2EJGA

Crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
235
structure length
232
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 64
structure length 232
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejgA01
3HFZB 1ADJA 4YROA 3HY1A 3ICAA 4M75E 3TEHA 3RKWA 3BY7A 4X9CA 1Y96A 2DTIA 2I2LA 4YRLA 4XTYA 3JB9J 4RCBA 1USYC 2C7IA 2E64A 5GANj 1X54A 4C92F 1LYLA 3VQWA 4CS4A 4MMLA 3BW1A 1C0AA 4M75F 3JCMc 2DU5A 2DJZA 1JJCA 4P3PA 4K86A 4M75G 1EVLA 1VQZA 4YP0A 4XEOA 3A5YA 1NYRA 4P3OA 3P8TA 2PMFA 4UPAA 4YRIA 1D3BB 1L0WA 4N0AC 2YLBA 4P73C 4JUVA 2ALYB 3RIRA 3KFUA 2E10A 2K57A 2ZZEA 1ASZA 4NCXA 3JCMV 4C92D 4C8QE 3A74A 3IKLA 4TTVA 2ZIOA 5LJ3g 3MF1A 1ASYA 1B70B 4H2XB 2I4LA 4F7UF 4M78D 3W3SA 3NETA 4J6WA 4WF2A 2P5IA 4YRRA 2IY5B 2G4CA 2QHSA 1Z7NA 4HWTA 2ZR2A 5ELOA 4M78A 3VQXA 3JB9F 1BBWA 3JCMg 1HC7A 3A31A 2ZT7A 1H4TA 3A32A 4M77A 4M75C 2J3MA 3QO7A 4M7DF 3JB9H 2DVEA 5GAMe 5ELNA 4H2TA 1N9RA 2EWNA 4H2YA 3V8LA 1EIYB 2ZT5A 3RKXA 4NL3A 1YGBA 5GANd 2DTHA 2DDZA 4Q15A 4OLFA 3NELA 3L2ZA 1USYA 4M7AA 3REXA 4E51A 4CS3A 4TVAB 3RL6A 3HXZA 4C8QF 1B7YA 1X55A 1NJ5A 3HXYA 3HFOA 4P72C 1W66A 4YRKA 4JRIA 4F7UB 1U1TA 4M7DA 2RB6A 3QO8A 3A7UA 3MF2A 5E3IA 3QO3A 1TH7A 2I4MA 3TEHB 4P75C 3IG2A 3VQVA 4KR3A 4M78F 4M7AC 1G5HA 4XEMA 4CH5A 4N0AA 4G85A 5CAIA 3V8KA 3I7FA 3L4GA 4RDXA 4M7DE 3A5ZA 4YYEA 2ZZFA 4PJOA 1B76A 3R07A 1I8FA 4M77E 4YPFA 5LJ3f 5LJ3h 3UGTA 4M78B 1WQWA 4YRQA 1U1SA 2E65A 4J5YA 3JCMX 5C51B 4TWAA 2IY5A 5GAOp 3QNEA 4X9DA 1NYQA 2RHQB 4KQEA 3QSUA 3P8YA 2Q7EA 4M7DG 4Y91A 4H02A 2ZTGA 4HA8A 2EJFA 3MEYA 5GAN7 4XTUA 4HVCA 5C53B 3TUPA 1NJ6A 1J5WA 5GAMj 3CMQA 5GMKm 3UGQA 4P74A 1QF6A 4M7AG 4C92A 4RQEA 1BIAA 3QTCA 1H4SA 4TQFA 4M77C 4EMKC 4M7DB 2DQ3A 2AKWB 2QHUA 2ZCEA 3HTZA 4YDQA 3TEGA 1M5Q1 5GAOm 2DKGA 4WI1A 3HXUA 2Q7HA 1LNXA 4ZIBA 5GMKe 5GANe 3IKMB 4M7AE 2ZZGA 4P72A 3RERA 4EO4A 3JCMW 2DZCA 4M7AB 2RHSB 5GAOn 4EX5A 3FB9A 4RCCA 2QHVA 2AMCA 3JCMd 5GAMd 1SETA 3WQZA 4M77F 4YRNA 1EQRA 2Q5IA 3HXWA 4M7DC 4P75A 5GAMf 4YRPA 3REUA 3BJUA 4XTZA 5GAOq 2RHSA 4XU2A 3HFZA 1MGQA 3EFRA 5LJ3d 4P3NA 4HWOA 4BW9A 3JCMP 2ZT6A 4K88A 4H2UA 5GMKl 3A7RA 4M75D 1QE0A 3EFSA 3PGGA 4TVYA 3JCMh 2E1HA 2ZGWA 3JCMb 2VXEA 4M75B 4XQ3A 4WJ4A 3HY0A 1KQ1A 4M75A 1BBUA 1H4VB 1HTTA 1I81A 12ASA 4XTXA 1EIYA 2ARTA 5GAN5 4RQFA 3HRKA 4YCWA 4C8QB 4XU3A 1H4QA 1G5IA 2YLCA 3SB2A 3HRIA 5K1XA 3JB9D 3GIBA 4UP9A 4C8QA 4P74C 4P71C 4BWAA 3VBBA 3M4GA 4H2VA 1I4K1 2QTXA 2E3CA 4X5OA 4NOYA 2ZNIA 4PNOA 4ZTZB 5K1PA 3VU3C 2ARSA 4AH6A 1Z7MA 1KOGA 4M7AD 2ODRD 5KNNA 4V2SA 4EMKA 1B70A 2QHTA 11ASA 4K87A 4M77G 3LSQA 2DTOA 5GAMh 4YCVA 5LJ5f 4XU0A 1B34B 4YRSA 4M7DD 4OP0A 1E24A 3QO5A 3RUXA 5LJ5d 2EAYA 1HXDA 3JCMe 4J15A 4G84A 3JB9I 4ZTUB 4HWRA 1E22A 2XGTA 4J6XA 4DQ2A 2XTIA 2FB7A 4JRKA 2CJBA 5I21A 4EMGA 5GMKh 1YCYA 2DZ9A 3M4QA 4C92G 2CJAA 3E9HA 2DXTA 5GMKj 1WYDA 4O2DA 4HT9A 1WLEA 4H2SA 1JBMA 4L87A 5GAN3 4A53A 1X2GA 3P8VA 1WNLA 2Y90A 2RHQA 3HFVA 1X01A 5LJ5j 1M8VA 4YCUA 3UFGA 4UP8A 4F7UG 4TQDA 1Y96B 2RA2A 2HNIA 3HSBA 4C92B 2I4NA 3HXXA 5HGQA 1G51A 4WJ3M 1PYSA 1I5LA 1X2HA 5GMKi 3AHUA 3JCMJ 1N9WA 1E1TA 3RGLA 3SWNA 5GANh 3NEMA 4P71A 3PCOB 3ERRA 4F7UE 1YFSA 3V7RA 4CH3A 4PJOF 3HFNA 4NL2A 3V8JA 3IALA 3LSSA 5GAN8 3SWNB 2Q5HA 4EMKB 3A7AA 3M4PA 3G1ZA 4Q6GA 2Q7GA 3HXVA 1EVKA 5GANf 5GAN2 4XU1A 4P73A 5LJ5g 3V7CA 4PG3A 2ALYA 5GAN4 5GAMg 2DU7A 1X56A 3VQYA 3L1AA 5DY9A 5C52B 2VC8A 4PJOE 2ZR3A 1NJ8A 4C8QD 4C92E 2P0LA 1B7YB 4PJOB 5GAN6 4TVAA 2PMEA 1NJ1A 4YRFA 2ZXFA 3JCMQ 5GAOr 4PJOD 4YRTA 2J3LA 1BIBA 1JJCB 3NENA 1NNHA 2RM4A 1KMNA 1N9SA 5F5WA 4M78E 4EMHA 4M77D 4H2WA 1B8AA 2DXUA 4J6YA 1YB3A 4PHCA 4HWSA 2AMCB 1LJOA 1SRYA 4F7UA 1IL2A 2CGHA 4UP7A 3UH0A 3JB9G 4XTWA 4RMFA 5LJ3j 2ARUA 2RD1A 4CS2A 5LJ5e 4CH4A 3INZA 3LC0A 1B34A 2FYKA 5GAOl 4PJOC 2E41A 4TVWA 1LOJA 3FJPA 1NJ2A 1GGMA 1SESA 4M78G 2AKWA 2ZNJA 3DSQA 4H2XA 1SERA 4YRGA 3V7SA 3QHSA 3OD1A 4QVDA 4MMKA 2VXFA 2I4OA 1WPYA 1RIQA 3PZCA 2EL9A 1YFTA 4JLIA 2ZIMA 1JRIA 4M77B 4HT8A 4YRCA 4A54A 1PYSB 1FYFA 2JN0A 2DQ0A 4XTVA 1D3BA 1H641 3SWNC 2ODRC 3FIFA 3BDUA 2C8MA 1KQ2A 2DEQA 1YFRA 1EOVA 3RESA 4DPGA 2ZT8A 4KR2A 5GANg 1ADYA 3RF1A 5LJ3e 2EJGA 3E9IA 4YRJA 3RACA 4YREA 5LJ5h 1HK9A 4C92C 4LNSA 1EFWA 4M7AF 1KMMA 3BFMA 2E5AA 3RKYA 2YHTA 4PJOG 4C8QC 2EJ9A 1ATIA 4M78C 1WQ7A 1E1OA 3L4GB 4C8QG 2ZINA 3PCOA 3JCMf 4HWPA 4CH6A 3QUIA 1WU7A 2CJ9A 4YRMA 4QVCA 2CIMA
chains in the Genus database with same CATH superfamily
2FPDA 3CC4Q 3OYKA 1ADJA 3ZL7C 3LYIA 3HY1A 1YCSB 4VUBA 3JAME 1D09B 2DL4A 3BY7A 3TREA 4X9CA 4YRLA 4XTYA 2RH2A 2PTKA 3VS6A 2J05A 3OYDA 1NYGA 4C92F 3VQWA 2HCKA 2IG0A 3VUBA 1ZA1B 4OMQA 3JCMc 2DJZA 1SG5A 4M75G 3CMAQ 1EVLA 1VQZA 4C0DC 4JZ4A 2PVOB 1K0XA 4UC4A 1NYRA 7AT1B 3P8TA 1K4US 4UPAA 4YRIA 2OAUA 3LX7A 1D3BB 1WXBA 2YLBA 4Z89A 5IXFA 2B8AA 2JW4A 4CC7A 2E10A 1YJNT 2K57A 1I5OB 4OMFB 1NEGA 3JCMV 2ESWA 4C92D 4C8QE 2QGFB 2XKOC 3SFMA 3DB4A 2ZIOA 3CCUT 1TU0B 2HAXA 1MNDA 1B70B 4Y28E 4H2XB 3REAB 4F7UF 5IHIA 1FMKA 2MMPA 2EKHA 4J6WA 2IY5B 2P5IA 4YRRA 2X4JA 1PSEA 4BE1A 2QHSA 4PL6A 2LQKA 5IH2A 3CMEQ 2DILA 2ZR2A 4PKCC 1G3SA 3QZ5B 2LRQA 3CCJT 1VQ5A 5CIUA 3A32A 2EGAA 1ABQA 1TG0A 1QMCA 4ESRA 2RPNA 3JB9H 2OJ2A 3A5ZB 2PNIA 3L42A 3TSZA 5D7UA 5ELNA 1MUZA 1N9RA 1QWEA 4H2YA 2ZT5A 1IGUA 2J7IA 5GANd 1VQPQ 4Q15A 1OPKA 4OLFA 2DL7A 3SD4A 1YWOA 2KXCA 4E51A 2RJCA 3OQ5A 1BKBA 1ZSZA 3RL6A 2GGRA 2EFIA 2AHJB 4C0FA 2P4RA 4LNPA 3G6EA 1K9MU 1TWBA 3P8BB 1OZ2A 4A4HA 1JXOA 3ZEHA 3M0UA 4J7FA 3MF2A 5E3IA 1TH7A 1ZHIA 2A28A 1RAGB 1RABB 3GOXA 3N5BB 2J06A 2JZ2A 2G6FX 4C5HA 3G6ET 1JEGA 1QVPA 2RN8A 4PFPA 4PLLA 1BI1A 3RR6A 1SRLA 1VQNQ 3L4GA 2D6FA 1T0HA 3G71Q 3CCLQ 2DPPB 3E9FA 1BI3A 1NJIC 2HMAA 1PNJA 4YPFA 3EGDB 3UGTA 1M2VB 1EX4A 2OI3A 4FYYB 1QVGP 3CEYA 1G2BA 2V26A 5IN1A 2E65A 2O88A 1WJRA 1M8MA 5KYWB 3L2UA 4FYXB 3PIOA 3CPWA 3I35A 2RHQB 3A1PA 2P0KA 3EG3A 1X43A 4M7DG 4Y91A 4H02A 4LDYA 3CMAA 1J5WA 2VWFA 1ZLMA 4AFSC 5GMKm 1Q86U 3UGQA 4P74A 1WLPB 2ZPGB 4DOVA 4C92A 2AKKA 1BIAA 2L89A 2CKKA 2DXCA 3QTCA 1VQ7Q 1KHIA 5KE2A 5DLOA 4M7DB 3CQTA 2YUOA 2ZCEA 2DO3A 2OTJA 4M4ZA 3X28B 2B86A 1Q82R 3CCEA 1OV3A 3C12A 3QYHB 1PCXA 2DKGA 2GBQA 3FLGA 1LNXA 2ZZDA 5GANe 3A8MB 2CH4W 1V1CA 3RERA 2ATCB 1A0NB 3JCMW 2RHSB 1BB9A 5I2SA 5GAOn 3FB9A 2RQVA 3CC4A 4DBFA 2VV5A 1M90C 2QEXT 2KT8A 2HDAA 1SETA 2D0QB 2FZKB 2RO0A 3JSCA 3WQZA 3HPWA 1SRMA 1AWWA 2D0NA 3BJUA 4XTZA 3EGXB 2IVWA 3MPUB 2O9SA 2MIOA 3C4SA 3J7AF 1YBYA 2KMTA 4BUGA 1LVKA 3M59A 3A7RA 5A0GA 2LP5A 1QE0A 3EFSA 2CZ6B 2DETA 3JCMh 1OI1A 4FIBA 2ZGWA 2YDLA 2K6DA 1M3AA 4E7HA 1GCQC 4A4FA 4D6WA 2XICA 3QJYA 1EIYA 3VS5A 4RG8A 4FW2A 2NUPB 3HRKA 4XU3A 2QI2A 2YLCA 3HRIA 2YUPA 1M1KU 4ELYC 3CXCP 2EVRA 4UP9A 4HVVA 2LT1A 2FG0A 3CCUQ 1QCOA 3FC3A 3I55Q 1HJDA 3PMIA 2LJ1A 2EYYA 1YJNQ 4NOYA 5FROA 4PNOA 4IIMA 1VQOQ 3CBOA 1QCFA 4M7AD 5KNNA 4IUVA 4EMKA 3TEEA 4K87A 3LSQA 2HQHA 3HP9A 2DTOA 1NPPA 5LJ5f 3OY9A 4XU0A 1B34B 1RAIB 5HKCA 2COZA 2NLUA 3C94A 1S72T 4OP0A 4MDWA 1VQPA 3UDCA 3IQLA 1Q81C 3NTIA 3JCMe 2KROA 4OGCA 5HY6A 4KRTA 3MQZA 1E22A 3QZ9B 2XTIA 3G4ST 5C0MA 5GMKh 2JM9A 2DZ9A 2KRSA 2KGTA 3VS1A 9ATCB 3VS7A 4HT9A 1UB4A 1WLEA 3CC4T 1X2GA 4ZN1A 4BB7A 2K2MA 3UFGA 4F7UG 4TQDA 1E6GA 3BDLA 2P0QA 4PJLA 1VQ9T 3HSBA 1UGVA 2I4NA 1G51A 4ELZC 8ATCB 1IGQA 3ERRA 4F7UE 1YFSA 3V7RA 1QVGS 4J9CA 4CH3A 1QP2A 3ASKA 1VYTA 3QDRB 4BI4A 2DVJA 3I56Q 4EMKB 3A98A 2R5MA 2DIGA 3H8ZA 1KD1U 2XG8D 2DK3A 3HXVA 1EVKA 5GAN2 4P73A 1WJQA 1M2OA 2DE0X 2PU9B 1KC8C 5GAN4 2DYIA 3QG1A 1KIKA 5A2QE 1PC0A 3AT1B 2KXDA 2F2XA 4PJOB 2DRKA 2O31A 1NJ1A 1PHTA 2CSQA 2R57A 1ZBJA 2YRCA 1BIBA 1JJCB 1JJ2A 1NNHA 2RM4A 4M78E 5CKBA 2DXUA 4MZPA 4F04B 2HSEB 4HWSA 2LC4A 3HHTB 3PNWC 1IL2A 2RHIA 3FDRA 5FLXE 1YJ9T 3UH0A 3JB9G 4RMFA 1D0YA 2EQKA 5HK3A 1IRXA 1QQJA 1S72A 4CH4A 1YP5A 5GAOl 2ZPFB 4PJOC 1LOJA 1NJ2A 1SESA 2ZNJA 2YXYA 3VRZA 4YRGA 3CCST 2XDDA 4E6RA 3QHSA 2GFAA 3OD1A 2XU8A 3X25B 4C5EA 4MMKA 1RIQA 4IUQA 3QIIA 2ZIMA 2Y4XA 4M77B 2RQRA 2KBTA 4A54A 2FO0A 1PYSB 2JN0A 2DQ0A 4A4GA 3BDUA 2CDTA 2VGMA 4DPGA 1JQQA 4KR2A 2CZ1B 3LGLA 4J9IA 3VKIA 2GTJA 2YUNA 1XTDA 4LVIA 1K73U 4OVAA 1HK9A 4LVJA 1FXXA 1OZ3A 4LNSA 1GFCA 2K5IA 1Y7XA 3M4YA 4DBRA 2E5AA 1GBQA 3OBYA 3HRTA 3CCSA 2QQ9A 3OW2P 1VQKT 1ATIA 4M78C 3MCAB 1YJNA 1ACMB 1I0CA 2VUBA 4J9GA 3O8VA 4QVCA 1NG2A 1WXUA 3RKWA 3F70A 4EIKA 2I2LA 2DTIA 3M5AA 3P8DA 4J8OA 3EGDA 3JB9J 3FJ5A 4Z8AA 1UUEA 2W10A 2K7AA 2DAQA 5GANj 1AWOA 4PJNA 3L2WA 4CS4A 1KQSS 4K11A 5DLQE 3CXCS 2DU5A 4XK8E 2ZPHB 2RQTA 1FYNA 3WVEB 1YIJA 1LCKA 3E1SA 1D1CA 1MV3A 1UE9A 4CC4B 4LE9A 2HKQB 2DIQA 1KQSP 2PMFA 4C0GA 1L0WA 1VQ8T 2PZ1A 2DJQA 2Z0WA 3RIRA 4ATOA 2ZZEA 2AZSA 1ZSZB 1ASZA 2FZCB 4NCXA 1TSFA 2VVKA 4E7SA 3GF5A 3L2RA 1SEMA 1XJWB 4QW2A 1WIEA 2WSFE 2G4CA 3A8LB 1VQNT 4OB1B 4HWTA 5CCAA 1VQ6Q 1WHMA 3JB9F 3JCMg 1HC7A 1KSWA 2ROTA 2ZT7A 5GJWB 1Q82C 4BI8B 4M7DF 2XMFA 2ED0A 2BUDA 5GAMe 4H2TA 4E7JA 3V8LA 1EIYB 2BE7D 3RKXA 2GQVA 4A4EA 4AT1B 1W4SA 4DBQA 2HZYA 2DDZA 