2E64A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
226
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 69
structure length 226
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e64A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e64A01
4CS4A 4C8QA 4LNSA 3UGQA 1PYSB 4RQEA 1NYQA 4HT8A 4M75B 3GIBA 3V8KA 1G5HA 4EMHA 1M8VA 4A54A 3RKWA 5LJ3d 3HSBA 4NOYA 1L0WA 4YRPA 1LYLA 1H4TA 1X2HA 3JCMg 1B7YB 4YRLA 1EVKA 2ALYA 5F5WA 4PJOB 1LOJA 1BBUA 4YRSA 3JCMP 1H4SA 5LJ3h 2EL9A 4CH4A 2AMCA 3INZA 4QVCA 3VQWA 4P71C 4M77C 2FB7A 2Y90A 4C92E 1YFRA 1B70A 4XEOA 4M7AC 1H4QA 3V7RA 3ERRA 2DKGA 5GAMg 2I4LA 3EFSA 4QVDA 4CH5A 2ZZFA 2IY5A 5LJ5g 2DVEA 3A5ZA 3RKYA 1HXDA 1I81A 1H641 4P3NA 4Q15A 4YRMA 3HY1A 3JCMh 1U1SA 3A74A 3QO5A 4M75A 4XTUA 4P3OA 5GAMd 5GAOl 3A32A 2RM4A 4C8QD 3BFMA 4EMGA 3QTCA 4P3PA 4P73A 5LJ5d 2ZNJA 2HNIA 5C51B 4EX5A 2AKWA 3JCMJ 1B7YA 2ARSA 2ZR3A 5GAMh 3JB9F 4PJOA 4N0AA 5LJ3j 4M77F 5LJ5h 2PMFA 4C92B 1FYFA 4M7AF 12ASA 3OD1A 3CMQA 1NJ6A 4XTXA 3FB9A 1SRYA 5GANg 2ZT8A 1YFSA 2P0LA 2DXUA 2I4NA 1ADYA 2ODRD 3HRIA 2YLCA 2PMEA 3G1ZA 4G85A 1H4VB 1WQWA 1ASZA 2P5IA 3RF1A 4M78E 3JB9G 4RDXA 3UFGA 4M77G 2VXFA 3JCMb 4TTVA 4J6WA 4X9CA 1MGQA 4M7AG 3SWNC 2JN0A 4TWAA 2QTXA 4DQ2A 1WYDA 4M75D 1W66A 5K1PA 4YRIA 4JLIA 5GANh 5GMKm 5GAMj 4M7AB 3M4PA 1QE0A 2DU5A 5LJ5j 1X56A 4C92A 4PJOD 4E51A 4YROA 2E3CA 1I8FA 3BDUA 4P74C 3VQYA 3JCMf 3HFVA 3QSUA 2RD1A 4H2XB 3KFUA 4P72C 1E22A 4M7DC 4CS3A 3SB2A 1QF6A 5LJ3g 4HT9A 2FYKA 4YDQA 3RUXA 3JCMX 1WPYA 2ZNIA 2K57A 2C8MA 4Y91A 1EOVA 4UP8A 4P71A 4UPAA 5GANj 3P8VA 4AH6A 1D3BB 5LJ5f 2ZXFA 1U1TA 3DSQA 4BW9A 4WJ3M 3FIFA 1N9WA 4HWPA 1Y96B 3HFNA 4NL2A 2RB6A 1LNXA 1WLEA 3QUIA 3JB9I 2RHSB 5E3IA 2DXTA 2ZT7A 4H02A 2CIMA 3AHUA 3V7CA 1E1TA 3ICAA 5GMKl 4C92D 4F7UF 1EVLA 3NETA 4M78A 4RCBA 3SWNB 1ADJA 2I4MA 4H2UA 1I4K1 4JUVA 4XU0A 1WU7A 2ARUA 4M7DE 4M7DF 5HGQA 2QHSA 4KR3A 3MEYA 2ZR2A 4H2XA 3JB9H 3RACA 1NJ2A 1YFTA 4MMLA 1USYA 1YB3A 4H2SA 5GANf 4PG3A 4F7UG 2Q7EA 2DQ0A 1PYSA 5GAN5 3HY0A 5DY9A 2ARTA 2Q7HA 1D3BA 4C8QC 3QO7A 4X5OA 4H2TA 4M7DG 3VU3C 1Y96A 4H2YA 2RHSA 2E10A 2DEQA 1Z7NA 2I4OA 4RMFA 2CJBA 5GMKe 3PZCA 2Q5IA 4L87A 3JCMW 4M77E 4M7DB 4YRCA 3E9HA 1JJCB 4XTZA 3SWNA 4J5YA 4M7AE 2ZGWA 4TQDA 4K86A 3LC0A 5GMKi 3IG2A 4M78D 5GAN6 2ODRC 3HXWA 1X54A 4XQ3A 4TVWA 2ZIOA 4EMKC 3QO3A 2E41A 2ZINA 4C8QF 3VQVA 2E64A 3IKMB 1M5Q1 4WI1A 1NJ1A 1B76A 4YRRA 2DQ3A 3BY7A 3TUPA 3A7AA 4YRKA 4PNOA 2VC8A 3RESA 4TVYA 3W3SA 4M75C 4PHCA 1ASYA 2DTOA 5GAOn 4V2SA 3L4GB 4M77B 3L2ZA 3IKLA 1IL2A 5LJ3f 2ZTGA 3P8YA 4XTYA 1X2GA 3BW1A 4C8QG 4M7DA 3JCMQ 3A7RA 1JJCA 4PJOC 4N0AC 5GAN4 1B34B 1E24A 2E5AA 2YLBA 4HA8A 1JRIA 4YRJA 4CH6A 2DTHA 4G84A 1G51A 3V8LA 1HTTA 3MF2A 4C8QB 4J15A 5CAIA 2EAYA 1E1OA 3M4QA 2E65A 3REUA 2DZ9A 1GGMA 2I2LA 3TEGA 3QNEA 4P75C 4YRGA 2QHTA 4YCWA 2RA2A 1NYRA 4RCCA 1G5IA 4M75F 1N9RA 4TQFA 3RIRA 4ZTZB 2CJAA 4JRIA 5GAN7 4MMKA 3HTZA 2QHUA 5GAMf 4K87A 3L4GA 4M77A 4BWAA 1BBWA 2EJ9A 2XTIA 4DPGA 4JRKA 4PJOF 4M7AA 3QO8A 4YRTA 4EO4A 5GAN2 5K1XA 3BJUA 4YRQA 4UP9A 1B34A 4YP0A 4H2WA 4EMKB 2RHQB 3M4GA 1KMNA 4YREA 1KQ1A 4M75G 1BIBA 4YCUA 4C92C 4KQEA 4F7UE 4XU1A 3A31A 1KMMA 1EFWA 2J3LA 1HK9A 1WQ7A 3WQZA 5LJ3e 5C52B 4PJOG 4WF2A 3IALA 5GAOp 3A7UA 2VXEA 1YGBA 1J5WA 2G4CA 3LSSA 4YRNA 3P8TA 3V8JA 1EIYB 2AKWB 1YCYA 2EJFA 5GAOr 3HXVA 4NL3A 2EJGA 3JCMe 3FJPA 3JB9D 3NEMA 4HWSA 2DTIA 3REXA 4O2DA 4C92F 4M77D 1NJ5A 4Q6GA 5KNNA 3JCMd 3UH0A 2EWNA 4EMKA 2RHQA 4F7UB 4M7AD 1B8AA 4WJ4A 2ZZGA 1SERA 5GAOq 4YYEA 3HFOA 3VBBA 3HRKA 1EQRA 3PGGA 3QHSA 5GAMe 3HXXA 3V7SA 2CJ9A 4H2VA 3HXUA 4HVCA 1SESA 1RIQA 2ZT5A 5C53B 4M78C 5LJ5e 3RL6A 2DZCA 2ZCEA 2ZZEA 4UP7A 4C92G 1KQ2A 1SETA 1LJOA 5GMKh 2QHVA 1EIYA 5GAN3 1X01A 4OLFA 4C8QE 3HXZA 1USYC 3JCMV 1HC7A 4OP0A 3NENA 3UGTA 2XGTA 4KR2A 1WNLA 4ZTUB 4XU2A 3PCOB 3TEHB 3RERA 2YHTA 1NJ8A 4P74A 5ELOA 4F7UA 4P75A 4XTWA 4YRFA 4P73C 3LSQA 2Q7GA 5ELNA 1JBMA 2DJZA 3EFRA 4ZIBA 4P72A 4M78F 5GANe 4RQFA 1C0AA 2J3MA 4HWOA 3VQXA 3I7FA 5GAN8 5GANd 1BIAA 3A5YA 4TVAB 3HFZB 4XTVA 4CS2A 3JCMc 2DDZA 1Z7MA 3L1AA 5I21A 3R07A 4HWTA 3RGLA 5GMKj 4NCXA 3HXYA 4CH3A 4X9DA 2CGHA 1X55A 3JB9J 1TH7A 3NELA 4M78G 4A53A 4M75E 3PCOA 2DU7A 4J6XA 3TEHA 3E9IA 2E1HA 4K88A 1KOGA 3RKXA 2ALYB 2C7IA 1I5LA 1NNHA 4XEMA 4XU3A 4M78B 2AMCB 1VQZA 4PJOE 4HWRA 4J6YA 2ZIMA 11ASA 2Q5HA 1B70B 1ATIA 4YPFA 3MF1A 4YCVA 5GAOm 2IY5B 1N9SA 4TVAA 2ZT6A 4M7DD 3HFZA
chains in the Genus database with same CATH superfamily
2RK2A 1U06A 3TSWA 3G4SA 4CS4A 4KUIA 2MWPA 3F70A 5KE3A 4HT8A 4M75B 4ELYC 1VQOT 4YTLA 1VQKQ 1RAEB 1WLPB 5IHIA 3GPLA 3HSBA 1BI1A 3MPUB 3NTHA 1L0WA 1X43A 4PJLA 4BUGA 3UF4A 1QW1A 4ORZA 4YRLA 1LOJA 2KT1A 1QLYA 2K2VA 2EL9A 5D7UA 1AWXA 2AMCA 3OMGA 3OS1A 3NGPA 5A0GA 2QA4T 4M77C 2FB7A 2QGFB 1YFRA 1X27A 1K73C 1B70A 1H4QA 2VVKA 4KULA 4M7AC 2WACA 5IXFA 2GF7A 3CCEQ 2HQXA 3A5ZA 3CC2T 4RTVA 1M2OA 2WSCE 4YRMA 1A0NB 1VQ6T 1BU1A 3BFMA 4EMGA 4P3PA 2LJ3A 1T0HA 1QP3A 2ZNJA 2HNIA 3ZEHA 1CKBA 1IRXA 3JCMJ 1B7YA 2A36A 1RABB 2F1LA 5I22A 3JB9F 3OYFA 5LJ3j 1YCSB 4M77F 4C92B 2H3EB 3CCRT 4M7AF 4ZN3A 1JXMA 4A4FA 3OD1A 4LDVA 1H3HA 3FB9A 1SRYA 2KRMA 2P0LA 2DXUA 2I4NA 2FO0A 2O4XA 4J7IA 5M9OA 3CCLQ 2AZVA 2P5IA 3RF1A 1D1CA 2QEXT 4RDXA 2K5FA 1TXQA 3UFGA 2PZ1A 1PC0A 2M0YA 1P92A 4DQ2A 1TOVA 2O31A 3VV0A 1VQ4T 5FRMA 5DLOA 3QBYA 5K1PA 2LX9A 2A28A 4JLIA 4YRIA 4QT7A 5GAMj 2RQWA 3M4PA 1IB8A 5LJ5j 1KD1R 1ZBXA 4PJOD 2YWWA 4JJBA 1Q7YU 4E51A 3VS1A 4ZNXA 4IUVA 1G3TA 4BACA 3FEOA 3OQ5A 1I8FA 3BDUA 2RI5A 1SEMA 5KYUB 5FU7C 2CZ1B 3EHRA 2EGEA 4BY6C 3QSUA 3VJPA 4H2XB 3KFUA 1YIJA 1WA7A 2R5MA 4JZ4A 1OPKA 1E22A 4CS3A 1QF6A 5LJ3g 4HT9A 4F04B 4J9CA 1ZHIA 1WPYA 2AIRB 1YITT 2K57A 1H92A 2C8MA 3CCUA 1VQPT 2OTJA 5GANj 1V29B 2KROA 3FIFA 1Z9QA 3OMCA 1N9WA 1LNXA 2HQHA 3J81E 3QUIA 3KXTA 1WI7A 2ZT7A 3QWYA 1KD1C 1VQ9Q 3G4ST 3AHUA 5DM7R 4MZTA 1S1NA 1KHIA 4RCBA 4OB3B 1ZBJA 2DFUA 1ADJA 4JJNK 4IUQA 4JUVA 4XU0A 5GJWB 1M27C 2HAXA 4A4HA 5KYYB 1UGSB 3HRSA 3LWHA 4OMMA 2QHSA 3RACA 2HD0A 2PNIA 4GLKA 1VQNT 4YREA 2AHJB 5C6SA 2JS0A 2CZ6B 2K79A 1HD3A 1NG2A 3X24B 4QVZA 4J7FA 4FSXA 2EGCA 5GAN5 3BE3A 2ARTA 4C8QC 2OI3A 3QO7A 2HKNA 3URGA 2XU8A 1YJNQ 1Y96A 4FYWB 2RHSA 4AFUC 4QKUA 1Z7NA 2J6FA 2K5IA 1NEBA 2NUPB 1QMCA 1RAFB 2D0QB 5A2QE 4XTZA 3VRYA 3PMIA 2QQBA 2HSPA 1UG1A 3EFOB 2QK0A 2YUPA 3M0PA 1YHQA 3FJ5A 3MP8A 4DBFA 2DPPB 3HXWA 3SEMA 1X54A 4KGZB 2AZSA 2DLPA 3CMEA 2E41A 2ZINA 4C8QF 2E64A 2KXDA 4YRRA 3I5RA 1KIKA 1Y57A 2YUNA 1K0XA 4RTXA 3QDRB 3TUPA 4RTWA 3P8DA 3W3SA 3CCMT 3LYIA 4PHCA 4LN2A 3L4GB 4M77B 1NYFA 4L5GA 4B9XA 3L2ZA 3IKLA 2ZTGA 2MPXC 2EFIA 2DNUA 2ESWA 1HYOA 2VKNA 4M7DA 3JCMQ 2E5AA 4PJJA 1N6AA 1Q86R 1ZUYA 4G84A 2D0NA 2L3QA 1HTTA 5KE2A 4ESRA 2DRMA 4RTYA 3CCVT 2KRSA 1G3SA 1VIEA 5LL6S 1Q81U 2J06A 3QNEA 3CEYA 3CCQQ 2HZYA 2EVRA 3PTAA 1RLPC 1EIFA 1E6GA 4TQFA 2OJ2A 3RMSA 4CRIA 1PCXA 5CKEA 1YJWQ 5GAN7 2CJAA 2DXBA 3CQTA 2M0OA 4A4EA 2ENMA 3HTZA 1YNZA 4BWAA 1GBRA 2XTIA 3P8BB 4HCBA 4ATOA 4YRTA 1YIJT 2RNAA 3PMTA 2XIDA 3CPFA 3BJUA 4YRQA 1WZOA 3VUZA 3M4GA 2CT4A 1Z9ZA 1KQ1A 2O9SA 2P4TA 1KMNA 1BIBA 3GNGA 4YCUA 2K6DA 1OQKA 4IUTA 2EBPA 1WYXA 2YRCA 3A5ZB 3CCUT 2OTJT 3M0QA 1GL5A 1EFNA 2A0FB 3A31A 1KMMA 3CMAQ 1MHNA 1HK9A 1QKWA 1WQ7A 2ZAEA 4DA4A 2D9TA 2FZGB 4WF2A 3IALA 1YGBA 1EIYB 3HL8A 2NYSA 2FZCB 2XDBA 2HQEA 1M3AA 2X4YA 2XICA 3CBMA 2EJGA 5L8RE 3G1JA 3NEMA 3KUFA 3REXA 2DTIA 5FU7B 4BE1A 4Q6GA 1X2KA 3NTKA 3UH0A 3M59A 4EMKA 2RHQA 1QVPA 4WJ4A 2CP7A 2M1HA 1SERA 5GAOq 4DBQA 1AT1B 2XMFA 4YYEA 3QG1A 3QWXX 3VBBA 3C94A 5I11A 3ZL7C 1GCPA 1BCMA 4M78C 3RL6A 2ZZEA 2K4YA 2LJ0A 1WXBA 2O9VA 4IKFA 2BZ8A 1WJSA 3TU4K 1ZA2B 4FW2A 5GAN3 1X6OA 4X1VA 3EHQA 3QIIA 1HC7A 4OP0A 3UGTA 1YHQT 2JTFA 4XU2A 1X69A 1ABQA 4Y92A 5CO7A 1WHGA 4F7UA 3CMET 1H3ZA 4P75A 5ELOA 3LSQA 4Y28E 3NFCA 4M78F 4Z8AA 1C0AA 2EPDA 4LDYA 3I7FA 3A5YA 4TVAB 1PSEA 1OYXA 3JCMc 5KH6A 2D8JA 3OBWA 2DYBA 3SDZA 5GMKj 4NCXA 2AT1B 3SD4A 5IHKA 2X4JA 2XKOC 1UHFA 3CCSQ 4IUUA 4M75E 2JM9A 1OI1A 5IHNA 3U23A 2C0TA 3TEHA 2H8HA 4CI0C 2MI6A 4K88A 1KOGA 1TU0B 4KBMB 4XU3A 3CC4Q 4A4GA 1GRIA 1VQZA 1WFWA 1K8AU 1MUZA 2KYBA 1WXUA 4HWRA 4E2FB 2DE0X 2RHYA 2FRWA 2CSQA 4PKCC 2DX1A 1PD0A 2VB6A 4VUBA 4YPFA 4HKEA 3MF1A 5GAOm 2ZT6A 4M7DD 1ZX6A 3EGXB 3I55Q 4QQGA 4DEXA 4BD3A 1TUDA 4JS5A 5KCOA 3GIBA 1Q82R 1G5HA 1M8VA 5CVIA 2CZ0B 3RKWA 5LJ3d 4MDXA 4YRPA 1N5ZA 5L23A 2KBTA 1MMNA 3E2UA 1H4TA 3O5ZA 5KYNA 2QQ9A 3RR6A 4J9EA 3CCJQ 3M55A 5F5WA 2V8IA 2NUTB 4PJNA 4BI8B 3R6NA 1BBUA 4YRSA 5LJ3h 2ATCB 1KQSP 1FX7A 2GTOA 3H0FA 3VQWA 4P71C 4Z02A 1M90R 4C92E 3C12A 3GP8A 1VQ8Q 2DKGA 4QVDA 2ZZFA 1Q7YC 2IY5A 1FMVA 2KXCA 3HPWA 2DVEA 2EYYA 1I81A 2H3JA 1SHFA 4P3NA 3JCMh 5C0MA 4HVWA 1ZSZA 3M9QA 5GAMd 5GAOl 3GOXA 2F2XA 3VRZA 3QTCA 4P73A 5LJ5d 1ABOA 1SPKA 2MIOA 2CUBA 4EX5A 1KK7A 1AVZC 3NMZC 3TCJA 1VQ5A 1RI9A 1YP5A 2ABLA 2ARSA 5GAMh 3OYBA 4PJOA 3L2VA 1S72T 1CKAA 1O75A 5LJ5h 1C6VX 1FYFA 2O2OA 3NHNA 2K7AA 3CMQA 2W0ZA 2KAFA 4XTXA 