1YGBA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 121
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ygbA01
1FYFA 3A5YA 4YCVA 4P71C 1G51A 4YROA 4DQ2A 4XU1A 3NEMA 4P72C 2IY5B 1NJ2A 2CGHA 2I4LA 2RHSA 3A7UA 4H2SA 3HXWA 4G85A 4YCWA 3IALA 4OLFA 3IKLA 4TTVA 3BJUA 2DJZA 1YFSA 2EAYA 4WJ4A 4K86A 3VQVA 4YRMA 1E24A 3V7RA 2DEQA 2DTIA 3P8VA 4G84A 4HWRA 2DTHA 2I4MA 4YRPA 4H2XB 4CH3A 4UP9A 3L4GB 3NENA 3QO5A 4TVWA 2EJFA 4CH6A 2J3MA 4HWOA 4H2VA 1BBUA 3HRKA 4Q6GA 4EO4A 4P73A 1Z7NA 3EFRA 4Q15A 1EFWA 3IG2A 4TVYA 3RF1A 4KQEA 3E9IA 3BFMA 2E41A 2DVEA 2ZIMA 4YRNA 3A32A 2QHTA 3DSQA 2DZCA 2ZT8A 3V8KA 3CMQA 4YRRA 3MF1A 3PCOB 3QO7A 2QHSA 4HWTA 1VQZA 2EWNA 4XU3A 3PZCA 3HY0A 4WJ3M 1G5IA 3RACA 1ASYA 3UH0A 3ERRA 1EIYB 2DZ9A 4J15A 1NYQA 1USYC 4H02A 1E1OA 3A74A 3QO8A 2I4NA 2EJ9A 2P0LA 3UGQA 4YRCA 1HXDA 2E65A 4XTWA 4RQFA 4CS4A 5K1PA 3TEGA 3RGLA 4P72A 5F5WA 4ZTUB 5C53B 2ARTA 2DDZA 4YRSA 3RKWA 1YFTA 3HXUA 1B70B 4OP0A 4H2YA 4YYEA 2AKWA 2ZZEA 1PYSA 4UPAA 2XTIA 4NCXA 5ELOA 1C0AA 1WLEA 4XTVA 3TUPA 2CJ9A 1H4TA 2ZINA 4UP8A 3I7FA 2ODRC 1USYA 4TWAA 4WI1A 1NJ6A 4H2TA 1KMNA 2ODRD 1KMMA 4H2UA 1YFRA 3P8TA 1X54A 1EIYA 3A7AA 4CS3A 2ZT6A 3LC0A 3VQYA 1X2GA 1JJCA 3QTCA 3P8YA 2QHVA 4TQDA 4HA8A 2PMEA 1YB3A 2ZTGA 3RL6A 1B7YB 4YREA 4P3PA 3L4GA 5HGQA 4YRLA 3A5ZA 2DKGA 4EX5A 3E9HA 2DU7A 2C7IA 4P73C 3LSQA 3HXZA 4CH5A 4XU0A 4YPFA 4ZIBA 1ATIA 3UGTA 2RHQA 5E3IA 2P5IA 4XU2A 4HVCA 3A7RA 1SRYA 5K1XA 3PCOA 1X01A 2E10A 1SESA 3MEYA 3RKXA 1JJCB 4KR2A 1IL2A 2CJAA 3M4QA 1WQ7A 1H4VB 2ZGWA 1QE0A 2CJBA 2ZIOA 1NYRA 3L1AA 1Z7MA 1X56A 5ELNA 3MF2A 4CH4A 1EVKA 1WU7A 2DQ0A 4XEMA 1WYDA 1EQRA 4HWPA 3HFZA 4BWAA 2ZT7A 3M4PA 1G5HA 3HFZB 4X5OA 2ZR3A 2C8MA 2ARUA 2AMCB 1EVLA 1PYSB 3HTZA 2ZT5A 1X55A 3TEHA 1E22A 2ZCEA 4AH6A 4YRTA 3HXVA 3TEHB 4E51A 5C52B 2PMFA 4P3OA 1WNLA 1RIQA 2RHSB 4P75A 2Q7EA 4TVAA 4RDXA 4P3NA 2ZNJA 1N9WA 2E64A 1GGMA 2EL9A 3G1ZA 4PG3A 3VQXA 3KFUA 3OD1A 3REXA 4K88A 4O2DA 4KR3A 2CIMA 3HFVA 1B70A 1ADJA 1B7YA 1NNHA 2DQ3A 2ZZGA 5KNNA 4DPGA 2G4CA 2ZR2A 2EJGA 1NJ8A 2Q7HA 2Q5HA 1BIBA 1B8AA 1WQWA 1LYLA 4YRIA 4XTUA 4RMFA 2IY5A 2E5AA 1YGBA 3EFSA 3UFGA 1SERA 3R07A 1H4QA 4WF2A 1EOVA 4XTZA 1E1TA 4HWSA 3NETA 3HY1A 1NJ5A 2I4OA 2ZXFA 2ALYA 1L0WA 4YDQA 1HTTA 3A31A 2ZNIA 3NELA 4P75C 2E3CA 3REUA 3V7SA 2ARSA 4P74C 3LSSA 2ALYB 4LNSA 1NJ1A 3L2ZA 4H2XA 2HNIA 1KOGA 4ZTZB 2AKWB 1B76A 3HRIA 3HXXA 2Q5IA 2DXUA 2Q7GA 4YRGA 4YRJA 2AMCA 3WQZA 1SETA 4P71A 5C51B 2FYKA 4CS2A 2DTOA 4BW9A 3RIRA 12ASA 3HXYA 4TVAB 3VQWA 3W3SA 4PHCA 1H4SA 3FJPA 2XGTA 2DU5A 2E1HA 4XTYA 3IKMB 4K87A 11ASA 1ADYA 4TQFA 2DXTA 4L87A 4YRFA 1QF6A 3QNEA 1W66A 1J5WA 4YP0A 3VBBA 3ICAA 3V8JA 4H2WA 3V7CA 3RKYA 2ZZFA 1BIAA 4P74A 4XEOA 4YRQA 1HC7A 1X2HA 3RUXA 2RHQB 1ASZA 4YCUA 2J3LA 1BBWA 3V8LA 1WPYA 4YRKA 4RQEA 4UP7A 4XTXA 2QHUA
