2EJGA

Crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
235
structure length
232
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 64
structure length 232
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejgA01
2DVEA 4JRIA 5I21A 1HXDA 3VU3C 4KR2A 1B8AA 1EOVA 3HXYA 4CH5A 4X5OA 3JCMh 4XQ3A 3LC0A 1I4K1 4N0AA 4M7AA 1LNXA 3HFZB 4RQEA 4M78G 5C53B 4EMKB 3REXA 2ZTGA 3NEMA 1RIQA 3QHSA 2ZT6A 4G84A 2ODRC 1LOJA 2E3CA 1EIYA 3G1ZA 4KR3A 3TUPA 4KQEA 5ELNA 4CS3A 2AKWA 4BW9A 4JRKA 4X9CA 4TWAA 3A7UA 2IY5A 1NJ2A 4M77C 4M7AF 3HFVA 2CJAA 4EO4A 1NNHA 5LJ3e 3VQVA 2XGTA 2EAYA 2DDZA 2ZIMA 4RMFA 4M75C 1B34A 4C8QD 4YRIA 2ZZFA 4M78E 2I4NA 3AHUA 1I5LA 4XTZA 5GMKl 5GAMg 4UPAA 1Y96A 5LJ5d 3RKXA 2RHSB 4H2SA 4YROA 2DU7A 3MF1A 3FIFA 1HK9A 2QHTA 4HWPA 4P72A 5GANg 2XTIA 1H4QA 3JCMX 2E5AA 2I2LA 4CH6A 5KNNA 1E22A 1WNLA 4H2UA 4J6YA 4M78D 4C92D 5HGQA 3RF1A 4UP9A 4H2WA 1KQ2A 1YFRA 3E9IA 3JCMP 11ASA 3SWNC 2ZCEA 4YREA 4TQFA 5GMKe 4YRKA 3A7AA 4UP7A 1PYSB 1WYDA 2ZINA 4H02A 1WQWA 3P8YA 2RD1A 3JCMc 2I4MA 2E10A 5GMKm 3HXWA 4XEOA 3HFZA 1ASZA 4YRLA 1LJOA 1X2GA 1B76A 4XTXA 1KMNA 3NENA 1X55A 1E1OA 2Y90A 4XU2A 2AKWB 4PJOG 4JUVA 4XU3A 4P3NA 5GAN7 4C8QB 2K57A 4YCUA 3JB9J 4YRNA 1H4SA 3JCMJ 4M7DG 5GAOl 4XU0A 1TH7A 1NJ8A 5GAN8 4CS2A 4RCBA 4ZTUB 3V8LA 4DQ2A 1WQ7A 4QVCA 2I4OA 3PCOB 4YRTA 4TVAB 3REUA 3JCMV 3JCMW 4Q6GA 4TVYA 4CH3A 2RHSA 1M8VA 3V8JA 4NCXA 5GAOp 1D3BB 2P5IA 2DXUA 4C92B 4HT9A 5GMKj 2ZGWA 4MMLA 3DSQA 3JCMb 2AMCB 3QO8A 1WLEA 4PJOE 3JCMd 2ZNJA 5GANf 3VQYA 1SERA 1X01A 4M7AG 3UFGA 2P0LA 4M7DE 5LJ5g 2QHSA 1JRIA 4PJOF 3A32A 2QTXA 3BDUA 5GAOm 5LJ3f 3IALA 3QNEA 4XTVA 3HRIA 1YCYA 4WF2A 3RIRA 4M7DF 3RACA 3GIBA 1ATIA 3P8VA 4M78C 1PYSA 2YHTA 4C92C 1ADYA 2I4LA 4H2XB 4M77B 5DY9A 5F5WA 3UH0A 3ERRA 3QTCA 4ZIBA 5ELOA 5GAMe 4M75B 1U1TA 3NELA 5LJ3h 3HXZA 5E3IA 4M7AE 5GANe 4H2YA 3E9HA 4A53A 1JJCB 4C8QA 1YFTA 5GAN6 4YRQA 4J6WA 4RDXA 1USYC 3TEHB 12ASA 5C52B 2Q5HA 4WI1A 1YGBA 5GAOn 2C7IA 4P71C 3PCOA 3FB9A 4TVAA 4XTYA 3IKLA 4XTUA 4M7AD 3SWNB 3M4QA 3A74A 4Y91A 4P74C 4YRSA 2CIMA 5K1PA 1D3BA 3V7RA 5GAOr 1NJ1A 1MGQA 4C92A 2ARSA 2AMCA 5GMKh 4NL2A 3QO3A 2ZR3A 3RGLA 3L1AA 2RHQB 1KQ1A 4K87A 1YB3A 4L87A 3RKWA 5LJ5f 3L4GB 4WJ3M 4CH4A 3BW1A 4EMHA 2EJFA 3LSSA 1IL2A 1NJ6A 4BWAA 4HVCA 4QVDA 3JCMg 3JB9F 2E64A 4YCVA 4XU1A 4Q15A 1E24A 4TTVA 4H2XA 4M77A 3IKMB 2HNIA 4OP0A 3CMQA 3ICAA 4P75C 3L2ZA 1USYA 1H641 4NOYA 2Q7EA 3TEGA 5LJ3j 4X9DA 4UP8A 3RERA 3A31A 4M75A 3LSQA 1E1TA 4PJOC 1U1SA 3W3SA 2PMFA 2DZCA 2E65A 2JN0A 3BY7A 2VXEA 2G4CA 4PHCA 1QF6A 2VXFA 1BBUA 3QSUA 2CJBA 3MEYA 4M7DC 1BIBA 3A7RA 2DQ0A 4YRFA 1JJCA 5GAN5 2ARTA 4M77F 2E41A 3UGQA 5LJ5e 3HXUA 1C0AA 3TEHA 1EFWA 1M5Q1 2ZT5A 4M75F 3IG2A 4YRCA 1BBWA 2RM4A 2CGHA 4HWTA 4YPFA 4HA8A 3VBBA 3EFRA 3SWNA 5GAMf 1NYRA 4P73C 1FYFA 4M78B 2FB7A 1H4VB 4N0AC 4M7AC 1ASYA 1G5HA 4EMGA 4HWSA 4E51A 3HRKA 4PNOA 1KMMA 2Q7GA 2RHQA 4F7UA 1ADJA 3KFUA 2ZT7A 1N9WA 4XTWA 1SETA 3L4GA 2PMEA 4H2VA 5LJ3d 5GAMh 1JBMA 3FJPA 2YLBA 2EL9A 3V7SA 2Q7HA 4PJOD 5GANh 2DZ9A 4C8QG 2ZXFA 4M7DD 4K86A 3HSBA 4AH6A 1B70B 1G51A 4K88A 1I81A 4P3PA 1KOGA 2DTIA 4RQFA 3M4PA 3V8KA 4YCWA 4G85A 3QO7A 2VC8A 4P73A 4P72C 2J3MA 3INZA 2EJGA 3QUIA 1B7YA 1J5WA 3VQWA 3JB9G 2ZIOA 5GAN2 4C92G 5GAN4 1L0WA 3HXXA 4C8QE 4CS4A 3JCMe 4OLFA 3M4GA 3BJUA 4P3OA 5C51B 3PGGA 4YDQA 4H2TA 4EX5A 1WU7A 2DKGA 4C8QF 4M78A 2EWNA 4NL3A 5GAN3 2Q5IA 3HY0A 4EMKC 4PG3A 2ZZEA 3I7FA 4HT8A 4M77G 4F7UB 4YRRA 4PJOB 4C92E 4TVWA 4ZTZB 5GAMj 1EQRA 2ALYB 4JLIA 4M75G 1X54A 5K1XA 4HWOA 3P8TA 4TQDA 4M7DB 3HFNA 4HWRA 4M78F 1EVLA 1NJ5A 2QHVA 4C92F 1N9SA 5GANj 2ZZGA 3HXVA 4DPGA 3RUXA 1Z7NA 1W66A 3V7CA 1SRYA 4YRMA 1I8FA 1EVKA 4YRJA 3NETA 3QO5A 2DJZA 3A5YA 3RESA 3JB9D 5LJ3g 1H4TA 1B70A 1HTTA 5LJ5h 1QE0A 4P71A 4LNSA 1BIAA 4M77E 4YP0A 2EJ9A 3HTZA 3PZCA 3EFSA 4P74A 3R07A 4YRPA 3RL6A 3WQZA 2ODRD 2ZT8A 4M75E 2YLCA 2J3LA 3VQXA 4M7AB 1B7YB 1G5IA 4XEMA 2CJ9A 4EMKA 2DXTA 3OD1A 2RB6A 2DU5A 2DEQA 3RKYA 2FYKA 2DTHA 1Z7MA 2QHUA 2ARUA 2ZNIA 1EIYB 4M77D 1X2HA 4F7UG 5GAOq 3JB9I 2E1HA 1GGMA 3BFMA 5GAMd 3JCMQ 3MF2A 4M75D 4J15A 4YRGA 2IY5B 2RA2A 1YFSA 3A5ZA 2DTOA 1NYQA 4MMKA 4RCCA 3JB9H 4P75A 2ZR2A 5GANd 2C8MA 1B34B 3HFOA 4PJOA 4YYEA 4A54A 1SESA 2DQ3A 1Y96B 3SB2A 4J6XA 2ALYA 4M7DA 4C8QC 5CAIA 1X56A 4F7UE 4J5YA 5GMKi 1WPYA 3JCMf 4O2DA 1LYLA 1VQZA 4WJ4A 1HC7A 3HY1A 4F7UF 5LJ5j 1N9RA 3UGTA 4V2SA
chains in the Genus database with same CATH superfamily
2PUOB 2M1HA 2DVEA 1QWFA 1HXDA 2IPOB 1B8AA 4BI4A 1EOVA 3HXYA 5A0DA 1TOVA 2XU8A 2EVRA 3JAME 4XQ3A 1I4K1 3RDVA 1BYMA 4M78G 1PHTA 2KYMA 3A8LB 4EMKB 1RAGB 4C0FA 4DBQA 3NEMA 2KDSA 4G84A 4D8DA 2ODRC 2E3CA 1EIYA 3FRNA 4KR3A 2CYZB 2E70A 1AHJB 2CP2A 5ELNA 2MWPA 2AKWA 4CS3A 2PUKB 4JRKA 2L3QA 5FU7B 1HYOA 1UGRB 2JTEA 1VQLQ 2EQUA 2ZIMA 2JUFA 2ROTA 4YRIA 1B34A 4M78E 2D6FA 2K5FA 1N6AA 3H41A 5GAMg 3MP6A 4YROA 1C6VX 3RKXA 5KE3A 1SRMA 4Y28E 1U8RA 3MF1A 2E5QA 1HK9A 1WJRA 5GANg 2XTIA 3R6OA 1WIEA 4AG1C 2PU9B 2LQ8A 2HDAA 5IT9E 4B9XA 4H2UA 2F2WA 4C92D 3CCQQ 1VQOT 2NS6A 4HVVA 3E9IA 11ASA 1D0ZA 3ZEHA 1Q82C 4YREA 1AWJA 3URGA 4AFZC 1E6GA 3QPHA 4RTVA 3EGUA 4UP7A 1AOJA 4ME7A 2ROLA 4LE9A 1TSFA 1WQWA 4XEOA 5GMKm 2KGTA 1UGSB 3CCVQ 1SEMA 2EYWA 1KMNA 4C5EA 5J39A 5CKFA 3G4SQ 1BCMA 2RPNA 1K1ZA 1E1OA 2AKWB 2CP5A 3M0QA 2AHJB 3CBOA 2GNCA 4XAXB 2XIDA 3JB9J 3JCMJ 1WXBA 2LCLA 2QGGA 5GAOl 2GQVA 1NJ8A 2FL7A 3HP9A 1W2BS 3V8LA 3JCMV 2BUDA 2CDTA 4NCXA 1BCOA 1D3BB 2DXUA 2ABLA 2A7YA 3PMIA 4C92B 4J7IA 3M4YA 3I56T 2AMCB 4J9DA 2ZNJA 3VYGA 5GANf 2ZPGB 3VQYA 2MAMA 1OX8A 3GNFB 1TS9A 3UA7A 2QTXA 3QNEA 4XTVA 4FW2A 2GTOA 1KSWA 4WF2A 1UEBA 3G6ET 3GIBA 4ORZA 2J6FA 1M3AA 4M77B 3S3MA 5DY9A 1CKAA 5KCHA 5F5WA 4DBRA 1NJIU 5ELOA 5CO7A 4HKEA 3HXZA 1M2VA 4MDWA 3L2QA 3CCET 1ABQA 1BU1A 2ED1A 3C95A 3E9HA 4A53A 1WJSA 1YJ9Q 1Y07A 3Q1JA 2K3BA 1B7TA 2F69A 1USYC 12ASA 5M9OA 2P4RA 4CC7A 1YGBA 3EG2A 1G3WA 3PCOA 2KYBA 2IVWA 3FB9A 4TVAA 4XTUA 4OB1B 3N5BB 4RUGA 2C06A 3UDCA 4Y91A 2RHYA 1NJ1A 2RI5A 1WHJA 2ZR3A 2X4WA 3O8VA 5CQYA 3CC2Q 3EGDA 2LX9A 1O9SA 1MMGA 3PIOA 3C94A 3BW1A 4EMHA 1ZX6A 3PFSA 1Q86R 1VA7A 2E3IA 2O4XA 1HSQA 2FG0A 2CH4W 2L89A 2BTTA 4XU1A 3OW2A 3EFOB 4HCZA 4CC4B 3L2ZA 2AKLA 3CXCP 2GFAA 4E7IA 3VS0A 3LSQA 1NG2A 4ZN3A 4CI0C 3UATA 2JTFA 3MEYA 3QSUA 2KT8A 1WDXA 2X9HA 3X25B 3RMSA 1OV3A 2QQ9A 2DQ0A 3A7RA 1UHCA 3S3NA 5I11A 2JZ2A 2O9SA 2MPXC 1C0AA 1MNEA 2H3EB 3TEHA 1EFWA 4C5GA 2ZT5A 4M75F 3IG2A 1H92A 2RM4A 2CGHA 2C0OA 3CCQT 3UWNA 1V29B 3MQZA 5IXBA 3CCUA 1NYRA 2C0TA 4LNPA 4M78B 2M9UA 4Z89A 5DM7R 1TWBA 3U23A 4M7AC 1RI9A 4OF1A 1GRIA 4J9FA 3FC3A 1YITA 4PJJA 2RHQA 4C0DC 3EG3A 2ZT7A 3CCVT 4JPBW 3HRSA 1SETA 3L4GA 2PMEA 3G4ST 2VB6A 1M90U 2DK3A 2EKHA 2Q7HA 4KGVB 1M1KU 3A8HB 1T0HA 2DZ9A 2EKOA 2ZPIB 4OMFB 5KYUA 1WXTA 3M57A 3HSBA 1JXOA 4YTLA 4AH6A 4K88A 5EG2A 1AZGB 1VQ8A 2DTIA 3MCAB 2VC8A 4J7FA 2DMOA 3CMEQ 3DLLA 3INZA 1VYTA 3NFCA 4J9CA 5GAN2 1WLPB 1L0WA 5IHIA 1K73R 3M4GA 2J05A 3CBPA 5D6XA 3CD6A 1C0MA 5IHKA 2B8AA 2DO3A 5J3BA 2YT6A 2LCCA 3TCJA 3CMAA 2G6FX 2EWNA 1S72Q 1QVFA 1VQ5Q 4JJDA 4EMKC 4MDXA 4PG3A 4IUQA 1VQ6Q 2DF6A 4BE2A 5KYXA 4CRIA 2LMJA 5HKCA 2HL5C 4BUGA 2CP7A 5HK3A 2DYBA 2EQIA 3HFNA 4KUDK 4HWRA 4P5NA 1NJ5A 4PK4A 2ZZGA 3M55A 3QKJA 3RUXA 5FU7C 1NM7A 2D1XA 1SRYA 1EVKA 3PTAA 3CXCS 4JJNK 2P0QA 1H4TA 1ZSZB 4TVRA 1B70A 5LJ5h 4GLKA 3VV0A 3LH0A 3CCJA 2PVGB 1PKSA 2KR3A 3OW2S 1GCPA 2EJ9A 3D7SB 3VKIA 2QAZA 2K7AA 3R07A 2LZ6B 2YRDA 2ZT8A 1FMVA 3H0HA 2KAFA 1VQ7A 4RTUA 4FL6A 2DEQA 1SSFA 3I55T 3CC2T 1Z7MA 2QHUA 3OYIA 1E7OA 2EW3A 1X2HA 2QQBA 3JB9I 2LJ1A 4C0ZA 3JCMQ 3MF2A 4M75D 4J15A 2IY5B 1YFSA 2CSQA 2XK0A 4RCCA 3P8BB 3JB9H 4OGCA 4LUEA 2VUBA 3HRUA 1Y96B 2DJQA 1HD3A 4OMPA 1QVGA 2ALYA 1MMNA 1KD1U 2EBPA 5CAIA 1EX4A 3JCMf 4ZTFA 1RAEB 1Q81C 1PG5B 2COZA 1SHFA 3CC7A 1NYFA 4WJ4A 4PJNA 1ZHIA 1HC7A 1QVGP 5LJ5j 1B07A 3H9NA 2IG0A 4ZN1A 3QDFA 4IUUA 4JRIA 2EYZA 1M8MA 4JRQA 4CH5A 1Y0MA 2LX7A 3O5ZA 3QIIA 3JCMh 4UC4A 1MMDA 2WSEE 4M7AA 2RHXA 1M1FA 1N8RC 1BBZA 2J06A 1X27A 3QHSA 3NTHA 5L23A 3KXTA 3HPWA 1D0XA 4X1VA 3CCUQ 2E12A 4AG2C 3UA6A 4BW9A 2CZ7B 3OS1A 4KULA 4TWAA 2JS0A 2LP5A 4M77C 2CUBA 1YN8A 3ZL7C 1YITQ 2NUPB 1NNHA 3KBGA 2XGTA 1RACB 4AFUC 4HT4A 3OS0A 4RMFA 5CKHA 1NLPC 3OYLA 1ABOA 4KBMB 4J9BA 2I4NA 1KQSA 4XTZA 1I5LA 5LJ5d 3THKA 1QVFS 2DU7A 2OTLA 3OYAA 1I5OB 1H4QA 3JCMX 2MIOA 3GNGA 4CH6A 5KNNA 1KC8U 1E22A 1JU5C 2RJEA 4RTWA 1VQ8Q 1MUZA 2JMCA 2QYZA 5D6WA 4OMQA 3G71A 2RMOA 3I56Q 3HKSA 2VGMA 2EIFA 3SD4A 4OB3B 3JCMc 1NYGA 3HXWA 2J6OA 1ASZA 1S72T 4BD3A 1VQ9A 1UECA 2QEXA 3M58A 1B76A 1VQ6T 1G3YA 3NENA 2OTJA 1VQMA 1SSHA 1VYVA 1KC8R 3G6EQ 1ZSGA 3LH5A 1W2BA 3CMAQ 5GAN7 2RQWA 1WHLA 3QZ5B 4XU0A 1TH7A 2FZCB 2AK5A 2DRMA 2K6DA 2Z0WA 2RN8A 4QVCA 2KK4A 4Q6GA 4TVYA 2A36A 1W1FA 5FRNA 1E6HA 1M8VA 3V8JA 2P5IA 1X2KA 5J26A 2ENMA 1H3ZA 1TUGB 4HT9A 4J9EA 5GMKj 3DSQA 4MMLA 3JCMb 2HD0A 3JCMd 4FSSA 4Z88A 1QVGS 1SERA 3UFGA 5I22A 2DM1A 3CCJQ 1T3SA 2L3RA 2QHSA 2BIVA 2I0NA 