2IPOB 2HEQA 3ER0A 2KRNA 1ADYA 2MCNA 3HRIA 3G1ZA 1H4VB 3CD6Q 1WQWA 5FWCA 1ASZA 4AT1B 1RAIB 1VQLQ 2BTTA 2LT4A 2ROLA 2YRVA 3JCMb 4TTVA 1M2VB 1FYNA 2HDAA 2K2MA 1ZUKA 1YJ9T 2JN0A 1PG5B 2F2VA 5CQXA 1AD5A 2LTOA 2X9HA 5HKCA 4M75D 3PT9A 3RBBB 2CZ7B 5GANh 2E6ZA 2DETA 2GFAA 4F17A 2DU5A 5IN1A 3ULRB 2VWFA 2JMAA 2XK0A 2O01E 2O88A 2ZCFB 5DLQE 2K3BA 2BZYA 3C0CA 1Y71A 4RKUE 4C0GA 3JCMf 4RTTA 1K73R 3HFVA 1VOMA 4M4ZA 1WXTA 2DL5A 2J05A 5FU6B 4E7LA 2EYWA 2FYKA 4YDQA 3CXCP 3MO8A 3RUXA 3UA6A 1VQ9A 1VQMQ 4JJDA 4Y91A 4UP8A 4UPAA 4BI3A 1D3BB 2XG8D 5LJ5f 3ME9A 4BW9A 1MMGA 5IAYA 2A3LA 1W2BA 3EGDB 1WHLA 3JB9I 1RAGB 2RHUA 3CC7A 4E7IA 2CIMA 3M53A 3V7CA 4RUGA 4C92D 2P84A 2M16A 3SWNB 3E1SA 1IHVA 2EQIA 3G71A 1WU7A 1X75C 4IUPA 1VQOQ 2ARUA 3MEAA 2ZR2A 1CSKA 1NJ2A 1YJNA 4ELZC 4X34A 1JU5C 1USYA 1YB3A 1U5SA 3I56A 5GANf 1YWPA 3LH0A 4F7UG 3MQZA 4E7KA 1Q81C 2Q7HA 1JEGA 2RK1A 3HRUA 2LQKA 4H2TA 2QA4Q 1V76A 4H2YA 5AT1B 2KEAA 3VS2A 1M3BA 1GBQA 2R58A 2CJBA 3JAME 3CC2Q 5FW9A 4M77E 3H41A 4YRCA 3E9HA 2PQWA 3D7SB 8ATCB 4ZGDB 4M7AE 2YDLA 1VQ6Q 1VYVA 2ZGWA 3TQ7P 4DOWA 3LC0A 2ZPEB 1WHKA 2HKQB 3EGUA 4R56A 1GFDA 2ODRC 1VQ5T 1OZ2A 1PSFA 4TVWA 2ZIOA 4HCKA 4JS4A 4AG2C 1MV0B 4LUEA 1B76A 3CCRQ 1K0SA 2L3PA 4PFPA 2DMOA 1UDLA 2M51A 2ED0A 3A8MB 3G7ZA 3LLRA 5GAOn 2PU9B 4V2SA 3L2UA 1X6BA 1UE9A 3P8YA 4OB1B 2QEXQ 2JTMA 2LT1A 1UJYA 2V26A 1JJCA 2YLBA 3REAB 2GFUA 4HA8A 1JRIA 4MZMA 2RQRA 3V8LA 4JDSA 5D6XA 3MF2A 2LCLA 4J15A 1VQ4Q 1K1ZA 2EAYA 1OULA 3REUA 1GGMA 1SSHA 2LJ1A 3LGLA 3TEGA 3GLXA 2OAWA 4YCWA 2RA2A 3C95A 3OYNA 2FZKB 5KYXA 2JVVA 2V8JA 1NYRA 4Q5WA 1N9RA 3RIRA 1AWJA 2DAQA 4ZTZB 1UGRB 4PLIA 2CREA 1YN8A 2QHUA 1BBWA 4DPGA 2L8DA 2QAZA 4IIOA 3CMAA 2LRQA 2BIVA 3VS4A 5GAN2 4D6WA 5AYFA 1FMWA 1B34A 4H2WA 3M0TA 3HTRA 3VS7A 4QQDA 1T3SA 1YITQ 3HHTB 4KH1B 2MF2A 1VQPQ 2FRYA 3WQZA 2DIGA 1QP2A 2HL3A 4PJOG 1UGQB 3CC7T 4L6V5 1T3LA 5GAOp 1RUWA 2VGNA 2BZXA 2OTLA 3P8TA 1RL2A 3M57A 3G4SQ 1YCYA 4DEYA 3G6EA 3A8HB 3CPWP 1GFCA 1MNEA 3G71T 1BK2A 3I35A 5GAOr 2AKLA 3HXVA 4NL3A 3VS5A 3FJPA 3JB9D 1NJIU 3WVEB 3H6ZA 4M77D 4FYXB 1VQNQ 4M7AD 1VQ7A 3I56T 2A37A 2ZZGA 1FWZA 2DVJA 3S3OA 2GQVA 3LH5A 1DJ7B 3R6OA 1IO6A 2DBMA 3HFOA 2JNGA 3HXXA 4OMQA 3A1PA 1KHCA 2CJ9A 3HXUA 1IREB 2ZPGB 2X4WA 1K8AC 2ZT5A 1I1JA 3OW2A 2M02A 2EKOA 1SETA 5GMKh 1G83A 2KMTA 4C8QE 3M0RA 4ZTUB 2EIFA 2QQSA 4FT2A 1I07A 5D6YA 3QXEB 1KQSA 3RERA 1NJ8A 2FPFA 4N4IA 4P74A 1NPPA 3PVQA 4ZTFA 1ZQ1A 1W2BP 1K9AA 2J6KA 4ZIBA 4P72A 3VS3A 1G2BA 3A8OB 2J3MA 4OGCA 1PKTA 1UUEA 5GAN8 2ZPBB 2COYA 1BIAA 4OMOA 3ASKA 2FG0A 1B7TA 5FRNA 3HFZB 4CS2A 1KQSS 2LC4A 3CCMQ 1Z7MA 4LVLA 1JQQA 3R07A 4CH3A 2CGHA 1X55A 2JMCA 1TH7A 1D0XA 2SEMA 1YWOA 5CQYA 3PCOA 4K11A 3OYEA 1YFNA 2B8AA 4J6XA 3E9IA 2R57A 2C7IA 5CIUA 1I5LA 4XEMA 2ECZA 3CCVQ 4JZ3A 1C1AA 2DD4A 2QI2A 2AMCB 3THKA 1BB9A 2DD5A 4J6YA 3PNWC 5GJVB 1AWOA 1B70B 3VKIA 4EPCA 2BE9B 3EG3A 1Y0MA 3PVLA 5CCAA 1N9SA 2RHZA 3ZFJA 3OYIA 4LNSA 2FPDA 2P0QA 3UATA 4AFQC 3PIOA 3CCJA 4WTOB 1QKXA 1NYGA 3V8KA 3VUBA 1YIJQ 4A54A 2PUOB 4NOYA 4AG1C 2HCKA 4ANJA 1B7YB 4LVMA 1WGSA 1EVKA 2ALYA 3CCUQ 1YI2A 3A8GB 2PVDB 1UHCA 3EG1A 3JCMP 2OTJQ 1H4SA 2RJFA 4CH4A 4PK4A 4ME7A 1ARKA 2MAMA 2HL5C 2CS7A 2OTLT 2PTKA 2Y90A 3V7RA 3G6ET 3GNFB 2O4XB 4CH5A 4LD9K 1NLOC 3RKYA 4HT4A 4D8DA 2P0PA 1H641 1M1GA 4KGVB 1NLPC 2GCXA 4EIKA 1U1SA 2XI9A 3CXCA 4C0ZA 3QO5A 4M75A 4XTUA 4RTZA 4BB7A 4P3OA 2ZPIB 4C8QD 3EH2A 1TS9A 1VQ7T 1U3OA 5A0DA 5CR2A 2DA9A 3TREA 1KC8U 1SRLA 1PKSA 5FU6C 1T0JA 4N0AA 1YBYA 2QDLA 3Q1JA 3CXCS 12ASA 1KFZA 2JXBA 3MCAB 1NJ6A 1Y7XA 4UC4A 3QPHA 1X2QA 2QASA 2YLCA 2ROTA 4G85A 3DLLA 3MEVA 2E12A 2E4HA 3IQLA 2KR3A 4M78E 1BYMA 4TVRA 1ZA1B 2XDDA 5KYWA 2VXFA 1YHQQ 1GXIE 4X9CA 2K9GA 2RF0A 2NUZA 3SWNC 2QTXA 1WYDA 3CMEQ 1LVKA 1W66A 5IH2A 2VASA 5GMKm 1X56A 4C92A 1WHHA 1V1CA 1BCOA 1M4ZA 4FSSA 1D1BA 4YROA 5CKBA 2E3CA 3OSSC 3QJYA 4PFZA 4DBRA 1OU9A 1RLQC 2PUKB 4GBQA 2ED1A 1G5VA 3VQYA 1AOJA 4MDWA 4ZGJB 2A7YA 2NLUA 2VUBA 1VQKA 1Q7YR 1WDXA 1M30A 3AT1B 8AT1B 3DB3A 4II1A 1XTDA 2EQKA 3OW2P 1EX4A 1AHJB 2V1RA 1ZSGA 1QVFA 1EOVA 4P71A 2CP0A 1TTHB 4LDUA 1M1KU 3P8VA 4AH6A 1M9SA 1KG1A 2DEUA 1HJDA 1Y96B 2QXFA 3HFNA 1Q95G 2P4RA 1WLEA 1JJ2P 2RHSB 1K9MU 2DXTA 4H02A 1NE8A 3CCEA 1UB4A 1E1TA 5GMKl 2LCCA 4QW2A 3UA7A 4F7UF 4Z89A 1EVLA 3E9FA 5KYUA 4L59A 2I4MA 5HGQA 2B86A 3MEYA 2CP5A 4OVAA 4H2XA 2DRKA 4OMLA 3QYHB 1N8RU 4MMLA 4MZPA 1YI2T 2AKKA 3S3MA 2DL8A 2GGRA 1X6GA 1E6HA 1TUCA 4PG3A 4J9FA 2Q7EA 2DQ0A 1PYSA 2JTEA 4WCIA 5DY9A 2JJ9A 2AK5A 4LE9A 4X5OA 2RO0A 3ZBDA 4M7DG 2ZPHB 2WSFE 2FEIA 3S3NA 4J9GA 4NS5A 3C4SA 2MOXA 2E10A 2RJDA 2CSIA 2RI3A 4RMFA 2QQRA 3PZCA 2Q5IA 1IGUA 3JCMW 3CCLA 2FL7A 4M7DB 1SG5A 3OYLA 2YT6A 1NJIR 4TQDA 4K86A 3CBPA 5GMKi 3DB4A 3IG2A 5KYYA 3CCRA 4M78D 5GAN6 3NTIA 4F14A 4XK8E 4E7HA 1AZEA 1UFFA 2EQMA 1FXXA 3QO3A 2M9UA 4C5HA 2DILA 3E9GA 2EKHA 3J80E 3IKMB 1S72Q 4WI1A 2YSQA 1W1FA 2LQ8A 3CPWA 1NM7A 1R77A 2LQNA 2KY9A 2DQ3A 3BY7A 2CP2A 3A7AA 1Q86U 4PNOA 2VC8A 3RESA 5HK0A 4TVYA 3OYYA 2IVWA 4BI4A 2CH4A 5A0LA 5KCHA 2F5TX 2IIMA 2L5QA 1WJQA 1IL2A 5LJ3f 2NUPA 2BUDA 2JOYA 3GBQA 1VQ4A 1X2GA 2X51A 3BW1A 4EDUA 3A7RA 1IZ6A 2YXYA 1K76A 4PJOC 3OYAA 3CPWS 1E24A 3EFOA 1GCQC 2MK5A 3X26B 1NJIC 2DTHA 1YJ9Q 4FL6A 3VS0A 2RQVA 3MKDA 3M4QA 3OYMA 3QDFA 2K3XA 2W10A 2RPNA 9ATCB 3BDLA 2G6FX 2COWA 2F5KA 4ZN1A 4RCCA 1G5IA 4FU6A 2JT4A 2CDTA 2QGGA 4A4KA 4E6RA 4MMKA 1BI3A 5GAMf 2QDYB 3QKJA 4M77A 1Q81R 3L4GA 2EJ9A 4OMPA 2FHDA 4PJOF 4M7AA 1VQKT 4EO4A 1C0MA 1RI0A 4RTUA 5K1XA 1WHMA 2HBPA 4UP9A 4YP0A 4EMKB 2RHQB 5HCKA 2EQJA 4M75G 4J9HA 4N4GA 4KQEA 4FW1A 1EFWA 4ZTJA 1D09B 5HK3A 5LJ3e 5C52B 2Z0WA 1PRMC 2J6OA 3A7UA 1J5WA 3LSSA 4YRNA 1W2BS 3CCET 3OYCA 1VQNA 1QCFA 1BKBA 3HKSA 3JCMe 4FM4B 2KE9A 2ZPFB 3H0IA 4J8OA 4O2DA 3QZ9B 5KNNA 2EWNA 2XDPA 4F7UB 1MV3A 2CP6A 3VS6A 3QZ5B 3H9NA 1EQRA 2V1QA 1VYTA 1RAHB 3QHSA 5GAMe 4H2VA 4HVCA 5KYWB 1RIQA 3I9QA 5J39A 5C53B 5LJ5e 5ECAA 2DZCA 4LVJA 3TSZA 1OX8A 4HCZA 1PRLC 2L3RA 4C92G 1OEBA 1SSFA 1EIYA 3EH1A 2BE7D 3CCLT 3M0SA 4N4HA 4RG8A 4OLFA 1ZUUA 3HXZA 1USYC 3JCMV 1BI0A 3J7AF 4KR2A 2E70A 1WNLA 3OYGA 2Y4XA 3REBB 4AMCA 2DJQA 1G3YA 1QVFP 3TEHB 1VQ5Q 4HCCA 2OAUA 2Y4YA 1KC8R 4XTWA 4AFZC 1MMAA 4F16A 3CCMA 5ELNA 1JBMA 2DJZA 1WIEA 3LX7A 4CC7A 2DIQA 3FDRA 4KT0E 5GANe 1IHWA 1WX6A 4RQFA 2KT8A 1I0CA 3CCQA 1TSFA 2DBKA 2L89A 1G8XA 4XTVA 1YJWA 3L1AA 3MP6A 2X4XA 1XJWB 4P5NA 3RGLA 4JRQA 1JB0E 3HXYA 4X9DA 4RG2A 3CCVA 2K5LA 4C0DB 2DYIA 3DKMA 4PLLA 3X25B 2RHXA 4R0KA 2E1HA 3MP1A 5CK9A 3RKXA 4CC2A 4C5GA 4JLGA 1N27A 2ZZDA 1EZZB 2V8KA 1Y07A 1D0YA 1KC8C 1AZGB 2ZIMA 2RMOA 2COZA 3OYHA 3M0UA 1Q82U 2Q5HA 2C0IA 6AT1B 2DF6A 1ATIA 4PFOA 2CUDA 5I2MA 4YCVA 1VQ9T 1M3CA 2IY5B 4TVAA 2QG9B 4J9DA 2E6NA 4IURA 4CC3A 4C8QA 2JW4A 5IT9E 1K8AR 3UGQA 4OB2B 1PYSB 4BDYA 4RQEA 1NYQA 1ZSZB 4C5EA 4EMHA 2KK4A 1M90U 1LYLA 3CBOA 2LCSA 1X2HA 3JCMg 2F69A 4PJOB 1OV3A 4C5IA 2LQWA 4LVIA 1XQHA 1M1KR 3FRNA 3INZA 1QWEA 4QVCA 1YJNT 3CC7Q 1SRMA 1UTIA 1K9MR 4XEOA 2DK3A 3EG2A 3ERRA 5GAMg 3X20B 3EFSA 2I4LA 5CKFA 1QVGP 4E7SA 3L2RA 4BDZA 5LJ5g 4DOVA 2X35A 1HXDA 3EGXA 2VYTA 3QYGB 3G71Q 3HY1A 4Q15A 4OB0B 3A74A 2OX7A 1SKUB 2KI7A 3A32A 2RM4A 1JO8A 3OYDA 3OS5A 1N8RR 5C51B 2A08A 3JRZA 2AKWA 3I56Q 1PHTA 1D1AA 2ZR3A 1JJ2A 2NUTA 4B9WA 4CC4B 2GBQA 3I5SA 2RH2A 2PMFA 1IGQA 2JM8A 3PFSA 1M1KC 4KRTA 3OW2S 2RHIA 2RJCA 3JV3A 2XHCA 3OB9A 5GANg 2PVOB 1YFSA 2ZT8A 1RACB 1K9MC 2ODRD 2NWMA 2PMEA 3A98A 2VV5A 1QCNA 1JJ2S 3JB9G 1E7OA 2DM1A 1QWFA 4M77G 4J6WA 3CCSA 1MGQA 4M7AG 1RAAB 1RADB 3MJXA 2X3WD 4TWAA 1VUBA 1BBZA 1VIFA 1F1BB 4O6JA 1B07A 1R0BG 1N8RC 4OMNA 5EC7A 3CC4A 4M7AB 3CCQT 1QE0A 1K73U 3M56A 4BE2A 2EYXA 1UGVA 1YJWT 4LDWA 2C06A 3TEEA 2KVQG 3I55A 4P74C 1NBEB 2MYSA 3JSCA 3H8ZA 4PL6A 2RD1A 2YUQA 2G3RA 4P72C 1PWTA 3EG9A 4M7DC 3SB2A 2LNVA 1M2VA 2GQIA 4J83A 3T9NA 3JCMX 2ZNIA 3SHWA 3CMAT 2LMJA 1TG0A 3WVDB 4B6MA 2ZXFA 5J3BA 1U1TA 3DSQA 4WJ3M 3M5AA 4HWPA 2BKDN 1OX9A 2RB6A 4NL2A 3X28B 3META 2KNBB 1UECA 4QQ6A 5E3IA 2FPEA 1VQ8A 2DL7A 2E3IA 2GTJA 2I0NA 1Q86C 3SFMA 3M4YA 3ICAA 2QTVA 1SHGA 2MMPA 3NETA 1KSWA 4M78A 1K4US 2VGMA 2DO3A 4H2UA 1I4K1 4LD6A 4M7DE 4M7DF 5EG2A 4KR3A 3JB9H 2E5KA 1YFTA 4JPBW 1OOTA 2LVMA 4BE0A 4IIMA 2CYZB 4DBHA 4H2SA 1W6XA 2RQUA 2RI2A 3KFVA 3HY0A 1D3BA 1W4SA 3FLGA 2OTLQ 1MMDA 2DL4A 3VU3C 3EGDA 1BI2A 3L42A 3G6EQ 4ZGEB 4BY6B 2DEQA 4KGXB 2C0OA 2I4OA 2A8EA 5GMKe 4L87A 3CD6A 2JZ2A 3FC3A 2DXCA 5I2SA 5IXBA 5D6WA 1NEGA 1JJCB 3L2QA 3SWNA 4J5YA 2LNHB 1VQLA 1OZ3A 1S72A 3OSVA 1TWBA 2KGTA 2CH4W 2L2PA 5J26A 5FWBA 1VQ7Q 2LZ6B 4XQ3A 3VYGA 1G3WA 3OYJA 1TUGB 5HY6A 1VYUA 1PD1A 1OU8A 4EMKC 2KDSA 4LVKA 3VQVA 1M5Q1 1NJ1A 5KYXB 1UGPB 4C0FA 1KD1U 2CKKA 2E3HA 2HBWA 4YRKA 4KUDK 4JRPA 4FYYB 4M75C 2FVUA 1PM3A 2IG0A 1ASYA 2DTOA 2R5AA 1YJ9A 2HSEB 2DL3A 3MEUA 4XTYA 1SF9A 3M54A 4E7ZA 4C8QG 3CCST 4E7JA 1H8KA 4N0AC 4FIBA 5GAN4 1B34B 3M58A 3PIPA 2D6FA 2X3XD 3OY9A 1FMKA 4YRJA 4CH6A 1G51A 2QYZA 1WJRA 3QJ6A 2YRDA 3UDCA 5CKHA 2EYQA 4C8QB 