2EJGA

Crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
235
structure length
232
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 64
structure length 232
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ejgA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2ejgA01
3BW1A 4RMFA 2RHSA 3A7UA 1BBWA 2ZTGA 2DVEA 1X56A 3JB9I 3HRIA 1WQWA 1MGQA 5LJ5e 3EFSA 3HXZA 4J15A 3LSQA 5ELNA 5KNNA 4TVAA 2K57A 5GANh 3BY7A 4C92A 2ZXFA 2G4CA 1C0AA 4PJOF 4H2WA 5K1XA 1X55A 4H2TA 1USYA 1KQ2A 4EO4A 4YRIA 4V2SA 1ASYA 1X01A 2VC8A 4CS3A 4YCWA 3V8LA 3HSBA 1E1TA 1N9SA 4OP0A 1WYDA 4X9DA 1H641 2QHSA 4C8QG 4C8QE 4F7UF 1NJ2A 3FIFA 1QF6A 3L1AA 4NL3A 4YROA 4N0AC 2DXUA 3RIRA 3HXYA 4P72C 2CGHA 3MF2A 3HFVA 4M75A 2ZGWA 1LOJA 1Y96A 3UGTA 3A5YA 3JB9G 4YREA 4H2VA 4K87A 4EX5A 4J6XA 2EJ9A 4JUVA 4P71A 2DTHA 3JB9D 1YFTA 4H2UA 3A5ZA 4C92B 1SESA 4M78F 4F7UA 1JRIA 2PMFA 1QE0A 2ARSA 3QO5A 1E24A 2ZR3A 2DXTA 4M7DC 4M7AF 4YRPA 3JCMd 3HFZA 1WLEA 4TTVA 2RHSB 5GAMe 1Z7MA 3LSSA 5LJ3j 1NJ5A 5GANg 4MMKA 1ADYA 2Q7GA 2RD1A 4M7DA 3NEMA 1M8VA 4KQEA 4H02A 4H2SA 1HXDA 3QNEA 3TEHB 3VBBA 1TH7A 5GAMj 3RACA 1LNXA 4AH6A 5GAN8 3HXUA 1RIQA 3IKLA 3GIBA 1WU7A 1WQ7A 2DQ3A 4YRRA 4XU3A 3RF1A 2AKWA 3P8TA 3E9IA 2DZ9A 4H2YA 4XTWA 2E1HA 4L87A 5LJ5f 3JCMP 2ZIOA 4P3NA 4M75E 3QO8A 4Q6GA 2CJBA 3JB9J 4C8QC 4HWTA 2ZR2A 2DQ0A 2CJ9A 4RDXA 3OD1A 1YCYA 2Q5IA 2DEQA 4CH4A 2I4NA 4UPAA 4P73A 3M4PA 4M75F 4M77A 1U1TA 1B34A 2C8MA 3M4QA 4YRCA 5GAMd 2ZIMA 1LYLA 4YRNA 1IL2A 1HC7A 4WJ4A 1NNHA 1EIYB 2I4OA 1WNLA 2XGTA 4M77B 4C8QD 5GMKl 5CAIA 1U1SA 4EMKC 3P8YA 3HFOA 5GANf 4CH5A 11ASA 5I21A 4J6WA 3HRKA 5HGQA 3QO3A 1B7YA 2I4LA 3IKMB 1X2GA 3L4GA 3W3SA 2ZT8A 3IG2A 4XTZA 4MMLA 4P73C 4P3PA 4YCVA 4NL2A 4EMKB 1M5Q1 1D3BA 4M78B 2XTIA 4WI1A 1EIYA 3JCMf 1H4VB 1W66A 2DTIA 4P71C 3TEGA 3UFGA 4PJOE 3V7RA 4EMHA 2QHUA 2QHTA 5C52B 1PYSA 1NJ8A 2AMCA 3AHUA 5GANd 2I4MA 3JCMJ 4OLFA 1N9RA 4YRLA 4M7AD 1E22A 3QHSA 3MEYA 4PJOB 5K1PA 2QTXA 4F7UB 4M7AG 4ZTUB 3JB9H 4RCBA 3HXWA 1KQ1A 4DQ2A 2FYKA 3RKYA 4TWAA 1I4K1 5GAN3 2DZCA 1LJOA 5ELOA 2C7IA 2J3LA 2IY5B 4PJOC 3JCMh 2E5AA 3SWNB 1H4SA 1EOVA 5C51B 4CS4A 4XTXA 2EL9A 3HTZA 4JRIA 4NCXA 3VQVA 3EFRA 2DJZA 1KOGA 2I2LA 4Q15A 2QHVA 2AKWB 3M4GA 3TUPA 3JCMc 4WJ3M 3A7AA 4YRQA 4M77E 4C8QA 1J5WA 4M7AB 2JN0A 3HFZB 3RKWA 4EMGA 1ATIA 5E3IA 4H2XA 1EFWA 2RM4A 4UP7A 4PG3A 1NJ6A 5GMKe 5LJ3h 1G5IA 4UP8A 2YLBA 1BIAA 1E1OA 1N9WA 1JBMA 3SWNC 2ZNJA 2ARTA 4XU2A 4G85A 4HA8A 3JB9F 1USYC 3VQXA 4KR3A 4YRTA 3E9HA 4K86A 4PHCA 2EJGA 4RQFA 4M78E 4C92F 3VQYA 4QVDA 3ICAA 1G51A 2P5IA 3QSUA 1YB3A 1Y96B 1YFRA 2DU7A 4PNOA 5GAOp 3PGGA 2ZZFA 4YRFA 4C92G 5GMKi 2DU5A 1HK9A 4C92D 1JJCA 4P74C 4JLIA 5GAN2 2RB6A 2RA2A 4CH3A 4YDQA 5GAOn 2DDZA 3PCOA 4M77D 4C8QF 4F7UE 4HT8A 4CS2A 1FYFA 3HY0A 3NETA 3QTCA 4XEMA 4PJOA 4HWSA 2YLCA 4XU0A 5GAN5 2ZT6A 3CMQA 4H2XB 4HVCA 3INZA 5LJ3d 4Y91A 3KFUA 4C8QB 1I8FA 4PJOG 3BJUA 5GMKh 4M75D 4TVAB 3A32A 2AMCB 3PCOB 3JCMW 4RQEA 4M75G 2EWNA 1H4TA 2ZT5A 3NELA 1JJCB 1EVKA 5LJ5j 2VXFA 4M7AA 5LJ5g 4LNSA 3A7RA 5GAN4 4M78A 4XTVA 5GMKm 2P0LA 3QO7A 4M75C 12ASA 2ZINA 3FJPA 3RESA 2CJAA 2IY5A 4YRKA 4HWPA 1B8AA 4C92E 3DSQA 4P74A 1B76A 4P75C 2ZNIA 3V7SA 3RL6A 3SWNA 4JRKA 3I7FA 3L4GB 3JCMX 3RERA 3JCMe 2ZT7A 4F7UG 5LJ3f 4TVYA 4QVCA 5GAOq 2ALYB 4BWAA 5GAN6 2ODRD 1B70A 3JCMb 3SB2A 4X9CA 5C53B 4XTYA 3A74A 4ZIBA 1I5LA 4YYEA 4HWRA 4O2DA 3R07A 1X54A 3REXA 4P3OA 3RKXA 1SRYA 5LJ5h 2CIMA 1H4QA 1KMMA 3MF1A 5DY9A 1D3BB 1EVLA 3G1ZA 3JCMQ 3ERRA 2E64A 2RHQB 4YP0A 2PMEA 1L0WA 2ARUA 4M78G 5GANe 2ZCEA 5GMKj 4M7DF 5GAMg 4M7AC 3FB9A 4M78D 5GAOl 3A31A 4RCCA 3UH0A 4K88A 4XEOA 1YFSA 4J6YA 2Y90A 4TQFA 4M78C 5GANj 2ALYA 5LJ3g 1NYRA 1B7YB 4A54A 3UGQA 4WF2A 2Q7HA 4HWOA 3VU3C 4C92C 4HT9A 2DTOA 3PZCA 2DKGA 4E51A 3BFMA 2EAYA 3V8KA 1WPYA 4TVWA 4J5YA 3REUA 4M77G 3HFNA 4G84A 2Q7EA 3P8VA 3HXVA 2ODRC 2RHQA 3IALA 4X5OA 4A53A 3HY1A 2E65A 4XTUA 4XU1A 5LJ3e 3TEHA 1PYSB 1NJ1A 1B34B 2YHTA 5GAMh 4M7DB 2E3CA 4YRJA 4PJOD 4YRGA 3NENA 4NOYA 4P75A 1GGMA 2ZZGA 1B70B 1HTTA 5LJ5d 1KMNA 4EMKA 2HNIA 4YCUA 3JCMg 1X2HA 3QUIA 4M7AE 4TQDA 4UP9A 3RGLA 2FB7A 4ZTZB 4M7DE 2E41A 3JCMV 2Q5HA 1ADJA 4YRSA 4YPFA 5GAN7 1Z7NA 1EQRA 1SERA 3BDUA 4M77F 1ASZA 1VQZA 5F5WA 2ZZEA 1BIBA 4CH6A 5GAMf 1SETA 3WQZA 4M75B 4N0AA 4DPGA 1NYQA 1YGBA 2J3MA 3V8JA 4M7DG 5GAOr 2E10A 3HXXA 4KR2A 4YRMA 1BBUA 4M7DD 3VQWA 2EJFA 4XQ3A 3LC0A 3L2ZA 3V7CA 4BW9A 4P72A 5GAOm 2VXEA 1G5HA 3RUXA 4M77C 1I81A
chains in the Genus database with same CATH superfamily
3A7UA 2DIGA 3HPWA 5L8RE 1B7TA 1VQMT 3JB9I 3HRIA 3EFSA 4KUIA 5ELNA 4ZNXA 4C92A 2RI5A 1VQOQ 2G4CA 2W0ZA 4PJOF 1M1GA 2LDMA 4H2WA 4H2TA 1G3WA 3OMCA 2VC8A 4ZGEB 4YCWA 1TOVA 2JT4A 3HSBA 5A0DA 1N9SA 4QQ6A 2RK2A 3KBGA 4OP0A 4R56A 1WYDA 4X9DA 3KXTA 4C8QE 1VQ9Q 2M0OA 2F5TX 3FIFA 1M1KR 2BTTA 1SHGA 1KIKA 2DXUA 3RIRA 4P72C 2CGHA 2QQSA 4C0GA 2ZGWA 2MCNA 1Y96A 3OYLA 3A8LB 4J6XA 4RTVA 2CUDA 8ATCB 3JB9D 1YFTA 3A5ZA 1ACMB 3CCUQ 4M78F 2PUKB 4F7UA 1YHQQ 4FW2A 4BI8B 2GGRA 2ROLA 4ZN3A 2ARSA 2KRNA 1E24A 2HAXA 3OYJA 4M7AF 1K73U 3JCMd 2M1HA 2MIOA 3HFZA 2DK3A 4TTVA 2RHSB 2AKKA 3CPWS 3CCQA 3LSSA 5GANg 2QGFB 3I56Q 1KD1U 2RJDA 1ZLMA 4H2SA 1HXDA 3M0TA 3TEHB 1M3AA 2JTFA 2K4YA 1TH7A 5GAMj 1NBEB 3J7AF 1HSQA 3HP9A 1PD1A 2NUPA 3GIBA 1WU7A 2EQIA 1UGPB 3E9IA 3H8ZA 1GBQA 2MI6A 1VQ7A 2GTJA 1X6OA 4JLGA 4RTXA 3QO8A 1QQJA 2CJBA 3JB9J 4C8QC 1AD5A 4HWTA 3CCVQ 3CMAA 2BZXA 2CJ9A 3VS1A 1YCYA 2L89A 2OTLA 3VRZA 3LWHA 3HL8A 4P73A 1Q81U 4N4IA 1LPLA 1QVFA 1K73R 2GQVA 2LNHB 5CKFA 2C8MA 1BKBA 1MMGA 1G5VA 2DYBA 4II1A 2I0NA 2DAQA 2L8DA 1CKBA 4ELYC 2CZ0B 1IL2A 4PLLA 3VUZA 2ED0A 1TG0A 3OB9A 1EIYB 4NS5A 3UPUA 4C8QD 1OX9A 4IUPA 1Q82C 5HK3A 4EIKA 1VQ8T 3M0SA 1U1SA 2DM1A 2GFAA 3M59A 4EMKC 3QKJA 1B7YA 1K9MR 4EPCA 3TEEA 4JS5A 3W3SA 1QWFA 3PIOA 1PD0A 1C1AA 1YN8A 2XIDA 3D7SB 2PU9B 4P3PA 2HMAA 1NM7A 1WYXA 3J80E 3M4YA 2DTIA 3U23A 3UFGA 4EMHA 3C12A 5C52B 1KK7A 1ZBXA 2QHTA 5KYWA 2AZVA 2J7IA 1UTIA 2YUOA 1IGQA 3M53A 5GANd 2I4MA 3S3OA 3EFOB 4DA4A 3CMAQ 2LRQA 3NTHA 4OLFA 2K3YA 2B8AA 4M7AD 3QHSA 4GBQA 3DB3A 4E6RA 3MEYA 3E9FA 3LH0A 4F7UB 2CREA 4A4GA 1KQ1A 1WHLA 4DQ2A 1ABOA 2DLPA 3RKYA 2Y4XA 5I22A 2DE0X 4F17A 5ELOA 4FSSA 3S6WA 4LVIA 2IY5B 4F14A 4PK4A 3JCMh 1M2OA 5D7UA 3P8BB 2E5AA 2YDLA 1GXIE 5C51B 1UG1A 3MP1A 2QK0A 2EL9A 3VQVA 2V26A 2O2OA 1KOGA 4Q15A 3M4GA 2HSEB 4J7IA 3CCQQ 3VS4A 4YRQA 4M77E 1J5WA 2VGMA 4M7AB 2JN0A 2KEAA 1X43A 2A28A 5HCKA 4EMGA 1K1ZA 2QTVA 3VS0A 2RNAA 5CKBA 1S72A 1FMVA 3CXCA 1G5IA 1R0CB 1ZSZC 1Y0MA 1N9WA 4BI4A 3OYNA 2ZNJA 4XU2A 3KFVA 4HA8A 3JB9F 2LMJA 4ORZA 2X3XD 3VQXA 3OS5A 1RAFB 1BBZA 4E7KA 4PHCA 2EJGA 4LVLA 5FROA 2KT8A 2ZPEB 4PLIA 1G51A 1GCPA 2D0QB 4UC4A 2R57A 3PT9A 1M90R 2COYA 2DU7A 3PGGA 2O4XA 2NUPB 5GMKi 1M3BA 3CBMA 4C92D 1BK2A 4OGCA 1N8RR 1VA7A 2VYTA 4JLIA 3PMIA 5GAN2 2RB6A 1YITA 1Q7YR 4CH3A 2RJFA 1HD3A 3PCOA 3OY9A 1KQSS 2LCLA 4HCBA 3QTCA 4XEMA 2LZ6B 4OMOA 2CP6A 2YLCA 1K0SA 2ZT6A 4OMNA 3CMQA 2CKKA 5I11A 4HVCA 3M57A 5LJ3d 4Y91A 1VQ8Q 3KFUA 2HQEA 4JDSA 2BZYA 4HVWA 2ESWA 4HVVA 3CPWA 1VQPQ 1GL5A 1EVKA 4RTTA 3OYBA 1RUWA 3H0IA 1MV0B 2L2PA 4XTVA 4M78A 1OZ2A 5GAN4 2KVQG 3CXCS 2QEXQ 12ASA 3QO7A 2KMTA 1G83A 3FJPA 4OMFB 3RESA 2IY5A 3CCMA 5KYXA 1VQPT 2KE9A 5EC7A 1UDLA 1B76A 4P75C 1ARKA 3MKDA 3SFMA 2DL3A 2ZNIA 4FW1A 4HCCA 3RR6A 3JCMX 4Z89A 1WHKA 3CCVT 1BI1A 1RLQC 2ALYB 4BWAA 2K5FA 3EFOA 1AT1B 4DOVA 3JCMb 1RI0A 4ZIBA 1IO6A 1KD1R 1JXOA 5D6WA 3LYIA 1X54A 3X28B 5LJ5h 3G1ZA 3JCMQ 1JO8A 2E64A 4OGEA 2RHQB 1L0WA 4GLKA 3RNJA 2LTOA 1CSKA 2EYXA 1HYOA 5GAOl 3UH0A 1TU0B 1DJ7B 2F5KA 2K3XA 4RTUA 1NYRA 2KXDA 1B7YB 4A54A 4DEXA 2HQHA 1U8RA 3PZCA 1WX6A 2DKGA 2RMOA 2JZ2A 4E51A 2P4TA 3OYGA 1P92A 4J9CA 3VKIA 1WPYA 3I9QA 3URGA 3HFNA 2Q7EA 5CKDA 1Z9QA 3IALA 1YIJQ 4C5GA 2BIVA 2QG9B 3MPUB 4XU1A 5LJ3e 3EHRA 1NJ1A 4HKEA 3OS0A 2E3CA 1VQ9A 1VQNA 2CH4W 4YRGA 4NOYA 4P75A 2PZ1A 5C0MA 3VUBA 2PVGB 1NYGA 1TXQA 3IQLA 2EBPA 3EG1A 4Q5WA 2FB7A 4ZTZB 2OX7A 2E41A 3G6EA 3CC7T 1VQOT 1BI3A 2PUOB 2KAFA 1M3CA 2EQUA 1Z7NA 2LCSA 3J81E 1SERA 1V1CA 2HEQA 1YITT 1NZ9A 1I1JA 1GFCA 1LCKA 1VQZA 2RJEA 5F5WA 5GAMf 1NPRA 2E12A 3CMEA 4M7DG 3CC4Q 1UFFA 4E2FB 1YJWQ 4YRMA 4DEYA 3OYFA 3CC2A 2EJFA 4BW9A 1PM3A 1OI1A 1UB4A 5GAOm 3QBYA 2RHSA 4ZGDB 5CR2A 1AOJA 1WQWA 4O5VA 2J05A 1KQSP 3OYDA 2K57A 4PL6A 1WJQA 1C0AA 2DF6A 1NEBA 1H92A 1W2BA 2K3BA 5K1XA 1Q86U 1USYA 2E4HA 3CCVA 4CS3A 3QG1A 1OOTA 1G3SA 4LNPA 5FWCA 4L59A 3V8LA 2XU8A 4MZTA 4LUEA 2J6OA 2RJCA 3L2VA 3UWNA 2C06A 1QF6A 2KXCA 4JZ3A 4DOWA 2K79A 1Q7YU 3CCRT 2X4JA 4ZTJA 3CPWP 1X75C 3OQ5A 1GCQC 2KR3A 2YXYA 4N4GA 3OYKA 2J6KA 1LOJA 3TSZA 3LLRA 1RAEB 4K87A 3UF4A 4EX5A 1KFZA 2EJ9A 3EH1A 1BI2A 2DTHA 3QZ5B 4IUTA 2CZ7B 4C92B 2YWWA 4IKFA 1PKSA 3VS3A 1X6BA 1M1KC 2ZR3A 2DXTA 4FIBA 4YRPA 5L23A 1WLEA 2C0TA 1VQ4T 3NHNA 4OMMA 4MMKA 3C0CA 1ADYA 1AZGB 4Y92A 2RQVA 4ME7A 1LNXA 1M90U 4AH6A 1Y07A 1OX8A 1K4US 2DEUA 4YRRA 3P8TA 2C0IA 2DIQA 3LGFA 4JJCA 1M1FA 2E1HA 4L87A 3ZFJA 