3RF1A

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rf1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rf1A01
2AMCA 4OLFA 3HY1A 4P71C 3HFZB 1EFWA 1H4TA 2Q7GA 2RHSA 2CJBA 1YFRA 3A7RA 1EVKA 1X56A 4HA8A 3UGQA 1G5IA 2P5IA 4CH5A 1X2HA 4XTUA 4P71A 3V8KA 4YP0A 2ZT6A 4BWAA 3IALA 1BIAA 2ZT7A 5KNNA 1YFSA 4XTVA 3VQYA 1X55A 1Z7MA 2DEQA 5ELOA 3MEYA 2AKWB 4CH4A 3L1AA 1EQRA 1JJCA 3IG2A 3REUA 2C8MA 3V8LA 4O2DA 2Q7HA 4TVAA 4XTZA 4G85A 4P73C 1WLEA 1B76A 1WU7A 3VQWA 3HXWA 1G5HA 2ZR2A 3BFMA 4P73A 1W66A 2AMCB 1NJ1A 2ALYA 2Q5IA 3IKMB 3QO8A 1G51A 1H4QA 1NJ5A 3EFSA 5C51B 4KR2A 2J3MA 4TTVA 3HTZA 4DQ2A 4TVWA 4XEMA 1H4VB 3QNEA 2ZTGA 4YYEA 4Q6GA 2J3LA 3ICAA 3E9HA 4HVCA 4PHCA 1WNLA 4YDQA 5K1PA 3A7AA 4PG3A 2QHVA 2ODRD 4HWTA 1Z7NA 4ZTZB 1B7YA 2DQ3A 3LC0A 2ZCEA 3LSSA 3P8YA 1JJCB 2I4MA 1SRYA 4TVAB 3MF2A 3BJUA 3TEGA 3V7CA 4CS2A 4HWOA 4TVYA 4G84A 4H2XA 2AKWA 1ASZA 1N9WA 2CJAA 2ALYB 3A31A 2DXTA 1WQWA 2DU7A 4WJ3M 3RUXA 3RIRA 4DPGA 4LNSA 2G4CA 1WQ7A 3L4GA 2E5AA 4J15A 1NJ6A 4CH3A 5C53B 4CS3A 2Q7EA 2EJGA 2DDZA 2ZZGA 1ASYA 3W3SA 2E41A 1NJ8A 1HTTA 3EFRA 2ZIOA 1B7YB 3HXUA 1X01A 2Q5HA 1E22A 2I4LA 2E1HA 4HWRA 5HGQA 3UGTA 2DTOA 3HXXA 1NYRA 2ODRC 4RQFA 2QHSA 3QO7A 4YCVA 1KOGA 4H2XB 3HXYA 4ZIBA 4YRKA 1WPYA 2DJZA 1H4SA 1FYFA 4YRNA 2ZT8A 4H2UA 1RIQA 2DTHA 4X5OA 4P75C 3I7FA 2EAYA 4YRPA 1NJ2A 1EVLA 4K88A 1NNHA 2E3CA 4ZTUB 3UFGA 3L4GB 4L87A 4YRMA 1BIBA 5ELNA 3TEHA 4P75A 1NYQA 3TUPA 4P74C 2DZCA 4XU3A 3V7SA 3QO5A 3RGLA 3E9IA 4Q15A 1X2GA 1YFTA 4P74A 4UP8A 1ATIA 1GGMA 2HNIA 1E1TA 3LSQA 4YRJA 2I4OA 4KR3A 1E24A 4YRQA 2ZZFA 2DZ9A 1KMNA 2ZGWA 3PZCA 3HFVA 2E10A 2RHQA 3V7RA 4XTWA 3HXVA 3QTCA 5E3IA 2DQ0A 4RDXA 2EWNA 4YRFA 1SERA 4HWPA 1PYSA 3NEMA 2EJ9A 3M4QA 3NELA 1BBUA 1IL2A 2CGHA 3TEHB 4K87A 4UP9A 1YGBA 1C0AA 3A5YA 4RMFA 1QF6A 1B8AA 2ZNJA 2DVEA 3ERRA 1X54A 1SESA 4UPAA 2E65A 4EX5A 4HWSA 2ARTA 2DU5A 2ARUA 2ZR3A 4YRGA 5K1XA 3HXZA 4K86A 3DSQA 1ADJA 4XTYA 3RKYA 1LYLA 3KFUA 4YRCA 3RACA 2RHQB 4YCUA 4YRRA 4CH6A 3A32A 3RL6A 1ADYA 3IKLA 3PCOA 2I4NA 3WQZA 2C7IA 1PYSB 4YROA 4UP7A 1J5WA 1SETA 2EL9A 2QHTA 4YPFA 4RQEA 3A74A 2FYKA 4H2YA 3HRIA 3NETA 2DXUA 4YREA 3RKXA 3MF1A 3V8JA 1EIYA 4H2VA 2QHUA 4XTXA 1HC7A 3FJPA 2CJ9A 1VQZA 3L2ZA 2ZINA 3A5ZA 1KMMA 4P72C 4YCWA 4NCXA 3VQXA 2DKGA 4KQEA 4YRTA 1B70A 3R07A 3P8TA 2ZXFA 4P72A 3G1ZA 1HXDA 2DTIA 4XEOA 2E64A 2IY5A 2RHSB 4XU2A 2ZT5A 2P0LA 3PCOB 4H2TA 4XU1A 3CMQA 2PMEA 2CIMA 4EO4A 1BBWA 4TWAA 3HFZA 2XGTA 1EOVA 4XU0A 4H02A 2ARSA 4OP0A 2EJFA 4P3NA 4TQFA 4TQDA 2XTIA 4CS4A 3HY0A 3RF1A 4YRLA 1WYDA 4P3PA 4BW9A 2ZIMA 4H2WA 1EIYB 3M4PA 1QE0A 4YRSA 1USYC 4WF2A 3A7UA 4AH6A 11ASA 3NENA 3VQVA 2ZNIA 4WJ4A 1USYA 1B70B 4E51A 1YB3A 2ZZEA 5F5WA 3REXA 3VBBA 3RKWA 5C52B 3P8VA 4H2SA 1E1OA 4P3OA 4YRIA 3UH0A 4WI1A 2IY5B 12ASA 1L0WA 3OD1A 2PMFA 3HRKA
chains in the Genus database with same CATH superfamily
5HYAA 4E7ZA 2AMCA 2CWYA 4FI5A 2C5JA 2CRBA 5JDNA 2WBLA 2UXDT 5LOVE 3HFZB 1H4TA 4X20E 2Q7GA 1YFRA 1X56A 3W15B 3ZN0B 3RPUA 2BKPA 4CH5A 2V7KA 4YP0A 3M3ZB 2XZEA 1T98A 5HEJA 3KBUA 1XNQT 4JI5T 1BIAA 5KNNA 2E9XA 3B5MA 4YSYA 3VQYA 4JEHB 1X55A 4EYYR 1Z8UA 1NAFA 5JDMA 5ELOA 4HWDA 3ZMUB 4CH4A 5DQWA 2NTXA 5JDLA 3REUA 2C8MA 4TVAA 4G85A 4QH4A 3AE7A 2W2UA 3T1YT 2WWUA 4JI1T 1VOMA 4LVIA 2ZR2A 5JR9B 4P73A 2K48A 2AMCB 3QO8A 4LF7T 4KR2A 4OX9T 2YU1A 3IEEA 3HTZA 4DQ2A 2BBJA 5KXJA 4I55E 1W0AA 4AKLA 4YYEA 5AQLB 4JI3T 3TKLB 1E1HB 4PHCA 3VHLA 4JI0T 4U7YA 2E9XB 5J1GA 2UXNB 1H7CA 1N32T 4ZTZB 2CMRA 4DV3T 1ZHCA 5AFUL 3LSSA 3A7MA 2I4MA 1SRYA 3PUVF 1FEWA 4I50E 4QWNB 3ZMTB 4TVAB 1IBKT 2LSJA 2FJDA 3TEGA 3P4PA 4H2XA 4HE8A 1S94A 5AQUB 3DTOA 3JAFA 2V6XA 2IIUA 5HEUA 1XMOT 2XAHB 2W00A 4TV9E 5FY7A 4WJ3M 2RPAA 4ILCA 3RIRA 4LNSA 4YFSA 3K3QC 4I4TE 2G4CA 1WQ7A 4EZ4A 4J15A 1NJ6A 3P50A 1MNDA 2Q7EA 2EJGA 1XZYA 1ASYA 3FBLA 5JQGE 2VKHA 2ODVA 1NJ8A 2VKDA 4X64T 2ZIOA 2XQ4A 4A5XA 3HXUA 1E22A 2D0TA 2XQ8A 2E1HA 3AAAB 3Q5WA 2YEVC 4LF8T 3HXXA 3ONJA 5GONE 4HFEA 5LHHB 3QO7A 4DIDB 4P09A 4K0KT 1KOGA 4H2XB 2HN1A 2DJZA 4OFZA 3JADA 1FYFA 3N2GE 1S35A 2XQYA 4YRNA 2ZT8A 2NOXA 4H9PC 4IIJE 5CA1E 2R6GF 4U72A 4YY3T 2C5IT 1MMDA 3SWHA 1VCTA 4O4IE 1NJ2A 1EVLA 1T7SA 1NNHA 5FNVE 4ZTUB 3LDQB 3L8RA 1VCSA 2EHOA 5ELNA 3GMIA 1QUUA 4KUMB 3TUPA 3V7SA 2B76A 3E9IA 2LLYA 4COFA 1X2GA 5C2TA 5FP3A 4Z91A 1ZKEA 1GGMA 1N36T 3N9LA 4O4LE 2DWGA 2W62A 3UU4A 3NZPA 1WFDA 4GYRA 3K1SA 1KMNA 2NR4A 2ZGWA 4GIWA 4YHHT 3V7RA 3L3PA 4CN6A 2X68A 5LA6E 5E3IA 3P4RA 2DQ0A 2W66A 1SERA 2V8SV 4HWFA 4H9NC 3ZLIA 2EJ9A 3AVSA 4X5TA 5HCMA 2EHOB 3PUQA 5J2TE 3J7Yq 4JI7T 3FZLB 4DBRA 4HFIA 2J47A 1I94T 3PURA 5LCYA 4WBOA 4AKIA 3CIRA 4YTNA 3A5YA 2CWOA 2ES0A 2ZNJA 3Q2MA 4UPAA 2RA1A 5FY0A 4IDOA 2AXDS 2ARTA 2ARUA 4UVCB 5K1XA 3FZMB 5AQTB 2X0HA 4B6XA 4XTYA 1LYLA 3KFUA 3HA4A 2BBHA 3TLUA 3RACA 2C0SA 3M65A 2JQKA 4YRRA 5ADXL 3A32A 2VVSA 3RKGA 5LJNA 4MHCA 2LKHA 4TWHA 2XHEB 4IDNA 4UP7A 5ABGA 2E8IA 3I0OA 2QHTA 2H7OA 5DQVA 4RQEA 4QXHB 2ZM8A 3ZT6A 2FYKA 1KFYA 4ZS2A 5FKYA 2W4XA 4TN7B 1MNEA 3O1JA 2L3LA 5AQSB 1I6ZA 3V5UA 5FY1A 4H9OC 3V8JA 2BVMA 4HWCA 4LVJA 4EB6E 3EDVA 4DV2T 3FJPA 5AQOB 5LG4A 2CJ9A 2BVLA 4DBQA 2BG9E 4ZS3A 1KMMA 2XAQB 4NXNT 2DKGA 4EYUA 2BZBA 4EIWA 1B70A 5FXWA 4KI0F 3G1ZA 1HXDA 4HN9A 