3RF1A

The crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
292
structure length
292
Chain Sequence
NLYFQSNAMTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPTDGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSLGAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWSEFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYCMLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha subunit
publication title The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC 11168
rcsb
source organism Campylobacter jejuni
molecule tags Ligase
total genus 102
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2011-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 3rf1A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3rf1A01
1X56A 4YP0A 4YRJA 4YRGA 2ODRD 2ZZFA 3EFRA 2DDZA 1YGBA 3BFMA 2ZT8A 1WYDA 1NNHA 3NELA 3HFZA 4YPFA 4YRMA 1PYSB 4K87A 4OP0A 2E10A 2ZZGA 4XU0A 4P73A 3W3SA 4H2YA 4O2DA 4Q6GA 4HWPA 1B7YB 2G4CA 1YFTA 4NCXA 1NJ5A 3V8JA 3BJUA 2FYKA 3HY0A 5HGQA 4XTWA 1E22A 2RHQB 3UFGA 1WNLA 1VQZA 4P71C 4YDQA 1B76A 4RQEA 1WQWA 2E65A 4HVCA 4YRPA 3HRIA 1LYLA 2Q7GA 4XTVA 4CS2A 1X54A 5ELNA 3RGLA 2CJ9A 2ZT5A 3A5YA 2P0LA 2DJZA 1PYSA 4YRQA 1SRYA 3A32A 1EVLA 3IALA 4L87A 3MF2A 1B7YA 2Q7EA 4CH6A 4CS3A 3VQYA 5C52B 2DU7A 3RKXA 3ERRA 4P72A 4XTZA 3RKYA 1EIYB 2RHQA 4CS4A 1HC7A 1ASZA 4XU3A 2J3LA 3IKMB 2P5IA 3LSQA 2ZGWA 4YRRA 2ZXFA 4XU2A 2DQ3A 1H4TA 2I4NA 2ZZEA 2PMFA 4YRLA 4TVWA 3L2ZA 4H2UA 2DZ9A 3VQWA 3QNEA 3QO7A 4P74A 1G51A 2E1HA 2J3MA 4UP7A 4TVYA 3TEHA 4PHCA 3NEMA 3HXYA 4HWTA 1EOVA 2IY5B 1YFRA 1EIYA 1G5HA 2ZR3A 1WQ7A 3WQZA 4YCUA 2E3CA 3QTCA 4WJ3M 1B70B 4HA8A 2DXTA 2I4LA 3L4GB 1L0WA 1ADJA 2ZT7A 4CH3A 1G5IA 3QO8A 3L1AA 2QHSA 3TEGA 3IKLA 1USYC 1JJCB 4YCWA 3UGQA 3HXZA 2EWNA 5C53B 1NJ6A 4G84A 3P8VA 3NETA 2C7IA 4LNSA 4X5OA 3DSQA 4CH4A 1ASYA 4XTXA 2ODRC 2E64A 4P75C 5K1PA 5C51B 4KR2A 2ARTA 2IY5A 1H4QA 2XTIA 2QHUA 2AMCB 1BBUA 4EO4A 1B70A 3REUA 4E51A 1Z7MA 2EAYA 3L4GA 4YRKA 3M4PA 5F5WA 2DXUA 1KOGA 4H2WA 3G1ZA 3HRKA 3R07A 1ATIA 1X2HA 2EJFA 1JJCA 4AH6A 3MEYA 4ZTUB 2I4MA 3A31A 3TEHB 2PMEA 3HY1A 2Q5HA 1WPYA 3HTZA 1QE0A 4YRFA 1FYFA 3A74A 4RDXA 1HTTA 3RUXA 2DKGA 2DEQA 2CJBA 4YRNA 4XU1A 2ZINA 2QHTA 1N9WA 2RHSB 3NENA 3HXUA 4XTUA 1SERA 4YROA 3RACA 4WF2A 3EFSA 2ZT6A 3E9HA 2DTOA 4TVAA 2AMCA 2DZCA 4P73C 4ZTZB 4P71A 4YCVA 4BW9A 1X55A 3ICAA 1EFWA 3TUPA 2CIMA 3V7RA 4HWRA 1C0AA 2ZNJA 3A5ZA 4P3NA 1E24A 2ZTGA 3LC0A 4Q15A 1EQRA 3OD1A 1BIAA 2HNIA 3PCOB 4YRIA 4ZIBA 4YREA 4TWAA 3UGTA 3RIRA 1X2GA 4P3PA 3QO5A 1WLEA 2RHSA 3HXXA 2I4OA 2C8MA 2CGHA 3KFUA 1KMNA 1H4SA 3HXWA 3CMQA 4H2VA 1NYRA 3V8LA 11ASA 3VQVA 4TTVA 3FJPA 1H4VB 2CJAA 2ZCEA 3I7FA 4KQEA 1W66A 1HXDA 2Q5IA 1SETA 4J15A 4H2SA 1YFSA 1QF6A 4H2XB 2XGTA 1RIQA 1B8AA 2ALYB 2DQ0A 4XEOA 4P72C 4H2TA 2DTHA 1KMMA 3RL6A 3PCOA 2QHVA 5E3IA 2Q7HA 1EVKA 3HFVA 3A7RA 4TVAB 4CH5A 4WJ4A 2E5AA 4OLFA 2ZIOA 3A7AA 4HWOA 3V7CA 1BIBA 4UP8A 2E41A 4YRCA 3RF1A 4XTYA 3A7UA 4YRSA 4P74C 4YYEA 2ZNIA 2ZR2A 4UPAA 3HXVA 4UP9A 4DQ2A 4H2XA 2EL9A 4K86A 1NJ1A 4YRTA 3RKWA 4DPGA 3V8KA 2ALYA 1NJ8A 4WI1A 1USYA 4BWAA 3MF1A 3P8TA 4HWSA 4XEMA 2DTIA 1NYQA 5KNNA 4PG3A 1E1OA 2AKWB 3IG2A 4P3OA 4H02A 2DVEA 4K88A 2ARUA 4RMFA 1GGMA 1E1TA 4RQFA 2EJGA 1NJ2A 4P75A 1X01A 2ZIMA 1YB3A 3HFZB 1J5WA 4TQDA 3REXA 4KR3A 4G85A 5K1XA 1SESA 2ARSA 12ASA 1ADYA 1WU7A 5ELOA 3VQXA 3UH0A 4TQFA 3PZCA 3LSSA 3VBBA 3P8YA 1Z7NA 4EX5A 3E9IA 2AKWA 2DU5A 3M4QA 3V7SA 1BBWA 2EJ9A 1IL2A
chains in the Genus database with same CATH superfamily
4I55E 4YP0A 4PW8A 1M7KA 4YRGA 3GWHA 3R84B 1AJ3A 2ZZFA 3B57A 3C4XA 5AQQB 2DDZA 3BFMA 2LHRA 1WYBA 3HL6A 3QUJA 4TWFA 1MIWA 3AE9A 1PYSB 4K87A 4DV4T 4WZXA 1VOMA 4O2DA 4Q6GA 3I9YA 1B7YB 5L4EA 4NCXA 4QX7B 1YD8G 2XY8B 1YXRA 5EK2A 3T8OA 3HY0A 3FZMB 4AQGA 1E22A 1OEDB 2I0MA 1NENA 4P71C 3ZMVB 1XZYA 2XAGB 4I43B 4RQEA 3OTOT 2YEVC 4XTVA 2KSRA 3IHRA 1X54A 2R6GF 3C4WA 2ZT5A 2OV9A 4DV2T 2WZHA 2PG8A 3GA8A 4DMWA 1XMQT 3PV0F 4U7IA 3PDYA 1PYSA 3CQXC 4YRQA 3G06A 1SRYA 5FXVA 3A32A 2VVNA 4L87A 2J1DG 3AE2A 2UU9T 2Q9QC 4MALA 4MBQA 2IIUA 2XZEA 1B7YA 1CUNA 1KNZA 3RKOA 3VQYA 2J4GA 4PAGA 2DU7A 3PJAA 1XNQT 3RKXA 2PJQA 4P72A 1US7B 4H9RC 4U3CA 3CKDA 1OEDA 4QH5A 2QGSA 2E5LT 3PUXF 4DO0A 3QNUA 4X64T 4ISTA 4IE4A 4H9OC 5L3GB 3LSQA 1D1AA 2BVLA 4TWDA 2ZGWA 4YRRA 3F57A 2ZXFA 4XU2A 5IWAT 4KHPT 2DZ9A 2XAHB 4F6RC 3TLVA 4TUYE 3HR0A 2BG9E 3QNEA 1WR0A 4P74A 1G51A 3TLTA 3RPUA 3RX6A 1YW0A 3TEHA 3IF8B 3LK2B 3X1DA 3HXYA 3BQIA 2IY5B 1HCIA 5HEGA 4LVMA 1G5HA 3WQZA 4YLHA 3NZQA 1B70B 2MOZA 2V7IA 4YXDA 3L4GB 1ADJA 4AKRB 2CHOA 4CH3A 3KFWX 2Z6EA 4CXYA 1N36T 3UU8A 2CCQA 4Z90A 4DIDB 3IKLA 2VL0A 3UGQA 2CA5A 1D1CA 2JPFA 1BR1A 5C53B 2L9QA 3P8VA 1JNRA 3LDQB 3MACA 1WRDA 3B13A 4O4IE 4IDNA 4ZI3C 2NTXA 3L8RA 4LMJA 5L3CB 2WSSV 1W0AA 1FEWA 4ZEYA 4EIWA 3NRXA 4P75C 4KR2A 3VRBA 2IY5A 2XTIA 2YINA 4ZOLE 1MNEA 3ZPOA 1B70A 3K3NA 3VKGA 2EAYA 3L4GA 4AI6A 3NRYA 3G1ZA 3HRKA 3UT5E 4DV7T 1QSDA 5FMNA 4O2AE 2BBJA 5L3DB 3AECA 2I4MA 4GYRA 3AEEA 3ZCIA 2UUBT 5HAXA 3KINB 5HEHA 4QXBB 1QE0A 4IE7A 2EHOA 4YRFA 2WDQA 3A74A 1HTTA 2V7MA 4YRNA 1HNZT 3AVSA 2QHTA 3JC6D 2UXBT 3P4QA 1UK5A 1SERA 4IL4A 4WF2A 2N2NA 3EFSA 2DNXA 2WAUA 2BS4A 5CGMA 4KX6A 2XM1A 1Z8UA 5LHIB 2CE7A 3TUPA 2V5DA 4UVAB 1E7PA 5HXSA 4UF0B 4Q15A 3LC0A 5JDQA 