2E64A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
226
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 69
structure length 226
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e64A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e64A01
4M77A 5GAOl 4PJOF 3HRIA 3HXWA 4RCCA 2ZINA 1B8AA 4TVYA 1ATIA 3VU3C 5GAOp 4ZTUB 2E3CA 2Q7GA 4M78B 1USYC 2EL9A 4NL2A 2E5AA 4M75D 4BW9A 4HWPA 3V8KA 4RMFA 4PJOB 3HRKA 2ARSA 3IALA 3P8VA 2DJZA 4H2XA 2Q5IA 1SRYA 3QSUA 3KFUA 4UPAA 4EMKB 1D3BA 4HWSA 3RKWA 4M78C 2RHSB 4F7UA 1SETA 4M75G 2DEQA 4P73A 4C8QE 4PJOC 4C92E 5GAMe 3WQZA 5LJ5e 2DQ3A 3P8YA 1B34A 1NYQA 4CH3A 4WF2A 4EMKC 2ZT6A 2DTIA 4PHCA 4YRJA 1B70B 4M7AF 4J15A 4MMKA 3JB9D 1BBUA 2ALYA 4M75A 3ERRA 5GANd 4P3PA 1EVLA 2ZNJA 3EFRA 3JCMf 4M7DF 1Y96A 5GANg 1EOVA 3NENA 5LJ3d 3MEYA 4YCUA 4CH6A 11ASA 1I5LA 5LJ3g 2E1HA 1YFTA 3LSSA 4DPGA 3V7RA 2ZGWA 4M7DB 1WYDA 4H2XB 4XQ3A 3UFGA 12ASA 1YGBA 4UP9A 3HXUA 4M7AC 2DDZA 4P3OA 5GANf 5I21A 5GMKj 3RUXA 1ADYA 1G5IA 2ZXFA 3BFMA 4M7DC 1N9RA 4K86A 3JB9I 4RDXA 1KMMA 2IY5A 1QF6A 1B34B 3RL6A 5E3IA 4P3NA 4XTWA 3HXZA 4NL3A 2ALYB 4M75B 2FYKA 2I2LA 3M4QA 3R07A 3EFSA 4H2VA 3VQYA 2P5IA 2Q5HA 1Y96B 1LNXA 2Q7HA 1M5Q1 5GMKm 3E9HA 1USYA 4EMGA 2QHVA 1B7YA 3VBBA 1ASYA 2PMEA 1G51A 2DQ0A 3JCMh 4Q15A 4XTYA 1M8VA 4LNSA 4M78A 4YRKA 3JB9H 4PJOA 1W66A 3V8JA 2HNIA 4TQFA 5GAMf 3HY0A 4C8QC 5LJ5f 2RB6A 5GAN8 4C92C 2AMCA 2QHUA 4EMKA 2IY5B 4M7AD 1HK9A 2C7IA 4XTXA 3RESA 5C52B 1LYLA 4H02A 1SESA 4Q6GA 4YRPA 2J3LA 2ODRC 1YCYA 4YROA 2DXTA 2ZZFA 3SWNC 2EWNA 4XTUA 3V8LA 3REUA 4M7AG 3CMQA 2FB7A 3A7RA 1JJCB 4AH6A 3LSQA 1NYRA 4NCXA 1WQWA 2CJ9A 3A32A 1ADJA 1KMNA 1H641 5CAIA 3GIBA 4P75C 3SB2A 4RQFA 4M7AA 3TUPA 2ZIOA 4EMHA 2ZCEA 2DXUA 3A7AA 4P72C 2ZR3A 4M7DA 4G85A 3HXXA 2DVEA 3QO8A 2Q7EA 4CH5A 3RACA 2AMCB 1NJ6A 5ELOA 3JCMd 5C53B 4YRTA 3IKMB 3REXA 4WJ4A 4A54A 3JCMV 1PYSA 3JCMg 4HA8A 1X2HA 5GAMh 4C8QD 4YP0A 4C92D 5LJ5h 4YRRA 2G4CA 4CS3A 5K1PA 4CS4A 4DQ2A 2DTOA 4H2UA 5GAN4 1X2GA 3IKLA 3PCOA 2I4MA 1YFSA 3JB9J 2ZIMA 4HWRA 1X01A 2DZ9A 2ODRD 5HGQA 3HFZB 4QVDA 1GGMA 3RF1A 4H2WA 4C8QG 4C92G 4XU2A 4UP7A 4HT8A 4XU1A 4HT9A 4EX5A 3W3SA 1U1SA 4M7AB 2CJBA 3NETA 2ZR2A 4WJ3M 3VQXA 3RKXA 2E41A 2RM4A 4C8QA 4C92A 2VXFA 1WQ7A 3JCMb 3G1ZA 4OP0A 4J6YA 1VQZA 3A5YA 1PYSB 2RA2A 3QTCA 3SWNA 1TH7A 1H4SA 2ZZEA 2VC8A 4NOYA 5KNNA 4V2SA 3PCOB 2RHQA 3V7CA 3E9IA 5GMKe 3QO7A 1Z7NA 4P71C 1IL2A 2YLCA 4P75A 2YLBA 3FJPA 1X54A 1NJ2A 4C8QF 2DTHA 5GAMd 4E51A 4C92F 5LJ5d 1JJCA 2E65A 5GAMg 4P72A 1FYFA 4H2SA 5LJ5g 4JRKA 2QHSA 3TEHB 4H2TA 2AKWA 4C8QB 4N0AC 4C92B 3A7UA 1I4K1 1LJOA 2DU7A 2VXEA 1WLEA 1H4VB 4CS2A 3RGLA 3L2ZA 1LOJA 1X55A 2QHTA 2ZT5A 4O2DA 1B76A 4YRGA 3SWNB 2P0LA 3NEMA 1U1TA 4A53A 2E10A 4L87A 3QNEA 4YPFA 1H4QA 1NNHA 2RHQB 4YCVA 3HY1A 5GANj 4XTZA 2CJAA 5GAN7 1HXDA 1E22A 4BWAA 2ZNIA 3P8TA 1I81A 1L0WA 5LJ3j 2ZT7A 4M77E 1QE0A 3PGGA 2QTXA 5GAN3 4PG3A 3HFZA 5ELNA 1J5WA 3A5ZA 4XU0A 1BBWA 4HVCA 2AKWB 3L4GB 4YYEA 1E1OA 5LJ3e 4M77G 1KOGA 3VQWA 2RD1A 4XTVA 1NJ1A 4J5YA 3PZCA 3HXYA 3RIRA 4YRIA 4F7UE 2DKGA 4TTVA 2XGTA 4P71A 3VQVA 2EAYA 5GAN2 3HXVA 2JN0A 5DY9A 4EO4A 4TVAA 4JLIA 4M75E 5K1XA 4F7UG 5GAMj 1SERA 3HFNA 5LJ5j 4JUVA 1NJ8A 4YREA 3RERA 3V7SA 1BIBA 3QO3A 4PNOA 3JCMc 4N0AA 1HC7A 4X5OA 3RKYA 5GAOm 3QUIA 2ZT8A 3A74A 2DU5A 4TVWA 4YRCA 3TEHA 3JCMW 4M77F 1ASZA 3IG2A 4ZIBA 2CGHA 4RCBA 1KQ1A 3UH0A 4YCWA 2PMFA 3BY7A 5GMKl 1NJ5A 4M77B 5GAN5 2EJFA 1HTTA 2C8MA 2ARUA 1YB3A 4P74C 4JRIA 3BJUA 4J6WA 3DSQA 4TVAB 3JB9G 5GAOn 2ARTA 3FB9A 4HWTA 5GAOq 4F7UF 3I7FA 5GMKh 4XEOA 4M77C 3HSBA 5F5WA 1EIYA 1WU7A 1N9SA 4J6XA 4WI1A 1D3BB 4KQEA 5GAOr 5GMKi 4F7UB 1RIQA 4YRLA 4YRFA 3TEGA 4M75F 5LJ3f 3ICAA 2I4OA 1Z7MA 5GAN6 4ZTZB 3HFOA 3INZA 3NELA 4YRMA 4M78E 2I4LA 3UGQA 4M78D 3L4GA 3MF1A 5C51B 3OD1A 3HTZA 4UP8A 1E24A 4PJOE 1N9WA 4PJOD 1WNLA 2Y90A 1JRIA 4P73C 4X9DA 2CIMA 4QVCA 3JCMX 3QHSA 4CH4A 4XU3A 2YHTA 1H4TA 1YFRA 4M78G 2K57A 4H2YA 1E1TA 3LC0A 4YRNA 3HFVA 2J3MA 4PJOG 4M75C 3JB9F 3JCMe 3JCMP 4TWAA 1I8FA 3UGTA 1C0AA 1KQ2A 4YRQA 4Y91A 1EIYB 3MF2A 3BW1A 3JCMJ 4HWOA 2E64A 4K87A 1JBMA 1BIAA 3L1AA 4M77D 3BDUA 3QO5A 4M7AE 3A31A 3M4GA 2EJGA 4YRSA 1EFWA 3M4PA 1WPYA 4TQDA 4KR3A 5GANe 5GANh 2ZZGA 1EQRA 2RHSA 2DZCA 4KR2A 4MMLA 3FIFA 4M7DE 4M7DD 4YDQA 4OLFA 4G84A 5LJ3h 2EJ9A 1MGQA 4K88A 1X56A 3AHUA 4X9CA 1EVKA 2ZTGA 2I4NA 4P74A 4XEMA 1B70A 2XTIA 4RQEA 3JCMQ 1G5HA 1B7YB 4M78F 4M7DG
chains in the Genus database with same CATH superfamily
4M77A 2QA4A 2CSQA 5GAOl 3HXWA 3G4SQ 2E3CA 1M1GA 4M78B 1USYC 2LDMA 2L2PA 3J7AF 4PJOB 2ARSA 2X4WA 1YITQ 2DJZA 1TWBA 1AWOA 3HRKA 2EGEA 2Q5IA 1ZSZB 4EMKB 1JEGA 2L3QA 1UE9A 3A1PA 4J9BA 1YWOA 1I07A 4HWSA 4QVZA 3VYGA 4P73A 4C8QE 2DA9A 2C06A 2DQ3A 3P8YA 1IZ6A 4MZMA 1NYQA 1M9SA 4PHCA 4YRJA 1B70B 2HQEA 2WSFE 3SHWA 1ZBXA 5FWCA 2LJ0A 4M75A 3ERRA 2CSIA 2J6OA 4FYYB 3O5ZA 3CMAA 4JZ3A 3A8LB 3HTRA 4FSSA 5IAYA 5KYUB 4M7DF 3NENA 5HKCA 4J83A 5FWBA 4CH6A 3OQ5A 5LJ3g 3HHTB 2E1HA 2RQRA 3E9FA 1K1ZA 1E6HA 3X28B 2W0ZA 12ASA 1QWEA 4KGVB 5GANf 2MPXC 3NPFA 1ADYA 2GF7A 2EGCA 2ZXFA 4FW2A 3BFMA 4M7DC 2FPEA 2MK5A 3CD6Q 4ELYC 3I35A 2CP6A 3CPWS 2XHCA 1T3LA 4C0DB 5E3IA 2VASA 1OOTA 3RMQA 1UFFA 3KUFA 3E9GA 1K8AU 3FLGA 1YIJT 4IUPA 1WXTA 2Q5HA 2CZ0B 1XQHA 2Q7HA 5GMKm 3E9HA 2V1RA 4PFZA 1USYA 3OSVA 2GNCA 4IUVA 3A8OB 4RG2A 2A8EA 1IHWA 4BI4A 1R8OB 4Z89A 4FU6A 1T0HA 1DJ7B 4KULA 2ED1A 5D6XA 2KYBA 2QASA 2R57A 2PVOB 4C8QC 1AT1B 3QDFA 1M1KC 4A63B 2C7IA 1F1BB 1X69A 1U06A 4LUEA 1LYLA 2ZPEB 1MMDA 2RQVA 4HXJA 1NJIC 2D0NA 4YROA 3G7ZA 2DXTA 1YIJA 3PVLA 1YITT 4AFUC 2QDLA 1X2QA 4BUGA 2CT3A 3LSQA 2OI3A 1N5ZA 1WQWA 2CJ9A 2A0FB 2YRDA 4AFSC 2D8HA 3CBOA 4J9EA 4DOWA 1QVFA 1SRMA 1WHMA 2DILA 4M7DA 4K11A 3M57A 3RACA 2AMCB 4E7SA 3JCMd 2RHIA 4YRTA 3IKMB 2A08A 2LVMA 1IHVA 3OYCA 1PYSA 1M3AA 1EZZB 5ECAA 1X2HA 2CREA 4C92D 3QZ5B 2G4CA 3M53A 3OYAA 2EW3A 5LL6S 4DQ2A 4TVRA 1YITA 1HSQA 3LH0A 4HWRA 3CEYA 4EDUA 2ODRD 3HFZB 2GQVA 1X43A 4H2WA 4C92G 4XU2A 2WSCE 3L2RA 1VQMQ 4HT8A 4HT9A 1U1SA 4M7AB 3H6ZA 1D1CA 3LWHA 1VQKQ 5FRNA 2O9VA 2F69A 2LQ8A 4C8QA 2BUDA 2QQBA 1Q81U 2CZ7B 3JCMb 5DM7R 1V76A 2ZPGB 2VVKA 3PMTA 1ZBJA 5CKBA 3OYMA 3QTCA 1FMVA 3PIPA 2RHZA 3QPHA 2K9GA 2OAWA 4P5NA 5HK0A 4BI3A 3E9IA 1D0YA 3E1SA 1VQ7Q 2RF0A 3H0IA 2DJQA 2YLCA 4J7FA 4C92F 1JJCA 2LX7A 3CD6A 1FYFA 2DBMA 3TEHB 3JV3A 3OB9A 1M90U 2AKWA 5CO7A 1I4K1 4C5HA 1WDXA 2QYZA 2ATCB 2LJ1A 3RGLA 1T0JA 4ZNXA 3L2ZA 1OPLA 3CCUT 1X55A 1G3SA 3META 3SWNB 3NEMA 1YJ9Q 3PVQA 4A53A 1Y07A 3KBGA 5KYYB 5KCHA 1RACB 1ZQ1A 3OYIA 1VQ4Q 4OB3B 1P92A 1SSHA 2SRCA 2D9TA 4JZ4A 6AT1B 1MMAA 1YJNQ 5LJ3j 3A8MB 4LN2A 2QTXA 5IXFA 5GAN3 4PG3A 3M0TA 4C0ZA 3A5ZA 4KH1B 1Q86C 1CKBA 3EHRA 3OBWA 2CH4A 3R6NA 2XU8A 2X35A 1R0CB 1IB8A 1KD1U 4PJJA 3CC4Q 2PZ1A 1Q7YR 4AG1C 3CCUA 1NJ1A 4J5YA 3VRYA 1K9MR 2KQWA 1SKUB 2DKGA 1KFZA 2XGTA 1NEBA 1K9MU 3KXTA 3HXVA 2QAZA 1VQKT 1AHJB 1C0MA 5D6WA 5DY9A 1R0BG 4R55A 3EH2A 3PT9A 3QKJA 1KHCA 3A8HB 2D1XA 4JUVA 4N4HA 4YREA 3QDRB 3OYLA 1BIBA 1D0XA 1PNJA 3WXMB 2CZ6B 5GAOm 3OYGA 1MMNA 2HMAA 1RAHB 2CT4A 1PSEA 1NE8A 4L59A 2DL3A 3JCMW 4OMOA 1ZSZC 3IG2A 3X24B 1KQ1A 1VQ7T 1RAAB 4F04B 1JJ2A 4OB1B 1PKTA 1AWJA 1I1JA 3I56Q 3OMCA 4D6WA 2OTLQ 5GMKl 1WHLA 2X4XA 2KDSA 3CC7T 4OMMA 2LMJA 4QT7A 1VQKA 4JRIA 1RAIB 4KH0B 2KNBB 2ZPIB 2O01E 5GAOn 3CXCA 4R0KA 2LRQA 4HWTA 4E7ZA 1NYFA 5GAOq 4IKFA 1S1NA 3U23A 1WJQA 4LNPA 1EIYA 1N9SA 4J6XA 4DBFA 1D3BB 1OULA 2V8KA 2QEXQ 4F7UB 1RIQA 5CK9A 1YI2Q 1V1CA 1YJ9T 5LJ3f 2K3BA 2ECZA 2I4OA 1Z7MA 5GAN6 4OMPA 4HVWA 4EIKA 3NELA 1HJDA 1RAGB 2RH2A 3QWXX 1VQ6Q 2KVQG 3C12A 4FT4A 1VQ7A 2DXBA 1RABB 1WNLA 1B3QA 2Y90A 1OZ3A 2MYSA 1YJNT 3OW2A 2CIMA 3ULRB 1BB9A 3QHSA 2KXCA 4IIMA 3CC7A 4CH4A 2A28A 2F5KA 2L3PA 2YHTA 4C0DC 3ZL7C 3VUBA 2K57A 2V26A 3P8VA 2FVUA 2RMOA 4YRNA 5I11A 3HFVA 5FU6B 3M59A 1ZHIA 4DA4A 3JCMe 4RTYA 4TWAA 1I8FA 5M9OA 2LC4A 2FEIA 4GLKA 2RN8A 2ENMA 3OYNA 1RADB 1I0CA 3DB3A 3L1AA 4OB0B 4M77D 1YJ9A 1ZSZA 2K6DA 3QO5A 4M7AE 3NTKA 2ESWA 2ZZDA 2BE9B 2H8HA 3M4GA 4QQGA 1WPYA 1EQRA 5HCKA 2RJEA 2BE7D 4HCCA 3VS7A 2LCCA 4LDYA 3EGXA 4BDYA 1XOVA 2JMAA 4WTOB 1UGVA 1YJNA 4X9CA 1C1AA 3OSSC 4D8DA 4R56A 1B70A 3RNJA 2QTVA 2ZCFB 4PLIA 4RQEA 1B7YB 3G71Q 2ZPBB 2VUBA 1GXIE 3OYKA 2DMOA 5KYUA 3HRIA 2MIOA 5CKHA 2DIGA 2FZCB 2IPOB 4II1A 1GBQA 2NWMA 2AKLA 5GAOp 4ZTUB 3EAEA 1U3OA 2FG0A 4M75D 4HWPA 3IALA 1V29B 4LD6A 3QSUA 2JNGA 2HCKA 1TTHB 2CH4W 3WVDB 4BACA 2OTLT 3CXCP 5HK3A 1WA7A 4M75G 5I22A 2FRYA 1XTDA 1PHTA 4AT1B 3QYGB 2WACA 3DLLA 2DTIA 4M7AF 4MMKA 2Y4YA 1PD1A 1QVFS 1GL5A 3LGLA 5GANd 3EFOA 3G6EQ 2JM9A 2IG0A 2QEXT 2KK4A 3M0SA 1YI2T 2E6ZA 3KFVA 4YCUA 2YUQA 3P8DA 3CCQQ 1UGPB 2V1QA 4IUUA 2O31A 2M1HA 1YFTA 3LSSA 4DPGA 3V7RA 1IGUA 2JTFA 5A0GA 1VQ6T 5KE2A 3M0UA 3EG1A 2JJ9A 3VS1A 1YGBA 3I56A 4UP9A 4Z88A 4M7AC 2OTLA 3ZBDA 1RI9A 1SHFA 4B9XA 1N9RA 4K86A 3CCLQ 4KUDK 1KMMA 3MP6A 1B34B 4X34A 1PCXA 5FW9A 1K0SA 3UA6A 4PL6A 1RL2A 4P3NA 4ZN1A 1QKXA 4LXCA 1VQLQ 1YNZA 