4U74A 4I43B 4EEBA 3R84B 3RQWA 4ZXLA 3NRYA 4H2TA 3OYZA 3RYIE 4A98A 2CLYB 2E9XD 3PV0F 5KX5E 4TWAA 1MMNA 2XGTA 4U2ZA 4HGAA 3LG7A 4OP0A 4TQDA 4CS4A 4PK5A 1D0YA 2P9BA 1G73A 4OYKA 2WMNA 2XM1A 5AQFB 4ZEYA 4AH6A 4QX7B 2V7LA 3EAMA 5JH7E 4TWFA 1B70B 4E51A 1YB3A 3REXA 3RKWA 5JR9C 2JIWA 1E1OA 4YRIA 2X9XA 1L0WA 3RQUA 4WBNE 5KDMC 3V5SA 4ZI7E 2WU2A 3ZT5A 4OLFA 4TNWA 1D1BA 4WW0A 3AE3A 3ZJ2A 1LKXA 2DI4A 3DJBA 3D0TA 2H88A 4DV7T 1BR1A 2XAGB 2KMFA 3I9YA 4QKNA 3UUBA 5HEHA 4HKAA 2BKOA 3UGQA 1U4QA 3NZQA 2D0UA 1W0BA 4HEAA 5ETWA 2FJAA 2ZT7A 2A3DA 4CQIA 4QHOA 4LVLA 4YSZA 2KXPB 2LT3A 4B3MT 4DNDA 5ABEA 3AVRA 4KHPT 1Z7MA 2XY8B 3SOLA 1MIYA 2E2AA 3MEYA 1ZEEA 3RH3A 3L1AA 5JRCA 2E5LT 3N9PA 2QRXA 4MLKA 2CXFA 4P73C 3ZSSA 4PJNA 1BR0A 1WLEA 5LXTE 1CUNA 1B76A 3C4ZA 1Z0PA 2LM2A 2XQ9A 3VQWA 1G5HA 3UTKA 2JMKA 2DCFA 3BFMA 3ZC0A 5C3JA 3UQ7A 5LMUT 1WYBA 3AE1A 1NJ1A 2ALYA 3IKMB 2NW7A 4C90A 2KSRA 4TVWA 3FB2A 4YT0A 2ZTGA 4Q6GA 3ZEFB 5CJ5A 4HVCA 4YDQA 5K1PA 3OVUA 4PAGA 2ODRD 4HWTA 2DHRA 4O2AE 2X66A 2CHNA 3J9X1 2CHOA 5AQIB 1E2AA 5JRCB 5LMNT 2NP9A 3VRBA 3NKZA 2IC6A 4HWOA 4TVYA 2EHOD 3WAJA 4TV8E 5EK2A 5HXHA 5E0OA 2CJAA 4IE0A 3KBTA 2ALYB 1YKEB 2PFVA 2XM2A 3K3NA 2LE8A 2PG8A 1WQWA 2DU7A 3RHWA 4XZCA 4QH5A 5HXRA 4DPGA 3AEDA 5JR9A 1YKHB 3PE0A 4CH3A 3ZCJA 5C53B 3CX8B 3ZMZB 2ZZGA 1N34T 2XJ7A 4ISSA 2IMLA 3F31A 4AXPA 3LFMA 1QLBA 1R8IA 2LOSA 3VR9A 3GN5A 3UU6A 4KHZF 4U31A 3MZKB 1MMAA 4LF5T 2X51A 4HWRA 5HGQA 2VQFT 5JDHA 5DJQC 2ODRC 1W09A 3E22E 2IDOB 4YCVA 1W9RA 4TNVA 2L8KA 3R6NA 1WPYA 4JI8T 2V1DB 2YDQA 2J1DG 2DL1A 5ABFA 4BJNA 4AI6A 1YXRA 4H2UA 1XWMA 2EHOC 1RIQA 3LJCA 5FMNA 1T8BA 4GK0E 2EAYA 3I7FA 2QA7A 4K88A 1SA0E 4JUYA 4L87A 1BIBA 4P75A 3E08A 4TWDA 4XU3A 3KV5A 5JDGA 3RGLA 4TUYE 3GN5B 4F8HA 5LYJE 3AA0B 1ATIA 3VKHA 2X9HA 3SS1A 3C4XA 4DV5T 3LSQA 1N33T 2I4OA 3N2OA 2B1EA 3N9NA 2QYWA 2D5UA 4CXXA 3PUGA 3T8OA 3SFEA 2VASA 5ABFB 2KINB 2Y8DA 4RDXA 3TLVA 3JC6D 3P4WA 3UUNA 3HL6A 1NENA 3NELA 1HG2A 3ESLA 4DR2T 2W61A 1XDPA 2CGHA 5L47A 4TX5A 1UK5A 3CX6B 3PUZF 4GOUA 4AQFA 2V7IA 1YGBA 1C0AA 4ZOLE 4ZI3C 3PJAJ 4DV6T 1HTJF 4IDZA 4MBQA 1QF6A 2ODUA 2DVEA 2CBJA 4PFOA 1X54A 3ZYKA 4UV9B 3RYCE 5FL0A 2DU5A 3C64A 2ZR3A 3KFWX 1MIWA 2C5KT 3DSQA 1ADJA 2WCAA 2DWKA 2VKOA 2I0MA 3CMLA 4YRCA 2MAWA 2UUAT 1MMGA 4YCUA 4CH6A 4KMCA 2CLYC 4MALA 3OPCA 4L9IA 3RIUA 3IKLA 3DP7A 2I4NA 4YROA 1GQEA 4PFPA 4IDPA 1KNPA 4UV8B 3CQCB 5AQVB 4YPFA 2LSKA 5KMGP 5AQJB 3A74A 3JC6C 4H2YA 5HXCA 3QC9A 2XQ7A 3MF1A 4ISTA 3ZYLA 2YN6A 5L3BB 5AQNB 3C98B 4H2VA 3ZN1B 4NUVA 4DR4T 3OTOT 4O8SA 3KDSE 4NCXA 4CXYA 5AQGB 2ZXFA 3P8TA 2W67A 3ZPOA 2V5DA 3Q5DA 3PTRB 4DR6T 4OYJA 2X0LB 4XEOA 2E64A 2IY5A 2RHSB 1HX8A 2UU9T 2P0LA 5FL1A 4OHFA 3RYHE 4XU1A 3CMQA 4NPPA 2PMEA 3O1IA 1BBWA 2Q9QA 1JNRA 5ABHA 3KV9A 2HN2A 4UVBB 2EJFA 4P3NA 1U5PA 4YRLA 4H9QC 1WYDA 3CK6A 4P3PA 2WZIA 4AKHA 4PW8A 4LFAT 4H2WA 2VL8A 2OLTA 3AXJB 4YRSA 2JJ9A 2H89A 4EAHA 3N2KE 4HFVA 4IL4A 1WCRA 3OJAA 11ASA 4F6RC 3VR8A 2ZNIA 2ZZEA 2XQ5A 3QOFA 3LK3B 2K24A 5C52B 3EVYA 3P8VA 3UH0A 2UUBT 2IY5B 12ASA 2WZHA 5BR8T 2YK0A 3UULA 1HCIA 2IUBA 1FIOA 3AA1B 2XQ3A 5HAXA 4CZZB 1KF6A 4L0RA 3N5LA 2WMOA 2BS3A 2Q9QB 2OA5A 4CI1B 1OWAA 4KBMB 4A56A 1G5IA 2P5IA 2LRLA 3ZKRA 4GYSA 4P71A 1Y64B 2ZT6A 3TLWA 4OK0A 4BWAA 2NWBA 2HHHT 1X79A 2ACZA 3H37A 3FZHB 3PUSA 1SE7A 3VRAA 4XTVA 2Y6XA 2JQQA 5LP6E 5HWXA 3H3AA 5F3JA 2DEQA 4DUYT 2W0GA 1XMQT 2AKWB 2V26A 1EQRA 1JJCA 2WY2A 3ZC1A 3IG2A 4O2DA 2Q7HA 4XTZA 3ETVA 4HFCA 4EV6A 3PU8A 4MFRA 5LHIB 3AE2A 3HXWA 1W66A 4U33A 4IGUA 2Q5IA 2KNDA 3RIAA 1H4QA 3OBVE 2BS4A 1M62A 2J3MA 2H3RA 1XNRT 2VL0A 2A8EA 4M1PA 5LB7B 2MPKA 4NUUA 2K5BB 5FVLA 2J3LA 3ICAA 5L3GB 5HCJA 5J0ZA 3UT5E 2VQET 3WAKA 3AE6A 2CCQA 4PG3A 4ILBA 2QHVA 4AKRB 2YU2A 4G63A 1D1CA 2IC9A 4YJ2E 3LC0A 5LBMA 5FYMA 2A9UA 1HR0T 2ZCEA 1HNXT 1JJCB 2CEAA 4XBFB 4A97A 3CWZB 4UELA 1HG5A 4UXNB 3MF2A 3FXEB 3BJUA 1D0XA 3V7CA 2SPCA 4G84A 4LMLA 1ASZA 5IHYA 2LEHA 1ZP0A 1HX1B 1UURA 3Q9DA 3A31A 3AB3B 2DXTA 5F8PA 3UU8A 1UUSA 3BQLA 1XDOA 4AQYT 4CXWA 2YKSA 2DLRA 3ZJ1A 3IF8B 5C8YE 4O4HE 3PJAA 3L4GA 5JREA 4H63H 2UUCT 2DDZA 1YQ3A 3EI0A 3W3SA 2E41A 1KK7A 4YXDA 1OEDA 3AE4A 2Q5HA 1VRBA 4CN1A 4LVMA 5L3CB 4DO0A 4ZI2D 3AECA 2LM9A 1ZOYA 1LVKA 2WQYA 2VK9A 5IUXA 3QB5A 5A1LA 5TAOA 3O4XE 3L09A 4PJMA 4CI3B 4YRKA 1H4SA 1NEKA 2OV9A 2X9YA 2WP9A 4DMVA 1HS7A 3TLSA 2WM9A 2X0YA 4P75C 4YRPA 3L4GB 2JMHA 1WLXA 4PJJA 4DVDA 1NYQA 1HF8A 5FVKA 2I6HA 5HXSA 2CA5A 1E7PA 2G0UA 1G8XA 1IJ6A 4DMWA 5JDQA 4Q15A 3AEAA 4P74A 1OEDB 4ZHQE 4UP8A 4FJOA 2HNIA 2M6BA 4UF0A 5AQRB 1T72A 4YRJA 2K3WA 5FXXA 5HEGA 4KR3A 3S4UA 3RYFE 2IAKA 1E24A 4YRQA 2ZM0A 2ZZFA 3RI5A 3I1AA 2NW9A 1YQ4A 3RX6A 4ZI2C 3PZCA 2CXDA 3MA9A 4NXMT 4UR9A 3LBXA 4XTWA 4YHJA 4YSXA 3HXVA 3QTCA 3NWIA 2EWNA 2MOZA 5L3EB 3BK9A 2V5CA 2LOPA 2XQ6A 2M6IA 4IE4A 1PYSA 3NEMA 4Z8XA 4DV4T 1CHUA 3UUXB 3AEGA 2YOEA 1D0ZA 1IL2A 4AQFC 2XAFB 2UXXB 4JV5T 4K87A 3O9XA 4H9RC 4UP9A 2WSSV 4Z90A 1QSDA 4AIUA 4V1Av 2RP4A 2NW8A 1IJ5A 1KEYA 2NTYA 4IDQA 4RMFA 1B8AA 3ERRA 2PTFA 1SESA 4KP3C 4UF0B 2IW5B 4UVAB 4EX5A 4B3TT 4QXBB 4HWSA 3HXZA 4K86A 4N78D 4KX6A 2XQAA 2LJLA 5LNKA 3OKQA 2Q9QD 5L3FB 2QVAA 2WDQA 3RIUC 3LBXB 4X1IE 3BQKA 3PDYA 3C51A 1WRDA 2ACXA 2F4VT 5BMVE 1BR4A 3RL6A 