2EJGA

Crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
235
structure length
232
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 64
structure length 232
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejgA01
4X9CA 4P74A 4XTXA 4TQDA 4AH6A 2AKWA 2ZXFA 5GAOp 4PJOE 3L1AA 3HFVA 5LJ3d 2EWNA 1NJ5A 1B34B 3RESA 2DTIA 1D3BA 3TEHB 1H4TA 4XTUA 4P73C 5GAMf 5LJ5f 3A7UA 4YRKA 4H02A 1RIQA 2ARUA 1ADYA 4C92D 4M78D 4RQEA 2I4LA 4MMKA 4P74C 4TVAB 1I4K1 2DEQA 4YCVA 3VQXA 3HFZA 3G1ZA 3EFSA 4C8QE 3R07A 4DPGA 2Q7HA 4M75A 2AMCB 2VXFA 4M77E 2RHSB 3RERA 2DJZA 3RACA 4M77G 2RB6A 4CS4A 3RGLA 4PJOB 2ODRD 1U1TA 2CJBA 1U1SA 3JCMg 3E9HA 3SWNB 4XU0A 1LOJA 4CH3A 1I81A 3QNEA 1G5IA 3MF1A 4YCUA 3HFOA 4M7DA 1QF6A 4M7AE 1X56A 5E3IA 3W3SA 3RIRA 1H4VB 4M75C 2CGHA 1W66A 3JCMX 3JCMd 3A74A 4C8QB 3BJUA 4H2SA 4JLIA 1ASYA 4YROA 4M77B 4N0AA 3VU3C 1G51A 3HXUA 2IY5A 1H641 2ZNIA 4G84A 2RHQB 4NL3A 2QHUA 3SB2A 3L4GA 1ADJA 2VC8A 2YLBA 3A5YA 4H2XB 4YP0A 2E5AA 4M7DC 3E9IA 3HTZA 4C92F 2QHSA 4M7AB 1B7YA 2ZT5A 4YCWA 1BIAA 4G85A 3HY0A 1WLEA 4PHCA 4N0AC 1B70B 4CS2A 1NYQA 4P3OA 2DDZA 1EVKA 4K87A 3RL6A 4BWAA 1YGBA 3JCMc 5LJ5j 5GAMj 4TWAA 4YRTA 3QO7A 1YFSA 4UP9A 2QHTA 5C52B 1FYFA 4F7UF 3QO3A 3JB9G 4KR3A 5LJ3f 4XU3A 3PCOB 4P72A 4O2DA 1LYLA 3A5ZA 3A7AA 2XTIA 3JB9F 2HNIA 2I2LA 3HXWA 3HRKA 2CIMA 4BW9A 1BIBA 3V8KA 1IL2A 4JRKA 4J6YA 1B8AA 4HWSA 3RKYA 3P8TA 5GAOr 4M75E 4YRCA 3LSSA 3BY7A 1QE0A 3NELA 4M77D 2DVEA 2AKWB 1EIYA 3LSQA 4P72C 2DQ3A 3REUA 1NJ1A 5GAOq 3A31A 4YREA 1WNLA 2ZZGA 1YB3A 1ASZA 1E1OA 2CJ9A 4P71A 1D3BB 4YPFA 5K1XA 2ZR2A 4M7DE 4C92A 4LNSA 4M78A 5ELNA 3M4PA 2Q7EA 4PG3A 4V2SA 4RCCA 4YRPA 4QVDA 3JCMf 5GAMe 5LJ5e 4EX5A 3TUPA 3HXVA 4PJOG 4Q6GA 4UP8A 4L87A 4CH6A 1YFTA 1GGMA 4PJOF 4KR2A 4P71C 3QUIA 2I4MA 1JRIA 5GANh 1H4SA 4TQFA 2DTHA 1JJCA 4F7UA 3NETA 4J5YA 2E64A 3NENA 4C92C 4RQFA 4M78C 4RDXA 1WQWA 4M7DB 3IALA 1G5HA 3INZA 4C8QG 1Y96A 2J3LA 4YRIA 2DKGA 4HWOA 4WI1A 4C8QF 2DXTA 3JB9I 4P3PA 4M77F 2DQ0A 1C0AA 2QTXA 2ODRC 2IY5B 4YRRA 2PMEA 4A53A 1M5Q1 3EFRA 1KMNA 3JB9D 1X2GA 1KOGA 3BW1A 1I5LA 1SRYA 1PYSB 4ZTZB 5GANf 2E3CA 2E65A 4M7AG 1B34A 4JRIA 2ZINA 3HFNA 3HXYA 4M7AF 3TEHA 1B76A 4RCBA 1B7YB 2I4NA 4J6WA 3IG2A 5HGQA 2P0LA 4TVAA 4XTZA 1EFWA 5LJ3h 3JCMP 5KNNA 3BFMA 2ALYB 1EOVA 1EQRA 1NJ2A 2PMFA 1ATIA 2RHSA 5LJ5g 5GAMg 5GAOl 1N9RA 4WJ4A 4X9DA 3QSUA 1WU7A 3UGQA 3AHUA 4JUVA 3QO5A 5GMKh 4P75A 5LJ5d 5GAMd 1KQ2A 2EL9A 2ZT6A 4C92E 4M78E 3HSBA 5I21A 5C51B 2RD1A 1BBWA 3RF1A 1NYRA 5GAOm 5GMKi 1MGQA 3NEMA 4YRNA 3JCMQ 3PGGA 4PJOD 3HXXA 3V7SA 4PNOA 4M77A 4CS3A 1EIYB 4K88A 4J6XA 4WF2A 1KMMA 4CH5A 2RHQA 2DZCA 1SESA 4HWTA 4QVCA 4P75C 4F7UE 4XTVA 2ZTGA 3RKXA 3JCMh 3I7FA 2DZ9A 4XU1A 1X54A 3BDUA 4C8QD 1USYA 3IKMB 4M78B 2C8MA 4M75G 3DSQA 3CMQA 2Q5IA 1M8VA 2ARTA 3A32A 3P8VA 1SERA 5GANj 4CH4A 3PZCA 3QO8A 2ZGWA 4EO4A 4YRMA 4ZIBA 4TVWA 2DTOA 2ZCEA 2XGTA 4M7AD 4M7DG 3PCOA 4RMFA 4HVCA 3HFZB 4X5OA 4MMLA 3HXZA 3KFUA 4M7DF 4M75B 2E10A 4EMKA 3FB9A 4YRSA 5F5WA 3UFGA 4YRGA 2YLCA 2JN0A 4OLFA 3JCMb 3M4QA 1H4QA 1X55A 2DU5A 4H2UA 3FJPA 3OD1A 4XTYA 1Z7NA 1SETA 4H2YA 1EVLA 1WQ7A 4NCXA 5GAN3 2E1HA 1KQ1A 5GAN7 3JCMV 2Q5HA 5GMKl 1TH7A 1E24A 4YRJA 1L0WA 4YDQA 5C53B 4EMKC 3VBBA 3HRIA 2ZR3A 1NJ6A 5LJ3j 4H2TA 4WJ3M 2P5IA 3TEGA 3A7RA 2EJ9A 4TVYA 5GANe 5GAN8 5CAIA 2ZIMA 3VQVA 3MEYA 5GMKm 2EJGA 4TTVA 3L4GB 3JB9H 3V7RA 5DY9A 2FB7A 2DU7A 4XEMA 4DQ2A 5GMKj 1HXDA 2RM4A 2DXUA 4Y91A 1YCYA 1NJ8A 2C7IA 2Y90A 1HTTA 1N9SA 3WQZA 3LC0A 4UPAA 4M75D 2AMCA 4HWRA 1WPYA 3L2ZA 4HWPA 3P8YA 3ERRA 4NL2A 2VXEA 1BBUA 4A54A 4NOYA 4PJOA 1E22A 1X01A 3REXA 3M4GA 4YRLA 3SWNA 4EMGA 3JCMW 4XU2A 1HC7A 4P3NA 1E1TA 1LNXA 12ASA 3MF2A 2YHTA 1I8FA 2FYKA 5LJ3e 4M7DD 4C92G 1PYSA 4M78G 2J3MA 1N9WA 2ZT8A 4K86A 3V8JA 1X2HA 4KQEA 4C8QA 4M78F 3FIFA 2EAYA 2QHVA 4J15A 1LJOA 3QHSA 4E51A 4PJOC 1JBMA 5GAN2 4HT9A 5GAN4 4HA8A 4H2VA 3SWNC 5GANg 11ASA 5GMKe 5GAN5 3HY1A 3JCMJ 2ZIOA 3ICAA 2I4OA 4H2XA 4UP7A 1NNHA 1J5WA 2ALYA 4YRFA 1WYDA 2Q7GA 2E41A 3VQWA 4F7UG 3QTCA 4C92B 3RKWA 4M7AA 5GANd 3V8LA 4C8QC 3IKLA 2G4CA 5GAOn 4M77C 1YFRA 4XTWA 1Z7MA 4M75F 2ARSA 2ZNJA 1B70A 4EMKB 3RUXA 5ELOA 3VQYA 4ZTUB 4EMHA 4XQ3A 2ZZEA 2ZZFA 4XEOA 3UGTA 3JCMe 2K57A 5K1PA 2EJFA 1JJCB 4F7UB 4OP0A 4HT8A 3GIBA 5GAN6 1USYC 2ZT7A 4H2WA 2RA2A 4M7AC 1VQZA 4YRQA 5LJ5h 5GAMh 1HK9A 3JB9J 2CJAA 4Q15A 1Y96B 3V7CA 4P73A 3UH0A 4YYEA 5LJ3g
chains in the Genus database with same CATH superfamily
4P74A 3SHWA 3H6ZA 2OTJQ 3I5SA 4CRIA 3CD6T 4UC4A 2AKWA 2K5LA 2ZXFA 5GAOp 2E6NA 4PFZA 5KYYA 1ZSZB 2QQRA 1SHFA 1B34B 2LNVA 5LJ5f 4C5GA 1K8AU 2ARUA 1EX4A 4C92D 4J9GA 4MMKA 4MZMA 4P74C 2DEQA 1BYMA 2MAMA 3HL8A 4CC2A 3VQXA 4C8QE 3LGLA 3R07A 3EGUA 1YHQQ 2JNGA 3RACA 1VQLQ 2JT4A 1M30A 3C4SA 1R0CB 5FU7B 1NJIC 2CJBA 1T0JA 2EGEA 4NS5A 2WSCE 3MF1A 4RUGA 2XKOC 4M7AE 1X56A 3OYNA 4BD3A 3W3SA 3RIRA 1YHQT 4HT4A 1ABQA 3HRSA 5FRNA 4C8QB 2XDBA 3JAME 1VQLT 2HBPA 2DX1A 3VU3C 4C5IA 1YJ9A 1G51A 1SKUB 2QASA 2DMOA 1VQ4T 4LVLA 5L8RE 2VC8A 3H0IA 4LDVA 1VQ5A 1ADJA 3EG1A 2D1XA 3QKJA 2RNAA 2D8JA 1PD1A 4M7AB 1UHFA 1SSFA 1UTIA 1SSHA 4A4EA 3TEEA 2FRYA 1WLEA 1KC8C 2V1RA 1K73C 2RJCA 2DIGA 2QGGA 2DDZA 2M1HA 1W2BA 4K87A 1GBRA 2EFIA 5GAMj 3E9FA 4ELYC 1YFSA 4UP9A 5C52B 1M4ZA 4BI4A 1FYFA 2D9TA 4OMLA 3VRYA 5LJ3f 3PCOB 1LYLA 1AHJB 3A7AA 2XTIA 3JB9F 3MKDA 4MZPA 3HRKA 2QDYB 1I0CA 4AFUC 1BIBA 1Y71A 2LZ6B 3V8KA 4JRKA 1R8OB 1BCMA 2K2VA 4YTLA 2LJ1A 2ZZDA 1K4US 3RKYA 2BZ8A 2VB6A 5GJWB 1UFFA 4E7KA 3NELA 2GNCA 4QT7A 3LSQA 2DQ3A 3REUA 1NJ1A 5GAOq 1JEGA 1KD1C 1WZOA 3QPHA 2ZZGA 1QP2A 1EZZB 5FROA 1K0SA 2LCCA 2ZAEA 3QJ6A 4M7DE 5IN1A 1I5OB 1OYXA 4M78A 1Q82U 3CCVT 1GRIA 4KGVB 4YRPA 5KH6A 3OYBA 1X43A 4RTYA 2MMPA 2ROLA 1K9MU 4EX5A 4C0ZA 2CS7A 2K79A 1XNIA 2E3HA 2MK5A 1G83A 3EGDB 4PJOF 1VQPA 3QUIA 1JRIA 3CMET 3M0QA 2QK0A 2E6ZA 1BI1A 1YI2A 3NENA 1JO8A 4M78C 4BY6C 1WQWA 1O9SA 1EIFA 1WJSA 2FVUA 4M7DB 3R6NA 1MUZA 3IALA 3IQLA 2DKGA 1KQSA 1BK2A 2DA9A 1ACMB 1VQNT 3LH0A 2RJDA 2GBQA 2DQ0A 2RI5A 3ZL7C 1MNDA 3KXTA 4HKEA 4A4KA 4A53A 1T3SA 4JRQA 3MP6A 1X2GA 1NPPA 3KFVA 1PYSB 1PWTA 1YFNA 2ZPBB 2IPOB 1YITQ 2KR3A 1VQ7T 2ZINA 4RCBA 1E7OA 1VQ8Q 1XOVA 2GTOA 2I4NA 4DEXA 3EG2A 2QA4T 2P0PA 4OMNA 3VUZA 5HGQA 2P0LA 1EFWA 1RAHB 4IUUA 5LJ3h 5I2SA 4C5EA 2P84A 2ENMA 2EQKA 2K5FA 1V76A 5KNNA 1YITT 3J80E 3CCMA 1YJNA 2RI2A 4WJ4A 1WGSA 1N9RA 4N4GA 1VQ8T 1Z9QA 2JZ2A 5KCOA 4DEYA 4OMOA 4HCBA 1AWXA 2QG9B 3HRTA 4RKUE 4C92E 3HSBA 3A8HB 5CKBA 4KGXB 3M0SA 2E5QA 3RF1A 1NYRA 2CP2A 5GMKi 3NEMA 1RACB 4PFOA 2ABLA 2F5TX 3L2RA 4M77A 2NUZA 1EIYB 2L2PA 2CSIA 2DD4A 1KMMA 1N8RR 1BI3A 2RHQA 1Q7YU 4HWTA 4QVCA 1GCQA 1X6GA 4F7UE 2I0NA 4IKFA 4LDYA 4M4ZA 1X54A 3REAB 3OY9A 3CC7T 2KRNA 2D6FA 3OMGA 4M75G 5HK3A 3DSQA 5FRMA 2HMAA 1YN8A 5KYYB 2RQUA 1IZ6A 2FPEA 4ZIBA 2OAUA 2E4HA 3OBYA 1BCOA 2JTEA 2XG8D 1U06A 2RHZA 2KBTA 4IIMA 4RMFA 2EQJA 3UF4A 4X5OA 1QVFA 2ZPFB 4YRSA 1J3TA 4OLFA 5HY6A 1H4QA 1X55A 3GPLA 4A4HA 1MMNA 1IRXA 3OD1A 1AWWA 1Z7NA 1SETA 4H2YA 1WI7A 2L3RA 1M2OA 2J05A 2MWOA 5IXBA 3CXCA 2HKQB 2E1HA 2SRCA 2DK3A 1Q81R 1E24A 3LGFA 4OMMA 4L59A 4YDQA 2L3QA 3VBBA 2LVMA 2QDLA 4WJ3M 1WHGA 3MEUA 3M0PA 3NMZC 2EJ9A 4F16A 5KYWA 1JQQA 4A4GA 3G71A 3MEYA 1PD0A 2DVJA 2FPDA 4Q5WA 4D8KA 3CCSQ 3I56Q 1ZSZA 2OTJA 2X3WD 1S72A 1VQOA 1HXDA 2W10A 3JSCA 3NHNA 3MEVA 2A37A 2DRKA 3EHQA 2DXCA 3J7AF 1HTTA 4RTTA 4FIBA 3WQZA 3CCST 2FO0A 2A3LA 3I56T 4M75D 1NLOC 1F1BB 1WPYA 2JTFA 1ZSZC 3ERRA 2DL7A 2QYZA 4A54A 3CBPA 5KE2A 3G1JA 3ZFJA 1UDLA 3QG1A 4EMGA 4J83A 4J9BA 1E1TA 2LX9A 5LJ3e 2F2VA 1WXBA 2J3MA 2VGNA 4ANJA 2HSPA 4RTXA 4C8QA 4M78F 1QVGA 3SDZA 4J15A 1LJOA 4DBFA 4E51A 1BI0A 1OEBA 2IIMA 1X6OA 5FU7C 4E6RA 5A2QE 2ECZA 4HA8A 1AZGB 5GANg 11ASA 1OX8A 1Q86U 1NNHA 1C0MA 1J5WA 2ALYA 2RHXA 2E41A 1XJWB 2O01E 4X1VA 3QTCA 3PTAA 1W6XA 4M7AA 4C8QC 2RHUA 4XTWA 2ARSA 4EMKB 3RUXA 2A28A 3EG3A 4ZTUB 2CKKA 1E6GA 3OYCA 2ZZFA 3UGTA 3ME9A 2M16A 1M1FA 3QXEB 1AWJA 4LD6A 2AT1B 3M5AA 4HT8A 1VYVA 2MPXC 1QW1A 2RA2A 3L2VA 1NJIR 4KUDK 4M7AC 1KIKA 2A08A 4HVVA 3G6EA 1PNJA 1V29B 1WJRA 3FLGA 4Q15A 1YP5A 3V7CA 3QYHB 1D0YA 4P73A 4J9IA 5CKHA 1H8KA 1M1KC 4J7FA 1NZ9A 2FHDA 4TQDA 4Y92A 4DOWA 3CCLA 2RK2A 2DIQA 3RMQA 2C0IA 3WVEB 3MEAA 4FYXB 3D7SB 2GCXA 2EWNA 5LJ3d 3RDVA 3M53A 1FMWA 1CKBA 4BI3A 4F04B 1NJ5A 3PIPA 3RESA 3HPWA 2X4WA 4MZTA 5L23A 4RMOA 1C6VX 4XTUA 3VS5A 4P73C 3P8DA 4YRKA 4H02A 1RIQA 1ADYA 2BZYA 2CZ6B 5DLOA 4OB1B 2ROTA 2QEXT 4BE2A 4E7IA 3G1ZA 1MHNA 1KC8R 1K73R 5LL6S 4CC7A 4OGCA 4FW1A 4M77E 1GXIE 3PVQA 2DJZA 1UJYA 3EGDA 4CS4A 2ODRD 4J9EA 1M90U 2ED0A 1UUEA 3JCMg 3Q1JA 1LOJA 4AG2C 3QNEA 1NPRA 3HFOA 3CBOA 4M7DA 2DBMA 3PIOA 2RHIA 3A74A 3BJUA 2MOXA 4ZGJB 2EVRA 2HZYA 4M77B 4N0AA 4FYWB 1H641 4G84A 4HCKA 2RHQB 2YRCA 4NL3A 3SB2A 3L4GA 4YP0A 1KD1R 3A5YA 2NUTB 2KK4A 4M7DC 2YUNA 2YUOA 3OS2A 2QHSA 3OSSC 3MO8A 3CCEA 2JTMA 4E7SA 4LN2A 4J9DA 1I07A 4MDWA 2XDDA 1W2BS 4GLMA 4ESRA 4N0AC 4CS2A 1NYQA 2L0AA 5A0DA 4J9FA 3X20B 1WHLA 3RL6A 