1YGBA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 121
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ygbA01
3UGQA 4WF2A 1X54A 3L4GB 4HVCA 4CS4A 2PMEA 1SERA 4Q6GA 4AH6A 2HNIA 1QF6A 3P8VA 1HTTA 4RDXA 1X01A 2ZZFA 4H2UA 1ADJA 1H4QA 4CS2A 4P74A 3IKMB 2ZTGA 3PZCA 3QNEA 4WJ3M 2ZT7A 2CJAA 1JJCA 4DQ2A 3QO8A 3M4QA 4P71C 2CIMA 3VQWA 4HWOA 3EFSA 2Q5HA 4WI1A 4TWAA 2Q7HA 11ASA 4G84A 3HRIA 3HY1A 1N9WA 4P3OA 4CH4A 3ICAA 1QE0A 4PHCA 1HC7A 3MF1A 3NELA 2DXUA 4YRSA 3HFZA 1H4SA 3REUA 2ODRC 4K88A 2QHVA 4ZIBA 3KFUA 1H4VB 1Z7MA 3PCOA 1HXDA 2ARTA 2DTIA 2XTIA 4P3NA 4LNSA 4YROA 1B8AA 3TEHA 1X56A 3M4PA 3L1AA 2XGTA 3UFGA 4XU1A 1ASZA 2ZR2A 4H2YA 2G4CA 1B70A 1B7YA 3HXZA 3NEMA 3HFZB 1KMNA 4YRMA 4XTUA 3E9IA 4K87A 1KMMA 2ZZEA 2I4NA 3PCOB 1USYC 4E51A 1EFWA 4YYEA 4TVWA 3QO5A 2ZZGA 4XU3A 4YCWA 3RKWA 2IY5A 2DQ3A 1WLEA 1EIYB 1NJ6A 2CJBA 3LC0A 4OLFA 4ZTZB 4YPFA 3P8YA 1LYLA 1WQ7A 2E5AA 2DU7A 2IY5B 4YRKA 1ATIA 1G5IA 2E65A 4O2DA 3W3SA 5HGQA 1NJ5A 2I4MA 2QHSA 2ALYA 4XEMA 3HXXA 1YB3A 1E24A 1NNHA 4YRLA 4P72C 3A74A 3RUXA 4X5OA 4XU2A 2ZT5A 3REXA 4PG3A 5F5WA 4BW9A 1VQZA 2CGHA 2ALYB 2ZCEA 3BFMA 3NENA 4YRJA 1WNLA 2EJGA 4TVAA 1WPYA 1E1TA 2EJFA 4P3PA 3RKYA 3V7RA 5ELOA 4RQEA 2ZIMA 3R07A 4YCVA 1J5WA 1EQRA 4HWPA 4Q15A 3HXWA 1JJCB 2E41A 2EWNA 3V7SA 5C53B 4J15A 4TVAB 1BBUA 4KR2A 3HRKA 4OP0A 4P71A 2QHUA 3LSSA 4RQFA 1C0AA 3A5YA 3A7UA 4XTVA 4H2TA 4YCUA 3ERRA 3WQZA 3BJUA 1NJ2A 4KR3A 3RF1A 3EFRA 4BWAA 3V7CA 3IG2A 3VQYA 2Q5IA 1IL2A 4XU0A 4YP0A 1SETA 2ZGWA 2ZNJA 1BBWA 2ZXFA 4P73C 4TQDA 3RGLA 3E9HA 2E3CA 2RHSA 3V8LA 3FJPA 4UPAA 2DQ0A 3P8TA 2EAYA 3V8KA 2RHQA 5K1PA 3TEHB 1X2HA 1GGMA 1EVLA 3LSQA 2ODRD 4XEOA 5C52B 4HWTA 1SRYA 1B70B 2C8MA 3HXYA 1B7YB 4TQFA 2DDZA 1RIQA 2C7IA 2RHSB 4P75C 1USYA 3RACA 4YRIA 1EVKA 4H2XA 3HY0A 4HWRA 2AMCA 4YRTA 1WQWA 4YRGA 1E22A 3VQVA 1G5HA 3DSQA 1SESA 5ELNA 2P5IA 2FYKA 4UP7A 4NCXA 3HXVA 1X55A 3VBBA 2DVEA 4XTZA 3QTCA 1YFSA 1L0WA 2CJ9A 3HFVA 4H2XB 4XTYA 2AMCB 4EO4A 4P74C 1X2GA 3G1ZA 4CH5A 3TUPA 3RKXA 3L2ZA 4YRFA 4TVYA 4H2WA 2DEQA 2EL9A 2EJ9A 1KOGA 2DXTA 1NYQA 3A7RA 4KQEA 2DKGA 2AKWA 2E1HA 4P72A 5KNNA 3A32A 3A31A 1G51A 3IKLA 2QHTA 2I4OA 4YRRA 4HA8A 4CS3A 2J3MA 3A7AA 3CMQA 3UH0A 2ZIOA 3IALA 2DU5A 1NJ1A 4YRQA 4H2SA 2Q7GA 4UP8A 2DJZA 2AKWB 2I4LA 2ZT8A 4CH6A 3OD1A 1W66A 4WJ4A 1ADYA 4K86A 4ZTUB 4YREA 4H02A 1H4TA 2ZNIA 1YGBA 1BIAA 1EOVA 4YDQA 3QO7A 5C51B 2E64A 1BIBA 2DTHA 3MF2A 4TTVA 3V8JA 1WYDA 2ARUA 4XTWA 3HXUA 1B76A 12ASA 4HWSA 3RL6A 5K1XA 2E10A 3A5ZA 1EIYA 2P0LA 4RMFA 4CH3A 3MEYA 3RIRA 4P73A 4DPGA 1WU7A 4UP9A 2DTOA 1PYSA 2DZCA 3HTZA 2RHQB 3TEGA 1NJ8A 1YFTA 1ASYA 3I7FA 1YFRA 1FYFA 2DZ9A 2J3LA 2ZINA 4G85A 4EX5A 3L4GA 2ZR3A 2ARSA 2ZT6A 3UGTA 1Z7NA 1PYSB 4YRNA 1E1OA 4YRCA 2Q7EA 3VQXA 3NETA 2PMFA 4P75A 1NYRA 4H2VA 4YRPA 4XTXA 5E3IA 4L87A
