2E64A

Crystal structure of biotin protein ligase from pyrococcus horikoshii, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
226
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 69
structure length 226
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e64A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e64A01
3VBBA 1U1SA 3JCMg 2FB7A 1KMNA 5K1XA 1NJ8A 4M78C 4PHCA 3HXXA 4M75D 2DU5A 4P75C 3JCMc 3GIBA 2J3LA 3VU3C 3RF1A 3RL6A 3L4GA 4UP9A 5E3IA 5ELOA 3LSSA 3NELA 3A5YA 4DQ2A 3A7UA 2Q5IA 4CH4A 4OP0A 4M78F 1B76A 4XTUA 2ARUA 4YCVA 4XTWA 4A54A 2E65A 3HXZA 2Y90A 1BBUA 2RB6A 4G84A 3E9HA 1BIAA 3L1AA 3UH0A 4J5YA 3NEMA 1M5Q1 1JJCB 3RKYA 4LNSA 2ZT8A 4EMHA 2AMCB 2Q7EA 1NJ2A 3FJPA 4P3NA 4M75A 4NOYA 4F7UB 4RMFA 5C51B 1B8AA 4TQDA 2E5AA 2PMFA 4NL2A 4M7AF 5LJ3h 4P71A 2ZT7A 5GAMd 1SRYA 2G4CA 4YRNA 4WF2A 5GANd 1VQZA 2IY5B 5GAMj 1WU7A 1X56A 4TVYA 2YLCA 2RHQB 4K87A 3MF2A 3RACA 4X9CA 3HXVA 5GAOm 4L87A 4C92B 4KR2A 1WQ7A 1YFSA 3PCOA 4N0AC 4PJOG 5GANh 3V8JA 4JUVA 4N0AA 4XTVA 1WLEA 3JCMP 3RKXA 1YFRA 3IKMB 4HT8A 1E1TA 2J3MA 4J6YA 4C8QD 4M77C 4HWPA 4NCXA 1B34A 4C8QE 3QHSA 1X01A 4YRCA 1N9RA 3BY7A 2QHVA 1LNXA 5GAOl 4KR3A 2CJAA 1I81A 1ATIA 3QNEA 1LOJA 5GANj 4YRMA 2Q5HA 1YCYA 2QHSA 2ZTGA 1YGBA 3HTZA 1I5LA 3WQZA 3PGGA 4EMKA 1QE0A 2AKWB 3HFVA 2PMEA 1JBMA 1I8FA 2C7IA 4EMKB 4KQEA 4UP7A 1H4QA 1ASYA 4C8QA 5GAN6 5CAIA 3M4PA 1JJCA 3QO8A 4C92F 1SESA 1WNLA 1W66A 4J6WA 4YDQA 4C92A 3JB9I 4M75F 3DSQA 4CH6A 2IY5A 1HK9A 4YRIA 4M77A 5GAOq 2ODRD 3PZCA 1H4TA 1KQ1A 2ODRC 1SERA 1KOGA 3SWNB 4XTYA 1WYDA 3REXA 4EMKC 3HRIA 4K86A 3RESA 3CMQA 3HFZA 3V8KA 4M7AG 2ZZFA 4P74A 1IL2A 5GANf 5C53B 1ADYA 4YRSA 1ASZA 3BW1A 4M77B 3JB9F 3RGLA 4BW9A 1USYA 1EOVA 1NNHA 3JCMf 4XU0A 1YB3A 4UPAA 4ZTZB 2DZ9A 4XEOA 4M77D 4YREA 2EL9A 3P8YA 4HWRA 3VQXA 1D3BA 4CH5A 4H2YA 3SWNC 3HXUA 1TH7A 5GANg 1KQ2A 4XEMA 4CS4A 4G85A 2K57A 2DKGA 1L0WA 1N9SA 2FYKA 1FYFA 5GANe 5GMKe 1G51A 4YROA 5LJ5j 3M4QA 3QTCA 4TWAA 2CJBA 4H2VA 3RKWA 4JRIA 2I4NA 5LJ3j 4YP0A 2QTXA 4M7DD 4YRGA 4OLFA 3FIFA 3P8VA 4M7DF 4YRLA 4H2UA 3TEGA 4BWAA 3A7AA 3HFNA 4WJ4A 2VC8A 4M7DG 2ARSA 2EJGA 2XTIA 3QO3A 4C92D 3VQYA 2ZNJA 4H2TA 4M7AE 2XGTA 4C92C 2DJZA 4M77F 3IALA 4XU2A 4HWOA 4M75E 4Q6GA 3EFSA 3JCMh 4CH3A 4M77E 4X9DA 1LYLA 2DZCA 4M7AC 1N9WA 11ASA 5LJ3g 3BFMA 1WPYA 2ARTA 3NETA 5GAN4 4TTVA 12ASA 1H641 3KFUA 4PNOA 3A5ZA 4XTXA 3FB9A 1EIYA 2ZIOA 4C8QF 4QVDA 4HA8A 4M7DA 5GAN7 1D3BB 3JCMJ 3IKLA 1Y96B 4M78A 4YRTA 1EIYB 4RCBA 5F5WA 2JN0A 3JB9D 1Z7NA 3V7SA 5GAN3 4RDXA 2DXTA 3JB9G 2YHTA 4C8QC 3JCMe 3V8LA 5GAMh 4WI1A 2DTHA 4YCUA 2RM4A 4P73A 3QUIA 3ICAA 4ZIBA 3E9IA 3OD1A 5LJ3d 4UP8A 4XQ3A 3JCMd 2I2LA 1NJ1A 2VXFA 1B70A 1E22A 4MMLA 2DXUA 5LJ5d 4DPGA 1SETA 4M75B 4M75G 5KNNA 4TVWA 4JRKA 3EFRA 5ELNA 4M7DC 4C92G 3TUPA 4H2XB 3UGQA 2ZZGA 2ZIMA 4HWSA 4EO4A 2RHSB 4P71C 2DTIA 2ALYA 5GAOn 1BBWA 4F7UG 4P72C 3BJUA 5GMKh 1PYSB 1I4K1 4YRQA 4YRPA 1LJOA 1NYQA 4J15A 5LJ3e 3MF1A 2QHUA 2ZT5A 4ZTUB 4PJOA 1QF6A 1USYC 3HFZB 1NJ6A 1H4SA 4EMGA 3L4GB 1WQWA 4H2XA 3BDUA 2E3CA 3HFOA 5GMKj 5HGQA 4X5OA 3M4GA 3QO5A 1PYSA 4J6XA 1Y96A 4M78B 4M78D 2P0LA 3A31A 3HXYA 5LJ5h 4RQEA 3JCMb 3RUXA 1Z7MA 4M7DE 3QSUA 4JLIA 1E24A 3SB2A 3HRKA 1MGQA 4P75A 5GAN2 2RD1A 2YLBA 4P72A 4A53A 3REUA 2AMCA 1NYRA 5LJ3f 2DDZA 2AKWA 2ZCEA 2EAYA 4PJOF 2ZR3A 4C92E 3UGTA 1EVLA 1B7YA 1GGMA 4P3PA 1E1OA 1J5WA 3VQVA 4AH6A 5K1PA 3AHUA 3A32A 3TEHB 4E51A 3L2ZA 4F7UE 4M75C 2ZGWA 4C8QB 2QHTA 4Y91A 2CIMA 4H2WA 3I7FA 3TEHA 4YPFA 1NJ5A 2EWNA 5GAMe 2DU7A 3R07A 4PJOB 4O2DA 4YRFA 4NL3A 1M8VA 4PG3A 2ALYB 5DY9A 3HXWA 1X2GA 4M7AB 3HY1A 2P5IA 2ZT6A 4RCCA 3MEYA 3PCOB 4YRRA 1X2HA 4RQFA 4F7UF 5GMKm 3VQWA 4H2SA 2ZXFA 5GMKi 4Q15A 4HWTA 4PJOD 2RHSA 2EJ9A 4CS3A 1HTTA 2HNIA 2CJ9A 4YCWA 2C8MA 2DQ3A 2Q7GA 2E41A 5GAN8 1EFWA 4M7DB 4P3OA 1YFTA 2I4MA 3A74A 3JB9J 4M78G 4QVCA 5C52B 4M7AA 5LJ5g 5GAMg 5LJ5e 2I4OA 3HY0A 4CS2A 3V7RA 5GAN5 1G5IA 3G1ZA 3IG2A 3JCMX 5GAOp 3JCMW 2ZNIA 1ADJA 4XTZA 2ZZEA 3RERA 4XU3A 1X54A 2EJFA 2E10A 4EX5A 4YYEA 3JCMV 2VXEA 3A7RA 2DQ0A 3ERRA 2ZINA 3QO7A 5GAMf 1X55A 5LJ5f 4V2SA 3NENA 4K88A 4YRJA 1B7YB 4HVCA 3HSBA 4PJOE 3RIRA 2I4LA 1BIBA 5GAOr 1U1TA 2E64A 2CGHA 4P74C 4TVAB 4H02A 3W3SA 1JRIA 4P73C 4M7AD 3JCMQ 1KMMA 3UFGA 4C8QG 1C0AA 2E1HA 4YRKA 4WJ3M 3P8TA 1EVKA 1B70B 4HT9A 2DVEA 4XU1A 4PJOC 4TQFA 4F7UA 2Q7HA 2DTOA 2ZR2A 4M78E 1HXDA 1RIQA 4M77G 5I21A 4TVAA 2RHQA 3LC0A 2DEQA 3INZA 1H4VB 1B34B 1HC7A 1G5HA 2RA2A 5GMKl 3SWNA 4MMKA 3V7CA 3JB9H 1EQRA 3LSQA
chains in the Genus database with same CATH superfamily
3VBBA 3QJ6A 1WDXA 2YWWA 2RHUA 2DVJA 4UC4A 3CC4T 5HY6A 4P75C 3GIBA 2J3LA 1E6HA 3RL6A 3L4GA 2QQSA 4E7SA 5E3IA 3JAME 3G6ET 2JJ9A 1UGVA 3A5YA 4JDSA 2DL3A 5HK0A 1IO6A 5KYWA 4CH4A 4M78F 2CZ1B 4XTUA 3ZBDA 2ARUA 4HVWA 3SFMA 3QKJA 2Y90A 2RJCA 1BIAA 3L1AA 4Z8AA 4J5YA 1S1NA 2HD0A 1EX4A 1GBRA 2ZT8A 4EMHA 1NPRA 1NJ2A 2VGMA 1N8RU 4P3NA 4IIOA 4XK8E 1X27A 1K1ZA 2RMOA 4BE1A 4PJNA 4IKFA 2EKHA 3LLRA 4NL2A 4HVUA 5HCKA 2EYXA 5LJ3h 2NUPB 2ZT7A 2BZYA 4JS4A 1NBEB 1WYXA 1TXQA 2CSQA 2XDBA 3CCVQ 2KDSA 3CCSA 5GAMj 1WU7A 2V1QA 1NYFA 1RI9A 3CQTA 3RACA 1QP2A 2YUNA 1SPKA 3L2RA 3CCRA 4IUVA 4PJOG 1VA7A 2L0AA 1KQSA 3PFSA 2VVKA 2XICA 3LYIA 1Q82R 5KYYA 1WLEA 1YFRA 1KD1U 1KG1A 1MMDA 2LZ6B 3OS0A 4M77C 4HWPA 1B34A 1D1CA 1XOVA 1N9RA 4DBFA 2FO0A 3OYMA 2PU9B 1VQ5A 2CS7A 4R55A 4OB2B 2CZ7B 1W4SA 2ZTGA 2J6FA 1YGBA 1YWPA 3MEVA 1D0YA 3EGDB 3PGGA 4EMKA 1QE0A 3S3NA 3HFVA 3H0FA 2D9TA 3CCJT 6AT1B 2X4YA 2JTMA 5FROA 1KD1R 4C8QA 1AWWA 1H3ZA 1YJWA 1UEBA 1M1FA 3FLGA 3M4PA 1SESA 4J6WA 2KGTA 1EFNA 3DSQA 3FJ5A 1VQNQ 4YRIA 1KIKA 5CO7A 4OVAA 2EYWA 3A8MB 3SWNB 1IGUA 1WXTA 3R6OA 1WYDA 1QVGS 4J9IA 2KMTA 2DAQA 3R6NA 3CMQA 3HFZA 3V8KA 3MPUB 1Z9QA 4M7AG 4P74A 2F69A 4YRSA 2FRWA 4ZGJB 3GPLA 3JB9F 3CXCA 2IVWA 1PSFA 1F1BB 1EOVA 1NNHA 3TVTA 4CRIA 1QVFS 2XD0A 1XQHA 2ED1A 2YT6A 1C1AA 2DZ9A 2K2MA 2PVOB 3CCEQ 4YREA 1UFFA 3P8YA 3VQXA 2NLUA 5CKBA 1TH7A 2M0YA 5GANg 4XEMA 3CCMA 4CS4A 3OYLA 2K57A 2RK2A 4BUGA 2BTTA 4YROA 2W10A 5LJ5j 2QGGA 1PNJA 2H8HA 2K2VA 3NGPA 1TOVA 4ANJA 2I4NA 3URGA 2C0IA 5LJ3j 4OMQA 5GJWB 4YP0A 3A1PA 4YRGA 4OLFA 4JLGA 4FSSA 1SEMA 3VRYA 4BD3A 4YRLA 1M1KC 1P92A 3MQZA 2CKKA 1VQ6A 1NJIC 5ECAA 1WX6A 3CCMT 2M9UA 4M77F 3CMAT 4XU2A 1KHIA 1MV3A 1UJYA 4HWOA 3VS2A 4LDUA 1LYLA 2CSIA 3QZ9B 3TSZA 3QXEB 4RTXA 1OZ3A 1NEGA 5LJ3g 2ARTA 3LH5A 5GAN4 2ZPEB 3KFUA 4FT4A 2X4WA 2HKNA 2COYA 4QVDA 5DM7R 5I2SA 1XNIA 3NTIA 1EIYB 4RCBA 3JB9D 4IUUA 2LT4A 1Z7NA 1JXMA 2M02A 1BI0A 1RL2A 3PMTA 1YN8A 2JTEA 2P4TA 2DEUA 2LQWA 4WI1A 3OA6A 4P73A 1VQ6T 2SRCA 3OS1A 3ICAA 3E9IA 2O31A 4UP8A 2I2LA 4BE0A 1RAAB 1BI3A 4WCIA 3OYEA 4MMLA 3CMET 3MP1A 2LNVA 3VS6A 2KXDA 2RQUA 4M75B 2F5KA 5FU7B 2CUBA 4M75G 5KNNA 4A4EA 1YIJA 3EFRA 5FRMA 5ELNA 2VUBA 4C92G 1QP3A 2FZGB 4GBQA 2ZZGA 2ZIMA 3UGQA 4ZNXA 3JRZA 2DTIA 1QKXA 2XG8D 4PFOA 3OYGA 1VQOA 3AT1B 4KULA 4YRQA 3EG9A 4YRPA 1OQKA 2VKNA 3C94A 2KXCA 2ZT5A 1QF6A 5J26A 3L2UA 2HEQA 1USYC 2KK4A 2NUZA 4A4KA 3I55T 4H2XA 2O4XB 4AG2C 1S72T 3BDUA 3H0HA 2DYIA 1YJWT 5GMKj 2O9VA 4II1A 4LDXA 3X28B 4L5GA 3M4GA 3QO5A 1YJNT 1YP5A 3S6WA 1PC0A 3MP8A 1IHWA 1SHGA 4M78B 4M78D 5LL6S 2P0LA 3HXYA 5LJ5h 5IN1A 2LQNA 4KUDK 3RUXA 4E6RA 1I0CA 3ME9A 5C6SA 4JJNK 4JLIA 3OYNA 3HRKA 4P72A 3J7AF 2AMCA 2K5FA 1CKAA 2ZCEA 3VS7A 4C92E 4JS5A 2DETA 1B7YA 4P3PA 1ZUUA 2FPEA 1E1OA 4D8KA 3VQVA 2MK5A 1QKWA 4E7JA 3QG1A 3A32A 2M0OA 3I55A 3KBGA 4E51A 4F7UE 4DEXA 1YITT 2COWA 1OOTA 3E1SA 1WHKA 2X51A 1AOJA 4Y91A 2CIMA 3UATA 1JB0E 1UGSB 2EQKA 2EWNA 2DU7A 4J9DA 3R07A 3DLMA 3E9FA 1M8VA 5FU6C 2ALYB 5IXFA 3M59A 3EAEA 2EVRA 2P5IA 3CC7T 4RTYA 3I5RA 2CREA 1V1CA 2H3JA 1PD1A 4J83A 2V1RA 4H2SA 3LWHA 1QW1A 5CQYA 5GMKi 4MZTA 4Q15A 1QVGP 2IIMA 1H8KA 2C8MA 2EGEA 2DQ3A 2Q7GA 2E41A 5GAN8 1G5VA 2KRNA 4M7DB 4FW1A 1KQSP 1YFTA 1N6AA 3JB9J 1M90U 4PFPA 3M5AA 4QVCA 2XIDA 3OBYA 4Y92A 2EQUA 1SSHA 3OYDA 4CS2A 2QEXQ 1MMGA 1UDLA 5GAN5 1WXBA 4ZN1A 1PRMC 2HAXA 1WHGA 5AYFA 1X54A 2DFUA 1VQMQ 3JCMV 3A7RA 1OPLA 4RTVA 3CCJA 2EKOA 3X25B 1X55A 5LJ5f 4V2SA 3P8BB 4LVMA 3NENA 4O6JA 3OQ5A 4K88A 1W1FA 2E5KA 2HQEA 4C5GA 4D8DA 1YJ9A 2NWMA 2E64A 4FYVB 3EHRA 1JRIA 3RR6A 4ESRA 3JCMQ 4C8QG 1YJNQ 3VS1A 1V76A 2QQAA 4YRKA 4WJ3M 1D1AA 1TUGB 3F70A 4HCBA 4PJOC 3CMAA 1VQ8T 2LQKA 1K8AU 2DERA 1NEBA 2ZR2A 1QMCA 3EG0A 1HXDA 2QA4A 2ZPGB 4DBRA 4E7ZA 2RF0A 4EDUA 2HCKA 1BBZA 1ZSZB 5IAYA 5D7UA 1H4VB 3VS4A 3PE0A 1VQKT 3CC2Q 1Q81U 4JJCA 5GMKl 1VUBA 4FYYB 2Y4YA 1UHFA 3O5ZA 3LSQA 2X4JA 1M3CA 3MKDA 1NJ8A 4M78C 3HXXA 3EGUA 5CVIA 2DU5A 3RF1A 2ABLA 1VQ9A 5A0GA 2O4XA 2L3QA 4K11A 2O9SA 3LSSA 5KE2A 2A3LA 4DQ2A 1CKBA 4BI4A 3A7UA 2Q5IA 1T3LA 2MI6A 1B76A 3TQ7P 5IHKA 3HRUA 2GQVA 3GNGA 1BCOA 2K6DA 3UH0A 3NEMA 1M5Q1 1VYVA 3M56A 3RKYA 1X2KA 4MZPA 1NJIU 2AMCB 3I5SA 2YUQA 2CP3A 1K9MU 2FPFA 4NOYA 1UGQB 3C12A 1QLYA 2KT8A 5C51B 1B8AA 4TQDA 2PMFA 3QPHA 3UDCA 3VV0A 1NG2A 3EFOB 2GGRA 1G2BA 1K73U 2G4CA 1SRYA 3RNJA 1VYUA 1E6GA 1OX9A 3OS2A 2R58A 3CCMQ 