4BWAA 5LJ5j 4YRTA 4TWAA 1N27A 2O31A 1PSEA 2EYQA 4O2DA 2OI3A 3PFSA 1UGRB 2ESWA 1CKAA 2HNIA 4LE9A 2CIMA 4BW9A 2D8HA 2LRQA 2O9SA 1MMDA 1IL2A 1FMKA 4HWSA 2QI2A 2CSQA 4M75E 3OB9A 8AT1B 2Z0WA 4YRCA 4EPCA 3EH2A 2C0TA 1QE0A 1Y07A 2L3SA 1EIYA 1JJ2A 1VQ9Q 4E7HA 1YB3A 4N4IA 3LWHA 1ASZA 3A8LB 3X25B 4P71A 4YPFA 3H8ZA 1OPKA 2R5MA 2M02A 1UEBA 4PLLA 4C92A 2XD0A 4LNSA 1KG1A 5KYWB 5D6XA 2LQ8A 3M4PA 5ELNA 4PG3A 2LTOA 3NTKA 4RCCA 3JCMf 1VQ9T 3OYDA 4BE0A 2LCLA 1QKXA 4RG2A 6AT1B 4CH6A 1PG5B 2GTJA 4P71C 5ECAA 2O88A 2I4MA 5EC7A 5GANh 4TQFA 5DM7R 1FMVA 4OB0B 4F7UA 4C92C 3QWXX 4C0FA 1KQSS 4RDXA 3QBYA 2LC4A 1QLYA 2K3YA 1G5HA 2K4YA 2A8EA 1Y96A 2J3LA 1I1JA 3EG0A 4OB3B 5J39A 2YDLA 3OSVA 4C8QF 3JB9I 4J9CA 2P0QA 3G7ZA 2QTXA 4A4FA 2HDAA 2ZPHB 2MYSA 1VQOT 1M8MA 1RAGB 1UJ0A 1KMNA 3I35A 2DRMA 1KOGA 1VQ4Q 1M1GA 3LWIA 4ZTZB 1ZUKA 1G3WA 2CREA 1ZHIA 3ASKA 2NLUA 4FL6A 1VQKT 4M7AF 3TEHA 2M0YA 1B7YB 2FL7A 2DD5A 4J6WA 2J6KA 4TVAA 4LVMA 1IHWA 2YT6A 2FZCB 3CMAA 3JCMP 2FZGB 2ALYB 1M3CA 1EOVA 4BACA 4LNPA 1EQRA 1NJ2A 1ATIA 2RHSA 5GAMg 1G5VA 2AZSA 4X9DA 3QSUA 3UGQA 4JS5A 3NGPA 2HQEA 3QO5A 5GMKh 2RPNA 1UG1A 2K3BA 5IAYA 5C51B 2EQUA 4AG1C 1BBWA 2AK5A 2ED1A 1M3AA 3MQZA 4AT1B 4WTOB 4YRNA 3JCMQ 3T9NA 2XICA 1Z9ZA 2X9HA 2O9VA 4FCYA 4CS3A 4AMCA 4RG8A 4J6XA 3M56A 3CBMA 3S3MA 1PKTA 1SESA 3H41A 4PK4A 4DBQA 2L8DA 3RKXA 3JCMh 2H3JA 2DZ9A 3MP1A 4XU1A 3TSZA 4FT2A 2V8IA 3CC4Q 3BDLA 1K8AC 1USYA 3IKMB 3CCVQ 1IGQA 2K9GA 4B9WA 3CCQT 1QCFA 2VGMA 2VKNA 2HKNA 4KGZB 3CPWA 2HL3A 1ZSGA 2KI7A 3G4SQ 2HD0A 3OYYA 1TSFA 2CH4A 1VIEA 5D6WA 4TVWA 2DTOA 3CC4T 4LD9K 4XAXB 3CMEQ 2LX7A 2A0FB 3OYIA 5CCAA 4F14A 1QVFS 2ZCEA 3FJ5A 4ZN1A 4HVCA 3DB4A 2CP0A 4M7DF 3CC2A 4EMKA 5KYXB 3G4ST 3FB9A 2LT1A 5I22A 3UFGA 2YLCA 3M4QA 1M3BA 2DU5A 3CCUA 3CXCS 1VQNQ 3UT1A 1VQ6A 3OYAA 1X75C 4FYYB 5GAN3 1D0XA 1YJWT 2WSFE 5GAN7 1GFCA 4LUDA 3M57A 4EIKA 2CP6A 3X28B 1L0WA 3SD4A 4EMKC 1AZEA 1VQ7Q 1IREB 4H2TA 2LJ3A 4E2FB 3I55A 1RLQC 4RTZA 1GL5A 2QA4Q 3BE3A 4JS4A 5GANe 1RADB 3PMIA 4CC3A 4TTVA 4A63B 3L4GB 2KSSA 3GNFB 3JB9H 2J7IA 1YWOA 1RUWA 4LDWA 5DY9A 2NS6A 2DU7A 4XEMA 4DQ2A 4D6WA 5CVIA 1N6AA 2J6OA 2KAFA 2DXUA 2P4RA 4EDUA 1BB9A 1NJ8A 1RI9A 2Y90A 1TOVA 3CCJQ 3LC0A 1UGPB 2JJ9A 4UPAA 4HWRA 3LX7A 1G3YA 3MHXA 3CCRQ 2KGTA 1TUDA 2LJ0A 1C1AA 3NFCA 3THKA 1HJDA 4R0KA 1WXTA 2OTLQ 4AFSC 1UECA 1SF9A 3JCMW 3CCJT 2YUQA 4P3NA 1JJ2P 1LNXA 1ZLMA 2JM9A 3MF2A 2YHTA 1VQMQ 4FT4A 1QVGS 1AD5A 2EIFA 3CCRT 2ZT8A 4K86A 1IHVA 1PHTA 4PJMA 3V8JA 1PCXA 3CC7Q 4KQEA 2O4XA 1M1KR 3QDRB 1Q82C 1OX9A 2EAYA 4PLIA 2X4YA 4J9HA 3SFMA 5HKCA 5CQYA 2OTLT 1QCNA 1QVPA 1JBMA 1K9MC 1W1FA 4H2VA 1VQMT 2X35A 5GMKe 5GAN5 2ZIOA 3ICAA 4Z8AA 5HCKA 2NUTA 4YRFA 1QWFA 3MP8A 5C0MA 3HKSA 3LW5E 1TG0A 4C92B 3RKWA 5GANd 3PMTA 3V8LA 1YIJA 4PJJA 2V26A 3JRZA 4M77C 5GAOn 4R56A 3EHRA 5ELOA 2KT1A 3M59A 2E5KA 1ZA1B 2DBKA 4XEOA 1PC0A 1GCQC 2NUPB 3JCMe 2PNIA 2JVVA 1MNEA 5K1PA 4F7UB 2L5QA 3DKMA 4J7IA 4H2WA 4YRQA 3X26B 5GAMh 1SHGA 1HK9A 1WHHA 2FG0A 1Y96B 4N4HA 2HCKA 4HCZA 4AFQC 2PVGB 2DLPA 2L89A 4X9CA 1ZUYA 4LDXA 4DBHA 2EW3A 2COYA 4OGEA 3VRZA 1X2QA 1RAIB 2CT4A 2Y4XA 3O8VA 1SRLA 2DTIA 3CD6A 1X27A 3WXMB 4R55A 3TEHB 1H4TA 2AHJB 5CQXA 1TUGB 2V8JA 1H3HA 2I4LA 3OMCA 4TVAB 2BE7D 5CKDA 2BIVA 3EFSA 1WYXA 2LQWA 3M9QA 3L2UA 2Q7HA 4M75A 2VXFA 1TXQA 2ZCFB 1W2BP 2RHSB 3RERA 1D1CA 1OV3A 1VQ5Q 3A8MB 3NTHA 1U1SA 1RAEB 1D09B 4XU0A 4CH3A 2RQRA 4KH1B 4YCUA 4ZTFA 2H8HA 1QF6A 1YJ9T 4JRPA 1GCPA 2YUPA 3MCAB 1H4VB 4M75C 2CGHA 1W66A 3JCMd 2LDMA 4H2SA 2HEQA 1ASYA 1VQ5T 3HXUA 1YHQA 2VWFA 4B6MA 1N8RU 1VQLA 3GNGA 4H2XB 4JJNK 4ZTJA 2E5AA 1DJ7B 1PM3A 1B7YA 2ZT5A 1VQ4A 4HXJA 1MV3A 2MCNA 1BIAA 4YCWA 2DF6A 2RJFA 3HY0A 4PHCA 2E70A 5IXFA 4PL6A 1FXXA 1NG2A 3VS3A 4HVWA 4P3OA 1EVKA 1QQJA 5IHKA 1YGBA 2C0OA 3AT1B 4FSXA 2QHTA 1U8RA 4IURA 1TUCA 3JB9G 4KR3A 4XU3A 4L6V5 3HXWA 2HL5C 3A1PA 2A36A 4J6YA 1KQSP 1VYUA 2J6FA 3UA6A 1B8AA 3C95A 4DOVA 1M2VB 1G2BA 3ZBDA 1OPLA 1JJ2S 3P8TA 3A8GB 1WDXA 1LCKA 3C94A 2NWMA 4OF1A 4TVRA 3LSSA 2R5AA 1VQPQ 3A8OB 2KRMA 4KULA 1Q81U 3ZEHA 3M54A 4PJLA 1E1OA 2CJ9A 2PUKB 1YBYA 1D3BB 1N5ZA 4J8OA 4PKCC 2ZR2A 1WHMA 1G8XA 3MPUB 2XK0A 2Q7EA 2QEXQ 4V2SA 1ZQ1A 1UGQB 1VQPT 4QVDA 2PVDB 5GAMe 2DETA 2JUFA 3TUPA 2RQWA 4PJOG 1YI2T 3CCVA 2EBPA 1YFTA 1GGMA 2LT4A 1A0NB 1H4SA 2DTHA 3QJYA 4LDUA 4JJDA 2QQAA 1GBQA 5FWBA 2F2WA 5KYXA 2EGCA 1IB8A 3CMEA 1D1AA 4YRIA 5DLQE 1RLPC 1BI2A 4HWOA 4JJBA 4WI1A 1PSFA 2DXTA 4HCCA 2BZXA 4P3PA 4M77F 2E12A 5FU6B 4ZGEB 2ODRC 2IY5B 2QGFB 2VV5A 2CDTA 3CCMQ 1YJNQ 3QZ9B 2K3XA 3EFRA 3JB9D 3X24B 1VQNA 1Q86C 1PRMC 5GANf 2E3CA 2E65A 3PVLA 4JZ3A 1KJWA 4JRIA 2ZPEB 2BE9B 2O4XB 3GLXA 3HFNA 3HXYA 2VUBA 1B3QA 1B76A 2G3RA 2JM8A 1K8AR 1ZA2B 2CP7A 2KMTA 3L42A 4LVJA 3CCMT 1YJNT 3QWYA 1VQ7A 2BKDN 4FW2A 1KHCA 3BFMA 2QA4A 1ZUUA 2PMFA 5AYFA 1X2KA 4LVIA 5LJ5g 5GAOl 2VYTA 2LCSA 1MMGA 1WU7A 1OULA 2OX7A 4LXCA 2EQIA 4JDSA 4Y28E 2KY9A 3WVDB 1YITA 1M27C 4KH0B 1W4SA 4OB2B 1QVFP 1NYGA 5GAMd 1KQ2A 2EL9A 2ZT6A 1VQ8A 4F17A 2DM1A 2KROA 2RD1A 1B07A 5GAOm 2C06A 2YSQA 1CSKA 3PGGA 4PJOD 2VVKA 3V7SA 4PNOA 3CXCP 2F1LA 2EQMA 1FWZA 1NJIU 3H9NA 3FC3A 3PE0A 2F69A 2X4XA 2VASA 1K9AA 4XTVA 2ZTGA 1YIJT 2EGAA 3I7FA 3CPWS 2HQHA 4DA4A 3VV0A 2C8MA 2PZ1A 3CMQA 2DFUA 2ARTA 5KCHA 3A32A 1KK7A 3TCJA 1WX6A 2QQBA 1SERA 3CC7A 2KT8A 2ZGWA 3OW2A 4EO4A 4X34A 4CC4B 2G6FX 1U5SA 1M90C 2XGTA 1YCSB 3TSWA 2H3EB 3MEWA 4BB7A 3KFUA 1PRLC 1K73U 1KC8U 2DJQA 4M75B 2F2XA 2QTVA 5F5WA 3LH5A 4HVUA 4RTVA 1NYFA 2JN0A 3MJXA 3FJPA 3G71Q 2YXYA 2NUPA 4XTYA 4NCXA 3VS7A 2KQWA 3P8HA 3UDCA 1VQOQ 1S72Q 1KQ1A 1T0HA 2Q5HA 4ME7A 5GMKl 1TH7A 1JXOA 4II1A 3OYHA 5C53B 5CIUA 2DERA 2ZR3A 4GBQA 1NJ6A 2CZ7B 1K1ZA 2D0QB 3ER0A 5LJ3j 2XIDA 3G71T 1VQKQ 2RN8A 2JW4A 1QVGP 1BBZA 3A98A 2OTJT 1Q82R 2P5IA 3A7RA 5KYNA 4TVYA 1S72T 2ZIMA 5GMKm 3FRNA 1UGVA 1S1NA 3LYIA 1K9MR 1KD1U 3URGA 1MV0B 1NLPC 2COZA 3U23A 3EG9B 1T3LA 3VYHB 4Y91A 4MDXA 5KYUB 2C7IA 3CQTA 2JXBA 2CP5A 3E9GA 2QQSA 4HWPA 1B7TA 2BUDA 3VS2A 2KE9A 4NL2A 4BI8B 1JXMA 3CCSA 3I56A 3M4GA 4YRLA 1QCOA 3EGXB 3DLLA 2RO0A 1HC7A 1AVZC 2K7AA 3UPUA 3S3NA 4Z02A 1I8FA 5CK9A 2F5KA 1OZ3A 4M78G 1WJQA 4PJNA 1X2HA 2XU8A 2CP3A 3DB3A 2GGRA 1V1CA 4Z89A 3CCQQ 2QHVA 3QHSA 1QP3A 2CYZB 2M51A 1GFDA 4QKUA 1SEMA 5J3BA 5I2MA 2L3PA 1HD3A 2CUDA 4O6JA 4BUGA 3HY1A 2I4OA 4H2XA 2GFUA 4FSSA 1AWOA 4GLKA 1LPLA 3G6EQ 1RL2A 2K2MA 3O5ZA 2RJEA 3IKLA 1NEBA 1WHKA 2E3IA 2IG0A 4FYVB 2XI9A 2DO3A 2KRSA 2M9UA 2R58A 3CCLQ 2ZZEA 4B9XA 2AIRB 3I5RA 4JPBW 3G6ET 2HQXA 2COWA 3EFOB 2W0ZA 4IUVA 4OP0A 1YJWQ 1G3TA 3GIBA 5GAN6 1USYC 4OMQA 2XDPA 3HP9A 5LJ5h 5FWCA 2FEIA 2EYXA 1SPKA 3UATA 3CCLT 2KYMA 5IHNA 5C6SA 1Q7YR 4IUPA 3OYJA 2DILA 2DNUA 4OVAA 1M2VA 4L5GA 2OJ2A 1FX7A 4ATOA 1VA7A 4XTXA 1VIFA 3OBWA 1D0ZA 2HSEB 3M4YA 2HBWA 4AH6A 3JV3A 2JMCA 4PJOE 3L1AA 1QWEA 3HFVA 2JS2A 1IO6A 2GF7A 1D3BA 2AZVA 2R57A 5M9OA 3PT9A 5GAMf 3A7UA 3OYMA 1OQKA 3M0UA 4M78D 4RQEA 2DE0X 2KEAA 1I4K1 4YCVA 2RH2A 5EG2A 3HFZA 3OYFA 1D1BA 3PNWC 4XK8E 4DPGA 1BU1A 3GOXA 9ATCB 2AMCB 3UWNA 4M77G 2RB6A 4ZGDB 2QEXA 3R6OA 3RGLA 4PJOB 2B8AA 3DLMA 2RQTA 1U1TA 5AT1B 4JLGA 2SEMA 1NM7A 2BTTA 3SWNB 3E9HA 3EH1A 1I81A 1G5IA 3CCEQ 1MMAA 1OOTA 1YNZA 5E3IA 3TREA 3GBQA 1E6HA 3LLRA 3JCMX 3FEOA 2JMAA 3NPFA 4JLIA 2Y4YA 4YROA 3KBGA 2EYWA 2IY5A 2ZNIA 3OQ5A 4KRTA 2QAZA 3CCET 4GY5A 2QHUA 3OW2P 2YLBA 5KE3A 2A7YA 3UA7A 3I9QA 3E9IA 3HTZA 4C92F 3VYGA 5HK0A 4G85A 1Q95G 2RQVA 1R77A 1B70B 5FU6C 2RMOA 2ZPIB 4KT0E 2YWWA 1OU8A 2DEUA 4C0DB 1AOJA 1UE9A 4LVKA 1RI0A 3JCMc 3QO7A 2KNBB 4BDYA 3VS6A 3QO3A 4F7UF 4P72A 3A5ZA 1UHCA 2RHYA 3C12A 2I2LA 3QZ5B 3SEMA 4JJCA 2PU9B 3M0RA 1ZBXA 5GAOr 2K6DA 3HRUA 1K76A 3BY7A 3OYEA 4M77D 2DVEA 2AKWB 1KFZA 1WA7A 2PVOB 4P72C 3A31A 4YREA 1WNLA 2NYSA 1K0XA 4RTUA 4DBRA 5IT9E 1Q86R 5K1XA 1XQHA 3RNJA 4C0GA 2GFAA 4WCIA 2MI6A 2ZPGB 4OMPA 4C5HA 1OU9A 2KDSA 4O5VA 5LJ5e 4QQDA 3REBB 3HXVA 4Q6GA 4UP8A 4L87A 2EYYA 3J81E 3TU4K 1G3SA 4LUEA 4KR2A 3HHTB 1VQ9A 1EFNA 1JJCA 3NETA 1R0BG 2E64A 4J5YA 4RQFA 4IUTA 2LNHB 5CO7A 2CUBA 1KSWA 3INZA 4C8QG 1YJ9Q 1KHIA 2KXDA 2DYIA 2X3XD 3E19A 2AKKA 1NE8A 2GQIA 3CMAQ 2CZ1B 4E47A 1C0AA 3GP8A 3H0HA 2ATCB 4KUIA 3RMSA 4YRRA 4D8DA 2PMEA 1Q7YC 1M5Q1 3NTIA 2FPFA 3BW1A 3OYGA 1I5LA 2HAXA 4E7ZA 1VUBA 1SRYA 3TVTA 5FLXE 4CI0C 4M7AG 1ABOA 2MF2A 3N5BB 1B34A 2KXCA 1IXDA 2MWPA 2KYBA 2RK1A 4FU6A 1M1KU 3CMAT 2PUOB 4VUBA 3IG2A 1UB4A 3EAEA 3CPWP 3OS0A 5A0GA 2P0KA 4XTZA 1VQKA 1H92A 3S6WA 2DL5A 1ARKA 1PKSA 5GJVB 1QKWA 2DL4A 2RF0A 3EG9A 3QYGB 1TWBA 1M90R 3RR6A 2EKHA 3AHUA 3HTRA 5KYUA 4JUVA 2O2OA 4P75A 5LJ5d 2DXBA 2XMFA 4M78E 5I21A 1OZ2A 1MGQA 3RBBB 3HXXA 3OS1A 1LVKA 4K88A 3EGXA 4ORZA 4WF2A 1QMCA 3CPFA 4CH5A 5D6YA 2DZCA 4P75C 1HYOA 3E2UA 3CC2Q 3BDUA 2V8KA 4C8QD 4M78B 4BY6B 3OW2S 2IVWA 3CCUQ 2Q5IA 1BKBA 1M8VA 3P8VA 1VQ6Q 4PFPA 5GANj 4CH4A 3PZCA 3QO8A 3M0TA 3OYKA 1YI2Q 1M9SA 4YRMA 3CCQA 1SG5A 3CC2T 2EPDA 3QIIA 2JOYA 4M7AD 4E7LA 4M7DG 3PCOA 1WHJA 3CCUT 1TS9A 7AT1B 3HFZB 1RABB 4IIOA 