5D6WA 1USYA 4M7AA 3REXA 4CS3A 1Y0MA 3NPFA 2X9HA 4C8QF 1NJ5A 1MMDA 3OB9A 3HFOA 1W66A 4FSXA 1JU5C 2ROLA 2ZPBB 1U1TA 3MP1A 1EZZB 1HD3A 3QO3A 2I4MA 1BYMA 1X2QA 4BY6C 4HXJA 4LVMA 3EGXA 3VQVA 3VRYA 4PLIA 4M78F 3SEMA 3CCJQ 4M7AC 2OTLQ 1OEBA 1YJWA 4XEMA 1KD1R 3I9QA 1D0XA 3V8KA 1S72Q 2NYSA 1NJIR 3I7FA 3A5ZA 2L8DA 4YYEA 4PJOA 1B76A 1PM3A 1TXQA 1S1NA 4JJNK 3R07A 4X1VA 1I8FA 2LNVA 2O01E 2EQMA 2R58A 4BD3A 4RG2A 4YRQA 4ZN3A 1SSHA 1GCQA 2NUTB 3QNEA 3QSUA 1QVGA 3RBBB 4OMNA 5CKDA 2QTVA 1M1KC 1PKSA 3A8OB 2BE9B 1WXTA 2FRWA 2QYZA 4XTUA 5C53B 3TUPA 1VYUA 3CMAT 2LNHB 3UT1A 3CMQA 3H41A 2DNUA 4QKUA 1RAHB 1R77A 3X20B 1QF6A 2QA4T 2GFUA 4TVRA 1WX6A 3UATA 2LQNA 4GLKA 1RAEB 1ZA2B 4TQFA 3NTHA 2JM8A 5FU6B 2AKWB 1FMVA 2KI7A 1M5Q1 5GAOm 3HRUA 1ZX6A 4JRQA 1YITT 5GMKe 4J7IA 4Y92A 1BU1A 1KD1C 2L3PA 2KR3A 2AMCA 3EG1A 3M0QA 3I55A 3CCEQ 1YITQ 2VYTA 2MAMA 4M77F 4YRNA 2RHYA 2RK2A 2KSSA 4HCKA 4AMCA 3URGA 2Q5IA 3TCJA 1U5SA 2FPEA 4P75A 1O75A 1Q81R 3CCQT 1VQ4A 3KUFA 3VV0A 2KNBB 2A7YA 5GAOq 4XU2A 4P3NA 3DLMA 4HWOA 1UGQB 1WHGA 2AT1B 2PVDB 3ME9A 5CKFA 1MMGA 4J83A 4FYVB 1BK2A 1EIFA 3OSSC 2P0PA 1YN8A 3PGGA 5CKEA 2E1HA 2K5LA 1QKWA 2CP5A 3JCMb 2VXEA 3HY0A 2RI5A 2EQUA 1I1JA 1AHJB 1I81A 3UF4A 4OMOA 4J9DA 2COWA 1OX9A 3M56A 4O6JA 1M90U 2MF2A 3JB9D 3GIBA 4HCBA 4BWAA 3M0SA 2DRMA 3VBBA 3M4GA 1VQPT 3C0CA 1I4K1 2ZNIA 5CKHA 1YNZA 3VU3C 3M55A 2AKLA 2K5FA 5CK9A 1KOGA 2ODRD 4C0DB 4V2SA 3J80E 4BY6B 1B70A 1YHQQ 2RI2A 4PJJA 2O2OA 2KRMA 5GAMh 2MOXA 3P8HA 2FZGB 4YRSA 2RI3A 1KQSA 1E24A 4ORZA 3I56A 2CUBA 2QAZA 4OF1A 2XIDA 2LZ6B 4MZMA 4J15A 2LQ8A 1UJ0A 2QQBA 4ZTUB 2XGTA 2QA4A 5KCHA 2FB7A 2FRYA 1VQMT 2OTJQ 3M4QA 1T3LA 3UPUA 3FRNA 4C92G 2M9UA 3U23A 2XDPA 4CC3A 5GMKj 3A8HB 5M9OA 1JBMA 1GBRA 2ZPIB 3P8VA 2MYSA 1X01A 3LGFA 1QKXA 2MPXC 1QWFA 2GCXA 3PT9A 2D9TA 1NLPC 2HNIA 2D1XA 4C92B 3MEWA 5GMKi 3AHUA 3RGLA 3EG9B 1H3HA 3PCOB 5KYUA 4BACA 4OB0B 2NUPA 4PJOF 1UGPB 2EYZA 3V8JA 3OSVA 2RHXA 2J6FA 3LSSA 2Q5HA 2FVUA 4R55A 1HSQA 3A7AA 1VQ5Q 2HKNA 3CPFA 2Q7GA 4IUPA 5GANf 2A37A 4PK4A 5LJ5g 1PRLC 1X6BA 5GAMg 3VQYA 3L1AA 4FM4B 4PJOE 3PMTA 4LUDA 2HBPA 2YT6A 4OMMA 3FEOA 1WHKA 4C8QD 4C92E 1B7YB 5GAN6 4TVAA 1VQLQ 2PMEA 2DD4A 1HYOA 5GAOr 2W0ZA 4RTVA 1KMNA 1U3OA 1VQ8Q 2H3EB 1CSKA 4M77D 4H2WA 5AYFA 4J6YA 1ZUKA 3S3MA 2A8EA 3DKMA 2F2VA 3G4SA 2AMCB 1LJOA 1VQOA 3OYJA 3META 1UJYA 5DM7R 1Q7YC 5FWCA 5LJ3j 4CS2A 4Z02A 3INZA 3KFVA 4IKFA 2CIMA 1B34A 2FYKA 1B7TA 1SERA 1VQ4Q 2AKWA 1W2BP 4E7LA 2DX1A 4J9BA 1OULA 2LJ0A 1WPYA 2I4OA 2KY9A 3MO8A 3MKDA 1UGRB 1JRIA 1JO8A 2FHDA 4JRPA 3CC2Q 4YRCA 1KC8R 1W2BS 2C8MA 1QLYA 1KQ2A 1VIEA 1YFRA 3RESA 4O5VA 3O5ZA 2GQIA 1M4ZA 4II1A 5LJ3e 2MWOA 2RJDA 3L2QA 3CCQA 1OU8A 1Z9ZA 4YREA 4C92C 1GL5A 1R0CB 1H92A 2O9VA 1KMMA 3BFMA 1Q81U 2YHTA 4PJOG 4C8QC 5I2MA 2EJ9A 2FL7A 4B6MA 1WQ7A 4JLGA 1E1OA 3L4GB 3JCMf 1WU7A 2NUZA 2CJ9A 4YRMA 3HFZB 2BZYA 3OW2S 4YROA 2X3WD 4M75E 8AT1B 4E7IA 1Y96A 3CCVQ 1PKTA 2LJ3A 1B07A 2PQWA 3ER0A 3H6ZA 3R6NA 3JV3A 1Q86R 2E64A 1JXMA 3HL8A 1X54A 5J3BA 4LDWA 1AT1B 1LYLA 3VUZA 4MMLA 5L8RE 3BW1A 1ZUYA 3CCMQ 4M75F 1Q82U 4KULA 1QVFS 4JPBW 1JJCA 1MNEA 3EG0A 1MMNA 3WVDB 4C5IA 4P3PA 3VS2A 3H0HA 2YWWA 3TQ7P 2OTJT 1RI9A 1X6GA 2E5KA 3QWXX 2HQXA 1N27A 4P3OA 3GNFB 4FU6A 4EDUA 2CS7A 4N0AC 4P73C 4JUVA 2DLPA 3OYMA 3T9NA 3UA7A 3QBYA 1AZEA 3IKLA 2FEIA 5CO7A 2QQSA 5I11A 3LW5E 1X75C 5LJ3g 2CYZB 3MF1A 1CKAA 5KCOA 2I4LA 2PUKB 4AG1C 3W3SA 2K3BA 2JTMA 1YHQT 3EG9A 3E19A 3GLXA 3WXMB 2PVGB 3VQXA 5D6XA 1M2VA 3A31A 4QQGA 1H4TA 3OMGA 1UG1A 3J81E 4M77A 4M75C 2J3MA 3QO7A 2KQWA 1ZSGA 2L5QA 3OYIA 1OU9A 2EWNA 3QXEB 4AFZC 4NL3A 3OS1A 1YGBA 1DJ7B 2DTHA 3OYCA 1ABOA 3H0FA 3NTKA 3L2ZA 1ZQ1A 4ZGDB 1WGSA 4TVAB 3HXZA 3DB3A 1B7YA 4QVZA 4C5GA 3HXYA 1VQ5T 3CD6Q 4JRIA 1ARKA 3I56T 3QO8A 1YI2A 2SRCA 1M3BA 4P75C 1X27A 4KR3A 1I07A 4F17A 4L59A 1G5HA 2DEUA 5KYYB 1W2BA 4G85A 5CAIA 4RDXA 4QT7A 4KUIA 3CCQQ 4IURA 4M7DE 2CT3A 4KBMB 1GXIE 1OQKA 1B3QA 5CVIA 1VQ6T 4JS4A 2K3XA 3R6OA 4MZTA 2RF0A 4M78B 2JS0A 1WQWA 2C0OA 2IY5A 4TWAA 1EFNA 2A36A 4GLMA 3CC2A 5GAOp 2DFUA 4X9DA 1NYQA 2EQIA 1VQOT 2CUDA 4HA8A 2ZTGA 2KE9A 2ABLA 2EJFA 3MEYA 4HVCA 2BZXA 3VS3A 2ENMA 1NJ6A 2JS2A 3RMSA 5GAMj 3OW2A 3REBB 3PE0A 3OYAA 2ED1A 5IAYA 2CP7A 4M7AG 4QQ6A 5FWBA 4N4IA 4CRIA 2QQAA 4E2FB 2LTOA 2CP3A 2COYA 4M77C 3MEUA 2QHUA 3HTZA 4YDQA 3TEGA 4WI1A 3HXUA 2Q7HA 1QP3A 2BZ8A 3EAEA 4DEXA 2A0FB 2JUFA 2EPDA 2ZZGA 4P72A 1WJSA 4EO4A 1AWXA 4M7AB 2DBMA 4RCCA 1SSFA 2QHVA 4Q5WA 3CD6T 3JCMd 3CPWS 1RAFB 1Y07A 5GAMd 1M3CA 2LT4A 3EG2A 1KC8U 1N6AA 1EQRA 2NS6A 4B9XA 4M7DC 4OMLA 3REUA 3LH5A 2GNCA 3MHXA 4EPCA 1KJWA 2E6ZA 3RNJA 1MGQA 1WYXA 2QQRA 5LJ3d 4JJCA 2F69A 4BW9A 4KGVB 4LD6A 3JCMP 1YIJT 2ZT6A 4H2UA 2K3YA 3SHWA 2LCSA 2K79A 5GMKl 2V8IA 2J6OA 2DM1A 1K9AA 2KEAA 1VQ7A 5IHKA 4XQ3A 2YUQA 1WZOA 2CP0A 1IXDA 4WJ4A 1BBUA 2E3HA 2M02A 4J9EA 4DEYA 1HTTA 12ASA 4DBHA 2ARTA 5GAN5 4RQFA 2WSEE 3M54A 4MDXA 2YRDA 2CT4A 4C8QB 1H4QA 5FRMA 5ECAA 1N8RR 1Q7YR 1K8AR 3CCMT 4FCYA 1BCMA 4P74C 3G71T 3CCLT 4N4HA 3EHQA 2HQEA 1QCNA 1K9MR 1VQNA 4JDSA 2XHCA 4H2VA 2QTXA 3M0RA 2E3CA 4X5OA 4GY5A 4AG2C 1RL2A 3EH2A 3CMEA 4ZTZB 2QDYB 2ARSA 4AH6A 1YI2Q 4HT4A 2QHTA 11ASA 2EGEA 3QPHA 3OYLA 1H3ZA 4JS5A 3MP6A 1NE8A 3VYHB 3CC7Q 4YCVA 5CQYA 4FT2A 1VQKQ 3CMET 4M7DD 1VA7A 2E12A 2HSPA 3NGPA 2JMAA 3QO5A 4A4KA 1QVFA 3EHRA 1HXDA 1AZGB 2EGCA 3VJPA 1YJ9A 1PRMC 3UA6A 4G84A 1IREB 4OGEA 1VQ6A 1IO6A 2X51A 4J6XA 3VS0A 1JJ2P 1VYVA 4KGXB 4JRKA 3A8GB 2HEQA 5I21A 4EMGA 2E4HA 1YCYA 2CJAA 1Z9QA 3E9HA 2DXTA 5FU6C 4O2DA 4A53A 3CBMA 3TSWA 2CP2A 2Y90A 2RHQA 5I22A 5LJ5j 1M8VA 1W70A 4ANJA 4UP8A 3NHNA 1Y96B 3D7SB 1KK7A 2LX7A 2JTFA 4FW1A 1RACB 3HXXA 5HGQA 4WJ3M 1PYSA 5L23A 1N9WA 3JCMJ 4Z88A 5FU7B 2QK0A 3SWNA 5GANh 1K1ZA 4P71A 1V29B 4C0ZA 2RHZA 2JOYA 4NL2A 5GAN8 4RUGA 3SWNB 5GJVB 2P4TA 2HL5C 4BE0A 2CSIA 3DLLA 3H0IA 4HVUA 1YFNA 4XU1A 3V7CA 4CC2A 1NBEB 4FL6A 2DL3A 5DY9A 5C52B 1NJ8A 2F2WA 3OS2A 1VQMQ 4RTTA 4YRFA 3ULRB 2F5KA 2G3RA 2CP6A 4RKUE 3MEVA 5F5WA 1R0BG 5KYNA 4EMHA 2C06A 4E7KA 4IUTA 4DA4A 4DOWA 1TTHB 1SRYA 4N4GA 5KE3A 4CI0C 2P84A 2JNGA 4XTWA 1TS9A 2RHUA 3M58A 3NFCA 2VKNA 2RD1A 1TOVA 5LJ5e 1QW1A 1TUDA 2X4XA 1UTIA 2E41A 4TVWA 1M1KR 3FJPA 1GGMA 1M9SA 1N5ZA 4M78G 4RMOA 3DSQA 4H2XA 3HKSA 2JXBA 2MCNA 2DYBA 2ECZA 2M0OA 2VXFA 1KFZA 3I55T 2EL9A 4KH1B 1G3YA 1RLPC 2E6NA 3MP8A 3OYBA 2QXFA 2RQWA 3CXCA 1H641 2L2PA 3SWNC 2ODRC 2XD0A 3HTRA 1GFDA 2QG9B 2KDSA 1EOVA 1WDXA 3RMQA 2ZT8A 2OTLA 5GANg 1ADYA 1WA7A 2JVVA 3OMCA 1YJWQ 4LD9K 2KRNA 2EJGA 3QYGB 1NJIU 5HK0A 4PJMA 3E9IA 1EFWA 2X3XD 4M7AF 2GTOA 5EG2A 3CCUA 4KT0E 4R56A 1WI7A 4ZGEB 2ZINA 3PCOA 3LH0A 4IIOA 4B9WA 2DXBA 2V1QA 3OS0A 2VGNA 2CZ0B 1V76A 2ZAEA 3ICAA 4OMPA 1IHWA 2O4XB 3TEHA 1VQ4T 2L3SA 4PFZA 1ZSZC 1XQHA 2DA9A 4RCBA 2M16A 2LCCA 1U8RA 1USYC 3OYFA 2C7IA 2LX9A 1AVZC 2Y4YA 1E6HA 1WHHA 1N8RU 1K8AU 1Q7YU 1TUCA 1AD5A 1C0AA 3I5RA 4HCZA 1VQLA 4X34A 4K86A 2OX7A 1ZUUA 3EFOB 1GCPA 3KXTA 1SF9A 3OS5A 4YP0A 4XEOA 3A5YA 1RI0A 3UWNA 1UGSB 2KYBA 5A0DA 2MI6A 2ALYB 1U06A 3CC7A 3KFUA 2DMOA 2CZ7B 3A74A 4TTVA 3CCVT 4L6V5 3SDZA 4LDUA 1SKUB 1WHLA 2HD0A 1OYXA 1PD1A 3H9NA 4AFQC 3MJXA 1T3SA 1O9SA 2IIMA 1ASYA 3CCRQ 4FYWB 3M9QA 1R8OB 2H8HA 2C0TA 4M78D 3NETA 4WF2A 2M1HA 1PSFA 1Z7NA 1Q86C 5ELOA 4M78A 1BBWA 1N8RC 1K8AC 4RTWA 1D1BA 2C0IA 1SHFA 4HVWA 2DVEA 2A3LA 1M30A 1VUBA 2FPFA 5KYYA 2L3QA 4OB3B 4LUEA 3G6EQ 3GPLA 1PG5B 3GNGA 4YTLA 3I5SA 3E9GA 3EH1A 3NELA 1M90R 1VQMA 2A08A 2LVMA 1NLOC 1X55A 4J9HA 2BTTA 4P72C 1VQ9A 5IT9E 3CCET 4YRKA 1FMWA 4F7UB 2M0YA 2WACA 4M7DA 2RB6A 4BI3A 3M57A 4BDYA 3A7UA 4A63B 3TEHB 2O4XA 2MK5A 1OX8A 3IG2A 2D8HA 1BI2A 3CCSQ 3JRZA 4F16A 4HCCA 4D8DA 4FT4A 1PWTA 2D8JA 2AZVA 5FRNA 4JJBA 2EYWA 5KYXB 4CH5A 4N0AA 4ZNXA 1K73R 2ZZFA 3OYEA 3G1JA 2DL5A 1Y57A 2PUOB 1PD0A 4M77E 1WHJA 1W1FA 2NUTA 5LJ3h 5LJ3f 2F1LA 1JJ2S 4LXCA 2QEXQ 1YITA 1U1SA 1G3WA 2CREA 2X4YA 4J5YA 3JCMX 3S3NA 5C51B 1P92A 4D8KA 2KAFA 1FX7A 3CCMA 4KQEA 1Q95G 2F5TX 3P8YA 3PFSA 5FU7C 1SHGA 2Q7EA 2QGGA 4XAXB 1K9MC 1VQLT 3X24B 5GAN7 1NZ9A 1YIJQ 1IZ6A 3ZBDA 2EQJA 3M0TA 3CD6A 2QA4Q 1X69A 1D1AA 2QASA 1X6OA 3CCRT 4RQEA 1H4SA 3MEAA 1MV0B 3CCJA 4EMKC 2DQ3A 5IXBA 2K4YA 2DD5A 2E70A 3VYGA 4ZIBA 2YSQA 1FWZA 3IKMB 3TVTA 2H3JA 4M7AE 1WFWA 1NPRA 2L3RA 2DZCA 2L0AA 4EX5A 1XNIA 2KVQG 2QEXA 2WSCE 1JB0E 2K9GA 3OBWA 3HXWA 5AT1B 5GAMf 4YRPA 1RAAB 3LWHA 3QDFA 4ZTJA 1D0ZA 2RHSA 2RJFA 2GF7A 5D6YA 3QKJA 5KH6A 3HFZA 3EFRA 1M1GA 2ZCFB 2V8KA 1G83A 4K88A 1OPLA 1M1FA 1X2KA 3G7ZA 3S3OA 4M75D 4LVKA 4TVYA 2RQUA 4M75B 2JT4A 1T0JA 1UFFA 1TUGB 1IHVA 1KQ1A 4P5NA 4M75A 1H4VB 2V1RA 1C1AA 4QQDA 4XTXA 2M51A 2R5AA 3LWIA 3THKA 4YCWA 1G5IA 3L2VA 3SB2A 4OB2B 5K1XA 4C8QA 4P71C 3G71A 3CCLA 2SEMA 2OAWA 1F1BB 3G4SQ 5KYWA 1OOTA 2EYXA 3CPWP 2KK4A 1GRIA 4E7ZA 1QVFP 5K1PA 1Z7MA 1W6XA 2NWMA 4M77G 1VIFA 3Q1JA 2JTEA 3OYGA 5KYXA 2DL8A 4L5GA 2MWPA 1LPLA 1KG1A 1Y71A 3RUXA 5LJ5d 2EAYA 1BI0A 3GP8A 1ZBXA 4JZ3A 5J39A 3JB9I 1NEBA 4HWRA 4DQ2A 3X26B 