2LCSA 2EYQA 2LTOA 2XU8A 3ZFJA 3OMCA 3MF2A 4X9CA 2QEXT 2LJ1A 4J9CA 5GAOm 3CD6T 3SDZA 3HXVA 2FG0A 4L87A 3A98A 4KR2A 1YFSA 2RQRA 3PCOA 3RMSA 2P0QA 3M58A 5FWBA 3WVDB 4FM4B 2J6OA 2F2XA 1XTDA 4FCYA 4C8QE 1X01A 3OW2P 5CKFA 1LNXA 3G7ZA 1PM3A 2GFAA 1ATIA 3QNEA 4JZ4A 2HL5C 2OAUA 3M0SA 1VIFA 4YRMA 3JSCA 4R0KA 2J6KA 4HCCA 3M9QA 3WQZA 2OTJT 2ATCB 1YITA 4BY6B 3X20B 1B07A 2J06A 2PVGB 1VQLQ 3EHQA 2E6NA 4E7KA 4UP7A 1NM7A 1ASYA 3CCRT 3I9QA 4LD9K 1YNZA 1SKUB 1IXDA 5J39A 2LC4A 1JJCA 3QO8A 4C92F 1W66A 2AIRB 1KFZA 5FU7C 2LP5A 4C92A 3JB9I 1B7TA 2QDYB 4M75F 4BDZA 2X35A 1N27A 5GAOq 3O8VA 2XI9A 1ZLMA 3TSWA 1FMWA 3NTKA 1RI0A 2ODRC 1KC8R 2E3HA 2IG0A 1FWZA 1KHCA 3PIOA 1BCMA 2X4XA 2O2OA 2QA4T 1MUZA 4DBHA 5KYXA 4K86A 4LUEA 1M4ZA 1FX7A 2FEIA 4KUIA 2PUOB 1QCFA 1ADYA 1JQQA 4Y28E 4R56A 5KH6A 2ED0A 5DLOA 4J9BA 1MHNA 2F1LA 2DIGA 2DX1A 2QI2A 3JCMf 3CCRQ 5HK3A 2VASA 2RQTA 4ZTZB 3CCET 3VYGA 4H2YA 1Q81R 2DYBA 2QYZA 2RJEA 4G85A 4J9FA 1IZ6A 1L0WA 4RMOA 1FYFA 3GP8A 2ECZA 1BI1A 5GMKe 2O88A 1C6VX 1QVFA 2DMOA 3VYHB 3L2WA 3M4QA 1QQJA 1R77A 1SHFA 4TVRA 3QTCA 4TWAA 4PJMA 4H2VA 1I1JA 1BK2A 5I2MA 2MIOA 1WIEA 3FIFA 3VS0A 4CC7A 3TEGA 4BWAA 2DNUA 3HFNA 4QQ6A 3VRZA 2NUTB 2EJGA 3QO3A 4C92D 2AKLA 3VQYA 2ZNJA 2RHIA 4OB3B 1M2VB 1M90C 4H2TA 4KH1B 2RO0A 3SD4A 2DJZA 4BY6C 3IALA 4M75E 1IREB 1Y57A 4J7FA 11ASA 2LJ0A 1Q7YU 2XK0A 1GCQC 3Q1JA 1W2BA 5IT9E 3M54A 4TTVA 3A5ZA 3EG1A 3UA6A 2ZIOA 1G3SA 3JCMJ 3IKLA 2Y4XA 4AMCA 1VQOQ 1Y07A 3CMAQ 2MAMA 2WSEE 5F5WA 1M1KR 2DRKA 3V7SA 4BI8B 2J7IA 2WACA 3JB9G 2YHTA 4C8QC 4YCUA 4FYXB 3CC2A 1TG0A 3M0QA 4AFSC 2OX7A 2EBPA 1K76A 3JCMd 3T9NA 2E6ZA 4KH0B 4F16A 1LPLA 2A7YA 3EH1A 3CBOA 1SETA 2BUDA 1BYMA 3OYKA 4M4ZA 2Z0WA 1Q81C 4TVWA 4JRKA 4LNPA 2XMFA 3TUPA 2F5TX 3OB9A 4HWSA 2QA4Q 2KVQG 3LGFA 2NUTA 5I11A 1Q86U 1BBWA 5FU6B 1ABOA 4F7UG 4ORZA 2EQJA 2K9GA 1PYSB 1M1GA 1I4K1 1Q82U 1LJOA 3LW5E 1UE9A 4C5HA 4J15A 5LJ3e 3MF1A 2GTJA 2QHUA 4DEYA 3HFZB 2LJ3A 1ACMB 2QK0A 4IIMA 2GFUA 1ZSZC 2RJDA 3REBB 1WQWA 4GY5A 1M3BA 3DLLA 1YI2Q 1KC8C 4X5OA 3CD6A 2RH2A 5EC7A 2KYBA 3CCJQ 3JCMb 3H9NA 1HD3A 3CCSQ 3M57A 3M53A 1UTIA 3QSUA 3SB2A 1MGQA 1PD0A 3I55Q 2YLBA 4P75A 4A53A 2JNGA 2AKWA 1OPKA 4IUTA 4PJOF 2HKQB 3UGTA 1EVLA 3LH0A 1GGMA 4PKCC 1JJ2P 1J5WA 5IXBA 2HMAA 3CCUT 2JXBA 4OF1A 2ZPIB 1VQ7T 2ROTA 3TEHB 1K9AA 2EYZA 3OSVA 2AHJB 2D8JA 4AFQC 3ZEHA 4B6MA 3VUBA 3S3MA 1RAEB 3HTRA 3BDLA 2QHTA 2D8HA 4X34A 4H2WA 3TEHA 3EG9B 1HJDA 4OMLA 2A0FB 4ATOA 2M16A 2K3XA 1M9SA 4PJOB 4O2DA 3PT9A 5A2QE 1KD1C 4PG3A 2KAFA 5DY9A 3HXWA 3HY1A 1Y71A 1OEBA 1WXUA 5KE3A 1X2HA 2FVUA 4F7UF 1VQ6Q 5GMKm 3MJXA 3VQWA 2DXBA 2ZXFA 2LCCA 1V29B 1YITQ 2ZAEA 4HKEA 4J8OA 2JM9A 2EJ9A 4PJJA 1W2BS 3EGXA 4CS3A 2JW4A 3L2QA 1NYGA 1EFWA 2ENMA 2QXFA 5CCAA 4P3OA 4WTOB 2MF2A 2MWPA 5FRNA 2I4MA 3EGXB 4M78G 5C52B 4M7AA 1YBYA 2I4OA 3V7RA 1GCQA 3OW2A 3JCMW 2ZNIA 3G4ST 2ZZEA 2HBPA 2L5QA 2DM1A 4XU3A 2DL8A 4A4HA 2BZ8A 1SG5A 4F17A 1WJQA 2DXCA 1X75C 4YYEA 3EG3A 2L89A 2OTJQ 1M27C 1ZBJA 3QWYA 2PUKB 3JV3A 3SHWA 4FT2A 5GAOr 1PKTA 5J3BA 2CGHA 4P74C 4NS5A 2CP5A 2MCNA 1LCKA 4QT7A 3CXCP 1R0CB 4BDYA 1C0AA 2FZKB 2E1HA 5A0LA 3CCEA 2CP7A 3NHNA 4XU1A 3QDFA 4TQFA 4F7UA 1T3SA 2X3XD 4M78E 1YIJT 2OI3A 3GBQA 1RIQA 1ZBXA 1VQLA 2DEQA 3INZA 1B34B 1WHLA 4DOWA 1WGSA 1HC7A 1G5HA 1T0JA 3SWNA 1MMNA 2RM4A 1EQRA 3JCMg 2FB7A 1WA7A 1N8RR 3P8HA 1VYTA 4M75D 2YRCA 2EFIA 1G83A 2MPXC 2QQ9A 3VU3C 4X1VA 3NELA 1PSEA 5IHNA 3OSSC 5C0MA 4YCVA 4KBMB 4XTWA 4A54A 2NUPA 3UF4A 1M1KU 1BBUA 3PIPA 3UWNA 3E9HA 2BE7D 3IQLA 2CZ6B 2XDPA 1JJCB 1GL5A 4LNSA 1QVFP 2Q7EA 3A8GB 1JXOA 1ZUKA 3FJPA 2RI5A 3PMIA 2E12A 1UUEA 2QASA 3CC7Q 4PL6A 3QIIA 1JJ2S 1Z9ZA 1HSQA 5GAMd 2R5MA 4FW2A 3J80E 4YRNA 2E5QA 5GANd 2IY5B 1M3AA 4E7IA 4RG2A 2E70A 1VQNT 2B86A 3OYIA 1X56A 4TVYA 2FL7A 3MEWA 2A08A 2DK3A 1TU0B 4OB0B 1WQ7A 1VQ7A 2P4RA 3A8LB 4AFUC 3GOXA 5GANh 3V8JA 4JUVA 3CC4Q 3JCMP 1E1TA 1AD5A 3CCLQ 4KRTA 4J9EA 4NCXA 3M55A 2PZ1A 3QHSA 4YRCA 2KY9A 1K8AC 1K4US 2KRSA 4KGVB 2QHVA 4FIBA 1RAFB 2FPDA 1WHHA 1WHMA 2RHXA 2I0NA 5KYWB 1LOJA 1RACB 1ABQA 2Q5HA 3HPWA 2NYSA 4LXCA 2G6FX 2HL3A 3OY9A 3HTZA 1I5LA 4JPBW 2XKOC 2AKWB 1KK7A 1JBMA 3EFOA 2QDLA 4KGZB 3BE3A 1Q86C 3WXMB 3DB3A 3QYHB 2HQXA 4Z02A 2CT3A 4RTUA 3MP6A 5CAIA 2VV5A 2KSSA 5CIUA 2K79A 2YXYA 2LX9A 4GLKA 3VS3A 2DE0X 1E7OA 1O75A 4N4HA 4PLIA 4OGEA 2AZVA 4CH6A 1LVKA 2IY5A 1W70A 4M77A 4EPCA 1VQMA 1JEGA 2YUOA 1GFCA 2OTLT 2DA9A 2L3SA 1SERA 3HL8A 1KOGA 4XTYA 2FHDA 1Y0MA 1NPPA 1GXIE 2DL5A 5CKEA 3RESA 2ZZFA 1IL2A 3M0UA 5GANf 5C53B 2QAZA 2F2WA 5KYXB 3L2VA 2DBKA 1R0BG 1G3WA 2O01E 1USYA 2OJ2A 4E7HA 1U06A 4XU0A 4VUBA 1YB3A 2ZPHB 4XEOA 2P0KA 2DL7A 4HWRA 2XHCA 3CCQQ 1D3BA 1BB9A 1TS9A 1M8MA 3WVEB 4CC4B 1TWBA 1D0XA 2V8IA 1KQ2A 2DPPB 2JT4A 2GF7A 3CD6Q 1AWJA 1EZZB 4LDYA 1YI2A 2YUPA 5KCHA 1VQ4T 1K73R 1MMAA 2DF6A 4ELYC 4JRIA 2HDAA 3FDRA 4MDXA 1RADB 1TTHB 2LMJA 1GCPA 1JO8A 3CPWP 4M7DF 3P8VA 1ARKA 3G4SA 3QBYA 2RK1A 2VC8A 2XTIA 3EG2A 3HKSA 1S72Q 1RAGB 3I35A 1ZQ1A 1N8RC 2XGTA 1M2OA 2IPOB 1PKSA 3EFSA 3JCMh 2LCLA 3G71A 4CH3A 4M77E 4X9DA 4FYWB 3TEEA 8AT1B 1G8XA 3BFMA 1WPYA 1GFDA 2HSEB 1B3QA 3NETA 1OYXA 12ASA 3OYFA 3QDRB 2KI7A 2F2VA 1VQLT 1EIYA 4C8QF 3TU4K 4HA8A 3CBMA 4M7DA 1D3BB 1QCOA 2KQWA 3E19A 3C4SA 1N5ZA 3QZ5B 4M78A 1YHQT 1X2QA 2CH4W 3CCQT 4A4FA 1OZ2A 1GBQA 3TREA 5CQXA 1HYOA 3THKA 2DXTA 3VKIA 3V8LA 1CSKA 5GAMh 2OTJA 1UGRB 3H8ZA 1TUDA 5D6WA 1EIFA 2LX7A 1G3YA 1RABB 2CZ0B 2VXFA 1QWFA 1B70A 1E22A 2DBMA 3HP9A 2JZ2A 4DPGA 1IB8A 3MO8A 2EYYA 1VQ8Q 1J3TA 1VQ4A 2K5IA 2MWOA 4OMFB 1Q86R 2AKKA 4EO4A 2RHSB 1QCNA 1QVPA 3H6ZA 4P71C 2W0ZA 1PRLC 2EQIA 3BJUA 5GMKh 4EIKA 1R8OB 3NPFA 1OU9A 3G1JA 2VB6A 4LVKA 4ZTUB 4DA4A 4PJOA 1Y7XA 1NJ6A 2FRYA 3UPUA 1ZA2B 4E2FB 1D1BA 2CH4A 2ZPBB 2MYSA 5HGQA 1RLQC 1SRMA 3NTHA 1MNEA 3TCJA 4J6XA 2YRDA 3ULRB 2PNIA 2E3IA 1K9MC 1QWEA 1I5OB 2QQRA 4C0ZA 2JOYA 5GAN2 2RD1A 1YFNA 3REUA 4OMNA 2DDZA 4OB1B 4L59A 4OMOA 4AT1B 3C95A 2HBWA 2DO3A 5K1PA 3CCLA 3OYJA 3AHUA 3MEUA 4IURA 1Q95G 5L23A 4QQDA 3REAB 4C8QB 1GRIA 2VYTA 2MMPA 3I7FA 1X43A 2RQVA 4YPFA 2RPNA 4LD6A 4YRFA 1G3TA 4LE9A 1WI7A 3PTAA 3CMEQ 1X2GA 1ZA1B 2ZT6A 4YRRA 3PCOB 4RQFA 5L8RE 4CC2A 4QVZA 1WFWA 3PVQA 4FL6A 4JJDA 3CC4A 2AT1B 4HWTA 4PJOD 1VQPT 1RAHB 4PFZA 2K7AA 2DD5A 1FXXA 1MV0B 2GBQA 4E47A 2RNAA 2DLPA 3OBWA 4AFZC 4CC3A 1K9MR 2RHYA 5GAMg 5LJ5e 2JVVA 2VGNA 3HY0A 5D6XA 1RUWA 3LX7A 2A8EA 3JCMX 5GAOp 4ZN3A 1ADJA 4XTZA 1FYNA 3RERA 2CUDA 2CP0A 1K73C 2X3WD 2B8AA 1T0HA 3QO7A 3ERRA 1PG5B 4C0FA 1B7YB 4HVCA 1KC8U 1FMVA 3RIRA 4HCKA 2I4LA 1BIBA 1SSFA 4C0DC 2DIQA 2ZPFB 4TVAB 4H02A 4P73C 4M7AD 1BU1A 3UFGA 5IHIA 3UT1A 2KT1A 3P8TA 1B70B 5HKCA 4HT9A 3G71T 4BB7A 4FSXA 5DLQE 4BI3A 2DTOA 1M30A 2WSFE 4M77G 5KYUB 2NS6A 2RHQA 2BKDN 4RKUE 1WLPB 1OV3A 2RA2A 3CC7A 2HQHA 3V7CA 2K5LA 3OW2S 1U1SA 1VQKA 2VWFA 2R5AA 4ZTJA 1KMNA 4OGCA 5K1XA 4PHCA 2V8JA 2G3RA 3G6EA 1VQ5Q 3JCMc 3MEAA 4B9WA 1BKBA 4UP9A 5ELOA 2L3RA 1VQ8A 2KR3A 1MNDA 2XDDA 1IRXA 2DILA 1YJNA 4HT4A 4OP0A 3G71Q 3CPWS 2QTVA 1PHTA 4N4GA 1AHJB 2E65A 4KGXB 3L42A 3HXZA 2RB6A 4G84A 4RTZA 3ER0A 1YHQA 2JS0A 4M75A 3GLXA 2YDLA 1ZHIA 4F7UB 3LWIA 2EQMA 2LQ8A 4RMFA 5IH2A 1X6OA 3SEMA 2E5AA 4QW2A 3CCST 1K0SA 4PK4A 1Q7YC 4M7AF 4P71A 1SRLA 1VQ5T 4WF2A 1VQPQ 2BE9B 2V8KA 2QEXA 3ZL7C 1ZSGA 1VQZA 4B9XA 1AWXA 2LVMA 2DL4A 4Q5WA 4ME7A 4MDWA 2YLCA 4L6V5 2RHQB 4K87A 4HCZA 4HVVA 4C92B 2LDMA 3UA7A 1KQSS 4ZGDB 2CDTA 4N0AC 2V26A 2PVDB 1W2BP 4N0AA 4XTVA 3RKXA 3U23A 3IKMB 2C06A 4HT8A 2J3MA 4J6YA 4C8QD 4JZ3A 4OMPA 2WSCE 2KEAA 3BY7A 5GAOl 3CCUA 2ESWA 2AZSA 1VQ7Q 3E9GA 3NMZC 4KR3A 2DD4A 3A8HB 2CJAA 1I81A 2JS2A 3CXCS 5GANj 1NE8A 1YCYA 7AT1B 2QHSA 1I07A 1YJWQ 4E7LA 4LVLA 3QYGB 4JRPA 4C0DB 4LVIA 2KYMA 2OTLA 2PMEA 1IHVA 4FU6A 4D6WA 1QVGA 2KROA 1I8FA 2LNHB 3D7SB 3M0RA 2C7IA 1VIEA 3EGDA 4EMKB 4KQEA 1H4QA 1Q82C 2RN8A 5GAN6 1TUCA 1WHJA 1X6BA 2JUFA 4P5NA 5CK9A 2RHZA 1UG1A 2AK5A 2RI3A 2FZCB 3FC3A 4C0GA 1OX8A 1WNLA 4YDQA 4ZGEB 1HK9A 3PZCA 1ZX6A 4RTTA 2ODRD 3RBBB 2PTKA 1H4TA 2ZZDA 1KQ1A 1PCXA 3CEYA 3I56T 2K3YA 1BI2A 1NJIR 3REXA 4EMKC 1O9SA 1X6GA 3HRIA 1K0XA 1YJ9Q 2GNCA 2GQIA 5CR2A 2K4YA 1ASZA 3BW1A 4M77B 3RGLA 1AZGB 4BW9A 2RI2A 5M9OA 4JJBA 4ZTFA 2GTOA 3CPWA 2COZA 1D09B 3OYCA 4UPAA 4M77D 4J9GA 2EL9A 1AVZC 3GF5A 2LRQA 4BE2A 4QQGA 9ATCB 4CH5A 1KJWA 2A28A 3SWNC 3HXUA 2BIVA 2CYZB 1X69A 1D0ZA 5FW9A 2DKGA 1N9SA 3CCUQ 2FYKA 3KUFA 5GANe 3KFVA 1G51A 2QGFB 5CKHA 3I56Q 2YRVA 1OI1A 1WJSA 1YIJQ 5EG2A 2R57A 2CJBA 3RKWA 1C0MA 2QTXA 4M7DD 2EW3A 2P0PA 4H2UA 3A7AA 2CT4A 4WJ4A 1H3HA 1RLPC 4Z89A 3I56A 2ARSA 4M7DG 3H0IA 2X9HA 2L3PA 2GCXA 4LVJA 4M7AE 1UECA 1VQPA 4C92C 1ZUYA 1PWTA 4Q6GA 1YJ9T 1M2VA 2DZCA 3MHXA 4M7AC 1N9WA 3ASKA 2JM8A 5KYUA 5AT1B 5KYYB 1H641 3HRSA 4PNOA 2M51A 2OTLQ 4XTXA 3FB9A 2DJQA 4RG8A 4IUQA 3VS5A 4RTWA 4PLLA 5GAN7 2KE9A 1UGPB 3OYBA 1Y96B 4YRTA 2H3EB 3HHTB 2JN0A 3CPFA 5GAN3 5KYNA 3OS5A 4RDXA 3NFCA 3JCMe 1YWOA 2C0TA 2DTHA 4ELZC 2EPDA 3QUIA 2ROLA 4ZIBA 4DBQA 3OD1A 4F04B 5LJ3d 4KT0E 2ZCFB 