2EJGA

Crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
235
structure length
232
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 64
structure length 232
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejgA01
1EIYB 2ZINA 4QVCA 1E1TA 4HWRA 4NCXA 4P72C 4BW9A 2AMCB 3V7SA 4M7AB 4J15A 2VXEA 1B7YA 4J6YA 2HNIA 4EMKB 3REXA 2Q7GA 2DXTA 4G85A 5CAIA 3RF1A 1Z7MA 2VXFA 4RQEA 2XTIA 3NENA 4Q6GA 2ALYA 4DPGA 4UP8A 5LJ3d 3JCMX 2YLBA 1NNHA 4YCWA 1Z7NA 3JB9J 4YRKA 3A7AA 1B7YB 2YHTA 3I7FA 1LOJA 4H2SA 4YRMA 3JCMQ 4M77B 2DJZA 1USYC 5I21A 4ZTUB 3RUXA 4YRNA 2DQ0A 4EMHA 5HGQA 3JCMc 3LC0A 4JUVA 1N9RA 3GIBA 4M78D 2Q7HA 2I2LA 4M75G 4M78F 1HC7A 3OD1A 4N0AA 5GAOm 4DQ2A 3UGQA 1YB3A 2DU7A 4P72A 4C8QB 2VC8A 5LJ5h 3QHSA 3TUPA 4WF2A 5GMKm 4F7UA 3JCMV 1KQ2A 1SESA 2C8MA 5GAMf 4RQFA 4RCCA 4M78C 2DZCA 3TEHA 3NELA 4G84A 2DTIA 2IY5A 1USYA 1X54A 3SWNC 3HXUA 4AH6A 3PCOB 5LJ5f 1NJ8A 2DTHA 4H2XB 4HWOA 4P74C 5ELOA 4YRIA 3V8LA 3HXYA 3MEYA 1X55A 2DQ3A 4M7AE 4HT9A 4OLFA 3RKXA 4LNSA 5GAN6 3RKYA 1ADYA 1X2HA 4M75D 4C92B 2XGTA 3VQVA 4A53A 3V8JA 3QUIA 4PJOB 4P71A 1D3BB 4M7DG 1G51A 1I81A 1W66A 3KFUA 2QHUA 4CS3A 5GAN3 4KR3A 1Y96B 1JBMA 4XU1A 4YRTA 2ZR3A 3HFVA 2PMEA 4M77E 2Y90A 1B70B 2I4LA 5GAMj 1SERA 4M78A 2QHTA 4HWSA 1NYRA 5GANe 1X56A 5LJ5g 2I4MA 3JB9G 1NJ6A 4M75C 3SWNA 4JLIA 1RIQA 2ZCEA 2AKWA 2RHQB 1ASYA 4ZIBA 5GAOl 3TEGA 3JCMh 4P74A 1I8FA 3QNEA 4YRLA 4H02A 3PGGA 4C8QE 1C0AA 3P8VA 3HY1A 3JCMb 3R07A 5GMKl 4HVCA 1LJOA 3LSQA 4P73A 4TVWA 3VBBA 2DU5A 3RERA 1B76A 3BW1A 4J6WA 4P3NA 4M7DD 2Q7EA 4M7DF 3RACA 2FYKA 4H2YA 1BIBA 4XU2A 4XEMA 5GMKj 1ASZA 5LJ5d 1EFWA 4MMLA 3E9IA 3P8TA 2CJAA 2QHVA 2ZGWA 4EO4A 1EVKA 3NEMA 4E51A 1WQ7A 4M75A 1PYSA 1HTTA 1I4K1 1EOVA 3JB9D 2ARUA 2Q5IA 3M4PA 4C92E 2DTOA 3CMQA 3QO8A 3JB9F 4CH5A 4PJOE 4M7DC 11ASA 1B34A 4XU0A 4HT8A 2ALYB 1YFRA 3HY0A 2DKGA 4XTYA 3VQYA 1G5HA 4K87A 3JCMe 2ZNIA 1BBWA 2CJ9A 3VQXA 4YRPA 2DVEA 4EX5A 1ATIA 4CH4A 3JCMg 3PZCA 12ASA 3WQZA 1WLEA 4EMGA 4JRKA 1B34B 4K86A 3REUA 1NJ2A 4P71C 1KQ1A 4P75C 4X9CA 3RIRA 2ZIMA 4K88A 2RB6A 3BFMA 4RDXA 1VQZA 3HRKA 5GANh 4H2VA 1YFSA 4CS4A 3RL6A 4M78E 3FB9A 3QSUA 3W3SA 4V2SA 3ICAA 4RMFA 4Q15A 3LSSA 3L2ZA 1NJ5A 3RGLA 1KOGA 1YCYA 4X5OA 5GAN2 1EQRA 5GAOn 3M4GA 4F7UB 4M7DA 2J3LA 2EAYA 2FB7A 4A54A 2EJGA 3A5ZA 2RM4A 2J3MA 1E24A 2Q5HA 4C8QG 4NL3A 3UFGA 4QVDA 2E5AA 1JJCA 3L4GA 5GANf 3TEHB 5LJ3h 5GAOr 1MGQA 2I4NA 2DDZA 2IY5B 4M7DB 4WI1A 4M75F 4P3OA 1ADJA 5GAOp 2DEQA 1J5WA 2C7IA 4UPAA 4P75A 3A31A 2JN0A 1JRIA 3BDUA 4P73C 4TWAA 4O2DA 4WJ4A 4HWPA 1JJCB 1GGMA 3L4GB 3HXVA 3DSQA 4M77D 3VQWA 3HFZA 2E64A 4C92G 4EMKC 1H4VB 5GAN4 5GAMe 1B8AA 2QTXA 5GANg 4PJOG 5LJ5j 5GAN8 4ZTZB 3UH0A 3HSBA 1QE0A 2DXUA 4M78B 5K1PA 3IKLA 4C8QD 2RA2A 1SETA 4J5YA 4C8QF 3UGTA 4YRGA 3SWNB 1EVLA 1U1SA 5GMKi 4YRQA 1WNLA 2AKWB 3FJPA 5LJ3e 3NETA 4CH6A 2QHSA 4YDQA 4PNOA 5LJ3g 3INZA 4YREA 4TQDA 4TVAA 1YGBA 4L87A 3JCMf 1M5Q1 1EIYA 4F7UE 1WPYA 2P5IA 2E10A 3HXXA 4XTUA 3IKMB 2AMCA 1L0WA 1KMNA 3E9HA 4C8QC 5GANd 2K57A 4EMKA 4XTZA 4C92D 2CGHA 2ZR2A 4C92F 4M7DE 5K1XA 4PJOD 1BBUA 3AHUA 2E1HA 3RKWA 4XU3A 3QO7A 4PJOF 4YCVA 4YROA 5F5WA 2ODRD 3A5YA 4YRSA 4MMKA 4M75B 4M77A 4M7AG 1PYSB 3QTCA 3L1AA 1H4QA 1LNXA 1NYQA 4NOYA 3P8YA 2E3CA 3RESA 2YLCA 2CJBA 4JRIA 4C92C 1NJ1A 3HXZA 4XTXA 3BY7A 4M77G 4PJOC 3IG2A 4UP9A 3JB9I 4C8QA 2ODRC 4HA8A 1TH7A 1KMMA 4P3PA 5GAMh 1LYLA 4RCBA 3FIFA 1WU7A 3A7RA 3V8KA 2E65A 2ZT6A 2I4OA 2RD1A 1SRYA 3A7UA 3MF1A 3MF2A 3IALA 4XTVA 2ZT5A 4J6XA 2P0LA 4PG3A 3JCMd 4PHCA 3PCOA 1N9SA 4M7AD 5E3IA 5GAOq 4H2XA 4NL2A 4M7AF 3ERRA 4HWTA 1X2GA 4CS2A 3A74A 4YPFA 2EJFA 1HK9A 4C92A 2ARTA 4YRCA 4BWAA 2ZT8A 4PJOA 4XQ3A 4F7UG 1D3BA 3EFSA 3JB9H 2PMFA 2ZXFA 4XEOA 1E22A 2ZTGA 2ARSA 5GMKh 5C51B 3HRIA 4M77F 5DY9A 4X9DA 5GAN7 4TTVA 1Y96A 1U1TA 5LJ3f 3V7CA 4YRJA 2RHSA 4M75E 4XTWA 4M7AC 1B70A 3HXWA 3VU3C 3SB2A 1M8VA 4YYEA 5GAN5 3V7RA 4KR2A 4UP7A 1H641 3HFNA 3JCMJ 4TVYA 1H4TA 3G1ZA 5C53B 2G4CA 3HFZB 1I5LA 3QO5A 2CIMA 5GAMg 4YP0A 5GANj 2RHSB 2RHQA 2ZZFA 5LJ5e 1X01A 4M77C 3HTZA 3EFRA 1QF6A 5C52B 2ZZGA 3A32A 1FYFA 1WYDA 2E41A 2ZIOA 2ZT7A 4H2UA 1IL2A 1WQWA 4OP0A 4KQEA 3HFOA 1H4SA 1N9WA 3JCMW 3M4QA 4H2WA 4Y91A 2DZ9A 3JCMP 5ELNA 4H2TA 2ZZEA 4YRRA 4YRFA 5KNNA 3QO3A 4WJ3M 1YFTA 2EL9A 4TQFA 2ZNJA 4F7UF 5LJ3j 4M78G 1BIAA 4M7AA 4YCUA 5GMKe 2EWNA 1G5IA 1E1OA 4CH3A 1HXDA 5GAMd 4TVAB 4N0AC 3BJUA 2EJ9A
chains in the Genus database with same CATH superfamily
2OX7A 2QXFA 1E1TA 4L6V5 4HVVA 4J15A 2M9UA 3X24B 4OB0B 1IRXA 4IUQA 3CCSA 2A37A 3E2UA 2DXTA 4HKEA 3RF1A 4RQEA 2CDTA 1VQPT 2DA9A 2EGAA 1K73C 2ALYA 2F2VA 2F2WA 5DLOA 4RTVA 2PTKA 3JCMX 2YLBA 1NEBA 1NNHA 1PWTA 2YUQA 2YT6A 1YJNA 1M8MA 4YRKA 3P8HA 2KDSA 2PU9B 2RHIA 4ZTUB 2SEMA 4ELZC 1GCQA 3RUXA 2K79A 1JJ2S 4YRNA 2MPXC 3M59A 1M2VA 1WI7A 2WSCE 3GF5A 2FZGB 2KQWA 1XNIA 1Q82C 3PMIA 4M75G 2P4RA 5L23A 3OD1A 4N0AA 1BI1A 4DQ2A 1EFNA 1M9SA 2VGNA 2RJDA 5I2MA 4P72A 1WA7A 3M57A 1PC0A 3VV0A 3OQ5A 2B86A 2W0ZA 2BZ8A 2EYWA 3QHSA 2HBPA 5C0MA 1VQPA 2QQRA 3UA6A 1D1CA 3A1PA 2VV5A 3CPWP 4RQFA 4M78C 3UDCA 2DZCA 3NELA 3O8VA 2DTIA 5IN1A 4IUTA 1VQ6T 1XQHA 2MAMA 2KAFA 4GLKA 1QKXA 5ELOA 4ANJA 2DYBA 4B9WA 3J81E 1VQKT 3RKXA 2JM9A 4OLFA 3PIPA 2XGTA 2X9HA 1XJWB 3M0RA 3V8JA 3QUIA 1D3BB 4M7DG 1I81A 4KR3A 1Y96B 2DIGA 2P84A 1JJ2A 2IPOB 3A8GB 1SERA 2CS7A 2MCNA 4LDUA 5GANe 2C0OA 2P0KA 4FYYB 5LJ5g 2I4MA 2CT4A 1VQ6A 3SWNA 4EDUA 2ZCEA 1N8RU 3TEGA 2LNVA 4L59A 2DJQA 4OMPA 4C8QE 2EQIA 3HY1A 5KYNA 1B3QA 1IO6A 3SFMA 2AKLA 4ESRA 1LJOA 3UPUA 1PHTA 4HCCA 1IHWA 4P73A 4TVWA 3VBBA 3RERA 2MIOA 3R6NA 3BW1A 4J6WA 2M0OA 1WIEA 3CCET 2FYKA 3HPWA 2QEXQ 3HP9A 5IHIA 4XEMA 1EX4A 4IIOA 3GNGA 5LJ5d 1EFWA 3P8TA 1O9SA 2ZGWA 1WDXA 5KYYA 2AKKA 2QA4Q 3CC2T 2LTOA 1GFCA 1PYSA 1I4K1 3LGFA 3GOXA 3JB9D 2ARUA 1VQLT 1WHHA 1B34A 3HY0A 2DKGA 2XICA 3JV3A 3JCMe 2ZNIA 2K2MA 2CH4A 4BDZA 2EYXA 3LH0A 3CPWS 1ATIA 2NWMA 2CREA 2DO3A 4C5EA 4E7SA 4MDWA 2JMCA 1WLEA 2V1QA 4JRKA 1B34B 3GBQA 3E1SA 3CCEA 3BE3A 4II1A 3RIRA 1JQQA 4K88A 2JM8A 2V8KA 1YBYA 4RDXA 3FRNA 5GANh 3M5AA 3CC2A 1ZSZB 4CS4A 3RL6A 5KE3A 3FB9A 4FW2A 1RAEB 2KEAA 3TCJA 4BY6C 1X69A 3ULRB 3U23A 5FROA 1PRMC 1VQLA 2G6FX 3M56A 4AFSC 1ACMB 1K9AA 2NUTB 2EAYA 1K76A 2YUPA 3PE0A 2E12A 2HDAA 2LJ3A 2J3MA 2Q5HA 2ZPFB 1KSWA 4NL3A 2E5KA 4QVDA 1JJCA 4QQ6A 3JSCA 4Y92A 5M9OA 4X34A 2QQSA 2JT4A 1G3WA 4P3OA 1J5WA 1Q7YC 4UPAA 4P75A 2OAWA 2XKOC 1YWOA 2J6FA 2M16A 3OYCA 4WJ4A 1JJCB 1VQ5T 4D8DA 2DRMA 2RK1A 2CT3A 2LZ6B 3VS4A 3OS0A 3VQWA 2KT8A 4BUGA 4RTZA 2E64A 3CC4Q 3CPWA 5I11A 3GPLA 1SKUB 3EAEA 1YITT 5J39A 5A0GA 2QTXA 2O88A 3UH0A 3HSBA 3M4YA 2DXUA 4M78B 1T3SA 5GJVB 3TSZA 1Y71A 3UGTA 4YRGA 4JPBW 1MMDA 1YI2T 1IGQA 3NETA 2C06A 3ME9A 3PFSA 4PNOA 1D09B 3HTRA 5LJ3g 3URGA 4TQDA 1YGBA 1VA7A 4DBFA 2ABLA 3QWYA 1M1KC 1EIYA 1I5OB 2EYYA 1ZUKA 1MNEA 2DD4A 2ZPGB 2AMCA 1VQ8Q 1L0WA 4C8QC 3OBYA 2K57A 2KVQG 2DBKA 1RAIB 4J9GA 3RBBB 4EMKA 1RI0A 2VUBA 1M1GA 4C92D 1ABOA 1M3BA 5K1XA 4PJOD 1OYXA 2E1HA 3QO7A 5F5WA 4LDXA 4C5IA 3CD6Q 2KT1A 3P8BB 1SEMA 3JRZA 4M77A 4M7AG 1QVFP 2DIQA 4OB1B 2K3XA 5C6SA 1UE9A 3VS7A 1V1CA 2DM1A 2KK4A 2CJBA 3FDRA 3HXZA 1D0ZA 3C94A 3THKA 1YHQT 2XDDA 2CSQA 4UP9A 3OSSC 4HCBA 3NTKA 5AYFA 3EH2A 4BI4A 4P3PA 1MUZA 4J9CA 1KC8R 1LYLA 1AWOA 1Y0MA 5CQXA 4QQGA 3CMAQ 2AIRB 3VJPA 2ZT6A 1KD1U 2I4OA 2DL3A 3MF2A 3M58A 2KBTA 4C0FA 2ED0A 4J6XA 4CC4B 2P0LA 1AVZC 1HJDA 3KFVA 4PHCA 2LQNA 3PCOA 1GBRA 1N9SA 5E3IA 4H2XA 1QWEA 5IHKA 1G3SA 3EG1A 4YPFA 2EJFA 5KYUA 2QK0A 2FVUA 4BWAA 1YHQA 1OQKA 2DERA 2C0IA 2AHJB 2ZXFA 2PMFA 1VIFA 4XEOA 2EBPA 4X9DA 1SPKA 2NUPA 1U1TA 5LJ3f 1BK2A 4E2FB 3E9FA 4XTWA 1UUEA 2E70A 1WHGA 2D0QB 4J7FA 3VU3C 2FPFA 1R0BG 2RHYA 3HFNA 4TVYA 1FX7A 3CCJT 1Q86R 1H4TA 2VASA 2KRMA 4BACA 2G4CA 2NUPB 3QO5A 3L2WA 4BY6B 4JJNK 3H6ZA 2DXCA 5D7UA 2K3YA 4O6JA 1QF6A 5C52B 2X4YA 3OYAA 3HHTB 1V76A 5IAYA 6AT1B 5L8RE 3G71T 3JCMW 5KYWB 1YJWA 4Y91A 5CKBA 3MQZA 4YRFA 4WJ3M 1X2KA 2ECZA 1YCSB 2DVJA 4XAXB 2X4XA 1GCQC 4TQFA 3TSWA 4M78G 1LVKA 1BIAA 1QVFS 1LCKA 1PSFA 3M0UA 4FCYA 5GMKe 2CUBA 2E6NA 2KXCA 1Z9QA 1NE8A 2JUFA 3ER0A 3CCJA 2WSEE 4IUPA 4N0AC 1SRMA 5FRNA 4LDWA 2QQAA 3EG9B 4HWRA 4NCXA 4P72C 4BI3A 4BW9A 3V7SA 3MEWA 4J6YA 2HNIA 1VQOQ 3CCQQ 2Q7GA 4OMOA 4KH0B 4LXCA 4LVJA 1Z7MA 2VXFA 2ZPIB 1ZBXA 3NENA 2RHXA 1YI2Q 3OY9A 3MP8A 4J9BA 1UGQB 4YCWA 1YIJA 5HKCA 3MP1A 2YHTA 1QVPA 1LOJA 1R0CB 1NM7A 4YRMA 2DJZA 2YWWA 3LGLA 3C12A 4JRPA 3EGUA 2DXBA 3JCMc 5KCHA 1NLPC 1N9RA 3GIBA 2I2LA 1KK7A 2X35A 2ZPHB 4RTWA 5GAOm 2IVWA 2GFUA 4OGCA 2X3WD 1VQ4Q 1A0NB 4C8QB 4CRIA 4BB7A 3CBPA 1OPLA 4WF2A 3X26B 5I2SA 1QVFA 2C8MA 4RCCA 4DA4A 1WXBA 2RJCA 3TEHA 2RH2A 1K73U 1N8RR 1AHJB 1SSFA 2J05A 4FM4B 1USYA 3SWNC 1S1NA 4OMNA 1VQ9Q 1VYTA 1NJ8A 7AT1B 2LRQA 2DQ3A 5GAN6 3RKYA 1H3ZA 1S72Q 4M75D 3VQVA 1E6GA 4OMLA 1OZ2A 4P71A 5CO7A 2JOYA 1W66A 3CCVQ 1I07A 4IIMA 3HFVA 2BE9B 2QEXT 4M77E 2Y4XA 2QI2A 2I4LA 1X6GA 1NG2A 1NYRA 1MMNA 1X56A 2QA4T 2EVRA 1HSQA 2KYMA 1AZGB 