2L3QA 2ZIOA 4N4HA 2ED1A 4M75E 3EG0A 4J8OA 3G6ET 2XG8D 1IB8A 3CC7A 1SG5A 3A8OB 4RDXA 2KDSA 3A98A 4C5EA 1K8AU 3C4SA 1R8OB 3CBOA 2DEQA 1VOMA 2DETA 4KUDK 4CH4A 1RABB 1UUEA 1IRXA 4LD9K 2NWMA 1VYVA 4M77A 4EDUA 2YRDA 1YJNQ 3M4QA 3CCST 5KE2A 4ZN1A 2LQNA 1NJIR 2ZIMA 4RTZA 2XDPA 2DL5A 3OBWA 1LYLA 1JB0E 1RAAB 2VWFA 1VQ5A 2XK0A 1K8AC 5CQXA 3C95A 1PRLC 1VQMQ 1VQKA 2I4OA 2XGTA 4AFQC 2NUTA 4AG1C 3NPFA 1OU9A 4QW2A 1QVFP 2LT4A 3G4SA 2NS6A 1YITQ 2E5QA 3P8YA 3HFOA 4CH5A 1UGRB 4J6WA 2FPDA 3JRZA 1JJ2A 1YJWT 2AIRB 3QZ9B 1QLYA 3CD6A 4HCKA 3IG2A 3E9GA 2RHUA 5DLQE 1SPKA 2NYSA 4JZ4A 2DRMA 2ZPGB 1ZBJA 2MWPA 2QQRA 2V8JA 3SEMA 3QYGB 4YCVA 2GBQA 1YI2A 4NL2A 4EMKB 2JNGA 1VQ4Q 4M78B 1Q81C 5KH6A 3PIPA 1M90C 2XTIA 3M54A 4WI1A 3MEVA 1EIYA 1VQ7Q 2KBTA 2D6FA 1OZ3A 1N5ZA 2A08A 3V7RA 1PYSA 4IIOA 1NJ8A 2H3EB 3X20B 3PTAA 5KYYA 3AHUA 1X2QA 2CZ6B 1OU8A 3JCMJ 1S72Q 2HDAA 3RDVA 2OTJT 3OMGA 4YRLA 1QP2A 1WHJA 1E22A 3WXMB 2ATCB 4FYWB 2KYMA 1MV3A 4M7AG 4ZTUB 2PTKA 4RCBA 4JS4A 3HXWA 3I55T 5AYFA 2RH2A 8AT1B 4TWAA 3I5RA 1GCQA 4LDUA 2B86A 2J3LA 1WHMA 2RHIA 1VQ4A 3FDRA 3M0PA 3VS2A 1OEBA 2DD4A 2D8JA 3SWNB 1H4SA 1EOVA 5KYNA 2FRWA 1M9SA 2V1RA 4FU6A 2O4XB 3CCUA 1KSWA 2DJZA 1BYMA 1IXDA 2KY9A 3EAEA 2VB6A 4WJ3M 4DBQA 2O01E 3O5ZA 2FZKB 1O9SA 2EYZA 5E3IA 3OYEA 2LJ3A 1ZQ1A 6AT1B 1YJ9A 3A1PA 2FG0A 5ECAA 2LT1A 5KCHA 1TTHB 1D1AA 1BIAA 2BZ8A 1E1OA 1JBMA 3HHTB 2JM9A 2IPOB 1VQ8A 2WSEE 3QXEB 1VQ6Q 3CMEQ 3M9QA 1XTDA 3VYHB 3EG2A 1T0JA 4A63B 2QA4Q 1BCOA 2JM8A 4K86A 3A5ZB 5CKHA 1R0BG 5IXBA 2SEMA 3EG9B 2YUQA 1YJNA 4LE9A 2GFUA 1GRIA 3QSUA 1Y96B 3G6EQ 4PNOA 5GAOp 2ZZFA 1HK9A 1ZUKA 2DILA 2P0QA 1Q86R 4QQDA 1W1FA 2XMFA 2QI2A 4B9XA 1JJCA 2XDDA 4P74C 3MCAB 1YJNT 1VQNQ 4M77D 4F7UE 4HT8A 5FRNA 4CS2A 1ZSZB 1NJIU 4HWSA 4Y28E 4HCZA 4XU0A 2QDYB 2MF2A 3X26B 4L6V5 2EQJA 2HQXA 1I8FA 2E3IA 4C8QB 3ZBDA 1YIJT 5GMKh 4P5NA 3A32A 2DL8A 2MPXC 2M51A 2RN8A 1KQSA 4RQEA 1H4TA 1BCMA 1QP3A 1JJCB 4FCYA 4LNSA 2O88A 3A7RA 3CD6T 4PFPA 1D0ZA 1KC8U 2OAWA 4KH1B 4Z02A 4BB7A 3FC3A 2CYZB 2CJAA 4KBMB 1NEGA 2KGTA 3THKA 2VGNA 2COWA 2FHDA 2A8EA 3RL6A 3M56A 4RTYA 4PJJA 1K9MC 1TUCA 3I7FA 3JCMe 2YUPA 4E47A 3Q1JA 4FYYB 3UA6A 3OYAA 2FZGB 1FMWA 2DXCA 2ODRD 5AT1B 4X9CA 3VS6A 4WTOB 2JTEA 2LC4A 3VYGA 5J39A 4J9FA 1I5LA 5A2QE 3CCQT 2OJ2A 1KMMA 4QQGA 5DY9A 1EVLA 3ERRA 4AFSC 1UJ0A 2PVOB 1QVGP 2ARUA 4M78G 2DMOA 5D6XA 5GANe 3E1SA 1YHQT 2LP5A 4LVMA 3MEAA 4IIMA 4M7AC 5GAMg 1AZEA 3FB9A 3A31A 5FLXE 4RCCA 4XK8E 4J6YA 5M9OA 1KG1A 4M78C 4ZTFA 3UGQA 4HWOA 2Q7HA 3GNFB 2A3LA 4HT9A 2DTOA 1RL2A 2NLUA 1BB9A 1E6GA 5IHIA 2D1XA 4D8DA 3BFMA 2EAYA 4BY6C 1RI9A 1W2BP 3REUA 3H0HA 3P8VA 2BKDN 2QA4T 1WXBA 4A53A 2BE7D 3HY1A 2E65A 4XTUA 1VQ6T 3TEHA 1PYSB 2L3RA 1B34B 5GAMh 4YRJA 2P84A 4PJOD 3CXCP 3ZL7C 1W4SA 1UGQB 1KMNA 4A4HA 4EMKA 3MHXA 1E6HA 2QA4A 1MNDA 2CH4A 3JCMg 1H3ZA 1X2HA 3ZEHA 4UP9A 3QYHB 1K9AA 3JCMV 4YPFA 1W2BS 5GAN7 2LCCA 2D9TA 2JS2A 1ZX6A 2DYIA 4J9IA 3TU4K 1X2KA 1ASZA 3PVLA 2X51A 2DJQA 1BIBA 1NYFA 2HSPA 3NMZC 4WCIA 3WQZA 4DPGA 1NYQA 2DXBA 3V8JA 2E10A 3HXXA 4KR2A 2EPDA 3VJPA 5HKCA 1G8XA 2NUTB 3TQ7P 4M7DD 2QQ9A 4XQ3A 3LC0A 3L2ZA 2CP0A 4J9GA 3V7CA 1YP5A 2A0FB 4HXJA 2LX7A 3CCRQ 4ELZC 3CPFA 3EGDB 2D8HA 1B07A 5LL6S 2VXEA 3RUXA 3EGXA 3BW1A 5DLOA 1T3LA 4BI3A 3CMAT 1SRMA 2DVEA 2ZTGA 1G3TA 1X56A 1MGQA 5LJ5e 2AHJB 4J83A 4J15A 3LSQA 1AWXA 4TVAA 1ZSZA 3I55Q 3BY7A 5GJWB 2ZXFA 3CQTA 3CCJQ 2HKNA 1KQ2A 4EO4A 4V2SA 3QDFA 1X01A 3KUFA 3JAME 3QPHA 1YHQA 2R5AA 1E1TA 1WXTA 1H641 4C8QG 2A7YA 4F7UF 4PJNA 2L3SA 2IG0A 1EX4A 3SD4A 4CRIA 3TREA 4NL3A 2DX1A 4RKUE 4YROA 4N0AC 2P0KA 1GFDA 2F2WA 3HFVA 4M75A 4F04B 3M55A 2HBPA 5J26A 4BD3A 4FYXB 5FU7B 5C6SA 1U3OA 4H2VA 4J9HA 4P71A 3UDCA 2F2VA 4KGVB 4H2UA 1T3SA 2LNVA 3CD6Q 2CT3A 1W6XA 2KYBA 1JRIA 1WXUA 4JPBW 3OYYA 2LJ0A 3P8HA 3QO5A 1WDXA 5A0LA 4M7DC 1MMNA 4AG2C 3JSCA 5LJ3j 2G6FX 2Q7GA 9ATCB 4M7DA 1K0XA 1M8VA 4KQEA 4H02A 4QKUA 1PNJA 2F2XA 1F1BB 1I07A 2JJ9A 3HXUA 1RIQA 3IKLA 3EGDA 1WQ7A 4XU3A 3RF1A 2JMAA 1M2VB 2RHXA 2DZ9A 1SHFA 3E2UA 3S3MA 1EZZB 3NFCA 4KGZB 4M4ZA 3CCSA 4P3NA 2HZYA 2ZPFB 2DQ0A 1PG5B 2HL3A 4C0ZA 4B9WA 2KK4A 2Q5IA 2I4NA 3MP8A 5CCAA 1UHCA 3M4PA 1EFNA 3C94A 1WLPB 4AT1B 1MMAA 3QJ6A 3PFSA 3EG3A 4YRCA 1VIEA 1V76A 1Y57A 1NE8A 1YIJA 1QKWA 1PSEA 4KULA 5IXFA 1BU1A 2CT4A 4LD6A 3QDRB 1HC7A 4WJ4A 1NPPA 1VQLA 1WNLA 2PVDB 3UA7A 4A4FA 5GMKl 3I35A 4TVRA 2DBKA 4CC3A 2K5IA 5IAYA 5EG2A 5GANf 2RI2A 3HRKA 2VVKA 3QO3A 3IKMB 1FWZA 2CSIA 2DRKA 2H8HA 4FSXA 1FYNA 4Z8AA 3CEYA 3I55A 4OB0B 2XDBA 3TSWA 1M2VA 2XICA 1A0NB 1IHWA 1PCXA 1M5Q1 1D3BA 3GLXA 3VS5A 1PWTA 1WHHA 2DNUA 3JCMf 4DBFA 3CCEA 3OW2A 1H4VB 1W66A 4P71C 3CCRA 3TEGA 3X25B 1SRLA 4PJMA 2DA9A 2QHUA 2HBWA 2O9SA 1UGSB 2YRVA 1ZUYA 1ABQA 2PQWA 5IN1A 1AHJB 3OYIA 1N9RA 1J3TA 3FJ5A 3CCLQ 2CS7A 3GOXA 1VQLT 1X69A 1QKXA 3TVTA 5GJVB 4RTWA 2QDLA 2RHZA 2XKOC 2DZCA 1YJWA 2KROA 2RQTA 4VUBA 4BACA 2RPNA 4PJOC 2MYSA 2EFIA 2VUBA 3MP6A 1JJ2P 4CS4A 3HTZA 1AWOA 4NCXA 4GLMA 1LVKA 1VUBA 1VQPA 1VQOA 4BDYA 2QYZA 3HRUA 3OYMA 4J9DA 2I2LA 2QHVA 2AKWB 3JCMc 1M1KU 2A36A 3LW5E 2WSFE 1QCFA 3META 5D6YA 1ATIA 2JTMA 4H2XA 3I5SA 2IIMA 2RM4A 1XNIA 2CP7A 4PG3A 5GMKe 5LJ3h 2E5KA 4UP8A 5IHKA 1RAHB 2YRCA 3MEWA 3RMSA 1USYC 3CCLT 1YNZA 2V8KA 1E7OA 3G4ST 1UJYA 4KR3A 4YRTA 3E9HA 3LGLA 2ZPHB 3H41A 4M78E 4C92F 3VQYA 1Q82U 4QVDA 2X4WA 3F70A 1N6AA 4XAXB 4RG8A 3OS1A 2V8IA 2M9UA 1VQ5T 4YRFA 2EYQA 2DU5A 3T9NA 3QJYA 2IVWA 1QCNA 3DB4A 1QVGA 1D1BA 1W70A 3OYHA 2FPEA 4KH0B 2RHYA 1QVGS 5CK9A 2LVMA 2RA2A 5GAOn 3DLLA 2DDZA 4FT4A 1Y71A 2YUNA 3NTIA 3H6ZA 3HY0A 3NETA 1XJWB 4PJOA 3HTRA 5FU6B 3LWIA 5GAN5 4JJDA 4H2XB 3INZA 2ZZDA 3A8HB 4Z88A 3BJUA 4M75D 1GBRA 2AMCB 3PCOB 3JCMW 2QXFA 2CZ1B 2NUZA 4BDZA 3RMQA 3NELA 5LJ5j 2VXFA 5LJ5g 1N27A 2PNIA 3CCUT 2K6DA 1UHFA 2P0LA 4FT2A 4M75C 2VV5A 2DVJA 4E7IA 2ZINA 3M0UA 3MJXA 2EGCA 4YRKA 1UEBA 2E6NA 4A4KA 2HL5C 4A4EA 4HWPA 2QGGA 3DSQA 4C92E 4P74A 2JMCA 4JJNK 2D0NA 2EYWA 3E19A 4X1VA 3SWNA 3L4GB 1AVZC 1RADB 3AT1B 2ZT7A 2QEXA 4PFZA 4TVYA 4LDVA 4QVCA 2RQUA 5GAOq 1WFWA 4IURA 2H3JA 5GAN6 1JEGA 3OW2S 1VYUA 1D1CA 4FL6A 5C53B 4OF1A 2C0OA 1XQHA 4XTYA 2AK5A 1D09B 2L0AA 2EQMA 4HWRA 1JQQA 3R07A 3REXA 4OB1B 4P3OA 1H4QA 2V1QA 2CIMA 3MF1A 1D3BB 2GTOA 3L2UA 4ZGJB 2SRCA 1D0XA 4M78D 2JS0A 2MOXA 2ZCFB 4LN2A 3A8GB 3OYCA 4XEOA 1WI7A 3R6NA 2L3PA 1K73C 4JJBA 2F1LA 1Z9ZA 5LJ3g 2KRSA 2MK5A 4WF2A 1FX7A 2KSSA 4JRPA 4QT7A 2LX9A 1SF9A 4G84A 3CCLA 4OMLA 1TS9A 2ODRC 1WHGA 1JJ2S 2LQKA 2RHQA 1QVFS 4B6MA 2AT1B 1YBYA 4C0DB 2KI7A 4JRQA 1Y7XA 2YHTA 2O9VA 4DBRA 2YT6A 2RQRA 1GGMA 2ZZGA 4R0KA 1H8KA 5LJ5d 2CP2A 3G1JA 4YCUA 5CO7A 2K2VA 3ER0A 3CCJT 3QUIA 4M7AE 2OAUA 4J7FA 3LH5A 4K11A 3P8DA 2Q5HA 3PNWC 1ADJA 2DL7A 1YI2T 3NTKA 2Z0WA 4M77F 2QQAA 2ZZEA 4CH6A 4E7JA 1VQNT 3VV0A 2J3MA 4C0FA 1YGBA 2ZPIB 5GAOr 3QWYA 3ME9A 1S72T 1BBUA 2K5LA 1NLOC 1WJRA 2M02A 3I56A 1OPLA 3UATA 4P72A 1SKUB 1K9MU 1G5HA 3EG9A 4M77C 1X2GA 1WZOA 4RMFA 4LDXA 3M58A 1BBWA 4OMQA 1YFNA 3EGUA 3MO8A 1U06A 3HXZA 3EHQA 2X4YA 5KNNA 2XHCA 2X4XA 5GANh 5HY6A 1OPKA 3CCMQ 2DFUA 2EIFA 1X55A 3G7ZA 1KHCA 4YRIA 3HKSA 1ASYA 4J9BA 1NLPC 2AZSA 2LQWA 2VASA 2QHSA 1M27C 1K8AR 1NJ2A 1ZA1B 1VQKQ 2OI3A 2ZAEA 3L1AA 4CC4B 2FEIA 3OA6A 1N8RU 2ROTA 3CCET 3HXYA 3MF2A 3PVQA 2P0PA 3FEOA 4O6JA 3UGTA 1UGVA 3JB9G 3A5YA 4YREA 1KHIA 4BY6B 4JUVA 1D0YA 2RK1A 2QEXT 3DKMA 2CSQA 1SESA 2Y4YA 2PMFA 2HKQB 1QE0A 2GCXA 3BE3A 3CC7Q 3ULRB 2RO0A 3EGXB 5GAMe 1VQ6A 1Z7MA 1ZUUA 2GQIA 5KYYB 1AWWA 1NJ5A 3OBYA 2RD1A 3NEMA 5IHNA 3VRYA 3QNEA 3VBBA 3RACA 3S3NA 3L42A 2M0YA 5GAN8 3OS2A 1N8RC 1VQ7T 4CC2A 4RUGA 2DQ3A 2RQWA 1KC8R 2AKWA 3SDZA 4H2YA 4XTWA 1X27A 3MQZA 5LJ5f 3JCMP 1EIFA 3CCEQ 3BDLA 2KT1A 2BE9B 2DERA 4Q6GA 2OTLQ 3CCMT 2WACA 4QVZA 5KE3A 2ZR2A 5IH2A 1S1NA 2OTLT 1UE9A 3OD1A 1IREB 3CCJA 1IHVA 1Q82R 4YTLA 4UPAA 2CP3A 3I56T 4M75F 1PRMC 5KYWB 4PKCC 2BUDA 1U1TA 1B34A 5GAMd 2VKNA 4HVUA 2CUBA 1QWEA 2MMPA 3H9NA 1K76A 4DBHA 1SSHA 1B3QA 2WSCE 3REBB 3X24B 4YRNA 4KGXB 1YWOA 4BE2A 3EH2A 1NNHA 1UECA 4M77B 3PE0A 1RAIB 5CAIA 4BE0A 11ASA 5I21A 1OULA 3G4SQ 5HGQA 5CVIA 2K9GA 1XOVA 4RMOA 5I2SA 4J9EA 1QW1A 2I4LA 1RLPC 1M4ZA 2L5QA 4RG2A 1KC8C 3L4GA 2ZT8A 2X9HA 1VQ9T 4XTZA 5J3BA 4MMLA 3JV3A 1KD1C 2CP5A 3O8VA 1RACB 2RF0A 4P73C 4L5GA 1I81A 1M8MA 2X3WD 5KYUA 2P4RA 1OQKA 4ATOA 1TWBA 3FRNA 4PJOE 5KCOA 4IUUA 2X35A 5FWBA 1VQMA 5FU6C 2AMCA 1SSFA 2EKHA 1PHTA 1YWPA 4C5IA 3CC4A 1H3HA 3H0FA 2EQKA 2FRYA 3QWXX 4PJOB 5K1PA 2QTXA 1JU5C 3JB9H 1MMDA 2LQ8A 2FYKA 4HT4A 1Q7YC 3LX7A 1I4K1 4IUQA 3OSVA 4C5HA 5GAN3 3OW2P 1YJ9Q 1LJOA 1U5SA 2ECZA 2E3HA 2FL7A 4OVAA 2C7IA 2ZPBB 3WVDB 4MZPA 4BUGA 4GY5A 4XTXA 1ZHIA 1MHNA 2EYYA 4JRIA 3EFRA 4D8KA 3TUPA 5CKEA 2DBMA 3A7AA 2YSQA 4C8QA 1O75A 2HCKA 4LVKA 3HFZB 3RKWA 1C0MA 1FXXA 1QMCA 3R6OA 1EFWA 4AMCA 4UP7A 2JXBA 1NJ6A 2O31A 1RAGB 2YLBA 3G71T 3GPLA 4AFZC 3SWNC 2ARTA 4G85A 2FZCB 1AEYA 4E7SA 4E7LA 2MWOA 3FLGA 1I5OB 3RBBB 4RQFA 2QASA 2KRMA 2JUFA 3GP8A 3ICAA 1KJWA 3G71A 2P5IA 1YB3A 5I2MA 4OMPA 