chains in the Genus database with same CATH superfamily
1FYFA 3A5YA 4YCVA 4P71C 1G51A 4YROA 4DQ2A 4XU1A 3NEMA 4P72C 2IY5B 1NJ2A 2CGHA 2I4LA 2RHSA 3A7UA 4H2SA 3HXWA 4G85A 4YCWA 3IALA 4OLFA 3IKLA 4TTVA 3BJUA 2DJZA 1YFSA 2EAYA 4WJ4A 4K86A 3VQVA 4YRMA 1E24A 3V7RA 2DEQA 2DTIA 3P8VA 4G84A 4HWRA 2DTHA 2I4MA 4YRPA 4H2XB 4CH3A 4UP9A 3L4GB 3NENA 3QO5A 4TVWA 2EJFA 4CH6A 2J3MA 4HWOA 4H2VA 1BBUA 3HRKA 4Q6GA 4EO4A 4P73A 1Z7NA 3EFRA 4Q15A 1EFWA 3IG2A 4TVYA 3RF1A 4KQEA 3E9IA 3BFMA 2E41A 2DVEA 2ZIMA 4YRNA 3A32A 2QHTA 3DSQA 2DZCA 2ZT8A 3V8KA 3CMQA 4YRRA 3MF1A 3PCOB 3QO7A 2QHSA 4HWTA 1VQZA 2EWNA 4XU3A 3PZCA 3HY0A 4WJ3M 1G5IA 3RACA 1ASYA 3UH0A 3ERRA 1EIYB 2DZ9A 4J15A 1NYQA 1USYC 4H02A 1E1OA 3A74A 3QO8A 2I4NA 2EJ9A 2P0LA 3UGQA 4YRCA 1HXDA 2E65A 4XTWA 4RQFA 4CS4A 5K1PA 3TEGA 3RGLA 4P72A 5F5WA 4ZTUB 5C53B 2ARTA 2DDZA 4YRSA 3RKWA 1YFTA 3HXUA 1B70B 4LVIA 4OP0A 2NS6A 4H2YA 4YYEA 2AKWA 2ZZEA 1PYSA 4UPAA 2XTIA 4NCXA 5ELOA 1C0AA 1WLEA 4XTVA 3TUPA 2CJ9A 1H4TA 2ZINA 4UP8A 3I7FA 2ODRC 1USYA 4TWAA 4WI1A 1NJ6A 4H2TA 1KMNA 2ODRD 1KMMA 4H2UA 1YFRA 3P8TA 1X54A 1EIYA 3A7AA 4CS3A 2ZT6A 3LC0A 3VQYA 1X2GA 1JJCA 3QTCA 3P8YA 2QHVA 4TQDA 4HA8A 2PMEA 1YB3A 2ZTGA 3RL6A 1B7YB 4YREA 4P3PA 3L4GA 5HGQA 4YRLA 3A5ZA 4LVMA 2DKGA 4EX5A 3E9HA 2DU7A 2C7IA 4P73C 3LSQA 3HXZA 4CH5A 4XU0A 4YPFA 4ZIBA 1ATIA 3UGTA 2RHQA 5E3IA 2P5IA 4XU2A 4HVCA 3A7RA 1SRYA 5K1XA 3PCOA 1X01A 2E10A 1SESA 3MEYA 3RKXA 1JJCB 4KR2A 1IL2A 2CJAA 3M4QA 1WQ7A 1H4VB 2ZGWA 1QE0A 2CJBA 2ZIOA 1NYRA 3L1AA 1Z7MA 1X56A 5ELNA 3MF2A 4CH4A 1EVKA 1WU7A 2DQ0A 4XEMA 1WYDA 1EQRA 4HWPA 3HFZA 4BWAA 2ZT7A 3M4PA 1G5HA 3HFZB 4X5OA 2ZR3A 2C8MA 2ARUA 2AMCB 1EVLA 1PYSB 3HTZA 2ZT5A 1X55A 3TEHA 1E22A 2ZCEA 4AH6A 4YRTA 3HXVA 3TEHB 4E51A 5C52B 2PMFA 4P3OA 1WNLA 1RIQA 2RHSB 4P75A 2Q7EA 4TVAA 4RDXA 4P3NA 2ZNJA 1N9WA 2E64A 4LVLA 1GGMA 2EL9A 3G1ZA 4PG3A 3VQXA 3KFUA 3OD1A 3REXA 4K88A 4O2DA 4KR3A 2CIMA 3HFVA 1B70A 1ADJA 1B7YA 1NNHA 2DQ3A 2ZZGA 5KNNA 4DPGA 2G4CA 2ZR2A 2EJGA 1NJ8A 2Q7HA 2Q5HA 1BIBA 1B8AA 1WQWA 1LYLA 4YRIA 4XTUA 4HT4A 4RMFA 2IY5A 2E5AA 1YGBA 3EFSA 3UFGA 1SERA 3R07A 1H4QA 4WF2A 1EOVA 4XTZA 1E1TA 4HWSA 3NETA 3HY1A 1NJ5A 2I4OA 2ZXFA 2ALYA 1L0WA 4LVJA 4YDQA 1HTTA 4LVKA 3A31A 2ZNIA 3NELA 4P75C 2E3CA 3MQZA 3REUA 3V7SA 2ARSA 4P74C 3LSSA 2ALYB 