4JZ3A 5LJ3f 3IALA 2CP0A 4KH0B 2KXCA 3NTIA 3HRIA 1VYUA 2RQUA 1K9MR 3E19A 5I2SA 2QTVA 3P8VA 4JLGA 1YWOA 4M78C 3NGPA 2YHTA 2I4LA 3P8HA 2R5MA 2LT1A 3EG0A 4H2XB 2EPDA 3F70A 3UH0A 4N4GA 2KROA 3QTCA 3J7AF 2XDBA 3NELA 5LJ3h 1V1CA 2A28A 2E6NA 4ZNXA 5E3IA 2KRMA 1PCXA 1WHKA 4E7LA 4XK8E 1WA7A 1X69A 1JJCB 3E1SA 1WGSA 4JRPA 3EH2A 1O75A 1YIJQ 2DBMA 4KRTA 4E7ZA 2LQNA 2K3YA 4J6WA 1OEBA 1RL2A 1NPPA 4J9IA 3VS7A 2QASA 1M2OA 2G3RA 5GAOn 2C7IA 2DIGA 3IKLA 1XTDA 2CP3A 3VS5A 3M4QA 3MEVA 1D3BA 1AZEA 3V7RA 4C92A 2ARSA 2P0PA 2AMCA 2VKNA 1BI2A 2RQTA 2VYTA 3QO3A 3TEEA 1KQSS 1W70A 3L1AA 1IGUA 4K87A 4L87A 4CC3A 3VS1A 1VQNA 1UJYA 1VQ4Q 1IL2A 1N27A 4HVCA 1X6OA 2K4YA 1UTIA 3JB9F 4YCVA 3M0RA 1I07A 2JXBA 3CCUT 4TTVA 2L3SA 2VASA 2DYIA 2DIQA 3M59A 3MEWA 4M77A 5FLXE 4GBQA 4OVAA 3OB9A 2Y4XA 1YITT 3TEGA 3QWXX 4RTTA 5LJ3j 4UP8A 1YI2A 2MOXA 1I1JA 2HSEB 2DZCA 2JN0A 1FYNA 4HCKA 1OZ2A 2VXFA 2CJBA 1OOTA 4N4IA 3WXMB 4ZTJA 5FU6B 2ARTA 2E41A 2EYXA 5LJ5e 1U06A 3HXUA 4LUDA 1M5Q1 4N4HA 1ZSZC 2FZKB 3OS2A 1IGQA 5KH6A 1BBWA 2MWOA 4YPFA 1VQ8T 3CBMA 3VBBA 2R58A 2NYSA 5GAMf 1FYFA 1EIFA 1PC0A 4JJBA 3PT9A 2FB7A 1WHHA 3OSSC 2DL7A 4N0AC 5HCKA 1KJWA 1G5VA 4EMGA 1G5HA 3X20B 3OYFA 4PNOA 3TQ7P 4PLLA 2K5LA 2EGEA 1TXQA 2NUZA 4J9HA 2K9GA 2OAWA 3CCSQ 5LJ3d 5GAMh 3G71Q 2DD4A 2ZZDA 3L2RA 2VVKA 3FJPA 3V7SA 3CMAT 3EFOA 5GANh 4C8QG 2ZXFA 1PWTA 1VQ9Q 2DX1A 2QEXQ 1I81A 2V1RA 2FPDA 3I9QA 2LJ3A 4DOVA 4KGXB 4DA4A 3MKDA 2EJGA 3VS2A 1B7YA 3QJYA 3FEOA 4OB2B 3ASKA 1YBYA 1T3LA 2YUPA 4C8QE 4CS4A 4HCBA 1PNJA 4BY6B 3JCMe 3CCJT 1UUEA 1NJIR 1IHWA 1AWWA 2HQEA 3FLGA 4C8QF 4M78A 4IIOA 4FT4A 1NE8A 3A5ZB 2X3XD 5HY6A 1YJNA 3I55Q 2IIMA 1VQ7T 1G8XA 2LT4A 1RLQC 1OULA 4ZTZB 5GAMj 3CXCA 4M75G 1WFWA 2MMPA 2E4HA 4TQDA 3MJXA 2KE9A 3S3OA 1EVLA 5GANj 1W66A 3V7CA 4RTZA 4B6MA 1YIJT 1Z9ZA 1I8FA 2LNHB 2OJ2A 3NETA 3QO5A 2DJZA 3RESA 3JB9D 1VUBA 2DXBA 4LNSA 5IXFA 2ZCFB 3HTZA 2HCKA 1YHQA 3RL6A 4QVZA 4GY5A 2ODRD 4M75E 2J3LA 5CKDA 1B7YB 2CJ9A 1X75C 2DXTA 3OD1A 2FRWA 2RB6A 1K8AU 2V26A 1Z9QA 2BZ8A 1C1AA 3RKYA 2FYKA 2DTHA 3OYMA 1D0YA 3OYJA 3C0CA 3VS6A 2L2PA 1QCOA 4F7UG 5KYWA 3QYGB 5GAMd 1VQ4T 5CKBA 4YRGA 2DTOA 5L8RE 3GP8A 2DEUA 1M9SA 4MMKA 3OYBA 4LVJA 4VUBA 5GANd 2QG9B 3NPFA 3RR6A 5D7UA 3HFOA 1VQKA 3TU4K 4BE0A 1G3TA 1KHIA 3DKMA 1AWXA 1RADB 1J3TA 2ZPBB 3GOXA 4F7UE 1WPYA 1D1AA 1W4SA 1Q86C 2NWMA 4IUTA 4O2DA 1YCSB 1VQZA 2X4XA 3OYGA 2D0QB 1K0XA 2L5QA 4F7UF 1IO6A 1N9RA 3RMQA 1YI2Q 2CZ0B 2YDLA 1ZSZA 2RHIA 4Z8AA 1Q7YU 2CKKA 5I21A 3VU3C 4KR2A 3M0UA 1RABB 4RTXA 2GCXA 2AIRB 4C0GA 4WCIA 2O31A 1NBEB 2KMTA 2X51A 1RAHB 5FROA 2OTLT 4B9WA 2MCNA 4N0AA 1LNXA 3HFZB 3OY9A 4RQEA 1UGQB 1K9AA 5C53B 1M90R 3REXA 2YUNA 5DLQE 2JNGA 5FW9A 3ME9A 1YJWA 4NS5A 3CC4A 3QYHB 2V8IA 1M1KR 1LOJA 2R57A 5KYWB 3TUPA 4KQEA 3CCLA 4ZGEB 3A98A 4MZMA 3CCST 2ZPHB 3G71T 1X6GA 4X9CA 2V8JA 3A7UA 2IY5A 1NJ2A 4M7AF 2D9TA 3HFVA 4EO4A 2EGAA 5LJ3e 2DL3A 3MEUA 2EAYA 2DDZA 3VUBA 4C8QD 7AT1B 1VQ9T 1OPKA 2ZZFA 4KUIA 2KVQG 2QEXT 2BZXA 4PKCC 5GMKl 4UPAA 1Y96A 2RHSB 1VQMT 1PSEA 2ZPEB 1K76A 3FIFA 2DAQA 2F2XA 2QHTA 4QW2A 6AT1B 2FEIA 4LXCA 2HSPA 1KFZA 1CKBA 2LRQA 1WHGA 1JB0E 1WNLA 4OMOA 1MV3A 3EH1A 3RF1A 4UP9A 1N8RU 1T0JA 5A0LA 1IREB 3REBB 1S1NA 1YFRA 4LD9K 5C6SA 4TQFA 4YRKA 1PYSB 1QCFA 1BI1A 2O01E 1WYDA 4H02A 2RD1A 2I4MA 1R8OB 3VS3A 5FWCA 2PVOB 3A8GB 4YRLA 1UGVA 2K5IA 2LQWA 3VUZA 3OBYA 4BI8B 4E7JA 1VIFA 1M90C 1X55A 3PE0A 2PNIA 2DRKA 3X28B 4PJOG 4XU3A 4A4FA 4P3NA 3TVTA 1QQJA 4C8QB 4ZGDB 3WVEB 1K73C 4YCUA 3SEMA 1ZUUA 4M7DG 1RAIB 3M0SA 1BKBA 2NUPA 3CPWA 5GAN8 4CS2A 2MK5A 4RCBA 4ZTUB 4DQ2A 1WQ7A 2KQWA 4YRTA 4WTOB 3JCMW 2RK1A 4QQ6A 5GAOp 4LN2A 3CPWP 3J81E 2FVUA 5FU6C 4LVMA 3QO8A 1WLEA 4PJOE 2A8EA 1NPRA 1VQLA 3OMCA 4M7DE 1JRIA 2QGFB 4PJOF 1FX7A 3BDUA 5GAOm 2RF0A 2J7IA 4F16A 3DB4A 1CSKA 1XJWB 1JXMA 1QCNA 5ECAA 4A4GA 4M7DF 2RH2A 1OYXA 4IUPA 3VRZA 4O6JA 2A37A 4C92C 1ADYA 1VQPA 1UGPB 2QI2A 4HXJA 3OYDA 2ZPFB 3VJPA 3CCMA 3ERRA 1RUWA 4FW1A 1KD1R 4ZIBA 5GAMe 2FPFA 2KY9A 4M75B 3OYYA 1U1TA 1YFNA 1JJ2P 3CCQA 1LPLA 1GFCA 4A4HA 2QQRA 1VQNT 5GANe 3LWHA 1WXUA 4H2YA 2D8HA 4F04B 2LJ0A 1U5SA 3LLRA 3LGFA 2YRVA 5KE2A 5KYYB 1EZZB 1UHFA 1UFFA 8ATCB 3EG9B 3TSWA 2Q5HA 1VQKQ 2JS2A 1M3BA 1KHCA 3JV3A 1YI2T 4XTYA 4M7AD 2E3HA 3SWNB 2QDLA 3A74A 1MV0B 2GBQA 4P74C 5C0MA 5GAOr 1JQQA 1X6BA 2NUTB 4LDUA 1QMCA 3ZFJA 5GMKh 1OQKA 5A0GA 3RGLA 1VIEA 5CKEA 1KQ1A 3I5SA 2X4JA 4BY6C 2DL4A 3OBWA 4CH4A 1PM3A 4OMLA 3LSSA 2EFIA 4BWAA 2E64A 2GF7A 4H2XA 2HNIA 4OP0A 2P0KA 3ICAA 1H641 2CS7A 3CQTA 4IIMA 3CC4Q 4X9DA 3MHXA 3A31A 3OYKA 3DB3A 3W3SA 2PMFA 3BY7A 3CD6Q 3OYHA 4PHCA 3CCLQ 4IURA 4YRFA 1JJCA 1BI3A 3X24B 3TREA 5GAN5 4M77F 2RNAA 3UGQA 3EGXB 2M51A 2LQKA 1PSFA 1IB8A 4MZPA 1UDLA 4JDSA 3M9QA 1NLOC 4A4EA 2XD0A 2QDYB 2YRCA 2DVJA 3A8MB 4HA8A 1X2QA 3EFRA 1EFNA 4R56A 4AFQC 3CPWS 2M0YA 3QG1A 2P4TA 3CCRA 1Q82U 1YJ9A 2O2OA 2YXYA 4PFOA 1Q95G 1YP5A 3OS5A 3HRKA 2L8DA 4AFSC 1KMMA 4HVUA 2KRNA 2EYYA 4D6WA 2LTOA 5A2QE 3KFUA 2HQHA 5GJVB 3H0FA 4FT2A 1N9WA 1GFDA 2V1QA 4XTWA 4BB7A 4DOWA 2RO0A 1JBMA 3S6WA 2YLBA 2DL5A 2FRYA 2MI6A 4PJOD 1KIKA 1VQ7Q 1QW1A 3P8DA 1YJNT 2CH4A 4M7DD 4K86A 3LYIA 1TUDA 1ZBXA 3CEYA 3PMTA 5LL6S 1JJ2S 5CK9A 2DLPA 1KOGA 3BE3A 2CZ6B 5IHNA 3M4PA 4YCWA 2J6KA 2RHZA 4G85A 4E7SA 2DBKA 1AWOA 2RI2A 2A0FB 3QO7A 4JZ4A 4OGEA 4BE1A 4P73A 1KC8C 4F14A 2MF2A 5EC7A 4P72C 3AT1B 1SHGA 2J3MA 3QUIA 2XI9A 4DBHA 1TG0A 4JS4A 3JB9G 2ZIOA 2GFUA 1NEGA 2M16A 4E2FB 4PJLA 2CT3A 1ACMB 5GAN4 4DEXA 1MNDA 3HXXA 2YSQA 4P3OA 2SRCA 3BJUA 4QQDA 3L42A 4EDUA 1MHNA 3PGGA 4YDQA 4IUVA 2DKGA 4MZTA 3OMGA 1YHQT 3C12A 4NL3A 2Q5IA 3CC7Q 3HY0A 2P84A 3I7FA 4LDWA 3OA6A 5CCAA 4YRRA 2EQMA 4PJOB 1AT1B 2GQIA 4KT0E 1D1BA 2KXDA 5CR2A 4JLIA 1EQRA 2PZ1A 4M7DB 1F1BB 4R55A 4M78F 1VQPQ 4DPGA 1UJ0A 3BDLA 1Z7NA 3FJ5A 1K9MC 3CCMQ 1WZOA 4YRMA 1QVPA 1AVZC 4OB0B 5CVIA 2V8KA 1HTTA 4BACA 1VQKT 1BB9A 2EQKA 4A63B 2XKOC 3PZCA 4P74A 4ZGJB 2OAUA 1GCQC 2PTKA 1H3HA 4FYVB 2YLCA 1HJDA 3VQXA 2D0NA 1G5IA 4XEMA 2F1LA 1M1GA 2COWA 3LX7A 3ZBDA 1Y71A 1IZ6A 2JOYA 2X4YA 4D8KA 1EIYB 4M77D 2FO0A 5FRMA 3A8OB 2DERA 2E5KA 2HEQA 2X3WD 2K2MA 2E1HA 2OTLQ 1PRLC 3OYCA 2QXFA 1U3OA 3CMEA 2W10A 1FMWA 2RA2A 3A5ZA 1XOVA 1NYQA 2LC4A 2K2VA 3JSCA 1YNZA 4FYYB 1ZA1B 2C8MA 1B34B 1QLYA 1YJWT 3CC4T 4A54A 1SESA 4KH1B 1PD0A 2WSCE 3CD6T 2BE9B 3CCLT 2D8JA 3QBYA 4C8QC 1X56A 1ZBJA 3J80E 2EGCA 1Y57A 2SEMA 3M54A 1S72A 1VQ5A 4AMCA 2XDDA 3E9FA 1VQ6A 2JMAA 1R0CB 3UT1A 2FHDA 3UGTA 2OTJQ 4V2SA 4LD6A 3M5AA 1W6XA 1VQMQ 3OYNA 2QA4A 2OX7A 2DA9A 1NEBA 4X5OA 1I0CA 2CZ1B 5GJWB 4CC2A 4BI3A 3LC0A 1AD5A 1JEGA 2JM8A 1SRLA 2ZTGA 3GPLA 1RIQA 2ZT6A 2KSSA 3MP1A 2AZVA 4K11A 2AT1B 3G1ZA 1M3CA 2BKDN 3I5RA 3CCRQ 2BZYA 4JJCA 2RJFA 2B86A 2CJAA 3JRZA 3NHNA 2VGNA 1QP3A 5I2MA 3VQVA 1NZ9A 4BDYA 2DE0X 1Q86U 1RI0A 2RI3A 4RKUE 4M75C 3PVQA 3AHUA 2ED0A 3L2VA 4H2SA 4ATOA 3R6NA 2ZAEA 1V76A 1ARKA 3REAB 2KI7A 4F17A 2AZSA 4HWPA 3E9GA 1ZLMA 4P72A 2E5AA 2YUQA 4ELZC 2I2LA 1LCKA 4II1A 1K0SA 2CUDA 4RTYA 2AKKA 2HKNA 4PJMA 3RNJA 4J6YA 1PRMC 4M78D 1IHVA 3VS4A 5HGQA 2KBTA 4H2WA 1KQ2A 3JCMP 3SWNC 2ZCEA 5GMKe 2ESWA 3A7AA 3M56A 1YWPA 2ZINA 3P8YA 4RG8A 1RAFB 2XDPA 2E10A 2JVVA 3HFZA 2DL8A 1OI1A 1LJOA 3CC7T 1X2GA 3ULRB 1MMAA 2DD5A 1IRXA 1WI7A 4XTXA 1TTHB 1M2VB 1VQLT 4E7KA 3UF4A 3OW2P 2Y90A 4XU2A 8AT1B 3OQ5A 5FWBA 4JUVA 2K57A 2F2VA 3WVDB 4YRNA 1H4SA 1R77A 1NJIC 1WX6A 1VQPT 2LNVA 2JW4A 1G3SA 3UPUA 3CCMT 4LDXA 1VQOA 4LVIA 4E47A 1B3QA 3REUA 2I4OA 3PCOB 4TVAB 1VQNQ 3GBQA 3EHRA 5D6YA 2PQWA 4CH3A 1K8AR 2RJDA 2RHSA 2W0ZA 2DXCA 3MPUB 1GCQA 3PNWC 2ZGWA 2XHCA 3H8ZA 3M0TA 3L2UA 2KEAA 4FCYA 2R5AA 1SKUB 1TUCA 3CPFA 2DILA 3EGDB 1X01A 4M7AG 2P0LA 5LJ5g 3A32A 3MO8A 2VV5A 3QXEB 1YCYA 3META 2O4XB 2YWWA 3RIRA 3E2UA 3RACA 1ATIA 1PYSA 2HL3A 2RQVA 4PFZA 2LDMA 2PVDB 3G7ZA 4PFPA 1K73U 3HTRA 3SDZA 4J9GA 4HCCA 2CP6A 1G2BA 4J8OA 3HRTA 2WACA 4C5IA 1PD1A 3QDRB 4E6RA 1UB4A 2H3JA 4M7AE 4O5VA 3NMZC 4KGZB 3I56A 1Q7YR 4C8QA 1YFTA 5GAN6 3H0IA 4YRQA 1VOMA 3PVLA 1WJQA 4RDXA 2WSFE 1RLPC 3TEHB 3FDRA 1QKWA 5C52B 4WI1A 1RAAB 1Q81U 4P71C 4DBFA 2OTJT 1H8KA 3RBBB 3SHWA 3G6EA 1X43A 1WHMA 5KYNA 4YRSA 2CIMA 5K1PA 5CIUA 1KK7A 1MGQA 1K8AC 3A1PA 4NL2A 1GL5A 4OMMA 2HAXA 2RHQB 2L3PA 4EPCA 1YB3A 3CCEA 1N5ZA 4L5GA 3RKWA 1A0NB 5LJ5f 3L4GB 4WJ3M 2QA4Q 2YUOA 2VWFA 2EJFA 2A3LA 1QVFP 1NJ6A 1Q81R 4QVDA 3JCMg 4Q15A 1E24A 3QWYA 3IKMB 3CCRT 1YJ9T 4BDZA 1DJ7B 3CMQA 4P75C 5KYUB 1USYA 5AT1B 4NOYA 2Q7EA 2KNBB 2OI3A 3RERA 4M75A 3X26B 1E1TA 1TU0B 2L0AA 4PJOC 1GBRA 1U1SA 1JO8A 3L2WA 2HQXA 3M53A 2E65A 2VXEA 2XMFA 2G4CA 2EYQA 2DFUA 1QF6A 2XICA 1BBUA 2XG8D 1M1KC 4M7DC 1BIBA 2JT4A 1Y7XA 1N8RR 3IQLA 2O9VA 1YJNQ 5KYYA 3QZ9B 1Q7YC 4L59A 1PKTA 3EG9A 3ER0A 2CSIA 2RQRA 4DEYA 1D1CA 4YRCA 3VYHB 4HWTA 1QKXA 1ZUYA 4EIKA 3SWNA 1P92A 3C4SA 3HL8A 2RHUA 3KUFA 1GXIE 3PIPA 4P73C 2HBWA 4LDVA 2FZGB 1H4VB 4AT1B 3MP8A 1FWZA 2K3XA 2NUTA 9ATCB 3OYEA 1YIJA 1ASYA 4HWSA 1WYXA 1QP2A 4E51A 2JJ9A 2QQAA 2Q7GA 4FIBA 1BI0A 