4DEXA 2KMTA 2NS6A 3VQYA 1Q82R 2QEXA 4FM4B 1NZ9A 1ZUKA 1HYOA 1M5Q1 1YI2A 2FPDA 5IN1A 4LD9K 1VQ8T 2LNVA 2YDLA 4ZGDB 2DPPB 2QA4T 4LVJA 4PJNA 2QQSA 1Q82U 1G51A 3JCMh 1VQ6A 2HKNA 7AT1B 1M8VA 4LNSA 2LQWA 2DERA 1X6OA 3M55A 2MAMA 3EHQA 4OGEA 5C0MA 2AMCA 2RB6A 5GAN8 1VOMA 2QHUA 2IY5B 2RNAA 5C52B 1YBYA 2HAXA 1SESA 3VKIA 4Q6GA 4YRPA 3HKSA 2XIDA 4IURA 4CC7A 2ZZFA 3SWNC 3TSZA 2XG8D 3V8LA 5DLOA 4PFPA 3PNWC 3A7RA 1CKAA 4A4FA 2RJCA 2C0TA 1VQ8A 2FZKB 2F5TX 4HCBA 1H641 5CAIA 4RQFA 4M7AA 1UGQB 1BKBA 1D1BA 3TSWA 3MO8A 1OU9A 2B8AA 2DX1A 3G71A 3G6ET 1PWTA 1NJ6A 5ELOA 3REXA 1Q7YC 1UEBA 2LNHB 3JCMV 1K9MC 3JCMg 4MZPA 3EH1A 4ZGJB 1YHQT 4HA8A 3UA7A 4C8QD 4YP0A 2K5FA 2A36A 1KC8R 3J80E 4ELZC 2X51A 2DTOA 4RTXA 3IKLA 3H0FA 1XJWB 1X01A 2DZ9A 3CCMQ 3QYHB 3RF1A 4F17A 2VKNA 1KC8U 4C8QG 4UP7A 3EGUA 3CCLT 2OX7A 4RTTA 4WJ3M 3VQXA 3L42A 3RKXA 2E41A 1VQLT 1OZ2A 1U5SA 1UJ0A 4C5GA 4GBQA 3G6EA 3IQLA 2EQKA 1G83A 1SEMA 1VQZA 2JMCA 1K8AR 1Y0MA 4PKCC 1YHQA 2QGGA 3SWNA 1VYTA 1H4SA 1KJWA 2RQUA 3VYHB 4F16A 5KYYA 2VC8A 2ZPHB 4V2SA 1ABQA 2E5KA 3FJ5A 1NLPC 2AHJB 1QP2A 3UF4A 3CCRQ 3CCJQ 2P4TA 2MMPA 3M4YA 2MCNA 2PTKA 3FJPA 4E2FB 2K2VA 1X54A 4C8QF 5GAMd 4GLMA 4E51A 3OS5A 5A0LA 1M2OA 2RI2A 2ZAEA 5LJ5d 1JJ2S 3M5AA 3CCLA 3BDLA 1AWWA 4H2SA 1PM3A 3MP1A 2QHSA 2JM8A 1QKWA 1K73U 1GFDA 4N0AC 1VQLA 1Q95G 2X4YA 1LJOA 2QQ9A 2VXEA 1H4VB 2DETA 4C5EA 1WHHA 3CXCS 1VQNQ 4C0GA 2EBPA 3MPUB 4FYWB 4JPBW 1LOJA 2AZSA 3LWIA 4J9GA 4FSXA 2ZT5A 1K4US 1BCOA 4O2DA 4JS5A 2P0LA 2M16A 4JRPA 5D6YA 4KRTA 3G4ST 4N4GA 2CP5A 4YCVA 1W6XA 3I5SA 5KYXB 1WHKA 4XTZA 1AZGB 5GAN7 5AYFA 1HXDA 3L2VA 1E22A 1I81A 1L0WA 5FU6C 1QE0A 3TREA 3PGGA 1PD0A 3GBQA 5ELNA 3OW2S 2RPNA 2ABLA 2LT4A 3PE0A 3VV0A 4ZN3A 1BU1A 3VS2A 4O5VA 1E1OA 2J6FA 2YUOA 3QXEB 1PRLC 1N6AA 3VQWA 4XTVA 5FROA 3ZEHA 2CKKA 3PFSA 2K4YA 3PZCA 3HXYA 5A0DA 3CCMT 5J39A 2COZA 4JRQA 3G4SA 2F2XA 1VQ9Q 2EAYA 4OMNA 3OYJA 3VS4A 5K1XA 1SERA 5GAMj 3HFNA 1KQSS 5LJ5j 2ROLA 1NJ8A 1IREB 3OYEA 5KYWB 2D0QB 4X5OA 1KG1A 4PNOA 3JCMc 4N0AA 1HC7A 4JJNK 1FMKA 2CP7A 5CQYA 1Q81R 2DL4A 5HY6A 3RKYA 2QG9B 3QUIA 3CD6T 2ZT8A 2L3SA 2KEAA 5A2QE 4TVWA 1PKSA 3R6OA 2COWA 4ZIBA 3EGDB 2BZXA 1W1FA 3CCMA 2P84A 2E12A 3PMIA 2NUTA 5CIUA 3TQ7P 4YCWA 2PMFA 2K3YA 5DLQE 4M77B 4AG2C 5GAN5 2EJFA 4A4HA 3OS2A 2HKQB 2ARUA 2HL5C 1YB3A 4P74C 1O75A 4J6WA 4TVAB 3JB9G 2YSQA 3FB9A 1SPKA 4XEOA 3OYBA 2X4JA 1QWFA 2MF2A 4PFOA 1M90R 2K3XA 2RHUA 5GMKi 1QCOA 4YRLA 4YRFA 4CC4B 1OYXA 3QG1A 2V8JA 3I5RA 4KGZB 4QQ6A 3NTIA 3LGFA 3NGPA 3JSCA 4M78E 2EKHA 3UGQA 4M78D 3FRNA 3L4GA 3MF1A 1E6GA 2EPDA 4PJOE 1E24A 3CCEQ 1UB4A 3S3MA 4PJOD 5KCOA 2KT1A 2RJDA 3F70A 1YCSB 1NBEB 3CMEQ 2GBQA 1H4TA 1NEGA 1QVFP 1YFRA 1X6BA 4M78G 2MOXA 2CUDA 4H2YA 1E1TA 3LC0A 3LX7A 1U8RA 4PJOG 3JB9F 3JCMP 2BZYA 3H8ZA 5IH2A 4YRQA 3UGTA 1C0AA 2KY9A 3CC2Q 3BW1A 2J7IA 4HT4A 5CKDA 2F1LA 2YXYA 5IHIA 4HWOA 4LUDA 1NG2A 4Y92A 1QW1A 5FU7B 8ATCB 3BDUA 4L5GA 1MV0B 1KD1R 1CSKA 2J05A 2FHDA 1G5VA 2NLUA 4TQDA 1VQ9T 4KR3A 5GANh 5KYNA 4LVMA 1H8KA 4B6MA 1TSFA 2FRWA 4YDQA 1OX9A 3MP8A 2HDAA 3HRUA 4K88A 5EG2A 1X56A 4KBMB 3AHUA 1M3BA 2H3JA 4P74A 4XEMA 2IIMA 5KH6A 2CZ1B 3LLRA 2XI9A 4M78F 4HVVA 1VQMT 5L23A 1LVKA 2FO0A 4PJOF 3X20B 2ZINA 1QCFA 2Q7GA 1PC0A 5J26A 4BW9A 3GF5A 4BY6C 3RR6A 2P4RA 1SRYA 2DM1A 1MUZA 4M78C 1VQ9A 1A0NB 1SSFA 2L5QA 4PJOC 5GAMe 5LJ5e 2KXDA 1B34A 4CH3A 1RUWA 3CBPA 4WF2A 2VWFA 4EMKC 2KYMA 4LDWA 4OMLA 1BBUA 4PJMA 3ZFJA 9ATCB 2RQWA 4D8KA 2ZNJA 1VQMA 3JCMf 3LW5E 2X3XD 1TUCA 5GANg 3MEYA 2XICA 1YJWQ 2JS2A 3HL8A 2W10A 11ASA 2X3WD 2XK0A 1I5LA 1M27C 3GNFB 2ZGWA 4M7DB 2AT1B 4ZGEB 4FCYA 4XQ3A 4H2XB 3UFGA 1WZOA 1KK7A 3CCET 2EKOA 1SHGA 2R58A 2DXCA 2DDZA 2FL7A 4ATOA 4P3OA 4LDXA 1Y7XA 5I21A 4BE2A 3OMGA 3OS1A 2HBPA 2KE9A 3GPLA 1W70A 2QQRA 5CKFA 1UGSB 5IHKA 4RDXA 3JB9I 2IY5A 1T3SA 5L8RE 1QF6A 2LX9A 4RTVA 2JZ2A 5CKEA 1VQ4T 1FYNA 2RK1A 4XTWA 1K8AC 3SFMA 3E2UA 3LYIA 3UT1A 1D0ZA 3A98A 2ALYB 2FYKA 3R07A 2HZYA 2QQAA 3MJXA 4H2VA 4E7LA 2NUPB 1Y96B 2VGMA 1LNXA 3PIOA 2HBWA 2QHVA 4LVLA 3A8GB 3LH5A 2X9HA 2FZGB 1WGSA 4JJDA 2KRMA 4ORZA 2QGFB 2DQ0A 2VB6A 2DEUA 4XTYA 3CCEA 3THKA 1TG0A 4DOVA 3CC4T 4M78A 2EYXA 3DKMA 3JB9H 4PJOA 1W66A 3V8JA 2HNIA 3QJYA 4TQFA 3QZ9B 1NM7A 2KI7A 3I55Q 1YP5A 3D7SB 3HY0A 1FX7A 1TS9A 3MEVA 3MKDA 4EMKA 4M7AD 4XTXA 1VQ4A 4FT2A 1KSWA 1KQSA 1OU8A 1MHNA 4HVUA 1NJIU 2G6FX 1YCYA 2EWNA 2LZ6B 3REUA 4HCZA 4M7AG 2JXBA 2SEMA 1JJCB 1RAEB 3C94A 4NCXA 1WJRA 1MV3A 2RJFA 3N5BB 3A32A 5AT1B 3GIBA 4P75C 3SB2A 3OYDA 1JJ2P 2D8JA 5FRMA 2ZIOA 1X75C 2ZCEA 3CC4A 2DXUA 3A7AA 4BB7A 1FXXA 4G85A 2DVEA 4CH5A 4RUGA 1N8RR 2NUZA 3I56T 5C53B 4QQDA 3T9NA 1TOVA 4ANJA 1BI3A 2JOYA 2ZPFB 2XMFA 2EFIA 4FIBA 2LCLA 5GAMh 3OBYA 1N8RU 3TCJA 3OA6A 5LJ5h 4YRRA 1ZA1B 4CS3A 4CS4A 4H2UA 5GAN4 1X2GA 2I4MA 4E7IA 1YFSA 2ZIMA 1WXUA 1WYXA 4N4IA 5HGQA 4QVDA 2O9SA 1GGMA 3CMAQ 1YN8A 4EX5A 3W3SA 2QXFA 2CJBA 3PTAA 2CP0A 1ZSGA 2EYQA 2J6KA 2DLPA 2L3RA 3OW2P 2PVDB 1TUGB 1Q81C 2DD5A 2BIVA 2RM4A 4PK4A 4A4GA 1X6GA 3P8HA 2VXFA 1WQ7A 2PVGB 1VQPQ 5FLXE 2F2WA 4OP0A 2D6FA 2LP5A 2LT1A 1C6VX 4JDSA 1ZUYA 2RA2A 2LTOA 4DEYA 2Y4XA 1D1AA 1TH7A 1NPRA 1K76A 2ZZEA 4XK8E 5KE3A 1MNEA 4NOYA 3PCOB 3V7CA 1I5OB 1TU0B 1VIEA 3NTHA 3SD4A 1Y71A 2DAQA 1R77A 2GFUA 4P75A 2YLBA 2DTHA 4Q5WA 2E6NA 2DBKA 3I55T 1KQSP 3UDCA 5GAMg 2GQIA 2MI6A 5LJ5g 1M90C 4FYVB 1IGQA 4H2TA 4C92B 2AIRB 2DE0X 3CQTA 4OGCA 2YUNA 2HEQA 2QHTA 3FC3A 3G71T 1B76A 4YRGA 1OQKA 5CCAA 2E10A 4RTWA 4VUBA 5CR2A 4AFZC 2RHQB 2LCSA 5GANj 1QLYA 2GTOA 3REAB 1YIJQ 2KGTA 4BWAA 1EIFA 4LDUA 3I55A 2HQXA 1B7TA 3GLXA 5KYWA 3HFZA 1BBWA 1QVPA 4HVCA 2XDBA 3E19A 1KD1C 4YYEA 2RHYA 3OY9A 4IUTA 1BI0A 1KOGA 3C0CA 3EGDA 2E70A 3RIRA 4F7UE 3SDZA 3CCVQ 3S6WA 2HD0A 1OV3A 2F2VA 4GY5A 4J9HA 2BTTA 3CCQT 3VQVA 5GAN2 2JN0A 2KR3A 4JJBA 1Z9ZA 3GP8A 4TVAA 1ZLMA 4JLIA 1M2VB 2HL3A 4F7UG 4E7JA 2VV5A 2C0OA 1G8XA 2EQUA 4KUIA 2YRCA 1VQPT 4BI8B 1GRIA 3RERA 3V7SA 3QO3A 4CRIA 1M30A 1IO6A 2JTEA 4CI0C 1AD5A 3DB4A 3VS3A 2VGNA 2GCXA 3A74A 1YWPA 2I0NA 5IXBA 3EGXB 4QKUA 2KROA 3TEHA 2RHXA 4BDZA 2BZ8A 2PNIA 3UWNA 2CGHA 4WCIA 3QIIA 1JU5C 1M1FA 2DL5A 4DBRA 2PUKB 1NJ5A 5C6SA 3CCQA 4NS5A 1TUDA 4A4KA 2WSEE 2LQKA 3BJUA 4F7UF 3VS0A 2DF6A 4BD3A 1VQPA 1WU7A 2Z0WA 3CPFA 2HQHA 4KQEA 4WI1A 1SF9A 2YUPA 1K73R 1AVZC 1KIKA 2DRMA 4C5IA 3H41A 1H3ZA 4JJCA 3ICAA 4MDXA 1W2BS 4ZTZB 3INZA 4OMFB 2I4LA 1UG1A 5C51B 1G3TA 2GFAA 1WHGA 3OD1A 3HTZA 4DBHA 1VQOQ 4UP8A 1N9WA 2K7AA 2E3IA 3EFOB 4OVAA 4FYXB 1BBZA 2G3RA 3EG9B 4QVCA 3GOXA 4J9DA 4RMOA 5I2SA 2K79A 3MHXA 3FDRA 3VS5A 3OS0A 3URGA 1KQ2A 4Y91A 1JQQA 2QDYB 5EC7A 3MF2A 3JCMJ 3SEMA 3M56A 2AZVA 1UHCA 2EYZA 1HD3A 1QVGA 1LCKA 2E64A 1JBMA 1BIAA 1FMWA 3CCVT 3ME9A 2EJGA 1EFWA 3M4PA 4HCKA 5GANe 2DZCA 4MMLA 3FIFA 4PJLA 4LE9A 1BI2A 3CCSQ 4OLFA 4G84A 2AKKA 2RQTA 1EVKA 3WVEB 2O4XB 2P0QA 3CCUQ 1VA7A 2XTIA 3AT1B 2XDDA 4E47A 3HRTA 3QBYA 2B86A 1MNDA 4RCCA 1JXOA 1B8AA 4TVYA 1ATIA 3VU3C 1K0XA 3L2UA 2EL9A 4ME7A 4NL2A 2E5AA 4M4ZA 3V8KA 2JS0A 3ER0A 2A37A 4OB2B 4H2XA 2KT8A 4RMFA 2DFUA 2O88A 1BCMA 1EX4A 3KFUA 1PG5B 4UPAA 3CCVA 3M9QA 1D3BA 3RKWA 1ZUUA 2RHSB 4F7UA 1SETA 1N8RC 2JW4A 2DEQA 2M51A 4C92E 3M0RA 3WQZA 1VQ5Q 1QP3A 4B9WA 4C0FA 1JB0E 2ZT6A 1VIFA 2NYSA 2QI2A 1M4ZA 3CCRT 4J15A 3CCJT 5I2MA 3TEEA 3JB9D 2FPFA 2ALYA 1QCNA 4P3PA 3M0QA 1EVLA 3EFRA 1X2KA 2NUPA 1Y96A 1ACMB 4J7IA 1EOVA 5LJ3d 1GFCA 2P0PA 4ZTFA 2R5MA 3OYYA 1UTIA 2OTJQ 2RI3A 1GBRA 1WYDA 1WX6A 1VQOT 1X27A 3HXUA 1VQNT 3CBMA 3HPWA 2DL7A 4XAXB 2EYWA 5GMKj 3RUXA 1G5IA 3X26B 4CC3A 2H3EB 2MWOA 5J3BA 1BI1A 3P8BB 1QVGP 3RL6A 3EG2A 2JTMA 2HSEB 2LQNA 4OF1A 2M0YA 3CCRA 3HXZA 2E4HA 4NL3A 3CCJA 2RK2A 4M75B 3M4QA 2I2LA 3EFSA 1WXBA 1WIEA 3L2WA 2P5IA 2RO0A 2YRVA 3RMSA 3CC7Q 2EVRA 1SRLA 4EMGA 1B7YA 1XNIA 2XDPA 1Q82C 2PU9B 3VBBA 2EIFA 1ASYA 1YFNA 3EG0A 2PMEA 2PQWA 1VQOA 4Q15A 1M3CA 4IIOA 3CCST 5CQXA 1SG5A 1WJSA 3MEWA 3M54A 1VQNA 4YRKA 1O9SA 5GAMf 1UGRB 1BK2A 5LJ5f 4C92C 3M58A 1HK9A 2HSPA 3RESA 2EQIA 1FWZA 2A7YA 2EGAA 3OYFA 4H02A 3UPUA 1M8MA 2J3LA 2ODRC 2A3LA 2EQJA 4E7KA 4XTUA 3CMQA 2FB7A 2JT4A 4O6JA 3Q1JA 4AH6A 3MQZA 1NYRA 1PRMC 3RBBB 2C0IA 2P0KA 1ADJA 1KMNA 3NMZC 2BKDN 2R5AA 4Z8AA 3CCSA 3TUPA 4EMHA 1VQ5T 3UATA 4P72C 2KAFA 2ZR3A 1LPLA 1WHJA 4JS4A 3HXXA 3QO8A 1NPPA 2Q7EA 1G3WA 3S3OA 1UDLA 4WJ4A 4ESRA 4A54A 1Q7YU 4RKUE 3VS6A 3HRSA 4EPCA 2OTJT 3MEUA 1GCQC 5K1PA 3J81E 3PCOA 3JB9J 1RLQC 5GJWB 1KC8C 3BE3A 1W2BA 2CDTA 2AK5A 3CPWA 4XU1A 2DD4A 4L6V5 2DK3A 3NETA 2ZR2A 1VQ5A 2XD0A 1AZEA 4LVIA 1JXMA 2PUOB 4LVKA 4C92A 1BYMA 1ARKA 3L2QA 3G1ZA 1AWXA 3C4SA 3VJPA 3MCAB 4J6YA 3CMET 2JUFA 4LDVA 3OYHA 3A5YA 1PYSB 2OTJA 1UUEA 4E7HA 3I9QA 2J06A 8AT1B 5KNNA 2LJ3A 3CC2T 2CP3A 2RHQA 5GMKe 3QO7A 2M0OA 1Z7NA 4P71C 1IL2A 2CUBA 1OEBA 1RLPC 1VUBA 1NJ2A 1UECA 1AOJA 2E65A 1ABOA 2K5IA 4P72A 4E6RA 4JRKA 4IUQA 1K73C 4FW1A 4C8QB 1S72Q 4ZTJA 3A7UA 1ZA2B 2DU7A 4CS2A 1WLEA 3S3NA 2NUTB 1M1KR 3CMEA 4F14A 3H9NA 1GCQA 5GJVB 1GCPA 3VUZA 1NJIR 1UHFA 1WFWA 2YT6A 1OX8A 