3RF1A

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha subunit
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rf1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rf1A01
1B7YB 3RF1A 4YRFA 1WPYA 1B70B 2E10A 4HWRA 3V8JA 2E3CA 2PMFA 4TVYA 2ALYB 4YYEA 4H2XB 3M4QA 1H4VB 1EVLA 2ZXFA 2J3LA 4CH3A 4WF2A 4CH5A 4H2TA 4AH6A 2ALYA 2I4OA 3QTCA 5K1PA 4EX5A 4P74C 5K1XA 2ZZFA 1E22A 1X01A 2Q7EA 2EJ9A 3ERRA 3P8VA 1QF6A 1G51A 4RMFA 1USYC 4P73A 4EO4A 4CH6A 1SRYA 1HXDA 1B8AA 4KR3A 2IY5B 4DPGA 12ASA 2Q5HA 2ARSA 4J15A 2ZIMA 2J3MA 2ZT5A 3HFZB 4P71C 2EAYA 1YGBA 1NNHA 5E3IA 4YRCA 3QO7A 2ODRC 4YRKA 3V7CA 1G5HA 4UPAA 4DQ2A 4G85A 1X55A 4XU2A 4YRRA 2XGTA 4YRQA 4YREA 4WI1A 4RQFA 3RGLA 4HA8A 4TQDA 1PYSA 4HWPA 3RUXA 3RKYA 2ZR3A 4H2VA 3P8TA 4TQFA 2QHSA 3HRIA 3REUA 3A32A 3UGQA 2ZGWA 3WQZA 3TEHA 4OLFA 2CGHA 5F5WA 2QHUA 2ODRD 2E41A 2ARTA 4YRIA 1EIYB 2DQ3A 5C52B 3IG2A 1E1TA 1WNLA 3NEMA 5KNNA 1YFSA 2DZ9A 2ZCEA 2Q7HA 2XTIA 4PG3A 3V8KA 3A7AA 4WJ3M 4CS2A 1EIYA 4K86A 1NJ8A 2AMCB 2DJZA 3EFSA 3HXVA 3ICAA 2EJGA 4G84A 1QE0A 3A7RA 1W66A 1KMNA 2CIMA 3E9IA 3RKXA 1EVKA 4XTWA 1G5IA 4CH4A 4XTZA 2I4NA 4PHCA 3HFVA 2DXUA 2RHSB 3RKWA 1X56A 5ELOA 3TUPA 3QO8A 4XTXA 3HXYA 4H2UA 3RL6A 1EOVA 3VQWA 3L2ZA 2DEQA 4UP8A 3V7SA 1SETA 1NJ1A 4K87A 3A5YA 1B70A 2FYKA 1WLEA 1WU7A 2RHQA 1ATIA 3BFMA 2E1HA 1Z7NA 1BIAA 3A31A 4Q15A 3HFZA 2ZZGA 1N9WA 4XTYA 1EQRA 4K88A 2IY5A 1EFWA 4CS4A 4HVCA 1ADYA 4UP7A 3A74A 3CMQA 3NENA 2DZCA 4YCVA 2DTHA 3V7RA 4OP0A 2DVEA 4TVAB 4LNSA 4KR2A 3G1ZA 3MF2A 4YROA 1H4SA 4HWTA 3REXA 3VQYA 1ASYA 1E1OA 2PMEA 3HY0A 2DTIA 4YCUA 3E9HA 4TWAA 2CJAA 4P72C 2DQ0A 1YFRA 4TVAA 2QHVA 4H2WA 2EWNA 4XU0A 4YRNA 4XU3A 2AMCA 2I4MA 3RIRA 3IALA 3L4GA 3HXWA 1YFTA 3OD1A 3R07A 4XEMA 1ASZA 4CS3A 2ZT8A 2DKGA 3VQXA 2ZT6A 1NYRA 4TTVA 1WQWA 2EJFA 3LSSA 2AKWA 11ASA 1X54A 1H4TA 3HXUA 4BWAA 3HXXA 1WYDA 3PZCA 4RDXA 1FYFA 2E64A 1GGMA 5C53B 4YRGA 3UGTA 3DSQA 4WJ4A 1BBWA 3VBBA 1SESA 4P3OA 3NETA 3W3SA 2E5AA 2ZINA 4RQEA 2QHTA 1BBUA 1YB3A 2G4CA 2RHSA 1X2GA 3HRKA 3MF1A 1HC7A 3QO5A 4HWOA 2P5IA 4L87A 4YPFA 1NJ6A 2CJBA 1BIBA 1E24A 1Z7MA 1NYQA 2HNIA 2DU5A 2DTOA 1B7YA 4P75A 4ZTUB 4XEOA 4UP9A 3EFRA 4YP0A 2Q5IA 2DU7A 3L1AA 4NCXA 3HY1A 3V8LA 4ZIBA 1NJ5A 5C51B 3M4PA 1LYLA 1JJCA 3PCOA 4YRJA 4XTUA 1NJ2A 4TVWA 3L4GB 3QNEA 2ZR2A 4E51A 3KFUA 1H4QA 2ZZEA 3HXZA 4P75C 4YCWA 2RHQB 4HWSA 2ZTGA 3LC0A 3A7UA 3MEYA 1IL2A 1PYSB 2EL9A 3VQVA 4O2DA 4P71A 2CJ9A 4P74A 2DXTA 5ELNA 4XU1A 2ZNIA 2I4LA 1J5WA 1C0AA 3I7FA 1ADJA 3P8YA 4YRTA 3NELA 4XTVA 2P0LA 4YRLA 4H2XA 2E65A 4X5OA 2C7IA 1USYA 1X2HA 1WQ7A 2C8MA 2ZIOA 4P3PA 4KQEA 3IKMB 3IKLA 2DDZA 1SERA 1RIQA 4Q6GA 4P73C 1KOGA 1VQZA 4YRPA 3UH0A 3BJUA 1KMMA 4H2YA 2ZT7A 4P3NA 1HTTA 4ZTZB 3RACA 4H02A 2ZNJA 4P72A 2ARUA 3FJPA 3A5ZA 3HTZA 4H2SA 4BW9A 5HGQA 2AKWB 3UFGA 3TEGA 1B76A 1JJCB 3PCOB 2Q7GA 3TEHB 3LSQA 4YDQA 4YRMA 1L0WA 4YRSA
chains in the Genus database with same CATH superfamily
4DR1T 5LBMA 3ZMSB 2XQ4A 1WPYA 2BZBA 1KFYA 1VRBA 4HWRA 3V8JA 5JH7E 2E3CA 2ALYB 4H2XB 1OWAA 2EHOB 5DQVA 1H4VB 1EVLA 4BAYB 2N2NA 4KI0F 4CI2B 4QH1A 4B3TT 4DV7T 3QTCA 5K1XA 1AJ3A 5HEHA 3B5MA 1X01A 4CN4A 4JI0T 4IREA 1G51A 1HNXT 4P73A 4U7IA 2XTLA 1B8AA 3LBXB 3RPUA 2ZLYA 3N9LA 3N2GE 5HXEA 4J15A 2XPKA 2ZIMA 3HFZB 3I0OA 4ILCA 4JYAT 2LSJA 3VHLA 1HR0T 1IJ6A 3QO7A 2M6BA 2DI4A 2ZM2A 3V7CA 4UEMA 4UPAA 1QLBA 4EAHA 4XU2A 2XGTA 2ZM6T 4NIQA 1HNZT 1I94T 3AA6B 4AIUA 4WI1A 3QB5A 2MOZA 4JUYA 4GIWA 3VR9A 4H9OC 4U72A 2WZHA 2LM2A 3OVUA 3HRIA 2NW7A 2EHOD 3MJXA 3WQZA 4TZ4C 2CGHA 2QHUA 3Q5DA 3ONJA 5FVLA 2LEHA 1LRZA 2NTXA 1GQEA 5HEUA 2CXDA 2CPTA 5AQPB 4EEBA 2Q7HA 2D0TA 5IYZE 1D0YA 5JDGA 4LVIA 4QXHB 3HKBE 1OEDE 4F6RC 2AMCB 2VVNA 1BR2A 2V7JA 3AEGA 5LHGB 3ICAA 3RYIE 4CXWA 4PK5A 2EJGA 1D1AA 4G84A 3KFWX 4NUVA 3A7RA 3ZJ1A 3KDSE 1W66A 1KMNA 3RKXA 4TNVA 4X1KE 2I4NA 2FJAA 2X0HA 2P9BA 3LSVA 2DXUA 2JQKA 3PV0F 1X56A 5ELOA 1DU2A 3QO8A 3RKWA 1U4QA 1FMWA 4C91A 3ZCJA 4UVAB 5F3JA 3VQWA 3RC8A 2DEQA 4AKHA 3C51A 2ACZA 2CHNA 4K87A 4PJJA 5AQTB 4EEDA 3PJAA 2XUEA 1WU7A 4LFCT 2W67A 3HL6A 5AQUB 2YOEA 1N9WA 4G2AA 4UXNB 4CN1A 4ILBA 4IIJE 3A5XA 5L4EA 3LBXA 3PUQA 5FY0A 3O4XE 2LSYA 1YW0A 4GYSA 4HVCA 3OJAA 3NENA 1W0BA 4L0RA 4UVBB 2DZCA 1N36T 2IMLA 4YCVA 3UU4A 4CZZB 2UXDT 3I9YA 2UXCT 3QK6A 3FXDB 4OP0A 2X51A 1FJGT 4YROA 1H4SA 1G8XA 4JI4T 2XQ8A 5AQLB 5ABEA 3HY0A 2DTIA 4UV9B 4YCUA 4B3RT 4IT4A 2CJAA 4OHFA 2X66A 5LHIB 4WW0A 2JJ9A 4OYKA 5L47A 2AMCA 2I4MA 5JDHA 5AQSB 3L4GA 3Q5XA 4X1YE 2IHR1 4XZCA 4P0AA 4CS3A 2DKGA 2ZT6A 1WQWA 3LSSA 3NVOA 3N9NA 1X54A 1WR0A 1H4TA 2QGSA 3L39A 2QRXA 3RKOA 4O2BE 2XAQB 2E64A 4HFVA 4EYYR 5KX5E 4ADZA 1MIVA 4CXYA 4DR5T 3PE0A 3DSQA 3RRWA 2YK0A 1HNWT 3ZT5A 2WU5A 3I1AA 1SESA 3AXJA 5J1GA 4P3OA 3MZKB 4AQYT 4UF0B 2X9YA 1T72A 3W3SA 4AISA 3KBTA 1OEDB 1NWMX 2VL8A 3K3QC 1BBUA 2CWOA 4I50E 4XBFB 4LFAT 3AE4A 2CA5A 2Q9QD 2B1EA 2CJBA 4IL4A 3SS1A 1Z7MA 5LNKA 5EZYE 1UURA 2NW8A 5F8PA 4NCXA 4ZIBA 2RPAA 1FEWA 2H7VC 5E0OA 4YTPA 5FY7A 1IAPA 3M4PA 3UQ4A 3Q9DA 1LYLA 3JC6C 2DL1A 5HEJA 3P8CD 2WMOA 5AFUL 4IE6A 1VCSA 2HH7A 4MLKA 4MHCA 3CX6B 1I6ZA 3KFUA 1WFDA 3C4ZA 4PK4A 2CMRA 4JEUB 2ODUA 5JDFA 1BR0A 3FZLB 1L0VA 1CUNA 2WAUA 4P75C 1IBKT 2RHQB 5FY1A 4HWSA 3PUSA 3LC0A 3AE6A 