4F7UA 1ADJA 5IAYA 5KYXB 4H2VA 3T9NA 2O88A 3G1JA 1YHQQ 1JJ2A 4OMNA 2EL9A 2RK2A 4FSXA 1FXXA 4L6V5 3M0PA 4LVLA 4X34A 3TSZA 4M4ZA 1M4ZA 2HKQB 2Y4YA 1B70B 1G51A 4P3PA 4RMOA 5AYFA 2GTJA 3DLMA 4RQFA 3V8KA 1AEYA 4LDYA 1BK2A 1VQ4A 1QWEA 4GLMA 2RJCA 2H8HA 3OSVA 4FU6A 2MYSA 4FM4B 2BE7D 2KRSA 1J5WA 4R0KA 3VQWA 2K79A 4PLIA 4C92G 2ECZA 3EGXA 1VQOQ 5KCOA 1IXDA 3CCVA 4IKFA 3EHQA 2CT4A 2HBPA 2ATCB 4OLFA 1UG1A 3G4SA 5C51B 4E7HA 1OZ3A 1SF9A 2QQSA 4H2TA 2NLUA 2QK0A 1WU7A 4EX5A 3H6ZA 2GGRA 4A4KA 1ZA2B 2CREA 5GAN3 2ZZEA 4HT8A 4M77G 3LWIA 4F7UB 2FPEA 4ESRA 5IN1A 4C92E 4TVWA 1SG5A 2ALYB 5K1XA 1X54A 4HWOA 3P8TA 1R0BG 4LVKA 3EAEA 3HHTB 1GBQA 3VRYA 2QHVA 2X35A 4C92F 1N9SA 2C0IA 2JM9A 3HXVA 3KFVA 3CMET 1ZUKA 4Z02A 3GLXA 1SPKA 4YRJA 1XQHA 1KQSP 1YJWQ 4HVWA 4QT7A 3NTKA 3A5YA 5LJ3g 2M0OA 2LCSA 1QE0A 4P71A 1KD1C 4ANJA 1BIAA 4M77E 1UE9A 3CCSA 4YP0A 4JS5A 4FYWB 2DPPB 3EFSA 1OX9A 1ZQ1A 4YRPA 3WQZA 4FYXB 2KT1A 4RG2A 4Y92A 1D09B 2F5KA 2F5TX 4M7AB 4J83A 2LVMA 4QKUA 4EMKA 1VQ5T 1OU9A 5DLOA 2DU5A 2COYA 4C0DB 2ARUA 2ZNIA 4ELYC 5GAOq 5IH2A 2QA4T 1GGMA 1G83A 3BFMA 2JTMA 3LGLA 1M27C 4P75A 2ZR2A 1M30A 5CQXA 1W2BP 5HK0A 1K9MU 4QQGA 3CCEQ 3I35A 4PJOA 4YYEA 2E6ZA 2DQ3A 3LW5E 3MEAA 3QJ6A 3SB2A 4J6XA 2DNUA 3GF5A 4C5HA 1FMKA 2HMAA 4Q5WA 2A08A 4M7DA 2EQJA 1K4US 4J5YA 5GMKi 3EG1A 1LYLA 1OPLA 3I55A 4PL6A 3CC2A 3HY1A 2DETA 2HZYA 2M02A 1LVKA 1XNIA 3SFMA 1Q82R 1KG1A 1OU8A
chains in the Genus database with same CATH topology
2PUOB 2M1HA 2DVEA 1HXDA 1B8AA 4BI4A 1EOVA 3HXYA 5A0DA 2XU8A 3JAME 4XQ3A 1I4K1 1BYMA 4M78G 4EMKB 3A8LB 4C0FA 3NEMA 2KDSA 4G84A 2ODRC 2E3CA 1EIYA 3FRNA 4KR3A 2CYZB 2E70A 1AHJB 5ELNA 2MWPA 2AKWA 4CS3A 2PUKB 4JRKA 5FU7B 1UGRB 2EQUA 2ZIMA 2JUFA 4YRIA 1B34A 4M78E 2D6FA 2K5FA 1N6AA 5GAMg 3MP6A 4YROA 3RKXA 5KE3A 4Y28E 1U8RA 3MF1A 2E5QA 1HK9A 1WJRA 5GANg 2XTIA 3R6OA 2PU9B 2LQ8A 5IT9E 4B9XA 4H2UA 4C92D 1VQOT 2NS6A 3E9IA 11ASA 3ZEHA 1Q82C 4YREA 3URGA 3QPHA 4UP7A 4ME7A 1WQWA 4XEOA 5GMKm 1UGSB 1KMNA 4C5EA 5J39A 5CKFA 1E1OA 2AKWB 2AHJB 3CBOA 4XAXB 2XIDA 3JB9J 3JCMJ 2LCLA 5GAOl 2GQVA 1NJ8A 2FL7A 3HP9A 1W2BS 3V8LA 3JCMV 2BUDA 4NCXA 1D3BB 2DXUA 2A7YA 3PMIA 4C92B 4J7IA 3M4YA 3I56T 2AMCB 2ZNJA 3VYGA 5GANf 2ZPGB 3VQYA 2MAMA 3GNFB 2QTXA 3QNEA 4XTVA 4WF2A 1UEBA 3G6ET 3GIBA 4M77B 3S3MA 5DY9A 5KCHA 5F5WA 1NJIU 5ELOA 5CO7A 4HKEA 3HXZA 4MDWA 3L2QA 3CCET 3C95A 3E9HA 4A53A 1WJSA 1Y07A 3Q1JA 2F69A 1USYC 12ASA 5M9OA 1YGBA 1G3WA 3PCOA 2IVWA 3FB9A 4TVAA 4XTUA 4OB1B 3N5BB 2C06A 3UDCA 4Y91A 2RHYA 1NJ1A 2RI5A 2ZR3A 2X4WA 3O8VA 5CQYA 2LX9A 1O9SA 3PIOA 3C94A 3BW1A 4EMHA 3PFSA 2O4XA 2L89A 4XU1A 3OW2A 4HCZA 3L2ZA 2GFAA 4E7IA 3LSQA 4ZN3A 4CI0C 2JTFA 3MEYA 3QSUA 3X25B 3RMSA 2QQ9A 2DQ0A 3A7RA 3S3NA 2JZ2A 1C0AA 3TEHA 1EFWA 4C5GA 2ZT5A 4M75F 3IG2A 2RM4A 2CGHA 3CCQT 3UWNA 1V29B 3MQZA 1NYRA 3CCUA 2M9UA 4M78B 5DM7R 4M7AC 4OF1A 3FC3A 1YITA 2RHQA 4C0DC 2ZT7A 3CCVT 3HRSA 1SETA 3L4GA 2PMEA 3G4ST 1M90U 2DK3A 2Q7HA 1M1KU 3A8HB 2DZ9A 2EKOA 2ZPIB 4OMFB 3M57A 3HSBA 4YTLA 4AH6A 4K88A 5EG2A 1VQ8A 2DTIA 3MCAB 2VC8A 4J7FA 3DLLA 3INZA 3NFCA 5GAN2 1L0WA 3M4GA 3CBPA 5D6XA 3CD6A 2B8AA 2DO3A 3CMAA 3TCJA 2LCCA 5J3BA 2EWNA 1QVFA 4EMKC 4MDXA 4PG3A 4IUQA 4BE2A 4CRIA 5HKCA 4BUGA 5HK3A 3HFNA 4KUDK 4HWRA 4P5NA 1NJ5A 2ZZGA 3M55A 3QKJA 3RUXA 5FU7C 1SRYA 1EVKA 3PTAA 3CXCS 4JJNK 2P0QA 1H4TA 1B70A 4TVRA 5LJ5h 4GLKA 3VV0A 3LH0A 3CCJA 2PVGB 3OW2S 2EJ9A 3VKIA 3R07A 2ZT8A 2KAFA 1VQ7A 4FL6A 2DEQA 1SSFA 3I55T 3CC2T 1Z7MA 2QHUA 3OYIA 1X2HA 2QQBA 3JB9I 4C0ZA 3JCMQ 3MF2A 4M75D 4J15A 2IY5B 1YFSA 2XK0A 4RCCA 3P8BB 3JB9H 4OGCA 2VUBA 3HRUA 1Y96B 1QVGA 2ALYA 1KD1U 5CAIA 3JCMf 4ZTFA 1Q81C 3CC7A 4WJ4A 1ZHIA 1HC7A 5LJ5j 2IG0A 4ZN1A 4IUUA 4JRIA 4JRQA 4CH5A 3QIIA 3JCMh 4UC4A 2WSEE 4M7AA 2RHXA 1M1FA 1N8RC 3QHSA 3NTHA 3KXTA 3HPWA 2E12A 4BW9A 2CZ7B 3OS1A 4KULA 4TWAA 4M77C 1NNHA 3KBGA 2XGTA 4HT4A 3OS0A 4RMFA 5CKHA 3OYLA 4KBMB 2I4NA 1KQSA 4XTZA 1I5LA 5LJ5d 1QVFS 2DU7A 2OTLA 3OYAA 1H4QA 3JCMX 3GNGA 4CH6A 5KNNA 1KC8U 1E22A 2RJEA 5D6WA 3G71A 3HKSA 2VGMA 2EIFA 3SD4A 4OB3B 3JCMc 3HXWA 1ASZA 1S72T 4BD3A 1VQ9A 2QEXA 3M58A 1B76A 1VQ6T 1G3YA 3NENA 2OTJA 1VQMA 1W2BA 5GAN7 3QZ5B 4XU0A 1TH7A 4QVCA 2KK4A 4Q6GA 4TVYA 5FRNA 1M8VA 3V8JA 2P5IA 5J26A 1H3ZA 4HT9A 5GMKj 3DSQA 4MMLA 3JCMb 2HD0A 3JCMd 1QVGS 1SERA 3UFGA 2L3RA 2QHSA 2BIVA 5LJ3f 3IALA 3HRIA 3NTIA 3E19A 5I2SA 3P8VA 4JLGA 4M78C 2YHTA 2I4LA 3P8HA 2R5MA 2LT1A 4H2XB 3F70A 3UH0A 4N4GA 3QTCA 3J7AF 2XDBA 3NELA 5LJ3h 2E6NA 5E3IA 4E7LA 4XK8E 1JJCB 3E1SA 1WGSA 4JRPA 1O75A 2K3YA 4J6WA 1RL2A 1NPPA 2G3RA 5GAOn 2C7IA 2DIGA 3IKLA 1XTDA 3M4QA 3MEVA 1D3BA 3V7RA 4C92A 2ARSA 2P0PA 2AMCA 1BI2A 2VYTA 3QO3A 3TEEA 1KQSS 3L1AA 4K87A 4L87A 1VQNA 1IL2A 1N27A 4HVCA 1X6OA 2K4YA 3JB9F 4YCVA 3CCUT 4TTVA 3M59A 2DIQA 3MEWA 4M77A 5FLXE 4OVAA 3OB9A 2Y4XA 1YITT 3TEGA 5LJ3j 4UP8A 1YI2A 2DZCA 2JN0A 1OZ2A 2VXFA 2CJBA 4N4IA 3WXMB 4ZTJA 5FU6B 2ARTA 2E41A 5LJ5e 3HXUA 1M5Q1 4N4HA 3OS2A 5KH6A 1BBWA 2MWOA 4YPFA 1VQ8T 3CBMA 3VBBA 2R58A 5GAMf 1FYFA 1EIFA 3PT9A 2FB7A 3OSSC 4N0AC 1G5VA 1G5HA 4EMGA 3X20B 3OYFA 4PNOA 4PLLA 2K5LA 5LJ3d 5GAMh 2DD4A 2ZZDA 3L2RA 3FJPA 3V7SA 3CMAT 5GANh 4C8QG 2ZXFA 1I81A 4DOVA 4DA4A 2EJGA 1B7YA 3QJYA 3FEOA 4OB2B 3ASKA 1YBYA 4C8QE 4CS4A 4HCBA 4BY6B 3JCMe 3CCJT 2HQEA 3FLGA 4C8QF 4M78A 4FT4A 1NE8A 3A5ZB 5HY6A 1YJNA 1VQ7T 2LT4A 4ZTZB 5GAMj 3CXCA 4M75G 2MMPA 4TQDA 3S3OA 1EVLA 5GANj 1W66A 3V7CA 1YIJT 1I8FA 3NETA 3QO5A 2DJZA 3RESA 3JB9D 1VUBA 2DXBA 4LNSA 2ZCFB 3HTZA 1YHQA 3RL6A 4QVZA 4GY5A 2ODRD 4M75E 2J3LA 5CKDA 1B7YB 2CJ9A 1X75C 2DXTA 3OD1A 2RB6A 1K8AU 3RKYA 2FYKA 2DTHA 3OYMA 3OYJA 4F7UG 3QYGB 5GAMd 1VQ4T 5CKBA 4YRGA 2DTOA 5L8RE 3GP8A 1M9SA 4MMKA 3OYBA 4LVJA 4VUBA 5GANd 3HFOA 1VQKA 3TU4K 4BE0A 1G3TA 1KHIA 3DKMA 2ZPBB 3GOXA 4F7UE 1WPYA 1W4SA 1Q86C 4IUTA 4O2DA 1VQZA 2X4XA 3OYGA 2D0QB 2L5QA 4F7UF 1N9RA 3RMQA 2CZ0B 2RHIA 1Q7YU 2CKKA 5I21A 3VU3C 4KR2A 2GCXA 4C0GA 2OTLT 2KMTA 5FROA 4B9WA 4N0AA 1LNXA 3HFZB 3OY9A 4RQEA 1UGQB 5C53B 3REXA 5DLQE 2JNGA 3ME9A 1YJWA 4NS5A 3CC4A 3QYHB 2V8IA 1LOJA 2R57A 3TUPA 4KQEA 3CCLA 4ZGEB 4MZMA 3CCST 2ZPHB 3G71T 4X9CA 2V8JA 3A7UA 2IY5A 1NJ2A 4M7AF 2D9TA 3HFVA 4EO4A 5LJ3e 3MEUA 2EAYA 2DDZA 3VUBA 4C8QD 1VQ9T 2ZZFA 4KUIA 2KVQG 2QEXT 4PKCC 5GMKl 4UPAA 1Y96A 2RHSB 1VQMT 1PSEA 2ZPEB 3FIFA 2DAQA 2QHTA 4QW2A 2LRQA 1JB0E 1WNLA 3RF1A 4UP9A 1N8RU 5A0LA 1IREB 1YFRA 4LD9K 5C6SA 4TQFA 4YRKA 1PYSB 1BI1A 2O01E 1WYDA 4H02A 2RD1A 2I4MA 1R8OB 2PVOB 3A8GB 4YRLA 2K5IA 3VUZA 3OBYA 4BI8B 4E7JA 1VIFA 1M90C 1X55A 3X28B 4PJOG 4XU3A 4A4FA 4P3NA 4C8QB 1K73C 4ZGDB 3WVEB 4YCUA 4M7DG 1BKBA 3CPWA 5GAN8 4CS2A 4RCBA 4ZTUB 4DQ2A 1WQ7A 2KQWA 4YRTA 3JCMW 2RK1A 4QQ6A 5GAOp 3J81E 2FVUA 5FU6C 4LVMA 3QO8A 1WLEA 4PJOE 2A8EA 1NPRA 1VQLA 3OMCA 4M7DE 1JRIA 4PJOF 1FX7A 3BDUA 5GAOm 3DB4A 4M7DF 4A4GA 2RH2A 1OYXA 4IUPA 4O6JA 4C92C 1ADYA 1VQPA 1UGPB 2QI2A 3OYDA 2ZPFB 3VJPA 3CCMA 3ERRA 4ZIBA 5GAMe 2KY9A 3OYYA 4M75B 1U1TA 3CCQA 4A4HA 2QQRA 1VQNT 5GANe 3LWHA 4H2YA 3LLRA 3LGFA 2YRVA 5KE2A 2Q5HA 1KHCA 1YI2T 4XTYA 4M7AD 3SWNB 3A74A 4P74C 5C0MA 5GAOr 4LDUA 3ZFJA 5GMKh 5A0GA 3RGLA 1VIEA 5CKEA 1KQ1A 2X4JA 4BY6C 3OBWA 4CH4A 3LSSA 2EFIA 4BWAA 2E64A 2GF7A 4H2XA 2HNIA 4OP0A 2P0KA 3ICAA 1H641 2CS7A 4X9DA 3MHXA 3A31A 3OYKA 3DB3A 3W3SA 2PMFA 3BY7A 3OYHA 4PHCA 4IURA 4YRFA 1JJCA 1BI3A 3X24B 3TREA 5GAN5 4M77F 3UGQA 2LQKA 1PSFA 4MZPA 4JDSA 3M9QA 4A4EA 2XD0A 2QDYB 3A8MB 4HA8A 3EFRA 4R56A 3CPWS 3QG1A 2P4TA 3CCRA 1Q82U 1YJ9A 3OS5A 3HRKA 2L8DA 1KMMA 4D6WA 2LTOA 5A2QE 3KFUA 4FT2A 1N9WA 4XTWA 4BB7A 4DOWA 2RO0A 1JBMA 3S6WA 2YLBA 2MI6A 4PJOD 1QW1A 3P8DA 1YJNT 4M7DD 4K86A 3LYIA 1ZBXA 3CEYA 3PMTA 5LL6S 1JJ2S 5CK9A 1KOGA 2CZ6B 3M4PA 4YCWA 2RHZA 4G85A 2RI2A 3QO7A 4OGEA 4BE1A 4P73A 1KC8C 2MF2A 4P72C 2J3MA 3QUIA 2XI9A 4JS4A 3JB9G 2ZIOA 2GFUA 2M16A 5GAN4 3HXXA 4P3OA 3BJUA 4QQDA 3L42A 4EDUA 1MHNA 3PGGA 4YDQA 4IUVA 2DKGA 3OMGA 4MZTA 1YHQT 3C12A 4NL3A 2Q5IA 3HY0A 3I7FA 4LDWA 3OA6A 5CCAA 4YRRA 2EQMA 4PJOB 4KT0E 5CR2A 1EQRA 4JLIA 4M7DB 4R55A 4M78F 4DPGA 3BDLA 1Z7NA 1K9MC 4YRMA 1QVPA 4OB0B 5CVIA 2V8KA 1HTTA 4BACA 1VQKT 2EQKA 2XKOC 3PZCA 4P74A 4ZGJB 2OAUA 2YLCA 3VQXA 1G5IA 4XEMA 1M1GA 3LX7A 3ZBDA 1Y71A 1IZ6A 2JOYA 2X4YA 1EIYB 4M77D 5FRMA 3A8OB 2E1HA 3OYCA 2QXFA 3CMEA 2RA2A 3A5ZA 1XOVA 1NYQA 2LC4A 2K2VA 3JSCA 2C8MA 1B34B 1YJWT 3CC4T 4A54A 1SESA 2WSCE 3CD6T 3CCLT 3QBYA 4C8QC 1X56A 3J80E 3M54A 1S72A 1VQ5A 2XDDA 3E9FA 1VQ6A 3UT1A 2FHDA 3UGTA 4V2SA 4LD6A 3M5AA 3OYNA 2QA4A 4X5OA 2CZ1B 4BI3A 3LC0A 2ZTGA 3GPLA 1RIQA 2ZT6A 2KSSA 3MP1A 3G1ZA 2BKDN 2RJFA 2CJAA 3JRZA 2VGNA 1QP3A 5I2MA 3VQVA 1NZ9A 4BDYA 1Q86U 1RI0A 2RI3A 4RKUE 4M75C 3AHUA 3L2VA 4H2SA 4ATOA 4HWPA 3E9GA 4P72A 2E5AA 4ELZC 2I2LA 4II1A 4J6YA 4M78D 5HGQA 4H2WA 1KQ2A 3JCMP 3SWNC 2ZCEA 5GMKe 3A7AA 3M56A 2ZINA 3P8YA 4RG8A 2XDPA 2E10A 2JVVA 3HFZA 1OI1A 1LJOA 3CC7T 1X2GA 2DD5A 4XTXA 1VQLT 4E7KA 2Y90A 4XU2A 3OQ5A 4JUVA 2K57A 3WVDB 4YRNA 1H4SA 1NJIC 1VQPT 2LNVA 