1VOMA 4MMLA 3HXZA 3I55Q 1IGUA 4JZ4A 1VQ6T 2E10A 3CC4A 2FZKB 4YRGA 4IUQA 1RAAB 3JCMb 1U3OA 3M55A 2RI3A 4H2UA 5CKEA 1TTHB 2FRWA 3VUBA 2J06A 1O75A 1EVLA 1WQ7A 3G4SA 1SRMA 2LP5A 3EFOA 4BE1A 3L2QA 1N8RC 2AKLA 2DPPB 3I55T 3JCMV 3OYLA 4QQ6A 4YRJA 4QW2A 2QQ9A 2CT3A 1NEGA 2LQNA 3HRIA 1YJWA 1WFWA 1ZBJA 1X69A 3VS4A 2EKOA 3TEGA 3VS0A 3QDFA 2KVQG 5GAN8 5CAIA 2X4JA 4OMFB 3F70A 1Y7XA 3VQVA 2LMJA 2EJGA 1RAFB 3V7RA 1TU0B 2FB7A 5CR2A 3ULRB 4BDZA 1JB0E 1H3ZA 5GMKj 3META 2DL3A 3P8BB 2RM4A 3H0FA 1OI1A 4QVZA 1YCYA 3OS5A 3VS1A 2DL8A 5FW9A 1N9SA 2DAQA 1NBEB 3VJPA 3OA6A 5J26A 2AMCA 3L2ZA 2WSEE 4QQGA 3FDRA 3P8YA 1WXUA 4RTWA 2XHCA 2VXEA 1BBUA 4PJOA 4NOYA 1WLPB 1YWPA 1E22A 1Y0MA 3A5ZB 4KBMB 2MIOA 1X01A 3REXA 3SWNA 1Q81C 4XU2A 1W70A 2CH4W 12ASA 2FYKA 4M7DD 2CZ0B 5D7UA 1YIJQ 2OAWA 4FM4B 4C92G 1UGSB 1PYSA 1N9WA 1JU5C 2V1QA 3CCJA 2JS0A 3FIFA 5CKFA 3TQ7P 4PJOC 5IH2A 3CCRA 1ZX6A 5GAN2 4HT9A 1FYNA 5GAN4 2QXFA 1AT1B 5IHIA 1X6BA 3SWNC 4K11A 1VYTA 3JCMJ 4UP7A 2OTLA 2WACA 1WYDA 2Q7GA 1P92A 3CEYA 4F7UG 2GQVA 3VQWA 2LQKA 4ZN3A 3E1SA 8ATCB 1VQMA 2K5IA 4ELZC 1XTDA 2PTKA 3C0CA 3GF5A 2EYZA 4P5NA 2G4CA 2M0OA 3M58A 1YFRA 1Z7MA 2ZNJA 4M75F 4AFZC 1B70A 3VQYA 1Y57A 4Z88A 4EMHA 4XQ3A 2PQWA 1WIEA 5I11A 1HSQA 3KUFA 2B86A 2K57A 3L2WA 2EJFA 1JJCB 2X51A 3S3OA 2ZT7A 3CD6Q 1VQZA 2DYBA 1AEYA 2CJAA 3JB9J 2D0NA 4ZNXA 3VKIA 4E7JA 5A0LA 3UH0A 2P4TA 2YRDA 4YYEA 4C0DC 5LJ3g 2YRVA
chains in the Genus database with same CATH topology
4P74A 3H6ZA 4CRIA 3CD6T 4UC4A 2AKWA 2K5LA 2ZXFA 5GAOp 2E6NA 2QQRA 1B34B 2LNVA 5LJ5f 4C5GA 1K8AU 2ARUA 4C92D 4MMKA 4MZMA 4P74C 2DEQA 1BYMA 2MAMA 3HL8A 3VQXA 4C8QE 3LGLA 3R07A 2JNGA 3RACA 3C4SA 5FU7B 2CJBA 1NJIC 4NS5A 2WSCE 3MF1A 2XKOC 4M7AE 1X56A 3OYNA 4BD3A 3W3SA 3RIRA 1YHQT 4HT4A 3HRSA 5FRNA 4C8QB 2XDBA 3JAME 1VQLT 2HBPA 3VU3C 4C5IA 1YJ9A 1G51A 1VQ4T 4LVLA 5L8RE 2VC8A 4LDVA 1ADJA 1VQ5A 3QKJA 4M7AB 1SSFA 4A4EA 3TEEA 1WLEA 1KC8C 1K73C 2RJCA 2DIGA 2DDZA 2M1HA 1W2BA 4K87A 2EFIA 5GAMj 3E9FA 4ELYC 1YFSA 4UP9A 5C52B 1M4ZA 4BI4A 1FYFA 2D9TA 5LJ3f 3PCOB 1LYLA 1AHJB 3A7AA 2XTIA 3JB9F 4MZPA 3HRKA 2QDYB 1BIBA 1Y71A 3V8KA 4JRKA 1R8OB 2K2VA 4YTLA 2ZZDA 3RKYA 4E7KA 3NELA 3LSQA 2DQ3A 3REUA 1NJ1A 5GAOq 1KD1C 3QPHA 2ZZGA 1QP2A 5FROA 2LCCA 3QJ6A 4M7DE 5IN1A 1OYXA 4M78A 1Q82U 3CCVT 4YRPA 5KH6A 3OYBA 2MMPA 1K9MU 4EX5A 4C0ZA 2CS7A 1XNIA 4PJOF 1VQPA 3QUIA 1JRIA 3CMET 2E6ZA 1BI1A 1YI2A 3NENA 4M78C 4BY6C 1WQWA 1O9SA 1EIFA 1WJSA 2FVUA 4M7DB 3IALA 2DKGA 1KQSA 1VQNT 3LH0A 2RJDA 2DQ0A 2RI5A 3KXTA 4HKEA 4A4KA 4A53A 4JRQA 3MP6A 1X2GA 1NPPA 1PYSB 2ZPBB 2ZINA 1VQ7T 4RCBA 1XOVA 2I4NA 2QA4T 2P0PA 3VUZA 5HGQA 2P0LA 1EFWA 4IUUA 5LJ3h 5I2SA 4C5EA 2EQKA 2K5FA 5KNNA 1YITT 3J80E 3CCMA 1YJNA 2RI2A 4WJ4A 1WGSA 1N9RA 4N4GA 1VQ8T 2JZ2A 5KCOA 4HCBA 3HRTA 4RKUE 4C92E 3HSBA 3A8HB 5CKBA 2E5QA 3RF1A 1NYRA 5GMKi 3NEMA 2F5TX 3L2RA 4M77A 1EIYB 2DD4A 1KMMA 1BI3A 2RHQA 1Q7YU 4HWTA 4QVCA 4F7UE 4IKFA 4LDYA 1X54A 3OY9A 3CC7T 2D6FA 3OMGA 4M75G 5HK3A 3DSQA 5FRMA 1IZ6A 4ZIBA 2OAUA 3OBYA 2XG8D 2RHZA 4RMFA 2EQJA 4X5OA 1QVFA 2ZPFB 4YRSA 4OLFA 5HY6A 1H4QA 1X55A 3GPLA 4A4HA 3OD1A 1Z7NA 1SETA 4H2YA 2MWOA 2L3RA 3CXCA 2E1HA 2DK3A 1E24A 3LGFA 4L59A 4YDQA 3VBBA 2LVMA 4WJ3M 3MEUA 2EJ9A 4A4GA 3G71A 3MEYA 4Q5WA 2OTJA 1S72A 1VQOA 1HXDA 3JSCA 3MEVA 2DXCA 3J7AF 1HTTA 3WQZA 4FIBA 3CCST 3I56T 2A3LA 4M75D 1WPYA 2JTFA 3ERRA 4A54A 3CBPA 5KE2A 3ZFJA 3QG1A 4EMGA 4J83A 1E1TA 2LX9A 5LJ3e 2J3MA 2VGNA 4C8QA 4M78F 1QVGA 3SDZA 4J15A 1LJOA 4E51A 1BI0A 1X6OA 5FU7C 5A2QE 4HA8A 5GANg 11ASA 1Q86U 1NNHA 1J5WA 2ALYA 2RHXA 2E41A 2O01E 3QTCA 3PTAA 4M7AA 4C8QC 2RHUA 4XTWA 2ARSA 4EMKB 3RUXA 4ZTUB 2CKKA 3OYCA 2ZZFA 3UGTA 3ME9A 2M16A 1M1FA 3QXEB 4HT8A 4LD6A 3M5AA 3L2VA 4KUDK 1QW1A 2RA2A 4M7AC 3G6EA 1V29B 1WJRA 3FLGA 4Q15A 3V7CA 3QYHB 4P73A 5CKHA 1M1KC 4J7FA 1NZ9A 2FHDA 4TQDA 4DOWA 3CCLA 2RK2A 2DIQA 3RMQA 3WVEB 3MEAA 2GCXA 2EWNA 5LJ3d 4BI3A 3M53A 1NJ5A 3PIPA 3RESA 3HPWA 2X4WA 4MZTA 4RMOA 4XTUA 4P73C 3P8DA 4YRKA 4H02A 1RIQA 1ADYA 2CZ6B 5DLOA 4OB1B 2QEXT 4BE2A 4E7IA 3G1ZA 1MHNA 5LL6S 4OGCA 4M77E 1GXIE 2DJZA 4CS4A 2ODRD 1M90U 3JCMg 3Q1JA 1LOJA 3QNEA 1NPRA 3HFOA 3CBOA 4M7DA 3PIOA 2RHIA 3A74A 3BJUA 4ZGJB 4M77B 4N0AA 1H641 4G84A 2RHQB 4NL3A 3SB2A 3L4GA 4YP0A 3A5YA 2KK4A 4M7DC 3OS2A 2QHSA 3OSSC 3MO8A 3CCEA 2JTMA 4MDWA 2XDDA 1W2BS 4N0AC 4CS2A 1NYQA 5A0DA 3X20B 3RL6A 4BWAA 5LJ5j 4YRTA 4TWAA 1N27A 1PSEA 2EYQA 4O2DA 3PFSA 1UGRB 2HNIA 2CIMA 4BW9A 2LRQA 1IL2A 4HWSA 2QI2A 4M75E 3OB9A 4YRCA 4EPCA 1QE0A 1Y07A 1EIYA 1JJ2A 4E7HA 1YB3A 4N4IA 3LWHA 1ASZA 3A8LB 3X25B 4P71A 4YPFA 3H8ZA 2R5MA 1UEBA 4PLLA 4C92A 2XD0A 4LNSA 1KG1A 5D6XA 2LQ8A 3M4PA 5ELNA 4PG3A 2LTOA 3NTKA 4RCCA 3JCMf 1VQ9T 3OYDA 4BE0A 2LCLA 4RG2A 4CH6A 4P71C 2I4MA 5GANh 4TQFA 5DM7R 4OB0B 4F7UA 4C92C 4C0FA 1KQSS 4RDXA 3QBYA 2LC4A 2K3YA 1G5HA 2K4YA 2A8EA 1Y96A 2J3LA 4OB3B 5J39A 3OSVA 4C8QF 3JB9I 2P0QA 3G7ZA 2QTXA 4A4FA 2ZPHB 1VQOT 1KMNA 1KOGA 1M1GA 3LWIA 4ZTZB 1G3WA 1ZHIA 3ASKA 2NLUA 4FL6A 1VQKT 4M7AF 3TEHA 1B7YB 2FL7A 2DD5A 4J6WA 4TVAA 4LVMA 3CMAA 3JCMP 2ALYB 1EOVA 1EQRA 4BACA 1NJ2A 1ATIA 2RHSA 5GAMg 1G5VA 4X9DA 3QSUA 3UGQA 4JS5A 2HQEA 3QO5A 5GMKh 5IAYA 5C51B 2EQUA 1BBWA 3MQZA 4YRNA 3JCMQ 3T9NA 2XICA 4CS3A 4RG8A 4J6XA 3M56A 3CBMA 3S3MA 1SESA 2L8DA 3RKXA 3JCMh 2H3JA 2DZ9A 3MP1A 4XU1A 4FT2A 2V8IA 3BDLA 1K8AC 1USYA 3IKMB 4B9WA 3CCQT 2VGMA 3CPWA 2HD0A 3OYYA 1VIEA 5D6WA 4TVWA 2DTOA 3CC4T 4LD9K 4XAXB 3OYIA 1QVFS 2ZCEA 5CCAA 4ZN1A 4HVCA 3DB4A 4M7DF 3CC2A 4EMKA 3G4ST 3FB9A 2LT1A 3UFGA 2YLCA 3M4QA 2DU5A 3CCUA 3CXCS 3UT1A 1VQ6A 3OYAA 1X75C 5GAN3 1YJWT 2WSFE 5GAN7 3M57A 3X28B 1L0WA 3SD4A 4EMKC 1IREB 4H2TA 3I55A 4JS4A 5GANe 3PMIA 4TTVA 3L4GB 2KSSA 3GNFB 3JB9H 5DY9A 4LDWA 2NS6A 2DU7A 4XEMA 4DQ2A 4D6WA 5CVIA 1N6AA 2KAFA 2DXUA 4EDUA 1NJ8A 2Y90A 3LC0A 1UGPB 4UPAA 4HWRA 3LX7A 1G3YA 3MHXA 3NFCA 3JCMW 3CCJT 4P3NA 1LNXA 3MF2A 2YHTA 4FT4A 1QVGS 2EIFA 3CCRT 2ZT8A 4K86A 3V8JA 4KQEA 2O4XA 3QDRB 1Q82C 2EAYA 4PLIA 2X4YA 3SFMA 5HKCA 5CQYA 2OTLT 1QVPA 1JBMA 1K9MC 4H2VA 1VQMT 2X35A 5GMKe 5GAN5 2ZIOA 3ICAA 4YRFA 3MP8A 5C0MA 3HKSA 3LW5E 4C92B 3RKWA 5GANd 3PMTA 3V8LA 1YIJA 3JRZA 4M77C 5GAOn 4R56A 5ELOA 3M59A 4XEOA 3JCMe 2JVVA 5K1PA 4F7UB 2L5QA 3DKMA 4J7IA 4H2WA 4YRQA 3X26B 5GAMh 1HK9A 1Y96B 4N4HA 4HCZA 2PVGB 2L89A 4X9CA 4LDXA 4OGEA 2Y4XA 3O8VA 2DTIA 3CD6A 3WXMB 4R55A 3TEHB 1H4TA 2AHJB 5CQXA 2V8JA 2I4LA 3OMCA 4TVAB 5CKDA 2BIVA 3EFSA 3M9QA 3L2UA 2Q7HA 4M75A 2VXFA 2ZCFB 2RHSB 3RERA 3A8MB 3NTHA 1U1SA 4XU0A 4CH3A 4YCUA 4ZTFA 1QF6A 1YJ9T 4JRPA 3MCAB 1H4VB 4M75C 2CGHA 1W66A 3JCMd 2LDMA 4H2SA 1ASYA 1VQ5T 3HXUA 1YHQA 1N8RU 1VQLA 3GNGA 4H2XB 4JJNK 4ZTJA 2E5AA 1DJ7B 1B7YA 2ZT5A 1VQ4A 4YCWA 1BIAA 2RJFA 3HY0A 4PHCA 2E70A 4PL6A 1FXXA 4P3OA 1EVKA 1YGBA 4FSXA 2QHTA 1U8RA 4IURA 3JB9G 4KR3A 4XU3A 4L6V5 3HXWA 4J6YA 1B8AA 3C95A 4DOVA 3ZBDA 1JJ2S 3P8TA 3A8GB 3C94A 4OF1A 4TVRA 3LSSA 2R5AA 3A8OB 4KULA 1Q81U 3ZEHA 3M54A 2CJ9A 1E1OA 2PUKB 1YBYA 1D3BB 4J8OA 4PKCC 2ZR2A 2XK0A 2Q7EA 4V2SA 1ZQ1A 1UGQB 1VQPT 4QVDA 2PVDB 5GAMe 2JUFA 3TUPA 4PJOG 1YI2T 3CCVA 1YFTA 1GGMA 2LT4A 1H4SA 2DTHA 3QJYA 4LDUA 2QQAA 3CMEA 4YRIA 5DLQE 1BI2A 4HWOA 4WI1A 1PSFA 2DXTA 4HCCA 4P3PA 4M77F 2E12A 5FU6B 4ZGEB 2ODRC 2IY5B 2VV5A 3QZ9B 2K3XA 3EFRA 3JB9D 3X24B 1VQNA 1Q86C 5GANf 2E3CA 2E65A 4JRIA 2ZPEB 3HFNA 2O4XB 3GLXA 3HXYA 2VUBA 1B76A 2G3RA 2KMTA 3L42A 4LVJA 3CCMT 1YJNT 1VQ7A 2BKDN 1KHCA 3BFMA 2QA4A 2PMFA 5AYFA 4LVIA 5LJ5g 5GAOl 2VYTA 1WU7A 4JDSA 4Y28E 2KY9A 3WVDB 1YITA 1W4SA 4OB2B 5GAMd 1KQ2A 2EL9A 2ZT6A 1VQ8A 2RD1A 5GAOm 2C06A 3PGGA 4PJOD 3V7SA 4PNOA 2EQMA 1FWZA 1NJIU 3FC3A 2F69A 2X4XA 4XTVA 2ZTGA 1YIJT 3I7FA 3CPWS 4DA4A 3VV0A 2C8MA 3CMQA 2ARTA 5KCHA 3A32A 3TCJA 2QQBA 1SERA 3CC7A 2ZGWA 3OW2A 4EO4A 4X34A 1M90C 2XGTA 3MEWA 4BB7A 3KFUA 1KC8U 1K73U 4M75B 5F5WA 2JN0A 3FJPA 4XTYA 4NCXA 2KQWA 3P8HA 3UDCA 1KQ1A 2Q5HA 4ME7A 5GMKl 1TH7A 4II1A 3OYHA 5C53B 5CIUA 2ZR3A 1NJ6A 2CZ7B 2D0QB 3ER0A 5LJ3j 2XIDA 3G71T 2OTJT 2P5IA 3A7RA 4TVYA 1S72T 2ZIMA 5GMKm 3FRNA 3LYIA 1KD1U 3URGA 3VYHB 4Y91A 4MDXA 2C7IA 3E9GA 2QQSA 4HWPA 2BUDA 4NL2A 4BI8B 3CCSA 3I56A 3M4GA 4YRLA 3DLLA 2RO0A 1HC7A 3UPUA 3S3NA 4Z02A 1I8FA 5CK9A 2F5KA 1OZ3A 4M78G 1WJQA 1X2HA 2XU8A 3DB3A 2QHVA 3QHSA 1QP3A 2CYZB 5J3BA 5I2MA 4O6JA 4BUGA 3HY1A 2I4OA 4H2XA 2GFUA 4GLKA 1RL2A 2RJEA 3IKLA 2IG0A 2XI9A 2DO3A 2M9UA 2R58A 2ZZEA 4B9XA 3G6ET 2HQXA 4IUVA 4OP0A 1USYC 3GIBA 1G3TA 5GAN6 2XDPA 3HP9A 5LJ5h 3CCLT 5C6SA 4IUPA 3OYJA 4OVAA 4L5GA 4ATOA 1FX7A 4XTXA 1VIFA 3OBWA 3M4YA 4AH6A 4PJOE 3L1AA 3HFVA 2GF7A 1D3BA 2R57A 5M9OA 3PT9A 5GAMf 3A7UA 3OYMA 4M78D 4RQEA 1I4K1 4YCVA 2RH2A 5EG2A 3HFZA 3OYFA 3PNWC 4XK8E 4DPGA 3GOXA 2AMCB 3UWNA 4M77G 2RB6A 4ZGDB 2QEXA 3R6OA 3RGLA 4PJOB 2B8AA 3DLMA 1U1TA 4JLGA 3E9HA 3SWNB 1I81A 1G5IA 5E3IA 3TREA 3LLRA 3JCMX 3FEOA 4JLIA 2Y4YA 4YROA 3KBGA 2ZNIA 2IY5A 3OQ5A 3CCET 4GY5A 2QHUA 2YLBA 5KE3A 2A7YA 3E9IA 3HTZA 4C92F 3VYGA 5HK0A 4G85A 1B70B 5FU6C 