1BIAA 2CLYB 4I4TE 4A5XA 3AA6B 3RYHE 3N2OA 3RIRA 5AQUB 4HWIB 2NW7A 2X9YA 2D5UA 3QO5A 2M6IA 2LRKA 1S94A 3UUXB 4ZI2C 3CMQA 3B5MA 4CXXA 3V8LA 1H4VB 2IC9A 5LBMA 2ZCEA 2WU5A 4LF7T 5AQLB 1W66A 1HXDA 5LB7B 4I0UA 2WMOA 2W4XA 3KVAA 1YFSA 1R8IA 2XGTA 3ZN1B 1B8AA 1SE7A 2DQ0A 3BQLA 5A1LA 3HA4A 4P72C 4UF0A 5DABA 2KWHA 4UEMA 1OEDC 4KUMB 3JAEA 2QHVA 4YJ2E 2HN1A 2VKJA 5TAOA 3O1HA 2Q7HA 5LA6E 4LFBT 2B76A 4CH5A 2NW9A 3O1JA 4U74A 5FY1A 4WJ4A 3E22E 4JYAT 4GOUA 3RC8A 4UP8A 4YSZA 2E41A 2HN2A 5JDFA 3RIFA 2XAFB 3TLUA 3MK7C 2XTLA 3PE0A 4P74C 3O1IA 5FP3A 4JLEA 3AEBA 2EL9A 3RKWA 4FJOA 2K3WA 2F4VT 1USYA 4WI1A 2V1DB 3Q2MA 3UUBA 4LVLA 2I59A 4CQIA 4UXNB 5LXTE 2V26A 3AAAB 4KMCA 4LF5T 2V7JA 3IG2A 3N2GE 4A97A 4Z91A 1ZV4X 2DVEA 3OKQA 1LVKA 2VWAA 3C4ZA 2P9BA 5JRCB 3OJAA 4TNVA 2LKHA 5C3JA 4KBMB 3LBXB 2BKOA 1YB3A 5HXHA 3REXA 2ACXA 4YJ3E 2JQHA 3OVUA 2UUAT 1ADYA 4KI0F 1WU7A 2K24A 1IJ6A 4OFZA 4UV8B 4NUUA 1HG2A 4JV5T 2LRLA 4HWFA 3N5LA 5FL0A 1WCRA 5HEJA 3ETVA 3JCFA 1LVFA 4L5GA 4B3RT 3V7SA 2WBLA 2QYWA 4HGAA 5JRCA 3N9MA 3AE7A 2ODRD 4PJLA 5IUXA 3QK6A 4EGWA 3AEDA 5KMGP 3LBXA 5E0OA 2BG9B 3P8CD 5HEOA 3KV9A 4YPFA 4ILAA 2EHOC 2XAJB 3MJXA 2DWGA 3N9LA 2E9XB 4XU0A 3W3SA 3P50A 3QB5A 5FL1A 2G4CA 4H9SE 4ZS2A 3BJUA 3FZLB 2FYKA 1KK7A 2MBGA 5J0ZA 2FJAA 3NKZA 4YDQA 1CHUA 2E65A 1WR6A 2NP9A 4DV6T 2MTQA 4HFHA 2LM2A 4P1NA 4HKAA 2CRBA 1JNZA 3RGLA 3V5SA 2CJ9A 2XQ9A 4A98A 3A5YA 2BG9A 3CIRA 4DUZT 4X1KE 2P0LA 1HG5A 2DJZA 4U31A 3MXZA 3ESLA 2E9XA 2IMLA 5JQGE 3VU7H 2G0UA 4U72A 3P4SA 1D0YA 4O4LE 2W67A 2Q7EA 3PUGA 2WZIA 4EZHA 4CS3A 4JUYA 5C52B 1T7SA 1HNXT 4NXNT 1SHZC 3ERRA 4KP3C 2JRKA 2UXNB 2XQ5A 1HC7A 2LSYA 4XU3A 2YKSA 4ANJA 5ABFA 1DU2A 2WU2A 2P5IA 3AE1A 2BVMA 5LYJE 3M65A 4LVIA 3CPZA 4LMLA 3NVOA 1G8XA 2DQ3A 2DHRA 4H2UA 3ZJ2A 2CLYC 1HR0T 1W0BA 4BAYB 2CXLA 2FJDA 2ZM0A 4O4HE 5FYMA 5LNKA 5DQWA 2J3MA 4UP7A 4MHCA 2X68A 2V7KA 4TV8E 3W15B 3WAKA 4MLKA 4EYYR 2ZR3A 1E2AA 1WQ7A 3UQ4A 3QTCA 5IHYA 4HA8A 4ZS3A 3RIAA 3CK6A 1S35A 1Y01A 4JI0T 5JR9B 1G5IA 2ODVA 3QO8A 5HEUA 3Q5EA 3S4UA 2QHSA 3TEGA 1USYC 1X9BA 4BJNA 3HXZA 2EWNA 4G84A 2LE8A 2IC6A 3BQKA 2C7IA 4LNSA 4ZI7E 4DMVA 4X5OA 3J9X1 3Q5WA 4X20E 4H9NC 3AA0B 4BJMA 4TNWA 3UU6A 4XTXA 4LFAT 3RC3A 4XAXB 1H4QA 1LRZA 1MNDA 1ZKEA 4IT4A 3N9OA 2Q9QD 1BBUA 4NPPA 3REUA 4E51A 1Z7MA 4ASKA 4GK0E 5BR8T 4U7YA 1KOGA 3KV6A 3CVRA 3O9XA 5JR9A 3R07A 2CPTA 4B6XA 1X2HA 5JDLA 2NOXA 3OPCA 4C90A 4ZTUB 4JI5T 5HWYA 3TEHB 3A7MA 3AA7B 2ZLYA 2FUPA 4YSYA 2FBWA 3EAMA 3IEEA 1X79A 5LGUB 1FYFA 4X1IE 2DEQA 5JDMA 2PTFA 5JH7E 2ZINA 1N32T 3Q9DA 2RHSB 3E08A 1T8BA 4YROA 2CEAA 3RACA 4JEUB 3EVYA 4ADZA 4P09A 4TVAA 5F8PA 5IYZE 4YTPA 4CI3B 3LFMA 2X9WA 4J2CA 5HCJA 4BW9A 4MFRA 4LFCT 1EFWA 5KXJA 3U78A 2CIMA 3AXJB 4CN6A 2K5BB 3MKDA 3A5ZA 1KNPA 5JDHA 1E24A 2ZTGA 3H3MA 3OD1A 4ZHQE 3RHWA 4X65T 4HFDA 3VHLA 3PCOB 2LT3A 1IJ5A 4DV3T 1IZNB 3VR8A 3N2KE 1X2GA 2A8EA 4IE5A 3ZYLA 4AKHA 2H89A 4P3PA 5C2TA 3J7Yq 2PBIA 2RHSA 2MYSA 1KMNA 2CM0A 1H4SA 2BG9C 4ZI3D 2ZM6T 4N78D 4G2AA 3ZSSA 2E9XC 4AXPA 4KQEA 3LG7A 2XQ8A 4IDZA 2D0TA 3PURA 2WY2A 3OYZA 3AXJA 4QXCB 3UQ7A 4LF4T 2EHOB 4QX8B 4WBNE 3FXDB 4H2TA 3DTOA 1WFDA 2JMHA 1J1JA 1KMMA 3PCOA 3RQWA 2BBHA 5AQFB 1T72A 5AQJB 4TN7B 2AXDS 3A7RA 2V7LA 4DBRA 5L3EB 3Q5XA 2W0GA 1KEYA 1UCUA 3V7CA 1V9DA 4YRCA 2A2FX 4XTYA 4AISA 3DP7A 2KINB 4WYVA 3RQUA 3A7UA 4YRSA 5C8YE 5CA0E 1KFYA 2XQ6A 2KNDA 4YYEA 2ZNIA 3RLFF 2ZR2A 1FMWA 3HXVA 2WMNA 2N9DA 4WW0A 5FY7A 2C5IT 3P4WA 1NJ1A 4DUYT 4YRTA 3LK42 3TLWA 4BWAA 2DCFA 1HFAA 4HWSA 2RPAA 1NYQA 2W62A 4PG3A 3CX6B 4YFSA 1W09A 2AKWB 3I0QA 2H88A 2H7VC 5HXRA 4P3OA 4DVDA 3IA3A 4EB6E 4K88A 3JADA 2ARUA 4RMFA 2H7OA 2EJGA 3N9QA 1VCSA 2CWYA 2XASB 1J5WA 4TQDA 3FB2A 4G85A 5ABHA 2V6XA 3F31A 5K1XA 5J2TE 1T98A 3FXEB 4HWHA 3KBTA 4ZI2D 1Y64B 5ELOA 1OWAA 4AKGA 3VQXA 3C50A 1D1BA 4EAHA 3UH0A 4GKJT 3ZC0A 3PZCA 2VB6A 5FXZA 3VBBA 4JI7T 4I50E 1D0ZA 3P8YA 5LCYA 3ABVA 1UUSA 1E1HB 4IGUA 4EX5A 4DR2T 2AKWA 5H6RB 3M4QA 3FZKB 5JR9C 5M4YA 2EJ9A 1YKEB 3ETUA 3ZLIA 2HPLA 1X56A 2J62A 3TKLB 3L39A 3AE5A 3SFDA 2ZT8A 5ETWA 3KBUA 1OEDE 3P7IA 4IDPA 2XQ7A 3CX7B 1O3XA 1NWMX 4OP0A 2B1EA 2D9DA 2E10A 3UU3A 5AQTB 2ZZGA 4YSXA 4P73A 2X66A 5HWXA 2XPKA 1HX1B 3RRWA 5LHHB 2BS2A 2X0LB 3LSVA 2XM2A 4GYSA 2KT9A 4OK0A 2FJEA 4XTWA 5JVDE 3UFGA 4EEDA 5AQRB 2W2UA 4HVCA 4YRPA 1LYLA 4JEHB 2Q7GA 4DR3T 2A9UA 2WDRA 5ELNA 1UX4A 3ZYKA 1ZP0A 4DNDA 5LP6E 4B3TT 4IHJE 5AQPB 1U5PA 3T1YT 4IE0A 3OBVE 2D0UA 2OLTA 3QC9A 2Y8DA 1J5ET 2NS6A 4AKIA 4XTZA 4AQYT 1EIYB 1U4QA 3MZKB 2WDVA 3SWHA 1HNWT 2J3LA 1N34T 3ZN0B 4HFCA 3D0TA 3ONJA 3QB5K 4UVCB 4LVJA 3KVBA 2WWVA 2ZZEA 2X0YA 2PMFA 4YRLA 4TVWA 3L2ZA 2KMFA 3RIUA 3BK9A 2VASA 3L3PA 3AEAA 3EUHA 1G73A 2DLRA 2E1HA 2QRXA 2VKDA 4TVYA 3U3IA 3R6NA 4ZXLA 3NEMA 4PNIA 2EHOD 3FBLA 3OYXA 1LKXA 3UU5A 1EIYA 2DL1A 4E7SA 1MMDA 2E3CA 3RKGA 3IBPA 3AAEB 4GK5E 4CZZB 3MA9A 4NUVA 5L47A 2DXTA 2I4LA 1L0WA 3AB3B 1IAPA 4UIGA 3ZSTA 2ZT7A 2E2AA 4QWNB 2X51A 1FMVA 5CJ5A 2HPJA 2ZM8A 3L1AA 3AEGA 1JJCB 4YCWA 2KWIB 3N9PA 3FBZA 1UGOA 1WYCA 2UXCT 4COFA 2SPCA 1XMOT 2JJ9A 2A72A 3UUMA 3DSQA 4TZ4C 3NWIA 1MIYA 4YTNA 1ASYA 2ODRC 5ABFB 2E64A 5K1PA 2NTYA 2Y6XA 5C51B 3WAJA 5FXXA 2ARTA 2DWKA 4JI1T 2XQYA 2X0HA 3ZMZB 2IUBA 4IDQA 2QHUA 3ZT6A 4EO4A 2QA7A 3AE6A 3I0OA 4PJMA 2LOPA 4YRKA 4K0UA 2WP9A 2DXUA 4H2WA 1QLBA 4HWCA 