2EVRA 5A0GA 1YFRA 4ANJA 4C92G 1M30A 2LJ1A 1CKAA 3PMTA 1YI2Q 4KT0E 2E70A 3NGPA 4F16A 4C0DC 4YDQA 4PFOA 4PJLA 1IGUA 1WA7A 4C8QF 1C6VX 4BE1A 1FYFA 3UT1A 1MUZA 4KRTA 7AT1B 1PSFA 4MZMA 1TUGB 3L2RA 2MAMA 3CCSQ 4E7ZA 1AWJA 4ESRA 3HRSA 4PJOG 1QCOA 4TVAB 1MNEA 1YCSB 3M0RA 4M75G 2HD0A 2EWNA 2QQBA 5CIUA 2XD0A 2ZT5A 4M7AA 1VQ5Q 3DLMA 2W10A 5GMKm 1TUDA 1VYTA 4LDYA 4MDWA 1JXMA 1Q81R 2J06A 2EW3A 1B8AA 4AFUC 3L2QA 4MDXA 3CC2Q 3V7SA 2DO3A 3HRTA 3M0QA 4JRKA 3RERA 3GBQA 2QAZA 4LXCA 5LJ3f 4F7UG 1VQKT 1Q95G 1WJSA 3CC2T 2RI3A 2DPPB 1B70A 3SB2A 3REAB 1ZSGA 3A74A 3SHWA 2A37A 3CMET 4YYEA 2FPFA 1I0CA 1BI0A 2K2MA 4CC7A 2OTJA 4FM4B 4O2DA 2G3RA 2EGEA 2ENMA 3RKXA 1SRYA 2J6FA 4YP0A 2PMEA 1R77A 1WIEA 1ZA2B 3GF5A 2ZCEA 1G2BA 4OB3B 5GMKj 2FO0A 4M7DF 4IUVA 2R5MA 4LVJA 3MEUA 4K88A 1YFSA 2XI9A 3GNGA 2Y90A 4TQFA 2F69A 2CDTA 5GANj 1TSFA 1VIFA 2ALYA 5HK0A 3VU3C 4C92C 1NJIC 3OSSC 4OB2B 1PC0A 3WVEB 2DL4A 1PKTA 3V8KA 5FU7C 1OYXA 4TVWA 4J5YA 2GF7A 3ASKA 3QIIA 4LDWA 4M77G 5KYXB 3N5BB 3TCJA 3M5AA 4CI0C 3HXVA 4E7HA 1IZ6A 4X5OA 2DD5A 3CBPA 1QVPA 4D6WA 1VQLQ 5DM7R 2EGAA 2AKLA 4M7DB 3G71Q 1OV3A 5FW9A 2JW4A 3NENA 1G3YA 1B70B 1HTTA 2KNBB 5KYUB 2GNCA 2HNIA 5IT9E 5CQYA 3A8MB 1NG2A 1Q86C 4TQDA 4R55A 3RGLA 1FMKA 1X6GA 2JOYA 2M16A 4M7DE 2JVVA 3L2WA 4YRSA 3VS7A 1EQRA 2K7AA 2ABLA 3BDUA 2FVUA 2COZA 1SETA 1V29B 1T0HA 4M75B 4N0AA 2EKOA 4FYVB 2OTJQ 2R58A 1WGSA 1HJDA 4X34A 1YJ9T 5FRMA 2E6ZA 3VQWA 1SEMA 2KQWA 3CC4T 4LUDA
chains in the Genus database with same CATH topology
3A7UA 2DIGA 3HPWA 5L8RE 1VQMT 3JB9I 3HRIA 3EFSA 4KUIA 5ELNA 4C92A 2RI5A 2G4CA 4PJOF 1M1GA 2LDMA 4H2WA 4H2TA 1G3WA 3OMCA 2VC8A 4ZGEB 4YCWA 3HSBA 5A0DA 1N9SA 4QQ6A 2RK2A 3KBGA 4OP0A 4R56A 1WYDA 4X9DA 3KXTA 4C8QE 2M0OA 2F5TX 3FIFA 2DXUA 3RIRA 4P72C 2CGHA 2QQSA 4C0GA 2ZGWA 1Y96A 3OYLA 3A8LB 4J6XA 3JB9D 1YFTA 3A5ZA 4M78F 2PUKB 4F7UA 4BI8B 4ZN3A 2ARSA 1E24A 2HAXA 3OYJA 4M7AF 1K73U 3JCMd 2M1HA 3HFZA 2DK3A 4TTVA 2RHSB 3CPWS 3CCQA 3LSSA 5GANg 1KD1U 2RJDA 4H2SA 1HXDA 3TEHB 2JTFA 2K4YA 1TH7A 5GAMj 3J7AF 3HP9A 3GIBA 1WU7A 1UGPB 3E9IA 3H8ZA 2MI6A 1VQ7A 1X6OA 4JLGA 3QO8A 2CJBA 3JB9J 4C8QC 4HWTA 3CMAA 2CJ9A 1YCYA 2L89A 2OTLA 3LWHA 3HL8A 4P73A 1Q81U 4N4IA 1QVFA 2GQVA 2C8MA 5CKFA 1BKBA 1G5VA 4II1A 2DAQA 2L8DA 4ELYC 2CZ0B 1IL2A 4PLLA 3VUZA 3OB9A 1EIYB 4NS5A 3UPUA 4C8QD 4IUPA 1Q82C 5HK3A 1VQ8T 1U1SA 2GFAA 3M59A 4EMKC 3QKJA 1B7YA 4EPCA 3TEEA 4JS5A 3W3SA 3PIOA 2XIDA 2PU9B 4P3PA 3J80E 3M4YA 2DTIA 3UFGA 4EMHA 3C12A 5C52B 1ZBXA 2QHTA 3M53A 5GANd 2I4MA 3S3OA 4DA4A 2LRQA 3NTHA 4OLFA 2K3YA 2B8AA 4M7AD 3QHSA 3DB3A 3MEYA 3E9FA 3LH0A 4F7UB 4A4GA 1KQ1A 4DQ2A 2Y4XA 3RKYA 5ELOA 3S6WA 4LVIA 2IY5B 3JCMh 2E5AA 3P8BB 1GXIE 5C51B 3MP1A 2EL9A 3VQVA 1KOGA 4Q15A 3M4GA 4J7IA 4YRQA 4M77E 1J5WA 2VGMA 4M7AB 2JN0A 4EMGA 5CKBA 1S72A 3CXCA 1G5IA 1N9WA 4BI4A 3OYNA 2ZNJA 4XU2A 4HA8A 3JB9F 3VQXA 3OS5A 4E7KA 4PHCA 2EJGA 4LVLA 5FROA 2ZPEB 4PLIA 1G51A 2D0QB 4UC4A 2R57A 3PT9A 2DU7A 3PGGA 2O4XA 5GMKi 3CBMA 4C92D 4OGCA 2VYTA 4JLIA 3PMIA 5GAN2 2RB6A 1YITA 4CH3A 2RJFA 3PCOA 3OY9A 1KQSS 2LCLA 4HCBA 3QTCA 4XEMA 2YLCA 2ZT6A 3CMQA 2CKKA 4HVCA 3M57A 5LJ3d 4Y91A 3KFUA 2HQEA 4JDSA 3CPWA 1EVKA 3OYBA 5GAN4 4M78A 4XTVA 1OZ2A 3CXCS 2KVQG 3QO7A 12ASA 2KMTA 3FJPA 4OMFB 3RESA 2IY5A 3CCMA 1VQPT 1B76A 4P75C 3SFMA 2ZNIA 4HCCA 3JCMX 3CCVT 1BI1A 2ALYB 4BWAA 2K5FA 4DOVA 3JCMb 1RI0A 4ZIBA 5D6WA 3LYIA 1X54A 3X28B 5LJ5h 3G1ZA 3JCMQ 2E64A 4OGEA 2RHQB 1L0WA 4GLKA 2LTOA 5GAOl 3UH0A 1DJ7B 2F5KA 2K3XA 1NYRA 1B7YB 4A54A 1U8RA 3PZCA 2DKGA 2JZ2A 4E51A 2P4TA 3OYGA 1P92A 3VKIA 1WPYA 3URGA 3HFNA 2Q7EA 5CKDA 3IALA 4C5GA 2BIVA 4XU1A 5LJ3e 1NJ1A 4HKEA 3OS0A 2E3CA 1VQ9A 1VQNA 4YRGA 4NOYA 4P75A 5C0MA 3VUBA 2PVGB 4Q5WA 2FB7A 4ZTZB 3G6EA 2E41A 3CC7T 1VQOT 1BI3A 2PUOB 2KAFA 2EQUA 1Z7NA 3J81E 1SERA 1YITT 1NZ9A 1VQZA 5F5WA 2RJEA 5GAMf 1NPRA 2E12A 3CMEA 4M7DG 4YRMA 3OYFA 3CC2A 2EJFA 4BW9A 1OI1A 1UB4A 5GAOm 3QBYA 2RHSA 4ZGDB 5CR2A 1WQWA 4O5VA 3OYDA 2K57A 4PL6A 1WJQA 1C0AA 5K1XA 1W2BA 1Q86U 1USYA 3CCVA 4CS3A 3QG1A 1G3SA 3V8LA 4L59A 2XU8A 4MZTA 2RJCA 3L2VA 3UWNA 2C06A 1QF6A 4DOWA 1Q7YU 3CCRT 2X4JA 4ZTJA 1X75C 3OQ5A 4N4GA 3OYKA 1LOJA 3LLRA 4K87A 4EX5A 2EJ9A 1BI2A 2DTHA 3QZ5B 4IUTA 2CZ7B 4C92B 4IKFA 1M1KC 2ZR3A 2DXTA 4FIBA 4YRPA 1WLEA 1VQ4T 4MMKA 1ADYA 4ME7A 1LNXA 1M90U 4AH6A 1Y07A 4YRRA 3P8TA 2DIQA 3LGFA 1M1FA 2E1HA 4L87A 3ZFJA 2ZIOA 4N4HA 4M75E 4J8OA 3G6ET 2XG8D 3CC7A 3A8OB 4RDXA 2KDSA 4C5EA 1K8AU 3C4SA 1R8OB 3CBOA 2DEQA 4KUDK 4CH4A 4LD9K 4M77A 4EDUA 3M4QA 3CCST 5KE2A 4ZN1A 2ZIMA 2XDPA 3OBWA 1LYLA 1JB0E 1VQ5A 2XK0A 1K8AC 5CQXA 3C95A 1VQKA 2I4OA 2XGTA 4QW2A 2NS6A 2LT4A 3G4SA 2E5QA 3P8YA 3HFOA 4CH5A 1UGRB 4J6WA 3JRZA 1JJ2A 1YJWT 3QZ9B 3CD6A 3IG2A 3E9GA 2RHUA 5DLQE 2ZPGB 2MWPA 2QQRA 2V8JA 4YCVA 3QYGB 1YI2A 4NL2A 4EMKB 2JNGA 4M78B 1Q81C 5KH6A 3PIPA 1M90C 2XTIA 3M54A 4WI1A 3MEVA 1EIYA 2D6FA 1OZ3A 3V7RA 1PYSA 1NJ8A 3PTAA 3X20B 3AHUA 2CZ6B 3JCMJ 2OTJT 3OMGA 4YRLA 1QP2A 1E22A 3WXMB 4M7AG 4ZTUB 4RCBA 4JS4A 3HXWA 3I55T 5AYFA 2RH2A 4TWAA 4LDUA 2J3LA 2RHIA 1VQ4A 3FDRA 2DD4A 3SWNB 1H4SA 1EOVA 4FU6A 1M9SA 2O4XB 3CCUA 2DJZA 1BYMA 2KY9A 3EAEA 4WJ3M 2O01E 1O9SA 5E3IA 3OYEA 1ZQ1A 1YJ9A 2LT1A 5KCHA 1BIAA 1E1OA 1JBMA 3HHTB 1VQ8A 2WSEE 3QXEB 3M9QA 1XTDA 3VYHB 4K86A 3A5ZB 5CKHA 1YJNA 2GFUA 3QSUA 1Y96B 4PNOA 5GAOp 2ZZFA 1HK9A 2P0QA 4QQDA 1JJCA 2QI2A 4B9XA 2XDDA 4P74C 3MCAB 1YJNT 4M77D 4F7UE 4HT8A 5FRNA 4CS2A 1NJIU 4HWSA 4Y28E 4HCZA 4XU0A 2QDYB 2MF2A 3X26B 4L6V5 2EQJA 2HQXA 1I8FA 4C8QB 1YIJT 3ZBDA 5GMKh 4P5NA 3A32A 1KQSA 4RQEA 1H4TA 1QP3A 1JJCB 4LNSA 3A7RA 3CD6T 1KC8U 4Z02A 4BB7A 3FC3A 2CYZB 2CJAA 4KBMB 2VGNA 2FHDA 2A8EA 3RL6A 3M56A 1K9MC 3I7FA 3JCMe 4E47A 3Q1JA 3OYAA 2DXCA 2ODRD 4X9CA 2LC4A 3VYGA 5J39A 1I5LA 5A2QE 3CCQT 1KMMA 4QQGA 5DY9A 1EVLA 3ERRA 2PVOB 2ARUA 4M78G 5D6XA 5GANe 3E1SA 1YHQT 4LVMA 3MEAA 4M7AC 5GAMg 3FB9A 3A31A 5FLXE 4RCCA 4XK8E 4J6YA 5M9OA 1KG1A 4M78C 4ZTFA 3UGQA 4HWOA 2Q7HA 3GNFB 2A3LA 4HT9A 2DTOA 1RL2A 2NLUA 3BFMA 2EAYA 4BY6C 3REUA 3P8VA 2BKDN 2QA4T 4A53A 3HY1A 2E65A 4XTUA 1VQ6T 3TEHA 1PYSB 2L3RA 1B34B 5GAMh 4YRJA 4PJOD 1W4SA 1UGQB 1KMNA 4A4HA 4EMKA 3MHXA 2QA4A 1H3ZA 3JCMg 1X2HA 4UP9A 3ZEHA 3QYHB 3JCMV 4YPFA 1W2BS 5GAN7 2LCCA 2D9TA 3TU4K 1ASZA 1BIBA 3WQZA 4DPGA 1NYQA 2DXBA 3V8JA 2E10A 3HXXA 4KR2A 3VJPA 5HKCA 4M7DD 2QQ9A 4XQ3A 3LC0A 3L2ZA 3V7CA 4ELZC 3CPFA 5LL6S 2VXEA 3RUXA 3BW1A 5DLOA 4BI3A 3CMAT 2ZTGA 2DVEA 1G3TA 1X56A 1MGQA 5LJ5e 2AHJB 4J83A 4J15A 3LSQA 4TVAA 3BY7A 2ZXFA 1KQ2A 4EO4A 4V2SA 1X01A 3KUFA 3JAME 3QPHA 1YHQA 2R5AA 1E1TA 1H641 4C8QG 2A7YA 4F7UF 2IG0A 3SD4A 4CRIA 3TREA 4NL3A 4RKUE 4YROA 4N0AC 2P0KA 3HFVA 4M75A 3M55A 2HBPA 5J26A 4BD3A 5FU7B 5C6SA 4H2VA 4P71A 3UDCA 4H2UA 2LNVA 1JRIA 3OYYA 3P8HA 3QO5A 5A0LA 4M7DC 3JSCA 5LJ3j 2Q7GA 4M7DA 1M8VA 4KQEA 4H02A 3HXUA 1RIQA 3IKLA 1WQ7A 4XU3A 3RF1A 2RHXA 2DZ9A 3S3MA 3NFCA 3CCSA 4P3NA 2ZPFB 2DQ0A 4C0ZA 4B9WA 2KK4A 2Q5IA 2I4NA 3MP8A 5CCAA 3M4PA 3C94A 3QJ6A 3PFSA 4YRCA 1VIEA 1NE8A 1YIJA 1PSEA 4KULA 4LD6A 3QDRB 1HC7A 4WJ4A 1NPPA 1VQLA 1WNLA 2PVDB 4A4FA 5GMKl 4TVRA 2K5IA 5IAYA 5EG2A 5GANf 2RI2A 3HRKA 3QO3A 3IKMB 1FWZA 4FSXA 3CEYA 3I55A 4OB0B 2XDBA 2XICA 1M5Q1 1D3BA 3GLXA 3JCMf 1H4VB 3CCEA 3OW2A 1W66A 4P71C 3CCRA 3TEGA 3X25B 2QHUA 1UGSB 2YRVA 2PQWA 5IN1A 1AHJB 3OYIA 1N9RA 2CS7A 3GOXA 1VQLT 2RHZA 2XKOC 2DZCA 1YJWA 4VUBA 4BACA 4PJOC 2EFIA 2VUBA 3MP6A 4CS4A 3HTZA 4NCXA 1VUBA 1VQPA 1VQOA 4BDYA 3OYMA 3HRUA 2I2LA 2QHVA 2AKWB 3JCMc 1M1KU 3LW5E 2WSFE 3META 5D6YA 1ATIA 2JTMA 4H2XA 2RM4A 1XNIA 4PG3A 5GMKe 5LJ3h 4UP8A 3RMSA 3MEWA 1USYC 3CCLT 2V8KA 3G4ST 4KR3A 4YRTA 3E9HA 3LGLA 2ZPHB 4M78E 4C92F 3VQYA 1Q82U 4QVDA 2X4WA 3F70A 1N6AA 4XAXB 4RG8A 3OS1A 2V8IA 2M9UA 1VQ5T 4YRFA 2EYQA 2DU5A 3T9NA 3QJYA 2IVWA 3DB4A 1QVGA 3OYHA 1QVGS 2RHYA 5CK9A 2LVMA 2RA2A 5GAOn 3DLLA 2DDZA 4FT4A 1Y71A 3NTIA 3H6ZA 3HY0A 3NETA 4PJOA 5FU6B 3LWIA 5GAN5 4H2XB 3INZA 2ZZDA 3A8HB 3BJUA 4M75D 2AMCB 3PCOB 3JCMW 2QXFA 2CZ1B 4BDZA 3RMQA 3NELA 5LJ5j 2VXFA 5LJ5g 1N27A 3CCUT 2P0LA 4FT2A 4M75C 2VV5A 4E7IA 2ZINA 4YRKA 1UEBA 2E6NA 4A4KA 4HWPA 4A4EA 3DSQA 4C92E 4P74A 4JJNK 3E19A 3SWNA 3L4GB 2ZT7A 2QEXA 4TVYA 4LDVA 4QVCA 5GAOq 4IURA 2H3JA 5GAN6 3OW2S 4FL6A 5C53B 4OF1A 1XQHA 4XTYA 2EQMA 4HWRA 3R07A 3REXA 4OB1B 4P3OA 1H4QA 2CIMA 3MF1A 1D3BB 3L2UA 4ZGJB 2ZCFB 4M78D 3A8GB 3OYCA 4XEOA 1K73C 5LJ3g 4WF2A 1FX7A 2KSSA 4JRPA 2LX9A 4G84A 3CCLA 2ODRC 1JJ2S 2RHQA 2LQKA 1QVFS 1YBYA 4C0DB 4JRQA 1Y7XA 2YHTA 1GGMA 2ZZGA 5LJ5d 4YCUA 5CO7A 2K2VA 3ER0A 3CCJT 3QUIA 4M7AE 2OAUA 4J7FA 3P8DA 2Q5HA 3PNWC 1ADJA 1YI2T 3NTKA 4M77F 2QQAA 2ZZEA 4CH6A 4E7JA 1VQNT 3VV0A 2J3MA 1YGBA 4C0FA 2ZPIB 5GAOr 3ME9A 1S72T 1BBUA 2K5LA 1WJRA 3I56A 4P72A 1K9MU 1G5HA 4M77C 1X2GA 4RMFA 4LDXA 3M58A 1BBWA 3MO8A 3HXZA 2X4YA 5KNNA 2XHCA 2X4XA 5GANh 5HY6A 2EIFA 1X55A 3G7ZA 1KHCA 4YRIA 3HKSA 1ASYA 2QHSA 1NJ2A 3L1AA 3OA6A 1N8RU 3CCET 3HXYA 3MF2A 2P0PA 3FEOA 4O6JA 3UGTA 3A5YA 3JB9G 4YREA 1KHIA 