4RTUA 3VS4A 2LDMA 2EIFA 6AT1B 2CJBA 5CQXA 3OYNA 2QDLA 1WYDA 2J6KA 3BE3A 4H2SA 4LDVA 2X35A 4L87A 5GAN3 3M0PA 1WNLA 1XOVA 3HFVA 3OA6A 4YCUA 1BCOA 1VQ8A 3LLRA 2RA2A 3EGUA 1RUWA 1G3TA 3C95A 1I5LA 1X2HA 5A0LA 4FSSA 4PFOA 1E1TA 3CBPA 3M53A 2HL3A 3NEMA 2KYMA 2ZPEB 1MMAA 1VQKA 1K76A 1E7OA 4LDXA 3HFNA 5KYUB 2DERA 3IALA 4KUDK 2EW3A 1K73C 5FW9A 2XDBA 1VQ9Q 2X4WA 2RJEA 3M4PA 3G1ZA 4R0KA 4Q6GA 1C0MA 5LL6S 3CC7T 3KBGA 5HCKA 4PG3A 3GBQA 4ME7A 3PVLA 2ALYA 1AOJA 4HKEA 1K0SA 3PTAA 4J9FA 1X56A 2DU7A 2VC8A 2ZR3A 3RDVA 2YRVA 2EKOA 1C6VX 3ZFJA 2KT1A 2P0LA 2RNAA 4LVLA 1G5VA 1VOMA 2RK1A 4GBQA 2ZXFA 1UECA 3JCMQ 4PJOD 4YRTA 3QJ6A 2J3LA 3NENA 4JJDA 1N9SA 4RTXA 3PVQA 1AEYA 1VQ7T 2HBWA 2EBPA 1B8AA 1UEBA 4F14A 1YB3A 1G8XA 1RADB 4PHCA 1H8KA 4F7UA 2CGHA 2JMCA 4UP7A 3OYYA 2VB6A 3E2UA 1M27C 2BKDN 3CC2T 2ARUA 1AWJA 1YWPA 4BDZA 1CKBA 3LC0A 1YHQA 1UHCA 4RTZA 3CCRA 4IUUA 2E3IA 5EC7A 3V7SA 4QVDA 2K2VA 1YJ9Q 1YJWT 3PZCA 1UHFA 4ZTFA 2VASA 1YFTA 4JLIA 3CCVA 1NM7A 3QWYA 4HT8A 2RMOA 2LMJA 1FYFA 4XTVA 1D3BA 2AIRB 3TU4K 3NMZC 1IB8A 3FIFA 3PIPA 2DF6A 2LQWA 4E47A 3S6WA 2DEQA 2E5QA 1KHCA 2IPOB 1YI2T 3EFOA 2OTLT 1MHNA 4KH0B 3RF1A 2V8JA 4RTYA 2JJ9A 5IHNA 3OYHA 4WCIA 1SPKA 2XI9A 5C6SA 2BIVA 4YRJA 3RACA 2AK5A 5LJ5h 2XK0A 2EYQA 4ZGJB 3HRSA 1NYFA 5J26A 1BBZA 4AFUC 3RKYA 1J3TA 4BE2A 4LN2A 4WTOB 1UDLA 2DBKA 2I0NA 4NS5A 4C8QG 4HWPA 4CH6A 2CH4A 2LCLA 3QUIA 4KGZB 5CR2A 1RLQC
chains in the Genus database with same CATH topology
3OYKA 1ADJA 3LYIA 3HY1A 4VUBA 3JAME 3BY7A 3TREA 4X9CA 4YRLA 4XTYA 2RH2A 3OYDA 4C92F 3VQWA 2IG0A 3VUBA 3JCMc 2DJZA 4M75G 1EVLA 1VQZA 4C0DC 2PVOB 4UC4A 1NYRA 3P8TA 4UPAA 4YRIA 2OAUA 3LX7A 1D3BB 2YLBA 2B8AA 2E10A 1YJNT 2K57A 4OMFB 3JCMV 4C92D 4C8QE 2XKOC 3SFMA 3DB4A 2ZIOA 3CCUT 2HAXA 1B70B 4Y28E 4H2XB 4F7UF 2MMPA 4J6WA 2IY5B 2P5IA 4YRRA 2X4JA 1PSEA 4BE1A 2QHSA 4PL6A 2LQKA 2ZR2A 4PKCC 1G3SA 3QZ5B 2LRQA 3CCJT 1VQ5A 5CIUA 3A32A 3JB9H 3A5ZB 3L42A 5ELNA 1N9RA 4H2YA 2ZT5A 5GANd 4Q15A 4OLFA 3SD4A 4E51A 2RJCA 3OQ5A 1BKBA 3RL6A 4C0FA 2EFIA 2AHJB 3G6EA 1K9MU 3P8BB 1OZ2A 4A4HA 3ZEHA 4J7FA 3MF2A 5E3IA 1ZHIA 1TH7A 3GOXA 3N5BB 2JZ2A 4C5HA 3G6ET 1QVPA 4PLLA 1BI1A 3L4GA 2D6FA 2DPPB 3E9FA 1BI3A 1NJIC 4YPFA 3UGTA 3CEYA 5IN1A 2E65A 1WJRA 3L2UA 3PIOA 3CPWA 2RHQB 2P0KA 4M7DG 4Y91A 4H02A 4LDYA 3CMAA 1J5WA 5GMKm 1Q86U 3UGQA 4P74A 2ZPGB 4DOVA 4C92A 1BIAA 2L89A 2CKKA 2DXCA 3QTCA 1KHIA 5KE2A 5DLOA 4M7DB 2ZCEA 2DO3A 2OTJA 3X28B 3CCEA 3C12A 3QYHB 2DKGA 3FLGA 1LNXA 2ZZDA 5GANe 3A8MB 3RERA 3JCMW 2RHSB 5I2SA 5GAOn 3FB9A 3CC4A 2VV5A 1M90C 2QEXT 1SETA 2D0QB 2RO0A 3JSCA 3WQZA 3HPWA 3BJUA 4XTZA 2IVWA 3C4SA 3J7AF 1YBYA 2KMTA 4BUGA 3M59A 3A7RA 5A0GA 1QE0A 3EFSA 2CZ6B 3JCMh 1OI1A 4FIBA 2ZGWA 4E7HA 4A4FA 4D6WA 2XICA 3QJYA 1EIYA 4RG8A 3HRKA 4XU3A 2QI2A 2YLCA 3HRIA 1M1KU 4ELYC 4UP9A 2LT1A 3FC3A 3PMIA 4NOYA 5FROA 4PNOA 3CBOA 4M7AD 5KNNA 4IUVA 4EMKA 3TEEA 4K87A 3LSQA 3HP9A 2DTOA 1NPPA 5LJ5f 3OY9A 4XU0A 1B34B 5HKCA 2NLUA 3C94A 1S72T 4OP0A 4MDWA 1VQPA 3UDCA 1Q81C 3NTIA 3JCMe 4OGCA 5HY6A 3MQZA 1E22A 3QZ9B 2XTIA 3G4ST 5C0MA 5GMKh 2DZ9A 4HT9A 1UB4A 1WLEA 3CC4T 1X2GA 4ZN1A 4BB7A 3UFGA 4F7UG 4TQDA 3BDLA 2P0QA 1VQ9T 3HSBA 2I4NA 1G51A 4ELZC 3ERRA 4F7UE 1YFSA 3V7RA 1QVGS 4CH3A 1QP2A 3ASKA 3QDRB 4BI4A 4EMKB 2R5MA 2DIGA 3H8ZA 1KD1U 2XG8D 2DK3A 3HXVA 1EVKA 5GAN2 4P73A 1WJQA 2PU9B 1KC8C 5GAN4 3QG1A 5A2QE 4PJOB 1NJ1A 2R57A 1BIBA 1JJCB 1JJ2A 1NNHA 2RM4A 4M78E 5CKBA 2DXUA 4MZPA 4HWSA 2LC4A 3HHTB 3PNWC 1IL2A 2RHIA 3FDRA 5FLXE 1YJ9T 3UH0A 3JB9G 4RMFA 2EQKA 5HK3A 1S72A 4CH4A 5GAOl 2ZPFB 4PJOC 1LOJA 1NJ2A 1SESA 2ZNJA 4YRGA 3CCST 2XDDA 3QHSA 2GFAA 3OD1A 2XU8A 3X25B 4C5EA 4MMKA 1RIQA 4IUQA 3QIIA 2ZIMA 2Y4XA 4M77B 4A54A 1PYSB 2JN0A 2DQ0A 4A4GA 3BDUA 2VGMA 4DPGA 4KR2A 2CZ1B 3LGLA 3VKIA 1XTDA 4LVIA 1K73U 4OVAA 1HK9A 4LVJA 1FXXA 1OZ3A 4LNSA 2K5IA 1Y7XA 3M4YA 2E5AA 3OBYA 3HRTA 3CCSA 2QQ9A 1VQKT 1ATIA 4M78C 3MCAB 1YJNA 2VUBA 3O8VA 4QVCA 3RKWA 3F70A 2I2LA 2DTIA 3M5AA 3P8DA 4J8OA 3JB9J 2DAQA 5GANj 3L2WA 4CS4A 1KQSS 5DLQE 3CXCS 2DU5A 4XK8E 2ZPHB 3WVEB 1YIJA 3E1SA 2DIQA 2PMFA 4C0GA 1L0WA 1VQ8T 3RIRA 4ATOA 2ZZEA 1ASZA 4NCXA 3GF5A 3L2RA 4QW2A 2WSFE 2G4CA 3A8LB 1VQNT 4OB1B 4HWTA 5CCAA 3JB9F 3JCMg 1HC7A 2ZT7A 1Q82C 4BI8B 4M7DF 2BUDA 5GAMe 4H2TA 4E7JA 3V8LA 1EIYB 3RKXA 2GQVA 4A4EA 1W4SA 2DDZA 5D6WA 1USYA 4M7AA 3REXA 4CS3A 4C8QF 1NJ5A 3OB9A 3HFOA 1W66A 4FSXA 2ZPBB 1U1TA 3MP1A 3QO3A 2I4MA 1BYMA 4BY6C 4LVMA 3VQVA 4PLIA 4M78F 4M7AC 1YJWA 4XEMA 3V8KA 3I7FA 3A5ZA 2L8DA 4YYEA 4PJOA 1B76A 4JJNK 3R07A 1I8FA 2LNVA 2O01E 2EQMA 2R58A 4BD3A 4RG2A 4YRQA 4ZN3A 3QNEA 3QSUA 1QVGA 5CKDA 1M1KC 3A8OB 4XTUA 5C53B 3TUPA 3CMAT 3UT1A 3CMQA 3X20B 1QF6A 2QA4T 2GFUA 4TVRA 4GLKA 4TQFA 3NTHA 5FU6B 2AKWB 1M5Q1 5GAOm 3HRUA 4JRQA 1YITT 5GMKe 4J7IA 1KD1C 2AMCA 3I55A 2VYTA 2MAMA 4M77F 4YRNA 2RHYA 2RK2A 2KSSA 3URGA 2Q5IA 3TCJA 4P75A 1O75A 3CCQT 1VQ4A 3KUFA 3VV0A 2A7YA 5GAOq 4XU2A 4P3NA 3DLMA 4HWOA 1UGQB 2PVDB 3ME9A 5CKFA 4J83A 1EIFA 2P0PA 3OSSC 3PGGA 2E1HA 5CKEA 2K5LA 3JCMb 2VXEA 3HY0A 2RI5A 2EQUA 1AHJB 1I81A 3M56A 4O6JA 1M90U 2MF2A 3JB9D 3GIBA 4HCBA 4BWAA 3VBBA 3M4GA 1VQPT 1I4K1 2ZNIA 5CKHA 3VU3C 3M55A 2K5FA 5CK9A 1KOGA 2ODRD 4C0DB 4V2SA 3J80E 4BY6B 1B70A 2RI2A 5GAMh 3P8HA 4YRSA 2RI3A 1KQSA 1E24A 3I56A 4OF1A 2XIDA 4MZMA 4J15A 2LQ8A 2QQBA 4ZTUB 2XGTA 2QA4A 5KCHA 2FB7A 1VQMT 3M4QA 3UPUA 3FRNA 4C92G 2M9UA 2XDPA 5GMKj 3A8HB 5M9OA 1JBMA 2ZPIB 3P8VA 1X01A 3LGFA 2GCXA 3PT9A 2D9TA 2HNIA 4C92B 3MEWA 5GMKi 3AHUA 3RGLA 3PCOB 4BACA 4OB0B 4PJOF 1UGPB 3V8JA 3OSVA 2RHXA 3LSSA 2Q5HA 2FVUA 4R55A 3A7AA 3CPFA 2Q7GA 4IUPA 5GANf 5LJ5g 5GAMg 3VQYA 3L1AA 4FM4B 4PJOE 3PMTA 2HBPA 3FEOA 4C8QD 4C92E 1B7YB 5GAN6 4TVAA 2PMEA 2DD4A 5GAOr 1KMNA 4M77D 4H2WA 5AYFA 4J6YA 3S3MA 2A8EA 3DKMA 3G4SA 2AMCB 1LJOA 1VQOA 3OYJA 3META 5DM7R 1Q7YC 5LJ3j 4CS2A 4Z02A 3INZA 4IKFA 1B34A 2FYKA 1SERA 2AKWA 4E7LA 2I4OA 1WPYA 2KY9A 3MO8A 1UGRB 1JRIA 2FHDA 4JRPA 4YRCA 1W2BS 2C8MA 1KQ2A 1YFRA 1VIEA 4O5VA 3RESA 1M4ZA 4II1A 5LJ3e 2MWOA 2RJDA 3L2QA 3CCQA 4YREA 4C92C 1KMMA 3BFMA 1Q81U 2YHTA 4PJOG 4C8QC 5I2MA 2EJ9A 2FL7A 1WQ7A 4JLGA 1E1OA 3L4GB 3JCMf 1WU7A 2CJ9A 4YRMA 3HFZB 3OW2S 4YROA 4M75E 4E7IA 1Y96A 2PQWA 3H6ZA 3ER0A 2E64A 3HL8A 1X54A 5J3BA 4LDWA 1LYLA 3VUZA 4MMLA 5L8RE 3BW1A 4M75F 1Q82U 4KULA 1QVFS 1JJCA 3WVDB 4C5IA 4P3PA 2OTJT 2HQXA 1N27A 4P3OA 3GNFB 4FU6A 4EDUA 2CS7A 4N0AC 4P73C 4JUVA 3OYMA 3T9NA 3QBYA 3IKLA 5CO7A 2QQSA 3LW5E 1X75C 5LJ3g 2CYZB 3MF1A 5KCOA 2I4LA 2PUKB 3W3SA 2JTMA 1YHQT 3E19A 3GLXA 3WXMB 2PVGB 3VQXA 5D6XA 3A31A 4QQGA 1H4TA 3OMGA 3J81E 4M77A 4M75C 2J3MA 3QO7A 2KQWA 2L5QA 3OYIA 2EWNA 3QXEB 4NL3A 3OS1A 1YGBA 1DJ7B 2DTHA 3OYCA 3NTKA 3L2ZA 1ZQ1A 4ZGDB 1WGSA 4TVAB 3HXZA 3DB3A 1B7YA 4QVZA 4C5GA 3HXYA 1VQ5T 4JRIA 3I56T 3QO8A 1YI2A 4P75C 4KR3A 4L59A 1G5HA 1W2BA 4G85A 5CAIA 4RDXA 4KUIA 4M7DE 4IURA 4KBMB 1GXIE 5CVIA 1VQ6T 4JS4A 2K3XA 3R6OA 4MZTA 4M78B 1WQWA 2IY5A 4TWAA 3CC2A 5GAOp 4X9DA 1NYQA 1VQOT 2ZTGA 4HA8A 2EJFA 3MEYA 4HVCA 1NJ6A 3RMSA 5GAMj 3OW2A 3OYAA 5IAYA 4M7AG 4QQ6A 4N4IA 4CRIA 2QQAA 2LTOA 4M77C 3MEUA 2QHUA 3HTZA 4YDQA 3TEGA 4WI1A 3HXUA 2Q7HA 1QP3A 3EAEA 2JUFA 2ZZGA 4P72A 1WJSA 4EO4A 4M7AB 4RCCA 1SSFA 2QHVA 4Q5WA 3CD6T 3JCMd 3CPWS 1Y07A 5GAMd 2LT4A 1KC8U 1N6AA 1EQRA 2NS6A 4B9XA 4M7DC 3REUA 3MHXA 4EPCA 2E6ZA 1MGQA 2QQRA 5LJ3d 2F69A 4BW9A 4LD6A 3JCMP 1YIJT 2ZT6A 4H2UA 2K3YA 5GMKl 2V8IA 1VQ7A 4XQ3A 4WJ4A 1BBUA 1HTTA 12ASA 2ARTA 5GAN5 4RQFA 2WSEE 3M54A 4MDXA 4C8QB 1H4QA 5FRMA 3CCMT 4P74C 3G71T 3CCLT 4N4HA 2HQEA 1VQNA 4JDSA 2XHCA 4H2VA 2QTXA 2E3CA 4X5OA 4GY5A 1RL2A 3CMEA 4ZTZB 2QDYB 2ARSA 4AH6A 4HT4A 2QHTA 11ASA 3QPHA 3OYLA 1H3ZA 4JS5A 3MP6A 1NE8A 3VYHB 4YCVA 5CQYA 4FT2A 3CMET 4M7DD 2E12A 3QO5A 4A4KA 1QVFA 1HXDA 3VJPA 1YJ9A 4G84A 1IREB 4OGEA 1VQ6A 4J6XA 4JRKA 3A8GB 5I21A 4EMGA 1YCYA 2CJAA 3E9HA 2DXTA 5FU6C 4O2DA 4A53A 3CBMA 2Y90A 2RHQA 5LJ5j 1M8VA 4UP8A 1Y96B 2JTFA 3HXXA 5HGQA 4WJ3M 1PYSA 1N9WA 3JCMJ 5FU7B 3SWNA 5GANh 4P71A 1V29B 4C0ZA 2RHZA 2JOYA 4NL2A 5GAN8 3SWNB 2P4TA 4BE0A 3DLLA 4XU1A 3V7CA 4FL6A 5DY9A 5C52B 1NJ8A 3OS2A 4YRFA 2F5KA 2G3RA 4RKUE 3MEVA 5F5WA 4EMHA 2C06A 4E7KA 4IUTA 4DA4A 4DOWA 1SRYA 4N4GA 5KE3A 4CI0C 2JNGA 4XTWA 2RHUA 3M58A 3NFCA 2RD1A 5LJ5e 1QW1A 2X4XA 2E41A 4TVWA 3FJPA 1GGMA 1M9SA 4M78G 4RMOA 3DSQA 4H2XA 3HKSA 2M0OA 2VXFA 3I55T 2EL9A 1G3YA 2E6NA 3MP8A 3OYBA 2QXFA 3CXCA 1H641 3SWNC 2ODRC 2XD0A 2KDSA 1EOVA 3RMQA 2ZT8A 2OTLA 5GANg 1ADYA 2JVVA 3OMCA 4LD9K 2EJGA 3QYGB 1NJIU 5HK0A 3E9IA 1EFWA 4M7AF 5EG2A 3CCUA 4KT0E 4R56A 4ZGEB 2ZINA 3PCOA 3LH0A 4B9WA 2DXBA 3OS0A 2VGNA 2CZ0B 3ICAA 2O4XB 3TEHA 1VQ4T 1XQHA 4RCBA 2M16A 2LCCA 1U8RA 1USYC 3OYFA 2C7IA 2LX9A 2Y4YA 1N8RU 1K8AU 1Q7YU 1C0AA 4HCZA 1VQLA 4X34A 4K86A 3KXTA 3OS5A 4YP0A 4XEOA 3A5YA 1RI0A 3UWNA 1UGSB 5A0DA 2MI6A 2ALYB 3CC7A 3KFUA 2CZ7B 3A74A 4TTVA 3CCVT 4L6V5 3SDZA 4LDUA 2HD0A 1OYXA 1O9SA 1ASYA 3M9QA 1R8OB 4M78D 3NETA 4WF2A 2M1HA 1PSFA 1Z7NA 1Q86C 