5CAIA 3CC4T 2JUFA 1E1OA 2E65A 2DZ9A 1VQMA 2I2LA 2KSSA 1W70A 3LGFA 4OF1A 4P75C 4YRGA 2QHTA 3H0HA 4O5VA 4M75F 1OPLA 2CT3A 4JRIA 1J3TA 2L3SA 1VA7A 7AT1B 3WXMB 1M8MA 3P8HA 1QQJA 3I55T 2NS6A 4K87A 2SRCA 4KH0B 4LXCA 2EQUA 3VYHB 4JRKA 4XAXB 1PNJA 4HXJA 3QO8A 5FLXE 2EW3A 3TVTA 3DLMA 1VQOA 3UPUA 4RMOA 2E5QA 4C92C 3CCJT 4AFSC 2YUOA 4GY5A 3UT1A 4D8KA 3HP9A 4F7UE 2KYMA 4XU1A 1QVFS 2J3LA 3HRTA 3MEWA 1AEYA 1LPLA 1I5OB 2VXEA 2LX7A 3OBYA 2G4CA 1VQ8T 2D1XA 2QA4A 4FT4A 3V8JA 3S6WA 2MWOA 1ACMB 2AKWB 2RJEA 2EJFA 1QCOA 4LDXA 2RQTA 4A63B 3CC2A 4JJCA 1UEBA 4HVUA 3RNJA 2L0AA 2P0KA 3UWNA 1D0ZA 1VQ6A 4HWSA 4C92F 1NJ5A 3OYKA 3JCMd 4C0DC 1B8AA 1YI2Q 5CKDA 1XOVA 1U8RA 2JS2A 3HRKA 2D8HA 3PGGA 4GLMA 3V7SA 3GF5A 3RMQA 4E47A 2J7IA 1SESA 1NPRA 2ZCEA 1Q82C 4UP7A 1MNDA 3O8VA 1KQ2A 3OS0A 4Z88A 1LJOA 4HVVA 2QHVA 3CD6T 3LW5E 2PVGB 4J9IA 1X01A 1VQLT 1XNIA 3LWIA 1GCQA 3NENA 2XGTA 2QEXA 3OA6A 3PCOB 2WSEE 4FYVB 2LDMA 4FCYA 1M1FA 2RN8A 3OS2A 2YHTA 1ZSZC 1M90C 2EYZA 3E19A 2DERA 3EG0A 4YRFA 4P73C 2Q7GA 3L2WA 2XD0A 3EFRA 1IXDA 1QVGA 1LCKA 4HWOA 3MHXA 3VQXA 4LUDA 3EG9B 5GANd 3N5BB 2KQWA 4J9BA 3RDVA 1HSQA 1NZ9A 4LNPA 2DDZA 5I21A 4HWTA 3KBGA 2CP3A 3PE0A 5FROA 3A8LB 3JB9J 3NELA 4M78G 1QVGS 1ZLMA 4R55A 4A53A 2LP5A 3EAEA 2DU7A 1B3QA 2ALYB 4OMFB 2QQAA 1VQMT 2EGAA 1NNHA 1R0CB 4M78B 2HMAA 2GNCA 2K3YA 1YITA 4PJOE 4OGEA 1KJWA 1JXOA 1VQPA 3NPFA 11ASA 1R8OB 4PJMA 1WHJA 1O9SA 1AWWA 2F2WA 1UJ0A 3HFZA
chains in the Genus database with same CATH topology
2RK2A 3G4SA 4CS4A 4KUIA 2MWPA 3F70A 5KE3A 4HT8A 4M75B 4ELYC 1VQOT 4YTLA 3GPLA 3HSBA 1BI1A 3NTHA 1L0WA 4BUGA 1QW1A 4YRLA 1LOJA 2K2VA 2EL9A 2AMCA 3OMGA 3OS1A 5A0GA 2QA4T 4M77C 2FB7A 1YFRA 1K73C 1B70A 1H4QA 4M7AC 4KULA 2WACA 2GF7A 2HQXA 3A5ZA 3CC2T 4YRMA 2WSCE 1VQ6T 3BFMA 4EMGA 4P3PA 1QP3A 2ZNJA 2HNIA 3ZEHA 3JCMJ 1B7YA 3JB9F 3OYFA 5LJ3j 4M77F 4C92B 3CCRT 4M7AF 4ZN3A 4A4FA 3OD1A 4LDVA 3FB9A 1SRYA 2P0LA 2DXUA 2I4NA 2O4XA 4J7IA 5M9OA 2P5IA 3RF1A 2QEXT 4RDXA 2K5FA 3UFGA 1P92A 4DQ2A 3VV0A 1VQ4T 5FRMA 5DLOA 3QBYA 5K1PA 2LX9A 4YRIA 4JLIA 5GAMj 3M4PA 5LJ5j 1ZBXA 4PJOD 1Q7YU 4E51A 4IUVA 1G3TA 4BACA 3FEOA 3OQ5A 1I8FA 3BDUA 2RI5A 5FU7C 2CZ1B 4BY6C 3QSUA 3VJPA 4H2XB 3KFUA 1YIJA 2R5MA 1E22A 4CS3A 1QF6A 5LJ3g 4HT9A 1ZHIA 1WPYA 1YITT 2K57A 2C8MA 3CCUA 1VQPT 2OTJA 5GANj 1V29B 3FIFA 1N9WA 3OMCA 1LNXA 3J81E 3QUIA 3KXTA 2ZT7A 1KD1C 3AHUA 3G4ST 5DM7R 4MZTA 1KHIA 4RCBA 4OB3B 1ADJA 4JJNK 4IUQA 4JUVA 4XU0A 2HAXA 4A4HA 1UGSB 3HRSA 3LWHA 2QHSA 3RACA 2HD0A 4GLKA 1VQNT 2AHJB 5C6SA 2CZ6B 3X24B 4QVZA 4J7FA 4FSXA 5GAN5 2ARTA 4C8QC 3QO7A 3URGA 2XU8A 1Y96A 2RHSA 1Z7NA 2K5IA 2D0QB 5A2QE 4XTZA 3PMIA 2QQBA 1YHQA 3MP8A 2DPPB 3HXWA 1X54A 3CMEA 2E41A 2ZINA 4C8QF 2E64A 4YRRA 3QDRB 3TUPA 3P8DA 3W3SA 3CCMT 3LYIA 4PHCA 3L4GB 4M77B 4B9XA 4L5GA 3L2ZA 3IKLA 2ZTGA 2EFIA 4M7DA 3JCMQ 2E5AA 1N6AA 4G84A 1HTTA 5KE2A 3CCVT 1G3SA 1VIEA 5LL6S 1Q81U 3QNEA 3CEYA 3PTAA 1EIFA 4TQFA 3RMSA 4CRIA 2CJAA 5CKEA 5GAN7 2DXBA 2M0OA 4A4EA 3HTZA 4BWAA 2XTIA 3P8BB 4HCBA 4ATOA 4YRTA 1YIJT 3PMTA 2XIDA 3CPFA 3BJUA 4YRQA 3VUZA 3M4GA 1KMNA 4YREA 1KQ1A 2P4TA 1BIBA 3GNGA 4YCUA 4IUTA 3A5ZB 3CCUT 2OTJT 3A31A 1KMMA 1MHNA 1HK9A 1WQ7A 4DA4A 2D9TA 4WF2A 3IALA 1YGBA 1EIYB 3HL8A 2XDBA 2HQEA 2X4YA 2XICA 3CBMA 2EJGA 5L8RE 3NEMA 3KUFA 3REXA 2DTIA 5FU7B 4BE1A 4Q6GA 3UH0A 3NTKA 3M59A 4EMKA 2RHQA 1QVPA 4WJ4A 2M1HA 1SERA 5GAOq 4YYEA 3QG1A 3VBBA 3C94A 4M78C 3RL6A 2ZZEA 2K4YA 4IKFA 1WJSA 3TU4K 5GAN3 1X6OA 3QIIA 1HC7A 4OP0A 3UGTA 1YHQT 2JTFA 4XU2A 5CO7A 3CMET 4F7UA 5ELOA 1H3ZA 4P75A 3LSQA 4Y28E 3NFCA 4M78F 1C0AA 4LDYA 3I7FA 3A5YA 4TVAB 1PSEA 1OYXA 3JCMc 5KH6A 3OBWA 3SDZA 5GMKj 4NCXA 3SD4A 2X4JA 2XKOC 4IUUA 4M75E 1OI1A 3TEHA 4CI0C 2MI6A 4K88A 1KOGA 4KBMB 4XU3A 4A4GA 1VQZA 1K8AU 4HWRA 2RHYA 4PKCC 4VUBA 4YPFA 4HKEA 3MF1A 5GAOm 2ZT6A 4M7DD 4QQGA 4BD3A 4JS5A 5KCOA 3GIBA 1G5HA 1M8VA 5CVIA 2CZ0B 3RKWA 5LJ3d 4MDXA 4YRPA 1H4TA 2QQ9A 3M55A 5F5WA 2V8IA 4BI8B 4YRSA 1BBUA 5LJ3h 1FX7A 3VQWA 4P71C 4Z02A 4C92E 3C12A 3GP8A 2DKGA 4QVDA 2ZZFA 1Q7YC 2IY5A 3HPWA 2DVEA 2H3JA 1I81A 4P3NA 3JCMh 5C0MA 3M9QA 5GAMd 5GAOl 3GOXA 3QTCA 4P73A 5LJ5d 4EX5A 1VQ5A 3TCJA 2ARSA 5GAMh 3OYBA 4PJOA 3L2VA 1S72T 1O75A 5LJ5h 1FYFA 3CMQA 2KAFA 4XTXA 3ER0A 1ADYA 3HRIA 3G1ZA 1H4VB 1WQWA 1ASZA 2LT4A 2YRVA 3JCMb 4TTVA 1YJ9T 2JN0A 5CQXA 2LTOA 5HKCA 4M75D 3PT9A 2CZ7B 5GANh 2E6ZA 2GFAA 2DU5A 5IN1A 2XK0A 2O01E 2ZCFB 5DLQE 1Y71A 4RKUE 4C0GA 3JCMf 3HFVA 5FU6B 4E7LA 2FYKA 4YDQA 3MO8A 3RUXA 1VQ9A 4Y91A 4UP8A 4UPAA 4BI3A 1D3BB 2XG8D 5LJ5f 3ME9A 4BW9A 5IAYA 2A3LA 1W2BA 3JB9I 2RHUA 3CC7A 4E7IA 2CIMA 3M53A 3V7CA 4C92D 2M16A 3SWNB 3E1SA 3G71A 1WU7A 1X75C 4IUPA 2ARUA 3MEAA 2ZR2A 1NJ2A 1YJNA 4ELZC 4X34A 1USYA 1YB3A 3I56A 5GANf 3LH0A 4F7UG 3MQZA 4E7KA 1Q81C 2Q7HA 2RK1A 3HRUA 2LQKA 4H2TA 4H2YA 2R58A 2CJBA 3JAME 4M77E 4YRCA 3E9HA 2PQWA 4ZGDB 4M7AE 2ZGWA 4DOWA 3LC0A 2ZPEB 4R56A 2ODRC 1VQ5T 1OZ2A 1PSFA 4TVWA 2ZIOA 4JS4A 1B76A 3A8MB 3G7ZA 3LLRA 5GAOn 2PU9B 4V2SA 3L2UA 3P8YA 4OB1B 2JTMA 2LT1A 1JJCA 2YLBA 2GFUA 4HA8A 1JRIA 4MZMA 3V8LA 4JDSA 5D6XA 3MF2A 2LCLA 4J15A 2EAYA 3REUA 1GGMA 3TEGA 3LGLA 3GLXA 4YCWA 2RA2A 3C95A 3OYNA 2JVVA 2V8JA 1NYRA 1N9RA 4Q5WA 3RIRA 2DAQA 4ZTZB 1UGRB 4PLIA 2QHUA 1BBWA 4DPGA 2L8DA 3CMAA 2LRQA 2BIVA 5GAN2 4D6WA 5AYFA 1B34A 4H2WA 4QQDA 3HHTB 2MF2A 3WQZA 2DIGA 1QP2A 4PJOG 1UGQB 3CC7T 4L6V5 5GAOp 2VGNA 2OTLA 3P8TA 1RL2A 3M57A 1YCYA 3G6EA 3A8HB 3G71T 5GAOr 3HXVA 4NL3A 3FJPA 3JB9D 1NJIU 3WVEB 3H6ZA 4M77D 4M7AD 1VQ7A 3I56T 2ZZGA 1FWZA 3S3OA 2GQVA 1DJ7B 3R6OA 3HFOA 2JNGA 3HXXA 2CJ9A 1KHCA 3HXUA 1IREB 2ZPGB 2X4WA 1K8AC 2ZT5A 3OW2A 2EKOA 1SETA 5GMKh 2KMTA 4C8QE 4ZTUB 2EIFA 2QQSA 4FT2A 5D6YA 3QXEB 1KQSA 3RERA 1NJ8A 4N4IA 4P74A 1NPPA 4ZTFA 1ZQ1A 4ZIBA 4P72A 3A8OB 2J3MA 4OGCA 5GAN8 2ZPBB 1BIAA 3ASKA 5FRNA 3HFZB 4CS2A 1KQSS 2LC4A 1Z7MA 4LVLA 3R07A 4CH3A 2CGHA 1X55A 1TH7A 5CQYA 3PCOA 3OYEA 2B8AA 4J6XA 3E9IA 2R57A 2C7IA 5CIUA 1I5LA 4XEMA 2DD4A 2QI2A 2AMCB 2DD5A 4J6YA 3PNWC 1B70B 3VKIA 4EPCA 5CCAA 1N9SA 2RHZA 3ZFJA 3OYIA 4LNSA 2P0QA 3PIOA 3CCJA 3V8KA 3VUBA 4A54A 2PUOB 4NOYA 1B7YB 4LVMA 1WGSA 1EVKA 2ALYA 1YI2A 3A8GB 2PVDB 1H4SA 3JCMP 2RJFA 4CH4A 4ME7A 2MAMA 2CS7A 2OTLT 2Y90A 3V7RA 3G6ET 3GNFB 2O4XB 4CH5A 4LD9K 3RKYA 4HT4A 2P0PA 1H641 1M1GA 2GCXA 1U1SA 2XI9A 3CXCA 4C0ZA 3QO5A 4M75A 4XTUA 4P3OA 4BB7A 2ZPIB 4C8QD 1VQ7T 5A0DA 5CR2A 3TREA 1KC8U 5FU6C 4N0AA 1YBYA 3Q1JA 3CXCS 12ASA 3MCAB 1NJ6A 1Y7XA 4UC4A 3QPHA 2YLCA 4G85A 3DLLA 3MEVA 2E12A 4M78E 1BYMA 4TVRA 2XDDA 2VXFA 1GXIE 4X9CA 3SWNC 2QTXA 1WYDA 1W66A 5GMKm 1X56A 4C92A 1M4ZA 4YROA 5CKBA 2E3CA 3OSSC 3QJYA 2PUKB 1G5VA 3VQYA 4MDWA 4ZGJB 2A7YA 2NLUA 2VUBA 1VQKA 3DB3A 4II1A 1XTDA 2EQKA 1AHJB 1QVFA 1EOVA 4P71A 1M1KU 4LDUA 3P8VA 4AH6A 1M9SA 1KG1A 1Y96B 1WLEA 2QXFA 3HFNA 2RHSB 1K9MU 2DXTA 4H02A 1NE8A 3CCEA 1UB4A 1E1TA 5GMKl 2LCCA 4QW2A 4F7UF 1EVLA 3E9FA 4L59A 2I4MA 5HGQA 3MEYA 4OVAA 4H2XA 3QYHB 1N8RU 4MMLA 4MZPA 1YI2T 3S3MA 4PG3A 2Q7EA 2DQ0A 1PYSA 5DY9A 4X5OA 2RO0A 3ZBDA 4M7DG 2ZPHB 2WSFE 3S3NA 4NS5A 3C4SA 2E10A 2RJDA 4RMFA 2RI3A 2QQRA 3PZCA 2Q5IA 3JCMW 3CCLA 2FL7A 4M7DB 3OYLA 4TQDA 4K86A 3CBPA 5GMKi 3DB4A 3IG2A 3CCRA 4M78D 5GAN6 3NTIA 4XK8E 4E7HA 2EQMA 1FXXA 3QO3A 2M9UA 4C5HA 3E9GA 3J80E 3IKMB 4WI1A 2LQ8A 3CPWA 2KY9A 2DQ3A 3BY7A 3A7AA 1Q86U 4PNOA 2VC8A 3RESA 5HK0A 4TVYA 3OYYA 2IVWA 4BI4A 5A0LA 5KCHA 2F5TX 2L5QA 1WJQA 1IL2A 5LJ3f 1VQ4A 2BUDA 2JOYA 1X2GA 3BW1A 4EDUA 3A7RA 1IZ6A 4PJOC 3OYAA 3CPWS 1E24A 3X26B 1NJIC 2DTHA 4FL6A 3M4QA 3OYMA 2K3XA 3BDLA 2F5KA 4ZN1A 4RCCA 1G5IA 4FU6A 4A4KA 4MMKA 1BI3A 5GAMf 2QDYB 3QKJA 4M77A 3L4GA 2EJ9A 2FHDA 4PJOF 4M7AA 1VQKT 4EO4A 1RI0A 5K1XA 2HBPA 4UP9A 4YP0A 4EMKB 2RHQB 2EQJA 4M75G 4N4GA 4KQEA 1EFWA 4ZTJA 5HK3A 5LJ3e 5C52B 3A7UA 1J5WA 3LSSA 4YRNA 1W2BS 3CCET 3OYCA 1VQNA 1BKBA 3HKSA 3JCMe 4FM4B 2ZPFB 4J8OA 4O2DA 3QZ9B 5KNNA 2EWNA 2XDPA 4F7UB 3QZ5B 1EQRA 3QHSA 5GAMe 4H2VA 4HVCA 1RIQA 5J39A 5C53B 5LJ5e 2DZCA 4LVJA 4HCZA 2L3RA 4C92G 1SSFA 1EIYA 3CCLT 4N4HA 4RG8A 4OLFA 3HXZA 1USYC 3JCMV 1BI0A 3J7AF 4KR2A 2E70A 1WNLA 3OYGA 2Y4XA 1G3YA 3TEHB 4HCCA 2OAUA 2Y4YA 4XTWA 3CCMA 5ELNA 1JBMA 2DJZA 3LX7A 2DIQA 3FDRA 4KT0E 5GANe 4RQFA 3CCQA 2L89A 4XTVA 1YJWA 3L1AA 3MP6A 2X4XA 4P5NA 3RGLA 4JRQA 1JB0E 3HXYA 4X9DA 4RG2A 3CCVA 2K5LA 4C0DB 3DKMA 4PLLA 3X25B 2RHXA 2E1HA 3MP1A 5CK9A 3RKXA 4C5GA 4JLGA 1N27A 2ZZDA 2V8KA 1Y07A 1KC8C 2ZIMA 3OYHA 1Q82U 2Q5HA 1ATIA 5I2MA 4YCVA 1VQ9T 2IY5B 4TVAA 2E6NA 4IURA 4C8QA 5IT9E 3UGQA 4OB2B 1PYSB 4BDYA 4RQEA 1NYQA 4C5EA 4EMHA 2KK4A 1M90U 1LYLA 3CBOA 1X2HA 3JCMg 2F69A 4PJOB 4C5IA 4LVIA 1XQHA 3FRNA 3INZA 4QVCA 1YJNT 4XEOA 2DK3A 3ERRA 5GAMg 3X20B 3EFSA 2I4LA 5CKFA 3L2RA 4BDZA 5LJ5g 4DOVA 2X35A 1HXDA 2VYTA 3QYGB 3HY1A 4Q15A 4OB0B 3A74A 3A32A 2RM4A 3OYDA 3OS5A 5C51B 3JRZA 2AKWA 2ZR3A 1JJ2A 4B9WA 2RH2A 2PMFA 3PFSA 1M1KC 3OW2S 2RHIA 2RJCA 2XHCA 3OB9A 5GANg 2PVOB 1YFSA 2ZT8A 1K9MC 2ODRD 2PMEA 2VV5A 1JJ2S 3JB9G 4M77G 4J6WA 