chains in the Genus database with same CATH superfamily
3UGQA 4WF2A 1X54A 3L4GB 4HVCA 4CS4A 2PMEA 1SERA 4Q6GA 4AH6A 2HNIA 1QF6A 3P8VA 1HTTA 4RDXA 1X01A 2ZZFA 4H2UA 1ADJA 1H4QA 4CS2A 4P74A 3IKMB 2ZTGA 3PZCA 3QNEA 4WJ3M 2ZT7A 2CJAA 1JJCA 4DQ2A 3QO8A 3M4QA 4P71C 2CIMA 3VQWA 4HWOA 3EFSA 2Q5HA 4WI1A 4TWAA 2Q7HA 11ASA 4G84A 3HRIA 3HY1A 1N9WA 4P3OA 4CH4A 3ICAA 1QE0A 4PHCA 1HC7A 3MF1A 3NELA 2DXUA 4YRSA 3HFZA 1H4SA 3REUA 2ODRC 4K88A 2QHVA 4ZIBA 3KFUA 1H4VB 1Z7MA 3PCOA 1HXDA 2ARTA 2DTIA 2XTIA 4P3NA 4LNSA 4YROA 1B8AA 3TEHA 1X56A 3M4PA 3L1AA 2XGTA 3UFGA 4XU1A 1ASZA 2ZR2A 4H2YA 2G4CA 1B70A 1B7YA 3HXZA 3NEMA 3HFZB 1KMNA 4YRMA 4XTUA 3E9IA 4K87A 1KMMA 2ZZEA 2I4NA 3PCOB 1USYC 4E51A 1EFWA 4YYEA 4TVWA 3QO5A 2ZZGA 4XU3A 4YCWA 3RKWA 2IY5A 2DQ3A 1WLEA 1EIYB 1NJ6A 2CJBA 3LC0A 4OLFA 4ZTZB 4YPFA 3P8YA 1LYLA 1WQ7A 2E5AA 2DU7A 2IY5B 4YRKA 1ATIA 1G5IA 2E65A 4O2DA 3W3SA 5HGQA 1NJ5A 2I4MA 2QHSA 2ALYA 4XEMA 3HXXA 1YB3A 1E24A 1NNHA 4YRLA 4P72C 3A74A 3RUXA 4X5OA 4LVKA 4XU2A 2ZT5A 3REXA 4PG3A 5F5WA 4BW9A 1VQZA 2CGHA 2ALYB 2ZCEA 3BFMA 3NENA 4YRJA 1WNLA 2EJGA 4TVAA 1WPYA 1E1TA 2EJFA 4P3PA 4LVIA 3RKYA 3V7RA 5ELOA 4RQEA 2ZIMA 3R07A 4YCVA 1J5WA 1EQRA 4HWPA 4Q15A 3HXWA 1JJCB 2E41A 2EWNA 3V7SA 5C53B 4J15A 4TVAB 1BBUA 4KR2A 3HRKA 4OP0A 4P71A 2QHUA 3LSSA 4RQFA 1C0AA 3A5YA 3A7UA 4XTVA 4H2TA 4YCUA 3ERRA 3WQZA 3BJUA 1NJ2A 4KR3A 3RF1A 3EFRA 4BWAA 3V7CA 3IG2A 3VQYA 2Q5IA 1IL2A 4XU0A 4YP0A 1SETA 2ZGWA 2ZNJA 1BBWA 2ZXFA 4P73C 4TQDA 3RGLA 3E9HA 2E3CA 2RHSA 3V8LA 3FJPA 4UPAA 2DQ0A 3P8TA 2EAYA 3V8KA 2RHQA 5K1PA 3TEHB 1X2HA 1GGMA 1EVLA 3LSQA 2ODRD 4XEOA 5C52B 4HWTA 1SRYA 1B70B 2C8MA 3HXYA 1B7YB 4TQFA 2DDZA 1RIQA 2C7IA 2RHSB 4P75C 1USYA 4LVJA 3RACA 4YRIA 1EVKA 4H2XA 3HY0A 4HWRA 2AMCA 4YRTA 1WQWA 4YRGA 1E22A 3VQVA 1G5HA 3DSQA 1SESA 5ELNA 2P5IA 2FYKA 4UP7A 4NCXA 3HXVA 1X55A 3VBBA 2DVEA 4XTZA 3QTCA 1YFSA 1L0WA 2CJ9A 3HFVA 4H2XB 4XTYA 2AMCB 4EO4A 4P74C 1X2GA 3G1ZA 4CH5A 3TUPA 3RKXA 3L2ZA 4YRFA 4TVYA 4H2WA 2DEQA 2EL9A 2EJ9A 1KOGA 2DXTA 1NYQA 3A7RA 4KQEA 2DKGA 2AKWA 2E1HA 4P72A 5KNNA 3A32A 3A31A 2NS6A 1G51A 3IKLA 2QHTA 2I4OA 4YRRA 4HA8A 4CS3A 2J3MA 3A7AA 3CMQA 3UH0A 2ZIOA 3IALA 2DU5A 1NJ1A 4YRQA 4H2SA 2Q7GA 4UP8A 2DJZA 2AKWB 2I4LA 2ZT8A 4CH6A 3OD1A 1W66A 4WJ4A 1ADYA 4K86A 4ZTUB 2A8EA 4YREA 4H02A 1H4TA 2ZNIA 1YGBA 1BIAA 1EOVA 4YDQA 3QO7A 5C51B 2E64A 1BIBA 2DTHA 3MF2A 4TTVA 3V8JA 1WYDA 