1Q7YR 2P84A 4XQ3A 3RMQA 3CCQA 2CP6A 4PJLA 2D6FA 1NJ1A 2JMCA 1VQKQ 3CC2T 2DXUA 5LJ5d 4LDWA 3HRTA 2RQWA 3VJPA 4AG1C 2DRMA 4M7DC 1A0NB 4H2XB 2D0QB 2JMAA 1WZOA 4O5VA 4J9HA 4XAXB 2ALYA 1YCSB 4IUPA 5GAOn 1JU5C 3QJYA 3KXTA 4P72C 1VOMA 3A8OB 4C5IA 4DOVA 4CI0C 1NYQA 5I22A 1KSWA 2SEMA 1H4SA 2D0NA 4JRQA 4EMGA 3L4GB 2EGCA 1AZEA 2E3CA 3HFOA 3FEOA 4LN2A 3S3OA 1VQOT 3CMEA 1PYSA 1Y96A 3A31A 4RQEA 8ATCB 4LDVA 1Z7MA 2HSPA 4OMMA 4M7DE 3RDVA 3G4SQ 2L8DA 1E24A 1VQ4Q 2A37A 2QG9B 1UHCA 4MZMA 3M4YA 3OYHA 1NYRA 5LJ3f 2QQBA 3CBPA 2EAYA 3OMGA 4F14A 2ZR3A 5GJVB 3FRNA 3MCAB 3G6EQ 4C5EA 2HZYA 4AH6A 1IGQA 4Z88A 2YSQA 1VQ9Q 2RJFA 3DKMA 1SF9A 3M0PA 5A0DA 2M1HA 2D1XA 3L2ZA 4M75C 3VUZA 2ZGWA 3QWXX 1NJ5A 5CKDA 5GAMe 3META 1RAIB 3H41A 3X24B 5FLXE 4NL3A 1UJ0A 4M7AB 4BACA 3PVLA 4RCCA 3MEYA 4LUDA 1WJRA 2A36A 4QKUA 1U5SA 1H92A 1S72A 2J05A 1U8RA 5KCOA 4A4GA 1YHQQ 2JTFA 2RHSA 3A5ZB 1HTTA 2HNIA 3CCLT 2CJ9A 4YCWA 1M90R 2EGAA 2L2PA 1AEYA 3E2UA 3GNFB 3A74A 1W6XA 3N5BB 5LJ5g 3OYAA 3CCVA 3G1ZA 1NLPC 1G5IA 3IG2A 2BZXA 4J7IA 1VQMT 3CCVT 2EJFA 1YI2T 2LT1A 2E10A 4EX5A 4N4IA 3M0TA 1AT1B 2VXEA 3X26B 2DQ0A 2ZINA 3DB4A 5GAMf 3J81E 5FWCA 4GLMA 2KBTA 4YRJA 2KRMA 3LGLA 3HSBA 4HXJA 3OYYA 1JJ2A 1DJ7B 4PJOE 1U1TA 1UB4A 2C0OA 3C0CA 3EH2A 3W3SA 2KNBB 1TSFA 1FMKA 1KMMA 2K3BA 1NLOC 2OAWA 2MOXA 1AWOA 1EVKA 1NZ9A 1U3OA 2DVEA 1VQNA 5D6YA 1OU8A 4A63B 2PQWA 2EIFA 3P8DA 1OULA 2Q7HA 1ZSZA 2E4HA 4RUGA 5I21A 4TVAA 3PNWC 1XJWB 1K8AR 3LC0A 4YTLA 2CP2A 4MMKA 1VQ9T 3JB9H
chains in the Genus database with same CATH topology
3VBBA 3QJ6A 2RHUA 4UC4A 3CC4T 5HY6A 4P75C 3GIBA 2J3LA 3RL6A 3L4GA 2QQSA 5E3IA 3JAME 3G6ET 3A5YA 4JDSA 5HK0A 4CH4A 4M78F 2CZ1B 4XTUA 3ZBDA 2ARUA 3SFMA 3QKJA 2Y90A 2RJCA 1BIAA 3L1AA 4J5YA 2HD0A 2ZT8A 4EMHA 1NPRA 1NJ2A 2VGMA 1N8RU 4P3NA 4XK8E 4BE1A 4IKFA 3LLRA 4NL2A 5LJ3h 2ZT7A 4JS4A 2XDBA 2KDSA 3CCSA 5GAMj 1WU7A 3RACA 1QP2A 3L2RA 3CCRA 4IUVA 4PJOG 1KQSA 3PFSA 2XICA 1WLEA 3LYIA 1YFRA 1KD1U 1KG1A 3OS0A 4M77C 4HWPA 1B34A 1XOVA 1N9RA 3OYMA 2PU9B 1VQ5A 2CS7A 4R55A 4OB2B 2CZ7B 1W4SA 2ZTGA 1YGBA 3MEVA 3PGGA 4EMKA 1QE0A 3S3NA 3HFVA 2D9TA 3CCJT 2X4YA 2JTMA 5FROA 4C8QA 1H3ZA 1YJWA 1UEBA 1M1FA 3FLGA 3M4PA 1SESA 4J6WA 3DSQA 4YRIA 5CO7A 4OVAA 3A8MB 3SWNB 3R6OA 1WYDA 1QVGS 2KMTA 2DAQA 3CMQA 3HFZA 3V8KA 4M7AG 4P74A 2F69A 4YRSA 4ZGJB 3GPLA 3JB9F 3CXCA 2IVWA 1PSFA 1EOVA 1NNHA 4CRIA 1QVFS 2XD0A 1XQHA 2DZ9A 2PVOB 4YREA 3P8YA 3VQXA 2NLUA 5CKBA 4XEMA 1TH7A 5GANg 3CCMA 4CS4A 3OYLA 2K57A 2RK2A 4BUGA 4YROA 5LJ5j 2K2VA 2I4NA 3URGA 5LJ3j 4YP0A 4YRGA 4OLFA 4JLGA 4BD3A 4YRLA 1M1KC 1P92A 3MQZA 2CKKA 1VQ6A 1NJIC 3CCMT 2M9UA 4M77F 3CMAT 4XU2A 1KHIA 4HWOA 4LDUA 1LYLA 3QZ9B 3QXEB 1OZ3A 5LJ3g 2ARTA 5GAN4 2ZPEB 3KFUA 4FT4A 2X4WA 4QVDA 5DM7R 5I2SA 1XNIA 3NTIA 1EIYB 4RCBA 3JB9D 4IUUA 2LT4A 1Z7NA 1BI0A 1RL2A 3PMTA 2P4TA 4WI1A 3OA6A 4P73A 1VQ6T 3OS1A 3ICAA 3E9IA 4UP8A 2I2LA 4BE0A 1BI3A 3OYEA 4MMLA 3CMET 3MP1A 2LNVA 4M75B 2F5KA 5FU7B 4M75G 5KNNA 4A4EA 1YIJA 3EFRA 5FRMA 5ELNA 2VUBA 4C92G 1QP3A 3UGQA 2ZZGA 2ZIMA 3JRZA 2DTIA 2XG8D 3OYGA 1VQOA 4KULA 4YRQA 4YRPA 3C94A 2ZT5A 1QF6A 5J26A 3L2UA 1USYC 2KK4A 4A4KA 3I55T 4H2XA 2O4XB 1S72T 3BDUA 1YJWT 5GMKj 4II1A 4LDXA 3X28B 4L5GA 3M4GA 3QO5A 1YJNT 3S6WA 3MP8A 4M78B 4M78D 5LL6S 2P0LA 3HXYA 5LJ5h 5IN1A 4KUDK 3RUXA 3ME9A 5C6SA 4JJNK 4JLIA 3OYNA 3HRKA 4P72A 3J7AF 2AMCA 2K5FA 2ZCEA 4C92E 4JS5A 1B7YA 4P3PA 1E1OA 3VQVA 4E7JA 3QG1A 3A32A 2M0OA 3I55A 3KBGA 4E51A 4F7UE 1YITT 3E1SA 4Y91A 2CIMA 1JB0E 1UGSB 2EQKA 2EWNA 2DU7A 3R07A 3DLMA 3E9FA 1M8VA 5FU6C 2ALYB 3M59A 3EAEA 2P5IA 3CC7T 2H3JA 4J83A 4H2SA 3LWHA 1QW1A 5CQYA 5GMKi 4MZTA 4Q15A 2C8MA 2DQ3A 2Q7GA 2E41A 5GAN8 1G5VA 4M7DB 1YFTA 1N6AA 3JB9J 1M90U 4QVCA 3M5AA 2XIDA 3OBYA 2EQUA 3OYDA 4CS2A 5GAN5 4ZN1A 2HAXA 5AYFA 1X54A 3JCMV 3A7RA 3CCJA 2EKOA 3X25B 1X55A 5LJ5f 4V2SA 3P8BB 4LVMA 3NENA 4O6JA 3OQ5A 4K88A 2HQEA 4C5GA 1YJ9A 2E64A 1JRIA 3JCMQ 4C8QG 2QQAA 4YRKA 4WJ3M 3F70A 4HCBA 4PJOC 3CMAA 1VQ8T 2LQKA 1K8AU 2ZR2A 2QA4A 1HXDA 2ZPGB 4EDUA 1H4VB 5IAYA 1VQKT 1Q81U 5GMKl 1VUBA 2Y4YA 3LSQA 2X4JA 1NJ8A 4M78C 3HXXA 5CVIA 2DU5A 3RF1A 1VQ9A 5A0GA 2O4XA 3LSSA 5KE2A 2A3LA 4DQ2A 4BI4A 3A7UA 2Q5IA 2MI6A 1B76A 3HRUA 2GQVA 3GNGA 3UH0A 3NEMA 1M5Q1 3M56A 3RKYA 4MZPA 1NJIU 2AMCB 1K9MU 4NOYA 1UGQB 3C12A 5C51B 1B8AA 4TQDA 2PMFA 3QPHA 3UDCA 3VV0A 1K73U 2G4CA 1SRYA 3OS2A 2R58A 2EYQA 2LTOA 2XU8A 3ZFJA 3OMCA 3MF2A 4L87A 4X9CA 2QEXT 5GAOm 3CD6T 3HXVA 3SDZA 4KR2A 1YFSA 3PCOA 3RMSA 2P0QA 3M58A 3WVDB 4FM4B 1XTDA 4C8QE 1X01A 5CKFA 1LNXA 3G7ZA 2GFAA 1ATIA 3QNEA 2OAUA 1VIFA 4YRMA 3JSCA 4HCCA 3M9QA 3WQZA 2OTJT 1YITA 4BY6B 3X20B 2PVGB 2E6NA 4E7KA 4UP7A 1ASYA 3CCRT 4LD9K 5J39A 2LC4A 1JJCA 3QO8A 4C92F 1W66A 5FU7C 4C92A 3JB9I 2QDYB 4M75F 4BDZA 2X35A 1N27A 5GAOq 3O8VA 2XI9A 3NTKA 1RI0A 2ODRC 2IG0A 1FWZA 1KHCA 3PIOA 2X4XA 2QA4T 4K86A 1M4ZA 1FX7A 4KUIA 2PUOB 1ADYA 4Y28E 4R56A 5KH6A 5DLOA 1MHNA 2DIGA 2QI2A 3JCMf 5HK3A 4ZTZB 3CCET 3VYGA 4H2YA 2RJEA 4G85A 1IZ6A 1L0WA 4RMOA 1FYFA 3GP8A 1BI1A 5GMKe 1QVFA 3VYHB 3L2WA 3M4QA 4TVRA 3QTCA 4TWAA 4H2VA 5I2MA 3FIFA 3TEGA 4BWAA 3HFNA 4QQ6A 2EJGA 3QO3A 4C92D 3VQYA 2ZNJA 2RHIA 4OB3B 1M90C 4H2TA 2RO0A 3SD4A 2DJZA 4BY6C 3IALA 4M75E 1IREB 4J7FA 11ASA 1Q7YU 2XK0A 3Q1JA 1W2BA 5IT9E 3M54A 4TTVA 3A5ZA 2ZIOA 1G3SA 3JCMJ 3IKLA 2Y4XA 1Y07A 2MAMA 2WSEE 5F5WA 3V7SA 4BI8B 2WACA 3JB9G 2YHTA 4C8QC 4YCUA 3CC2A 3JCMd 3T9NA 2E6ZA 2A7YA 3CBOA 1SETA 2BUDA 1BYMA 3OYKA 1Q81C 4TVWA 4JRKA 3TUPA 2F5TX 3OB9A 4HWSA 2KVQG 3LGFA 1Q86U 1BBWA 5FU6B 4F7UG 2EQJA 1PYSB 1M1GA 1I4K1 1Q82U 1LJOA 3LW5E 4C5HA 4J15A 5LJ3e 3MF1A 2QHUA 3HFZB 2GFUA 2RJDA 1WQWA 4GY5A 3DLLA 1KC8C 4X5OA 3CD6A 2RH2A 3JCMb 3M57A 3M53A 3QSUA 3SB2A 1MGQA 4P75A 2YLBA 4A53A 2JNGA 2AKWA 4IUTA 4PJOF 3UGTA 1EVLA 3LH0A 1GGMA 4PKCC 1J5WA 3CCUT 4OF1A 2ZPIB 1VQ7T 3TEHB 3OSVA 2AHJB 3ZEHA 3VUBA 3S3MA 2QHTA 3BDLA 4X34A 4H2WA 3TEHA 4ATOA 2M16A 2K3XA 1M9SA 4PJOB 4O2DA 3PT9A 5A2QE 1KD1C 4PG3A 2KAFA 5DY9A 3HXWA 3HY1A 1Y71A 5KE3A 1X2HA 2FVUA 4F7UF 5GMKm 3VQWA 2DXBA 2ZXFA 2LCCA 1V29B 4HKEA 4J8OA 2EJ9A 1W2BS 4CS3A 3L2QA 1EFWA 5CCAA 2QXFA 4P3OA 2MF2A 2MWPA 5FRNA 2I4MA 4M78G 5C52B 4M7AA 1YBYA 2I4OA 3V7RA 3OW2A 3JCMW 2ZNIA 3G4ST 2ZZEA 2HBPA 2L5QA 4XU3A 4A4HA 1WJQA 2DXCA 1X75C 4YYEA 2L89A 2PUKB 4FT2A 5GAOr 5J3BA 2CGHA 4P74C 4NS5A 1C0AA 4BDYA 2E1HA 5A0LA 3CCEA 4XU1A 4TQFA 4F7UA 4M78E 1YIJT 1RIQA 1ZBXA 1VQLA 2DEQA 3INZA 1B34B 4DOWA 1WGSA 1HC7A 1G5HA 3SWNA 1EQRA 2RM4A 3JCMg 2FB7A 3P8HA 4M75D 2EFIA 2QQ9A 3VU3C 3NELA 1PSEA 3OSSC 5C0MA 4YCVA 4KBMB 4XTWA 4A54A 1M1KU 1BBUA 3PIPA 3UWNA 3E9HA 2CZ6B 2XDPA 1JJCB 4LNSA 2Q7EA 3A8GB 3FJPA 2RI5A 3PMIA 2E12A 4PL6A 3QIIA 1JJ2S 5GAMd 2R5MA 3J80E 4YRNA 2E5QA 5GANd 2IY5B 4E7IA 4RG2A 2E70A 1VQNT 3OYIA 1X56A 4TVYA 2FL7A 3MEWA 2DK3A 4OB0B 1WQ7A 1VQ7A 3A8LB 3GOXA 5GANh 3V8JA 4JUVA 3JCMP 1E1TA 4NCXA 3M55A 3QHSA 4YRCA 2KY9A 1K8AC 2QHVA 4FIBA 2RHXA 1LOJA 2Q5HA 3HPWA 3OY9A 3HTZA 1I5LA 2XKOC 2AKWB 1JBMA 1Q86C 3WXMB 3DB3A 3QYHB 2HQXA 4Z02A 3MP6A 5CAIA 2VV5A 2KSSA 5CIUA 2LX9A 4GLKA 1O75A 4N4HA 4PLIA 4OGEA 4CH6A 2IY5A 4M77A 4EPCA 1VQMA 2OTLT 1SERA 3HL8A 1KOGA 4XTYA 2FHDA 1NPPA 1GXIE 5CKEA 3RESA 2ZZFA 1IL2A 5GANf 5C53B 3L2VA 1G3WA 2O01E 1USYA 4E7HA 4XU0A 4VUBA 1YB3A 2ZPHB 4XEOA 2P0KA 4HWRA 2XHCA 1D3BA 3WVEB 2V8IA 1KQ2A 2DPPB 2GF7A 4LDYA 1YI2A 5KCHA 1VQ4T 4ELYC 4JRIA 3FDRA 4MDXA 3P8VA 4M7DF 3G4SA 3QBYA 2RK1A 2VC8A 2XTIA 3HKSA 1ZQ1A 2XGTA 1N8RC 3EFSA 3JCMh 2LCLA 3G71A 4CH3A 4M77E 4X9DA 3TEEA 3BFMA 1WPYA 3NETA 1OYXA 12ASA 3OYFA 3QDRB 1VQLT 1EIYA 4C8QF 3TU4K 4HA8A 3CBMA 4M7DA 1D3BB 2KQWA 3E19A 3C4SA 3QZ5B 4M78A 1YHQT 3CCQT 4A4FA 1OZ2A 3TREA 5CQXA 2DXTA 3VKIA 3V8LA 5GAMh 2OTJA 1UGRB 3H8ZA 5D6WA 1EIFA 1G3YA 2CZ0B 2VXFA 1B70A 1E22A 3HP9A 2JZ2A 4DPGA 3MO8A 1VQ4A 2K5IA 2MWOA 4OMFB 4EO4A 2RHSB 1QVPA 4P71C 3H6ZA 3BJUA 5GMKh 1R8OB 4LVKA 4ZTUB 4DA4A 4PJOA 1Y7XA 1NJ6A 3UPUA 2ZPBB 5HGQA 3NTHA 3TCJA 4J6XA 1K9MC 2QQRA 4C0ZA 2JOYA 5GAN2 2RD1A 3REUA 2DDZA 4OB1B 4L59A 3C95A 2DO3A 5K1PA 3CCLA 3OYJA 3AHUA 3MEUA 4IURA 4QQDA 4C8QB 2VYTA 2MMPA 3I7FA 4YPFA 4LD6A 4YRFA 1G3TA 3PTAA 1X2GA 2ZT6A 4YRRA 3PCOB 4RQFA 5L8RE 4QVZA 4FL6A 3CC4A 4HWTA 4PJOD 1VQPT 2DD5A 1FXXA 4E47A 3OBWA 2RHYA 5GAMg 5LJ5e 2JVVA 2VGNA 3HY0A 5D6XA 3LX7A 2A8EA 3JCMX 5GAOp 4ZN3A 1ADJA 4XTZA 3RERA 1K73C 2B8AA 3QO7A 3ERRA 4C0FA 1B7YB 4HVCA 1KC8U 3RIRA 2I4LA 1BIBA 1SSFA 4C0DC 2DIQA 2ZPFB 4TVAB 4H02A 4P73C 4M7AD 3UFGA 3UT1A 3P8TA 1B70B 5HKCA 4HT9A 3G71T 4BB7A 4FSXA 5DLQE 4BI3A 2DTOA 2WSFE 4M77G 2NS6A 2RHQA 2BKDN 4RKUE 2RA2A 3CC7A 3V7CA 2K5LA 3OW2S 1U1SA 1VQKA 2R5AA 4ZTJA 1KMNA 4OGCA 5K1XA 4PHCA 2V8JA 2G3RA 3G6EA 3JCMc 3MEAA 4B9WA 1BKBA 4UP9A 5ELOA 2L3RA 1VQ8A 2XDDA 1YJNA 4HT4A 4OP0A 3CPWS 4N4GA 1AHJB 2E65A 3L42A 3HXZA 2RB6A 4G84A 3ER0A 1YHQA 4M75A 3GLXA 1ZHIA 4F7UB 3LWIA 2EQMA 2LQ8A 4RMFA 1X6OA 2E5AA 4QW2A 3CCST 4M7AF 1Q7YC 4P71A 1VQ5T 4WF2A 2V8KA 2QEXA 1VQZA 4B9XA 2LVMA 4Q5WA 4ME7A 4MDWA 2YLCA 4L6V5 