3RF1A

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rf1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rf1A01
4YRPA 1ASZA 3HFZB 1G5HA 4P71A 4WJ3M 4H2UA 2AKWA 3BFMA 3HXVA 2QHSA 3WQZA 1WYDA 5HGQA 1YFRA 1H4SA 1JJCB 3TUPA 2CJ9A 4P3NA 2RHSB 1H4VB 1ASYA 1ADJA 3P8YA 4J15A 3UH0A 2ZR3A 2I4LA 1BIAA 3HY1A 3A5YA 3NELA 3M4PA 5K1PA 1N9WA 2Q7EA 1B70A 3V8KA 4PG3A 2I4NA 3RL6A 3V7SA 2ZT6A 2E64A 1NYRA 4H2TA 5F5WA 2J3MA 1Z7MA 1H4TA 4CH6A 3RIRA 3R07A 3VBBA 3RGLA 2RHSA 1QE0A 3V7RA 4YCUA 4YRTA 4XU0A 4TQDA 1H4QA 2ALYB 3VQWA 4XTUA 4XTYA 4BWAA 2ZT7A 2ARUA 4K88A 2Q7HA 1X55A 1USYA 2ZIMA 2DXTA 4HVCA 1EVKA 1IL2A 3HFVA 4UPAA 4TTVA 2IY5A 2ZXFA 4XU1A 2DU5A 1NJ2A 1G51A 1EVLA 1VQZA 3HXXA 2DEQA 2I4OA 3FJPA 3DSQA 2DTHA 4KR3A 4BW9A 3QO5A 1BIBA 1W66A 4P3PA 4XEOA 4YRRA 1SERA 4K86A 1HTTA 4HWOA 1J5WA 2E3CA 1PYSA 4YYEA 4P72C 2EJGA 4CS4A 1EFWA 4XTZA 4G84A 1NJ8A 3CMQA 2ZNJA 2ZZGA 1X2HA 4XTXA 2QHUA 4YREA 1B7YB 1ADYA 4X5OA 2DDZA 4HWSA 3REUA 4RQEA 1BBWA 2XGTA 3TEGA 3L1AA 4P75C 1E1OA 1LYLA 2AMCA 2ZT8A 2IY5B 4P3OA 5K1XA 3A31A 2DZ9A 2ZIOA 12ASA 3V8LA 3MF1A 2DQ3A 2CIMA 3A7AA 2C7IA 4YRNA 2ALYA 4P74A 4H2XB 3RKXA 3W3SA 3ICAA 4HA8A 3BJUA 3HXUA 1E22A 3QTCA 1ATIA 2DU7A 4CH3A 3E9IA 4ZIBA 2Q5IA 5C52B 2E65A 5ELOA 3HY0A 4H2WA 2EAYA 5KNNA 1PYSB 2P0LA 4Q15A 2ZZEA 4YP0A 3HXYA 4TVWA 2RHQA 4XTVA 4YRMA 2ZTGA 2XTIA 3RACA 1B76A 4XEMA 4DPGA 4TVAB 3NEMA 1Z7NA 4XU2A 2Q5HA 5C51B 3IALA 3OD1A 4UP9A 3G1ZA 3PCOB 1X54A 3HXZA 1EQRA 2P5IA 1X2GA 1G5IA 1SRYA 2G4CA 4YDQA 2AKWB 4P74C 4YRGA 4P73A 4KQEA 2CGHA 2CJBA 4TWAA 3E9HA 3LC0A 4CH5A 4H2SA 1E24A 3LSSA 4OP0A 4L87A 4NCXA 2E1HA 3M4QA 4YPFA 3RUXA 3ERRA 3TEHB 4WI1A 4RMFA 2ZCEA 2DJZA 2DXUA 2FYKA 2J3LA 1X56A 3A5ZA 2PMFA 2QHTA 3L4GB 4YRCA 2Q7GA 4H2YA 1KOGA 3MEYA 2DTOA 4OLFA 4RQFA 4RDXA 4XTWA 2ZNIA 1WQWA 2DZCA 4G85A 4H02A 3V8JA 2CJAA 4Q6GA 3VQXA 5C53B 4YRLA 3UGQA 1B70B 2DQ0A 3P8VA 2EJFA 3IG2A 4O2DA 2DKGA 4YRJA 4YROA 3V7CA 1HC7A 3PZCA 1KMNA 4HWRA 2ARSA 2E10A 1KMMA 2ZINA 2ZZFA 1X01A 3P8TA 3HRKA 3NETA 2E41A 4YCVA 1USYC 3L4GA 2E5AA 1E1TA 4CS3A 2ZR2A 3A7UA 1NNHA 2PMEA 4KR2A 1YFSA 4WF2A 3QNEA 4HWTA 1GGMA 2AMCB 3HFZA 3A32A 3REXA 4WJ4A 3UGTA 3NENA 4TVYA 4XU3A 3EFSA 2ZT5A 4YRSA 1RIQA 1WNLA 4K87A 3RKYA 4HWPA 3L2ZA 4ZTUB 1C0AA 4CS2A 1NJ1A 1EIYB 4DQ2A 3PCOA 2ODRD 4YCWA 3HRIA 4TVAA 1NYQA 4YRQA 3VQVA 1YGBA 1SESA 1WQ7A 1WPYA 2RHQB 1B8AA 4LNSA 3RKWA 4CH4A 11ASA 2DTIA 1SETA 3IKMB 4PHCA 3HXWA 1JJCA 4UP7A 1QF6A 4H2VA 4YRFA 4P72A 4H2XA 1EOVA 3TEHA 2EJ9A 2ZGWA 3IKLA 4P71C 4EO4A 1BBUA 1HXDA 3LSQA 5E3IA 2C8MA 2EL9A 4P73C 5ELNA 2ARTA 4EX5A 4TQFA 2I4MA 3EFRA 2HNIA 3QO8A 1WLEA 3RF1A 3UFGA 1YFTA 1FYFA 4AH6A 1B7YA 4ZTZB 1NJ5A 1EIYA 3A7RA 4P75A 3MF2A 1WU7A 4YRIA 2EWNA 4UP8A 3HTZA 4E51A 3A74A 1YB3A 1L0WA 2DVEA 3QO7A 1NJ6A 4YRKA 2QHVA 3VQYA 2ODRC 3KFUA 3I7FA
chains in the Genus database with same CATH superfamily
4AI6A 1EZ3A 2HPLA 1G5HA 1FIOA 4H2UA 2I0MA 4WYVA 3PJAJ 1B7TA 4EXTA 3HXVA 2QHSA 2K9AA 1FMWA 4HFBA 1JJCB 2E9XC 5LGTB 3TUPA 4JEHB 2CXLA 2WP9A 1H4VB 4ZI2C 1ADJA 3P8YA 5HWXA 4YTNA 3AA0B 3EVYA 4LVJA 5EK4A 4PFPA 3HY1A 4B3MT 1UURA 5K1PA 5DQVA 4TN7B 4EEBA 2LE8A 3AE8A 1MIYA 4Z8XA 3UUNA 4H2TA 5HEJA 3ZEFB 2PG8A 3CWZB 4CH6A 3RIRA 3KV9A 3RPUA 4JI1T 3Q5DA 4GK0E 1IBKT 2WDQA 3LJCA 4EOZB 3GN5A 4K88A 5AQQB 4X62T 4HWHA 3RYHE 4ZI2D 4YHHT 2CHOA 2IY5A 2ZXFA 3AA1B 5DQWA 5AQKB 1NJ2A 2E9XD 2NW9A 1VQZA 2XJ7A 3PUVF 5ABEA 3MJXA 3G06A 3I0OA 3EDVA 5J2TE 3DSQA 4KR3A 3AXJA 3QO5A 4P3PA 4GYSA 2WMOA 3K3QC 3NZQA 3PUQA 1NAFA 2ZM6T 5CA1E 3KBTA 1J5WA 4JYAT 1EFWA 2CLYB 4G84A 3V5UA 3CMQA 2WDVA 3AEAA 4XTXA 3AEDA 4U3CA 2CEAA 1HNWT 2KLQA 2WU2A 4JI2T 4MLKA 2DDZA 4HWSA 4P1NA 1BBWA 1HG5A 2FJBA 2R6GF 4X5TA 3K3NA 4P3OA 2WAUA 12ASA 2DNXA 3BK9A 3RYCE 2CIMA 3A7AA 2C7IA 1UCUA 2X9XA 3NZPA 3UUBA 2ALYA 4H2XB 3QK6A 5JDQA 3OBVE 2XM2A 5AQUB 3HXUA 5FXZA 3QTCA 2DU7A 2JQ9A 1WFDA 2IHR1 3E9IA 1S94A 4U2YA 3CQCB 4ZIBA 1L0VA 3ZSSA 5JTGA 4LFAT 2Q5IA 2XTLA 3HY0A 3AE9A 2XAFB 4Q15A 4YP0A 4HTEA 2VASA 4ILCA 4KBMB 2BG9E 3KFWX 4UVAB 4TVWA 3T1HT 2UXXB 3AXJB 4YRMA 2ZTGA 4P0AA 3RACA 5BR8T 3O1IA 1Z7NA 4XU2A 4G2AA 3NWIA 2QGSA 3ETVA 2XUEA 2LRKA 3FZLB 3HXZA 2IMLA 1KFYA 1MMAA 2VL0A 5HEGA 1W0AA 3K1SA 3CX8B 3Q2MA 2VURA 2AKWB 1SE7A 2V7MA 2YU2A 4A5XA 2CPTA 2KMFA 4YSZA 1D1AA 2EHOD 4H2SA 3LSSA 3RRCA 4OP0A 1YXRA 1HG2A 2H88A 1MNEA 2BKNA 2MPKA 2JPFA 4RMFA 1M62A 1UK5A 2ZCEA 2V6XA 1WRDA 3CX7B 2DL1A 3L4GB 4H2YA 5LYJE 4HFHA 2SPCA 2VKDA 4ASKA 4OLFA 4RQFA 1D0ZA 2WDRA 3V8JA 1MMGA 3SWHA 5C53B 4YRLA 2ZM8A 1LRZA 4DMVA 3P8VA 3RKGA 3L39A 3IG2A 2H7OA 3P50A 2UXCT 4MHCA 4B3TT 1X9BA 3ZYMA 4I43B 4YRJA 2ODVA 1HC7A 1KNRA 4HWRA 1SUMB 3OYZA 1N36T 2E10A 4HFCA 2ZZFA 2V6YB 1XNQT 5JDHA 3HRKA 3PV0F 2YOEA 4U7YA 4U31A 4IDOA 2LRLA 4E7SA 1WYBA 4CS3A 2WCAA 4AKHA 2BG9C 2WSSV 3HKEE 4HWTA 4TWDA 5J1GA 3AB3B 5FL1A 1HFAA 3DTOA 1S35A 5L3CB 3NVOA 4LF7T 4DV1T 3EFSA 4YJ2E 3LFMA 4YTMA 5FP3A 3L8RA 4ZOLE 4BA9A 1C0AA 1Y64B 4H9OC 4DQ2A 3BQLA 3MKDA 5TAOA 4YCWA 4EIWA 2E5VA 3IF8B 3AVRA 3VQVA 3RI5A 4ZI3D 1SESA 1WPYA 3VR8A 4EGWA 4DUYT 1G8XA 4BJNA 4X65T 2ZLYA 1MMDA 1R8IA 4H9NC 3OVUA 4A97A 4IE0A 2P9BA 2V7LA 4MBQA 2B76A 4UP7A 4H2VA 3N2GE 3KVBA 3UU4A 4TNWA 5JRCB 3ZT6A 4B3ST 5JDNA 1EOVA 3O1JA 2WZIA 3EHZA 