2ARUA 4XTWA 4LVMA 3HXUA 1B76A 12ASA 4HWSA 3RL6A 5K1XA 2E10A 3A5ZA 1EIYA 2P0LA 4RMFA 4CH3A 3MEYA 3MQZA 3RIRA 4P73A 4DPGA 1WU7A 4UP9A 2DTOA 1PYSA 2DZCA 3HTZA 2RHQB 3TEGA 1NJ8A 1YFTA 1ASYA 3I7FA 1YFRA 1FYFA 2DZ9A 2J3LA 2ZINA 4G85A 4EX5A 3L4GA 2ZR3A 4LVLA 2ARSA 2ZT6A 3UGTA 4HT4A 1Z7NA 1PYSB 4YRNA 1E1OA 4YRCA 2Q7EA 3VQXA 3NETA 2PMFA 4P75A 1NYRA 4H2VA 4YRPA 4XTXA 5E3IA 4L87A
chains in the Genus database with same CATH topology
3UGQA 4WF2A 1X54A 3L4GB 4HVCA 4CS4A 2PMEA 1SERA 4Q6GA 4AH6A 2HNIA 1QF6A 3P8VA 1HTTA 4RDXA 1X01A 2ZZFA 4H2UA 1ADJA 1H4QA 4CS2A 4P74A 3IKMB 2ZTGA 3PZCA 3QNEA 4WJ3M 2ZT7A 2CJAA 1JJCA 4DQ2A 3QO8A 3M4QA 4P71C 2CIMA 3VQWA 4HWOA 3EFSA 2Q5HA 4WI1A 4TWAA 2Q7HA 11ASA 4G84A 3HRIA 3HY1A 1N9WA 4P3OA 4CH4A 3ICAA 1QE0A 4PHCA 1HC7A 3MF1A 3NELA 2DXUA 4YRSA 3HFZA 1H4SA 3REUA 2ODRC 4K88A 2QHVA 4ZIBA 3KFUA 1H4VB 1Z7MA 3PCOA 1HXDA 2ARTA 2DTIA 2XTIA 4P3NA 4LNSA 4YROA 1B8AA 3TEHA 1X56A 3M4PA 3L1AA 2XGTA 3UFGA 4XU1A 1ASZA 2ZR2A 4H2YA 2G4CA 1B70A 1B7YA 3HXZA 3NEMA 3HFZB 1KMNA 4YRMA 4XTUA 3E9IA 4K87A 1KMMA 2ZZEA 2I4NA 3PCOB 1USYC 4E51A 1EFWA 4YYEA 4TVWA 3QO5A 2ZZGA 4XU3A 4YCWA 3RKWA 2IY5A 2DQ3A 1WLEA 1EIYB 1NJ6A 2CJBA 3LC0A 4OLFA 4ZTZB 4YPFA 3P8YA 1LYLA 1WQ7A 2E5AA 2DU7A 2IY5B 4YRKA 1ATIA 1G5IA 2E65A 4O2DA 3W3SA 5HGQA 1NJ5A 2I4MA 2QHSA 2ALYA 4XEMA 3HXXA 1YB3A 1E24A 1NNHA 4YRLA 4P72C 3A74A 3RUXA 4X5OA 4LVKA 4XU2A 2ZT5A 3REXA 4PG3A 5F5WA 4BW9A 1VQZA 2CGHA 2ALYB 2ZCEA 3BFMA 3NENA 4YRJA 1WNLA 2EJGA 4TVAA 1WPYA 1E1TA 2EJFA 4P3PA 4LVIA 3RKYA 3V7RA 5ELOA 4RQEA 2ZIMA 3R07A 4YCVA 1J5WA 1EQRA 4HWPA 4Q15A 3HXWA 1JJCB 2E41A 2EWNA 3V7SA 5C53B 4J15A 4TVAB 1BBUA 4KR2A 3HRKA 4OP0A 4P71A 2QHUA 3LSSA 4RQFA 1C0AA 3A5YA 3A7UA 4XTVA 4H2TA 4YCUA 3ERRA 3WQZA 3BJUA 1NJ2A 4KR3A 3RF1A 3EFRA 4BWAA 3V7CA 3IG2A 3VQYA 2Q5IA 1IL2A 4XU0A 4YP0A 1SETA 2ZGWA 2ZNJA 1BBWA 2ZXFA 4P73C 4TQDA 3RGLA 3E9HA 2E3CA 2RHSA 3V8LA 3FJPA 4UPAA 2DQ0A 3P8TA 2EAYA 3V8KA 2RHQA 5K1PA 3TEHB 1X2HA 1GGMA 1EVLA 3LSQA 2ODRD 4XEOA 5C52B 4HWTA 1SRYA 1B70B 2C8MA 3HXYA 1B7YB 4TQFA 2DDZA 1RIQA 2C7IA 2RHSB 4P75C 1USYA 4LVJA 3RACA 4YRIA 1EVKA 4H2XA 3HY0A 4HWRA 2AMCA 4YRTA 1WQWA 4YRGA 1E22A 3VQVA 1G5HA 3DSQA 1SESA 5ELNA 2P5IA 2FYKA 4UP7A 4NCXA 3HXVA 1X55A 3VBBA 2DVEA 4XTZA 3QTCA 1YFSA 1L0WA 2CJ9A 3HFVA 4H2XB 4XTYA 2AMCB 4EO4A 4P74C 1X2GA 3G1ZA 4CH5A 3TUPA 3RKXA 3L2ZA 4YRFA 4TVYA 4H2WA 2DEQA 2EL9A 2EJ9A 1KOGA 2DXTA 1NYQA 3A7RA 4KQEA 2DKGA 2AKWA 2E1HA 4P72A 5KNNA 3A32A 3A31A 2NS6A 1G51A 3IKLA 2QHTA 2I4OA 4YRRA 4HA8A 4CS3A 2J3MA 3A7AA 3CMQA 3UH0A 2ZIOA 3IALA 2DU5A 1NJ1A 4YRQA 4H2SA 2Q7GA 4UP8A 