1NLOC 1U1TA 4L87A 3QNEA 4YPFA 1M1KU 1H4QA 1NNHA 4RTUA 3CC2A 1VYUA 2OAUA 4Y28E 4BE1A 3HY1A 1N27A 2CJAA 1EFNA 4RTZA 2CS7A 1JO8A 1M2VA 2ZNIA 3P8TA 1RAFB 3GNGA 3G1JA 2ZT7A 2K5LA 4M77E 2COYA 2E5QA 1J5WA 2DO3A 1VQ8Q 4XU0A 4J8OA 2RI5A 2GTJA 2AKWB 2QA4Q 2ROTA 3L4GB 3ASKA 1W2BP 5LJ3e 4M77G 3CPWP 1Y57A 4QW2A 2RD1A 3QWYA 3TVTA 3EG3A 4FL6A 4YRIA 2CP2A 3C95A 1QVGS 4OMQA 4J9FA 4TTVA 1YJWT 2DYIA 4P71A 4HKEA 1OPKA 1W4SA 1KHIA 2JVVA 4EO4A 3RDVA 4M75E 2KRSA 1H92A 3O8VA 4CC2A 1E7OA 3HP9A 3A5ZB 3JAME 2EYYA 4JLGA 4MDWA 2DU5A 4YRCA 4RG8A 4KGXB 4M77F 1ASZA 2KRNA 2V8IA 1IRXA 2L0AA 4RCBA 1NYGA 3UH0A 3EG9A 3BY7A 3MEAA 2DVJA 4Z02A 1YJWA 1HTTA 2C8MA 1G3YA 4BE0A 1UJYA 4AMCA 1YHQQ 3DLMA 3DSQA 1MMGA 1S72T 2ARTA 1TXQA 3NFCA 4PLLA 2DIQA 4DBQA 3I7FA 5GMKh 4M77C 3HSBA 5KYXA 2DL8A 1QQJA 5F5WA 2M02A 2K2MA 2L8DA 2EQMA 1J3TA 3VRZA 1OI1A 4MZTA 5GAOr 4AFQC 4KT0E 5IHNA 3TEGA 4M75F 2QK0A 2IVWA 3HFOA 3H0HA 4YRMA 2MWPA 2XKOC 1PSFA 2M9UA 3FEOA 1JRIA 4P73C 2GGRA 4X9DA 2L89A 5D7UA 3JCMX 2O4XA 1D09B 4XU3A 3QJ6A 1WLPB 1Z9QA 2J3MA 4M75C 1S72A 1WI7A 3JRZA 3REBB 3TU4K 1EIYB 2CYZB 4X1VA 1IXDA 2OJ2A 4J9IA 1Q86R 3M0PA 2VYTA 4K87A 5IT9E 1RI0A 1ZX6A 4A4EA 1H3HA 1VYVA 4YTLA 2YWWA 2ED0A 2KSSA 2DYBA 3A31A 2DNUA 4YRSA 1B07A 2KBTA 2O2OA 1Q86U 1G2BA 2E3HA 2ZZGA 2RHSA 4KR2A 4M7DE 3NHNA 4M7DD 4UC4A 5LJ3h 2EJ9A 1MGQA 2DRKA 5FU7C 2ZTGA 2I4NA 5CVIA 3X25B 1QMCA 3JCMQ 1G5HA 4J9CA 1K9AA 3CMAT 4M7DG 1AEYA 4BY6B
chains in the Genus database with same CATH topology
4M77A 2QA4A 5GAOl 3HXWA 2E3CA 1M1GA 4M78B 1USYC 2LDMA 3J7AF 4PJOB 2ARSA 2X4WA 3HRKA 2DJZA 3P8VA 2Q5IA 4EMKB 4HWSA 4QVZA 3VYGA 4P73A 4C8QE 2C06A 2DQ3A 3P8YA 1IZ6A 4MZMA 1NYQA 1M9SA 4PHCA 4YRJA 1B70B 2HQEA 2WSFE 1ZBXA 4M75A 3ERRA 3CMAA 3A8LB 5IAYA 4M7DF 3NENA 5HKCA 4J83A 4CH6A 3OQ5A 5LJ3g 3HHTB 2E1HA 3E9FA 3X28B 12ASA 5GANf 1ADYA 2GF7A 2ZXFA 3BFMA 4M7DC 4ELYC 3CPWS 2XHCA 5E3IA 4C0DB 3RMQA 3KUFA 3E9GA 1K8AU 3FLGA 1YIJT 4IUPA 2Q5HA 2CZ0B 1XQHA 2Q7HA 5GMKm 3E9HA 1USYA 3OSVA 4IUVA 3A8OB 4RG2A 2A8EA 4BI4A 1R8OB 4FU6A 1DJ7B 4KULA 5D6XA 2R57A 2PVOB 4C8QC 1M1KC 2C7IA 1LYLA 2ZPEB 1NJIC 4YROA 3G7ZA 2DXTA 1YIJA 1YITT 4BUGA 3LSQA 1WQWA 2CJ9A 3CBOA 4DOWA 1QVFA 4M7DA 3M57A 3RACA 2AMCB 3JCMd 2RHIA 4YRTA 3IKMB 2LVMA 3OYCA 1PYSA 1X2HA 4C92D 3QZ5B 2G4CA 3M53A 3OYAA 5LL6S 4DQ2A 4TVRA 1YITA 3LH0A 4HWRA 3CEYA 4EDUA 2ODRD 3HFZB 2GQVA 4H2WA 4C92G 4XU2A 2WSCE 3L2RA 4HT8A 4HT9A 1U1SA 4M7AB 3H6ZA 3LWHA 5FRNA 2F69A 2LQ8A 4C8QA 2BUDA 2QQBA 1Q81U 2CZ7B 3JCMb 5DM7R 2ZPGB 3PMTA 5CKBA 3OYMA 3QTCA 3PIPA 2RHZA 3QPHA 4P5NA 5HK0A 4BI3A 3E9IA 3E1SA 2YLCA 4J7FA 4C92F 1JJCA 3CD6A 1FYFA 3TEHB 3OB9A 1M90U 2AKWA 5CO7A 1I4K1 4C5HA 3RGLA 3L2ZA 3CCUT 1X55A 1G3SA 3META 3SWNB 3NEMA 4A53A 1Y07A 3KBGA 5KCHA 1ZQ1A 3OYIA 4OB3B 1P92A 2D9TA 5LJ3j 3A8MB 2QTXA 5GAN3 4PG3A 4C0ZA 3A5ZA 1Q86C 3OBWA 2XU8A 2X35A 1KD1U 3CCUA 1NJ1A 4J5YA 2KQWA 2DKGA 2XGTA 1K9MU 3KXTA 3HXVA 1VQKT 1AHJB 5DY9A 5D6WA 4R55A 3PT9A 3QKJA 1KHCA 3A8HB 4JUVA 4N4HA 4YREA 3QDRB 3OYLA 1BIBA 3WXMB 2CZ6B 5GAOm 3OYGA 1PSEA 1NE8A 4L59A 3JCMW 3IG2A 3X24B 1KQ1A 1VQ7T 1JJ2A 4OB1B 3OMCA 4D6WA 5GMKl 2X4XA 2KDSA 3CC7T 1VQKA 4JRIA 2ZPIB 2O01E 5GAOn 3CXCA 2LRQA 4HWTA 5GAOq 4IKFA 1WJQA 1EIYA 1N9SA 4J6XA 1D3BB 2V8KA 4F7UB 1RIQA 5CK9A 1YJ9T 5LJ3f 2I4OA 1Z7MA 5GAN6 3NELA 2RH2A 2KVQG 3C12A 4FT4A 1VQ7A 2DXBA 1WNLA 2Y90A 1OZ3A 1YJNT 2CIMA 3OW2A 3QHSA 3CC7A 4CH4A 2F5KA 2YHTA 4C0DC 3VUBA 2K57A 2FVUA 4YRNA 3HFVA 5FU6B 3M59A 1ZHIA 4DA4A 3JCMe 4TWAA 1I8FA 5M9OA 2LC4A 4GLKA 3OYNA 3DB3A 3L1AA 4OB0B 4M77D 1YJ9A 3QO5A 4M7AE 2ZZDA 3NTKA 3M4GA 4QQGA 1WPYA 1EQRA 2RJEA 4HCCA 2LCCA 4LDYA 4BDYA 1XOVA 1YJNA 4X9CA 4R56A 3OSSC 1B70A 2ZCFB 4PLIA 4RQEA 1B7YB 2ZPBB 2VUBA 1GXIE 3OYKA 3HRIA 5CKHA 2DIGA 4II1A 5GAOp 4ZTUB 3EAEA 4M75D 4HWPA 3IALA 1V29B 4LD6A 3QSUA 2JNGA 3WVDB 4BACA 2OTLT 5HK3A 4M75G 1XTDA 3QYGB 2WACA 3DLLA 2DTIA 4M7AF 4MMKA 2Y4YA 1QVFS 3LGLA 5GANd 2IG0A 2QEXT 2KK4A 1YI2T 2E6ZA 4YCUA 3P8DA 1UGPB 4IUUA 2M1HA 1YFTA 3LSSA 4DPGA 3V7RA 2JTFA 5A0GA 1VQ6T 5KE2A 1YGBA 3I56A 4UP9A 4M7AC 2OTLA 3ZBDA 4B9XA 1N9RA 4K86A 4KUDK 1KMMA 3MP6A 1B34B 4X34A 4PL6A 1RL2A 4P3NA 4ZN1A 2KMTA 2NS6A 3VQYA 2QEXA 4FM4B 1NZ9A 1M5Q1 1YI2A 5IN1A 4LD9K 1VQ8T 2LNVA 4ZGDB 2DPPB 2QA4T 4LVJA 2QQSA 1Q82U 1G51A 3JCMh 1VQ6A 1M8VA 4LNSA 1X6OA 3M55A 2MAMA 4OGEA 5C0MA 2AMCA 2RB6A 5GAN8 2QHUA 2IY5B 5C52B 1YBYA 2HAXA 1SESA 3VKIA 4Q6GA 4YRPA 3HKSA 2XIDA 4IURA 2ZZFA 3SWNC 3V8LA 2XG8D 5DLOA 3PNWC 3A7RA 4A4FA 2RJCA 1VQ8A 2F5TX 4HCBA 1H641 5CAIA 4RQFA 4M7AA 1UGQB 1BKBA 3MO8A 2B8AA 3G71A 3G6ET 1NJ6A 5ELOA 3REXA 1Q7YC 1UEBA 3JCMV 1K9MC 3JCMg 4MZPA 4ZGJB 1YHQT 4HA8A 4C8QD 4YP0A 2K5FA 3J80E 4ELZC 2DTOA 3IKLA 1X01A 2DZ9A 3QYHB 3RF1A 1KC8U 4C8QG 4UP7A 3CCLT 4WJ3M 3VQXA 3L42A 3RKXA 2E41A 1VQLT 1OZ2A 4C5GA 3G6EA 2EQKA 1VQZA 4PKCC 1YHQA 3SWNA 1H4SA 3VYHB 2VC8A 2ZPHB 4V2SA 2AHJB 1QP2A 2P4TA 2MMPA 3M4YA 3FJPA 2K2VA 1X54A 4C8QF 5GAMd 4E51A 3OS5A 5A0LA 2RI2A 5LJ5d 1JJ2S 3M5AA 3CCLA 3BDLA 4H2SA 3MP1A 2QHSA 1K73U 4N0AC 1VQLA 2X4YA 1LJOA 2QQ9A 2VXEA 1H4VB 4C5EA 3CXCS 4C0GA 1LOJA 3LWIA 4FSXA 2ZT5A 4O2DA 4JS5A 2P0LA 2M16A 4JRPA 5D6YA 3G4ST 4N4GA 4YCVA 4XTZA 5GAN7 5AYFA 1HXDA 3L2VA 1E22A 1I81A 1L0WA 5FU6C 1QE0A 3TREA 3PGGA 5ELNA 3OW2S 2LT4A 3VV0A 4ZN3A 4O5VA 1E1OA 3QXEB 3VQWA 1N6AA 4XTVA 5FROA 3ZEHA 2CKKA 3PFSA 2K4YA 3PZCA 3HXYA 5A0DA 3CCMT 5J39A 4JRQA 3G4SA 2EAYA 3OYJA 5K1XA 1SERA 5GAMj 3HFNA 1KQSS 5LJ5j 1NJ8A 1IREB 3OYEA 2D0QB 4X5OA 1HC7A 4PNOA 3JCMc 4N0AA 1KG1A 4JJNK 5CQYA 5HY6A 3RKYA 3QUIA 2ZT8A 3CD6T 5A2QE 4TVWA 3R6OA 4ZIBA 3CCMA 2E12A 3PMIA 5CIUA 4YCWA 2PMFA 2K3YA 5DLQE 4M77B 5GAN5 2EJFA 4A4HA 3OS2A 2ARUA 1YB3A 4P74C 1O75A 4J6WA 4TVAB 3JB9G 3FB9A 4XEOA 3OYBA 2X4JA 2MF2A 2K3XA 2RHUA 5GMKi 4YRLA 4YRFA 1OYXA 3QG1A 2V8JA 4QQ6A 3NTIA 3LGFA 3JSCA 4M78E 3UGQA 4M78D 3FRNA 3L4GA 3MF1A 1E24A 4PJOE 4PJOD 1UB4A 3S3MA 5KCOA 2RJDA 3F70A 1H4TA 1YFRA 4M78G 4H2YA 1E1TA 3LC0A 3LX7A 1U8RA 4PJOG 3JB9F 3JCMP 3H8ZA 3UGTA 4YRQA 1C0AA 2KY9A 3BW1A 4HT4A 5CKDA 4HWOA 1QW1A 5FU7B 3BDUA 4L5GA 2FHDA 1G5VA 2NLUA 4TQDA 1VQ9T 4KR3A 5GANh 4LVMA 4YDQA 3MP8A 3HRUA 4K88A 5EG2A 1X56A 4KBMB 3AHUA 2H3JA 4P74A 4XEMA 5KH6A 2CZ1B 3LLRA 2XI9A 4M78F 1VQMT 4PJOF 3X20B 2ZINA 2Q7GA 5J26A 4BW9A 3GF5A 4BY6C 1SRYA 4M78C 1VQ9A 1SSFA 2L5QA 4PJOC 5GAMe 5LJ5e 1B34A 4CH3A 3CBPA 4WF2A 4EMKC 4LDWA 1BBUA 3ZFJA 2ZNJA 1VQMA 3JCMf 3LW5E 5GANg 3MEYA 2XICA 3HL8A 11ASA 2XK0A 1I5LA 3GNFB 2ZGWA 4M7DB 4ZGEB 4H2XB 4XQ3A 3UFGA 3CCET 2EKOA 2R58A 2DXCA 2DDZA 2FL7A 4ATOA 4P3OA 4LDXA 1Y7XA 5I21A 4BE2A 3OMGA 3OS1A 2HBPA 3GPLA 2QQRA 5CKFA 1UGSB 4RDXA 3JB9I 2IY5A 5L8RE 1QF6A 2LX9A 2JZ2A 5CKEA 1VQ4T 2RK1A 4XTWA 1K8AC 3SFMA 3LYIA 3UT1A 2ALYB 3R07A 2FYKA 2QQAA 4H2VA 4E7LA 1Y96B 2VGMA 1LNXA 3PIOA 2QHVA 4LVLA 3A8GB 1WGSA 2DQ0A 4XTYA 3CCEA 3CC4T 4DOVA 4M78A 3DKMA 3JB9H 4PJOA 1W66A 3V8JA 2HNIA 3QJYA 4TQFA 3QZ9B 3HY0A 1FX7A 3MEVA 4EMKA 4M7AD 4XTXA 1VQ4A 4FT2A 1KQSA 1MHNA 1NJIU 1YCYA 2EWNA 3REUA 4HCZA 4M7AG 1JJCB 3C94A 4NCXA 1WJRA 2RJFA 3N5BB 3A32A 3GIBA 4P75C 3SB2A 3OYDA 5FRMA 2ZIOA 1X75C 2ZCEA 3CC4A 2DXUA 3A7AA 4BB7A 1FXXA 4G85A 2DVEA 4CH5A 3I56T 5C53B 4QQDA 3T9NA 1BI3A 2JOYA 2ZPFB 2EFIA 4FIBA 2LCLA 5GAMh 3OBYA 1N8RU 3TCJA 3OA6A 5LJ5h 4YRRA 4CS3A 4CS4A 4H2UA 5GAN4 1X2GA 2I4MA 4E7IA 1YFSA 2ZIMA 4N4IA 5HGQA 4QVDA 1GGMA 4EX5A 3W3SA 2QXFA 2CJBA 3PTAA 2EYQA 2L3RA 2PVDB 1Q81C 2DD5A 2BIVA 2RM4A 4A4GA 3P8HA 2VXFA 1WQ7A 2PVGB 5FLXE 4OP0A 2D6FA 2LT1A 4JDSA 2RA2A 2LTOA 2Y4XA 1TH7A 1NPRA 2ZZEA 4XK8E 5KE3A 4NOYA 3PCOB 3V7CA 3NTHA 1VIEA 3SD4A 1Y71A 2DAQA 2GFUA 4P75A 2YLBA 2DTHA 4Q5WA 2E6NA 3I55T 3UDCA 5GAMg 2MI6A 5LJ5g 1M90C 4H2TA 4C92B 4OGCA 2QHTA 3FC3A 3G71T 1B76A 4YRGA 5CCAA 2E10A 4VUBA 5CR2A 2RHQB 5GANj 4BWAA 1EIFA 4LDUA 3I55A 2HQXA 3GLXA 3HFZA 1BBWA 1QVPA 4HVCA 2XDBA 3E19A 1KD1C 4YYEA 2RHYA 3OY9A 4IUTA 1BI0A 1KOGA 2E70A 3RIRA 4F7UE 3SDZA 3S6WA 2HD0A 4GY5A 3CCQT 3VQVA 5GAN2 2JN0A 3GP8A 4TVAA 4JLIA 4F7UG 4E7JA 2VV5A 2EQUA 4KUIA 1VQPT 4BI8B 3RERA 3V7SA 3QO3A 4CRIA 4CI0C 3DB4A 2VGNA 2GCXA 3A74A 3TEHA 2RHXA 4BDZA 3UWNA 2CGHA 3QIIA 1M1FA 2PUKB 1NJ5A 5C6SA 3CCQA 4NS5A 4A4KA 2WSEE 2LQKA 3BJUA 4F7UF 4BD3A 1VQPA 1WU7A 3CPFA 4WI1A 4KQEA 4C5IA 1H3ZA 3ICAA 4MDXA 1W2BS 4ZTZB 3INZA 4OMFB 2I4LA 5C51B 1G3TA 2GFAA 3OD1A 3HTZA 4UP8A 1N9WA 4OVAA 2G3RA 4QVCA 3GOXA 4RMOA 5I2SA 3MHXA 3FDRA 3OS0A 3URGA 1KQ2A 4Y91A 2QDYB 3MF2A 3JCMJ 3M56A 1QVGA 2E64A 1JBMA 1BIAA 3CCVT 3ME9A 2EJGA 1EFWA 3M4PA 5GANe 2DZCA 4MMLA 3FIFA 1BI2A 4OLFA 4G84A 1EVKA 3WVEB 2O4XB 2P0QA 2XTIA 2XDDA 4E47A 3HRTA 3QBYA 4RCCA 1B8AA 4TVYA 1ATIA 3VU3C 3L2UA 2EL9A 4ME7A 4NL2A 2E5AA 3V8KA 3ER0A 4RMFA 4OB2B 4H2XA 3KFUA 4UPAA 3CCVA 3M9QA 1D3BA 3RKWA 2RHSB 4F7UA 1SETA 1N8RC 2DEQA 4C92E 3WQZA 1QP3A 4B9WA 4C0FA 1JB0E 2ZT6A 1VIFA 2QI2A 3CCRT 1M4ZA 4J15A 3CCJT 5I2MA 3TEEA 3JB9D 2ALYA 4P3PA 1EVLA 3EFRA 1Y96A 4J7IA 1EOVA 5LJ3d 2P0PA 4ZTFA 2R5MA 3OYYA 2RI3A 1WYDA 1VQOT 3HXUA 1VQNT 