5FKYA 2W61A 3QNUA 3IKLA 4P71C 5CJ5A 4EO4A 4LFCT 3LSQA 4ADZA 2CWOA 5E3IA 4P73C 4KMCA 3PUXF 4EX5A 2QVAA 5J2UE 2LJLA 4K0UA 2I4MA 3EFRA 3PUWF 3PE0A 2ZM0A 3RF1A 2XY8B 2YDRA 1GQEA 4BAYB 1LKXA 1E1HB 1MIWA 4I55E 2J47A 1W9RA 1NJ5A 1BR1A 4IDPA 3NBXX 1Y01A 5LXTE 2DWKA 4UP8A 1L0WA 1BR4A 2BBHA 2J1DG 4ZI3C 4DV3T 5HCMA 2BBJA 1NJ6A 4DV2T 4CI2B 2QHVA 4OX9T 3C4WA 4WZXA 4YFSA 4TV8E 3UQ7A 2ODRC 3KFUA 3Q9DA 3I9YA 2W67A 2VVNA 1ASZA 3RIFA 4H9RC 4WJ3M 2IIUA 3K8PC 3KV4A 2BDEA 4ZXLA 3BFMA 4AKGA 4CN4A 1WYDA 2K24A 4U7IA 4UF0A 4LMKA 1XMQT 2NTYA 2CJ9A 5AQPB 1CHUA 2X9YA 5AQVB 5LBMA 4M1PA 2N9DA 3UH0A 2ZR3A 3U78A 2I4LA 3A5YA 4HWDA 3M4PA 3AEBA 3CPZA 3RKOA 2E8IA 4U74A 5IUXA 2C5IT 3V8KA 5C2TA 2KNDA 3RL6A 1NYRA 4AXPA 4FI5A 5F5WA 1NEKA 4DV7T 4ZI7E 1IAPA 3PUSA 4DV5T 3R07A 3AEFA 5HXCA 3VBBA 2NR4A 1QE0A 4YRTA 3I0QA 3ONXA 2XQ5A 4TWFA 4TQDA 1H4QA 2ALYB 3VQWA 4BWAA 3LBXB 4XAXB 2ZIMA 3T8OA 2YK0A 4HVCA 3RIUC 1EVKA 3C50A 4AIUA 5JDFA 3UFEA 2NOXA 3C4XA 4YSYA 4DO0A 5HAXA 1WR6A 5M4YA 2NP9A 2DEQA 2WZHA 4JI0T 4TZ4C 3ETUA 5FL0A 4BW9A 4MALA 4YRRA 2LT3A 3MACA 3KV6A 3HKCE 4K86A 5FMNA 2KSRA 1E2AA 3JAFA 4HWOA 3C64A 2NTXA 2UXNB 1IBMT 1VCTA 4K0KT 4CS4A 3O4XE 4Z90A 3N9MA 3FXEB 2WWUA 4HE8A 4YREA 3MZKB 2OV9A 3FXDB 3P4SA 3L09A 4RQEA 3J7Yq 3HKBE 3VU7H 3IBPA 3TEGA 3P8CD 4C90A 4LVMA 1LYLA 2AMCA 2IY5B 2DZ9A 5IHYA 2OLTA 3ZYKA 2DQ3A 4JI8T 3CK6A 2KXPB 3RKXA 3W3SA 1OWAA 4KHZF 4HA8A 5AQHB 2XQAA 3PTRB 2ZM2A 2BVLA 2W2UA 5JR9C 1D1CA 4E7ZA 4TV9E 2XPKA 1IBLT 2X66A 4AKRB 1E7PA 2E65A 2JMKA 3ZPOA 2EAYA 5KNNA 4XBFB 3ABVA 1ZEEA 4PK4A 4X64T 1D0XA 4O4JE 3UUXB 4IDZA 1MMNA 4XTVA 2G0UA 3EABA 3I9WA 3C98B 5C51B 1IZNB 3PCOB 3AECA 1X54A 4AKLA 1XNRT 1EQRA 3TLSA 1X2GA 2P5IA 2C5KT 4JI5T 3ZMTB 4EAHA 3ZMVB 4IIJE 4IL9A 1LVFA 4EYYR 4YDQA 2LLYA 4P73A 2Q9QA 4O8SA 5FYMA 2CJBA 4KQEA 2J62A 3E9HA 2XQYA 3LC0A 2GK9A 3RC8A 2Y48B 1E24A 2Q9QB 4L87A 1FEWA 3M4QA 4YPFA 3ERRA 2VQET 3GMIA 3BQIA 2Y6XA 2QHTA 4YRCA 2AE9A 4UVCB 4YY3T 2UUAT 4RDXA 3KVAA 4QXCB 3FHNA 1OEDB 1KEYA 3QUJA 2CJAA 2MBGA 3VQXA 4EZ4A 2DQ0A 4ILUA 5ADXL 2ODUA 2E9XB 3CQGB 4KUMB 3C51A 4DIDB 1N34T 4YROA 4ZS3A 2IW5B 3V7CA 1KMNA 3NRXA 2FJAA 2X9HA 1WLXA 5L2LA 2PFVA 5FY1A 3P4QA 4J2CA 3LG7A 3DJBA 3OPCA 2N2NA 5LG4A 1USYC 2X0HA 3ZT5A 4L0RA 2HN1A 4KR2A 5LG3A 1YFSA 2A3DA 2BG9A 3N9OA 3QNEA 4DV4T 3QB5A 2AMCB 1VRBA 4PJNA 3N9QA 3REXA 5LMUT 4WJ4A 3NKZA 1WNLA 3RKYA 1X79A 1I94T 4PJMA 4HWPA 3L2ZA 3WAJA 4F6RC 3ONLC 3EDUA 1HF8A 1VOMA 4TUYE 4ISSA 3SRZA 2ODRD 4IHJE 3HRIA 3UU5A 4TVAA 2L9QA 1NYQA 1YGBA 1WQ7A 1D1BA 4DNDA 2RHQB 4CH4A 4GKJT 3ZMUB 2HN2A 1JNZA 4DR7T 2DTIA 2HH7A 3P4WA 3ZCJA 3IKMB 4BJMA 4PHCA 3HXWA 1JJCA 1QF6A 2W63A 4KP3C 2V7KA 3AE7A 2X51A 4HEAA 2W0GA 2D5UA 4DMWA 2EJ9A 2X67A 3PUAA 1WYCA 2BS4A 2CXDA 1BBUA 4HFVA 1MIVA 2ES0A 4CI1B 2C8MA 1H7CA 4IREA 2EL9A 2MYSA 2XHEB 3AAIA 2V8SV 2ARTA 2JIWA 2YEVC 1U5PA 5HXHA 5LHGB 3TLWA 4LVKA 3N2KE 4Q25A 4JI7T 2EHOC 2HNIA 2YDSA 3QO8A 1OEDC 2CXFA 4NXMT 1YFTA 5CFBA 2YU1A 1B7YA 1YQ3A 1HR0T 5L3GB 5AQGB 4P75A 2MTQA 2C0SA 4A98A 4CXYA 5ETWA 3A74A 1YB3A 4EEDA 3TLVA 5LJMA 4QH5A 2C5JA 2W00A 3AVSA 3QO7A 1ZHCA 3N5LA 5LP6E 4ANJA 2UXBT 5JR9B 4P0BA 2JQHA 3GN5B 5L3EB 5EK2A 3ZLIA 3ZCIA 2DCFA 3ZC1A 3HFZB 1Z8UA 3AEGA 3QB5K 4P71A 3SS1A 1ZKEA 3HA4A 3N2OA 4JV5T 2V6YA 4LVIA 3ZN1B 3HI2A 1FJGT 4QWNB 5HEHA 3W15B 2FBWA 2KWHA 3WQZA 1J5ET 5HGQA 2ZMAA 1H4SA 3UU3A 4HKAA 4P3NA 3JCFA 3E08A 2RHSB 5AQJB 2YDQA 4YTPA 3FZFB 4QH4A 3OTOT 4J15A 1SHZC 1BIAA 2ACZA 3Q5XA 1N9WA 4DR2T 2V5CA 3RQWA 4ZZBA 1XDOA 2N1GA 4NUUA 4JI4T 2I4NA 2FUPA 4ZZCA 2WMNA 2J3MA 3RYIE 3KINB 5JVDE 3WI3A 4CN1A 2X68A 3V7RA 4YCUA 2WS3A 4XU0A 3AA6B 4QKNA 3LK2B 2XAGB 3OJAA 2M6IA 4XTYA 2ARUA 1HX8A 4LF6T 5ABFB 2Q7HA 1USYA 2MAWA 2DXTA 5ABFA 1IL2A 4TWHA 4TTVA 4XU1A 2EHOB 2J4GA 1EVLA 1N32T 1UX5A 5L3DB 2JJ9A 3T1YT 4CZZB 3ZT7A 2UUCT 2I4OA 3FJPA 2DTHA 4NUVA 1W66A 1G73A 5E0OA 4XEOA 1YKEB 1SERA 5FXVA 1IJ6A 2E3CA 3M3ZB 4YYEA 4P72C 2BZBA 2EJGA 2WBLA 4ISTA 2XAJB 4XTZA 3CVRA 2NS6A 1UX4A 2ZZGA 4IT4A 4DR5T 2XQ9A 2QHUA 4OFZA 4CXWA 5L47A 3UU6A 2JRKA 3EI0A 2CRBA 4DUZT 2XGTA 3L1AA 2ZT8A 4FJOA 4LF4T 1XMOT 3I1AA 3RRWA 2XAQB 2ZIOA 3RH3A 3V8LA 3VR9A 2M67A 5FXXA 3JC6C 3LBXA 3PDYA 4IE7A 5DABA 4YLHA 2Z6EA 3BJUA 2DLRA 4UR9A 2LSJA 1ATIA 3ESLA 3MQZA 1KF6A 4IDNA 4OK0A 2CE7A 4CQIA 4HT4A 2PTFA 2DHRA 1XZYA 2JQKA 5C52B 5ELOA 3OYXA 4QXHB 4WNKA 3CQXC 2XSAA 4ZS2A 3SFDA 2P0LA 3QOFA 2XSBA 3H37A 2IC9A 3RHWA 2W62A 2WB5A 1YW0A 2VL8A 4AQYT 5C8YE 5IYZE 2A8EA 2LHRA 4EZHA 4XEMA 3E0ZA 3CX6B 2I59A 1I6ZA 2LKHA 5LA6E 1O3XA 3IALA 3OD1A 3G1ZA 4UP9A 5LHIB 3ZJ1A 2W66A 4JEUB 1NENA 1G5IA 2VB6A 4LF8T 4X1KE 4QXBB 4COFA 5LCYA 4PJLA 4ERRA 4XZCA 5IWAT 3SFEA 3PJAA 2CGHA 4TWAA 1YQ4A 2CLYC 1HNZT 4QX7B 4I0UA 4QX8B 2V1DB 2E1HA 5AQRB 4DR1T 4YHJA 3TEHB 2XAHB 4WI1A 2BVMA 4QHOA 2DXUA 3Q5WA 2FYKA 2J3LA 3RIAA 3ONJA 4V1Av 1X56A 3A5ZA 5LGUB 1JNRA 3RLFF 2Y8DA 4XTWA 3WAKA 1WQWA 2JQQA 4WW0A 4PJJA 1W09A 3CMLA 2DZCA 3LK3B 4Z91A 2RP4A 3UGQA 3FBLA 4YT0A 1T8BA 2A9UA 4X1YE 4PK5A 4H63V 4O2DA 2LM9A 3F2EA 3F57A 2QYWA 1T72A 2HHHT 4DR4T 3C4ZA 5HWYA 1NWMX 3PURA 4QH1A 2ZINA 4HFEA 3JADA 3UUMA 1XDPA 3P8TA 2IAKA 3TKLB 1DU2A 4YCVA 4CI3B 4YSXA 2BS3A 3L4GA 1E1TA 2IUBA 3A7UA 3MK7C 2XM1A 3AAAB 1NNHA 2CA5A 2PMEA 