3CCSA 1MGQA 4M7AG 4TWAA 1VUBA 1VIFA 4O6JA 1N8RC 3CC4A 4M7AB 3CCQT 1QE0A 1K73U 3M56A 4BE2A 1YJWT 4LDWA 2C06A 3TEEA 2KVQG 3I55A 4P74C 3JSCA 3H8ZA 4PL6A 2RD1A 2G3RA 4P72C 4M7DC 3SB2A 2LNVA 4J83A 3T9NA 3JCMX 2ZNIA 3CMAT 3WVDB 2ZXFA 5J3BA 1U1TA 3DSQA 4WJ3M 3M5AA 4HWPA 2BKDN 4NL2A 2RB6A 3X28B 3META 4QQ6A 5E3IA 1VQ8A 1Q86C 3SFMA 3M4YA 3ICAA 2MMPA 3NETA 4M78A 2VGMA 2DO3A 4H2UA 1I4K1 4LD6A 4M7DE 4M7DF 5EG2A 4KR3A 3JB9H 1YFTA 2LVMA 4BE0A 2CYZB 4H2SA 2RI2A 3HY0A 1D3BA 1W4SA 3FLGA 3VU3C 1BI2A 3L42A 4ZGEB 4BY6B 2DEQA 2I4OA 2A8EA 5GMKe 4L87A 3CD6A 2JZ2A 3FC3A 2DXCA 5I2SA 5D6WA 1JJCB 3L2QA 3SWNA 4J5YA 1VQLA 1OZ3A 1S72A 3OSVA 5J26A 4XQ3A 3VYGA 1G3WA 3OYJA 5HY6A 4EMKC 2KDSA 4LVKA 3VQVA 1M5Q1 1NJ1A 1UGPB 4C0FA 1KD1U 2CKKA 4YRKA 4KUDK 4JRPA 4M75C 2FVUA 2IG0A 1ASYA 2DTOA 2R5AA 1YJ9A 3MEUA 4XTYA 3M54A 4C8QG 3CCST 4E7JA 4N0AC 4FIBA 5GAN4 1B34B 3M58A 3PIPA 2D6FA 3OY9A 4CH6A 4YRJA 1G51A 1WJRA 3QJ6A 3UDCA 5CKHA 2EYQA 4C8QB 5CAIA 3CC4T 2JUFA 1E1OA 2E65A 2DZ9A 1VQMA 2I2LA 2KSSA 3LGFA 4OF1A 4P75C 4YRGA 2QHTA 4O5VA 4M75F 4JRIA 3WXMB 3P8HA 3I55T 2NS6A 4K87A 2EQUA 3VYHB 4JRKA 4XAXB 3QO8A 5FLXE 3DLMA 1VQOA 3UPUA 4RMOA 2E5QA 4C92C 3CCJT 4GY5A 3UT1A 4F7UE 3HP9A 4XU1A 1QVFS 2J3LA 3HRTA 3MEWA 2VXEA 3OBYA 2G4CA 1VQ8T 2QA4A 4FT4A 3V8JA 3S6WA 2MWOA 2AKWB 2RJEA 2EJFA 4LDXA 3CC2A 1UEBA 2P0KA 3UWNA 1VQ6A 4HWSA 4C92F 1NJ5A 3OYKA 3JCMd 4C0DC 1B8AA 5CKDA 1XOVA 1U8RA 3HRKA 3PGGA 3V7SA 3GF5A 3RMQA 4E47A 1SESA 1NPRA 2ZCEA 1Q82C 4UP7A 3O8VA 1KQ2A 3OS0A 1LJOA 2QHVA 3CD6T 3LW5E 2PVGB 1X01A 1VQLT 1XNIA 3LWIA 3NENA 2XGTA 2QEXA 3OA6A 3PCOB 2WSEE 2LDMA 1M1FA 3OS2A 2YHTA 1M90C 3E19A 4YRFA 4P73C 2Q7GA 3L2WA 2XD0A 3EFRA 1QVGA 4HWOA 3MHXA 3VQXA 5GANd 3N5BB 2KQWA 1NZ9A 2DDZA 5I21A 4HWTA 3KBGA 5FROA 3A8LB 3JB9J 3NELA 4M78G 1QVGS 4R55A 4A53A 3EAEA 2DU7A 2ALYB 4OMFB 2QQAA 1VQMT 1NNHA 4M78B 2K3YA 1YITA 4PJOE 4OGEA 1VQPA 11ASA 1R8OB 1O9SA 3HFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS4 A;  4C8Q A;  4LNS A;  3UGQ A;  1PYS B;  4RQE A;  1NYQ A;  4HT8 A;  4M75 B;  3GIB A;  3V8K A;  1G5H A;  4EMH A;  1M8V A;  4A54 A;  3RKW A;  5LJ3 d;  3HSB A;  4NOY A;  1L0W A;  4YRP A;  1LYL A;  1H4T A;  1X2H A;  3JCM g;  1B7Y B;  4YRL A;  1EVK A;  2ALY A;  5F5W A;  4PJO B;  1LOJ A;  1BBU A;  4YRS A;  3JCM P;  1H4S A;  5LJ3 h;  2EL9 A;  4CH4 A;  2AMC A;  3INZ A;  4QVC A;  3VQW A;  4P71 C;  4M77 C;  2FB7 A;  2Y90 A;  4C92 E;  1YFR A;  1B70 A;  4XEO A;  4M7A C;  1H4Q A;  3V7R A;  3ERR A;  2DKG A;  5GAM g;  2I4L A;  3EFS A;  4QVD A;  4CH5 A;  2ZZF A;  2IY5 A;  5LJ5 g;  2DVE A;  3A5Z A;  3RKY A;  1HXD A;  1I81 A;  1H64 1;  4P3N A;  4Q15 A;  4YRM A;  3HY1 A;  3JCM h;  1U1S A;  3A74 A;  3QO5 A;  4M75 A;  4XTU A;  4P3O A;  5GAM d;  5GAO l;  3A32 A;  2RM4 A;  4C8Q D;  3BFM A;  4EMG A;  3QTC A;  4P3P A;  4P73 A;  5LJ5 d;  2ZNJ A;  2HNI A;  5C51 B;  4EX5 A;  2AKW A;  3JCM J;  1B7Y A;  2ARS A;  2ZR3 A;  5GAM h;  3JB9 F;  4PJO A;  4N0A A;  5LJ3 j;  4M77 F;  5LJ5 h;  2PMF A;  4C92 B;  1FYF A;  4M7A F;  12AS A;  3OD1 A;  3CMQ A;  1NJ6 A;  4XTX A;  3FB9 A;  1SRY A;  5GAN g;  2ZT8 A;  1YFS A;  2P0L A;  2DXU A;  2I4N A;  1ADY A;  2ODR D;  3HRI A;  2YLC A;  2PME A;  3G1Z A;  4G85 A;  1H4V B;  1WQW A;  1ASZ A;  2P5I A;  3RF1 A;  4M78 E;  3JB9 G;  4RDX A;  3UFG A;  4M77 G;  2VXF A;  3JCM b;  4TTV A;  4J6W A;  4X9C A;  1MGQ A;  4M7A G;  3SWN C;  2JN0 A;  4TWA A;  2QTX A;  4DQ2 A;  1WYD A;  4M75 D;  1W66 A;  5K1P A;  4YRI A;  4JLI A;  5GAN h;  5GMK m;  5GAM j;  4M7A B;  3M4P A;  1QE0 A;  2DU5 A;  5LJ5 j;  1X56 A;  4C92 A;  4PJO D;  4E51 A;  4YRO A;  2E3C A;  1I8F A;  3BDU A;  4P74 C;  3VQY A;  3JCM f;  3HFV A;  3QSU A;  2RD1 A;  4H2X B;  3KFU A;  4P72 C;  1E22 A;  4M7D C;  4CS3 A;  3SB2 A;  1QF6 A;  5LJ3 g;  4HT9 A;  2FYK A;  4YDQ A;  3RUX A;  3JCM X;  1WPY A;  2ZNI A;  2K57 A;  2C8M A;  4Y91 A;  1EOV A;  4UP8 A;  4P71 A;  4UPA A;  5GAN j;  3P8V A;  4AH6 A;  1D3B B;  5LJ5 f;  2ZXF A;  1U1T A;  3DSQ A;  4BW9 A;  4WJ3 M;  3FIF A;  1N9W A;  4HWP A;  1Y96 B;  3HFN A;  4NL2 A;  2RB6 A;  1LNX A;  1WLE A;  3QUI A;  3JB9 I;  2RHS B;  5E3I A;  2DXT A;  2ZT7 A;  4H02 A;  2CIM A;  3AHU A;  3V7C A;  1E1T A;  3ICA A;  5GMK l;  4C92 D;  4F7U F;  1EVL A;  3NET A;  4M78 A;  4RCB A;  3SWN B;  1ADJ A;  2I4M A;  4H2U A;  1I4K 1;  4JUV A;  4XU0 A;  1WU7 A;  2ARU A;  4M7D E;  4M7D F;  5HGQ A;  2QHS A;  4KR3 A;  3MEY A;  2ZR2 A;  4H2X A;  3JB9 H;  3RAC A;  1NJ2 A;  1YFT A;  4MML A;  1USY A;  1YB3 A;  4H2S A;  5GAN f;  4PG3 A;  4F7U G;  2Q7E A;  2DQ0 A;  1PYS A;  5GAN 5;  3HY0 A;  5DY9 A;  2ART A;  2Q7H A;  1D3B A;  4C8Q C;  3QO7 A;  4X5O A;  4H2T A;  4M7D G;  3VU3 C;  1Y96 A;  4H2Y A;  2RHS A;  2E10 A;  2DEQ A;  1Z7N A;  2I4O A;  4RMF A;  2CJB A;  5GMK e;  3PZC A;  2Q5I A;  4L87 A;  3JCM W;  4M77 E;  4M7D B;  4YRC A;  3E9H A;  1JJC B;  4XTZ A;  3SWN A;  4J5Y A;  4M7A E;  2ZGW A;  4TQD A;  4K86 A;  3LC0 A;  5GMK i;  3IG2 A;  4M78 D;  5GAN 6;  2ODR C;  3HXW A;  1X54 A;  4XQ3 A;  4TVW A;  2ZIO A;  4EMK C;  3QO3 A;  2E41 A;  2ZIN A;  4C8Q F;  3VQV A;  2E64 A;  3IKM B;  1M5Q 1;  4WI1 A;  1NJ1 A;  1B76 A;  4YRR A;  2DQ3 A;  3BY7 A;  3TUP A;  3A7A A;  4YRK A;  4PNO A;  2VC8 A;  3RES A;  4TVY A;  3W3S A;  4M75 C;  4PHC A;  1ASY A;  2DTO A;  5GAO n;  4V2S A;  3L4G B;  4M77 B;  3L2Z A;  3IKL A;  1IL2 A;  5LJ3 f;  2ZTG A;  3P8Y A;  4XTY A;  1X2G A;  3BW1 A;  4C8Q G;  4M7D A;  3JCM Q;  3A7R A;  1JJC A;  4PJO C;  4N0A C;  5GAN 4;  1B34 B;  1E24 A;  2E5A A;  2YLB A;  4HA8 A;  1JRI A;  4YRJ A;  4CH6 A;  2DTH A;  4G84 A;  1G51 A;  3V8L A;  1HTT A;  3MF2 A;  4C8Q B;  4J15 A;  5CAI A;  2EAY A;  1E1O A;  3M4Q A;  2E65 A;  3REU A;  2DZ9 A;  1GGM A;  2I2L A;  3TEG A;  3QNE A;  4P75 C;  4YRG A;  2QHT A;  4YCW A;  2RA2 A;  1NYR A;  4RCC A;  1G5I A;  4M75 F;  1N9R A;  4TQF A;  3RIR A;  4ZTZ B;  2CJA A;  4JRI A;  5GAN 7;  4MMK A;  3HTZ A;  2QHU A;  5GAM f;  4K87 A;  3L4G A;  4M77 A;  4BWA A;  1BBW A;  2EJ9 A;  2XTI A;  4DPG A;  4JRK A;  4PJO F;  4M7A A;  3QO8 A;  4YRT A;  4EO4 A;  5GAN 2;  5K1X A;  3BJU A;  4YRQ A;  4UP9 A;  1B34 A;  4YP0 A;  4H2W A;  4EMK B;  2RHQ B;  3M4G A;  1KMN A;  4YRE A;  1KQ1 A;  4M75 G;  1BIB A;  4YCU A;  4C92 C;  4KQE A;  4F7U E;  4XU1 A;  3A31 A;  1KMM A;  1EFW A;  2J3L A;  1HK9 A;  1WQ7 A;  3WQZ A;  5LJ3 e;  5C52 B;  4PJO G;  4WF2 A;  3IAL A;  5GAO p;  3A7U A;  2VXE A;  1YGB A;  1J5W A;  2G4C A;  3LSS A;  4YRN A;  3P8T A;  3V8J A;  1EIY B;  2AKW B;  1YCY A;  2EJF A;  5GAO r;  3HXV A;  4NL3 A;  2EJG A;  3JCM e;  3FJP A;  3JB9 D;  3NEM A;  4HWS A;  2DTI A;  3REX A;  4O2D A;  4C92 F;  4M77 D;  1NJ5 A;  4Q6G A;  5KNN A;  3JCM d;  3UH0 A;  2EWN A;  4EMK A;  2RHQ A;  4F7U B;  4M7A D;  1B8A A;  4WJ4 A;  2ZZG A;  1SER A;  5GAO q;  4YYE A;  3HFO A;  3VBB A;  3HRK A;  1EQR A;  3PGG A;  3QHS A;  5GAM e;  3HXX A;  3V7S A;  2CJ9 A;  4H2V A;  3HXU A;  4HVC A;  1SES A;  1RIQ A;  2ZT5 A;  5C53 B;  4M78 C;  5LJ5 e;  3RL6 A;  2DZC A;  2ZCE A;  2ZZE A;  4UP7 A;  4C92 G;  1KQ2 A;  1SET A;  1LJO A;  5GMK h;  2QHV A;  1EIY A;  5GAN 3;  1X01 A;  4OLF A;  4C8Q E;  3HXZ A;  1USY C;  3JCM V;  1HC7 A;  4OP0 A;  3NEN A;  3UGT A;  2XGT A;  4KR2 A;  1WNL A;  4ZTU B;  4XU2 A;  3PCO B;  3TEH B;  3RER A;  2YHT A;  1NJ8 A;  4P74 A;  5ELO A;  4F7U A;  4P75 A;  4XTW A;  4YRF A;  4P73 C;  3LSQ A;  2Q7G A;  5ELN A;  1JBM A;  2DJZ A;  3EFR A;  4ZIB A;  4P72 A;  4M78 F;  5GAN e;  4RQF A;  1C0A A;  2J3M A;  4HWO A;  3VQX A;  3I7F A;  5GAN 8;  5GAN d;  1BIA A;  3A5Y A;  4TVA B;  3HFZ B;  4XTV A;  4CS2 A;  3JCM c;  2DDZ A;  1Z7M A;  3L1A A;  5I21 A;  3R07 A;  4HWT A;  3RGL A;  5GMK j;  4NCX A;  3HXY A;  4CH3 A;  4X9D A;  2CGH A;  1X55 A;  3JB9 J;  1TH7 A;  3NEL A;  4M78 G;  4A53 A;  4M75 E;  3PCO A;  2DU7 A;  4J6X A;  3TEH A;  3E9I A;  2E1H A;  4K88 A;  1KOG A;  3RKX A;  2ALY B;  2C7I A;  1I5L A;  1NNH A;  4XEM A;  4XU3 A;  4M78 B;  2AMC B;  1VQZ A;  4PJO E;  4HWR A;  4J6Y A;  2ZIM A;  11AS A;  2Q5H A;  1B70 B;  1ATI A;  4YPF A;  3MF1 A;  4YCV A;  5GAO m;  2IY5 B;  1N9S A;  4TVA A;  2ZT6 A;  4M7D D;  3HFZ A; 
#chains in the Genus database with same CATH topology