1M90U 1XTDA 4LE9A 5ECAA 2V8JA 3VRYA 4ZIBA 3ZL7C 2DK3A 4YRLA 4LD6A 4H02A 1ZUYA 4LVLA 5LL6S 1C0AA 1E6HA 3P8VA 3NTHA 3UA7A 3JCMb 2X3XD 2AZVA 1M27C 4GBQA 3BDLA 2RN8A 5GMKl 3LX7A 3LSQA 1IB8A 1TOVA 5CR2A 4A63B 4M7DD 2GBQA 3X28B 3I56Q 2QEXA 4EPCA 2ZAEA 4XU2A 4F04B 4BE1A 4MMLA 4BE0A 1AWWA 2QHVA 2QA4A 4QKUA 2QTVA 2L3PA 3TEEA 1WQ7A 1R77A 1G5VA 2DMOA 3G71Q 1HTTA 3QBYA 3QXEB 1N27A 3TU4K 2Q5IA 3M4PA 3CMQA 3QO8A 1JEGA 3JB9F 2MMPA 4F16A 1AD5A 1PKSA 2ALYB 1YFRA 3VQYA 1Q95G 4QVZA 2DETA 2GCXA 4CC7A 3VQXA 4E7IA 1OU9A 3G6EQ 2DVEA 1TWBA 2JVVA 4N4IA 3JCMg 2E3HA 12ASA 3PZCA 5I22A 1ZA2B 3WQZA 4EMGA 1NJ2A 1M2VB 4P75C 4RTXA 2RMOA 1RAFB 1RLPC 1NYFA 2LX7A 2F2XA 3BFMA 4NS5A 3NHNA 1X43A 2BKDN 4AFUC 1KC8C 4V2SA 3LWHA 2X51A 4VUBA 4Q15A 3L2QA 3L2ZA 3CC4T 2K6DA 3VS5A 3NTIA 2KMTA 4GLMA 2EQMA 2KE9A 1EQRA 2P0PA 4IKFA 2J3LA 4A54A 2DL5A 2VWFA 3LWIA 2JMAA 2YRCA 2COWA 1E24A 4C8QG 2EQKA 2E5AA 4BD3A 3L4GA 2H3JA 2M51A 5GANf 1ZSGA 3AT1B 4LUDA 1WJRA 2DDZA 4OVAA 1UJ0A 4AFZC 3QIIA 1IREB 3OYBA 3HRUA 4A4FA 2DEQA 1UJYA 4JS4A 1JRIA 4J7IA 4HWPA 1GGMA 3L4GB 3HXVA 5DM7R 4CI0C 2B8AA 3DSQA 5CQYA 1NJIR 1M3CA 4JJCA 3CC4A 3M0PA 4DOVA 1VQ8T 2PVOB 3ZBDA 2KRSA 4WTOB 2A36A 2HQHA 4EMKC 1W70A 4EIKA 1Q86C 2COYA 4LN2A 5LJ5j 1RI9A 5GAN8 2KR3A 1QE0A 1RAGB 2R58A 2MK5A 1VQKA 2RA2A 1ZBJA 4E7KA 4J5YA 3CD6T 4J9EA 3SWNB 5GMKi 4YRQA 3FJPA 4LDYA 4CH6A 2QHSA 1K8AU 3N5BB 2XK0A 2XIDA 4JLGA 2MOXA 2K2VA 3JCMf 2EGEA 3C4SA 1QW1A 2P5IA 3HXXA 1VQ8A 1KMNA 3E9HA 2JJ9A 2QDLA 2RQRA 2YRDA 1HD3A 2DYIA 1WYXA 1KD1R 4PLLA 4XTZA 3MCAB 2ZR2A 3CMAT 3X20B 4C92F 4M7DE 1YFNA 3ZEHA 2RK2A 4YROA 4XU3A 4PJOF 1OPKA 5KYYB 2IIMA 2XU8A 8ATCB 2ODRD 3CD6A 4YRSA 1G3YA 4F14A 2WSFE 3OYMA 1PYSB 1VYVA 1LPLA 2ED1A 1AWJA 2CP2A 2A28A 2J7IA 3KUFA 3C95A 2RHUA 1OX8A 4NOYA 2E3CA 1GBQA 1NPRA 4XTXA 2AT1B 5FU7B 3IG2A 3CCRQ 3OYFA 1TH7A 2HEQA 3OYJA 3LLRA 2LMJA 4MZMA 2WACA 1WU7A 3CMAA 2E65A 2QGGA 2GNCA 3QPHA 1SRYA 1PNJA 4O5VA 1UGVA 1WFWA 2ZT5A 1PRLC 2RQVA 1KIKA 4PG3A 2CP6A 1PD0A 2OAUA 4M7AD 3QDFA 4NL2A 3ERRA 4JJBA 1X2GA 2MI6A 1MNDA 1N8RC 3RMQA 2MYSA 2O31A 4C92A 4YRCA 1T0HA 2FO0A 4KGZB 4PJOA 2P4TA 4AFQC 3EFSA 4Z89A 2H8HA 1G8XA 4M77F 5DY9A 4XK8E 1OEBA 3QJYA 4TTVA 4JS5A 4J9HA 3G4SQ 4C0ZA 1W6XA 4Q5WA 1B70A 2LCSA 2LJ0A 3VYGA 1WJSA 2L8DA 5GAN5 4KR2A 4UP7A 3JCMJ 2HZYA 2R57A 4AG2C 3G1ZA 1K9MR 1UGRB 5GAMg 2CIMA 3A8HB 4ZGDB 3EG0A 2RHQA 4E7HA 4KGXB 5LJ5e 4Z02A 1WHKA 2DX1A 3CCMQ 3CCQT 1VQOT 3EFRA 1FYFA 4B9XA 1W2BP 1IL2A 5CIUA 1I1JA 3M4QA 2NS6A 1VQ5A 3H0IA 5KNNA 2EL9A 2YUOA 4MZTA 1UFFA 1BU1A 4CC2A 2ZPBB 4F7UF 5LJ3j 2YRVA 1NEGA 2HSEB 2GQIA 3I5RA 1YITA 4MZPA 2XD0A 2EWNA 1G5IA 4J83A 1AOJA 2BE7D 4CH3A 1BCMA 2KGTA 5GAMd 1TUCA 1BKBA 3A8LB 2EJ9A 2V26A 1EIYB 2ZINA 4QVCA 1IGUA 1VQ4T 2AMCB 1H3HA 2VXEA 4PFOA 3CCQA 5HY6A 4EMKB 1NBEB 3DLMA 1QCFA 4G85A 5CAIA 1Q81U 2XTIA 1RAHB 1YI2A 1RAAB 2CP0A 1D0YA 3VYHB 4DPGA 4UP8A 5LJ3d 5IHNA 3NFCA 5FWCA 1TTHB 1FMVA 1WXTA 3FJ5A 3A7AA 2LX9A 2XMFA 3CBOA 2LCLA 2EFIA 5CCAA 3HRSA 3JCMQ 4M77B 1USYC 3L2RA 4PK4A 2J6OA 1ZA1B 1VQ9T 3OYHA 2DQ0A 2QDYB 3NGPA 5HGQA 1UHCA 4JUVA 1UB4A 2J06A 4M78D 2Y4YA 3H0FA 1X6OA 3QKJA 3OS2A 1S72T 2LT4A 3UGQA 3MP6A 5EG2A 3I55Q 1YB3A 4IUVA 1FXXA 1I0CA 1MV0B 4KT0E 1VQ4A 3FEOA 1QLYA 3EFOA 1UHFA 4FYVB 5LJ5h 3EHRA 3CCVT 2O9VA 2HMAA 1K1ZA 4A4GA 1H8KA 5CKFA 3I5SA 4F7UA 3JCMV 1EZZB 5CKEA 1KHIA 5GAMf 1Y57A 1M90R 2FPDA 4G84A 1ZQ1A 2IY5A 1X54A 4HT4A 3HXUA 1WX6A 4AH6A 1VQ9A 5CVIA 3RDVA 3PCOB 2JZ2A 2DTHA 4H2XB 4R55A 4BI8B 1WJQA 2EQUA 1F1BB 2LJ1A 2ROTA 3V8LA 4YRIA 3MJXA 1MMAA 1PM3A 3MEYA 2BTTA 1X55A 5KYUB 4M7AE 4HT9A 5KCOA 4DBQA 2ZZDA 1S72A 1BYMA 3DB4A 4A53A 2KSSA 2QAZA 1W2BS 1VQ7Q 1FMKA 1G51A 1BI3A 4A4EA 3KFUA 2QHUA 3OMGA 4PJNA 1BI0A 2L0AA 3F70A 4CS3A 4XU1A 2A3LA 2X4JA 1X6BA 3HL8A 3I56T 2ZR3A 4PJLA 2Y90A 1NJIC 2EKHA 1QWFA 3A8MB 2H3EB 2DL4A 2RNAA 2QHTA 2LDMA 4HWSA 1SG5A 1NJ6A 4D6WA 2FEIA 1YWPA 2AKWA 1ASYA 4FW1A 1K4US 4P74A 1I8FA 3QNEA 5KE2A 4KUDK 2K3BA 1C6VX 5HK0A 3OYIA 2CH4W 2NUZA 3HKSA 2KXDA 5GJWB 4RTUA 3G6ET 2DU5A 2CZ0B 3OW2A 4M7DF 3CCLQ 1IHVA 3RACA 2GTJA 1BIBA 2DE0X 2F5KA 3MO8A 1ASZA 3MEAA 4OB3B 3EG3A 4IURA 2CJAA 3DLLA 5CK9A 4EO4A 2JS2A 2DL7A 4M75A 1KD1C 2BUDA 3G71A 1W2BA 1E7OA 4FL6A 2F5TX 2MWPA 4C92E 4CH5A 3O5ZA 4J9FA 4PJOE 1ABQA 1KQSP 2OTLQ 4HCZA 4XU0A 4XTYA 1WZOA 2DEUA 3A8OB 3OMCA 2CJ9A 5KYXA 3G6EA 3OYDA 4CH4A 2R5MA 3D7SB 2KROA 4N4GA 1FWZA 3QZ9B 3EG2A 4AG1C 1SHGA 2AZSA 4KH1B 3TREA 2ZIMA 8AT1B 4ZNXA 1O75A 3UWNA 2ATCB 3HRKA 5IXBA 1YFSA 1X2QA 2HL5C 4ZN1A 4M78E 4RMFA 2RQUA 2OI3A 1NJ5A 2COZA 1DJ7B 4UC4A 5GAN2 5GAOn 3M4GA 4M7DA 2FB7A 1OI1A 4OMFB 2XDPA 2EJGA 3A5ZA 4ZN3A 3TEHB 5LJ3h 5GAOr 2I4NA 2AK5A 4M7DB 1K8AR 1Q82U 4WI1A 5FLXE 4HXJA 5GAOp 2GFAA 3M53A 4R0KA 2C7IA 4P73C 2JN0A 3S3OA 1D0XA 2HKQB 3VS6A 4C5GA 3A98A 3HFZA 1W1FA 1WHMA 4PJMA 1RLQC 1IZ6A 1U5SA 3M0QA 1H4VB 5GAN4 4AT1B 4D8KA 3S6WA 1B8AA 2E4HA 3GLXA 2R5AA 3KBGA 2A0FB 5GANg 2EQJA 3QYHB 1K9MC 3REAB 1U8RA 5A0LA 4J9DA 1QKWA 3IKLA 2FZKB 4QT7A 4C8QD 3ASKA 1MHNA 1TSFA 2DL8A 1U1SA 4DOWA 2PZ1A 5FU7C 1B07A 1TG0A 4KBMB 3OYYA 4ATOA 3CC7Q 4YDQA 3CCUQ 5A2QE 3INZA 2BZXA 4YREA 1KQSS 4TVAA 3CXCP 1KFZA 1AT1B 2M0YA 3CQTA 4F7UE 1NPPA 1TXQA 4XTUA 3IKMB 3CCRT 3TQ7P 3CMEQ 4DEYA 2HAXA 5GANd 1OZ3A 2O4XA 4PKCC 4GY5A 2RQTA 3NPFA 1XOVA 4RUGA 3H0HA 1QCNA 2XHCA 4TVRA 3LH5A 1GFDA 3RKWA 4YCVA 1Q86U 3MPUB 3KXTA 3A5YA 3EGDA 1GXIE 2L89A 1UECA 4L5GA 2O4XB 2VGMA 4B6MA 3EGXA 4PL6A 1H4QA 1LNXA 5D6YA 4HCKA 1YIJQ 1YJ9Q 3EGDB 3E19A 4JRIA 4C92C 2RPNA 3EGXB 4PJOC 1K0SA 3CCRA 1M2OA 1KG1A 1QVGP 2RJFA 2DFUA 1VQMQ 4HVWA 5IT9E 2DAQA 1KMMA 4RCBA 2V1RA 1T0JA 1WLPB 4OMMA 3G4ST 4JRQA 3A7RA 3V8KA 3OYEA 2RI2A 2OTJQ 2RD1A 4LNPA 3A7UA 3QYGB 4XTVA 1KQSA 2K5IA 2D9TA 1ARKA 1D1BA 1VIEA 4DBRA 3JCMd 4M7AF 1OV3A 1UGPB 1WHJA 5D6WA 2DPPB 4ZGJB 3CCMT 4HWTA 1M90C 2D0NA 3I9QA 4FU6A 1HK9A 3OS1A 2KY9A 2KNBB 2ZT8A 4XQ3A 1D3BA 1UGSB 2DRKA 3JB9H 1VQNQ 1GL5A 1KJWA 2ZTGA 2GQVA 2L3SA 3PIOA 2ARSA 3HRIA 1Y96A 3V7CA 1P92A 3G4SA 3X25B 2YXYA 4YRJA 4M75E 2MF2A 1ZLMA 5HCKA 3SB2A 3VUZA 1M8VA 3HRTA 1JB0E 1G3TA 3CXCS 4YP0A 1Q81R 1BBZA 1X01A 4E6RA 3CCMA 4M77C 3SDZA 3HTZA 2YSQA 1HYOA 2IG0A 2ZZGA 3A32A 1WYDA 2XG8D 2E41A 2ZIOA 2ZT7A 4H2UA 2O9SA 1WQWA 4OP0A 5EC7A 1H4SA 1CKAA 4AMCA 1N9WA 4ZTFA 4H2WA 4ME7A 2DZ9A 4H2TA 2ZZEA 1Q7YU 2J6KA 4BDYA 2CYZB 2PNIA 2W10A 2D8JA 2D8HA 1CSKA 1H92A 2CKKA 4M7AA 1OX9A 3OBWA 1VUBA 4YCUA 1YNZA 1E1OA 2PVDB 3MEVA 4K11A 1HXDA 2RI3A 3WVEB 2V8IA 3BJUA 1M4ZA 1BB9A 4F17A 1NLOC 3I55T 2FRYA 2G3RA 1OU8A 4M7AB 1B7YA 2QASA 2K5FA 3R6OA 4P5NA 3REXA 3CCSQ 4PFPA 1QVGS 1D1AA 3ZFJA 4RTTA 3QJ6A 4JJDA 4Q6GA 4QW2A 3DKMA 1YJNQ 1Z7NA 2O01E 3JB9J 5FW9A 3H9NA 3GP8A 1B7YB 4ELYC 3EH1A 2FG0A 3VS2A 3I7FA 4H2SA 2QQ9A 2DD5A 5I21A 3M0SA 3CXCA 2DNUA 4EMHA 1BCOA 3LC0A 1OULA 4LVMA 1M1KU 2Q7HA 1SRLA 4FSXA 3OYLA 4M78F 1PSEA 4Y28E 1HC7A 4QQDA 1ZSZA 3I55A 2DU7A 2MWOA 1VQ7T 2VYTA 2VC8A 2ENMA 3RNJA 4C0DC 2DILA 4LDVA 2PQWA 1PG5B 3TUPA 2I0NA 5GMKm 2NUTA 1QCOA 1SF9A 1VQPQ 1KQ2A 2D1XA 1AWXA 4OB2B 4DBHA 1RACB 3H41A 1SESA 4C0GA 2VVKA 1JXOA 2M02A 3VS0A 4ZTJA 2A7YA 1QQJA 3JAME 4KULA 3OYGA 3I35A 4J8OA 2L5QA 2D6FA 3FLGA 4KGVB 3MKDA 5LJ5f 4HWOA 4P74C 4C5HA 3HXYA 2LQWA 1QVGA 4J9IA 4LNSA 3OYNA 3LW5E 1ADYA 1X2HA 4C92B 1K8AC 1SHFA 4MDXA 1RABB 2CUDA 4WCIA 3REBB 4PJOB 1VQ7A 1ZX6A 4LD9K 3OW2P 2EPDA 4M4ZA 2EIFA 5GAN3 1JBMA 2BZYA 2O2OA 4YRTA 3CCLT 2PMEA 1B70B 1UG1A 2EGCA 3J80E 4A4HA 5GAMj 3PTAA 4M78A 3SD4A 4LVKA 4IUUA 4BE2A 1NYGA 3JB9G 4M75C 1VQ6Q 4JLIA 1RIQA 2PUOB 3FC3A 1U3OA 2RHQB 1TU0B 5GAOl 3WVDB 4PJJA 3JCMh 5FRMA 3SEMA 2NYSA 4HVUA 5D6XA 4FT4A 2OTLT 1GRIA 3PGGA 1VQKQ 2LQ8A 1NZ9A 2QQBA 4E7LA 3VKIA 3P8DA 2KI7A 2HQEA 3R07A 3VRZA 1M3AA 1UEBA 4HVCA 2FHDA 2CZ6B 4PLIA 3L2UA 1IXDA 1B76A 2K7AA 1VOMA 4A4KA 4P3NA 4OMQA 4RTYA 3WXMB 2Q7EA 3G7ZA 3CCLA 2LQKA 4H2YA 2CZ1B 2EKOA 2JTFA 5GMKj 3EHQA 1VQOA 2M1HA 3E9IA 3GNFB 4KUIA 3TVTA 5A0DA 1N5ZA 1EVKA 5KH6A 2LP5A 3NEMA 1NJIU 4E51A 1K73R 4E47A 2FPEA 1EOVA 2E6ZA 2DTOA 1R8OB 1Y07A 2F1LA 1GCPA 2XI9A 2OTLA 4M7DC 11ASA 3C0CA 1CKBA 2GF7A 5IH2A 4HT8A 5FU6C 1G5HA 2C0TA 4K87A 2L3RA 1WGSA 2LC4A 1BBWA 2CP5A 1Q82R 4YRPA 1YN8A 2ZCFB 4EX5A 5DLQE 1FYNA 2HCKA 3VS1A 4K86A 3REUA 3RMSA 3CCEQ 3META 1KQ1A 4P71C 2ROLA 4X9CA 2K4YA 3LYIA 3OB9A 2BIVA 2RB6A 4DEXA 4LUEA 1VQZA 2Z0WA 5CKHA 3CC2Q 4H2VA 2QGFB 9ATCB 3QG1A 3E9GA 3SHWA 5IXFA 3QSUA 3W3SA 3ICAA 3EFOB 3LSSA 2DBMA 3RGLA 5CKDA 1KOGA 3PNWC 1VQLQ 1Y7XA 1YCYA 1ZUUA 1JO8A 4X5OA 4CC3A 3OW2S 4F7UB 1YP5A 3RR6A 2RM4A 3UFGA 1MGQA 1QMCA 2IY5B 1PKTA 3PT9A 1SSHA 3L42A 4Z88A 4YTLA 2RJEA 4M75F 1UDLA 1ADJA 4Z8AA 3CEYA 5AT1B 3QZ5B 3Q1JA 1J3TA 3A31A 3BDUA 1VYUA 2CP7A 3VUBA 3CCVA 4TWAA 2RF0A 1C1AA 4O2DA 2NLUA 3M54A 3CC7T 1YJWT 2LNHB 1ZHIA 4E7JA 3CCUT 4FYWB 4M77D 1RADB 2FL7A 1M1FA 1TUGB 3S3MA 1QP2A 2ESWA 3H8ZA 3CMET 4C0DB 3PMTA 1PD1A 4C92G 4OF1A 2A08A 5GAMe 1OOTA 4PJOG 4ORZA 4ZTZB 2LVMA 1B7TA 5K1PA 1Q81C 3UT1A 5KYWA 1WHLA 2GTOA 4FYXB 2OJ2A 2HSPA 