5ELOA 4M78A 1BBWA 1N8RC 1K8AC 2DVEA 2A3LA 1VUBA 3GPLA 4OB3B 3GNGA 4YTLA 3E9GA 3NELA 1VQMA 2LVMA 1X55A 4P72C 1VQ9A 5IT9E 3CCET 4YRKA 4F7UB 2WACA 4M7DA 2RB6A 4BI3A 3M57A 4BDYA 3A7UA 3TEHB 2O4XA 3IG2A 1BI2A 3JRZA 4HCCA 4FT4A 5FRNA 4CH5A 4N0AA 2ZZFA 3OYEA 2PUOB 4M77E 1JJ2S 5LJ3f 5LJ3h 1YITA 1U1SA 1G3WA 2X4YA 4J5YA 3JCMX 3S3NA 5C51B 1P92A 2KAFA 1FX7A 3CCMA 4KQEA 2F5TX 3P8YA 3PFSA 5FU7C 2Q7EA 4XAXB 1K9MC 1VQLT 3X24B 5GAN7 1NZ9A 1IZ6A 3ZBDA 2EQJA 5CR2A 3CD6A 1X6OA 3CCRT 4RQEA 1H4SA 3MEAA 3CCJA 4EMKC 2DQ3A 2K4YA 2DD5A 2E70A 3VYGA 4ZIBA 1FWZA 3IKMB 4M7AE 2H3JA 1NPRA 2L3RA 2DZCA 4EX5A 1XNIA 2KVQG 2QEXA 2WSCE 1JB0E 3OBWA 3HXWA 5GAMf 4YRPA 3LWHA 4ZTJA 2RHSA 3HFZA 2RJFA 2GF7A 3QKJA 5D6YA 5KH6A 3EFRA 1M1GA 2ZCFB 2V8KA 4K88A 1M1FA 3G7ZA 3S3OA 4M75D 4LVKA 4TVYA 4M75B 1KQ1A 4P5NA 4M75A 1H4VB 4QQDA 4XTXA 2R5AA 3LWIA 4YCWA 1G5IA 3L2VA 3SB2A 4OB2B 5K1XA 4C8QA 4P71C 3G71A 3CCLA 2KK4A 5K1PA 1Z7MA 4M77G 1VIFA 3Q1JA 3OYGA 4L5GA 2MWPA 1KG1A 1Y71A 3RUXA 5LJ5d 2EAYA 1BI0A 3GP8A 1ZBXA 5J39A 3JB9I 4HWRA 4DQ2A 3X26B 2LDMA 2EIFA 2CJBA 5CQXA 3OYNA 1WYDA 4H2SA 4LDVA 4L87A 2X35A 5GAN3 1WNLA 1XOVA 3HFVA 3OA6A 4YCUA 1VQ8A 3LLRA 2RA2A 1G3TA 3C95A 1I5LA 1X2HA 5A0LA 1E1TA 3CBPA 3M53A 3NEMA 2ZPEB 1VQKA 4LDXA 3HFNA 3IALA 4KUDK 1K73C 2XDBA 2X4WA 2RJEA 4Q6GA 3M4PA 3G1ZA 5LL6S 3CC7T 3KBGA 4PG3A 4ME7A 2ALYA 4HKEA 2DU7A 3PTAA 1X56A 2VC8A 2ZR3A 2YRVA 2EKOA 3ZFJA 2P0LA 4LVLA 1G5VA 2RK1A 2ZXFA 3JCMQ 4PJOD 4YRTA 3QJ6A 2J3LA 3NENA 1N9SA 1VQ7T 1B8AA 1UEBA 1YB3A 4PHCA 4F7UA 2CGHA 4UP7A 3OYYA 2BKDN 3CC2T 2ARUA 4BDZA 3LC0A 1YHQA 3CCRA 4IUUA 3V7SA 4QVDA 2K2VA 1YJWT 3PZCA 4ZTFA 1YFTA 4JLIA 3CCVA 4HT8A 1FYFA 4XTVA 1D3BA 3TU4K 3FIFA 3PIPA 4E47A 3S6WA 2DEQA 2E5QA 1KHCA 1YI2T 2OTLT 1MHNA 3RF1A 2V8JA 3OYHA 5C6SA 2XI9A 2BIVA 4YRJA 3RACA 5LJ5h 2XK0A 2EYQA 4ZGJB 3HRSA 5J26A 3RKYA 4BE2A 4NS5A 4C8QG 4HWPA 4CH6A 2LCLA 3QUIA 2CIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFZ B;  1ADJ A;  4YRO A;  3HY1 A;  3ICA A;  4M75 E;  3TEH A;  3RKW A;  3BY7 A;  4X9C A;  1Y96 A;  2DTI A;  2I2L A;  4YRL A;  4XTY A;  3JB9 J;  4RCB A;  1USY C;  2C7I A;  2E64 A;  5GAN j;  1X54 A;  4C92 F;  1LYL A;  3VQW A;  4CS4 A;  4MML A;  3BW1 A;  1C0A A;  4M75 F;  3JCM c;  2DU5 A;  2DJZ A;  1JJC A;  4P3P A;  4K86 A;  4M75 G;  1EVL A;  1VQZ A;  4YP0 A;  4XEO A;  3A5Y A;  1NYR A;  4P3O A;  3P8T A;  2PMF A;  4UPA A;  4YRI A;  1D3B B;  1L0W A;  4N0A C;  2YLB A;  4P73 C;  4JUV A;  2ALY B;  3RIR A;  3KFU A;  2E10 A;  2K57 A;  2ZZE A;  1ASZ A;  4NCX A;  3JCM V;  4C92 D;  4C8Q E;  3A74 A;  3IKL A;  4TTV A;  2ZIO A;  5LJ3 g;  3MF1 A;  1ASY A;  1B70 B;  4H2X B;  2I4L A;  4F7U F;  4M78 D;  3W3S A;  3NET A;  4J6W A;  4WF2 A;  2P5I A;  4YRR A;  2IY5 B;  2G4C A;  2QHS A;  1Z7N A;  4HWT A;  2ZR2 A;  5ELO A;  4M78 A;  3VQX A;  3JB9 F;  1BBW A;  3JCM g;  1HC7 A;  3A31 A;  2ZT7 A;  1H4T A;  3A32 A;  4M77 A;  4M75 C;  2J3M A;  3QO7 A;  4M7D F;  3JB9 H;  2DVE A;  5GAM e;  5ELN A;  4H2T A;  1N9R A;  2EWN A;  4H2Y A;  3V8L A;  1EIY B;  2ZT5 A;  3RKX A;  4NL3 A;  1YGB A;  5GAN d;  2DTH A;  2DDZ A;  4Q15 A;  4OLF A;  3NEL A;  3L2Z A;  1USY A;  4M7A A;  3REX A;  4E51 A;  4CS3 A;  4TVA B;  3RL6 A;  3HXZ A;  4C8Q F;  1B7Y A;  1X55 A;  1NJ5 A;  3HXY A;  3HFO A;  4P72 C;  1W66 A;  4YRK A;  4JRI A;  4F7U B;  1U1T A;  4M7D A;  2RB6 A;  3QO8 A;  3A7U A;  3MF2 A;  5E3I A;  3QO3 A;  1TH7 A;  2I4M A;  3TEH B;  4P75 C;  3IG2 A;  3VQV A;  4KR3 A;  4M78 F;  4M7A C;  1G5H A;  4XEM A;  4CH5 A;  4N0A A;  4G85 A;  5CAI A;  3V8K A;  3I7F A;  3L4G A;  4RDX A;  4M7D E;  3A5Z A;  4YYE A;  2ZZF A;  4PJO A;  1B76 A;  3R07 A;  1I8F A;  4M77 E;  4YPF A;  5LJ3 f;  5LJ3 h;  3UGT A;  4M78 B;  1WQW A;  4YRQ A;  1U1S A;  2E65 A;  4J5Y A;  3JCM X;  5C51 B;  4TWA A;  2IY5 A;  5GAO p;  3QNE A;  4X9D A;  1NYQ A;  2RHQ B;  4KQE A;  3QSU A;  3P8Y A;  2Q7E A;  4M7D G;  4Y91 A;  4H02 A;  2ZTG A;  4HA8 A;  2EJF A;  3MEY A;  5GAN 7;  4XTU A;  4HVC A;  5C53 B;  3TUP A;  1NJ6 A;  1J5W A;  5GAM j;  3CMQ A;  5GMK m;  3UGQ A;  4P74 A;  1QF6 A;  4M7A G;  4C92 A;  4RQE A;  1BIA A;  3QTC A;  1H4S A;  4TQF A;  4M77 C;  4EMK C;  4M7D B;  2DQ3 A;  2AKW B;  2QHU A;  2ZCE A;  3HTZ A;  4YDQ A;  3TEG A;  1M5Q 1;  5GAO m;  2DKG A;  4WI1 A;  3HXU A;  2Q7H A;  1LNX A;  4ZIB A;  5GMK e;  5GAN e;  3IKM B;  4M7A E;  2ZZG A;  4P72 A;  3RER A;  4EO4 A;  3JCM W;  2DZC A;  4M7A B;  2RHS B;  5GAO n;  4EX5 A;  3FB9 A;  4RCC A;  2QHV A;  2AMC A;  3JCM d;  5GAM d;  1SET A;  3WQZ A;  4M77 F;  4YRN A;  1EQR A;  2Q5I A;  3HXW A;  4M7D C;  4P75 A;  5GAM f;  4YRP A;  3REU A;  3BJU A;  4XTZ A;  5GAO q;  2RHS A;  4XU2 A;  3HFZ A;  1MGQ A;  3EFR A;  5LJ3 d;  4P3N A;  4HWO A;  4BW9 A;  3JCM P;  2ZT6 A;  4K88 A;  4H2U A;  5GMK l;  3A7R A;  4M75 D;  1QE0 A;  3EFS A;  3PGG A;  4TVY A;  3JCM h;  2E1H A;  2ZGW A;  3JCM b;  2VXE A;  4M75 B;  4XQ3 A;  4WJ4 A;  3HY0 A;  1KQ1 A;  4M75 A;  1BBU A;  1H4V B;  1HTT A;  1I81 A;  12AS A;  4XTX A;  1EIY A;  2ART A;  5GAN 5;  4RQF A;  3HRK A;  4YCW A;  4C8Q B;  4XU3 A;  1H4Q A;  1G5I A;  2YLC A;  3SB2 A;  3HRI A;  5K1X A;  3JB9 D;  3GIB A;  4UP9 A;  4C8Q A;  4P74 C;  4P71 C;  4BWA A;  3VBB A;  3M4G A;  4H2V A;  1I4K 1;  2QTX A;  2E3C A;  4X5O A;  4NOY A;  2ZNI A;  4PNO A;  4ZTZ B;  5K1P A;  3VU3 C;  2ARS A;  4AH6 A;  1Z7M A;  1KOG A;  4M7A D;  2ODR D;  5KNN A;  4V2S A;  4EMK A;  1B70 A;  2QHT A;  11AS A;  4K87 A;  4M77 G;  3LSQ A;  2DTO A;  5GAM h;  4YCV A;  5LJ5 f;  4XU0 A;  1B34 B;  4YRS A;  4M7D D;  4OP0 A;  1E24 A;  3QO5 A;  3RUX A;  5LJ5 d;  2EAY A;  1HXD A;  3JCM e;  4J15 A;  4G84 A;  3JB9 I;  4ZTU B;  4HWR A;  1E22 A;  2XGT A;  4J6X A;  4DQ2 A;  2XTI A;  2FB7 A;  4JRK A;  2CJB A;  5I21 A;  4EMG A;  5GMK h;  1YCY A;  2DZ9 A;  3M4Q A;  4C92 G;  2CJA A;  3E9H A;  2DXT A;  5GMK j;  1WYD A;  4O2D A;  4HT9 A;  1WLE A;  4H2S A;  1JBM A;  4L87 A;  5GAN 3;  4A53 A;  1X2G A;  3P8V A;  1WNL A;  2Y90 A;  2RHQ A;  3HFV A;  1X01 A;  5LJ5 j;  1M8V A;  4YCU A;  3UFG A;  4UP8 A;  4F7U G;  4TQD A;  1Y96 B;  2RA2 A;  2HNI A;  3HSB A;  4C92 B;  2I4N A;  3HXX A;  5HGQ A;  1G51 A;  4WJ3 M;  1PYS A;  1I5L A;  1X2H A;  5GMK i;  3AHU A;  3JCM J;  1N9W A;  1E1T A;  3RGL A;  3SWN A;  5GAN h;  3NEM A;  4P71 A;  3PCO B;  3ERR A;  4F7U E;  1YFS A;  3V7R A;  4CH3 A;  4PJO F;  3HFN A;  4NL2 A;  3V8J A;  3IAL A;  3LSS A;  5GAN 8;  3SWN B;  2Q5H A;  4EMK B;  3A7A A;  3M4P A;  3G1Z A;  4Q6G A;  2Q7G A;  3HXV A;  1EVK A;  5GAN f;  5GAN 2;  4XU1 A;  4P73 A;  5LJ5 g;  3V7C A;  4PG3 A;  2ALY A;  5GAN 4;  5GAM g;  2DU7 A;  1X56 A;  3VQY A;  3L1A A;  5DY9 A;  5C52 B;  2VC8 A;  4PJO E;  2ZR3 A;  1NJ8 A;  4C8Q D;  4C92 E;  2P0L A;  1B7Y B;  4PJO B;  5GAN 6;  4TVA A;  2PME A;  1NJ1 A;  4YRF A;  2ZXF A;  3JCM Q;  5GAO r;  4PJO D;  4YRT A;  2J3L A;  1BIB A;  1JJC B;  3NEN A;  1NNH A;  2RM4 A;  1KMN A;  1N9S A;  5F5W A;  4M78 E;  4EMH A;  4M77 D;  4H2W A;  1B8A A;  2DXU A;  4J6Y A;  1YB3 A;  4PHC A;  4HWS A;  2AMC B;  1LJO A;  1SRY A;  4F7U A;  1IL2 A;  2CGH A;  4UP7 A;  3UH0 A;  3JB9 G;  4XTW A;  4RMF A;  5LJ3 j;  2ARU A;  2RD1 A;  4CS2 A;  5LJ5 e;  4CH4 A;  3INZ A;  3LC0 A;  1B34 A;  2FYK A;  5GAO l;  4PJO C;  2E41 A;  4TVW A;  1LOJ A;  3FJP A;  1NJ2 A;  1GGM A;  1SES A;  4M78 G;  2AKW A;  2ZNJ A;  3DSQ A;  4H2X A;  1SER A;  4YRG A;  3V7S A;  3QHS A;  3OD1 A;  4QVD A;  4MMK A;  2VXF A;  2I4O A;  1WPY A;  1RIQ A;  3PZC A;  2EL9 A;  1YFT A;  4JLI A;  2ZIM A;  1JRI A;  4M77 B;  4HT8 A;  4YRC A;  4A54 A;  1PYS B;  1FYF A;  2JN0 A;  2DQ0 A;  4XTV A;  1D3B A;  1H64 1;  3SWN C;  2ODR C;  3FIF A;  3BDU A;  2C8M A;  1KQ2 A;  2DEQ A;  1YFR A;  1EOV A;  3RES A;  4DPG A;  2ZT8 A;  4KR2 A;  5GAN g;  1ADY A;  3RF1 A;  5LJ3 e;  2EJG A;  3E9I A;  4YRJ A;  3RAC A;  4YRE A;  5LJ5 h;  1HK9 A;  4C92 C;  4LNS A;  1EFW A;  4M7A F;  1KMM A;  3BFM A;  2E5A A;  3RKY A;  2YHT A;  4PJO G;  4C8Q C;  2EJ9 A;  1ATI A;  4M78 C;  1WQ7 A;  1E1O A;  3L4G B;  4C8Q G;  2ZIN A;  3PCO A;  3JCM f;  4HWP A;  4CH6 A;  3QUI A;  1WU7 A;  2CJ9 A;  4YRM A;  4QVC A;  2CIM A; 
#chains in the Genus database with same CATH topology