1G3SA 3UPUA 3CCMT 4LDXA 1VQOA 4LVIA 4E47A 3REUA 2I4OA 3PCOB 4TVAB 5D6YA 2PQWA 4CH3A 2RHSA 2RJDA 2DXCA 3PNWC 2ZGWA 2XHCA 3H8ZA 3L2UA 2R5AA 3CPFA 1X01A 4M7AG 2P0LA 5LJ5g 3A32A 3MO8A 2VV5A 3QXEB 1YCYA 3META 2O4XB 3RIRA 3RACA 1ATIA 1PYSA 2LDMA 2PVDB 3G7ZA 1K73U 3SDZA 4HCCA 4J8OA 3HRTA 2WACA 4C5IA 3QDRB 1UB4A 2H3JA 4M7AE 4O5VA 3I56A 4C8QA 1YFTA 5GAN6 4YRQA 1WJQA 4RDXA 2WSFE 3TEHB 3FDRA 5C52B 4WI1A 1Q81U 4P71C 2OTJT 3G6EA 4YRSA 2CIMA 5K1PA 5CIUA 1MGQA 1K8AC 4NL2A 2HAXA 2RHQB 4EPCA 1YB3A 3CCEA 4L5GA 3RKWA 5LJ5f 3L4GB 4WJ3M 2EJFA 2A3LA 1NJ6A 4QVDA 3JCMg 4Q15A 1E24A 3IKMB 3CCRT 1YJ9T 4BDZA 1DJ7B 3CMQA 4P75C 1USYA 2Q7EA 4NOYA 3RERA 4M75A 3X26B 1E1TA 4PJOC 1U1SA 3L2WA 2HQXA 3M53A 2E65A 2VXEA 2G4CA 2EYQA 1QF6A 2XICA 1BBUA 2XG8D 1M1KC 4M7DC 1BIBA 1Y7XA 3QZ9B 1Q7YC 4L59A 3ER0A 4YRCA 3VYHB 4HWTA 3SWNA 1P92A 3C4SA 3HL8A 2RHUA 3KUFA 1GXIE 3PIPA 4P73C 1H4VB 4LDVA 3MP8A 1FWZA 2K3XA 3OYEA 1YIJA 1ASYA 4HWSA 4E51A 1QP2A 2QQAA 2Q7GA 4FIBA 1BI0A 4F7UA 1ADJA 5IAYA 4H2VA 3T9NA 1JJ2A 2EL9A 2RK2A 4FSXA 1FXXA 4L6V5 4LVLA 4X34A 1M4ZA 2Y4YA 1B70B 1G51A 4P3PA 4RMOA 5AYFA 3DLMA 4RQFA 3V8KA 4LDYA 1VQ4A 2RJCA 3OSVA 4FU6A 4FM4B 1J5WA 3VQWA 4PLIA 4C92G 5KCOA 3CCVA 4IKFA 2HBPA 4OLFA 3G4SA 5C51B 4E7HA 1OZ3A 2QQSA 4H2TA 2NLUA 4EX5A 1WU7A 3H6ZA 4A4KA 5GAN3 2ZZEA 4HT8A 4M77G 3LWIA 4F7UB 5IN1A 4C92E 4TVWA 2ALYB 5K1XA 1X54A 4HWOA 3P8TA 4LVKA 3EAEA 3HHTB 2QHVA 2X35A 4C92F 1N9SA 3HXVA 3CMET 4Z02A 3GLXA 4YRJA 1XQHA 3NTKA 3A5YA 5LJ3g 2M0OA 1QE0A 4P71A 1KD1C 1BIAA 4M77E 3CCSA 4YP0A 4JS5A 2DPPB 3EFSA 1ZQ1A 4YRPA 3WQZA 4RG2A 2F5KA 2F5TX 4M7AB 4J83A 2LVMA 4EMKA 1VQ5T 5DLOA 2DU5A 4C0DB 2ARUA 2ZNIA 4ELYC 5GAOq 2QA4T 1GGMA 3BFMA 2JTMA 3LGLA 4P75A 2ZR2A 5CQXA 1K9MU 5HK0A 4QQGA 4PJOA 4YYEA 2E6ZA 2DQ3A 3LW5E 3MEAA 3QJ6A 3SB2A 4J6XA 3GF5A 4C5HA 4Q5WA 4M7DA 2EQJA 4J5YA 5GMKi 1LYLA 3I55A 4PL6A 3CC2A 3HY1A 1KG1A 3SFMA 1XNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVE A;  4JRI A;  5I21 A;  1HXD A;  3VU3 C;  4KR2 A;  1B8A A;  1EOV A;  3HXY A;  4CH5 A;  4X5O A;  3JCM h;  4XQ3 A;  3LC0 A;  1I4K 1;  4N0A A;  4M7A A;  1LNX A;  3HFZ B;  4RQE A;  4M78 G;  5C53 B;  4EMK B;  3REX A;  2ZTG A;  3NEM A;  1RIQ A;  3QHS A;  2ZT6 A;  4G84 A;  2ODR C;  1LOJ A;  2E3C A;  1EIY A;  3G1Z A;  4KR3 A;  3TUP A;  4KQE A;  5ELN A;  4CS3 A;  2AKW A;  4BW9 A;  4JRK A;  4X9C A;  4TWA A;  3A7U A;  2IY5 A;  1NJ2 A;  4M77 C;  4M7A F;  3HFV A;  2CJA A;  4EO4 A;  1NNH A;  5LJ3 e;  3VQV A;  2XGT A;  2EAY A;  2DDZ A;  2ZIM A;  4RMF A;  4M75 C;  1B34 A;  4C8Q D;  4YRI A;  2ZZF A;  4M78 E;  2I4N A;  3AHU A;  1I5L A;  4XTZ A;  5GMK l;  5GAM g;  4UPA A;  1Y96 A;  5LJ5 d;  3RKX A;  2RHS B;  4H2S A;  4YRO A;  2DU7 A;  3MF1 A;  3FIF A;  1HK9 A;  2QHT A;  4HWP A;  4P72 A;  5GAN g;  2XTI A;  1H4Q A;  3JCM X;  2E5A A;  2I2L A;  4CH6 A;  5KNN A;  1E22 A;  1WNL A;  4H2U A;  4J6Y A;  4M78 D;  4C92 D;  5HGQ A;  3RF1 A;  4UP9 A;  4H2W A;  1KQ2 A;  1YFR A;  3E9I A;  3JCM P;  11AS A;  3SWN C;  2ZCE A;  4YRE A;  4TQF A;  5GMK e;  4YRK A;  3A7A A;  4UP7 A;  1PYS B;  1WYD A;  2ZIN A;  4H02 A;  1WQW A;  3P8Y A;  2RD1 A;  3JCM c;  2I4M A;  2E10 A;  5GMK m;  3HXW A;  4XEO A;  3HFZ A;  1ASZ A;  4YRL A;  1LJO A;  1X2G A;  1B76 A;  4XTX A;  1KMN A;  3NEN A;  1X55 A;  1E1O A;  2Y90 A;  4XU2 A;  2AKW B;  4PJO G;  4JUV A;  4XU3 A;  4P3N A;  5GAN 7;  4C8Q B;  2K57 A;  4YCU A;  3JB9 J;  4YRN A;  1H4S A;  3JCM J;  4M7D G;  5GAO l;  4XU0 A;  1TH7 A;  1NJ8 A;  5GAN 8;  4CS2 A;  4RCB A;  4ZTU B;  3V8L A;  4DQ2 A;  1WQ7 A;  4QVC A;  2I4O A;  3PCO B;  4YRT A;  4TVA B;  3REU A;  3JCM V;  3JCM W;  4Q6G A;  4TVY A;  4CH3 A;  2RHS A;  1M8V A;  3V8J A;  4NCX A;  5GAO p;  1D3B B;  2P5I A;  2DXU A;  4C92 B;  4HT9 A;  5GMK j;  2ZGW A;  4MML A;  3DSQ A;  3JCM b;  2AMC B;  3QO8 A;  1WLE A;  4PJO E;  3JCM d;  2ZNJ A;  5GAN f;  3VQY A;  1SER A;  1X01 A;  4M7A G;  3UFG A;  2P0L A;  4M7D E;  5LJ5 g;  2QHS A;  1JRI A;  4PJO F;  3A32 A;  2QTX A;  3BDU A;  5GAO m;  5LJ3 f;  3IAL A;  3QNE A;  4XTV A;  3HRI A;  1YCY A;  4WF2 A;  3RIR A;  4M7D F;  3RAC A;  3GIB A;  1ATI A;  3P8V A;  4M78 C;  1PYS A;  2YHT A;  4C92 C;  1ADY A;  2I4L A;  4H2X B;  4M77 B;  5DY9 A;  5F5W A;  3UH0 A;  3ERR A;  3QTC A;  4ZIB A;  5ELO A;  5GAM e;  4M75 B;  1U1T A;  3NEL A;  5LJ3 h;  3HXZ A;  5E3I A;  4M7A E;  5GAN e;  4H2Y A;  3E9H A;  4A53 A;  1JJC B;  4C8Q A;  1YFT A;  5GAN 6;  4YRQ A;  4J6W A;  4RDX A;  1USY C;  3TEH B;  12AS A;  5C52 B;  2Q5H A;  4WI1 A;  1YGB A;  5GAO n;  2C7I A;  4P71 C;  3PCO A;  3FB9 A;  4TVA A;  4XTY A;  3IKL A;  4XTU A;  4M7A D;  3SWN B;  3M4Q A;  3A74 A;  4Y91 A;  4P74 C;  4YRS A;  2CIM A;  5K1P A;  1D3B A;  3V7R A;  5GAO r;  1NJ1 A;  1MGQ A;  4C92 A;  2ARS A;  2AMC A;  5GMK h;  4NL2 A;  3QO3 A;  2ZR3 A;  3RGL A;  3L1A A;  2RHQ B;  1KQ1 A;  4K87 A;  1YB3 A;  4L87 A;  3RKW A;  5LJ5 f;  3L4G B;  4WJ3 M;  4CH4 A;  3BW1 A;  4EMH A;  2EJF A;  3LSS A;  1IL2 A;  1NJ6 A;  4BWA A;  4HVC A;  4QVD A;  3JCM g;  3JB9 F;  2E64 A;  4YCV A;  4XU1 A;  4Q15 A;  1E24 A;  4TTV A;  4H2X A;  4M77 A;  3IKM B;  2HNI A;  4OP0 A;  3CMQ A;  3ICA A;  4P75 C;  3L2Z A;  1USY A;  1H64 1;  4NOY A;  2Q7E A;  3TEG A;  5LJ3 j;  4X9D A;  4UP8 A;  3RER A;  3A31 A;  4M75 A;  3LSQ A;  1E1T A;  4PJO C;  1U1S A;  3W3S A;  2PMF A;  2DZC A;  2E65 A;  2JN0 A;  3BY7 A;  2VXE A;  2G4C A;  4PHC A;  1QF6 A;  2VXF A;  1BBU A;  3QSU A;  2CJB A;  3MEY A;  4M7D C;  1BIB A;  3A7R A;  2DQ0 A;  4YRF A;  1JJC A;  5GAN 5;  2ART A;  4M77 F;  2E41 A;  3UGQ A;  5LJ5 e;  3HXU A;  1C0A A;  3TEH A;  1EFW A;  1M5Q 1;  2ZT5 A;  4M75 F;  3IG2 A;  4YRC A;  1BBW A;  2RM4 A;  2CGH A;  4HWT A;  4YPF A;  4HA8 A;  3VBB A;  3EFR A;  3SWN A;  5GAM f;  1NYR A;  4P73 C;  1FYF A;  4M78 B;  2FB7 A;  1H4V B;  4N0A C;  4M7A C;  1ASY A;  1G5H A;  4EMG A;  4HWS A;  4E51 A;  3HRK A;  4PNO A;  1KMM A;  2Q7G A;  2RHQ A;  4F7U A;  1ADJ A;  3KFU A;  2ZT7 A;  1N9W A;  4XTW A;  1SET A;  3L4G A;  2PME A;  4H2V A;  5LJ3 d;  5GAM h;  1JBM A;  3FJP A;  2YLB A;  2EL9 A;  3V7S A;  2Q7H A;  4PJO D;  5GAN h;  2DZ9 A;  4C8Q G;  2ZXF A;  4M7D D;  4K86 A;  3HSB A;  4AH6 A;  1B70 B;  1G51 A;  4K88 A;  1I81 A;  4P3P A;  1KOG A;  2DTI A;  4RQF A;  3M4P A;  3V8K A;  4YCW A;  4G85 A;  3QO7 A;  2VC8 A;  4P73 A;  4P72 C;  2J3M A;  3INZ A;  2EJG A;  3QUI A;  1B7Y A;  1J5W A;  3VQW A;  3JB9 G;  2ZIO A;  5GAN 2;  4C92 G;  5GAN 4;  1L0W A;  3HXX A;  4C8Q E;  4CS4 A;  3JCM e;  4OLF A;  3M4G A;  3BJU A;  4P3O A;  5C51 B;  3PGG A;  4YDQ A;  4H2T A;  4EX5 A;  1WU7 A;  2DKG A;  4C8Q F;  4M78 A;  2EWN A;  4NL3 A;  5GAN 3;  2Q5I A;  3HY0 A;  4EMK C;  4PG3 A;  2ZZE A;  3I7F A;  4HT8 A;  4M77 G;  4F7U B;  4YRR A;  4PJO B;  4C92 E;  4TVW A;  4ZTZ B;  5GAM j;  1EQR A;  2ALY B;  4JLI A;  4M75 G;  1X54 A;  5K1X A;  4HWO A;  3P8T A;  4TQD A;  4M7D B;  3HFN A;  4HWR A;  4M78 F;  1EVL A;  1NJ5 A;  2QHV A;  4C92 F;  1N9S A;  5GAN j;  2ZZG A;  3HXV A;  4DPG A;  3RUX A;  1Z7N A;  1W66 A;  3V7C A;  1SRY A;  4YRM A;  1I8F A;  1EVK A;  4YRJ A;  3NET A;  3QO5 A;  2DJZ A;  3A5Y A;  3RES A;  3JB9 D;  5LJ3 g;  1H4T A;  1B70 A;  1HTT A;  5LJ5 h;  1QE0 A;  4P71 A;  4LNS A;  1BIA A;  4M77 E;  4YP0 A;  2EJ9 A;  3HTZ A;  3PZC A;  3EFS A;  4P74 A;  3R07 A;  4YRP A;  3RL6 A;  3WQZ A;  2ODR D;  2ZT8 A;  4M75 E;  2YLC A;  2J3L A;  3VQX A;  4M7A B;  1B7Y B;  1G5I A;  4XEM A;  2CJ9 A;  4EMK A;  2DXT A;  3OD1 A;  2RB6 A;  2DU5 A;  2DEQ A;  3RKY A;  2FYK A;  2DTH A;  1Z7M A;  2QHU A;  2ARU A;  2ZNI A;  1EIY B;  4M77 D;  1X2H A;  4F7U G;  5GAO q;  3JB9 I;  2E1H A;  1GGM A;  3BFM A;  5GAM d;  3JCM Q;  3MF2 A;  4M75 D;  4J15 A;  4YRG A;  2IY5 B;  2RA2 A;  1YFS A;  3A5Z A;  2DTO A;  1NYQ A;  4MMK A;  4RCC A;  3JB9 H;  4P75 A;  2ZR2 A;  5GAN d;  2C8M A;  1B34 B;  3HFO A;  4PJO A;  4YYE A;  4A54 A;  1SES A;  2DQ3 A;  1Y96 B;  3SB2 A;  4J6X A;  2ALY A;  4M7D A;  4C8Q C;  5CAI A;  1X56 A;  4F7U E;  4J5Y A;  5GMK i;  1WPY A;  3JCM f;  4O2D A;  1LYL A;  1VQZ A;  4WJ4 A;  1HC7 A;  3HY1 A;  4F7U F;  5LJ5 j;  1N9R A;  3UGT A;  4V2S A; 
#chains in the Genus database with same CATH topology