2ZPIB 4KT0E 4C0DB 4LVKA 1RI0A 3JCMc 3QO7A 4BDYA 4F7UF 3QO3A 4P72A 3A5ZA 2RHYA 3C12A 2I2LA 3QZ5B 2PU9B 1ZBXA 5GAOr 3HRUA 3BY7A 3OYEA 4M77D 2DVEA 2AKWB 2PVOB 4P72C 3A31A 4YREA 1WNLA 5IT9E 5K1XA 1XQHA 4C0GA 2GFAA 2MI6A 2ZPGB 4C5HA 2KDSA 4O5VA 5LJ5e 4QQDA 3HXVA 4Q6GA 4UP8A 4L87A 3J81E 3TU4K 1G3SA 4KR2A 3HHTB 1VQ9A 1JJCA 3NETA 4J5YA 2E64A 4RQFA 4IUTA 5CO7A 3INZA 4C8QG 1KHIA 3E19A 1NE8A 2CZ1B 4E47A 1C0AA 3GP8A 4KUIA 3RMSA 4YRRA 2PMEA 1Q7YC 1M5Q1 3NTIA 3BW1A 3OYGA 1I5LA 2HAXA 1SRYA 1VUBA 5FLXE 4CI0C 4M7AG 2MF2A 3N5BB 1B34A 2MWPA 2RK1A 4FU6A 1M1KU 3CMAT 2PUOB 4VUBA 3IG2A 1UB4A 3EAEA 3OS0A 5A0GA 2P0KA 4XTZA 1VQKA 3S6WA 3QYGB 3AHUA 4JUVA 4P75A 5LJ5d 2DXBA 4M78E 5I21A 1OZ2A 1MGQA 3HXXA 3OS1A 4K88A 4WF2A 3CPFA 4CH5A 5D6YA 2DZCA 4P75C 3BDUA 2V8KA 4C8QD 4M78B 4BY6B 3OW2S 2IVWA 2Q5IA 1BKBA 1M8VA 3P8VA 5GANj 4CH4A 3PZCA 3QO8A 3OYKA 1M9SA 4YRMA 3CCQA 3CC2T 3QIIA 2JOYA 4M7AD 4E7LA 4M7DG 3PCOA 3CCUT 3HFZB 4MMLA 3HXZA 1VQ6T 2E10A 3CC4A 4YRGA 4IUQA 3JCMb 3M55A 2RI3A 4H2UA 5CKEA 3VUBA 1O75A 1EVLA 1WQ7A 3G4SA 4BE1A 3L2QA 1N8RC 2DPPB 3I55T 3JCMV 3OYLA 4QQ6A 4YRJA 4QW2A 2QQ9A 3HRIA 1YJWA 2EKOA 3TEGA 5GAN8 2KVQG 5CAIA 2X4JA 4OMFB 3F70A 1Y7XA 3VQVA 2EJGA 3V7RA 2FB7A 5CR2A 4BDZA 1JB0E 1H3ZA 5GMKj 3META 3P8BB 2RM4A 1OI1A 4QVZA 1YCYA 3OS5A 1N9SA 2DAQA 3VJPA 3OA6A 5J26A 2AMCA 3L2ZA 2WSEE 4QQGA 3FDRA 3P8YA 2XHCA 2VXEA 1BBUA 4PJOA 4NOYA 1E22A 3A5ZB 4KBMB 1X01A 3REXA 3SWNA 1Q81C 4XU2A 12ASA 2FYKA 4M7DD 2CZ0B 4FM4B 4C92G 1UGSB 1PYSA 1N9WA 3CCJA 3FIFA 5CKFA 4PJOC 3CCRA 5GAN2 4HT9A 5GAN4 2QXFA 3SWNC 3JCMJ 4UP7A 2OTLA 2WACA 1WYDA 2Q7GA 1P92A 3CEYA 4F7UG 2GQVA 3VQWA 2LQKA 4ZN3A 3E1SA 1VQMA 2K5IA 4ELZC 1XTDA 3GF5A 4P5NA 2G4CA 1Z7MA 2M0OA 1YFRA 2ZNJA 3M58A 4M75F 1B70A 3VQYA 4EMHA 4XQ3A 2PQWA 3KUFA 2K57A 3L2WA 2EJFA 1JJCB 3S3OA 2ZT7A 1VQZA 2CJAA 3JB9J 3VKIA 4E7JA 5A0LA 3UH0A 2P4TA 4YYEA 4C0DC 5LJ3g 2YRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9C A;  4P74 A;  4XTX A;  4TQD A;  4AH6 A;  2AKW A;  2ZXF A;  5GAO p;  4PJO E;  3L1A A;  3HFV A;  5LJ3 d;  2EWN A;  1NJ5 A;  1B34 B;  3RES A;  2DTI A;  1D3B A;  3TEH B;  1H4T A;  4XTU A;  4P73 C;  5GAM f;  5LJ5 f;  3A7U A;  4YRK A;  4H02 A;  1RIQ A;  2ARU A;  1ADY A;  4C92 D;  4M78 D;  4RQE A;  2I4L A;  4MMK A;  4P74 C;  4TVA B;  1I4K 1;  2DEQ A;  4YCV A;  3VQX A;  3HFZ A;  3G1Z A;  3EFS A;  4C8Q E;  3R07 A;  4DPG A;  2Q7H A;  4M75 A;  2AMC B;  2VXF A;  4M77 E;  2RHS B;  3RER A;  2DJZ A;  3RAC A;  4M77 G;  2RB6 A;  4CS4 A;  3RGL A;  4PJO B;  2ODR D;  1U1T A;  2CJB A;  1U1S A;  3JCM g;  3E9H A;  3SWN B;  4XU0 A;  1LOJ A;  4CH3 A;  1I81 A;  3QNE A;  1G5I A;  3MF1 A;  4YCU A;  3HFO A;  4M7D A;  1QF6 A;  4M7A E;  1X56 A;  5E3I A;  3W3S A;  3RIR A;  1H4V B;  4M75 C;  2CGH A;  1W66 A;  3JCM X;  3JCM d;  3A74 A;  4C8Q B;  3BJU A;  4H2S A;  4JLI A;  1ASY A;  4YRO A;  4M77 B;  4N0A A;  3VU3 C;  1G51 A;  3HXU A;  2IY5 A;  1H64 1;  2ZNI A;  4G84 A;  2RHQ B;  4NL3 A;  2QHU A;  3SB2 A;  3L4G A;  1ADJ A;  2VC8 A;  2YLB A;  3A5Y A;  4H2X B;  4YP0 A;  2E5A A;  4M7D C;  3E9I A;  3HTZ A;  4C92 F;  2QHS A;  4M7A B;  1B7Y A;  2ZT5 A;  4YCW A;  1BIA A;  4G85 A;  3HY0 A;  1WLE A;  4PHC A;  4N0A C;  1B70 B;  4CS2 A;  1NYQ A;  4P3O A;  2DDZ A;  1EVK A;  4K87 A;  3RL6 A;  4BWA A;  1YGB A;  3JCM c;  5LJ5 j;  5GAM j;  4TWA A;  4YRT A;  3QO7 A;  1YFS A;  4UP9 A;  2QHT A;  5C52 B;  1FYF A;  4F7U F;  3QO3 A;  3JB9 G;  4KR3 A;  5LJ3 f;  4XU3 A;  3PCO B;  4P72 A;  4O2D A;  1LYL A;  3A5Z A;  3A7A A;  2XTI A;  3JB9 F;  2HNI A;  2I2L A;  3HXW A;  3HRK A;  2CIM A;  4BW9 A;  1BIB A;  3V8K A;  1IL2 A;  4JRK A;  4J6Y A;  1B8A A;  4HWS A;  3RKY A;  3P8T A;  5GAO r;  4M75 E;  4YRC A;  3LSS A;  3BY7 A;  1QE0 A;  3NEL A;  4M77 D;  2DVE A;  2AKW B;  1EIY A;  3LSQ A;  4P72 C;  2DQ3 A;  3REU A;  1NJ1 A;  5GAO q;  3A31 A;  4YRE A;  1WNL A;  2ZZG A;  1YB3 A;  1ASZ A;  1E1O A;  2CJ9 A;  4P71 A;  1D3B B;  4YPF A;  5K1X A;  2ZR2 A;  4M7D E;  4C92 A;  4LNS A;  4M78 A;  5ELN A;  3M4P A;  2Q7E A;  4PG3 A;  4V2S A;  4RCC A;  4YRP A;  4QVD A;  3JCM f;  5GAM e;  5LJ5 e;  4EX5 A;  3TUP A;  3HXV A;  4PJO G;  4Q6G A;  4UP8 A;  4L87 A;  4CH6 A;  1YFT A;  1GGM A;  4PJO F;  4KR2 A;  4P71 C;  3QUI A;  2I4M A;  1JRI A;  5GAN h;  1H4S A;  4TQF A;  2DTH A;  1JJC A;  4F7U A;  3NET A;  4J5Y A;  2E64 A;  3NEN A;  4C92 C;  4RQF A;  4M78 C;  4RDX A;  1WQW A;  4M7D B;  3IAL A;  1G5H A;  3INZ A;  4C8Q G;  1Y96 A;  2J3L A;  4YRI A;  2DKG A;  4HWO A;  4WI1 A;  4C8Q F;  2DXT A;  3JB9 I;  4P3P A;  4M77 F;  2DQ0 A;  1C0A A;  2QTX A;  2ODR C;  2IY5 B;  4YRR A;  2PME A;  4A53 A;  1M5Q 1;  3EFR A;  1KMN A;  3JB9 D;  1X2G A;  1KOG A;  3BW1 A;  1I5L A;  1SRY A;  1PYS B;  4ZTZ B;  5GAN f;  2E3C A;  2E65 A;  4M7A G;  1B34 A;  4JRI A;  2ZIN A;  3HFN A;  3HXY A;  4M7A F;  3TEH A;  1B76 A;  4RCB A;  1B7Y B;  2I4N A;  4J6W A;  3IG2 A;  5HGQ A;  2P0L A;  4TVA A;  4XTZ A;  1EFW A;  5LJ3 h;  3JCM P;  5KNN A;  3BFM A;  2ALY B;  1EOV A;  1EQR A;  1NJ2 A;  2PMF A;  1ATI A;  2RHS A;  5LJ5 g;  5GAM g;  5GAO l;  1N9R A;  4WJ4 A;  4X9D A;  3QSU A;  1WU7 A;  3UGQ A;  3AHU A;  4JUV A;  3QO5 A;  5GMK h;  4P75 A;  5LJ5 d;  5GAM d;  1KQ2 A;  2EL9 A;  2ZT6 A;  4C92 E;  4M78 E;  3HSB A;  5I21 A;  5C51 B;  2RD1 A;  1BBW A;  3RF1 A;  1NYR A;  5GAO m;  5GMK i;  1MGQ A;  3NEM A;  4YRN A;  3JCM Q;  3PGG A;  4PJO D;  3HXX A;  3V7S A;  4PNO A;  4M77 A;  4CS3 A;  1EIY B;  4K88 A;  4J6X A;  4WF2 A;  1KMM A;  4CH5 A;  2RHQ A;  2DZC A;  1SES A;  4HWT A;  4QVC A;  4P75 C;  4F7U E;  4XTV A;  2ZTG A;  3RKX A;  3JCM h;  3I7F A;  2DZ9 A;  4XU1 A;  1X54 A;  3BDU A;  4C8Q D;  1USY A;  3IKM B;  4M78 B;  2C8M A;  4M75 G;  3DSQ A;  3CMQ A;  2Q5I A;  1M8V A;  2ART A;  3A32 A;  3P8V A;  1SER A;  5GAN j;  4CH4 A;  3PZC A;  3QO8 A;  2ZGW A;  4EO4 A;  4YRM A;  4ZIB A;  4TVW A;  2DTO A;  2ZCE A;  2XGT A;  4M7A D;  4M7D G;  3PCO A;  4RMF A;  4HVC A;  3HFZ B;  4X5O A;  4MML A;  3HXZ A;  3KFU A;  4M7D F;  4M75 B;  2E10 A;  4EMK A;  3FB9 A;  4YRS A;  5F5W A;  3UFG A;  4YRG A;  2YLC A;  2JN0 A;  4OLF A;  3JCM b;  3M4Q A;  1H4Q A;  1X55 A;  2DU5 A;  4H2U A;  3FJP A;  3OD1 A;  4XTY A;  1Z7N A;  1SET A;  4H2Y A;  1EVL A;  1WQ7 A;  4NCX A;  5GAN 3;  2E1H A;  1KQ1 A;  5GAN 7;  3JCM V;  2Q5H A;  5GMK l;  1TH7 A;  1E24 A;  4YRJ A;  1L0W A;  4YDQ A;  5C53 B;  4EMK C;  3VBB A;  3HRI A;  2ZR3 A;  1NJ6 A;  5LJ3 j;  4H2T A;  4WJ3 M;  2P5I A;  3TEG A;  3A7R A;  2EJ9 A;  4TVY A;  5GAN e;  5GAN 8;  5CAI A;  2ZIM A;  3VQV A;  3MEY A;  5GMK m;  2EJG A;  4TTV A;  3L4G B;  3JB9 H;  3V7R A;  5DY9 A;  2FB7 A;  2DU7 A;  4XEM A;  4DQ2 A;  5GMK j;  1HXD A;  2RM4 A;  2DXU A;  4Y91 A;  1YCY A;  1NJ8 A;  2C7I A;  2Y90 A;  1HTT A;  1N9S A;  3WQZ A;  3LC0 A;  4UPA A;  4M75 D;  2AMC A;  4HWR A;  1WPY A;  3L2Z A;  4HWP A;  3P8Y A;  3ERR A;  4NL2 A;  2VXE A;  1BBU A;  4A54 A;  4NOY A;  4PJO A;  1E22 A;  1X01 A;  3REX A;  3M4G A;  4YRL A;  3SWN A;  4EMG A;  3JCM W;  4XU2 A;  1HC7 A;  4P3N A;  1E1T A;  1LNX A;  12AS A;  3MF2 A;  2YHT A;  1I8F A;  2FYK A;  5LJ3 e;  4M7D D;  4C92 G;  1PYS A;  4M78 G;  2J3M A;  1N9W A;  2ZT8 A;  4K86 A;  3V8J A;  1X2H A;  4KQE A;  4C8Q A;  4M78 F;  3FIF A;  2EAY A;  2QHV A;  4J15 A;  1LJO A;  3QHS A;  4E51 A;  4PJO C;  1JBM A;  5GAN 2;  4HT9 A;  5GAN 4;  4HA8 A;  4H2V A;  3SWN C;  5GAN g;  11AS A;  5GMK e;  5GAN 5;  3HY1 A;  3JCM J;  2ZIO A;  3ICA A;  2I4O A;  4H2X A;  4UP7 A;  1NNH A;  1J5W A;  2ALY A;  4YRF A;  1WYD A;  2Q7G A;  2E41 A;  3VQW A;  4F7U G;  3QTC A;  4C92 B;  3RKW A;  4M7A A;  5GAN d;  3V8L A;  4C8Q C;  3IKL A;  2G4C A;  5GAO n;  4M77 C;  1YFR A;  4XTW A;  1Z7M A;  4M75 F;  2ARS A;  2ZNJ A;  1B70 A;  4EMK B;  3RUX A;  5ELO A;  3VQY A;  4ZTU B;  4EMH A;  4XQ3 A;  2ZZE A;  2ZZF A;  4XEO A;  3UGT A;  3JCM e;  2K57 A;  5K1P A;  2EJF A;  1JJC B;  4F7U B;  4OP0 A;  4HT8 A;  3GIB A;  5GAN 6;  1USY C;  2ZT7 A;  4H2W A;  2RA2 A;  4M7A C;  1VQZ A;  4YRQ A;  5LJ5 h;  5GAM h;  1HK9 A;  3JB9 J;  2CJA A;  4Q15 A;  1Y96 B;  3V7C A;  4P73 A;  3UH0 A;  4YYE A;  5LJ3 g; 
#chains in the Genus database with same CATH topology