2HL3A 1SETA 4RG8A 2KRNA 4C8QF 4KRTA 2JNGA 1EVLA 2P0QA 1WNLA 1M30A 1X27A 3OSVA 2AKWB 2DF6A 4RG2A 5LJ3e 3S3NA 3OS5A 1U06A 5J26A 2JXBA 3CC7A 4FT2A 1YIJT 2JS0A 3CCUA 1YJ9T 2HBWA 3I56A 1VQ5Q 4L87A 1M5Q1 1WPYA 1N6AA 2E10A 3EG9A 3CMEA 2L2PA 1YITQ 1VQMT 2RI5A 3PVQA 1UTIA 4ZGEB 2CGHA 2HKNA 2RO0A 2OTJT 2SRCA 1AEYA 1BBUA 2CZ7B 2HD0A 1WXUA 3MHXA 3AHUA 2PVGB 2KYBA 1KHCA 2JW4A 2EYZA 2X4WA 4MMKA 1K9MU 4M75B 1EIFA 3QTCA 2XDBA 3G1JA 3L1AA 1W4SA 1NYQA 1YJ9A 2CSIA 3P8YA 3RESA 2YLCA 2LT1A 1G2BA 1NJ1A 5KYXB 3BY7A 4M77G 3J7AF 1PCXA 2RQWA 3JB9I 4C8QA 3OYKA 2QYZA 1VQNT 2FZCB 1VQMA 2ODRC 4HA8A 1JU5C 5FWBA 5GAMh 2E3IA 1MMGA 3FIFA 4RMOA 2VKNA 3PVLA 2OTJA 3MEUA 3MF1A 3IQLA 3IALA 3QDRB 2EW3A 1JJ2P 2HQXA 4N4HA 4RKUE 1C0MA 4JZ4A 2PUKB 5GAOq 2ZPEB 2QG9B 4R56A 1FMWA 4CS2A 2E5QA 3A74A 1QP3A 4JDSA 4X1VA 3A5ZB 5FU6B 2FRWA 1Q7YR 1Z9ZA 1BI2A 3UF4A 5J3BA 2ARTA 3NMZC 3M0TA 1YHQQ 4FSSA 4F7UG 1VQNA 1E22A 1TS9A 5GMKh 5C51B 1MV3A 5GAN7 3DB3A 3CPFA 2VB6A 2RHSA 2DLPA 1JXMA 4M7AC 3M55A 3HXWA 2YDLA 1KC8U 3QWXX 4YYEA 3V7RA 4PFZA 1H641 2JTEA 2YUNA 2L3QA 5C53B 1TUDA 3HFZB 1I5LA 1K0XA 2JTMA 5GANj 2RHSB 2ZZFA 5HK3A 2LCCA 3CCST 3L2VA 1V29B 4KQEA 3HFOA 4JZ3A 3OA6A 2EYQA 1AZEA 3CBMA 1YJWQ 1YJNT 3JCMP 5ELNA 4YRRA 3VS3A 3QO3A 3M9QA 2RHZA 1YFTA 4FIBA 1X75C 2CP3A 1G83A 1M1KR 2ZNJA 3T9NA 4LVIA 2GGRA 3UATA 1T3LA 2K9GA 2A8EA 1RUWA 1RL2A 4OGEA 2K5LA 4TVAB 2F69A 3CCJQ 1ZSZC 4E7ZA
chains in the Genus database with same CATH topology
2QXFA 1E1TA 4L6V5 4J15A 2M9UA 3X24B 4OB0B 4IUQA 3CCSA 2DXTA 4HKEA 3RF1A 4RQEA 1VQPT 1K73C 2ALYA 5DLOA 3JCMX 2YLBA 1NNHA 1YJNA 4YRKA 3P8HA 2KDSA 2PU9B 2RHIA 4ZTUB 4ELZC 3RUXA 1JJ2S 4YRNA 3M59A 2WSCE 3GF5A 2KQWA 1XNIA 1Q82C 3PMIA 4M75G 3OD1A 4N0AA 1BI1A 4DQ2A 1M9SA 2VGNA 2RJDA 5I2MA 4P72A 3M57A 3VV0A 3OQ5A 3QHSA 2HBPA 5C0MA 1VQPA 2QQRA 2VV5A 4RQFA 4M78C 3UDCA 2DZCA 3NELA 3O8VA 2DTIA 5IN1A 4IUTA 1VQ6T 1XQHA 2MAMA 2KAFA 4GLKA 5ELOA 4B9WA 3J81E 1VQKT 3RKXA 4OLFA 3PIPA 2XGTA 3V8JA 3QUIA 1D3BB 4M7DG 1I81A 4KR3A 1Y96B 2DIGA 1JJ2A 3A8GB 1SERA 2CS7A 4LDUA 5GANe 2P0KA 5LJ5g 2I4MA 1VQ6A 3SWNA 4EDUA 2ZCEA 1N8RU 3TEGA 2LNVA 4L59A 4C8QE 3HY1A 3SFMA 3UPUA 1LJOA 4HCCA 4P73A 4TVWA 3VBBA 3RERA 3BW1A 4J6WA 2M0OA 3CCET 2FYKA 3HPWA 3HP9A 4XEMA 3GNGA 5LJ5d 1EFWA 3P8TA 1O9SA 2ZGWA 3CC2T 2LTOA 1PYSA 1I4K1 3LGFA 3GOXA 3JB9D 2ARUA 1VQLT 1B34A 3HY0A 2DKGA 2XICA 3JCMe 2ZNIA 4BDZA 3LH0A 3CPWS 1ATIA 2DO3A 4C5EA 4MDWA 1WLEA 4JRKA 1B34B 3E1SA 3CCEA 4II1A 3RIRA 4K88A 2V8KA 1YBYA 4RDXA 3FRNA 5GANh 3M5AA 3CC2A 4CS4A 3RL6A 5KE3A 3FB9A 3TCJA 4BY6C 5FROA 1VQLA 3M56A 2EAYA 2E12A 2J3MA 2Q5HA 2ZPFB 4NL3A 4QVDA 1JJCA 4QQ6A 3JSCA 5M9OA 4X34A 2QQSA 1G3WA 4P3OA 1J5WA 1Q7YC 4UPAA 4P75A 2XKOC 2M16A 3OYCA 4WJ4A 1JJCB 1VQ5T 2RK1A 3OS0A 3VQWA 4BUGA 2E64A 3CPWA 3GPLA 3EAEA 1YITT 5J39A 5A0GA 2QTXA 3UH0A 3HSBA 3M4YA 2DXUA 4M78B 1Y71A 3UGTA 4YRGA 1YI2T 3NETA 2C06A 3ME9A 3PFSA 4PNOA 5LJ3g 3URGA 4TQDA 1YGBA 1M1KC 1EIYA 2DD4A 2ZPGB 2AMCA 1L0WA 4C8QC 3OBYA 2K57A 2KVQG 4EMKA 1RI0A 2VUBA 1M1GA 4C92D 5K1XA 4PJOD 1OYXA 2E1HA 3QO7A 5F5WA 4LDXA 4C5IA 3P8BB 3JRZA 4M77A 4M7AG 2DIQA 4OB1B 2K3XA 5C6SA 2KK4A 2CJBA 3FDRA 3HXZA 3C94A 1YHQT 2XDDA 4UP9A 3OSSC 4HCBA 3NTKA 5AYFA 4BI4A 4P3PA 1LYLA 5CQXA 4QQGA 3VJPA 2ZT6A 1KD1U 2I4OA 3MF2A 3M58A 4C0FA 4J6XA 2P0LA 4PHCA 3PCOA 1N9SA 5E3IA 4H2XA 1G3SA 4YPFA 2EJFA 2FVUA 4BWAA 1YHQA 2AHJB 2ZXFA 2PMFA 1VIFA 4XEOA 4X9DA 1U1TA 5LJ3f 3E9FA 4XTWA 2E70A 2D0QB 4J7FA 3VU3C 2RHYA 3HFNA 4TVYA 1FX7A 3CCJT 1H4TA 4BACA 2G4CA 3QO5A 3L2WA 4BY6B 4JJNK 3H6ZA 2DXCA 2K3YA 4O6JA 1QF6A 5C52B 2X4YA 3OYAA 3HHTB 5IAYA 5L8RE 3G71T 3JCMW 1YJWA 4Y91A 5CKBA 3MQZA 4YRFA 4WJ3M 4XAXB 2X4XA 4TQFA 4M78G 1BIAA 1QVFS 1PSFA 5GMKe 2E6NA 1NE8A 2JUFA 3ER0A 3CCJA 2WSEE 4IUPA 4N0AC 5FRNA 4LDWA 2QQAA 4HWRA 4NCXA 4P72C 4BI3A 4BW9A 3V7SA 3MEWA 4J6YA 2HNIA 2Q7GA 4LVJA 1Z7MA 2VXFA 2ZPIB 1ZBXA 3NENA 2RHXA 3OY9A 3MP8A 1UGQB 4YCWA 1YIJA 5HKCA 3MP1A 2YHTA 1QVPA 1LOJA 4YRMA 2DJZA 3LGLA 3C12A 4JRPA 2DXBA 3JCMc 5KCHA 1N9RA 3GIBA 2I2LA 2X35A 2ZPHB 5GAOm 2IVWA 2GFUA 4OGCA 4C8QB 4CRIA 4BB7A 3CBPA 4WF2A 3X26B 5I2SA 1QVFA 2C8MA 4RCCA 4DA4A 2RJCA 3TEHA 2RH2A 1K73U 1AHJB 1SSFA 4FM4B 1USYA 3SWNC 1NJ8A 2LRQA 2DQ3A 5GAN6 3RKYA 1H3ZA 4M75D 3VQVA 1OZ2A 4P71A 5CO7A 2JOYA 1W66A 3HFVA 2QEXT 4M77E 2Y4XA 2QI2A 2I4LA 1NYRA 1X56A 2QA4T 1M90U 1XTDA 2V8JA 4ZIBA 2DK3A 4YRLA 4LD6A 4H02A 4LVLA 5LL6S 1C0AA 3P8VA 3NTHA 3JCMb 3BDLA 5GMKl 3LX7A 3LSQA 5CR2A 4M7DD 3X28B 2QEXA 4EPCA 4XU2A 4BE1A 4MMLA 4BE0A 2QHVA 2QA4A 3TEEA 1WQ7A 1G5VA 1HTTA 3QBYA 3QXEB 1N27A 3TU4K 2Q5IA 3M4PA 3CMQA 3QO8A 3JB9F 2MMPA 2ALYB 1YFRA 3VQYA 4QVZA 2GCXA 3VQXA 4E7IA 2DVEA 2JVVA 4N4IA 3JCMg 3PZCA 12ASA 3WQZA 4EMGA 1NJ2A 4P75C 3BFMA 4NS5A 2BKDN 1KC8C 4V2SA 3LWHA 4VUBA 4Q15A 3L2QA 3L2ZA 3CC4T 3NTIA 2KMTA 2EQMA 1EQRA 2P0PA 4IKFA 2J3LA 4A54A 3LWIA 1E24A 4C8QG 2EQKA 2E5AA 4BD3A 3L4GA 2H3JA 5GANf 1WJRA 2DDZA 4OVAA 3QIIA 1IREB 3OYBA 3HRUA 4A4FA 2DEQA 4JS4A 1JRIA 4J7IA 4HWPA 1GGMA 3L4GB 3HXVA 5DM7R 4CI0C 2B8AA 3DSQA 5CQYA 3CC4A 4DOVA 1VQ8T 2PVOB 3ZBDA 4EMKC 1Q86C 5LJ5j 5GAN8 1QE0A 2R58A 1VQKA 2RA2A 4E7KA 4J5YA 3CD6T 3SWNB 5GMKi 4YRQA 3FJPA 4LDYA 4CH6A 2QHSA 1K8AU 3N5BB 2XK0A 2XIDA 4JLGA 2K2VA 3JCMf 3C4SA 1QW1A 2P5IA 3HXXA 1VQ8A 1KMNA 3E9HA 4PLLA 4XTZA 3MCAB 2ZR2A 3CMAT 3X20B 4C92F 4M7DE 3ZEHA 2RK2A 4YROA 4XU3A 4PJOF 2ODRD 2XU8A 3CD6A 4YRSA 1G3YA 2WSFE 3OYMA 1PYSB 3KUFA 3C95A 2RHUA 4NOYA 2E3CA 1NPRA 4XTXA 5FU7B 3IG2A 3OYFA 1TH7A 3OYJA 3LLRA 4MZMA 2WACA 1WU7A 3CMAA 2E65A 3QPHA 1SRYA 4O5VA 2ZT5A 4PG3A 2OAUA 4M7AD 4NL2A 3ERRA 1X2GA 2MI6A 1N8RC 3RMQA 4C92A 4YRCA 4PJOA 2P4TA 3EFSA 4M77F 5DY9A 4XK8E 3QJYA 4TTVA 4JS5A 4C0ZA 4Q5WA 1B70A 3VYGA 1WJSA 2L8DA 5GAN5 4KR2A 4UP7A 3JCMJ 2R57A 3G1ZA 1UGRB 5GAMg 2CIMA 3A8HB 4ZGDB 2RHQA 4E7HA 5LJ5e 4Z02A 1VQOT 3CCQT 3EFRA 1FYFA 4B9XA 1IL2A 5CIUA 3M4QA 2NS6A 1VQ5A 5KNNA 2EL9A 4MZTA 2ZPBB 4F7UF 5LJ3j 2YRVA 1YITA 4MZPA 2XD0A 2EWNA 1G5IA 4J83A 4CH3A 5GAMd 1BKBA 3A8LB 2EJ9A 1EIYB 2ZINA 4QVCA 1VQ4T 2AMCB 2VXEA 3CCQA 5HY6A 4EMKB 3DLMA 4G85A 5CAIA 1Q81U 2XTIA 1YI2A 3VYHB 4DPGA 4UP8A 5LJ3d 3NFCA 3A7AA 2LX9A 3CBOA 2LCLA 2EFIA 5CCAA 3HRSA 3JCMQ 4M77B 1USYC 3L2RA 1VQ9T 3OYHA 2DQ0A 2QDYB 5HGQA 4JUVA 1UB4A 4M78D 2Y4YA 1X6OA 3QKJA 3OS2A 1S72T 2LT4A 3UGQA 3MP6A 5EG2A 1YB3A 4IUVA 1FXXA 4KT0E 1VQ4A 3FEOA 5LJ5h 3CCVT 4A4GA 5CKFA 4F7UA 3JCMV 5CKEA 1KHIA 5GAMf 4G84A 1ZQ1A 2IY5A 1X54A 4HT4A 3HXUA 4AH6A 1VQ9A 5CVIA 3PCOB 2JZ2A 2DTHA 4H2XB 4R55A 4BI8B 1WJQA 2EQUA 3V8LA 4YRIA 3MEYA 1X55A 4M7AE 4HT9A 5KCOA 2ZZDA 1S72A 1BYMA 3DB4A 4A53A 2KSSA 1W2BS 1G51A 1BI3A 4A4EA 3KFUA 2QHUA 3OMGA 1BI0A 3F70A 4CS3A 4XU1A 2A3LA 2X4JA 3HL8A 3I56T 2ZR3A 2Y90A 1NJIC 3A8MB 2QHTA 2LDMA 4HWSA 1NJ6A 4D6WA 2AKWA 1ASYA 4P74A 1I8FA 3QNEA 5KE2A 4KUDK 5HK0A 3OYIA 3HKSA 3G6ET 2DU5A 2CZ0B 3OW2A 4M7DF 3RACA 1BIBA 2F5KA 3MO8A 1ASZA 3MEAA 4OB3B 4IURA 2CJAA 3DLLA 5CK9A 4EO4A 4M75A 1KD1C 2BUDA 3G71A 1W2BA 4FL6A 2F5TX 2MWPA 4C92E 4CH5A 4PJOE 4HCZA 4XU0A 4XTYA 3A8OB 3OMCA 2CJ9A 3G6EA 3OYDA 4CH4A 2R5MA 4N4GA 1FWZA 3QZ9B 3TREA 2ZIMA 1O75A 3UWNA 3HRKA 1YFSA 4ZN1A 4M78E 4RMFA 1NJ5A 1DJ7B 4UC4A 5GAN2 5GAOn 3M4GA 4M7DA 2FB7A 1OI1A 4OMFB 2XDPA 2EJGA 3A5ZA 4ZN3A 3TEHB 5LJ3h 5GAOr 2I4NA 4M7DB 4WI1A 1Q82U 5FLXE 5GAOp 2GFAA 3M53A 2C7IA 4P73C 2JN0A 3S3OA 4C5GA 3HFZA 1IZ6A 1H4VB 5GAN4 3S6WA 1B8AA 3GLXA 2R5AA 3KBGA 5GANg 2EQJA 3QYHB 1K9MC 1U8RA 5A0LA 3IKLA 4C8QD 3ASKA 1MHNA 1U1SA 4DOWA 5FU7C 4KBMB 3OYYA 4ATOA 4YDQA 5A2QE 3INZA 4YREA 1KQSS 4TVAA 4F7UE 1NPPA 4XTUA 3IKMB 3CCRT 2HAXA 5GANd 1OZ3A 2O4XA 4PKCC 4GY5A 1XOVA 2XHCA 4TVRA 3RKWA 4YCVA 1Q86U 3KXTA 3A5YA 1GXIE 2L89A 4L5GA 2O4XB 2VGMA 4PL6A 1H4QA 1LNXA 5D6YA 3E19A 4JRIA 4C92C 4PJOC 3CCRA 1KG1A 2RJFA 5IT9E 2DAQA 1KMMA 4RCBA 3G4ST 4JRQA 3A7RA 3V8KA 3OYEA 2RI2A 2RD1A 3A7UA 3QYGB 4XTVA 1KQSA 2K5IA 2D9TA 1VIEA 3JCMd 4M7AF 1UGPB 5D6WA 4ZGJB 4HWTA 2DPPB 3CCMT 1M90C 4FU6A 1HK9A 3OS1A 2KY9A 2ZT8A 4XQ3A 1D3BA 1UGSB 3JB9H 2ZTGA 2GQVA 3PIOA 2ARSA 3HRIA 1Y96A 3V7CA 1P92A 3G4SA 3X25B 4YRJA 4M75E 2MF2A 3SB2A 3VUZA 1M8VA 3HRTA 1JB0E 1G3TA 3CXCS 4YP0A 1X01A 3CCMA 4M77C 3SDZA 3HTZA 2IG0A 2ZZGA 3A32A 1WYDA 2XG8D 2E41A 2ZIOA 2ZT7A 4H2UA 1WQWA 4OP0A 1H4SA 1N9WA 4ZTFA 4H2WA 4ME7A 2DZ9A 4H2TA 2ZZEA 1Q7YU 4BDYA 2CYZB 2CKKA 4M7AA 3OBWA 1VUBA 4YCUA 1E1OA 2PVDB 3MEVA 1HXDA 2RI3A 3WVEB 2V8IA 3BJUA 1M4ZA 3I55T 2G3RA 4M7AB 1B7YA 2K5FA 3R6OA 4P5NA 3REXA 1QVGS 3ZFJA 3QJ6A 4Q6GA 4QW2A 3DKMA 1Z7NA 2O01E 3JB9J 3GP8A 1B7YB 4ELYC 3I7FA 4H2SA 2QQ9A 2DD5A 5I21A 3CXCA 4EMHA 3LC0A 4LVMA 1M1KU 2Q7HA 4FSXA 3OYLA 4M78F 1PSEA 4Y28E 1HC7A 4QQDA 3I55A 2DU7A 2MWOA 1VQ7T 2VYTA 2VC8A 4C0DC 4LDVA 2PQWA 3TUPA 5GMKm 1KQ2A 1SESA 4OB2B 4C0GA 4ZTJA 2A7YA 3JAME 4KULA 3OYGA 4J8OA 2L5QA 2D6FA 3FLGA 5LJ5f 4HWOA 4P74C 4C5HA 3HXYA 1QVGA 4LNSA 3OYNA 3LW5E 1ADYA 1X2HA 4C92B 1K8AC 4MDXA 4PJOB 1VQ7A 4LD9K 2EIFA 5GAN3 1JBMA 4YRTA 3CCLT 2PMEA 1B70B 3J80E 4A4HA 