1B8AA 4HGAA 4WJ4A 1PYSA 2CLYC 4AIUA 2X67A 5AQRB 2W0GA 3AEBA 2CJBA 3P8YA 5LGUB 4AI6A 5ABFA 4DBRA 2VQFT 4HN9A 2WY2A 2FUPA 4PK4A 1VQZA 4X1KE 4BA9A 4ADZA 4CI2B 5AQKB 1G8XA 4H2XB 3CX6B 4X20E 2MYSA 4GK0E 2PFVA 1HX1B 4QXCB 4DV5T 3ESLA 3F31A 2XQ7A 2XQ3A 3PZCA 2X0YA 4YHJA 3A74A 4KHPT 4IE6A 3U3IA 1WQ7A 4IDZA 2D0TA 3MF1A 3B5MA 5AQJB 3H37A 3ZSSA 4EYYR 2C5JA 3RQWA 1T8BA 5KDMC 2KZ7B 5C8YE 1XNQT 3ZKRA 2P9BA 3IBPA 4TVYA 2ZM0A 2CHOA 3QC9A 3J9X1 1IBKT 3ONJA 3QTCA 3K3OA 4HFVA 2YEVC 3AE9A 2V6YB 4LF5T 3DJBA 2M6BA 1J5WA 2Z6EA 1YB3A 2E3CA 2XQYA 3HKCE 3RIFA 4TN7B 3RQUA 4A97A 4DUZT 4ZHQE 3RYFE 3V8KA 1QSDA 1BIBA 5TAOA 4IL9A 2VL8A 4X62T 2PMEA 4LVIA 3ZCIA 2YDQA 3MEYA 4BW9A 4O8SA 2I59A 3AE8A 2X0HA 2I6HA 4GK5E 4U2ZA 4YCVA 2BKNA 5LBQB 3AE7A 1G73A 4PJLA 4KMCA 3ZEFB 4WBOA 1X2GA 5ABGA 3A7MA 3RKOA 5HCJA 2WQYA 3G06A 3G1ZA 1XDPA 2VKHA 2CE7A 4ERRA 3MQZA 1ZKEA 4KHZF 4X64T 4JUYA 5KXJA 3UU5A 4EV6A 1AJ3A 3OD1A 4TNWA 3JADA 4AXPA 2VQET 1YKHB 2LT3A 3M3ZB 3HY0A 4YRTA 3AXJB 2Q7GA 5LB7B 2ZR2A 1NWMX 2I0MA 3RIAA 3H3MA 1L0WA 2QYWA 2CJ9A 3C4XA 1Y64B 2A9UA 4MHCA 4JI7T 4KBMB 3RKWA 1MMGA 2AXDS 2C5IT 3LFMA 3HA4A 1MNDA 4NUVA 2D5UA 3Q5XA 2VKOA 1HNZT 2WDVA 4ILCA 3EAMA 1X01A 3MKDA 1YQ3A 3ZT7A 4A98A 1NJ6A 3E08A 4TX5A 2OLTA 2KXPB 2KINB 4YCUA 3IKLA 2XQ9A 4PJJA 2D2SA 1XZYA 5IWAT 2Q9QD 4NXNT 2JMHA 3GA8A 3LBXB 4G2AA 2QHVA 2XGTA 1W9RA 3FXEB 3FB2A 3AA1B 4PG3A 2DTOA 2ZNJA 4XU0A 1NJ5A 2XAFB 1W09A 4CN1A 4NCXA 1UX5A 4FJOA 1UCUA 1WYCA 2VKJA 1W0BA 1WLEA 2W61A 3L4GA 3O4XE 3C98B 1B7TA 3UU4A 3AA6B 1J5ET 1BR4A 1H4TA 4H9QC 1GGMA 2X0LB 4AISA 4Q25A 5BR8T 4DV2T 2EWNA 2FBWA 3ZN0B 2EHOB 2K24A 2KSRA 4DVDA 2BVMA 1QLBA 4P75C 3VKGA 4IL4A 3PUSA 1D1CA 2W4XA 4X1IE 1M62A 2IY5A 2K3WA 2EAYA 4OYKA 4L9IA 5JDQA 3ZN1B 2ZT8A 2UUAT 2J62A 5CGMA 4QKNA 3CVRA 2NTYA 1B70B 2YU2A 4CH6A 4RDXA 3PCOB 3JAEA 3EFSA 3VHLA 2IUBA 2ZT6A 4YLHA 3HFVA 4YDQA 3I1AA 5KX5E 3NETA 2MTQA 4EO4A 2ZXFA 3KVBA 1Z0PA 1Z7NA 2FYKA 1KOGA 4CS3A 2W67A 2WDQA 2WWUA 3SOLA 4YT0A 4G84A 2N1GA 3ZJ2A 2V7MA 5H6RB 3KFUA 2ZM6T 3P8CD 5E0OA 4ZEYA 5ELOA 2CJAA 1XDOA 4TTVA 5FL1A 5AQVB 1XMQT 3PV0F 3C64A 5ELNA 5FXZA 4ZXLA 1Z7MA 1IBLT 4HVCA 4HFIA 2XSBA 4XTUA 3H3AA 1H4SA 2WU5A 4ZTUB 3QO8A 4HE8A 3AEFA 2ARTA 2MPKA 3KV9A 4QH4A 4C90A 3ETVA 4HWRA 5GONE 2XAGB 3I9YA 2VKDA 2XQ5A 5FY1A 4TQDA 3UGQA 1SA0E 3MA9A 2UU9T 3A8YC 2ODVA 2ZLYA 2DTHA 3EHZA 3N9PA 1MMNA 3O1HA 4YTPA 2ZIMA 2YDSA 4YRRA 1KNZA 2HN2A 2E5VA 2DQ0A 3TLVA 5J2UE 4EGWA 1LVFA 2BBHA 4CQIA 4H63H 4YJ2E 2XQAA 4TVWA 5JDMA 5L3DB 3REXA 4NUUA 1QUUA 2CEAA 3RGLA 5FY0A 2LOSA 5LJNA 4YHHT 1NJ8A 4H2YA 5L3GB 4H9RC 3UFGA 2Q9QC 2VURA 2V5CA 3OBVE 4ZIBA 1T7SA 3Q2MA 4PNIA 3NELA 1KNRA 3KINB 5JH7E 1WLXA 2CGHA 5HWYA 2QHTA 1QF6A 3BFMA 4UVCB 1JJCA 1N34T 5JRCA 1H7CA 4YRGA 1D0ZA 2EL9A 1KF6A 4XEOA 4HFBA 1IBMT 3L3PA 4U74A 3HL6A 2XZEA 5JQGE 2E9XD 2CA5A 2WB5A 4OP0A 3PUXF 4H2TA 3PUWF 4XEMA 2X9XA 5KNNA 2E8IA 4AQFC 2WCAA 3NBXX 4YSXA 4B3MT 2W62A 4P72C 3E22E 2AKWA 3RHWA 4OLFA 1WRDA 3N9MA 4ILBA 4CI1B 3MACA 2DEQA 2WMOA 2IIUA 11ASA 4KQEA 1PYSB 3K3NA 4ASKA 2ZZFA 4A56A 3V7RA 2C7IA 2CXLA 1HR0T 5ABFB 2ODUA 3AEDA 2W2UA 2WS3A 3Q5EA 4H9OC 3FZHB 3AAAB 4H2WA 1YQ4A 3L8RA 1EIYA 2DJZA 4EIWA 4IE0A 2C0SA 2LHNA 3B13A 4HEAA 2I4LA 3ICAA 3U78A 1E1TA 1H4VB 4KR2A 1FIOA 1DU2A 4EZHA 2QRXA 5J0ZA 3N9LA 2LKHA 2ZM2A 4LFAT 3N2GE 4LMLA 3BJUA 4E51A 1WR0A 5LBMA 4L0RA 5AQNB 3ZSTA 5HEUA 3HRIA 2JQQA 4HKAA 1OEDC 2LKGA 1YKEB 3VRAA 3UQ4A 1ZHCA 3M4PA 4YROA 3RH3A 1D0YA 3CQGB 1WR6A 3QB5K 4DMWA 3CQXC 3RIUC 4JI8T 2ODRD 2YDRA 2BVLA 3T1YT 2KT9A 5AQPB 3ZT5A 4CZZB 4H2SA 2EJGA 4PFOA 3UUMA 3P4PA 1HS7A 5LP6E 5HYAA 2BG9C 4I55E 1E7PA 4DR6T 3TLUA 1I6ZA 3V7CA 5ADXL 4AKHA 2D0UA 1X79A 2A8EA 3A7UA 5L3FB 2D9DA 4DQ2A 4OFZA 4HWCA 1XMOT 2I4NA 2G4CA 5EK3A 2CM0A 1ASYA 2NR4A 4IE5A 2JQKA 1HFAA 3RACA 1BIAA 1HX8A 4XU3A 4JI3T 4IDQA 4GYSA 5AQOB 2OV9A 3Q9DA 3A5ZA 1YW0A 4DIDB 3N9QA 4IE7A 4OYJA 4JI5T 4EYUA 4YJ3E 3RYHE 4DPGA 4U72A 3AVRA 3JC6D 4MFRA 4YP0A 3AE4A 1USYA 2IAKA 3R6NA 4GOUA 4EEBA 4FI5A 4BWAA 1Z8UA 4O4JE 4WW0A 2WBLA 3AE5A 3P8VA 2H89A 4TWDA 4YRCA 3VU7H 4GYRA 4YSYA 3ZPOA 2QVAA 2IC6A 1UGOA 4MLKA 4HA8A 1ASZA 2ALYA 4TV8E 3P4RA 5C52B 2QHSA 1UX4A 4TUYE 3IF8B 4NIQA 5HXRA 4EZ4A 4DBQA 2ZINA 3N9NA 5JR9C 2XPKA 3O9XA 2WU2A 2XAQB 4DR2T 4HT4A 2YK0A 4UELA 4P75A 1MNEA 2XQ4A 4HWDA 1US7B 2PG8A 2E9XC 1LKXA 1FMWA 2K9AA 2XAHB 3EABA 3PUYF 4UV8B 2VL0A 4H63V 3L2ZA 2UXDT 5HEOA 4DR5T 4ZOLE 4XTVA 2K48A 4DV1T 1YGBA 2ACXA 4DMVA 4OX9T 3OYZA 2V6XA 2CMRA 2CPTA 3EI0A 4I0UA 2WZHA 4YRQA 3IG2A 2X51A 5JVDE 3V8LA 4WF2A 4HWPA 1E1HB 3AAIA 4K0KT 5HEGA 1NENA 4PHCA 4RQEA 5LJMA 2PJQA 2IY5B 3FBLA 4UPAA 2N9DA 3TEHA 2KMFA 2XM2A 3A7AA 2DDZA 3ANWA 1FMVA 4Z8XA 2FJAA 4JEHB 1MIYA 2NTXA 5FY7A 2ODRC 1X54A 1U4QA 4DV3T 2RHQA 4ZI3D 5FXVA 4G85A 2M67A 2BKPA 2E1HA 1R8IA 1WQWA 3OTOT 1ADJA 3KDSE 5AQFB 2C5KT 3GMIA 4BAYB 4YRKA 2DWKA 3NZPA 2CCQA 1B7YB 2IDOB 4CXWA 3P4SA 4P3OA 2ZNIA 4JLEA 3M65A 4H2XA 2BDEA 4TNVA 4X5TA 4TV9E 4UIGA 3HRKA 4TVAB 3ZMUB 3NEMA 2KNDA 3RX6A 2CBJA 5AQLB 3NVOA 3ZC0A 3RRCA 4KUMB 3LJCA 5BMVE 3UUBA 4GKKT 1USYC 4E7SA 4X65T 2Q9QA 4P74C 3PUQA 3CPZA 2DU5A 4K88A 4YTNA 3JC6C 2A2FX 4U2YA 3NRYA 2DU7A 5HXCA 4LF9T 2N2NA 2ZZEA 2ARUA 2EJ9A 2H7OA 3HXYA 2V6YA 1N36T 4IGUA 2E41A 3UUNA 2KWHA 1WCRA 4IDNA 5L47A 4QX8B 3KBTA 3HY1A 3PJAA 4P71C 4AQFA 3N2KE 1G5IA 2ZT7A 4H2VA 4U33A 2GK9A 4P72A 4LMKA 3SFDA 4LVMA 5F5WA 4YRLA 2RP4A 4LVJA 5AQQB 3N5LA 3MZKB 2AE9A 4ZS2A 2PTFA 4O4HE 3BK9A 3PUAA 3IKMB 4PW8A 3QO5A 2LSGA 5EZYE 3M4QA 2WWVA 3ZYMA 2IMLA 3KV5A 1WYBA 5LA6E 3HTZA 2BS3A 2FJBA 3K1SA 4J15A 5JRCB 1UK5A 4TQFA 3PDYA 4UP8A 1B76A 3D0TA 4KP3C 4UP9A 1T72A 3AXJA 2JQHA 1H4QA 1W66A 2XASB 5FMNA 2UUCT 2NW9A 2PMFA 4EAHA 3L09A 2SPCA 1Y01A 4NPPA 2A3DA 4H9SE 2JMKA 1QE0A 3ZMSB 3CWZB 3UU6A 3B57A 3PU8A 1OEDA 2AKWB 4ILUA 4CXXA 4UF0A 3CMLA 2RHSA 2ZZGA 2J3MA 4U3CA 2R6GF 1NJ2A 2X9WA 4UXNB 5LMUT 4QHOA 3AVSA 3PU3A 3RIUA 4JI6T 3KFWX 2ZT5A 2CWYA 5CJ5A 2E10A 5EK4A 3FZMB 5AQGB 2UXXB 4P1NA 4JI4T 5JDNA 2X9YA 2BG9A 2XTLA 2XM1A 1ZV4X 4YYEA 5DQWA 1SESA 1EIYB 3VQYA 2LM2A 3A7RA 4XTZA 4U7YA 2DXTA 2ZM8A 4B3TT 4ZI3C 4ZI2D 4PJMA 4P3PA 3HKBE 1SETA 4GIWA 3EVYA 2DZ9A 3HXWA 2EJFA 3AE6A 4X66T 2XSAA 3F57A 4X5OA 1T98A 3PUZF 1G51A 4IE4A 2AMCA 4PK5A 2EHOD 2V5DA 3NWIA 3GWHA 3LSSA 2C8MA 1D0XA 3HFZB 3FHNA 4L87A 2X9HA 3ZYLA 1SHZC 4B3ST 4DV7T 3REUA 5K1XA 2DQ3A 1MMAA 4YRFA 3JAFA 3LSVA 3GN5B 3OVUA 1FYFA 1KMNA 2HH7A 3FBZA 3IHRA 3R84B 3Q5WA 5AQTB 3QNEA 5JDHA 3RF1A 2CRBA 4L5GA 2IC9A 2NOXA 5HXEA 4Q6GA 3VKHA 5AQMB 4YY3T 1NNHA 2V7IA 4A5XA 1OEDE 4JYAT 1YXRA 5E3IA 3E0ZA 2DZCA 2V26A 2XHEB 5HWXA 2V7LA 2LRKA 5HCMA 2L9QA 5JR9A 3EDVA 2I4OA 1G5HA 4K87A 2XAJB 2OA5A 2E9XA 3BQLA 3HXXA 4DV6T 4UVAB 5LHIB 1IZNB 3RL6A 2XQ6A 2HN1A 1EFWA 1YFSA 4P09A 2ACZA 3ZMVB 3SS1A 3FXDB 4AH6A 3C50A 3CKDA 3AA0B 4CN4A 5DQVA 1O3XA 3VQVA 4P3NA 3LC0A 3ONXA 3OJAA 1IAPA 3LK42 5LXTE 4ZTZB 5DJQC 1HTTA 1HNWT 3OKQA 3HR0A 5LHGB 2LSIA 3KBUA 4YCWA 5ABHA 4WZXA 4AQGA 1E1OA 4YRJA 4U31A 5CA0E 2HPLA 5IHYA 1X2HA 3QO7A 2NW7A 1CHUA 4XBFB 1SUMB 5LYJE 1C0AA 2IW5B 2JJ9A 2E65A 5EK2A 1EQRA 3K3QC 1WPYA 2VK9A 3VR8A 5FYMA 4P0AA 4QH1A 4NXMT 2Q5HA 4LF6T 3TUPA 4QX7B 3FZFB 4JI2T 4HWHA 3QNUA 5J1GA 2E5LT 4ISSA 3TEGA 3CMQA 2DVEA 4LVKA 1WU7A 3SWHA 3IA3A 3OPCA 3RI5A 2X66A 3NKZA 2DLRA 1JNRA 2DCFA 5AQHB 4CS4A 4AKGA 1MMDA 1HC7A 3DTOA 3T1HT 3FZKB 2Q7HA 3NZQA 2LSJA 2ES0A 2CBIA 3ZCJA 2W66A 1ZOYA 2E5AA 3ZC1A 2BKOA 4DUYT 4JBWF 1HXDA 2QHUA 4Z91A 4WJ3M 3LK3B 3UTKA 4ZI2C 1JNZA 4DR1T 4KI0F 4H9NC 4IDPA 4TWHA 2YU1A 3P8TA 3PTRB 1LYLA 2EHOC 3TEHB 2DKGA 1VCSA 4O2BE 1OWAA 4EB6E 4P74A 3N9OA 3AB3B 4PJNA 1BBUA 5FNVE 3WAKA 3KV4A 3PUGA 1E22A 3AEGA 1EVKA 2QA7A 1FJGT 4N78D 4B3RT 3LG7A 4K0UA 3CX7B 3RRWA 2ZTGA 4PK6A 4XZCA 2LRLA 4ZI7E 3VR9A 1CUNA 3O1IA 5A1LA 3NENA 5H6QB 1YD8G 3KV6A 4P73C 3QUJA 4RMFA 2XUEA 2YKSA 3VQWA 4P71A 3V8JA 3AE2A 1UUSA 3J7Yq 4YPFA 2XTIA 2Y48B 2WP9A 5JREA 3UGTA 3VRBA 2J3LA 4EX5A 2JRKA 2PBIA 3I0OA 2BS4A 2XQ8A 4G63A 2CWOA 3A5YA 2Q9QB 3IALA 2NWBA 3HKDE 4Q15A 3WQZA 1MIWA 4M1PA 2LSYA 3JCFA 4DNDA 5JDLA 2MOZA 3AA7B 4E7ZA 2HNIA 3X1DA 2H3RA 3L4GB 4B6XA 1BR1A 1E2AA 5F8PA 2LE8A 4WNKA 1ATIA 4Z90A 1VOMA 5LOVE 1ZEEA 4O4IE 4XU1A 4O2AE 5LG3A 3PURA 1EVLA 1J1JA 5LMNT 3F2EA 3S4UA 4QXBB 3UU3A 1VCTA 5LGNB 2CXFA 5HEJA 2FJEA 1XWMA 3ZYKA 4F8HA 2BBJA 2VVNA 4PAGA 2H7VC 4TZ4C 5AFUL 3MK7C 4O4LE 4LFCT 3PE0A 4HWIB 4WI1A 3VQXA 2DWGA 1NEKA 3FJPA 1KMMA 4BJMA 1N9WA 2XJ7A 3VBBA 4LNSA 4LF4T 4XTWA 4COFA 2JIWA 3RC3A 2DL1A 2ZIOA 3A5XA 3P4WA 1IJ6A 4F6RC 1VRBA 3HXZA 4YTMA 4MALA 3R07A 2QGSA 1BR2A 3EDUA 3V5SA 4WBNE 5JTGA 2KWIB 3SRZA 1BR0A 1LVKA 4HWTA 5L3BB 1W0AA 2F4VT 5C53B 1HTJF 5K1PA 1OEDB 3AECA 1WNLA 5C51B 3AEEA 1EZ3A 4UF0B 2RHSB 5HAXA 4HFHA 4YFSA 4IHJE 1L0VA 4LMJA 4I50E 4EOZB 4YRMA 1S94A 2WZIA 5HGQA 3PJAJ 5FP3A 5CB4E 4J2CA 5FVKA 2KLQA 3RUXA 5LNKA 1SRYA 4DV0T 5IYZE 3RKGA 2DXUA 5F3JA 3P7IA 4I43B 2BG9B 1E24A 2WM9A 3ZMTB 2X68A 3MXZA 3C4WA 3P4QA 5FL0A 3WAJA 1NJ1A 2WSSV 4IDOA 5DABA 5L3EB 2WMNA 4CH5A 2ZR3A 3HI2A 4RQFA 1KNPA 1NYRA 3ONLC 2UXCT 5AQSB 4AKRB 3AAEB 5J2TE 2AMCB 2LSKA 2IHR1 4LFBT 3E9IA 3WI3A
chains in the Genus database with same CATH topology