3A7UA 3MEYA 1QUUA 4KMCA 2D9DA 5LHHB 2EL9A 2VQET 5CA1E 3VQVA 4O2DA 4H9RC 3ZKRA 2KXPB 1NEKA 4P74A 4X62T 1J5WA 1C0AA 4JI2T 4G63A 4HWHA 2LT3A 4XTVA 5FYMA 2P0LA 1Y01A 2VWAA 3IA3A 5IHYA 4LFBT 4B3ST 3RYFE 2HN1A 5LJMA 2DDZA 1SERA 2MAWA 2BVLA 1KOGA 4YRPA 1XWMA 5FKYA 4I55E 2W61A 3T1YT 2VVSA 4PJLA 1IJ5A 4ZTZB 3RACA 3J7Yq 3AAEB 2JIWA 4P72A 1XNQT 3A5ZA 2LKGA 3VKGA 2L3LA 5L3CB 5HGQA 3TEGA 2WSSV 1YQ3A 5AQVB 3E22E 3Q2MA 2VK9A 4X5TA 1L0WA 2IW5B 4O4IE 4JBWF 2K48A 3RF1A 3AE2A 5LG4A 1B70B 5FL1A 3TLWA 3DP7A 4DNDA 4TVYA 4YTNA 4YYEA 4GK0E 2E9XA 2LRLA 3BK9A 4PNIA 4DR3T 2KNDA 3UU8A 4EXTA 2Y8DA 4U74A 1OEDA 2ZXFA 2QVAA 2J3LA 4CH3A 3Q5WA 1UX5A 2VB6A 3C64A 4BA9A 2PJQA 3HKDE 3PUXF 1BR4A 5K1PA 4YFSA 2XM2A 3HR0A 1UUSA 2DHRA 2V1DB 2JQ9A 4JI1T 4Z90A 3LK3B 3CK6A 1E22A 2Q7EA 2HPJA 2EJ9A 2K24A 3P4RA 2C5JA 2AXDS 2YDSA 2VKJA 1M7KA 2N9DA 1USYC 4DR6T 2NW9A 1SRYA 4KR3A 2IY5B 2OLTA 1CHUA 3AA1B 2DLRA 3KV9A 4WNKA 4EZHA 2I6HA 2ZMAA 2J3MA 2ZT5A 2WCAA 4P71C 4DO0A 1SA0E 5LGTB 2XJ7A 5HXRA 2NTYA 1YGBA 5LBQB 4YRKA 3AB3B 1X55A 3ZMTB 2C0SA 4YRRA 4YRQA 4YREA 4QH4A 2XSBA 4RQFA 3RGLA 2J4GA 3I0QA 1PYSA 4HWPA 3LDQB 3GN5A 3RUXA 3RKYA 4H2VA 3OYZA 3FBLA 5EK2A 3REUA 3UGQA 3JCFA 3VU7H 3JAFA 1ZV4X 3UU6A 4U33A 1V9DA 2LOSA 2W63A 4O4LE 2E41A 4OX9T 3NWIA 3UULA 5IWAT 4YRIA 3R84B 3IG2A 1WNLA 2BVMA 2DZ9A 2BG9A 3TLSA 2ZCEA 4PG3A 3V8KA 1D1CA 2A72A 1FMVA 3X1DA 3EFSA 3HXVA 4IDZA 4YY3T 2IDOB 2LHRA 1IBLT 3H3MA 1T7SA 2CIMA 3E9IA 3ABVA 4XTWA 1JNRA 5ABFB 3V5SA 2V5CA 3ETUA 4CH4A 4XTZA 5LGUB 3MK7C 5BR8T 1ZP0A 5AQKB 4ISTA 2RHSB 4IDQA 5CFBA 5TAOA 1E1HB 5CA0E 5C2TA 3HXYA 3H37A 2N1GA 4AQFC 3L2ZA 5HXCA 4PK6A 4NUUA 3C98B 2FYKA 3KVBA 2RHQA 4GKKT 1ATIA 3OBVE 3UUNA 1Z7NA 3A31A 4DMWA 2ZZGA 4XTYA 4Z8XA 5HXHA 4BJMA 2Z6EA 2WQYA 4CS4A 1ADYA 4UP7A 1YKEB 3CMQA 3CWZB 1X9BA 4I0UA 2W00A 2GK9A 3EVYA 2ZM0A 4JI7T 2F4VT 2BDEA 3PUVF 1R8IA 3ZEFB 4ZS2A 3CQCB 4E7SA 3C4WA 3O1JA 2UUBT 4KP3C 2CXFA 4KR2A 1KEYA 3QC9A 4AQFA 1M62A 4J2CA 1MMNA 3EI0A 3RIUC 2PMEA 4YHHT 1US7B 4X66T 1YFRA 4TVAA 4H2WA 4FI5A 4XU0A 4YRNA 1KNZA 1KK7A 2LRKA 5AQFB 3RIRA 3MXZA 3IALA 2X9WA 3HXWA 4GOUA 2NP9A 4QHOA 3S4UA 1FIOA 4XEMA 1SHZC 3VQXA 1NYRA 5H6RB 2CE7A 4BWAA 2CBJA 1Z8UA 2WP9A 4HFCA 1VOMA 3PUYF 3JC6D 1NAFA 4O2AE 2IC6A 4LVMA 3GWHA 1BBWA 2CLYB 1MIYA 3TLUA 1UX4A 3VBBA 2W0GA 5AQRB 3JAEA 2WDQA 4YT0A 3AVRA 4EYUA 4NXNT 4H63H 2VKHA 2YDRA 5JR9A 3AEEA 2E5AA 3EABA 3ZSTA 4HT4A 2ZINA 3K3OA 4I43B 5ABGA 3ONXA 3I9WA 5ADXL 3HRKA 1XDPA 2VKOA 5ABHA 2P5IA 4HWOA 4YPFA 4PW8A 3PDYA 4EGWA 1E24A 1NYQA 1B7YA 2WBLA 4UP9A 4YP0A 4KHZF 2Q5IA 3UT5E 4NXMT 3L1AA 2XSAA 2Y6XA 3EDVA 1LKXA 4EIWA 2ES0A 1S35A 1E2AA 3IF8B 1JJCA 4YRJA 4XTUA 1NJ2A 1W09A 2FJDA 2ZR2A 4E51A 2JMHA 2V7LA 4K0UA 3RIFA 3RKGA 3PUWF 2UUAT 1XMQT 3SWHA 4ASKA 1PYSB 3QUJA 4ZS3A 5EK4A 2K9AA 5JVDE 2BS4A 4ZI7E 4XU1A 2V7IA 3I7FA 3P8YA 4YRTA 1ZHCA 1T98A 5JREA 1H7CA 2NS6A 2C7IA 4JLEA 2MYSA 2PTFA 2ZIOA 4FJOA 4KQEA 3IKMB 3IKLA 4DMVA 4XAXB 4H9QC 2XQ9A 3ZC1A 5JDQA 3A8YC 2V8SV 2UXBT 4QH5A 5CJ5A 2W66A 4AI6A 4IDNA 2JPFA 3EAMA 3UUBA 4B3MT 4H02A 5JRCA 3AA7B 2M67A 3U78A 4BW9A 3K1SA 3M3ZB 1B76A 3PCOB 2W2UA 4YXDA 4KX6A 3N9PA 3B13A 4YRMA 3FBZA 4JI6T 3O9XA 4YRFA 4UELA 1D0XA 4HWCA 5LCYA 2BG9E 4YSXA 4HEAA 3O1HA 5AQQB 4B6XA 3LK2B 4HTEA 3N5LA 3P4WA 5L3GB 4CH5A 4H2TA 4AH6A 2KSRA 3LG7A 2Q9QA 3RLFF 5LB7B 1HG5A 2D2SA 2A9UA 3P8VA 2JQHA 5JQGE 2V5DA 3D0TA 1E7PA 2LKHA 3UUMA 3AE5A 2LSIA 3OKQA 4CQIA 4DPGA 4TV8E 2KWIB 3AVSA 1KF6A 2KT9A 3K8PC 12ASA 4DBRA 1MMDA 5H6QB 5FL0A 4YHJA 5C3JA 3NRXA 3P4SA 1NNHA 1N34T 3V5UA 3F31A 1NENA 4TWDA 5DJQC 2XZEA 4HWIB 5LYJE 5FP3A 5JTGA 2PFVA 2W4XA 3ZC0A 2NWBA 1G73A 4ZHQE 4AKIA 3T1HT 2EHOA 2MTQA 2H7OA 2ZR3A 4DVDA 3A32A 5J0ZA 4DBQA 3TEHA 3FHNA 2YU2A 4ILAA 4OLFA 3JADA 2PBIA 4H63V 2VASA 5FMNA 2M6IA 2W62A 3HA4A 1E1TA 4LVKA 3E0ZA 3NEMA 5KNNA 4JEHB 2XTIA 2OV9A 3ANWA 4EOZB 4ZZBA 3FXEB 2LSKA 3P4QA 3GMIA 4CS2A 1EIYA 4K86A 1NJ8A 3NZPA 3PU8A 3RHWA 4P0BA 4DV2T 1QE0A 2E8IA 1HFAA 4C90A 2DWGA 2XQ5A 1UCUA 3H3AA 1EVKA 1G5IA 1LVFA 4QXCB 4HN9A 4YTMA 4PHCA 1XMOT 2FJBA 4HFIA 3RL6A 3P7IA 1EOVA 2BS3A 3AA0B 3V7SA 2XY8B 3F2EA 2XQAA 3NBXX 1B70A 2LHNA 3A5YA 4CI3B 3RIAA 1WLEA 1XDOA 4UR9A 1HX1B 1WR6A 2CHOA 2E1HA 1BIAA 4IE0A 2E2AA 3TLVA 4TUYE 3HFZA 3Q5EA 4HFBA 5L3EB 5BMVE 2UUCT 1LVKA 3C4XA 3ZYKA 4K88A 1EFWA 4K0KT 4COFA 3UUXB 1X79A 2V7KA 2L8KA 4LF7T 4JI5T 5LP6E 2DTHA 4X20E 4ZI3D 4X65T 3IHRA 4ZEYA 4KUMB 4DR7T 2X0YA 1W9RA 3OTOT 4KBMB 4LMJA 3VRBA 4TVAB 2LSGA 4LNSA 4DV1T 3G1ZA 3MF2A 5AQGB 4HWTA 3REXA 2XM1A 5LG3A 4JI3T 4OK0A 3TLTA 2LM9A 3RQWA 5CGMA 3E9HA 4P72C 2WDRA 2EWNA 3FZMB 4XU3A 3HKEE 4TWHA 1VCTA 1KNPA 3ZPOA 1UK5A 2WWVA 3NZQA 2NOXA 2UXNB 5LA6E 3N2OA 3ZJ2A 5FXZA 3RIUA 3R07A 1ASZA 3ZMZB 2X9XA 3O1IA 1YXRA 4PFOA 2CEAA 3AXJB 4TTVA 11ASA 4GYRA 3HXXA 5JRCB 2Y48B 5HYAA 4RDXA 1FYFA 5M4YA 2K5BB 1GGMA 1WYBA 4HFDA 2LE8A 3IEEA 5GONE 2H3RA 4EZ4A 4HE8A 4A5XA 4U2ZA 1HTJF 3ETVA 3EUHA 3RYCE 3SFDA 3ONLC 3KINB 2OA5A 1YB3A 4CI1B 5J2UE 2D5UA 3ZN1B 2RHSA 1X2GA 5KXJA 5FVKA 2JRKA 3KV5A 2ACXA 3ZN0B 2FJEA 3MF1A 1HC7A 3QO5A 5HEOA 3OYXA 3P50A 1BIBA 2HNIA 2I59A 2DTOA 4ZTUB 1EZ3A 3PTRB 3ZCIA 4A56A 4QKNA 2DU7A 3ZYMA 4DV0T 4HKAA 3V8LA 4NPPA 4JV5T 3MA9A 3CQXC 1NJ5A 3SOLA 4EV6A 4O4JE 1U5PA 5C51B 