5GAMj 3PTAA 4M78A 3SD4A 4LVKA 4IUUA 4BE2A 3JB9G 4M75C 4JLIA 1RIQA 2PUOB 3FC3A 2RHQB 5GAOl 3WVDB 5FRMA 3JCMh 5D6XA 4FT4A 2OTLT 3PGGA 2LQ8A 1NZ9A 2QQBA 4E7LA 3VKIA 3P8DA 3R07A 2HQEA 1UEBA 4HVCA 2FHDA 2CZ6B 4PLIA 3L2UA 1B76A 4A4KA 4P3NA 3WXMB 2Q7EA 3G7ZA 3CCLA 2LQKA 4H2YA 2CZ1B 2EKOA 2JTFA 5GMKj 1VQOA 2M1HA 3E9IA 3GNFB 4KUIA 5A0DA 1EVKA 5KH6A 3NEMA 1NJIU 4E51A 4E47A 1EOVA 2E6ZA 2DTOA 1R8OB 1Y07A 2XI9A 2OTLA 4M7DC 11ASA 2GF7A 4HT8A 5FU6C 1G5HA 4K87A 2L3RA 1WGSA 2LC4A 1BBWA 4YRPA 2ZCFB 4EX5A 5DLQE 4K86A 3REUA 3RMSA 3META 1KQ1A 4P71C 4X9CA 2K4YA 3LYIA 3OB9A 2BIVA 2RB6A 1VQZA 5CKHA 4H2VA 3QG1A 3E9GA 3QSUA 3W3SA 3ICAA 3LSSA 3RGLA 5CKDA 1KOGA 3PNWC 1Y7XA 1YCYA 4X5OA 3OW2S 4F7UB 2RM4A 3UFGA 1MGQA 2IY5B 3PT9A 3L42A 4YTLA 2RJEA 4M75F 1ADJA 3CEYA 3QZ5B 3Q1JA 3A31A 3BDUA 3VUBA 3CCVA 4TWAA 4O2DA 2NLUA 3M54A 3CC7T 1YJWT 1ZHIA 4E7JA 3CCUT 4M77D 2FL7A 1M1FA 3S3MA 1QP2A 3H8ZA 3CMET 4C0DB 3PMTA 4C92G 4OF1A 5GAMe 4PJOG 4ZTZB 2LVMA 5K1PA 1Q81C 3UT1A 1SETA 4RG8A 4C8QF 2JNGA 1EVLA 2P0QA 1WNLA 3OSVA 2AKWB 4RG2A 5LJ3e 3S3NA 3OS5A 5J26A 3CC7A 4FT2A 1YIJT 3CCUA 1YJ9T 3I56A 4L87A 1M5Q1 1WPYA 1N6AA 2E10A 3CMEA 1VQMT 2RI5A 4ZGEB 2CGHA 2RO0A 2OTJT 1BBUA 2CZ7B 2HD0A 3MHXA 3AHUA 2PVGB 1KHCA 2X4WA 4MMKA 1K9MU 4M75B 1EIFA 3QTCA 2XDBA 3L1AA 1W4SA 1NYQA 1YJ9A 3P8YA 3RESA 2YLCA 2LT1A 1NJ1A 3BY7A 4M77G 3J7AF 3JB9I 4C8QA 3OYKA 1VQNT 2ODRC 1VQMA 4HA8A 5GAMh 3FIFA 4RMOA 2OTJA 3MEUA 3MF1A 3IALA 3QDRB 2HQXA 4N4HA 4RKUE 2PUKB 5GAOq 2ZPEB 4R56A 4CS2A 2E5QA 3A74A 1QP3A 4JDSA 3A5ZB 5FU6B 2ARTA 1BI2A 5J3BA 4F7UG 1VQNA 1E22A 5GMKh 5C51B 5GAN7 3DB3A 3CPFA 2RHSA 4M7AC 3M55A 3HXWA 1KC8U 4YYEA 3V7RA 1H641 5C53B 3HFZB 1I5LA 2JTMA 5GANj 2RHSB 2ZZFA 5HK3A 2LCCA 3CCST 3L2VA 1V29B 4KQEA 3HFOA 3OA6A 2EYQA 3CBMA 1YJNT 3JCMP 5ELNA 4YRRA 3QO3A 3M9QA 2RHZA 1YFTA 4FIBA 1X75C 2ZNJA 3T9NA 4LVIA 2A8EA 1RL2A 4OGEA 2K5LA 4TVAB 2F69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIY B;  2ZIN A;  4QVC A;  1E1T A;  4HWR A;  4NCX A;  4P72 C;  4BW9 A;  2AMC B;  3V7S A;  4M7A B;  4J15 A;  2VXE A;  1B7Y A;  4J6Y A;  2HNI A;  4EMK B;  3REX A;  2Q7G A;  2DXT A;  4G85 A;  5CAI A;  3RF1 A;  1Z7M A;  2VXF A;  4RQE A;  2XTI A;  3NEN A;  4Q6G A;  2ALY A;  4DPG A;  4UP8 A;  5LJ3 d;  3JCM X;  2YLB A;  1NNH A;  4YCW A;  1Z7N A;  3JB9 J;  4YRK A;  3A7A A;  1B7Y B;  2YHT A;  3I7F A;  1LOJ A;  4H2S A;  4YRM A;  3JCM Q;  4M77 B;  2DJZ A;  1USY C;  5I21 A;  4ZTU B;  3RUX A;  4YRN A;  2DQ0 A;  4EMH A;  5HGQ A;  3JCM c;  3LC0 A;  4JUV A;  1N9R A;  3GIB A;  4M78 D;  2Q7H A;  2I2L A;  4M75 G;  4M78 F;  1HC7 A;  3OD1 A;  4N0A A;  5GAO m;  4DQ2 A;  3UGQ A;  1YB3 A;  2DU7 A;  4P72 A;  4C8Q B;  2VC8 A;  5LJ5 h;  3QHS A;  3TUP A;  4WF2 A;  5GMK m;  4F7U A;  3JCM V;  1KQ2 A;  1SES A;  2C8M A;  5GAM f;  4RQF A;  4RCC A;  4M78 C;  2DZC A;  3TEH A;  3NEL A;  4G84 A;  2DTI A;  2IY5 A;  1USY A;  1X54 A;  3SWN C;  3HXU A;  4AH6 A;  3PCO B;  5LJ5 f;  1NJ8 A;  2DTH A;  4H2X B;  4HWO A;  4P74 C;  5ELO A;  4YRI A;  3V8L A;  3HXY A;  3MEY A;  1X55 A;  2DQ3 A;  4M7A E;  4HT9 A;  4OLF A;  3RKX A;  4LNS A;  5GAN 6;  3RKY A;  1ADY A;  1X2H A;  4M75 D;  4C92 B;  2XGT A;  3VQV A;  4A53 A;  3V8J A;  3QUI A;  4PJO B;  4P71 A;  1D3B B;  4M7D G;  1G51 A;  1I81 A;  1W66 A;  3KFU A;  2QHU A;  4CS3 A;  5GAN 3;  4KR3 A;  1Y96 B;  1JBM A;  4XU1 A;  4YRT A;  2ZR3 A;  3HFV A;  2PME A;  4M77 E;  2Y90 A;  1B70 B;  2I4L A;  5GAM j;  1SER A;  4M78 A;  2QHT A;  4HWS A;  1NYR A;  5GAN e;  1X56 A;  5LJ5 g;  2I4M A;  3JB9 G;  1NJ6 A;  4M75 C;  3SWN A;  4JLI A;  1RIQ A;  2ZCE A;  2AKW A;  2RHQ B;  1ASY A;  4ZIB A;  5GAO l;  3TEG A;  3JCM h;  4P74 A;  1I8F A;  3QNE A;  4YRL A;  4H02 A;  3PGG A;  4C8Q E;  1C0A A;  3P8V A;  3HY1 A;  3JCM b;  3R07 A;  5GMK l;  4HVC A;  1LJO A;  3LSQ A;  4P73 A;  4TVW A;  3VBB A;  2DU5 A;  3RER A;  1B76 A;  3BW1 A;  4J6W A;  4P3N A;  4M7D D;  2Q7E A;  4M7D F;  3RAC A;  2FYK A;  4H2Y A;  1BIB A;  4XU2 A;  4XEM A;  5GMK j;  1ASZ A;  5LJ5 d;  1EFW A;  4MML A;  3E9I A;  3P8T A;  2CJA A;  2QHV A;  2ZGW A;  4EO4 A;  1EVK A;  3NEM A;  4E51 A;  1WQ7 A;  4M75 A;  1PYS A;  1HTT A;  1I4K 1;  1EOV A;  3JB9 D;  2ARU A;  2Q5I A;  3M4P A;  4C92 E;  2DTO A;  3CMQ A;  3QO8 A;  3JB9 F;  4CH5 A;  4PJO E;  4M7D C;  11AS A;  1B34 A;  4XU0 A;  4HT8 A;  2ALY B;  1YFR A;  3HY0 A;  2DKG A;  4XTY A;  3VQY A;  1G5H A;  4K87 A;  3JCM e;  2ZNI A;  1BBW A;  2CJ9 A;  3VQX A;  4YRP A;  2DVE A;  4EX5 A;  1ATI A;  4CH4 A;  3JCM g;  3PZC A;  12AS A;  3WQZ A;  1WLE A;  4EMG A;  4JRK A;  1B34 B;  4K86 A;  3REU A;  1NJ2 A;  4P71 C;  1KQ1 A;  4P75 C;  4X9C A;  3RIR A;  2ZIM A;  4K88 A;  2RB6 A;  3BFM A;  4RDX A;  1VQZ A;  3HRK A;  5GAN h;  4H2V A;  1YFS A;  4CS4 A;  3RL6 A;  4M78 E;  3FB9 A;  3QSU A;  3W3S A;  4V2S A;  3ICA A;  4RMF A;  4Q15 A;  3LSS A;  3L2Z A;  1NJ5 A;  3RGL A;  1KOG A;  1YCY A;  4X5O A;  5GAN 2;  1EQR A;  5GAO n;  3M4G A;  4F7U B;  4M7D A;  2J3L A;  2EAY A;  2FB7 A;  4A54 A;  2EJG A;  3A5Z A;  2RM4 A;  2J3M A;  1E24 A;  2Q5H A;  4C8Q G;  4NL3 A;  3UFG A;  4QVD A;  2E5A A;  1JJC A;  3L4G A;  5GAN f;  3TEH B;  5LJ3 h;  5GAO r;  1MGQ A;  2I4N A;  2DDZ A;  2IY5 B;  4M7D B;  4WI1 A;  4M75 F;  4P3O A;  1ADJ A;  5GAO p;  2DEQ A;  1J5W A;  2C7I A;  4UPA A;  4P75 A;  3A31 A;  2JN0 A;  1JRI A;  3BDU A;  4P73 C;  4TWA A;  4O2D A;  4WJ4 A;  4HWP A;  1JJC B;  1GGM A;  3L4G B;  3HXV A;  3DSQ A;  4M77 D;  3VQW A;  3HFZ A;  2E64 A;  4C92 G;  4EMK C;  1H4V B;  5GAN 4;  5GAM e;  1B8A A;  2QTX A;  5GAN g;  4PJO G;  5LJ5 j;  5GAN 8;  4ZTZ B;  3UH0 A;  3HSB A;  1QE0 A;  2DXU A;  4M78 B;  5K1P A;  3IKL A;  4C8Q D;  2RA2 A;  1SET A;  4J5Y A;  4C8Q F;  3UGT A;  4YRG A;  3SWN B;  1EVL A;  1U1S A;  5GMK i;  4YRQ A;  1WNL A;  2AKW B;  3FJP A;  5LJ3 e;  3NET A;  4CH6 A;  2QHS A;  4YDQ A;  4PNO A;  5LJ3 g;  3INZ A;  4YRE A;  4TQD A;  4TVA A;  1YGB A;  4L87 A;  3JCM f;  1M5Q 1;  1EIY A;  4F7U E;  1WPY A;  2P5I A;  2E10 A;  3HXX A;  4XTU A;  3IKM B;  2AMC A;  1L0W A;  1KMN A;  3E9H A;  4C8Q C;  5GAN d;  2K57 A;  4EMK A;  4XTZ A;  4C92 D;  2CGH A;  2ZR2 A;  4C92 F;  4M7D E;  5K1X A;  4PJO D;  1BBU A;  3AHU A;  2E1H A;  3RKW A;  4XU3 A;  3QO7 A;  4PJO F;  4YCV A;  4YRO A;  5F5W A;  2ODR D;  3A5Y A;  4YRS A;  4MMK A;  4M75 B;  4M77 A;  4M7A G;  1PYS B;  3QTC A;  3L1A A;  1H4Q A;  1LNX A;  1NYQ A;  4NOY A;  3P8Y A;  2E3C A;  3RES A;  2YLC A;  2CJB A;  4JRI A;  4C92 C;  1NJ1 A;  3HXZ A;  4XTX A;  3BY7 A;  4M77 G;  4PJO C;  3IG2 A;  4UP9 A;  3JB9 I;  4C8Q A;  2ODR C;  4HA8 A;  1TH7 A;  1KMM A;  4P3P A;  5GAM h;  1LYL A;  4RCB A;  3FIF A;  1WU7 A;  3A7R A;  3V8K A;  2E65 A;  2ZT6 A;  2I4O A;  2RD1 A;  1SRY A;  3A7U A;  3MF1 A;  3MF2 A;  3IAL A;  4XTV A;  2ZT5 A;  4J6X A;  2P0L A;  4PG3 A;  3JCM d;  4PHC A;  3PCO A;  1N9S A;  4M7A D;  5E3I A;  5GAO q;  4H2X A;  4NL2 A;  4M7A F;  3ERR A;  4HWT A;  1X2G A;  4CS2 A;  3A74 A;  4YPF A;  2EJF A;  1HK9 A;  4C92 A;  2ART A;  4YRC A;  4BWA A;  2ZT8 A;  4PJO A;  4XQ3 A;  4F7U G;  1D3B A;  3EFS A;  3JB9 H;  2PMF A;  2ZXF A;  4XEO A;  1E22 A;  2ZTG A;  2ARS A;  5GMK h;  5C51 B;  3HRI A;  4M77 F;  5DY9 A;  4X9D A;  5GAN 7;  4TTV A;  1Y96 A;  1U1T A;  5LJ3 f;  3V7C A;  4YRJ A;  2RHS A;  4M75 E;  4XTW A;  4M7A C;  1B70 A;  3HXW A;  3VU3 C;  3SB2 A;  1M8V A;  4YYE A;  5GAN 5;  3V7R A;  4KR2 A;  4UP7 A;  1H64 1;  3HFN A;  3JCM J;  4TVY A;  1H4T A;  3G1Z A;  5C53 B;  2G4C A;  3HFZ B;  1I5L A;  3QO5 A;  2CIM A;  5GAM g;  4YP0 A;  5GAN j;  2RHS B;  2RHQ A;  2ZZF A;  5LJ5 e;  1X01 A;  4M77 C;  3HTZ A;  3EFR A;  1QF6 A;  5C52 B;  2ZZG A;  3A32 A;  1FYF A;  1WYD A;  2E41 A;  2ZIO A;  2ZT7 A;  4H2U A;  1IL2 A;  1WQW A;  4OP0 A;  4KQE A;  3HFO A;  1H4S A;  1N9W A;  3JCM W;  3M4Q A;  4H2W A;  4Y91 A;  2DZ9 A;  3JCM P;  5ELN A;  4H2T A;  2ZZE A;  4YRR A;  4YRF A;  5KNN A;  3QO3 A;  4WJ3 M;  1YFT A;  2EL9 A;  4TQF A;  2ZNJ A;  4F7U F;  5LJ3 j;  4M78 G;  1BIA A;  4M7A A;  4YCU A;  5GMK e;  2EWN A;  1G5I A;  1E1O A;  4CH3 A;  1HXD A;  5GAM d;  4TVA B;  4N0A C;  3BJU A;  2EJ9 A; 
#chains in the Genus database with same CATH topology