2RHQB 4K87A 4HCZA 4C92B 2LDMA 1KQSS 4ZGDB 4N0AC 2PVDB 4N0AA 4XTVA 3RKXA 3IKMB 2C06A 4HT8A 2J3MA 4J6YA 4C8QD 2WSCE 3BY7A 5GAOl 3CCUA 3E9GA 4KR3A 2DD4A 3A8HB 2CJAA 1I81A 3CXCS 5GANj 1NE8A 1YCYA 2QHSA 4E7LA 4LVLA 3QYGB 4JRPA 4C0DB 4LVIA 2OTLA 2PMEA 4FU6A 1QVGA 4D6WA 1I8FA 2C7IA 1VIEA 4EMKB 4KQEA 1H4QA 1Q82C 5GAN6 4P5NA 2JUFA 5CK9A 2RHZA 2RI3A 3FC3A 4C0GA 1WNLA 4YDQA 4ZGEB 1HK9A 3PZCA 2ODRD 1H4TA 2ZZDA 1KQ1A 3I56T 3CEYA 2K3YA 1BI2A 3REXA 4EMKC 1O9SA 3HRIA 5CR2A 2K4YA 1ASZA 3BW1A 4M77B 3RGLA 4BW9A 2RI2A 5M9OA 4ZTFA 3CPWA 3OYCA 4UPAA 4M77D 2EL9A 3GF5A 2LRQA 4BE2A 4QQGA 4CH5A 3SWNC 3HXUA 2BIVA 2CYZB 2DKGA 1N9SA 2FYKA 3KUFA 5GANe 1G51A 5CKHA 2YRVA 1OI1A 1WJSA 5EG2A 2R57A 2CJBA 3RKWA 2QTXA 4M7DD 2P0PA 4H2UA 3A7AA 4WJ4A 3I56A 2ARSA 4M7DG 2GCXA 4LVJA 4M7AE 1VQPA 4C92C 4Q6GA 1YJ9T 2DZCA 3MHXA 4M7AC 1N9WA 3ASKA 1H641 3HRSA 4PNOA 4XTXA 3FB9A 4RG8A 4IUQA 4PLLA 5GAN7 1UGPB 3OYBA 1Y96B 4YRTA 3HHTB 2JN0A 3CPFA 5GAN3 3OS5A 4RDXA 3NFCA 3JCMe 2DTHA 4ELZC 3QUIA 4ZIBA 3OD1A 5LJ3d 4KT0E 2ZCFB 4XQ3A 3RMQA 3CCQA 2D6FA 1NJ1A 3CC2T 2DXUA 5LJ5d 4LDWA 3HRTA 3VJPA 4M7DC 4H2XB 2D0QB 4O5VA 4XAXB 2ALYA 4IUPA 5GAOn 3QJYA 3KXTA 4P72C 3A8OB 4C5IA 4DOVA 4CI0C 1NYQA 1H4SA 4JRQA 4EMGA 3L4GB 2E3CA 3HFOA 3FEOA 3S3OA 1VQOT 3CMEA 1PYSA 1Y96A 3A31A 4RQEA 4LDVA 1Z7MA 4M7DE 2L8DA 1E24A 4MZMA 3M4YA 3OYHA 1NYRA 5LJ3f 2QQBA 3CBPA 2EAYA 3OMGA 2ZR3A 3FRNA 3MCAB 4C5EA 4AH6A 2RJFA 3DKMA 5A0DA 2M1HA 3L2ZA 4M75C 3VUZA 2ZGWA 1NJ5A 5CKDA 5GAMe 3META 3X24B 5FLXE 4NL3A 4M7AB 4BACA 3MEYA 4RCCA 1WJRA 1S72A 1U8RA 5KCOA 4A4GA 2JTFA 2RHSA 3A5ZB 1HTTA 2HNIA 3CCLT 2CJ9A 4YCWA 3GNFB 3A74A 3N5BB 3CCVA 5LJ5g 3OYAA 3G1ZA 1G5IA 3IG2A 4J7IA 1VQMT 3CCVT 2EJFA 1YI2T 2LT1A 2E10A 4EX5A 4N4IA 2VXEA 3X26B 2DQ0A 2ZINA 3DB4A 5GAMf 3J81E 4YRJA 3LGLA 3HSBA 4PJOE 3OYYA 1JJ2A 1DJ7B 1U1TA 1UB4A 3W3SA 1KMMA 1EVKA 1NZ9A 2DVEA 1VQNA 5D6YA 2PQWA 2EIFA 3P8DA 2Q7HA 5I21A 4TVAA 3PNWC 3LC0A 4YTLA 4MMKA 1VQ9T 3JB9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VBB A;  1U1S A;  3JCM g;  2FB7 A;  1KMN A;  5K1X A;  1NJ8 A;  4M78 C;  4PHC A;  3HXX A;  4M75 D;  2DU5 A;  4P75 C;  3JCM c;  3GIB A;  2J3L A;  3VU3 C;  3RF1 A;  3RL6 A;  3L4G A;  4UP9 A;  5E3I A;  5ELO A;  3LSS A;  3NEL A;  3A5Y A;  4DQ2 A;  3A7U A;  2Q5I A;  4CH4 A;  4OP0 A;  4M78 F;  1B76 A;  4XTU A;  2ARU A;  4YCV A;  4XTW A;  4A54 A;  2E65 A;  3HXZ A;  2Y90 A;  1BBU A;  2RB6 A;  4G84 A;  3E9H A;  1BIA A;  3L1A A;  3UH0 A;  4J5Y A;  3NEM A;  1M5Q 1;  1JJC B;  3RKY A;  4LNS A;  2ZT8 A;  4EMH A;  2AMC B;  2Q7E A;  1NJ2 A;  3FJP A;  4P3N A;  4M75 A;  4NOY A;  4F7U B;  4RMF A;  5C51 B;  1B8A A;  4TQD A;  2E5A A;  2PMF A;  4NL2 A;  4M7A F;  5LJ3 h;  4P71 A;  2ZT7 A;  5GAM d;  1SRY A;  2G4C A;  4YRN A;  4WF2 A;  5GAN d;  1VQZ A;  2IY5 B;  5GAM j;  1WU7 A;  1X56 A;  4TVY A;  2YLC A;  2RHQ B;  4K87 A;  3MF2 A;  3RAC A;  4X9C A;  3HXV A;  5GAO m;  4L87 A;  4C92 B;  4KR2 A;  1WQ7 A;  1YFS A;  3PCO A;  4N0A C;  4PJO G;  5GAN h;  3V8J A;  4JUV A;  4N0A A;  4XTV A;  1WLE A;  3JCM P;  3RKX A;  1YFR A;  3IKM B;  4HT8 A;  1E1T A;  2J3M A;  4J6Y A;  4C8Q D;  4M77 C;  4HWP A;  4NCX A;  1B34 A;  4C8Q E;  3QHS A;  1X01 A;  4YRC A;  1N9R A;  3BY7 A;  2QHV A;  1LNX A;  5GAO l;  4KR3 A;  2CJA A;  1I81 A;  1ATI A;  3QNE A;  1LOJ A;  5GAN j;  4YRM A;  2Q5H A;  1YCY A;  2QHS A;  2ZTG A;  1YGB A;  3HTZ A;  1I5L A;  3WQZ A;  3PGG A;  4EMK A;  1QE0 A;  2AKW B;  3HFV A;  2PME A;  1JBM A;  1I8F A;  2C7I A;  4EMK B;  4KQE A;  4UP7 A;  1H4Q A;  1ASY A;  4C8Q A;  5GAN 6;  5CAI A;  3M4P A;  1JJC A;  3QO8 A;  4C92 F;  1SES A;  1WNL A;  1W66 A;  4J6W A;  4YDQ A;  4C92 A;  3JB9 I;  4M75 F;  3DSQ A;  4CH6 A;  2IY5 A;  1HK9 A;  4YRI A;  4M77 A;  5GAO q;  2ODR D;  3PZC A;  1H4T A;  1KQ1 A;  2ODR C;  1SER A;  1KOG A;  3SWN B;  4XTY A;  1WYD A;  3REX A;  4EMK C;  3HRI A;  4K86 A;  3RES A;  3CMQ A;  3HFZ A;  3V8K A;  4M7A G;  2ZZF A;  4P74 A;  1IL2 A;  5GAN f;  5C53 B;  1ADY A;  4YRS A;  1ASZ A;  3BW1 A;  4M77 B;  3JB9 F;  3RGL A;  4BW9 A;  1USY A;  1EOV A;  1NNH A;  3JCM f;  4XU0 A;  1YB3 A;  4UPA A;  4ZTZ B;  2DZ9 A;  4XEO A;  4M77 D;  4YRE A;  2EL9 A;  3P8Y A;  4HWR A;  3VQX A;  1D3B A;  4CH5 A;  4H2Y A;  3SWN C;  3HXU A;  1TH7 A;  5GAN g;  1KQ2 A;  4XEM A;  4CS4 A;  4G85 A;  2K57 A;  2DKG A;  1L0W A;  1N9S A;  2FYK A;  1FYF A;  5GAN e;  5GMK e;  1G51 A;  4YRO A;  5LJ5 j;  3M4Q A;  3QTC A;  4TWA A;  2CJB A;  4H2V A;  3RKW A;  4JRI A;  2I4N A;  5LJ3 j;  4YP0 A;  2QTX A;  4M7D D;  4YRG A;  4OLF A;  3FIF A;  3P8V A;  4M7D F;  4YRL A;  4H2U A;  3TEG A;  4BWA A;  3A7A A;  3HFN A;  4WJ4 A;  2VC8 A;  4M7D G;  2ARS A;  2EJG A;  2XTI A;  3QO3 A;  4C92 D;  3VQY A;  2ZNJ A;  4H2T A;  4M7A E;  2XGT A;  4C92 C;  2DJZ A;  4M77 F;  3IAL A;  4XU2 A;  4HWO A;  4M75 E;  4Q6G A;  3EFS A;  3JCM h;  4CH3 A;  4M77 E;  4X9D A;  1LYL A;  2DZC A;  4M7A C;  1N9W A;  11AS A;  5LJ3 g;  3BFM A;  1WPY A;  2ART A;  3NET A;  5GAN 4;  4TTV A;  12AS A;  1H64 1;  3KFU A;  4PNO A;  3A5Z A;  4XTX A;  3FB9 A;  1EIY A;  2ZIO A;  4C8Q F;  4QVD A;  4HA8 A;  4M7D A;  5GAN 7;  1D3B B;  3JCM J;  3IKL A;  1Y96 B;  4M78 A;  4YRT A;  1EIY B;  4RCB A;  5F5W A;  2JN0 A;  3JB9 D;  1Z7N A;  3V7S A;  5GAN 3;  4RDX A;  2DXT A;  3JB9 G;  2YHT A;  4C8Q C;  3JCM e;  3V8L A;  5GAM h;  4WI1 A;  2DTH A;  4YCU A;  2RM4 A;  4P73 A;  3QUI A;  3ICA A;  4ZIB A;  3E9I A;  3OD1 A;  5LJ3 d;  4UP8 A;  4XQ3 A;  3JCM d;  2I2L A;  1NJ1 A;  2VXF A;  1B70 A;  1E22 A;  4MML A;  2DXU A;  5LJ5 d;  4DPG A;  1SET A;  4M75 B;  4M75 G;  5KNN A;  4TVW A;  4JRK A;  3EFR A;  5ELN A;  4M7D C;  4C92 G;  3TUP A;  4H2X B;  3UGQ A;  2ZZG A;  2ZIM A;  4HWS A;  4EO4 A;  2RHS B;  4P71 C;  2DTI A;  2ALY A;  5GAO n;  1BBW A;  4F7U G;  4P72 C;  3BJU A;  5GMK h;  1PYS B;  1I4K 1;  4YRQ A;  4YRP A;  1LJO A;  1NYQ A;  4J15 A;  5LJ3 e;  3MF1 A;  2QHU A;  2ZT5 A;  4ZTU B;  4PJO A;  1QF6 A;  1USY C;  3HFZ B;  1NJ6 A;  1H4S A;  4EMG A;  3L4G B;  1WQW A;  4H2X A;  3BDU A;  2E3C A;  3HFO A;  5GMK j;  5HGQ A;  4X5O A;  3M4G A;  3QO5 A;  1PYS A;  4J6X A;  1Y96 A;  4M78 B;  4M78 D;  2P0L A;  3A31 A;  3HXY A;  5LJ5 h;  4RQE A;  3JCM b;  3RUX A;  1Z7M A;  4M7D E;  3QSU A;  4JLI A;  1E24 A;  3SB2 A;  3HRK A;  1MGQ A;  4P75 A;  5GAN 2;  2RD1 A;  2YLB A;  4P72 A;  4A53 A;  3REU A;  2AMC A;  1NYR A;  5LJ3 f;  2DDZ A;  2AKW A;  2ZCE A;  2EAY A;  4PJO F;  2ZR3 A;  4C92 E;  3UGT A;  1EVL A;  1B7Y A;  1GGM A;  4P3P A;  1E1O A;  1J5W A;  3VQV A;  4AH6 A;  5K1P A;  3AHU A;  3A32 A;  3TEH B;  4E51 A;  3L2Z A;  4F7U E;  4M75 C;  2ZGW A;  4C8Q B;  2QHT A;  4Y91 A;  2CIM A;  4H2W A;  3I7F A;  3TEH A;  4YPF A;  1NJ5 A;  2EWN A;  5GAM e;  2DU7 A;  3R07 A;  4PJO B;  4O2D A;  4YRF A;  4NL3 A;  1M8V A;  4PG3 A;  2ALY B;  5DY9 A;  3HXW A;  1X2G A;  4M7A B;  3HY1 A;  2P5I A;  2ZT6 A;  4RCC A;  3MEY A;  3PCO B;  4YRR A;  1X2H A;  4RQF A;  4F7U F;  5GMK m;  3VQW A;  4H2S A;  2ZXF A;  5GMK i;  4Q15 A;  4HWT A;  4PJO D;  2RHS A;  2EJ9 A;  4CS3 A;  1HTT A;  2HNI A;  2CJ9 A;  4YCW A;  2C8M A;  2DQ3 A;  2Q7G A;  2E41 A;  5GAN 8;  1EFW A;  4M7D B;  4P3O A;  1YFT A;  2I4M A;  3A74 A;  3JB9 J;  4M78 G;  4QVC A;  5C52 B;  4M7A A;  5LJ5 g;  5GAM g;  5LJ5 e;  2I4O A;  3HY0 A;  4CS2 A;  3V7R A;  5GAN 5;  1G5I A;  3G1Z A;  3IG2 A;  3JCM X;  5GAO p;  3JCM W;  2ZNI A;  1ADJ A;  4XTZ A;  2ZZE A;  3RER A;  4XU3 A;  1X54 A;  2EJF A;  2E10 A;  4EX5 A;  4YYE A;  3JCM V;  2VXE A;  3A7R A;  2DQ0 A;  3ERR A;  2ZIN A;  3QO7 A;  5GAM f;  1X55 A;  5LJ5 f;  4V2S A;  3NEN A;  4K88 A;  4YRJ A;  1B7Y B;  4HVC A;  3HSB A;  4PJO E;  3RIR A;  2I4L A;  1BIB A;  5GAO r;  1U1T A;  2E64 A;  2CGH A;  4P74 C;  4TVA B;  4H02 A;  3W3S A;  1JRI A;  4P73 C;  4M7A D;  3JCM Q;  1KMM A;  3UFG A;  4C8Q G;  1C0A A;  2E1H A;  4YRK A;  4WJ3 M;  3P8T A;  1EVK A;  1B70 B;  4HT9 A;  2DVE A;  4XU1 A;  4PJO C;  4TQF A;  4F7U A;  2Q7H A;  2DTO A;  2ZR2 A;  4M78 E;  1HXD A;  1RIQ A;  4M77 G;  5I21 A;  4TVA A;  2RHQ A;  3LC0 A;  2DEQ A;  3INZ A;  1H4V B;  1B34 B;  1HC7 A;  1G5H A;  2RA2 A;  5GMK l;  3SWN A;  4MMK A;  3V7C A;  3JB9 H;  1EQR A;  3LSQ A; 
#chains in the Genus database with same CATH topology