2WWVA 1ADYA 3QNUA 3RRWA 5LGUB 3WQZA 2C7IA 1PYSB 3AEFA 3GWHA 4CN4A 1SETA 2EL9A 3N9QA 4EXTA 4LMKA 4DV0T 3FBZA 4U7IA 5LGTB 2V6YA 3TLTA 3NETA 3RKXA 3P7IA 2BG9A 1BR2A 3G06A 1L0VA 4ILUA 3HKEE 4ZI3D 4EOZB 5CFBA 1EIYA 4B3RT 4P0BA 4P0AA 2D9DA 3B57A 4JLEA 1HC7A 4GKKT 1EZ3A 5LHGB 4YLHA 3KINB 3A5XA 4JYAT 2LSIA 4WNKA 2WDRA 1HNWT 3LK2B 4HFBA 4KQEA 2N1GA 3B13A 2MBGA 4P72A 2HH7A 3ZSTA 2YINA 2ZMAA 3UU3A 5H6RB 1V9DA 2DTIA 3AE5A 2NS6A 1Y01A 3CPZA 2XSAA 3PU3A 2ZT5A 5IWAT 2Q9QC 4LF9T 3EDUA 2JQHA 2CIMA 4Q25A 1SUMB 2V7JA 3U78A 5LG3A 5EZYE 4H02A 4IHJE 2ARSA 2L9QA 2V6YB 3P4QA 2JQ9A 2XTIA 3SRZA 4PJLA 3HY0A 4H63V 3RF1A 2BG9B 2VWAA 4DR7T 1EIYB 5AQHB 3M4PA 2D2SA 3CQGB 4GK5E 4WF2A 1IBMT 3QUJA 4EGWA 3HKDE 3UFEA 3K3OA 1USYA 4J2CA 5AQQB 2N2NA 1J5ET 1UX4A 3VBBA 3RLFF 3C50A 4P3OA 4WI1A 2H7VC 4ERRA 2W63A 2VURA 3OD1A 2PMFA 2XSBA 2CBIA 3HRKA 4XAXB 3HKCE 4QH1A 3MQZA 3ZCIA 3HY1A 2KZ7B 2XASB 4P71C 1EFWA 1KNZA 4HFDA 2RHSA 1IZNB 2CJBA 1UGOA 2VKJA 3A7RA 1EVKA 4HA8A 3IHRA 1LRZA 3UQ4A 2LHRA 1X2HA 3L39A 3AA6B 4XTUA 3V8KA 3AE8A 4X1KE 3N9OA 4EEDA 5CA0E 3IALA 2UXCT 2Y48B 1LVFA 4ANJA 1YFSA 4JI2T 3QK6A 4HWIB 1OEDE 2A72A 3ONXA 2ZM2A 4UIGA 1UX5A 3VKGA 3AXJA 3IA3A 3V8LA 2LKGA 1KNRA 2YDRA 3RC3A 2XUEA 2KT9A 2ZM6T 1WU7A 3O1HA 4O4JE 3RC8A 1G51A 2IHR1 2PBIA 5J2UE 1NJ5A 3EFSA 5C51B 1YD8G 3HR0A 3AEBA 3MXZA 4TTVA 2BDEA 4BAYB 5JVDE 1M7KA 5L2LA 5AQKB 4XEMA 1H4VB 2J4GA 3QNEA 3MACA 5HWYA 3E9HA 1WNLA 4IE7A 5EK4A 3A7AA 3AAIA 4YJ3E 2QGSA 4QX8B 1Z7NA 4BJMA 1B7YA 2DQ3A 1ZV4X 2WS3A 3E0ZA 4O2BE 2LRKA 3P8YA 3CVRA 2KWHA 4EZHA 5LGNB 4CS2A 5LBQB 4ADZA 1J1JA 3RIFA 3ZMSB 5EK3A 2AKWA 2KWIB 3GA8A 4JBWF 1N9WA 4HT4A 5JDFA 2N9DA 4L5GA 4IREA 4E7SA 4JI4T 4X66T 3RUXA 2GK9A 3Q5EA 2BS2A 1DU2A 3SFDA 3HI2A 3C4WA 2E5AA 4PK6A 3CKDA 1JNZA 3ZT7A 4HTEA 4CS3A 3BQIA 5HEOA 1OEDC 5AQPB 2LSGA 1HTTA 3EFRA 4U3CA 4X62T 4HWHA 1B7YB 1X01A 3ZMVB 2LHNA 2I4LA 3IBPA 4GKJT 1FJGT 2YDSA 4C91A 5FXVA 3UGTA 1FMWA 2DTOA 3F2EA 1NYRA 5LJMA 4RQFA 2QHSA 1D1AA 4P1NA 3LSVA 3HXYA 4ZIBA 5AQMB 3EHZA 1O3XA 4JI6T 2A2FX 3NRXA 3UUMA 2WDVA 3NBXX 2DTHA 4X5OA 2X9WA 5HXEA 2CE7A 2AE9A 3HKBE 4HFHA 2E3CA 2UXBT 3EABA 3UFGA 2V7MA 4YRMA 4ASKA 3TEHA 4LF6T 2VVNA 5CB4E 4PNIA 3PUYF 3RRCA 4P74C 2DZCA 3QO5A 2ZLYA 3MJXA 5IYZE 3WI3A 3FZFB 1YFTA 3CX7B 4AKGA 2Z6EA 1E1TA 3OYXA 3H3MA 2FUPA 5L4HA 4LVKA 2DZ9A 2WAUA 3HFVA 4ILAA 2E10A 3ETUA 2RHQA 3PUXF 4X65T 3QB5K 1WR0A 4YRFA 4HWPA 3ANWA 3VU7H 4DR3T 4AISA 2KLQA 3AEEA 3M4QA 5H6QB 2K9AA 2I59A 1BBUA 4IE5A 3TEHB 4BA9A 1X9BA 3KV6A 5DABA 4AQGA 4DUZT 3Q5XA 2XPKA 4LFCT 1SHZC 3KVBA 4QXCB 2E5VA 4WZXA 3MK7C 3UU5A 1US7B 3ZYMA 2E65A 3K8PC 4LMJA 1IBLT 2MYSA 4NIQA 4YRGA 3P4SA 2CM0A 3AE9A 3KVAA 3RKOA 3RKYA 2J62A 4PK4A 3T1HT 4IE6A 2RHQB 3A8YC 4YTPA 4TZ4C 1HFAA 3MKDA 3N9MA 4YTMA 2PJQA 2DNXA 5L3DB 3PUWF 3ANWB 4UEMA 4DR5T 3PCOA 4ZZCA 2E9XC 3X1DA 3JAEA 3CQXC 2CXLA 1J5WA 2FJBA 2BG9C 2CPTA 3EUHA 4DR1T 1OXZA 4LF4T 1YW0A 1B7TA 3HRIA 4DV1T 2DXUA 4YREA 5CGMA 1AJ3A 2LSYA 4B3ST 2WB5A 2XTLA 3LK42 2JPFA 2QHUA 2HPLA 4XTXA 1MIVA 5M4YA 1VQZA 2X67A 3L2ZA 2ZINA 3A5ZA 4P72C 4YCWA 3NVOA 3VQXA 1WYCA 2FJEA 4YRTA 3R07A 4G2AA 4LFBT 3I9WA 3AA7B 3FXDB 2XAJB 3KV4A 3ONLC 4IL9A 4XU2A 1HNZT 3PCOB 4U2YA 4IT4A 1NWMX 4EO4A 3HFZA 1EOVA 3JCFA 4K0UA 4H9SE 4XU0A 2M67A 4WYVA 4CI2B 3F57A 4JEUB 4TQFA 4BW9A 1WR6A 2ZIMA 2VB6A 3PUAA 2HPJA 2JRKA 1UCUA 1QE0A 5JTGA 1USYC 2MTQA 3A7UA 3P8CD 2FBWA 3AAEB 4ZZBA 3NENA 3VQVA 5FXZA 4WJ4A 1FMVA 3I0QA 5F5WA 1IAPA 4H2SA 4X1YE 4I0UA 3FZKB 5L4EA 2BKNA 2WU5A 3ABVA 3FHNA 3U3IA
chains in the Genus database with same CATH topology
2AMCA 4OLFA 3MQZA 3HY1A 4P71C 3HFZB 1EFWA 1H4TA 2Q7GA 2RHSA 2CJBA 1YFRA 3A7RA 1EVKA 1X56A 4HA8A 3UGQA 1G5IA 2P5IA 4CH5A 1X2HA 4XTUA 4P71A 3V8KA 4YP0A 2ZT6A 4BWAA 3IALA 1BIAA 2ZT7A 5KNNA 4LVLA 1YFSA 4XTVA 3VQYA 1X55A 1Z7MA 2DEQA 5ELOA 3MEYA 2AKWB 4CH4A 3L1AA 1EQRA 1JJCA 3IG2A 3REUA 2C8MA 3V8LA 4O2DA 2Q7HA 4TVAA 4XTZA 4G85A 4P73C 1WLEA 1B76A 1WU7A 3VQWA 3HXWA 1G5HA 4LVIA 2ZR2A 3BFMA 4P73A 1W66A 2AMCB 1NJ1A 2ALYA 2Q5IA 3IKMB 3QO8A 1G51A 1H4QA 1NJ5A 3EFSA 5C51B 4KR2A 2J3MA 4TTVA 3HTZA 4DQ2A 4TVWA 4XEMA 2A8EA 1H4VB 3QNEA 2ZTGA 4YYEA 4Q6GA 2J3LA 3ICAA 3E9HA 4HVCA 4PHCA 1WNLA 4YDQA 5K1PA 3A7AA 4PG3A 2QHVA 2ODRD 4HWTA 1Z7NA 4ZTZB 1B7YA 2DQ3A 3LC0A 2ZCEA 3LSSA 3P8YA 1JJCB 2I4MA 1SRYA 4TVAB 3MF2A 3BJUA 3TEGA 3V7CA 4CS2A 4HWOA 4TVYA 4G84A 4H2XA 2AKWA 1ASZA 1N9WA 2CJAA 4HT4A 2ALYB 3A31A 2DXTA 1WQWA 2DU7A 4WJ3M 3RUXA 3RIRA 4DPGA 4LNSA 2G4CA 1WQ7A 3L4GA 2E5AA 4J15A 1NJ6A 4CH3A 5C53B 4CS3A 2Q7EA 2EJGA 2DDZA 2ZZGA 1ASYA 3W3SA 2E41A 1NJ8A 1HTTA 3EFRA 2ZIOA 1B7YB 3HXUA 1X01A 2Q5HA 1E22A 4LVMA 2I4LA 2E1HA 4HWRA 5HGQA 3UGTA 2DTOA 3HXXA 1NYRA 2ODRC 4RQFA 2QHSA 3QO7A 4YCVA 1KOGA 4H2XB 3HXYA 4ZIBA 4YRKA 1WPYA 2DJZA 1H4SA 1FYFA 4YRNA 2ZT8A 4H2UA 1RIQA 2DTHA 4X5OA 4P75C 3I7FA 2EAYA 4YRPA 1NJ2A 1EVLA 4K88A 1NNHA 2E3CA 4ZTUB 3UFGA 3L4GB 4L87A 4YRMA 1BIBA 5ELNA 3TEHA 4P75A 1NYQA 3TUPA 4P74C 2DZCA 4XU3A 3V7SA 3QO5A 3RGLA 3E9IA 4Q15A 1X2GA 1YFTA 4P74A 4UP8A 1ATIA 1GGMA 2HNIA 1E1TA 3LSQA 4YRJA 2I4OA 4KR3A 1E24A 4LVKA 4YRQA 2ZZFA 2DZ9A 1KMNA 2ZGWA 3PZCA 3HFVA 2E10A 2RHQA 3V7RA 4XTWA 3HXVA 3QTCA 5E3IA 2DQ0A 4RDXA 2EWNA 4YRFA 1SERA 4HWPA 1PYSA 3NEMA 