3CBMA 3HPWA 4XAXB 5GMKj 3RUXA 1G5IA 3X26B 2MWOA 5J3BA 1BI1A 3P8BB 3RL6A 2JTMA 4OF1A 3CCRA 3HXZA 4NL3A 3CCJA 2RK2A 4M75B 3M4QA 2I2LA 3EFSA 3L2WA 2P5IA 2RO0A 2YRVA 3RMSA 4EMGA 1B7YA 1XNIA 2XDPA 1Q82C 2PU9B 3VBBA 2EIFA 1ASYA 2PMEA 2PQWA 1VQOA 4Q15A 3CCST 5CQXA 1WJSA 3MEWA 3M54A 1VQNA 4YRKA 1O9SA 5GAMf 1UGRB 5LJ5f 4C92C 3M58A 1HK9A 3RESA 1FWZA 2A7YA 3OYFA 4H02A 3UPUA 2J3LA 2ODRC 2A3LA 2EQJA 4E7KA 4XTUA 3CMQA 2FB7A 4AH6A 4O6JA 3Q1JA 3MQZA 1NYRA 2P0KA 1ADJA 1KMNA 2BKDN 2R5AA 3CCSA 3TUPA 4EMHA 1VQ5T 4P72C 2KAFA 2ZR3A 4JS4A 3HXXA 3QO8A 1NPPA 2Q7EA 1G3WA 3S3OA 4WJ4A 4A54A 1Q7YU 4RKUE 3HRSA 4EPCA 2OTJT 3MEUA 5K1PA 3J81E 3PCOA 3JB9J 1KC8C 1W2BA 3CPWA 4XU1A 2DD4A 4L6V5 2DK3A 3NETA 2ZR2A 1VQ5A 2XD0A 4LVIA 2PUOB 4LVKA 4C92A 1BYMA 3L2QA 3G1ZA 3C4SA 3VJPA 3MCAB 4J6YA 3CMET 2JUFA 4LDVA 3OYHA 3A5YA 1PYSB 2OTJA 4E7HA 5KNNA 3CC2T 2RHQA 5GMKe 3QO7A 2M0OA 1Z7NA 4P71C 1IL2A 1VUBA 1NJ2A 2E65A 2K5IA 4P72A 4JRKA 4IUQA 1K73C 4C8QB 4ZTJA 3A7UA 2DU7A 4CS2A 1WLEA 3S3NA 3CMEA 3VUZA 1U1TA 4L87A 3QNEA 4YPFA 1M1KU 1H4QA 1NNHA 3CC2A 2OAUA 4Y28E 4BE1A 3HY1A 1N27A 2CJAA 2CS7A 2ZNIA 3P8TA 3GNGA 2ZT7A 2K5LA 4M77E 2E5QA 1J5WA 2DO3A 4XU0A 4J8OA 2RI5A 2AKWB 3L4GB 3ASKA 5LJ3e 4M77G 4QW2A 2RD1A 4FL6A 4YRIA 3C95A 1QVGS 4TTVA 1YJWT 4P71A 4HKEA 1W4SA 1KHIA 2JVVA 4EO4A 4M75E 3O8VA 3HP9A 3A5ZB 3JAME 4JLGA 4MDWA 2DU5A 4YRCA 4RG8A 4M77F 1ASZA 2V8IA 4RCBA 3UH0A 3BY7A 3MEAA 4Z02A 1YJWA 1HTTA 2C8MA 1G3YA 4BE0A 3DLMA 3DSQA 1S72T 2ARTA 3NFCA 4PLLA 2DIQA 3I7FA 5GMKh 4M77C 3HSBA 5F5WA 2L8DA 2EQMA 1OI1A 4MZTA 5GAOr 4KT0E 3TEGA 4M75F 2IVWA 3HFOA 4YRMA 2MWPA 2XKOC 1PSFA 2M9UA 3FEOA 1JRIA 4P73C 4X9DA 2L89A 3JCMX 2O4XA 4XU3A 3QJ6A 2J3MA 4M75C 1S72A 3JRZA 3TU4K 1EIYB 2CYZB 2VYTA 4K87A 5IT9E 1RI0A 4A4EA 4YTLA 2KSSA 3A31A 4YRSA 1Q86U 2ZZGA 2RHSA 4KR2A 4M7DE 4M7DD 4UC4A 5LJ3h 2EJ9A 1MGQA 5FU7C 2ZTGA 2I4NA 5CVIA 3X25B 3JCMQ 1G5HA 3CMAT 4M7DG 4BY6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 A;  5GAO l;  4PJO F;  3HRI A;  3HXW A;  4RCC A;  2ZIN A;  1B8A A;  4TVY A;  1ATI A;  3VU3 C;  5GAO p;  4ZTU B;  2E3C A;  2Q7G A;  4M78 B;  1USY C;  2EL9 A;  4NL2 A;  2E5A A;  4M75 D;  4BW9 A;  4HWP A;  3V8K A;  4RMF A;  4PJO B;  3HRK A;  2ARS A;  3IAL A;  3P8V A;  2DJZ A;  4H2X A;  2Q5I A;  1SRY A;  3QSU A;  3KFU A;  4UPA A;  4EMK B;  1D3B A;  4HWS A;  3RKW A;  4M78 C;  2RHS B;  4F7U A;  1SET A;  4M75 G;  2DEQ A;  4P73 A;  4C8Q E;  4PJO C;  4C92 E;  5GAM e;  3WQZ A;  5LJ5 e;  2DQ3 A;  3P8Y A;  1B34 A;  1NYQ A;  4CH3 A;  4WF2 A;  4EMK C;  2ZT6 A;  2DTI A;  4PHC A;  4YRJ A;  1B70 B;  4M7A F;  4J15 A;  4MMK A;  3JB9 D;  1BBU A;  2ALY A;  4M75 A;  3ERR A;  5GAN d;  4P3P A;  1EVL A;  2ZNJ A;  3EFR A;  3JCM f;  4M7D F;  1Y96 A;  5GAN g;  1EOV A;  3NEN A;  5LJ3 d;  3MEY A;  4YCU A;  4CH6 A;  11AS A;  1I5L A;  5LJ3 g;  2E1H A;  1YFT A;  3LSS A;  4DPG A;  3V7R A;  2ZGW A;  4M7D B;  1WYD A;  4H2X B;  4XQ3 A;  3UFG A;  12AS A;  1YGB A;  4UP9 A;  3HXU A;  4M7A C;  2DDZ A;  4P3O A;  5GAN f;  5I21 A;  5GMK j;  3RUX A;  1ADY A;  1G5I A;  2ZXF A;  3BFM A;  4M7D C;  1N9R A;  4K86 A;  3JB9 I;  4RDX A;  1KMM A;  2IY5 A;  1QF6 A;  1B34 B;  3RL6 A;  5E3I A;  4P3N A;  4XTW A;  3HXZ A;  4NL3 A;  2ALY B;  4M75 B;  2FYK A;  2I2L A;  3M4Q A;  3R07 A;  3EFS A;  4H2V A;  3VQY A;  2P5I A;  2Q5H A;  1Y96 B;  1LNX A;  2Q7H A;  1M5Q 1;  5GMK m;  3E9H A;  1USY A;  4EMG A;  2QHV A;  1B7Y A;  3VBB A;  1ASY A;  2PME A;  1G51 A;  2DQ0 A;  3JCM h;  4Q15 A;  4XTY A;  1M8V A;  4LNS A;  4M78 A;  4YRK A;  3JB9 H;  4PJO A;  1W66 A;  3V8J A;  2HNI A;  4TQF A;  5GAM f;  3HY0 A;  4C8Q C;  5LJ5 f;  2RB6 A;  5GAN 8;  4C92 C;  2AMC A;  2QHU A;  4EMK A;  2IY5 B;  4M7A D;  1HK9 A;  2C7I A;  4XTX A;  3RES A;  5C52 B;  1LYL A;  4H02 A;  1SES A;  4Q6G A;  4YRP A;  2J3L A;  2ODR C;  1YCY A;  4YRO A;  2DXT A;  2ZZF A;  3SWN C;  2EWN A;  4XTU A;  3V8L A;  3REU A;  4M7A G;  3CMQ A;  2FB7 A;  3A7R A;  1JJC B;  4AH6 A;  3LSQ A;  1NYR A;  4NCX A;  1WQW A;  2CJ9 A;  3A32 A;  1ADJ A;  1KMN A;  1H64 1;  5CAI A;  3GIB A;  4P75 C;  3SB2 A;  4RQF A;  4M7A A;  3TUP A;  2ZIO A;  4EMH A;  2ZCE A;  2DXU A;  3A7A A;  4P72 C;  2ZR3 A;  4M7D A;  4G85 A;  3HXX A;  2DVE A;  3QO8 A;  2Q7E A;  4CH5 A;  3RAC A;  2AMC B;  1NJ6 A;  5ELO A;  3JCM d;  5C53 B;  4YRT A;  3IKM B;  3REX A;  4WJ4 A;  4A54 A;  3JCM V;  1PYS A;  3JCM g;  4HA8 A;  1X2H A;  5GAM h;  4C8Q D;  4YP0 A;  4C92 D;  5LJ5 h;  4YRR A;  2G4C A;  4CS3 A;  5K1P A;  4CS4 A;  4DQ2 A;  2DTO A;  4H2U A;  5GAN 4;  1X2G A;  3IKL A;  3PCO A;  2I4M A;  1YFS A;  3JB9 J;  2ZIM A;  4HWR A;  1X01 A;  2DZ9 A;  2ODR D;  5HGQ A;  3HFZ B;  4QVD A;  1GGM A;  3RF1 A;  4H2W A;  4C8Q G;  4C92 G;  4XU2 A;  4UP7 A;  4HT8 A;  4XU1 A;  4HT9 A;  4EX5 A;  3W3S A;  1U1S A;  4M7A B;  2CJB A;  3NET A;  2ZR2 A;  4WJ3 M;  3VQX A;  3RKX A;  2E41 A;  2RM4 A;  4C8Q A;  4C92 A;  2VXF A;  1WQ7 A;  3JCM b;  3G1Z A;  4OP0 A;  4J6Y A;  1VQZ A;  3A5Y A;  1PYS B;  2RA2 A;  3QTC A;  3SWN A;  1TH7 A;  1H4S A;  2ZZE A;  2VC8 A;  4NOY A;  5KNN A;  4V2S A;  3PCO B;  2RHQ A;  3V7C A;  3E9I A;  5GMK e;  3QO7 A;  1Z7N A;  4P71 C;  1IL2 A;  2YLC A;  4P75 A;  2YLB A;  3FJP A;  1X54 A;  1NJ2 A;  4C8Q F;  2DTH A;  5GAM d;  4E51 A;  4C92 F;  5LJ5 d;  1JJC A;  2E65 A;  5GAM g;  4P72 A;  1FYF A;  4H2S A;  5LJ5 g;  4JRK A;  2QHS A;  3TEH B;  4H2T A;  2AKW A;  4C8Q B;  4N0A C;  4C92 B;  3A7U A;  1I4K 1;  1LJO A;  2DU7 A;  2VXE A;  1WLE A;  1H4V B;  4CS2 A;  3RGL A;  3L2Z A;  1LOJ A;  1X55 A;  2QHT A;  2ZT5 A;  4O2D A;  1B76 A;  4YRG A;  3SWN B;  2P0L A;  3NEM A;  1U1T A;  4A53 A;  2E10 A;  4L87 A;  3QNE A;  4YPF A;  1H4Q A;  1NNH A;  2RHQ B;  4YCV A;  3HY1 A;  5GAN j;  4XTZ A;  2CJA A;  5GAN 7;  1HXD A;  1E22 A;  4BWA A;  2ZNI A;  3P8T A;  1I81 A;  1L0W A;  5LJ3 j;  2ZT7 A;  4M77 E;  1QE0 A;  3PGG A;  2QTX A;  5GAN 3;  4PG3 A;  3HFZ A;  5ELN A;  1J5W A;  3A5Z A;  4XU0 A;  1BBW A;  4HVC A;  2AKW B;  3L4G B;  4YYE A;  1E1O A;  5LJ3 e;  4M77 G;  1KOG A;  3VQW A;  2RD1 A;  4XTV A;  1NJ1 A;  4J5Y A;  3PZC A;  3HXY A;  3RIR A;  4YRI A;  4F7U E;  2DKG A;  4TTV A;  2XGT A;  4P71 A;  3VQV A;  2EAY A;  5GAN 2;  3HXV A;  2JN0 A;  5DY9 A;  4EO4 A;  4TVA A;  4JLI A;  4M75 E;  5K1X A;  4F7U G;  5GAM j;  1SER A;  3HFN A;  5LJ5 j;  4JUV A;  1NJ8 A;  4YRE A;  3RER A;  3V7S A;  1BIB A;  3QO3 A;  4PNO A;  3JCM c;  4N0A A;  1HC7 A;  4X5O A;  3RKY A;  5GAO m;  3QUI A;  2ZT8 A;  3A74 A;  2DU5 A;  4TVW A;  4YRC A;  3TEH A;  3JCM W;  4M77 F;  1ASZ A;  3IG2 A;  4ZIB A;  2CGH A;  4RCB A;  1KQ1 A;  3UH0 A;  4YCW A;  2PMF A;  3BY7 A;  5GMK l;  1NJ5 A;  4M77 B;  5GAN 5;  2EJF A;  1HTT A;  2C8M A;  2ARU A;  1YB3 A;  4P74 C;  4JRI A;  3BJU A;  4J6W A;  3DSQ A;  4TVA B;  3JB9 G;  5GAO n;  2ART A;  3FB9 A;  4HWT A;  5GAO q;  4F7U F;  3I7F A;  5GMK h;  4XEO A;  4M77 C;  3HSB A;  5F5W A;  1EIY A;  1WU7 A;  1N9S A;  4J6X A;  4WI1 A;  1D3B B;  4KQE A;  5GAO r;  5GMK i;  4F7U B;  1RIQ A;  4YRL A;  4YRF A;  3TEG A;  4M75 F;  5LJ3 f;  3ICA A;  2I4O A;  1Z7M A;  5GAN 6;  4ZTZ B;  3HFO A;  3INZ A;  3NEL A;  4YRM A;  4M78 E;  2I4L A;  3UGQ A;  4M78 D;  3L4G A;  3MF1 A;  5C51 B;  3OD1 A;  3HTZ A;  4UP8 A;  1E24 A;  4PJO E;  1N9W A;  4PJO D;  1WNL A;  2Y90 A;  1JRI A;  4P73 C;  4X9D A;  2CIM A;  4QVC A;  3JCM X;  3QHS A;  4CH4 A;  4XU3 A;  2YHT A;  1H4T A;  1YFR A;  4M78 G;  2K57 A;  4H2Y A;  1E1T A;  3LC0 A;  4YRN A;  3HFV A;  2J3M A;  4PJO G;  4M75 C;  3JB9 F;  3JCM e;  3JCM P;  4TWA A;  1I8F A;  3UGT A;  1C0A A;  1KQ2 A;  4YRQ A;  4Y91 A;  1EIY B;  3MF2 A;  3BW1 A;  3JCM J;  4HWO A;  2E64 A;  4K87 A;  1JBM A;  1BIA A;  3L1A A;  4M77 D;  3BDU A;  3QO5 A;  4M7A E;  3A31 A;  3M4G A;  2EJG A;  4YRS A;  1EFW A;  3M4P A;  1WPY A;  4TQD A;  4KR3 A;  5GAN e;  5GAN h;  2ZZG A;  1EQR A;  2RHS A;  2DZC A;  4KR2 A;  4MML A;  3FIF A;  4M7D E;  4M7D D;  4YDQ A;  4OLF A;  4G84 A;  5LJ3 h;  2EJ9 A;  1MGQ A;  4K88 A;  1X56 A;  3AHU A;  4X9C A;  1EVK A;  2ZTG A;  2I4N A;  4P74 A;  4XEM A;  1B70 A;  2XTI A;  4RQE A;  3JCM Q;  1G5H A;  1B7Y B;  4M78 F;  4M7D G; 
#chains in the Genus database with same CATH topology