4BY6B 4JUVA 2RK1A 2QEXT 3DKMA 1SESA 2Y4YA 2PMFA 1QE0A 2GCXA 2RO0A 5GAMe 1VQ6A 1Z7MA 1NJ5A 3OBYA 2RD1A 3NEMA 3QNEA 3VBBA 3RACA 3S3NA 3L42A 3OS2A 5GAN8 1N8RC 1VQ7T 2DQ3A 2AKWA 3SDZA 4H2YA 4XTWA 3MQZA 5LJ5f 3JCMP 1EIFA 3BDLA 4Q6GA 3CCMT 2WACA 4QVZA 5KE3A 2ZR2A 2OTLT 3OD1A 1IREB 3CCJA 4YTLA 4UPAA 3I56T 4M75F 4PKCC 2BUDA 1U1TA 1B34A 5GAMd 2MMPA 2WSCE 3X24B 4YRNA 4BE2A 1NNHA 4M77B 5CAIA 4BE0A 11ASA 5I21A 5HGQA 5CVIA 1XOVA 4RMOA 5I2SA 1QW1A 2I4LA 4RG2A 1M4ZA 2L5QA 1KC8C 3L4GA 2ZT8A 1VQ9T 4XTZA 5J3BA 4MMLA 1KD1C 3O8VA 4P73C 4L5GA 4ATOA 3FRNA 4PJOE 5KCOA 4IUUA 2X35A 1VQMA 5FU6C 2AMCA 1SSFA 3CC4A 4C5IA 2EQKA 4PJOB 5K1PA 2QTXA 3JB9H 2LQ8A 2FYKA 4HT4A 1Q7YC 3LX7A 1I4K1 4IUQA 3OSVA 4C5HA 5GAN3 1LJOA 2FL7A 4OVAA 2C7IA 2ZPBB 3WVDB 4MZPA 4BUGA 4GY5A 4XTXA 1ZHIA 1MHNA 4JRIA 3EFRA 3TUPA 5CKEA 3A7AA 4C8QA 1O75A 4LVKA 3HFZB 3RKWA 1FXXA 3R6OA 1EFWA 4UP7A 1NJ6A 2YLBA 3G71T 3GPLA 3SWNC 2ARTA 4G85A 4E7LA 2MWOA 3FLGA 4RQFA 2JUFA 3GP8A 3ICAA 3G71A 2P5IA 1YB3A 5I2MA 5A0GA 1YFRA 4C92G 3PMTA 4KT0E 2E70A 4C0DC 4YDQA 4C8QF 4BE1A 1FYFA 3UT1A 1PSFA 4MZMA 3L2RA 2MAMA 3HRSA 4PJOG 4TVAB 4M75G 2HD0A 2EWNA 2QQBA 5CIUA 2XD0A 2ZT5A 4M7AA 3DLMA 5GMKm 4LDYA 4MDWA 1B8AA 3L2QA 4MDXA 3V7SA 2DO3A 3HRTA 4JRKA 3RERA 4F7UG 5LJ3f 1VQKT 1WJSA 3CC2T 2RI3A 2DPPB 1B70A 3SB2A 3A74A 3CMET 4YYEA 1BI0A 2OTJA 4FM4B 4O2DA 2G3RA 3RKXA 1SRYA 4YP0A 2PMEA 3GF5A 2ZCEA 4OB3B 5GMKj 4M7DF 4IUVA 2R5MA 4LVJA 3MEUA 4K88A 1YFSA 2XI9A 3GNGA 2Y90A 4TQFA 2F69A 5GANj 1VIFA 2ALYA 5HK0A 3VU3C 4C92C 1NJIC 3OSSC 4OB2B 3WVEB 3V8KA 5FU7C 1OYXA 4TVWA 4J5YA 2GF7A 3ASKA 3QIIA 4LDWA 4M77G 3N5BB 3TCJA 3M5AA 4CI0C 3HXVA 4E7HA 1IZ6A 4X5OA 2DD5A 3CBPA 1QVPA 4D6WA 5DM7R 4M7DB 3NENA 1G3YA 1B70B 1HTTA 2HNIA 5IT9E 5CQYA 3A8MB 1Q86C 4TQDA 4R55A 3RGLA 2JOYA 2M16A 4M7DE 2JVVA 3L2WA 4YRSA 1EQRA 3BDUA 2FVUA 1SETA 1V29B 4M75B 4N0AA 2EKOA 2R58A 1WGSA 4X34A 1YJ9T 5FRMA 2E6ZA 3VQWA 2KQWA 3CC4T 1I81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW1 A;  4RMF A;  2RHS A;  3A7U A;  1BBW A;  2ZTG A;  2DVE A;  1X56 A;  3JB9 I;  3HRI A;  1WQW A;  1MGQ A;  5LJ5 e;  3EFS A;  3HXZ A;  4J15 A;  3LSQ A;  5ELN A;  5KNN A;  4TVA A;  2K57 A;  5GAN h;  3BY7 A;  4C92 A;  2ZXF A;  2G4C A;  1C0A A;  4PJO F;  4H2W A;  5K1X A;  1X55 A;  4H2T A;  1USY A;  1KQ2 A;  4EO4 A;  4YRI A;  4V2S A;  1ASY A;  1X01 A;  2VC8 A;  4CS3 A;  4YCW A;  3V8L A;  3HSB A;  1E1T A;  1N9S A;  4OP0 A;  1WYD A;  4X9D A;  1H64 1;  2QHS A;  4C8Q G;  4C8Q E;  4F7U F;  1NJ2 A;  3FIF A;  1QF6 A;  3L1A A;  4NL3 A;  4YRO A;  4N0A C;  2DXU A;  3RIR A;  3HXY A;  4P72 C;  2CGH A;  3MF2 A;  3HFV A;  4M75 A;  2ZGW A;  1LOJ A;  1Y96 A;  3UGT A;  3A5Y A;  3JB9 G;  4YRE A;  4H2V A;  4K87 A;  4EX5 A;  4J6X A;  2EJ9 A;  4JUV A;  4P71 A;  2DTH A;  3JB9 D;  1YFT A;  4H2U A;  3A5Z A;  4C92 B;  1SES A;  4M78 F;  4F7U A;  1JRI A;  2PMF A;  1QE0 A;  2ARS A;  3QO5 A;  1E24 A;  2ZR3 A;  2DXT A;  4M7D C;  4M7A F;  4YRP A;  3JCM d;  3HFZ A;  1WLE A;  4TTV A;  2RHS B;  5GAM e;  1Z7M A;  3LSS A;  5LJ3 j;  1NJ5 A;  5GAN g;  4MMK A;  1ADY A;  2Q7G A;  2RD1 A;  4M7D A;  3NEM A;  1M8V A;  4KQE A;  4H02 A;  4H2S A;  1HXD A;  3QNE A;  3TEH B;  3VBB A;  1TH7 A;  5GAM j;  3RAC A;  1LNX A;  4AH6 A;  5GAN 8;  3HXU A;  1RIQ A;  3IKL A;  3GIB A;  1WU7 A;  1WQ7 A;  2DQ3 A;  4YRR A;  4XU3 A;  3RF1 A;  2AKW A;  3P8T A;  3E9I A;  2DZ9 A;  4H2Y A;  4XTW A;  2E1H A;  4L87 A;  5LJ5 f;  3JCM P;  2ZIO A;  4P3N A;  4M75 E;  3QO8 A;  4Q6G A;  2CJB A;  3JB9 J;  4C8Q C;  4HWT A;  2ZR2 A;  2DQ0 A;  2CJ9 A;  4RDX A;  3OD1 A;  1YCY A;  2Q5I A;  2DEQ A;  4CH4 A;  2I4N A;  4UPA A;  4P73 A;  3M4P A;  4M75 F;  4M77 A;  1U1T A;  1B34 A;  2C8M A;  3M4Q A;  4YRC A;  5GAM d;  2ZIM A;  1LYL A;  4YRN A;  1IL2 A;  1HC7 A;  4WJ4 A;  1NNH A;  1EIY B;  2I4O A;  1WNL A;  2XGT A;  4M77 B;  4C8Q D;  5GMK l;  5CAI A;  1U1S A;  4EMK C;  3P8Y A;  3HFO A;  5GAN f;  4CH5 A;  11AS A;  5I21 A;  4J6W A;  3HRK A;  5HGQ A;  3QO3 A;  1B7Y A;  2I4L A;  3IKM B;  1X2G A;  3L4G A;  3W3S A;  2ZT8 A;  3IG2 A;  4XTZ A;  4MML A;  4P73 C;  4P3P A;  4YCV A;  4NL2 A;  4EMK B;  1M5Q 1;  1D3B A;  4M78 B;  2XTI A;  4WI1 A;  1EIY A;  3JCM f;  1H4V B;  1W66 A;  2DTI A;  4P71 C;  3TEG A;  3UFG A;  4PJO E;  3V7R A;  4EMH A;  2QHU A;  2QHT A;  5C52 B;  1PYS A;  1NJ8 A;  2AMC A;  3AHU A;  5GAN d;  2I4M A;  3JCM J;  4OLF A;  1N9R A;  4YRL A;  4M7A D;  1E22 A;  3QHS A;  3MEY A;  4PJO B;  5K1P A;  2QTX A;  4F7U B;  4M7A G;  4ZTU B;  3JB9 H;  4RCB A;  3HXW A;  1KQ1 A;  4DQ2 A;  2FYK A;  3RKY A;  4TWA A;  1I4K 1;  5GAN 3;  2DZC A;  1LJO A;  5ELO A;  2C7I A;  2J3L A;  2IY5 B;  4PJO C;  3JCM h;  2E5A A;  3SWN B;  1H4S A;  1EOV A;  5C51 B;  4CS4 A;  4XTX A;  2EL9 A;  3HTZ A;  4JRI A;  4NCX A;  3VQV A;  3EFR A;  2DJZ A;  1KOG A;  2I2L A;  4Q15 A;  2QHV A;  2AKW B;  3M4G A;  3TUP A;  3JCM c;  4WJ3 M;  3A7A A;  4YRQ A;  4M77 E;  4C8Q A;  1J5W A;  4M7A B;  2JN0 A;  3HFZ B;  3RKW A;  4EMG A;  1ATI A;  5E3I A;  4H2X A;  1EFW A;  2RM4 A;  4UP7 A;  4PG3 A;  1NJ6 A;  5GMK e;  5LJ3 h;  1G5I A;  4UP8 A;  2YLB A;  1BIA A;  1E1O A;  1N9W A;  1JBM A;  3SWN C;  2ZNJ A;  2ART A;  4XU2 A;  4G85 A;  4HA8 A;  3JB9 F;  1USY C;  3VQX A;  4KR3 A;  4YRT A;  3E9H A;  4K86 A;  4PHC A;  2EJG A;  4RQF A;  4M78 E;  4C92 F;  3VQY A;  4QVD A;  3ICA A;  1G51 A;  2P5I A;  3QSU A;  1YB3 A;  1Y96 B;  1YFR A;  2DU7 A;  4PNO A;  5GAO p;  3PGG A;  2ZZF A;  4YRF A;  4C92 G;  5GMK i;  2DU5 A;  1HK9 A;  4C92 D;  1JJC A;  4P74 C;  4JLI A;  5GAN 2;  2RB6 A;  2RA2 A;  4CH3 A;  4YDQ A;  5GAO n;  2DDZ A;  3PCO A;  4M77 D;  4C8Q F;  4F7U E;  4HT8 A;  4CS2 A;  1FYF A;  3HY0 A;  3NET A;  3QTC A;  4XEM A;  4PJO A;  4HWS A;  2YLC A;  4XU0 A;  5GAN 5;  2ZT6 A;  3CMQ A;  4H2X B;  4HVC A;  3INZ A;  5LJ3 d;  4Y91 A;  3KFU A;  4C8Q B;  1I8F A;  4PJO G;  3BJU A;  5GMK h;  4M75 D;  4TVA B;  3A32 A;  2AMC B;  3PCO B;  3JCM W;  4RQE A;  4M75 G;  2EWN A;  1H4T A;  2ZT5 A;  3NEL A;  1JJC B;  1EVK A;  5LJ5 j;  2VXF A;  4M7A A;  5LJ5 g;  4LNS A;  3A7R A;  5GAN 4;  4M78 A;  4XTV A;  5GMK m;  2P0L A;  3QO7 A;  4M75 C;  12AS A;  2ZIN A;  3FJP A;  3RES A;  2CJA A;  2IY5 A;  4YRK A;  4HWP A;  1B8A A;  4C92 E;  3DSQ A;  4P74 A;  1B76 A;  4P75 C;  2ZNI A;  3V7S A;  3RL6 A;  3SWN A;  4JRK A;  3I7F A;  3L4G B;  3JCM X;  3RER A;  3JCM e;  2ZT7 A;  4F7U G;  5LJ3 f;  4TVY A;  4QVC A;  5GAO q;  2ALY B;  4BWA A;  5GAN 6;  2ODR D;  1B70 A;  3JCM b;  3SB2 A;  4X9C A;  5C53 B;  4XTY A;  3A74 A;  4ZIB A;  1I5L A;  4YYE A;  4HWR A;  4O2D A;  3R07 A;  1X54 A;  3REX A;  4P3O A;  3RKX A;  1SRY A;  5LJ5 h;  2CIM A;  1H4Q A;  1KMM A;  3MF1 A;  5DY9 A;  1D3B B;  1EVL A;  3G1Z A;  3JCM Q;  3ERR A;  2E64 A;  2RHQ B;  4YP0 A;  2PME A;  1L0W A;  2ARU A;  4M78 G;  5GAN e;  2ZCE A;  5GMK j;  4M7D F;  5GAM g;  4M7A C;  3FB9 A;  4M78 D;  5GAO l;  3A31 A;  4RCC A;  3UH0 A;  4K88 A;  4XEO A;  1YFS A;  4J6Y A;  2Y90 A;  4TQF A;  4M78 C;  5GAN j;  2ALY A;  5LJ3 g;  1NYR A;  1B7Y B;  4A54 A;  3UGQ A;  4WF2 A;  2Q7H A;  4HWO A;  3VU3 C;  4C92 C;  4HT9 A;  2DTO A;  3PZC A;  2DKG A;  4E51 A;  3BFM A;  2EAY A;  3V8K A;  1WPY A;  4TVW A;  4J5Y A;  3REU A;  4M77 G;  3HFN A;  4G84 A;  2Q7E A;  3P8V A;  3HXV A;  2ODR C;  2RHQ A;  3IAL A;  4X5O A;  4A53 A;  3HY1 A;  2E65 A;  4XTU A;  4XU1 A;  5LJ3 e;  3TEH A;  1PYS B;  1NJ1 A;  1B34 B;  2YHT A;  5GAM h;  4M7D B;  2E3C A;  4YRJ A;  4PJO D;  4YRG A;  3NEN A;  4NOY A;  4P75 A;  1GGM A;  2ZZG A;  1B70 B;  1HTT A;  5LJ5 d;  1KMN A;  4EMK A;  2HNI A;  4YCU A;  3JCM g;  1X2H A;  3QUI A;  4M7A E;  4TQD A;  4UP9 A;  3RGL A;  2FB7 A;  4ZTZ B;  4M7D E;  2E41 A;  3JCM V;  2Q5H A;  1ADJ A;  4YRS A;  4YPF A;  5GAN 7;  1Z7N A;  1EQR A;  1SER A;  3BDU A;  4M77 F;  1ASZ A;  1VQZ A;  5F5W A;  2ZZE A;  1BIB A;  4CH6 A;  5GAM f;  1SET A;  3WQZ A;  4M75 B;  4N0A A;  4DPG A;  1NYQ A;  1YGB A;  2J3M A;  3V8J A;  4M7D G;  5GAO r;  2E10 A;  3HXX A;  4KR2 A;  4YRM A;  1BBU A;  4M7D D;  3VQW A;  2EJF A;  4XQ3 A;  3LC0 A;  3L2Z A;  3V7C A;  4BW9 A;  4P72 A;  5GAO m;  2VXE A;  1G5H A;  3RUX A;  4M77 C;  1I81 A; 
#chains in the Genus database with same CATH topology