4YRFA 3V7CA 2PMEA 1FYFA 4LVIA 1KMNA 2A8EA 3A7UA 4HWSA 3MEYA 4BW9A 4DQ2A 3QNEA 3RF1A 4HWOA 2I4NA 2G4CA 4YCVA 4XU2A 3W3SA 4Q6GA 1ASYA 1NNHA 1X2GA 3RACA 1JJCB 1BIAA 2I4MA 3I7FA 3G1ZA 4XU3A 5E3IA 4H02A 3MQZA 2DZCA 3OD1A 1EOVA 3A5ZA 2I4OA 1G5HA 3HY0A 4K87A 4DPGA 4YRTA 2Q7GA 2ZR2A 3HXXA 1NYQA 4YP0A 1USYA 1L0WA 1X56A 2CJ9A 3RL6A 4BWAA 1EFWA 1YFSA 3RKWA 4XTXA 4AH6A 1B7YA 4H2UA 3P8VA 4YRCA 3VQVA 4P3NA 4CH3A 3LC0A 1IL2A 4ZTZB 4HA8A 1ASZA 2ALYA 1HTTA 1X01A 5C52B 2QHSA 4TVAA 1NJ6A 4YCWA 4YCUA 2ZINA 3IKLA 1E1OA 4O2DA 3RKXA 4YRJA 4HT4A 1X2HA 4YRNA 3QO7A 4P75A 1ADYA 4YRIA 1C0AA 2QHVA 2E65A 1EQRA 2XGTA 2ZCEA 2ZGWA 4K86A 1WPYA 3L2ZA 4PG3A 4XTYA 2DTOA 2ZNJA 4XTVA 4XU0A 2Q5HA 4YRPA 3TUPA 1NJ5A 4NCXA 1YGBA 3RIRA 1WLEA 3L4GA 3TEGA 3CMQA 2DVEA 4LVKA 1H4TA 4YREA 1WU7A 1GGMA 3RKYA 4UP7A 4YRQA 3IG2A 3LSQA 2EWNA 3V8LA 4CS4A 4WF2A 4HWPA 1HC7A 4P75C 3ERRA 2Q7HA 2CIMA 2IY5A 4PHCA 4RQEA 2E5AA 1HXDA 2EAYA 2QHUA 1WYDA 4WJ3M 1B70A 4LVLA 2ZT8A 2IY5B 2DTIA 3PCOA 4CH4A 4P73A 4UPAA 12ASA 3TEHA 1B70B 3A7AA 4CH6A 4RDXA 3PCOB 2DDZA 3EFSA 3P8TA 2ZT6A 2ARSA 3HFVA 4YDQA 3HXVA 3A31A 3NETA 4EO4A 1LYLA 2ZXFA 3TEHB 2ODRC 2DKGA 1X54A 1Z7NA 2FYKA 1KOGA 4CS3A 1X55A 2RHQA 1SERA 4G84A 4G85A 1YFRA 4P74A 2E1HA 1WQWA 3KFUA 1BBUA 1ADJA 1E22A 1EVKA 5ELOA 2CJAA 2E64A 4TTVA 4YRSA 4YRKA 1B7YB 4P3OA 2ZNIA 2ZTGA 5ELNA 3MF2A 4H2XA 4TWAA 1Z7MA 3NENA 1YFTA 4HVCA 2P5IA 4P73C 2Q7EA 2ALYB 3HRKA 4XTUA 4TVAB 4RMFA 1H4SA 3NEMA 4ZTUB 3QO8A 3VQWA 4P71A 3V8JA 2Q5IA 2ARTA 3EFRA 4YPFA 2XTIA 1USYC 4HWRA 2P0LA 3UGTA 2J3LA 4P74C 4EX5A 4TQDA 2DU5A 3DSQA 4K88A 3UGQA 3A5YA 1BBWA 2DTHA 3IALA 4Q15A 3WQZA 2DU7A 2ZZEA 2ARUA 2ZIMA 2EJ9A 3V7SA 4YRRA 3HXYA 2HNIA 2DQ0A 2E41A 3HFZA 2NS6A 3UH0A 3L4GB 4TVWA 3L1AA 3HY1A 1ATIA 3REXA 4P71C 1G5IA 2ZT7A 4H2VA 4P72A 4XU1A 3RGLA 4LVMA 5F5WA 4YRLA 1NJ8A 4H2YA 1EVLA 4LVJA 3UFGA 4ZIBA 4CS2A 3HXUA 3NELA 4KR3A 3A32A 2CGHA 3IKMB 2QHTA 1QF6A 3BFMA 3QO5A 1JJCA 3M4QA 4YRGA 1RIQA 2EL9A 4XEOA 3HTZA 4J15A 4TQFA 3VQXA 4WI1A 4UP8A 3FJPA 1B76A 3E9HA 1KMMA 4UP9A 1N9WA 4OP0A 3VBBA 4H2TA 4LNSA 4XEMA 4XTWA 1H4QA 5KNNA 1W66A 2RHQB 2PMFA 1B8AA 4P72C 4WJ4A 2AKWA 2ZIOA 1PYSA 3HXZA 4OLFA 3R07A 1QE0A 2CJBA 3P8YA 2DEQA 2AKWB 11ASA 4KQEA 1PYSB 4HWTA 2RHSA 2ZZFA 2ZZGA 2J3MA 3V7RA 1VQZA 1NJ2A 2C7IA 5C53B 5K1PA 1WNLA 5C51B 2ZT5A 4H2XB 2RHSB 2E10A 4YRMA 4H2WA 5HGQA 1EIYA 2DJZA 3PZCA 3A74A 2I4LA 3RUXA 4YYEA 1SRYA 3ICAA 1E1TA 1SESA 1H4VB 1EIYB 4KR2A 1WQ7A 2DXUA 3VQYA 3MF1A 3A7RA 4XTZA 1E24A 2DXTA 4P3PA 3BJUA 4E51A 4TVYA 1SETA 3HRIA 1NJ1A 2DZ9A 3HXWA 2EJFA 3QTCA 3M4PA 4YROA 4X5OA 1G51A 4CH5A 2ZR3A 2AMCA 2ODRD 4RQFA 3LSSA 1J5WA 2C8MA 1NYRA 3HFZB 1YB3A 2E3CA 4L87A 4H2SA 2AMCB 2EJGA 3V8KA 3REUA 1BIBA 5K1XA 3E9IA 2DQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRF A;  3V7C A;  2PME A;  1FYF A;  1KMN A;  3A7U A;  4HWS A;  3MEY A;  4BW9 A;  4DQ2 A;  3QNE A;  3RF1 A;  4HWO A;  2I4N A;  2G4C A;  4YCV A;  4XU2 A;  3W3S A;  4Q6G A;  1ASY A;  1NNH A;  1X2G A;  3RAC A;  1JJC B;  1BIA A;  2I4M A;  3I7F A;  3G1Z A;  4XU3 A;  5E3I A;  4H02 A;  2DZC A;  3OD1 A;  1EOV A;  3A5Z A;  2I4O A;  1G5H A;  3HY0 A;  4K87 A;  4DPG A;  4YRT A;  2Q7G A;  2ZR2 A;  3HXX A;  1NYQ A;  4YP0 A;  1USY A;  1L0W A;  1X56 A;  2CJ9 A;  3RL6 A;  4BWA A;  1EFW A;  1YFS A;  3RKW A;  4XTX A;  4AH6 A;  1B7Y A;  4H2U A;  3P8V A;  4YRC A;  3VQV A;  4P3N A;  4CH3 A;  3LC0 A;  1IL2 A;  4ZTZ B;  4HA8 A;  1ASZ A;  2ALY A;  1HTT A;  1X01 A;  5C52 B;  2QHS A;  4TVA A;  1NJ6 A;  4YCW A;  4YCU A;  2ZIN A;  3IKL A;  1E1O A;  4O2D A;  3RKX A;  4YRJ A;  1X2H A;  4YRN A;  3QO7 A;  4P75 A;  1ADY A;  4YRI A;  1C0A A;  2QHV A;  2E65 A;  1EQR A;  2XGT A;  2ZCE A;  2ZGW A;  4K86 A;  1WPY A;  3L2Z A;  4PG3 A;  4XTY A;  2DTO A;  2ZNJ A;  4XTV A;  4XU0 A;  2Q5H A;  4YRP A;  3TUP A;  1NJ5 A;  4NCX A;  1YGB A;  3RIR A;  1WLE A;  3L4G A;  3TEG A;  3CMQ A;  2DVE A;  1H4T A;  4YRE A;  1WU7 A;  1GGM A;  3RKY A;  4UP7 A;  4YRQ A;  3IG2 A;  3LSQ A;  2EWN A;  3V8L A;  4CS4 A;  4WF2 A;  4HWP A;  1HC7 A;  4P75 C;  3ERR A;  2Q7H A;  2CIM A;  2IY5 A;  4PHC A;  4RQE A;  2E5A A;  1HXD A;  2EAY A;  2QHU A;  1WYD A;  4WJ3 M;  1B70 A;  2ZT8 A;  2IY5 B;  2DTI A;  3PCO A;  4CH4 A;  4P73 A;  4UPA A;  12AS A;  3TEH A;  1B70 B;  3A7A A;  4CH6 A;  4RDX A;  3PCO B;  2DDZ A;  3EFS A;  3P8T A;  2ZT6 A;  2ARS A;  3HFV A;  4YDQ A;  3HXV A;  3A31 A;  3NET A;  4EO4 A;  1LYL A;  2ZXF A;  3TEH B;  2ODR C;  2DKG A;  1X54 A;  1Z7N A;  2FYK A;  1KOG A;  4CS3 A;  1X55 A;  2RHQ A;  1SER A;  4G84 A;  4G85 A;  1YFR A;  4P74 A;  2E1H A;  1WQW A;  3KFU A;  1BBU A;  1ADJ A;  1E22 A;  1EVK A;  5ELO A;  2CJA A;  2E64 A;  