1MNEA 2X67A 2WMNA 3GA8A 5HEGA 3CKDA 4AKRB 3N9OA 5KMGP 4TVWA 3IBPA 1HF8A 3L4GB 4MALA 2WS3A 3NRYA 3L8RA 3UFEA 4TWFA 2CM0A 5HWYA 1IBMT 2E5VA 3LFMA 4QX7B 3SFEA 4WBNE 4CN6A 3DJBA 4YCWA 5LMNT 5AQMB 1WLXA 3AE3A 3DTOA 4OYJA 4LF8T 3AE9A 3LJCA 4P71A 3CMLA 2DXTA 4UV8B 2C5KT 5HWXA 2IC9A 3AEAA 1HS7A 4N78D 4YRLA 4H2XA 3G06A 4ZI2D 1USYA 2C8MA 3RC3A 2V7MA 1HCIA 4L9IA 3R6NA 4Q6GA 4DR4T 4P73C 5JDMA 1JNZA 3UH0A 3ANWB 3OPCA 1KMMA 4H2YA 3A7MA 3C50A 2BG9C 2D0UA 3FZFB 3AEBA 3KV4A 5A1LA 1HTTA 2XAJB 2ZNJA 4X64T 2ARUA 2V26A 2LJLA 4P1NA 3HTZA 4H2SA 2KINB 1Z0PA 2AKWB 3UFGA 2BBHA 4MFRA 2Q7GA 2E9XD 4YDQA 3L3PA 3AE8A 4DV5T 2B76A 1B7YB 2HHHT 5AQHB 2Q9QB 5LXTE 4HWDA 2E10A 1J1JA 4PJNA 2A8EA 2PMFA 4ZOLE 3CIRA 1MNDA 3M4QA 3ESLA 3PURA 2XQYA 4IDOA 5L2LA 4WF2A 2E9XB 2CBIA 2ALYA 5AQJB 2I4OA 2XQ7A 2X68A 3SRZA 3EDUA 4EX5A 4P74C 5FXVA 2ZZFA 3MQZA 2EHOC 4OFZA 5JR9B 2WM9A 4PAGA 3ERRA 3QOFA 1QF6A 2CXLA 4RMFA 5J2TE 4EO4A 4CH6A 1HXDA 3UU3A 3AEFA 5AQOB 2V6XA 3AE1A 4LMKA 2Q5HA 4O8SA 2ARSA 2WY2A 3HI2A 5AQNB 4V1Av 3AE7A 3CX7B 4BJNA 4EB6E 1KNRA 3ZMUB 5L3FB 2EAYA 5E3IA 4YRCA 3CQGB 3WAJA 4MBQA 2YU1A 4AQGA 2ODRC 3RH3A 5IUXA 1G5HA 2XQ6A 4DQ2A 2VL0A 2YEVC 4G85A 5ETWA 3N2KE 4KHPT 3MKDA 1ZEEA 2J1DG 5LGNB 3ZMVB 4HA8A 4TQDA 4IE5A 4Z91A 5ABFA 4TQFA 3P8TA 2QHSA 2IUBA 1QSDA 3HKCE 3ZSSA 2R6GF 2V6YB 3ZT6A 2ZGWA 1ZKEA 3AAAB 3UU5A 2RA1A 3EHZA 2Q9QC 1WYCA 5F5WA 4YSZA 2ODRD 2ARTA 4WZXA 1EIYB 3BQIA 2DQ3A 4E7ZA 3B57A 4Q25A 5C52B 2BKNA 3BQKA 3WAKA 3VKHA 4P09A 1YFSA 5JDLA 1J5ET 3A7AA 4WJ3M 4LVLA 3RRCA 3FB2A 1HX8A 5HCMA 4U31A 2VQFT 4DV3T 2DJZA 2LLYA 2J47A 4ERRA 2YDQA 4IE7A 5LJNA 2KZ7B 2YINA 4QX8B 3CX8B 3ZYLA 5L4HA 3GN5B 3RX6A 5L3DB 4TN7B 3ZT7A 4AKLA 4ISSA 4ZZCA 4WYVA 3HFVA 5JDNA 3ZLIA 3TUPA 1D0ZA 1SE7A 4XTXA 1OEDC 3TKLB 2YKSA 4H2UA 5CB4E 4F8HA 4DR2T 4DUYT 4UP8A 2VURA 1SETA 5LOVE 1NJ1A 3PUGA 2HN2A 2BBJA 2L9QA 4U3CA 2AE9A 1XNRT 3BFMA 4HGAA 2H88A 4Q15A 2VKDA 3PUAA 4DV6T 4GK5E 2DWKA 1EQRA 3E08A 2IY5A 4H9SE 3WI3A 4AKGA 4U7YA 3A74A 1W0AA 2A3DA 4LF5T 3PU3A 4ZI3C 3T8OA 4HFEA 4YRSA 2DNXA 3V7RA 5HXSA 3KVAA 4H9NC 1UGOA 2PG8A 4A98A 2MPKA 4DUZT 2DVEA 4I4TE 2KMFA 3AECA 4YJ3E 4JI8T 3VQYA 1ASYA 1E1OA 3M65A 1IZNB 4U2YA 3PJAJ 2MBGA 4TWAA 2CWYA 2DCFA 4UF0A 2DQ0A 2A2FX 1D1BA 2QHVA 3UQ7A 2E5LT 2J62A 2XQ3A 4L5GA 4LMLA 1MIWA 5FXXA 1YFTA 3OD1A 2FBWA 4A97A 3VRAA 4YSYA 5FNVE 2ZT8A 4O4HE 4IDPA 5HCJA 2EJFA 5HAXA 4QXBB 2AKWA 2WWUA 3HXUA 1YQ4A 5KDMC 1WYDA 3PZCA 3QNUA 3FZKB 2XASB 5C53B 3PUZF 3BQLA 4YRGA 5EK3A 1ZOYA 3W15B 3UGTA 2XHEB 3RQUA 2IIUA 4WJ4A 5FXWA 4PFPA 1BR1A 1N33T 1MMAA 3FZHB 4ANJA 3NETA 5L3BB 1XZYA 4ILUA 3KBUA 1OXZA 2RP4A 3UTKA 4RQEA 2QHTA 1YD8G 4DIDB 2K3WA 4IHJE 4X1IE 2G4CA 3U3IA 3J9X1 4L87A 3KV6A 1NJ6A 2ODVA 2WB5A 4IGUA 3AAIA 3AEDA 4ZXLA 2DU5A 4P75A 3VR8A 4XEOA 4DV4T 3EFRA 4LF4T 3K3NA 2BKOA 3HY1A 4IL9A 4HFHA 4YJ2E 1SUMB 2JQQA 2WDVA 3PCOA 1O3XA 4M1PA 3QB5K 2BG9B 5AQIB 2KLQA 2X0LB 2V6YA 3QNEA 4TX5A 2IAKA 3NKZA 4LF6T 1WCRA 4H9PC 1N32T 1H4QA 5DABA 2X9HA 2ZZEA 3HXZA 3RI5A 2NR4A 1MMGA 1Y64B 5LMUT 2ZM8A 2ZTGA 4LF9T 2UXXB 1IL2A 2LOPA 1B7TA 5JR9C 2XAHB 4WBOA 4CXXA 1HG2A 3CVRA 4YLHA 2CJ9A 5ELNA 2XAFB 4TV9E 2FUPA 4GKJT 2ZNIA 2I4LA 2SPCA 1ADJA 4PJMA 3P4PA 2I0MA 3NELA 2E9XC 5C8YE 2BS2A 3CPZA 2E65A 4X5OA 5DQWA 1X2HA 2YN6A 1WQ7A 4P3PA 1RIQA 2UU9T 1WRDA 3N9MA 2CRBA 2JMKA 4IE4A 1VQZA 2WU2A 4TNWA 1S94A 4AXPA 4LVJA 4QWNB 3BJUA 4UIGA 1T8BA 2KWHA 2CCQA 2C5IT 2ZT7A 2G0UA 2H89A 2QA7A 4P3NA 3F57A 3N9QA 3L09A 2CLYC 4HWFA 3FJPA 1YKHB 4UVCB 3LK42 4ZI2C 1JJCB 2XAGB 3TEHB 3RYHE 3LSQA 2HPLA 2BKPA 2QYWA 2WZIA 3MACA
chains in the Genus database with same CATH topology
1B7YB 3RF1A 4YRFA 1WPYA 1B70B 2E10A 2A8EA 4HWRA 3V8JA 2E3CA 2PMFA 4TVYA 2ALYB 4YYEA 4H2XB 3M4QA 1H4VB 1EVLA 2ZXFA 2J3LA 4CH3A 4WF2A 4CH5A 4H2TA 4AH6A 2ALYA 2I4OA 3QTCA 5K1PA 4EX5A 4P74C 5K1XA 2ZZFA 1E22A 1X01A 3MQZA 2Q7EA 2EJ9A 3ERRA 3P8VA 1QF6A 1G51A 4RMFA 1USYC 4P73A 4EO4A 4CH6A 1SRYA 1HXDA 1B8AA 4KR3A 2IY5B 4DPGA 12ASA 2Q5HA 2ARSA 4J15A 2ZIMA 2J3MA 2ZT5A 3HFZB 4P71C 2EAYA 1YGBA 1NNHA 5E3IA 4YRCA 3QO7A 2ODRC 4YRKA 3V7CA 1G5HA 4UPAA 4DQ2A 4G85A 1X55A 4XU2A 4YRRA 2XGTA 4YRQA 4YREA 4WI1A 4RQFA 3RGLA 4HA8A 4TQDA 1PYSA 4HWPA 3RUXA 3RKYA 2ZR3A 4H2VA 3P8TA 4TQFA 2QHSA 3HRIA 3REUA 3A32A 3UGQA 2ZGWA 3WQZA 3TEHA 4OLFA 2CGHA 5F5WA 2QHUA 2ODRD 2E41A 2ARTA 4YRIA 1EIYB 2DQ3A 5C52B 3IG2A 1E1TA 1WNLA 4LVKA 3NEMA 5KNNA 1YFSA 2DZ9A 2ZCEA 2Q7HA 2XTIA 4PG3A 3V8KA 4LVIA 3A7AA 4WJ3M 4LVLA 4CS2A 1EIYA 4K86A 1NJ8A 2AMCB 2DJZA 3EFSA 3HXVA 3ICAA 2EJGA 4G84A 1QE0A 3A7RA 1W66A 1KMNA 2CIMA 3E9IA 3RKXA 1EVKA 4XTWA 1G5IA 4CH4A 4XTZA 2I4NA 4PHCA 3HFVA 2DXUA 2RHSB 3RKWA 1X56A 5ELOA 3TUPA 3QO8A 4XTXA 3HXYA 4H2UA 3RL6A 1EOVA 3VQWA 3L2ZA 2DEQA 4UP8A 3V7SA 1SETA 1NJ1A 4K87A 3A5YA 1B70A 2FYKA 1WLEA 1WU7A 2RHQA 1ATIA 3BFMA 2E1HA 1Z7NA 1BIAA 3A31A 4Q15A 3HFZA 2ZZGA 1N9WA 4XTYA 1EQRA 4K88A 2IY5A 1EFWA 4CS4A 4HVCA 1ADYA 4UP7A 3A74A 3CMQA 3NENA 2DZCA 4YCVA 2DTHA 3V7RA 4OP0A 2DVEA 4TVAB 4LNSA 4KR2A 3G1ZA 3MF2A 4YROA 1H4SA 4HWTA 3REXA 3VQYA 1ASYA 1E1OA 2PMEA 3HY0A 2DTIA 4YCUA 3E9HA 4TWAA 2CJAA 4P72C 2DQ0A 1YFRA 4TVAA 2QHVA 4H2WA 2EWNA 4XU0A 4YRNA 4XU3A 2AMCA 2I4MA 3RIRA 3IALA 3L4GA 3HXWA 1YFTA 3OD1A 3R07A 4XEMA 1ASZA 4CS3A 