 3VBB A;  3QJ6 A;  1WDX A;  2YWW A;  2RHU A;  2DVJ A;  4UC4 A;  3CC4 T;  5HY6 A;  4P75 C;  3GIB A;  2J3L A;  1E6H A;  3RL6 A;  3L4G A;  2QQS A;  4E7S A;  5E3I A;  3JAM E;  3G6E T;  2JJ9 A;  1UGV A;  3A5Y A;  4JDS A;  2DL3 A;  5HK0 A;  1IO6 A;  5KYW A;  4CH4 A;  4M78 F;  2CZ1 B;  4XTU A;  3ZBD A;  2ARU A;  4HVW A;  3SFM A;  3QKJ A;  2Y90 A;  2RJC A;  1BIA A;  3L1A A;  4Z8A A;  4J5Y A;  1S1N A;  2HD0 A;  1EX4 A;  1GBR A;  2ZT8 A;  4EMH A;  1NPR A;  1NJ2 A;  2VGM A;  1N8R U;  4P3N A;  4IIO A;  4XK8 E;  1X27 A;  1K1Z A;  2RMO A;  4BE1 A;  4PJN A;  4IKF A;  2EKH A;  3LLR A;  4NL2 A;  4HVU A;  5HCK A;  2EYX A;  5LJ3 h;  2NUP B;  2ZT7 A;  2BZY A;  4JS4 A;  1NBE B;  1WYX A;  1TXQ A;  2CSQ A;  2XDB A;  3CCV Q;  2KDS A;  3CCS A;  5GAM j;  1WU7 A;  2V1Q A;  1NYF A;  1RI9 A;  3CQT A;  3RAC A;  1QP2 A;  2YUN A;  1SPK A;  3L2R A;  3CCR A;  4IUV A;  4PJO G;  1VA7 A;  2L0A A;  1KQS A;  3PFS A;  2VVK A;  2XIC A;  3LYI A;  1Q82 R;  5KYY A;  1WLE A;  1YFR A;  1KD1 U;  1KG1 A;  1MMD A;  2LZ6 B;  3OS0 A;  4M77 C;  4HWP A;  1B34 A;  1D1C A;  1XOV A;  1N9R A;  4DBF A;  2FO0 A;  3OYM A;  2PU9 B;  1VQ5 A;  2CS7 A;  4R55 A;  4OB2 B;  2CZ7 B;  1W4S A;  2ZTG A;  2J6F A;  1YGB A;  1YWP A;  3MEV A;  1D0Y A;  3EGD B;  3PGG A;  4EMK A;  1QE0 A;  3S3N A;  3HFV A;  3H0F A;  2D9T A;  3CCJ T;  6AT1 B;  2X4Y A;  2JTM A;  5FRO A;  1KD1 R;  4C8Q A;  1AWW A;  1H3Z A;  1YJW A;  1UEB A;  1M1F A;  3FLG A;  3M4P A;  1SES A;  4J6W A;  2KGT A;  1EFN A;  3DSQ A;  3FJ5 A;  1VQN Q;  4YRI A;  1KIK A;  5CO7 A;  4OVA A;  2EYW A;  3A8M B;  3SWN B;  1IGU A;  1WXT A;  3R6O A;  1WYD A;  1QVG S;  4J9I A;  2KMT A;  2DAQ A;  3R6N A;  3CMQ A;  3HFZ A;  3V8K A;  3MPU B;  1Z9Q A;  4M7A G;  4P74 A;  2F69 A;  4YRS A;  2FRW A;  4ZGJ B;  3GPL A;  3JB9 F;  3CXC A;  2IVW A;  1PSF A;  1F1B B;  1EOV A;  1NNH A;  3TVT A;  4CRI A;  1QVF S;  2XD0 A;  1XQH A;  2ED1 A;  2YT6 A;  1C1A A;  2DZ9 A;  2K2M A;  2PVO B;  3CCE Q;  4YRE A;  1UFF A;  3P8Y A;  3VQX A;  2NLU A;  5CKB A;  1TH7 A;  2M0Y A;  5GAN g;  4XEM A;  3CCM A;  4CS4 A;  3OYL A;  2K57 A;  2RK2 A;  4BUG A;  2BTT A;  4YRO A;  2W10 A;  5LJ5 j;  2QGG A;  1PNJ A;  2H8H A;  2K2V A;  3NGP A;  1TOV A;  4ANJ A;  2I4N A;  3URG A;  2C0I A;  5LJ3 j;  4OMQ A;  5GJW B;  4YP0 A;  3A1P A;  4YRG A;  4OLF A;  4JLG A;  4FSS A;  1SEM A;  3VRY A;  4BD3 A;  4YRL A;  1M1K C;  1P92 A;  3MQZ A;  2CKK A;  1VQ6 A;  1NJI C;  5ECA A;  1WX6 A;  3CCM T;  2M9U A;  4M77 F;  3CMA T;  4XU2 A;  1KHI A;  1MV3 A;  1UJY A;  4HWO A;  3VS2 A;  4LDU A;  1LYL A;  2CSI A;  3QZ9 B;  3TSZ A;  3QXE B;  4RTX A;  1OZ3 A;  1NEG A;  5LJ3 g;  2ART A;  3LH5 A;  5GAN 4;  2ZPE B;  3KFU A;  4FT4 A;  2X4W A;  2HKN A;  2COY A;  4QVD A;  5DM7 R;  5I2S A;  1XNI A;  3NTI A;  1EIY B;  4RCB A;  3JB9 D;  4IUU A;  2LT4 A;  1Z7N A;  1JXM A;  2M02 A;  1BI0 A;  1RL2 A;  3PMT A;  1YN8 A;  2JTE A;  2P4T A;  2DEU A;  2LQW A;  4WI1 A;  3OA6 A;  4P73 A;  1VQ6 T;  2SRC A;  3OS1 A;  3ICA A;  3E9I A;  2O31 A;  4UP8 A;  2I2L A;  4BE0 A;  1RAA B;  1BI3 A;  4WCI A;  3OYE A;  4MML A;  3CME T;  3MP1 A;  2LNV A;  3VS6 A;  2KXD A;  2RQU A;  4M75 B;  2F5K A;  5FU7 B;  2CUB A;  4M75 G;  5KNN A;  4A4E A;  1YIJ A;  3EFR A;  5FRM A;  5ELN A;  2VUB A;  4C92 G;  1QP3 A;  2FZG B;  4GBQ A;  2ZZG A;  2ZIM A;  3UGQ A;  4ZNX A;  3JRZ A;  2DTI A;  1QKX A;  2XG8 D;  4PFO A;  3OYG A;  1VQO A;  3AT1 B;  4KUL A;  4YRQ A;  3EG9 A;  4YRP A;  1OQK A;  2VKN A;  3C94 A;  2KXC A;  2ZT5 A;  1QF6 A;  5J26 A;  3L2U A;  2HEQ A;  1USY C;  2KK4 A;  2NUZ A;  4A4K A;  3I55 T;  4H2X A;  2O4X B;  4AG2 C;  1S72 T;  3BDU A;  3H0H A;  2DYI A;  1YJW T;  5GMK j;  2O9V A;  4II1 A;  4LDX A;  3X28 B;  4L5G A;  3M4G A;  3QO5 A;  1YJN T;  1YP5 A;  3S6W A;  1PC0 A;  3MP8 A;  1IHW A;  1SHG A;  4M78 B;  4M78 D;  5LL6 S;  2P0L A;  3HXY A;  5LJ5 h;  5IN1 A;  2LQN A;  4KUD K;  3RUX A;  4E6R A;  1I0C A;  3ME9 A;  5C6S A;  4JJN K;  4JLI A;  3OYN A;  3HRK A;  4P72 A;  3J7A F;  2AMC A;  2K5F A;  1CKA A;  2ZCE A;  3VS7 A;  4C92 E;  4JS5 A;  2DET A;  1B7Y A;  4P3P A;  1ZUU A;  2FPE A;  1E1O A;  4D8K A;  3VQV A;  2MK5 A;  1QKW A;  4E7J A;  3QG1 A;  3A32 A;  2M0O A;  3I55 A;  3KBG A;  4E51 A;  4F7U E;  4DEX A;  1YIT T;  2COW A;  1OOT A;  3E1S A;  1WHK A;  2X51 A;  1AOJ A;  4Y91 A;  2CIM A;  3UAT A;  1JB0 E;  1UGS B;  2EQK A;  2EWN A;  2DU7 A;  4J9D A;  3R07 A;  3DLM A;  3E9F A;  1M8V A;  5FU6 C;  2ALY B;  5IXF A;  3M59 A;  3EAE A;  2EVR A;  2P5I A;  3CC7 T;  4RTY A;  3I5R A;  2CRE A;  1V1C A;  2H3J A;  1PD1 A;  4J83 A;  2V1R A;  4H2S A;  3LWH A;  1QW1 A;  5CQY A;  5GMK i;  4MZT A;  4Q15 A;  1QVG P;  2IIM A;  1H8K A;  2C8M A;  2EGE A;  2DQ3 A;  2Q7G A;  2E41 A;  5GAN 8;  1G5V A;  2KRN A;  4M7D B;  4FW1 A;  1KQS P;  1YFT A;  1N6A A;  3JB9 J;  1M90 U;  4PFP A;  3M5A A;  4QVC A;  2XID A;  3OBY A;  4Y92 A;  2EQU A;  1SSH A;  3OYD A;  4CS2 A;  2QEX Q;  1MMG A;  1UDL A;  5GAN 5;  1WXB A;  4ZN1 A;  1PRM C;  2HAX A;  1WHG A;  5AYF A;  1X54 A;  2DFU A;  1VQM Q;  3JCM V;  3A7R A;  1OPL A;  4RTV A;  3CCJ A;  2EKO A;  3X25 B;  1X55 A;  5LJ5 f;  4V2S A;  3P8B B;  4LVM A;  3NEN A;  4O6J A;  3OQ5 A;  4K88 A;  1W1F A;  2E5K A;  2HQE A;  4C5G A;  4D8D A;  1YJ9 A;  2NWM A;  2E64 A;  4FYV B;  3EHR A;  1JRI A;  3RR6 A;  4ESR A;  3JCM Q;  4C8Q G;  1YJN Q;  3VS1 A;  1V76 A;  2QQA A;  4YRK A;  4WJ3 M;  1D1A A;  1TUG B;  3F70 A;  4HCB A;  4PJO C;  3CMA A;  1VQ8 T;  2LQK A;  1K8A U;  2DER A;  1NEB A;  2ZR2 A;  1QMC A;  3EG0 A;  1HXD A;  2QA4 A;  2ZPG B;  4DBR A;  4E7Z A;  2RF0 A;  4EDU A;  2HCK A;  1BBZ A;  1ZSZ B;  5IAY A;  5D7U A;  1H4V B;  3VS4 A;  3PE0 A;  1VQK T;  3CC2 Q;  1Q81 U;  4JJC A;  5GMK l;  1VUB A;  4FYY B;  2Y4Y A;  1UHF A;  3O5Z A;  3LSQ A;  2X4J A;  1M3C A;  3MKD A;  1NJ8 A;  4M78 C;  3HXX A;  3EGU A;  5CVI A;  2DU5 A;  3RF1 A;  2ABL A;  1VQ9 A;  5A0G A;  2O4X A;  2L3Q A;  4K11 A;  2O9S A;  3LSS A;  5KE2 A;  2A3L A;  4DQ2 A;  1CKB A;  4BI4 A;  3A7U A;  2Q5I A;  1T3L A;  2MI6 A;  1B76 A;  3TQ7 P;  5IHK A;  3HRU A;  2GQV A;  3GNG A;  1BCO A;  2K6D A;  3UH0 A;  3NEM A;  1M5Q 1;  1VYV A;  3M56 A;  3RKY A;  1X2K A;  4MZP A;  1NJI U;  2AMC B;  3I5S A;  2YUQ A;  2CP3 A;  1K9M U;  2FPF A;  4NOY A;  1UGQ B;  3C12 A;  1QLY A;  2KT8 A;  5C51 B;  1B8A A;  4TQD A;  2PMF A;  3QPH A;  3UDC A;  3VV0 A;  1NG2 A;  3EFO B;  2GGR A;  1G2B A;  1K73 U;  2G4C A;  1SRY A;  3RNJ A;  1VYU A;  1E6G A;  1OX9 A;  3OS2 A;  2R58 A;  3CCM Q;  2LCS A;  2EYQ A;  2LTO A;  2XU8 A;  3ZFJ A;  3OMC A;  3MF2 A;  4X9C A;  2QEX T;  2LJ1 A;  4J9C A;  5GAO m;  3CD6 T;  3SDZ A;  3HXV A;  2FG0 A;  4L87 A;  3A98 A;  4KR2 A;  1YFS A;  2RQR A;  3PCO A;  3RMS A;  2P0Q A;  3M58 A;  5FWB A;  3WVD B;  4FM4 B;  2J6O A;  2F2X A;  1XTD A;  4FCY A;  4C8Q E;  1X01 A;  3OW2 P;  5CKF A;  1LNX A;  3G7Z A;  1PM3 A;  2GFA A;  1ATI A;  3QNE A;  4JZ4 A;  2HL5 C;  2OAU A;  3M0S A;  1VIF A;  4YRM A;  3JSC A;  4R0K A;  2J6K A;  4HCC A;  3M9Q A;  3WQZ A;  2OTJ T;  2ATC B;  1YIT A;  4BY6 B;  3X20 B;  1B07 A;  2J06 A;  2PVG B;  1VQL Q;  3EHQ A;  2E6N A;  4E7K A;  4UP7 A;  1NM7 A;  1ASY A;  3CCR T;  3I9Q A;  4LD9 K;  1YNZ A;  1SKU B;  1IXD A;  5J39 A;  2LC4 A;  1JJC A;  3QO8 A;  4C92 F;  1W66 A;  2AIR B;  1KFZ A;  5FU7 C;  2LP5 A;  4C92 A;  3JB9 I;  1B7T A;  2QDY B;  4M75 F;  4BDZ A;  2X35 A;  1N27 A;  5GAO q;  3O8V A;  2XI9 A;  1ZLM A;  3TSW A;  1FMW A;  3NTK A;  1RI0 A;  2ODR C;  1KC8 R;  2E3H A;  2IG0 A;  1FWZ A;  1KHC A;  3PIO A;  1BCM A;  2X4X A;  2O2O A;  2QA4 T;  1MUZ A;  4DBH A;  5KYX A;  4K86 A;  4LUE A;  1M4Z A;  1FX7 A;  2FEI A;  4KUI A;  2PUO B;  1QCF A;  1ADY A;  1JQQ A;  4Y28 E;  4R56 A;  5KH6 A;  2ED0 A;  5DLO A;  4J9B A;  1MHN A;  2F1L A;  2DIG A;  2DX1 A;  2QI2 A;  3JCM f;  3CCR Q;  5HK3 A;  2VAS A;  2RQT A;  4ZTZ B;  3CCE T;  3VYG A;  4H2Y A;  1Q81 R;  2DYB A;  2QYZ A;  2RJE A;  4G85 A;  4J9F A;  1IZ6 A;  1L0W A;  4RMO A;  1FYF A;  3GP8 A;  2ECZ A;  1BI1 A;  5GMK e;  2O88 A;  1C6V X;  1QVF A;  2DMO A;  3VYH B;  3L2W A;  3M4Q A;  1QQJ A;  1R77 A;  1SHF A;  4TVR A;  3QTC A;  4TWA A;  4PJM A;  4H2V A;  1I1J A;  1BK2 A;  5I2M A;  2MIO A;  1WIE A;  3FIF A;  3VS0 A;  4CC7 A;  3TEG A;  4BWA A;  2DNU A;  3HFN A;  4QQ6 A;  3VRZ A;  2NUT B;  2EJG A;  3QO3 A;  4C92 D;  2AKL A;  3VQY A;  2ZNJ A;  2RHI A;  4OB3 B;  1M2V B;  1M90 C;  4H2T A;  4KH1 B;  2RO0 A;  3SD4 A;  2DJZ A;  4BY6 C;  3IAL A;  4M75 E;  1IRE B;  1Y57 A;  4J7F A;  11AS A;  2LJ0 A;  1Q7Y U;  2XK0 A;  1GCQ C;  3Q1J A;  1W2B A;  5IT9 E;  3M54 A;  4TTV A;  3A5Z A;  3EG1 A;  3UA6 A;  2ZIO A;  1G3S A;  3JCM J;  3IKL A;  2Y4X A;  4AMC A;  1VQO Q;  1Y07 A;  3CMA Q;  2MAM A;  2WSE E;  5F5W A;  1M1K R;  2DRK A;  3V7S A;  4BI8 B;  2J7I A;  2WAC A;  3JB9 G;  2YHT A;  4C8Q C;  4YCU A;  4FYX B;  3CC2 A;  1TG0 A;  3M0Q A;  4AFS C;  2OX7 A;  2EBP A;  1K76 A;  3JCM d;  3T9N A;  2E6Z A;  4KH0 B;  4F16 A;  1LPL A;  2A7Y A;  3EH1 A;  3CBO A;  1SET A;  2BUD A;  1BYM A;  3OYK A;  4M4Z A;  2Z0W A;  1Q81 C;  4TVW A;  4JRK A;  4LNP A;  2XMF A;  3TUP A;  2F5T X;  3OB9 A;  4HWS A;  2QA4 Q;  2KVQ G;  3LGF A;  2NUT A;  5I11 A;  1Q86 U;  1BBW A;  5FU6 B;  1ABO A;  4F7U G;  4ORZ A;  2EQJ A;  2K9G A;  1PYS B;  1M1G A;  1I4K 1;  1Q82 U;  1LJO A;  3LW5 E;  1UE9 A;  4C5H A;  4J15 A;  5LJ3 e;  3MF1 A;  2GTJ A;  2QHU A;  4DEY A;  3HFZ B;  2LJ3 A;  1ACM B;  2QK0 A;  4IIM A;  2GFU A;  1ZSZ C;  2RJD A;  