1JJCA 4U2ZA 4AH6A 3MEYA 4PK6A 1HF8A 2ODUA 3HY1A 4XBFB 4WBOA 1WPYA 3I9WA 2DKGA 2CJBA 4XU1A 5FY0A 3AAIA 4ILUA 3NENA 5J2UE 3PU8A 3HXUA 5LBQB 4XTUA 3UTKA 5LG3A 3RI5A 2E8IA 2WB5A 1MIVA 1HTJF 4P73C 2M67A 4ZTZB 3K1SA 5LOVE 2MPKA 1X55A 3NZPA 2WWUA 3DJBA 3CWZB 1EQRA 3PUAA 2HNIA 4ZIBA 4YHJA 4OX9T 2XQAA 2YU2A 3PUZF 4HFIA 4TWAA 5JTGA 5LG4A 4HFBA 3Q5DA 2W61A 3JAFA 2KLQA 5EK3A 3ZT7A 2I4OA 3HXXA 2V5CA 2CGHA 4DR5T 3PUSA 2LJLA 5AQNB 3HXWA 1ZHCA 4H2VA 3RYIE 11ASA 3VQVA 3K8PC 2CJAA 2NWBA 2ZM2A 4IIJE 2Y48B 2LSIA 4H2SA 1RIQA 2L8KA 3ONXA 1MMGA 4HFVA 3PU3A 3AE3A 3RL6A 5KX5E 5E3IA 2LHNA 4A56A 2VK9A 1EVKA 5AQHB 3HFVA 1I94T 4TVAB 3AVRA 2RP4A 1B7TA 4ERRA 2VL8A 4B3ST 5FKYA 2E5AA 4OLFA 4G63A 3VR9A 3ZJ1A 3UU4A 1BIBA 5FVKA 2LKGA 3RF1A 3RYCE 3RIUC 4EOZB 4EXTA 4LMKA 2NW8A 4X66T 2XQ3A 1YKHB 2UXDT 4K86A 3V8KA 2PFVA 3GMIA 1NJ8A 3SS1A 3UFEA 3EDUA 3P8TA 5CA1E 2DTIA 2XSBA 4ZZCA 3C64A 2VURA 4QH4A 5JDNA 1VCTA 3C98B 2VKOA 5GONE 2XUEA 3A5XA 2H3RA 4HFEA 4RQFA 2C0SA 4UVBB 5AQVB 3ZMSB 4IE6A 4X1YE 3PUVF 2ZIMA 4YTMA 3HFZB 4KR3A 5LGNB 2QVAA 2VQET 5BMVE 4P0AA 1SESA 2ARSA 12ASA 4K0KT 2LSKA 4WNKA 4Z8XA 2LSJA 4CI1B 2VVSA 5HYAA 1BR2A 2WS3A 4TQFA 5EK4A 2E9XD 2JQ9A 4JI4T 2IHR1 4PFPA 1Z7NA 2LSGA 2JMKA 3A8YC 4PJNA 2DU5A 4LVKA 3EABA 4JBWF 3NBXX 4O8SA 5FXWA 1IL2A 4ILCA 4OYJA 4YRJA 3AA1B 4OHFA 5JDGA 4DV1T 3EFRA 2YDRA 3ZCJA 1YGBA 3FZHB 3VRAA 5AQKB 1WYDA 4X62T 1NNHA 3NELA 4NIQA 3HFZA 4YRMA 2CWOA 4CI2B 5ADXL 3ZMUB 4H2YA 5EZYE 3EHZA 4QXHB 3HKCE 4HWPA 3AE8A 4HE8A 1FJGT 4H63H 4HEAA 4PK5A 4TX5A 1YFTA 5AFUL 1NJ5A 3V8JA 5HGQA 5LMNT 4LF8T 2RHQB 2BDEA 2CXDA 3HI2A 1WNLA 1VQZA 3HKEE 3TLSA 1YQ3A 1FIOA 3ZC1A 4GIWA 2CBJA 1BR0A 1B76A 1WQWA 4Q25A 2X67A 1YQ4A 3HRIA 3K3QC 4PFOA 4CS2A 4H63V 3H37A 2J47A 4YHHT 5ABEA 2YU1A 4AQFA 3SFEA 3IALA 1EVLA 2K48A 5DJQC 3MF2A 5AQSB 4CH6A 3UUNA 4EV6A 4QH1A 4JI2T 4U2YA 5L3FB 1I6ZA 4EEBA 4HWDA 3RKYA 2RHQA 4CS4A 1N33T 3HKBE 2GK9A 4L0RA 1ASZA 3L09A 3ZEFB 2E5VA 2XHEB 5CB4E 3IKMB 2BKPA 3P4RA 3KV5A 4O4JE 2W00A 2BZBA 2ZMAA 4EZ4A 1WLXA 1H4TA 5FVLA 2I4NA 3FHNA 3ZYMA 3ONLC 3AEFA 3JC6C 1MMAA 4ZZBA 1ZOYA 2LEHA 3V5UA 5AQOB 5F3JA 3VQWA 1IBKT 3RYFE 3QO7A 2KXPB 2YDQA 5DQVA 4B3MT 1BR4A 2WM9A 3CX8B 4PHCA 3WI3A 2XAQB 3CQCB 3KV4A 4DBQA 4HWTA 1EOVA 4IL9A 4C91A 1YFRA 4YCUA 4H9PC 5ABGA 3P4PA 4WJ3M 2BKNA 2D2SA 3UULA 4PJJA 2BS3A 4L9IA 5LJNA 5L3BB 1NJ6A 1ZEEA 1L0VA 3NETA 2K9AA 2I6HA 5LMUT 2LLYA 3CQGB 1UX5A 3AE4A 4DV5T 5KDMC 2OA5A 3QOFA 4CH4A 4X5TA 4QKNA 4V1Av 5J1GA 2X9HA 5L4HA 2A3DA 4YY3T 3GN5B 2JIWA 2UUCT 3KDSE 2AMCB 4PK4A 2YDSA 2CBIA 1SA0E 3EDVA 3PJAJ 3M4PA 5F5WA 4O2BE 1D0XA 3ZKRA 4DR1T 4P0BA 5L2LA 1ATIA 3HKDE 3PTRB 2EJFA 1XNRT 5HCMA 2ACZA 3A31A 4OYKA 2YN6A 2DI4A 4YT0A 2PMEA 2Q5HA 3HTZA 1H7CA 4RDXA 4HT4A 4EYUA 3RUXA 2RA1A 2WCAA 1XDOA 2X9XA 1IBMT 2Q9QB 4F8HA 1N9WA 4DV0T 3VKHA 5CFBA 2M6BA 4UV9B 3GN5A 2ZT6A 3E9HA 2DTOA 4TV9E 2AMCA 2DZCA 1KNRA 5AQMB 2CMRA 4CN4A 1M62A 4P71A 4ISSA 4YCVA 3ICAA 3PUWF 3K3OA 3V7RA 3E0ZA 4TWHA 4HWRA 1C0AA 2ZNJA 4IDOA 2HHHT 2UXXB 4P3NA 2MAWA 2C5JA 4YRIA 2XJ7A 4YREA 3ZT5A 4JI6T 2CXFA 1HS7A 4U33A 3UGTA 1NAFA 2JQQA 3MQZA 3LK3B 4JI8T 2Q9QA 1WLEA 2V8SV 2C8MA 3M3ZB 4CN1A 3KFUA 5JREA 3RH3A 1NYRA 2C5KT 4TTVA 4AQFC 4GKKT 3FJPA 4H9QC 3I7FA 2IW5B 1GQEA 2Q5IA 1SETA 4DR7T 4J15A 4UR9A 4M1PA 1QF6A 4H2XB 1XDPA 2ALYB 4XEOA 3ANWB 5H6QB 4AKLA 1KF6A 4HTEA 2DTHA 2VQFT 3F2EA 2L3LA 2KZ7B 1W9RA 4DR4T 4UELA 4NXMT 2HH7A 3I1AA 5LJMA 1Z0PA 4JI3T 5FNVE 2IAKA 3T1HT 5LGTB 2ZIOA 2AE9A 3A7AA 4HWOA 4HN9A 3H3AA 3SOLA 2N1GA 1XWMA 4CXWA 2WQYA 5AQIB 5LHGB 1EZ3A 1UURA 4UPAA 2IDOB 4UP9A 4DQ2A 2XSAA 4H2XA 4DPGA 1MMNA 2XQ4A 4BA9A 2ALYA 3EI0A 3ANWA 4ILBA 3PUQA 4DR6T 3RRCA 3MF1A 2NR4A 2W63A 2FJBA 4XEMA 2V6YB 5HXCA 5KNNA 2LOSA 1E1OA 2LM9A 4AIUA 4H02A 3SRZA 1GGMA 1E1TA 3N9NA 2YOEA 1IBLT 1QUUA 1NJ2A 4KHZF 4LF9T 4P75A 1X01A 4XZCA 3PUYF 1NEKA 2JQKA 1HX8A 2VKHA 1SUMB 3C51A 4IREA 1VRBA 4E7ZA 3LSSA 1OXZA 3LJCA 5AQGB 3O4XE 2V6YA 2ES0A 3CMLA 3ZMTB 4FI5A 2W66A 3E9IA 2YK0A 2CHNA 3FZFB 4QHOA 4LF6T 1BBWA 5HXEA
chains in the Genus database with same CATH topology
1X56A 4YP0A 4YRJA 4YRGA 2ODRD 2ZZFA 3EFRA 2DDZA 1YGBA 3BFMA 2ZT8A 1WYDA 1NNHA 3NELA 3HFZA 4YPFA 4YRMA 1PYSB 4K87A 4OP0A 2E10A 2ZZGA 4XU0A 4P73A 3W3SA 4H2YA 4O2DA 4Q6GA 4HWPA 1B7YB 2G4CA 1YFTA 4NCXA 1NJ5A 3V8JA 3BJUA 2FYKA 3HY0A 5HGQA 4XTWA 1E22A 2RHQB 3UFGA 1WNLA 1VQZA 4P71C 4YDQA 1B76A 4RQEA 1WQWA 2E65A 4HVCA 4YRPA 3HRIA 1LYLA 2Q7GA 4XTVA 4CS2A 1X54A 5ELNA 3RGLA 2CJ9A 2ZT5A 3A5YA 2P0LA 2DJZA 1PYSA 4YRQA 1SRYA 3A32A 1EVLA 3IALA 4L87A 3MF2A 1B7YA 2Q7EA 4CH6A 4CS3A 3VQYA 5C52B 2DU7A 2NS6A 3RKXA 3ERRA 4P72A 4XTZA 3RKYA 1EIYB 2RHQA 4CS4A 1HC7A 1ASZA 4XU3A 2J3LA 3IKMB 2P5IA 3LSQA 4LVIA 2ZGWA 4YRRA 2ZXFA 4XU2A 2DQ3A 1H4TA 2I4NA 4LVJA 2ZZEA 2PMFA 4YRLA 4TVWA 3L2ZA 4H2UA 2DZ9A 3VQWA 3QNEA 3QO7A 4P74A 1G51A 2E1HA 2J3MA 4UP7A 4TVYA 3TEHA 4PHCA 3NEMA 3HXYA 4HWTA 1EOVA 2IY5B 1YFRA 4LVMA 1EIYA 1G5HA 2ZR3A 1WQ7A 3WQZA 4YCUA 2E3CA 3QTCA 4WJ3M 1B70B 4HA8A 2DXTA 2I4LA 3L4GB 1L0WA 1ADJA 2ZT7A 4CH3A 1G5IA 3QO8A 3L1AA 2QHSA 3TEGA 3IKLA 1USYC 1JJCB 4YCWA 3UGQA 3HXZA 2EWNA 5C53B 1NJ6A 4G84A 3P8VA 3NETA 2C7IA 4LNSA 4X5OA 3DSQA 4CH4A 1ASYA 4XTXA 2ODRC 2E64A 4P75C 5K1PA 5C51B 4KR2A 2ARTA 2IY5A 1H4QA 2XTIA 2QHUA 2AMCB 1BBUA 4EO4A 1B70A 3REUA 4E51A 1Z7MA 2EAYA 