2ZT8A 2DKGA 3VQXA 2ZT6A 1NYRA 4TTVA 1WQWA 2EJFA 3LSSA 2AKWA 11ASA 1X54A 1H4TA 3HXUA 4BWAA 3HXXA 1WYDA 3PZCA 4RDXA 1FYFA 2E64A 1GGMA 5C53B 4YRGA 3UGTA 3DSQA 4WJ4A 4LVMA 1BBWA 3VBBA 1SESA 4P3OA 3NETA 3W3SA 2E5AA 4HT4A 2ZINA 4RQEA 2QHTA 1BBUA 1YB3A 2G4CA 2RHSA 1X2GA 3HRKA 3MF1A 1HC7A 3QO5A 4HWOA 2P5IA 4L87A 4YPFA 1NJ6A 2CJBA 1BIBA 1E24A 1Z7MA 1NYQA 2HNIA 2DU5A 2DTOA 1B7YA 4P75A 4ZTUB 4XEOA 4UP9A 3EFRA 4YP0A 2Q5IA 2DU7A 3L1AA 4NCXA 3HY1A 3V8LA 4ZIBA 1NJ5A 5C51B 3M4PA 1LYLA 1JJCA 3PCOA 4YRJA 4XTUA 1NJ2A 4TVWA 3L4GB 3QNEA 2ZR2A 4E51A 3KFUA 1H4QA 2ZZEA 3HXZA 4P75C 4YCWA 2RHQB 4HWSA 2ZTGA 3LC0A 3A7UA 3MEYA 1IL2A 1PYSB 2EL9A 3VQVA 4O2DA 4P71A 2CJ9A 4P74A 2DXTA 5ELNA 4XU1A 2ZNIA 2I4LA 1J5WA 1C0AA 3I7FA 1ADJA 3P8YA 4YRTA 3NELA 4XTVA 2P0LA 2NS6A 4YRLA 4H2XA 2E65A 4X5OA 2C7IA 1USYA 1X2HA 1WQ7A 2C8MA 2ZIOA 4P3PA 4KQEA 3IKMB 3IKLA 2DDZA 1SERA 1RIQA 4Q6GA 4P73C 1KOGA 1VQZA 4YRPA 3UH0A 4LVJA 3BJUA 1KMMA 4H2YA 2ZT7A 4P3NA 1HTTA 4ZTZB 3RACA 4H02A 2ZNJA 4P72A 2ARUA 3FJPA 3A5ZA 3HTZA 4H2SA 4BW9A 5HGQA 2AKWB 3UFGA 3TEGA 1B76A 1JJCB 3PCOB 2Q7GA 3TEHB 3LSQA 4YDQA 4YRMA 1L0WA 4YRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7Y B;  3RF1 A;  4YRF A;  1WPY A;  1B70 B;  2E10 A;  4HWR A;  3V8J A;  2E3C A;  2PMF A;  4TVY A;  2ALY B;  4YYE A;  4H2X B;  3M4Q A;  1H4V B;  1EVL A;  2ZXF A;  2J3L A;  4CH3 A;  4WF2 A;  4CH5 A;  4H2T A;  4AH6 A;  2ALY A;  2I4O A;  3QTC A;  5K1P A;  4EX5 A;  4P74 C;  5K1X A;  2ZZF A;  1E22 A;  1X01 A;  2Q7E A;  2EJ9 A;  3ERR A;  3P8V A;  1QF6 A;  1G51 A;  4RMF A;  1USY C;  4P73 A;  4EO4 A;  4CH6 A;  1SRY A;  1HXD A;  1B8A A;  4KR3 A;  2IY5 B;  4DPG A;  12AS A;  2Q5H A;  2ARS A;  4J15 A;  2ZIM A;  2J3M A;  2ZT5 A;  3HFZ B;  4P71 C;  2EAY A;  1YGB A;  1NNH A;  5E3I A;  4YRC A;  3QO7 A;  2ODR C;  4YRK A;  3V7C A;  1G5H A;  4UPA A;  4DQ2 A;  4G85 A;  1X55 A;  4XU2 A;  4YRR A;  2XGT A;  4YRQ A;  4YRE A;  4WI1 A;  4RQF A;  3RGL A;  4HA8 A;  4TQD A;  1PYS A;  4HWP A;  3RUX A;  3RKY A;  2ZR3 A;  4H2V A;  3P8T A;  4TQF A;  2QHS A;  3HRI A;  3REU A;  3A32 A;  3UGQ A;  2ZGW A;  3WQZ A;  3TEH A;  4OLF A;  2CGH A;  5F5W A;  2QHU A;  2ODR D;  2E41 A;  2ART A;  4YRI A;  1EIY B;  2DQ3 A;  5C52 B;  3IG2 A;  1E1T A;  1WNL A;  3NEM A;  5KNN A;  1YFS A;  2DZ9 A;  2ZCE A;  2Q7H A;  2XTI A;  4PG3 A;  3V8K A;  3A7A A;  4WJ3 M;  4CS2 A;  1EIY A;  4K86 A;  1NJ8 A;  2AMC B;  2DJZ A;  3EFS A;  3HXV A;  3ICA A;  2EJG A;  4G84 A;  1QE0 A;  3A7R A;  1W66 A;  1KMN A;  2CIM A;  3E9I A;  3RKX A;  1EVK A;  4XTW A;  1G5I A;  4CH4 A;  4XTZ A;  2I4N A;  4PHC A;  3HFV A;  2DXU A;  2RHS B;  3RKW A;  1X56 A;  5ELO A;  3TUP A;  3QO8 A;  4XTX A;  3HXY A;  4H2U A;  3RL6 A;  1EOV A;  3VQW A;  3L2Z A;  2DEQ A;  4UP8 A;  3V7S A;  1SET A;  1NJ1 A;  4K87 A;  3A5Y A;  1B70 A;  2FYK A;  1WLE A;  1WU7 A;  2RHQ A;  1ATI A;  3BFM A;  2E1H A;  1Z7N A;  1BIA A;  3A31 A;  4Q15 A;  3HFZ A;  2ZZG A;  1N9W A;  4XTY A;  1EQR A;  4K88 A;  2IY5 A;  1EFW A;  4CS4 A;  4HVC A;  1ADY A;  4UP7 A;  3A74 A;  3CMQ A;  3NEN A;  2DZC A;  4YCV A;  2DTH A;  3V7R A;  4OP0 A;  2DVE A;  4TVA B;  4LNS A;  4KR2 A;  3G1Z A;  3MF2 A;  4YRO A;  1H4S A;  4HWT A;  3REX A;  3VQY A;  1ASY A;  1E1O A;  2PME A;  3HY0 A;  2DTI A;  4YCU A;  3E9H A;  4TWA A;  2CJA A;  4P72 C;  2DQ0 A;  1YFR A;  4TVA A;  2QHV A;  4H2W A;  2EWN A;  4XU0 A;  4YRN A;  4XU3 A;  2AMC A;  2I4M A;  3RIR A;  3IAL A;  3L4G A;  3HXW A;  1YFT A;  3OD1 A;  3R07 A;  4XEM A;  1ASZ A;  4CS3 A;  2ZT8 A;  2DKG A;  3VQX A;  2ZT6 A;  1NYR A;  4TTV A;  1WQW A;  2EJF A;  3LSS A;  2AKW A;  11AS A;  1X54 A;  1H4T A;  3HXU A;  4BWA A;  3HXX A;  1WYD A;  3PZC A;  4RDX A;  1FYF A;  2E64 A;  1GGM A;  5C53 B;  4YRG A;  3UGT A;  3DSQ A;  4WJ4 A;  1BBW A;  3VBB A;  1SES A;  4P3O A;  3NET A;  3W3S A;  2E5A A;  2ZIN A;  4RQE A;  2QHT A;  1BBU A;  1YB3 A;  2G4C A;  2RHS A;  1X2G A;  3HRK A;  3MF1 A;  1HC7 A;  3QO5 A;  4HWO A;  2P5I A;  4L87 A;  4YPF A;  1NJ6 A;  2CJB A;  1BIB A;  1E24 A;  1Z7M A;  1NYQ A;  2HNI A;  2DU5 A;  2DTO A;  1B7Y A;  4P75 A;  4ZTU B;  4XEO A;  4UP9 A;  3EFR A;  4YP0 A;  2Q5I A;  2DU7 A;  3L1A A;  4NCX A;  3HY1 A;  3V8L A;  4ZIB A;  1NJ5 A;  5C51 B;  3M4P A;  1LYL A;  1JJC A;  3PCO A;  4YRJ A;  4XTU A;  1NJ2 A;  4TVW A;  3L4G B;  3QNE A;  2ZR2 A;  4E51 A;  3KFU A;  1H4Q A;  2ZZE A;  3HXZ A;  4P75 C;  4YCW A;  2RHQ B;  4HWS A;  2ZTG A;  3LC0 A;  3A7U A;  3MEY A;  1IL2 A;  1PYS B;  2EL9 A;  3VQV A;  4O2D A;  4P71 A;  2CJ9 A;  4P74 A;  2DXT A;  5ELN A;  4XU1 A;  2ZNI A;  2I4L A;  1J5W A;  1C0A A;  3I7F A;  1ADJ A;  3P8Y A;  4YRT A;  3NEL A;  4XTV A;  2P0L A;  4YRL A;  4H2X A;  2E65 A;  4X5O A;  2C7I A;  1USY A;  1X2H A;  1WQ7 A;  2C8M A;  2ZIO A;  4P3P A;  4KQE A;  3IKM B;  3IKL A;  2DDZ A;  1SER A;  1RIQ A;  4Q6G A;  4P73 C;  1KOG A;  1VQZ A;  4YRP A;  3UH0 A;  3BJU A;  1KMM A;  4H2Y A;  2ZT7 A;  4P3N A;  1HTT A;  4ZTZ B;  3RAC A;  4H02 A;  2ZNJ A;  4P72 A;  2ARU A;  3FJP A;  3A5Z A;  3HTZ A;  4H2S A;  4BW9 A;  5HGQ A;  2AKW B;  3UFG A;  3TEG A;  1B76 A;  1JJC B;  3PCO B;  2Q7G A;  3TEH B;  3LSQ A;  4YDQ A;  4YRM A;  1L0W A;  4YRS A; 