4LNSA 1NJ1A 3L2ZA 4H2XA 2HNIA 1KOGA 4ZTZB 2AKWB 1B76A 3HRIA 3HXXA 2Q5IA 2DXUA 2Q7GA 4YRGA 4YRJA 2AMCA 3WQZA 1SETA 4P71A 5C51B 2FYKA 4CS2A 2DTOA 4BW9A 3RIRA 12ASA 3HXYA 4TVAB 3VQWA 3W3SA 4PHCA 1H4SA 3FJPA 2XGTA 2DU5A 2E1HA 4XTYA 3IKMB 4K87A 11ASA 1ADYA 4TQFA 2DXTA 4L87A 4YRFA 1QF6A 3QNEA 1W66A 1J5WA 4YP0A 3VBBA 3ICAA 3V8JA 4H2WA 3V7CA 3RKYA 2ZZFA 1BIAA 4P74A 4XEOA 4YRQA 1HC7A 1X2HA 3RUXA 2RHQB 1ASZA 4YCUA 2J3LA 2A8EA 1BBWA 3V8LA 1WPYA 4YRKA 4RQEA 4UP7A 4XTXA 2QHUA
chains in the Genus database with same CATH topology
1FYFA 3A5YA 4YCVA 4P71C 1G51A 4YROA 4DQ2A 4XU1A 3NEMA 4P72C 2IY5B 1NJ2A 2CGHA 2I4LA 2RHSA 3A7UA 4H2SA 3HXWA 4G85A 4YCWA 3IALA 4OLFA 3IKLA 4TTVA 3BJUA 2DJZA 1YFSA 2EAYA 4WJ4A 4K86A 3VQVA 4YRMA 1E24A 3V7RA 2DEQA 2DTIA 3P8VA 4G84A 4HWRA 2DTHA 2I4MA 4YRPA 4H2XB 4CH3A 4UP9A 3L4GB 3NENA 3QO5A 4TVWA 2EJFA 4CH6A 2J3MA 4HWOA 4H2VA 1BBUA 3HRKA 4Q6GA 4EO4A 4P73A 1Z7NA 3EFRA 4Q15A 1EFWA 3IG2A 4TVYA 3RF1A 4KQEA 3E9IA 3BFMA 2E41A 2DVEA 2ZIMA 4YRNA 3A32A 2QHTA 3DSQA 2DZCA 2ZT8A 3V8KA 3CMQA 4YRRA 3MF1A 3PCOB 3QO7A 2QHSA 4HWTA 1VQZA 2EWNA 4XU3A 3PZCA 3HY0A 4WJ3M 1G5IA 3RACA 1ASYA 3UH0A 3ERRA 1EIYB 2DZ9A 4J15A 1NYQA 1USYC 4H02A 1E1OA 3A74A 3QO8A 2I4NA 2EJ9A 2P0LA 3UGQA 4YRCA 1HXDA 2E65A 4XTWA 4RQFA 4CS4A 5K1PA 3TEGA 3RGLA 4P72A 5F5WA 4ZTUB 5C53B 2ARTA 2DDZA 4YRSA 3RKWA 1YFTA 3HXUA 1B70B 4LVIA 4OP0A 2NS6A 4H2YA 4YYEA 2AKWA 2ZZEA 1PYSA 4UPAA 2XTIA 4NCXA 5ELOA 1C0AA 1WLEA 4XTVA 3TUPA 2CJ9A 1H4TA 2ZINA 4UP8A 3I7FA 2ODRC 1USYA 4TWAA 4WI1A 1NJ6A 4H2TA 1KMNA 2ODRD 1KMMA 4H2UA 1YFRA 3P8TA 1X54A 1EIYA 3A7AA 4CS3A 2ZT6A 3LC0A 3VQYA 1X2GA 1JJCA 3QTCA 3P8YA 2QHVA 4TQDA 4HA8A 2PMEA 1YB3A 2ZTGA 3RL6A 1B7YB 4YREA 4P3PA 3L4GA 5HGQA 4YRLA 3A5ZA 4LVMA 2DKGA 4EX5A 3E9HA 2DU7A 2C7IA 4P73C 3LSQA 3HXZA 4CH5A 4XU0A 4YPFA 4ZIBA 1ATIA 3UGTA 2RHQA 5E3IA 2P5IA 4XU2A 4HVCA 3A7RA 1SRYA 5K1XA 3PCOA 1X01A 2E10A 1SESA 3MEYA 3RKXA 1JJCB 4KR2A 1IL2A 2CJAA 3M4QA 1WQ7A 1H4VB 2ZGWA 1QE0A 2CJBA 2ZIOA 1NYRA 3L1AA 1Z7MA 1X56A 5ELNA 3MF2A 4CH4A 1EVKA 1WU7A 2DQ0A 4XEMA 1WYDA 1EQRA 4HWPA 3HFZA 4BWAA 2ZT7A 3M4PA 1G5HA 3HFZB 4X5OA 2ZR3A 2C8MA 2ARUA 2AMCB 1EVLA 1PYSB 3HTZA 2ZT5A 1X55A 3TEHA 1E22A 2ZCEA 4AH6A 4YRTA 3HXVA 3TEHB 4E51A 5C52B 2PMFA 4P3OA 1WNLA 1RIQA 2RHSB 4P75A 2Q7EA 4TVAA 4RDXA 4P3NA 2ZNJA 1N9WA 2E64A 4LVLA 1GGMA 2EL9A 3G1ZA 4PG3A 3VQXA 3KFUA 3OD1A 3REXA 4K88A 4O2DA 4KR3A 2CIMA 3HFVA 1B70A 1ADJA 1B7YA 1NNHA 2DQ3A 2ZZGA 5KNNA 4DPGA 2G4CA 2ZR2A 2EJGA 1NJ8A 2Q7HA 2Q5HA 1BIBA 1B8AA 1WQWA 1LYLA 4YRIA 4XTUA 4HT4A 