3L4GA 4YRKA 3M4PA 5F5WA 2DXUA 1KOGA 4H2WA 3G1ZA 3HRKA 3R07A 1ATIA 1X2HA 2EJFA 1JJCA 4AH6A 3MEYA 4ZTUB 2I4MA 3A31A 3TEHB 2PMEA 3HY1A 2Q5HA 1WPYA 3HTZA 1QE0A 4YRFA 1FYFA 3A74A 4RDXA 1HTTA 4HT4A 3RUXA 2DKGA 2DEQA 2CJBA 4YRNA 4XU1A 2ZINA 2QHTA 1N9WA 2RHSB 3NENA 3HXUA 4XTUA 1SERA 4YROA 3RACA 4WF2A 3EFSA 2ZT6A 3E9HA 2DTOA 4TVAA 2AMCA 2DZCA 4P73C 4ZTZB 4P71A 4YCVA 4BW9A 1X55A 3ICAA 1EFWA 3TUPA 2CIMA 3V7RA 4HWRA 1C0AA 2ZNJA 3A5ZA 4P3NA 1E24A 2ZTGA 3LC0A 4Q15A 1EQRA 3OD1A 1BIAA 2HNIA 3PCOB 4YRIA 4ZIBA 4YREA 4TWAA 3UGTA 3RIRA 1X2GA 2A8EA 4P3PA 3MQZA 3QO5A 1WLEA 2RHSA 3HXXA 2I4OA 2C8MA 2CGHA 3KFUA 1KMNA 1H4SA 3HXWA 3CMQA 4H2VA 1NYRA 3V8LA 11ASA 3VQVA 4TTVA 3FJPA 1H4VB 2CJAA 2ZCEA 3I7FA 4KQEA 1W66A 1HXDA 2Q5IA 1SETA 4J15A 4H2SA 1YFSA 1QF6A 4H2XB 2XGTA 1RIQA 1B8AA 2ALYB 2DQ0A 4XEOA 4P72C 4H2TA 2DTHA 1KMMA 3RL6A 3PCOA 2QHVA 5E3IA 2Q7HA 1EVKA 3HFVA 3A7RA 4TVAB 4CH5A 4WJ4A 2E5AA 4OLFA 2ZIOA 3A7AA 4HWOA 3V7CA 1BIBA 4UP8A 2E41A 4YRCA 3RF1A 4XTYA 3A7UA 4YRSA 4P74C 4YYEA 2ZNIA 2ZR2A 4UPAA 3HXVA 4UP9A 4DQ2A 4H2XA 2EL9A 4K86A 1NJ1A 4YRTA 3RKWA 4DPGA 3V8KA 2ALYA 1NJ8A 4WI1A 1USYA 4BWAA 4LVLA 3MF1A 3P8TA 4HWSA 4XEMA 2DTIA 1NYQA 5KNNA 4PG3A 1E1OA 2AKWB 3IG2A 4P3OA 4H02A 2DVEA 4K88A 2ARUA 4RMFA 1GGMA 1E1TA 4RQFA 2EJGA 1NJ2A 4P75A 1X01A 2ZIMA 1YB3A 3HFZB 1J5WA 4TQDA 3REXA 4KR3A 4G85A 5K1XA 1SESA 2ARSA 12ASA 1ADYA 1WU7A 5ELOA 3VQXA 3UH0A 4TQFA 3PZCA 3LSSA 3VBBA 3P8YA 1Z7NA 4EX5A 3E9IA 2AKWA 2DU5A 4LVKA 3M4QA 3V7SA 1BBWA 2EJ9A 1IL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X56 A;  4YP0 A;  4YRJ A;  4YRG A;  2ODR D;  2ZZF A;  3EFR A;  2DDZ A;  1YGB A;  3BFM A;  2ZT8 A;  1WYD A;  1NNH A;  3NEL A;  3HFZ A;  4YPF A;  4YRM A;  1PYS B;  4K87 A;  4OP0 A;  2E10 A;  2ZZG A;  4XU0 A;  4P73 A;  3W3S A;  4H2Y A;  4O2D A;  4Q6G A;  4HWP A;  1B7Y B;  2G4C A;  1YFT A;  4NCX A;  1NJ5 A;  3V8J A;  3BJU A;  2FYK A;  3HY0 A;  5HGQ A;  4XTW A;  1E22 A;  2RHQ B;  3UFG A;  1WNL A;  1VQZ A;  4P71 C;  4YDQ A;  1B76 A;  4RQE A;  1WQW A;  2E65 A;  4HVC A;  4YRP A;  3HRI A;  1LYL A;  2Q7G A;  4XTV A;  4CS2 A;  1X54 A;  5ELN A;  3RGL A;  2CJ9 A;  2ZT5 A;  3A5Y A;  2P0L A;  2DJZ A;  1PYS A;  4YRQ A;  1SRY A;  3A32 A;  1EVL A;  3IAL A;  4L87 A;  3MF2 A;  1B7Y A;  2Q7E A;  4CH6 A;  4CS3 A;  3VQY A;  5C52 B;  2DU7 A;  3RKX A;  3ERR A;  4P72 A;  4XTZ A;  3RKY A;  1EIY B;  2RHQ A;  4CS4 A;  1HC7 A;  1ASZ A;  4XU3 A;  2J3L A;  3IKM B;  2P5I A;  3LSQ A;  2ZGW A;  4YRR A;  2ZXF A;  4XU2 A;  2DQ3 A;  1H4T A;  2I4N A;  2ZZE A;  2PMF A;  4YRL A;  4TVW A;  3L2Z A;  4H2U A;  2DZ9 A;  3VQW A;  3QNE A;  3QO7 A;  4P74 A;  1G51 A;  2E1H A;  2J3M A;  4UP7 A;  4TVY A;  3TEH A;  4PHC A;  3NEM A;  3HXY A;  4HWT A;  1EOV A;  2IY5 B;  1YFR A;  1EIY A;  1G5H A;  2ZR3 A;  1WQ7 A;  3WQZ A;  4YCU A;  2E3C A;  3QTC A;  4WJ3 M;  1B70 B;  4HA8 A;  2DXT A;  2I4L A;  3L4G B;  1L0W A;  1ADJ A;  2ZT7 A;  4CH3 A;  1G5I A;  3QO8 A;  3L1A A;  2QHS A;  3TEG A;  3IKL A;  1USY C;  1JJC B;  4YCW A;  3UGQ A;  3HXZ A;  2EWN A;  5C53 B;  1NJ6 A;  4G84 A;  3P8V A;  3NET A;  2C7I A;  4LNS A;  4X5O A;  3DSQ A;  4CH4 A;  1ASY A;  4XTX A;  2ODR C;  2E64 A;  4P75 C;  5K1P A;  5C51 B;  4KR2 A;  2ART A;  2IY5 A;  1H4Q A;  2XTI A;  2QHU A;  2AMC B;  1BBU A;  4EO4 A;  1B70 A;  3REU A;  4E51 A;  1Z7M A;  2EAY A;  3L4G A;  4YRK A;  3M4P A;  5F5W A;  2DXU A;  1KOG A;  4H2W A;  3G1Z A;  3HRK A;  3R07 A;  1ATI A;  1X2H A;  2EJF A;  1JJC A;  4AH6 A;  3MEY A;  4ZTU B;  2I4M A;  3A31 A;  3TEH B;  2PME A;  3HY1 A;  2Q5H A;  1WPY A;  3HTZ A;  1QE0 A;  4YRF A;  1FYF A;  3A74 A;  4RDX A;  1HTT A;  3RUX A;  2DKG A;  2DEQ A;  2CJB A;  4YRN A;  4XU1 A;  2ZIN A;  2QHT A;  1N9W A;  2RHS B;  3NEN A;  3HXU A;  4XTU A;  1SER A;  4YRO A;  3RAC A;  4WF2 A;  3EFS A;  2ZT6 A;  3E9H A;  2DTO A;  4TVA A;  2AMC A;  2DZC A;  4P73 C;  4ZTZ B;  4P71 A;  4YCV A;  4BW9 A;  1X55 A;  3ICA A;  1EFW A;  3TUP A;  2CIM A;  3V7R A;  4HWR A;  1C0A A;  2ZNJ A;  3A5Z A;  4P3N A;  1E24 A;  2ZTG A;  3LC0 A;  4Q15 A;  1EQR A;  3OD1 A;  1BIA A;  2HNI A;  3PCO B;  4YRI A;  4ZIB A;  4YRE A;  4TWA A;  3UGT A;  3RIR A;  1X2G A;  4P3P A;  3QO5 A;  1WLE A;  2RHS A;  3HXX A;  2I4O A;  2C8M A;  2CGH A;  3KFU A;  1KMN A;  1H4S A;  3HXW A;  3CMQ A;  4H2V A;  1NYR A;  3V8L A;  11AS A;  3VQV A;  4TTV A;  3FJP A;  1H4V B;  2CJA A;  2ZCE A;  3I7F A;  4KQE A;  1W66 A;  1HXD A;  2Q5I A;  1SET A;  4J15 A;  4H2S A;  1YFS A;  1QF6 A;  4H2X B;  2XGT A;  1RIQ A;  1B8A A;  2ALY B;  2DQ0 A;  4XEO A;  4P72 C;  4H2T A;  2DTH A;  1KMM A;  3RL6 A;  3PCO A;  2QHV A;  5E3I A;  2Q7H A;  1EVK A;  3HFV A;  3A7R A;  4TVA B;  4CH5 A;  4WJ4 A;  2E5A A;  4OLF A;  2ZIO A;  3A7A A;  4HWO A;  3V7C A;  1BIB A;  4UP8 A;  2E41 A;  4YRC A;  3RF1 A;  4XTY A;  3A7U A;  4YRS A;  4P74 C;  4YYE A;  2ZNI A;  2ZR2 A;  4UPA A;  3HXV A;  4UP9 A;  4DQ2 A;  4H2X A;  2EL9 A;  4K86 A;  1NJ1 A;  4YRT A;  3RKW A;  4DPG A;  3V8K A;  2ALY A;  1NJ8 A;  4WI1 A;  1USY A;  4BWA A;  3MF1 A;  3P8T A;  4HWS A;  4XEM A;  2DTI A;  1NYQ A;  5KNN A;  4PG3 A;  1E1O A;  2AKW B;  3IG2 A;  4P3O A;  4H02 A;  2DVE A;  4K88 A;  2ARU A;  4RMF A;  1GGM A;  1E1T A;  4RQF A;  2EJG A;  1NJ2 A;  4P75 A;  1X01 A;  2ZIM A;  1YB3 A;  3HFZ B;  1J5W A;  4TQD A;  3REX A;  4KR3 A;  4G85 A;  5K1X A;  1SES A;  2ARS A;  12AS A;  1ADY A;  1WU7 A;  5ELO A;  3VQX A;  3UH0 A;  4TQF A;  3PZC A;  3LSS A;  3VBB A;  3P8Y A;  1Z7N A;  4EX5 A;  3E9I A;  2AKW A;  2DU5 A;  3M4Q A;  3V7S A;  1BBW A;  2EJ9 A;  1IL2 A; 