 4P74 A;  3SHW A;  3H6Z A;  2OTJ Q;  3I5S A;  4CRI A;  3CD6 T;  4UC4 A;  2AKW A;  2K5L A;  2ZXF A;  5GAO p;  2E6N A;  4PFZ A;  5KYY A;  1ZSZ B;  2QQR A;  1SHF A;  1B34 B;  2LNV A;  5LJ5 f;  4C5G A;  1K8A U;  2ARU A;  1EX4 A;  4C92 D;  4J9G A;  4MMK A;  4MZM A;  4P74 C;  2DEQ A;  1BYM A;  2MAM A;  3HL8 A;  4CC2 A;  3VQX A;  4C8Q E;  3LGL A;  3R07 A;  3EGU A;  1YHQ Q;  2JNG A;  3RAC A;  1VQL Q;  2JT4 A;  1M30 A;  3C4S A;  1R0C B;  5FU7 B;  1NJI C;  2CJB A;  1T0J A;  2EGE A;  4NS5 A;  2WSC E;  3MF1 A;  4RUG A;  2XKO C;  4M7A E;  1X56 A;  3OYN A;  4BD3 A;  3W3S A;  3RIR A;  1YHQ T;  4HT4 A;  1ABQ A;  3HRS A;  5FRN A;  4C8Q B;  2XDB A;  3JAM E;  1VQL T;  2HBP A;  2DX1 A;  3VU3 C;  4C5I A;  1YJ9 A;  1G51 A;  1SKU B;  2QAS A;  2DMO A;  1VQ4 T;  4LVL A;  5L8R E;  2VC8 A;  3H0I A;  4LDV A;  1VQ5 A;  1ADJ A;  3EG1 A;  2D1X A;  3QKJ A;  2RNA A;  2D8J A;  1PD1 A;  4M7A B;  1UHF A;  1SSF A;  1UTI A;  1SSH A;  4A4E A;  3TEE A;  2FRY A;  1WLE A;  1KC8 C;  2V1R A;  1K73 C;  2RJC A;  2DIG A;  2QGG A;  2DDZ A;  2M1H A;  1W2B A;  4K87 A;  1GBR A;  2EFI A;  5GAM j;  3E9F A;  4ELY C;  1YFS A;  4UP9 A;  5C52 B;  1M4Z A;  4BI4 A;  1FYF A;  2D9T A;  4OML A;  3VRY A;  5LJ3 f;  3PCO B;  1LYL A;  1AHJ B;  3A7A A;  2XTI A;  3JB9 F;  3MKD A;  4MZP A;  3HRK A;  2QDY B;  1I0C A;  4AFU C;  1BIB A;  1Y71 A;  2LZ6 B;  3V8K A;  4JRK A;  1R8O B;  1BCM A;  2K2V A;  4YTL A;  2LJ1 A;  2ZZD A;  1K4U S;  3RKY A;  2BZ8 A;  2VB6 A;  5GJW B;  1UFF A;  4E7K A;  3NEL A;  2GNC A;  4QT7 A;  3LSQ A;  2DQ3 A;  3REU A;  1NJ1 A;  5GAO q;  1JEG A;  1KD1 C;  1WZO A;  3QPH A;  2ZZG A;  1QP2 A;  1EZZ B;  5FRO A;  1K0S A;  2LCC A;  2ZAE A;  3QJ6 A;  4M7D E;  5IN1 A;  1I5O B;  1OYX A;  4M78 A;  1Q82 U;  3CCV T;  1GRI A;  4KGV B;  4YRP A;  5KH6 A;  3OYB A;  1X43 A;  4RTY A;  2MMP A;  2ROL A;  1K9M U;  4EX5 A;  4C0Z A;  2CS7 A;  2K79 A;  1XNI A;  2E3H A;  2MK5 A;  1G83 A;  3EGD B;  4PJO F;  1VQP A;  3QUI A;  1JRI A;  3CME T;  3M0Q A;  2QK0 A;  2E6Z A;  1BI1 A;  1YI2 A;  3NEN A;  1JO8 A;  4M78 C;  4BY6 C;  1WQW A;  1O9S A;  1EIF A;  1WJS A;  2FVU A;  4M7D B;  3R6N A;  1MUZ A;  3IAL A;  3IQL A;  2DKG A;  1KQS A;  1BK2 A;  2DA9 A;  1ACM B;  1VQN T;  3LH0 A;  2RJD A;  2GBQ A;  2DQ0 A;  2RI5 A;  3ZL7 C;  1MND A;  3KXT A;  4HKE A;  4A4K A;  4A53 A;  1T3S A;  4JRQ A;  3MP6 A;  1X2G A;  1NPP A;  3KFV A;  1PYS B;  1PWT A;  1YFN A;  2ZPB B;  2IPO B;  1YIT Q;  2KR3 A;  1VQ7 T;  2ZIN A;  4RCB A;  1E7O A;  1VQ8 Q;  1XOV A;  2GTO A;  2I4N A;  4DEX A;  3EG2 A;  2QA4 T;  2P0P A;  4OMN A;  3VUZ A;  5HGQ A;  2P0L A;  1EFW A;  1RAH B;  4IUU A;  5LJ3 h;  5I2S A;  4C5E A;  2P84 A;  2ENM A;  2EQK A;  2K5F A;  1V76 A;  5KNN A;  1YIT T;  3J80 E;  3CCM A;  1YJN A;  2RI2 A;  4WJ4 A;  1WGS A;  1N9R A;  4N4G A;  1VQ8 T;  1Z9Q A;  2JZ2 A;  5KCO A;  4DEY A;  4OMO A;  4HCB A;  1AWX A;  2QG9 B;  3HRT A;  4RKU E;  4C92 E;  3HSB A;  3A8H B;  5CKB A;  4KGX B;  3M0S A;  2E5Q A;  3RF1 A;  1NYR A;  2CP2 A;  5GMK i;  3NEM A;  1RAC B;  4PFO A;  2ABL A;  2F5T X;  3L2R A;  4M77 A;  2NUZ A;  1EIY B;  2L2P A;  2CSI A;  2DD4 A;  1KMM A;  1N8R R;  1BI3 A;  2RHQ A;  1Q7Y U;  4HWT A;  4QVC A;  1GCQ A;  1X6G A;  4F7U E;  2I0N A;  4IKF A;  4LDY A;  4M4Z A;  1X54 A;  3REA B;  3OY9 A;  3CC7 T;  2KRN A;  2D6F A;  3OMG A;  4M75 G;  5HK3 A;  3DSQ A;  5FRM A;  2HMA A;  1YN8 A;  5KYY B;  2RQU A;  1IZ6 A;  2FPE A;  4ZIB A;  2OAU A;  2E4H A;  3OBY A;  1BCO A;  2JTE A;  2XG8 D;  1U06 A;  2RHZ A;  2KBT A;  4IIM A;  4RMF A;  2EQJ A;  3UF4 A;  4X5O A;  1QVF A;  2ZPF B;  4YRS A;  1J3T A;  4OLF A;  5HY6 A;  1H4Q A;  1X55 A;  3GPL A;  4A4H A;  1MMN A;  1IRX A;  3OD1 A;  1AWW A;  1Z7N A;  1SET A;  4H2Y A;  1WI7 A;  2L3R A;  1M2O A;  2J05 A;  2MWO A;  5IXB A;  3CXC A;  2HKQ B;  2E1H A;  2SRC A;  2DK3 A;  1Q81 R;  1E24 A;  3LGF A;  4OMM A;  4L59 A;  4YDQ A;  2L3Q A;  3VBB A;  2LVM A;  2QDL A;  4WJ3 M;  1WHG A;  3MEU A;  3M0P A;  3NMZ C;  2EJ9 A;  4F16 A;  5KYW A;  1JQQ A;  4A4G A;  3G71 A;  3MEY A;  1PD0 A;  2DVJ A;  2FPD A;  4Q5W A;  4D8K A;  3CCS Q;  3I56 Q;  1ZSZ A;  2OTJ A;  2X3W D;  1S72 A;  1VQO A;  1HXD A;  2W10 A;  3JSC A;  3NHN A;  3MEV A;  2A37 A;  2DRK A;  3EHQ A;  2DXC A;  3J7A F;  1HTT A;  4RTT A;  4FIB A;  3WQZ A;  3CCS T;  2FO0 A;  2A3L A;  3I56 T;  4M75 D;  1NLO C;  1F1B B;  1WPY A;  2JTF A;  1ZSZ C;  3ERR A;  2DL7 A;  2QYZ A;  4A54 A;  3CBP A;  5KE2 A;  3G1J A;  3ZFJ A;  1UDL A;  3QG1 A;  4EMG A;  4J83 A;  4J9B A;  1E1T A;  2LX9 A;  5LJ3 e;  2F2V A;  1WXB A;  2J3M A;  2VGN A;  4ANJ A;  2HSP A;  4RTX A;  4C8Q A;  4M78 F;  1QVG A;  3SDZ A;  4J15 A;  1LJO A;  4DBF A;  4E51 A;  1BI0 A;  1OEB A;  2IIM A;  1X6O A;  5FU7 C;  4E6R A;  5A2Q E;  2ECZ A;  4HA8 A;  1AZG B;  5GAN g;  11AS A;  1OX8 A;  1Q86 U;  1NNH A;  1C0M A;  1J5W A;  2ALY A;  2RHX A;  2E41 A;  1XJW B;  2O01 E;  4X1V A;  3QTC A;  3PTA A;  1W6X A;  4M7A A;  4C8Q C;  2RHU A;  4XTW A;  2ARS A;  4EMK B;  3RUX A;  2A28 A;  3EG3 A;  4ZTU B;  2CKK A;  1E6G A;  3OYC A;  2ZZF A;  3UGT A;  3ME9 A;  2M16 A;  1M1F A;  3QXE B;  1AWJ A;  4LD6 A;  2AT1 B;  3M5A A;  4HT8 A;  1VYV A;  2MPX C;  1QW1 A;  2RA2 A;  3L2V A;  1NJI R;  4KUD K;  4M7A C;  1KIK A;  2A08 A;  4HVV A;  3G6E A;  1PNJ A;  1V29 B;  1WJR A;  3FLG A;  4Q15 A;  1YP5 A;  3V7C A;  3QYH B;  1D0Y A;  4P73 A;  4J9I A;  5CKH A;  1H8K A;  1M1K C;  4J7F A;  1NZ9 A;  2FHD A;  4TQD A;  4Y92 A;  4DOW A;  3CCL A;  2RK2 A;  2DIQ A;  3RMQ A;  2C0I A;  3WVE B;  3MEA A;  4FYX B;  3D7S B;  2GCX A;  2EWN A;  5LJ3 d;  3RDV A;  3M53 A;  1FMW A;  1CKB A;  4BI3 A;  4F04 B;  1NJ5 A;  3PIP A;  3RES A;  3HPW A;  2X4W A;  4MZT A;  5L23 A;  4RMO A;  1C6V X;  4XTU A;  3VS5 A;  4P73 C;  3P8D A;  4YRK A;  4H02 A;  1RIQ A;  1ADY A;  2BZY A;  2CZ6 B;  5DLO A;  4OB1 B;  2ROT A;  2QEX T;  4BE2 A;  4E7I A;  3G1Z A;  1MHN A;  1KC8 R;  1K73 R;  5LL6 S;  4CC7 A;  4OGC A;  4FW1 A;  4M77 E;  1GXI E;  3PVQ A;  2DJZ A;  1UJY A;  3EGD A;  4CS4 A;  2ODR D;  4J9E A;  1M90 U;  2ED0 A;  1UUE A;  3JCM g;  3Q1J A;  1LOJ A;  4AG2 C;  3QNE A;  1NPR A;  3HFO A;  3CBO A;  4M7D A;  2DBM A;  3PIO A;  2RHI A;  3A74 A;  3BJU A;  2MOX A;  4ZGJ B;  2EVR A;  2HZY A;  4M77 B;  4N0A A;  4FYW B;  1H64 1;  4G84 A;  4HCK A;  2RHQ B;  2YRC A;  4NL3 A;  3SB2 A;  3L4G A;  4YP0 A;  1KD1 R;  3A5Y A;  2NUT B;  2KK4 A;  4M7D C;  2YUN A;  2YUO A;  3OS2 A;  2QHS A;  3OSS C;  3MO8 A;  3CCE A;  2JTM A;  4E7S A;  4LN2 A;  4J9D A;  1I07 A;  4MDW A;  2XDD A;  1W2B S;  4GLM A;  4ESR A;  4N0A C;  4CS2 A;  1NYQ A;  2L0A A;  5A0D A;  4J9F A;  3X20 B;  1WHL A;  3RL6 A;  4BWA A;  5LJ5 j;  4YRT A;  4TWA A;  1N27 A;  2O31 A;  1PSE A;  2EYQ A;  4O2D A;  2OI3 A;  3PFS A;  1UGR B;  2ESW A;  1CKA A;  2HNI A;  4LE9 A;  2CIM A;  4BW9 A;  2D8H A;  2LRQ A;  2O9S A;  1MMD A;  1IL2 A;  1FMK A;  4HWS A;  2QI2 A;  2CSQ A;  4M75 E;  3OB9 A;  8AT1 B;  2Z0W A;  4YRC A;  4EPC A;  3EH2 A;  2C0T A;  1QE0 A;  1Y07 A;  2L3S A;  1EIY A;  1JJ2 A;  1VQ9 Q;  4E7H A;  1YB3 A;  4N4I A;  3LWH A;  1ASZ A;  3A8L B;  3X25 B;  4P71 A;  4YPF A;  3H8Z A;  1OPK A;  2R5M A;  2M02 A;  1UEB A;  4PLL A;  4C92 A;  2XD0 A;  4LNS A;  1KG1 A;  5KYW B;  5D6X A;  2LQ8 A;  3M4P A;  5ELN A;  4PG3 A;  2LTO A;  3NTK A;  4RCC A;  3JCM f;  1VQ9 T;  3OYD A;  4BE0 A;  2LCL A;  1QKX A;  4RG2 A;  6AT1 B;  4CH6 A;  1PG5 B;  2GTJ A;  4P71 C;  5ECA A;  2O88 A;  2I4M A;  5EC7 A;  5GAN h;  4TQF A;  5DM7 R;  1FMV A;  4OB0 B;  4F7U A;  4C92 C;  3QWX X;  4C0F A;  1KQS S;  4RDX A;  3QBY A;  2LC4 A;  1QLY A;  2K3Y A;  1G5H A;  2K4Y A;  2A8E A;  1Y96 A;  2J3L A;  1I1J A;  3EG0 A;  4OB3 B;  5J39 A;  2YDL A;  3OSV A;  4C8Q F;  3JB9 I;  4J9C A;  2P0Q A;  3G7Z A;  2QTX A;  4A4F A;  2HDA A;  2ZPH B;  2MYS A;  1VQO T;  1M8M A;  1RAG B;  1UJ0 A;  1KMN A;  3I35 A;  2DRM A;  1KOG A;  1VQ4 Q;  1M1G A;  3LWI A;  4ZTZ B;  1ZUK A;  1G3W A;  2CRE A;  1ZHI A;  3ASK A;  2NLU A;  4FL6 A;  1VQK T;  4M7A F;  3TEH A;  2M0Y A;  1B7Y B;  2FL7 A;  2DD5 A;  4J6W A;  2J6K A;  4TVA A;  4LVM A;  1IHW A;  2YT6 A;  2FZC B;  3CMA A;  3JCM P;  2FZG B;  2ALY B;  1M3C A;  1EOV A;  4BAC A;  4LNP A;  1EQR A;  1NJ2 A;  1ATI A;  2RHS A;  5GAM g;  1G5V A;  2AZS A;  4X9D A;  3QSU A;  3UGQ A;  4JS5 A;  3NGP A;  2HQE A;  3QO5 A;  5GMK h;  2RPN A;  1UG1 A;  2K3B A;  5IAY A;  5C51 B;  2EQU A;  4AG1 C;  1BBW A;  2AK5 A;  2ED1 A;  1M3A A;  3MQZ A;  4AT1 B;  4WTO B;  4YRN A;  3JCM Q;  3T9N A;  2XIC A;  1Z9Z A;  2X9H A;  2O9V A;  4FCY A;  4CS3 A;  4AMC A;  4RG8 A;  4J6X A;  3M56 A;  3CBM A;  3S3M A;  1PKT A;  1SES A;  3H41 A;  4PK4 A;  4DBQ A;  2L8D A;  3RKX A;  3JCM h;  2H3J A;  2DZ9 A;  3MP1 A;  4XU1 A;  3TSZ A;  4FT2 A;  2V8I A;  3CC4 Q;  3BDL A;  1K8A C;  1USY A;  3IKM B;  3CCV Q;  1IGQ A;  2K9G A;  4B9W A;  3CCQ T;  1QCF A;  2VGM A;  2VKN A;  2HKN A;  4KGZ B;  3CPW A;  2HL3 A;  1ZSG A;  2KI7 A;  3G4S Q;  2HD0 A;  3OYY A;  1TSF A;  2CH4 A;  1VIE A;  5D6W A;  4TVW A;  2DTO A;  3CC4 T;  4LD9 K;  4XAX B;  3CME Q;  2LX7 A;  2A0F B;  3OYI A;  5CCA A;  4F14 A;  1QVF S;  2ZCE A;  3FJ5 A;  4ZN1 A;  4HVC A;  3DB4 A;  2CP0 A;  4M7D F;  3CC2 A;  4EMK A;  5KYX B;  3G4S T;  3FB9 A;  2LT1 A;  5I22 A;  3UFG A;  2YLC A;  3M4Q A;  1M3B A;  2DU5 A;  3CCU A;  3CXC S;  1VQN Q;  3UT1 A;  1VQ6 A;  3OYA A;  1X75 C;  4FYY B;  5GAN 3;  1D0X A;  1YJW T;  2WSF E;  5GAN 7;  1GFC A;  4LUD A;  3M57 A;  4EIK A;  2CP6 A;  3X28 B;  1L0W A;  3SD4 A;  4EMK C;  1AZE A;  1VQ7 