4RMFA 2IY5A 2E5AA 1YGBA 3EFSA 3UFGA 1SERA 3R07A 1H4QA 4WF2A 1EOVA 4XTZA 1E1TA 4HWSA 3NETA 3HY1A 1NJ5A 2I4OA 2ZXFA 2ALYA 1L0WA 4LVJA 4YDQA 1HTTA 4LVKA 3A31A 2ZNIA 3NELA 4P75C 2E3CA 3MQZA 3REUA 3V7SA 2ARSA 4P74C 3LSSA 2ALYB 4LNSA 1NJ1A 3L2ZA 4H2XA 2HNIA 1KOGA 4ZTZB 2AKWB 1B76A 3HRIA 3HXXA 2Q5IA 2DXUA 2Q7GA 4YRGA 4YRJA 2AMCA 3WQZA 1SETA 4P71A 5C51B 2FYKA 4CS2A 2DTOA 4BW9A 3RIRA 12ASA 3HXYA 4TVAB 3VQWA 3W3SA 4PHCA 1H4SA 3FJPA 2XGTA 2DU5A 2E1HA 4XTYA 3IKMB 4K87A 11ASA 1ADYA 4TQFA 2DXTA 4L87A 4YRFA 1QF6A 3QNEA 1W66A 1J5WA 4YP0A 3VBBA 3ICAA 3V8JA 4H2WA 3V7CA 3RKYA 2ZZFA 1BIAA 4P74A 4XEOA 4YRQA 1HC7A 1X2HA 3RUXA 2RHQB 1ASZA 4YCUA 2J3LA 2A8EA 1BBWA 3V8LA 1WPYA 4YRKA 4RQEA 4UP7A 4XTXA 2QHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYF A;  3A5Y A;  4YCV A;  4P71 C;  1G51 A;  4YRO A;  4DQ2 A;  4XU1 A;  3NEM A;  4P72 C;  2IY5 B;  1NJ2 A;  2CGH A;  2I4L A;  2RHS A;  3A7U A;  4H2S A;  3HXW A;  4G85 A;  4YCW A;  3IAL A;  4OLF A;  3IKL A;  4TTV A;  3BJU A;  2DJZ A;  1YFS A;  2EAY A;  4WJ4 A;  4K86 A;  3VQV A;  4YRM A;  1E24 A;  3V7R A;  2DEQ A;  2DTI A;  3P8V A;  4G84 A;  4HWR A;  2DTH A;  2I4M A;  4YRP A;  4H2X B;  4CH3 A;  4UP9 A;  3L4G B;  3NEN A;  3QO5 A;  4TVW A;  2EJF A;  4CH6 A;  2J3M A;  4HWO A;  4H2V A;  1BBU A;  3HRK A;  4Q6G A;  4EO4 A;  4P73 A;  1Z7N A;  3EFR A;  4Q15 A;  1EFW A;  3IG2 A;  4TVY A;  3RF1 A;  4KQE A;  3E9I A;  3BFM A;  2E41 A;  2DVE A;  2ZIM A;  4YRN A;  3A32 A;  2QHT A;  3DSQ A;  2DZC A;  2ZT8 A;  3V8K A;  3CMQ A;  4YRR A;  3MF1 A;  3PCO B;  3QO7 A;  2QHS A;  4HWT A;  1VQZ A;  2EWN A;  4XU3 A;  3PZC A;  3HY0 A;  4WJ3 M;  1G5I A;  3RAC A;  1ASY A;  3UH0 A;  3ERR A;  1EIY B;  2DZ9 A;  4J15 A;  1NYQ A;  1USY C;  4H02 A;  1E1O A;  3A74 A;  3QO8 A;  2I4N A;  2EJ9 A;  2P0L A;  3UGQ A;  4YRC A;  1HXD A;  2E65 A;  4XTW A;  4RQF A;  4CS4 A;  5K1P A;  3TEG A;  3RGL A;  4P72 A;  5F5W A;  4ZTU B;  5C53 B;  2ART A;  2DDZ A;  4YRS A;  3RKW A;  1YFT A;  3HXU A;  1B70 B;  4OP0 A;  4H2Y A;  4YYE A;  2AKW A;  2ZZE A;  1PYS A;  4UPA A;  2XTI A;  4NCX A;  5ELO A;  1C0A A;  1WLE A;  4XTV A;  3TUP A;  2CJ9 A;  1H4T A;  2ZIN A;  4UP8 A;  3I7F A;  2ODR C;  1USY A;  4TWA A;  4WI1 A;  1NJ6 A;  4H2T A;  1KMN A;  2ODR D;  1KMM A;  4H2U A;  1YFR A;  3P8T A;  1X54 A;  1EIY A;  3A7A A;  4CS3 A;  2ZT6 A;  3LC0 A;  3VQY A;  1X2G A;  1JJC A;  3QTC A;  3P8Y A;  2QHV A;  4TQD A;  4HA8 A;  2PME A;  1YB3 A;  2ZTG A;  3RL6 A;  1B7Y B;  4YRE A;  4P3P A;  3L4G A;  5HGQ A;  4YRL A;  3A5Z