#chains in the Genus database with same CATH topology
 4I55 E;  4YP0 A;  4PW8 A;  1M7K A;  4YRG A;  3GWH A;  3R84 B;  1AJ3 A;  2ZZF A;  3B57 A;  3C4X A;  5AQQ B;  2DDZ A;  3BFM A;  2LHR A;  1WYB A;  3HL6 A;  3QUJ A;  4TWF A;  1MIW A;  3AE9 A;  1PYS B;  4K87 A;  4DV4 T;  4WZX A;  1VOM A;  4O2D A;  4Q6G A;  3I9Y A;  1B7Y B;  5L4E A;  4NCX A;  4QX7 B;  1YD8 G;  2XY8 B;  1YXR A;  5EK2 A;  3T8O A;  3HY0 A;  3FZM B;  4AQG A;  1E22 A;  1OED B;  2I0M A;  1NEN A;  4P71 C;  3ZMV B;  1XZY A;  2XAG B;  4I43 B;  4RQE A;  3OTO T;  2YEV C;  4XTV A;  2KSR A;  3IHR A;  1X54 A;  2R6G F;  3C4W A;  2ZT5 A;  2OV9 A;  4DV2 T;  2WZH A;  2PG8 A;  3GA8 A;  4DMW A;  1XMQ T;  3PV0 F;  4U7I A;  3PDY A;  1PYS A;  3CQX C;  4YRQ A;  3G06 A;  1SRY A;  5FXV A;  3A32 A;  2VVN A;  4L87 A;  2J1D G;  3AE2 A;  2UU9 T;  2Q9Q C;  4MAL A;  4MBQ A;  2IIU A;  2XZE A;  1B7Y A;  1CUN A;  1KNZ A;  3RKO A;  3VQY A;  2J4G A;  4PAG A;  2DU7 A;  3PJA A;  1XNQ T;  3RKX A;  2PJQ A;  4P72 A;  1US7 B;  4H9R C;  4U3C A;  3CKD A;  1OED A;  4QH5 A;  2QGS A;  2E5L T;  3PUX F;  4DO0 A;  3QNU A;  4X64 T;  4IST A;  4IE4 A;  4H9O C;  5L3G B;  3LSQ A;  1D1A A;  2BVL A;  4TWD A;  2ZGW A;  4YRR A;  3F57 A;  2ZXF A;  4XU2 A;  5IWA T;  4KHP T;  2DZ9 A;  2XAH B;  4F6R C;  3TLV A;  4TUY E;  3HR0 A;  2BG9 E;  3QNE A;  1WR0 A;  4P74 A;  1G51 A;  3TLT A;  3RPU A;  3RX6 A;  1YW0 A;  3TEH A;  3IF8 B;  3LK2 B;  3X1D A;  3HXY A;  3BQI A;  2IY5 B;  1HCI A;  5HEG A;  4LVM A;  1G5H A;  3WQZ A;  4YLH A;  3NZQ A;  1B70 B;  2MOZ A;  2V7I A;  4YXD A;  3L4G B;  1ADJ A;  4AKR B;  2CHO A;  4CH3 A;  3KFW X;  2Z6E A;  4CXY A;  1N36 T;  3UU8 A;  2CCQ A;  4Z90 A;  4DID B;  3IKL A;  2VL0 A;  3UGQ A;  2CA5 A;  1D1C A;  2JPF A;  1BR1 A;  5C53 B;  2L9Q A;  3P8V A;  1JNR A;  3LDQ B;  3MAC A;  1WRD A;  3B13 A;  4O4I E;  4IDN A;  4ZI3 C;  2NTX A;  3L8R A;  4LMJ A;  5L3C B;  2WSS V;  1W0A A;  1FEW A;  4ZEY A;  4EIW A;  3NRX A;  4P75 C;  4KR2 A;  3VRB A;  2IY5 A;  2XTI A;  2YIN A;  4ZOL E;  1MNE A;  3ZPO A;  1B70 A;  3K3N A;  3VKG A;  2EAY A;  3L4G A;  4AI6 A;  3NRY A;  3G1Z A;  3HRK A;  3UT5 E;  4DV7 T;  1QSD A;  5FMN A;  4O2A E;  2BBJ A;  5L3D B;  3AEC A;  2I4M A;  4GYR A;  3AEE A;  3ZCI A;  2UUB T;  5HAX A;  3KIN B;  5HEH A;  4QXB B;  1QE0 A;  4IE7 A;  2EHO A;  4YRF A;  2WDQ A;  3A74 A;  1HTT A;  2V7M A;  4YRN A;  1HNZ T;  3AVS A;  2QHT A;  3JC6 D;  2UXB T;  3P4Q A;  1UK5 A;  1SER A;  4IL4 A;  4WF2 A;  2N2N A;  3EFS A;  2DNX A;  2WAU A;  2BS4 A;  5CGM A;  4KX6 A;  2XM1 A;  1Z8U A;  5LHI B;  2CE7 A;  3TUP A;  2V5D A;  4UVA B;  1E7P A;  5HXS A;  4UF0 B;  4Q15 A;  3LC0 A;  5JDQ A;  1BIA A;  2CLY B;  4I4T E;  4A5X A;  3AA6 B;  3RYH E;  3N2O A;  3RIR A;  5AQU B;  4HWI B;  2NW7 A;  2X9Y A;  2D5U A;  3QO5 A;  2M6I A;  2LRK A;  1S94 A;  3UUX B;  4ZI2 C;  3CMQ A;  3B5M A;  4CXX A;  3V8L A;  1H4V B;  2IC9 A;  5LBM A;  2ZCE A;  2WU5 A;  4LF7 T;  5AQL B;  1W66 A;  1HXD A;  5LB7 B;  4I0U A;  2WMO A;  2W4X A;  3KVA A;  1YFS A;  1R8I A;  2XGT A;  3ZN1 B;  1B8A A;  1SE7 A;  2DQ0 A;  3BQL A;  5A1L A;  3HA4 A;  4P72 C;  4UF0 A;  5DAB A;  2KWH A;  4UEM A;  1OED C;  4KUM B;  3JAE A;  2QHV A;  4YJ2 E;  2HN1 A;  2VKJ A;  5TAO A;  3O1H A;  2Q7H A;  5LA6 E;  4LFB T;  2B76 A;  4CH5 A;  2NW9 A;  3O1J A;  4U74 A;  5FY1 A;  4WJ4 A;  3E22 E;  4JYA T;  4GOU A;  3RC8 A;  4UP8 A;  4YSZ A;  2E41 A;  2HN2 A;  5JDF A;  3RIF A;  2XAF B;  3TLU A;  3MK7 C;  2XTL A;  3PE0 A;  4P74 C;  3O1I A;  5FP3 A;  4JLE A;  3AEB A;  2EL9 A;  3RKW A;  4FJO A;  2K3W A;  2F4V T;  1USY A;  4WI1 A;  2V1D B;  3Q2M A;  3UUB A;  4LVL A;  2I59 A;  4CQI A;  4UXN B;  5LXT E;  2V26 A;  3AAA B;  4KMC A;  4LF5 T;  2V7J A;  3IG2 A;  3N2G E;  4A97 A;  4Z91 A;  1ZV4 X;  2DVE A;  3OKQ A;  1LVK A;  2VWA A;  3C4Z A;  2P9B A;  5JRC B;  3OJA A;  4TNV A;  2LKH A;  5C3J A;  4KBM B;  3LBX B;  2BKO A;  1YB3 A;  5HXH A;  3REX A;  2ACX A;  4YJ3 E;  2JQH A;  3OVU A;  2UUA T;  1ADY A;  4KI0 F;  1WU7 A;  2K24 A;  1IJ6 A;  4OFZ A;  4UV8 B;  4NUU A;  1HG2 A;  4JV5 T;  2LRL A;  4HWF A;  3N5L A;  5FL0 A;  1WCR A;  5HEJ A;  3ETV A;  3JCF A;  1LVF A;  4L5G A;  4B3R T;  3V7S A;  2WBL A;  2QYW A;  4HGA A;  5JRC A;  3N9M A;  3AE7 A;  2ODR D;  4PJL A;  5IUX A;  3QK6 A;  4EGW A;  3AED A;  5KMG P;  3LBX A;  5E0O A;  2BG9 B;  3P8C D;  5HEO A;  3KV9 A;  4YPF A;  4ILA A;  2EHO C;  2XAJ B;  3MJX A;  2DWG A;  3N9L A;  2E9X B;  4XU0 A;  3W3S A;  3P50 A;  3QB5 A;  5FL1 A;  2G4C A;  4H9S E;  4ZS2 A;  3BJU A;  3FZL B;  2FYK A;  1KK7 A;  2MBG A;  5J0Z A;  2FJA A;  3NKZ A;  4YDQ A;  1CHU A;  2E65 A;  1WR6 A;  2NP9 A;  4DV6 T;  2MTQ A;  4HFH A;  2LM2 A;  4P1N A;  4HKA A;  2CRB A;  1JNZ A;  3RGL A;  3V5S A;  2CJ9 A;  2XQ9 A;  4A98 A;  3A5Y A;  2BG9 A;  3CIR A;  4DUZ T;  4X1K E;  2P0L A;  1HG5 A;  2DJZ A;  4U31 A;  3MXZ A;  3ESL A;  2E9X A;  2IML A;  5JQG E;  3VU7 H;  2G0U A;  4U72 A;  3P4S A;  1D0Y A;  