2EJ9A 3M4QA 3NELA 1BBUA 1IL2A 2CGHA 3TEHB 4K87A 4UP9A 1YGBA 1C0AA 3A5YA 4RMFA 1QF6A 1B8AA 2ZNJA 2DVEA 3ERRA 1X54A 1SESA 4UPAA 2E65A 4EX5A 4HWSA 2ARTA 2DU5A 2ARUA 2ZR3A 4YRGA 5K1XA 3HXZA 4K86A 3DSQA 1ADJA 4XTYA 3RKYA 1LYLA 3KFUA 4YRCA 3RACA 2RHQB 4YCUA 4YRRA 4CH6A 3A32A 3RL6A 1ADYA 3IKLA 3PCOA 2I4NA 3WQZA 2C7IA 1PYSB 4YROA 4UP7A 1J5WA 1SETA 2EL9A 2QHTA 4YPFA 4RQEA 3A74A 2FYKA 4H2YA 3HRIA 3NETA 2DXUA 4YREA 3RKXA 3MF1A 3V8JA 1EIYA 4LVJA 4H2VA 2QHUA 4XTXA 1HC7A 3FJPA 2CJ9A 1VQZA 3L2ZA 2ZINA 3A5ZA 1KMMA 4P72C 4YCWA 4NCXA 3VQXA 2DKGA 4KQEA 4YRTA 1B70A 3R07A 3P8TA 2ZXFA 4P72A 3G1ZA 1HXDA 2DTIA 4XEOA 2E64A 2NS6A 2IY5A 2RHSB 4XU2A 2ZT5A 2P0LA 3PCOB 4H2TA 4XU1A 3CMQA 2PMEA 2CIMA 4EO4A 1BBWA 4TWAA 3HFZA 2XGTA 1EOVA 4XU0A 4H02A 2ARSA 4OP0A 2EJFA 4P3NA 4TQFA 4TQDA 2XTIA 4CS4A 3HY0A 3RF1A 4YRLA 1WYDA 4P3PA 4BW9A 2ZIMA 4H2WA 1EIYB 3M4PA 1QE0A 4YRSA 1USYC 4WF2A 3A7UA 4AH6A 11ASA 3NENA 3VQVA 2ZNIA 4WJ4A 1USYA 1B70B 4E51A 1YB3A 2ZZEA 5F5WA 3REXA 3VBBA 3RKWA 5C52B 3P8VA 4H2SA 1E1OA 4P3OA 4YRIA 3UH0A 4WI1A 2IY5B 12ASA 1L0WA 3OD1A 2PMFA 3HRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMC A;  4OLF A;  3HY1 A;  4P71 C;  3HFZ B;  1EFW A;  1H4T A;  2Q7G A;  2RHS A;  2CJB A;  1YFR A;  3A7R A;  1EVK A;  1X56 A;  4HA8 A;  3UGQ A;  1G5I A;  2P5I A;  4CH5 A;  1X2H A;  4XTU A;  4P71 A;  3V8K A;  4YP0 A;  2ZT6 A;  4BWA A;  3IAL A;  1BIA A;  2ZT7 A;  5KNN A;  1YFS A;  4XTV A;  3VQY A;  1X55 A;  1Z7M A;  2DEQ A;  5ELO A;  3MEY A;  2AKW B;  4CH4 A;  3L1A A;  1EQR A;  1JJC A;  3IG2 A;  3REU A;  2C8M A;  3V8L A;  4O2D A;  2Q7H A;  4TVA A;  4XTZ A;  4G85 A;  4P73 C;  1WLE A;  1B76 A;  1WU7 A;  3VQW A;  3HXW A;  1G5H A;  2ZR2 A;  3BFM A;  4P73 A;  1W66 A;  2AMC B;  1NJ1 A;  2ALY A;  2Q5I A;  3IKM B;  3QO8 A;  1G51 A;  1H4Q A;  1NJ5 A;  3EFS A;  5C51 B;  4KR2 A;  2J3M A;  4TTV A;  3HTZ A;  4DQ2 A;  4TVW A;  4XEM A;  1H4V B;  3QNE A;  2ZTG A;  4YYE A;  4Q6G A;  2J3L A;  3ICA A;  3E9H A;  4HVC A;  4PHC A;  1WNL A;  4YDQ A;  5K1P A;  3A7A A;  4PG3 A;  2QHV A;  2ODR D;  4HWT A;  1Z7N A;  4ZTZ B;  1B7Y A;  2DQ3 A;  3LC0 A;  2ZCE A;  3LSS A;  3P8Y A;  1JJC B;  2I4M A;  1SRY A;  4TVA B;  3MF2 A;  3BJU A;  3TEG A;  3V7C A;  4CS2 A;  4HWO A;  4TVY A;  4G84 A;  4H2X A;  2AKW A;  1ASZ A;  1N9W A;  2CJA A;  2ALY B;  3A31 A;  2DXT A;  1WQW A;  2DU7 A;  4WJ3 M;  3RUX A;  3RIR A;  4DPG A;  4LNS A;  2G4C A;  1WQ7 A;  3L4G A;  2E5A A;  4J15 A;  1NJ6 A;  4CH3 A;  5C53 B;  4CS3 A;  2Q7E A;  2EJG A;  2DDZ A;  2ZZG A;  1ASY A;  3W3S A;  2E41 A;  1NJ8 A;  1HTT A;  3EFR A;  2ZIO A;  1B7Y B;  3HXU A;  1X01 A;  2Q5H A;  1E22 A;  2I4L A;  2E1H A;  4HWR A;  5HGQ A;  3UGT A;  2DTO A;  3HXX A;  1NYR A;  2ODR C;  4RQF A;  2QHS A;  3QO7 A;  4YCV A;  1KOG A;  4H2X B;  3HXY A;  4ZIB A;  4YRK A;  1WPY A;  2DJZ A;  1H4S A;  1FYF A;  4YRN A;  2ZT8 A;  4H2U A;  1RIQ A;  2DTH A;  4X5O A;  4P75 C;  3I7F A;  2EAY A;  4YRP A;  1NJ2 A;  1EVL A;  4K88 A;  1NNH A;  2E3C A;  4ZTU B;  3UFG A;  3L4G B;  4L87 A;  4YRM A;  1BIB A;  5ELN A;  3TEH A;  4P75 A;  1NYQ A;  3TUP A;  4P74 C;  2DZC A;  4XU3 A;  3V7S A;  3QO5 A;  3RGL A;  3E9I A;  4Q15 A;  1X2G A;  1YFT A;  4P74 A;  4UP8 A;  1ATI A;  1GGM A;  2HNI A;  1E1T A;  3LSQ A;  4YRJ A;  2I4O A;  4KR3 A;  1E24 A;  4YRQ A;  2ZZF A;  2DZ9 A;  1KMN A;  2ZGW A;  3PZC A;  3HFV A;  2E10 A;  2RHQ A;  3V7R A;  4XTW A;  3HXV A;  3QTC A;  5E3I A;  2DQ0 A;  4RDX A;  2EWN A;  4YRF A;  1SER A;  4HWP A;  1PYS A;  3NEM A;  2EJ9 A;  3M4Q A;  3NEL A;  1BBU A;  1IL2 A;  2CGH A;  3TEH B;  4K87 A;  4UP9 A;  1YGB A;  1C0A A;  3A5Y A;  4RMF A;  1QF6 A;  1B8A A;  2ZNJ A;  2DVE A;  3ERR A;  1X54 A;  1SES A;  4UPA A;  2E65 A;  4EX5 A;  4HWS A;  2ART A;  2DU5 A;  2ARU A;  2ZR3 A;  4YRG A;  5K1X A;  3HXZ A;  4K86 A;  3DSQ A;  1ADJ A;  4XTY A;  3RKY A;  1LYL A;  3KFU A;  4YRC A;  3RAC A;  2RHQ B;  4YCU A;  4YRR A;  4CH6 A;  3A32 A;  3RL6 A;  1ADY A;  3IKL A;  3PCO A;  2I4N A;  3WQZ A;  2C7I A;  1PYS B;  4YRO A;  4UP7 A;  1J5W A;  1SET A;  2EL9 A;  2QHT A;  4YPF A;  4RQE A;  3A74 A;  2FYK A;  4H2Y A;  3HRI A;  3NET A;  2DXU A;  4YRE A;  3RKX A;  3MF1 A;  3V8J A;  1EIY A;  4H2V A;  2QHU A;  4XTX A;  1HC7 A;  3FJP A;  2CJ9 A;  1VQZ A;  3L2Z A;  2ZIN A;  3A5Z A;  1KMM A;  4P72 C;  4YCW A;  4NCX A;  3VQX A;  2DKG A;  4KQE A;  4YRT A;  1B70 A;  3R07 A;  3P8T A;  2ZXF A;  4P72 A;  3G1Z A;  1HXD A;  2DTI A;  4XEO A;  2E64 A;  2IY5 A;  2RHS B;  4XU2 A;  2ZT5 A;  2P0L A;  3PCO B;  4H2T A;  4XU1 A;  3CMQ A;  2PME A;  2CIM A;  4EO4 A;  1BBW A;  4TWA A;  3HFZ A;  2XGT A;  1EOV A;  4XU0 A;  4H02 A;  2ARS A;  4OP0 A;  2EJF A;  4P3N A;  4TQF A;  4TQD A;  2XTI A;  4CS4 A;  3HY0 A;  3RF1 A;  4YRL A;  1WYD A;  4P3P A;  4BW9 A;  2ZIM A;  4H2W A;  1EIY B;  3M4P A;  1QE0 A;  4YRS A;  1USY C;  4WF2 A;  3A7U A;  4AH6 A;  11AS A;  3NEN A;  3VQV A;  2ZNI A;  4WJ4 A;  1USY A;  1B70 B;  4E51 A;  1YB3 A;  2ZZE A;  5F5W A;  3REX A;  3VBB A;  3RKW A;  5C52 B;  3P8V A;  4H2S A;  1E1O A;  4P3O A;  4YRI A;  3UH0 A;  4WI1 A;  2IY5 B;  12AS A;  1L0W A;  3OD1 A;  2PMF A;  3HRK A; 