A;  2DKG A;  4EX5 A;  3E9H A;  2DU7 A;  2C7I A;  4P73 C;  3LSQ A;  3HXZ A;  4CH5 A;  4XU0 A;  4YPF A;  4ZIB A;  1ATI A;  3UGT A;  2RHQ A;  5E3I A;  2P5I A;  4XU2 A;  4HVC A;  3A7R A;  1SRY A;  5K1X A;  3PCO A;  1X01 A;  2E10 A;  1SES A;  3MEY A;  3RKX A;  1JJC B;  4KR2 A;  1IL2 A;  2CJA A;  3M4Q A;  1WQ7 A;  1H4V B;  2ZGW A;  1QE0 A;  2CJB A;  2ZIO A;  1NYR A;  3L1A A;  1Z7M A;  1X56 A;  5ELN A;  3MF2 A;  4CH4 A;  1EVK A;  1WU7 A;  2DQ0 A;  4XEM A;  1WYD A;  1EQR A;  4HWP A;  3HFZ A;  4BWA A;  2ZT7 A;  3M4P A;  1G5H A;  3HFZ B;  4X5O A;  2ZR3 A;  2C8M A;  2ARU A;  2AMC B;  1EVL A;  1PYS B;  3HTZ A;  2ZT5 A;  1X55 A;  3TEH A;  1E22 A;  2ZCE A;  4AH6 A;  4YRT A;  3HXV A;  3TEH B;  4E51 A;  5C52 B;  2PMF A;  4P3O A;  1WNL A;  1RIQ A;  2RHS B;  4P75 A;  2Q7E A;  4TVA A;  4RDX A;  4P3N A;  2ZNJ A;  1N9W A;  2E64 A;  1GGM A;  2EL9 A;  3G1Z A;  4PG3 A;  3VQX A;  3KFU A;  3OD1 A;  3REX A;  4K88 A;  4O2D A;  4KR3 A;  2CIM A;  3HFV A;  1B70 A;  1ADJ A;  1B7Y A;  1NNH A;  2DQ3 A;  2ZZG A;  5KNN A;  4DPG A;  2G4C A;  2ZR2 A;  2EJG A;  1NJ8 A;  2Q7H A;  2Q5H A;  1BIB A;  1B8A A;  1WQW A;  1LYL A;  4YRI A;  4XTU A;  4RMF A;  2IY5 A;  2E5A A;  1YGB A;  3EFS A;  3UFG A;  1SER A;  3R07 A;  1H4Q A;  4WF2 A;  1EOV A;  4XTZ A;  1E1T A;  4HWS A;  3NET A;  3HY1 A;  1NJ5 A;  2I4O A;  2ZXF A;  2ALY A;  1L0W A;  4YDQ A;  1HTT A;  3A31 A;  2ZNI A;  3NEL A;  4P75 C;  2E3C A;  3REU A;  3V7S A;  2ARS A;  4P74 C;  3LSS A;  2ALY B;  4LNS A;  1NJ1 A;  3L2Z A;  4H2X A;  2HNI A;  1KOG A;  4ZTZ B;  2AKW B;  1B76 A;  3HRI A;  3HXX A;  2Q5I A;  2DXU A;  2Q7G A;  4YRG A;  4YRJ A;  2AMC A;  3WQZ A;  1SET A;  4P71 A;  5C51 B;  2FYK A;  4CS2 A;  2DTO A;  4BW9 A;  3RIR A;  12AS A;  3HXY A;  4TVA B;  3VQW A;  3W3S A;  4PHC A;  1H4S A;  3FJP A;  2XGT A;  2DU5 A;  2E1H A;  4XTY A;  3IKM B;  4K87 A;  11AS A;  1ADY A;  4TQF A;  2DXT A;  4L87 A;  4YRF A;  1QF6 A;  3QNE A;  1W66 A;  1J5W A;  4YP0 A;  3VBB A;  3ICA A;  3V8J A;  4H2W A;  3V7C A;  3RKY A;  2ZZF A;  1BIA A;  4P74 A;  4XEO A;  4YRQ A;  1HC7 A;  1X2H A;  3RUX A;  2RHQ B;  1ASZ A;  4YCU A;  2J3L A;  1BBW A;  3V8L A;  1WPY A;  4YRK A;  4RQE A;  4UP7 A;  4XTX A;  2QHU A; 
#chains in the Genus database with same CATH topology