#chains in the Genus database with same CATH topology
 4DR1 T;  5LBM A;  3ZMS B;  2XQ4 A;  1WPY A;  2BZB A;  1KFY A;  1VRB A;  4HWR A;  3V8J A;  5JH7 E;  2E3C A;  2ALY B;  4H2X B;  1OWA A;  2EHO B;  5DQV A;  1H4V B;  1EVL A;  4BAY B;  2N2N A;  4KI0 F;  4CI2 B;  4QH1 A;  4B3T T;  4DV7 T;  3QTC A;  5K1X A;  1AJ3 A;  5HEH A;  3B5M A;  1X01 A;  4CN4 A;  4JI0 T;  4IRE A;  1G51 A;  1HNX T;  4P73 A;  4U7I A;  2XTL A;  1B8A A;  3LBX B;  3RPU A;  2ZLY A;  3N9L A;  3N2G E;  5HXE A;  4J15 A;  2XPK A;  2ZIM A;  3HFZ B;  3I0O A;  4ILC A;  4JYA T;  2LSJ A;  3VHL A;  1HR0 T;  1IJ6 A;  3QO7 A;  2M6B A;  2DI4 A;  2ZM2 A;  3V7C A;  4UEM A;  4UPA A;  1QLB A;  4EAH A;  4XU2 A;  2XGT A;  2ZM6 T;  4NIQ A;  1HNZ T;  1I94 T;  3AA6 B;  4AIU A;  4WI1 A;  3QB5 A;  2MOZ A;  4JUY A;  4GIW A;  3VR9 A;  4H9O C;  4U72 A;  2WZH A;  2LM2 A;  3OVU A;  3HRI A;  2NW7 A;  2EHO D;  3MJX A;  3WQZ A;  4TZ4 C;  2CGH A;  2QHU A;  3Q5D A;  3ONJ A;  5FVL A;  2LEH A;  1LRZ A;  2NTX A;  1GQE A;  5HEU A;  2CXD A;  2CPT A;  5AQP B;  4EEB A;  2Q7H A;  2D0T A;  5IYZ E;  1D0Y A;  5JDG A;  4LVI A;  4QXH B;  3HKB E;  1OED E;  4F6R C;  2AMC B;  2VVN A;  1BR2 A;  2V7J A;  3AEG A;  5LHG B;  3ICA A;  3RYI E;  4CXW A;  4PK5 A;  2EJG A;  1D1A A;  4G84 A;  3KFW X;  4NUV A;  3A7R A;  3ZJ1 A;  3KDS E;  1W66 A;  1KMN A;  3RKX A;  4TNV A;  4X1K E;  2I4N A;  2FJA A;  2X0H A;  2P9B A;  3LSV A;  2DXU A;  2JQK A;  3PV0 F;  1X56 A;  5ELO A;  1DU2 A;  3QO8 A;  3RKW A;  1U4Q A;  1FMW A;  4C91 A;  3ZCJ A;  4UVA B;  5F3J A;  3VQW A;  3RC8 A;  2DEQ A;  4AKH A;  3C51 A;  2ACZ A;  2CHN A;  4K87 A;  4PJJ A;  5AQT B;  4EED A;  3PJA A;  2XUE A;  1WU7 A;  4LFC T;  2W67 A;  3HL6 A;  5AQU B;  2YOE A;  1N9W A;  4G2A A;  4UXN B;  4CN1 A;  4ILB A;  4IIJ E;  3A5X A;  5L4E A;  3LBX A;  3PUQ A;  5FY0 A;  3O4X E;  2LSY A;  1YW0 A;  4GYS A;  4HVC A;  3OJA A;  3NEN A;  1W0B A;  4L0R A;  4UVB B;  2DZC A;  1N36 T;  2IML A;  4YCV A;  3UU4 A;  4CZZ B;  2UXD T;  3I9Y A;  2UXC T;  3QK6 A;  3FXD B;  4OP0 A;  2X51 A;  1FJG T;  4YRO A;  1H4S A;  1G8X A;  4JI4 T;  2XQ8 A;  5AQL B;  5ABE A;  3HY0 A;  2DTI A;  4UV9 B;  4YCU A;  4B3R T;  4IT4 A;  2CJA A;  4OHF A;  2X66 A;  5LHI B;  4WW0 A;  2JJ9 A;  4OYK A;  5L47 A;  2AMC A;  2I4M A;  5JDH A;  5AQS B;  3L4G A;  3Q5X A;  4X1Y E;  2IHR 1;  4XZC A;  4P0A A;  4CS3 A;  2DKG A;  2ZT6 A;  1WQW A;  3LSS A;  3NVO A;  3N9N A;  1X54 A;  1WR0 A;  1H4T A;  2QGS A;  3L39 A;  2QRX A;  3RKO A;  4O2B E;  2XAQ B;  2E64 A;  4HFV A;  4EYY R;  5KX5 E;  4ADZ A;  1MIV A;  4CXY A;  4DR5 T;  3PE0 A;  3DSQ A;  3RRW A;  2YK0 A;  1HNW T;  3ZT5 A;  2WU5 A;  3I1A A;  1SES A;  3AXJ A;  5J1G A;  4P3O A;  3MZK B;  4AQY T;  4UF0 B;  2X9Y A;  1T72 A;  3W3S A;  4AIS A;  3KBT A;  1OED B;  1NWM X;  2VL8 A;  3K3Q C;  1BBU A;  2CWO A;  4I50 E;  4XBF B;  4LFA T;  3AE4 A;  2CA5 A;  2Q9Q D;  2B1E A;  2CJB A;  4IL4 A;  3SS1 A;  1Z7M A;  5LNK A;  5EZY E;  1UUR A;  2NW8 A;  5F8P A;  4NCX A;  4ZIB A;  2RPA A;  1FEW A;  2H7V C;  5E0O A;  4YTP A;  5FY7 A;  1IAP A;  3M4P A;  3UQ4 A;  3Q9D A;  1LYL A;  3JC6 C;  2DL1 A;  5HEJ A;  3P8C D;  2WMO A;  5AFU L;  4IE6 A;  1VCS A;  2HH7 A;  4MLK A;  4MHC A;  3CX6 B;  1I6Z A;  3KFU A;  1WFD A;  3C4Z A;  4PK4 A;  2CMR A;  4JEU B;  2ODU A;  5JDF A;  1BR0 A;  3FZL B;  1L0V A;  1CUN A;  2WAU A;  4P75 C;  1IBK T;  2RHQ B;  5FY1 A;  4HWS A;  3PUS A;  3LC0 A;  3AE6 A;  3A7U A;  3MEY A;  1QUU A;  4KMC A;  2D9D A;  5LHH B;  2EL9 A;  2VQE T;  5CA1 E;  3VQV A;  4O2D A;  4H9R C;  3ZKR A;  2KXP B;  1NEK A;  4P74 A;  4X62 T;  1J5W A;  1C0A A;  4JI2 T;  4G63 A;  4HWH A;  2LT3 A;  4XTV A;  5FYM A;  2P0L A;  1Y01 A;  2VWA A;  3IA3 A;  5IHY A;  4LFB T;  4B3S T;  3RYF E;  2HN1 A;  5LJM A;  2DDZ A;  1SER A;  2MAW A;  2BVL A;  1KOG A;  4YRP A;  1XWM A;  5FKY A;  4I55 E;  2W61 A;  3T1Y T;  2VVS A;  4PJL A;  1IJ5 A;  4ZTZ B;  3RAC A;  3J7Y q;  3AAE B;  2JIW A;  4P72 A;  1XNQ T;  3A5Z A;  2LKG A;  3VKG A;  2L3L A;  5L3C B;  5HGQ A;  3TEG A;  2WSS V;  1YQ3 A;  5AQV B;  3E22 E;  3Q2M A;  2VK9 A;  4X5T A;  1L0W A;  2IW5 B;  4O4I E;  4JBW F;  2K48 A;  3RF1 A;  3AE2 A;  5LG4 A;  1B70 B;  5FL1 A;  3TLW A;  3DP7 A;  4DND A;  4TVY A;  4YTN A;  4YYE A;  4GK0 E;  2E9X A;  2LRL A;  3BK9 A;  4PNI A;  4DR3 T;  2KND A;  3UU8 A;  4EXT A;  2Y8D A;  4U74 A;  1OED A;  2ZXF A;  2QVA A;  2J3L A;  4CH3 A;  3Q5W A;  1UX5 A;  2VB6 A;  3C64 A;  4BA9 A;  2PJQ A;  3HKD E;  3PUX F;  1BR4 A;  5K1P A;  4YFS A;  2XM2 A;  3HR0 A;  1UUS A;  2DHR A;  2V1D B;  2JQ9 A;  4JI1 T;  4Z90 A;  3LK3 B;  3CK6 A;  1E22 A;  2Q7E A;  2HPJ A;  2EJ9 A;  2K24 A;  3P4R A;  2C5J A;  2AXD S;  2YDS A;  2VKJ A;  1M7K A;  2N9D A;  1USY C;  4DR6 T;  2NW9 A;  1SRY A;  4KR3 A;  2IY5 B;  2OLT A;  1CHU A;  3AA1 B;  2DLR A;  3KV9 A;  4WNK A;  4EZH A;  2I6H A;  2ZMA A;  2J3M A;  2ZT5 A;  2WCA A;  4P71 C;  4DO0 A;  1SA0 E;  5LGT B;  2XJ7 A;  5HXR A;  2NTY A;  1YGB A;  5LBQ B;  4YRK A;  3AB3 B;  1X55 A;  3ZMT B;  2C0S A;  4YRR A;  4YRQ A;  4YRE A;  4QH4 A;  2XSB A;  4RQF A;  3RGL A;  2J4G A;  3I0Q A;  1PYS A;  4HWP A;  3LDQ B;  3GN5 A;  3RUX A;  3RKY A;  4H2V