 2OX7 A;  2QXF A;  1E1T A;  4L6V 5;  4HVV A;  4J15 A;  2M9U A;  3X24 B;  4OB0 B;  1IRX A;  4IUQ A;  3CCS A;  2A37 A;  3E2U A;  2DXT A;  4HKE A;  3RF1 A;  4RQE A;  2CDT A;  1VQP T;  2DA9 A;  2EGA A;  1K73 C;  2ALY A;  2F2V A;  2F2W A;  5DLO A;  4RTV A;  2PTK A;  3JCM X;  2YLB A;  1NEB A;  1NNH A;  1PWT A;  2YUQ A;  2YT6 A;  1YJN A;  1M8M A;  4YRK A;  3P8H A;  2KDS A;  2PU9 B;  2RHI A;  4ZTU B;  2SEM A;  4ELZ C;  1GCQ A;  3RUX A;  2K79 A;  1JJ2 S;  4YRN A;  2MPX C;  3M59 A;  1M2V A;  1WI7 A;  2WSC E;  3GF5 A;  2FZG B;  2KQW A;  1XNI A;  1Q82 C;  3PMI A;  4M75 G;  2P4R A;  5L23 A;  3OD1 A;  4N0A A;  1BI1 A;  4DQ2 A;  1EFN A;  1M9S A;  2VGN A;  2RJD A;  5I2M A;  4P72 A;  1WA7 A;  3M57 A;  1PC0 A;  3VV0 A;  3OQ5 A;  2B86 A;  2W0Z A;  2BZ8 A;  2EYW A;  3QHS A;  2HBP A;  5C0M A;  1VQP A;  2QQR A;  3UA6 A;  1D1C A;  3A1P A;  2VV5 A;  3CPW P;  4RQF A;  4M78 C;  3UDC A;  2DZC A;  3NEL A;  3O8V A;  2DTI A;  5IN1 A;  4IUT A;  1VQ6 T;  1XQH A;  2MAM A;  2KAF A;  4GLK A;  1QKX A;  5ELO A;  4ANJ A;  2DYB A;  4B9W A;  3J81 E;  1VQK T;  3RKX A;  2JM9 A;  4OLF A;  3PIP A;  2XGT A;  2X9H A;  1XJW B;  3M0R A;  3V8J A;  3QUI A;  1D3B B;  4M7D G;  1I81 A;  4KR3 A;  1Y96 B;  2DIG A;  2P84 A;  1JJ2 A;  2IPO B;  3A8G B;  1SER A;  2CS7 A;  2MCN A;  4LDU A;  5GAN e;  2C0O A;  2P0K A;  4FYY B;  5LJ5 g;  2I4M A;  2CT4 A;  1VQ6 A;  3SWN A;  4EDU A;  2ZCE A;  1N8R U;  3TEG A;  2LNV A;  4L59 A;  2DJQ A;  4OMP A;  4C8Q E;  2EQI A;  3HY1 A;  5KYN A;  1B3Q A;  1IO6 A;  3SFM A;  2AKL A;  4ESR A;  1LJO A;  3UPU A;  1PHT A;  4HCC A;  1IHW A;  4P73 A;  4TVW A;  3VBB A;  3RER A;  2MIO A;  3R6N A;  3BW1 A;  4J6W A;  2M0O A;  1WIE A;  3CCE T;  2FYK A;  3HPW A;  2QEX Q;  3HP9 A;  5IHI A;  4XEM A;  1EX4 A;  4IIO A;  3GNG A;  5LJ5 d;  1EFW A;  3P8T A;  1O9S A;  2ZGW A;  1WDX A;  5KYY A;  2AKK A;  2QA4 Q;  3CC2 T;  2LTO A;  1GFC A;  1PYS A;  1I4K 1;  3LGF A;  3GOX A;  3JB9 D;  2ARU A;  1VQL T;  1WHH A;  1B34 A;  3HY0 A;  2DKG A;  2XIC A;  3JV3 A;  3JCM e;  2ZNI A;  2K2M A;  2CH4 A;  4BDZ A;  2EYX A;  3LH0 A;  3CPW S;  1ATI A;  2NWM A;  2CRE A;  2DO3 A;  4C5E A;  4E7S A;  4MDW A;  2JMC A;  1WLE A;  2V1Q A;  4JRK A;  1B34 B;  3GBQ A;  3E1S A;  3CCE A;  3BE3 A;  4II1 A;  3RIR A;  1JQQ A;  4K88 A;  2JM8 A;  2V8K A;  1YBY A;  4RDX A;  3FRN A;  5GAN h;  3M5A A;  3CC2 A;  1ZSZ B;  4CS4 A;  3RL6 A;  5KE3 A;  3FB9 A;  4FW2 A;  1RAE B;  2KEA A;  3TCJ A;  4BY6 C;  1X69 A;  3ULR B;  3U23 A;  5FRO A;  1PRM C;  1VQL A;  2G6F X;  3M56 A;  4AFS C;  1ACM B;  1K9A A;  2NUT B;  2EAY A;  1K76 A;  2YUP A;  3PE0 A;  2E12 A;  2HDA A;  2LJ3 A;  2J3M A;  2Q5H A;  2ZPF B;  1KSW A;  4NL3 A;  2E5K A;  4QVD A;  1JJC A;  4QQ6 A;  3JSC A;  4Y92 A;  5M9O A;  4X34 A;  2QQS A;  2JT4 A;  1G3W A;  4P3O A;  1J5W A;  1Q7Y C;  4UPA A;  4P75 A;  2OAW A;  2XKO C;  1YWO A;  2J6F A;  2M16 A;  3OYC A;  4WJ4 A;  1JJC B;  1VQ5 T;  4D8D A;  2DRM A;  2RK1 A;  2CT3 A;  2LZ6 B;  3VS4 A;  3OS0 A;  3VQW A;  2KT8 A;  4BUG A;  4RTZ A;  2E64 A;  3CC4 Q;  3CPW A;  5I11 A;  3GPL A;  1SKU B;  3EAE A;  1YIT T;  5J39 A;  5A0G A;  2QTX A;  2O88 A;  3UH0 A;  3HSB A;  3M4Y A;  2DXU A;  4M78 B;  1T3S A;  5GJV B;  3TSZ A;  1Y71 A;  3UGT A;  4YRG A;  4JPB W;  1MMD A;  1YI2 T;  1IGQ A;  3NET A;  2C06 A;  3ME9 A;  3PFS A;  4PNO A;  1D09 B;  3HTR A;  5LJ3 g;  3URG A;  4TQD A;  1YGB A;  1VA7 A;  4DBF A;  2ABL A;  3QWY A;  1M1K C;  1EIY A;  1I5O B;  2EYY A;  1ZUK A;  1MNE A;  2DD4 A;  2ZPG B;  2AMC A;  1VQ8 Q;  1L0W A;  4C8Q C;  3OBY A;  2K57 A;  2KVQ G;  2DBK A;  1RAI B;  4J9G A;  3RBB B;  4EMK A;  1RI0 A;  2VUB A;  1M1G A;  4C92 D;  1ABO A;  1M3B A;  5K1X A;  4PJO D;  1OYX A;  2E1H A;  3QO7 A;  5F5W A;  4LDX A;  4C5I A;  3CD6 Q;  2KT1 A;  3P8B B;  1SEM A;  3JRZ A;  4M77 A;  4M7A G;  1QVF P;  2DIQ A;  4OB1 B;  2K3X A;  5C6S A;  1UE9 A;  3VS7 A;  1V1C A;  2DM1 A;  2KK4 A;  2CJB A;  3FDR A;  3HXZ A;  1D0Z A;  3C94 A;  3THK A;  1YHQ T;  2XDD A;  2CSQ A;  4UP9 A;  3OSS C;  4HCB A;  3NTK A;  5AYF A;  3EH2 A;  4BI4 A;  4P3P A;  1MUZ A;  4J9C A;  1KC8 R;  1LYL A;  1AWO A;  1Y0M A;  5CQX A;  4QQG A;  3CMA Q;  2AIR B;  3VJP A;  2ZT6 A;  1KD1 U;  2I4O A;  2DL3 A;  3MF2 A;  3M58 A;  2KBT A;  4C0F A;  2ED0 A;  4J6X A;  4CC4 B;  2P0L A;  1AVZ C;  1HJD A;  3KFV A;  4PHC A;  2LQN A;  3PCO A;  1GBR A;  1N9S A;  5E3I A;  4H2X A;  1QWE A;  5IHK A;  1G3S A;  3EG1 A;  4YPF A;  2EJF A;  5KYU A;  2QK0 A;  2FVU A;  4BWA A;  1YHQ A;  1OQK A;  2DER A;  2C0I A;  2AHJ B;  2ZXF A;  2PMF A;  1VIF A;  4XEO A;  2EBP A;  4X9D A;  1SPK A;  2NUP A;  1U1T A;  5LJ3 f;  1BK2 A;  4E2F B;  3E9F A;  4XTW A;  1UUE A;  2E70 A;  1WHG A;  2D0Q B;  4J7F A;  3VU3 C;  2FPF A;  1R0B G;  2RHY A;  3HFN A;  4TVY A;  1FX7 A;  3CCJ T;  1Q86 R;  1H4T A;  2VAS A;  2KRM A;  4BAC A;  2G4C A;  2NUP B;  3QO5 A;  3L2W A;  4BY6 B;  4JJN K;  3H6Z A;  2DXC A;  5D7U A;  2K3Y A;  4O6J A;  1QF6 A;  5C52 B;  2X4Y A;  3OYA A;  3HHT B;  1V76 A;  5IAY A;  6AT1 B;  5L8R E;  3G71 T;  3JCM W;  5KYW B;  1YJW A;  4Y91 A;  5CKB A;  3MQZ A;  4YRF A;  4WJ3 M;  1X2K A;  2ECZ A;  1YCS B;  2DVJ A;  4XAX B;  2X4X A;  1GCQ C;  4TQF A;  3TSW A;  4M78 G;  1LVK A;  1BIA A;  1QVF S;  1LCK A;  1PSF A;  3M0U A;  4FCY A;  5GMK e;  2CUB A;  2E6N A;  2KXC A;  1Z9Q A;  1NE8 A;  2JUF A;  3ER0 A;  3CCJ A;  2WSE E;  4IUP A;  4N0A C;  1SRM A;  5FRN A;  4LDW A;  2QQA A;  3EG9 B;  4HWR A;  4NCX A;  4P72 C;  4BI3 A;  4BW9 A;  3V7S A;  3MEW A;  4J6Y A;  2HNI A;  1VQO Q;  3CCQ Q;  2Q7G A;  4OMO A;  4KH0 B;  4LXC A;  4LVJ A;  1Z7M A;  2VXF A;  2ZPI B;  1ZBX A;  3NEN A;  2RHX A;  1YI2 Q;  3OY9 A;  3MP8 A;  4J9B A;  1UGQ B;  4YCW A;  1YIJ A;  5HKC A;  3MP1 A;  2YHT A;  1QVP A;  1LOJ A;  1R0C B;  1NM7 A;  4YRM A;  2DJZ A;  2YWW A;  3LGL A;  3C12 A;  4JRP A;  3EGU A;  2DXB A;  3JCM c;  5KCH A;  1NLP C;  1N9R A;  3GIB A;  2I2L A;  1KK7 A;  2X35 A;  2ZPH B;  4RTW A;  5GAO m;  2IVW A;  2GFU A;  4OGC A;  2X3W D;  1VQ4 Q;  1A0N B;  4C8Q B;  4CRI A;  4BB7 A;  3CBP A;  1OPL A;  4WF2 A;  3X26 B;  5I2S A;  1QVF A;  2C8M A;  4RCC A;  4DA4 A;  1WXB A;  2RJC A;  3TEH A;  2RH2 A;  1K73 U;  1N8R R;  1AHJ B;  1SSF A;  2J05 A;  4FM4 B;  1USY A;  3SWN C;  1S1N A;  4OMN A;  1VQ9 Q;  1VYT A;  1NJ8 A;  7AT1 B;  2LRQ A;  2DQ3 A;  5GAN 6;  3RKY A;  1H3Z A;  1S72 Q;  4M75 D;  3VQV A;  1E6G A;  4OML A;  1OZ2 A;  4P71 A;  5CO7 A;  2JOY A;  1W66 A;  3CCV Q;  1I07 A;  4IIM A;  3HFV A;  2BE9 B;  2QEX T;  4M77 E;  2Y4X A;  2QI2 A;  2I4L A;  1X6G A;  1NG2 A;  1NYR A;  1MMN A;  1X56 A;  2QA4 T;  2EVR A;  1HSQ A;  2KYM A;  1AZG B;  1M90 U;  1XTD A;  4LE9 A;  5ECA A;  2V8J A;  3VRY A;  4ZIB A;  3ZL7 C;  2DK3 A;  4YRL A;  4LD6 A;  4H02 A;  1ZUY A;  4LVL A;  5LL6 S;  1C0A A;  1E6H A;  3P8V A;  3NTH A;  3UA7 A;  3JCM b;  2X3X D;  2AZV A;  1M27 C;  4GBQ A;  3BDL A;  2RN8 A;  5GMK l;  3LX7 A;  3LSQ A;  1IB8 A;  1TOV A;  5CR2 A;  4A63 B;  4M7D D;  2GBQ A;  3X28 B;  3I56 Q;  2QEX A;  4EPC A;  2ZAE A;  4XU2 A;  4F04 B;  4BE1 A;  4MML A;  4BE0 A;  1AWW A;  2QHV A;  2QA4 A;  4QKU A;  2QTV A;  2L3P A;  3TEE A;  1WQ7 A;  1R77 A;  1G5V A;  2DMO A;  3G71 Q;  1HTT A;  3QBY A;  3QXE B;  1N27 A;  3TU4 K;  2Q5I A;  3M4P A;  3CMQ A;  3QO8 A;  1JEG A;  3JB9 F;  2MMP A;  4F16 A;  1AD5 A;  1PKS A;  2ALY B;  1YFR A;  3VQY A;  1Q95 G;  4QVZ A;  2DET A;  2GCX A;  4CC7 A;  3VQX A;  4E7I A;  1OU9 A;  3G6E Q;  2DVE A;  1TWB A;  2JVV A;  4N4I A;  3JCM g;  2E3H A;  12AS A;  3PZC A;  5I22 A;  1ZA2 B;  3WQZ A;  4EMG A;  1NJ2 A;  1M2V B;  4P75 C;  4RTX A;  2RMO A;  1RAF B;  1RLP C;  1NYF A;  2LX7 A;  2F2X A;  3BFM A;  4NS5 A;  3NHN A;  1X43 A;  2BKD N;  4AFU C;  1KC8 C;  4V2S A;  3LWH A;  2X51 A;  4VUB A;  4Q15 A;  3L2Q A;  3L2Z A;  3CC4 T;  2K6D A;  3VS5 A;  3NTI A;  2KMT A;  4GLM A;  2EQM A;  2KE9 A;  1EQR A;  2P0P A;  4IKF A;  2J3L A;  4A54 A;  2DL5 A;  2VWF A;  3LWI A;  2JMA A;  2YRC A;  2COW A;  1E24 A;  4C8Q G;  2EQK A;  2E5A A;  4BD3 A;  3L4G A;  2H3J A;  2M51 A;  5GAN f;  1ZSG A;  3AT1 B;  4LUD A;  1WJR A;  2DDZ A;  4OVA A;  1UJ0 A;  4AFZ C;  3QII A;  1IRE B;  3OYB A;  3HRU A;  4A4F A;  2DEQ A;  1UJY A;  4JS4 A;  1JRI A;  4J7I A;  4HWP A;  1GGM A;  3L4G B;  3HXV A;  5DM7 R;  4CI0 C;  2B8A A;  3DSQ A;  5CQY A;  1NJI R;  1M3C A;  4JJC A;  3CC4 A;  3M0P A;  4DOV A;  1VQ8 T;  2PVO B;  3ZBD A;  2KRS A;  4WTO B;  2A36 A;  2HQH A;  4EMK C;  1W70 A;  4EIK A;  1Q86 C;  2COY A;  4LN2 A;  5LJ5 j;  1RI9 A;  5GAN 8;  2KR3 A;  1QE0 A;  1RAG B;  2R58 A;  2MK5 A;  1VQK A;  2RA2 A;  1ZBJ A;  4E7K A;  4J5Y A;  3CD6 T;  4J9E A;  3SWN B;  5GMK i;  4YRQ A;  3FJP A;  4LDY A;  4CH6 A;  2QHS A;  1K8A U;  3N5B B;  2XK0 A;  2XID A;  4JLG A;  2MOX A;  2K2V A;  3JCM f;  2EGE A;  3C4S A;  1QW1 A;  2P5I A;  3HXX A;  1VQ8 A;  1KMN A;  3E9H A;  2JJ9 A;  2QDL A;  2RQR A;  2YRD A;  1HD3 A;  2DYI A;  1WYX A;  1KD1 R;  4PLL A;  4XTZ A;  3MCA B;  2ZR2 A;  3CMA T;  3X20 B;  4C92 F;  4M7D E;  1YFN A;  3ZEH A;  2RK2 A;  4YRO A;  4XU3 A;  4PJO F;  1OPK A;  5KYY B;  2IIM A;  2XU8 A;  8ATC B;  2ODR D;  3CD6 A;  4YRS A;  1G3Y A;  4F14 A;  2WSF E;  3OYM A;  1PYS B;  1VYV A;  1LPL A;  2ED1 A;  1AWJ A;  2CP2 A;  2A28 A;  2J7I A;  3KUF A;  3C95 A;  2RHU A;  1OX8 A;  4NOY A;  2E3C A;  1GBQ A;  1NPR A;  4XTX A;  2AT1 B;  5FU7 B;  3IG2 A;  3CCR Q;  3OYF A;  1TH7 A;  2HEQ A;  3OYJ A;  3LLR A;  2LMJ A;  4MZM A;  2WAC A;  1WU7 A;  3CMA A;  2E65 A;  2QGG A;  2GNC A;  3QPH