4O4L E;  2W67 A;  2Q7E A;  3PUG A;  2WZI A;  4EZH A;  4CS3 A;  4JUY A;  5C52 B;  1T7S A;  1HNX T;  4NXN T;  1SHZ C;  3ERR A;  4KP3 C;  2JRK A;  2UXN B;  2XQ5 A;  1HC7 A;  2LSY A;  4XU3 A;  2YKS A;  4ANJ A;  5ABF A;  1DU2 A;  2WU2 A;  2P5I A;  3AE1 A;  2BVM A;  5LYJ E;  3M65 A;  4LVI A;  3CPZ A;  4LML A;  3NVO A;  1G8X A;  2DQ3 A;  2DHR A;  4H2U A;  3ZJ2 A;  2CLY C;  1HR0 T;  1W0B A;  4BAY B;  2CXL A;  2FJD A;  2ZM0 A;  4O4H E;  5FYM A;  5LNK A;  5DQW A;  2J3M A;  4UP7 A;  4MHC A;  2X68 A;  2V7K A;  4TV8 E;  3W15 B;  3WAK A;  4MLK A;  4EYY R;  2ZR3 A;  1E2A A;  1WQ7 A;  3UQ4 A;  3QTC A;  5IHY A;  4HA8 A;  4ZS3 A;  3RIA A;  3CK6 A;  1S35 A;  1Y01 A;  4JI0 T;  5JR9 B;  1G5I A;  2ODV A;  3QO8 A;  5HEU A;  3Q5E A;  3S4U A;  2QHS A;  3TEG A;  1USY C;  1X9B A;  4BJN A;  3HXZ A;  2EWN A;  4G84 A;  2LE8 A;  2IC6 A;  3BQK A;  2C7I A;  4LNS A;  4ZI7 E;  4DMV A;  4X5O A;  3J9X 1;  3Q5W A;  4X20 E;  4H9N C;  3AA0 B;  4BJM A;  4TNW A;  3UU6 A;  4XTX A;  4LFA T;  3RC3 A;  4XAX B;  1H4Q A;  1LRZ A;  1MND A;  1ZKE A;  4IT4 A;  3N9O A;  2Q9Q D;  1BBU A;  4NPP A;  3REU A;  4E51 A;  1Z7M A;  4ASK A;  4GK0 E;  5BR8 T;  4U7Y A;  1KOG A;  3KV6 A;  3CVR A;  3O9X A;  5JR9 A;  3R07 A;  2CPT A;  4B6X A;  1X2H A;  5JDL A;  2NOX A;  3OPC A;  4C90 A;  4ZTU B;  4JI5 T;  5HWY A;  3TEH B;  3A7M A;  3AA7 B;  2ZLY A;  2FUP A;  4YSY A;  2FBW A;  3EAM A;  3IEE A;  1X79 A;  5LGU B;  1FYF A;  4X1I E;  2DEQ A;  5JDM A;  2PTF A;  5JH7 E;  2ZIN A;  1N32 T;  3Q9D A;  2RHS B;  3E08 A;  1T8B A;  4YRO A;  2CEA A;  3RAC A;  4JEU B;  3EVY A;  4ADZ A;  4P09 A;  4TVA A;  5F8P A;  5IYZ E;  4YTP A;  4CI3 B;  3LFM A;  2X9W A;  4J2C A;  5HCJ A;  4BW9 A;  4MFR A;  4LFC T;  1EFW A;  5KXJ A;  3U78 A;  2CIM A;  3AXJ B;  4CN6 A;  2K5B B;  3MKD A;  3A5Z A;  1KNP A;  5JDH A;  1E24 A;  2ZTG A;  3H3M A;  3OD1 A;  4ZHQ E;  3RHW A;  4X65 T;  4HFD A;  3VHL A;  3PCO B;  2LT3 A;  1IJ5 A;  4DV3 T;  1IZN B;  3VR8 A;  3N2K E;  1X2G A;  2A8E A;  4IE5 A;  3ZYL A;  4AKH A;  2H89 A;  4P3P A;  5C2T A;  3J7Y q;  2PBI A;  2RHS A;  2MYS A;  1KMN A;  2CM0 A;  1H4S A;  2BG9 C;  4ZI3 D;  2ZM6 T;  4N78 D;  4G2A A;  3ZSS A;  2E9X C;  4AXP A;  4KQE A;  3LG7 A;  2XQ8 A;  4IDZ A;  2D0T A;  3PUR A;  2WY2 A;  3OYZ A;  3AXJ A;  4QXC B;  3UQ7 A;  4LF4 T;  2EHO B;  4QX8 B;  4WBN E;  3FXD B;  4H2T A;  3DTO A;  1WFD A;  2JMH A;  1J1J A;  1KMM A;  3PCO A;  3RQW A;  2BBH A;  5AQF B;  1T72 A;  5AQJ B;  4TN7 B;  2AXD S;  3A7R A;  2V7L A;  4DBR A;  5L3E B;  3Q5X A;  2W0G A;  1KEY A;  1UCU A;  3V7C A;  1V9D A;  4YRC A;  2A2F X;  4XTY A;  4AIS A;  3DP7 A;  2KIN B;  4WYV A;  3RQU A;  3A7U A;  4YRS A;  5C8Y E;  5CA0 E;  1KFY A;  2XQ6 A;  2KND A;  4YYE A;  2ZNI A;  3RLF F;  2ZR2 A;  1FMW A;  3HXV A;  2WMN A;  2N9D A;  4WW0 A;  5FY7 A;  2C5I T;  3P4W A;  1NJ1 A;  4DUY T;  4YRT A;  3LK4 2;  3TLW A;  4BWA A;  2DCF A;  1HFA A;  4HWS A;  2RPA A;  1NYQ A;  2W62 A;  4PG3 A;  3CX6 B;  4YFS A;  1W09 A;  2AKW B;  3I0Q A;  2H88 A;  2H7V C;  5HXR A;  4P3O A;  4DVD A;  3IA3 A;  4EB6 E;  4K88 A;  3JAD A;  2ARU A;  4RMF A;  2H7O A;  2EJG A;  3N9Q A;  1VCS A;  2CWY A;  2XAS B;  1J5W A;  4TQD A;  3FB2 A;  4G85 A;  5ABH A;  2V6X A;  3F31 A;  5K1X A;  5J2T E;  1T98 A;  3FXE B;  4HWH A;  3KBT A;  4ZI2 D;  1Y64 B;  5ELO A;  1OWA A;  4AKG A;  3VQX A;  3C50 A;  1D1B A;  4EAH A;  3UH0 A;  4GKJ T;  3ZC0 A;  3PZC A;  2VB6 A;  5FXZ A;  3VBB A;  4JI7 T;  4I50 E;  1D0Z A;  3P8Y A;  5LCY A;  3ABV A;  1UUS A;  1E1H B;  4IGU A;  4EX5 A;  4DR2 T;  2AKW A;  5H6R B;  3M4Q A;  3FZK B;  5JR9 C;  5M4Y A;  2EJ9 A;  1YKE B;  3ETU A;  3ZLI A;  2HPL A;  1X56 A;  2J62 A;  3TKL B;  3L39 A;  3AE5 A;  3SFD A;  2ZT8 A;  5ETW A;  3KBU A;  1OED E;  3P7I A;  4IDP A;  2XQ7 A;  3CX7 B;  1O3X A;  1NWM X;  4OP0 A;  2B1E A;  2D9D A;  2E10 A;  3UU3 A;  5AQT B;  2ZZG A;  4YSX A;  4P73 A;  2X66 A;  5HWX A;  2XPK A;  1HX1 B;  3RRW A;  5LHH B;  2BS2 A;  2X0L B;  3LSV A;  2XM2 A;  4GYS A;  2KT9 A;  4OK0 A;  2FJE A;  4XTW A;  5JVD E;  3UFG A;  4EED A;  5AQR B;  2W2U A;  4HVC A;  4YRP A;  1LYL A;  4JEH B;  2Q7G A;  4DR3 T;  2A9U A;  2WDR A;  5ELN A;  1UX4 A;  3ZYK A;  1ZP0 A;  4DND A;  5LP6 E;  4B3T T;  4IHJ E;  5AQP B;  1U5P A;  3T1Y T;  4IE0 A;  3OBV E;  2D0U A;  2OLT A;  3QC9 A;  2Y8D A;  1J5E T;  2NS6 A;  4AKI A;  4XTZ A;  4AQY T;  1EIY B;  1U4Q A;  3MZK B;  2WDV A;  3SWH A;  1HNW T;  2J3L A;  1N34 T;  3ZN0 B;  4HFC A;  3D0T A;  3ONJ A;  3QB5 K;  4UVC B;  4LVJ A;  3KVB A;  2WWV A;  2ZZE A;  2X0Y A;  2PMF A;  4YRL A;  4TVW A;  3L2Z A;  2KMF A;  3RIU A;  3BK9 A;  2VAS A;  3L3P A;  3AEA A;  3EUH A;  1G73 A;  2DLR A;  2E1H A;  2QRX A;  2VKD A;  4TVY A;  3U3I A;  3R6N A;  4ZXL A;  3NEM A;  4PNI A;  2EHO D;  3FBL A;  3OYX A;  1LKX A;  3UU5 A;  1EIY A;  2DL1 A;  4E7S A;  1MMD A;  2E3C A;  3RKG A;  3IBP A;  3AAE B;  4GK5 E;  4CZZ B;  3MA9 A;  4NUV A;  5L47 A;  2DXT A;  2I4L A;  1L0W A;  3AB3 B;  1IAP A;  4UIG A;  3ZST A;  2ZT7 A;  2E2A A;  4QWN B;  2X51 A;  1FMV A;  5CJ5 A;  2HPJ A;  2ZM8 A;  3L1A A;  3AEG A;  1JJC B;  4YCW A;  2KWI B;  3N9P A;  3FBZ A;  1UGO A;  1WYC A;  2UXC T;  4COF A;  2SPC A;  1XMO T;  2JJ9 A;  2A72 A;  3UUM A;  3DSQ A;  4TZ4 C;  3NWI