A;  3OYZ A;  3FBL A;  5EK2 A;  3REU A;  3UGQ A;  3JCF A;  3VU7 H;  3JAF A;  1ZV4 X;  3UU6 A;  4U33 A;  1V9D A;  2LOS A;  2W63 A;  4O4L E;  2E41 A;  4OX9 T;  3NWI A;  3UUL A;  5IWA T;  4YRI A;  3R84 B;  3IG2 A;  1WNL A;  2BVM A;  2DZ9 A;  2BG9 A;  3TLS A;  2ZCE A;  4PG3 A;  3V8K A;  1D1C A;  2A72 A;  1FMV A;  3X1D A;  3EFS A;  3HXV A;  4IDZ A;  4YY3 T;  2IDO B;  2LHR A;  1IBL T;  3H3M A;  1T7S A;  2CIM A;  3E9I A;  3ABV A;  4XTW A;  1JNR A;  5ABF B;  3V5S A;  2V5C A;  3ETU A;  4CH4 A;  4XTZ A;  5LGU B;  3MK7 C;  5BR8 T;  1ZP0 A;  5AQK B;  4IST A;  2RHS B;  4IDQ A;  5CFB A;  5TAO A;  1E1H B;  5CA0 E;  5C2T A;  3HXY A;  3H37 A;  2N1G A;  4AQF C;  3L2Z A;  5HXC A;  4PK6 A;  4NUU A;  3C98 B;  2FYK A;  3KVB A;  2RHQ A;  4GKK T;  1ATI A;  3OBV E;  3UUN A;  1Z7N A;  3A31 A;  4DMW A;  2ZZG A;  4XTY A;  4Z8X A;  5HXH A;  4BJM A;  2Z6E A;  2WQY A;  4CS4 A;  1ADY A;  4UP7 A;  1YKE B;  3CMQ A;  3CWZ B;  1X9B A;  4I0U A;  2W00 A;  2GK9 A;  3EVY A;  2ZM0 A;  4JI7 T;  2F4V T;  2BDE A;  3PUV F;  1R8I A;  3ZEF B;  4ZS2 A;  3CQC B;  4E7S A;  3C4W A;  3O1J A;  2UUB T;  4KP3 C;  2CXF A;  4KR2 A;  1KEY A;  3QC9 A;  4AQF A;  1M62 A;  4J2C A;  1MMN A;  3EI0 A;  3RIU C;  2PME A;  4YHH T;  1US7 B;  4X66 T;  1YFR A;  4TVA A;  4H2W A;  4FI5 A;  4XU0 A;  4YRN A;  1KNZ A;  1KK7 A;  2LRK A;  5AQF B;  3RIR A;  3MXZ A;  3IAL A;  2X9W A;  3HXW A;  4GOU A;  2NP9 A;  4QHO A;  3S4U A;  1FIO A;  4XEM A;  1SHZ C;  3VQX A;  1NYR A;  5H6R B;  2CE7 A;  4BWA A;  2CBJ A;  1Z8U A;  2WP9 A;  4HFC A;  1VOM A;  3PUY F;  3JC6 D;  1NAF A;  4O2A E;  2IC6 A;  4LVM A;  3GWH A;  1BBW A;  2CLY B;  1MIY A;  3TLU A;  1UX4 A;  3VBB A;  2W0G A;  5AQR B;  3JAE A;  2WDQ A;  4YT0 A;  3AVR A;  4EYU A;  4NXN T;  4H63 H;  2VKH A;  2YDR A;  5JR9 A;  3AEE A;  2E5A A;  3EAB A;  3ZST A;  4HT4 A;  2ZIN A;  3K3O A;  4I43 B;  5ABG A;  3ONX A;  3I9W A;  5ADX L;  3HRK A;  1XDP A;  2VKO A;  5ABH A;  2P5I A;  4HWO A;  4YPF A;  4PW8 A;  3PDY A;  4EGW A;  1E24 A;  1NYQ A;  1B7Y A;  2WBL A;  4UP9 A;  4YP0 A;  4KHZ F;  2Q5I A;  3UT5 E;  4NXM T;  3L1A A;  2XSA A;  2Y6X A;  3EDV A;  1LKX A;  4EIW A;  2ES0 A;  1S35 A;  1E2A A;  3IF8 B;  1JJC A;  4YRJ A;  4XTU A;  1NJ2 A;  1W09 A;  2FJD A;  2ZR2 A;  4E51 A;  2JMH A;  2V7L A;  4K0U A;  3RIF A;  3RKG A;  3PUW F;  2UUA T;  1XMQ T;  3SWH A;  4ASK A;  1PYS B;  3QUJ A;  4ZS3 A;  5EK4 A;  2K9A A;  5JVD E;  2BS4 A;  4ZI7 E;  4XU1 A;  2V7I A;  3I7F A;  3P8Y A;  4YRT A;  1ZHC A;  1T98 A;  5JRE A;  1H7C A;  2NS6 A;  2C7I A;  4JLE A;  2MYS A;  2PTF A;  2ZIO A;  4FJO A;  4KQE A;  3IKM B;  3IKL A;  4DMV A;  4XAX B;  4H9Q C;  2XQ9 A;  3ZC1 A;  5JDQ A;  3A8Y C;  2V8S V;  2UXB T;  4QH5 A;  5CJ5 A;  2W66 A;  4AI6 A;  4IDN A;  2JPF A;  3EAM A;  3UUB A;  4B3M T;  4H02 A;  5JRC A;  3AA7 B;  2M67 A;  3U78 A;  4BW9 A;  3K1S A;  3M3Z B;  1B76 A;  3PCO B;  2W2U A;  4YXD A;  4KX6 A;  3N9P A;  3B13 A;  4YRM A;  3FBZ A;  4JI6 T;  3O9X A;  4YRF A;  4UEL A;  1D0X A;  4HWC A;  5LCY A;  2BG9 E;  4YSX A;  4HEA A;  3O1H A;  5AQQ B;  4B6X A;  3LK2 B;  4HTE A;  3N5L A;  3P4W A;  5L3G B;  4CH5 A;  4H2T A;  4AH6 A;  2KSR A;  3LG7 A;  2Q9Q A;  3RLF F;  5LB7 B;  1HG5 A;  2D2S A;  2A9U A;  3P8V A;  2JQH A;  5JQG E;  2V5D A;  3D0T A;  1E7P A;  2LKH A;  3UUM A;  3AE5 A;  2LSI A;  3OKQ A;  4CQI A;  4DPG A;  4TV8 E;  2KWI B;  3AVS A;  1KF6 A;  2KT9 A;  3K8P C;  12AS A;  4DBR A;  1MMD A;  5H6Q B;  5FL0 A;  4YHJ A;  5C3J A;  3NRX A;  3P4S A;  1NNH A;  1N34 T;  3V5U A;  3F31 A;  1NEN A;  4TWD A;  5DJQ C;  2XZE A;  4HWI B;  5LYJ E;  5FP3 A;  5JTG A;  2PFV A;  2W4X A;  3ZC0 A;  2NWB A;  1G73 A;  4ZHQ E;  4AKI A;  3T1H T;  2EHO A;  2MTQ A;  2H7O A;  2ZR3 A;  4DVD A;  3A32 A;  5J0Z A;  4DBQ A;  3TEH A;  3FHN A;  2YU2 A;  4ILA A;  4OLF A;  3JAD A;  2PBI A;  4H63 V;  2VAS A;  5FMN A;  2M6I A;  2W62 A;  3HA4 A;  1E1T A;  4LVK A;  3E0Z A;  3NEM A;  5KNN A;  4JEH B;  2XTI A;  2OV9 A;  3ANW A;  4EOZ B;  4ZZB A;  3FXE B;  2LSK A;  3P4Q A;  3GMI A;  4CS2 A;  1EIY A;  4K86 A;  1NJ8 A;  3NZP A;  3PU8 A;  3RHW A;  4P0B A;  4DV2 T;  1QE0 A;  2E8I A;  1HFA A;  4C90 A;  2DWG A;  2XQ5 A;  1UCU A;  3H3A A;  1EVK A;  1G5I A;  1LVF A;  4QXC B;  4HN9 A;  4YTM A;  4PHC A;  1XMO T;  2FJB A;  4HFI A;  3RL6 A;  3P7I A;  1EOV A;  2BS3 A;  3AA0 B;  3V7S A;  2XY8 B;  3F2E A;  2XQA A;  3NBX X;  1B70 A;  2LHN A;  3A5Y A;  4CI3 B;  3RIA A;  1WLE A;  1XDO A;  4UR9 A;  1HX1 B;  1WR6 A;  2CHO A;  2E1H A;  1BIA A;  4IE0 A;  2E2A A;  3TLV A;  4TUY E;  3HFZ A;  3Q5E A;  4HFB A;  5L3E B;  5BMV E;  2UUC T;  1LVK A;  3C4X A;  3ZYK A;  4K88 A;  1EFW A;  4K0K T;  4COF A;  3UUX B;  1X79 A;  2V7K A;  2L8K A;  4LF7 T;  4JI5 T;  5LP6 E;  2DTH A;  4X20 E;  4ZI3 D;  4X65 T;  3IHR A;  4ZEY A;  4KUM B;  4DR7 T;  2X0Y A;  1W9R A;  3OTO T;  4KBM B;  4LMJ A;  3VRB A;  4TVA B;  2LSG A;  4LNS A;  4DV1 T;  3G1Z A;  3MF2 A;  5AQG B;  4HWT A;  3REX A;  2XM1 A;  5LG3 A;  4JI3 T;  4OK0 A;  3TLT A;  2LM9 A;  3RQW A;  5CGM A;  3E9H A;  4P72 C;  2WDR A;  2EWN A;  3FZM B;  4XU3 A;  3HKE E;  4TWH A;  1VCT A;  1KNP A;  3ZPO A;  1UK5 A;  2WWV A;  3NZQ A;  2NOX A;  