2DJZA 2AKWB 2I4LA 2ZT8A 4CH6A 3OD1A 1W66A 4WJ4A 1ADYA 4K86A 4ZTUB 2A8EA 4YREA 4H02A 1H4TA 2ZNIA 1YGBA 1BIAA 1EOVA 4YDQA 3QO7A 5C51B 2E64A 1BIBA 2DTHA 3MF2A 4TTVA 3V8JA 1WYDA 2ARUA 4XTWA 4LVMA 3HXUA 1B76A 12ASA 4HWSA 3RL6A 5K1XA 2E10A 3A5ZA 1EIYA 2P0LA 4RMFA 4CH3A 3MEYA 3MQZA 3RIRA 4P73A 4DPGA 1WU7A 4UP9A 2DTOA 1PYSA 2DZCA 3HTZA 2RHQB 3TEGA 1NJ8A 1YFTA 1ASYA 3I7FA 1YFRA 1FYFA 2DZ9A 2J3LA 2ZINA 4G85A 4EX5A 3L4GA 2ZR3A 4LVLA 2ARSA 2ZT6A 3UGTA 4HT4A 1Z7NA 1PYSB 4YRNA 1E1OA 4YRCA 2Q7EA 3VQXA 3NETA 2PMFA 4P75A 1NYRA 4H2VA 4YRPA 4XTXA 5E3IA 4L87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UGQ A;  4WF2 A;  1X54 A;  3L4G B;  4HVC A;  4CS4 A;  2PME A;  1SER A;  4Q6G A;  4AH6 A;  2HNI A;  1QF6 A;  3P8V A;  1HTT A;  4RDX A;  1X01 A;  2ZZF A;  4H2U A;  1ADJ A;  1H4Q A;  4CS2 A;  4P74 A;  3IKM B;  2ZTG A;  3PZC A;  3QNE A;  4WJ3 M;  2ZT7 A;  2CJA A;  1JJC A;  4DQ2 A;  3QO8 A;  3M4Q A;  4P71 C;  2CIM A;  3VQW A;  4HWO A;  3EFS A;  2Q5H A;  4WI1 A;  4TWA A;  2Q7H A;  11AS A;  4G84 A;  3HRI A;  3HY1 A;  1N9W A;  4P3O A;  4CH4 A;  3ICA A;  1QE0 A;  4PHC A;  1HC7 A;  3MF1 A;  3NEL A;  2DXU A;  4YRS A;  3HFZ A;  1H4S A;  3REU A;  2ODR C;  4K88 A;  2QHV A;  4ZIB A;  3KFU A;  1H4V B;  1Z7M A;  3PCO A;  1HXD A;  2ART A;  2DTI A;  2XTI A;  4P3N A;  4LNS A;  4YRO A;  1B8A A;  3TEH A;  1X56 A;  3M4P A;  3L1A A;  2XGT A;  3UFG A;  4XU1 A;  1ASZ A;  2ZR2 A;  4H2Y A;  2G4C A;  1B70 A;  1B7Y A;  3HXZ A;  3NEM A;  3HFZ B;  1KMN A;  4YRM A;  4XTU A;  3E9I A;  4K87 A;  1KMM A;  2ZZE A;  2I4N A;  3PCO B;  1USY C;  4E51 A;  1EFW A;  4YYE A;  4TVW A;  3QO5 A;  2ZZG A;  4XU3 A;  4YCW A;  3RKW A;  2IY5 A;  2DQ3 A;  1WLE A;  1EIY B;  1NJ6 A;  2CJB A;  3LC0 A;  4OLF A;  4ZTZ B;  4YPF A;  3P8Y A;  1LYL A;  1WQ7 A;  2E5A A;  2DU7 A;  2IY5 B;  4YRK A;  1ATI A;  1G5I A;  2E65 A;  4O2D A;  3W3S A;  5HGQ A;  1NJ5 A;  2I4M A;  2QHS A;  2ALY A;  4XEM A;  3HXX A;  1YB3 A;  1E24 A;  1NNH A;  4YRL A;  4P72 C;  3A74 A;  3RUX A;  4X5O A;  4XU2 A;  2ZT5 A;  3REX A;  4PG3 A;  5F5W A;  4BW9 A;  1VQZ A;  2CGH A;  2ALY B;  2ZCE A;  3BFM A;  3NEN A;  4YRJ A;  1WNL A;  2EJG A;  4TVA A;  1WPY A;  1E1T A;  2EJF A;  4P3P A;  3RKY A;  3V7R A;  5ELO A;  4RQE A;  2ZIM A;  3R07 A;  4YCV A;  1J5W A;  1EQR A;  4HWP A;  4Q15 A;  3HXW A;  1JJC B;  2E41 A;  2EWN A;  3V7S A;  5C53 B;  4J15 A;  4TVA B;  1BBU A;  4KR2 A;  3HRK A;  4OP0 A;  4P71 A;  2QHU A;  3LSS A;  4RQF A;  1C0A A;  3A5Y A;  3A7U A;  4XTV A;  4H2T A;  4YCU A;  3ERR A;  3WQZ A;  3BJU A;  1NJ2 A;  4KR3 A;  3RF1 