A;  1MIY A;  4YTN A;  1ASY A;  2ODR C;  5ABF B;  2E64 A;  5K1P A;  2NTY A;  2Y6X A;  5C51 B;  3WAJ A;  5FXX A;  2ART A;  2DWK A;  4JI1 T;  2XQY A;  2X0H A;  3ZMZ B;  2IUB A;  4IDQ A;  2QHU A;  3ZT6 A;  4EO4 A;  2QA7 A;  3AE6 A;  3I0O A;  4PJM A;  2LOP A;  4YRK A;  4K0U A;  2WP9 A;  2DXU A;  4H2W A;  1QLB A;  4HWC A;  1JJC A;  4U2Z A;  4AH6 A;  3MEY A;  4PK6 A;  1HF8 A;  2ODU A;  3HY1 A;  4XBF B;  4WBO A;  1WPY A;  3I9W A;  2DKG A;  2CJB A;  4XU1 A;  5FY0 A;  3AAI A;  4ILU A;  3NEN A;  5J2U E;  3PU8 A;  3HXU A;  5LBQ B;  4XTU A;  3UTK A;  5LG3 A;  3RI5 A;  2E8I A;  2WB5 A;  1MIV A;  1HTJ F;  4P73 C;  2M67 A;  4ZTZ B;  3K1S A;  5LOV E;  2MPK A;  1X55 A;  3NZP A;  2WWU A;  3DJB A;  3CWZ B;  1EQR A;  3PUA A;  2HNI A;  4ZIB A;  4YHJ A;  4OX9 T;  2XQA A;  2YU2 A;  3PUZ F;  4HFI A;  4TWA A;  5JTG A;  5LG4 A;  4HFB A;  3Q5D A;  2W61 A;  3JAF A;  2KLQ A;  5EK3 A;  3ZT7 A;  2I4O A;  3HXX A;  2V5C A;  2CGH A;  4DR5 T;  3PUS A;  2LJL A;  5AQN B;  3HXW A;  1ZHC A;  4H2V A;  3RYI E;  11AS A;  3VQV A;  3K8P C;  2CJA A;  2NWB A;  2ZM2 A;  4IIJ E;  2Y48 B;  2LSI A;  4H2S A;  1RIQ A;  2L8K A;  3ONX A;  1MMG A;  4HFV A;  3PU3 A;  3AE3 A;  3RL6 A;  5KX5 E;  5E3I A;  2LHN A;  4A56 A;  2VK9 A;  1EVK A;  5AQH B;  3HFV A;  1I94 T;  4TVA B;  3AVR A;  2RP4 A;  1B7T A;  4ERR A;  2VL8 A;  4B3S T;  5FKY A;  2E5A A;  4OLF A;  4G63 A;  3VR9 A;  3ZJ1 A;  3UU4 A;  1BIB A;  5FVK A;  2LKG A;  3RF1 A;  3RYC E;  3RIU C;  4EOZ B;  4EXT A;  4LMK A;  2NW8 A;  4X66 T;  2XQ3 A;  1YKH B;  2UXD T;  4K86 A;  3V8K A;  2PFV A;  3GMI A;  1NJ8 A;  3SS1 A;  3UFE A;  3EDU A;  3P8T A;  5CA1 E;  2DTI A;  2XSB A;  4ZZC A;  3C64 A;  2VUR A;  4QH4 A;  5JDN A;  1VCT A;  3C98 B;  2VKO A;  5GON E;  2XUE A;  3A5X A;  2H3R A;  4HFE A;  4RQF A;  2C0S A;  4UVB B;  5AQV B;  3ZMS B;  4IE6 A;  4X1Y E;  3PUV F;  2ZIM A;  4YTM A;  3HFZ B;  4KR3 A;  5LGN B;  2QVA A;  2VQE T;  5BMV E;  4P0A A;  1SES A;  2ARS A;  12AS A;  4K0K T;  2LSK A;  4WNK A;  4Z8X A;  2LSJ A;  4CI1 B;  2VVS A;  5HYA A;  1BR2 A;  2WS3 A;  4TQF A;  5EK4 A;  2E9X D;  2JQ9 A;  4JI4 T;  2IHR 1;  4PFP A;  1Z7N A;  2LSG A;  2JMK A;  3A8Y C;  4PJN A;  2DU5 A;  4LVK A;  3EAB A;  4JBW F;  3NBX X;  4O8S A;  5FXW A;  1IL2 A;  4ILC A;  4OYJ A;  4YRJ A;  3AA1 B;  4OHF A;  5JDG A;  4DV1 T;  3EFR A;  2YDR A;  3ZCJ A;  1YGB A;  3FZH B;  3VRA A;  5AQK B;  1WYD A;  4X62 T;  1NNH A;  3NEL A;  4NIQ A;  3HFZ A;  4YRM A;  2CWO A;  4CI2 B;  5ADX L;  3ZMU B;  4H2Y A;  5EZY E;  3EHZ A;  4QXH B;  3HKC E;  4HWP A;  3AE8 A;  4HE8 A;  1FJG T;  4H63 H;  4HEA A;  4PK5 A;  4TX5 A;  1YFT A;  5AFU L;  1NJ5 A;  3V8J A;  5HGQ A;  5LMN T;  4LF8 T;  2RHQ B;  2BDE A;  2CXD A;  3HI2 A;  1WNL A;  1VQZ A;  3HKE E;  3TLS A;  1YQ3 A;  1FIO A;  3ZC1 A;  4GIW A;  2CBJ A;  1BR0 A;  1B76 A;  1WQW A;  4Q25 A;  2X67 A;  1YQ4 A;  3HRI A;  3K3Q C;  4PFO A;  4CS2 A;  4H63 V;  3H37 A;  2J47 A;  4YHH T;  5ABE A;  2YU1 A;  4AQF A;  3SFE A;  3IAL A;  1EVL A;  2K48 A;  5DJQ C;  3MF2 A;  5AQS B;  4CH6 A;  3UUN A;  4EV6 A;  4QH1 A;  4JI2 T;  4U2Y A;  5L3F B;  1I6Z A;  4EEB A;  4HWD A;  3RKY A;  2RHQ A;  4CS4 A;  1N33 T;  3HKB E;  2GK9 A;  4L0R A;  1ASZ A;  3L09 A;  3ZEF B;  2E5V A;  2XHE B;  5CB4 E;  3IKM B;  2BKP A;  3P4R A;  3KV5 A;  4O4J E;  2W00 A;  2BZB A;  2ZMA A;  4EZ4 A;  1WLX A;  1H4T A;  5FVL A;  2I4N A;  3FHN A;  3ZYM A;  3ONL C;  3AEF A;  3JC6 C;  1MMA A;  4ZZB A;  1ZOY A;  2LEH A;  3V5U A;  5AQO B;  5F3J A;  3VQW A;  1IBK T;  3RYF E;  3QO7 A;  2KXP B;  2YDQ A;  5DQV A;  4B3M T;  1BR4 A;  2WM9 A;  3CX8 B;  4PHC A;  3WI3 A;  2XAQ B;  3CQC B;  3KV4 A;  4DBQ A;  4HWT A;  1EOV A;  4IL9 A;  4C91 A;  1YFR A;  4YCU A;  4H9P C;  5ABG A;  3P4P A;  4WJ3 M;  2BKN A;  2D2S A;  3UUL A;  4PJJ A;  2BS3 A;  4L9I A;  5LJN A;  5L3B B;  1NJ6 A;  1ZEE A;  1L0V A;  3NET A;  2K9A A;  2I6H A;  5LMU T;  2LLY A;  3CQG B;  1UX5 A;  3AE4 A;  4DV5 T;  5KDM C;  2OA5 A;  3QOF A;  4CH4 A;  4X5T A;  4QKN A;  4V1A v;  5J1G A;  2X9H A;  5L4H A;  2A3D A;  4YY3 T;  3GN5 B;  2JIW A;  2UUC T;  3KDS E;  2AMC B;  4PK4 A;  2YDS A;  2CBI A;  1SA0 E;  3EDV A;  3PJA J;  3M4P A;  5F5W A;  4O2B E;  1D0X A;  3ZKR A;  4DR1 T;  4P0B A;  5L2L A;  1ATI A;  3HKD E;  3PTR B;  2EJF A;  1XNR T;  5HCM A;  2ACZ A;  3A31 A;  4OYK A;  2YN6 A;  2DI4 A;  4YT0 A;  2PME A;  2Q5H A;  3HTZ A;  1H7C A;  4RDX A;  4HT4 A;  4EYU A;  3RUX A;  2RA1 A;  2WCA A;  1XDO A;  2X9X A;  1IBM T;  2Q9Q B;  4F8H A;  1N9W A;  4DV0 T;  3VKH A;  5CFB A;  2M6B A;  4UV9 B;  3GN5 A;  2ZT6 A;  3E9H A;  2DTO A;  4TV9 E;  2AMC A;  2DZC A;  1KNR A;  5AQM B;  2CMR A;  4CN4 A;  1M62 A;  4P71 A;  4ISS A;  4YCV A;  3ICA A;  3PUW F;  3K3O A;  3V7R A;  3E0Z A;  4TWH A;  4HWR A;  1C0A A;  2ZNJ A;  4IDO A;  2HHH T;  2UXX B;  4P3N A;  2MAW A;  2C5J A;  4YRI A;  2XJ7 A;  4YRE A;  3ZT5 A;  4JI6 T;  2CXF A;  1HS7 A;  4U33 A;  3UGT A;  1NAF A;  2JQQ A;  3MQZ A;  3LK3 B;  4JI8 T;  2Q9Q A;  1WLE A;  2V8S V;  2C8M A;  3M3Z B;  4CN1 A;  3KFU A;  5JRE A;  3RH3 A;  1NYR A;  2C5K T;  4TTV A;  4AQF C;  4GKK T;  3FJP A;  4H9Q C;  3I7F A;  2IW5 B;  1GQE A;  2Q5I A;  1SET A;  4DR7 T;  4J15 A;  4UR9 A;  4M1P A;  1QF6 A;  4H2X B;  1XDP A;  2ALY