4JI3T 4WF2A 5AQFB 2D0UA 5JRCA 1KK7A 4MFRA 3HFZA 1KNPA 3UGTA 3FZHB 3NENA 3D0TA 5KMGP 4XU3A 5HCJA 2ZT5A 4NPPA 1RIQA 4IL4A 3O9XA 2RA1A 4ZTUB 4CS2A 3RQUA 1NJ1A 3Q5EA 1EIYB 4HFIA 1V9DA 2XQ8A 2E9XA 3M65A 4YRQA 5EZYE 4AISA 2D0TA 3RKWA 1B8AA 2NW8A 4LNSA 1OEDA 4IGUA 3ZMSB 5CGMA 3ANWA 2CMRA 2EHOA 3VRAA 2X0YA 4YRFA 2XQ4A 4UIGA 3AA7B 4UV9B 5AQLB 4CXXA 2KINB 1MNDA 2WM9A 3BQKA 5ELNA 2PJQA 5AQOB 5HEUA 2PBIA 5AQIB 5AQTB 2UUBT 1AJ3A 2LM2A 4I50E 4UVBB 2F4VT 4F8HA 5CA0E 4AQGA 1US7B 4DVDA 4PAGA 4O2AE 5F8PA 4AH6A 4ZHQE 5LNKA 2LOPA 2ACXA 4ILBA 1WU7A 2AXDS 3B5MA 2CWYA 4YRIA 4GOUA 2EWNA 2VQFT 3ZC0A 5HXEA 1ZOYA 4E51A 2K5BB 3AE5A 4N78D 3MXZA 2RPAA 2LSYA 4NIQA 2YINA 4YRKA 4KI0F 3VQYA 4ZEYA 2BG9B 2I6HA 3RYFE 5EK3A 3CKDA 1XWMA 4DBQA 3KV5A 5F3JA 4PW8A 3HL6A 4IE5A 3IEEA 4YRPA 2XASB 3AEEA 3UTKA 2BKPA 1J1JA 1KNZA 2AKWA 4JI6T 5ABGA 5JR9A 4NXNT 3IHRA 2A72A 1YFRA 3PUGA 3AAEB 4GK5E 2LSGA 4LMLA 4A56A 5ABHA 4HWCA 4EB6E 2CCQA 1ASYA 4O4HE 4DV6T 3NELA 5A1LA 5J0ZA 4X66T 2Q7EA 5FVLA 1HNXT 3DP7A 2UXDT 3RC3A 5AQNB 4LVLA 1OXZA 4H9QC 1B70A 1UUSA 4PG3A 4U33A 3V7SA 2ZT6A 2E64A 4YJ3E 1M7KA 3UULA 5BMVE 5AQMB 1Z7MA 4B6XA 1H4TA 2XQ7A 3RGLA 2XZEA 2RHSA 4IE4A 2DWGA 1N33T 5H6RB 5AFUL 4XTUA 2BS2A 2ZT7A 1X55A 4IDQA 2K48A 4B3RT 5L3BB 2XQ6A 3HFVA 3ZSTA 4UPAA 2LHNA 5H6QB 2L8KA 4H9SE 5DJQC 2DU5A 4HFDA 1G51A 2CM0A 1HCIA 5JDLA 1HS7A 4PFOA 3HXXA 3AE3A 1BIBA 2A2FX 4AKIA 1HTTA 3U3IA 1ZP0A 5KX5E 2FJDA 2K3WA 1PYSA 3LSVA 4U2ZA 1QUUA 4HWIB 2LSKA 2H3RA 4L5GA 4LF5T 1NJ8A 4EYUA 2ZNJA 5L4HA 1X2HA 3CIRA 2FJEA 1B7YB 1ADYA 4X5OA 4AQFA 2KWIB 1W0BA 3REUA 3PUZF 3KBUA 4P75C 1VCSA 1E1OA 5LHHB 4GIWA 5K1XA 3A31A 3VRBA 4LF9T 3HKDE 5JQGE 3MF1A 4YRNA 5C3JA 3H3AA 3O1HA 5FY7A 2QRXA 4P74A 3ICAA 5LB7B 2CHNA 1E22A 3ZYLA 2UU9T 4CH3A 2VKJA 5JH7E 2X9WA 4UV8B 2X0LB 2L3LA 1OEDE 3AE2A 4H2WA 1PYSB 2D2SA 2ZZEA 4YXDA 1BR2A 3HXYA 2VKOA 2VWAA 2RHQA 1SA0E 3P4RA 2XTIA 2D9DA 1B76A 4DPGA 4TVAB 3NEMA 2Q5HA 4OHFA 4U72A 2Q9QC 2HPJA 4EV6A 4P09A 2WWVA 5L4EA 3VKGA 3ZKRA 3ZMZB 4O4IE 2OA5A 4UEMA 2XQ3A 1SRYA 2G4CA 3F31A 3R84B 3RX6A 4P74C 2VK9A 3LDQB 4YRGA 2VVSA 2E5LT 3H3MA 4G63A 4JBWF 4X1IE 3N9LA 4CH5A 5HXSA 3N9NA 5AQSB 3RIUA 2LKGA 4NCXA 5LGNB 3PUYF 1YKHB 3RUXA 2Q9QD 3SOLA 2MOZA 4UELA 3AE1A 1FMVA 2DJZA 4PNIA 3A7MA 2PMFA 2NWBA 2Q7GA 3PU3A 3ZJ2A 1KOGA 3MEYA 2DTOA 2IDOB 4AQFC 2BKOA 3JAEA 2ZNIA 3AE6A 1QLBA 4G85A 2H89A 2V5DA 4H02A 2IC6A 4ILAA 4Q6GA 2QA7A 3HR0A 3TLTA 3KDSE 1B70B 2EJFA 1LVKA 4L9IA 2WY2A 3LK42 1T98A 4WBNE 5KDMC 3FB2A 2CBIA 3PU8A 4TNVA 2DKGA 3PZCA 3FZKB 5JDGA 4H63H 3L3PA 2W4XA 4CN6A 2ARSA 1KMMA 1X01A 4HWFA 3B57A 4GKKT 3UQ4A 2DI4A 3NETA 5FY0A 3N9PA 2E41A 4TX5A 5HXRA 1HX1B 3A8YC 2E5AA 4UF0B 2ZR2A 5FXWA 5LBQB 4OYKA 3FBZA 4GYRA 3GWHA 2JMHA 1GGMA 2CBJA 3UU8A 1T7SA 4LMJA 3A32A 3P7IA 2H7VC 5JDMA 3GA8A 4IE6A 5KXJA 4TVYA 3EUHA 4O4LE 4YRSA 4K87A 4O2BE 2V7JA 3EAMA 3IA3A 5FVKA 2VKHA 3PCOA 3VHLA 5LJNA 2KZ7B 3JC6D 2V26A 5LMNT 4DR3T 2LOSA 4WBOA 2M6BA 4DV0T 3S4UA 11ASA 4JUYA 1SETA 1Z0PA 1WCRA 4DBRA 3MA9A 1U4QA 2KT9A 4P72A 4H2XA 2YN6A 3QC9A 3VKHA 1HTJF 5HYAA 3AE4A 5L3FB 4UXNB 1UGOA 3TEHA 2ZGWA 4OYJA 1IJ5A 1HXDA 3OKQA 3E22E 1ZV4X 2WU5A 3J9X1 3ANWB 4KHPT 4HN9A 3NRYA 3A5XA 4TQFA 5LOVE 1QSDA 4KX6A 3V5SA 1WR0A 2LEHA 1CUNA 1YD8G 3X1DA 4HGAA 1WLEA 3UFGA 2YKSA 4C91A 2LSIA 4JLEA 1FYFA 3K3OA 4ZTZB 4H9PC 5GONE 1EIYA 4PK6A 3A7RA 5HEOA 3MF2A 4LFBT 3R6NA 3UT5E 1D0YA 3ZN0B 3HTZA 4X20E 5JREA 2DVEA 3B13A 4I4TE 4DR6T 5FNVE 2NW7A 3TLUA 2WQYA 3P4PA 2B1EA 2V7IA 1BR0A 2E2AA 5CB4E 3FZMB 3I7FA
chains in the Genus database with same CATH topology
4YRPA 1ASZA 3HFZB 1G5HA 4P71A 4WJ3M 4H2UA 4LVIA 2AKWA 3BFMA 3HXVA 2QHSA 3WQZA 1WYDA 5HGQA 1YFRA 1H4SA 1JJCB 3TUPA 2CJ9A 4P3NA 2RHSB 1H4VB 1ASYA 1ADJA 3P8YA 4J15A 4LVJA 3UH0A 2ZR3A 2I4LA 1BIAA 3HY1A 3A5YA 3NELA 3M4PA 5K1PA 1N9WA 2Q7EA 4LVLA 1B70A 3V8KA 4PG3A 2I4NA 3RL6A 3V7SA 2ZT6A 2E64A 1NYRA 4H2TA 5F5WA 2J3MA 1Z7MA 1H4TA 4CH6A 3RIRA 3R07A 3VBBA 3RGLA 2RHSA 1QE0A 3V7RA 4YCUA 4YRTA 4XU0A 4TQDA 1H4QA 2ALYB 3VQWA 4XTUA 4XTYA 4BWAA 2ZT7A 2ARUA 4K88A 2Q7HA 1X55A 1USYA 2ZIMA 2DXTA 4HVCA 1EVKA 1IL2A 3HFVA 4UPAA 4TTVA 2IY5A 2ZXFA 4XU1A 2DU5A 1NJ2A 1G51A 1EVLA 1VQZA 3HXXA 2DEQA 2I4OA 3FJPA 3DSQA 2DTHA 4KR3A 4BW9A 3QO5A 1BIBA 1W66A 4P3PA 4XEOA 4YRRA 1SERA 4K86A 1HTTA 4HWOA 1J5WA 2E3CA 1PYSA 4YYEA 4P72C 2EJGA 4CS4A 1EFWA 4XTZA 2NS6A 4G84A 1NJ8A 3CMQA 2ZNJA 2ZZGA 1X2HA 4XTXA 2QHUA 4YREA 1B7YB 1ADYA 4X5OA 2DDZA 4HWSA 3REUA 4RQEA 1BBWA 2XGTA 3TEGA 3L1AA 4P75C 4LVMA 1E1OA 1LYLA 2AMCA 2ZT8A 2IY5B 4P3OA 5K1XA 3A31A 2DZ9A 2ZIOA 12ASA 3V8LA 3MF1A 2DQ3A 2CIMA 3A7AA 2C7IA 4YRNA 2ALYA 4P74A 4H2XB 3RKXA 3W3SA 3ICAA 4HA8A 3BJUA 3HXUA 1E22A 3QTCA 1ATIA 2DU7A 3MQZA 4CH3A 3E9IA 4HT4A 4ZIBA 2Q5IA 5C52B 2E65A 5ELOA 3HY0A 4H2WA 2EAYA 5KNNA 1PYSB 2P0LA 4Q15A 2ZZEA 4YP0A 3HXYA 4TVWA 2RHQA 4XTVA 4YRMA 2ZTGA 2A8EA 2XTIA 3RACA 1B76A 4XEMA 4DPGA 4TVAB 3NEMA 1Z7NA 4XU2A 2Q5HA 5C51B 3IALA 3OD1A 4UP9A 3G1ZA 3PCOB 1X54A 3HXZA 1EQRA 2P5IA 1X2GA 1G5IA 1SRYA 2G4CA 4YDQA 2AKWB 4P74C 4YRGA 4P73A 4KQEA 2CGHA 2CJBA 4TWAA 3E9HA 3LC0A 4CH5A 4H2SA 1E24A 3LSSA 4OP0A 4L87A 4NCXA 2E1HA 3M4QA 4YPFA 3RUXA 3ERRA 3TEHB 4WI1A 4RMFA 2ZCEA 2DJZA 2DXUA 2FYKA 2J3LA 1X56A 3A5ZA 