#chains in the Genus database with same CATH topology
 5HYA A;  4E7Z A;  2AMC A;  2CWY A;  4FI5 A;  2C5J A;  2CRB A;  5JDN A;  2WBL A;  2UXD T;  5LOV E;  3HFZ B;  1H4T A;  4X20 E;  2Q7G A;  1YFR A;  1X56 A;  3W15 B;  3ZN0 B;  3RPU A;  2BKP A;  4CH5 A;  2V7K A;  4YP0 A;  3M3Z B;  2XZE A;  1T98 A;  5HEJ A;  3KBU A;  1XNQ T;  4JI5 T;  1BIA A;  5KNN A;  2E9X A;  3B5M A;  4YSY A;  3VQY A;  4JEH B;  1X55 A;  4EYY R;  1Z8U A;  1NAF A;  5JDM A;  5ELO A;  4HWD A;  3ZMU B;  4CH4 A;  5DQW A;  2NTX A;  5JDL A;  3REU A;  2C8M A;  4TVA A;  4G85 A;  4QH4 A;  3AE7 A;  2W2U A;  3T1Y T;  2WWU A;  4JI1 T;  1VOM A;  4LVI A;  2ZR2 A;  5JR9 B;  4P73 A;  2K48 A;  2AMC B;  3QO8 A;  4LF7 T;  4KR2 A;  4OX9 T;  2YU1 A;  3IEE A;  3HTZ A;  4DQ2 A;  2BBJ A;  5KXJ A;  4I55 E;  1W0A A;  4AKL A;  4YYE A;  5AQL B;  4JI3 T;  3TKL B;  1E1H B;  4PHC A;  3VHL A;  4JI0 T;  4U7Y A;  2E9X B;  5J1G A;  2UXN B;  1H7C A;  1N32 T;  4ZTZ B;  2CMR A;  4DV3 T;  1ZHC A;  5AFU L;  3LSS A;  3A7M A;  2I4M A;  1SRY A;  3PUV F;  1FEW A;  4I50 E;  4QWN B;  3ZMT B;  4TVA B;  1IBK T;  2LSJ A;  2FJD A;  3TEG A;  3P4P A;  4H2X A;  4HE8 A;  1S94 A;  5AQU B;  3DTO A;  3JAF A;  2V6X A;  2IIU A;  5HEU A;  1XMO T;  2XAH B;  2W00 A;  4TV9 E;  5FY7 A;  4WJ3 M;  2RPA A;  4ILC A;  3RIR A;  4LNS A;  4YFS A;  3K3Q C;  4I4T E;  2G4C A;  1WQ7 A;  4EZ4 A;  4J15 A;  1NJ6 A;  3P50 A;  1MND A;  2Q7E A;  2EJG A;  1XZY A;  1ASY A;  3FBL A;  5JQG E;  2VKH A;  2ODV A;  1NJ8 A;  2VKD A;  4X64 T;  2ZIO A;  2XQ4 A;  4A5X A;  3HXU A;  1E22 A;  2D0T A;  2XQ8 A;  2E1H A;  3AAA B;  3Q5W A;  2YEV C;  4LF8 T;  3HXX A;  3ONJ A;  5GON E;  4HFE A;  5LHH B;  3QO7 A;  4DID B;  4P09 A;  4K0K T;  1KOG A;  4H2X B;  2HN1 A;  2DJZ A;  4OFZ A;  3JAD A;  1FYF A;  3N2G E;  1S35 A;  2XQY A;  4YRN A;  2ZT8 A;  2NOX A;  4H9P C;  4IIJ E;  5CA1 E;  2R6G F;  4U72 A;  4YY3 T;  2C5I T;  1MMD A;  3SWH A;  1VCT A;  4O4I E;  1NJ2 A;  1EVL A;  1T7S A;  1NNH A;  5FNV E;  4ZTU B;  3LDQ B;  3L8R A;  1VCS A;  2EHO A;  5ELN A;  3GMI A;  1QUU A;  4KUM B;  3TUP A;  3V7S A;  2B76 A;  3E9I A;  2LLY A;  4COF A;  1X2G A;  5C2T A;  5FP3 A;  4Z91 A;  1ZKE A;  1GGM A;  1N36 T;  3N9L A;  4O4L E;  2DWG A;  2W62 A;  3UU4 A;  3NZP A;  1WFD A;  4GYR A;  3K1S A;  1KMN A;  2NR4 A;  2ZGW A;  4GIW A;  4YHH T;  3V7R A;  3L3P A;  4CN6 A;  2X68 A;  5LA6 E;  5E3I A;  3P4R A;  2DQ0 A;  2W66 A;  1SER A;  2V8S V;  4HWF A;  4H9N C;  3ZLI A;  2EJ9 A;  3AVS A;  4X5T A;  5HCM A;  2EHO B;  3PUQ A;  5J2T E;  3J7Y q;  4JI7 T;  3FZL B;  4DBR A;  4HFI A;  2J47 A;  1I94 T;  3PUR A;  5LCY A;  4WBO A;  4AKI A;  3CIR A;  4YTN A;  3A5Y A;  2CWO A;  2ES0 A;  2ZNJ A;  3Q2M A;  4UPA A;  2RA1 A;  5FY0 A;  4IDO A;  2AXD S;  2ART A;  2ARU A;  4UVC B;  5K1X A;  3FZM B;  5AQT B;  2X0H A;  4B6X A;  4XTY A;  1LYL A;  3KFU A;  3HA4 A;  2BBH A;  3TLU A;  3RAC A;  2C0S A;  3M65 A;  2JQK A;  4YRR A;  5ADX L;  3A32 A;  2VVS A;  3RKG A;  5LJN A;  4MHC A;  2LKH A;  4TWH A;  2XHE B;  4IDN A;  4UP7 A;  5ABG A;  2E8I A;  3I0O A;  2QHT A;  2H7O A;  5DQV A;  4RQE A;  4QXH B;  2ZM8 A;  3ZT6 A;  2FYK A;  1KFY A;  4ZS2 A;  5FKY A;  2W4X A;  4TN7 B;  1MNE A;  3O1J A;  2L3L A;  5AQS B;  1I6Z A;  3V5U A;  5FY1 A;  4H9O C;  3V8J A;  2BVM A;  4HWC A;  4LVJ A;  4EB6 E;  3EDV A;  4DV2 T;  3FJP A;  5AQO B;  5LG4 A;  2CJ9 A;  2BVL A;  4DBQ A;  2BG9 E;  4ZS3 A;  1KMM A;  2XAQ B;  4NXN T;  2DKG A;  4EYU A;  2BZB A;  4EIW A;  1B70 A;  5FXW A;  4KI0 F;  3G1Z A;  1HXD A;  4HN9 A;  4U74 A;  4I43 B;  4EEB A;  3R84 B;  3RQW A;  4ZXL A;  3NRY A;  4H2T A;  3OYZ A;  3RYI E;  4A98 A;  2CLY B;  2E9X D;  3PV0 F;  5KX5 E;  4TWA A;  1MMN A;  2XGT A;  4U2Z A;  4HGA A;  3LG7 A;  4OP0 A;  4TQD A;  4CS4 A;  4PK5 A;  1D0Y A;  2P9B A;  1G73 A;  4OYK A;  2WMN A;  2XM1 A;  5AQF B;  4ZEY A;  4AH6 A;  4QX7 B;  2V7L A;  3EAM A;  5JH7 E;  4TWF A;  1B70 B;  4E51 A;  1YB3 A;  3REX A;  3RKW A;  5JR9 C;  2JIW A;  1E1O A;  4YRI A;  2X9X A;  1L0W A;  3RQU A;  4WBN E;  5KDM C;  3V5S A;  4ZI7 E;  2WU2 A;  3ZT5 A;  4OLF A;  4TNW A;  1D1B A;  4WW0 A;  3AE3 A;  3ZJ2 A;  1LKX A;  2DI4 A;  3DJB A;  3D0T A;  2H88 A;  4DV7 T;  1BR1 A;  2XAG B;  2KMF A;  3I9Y A;  4QKN A;  3UUB A;  5HEH A;  4HKA A;  2BKO A;  3UGQ A;  1U4Q A;  3NZQ A;  2D0U A;  1W0B A;  4HEA A;  5ETW A;  2FJA A;  2ZT7 A;  2A3D A;  4CQI A;  4QHO A;  4LVL A;  4YSZ A;  2KXP B;  2LT3 A;  4B3M T;  4DND A;  5ABE A;  3AVR A;  4KHP T;  1Z7M A;  2XY8 B;  3SOL A;  1MIY A;  2E2A A;  3MEY A;  1ZEE A;  3RH3 A;  3L1A A;  5JRC A;  2E5L T;  3N9P A;  2QRX A;  4MLK A;  2CXF A;  4P73 C;  3ZSS A;  4PJN A;  1BR0 A;  1WLE A;  5LXT E;  1CUN A;  1B76 A;  3C4Z A;  1Z0P A;  2LM2 A;  2XQ9 A;  3VQW A;  1G5H A;  3UTK A;  2JMK A;  2DCF A;  3BFM A;  3ZC0 A;  5C3J A;  3UQ7 A;  5LMU T;  1WYB A;  3AE1 A;  1NJ1 A;  2ALY A;  3IKM B;  2NW7 A;  4C90 A;  2KSR A;  4TVW A;  3FB2 A;  4YT0 A;  2ZTG A;  4Q6G A;  3ZEF B;  5CJ5 A;  4HVC A;  4YDQ A;  5K1P A;  3OVU A;  4PAG A;  2ODR D;  4HWT A;  2DHR A;  4O2A E;  2X66 A;  2CHN A;  3J9X 1;  2CHO A;  5AQI B;  1E2A A;  5JRC B;  5LMN T;  2NP9 A;  3VRB A;  3NKZ A;  2IC6 A;  4HWO A;  4TVY A;  2EHO D;  3WAJ A;  4TV8 E;  5EK2 A;  5HXH A;  5E0O A;  2CJA A;  4IE0 A;  3KBT A;  2ALY B;  1YKE B;  2PFV A;  2XM2 A;  3K3N A;  2LE8 A;  2PG8 A;  1WQW A;  2DU7 A;  3RHW A;  4XZC A;  4QH5 A;  5HXR A;  4DPG A;  3AED A;  5JR9 A;  1YKH B;  3PE0 A;  4CH3 A;  3ZCJ A;  5C53 B;  3CX8 B;  3ZMZ B;  2ZZG A;  1N34 T;  2XJ7 A;  4ISS A;  2IML A;  3F31 A;  4AXP A;  3LFM A;  1QLB A;  1R8I A;  2LOS A;  3VR9 A;  3GN5 A;  3UU6 A;  4KHZ F;  4U31 A;  3MZK B;  1MMA A;  4LF5 T;  2X51 A;  4HWR A;  5HGQ A;  2VQF T;  5JDH A;  5DJQ C;  2ODR C;  1W09 A;  3E22 E;  2IDO B;  4YCV A;  1W9R A;  4TNV A;  2L8K A;  3R6N A;  1WPY A;  4JI8 T;  2V1D B;  2YDQ A;  2J1D G;  2DL1 A;  5ABF A;  4BJN A;  4AI6 A;  1YXR A;  4H2U A;  1XWM A;  2EHO C;  1RIQ A;  3LJC A;  5FMN A;  1T8B A;  4GK0 E;  2EAY A;  3I7F A;  2QA7 A;  4K88 A;  1SA0 E;  4JUY A;  4L87 A;  1BIB A;  4P75 A;  3E08 A;  4TWD A;  4XU3 A;  3KV5 A;  5JDG A;  3RGL A;  4TUY E;  3GN5 B;  4F8H A;  5LYJ E;  3AA0 B;  1ATI A;  3VKH A;  2X9H A;  3SS1 A;  3C4X A;  4DV5 T;  3LSQ A;  1N33 T;  2I4O A;  3N2O A;  2B1E A;  3N9N A;  2QYW A;  2D5U A;  4CXX A;  3PUG A;  3T8O A;  3SFE A;  2VAS A;  5ABF B;  2KIN B;  2Y8D A;  4RDX A;  3TLV A;  3JC6 D;  3P4W A;  3UUN A;  3HL6 A;  1NEN A;  3NEL A;  1HG2 A;  3ESL A;  4DR2 T;  2W61 A;  1XDP A;  2CGH A;  5L47 A;  4TX5 A;  1UK5 A;  3CX6 B;  3PUZ F;  4GOU A;  4AQF A;  2V7I A;  1YGB A;  1C0A A;  4ZOL E;  4ZI3 C;  3PJA J;  4DV6 T;  1HTJ F;  4IDZ A;  4MBQ A;  1QF6 A;  2ODU A;  2DVE A;  2CBJ A;  4PFO A;  1X54 A;  3ZYK A;  4UV9 B;  3RYC E;  5FL0 A;  2DU5 A;  3C64 A;  2ZR3 A;  3KFW X;  1MIW A;  2C5K T;  3DSQ A;  1ADJ A;  2WCA A;  2DWK A;  2VKO A;  2I0M A;  3CML A;  4YRC A;  2MAW A;  2UUA T;  1MMG A;  4YCU A;  4CH6 A;  4KMC A;  2CLY C;  4MAL A;  3OPC A;  4L9I A;  3RIU A;  3IKL A;  3DP7 A;  2I4N A;  4YRO A;  1GQE A;  4PFP A;  4IDP A;  1KNP A;  4UV8 B;  3CQC B;  5AQV B;  4YPF A;  2LSK A;  5KMG P;  5AQJ B;  3A74 A;  3JC6 C;  4H2Y A;  5HXC A;  3QC9 A;  2XQ7 A;  3MF1 A;  4IST A;  3ZYL A;  2YN6 A;  5L3B B;  5AQN B;  3C98 B;  4H2V A;  3ZN1 B;  4NUV A;  4DR4 T;  3OTO T;  4O8S A;  3KDS E;  4NCX A;  4CXY A;  5AQG B;  2ZXF A;  3P8T A;  2W67 A;  3ZPO A;  2V5D A;  3Q5D A;  3PTR B;  4DR6 T;  4OYJ A;  2X0L B;  4XEO A;  2E64 A;  2IY5 A;  2RHS B;  1HX8 A;  2UU9 T;  2P0L A;  5FL1 A;  4OHF A;  3RYH E;  4XU1 A;  3CMQ A;  4NPP A;  2PME A;  3O1I A;  1BBW A;  2Q9Q A;  1JNR A;  5ABH A;  3KV9 A;  2HN2 A;  4UVB B;  2EJF A;  4P3N A;  1U5P A;  4YRL A;  4H9Q C;  1WYD A;  3CK6 A;  4P3P A;  2WZI A;  4AKH A;  4PW8 A;  4LFA T;  4H2W A;  2VL8 A;  2OLT A;  3AXJ B;  4YRS A;  2JJ9 A;  2H89 A;  4EAH A;  3N2K E;  4HFV A;  4IL4 A;  1WCR A;  3OJA A;  11AS A;  4F6R C;  3VR8 A;  2ZNI A;  2ZZE A;  2XQ5 A;  3QOF A;  3LK3 B;  2K24 A;  5C52 B;  3EVY A;  3P8V A;  3UH0 A;  2UUB T;  2IY5 B;  12AS A;  2WZH A;  5BR8 T;  2YK0 A;  3UUL A;  1HCI A;  2IUB A;  1FIO A;  3AA1 B;  2XQ3 A;  5HAX A;  4CZZ B;  1KF6 A;  4L0R A;  3N5L A;  2WMO A;  2BS3 A;  2Q9Q B;  2OA5 A;  4CI1 B;  1OWA A;  4KBM B;  4A56 A;  1G5I A;  2P5I A;  2LRL A;  3ZKR A;  4GYS A;  4P71 A;  1Y64 B;  2ZT6 A;  3TLW A;  4OK0 A;  4BWA A;  2NWB A;  2HHH T;  1X79 A;  2ACZ A;  3H37 A;  3FZH B;  3PUS A;  1SE7 A;  3VRA A;  4XTV A;  2Y6X A;  2JQQ A;  5LP6 E;  5HWX A;  3H3A A;  5F3J A;  2DEQ A;  4DUY T;  2W0G A;  1XMQ T;  2AKW B;  2V26 A;  1EQR A;  1JJC A;  2WY2 A;  3ZC1 A;  3IG2 A;  4O2D A;  2Q7H A;  4XTZ A;  3ETV A;  4HFC A;  4EV6 A;  3PU8 A;  4MFR A;  5LHI B;  3AE2 A;  3HXW A;  1W66 A;  4U33 A;  4IGU A;  2Q5I A;  2KND A;  3RIA A;  1H4Q A;  3OBV E;  2BS4 A;  1M62 A;  2J3M A;  2H3R A;  1XNR T;  2VL0 A;  2A8E A;  4M1P A;  5LB7 B;  2MPK A;  4NUU A;  2K5B B;  5FVL A;  2J3L A;  3ICA A;  5L3G B;  5HCJ A;  5J0Z A;  3UT5 E;  2VQE T;  3WAK A;  3AE6 A;  2CCQ A;  4PG3 A;  4ILB A;  2QHV A;  4AKR B;  2YU2 A;  4G63 A;  1D1C A;  2IC9 A;  4YJ2 E;  3LC0 A;  5LBM A;  5FYM A;  2A9U A;  1HR0 T;  2ZCE A;  1HNX T;  1JJC B;  2CEA A;  4XBF B;  4A97 A;  3CWZ B;  4UEL A;  1HG5 A;  4UXN B;  3MF2 A;  3FXE B;  3BJU A;  1D0X A;  3V7C A;  2SPC A;  4G84 A;  4LML A;  1ASZ A;  5IHY A;  2LEH A;  1ZP0 A;  1HX1 B;  1UUR A;  3Q9D A;  3A31 A;  3AB3 B;  2DXT A;  5F8P A;  3UU8 A;  1UUS A;  3BQL A;  1XDO A;  4AQY T;  4CXW A;  2YKS A;  2DLR A;  3ZJ1 A;  3IF8 B;  5C8Y E;  4O4H E;  3PJA A;  3L4G A;  5JRE A;  4H63 H;  2UUC T;  2DDZ A;  1YQ3 A;  3EI0 A;  3W3S A;  2E41 A;  1KK7 A;  4YXD A;  1OED A;  3AE4 A;  2Q5H A;  1VRB A;  4CN1 A;  4LVM A;  5L3C B;  4DO0 A;  4ZI2 D;  3AEC A;  2LM9 A;  1ZOY A;  1LVK A;  2WQY A;  2VK9 A;  5IUX A;  3QB5 A;  5A1L A;  5TAO A;  3O4X E;  3L09 A;  4PJM A;  4CI3 B;  4YRK A;  1H4S A;  1NEK A;  2OV9 A;  2X9Y A;  2WP9 A;  4DMV A;  1HS7 A;  3TLS A;  2WM9 A;  2X0Y A;  4P75 C;  4YRP A;  3L4G B;  2JMH A;  1WLX A;  4PJJ A;  4DVD A;  1NYQ A;  1HF8 A;  5FVK A;  2I6H A;  5HXS A;  2CA5 A;  1E7P A;  2G0U A;  1G8X A;  1IJ6 A;  4DMW A;  5JDQ A;  4Q15 A;  3AEA A;  4P74 A;  1OED B;  4ZHQ E;  4UP8 A;  4FJO A;  2HNI A;  2M6B A;  4UF0 A;  5AQR B;  1T72 A;  4YRJ A;  2K3W A;  5FXX A;  5HEG A;  4KR3 A;  3S4U A;  3RYF E;  2IAK A;  1E24 