 3A7U A;  2DIG A;  3HPW A;  5L8R E;  1B7T A;  1VQM T;  3JB9 I;  3HRI A;  3EFS A;  4KUI A;  5ELN A;  4ZNX A;  4C92 A;  2RI5 A;  1VQO Q;  2G4C A;  2W0Z A;  4PJO F;  1M1G A;  2LDM A;  4H2W A;  4H2T A;  1G3W A;  3OMC A;  2VC8 A;  4ZGE B;  4YCW A;  1TOV A;  2JT4 A;  3HSB A;  5A0D A;  1N9S A;  4QQ6 A;  2RK2 A;  3KBG A;  4OP0 A;  4R56 A;  1WYD A;  4X9D A;  3KXT A;  4C8Q E;  1VQ9 Q;  2M0O A;  2F5T X;  3FIF A;  1M1K R;  2BTT A;  1SHG A;  1KIK A;  2DXU A;  3RIR A;  4P72 C;  2CGH A;  2QQS A;  4C0G A;  2ZGW A;  2MCN A;  1Y96 A;  3OYL A;  3A8L B;  4J6X A;  4RTV A;  2CUD A;  8ATC B;  3JB9 D;  1YFT A;  3A5Z A;  1ACM B;  3CCU Q;  4M78 F;  2PUK B;  4F7U A;  1YHQ Q;  4FW2 A;  4BI8 B;  2GGR A;  2ROL A;  4ZN3 A;  2ARS A;  2KRN A;  1E24 A;  2HAX A;  3OYJ A;  4M7A F;  1K73 U;  3JCM d;  2M1H A;  2MIO A;  3HFZ A;  2DK3 A;  4TTV A;  2RHS B;  2AKK A;  3CPW S;  3CCQ A;  3LSS A;  5GAN g;  2QGF B;  3I56 Q;  1KD1 U;  2RJD A;  1ZLM A;  4H2S A;  1HXD A;  3M0T A;  3TEH B;  1M3A A;  2JTF A;  2K4Y A;  1TH7 A;  5GAM j;  1NBE B;  3J7A F;  1HSQ A;  3HP9 A;  1PD1 A;  2NUP A;  3GIB A;  1WU7 A;  2EQI A;  1UGP B;  3E9I A;  3H8Z A;  1GBQ A;  2MI6 A;  1VQ7 A;  2GTJ A;  1X6O A;  4JLG A;  4RTX A;  3QO8 A;  1QQJ A;  2CJB A;  3JB9 J;  4C8Q C;  1AD5 A;  4HWT A;  3CCV Q;  3CMA A;  2BZX A;  2CJ9 A;  3VS1 A;  1YCY A;  2L89 A;  2OTL A;  3VRZ A;  3LWH A;  3HL8 A;  4P73 A;  1Q81 U;  4N4I A;  1LPL A;  1QVF A;  1K73 R;  2GQV A;  2LNH B;  5CKF A;  2C8M A;  1BKB A;  1MMG A;  1G5V A;  2DYB A;  4II1 A;  2I0N A;  2DAQ A;  2L8D A;  1CKB A;  4ELY C;  2CZ0 B;  1IL2 A;  4PLL A;  3VUZ A;  2ED0 A;  1TG0 A;  3OB9 A;  1EIY B;  4NS5 A;  3UPU A;  4C8Q D;  1OX9 A;  4IUP A;  1Q82 C;  5HK3 A;  4EIK A;  1VQ8 T;  3M0S A;  1U1S A;  2DM1 A;  2GFA A;  3M59 A;  4EMK C;  3QKJ A;  1B7Y A;  1K9M R;  4EPC A;  3TEE A;  4JS5 A;  3W3S A;  1QWF A;  3PIO A;  1PD0 A;  1C1A A;  1YN8 A;  2XID A;  3D7S B;  2PU9 B;  4P3P A;  2HMA A;  1NM7 A;  1WYX A;  3J80 E;  3M4Y A;  2DTI A;  3U23 A;  3UFG A;  4EMH A;  3C12 A;  5C52 B;  1KK7 A;  1ZBX A;  2QHT A;  5KYW A;  2AZV A;  2J7I A;  1UTI A;  2YUO A;  1IGQ A;  3M53 A;  5GAN d;  2I4M A;  3S3O A;  3EFO B;  4DA4 A;  3CMA Q;  2LRQ A;  3NTH A;  4OLF A;  2K3Y A;  2B8A A;  4M7A D;  3QHS A;  4GBQ A;  3DB3 A;  4E6R A;  3MEY A;  3E9F A;  3LH0 A;  4F7U B;  2CRE A;  4A4G A;  1KQ1 A;  1WHL A;  4DQ2 A;  1ABO A;  2DLP A;  3RKY A;  2Y4X A;  5I22 A;  2DE0 X;  4F17 A;  5ELO A;  4FSS A;  3S6W A;  4LVI A;  2IY5 B;  4F14 A;  4PK4 A;  3JCM h;  1M2O A;  5D7U A;  3P8B B;  2E5A A;  2YDL A;  1GXI E;  5C51 B;  1UG1 A;  3MP1 A;  2QK0 A;  2EL9 A;  3VQV A;  2V26 A;  2O2O A;  1KOG A;  4Q15 A;  3M4G A;  2HSE B;  4J7I A;  3CCQ Q;  3VS4 A;  4YRQ A;  4M77 E;  1J5W A;  2VGM A;  4M7A B;  2JN0 A;  2KEA A;  1X43 A;  2A28 A;  5HCK A;  4EMG A;  1K1Z A;  2QTV A;  3VS0 A;  2RNA A;  5CKB A;  1S72 A;  1FMV A;  3CXC A;  1G5I A;  1R0C B;  1ZSZ C;  1Y0M A;  1N9W A;  4BI4 A;  3OYN A;  2ZNJ A;  4XU2 A;  3KFV A;  4HA8 A;  3JB9 F;  2LMJ A;  4ORZ A;  2X3X D;  3VQX A;  3OS5 A;  1RAF B;  1BBZ A;  4E7K A;  4PHC A;  2EJG A;  4LVL A;  5FRO A;  2KT8 A;  2ZPE B;  4PLI A;  1G51 A;  1GCP A;  2D0Q B;  4UC4 A;  2R57 A;  3PT9 A;  1M90 R;  2COY A;  2DU7 A;  3PGG A;  2O4X A;  2NUP B;  5GMK i;  1M3B A;  3CBM A;  4C92 D;  1BK2 A;  4OGC A;  1N8R R;  1VA7 A;  2VYT A;  4JLI A;  3PMI A;  5GAN 2;  2RB6 A;  1YIT A;  1Q7Y R;  4CH3 A;  2RJF A;  1HD3 A;  3PCO A;  3OY9 A;  1KQS S;  2LCL A;  4HCB A;  3QTC A;  4XEM A;  2LZ6 B;  4OMO A;  2CP6 A;  2YLC A;  1K0S A;  2ZT6 A;  4OMN A;  3CMQ A;  2CKK A;  5I11 A;  4HVC A;  3M57 A;  5LJ3 d;  4Y91 A;  1VQ8 Q;  3KFU A;  2HQE A;  4JDS A;  2BZY A;  4HVW A;  2ESW A;  4HVV A;  3CPW A;  1VQP Q;  1GL5 A;  1EVK A;  4RTT A;  3OYB A;  1RUW A;  3H0I A;  1MV0 B;  2L2P A;  4XTV A;  4M78 A;  1OZ2 A;  5GAN 4;  2KVQ G;  3CXC S;  2QEX Q;  12AS A;  3QO7 A;  2KMT A;  1G83 A;  3FJP A;  4OMF B;  3RES A;  2IY5 A;  3CCM A;  5KYX A;  1VQP T;  2KE9 A;  5EC7 A;  1UDL A;  1B76 A;  4P75 C;  1ARK A;  3MKD A;  3SFM A;  2DL3 A;  2ZNI A;  4FW1 A;  4HCC A;  3RR6 A;  3JCM X;  4Z89 A;  1WHK A;  3CCV T;  1BI1 A;  1RLQ C;  2ALY B;  4BWA A;  2K5F A;  3EFO A;  1AT1 B;  4DOV A;  3JCM b;  1RI0 A;  4ZIB A;  1IO6 A;  1KD1 R;  1JXO A;  5D6W A;  3LYI A;  1X54 A;  3X28 B;  5LJ5 h;  3G1Z A;  3JCM Q;  1JO8 A;  2E64 A;  4OGE A;  2RHQ B;  1L0W A;  4GLK A;  3RNJ A;  2LTO A;  1CSK A;  2EYX A;  1HYO A;  5GAO l;  3UH0 A;  1TU0 B;  1DJ7 B;  2F5K A;  2K3X A;  4RTU A;  1NYR A;  2KXD A;  1B7Y B;  4A54 A;  4DEX A;  2HQH A;  1U8R A;  3PZC A;  1WX6 A;  2DKG A;  2RMO A;  2JZ2 A;  4E51 A;  2P4T A;  3OYG A;  1P92 A;  4J9C A;  3VKI A;  1WPY A;  3I9Q A;  3URG A;  3HFN A;  2Q7E A;  5CKD A;  1Z9Q A;  3IAL A;  1YIJ Q;  4C5G A;  2BIV A;  2QG9 B;  3MPU B;  4XU1 A;  5LJ3 e;  3EHR A;  1NJ1 A;  4HKE A;  3OS0 A;  2E3C A;  1VQ9 A;  1VQN A;  2CH4 W;  4YRG A;  4NOY A;  4P75 A;  2PZ1 A;  5C0M A;  3VUB A;  2PVG B;  1NYG A;  1TXQ A;  3IQL A;  2EBP A;  3EG1 A;  4Q5W A;  2FB7 A;  4ZTZ B;  2OX7 A;  2E41 A;  3G6E A;  3CC7 T;  1VQO T;  1BI3 A;  2PUO B;  2KAF A;  1M3C A;  2EQU A;  1Z7N A;  2LCS A;  3J81 E;  1SER A;  1V1C A;  2HEQ A;  1YIT T;  1NZ9 A;  1I1J A;  1GFC A;  1LCK A;  1VQZ A;  2RJE A;  5F5W A;  5GAM f;  1NPR A;  2E12 A;  3CME A;  4M7D G;  3CC4 Q;  1UFF A;  4E2F B;  1YJW Q;  4YRM A;  4DEY A;  3OYF A;  3CC2 A;  2EJF A;  4BW9 A;  1PM3 A;  1OI1 A;  1UB4 A;  5GAO m;  3QBY A;  2RHS A;  4ZGD B;  5CR2 A;  1AOJ A;  1WQW A;  4O5V A;  2J05 A;  1KQS P;  3OYD A;  2K57 A;  4PL6 A;  1WJQ A;  1C0A A;  2DF6 A;  1NEB A;  1H92 A;  1W2B A;  2K3B A;  5K1X A;  1Q86 U;  1USY A;  2E4H A;  3CCV A;  4CS3 A;  3QG1 A;  1OOT A;  1G3S A;  4LNP A;  5FWC A;  4L59 A;  3V8L A;  2XU8 A;  4MZT A;  4LUE A;  2J6O A;  2RJC A;  3L2V A;  3UWN A;  2C06 A;  1QF6 A;  2KXC A;  4JZ3 A;  4DOW A;  2K79 A;  1Q7Y U;  3CCR T;  2X4J A;  4ZTJ A;  3CPW P;  1X75 C;  3OQ5 A;  1GCQ C;  2KR3 A;  2YXY A;  4N4G A;  3OYK A;  2J6K A;  1LOJ A;  3TSZ A;  3LLR A;  1RAE B;  4K87 A;  3UF4 A;  4EX5 A;  1KFZ A;  2EJ9 A;  3EH1 A;  1BI2 A;  2DTH A;  3QZ5 B;  4IUT A;  2CZ7 B;  4C92 B;  2YWW A;  4IKF A;  1PKS A;  3VS3 A;  1X6B A;  1M1K C;  2ZR3 A;  2DXT A;  4FIB A;  4YRP A;  5L23 A;  1WLE A;  2C0T A;  1VQ4 T;  3NHN A;  4OMM A;  4MMK A;  3C0C A;  1ADY A;  1AZG B;  4Y92 A;  2RQV A;  4ME7 A;  1LNX A;  1M90 U;  4AH6 A;  1Y07 A;  1OX8 A;  1K4U S;  2DEU A;  4YRR A;  3P8T A;  2C0I A;  2DIQ A;  3LGF A;  4JJC A;  1M1F A;  2E1H A;  4L87 A;  3ZFJ A;  2L3Q A;  2ZIO A;  4N4H A;  2ED1 A;  4M75 E;  3EG0 A;  4J8O A;  3G6E T;  2XG8 D;  1IB8 A;  3CC7 A;  1SG5 A;  3A8O B;  4RDX A;  2KDS A;  3A98 A;  4C5E A;  1K8A U;  3C4S A;  1R8O B;  3CBO A;  2DEQ A;  1VOM A;  2DET A;  4KUD K;  4CH4 A;  1RAB B;  1UUE A;  1IRX A;  4LD9 K;  2NWM A;  1VYV A;  4M77 A;  4EDU A;  2YRD A;  1YJN Q;  3M4Q A;  3CCS T;  5KE2 A;  4ZN1 A;  2LQN A;  1NJI R;  2ZIM A;  4RTZ A;  2XDP A;  2DL5 A;  3OBW A;  1LYL A;  1JB0 E;  1RAA B;  2VWF A;  1VQ5 A;  2XK0 A;  1K8A C;  5CQX A;  3C95 A;  1PRL C;  1VQM Q;  1VQK A;  2I4O A;  2XGT A;  4AFQ C;  2NUT A;  4AG1 C;  3NPF A;  1OU9 A;  4QW2 A;  1QVF P;  2LT4 A;  3G4S A;  2NS6 A;  1YIT Q;  2E5Q A;  3P8Y A;  3HFO A;  4CH5 A;  1UGR B;  4J6W A;  2FPD A;  3JRZ A;  1JJ2 A;  1YJW T;  2AIR B;  3QZ9 B;  1QLY A;  3CD6 A;  4HCK A;  3IG2 A;  3E9G A;  2RHU A;  5DLQ E;  1SPK A;  2NYS A;  4JZ4 A;  2DRM A;  2ZPG B;  1ZBJ A;  2MWP A;  2QQR A;  2V8J A;  3SEM A;  3QYG B;  4YCV A;  2GBQ A;  1YI2 A;  4NL2 A;  4EMK B;  2JNG A;  1VQ4 Q;  4M78 B;  1Q81 C;  5KH6 A;  3PIP A;  1M90 C;  2XTI A;  3M54 A;  4WI1 A;  3MEV A;  1EIY A;  1VQ7 Q;  2KBT A;  2D6F A;  1OZ3 A;  1N5Z A;  2A08 A;  3V7R A;  1PYS A;  4IIO A;  1NJ8 A;  2H3E B;  3X20 B;  3PTA A;  5KYY A;  3AHU A;  1X2Q A;  2CZ6 B;  1OU8 A;  3JCM J;  1S72 Q;  2HDA A;  3RDV A;  2OTJ T;  3OMG A;  4YRL A;  1QP2 A;  1WHJ A;  1E22 A;  3WXM B;  2ATC B;  4FYW B;  2KYM A;  1MV3 A;  4M7A G;  4ZTU B;  2PTK A;  4RCB A;  4JS4 A;  3HXW A;  3I55 T;  5AYF A;  2RH2 A;  8AT1 B;  4TWA A;  3I5R A;  1GCQ A;  4LDU A;  2B86 A;  2J3L A;  1WHM A;  2RHI A;  1VQ4 A;  3FDR A;  3M0P A;  3VS2 A;  1OEB A;  2DD4 A;  2D8J A;  3SWN B;  1H4S A;  1EOV A;  5KYN A;  2FRW A;  1M9S A;  2V1R A;  4FU6 A;  2O4X B;  3CCU A;  1KSW A;  2DJZ A;  1BYM A;  1IXD A;  2KY9 A;  3EAE A;  2VB6 A;  4WJ3 M;  4DBQ A;  2O01 E;  3O5Z A;  2FZK B;  1O9S A;  2EYZ A;  5E3I A;  3OYE A;  2LJ3 A;  1ZQ1 A;  6AT1 B;  1YJ9 A;  3A1P A;  2FG0 A;  5ECA A;  2LT1 A;  5KCH A;  1TTH B;  1D1A A;  1BIA A;  2BZ8 A;  1E1O A;  1JBM A;  3HHT B;  2JM9 A;  2IPO B;  1VQ8 A;  2WSE E;  3QXE B;  1VQ6 Q;  3CME Q;  3M9Q A;  1XTD A;  3VYH B;  3EG2 A;  1T0J A;  4A63 B;  2QA4 Q;  1BCO A;  2JM8 A;  4K86 A;  3A5Z B;  5CKH A;  1R0B G;  5IXB A;  2SEM A;  3EG9 B;  2YUQ A;  1YJN A;  4LE9 A;  2GFU A;  1GRI A;  3QSU A;  1Y96 B;  3G6E Q;  4PNO A;  5GAO p;  2ZZF A;  1HK9 A;  1ZUK A;  2DIL A;  2P0Q A;  1Q86 R;  4QQD A;  1W1F A;  2XMF A;  2QI2 A;  4B9X A;  1JJC A;  2XDD A;  4P74 C;  3MCA B;  1YJN T;  1VQN Q;  4M77 D;  4F7U E;  4HT8 A;  5FRN A;  4CS2 A;  1ZSZ B;  1NJI U;  4HWS A;  4Y28 E;  4HCZ A;  4XU0 A;  2QDY B;  2MF2 A;  3X26 B;  4L6V 5;  2EQJ A;  2HQX A;  1I8F A;  2E3I A;  4C8Q B;  3ZBD A;  1YIJ T;  5GMK h;  4P5N A;  3A32 A;  2DL8 A;  2MPX C;  2M51 A;  2RN8 A;  1KQS A;  4RQE A;  1H4T A;  1BCM A;  1QP3 A;  1JJC B;  4FCY A;  4LNS A;  2O88 A;  3A7R A;  