 2RK2 A;  1U06 A;  3TSW A;  3G4S A;  4CS4 A;  4KUI A;  2MWP A;  3F70 A;  5KE3 A;  4HT8 A;  4M75 B;  4ELY C;  1VQO T;  4YTL A;  1VQK Q;  1RAE B;  1WLP B;  5IHI A;  3GPL A;  3HSB A;  1BI1 A;  3MPU B;  3NTH A;  1L0W A;  1X43 A;  4PJL A;  4BUG A;  3UF4 A;  1QW1 A;  4ORZ A;  4YRL A;  1LOJ A;  2KT1 A;  1QLY A;  2K2V A;  2EL9 A;  5D7U A;  1AWX A;  2AMC A;  3OMG A;  3OS1 A;  3NGP A;  5A0G A;  2QA4 T;  4M77 C;  2FB7 A;  2QGF B;  1YFR A;  1X27 A;  1K73 C;  1B70 A;  1H4Q A;  2VVK A;  4KUL A;  4M7A C;  2WAC A;  5IXF A;  2GF7 A;  3CCE Q;  2HQX A;  3A5Z A;  3CC2 T;  4RTV A;  1M2O A;  2WSC E;  4YRM A;  1A0N B;  1VQ6 T;  1BU1 A;  3BFM A;  4EMG A;  4P3P A;  2LJ3 A;  1T0H A;  1QP3 A;  2ZNJ A;  2HNI A;  3ZEH A;  1CKB A;  1IRX A;  3JCM J;  1B7Y A;  2A36 A;  1RAB B;  2F1L A;  5I22 A;  3JB9 F;  3OYF A;  5LJ3 j;  1YCS B;  4M77 F;  4C92 B;  2H3E B;  3CCR T;  4M7A F;  4ZN3 A;  1JXM A;  4A4F A;  3OD1 A;  4LDV A;  1H3H A;  3FB9 A;  1SRY A;  2KRM A;  2P0L A;  2DXU A;  2I4N A;  2FO0 A;  2O4X A;  4J7I A;  5M9O A;  3CCL Q;  2AZV A;  2P5I A;  3RF1 A;  1D1C A;  2QEX T;  4RDX A;  2K5F A;  1TXQ A;  3UFG A;  2PZ1 A;  1PC0 A;  2M0Y A;  1P92 A;  4DQ2 A;  1TOV A;  2O31 A;  3VV0 A;  1VQ4 T;  5FRM A;  5DLO A;  3QBY A;  5K1P A;  2LX9 A;  2A28 A;  4JLI A;  4YRI A;  4QT7 A;  5GAM j;  2RQW A;  3M4P A;  1IB8 A;  5LJ5 j;  1KD1 R;  1ZBX A;  4PJO D;  2YWW A;  4JJB A;  1Q7Y U;  4E51 A;  3VS1 A;  4ZNX A;  4IUV A;  1G3T A;  4BAC A;  3FEO A;  3OQ5 A;  1I8F A;  3BDU A;  2RI5 A;  1SEM A;  5KYU B;  5FU7 C;  2CZ1 B;  3EHR A;  2EGE A;  4BY6 C;  3QSU A;  3VJP A;  4H2X B;  3KFU A;  1YIJ A;  1WA7 A;  2R5M A;  4JZ4 A;  1OPK A;  1E22 A;  4CS3 A;  1QF6 A;  5LJ3 g;  4HT9 A;  4F04 B;  4J9C A;  1ZHI A;  1WPY A;  2AIR B;  1YIT T;  2K57 A;  1H92 A;  2C8M A;  3CCU A;  1VQP T;  2OTJ A;  5GAN j;  1V29 B;  2KRO A;  3FIF A;  1Z9Q A;  3OMC A;  1N9W A;  1LNX A;  2HQH A;  3J81 E;  3QUI A;  3KXT A;  1WI7 A;  2ZT7 A;  3QWY A;  1KD1 C;  1VQ9 Q;  3G4S T;  3AHU A;  5DM7 R;  4MZT A;  1S1N A;  1KHI A;  4RCB A;  4OB3 B;  1ZBJ A;  2DFU A;  1ADJ A;  4JJN K;  4IUQ A;  4JUV A;  4XU0 A;  5GJW B;  1M27 C;  2HAX A;  4A4H A;  5KYY B;  1UGS B;  3HRS A;  3LWH A;  4OMM A;  2QHS A;  3RAC A;  2HD0 A;  2PNI A;  4GLK A;  1VQN T;  4YRE A;  2AHJ B;  5C6S A;  2JS0 A;  2CZ6 B;  2K79 A;  1HD3 A;  1NG2 A;  3X24 B;  4QVZ A;  4J7F A;  4FSX A;  2EGC A;  5GAN 5;  3BE3 A;  2ART A;  4C8Q C;  2OI3 A;  3QO7 A;  2HKN A;  3URG A;  2XU8 A;  1YJN Q;  1Y96 A;  4FYW B;  2RHS A;  4AFU C;  4QKU A;  1Z7N A;  2J6F A;  2K5I A;  1NEB A;  2NUP B;  1QMC A;  1RAF B;  2D0Q B;  5A2Q E;  4XTZ A;  3VRY A;  3PMI A;  2QQB A;  2HSP A;  1UG1 A;  3EFO B;  2QK0 A;  2YUP A;  3M0P A;  1YHQ A;  3FJ5 A;  3MP8 A;  4DBF A;  2DPP B;  3HXW A;  3SEM A;  1X54 A;  4KGZ B;  2AZS A;  2DLP A;  3CME A;  2E41 A;  2ZIN A;  4C8Q F;  2E64 A;  2KXD A;  4YRR A;  3I5R A;  1KIK A;  1Y57 A;  2YUN A;  1K0X A;  4RTX A;  3QDR B;  3TUP A;  4RTW A;  3P8D A;  3W3S A;  3CCM T;  3LYI A;  4PHC A;  4LN2 A;  3L4G B;  4M77 B;  1NYF A;  4L5G A;  4B9X A;  3L2Z A;  3IKL A;  2ZTG A;  2MPX C;  2EFI A;  2DNU A;  2ESW A;  1HYO A;  2VKN A;  4M7D A;  3JCM Q;  2E5A A;  4PJJ A;  1N6A A;  1Q86 R;  1ZUY A;  4G84 A;  2D0N A;  2L3Q A;  1HTT A;  5KE2 A;  4ESR A;  2DRM A;  4RTY A;  3CCV T;  2KRS A;  1G3S A;  1VIE A;  5LL6 S;  1Q81 U;  2J06 A;  3QNE A;  3CEY A;  3CCQ Q;  2HZY A;  2EVR A;  3PTA A;  1RLP C;  1EIF A;  1E6G A;  4TQF A;  2OJ2 A;  3RMS A;  4CRI A;  1PCX A;  5CKE A;  1YJW Q;  5GAN 7;  2CJA A;  2DXB A;  3CQT A;  2M0O A;  4A4E A;  2ENM A;  3HTZ A;  1YNZ A;  4BWA A;  1GBR A;  2XTI A;  3P8B B;  4HCB A;  4ATO A;  4YRT A;  1YIJ T;  2RNA A;  3PMT A;  2XID A;  3CPF A;  3BJU A;  4YRQ A;  1WZO A;  3VUZ A;  3M4G A;  2CT4 A;  1Z9Z A;  1KQ1 A;  2O9S A;  2P4T A;  1KMN A;  1BIB A;  3GNG A;  4YCU A;  2K6D A;  1OQK A;  4IUT A;  2EBP A;  1WYX A;  2YRC A;  3A5Z B;  3CCU T;  2OTJ T;  3M0Q A;  1GL5 A;  1EFN A;  2A0F B;  3A31 A;  1KMM A;  3CMA Q;  1MHN A;  1HK9 A;  1QKW A;  1WQ7 A;  2ZAE A;  4DA4 A;  2D9T A;  2FZG B;  4WF2 A;  3IAL A;  1YGB A;  1EIY B;  3HL8 A;  2NYS A;  2FZC B;  2XDB A;  2HQE A;  1M3A A;  2X4Y A;  2XIC A;  3CBM A;  2EJG A;  5L8R E;  3G1J A;  3NEM A;  3KUF A;  3REX A;  2DTI A;  5FU7 B;  4BE1 A;  4Q6G A;  1X2K A;  3NTK A;  3UH0 A;  3M59 A;  4EMK A;  2RHQ A;  1QVP A;  4WJ4 A;  2CP7 A;  2M1H A;  1SER A;  5GAO q;  4DBQ A;  1AT1 B;  2XMF A;  4YYE A;  3QG1 A;  3QWX X;  3VBB A;  3C94 A;  5I11 A;  3ZL7 C;  1GCP A;  1BCM A;  4M78 C;  3RL6 A;  2ZZE A;  2K4Y A;  2LJ0 A;  1WXB A;  2O9V A;  4IKF A;  2BZ8 A;  1WJS A;  3TU4 K;  1ZA2 B;  4FW2 A;  5GAN 3;  1X6O A;  4X1V A;  3EHQ A;  3QII A;  1HC7 A;  4OP0 A;  3UGT A;  1YHQ T;  2JTF A;  4XU2 A;  1X69 A;  1ABQ A;  4Y92 A;  5CO7 A;  1WHG A;  4F7U A;  3CME T;  1H3Z A;  4P75 A;  5ELO A;  3LSQ A;  4Y28 E;  3NFC A;  4M78 F;  4Z8A A;  1C0A A;  2EPD A;  4LDY A;  3I7F A;  3A5Y A;  4TVA B;  1PSE A;  1OYX A;  3JCM c;  5KH6 A;  2D8J A;  3OBW A;  2DYB A;  3SDZ A;  5GMK j;  4NCX A;  2AT1 B;  3SD4 A;  5IHK A;  2X4J A;  2XKO C;  1UHF A;  3CCS Q;  4IUU A;  4M75 E;  2JM9 A;  1OI1 A;  5IHN A;  3U23 A;  2C0T A;  3TEH A;  2H8H A;  4CI0 C;  2MI6 A;  4K88 A;  1KOG A;  1TU0 B;  4KBM B;  4XU3 A;  3CC4 Q;  4A4G A;  1GRI A;  1VQZ A;  1WFW A;  1K8A U;  1MUZ A;  2KYB A;  1WXU A;  4HWR A;  4E2F B;  2DE0 X;  2RHY A;  2FRW A;  2CSQ A;  4PKC C;  2DX1 A;  1PD0 A;  2VB6 A;  4VUB A;  4YPF A;  4HKE A;  3MF1 A;  5GAO m;  2ZT6 A;  4M7D D;  1ZX6 A;  3EGX B;  3I55 Q;  4QQG A;  4DEX A;  4BD3 A;  1TUD A;  4JS5 A;  5KCO A;  3GIB A;  1Q82 R;  1G5H A;  1M8V A;  5CVI A;  2CZ0 B;  3RKW A;  5LJ3 d;  4MDX A;  4YRP A;  1N5Z A;  5L23 A;  2KBT A;  1MMN A;  3E2U A;  1H4T A;  3O5Z A;  5KYN A;  2QQ9 A;  3RR6 A;  4J9E A;  3CCJ Q;  3M55 A;  5F5W A;  2V8I A;  2NUT B;  4PJN A;  4BI8 B;  3R6N A;  1BBU A;  4YRS A;  5LJ3 h;  2ATC B;  1KQS P;  1FX7 A;  2GTO A;  3H0F A;  3VQW A;  4P71 C;  4Z02 A;  1M90 R;  4C92 E;  3C12 A;  3GP8 A;  1VQ8 Q;  2DKG A;  4QVD A;  2ZZF A;  1Q7Y C;  2IY5 A;  1FMV A;  2KXC A;  3HPW A;  2DVE A;  2EYY A;  1I81 A;  2H3J A;  1SHF A;  4P3N A;  3JCM h;  5C0M A;  4HVW A;  1ZSZ A;  3M9Q A;  5GAM d;  5GAO l;  3GOX A;  2F2X A;  3VRZ A;  3QTC A;  4P73 A;  5LJ5 d;  1ABO A;  1SPK A;  2MIO A;  2CUB A;  4EX5 A;  1KK7 A;  1AVZ C;  3NMZ C;  3TCJ A;  1VQ5 A;  1RI9 A;  1YP5 A;  2ABL A;  2ARS A;  5GAM h;  3OYB A;  4PJO A;  3L2V A;  1S72 T;  1CKA A;  1O75 A;  5LJ5 h;  1C6V X;  1FYF A;  2O2O A;  3NHN A;  2K7A A;  3CMQ A;  2W0Z A;  2KAF A;  4XTX A;  2IPO B;  2HEQ A;  3ER0 A;  2KRN A;  1ADY A;  2MCN A;  3HRI A;  3G1Z A;  1H4V B;  3CD6 Q;  1WQW A;  5FWC A;  1ASZ A;  4AT1 B;  1RAI B;  1VQL Q;  2BTT A;  2LT4 A;  2ROL A;  2YRV A;  3JCM b;  4TTV A;  1M2V B;  1FYN A;  2HDA A;  2K2M A;  1ZUK A;  1YJ9 T;  2JN0 A;  1PG5 B;  2F2V A;  5CQX A;  1AD5 A;  2LTO A;  2X9H A;  5HKC A;  4M75 D;  3PT9 A;  3RBB B;  2CZ7 B;  5GAN h;  2E6Z A;  2DET A;  2GFA A;  4F17 A;  2DU5 A;  5IN1 A;  3ULR B;  2VWF A;  2JMA A;  2XK0 A;  2O01 E;  2O88 A;  2ZCF B;  5DLQ E;  2K3B A;  2BZY A;  3C0C A;  1Y71 A;  4RKU E;  4C0G A;  3JCM f;  4RTT A;  1K73 R;  3HFV A;  1VOM A;  4M4Z A;  1WXT A;  2DL5 A;  2J05 A;  5FU6 B;  4E7L A;  2EYW A;  2FYK A;  4YDQ A;  3CXC P;  3MO8 A;  3RUX A;  3UA6 A;  1VQ9 A;  1VQM Q;  4JJD A;  4Y91 A;  4UP8 A;  4UPA A;  4BI3 A;  1D3B B;  2XG8 D;  5LJ5 f;  3ME9 A;  4BW9 A;  1MMG A;  5IAY A;  2A3L A;  1W2B A;  3EGD B;  1WHL A;  3JB9 I;  1RAG B;  2RHU A;  3CC7 A;  4E7I A;  2CIM A;  3M53 A;  3V7C A;  4RUG A;  4C92 D;  2P84 A;  2M16 A;  3SWN B;  3E1S A;  1IHV A;  2EQI A;  3G71 A;  1WU7 A;  1X75 C;  4IUP A;  1VQO Q;  2ARU A;  3MEA A;  2ZR2 A;  1CSK A;  1NJ2 A;  1YJN A;  4ELZ C;  4X34 A;  1JU5 C;  1USY A;  1YB3 A;  1U5S A;  3I56 A;  5GAN f;  1YWP A;  3LH0 A;  4F7U G;  3MQZ A;  4E7K A;  1Q81 C;  2Q7H A;  1JEG A;  2RK1 A;  3HRU A;  2LQK A;  4H2T A;  2QA4 Q;  1V76 A;  4H2Y A;  5AT1 B;  2KEA A;  3VS2 A;  1M3B A;  1GBQ A;  2R58 A;  2CJB A;  3JAM E;  3CC2 Q;  5FW9 A;  4M77 E;  3H41 A;  4YRC A;  3E9H A;  2PQW A;  3D7S B;  8ATC B;  4ZGD B;  4M7A E;  2YDL A;  1VQ6 Q;  1VYV A;  2ZGW A;  3TQ7 P;  4DOW A;  3LC0 A;  2ZPE B;  1WHK A;  2HKQ B;  3EGU A;  4R56 A;  1GFD A;  2ODR C;  1VQ5 T;  1OZ2 A;  1PSF A;  4TVW A;  2ZIO A;  4HCK A;  4JS4 A;  4AG2 C;  1MV0 B;  4LUE A;  1B76 A;  3CCR Q;  1K0S A;  2L3P A;  4PFP A;  2DMO A;  1UDL A;  2M51 A;  2ED0 A;  3A8M B;  3G7Z A;  3LLR A;  5GAO n;  2PU9 B;  4V2S A;  3L2U A;  1X6B A;  1UE9 A;  3P8Y A;  4OB1 B;  2QEX Q;  2JTM A;  2LT1 A;  1UJY A;  2V26 A;  1JJC A;  2YLB A;  3REA B;  2GFU A;  4HA8 A;  1JRI A;  4MZM A;  2RQR A;  3V8L A;  4JDS A;  5D6X A;  3MF2 A;  2LCL A;  4J15 A;  1VQ4 Q;  1K1Z A;  2EAY A;  1OUL A;  3REU A;  1GGM A;  1SSH A;  2LJ1 A;  3LGL A;  3TEG A;  3GLX A;  2OAW A;  4YCW A;  2RA2 A;  3C95 A;  3OYN A;  2FZK B;  5KYX A;  2JVV A;  2V8J A;  1NYR A;  4Q5W A;  1N9R A;  3RIR A;  1AWJ A;  2DAQ A;  4ZTZ B;  1UGR B;  4PLI A;  2CRE A;  1YN8 A;  2QHU A;  1BBW A;  4DPG A;  2L8D A;  2QAZ A;  4IIO A;  3CMA A;  2LRQ A;  2BIV A;  3VS4 A;  5GAN 2;  4D6W A;  5AYF A;  1FMW A;  1B34 A;  4H2W A;  3M0T A;  3HTR A;  3VS7 A;  4QQD A;  1T3S A;  1YIT Q;  3HHT B;  4KH1 B;  2MF2 A;  1VQP Q;  2FRY A;  3WQZ A;  2DIG A;  1QP2 A;  2HL3 A;  4PJO G;  1UGQ B;  3CC7 T;  4L6V 5;  1T3L A;  5GAO p;  1RUW A;  2VGN A;  2BZX A;  2OTL A;  3P8T A;  1RL2 A;  3M57 A;  3G4S Q;  