A;  4YRQ A;  2ZM0 A;  2ZZF A;  3RI5 A;  3I1A A;  2NW9 A;  1YQ4 A;  3RX6 A;  4ZI2 C;  3PZC A;  2CXD A;  3MA9 A;  4NXM T;  4UR9 A;  3LBX A;  4XTW A;  4YHJ A;  4YSX A;  3HXV A;  3QTC A;  3NWI A;  2EWN A;  2MOZ A;  5L3E B;  3BK9 A;  2V5C A;  2LOP A;  2XQ6 A;  2M6I A;  4IE4 A;  1PYS A;  3NEM A;  4Z8X A;  4DV4 T;  1CHU A;  3UUX B;  3AEG A;  2YOE A;  1D0Z A;  1IL2 A;  4AQF C;  2XAF B;  2UXX B;  4JV5 T;  4K87 A;  3O9X A;  4H9R C;  4UP9 A;  2WSS V;  4Z90 A;  1QSD A;  4AIU A;  4V1A v;  2RP4 A;  2NW8 A;  1IJ5 A;  1KEY A;  2NTY A;  4IDQ A;  4RMF A;  1B8A A;  3ERR A;  2PTF A;  1SES A;  4KP3 C;  4UF0 B;  2IW5 B;  4UVA B;  4EX5 A;  4B3T T;  4QXB B;  4HWS A;  3HXZ A;  4K86 A;  4N78 D;  4KX6 A;  2XQA A;  2LJL A;  5LNK A;  3OKQ A;  2Q9Q D;  5L3F B;  2QVA A;  2WDQ A;  3RIU C;  3LBX B;  4X1I E;  3BQK A;  3PDY A;  3C51 A;  1WRD A;  2ACX A;  2F4V T;  5BMV E;  1BR4 A;  3RL6 A;  2WWV A;  1ADY A;  3QNU A;  3RRW A;  5LGU B;  3WQZ A;  2C7I A;  1PYS B;  3AEF A;  3GWH A;  4CN4 A;  1SET A;  2EL9 A;  3N9Q A;  4EXT A;  4LMK A;  4DV0 T;  3FBZ A;  4U7I A;  5LGT B;  2V6Y A;  3TLT A;  3NET A;  3RKX A;  3P7I A;  2BG9 A;  1BR2 A;  3G06 A;  1L0V A;  4ILU A;  3HKE E;  4ZI3 D;  4EOZ B;  5CFB A;  1EIY A;  4B3R T;  4P0B A;  4P0A A;  2D9D A;  3B57 A;  4JLE A;  1HC7 A;  4GKK T;  1EZ3 A;  5LHG B;  4YLH A;  3KIN B;  3A5X A;  4JYA T;  2LSI A;  4WNK A;  2WDR A;  1HNW T;  3LK2 B;  4HFB A;  4KQE A;  2N1G A;  3B13 A;  2MBG A;  4P72 A;  2HH7 A;  3ZST A;  2YIN A;  2ZMA A;  3UU3 A;  5H6R B;  1V9D A;  2DTI A;  3AE5 A;  2NS6 A;  1Y01 A;  3CPZ A;  2XSA A;  3PU3 A;  2ZT5 A;  5IWA T;  2Q9Q C;  4LF9 T;  3EDU A;  2JQH A;  2CIM A;  4Q25 A;  1SUM B;  2V7J A;  3U78 A;  5LG3 A;  5EZY E;  4H02 A;  4IHJ E;  2ARS A;  2L9Q A;  2V6Y B;  3P4Q A;  2JQ9 A;  2XTI A;  3SRZ A;  4PJL A;  3HY0 A;  4H63 V;  3RF1 A;  2BG9 B;  2VWA A;  4DR7 T;  1EIY B;  5AQH B;  3M4P A;  2D2S A;  3CQG B;  4GK5 E;  4WF2 A;  1IBM T;  3QUJ A;  4EGW A;  3HKD E;  3UFE A;  3K3O A;  1USY A;  4J2C A;  5AQQ B;  2N2N A;  1J5E T;  1UX4 A;  3VBB A;  3RLF F;  3C50 A;  4P3O A;  4WI1 A;  2H7V C;  4ERR A;  2W63 A;  2VUR A;  3OD1 A;  2PMF A;  2XSB A;  2CBI A;  3HRK A;  4XAX B;  3HKC E;  4QH1 A;  3MQZ A;  3ZCI A;  3HY1 A;  2KZ7 B;  2XAS B;  4P71 C;  1EFW A;  1KNZ A;  4HFD A;  2RHS A;  1IZN B;  2CJB A;  1UGO A;  2VKJ A;  3A7R A;  1EVK A;  4HA8 A;  3IHR A;  1LRZ A;  3UQ4 A;  2LHR A;  1X2H A;  3L39 A;  3AA6 B;  4XTU A;  3V8K A;  3AE8 A;  4X1K E;  3N9O A;  4EED A;  5CA0 E;  3IAL A;  2UXC T;  2Y48 B;  1LVF A;  4ANJ A;  1YFS A;  4JI2 T;  3QK6 A;  4HWI B;  1OED E;  2A72 A;  3ONX A;  2ZM2 A;  4UIG A;  1UX5 A;  3VKG A;  3AXJ A;  3IA3 A;  3V8L A;  2LKG A;  1KNR A;  2YDR A;  3RC3 A;  2XUE A;  2KT9 A;  2ZM6 T;  1WU7 A;  3O1H A;  4O4J E;  3RC8 A;  1G51 A;  2IHR 1;  2PBI A;  5J2U E;  1NJ5 A;  3EFS A;  5C51 B;  1YD8 G;  3HR0 A;  3AEB A;  3MXZ A;  4TTV A;  2BDE A;  4BAY B;  5JVD E;  1M7K A;  5L2L A;  5AQK B;  4XEM A;  1H4V B;  2J4G A;  3QNE A;  3MAC A;  5HWY A;  3E9H A;  1WNL A;  4IE7 A;  5EK4 A;  3A7A A;  3AAI A;  4YJ3 E;  2QGS A;  4QX8 B;  1Z7N A;  4BJM A;  1B7Y A;  2DQ3 A;  1ZV4 X;  2WS3 A;  3E0Z A;  4O2B E;  2LRK A;  3P8Y A;  3CVR A;  2KWH A;  4EZH A;  5LGN B;  4CS2 A;  5LBQ B;  4ADZ A;  1J1J A;  3RIF A;  3ZMS B;  5EK3 A;  2AKW A;  2KWI B;  3GA8 A;  4JBW F;  1N9W A;  4HT4 A;  5JDF A;  2N9D A;  4L5G A;  4IRE A;  4E7S A;  4JI4 T;  4X66 T;  3RUX A;  2GK9 A;  3Q5E A;  2BS2 A;  1DU2 A;  3SFD A;  3HI2 A;  3C4W A;  2E5A A;  4PK6 A;  3CKD A;  1JNZ A;  3ZT7 A;  4HTE A;  4CS3 A;  3BQI A;  5HEO A;  1OED C;  5AQP B;  2LSG A;  1HTT A;  3EFR A;  4U3C A;  4X62 T;  4HWH A;  1B7Y B;  1X01 A;  3ZMV B;  2LHN A;  2I4L A;  3IBP A;  4GKJ T;  1FJG T;  2YDS A;  4C91 A;  5FXV A;  3UGT A;  1FMW A;  2DTO A;  3F2E A;  1NYR A;  5LJM A;  4RQF A;  2QHS A;  1D1A A;  4P1N A;  3LSV A;  3HXY A;  4ZIB A;  5AQM B;  3EHZ A;  1O3X A;  4JI6 T;  2A2F X;  3NRX A;  3UUM A;  2WDV A;  3NBX X;  2DTH A;  4X5O A;  2X9W A;  5HXE A;  2CE7 A;  2AE9 A;  3HKB E;  4HFH A;  2E3C A;  2UXB T;  3EAB A;  3UFG A;  2V7M A;  4YRM A;  4ASK A;  3TEH A;  4LF6 T;  2VVN A;  5CB4 E;  4PNI A;  3PUY F;  3RRC A;  4P74 C;  2DZC A;  3QO5 A;  2ZLY A;  3MJX A;  5IYZ E;  3WI3 A;  3FZF B;  1YFT A;  3CX7 B;  4AKG A;  2Z6E A;  1E1T A;  3OYX A;  3H3M A;  2FUP A;  5L4H A;  4LVK A;  2DZ9 A;  2WAU A;  3HFV A;  4ILA A;  2E10 A;  3ETU A;  2RHQ A;  3PUX F;  4X65 T;  3QB5 K;  1WR0 A;  4YRF A;  4HWP A;  3ANW A;  3VU7 H;  4DR3 T;  4AIS A;  2KLQ A;  3AEE A;  3M4Q A;  5H6Q B;  2K9A A;  2I59 A;  1BBU A;  4IE5 A;  3TEH B;  4BA9 A;  1X9B A;  3KV6 A;  5DAB A;  4AQG A;  4DUZ T;  3Q5X A;  2XPK A;  4LFC T;  1SHZ C;  3KVB A;  4QXC B;  2E5V A;  4WZX A;  3MK7 C;  3UU5 A;  1US7 B;  3ZYM A;  2E65 A;  3K8P C;  4LMJ A;  1IBL T;  2MYS A;  4NIQ A;  4YRG A;  3P4S A;  2CM0 A;  3AE9 A;  3KVA A;  3RKO A;  3RKY A;  2J62 A;  4PK4 A;  3T1H T;  4IE6 A;  2RHQ B;  3A8Y C;  4YTP A;  4TZ4 C;  1HFA A;  3MKD A;  3N9M A;  4YTM A;  2PJQ A;  2DNX A;  5L3D B;  3PUW F;  3ANW B;  4UEM A;  4DR5 T;  3PCO A;  4ZZC A;  2E9X C;  3X1D A;  3JAE A;  3CQX C;  2CXL A;  