 2PUO B;  2M1H A;  2DVE A;  1QWF A;  1HXD A;  2IPO B;  1B8A A;  4BI4 A;  1EOV A;  3HXY A;  5A0D A;  1TOV A;  2XU8 A;  2EVR A;  3JAM E;  4XQ3 A;  1I4K 1;  3RDV A;  1BYM A;  4M78 G;  1PHT A;  2KYM A;  3A8L B;  4EMK B;  1RAG B;  4C0F A;  4DBQ A;  3NEM A;  2KDS A;  4G84 A;  4D8D A;  2ODR C;  2E3C A;  1EIY A;  3FRN A;  4KR3 A;  2CYZ B;  2E70 A;  1AHJ B;  2CP2 A;  5ELN A;  2MWP A;  2AKW A;  4CS3 A;  2PUK B;  4JRK A;  2L3Q A;  5FU7 B;  1HYO A;  1UGR B;  2JTE A;  1VQL Q;  2EQU A;  2ZIM A;  2JUF A;  2ROT A;  4YRI A;  1B34 A;  4M78 E;  2D6F A;  2K5F A;  1N6A A;  3H41 A;  5GAM g;  3MP6 A;  4YRO A;  1C6V X;  3RKX A;  5KE3 A;  1SRM A;  4Y28 E;  1U8R A;  3MF1 A;  2E5Q A;  1HK9 A;  1WJR A;  5GAN g;  2XTI A;  3R6O A;  1WIE A;  4AG1 C;  2PU9 B;  2LQ8 A;  2HDA A;  5IT9 E;  4B9X A;  4H2U A;  2F2W A;  4C92 D;  3CCQ Q;  1VQO T;  2NS6 A;  4HVV A;  3E9I A;  11AS A;  1D0Z A;  3ZEH A;  1Q82 C;  4YRE A;  1AWJ A;  3URG A;  4AFZ C;  1E6G A;  3QPH A;  4RTV A;  3EGU A;  4UP7 A;  1AOJ A;  4ME7 A;  2ROL A;  4LE9 A;  1TSF A;  1WQW A;  4XEO A;  5GMK m;  2KGT A;  1UGS B;  3CCV Q;  1SEM A;  2EYW A;  1KMN A;  4C5E A;  5J39 A;  5CKF A;  3G4S Q;  1BCM A;  2RPN A;  1K1Z A;  1E1O A;  2AKW B;  2CP5 A;  3M0Q A;  2AHJ B;  3CBO A;  2GNC A;  4XAX B;  2XID A;  3JB9 J;  3JCM J;  1WXB A;  2LCL A;  2QGG A;  5GAO l;  2GQV A;  1NJ8 A;  2FL7 A;  3HP9 A;  1W2B S;  3V8L A;  3JCM V;  2BUD A;  2CDT A;  4NCX A;  1BCO A;  1D3B B;  2DXU A;  2ABL A;  2A7Y A;  3PMI A;  4C92 B;  4J7I A;  3M4Y A;  3I56 T;  2AMC B;  4J9D A;  2ZNJ A;  3VYG A;  5GAN f;  2ZPG B;  3VQY A;  2MAM A;  1OX8 A;  3GNF B;  1TS9 A;  3UA7 A;  2QTX A;  3QNE A;  4XTV A;  4FW2 A;  2GTO A;  1KSW A;  4WF2 A;  1UEB A;  3G6E T;  3GIB A;  4ORZ A;  2J6F A;  1M3A A;  4M77 B;  3S3M A;  5DY9 A;  1CKA A;  5KCH A;  5F5W A;  4DBR A;  1NJI U;  5ELO A;  5CO7 A;  4HKE A;  3HXZ A;  1M2V A;  4MDW A;  3L2Q A;  3CCE T;  1ABQ A;  1BU1 A;  2ED1 A;  3C95 A;  3E9H A;  4A53 A;  1WJS A;  1YJ9 Q;  1Y07 A;  3Q1J A;  2K3B A;  1B7T A;  2F69 A;  1USY C;  12AS A;  5M9O A;  2P4R A;  4CC7 A;  1YGB A;  3EG2 A;  1G3W A;  3PCO A;  2KYB A;  2IVW A;  3FB9 A;  4TVA A;  4XTU A;  4OB1 B;  3N5B B;  4RUG A;  2C06 A;  3UDC A;  4Y91 A;  2RHY A;  1NJ1 A;  2RI5 A;  1WHJ A;  2ZR3 A;  2X4W A;  3O8V A;  5CQY A;  3CC2 Q;  3EGD A;  2LX9 A;  1O9S A;  1MMG A;  3PIO A;  3C94 A;  3BW1 A;  4EMH A;  1ZX6 A;  3PFS A;  1Q86 R;  1VA7 A;  2E3I A;  2O4X A;  1HSQ A;  2FG0 A;  2CH4 W;  2L89 A;  2BTT A;  4XU1 A;  3OW2 A;  3EFO B;  4HCZ A;  4CC4 B;  3L2Z A;  2AKL A;  3CXC P;  2GFA A;  4E7I A;  3VS0 A;  3LSQ A;  1NG2 A;  4ZN3 A;  4CI0 C;  3UAT A;  2JTF A;  3MEY A;  3QSU A;  2KT8 A;  1WDX A;  2X9H A;  3X25 B;  3RMS A;  1OV3 A;  2QQ9 A;  2DQ0 A;  3A7R A;  1UHC A;  3S3N A;  5I11 A;  2JZ2 A;  2O9S A;  2MPX C;  1C0A A;  1MNE A;  2H3E B;  3TEH A;  1EFW A;  4C5G A;  2ZT5 A;  4M75 F;  3IG2 A;  1H92 A;  2RM4 A;  2CGH A;  2C0O A;  3CCQ T;  3UWN A;  1V29 B;  3MQZ A;  5IXB A;  3CCU A;  1NYR A;  2C0T A;  4LNP A;  4M78 B;  2M9U A;  4Z89 A;  5DM7 R;  1TWB A;  3U23 A;  4M7A C;  1RI9 A;  4OF1 A;  1GRI A;  4J9F A;  3FC3 A;  1YIT A;  4PJJ A;  2RHQ A;  4C0D C;  3EG3 A;  2ZT7 A;  3CCV T;  4JPB W;  3HRS A;  1SET A;  3L4G A;  2PME A;  3G4S T;  2VB6 A;  1M90 U;  2DK3 A;  2EKH A;  2Q7H A;  4KGV B;  1M1K U;  3A8H B;  1T0H A;  2DZ9 A;  2EKO A;  2ZPI B;  4OMF B;  5KYU A;  1WXT A;  3M57 A;  3HSB A;  1JXO A;  4YTL A;  4AH6 A;  4K88 A;  5EG2 A;  1AZG B;  1VQ8 A;  2DTI A;  3MCA B;  2VC8 A;  4J7F A;  2DMO A;  3CME Q;  3DLL A;  3INZ A;  1VYT A;  3NFC A;  4J9C A;  5GAN 2;  1WLP B;  1L0W A;  5IHI A;  1K73 R;  3M4G A;  2J05 A;  3CBP A;  5D6X A;  3CD6 A;  1C0M A;  5IHK A;  2B8A A;  2DO3 A;  5J3B A;  2YT6 A;  2LCC A;  3TCJ A;  3CMA A;  2G6F X;  2EWN A;  1S72 Q;  1QVF A;  1VQ5 Q;  4JJD A;  4EMK C;  4MDX A;  4PG3 A;  4IUQ A;  1VQ6 Q;  2DF6 A;  4BE2 A;  5KYX A;  4CRI A;  2LMJ A;  5HKC A;  2HL5 C;  4BUG A;  2CP7 A;  5HK3 A;  2DYB A;  2EQI A;  3HFN A;  4KUD K;  4HWR A;  4P5N A;  1NJ5 A;  4PK4 A;  2ZZG A;  3M55 A;  3QKJ A;  3RUX A;  5FU7 C;  1NM7 A;  2D1X A;  1SRY A;  1EVK A;  3PTA A;  3CXC S;  4JJN K;  2P0Q A;  1H4T A;  1ZSZ B;  4TVR A;  1B70 A;  5LJ5 h;  4GLK A;  3VV0 A;  3LH0 A;  3CCJ A;  2PVG B;  1PKS A;  2KR3 A;  3OW2 S;  1GCP A;  2EJ9 A;  3D7S B;  3VKI A;  2QAZ A;  2K7A A;  3R07 A;  2LZ6 B;  2YRD A;  2ZT8 A;  1FMV A;  3H0H A;  2KAF A;  1VQ7 A;  4RTU A;  4FL6 A;  2DEQ A;  1SSF A;  3I55 T;  3CC2 T;  1Z7M A;  2QHU A;  3OYI A;  1E7O A;  2EW3 A;  1X2H A;  2QQB A;  3JB9 I;  2LJ1 A;  4C0Z A;  3JCM Q;  3MF2 A;  4M75 D;  4J15 A;  2IY5 B;  1YFS A;  2CSQ A;  2XK0 A;  4RCC A;  3P8B B;  3JB9 H;  4OGC A;  4LUE A;  2VUB A;  3HRU A;  1Y96 B;  2DJQ A;  1HD3 A;  4OMP A;  1QVG A;  2ALY A;  1MMN A;  1KD1 U;  2EBP A;  5CAI A;  1EX4 A;  3JCM f;  4ZTF A;  1RAE B;  1Q81 C;  1PG5 B;  2COZ A;  1SHF A;  3CC7 A;  1NYF A;  4WJ4 A;  4PJN A;  1ZHI A;  1HC7 A;  1QVG P;  5LJ5 j;  1B07 A;  3H9N A;  2IG0 A;  4ZN1 A;  3QDF A;  4IUU A;  4JRI A;  2EYZ A;  1M8M A;  4JRQ A;  4CH5 A;  1Y0M A;  2LX7 A;  3O5Z A;  3QII A;  3JCM h;  4UC4 A;  1MMD A;  2WSE E;  4M7A A;  2RHX A;  1M1F A;  1N8R C;  1BBZ A;  2J06 A;  1X27 A;  3QHS A;  3NTH A;  5L23 A;  3KXT A;  3HPW A;  1D0X A;  4X1V A;  3CCU Q;  2E12 A;  4AG2 C;  3UA6 A;  4BW9 A;  2CZ7 B;  3OS1 A;  4KUL A;  4TWA A;  2JS0 A;  2LP5 A;  4M77 C;  2CUB A;  1YN8 A;  3ZL7 C;  1YIT Q;  2NUP B;  1NNH A;  3KBG A;  2XGT A;  1RAC B;  4AFU C;  4HT4 A;  3OS0 A;  4RMF A;  5CKH A;  1NLP C;  3OYL A;  1ABO A;  4KBM B;  4J9B A;  2I4N A;  1KQS A;  4XTZ A;  1I5L A;  5LJ5 d;  3THK A;  1QVF S;  2DU7 A;  2OTL A;  3OYA A;  1I5O B;  1H4Q A;  3JCM X;  2MIO A;  3GNG A;  4CH6 A;  5KNN A;  1KC8 U;  1E22 A;  1JU5 C;  2RJE A;  4RTW A;  1VQ8 Q;  1MUZ A;  2JMC A;  2QYZ A;  5D6W A;  4OMQ A;  3G71 A;  2RMO A;  3I56 Q;  3HKS A;  2VGM A;  2EIF A;  3SD4 A;  4OB3 B;  3JCM c;  1NYG A;  3HXW A;  2J6O A;  1ASZ A;  1S72 T;  4BD3 A;  1VQ9 A;  1UEC A;  2QEX A;  3M58 A;  1B76 A;  1VQ6 T;  1G3Y A;  3NEN A;  2OTJ A;  1VQM A;  1SSH A;  1VYV A;  1KC8 R;  3G6E Q;  1ZSG A;  3LH5 A;  1W2B A;  3CMA Q;  5GAN 7;  2RQW A;  1WHL A;  3QZ5 B;  4XU0 A;  1TH7 A;  2FZC B;  2AK5 A;  2DRM A;  2K6D A;  2Z0W A;  2RN8 A;  4QVC A;  2KK4 A;  4Q6G A;  4TVY A;  2A36 A;  1W1F A;  5FRN A;  1E6H A;  1M8V A;  3V8J A;  2P5I A;  1X2K A;  5J26 A;  2ENM A;  1H3Z A;  1TUG B;  4HT9 A;  4J9E A;  5GMK j;  3DSQ A;  4MML A;  3JCM b;  2HD0 A;  3JCM d;  4FSS A;  4Z88 A;  1QVG S;  1SER A;  3UFG A;  5I22 A;  2DM1 A;  3CCJ Q;  1T3S A;  2L3R A;  2QHS A;  2BIV A;  2I0N A;  4JZ3 A;  5LJ3 f;  3IAL A;  2CP0 A;  4KH0 B;  2KXC A;  3NTI A;  3HRI A;  1VYU A;  2RQU A;  1K9M R;  3E19 A;  5I2S A;  2QTV A;  3P8V A;  4JLG A;  1YWO A;  4M78 C;  3NGP A;  2YHT A;  2I4L A;  3P8H A;  2R5M A;  2LT1 A;  3EG0 A;  4H2X B;  2EPD A;  3F70 A;  3UH0 A;  4N4G A;  2KRO A;  3QTC A;  3J7A F;  2XDB A;  3NEL A;  5LJ3 h;  1V1C A;  2A28 A;  2E6N A;  4ZNX A;  5E3I A;  2KRM A;  1PCX A;  1WHK A;  4E7L A;  4XK8 E;  1WA7 A;  1X69 A;  1JJC B;  3E1S A;  1WGS A;  4JRP A;  3EH2 A;  1O75 A;  1YIJ Q;  2DBM A;  4KRT A;  4E7Z A;  2LQN A;  2K3Y A;  4J6W A;  1OEB A;  1RL2 A;  1NPP A;  4J9I A;  3VS7 A;  2QAS A;  1M2O A;  2G3R A;  5GAO n;  2C7I A;  2DIG A;  3IKL A;  1XTD A;  2CP3 A;  3VS5 A;  3M4Q A;  3MEV A;  1D3B A;  1AZE A;  3V7R A;  4C92 A;  2ARS A;  2P0P A;  2AMC A;  2VKN A;  1BI2 A;  2RQT A;  2VYT A;  3QO3 A;  3TEE A;  1KQS S;  1W70 A;  3L1A A;  1IGU A;  4K87 A;  4L87 A;  4CC3 A;  3VS1 A;  1VQN A;  1UJY A;  1VQ4 Q;  1IL2 A;  1N27 A;  4HVC A;  1X6O A;  2K4Y A;  1UTI A;  3JB9 F;  4YCV A;  3M0R A;  1I07 A;  2JXB A;  3CCU T;  4TTV A;  2L3S A;  2VAS A;  2DYI A;  2DIQ A;  3M59 A;  3MEW A;  4M77 A;  5FLX E;  4GBQ A;  4OVA A;  3OB9 A;  2Y4X A;  1YIT T;  3TEG A;  3QWX X;  4RTT A;  5LJ3 j;  4UP8 A;  1YI2 A;  2MOX A;  1I1J A;  2HSE B;  2DZC A;  2JN0 A;  1FYN A;  4HCK A;  1OZ2 A;  2VXF A;  2CJB A;  1OOT A;  4N4I A;  3WXM B;  4ZTJ A;  5FU6 B;  2ART A;  2E41 A;  2EYX A;  5LJ5 e;  1U06 A;  3HXU A;  4LUD A;  1M5Q 1;  4N4H A;  1ZSZ C;  2FZK B;  3OS2 A;  1IGQ A;  5KH6 A;  1BBW A;  2MWO A;  4YPF A;  1VQ8 T;  3CBM A;  3VBB A;  2R58 A;  2NYS A;  5GAM f;  1FYF A;  1EIF A;  1PC0 A;  4JJB A;  3PT9 A;  2FB7 A;  1WHH A;  3OSS C;  2DL7 A;  4N0A C;  5HCK A;  1KJW A;  1G5V A;  4EMG A;  1G5H A;  3X20 B;  3OYF A;  4PNO A;  3TQ7 P;  4PLL A;  2K5L A;  2EGE A;  1TXQ A;  2NUZ A;  4J9H A;  2K9G A;  2OAW A;  3CCS Q;  5LJ3 d;  5GAM h;  3G71 Q;  2DD4 A;  2ZZD A;  3L2R A;  2VVK A;  3FJP A;  3V7S A;  3CMA T;  3EFO A;  5GAN h;  4C8Q G;  2ZXF A;  1PWT A;  1VQ9 Q;  2DX1 A;  2QEX Q;  1I81 A;  2V1R A;  2FPD A;  3I9Q A;  2LJ3 A;  4DOV A;  4KGX B;  4DA4 A;  3MKD A;  2EJG A;  3VS2 A;  1B7Y A;  3QJY A;  3FEO A;  4OB2 B;  3ASK A;  1YBY A;  1T3L A;  2YUP A;  4C8Q E;  4CS4 A;  4HCB A;  1PNJ A;  4BY6 B;  3JCM e;  3CCJ T;  1UUE A;  1NJI R;  1IHW A;  1AWW A;  2HQE A;  3FLG A;  4C8Q F;  4M78 A;  4IIO A;  4FT4 A;  1NE8 A;  3A5Z B;  2X3X D;  5HY6 A;  1YJN A;  3I55 Q;  2IIM A;  1VQ7 T;  1G8X A;  2LT4 A;  1RLQ C;  1OUL A;  4ZTZ B;  5GAM j;  3CXC A;  4M75 G;  1WFW A;  2MMP A;  2E4H A;  4TQD A;  3MJX A;  2KE9 A;  3S3O A;  1EVL A;  5GAN j;  1W66 A;  3V7C A;  4RTZ A;  4B6M A;  1YIJ T;  1Z9Z A;  1I8F A;  2LNH B;  2OJ2 A;  3NET A;  3QO5 A;  2DJZ A;  3RES A;  3JB9 D;  1VUB A;  2DXB A;  4LNS A;  5IXF A;  2ZCF B;  3HTZ A;  2HCK A;  1YHQ A;  3RL6 