1YCY A;  4DEY A;  3G6E A;  3A8H B;  3CPW P;  1GFC A;  1MNE A;  3G71 T;  1BK2 A;  3I35 A;  5GAO r;  2AKL A;  3HXV A;  4NL3 A;  3VS5 A;  3FJP A;  3JB9 D;  1NJI U;  3WVE B;  3H6Z A;  4M77 D;  4FYX B;  1VQN Q;  4M7A D;  1VQ7 A;  3I56 T;  2A37 A;  2ZZG A;  1FWZ A;  2DVJ A;  3S3O A;  2GQV A;  3LH5 A;  1DJ7 B;  3R6O A;  1IO6 A;  2DBM A;  3HFO A;  2JNG A;  3HXX A;  4OMQ A;  3A1P A;  1KHC A;  2CJ9 A;  3HXU A;  1IRE B;  2ZPG B;  2X4W A;  1K8A C;  2ZT5 A;  1I1J A;  3OW2 A;  2M02 A;  2EKO A;  1SET A;  5GMK h;  1G83 A;  2KMT A;  4C8Q E;  3M0R A;  4ZTU B;  2EIF A;  2QQS A;  4FT2 A;  1I07 A;  5D6Y A;  3QXE B;  1KQS A;  3RER A;  1NJ8 A;  2FPF A;  4N4I A;  4P74 A;  1NPP A;  3PVQ A;  4ZTF A;  1ZQ1 A;  1W2B P;  1K9A A;  2J6K A;  4ZIB A;  4P72 A;  3VS3 A;  1G2B A;  3A8O B;  2J3M A;  4OGC A;  1PKT A;  1UUE A;  5GAN 8;  2ZPB B;  2COY A;  1BIA A;  4OMO A;  3ASK A;  2FG0 A;  1B7T A;  5FRN A;  3HFZ B;  4CS2 A;  1KQS S;  2LC4 A;  3CCM Q;  1Z7M A;  4LVL A;  1JQQ A;  3R07 A;  4CH3 A;  2CGH A;  1X55 A;  2JMC A;  1TH7 A;  1D0X A;  2SEM A;  1YWO A;  5CQY A;  3PCO A;  4K11 A;  3OYE A;  1YFN A;  2B8A A;  4J6X A;  3E9I A;  2R57 A;  2C7I A;  5CIU A;  1I5L A;  4XEM A;  2ECZ A;  3CCV Q;  4JZ3 A;  1C1A A;  2DD4 A;  2QI2 A;  2AMC B;  3THK A;  1BB9 A;  2DD5 A;  4J6Y A;  3PNW C;  5GJV B;  1AWO A;  1B70 B;  3VKI A;  4EPC A;  2BE9 B;  3EG3 A;  1Y0M A;  3PVL A;  5CCA A;  1N9S A;  2RHZ A;  3ZFJ A;  3OYI A;  4LNS A;  2FPD A;  2P0Q A;  3UAT A;  4AFQ C;  3PIO A;  3CCJ A;  4WTO B;  1QKX A;  1NYG A;  3V8K A;  3VUB A;  1YIJ Q;  4A54 A;  2PUO B;  4NOY A;  4AG1 C;  2HCK A;  4ANJ A;  1B7Y B;  4LVM A;  1WGS A;  1EVK A;  2ALY A;  3CCU Q;  1YI2 A;  3A8G B;  2PVD B;  1UHC A;  3EG1 A;  3JCM P;  2OTJ Q;  1H4S A;  2RJF A;  4CH4 A;  4PK4 A;  4ME7 A;  1ARK A;  2MAM A;  2HL5 C;  2CS7 A;  2OTL T;  2PTK A;  2Y90 A;  3V7R A;  3G6E T;  3GNF B;  2O4X B;  4CH5 A;  4LD9 K;  1NLO C;  3RKY A;  4HT4 A;  4D8D A;  2P0P A;  1H64 1;  1M1G A;  4KGV B;  1NLP C;  2GCX A;  4EIK A;  1U1S A;  2XI9 A;  3CXC A;  4C0Z A;  3QO5 A;  4M75 A;  4XTU A;  4RTZ A;  4BB7 A;  4P3O A;  2ZPI B;  4C8Q D;  3EH2 A;  1TS9 A;  1VQ7 T;  1U3O A;  5A0D A;  5CR2 A;  2DA9 A;  3TRE A;  1KC8 U;  1SRL A;  1PKS A;  5FU6 C;  1T0J A;  4N0A A;  1YBY A;  2QDL A;  3Q1J A;  3CXC S;  12AS A;  1KFZ A;  2JXB A;  3MCA B;  1NJ6 A;  1Y7X A;  4UC4 A;  3QPH A;  1X2Q A;  2QAS A;  2YLC A;  2ROT A;  4G85 A;  3DLL A;  3MEV A;  2E12 A;  2E4H A;  3IQL A;  2KR3 A;  4M78 E;  1BYM A;  4TVR A;  1ZA1 B;  2XDD A;  5KYW A;  2VXF A;  1YHQ Q;  1GXI E;  4X9C A;  2K9G A;  2RF0 A;  2NUZ A;  3SWN C;  2QTX A;  1WYD A;  3CME Q;  1LVK A;  1W66 A;  5IH2 A;  2VAS A;  5GMK m;  1X56 A;  4C92 A;  1WHH A;  1V1C A;  1BCO A;  1M4Z A;  4FSS A;  1D1B A;  4YRO A;  5CKB A;  2E3C A;  3OSS C;  3QJY A;  4PFZ A;  4DBR A;  1OU9 A;  1RLQ C;  2PUK B;  4GBQ A;  2ED1 A;  1G5V A;  3VQY A;  1AOJ A;  4MDW A;  4ZGJ B;  2A7Y A;  2NLU A;  2VUB A;  1VQK A;  1Q7Y R;  1WDX A;  1M30 A;  3AT1 B;  8AT1 B;  3DB3 A;  4II1 A;  1XTD A;  2EQK A;  3OW2 P;  1EX4 A;  1AHJ B;  2V1R A;  1ZSG A;  1QVF A;  1EOV A;  4P71 A;  2CP0 A;  1TTH B;  4LDU A;  1M1K U;  3P8V A;  4AH6 A;  1M9S A;  1KG1 A;  2DEU A;  1HJD A;  1Y96 B;  2QXF A;  3HFN A;  1Q95 G;  2P4R A;  1WLE A;  1JJ2 P;  2RHS B;  1K9M U;  2DXT A;  4H02 A;  1NE8 A;  3CCE A;  1UB4 A;  1E1T A;  5GMK l;  2LCC A;  4QW2 A;  3UA7 A;  4F7U F;  4Z89 A;  1EVL A;  3E9F A;  5KYU A;  4L59 A;  2I4M A;  5HGQ A;  2B86 A;  3MEY A;  2CP5 A;  4OVA A;  4H2X A;  2DRK A;  4OML A;  3QYH B;  1N8R U;  4MML A;  4MZP A;  1YI2 T;  2AKK A;  3S3M A;  2DL8 A;  2GGR A;  1X6G A;  1E6H A;  1TUC A;  4PG3 A;  4J9F A;  2Q7E A;  2DQ0 A;  1PYS A;  2JTE A;  4WCI A;  5DY9 A;  2JJ9 A;  2AK5 A;  4LE9 A;  4X5O A;  2RO0 A;  3ZBD A;  4M7D G;  2ZPH B;  2WSF E;  2FEI A;  3S3N A;  4J9G A;  4NS5 A;  3C4S A;  2MOX A;  2E10 A;  2RJD A;  2CSI A;  2RI3 A;  4RMF A;  2QQR A;  3PZC A;  2Q5I A;  1IGU A;  3JCM W;  3CCL A;  2FL7 A;  4M7D B;  1SG5 A;  3OYL A;  2YT6 A;  1NJI R;  4TQD A;  4K86 A;  3CBP A;  5GMK i;  3DB4 A;  3IG2 A;  5KYY A;  3CCR A;  4M78 D;  5GAN 6;  3NTI A;  4F14 A;  4XK8 E;  4E7H A;  1AZE A;  1UFF A;  2EQM A;  1FXX A;  3QO3 A;  2M9U A;  4C5H A;  2DIL A;  3E9G A;  2EKH A;  3J80 E;  3IKM B;  1S72 Q;  4WI1 A;  2YSQ A;  1W1F A;  2LQ8 A;  3CPW A;  1NM7 A;  1R77 A;  2LQN A;  2KY9 A;  2DQ3 A;  3BY7 A;  2CP2 A;  3A7A A;  1Q86 U;  4PNO A;  2VC8 A;  3RES A;  5HK0 A;  4TVY A;  3OYY A;  2IVW A;  4BI4 A;  2CH4 A;  5A0L A;  5KCH A;  2F5T X;  2IIM A;  2L5Q A;  1WJQ A;  1IL2 A;  5LJ3 f;  2NUP A;  2BUD A;  2JOY A;  3GBQ A;  1VQ4 A;  1X2G A;  2X51 A;  3BW1 A;  4EDU A;  3A7R A;  1IZ6 A;  2YXY A;  1K76 A;  4PJO C;  3OYA A;  3CPW S;  1E24 A;  3EFO A;  1GCQ C;  2MK5 A;  3X26 B;  1NJI C;  2DTH A;  1YJ9 Q;  4FL6 A;  3VS0 A;  2RQV A;  3MKD A;  3M4Q A;  3OYM A;  3QDF A;  2K3X A;  2W10 A;  2RPN A;  9ATC B;  3BDL A;  2G6F X;  2COW A;  2F5K A;  4ZN1 A;  4RCC A;  1G5I A;  4FU6 A;  2JT4 A;  2CDT A;  2QGG A;  4A4K A;  4E6R A;  4MMK A;  1BI3 A;  5GAM f;  2QDY B;  3QKJ A;  4M77 A;  1Q81 R;  3L4G A;  2EJ9 A;  4OMP A;  2FHD A;  4PJO F;  4M7A A;  1VQK T;  4EO4 A;  1C0M A;  1RI0 A;  4RTU A;  5K1X A;  1WHM A;  2HBP A;  4UP9 A;  4YP0 A;  4EMK B;  2RHQ B;  5HCK A;  2EQJ A;  4M75 G;  4J9H A;  4N4G A;  4KQE A;  4FW1 A;  1EFW A;  4ZTJ A;  1D09 B;  5HK3 A;  5LJ3 e;  5C52 B;  2Z0W A;  1PRM C;  2J6O A;  3A7U A;  1J5W A;  3LSS A;  4YRN A;  1W2B S;  3CCE T;  3OYC A;  1VQN A;  1QCF A;  1BKB A;  3HKS A;  3JCM e;  4FM4 B;  2KE9 A;  2ZPF B;  3H0I A;  4J8O A;  4O2D A;  3QZ9 B;  5KNN A;  2EWN A;  2XDP A;  4F7U B;  1MV3 A;  2CP6 A;  3VS6 A;  3QZ5 B;  3H9N A;  1EQR A;  2V1Q A;  1VYT A;  1RAH B;  3QHS A;  5GAM e;  4H2V A;  4HVC A;  5KYW B;  1RIQ A;  3I9Q A;  5J39 A;  5C53 B;  5LJ5 e;  5ECA A;  2DZC A;  4LVJ A;  3TSZ A;  1OX8 A;  4HCZ A;  1PRL C;  2L3R A;  4C92 G;  1OEB A;  1SSF A;  1EIY A;  3EH1 A;  2BE7 D;  3CCL T;  3M0S A;  4N4H A;  4RG8 A;  4OLF A;  1ZUU A;  3HXZ A;  1USY C;  3JCM V;  1BI0 A;  3J7A F;  4KR2 A;  2E70 A;  1WNL A;  3OYG A;  2Y4X A;  3REB B;  4AMC A;  2DJQ A;  1G3Y A;  1QVF P;  3TEH B;  1VQ5 Q;  4HCC A;  2OAU A;  2Y4Y A;  1KC8 R;  4XTW A;  4AFZ C;  1MMA A;  4F16 A;  3CCM A;  5ELN A;  1JBM A;  2DJZ A;  1WIE A;  3LX7 A;  4CC7 A;  2DIQ A;  3FDR A;  4KT0 E;  5GAN e;  1IHW A;  1WX6 A;  4RQF A;  2KT8 A;  1I0C A;  3CCQ A;  1TSF A;  2DBK A;  2L89 A;  1G8X A;  4XTV A;  1YJW A;  3L1A A;  3MP6 A;  2X4X A;  1XJW B;  4P5N A;  3RGL A;  4JRQ A;  1JB0 E;  3HXY A;  4X9D A;  4RG2 A;  3CCV A;  2K5L A;  4C0D B;  2DYI A;  3DKM A;  4PLL A;  3X25 B;  2RHX A;  4R0K A;  2E1H A;  3MP1 A;  5CK9 A;  3RKX A;  4CC2 A;  4C5G A;  4JLG A;  1N27 A;  2ZZD A;  1EZZ B;  2V8K A;  1Y07 A;  1D0Y A;  1KC8 C;  1AZG B;  2ZIM A;  2RMO A;  2COZ A;  3OYH A;  3M0U A;  1Q82 U;  2Q5H A;  2C0I A;  6AT1 B;  2DF6 A;  1ATI A;  4PFO A;  2CUD A;  5I2M A;  4YCV A;  1VQ9 T;  1M3C A;  2IY5 B;  4TVA A;  2QG9 B;  4J9D A;  2E6N A;  4IUR A;  4CC3 A;  4C8Q A;  2JW4 A;  5IT9 E;  1K8A R;  3UGQ A;  4OB2 B;  1PYS B;  4BDY A;  4RQE A;  1NYQ A;  1ZSZ B;  4C5E A;  4EMH A;  2KK4 A;  1M90 U;  1LYL A;  3CBO A;  2LCS A;  1X2H A;  3JCM g;  2F69 A;  4PJO B;  1OV3 A;  4C5I A;  2LQW A;  4LVI A;  1XQH A;  1M1K R;  3FRN A;  3INZ A;  1QWE A;  4QVC A;  1YJN T;  3CC7 Q;  1SRM A;  1UTI A;  1K9M R;  4XEO A;  2DK3 A;  3EG2 A;  3ERR A;  5GAM g;  3X20 B;  3EFS A;  2I4L A;  5CKF A;  1QVG P;  4E7S A;  3L2R A;  4BDZ A;  5LJ5 g;  4DOV A;  2X35 A;  1HXD A;  3EGX A;  2VYT A;  3QYG B;  3G71 Q;  3HY1 A;  4Q15 A;  4OB0 B;  3A74 A;  2OX7 A;  1SKU B;  2KI7 A;  3A32 A;  2RM4 A;  1JO8 A;  3OYD A;  3OS5 A;  1N8R R;  5C51 B;  2A08 A;  3JRZ A;  2AKW A;  3I56 Q;  1PHT A;  1D1A A;  2ZR3 A;  1JJ2 A;  2NUT A;  4B9W A;  4CC4 B;  2GBQ A;  3I5S A;  2RH2 A;  2PMF A;  1IGQ A;  2JM8 A;  3PFS A;  1M1K C;  4KRT A;  3OW2 S;  2RHI A;  2RJC A;  3JV3 A;  2XHC A;  3OB9 A;  5GAN g;  2PVO B;  1YFS A;  2ZT8 A;  1RAC B;  1K9M C;  2ODR D;  2NWM A;  2PME A;  3A98 A;  2VV5 A;  1QCN A;  1JJ2 S;  3JB9 G;  1E7O A;  2DM1 A;  1QWF A;  4M77 G;  4J6W A;  3CCS A;  1MGQ A;  4M7A G;  1RAA B;  1RAD B;  3MJX A;  2X3W D;  4TWA A;  1VUB A;  1BBZ A;  1VIF A;  1F1B B;  4O6J A;  1B07 A;  1R0B G;  1N8R C;  4OMN A;  5EC7 A;  3CC4 A;  4M7A B;  3CCQ T;  1QE0 A;  1K73 U;  3M56 A;  4BE2 A;  2EYX A;  1UGV A;  1YJW T;  4LDW A;  2C06 A;  3TEE A;  2KVQ G;  3I55 A;  4P74 C;  1NBE B;  2MYS A;  3JSC A;  3H8Z A;  4PL6 A;  2RD1 A;  2YUQ A;  2G3R A;  4P72 C;  1PWT A;  3EG9 A;  4M7D C;  3SB2 A;  2LNV A;  1M2V A;  2GQI A;  4J83 A;  3T9N A;  3JCM X;  2ZNI A;  3SHW A;  3CMA T;  2LMJ A;  1TG0 A;  3WVD B;  4B6M A;  2ZXF A;  5J3B A;  1U1T A;  3DSQ A;  4WJ3 M;  3M5A A;  4HWP A;  2BKD N;  1OX9 A;  2RB6 A;  