Q;  1IRE B;  4H2T A;  2LJ3 A;  4E2F B;  3I55 A;  1RLQ C;  4RTZ A;  1GL5 A;  2QA4 Q;  3BE3 A;  4JS4 A;  5GAN e;  1RAD B;  3PMI A;  4CC3 A;  4TTV A;  4A63 B;  3L4G B;  2KSS A;  3GNF B;  3JB9 H;  2J7I A;  1YWO A;  1RUW A;  4LDW A;  5DY9 A;  2NS6 A;  2DU7 A;  4XEM A;  4DQ2 A;  4D6W A;  5CVI A;  1N6A A;  2J6O A;  2KAF A;  2DXU A;  2P4R A;  4EDU A;  1BB9 A;  1NJ8 A;  1RI9 A;  2Y90 A;  1TOV A;  3CCJ Q;  3LC0 A;  1UGP B;  2JJ9 A;  4UPA A;  4HWR A;  3LX7 A;  1G3Y A;  3MHX A;  3CCR Q;  2KGT A;  1TUD A;  2LJ0 A;  1C1A A;  3NFC A;  3THK A;  1HJD A;  4R0K A;  1WXT A;  2OTL Q;  4AFS C;  1UEC A;  1SF9 A;  3JCM W;  3CCJ T;  2YUQ A;  4P3N A;  1JJ2 P;  1LNX A;  1ZLM A;  2JM9 A;  3MF2 A;  2YHT A;  1VQM Q;  4FT4 A;  1QVG S;  1AD5 A;  2EIF A;  3CCR T;  2ZT8 A;  4K86 A;  1IHV A;  1PHT A;  4PJM A;  3V8J A;  1PCX A;  3CC7 Q;  4KQE A;  2O4X A;  1M1K R;  3QDR B;  1Q82 C;  1OX9 A;  2EAY A;  4PLI A;  2X4Y A;  4J9H A;  3SFM A;  5HKC A;  5CQY A;  2OTL T;  1QCN A;  1QVP A;  1JBM A;  1K9M C;  1W1F A;  4H2V A;  1VQM T;  2X35 A;  5GMK e;  5GAN 5;  2ZIO A;  3ICA A;  4Z8A A;  5HCK A;  2NUT A;  4YRF A;  1QWF A;  3MP8 A;  5C0M A;  3HKS A;  3LW5 E;  1TG0 A;  4C92 B;  3RKW A;  5GAN d;  3PMT A;  3V8L A;  1YIJ A;  4PJJ A;  2V26 A;  3JRZ A;  4M77 C;  5GAO n;  4R56 A;  3EHR A;  5ELO A;  2KT1 A;  3M59 A;  2E5K A;  1ZA1 B;  2DBK A;  4XEO A;  1PC0 A;  1GCQ C;  2NUP B;  3JCM e;  2PNI A;  2JVV A;  1MNE A;  5K1P A;  4F7U B;  2L5Q A;  3DKM A;  4J7I A;  4H2W A;  4YRQ A;  3X26 B;  5GAM h;  1SHG A;  1HK9 A;  1WHH A;  2FG0 A;  1Y96 B;  4N4H A;  2HCK A;  4HCZ A;  4AFQ C;  2PVG B;  2DLP A;  2L89 A;  4X9C A;  1ZUY A;  4LDX A;  4DBH A;  2EW3 A;  2COY A;  4OGE A;  3VRZ A;  1X2Q A;  1RAI B;  2CT4 A;  2Y4X A;  3O8V A;  1SRL A;  2DTI A;  3CD6 A;  1X27 A;  3WXM B;  4R55 A;  3TEH B;  1H4T A;  2AHJ B;  5CQX A;  1TUG B;  2V8J A;  1H3H A;  2I4L A;  3OMC A;  4TVA B;  2BE7 D;  5CKD A;  2BIV A;  3EFS A;  1WYX A;  2LQW A;  3M9Q A;  3L2U A;  2Q7H A;  4M75 A;  2VXF A;  1TXQ A;  2ZCF B;  1W2B P;  2RHS B;  3RER A;  1D1C A;  1OV3 A;  1VQ5 Q;  3A8M B;  3NTH A;  1U1S A;  1RAE B;  1D09 B;  4XU0 A;  4CH3 A;  2RQR A;  4KH1 B;  4YCU A;  4ZTF A;  2H8H A;  1QF6 A;  1YJ9 T;  4JRP A;  1GCP A;  2YUP A;  3MCA B;  1H4V B;  4M75 C;  2CGH A;  1W66 A;  3JCM d;  2LDM A;  4H2S A;  2HEQ A;  1ASY A;  1VQ5 T;  3HXU A;  1YHQ A;  2VWF A;  4B6M A;  1N8R U;  1VQL A;  3GNG A;  4H2X B;  4JJN K;  4ZTJ A;  2E5A A;  1DJ7 B;  1PM3 A;  1B7Y A;  2ZT5 A;  1VQ4 A;  4HXJ A;  1MV3 A;  2MCN A;  1BIA A;  4YCW A;  2DF6 A;  2RJF A;  3HY0 A;  4PHC A;  2E70 A;  5IXF A;  4PL6 A;  1FXX A;  1NG2 A;  3VS3 A;  4HVW A;  4P3O A;  1EVK A;  1QQJ A;  5IHK A;  1YGB A;  2C0O A;  3AT1 B;  4FSX A;  2QHT A;  1U8R A;  4IUR A;  1TUC A;  3JB9 G;  4KR3 A;  4XU3 A;  4L6V 5;  3HXW A;  2HL5 C;  3A1P A;  2A36 A;  4J6Y A;  1KQS P;  1VYU A;  2J6F A;  3UA6 A;  1B8A A;  3C95 A;  4DOV A;  1M2V B;  1G2B A;  3ZBD A;  1OPL A;  1JJ2 S;  3P8T A;  3A8G B;  1WDX A;  1LCK A;  3C94 A;  2NWM A;  4OF1 A;  4TVR A;  3LSS A;  2R5A A;  1VQP Q;  3A8O B;  2KRM A;  4KUL A;  1Q81 U;  3ZEH A;  3M54 A;  4PJL A;  1E1O A;  2CJ9 A;  2PUK B;  1YBY A;  1D3B B;  1N5Z A;  4J8O A;  4PKC C;  2ZR2 A;  1WHM A;  1G8X A;  3MPU B;  2XK0 A;  2Q7E A;  2QEX Q;  4V2S A;  1ZQ1 A;  1UGQ B;  1VQP T;  4QVD A;  2PVD B;  5GAM e;  2DET A;  2JUF A;  3TUP A;  2RQW A;  4PJO G;  1YI2 T;  3CCV A;  2EBP A;  1YFT A;  1GGM A;  2LT4 A;  1A0N B;  1H4S A;  2DTH A;  3QJY A;  4LDU A;  4JJD A;  2QQA A;  1GBQ A;  5FWB A;  2F2W A;  5KYX A;  2EGC A;  1IB8 A;  3CME A;  1D1A A;  4YRI A;  5DLQ E;  1RLP C;  1BI2 A;  4HWO A;  4JJB A;  4WI1 A;  1PSF A;  2DXT A;  4HCC A;  2BZX A;  4P3P A;  4M77 F;  2E12 A;  5FU6 B;  4ZGE B;  2ODR C;  2IY5 B;  2QGF B;  2VV5 A;  2CDT A;  3CCM Q;  1YJN Q;  3QZ9 B;  2K3X A;  3EFR A;  3JB9 D;  3X24 B;  1VQN A;  1Q86 C;  1PRM C;  5GAN f;  2E3C A;  2E65 A;  3PVL A;  4JZ3 A;  1KJW A;  4JRI A;  2ZPE B;  2BE9 B;  2O4X B;  3GLX A;  3HFN A;  3HXY A;  2VUB A;  1B3Q A;  1B76 A;  2G3R A;  2JM8 A;  1K8A R;  1ZA2 B;  2CP7 A;  2KMT A;  3L42 A;  4LVJ A;  3CCM T;  1YJN T;  3QWY A;  1VQ7 A;  2BKD N;  4FW2 A;  1KHC A;  3BFM A;  2QA4 A;  1ZUU A;  2PMF A;  5AYF A;  1X2K A;  4LVI A;  5LJ5 g;  5GAO l;  2VYT A;  2LCS A;  1MMG A;  1WU7 A;  1OUL A;  2OX7 A;  4LXC A;  2EQI A;  4JDS A;  4Y28 E;  2KY9 A;  3WVD B;  1YIT A;  1M27 C;  4KH0 B;  1W4S A;  4OB2 B;  1QVF P;  1NYG A;  5GAM d;  1KQ2 A;  2EL9 A;  2ZT6 A;  1VQ8 A;  4F17 A;  2DM1 A;  2KRO A;  2RD1 A;  1B07 A;  5GAO m;  2C06 A;  2YSQ A;  1CSK A;  3PGG A;  4PJO D;  2VVK A;  3V7S A;  4PNO A;  3CXC P;  2F1L A;  2EQM A;  1FWZ A;  1NJI U;  3H9N A;  3FC3 A;  3PE0 A;  2F69 A;  2X4X A;  2VAS A;  1K9A A;  4XTV A;  2ZTG A;  1YIJ T;  2EGA A;  3I7F A;  3CPW S;  2HQH A;  4DA4 A;  3VV0 A;  2C8M A;  2PZ1 A;  3CMQ A;  2DFU A;  2ART A;  5KCH A;  3A32 A;  1KK7 A;  3TCJ A;  1WX6 A;  2QQB A;  1SER A;  3CC7 A;  2KT8 A;  2ZGW A;  3OW2 A;  4EO4 A;  4X34 A;  4CC4 B;  2G6F X;  1U5S A;  1M90 C;  2XGT A;  1YCS B;  3TSW A;  2H3E B;  3MEW A;  4BB7 A;  3KFU A;  1PRL C;  1K73 U;  1KC8 U;  2DJQ A;  4M75 B;  2F2X A;  2QTV A;  5F5W A;  3LH5 A;  4HVU A;  4RTV A;  1NYF A;  2JN0 A;  3MJX A;  3FJP A;  3G71 Q;  2YXY A;  2NUP A;  4XTY A;  4NCX A;  3VS7 A;  2KQW A;  3P8H A;  3UDC A;  1VQO Q;  1S72 Q;  1KQ1 A;  1T0H A;  2Q5H A;  4ME7 A;  5GMK l;  1TH7 A;  1JXO A;  4II1 A;  3OYH A;  5C53 B;  5CIU A;  2DER A;  2ZR3 A;  4GBQ A;  1NJ6 A;  2CZ7 B;  1K1Z A;  2D0Q B;  3ER0 A;  5LJ3 j;  2XID A;  3G71 T;  1VQK Q;  2RN8 A;  2JW4 A;  1QVG P;  1BBZ A;  3A98 A;  2OTJ T;  1Q82 R;  2P5I A;  3A7R A;  5KYN A;  4TVY A;  1S72 T;  2ZIM A;  5GMK m;  3FRN A;  1UGV A;  1S1N A;  3LYI A;  1K9M R;  1KD1 U;  3URG A;  1MV0 B;  1NLP C;  2COZ A;  3U23 A;  3EG9 B;  1T3L A;  3VYH B;  4Y91 A;  4MDX A;  5KYU B;  2C7I A;  3CQT A;  2JXB A;  2CP5 A;  3E9G A;  2QQS A;  4HWP A;  1B7T A;  2BUD A;  3VS2 A;  2KE9 A;  4NL2 A;  4BI8 B;  1JXM A;  3CCS A;  3I56 A;  3M4G A;  4YRL A;  1QCO A;  3EGX B;  3DLL A;  2RO0 A;  1HC7 A;  1AVZ C;  2K7A A;  3UPU A;  3S3N A;  4Z02 A;  1I8F A;  5CK9 A;  2F5K A;  1OZ3 A;  4M78 G;  1WJQ A;  4PJN A;  1X2H A;  2XU8 A;  2CP3 A;  3DB3 A;  2GGR A;  1V1C A;  4Z89 A;  3CCQ Q;  2QHV A;  3QHS A;  1QP3 A;  2CYZ B;  2M51 A;  1GFD A;  4QKU A;  1SEM A;  5J3B A;  5I2M A;  2L3P A;  1HD3 A;  2CUD A;  4O6J A;  4BUG A;  3HY1 A;  2I4O A;  4H2X A;  2GFU A;  4FSS A;  1AWO A;  4GLK A;  1LPL A;  3G6E Q;  1RL2 A;  2K2M A;  3O5Z A;  2RJE A;  3IKL A;  1NEB A;  1WHK A;  2E3I A;  2IG0 A;  4FYV B;  2XI9 A;  2DO3 A;  2KRS A;  2M9U A;  2R58 A;  3CCL Q;  2ZZE A;  4B9X A;  2AIR B;  3I5R A;  4JPB W;  3G6E T;  2HQX A;  2COW A;  3EFO B;  2W0Z A;  4IUV A;  4OP0 A;  1YJW Q;  1G3T A;  3GIB A;  5GAN 6;  1USY C;  4OMQ A;  2XDP A;  3HP9 A;  5LJ5 h;  5FWC A;  2FEI A;  2EYX A;  1SPK A;  3UAT A;  3CCL T;  2KYM A;  5IHN A;  5C6S A;  1Q7Y R;  4IUP A;  3OYJ A;  2DIL A;  2DNU A;  4OVA A;  1M2V A;  4L5G A;  2OJ2 A;  1FX7 A;  4ATO A;  1VA7 A;  4XTX A;  1VIF A;  3OBW A;  1D0Z A;  2HSE B;  3M4Y A;  2HBW A;  4AH6 A;  3JV3 A;  2JMC A;  4PJO E;  3L1A A;  1QWE A;  3HFV A;  2JS2 A;  1IO6 A;  2GF7 A;  1D3B A;  2AZV A;  2R57 A;  5M9O A;  3PT9 A;  5GAM f;  3A7U A;  3OYM A;  1OQK A;  3M0U A;  4M78 D;  4RQE A;  2DE0 X;  2KEA A;  1I4K 1;  4YCV A;  2RH2 A;  5EG2 A;  3HFZ A;  3OYF A;  1D1B A;  3PNW C;  4XK8 E;  4DPG A;  1BU1 A;  3GOX A;  9ATC B;  2AMC B;  3UWN A;  4M77 G;  2RB6 A;  4ZGD B;  2QEX A;  3R6O A;  3RGL A;  4PJO B;  2B8A A;  3DLM A;  2RQT A;  1U1T A;  5AT1 B;  4JLG A;  2SEM A;  1NM7 A;  2BTT A;  3SWN B;  3E9H A;  3EH1 A;  1I81 A;  1G5I A;  3CCE Q;  1MMA A;  1OOT A;  1YNZ A;  5E3I A;  3TRE A;  3GBQ A;  1E6H A;  3LLR A;  3JCM X;  3FEO A;  2JMA A;  3NPF A;  4JLI A;  2Y4Y A;  4YRO A;  3KBG A;  2EYW A;  2IY5 A;  2ZNI A;  3OQ5 A;  4KRT A;  2QAZ A;  3CCE T;  4GY5 A;  2QHU A;  3OW2 P;  2YLB A;  5KE3 A;  2A7Y A;  3UA7 A;  3I9Q A;  3E9I A;  3HTZ A;  4C92 F;  3VYG A;  5HK0 A;  4G85 A;  1Q95 G;  2RQV A;  1R77 A;  1B70 B;  5FU6 C;  2RMO A;  2ZPI B;  4KT0 E;  2YWW A;  1OU8 A;  2DEU A;  4C0D B;  1AOJ A;  1UE9 A;  4LVK A;  1RI0 A;  3JCM c;  3QO7 A;  2KNB B;  4BDY A;  3VS6 A;  3QO3 A;  4F7U F;  4P72 A;  3A5Z A;  1UHC A;  2RHY A;  3C12 A;  2I2L A;  3QZ5 B;  3SEM A;  4JJC A;  2PU9 B;  3M0R A;  1ZBX A;  5GAO r;  2K6D A;  3HRU A;  1K76 A;  3BY7 A;  3OYE A;  4M77 D;  2DVE A;  2AKW B;  1KFZ A;  1WA7 A;  2PVO B;  4P72 C;  3A31 A;  4YRE A;  1WNL A;  2NYS A;  1K0X A;  4RTU A;  4DBR A;  5IT9 E;  1Q86 R;  5K1X A;  1XQH A;  3RNJ A;  4C0G A;  2GFA A;  4WCI A;  2MI6 A;  2ZPG B;  4OMP A;  4C5H A;  1OU9 A;  2KDS A;  4O5V A;  5LJ5 e;  4QQD A;  3REB B;  3HXV A;  4Q6G A;  4UP8 A;  4L87 A;  2EYY A;  3J81 E;  3TU4 