A;  4QVZ A;  4GY5 A;  2ODR D;  4M75 E;  2J3L A;  5CKD A;  1B7Y B;  2CJ9 A;  1X75 C;  2DXT A;  3OD1 A;  2FRW A;  2RB6 A;  1K8A U;  2V26 A;  1Z9Q A;  2BZ8 A;  1C1A A;  3RKY A;  2FYK A;  2DTH A;  3OYM A;  1D0Y A;  3OYJ A;  3C0C A;  3VS6 A;  2L2P A;  1QCO A;  4F7U G;  5KYW A;  3QYG B;  5GAM d;  1VQ4 T;  5CKB A;  4YRG A;  2DTO A;  5L8R E;  3GP8 A;  2DEU A;  1M9S A;  4MMK A;  3OYB A;  4LVJ A;  4VUB A;  5GAN d;  2QG9 B;  3NPF A;  3RR6 A;  5D7U A;  3HFO A;  1VQK A;  3TU4 K;  4BE0 A;  1G3T A;  1KHI A;  3DKM A;  1AWX A;  1RAD B;  1J3T A;  2ZPB B;  3GOX A;  4F7U E;  1WPY A;  1D1A A;  1W4S A;  1Q86 C;  2NWM A;  4IUT A;  4O2D A;  1YCS B;  1VQZ A;  2X4X A;  3OYG A;  2D0Q B;  1K0X A;  2L5Q A;  4F7U F;  1IO6 A;  1N9R A;  3RMQ A;  1YI2 Q;  2CZ0 B;  2YDL A;  1ZSZ A;  2RHI A;  4Z8A A;  1Q7Y U;  2CKK A;  5I21 A;  3VU3 C;  4KR2 A;  3M0U A;  1RAB B;  4RTX A;  2GCX A;  2AIR B;  4C0G A;  4WCI A;  2O31 A;  1NBE B;  2KMT A;  2X51 A;  1RAH B;  5FRO A;  2OTL T;  4B9W A;  2MCN A;  4N0A A;  1LNX A;  3HFZ B;  3OY9 A;  4RQE A;  1UGQ B;  1K9A A;  5C53 B;  1M90 R;  3REX A;  2YUN A;  5DLQ E;  2JNG A;  5FW9 A;  3ME9 A;  1YJW A;  4NS5 A;  3CC4 A;  3QYH B;  2V8I A;  1M1K R;  1LOJ A;  2R57 A;  5KYW B;  3TUP A;  4KQE A;  3CCL A;  4ZGE B;  3A98 A;  4MZM A;  3CCS T;  2ZPH B;  3G71 T;  1X6G A;  4X9C A;  2V8J A;  3A7U A;  2IY5 A;  1NJ2 A;  4M7A F;  2D9T A;  3HFV A;  4EO4 A;  2EGA A;  5LJ3 e;  2DL3 A;  3MEU A;  2EAY A;  2DDZ A;  3VUB A;  4C8Q D;  7AT1 B;  1VQ9 T;  1OPK A;  2ZZF A;  4KUI A;  2KVQ G;  2QEX T;  2BZX A;  4PKC C;  5GMK l;  4UPA A;  1Y96 A;  2RHS B;  1VQM T;  1PSE A;  2ZPE B;  1K76 A;  3FIF A;  2DAQ A;  2F2X A;  2QHT A;  4QW2 A;  6AT1 B;  2FEI A;  4LXC A;  2HSP A;  1KFZ A;  1CKB A;  2LRQ A;  1WHG A;  1JB0 E;  1WNL A;  4OMO A;  1MV3 A;  3EH1 A;  3RF1 A;  4UP9 A;  1N8R U;  1T0J A;  5A0L A;  1IRE B;  3REB B;  1S1N A;  1YFR A;  4LD9 K;  5C6S A;  4TQF A;  4YRK A;  1PYS B;  1QCF A;  1BI1 A;  2O01 E;  1WYD A;  4H02 A;  2RD1 A;  2I4M A;  1R8O B;  3VS3 A;  5FWC A;  2PVO B;  3A8G B;  4YRL A;  1UGV A;  2K5I A;  2LQW A;  3VUZ A;  3OBY A;  4BI8 B;  4E7J A;  1VIF A;  1M90 C;  1X55 A;  3PE0 A;  2PNI A;  2DRK A;  3X28 B;  4PJO G;  4XU3 A;  4A4F A;  4P3N A;  3TVT A;  1QQJ A;  4C8Q B;  4ZGD B;  3WVE B;  1K73 C;  4YCU A;  3SEM A;  1ZUU A;  4M7D G;  1RAI B;  3M0S A;  1BKB A;  2NUP A;  3CPW A;  5GAN 8;  4CS2 A;  2MK5 A;  4RCB A;  4ZTU B;  4DQ2 A;  1WQ7 A;  2KQW A;  4YRT A;  4WTO B;  3JCM W;  2RK1 A;  4QQ6 A;  5GAO p;  4LN2 A;  3CPW P;  3J81 E;  2FVU A;  5FU6 C;  4LVM A;  3QO8 A;  1WLE A;  4PJO E;  2A8E A;  1NPR A;  1VQL A;  3OMC A;  4M7D E;  1JRI A;  2QGF B;  4PJO F;  1FX7 A;  3BDU A;  5GAO m;  2RF0 A;  2J7I A;  4F16 A;  3DB4 A;  1CSK A;  1XJW B;  1JXM A;  1QCN A;  5ECA A;  4A4G A;  4M7D F;  2RH2 A;  1OYX A;  4IUP A;  3VRZ A;  4O6J A;  2A37 A;  4C92 C;  1ADY A;  1VQP A;  1UGP B;  2QI2 A;  4HXJ A;  3OYD A;  2ZPF B;  3VJP A;  3CCM A;  3ERR A;  1RUW A;  4FW1 A;  1KD1 R;  4ZIB A;  5GAM e;  2FPF A;  2KY9 A;  4M75 B;  3OYY A;  1U1T A;  1YFN A;  1JJ2 P;  3CCQ A;  1LPL A;  1GFC A;  4A4H A;  2QQR A;  1VQN T;  5GAN e;  3LWH A;  1WXU A;  4H2Y A;  2D8H A;  4F04 B;  2LJ0 A;  1U5S A;  3LLR A;  3LGF A;  2YRV A;  5KE2 A;  5KYY B;  1EZZ B;  1UHF A;  1UFF A;  8ATC B;  3EG9 B;  3TSW A;  2Q5H A;  1VQK Q;  2JS2 A;  1M3B A;  1KHC A;  3JV3 A;  1YI2 T;  4XTY A;  4M7A D;  2E3H A;  3SWN B;  2QDL A;  3A74 A;  1MV0 B;  2GBQ A;  4P74 C;  5C0M A;  5GAO r;  1JQQ A;  1X6B A;  2NUT B;  4LDU A;  1QMC A;  3ZFJ A;  5GMK h;  1OQK A;  5A0G A;  3RGL A;  1VIE A;  5CKE A;  1KQ1 A;  3I5S A;  2X4J A;  4BY6 C;  2DL4 A;  3OBW A;  4CH4 A;  1PM3 A;  4OML A;  3LSS A;  2EFI A;  4BWA A;  2E64 A;  2GF7 A;  4H2X A;  2HNI A;  4OP0 A;  2P0K A;  3ICA A;  1H64 1;  2CS7 A;  3CQT A;  4IIM A;  3CC4 Q;  4X9D A;  3MHX A;  3A31 A;  3OYK A;  3DB3 A;  3W3S A;  2PMF A;  3BY7 A;  3CD6 Q;  3OYH A;  4PHC A;  3CCL Q;  4IUR A;  4YRF A;  1JJC A;  1BI3 A;  3X24 B;  3TRE A;  5GAN 5;  4M77 F;  2RNA A;  3UGQ A;  3EGX B;  2M51 A;  2LQK A;  1PSF A;  1IB8 A;  4MZP A;  1UDL A;  4JDS A;  3M9Q A;  1NLO C;  4A4E A;  2XD0 A;  2QDY B;  2YRC A;  2DVJ A;  3A8M B;  4HA8 A;  1X2Q A;  3EFR A;  1EFN A;  4R56 A;  4AFQ C;  3CPW S;  2M0Y A;  3QG1 A;  2P4T A;  3CCR A;  1Q82 U;  1YJ9 A;  2O2O A;  2YXY A;  4PFO A;  1Q95 G;  1YP5 A;  3OS5 A;  3HRK A;  2L8D A;  4AFS C;  1KMM A;  4HVU A;  2KRN A;  2EYY A;  4D6W A;  2LTO A;  5A2Q E;  3KFU A;  2HQH A;  5GJV B;  3H0F A;  4FT2 A;  1N9W A;  1GFD A;  2V1Q A;  4XTW A;  4BB7 A;  4DOW A;  2RO0 A;  1JBM A;  3S6W A;  2YLB A;  2DL5 A;  2FRY A;  2MI6 A;  4PJO D;  1KIK A;  1VQ7 Q;  1QW1 A;  3P8D A;  1YJN T;  2CH4 A;  4M7D D;  4K86 A;  3LYI A;  1TUD A;  1ZBX A;  3CEY A;  3PMT A;  5LL6 S;  1JJ2 S;  5CK9 A;  2DLP A;  1KOG A;  3BE3 A;  2CZ6 B;  5IHN A;  3M4P A;  4YCW A;  2J6K A;  2RHZ A;  4G85 A;  4E7S A;  2DBK A;  1AWO A;  2RI2 A;  2A0F B;  3QO7 A;  4JZ4 A;  4OGE A;  4BE1 A;  4P73 A;  1KC8 C;  4F14 A;  2MF2 A;  5EC7 A;  4P72 C;  3AT1 B;  1SHG A;  2J3M A;  3QUI A;  2XI9 A;  4DBH A;  1TG0 A;  4JS4 A;  3JB9 G;  2ZIO A;  2GFU A;  1NEG A;  2M16 A;  4E2F B;  4PJL A;  2CT3 A;  1ACM B;  5GAN 4;  4DEX A;  1MND A;  3HXX A;  2YSQ A;  4P3O A;  2SRC A;  3BJU A;  4QQD A;  3L42 A;  4EDU A;  1MHN A;  3PGG A;  4YDQ A;  4IUV A;  2DKG A;  4MZT A;  3OMG A;  1YHQ T;  3C12 A;  4NL3 A;  2Q5I A;  3CC7 Q;  3HY0 A;  2P84 A;  3I7F A;  4LDW A;  3OA6 A;  5CCA A;  4YRR A;  2EQM A;  4PJO B;  1AT1 B;  2GQI A;  4KT0 E;  1D1B A;  2KXD A;  5CR2 A;  4JLI A;  1EQR A;  2PZ1 A;  4M7D B;  1F1B B;  4R55 A;  4M78 F;  1VQP Q;  4DPG A;  1UJ0 A;  3BDL A;  1Z7N A;  3FJ5 A;  1K9M C;  3CCM Q;  1WZO A;  4YRM A;  1QVP A;  1AVZ C;  4OB0 B;  5CVI A;  2V8K A;  1HTT A;  4BAC A;  1VQK T;  1BB9 A;  2EQK A;  4A63 B;  2XKO C;  3PZC A;  4P74 A;  4ZGJ B;  2OAU A;  1GCQ C;  2PTK A;  1H3H A;  4FYV B;  2YLC A;  1HJD A;  3VQX A;  2D0N A;  1G5I A;  4XEM A;  2F1L A;  1M1G A;  2COW A;  3LX7 A;  3ZBD A;  1Y71 A;  1IZ6 A;  2JOY A;  2X4Y A;  4D8K A;  1EIY B;  4M77 D;  2FO0 A;  5FRM A;  3A8O B;  2DER A;  2E5K A;  2HEQ A;  2X3W D;  2K2M A;  2E1H A;  2OTL Q;  1PRL C;  3OYC A;  2QXF A;  1U3O A;  3CME A;  2W10 A;  1FMW A;  2RA2 A;  3A5Z A;  1XOV A;  1NYQ A;  2LC4 A;  2K2V A;  3JSC A;  1YNZ A;  4FYY B;  1ZA1 B;  2C8M A;  1B34 B;  1QLY A;  1YJW T;  3CC4 T;  4A54 A;  1SES A;  4KH1 B;  1PD0 A;  2WSC E;  3CD6 T;  2BE9 B;  3CCL T;  2D8J A;  3QBY A;  4C8Q C;  1X56 A;  1ZBJ A;  3J80 E;  2EGC A;  1Y57 A;  2SEM A;  3M54 A;  1S72 A;  1VQ5 A;  4AMC A;  2XDD A;  3E9F A;  1VQ6 A;  2JMA A;  1R0C B;  3UT1 A;  2FHD A;  3UGT A;  2OTJ Q;  4V2S A;  4LD6 A;  3M5A A;  1W6X A;  1VQM Q;  3OYN A;  2QA4 A;  2OX7 A;  2DA9 A;  1NEB A;  4X5O A;  1I0C A;  2CZ1 B;  5GJW B;  4CC2 A;  4BI3 A;  3LC0 A;  1AD5 A;  1JEG A;  2JM8 A;  1SRL A;  2ZTG A;  3GPL A;  1RIQ A;  2ZT6 A;  2KSS A;  3MP1 A;  2AZV A;  4K11 A;  2AT1 B;  3G1Z A;  1M3C A;  2BKD N;  3I5R A;  3CCR Q;  2BZY A;  4JJC A;  2RJF A;  2B86 A;  2CJA A;  3JRZ A;  3NHN A;  2VGN A;  1QP3 A;  5I2M A;  3VQV A;  1NZ9 A;  4BDY A;  2DE0 X;  1Q86 U;  1RI0 A;  2RI3 A;  4RKU E;  4M75 C;  3PVQ A;  3AHU A;  2ED0 A;  3L2V A;  4H2S A;  4ATO A;  3R6N A;  2ZAE A;  1V76 A;  1ARK A;  3REA B;  2KI7 A;  4F17 A;  2AZS A;  4HWP A;  3E9G A;  1ZLM A;  4P72 A;  2E5A A;  2YUQ A;  4ELZ C;  2I2L A;  1LCK A;  4II1 A;  1K0S A;  2CUD A;  4RTY A;  2AKK A;  2HKN A;  4PJM A;  3RNJ A;  4J6Y A;  1PRM C;  4M78 D;  1IHV A;  3VS4 A;  5HGQ A;  2KBT A;  4H2W A;  1KQ2 A;  3JCM P;  3SWN C;  2ZCE A;  5GMK e;  2ESW A;  3A7A A;  3M56 A;  1YWP A;  2ZIN A;  3P8Y A;  4RG8 A;  1RAF B;  2XDP A;  2E10 A;  2JVV A;  3HFZ A;  2DL8 A;  1OI1 A;  1LJO A;  3CC7 T;  1X2G A;  3ULR B;  1MMA A;  2DD5 A;  1IRX A;  1WI7 A;  4XTX A;  1TTH B;  1M2V B;  1VQL T;  4E7K A;  3UF4 A;  3OW2 P;  2Y90 A;  4XU2 A;  8AT1 B;  3OQ5 A;  5FWB A;  4JUV A;  2K57 A;  2F2V A;  3WVD B;  4YRN A;  1H4S A;  1R77 A;  1NJI C;  1WX6 A;  1VQP T;  2LNV A;  2JW4 A;  1G3S A;  3UPU A;  3CCM T;  4LDX A;  1VQO A;  4LVI A;  4E47 A;  1B3Q A;  3REU A;  2I4O A;  3PCO B;  4TVA B;  1VQN Q;  3GBQ A;  3EHR A;  5D6Y A;  2PQW A;  4CH3 A;  1K8A R;  2RJD A;  2RHS A;  2W0Z A;  2DXC A;  3MPU B;  1GCQ A;  3PNW C;  2ZGW A;  2XHC A;  3H8Z A;  3M0T A;  3L2U A;  2KEA A;  4FCY A;  2R5A A;  1SKU B;  1TUC A;  3CPF A;  2DIL A;  3EGD B;  1X01 A;  4M7A G;  2P0L A;  5LJ5 g;  3A32 A;  3MO8 A;  2VV5 A;  3QXE B;  1YCY A;  3MET A;  2O4X B;  2YWW A;  3RIR A;  3E2U A;  3RAC A;  1ATI A;  1PYS A;  2HL3 A;  2RQV A;  4PFZ A;  2LDM A;  2PVD B;  3G7Z A;  4PFP A;  1K73 U;  3HTR A;  3SDZ A;  4J9G A;  4HCC A;  2CP6 A;  1G2B A;  4J8O A;  3HRT A;  2WAC A;  4C5I A;  1PD1 A;  3QDR B;  4E6R A;  1UB4 A;  2H3J A;  4M7A E;  4O5V