 2FPD A;  3CC4 Q;  3OYK A;  1ADJ A;  3ZL7 C;  3LYI A;  3HY1 A;  1YCS B;  4VUB A;  3JAM E;  1D09 B;  2DL4 A;  3BY7 A;  3TRE A;  4X9C A;  4YRL A;  4XTY A;  2RH2 A;  2PTK A;  3VS6 A;  2J05 A;  3OYD A;  1NYG A;  4C92 F;  3VQW A;  2HCK A;  2IG0 A;  3VUB A;  1ZA1 B;  4OMQ A;  3JCM c;  2DJZ A;  1SG5 A;  4M75 G;  3CMA Q;  1EVL A;  1VQZ A;  4C0D C;  4JZ4 A;  2PVO B;  1K0X A;  4UC4 A;  1NYR A;  7AT1 B;  3P8T A;  1K4U S;  4UPA A;  4YRI A;  2OAU A;  3LX7 A;  1D3B B;  1WXB A;  2YLB A;  4Z89 A;  5IXF A;  2B8A A;  2JW4 A;  4CC7 A;  2E10 A;  1YJN T;  2K57 A;  1I5O B;  4OMF B;  1NEG A;  3JCM V;  2ESW A;  4C92 D;  4C8Q E;  2QGF B;  2XKO C;  3SFM A;  3DB4 A;  2ZIO A;  3CCU T;  1TU0 B;  2HAX A;  1MND A;  1B70 B;  4Y28 E;  4H2X B;  3REA B;  4F7U F;  5IHI A;  1FMK A;  2MMP A;  2EKH A;  4J6W A;  2IY5 B;  2P5I A;  4YRR A;  2X4J A;  1PSE A;  4BE1 A;  2QHS A;  4PL6 A;  2LQK A;  5IH2 A;  3CME Q;  2DIL A;  2ZR2 A;  4PKC C;  1G3S A;  3QZ5 B;  2LRQ A;  3CCJ T;  1VQ5 A;  5CIU A;  3A32 A;  2EGA A;  1ABQ A;  1TG0 A;  1QMC A;  4ESR A;  2RPN A;  3JB9 H;  2OJ2 A;  3A5Z B;  2PNI A;  3L42 A;  3TSZ A;  5D7U A;  5ELN A;  1MUZ A;  1N9R A;  1QWE A;  4H2Y A;  2ZT5 A;  1IGU A;  2J7I A;  5GAN d;  1VQP Q;  4Q15 A;  1OPK A;  4OLF A;  2DL7 A;  3SD4 A;  1YWO A;  2KXC A;  4E51 A;  2RJC A;  3OQ5 A;  1BKB A;  1ZSZ A;  3RL6 A;  2GGR A;  2EFI A;  2AHJ B;  4C0F A;  2P4R A;  4LNP A;  3G6E A;  1K9M U;  1TWB A;  3P8B B;  1OZ2 A;  4A4H A;  1JXO A;  3ZEH A;  3M0U A;  4J7F A;  3MF2 A;  5E3I A;  1TH7 A;  1ZHI A;  2A28 A;  1RAG B;  1RAB B;  3GOX A;  3N5B B;  2J06 A;  2JZ2 A;  2G6F X;  4C5H A;  3G6E T;  1JEG A;  1QVP A;  2RN8 A;  4PFP A;  4PLL A;  1BI1 A;  3RR6 A;  1SRL A;  1VQN Q;  3L4G A;  2D6F A;  1T0H A;  3G71 Q;  3CCL Q;  2DPP B;  3E9F A;  1BI3 A;  1NJI C;  2HMA A;  1PNJ A;  4YPF A;  3EGD B;  3UGT A;  1M2V B;  1EX4 A;  2OI3 A;  4FYY B;  1QVG P;  3CEY A;  1G2B A;  2V26 A;  5IN1 A;  2E65 A;  2O88 A;  1WJR A;  1M8M A;  5KYW B;  3L2U A;  4FYX B;  3PIO A;  3CPW A;  3I35 A;  2RHQ B;  3A1P A;  2P0K A;  3EG3 A;  1X43 A;  4M7D G;  4Y91 A;  4H02 A;  4LDY A;  3CMA A;  1J5W A;  2VWF A;  1ZLM A;  4AFS C;  5GMK m;  1Q86 U;  3UGQ A;  4P74 A;  1WLP B;  2ZPG B;  4DOV A;  4C92 A;  2AKK A;  1BIA A;  2L89 A;  2CKK A;  2DXC A;  3QTC A;  1VQ7 Q;  1KHI A;  5KE2 A;  5DLO A;  4M7D B;  3CQT A;  2YUO A;  2ZCE A;  2DO3 A;  2OTJ A;  4M4Z A;  3X28 B;  2B86 A;  1Q82 R;  3CCE A;  1OV3 A;  3C12 A;  3QYH B;  1PCX A;  2DKG A;  2GBQ A;  3FLG A;  1LNX A;  2ZZD A;  5GAN e;  3A8M B;  2CH4 W;  1V1C A;  3RER A;  2ATC B;  1A0N B;  3JCM W;  2RHS B;  1BB9 A;  5I2S A;  5GAO n;  3FB9 A;  2RQV A;  3CC4 A;  4DBF A;  2VV5 A;  1M90 C;  2QEX T;  2KT8 A;  2HDA A;  1SET A;  2D0Q B;  2FZK B;  2RO0 A;  3JSC A;  3WQZ A;  3HPW A;  1SRM A;  1AWW A;  2D0N A;  3BJU A;  4XTZ A;  3EGX B;  2IVW A;  3MPU B;  2O9S A;  2MIO A;  3C4S A;  3J7A F;  1YBY A;  2KMT A;  4BUG A;  1LVK A;  3M59 A;  3A7R A;  5A0G A;  2LP5 A;  1QE0 A;  3EFS A;  2CZ6 B;  2DET A;  3JCM h;  1OI1 A;  4FIB A;  2ZGW A;  2YDL A;  2K6D A;  1M3A A;  4E7H A;  1GCQ C;  4A4F A;  4D6W A;  2XIC A;  3QJY A;  1EIY A;  3VS5 A;  4RG8 A;  4FW2 A;  2NUP B;  3HRK A;  4XU3 A;  2QI2 A;  2YLC A;  3HRI A;  2YUP A;  1M1K U;  4ELY C;  3CXC P;  2EVR A;  4UP9 A;  4HVV A;  2LT1 A;  2FG0 A;  3CCU Q;  1QCO A;  3FC3 A;  3I55 Q;  1HJD A;  3PMI A;  2LJ1 A;  2EYY A;  1YJN Q;  4NOY A;  5FRO A;  4PNO A;  4IIM A;  1VQO Q;  3CBO A;  1QCF A;  4M7A D;  5KNN A;  4IUV A;  4EMK A;  3TEE A;  4K87 A;  3LSQ A;  2HQH A;  3HP9 A;  2DTO A;  1NPP A;  5LJ5 f;  3OY9 A;  4XU0 A;  1B34 B;  1RAI B;  5HKC A;  2COZ A;  2NLU A;  3C94 A;  1S72 T;  4OP0 A;  4MDW A;  1VQP A;  3UDC A;  3IQL A;  1Q81 C;  3NTI A;  3JCM e;  2KRO A;  4OGC A;  5HY6 A;  4KRT A;  3MQZ A;  1E22 A;  3QZ9 B;  2XTI A;  3G4S T;  5C0M A;  5GMK h;  2JM9 A;  2DZ9 A;  2KRS A;  2KGT A;  3VS1 A;  9ATC B;  3VS7 A;  4HT9 A;  1UB4 A;  1WLE A;  3CC4 T;  1X2G A;  4ZN1 A;  4BB7 A;  2K2M A;  3UFG A;  4F7U G;  4TQD A;  1E6G A;  3BDL A;  2P0Q A;  4PJL A;  1VQ9 T;  3HSB A;  1UGV A;  2I4N A;  1G51 A;  4ELZ C;  8ATC B;  1IGQ A;  3ERR A;  4F7U E;  1YFS A;  3V7R A;  1QVG S;  4J9C A;  4CH3 A;  1QP2 A;  3ASK A;  1VYT A;  3QDR B;  4BI4 A;  2DVJ A;  3I56 Q;  4EMK B;  3A98 A;  2R5M A;  2DIG A;  3H8Z A;  1KD1 U;  2XG8 D;  2DK3 A;  3HXV A;  1EVK A;  5GAN 2;  4P73 A;  1WJQ A;  1M2O A;  2DE0 X;  2PU9 B;  1KC8 C;  5GAN 4;  2DYI A;  3QG1 A;  1KIK A;  5A2Q E;  1PC0 A;  3AT1 B;  2KXD A;  2F2X A;  4PJO B;  2DRK A;  2O31 A;  1NJ1 A;  1PHT A;  2CSQ A;  2R57 A;  1ZBJ A;  2YRC A;  1BIB A;  1JJC B;  1JJ2 A;  1NNH A;  2RM4 A;  4M78 E;  5CKB A;  2DXU A;  4MZP A;  4F04 B;  2HSE B;  4HWS A;  2LC4 A;  3HHT B;  3PNW C;  1IL2 A;  2RHI A;  3FDR A;  5FLX E;  1YJ9 T;  3UH0 A;  3JB9 G;  4RMF A;  1D0Y A;  2EQK A;  5HK3 A;  1IRX A;  1QQJ A;  1S72 A;  4CH4 A;  1YP5 A;  5GAO l;  2ZPF B;  4PJO C;  1LOJ A;  1NJ2 A;  1SES A;  2ZNJ A;  2YXY A;  3VRZ A;  4YRG A;  3CCS T;  2XDD A;  4E6R A;  3QHS A;  2GFA A;  3OD1 A;  2XU8 A;  3X25 B;  4C5E A;  4MMK A;  1RIQ A;  4IUQ A;  3QII A;  2ZIM A;  2Y4X A;  4M77 B;  2RQR A;  2KBT A;  4A54 A;  2FO0 A;  1PYS B;  2JN0 A;  2DQ0 A;  4A4G A;  3BDU A;  2CDT A;  2VGM A;  4DPG A;  1JQQ A;  4KR2 A;  2CZ1 B;  3LGL A;  4J9I A;  3VKI A;  2GTJ A;  2YUN A;  1XTD A;  4LVI A;  1K73 U;  4OVA A;  1HK9 A;  4LVJ A;  1FXX A;  1OZ3 A;  4LNS A;  1GFC A;  2K5I A;  1Y7X A;  3M4Y A;  4DBR A;  2E5A A;  1GBQ A;  3OBY A;  3HRT A;  3CCS A;  2QQ9 A;  3OW2 P;  1VQK T;  1ATI A;  4M78 C;  3MCA B;  1YJN A;  1ACM B;  1I0C A;  2VUB A;  4J9G A;  3O8V A;  4QVC A;  1NG2 A;  1WXU A;  3RKW A;  3F70 A;  4EIK A;  2I2L A;  2DTI A;  3M5A A;  3P8D A;  4J8O A;  3EGD A;  3JB9 J;  3FJ5 A;  4Z8A A;  1UUE A;  2W10 A;  2K7A A;  2DAQ A;  5GAN j;  1AWO A;  4PJN A;  3L2W A;  4CS4 A;  1KQS S;  4K11 A;  5DLQ E;  3CXC S;  2DU5 A;  4XK8 E;  2ZPH B;  2RQT A;  1FYN A;  3WVE B;  1YIJ A;  1LCK A;  3E1S A;  1D1C A;  1MV3 A;  1UE9 A;  4CC4 B;  4LE9 A;  2HKQ B;  2DIQ A;  1KQS P;  2PMF A;  4C0G A;  1L0W A;  1VQ8 T;  2PZ1 A;  2DJQ A;  2Z0W A;  3RIR A;  4ATO A;  2ZZE A;  2AZS A;  1ZSZ B;  1ASZ A;  2FZC B;  4NCX A;  1TSF A;  2VVK A;  4E7S A;  3GF5 A;  3L2R A;  1SEM A;  1XJW B;  4QW2 A;  1WIE A;  2WSF E;  2G4C A;  3A8L B;  1VQN T;  4OB1 B;  4HWT A;  5CCA A;  1VQ6 Q;  1WHM A;  3JB9 F;  3JCM g;  1HC7 A;  1KSW A;  2ROT A;  2ZT7 A;  5GJW B;  1Q82 C;  4BI8 B;  4M7D F;  2XMF A;  2ED0 A;  2BUD A;  5GAM e;  4H2T A;  4E7J A;  3V8L A;  1EIY B;  2BE7 D;  3RKX A;  2GQV A;  4A4E A;  4AT1 B;  1W4S A;  4DBQ A;  2HZY A;  2DDZ A;  5D6W A;  1USY A;  4M7A A;  3REX A;  4CS3 A;  1Y0M A;  3NPF A;  2X9H A;  4C8Q F;  1NJ5 A;  1MMD A;  3OB9 A;  3HFO A;  1W66 A;  4FSX A;  1JU5 C;  2ROL A;  2ZPB B;  1U1T A;  3MP1 A;  1EZZ B;  1HD3 A;  3QO3 A;  2I4M A;  1BYM A;  1X2Q A;  4BY6 C;  4HXJ A;  4LVM A;  3EGX A;  3VQV A;  3VRY A;  4PLI A;  4M78 F;  3SEM A;  3CCJ Q;  4M7A C;  2OTL Q;  1OEB A;  1YJW A;  4XEM A;  1KD1 R;  3I9Q A;  1D0X A;  3V8K A;  1S72 Q;  2NYS A;  1NJI R;  3I7F A;  3A5Z A;  2L8D A;  4YYE A;  4PJO A;  1B76 A;  1PM3 A;  1TXQ A;  1S1N A;  4JJN K;  3R07 A;  4X1V A;  1I8F A;  2LNV A;  2O01 E;  2EQM A;  2R58 A;  4BD3 A;  4RG2 A;  4YRQ A;  4ZN3 A;  1SSH A;  1GCQ A;  2NUT B;  3QNE A;  3QSU A;  1QVG A;  3RBB B;  4OMN A;  5CKD A;  2QTV A;  1M1K C;  1PKS A;  3A8O B;  2BE9 B;  1WXT A;  2FRW A;  2QYZ A;  4XTU A;  5C53 B;  3TUP A;  1VYU A;  3CMA T;  2LNH B;  3UT1 A;  3CMQ A;  3H41 A;  2DNU A;  4QKU A;  1RAH B;  1R77 A;  3X20 B;  1QF6 A;  2QA4 T;  2GFU A;  4TVR A;  1WX6 A;  3UAT A;  2LQN A;  4GLK A;  1RAE B;  1ZA2 B;  4TQF A;  3NTH A;  2JM8 A;  5FU6 B;  2AKW B;  1FMV A;  2KI7 A;  1M5Q 1;  5GAO m;  3HRU A;  1ZX6 A;  4JRQ A;  1YIT T;  5GMK e;  4J7I A;  4Y92 A;  1BU1 A;  1KD1 C;  2L3P A;  2KR3 A;  2AMC A;  3EG1 A;  3M0Q A;  3I55 A;  3CCE Q;  1YIT Q;  2VYT A;  2MAM A;  4M77 F;  4YRN A;  2RHY A;  2RK2 A;  2KSS A;  4HCK A;  4AMC A;  3URG A;  2Q5I A;  3TCJ A;  1U5S A;  2FPE A;  4P75 A;  1O75 A;  1Q81 R;  3CCQ T;  1VQ4 A;  3KUF A;  3VV0 A;  2KNB B;  2A7Y A;  5GAO q;  4XU2 A;  4P3N A;  3DLM A;  4HWO A;  1UGQ B;  1WHG A;  2AT1 B;  2PVD B;  3ME9 A;  5CKF A;  1MMG A;  4J83 A;  4FYV B;  1BK2 A;  1EIF A;  3OSS C;  2P0P A;  1YN8 A;  3PGG A;  5CKE A;  2E1H A;  2K5L A;  1QKW A;  2CP5 A;  3JCM b;  2VXE A;  3HY0 A;  2RI5 A;  2EQU A;  1I1J A;  1AHJ B;  1I81 A;  3UF4 A;  4OMO A;  4J9D A;  2COW A;  1OX9 A;  3M56 A;  4O6J A;  1M90 U;  2MF2 A;  3JB9 D;  3GIB A;  4HCB A;  4BWA A;  3M0S A;  2DRM A;  3VBB A;  3M4G A;  1VQP T;  3C0C A;  1I4K 1;  2ZNI A;  5CKH A;  1YNZ A;  3VU3 C;  3M55 A;  2AKL A;  2K5F A;  5CK9 A;  1KOG A;  2ODR D;  4C0D B;  4V2S A;  3J80 E;  4BY6 B;  1B70 A;  1YHQ Q;  2RI2 A;  4PJJ A;  2O2O A;  2KRM A;  5GAM h;  2MOX A;  3P8H A;  2FZG B;  4YRS A;  2RI3 A;  1KQS A;  1E24 A;  4ORZ A;  3I56 A;  2CUB A;  2QAZ A;  4OF1 A;  2XID A;  2LZ6 B;  4MZM A;  4J15 A;  2LQ8 A;  1UJ0 A;  2QQB A;  4ZTU B;  2XGT A;  2QA4 A;  5KCH A;  2FB7 A;  2FRY A;  1VQM T;  2OTJ Q;  3M4Q A;  1T3L A;  3UPU A;  3FRN A;  4C92 G;  2M9U A;  3U23 A;  2XDP A;  4CC3 A;  5GMK j;  3A8H B;  5M9O A;  1JBM A;  1GBR A;  2ZPI B;  3P8V A;  2MYS A;  1X01 A;  3LGF A;  1QKX A;  2MPX C;  1QWF A;  2GCX A;  3PT9 A;  2D9T A;  1NLP C;  2HNI A;  2D1X A;  4C92 B;  3MEW A;  5GMK i;  3AHU A;  3RGL A;  3EG9 B;  1H3H A;  3PCO B;  5KYU A;  4BAC A;  4OB0 B;  2NUP A;  4PJO F;  1UGP