3CD6 T;  4PFP A;  1D0Z A;  1KC8 U;  2OAW A;  4KH1 B;  4Z02 A;  4BB7 A;  3FC3 A;  2CYZ B;  2CJA A;  4KBM B;  1NEG A;  2KGT A;  3THK A;  2VGN A;  2COW A;  2FHD A;  2A8E A;  3RL6 A;  3M56 A;  4RTY A;  4PJJ A;  1K9M C;  1TUC A;  3I7F A;  3JCM e;  2YUP A;  4E47 A;  3Q1J A;  4FYY B;  3UA6 A;  3OYA A;  2FZG B;  1FMW A;  2DXC A;  2ODR D;  5AT1 B;  4X9C A;  3VS6 A;  4WTO B;  2JTE A;  2LC4 A;  3VYG A;  5J39 A;  4J9F A;  1I5L A;  5A2Q E;  3CCQ T;  2OJ2 A;  1KMM A;  4QQG A;  5DY9 A;  1EVL A;  3ERR A;  4AFS C;  1UJ0 A;  2PVO B;  1QVG P;  2ARU A;  4M78 G;  2DMO A;  5D6X A;  5GAN e;  3E1S A;  1YHQ T;  2LP5 A;  4LVM A;  3MEA A;  4IIM A;  4M7A C;  5GAM g;  1AZE A;  3FB9 A;  3A31 A;  5FLX E;  4RCC A;  4XK8 E;  4J6Y A;  5M9O A;  1KG1 A;  4M78 C;  4ZTF A;  3UGQ A;  4HWO A;  2Q7H A;  3GNF B;  2A3L A;  4HT9 A;  2DTO A;  1RL2 A;  2NLU A;  1BB9 A;  1E6G A;  5IHI A;  2D1X A;  4D8D A;  3BFM A;  2EAY A;  4BY6 C;  1RI9 A;  1W2B P;  3REU A;  3H0H A;  3P8V A;  2BKD N;  2QA4 T;  1WXB A;  4A53 A;  2BE7 D;  3HY1 A;  2E65 A;  4XTU A;  1VQ6 T;  3TEH A;  1PYS B;  2L3R A;  1B34 B;  5GAM h;  4YRJ A;  2P84 A;  4PJO D;  3CXC P;  3ZL7 C;  1W4S A;  1UGQ B;  1KMN A;  4A4H A;  4EMK A;  3MHX A;  1E6H A;  2QA4 A;  1MND A;  2CH4 A;  3JCM g;  1H3Z A;  1X2H A;  3ZEH A;  4UP9 A;  3QYH B;  1K9A A;  3JCM V;  4YPF A;  1W2B S;  5GAN 7;  2LCC A;  2D9T A;  2JS2 A;  1ZX6 A;  2DYI A;  4J9I A;  3TU4 K;  1X2K A;  1ASZ A;  3PVL A;  2X51 A;  2DJQ A;  1BIB A;  1NYF A;  2HSP A;  3NMZ C;  4WCI A;  3WQZ A;  4DPG A;  1NYQ A;  2DXB A;  3V8J A;  2E10 A;  3HXX A;  4KR2 A;  2EPD A;  3VJP A;  5HKC A;  1G8X A;  2NUT B;  3TQ7 P;  4M7D D;  2QQ9 A;  4XQ3 A;  3LC0 A;  3L2Z A;  2CP0 A;  4J9G A;  3V7C A;  1YP5 A;  2A0F B;  4HXJ A;  2LX7 A;  3CCR Q;  4ELZ C;  3CPF A;  3EGD B;  2D8H A;  1B07 A;  5LL6 S;  2VXE A;  3RUX A;  3EGX A;  3BW1 A;  5DLO A;  1T3L A;  4BI3 A;  3CMA T;  1SRM A;  2DVE A;  2ZTG A;  1G3T A;  1X56 A;  1MGQ A;  5LJ5 e;  2AHJ B;  4J83 A;  4J15 A;  3LSQ A;  1AWX A;  4TVA A;  1ZSZ A;  3I55 Q;  3BY7 A;  5GJW B;  2ZXF A;  3CQT A;  3CCJ Q;  2HKN A;  1KQ2 A;  4EO4 A;  4V2S A;  3QDF A;  1X01 A;  3KUF A;  3JAM E;  3QPH A;  1YHQ A;  2R5A A;  1E1T A;  1WXT A;  1H64 1;  4C8Q G;  2A7Y A;  4F7U F;  4PJN A;  2L3S A;  2IG0 A;  1EX4 A;  3SD4 A;  4CRI A;  3TRE A;  4NL3 A;  2DX1 A;  4RKU E;  4YRO A;  4N0A C;  2P0K A;  1GFD A;  2F2W A;  3HFV A;  4M75 A;  4F04 B;  3M55 A;  2HBP A;  5J26 A;  4BD3 A;  4FYX B;  5FU7 B;  5C6S A;  1U3O A;  4H2V A;  4J9H A;  4P71 A;  3UDC A;  2F2V A;  4KGV B;  4H2U A;  1T3S A;  2LNV A;  3CD6 Q;  2CT3 A;  1W6X A;  2KYB A;  1JRI A;  1WXU A;  4JPB W;  3OYY A;  2LJ0 A;  3P8H A;  3QO5 A;  1WDX A;  5A0L A;  4M7D C;  1MMN A;  4AG2 C;  3JSC A;  5LJ3 j;  2G6F X;  2Q7G A;  9ATC B;  4M7D A;  1K0X A;  1M8V A;  4KQE A;  4H02 A;  4QKU A;  1PNJ A;  2F2X A;  1F1B B;  1I07 A;  2JJ9 A;  3HXU A;  1RIQ A;  3IKL A;  3EGD A;  1WQ7 A;  4XU3 A;  3RF1 A;  2JMA A;  1M2V B;  2RHX A;  2DZ9 A;  1SHF A;  3E2U A;  3S3M A;  1EZZ B;  3NFC A;  4KGZ B;  4M4Z A;  3CCS A;  4P3N A;  2HZY A;  2ZPF B;  2DQ0 A;  1PG5 B;  2HL3 A;  4C0Z A;  4B9W A;  2KK4 A;  2Q5I A;  2I4N A;  3MP8 A;  5CCA A;  1UHC A;  3M4P A;  1EFN A;  3C94 A;  1WLP B;  4AT1 B;  1MMA A;  3QJ6 A;  3PFS A;  3EG3 A;  4YRC A;  1VIE A;  1V76 A;  1Y57 A;  1NE8 A;  1YIJ A;  1QKW A;  1PSE A;  4KUL A;  5IXF A;  1BU1 A;  2CT4 A;  4LD6 A;  3QDR B;  1HC7 A;  4WJ4 A;  1NPP A;  1VQL A;  1WNL A;  2PVD B;  3UA7 A;  4A4F A;  5GMK l;  3I35 A;  4TVR A;  2DBK A;  4CC3 A;  2K5I A;  5IAY A;  5EG2 A;  5GAN f;  2RI2 A;  3HRK A;  2VVK A;  3QO3 A;  3IKM B;  1FWZ A;  2CSI A;  2DRK A;  2H8H A;  4FSX A;  1FYN A;  4Z8A A;  3CEY A;  3I55 A;  4OB0 B;  2XDB A;  3TSW A;  1M2V A;  2XIC A;  1A0N B;  1IHW A;  1PCX A;  1M5Q 1;  1D3B A;  3GLX A;  3VS5 A;  1PWT A;  1WHH A;  2DNU A;  3JCM f;  4DBF A;  3CCE A;  3OW2 A;  1H4V B;  1W66 A;  4P71 C;  3CCR A;  3TEG A;  3X25 B;  1SRL A;  4PJM A;  2DA9 A;  2QHU A;  2HBW A;  2O9S A;  1UGS B;  2YRV A;  1ZUY A;  1ABQ A;  2PQW A;  5IN1 A;  1AHJ B;  3OYI A;  1N9R A;  1J3T A;  3FJ5 A;  3CCL Q;  2CS7 A;  3GOX A;  1VQL T;  1X69 A;  1QKX A;  3TVT A;  5GJV B;  4RTW A;  2QDL A;  2RHZ A;  2XKO C;  2DZC A;  1YJW A;  2KRO A;  2RQT A;  4VUB A;  4BAC A;  2RPN A;  4PJO C;  2MYS A;  2EFI A;  2VUB A;  3MP6 A;  1JJ2 P;  4CS4 A;  3HTZ A;  1AWO A;  4NCX A;  4GLM A;  1LVK A;  1VUB A;  1VQP A;  1VQO A;  4BDY A;  2QYZ A;  3HRU A;  3OYM A;  4J9D A;  2I2L A;  2QHV A;  2AKW B;  3JCM c;  1M1K U;  2A36 A;  3LW5 E;  2WSF E;  1QCF A;  3MET A;  5D6Y A;  1ATI A;  2JTM A;  4H2X A;  3I5S A;  2IIM A;  2RM4 A;  1XNI A;  2CP7 A;  4PG3 A;  5GMK e;  5LJ3 h;  2E5K A;  4UP8 A;  5IHK A;  1RAH B;  2YRC A;  3MEW A;  3RMS A;  1USY C;  3CCL T;  1YNZ A;  2V8K A;  1E7O A;  3G4S T;  1UJY A;  4KR3 A;  4YRT A;  3E9H A;  3LGL A;  2ZPH B;  3H41 A;  4M78 E;  4C92 F;  3VQY A;  1Q82 U;  4QVD A;  2X4W A;  3F70 A;  1N6A A;  4XAX B;  4RG8 A;  3OS1 A;  2V8I A;  2M9U A;  1VQ5 T;  4YRF A;  2EYQ A;  2DU5 A;  3T9N A;  3QJY A;  2IVW A;  1QCN A;  3DB4 A;  1QVG A;  1D1B A;  1W70 A;  3OYH A;  2FPE A;  4KH0 B;  2RHY A;  1QVG S;  5CK9 A;  2LVM A;  2RA2 A;  5GAO n;  3DLL A;  2DDZ A;  4FT4 A;  1Y71 A;  2YUN A;  3NTI A;  3H6Z A;  3HY0 A;  3NET A;  1XJW B;  4PJO A;  3HTR A;  5FU6 B;  3LWI A;  5GAN 5;  4JJD A;  4H2X B;  3INZ A;  2ZZD A;  3A8H B;  4Z88 A;  3BJU A;  4M75 D;  1GBR A;  2AMC B;  3PCO B;  3JCM W;  2QXF A;  2CZ1 B;  2NUZ A;  4BDZ A;  3RMQ A;  3NEL A;  5LJ5 j;  2VXF A;  5LJ5 g;  1N27 A;  2PNI A;  3CCU T;  2K6D A;  1UHF A;  2P0L A;  4FT2 A;  4M75 C;  2VV5 A;  2DVJ A;  4E7I A;  2ZIN A;  3M0U A;  3MJX A;  2EGC A;  4YRK A;  1UEB A;  2E6N A;  4A4K A;  2HL5 C;  4A4E A;  4HWP A;  2QGG A;  3DSQ A;  4C92 E;  4P74 A;  2JMC A;  4JJN K;  2D0N A;  2EYW A;  3E19 A;  4X1V A;  3SWN A;  3L4G B;  1AVZ C;  1RAD B;  3AT1 B;  2ZT7 A;  2QEX A;  4PFZ A;  4TVY A;  4LDV A;  4QVC A;  2RQU A;  5GAO q;  1WFW A;  4IUR A;  2H3J A;  5GAN 6;  1JEG A;  3OW2 S;  1VYU A;  1D1C A;  4FL6 A;  5C53 B;  4OF1 A;  2C0O A;  1XQH A;  4XTY A;  2AK5 A;  1D09 B;  2L0A A;  2EQM A;  4HWR A;  1JQQ A;  3R07 A;  3REX A;  4OB1 B;  4P3O A;  1H4Q A;  2V1Q A;  2CIM A;  3MF1 A;  1D3B B;  2GTO A;  3L2U A;  4ZGJ B;  2SRC A;  1D0X A;  4M78 D;  2JS0 A;  2MOX A;  2ZCF B;  4LN2 A;  3A8G B;  3OYC A;  4XEO A;  1WI7 A;  3R6N A;  2L3P A;  1K73 C;  4JJB A;  2F1L A;  1Z9Z A;  5LJ3 g;  2KRS A;  2MK5 A;  4WF2 A;  1FX7 A;  2KSS A;  4JRP A;  4QT7 A;  2LX9 A;  1SF9 A;  4G84 A;  3CCL A;  4OML A;  1TS9 A;  2ODR C;  1WHG A;  1JJ2 S;  2LQK A;  2RHQ A;  1QVF S;  4B6M A;  2AT1 B;  1YBY A;  4C0D B;  2KI7 A;  4JRQ A;  1Y7X A;  2YHT A;  2O9V A;  4DBR A;  2YT6 A;  2RQR A;  1GGM A;  2ZZG A;  4R0K A;  1H8K A;  5LJ5 d;  2CP2 A;  3G1J A;  4YCU A;  5CO7 A;  2K2V A;  3ER0 A;  3CCJ T;  3QUI A;  4M7A E;  2OAU A;  4J7F A;  3LH5 A;  4K11 A;  3P8D A;  2Q5H A;  3PNW C;  1ADJ A;  2DL7 A;  1YI2 T;  3NTK A;  2Z0W A;  4M77 F;  2QQA A;  2ZZE A;  4CH6 A;  4E7J A;  1VQN T;  3VV0 A;  2J3M A;  4C0F A;  1YGB A;  2ZPI B;  5GAO r;  3QWY A;  3ME9 A;  1S72 T;  1BBU A;  2K5L A;  1NLO C;  1WJR A;  2M02 A;  3I56 A;  1OPL A;  3UAT A;  4P72 A;  1SKU B;  1K9M U;  1G5H A;  3EG9 A;  4M77 C;  1X2G A;  1WZO A;  4RMF A;  4LDX A;  3M58 A;  1BBW A;  4OMQ A;  1YFN A;  3EGU A;  3MO8 A;  1U06 A;  3HXZ A;  3EHQ A;  2X4Y A;  5KNN A;  2XHC A;  2X4X A;  5GAN h;  5HY6 A;  1OPK A;  3CCM Q;  2DFU A;  2EIF A;  1X55 A;  3G7Z A;  1KHC A;  4YRI A;  3HKS A;  1ASY A;  4J9B A;  1NLP C;  2AZS A;  2LQW A;  2VAS A;  2QHS A;  1M27 C;  1K8A R;  1NJ2 A;  1ZA1 B;  1VQK Q;  2OI3 A;  2ZAE A;  3L1A A;  4CC4 B;  2FEI A;  3OA6 A;  1N8R U;  2ROT A;  3CCE T;  3HXY A;  3MF2 A;  3PVQ A;  2P0P A;  3FEO A;  4O6J A;  3UGT A;  1UGV A;  3JB9 G;  3A5Y A;  4YRE A;  1KHI A;  4BY6 B;  4JUV A;  1D0Y A;  2RK1 A;  2QEX T;  3DKM A;  2CSQ A;  1SES A;  2Y4Y A;  2PMF A;  2HKQ B;  1QE0 A;  2GCX A;  3BE3 A;  3CC7 Q;  3ULR B;  2RO0 A;  3EGX B;  5GAM e;  1VQ6 A;  1Z7M A;  1ZUU A;  2GQI A;  5KYY B;  1AWW A;  1NJ5 A;  3OBY A;  2RD1 A;  3NEM A;  5IHN A;  3VRY A;  3QNE A;  3VBB A;  3RAC A;  3S3N A;  3L42 A;  2M0Y A;  5GAN 8;  3OS2 A;  1N8R C;  1VQ7 T;  4CC2 A;  4RUG A;  2DQ3 A;  2RQW A;  1KC8 R;  2AKW A;  3SDZ A;  4H2Y A;  4XTW A;  1X27 A;  3MQZ A;  5LJ5 f;  3JCM P;  1EIF A;  3CCE Q;  3BDL A;  2KT1 A;  2BE9 B;  2DER A;  4Q6G A;  2OTL Q;  3CCM T;  2WAC A;  4QVZ A;  5KE3 A;  2ZR2 A;  5IH2 A;  1S1N A;  2OTL T;  1UE9 A;  3OD1 A;  1IRE B;  3CCJ A;  1IHV A;  1Q82 R;  4YTL A;  4UPA A;  2CP3 A;  3I56 T;  4M75 F;  1PRM C;  5KYW B;  4PKC C;  2BUD A;  1U1T A;  1B34 A;  5GAM d;  2VKN A;  4HVU A;  2CUB A;  1QWE A;  2MMP A;  3H9N A;  1K76 A;  4DBH A;  1SSH A;  1B3Q A;  2WSC E;  3REB B;  3X24 B;  4YRN A;  