A;  3EFR A;  4BWA A;  3V7C A;  3IG2 A;  3VQY A;  2Q5I A;  1IL2 A;  4XU0 A;  4YP0 A;  1SET A;  2ZGW A;  2ZNJ A;  1BBW A;  2ZXF A;  4P73 C;  4TQD A;  3RGL A;  3E9H A;  2E3C A;  2RHS A;  3V8L A;  3FJP A;  4UPA A;  2DQ0 A;  3P8T A;  2EAY A;  3V8K A;  2RHQ A;  5K1P A;  3TEH B;  1X2H A;  1GGM A;  1EVL A;  3LSQ A;  2ODR D;  4XEO A;  5C52 B;  4HWT A;  1SRY A;  1B70 B;  2C8M A;  3HXY A;  1B7Y B;  4TQF A;  2DDZ A;  1RIQ A;  2C7I A;  2RHS B;  4P75 C;  1USY A;  3RAC A;  4YRI A;  1EVK A;  4H2X A;  3HY0 A;  4HWR A;  2AMC A;  4YRT A;  1WQW A;  4YRG A;  1E22 A;  3VQV A;  1G5H A;  3DSQ A;  1SES A;  5ELN A;  2P5I A;  2FYK A;  4UP7 A;  4NCX A;  3HXV A;  1X55 A;  3VBB A;  2DVE A;  4XTZ A;  3QTC A;  1YFS A;  1L0W A;  2CJ9 A;  3HFV A;  4H2X B;  4XTY A;  2AMC B;  4EO4 A;  4P74 C;  1X2G A;  3G1Z A;  4CH5 A;  3TUP A;  3RKX A;  3L2Z A;  4YRF A;  4TVY A;  4H2W A;  2DEQ A;  2EL9 A;  2EJ9 A;  1KOG A;  2DXT A;  1NYQ A;  3A7R A;  4KQE A;  2DKG A;  2AKW A;  2E1H A;  4P72 A;  5KNN A;  3A32 A;  3A31 A;  1G51 A;  3IKL A;  2QHT A;  2I4O A;  4YRR A;  4HA8 A;  4CS3 A;  2J3M A;  3A7A A;  3CMQ A;  3UH0 A;  2ZIO A;  3IAL A;  2DU5 A;  1NJ1 A;  4YRQ A;  4H2S A;  2Q7G A;  4UP8 A;  2DJZ A;  2AKW B;  2I4L A;  2ZT8 A;  4CH6 A;  3OD1 A;  1W66 A;  4WJ4 A;  1ADY A;  4K86 A;  4ZTU B;  4YRE A;  4H02 A;  1H4T A;  2ZNI A;  1YGB A;  1BIA A;  1EOV A;  4YDQ A;  3QO7 A;  5C51 B;  2E64 A;  1BIB A;  2DTH A;  3MF2 A;  4TTV A;  3V8J A;  1WYD A;  2ARU A;  4XTW A;  3HXU A;  1B76 A;  12AS A;  4HWS A;  3RL6 A;  5K1X A;  2E10 A;  3A5Z A;  1EIY A;  2P0L A;  4RMF A;  4CH3 A;  3MEY A;  3RIR A;  4P73 A;  4DPG A;  1WU7 A;  4UP9 A;  2DTO A;  1PYS A;  2DZC A;  3HTZ A;  2RHQ B;  3TEG A;  1NJ8 A;  1YFT A;  1ASY A;  3I7F A;  1YFR A;  1FYF A;  2DZ9 A;  2J3L A;  2ZIN A;  4G85 A;  4EX5 A;  3L4G A;  2ZR3 A;  2ARS A;  2ZT6 A;  3UGT A;  1Z7N A;  1PYS B;  4YRN A;  1E1O A;  4YRC A;  2Q7E A;  3VQX A;  3NET A;  2PMF A;  4P75 A;  1NYR A;  4H2V A;  4YRP A;  4XTX A;  5E3I A;  4L87 A; 
#chains in the Genus database with same CATH topology
 3UGQ A;  4WF2 A;  1X54 A;  3L4G B;  4HVC A;  4CS4 A;  2PME A;  1SER A;  4Q6G A;  4AH6 A;  2HNI A;  1QF6 A;  3P8V A;  1HTT A;  4RDX A;  1X01 A;  2ZZF A;  4H2U A;  1ADJ A;  1H4Q A;  4CS2 A;  4P74 A;  3IKM B;  2ZTG A;  3PZC A;  3QNE A;  4WJ3 M;  2ZT7 A;  2CJA A;  1JJC A;  4DQ2 A;  3QO8 A;  3M4Q A;  4P71 C;  2CIM A;  3VQW A;  4HWO A;  3EFS A;  2Q5H A;  4WI1 A;  4TWA A;  2Q7H A;  11AS A;  4G84 A;  3HRI A;  3HY1 A;  1N9W A;  4P3O A;  4CH4 A;  3ICA A;  1QE0 A;  4PHC A;  1HC7 