B;  2EYZ A;  3V8J A;  3OSV A;  2RHX A;  2J6F A;  3LSS A;  2Q5H A;  2FVU A;  4R55 A;  1HSQ A;  3A7A A;  1VQ5 Q;  2HKN A;  3CPF A;  2Q7G A;  4IUP A;  5GAN f;  2A37 A;  4PK4 A;  5LJ5 g;  1PRL C;  1X6B A;  5GAM g;  3VQY A;  3L1A A;  4FM4 B;  4PJO E;  3PMT A;  4LUD A;  2HBP A;  2YT6 A;  4OMM A;  3FEO A;  1WHK A;  4C8Q D;  4C92 E;  1B7Y B;  5GAN 6;  4TVA A;  1VQL Q;  2PME A;  2DD4 A;  1HYO A;  5GAO r;  2W0Z A;  4RTV A;  1KMN A;  1U3O A;  1VQ8 Q;  2H3E B;  1CSK A;  4M77 D;  4H2W A;  5AYF A;  4J6Y A;  1ZUK A;  3S3M A;  2A8E A;  3DKM A;  2F2V A;  3G4S A;  2AMC B;  1LJO A;  1VQO A;  3OYJ A;  3MET A;  1UJY A;  5DM7 R;  1Q7Y C;  5FWC A;  5LJ3 j;  4CS2 A;  4Z02 A;  3INZ A;  3KFV A;  4IKF A;  2CIM A;  1B34 A;  2FYK A;  1B7T A;  1SER A;  1VQ4 Q;  2AKW A;  1W2B P;  4E7L A;  2DX1 A;  4J9B A;  1OUL A;  2LJ0 A;  1WPY A;  2I4O A;  2KY9 A;  3MO8 A;  3MKD A;  1UGR B;  1JRI A;  1JO8 A;  2FHD A;  4JRP A;  3CC2 Q;  4YRC A;  1KC8 R;  1W2B S;  2C8M A;  1QLY A;  1KQ2 A;  1VIE A;  1YFR A;  3RES A;  4O5V A;  3O5Z A;  2GQI A;  1M4Z A;  4II1 A;  5LJ3 e;  2MWO A;  2RJD A;  3L2Q A;  3CCQ A;  1OU8 A;  1Z9Z A;  4YRE A;  4C92 C;  1GL5 A;  1R0C B;  1H92 A;  2O9V A;  1KMM A;  3BFM A;  1Q81 U;  2YHT A;  4PJO G;  4C8Q C;  5I2M A;  2EJ9 A;  2FL7 A;  4B6M A;  1WQ7 A;  4JLG A;  1E1O A;  3L4G B;  3JCM f;  1WU7 A;  2NUZ A;  2CJ9 A;  4YRM A;  3HFZ B;  2BZY A;  3OW2 S;  4YRO A;  2X3W D;  4M75 E;  8AT1 B;  4E7I A;  1Y96 A;  3CCV Q;  1PKT A;  2LJ3 A;  1B07 A;  2PQW A;  3ER0 A;  3H6Z A;  3R6N A;  3JV3 A;  1Q86 R;  2E64 A;  1JXM A;  3HL8 A;  1X54 A;  5J3B A;  4LDW A;  1AT1 B;  1LYL A;  3VUZ A;  4MML A;  5L8R E;  3BW1 A;  1ZUY A;  3CCM Q;  4M75 F;  1Q82 U;  4KUL A;  1QVF S;  4JPB W;  1JJC A;  1MNE A;  3EG0 A;  1MMN A;  3WVD B;  4C5I A;  4P3P A;  3VS2 A;  3H0H A;  2YWW A;  3TQ7 P;  2OTJ T;  1RI9 A;  1X6G A;  2E5K A;  3QWX X;  2HQX A;  1N27 A;  4P3O A;  3GNF B;  4FU6 A;  4EDU A;  2CS7 A;  4N0A C;  4P73 C;  4JUV A;  2DLP A;  3OYM A;  3T9N A;  3UA7 A;  3QBY A;  1AZE A;  3IKL A;  2FEI A;  5CO7 A;  2QQS A;  5I11 A;  3LW5 E;  1X75 C;  5LJ3 g;  2CYZ B;  3MF1 A;  1CKA A;  5KCO A;  2I4L A;  2PUK B;  4AG1 C;  3W3S A;  2K3B A;  2JTM A;  1YHQ T;  3EG9 A;  3E19 A;  3GLX A;  3WXM B;  2PVG B;  3VQX A;  5D6X A;  1M2V A;  3A31 A;  4QQG A;  1H4T A;  3OMG A;  1UG1 A;  3J81 E;  4M77 A;  4M75 C;  2J3M A;  3QO7 A;  2KQW A;  1ZSG A;  2L5Q A;  3OYI A;  1OU9 A;  2EWN A;  3QXE B;  4AFZ C;  4NL3 A;  3OS1 A;  1YGB A;  1DJ7 B;  2DTH A;  3OYC A;  1ABO A;  3H0F A;  3NTK A;  3L2Z A;  1ZQ1 A;  4ZGD B;  1WGS A;  4TVA B;  3HXZ A;  3DB3 A;  1B7Y A;  4QVZ A;  4C5G A;  3HXY A;  1VQ5 T;  3CD6 Q;  4JRI A;  1ARK A;  3I56 T;  3QO8 A;  1YI2 A;  2SRC A;  1M3B A;  4P75 C;  1X27 A;  4KR3 A;  1I07 A;  4F17 A;  4L59 A;  1G5H A;  2DEU A;  5KYY B;  1W2B A;  4G85 A;  5CAI A;  4RDX A;  4QT7 A;  4KUI A;  3CCQ Q;  4IUR A;  4M7D E;  2CT3 A;  4KBM B;  1GXI E;  1OQK A;  1B3Q A;  5CVI A;  1VQ6 T;  4JS4 A;  2K3X A;  3R6O A;  4MZT A;  2RF0 A;  4M78 B;  2JS0 A;  1WQW A;  2C0O A;  2IY5 A;  4TWA A;  1EFN A;  2A36 A;  4GLM A;  3CC2 A;  5GAO p;  2DFU A;  4X9D A;  1NYQ A;  2EQI A;  1VQO T;  2CUD A;  4HA8 A;  2ZTG A;  2KE9 A;  2ABL A;  2EJF A;  3MEY A;  4HVC A;  2BZX A;  3VS3 A;  2ENM A;  1NJ6 A;  2JS2 A;  3RMS A;  5GAM j;  3OW2 A;  3REB B;  3PE0 A;  3OYA A;  2ED1 A;  5IAY A;  2CP7 A;  4M7A G;  4QQ6 A;  5FWB A;  4N4I A;  4CRI A;  2QQA A;  4E2F B;  2LTO A;  2CP3 A;  2COY A;  4M77 C;  3MEU A;  2QHU A;  3HTZ A;  4YDQ A;  3TEG A;  4WI1 A;  3HXU A;  2Q7H A;  1QP3 A;  2BZ8 A;  3EAE A;  4DEX A;  2A0F B;  2JUF A;  2EPD A;  2ZZG A;  4P72 A;  1WJS A;  4EO4 A;  1AWX A;  4M7A B;  2DBM A;  4RCC A;  1SSF A;  2QHV A;  4Q5W A;  3CD6 T;  3JCM d;  3CPW S;  1RAF B;  1Y07 A;  5GAM d;  1M3C A;  2LT4 A;  3EG2 A;  1KC8 U;  1N6A A;  1EQR A;  2NS6 A;  4B9X A;  4M7D C;  4OML A;  3REU A;  3LH5 A;  2GNC A;  3MHX A;  4EPC A;  1KJW A;  2E6Z A;  3RNJ A;  1MGQ A;  1WYX A;  2QQR A;  5LJ3 d;  4JJC A;  2F69 A;  4BW9 A;  4KGV B;  4LD6 A;  3JCM P;  1YIJ T;  2ZT6 A;  4H2U A;  2K3Y A;  3SHW A;  2LCS A;  2K79 A;  5GMK l;  2V8I A;  2J6O A;  2DM1 A;  1K9A A;  2KEA A;  1VQ7 A;  5IHK A;  4XQ3 A;  2YUQ A;  1WZO A;  2CP0 A;  1IXD A;  4WJ4 A;  1BBU A;  2E3H A;  2M02 A;  4J9E A;  4DEY A;  1HTT A;  12AS A;  4DBH A;  2ART A;  5GAN 5;  4RQF A;  2WSE E;  3M54 A;  4MDX A;  2YRD A;  2CT4 A;  4C8Q B;  1H4Q A;  5FRM A;  5ECA A;  1N8R R;  1Q7Y R;  1K8A R;  3CCM T;  4FCY A;  1BCM A;  4P74 C;  3G71 T;  3CCL T;  4N4H A;  3EHQ A;  2HQE A;  1QCN A;  1K9M R;  1VQN A;  4JDS A;  2XHC A;  4H2V A;  2QTX A;  3M0R A;  2E3C A;  4X5O A;  4GY5 A;  4AG2 C;  1RL2 A;  3EH2 A;  3CME A;  4ZTZ B;  2QDY B;  2ARS A;  4AH6 A;  1YI2 Q;  4HT4 A;  2QHT A;  11AS A;  2EGE A;  3QPH A;  3OYL A;  1H3Z A;  4JS5 A;  3MP6 A;  1NE8 A;  3VYH B;  3CC7 Q;  4YCV A;  5CQY A;  4FT2 A;  1VQK Q;  3CME T;  4M7D D;  1VA7 A;  2E12 A;  2HSP A;  3NGP A;  2JMA A;  3QO5 A;  4A4K A;  1QVF A;  3EHR A;  1HXD A;  1AZG B;  2EGC A;  3VJP A;  1YJ9 A;  1PRM C;  3UA6 A;  4G84 A;  1IRE B;  4OGE A;  1VQ6 A;  1IO6 A;  2X51 A;  4J6X A;  3VS0 A;  1JJ2 P;  1VYV A;  4KGX B;  4JRK A;  3A8G B;  2HEQ A;  5I21 A;  4EMG A;  2E4H A;  1YCY A;  2CJA A;  1Z9Q A;  3E9H A;  2DXT A;  5FU6 C;  4O2D A;  4A53 A;  3CBM A;  3TSW A;  2CP2 A;  2Y90 A;  2RHQ A;  5I22 A;  5LJ5 j;  1M8V A;  1W70 A;  4ANJ A;  4UP8 A;  3NHN A;  1Y96 B;  3D7S B;  1KK7 A;  2LX7 A;  2JTF A;  4FW1 A;  1RAC B;  3HXX A;  5HGQ A;  4WJ3 M;  1PYS A;  5L23 A;  1N9W A;  3JCM J;  4Z88 A;  5FU7 B;  2QK0 A;  3SWN A;  5GAN h;  1K1Z A;  4P71 A;  1V29 B;  4C0Z A;  2RHZ A;  2JOY A;  4NL2 A;  5GAN 8;  4RUG A;  3SWN B;  5GJV B;  2P4T A;  2HL5 C;  4BE0 A;  2CSI A;  3DLL A;  3H0I A;  4HVU A;  1YFN A;  4XU1 A;  3V7C A;  4CC2 A;  1NBE B;  4FL6 A;  2DL3 A;  5DY9 A;  5C52 B;  1NJ8 A;  2F2W A;  3OS2 A;  1VQM Q;  4RTT A;  4YRF A;  3ULR B;  2F5K A;  2G3R A;  2CP6 A;  4RKU E;  3MEV A;  5F5W A;  1R0B G;  5KYN A;  4EMH A;  2C06 A;  4E7K A;  4IUT A;  4DA4 A;  4DOW A;  1TTH B;  1SRY A;  4N4G A;  5KE3 A;  4CI0 C;  2P84 A;  2JNG A;  4XTW A;  1TS9 A;  2RHU A;  3M58 A;  3NFC A;  2VKN A;  2RD1 A;  1TOV A;  5LJ5 e;  1QW1 A;  1TUD A;  2X4X A;  1UTI A;  2E41 A;  4TVW A;  1M1K R;  3FJP A;  1GGM A;  1M9S A;  1N5Z A;  4M78 G;  4RMO A;  3DSQ A;  4H2X A;  3HKS A;  2JXB A;  2MCN A;  2DYB A;  2ECZ A;  2M0O A;  2VXF A;  1KFZ A;  3I55 T;  2EL9 A;  4KH1 B;  1G3Y A;  1RLP C;  2E6N A;  3MP8 A;  3OYB A;  2QXF A;  2RQW A;  3CXC A;  1H64 1;  2L2P A;  3SWN C;  2ODR C;  2XD0 A;  3HTR A;  1GFD A;  2QG9 B;  2KDS A;  1EOV A;  1WDX A;  3RMQ A;  2ZT8 A;  2OTL A;  5GAN g;  1ADY A;  1WA7 A;  2JVV A;  3OMC A;  1YJW Q;  4LD9 K;  2KRN A;  2EJG A;  3QYG B;  1NJI U;  5HK0 A;  4PJM A;  3E9I A;  1EFW A;  2X3X D;  4M7A F;  2GTO A;  5EG2 A;  3CCU A;  4KT0 E;  4R56 A;  1WI7 A;  4ZGE B;  2ZIN A;  3PCO A;  3LH0 A;  4IIO A;  4B9W A;  2DXB A;  2V1Q A;  3OS0 A;  2VGN A;  2CZ0 B;  1V76 A;  2ZAE A;  3ICA A;  4OMP A;  1IHW A;  2O4X B;  3TEH A;  1VQ4 T;  2L3S A;  4PFZ A;  1ZSZ C;  1XQH A;  2DA9 A;  4RCB A;  2M16 A;  2LCC A;  1U8R A;  1USY C;  3OYF A;  2C7I A;  2LX9 A;  1AVZ C;  2Y4Y A;  1E6H A;  1WHH A;  1N8R U;  1K8A U;  1Q7Y U;  1TUC A;  1AD5 A;  1C0A A;  3I5R A;  4HCZ A;  1VQL A;  4X34 A;  4K86 A;  2OX7 A;  1ZUU A;  3EFO B;  1GCP A;  3KXT A;  1SF9 A;  3OS5 A;  4YP0 A;  4XEO A;  3A5Y A;  1RI0 A;  3UWN A;  1UGS B;  2KYB A;  5A0D A;  2MI6 A;  2ALY B;  1U06 A;  3CC7 A;  3KFU A;  2DMO A;  2CZ7 B;  3A74 A;  4TTV A;  3CCV T;  4L6V 5;  3SDZ A;  4LDU A;  1SKU B;  1WHL A;  2HD0 A;  1OYX A;  1PD1 A;  3H9N A;  4AFQ C;  3MJX A;  1T3S A;  1O9S A;  2IIM A;  1ASY A;  3CCR Q;  4FYW B;  3M9Q A;  1R8O B;  2H8H A;  2C0T A;  4M78 D;  3NET A;  4WF2 A;  2M1H A;  1PSF A;  1Z7N A;  1Q86 C;  5ELO A;  4M78 A;  1BBW A;  1N8R C;  1K8A C;  4RTW A;  1D1B A;  2C0I A;  1SHF A;  4HVW A;  2DVE A;  2A3L A;  1M30 A;  1VUB A;  2FPF A;  5KYY A;  2L3Q A;  4OB3 B;  4LUE A;  3G6E Q;  3GPL A;  1PG5 B;  3GNG A;  4YTL A;  3I5S A;  3E9G A;  3EH1 A;  3NEL A;  1M90 R;  1VQM A;  2A08 A;  2LVM A;  1NLO C;  1X55 A;  4J9H A;  2BTT A;  4P72 C;  1VQ9 A;  5IT9 E;  3CCE T;  4YRK A;  1FMW A;  4F7U B;  2M0Y A;  2WAC A;  4M7D A;  2RB6 A;  4BI3 A;  3M57 A;  4BDY A;  3A7U A;  4A63 B;  3TEH B;  2O4X A;  2MK5 A;  1OX8 A;  3IG2 A;  2D8H A;  1BI2 A;  3CCS Q;  3JRZ A;  4F16 A;  4HCC A;  4D8D A;  4FT4 A;  1PWT A;  2D8J A;  2AZV A;  5FRN A;  4JJB A;  2EYW A;  5KYX B;  4CH5 A;  4N0A A;  4ZNX A;  1K73 R;  2ZZF A;  3OYE A;  3G1J A;  2DL5 A;  1Y57 A;  2PUO B;  1PD0 A;  4M77 E;  1WHJ A;  1W1F A;  2NUT A;  5LJ3 h;  5LJ3 f;  2F1L A;  1JJ2 S;  4LXC A;  2QEX Q;  1YIT A;  1U1S A;  1G3W A;  2CRE A;  2X4Y A;  4J5Y A;  3JCM X;  3S3N A;  5C51 B;  1P92 