A;  3NMZ C;  4KGZ B;  3I56 A;  1Q7Y R;  4C8Q A;  1YFT A;  5GAN 6;  3H0I A;  4YRQ A;  1VOM A;  3PVL A;  1WJQ A;  4RDX A;  2WSF E;  1RLP C;  3TEH B;  3FDR A;  1QKW A;  5C52 B;  4WI1 A;  1RAA B;  1Q81 U;  4P71 C;  4DBF A;  2OTJ T;  1H8K A;  3RBB B;  3SHW A;  3G6E A;  1X43 A;  1WHM A;  5KYN A;  4YRS A;  2CIM A;  5K1P A;  5CIU A;  1KK7 A;  1MGQ A;  1K8A C;  3A1P A;  4NL2 A;  1GL5 A;  4OMM A;  2HAX A;  2RHQ B;  2L3P A;  4EPC A;  1YB3 A;  3CCE A;  1N5Z A;  4L5G A;  3RKW A;  1A0N B;  5LJ5 f;  3L4G B;  4WJ3 M;  2QA4 Q;  2YUO A;  2VWF A;  2EJF A;  2A3L A;  1QVF P;  1NJ6 A;  1Q81 R;  4QVD A;  3JCM g;  4Q15 A;  1E24 A;  3QWY A;  3IKM B;  3CCR T;  1YJ9 T;  4BDZ A;  1DJ7 B;  3CMQ A;  4P75 C;  5KYU B;  1USY A;  5AT1 B;  4NOY A;  2Q7E A;  2KNB B;  2OI3 A;  3RER A;  4M75 A;  3X26 B;  1E1T A;  1TU0 B;  2L0A A;  4PJO C;  1GBR A;  1U1S A;  1JO8 A;  3L2W A;  2HQX A;  3M53 A;  2E65 A;  2VXE A;  2XMF A;  2G4C A;  2EYQ A;  2DFU A;  1QF6 A;  2XIC A;  1BBU A;  2XG8 D;  1M1K C;  4M7D C;  1BIB A;  2JT4 A;  1Y7X A;  1N8R R;  3IQL A;  2O9V A;  1YJN Q;  5KYY A;  3QZ9 B;  1Q7Y C;  4L59 A;  1PKT A;  3EG9 A;  3ER0 A;  2CSI A;  2RQR A;  4DEY A;  1D1C A;  4YRC A;  3VYH B;  4HWT A;  1QKX A;  1ZUY A;  4EIK A;  3SWN A;  1P92 A;  3C4S A;  3HL8 A;  2RHU A;  3KUF A;  1GXI E;  3PIP A;  4P73 C;  2HBW A;  4LDV A;  2FZG B;  1H4V B;  4AT1 B;  3MP8 A;  1FWZ A;  2K3X A;  2NUT A;  9ATC B;  3OYE A;  1YIJ A;  1ASY A;  4HWS A;  1WYX A;  1QP2 A;  4E51 A;  2JJ9 A;  2QQA A;  2Q7G A;  4FIB A;  1BI0 A;  4F7U A;  1ADJ A;  5IAY A;  5KYX B;  4H2V A;  3T9N A;  2O88 A;  3G1J A;  1YHQ Q;  1JJ2 A;  4OMN A;  2EL9 A;  2RK2 A;  4FSX A;  1FXX A;  4L6V 5;  3M0P A;  4LVL A;  4X34 A;  3TSZ A;  4M4Z A;  1M4Z A;  2HKQ B;  2Y4Y A;  1B70 B;  1G51 A;  4P3P A;  4RMO A;  5AYF A;  2GTJ A;  3DLM A;  4RQF A;  3V8K A;  1AEY A;  4LDY A;  1BK2 A;  1VQ4 A;  1QWE A;  4GLM A;  2RJC A;  2H8H A;  3OSV A;  4FU6 A;  2MYS A;  4FM4 B;  2BE7 D;  2KRS A;  1J5W A;  4R0K A;  3VQW A;  2K79 A;  4PLI A;  4C92 G;  2ECZ A;  3EGX A;  1VQO Q;  5KCO A;  1IXD A;  3CCV A;  4IKF A;  3EHQ A;  2CT4 A;  2HBP A;  2ATC B;  4OLF A;  1UG1 A;  3G4S A;  5C51 B;  4E7H A;  1OZ3 A;  1SF9 A;  2QQS A;  4H2T A;  2NLU A;  2QK0 A;  1WU7 A;  4EX5 A;  3H6Z A;  2GGR A;  4A4K A;  1ZA2 B;  2CRE A;  5GAN 3;  2ZZE A;  4HT8 A;  4M77 G;  3LWI A;  4F7U B;  2FPE A;  4ESR A;  5IN1 A;  4C92 E;  4TVW A;  1SG5 A;  2ALY B;  5K1X A;  1X54 A;  4HWO A;  3P8T A;  1R0B G;  4LVK A;  3EAE A;  3HHT B;  1GBQ A;  3VRY A;  2QHV A;  2X35 A;  4C92 F;  1N9S A;  2C0I A;  2JM9 A;  3HXV A;  3KFV A;  3CME T;  1ZUK A;  4Z02 A;  3GLX A;  1SPK A;  4YRJ A;  1XQH A;  1KQS P;  1YJW Q;  4HVW A;  4QT7 A;  3NTK A;  3A5Y A;  5LJ3 g;  2M0O A;  2LCS A;  1QE0 A;  4P71 A;  1KD1 C;  4ANJ A;  1BIA A;  4M77 E;  1UE9 A;  3CCS A;  4YP0 A;  4JS5 A;  4FYW B;  2DPP B;  3EFS A;  1OX9 A;  1ZQ1 A;  4YRP A;  3WQZ A;  4FYX B;  2KT1 A;  4RG2 A;  4Y92 A;  1D09 B;  2F5K A;  2F5T X;  4M7A B;  4J83 A;  2LVM A;  4QKU A;  4EMK A;  1VQ5 T;  1OU9 A;  5DLO A;  2DU5 A;  2COY A;  4C0D B;  2ARU A;  2ZNI A;  4ELY C;  5GAO q;  5IH2 A;  2QA4 T;  1GGM A;  1G83 A;  3BFM A;  2JTM A;  3LGL A;  1M27 C;  4P75 A;  2ZR2 A;  1M30 A;  5CQX A;  1W2B P;  5HK0 A;  1K9M U;  4QQG A;  3CCE Q;  3I35 A;  4PJO A;  4YYE A;  2E6Z A;  2DQ3 A;  3LW5 E;  3MEA A;  3QJ6 A;  3SB2 A;  4J6X A;  2DNU A;  3GF5 A;  4C5H A;  1FMK A;  2HMA A;  4Q5W A;  2A08 A;  4M7D A;  2EQJ A;  1K4U S;  4J5Y A;  5GMK i;  3EG1 A;  1LYL A;  1OPL A;  3I55 A;  4PL6 A;  3CC2 A;  3HY1 A;  2DET A;  2HZY A;  2M02 A;  1LVK A;  1XNI A;  3SFM A;  1Q82 R;  1KG1 A;  1OU8 A; 
#chains in the Genus database with same CATH homology
 2PUO B;  2M1H A;  2DVE A;  1HXD A;  1B8A A;  4BI4 A;  1EOV A;  3HXY A;  5A0D A;  2XU8 A;  3JAM E;  4XQ3 A;  1I4K 1;  1BYM A;  4M78 G;  4EMK B;  3A8L B;  4C0F A;  3NEM A;  2KDS A;  4G84 A;  2ODR C;  2E3C A;  1EIY A;  3FRN A;  4KR3 A;  2CYZ B;  2E70 A;  1AHJ B;  5ELN A;  2MWP A;  2AKW A;  4CS3 A;  2PUK B;  4JRK A;  5FU7 B;  1UGR B;  2EQU A;  2ZIM A;  2JUF A;  4YRI A;  1B34 A;  4M78 E;  2D6F A;  2K5F A;  1N6A A;  5GAM g;  3MP6 A;  4YRO A;  3RKX A;  5KE3 A;  4Y28 E;  1U8R A;  3MF1 A;  2E5Q A;  1HK9 A;  1WJR A;  5GAN g;  2XTI A;  3R6O A;  2PU9 B;  2LQ8 A;  5IT9 E;  4B9X A;  4H2U A;  4C92 D;  1VQO T;  2NS6 A;  3E9I A;  11AS A;  3ZEH A;  1Q82 C;  4YRE A;  3URG A;  3QPH A;  4UP7 A;  4ME7 A;  1WQW A;  4XEO A;  5GMK m;  1UGS B;  1KMN A;  4C5E A;  5J39 A;  5CKF A;  1E1O A;  2AKW B;  2AHJ B;  3CBO A;  4XAX B;  2XID A;  3JB9 J;  3JCM J;  2LCL A;  5GAO l;  2GQV A;  1NJ8 A;  2FL7 A;  3HP9 A;  1W2B S;  3V8L A;  3JCM V;  2BUD A;  4NCX A;  1D3B B;  2DXU A;  2A7Y A;  3PMI A;  4C92 B;  4J7I A;  3M4Y A;  3I56 T;  2AMC B;  2ZNJ A;  3VYG A;  5GAN f;  2ZPG B;  3VQY A;  2MAM A;  3GNF B;  2QTX A;  3QNE A;  4XTV A;  4WF2 A;  1UEB A;  3G6E T;  3GIB A;  4M77 B;  3S3M A;  5DY9 A;  5KCH A;  5F5W A;  1NJI U;  5ELO A;  5CO7 A;  4HKE A;  3HXZ A;  4MDW A;  3L2Q A;  3CCE T;  3C95 A;  3E9H A;  4A53 A;  1WJS A;  1Y07 A;  3Q1J A;  2F69 A;  1USY C;  12AS A;  5M9O A;  1YGB A;  1G3W A;  3PCO A;  2IVW A;  3FB9 A;  4TVA A;  4XTU A;  4OB1 B;  3N5B B;  2C06 A;  3UDC A;  4Y91 A;  2RHY A;  1NJ1 A;  2RI5 A;  2ZR3 A;  2X4W A;  3O8V A;  5CQY A;  2LX9 A;  1O9S A;  3PIO A;  3C94 A;  3BW1 A;  4EMH A;  3PFS A;  2O4X A;  2L89 A;  4XU1 A;  3OW2 A;  4HCZ A;  3L2Z A;  2GFA A;  4E7I A;  3LSQ A;  4ZN3 A;  4CI0 C;  2JTF A;  3MEY A;  3QSU A;  3X25 B;  3RMS A;  2QQ9 A;  2DQ0 A;  3A7R A;  3S3N A;  2JZ2 A;  1C0A A;  3TEH A;  1EFW A;  4C5G A;  2ZT5 A;  4M75 F;  3IG2 A;  2RM4 A;  2CGH A;  3CCQ T;  3UWN A;  1V29 B;  3MQZ A;  1NYR A;  3CCU A;  2M9U A;  4M78 B;  5DM7 R;  4M7A C;  4OF1 A;  3FC3 A;  1YIT A;  2RHQ A;  4C0D C;  2ZT7 A;  3CCV T;  3HRS A;  1SET A;  3L4G A;  2PME A;  3G4S T;  1M90 U;  2DK3 A;  2Q7H A;  1M1K U;  3A8H B;  2DZ9 A;  2EKO A;  2ZPI B;  4OMF B;  3M57 A;  3HSB A;  4YTL A;  4AH6 A;  4K88 A;  5EG2 A;  1VQ8 A;  2DTI A;  3MCA B;  2VC8 A;  4J7F A;  3DLL A;  3INZ A;  3NFC A;  5GAN 2;  1L0W A;  3M4G A;  3CBP A;  5D6X A;  3CD6 A;  2B8A A;  2DO3 A;  3CMA A;  3TCJ A;  2LCC A;  5J3B A;  2EWN A;  1QVF A;  4EMK C;  4MDX A;  4PG3 A;  4IUQ A;  4BE2 A;  4CRI A;  5HKC A;  4BUG A;  5HK3 A;  3HFN A;  4KUD K;  4HWR A;  4P5N A;  1NJ5 A;  2ZZG A;  3M55 A;  3QKJ A;  3RUX A;  5FU7 C;  1SRY A;  1EVK A;  3PTA A;  3CXC S;  4JJN K;  2P0Q A;  1H4T A;  1B70 A;  4TVR A;  5LJ5 h;  4GLK A;  3VV0 A;  3LH0 A;  3CCJ A;  2PVG B;  3OW2 S;  2EJ9 A;  3VKI A;  3R07 A;  2ZT8 A;  2KAF A;  1VQ7 A;  4FL6 A;  2DEQ A;  1SSF A;  3I55 T;  3CC2 T;  1Z7M A;  2QHU A;  3OYI A;  1X2H A;  2QQB A;  3JB9 I;  4C0Z A;  3JCM Q;  3MF2 A;  4M75 D;  4J15 A;  2IY5 B;  1YFS A;  2XK0 A;  4RCC A;  3P8B B;  3JB9 H;  4OGC A;  2VUB A;  3HRU A;  1Y96 B;  1QVG A;  2ALY A;  1KD1 U;  5CAI A;  3JCM f;  4ZTF A;  1Q81 C;  3CC7 A;  4WJ4 A;  1ZHI A;  1HC7 A;  5LJ5 j;  2IG0 A;  4ZN1 A;  4IUU A;  4JRI A;  4JRQ A;  4CH5 A;  3QII A;  3JCM h;  4UC4 A;  2WSE E;  4M7A A;  2RHX A;  1M1F A;  1N8R C;  3QHS A;  3NTH A;  3KXT A;  3HPW A;  2E12 A;  4BW9 A;  2CZ7 B;  3OS1 A;  4KUL A;  4TWA A;  4M77 C;  1NNH A;  3KBG A;  2XGT A;  4HT4 A;  3OS0 A;  4RMF A;  5CKH A;  3OYL A;  4KBM B;  2I4N A;  1KQS A;  4XTZ A;  1I5L A;  5LJ5 d;  1QVF S;  2DU7 A;  2OTL A;  3OYA A;  1H4Q A;  3JCM X;  3GNG A;  4CH6 A;  5KNN A;  1KC8 U;  1E22 A;  2RJE A;  5D6W A;  3G71 A;  3HKS A;  2VGM A;  2EIF A;  3SD4 A;  4OB3 B;  3JCM c;  3HXW A;  1ASZ A;  1S72 T;  4BD3 A;  1VQ9 A;  2QEX A;  3M58 A;  1B76 A;  1VQ6 T;  1G3Y A;  3NEN A;  2OTJ A;  1VQM A;  1W2B A;  5GAN 7;  3QZ5 B;  4XU0 A;  1TH7 A;  4QVC A;  2KK4 A;  4Q6G A;  4TVY A;  5FRN A;  1M8V A;  3V8J A;  2P5I A;  5J26 A;  1H3Z A;  4HT9 A;  5GMK j;  3DSQ A;  4MML A;  3JCM b;  2HD0 A;  3JCM d;  1QVG S;  1SER A;  3UFG A;  2L3R A;  2QHS A;  2BIV A;  5LJ3 f;  3IAL A;  3HRI A;  3NTI A;  3E19 A;  5I2S A;  3P8V A;  4JLG A;  4M78 C;  2YHT A;  2I4L A;  3P8H A;  2R5M A;  2LT1 A;  4H2X B;  3F70 A;  3UH0 A;  4N4G A;  3QTC A;  3J7A F;  2XDB A;  3NEL A;  5LJ3 h;  2E6N A;  5E3I A;  4E7L A;  4XK8 E;  1JJC B;  3E1S A;  1WGS A;  4JRP A;  1O75 A;  2K3Y A;  4J6W A;  1RL2 A;  1NPP A;  2G3R A;  5GAO n;  2C7I A;  2DIG A;  3IKL A;  1XTD A;  3M4Q A;  3MEV A;  1D3B A;  3V7R A;  4C92 A;  2ARS A;  2P0P A;  2AMC A;  1BI2 A;  2VYT A;  3QO3 A;  3TEE A;  1KQS S;  3L1A A;  4K87 A;  4L87 A;  1VQN A;  1IL2 A;  1N27 A;  4HVC A;  1X6O A;  2K4Y A;  3JB9 F;  4YCV A;  3CCU T;  4TTV A;  3M59 A;  2DIQ A;  3MEW A;  4M77 A;  5FLX E;  4OVA A;  3OB9 A;  2Y4X A;  1YIT T;  3TEG A;  5LJ3 j;  4UP8 A;  1YI2 A;  2DZC A;  2JN0 A;  1OZ2 A;  2VXF A;  2CJB A;  4N4I A;  3WXM B;  4ZTJ A;  5FU6 B;  2ART A;  2E41 A;  5LJ5 e;  3HXU A;  