A;  3MF1 A;  3NEL A;  2DXU A;  4YRS A;  3HFZ A;  1H4S A;  3REU A;  2ODR C;  4K88 A;  2QHV A;  4ZIB A;  3KFU A;  1H4V B;  1Z7M A;  3PCO A;  1HXD A;  2ART A;  2DTI A;  2XTI A;  4P3N A;  4LNS A;  4YRO A;  1B8A A;  3TEH A;  1X56 A;  3M4P A;  3L1A A;  2XGT A;  3UFG A;  4XU1 A;  1ASZ A;  2ZR2 A;  4H2Y A;  2G4C A;  1B70 A;  1B7Y A;  3HXZ A;  3NEM A;  3HFZ B;  1KMN A;  4YRM A;  4XTU A;  3E9I A;  4K87 A;  1KMM A;  2ZZE A;  2I4N A;  3PCO B;  1USY C;  4E51 A;  1EFW A;  4YYE A;  4TVW A;  3QO5 A;  2ZZG A;  4XU3 A;  4YCW A;  3RKW A;  2IY5 A;  2DQ3 A;  1WLE A;  1EIY B;  1NJ6 A;  2CJB A;  3LC0 A;  4OLF A;  4ZTZ B;  4YPF A;  3P8Y A;  1LYL A;  1WQ7 A;  2E5A A;  2DU7 A;  2IY5 B;  4YRK A;  1ATI A;  1G5I A;  2E65 A;  4O2D A;  3W3S A;  5HGQ A;  1NJ5 A;  2I4M A;  2QHS A;  2ALY A;  4XEM A;  3HXX A;  1YB3 A;  1E24 A;  1NNH A;  4YRL A;  4P72 C;  3A74 A;  3RUX A;  4X5O A;  4LVK A;  4XU2 A;  2ZT5 A;  3REX A;  4PG3 A;  5F5W A;  4BW9 A;  1VQZ A;  2CGH A;  2ALY B;  2ZCE A;  3BFM A;  3NEN A;  4YRJ A;  1WNL A;  2EJG A;  4TVA A;  1WPY A;  1E1T A;  2EJF A;  4P3P A;  4LVI A;  3RKY A;  3V7R A;  5ELO A;  4RQE A;  2ZIM A;  3R07 A;  4YCV A;  1J5W A;  1EQR A;  4HWP A;  4Q15 A;  3HXW A;  1JJC B;  2E41 A;  2EWN A;  3V7S A;  5C53 B;  4J15 A;  4TVA B;  1BBU A;  4KR2 A;  3HRK A;  4OP0 A;  4P71 A;  2QHU A;  3LSS A;  4RQF A;  1C0A A;  3A5Y A;  3A7U A;  4XTV A;  4H2T A;  4YCU A;  3ERR A;  3WQZ A;  3BJU A;  1NJ2 A;  4KR3 A;  3RF1 A;  3EFR A;  4BWA A;  3V7C A;  3IG2 A;  3VQY A;  2Q5I A;  1IL2 A;  4XU0 A;  4YP0 A;  1SET A;  2ZGW A;  2ZNJ A;  1BBW A;  2ZXF A;  4P73 C;  4TQD A;  3RGL A;  3E9H A;  2E3C A;  2RHS A;  3V8L A;  3FJP A;  4UPA A;  2DQ0 A;  3P8T A;  2EAY A;  3V8K A;  2RHQ A;  5K1P A;  3TEH B;  1X2H A;  1GGM A;  1EVL A;  3LSQ A;  2ODR D;  4XEO A;  5C52 B;  4HWT A;  1SRY A;  1B70 B;  2C8M A;  3HXY A;  1B7Y B;  4TQF A;  2DDZ A;  1RIQ A;  2C7I A;  2RHS B;  4P75 C;  1USY A;  4LVJ A;  3RAC A;  4YRI A;  1EVK A;  4H2X A;  3HY0 A;  4HWR A;  2AMC A;  4YRT A;  1WQW A;  4YRG A;  1E22 A;  3VQV A;  1G5H A;  3DSQ A;  1SES A;  5ELN A;  2P5I A;  2FYK A;  4UP7 A;  4NCX A;  3HXV A;  1X55 A;  3VBB A;  2DVE A;  4XTZ A;  3QTC A;  1YFS A;  1L0W A;  2CJ9 A;  3HFV A;  4H2X B;  4XTY A;  2AMC B;  4EO4 A;  4P74 C;  1X2G A;  3G1Z A;  4CH5 A;  3TUP A;  3RKX A;  3L2Z A;  4YRF A;  4TVY A;  4H2W A;  2DEQ A;  2EL9 A;  2EJ9 A;  1KOG A;  2DXT A;  1NYQ A;  3A7R A;  4KQE A;  2DKG A;  2AKW A;  2E1H A;  4P72 A;  5KNN A;  3A32 A;  3A31 A;  2NS6 A;  1G51 A;  3IKL A;  2QHT A;  2I4O A;  4YRR A;  4HA8 