4KGX B;  1YWO A;  4BE2 A;  3EH2 A;  1NNH A;  1UEC A;  4M77 B;  3PE0 A;  1RAI B;  5CAI A;  4BE0 A;  11AS A;  5I21 A;  1OUL A;  3G4S Q;  5HGQ A;  5CVI A;  2K9G A;  1XOV A;  4RMO A;  5I2S A;  4J9E A;  1QW1 A;  2I4L A;  1RLP C;  1M4Z A;  2L5Q A;  4RG2 A;  1KC8 C;  3L4G A;  2ZT8 A;  2X9H A;  1VQ9 T;  4XTZ A;  5J3B A;  4MML A;  3JV3 A;  1KD1 C;  2CP5 A;  3O8V A;  1RAC B;  2RF0 A;  4P73 C;  4L5G A;  1I81 A;  1M8M A;  2X3W D;  5KYU A;  2P4R A;  1OQK A;  4ATO A;  1TWB A;  3FRN A;  4PJO E;  5KCO A;  4IUU A;  2X35 A;  5FWB A;  1VQM A;  5FU6 C;  2AMC A;  1SSF A;  2EKH A;  1PHT A;  1YWP A;  4C5I A;  3CC4 A;  1H3H A;  3H0F A;  2EQK A;  2FRY A;  3QWX X;  4PJO B;  5K1P A;  2QTX A;  1JU5 C;  3JB9 H;  1MMD A;  2LQ8 A;  2FYK A;  4HT4 A;  1Q7Y C;  3LX7 A;  1I4K 1;  4IUQ A;  3OSV A;  4C5H A;  5GAN 3;  3OW2 P;  1YJ9 Q;  1LJO A;  1U5S A;  2ECZ A;  2E3H A;  2FL7 A;  4OVA A;  2C7I A;  2ZPB B;  3WVD B;  4MZP A;  4BUG A;  4GY5 A;  4XTX A;  1ZHI A;  1MHN A;  2EYY A;  4JRI A;  3EFR A;  4D8K A;  3TUP A;  5CKE A;  2DBM A;  3A7A A;  2YSQ A;  4C8Q A;  1O75 A;  2HCK A;  4LVK A;  3HFZ B;  3RKW A;  1C0M A;  1FXX A;  1QMC A;  3R6O A;  1EFW A;  4AMC A;  4UP7 A;  2JXB A;  1NJ6 A;  2O31 A;  1RAG B;  2YLB A;  3G71 T;  3GPL A;  4AFZ C;  3SWN C;  2ART A;  4G85 A;  2FZC B;  1AEY A;  4E7S A;  4E7L A;  2MWO A;  3FLG A;  1I5O B;  3RBB B;  4RQF A;  2QAS A;  2KRM A;  2JUF A;  3GP8 A;  3ICA A;  1KJW A;  3G71 A;  2P5I A;  1YB3 A;  5I2M A;  4OMP A;  2EVR A;  5A0G A;  1YFR A;  4ANJ A;  4C92 G;  1M30 A;  2LJ1 A;  1CKA A;  3PMT A;  1YI2 Q;  4KT0 E;  2E70 A;  3NGP A;  4F16 A;  4C0D C;  4YDQ A;  4PFO A;  4PJL A;  1IGU A;  1WA7 A;  4C8Q F;  1C6V X;  4BE1 A;  1FYF A;  3UT1 A;  1MUZ A;  4KRT A;  7AT1 B;  1PSF A;  4MZM A;  1TUG B;  3L2R A;  2MAM A;  3CCS Q;  4E7Z A;  1AWJ A;  4ESR A;  3HRS A;  4PJO G;  1QCO A;  4TVA B;  1MNE A;  1YCS B;  3M0R A;  4M75 G;  2HD0 A;  2EWN A;  2QQB A;  5CIU A;  2XD0 A;  2ZT5 A;  4M7A A;  1VQ5 Q;  3DLM A;  2W10 A;  5GMK m;  1TUD A;  1VYT A;  4LDY A;  4MDW A;  1JXM A;  1Q81 R;  2J06 A;  2EW3 A;  1B8A A;  4AFU C;  3L2Q A;  4MDX A;  3CC2 Q;  3V7S A;  2DO3 A;  3HRT A;  3M0Q A;  4JRK A;  3RER A;  3GBQ A;  2QAZ A;  4LXC A;  5LJ3 f;  4F7U G;  1VQK T;  1Q95 G;  1WJS A;  3CC2 T;  2RI3 A;  2DPP B;  1B70 A;  3SB2 A;  3REA B;  1ZSG A;  3A74 A;  3SHW A;  2A37 A;  3CME T;  4YYE A;  2FPF A;  1I0C A;  1BI0 A;  2K2M A;  4CC7 A;  2OTJ A;  4FM4 B;  4O2D A;  2G3R A;  2EGE A;  2ENM A;  3RKX A;  1SRY A;  2J6F A;  4YP0 A;  2PME A;  1R77 A;  1WIE A;  1ZA2 B;  3GF5 A;  2ZCE A;  1G2B A;  4OB3 B;  5GMK j;  2FO0 A;  4M7D F;  4IUV A;  2R5M A;  4LVJ A;  3MEU A;  4K88 A;  1YFS A;  2XI9 A;  3GNG A;  2Y90 A;  4TQF A;  2F69 A;  2CDT A;  5GAN j;  1TSF A;  1VIF A;  2ALY A;  5HK0 A;  3VU3 C;  4C92 C;  1NJI C;  3OSS C;  4OB2 B;  1PC0 A;  3WVE B;  2DL4 A;  1PKT A;  3V8K A;  5FU7 C;  1OYX A;  4TVW A;  4J5Y A;  2GF7 A;  3ASK A;  3QII A;  4LDW A;  4M77 G;  5KYX B;  3N5B B;  3TCJ A;  3M5A A;  4CI0 C;  3HXV A;  4E7H A;  1IZ6 A;  4X5O A;  2DD5 A;  3CBP A;  1QVP A;  4D6W A;  1VQL Q;  5DM7 R;  2EGA A;  2AKL A;  4M7D B;  3G71 Q;  1OV3 A;  5FW9 A;  2JW4 A;  3NEN A;  1G3Y A;  1B70 B;  1HTT A;  2KNB B;  5KYU B;  2GNC A;  2HNI A;  5IT9 E;  5CQY A;  3A8M B;  1NG2 A;  1Q86 C;  4TQD A;  4R55 A;  3RGL A;  1FMK A;  1X6G A;  2JOY A;  2M16 A;  4M7D E;  2JVV A;  3L2W A;  4YRS A;  3VS7 A;  1EQR A;  2K7A A;  2ABL A;  3BDU A;  2FVU A;  2COZ A;  1SET A;  1V29 B;  1T0H A;  4M75 B;  4N0A A;  2EKO A;  4FYV B;  2OTJ Q;  2R58 A;  1WGS A;  1HJD A;  4X34 A;  1YJ9 T;  5FRM A;  2E6Z A;  3VQW A;  1SEM A;  2KQW A;  3CC4 T;  4LUD A; 
#chains in the Genus database with same CATH homology
 3A7U A;  2DIG A;  3HPW A;  5L8R E;  1VQM T;  3JB9 I;  3HRI A;  3EFS A;  4KUI A;  5ELN A;  4C92 A;  2RI5 A;  2G4C A;  4PJO F;  1M1G A;  2LDM A;  4H2W A;  4H2T A;  1G3W A;  3OMC A;  2VC8 A;  4ZGE B;  4YCW A;  3HSB A;  5A0D A;  1N9S A;  4QQ6 A;  2RK2 A;  3KBG A;  4OP0 A;  4R56 A;  1WYD A;  4X9D A;  3KXT A;  4C8Q E;  2M0O A;  2F5T X;  3FIF A;  2DXU A;  3RIR A;  4P72 C;  2CGH A;  2QQS A;  4C0G A;  2ZGW A;  1Y96 A;  3OYL A;  3A8L B;  4J6X A;  3JB9 D;  1YFT A;  3A5Z A;  4M78 F;  2PUK B;  4F7U A;  4BI8 B;  4ZN3 A;  2ARS A;  1E24 A;  2HAX A;  3OYJ A;  4M7A F;  1K73 U;  3JCM d;  2M1H A;  3HFZ A;  2DK3 A;  4TTV A;  2RHS B;  3CPW S;  3CCQ A;  3LSS A;  5GAN g;  1KD1 U;  2RJD A;  4H2S A;  1HXD A;  3TEH B;  2JTF A;  2K4Y A;  1TH7 A;  5GAM j;  3J7A F;  3HP9 A;  3GIB A;  1WU7 A;  1UGP B;  3E9I A;  3H8Z A;  2MI6 A;  1VQ7 A;  1X6O A;  4JLG A;  3QO8 A;  2CJB A;  3JB9 J;  4C8Q C;  4HWT A;  3CMA A;  2CJ9 A;  1YCY A;  2L89 A;  2OTL A;  3LWH A;  3HL8 A;  4P73 A;  1Q81 U;  4N4I A;  1QVF A;  2GQV A;  2C8M A;  5CKF A;  1BKB A;  1G5V A;  4II1 A;  2DAQ A;  2L8D A;  4ELY C;  2CZ0 B;  1IL2 A;  4PLL A;  3VUZ A;  3OB9 A;  1EIY B;  4NS5 A;  3UPU A;  4C8Q D;  4IUP A;  1Q82 C;  5HK3 A;  1VQ8 T;  1U1S A;  2GFA A;  3M59 A;  4EMK C;  3QKJ A;  1B7Y A;  4EPC A;  3TEE A;  4JS5 A;  3W3S A;  3PIO A;  2XID A;  2PU9 B;  4P3P A;  3J80 E;  3M4Y A;  2DTI A;  3UFG A;  4EMH A;  3C12 A;  5C52 B;  1ZBX A;  2QHT A;  3M53 A;  5GAN d;  2I4M A;  3S3O A;  4DA4 A;  2LRQ A;  3NTH A;  4OLF A;  2K3Y A;  2B8A A;  4M7A D;  3QHS A;  3DB3 A;  3MEY A;  3E9F A;  3LH0 A;  4F7U B;  4A4G A;  1KQ1 A;  4DQ2 A;  2Y4X A;  3RKY A;  5ELO A;  3S6W A;  4LVI A;  2IY5 B;  3JCM h;  2E5A A;  3P8B B;  1GXI E;  5C51 B;  3MP1 A;  2EL9 A;  3VQV A;  1KOG A;  4Q15 A;  3M4G A;  4J7I A;  4YRQ A;  4M77 E;  1J5W A;  2VGM A;  4M7A B;  2JN0 A;  4EMG A;  5CKB A;  1S72 A;  3CXC A;  1G5I A;  1N9W A;  4BI4 A;  3OYN A;  2ZNJ A;  4XU2 A;  4HA8 A;  3JB9 F;  3VQX A;  3OS5 A;  4E7K A;  4PHC A;  2EJG A;  4LVL A;  5FRO A;  2ZPE B;  4PLI A;  1G51 A;  2D0Q B;  4UC4 A;  2R57 A;  3PT9 A;  2DU7 A;  3PGG A;  2O4X A;  5GMK i;  3CBM A;  4C92 D;  4OGC A;  2VYT A;  4JLI A;  3PMI A;  5GAN 2;  2RB6 A;  1YIT A;  4CH3 A;  2RJF A;  3PCO A;  3OY9 A;  1KQS S;  2LCL A;  4HCB A;  3QTC A;  4XEM A;  2YLC A;  2ZT6 A;  3CMQ A;  2CKK A;  4HVC A;  3M57 A;  5LJ3 d;  4Y91 A;  3KFU A;  2HQE A;  4JDS A;  3CPW A;  1EVK A;  3OYB A;  5GAN 4;  4M78 A;  4XTV A;  1OZ2 A;  3CXC S;  2KVQ G;  3QO7 A;  12AS A;  2KMT A;  3FJP A;  4OMF B;  3RES A;  2IY5 A;  3CCM A;  1VQP T;  1B76 A;  4P75 C;  3SFM A;  2ZNI A;  4HCC A;  3JCM X;  3CCV T;  1BI1 A;  2ALY B;  4BWA A;  2K5F A;  4DOV A;  3JCM b;  1RI0 A;  4ZIB A;  5D6W A;  3LYI A;  1X54 A;  3X28 B;  5LJ5 h;  3G1Z A;  3JCM Q;  2E64 A;  4OGE A;  2RHQ B;  1L0W A;  4GLK A;  2LTO A;  5GAO l;  3UH0 A;  1DJ7 B;  2F5K A;  2K3X A;  1NYR A;  1B7Y B;  4A54 A;  1U8R A;  3PZC A;  2DKG A;  2JZ2 A;  4E51 A;  2P4T A;  3OYG A;  1P92 A;  3VKI A;  1WPY A;  3URG A;  3HFN A;  2Q7E A;  5CKD A;  3IAL A;  4C5G A;  2BIV A;  4XU1 A;  5LJ3 e;  1NJ1 A;  4HKE A;  3OS0 A;  2E3C A;  1VQ9 A;  1VQN A;  4YRG A;  4NOY A;  4P75 A;  5C0M A;  3VUB A;  2PVG B;  4Q5W A;  2FB7 A;  4ZTZ B;  3G6E A;  2E41 A;  3CC7 T;  1VQO T;  1BI3 A;  2PUO B;  2KAF A;  2EQU A;  1Z7N A;  3J81 E;  1SER A;  1YIT T;  1NZ9 A;  1VQZ A;  5F5W A;  2RJE A;  5GAM f;  1NPR A;  2E12 A;  3CME A;  4M7D G;  4YRM A;  3OYF A;  3CC2 A;  2EJF A;  4BW9 A;  1OI1 A;  1UB4 A;  5GAO m;  3QBY A;  2RHS A;  4ZGD B;  5CR2 A;  1WQW A;  4O5V A;  3OYD A;  2K57 A;  4PL6 A;  1WJQ A;  1C0A A;  5K1X A;  1W2B A;  1Q86 U;  1USY A;  3CCV A;  4CS3 A;  3QG1 A;  1G3S A;  3V8L A;  4L59 A;  2XU8 A;  4MZT A;  2RJC A;  3L2V A;  3UWN A;  2C06 A;  1QF6 A;  4DOW A;  1Q7Y U;  3CCR T;  2X4J A;  4ZTJ A;  1X75 C;  3OQ5 A;  4N4G A;  3OYK A;  1LOJ A;  3LLR A;  4K87 A;  4EX5 A;  2EJ9 A;  1BI2 A;  2DTH A;  3QZ5 B;  4IUT A;  2CZ7 B;  4C92 B;  4IKF A;  1M1K C;  2ZR3 A;  2DXT A;  4FIB A;  4YRP A;  1WLE A;  1VQ4 T;  4MMK A;  1ADY A;  4ME7 A;  1LNX A;  1M90 U;  4AH6 A;  1Y07 A;  4YRR A;  3P8T A;  2DIQ A;  3LGF A;  1M1F A;  2E1H A;  4L87 A;  3ZFJ A;  2ZIO A;  4N4H A;  4M75 E;  4J8O A;  3G6E T;  2XG8 D;  3CC7 A;  3A8O B;  4RDX A;  2KDS A;  4C5E A;  1K8A U;  3C4S A;  1R8O B;  3CBO A;  2DEQ A;  4KUD K;  4CH4 A;  4LD9 K;  4M77 A;  4EDU A;  3M4Q A;  3CCS T;  5KE2 A;  4ZN1 A;  2ZIM A;  2XDP A;  3OBW A;  1LYL A;  1JB0 E;  1VQ5 A;  2XK0 A;  1K8A C;  5CQX A;  3C95 A;  1VQK A;  2I4O A;  2XGT A;  4QW2 A;  2NS6 A;  2LT4 A;  3G4S A;  2E5Q A;  3P8Y A;  3HFO A;  4CH5 A;  1UGR B;  4J6W A;  3JRZ A;  1JJ2 A;  1YJW T;  3QZ9 B;  3CD6 A;  3IG2 A;  3E9G A;  2RHU A;  5DLQ E;  2ZPG B;  2MWP A;  2QQR A;  2V8J A;  4YCV A;  3QYG B;  1YI2 A;  4NL2 A;  4EMK B;  2JNG A;  4M78 B;  1Q81 C;  5KH6 A;  3PIP A;  1M90 C;  2XTI A;  3M54 A;  4WI1 A;  3MEV A;  1EIY A;  2D6F A;  1OZ3 A;  3V7R A;  1PYS A;  1NJ8 A;  3PTA A;  3X20 B;  3AHU A;  2CZ6 B;  3JCM J;  2OTJ T;  3OMG A;  4YRL A;  1QP2 A;  1E22 A;  3WXM