 4M77 A;  2QA4 A;  2CSQ A;  5GAO l;  3HXW A;  3G4S Q;  2E3C A;  1M1G A;  4M78 B;  1USY C;  2LDM A;  2L2P A;  3J7A F;  4PJO B;  2ARS A;  2X4W A;  1YIT Q;  2DJZ A;  1TWB A;  1AWO A;  3HRK A;  2EGE A;  2Q5I A;  1ZSZ B;  4EMK B;  1JEG A;  2L3Q A;  1UE9 A;  3A1P A;  4J9B A;  1YWO A;  1I07 A;  4HWS A;  4QVZ A;  3VYG A;  4P73 A;  4C8Q E;  2DA9 A;  2C06 A;  2DQ3 A;  3P8Y A;  1IZ6 A;  4MZM A;  1NYQ A;  1M9S A;  4PHC A;  4YRJ A;  1B70 B;  2HQE A;  2WSF E;  3SHW A;  1ZBX A;  5FWC A;  2LJ0 A;  4M75 A;  3ERR A;  2CSI A;  2J6O A;  4FYY B;  3O5Z A;  3CMA A;  4JZ3 A;  3A8L B;  3HTR A;  4FSS A;  5IAY A;  5KYU B;  4M7D F;  3NEN A;  5HKC A;  4J83 A;  5FWB A;  4CH6 A;  3OQ5 A;  5LJ3 g;  3HHT B;  2E1H A;  2RQR A;  3E9F A;  1K1Z A;  1E6H A;  3X28 B;  2W0Z A;  12AS A;  1QWE A;  4KGV B;  5GAN f;  2MPX C;  3NPF A;  1ADY A;  2GF7 A;  2EGC A;  2ZXF A;  4FW2 A;  3BFM A;  4M7D C;  2FPE A;  2MK5 A;  3CD6 Q;  4ELY C;  3I35 A;  2CP6 A;  3CPW S;  2XHC A;  1T3L A;  4C0D B;  5E3I A;  2VAS A;  1OOT A;  3RMQ A;  1UFF A;  3KUF A;  3E9G A;  1K8A U;  3FLG A;  1YIJ T;  4IUP A;  1WXT A;  2Q5H A;  2CZ0 B;  1XQH A;  2Q7H A;  5GMK m;  3E9H A;  2V1R A;  4PFZ A;  1USY A;  3OSV A;  2GNC A;  4IUV A;  3A8O B;  4RG2 A;  2A8E A;  1IHW A;  4BI4 A;  1R8O B;  4Z89 A;  4FU6 A;  1T0H A;  1DJ7 B;  4KUL A;  2ED1 A;  5D6X A;  2KYB A;  2QAS A;  2R57 A;  2PVO B;  4C8Q C;  1AT1 B;  3QDF A;  1M1K C;  4A63 B;  2C7I A;  1F1B B;  1X69 A;  1U06 A;  4LUE A;  1LYL A;  2ZPE B;  1MMD A;  2RQV A;  4HXJ A;  1NJI C;  2D0N A;  4YRO A;  3G7Z A;  2DXT A;  1YIJ A;  3PVL A;  1YIT T;  4AFU C;  2QDL A;  1X2Q A;  4BUG A;  2CT3 A;  3LSQ A;  2OI3 A;  1N5Z A;  1WQW A;  2CJ9 A;  2A0F B;  2YRD A;  4AFS C;  2D8H A;  3CBO A;  4J9E A;  4DOW A;  1QVF A;  1SRM A;  1WHM A;  2DIL A;  4M7D A;  4K11 A;  3M57 A;  3RAC A;  2AMC B;  4E7S A;  3JCM d;  2RHI A;  4YRT A;  3IKM B;  2A08 A;  2LVM A;  1IHV A;  3OYC A;  1PYS A;  1M3A A;  1EZZ B;  5ECA A;  1X2H A;  2CRE A;  4C92 D;  3QZ5 B;  2G4C A;  3M53 A;  3OYA A;  2EW3 A;  5LL6 S;  4DQ2 A;  4TVR A;  1YIT A;  1HSQ A;  3LH0 A;  4HWR A;  3CEY A;  4EDU A;  2ODR D;  3HFZ B;  2GQV A;  1X43 A;  4H2W A;  4C92 G;  4XU2 A;  2WSC E;  3L2R A;  1VQM Q;  4HT8 A;  4HT9 A;  1U1S A;  4M7A B;  3H6Z A;  1D1C A;  3LWH A;  1VQK Q;  5FRN A;  2O9V A;  2F69 A;  2LQ8 A;  4C8Q A;  2BUD A;  2QQB A;  1Q81 U;  2CZ7 B;  3JCM b;  5DM7 R;  1V76 A;  2ZPG B;  2VVK A;  3PMT A;  1ZBJ A;  5CKB A;  3OYM A;  3QTC A;  1FMV A;  3PIP A;  2RHZ A;  3QPH A;  2K9G A;  2OAW A;  4P5N A;  5HK0 A;  4BI3 A;  3E9I A;  1D0Y A;  3E1S A;  1VQ7 Q;  2RF0 A;  3H0I A;  2DJQ A;  2YLC A;  4J7F A;  4C92 F;  1JJC A;  2LX7 A;  3CD6 A;  1FYF A;  2DBM A;  3TEH B;  3JV3 A;  3OB9 A;  1M90 U;  2AKW A;  5CO7 A;  1I4K 1;  4C5H A;  1WDX A;  2QYZ A;  2ATC B;  2LJ1 A;  3RGL A;  1T0J A;  4ZNX A;  3L2Z A;  1OPL A;  3CCU T;  1X55 A;  1G3S A;  3MET A;  3SWN B;  3NEM A;  1YJ9 Q;  3PVQ A;  4A53 A;  1Y07 A;  3KBG A;  5KYY B;  5KCH A;  1RAC B;  1ZQ1 A;  3OYI A;  1VQ4 Q;  4OB3 B;  1P92 A;  1SSH A;  2SRC A;  2D9T A;  4JZ4 A;  6AT1 B;  1MMA A;  1YJN Q;  5LJ3 j;  3A8M B;  4LN2 A;  2QTX A;  5IXF A;  5GAN 3;  4PG3 A;  3M0T A;  4C0Z A;  3A5Z A;  4KH1 B;  1Q86 C;  1CKB A;  3EHR A;  3OBW A;  2CH4 A;  3R6N A;  2XU8 A;  2X35 A;  1R0C B;  1IB8 A;  1KD1 U;  4PJJ A;  3CC4 Q;  2PZ1 A;  1Q7Y R;  4AG1 C;  3CCU A;  1NJ1 A;  4J5Y A;  3VRY A;  1K9M R;  2KQW A;  1SKU B;  2DKG A;  1KFZ A;  2XGT A;  1NEB A;  1K9M U;  3KXT A;  3HXV A;  2QAZ A;  1VQK T;  1AHJ B;  1C0M A;  5D6W A;  5DY9 A;  1R0B G;  4R55 A;  3EH2 A;  3PT9 A;  3QKJ A;  1KHC A;  3A8H B;  2D1X A;  4JUV A;  4N4H A;  4YRE A;  3QDR B;  3OYL A;  1BIB A;  1D0X A;  1PNJ A;  3WXM B;  2CZ6 B;  5GAO m;  3OYG A;  1MMN A;  2HMA A;  1RAH B;  2CT4 A;  1PSE A;  1NE8 A;  4L59 A;  2DL3 A;  3JCM W;  4OMO A;  1ZSZ C;  3IG2 A;  3X24 B;  1KQ1 A;  1VQ7 T;  1RAA B;  4F04 B;  1JJ2 A;  4OB1 B;  1PKT A;  1AWJ A;  1I1J A;  3I56 Q;  3OMC A;  4D6W A;  2OTL Q;  5GMK l;  1WHL A;  2X4X A;  2KDS A;  3CC7 T;  4OMM A;  2LMJ A;  4QT7 A;  1VQK A;  4JRI A;  1RAI B;  4KH0 B;  2KNB B;  2ZPI B;  2O01 E;  5GAO n;  3CXC A;  4R0K A;  2LRQ A;  4HWT A;  4E7Z A;  1NYF A;  5GAO q;  4IKF A;  1S1N A;  3U23 A;  1WJQ A;  4LNP A;  1EIY A;  1N9S A;  4J6X A;  4DBF A;  1D3B B;  1OUL A;  2V8K A;  2QEX Q;  4F7U B;  1RIQ A;  5CK9 A;  1YI2 Q;  1V1C A;  1YJ9 T;  5LJ3 f;  2K3B A;  2ECZ A;  2I4O A;  1Z7M A;  5GAN 6;  4OMP A;  4HVW A;  4EIK A;  3NEL A;  1HJD A;  1RAG B;  2RH2 A;  3QWX X;  1VQ6 Q;  2KVQ G;  3C12 A;  4FT4 A;  1VQ7 A;  2DXB A;  1RAB B;  1WNL A;  1B3Q A;  2Y90 A;  1OZ3 A;  2MYS A;  1YJN T;  3OW2 A;  2CIM A;  3ULR B;  1BB9 A;  3QHS A;  2KXC A;  4IIM A;  3CC7 A;  4CH4 A;  2A28 A;  2F5K A;  2L3P A;  2YHT A;  4C0D C;  3ZL7 C;  3VUB A;  2K57 A;  2V26 A;  3P8V A;  2FVU A;  2RMO A;  4YRN A;  5I11 A;  3HFV A;  5FU6 B;  3M59 A;  1ZHI A;  4DA4 A;  3JCM e;  4RTY A;  4TWA A;  1I8F A;  5M9O A;  2LC4 A;  2FEI A;  4GLK A;  2RN8 A;  2ENM A;  3OYN A;  1RAD B;  1I0C A;  3DB3 A;  3L1A A;  4OB0 B;  4M77 D;  1YJ9 A;  1ZSZ A;  2K6D A;  3QO5 A;  4M7A E;  3NTK A;  2ESW A;  2ZZD A;  2BE9 B;  2H8H A;  3M4G A;  4QQG A;  1WPY A;  1EQR A;  5HCK A;  2RJE A;  2BE7 D;  4HCC A;  3VS7 A;  2LCC A;  4LDY A;  3EGX A;  4BDY A;  1XOV A;  2JMA A;  4WTO B;  1UGV A;  1YJN A;  4X9C A;  1C1A A;  3OSS C;  4D8D A;  4R56 A;  1B70 A;  3RNJ A;  2QTV A;  2ZCF B;  4PLI A;  4RQE A;  1B7Y B;  3G71 Q;  2ZPB B;  2VUB A;  1GXI E;  3OYK A;  2DMO A;  5KYU A;  3HRI A;  2MIO A;  5CKH A;  2DIG A;  2FZC B;  2IPO B;  4II1 A;  1GBQ A;  2NWM A;  2AKL A;  5GAO p;  4ZTU B;  3EAE A;  1U3O A;  2FG0 A;  4M75 D;  4HWP A;  3IAL A;  1V29 B;  4LD6 A;  3QSU A;  2JNG A;  2HCK A;  1TTH B;  2CH4 W;  3WVD B;  4BAC A;  2OTL T;  3CXC P;  5HK3 A;  1WA7 A;  4M75 G;  5I22 A;  2FRY A;  1XTD A;  1PHT A;  4AT1 B;  3QYG B;  2WAC A;  3DLL A;  2DTI A;  4M7A F;  4MMK A;  2Y4Y A;  1PD1 A;  1QVF S;  1GL5 A;  3LGL A;  5GAN d;  3EFO A;  3G6E Q;  2JM9 A;  2IG0 A;  2QEX T;  2KK4 A;  3M0S A;  1YI2 T;  2E6Z A;  3KFV A;  4YCU A;  2YUQ A;  3P8D A;  3CCQ Q;  1UGP B;  2V1Q A;  4IUU A;  2O31 A;  2M1H A;  1YFT A;  3LSS A;  4DPG A;  3V7R A;  1IGU A;  2JTF A;  5A0G A;  1VQ6 T;  5KE2 A;  3M0U A;  3EG1 A;  2JJ9 A;  3VS1 A;  1YGB A;  3I56 A;  4UP9 A;  4Z88 A;  4M7A C;  2OTL A;  3ZBD A;  1RI9 A;  1SHF A;  4B9X A;  1N9R A;  4K86 A;  3CCL Q;  4KUD K;  1KMM A;  3MP6 A;  1B34 B;  4X34 A;  1PCX A;  5FW9 A;  1K0S A;  3UA6 A;  4PL6 A;  1RL2 A;  4P3N A;  4ZN1 A;  1QKX A;  4LXC A;  1VQL Q;  1YNZ A;  4DEX A;  2KMT A;  2NS6 A;  3VQY A;  1Q82 R;  2QEX A;  4FM4 B;  1NZ9 A;  1ZUK A;  1HYO A;  1M5Q 1;  1YI2 A;  2FPD A;  5IN1 A;  4LD9 K;  1VQ8 T;  2LNV A;  2YDL A;  4ZGD B;  2DPP B;  2QA4 T;  4LVJ A;  4PJN A;  2QQS A;  1Q82 U;  1G51 A;  3JCM h;  1VQ6 A;  2HKN A;  7AT1 B;  1M8V A;  4LNS A;  2LQW A;  2DER A;  1X6O A;  3M55 A;  2MAM A;  3EHQ A;  4OGE A;  5C0M A;  2AMC A;  2RB6 A;  5GAN 8;  1VOM A;  2QHU A;  2IY5 B;  2RNA A;  5C52 B;  1YBY A;  2HAX A;  1SES A;  3VKI A;  4Q6G A;  4YRP A;  3HKS A;  2XID A;  4IUR A;  4CC7 A;  2ZZF A;  3SWN C;  3TSZ A;  2XG8 D;  3V8L A;  5DLO A;  4PFP A;  3PNW C;  3A7R A;  1CKA A;  4A4F A;  2RJC A;  2C0T A;  1VQ8 A;  2FZK B;  2F5T X;  4HCB A;  1H64 1;  5CAI A;  4RQF A;  4M7A A;  1UGQ B;  1BKB A;  1D1B A;  3TSW A;  3MO8 A;  1OU9 A;  2B8A A;  2DX1 A;  3G71 A;  3G6E T;  1PWT A;  1NJ6 A;  5ELO A;  3REX A;  1Q7Y C;  1UEB A;  2LNH B;  3JCM V;  1K9M C;  3JCM g;  4MZP A;  3EH1 A;  4ZGJ B;  1YHQ T;  4HA8 A;  3UA7 A;  4C8Q D;  4YP0 A;  2K5F A;  2A36 A;  1KC8 R;  3J80 E;  4ELZ C;  2X51 A;  2DTO A;  4RTX A;  3IKL A;  3H0F A;  1XJW B;  1X01 A;  2DZ9 A;  3CCM Q;  3QYH B;  3RF1 A;  4F17 A;  2VKN A;  1KC8 U;  4C8Q G;  4UP7 A;  3EGU A;  3CCL T;  2OX7 A;  4RTT A;  4WJ3 M;  3VQX A;  3L42 A;  3RKX A;  2E41 A;  1VQL T;  1OZ2 A;  1U5S A;  1UJ0 A;  4C5G A;  4GBQ A;  3G6E A;  3IQL A;  2EQK A;  1G83 A;  1SEM A;  1VQZ A;  2JMC A;  1K8A R;  1Y0M A;  4PKC C;  1YHQ A;  2QGG A;  3SWN A;  1VYT A;  1H4S A;  1KJW A;  2RQU A;  3VYH B;  4F16 A;  5KYY A;  2VC8 A;  2ZPH B;  4V2S A;  1ABQ A;  2E5K A;  3FJ5 A;  1NLP C;  2AHJ B;  1QP2 A;  3UF4 A;  3CCR Q;  3CCJ Q;  2P4T A;  2MMP A;  3M4Y A;  2MCN A;  2PTK A;  3FJP A;  4E2F B;  2K2V A;  1X54 A;  4C8Q F;  5GAM d;  4GLM A;  4E51 A;  3OS5 A;  5A0L A;  1M2O A;  2RI2 A;  2ZAE A;  5LJ5 d;  1JJ2 S;  3M5A A;  3CCL A;  3BDL A;  1AWW A;  4H2S A;  1PM3 A;  3MP1 A;  2QHS A;  2JM8 A;  1QKW A;  1K73 U;  1GFD A;  4N0A C;  1VQL A;  1Q95 G;  2X4Y A;  1LJO A;  2QQ9 A;  2VXE A;  1H4V B;  2DET A;  4C5E A;  1WHH A;  3CXC S;  1VQN Q;  4C0G A;  2EBP A;  3MPU B;  4FYW B;  4JPB W;  1LOJ A;  2AZS A;  3LWI A;  4J9G A;  4FSX A;  2ZT5 A;  1K4U S;  1BCO A;  4O2D A;  4JS5 A;  2P0L A;  2M16 A;  4JRP A;  5D6Y A;  4KRT A;  3G4S T;  4N4G A;  2CP5 A;  4YCV A;  1W6X A;  3I5S A;  5KYX B;  1WHK A;  4XTZ A;  1AZG B;  5GAN 7;  5AYF A;  1HXD A;  3L2V A;  1E22 A;  1I81 A;  1L0W A;  5FU6 C;  1QE0 A;  3TRE A;  3PGG A;  1PD0 A;  3GBQ A;  5ELN A;  3OW2 S;  2RPN A;  2ABL A;  2LT4 A;  3PE0 A;  3VV0 A;  4ZN3 A;  1BU1 A;  3VS2 A;  4O5V A;  1E1O A;  2J6F A;  2YUO A;  3QXE B;  1PRL C;  1N6A A;  3VQW A;  4XTV A;  5FRO A;  3ZEH A;  2CKK A;  3PFS A;  2K4Y A;  3PZC A;  3HXY A;  5A0D A;  3CCM T;  5J39 A;  2COZ A;  4JRQ A;  3G4S A;  2F2X A;  1VQ9 Q;  2EAY A;  4OMN A;  3OYJ A;  3VS4 A;  5K1X A;  1SER A;  5GAM j;  3HFN A;  