2PMFA 2QHTA 3L4GB 4YRCA 2Q7GA 4H2YA 1KOGA 3MEYA 2DTOA 4OLFA 4RQFA 4RDXA 4XTWA 2ZNIA 1WQWA 2DZCA 4G85A 4H02A 3V8JA 2CJAA 4Q6GA 3VQXA 5C53B 4YRLA 3UGQA 1B70B 2DQ0A 3P8VA 2EJFA 3IG2A 4O2DA 2DKGA 4YRJA 4YROA 3V7CA 1HC7A 3PZCA 1KMNA 4HWRA 2ARSA 2E10A 1KMMA 2ZINA 2ZZFA 1X01A 3P8TA 3HRKA 3NETA 2E41A 4YCVA 1USYC 3L4GA 2E5AA 1E1TA 4CS3A 2ZR2A 3A7UA 1NNHA 2PMEA 4KR2A 1YFSA 4WF2A 3QNEA 4HWTA 1GGMA 2AMCB 3HFZA 3A32A 3REXA 4WJ4A 3UGTA 3NENA 4TVYA 4XU3A 3EFSA 2ZT5A 4YRSA 1RIQA 1WNLA 4K87A 3RKYA 4HWPA 3L2ZA 4ZTUB 1C0AA 4CS2A 1NJ1A 1EIYB 4DQ2A 3PCOA 2ODRD 4YCWA 3HRIA 4TVAA 1NYQA 4YRQA 3VQVA 1YGBA 1SESA 1WQ7A 1WPYA 2RHQB 1B8AA 4LNSA 3RKWA 4CH4A 11ASA 2DTIA 1SETA 3IKMB 4PHCA 3HXWA 1JJCA 4UP7A 1QF6A 4H2VA 4YRFA 4P72A 4H2XA 1EOVA 3TEHA 2EJ9A 2ZGWA 3IKLA 4P71C 4EO4A 1BBUA 1HXDA 3LSQA 5E3IA 2C8MA 2EL9A 4P73C 5ELNA 2ARTA 4EX5A 4TQFA 2I4MA 3EFRA 4LVKA 2HNIA 3QO8A 1WLEA 3RF1A 3UFGA 1YFTA 1FYFA 4AH6A 1B7YA 4ZTZB 1NJ5A 1EIYA 3A7RA 4P75A 3MF2A 1WU7A 4YRIA 2EWNA 4UP8A 3HTZA 4E51A 3A74A 1YB3A 1L0WA 2DVEA 3QO7A 1NJ6A 4YRKA 2QHVA 3VQYA 2ODRC 3KFUA 3I7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRP A;  1ASZ A;  3HFZ B;  1G5H A;  4P71 A;  4WJ3 M;  4H2U A;  2AKW A;  3BFM A;  3HXV A;  2QHS A;  3WQZ A;  1WYD A;  5HGQ A;  1YFR A;  1H4S A;  1JJC B;  3TUP A;  2CJ9 A;  4P3N A;  2RHS B;  1H4V B;  1ASY A;  1ADJ A;  3P8Y A;  4J15 A;  3UH0 A;  2ZR3 A;  2I4L A;  1BIA A;  3HY1 A;  3A5Y A;  3NEL A;  3M4P A;  5K1P A;  1N9W A;  2Q7E A;  1B70 A;  3V8K A;  4PG3 A;  2I4N A;  3RL6 A;  3V7S A;  2ZT6 A;  2E64 A;  1NYR A;  4H2T A;  5F5W A;  2J3M A;  1Z7M A;  1H4T A;  4CH6 A;  3RIR A;  3R07 A;  3VBB A;  3RGL A;  2RHS A;  1QE0 A;  3V7R A;  4YCU A;  4YRT A;  4XU0 A;  4TQD A;  1H4Q A;  2ALY B;  3VQW A;  4XTU A;  4XTY A;  4BWA A;  2ZT7 A;  2ARU A;  4K88 A;  2Q7H A;  1X55 A;  1USY A;  2ZIM A;  2DXT A;  4HVC A;  1EVK A;  1IL2 A;  3HFV A;  4UPA A;  4TTV A;  2IY5 A;  2ZXF A;  4XU1 A;  2DU5 A;  1NJ2 A;  1G51 A;  1EVL A;  1VQZ A;  3HXX A;  2DEQ A;  2I4O A;  3FJP A;  3DSQ A;  2DTH A;  4KR3 A;  4BW9 A;  3QO5 A;  1BIB A;  1W66 A;  4P3P A;  4XEO A;  4YRR A;  1SER A;  4K86 A;  1HTT A;  4HWO A;  1J5W A;  2E3C A;  1PYS A;  4YYE A;  4P72 C;  2EJG A;  4CS4 A;  1EFW A;  4XTZ A;  4G84 A;  1NJ8 A;  3CMQ A;  2ZNJ A;  2ZZG A;  1X2H A;  4XTX A;  2QHU A;  4YRE A;  1B7Y B;  1ADY A;  4X5O A;  2DDZ A;  4HWS A;  3REU A;  4RQE A;  1BBW A;  2XGT A;  3TEG A;  3L1A A;  4P75 C;  1E1O A;  1LYL A;  2AMC A;  2ZT8 A;  2IY5 B;  4P3O A;  5K1X A;  3A31 A;  2DZ9 A;  2ZIO A;  12AS A;  3V8L A;  3MF1 A;  2DQ3 A;  2CIM A;  3A7A A;  2C7I A;  4YRN A;  2ALY A;  4P74 A;  4H2X B;  3RKX A;  3W3S A;  3ICA A;  4HA8 A;  3BJU A;  3HXU A;  1E22 A;  3QTC A;  1ATI A;  2DU7 A;  4CH3 A;  3E9I A;  4ZIB A;  2Q5I A;  5C52 B;  2E65 A;  5ELO A;  3HY0 A;  4H2W A;  2EAY A;  5KNN A;  1PYS B;  2P0L A;  4Q15 A;  2ZZE A;  4YP0 A;  3HXY A;  4TVW A;  2RHQ A;  4XTV A;  4YRM A;  2ZTG A;  2XTI A;  3RAC A;  1B76 A;  4XEM A;  4DPG A;  4TVA B;  3NEM A;  1Z7N A;  4XU2 A;  2Q5H A;  5C51 B;  3IAL A;  3OD1 A;  4UP9 A;  3G1Z A;  3PCO B;  1X54 A;  3HXZ A;  1EQR A;  2P5I A;  1X2G A;  1G5I A;  1SRY A;  2G4C A;  4YDQ A;  2AKW B;  4P74 C;  4YRG A;  4P73 A;  4KQE A;  2CGH A;  2CJB A;  4TWA A;  3E9H A;  3LC0 A;  4CH5 A;  4H2S A;  1E24 A;  3LSS A;  4OP0 A;  4L87 A;  4NCX A;  2E1H A;  3M4Q A;  4YPF A;  3RUX A;  3ERR A;  3TEH B;  4WI1 A;  4RMF A;  2ZCE A;  2DJZ A;  2DXU A;  2FYK A;  2J3L A;  1X56 A;  3A5Z A;  2PMF A;  2QHT A;  3L4G B;  4YRC A;  2Q7G A;  4H2Y A;  1KOG A;  3MEY A;  2DTO A;  4OLF A;  4RQF A;  4RDX A;  4XTW A;  2ZNI A;  1WQW A;  2DZC A;  4G85 A;  4H02 A;  3V8J A;  2CJA A;  4Q6G A;  3VQX A;  5C53 B;  4YRL A;  3UGQ A;  1B70 B;  2DQ0 A;  3P8V A;  2EJF A;  3IG2 A;  4O2D A;  2DKG A;  4YRJ A;  4YRO A;  3V7C A;  1HC7 A;  3PZC A;  1KMN A;  4HWR A;  2ARS A;  2E10 A;  1KMM A;  2ZIN A;  2ZZF A;  1X01 A;  3P8T A;  3HRK A;  3NET A;  2E41 A;  4YCV A;  1USY C;  3L4G A;  2E5A A;  1E1T A;  4CS3 A;  2ZR2 A;  3A7U A;  1NNH A;  2PME A;  4KR2 A;  1YFS A;  4WF2 A;  3QNE A;  4HWT A;  1GGM A;  2AMC B;  3HFZ A;  3A32 A;  3REX A;  4WJ4 A;  3UGT A;  3NEN A;  4TVY A;  4XU3 A;  3EFS A;  2ZT5 A;  4YRS A;  1RIQ A;  1WNL A;  4K87 A;  3RKY A;  4HWP A;  3L2Z A;  4ZTU B;  1C0A A;  4CS2 A;  1NJ1 A;  1EIY B;  4DQ2 A;  3PCO A;  2ODR D;  4YCW A;  3HRI A;  4TVA A;  1NYQ A;  4YRQ A;  3VQV A;  1YGB A;  1SES A;  1WQ7 A;  1WPY A;  2RHQ B;  1B8A A;  4LNS A;  3RKW A;  4CH4 A;  11AS A;  2DTI A;  1SET A;  3IKM B;  4PHC A;  3HXW A;  1JJC A;  4UP7 A;  1QF6 A;  4H2V A;  4YRF A;  4P72 A;  4H2X A;  1EOV A;  3TEH A;  2EJ9 A;  2ZGW A;  3IKL A;  4P71 C;  4EO4 A;  1BBU A;  1HXD A;  3LSQ A;  5E3I A;  2C8M A;  2EL9 A;  4P73 C;  5ELN A;  2ART A;  4EX5 A;  4TQF A;  2I4M A;  3EFR A;  2HNI A;  3QO8 A;  1WLE A;  3RF1 A;  3UFG A;  1YFT A;  1FYF A;  4AH6 A;  1B7Y A;  4ZTZ B;  1NJ5 A;  1EIY A;  3A7R A;  4P75 A;  3MF2 A;  1WU7 A;  4YRI A;  2EWN A;  4UP8 A;  3HTZ A;  4E51 A;  3A74 A;  1YB3 A;  1L0W A;  2DVE A;  3QO7 A;  1NJ6 A;  4YRK A;  2QHV A;  3VQY A;  2ODR C;  3KFU A;  3I7F A; 