2UXN B;  5LA6 E;  3N2O A;  3ZJ2 A;  5FXZ A;  3RIU A;  3R07 A;  1ASZ A;  3ZMZ B;  2X9X A;  3O1I A;  1YXR A;  4PFO A;  2CEA A;  3AXJ B;  4TTV A;  11AS A;  4GYR A;  3HXX A;  5JRC B;  2Y48 B;  5HYA A;  4RDX A;  1FYF A;  5M4Y A;  2K5B B;  1GGM A;  1WYB A;  4HFD A;  2LE8 A;  3IEE A;  5GON E;  2H3R A;  4EZ4 A;  4HE8 A;  4A5X A;  4U2Z A;  1HTJ F;  3ETV A;  3EUH A;  3RYC E;  3SFD A;  3ONL C;  3KIN B;  2OA5 A;  1YB3 A;  4CI1 B;  5J2U E;  2D5U A;  3ZN1 B;  2RHS A;  1X2G A;  5KXJ A;  5FVK A;  2JRK A;  3KV5 A;  2ACX A;  3ZN0 B;  2FJE A;  3MF1 A;  1HC7 A;  3QO5 A;  5HEO A;  3OYX A;  3P50 A;  1BIB A;  2HNI A;  2I59 A;  2DTO A;  4ZTU B;  1EZ3 A;  3PTR B;  3ZCI A;  4A56 A;  4QKN A;  2DU7 A;  3ZYM A;  4DV0 T;  4HKA A;  3V8L A;  4NPP A;  4JV5 T;  3MA9 A;  3CQX C;  1NJ5 A;  3SOL A;  4EV6 A;  4O4J E;  1U5P A;  5C51 B;  1MNE A;  2X67 A;  2WMN A;  3GA8 A;  5HEG A;  3CKD A;  4AKR B;  3N9O A;  5KMG P;  4TVW A;  3IBP A;  1HF8 A;  3L4G B;  4MAL A;  2WS3 A;  3NRY A;  3L8R A;  3UFE A;  4TWF A;  2CM0 A;  5HWY A;  1IBM T;  2E5V A;  3LFM A;  4QX7 B;  3SFE A;  4WBN E;  4CN6 A;  3DJB A;  4YCW A;  5LMN T;  5AQM B;  1WLX A;  3AE3 A;  3DTO A;  4OYJ A;  4LF8 T;  3AE9 A;  3LJC A;  4P71 A;  3CML A;  2DXT A;  4UV8 B;  2C5K T;  5HWX A;  2IC9 A;  3AEA A;  1HS7 A;  4N78 D;  4YRL A;  4H2X A;  3G06 A;  4ZI2 D;  1USY A;  2C8M A;  3RC3 A;  2V7M A;  1HCI A;  4L9I A;  3R6N A;  4Q6G A;  4DR4 T;  4P73 C;  5JDM A;  1JNZ A;  3UH0 A;  3ANW B;  3OPC A;  1KMM A;  4H2Y A;  3A7M A;  3C50 A;  2BG9 C;  2D0U A;  3FZF B;  3AEB A;  3KV4 A;  5A1L A;  1HTT A;  2XAJ B;  2ZNJ A;  4X64 T;  2ARU A;  2V26 A;  2LJL A;  4P1N A;  3HTZ A;  4H2S A;  2KIN B;  1Z0P A;  2AKW B;  3UFG A;  2BBH A;  4MFR A;  2Q7G A;  2E9X D;  4YDQ A;  3L3P A;  3AE8 A;  4DV5 T;  2B76 A;  1B7Y B;  2HHH T;  5AQH B;  2Q9Q B;  5LXT E;  4HWD A;  2E10 A;  1J1J A;  4PJN A;  2A8E A;  2PMF A;  4ZOL E;  3CIR A;  1MND A;  3M4Q A;  3ESL A;  3PUR A;  2XQY A;  4IDO A;  5L2L A;  4WF2 A;  2E9X B;  2CBI A;  2ALY A;  5AQJ B;  2I4O A;  2XQ7 A;  2X68 A;  3SRZ A;  3EDU A;  4EX5 A;  4P74 C;  5FXV A;  2ZZF A;  3MQZ A;  2EHO C;  4OFZ A;  5JR9 B;  2WM9 A;  4PAG A;  3ERR A;  3QOF A;  1QF6 A;  2CXL A;  4RMF A;  5J2T E;  4EO4 A;  4CH6 A;  1HXD A;  3UU3 A;  3AEF A;  5AQO B;  2V6X A;  3AE1 A;  4LMK A;  2Q5H A;  4O8S A;  2ARS A;  2WY2 A;  3HI2 A;  5AQN B;  4V1A v;  3AE7 A;  3CX7 B;  4BJN A;  4EB6 E;  1KNR A;  3ZMU B;  5L3F B;  2EAY A;  5E3I A;  4YRC A;  3CQG B;  3WAJ A;  4MBQ A;  2YU1 A;  4AQG A;  2ODR C;  3RH3 A;  5IUX A;  1G5H A;  2XQ6 A;  4DQ2 A;  2VL0 A;  2YEV C;  4G85 A;  5ETW A;  3N2K E;  4KHP T;  3MKD A;  1ZEE A;  2J1D G;  5LGN B;  3ZMV B;  4HA8 A;  4TQD A;  4IE5 A;  4Z91 A;  5ABF A;  4TQF A;  3P8T A;  2QHS A;  2IUB A;  1QSD A;  3HKC E;  3ZSS A;  2R6G F;  2V6Y B;  3ZT6 A;  2ZGW A;  1ZKE A;  3AAA B;  3UU5 A;  2RA1 A;  3EHZ A;  2Q9Q C;  1WYC A;  5F5W A;  4YSZ A;  2ODR D;  2ART A;  4WZX A;  1EIY B;  3BQI A;  2DQ3 A;  4E7Z A;  3B57 A;  4Q25 A;  5C52 B;  2BKN A;  3BQK A;  3WAK A;  3VKH A;  4P09 A;  1YFS A;  5JDL A;  1J5E T;  3A7A A;  4WJ3 M;  4LVL A;  3RRC A;  3FB2 A;  1HX8 A;  5HCM A;  4U31 A;  2VQF T;  4DV3 T;  2DJZ A;  2LLY A;  2J47 A;  4ERR A;  2YDQ A;  4IE7 A;  5LJN A;  2KZ7 B;  2YIN A;  4QX8 B;  3CX8 B;  3ZYL A;  5L4H A;  3GN5 B;  3RX6 A;  5L3D B;  4TN7 B;  3ZT7 A;  4AKL A;  4ISS A;  4ZZC A;  4WYV A;  3HFV A;  5JDN A;  3ZLI A;  3TUP A;  1D0Z A;  1SE7 A;  4XTX A;  1OED C;  3TKL B;  2YKS A;  4H2U A;  5CB4 E;  4F8H A;  4DR2 T;  4DUY T;  4UP8 A;  2VUR A;  1SET A;  5LOV E;  1NJ1 A;  3PUG A;  2HN2 A;  2BBJ A;  2L9Q A;  4U3C A;  2AE9 A;  1XNR T;  3BFM A;  4HGA A;  2H88 A;  4Q15 A;  2VKD A;  3PUA A;  4DV6 T;  4GK5 E;  2DWK A;  1EQR A;  3E08 A;  2IY5 A;  4H9S E;  3WI3 A;  4AKG A;  4U7Y A;  3A74 A;  1W0A A;  2A3D A;  4LF5 T;  3PU3 A;  4ZI3 C;  3T8O A;  4HFE A;  4YRS A;  2DNX A;  3V7R A;  5HXS A;  3KVA A;  4H9N C;  1UGO A;  2PG8 A;  4A98 A;  2MPK A;  4DUZ T;  2DVE A;  4I4T E;  2KMF A;  3AEC A;  4YJ3 E;  4JI8 T;  3VQY A;  1ASY A;  1E1O A;  3M65 A;  1IZN B;  4U2Y A;  3PJA J;  2MBG A;  4TWA A;  2CWY A;  2DCF A;  4UF0 A;  2DQ0 A;  2A2F X;  1D1B A;  2QHV A;  3UQ7 A;  2E5L T;  2J62 A;  2XQ3 A;  4L5G A;  4LML A;  1MIW A;  5FXX A;  1YFT A;  3OD1 A;  2FBW A;  4A97 A;  3VRA A;  4YSY A;  5FNV E;  2ZT8 A;  4O4H E;  4IDP A;  5HCJ A;  2EJF A;  5HAX A;  4QXB B;  2AKW A;  2WWU A;  3HXU A;  1YQ4 A;  5KDM C;  1WYD A;  3PZC A;  3QNU A;  3FZK B;  2XAS B;  5C53 B;  3PUZ F;  3BQL A;  4YRG A;  5EK3 A;  1ZOY A;  3W15 B;  3UGT A;  2XHE B;  3RQU A;  2IIU A;  4WJ4 A;  5FXW A;  4PFP A;  1BR1 A;  1N33 T;  1MMA A;  3FZH B;  4ANJ A;  3NET A;  5L3B B;  1XZY A;  4ILU A;  3KBU A;  1OXZ A;  2RP4 A;  3UTK A;  4RQE A;  2QHT A;  1YD8 G;  4DID B;  2K3W A;  4IHJ E;  4X1I E;  2G4C A;  3U3I A;  3J9X 1;  4L87 A;  3KV6 A;  1NJ6 A;  2ODV A;  2WB5 A;  4IGU A;  3AAI A;  3AED A;  4ZXL A;  2DU5 A;  4P75 A;  3VR8 A;  4XEO A;  4DV4 T;  3EFR A;  4LF4 T;  3K3N A;  2BKO A;  3HY1 A;  4IL9 A;  4HFH A;  4YJ2 E;  1SUM B;  2JQQ A;  2WDV A;  3PCO A;  1O3X A;  4M1P A;  3QB5 K;  2BG9 B;  5AQI B;  2KLQ A;  2X0L