4NL2 A;  3X28 B;  3MET A;  2KNB B;  1UEC A;  4QQ6 A;  5E3I A;  2FPE A;  1VQ8 A;  2DL7 A;  2E3I A;  2GTJ A;  2I0N A;  1Q86 C;  3SFM A;  3M4Y A;  3ICA A;  2QTV A;  1SHG A;  2MMP A;  3NET A;  1KSW A;  4M78 A;  1K4U S;  2VGM A;  2DO3 A;  4H2U A;  1I4K 1;  4LD6 A;  4M7D E;  4M7D F;  5EG2 A;  4KR3 A;  3JB9 H;  2E5K A;  1YFT A;  4JPB W;  1OOT A;  2LVM A;  4BE0 A;  4IIM A;  2CYZ B;  4DBH A;  4H2S A;  1W6X A;  2RQU A;  2RI2 A;  3KFV A;  3HY0 A;  1D3B A;  1W4S A;  3FLG A;  2OTL Q;  1MMD A;  2DL4 A;  3VU3 C;  3EGD A;  1BI2 A;  3L42 A;  3G6E Q;  4ZGE B;  4BY6 B;  2DEQ A;  4KGX B;  2C0O A;  2I4O A;  2A8E A;  5GMK e;  4L87 A;  3CD6 A;  2JZ2 A;  3FC3 A;  2DXC A;  5I2S A;  5IXB A;  5D6W A;  1NEG A;  1JJC B;  3L2Q A;  3SWN A;  4J5Y A;  2LNH B;  1VQL A;  1OZ3 A;  1S72 A;  3OSV A;  1TWB A;  2KGT A;  2CH4 W;  2L2P A;  5J26 A;  5FWB A;  1VQ7 Q;  2LZ6 B;  4XQ3 A;  3VYG A;  1G3W A;  3OYJ A;  1TUG B;  5HY6 A;  1VYU A;  1PD1 A;  1OU8 A;  4EMK C;  2KDS A;  4LVK A;  3VQV A;  1M5Q 1;  1NJ1 A;  5KYX B;  1UGP B;  4C0F A;  1KD1 U;  2CKK A;  2E3H A;  2HBW A;  4YRK A;  4KUD K;  4JRP A;  4FYY B;  4M75 C;  2FVU A;  1PM3 A;  2IG0 A;  1ASY A;  2DTO A;  2R5A A;  1YJ9 A;  2HSE B;  2DL3 A;  3MEU A;  4XTY A;  1SF9 A;  3M54 A;  4E7Z A;  4C8Q G;  3CCS T;  4E7J A;  1H8K A;  4N0A C;  4FIB A;  5GAN 4;  1B34 B;  3M58 A;  3PIP A;  2D6F A;  2X3X D;  3OY9 A;  1FMK A;  4YRJ A;  4CH6 A;  1G51 A;  2QYZ A;  1WJR A;  3QJ6 A;  2YRD A;  3UDC A;  5CKH A;  2EYQ A;  4C8Q B;  5CAI A;  3CC4 T;  2JUF A;  1E1O A;  2E65 A;  2DZ9 A;  1VQM A;  2I2L A;  2KSS A;  1W70 A;  3LGF A;  4OF1 A;  4P75 C;  4YRG A;  2QHT A;  3H0H A;  4O5V A;  4M75 F;  1OPL A;  2CT3 A;  4JRI A;  1J3T A;  2L3S A;  1VA7 A;  7AT1 B;  3WXM B;  1M8M A;  3P8H A;  1QQJ A;  3I55 T;  2NS6 A;  4K87 A;  2SRC A;  4KH0 B;  4LXC A;  2EQU A;  3VYH B;  4JRK A;  4XAX B;  1PNJ A;  4HXJ A;  3QO8 A;  5FLX E;  2EW3 A;  3TVT A;  3DLM A;  1VQO A;  3UPU A;  4RMO A;  2E5Q A;  4C92 C;  3CCJ T;  4AFS C;  2YUO A;  4GY5 A;  3UT1 A;  4D8K A;  3HP9 A;  4F7U E;  2KYM A;  4XU1 A;  1QVF S;  2J3L A;  3HRT A;  3MEW A;  1AEY A;  1LPL A;  1I5O B;  2VXE A;  2LX7 A;  3OBY A;  2G4C A;  1VQ8 T;  2D1X A;  2QA4 A;  4FT4 A;  3V8J A;  3S6W A;  2MWO A;  1ACM B;  2AKW B;  2RJE A;  2EJF A;  1QCO A;  4LDX A;  2RQT A;  4A63 B;  3CC2 A;  4JJC A;  1UEB A;  4HVU A;  3RNJ A;  2L0A A;  2P0K A;  3UWN A;  1D0Z A;  1VQ6 A;  4HWS A;  4C92 F;  1NJ5 A;  3OYK A;  3JCM d;  4C0D C;  1B8A A;  1YI2 Q;  5CKD A;  1XOV A;  1U8R A;  2JS2 A;  3HRK A;  2D8H A;  3PGG A;  4GLM A;  3V7S A;  3GF5 A;  3RMQ A;  4E47 A;  2J7I A;  1SES A;  1NPR A;  2ZCE A;  1Q82 C;  4UP7 A;  1MND A;  3O8V A;  1KQ2 A;  3OS0 A;  4Z88 A;  1LJO A;  4HVV A;  2QHV A;  3CD6 T;  3LW5 E;  2PVG B;  4J9I A;  1X01 A;  1VQL T;  1XNI A;  3LWI A;  1GCQ A;  3NEN A;  2XGT A;  2QEX A;  3OA6 A;  3PCO B;  2WSE E;  4FYV B;  2LDM A;  4FCY A;  1M1F A;  2RN8 A;  3OS2 A;  2YHT A;  1ZSZ C;  1M90 C;  2EYZ A;  3E19 A;  2DER A;  3EG0 A;  4YRF A;  4P73 C;  2Q7G A;  3L2W A;  2XD0 A;  3EFR A;  1IXD A;  1QVG A;  1LCK A;  4HWO A;  3MHX A;  3VQX A;  4LUD A;  3EG9 B;  5GAN d;  3N5B B;  2KQW A;  4J9B A;  3RDV A;  1HSQ A;  1NZ9 A;  4LNP A;  2DDZ A;  5I21 A;  4HWT A;  3KBG A;  2CP3 A;  3PE0 A;  5FRO A;  3A8L B;  3JB9 J;  3NEL A;  4M78 G;  1QVG S;  1ZLM A;  4R55 A;  4A53 A;  2LP5 A;  3EAE A;  2DU7 A;  1B3Q A;  2ALY B;  4OMF B;  2QQA A;  1VQM T;  2EGA A;  1NNH A;  1R0C B;  4M78 B;  2HMA A;  2GNC A;  2K3Y A;  1YIT A;  4PJO E;  4OGE A;  1KJW A;  1JXO A;  1VQP A;  3NPF A;  11AS A;  1R8O B;  4PJM A;  1WHJ A;  1O9S A;  1AWW A;  2F2W A;  1UJ0 A;  3HFZ A; 
#chains in the Genus database with same CATH homology
 2RK2 A;  3G4S A;  4CS4 A;  4KUI A;  2MWP A;  3F70 A;  5KE3 A;  4HT8 A;  4M75 B;  4ELY C;  1VQO T;  4YTL A;  3GPL A;  3HSB A;  1BI1 A;  3NTH A;  1L0W A;  4BUG A;  1QW1 A;  4YRL A;  1LOJ A;  2K2V A;  2EL9 A;  2AMC A;  3OMG A;  3OS1 A;  5A0G A;  2QA4 T;  4M77 C;  2FB7 A;  1YFR A;  1K73 C;  1B70 A;  1H4Q A;  4M7A C;  4KUL A;  2WAC A;  2GF7 A;  2HQX A;  3A5Z A;  3CC2 T;  4YRM A;  2WSC E;  1VQ6 T;  3BFM A;  4EMG A;  4P3P A;  1QP3 A;  2ZNJ A;  2HNI A;  3ZEH A;  3JCM J;  1B7Y A;  3JB9 F;  3OYF A;  5LJ3 j;  4M77 F;  4C92 B;  3CCR T;  4M7A F;  4ZN3 A;  4A4F A;  3OD1 A;  4LDV A;  3FB9 A;  1SRY A;  2P0L A;  2DXU A;  2I4N A;  2O4X A;  4J7I A;  5M9O A;  2P5I A;  3RF1 A;  2QEX T;  4RDX A;  2K5F A;  3UFG A;  1P92 A;  4DQ2 A;  3VV0 A;  1VQ4 T;  5FRM A;  5DLO A;  3QBY A;  5K1P A;  2LX9 A;  4YRI A;  4JLI A;  5GAM j;  3M4P A;  5LJ5 j;  1ZBX A;  4PJO D;  1Q7Y U;  4E51 A;  4IUV A;  1G3T A;  4BAC A;  3FEO A;  3OQ5 A;  1I8F A;  3BDU A;  2RI5 A;  5FU7 C;  2CZ1 B;  4BY6 C;  3QSU A;  3VJP A;  4H2X B;  3KFU A;  1YIJ A;  2R5M A;  1E22 A;  4CS3 A;  1QF6 A;  5LJ3 g;  4HT9 A;  1ZHI A;  1WPY A;  1YIT T;  2K57 A;  2C8M A;  3CCU A;  1VQP T;  2OTJ A;  5GAN j;  1V29 B;  3FIF A;  1N9W A;  3OMC A;  1LNX A;  3J81 E;  3QUI A;  3KXT A;  2ZT7 A;  1KD1 C;  3AHU A;  3G4S T;  5DM7 R;  4MZT A;  1KHI A;  4RCB A;  4OB3 B;  1ADJ A;  4JJN K;  4IUQ A;  4JUV A;  4XU0 A;  2HAX A;  4A4H A;  1UGS B;  3HRS A;  3LWH A;  2QHS A;  3RAC A;  2HD0 A;  4GLK A;  1VQN T;  2AHJ B;  5C6S A;  2CZ6 B;  3X24 B;  4QVZ A;  4J7F A;  4FSX A;  5GAN 5;  2ART A;  4C8Q C;  3QO7 A;  3URG A;  2XU8 A;  1Y96 A;  2RHS A;  1Z7N A;  2K5I A;  2D0Q B;  5A2Q E;  4XTZ A;  3PMI A;  2QQB A;  1YHQ A;  3MP8 A;  2DPP B;  3HXW A;  1X54 A;  3CME A;  2E41 A;  2ZIN A;  4C8Q F;  2E64 A;  4YRR A;  3QDR B;  3TUP A;  3P8D A;  3W3S A;  3CCM T;  3LYI A;  4PHC A;  3L4G B;  4M77 B;  4B9X A;  4L5G A;  3L2Z A;  3IKL A;  2ZTG A;  2EFI A;  4M7D A;  3JCM Q;  2E5A A;  1N6A A;  4G84 A;  1HTT A;  5KE2 A;  3CCV T;  1G3S A;  1VIE A;  5LL6 S;  1Q81 U;  3QNE A;  3CEY A;  3PTA A;  1EIF A;  4TQF A;  3RMS A;  4CRI A;  2CJA A;  5CKE A;  5GAN 7;  2DXB A;  2M0O A;  4A4E A;  3HTZ A;  4BWA A;  2XTI A;  3P8B B;  4HCB A;  4ATO A;  4YRT A;  1YIJ T;  3PMT A;  2XID A;  3CPF A;  3BJU A;  4YRQ A;  3VUZ A;  3M4G A;  1KMN A;  4YRE A;  1KQ1 A;  2P4T A;  1BIB A;  3GNG A;  4YCU A;  4IUT A;  3A5Z B;  3CCU T;  2OTJ T;  3A31 A;  1KMM A;  1MHN A;  1HK9 A;  1WQ7 A;  4DA4 A;  2D9T A;  4WF2 A;  3IAL A;  1YGB A;  1EIY B;  3HL8 A;  2XDB A;  2HQE A;  2X4Y A;  2XIC A;  3CBM A;  2EJG A;  5L8R E;  3NEM A;  3KUF A;  3REX A;  2DTI A;  5FU7 B;  4BE1 A;  4Q6G A;  3UH0 A;  3NTK A;  3M59 A;  4EMK A;  2RHQ A;  1QVP A;  4WJ4 A;  2M1H A;  1SER A;  5GAO q;  4YYE A;  3QG1 A;  3VBB A;  3C94 A;  4M78 C;  3RL6 A;  2ZZE A;  2K4Y A;  4IKF A;  1WJS A;  3TU4 K;  5GAN 3;  1X6O A;  3QII A;  1HC7 A;  4OP0 A;  3UGT A;  1YHQ T;  2JTF A;  4XU2 A;  5CO7 A;  3CME T;  4F7U A;  5ELO A;  1H3Z A;  4P75 A;  3LSQ A;  4Y28 E;  3NFC A;  4M78 F;  1C0A A;  4LDY A;  3I7F A;  3A5Y A;  4TVA B;  1PSE A;  1OYX A;  3JCM c;  5KH6 A;  3OBW A;  3SDZ A;  5GMK j;  4NCX A;  3SD4 A;  2X4J A;  2XKO C;  4IUU A;  4M75 E;  1OI1 A;  3TEH A;  4CI0 C;  2MI6 A;  4K88 A;  1KOG A;  4KBM B;  4XU3 A;  4A4G A;  1VQZ A;  1K8A U;  4HWR A;  2RHY A;  4PKC C;  4VUB A;  4YPF A;  4HKE A;  3MF1 A;  5GAO m;  2ZT6 A;  4M7D D;  4QQG A;  4BD3 A;  4JS5 A;  5KCO A;  3GIB A;  1G5H A;  1M8V A;  5CVI A;  2CZ0 B;  3RKW A;  5LJ3 d;  4MDX A;  4YRP A;  1H4T A;  2QQ9 A;  3M55 A;  5F5W A;  2V8I A;  4BI8 B;  4YRS A;  1BBU A;  5LJ3 h;  1FX7 A;  3VQW A;  4P71 C;  4Z02 A;  4C92 E;  3C12 A;  3GP8 A;  2DKG A;  4QVD A;  2ZZF A;  1Q7Y C;  2IY5 A;  3HPW A;  2DVE A;  2H3J A;  1I81 A;  4P3N A;  3JCM h;  5C0M A;  3M9Q A;  5GAM d;  5GAO l;  3GOX A;  3QTC A;  4P73 A;  5LJ5 d;  4EX5 A;  1VQ5 A;  3TCJ A;  2ARS A;  5GAM h;  3OYB A;  4PJO A;  3L2V A;  1S72 T;  1O75 A;  5LJ5 h;  1FYF A;  3CMQ A;  2KAF A;  4XTX A;  3ER0 A;  1ADY A;  3HRI A;  3G1Z A;  1H4V B;  1WQW A;  1ASZ A;  2LT4 A;  2YRV A;  3JCM b;  4TTV A;  1YJ9 T;  2JN0 A;  5CQX A;  2LTO A;  5HKC A;  4M75 D;  3PT9 A;  2CZ7 B;  5GAN h;  2E6Z A;  2GFA A;  2DU5 A;  5IN1 A;  2XK0 A;  2O01 E;  2ZCF B;  5DLQ E;  1Y71 A;  4RKU E;  4C0G A;  3JCM f;  3HFV A;  5FU6 B;  4E7L A;  2FYK A;  4YDQ A;  3MO8 A;  3RUX A;  1VQ9 A;  4Y91 A;  4UP8 A;  4UPA A;  4BI3 A;  1D3B B;  2XG8 D;  5LJ5 f;  3ME9 A;  4BW9 A;  5IAY A;  2A3L A;  1W2B A;  3JB9 I;  2RHU A;  3CC7 A;  4E7I A;  2CIM A;  3M53 A;  3V7C A;  4C92 D;  2M16 A;  3SWN B;  3E1S A;  3G71 A;  1WU7 A;  1X75 C;  4IUP A;  2ARU A;  3MEA A;  2ZR2 A;  1NJ2 A;  1YJN A;  4ELZ C;  4X34 A;  1USY A;  1YB3 A;  3I56 A;  5GAN f;  3LH0 A;  4F7U G;  3MQZ A;  4E7K A;  1Q81 C;  2Q7H A;  2RK1 A;  3HRU A;  2LQK A;  4H2T A;  4H2Y A;  2R58 A;  2CJB A;  3JAM E;  4M77 E;  4YRC A;  3E9H A;  2PQW A;  4ZGD B;  4M7A E;  2ZGW A;  4DOW A;  3LC0 A;  2ZPE B;  4R56 A;  2ODR C;  1VQ5 T;  1OZ2 A;  1PSF A;  4TVW A;  2ZIO A;  4JS4 A;  1B76 A;  3A8M