K;  1G3S A;  4LUE A;  4KR2 A;  3HHT B;  1VQ9 A;  1EFN A;  1JJC A;  3NET A;  1R0B G;  2E64 A;  4J5Y A;  4RQF A;  4IUT A;  2LNH B;  5CO7 A;  2CUB A;  1KSW A;  3INZ A;  4C8Q G;  1YJ9 Q;  1KHI A;  2KXD A;  2DYI A;  2X3X D;  3E19 A;  2AKK A;  1NE8 A;  2GQI A;  3CMA Q;  2CZ1 B;  4E47 A;  1C0A A;  3GP8 A;  3H0H A;  2ATC B;  4KUI A;  3RMS A;  4YRR A;  4D8D A;  2PME A;  1Q7Y C;  1M5Q 1;  3NTI A;  2FPF A;  3BW1 A;  3OYG A;  1I5L A;  2HAX A;  4E7Z A;  1VUB A;  1SRY A;  3TVT A;  5FLX E;  4CI0 C;  4M7A G;  1ABO A;  2MF2 A;  3N5B B;  1B34 A;  2KXC A;  1IXD A;  2MWP A;  2KYB A;  2RK1 A;  4FU6 A;  1M1K U;  3CMA T;  2PUO B;  4VUB A;  3IG2 A;  1UB4 A;  3EAE A;  3CPW P;  3OS0 A;  5A0G A;  2P0K A;  4XTZ A;  1VQK A;  1H92 A;  3S6W A;  2DL5 A;  1ARK A;  1PKS A;  5GJV B;  1QKW A;  2DL4 A;  2RF0 A;  3EG9 A;  3QYG B;  1TWB A;  1M90 R;  3RR6 A;  2EKH A;  3AHU A;  3HTR A;  5KYU A;  4JUV A;  2O2O A;  4P75 A;  5LJ5 d;  2DXB A;  2XMF A;  4M78 E;  5I21 A;  1OZ2 A;  1MGQ A;  3RBB B;  3HXX A;  3OS1 A;  1LVK A;  4K88 A;  3EGX A;  4ORZ A;  4WF2 A;  1QMC A;  3CPF A;  4CH5 A;  5D6Y A;  2DZC A;  4P75 C;  1HYO A;  3E2U A;  3CC2 Q;  3BDU A;  2V8K A;  4C8Q D;  4M78 B;  4BY6 B;  3OW2 S;  2IVW A;  3CCU Q;  2Q5I A;  1BKB A;  1M8V A;  3P8V A;  1VQ6 Q;  4PFP A;  5GAN j;  4CH4 A;  3PZC A;  3QO8 A;  3M0T A;  3OYK A;  1YI2 Q;  1M9S A;  4YRM A;  3CCQ A;  1SG5 A;  3CC2 T;  2EPD A;  3QII A;  2JOY A;  4M7A D;  4E7L A;  4M7D G;  3PCO A;  1WHJ A;  3CCU T;  1TS9 A;  7AT1 B;  3HFZ B;  1RAB B;  4IIO A;  1VOM A;  4MML A;  3HXZ A;  3I55 Q;  1IGU A;  4JZ4 A;  1VQ6 T;  2E10 A;  3CC4 A;  2FZK B;  4YRG A;  4IUQ A;  1RAA B;  3JCM b;  1U3O A;  3M55 A;  2RI3 A;  4H2U A;  5CKE A;  1TTH B;  2FRW A;  3VUB A;  2J06 A;  1O75 A;  1EVL A;  1WQ7 A;  3G4S A;  1SRM A;  2LP5 A;  3EFO A;  4BE1 A;  3L2Q A;  1N8R C;  2AKL A;  2DPP B;  3I55 T;  3JCM V;  3OYL A;  4QQ6 A;  4YRJ A;  4QW2 A;  2QQ9 A;  2CT3 A;  1NEG A;  2LQN A;  3HRI A;  1YJW A;  1WFW A;  1ZBJ A;  1X69 A;  3VS4 A;  2EKO A;  3TEG A;  3VS0 A;  3QDF A;  2KVQ G;  5GAN 8;  5CAI A;  2X4J A;  4OMF B;  3F70 A;  1Y7X A;  3VQV A;  2LMJ A;  2EJG A;  1RAF B;  3V7R A;  1TU0 B;  2FB7 A;  5CR2 A;  3ULR B;  4BDZ A;  1JB0 E;  1H3Z A;  5GMK j;  3MET A;  2DL3 A;  3P8B B;  2RM4 A;  3H0F A;  1OI1 A;  4QVZ A;  1YCY A;  3OS5 A;  3VS1 A;  2DL8 A;  5FW9 A;  1N9S A;  2DAQ A;  1NBE B;  3VJP A;  3OA6 A;  5J26 A;  2AMC A;  3L2Z A;  2WSE E;  4QQG A;  3FDR A;  3P8Y A;  1WXU A;  4RTW A;  2XHC A;  2VXE A;  1BBU A;  4PJO A;  4NOY A;  1WLP B;  1YWP A;  1E22 A;  1Y0M A;  3A5Z B;  4KBM B;  2MIO A;  1X01 A;  3REX A;  3SWN A;  1Q81 C;  4XU2 A;  1W70 A;  2CH4 W;  12AS A;  2FYK A;  4M7D D;  2CZ0 B;  5D7U A;  1YIJ Q;  2OAW A;  4FM4 B;  4C92 G;  1UGS B;  1PYS A;  1N9W A;  1JU5 C;  2V1Q A;  3CCJ A;  2JS0 A;  3FIF A;  5CKF A;  3TQ7 P;  4PJO C;  5IH2 A;  3CCR A;  1ZX6 A;  5GAN 2;  4HT9 A;  1FYN A;  5GAN 4;  2QXF A;  1AT1 B;  5IHI A;  1X6B A;  3SWN C;  4K11 A;  1VYT A;  3JCM J;  4UP7 A;  2OTL A;  2WAC A;  1WYD A;  2Q7G A;  1P92 A;  3CEY A;  4F7U G;  2GQV A;  3VQW A;  2LQK A;  4ZN3 A;  3E1S A;  8ATC B;  1VQM A;  2K5I A;  4ELZ C;  1XTD A;  2PTK A;  3C0C A;  3GF5 A;  2EYZ A;  4P5N A;  2G4C A;  2M0O A;  3M58 A;  1YFR A;  1Z7M A;  2ZNJ A;  4M75 F;  4AFZ C;  1B70 A;  3VQY A;  1Y57 A;  4Z88 A;  4EMH A;  4XQ3 A;  2PQW A;  1WIE A;  5I11 A;  1HSQ A;  3KUF A;  2B86 A;  2K57 A;  3L2W A;  2EJF A;  1JJC B;  2X51 A;  3S3O A;  2ZT7 A;  3CD6 Q;  1VQZ A;  2DYB A;  1AEY A;  2CJA A;  3JB9 J;  2D0N A;  4ZNX A;  3VKI A;  4E7J A;  5A0L A;  3UH0 A;  2P4T A;  2YRD A;  4YYE A;  4C0D C;  5LJ3 g;  2YRV A; 
#chains in the Genus database with same CATH homology
 4P74 A;  3H6Z A;  4CRI A;  3CD6 T;  4UC4 A;  2AKW A;  2K5L A;  2ZXF A;  5GAO p;  2E6N A;  2QQR A;  1B34 B;  2LNV A;  5LJ5 f;  4C5G A;  1K8A U;  2ARU A;  4C92 D;  4MMK A;  4MZM A;  4P74 C;  2DEQ A;  1BYM A;  2MAM A;  3HL8 A;  3VQX A;  4C8Q E;  3LGL A;  3R07 A;  2JNG A;  3RAC A;  3C4S A;  5FU7 B;  2CJB A;  1NJI C;  4NS5 A;  2WSC E;  3MF1 A;  2XKO C;  4M7A E;  1X56 A;  3OYN A;  4BD3 A;  3W3S A;  3RIR A;  1YHQ T;  4HT4 A;  3HRS A;  5FRN A;  4C8Q B;  2XDB A;  3JAM E;  1VQL T;  2HBP A;  3VU3 C;  4C5I A;  1YJ9 A;  1G51 A;  1VQ4 T;  4LVL A;  5L8R E;  2VC8 A;  4LDV A;  1ADJ A;  1VQ5 A;  3QKJ A;  4M7A B;  1SSF A;  4A4E A;  3TEE A;  1WLE A;  1KC8 C;  1K73 C;  2RJC A;  2DIG A;  2DDZ A;  2M1H A;  1W2B A;  4K87 A;  2EFI A;  5GAM j;  3E9F A;  4ELY C;  1YFS A;  4UP9 A;  5C52 B;  1M4Z A;  4BI4 A;  1FYF A;  2D9T A;  5LJ3 f;  3PCO B;  1LYL A;  1AHJ B;  3A7A A;  2XTI A;  3JB9 F;  4MZP A;  3HRK A;  2QDY B;  1BIB A;  1Y71 A;  3V8K A;  4JRK A;  1R8O B;  2K2V A;  4YTL A;  2ZZD A;  3RKY A;  4E7K A;  3NEL A;  3LSQ A;  2DQ3 A;  3REU A;  1NJ1 A;  5GAO q;  1KD1 C;  3QPH A;  2ZZG A;  1QP2 A;  5FRO A;  2LCC A;  3QJ6 A;  4M7D E;  5IN1 A;  1OYX A;  4M78 A;  1Q82 U;  3CCV T;  4YRP A;  5KH6 A;  3OYB A;  2MMP A;  1K9M U;  4EX5 A;  4C0Z A;  2CS7 A;  1XNI A;  4PJO F;  1VQP A;  3QUI A;  1JRI A;  3CME T;  2E6Z A;  1BI1 A;  1YI2 A;  3NEN A;  4M78 C;  4BY6 C;  1WQW A;  1O9S A;  1EIF A;  1WJS A;  2FVU A;  4M7D B;  3IAL A;  2DKG A;  1KQS A;  1VQN T;  3LH0 A;  2RJD A;  2DQ0 A;  2RI5 A;  3KXT A;  4HKE A;  4A4K A;  4A53 A;  4JRQ A;  3MP6 A;  1X2G A;  1NPP A;  1PYS B;  2ZPB B;  2ZIN A;  1VQ7 T;  4RCB A;  1XOV A;  2I4N A;  2QA4 T;  2P0P A;  3VUZ A;  5HGQ A;  2P0L A;  1EFW A;  4IUU A;  5LJ3 h;  5I2S A;  4C5E A;  2EQK A;  2K5F A;  5KNN A;  1YIT T;  3J80 E;  3CCM A;  1YJN A;  2RI2 A;  4WJ4 A;  1WGS A;  1N9R A;  4N4G A;  1VQ8 T;  2JZ2 A;  5KCO A;  4HCB A;  3HRT A;  4RKU E;  4C92 E;  3HSB A;  3A8H B;  5CKB A;  2E5Q A;  3RF1 A;  1NYR A;  5GMK i;  3NEM A;  2F5T X;  3L2R A;  4M77 A;  1EIY B;  2DD4 A;  1KMM A;  1BI3 A;  2RHQ A;  1Q7Y U;  4HWT A;  4QVC A;  4F7U E;  4IKF A;  4LDY A;  1X54 A;  3OY9 A;  3CC7 T;  2D6F A;  3OMG A;  4M75 G;  5HK3 A;  3DSQ A;  5FRM A;  1IZ6 A;  4ZIB A;  2OAU A;  3OBY A;  2XG8 D;  2RHZ A;  4RMF A;  2EQJ A;  4X5O A;  1QVF A;  2ZPF B;  4YRS A;  4OLF A;  5HY6 A;  1H4Q A;  1X55 A;  3GPL A;  4A4H A;  3OD1 A;  1Z7N A;  1SET A;  4H2Y A;  2MWO A;  2L3R A;  3CXC A;  2E1H A;  2DK3 A;  1E24 A;  3LGF A;  4L59 A;  4YDQ A;  3VBB A;  2LVM A;  4WJ3 M;  3MEU A;  2EJ9 A;  4A4G A;  3G71 A;  3MEY A;  4Q5W A;  2OTJ A;  1S72 A;  1VQO A;  1HXD A;  3JSC A;  3MEV A;  2DXC A;  3J7A F;  1HTT A;  3WQZ A;  4FIB A;  3CCS T;  3I56 T;  2A3L A;  4M75 D;  1WPY A;  2JTF A;  3ERR A;  4A54 A;  3CBP A;  5KE2 A;  3ZFJ A;  3QG1 A;  4EMG A;  4J83 A;  1E1T A;  2LX9 A;  5LJ3 e;  2J3M A;  2VGN A;  4C8Q A;  4M78 F;  1QVG A;  3SDZ A;  4J15 A;  1LJO A;  4E51 A;  1BI0 A;  1X6O A;  5FU7 C;  5A2Q E;  4HA8 A;  5GAN g;  11AS A;  1Q86 U;  1NNH A;  1J5W A;  2ALY A;  2RHX A;  2E41 A;  2O01 E;  3QTC A;  3PTA A;  4M7A A;  4C8Q C;  2RHU A;  4XTW A;  2ARS A;  4EMK B;  3RUX A;  4ZTU B;  2CKK A;  3OYC A;  2ZZF A;  3UGT A;  3ME9 A;  2M16 A;  1M1F A;  3QXE B;  4HT8 A;  4LD6 A;  3M5A A;  3L2V A;  4KUD K;  1QW1 A;  2RA2 A;  4M7A C;  3G6E A;  1V29 B;  1WJR A;  3FLG A;  4Q15 A;  3V7C A;  3QYH B;  4P73 A;  5CKH A;  1M1K C;  4J7F A;  1NZ9 A;  2FHD A;  4TQD A;  4DOW A;  3CCL A;  2RK2 A;  2DIQ A;  3RMQ A;  3WVE B;  3MEA A;  2GCX A;  2EWN A;  5LJ3 d;  4BI3 A;  3M53 A;  1NJ5 A;  3PIP A;  3RES A;  3HPW A;  2X4W A;  4MZT A;  4RMO A;  4XTU A;  4P73 C;  3P8D A;  4YRK A;  4H02 A;  1RIQ A;  1ADY A;  2CZ6 B;  5DLO A;  4OB1 B;  2QEX T;  4BE2 A;  4E7I A;  3G1Z A;  1MHN A;  5LL6 S;  4OGC A;  4M77 E;  1GXI E;  2DJZ A;  4CS4 A;  2ODR D;  1M90 U;  3JCM g;  3Q1J A;  1LOJ A;  3QNE A;  1NPR A;  3HFO A;  3CBO A;  4M7D A;  3PIO A;  2RHI A;  3A74 A;  3BJU A;  4ZGJ B;  4M77 B;  4N0A A;  1H64 1;  4G84 A;  2RHQ B;  4NL3 A;  3SB2 A;  3L4G A;  4YP0 A;  3A5Y A;  2KK4 A;  4M7D C;  3OS2 A;  2QHS A;  3OSS C;  3MO8 A;  3CCE A;  2JTM A;  4MDW A;  2XDD A;  1W2B S;  4N0A C;  4CS2 A;  1NYQ A;  5A0D A;  3X20 B;  3RL6 A;  4BWA A;  5LJ5 j;  4YRT A;  4TWA A;  1N27 A;  1PSE A;  2EYQ A;  4O2D A;  3PFS A;  1UGR B;  2HNI A;  2CIM A;  4BW9 A;  2LRQ A;  1IL2 A;  4HWS A;  2QI2 A;  4M75 E;  3OB9 A;  4YRC A;  4EPC A;  1QE0 A;  1Y07 A;  1EIY A;  1JJ2 A;  4E7H A;  1YB3 A;  4N4I A;  3LWH A;  1ASZ A;  3A8L B;  3X25 B;  4P71 A;  4YPF A;  3H8Z A;  2R5M A;  1UEB A;  4PLL A;  4C92 A;  2XD0 A;  4LNS A;  1KG1 A;  5D6X A;  2LQ8 A;  3M4P A;  5ELN A;  4PG3 A;  2LTO A;  3NTK A;  4RCC A;  3JCM f;  1VQ9 T;  3OYD A;  4BE0 A;  2LCL A;  4RG2 A;  4CH6 A;  4P71 C;  2I4M A;  5GAN h;  4TQF A;  5DM7 R;  4OB0 B;  4F7U A;  4C92 C;  4C0F A;  1KQS S;  4RDX A;  3QBY A;  2LC4 A;  2K3Y A;  1G5H A;  2K4Y A;  2A8E A;  1Y96 A;  2J3L A;  4OB3 B;  5J39 A;  3OSV A;  4C8Q F;  3JB9 I;  2P0Q A;  3G7Z A;  2QTX A;  4A4F A;  2ZPH B;  1VQO T;  