A;  1SRY A;  1PNJ A;  4O5V A;  1UGV A;  1WFW A;  2ZT5 A;  1PRL C;  2RQV A;  1KIK A;  4PG3 A;  2CP6 A;  1PD0 A;  2OAU A;  4M7A D;  3QDF A;  4NL2 A;  3ERR A;  4JJB A;  1X2G A;  2MI6 A;  1MND A;  1N8R C;  3RMQ A;  2MYS A;  2O31 A;  4C92 A;  4YRC A;  1T0H A;  2FO0 A;  4KGZ B;  4PJO A;  2P4T A;  4AFQ C;  3EFS A;  4Z89 A;  2H8H A;  1G8X A;  4M77 F;  5DY9 A;  4XK8 E;  1OEB A;  3QJY A;  4TTV A;  4JS5 A;  4J9H A;  3G4S Q;  4C0Z A;  1W6X A;  4Q5W A;  1B70 A;  2LCS A;  2LJ0 A;  3VYG A;  1WJS A;  2L8D A;  5GAN 5;  4KR2 A;  4UP7 A;  3JCM J;  2HZY A;  2R57 A;  4AG2 C;  3G1Z A;  1K9M R;  1UGR B;  5GAM g;  2CIM A;  3A8H B;  4ZGD B;  3EG0 A;  2RHQ A;  4E7H A;  4KGX B;  5LJ5 e;  4Z02 A;  1WHK A;  2DX1 A;  3CCM Q;  3CCQ T;  1VQO T;  3EFR A;  1FYF A;  4B9X A;  1W2B P;  1IL2 A;  5CIU A;  1I1J A;  3M4Q A;  2NS6 A;  1VQ5 A;  3H0I A;  5KNN A;  2EL9 A;  2YUO A;  4MZT A;  1UFF A;  1BU1 A;  4CC2 A;  2ZPB B;  4F7U F;  5LJ3 j;  2YRV A;  1NEG A;  2HSE B;  2GQI A;  3I5R A;  1YIT A;  4MZP A;  2XD0 A;  2EWN A;  1G5I A;  4J83 A;  1AOJ A;  2BE7 D;  4CH3 A;  1BCM A;  2KGT A;  5GAM d;  1TUC A;  1BKB A;  3A8L B;  2EJ9 A;  2V26 A;  1EIY B;  2ZIN A;  4QVC A;  1IGU A;  1VQ4 T;  2AMC B;  1H3H A;  2VXE A;  4PFO A;  3CCQ A;  5HY6 A;  4EMK B;  1NBE B;  3DLM A;  1QCF A;  4G85 A;  5CAI A;  1Q81 U;  2XTI A;  1RAH B;  1YI2 A;  1RAA B;  2CP0 A;  1D0Y A;  3VYH B;  4DPG A;  4UP8 A;  5LJ3 d;  5IHN A;  3NFC A;  5FWC A;  1TTH B;  1FMV A;  1WXT A;  3FJ5 A;  3A7A A;  2LX9 A;  2XMF A;  3CBO A;  2LCL A;  2EFI A;  5CCA A;  3HRS A;  3JCM Q;  4M77 B;  1USY C;  3L2R A;  4PK4 A;  2J6O A;  1ZA1 B;  1VQ9 T;  3OYH A;  2DQ0 A;  2QDY B;  3NGP A;  5HGQ A;  1UHC A;  4JUV A;  1UB4 A;  2J06 A;  4M78 D;  2Y4Y A;  3H0F A;  1X6O A;  3QKJ A;  3OS2 A;  1S72 T;  2LT4 A;  3UGQ A;  3MP6 A;  5EG2 A;  3I55 Q;  1YB3 A;  4IUV A;  1FXX A;  1I0C A;  1MV0 B;  4KT0 E;  1VQ4 A;  3FEO A;  1QLY A;  3EFO A;  1UHF A;  4FYV B;  5LJ5 h;  3EHR A;  3CCV T;  2O9V A;  2HMA A;  1K1Z A;  4A4G A;  1H8K A;  5CKF A;  3I5S A;  4F7U A;  3JCM V;  1EZZ B;  5CKE A;  1KHI A;  5GAM f;  1Y57 A;  1M90 R;  2FPD A;  4G84 A;  1ZQ1 A;  2IY5 A;  1X54 A;  4HT4 A;  3HXU A;  1WX6 A;  4AH6 A;  1VQ9 A;  5CVI A;  3RDV A;  3PCO B;  2JZ2 A;  2DTH A;  4H2X B;  4R55 A;  4BI8 B;  1WJQ A;  2EQU A;  1F1B B;  2LJ1 A;  2ROT A;  3V8L A;  4YRI A;  3MJX A;  1MMA A;  1PM3 A;  3MEY A;  2BTT A;  1X55 A;  5KYU B;  4M7A E;  4HT9 A;  5KCO A;  4DBQ A;  2ZZD A;  1S72 A;  1BYM A;  3DB4 A;  4A53 A;  2KSS A;  2QAZ A;  1W2B S;  1VQ7 Q;  1FMK A;  1G51 A;  1BI3 A;  4A4E A;  3KFU A;  2QHU A;  3OMG A;  4PJN A;  1BI0 A;  2L0A A;  3F70 A;  4CS3 A;  4XU1 A;  2A3L A;  2X4J A;  1X6B A;  3HL8 A;  3I56 T;  2ZR3 A;  4PJL A;  2Y90 A;  1NJI C;  2EKH A;  1QWF A;  3A8M B;  2H3E B;  2DL4 A;  2RNA A;  2QHT A;  2LDM A;  4HWS A;  1SG5 A;  1NJ6 A;  4D6W A;  2FEI A;  1YWP A;  2AKW A;  1ASY A;  4FW1 A;  1K4U S;  4P74 A;  1I8F A;  3QNE A;  5KE2 A;  4KUD K;  2K3B A;  1C6V X;  5HK0 A;  3OYI A;  2CH4 W;  2NUZ A;  3HKS A;  2KXD A;  5GJW B;  4RTU A;  3G6E T;  2DU5 A;  2CZ0 B;  3OW2 A;  4M7D F;  3CCL Q;  1IHV A;  3RAC A;  2GTJ A;  1BIB A;  2DE0 X;  2F5K A;  3MO8 A;  1ASZ A;  3MEA A;  4OB3 B;  3EG3 A;  4IUR A;  2CJA A;  3DLL A;  5CK9 A;  4EO4 A;  2JS2 A;  2DL7 A;  4M75 A;  1KD1 C;  2BUD A;  3G71 A;  1W2B A;  1E7O A;  4FL6 A;  2F5T X;  2MWP A;  4C92 E;  4CH5 A;  3O5Z A;  4J9F A;  4PJO E;  1ABQ A;  1KQS P;  2OTL Q;  4HCZ A;  4XU0 A;  4XTY A;  1WZO A;  2DEU A;  3A8O B;  3OMC A;  2CJ9 A;  5KYX A;  3G6E A;  3OYD A;  4CH4 A;  2R5M A;  3D7S B;  2KRO A;  4N4G A;  1FWZ A;  3QZ9 B;  3EG2 A;  4AG1 C;  1SHG A;  2AZS A;  4KH1 B;  3TRE A;  2ZIM A;  8AT1 B;  4ZNX A;  1O75 A;  3UWN A;  2ATC B;  3HRK A;  5IXB A;  1YFS A;  1X2Q A;  2HL5 C;  4ZN1 A;  4M78 E;  4RMF A;  2RQU A;  2OI3 A;  1NJ5 A;  2COZ A;  1DJ7 B;  4UC4 A;  5GAN 2;  5GAO n;  3M4G A;  4M7D A;  2FB7 A;  1OI1 A;  4OMF B;  2XDP A;  2EJG A;  3A5Z A;  4ZN3 A;  3TEH B;  5LJ3 h;  5GAO r;  2I4N A;  2AK5 A;  4M7D B;  1K8A R;  1Q82 U;  4WI1 A;  5FLX E;  4HXJ A;  5GAO p;  2GFA A;  3M53 A;  4R0K A;  2C7I A;  4P73 C;  2JN0 A;  3S3O A;  1D0X A;  2HKQ B;  3VS6 A;  4C5G A;  3A98 A;  3HFZ A;  1W1F A;  1WHM A;  4PJM A;  1RLQ C;  1IZ6 A;  1U5S A;  3M0Q A;  1H4V B;  5GAN 4;  4AT1 B;  4D8K A;  3S6W A;  1B8A A;  2E4H A;  3GLX A;  2R5A A;  3KBG A;  2A0F B;  5GAN g;  2EQJ A;  3QYH B;  1K9M C;  3REA B;  1U8R A;  5A0L A;  4J9D A;  1QKW A;  3IKL A;  2FZK B;  4QT7 A;  4C8Q D;  3ASK A;  1MHN A;  1TSF A;  2DL8 A;  1U1S A;  4DOW A;  2PZ1 A;  5FU7 C;  1B07 A;  1TG0 A;  4KBM B;  3OYY A;  4ATO A;  3CC7 Q;  4YDQ A;  3CCU Q;  5A2Q E;  3INZ A;  2BZX A;  4YRE A;  1KQS S;  4TVA A;  3CXC P;  1KFZ A;  1AT1 B;  2M0Y A;  3CQT A;  4F7U E;  1NPP A;  1TXQ A;  4XTU A;  3IKM B;  3CCR T;  3TQ7 P;  3CME Q;  4DEY A;  2HAX A;  5GAN d;  1OZ3 A;  2O4X A;  4PKC C;  4GY5 A;  2RQT A;  3NPF A;  1XOV A;  4RUG A;  3H0H A;  1QCN A;  2XHC A;  4TVR A;  3LH5 A;  1GFD A;  3RKW A;  4YCV A;  1Q86 U;  3MPU B;  3KXT A;  3A5Y A;  3EGD A;  1GXI E;  2L89 A;  1UEC A;  4L5G A;  2O4X B;  2VGM A;  4B6M A;  3EGX A;  4PL6 A;  1H4Q A;  1LNX A;  5D6Y A;  4HCK A;  1YIJ Q;  1YJ9 Q;  3EGD B;  3E19 A;  4JRI A;  4C92 C;  2RPN A;  3EGX B;  4PJO C;  1K0S A;  3CCR A;  1M2O A;  1KG1 A;  1QVG P;  2RJF A;  2DFU A;  1VQM Q;  4HVW A;  5IT9 E;  2DAQ A;  1KMM A;  4RCB A;  2V1R A;  1T0J A;  1WLP B;  4OMM A;  3G4S T;  4JRQ A;  3A7R A;  3V8K A;  3OYE A;  2RI2 A;  2OTJ Q;  2RD1 A;  4LNP A;  3A7U A;  3QYG B;  4XTV A;  1KQS A;  2K5I A;  2D9T A;  1ARK A;  1D1B A;  1VIE A;  4DBR A;  3JCM d;  4M7A F;  1OV3 A;  1UGP B;  1WHJ A;  5D6W A;  2DPP B;  4ZGJ B;  3CCM T;  4HWT A;  1M90 C;  2D0N A;  3I9Q A;  4FU6 A;  1HK9 A;  3OS1 A;  2KY9 A;  2KNB B;  2ZT8 A;  4XQ3 A;  1D3B A;  1UGS B;  2DRK A;  3JB9 H;  1VQN Q;  1GL5 A;  1KJW A;  2ZTG A;  2GQV A;  2L3S A;  3PIO A;  2ARS A;  3HRI A;  1Y96 A;  3V7C A;  1P92 A;  3G4S A;  3X25 B;  2YXY A;  4YRJ A;  4M75 E;  2MF2 A;  1ZLM A;  5HCK A;  3SB2 A;  3VUZ A;  1M8V A;  3HRT A;  1JB0 E;  1G3T A;  3CXC S;  4YP0 A;  1Q81 R;  1BBZ A;  1X01 A;  4E6R A;  3CCM A;  4M77 C;  3SDZ A;  3HTZ A;  2YSQ A;  1HYO A;  2IG0 A;  2ZZG A;  3A32 A;  1WYD A;  2XG8 D;  2E41 A;  2ZIO A;  2ZT7 A;  4H2U A;  2O9S A;  1WQW A;  4OP0 A;  5EC7 A;  1H4S A;  1CKA A;  4AMC A;  1N9W A;  4ZTF A;  4H2W A;  4ME7 A;  2DZ9 A;  4H2T A;  2ZZE A;  1Q7Y U;  2J6K A;  4BDY A;  2CYZ B;  2PNI A;  2W10 A;  2D8J A;  2D8H A;  1CSK A;  1H92 A;  2CKK A;  4M7A A;  1OX9 A;  3OBW A;  1VUB A;  4YCU A;  1YNZ A;  1E1O A;  2PVD B;  3MEV A;  4K11 A;  1HXD A;  2RI3 A;  3WVE B;  2V8I A;  3BJU A;  1M4Z A;  1BB9 A;  4F17 A;  1NLO C;  3I55 T;  2FRY A;  2G3R A;  1OU8 A;  4M7A B;  1B7Y A;  2QAS A;  2K5F A;  3R6O A;  4P5N A;  3REX A;  3CCS Q;  4PFP A;  1QVG S;  1D1A A;  3ZFJ A;  4RTT A;  3QJ6 A;  4JJD A;  4Q6G A;  4QW2 A;  3DKM A;  1YJN Q;  1Z7N A;  2O01 E;  3JB9 J;  5FW9 A;  3H9N A;  3GP8 A;  1B7Y B;  4ELY C;  3EH1 A;  2FG0 A;  3VS2 A;  3I7F A;  4H2S A;  2QQ9 A;  2DD5 A;  5I21 A;  3M0S A;  3CXC A;  2DNU A;  4EMH A;  1BCO A;  3LC0 A;  1OUL A;  4LVM A;  1M1K U;  2Q7H A;  1SRL A;  4FSX A;  3OYL A;  4M78 F;  1PSE A;  4Y28 E;  1HC7 A;  4QQD A;  1ZSZ A;  3I55 A;  2DU7 A;  2MWO A;  1VQ7 T;  2VYT A;  2VC8 A;  2ENM A;  3RNJ A;  4C0D C;  2DIL A;  4LDV A;  2PQW A;  1PG5 B;  3TUP A;  2I0N A;  5GMK m;  2NUT A;  1QCO A;  1SF9 A;  1VQP Q;  1KQ2 A;  2D1X A;  1AWX A;  4OB2 B;  4DBH A;  1RAC B;  3H41 A;  1SES A;  4C0G A;  2VVK A;  1JXO A;  2M02 A;  3VS0 A;  4ZTJ A;  2A7Y A;  1QQJ A;  3JAM E;  4KUL A;  3OYG A;  3I35 A;  4J8O A;  2L5Q A;  2D6F A;  3FLG A;  4KGV B;  3MKD A;  5LJ5 f;  4HWO A;  4P74 C;  4C5H A;  3HXY A;  2LQW A;  1QVG A;  4J9I A;  4LNS A;  3OYN A;  3LW5 E;  1ADY A;  1X2H A;  4C92 B;  1K8A C;  1SHF A;  4MDX A;  1RAB B;  2CUD A;  4WCI A;  3REB B;  4PJO B;  1VQ7 A;  1ZX6 A;  4LD9 K;  3OW2 P;  2EPD A;  4M4Z A;  2EIF A;  5GAN 3;  1JBM A;  2BZY A;  2O2O A;  4YRT A;  3CCL T;  2PME A;  1B70 B;  1UG1 A;  2EGC A;  3J80 E;  4A4H A;  5GAM j;  3PTA A;  4M78 A;  3SD4 A;  4LVK A;  4IUU A;  4BE2 A;  1NYG A;  3JB9 G;  4M75 C;  1VQ6 Q;  4JLI A;  1RIQ A;  2PUO B;  3FC3 A;  1U3O A;  2RHQ B;  1TU0 B;  5GAO l;  3WVD B;  4PJJ A;  3JCM h;  5FRM A;  3SEM A;  2NYS A;  4HVU A;  5D6X A;  4FT4 A;  2OTL T;  1GRI A;  3PGG A;  1VQK Q;  2LQ8 A;  1NZ9 A;  2QQB A;  4E7L A;  3VKI A;  3P8D A;  2KI7 A;  2HQE A;  3R07 A;  3VRZ A;  1M3A A;  1UEB A;  4HVC A;  2FHD A;  2CZ6 B;  4PLI A;  3L2U A;  1IXD A;  1B76 A;  2K7A A;  1VOM A;  4A4K A;  4P3N A;  4OMQ A;  4RTY A;  3WXM B;  2Q7E A;  3G7Z A;  3CCL A;  2LQK A;  4H2Y A;  2CZ1 B;  2EKO A;  2JTF A;  5GMK j;  3EHQ A;  1VQO A;  2M1H A;  3E9I A;  3GNF B;  4KUI A;  3TVT A;  5A0D A;  1N5Z A;  