A;  4CS3 A;  2J3M A;  3A7A A;  3CMQ A;  3UH0 A;  2ZIO A;  3IAL A;  2DU5 A;  1NJ1 A;  4YRQ A;  4H2S A;  2Q7G A;  4UP8 A;  2DJZ A;  2AKW B;  2I4L A;  2ZT8 A;  4CH6 A;  3OD1 A;  1W66 A;  4WJ4 A;  1ADY A;  4K86 A;  4ZTU B;  2A8E A;  4YRE A;  4H02 A;  1H4T A;  2ZNI A;  1YGB A;  1BIA A;  1EOV A;  4YDQ A;  3QO7 A;  5C51 B;  2E64 A;  1BIB A;  2DTH A;  3MF2 A;  4TTV A;  3V8J A;  1WYD A;  2ARU A;  4XTW A;  4LVM A;  3HXU A;  1B76 A;  12AS A;  4HWS A;  3RL6 A;  5K1X A;  2E10 A;  3A5Z A;  1EIY A;  2P0L A;  4RMF A;  4CH3 A;  3MEY A;  3MQZ A;  3RIR A;  4P73 A;  4DPG A;  1WU7 A;  4UP9 A;  2DTO A;  1PYS A;  2DZC A;  3HTZ A;  2RHQ B;  3TEG A;  1NJ8 A;  1YFT A;  1ASY A;  3I7F A;  1YFR A;  1FYF A;  2DZ9 A;  2J3L A;  2ZIN A;  4G85 A;  4EX5 A;  3L4G A;  2ZR3 A;  4LVL A;  2ARS A;  2ZT6 A;  3UGT A;  4HT4 A;  1Z7N A;  1PYS B;  4YRN A;  1E1O A;  4YRC A;  2Q7E A;  3VQX A;  3NET A;  2PMF A;  4P75 A;  1NYR A;  4H2V A;  4YRP A;  4XTX A;  5E3I A;  4L87 A; 
#chains in the Genus database with same CATH homology
 3UGQ A;  4WF2 A;  1X54 A;  3L4G B;  4HVC A;  4CS4 A;  2PME A;  1SER A;  4Q6G A;  4AH6 A;  2HNI A;  1QF6 A;  3P8V A;  1HTT A;  4RDX A;  1X01 A;  2ZZF A;  4H2U A;  1ADJ A;  1H4Q A;  4CS2 A;  4P74 A;  3IKM B;  2ZTG A;  3PZC A;  3QNE A;  4WJ3 M;  2ZT7 A;  2CJA A;  1JJC A;  4DQ2 A;  3QO8 A;  3M4Q A;  4P71 C;  2CIM A;  3VQW A;  4HWO A;  3EFS A;  2Q5H A;  4WI1 A;  4TWA A;  2Q7H A;  11AS A;  4G84 A;  3HRI A;  3HY1 A;  1N9W A;  4P3O A;  4CH4 A;  3ICA A;  1QE0 A;  4PHC A;  1HC7 A;  3MF1 A;  3NEL A;  2DXU A;  4YRS A;  3HFZ A;  1H4S A;  3REU A;  2ODR C;  4K88 A;  2QHV A;  4ZIB A;  3KFU A;  1H4V B;  1Z7M A;  3PCO A;  1HXD A;  2ART A;  2DTI A;  2XTI A;  4P3N A;  4LNS A;  4YRO A;  1B8A A;  3TEH A;  1X56 A;  3M4P A;  3L1A A;  2XGT A;  3UFG A;  4XU1 A;  1ASZ A;  2ZR2 A;  4H2Y A;  2G4C A;  1B70 A;  1B7Y A;  3HXZ A;  3NEM A;  3HFZ B;  1KMN A;  4YRM A;  4XTU A;  3E9I A;  4K87 A;  1KMM A;  2ZZE A;  2I4N A;  3PCO B;  1USY C;  4E51 A;  1EFW A;  4YYE A;  4TVW A;  3QO5 A;  2ZZG A;  4XU3 A;  4YCW A;  3RKW A;  2IY5 A;  2DQ3 A;  1WLE A;  1EIY B;  1NJ6 A;  2CJB A;  3LC0 A;  4OLF A;  4ZTZ B;  4YPF A;  3P8Y A;  1LYL A;  1WQ7 A;  2E5A A;  2DU7 A;  2IY5 B;  4YRK A;  1ATI A;  1G5I A;  2E65 A;  4O2D A;  3W3S A;  5HGQ A;  1NJ5 A;  2I4M A;  2QHS A;  2ALY A;  4XEM A;  3HXX A;  1YB3 A;  1E24 A;  1NNH A;  4YRL A;  4P72 C;  3A74 A;  3RUX A;  4X5O A;  4LVK A;  4XU2 A;  2ZT5 A;  3REX A;  4PG3 A;  5F5W A;  4BW9 A;  1VQZ A;  2CGH A;  2ALY B;  2ZCE A;  3BFM A;  3NEN A;  4YRJ A;  1WNL