4TTV A;  4YRS A;  4YRK A;  1B7Y B;  4P3O A;  2ZNI A;  2ZTG A;  5ELN A;  3MF2 A;  4H2X A;  4TWA A;  1Z7M A;  3NEN A;  1YFT A;  4HVC A;  2P5I A;  4P73 C;  2Q7E A;  2ALY B;  3HRK A;  4XTU A;  4TVA B;  4RMF A;  1H4S A;  3NEM A;  4ZTU B;  3QO8 A;  3VQW A;  4P71 A;  3V8J A;  2Q5I A;  2ART A;  3EFR A;  4YPF A;  2XTI A;  1USY C;  4HWR A;  2P0L A;  3UGT A;  2J3L A;  4P74 C;  4EX5 A;  4TQD A;  2DU5 A;  3DSQ A;  4K88 A;  3UGQ A;  3A5Y A;  1BBW A;  2DTH A;  3IAL A;  4Q15 A;  3WQZ A;  2DU7 A;  2ZZE A;  2ARU A;  2ZIM A;  2EJ9 A;  3V7S A;  4YRR A;  3HXY A;  2HNI A;  2DQ0 A;  2E41 A;  3HFZ A;  3UH0 A;  3L4G B;  4TVW A;  3L1A A;  3HY1 A;  1ATI A;  3REX A;  4P71 C;  1G5I A;  2ZT7 A;  4H2V A;  4P72 A;  4XU1 A;  3RGL A;  5F5W A;  4YRL A;  1NJ8 A;  4H2Y A;  1EVL A;  3UFG A;  4ZIB A;  4CS2 A;  3HXU A;  3NEL A;  4KR3 A;  3A32 A;  2CGH A;  3IKM B;  2QHT A;  1QF6 A;  3BFM A;  3QO5 A;  1JJC A;  3M4Q A;  4YRG A;  1RIQ A;  2EL9 A;  4XEO A;  3HTZ A;  4J15 A;  4TQF A;  3VQX A;  4WI1 A;  4UP8 A;  3FJP A;  1B76 A;  3E9H A;  1KMM A;  4UP9 A;  1N9W A;  4OP0 A;  3VBB A;  4H2T A;  4LNS A;  4XEM A;  4XTW A;  1H4Q A;  5KNN A;  1W66 A;  2RHQ B;  2PMF A;  1B8A A;  4P72 C;  4WJ4 A;  2AKW A;  2ZIO A;  1PYS A;  3HXZ A;  4OLF A;  3R07 A;  1QE0 A;  2CJB A;  3P8Y A;  2DEQ A;  2AKW B;  11AS A;  4KQE A;  1PYS B;  4HWT A;  2RHS A;  2ZZF A;  2ZZG A;  2J3M A;  3V7R A;  1VQZ A;  1NJ2 A;  2C7I A;  5C53 B;  5K1P A;  1WNL A;  5C51 B;  2ZT5 A;  4H2X B;  2RHS B;  2E10 A;  4YRM A;  4H2W A;  5HGQ A;  1EIY A;  2DJZ A;  3PZC A;  3A74 A;  2I4L A;  3RUX A;  4YYE A;  1SRY A;  3ICA A;  1E1T A;  1SES A;  1H4V B;  1EIY B;  4KR2 A;  1WQ7 A;  2DXU A;  3VQY A;  3MF1 A;  3A7R A;  4XTZ A;  1E24 A;  2DXT A;  4P3P A;  3BJU A;  4E51 A;  4TVY A;  1SET A;  3HRI A;  1NJ1 A;  2DZ9 A;  3HXW A;  2EJF A;  3QTC A;  3M4P A;  4YRO A;  4X5O A;  1G51 A;  4CH5 A;  2ZR3 A;  2AMC A;  2ODR D;  4RQF A;  3LSS A;  1J5W A;  2C8M A;  1NYR A;  3HFZ B;  1YB3 A;  2E3C A;  4L87 A;  4H2S A;  2AMC B;  2EJG A;  3V8K A;  3REU A;  1BIB A;  5K1X A;  3E9I A;  2DQ3 A; 
#chains in the Genus database with same CATH topology
 2DI4 A;  3UUX B;  2DHR A;  4HWS A;  2CLY B;  3I9W A;  3AE1 A;  5JDF A;  4UEM A;  4HWO A;  4ZS3 A;  1NAF A;  5L2L A;  3K8P C;  4XU2 A;  3W3S A;  4DO0 A;  2BS2 A;  1HNX T;  1JJC B;  2LOP A;  2I4M A;  3I7F A;  5C3J A;  4AKL A;  4WYV A;  2Y6X A;  4H02 A;  2RPA A;  2V7K A;  4HTE A;  1EOV A;  3SFE A;  5ABE A;  5CFB A;  2JPF A;  1N33 T;  4UVB B;  2J1D G;  4CN6 A;  2UXN B;  4LF7 T;  5JR9 B;  3CIR A;  2RA1 A;  1LRZ A;  1NYQ A;  1GQE A;  1X56 A;  4IT4 A;  2ZMA A;  4ANJ A;  3OYX A;  5FKY A;  2E9X B;  3RPU A;  2UXB T;  5FXX A;  4XTX A;  1B7Y A;  4H2U A;  4ZZC A;  2HPJ A;  4ILA A;  2MBG A;  4CH3 A;  4JI1 T;  1IL2 A;  2YIN A;  3RLF F;  3KVA A;  3HKE E;  2VWA A;  1WFD A;  4TVA A;  5LG4 A;  3UFE A;  5ETW A;  5FXW A;  4O2D A;  4PFP A;  3RKX A;  2CXD A;  5JDG A;  3AEA A;  4MBQ A;  3LBX A;  4YRN A;  2CHN A;  5LGT B;  1M7K A;  5HXH A;  2M6I A;  1ADY A;  4YRI A;  2HHH T;  3ABV A;  2VVS A;  4HFD A;  2ZCE A;  4IRE A;  2ZGW A;  4K86 A;  3ZJ1 A;  4XTY A;  3V5U A;  4YRP A;  3NRX A;  1ZP0 A;  2B76 A;  4U7I A;  1D1B A;  4H9P C;  4LF8 T;  3RIR A;  4GKJ T;  1UUR A;  4HWF A;  4YRE A;  2EHO A;  3RKY A;  4UP7 A;  1I94 T;  3ETU A;  3LSQ A;  1SE7 A;  2XY8 B;  2VAS A;  4HFE A;  4JV5 T;  3RC8 A;  3ERR A;  3QOF A;  2CIM A;  3I0Q A;  2V1D B;  4DV4 T;  3O1J A;  1WYD A;  4OK0 A;  1B70 A;  4LVL A;  5L4E A;  1KFY A;  2DTI A;  3PCO A;  2W63 A;  2E2A A;  3TLT A;  4CH4 A;  5HEH A;  4P73 A;  12AS A;  2W00 A;  2G0U A;  4C91 A;  5LCY A;  2ARS A;  3RYC E;  3UUL A;  3A31 A;  3HXV A;  1V9D A;  1HG2 A;  2BG9 E;  1X55 A;  4AKI A;  1D1A A;  1OXZ A;  4ZZB A;  4JI0 T;  1SER A;  2LM9 A;  3MJX A;  3ZT6 A;  1YFR A;  2L8K A;  3UU8 A;  4IIJ E;  4XAX B;  2Y8D A;  2LEH A;  4KX6 A;  4HFC A;  3QK6 A;  4YRS A;  2E64 A;  3RYI E;  4V1A v;  5C2T A;  3CK6 A;  4QWN B;  3BQK A;  3TLS A;  5LHH B;  3UQ7 A;  2JQ9 A;  1X9B A;  3C51 A;  3MF2 A;  4TWA A;  5AQU B;  2LHR A;  3DP7 A;  4BJN A;  1YFT A;  2P5I A;  4CI3 B;  5FVL A;  2YN6 A;  2Q7E A;  2MAW A;  4QXH B;  3T8O A;  2ALY B;  4YSZ A;  3ZLI A;  4DR3 T;  2NW8 A;  2Q5I A;  1U5P A;  4QH5 A;  2J4G A;  3EFR A;  4OHF A;  3TKL B;  2VB6 A;  2P0L A;  4JEU B;  1KK7 A;  4EXT A;  2DNX A;  3N2O A;  3DSQ A;  1KEY A;  3TLW A;  5L3C B;  3ZMZ B;  1S35 A;  3LK2 B;  5IUX A;  1BBW A;  5AQI B;  2V7J A;  3UT5 E;  3L39 A;  3V7S A;  1HCI A;  4UR9 A;  2UUB T;  3IEE A;  3HFZ A;  2YOE