B;  2V6Y A;  3QNE A;  4TX5 A;  2IAK A;  3NKZ A;  4LF6 T;  1WCR A;  4H9P C;  1N32 T;  1H4Q A;  5DAB A;  2X9H A;  2ZZE A;  3HXZ A;  3RI5 A;  2NR4 A;  1MMG A;  1Y64 B;  5LMU T;  2ZM8 A;  2ZTG A;  4LF9 T;  2UXX B;  1IL2 A;  2LOP A;  1B7T A;  5JR9 C;  2XAH B;  4WBO A;  4CXX A;  1HG2 A;  3CVR A;  4YLH A;  2CJ9 A;  5ELN A;  2XAF B;  4TV9 E;  2FUP A;  4GKJ T;  2ZNI A;  2I4L A;  2SPC A;  1ADJ A;  4PJM A;  3P4P A;  2I0M A;  3NEL A;  2E9X C;  5C8Y E;  2BS2 A;  3CPZ A;  2E65 A;  4X5O A;  5DQW A;  1X2H A;  2YN6 A;  1WQ7 A;  4P3P A;  1RIQ A;  2UU9 T;  1WRD A;  3N9M A;  2CRB A;  2JMK A;  4IE4 A;  1VQZ A;  2WU2 A;  4TNW A;  1S94 A;  4AXP A;  4LVJ A;  4QWN B;  3BJU A;  4UIG A;  1T8B A;  2KWH A;  2CCQ A;  2C5I T;  2ZT7 A;  2G0U A;  2H89 A;  2QA7 A;  4P3N A;  3F57 A;  3N9Q A;  3L09 A;  2CLY C;  4HWF A;  3FJP A;  1YKH B;  4UVC B;  3LK4 2;  4ZI2 C;  1JJC B;  2XAG B;  3TEH B;  3RYH E;  3LSQ A;  2HPL A;  2BKP A;  2QYW A;  2WZI A;  3MAC A; 
#chains in the Genus database with same CATH homology
 1B7Y B;  3RF1 A;  4YRF A;  1WPY A;  1B70 B;  2E10 A;  2A8E A;  4HWR A;  3V8J A;  2E3C A;  2PMF A;  4TVY A;  2ALY B;  4YYE A;  4H2X B;  3M4Q A;  1H4V B;  1EVL A;  2ZXF A;  2J3L A;  4CH3 A;  4WF2 A;  4CH5 A;  4H2T A;  4AH6 A;  2ALY A;  2I4O A;  3QTC A;  5K1P A;  4EX5 A;  4P74 C;  5K1X A;  2ZZF A;  1E22 A;  1X01 A;  3MQZ A;  2Q7E A;  2EJ9 A;  3ERR A;  3P8V A;  1QF6 A;  1G51 A;  4RMF A;  1USY C;  4P73 A;  4EO4 A;  4CH6 A;  1SRY A;  1HXD A;  1B8A A;  4KR3 A;  2IY5 B;  4DPG A;  12AS A;  2Q5H A;  2ARS A;  4J15 A;  2ZIM A;  2J3M A;  2ZT5 A;  3HFZ B;  4P71 C;  2EAY A;  1YGB A;  1NNH A;  5E3I A;  4YRC A;  3QO7 A;  2ODR C;  4YRK A;  3V7C A;  1G5H A;  4UPA A;  4DQ2 A;  4G85 A;  1X55 A;  4XU2 A;  4YRR A;  2XGT A;  4YRQ A;  4YRE A;  4WI1 A;  4RQF A;  3RGL A;  4HA8 A;  4TQD A;  1PYS A;  4HWP A;  3RUX A;  3RKY A;  2ZR3 A;  4H2V A;  3P8T A;  4TQF A;  2QHS A;  3HRI A;  3REU A;  3A32 A;  3UGQ A;  2ZGW A;  3WQZ A;  3TEH A;  4OLF A;  2CGH A;  5F5W A;  2QHU A;  2ODR D;  2E41 A;  2ART A;  4YRI A;  1EIY B;  2DQ3 A;  5C52 B;  3IG2 A;  1E1T A;  1WNL A;  4LVK A;  3NEM A;  5KNN A;  1YFS A;  2DZ9 A;  2ZCE A;  2Q7H A;  2XTI A;  4PG3 A;  3V8K A;  4LVI A;  3A7A A;  4WJ3 M;  4LVL A;  4CS2 A;  1EIY A;  4K86 A;  1NJ8 A;  2AMC B;  2DJZ A;  3EFS A;  3HXV A;  3ICA A;  2EJG A;  4G84 A;  1QE0 A;  3A7R A;  1W66 A;  1KMN A;  2CIM A;  3E9I A;  3RKX A;  1EVK A;  4XTW A;  1G5I A;  4CH4 A;  4XTZ A;  2I4N A;  4PHC A;  3HFV A;  2DXU A;  2RHS B;  3RKW A;  1X56 A;  5ELO A;  3TUP A;  3QO8 A;  4XTX A;  3HXY A;  4H2U A;  3RL6 A;  1EOV A;  3VQW A;  3L2Z A;  2DEQ A;  4UP8 A;  3V7S A;  1SET A;  1NJ1 A;  4K87 A;  3A5Y A;  1B70 A;  2FYK A;  1WLE A;  1WU7 A;  2RHQ A;  1ATI A;  3BFM A;  2E1H A;  1Z7N A;  1BIA A;  3A31 A;  4Q15 A;  3HFZ A;  2ZZG A;  1N9W A;  4XTY A;  1EQR A;  4K88 A;  2IY5 A;  1EFW A;  4CS4 A;  4HVC A;  1ADY A;  4UP7 A;  3A74 A;  3CMQ A;  3NEN A;  2DZC A;  4YCV A;  2DTH A;  3V7R A;  4OP0 A;  2DVE A;  4TVA B;  4LNS A;  4KR2 A;  3G1Z A;  3MF2 A;  4YRO A;  1H4S A;  4HWT A;  3REX A;  3VQY A;  1ASY A;  1E1O A;  2PME A;  3HY0 A;  2DTI A;  4YCU A;  3E9H A;  4TWA A;  2CJA A;  4P72 C;  2DQ0 A;  1YFR A;  4TVA A;  2QHV A;  4H2W A;  2EWN A;  4XU0 A;  4YRN A;  4XU3 A;  2AMC A;  2I4M A;  3RIR A;  3IAL A;  3L4G A;  3HXW A;  1YFT A;  3OD1 A;  3R07 A;  4XEM A;  1ASZ A;  4CS3 A;  2ZT8 A;  2DKG A;  3VQX A;  2ZT6 A;  1NYR A;  4TTV A;  1WQW A;  2EJF A;  3LSS A;  2AKW A;  11AS A;  1X54 A;  1H4T A;  3HXU A;  4BWA A;  3HXX A;  1WYD A;  3PZC A;  4RDX A;  1FYF A;  2E64 A;  1GGM A;  5C53 B;  4YRG A;  3UGT A;  3DSQ A;  4WJ4 A;  4LVM A;  1BBW A;  3VBB A;  1SES A;  4P3O A;  3NET A;  3W3S A;  2E5A A;  4HT4 A;  2ZIN A;  4RQE A;  2QHT A;  1BBU A;  1YB3 A;  2G4C A;  2RHS A;  1X2G A;  3HRK A;  3MF1 A;  1HC7 A;  3QO5 A;  4HWO A;  2P5I A;  4L87 A;  4YPF A;  1NJ6 A;  2CJB A;  1BIB A;  1E24 A;  1Z7M A;  1NYQ A;  2HNI A;  2DU5 A;  2DTO A;  1B7Y A;  4P75 A;  4ZTU B;  4XEO A;  4UP9 A;  3EFR A;  4YP0 A;  2Q5I A;  2DU7 A;  3L1A A;  4NCX A;  3HY1 A;  3V8L A;  4ZIB A;  1NJ5 A;  5C51 B;  3M4P A;  1LYL A;  1JJC A;  3PCO A;  4YRJ A;  4XTU A;  1NJ2 A;  4TVW A;  3L4G B;  3QNE A;  2ZR2 A;  4E51 A;  3KFU A;  1H4Q A;  2ZZE A;  3HXZ A;  4P75 C;  4YCW A;  2RHQ B;  4HWS A;  2ZTG A;  3LC0 A;  3A7U A;  3MEY A;  1IL2 A;  1PYS B;  2EL9 A;  3VQV A;  4O2D A;  4P71 A;  2CJ9 A;  4P74 A;  2DXT A;  5ELN A;  4XU1 A;  2ZNI A;  2I4L A;  1J5W A;  1C0A A;  3I7F A;  1ADJ A;  3P8Y A;  4YRT A;  3NEL A;  4XTV A;  2P0L A;  2NS6 A;  4YRL A;  4H2X A;  2E65 A;  4X5O A;  2C7I A;  1USY A;  1X2H A;  1WQ7 A;  2C8M A;  2ZIO A;  4P3P A;  4KQE A;  3IKM B;  3IKL A;  2DDZ A;  1SER A;  1RIQ A;  4Q6G A;  4P73 C;  1KOG A;  1VQZ A;  4YRP A;  3UH0 A;  4LVJ A;  3BJU A;  1KMM A;  4H2Y A;  2ZT7 A;  4P3N A;  1HTT A;  4ZTZ B;  3RAC A;  4H02 A;  2ZNJ A;  4P72 A;  2ARU A;  3FJP A;  3A5Z A;  3HTZ A;  4H2S A;  4BW9 A;  5HGQ A;  2AKW B;  3UFG A;  3TEG A;  1B76 A;  1JJC B;  3PCO B;  2Q7G A;  3TEH B;  3LSQ A;  4YDQ A;  4YRM A;  1L0W A;  4YRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...