1KQS S;  5LJ5 j;  2ROL A;  1NJ8 A;  1IRE B;  3OYE A;  5KYW B;  2D0Q B;  4X5O A;  1KG1 A;  4PNO A;  3JCM c;  4N0A A;  1HC7 A;  4JJN K;  1FMK A;  2CP7 A;  5CQY A;  1Q81 R;  2DL4 A;  5HY6 A;  3RKY A;  2QG9 B;  3QUI A;  3CD6 T;  2ZT8 A;  2L3S A;  2KEA A;  5A2Q E;  4TVW A;  1PKS A;  3R6O A;  2COW A;  4ZIB A;  3EGD B;  2BZX A;  1W1F A;  3CCM A;  2P84 A;  2E12 A;  3PMI A;  2NUT A;  5CIU A;  3TQ7 P;  4YCW A;  2PMF A;  2K3Y A;  5DLQ E;  4M77 B;  4AG2 C;  5GAN 5;  2EJF A;  4A4H A;  3OS2 A;  2HKQ B;  2ARU A;  2HL5 C;  1YB3 A;  4P74 C;  1O75 A;  4J6W A;  4TVA B;  3JB9 G;  2YSQ A;  3FB9 A;  1SPK A;  4XEO A;  3OYB A;  2X4J A;  1QWF A;  2MF2 A;  4PFO A;  1M90 R;  2K3X A;  2RHU A;  5GMK i;  1QCO A;  4YRL A;  4YRF A;  4CC4 B;  1OYX A;  3QG1 A;  2V8J A;  3I5R A;  4KGZ B;  4QQ6 A;  3NTI A;  3LGF A;  3NGP A;  3JSC A;  4M78 E;  2EKH A;  3UGQ A;  4M78 D;  3FRN A;  3L4G A;  3MF1 A;  1E6G A;  2EPD A;  4PJO E;  1E24 A;  3CCE Q;  1UB4 A;  3S3M A;  4PJO D;  5KCO A;  2KT1 A;  2RJD A;  3F70 A;  1YCS B;  1NBE B;  3CME Q;  2GBQ A;  1H4T A;  1NEG A;  1QVF P;  1YFR A;  1X6B A;  4M78 G;  2MOX A;  2CUD A;  4H2Y A;  1E1T A;  3LC0 A;  3LX7 A;  1U8R A;  4PJO G;  3JB9 F;  3JCM P;  2BZY A;  3H8Z A;  5IH2 A;  4YRQ A;  3UGT A;  1C0A A;  2KY9 A;  3CC2 Q;  3BW1 A;  2J7I A;  4HT4 A;  5CKD A;  2F1L A;  2YXY A;  5IHI A;  4HWO A;  4LUD A;  1NG2 A;  4Y92 A;  1QW1 A;  5FU7 B;  8ATC B;  3BDU A;  4L5G A;  1MV0 B;  1KD1 R;  1CSK A;  2J05 A;  2FHD A;  1G5V A;  2NLU A;  4TQD A;  1VQ9 T;  4KR3 A;  5GAN h;  5KYN A;  4LVM A;  1H8K A;  4B6M A;  1TSF A;  2FRW A;  4YDQ A;  1OX9 A;  3MP8 A;  2HDA A;  3HRU A;  4K88 A;  5EG2 A;  1X56 A;  4KBM B;  3AHU A;  1M3B A;  2H3J A;  4P74 A;  4XEM A;  2IIM A;  5KH6 A;  2CZ1 B;  3LLR A;  2XI9 A;  4M78 F;  4HVV A;  1VQM T;  5L23 A;  1LVK A;  2FO0 A;  4PJO F;  3X20 B;  2ZIN A;  1QCF A;  2Q7G A;  1PC0 A;  5J26 A;  4BW9 A;  3GF5 A;  4BY6 C;  3RR6 A;  2P4R A;  1SRY A;  2DM1 A;  1MUZ A;  4M78 C;  1VQ9 A;  1A0N B;  1SSF A;  2L5Q A;  4PJO C;  5GAM e;  5LJ5 e;  2KXD A;  1B34 A;  4CH3 A;  1RUW A;  3CBP A;  4WF2 A;  2VWF A;  4EMK C;  2KYM A;  4LDW A;  4OML A;  1BBU A;  4PJM A;  3ZFJ A;  9ATC B;  2RQW A;  4D8K A;  2ZNJ A;  1VQM A;  3JCM f;  3LW5 E;  2X3X D;  1TUC A;  5GAN g;  3MEY A;  2XIC A;  1YJW Q;  2JS2 A;  3HL8 A;  2W10 A;  11AS A;  2X3W D;  2XK0 A;  1I5L A;  1M27 C;  3GNF B;  2ZGW A;  4M7D B;  2AT1 B;  4ZGE B;  4FCY A;  4XQ3 A;  4H2X B;  3UFG A;  1WZO A;  1KK7 A;  3CCE T;  2EKO A;  1SHG A;  2R58 A;  2DXC A;  2DDZ A;  2FL7 A;  4ATO A;  4P3O A;  4LDX A;  1Y7X A;  5I21 A;  4BE2 A;  3OMG A;  3OS1 A;  2HBP A;  2KE9 A;  3GPL A;  1W70 A;  2QQR A;  5CKF A;  1UGS B;  5IHK A;  4RDX A;  3JB9 I;  2IY5 A;  1T3S A;  5L8R E;  1QF6 A;  2LX9 A;  4RTV A;  2JZ2 A;  5CKE A;  1VQ4 T;  1FYN A;  2RK1 A;  4XTW A;  1K8A C;  3SFM A;  3E2U A;  3LYI A;  3UT1 A;  1D0Z A;  3A98 A;  2ALY B;  2FYK A;  3R07 A;  2HZY A;  2QQA A;  3MJX A;  4H2V A;  4E7L A;  2NUP B;  1Y96 B;  2VGM A;  1LNX A;  3PIO A;  2HBW A;  2QHV A;  4LVL A;  3A8G B;  3LH5 A;  2X9H A;  2FZG B;  1WGS A;  4JJD A;  2KRM A;  4ORZ A;  2QGF B;  2DQ0 A;  2VB6 A;  2DEU A;  4XTY A;  3CCE A;  3THK A;  1TG0 A;  4DOV A;  3CC4 T;  4M78 A;  2EYX A;  3DKM A;  3JB9 H;  4PJO A;  1W66 A;  3V8J A;  2HNI A;  3QJY A;  4TQF A;  3QZ9 B;  1NM7 A;  2KI7 A;  3I55 Q;  1YP5 A;  3D7S B;  3HY0 A;  1FX7 A;  1TS9 A;  3MEV A;  3MKD A;  4EMK A;  4M7A D;  4XTX A;  1VQ4 A;  4FT2 A;  1KSW A;  1KQS A;  1OU8 A;  1MHN A;  4HVU A;  1NJI U;  2G6F X;  1YCY A;  2EWN A;  2LZ6 B;  3REU A;  4HCZ A;  4M7A G;  2JXB A;  2SEM A;  1JJC B;  1RAE B;  3C94 A;  4NCX A;  1WJR A;  1MV3 A;  2RJF A;  3N5B B;  3A32 A;  5AT1 B;  3GIB A;  4P75 C;  3SB2 A;  3OYD A;  1JJ2 P;  2D8J A;  5FRM A;  2ZIO A;  1X75 C;  2ZCE A;  3CC4 A;  2DXU A;  3A7A A;  4BB7 A;  1FXX A;  4G85 A;  2DVE A;  4CH5 A;  4RUG A;  1N8R R;  2NUZ A;  3I56 T;  5C53 B;  4QQD A;  3T9N A;  1TOV A;  4ANJ A;  1BI3 A;  2JOY A;  2ZPF B;  2XMF A;  2EFI A;  4FIB A;  2LCL A;  5GAM h;  3OBY A;  1N8R U;  3TCJ A;  3OA6 A;  5LJ5 h;  4YRR A;  1ZA1 B;  4CS3 A;  4CS4 A;  4H2U A;  5GAN 4;  1X2G A;  2I4M A;  4E7I A;  1YFS A;  2ZIM A;  1WXU A;  1WYX A;  4N4I A;  5HGQ A;  4QVD A;  2O9S A;  1GGM A;  3CMA Q;  1YN8 A;  4EX5 A;  3W3S A;  2QXF A;  2CJB A;  3PTA A;  2CP0 A;  1ZSG A;  2EYQ A;  2J6K A;  2DLP A;  2L3R A;  3OW2 P;  2PVD B;  1TUG B;  1Q81 C;  2DD5 A;  2BIV A;  2RM4 A;  4PK4 A;  4A4G A;  1X6G A;  3P8H A;  2VXF A;  1WQ7 A;  2PVG B;  1VQP Q;  5FLX E;  2F2W A;  4OP0 A;  2D6F A;  2LP5 A;  2LT1 A;  1C6V X;  4JDS A;  1ZUY A;  2RA2 A;  2LTO A;  4DEY A;  2Y4X A;  1D1A A;  1TH7 A;  1NPR A;  1K76 A;  2ZZE A;  4XK8 E;  5KE3 A;  1MNE A;  4NOY A;  3PCO B;  3V7C A;  1I5O B;  1TU0 B;  1VIE A;  3NTH A;  3SD4 A;  1Y71 A;  2DAQ A;  1R77 A;  2GFU A;  4P75 A;  2YLB A;  2DTH A;  4Q5W A;  2E6N A;  2DBK A;  3I55 T;  1KQS P;  3UDC A;  5GAM g;  2GQI A;  2MI6 A;  5LJ5 g;  1M90 C;  4FYV B;  1IGQ A;  4H2T A;  4C92 B;  2AIR B;  2DE0 X;  3CQT A;  4OGC A;  2YUN A;  2HEQ A;  2QHT A;  3FC3 A;  3G71 T;  1B76 A;  4YRG A;  1OQK A;  5CCA A;  2E10 A;  4RTW A;  4VUB A;  5CR2 A;  4AFZ C;  2RHQ B;  2LCS A;  5GAN j;  1QLY A;  2GTO A;  3REA B;  1YIJ Q;  2KGT A;  4BWA A;  1EIF A;  4LDU A;  3I55 A;  2HQX A;  1B7T A;  3GLX A;  5KYW A;  3HFZ A;  1BBW A;  1QVP A;  4HVC A;  2XDB A;  3E19 A;  1KD1 C;  4YYE A;  2RHY A;  3OY9 A;  4IUT A;  1BI0 A;  1KOG A;  3C0C A;  3EGD A;  2E70 A;  3RIR A;  4F7U E;  3SDZ A;  3CCV Q;  3S6W A;  2HD0 A;  1OV3 A;  2F2V A;  4GY5 A;  4J9H A;  2BTT A;  3CCQ T;  3VQV A;  5GAN 2;  2JN0 A;  2KR3 A;  4JJB A;  1Z9Z A;  3GP8 A;  4TVA A;  1ZLM A;  4JLI A;  1M2V B;  2HL3 A;  4F7U G;  4E7J A;  2VV5 A;  2C0O A;  1G8X A;  2EQU A;  4KUI A;  2YRC A;  1VQP T;  4BI8 B;  1GRI A;  3RER A;  3V7S A;  3QO3 A;  4CRI A;  1M30 A;  1IO6 A;  2JTE A;  4CI0 C;  1AD5 A;  3DB4 A;  3VS3 A;  2VGN A;  2GCX A;  3A74 A;  1YWP A;  2I0N A;  5IXB A;  3EGX B;  4QKU A;  2KRO A;  3TEH A;  2RHX A;  4BDZ A;  2BZ8 A;  2PNI A;  3UWN A;  2CGH A;  4WCI A;  3QII A;  1JU5 C;  1M1F A;  2DL5 A;  4DBR A;  2PUK B;  1NJ5 A;  5C6S A;  3CCQ A;  4NS5 A;  1TUD A;  4A4K A;  2WSE E;  2LQK A;  3BJU A;  4F7U F;  3VS0 A;  2DF6 A;  4BD3 A;  1VQP A;  1WU7 A;  2Z0W A;  3CPF A;  2HQH A;  4KQE A;  4WI1 A;  1SF9 A;  2YUP A;  1K73 R;  1AVZ C;  1KIK A;  2DRM A;  4C5I A;  3H41 A;  1H3Z A;  4JJC A;  3ICA A;  4MDX A;  1W2B S;  4ZTZ B;  3INZ A;  4OMF B;  2I4L A;  1UG1 A;  5C51 B;  1G3T A;  2GFA A;  1WHG A;  3OD1 A;  3HTZ A;  4DBH A;  1VQO Q;  4UP8 A;  1N9W A;  2K7A A;  2E3I A;  3EFO B;  4OVA A;  4FYX B;  1BBZ A;  2G3R A;  3EG9 B;  4QVC A;  3GOX A;  4J9D A;  4RMO A;  5I2S A;  2K79 A;  3MHX A;  3FDR A;  3VS5 A;  3OS0 A;  3URG A;  1KQ2 A;  4Y91 A;  1JQQ A;  2QDY B;  5EC7 A;  3MF2 A;  3JCM J;  3SEM A;  3M56 A;  2AZV A;  1UHC A;  2EYZ A;  1HD3 A;  1QVG A;  1LCK A;  2E64 A;  1JBM A;  1BIA A;  1FMW A;  3CCV T;  3ME9 A;  2EJG A;  1EFW A;  3M4P A;  4HCK A;  5GAN e;  2DZC A;  4MML A;  3FIF A;  4PJL A;  4LE9 A;  1BI2 A;  3CCS Q;  4OLF A;  4G84 A;  2AKK A;  2RQT A;  1EVK A;  3WVE B;  2O4X B;  2P0Q A;  3CCU Q;  1VA7 A;  2XTI A;  3AT1 B;  2XDD A;  4E47 A;  3HRT A;  3QBY A;  2B86 A;  1MND A;  4RCC A;  1JXO A;  1B8A A;  4TVY A;  1ATI A;  3VU3 C;  1K0X A;  3L2U A;  2EL9 A;  4ME7 A;  4NL2 A;  2E5A A;  4M4Z A;  3V8K A;  2JS0 A;  3ER0 A;  2A37 A;  4OB2 B;  4H2X A;  2KT8 A;  4RMF A;  2DFU A;  2O88 A;  1BCM A;  1EX4 A;  3KFU A;  1PG5 B;  4UPA A;  3CCV A;  3M9Q A;  1D3B A;  3RKW A;  1ZUU A;  2RHS B;  4F7U A;  1SET A;  1N8R C;  2JW4 A;  2DEQ A;  2M51 A;  4C92 E;  3M0R A;  3WQZ A;  1VQ5 Q;  1QP3 A;  4B9W A;  4C0F A;  1JB0 E;  2ZT6 A;  1VIF A;  2NYS A;  2QI2 A;  1M4Z A;  3CCR T;  4J15 A;  3CCJ T;  5I2M A;  3TEE A;  3JB9 D;  2FPF A;  2ALY A;  1QCN A;  4P3P A;  3M0Q A;  1EVL A;  3EFR A;  1X2K A;  2NUP A;  1Y96 A;  1ACM B;  4J7I A;  1EOV A;  5LJ3 d;  1GFC A;  2P0P A;  4ZTF A;  2R5M A;  3OYY A;  1UTI A;  2OTJ Q;  2RI3 A;  1GBR A;  1WYD A;  1WX6 A;  1VQO T;  1X27 A;  3HXU A;  1VQN T;  3CBM A;  3HPW A;  2DL7 A;  4XAX B;  2EYW A;  5GMK j;  3RUX A;  1G5I A;  3X26 B;  4CC3 A;  2H3E B;  2MWO A;  5J3B A;  1BI1 A;  3P8B B;  1QVG P;  3RL6 A;  3EG2 A;  2JTM A;  2HSE B;  2LQN A;  4OF1 A;  2M0Y A;  3CCR A;  3HXZ A;  2E4H A;  4NL3 A;  3CCJ A;  2RK2 A;  4M75 B;  3M4Q A;  2I2L A;  3EFS A;  1WXB A;  1WIE A;  3L2W A;  2P5I A;  2RO0 A;  2YRV A;  3RMS A;  3CC7 Q;  2EVR A;  1SRL A;  4EMG A;  1B7Y A;  1XNI A;  2XDP A;  1Q82 C;  2PU9 B;  3VBB A;  2EIF A;  1ASY A;  1YFN A;  3EG0 A;  2PME A;  2PQW A;  1VQO A;  4Q15 A;  1M3C A;  4IIO A;  3CCS T;  5CQX A;  1SG5 A;  1WJS A;  3MEW A;  3M54 A;  1VQN A;  4YRK A;  1O9S A;  5GAM f;  1UGR B;  1BK2 A;  5LJ5 f;  4C92 C;  3M58 A;  1HK9 A;  