A;  4D8K A;  2KAF A;  1FX7 A;  3CCM A;  4KQE A;  1Q95 G;  2F5T X;  3P8Y A;  3PFS A;  5FU7 C;  1SHG A;  2Q7E A;  2QGG A;  4XAX B;  1K9M C;  1VQL T;  3X24 B;  5GAN 7;  1NZ9 A;  1YIJ Q;  1IZ6 A;  3ZBD A;  2EQJ A;  3M0T A;  3CD6 A;  2QA4 Q;  1X69 A;  1D1A A;  2QAS A;  1X6O A;  3CCR T;  4RQE A;  1H4S A;  3MEA A;  1MV0 B;  3CCJ A;  4EMK C;  2DQ3 A;  5IXB A;  2K4Y A;  2DD5 A;  2E70 A;  3VYG A;  4ZIB A;  2YSQ A;  1FWZ A;  3IKM B;  3TVT A;  2H3J A;  4M7A E;  1WFW A;  1NPR A;  2L3R A;  2DZC A;  2L0A A;  4EX5 A;  1XNI A;  2KVQ G;  2QEX A;  2WSC E;  1JB0 E;  2K9G A;  3OBW A;  3HXW A;  5AT1 B;  5GAM f;  4YRP A;  1RAA B;  3LWH A;  3QDF A;  4ZTJ A;  1D0Z A;  2RHS A;  2RJF A;  2GF7 A;  5D6Y A;  3QKJ A;  5KH6 A;  3HFZ A;  3EFR A;  1M1G A;  2ZCF B;  2V8K A;  1G83 A;  4K88 A;  1OPL A;  1M1F A;  1X2K A;  3G7Z A;  3S3O A;  4M75 D;  4LVK A;  4TVY A;  2RQU A;  4M75 B;  2JT4 A;  1T0J A;  1UFF A;  1TUG B;  1IHV A;  1KQ1 A;  4P5N A;  4M75 A;  1H4V B;  2V1R A;  1C1A A;  4QQD A;  4XTX A;  2M51 A;  2R5A A;  3LWI A;  3THK A;  4YCW A;  1G5I A;  3L2V A;  3SB2 A;  4OB2 B;  5K1X A;  4C8Q A;  4P71 C;  3G71 A;  3CCL A;  2SEM A;  2OAW A;  1F1B B;  3G4S Q;  5KYW A;  1OOT A;  2EYX A;  3CPW P;  2KK4 A;  1GRI A;  4E7Z A;  1QVF P;  5K1P A;  1Z7M A;  1W6X A;  2NWM A;  4M77 G;  1VIF A;  3Q1J A;  2JTE A;  3OYG A;  5KYX A;  2DL8 A;  4L5G A;  2MWP A;  1LPL A;  1KG1 A;  1Y71 A;  3RUX A;  5LJ5 d;  2EAY A;  1BI0 A;  3GP8 A;  1ZBX A;  4JZ3 A;  5J39 A;  3JB9 I;  1NEB A;  4HWR A;  4DQ2 A;  3X26 B;  4RTU A;  3VS4 A;  2LDM A;  2EIF A;  6AT1 B;  2CJB A;  5CQX A;  3OYN A;  2QDL A;  1WYD A;  2J6K A;  3BE3 A;  4H2S A;  4LDV A;  2X35 A;  4L87 A;  5GAN 3;  3M0P A;  1WNL A;  1XOV A;  3HFV A;  3OA6 A;  4YCU A;  1BCO A;  1VQ8 A;  3LLR A;  2RA2 A;  3EGU A;  1RUW A;  1G3T A;  3C95 A;  1I5L A;  1X2H A;  5A0L A;  4FSS A;  4PFO A;  1E1T A;  3CBP A;  3M53 A;  2HL3 A;  3NEM A;  2KYM A;  2ZPE B;  1MMA A;  1VQK A;  1K76 A;  1E7O A;  4LDX A;  3HFN A;  5KYU B;  2DER A;  3IAL A;  4KUD K;  2EW3 A;  1K73 C;  5FW9 A;  2XDB A;  1VQ9 Q;  2X4W A;  2RJE A;  3M4P A;  3G1Z A;  4R0K A;  4Q6G A;  1C0M A;  5LL6 S;  3CC7 T;  3KBG A;  5HCK A;  4PG3 A;  3GBQ A;  4ME7 A;  3PVL A;  2ALY A;  1AOJ A;  4HKE A;  1K0S A;  3PTA A;  4J9F A;  1X56 A;  2DU7 A;  2VC8 A;  2ZR3 A;  3RDV A;  2YRV A;  2EKO A;  1C6V X;  3ZFJ A;  2KT1 A;  2P0L A;  2RNA A;  4LVL A;  1G5V A;  1VOM A;  2RK1 A;  4GBQ A;  2ZXF A;  1UEC A;  3JCM Q;  4PJO D;  4YRT A;  3QJ6 A;  2J3L A;  3NEN A;  4JJD A;  1N9S A;  4RTX A;  3PVQ A;  1AEY A;  1VQ7 T;  2HBW A;  2EBP A;  1B8A A;  1UEB A;  4F14 A;  1YB3 A;  1G8X A;  1RAD B;  4PHC A;  1H8K A;  4F7U A;  2CGH A;  2JMC A;  4UP7 A;  3OYY A;  2VB6 A;  3E2U A;  1M27 C;  2BKD N;  3CC2 T;  2ARU A;  1AWJ A;  1YWP A;  4BDZ A;  1CKB A;  3LC0 A;  1YHQ A;  1UHC A;  4RTZ A;  3CCR A;  4IUU A;  2E3I A;  5EC7 A;  3V7S A;  4QVD A;  2K2V A;  1YJ9 Q;  1YJW T;  3PZC A;  1UHF A;  4ZTF A;  2VAS A;  1YFT A;  4JLI A;  3CCV A;  1NM7 A;  3QWY A;  4HT8 A;  2RMO A;  2LMJ A;  1FYF A;  4XTV A;  1D3B A;  2AIR B;  3TU4 K;  3NMZ C;  1IB8 A;  3FIF A;  3PIP A;  2DF6 A;  2LQW A;  4E47 A;  3S6W A;  2DEQ A;  2E5Q A;  1KHC A;  2IPO B;  1YI2 T;  3EFO A;  2OTL T;  1MHN A;  4KH0 B;  3RF1 A;  2V8J A;  4RTY A;  2JJ9 A;  5IHN A;  3OYH A;  4WCI A;  1SPK A;  2XI9 A;  5C6S A;  2BIV A;  4YRJ A;  3RAC A;  2AK5 A;  5LJ5 h;  2XK0 A;  2EYQ A;  4ZGJ B;  3HRS A;  1NYF A;  5J26 A;  1BBZ A;  4AFU C;  3RKY A;  1J3T A;  4BE2 A;  4LN2 A;  4WTO B;  1UDL A;  2DBK A;  2I0N A;  4NS5 A;  4C8Q G;  4HWP A;  4CH6 A;  2CH4 A;  2LCL A;  3QUI A;  4KGZ B;  5CR2 A;  1RLQ C; 
#chains in the Genus database with same CATH homology
 3OYK A;  1ADJ A;  3LYI A;  3HY1 A;  4VUB A;  3JAM E;  3BY7 A;  3TRE A;  4X9C A;  4YRL A;  4XTY A;  2RH2 A;  3OYD A;  4C92 F;  3VQW A;  2IG0 A;  3VUB A;  3JCM c;  2DJZ A;  4M75 G;  1EVL A;  1VQZ A;  4C0D C;  2PVO B;  4UC4 A;  1NYR A;  3P8T A;  4UPA A;  4YRI A;  2OAU A;  3LX7 A;  1D3B B;  2YLB A;  2B8A A;  2E10 A;  1YJN T;  2K57 A;  4OMF B;  3JCM V;  4C92 D;  4C8Q E;  2XKO C;  3SFM A;  3DB4 A;  2ZIO A;  3CCU T;  2HAX A;  1B70 B;  4Y28 E;  4H2X B;  4F7U F;  2MMP A;  4J6W A;  2IY5 B;  2P5I A;  4YRR A;  2X4J A;  1PSE A;  4BE1 A;  2QHS A;  4PL6 A;  2LQK A;  2ZR2 A;  4PKC C;  1G3S A;  3QZ5 B;  2LRQ A;  3CCJ T;  1VQ5 A;  5CIU A;  3A32 A;  3JB9 H;  3A5Z B;  3L42 A;  5ELN A;  1N9R A;  4H2Y A;  2ZT5 A;  5GAN d;  4Q15 A;  4OLF A;  3SD4 A;  4E51 A;  2RJC A;  3OQ5 A;  1BKB A;  3RL6 A;  4C0F A;  2EFI A;  2AHJ B;  3G6E A;  1K9M U;  3P8B B;  1OZ2 A;  4A4H A;  3ZEH A;  4J7F A;  3MF2 A;  5E3I A;  1ZHI A;  1TH7 A;  3GOX A;  3N5B B;  2JZ2 A;  4C5H A;  3G6E T;  1QVP A;  4PLL A;  1BI1 A;  3L4G A;  2D6F A;  2DPP B;  3E9F A;  1BI3 A;  1NJI C;  4YPF A;  3UGT A;  3CEY A;  5IN1 A;  2E65 A;  1WJR A;  3L2U A;  3PIO A;  3CPW A;  2RHQ B;  2P0K A;  4M7D G;  4Y91 A;  4H02 A;  4LDY A;  3CMA A;  1J5W A;  5GMK m;  1Q86 U;  3UGQ A;  4P74 A;  2ZPG B;  4DOV A;  4C92 A;  1BIA A;  2L89 A;  2CKK A;  2DXC A;  3QTC A;  1KHI A;  5KE2 A;  5DLO A;  4M7D B;  2ZCE A;  2DO3 A;  2OTJ A;  3X28 B;  3CCE A;  3C12 A;  3QYH B;  2DKG A;  3FLG A;  1LNX A;  2ZZD A;  5GAN e;  3A8M B;  3RER A;  3JCM W;  2RHS B;  5I2S A;  5GAO n;  3FB9 A;  3CC4 A;  2VV5 A;  1M90 C;  2QEX T;  1SET A;  2D0Q B;  2RO0 A;  3JSC A;  3WQZ A;  3HPW A;  3BJU A;  4XTZ A;  2IVW A;  3C4S A;  3J7A F;  1YBY A;  2KMT A;  4BUG A;  3M59 A;  3A7R A;  5A0G A;  1QE0 A;  3EFS A;  2CZ6 B;  3JCM h;  1OI1 A;  4FIB A;  2ZGW A;  4E7H A;  4A4F A;  4D6W A;  2XIC A;  3QJY A;  1EIY A;  4RG8 A;  3HRK A;  4XU3 A;  2QI2 A;  2YLC A;  3HRI A;  1M1K U;  4ELY C;  4UP9 A;  2LT1 A;  3FC3 A;  3PMI A;  4NOY A;  5FRO A;  4PNO A;  3CBO A;  4M7A D;  5KNN A;  4IUV A;  4EMK A;  3TEE A;  4K87 A;  3LSQ A;  3HP9 A;  2DTO A;  1NPP A;  5LJ5 f;  3OY9 A;  4XU0 A;  1B34 B;  5HKC A;  2NLU A;  3C94 A;  1S72 T;  4OP0 A;  4MDW A;  1VQP A;  3UDC A;  1Q81 C;  3NTI A;  3JCM e;  4OGC A;  5HY6 A;  3MQZ A;  1E22 A;  3QZ9 B;  2XTI A;  3G4S T;  5C0M A;  5GMK h;  2DZ9 A;  4HT9 A;  1UB4 A;  1WLE A;  3CC4 T;  1X2G A;  4ZN1 A;  4BB7 A;  3UFG A;  4F7U G;  4TQD A;  3BDL A;  2P0Q A;  1VQ9 T;  3HSB A;  2I4N A;  1G51 A;  4ELZ C;  3ERR A;  4F7U E;  1YFS A;  3V7R A;  1QVG S;  4CH3 A;  1QP2 A;  3ASK A;  3QDR B;  4BI4 A;  4EMK B;  2R5M A;  2DIG A;  3H8Z A;  1KD1 U;  2XG8 D;  2DK3 A;  3HXV A;  1EVK A;  5GAN 2;  4P73 A;  1WJQ A;  2PU9 B;  1KC8 C;  5GAN 4;  3QG1 A;  5A2Q E;  4PJO B;  1NJ1 A;  2R57 A;  1BIB A;  1JJC B;  1JJ2 A;  1NNH A;  2RM4 A;  4M78 E;  5CKB A;  2DXU A;  4MZP A;  4HWS A;  2LC4 A;  3HHT B;  3PNW C;  1IL2 A;  2RHI A;  3FDR A;  5FLX E;  1YJ9 T;  3UH0 A;  3JB9 G;  4RMF A;  2EQK A;  5HK3 A;  1S72 A;  4CH4 A;  5GAO l;  2ZPF B;  4PJO C;  1LOJ A;  1NJ2 A;  1SES A;  2ZNJ A;  4YRG A;  3CCS T;  2XDD A;  3QHS A;  2GFA A;  3OD1 A;  2XU8 A;  3X25 B;  4C5E A;  4MMK A;  1RIQ A;  4IUQ A;  3QII A;  2ZIM A;  2Y4X A;  4M77 B;  4A54 A;  1PYS B;  2JN0 A;  2DQ0 A;  4A4G A;  3BDU A;  2VGM A;  4DPG A;  4KR2 A;  2CZ1 B;  3LGL A;  3VKI A;  1XTD A;  4LVI A;  1K73 U;  4OVA A;  1HK9 A;  4LVJ A;  1FXX A;  1OZ3 A;  4LNS A;  2K5I A;  1Y7X A;  3M4Y A;  2E5A A;  3OBY A;  3HRT A;  3CCS A;  2QQ9 A;  1VQK T;  1ATI A;  4M78 C;  3MCA B;  1YJN A;  2VUB A;  3O8V A;  4QVC A;  3RKW A;  3F70 A;  2I2L A;  2DTI A;  3M5A A;  3P8D A;  4J8O A;  3JB9 J;  2DAQ A;  5GAN j;  3L2W A;  4CS4 A;  1KQS S;  5DLQ E;  3CXC S;  2DU5 A;  4XK8 E;  2ZPH B;  3WVE B;  1YIJ A;  3E1S A;  2DIQ A;  2PMF A;  4C0G A;  1L0W A;  1VQ8 T;  3RIR A;  4ATO A;  2ZZE A;  1ASZ A;  4NCX A;  3GF5 A;  3L2R A;  4QW2 A;  2WSF E;  2G4C A;  3A8L B;  1VQN T;  4OB1 B;  4HWT A;  5CCA A;  3JB9 F;  3JCM g;  1HC7 A;  2ZT7 A;  1Q82 C;  4BI8 B;  4M7D F;  2BUD A;  5GAM e;  4H2T A;  4E7J A;  3V8L A;  1EIY B;  3RKX A;  2GQV A;  4A4E A;  1W4S A;  2DDZ A;  5D6W A;  1USY A;  4M7A A;  3REX A;  4CS3 A;  4C8Q F;  1NJ5 A;  3OB9 A;  3HFO A;  1W66 A;  4FSX A;  2ZPB B;  1U1T A;  3MP1 A;  3QO3 A;  2I4M A;  1BYM A;  4BY6 C;  4LVM A;  3VQV A;  4PLI A;  4M78 F;  4M7A C;  1YJW A;  4XEM A;  3V8K A;  3I7F A;  3A5Z A;  2L8D A;  4YYE A;  4PJO A;  1B76 A;  4JJN K;  3R07 A;  1I8F A;  2LNV A;  2O01 E;  2EQM A;  2R58 A;  4BD3 A;  4RG2 A;  4YRQ A;  4ZN3 A;  3QNE A;  3QSU A;  1QVG A;  5CKD A;  1M1K C;  3A8O B;  4XTU A;  5C53 B;  3TUP A;  3CMA T;  3UT1 A;  3CMQ A;  3X20 B;  1QF6 A;  2QA4 T;  2GFU A;  4TVR A;  4GLK A;  4TQF A;  3NTH A;  5FU6 B;  2AKW B;  1M5Q 1;  5GAO m;  3HRU A;  4JRQ A;  1YIT T;  5GMK e;  4J7I A;  1KD1 C;  2AMC A;  3I55 A;  2VYT A;  2MAM A;  4M77 F;  4YRN A;  2RHY A;  2RK2 A;  2KSS A;  3URG A;  2Q5I A;  3TCJ A;  4P75 A;  1O75 A;  3CCQ T;  1VQ4 A;  3KUF A;  3VV0 A;  2A7Y A;  5GAO q;  4XU2 A;  4P3N A;  