A;  2NS6 A;  3UH0 A;  3EUH A;  3CQC B;  3P50 A;  3LDQ B;  2B1E A;  1FEW A;  3L1A A;  1IJ5 A;  3C4Z A;  4EED A;  4UV9 B;  3PUV F;  4DR4 T;  3GN5 A;  2K5B B;  1N32 T;  2WAU A;  2J47 A;  2WDR A;  4I4T E;  2BZB A;  1XNR T;  4IST A;  2A72 A;  2L3L A;  3BQI A;  4YXD A;  4TWF A;  1MIV A;  4CS2 A;  2LJL A;  3HXU A;  4KR3 A;  2LLY A;  5HXS A;  3CX8 B;  3A32 A;  5L4H A;  3FZL B;  4CXY A;  1RIQ A;  4AQY T;  5CA1 E;  2H88 A;  1HF8 A;  1HG5 A;  3AE3 A;  3ANW B;  3QB5 A;  2NP9 A;  4P0B A;  3E9H A;  5M4Y A;  2V8S V;  3W15 B;  4DR7 T;  2RHQ B;  5KMG P;  3Q5D A;  2FJD A;  4X1Y E;  1B8A A;  4HGA A;  4WJ4 A;  1PYS A;  2CLY C;  4AIU A;  2X67 A;  5AQR B;  2W0G A;  3AEB A;  2CJB A;  3P8Y A;  5LGU B;  4AI6 A;  5ABF A;  4DBR A;  2VQF T;  4HN9 A;  2WY2 A;  2FUP A;  4PK4 A;  1VQZ A;  4X1K E;  4BA9 A;  4ADZ A;  4CI2 B;  5AQK B;  1G8X A;  4H2X B;  3CX6 B;  4X20 E;  2MYS A;  4GK0 E;  2PFV A;  1HX1 B;  4QXC B;  4DV5 T;  3ESL A;  3F31 A;  2XQ7 A;  2XQ3 A;  3PZC A;  2X0Y A;  4YHJ A;  3A74 A;  4KHP T;  4IE6 A;  3U3I A;  1WQ7 A;  4IDZ A;  2D0T A;  3MF1 A;  3B5M A;  5AQJ B;  3H37 A;  3ZSS A;  4EYY R;  2C5J A;  3RQW A;  1T8B A;  5KDM C;  2KZ7 B;  5C8Y E;  1XNQ T;  3ZKR A;  2P9B A;  3IBP A;  4TVY A;  2ZM0 A;  2CHO A;  3QC9 A;  3J9X 1;  1IBK T;  3ONJ A;  3QTC A;  3K3O A;  4HFV A;  2YEV C;  3AE9 A;  2V6Y B;  4LF5 T;  3DJB A;  2M6B A;  1J5W A;  2Z6E A;  1YB3 A;  2E3C A;  2XQY A;  3HKC E;  3RIF A;  4TN7 B;  3RQU A;  4A97 A;  4DUZ T;  4ZHQ E;  3RYF E;  3V8K A;  1QSD A;  1BIB A;  5TAO A;  4IL9 A;  2VL8 A;  4X62 T;  2PME A;  4LVI A;  3ZCI A;  2YDQ A;  3MEY A;  4BW9 A;  4O8S A;  2I59 A;  3AE8 A;  2X0H A;  2I6H A;  4GK5 E;  4U2Z A;  4YCV A;  2BKN A;  5LBQ B;  3AE7 A;  1G73 A;  4PJL A;  4KMC A;  3ZEF B;  4WBO A;  1X2G A;  5ABG A;  3A7M A;  3RKO A;  5HCJ A;  2WQY A;  3G06 A;  3G1Z A;  1XDP A;  2VKH A;  2CE7 A;  4ERR A;  3MQZ A;  1ZKE A;  4KHZ F;  4X64 T;  4JUY A;  5KXJ A;  3UU5 A;  4EV6 A;  1AJ3 A;  3OD1 A;  4TNW A;  3JAD A;  4AXP A;  2VQE T;  1YKH B;  2LT3 A;  3M3Z B;  3HY0 A;  4YRT A;  3AXJ B;  2Q7G A;  5LB7 B;  2ZR2 A;  1NWM X;  2I0M A;  3RIA A;  3H3M A;  1L0W A;  2QYW A;  2CJ9 A;  3C4X A;  1Y64 B;  2A9U A;  4MHC A;  4JI7 T;  4KBM B;  3RKW A;  1MMG A;  2AXD S;  2C5I T;  3LFM A;  3HA4 A;  1MND A;  4NUV A;  2D5U A;  3Q5X A;  2VKO A;  1HNZ T;  2WDV A;  4ILC A;  3EAM A;  1X01 A;  3MKD A;  1YQ3 A;  3ZT7 A;  4A98 A;  1NJ6 A;  3E08 A;  4TX5 A;  2OLT A;  2KXP B;  2KIN B;  4YCU A;  3IKL A;  2XQ9 A;  4PJJ A;  2D2S A;  1XZY A;  5IWA T;  2Q9Q D;  4NXN T;  2JMH A;  3GA8 A;  3LBX B;  4G2A A;  2QHV A;  2XGT A;  1W9R A;  3FXE B;  3FB2 A;  3AA1 B;  4PG3 A;  2DTO A;  2ZNJ A;  4XU0 A;  1NJ5 A;  2XAF B;  1W09 A;  4CN1 A;  4NCX A;  1UX5 A;  4FJO A;  1UCU A;  1WYC A;  2VKJ A;  1W0B A;  1WLE A;  2W61 A;  3L4G A;  3O4X E;  3C98 B;  1B7T A;  3UU4 A;  3AA6 B;  1J5E T;  1BR4 A;  1H4T A;  4H9Q C;  1GGM A;  2X0L B;  4AIS A;  4Q25 A;  5BR8 T;  4DV2 T;  2EWN A;  2FBW A;  3ZN0 B;  2EHO B;  2K24 A;  2KSR A;  4DVD A;  2BVM A;  1QLB A;  4P75 C;  3VKG A;  4IL4 A;  3PUS A;  1D1C A;  2W4X A;  4X1I E;  1M62 A;  2IY5 A;  2K3W A;  2EAY A;  4OYK A;  4L9I A;  5JDQ A;  3ZN1 B;  2ZT8 A;  2UUA T;  2J62 A;  5CGM A;  4QKN A;  3CVR A;  2NTY A;  1B70 B;  2YU2 A;  4CH6 A;  4RDX A;  3PCO B;  3JAE A;  3EFS A;  3VHL A;  2IUB A;  2ZT6 A;  4YLH A;  3HFV A;  4YDQ A;  3I1A A;  5KX5 E;  3NET A;  2MTQ A;  4EO4 A;  2ZXF A;  3KVB A;  1Z0P A;  1Z7N A;  2FYK A;  1KOG A;  4CS3 A;  2W67 A;  2WDQ A;  2WWU A;  3SOL A;  4YT0 A;  4G84 A;  2N1G A;  3ZJ2 A;  2V7M A;  5H6R B;  3KFU A;  2ZM6 T;  3P8C D;  5E0O A;  4ZEY A;  5ELO A;  2CJA A;  1XDO A;  4TTV A;  5FL1 A;  5AQV B;  1XMQ T;  3PV0 F;  3C64 A;  5ELN A;  5FXZ A;  4ZXL A;  1Z7M A;  1IBL T;  4HVC A;  4HFI A;  2XSB A;  4XTU A;  3H3A A;  1H4S A;  2WU5 A;  4ZTU B;  3QO8 A;  4HE8 A;  3AEF A;  2ART A;  2MPK A;  3KV9 A;  4QH4 A;  4C90 A;  3ETV A;  4HWR A;  5GON E;  2XAG B;  3I9Y A;  2VKD A;  2XQ5 A;  5FY1 A;  4TQD A;  3UGQ A;  1SA0 E;  3MA9 A;  2UU9 T;  3A8Y C;  2ODV A;  2ZLY A;  2DTH A;  3EHZ A;  3N9P A;  1MMN A;  3O1H A;  4YTP A;  2ZIM A;  2YDS A;  4YRR A;  1KNZ A;  2HN2 A;  2E5V A;  2DQ0 A;  3TLV A;  5J2U E;  4EGW A;  1LVF A;  2BBH A;  4CQI A;  4H63 H;  4YJ2 E;  2XQA A;  4TVW A;  5JDM A;  5L3D B;  3REX A;  4NUU A;  1QUU A;  2CEA A;  3RGL A;  5FY0 A;  2LOS A;  5LJN A;  4YHH T;  1NJ8 A;  4H2Y A;  5L3G B;  4H9R C;  3UFG A;  2Q9Q C;  2VUR A;  2V5C A;  3OBV E;  4ZIB A;  1T7S A;  3Q2M A;  4PNI A;  3NEL A;  1KNR A;  