2HSP A;  3RES A;  2EQI A;  1FWZ A;  2A7Y A;  2EGA A;  3OYF A;  4H02 A;  3UPU A;  1M8M A;  2J3L A;  2ODR C;  2A3L A;  2EQJ A;  4E7K A;  4XTU A;  3CMQ A;  2FB7 A;  2JT4 A;  4O6J A;  3Q1J A;  4AH6 A;  3MQZ A;  1NYR A;  1PRM C;  3RBB B;  2C0I A;  2P0K A;  1ADJ A;  1KMN A;  3NMZ C;  2BKD N;  2R5A A;  4Z8A A;  3CCS A;  3TUP A;  4EMH A;  1VQ5 T;  3UAT A;  4P72 C;  2KAF A;  2ZR3 A;  1LPL A;  1WHJ A;  4JS4 A;  3HXX A;  3QO8 A;  1NPP A;  2Q7E A;  1G3W A;  3S3O A;  1UDL A;  4WJ4 A;  4ESR A;  4A54 A;  1Q7Y U;  4RKU E;  3VS6 A;  3HRS A;  4EPC A;  2OTJ T;  3MEU A;  1GCQ C;  5K1P A;  3J81 E;  3PCO A;  3JB9 J;  1RLQ C;  5GJW B;  1KC8 C;  3BE3 A;  1W2B A;  2CDT A;  2AK5 A;  3CPW A;  4XU1 A;  2DD4 A;  4L6V 5;  2DK3 A;  3NET A;  2ZR2 A;  1VQ5 A;  2XD0 A;  1AZE A;  4LVI A;  1JXM A;  2PUO B;  4LVK A;  4C92 A;  1BYM A;  1ARK A;  3L2Q A;  3G1Z A;  1AWX A;  3C4S A;  3VJP A;  3MCA B;  4J6Y A;  3CME T;  2JUF A;  4LDV A;  3OYH A;  3A5Y A;  1PYS B;  2OTJ A;  1UUE A;  4E7H A;  3I9Q A;  2J06 A;  8AT1 B;  5KNN A;  2LJ3 A;  3CC2 T;  2CP3 A;  2RHQ A;  5GMK e;  3QO7 A;  2M0O A;  1Z7N A;  4P71 C;  1IL2 A;  2CUB A;  1OEB A;  1RLP C;  1VUB A;  1NJ2 A;  1UEC A;  1AOJ A;  2E65 A;  1ABO A;  2K5I A;  4P72 A;  4E6R A;  4JRK A;  4IUQ A;  1K73 C;  4FW1 A;  4C8Q B;  1S72 Q;  4ZTJ A;  3A7U A;  1ZA2 B;  2DU7 A;  4CS2 A;  1WLE A;  3S3N A;  2NUT B;  1M1K R;  3CME A;  4F14 A;  3H9N A;  1GCQ A;  5GJV B;  1GCP A;  3VUZ A;  1NJI R;  1UHF A;  1WFW A;  2YT6 A;  1OX8 A;  1NLO C;  1U1T A;  4L87 A;  3QNE A;  4YPF A;  1M1K U;  1H4Q A;  1NNH A;  4RTU A;  3CC2 A;  1VYU A;  2OAU A;  4Y28 E;  4BE1 A;  3HY1 A;  1N27 A;  2CJA A;  1EFN A;  4RTZ A;  2CS7 A;  1JO8 A;  1M2V A;  2ZNI A;  3P8T A;  1RAF B;  3GNG A;  3G1J A;  2ZT7 A;  2K5L A;  4M77 E;  2COY A;  2E5Q A;  1J5W A;  2DO3 A;  1VQ8 Q;  4XU0 A;  4J8O A;  2RI5 A;  2GTJ A;  2AKW B;  2QA4 Q;  2ROT A;  3L4G B;  3ASK A;  1W2B P;  5LJ3 e;  4M77 G;  3CPW P;  1Y57 A;  4QW2 A;  2RD1 A;  3QWY A;  3TVT A;  3EG3 A;  4FL6 A;  4YRI A;  2CP2 A;  3C95 A;  1QVG S;  4OMQ A;  4J9F A;  4TTV A;  1YJW T;  2DYI A;  4P71 A;  4HKE A;  1OPK A;  1W4S A;  1KHI A;  2JVV A;  4EO4 A;  3RDV A;  4M75 E;  2KRS A;  1H92 A;  3O8V A;  4CC2 A;  1E7O A;  3HP9 A;  3A5Z B;  3JAM E;  2EYY A;  4JLG A;  4MDW A;  2DU5 A;  4YRC A;  4RG8 A;  4KGX B;  4M77 F;  1ASZ A;  2KRN A;  2V8I A;  1IRX A;  2L0A A;  4RCB A;  1NYG A;  3UH0 A;  3EG9 A;  3BY7 A;  3MEA A;  2DVJ A;  4Z02 A;  1YJW A;  1HTT A;  2C8M A;  1G3Y A;  4BE0 A;  1UJY A;  4AMC A;  1YHQ Q;  3DLM A;  3DSQ A;  1MMG A;  1S72 T;  2ART A;  1TXQ A;  3NFC A;  4PLL A;  2DIQ A;  4DBQ A;  3I7F A;  5GMK h;  4M77 C;  3HSB A;  5KYX A;  2DL8 A;  1QQJ A;  5F5W A;  2M02 A;  2K2M A;  2L8D A;  2EQM A;  1J3T A;  3VRZ A;  1OI1 A;  4MZT A;  5GAO r;  4AFQ C;  4KT0 E;  5IHN A;  3TEG A;  4M75 F;  2QK0 A;  2IVW A;  3HFO A;  3H0H A;  4YRM A;  2MWP A;  2XKO C;  1PSF A;  2M9U A;  3FEO A;  1JRI A;  4P73 C;  2GGR A;  4X9D A;  2L89 A;  5D7U A;  3JCM X;  2O4X A;  1D09 B;  4XU3 A;  3QJ6 A;  1WLP B;  1Z9Q A;  2J3M A;  4M75 C;  1S72 A;  1WI7 A;  3JRZ A;  3REB B;  3TU4 K;  1EIY B;  2CYZ B;  4X1V A;  1IXD A;  2OJ2 A;  4J9I A;  1Q86 R;  3M0P A;  2VYT A;  4K87 A;  5IT9 E;  1RI0 A;  1ZX6 A;  4A4E A;  1H3H A;  1VYV A;  4YTL A;  2YWW A;  2ED0 A;  2KSS A;  2DYB A;  3A31 A;  2DNU A;  4YRS A;  1B07 A;  2KBT A;  2O2O A;  1Q86 U;  1G2B A;  2E3H A;  2ZZG A;  2RHS A;  4KR2 A;  4M7D E;  3NHN A;  4M7D D;  4UC4 A;  5LJ3 h;  2EJ9 A;  1MGQ A;  2DRK A;  5FU7 C;  2ZTG A;  2I4N A;  5CVI A;  3X25 B;  1QMC A;  3JCM Q;  1G5H A;  4J9C A;  1K9A A;  3CMA T;  4M7D G;  1AEY A;  4BY6 B; 
#chains in the Genus database with same CATH homology
 4M77 A;  2QA4 A;  5GAO l;  3HXW A;  2E3C A;  1M1G A;  4M78 B;  1USY C;  2LDM A;  3J7A F;  4PJO B;  2ARS A;  2X4W A;  3HRK A;  2DJZ A;  3P8V A;  2Q5I A;  4EMK B;  4HWS A;  4QVZ A;  3VYG A;  4P73 A;  4C8Q E;  2C06 A;  2DQ3 A;  3P8Y A;  1IZ6 A;  4MZM A;  1NYQ A;  1M9S A;  4PHC A;  4YRJ A;  1B70 B;  2HQE A;  2WSF E;  1ZBX A;  4M75 A;  3ERR A;  3CMA A;  3A8L B;  5IAY A;  4M7D F;  3NEN A;  5HKC A;  4J83 A;  4CH6 A;  3OQ5 A;  5LJ3 g;  3HHT B;  2E1H A;  3E9F A;  3X28 B;  12AS A;  5GAN f;  1ADY A;  2GF7 A;  2ZXF A;  3BFM A;  4M7D C;  4ELY C;  3CPW S;  2XHC A;  5E3I A;  4C0D B;  3RMQ A;  3KUF A;  3E9G A;  1K8A U;  3FLG A;  1YIJ T;  4IUP A;  2Q5H A;  2CZ0 B;  1XQH A;  2Q7H A;  5GMK m;  3E9H A;  1USY A;  3OSV A;  4IUV A;  3A8O B;  4RG2 A;  2A8E A;  4BI4 A;  1R8O B;  4FU6 A;  1DJ7 B;  4KUL A;  5D6X A;  2R57 A;  2PVO B;  4C8Q C;  1M1K C;  2C7I A;  1LYL A;  2ZPE B;  1NJI C;  4YRO A;  3G7Z A;  2DXT A;  1YIJ A;  1YIT T;  4BUG A;  3LSQ A;  1WQW A;  2CJ9 A;  3CBO A;  4DOW A;  1QVF A;  4M7D A;  3M57 A;  3RAC A;  2AMC B;  3JCM d;  2RHI A;  4YRT A;  3IKM B;  2LVM A;  3OYC A;  1PYS A;  1X2H A;  4C92 D;  3QZ5 B;  2G4C A;  3M53 A;  3OYA A;  5LL6 S;  4DQ2 A;  4TVR A;  1YIT A;  3LH0 A;  4HWR A;  3CEY A;  4EDU A;  2ODR D;  3HFZ B;  2GQV A;  4H2W A;  4C92 G;  4XU2 A;  2WSC E;  3L2R A;  4HT8 A;  4HT9 A;  1U1S A;  4M7A B;  3H6Z A;  3LWH A;  5FRN A;  2F69 A;  2LQ8 A;  4C8Q A;  2BUD A;  2QQB A;  1Q81 U;  2CZ7 B;  3JCM b;  5DM7 R;  2ZPG B;  3PMT A;  5CKB A;  3OYM A;  3QTC A;  3PIP A;  2RHZ A;  3QPH A;  4P5N A;  5HK0 A;  4BI3 A;  3E9I A;  3E1S A;  2YLC A;  4J7F A;  4C92 F;  1JJC A;  3CD6 A;  1FYF A;  3TEH B;  3OB9 A;  1M90 U;  2AKW A;  5CO7 A;  1I4K 1;  4C5H A;  3RGL A;  3L2Z A;  3CCU T;  1X55 A;  1G3S A;  3MET A;  3SWN B;  3NEM A;  4A53 A;  1Y07 A;  3KBG A;  5KCH A;  1ZQ1 A;  3OYI A;  4OB3 B;  1P92 A;  2D9T A;  5LJ3 j;  3A8M B;  2QTX A;  5GAN 3;  4PG3 A;  4C0Z A;  3A5Z A;  1Q86 C;  3OBW A;  2XU8 A;  2X35 A;  1KD1 U;  3CCU A;  1NJ1 A;  4J5Y A;  2KQW A;  2DKG A;  2XGT A;  1K9M U;  3KXT A;  3HXV A;  1VQK T;  1AHJ B;  5DY9 A;  5D6W A;  4R55 A;  3PT9 A;  3QKJ A;  1KHC A;  3A8H B;  4JUV A;  4N4H A;  4YRE A;  3QDR B;  3OYL A;  1BIB A;  3WXM B;  2CZ6 B;  5GAO m;  3OYG A;  1PSE A;  1NE8 A;  4L59 A;  3JCM W;  3IG2 A;  3X24 B;  1KQ1 A;  1VQ7 T;  1JJ2 A;  4OB1 B;  3OMC A;  4D6W A;  5GMK l;  2X4X A;  2KDS A;  3CC7 T;  1VQK A;  4JRI A;  2ZPI B;  2O01 E;  5GAO n;  3CXC A;  2LRQ A;  4HWT A;  5GAO q;  4IKF A;  1WJQ A;  1EIY A;  1N9S A;  4J6X A;  1D3B B;  2V8K A;  4F7U B;  1RIQ A;  5CK9 A;  1YJ9 T;  5LJ3 f;  2I4O A;  1Z7M A;  5GAN 6;  3NEL A;  2RH2 A;  2KVQ G;  3C12 A;  4FT4 A;  1VQ7 A;  2DXB A;  1WNL A;  2Y90 A;  1OZ3 A;  1YJN T;  2CIM A;  3OW2 A;  3QHS A;  3CC7 A;  4CH4 A;  2F5K A;  2YHT A;  4C0D C;  3VUB A;  2K57 A;  2FVU A;  4YRN A;  3HFV A;  5FU6 B;  3M59 A;  1ZHI A;  4DA4 A;  3JCM e;  4TWA A;  1I8F A;  5M9O A;  2LC4 A;  4GLK A;  3OYN A;  3DB3 A;  3L1A A;  4OB0 B;  4M77 D;  1YJ9 A;  3QO5 A;  4M7A E;  2ZZD A;  3NTK A;  3M4G A;  4QQG A;  1WPY A;  1EQR A;  2RJE A;  4HCC A;  2LCC A;  4LDY A;  4BDY A;  1XOV A;  1YJN A;  4X9C A;  4R56 A;  3OSS C;  1B70 A;  2ZCF B;  4PLI A;  4RQE A;  1B7Y B;  2ZPB B;  2VUB A;  1GXI E;  3OYK A;  3HRI A;  5CKH A;  2DIG A;  4II1 A;  5GAO p;  4ZTU B;  3EAE A;  4M75 D;  4HWP A;  3IAL A;  1V29 B;  4LD6 A;  3QSU A;  2JNG A;  3WVD B;  4BAC A;  2OTL T;  5HK3 A;  4M75 G;  1XTD A;  3QYG B;  2WAC A;  3DLL A;  2DTI A;  4M7A F;  4MMK A;  2Y4Y A;  1QVF S;  3LGL A;  5GAN d;  2IG0 A;  2QEX T;  2KK4 A;  1YI2 T;  2E6Z A;  4YCU A;  3P8D A;  1UGP B;  4IUU A;  2M1H A;  1YFT A;  3LSS A;  4DPG A;  3V7R A;  2JTF A;  5A0G A;  1VQ6 T;  5KE2 A;  1YGB A;  3I56 A;  4UP9 A;  4M7A C;  2OTL A;  3ZBD A;  4B9X A;  1N9R A;  4K86 A;  4KUD K;  1KMM A;  3MP6 A;  1B34 B;  4X34 A;  4PL6 A;  1RL2 A;  4P3N A;  4ZN1 A;  2KMT A;  2NS6 A;  3VQY A;  2QEX A;  4FM4 B;  1NZ9 A;  1M5Q 1;  1YI2 A;  5IN1 A;  4LD9 K;  1VQ8 T;  2LNV A;  4ZGD B;  2DPP B;  2QA4 T;  4LVJ A;  2QQS A;  1Q82 U;  1G51 A;  3JCM h;  1VQ6 A;  1M8V A;  4LNS A;  1X6O A;  3M55 A;  2MAM A;  4OGE A;  5C0M A;  2AMC A;  2RB6 A;  5GAN 8;  2QHU A;  2IY5 B;  5C52 B;  1YBY A;  2HAX A;  1SES A;  3VKI A;  4Q6G A;  4YRP A;  3HKS A;  2XID A;  4IUR A;  2ZZF A;  3SWN C;  3V8L A;  2XG8 D;  5DLO A;  3PNW C;  3A7R A;  4A4F A;  2RJC A;  1VQ8 A;  2F5T X;  4HCB A;  1H64 1;  5CAI A;  4RQF A;  4M7A A;  1UGQ B;  1BKB A;  3MO8 A;  2B8A A;  3G71 A;  3G6E T;  1NJ6 A;  5ELO A;  3REX A;  1Q7Y C;  1UEB A;  3JCM V;  1K9M C;  3JCM g;  4MZP A;  4ZGJ B;  1YHQ T;  4HA8 A;  4C8Q D;  4YP0 A;  2K5F A;  3J80 E;  4ELZ C;  2DTO A;  3IKL A;  1X01 A;  2DZ9 A;  3QYH B;  3RF1 A;  1KC8 U;  4C8Q G;  4UP7 A;  3CCL T;  4WJ3 M;  3VQX A;  3L42 A;  3RKX A;  2E41 A;  1VQL T;  1OZ2 A;  4C5G A;  3G6E A;  2EQK A;  1VQZ A;  4PKC C;  1YHQ A;  3SWN A;  1H4S A;  3VYH B;  2VC8 A;  2ZPH B;  4V2S A;  2AHJ B;  1QP2 A;  2P4T A;  2MMP A;  3M4Y A;  3FJP A;  2K2V A;  1X54 A;  4C8Q F;  5GAM d;  4E51 A;  3OS5 A;  5A0L