 1FYF A;  3A5Y A;  4YCV A;  4P71 C;  1G51 A;  4YRO A;  4DQ2 A;  4XU1 A;  3NEM A;  4P72 C;  2IY5 B;  1NJ2 A;  2CGH A;  2I4L A;  2RHS A;  3A7U A;  4H2S A;  3HXW A;  4G85 A;  4YCW A;  3IAL A;  4OLF A;  3IKL A;  4TTV A;  3BJU A;  2DJZ A;  1YFS A;  2EAY A;  4WJ4 A;  4K86 A;  3VQV A;  4YRM A;  1E24 A;  3V7R A;  2DEQ A;  2DTI A;  3P8V A;  4G84 A;  4HWR A;  2DTH A;  2I4M A;  4YRP A;  4H2X B;  4CH3 A;  4UP9 A;  3L4G B;  3NEN A;  3QO5 A;  4TVW A;  2EJF A;  4CH6 A;  2J3M A;  4HWO A;  4H2V A;  1BBU A;  3HRK A;  4Q6G A;  4EO4 A;  4P73 A;  1Z7N A;  3EFR A;  4Q15 A;  1EFW A;  3IG2 A;  4TVY A;  3RF1 A;  4KQE A;  3E9I A;  3BFM A;  2E41 A;  2DVE A;  2ZIM A;  4YRN A;  3A32 A;  2QHT A;  3DSQ A;  2DZC A;  2ZT8 A;  3V8K A;  3CMQ A;  4YRR A;  3MF1 A;  3PCO B;  3QO7 A;  2QHS A;  4HWT A;  1VQZ A;  2EWN A;  4XU3 A;  3PZC A;  3HY0 A;  4WJ3 M;  1G5I A;  3RAC A;  1ASY A;  3UH0 A;  3ERR A;  1EIY B;  2DZ9 A;  4J15 A;  1NYQ A;  1USY C;  4H02 A;  1E1O A;  3A74 A;  3QO8 A;  2I4N A;  2EJ9 A;  2P0L A;  3UGQ A;  4YRC A;  1HXD A;  2E65 A;  4XTW A;  4RQF A;  4CS4 A;  5K1P A;  3TEG A;  3RGL A;  4P72 A;  5F5W A;  4ZTU B;  5C53 B;  2ART A;  2DDZ A;  4YRS A;  3RKW A;  1YFT A;  3HXU A;  1B70 B;  4LVI A;  4OP0 A;  2NS6 A;  4H2Y A;  4YYE A;  2AKW A;  2ZZE A;  1PYS A;  4UPA A;  2XTI A;  4NCX A;  5ELO A;  1C0A A;  1WLE A;  4XTV A;  3TUP A;  2CJ9 A;  1H4T A;  2ZIN A;  4UP8 A;  3I7F A;  2ODR C;  1USY A;  4TWA A;  4WI1 A;  1NJ6 A;  4H2T A;  1KMN A;  2ODR D;  1KMM A;  4H2U A;  1YFR A;  3P8T A;  1X54 A;  1EIY A;  3A7A A;  4CS3 A;  2ZT6 A;  3LC0 A;  3VQY A;  1X2G A;  1JJC A;  3QTC A;  3P8Y A;  2QHV A;  4TQD A;  4HA8 A;  2PME A;  1YB3 A;  2ZTG A;  3RL6 A;  1B7Y B;  4YRE A;  4P3P A;  3L4G A;  5HGQ A;  4YRL A;  3A5Z A;  4LVM A;  2DKG A;  4EX5 A;  3E9H A;  2DU7 A;  2C7I A;  4P73 C;  3LSQ A;  3HXZ A;  4CH5 A;  4XU0 A;  4YPF A;  4ZIB A;  1ATI A;  3UGT A;  2RHQ A;  5E3I A;  2P5I A;  4XU2 A;  4HVC A;  3A7R A;  1SRY A;  5K1X A;  3PCO A;  1X01 A;  2E10 A;  1SES A;  3MEY A;  3RKX A;  1JJC B;  4KR2 A;  1IL2 A;  2CJA A;  3M4Q A;  1WQ7 A;  1H4V B;  2ZGW A;  1QE0 A;  2CJB A;  2ZIO A;  1NYR A;  3L1A A;  1Z7M A;  1X56 A;  5ELN A;  3MF2 A;  4CH4 A;  1EVK A;  1WU7 A;  2DQ0 A;  4XEM A;  1WYD A;  1EQR A;  4HWP A;  3HFZ A;  4BWA A;  2ZT7 A;  3M4P A;  1G5H A;  3HFZ B;  4X5O A;  2ZR3 A;  2C8M A;  2ARU A;  2AMC B;  1EVL A;  1PYS B;  3HTZ A;  2ZT5 A;  1X55 A;  3TEH A;  1E22 A;  2ZCE A;  4AH6 A;  4YRT A;  3HXV A;  3TEH B;  4E51 A;  5C52 B;  2PMF A;  4P3O A;  1WNL A;  1RIQ A;  2RHS B;  4P75 A;  2Q7E A;  4TVA A;  4RDX A;  4P3N A;  2ZNJ A;  1N9W A;  2E64 A;  4LVL A;  1GGM A;  2EL9 A;  3G1Z A;  4PG3 A;  3VQX A;  3KFU A;  3OD1 A;  3REX A;  4K88 A;  4O2D A;  4KR3 A;  2CIM A;  3HFV