3DLM A;  4HWO A;  1UGQ B;  2PVD B;  3ME9 A;  5CKF A;  4J83 A;  1EIF A;  2P0P A;  3OSS C;  3PGG A;  2E1H A;  5CKE A;  2K5L A;  3JCM b;  2VXE A;  3HY0 A;  2RI5 A;  2EQU A;  1AHJ B;  1I81 A;  3M56 A;  4O6J A;  1M90 U;  2MF2 A;  3JB9 D;  3GIB A;  4HCB A;  4BWA A;  3VBB A;  3M4G A;  1VQP T;  1I4K 1;  2ZNI A;  5CKH A;  3VU3 C;  3M55 A;  2K5F A;  5CK9 A;  1KOG A;  2ODR D;  4C0D B;  4V2S A;  3J80 E;  4BY6 B;  1B70 A;  2RI2 A;  5GAM h;  3P8H A;  4YRS A;  2RI3 A;  1KQS A;  1E24 A;  3I56 A;  4OF1 A;  2XID A;  4MZM A;  4J15 A;  2LQ8 A;  2QQB A;  4ZTU B;  2XGT A;  2QA4 A;  5KCH A;  2FB7 A;  1VQM T;  3M4Q A;  3UPU A;  3FRN A;  4C92 G;  2M9U A;  2XDP A;  5GMK j;  3A8H B;  5M9O A;  1JBM A;  2ZPI B;  3P8V A;  1X01 A;  3LGF A;  2GCX A;  3PT9 A;  2D9T A;  2HNI A;  4C92 B;  3MEW A;  5GMK i;  3AHU A;  3RGL A;  3PCO B;  4BAC A;  4OB0 B;  4PJO F;  1UGP B;  3V8J A;  3OSV A;  2RHX A;  3LSS A;  2Q5H A;  2FVU A;  4R55 A;  3A7A A;  3CPF A;  2Q7G A;  4IUP A;  5GAN f;  5LJ5 g;  5GAM g;  3VQY A;  3L1A A;  4FM4 B;  4PJO E;  3PMT A;  2HBP A;  3FEO A;  4C8Q D;  4C92 E;  1B7Y B;  5GAN 6;  4TVA A;  2PME A;  2DD4 A;  5GAO r;  1KMN A;  4M77 D;  4H2W A;  5AYF A;  4J6Y A;  3S3M A;  2A8E A;  3DKM A;  3G4S A;  2AMC B;  1LJO A;  1VQO A;  3OYJ A;  3MET A;  5DM7 R;  1Q7Y C;  5LJ3 j;  4CS2 A;  4Z02 A;  3INZ A;  4IKF A;  1B34 A;  2FYK A;  1SER A;  2AKW A;  4E7L A;  2I4O A;  1WPY A;  2KY9 A;  3MO8 A;  1UGR B;  1JRI A;  2FHD A;  4JRP A;  4YRC A;  1W2B S;  2C8M A;  1KQ2 A;  1YFR A;  1VIE A;  4O5V A;  3RES A;  1M4Z A;  4II1 A;  5LJ3 e;  2MWO A;  2RJD A;  3L2Q A;  3CCQ A;  4YRE A;  4C92 C;  1KMM A;  3BFM A;  1Q81 U;  2YHT A;  4PJO G;  4C8Q C;  5I2M A;  2EJ9 A;  2FL7 A;  1WQ7 A;  4JLG A;  1E1O A;  3L4G B;  3JCM f;  1WU7 A;  2CJ9 A;  4YRM A;  3HFZ B;  3OW2 S;  4YRO A;  4M75 E;  4E7I A;  1Y96 A;  2PQW A;  3H6Z A;  3ER0 A;  2E64 A;  3HL8 A;  1X54 A;  5J3B A;  4LDW A;  1LYL A;  3VUZ A;  4MML A;  5L8R E;  3BW1 A;  4M75 F;  1Q82 U;  4KUL A;  1QVF S;  1JJC A;  3WVD B;  4C5I A;  4P3P A;  2OTJ T;  2HQX A;  1N27 A;  4P3O A;  3GNF B;  4FU6 A;  4EDU A;  2CS7 A;  4N0A C;  4P73 C;  4JUV A;  3OYM A;  3T9N A;  3QBY A;  3IKL A;  5CO7 A;  2QQS A;  3LW5 E;  1X75 C;  5LJ3 g;  2CYZ B;  3MF1 A;  5KCO A;  2I4L A;  2PUK B;  3W3S A;  2JTM A;  1YHQ T;  3E19 A;  3GLX A;  3WXM B;  2PVG B;  3VQX A;  5D6X A;  3A31 A;  4QQG A;  1H4T A;  3OMG A;  3J81 E;  4M77 A;  4M75 C;  2J3M A;  3QO7 A;  2KQW A;  2L5Q A;  3OYI A;  2EWN A;  3QXE B;  4NL3 A;  3OS1 A;  1YGB A;  1DJ7 B;  2DTH A;  3OYC A;  3NTK A;  3L2Z A;  1ZQ1 A;  4ZGD B;  1WGS A;  4TVA B;  3HXZ A;  3DB3 A;  1B7Y A;  4QVZ A;  4C5G A;  3HXY A;  1VQ5 T;  4JRI A;  3I56 T;  3QO8 A;  1YI2 A;  4P75 C;  4KR3 A;  4L59 A;  1G5H A;  1W2B A;  4G85 A;  5CAI A;  4RDX A;  4KUI A;  4M7D E;  4IUR A;  4KBM B;  1GXI E;  5CVI A;  1VQ6 T;  4JS4 A;  2K3X A;  3R6O A;  4MZT A;  4M78 B;  1WQW A;  2IY5 A;  4TWA A;  3CC2 A;  5GAO p;  4X9D A;  1NYQ A;  1VQO T;  2ZTG A;  4HA8 A;  2EJF A;  3MEY A;  4HVC A;  1NJ6 A;  3RMS A;  5GAM j;  3OW2 A;  3OYA A;  5IAY A;  4M7A G;  4QQ6 A;  4N4I A;  4CRI A;  2QQA A;  2LTO A;  4M77 C;  3MEU A;  2QHU A;  3HTZ A;  4YDQ A;  3TEG A;  4WI1 A;  3HXU A;  2Q7H A;  1QP3 A;  3EAE A;  2JUF A;  2ZZG A;  4P72 A;  1WJS A;  4EO4 A;  4M7A B;  4RCC A;  1SSF A;  2QHV A;  4Q5W A;  3CD6 T;  3JCM d;  3CPW S;  1Y07 A;  5GAM d;  2LT4 A;  1KC8 U;  1N6A A;  1EQR A;  2NS6 A;  4B9X A;  4M7D C;  3REU A;  3MHX A;  4EPC A;  2E6Z A;  1MGQ A;  2QQR A;  5LJ3 d;  2F69 A;  4BW9 A;  4LD6 A;  3JCM P;  1YIJ T;  2ZT6 A;  4H2U A;  2K3Y A;  5GMK l;  2V8I A;  1VQ7 A;  4XQ3 A;  4WJ4 A;  1BBU A;  1HTT A;  12AS A;  2ART A;  5GAN 5;  4RQF A;  2WSE E;  3M54 A;  4MDX A;  4C8Q B;  1H4Q A;  5FRM A;  3CCM T;  4P74 C;  3G71 T;  3CCL T;  4N4H A;  2HQE A;  1VQN A;  4JDS A;  2XHC A;  4H2V A;  2QTX A;  2E3C A;  4X5O A;  4GY5 A;  1RL2 A;  3CME A;  4ZTZ B;  2QDY B;  2ARS A;  4AH6 A;  4HT4 A;  2QHT A;  11AS A;  3QPH A;  3OYL A;  1H3Z A;  4JS5 A;  3MP6 A;  1NE8 A;  3VYH B;  4YCV A;  5CQY A;  4FT2 A;  3CME T;  4M7D D;  2E12 A;  3QO5 A;  4A4K A;  1QVF A;  1HXD A;  3VJP A;  1YJ9 A;  4G84 A;  1IRE B;  4OGE A;  1VQ6 A;  4J6X A;  4JRK A;  3A8G B;  5I21 A;  4EMG A;  1YCY A;  2CJA A;  3E9H A;  2DXT A;  5FU6 C;  4O2D A;  4A53 A;  3CBM A;  2Y90 A;  2RHQ A;  5LJ5 j;  1M8V A;  4UP8 A;  1Y96 B;  2JTF A;  3HXX A;  5HGQ A;  4WJ3 M;  1PYS A;  1N9W A;  3JCM J;  5FU7 B;  3SWN A;  5GAN h;  4P71 A;  1V29 B;  4C0Z A;  2RHZ A;  2JOY A;  4NL2 A;  5GAN 8;  3SWN B;  2P4T A;  4BE0 A;  3DLL A;  4XU1 A;  3V7C A;  4FL6 A;  5DY9 A;  5C52 B;  1NJ8 A;  3OS2 A;  4YRF A;  2F5K A;  2G3R A;  4RKU E;  3MEV A;  5F5W A;  4EMH A;  2C06 A;  4E7K A;  4IUT A;  4DA4 A;  4DOW A;  1SRY A;  4N4G A;  5KE3 A;  4CI0 C;  2JNG A;  4XTW A;  2RHU A;  3M58 A;  3NFC A;  2RD1 A;  5LJ5 e;  1QW1 A;  2X4X A;  2E41 A;  4TVW A;  3FJP A;  1GGM A;  1M9S A;  4M78 G;  4RMO A;  3DSQ A;  4H2X A;  3HKS A;  2M0O A;  2VXF A;  3I55 T;  2EL9 A;  1G3Y A;  2E6N A;  3MP8 A;  3OYB A;  2QXF A;  3CXC A;  1H64 1;  3SWN C;  2ODR C;  2XD0 A;  2KDS A;  1EOV A;  3RMQ A;  2ZT8 A;  2OTL A;  5GAN g;  1ADY A;  2JVV A;  3OMC A;  4LD9 K;  2EJG A;  3QYG B;  1NJI U;  5HK0 A;  3E9I A;  1EFW A;  4M7A F;  5EG2 A;  3CCU A;  4KT0 E;  4R56 A;  4ZGE B;  2ZIN A;  3PCO A;  3LH0 A;  4B9W A;  2DXB A;  3OS0 A;  2VGN A;  2CZ0 B;  3ICA A;  2O4X B;  3TEH A;  1VQ4 T;  1XQH A;  4RCB A;  2M16 A;  2LCC A;  1U8R A;  1USY C;  3OYF A;  2C7I A;  2LX9 A;  2Y4Y A;  1N8R U;  1K8A U;  1Q7Y U;  1C0A A;  4HCZ A;  1VQL A;  4X34 A;  4K86 A;  3KXT A;  3OS5 A;  4YP0 A;  4XEO A;  3A5Y A;  1RI0 A;  3UWN A;  1UGS B;  5A0D A;  2MI6 A;  2ALY B;  3CC7 A;  3KFU A;  2CZ7 B;  3A74 A;  4TTV A;  3CCV T;  4L6V 5;  3SDZ A;  4LDU A;  2HD0 A;  1OYX A;  1O9S A;  1ASY A;  3M9Q A;  1R8O B;  4M78 D;  3NET A;  4WF2 A;  2M1H A;  1PSF A;  1Z7N A;  1Q86 C;  5ELO A;  4M78 A;  1BBW A;  1N8R C;  1K8A C;  2DVE A;  2A3L A;  1VUB A;  3GPL A;  4OB3 B;  3GNG A;  4YTL A;  3E9G A;  3NEL A;  1VQM A;  2LVM A;  1X55 A;  4P72 C;  1VQ9 A;  5IT9 E;  3CCE T;  4YRK A;  4F7U B;  2WAC A;  4M7D A;  2RB6 A;  4BI3 A;  3M57 A;  4BDY A;  3A7U A;  3TEH B;  2O4X A;  3IG2 A;  1BI2 A;  3JRZ A;  4HCC A;  4FT4 A;  5FRN A;  4CH5 A;  4N0A A;  2ZZF A;  3OYE A;  2PUO B;  4M77 E;  1JJ2 S;  5LJ3 f;  5LJ3 h;  1YIT A;  1U1S A;  1G3W A;  2X4Y A;  4J5Y A;  3JCM X;  3S3N A;  5C51 B;  1P92 A;  2KAF A;  1FX7 A;  3CCM A;  4KQE A;  2F5T X;  3P8Y A;  3PFS A;  5FU7 C;  2Q7E A;  4XAX B;  1K9M C;  1VQL T;  3X24 B;  5GAN 7;  1NZ9 A;  1IZ6 A;  3ZBD A;  2EQJ A;  5CR2 A;  3CD6 A;  1X6O A;  3CCR T;  4RQE A;  1H4S A;  3MEA A;  3CCJ A;  4EMK C;  2DQ3 A;  2K4Y A;  2DD5 A;  2E70 A;  3VYG A;  4ZIB A;  1FWZ A;  3IKM B;  4M7A E;  2H3J A;  1NPR A;  2L3R A;  2DZC A;  4EX5 A;  1XNI A;  2KVQ G;  2QEX A;  2WSC E;  1JB0 E;  3OBW A;  3HXW A;  5GAM f;  4YRP A;  3LWH A;  4ZTJ A;  2RHS A;  3HFZ A;  2RJF A;  2GF7 A;  3QKJ A;  5D6Y A;  5KH6 A;  3EFR A;  1M1G A;  2ZCF B;  2V8K A;  4K88 A;  1M1F A;  3G7Z A;  3S3O A;  4M75 D;  4LVK A;  4TVY A;  4M75 B;  1KQ1 A;  4P5N A;  4M75 A;  1H4V B;  4QQD A;  4XTX A;  2R5A A;  3LWI A;  4YCW A;  1G5I A;  3L2V A;  3SB2 A;  4OB2 B;  5K1X A;  4C8Q A;  4P71 C;  3G71 A;  3CCL A;  2KK4 A;  5K1P A;  1Z7M A;  4M77 G;  1VIF A;  3Q1J A;  3OYG A;  4L5G A;  2MWP A;  1KG1 A;  1Y71 A;  3RUX A;  5LJ5 d;  2EAY A;  1BI0 A;  3GP8 A;  1ZBX A;  5J39 A;  3JB9 I;  4HWR A;  4DQ2 A;  3X26 B;  2LDM A;  2EIF A;  2CJB A;  5CQX A;  3OYN A;  1WYD A;  4H2S A;  4LDV A;  4L87 A;  2X35 A;  5GAN 3;  1WNL A;  1XOV A;  3HFV A;  3OA6 A;  4YCU A;  1VQ8 A;  3LLR A;  2RA2 A;  1G3T A;  3C95 A;  1I5L A;  1X2H A;  5A0L A;  1E1T A;  3CBP A;  3M53 A;  3NEM A;  2ZPE B;  1VQK A;  4LDX A;  3HFN A;  3IAL A;  4KUD K;  1K73 C;  2XDB A;  2X4W A;  2RJE A;  4Q6G A;  3M4P A;  3G1Z A;  5LL6 S;  3CC7 T;  3KBG A;  4PG3 A;  4ME7 A;  2ALY A;  4HKE A;  2DU7 A;  3PTA A;  1X56 A;  2VC8 A;  2ZR3 A;  2YRV A;  2EKO A;  3ZFJ A;  2P0L A;  4LVL A;  1G5V A;  2RK1 A;  2ZXF A;  3JCM Q;  4PJO D;  4YRT A;  3QJ6 A;  2J3L A;  3NEN A;  1N9S A;  1VQ7 T;  1B8A A;  1UEB A;  1YB3 A;  4PHC A;  4F7U A;  2CGH A;  4UP7 A;  3OYY A;  2BKD N;  3CC2 T;  2ARU A;  4BDZ A;  3LC0 A;  1YHQ A;  3CCR A;  4IUU A;  3V7S A;  4QVD A;  2K2V A;  1YJW T;  3PZC A;  4ZTF A;  1YFT A;  4JLI A;  3CCV A;  4HT8 A;  1FYF A;  4XTV A;  1D3B A;  3TU4 K;  3FIF A;  3PIP A;  4E47 A;  3S6W A;  2DEQ A;  2E5Q A;  1KHC A;  1YI2 T;  2OTL T;  1MHN A;  3RF1 A;  2V8J A;  3OYH A;  5C6S A;  2XI9 A;  2BIV A;  4YRJ A;  3RAC A;  5LJ5 h;  2XK0 A;  2EYQ A;  4ZGJ B;  3HRS A;  5J26 A;  3RKY A;  4BE2 A;  4NS5 A;  4C8Q G;  4HWP A;  4CH6 A;  2LCL A;  3QUI A;  2CIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...