A;  2RI2 A;  5LJ5 d;  1JJ2 S;  3M5A A;  3CCL A;  3BDL A;  4H2S A;  3MP1 A;  2QHS A;  1K73 U;  4N0A C;  1VQL A;  2X4Y A;  1LJO A;  2QQ9 A;  2VXE A;  1H4V B;  4C5E A;  3CXC S;  4C0G A;  1LOJ A;  3LWI A;  4FSX A;  2ZT5 A;  4O2D A;  4JS5 A;  2P0L A;  2M16 A;  4JRP A;  5D6Y A;  3G4S T;  4N4G A;  4YCV A;  4XTZ A;  5GAN 7;  5AYF A;  1HXD A;  3L2V A;  1E22 A;  1I81 A;  1L0W A;  5FU6 C;  1QE0 A;  3TRE A;  3PGG A;  5ELN A;  3OW2 S;  2LT4 A;  3VV0 A;  4ZN3 A;  4O5V A;  1E1O A;  3QXE B;  3VQW A;  1N6A A;  4XTV A;  5FRO A;  3ZEH A;  2CKK A;  3PFS A;  2K4Y A;  3PZC A;  3HXY A;  5A0D A;  3CCM T;  5J39 A;  4JRQ A;  3G4S A;  2EAY A;  3OYJ A;  5K1X A;  1SER A;  5GAM j;  3HFN A;  1KQS S;  5LJ5 j;  1NJ8 A;  1IRE B;  3OYE A;  2D0Q B;  4X5O A;  1HC7 A;  4PNO A;  3JCM c;  4N0A A;  1KG1 A;  4JJN K;  5CQY A;  5HY6 A;  3RKY A;  3QUI A;  2ZT8 A;  3CD6 T;  5A2Q E;  4TVW A;  3R6O A;  4ZIB A;  3CCM A;  2E12 A;  3PMI A;  5CIU A;  4YCW A;  2PMF A;  2K3Y A;  5DLQ E;  4M77 B;  5GAN 5;  2EJF A;  4A4H A;  3OS2 A;  2ARU A;  1YB3 A;  4P74 C;  1O75 A;  4J6W A;  4TVA B;  3JB9 G;  3FB9 A;  4XEO A;  3OYB A;  2X4J A;  2MF2 A;  2K3X A;  2RHU A;  5GMK i;  4YRL A;  4YRF A;  1OYX A;  3QG1 A;  2V8J A;  4QQ6 A;  3NTI A;  3LGF A;  3JSC A;  4M78 E;  3UGQ A;  4M78 D;  3FRN A;  3L4G A;  3MF1 A;  1E24 A;  4PJO E;  4PJO D;  1UB4 A;  3S3M A;  5KCO A;  2RJD A;  3F70 A;  1H4T A;  1YFR A;  4M78 G;  4H2Y A;  1E1T A;  3LC0 A;  3LX7 A;  1U8R A;  4PJO G;  3JB9 F;  3JCM P;  3H8Z A;  3UGT A;  4YRQ A;  1C0A A;  2KY9 A;  3BW1 A;  4HT4 A;  5CKD A;  4HWO A;  1QW1 A;  5FU7 B;  3BDU A;  4L5G A;  2FHD A;  1G5V A;  2NLU A;  4TQD A;  1VQ9 T;  4KR3 A;  5GAN h;  4LVM A;  4YDQ A;  3MP8 A;  3HRU A;  4K88 A;  5EG2 A;  1X56 A;  4KBM B;  3AHU A;  2H3J A;  4P74 A;  4XEM A;  5KH6 A;  2CZ1 B;  3LLR A;  2XI9 A;  4M78 F;  1VQM T;  4PJO F;  3X20 B;  2ZIN A;  2Q7G A;  5J26 A;  4BW9 A;  3GF5 A;  4BY6 C;  1SRY A;  4M78 C;  1VQ9 A;  1SSF A;  2L5Q A;  4PJO C;  5GAM e;  5LJ5 e;  1B34 A;  4CH3 A;  3CBP A;  4WF2 A;  4EMK C;  4LDW A;  1BBU A;  3ZFJ A;  2ZNJ A;  1VQM A;  3JCM f;  3LW5 E;  5GAN g;  3MEY A;  2XIC A;  3HL8 A;  11AS A;  2XK0 A;  1I5L A;  3GNF B;  2ZGW A;  4M7D B;  4ZGE B;  4H2X B;  4XQ3 A;  3UFG A;  3CCE T;  2EKO A;  2R58 A;  2DXC A;  2DDZ A;  2FL7 A;  4ATO A;  4P3O A;  4LDX A;  1Y7X A;  5I21 A;  4BE2 A;  3OMG A;  3OS1 A;  2HBP A;  3GPL A;  2QQR A;  5CKF A;  1UGS B;  4RDX A;  3JB9 I;  2IY5 A;  5L8R E;  1QF6 A;  2LX9 A;  2JZ2 A;  5CKE A;  1VQ4 T;  2RK1 A;  4XTW A;  1K8A C;  3SFM A;  3LYI A;  3UT1 A;  2ALY B;  3R07 A;  2FYK A;  2QQA A;  4H2V A;  4E7L A;  1Y96 B;  2VGM A;  1LNX A;  3PIO A;  2QHV A;  4LVL A;  3A8G B;  1WGS A;  2DQ0 A;  4XTY A;  3CCE A;  3CC4 T;  4DOV A;  4M78 A;  3DKM A;  3JB9 H;  4PJO A;  1W66 A;  3V8J A;  2HNI A;  3QJY A;  4TQF A;  3QZ9 B;  3HY0 A;  1FX7 A;  3MEV A;  4EMK A;  4M7A D;  4XTX A;  1VQ4 A;  4FT2 A;  1KQS A;  1MHN A;  1NJI U;  1YCY A;  2EWN A;  3REU A;  4HCZ A;  4M7A G;  1JJC B;  3C94 A;  4NCX A;  1WJR A;  2RJF A;  3N5B B;  3A32 A;  3GIB A;  4P75 C;  3SB2 A;  3OYD A;  5FRM A;  2ZIO A;  1X75 C;  2ZCE A;  3CC4 A;  2DXU A;  3A7A A;  4BB7 A;  1FXX A;  4G85 A;  2DVE A;  4CH5 A;  3I56 T;  5C53 B;  4QQD A;  3T9N A;  1BI3 A;  2JOY A;  2ZPF B;  2EFI A;  4FIB A;  2LCL A;  5GAM h;  3OBY A;  1N8R U;  3TCJ A;  3OA6 A;  5LJ5 h;  4YRR A;  4CS3 A;  4CS4 A;  4H2U A;  5GAN 4;  1X2G A;  2I4M A;  4E7I A;  1YFS A;  2ZIM A;  4N4I A;  5HGQ A;  4QVD A;  1GGM A;  4EX5 A;  3W3S A;  2QXF A;  2CJB A;  3PTA A;  2EYQ A;  2L3R A;  2PVD B;  1Q81 C;  2DD5 A;  2BIV A;  2RM4 A;  4A4G A;  3P8H A;  2VXF A;  1WQ7 A;  2PVG B;  5FLX E;  4OP0 A;  2D6F A;  2LT1 A;  4JDS A;  2RA2 A;  2LTO A;  2Y4X A;  1TH7 A;  1NPR A;  2ZZE A;  4XK8 E;  5KE3 A;  4NOY A;  3PCO B;  3V7C A;  3NTH A;  1VIE A;  3SD4 A;  1Y71 A;  2DAQ A;  2GFU A;  4P75 A;  2YLB A;  2DTH A;  4Q5W A;  2E6N A;  3I55 T;  3UDC A;  5GAM g;  2MI6 A;  5LJ5 g;  1M90 C;  4H2T A;  4C92 B;  4OGC A;  2QHT A;  3FC3 A;  3G71 T;  1B76 A;  4YRG A;  5CCA A;  2E10 A;  4VUB A;  5CR2 A;  2RHQ B;  5GAN j;  4BWA A;  1EIF A;  4LDU A;  3I55 A;  2HQX A;  3GLX A;  3HFZ A;  1BBW A;  1QVP A;  4HVC A;  2XDB A;  3E19 A;  1KD1 C;  4YYE A;  2RHY A;  3OY9 A;  4IUT A;  1BI0 A;  1KOG A;  2E70 A;  3RIR A;  4F7U E;  3SDZ A;  3S6W A;  2HD0 A;  4GY5 A;  3CCQ T;  3VQV A;  5GAN 2;  2JN0 A;  3GP8 A;  4TVA A;  4JLI A;  4F7U G;  4E7J A;  2VV5 A;  2EQU A;  4KUI A;  1VQP T;  4BI8 B;  3RER A;  3V7S A;  3QO3 A;  4CRI A;  4CI0 C;  3DB4 A;  2VGN A;  2GCX A;  3A74 A;  3TEH A;  2RHX A;  4BDZ A;  3UWN A;  2CGH A;  3QII A;  1M1F A;  2PUK B;  1NJ5 A;  5C6S A;  3CCQ A;  4NS5 A;  4A4K A;  2WSE E;  2LQK A;  3BJU A;  4F7U F;  4BD3 A;  1VQP A;  1WU7 A;  3CPF A;  4WI1 A;  4KQE A;  4C5I A;  1H3Z A;  3ICA A;  4MDX A;  1W2B S;  4ZTZ B;  3INZ A;  4OMF B;  2I4L A;  5C51 B;  1G3T A;  2GFA A;  3OD1 A;  3HTZ A;  4UP8 A;  1N9W A;  4OVA A;  2G3R A;  4QVC A;  3GOX A;  4RMO A;  5I2S A;  3MHX A;  3FDR A;  3OS0 A;  3URG A;  1KQ2 A;  4Y91 A;  2QDY B;  3MF2 A;  3JCM J;  3M56 A;  1QVG A;  2E64 A;  1JBM A;  1BIA A;  3CCV T;  3ME9 A;  2EJG A;  1EFW A;  3M4P A;  5GAN e;  2DZC A;  4MML A;  3FIF A;  1BI2 A;  4OLF A;  4G84 A;  1EVK A;  3WVE B;  2O4X B;  2P0Q A;  2XTI A;  2XDD A;  4E47 A;  3HRT A;  3QBY A;  4RCC A;  1B8A A;  4TVY A;  1ATI A;  3VU3 C;  3L2U A;  2EL9 A;  4ME7 A;  4NL2 A;  2E5A A;  3V8K A;  3ER0 A;  4RMF A;  4OB2 B;  4H2X A;  3KFU A;  4UPA A;  3CCV A;  3M9Q A;  1D3B A;  3RKW A;  2RHS B;  4F7U A;  1SET A;  1N8R C;  2DEQ A;  4C92 E;  3WQZ A;  1QP3 A;  4B9W A;  4C0F A;  1JB0 E;  2ZT6 A;  1VIF A;  2QI2 A;  3CCR T;  1M4Z A;  4J15 A;  3CCJ T;  5I2M A;  3TEE A;  3JB9 D;  2ALY A;  4P3P A;  1EVL A;  3EFR A;  1Y96 A;  4J7I A;  1EOV A;  5LJ3 d;  2P0P A;  4ZTF A;  2R5M A;  3OYY A;  2RI3 A;  1WYD A;  1VQO T;  3HXU A;  1VQN T;  3CBM A;  3HPW A;  4XAX B;  5GMK j;  3RUX A;  1G5I A;  3X26 B;  2MWO A;  5J3B A;  1BI1 A;  3P8B B;  3RL6 A;  2JTM A;  4OF1 A;  3CCR A;  3HXZ A;  4NL3 A;  3CCJ A;  2RK2 A;  4M75 B;  3M4Q A;  2I2L A;  3EFS A;  3L2W A;  2P5I A;  2RO0 A;  2YRV A;  3RMS A;  4EMG A;  1B7Y A;  1XNI A;  2XDP A;  1Q82 C;  2PU9 B;  3VBB A;  2EIF A;  1ASY A;  2PME A;  2PQW A;  1VQO A;  4Q15 A;  3CCS T;  5CQX A;  1WJS A;  3MEW A;  3M54 A;  1VQN A;  4YRK A;  1O9S A;  5GAM f;  1UGR B;  5LJ5 f;  4C92 C;  3M58 A;  1HK9 A;  3RES A;  1FWZ A;  2A7Y A;  3OYF A;  4H02 A;  3UPU A;  2J3L A;  2ODR C;  2A3L A;  2EQJ A;  4E7K A;  4XTU A;  3CMQ A;  2FB7 A;  4AH6 A;  4O6J A;  3Q1J A;  3MQZ A;  1NYR A;  2P0K A;  1ADJ A;  1KMN A;  2BKD N;  2R5A A;  3CCS A;  3TUP A;  4EMH A;  1VQ5 T;  4P72 C;  2KAF A;  2ZR3 A;  4JS4 A;  3HXX A;  3QO8 A;  1NPP A;  2Q7E A;  1G3W A;  3S3O A;  4WJ4 A;  4A54 A;  1Q7Y U;  4RKU E;  3HRS A;  4EPC A;  2OTJ T;  3MEU A;  5K1P A;  3J81 E;  3PCO A;  3JB9 J;  1KC8 C;  1W2B A;  3CPW A;  4XU1 A;  2DD4 A;  4L6V 5;  2DK3 A;  3NET A;  2ZR2 A;  1VQ5 A;  2XD0 A;  4LVI A;  2PUO B;  4LVK A;  4C92 A;  1BYM A;  3L2Q A;  3G1Z A;  3C4S A;  3VJP A;  3MCA B;  4J6Y A;  3CME T;  2JUF A;  4LDV A;  3OYH A;  3A5Y A;  1PYS B;  2OTJ A;  4E7H A;  5KNN A;  3CC2 T;  2RHQ A;  5GMK e;  3QO7 A;  2M0O A;  1Z7N A;  4P71 C;  1IL2 A;  1VUB A;  1NJ2 A;  2E65 A;  2K5I A;  4P72 A;  4JRK A;  4IUQ A;  1K73 C;  4C8Q B;  4ZTJ A;  3A7U A;  2DU7 A;  4CS2 A;  1WLE A;  3S3N A;  3CME A;  3VUZ A;  1U1T A;  4L87 A;  3QNE A;  4YPF A;  1M1K U;  1H4Q A;  1NNH A;  3CC2 A;  2OAU A;  4Y28 E;  4BE1 A;  3HY1 A;  1N27 A;  2CJA A;  2CS7 A;  2ZNI A;  3P8T A;  3GNG A;  2ZT7 A;  2K5L A;  4M77 E;  2E5Q A;  1J5W A;  2DO3 A;  4XU0 A;  4J8O A;  2RI5 A;  2AKW B;  3L4G B;  3ASK A;  5LJ3 e;  4M77 G;  4QW2 A;  2RD1 A;  4FL6 A;  4YRI A;  3C95 A;  1QVG S;  4TTV A;  1YJW T;  4P71 A;  4HKE A;  1W4S A;  1KHI A;  2JVV A;  4EO4 A;  4M75 E;  3O8V A;  3HP9 A;  3A5Z B;  3JAM E;  4JLG A;  4MDW A;  2DU5 A;  4YRC A;  4RG8 A;  4M77 F;  1ASZ A;  2V8I A;  4RCB A;  3UH0 A;  3BY7 A;  3MEA A;  4Z02 A;  1YJW A;  1HTT A;  2C8M A;  1G3Y A;  4BE0 A;  3DLM A;  3DSQ A;  1S72 T;  2ART A;  3NFC A;  4PLL A;  2DIQ A;  3I7F A;  5GMK h;  4M77 C;  3HSB A;  5F5W A;  2L8D A;  2EQM A;  1OI1 A;  4MZT A;  5GAO r;  4KT0 E;  3TEG A;  4M75 F;  2IVW A;  3HFO A;  4YRM A;  2MWP A;  2XKO C;  1PSF A;  2M9U A;  3FEO A;  1JRI A;  4P73 C;  4X9D A;  2L89 A;  3JCM X;  2O4X A;  4XU3 A;  3QJ6 A;  2J3M A;  4M75 C;  1S72 A;  3JRZ A;  3TU4 K;  1EIY B;  2CYZ B;  2VYT A;  4K87 A;  5IT9 E;  1RI0 A;  4A4E A;  4YTL A;  2KSS A;  3A31 A;  4YRS A;  1Q86 U;  2ZZG A;  2RHS A;  4KR2 A;  4M7D E;  4M7D D;  4UC4 A;  5LJ3 h;  2EJ9 A;  1MGQ A;  5FU7 C;  2ZTG A;  2I4N A;  5CVI A;  3X25 B;  3JCM Q;  1G5H A;  3CMA T;  4M7D G;  4BY6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...