1EVK A;  5KH6 A;  2LP5 A;  3NEM A;  1NJI U;  4E51 A;  1K73 R;  4E47 A;  2FPE A;  1EOV A;  2E6Z A;  2DTO A;  1R8O B;  1Y07 A;  2F1L A;  1GCP A;  2XI9 A;  2OTL A;  4M7D C;  11AS A;  3C0C A;  1CKB A;  2GF7 A;  5IH2 A;  4HT8 A;  5FU6 C;  1G5H A;  2C0T A;  4K87 A;  2L3R A;  1WGS A;  2LC4 A;  1BBW A;  2CP5 A;  1Q82 R;  4YRP A;  1YN8 A;  2ZCF B;  4EX5 A;  5DLQ E;  1FYN A;  2HCK A;  3VS1 A;  4K86 A;  3REU A;  3RMS A;  3CCE Q;  3MET A;  1KQ1 A;  4P71 C;  2ROL A;  4X9C A;  2K4Y A;  3LYI A;  3OB9 A;  2BIV A;  2RB6 A;  4DEX A;  4LUE A;  1VQZ A;  2Z0W A;  5CKH A;  3CC2 Q;  4H2V A;  2QGF B;  9ATC B;  3QG1 A;  3E9G A;  3SHW A;  5IXF A;  3QSU A;  3W3S A;  3ICA A;  3EFO B;  3LSS A;  2DBM A;  3RGL A;  5CKD A;  1KOG A;  3PNW C;  1VQL Q;  1Y7X A;  1YCY A;  1ZUU A;  1JO8 A;  4X5O A;  4CC3 A;  3OW2 S;  4F7U B;  1YP5 A;  3RR6 A;  2RM4 A;  3UFG A;  1MGQ A;  1QMC A;  2IY5 B;  1PKT A;  3PT9 A;  1SSH A;  3L42 A;  4Z88 A;  4YTL A;  2RJE A;  4M75 F;  1UDL A;  1ADJ A;  4Z8A A;  3CEY A;  5AT1 B;  3QZ5 B;  3Q1J A;  1J3T A;  3A31 A;  3BDU A;  1VYU A;  2CP7 A;  3VUB A;  3CCV A;  4TWA A;  2RF0 A;  1C1A A;  4O2D A;  2NLU A;  3M54 A;  3CC7 T;  1YJW T;  2LNH B;  1ZHI A;  4E7J A;  3CCU T;  4FYW B;  4M77 D;  1RAD B;  2FL7 A;  1M1F A;  1TUG B;  3S3M A;  1QP2 A;  2ESW A;  3H8Z A;  3CME T;  4C0D B;  3PMT A;  1PD1 A;  4C92 G;  4OF1 A;  2A08 A;  5GAM e;  1OOT A;  4PJO G;  4ORZ A;  4ZTZ B;  2LVM A;  1B7T A;  5K1P A;  1Q81 C;  3UT1 A;  5KYW A;  1WHL A;  2GTO A;  4FYX B;  2OJ2 A;  2HSP A;  2HL3 A;  1SET A;  4RG8 A;  2KRN A;  4C8Q F;  4KRT A;  2JNG A;  1EVL A;  2P0Q A;  1WNL A;  1M30 A;  1X27 A;  3OSV A;  2AKW B;  2DF6 A;  4RG2 A;  5LJ3 e;  3S3N A;  3OS5 A;  1U06 A;  5J26 A;  2JXB A;  3CC7 A;  4FT2 A;  1YIJ T;  2JS0 A;  3CCU A;  1YJ9 T;  2HBW A;  3I56 A;  1VQ5 Q;  4L87 A;  1M5Q 1;  1WPY A;  1N6A A;  2E10 A;  3EG9 A;  3CME A;  2L2P A;  1YIT Q;  1VQM T;  2RI5 A;  3PVQ A;  1UTI A;  4ZGE B;  2CGH A;  2HKN A;  2RO0 A;  2OTJ T;  2SRC A;  1AEY A;  1BBU A;  2CZ7 B;  2HD0 A;  1WXU A;  3MHX A;  3AHU A;  2PVG B;  2KYB A;  1KHC A;  2JW4 A;  2EYZ A;  2X4W A;  4MMK A;  1K9M U;  4M75 B;  1EIF A;  3QTC A;  2XDB A;  3G1J A;  3L1A A;  1W4S A;  1NYQ A;  1YJ9 A;  2CSI A;  3P8Y A;  3RES A;  2YLC A;  2LT1 A;  1G2B A;  1NJ1 A;  5KYX B;  3BY7 A;  4M77 G;  3J7A F;  1PCX A;  2RQW A;  3JB9 I;  4C8Q A;  3OYK A;  2QYZ A;  1VQN T;  2FZC B;  1VQM A;  2ODR C;  4HA8 A;  1JU5 C;  5FWB A;  5GAM h;  2E3I A;  1MMG A;  3FIF A;  4RMO A;  2VKN A;  3PVL A;  2OTJ A;  3MEU A;  3MF1 A;  3IQL A;  3IAL A;  3QDR B;  2EW3 A;  1JJ2 P;  2HQX A;  4N4H A;  4RKU E;  1C0M A;  4JZ4 A;  2PUK B;  5GAO q;  2ZPE B;  2QG9 B;  4R56 A;  1FMW A;  4CS2 A;  2E5Q A;  3A74 A;  1QP3 A;  4JDS A;  4X1V A;  3A5Z B;  5FU6 B;  2FRW A;  1Q7Y R;  1Z9Z A;  1BI2 A;  3UF4 A;  5J3B A;  2ART A;  3NMZ C;  3M0T A;  1YHQ Q;  4FSS A;  4F7U G;  1VQN A;  1E22 A;  1TS9 A;  5GMK h;  5C51 B;  1MV3 A;  5GAN 7;  3DB3 A;  3CPF A;  2VB6 A;  2RHS A;  2DLP A;  1JXM A;  4M7A C;  3M55 A;  3HXW A;  2YDL A;  1KC8 U;  3QWX X;  4YYE A;  3V7R A;  4PFZ A;  1H64 1;  2JTE A;  2YUN A;  2L3Q A;  5C53 B;  1TUD A;  3HFZ B;  1I5L A;  1K0X A;  2JTM A;  5GAN j;  2RHS B;  2ZZF A;  5HK3 A;  2LCC A;  3CCS T;  3L2V A;  1V29 B;  4KQE A;  3HFO A;  4JZ3 A;  3OA6 A;  2EYQ A;  1AZE A;  3CBM A;  1YJW Q;  1YJN T;  3JCM P;  5ELN A;  4YRR A;  3VS3 A;  3QO3 A;  3M9Q A;  2RHZ A;  1YFT A;  4FIB A;  1X75 C;  2CP3 A;  1G83 A;  1M1K R;  2ZNJ A;  3T9N A;  4LVI A;  2GGR A;  3UAT A;  1T3L A;  2K9G A;  2A8E A;  1RUW A;  1RL2 A;  4OGE A;  2K5L A;  4TVA B;  2F69 A;  3CCJ Q;  1ZSZ C;  4E7Z A; 
#chains in the Genus database with same CATH homology
 2QXF A;  1E1T A;  4L6V 5;  4J15 A;  2M9U A;  3X24 B;  4OB0 B;  4IUQ A;  3CCS A;  2DXT A;  4HKE A;  3RF1 A;  4RQE A;  1VQP T;  1K73 C;  2ALY A;  5DLO A;  3JCM X;  2YLB A;  1NNH A;  1YJN A;  4YRK A;  3P8H A;  2KDS A;  2PU9 B;  2RHI A;  4ZTU B;  4ELZ C;  3RUX A;  1JJ2 S;  4YRN A;  3M59 A;  2WSC E;  3GF5 A;  2KQW A;  1XNI A;  1Q82 C;  3PMI A;  4M75 G;  3OD1 A;  4N0A A;  1BI1 A;  4DQ2 A;  1M9S A;  2VGN A;  2RJD A;  5I2M A;  4P72 A;  3M57 A;  3VV0 A;  3OQ5 A;  3QHS A;  2HBP A;  5C0M A;  1VQP A;  2QQR A;  2VV5 A;  4RQF A;  4M78 C;  3UDC A;  2DZC A;  3NEL A;  3O8V A;  2DTI A;  5IN1 A;  4IUT A;  1VQ6 T;  1XQH A;  2MAM A;  2KAF A;  4GLK A;  5ELO A;  4B9W A;  3J81 E;  1VQK T;  3RKX A;  4OLF A;  3PIP A;  2XGT A;  3V8J A;  3QUI A;  1D3B B;  4M7D G;  1I81 A;  4KR3 A;  1Y96 B;  2DIG A;  1JJ2 A;  3A8G B;  1SER A;  2CS7 A;  4LDU A;  5GAN e;  2P0K A;  5LJ5 g;  2I4M A;  1VQ6 A;  3SWN A;  4EDU A;  2ZCE A;  1N8R U;  3TEG A;  2LNV A;  4L59 A;  4C8Q E;  3HY1 A;  3SFM A;  3UPU A;  1LJO A;  4HCC A;  4P73 A;  4TVW A;  3VBB A;  3RER A;  3BW1 A;  4J6W A;  2M0O A;  3CCE T;  2FYK A;  3HPW A;  3HP9 A;  4XEM A;  3GNG A;  5LJ5 d;  1EFW A;  3P8T A;  1O9S A;  2ZGW A;  3CC2 T;  2LTO A;  1PYS A;  1I4K 1;  3LGF A;  3GOX A;  3JB9 D;  2ARU A;  1VQL T;  1B34 A;  3HY0 A;  2DKG A;  2XIC A;  3JCM e;  2ZNI A;  4BDZ A;  3LH0 A;  3CPW S;  1ATI A;  2DO3 A;  4C5E A;  4MDW A;  1WLE A;  4JRK A;  1B34 B;  3E1S A;  3CCE A;  4II1 A;  3RIR A;  4K88 A;  2V8K A;  1YBY A;  4RDX A;  3FRN A;  5GAN h;  3M5A A;  3CC2 A;  4CS4 A;  3RL6 A;  5KE3 A;  3FB9 A;  3TCJ A;  4BY6 C;  5FRO A;  1VQL A;  3M56 A;  2EAY A;  2E12 A;  2J3M A;  2Q5H A;  2ZPF B;  4NL3 A;  4QVD A;  1JJC A;  4QQ6 A;  3JSC A;  5M9O A;  4X34 A;  2QQS A;  1G3W A;  4P3O A;  1J5W A;  1Q7Y C;  4UPA A;  4P75 A;  2XKO C;  2M16 A;  3OYC A;  4WJ4 A;  1JJC B;  1VQ5 T;  2RK1 A;  3OS0 A;  3VQW A;  4BUG A;  2E64 A;  3CPW A;  3GPL A;  3EAE A;  1YIT T;  5J39 A;  5A0G A;  2QTX A;  3UH0 A;  3HSB A;  3M4Y A;  2DXU A;  4M78 B;  1Y71 A;  3UGT A;  4YRG A;  1YI2 T;  3NET A;  2C06 A;  3ME9 A;  3PFS A;  4PNO A;  5LJ3 g;  3URG A;  4TQD A;  1YGB A;  1M1K C;  1EIY A;  2DD4 A;  2ZPG B;  2AMC A;  1L0W A;  4C8Q C;  3OBY A;  2K57 A;  2KVQ G;  4EMK A;  1RI0 A;  2VUB A;  1M1G A;  4C92 D;  5K1X A;  4PJO D;  1OYX A;  2E1H A;  3QO7 A;  5F5W A;  4LDX A;  4C5I A;  3P8B B;  3JRZ A;  4M77 A;  4M7A G;  2DIQ A;  4OB1 B;  2K3X A;  5C6S A;  2KK4 A;  2CJB A;  3FDR A;  3HXZ A;  3C94 A;  1YHQ T;  2XDD A;  4UP9 A;  3OSS C;  4HCB A;  3NTK A;  5AYF A;  4BI4 A;  4P3P A;  1LYL A;  5CQX A;  4QQG A;  3VJP A;  2ZT6 A;  1KD1 U;  2I4O A;  3MF2 A;  3M58 A;  4C0F A;  4J6X A;  2P0L A;  4PHC A;  3PCO A;  1N9S A;  5E3I A;  4H2X A;  1G3S A;  4YPF A;  2EJF A;  2FVU A;  4BWA A;  1YHQ A;  2AHJ B;  2ZXF A;  2PMF A;  1VIF A;  4XEO A;  4X9D A;  1U1T A;  5LJ3 f;  3E9F A;  4XTW A;  2E70 A;  2D0Q B;  4J7F A;  3VU3 C;  2RHY A;  3HFN A;  4TVY A;  1FX7 A;  3CCJ T;  1H4T A;  4BAC A;  2G4C A;  3QO5 A;  3L2W A;  4BY6 B;  4JJN K;  3H6Z A;  2DXC A;  2K3Y A;  4O6J A;  1QF6 A;  5C52 B;  2X4Y A;  3OYA A;  3HHT B;  5IAY A;  5L8R E;  3G71 T;  3JCM W;  1YJW A;  4Y91 A;  5CKB A;  3MQZ A;  4YRF A;  4WJ3 M;  4XAX B;  2X4X A;  4TQF A;  4M78 G;  1BIA A;  1QVF S;  1PSF A;  5GMK e;  2E6N A;  1NE8 A;  2JUF A;  3ER0 A;  3CCJ A;  2WSE E;  4IUP A;  4N0A C;  5FRN A;  4LDW A;  2QQA A;  4HWR A;  4NCX A;  4P72 C;  4BI3 A;  4BW9 A;  3V7S A;  3MEW A;  4J6Y A;  2HNI A;  2Q7G A;  4LVJ A;  1Z7M A;  2VXF A;  2ZPI B;  1ZBX A;  3NEN A;  2RHX A;  3OY9 A;  3MP8 A;  1UGQ B;  4YCW A;  1YIJ A;  5HKC A;  3MP1 A;  2YHT A;  1QVP A;  1LOJ A;  4YRM A;  2DJZ A;  3LGL A;  3C12 A;  4JRP A;  2DXB A;  3JCM c;  5KCH A;  1N9R A;  3GIB A;  2I2L A;  2X35 A;  2ZPH B;  5GAO m;  2IVW A;  2GFU A;  4OGC A;  4C8Q B;  4CRI A;  4BB7 A;  3CBP A;  4WF2 A;  3X26 B;  5I2S A;  1QVF A;  2C8M A;  4RCC A;  4DA4 A;  2RJC A;  3TEH A;  2RH2 A;  1K73 U;  1AHJ B;  1SSF A;  4FM4 B;  1USY A;  3SWN C;  1NJ8 A;  2LRQ A;  2DQ3 A;  5GAN 6;  3RKY A;  1H3Z A;  4M75 D;  3VQV A;  1OZ2 A;  4P71 A;  5CO7 A;  2JOY A;  1W66 A;  3HFV A;  2QEX T;  4M77 E;  2Y4X A;  2QI2 A;  2I4L A;  1NYR A;  1X56 A;  2QA4 T;  1M90 U;  1XTD A;  2V8J A;  4ZIB A;  2DK3 A;  4YRL A;  4LD6 A;  4H02 A;  4LVL A;  5LL6 S;  1C0A A;  3P8V A;  3NTH A;  3JCM b;  3BDL A;  5GMK l;  3LX7 A;  3LSQ A;  5CR2 A;  4M7D D;  3X28 B;  2QEX A;  4EPC A;  4XU2 A;  4BE1 A;  4MML A;  4BE0 A;  2QHV A;  2QA4 A;  3TEE A;  1WQ7 A;  1G5V A;  1HTT A;  3QBY A;  3QXE B;  1N27 A;  3TU4 K;  2Q5I A;  3M4P A;  3CMQ A;  3QO8 A;  3JB9 F;  2MMP A;  2ALY B;  1YFR A;  3VQY A;  4QVZ A;  2GCX A;  3VQX A;  4E7I A;  2DVE A;  2JVV A;  4N4I A;  3JCM g;  3PZC A;  12AS A;  3WQZ A;  4EMG A;  1NJ2 A;  4P75 C;  3BFM A;  4NS5 A;  2BKD N;  1KC8 C;  4V2S A;  3LWH A;  4VUB A;  4Q15 A;  3L2Q A;  3L2Z A;  3CC4 T;  3NTI A;  2KMT A;  2EQM A;  1EQR A;  2P0P A;  4IKF A;  2J3L A;  4A54 A;  3LWI A;  1E24 A;  4C8Q G;  2EQK A;  2E5A A;  4BD3 A;  3L4G A;  2H3J A;  5GAN f;  1WJR A;  2DDZ A;  4OVA A;  