A;  1B70 A;  1ADJ A;  1B7Y A;  1NNH A;  2DQ3 A;  2ZZG A;  5KNN A;  4DPG A;  2G4C A;  2ZR2 A;  2EJG A;  1NJ8 A;  2Q7H A;  2Q5H A;  1BIB A;  1B8A A;  1WQW A;  1LYL A;  4YRI A;  4XTU A;  4HT4 A;  4RMF A;  2IY5 A;  2E5A A;  1YGB A;  3EFS A;  3UFG A;  1SER A;  3R07 A;  1H4Q A;  4WF2 A;  1EOV A;  4XTZ A;  1E1T A;  4HWS A;  3NET A;  3HY1 A;  1NJ5 A;  2I4O A;  2ZXF A;  2ALY A;  1L0W A;  4LVJ A;  4YDQ A;  1HTT A;  4LVK A;  3A31 A;  2ZNI A;  3NEL A;  4P75 C;  2E3C A;  3MQZ A;  3REU A;  3V7S A;  2ARS A;  4P74 C;  3LSS A;  2ALY B;  4LNS A;  1NJ1 A;  3L2Z A;  4H2X A;  2HNI A;  1KOG A;  4ZTZ B;  2AKW B;  1B76 A;  3HRI A;  3HXX A;  2Q5I A;  2DXU A;  2Q7G A;  4YRG A;  4YRJ A;  2AMC A;  3WQZ A;  1SET A;  4P71 A;  5C51 B;  2FYK A;  4CS2 A;  2DTO A;  4BW9 A;  3RIR A;  12AS A;  3HXY A;  4TVA B;  3VQW A;  3W3S A;  4PHC A;  1H4S A;  3FJP A;  2XGT A;  2DU5 A;  2E1H A;  4XTY A;  3IKM B;  4K87 A;  11AS A;  1ADY A;  4TQF A;  2DXT A;  4L87 A;  4YRF A;  1QF6 A;  3QNE A;  1W66 A;  1J5W A;  4YP0 A;  3VBB A;  3ICA A;  3V8J A;  4H2W A;  3V7C A;  3RKY A;  2ZZF A;  1BIA A;  4P74 A;  4XEO A;  4YRQ A;  1HC7 A;  1X2H A;  3RUX A;  2RHQ B;  1ASZ A;  4YCU A;  2J3L A;  2A8E A;  1BBW A;  3V8L A;  1WPY A;  4YRK A;  4RQE A;  4UP7 A;  4XTX A;  2QHU A; 
#chains in the Genus database with same CATH homology
 1FYF A;  3A5Y A;  4YCV A;  4P71 C;  1G51 A;  4YRO A;  4DQ2 A;  4XU1 A;  3NEM A;  4P72 C;  2IY5 B;  1NJ2 A;  2CGH A;  2I4L A;  2RHS A;  3A7U A;  4H2S A;  3HXW A;  4G85 A;  4YCW A;  3IAL A;  4OLF A;  3IKL A;  4TTV A;  3BJU A;  2DJZ A;  1YFS A;  2EAY A;  4WJ4 A;  4K86 A;  3VQV A;  4YRM A;  1E24 A;  3V7R A;  2DEQ A;  2DTI A;  3P8V A;  4G84 A;  4HWR A;  2DTH A;  2I4M A;  4YRP A;  4H2X B;  4CH3 A;  4UP9 A;  3L4G B;  3NEN A;  3QO5 A;  4TVW A;  2EJF A;  4CH6 A;  2J3M A;  4HWO A;  4H2V A;  1BBU A;  3HRK A;  4Q6G A;  4EO4 A;  4P73 A;  1Z7N A;  3EFR A;  4Q15 A;  1EFW A;  3IG2 A;  4TVY A;  3RF1 A;  4KQE A;  3E9I A;  3BFM A;  2E41 A;  2DVE A;  2ZIM A;  4YRN A;  3A32 A;  2QHT A;  3DSQ A;  2DZC A;  2ZT8 A;  3V8K A;  3CMQ A;  4YRR A;  3MF1 A;  3PCO B;  3QO7 A;  2QHS A;  4HWT A;  1VQZ A;  2EWN A;  4XU3 A;  3PZC A;  3HY0 A;  4WJ3 M;  1G5I A;  3RAC A;  1ASY A;  3UH0 A;  3ERR A;  1EIY B;  2DZ9 A;  4J15 A;  1NYQ A;  1USY C;  4H02 A;  1E1O A;  3A74 A;  3QO8 A;  2I4N A;  2EJ9 A;  2P0L A;  3UGQ A;  4YRC A;  1HXD A;  2E65 A;  4XTW A;  4RQF A;  4CS4 A;  5K1P A;  3TEG A;  3RGL A;  4P72 A;  5F5W A;  4ZTU B;  5C53 B;  2ART A;  2DDZ A;  