#chains in the Genus database with same CATH topology
 4AI6 A;  1EZ3 A;  2HPL A;  1G5H A;  1FIO A;  4H2U A;  2I0M A;  4WYV A;  3PJA J;  1B7T A;  4EXT A;  3HXV A;  2QHS A;  2K9A A;  1FMW A;  4HFB A;  1JJC B;  2E9X C;  5LGT B;  3TUP A;  4JEH B;  2CXL A;  2WP9 A;  1H4V B;  4ZI2 C;  1ADJ A;  3P8Y A;  5HWX A;  4YTN A;  3AA0 B;  3EVY A;  4LVJ A;  5EK4 A;  4PFP A;  3HY1 A;  4B3M T;  1UUR A;  5K1P A;  5DQV A;  4TN7 B;  4EEB A;  2LE8 A;  3AE8 A;  1MIY A;  4Z8X A;  3UUN A;  4H2T A;  5HEJ A;  3ZEF B;  2PG8 A;  3CWZ B;  4CH6 A;  3RIR A;  3KV9 A;  3RPU A;  4JI1 T;  3Q5D A;  4GK0 E;  1IBK T;  2WDQ A;  3LJC A;  4EOZ B;  3GN5 A;  4K88 A;  5AQQ B;  4X62 T;  4HWH A;  3RYH E;  4ZI2 D;  4YHH T;  2CHO A;  2IY5 A;  2ZXF A;  3AA1 B;  5DQW A;  5AQK B;  1NJ2 A;  2E9X D;  2NW9 A;  1VQZ A;  2XJ7 A;  3PUV F;  5ABE A;  3MJX A;  3G06 A;  3I0O A;  3EDV A;  5J2T E;  3DSQ A;  4KR3 A;  3AXJ A;  3QO5 A;  4P3P A;  4GYS A;  2WMO A;  3K3Q C;  3NZQ A;  3PUQ A;  1NAF A;  2ZM6 T;  5CA1 E;  3KBT A;  1J5W A;  4JYA T;  1EFW A;  2CLY B;  4G84 A;  3V5U A;  3CMQ A;  2WDV A;  3AEA A;  4XTX A;  3AED A;  4U3C A;  2CEA A;  1HNW T;  2KLQ A;  2WU2 A;  4JI2 T;  4MLK A;  2DDZ A;  4HWS A;  4P1N A;  1BBW A;  1HG5 A;  2FJB A;  2R6G F;  4X5T A;  3K3N A;  4P3O A;  2WAU A;  12AS A;  2DNX A;  3BK9 A;  3RYC E;  2CIM A;  3A7A A;  2C7I A;  1UCU A;  2X9X A;  3NZP A;  3UUB A;  2ALY A;  4H2X B;  3QK6 A;  5JDQ A;  3OBV E;  2XM2 A;  5AQU B;  3HXU A;  5FXZ A;  3QTC A;  2DU7 A;  2JQ9 A;  1WFD A;  2IHR 1;  3E9I A;  1S94 A;  4U2Y A;  3CQC B;  4ZIB A;  1L0V A;  3ZSS A;  5JTG A;  4LFA T;  2Q5I A;  2XTL A;  3HY0 A;  3AE9 A;  2XAF B;  4Q15 A;  4YP0 A;  4HTE A;  2VAS A;  4ILC A;  4KBM B;  2BG9 E;  3KFW X;  4UVA B;  4TVW A;  3T1H T;  2UXX B;  3AXJ B;  4YRM A;  2ZTG A;  4P0A A;  3RAC A;  5BR8 T;  3O1I A;  1Z7N A;  4XU2 A;  4G2A A;  3NWI A;  2QGS A;  3ETV A;  2XUE A;  2LRK A;  3FZL B;  3HXZ A;  2IML A;  1KFY A;  1MMA A;  2VL0 A;  5HEG A;  1W0A A;  3K1S A;  3CX8 B;  3Q2M A;  2VUR A;  2AKW B;  1SE7 A;  2V7M A;  2YU2 A;  4A5X A;  2CPT A;  2KMF A;  4YSZ A;  1D1A A;  2EHO D;  4H2S A;  3LSS A;  3RRC A;  4OP0 A;  1YXR A;  1HG2 A;  2H88 A;  1MNE A;  2BKN A;  2MPK A;  2JPF A;  4RMF A;  1M62 A;  1UK5 A;  2ZCE A;  2V6X A;  1WRD A;  3CX7 B;  2DL1 A;  3L4G B;  4H2Y A;  5LYJ E;  4HFH A;  2SPC A;  2VKD A;  4ASK A;  4OLF A;  4RQF A;  1D0Z A;  2WDR A;  3V8J A;  1MMG A;  3SWH A;  5C53 B;  4YRL A;  2ZM8 A;  1LRZ A;  4DMV A;  3P8V A;  3RKG A;  3L39 A;  3IG2 A;  2H7O A;  3P50 A;  2UXC T;  4MHC A;  4B3T T;  1X9B A;  3ZYM A;  4I43 B;  4YRJ A;  2ODV A;  1HC7 A;  1KNR A;  4HWR A;  1SUM B;  3OYZ A;  1N36 T;  2E10 A;  4HFC A;  2ZZF A;  2V6Y B;  1XNQ T;  5JDH A;  3HRK A;  3PV0 F;  2YOE A;  4U7Y A;  4U31 A;  4IDO A;  2LRL A;  4E7S A;  1WYB A;  4CS3 A;  2WCA A;  4AKH A;  2BG9 C;  2WSS V;  3HKE E;  4HWT A;  4TWD A;  5J1G A;  3AB3 B;  5FL1 A;  1HFA A;  3DTO A;  1S35 A;  5L3C B;  3NVO A;  4LF7 T;  4DV1 T;  3EFS A;  4YJ2 E;  3LFM A;  4YTM A;  5FP3 A;  3L8R A;  4ZOL E;  4BA9 A;  1C0A A;  1Y64 B;  4H9O C;  4DQ2 A;  3BQL A;  3MKD A;  5TAO A;  4YCW A;  4EIW A;  2E5V A;  3IF8 B;  3AVR A;  3VQV A;  3RI5 A;  4ZI3 D;  1SES A;  1WPY A;  3VR8 A;  4EGW A;  4DUY T;  1G8X A;  4BJN A;  4X65 T;  2ZLY A;  1MMD A;  1R8I A;  4H9N C;  3OVU A;  4A97 A;  4IE0 A;  2P9B A;  2V7L A;  4MBQ A;  2B76 A;  4UP7 A;  4H2V A;  3N2G E;  3KVB A;  3UU4 A;  4TNW A;  5JRC B;  3ZT6 A;  4B3S T;  5JDN A;  1EOV A;  3O1J A;  2WZI A;  3EHZ A;  5FKY A;  2W61 A;  3QNU A;  3IKL A;  4P71 C;  5CJ5 A;  4EO4 A;  4LFC T;  3LSQ A;  4ADZ A;  2CWO A;  5E3I A;  4P73 C;  4KMC A;  3PUX F;  4EX5 A;  2QVA A;  5J2U E;  2LJL A;  4K0U A;  2I4M A;  3EFR A;  3PUW F;  3PE0 A;  2ZM0 A;  3RF1 A;  2XY8 B;  2YDR A;  1GQE A;  4BAY B;  1LKX A;  1E1H B;  1MIW A;  4I55 E;  2J47 A;  1W9R A;  1NJ5 A;  1BR1 A;  4IDP A;  3NBX X;  1Y01 A;  5LXT E;  2DWK A;  4UP8 A;  1L0W A;  1BR4 A;  2BBH A;  2J1D G;  4ZI3 C;  4DV3 T;  5HCM A;  2BBJ A;  1NJ6 A;  4DV2 T;  4CI2 B;  2QHV A;  4OX9 T;  3C4W A;  4WZX A;  4YFS A;  4TV8 E;  3UQ7 A;  2ODR C;  3KFU A;  3Q9D A;  3I9Y A;  2W67 A;  2VVN A;  1ASZ A;  3RIF A;  4H9R C;  4WJ3 M;  2IIU A;  3K8P C;  3KV4 A;  2BDE A;  4ZXL A;  3BFM A;  4AKG A;  4CN4 A;  1WYD A;  2K24 A;  4U7I A;  4UF0 A;  4LMK A;  1XMQ T;  2NTY A;  2CJ9 A;  5AQP B;  1CHU A;  2X9Y A;  5AQV B;  5LBM A;  4M1P A;  2N9D A;  3UH0 A;  2ZR3 A;  3U78 A;  2I4L A;  3A5Y A;  4HWD A;  3M4P A;  3AEB A;  3CPZ A;  3RKO A;  2E8I A;  4U74 A;  5IUX A;  2C5I T;  3V8K A;  5C2T A;  2KND A;  3RL6 A;  1NYR A;  4AXP A;  4FI5 A;  5F5W A;  1NEK A;  4DV7 T;  4ZI7 E;  1IAP A;  3PUS A;  4DV5 T;  3R07 A;  3AEF A;  5HXC A;  3VBB A;  2NR4 A;  1QE0 A;  4YRT A;  3I0Q A;  3ONX A;  2XQ5 A;  4TWF A;  4TQD A;  1H4Q A;  2ALY B;  3VQW A;  4BWA A;  3LBX B;  4XAX B;  2ZIM A;  3T8O A;  2YK0 A;  4HVC A;  3RIU C;  1EVK A;  3C50 A;  4AIU A;  5JDF A;  3UFE A;  2NOX A;  3C4X A;  4YSY A;  4DO0 A;  5HAX A;  1WR6 A;  5M4Y A;  2NP9 A;  2DEQ A;  2WZH A;  4JI0 T;  4TZ4 C;  3ETU A;  5FL0 A;  4BW9 A;  4MAL A;  4YRR A;  2LT3 A;  3MAC A;  3KV6 A;  3HKC E;  4K86 A;  5FMN A;  2KSR A;  1E2A