3REB B;  1WQW A;  4GY5 A;  1M3B A;  3DLL A;  1YI2 Q;  1KC8 C;  4X5O A;  3CD6 A;  2RH2 A;  5EC7 A;  2KYB A;  3CCJ Q;  3JCM b;  3H9N A;  1HD3 A;  3CCS Q;  3M57 A;  3M53 A;  1UTI A;  3QSU A;  3SB2 A;  1MGQ A;  1PD0 A;  3I55 Q;  2YLB A;  4P75 A;  4A53 A;  2JNG A;  2AKW A;  1OPK A;  4IUT A;  4PJO F;  2HKQ B;  3UGT A;  1EVL A;  3LH0 A;  1GGM A;  4PKC C;  1JJ2 P;  1J5W A;  5IXB A;  2HMA A;  3CCU T;  2JXB A;  4OF1 A;  2ZPI B;  1VQ7 T;  2ROT A;  3TEH B;  1K9A A;  2EYZ A;  3OSV A;  2AHJ B;  2D8J A;  4AFQ C;  3ZEH A;  4B6M A;  3VUB A;  3S3M A;  1RAE B;  3HTR A;  3BDL A;  2QHT A;  2D8H A;  4X34 A;  4H2W A;  3TEH A;  3EG9 B;  1HJD A;  4OML A;  2A0F B;  4ATO A;  2M16 A;  2K3X A;  1M9S A;  4PJO B;  4O2D A;  3PT9 A;  5A2Q E;  1KD1 C;  4PG3 A;  2KAF A;  5DY9 A;  3HXW A;  3HY1 A;  1Y71 A;  1OEB A;  1WXU A;  5KE3 A;  1X2H A;  2FVU A;  4F7U F;  1VQ6 Q;  5GMK m;  3MJX A;  3VQW A;  2DXB A;  2ZXF A;  2LCC A;  1V29 B;  1YIT Q;  2ZAE A;  4HKE A;  4J8O A;  2JM9 A;  2EJ9 A;  4PJJ A;  1W2B S;  3EGX A;  4CS3 A;  2JW4 A;  3L2Q A;  1NYG A;  1EFW A;  2ENM A;  2QXF A;  5CCA A;  4P3O A;  4WTO B;  2MF2 A;  2MWP A;  5FRN A;  2I4M A;  3EGX B;  4M78 G;  5C52 B;  4M7A A;  1YBY A;  2I4O A;  3V7R A;  1GCQ A;  3OW2 A;  3JCM W;  2ZNI A;  3G4S T;  2ZZE A;  2HBP A;  2L5Q A;  2DM1 A;  4XU3 A;  2DL8 A;  4A4H A;  2BZ8 A;  1SG5 A;  4F17 A;  1WJQ A;  2DXC A;  1X75 C;  4YYE A;  3EG3 A;  2L89 A;  2OTJ Q;  1M27 C;  1ZBJ A;  3QWY A;  2PUK B;  3JV3 A;  3SHW A;  4FT2 A;  5GAO r;  1PKT A;  5J3B A;  2CGH A;  4P74 C;  4NS5 A;  2CP5 A;  2MCN A;  1LCK A;  4QT7 A;  3CXC P;  1R0C B;  4BDY A;  1C0A A;  2FZK B;  2E1H A;  5A0L A;  3CCE A;  2CP7 A;  3NHN A;  4XU1 A;  3QDF A;  4TQF A;  4F7U A;  1T3S A;  2X3X D;  4M78 E;  1YIJ T;  2OI3 A;  3GBQ A;  1RIQ A;  1ZBX A;  1VQL A;  2DEQ A;  3INZ A;  1B34 B;  1WHL A;  4DOW A;  1WGS A;  1HC7 A;  1G5H A;  1T0J A;  3SWN A;  1MMN A;  2RM4 A;  1EQR A;  3JCM g;  2FB7 A;  1WA7 A;  1N8R R;  3P8H A;  1VYT A;  4M75 D;  2YRC A;  2EFI A;  1G83 A;  2MPX C;  2QQ9 A;  3VU3 C;  4X1V A;  3NEL A;  1PSE A;  5IHN A;  3OSS C;  5C0M A;  4YCV A;  4KBM B;  4XTW A;  4A54 A;  2NUP A;  3UF4 A;  1M1K U;  1BBU A;  3PIP A;  3UWN A;  3E9H A;  2BE7 D;  3IQL A;  2CZ6 B;  2XDP A;  1JJC B;  1GL5 A;  4LNS A;  1QVF P;  2Q7E A;  3A8G B;  1JXO A;  1ZUK A;  3FJP A;  2RI5 A;  3PMI A;  2E12 A;  1UUE A;  2QAS A;  3CC7 Q;  4PL6 A;  3QII A;  1JJ2 S;  1Z9Z A;  1HSQ A;  5GAM d;  2R5M A;  4FW2 A;  3J80 E;  4YRN A;  2E5Q A;  5GAN d;  2IY5 B;  1M3A A;  4E7I A;  4RG2 A;  2E70 A;  1VQN T;  2B86 A;  3OYI A;  1X56 A;  4TVY A;  2FL7 A;  3MEW A;  2A08 A;  2DK3 A;  1TU0 B;  4OB0 B;  1WQ7 A;  1VQ7 A;  2P4R A;  3A8L B;  4AFU C;  3GOX A;  5GAN h;  3V8J A;  4JUV A;  3CC4 Q;  3JCM P;  1E1T A;  1AD5 A;  3CCL Q;  4KRT A;  4J9E A;  4NCX A;  3M55 A;  2PZ1 A;  3QHS A;  4YRC A;  2KY9 A;  1K8A C;  1K4U S;  2KRS A;  4KGV B;  2QHV A;  4FIB A;  1RAF B;  2FPD A;  1WHH A;  1WHM A;  2RHX A;  2I0N A;  5KYW B;  1LOJ A;  1RAC B;  1ABQ A;  2Q5H A;  3HPW A;  2NYS A;  4LXC A;  2G6F X;  2HL3 A;  3OY9 A;  3HTZ A;  1I5L A;  4JPB W;  2XKO C;  2AKW B;  1KK7 A;  1JBM A;  3EFO A;  2QDL A;  4KGZ B;  3BE3 A;  1Q86 C;  3WXM B;  3DB3 A;  3QYH B;  2HQX A;  4Z02 A;  2CT3 A;  4RTU A;  3MP6 A;  5CAI A;  2VV5 A;  2KSS A;  5CIU A;  2K79 A;  2YXY A;  2LX9 A;  4GLK A;  3VS3 A;  2DE0 X;  1E7O A;  1O75 A;  4N4H A;  4PLI A;  4OGE A;  2AZV A;  4CH6 A;  1LVK A;  2IY5 A;  1W70 A;  4M77 A;  4EPC A;  1VQM A;  1JEG A;  2YUO A;  1GFC A;  2OTL T;  2DA9 A;  2L3S A;  1SER A;  3HL8 A;  1KOG A;  4XTY A;  2FHD A;  1Y0M A;  1NPP A;  1GXI E;  2DL5 A;  5CKE A;  3RES A;  2ZZF A;  1IL2 A;  3M0U A;  5GAN f;  5C53 B;  2QAZ A;  2F2W A;  5KYX B;  3L2V A;  2DBK A;  1R0B G;  1G3W A;  2O01 E;  1USY A;  2OJ2 A;  4E7H A;  1U06 A;  4XU0 A;  4VUB A;  1YB3 A;  2ZPH B;  4XEO A;  2P0K A;  2DL7 A;  4HWR A;  2XHC A;  3CCQ Q;  1D3B A;  1BB9 A;  1TS9 A;  1M8M A;  3WVE B;  4CC4 B;  1TWB A;  1D0X A;  2V8I A;  1KQ2 A;  2DPP B;  2JT4 A;  2GF7 A;  3CD6 Q;  1AWJ A;  1EZZ B;  4LDY A;  1YI2 A;  2YUP A;  5KCH A;  1VQ4 T;  1K73 R;  1MMA A;  2DF6 A;  4ELY C;  4JRI A;  2HDA A;  3FDR A;  4MDX A;  1RAD B;  1TTH B;  2LMJ A;  1GCP A;  1JO8 A;  3CPW P;  4M7D F;  3P8V A;  1ARK A;  3G4S A;  3QBY A;  2RK1 A;  2VC8 A;  2XTI A;  3EG2 A;  3HKS A;  1S72 Q;  1RAG B;  3I35 A;  1ZQ1 A;  1N8R C;  2XGT A;  1M2O A;  2IPO B;  1PKS A;  3EFS A;  3JCM h;  2LCL A;  3G71 A;  4CH3 A;  4M77 E;  4X9D A;  4FYW B;  3TEE A;  8AT1 B;  1G8X A;  3BFM A;  1WPY A;  1GFD A;  2HSE B;  1B3Q A;  3NET A;  1OYX A;  12AS A;  3OYF A;  3QDR B;  2KI7 A;  2F2V A;  1VQL T;  1EIY A;  4C8Q F;  3TU4 K;  4HA8 A;  3CBM A;  4M7D A;  1D3B B;  1QCO A;  2KQW A;  3E19 A;  3C4S A;  1N5Z A;  3QZ5 B;  4M78 A;  1YHQ T;  1X2Q A;  2CH4 W;  3CCQ T;  4A4F A;  1OZ2 A;  1GBQ A;  3TRE A;  5CQX A;  1HYO A;  3THK A;  2DXT A;  3VKI A;  3V8L A;  1CSK A;  5GAM h;  2OTJ A;  1UGR B;  3H8Z A;  1TUD A;  5D6W A;  1EIF A;  2LX7 A;  1G3Y A;  1RAB B;  2CZ0 B;  2VXF A;  1QWF A;  1B70 A;  1E22 A;  2DBM A;  3HP9 A;  2JZ2 A;  4DPG A;  1IB8 A;  3MO8 A;  2EYY A;  1VQ8 Q;  1J3T A;  1VQ4 A;  2K5I A;  2MWO A;  4OMF B;  1Q86 R;  2AKK A;  4EO4 A;  2RHS B;  1QCN A;  1QVP A;  3H6Z A;  4P71 C;  2W0Z A;  1PRL C;  2EQI A;  3BJU A;  5GMK h;  4EIK A;  1R8O B;  3NPF A;  1OU9 A;  3G1J A;  2VB6 A;  4LVK A;  4ZTU B;  4DA4 A;  4PJO A;  1Y7X A;  1NJ6 A;  2FRY A;  3UPU A;  1ZA2 B;  4E2F B;  1D1B A;  2CH4 A;  2ZPB B;  2MYS A;  5HGQ A;  1RLQ C;  1SRM A;  3NTH A;  1MNE A;  3TCJ A;  4J6X A;  2YRD A;  3ULR B;  2PNI A;  2E3I A;  1K9M C;  1QWE A;  1I5O B;  2QQR A;  4C0Z A;  2JOY A;  5GAN 2;  2RD1 A;  1YFN A;  3REU A;  4OMN A;  2DDZ A;  4OB1 B;  4L59 A;  4OMO A;  4AT1 B;  3C95 A;  2HBW A;  2DO3 A;  5K1P A;  3CCL A;  3OYJ A;  3AHU A;  3MEU A;  4IUR A;  1Q95 G;  5L23 A;  4QQD A;  3REA B;  4C8Q B;  1GRI A;  2VYT A;  2MMP A;  3I7F A;  1X43 A;  2RQV A;  4YPF A;  2RPN A;  4LD6 A;  4YRF A;  1G3T A;  4LE9 A;  1WI7 A;  3PTA A;  3CME Q;  1X2G A;  1ZA1 B;  2ZT6 A;  4YRR A;  3PCO B;  4RQF A;  5L8R E;  4CC2 A;  4QVZ A;  1WFW A;  3PVQ A;  4FL6 A;  4JJD A;  3CC4 A;  2AT1 B;  4HWT A;  4PJO D;  1VQP T;  1RAH B;  4PFZ A;  2K7A A;  2DD5 A;  1FXX A;  1MV0 B;  2GBQ A;  4E47 A;  2RNA A;  2DLP A;  3OBW A;  4AFZ C;  4CC3 A;  1K9M R;  2RHY A;  5GAM g;  5LJ5 e;  2JVV A;  2VGN A;  3HY0 A;  5D6X A;  1RUW A;  3LX7 A;  2A8E A;  3JCM X;  5GAO p;  4ZN3 A;  1ADJ A;  4XTZ A;  1FYN A;  3RER A;  2CUD A;  2CP0 A;  1K73 C;  2X3W D;  2B8A A;  1T0H A;  3QO7 A;  3ERR A;  1PG5 B;  4C0F A;  1B7Y B;  4HVC A;  1KC8 U;  1FMV A;  3RIR A;  4HCK A;  2I4L A;  1BIB A;  1SSF A;  4C0D C;  2DIQ A;  2ZPF B;  4TVA B;  4H02 A;  4P73 C;  4M7A D;  1BU1 A;  3UFG A;  5IHI A;  3UT1 A;  2KT1 A;  3P8T A;  1B70 B;  5HKC A;  4HT9 A;  3G71 T;  4BB7 A;  4FSX A;  5DLQ E;  4BI3 A;  2DTO A;  1M30 A;  2WSF E;  4M77 G;  5KYU B;  2NS6 A;  2RHQ A;  2BKD N;  4RKU E;  1WLP B;  1OV3 A;  2RA2 A;  3CC7 A;  2HQH A;  3V7C A;  2K5L A;  3OW2 S;  1U1S A;  1VQK A;  2VWF A;  2R5A A;  4ZTJ A;  1KMN A;  4OGC A;  5K1X A;  4PHC A;  2V8J A;  2G3R A;  3G6E A;  1VQ5 Q;  3JCM c;  3MEA A;  4B9W A;  1BKB A;  4UP9 A;  5ELO A;  2L3R A;  1VQ8 A;  2KR3 A;  1MND A;  2XDD A;  1IRX A;  2DIL A;  1YJN A;  4HT4 A;  4OP0 A;  3G71 Q;  3CPW S;  2QTV A;  1PHT A;  4N4G A;  1AHJ B;  2E65 A;  4KGX B;  3L42 A;  3HXZ A;  2RB6 A;  4G84 A;  4RTZ A;  3ER0 A;  1YHQ A;  2JS0 A;  4M75 A;  3GLX A;  2YDL A;  1ZHI A;  4F7U B;  3LWI A;  2EQM A;  2LQ8 A;  4RMF A;  5IH2 A;  1X6O A;  3SEM A;  2E5A A;  4QW2 A;  3CCS T;  1K0S A;  4PK4 A;  1Q7Y C;  4M7A F;  4P71 A;  1SRL A;  1VQ5 T;  4WF2 A;  1VQP Q;  2BE9 B;  2V8K A;  2QEX A;  3ZL7 C;  1ZSG A;  1VQZ A;  4B9X A;  1AWX A;  2LVM A;  2DL4 A;  4Q5W A;  4ME7 A;  4MDW A;  2YLC A;  4L6V 5;  2RHQ B;  4K87 A;  4HCZ A;  4HVV A;  4C92 B;  2LDM A;  3UA7 A;  1KQS S;  4ZGD B;  2CDT A;  4N0A C;  2V26 A;  2PVD B;  1W2B P;  4N0A A;  4XTV A;  3RKX A;  3U23 A;  3IKM B;  2C06 A;  4HT8 A;  2J3M A;  4J6Y A;  4C8Q D;  4JZ3 A;  4OMP A;  2WSC E;  2KEA A;  3BY7 A;  5GAO l;  3CCU A;  2ESW A;  2AZS A;  1VQ7 Q;  3E9G A;  3NMZ C;  4KR3 A;  2DD4 A;  3A8H B;  2CJA A;  1I81 A;  2JS2 A;  3CXC S;  5GAN j;  1NE8 A;  1YCY A;  7AT1 B;  2QHS A;  1I07 A;  1YJW Q;  4E7L A;  4LVL A;  3QYG B;  4JRP A;  4C0D B;  4LVI A;  2KYM A;  2OTL A;  2PME A;  1IHV A;  4FU6 A;  4D6W A;  1QVG A;  2KRO A;  1I8F A;  2LNH B;  3D7S B;  3M0R A;  2C7I A;  1VIE A;  3EGD A;  4EMK B;  4KQE A;  1H4Q A;  1Q82 C;  2RN8 A;  5GAN 6;  1TUC A;  1WHJ A;  1X6B A;  2JUF A;  4P5N A;  5CK9 A;  2RHZ A;  1UG1 A;  2AK5 A;  2RI3 A;  2FZC B;  3FC3 A;  4C0G A;  1OX8 A;  1WNL A;  4YDQ A;  4ZGE B;  1HK9 A;  3PZC A;  1ZX6 A;  4RTT A;  2ODR D;  3RBB B;  2PTK A;  1H4T A;  2ZZD A;  