3QII A;  1IRE B;  3OYB A;  3HRU A;  4A4F A;  2DEQ A;  4JS4 A;  1JRI A;  4J7I A;  4HWP A;  1GGM A;  3L4G B;  3HXV A;  5DM7 R;  4CI0 C;  2B8A A;  3DSQ A;  5CQY A;  3CC4 A;  4DOV A;  1VQ8 T;  2PVO B;  3ZBD A;  4EMK C;  1Q86 C;  5LJ5 j;  5GAN 8;  1QE0 A;  2R58 A;  1VQK A;  2RA2 A;  4E7K A;  4J5Y A;  3CD6 T;  3SWN B;  5GMK i;  4YRQ A;  3FJP A;  4LDY A;  4CH6 A;  2QHS A;  1K8A U;  3N5B B;  2XK0 A;  2XID A;  4JLG A;  2K2V A;  3JCM f;  3C4S A;  1QW1 A;  2P5I A;  3HXX A;  1VQ8 A;  1KMN A;  3E9H A;  4PLL A;  4XTZ A;  3MCA B;  2ZR2 A;  3CMA T;  3X20 B;  4C92 F;  4M7D E;  3ZEH A;  2RK2 A;  4YRO A;  4XU3 A;  4PJO F;  2ODR D;  2XU8 A;  3CD6 A;  4YRS A;  1G3Y A;  2WSF E;  3OYM A;  1PYS B;  3KUF A;  3C95 A;  2RHU A;  4NOY A;  2E3C A;  1NPR A;  4XTX A;  5FU7 B;  3IG2 A;  3OYF A;  1TH7 A;  3OYJ A;  3LLR A;  4MZM A;  2WAC A;  1WU7 A;  3CMA A;  2E65 A;  3QPH A;  1SRY A;  4O5V A;  2ZT5 A;  4PG3 A;  2OAU A;  4M7A D;  4NL2 A;  3ERR A;  1X2G A;  2MI6 A;  1N8R C;  3RMQ A;  4C92 A;  4YRC A;  4PJO A;  2P4T A;  3EFS A;  4M77 F;  5DY9 A;  4XK8 E;  3QJY A;  4TTV A;  4JS5 A;  4C0Z A;  4Q5W A;  1B70 A;  3VYG A;  1WJS A;  2L8D A;  5GAN 5;  4KR2 A;  4UP7 A;  3JCM J;  2R57 A;  3G1Z A;  1UGR B;  5GAM g;  2CIM A;  3A8H B;  4ZGD B;  2RHQ A;  4E7H A;  5LJ5 e;  4Z02 A;  1VQO T;  3CCQ T;  3EFR A;  1FYF A;  4B9X A;  1IL2 A;  5CIU A;  3M4Q A;  2NS6 A;  1VQ5 A;  5KNN A;  2EL9 A;  4MZT A;  2ZPB B;  4F7U F;  5LJ3 j;  2YRV A;  1YIT A;  4MZP A;  2XD0 A;  2EWN A;  1G5I A;  4J83 A;  4CH3 A;  5GAM d;  1BKB A;  3A8L B;  2EJ9 A;  1EIY B;  2ZIN A;  4QVC A;  1VQ4 T;  2AMC B;  2VXE A;  3CCQ A;  5HY6 A;  4EMK B;  3DLM A;  4G85 A;  5CAI A;  1Q81 U;  2XTI A;  1YI2 A;  3VYH B;  4DPG A;  4UP8 A;  5LJ3 d;  3NFC A;  3A7A A;  2LX9 A;  3CBO A;  2LCL A;  2EFI A;  5CCA A;  3HRS A;  3JCM Q;  4M77 B;  1USY C;  3L2R A;  1VQ9 T;  3OYH A;  2DQ0 A;  2QDY B;  5HGQ A;  4JUV A;  1UB4 A;  4M78 D;  2Y4Y A;  1X6O A;  3QKJ A;  3OS2 A;  1S72 T;  2LT4 A;  3UGQ A;  3MP6 A;  5EG2 A;  1YB3 A;  4IUV A;  1FXX A;  4KT0 E;  1VQ4 A;  3FEO A;  5LJ5 h;  3CCV T;  4A4G A;  5CKF A;  4F7U A;  3JCM V;  5CKE A;  1KHI A;  5GAM f;  4G84 A;  1ZQ1 A;  2IY5 A;  1X54 A;  4HT4 A;  3HXU A;  4AH6 A;  1VQ9 A;  5CVI A;  3PCO B;  2JZ2 A;  2DTH A;  4H2X B;  4R55 A;  4BI8 B;  1WJQ A;  2EQU A;  3V8L A;  4YRI A;  3MEY A;  1X55 A;  4M7A E;  4HT9 A;  5KCO A;  2ZZD A;  1S72 A;  1BYM A;  3DB4 A;  4A53 A;  2KSS A;  1W2B S;  1G51 A;  1BI3 A;  4A4E A;  3KFU A;  2QHU A;  3OMG A;  1BI0 A;  3F70 A;  4CS3 A;  4XU1 A;  2A3L A;  2X4J A;  3HL8 A;  3I56 T;  2ZR3 A;  2Y90 A;  1NJI C;  3A8M B;  2QHT A;  2LDM A;  4HWS A;  1NJ6 A;  4D6W A;  2AKW A;  1ASY A;  4P74 A;  1I8F A;  3QNE A;  5KE2 A;  4KUD K;  5HK0 A;  3OYI A;  3HKS A;  3G6E T;  2DU5 A;  2CZ0 B;  3OW2 A;  4M7D F;  3RAC A;  1BIB A;  2F5K A;  3MO8 A;  1ASZ A;  3MEA A;  4OB3 B;  4IUR A;  2CJA A;  3DLL A;  5CK9 A;  4EO4 A;  4M75 A;  1KD1 C;  2BUD A;  3G71 A;  1W2B A;  4FL6 A;  2F5T X;  2MWP A;  4C92 E;  4CH5 A;  4PJO E;  4HCZ A;  4XU0 A;  4XTY A;  3A8O B;  3OMC A;  2CJ9 A;  3G6E A;  3OYD A;  4CH4 A;  2R5M A;  4N4G A;  1FWZ A;  3QZ9 B;  3TRE A;  2ZIM A;  1O75 A;  3UWN A;  3HRK A;  1YFS A;  4ZN1 A;  4M78 E;  4RMF A;  1NJ5 A;  1DJ7 B;  4UC4 A;  5GAN 2;  5GAO n;  3M4G A;  4M7D A;  2FB7 A;  1OI1 A;  4OMF B;  2XDP A;  2EJG A;  3A5Z A;  4ZN3 A;  3TEH B;  5LJ3 h;  5GAO r;  2I4N A;  4M7D B;  4WI1 A;  1Q82 U;  5FLX E;  5GAO p;  2GFA A;  3M53 A;  2C7I A;  4P73 C;  2JN0 A;  3S3O A;  4C5G A;  3HFZ A;  1IZ6 A;  1H4V B;  5GAN 4;  3S6W A;  1B8A A;  3GLX A;  2R5A A;  3KBG A;  5GAN g;  2EQJ A;  3QYH B;  1K9M C;  1U8R A;  5A0L A;  3IKL A;  4C8Q D;  3ASK A;  1MHN A;  1U1S A;  4DOW A;  5FU7 C;  4KBM B;  3OYY A;  4ATO A;  4YDQ A;  5A2Q E;  3INZ A;  4YRE A;  1KQS S;  4TVA A;  4F7U E;  1NPP A;  4XTU A;  3IKM B;  3CCR T;  2HAX A;  5GAN d;  1OZ3 A;  2O4X A;  4PKC C;  4GY5 A;  1XOV A;  2XHC A;  4TVR A;  3RKW A;  4YCV A;  1Q86 U;  3KXT A;  3A5Y A;  1GXI E;  2L89 A;  4L5G A;  2O4X B;  2VGM A;  4PL6 A;  1H4Q A;  1LNX A;  5D6Y A;  3E19 A;  4JRI A;  4C92 C;  4PJO C;  3CCR A;  1KG1 A;  2RJF A;  5IT9 E;  2DAQ A;  1KMM A;  4RCB A;  3G4S T;  4JRQ A;  3A7R A;  3V8K A;  3OYE A;  2RI2 A;  2RD1 A;  3A7U A;  3QYG B;  4XTV A;  1KQS A;  2K5I A;  2D9T A;  1VIE A;  3JCM d;  4M7A F;  1UGP B;  5D6W A;  4ZGJ B;  4HWT A;  2DPP B;  3CCM T;  1M90 C;  4FU6 A;  1HK9 A;  3OS1 A;  2KY9 A;  2ZT8 A;  4XQ3 A;  1D3B A;  1UGS B;  3JB9 H;  2ZTG A;  2GQV A;  3PIO A;  2ARS A;  3HRI A;  1Y96 A;  3V7C A;  1P92 A;  3G4S A;  3X25 B;  4YRJ A;  4M75 E;  2MF2 A;  3SB2 A;  3VUZ A;  1M8V A;  3HRT A;  1JB0 E;  1G3T A;  3CXC S;  4YP0 A;  1X01 A;  3CCM A;  4M77 C;  3SDZ A;  3HTZ A;  2IG0 A;  2ZZG A;  3A32 A;  1WYD A;  2XG8 D;  2E41 A;  2ZIO A;  2ZT7 A;  4H2U A;  1WQW A;  4OP0 A;  1H4S A;  1N9W A;  4ZTF A;  4H2W A;  4ME7 A;  2DZ9 A;  4H2T A;  2ZZE A;  1Q7Y U;  4BDY A;  2CYZ B;  2CKK A;  4M7A A;  3OBW A;  1VUB A;  4YCU A;  1E1O A;  2PVD B;  3MEV A;  1HXD A;  2RI3 A;  3WVE B;  2V8I A;  3BJU A;  1M4Z A;  3I55 T;  2G3R A;  4M7A B;  1B7Y A;  2K5F A;  3R6O A;  4P5N A;  3REX A;  1QVG S;  3ZFJ A;  3QJ6 A;  4Q6G A;  4QW2 A;  3DKM A;  1Z7N A;  2O01 E;  3JB9 J;  3GP8 A;  1B7Y B;  4ELY C;  3I7F A;  4H2S A;  2QQ9 A;  2DD5 A;  5I21 A;  3CXC A;  4EMH A;  3LC0 A;  4LVM A;  1M1K U;  2Q7H A;  4FSX A;  3OYL A;  4M78 F;  1PSE A;  4Y28 E;  1HC7 A;  4QQD A;  3I55 A;  2DU7 A;  2MWO A;  1VQ7 T;  2VYT A;  2VC8 A;  4C0D C;  4LDV A;  2PQW A;  3TUP A;  5GMK m;  1KQ2 A;  1SES A;  4OB2 B;  4C0G A;  4ZTJ A;  2A7Y A;  3JAM E;  4KUL A;  3OYG A;  4J8O A;  2L5Q A;  2D6F A;  3FLG A;  5LJ5 f;  4HWO A;  4P74 C;  4C5H A;  3HXY A;  1QVG A;  4LNS A;  3OYN A;  3LW5 E;  1ADY A;  1X2H A;  4C92 B;  1K8A C;  4MDX A;  4PJO B;  1VQ7 A;  4LD9 K;  2EIF A;  5GAN 3;  1JBM A;  4YRT A;  3CCL T;  2PME A;  1B70 B;  3J80 E;  4A4H A;  5GAM j;  3PTA A;  4M78 A;  3SD4 A;  4LVK A;  4IUU A;  4BE2 A;  3JB9 G;  4M75 C;  4JLI A;  1RIQ A;  2PUO B;  3FC3 A;  2RHQ B;  5GAO l;  3WVD B;  5FRM A;  3JCM h;  5D6X A;  4FT4 A;  2OTL T;  3PGG A;  2LQ8 A;  1NZ9 A;  2QQB A;  4E7L A;  3VKI A;  3P8D A;  3R07 A;  2HQE A;  1UEB A;  4HVC A;  2FHD A;  2CZ6 B;  4PLI A;  3L2U A;  1B76 A;  4A4K A;  4P3N A;  3WXM B;  2Q7E A;  3G7Z A;  3CCL A;  2LQK A;  4H2Y A;  2CZ1 B;  2EKO A;  2JTF A;  5GMK j;  1VQO A;  2M1H A;  3E9I A;  3GNF B;  4KUI A;  5A0D A;  1EVK A;  5KH6 A;  3NEM A;  1NJI U;  4E51 A;  4E47 A;  1EOV A;  2E6Z A;  2DTO A;  1R8O B;  1Y07 A;  2XI9 A;  2OTL A;  4M7D C;  11AS A;  2GF7 A;  4HT8 A;  5FU6 C;  1G5H A;  4K87 A;  2L3R A;  1WGS A;  2LC4 A;  1BBW A;  4YRP A;  2ZCF B;  4EX5 A;  5DLQ E;  4K86 A;  3REU A;  3RMS A;  3MET A;  1KQ1 A;  4P71 C;  4X9C A;  2K4Y A;  3LYI A;  3OB9 A;  2BIV A;  2RB6 A;  1VQZ A;  5CKH A;  4H2V A;  3QG1 A;  3E9G A;  3QSU A;  3W3S A;  3ICA A;  3LSS A;  3RGL A;  5CKD A;  1KOG A;  3PNW C;  1Y7X A;  1YCY A;  4X5O A;  3OW2 S;  4F7U B;  2RM4 A;  3UFG A;  1MGQ A;  2IY5 B;  3PT9 A;  3L42 A;  4YTL A;  2RJE A;  4M75 F;  1ADJ A;  3CEY A;  3QZ5 B;  3Q1J A;  3A31 A;  3BDU A;  3VUB A;  3CCV A;  4TWA A;  4O2D A;  2NLU A;  3M54 A;  3CC7 T;  1YJW T;  1ZHI A;  4E7J A;  3CCU T;  4M77 D;  2FL7 A;  1M1F A;  3S3M A;  1QP2 A;  3H8Z A;  3CME T;  4C0D B;  3PMT A;  4C92 G;  4OF1 A;  5GAM e;  4PJO G;  4ZTZ B;  2LVM A;  5K1P A;  1Q81 C;  3UT1 A;  1SET A;  4RG8 A;  4C8Q F;  2JNG A;  1EVL A;  2P0Q A;  1WNL A;  3OSV A;  2AKW B;  4RG2 A;  5LJ3 e;  3S3N A;  3OS5 A;  5J26 A;  3CC7 A;  4FT2 A;  1YIJ T;  3CCU A;  1YJ9 T;  3I56 A;  4L87 A;  1M5Q 1;  1WPY A;  1N6A A;  2E10 A;  3CME A;  1VQM T;  2RI5 A;  4ZGE B;  2CGH A;  2RO0 A;  2OTJ T;  1BBU A;  2CZ7 B;  2HD0 A;  3MHX A;  3AHU A;  2PVG B;  1KHC A;  2X4W A;  4MMK A;  1K9M U;  4M75 B;  1EIF A;  3QTC A;  2XDB A;  3L1A A;  1W4S A;  1NYQ A;  1YJ9 A;  3P8Y A;  3RES A;  2YLC A;  2LT1 A;  1NJ1 A;  3BY7 A;  4M77 G;  3J7A F;  3JB9 I;  4C8Q A;  3OYK A;  1VQN T;  2ODR C;  1VQM A;  4HA8 A;  5GAM h;  3FIF A;  4RMO A;  2OTJ A;  3MEU A;  3MF1 A;  3IAL A;  3QDR B;  2HQX A;  4N4H A;  4RKU E;  2PUK B;  5GAO q;  2ZPE B;  4R56 A;  4CS2 A;  2E5Q A;  3A74 A;  1QP3 A;  4JDS A;  3A5Z B;  5FU6 B;  2ART A;  1BI2 A;  5J3B A;  4F7U G;  1VQN A;  1E22 A;  5GMK h;  5C51 B;  5GAN 7;  3DB3 A;  3CPF A;  2RHS A;  4M7A C;  3M55 A;  3HXW A;  1KC8 U;  4YYE A;  3V7R A;  1H64 1;  5C53 B;  3HFZ B;  1I5L A;  2JTM A;  5GAN j;  2RHS B;  2ZZF A;  5HK3 A;  2LCC A;  3CCS T;  3L2V A;  1V29 B;  4KQE A;  3HFO A;  3OA6 A;  2EYQ A;  3CBM A;  1YJN T;  3JCM P;  5ELN A;  4YRR A;  3QO3 A;  3M9Q A;  2RHZ A;  1YFT A;  4FIB A;  1X75 C;  2ZNJ A;  3T9N A;  4LVI A;  2A8E A;  1RL2 A;  4OGE A;  2K5L A;  4TVA B;  2F69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...