A;  3JAF A;  4HWO A;  3C64 A;  2NTX A;  2UXN B;  1IBM T;  1VCT A;  4K0K T;  4CS4 A;  3O4X E;  4Z90 A;  3N9M A;  3FXE B;  2WWU A;  4HE8 A;  4YRE A;  3MZK B;  2OV9 A;  3FXD B;  3P4S A;  3L09 A;  4RQE A;  3J7Y q;  3HKB E;  3VU7 H;  3IBP A;  3TEG A;  3P8C D;  4C90 A;  4LVM A;  1LYL A;  2AMC A;  2IY5 B;  2DZ9 A;  5IHY A;  2OLT A;  3ZYK A;  2DQ3 A;  4JI8 T;  3CK6 A;  2KXP B;  3RKX A;  3W3S A;  1OWA A;  4KHZ F;  4HA8 A;  5AQH B;  2XQA A;  3PTR B;  2ZM2 A;  2BVL A;  2W2U A;  5JR9 C;  1D1C A;  4E7Z A;  4TV9 E;  2XPK A;  1IBL T;  2X66 A;  4AKR B;  1E7P A;  2E65 A;  2JMK A;  3ZPO A;  2EAY A;  5KNN A;  4XBF B;  3ABV A;  1ZEE A;  4PK4 A;  4X64 T;  1D0X A;  4O4J E;  3UUX B;  4IDZ A;  1MMN A;  4XTV A;  2G0U A;  3EAB A;  3I9W A;  3C98 B;  5C51 B;  1IZN B;  3PCO B;  3AEC A;  1X54 A;  4AKL A;  1XNR T;  1EQR A;  3TLS A;  1X2G A;  2P5I A;  2C5K T;  4JI5 T;  3ZMT B;  4EAH A;  3ZMV B;  4IIJ E;  4IL9 A;  1LVF A;  4EYY R;  4YDQ A;  2LLY A;  4P73 A;  2Q9Q A;  4O8S A;  5FYM A;  2CJB A;  4KQE A;  2J62 A;  3E9H A;  2XQY A;  3LC0 A;  2GK9 A;  3RC8 A;  2Y48 B;  1E24 A;  2Q9Q B;  4L87 A;  1FEW A;  3M4Q A;  4YPF A;  3ERR A;  2VQE T;  3GMI A;  3BQI A;  2Y6X A;  2QHT A;  4YRC A;  2AE9 A;  4UVC B;  4YY3 T;  2UUA T;  4RDX A;  3KVA A;  4QXC B;  3FHN A;  1OED B;  1KEY A;  3QUJ A;  2CJA A;  2MBG A;  3VQX A;  4EZ4 A;  2DQ0 A;  4ILU A;  5ADX L;  2ODU A;  2E9X B;  3CQG B;  4KUM B;  3C51 A;  4DID B;  1N34 T;  4YRO A;  4ZS3 A;  2IW5 B;  3V7C A;  1KMN A;  3NRX A;  2FJA A;  2X9H A;  1WLX A;  5L2L A;  2PFV A;  5FY1 A;  3P4Q A;  4J2C A;  3LG7 A;  3DJB A;  3OPC A;  2N2N A;  5LG4 A;  1USY C;  2X0H A;  3ZT5 A;  4L0R A;  2HN1 A;  4KR2 A;  5LG3 A;  1YFS A;  2A3D A;  2BG9 A;  3N9O A;  3QNE A;  4DV4 T;  3QB5 A;  2AMC B;  1VRB A;  4PJN A;  3N9Q A;  3REX A;  5LMU T;  4WJ4 A;  3NKZ A;  1WNL A;  3RKY A;  1X79 A;  1I94 T;  4PJM A;  4HWP A;  3L2Z A;  3WAJ A;  4F6R C;  3ONL C;  3EDU A;  1HF8 A;  1VOM A;  4TUY E;  4ISS A;  3SRZ A;  2ODR D;  4IHJ E;  3HRI A;  3UU5 A;  4TVA A;  2L9Q A;  1NYQ A;  1YGB A;  1WQ7 A;  1D1B A;  4DND A;  2RHQ B;  4CH4 A;  4GKJ T;  3ZMU B;  2HN2 A;  1JNZ A;  4DR7 T;  2DTI A;  2HH7 A;  3P4W A;  3ZCJ A;  3IKM B;  4BJM A;  4PHC A;  3HXW A;  1JJC A;  1QF6 A;  2W63 A;  4KP3 C;  2V7K A;  3AE7 A;  2X51 A;  4HEA A;  2W0G A;  2D5U A;  4DMW A;  2EJ9 A;  2X67 A;  3PUA A;  1WYC A;  2BS4 A;  2CXD A;  1BBU A;  4HFV A;  1MIV A;  2ES0 A;  4CI1 B;  2C8M A;  1H7C A;  4IRE A;  2EL9 A;  2MYS A;  2XHE B;  3AAI A;  2V8S V;  2ART A;  2JIW A;  2YEV C;  1U5P A;  5HXH A;  5LHG B;  3TLW A;  4LVK A;  3N2K E;  4Q25 A;  4JI7 T;  2EHO C;  2HNI A;  2YDS A;  3QO8 A;  1OED C;  2CXF A;  4NXM T;  1YFT A;  5CFB A;  2YU1 A;  1B7Y A;  1YQ3 A;  1HR0 T;  5L3G B;  5AQG B;  4P75 A;  2MTQ A;  2C0S A;  4A98 A;  4CXY A;  5ETW A;  3A74 A;  1YB3 A;  4EED A;  3TLV A;  5LJM A;  4QH5 A;  2C5J A;  2W00 A;  3AVS A;  3QO7 A;  1ZHC A;  3N5L A;  5LP6 E;  4ANJ A;  2UXB T;  5JR9 B;  4P0B A;  2JQH A;  3GN5 B;  5L3E B;  5EK2 A;  3ZLI A;  3ZCI A;  2DCF A;  3ZC1 A;  3HFZ B;  1Z8U A;  3AEG A;  3QB5 K;  4P71 A;  3SS1 A;  1ZKE A;  3HA4 A;  3N2O A;  4JV5 T;  2V6Y A;  4LVI A;  3ZN1 B;  3HI2 A;  1FJG T;  4QWN B;  5HEH A;  3W15 B;  2FBW A;  2KWH A;  3WQZ A;  1J5E T;  5HGQ A;  2ZMA A;  1H4S A;  3UU3 A;  4HKA A;  4P3N A;  3JCF A;  3E08 A;  2RHS B;  5AQJ B;  2YDQ A;  4YTP A;  3FZF B;  4QH4 A;  3OTO T;  4J15 A;  1SHZ C;  1BIA A;  2ACZ A;  3Q5X A;  1N9W A;  4DR2 T;  2V5C A;  3RQW A;  4ZZB A;  1XDO A;  2N1G A;  4NUU A;  4JI4 T;  2I4N A;  2FUP A;  4ZZC A;  2WMN A;  2J3M A;  3RYI E;  3KIN B;  5JVD E;  3WI3 A;  4CN1 A;  2X68 A;  3V7R A;  4YCU A;  2WS3 A;  4XU0 A;  3AA6 B;  4QKN A;  3LK2 B;  2XAG B;  3OJA A;  2M6I A;  4XTY A;  2ARU A;  1HX8 A;  4LF6 T;  5ABF B;  2Q7H A;  1USY A;  2MAW A;  2DXT A;  5ABF A;  1IL2 A;  4TWH A;  4TTV A;  4XU1 A;  2EHO B;  2J4G A;  1EVL A;  1N32 T;  1UX5 A;  5L3D B;  2JJ9 A;  3T1Y T;  4CZZ B;  3ZT7 A;  2UUC T;  2I4O A;  3FJP A;  2DTH A;  4NUV A;  1W66 A;  1G73 A;  5E0O A;  4XEO A;  1YKE B;  1SER A;  5FXV A;  1IJ6 A;  2E3C A;  3M3Z B;  4YYE A;  4P72 C;  2BZB A;  2EJG A;  2WBL A;  4IST A;  2XAJ B;  4XTZ A;  3CVR A;  2NS6 A;  1UX4 A;  2ZZG A;  4IT4 A;  4DR5 T;  2XQ9 A;  2QHU A;  4OFZ A;  4CXW A;  5L47 A;  3UU6 A;  2JRK A;  3EI0 A;  2CRB A;  4DUZ T;  2XGT A;  3L1A A;  2ZT8 A;  4FJO A;  4LF4 T;  1XMO T;  3I1A A;  3RRW A;  2XAQ B;  2ZIO A;  3RH3 A;  3V8L A;  3VR9 A;  2M67 A;  5FXX A;  3JC6 C;  3LBX A;  3PDY A;  4IE7 A;  5DAB A;  4YLH A;  2Z6E A;  3BJU A;  2DLR A;  4UR9 A;  2LSJ A;  1ATI A;  3ESL A;  3MQZ A;  1KF6 A;  4IDN A;  4OK0 A;  2CE7 A;  4CQI A;  4HT4 A;  2PTF A;  2DHR A;  1XZY A;  2JQK A;  5C52 B;  5ELO A;  3OYX A;  4QXH B;  4WNK A;  3CQX C;  2XSA A;  4ZS2 A;  3SFD A;  2P0L A;  3QOF A;  2XSB A;  3H37 A;  2IC9 A;  3RHW A;  2W62 A;  2WB5 A;  1YW0 A;  2VL8 A;  4AQY T;  5C8Y E;  5IYZ E;  2A8E A;  2LHR A;  4EZH A;  4XEM A;  3E0Z A;  3CX6 B;  2I59 A;  1I6Z A;  2LKH A;  5LA6 E;  1O3X A;  3IAL A;  3OD1 A;  3G1Z A;  4UP9 A;  5LHI B;  3ZJ1 A;  2W66 A;  4JEU B;  1NEN A;  1G5I A;  2VB6 A;  4LF8 T;  4X1K