B;  4M7A G;  4ZTU B;  4RCB A;  4JS4 A;  3HXW A;  3I55 T;  5AYF A;  2RH2 A;  4TWA A;  4LDU A;  2J3L A;  2RHI A;  1VQ4 A;  3FDR A;  2DD4 A;  3SWN B;  1H4S A;  1EOV A;  4FU6 A;  1M9S A;  2O4X B;  3CCU A;  2DJZ A;  1BYM A;  2KY9 A;  3EAE A;  4WJ3 M;  2O01 E;  1O9S A;  5E3I A;  3OYE A;  1ZQ1 A;  1YJ9 A;  2LT1 A;  5KCH A;  1BIA A;  1E1O A;  1JBM A;  3HHT B;  1VQ8 A;  2WSE E;  3QXE B;  3M9Q A;  1XTD A;  3VYH B;  4K86 A;  3A5Z B;  5CKH A;  1YJN A;  2GFU A;  3QSU A;  1Y96 B;  4PNO A;  5GAO p;  2ZZF A;  1HK9 A;  2P0Q A;  4QQD A;  1JJC A;  2QI2 A;  4B9X A;  2XDD A;  4P74 C;  3MCA B;  1YJN T;  4M77 D;  4F7U E;  4HT8 A;  5FRN A;  4CS2 A;  1NJI U;  4HWS A;  4Y28 E;  4HCZ A;  4XU0 A;  2QDY B;  2MF2 A;  3X26 B;  4L6V 5;  2EQJ A;  2HQX A;  1I8F A;  4C8Q B;  1YIJ T;  3ZBD A;  5GMK h;  4P5N A;  3A32 A;  1KQS A;  4RQE A;  1H4T A;  1QP3 A;  1JJC B;  4LNS A;  3A7R A;  3CD6 T;  1KC8 U;  4Z02 A;  4BB7 A;  3FC3 A;  2CYZ B;  2CJA A;  4KBM B;  2VGN A;  2FHD A;  2A8E A;  3RL6 A;  3M56 A;  1K9M C;  3I7F A;  3JCM e;  4E47 A;  3Q1J A;  3OYA A;  2DXC A;  2ODR D;  4X9C A;  2LC4 A;  3VYG A;  5J39 A;  1I5L A;  5A2Q E;  3CCQ T;  1KMM A;  4QQG A;  5DY9 A;  1EVL A;  3ERR A;  2PVO B;  2ARU A;  4M78 G;  5D6X A;  5GAN e;  3E1S A;  1YHQ T;  4LVM A;  3MEA A;  4M7A C;  5GAM g;  3FB9 A;  3A31 A;  5FLX E;  4RCC A;  4XK8 E;  4J6Y A;  5M9O A;  1KG1 A;  4M78 C;  4ZTF A;  3UGQ A;  4HWO A;  2Q7H A;  3GNF B;  2A3L A;  4HT9 A;  2DTO A;  1RL2 A;  2NLU A;  3BFM A;  2EAY A;  4BY6 C;  3REU A;  3P8V A;  2BKD N;  2QA4 T;  4A53 A;  3HY1 A;  2E65 A;  4XTU A;  1VQ6 T;  3TEH A;  1PYS B;  2L3R A;  1B34 B;  5GAM h;  4YRJ A;  4PJO D;  1W4S A;  1UGQ B;  1KMN A;  4A4H A;  4EMK A;  3MHX A;  2QA4 A;  1H3Z A;  3JCM g;  1X2H A;  4UP9 A;  3ZEH A;  3QYH B;  3JCM V;  4YPF A;  1W2B S;  5GAN 7;  2LCC A;  2D9T A;  3TU4 K;  1ASZ A;  1BIB A;  3WQZ A;  4DPG A;  1NYQ A;  2DXB A;  3V8J A;  2E10 A;  3HXX A;  4KR2 A;  3VJP A;  5HKC A;  4M7D D;  2QQ9 A;  4XQ3 A;  3LC0 A;  3L2Z A;  3V7C A;  4ELZ C;  3CPF A;  5LL6 S;  2VXE A;  3RUX A;  3BW1 A;  5DLO A;  4BI3 A;  3CMA T;  2ZTG A;  2DVE A;  1G3T A;  1X56 A;  1MGQ A;  5LJ5 e;  2AHJ B;  4J83 A;  4J15 A;  3LSQ A;  4TVA A;  3BY7 A;  2ZXF A;  1KQ2 A;  4EO4 A;  4V2S A;  1X01 A;  3KUF A;  3JAM E;  3QPH A;  1YHQ A;  2R5A A;  1E1T A;  1H64 1;  4C8Q G;  2A7Y A;  4F7U F;  2IG0 A;  3SD4 A;  4CRI A;  3TRE A;  4NL3 A;  4RKU E;  4YRO A;  4N0A C;  2P0K A;  3HFV A;  4M75 A;  3M55 A;  2HBP A;  5J26 A;  4BD3 A;  5FU7 B;  5C6S A;  4H2V A;  4P71 A;  3UDC A;  4H2U A;  2LNV A;  1JRI A;  3OYY A;  3P8H A;  3QO5 A;  5A0L A;  4M7D C;  3JSC A;  5LJ3 j;  2Q7G A;  4M7D A;  1M8V A;  4KQE A;  4H02 A;  3HXU A;  1RIQ A;  3IKL A;  1WQ7 A;  4XU3 A;  3RF1 A;  2RHX A;  2DZ9 A;  3S3M A;  3NFC A;  3CCS A;  4P3N A;  2ZPF B;  2DQ0 A;  4C0Z A;  4B9W A;  2KK4 A;  2Q5I A;  2I4N A;  3MP8 A;  5CCA A;  3M4P A;  3C94 A;  3QJ6 A;  3PFS A;  4YRC A;  1VIE A;  1NE8 A;  1YIJ A;  1PSE A;  4KUL A;  4LD6 A;  3QDR B;  1HC7 A;  4WJ4 A;  1NPP A;  1VQL A;  1WNL A;  2PVD B;  4A4F A;  5GMK l;  4TVR A;  2K5I A;  5IAY A;  5EG2 A;  5GAN f;  2RI2 A;  3HRK A;  3QO3 A;  3IKM B;  1FWZ A;  4FSX A;  3CEY A;  3I55 A;  4OB0 B;  2XDB A;  2XIC A;  1M5Q 1;  1D3B A;  3GLX A;  3JCM f;  1H4V B;  3CCE A;  3OW2 A;  1W66 A;  4P71 C;  3CCR A;  3TEG A;  3X25 B;  2QHU A;  1UGS B;  2YRV A;  2PQW A;  5IN1 A;  1AHJ B;  3OYI A;  1N9R A;  2CS7 A;  3GOX A;  1VQL T;  2RHZ A;  2XKO C;  2DZC A;  1YJW A;  4VUB A;  4BAC A;  4PJO C;  2EFI A;  2VUB A;  3MP6 A;  4CS4 A;  3HTZ A;  4NCX A;  1VUB A;  1VQP A;  1VQO A;  4BDY A;  3OYM A;  3HRU A;  2I2L A;  2QHV A;  2AKW B;  3JCM c;  1M1K U;  3LW5 E;  2WSF E;  3MET A;  5D6Y A;  1ATI A;  2JTM A;  4H2X A;  2RM4 A;  1XNI A;  4PG3 A;  5GMK e;  5LJ3 h;  4UP8 A;  3RMS A;  3MEW A;  1USY C;  3CCL T;  2V8K A;  3G4S T;  4KR3 A;  4YRT A;  3E9H A;  3LGL A;  2ZPH B;  4M78 E;  4C92 F;  3VQY A;  1Q82 U;  4QVD A;  2X4W A;  3F70 A;  1N6A A;  4XAX B;  4RG8 A;  3OS1 A;  2V8I A;  2M9U A;  1VQ5 T;  4YRF A;  2EYQ A;  2DU5 A;  3T9N A;  3QJY A;  2IVW A;  3DB4 A;  1QVG A;  3OYH A;  1QVG S;  2RHY A;  5CK9 A;  2LVM A;  2RA2 A;  5GAO n;  3DLL A;  2DDZ A;  4FT4 A;  1Y71 A;  3NTI A;  3H6Z A;  3HY0 A;  3NET A;  4PJO A;  5FU6 B;  3LWI A;  5GAN 5;  4H2X B;  3INZ A;  2ZZD A;  3A8H B;  3BJU A;  4M75 D;  2AMC B;  3PCO B;  3JCM W;  2QXF A;  2CZ1 B;  4BDZ A;  3RMQ A;  3NEL A;  5LJ5 j;  2VXF A;  5LJ5 g;  1N27 A;  3CCU T;  2P0L A;  4FT2 A;  4M75 C;  2VV5 A;  4E7I A;  2ZIN A;  4YRK A;  1UEB A;  2E6N A;  4A4K A;  4HWP A;  4A4E A;  3DSQ A;  4C92 E;  4P74 A;  4JJN K;  3E19 A;  3SWN A;  3L4G B;  2ZT7 A;  2QEX A;  4TVY A;  4LDV A;  4QVC A;  5GAO q;  4IUR A;  2H3J A;  5GAN 6;  3OW2 S;  4FL6 A;  5C53 B;  4OF1 A;  1XQH A;  4XTY A;  2EQM A;  4HWR A;  3R07 A;  3REX A;  4OB1 B;  4P3O A;  1H4Q A;  2CIM A;  3MF1 A;  1D3B B;  3L2U A;  4ZGJ B;  2ZCF B;  4M78 D;  3A8G B;  3OYC A;  4XEO A;  1K73 C;  5LJ3 g;  4WF2 A;  1FX7 A;  2KSS A;  4JRP A;  2LX9 A;  4G84 A;  3CCL A;  2ODR C;  1JJ2 S;  2RHQ A;  2LQK A;  1QVF S;  1YBY A;  4C0D B;  4JRQ A;  1Y7X A;  2YHT A;  1GGM A;  2ZZG A;  5LJ5 d;  4YCU A;  5CO7 A;  2K2V A;  3ER0 A;  3CCJ T;  3QUI A;  4M7A E;  2OAU A;  4J7F A;  3P8D A;  2Q5H A;  3PNW C;  1ADJ A;  1YI2 T;  3NTK A;  4M77 F;  2QQA A;  2ZZE A;  4CH6 A;  4E7J A;  1VQN T;  3VV0 A;  2J3M A;  1YGB A;  4C0F A;  2ZPI B;  5GAO r;  3ME9 A;  1S72 T;  1BBU A;  2K5L A;  1WJR A;  3I56 A;  4P72 A;  1K9M U;  1G5H A;  4M77 C;  1X2G A;  4RMF A;  4LDX A;  3M58 A;  1BBW A;  3MO8 A;  3HXZ A;  2X4Y A;  5KNN A;  2XHC A;  2X4X A;  5GAN h;  5HY6 A;  2EIF A;  1X55 A;  3G7Z A;  1KHC A;  4YRI A;  3HKS A;  1ASY A;  2QHS A;  1NJ2 A;  3L1A A;  3OA6 A;  1N8R U;  3CCE T;  3HXY A;  3MF2 A;  2P0P A;  3FEO A;  4O6J A;  3UGT A;  3A5Y A;  3JB9 G;  4YRE A;  1KHI A;  4BY6 B;  4JUV A;  2RK1 A;  2QEX T;  3DKM A;  1SES A;  2Y4Y A;  2PMF A;  1QE0 A;  2GCX A;  2RO0 A;  5GAM e;  1VQ6 A;  1Z7M A;  1NJ5 A;  3OBY A;  2RD1 A;  3NEM A;  3QNE A;  3VBB A;  3RAC A;  3S3N A;  3L42 A;  3OS2 A;  5GAN 8;  1N8R C;  1VQ7 T;  2DQ3 A;  2AKW A;  3SDZ A;  4H2Y A;  4XTW A;  3MQZ A;  5LJ5 f;  3JCM P;  1EIF A;  3BDL A;  4Q6G A;  3CCM T;  2WAC A;  4QVZ A;  5KE3 A;  2ZR2 A;  2OTL T;  3OD1 A;  1IRE B;  3CCJ A;  4YTL A;  4UPA A;  3I56 T;  4M75 F;  4PKC C;  2BUD A;  1U1T A;  1B34 A;  5GAM d;  2MMP A;  2WSC E;  3X24 B;  4YRN A;  4BE2 A;  1NNH A;  4M77 B;  5CAI A;  4BE0 A;  11AS A;  5I21 A;  5HGQ A;  5CVI A;  1XOV A;  4RMO A;  5I2S A;  1QW1 A;  2I4L A;  4RG2 A;  1M4Z A;  2L5Q A;  1KC8 C;  3L4G A;  2ZT8 A;  1VQ9 T;  4XTZ A;  5J3B A;  4MML A;  1KD1 C;  3O8V A;  4P73 C;  4L5G A;  4ATO A;  3FRN A;  4PJO E;  5KCO A;  4IUU A;  2X35 A;  1VQM A;  5FU6 C;  2AMC A;  1SSF A;  3CC4 A;  4C5I A;  2EQK A;  4PJO B;  5K1P A;  2QTX A;  3JB9 H;  2LQ8 A;  2FYK A;  4HT4 A;  1Q7Y C;  3LX7 A;  1I4K 1;  4IUQ A;  3OSV A;  4C5H A;  5GAN 3;  1LJO A;  2FL7 A;  4OVA A;  2C7I A;  2ZPB B;  3WVD B;  4MZP A;  4BUG A;  4GY5 A;  4XTX A;  1ZHI A;  1MHN A;  4JRI A;  3EFR A;  3TUP A;  5CKE A;  3A7A A;  4C8Q A;  1O75 A;  4LVK A;  3HFZ B;  3RKW A;  1FXX A;  3R6O A;  1EFW A;  4UP7 A;  1NJ6 A;  2YLB A;  3G71 T;  3GPL A;  3SWN C;  2ART A;  4G85 A;  4E7L A;  2MWO A;  3FLG A;  4RQF A;  2JUF A;  3GP8 A;  3ICA A;  3G71 A;  2P5I A;  1YB3 A;  5I2M A;  5A0G A;  1YFR A;  4C92 G;  3PMT A;  4KT0 E;  2E70 A;  4C0D C;  4YDQ A;  4C8Q F;  4BE1 A;  1FYF A;  3UT1 A;  1PSF A;  4MZM A;  3L2R A;  2MAM A;  3HRS A;  4PJO G;  4TVA B;  4M75 G;  2HD0 A;  2EWN A;  2QQB A;  5CIU A;  2XD0 A;  2ZT5 A;  4M7A A;  3DLM A;  5GMK m;  4LDY A;  4MDW A;  1B8A A;  3L2Q A;  4MDX A;  3V7S A;  2DO3 A;  3HRT A;  4JRK A;  3RER A;  4F7U G;  5LJ3 f;  1VQK T;  1WJS A;  3CC2 T;  2RI3 A;  2DPP B;  1B70 A;  3SB2 A;  3A74 A;  3CME T;  4YYE A;  1BI0 A;  2OTJ A;  4FM4 B;  4O2D A;  2G3R A;  3RKX A;  1SRY A;  4YP0 A;  2PME A;  3GF5 A;  2ZCE A;  4OB3 B;  5GMK j;  4M7D F;  4IUV A;  2R5M A;  4LVJ A;  3MEU A;  4K88 A;  1YFS A;  2XI9 A;  3GNG A;  2Y90 A;  4TQF A;  2F69 A;  5GAN j;  1VIF A;  2ALY A;  5HK0 A;  3VU3 C;  4C92 C;  1NJI C;  3OSS C;  4OB2 B;  3WVE B;  3V8K A;  5FU7 C;  1OYX A;  4TVW A;  4J5Y A;  2GF7 A;  3ASK A;  3QII A;  4LDW A;  4M77 G;  3N5B B;  3TCJ A;  3M5A A;  4CI0 C;  3HXV A;  4E7H A;  1IZ6 A;  4X5O A;  2DD5 A;  3CBP A;  1QVP A;  4D6W A;  5DM7 R;  4M7D B;  3NEN A;  1G3Y A;  1B70 B;  1HTT A;  2HNI A;  5IT9 E;  5CQY A;  3A8M B;  1Q86 C;  4TQD A;  4R55 A;  3RGL A;  2JOY A;  2M16 A;  4M7D E;  2JVV A;  3L2W A;  4YRS A;  1EQR A;  3BDU A;  2FVU A;  1SET A;  1V29 B;  4M75 B;  4N0A A;  2EKO A;  2R58 A;  1WGS A;  4X34 A;  1YJ9 T;  5FRM A;  2E6Z A;  3VQW A;  2KQW A;  3CC4 T;  1I81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...