1M5Q 1;  4N4H A;  3OS2 A;  5KH6 A;  1BBW A;  2MWO A;  4YPF A;  1VQ8 T;  3CBM A;  3VBB A;  2R58 A;  5GAM f;  1FYF A;  1EIF A;  3PT9 A;  2FB7 A;  3OSS C;  4N0A C;  1G5V A;  1G5H A;  4EMG A;  3X20 B;  3OYF A;  4PNO A;  4PLL A;  2K5L A;  5LJ3 d;  5GAM h;  2DD4 A;  2ZZD A;  3L2R A;  3FJP A;  3V7S A;  3CMA T;  5GAN h;  4C8Q G;  2ZXF A;  1I81 A;  4DOV A;  4DA4 A;  2EJG A;  1B7Y A;  3QJY A;  3FEO A;  4OB2 B;  3ASK A;  1YBY A;  4C8Q E;  4CS4 A;  4HCB A;  4BY6 B;  3JCM e;  3CCJ T;  2HQE A;  3FLG A;  4C8Q F;  4M78 A;  4FT4 A;  1NE8 A;  3A5Z B;  5HY6 A;  1YJN A;  1VQ7 T;  2LT4 A;  4ZTZ B;  5GAM j;  3CXC A;  4M75 G;  2MMP A;  4TQD A;  3S3O A;  1EVL A;  5GAN j;  1W66 A;  3V7C A;  1YIJ T;  1I8F A;  3NET A;  3QO5 A;  2DJZ A;  3RES A;  3JB9 D;  1VUB A;  2DXB A;  4LNS A;  2ZCF B;  3HTZ A;  1YHQ A;  3RL6 A;  4QVZ A;  4GY5 A;  2ODR D;  4M75 E;  2J3L A;  5CKD A;  1B7Y B;  2CJ9 A;  1X75 C;  2DXT A;  3OD1 A;  2RB6 A;  1K8A U;  3RKY A;  2FYK A;  2DTH A;  3OYM A;  3OYJ A;  4F7U G;  3QYG B;  5GAM d;  1VQ4 T;  5CKB A;  4YRG A;  2DTO A;  5L8R E;  3GP8 A;  1M9S A;  4MMK A;  3OYB A;  4LVJ A;  4VUB A;  5GAN d;  3HFO A;  1VQK A;  3TU4 K;  4BE0 A;  1G3T A;  1KHI A;  3DKM A;  2ZPB B;  3GOX A;  4F7U E;  1WPY A;  1W4S A;  1Q86 C;  4IUT A;  4O2D A;  1VQZ A;  2X4X A;  3OYG A;  2D0Q B;  2L5Q A;  4F7U F;  1N9R A;  3RMQ A;  2CZ0 B;  2RHI A;  1Q7Y U;  2CKK A;  5I21 A;  3VU3 C;  4KR2 A;  2GCX A;  4C0G A;  2OTL T;  2KMT A;  5FRO A;  4B9W A;  4N0A A;  1LNX A;  3HFZ B;  3OY9 A;  4RQE A;  1UGQ B;  5C53 B;  3REX A;  5DLQ E;  2JNG A;  3ME9 A;  1YJW A;  4NS5 A;  3CC4 A;  3QYH B;  2V8I A;  1LOJ A;  2R57 A;  3TUP A;  4KQE A;  3CCL A;  4ZGE B;  4MZM A;  3CCS T;  2ZPH B;  3G71 T;  4X9C A;  2V8J A;  3A7U A;  2IY5 A;  1NJ2 A;  4M7A F;  2D9T A;  3HFV A;  4EO4 A;  5LJ3 e;  3MEU A;  2EAY A;  2DDZ A;  3VUB A;  4C8Q D;  1VQ9 T;  2ZZF A;  4KUI A;  2KVQ G;  2QEX T;  4PKC C;  5GMK l;  4UPA A;  1Y96 A;  2RHS B;  1VQM T;  1PSE A;  2ZPE B;  3FIF A;  2DAQ A;  2QHT A;  4QW2 A;  2LRQ A;  1JB0 E;  1WNL A;  3RF1 A;  4UP9 A;  1N8R U;  5A0L A;  1IRE B;  1YFR A;  4LD9 K;  5C6S A;  4TQF A;  4YRK A;  1PYS B;  1BI1 A;  2O01 E;  1WYD A;  4H02 A;  2RD1 A;  2I4M A;  1R8O B;  2PVO B;  3A8G B;  4YRL A;  2K5I A;  3VUZ A;  3OBY A;  4BI8 B;  4E7J A;  1VIF A;  1M90 C;  1X55 A;  3X28 B;  4PJO G;  4XU3 A;  4A4F A;  4P3N A;  4C8Q B;  1K73 C;  4ZGD B;  3WVE B;  4YCU A;  4M7D G;  1BKB A;  3CPW A;  5GAN 8;  4CS2 A;  4RCB A;  4ZTU B;  4DQ2 A;  1WQ7 A;  2KQW A;  4YRT A;  3JCM W;  2RK1 A;  4QQ6 A;  5GAO p;  3J81 E;  2FVU A;  5FU6 C;  4LVM A;  3QO8 A;  1WLE A;  4PJO E;  2A8E A;  1NPR A;  1VQL A;  3OMC A;  4M7D E;  1JRI A;  4PJO F;  1FX7 A;  3BDU A;  5GAO m;  3DB4 A;  4M7D F;  4A4G A;  2RH2 A;  1OYX A;  4IUP A;  4O6J A;  4C92 C;  1ADY A;  1VQP A;  1UGP B;  2QI2 A;  3OYD A;  2ZPF B;  3VJP A;  3CCM A;  3ERR A;  4ZIB A;  5GAM e;  2KY9 A;  3OYY A;  4M75 B;  1U1T A;  3CCQ A;  4A4H A;  2QQR A;  1VQN T;  5GAN e;  3LWH A;  4H2Y A;  3LLR A;  3LGF A;  2YRV A;  5KE2 A;  2Q5H A;  1KHC A;  1YI2 T;  4XTY A;  4M7A D;  3SWN B;  3A74 A;  4P74 C;  5C0M A;  5GAO r;  4LDU A;  3ZFJ A;  5GMK h;  5A0G A;  3RGL A;  1VIE A;  5CKE A;  1KQ1 A;  2X4J A;  4BY6 C;  3OBW A;  4CH4 A;  3LSS A;  2EFI A;  4BWA A;  2E64 A;  2GF7 A;  4H2X A;  2HNI A;  4OP0 A;  2P0K A;  3ICA A;  1H64 1;  2CS7 A;  4X9D A;  3MHX A;  3A31 A;  3OYK A;  3DB3 A;  3W3S A;  2PMF A;  3BY7 A;  3OYH A;  4PHC A;  4IUR A;  4YRF A;  1JJC A;  1BI3 A;  3X24 B;  3TRE A;  5GAN 5;  4M77 F;  3UGQ A;  2LQK A;  1PSF A;  4MZP A;  4JDS A;  3M9Q A;  4A4E A;  2XD0 A;  2QDY B;  3A8M B;  4HA8 A;  3EFR A;  4R56 A;  3CPW S;  3QG1 A;  2P4T A;  3CCR A;  1Q82 U;  1YJ9 A;  3OS5 A;  3HRK A;  2L8D A;  1KMM A;  4D6W A;  2LTO A;  5A2Q E;  3KFU A;  4FT2 A;  1N9W A;  4XTW A;  4BB7 A;  4DOW A;  2RO0 A;  1JBM A;  3S6W A;  2YLB A;  2MI6 A;  4PJO D;  1QW1 A;  3P8D A;  1YJN T;  4M7D D;  4K86 A;  3LYI A;  1ZBX A;  3CEY A;  3PMT A;  5LL6 S;  1JJ2 S;  5CK9 A;  1KOG A;  2CZ6 B;  3M4P A;  4YCW A;  2RHZ A;  4G85 A;  2RI2 A;  3QO7 A;  4OGE A;  4BE1 A;  4P73 A;  1KC8 C;  2MF2 A;  4P72 C;  2J3M A;  3QUI A;  2XI9 A;  4JS4 A;  3JB9 G;  2ZIO A;  2GFU A;  2M16 A;  5GAN 4;  3HXX A;  4P3O A;  3BJU A;  4QQD A;  3L42 A;  4EDU A;  1MHN A;  3PGG A;  4YDQ A;  4IUV A;  2DKG A;  3OMG A;  4MZT A;  1YHQ T;  3C12 A;  4NL3 A;  2Q5I A;  3HY0 A;  3I7F A;  4LDW A;  3OA6 A;  5CCA A;  4YRR A;  2EQM A;  4PJO B;  4KT0 E;  5CR2 A;  1EQR A;  4JLI A;  4M7D B;  4R55 A;  4M78 F;  4DPG A;  3BDL A;  1Z7N A;  1K9M C;  4YRM A;  1QVP A;  4OB0 B;  5CVI A;  2V8K A;  1HTT A;  4BAC A;  1VQK T;  2EQK A;  2XKO C;  3PZC A;  4P74 A;  4ZGJ B;  2OAU A;  2YLC A;  3VQX A;  1G5I A;  4XEM A;  1M1G A;  3LX7 A;  3ZBD A;  1Y71 A;  1IZ6 A;  2JOY A;  2X4Y A;  1EIY B;  4M77 D;  5FRM A;  3A8O B;  2E1H A;  3OYC A;  2QXF A;  3CME A;  2RA2 A;  3A5Z A;  1XOV A;  1NYQ A;  2LC4 A;  2K2V A;  3JSC A;  2C8M A;  1B34 B;  1YJW T;  3CC4 T;  4A54 A;  1SES A;  2WSC E;  3CD6 T;  3CCL T;  3QBY A;  4C8Q C;  1X56 A;  3J80 E;  3M54 A;  1S72 A;  1VQ5 A;  2XDD A;  3E9F A;  1VQ6 A;  3UT1 A;  2FHD A;  3UGT A;  4V2S A;  4LD6 A;  3M5A A;  3OYN A;  2QA4 A;  4X5O A;  2CZ1 B;  4BI3 A;  3LC0 A;  2ZTG A;  3GPL A;  1RIQ A;  2ZT6 A;  2KSS A;  3MP1 A;  3G1Z A;  2BKD N;  2RJF A;  2CJA A;  3JRZ A;  2VGN A;  1QP3 A;  5I2M A;  3VQV A;  1NZ9 A;  4BDY A;  1Q86 U;  1RI0 A;  2RI3 A;  4RKU E;  4M75 C;  3AHU A;  3L2V A;  4H2S A;  4ATO A;  4HWP A;  3E9G A;  4P72 A;  2E5A A;  4ELZ C;  2I2L A;  4II1 A;  4J6Y A;  4M78 D;  5HGQ A;  4H2W A;  1KQ2 A;  3JCM P;  3SWN C;  2ZCE A;  5GMK e;  3A7A A;  3M56 A;  2ZIN A;  3P8Y A;  4RG8 A;  2XDP A;  2E10 A;  2JVV A;  3HFZ A;  1OI1 A;  1LJO A;  3CC7 T;  1X2G A;  2DD5 A;  4XTX A;  1VQL T;  4E7K A;  2Y90 A;  4XU2 A;  3OQ5 A;  4JUV A;  2K57 A;  3WVD B;  4YRN A;  1H4S A;  1NJI C;  1VQP T;  2LNV A;  1G3S A;  3UPU A;  3CCM T;  4LDX A;  1VQO A;  4LVI A;  4E47 A;  3REU A;  2I4O A;  3PCO B;  4TVA B;  5D6Y A;  2PQW A;  4CH3 A;  2RHS A;  2RJD A;  2DXC A;  3PNW C;  2ZGW A;  2XHC A;  3H8Z A;  3L2U A;  2R5A A;  3CPF A;  1X01 A;  4M7A G;  2P0L A;  5LJ5 g;  3A32 A;  3MO8 A;  2VV5 A;  3QXE B;  1YCY A;  3MET A;  2O4X B;  3RIR A;  3RAC A;  1ATI A;  1PYS A;  2LDM A;  2PVD B;  3G7Z A;  1K73 U;  3SDZ A;  4HCC A;  4J8O A;  3HRT A;  2WAC A;  4C5I A;  3QDR B;  1UB4 A;  2H3J A;  4M7A E;  4O5V A;  3I56 A;  4C8Q A;  1YFT A;  5GAN 6;  4YRQ A;  1WJQ A;  4RDX A;  2WSF E;  3TEH B;  3FDR A;  5C52 B;  4WI1 A;  1Q81 U;  4P71 C;  2OTJ T;  3G6E A;  4YRS A;  2CIM A;  5K1P A;  5CIU A;  1MGQ A;  1K8A C;  4NL2 A;  2HAX A;  2RHQ B;  4EPC A;  1YB3 A;  3CCE A;  4L5G A;  3RKW A;  5LJ5 f;  3L4G B;  4WJ3 M;  2EJF A;  2A3L A;  1NJ6 A;  4QVD A;  3JCM g;  4Q15 A;  1E24 A;  3IKM B;  3CCR T;  1YJ9 T;  4BDZ A;  1DJ7 B;  3CMQ A;  4P75 C;  1USY A;  2Q7E A;  4NOY A;  3RER A;  4M75 A;  3X26 B;  1E1T A;  4PJO C;  1U1S A;  3L2W A;  2HQX A;  3M53 A;  2E65 A;  2VXE A;  2G4C A;  2EYQ A;  1QF6 A;  2XIC A;  1BBU A;  2XG8 D;  1M1K C;  4M7D C;  1BIB A;  1Y7X A;  3QZ9 B;  1Q7Y C;  4L59 A;  3ER0 A;  4YRC A;  3VYH B;  4HWT A;  3SWN A;  1P92 A;  3C4S A;  3HL8 A;  2RHU A;  3KUF A;  1GXI E;  3PIP A;  4P73 C;  1H4V B;  4LDV A;  3MP8 A;  1FWZ A;  2K3X A;  3OYE A;  1YIJ A;  1ASY A;  4HWS A;  4E51 A;  1QP2 A;  2QQA A;  2Q7G A;  4FIB A;  1BI0 A;  4F7U A;  1ADJ A;  5IAY A;  4H2V A;  3T9N A;  1JJ2 A;  2EL9 A;  2RK2 A;  4FSX A;  1FXX A;  4L6V 5;  4LVL A;  4X34 A;  1M4Z A;  2Y4Y A;  1B70 B;  1G51 A;  4P3P A;  4RMO A;  5AYF A;  3DLM A;  4RQF A;  3V8K A;  4LDY A;  1VQ4 A;  2RJC A;  3OSV A;  4FU6 A;  4FM4 B;  1J5W A;  3VQW A;  4PLI A;  4C92 G;  5KCO A;  3CCV A;  4IKF A;  2HBP A;  4OLF A;  3G4S A;  5C51 B;  4E7H A;  1OZ3 A;  2QQS A;  4H2T A;  2NLU A;  4EX5 A;  1WU7 A;  3H6Z A;  4A4K A;  5GAN 3;  2ZZE A;  4HT8 A;  4M77 G;  3LWI A;  4F7U B;  5IN1 A;  4C92 E;  4TVW A;  2ALY B;  5K1X A;  1X54 A;  4HWO A;  3P8T A;  4LVK A;  3EAE A;  3HHT B;  2QHV A;  2X35 A;  4C92 F;  1N9S A;  3HXV A;  3CME T;  4Z02 A;  3GLX A;  4YRJ A;  1XQH A;  3NTK A;  3A5Y A;  5LJ3 g;  2M0O A;  1QE0 A;  4P71 A;  1KD1 C;  1BIA A;  4M77 E;  3CCS A;  4YP0 A;  4JS5 A;  2DPP B;  3EFS A;  1ZQ1 A;  4YRP A;  3WQZ A;  4RG2 A;  2F5K A;  2F5T X;  4M7A B;  4J83 A;  2LVM A;  4EMK A;  1VQ5 T;  5DLO A;  2DU5 A;  4C0D B;  2ARU A;  2ZNI A;  4ELY C;  5GAO q;  2QA4 T;  1GGM A;  3BFM A;  2JTM A;  3LGL A;  4P75 A;  2ZR2 A;  5CQX A;  1K9M U;  5HK0 A;  4QQG A;  4PJO A;  4YYE A;  2E6Z A;  2DQ3 A;  3LW5 E;  3MEA A;  3QJ6 A;  3SB2 A;  4J6X A;  3GF5 A;  4C5H A;  4Q5W A;  4M7D A;  2EQJ A;  4J5Y A;  5GMK i;  1LYL A;  3I55 A;  4PL6 A;  3CC2 A;  3HY1 A;  1KG1 A;  3SFM A;  1XNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...