A;  2EJG A;  4TVA A;  1WPY A;  1E1T A;  2EJF A;  4P3P A;  4LVI A;  3RKY A;  3V7R A;  5ELO A;  4RQE A;  2ZIM A;  3R07 A;  4YCV A;  1J5W A;  1EQR A;  4HWP A;  4Q15 A;  3HXW A;  1JJC B;  2E41 A;  2EWN A;  3V7S A;  5C53 B;  4J15 A;  4TVA B;  1BBU A;  4KR2 A;  3HRK A;  4OP0 A;  4P71 A;  2QHU A;  3LSS A;  4RQF A;  1C0A A;  3A5Y A;  3A7U A;  4XTV A;  4H2T A;  4YCU A;  3ERR A;  3WQZ A;  3BJU A;  1NJ2 A;  4KR3 A;  3RF1 A;  3EFR A;  4BWA A;  3V7C A;  3IG2 A;  3VQY A;  2Q5I A;  1IL2 A;  4XU0 A;  4YP0 A;  1SET A;  2ZGW A;  2ZNJ A;  1BBW A;  2ZXF A;  4P73 C;  4TQD A;  3RGL A;  3E9H A;  2E3C A;  2RHS A;  3V8L A;  3FJP A;  4UPA A;  2DQ0 A;  3P8T A;  2EAY A;  3V8K A;  2RHQ A;  5K1P A;  3TEH B;  1X2H A;  1GGM A;  1EVL A;  3LSQ A;  2ODR D;  4XEO A;  5C52 B;  4HWT A;  1SRY A;  1B70 B;  2C8M A;  3HXY A;  1B7Y B;  4TQF A;  2DDZ A;  1RIQ A;  2C7I A;  2RHS B;  4P75 C;  1USY A;  4LVJ A;  3RAC A;  4YRI A;  1EVK A;  4H2X A;  3HY0 A;  4HWR A;  2AMC A;  4YRT A;  1WQW A;  4YRG A;  1E22 A;  3VQV A;  1G5H A;  3DSQ A;  1SES A;  5ELN A;  2P5I A;  2FYK A;  4UP7 A;  4NCX A;  3HXV A;  1X55 A;  3VBB A;  2DVE A;  4XTZ A;  3QTC A;  1YFS A;  1L0W A;  2CJ9 A;  3HFV A;  4H2X B;  4XTY A;  2AMC B;  4EO4 A;  4P74 C;  1X2G A;  3G1Z A;  4CH5 A;  3TUP A;  3RKX A;  3L2Z A;  4YRF A;  4TVY A;  4H2W A;  2DEQ A;  2EL9 A;  2EJ9 A;  1KOG A;  2DXT A;  1NYQ A;  3A7R A;  4KQE A;  2DKG A;  2AKW A;  2E1H A;  4P72 A;  5KNN A;  3A32 A;  3A31 A;  2NS6 A;  1G51 A;  3IKL A;  2QHT A;  2I4O A;  4YRR A;  4HA8 A;  4CS3 A;  2J3M A;  3A7A A;  3CMQ A;  3UH0 A;  2ZIO A;  3IAL A;  2DU5 A;  1NJ1 A;  4YRQ A;  4H2S A;  2Q7G A;  4UP8 A;  2DJZ A;  2AKW B;  2I4L A;  2ZT8 A;  4CH6 A;  3OD1 A;  1W66 A;  4WJ4 A;  1ADY A;  4K86 A;  4ZTU B;  2A8E A;  4YRE A;  4H02 A;  1H4T A;  2ZNI A;  1YGB A;  1BIA A;  1EOV A;  4YDQ A;  3QO7 A;  5C51 B;  2E64 A;  1BIB A;  2DTH A;  3MF2 A;  4TTV A;  3V8J A;  1WYD A;  2ARU A;  4XTW A;  4LVM A;  3HXU A;  1B76 A;  12AS A;  4HWS A;  3RL6 A;  5K1X A;  2E10 A;  3A5Z A;  1EIY A;  2P0L A;  4RMF A;  4CH3 A;  3MEY A;  3MQZ A;  3RIR A;  4P73 A;  4DPG A;  1WU7 A;  4UP9 A;  2DTO A;  1PYS A;  2DZC A;  3HTZ A;  2RHQ B;  3TEG A;  1NJ8 A;  1YFT A;  1ASY A;  3I7F A;  1YFR A;  1FYF A;  2DZ9 A;  2J3L A;  2ZIN A;  4G85 A;  4EX5 A;  3L4G A;  2ZR3 A;  4LVL A;  2ARS A;  2ZT6 A;  3UGT A;  4HT4 A;  1Z7N A;  1PYS B;  4YRN A;  1E1O A;  4YRC A;  2Q7E A;  3VQX A;  3NET A;  2PMF A;  4P75 A;  1NYR A;  4H2V A;  4YRP A;  4XTX A;  5E3I A;  4L87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...