3KIN B;  5JH7 E;  1WLX A;  2CGH A;  5HWY A;  2QHT A;  1QF6 A;  3BFM A;  4UVC B;  1JJC A;  1N34 T;  5JRC A;  1H7C A;  4YRG A;  1D0Z A;  2EL9 A;  1KF6 A;  4XEO A;  4HFB A;  1IBM T;  3L3P A;  4U74 A;  3HL6 A;  2XZE A;  5JQG E;  2E9X D;  2CA5 A;  2WB5 A;  4OP0 A;  3PUX F;  4H2T A;  3PUW F;  4XEM A;  2X9X A;  5KNN A;  2E8I A;  4AQF C;  2WCA A;  3NBX X;  4YSX A;  4B3M T;  2W62 A;  4P72 C;  3E22 E;  2AKW A;  3RHW A;  4OLF A;  1WRD A;  3N9M A;  4ILB A;  4CI1 B;  3MAC A;  2DEQ A;  2WMO A;  2IIU A;  11AS A;  4KQE A;  1PYS B;  3K3N A;  4ASK A;  2ZZF A;  4A56 A;  3V7R A;  2C7I A;  2CXL A;  1HR0 T;  5ABF B;  2ODU A;  3AED A;  2W2U A;  2WS3 A;  3Q5E A;  4H9O C;  3FZH B;  3AAA B;  4H2W A;  1YQ4 A;  3L8R A;  1EIY A;  2DJZ A;  4EIW A;  4IE0 A;  2C0S A;  2LHN A;  3B13 A;  4HEA A;  2I4L A;  3ICA A;  3U78 A;  1E1T A;  1H4V B;  4KR2 A;  1FIO A;  1DU2 A;  4EZH A;  2QRX A;  5J0Z A;  3N9L A;  2LKH A;  2ZM2 A;  4LFA T;  3N2G E;  4LML A;  3BJU A;  4E51 A;  1WR0 A;  5LBM A;  4L0R A;  5AQN B;  3ZST A;  5HEU A;  3HRI A;  2JQQ A;  4HKA A;  1OED C;  2LKG A;  1YKE B;  3VRA A;  3UQ4 A;  1ZHC A;  3M4P A;  4YRO A;  3RH3 A;  1D0Y A;  3CQG B;  1WR6 A;  3QB5 K;  4DMW A;  3CQX C;  3RIU C;  4JI8 T;  2ODR D;  2YDR A;  2BVL A;  3T1Y T;  2KT9 A;  5AQP B;  3ZT5 A;  4CZZ B;  4H2S A;  2EJG A;  4PFO A;  3UUM A;  3P4P A;  1HS7 A;  5LP6 E;  5HYA A;  2BG9 C;  4I55 E;  1E7P A;  4DR6 T;  3TLU A;  1I6Z A;  3V7C A;  5ADX L;  4AKH A;  2D0U A;  1X79 A;  2A8E A;  3A7U A;  5L3F B;  2D9D A;  4DQ2 A;  4OFZ A;  4HWC A;  1XMO T;  2I4N A;  2G4C A;  5EK3 A;  2CM0 A;  1ASY A;  2NR4 A;  4IE5 A;  2JQK A;  1HFA A;  3RAC A;  1BIA A;  1HX8 A;  4XU3 A;  4JI3 T;  4IDQ A;  4GYS A;  5AQO B;  2OV9 A;  3Q9D A;  3A5Z A;  1YW0 A;  4DID B;  3N9Q A;  4IE7 A;  4OYJ A;  4JI5 T;  4EYU A;  4YJ3 E;  3RYH E;  4DPG A;  4U72 A;  3AVR A;  3JC6 D;  4MFR A;  4YP0 A;  3AE4 A;  1USY A;  2IAK A;  3R6N A;  4GOU A;  4EEB A;  4FI5 A;  4BWA A;  1Z8U A;  4O4J E;  4WW0 A;  2WBL A;  3AE5 A;  3P8V A;  2H89 A;  4TWD A;  4YRC A;  3VU7 H;  4GYR A;  4YSY A;  3ZPO A;  2QVA A;  2IC6 A;  1UGO A;  4MLK A;  4HA8 A;  1ASZ A;  2ALY A;  4TV8 E;  3P4R A;  5C52 B;  2QHS A;  1UX4 A;  4TUY E;  3IF8 B;  4NIQ A;  5HXR A;  4EZ4 A;  4DBQ A;  2ZIN A;  3N9N A;  5JR9 C;  2XPK A;  3O9X A;  2WU2 A;  2XAQ B;  4DR2 T;  4HT4 A;  2YK0 A;  4UEL A;  4P75 A;  1MNE A;  2XQ4 A;  4HWD A;  1US7 B;  2PG8 A;  2E9X C;  1LKX A;  1FMW A;  2K9A A;  2XAH B;  3EAB A;  3PUY F;  4UV8 B;  2VL0 A;  4H63 V;  3L2Z A;  2UXD T;  5HEO A;  4DR5 T;  4ZOL E;  4XTV A;  2K48 A;  4DV1 T;  1YGB A;  2ACX A;  4DMV A;  4OX9 T;  3OYZ A;  2V6X A;  2CMR A;  2CPT A;  3EI0 A;  4I0U A;  2WZH A;  4YRQ A;  3IG2 A;  2X51 A;  5JVD E;  3V8L A;  4WF2 A;  4HWP A;  1E1H B;  3AAI A;  4K0K T;  5HEG A;  1NEN A;  4PHC A;  4RQE A;  5LJM A;  2PJQ A;  2IY5 B;  3FBL A;  4UPA A;  2N9D A;  3TEH A;  2KMF A;  2XM2 A;  3A7A A;  2DDZ A;  3ANW A;  1FMV A;  4Z8X A;  2FJA A;  4JEH B;  1MIY A;  2NTX A;  5FY7 A;  2ODR C;  1X54 A;  1U4Q A;  4DV3 T;  2RHQ A;  4ZI3 D;  5FXV A;  4G85 A;  2M67 A;  2BKP A;  2E1H A;  1R8I A;  1WQW A;  3OTO T;  1ADJ A;  3KDS E;  5AQF B;  2C5K T;  3GMI A;  4BAY B;  4YRK A;  2DWK A;  3NZP A;  2CCQ A;  1B7Y B;  2IDO B;  4CXW A;  3P4S A;  4P3O A;  2ZNI A;  4JLE A;  3M65 A;  4H2X A;  2BDE A;  4TNV A;  4X5T A;  4TV9 E;  4UIG A;  3HRK A;  4TVA B;  3ZMU B;  3NEM A;  2KND A;  3RX6 A;  2CBJ A;  5AQL B;  3NVO A;  3ZC0 A;  3RRC A;  4KUM B;  3LJC A;  5BMV E;  3UUB A;  4GKK T;  1USY C;  4E7S A;  4X65 T;  2Q9Q A;  4P74 C;  3PUQ A;  3CPZ A;  2DU5 A;  4K88 A;  4YTN A;  3JC6 C;  2A2F X;  4U2Y A;  3NRY A;  2DU7 A;  5HXC A;  4LF9 T;  2N2N A;  2ZZE A;  2ARU A;  2EJ9 A;  2H7O A;  3HXY A;  2V6Y A;  1N36 T;  4IGU A;  2E41 A;  3UUN A;  2KWH A;  1WCR A;  4IDN A;  5L47 A;  4QX8 B;  3KBT A;  3HY1 A;  3PJA A;  4P71 C;  4AQF A;  3N2K E;  1G5I A;  2ZT7 A;  4H2V A;  4U33 A;  2GK9 A;  4P72 A;  4LMK A;  3SFD A;  4LVM A;  5F5W A;  4YRL A;  2RP4 A;  4LVJ A;  5AQQ B;  3N5L A;  3MZK B;  2AE9 A;  4ZS2 A;  2PTF A;  4O4H E;  3BK9 A;  3PUA A;  3IKM B;  4PW8 A;  3QO5 A;  2LSG A;  5EZY E;  3M4Q A;  2WWV A;  3ZYM A;  2IML A;  3KV5 A;  1WYB A;  5LA6 E;  3HTZ A;  2BS3 A;  2FJB A;  3K1S A;  4J15 A;  5JRC B;  1UK5 A;  4TQF A;  3PDY A;  4UP8 A;  1B76 A;  3D0T A;  4KP3 C;  4UP9 A;  1T72 A;  3AXJ A;  2JQH A;  1H4Q A;  1W66 A;  2XAS B;  5FMN A;  2UUC T;  2NW9 A;  2PMF A;  4EAH A;  3L09 A;  2SPC A;  1Y01 A;  4NPP A;  2A3D A;  4H9S E;  2JMK A;  1QE0 A;  3ZMS B;  3CWZ B;  3UU6 A;  3B57 A;  3PU8 A;  1OED A;  2AKW B;  4ILU A;  4CXX A;  4UF0 A;  3CML A;  2RHS A;  2ZZG A;  2J3M A;  4U3C A;  2R6G F;  1NJ2 A;  2X9W A;  4UXN B;  5LMU T;  4QHO A;  3AVS A;  3PU3 A;  3RIU A;  4JI6 T;  3KFW X;  2ZT5 A;  2CWY A;  5CJ5 A;  2E10 A;  5EK4 A;  3FZM B;  5AQG B;  2UXX B;  4P1N A;  4JI4 T;  5JDN A;  2X9Y A;  2BG9 A;  2XTL A;  2XM1 A;  1ZV4 X;  4YYE A;  5DQW A;  1SES A;  1EIY B;  3VQY A;  2LM2 A;  3A7R A;  4XTZ A;  4U7Y A;  2DXT A;  2ZM8 A;  4B3T T;  4ZI3 C;  4ZI2 D;  4PJM A;  4P3P A;  3HKB E;  1SET A;  4GIW A;  3EVY A;  2DZ9 A;  3HXW A;  2EJF A;  3AE6 A;  4X66 T;  2XSA A;  3F57 A;  4X5O A;  1T98 A;  3PUZ F;  1G51 A;  4IE4 A;  2AMC A;  4PK5 A;  2EHO D;  2V5D A;  3NWI A;  3GWH A;  3LSS A;  2C8M A;  1D0X A;  3HFZ B;  3FHN A;  4L87 A;  2X9H A;  3ZYL A;  1SHZ C;  4B3S T;  4DV7 T;  3REU A;  5K1X A;  2DQ3 A;  1MMA A;  4YRF A;  3JAF A;  3LSV A;  3GN5 B;  3OVU A;  1FYF A;  1KMN A;  2HH7 A;  3FBZ A;  3IHR A;  3R84 B;  3Q5W A;  5AQT B;  3QNE A;  5JDH A;  3RF1 A;  2CRB A;  4L5G A;  2IC9 A;  2NOX A;  5HXE A;  4Q6G A;  3VKH A;  5AQM B;  4YY3 T;  1NNH A;  2V7I A;  4A5X A;  1OED E;  4JYA T;  1YXR A;  5E3I A;  3E0Z A;  2DZC A;  2V26 A;  2XHE B;  5HWX A;  2V7L A;  2LRK A;  5HCM A;  2L9Q A;  5JR9 A;  3EDV A;  2I4O A;  1G5H A;  4K87 A;  2XAJ B;  2OA5 A;  2E9X A;  3BQL A;  3HXX A;  4DV6 T;  4UVA B;  5LHI B;  1IZN B;  3RL6 A;  2XQ6 A;  2HN1 A;  1EFW A;  1YFS A;  4P09 A;  2ACZ A;  3ZMV B;  3SS1 A;  3FXD B;  4AH6 A;  3C50 A;  3CKD A;  3AA0 B;  4CN4 A;  5DQV A;  1O3X A;  3VQV A;  4P3N A;  3LC0 A;  3ONX A;  3OJA A;  1IAP A;  3LK4 2;  5LXT E;  4ZTZ B;  5DJQ C;  1HTT A;  1HNW T;  3OKQ A;  3HR0 A;  5LHG B;  2LSI A;  3KBU A;  4YCW A;  5ABH A;  4WZX A;  4AQG A;  1E1O A;  4YRJ A;  4U31 A;  5CA0 E;  2HPL A;  5IHY A;  1X2H A;  3QO7 A;  2NW7 A;  1CHU A;  4XBF B;  1SUM B;  5LYJ E;  1C0A A;  2IW5 B;  2JJ9 A;  2E65 A;  5EK2 A;  1EQR A;  3K3Q C;  1WPY A;  2VK9 A;  3VR8 A;  5FYM A;  4P0A A;  4QH1 A;  4NXM T;  2Q5H A;  4LF6 T;  3TUP A;  4QX7 B;  3FZF B;  4JI2 T;  4HWH A;  3QNU A;  5J1G A;  2E5L T;  4ISS A;  3TEG A;  3CMQ A;  2DVE A;  4LVK A;  1WU7 A;  3SWH A;  3IA3 A;  3OPC A;  3RI5 A;  2X66 A;  3NKZ A;  2DLR A;  1JNR A;  2DCF A;  5AQH B;  4CS4 A;  4AKG A;  1MMD A;  1HC7 A;  3DTO A;  3T1H T;  3FZK B;  2Q7H A;  3NZQ A;  2LSJ A;  2ES0 A;  2CBI A;  3ZCJ A;  2W66 A;  1ZOY A;  2E5A A;  3ZC1 A;  2BKO A;  4DUY T;  4JBW F;  1HXD A;  2QHU A;  4Z91 A;  4WJ3 M;  3LK3 B;  3UTK A;  4ZI2 C;  1JNZ A;  4DR1 T;  4KI0 F;  4H9N C;  4IDP A;  4TWH A;  2YU1 A;  3P8T A;  3PTR B;  1LYL A;  2EHO C;  3TEH B;  2DKG A;  1VCS A;  4O2B E;  1OWA A;  4EB6 E;  4P74 A;  3N9O A;  3AB3 B;  4PJN A;  1BBU A;  5FNV E;  3WAK A;  3KV4 A;  3PUG A;  1E22 A;  3AEG A;  1EVK A;  2QA7 A;  1FJG T;  4N78 D;  4B3R T;  3LG7 A;  4K0U A;  3CX7 B;  3RRW A;  2ZTG A;  4PK6 A;  4XZC A;  2LRL A;  4ZI7 E;  3VR9 A;  1CUN A;  3O1I A;  5A1L A;  3NEN A;  5H6Q B;  1YD8 G;  3KV6 A;  4P73 C;  3QUJ A;  4RMF A;  2XUE A;  2YKS A;  3VQW A;  4P71 A;  3V8J A;  3AE2 A;  1UUS A;  3J7Y q;  4YPF A;  2XTI A;  2Y48 B;  2WP9 A;  5JRE A;  3UGT A;  3VRB A;  2J3L A;  4EX5 A;  2JRK A;  2PBI A;  3I0O A;  2BS4 A;  2XQ8 A;  4G63 A;  2CWO A;  3A5Y A;  2Q9Q B;  3IAL A;  2NWB A;  3HKD E;  4Q15 A;  3WQZ A;  1MIW A;  4M1P A;  2LSY A;  3JCF A;  4DND A;  5JDL A;  2MOZ A;  3AA7 B;  4E7Z A;  2HNI A;  3X1D A;  2H3R A;  3L4G B;  4B6X A;  1BR1 A;  1E2A A;  5F8P A;  2LE8 A;  4WNK A;  1ATI A;  4Z90 A;  1VOM A;  5LOV E;  1ZEE A;  4O4I E;  4XU1 A;  4O2A E;  5LG3 A;  3PUR A;  1EVL A;  1J1J A;  5LMN T;  3F2E A;  3S4U A;  4QXB B;  3UU3 A;  1VCT A;  5LGN B;  2CXF A;  5HEJ A;  2FJE A;  1XWM A;  3ZYK A;  4F8H A;  2BBJ A;  2VVN A;  4PAG A;  2H7V C;  4TZ4 C;  5AFU L;  3MK7 C;  4O4L E;  4LFC T;  3PE0 A;  4HWI B;  4WI1 A;  3VQX A;  2DWG A;  1NEK A;  3FJP A;  1KMM A;  4BJM A;  1N9W A;  2XJ7 A;  3VBB A;  4LNS A;  4LF4 T;  4XTW A;  4COF A;  2JIW A;  3RC3 A;  2DL1 A;  2ZIO A;  3A5X A;  3P4W A;  1IJ6 A;  4F6R C;  1VRB A;  3HXZ A;  4YTM A;  4MAL A;  3R07 A;  2QGS A;  1BR2 A;  3EDU A;  3V5S A;  4WBN E;  5JTG A;  2KWI B;  3SRZ A;  1BR0 A;  1LVK A;  4HWT A;  5L3B B;  1W0A A;  2F4V T;  5C53 B;  1HTJ F;  5K1P A;  1OED B;  3AEC A;  1WNL A;  5C51 B;  3AEE A;  1EZ3 A;  4UF0 B;  2RHS B;  5HAX A;  4HFH A;  4YFS A;  4IHJ E;  1L0V A;  4LMJ A;  4I50 E;  4EOZ B;  4YRM A;  1S94 A;  2WZI A;  5HGQ A;  3PJA J;  5FP3 A;  5CB4 E;  4J2C A;  5FVK A;  2KLQ A;  3RUX A;  5LNK A;  1SRY A;  4DV0 T;  5IYZ E;  3RKG A;  2DXU A;  5F3J A;  3P7I A;  4I43 B;  2BG9 B;  1E24 A;  2WM9 A;  3ZMT B;  2X68 A;  3MXZ A;  3C4W A;  3P4Q A;  5FL0 A;  3WAJ A;  1NJ1 A;  2WSS V;  4IDO A;  5DAB A;  5L3E B;  2WMN A;  4CH5 A;  2ZR3 A;  3HI2 A;  4RQF A;  1KNP A;  1NYR A;  3ONL C;  2UXC T;  5AQS B;  4AKR B;  3AAE B;  5J2T E;  2AMC B;  2LSK A;  2IHR 1;  4LFB T;  3E9I A;  3WI3 A; 