B;  4XEO A;  3ANW B;  5H6Q B;  4AKL A;  1KF6 A;  4HTE A;  2DTH A;  2VQF T;  3F2E A;  2L3L A;  2KZ7 B;  1W9R A;  4DR4 T;  4UEL A;  4NXM T;  2HH7 A;  3I1A A;  5LJM A;  1Z0P A;  4JI3 T;  5FNV E;  2IAK A;  3T1H T;  5LGT B;  2ZIO A;  2AE9 A;  3A7A A;  4HWO A;  4HN9 A;  3H3A A;  3SOL A;  2N1G A;  1XWM A;  4CXW A;  2WQY A;  5AQI B;  5LHG B;  1EZ3 A;  1UUR A;  4UPA A;  2IDO B;  4UP9 A;  4DQ2 A;  2XSA A;  4H2X A;  4DPG A;  1MMN A;  2XQ4 A;  4BA9 A;  2ALY A;  3EI0 A;  3ANW A;  4ILB A;  3PUQ A;  4DR6 T;  3RRC A;  3MF1 A;  2NR4 A;  2W63 A;  2FJB A;  4XEM A;  2V6Y B;  5HXC A;  5KNN A;  2LOS A;  1E1O A;  2LM9 A;  4AIU A;  4H02 A;  3SRZ A;  1GGM A;  1E1T A;  3N9N A;  2YOE A;  1IBL T;  1QUU A;  1NJ2 A;  4KHZ F;  4LF9 T;  4P75 A;  1X01 A;  4XZC A;  3PUY F;  1NEK A;  2JQK A;  1HX8 A;  2VKH A;  1SUM B;  3C51 A;  4IRE A;  1VRB A;  4E7Z A;  3LSS A;  1OXZ A;  3LJC A;  5AQG B;  3O4X E;  2V6Y A;  2ES0 A;  3CML A;  3ZMT B;  4FI5 A;  2W66 A;  3E9I A;  2YK0 A;  2CHN A;  3FZF B;  4QHO A;  4LF6 T;  1BBW A;  5HXE A; 
#chains in the Genus database with same CATH homology
 1X56 A;  4YP0 A;  4YRJ A;  4YRG A;  2ODR D;  2ZZF A;  3EFR A;  2DDZ A;  1YGB A;  3BFM A;  2ZT8 A;  1WYD A;  1NNH A;  3NEL A;  3HFZ A;  4YPF A;  4YRM A;  1PYS B;  4K87 A;  4OP0 A;  2E10 A;  2ZZG A;  4XU0 A;  4P73 A;  3W3S A;  4H2Y A;  4O2D A;  4Q6G A;  4HWP A;  1B7Y B;  2G4C A;  1YFT A;  4NCX A;  1NJ5 A;  3V8J A;  3BJU A;  2FYK A;  3HY0 A;  5HGQ A;  4XTW A;  1E22 A;  2RHQ B;  3UFG A;  1WNL A;  1VQZ A;  4P71 C;  4YDQ A;  1B76 A;  4RQE A;  1WQW A;  2E65 A;  4HVC A;  4YRP A;  3HRI A;  1LYL A;  2Q7G A;  4XTV A;  4CS2 A;  1X54 A;  5ELN A;  3RGL A;  2CJ9 A;  2ZT5 A;  3A5Y A;  2P0L A;  2DJZ A;  1PYS A;  4YRQ A;  1SRY A;  3A32 A;  1EVL A;  3IAL A;  4L87 A;  3MF2 A;  1B7Y A;  2Q7E A;  4CH6 A;  4CS3 A;  3VQY A;  5C52 B;  2DU7 A;  2NS6 A;  3RKX A;  3ERR A;  4P72 A;  4XTZ A;  3RKY A;  1EIY B;  2RHQ A;  4CS4 A;  1HC7 A;  1ASZ A;  4XU3 A;  2J3L A;  3IKM B;  2P5I A;  3LSQ A;  4LVI A;  2ZGW A;  4YRR A;  2ZXF A;  4XU2 A;  2DQ3 A;  1H4T A;  2I4N A;  4LVJ A;  2ZZE A;  2PMF A;  4YRL A;  4TVW A;  3L2Z A;  4H2U A;  2DZ9 A;  3VQW A;  3QNE A;  3QO7 A;  4P74 A;  1G51 A;  2E1H A;  2J3M A;  4UP7 A;  4TVY A;  3TEH A;  4PHC A;  3NEM A;  3HXY A;  4HWT A;  1EOV A;  2IY5 B;  1YFR A;  4LVM A;  1EIY A;  1G5H A;  2ZR3 A;  1WQ7 A;  3WQZ A;  4YCU A;  2E3C A;  3QTC A;  4WJ3 M;  1B70 B;  4HA8 A;  2DXT A;  2I4L A;  3L4G B;  1L0W A;  1ADJ A;  2ZT7 A;  4CH3 A;  1G5I A;  3QO8 A;  3L1A A;  2QHS A;  3TEG A;  3IKL A;  1USY C;  1JJC B;  4YCW A;  3UGQ A;  3HXZ A;  2EWN A;  5C53 B;  1NJ6 A;  4G84 A;  3P8V A;  3NET A;  2C7I A;  4LNS A;  4X5O A;  3DSQ A;  4CH4 A;  1ASY A;  4XTX A;  2ODR C;  2E64 A;  4P75 C;  5K1P A;  5C51 B;  4KR2 A;  2ART A;  2IY5 A;  1H4Q A;  2XTI A;  2QHU A;  2AMC B;  1BBU A;  4EO4 A;  1B70 A;  3REU A;  4E51 A;  1Z7M A;  2EAY A;  3L4G A;  4YRK A;  3M4P A;  5F5W A;  2DXU A;  1KOG A;  4H2W A;  3G1Z A;  3HRK A;  3R07 A;  1ATI A;  1X2H A;  2EJF A;  1JJC A;  4AH6 A;  3MEY A;  4ZTU B;  2I4M A;  3A31 A;  3TEH B;  2PME A;  3HY1 A;  2Q5H A;  1WPY A;  3HTZ A;  1QE0 A;  4YRF A;  1FYF A;  3A74 A;  4RDX A;  1HTT A;  4HT4 A;  3RUX A;  2DKG A;  2DEQ A;  2CJB A;  4YRN A;  4XU1 A;  2ZIN A;  2QHT A;  1N9W A;  2RHS B;  3NEN A;  3HXU A;  4XTU A;  1SER A;  4YRO A;  3RAC A;  4WF2 A;  3EFS A;  2ZT6 A;  3E9H A;  2DTO A;  4TVA A;  2AMC A;  2DZC A;  4P73 C;  4ZTZ B;  4P71 A;  4YCV A;  4BW9 A;  1X55 A;  3ICA A;  1EFW A;  3TUP A;  2CIM A;  3V7R A;  4HWR A;  1C0A A;  2ZNJ A;  3A5Z A;  4P3N A;  1E24 A;  2ZTG A;  3LC0 A;  4Q15 A;  1EQR A;  3OD1 A;  1BIA A;  2HNI A;  3PCO B;  4YRI A;  4ZIB A;  4YRE A;  4TWA A;  3UGT A;  3RIR A;  1X2G A;  2A8E A;  4P3P A;  3MQZ A;  3QO5 A;  1WLE A;  2RHS A;  3HXX A;  2I4O A;  2C8M A;  2CGH A;  3KFU A;  1KMN A;  1H4S A;  3HXW A;  3CMQ A;  4H2V A;  1NYR A;  3V8L A;  11AS A;  3VQV A;  4TTV A;  3FJP A;  1H4V B;  2CJA A;  2ZCE A;  3I7F A;  4KQE A;  1W66 A;  1HXD A;  2Q5I A;  1SET A;  4J15 A;  4H2S A;  1YFS A;  1QF6 A;  4H2X B;  2XGT A;  1RIQ A;  1B8A A;  2ALY B;  2DQ0 A;  4XEO A;  4P72 C;  4H2T A;  2DTH A;  1KMM A;  3RL6 A;  3PCO A;  2QHV A;  5E3I A;  2Q7H A;  1EVK A;  3HFV A;  3A7R A;  4TVA B;  4CH5 A;  4WJ4 A;  2E5A A;  4OLF A;  2ZIO A;  3A7A A;  4HWO A;  3V7C A;  1BIB A;  4UP8 A;  2E41 A;  4YRC A;  3RF1 A;  4XTY A;  3A7U A;  4YRS A;  4P74 C;  4YYE A;  2ZNI A;  2ZR2 A;  4UPA A;  3HXV A;  4UP9 A;  4DQ2 A;  4H2X A;  2EL9 A;  4K86 A;  1NJ1 A;  4YRT A;  3RKW A;  4DPG A;  3V8K A;  2ALY A;  1NJ8 A;  4WI1 A;  1USY A;  4BWA A;  4LVL A;  3MF1 A;  3P8T A;  4HWS A;  4XEM A;  2DTI A;  1NYQ A;  5KNN A;  4PG3 A;  1E1O A;  2AKW B;  3IG2 A;  4P3O A;  4H02 A;  2DVE A;  4K88 A;  2ARU A;  4RMF A;  1GGM A;  1E1T A;  4RQF A;  2EJG A;  1NJ2 A;  4P75 A;  1X01 A;  2ZIM A;  1YB3 A;  3HFZ B;  1J5W A;  4TQD A;  3REX A;  4KR3 A;  4G85 A;  5K1X A;  1SES A;  2ARS A;  12AS A;  1ADY A;  1WU7 A;  5ELO A;  3VQX A;  3UH0 A;  4TQF A;  3PZC A;  3LSS A;  3VBB A;  3P8Y A;  1Z7N A;  4EX5 A;  3E9I A;  2AKW A;  2DU5 A;  4LVK A;  3M4Q A;  3V7S A;  1BBW A;  2EJ9 A;  1IL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...