E;  4QXB B;  4COF A;  5LCY A;  4PJL A;  4ERR A;  4XZC A;  5IWA T;  3SFE A;  3PJA A;  2CGH A;  4TWA A;  1YQ4 A;  2CLY C;  1HNZ T;  4QX7 B;  4I0U A;  4QX8 B;  2V1D B;  2E1H A;  5AQR B;  4DR1 T;  4YHJ A;  3TEH B;  2XAH B;  4WI1 A;  2BVM A;  4QHO A;  2DXU A;  3Q5W A;  2FYK A;  2J3L A;  3RIA A;  3ONJ A;  4V1A v;  1X56 A;  3A5Z A;  5LGU B;  1JNR A;  3RLF F;  2Y8D A;  4XTW A;  3WAK A;  1WQW A;  2JQQ A;  4WW0 A;  4PJJ A;  1W09 A;  3CML A;  2DZC A;  3LK3 B;  4Z91 A;  2RP4 A;  3UGQ A;  3FBL A;  4YT0 A;  1T8B A;  2A9U A;  4X1Y E;  4PK5 A;  4H63 V;  4O2D A;  2LM9 A;  3F2E A;  3F57 A;  2QYW A;  1T72 A;  2HHH T;  4DR4 T;  3C4Z A;  5HWY A;  1NWM X;  3PUR A;  4QH1 A;  2ZIN A;  4HFE A;  3JAD A;  3UUM A;  1XDP A;  3P8T A;  2IAK A;  3TKL B;  1DU2 A;  4YCV A;  4CI3 B;  4YSX A;  2BS3 A;  3L4G A;  1E1T A;  2IUB A;  3A7U A;  3MK7 C;  2XM1 A;  3AAA B;  1NNH A;  2CA5 A;  2PME A;  4JI3 T;  4WF2 A;  5AQF B;  2D0U A;  5JRC A;  1KK7 A;  4MFR A;  3HFZ A;  1KNP A;  3UGT A;  3FZH B;  3NEN A;  3D0T A;  5KMG P;  4XU3 A;  5HCJ A;  2ZT5 A;  4NPP A;  1RIQ A;  4IL4 A;  3O9X A;  2RA1 A;  4ZTU B;  4CS2 A;  3RQU A;  1NJ1 A;  3Q5E A;  1EIY B;  4HFI A;  1V9D A;  2XQ8 A;  2E9X A;  3M65 A;  4YRQ A;  5EZY E;  4AIS A;  2D0T A;  3RKW A;  1B8A A;  2NW8 A;  4LNS A;  1OED A;  4IGU A;  3ZMS B;  5CGM A;  3ANW A;  2CMR A;  2EHO A;  3VRA A;  2X0Y A;  4YRF A;  2XQ4 A;  4UIG A;  3AA7 B;  4UV9 B;  5AQL B;  4CXX A;  2KIN B;  1MND A;  2WM9 A;  3BQK A;  5ELN A;  2PJQ A;  5AQO B;  5HEU A;  2PBI A;  5AQI B;  5AQT B;  2UUB T;  1AJ3 A;  2LM2 A;  4I50 E;  4UVB B;  2F4V T;  4F8H A;  5CA0 E;  4AQG A;  1US7 B;  4DVD A;  4PAG A;  4O2A E;  5F8P A;  4AH6 A;  4ZHQ E;  5LNK A;  2LOP A;  2ACX A;  4ILB A;  1WU7 A;  2AXD S;  3B5M A;  2CWY A;  4YRI A;  4GOU A;  2EWN A;  2VQF T;  3ZC0 A;  5HXE A;  1ZOY A;  4E51 A;  2K5B B;  3AE5 A;  4N78 D;  3MXZ A;  2RPA A;  2LSY A;  4NIQ A;  2YIN A;  4YRK A;  4KI0 F;  3VQY A;  4ZEY A;  2BG9 B;  2I6H A;  3RYF E;  5EK3 A;  3CKD A;  1XWM A;  4DBQ A;  3KV5 A;  5F3J A;  4PW8 A;  3HL6 A;  4IE5 A;  3IEE A;  4YRP A;  2XAS B;  3AEE A;  3UTK A;  2BKP A;  1J1J A;  1KNZ A;  2AKW A;  4JI6 T;  5ABG A;  5JR9 A;  4NXN T;  3IHR A;  2A72 A;  1YFR A;  3PUG A;  3AAE B;  4GK5 E;  2LSG A;  4LML A;  4A56 A;  5ABH A;  4HWC A;  4EB6 E;  2CCQ A;  1ASY A;  4O4H E;  4DV6 T;  3NEL A;  5A1L A;  5J0Z A;  4X66 T;  2Q7E A;  5FVL A;  1HNX T;  3DP7 A;  2UXD T;  3RC3 A;  5AQN B;  4LVL A;  1OXZ A;  4H9Q C;  1B70 A;  1UUS A;  4PG3 A;  4U33 A;  3V7S A;  2ZT6 A;  2E64 A;  4YJ3 E;  1M7K A;  3UUL A;  5BMV E;  5AQM B;  1Z7M A;  4B6X A;  1H4T A;  2XQ7 A;  3RGL A;  2XZE A;  2RHS A;  4IE4 A;  2DWG A;  1N33 T;  5H6R B;  5AFU L;  4XTU A;  2BS2 A;  2ZT7 A;  1X55 A;  4IDQ A;  2K48 A;  4B3R T;  5L3B B;  2XQ6 A;  3HFV A;  3ZST A;  4UPA A;  2LHN A;  5H6Q B;  2L8K A;  4H9S E;  5DJQ C;  2DU5 A;  4HFD A;  1G51 A;  2CM0 A;  1HCI A;  5JDL A;  1HS7 A;  4PFO A;  3HXX A;  3AE3 A;  1BIB A;  2A2F X;  4AKI A;  1HTT A;  3U3I A;  1ZP0 A;  5KX5 E;  2FJD A;  2K3W A;  1PYS A;  3LSV A;  4U2Z A;  1QUU A;  4HWI B;  2LSK A;  2H3R A;  4L5G A;  4LF5 T;  1NJ8 A;  4EYU A;  2ZNJ A;  5L4H A;  1X2H A;  3CIR A;  2FJE A;  1B7Y B;  1ADY A;  4X5O A;  4AQF A;  2KWI B;  1W0B A;  3REU A;  3PUZ F;  3KBU A;  4P75 C;  1VCS A;  1E1O A;  5LHH B;  4GIW A;  5K1X A;  3A31 A;  3VRB A;  4LF9 T;  3HKD E;  5JQG E;  3MF1 A;  4YRN A;  5C3J A;  3H3A A;  3O1H A;  5FY7 A;  2QRX A;  4P74 A;  3ICA A;  5LB7 B;  2CHN A;  1E22 A;  3ZYL A;  2UU9 T;  4CH3 A;  2VKJ A;  5JH7 E;  2X9W A;  4UV8 B;  2X0L B;  2L3L A;  1OED E;  3AE2 A;  4H2W A;  1PYS B;  2D2S A;  2ZZE A;  4YXD A;  1BR2 A;  3HXY A;  2VKO A;  2VWA A;  2RHQ A;  1SA0 E;  3P4R A;  2XTI A;  2D9D A;  1B76 A;  4DPG A;  4TVA B;  3NEM A;  2Q5H A;  4OHF A;  4U72 A;  2Q9Q C;  2HPJ A;  4EV6 A;  4P09 A;  2WWV A;  5L4E A;  3VKG A;  3ZKR A;  3ZMZ B;  4O4I E;  2OA5 A;  4UEM A;  2XQ3 A;  1SRY A;  2G4C A;  3F31 A;  3R84 B;  3RX6 A;  4P74 C;  2VK9 A;  3LDQ B;  4YRG A;  2VVS A;  2E5L T;  3H3M A;  4G63 A;  4JBW F;  4X1I E;  3N9L A;  4CH5 A;  5HXS A;  3N9N A;  5AQS B;  3RIU A;  2LKG A;  4NCX A;  5LGN B;  3PUY F;  1YKH B;  3RUX A;  2Q9Q D;  3SOL A;  2MOZ A;  4UEL A;  3AE1 A;  1FMV A;  2DJZ A;  4PNI A;  3A7M A;  2PMF A;  2NWB A;  2Q7G A;  3PU3 A;  3ZJ2 A;  1KOG A;  3MEY A;  2DTO A;  2IDO B;  4AQF C;  2BKO A;  3JAE A;  2ZNI A;  3AE6 A;  1QLB A;  4G85 A;  2H89 A;  2V5D A;  4H02 A;  2IC6 A;  4ILA A;  4Q6G A;  2QA7 A;  3HR0 A;  3TLT A;  3KDS E;  1B70 B;  2EJF A;  1LVK A;  4L9I A;  2WY2 A;  3LK4 2;  1T98 A;  4WBN E;  5KDM C;  3FB2 A;  2CBI A;  3PU8 A;  4TNV A;  2DKG A;  3PZC A;  3FZK B;  5JDG A;  4H63 H;  3L3P A;  2W4X A;  4CN6 A;  2ARS A;  1KMM A;  1X01 A;  4HWF A;  3B57 A;  4GKK T;  3UQ4 A;  2DI4 A;  3NET A;  5FY0 A;  3N9P A;  2E41 A;  4TX5 A;  5HXR A;  1HX1 B;  3A8Y C;  2E5A A;  4UF0 B;  2ZR2 A;  5FXW A;  5LBQ B;  4OYK A;  3FBZ A;  4GYR A;  3GWH A;  2JMH A;  1GGM A;  2CBJ A;  3UU8 A;  1T7S A;  4LMJ A;  3A32 A;  3P7I A;  2H7V C;  5JDM A;  3GA8 A;  4IE6 A;  5KXJ A;  4TVY A;  3EUH A;  4O4L E;  4YRS A;  4K87 A;  4O2B E;  2V7J A;  