#chains in the Genus database with same CATH homology
 4YRF A;  3V7C A;  2PME A;  1FYF A;  4LVI A;  1KMN A;  2A8E A;  3A7U A;  4HWS A;  3MEY A;  4BW9 A;  4DQ2 A;  3QNE A;  3RF1 A;  4HWO A;  2I4N A;  2G4C A;  4YCV A;  4XU2 A;  3W3S A;  4Q6G A;  1ASY A;  1NNH A;  1X2G A;  3RAC A;  1JJC B;  1BIA A;  2I4M A;  3I7F A;  3G1Z A;  4XU3 A;  5E3I A;  4H02 A;  3MQZ A;  2DZC A;  3OD1 A;  1EOV A;  3A5Z A;  2I4O A;  1G5H A;  3HY0 A;  4K87 A;  4DPG A;  4YRT A;  2Q7G A;  2ZR2 A;  3HXX A;  1NYQ A;  4YP0 A;  1USY A;  1L0W A;  1X56 A;  2CJ9 A;  3RL6 A;  4BWA A;  1EFW A;  1YFS A;  3RKW A;  4XTX A;  4AH6 A;  1B7Y A;  4H2U A;  3P8V A;  4YRC A;  3VQV A;  4P3N A;  4CH3 A;  3LC0 A;  1IL2 A;  4ZTZ B;  4HA8 A;  1ASZ A;  2ALY A;  1HTT A;  1X01 A;  5C52 B;  2QHS A;  4TVA A;  1NJ6 A;  4YCW A;  4YCU A;  2ZIN A;  3IKL A;  1E1O A;  4O2D A;  3RKX A;  4YRJ A;  4HT4 A;  1X2H A;  4YRN A;  3QO7 A;  4P75 A;  1ADY A;  4YRI A;  1C0A A;  2QHV A;  2E65 A;  1EQR A;  2XGT A;  2ZCE A;  2ZGW A;  4K86 A;  1WPY A;  3L2Z A;  4PG3 A;  4XTY A;  2DTO A;  2ZNJ A;  4XTV A;  4XU0 A;  2Q5H A;  4YRP A;  3TUP A;  1NJ5 A;  4NCX A;  1YGB A;  3RIR A;  1WLE A;  3L4G A;  3TEG A;  3CMQ A;  2DVE A;  4LVK A;  1H4T A;  4YRE A;  1WU7 A;  1GGM A;  3RKY A;  4UP7 A;  4YRQ A;  3IG2 A;  3LSQ A;  2EWN A;  3V8L A;  4CS4 A;  4WF2 A;  4HWP A;  1HC7 A;  4P75 C;  3ERR A;  2Q7H A;  2CIM A;  2IY5 A;  4PHC A;  4RQE A;  2E5A A;  1HXD A;  2EAY A;  2QHU A;  1WYD A;  4WJ3 M;  1B70 A;  4LVL A;  2ZT8 A;  2IY5 B;  2DTI A;  3PCO A;  4CH4 A;  4P73 A;  4UPA A;  12AS A;  3TEH A;  1B70 B;  3A7A A;  4CH6 A;  4RDX A;  3PCO B;  2DDZ A;  3EFS A;  3P8T A;  2ZT6 A;  2ARS A;  3HFV A;  4YDQ A;  3HXV A;  3A31 A;  3NET A;  4EO4 A;  1LYL A;  2ZXF A;  3TEH B;  2ODR C;  2DKG A;  1X54 A;  1Z7N A;  2FYK A;  1KOG A;  4CS3 A;  1X55 A;  2RHQ A;  1SER A;  4G84 A;  4G85 A;  1YFR A;  4P74 A;  2E1H A;  1WQW A;  3KFU A;  1BBU A;  1ADJ A;  1E22 A;  1EVK A;  5ELO A;  2CJA A;  2E64 A;  4TTV A;  4YRS A;  4YRK A;  1B7Y B;  4P3O A;  2ZNI A;  2ZTG A;  5ELN A;  3MF2 A;  4H2X A;  4TWA A;  1Z7M A;  3NEN A;  1YFT A;  4HVC A;  2P5I A;  4P73 C;  2Q7E A;  2ALY B;  3HRK A;  4XTU A;  4TVA B;  4RMF A;  1H4S A;  3NEM A;  4ZTU B;  3QO8 A;  3VQW A;  4P71 A;  3V8J A;  2Q5I A;  2ART A;  3EFR A;  4YPF A;  2XTI A;  1USY C;  4HWR A;  2P0L A;  3UGT A;  2J3L A;  4P74 C;  4EX5 A;  4TQD A;  2DU5 A;  3DSQ A;  4K88 A;  3UGQ A;  3A5Y A;  1BBW A;  2DTH A;  3IAL A;  4Q15 A;  3WQZ A;  2DU7 A;  2ZZE A;  2ARU A;  2ZIM A;  2EJ9 A;  3V7S A;  4YRR A;  3HXY A;  2HNI A;  2DQ0 A;  2E41 A;  3HFZ A;  2NS6 A;  3UH0 A;  3L4G B;  4TVW A;  3L1A A;  3HY1 A;  1ATI A;  3REX A;  4P71 C;  1G5I A;  2ZT7 A;  4H2V A;  4P72 A;  4XU1 A;  3RGL A;  4LVM A;  5F5W A;  4YRL A;  1NJ8 A;  4H2Y A;  1EVL A;  4LVJ A;  3UFG A;  4ZIB A;  4CS2 A;  3HXU A;  3NEL A;  4KR3 A;  3A32 A;  2CGH A;  3IKM B;  2QHT A;  1QF6 A;  3BFM A;  3QO5 A;  1JJC A;  3M4Q A;  4YRG A;  1RIQ A;  2EL9 A;  4XEO A;  3HTZ A;  4J15 A;  4TQF A;  3VQX A;  4WI1 A;  4UP8 A;  3FJP A;  1B76 A;  3E9H A;  1KMM A;  4UP9 A;  1N9W A;  4OP0 A;  3VBB A;  4H2T A;  4LNS A;  4XEM A;  4XTW A;  1H4Q A;  5KNN A;  1W66 A;  2RHQ B;  2PMF A;  1B8A A;  4P72 C;  4WJ4 A;  2AKW A;  2ZIO A;  1PYS A;  3HXZ A;  4OLF A;  3R07 A;  1QE0 A;  2CJB A;  3P8Y A;  2DEQ A;  2AKW B;  11AS A;  4KQE A;  1PYS B;  4HWT A;  2RHS A;  2ZZF A;  2ZZG A;  2J3M A;  3V7R A;  1VQZ A;  1NJ2 A;  2C7I A;  5C53 B;  5K1P A;  1WNL A;  5C51 B;  2ZT5 A;  4H2X B;  2RHS B;  2E10 A;  4YRM A;  4H2W A;  5HGQ A;  1EIY A;  2DJZ A;  3PZC A;  3A74 A;  2I4L A;  3RUX A;  4YYE A;  1SRY A;  3ICA A;  1E1T A;  1SES A;  1H4V B;  1EIY B;  4KR2 A;  1WQ7 A;  2DXU A;  3VQY A;  3MF1 A;  3A7R A;  4XTZ A;  1E24 A;  2DXT A;  4P3P A;  3BJU A;  4E51 A;  4TVY A;  1SET A;  3HRI A;  1NJ1 A;  2DZ9 A;  3HXW A;  2EJF A;  3QTC A;  3M4P A;  4YRO A;  4X5O A;  1G51 A;  4CH5 A;  2ZR3 A;  2AMC A;  2ODR D;  4RQF A;  3LSS A;  1J5W A;  2C8M A;  1NYR A;  3HFZ B;  1YB3 A;  2E3C A;  4L87 A;  4H2S A;  2AMC B;  2EJG A;  3V8K A;  3REU A;  1BIB A;  5K1X A;  3E9I A;  2DQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...