1KQ1 A;  1PCX A;  3CEY A;  3I56 T;  2K3Y A;  1BI2 A;  1NJI R;  3REX A;  4EMK C;  1O9S A;  1X6G A;  3HRI A;  1K0X A;  1YJ9 Q;  2GNC A;  2GQI A;  5CR2 A;  2K4Y A;  1ASZ A;  3BW1 A;  4M77 B;  3RGL A;  1AZG B;  4BW9 A;  2RI2 A;  5M9O A;  4JJB A;  4ZTF A;  2GTO A;  3CPW A;  2COZ A;  1D09 B;  3OYC A;  4UPA A;  4M77 D;  4J9G A;  2EL9 A;  1AVZ C;  3GF5 A;  2LRQ A;  4BE2 A;  4QQG A;  9ATC B;  4CH5 A;  1KJW A;  2A28 A;  3SWN C;  3HXU A;  2BIV A;  2CYZ B;  1X69 A;  1D0Z A;  5FW9 A;  2DKG A;  1N9S A;  3CCU Q;  2FYK A;  3KUF A;  5GAN e;  3KFV A;  1G51 A;  2QGF B;  5CKH A;  3I56 Q;  2YRV A;  1OI1 A;  1WJS A;  1YIJ Q;  5EG2 A;  2R57 A;  2CJB A;  3RKW A;  1C0M A;  2QTX A;  4M7D D;  2EW3 A;  2P0P A;  4H2U A;  3A7A A;  2CT4 A;  4WJ4 A;  1H3H A;  1RLP C;  4Z89 A;  3I56 A;  2ARS A;  4M7D G;  3H0I A;  2X9H A;  2L3P A;  2GCX A;  4LVJ A;  4M7A E;  1UEC A;  1VQP A;  4C92 C;  1ZUY A;  1PWT A;  4Q6G A;  1YJ9 T;  1M2V A;  2DZC A;  3MHX A;  4M7A C;  1N9W A;  3ASK A;  2JM8 A;  5KYU A;  5AT1 B;  5KYY B;  1H64 1;  3HRS A;  4PNO A;  2M51 A;  2OTL Q;  4XTX A;  3FB9 A;  2DJQ A;  4RG8 A;  4IUQ A;  3VS5 A;  4RTW A;  4PLL A;  5GAN 7;  2KE9 A;  1UGP B;  3OYB A;  1Y96 B;  4YRT A;  2H3E B;  3HHT B;  2JN0 A;  3CPF A;  5GAN 3;  5KYN A;  3OS5 A;  4RDX A;  3NFC A;  3JCM e;  1YWO A;  2C0T A;  2DTH A;  4ELZ C;  2EPD A;  3QUI A;  2ROL A;  4ZIB A;  4DBQ A;  3OD1 A;  4F04 B;  5LJ3 d;  4KT0 E;  2ZCF B;  1Q7Y R;  2P84 A;  4XQ3 A;  3RMQ A;  3CCQ A;  2CP6 A;  4PJL A;  2D6F A;  1NJ1 A;  2JMC A;  1VQK Q;  3CC2 T;  2DXU A;  5LJ5 d;  4LDW A;  3HRT A;  2RQW A;  3VJP A;  4AG1 C;  2DRM A;  4M7D C;  1A0N B;  4H2X B;  2D0Q B;  2JMA A;  1WZO A;  4O5V A;  4J9H A;  4XAX B;  2ALY A;  1YCS B;  4IUP A;  5GAO n;  1JU5 C;  3QJY A;  3KXT A;  4P72 C;  1VOM A;  3A8O B;  4C5I A;  4DOV A;  4CI0 C;  1NYQ A;  5I22 A;  1KSW A;  2SEM A;  1H4S A;  2D0N A;  4JRQ A;  4EMG A;  3L4G B;  2EGC A;  1AZE A;  2E3C A;  3HFO A;  3FEO A;  4LN2 A;  3S3O A;  1VQO T;  3CME A;  1PYS A;  1Y96 A;  3A31 A;  4RQE A;  8ATC B;  4LDV A;  1Z7M A;  2HSP A;  4OMM A;  4M7D E;  3RDV A;  3G4S Q;  2L8D A;  1E24 A;  1VQ4 Q;  2A37 A;  2QG9 B;  1UHC A;  4MZM A;  3M4Y A;  3OYH A;  1NYR A;  5LJ3 f;  2QQB A;  3CBP A;  2EAY A;  3OMG A;  4F14 A;  2ZR3 A;  5GJV B;  3FRN A;  3MCA B;  3G6E Q;  4C5E A;  2HZY A;  4AH6 A;  1IGQ A;  4Z88 A;  2YSQ A;  1VQ9 Q;  2RJF A;  3DKM A;  1SF9 A;  3M0P A;  5A0D A;  2M1H A;  2D1X A;  3L2Z A;  4M75 C;  3VUZ A;  2ZGW A;  3QWX X;  1NJ5 A;  5CKD A;  5GAM e;  3MET A;  1RAI B;  3H41 A;  3X24 B;  5FLX E;  4NL3 A;  1UJ0 A;  4M7A B;  4BAC A;  3PVL A;  4RCC A;  3MEY A;  4LUD A;  1WJR A;  2A36 A;  4QKU A;  1U5S A;  1H92 A;  1S72 A;  2J05 A;  1U8R A;  5KCO A;  4A4G A;  1YHQ Q;  2JTF A;  2RHS A;  3A5Z B;  1HTT A;  2HNI A;  3CCL T;  2CJ9 A;  4YCW A;  1M90 R;  2EGA A;  2L2P A;  1AEY A;  3E2U A;  3GNF B;  3A74 A;  1W6X A;  3N5B B;  5LJ5 g;  3OYA A;  3CCV A;  3G1Z A;  1NLP C;  1G5I A;  3IG2 A;  2BZX A;  4J7I A;  1VQM T;  3CCV T;  2EJF A;  1YI2 T;  2LT1 A;  2E10 A;  4EX5 A;  4N4I A;  3M0T A;  1AT1 B;  2VXE A;  3X26 B;  2DQ0 A;  2ZIN A;  3DB4 A;  5GAM f;  3J81 E;  5FWC A;  4GLM A;  2KBT A;  4YRJ A;  2KRM A;  3LGL A;  3HSB A;  4HXJ A;  3OYY A;  1JJ2 A;  1DJ7 B;  4PJO E;  1U1T A;  1UB4 A;  2C0O A;  3C0C A;  3EH2 A;  3W3S A;  2KNB B;  1TSF A;  1FMK A;  1KMM A;  2K3B A;  1NLO C;  2OAW A;  2MOX A;  1AWO A;  1EVK A;  1NZ9 A;  1U3O A;  2DVE A;  1VQN A;  5D6Y A;  1OU8 A;  4A63 B;  2PQW A;  2EIF A;  3P8D A;  1OUL A;  2Q7H A;  1ZSZ A;  2E4H A;  4RUG A;  5I21 A;  4TVA A;  3PNW C;  1XJW B;  1K8A R;  3LC0 A;  4YTL A;  2CP2 A;  4MMK A;  1VQ9 T;  3JB9 H; 
#chains in the Genus database with same CATH homology
 3VBB A;  3QJ6 A;  2RHU A;  4UC4 A;  3CC4 T;  5HY6 A;  4P75 C;  3GIB A;  2J3L A;  3RL6 A;  3L4G A;  2QQS A;  5E3I A;  3JAM E;  3G6E T;  3A5Y A;  4JDS A;  5HK0 A;  4CH4 A;  4M78 F;  2CZ1 B;  4XTU A;  3ZBD A;  2ARU A;  3SFM A;  3QKJ A;  2Y90 A;  2RJC A;  1BIA A;  3L1A A;  4J5Y A;  2HD0 A;  2ZT8 A;  4EMH A;  1NPR A;  1NJ2 A;  2VGM A;  1N8R U;  4P3N A;  4XK8 E;  4BE1 A;  4IKF A;  3LLR A;  4NL2 A;  5LJ3 h;  2ZT7 A;  4JS4 A;  2XDB A;  2KDS A;  3CCS A;  5GAM j;  1WU7 A;  3RAC A;  1QP2 A;  3L2R A;  3CCR A;  4IUV A;  4PJO G;  1KQS A;  3PFS A;  2XIC A;  1WLE A;  3LYI A;  1YFR A;  1KD1 U;  1KG1 A;  3OS0 A;  4M77 C;  4HWP A;  1B34 A;  1XOV A;  1N9R A;  3OYM A;  2PU9 B;  1VQ5 A;  2CS7 A;  4R55 A;  4OB2 B;  2CZ7 B;  1W4S A;  2ZTG A;  1YGB A;  3MEV A;  3PGG A;  4EMK A;  1QE0 A;  3S3N A;  3HFV A;  2D9T A;  3CCJ T;  2X4Y A;  2JTM A;  5FRO A;  4C8Q A;  1H3Z A;  1YJW A;  1UEB A;  1M1F A;  3FLG A;  3M4P A;  1SES A;  4J6W A;  3DSQ A;  4YRI A;  5CO7 A;  4OVA A;  3A8M B;  3SWN B;  3R6O A;  1WYD A;  1QVG S;  2KMT A;  2DAQ A;  3CMQ A;  3HFZ A;  3V8K A;  4M7A G;  4P74 A;  2F69 A;  4YRS A;  4ZGJ B;  3GPL A;  3JB9 F;  3CXC A;  2IVW A;  1PSF A;  1EOV A;  1NNH A;  4CRI A;  1QVF S;  2XD0 A;  1XQH A;  2DZ9 A;  2PVO B;  4YRE A;  3P8Y A;  3VQX A;  2NLU A;  5CKB A;  4XEM A;  1TH7 A;  5GAN g;  3CCM A;  4CS4 A;  3OYL A;  2K57 A;  2RK2 A;  4BUG A;  4YRO A;  5LJ5 j;  2K2V A;  2I4N A;  3URG A;  5LJ3 j;  4YP0 A;  4YRG A;  4OLF A;  4JLG A;  4BD3 A;  4YRL A;  1M1K C;  1P92 A;  3MQZ A;  2CKK A;  1VQ6 A;  1NJI C;  3CCM T;  2M9U A;  4M77 F;  3CMA T;  4XU2 A;  1KHI A;  4HWO A;  4LDU A;  1LYL A;  3QZ9 B;  3QXE B;  1OZ3 A;  5LJ3 g;  2ART A;  5GAN 4;  2ZPE B;  3KFU A;  4FT4 A;  2X4W A;  4QVD A;  5DM7 R;  5I2S A;  1XNI A;  3NTI A;  1EIY B;  4RCB A;  3JB9 D;  4IUU A;  2LT4 A;  1Z7N A;  1BI0 A;  1RL2 A;  3PMT A;  2P4T A;  4WI1 A;  3OA6 A;  4P73 A;  1VQ6 T;  3OS1 A;  3ICA A;  3E9I A;  4UP8 A;  2I2L A;  4BE0 A;  1BI3 A;  3OYE A;  4MML A;  3CME T;  3MP1 A;  2LNV A;  4M75 B;  2F5K A;  5FU7 B;  4M75 G;  5KNN A;  4A4E A;  1YIJ A;  3EFR A;  5FRM A;  5ELN A;  2VUB A;  4C92 G;  1QP3 A;  3UGQ A;  2ZZG A;  2ZIM A;  3JRZ A;  2DTI A;  2XG8 D;  3OYG A;  1VQO A;  4KUL A;  4YRQ A;  4YRP A;  3C94 A;  2ZT5 A;  1QF6 A;  5J26 A;  3L2U A;  1USY C;  2KK4 A;  4A4K A;  3I55 T;  4H2X A;  2O4X B;  1S72 T;  3BDU A;  1YJW T;  5GMK j;  4II1 A;  4LDX A;  3X28 B;  4L5G A;  3M4G A;  3QO5 A;  1YJN T;  3S6W A;  3MP8 A;  4M78 B;  4M78 D;  5LL6 S;  2P0L A;  3HXY A;  5LJ5 h;  5IN1 A;  4KUD K;  3RUX A;  3ME9 A;  5C6S A;  4JJN K;  4JLI A;  3OYN A;  3HRK A;  4P72 A;  3J7A F;  2AMC A;  2K5F A;  2ZCE A;  4C92 E;  4JS5 A;  1B7Y A;  4P3P A;  1E1O A;  3VQV A;  4E7J A;  3QG1 A;  3A32 A;  2M0O A;  3I55 A;  3KBG A;  4E51 A;  4F7U E;  1YIT T;  3E1S A;  4Y91 A;  2CIM A;  1JB0 E;  1UGS B;  2EQK A;  2EWN A;  2DU7 A;  3R07 A;  3DLM A;  3E9F A;  1M8V A;  5FU6 C;  2ALY B;  3M59 A;  3EAE A;  2P5I A;  3CC7 T;  2H3J A;  4J83 A;  4H2S A;  3LWH A;  1QW1 A;  5CQY A;  5GMK i;  4MZT A;  4Q15 A;  2C8M A;  2DQ3 A;  2Q7G A;  2E41 A;  5GAN 8;  1G5V A;  4M7D B;  1YFT A;  1N6A A;  3JB9 J;  1M90 U;  4QVC A;  3M5A A;  2XID A;  3OBY A;  2EQU A;  3OYD A;  4CS2 A;  5GAN 5;  4ZN1 A;  2HAX A;  5AYF A;  1X54 A;  3JCM V;  3A7R A;  3CCJ A;  2EKO A;  3X25 B;  1X55 A;  5LJ5 f;  4V2S A;  3P8B B;  4LVM A;  3NEN A;  4O6J A;  3OQ5 A;  4K88 A;  2HQE A;  4C5G A;  1YJ9 A;  2E64 A;  1JRI A;  3JCM Q;  4C8Q G;  2QQA A;  4YRK A;  4WJ3 M;  3F70 A;  4HCB A;  4PJO C;  3CMA A;  1VQ8 T;  2LQK A;  1K8A U;  2ZR2 A;  2QA4 A;  1HXD A;  2ZPG B;  4EDU A;  1H4V B;  5IAY A;  1VQK T;  1Q81 U;  5GMK l;  1VUB A;  2Y4Y A;  3LSQ A;  2X4J A;  1NJ8 A;  4M78 C;  3HXX A;  5CVI A;  2DU5 A;  3RF1 A;  1VQ9 A;  5A0G A;  2O4X A;  3LSS A;  5KE2 A;  2A3L A;  4DQ2 A;  4BI4 A;  3A7U A;  2Q5I A;  2MI6 A;  1B76 A;  3HRU A;  2GQV A;  3GNG A;  3UH0 A;  3NEM A;  1M5Q 1;  3M56 A;  3RKY A;  4MZP A;  1NJI U;  2AMC B;  1K9M U;  4NOY A;  1UGQ B;  3C12 A;  5C51 B;  1B8A A;  4TQD A;  2PMF A;  3QPH A;  3UDC A;  3VV0 A;  1K73 U;  2G4C A;  1SRY A;  3OS2 A;  2R58 A;  2EYQ A;  2LTO A;  2XU8 A;  3ZFJ A;  3OMC A;  3MF2 A;  4L87 A;  4X9C A;  2QEX T;  5GAO m;  3CD6 T;  3HXV A;  3SDZ A;  4KR2 A;  1YFS A;  3PCO A;  3RMS A;  2P0Q A;  3M58 A;  3WVD B;  4FM4 B;  1XTD A;  4C8Q E;  1X01 A;  5CKF A;  1LNX A;  3G7Z A;  2GFA A;  1ATI A;  3QNE A;  2OAU A;  1VIF A;  4YRM A;  3JSC A;  4HCC A;  3M9Q A;  3WQZ A;  2OTJ T;  1YIT A;  4BY6 B;  3X20 B;  2PVG B;  2E6N A;  4E7K A;  4UP7 A;  1ASY A;  3CCR T;  4LD9 K;  5J39 A;  2LC4 A;  1JJC A;  3QO8 A;  4C92 F;  1W66 A;  5FU7 C;  4C92 A;  3JB9 I;  2QDY B;  4M75 F;  4BDZ A;  2X35 A;  1N27 A;  5GAO q;  3O8V A;  2XI9 A;  3NTK A;  1RI0 A;  2ODR C;  2IG0 A;  1FWZ A;  1KHC A;  3PIO A;  2X4X A;  2QA4 T;  4K86 A;  1M4Z A;  1FX7 A;  4KUI A;  2PUO B;  1ADY A;  4Y28 E;  4R56 A;  5KH6 A;  5DLO A;  1MHN A;  2DIG A;  2QI2 A;  3JCM f;  5HK3 A;  4ZTZ B;  3CCE T;  3VYG A;  4H2Y A;  2RJE A;  4G85 A;  1IZ6 A;  1L0W A;  4RMO A;  1FYF A;  3GP8 A;  1BI1 A;  5GMK e;  1QVF A;  3VYH B;  3L2W A;  3M4Q A;  4TVR A;  3QTC A;  4TWA A;  4H2V A;  5I2M A;  3FIF A;  3TEG A;  4BWA A;  3HFN A;  4QQ6 A;  2EJG A;  3QO3 A;  4C92 D;  3VQY A;  2ZNJ A;  2RHI A;  4OB3 B;  1M90 C;  4H2T A;  2RO0 A;  3SD4 A;  2DJZ A;  4BY6 C;  3IAL A;  4M75 E;  1IRE B;  4J7F A;  11AS A;  1Q7Y U;  2XK0 A;  3Q1J A;  1W2B A;  5IT9 E;  3M54 A;  4TTV A;  3A5Z A;  2ZIO A;  1G3S A;  3JCM J;  3IKL A;  2Y4X A;  1Y07 A;  2MAM A;  2WSE E;  5F5W A;  3V7S A;  4BI8 B;  2WAC A;  3JB9 G;  2YHT A;  4C8Q C;  4YCU A;  3CC2 A;  3JCM d;  3T9N A;  2E6Z A;  2A7Y A;  3CBO A;  1SET A;  2BUD A;  1BYM A;  3OYK A;  1Q81 C;  4TVW A;  4JRK A;  3TUP A;  2F5T X;  3OB9 A;  4HWS A;  2KVQ G;  3LGF A;  1Q86 U;  1BBW A;  5FU6 B;  4F7U G;  2EQJ A;  1PYS B;  1M1G A;  1I4K 1;  1Q82 U;  1LJO A;  3LW5 E;  4C5H A;  4J15 A;  5LJ3 e;  3MF1 A;  2QHU A;  3HFZ B;  2GFU A;  2RJD A;  1WQW A;  4GY5 A;  3DLL A;  1KC8 C;  4X5O A;  3CD6 A;  2RH2 A;  3JCM b;  3M57 A;  3M53 A;  3QSU A;  3SB2 A;  1MGQ A;  4P75 A;  2YLB A;  4A53 A;  2JNG A;  2AKW A;  4IUT A;  4PJO F;  3UGT A;  1EVL A;  3LH0 A;  1GGM A;  4PKC C;  1J5W A;  3CCU T;  4OF1 A;  2ZPI B;  1VQ7 T;  3TEH B;  3OSV A;  2AHJ B;  3ZEH A;  3VUB A;  3S3M A;  2QHT A;  3BDL A;  4X34 A;  4H2W A;  3TEH A;  4ATO A;  2M16 A;  2K3X A;  1M9S A;  4PJO B;  4O2D A;  3PT9 A;  5A2Q E;  1KD1 C;  4PG3 A;  2KAF A;  5DY9 A;  3HXW A;  3HY1 A;  1Y71 A;  5KE3 A;  1X2H A;  2FVU A;  4F7U F;  5GMK m;  3VQW A;  2DXB A;  2ZXF A;  2LCC A;  1V29 B;  4HKE A;  4J8O A;  2EJ9 A;  1W2B S;  4CS3 A;  3L2Q A;  1EFW A;  5CCA A;  2QXF A;  4P3O A;  2MF2 A;  2MWP A;  5FRN A;  2I4M A;  4M78 G;  5C52 B;  4M7A A;  1YBY A;  2I4O A;  3V7R A;  3OW2 A;  3JCM W;  2ZNI A;  3G4S T;  2ZZE A;  2HBP A;  2L5Q A;  4XU3 A;  4A4H A;  1WJQ A;  2DXC A;  1X75 C;  4YYE A;  2L89 A;  2PUK B;  4FT2 A;  5GAO r;  5J3B A;  2CGH A;  4P74 C;  4NS5 A;  1C0A A;  4BDY A;  2E1H A;  5A0L A;  3CCE A;  4XU1 A;  4TQF A;  4F7U A;  4M78 E;  1YIJ T;  1RIQ A;  1ZBX A;  1VQL A;  2DEQ A;  3INZ A;  1B34 B;  4DOW A;  1WGS A;  1HC7 A;  1G5H A;  3SWN A;  1EQR A;  2RM4 A;  3JCM g;  2FB7 A;  3P8H A;  4M75 D;  2EFI A;  2QQ9 A;  3VU3 C;  3NEL A;  1PSE A;  3OSS C;  5C0M A;  4YCV A;  4KBM B;  4XTW A;  4A54 A;  1M1K U;  1BBU A;  3PIP A;  3UWN A;  3E9H A;  2CZ6 B;  2XDP A;  1JJC B;  4LNS A;  2Q7E A;  3A8G B;  3FJP A;  2RI5 A;  3PMI A;  2E12 A;  4PL6 A;  3QII A;  1JJ2 S;  5GAM d;  2R5M A;  3J80 E;  4YRN A;  2E5Q A;  5GAN d;  2IY5 B;  4E7I A;  4RG2 A;  2E70 A;  1VQN T;  3OYI A;  1X56 A;  4TVY A;  2FL7 A;  3MEW A;  2DK3 A;  4OB0 B;  1WQ7 A;  1VQ7 A;  3A8L B;  3GOX A;  5GAN h;  3V8J A;  4JUV A;  3JCM P;  1E1T A;  4NCX A;  3M55 A;  3QHS A;  4YRC A;  2KY9 A;  1K8A C;  2QHV A;  4FIB A;  2RHX A;  1LOJ A;  2Q5H A;  3HPW A;  3OY9 A;  3HTZ A;  1I5L A;  2XKO C;  2AKW B;  1JBM A;  1Q86 C;  3WXM B;  3DB3 A;  3QYH B;  2HQX A;  4Z02 A;  3MP6 A;  5CAI A;  2VV5 A;  2KSS A;  5CIU A;  2LX9 A;  4GLK A;  1O75 A;  4N4H A;  4PLI A;  4OGE A;  4CH6 A;  2IY5 A;  4M77 A;  4EPC A;  1VQM A;  2OTL T;  1SER A;  3HL8 A;  1KOG A;  4XTY A;  2FHD A;  1NPP A;  1GXI E;  5CKE A;  3RES A;  2ZZF A;  1IL2 A;  5GAN f;  5C53 B;  3L2V A;  1G3W A;  2O01 E;  1USY A;  4E7H A;  4XU0 A;  4VUB A;  1YB3 A;  2ZPH B;  4XEO A;  2P0K A;  4HWR A;  2XHC A;  1D3B A;  3WVE B;  2V8I A;  1KQ2 A;  2DPP B;  2GF7 A;  4LDY A;  1YI2 A;  5KCH A;  1VQ4 T;  4ELY C;  4JRI A;  3FDR A;  4MDX A;  3P8V A;  4M7D F;  3G4S A;  3QBY A;  2RK1 A;  2VC8 A;  2XTI A;  3HKS A;  1ZQ1 A;  2XGT A;  1N8R C;  3EFS A;  3JCM h;  2LCL A;  3G71 A;  4CH3 A;  4M77 E;  4X9D A;  3TEE A;  3BFM A;  1WPY A;  3NET A;  1OYX A;  12AS A;  3OYF A;  3QDR B;  1VQL T;  1EIY A;  4C8Q F;  3TU4 K;  4HA8 A;  3CBM A;  4M7D A;  1D3B B;  2KQW A;  3E19 A;  3C4S A;  3QZ5 B;  4M78 A;  1YHQ T;  3CCQ T;  4A4F A;  1OZ2 A;  3TRE A;  5CQX A;  2DXT A;  3VKI A;  3V8L A;  5GAM h;  2OTJ A;  1UGR B;  3H8Z A;  5D6W A;  1EIF A;  1G3Y A;  2CZ0 B;  2VXF A;  1B70 A;  1E22 A;  3HP9 A;  2JZ2 A;  4DPG A;  3MO8 A;  1VQ4 A;  2K5I A;  2MWO A;  4OMF B;  4EO4 A;  2RHS B;  1QVP A;  4P71 C;  3H6Z A;  3BJU A;  5GMK h;  1R8O B;  4LVK A;  4ZTU B;  4DA4 A;  4PJO A;  1Y7X A;  1NJ6 A;  3UPU A;  2ZPB B;  5HGQ A;  3NTH A;  3TCJ A;  4J6X A;  1K9M C;  2QQR A;  4C0Z A;  2JOY A;  5GAN 2;  2RD1 A;  3REU A;  2DDZ A;  4OB1 B;  4L59 A;  3C95 A;  2DO3 A;  5K1P A;  3CCL A;  3OYJ A;  3AHU A;  3MEU A;  4IUR A;  4QQD A;  4C8Q B;  2VYT A;  2MMP A;  3I7F A;  4YPF A;  4LD6 A;  4YRF A;  1G3T A;  3PTA A;  1X2G A;  2ZT6 A;  4YRR A;  3PCO B;  4RQF A;  5L8R E;  4QVZ A;  4FL6 A;  3CC4 A;  4HWT A;  4PJO D;  1VQP T;  2DD5 A;  1FXX A;  4E47 A;  3OBW A;  2RHY A;  5GAM g;  5LJ5 e;  2JVV A;  2VGN A;  3HY0 A;  5D6X A;  3LX7 A;  2A8E A;  3JCM X;  5GAO p;  4ZN3 A;  1ADJ A;  4XTZ A;  3RER A;  1K73 C;  2B8A A;  3QO7 A;  3ERR A;  4C0F A;  1B7Y B;  4HVC A;  1KC8 U;  3RIR A;  2I4L A;  1BIB A;  1SSF A;  4C0D C;  2DIQ A;  2ZPF B;  4TVA B;  4H02 A;  4P73 C;  4M7A D;  3UFG A;  3UT1 A;  3P8T A;  1B70 B;  5HKC A;  4HT9 A;  3G71 T;  4BB7 A;  4FSX A;  5DLQ E;  4BI3 A;  2DTO A;  2WSF E;  4M77 G;  2NS6 A;  2RHQ A;  2BKD N;  4RKU E;  2RA2 A;  3CC7 A;  3V7C A;  2K5L A;  3OW2 S;  1U1S A;  1VQK A;  2R5A A;  4ZTJ A;  1KMN A;  4OGC A;  5K1X A;  4PHC A;  2V8J A;  2G3R A;  3G6E A;  3JCM c;  3MEA A;  4B9W A;  1BKB A;  4UP9 A;  5ELO A;  2L3R A;  1VQ8 A;  2XDD A;  1YJN A;  4HT4 A;  4OP0 A;  3CPW S;  4N4G A;  1AHJ B;  2E65 A;  3L42 A;  3HXZ A;  2RB6 A;  4G84 A;  3ER0 A;  1YHQ A;  4M75 A;  3GLX A;  1ZHI A;  4F7U B;  3LWI A;  2EQM A;  2LQ8 A;  4RMF A;  1X6O A;  2E5A A;  4QW2 A;  3CCS T;  4M7A F;  1Q7Y C;  4P71 A;  1VQ5 T;  4WF2 A;  2V8K A;  2QEX A;  1VQZ A;  4B9X A;  2LVM A;  4Q5W A;  4ME7 A;  4MDW A;  2YLC A;  4L6V 5;  2RHQ B;  4K87 A;  4HCZ A;  4C92 B;  2LDM A;  1KQS S;  4ZGD B;  4N0A C;  2PVD B;  4N0A A;  4XTV A;  3RKX A;  3IKM B;  2C06 A;  4HT8 A;  2J3M A;  4J6Y A;  4C8Q D;  2WSC E;  3BY7 A;  5GAO l;  3CCU A;  3E9G A;  4KR3 A;  2DD4 A;  3A8H B;  2CJA A;  1I81 A;  3CXC S;  5GAN j;  1NE8 A;  1YCY A;  2QHS A;  4E7L A;  4LVL A;  3QYG B;  4JRP A;  4C0D B;  4LVI A;  2OTL A;  2PME A;  4FU6 A;  1QVG A;  4D6W A;  1I8F A;  2C7I A;  1VIE A;  4EMK B;  4KQE A;  1H4Q A;  1Q82 C;  5GAN 6;  4P5N A;  2JUF A;  5CK9 A;  2RHZ A;  2RI3 A;  3FC3 A;  4C0G A;  1WNL A;  4YDQ A;  4ZGE B;  1HK9 A;  3PZC A;  2ODR D;  1H4T A;  2ZZD A;  1KQ1 A;  3I56 T;  3CEY A;  2K3Y A;  1BI2 A;  3REX A;  4EMK C;  1O9S A;  3HRI A;  5CR2 A;  2K4Y A;  1ASZ A;  3BW1 A;  4M77 B;  3RGL A;  4BW9 A;  2RI2 A;  5M9O A;  4ZTF A;  3CPW A;  3OYC A;  4UPA A;  4M77 D;  2EL9 A;  3GF5 A;  2LRQ A;  4BE2 A;  4QQG A;  4CH5 A;  3SWN C;  3HXU A;  2BIV A;  2CYZ B;  2DKG A;  1N9S A;  2FYK A;  3KUF A;  5GAN e;  1G51 A;  5CKH A;  2YRV A;  1OI1 A;  1WJS A;  5EG2 A;  2R57 A;  2CJB A;  3RKW A;  2QTX A;  4M7D D;  2P0P A;  4H2U A;  3A7A A;  4WJ4 A;  3I56 A;  2ARS A;  4M7D G;  2GCX A;  4LVJ A;  4M7A E;  1VQP A;  4C92 C;  4Q6G A;  1YJ9 T;  2DZC A;  3MHX A;  4M7A C;  1N9W A;  3ASK A;  1H64 1;  3HRS A;  4PNO A;  4XTX A;  3FB9 A;  4RG8 A;  4IUQ A;  4PLL A;  5GAN 7;  1UGP B;  3OYB A;  1Y96 B;  4YRT A;  3HHT B;  2JN0 A;  3CPF A;  5GAN 3;  3OS5 A;  4RDX A;  3NFC A;  3JCM e;  2DTH A;  4ELZ C;  3QUI A;  4ZIB A;  3OD1 A;  5LJ3 d;  4KT0 E;  2ZCF B;  4XQ3 A;  3RMQ A;  3CCQ A;  2D6F A;  1NJ1 A;  3CC2 T;  2DXU A;  5LJ5 d;  4LDW A;  3HRT A;  3VJP A;  4M7D C;  4H2X B;  2D0Q B;  4O5V A;  4XAX B;  2ALY A;  4IUP A;  5GAO n;  3QJY A;  3KXT A;  4P72 C;  3A8O B;  4C5I A;  4DOV A;  4CI0 C;  1NYQ A;  1H4S A;  4JRQ A;  4EMG A;  3L4G B;  2E3C A;  3HFO A;  3FEO A;  3S3O A;  1VQO T;  3CME A;  1PYS A;  1Y96 A;  3A31 A;  4RQE A;  4LDV A;  1Z7M A;  4M7D E;  2L8D A;  1E24 A;  4MZM A;  3M4Y A;  3OYH A;  1NYR A;  5LJ3 f;  2QQB A;  3CBP A;  2EAY A;  3OMG A;  2ZR3 A;  3FRN A;  3MCA B;  4C5E A;  4AH6 A;  2RJF A;  3DKM A;  5A0D A;  2M1H A;  3L2Z A;  4M75 C;  3VUZ A;  2ZGW A;  1NJ5 A;  5CKD A;  5GAM e;  3MET A;  3X24 B;  5FLX E;  4NL3 A;  4M7A B;  4BAC A;  3MEY A;  4RCC A;  1WJR A;  1S72 A;  1U8R A;  5KCO A;  4A4G A;  2JTF A;  2RHS A;  3A5Z B;  1HTT A;  2HNI A;  3CCL T;  2CJ9 A;  4YCW A;  3GNF B;  3A74 A;  3N5B B;  3CCV A;  5LJ5 g;  3OYA A;  3G1Z A;  1G5I A;  3IG2 A;  4J7I A;  1VQM T;  3CCV T;  2EJF A;  1YI2 T;  2LT1 A;  2E10 A;  4EX5 A;  4N4I A;  2VXE A;  3X26 B;  2DQ0 A;  2ZIN A;  3DB4 A;  5GAM f;  3J81 E;  4YRJ A;  3LGL A;  3HSB A;  4PJO E;  3OYY A;  1JJ2 A;  1DJ7 B;  1U1T A;  1UB4 A;  3W3S A;  1KMM A;  1EVK A;  1NZ9 A;  2DVE A;  1VQN A;  5D6Y A;  2PQW A;  2EIF A;  3P8D A;  2Q7H A;  5I21 A;  4TVA A;  3PNW C;  3LC0 A;  4YTL A;  4MMK A;  1VQ9 T;  3JB9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...