3EAM A;  3IA3 A;  5FVK A;  2VKH A;  3PCO A;  3VHL A;  5LJN A;  2KZ7 B;  3JC6 D;  2V26 A;  5LMN T;  4DR3 T;  2LOS A;  4WBO A;  2M6B A;  4DV0 T;  3S4U A;  11AS A;  4JUY A;  1SET A;  1Z0P A;  1WCR A;  4DBR A;  3MA9 A;  1U4Q A;  2KT9 A;  4P72 A;  4H2X A;  2YN6 A;  3QC9 A;  3VKH A;  1HTJ F;  5HYA A;  3AE4 A;  5L3F B;  4UXN B;  1UGO A;  3TEH A;  2ZGW A;  4OYJ A;  1IJ5 A;  1HXD A;  3OKQ A;  3E22 E;  1ZV4 X;  2WU5 A;  3J9X 1;  3ANW B;  4KHP T;  4HN9 A;  3NRY A;  3A5X A;  4TQF A;  5LOV E;  1QSD A;  4KX6 A;  3V5S A;  1WR0 A;  2LEH A;  1CUN A;  1YD8 G;  3X1D A;  4HGA A;  1WLE A;  3UFG A;  2YKS A;  4C91 A;  2LSI A;  4JLE A;  1FYF A;  3K3O A;  4ZTZ B;  4H9P C;  5GON E;  1EIY A;  4PK6 A;  3A7R A;  5HEO A;  3MF2 A;  4LFB T;  3R6N A;  3UT5 E;  1D0Y A;  3ZN0 B;  3HTZ A;  4X20 E;  5JRE A;  2DVE A;  3B13 A;  4I4T E;  4DR6 T;  5FNV E;  2NW7 A;  3TLU A;  2WQY A;  3P4P A;  2B1E A;  2V7I A;  1BR0 A;  2E2A A;  5CB4 E;  3FZM B;  3I7F A; 
#chains in the Genus database with same CATH homology
 4YRP A;  1ASZ A;  3HFZ B;  1G5H A;  4P71 A;  4WJ3 M;  4H2U A;  4LVI A;  2AKW A;  3BFM A;  3HXV A;  2QHS A;  3WQZ A;  1WYD A;  5HGQ A;  1YFR A;  1H4S A;  1JJC B;  3TUP A;  2CJ9 A;  4P3N A;  2RHS B;  1H4V B;  1ASY A;  1ADJ A;  3P8Y A;  4J15 A;  4LVJ A;  3UH0 A;  2ZR3 A;  2I4L A;  1BIA A;  3HY1 A;  3A5Y A;  3NEL A;  3M4P A;  5K1P A;  1N9W A;  2Q7E A;  4LVL A;  1B70 A;  3V8K A;  4PG3 A;  2I4N A;  3RL6 A;  3V7S A;  2ZT6 A;  2E64 A;  1NYR A;  4H2T A;  5F5W A;  2J3M A;  1Z7M A;  1H4T A;  4CH6 A;  3RIR A;  3R07 A;  3VBB A;  3RGL A;  2RHS A;  1QE0 A;  3V7R A;  4YCU A;  4YRT A;  4XU0 A;  4TQD A;  1H4Q A;  2ALY B;  3VQW A;  4XTU A;  4XTY A;  4BWA A;  2ZT7 A;  2ARU A;  4K88 A;  2Q7H A;  1X55 A;  1USY A;  2ZIM A;  2DXT A;  4HVC A;  1EVK A;  1IL2 A;  3HFV A;  4UPA A;  4TTV A;  2IY5 A;  2ZXF A;  4XU1 A;  2DU5 A;  1NJ2 A;  1G51 A;  1EVL A;  1VQZ A;  3HXX A;  2DEQ A;  2I4O A;  3FJP A;  3DSQ A;  2DTH A;  4KR3 A;  4BW9 A;  3QO5 A;  1BIB A;  1W66 A;  4P3P A;  4XEO A;  4YRR A;  1SER A;  4K86 A;  1HTT A;  4HWO A;  1J5W A;  2E3C A;  1PYS A;  4YYE A;  4P72 C;  2EJG A;  4CS4 A;  1EFW A;  4XTZ A;  2NS6 A;  4G84 A;  1NJ8 A;  3CMQ A;  2ZNJ A;  2ZZG A;  1X2H A;  4XTX A;  2QHU A;  4YRE A;  1B7Y B;  1ADY A;  4X5O A;  2DDZ A;  4HWS A;  3REU A;  4RQE A;  1BBW A;  2XGT A;  3TEG A;  3L1A A;  4P75 C;  4LVM A;  1E1O A;  1LYL A;  2AMC A;  2ZT8 A;  2IY5 B;  4P3O A;  5K1X A;  3A31 A;  2DZ9 A;  2ZIO A;  12AS A;  3V8L A;  3MF1 A;  2DQ3 A;  2CIM A;  3A7A A;  2C7I A;  4YRN A;  2ALY A;  4P74 A;  4H2X B;  3RKX A;  3W3S A;  3ICA A;  4HA8 A;  3BJU A;  3HXU A;  1E22 A;  3QTC A;  1ATI A;  2DU7 A;  3MQZ A;  4CH3 A;  3E9I A;  4HT4 A;  4ZIB A;  2Q5I A;  5C52 B;  2E65 A;  5ELO A;  3HY0 A;  4H2W A;  2EAY A;  5KNN A;  1PYS B;  2P0L A;  4Q15 A;  2ZZE A;  4YP0 A;  3HXY A;  4TVW A;  2RHQ A;  4XTV A;  4YRM A;  2ZTG A;  2A8E A;  2XTI A;  3RAC A;  1B76 A;  4XEM A;  4DPG A;  4TVA B;  3NEM A;  1Z7N A;  4XU2 A;  2Q5H A;  5C51 B;  3IAL A;  3OD1 A;  4UP9 A;  3G1Z A;  3PCO B;  1X54 A;  3HXZ A;  1EQR A;  2P5I A;  1X2G A;  1G5I A;  1SRY A;  2G4C A;  4YDQ A;  2AKW B;  4P74 C;  4YRG A;  4P73 A;  4KQE A;  2CGH A;  2CJB A;  4TWA A;  3E9H A;  3LC0 A;  4CH5 A;  4H2S A;  1E24 A;  3LSS A;  4OP0 A;  4L87 A;  4NCX A;  2E1H A;  3M4Q A;  4YPF A;  3RUX A;  3ERR A;  3TEH B;  4WI1 A;  4RMF A;  2ZCE A;  2DJZ A;  2DXU A;  2FYK A;  2J3L A;  1X56 A;  3A5Z A;  2PMF A;  2QHT A;  3L4G B;  4YRC A;  2Q7G A;  4H2Y A;  1KOG A;  3MEY A;  2DTO A;  4OLF A;  4RQF A;  4RDX A;  4XTW A;  2ZNI A;  1WQW A;  2DZC A;  4G85 A;  4H02 A;  3V8J A;  2CJA A;  4Q6G A;  3VQX A;  5C53 B;  4YRL A;  3UGQ A;  1B70 B;  2DQ0 A;  3P8V A;  2EJF A;  3IG2 A;  4O2D A;  2DKG A;  4YRJ A;  4YRO A;  3V7C A;  1HC7 A;  3PZC A;  1KMN A;  4HWR A;  2ARS A;  2E10 A;  1KMM A;  2ZIN A;  2ZZF A;  1X01 A;  3P8T A;  3HRK A;  3NET A;  2E41 A;  4YCV A;  1USY C;  3L4G A;  2E5A A;  1E1T A;  4CS3 A;  2ZR2 A;  3A7U A;  1NNH A;  2PME A;  4KR2 A;  1YFS A;  4WF2 A;  3QNE A;  4HWT A;  1GGM A;  2AMC B;  3HFZ A;  3A32 A;  3REX A;  4WJ4 A;  3UGT A;  3NEN A;  4TVY A;  4XU3 A;  3EFS A;  2ZT5 A;  4YRS A;  1RIQ A;  1WNL A;  4K87 A;  3RKY A;  4HWP A;  3L2Z A;  4ZTU B;  1C0A A;  4CS2 A;  1NJ1 A;  1EIY B;  4DQ2 A;  3PCO A;  2ODR D;  4YCW A;  3HRI A;  4TVA A;  1NYQ A;  4YRQ A;  3VQV A;  1YGB A;  1SES A;  1WQ7 A;  1WPY A;  2RHQ B;  1B8A A;  4LNS A;  3RKW A;  4CH4 A;  11AS A;  2DTI A;  1SET A;  3IKM B;  4PHC A;  3HXW A;  1JJC A;  4UP7 A;  1QF6 A;  4H2V A;  4YRF A;  4P72 A;  4H2X A;  1EOV A;  3TEH A;  2EJ9 A;  2ZGW A;  3IKL A;  4P71 C;  4EO4 A;  1BBU A;  1HXD A;  3LSQ A;  5E3I A;  2C8M A;  2EL9 A;  4P73 C;  5ELN A;  2ART A;  4EX5 A;  4TQF A;  2I4M A;  3EFR A;  4LVK A;  2HNI A;  3QO8 A;  1WLE A;  3RF1 A;  3UFG A;  1YFT A;  1FYF A;  4AH6 A;  1B7Y A;  4ZTZ B;  1NJ5 A;  1EIY A;  3A7R A;  4P75 A;  3MF2 A;  1WU7 A;  4YRI A;  2EWN A;  4UP8 A;  3HTZ A;  4E51 A;  3A74 A;  1YB3 A;  1L0W A;  2DVE A;  3QO7 A;  1NJ6 A;  4YRK A;  2QHV A;  3VQY A;  2ODR C;  3KFU A;  3I7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...