1KMN A;  1KOG A;  1M1G A;  3LWI A;  4ZTZ B;  1G3W A;  1ZHI A;  3ASK A;  2NLU A;  4FL6 A;  1VQK T;  4M7A F;  3TEH A;  1B7Y B;  2FL7 A;  2DD5 A;  4J6W A;  4TVA A;  4LVM A;  3CMA A;  3JCM P;  2ALY B;  1EOV A;  1EQR A;  4BAC A;  1NJ2 A;  1ATI A;  2RHS A;  5GAM g;  1G5V A;  4X9D A;  3QSU A;  3UGQ A;  4JS5 A;  2HQE A;  3QO5 A;  5GMK h;  5IAY A;  5C51 B;  2EQU A;  1BBW A;  3MQZ A;  4YRN A;  3JCM Q;  3T9N A;  2XIC A;  4CS3 A;  4RG8 A;  4J6X A;  3M56 A;  3CBM A;  3S3M A;  1SES A;  2L8D A;  3RKX A;  3JCM h;  2H3J A;  2DZ9 A;  3MP1 A;  4XU1 A;  4FT2 A;  2V8I A;  3BDL A;  1K8A C;  1USY A;  3IKM B;  4B9W A;  3CCQ T;  2VGM A;  3CPW A;  2HD0 A;  3OYY A;  1VIE A;  5D6W A;  4TVW A;  2DTO A;  3CC4 T;  4LD9 K;  4XAX B;  3OYI A;  1QVF S;  2ZCE A;  5CCA A;  4ZN1 A;  4HVC A;  3DB4 A;  4M7D F;  3CC2 A;  4EMK A;  3G4S T;  3FB9 A;  2LT1 A;  3UFG A;  2YLC A;  3M4Q A;  2DU5 A;  3CCU A;  3CXC S;  3UT1 A;  1VQ6 A;  3OYA A;  1X75 C;  5GAN 3;  1YJW T;  2WSF E;  5GAN 7;  3M57 A;  3X28 B;  1L0W A;  3SD4 A;  4EMK C;  1IRE B;  4H2T A;  3I55 A;  4JS4 A;  5GAN e;  3PMI A;  4TTV A;  3L4G B;  2KSS A;  3GNF B;  3JB9 H;  5DY9 A;  4LDW A;  2NS6 A;  2DU7 A;  4XEM A;  4DQ2 A;  4D6W A;  5CVI A;  1N6A A;  2KAF A;  2DXU A;  4EDU A;  1NJ8 A;  2Y90 A;  3LC0 A;  1UGP B;  4UPA A;  4HWR A;  3LX7 A;  1G3Y A;  3MHX A;  3NFC A;  3JCM W;  3CCJ T;  4P3N A;  1LNX A;  3MF2 A;  2YHT A;  4FT4 A;  1QVG S;  2EIF A;  3CCR T;  2ZT8 A;  4K86 A;  3V8J A;  4KQE A;  2O4X A;  3QDR B;  1Q82 C;  2EAY A;  4PLI A;  2X4Y A;  3SFM A;  5HKC A;  5CQY A;  2OTL T;  1QVP A;  1JBM A;  1K9M C;  4H2V A;  1VQM T;  2X35 A;  5GMK e;  5GAN 5;  2ZIO A;  3ICA A;  4YRF A;  3MP8 A;  5C0M A;  3HKS A;  3LW5 E;  4C92 B;  3RKW A;  5GAN d;  3PMT A;  3V8L A;  1YIJ A;  3JRZ A;  4M77 C;  5GAO n;  4R56 A;  5ELO A;  3M59 A;  4XEO A;  3JCM e;  2JVV A;  5K1P A;  4F7U B;  2L5Q A;  3DKM A;  4J7I A;  4H2W A;  4YRQ A;  3X26 B;  5GAM h;  1HK9 A;  1Y96 B;  4N4H A;  4HCZ A;  2PVG B;  2L89 A;  4X9C A;  4LDX A;  4OGE A;  2Y4X A;  3O8V A;  2DTI A;  3CD6 A;  3WXM B;  4R55 A;  3TEH B;  1H4T A;  2AHJ B;  5CQX A;  2V8J A;  2I4L A;  3OMC A;  4TVA B;  5CKD A;  2BIV A;  3EFS A;  3M9Q A;  3L2U A;  2Q7H A;  4M75 A;  2VXF A;  2ZCF B;  2RHS B;  3RER A;  3A8M B;  3NTH A;  1U1S A;  4XU0 A;  4CH3 A;  4YCU A;  4ZTF A;  1QF6 A;  1YJ9 T;  4JRP A;  3MCA B;  1H4V B;  4M75 C;  2CGH A;  1W66 A;  3JCM d;  2LDM A;  4H2S A;  1ASY A;  1VQ5 T;  3HXU A;  1YHQ A;  1N8R U;  1VQL A;  3GNG A;  4H2X B;  4JJN K;  4ZTJ A;  2E5A A;  1DJ7 B;  1B7Y A;  2ZT5 A;  1VQ4 A;  4YCW A;  1BIA A;  2RJF A;  3HY0 A;  4PHC A;  2E70 A;  4PL6 A;  1FXX A;  4P3O A;  1EVK A;  1YGB A;  4FSX A;  2QHT A;  1U8R A;  4IUR A;  3JB9 G;  4KR3 A;  4XU3 A;  4L6V 5;  3HXW A;  4J6Y A;  1B8A A;  3C95 A;  4DOV A;  3ZBD A;  1JJ2 S;  3P8T A;  3A8G B;  3C94 A;  4OF1 A;  4TVR A;  3LSS A;  2R5A A;  3A8O B;  4KUL A;  1Q81 U;  3ZEH A;  3M54 A;  2CJ9 A;  1E1O A;  2PUK B;  1YBY A;  1D3B B;  4J8O A;  4PKC C;  2ZR2 A;  2XK0 A;  2Q7E A;  4V2S A;  1ZQ1 A;  1UGQ B;  1VQP T;  4QVD A;  2PVD B;  5GAM e;  2JUF A;  3TUP A;  4PJO G;  1YI2 T;  3CCV A;  1YFT A;  1GGM A;  2LT4 A;  1H4S A;  2DTH A;  3QJY A;  4LDU A;  2QQA A;  3CME A;  4YRI A;  5DLQ E;  1BI2 A;  4HWO A;  4WI1 A;  1PSF A;  2DXT A;  4HCC A;  4P3P A;  4M77 F;  2E12 A;  5FU6 B;  4ZGE B;  2ODR C;  2IY5 B;  2VV5 A;  3QZ9 B;  2K3X A;  3EFR A;  3JB9 D;  3X24 B;  1VQN A;  1Q86 C;  5GAN f;  2E3C A;  2E65 A;  4JRI A;  2ZPE B;  3HFN A;  2O4X B;  3GLX A;  3HXY A;  2VUB A;  1B76 A;  2G3R A;  2KMT A;  3L42 A;  4LVJ A;  3CCM T;  1YJN T;  1VQ7 A;  2BKD N;  1KHC A;  3BFM A;  2QA4 A;  2PMF A;  5AYF A;  4LVI A;  5LJ5 g;  5GAO l;  2VYT A;  1WU7 A;  4JDS A;  4Y28 E;  2KY9 A;  3WVD B;  1YIT A;  1W4S A;  4OB2 B;  5GAM d;  1KQ2 A;  2EL9 A;  2ZT6 A;  1VQ8 A;  2RD1 A;  5GAO m;  2C06 A;  3PGG A;  4PJO D;  3V7S A;  4PNO A;  2EQM A;  1FWZ A;  1NJI U;  3FC3 A;  2F69 A;  2X4X A;  4XTV A;  2ZTG A;  1YIJ T;  3I7F A;  3CPW S;  4DA4 A;  3VV0 A;  2C8M A;  3CMQ A;  2ART A;  5KCH A;  3A32 A;  3TCJ A;  2QQB A;  1SER A;  3CC7 A;  2ZGW A;  3OW2 A;  4EO4 A;  4X34 A;  1M90 C;  2XGT A;  3MEW A;  4BB7 A;  3KFU A;  1KC8 U;  1K73 U;  4M75 B;  5F5W A;  2JN0 A;  3FJP A;  4XTY A;  4NCX A;  2KQW A;  3P8H A;  3UDC A;  1KQ1 A;  2Q5H A;  4ME7 A;  5GMK l;  1TH7 A;  4II1 A;  3OYH A;  5C53 B;  5CIU A;  2ZR3 A;  1NJ6 A;  2CZ7 B;  2D0Q B;  3ER0 A;  5LJ3 j;  2XID A;  3G71 T;  2OTJ T;  2P5I A;  3A7R A;  4TVY A;  1S72 T;  2ZIM A;  5GMK m;  3FRN A;  3LYI A;  1KD1 U;  3URG A;  3VYH B;  4Y91 A;  4MDX A;  2C7I A;  3E9G A;  2QQS A;  4HWP A;  2BUD A;  4NL2 A;  4BI8 B;  3CCS A;  3I56 A;  3M4G A;  4YRL A;  3DLL A;  2RO0 A;  1HC7 A;  3UPU A;  3S3N A;  4Z02 A;  1I8F A;  5CK9 A;  2F5K A;  1OZ3 A;  4M78 G;  1WJQ A;  1X2H A;  2XU8 A;  3DB3 A;  2QHV A;  3QHS A;  1QP3 A;  2CYZ B;  5J3B A;  5I2M A;  4O6J A;  4BUG A;  3HY1 A;  2I4O A;  4H2X A;  2GFU A;  4GLK A;  1RL2 A;  2RJE A;  3IKL A;  2IG0 A;  2XI9 A;  2DO3 A;  2M9U A;  2R58 A;  2ZZE A;  4B9X A;  3G6E T;  2HQX A;  4IUV A;  4OP0 A;  1USY C;  3GIB A;  1G3T A;  5GAN 6;  2XDP A;  3HP9 A;  5LJ5 h;  3CCL T;  5C6S A;  4IUP A;  3OYJ A;  4OVA A;  4L5G A;  4ATO A;  1FX7 A;  4XTX A;  1VIF A;  3OBW A;  3M4Y A;  4AH6 A;  4PJO E;  3L1A A;  3HFV A;  2GF7 A;  1D3B A;  2R57 A;  5M9O A;  3PT9 A;  5GAM f;  3A7U A;  3OYM A;  4M78 D;  4RQE A;  1I4K 1;  4YCV A;  2RH2 A;  5EG2 A;  3HFZ A;  3OYF A;  3PNW C;  4XK8 E;  4DPG A;  3GOX A;  2AMC B;  3UWN A;  4M77 G;  2RB6 A;  4ZGD B;  2QEX A;  3R6O A;  3RGL A;  4PJO B;  2B8A A;  3DLM A;  1U1T A;  4JLG A;  3E9H A;  3SWN B;  1I81 A;  1G5I A;  5E3I A;  3TRE A;  3LLR A;  3JCM X;  3FEO A;  4JLI A;  2Y4Y A;  4YRO A;  3KBG A;  2ZNI A;  2IY5 A;  3OQ5 A;  3CCE T;  4GY5 A;  2QHU A;  2YLB A;  5KE3 A;  2A7Y A;  3E9I A;  3HTZ A;  4C92 F;  3VYG A;  5HK0 A;  4G85 A;  1B70 B;  5FU6 C;  2ZPI B;  4KT0 E;  4C0D B;  4LVK A;  1RI0 A;  3JCM c;  3QO7 A;  4BDY A;  4F7U F;  3QO3 A;  4P72 A;  3A5Z A;  2RHY A;  3C12 A;  2I2L A;  3QZ5 B;  2PU9 B;  1ZBX A;  5GAO r;  3HRU A;  3BY7 A;  3OYE A;  4M77 D;  2DVE A;  2AKW B;  2PVO B;  4P72 C;  3A31 A;  4YRE A;  1WNL A;  5IT9 E;  5K1X A;  1XQH A;  4C0G A;  2GFA A;  2MI6 A;  2ZPG B;  4C5H A;  2KDS A;  4O5V A;  5LJ5 e;  4QQD A;  3HXV A;  4Q6G A;  4UP8 A;  4L87 A;  3J81 E;  3TU4 K;  1G3S A;  4KR2 A;  3HHT B;  1VQ9 A;  1JJC A;  3NET A;  4J5Y A;  2E64 A;  4RQF A;  4IUT A;  5CO7 A;  3INZ A;  4C8Q G;  1KHI A;  3E19 A;  1NE8 A;  2CZ1 B;  4E47 A;  1C0A A;  3GP8 A;  4KUI A;  3RMS A;  4YRR A;  2PME A;  1Q7Y C;  1M5Q 1;  3NTI A;  3BW1 A;  3OYG A;  1I5L A;  2HAX A;  1SRY A;  1VUB A;  5FLX E;  4CI0 C;  4M7A G;  2MF2 A;  3N5B B;  1B34 A;  2MWP A;  2RK1 A;  4FU6 A;  1M1K U;  3CMA T;  2PUO B;  4VUB A;  3IG2 A;  1UB4 A;  3EAE A;  3OS0 A;  5A0G A;  2P0K A;  4XTZ A;  1VQK A;  3S6W A;  3QYG B;  3AHU A;  4JUV A;  4P75 A;  5LJ5 d;  2DXB A;  4M78 E;  5I21 A;  1OZ2 A;  1MGQ A;  3HXX A;  3OS1 A;  4K88 A;  4WF2 A;  3CPF A;  4CH5 A;  5D6Y A;  2DZC A;  4P75 C;  3BDU A;  2V8K A;  4C8Q D;  4M78 B;  4BY6 B;  3OW2 S;  2IVW A;  2Q5I A;  1BKB A;  1M8V A;  3P8V A;  5GAN j;  4CH4 A;  3PZC A;  3QO8 A;  3OYK A;  1M9S A;  4YRM A;  3CCQ A;  3CC2 T;  3QII A;  2JOY A;  4M7A D;  4E7L A;  4M7D G;  3PCO A;  3CCU T;  3HFZ B;  4MML A;  3HXZ A;  1VQ6 T;  2E10 A;  3CC4 A;  4YRG A;  4IUQ A;  3JCM b;  3M55 A;  2RI3 A;  4H2U A;  5CKE A;  3VUB A;  1O75 A;  1EVL A;  1WQ7 A;  3G4S A;  4BE1 A;  3L2Q A;  1N8R C;  2DPP B;  3I55 T;  3JCM V;  3OYL A;  4QQ6 A;  4YRJ A;  4QW2 A;  2QQ9 A;  3HRI A;  1YJW A;  2EKO A;  3TEG A;  5GAN 8;  2KVQ G;  5CAI A;  2X4J A;  4OMF B;  3F70 A;  1Y7X A;  3VQV A;  2EJG A;  3V7R A;  2FB7 A;  5CR2 A;  4BDZ A;  1JB0 E;  1H3Z A;  5GMK j;  3MET A;  3P8B B;  2RM4 A;  1OI1 A;  4QVZ A;  1YCY A;  3OS5 A;  1N9S A;  2DAQ A;  3VJP A;  3OA6 A;  5J26 A;  2AMC A;  3L2Z A;  2WSE E;  4QQG A;  3FDR A;  3P8Y A;  2XHC A;  2VXE A;  1BBU A;  4PJO A;  4NOY A;  1E22 A;  3A5Z B;  4KBM B;  1X01 A;  3REX A;  3SWN A;  1Q81 C;  4XU2 A;  12AS A;  2FYK A;  4M7D D;  2CZ0 B;  4FM4 B;  4C92 G;  1UGS B;  1PYS A;  1N9W A;  3CCJ A;  3FIF A;  5CKF A;  4PJO C;  3CCR A;  5GAN 2;  4HT9 A;  5GAN 4;  2QXF A;  3SWN C;  3JCM J;  4UP7 A;  2OTL A;  2WAC A;  1WYD A;  2Q7G A;  1P92 A;  3CEY A;  4F7U G;  2GQV A;  3VQW A;  2LQK A;  4ZN3 A;  3E1S A;  1VQM A;  2K5I A;  4ELZ C;  1XTD A;  3GF5 A;  4P5N A;  2G4C A;  1Z7M A;  2M0O A;  1YFR A;  2ZNJ A;  3M58 A;  4M75 F;  1B70 A;  3VQY A;  4EMH A;  4XQ3 A;  2PQW A;  3KUF A;  2K57 A;  3L2W A;  2EJF A;  1JJC B;  3S3O A;  2ZT7 A;  1VQZ A;  2CJA A;  3JB9 J;  3VKI A;  4E7J A;  5A0L A;  3UH0 A;  2P4T A;  4YYE A;  4C0D C;  5LJ3 g;  2YRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...