1J5W A;  2FJB A;  2BG9 C;  2CPT A;  3EUH A;  4DR1 T;  1OXZ A;  4LF4 T;  1YW0 A;  1B7T A;  3HRI A;  4DV1 T;  2DXU A;  4YRE A;  5CGM A;  1AJ3 A;  2LSY A;  4B3S T;  2WB5 A;  2XTL A;  3LK4 2;  2JPF A;  2QHU A;  2HPL A;  4XTX A;  1MIV A;  5M4Y A;  1VQZ A;  2X67 A;  3L2Z A;  2ZIN A;  3A5Z A;  4P72 C;  4YCW A;  3NVO A;  3VQX A;  1WYC A;  2FJE A;  4YRT A;  3R07 A;  4G2A A;  4LFB T;  3I9W A;  3AA7 B;  3FXD B;  2XAJ B;  3KV4 A;  3ONL C;  4IL9 A;  4XU2 A;  1HNZ T;  3PCO B;  4U2Y A;  4IT4 A;  1NWM X;  4EO4 A;  3HFZ A;  1EOV A;  3JCF A;  4K0U A;  4H9S E;  4XU0 A;  2M67 A;  4WYV A;  4CI2 B;  3F57 A;  4JEU B;  4TQF A;  4BW9 A;  1WR6 A;  2ZIM A;  2VB6 A;  3PUA A;  2HPJ A;  2JRK A;  1UCU A;  1QE0 A;  5JTG A;  1USY C;  2MTQ A;  3A7U A;  3P8C D;  2FBW A;  3AAE B;  4ZZB A;  3NEN A;  3VQV A;  5FXZ A;  4WJ4 A;  1FMV A;  3I0Q A;  5F5W A;  1IAP A;  4H2S A;  4X1Y E;  4I0U A;  3FZK B;  5L4E A;  2BKN A;  2WU5 A;  3ABV A;  3FHN A;  3U3I A; 
#chains in the Genus database with same CATH homology
 2AMC A;  4OLF A;  3MQZ A;  3HY1 A;  4P71 C;  3HFZ B;  1EFW A;  1H4T A;  2Q7G A;  2RHS A;  2CJB A;  1YFR A;  3A7R A;  1EVK A;  1X56 A;  4HA8 A;  3UGQ A;  1G5I A;  2P5I A;  4CH5 A;  1X2H A;  4XTU A;  4P71 A;  3V8K A;  4YP0 A;  2ZT6 A;  4BWA A;  3IAL A;  1BIA A;  2ZT7 A;  5KNN A;  4LVL A;  1YFS A;  4XTV A;  3VQY A;  1X55 A;  1Z7M A;  2DEQ A;  5ELO A;  3MEY A;  2AKW B;  4CH4 A;  3L1A A;  1EQR A;  1JJC A;  3IG2 A;  3REU A;  2C8M A;  3V8L A;  4O2D A;  2Q7H A;  4TVA A;  4XTZ A;  4G85 A;  4P73 C;  1WLE A;  1B76 A;  1WU7 A;  3VQW A;  3HXW A;  1G5H A;  4LVI A;  2ZR2 A;  3BFM A;  4P73 A;  1W66 A;  2AMC B;  1NJ1 A;  2ALY A;  2Q5I A;  3IKM B;  3QO8 A;  1G51 A;  1H4Q A;  1NJ5 A;  3EFS A;  5C51 B;  4KR2 A;  2J3M A;  4TTV A;  3HTZ A;  4DQ2 A;  4TVW A;  4XEM A;  2A8E A;  1H4V B;  3QNE A;  2ZTG A;  4YYE A;  4Q6G A;  2J3L A;  3ICA A;  3E9H A;  4HVC A;  4PHC A;  1WNL A;  4YDQ A;  5K1P A;  3A7A A;  4PG3 A;  2QHV A;  2ODR D;  4HWT A;  1Z7N A;  4ZTZ B;  1B7Y A;  2DQ3 A;  3LC0 A;  2ZCE A;  3LSS A;  3P8Y A;  1JJC B;  2I4M A;  1SRY A;  4TVA B;  3MF2 A;  3BJU A;  3TEG A;  3V7C A;  4CS2 A;  4HWO A;  4TVY A;  4G84 A;  4H2X A;  2AKW A;  1ASZ A;  1N9W A;  2CJA A;  4HT4 A;  2ALY B;  3A31 A;  2DXT A;  1WQW A;  2DU7 A;  4WJ3 M;  3RUX A;  3RIR A;  4DPG A;  4LNS A;  2G4C A;  1WQ7 A;  3L4G A;  2E5A A;  4J15 A;  1NJ6 A;  4CH3 A;  5C53 B;  4CS3 A;  2Q7E A;  2EJG A;  2DDZ A;  2ZZG A;  1ASY A;  3W3S A;  2E41 A;  1NJ8 A;  1HTT A;  3EFR A;  2ZIO A;  1B7Y B;  3HXU A;  1X01 A;  2Q5H A;  1E22 A;  4LVM A;  2I4L A;  2E1H A;  4HWR A;  5HGQ A;  3UGT A;  2DTO A;  3HXX A;  1NYR A;  2ODR C;  4RQF A;  2QHS A;  3QO7 A;  4YCV A;  1KOG A;  4H2X B;  3HXY A;  4ZIB A;  4YRK A;  1WPY A;  2DJZ A;  1H4S A;  1FYF A;  4YRN A;  2ZT8 A;  4H2U A;  1RIQ A;  2DTH A;  4X5O A;  4P75 C;  3I7F A;  2EAY A;  4YRP A;  1NJ2 A;  1EVL A;  4K88 A;  1NNH A;  2E3C A;  4ZTU B;  3UFG A;  3L4G B;  4L87 A;  4YRM A;  1BIB A;  5ELN A;  3TEH A;  4P75 A;  1NYQ A;  3TUP A;  4P74 C;  2DZC A;  4XU3 A;  3V7S A;  3QO5 A;  3RGL A;  3E9I A;  4Q15 A;  1X2G A;  1YFT A;  4P74 A;  4UP8 A;  1ATI A;  1GGM A;  2HNI A;  1E1T A;  3LSQ A;  4YRJ A;  2I4O A;  4KR3 A;  1E24 A;  4LVK A;  4YRQ A;  2ZZF A;  2DZ9 A;  1KMN A;  2ZGW A;  3PZC A;  3HFV A;  2E10 A;  2RHQ A;  3V7R A;  4XTW A;  3HXV A;  3QTC A;  5E3I A;  2DQ0 A;  4RDX A;  2EWN A;  4YRF A;  1SER A;  4HWP A;  1PYS A;  3NEM A;  2EJ9 A;  3M4Q A;  3NEL A;  1BBU A;  1IL2 A;  2CGH A;  3TEH B;  4K87 A;  4UP9 A;  1YGB A;  1C0A A;  3A5Y A;  4RMF A;  1QF6 A;  1B8A A;  2ZNJ A;  2DVE A;  3ERR A;  1X54 A;  1SES A;  4UPA A;  2E65 A;  4EX5 A;  4HWS A;  2ART A;  2DU5 A;  2ARU A;  2ZR3 A;  4YRG A;  5K1X A;  3HXZ A;  4K86 A;  3DSQ A;  1ADJ A;  4XTY A;  3RKY A;  1LYL A;  3KFU A;  4YRC A;  3RAC A;  2RHQ B;  4YCU A;  4YRR A;  4CH6 A;  3A32 A;  3RL6 A;  1ADY A;  3IKL A;  3PCO A;  2I4N A;  3WQZ A;  2C7I A;  1PYS B;  4YRO A;  4UP7 A;  1J5W A;  1SET A;  2EL9 A;  2QHT A;  4YPF A;  4RQE A;  3A74 A;  2FYK A;  4H2Y A;  3HRI A;  3NET A;  2DXU A;  4YRE A;  3RKX A;  3MF1 A;  3V8J A;  1EIY A;  4LVJ A;  4H2V A;  2QHU A;  4XTX A;  1HC7 A;  3FJP A;  2CJ9 A;  1VQZ A;  3L2Z A;  2ZIN A;  3A5Z A;  1KMM A;  4P72 C;  4YCW A;  4NCX A;  3VQX A;  2DKG A;  4KQE A;  4YRT A;  1B70 A;  3R07 A;  3P8T A;  2ZXF A;  4P72 A;  3G1Z A;  1HXD A;  2DTI A;  4XEO A;  2E64 A;  2NS6 A;  2IY5 A;  2RHS B;  4XU2 A;  2ZT5 A;  2P0L A;  3PCO B;  4H2T A;  4XU1 A;  3CMQ A;  2PME A;  2CIM A;  4EO4 A;  1BBW A;  4TWA A;  3HFZ A;  2XGT A;  1EOV A;  4XU0 A;  4H02 A;  2ARS A;  4OP0 A;  2EJF A;  4P3N A;  4TQF A;  4TQD A;  2XTI A;  4CS4 A;  3HY0 A;  3RF1 A;  4YRL A;  1WYD A;  4P3P A;  4BW9 A;  2ZIM A;  4H2W A;  1EIY B;  3M4P A;  1QE0 A;  4YRS A;  1USY C;  4WF2 A;  3A7U A;  4AH6 A;  11AS A;  3NEN A;  3VQV A;  2ZNI A;  4WJ4 A;  1USY A;  1B70 B;  4E51 A;  1YB3 A;  2ZZE A;  5F5W A;  3REX A;  3VBB A;  3RKW A;  5C52 B;  3P8V A;  4H2S A;  1E1O A;  4P3O A;  4YRI A;  3UH0 A;  4WI1 A;  2IY5 B;  12AS A;  1L0W A;  3OD1 A;  2PMF A;  3HRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...