B;  3G7Z A;  3LLR A;  5GAO n;  2PU9 B;  4V2S A;  3L2U A;  3P8Y A;  4OB1 B;  2JTM A;  2LT1 A;  1JJC A;  2YLB A;  2GFU A;  4HA8 A;  1JRI A;  4MZM A;  3V8L A;  4JDS A;  5D6X A;  3MF2 A;  2LCL A;  4J15 A;  2EAY A;  3REU A;  1GGM A;  3TEG A;  3LGL A;  3GLX A;  4YCW A;  2RA2 A;  3C95 A;  3OYN A;  2JVV A;  2V8J A;  1NYR A;  1N9R A;  4Q5W A;  3RIR A;  2DAQ A;  4ZTZ B;  1UGR B;  4PLI A;  2QHU A;  1BBW A;  4DPG A;  2L8D A;  3CMA A;  2LRQ A;  2BIV A;  5GAN 2;  4D6W A;  5AYF A;  1B34 A;  4H2W A;  4QQD A;  3HHT B;  2MF2 A;  3WQZ A;  2DIG A;  1QP2 A;  4PJO G;  1UGQ B;  3CC7 T;  4L6V 5;  5GAO p;  2VGN A;  2OTL A;  3P8T A;  1RL2 A;  3M57 A;  1YCY A;  3G6E A;  3A8H B;  3G71 T;  5GAO r;  3HXV A;  4NL3 A;  3FJP A;  3JB9 D;  1NJI U;  3WVE B;  3H6Z A;  4M77 D;  4M7A D;  1VQ7 A;  3I56 T;  2ZZG A;  1FWZ A;  3S3O A;  2GQV A;  1DJ7 B;  3R6O A;  3HFO A;  2JNG A;  3HXX A;  2CJ9 A;  1KHC A;  3HXU A;  1IRE B;  2ZPG B;  2X4W A;  1K8A C;  2ZT5 A;  3OW2 A;  2EKO A;  1SET A;  5GMK h;  2KMT A;  4C8Q E;  4ZTU B;  2EIF A;  2QQS A;  4FT2 A;  5D6Y A;  3QXE B;  1KQS A;  3RER A;  1NJ8 A;  4N4I A;  4P74 A;  1NPP A;  4ZTF A;  1ZQ1 A;  4ZIB A;  4P72 A;  3A8O B;  2J3M A;  4OGC A;  5GAN 8;  2ZPB B;  1BIA A;  3ASK A;  5FRN A;  3HFZ B;  4CS2 A;  1KQS S;  2LC4 A;  1Z7M A;  4LVL A;  3R07 A;  4CH3 A;  2CGH A;  1X55 A;  1TH7 A;  5CQY A;  3PCO A;  3OYE A;  2B8A A;  4J6X A;  3E9I A;  2R57 A;  2C7I A;  5CIU A;  1I5L A;  4XEM A;  2DD4 A;  2QI2 A;  2AMC B;  2DD5 A;  4J6Y A;  3PNW C;  1B70 B;  3VKI A;  4EPC A;  5CCA A;  1N9S A;  2RHZ A;  3ZFJ A;  3OYI A;  4LNS A;  2P0Q A;  3PIO A;  3CCJ A;  3V8K A;  3VUB A;  4A54 A;  2PUO B;  4NOY A;  1B7Y B;  4LVM A;  1WGS A;  1EVK A;  2ALY A;  1YI2 A;  3A8G B;  2PVD B;  1H4S A;  3JCM P;  2RJF A;  4CH4 A;  4ME7 A;  2MAM A;  2CS7 A;  2OTL T;  2Y90 A;  3V7R A;  3G6E T;  3GNF B;  2O4X B;  4CH5 A;  4LD9 K;  3RKY A;  4HT4 A;  2P0P A;  1H64 1;  1M1G A;  2GCX A;  1U1S A;  2XI9 A;  3CXC A;  4C0Z A;  3QO5 A;  4M75 A;  4XTU A;  4P3O A;  4BB7 A;  2ZPI B;  4C8Q D;  1VQ7 T;  5A0D A;  5CR2 A;  3TRE A;  1KC8 U;  5FU6 C;  4N0A A;  1YBY A;  3Q1J A;  3CXC S;  12AS A;  3MCA B;  1NJ6 A;  1Y7X A;  4UC4 A;  3QPH A;  2YLC A;  4G85 A;  3DLL A;  3MEV A;  2E12 A;  4M78 E;  1BYM A;  4TVR A;  2XDD A;  2VXF A;  1GXI E;  4X9C A;  3SWN C;  2QTX A;  1WYD A;  1W66 A;  5GMK m;  1X56 A;  4C92 A;  1M4Z A;  4YRO A;  5CKB A;  2E3C A;  3OSS C;  3QJY A;  2PUK B;  1G5V A;  3VQY A;  4MDW A;  4ZGJ B;  2A7Y A;  2NLU A;  2VUB A;  1VQK A;  3DB3 A;  4II1 A;  1XTD A;  2EQK A;  1AHJ B;  1QVF A;  1EOV A;  4P71 A;  1M1K U;  4LDU A;  3P8V A;  4AH6 A;  1M9S A;  1KG1 A;  1Y96 B;  1WLE A;  2QXF A;  3HFN A;  2RHS B;  1K9M U;  2DXT A;  4H02 A;  1NE8 A;  3CCE A;  1UB4 A;  1E1T A;  5GMK l;  2LCC A;  4QW2 A;  4F7U F;  1EVL A;  3E9F A;  4L59 A;  2I4M A;  5HGQ A;  3MEY A;  4OVA A;  4H2X A;  3QYH B;  1N8R U;  4MML A;  4MZP A;  1YI2 T;  3S3M A;  4PG3 A;  2Q7E A;  2DQ0 A;  1PYS A;  5DY9 A;  4X5O A;  2RO0 A;  3ZBD A;  4M7D G;  2ZPH B;  2WSF E;  3S3N A;  4NS5 A;  3C4S A;  2E10 A;  2RJD A;  4RMF A;  2RI3 A;  2QQR A;  3PZC A;  2Q5I A;  3JCM W;  3CCL A;  2FL7 A;  4M7D B;  3OYL A;  4TQD A;  4K86 A;  3CBP A;  5GMK i;  3DB4 A;  3IG2 A;  3CCR A;  4M78 D;  5GAN 6;  3NTI A;  4XK8 E;  4E7H A;  2EQM A;  1FXX A;  3QO3 A;  2M9U A;  4C5H A;  3E9G A;  3J80 E;  3IKM B;  4WI1 A;  2LQ8 A;  3CPW A;  2KY9 A;  2DQ3 A;  3BY7 A;  3A7A A;  1Q86 U;  4PNO A;  2VC8 A;  3RES A;  5HK0 A;  4TVY A;  3OYY A;  2IVW A;  4BI4 A;  5A0L A;  5KCH A;  2F5T X;  2L5Q A;  1WJQ A;  1IL2 A;  5LJ3 f;  1VQ4 A;  2BUD A;  2JOY A;  1X2G A;  3BW1 A;  4EDU A;  3A7R A;  1IZ6 A;  4PJO C;  3OYA A;  3CPW S;  1E24 A;  3X26 B;  1NJI C;  2DTH A;  4FL6 A;  3M4Q A;  3OYM A;  2K3X A;  3BDL A;  2F5K A;  4ZN1 A;  4RCC A;  1G5I A;  4FU6 A;  4A4K A;  4MMK A;  1BI3 A;  5GAM f;  2QDY B;  3QKJ A;  4M77 A;  3L4G A;  2EJ9 A;  2FHD A;  4PJO F;  4M7A A;  1VQK T;  4EO4 A;  1RI0 A;  5K1X A;  2HBP A;  4UP9 A;  4YP0 A;  4EMK B;  2RHQ B;  2EQJ A;  4M75 G;  4N4G A;  4KQE A;  1EFW A;  4ZTJ A;  5HK3 A;  5LJ3 e;  5C52 B;  3A7U A;  1J5W A;  3LSS A;  4YRN A;  1W2B S;  3CCE T;  3OYC A;  1VQN A;  1BKB A;  3HKS A;  3JCM e;  4FM4 B;  2ZPF B;  4J8O A;  4O2D A;  3QZ9 B;  5KNN A;  2EWN A;  2XDP A;  4F7U B;  3QZ5 B;  1EQR A;  3QHS A;  5GAM e;  4H2V A;  4HVC A;  1RIQ A;  5J39 A;  5C53 B;  5LJ5 e;  2DZC A;  4LVJ A;  4HCZ A;  2L3R A;  4C92 G;  1SSF A;  1EIY A;  3CCL T;  4N4H A;  4RG8 A;  4OLF A;  3HXZ A;  1USY C;  3JCM V;  1BI0 A;  3J7A F;  4KR2 A;  2E70 A;  1WNL A;  3OYG A;  2Y4X A;  1G3Y A;  3TEH B;  4HCC A;  2OAU A;  2Y4Y A;  4XTW A;  3CCM A;  5ELN A;  1JBM A;  2DJZ A;  3LX7 A;  2DIQ A;  3FDR A;  4KT0 E;  5GAN e;  4RQF A;  3CCQ A;  2L89 A;  4XTV A;  1YJW A;  3L1A A;  3MP6 A;  2X4X A;  4P5N A;  3RGL A;  4JRQ A;  1JB0 E;  3HXY A;  4X9D A;  4RG2 A;  3CCV A;  2K5L A;  4C0D B;  3DKM A;  4PLL A;  3X25 B;  2RHX A;  2E1H A;  3MP1 A;  5CK9 A;  3RKX A;  4C5G A;  4JLG A;  1N27 A;  2ZZD A;  2V8K A;  1Y07 A;  1KC8 C;  2ZIM A;  3OYH A;  1Q82 U;  2Q5H A;  1ATI A;  5I2M A;  4YCV A;  1VQ9 T;  2IY5 B;  4TVA A;  2E6N A;  4IUR A;  4C8Q A;  5IT9 E;  3UGQ A;  4OB2 B;  1PYS B;  4BDY A;  4RQE A;  1NYQ A;  4C5E A;  4EMH A;  2KK4 A;  1M90 U;  1LYL A;  3CBO A;  1X2H A;  3JCM g;  2F69 A;  4PJO B;  4C5I A;  4LVI A;  1XQH A;  3FRN A;  3INZ A;  4QVC A;  1YJN T;  4XEO A;  2DK3 A;  3ERR A;  5GAM g;  3X20 B;  3EFS A;  2I4L A;  5CKF A;  3L2R A;  4BDZ A;  5LJ5 g;  4DOV A;  2X35 A;  1HXD A;  2VYT A;  3QYG B;  3HY1 A;  4Q15 A;  4OB0 B;  3A74 A;  3A32 A;  2RM4 A;  3OYD A;  3OS5 A;  5C51 B;  3JRZ A;  2AKW A;  2ZR3 A;  1JJ2 A;  4B9W A;  2RH2 A;  2PMF A;  3PFS A;  1M1K C;  3OW2 S;  2RHI A;  2RJC A;  2XHC A;  3OB9 A;  5GAN g;  2PVO B;  1YFS A;  2ZT8 A;  1K9M C;  2ODR D;  2PME A;  2VV5 A;  1JJ2 S;  3JB9 G;  4M77 G;  4J6W A;  3CCS A;  1MGQ A;  4M7A G;  4TWA A;  1VUB A;  1VIF A;  4O6J A;  1N8R C;  3CC4 A;  4M7A B;  3CCQ T;  1QE0 A;  1K73 U;  3M56 A;  4BE2 A;  1YJW T;  4LDW A;  2C06 A;  3TEE A;  2KVQ G;  3I55 A;  4P74 C;  3JSC A;  3H8Z A;  4PL6 A;  2RD1 A;  2G3R A;  4P72 C;  4M7D C;  3SB2 A;  2LNV A;  4J83 A;  3T9N A;  3JCM X;  2ZNI A;  3CMA T;  3WVD B;  2ZXF A;  5J3B A;  1U1T A;  3DSQ A;  4WJ3 M;  3M5A A;  4HWP A;  2BKD N;  4NL2 A;  2RB6 A;  3X28 B;  3MET A;  4QQ6 A;  5E3I A;  1VQ8 A;  1Q86 C;  3SFM A;  3M4Y A;  3ICA A;  2MMP A;  3NET A;  4M78 A;  2VGM A;  2DO3 A;  4H2U A;  1I4K 1;  4LD6 A;  4M7D E;  4M7D F;  5EG2 A;  4KR3 A;  3JB9 H;  1YFT A;  2LVM A;  4BE0 A;  2CYZ B;  4H2S A;  2RI2 A;  3HY0 A;  1D3B A;  1W4S A;  3FLG A;  3VU3 C;  1BI2 A;  3L42 A;  4ZGE B;  4BY6 B;  2DEQ A;  2I4O A;  2A8E A;  5GMK e;  4L87 A;  3CD6 A;  2JZ2 A;  3FC3 A;  2DXC A;  5I2S A;  5D6W A;  1JJC B;  3L2Q A;  3SWN A;  4J5Y A;  1VQL A;  1OZ3 A;  1S72 A;  3OSV A;  5J26 A;  4XQ3 A;  3VYG A;  1G3W A;  3OYJ A;  5HY6 A;  4EMK C;  2KDS A;  4LVK A;  3VQV A;  1M5Q 1;  1NJ1 A;  1UGP B;  4C0F A;  1KD1 U;  2CKK A;  4YRK A;  4KUD K;  4JRP A;  4M75 C;  2FVU A;  2IG0 A;  1ASY A;  2DTO A;  2R5A A;  1YJ9 A;  3MEU A;  4XTY A;  3M54 A;  4C8Q G;  3CCS T;  4E7J A;  4N0A C;  4FIB A;  5GAN 4;  1B34 B;  3M58 A;  3PIP A;  2D6F A;  3OY9 A;  4CH6 A;  4YRJ A;  1G51 A;  1WJR A;  3QJ6 A;  3UDC A;  5CKH A;  2EYQ A;  4C8Q B;  5CAI A;  3CC4 T;  2JUF A;  1E1O A;  2E65 A;  2DZ9 A;  1VQM A;  2I2L A;  2KSS A;  3LGF A;  4OF1 A;  4P75 C;  4YRG A;  2QHT A;  4O5V A;  4M75 F;  4JRI A;  3WXM B;  3P8H A;  3I55 T;  2NS6 A;  4K87 A;  2EQU A;  3VYH B;  4JRK A;  4XAX B;  3QO8 A;  5FLX E;  3DLM A;  1VQO A;  3UPU A;  4RMO A;  2E5Q A;  4C92 C;  3CCJ T;  4GY5 A;  3UT1 A;  4F7U E;  3HP9 A;  4XU1 A;  1QVF S;  2J3L A;  3HRT A;  3MEW A;  2VXE A;  3OBY A;  2G4C A;  1VQ8 T;  2QA4 A;  4FT4 A;  3V8J A;  3S6W A;  2MWO A;  2AKW B;  2RJE A;  2EJF A;  4LDX A;  3CC2 A;  1UEB A;  2P0K A;  3UWN A;  1VQ6 A;  4HWS A;  4C92 F;  1NJ5 A;  3OYK A;  3JCM d;  4C0D C;  1B8A A;  5CKD A;  1XOV A;  1U8R A;  3HRK A;  3PGG A;  3V7S A;  3GF5 A;  3RMQ A;  4E47 A;  1SES A;  1NPR A;  2ZCE A;  1Q82 C;  4UP7 A;  3O8V A;  1KQ2 A;  3OS0 A;  1LJO A;  2QHV A;  3CD6 T;  3LW5 E;  2PVG B;  1X01 A;  1VQL T;  1XNI A;  3LWI A;  3NEN A;  2XGT A;  2QEX A;  3OA6 A;  3PCO B;  2WSE E;  2LDM A;  1M1F A;  3OS2 A;  2YHT A;  1M90 C;  3E19 A;  4YRF A;  4P73 C;  2Q7G A;  3L2W A;  2XD0 A;  3EFR A;  1QVG A;  4HWO A;  3MHX A;  3VQX A;  5GAN d;  3N5B B;  2KQW A;  1NZ9 A;  2DDZ A;  5I21 A;  4HWT A;  3KBG A;  5FRO A;  3A8L B;  3JB9 J;  3NEL A;  4M78 G;  1QVG S;  4R55 A;  4A53 A;  3EAE A;  2DU7 A;  2ALY B;  4OMF B;  2QQA A;  1VQM T;  1NNH A;  4M78 B;  2K3Y A;  1YIT A;  4PJO E;  4OGE A;  1VQP A;  11AS A;  1R8O B;  1O9S A;  3HFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...