4YRS A;  3RKW A;  1YFT A;  3HXU A;  1B70 B;  4LVI A;  4OP0 A;  2NS6 A;  4H2Y A;  4YYE A;  2AKW A;  2ZZE A;  1PYS A;  4UPA A;  2XTI A;  4NCX A;  5ELO A;  1C0A A;  1WLE A;  4XTV A;  3TUP A;  2CJ9 A;  1H4T A;  2ZIN A;  4UP8 A;  3I7F A;  2ODR C;  1USY A;  4TWA A;  4WI1 A;  1NJ6 A;  4H2T A;  1KMN A;  2ODR D;  1KMM A;  4H2U A;  1YFR A;  3P8T A;  1X54 A;  1EIY A;  3A7A A;  4CS3 A;  2ZT6 A;  3LC0 A;  3VQY A;  1X2G A;  1JJC A;  3QTC A;  3P8Y A;  2QHV A;  4TQD A;  4HA8 A;  2PME A;  1YB3 A;  2ZTG A;  3RL6 A;  1B7Y B;  4YRE A;  4P3P A;  3L4G A;  5HGQ A;  4YRL A;  3A5Z A;  4LVM A;  2DKG A;  4EX5 A;  3E9H A;  2DU7 A;  2C7I A;  4P73 C;  3LSQ A;  3HXZ A;  4CH5 A;  4XU0 A;  4YPF A;  4ZIB A;  1ATI A;  3UGT A;  2RHQ A;  5E3I A;  2P5I A;  4XU2 A;  4HVC A;  3A7R A;  1SRY A;  5K1X A;  3PCO A;  1X01 A;  2E10 A;  1SES A;  3MEY A;  3RKX A;  1JJC B;  4KR2 A;  1IL2 A;  2CJA A;  3M4Q A;  1WQ7 A;  1H4V B;  2ZGW A;  1QE0 A;  2CJB A;  2ZIO A;  1NYR A;  3L1A A;  1Z7M A;  1X56 A;  5ELN A;  3MF2 A;  4CH4 A;  1EVK A;  1WU7 A;  2DQ0 A;  4XEM A;  1WYD A;  1EQR A;  4HWP A;  3HFZ A;  4BWA A;  2ZT7 A;  3M4P A;  1G5H A;  3HFZ B;  4X5O A;  2ZR3 A;  2C8M A;  2ARU A;  2AMC B;  1EVL A;  1PYS B;  3HTZ A;  2ZT5 A;  1X55 A;  3TEH A;  1E22 A;  2ZCE A;  4AH6 A;  4YRT A;  3HXV A;  3TEH B;  4E51 A;  5C52 B;  2PMF A;  4P3O A;  1WNL A;  1RIQ A;  2RHS B;  4P75 A;  2Q7E A;  4TVA A;  4RDX A;  4P3N A;  2ZNJ A;  1N9W A;  2E64 A;  4LVL A;  1GGM A;  2EL9 A;  3G1Z A;  4PG3 A;  3VQX A;  3KFU A;  3OD1 A;  3REX A;  4K88 A;  4O2D A;  4KR3 A;  2CIM A;  3HFV A;  1B70 A;  1ADJ A;  1B7Y A;  1NNH A;  2DQ3 A;  2ZZG A;  5KNN A;  4DPG A;  2G4C A;  2ZR2 A;  2EJG A;  1NJ8 A;  2Q7H A;  2Q5H A;  1BIB A;  1B8A A;  1WQW A;  1LYL A;  4YRI A;  4XTU A;  4HT4 A;  4RMF A;  2IY5 A;  2E5A A;  1YGB A;  3EFS A;  3UFG A;  1SER A;  3R07 A;  1H4Q A;  4WF2 A;  1EOV A;  4XTZ A;  1E1T A;  4HWS A;  3NET A;  3HY1 A;  1NJ5 A;  2I4O A;  2ZXF A;  2ALY A;  1L0W A;  4LVJ A;  4YDQ A;  1HTT A;  4LVK A;  3A31 A;  2ZNI A;  3NEL A;  4P75 C;  2E3C A;  3MQZ A;  3REU A;  3V7S A;  2ARS A;  4P74 C;  3LSS A;  2ALY B;  4LNS A;  1NJ1 A;  3L2Z A;  4H2X A;  2HNI A;  1KOG A;  4ZTZ B;  2AKW B;  1B76 A;  3HRI A;  3HXX A;  2Q5I A;  2DXU A;  2Q7G A;  4YRG A;  4YRJ A;  2AMC A;  3WQZ A;  1SET A;  4P71 A;  5C51 B;  2FYK A;  4CS2 A;  2DTO A;  4BW9 A;  3RIR A;  12AS A;  3HXY A;  4TVA B;  3VQW A;  3W3S A;  4PHC A;  1H4S A;  3FJP A;  2XGT A;  2DU5 A;  2E1H A;  4XTY A;  3IKM B;  4K87 A;  11AS A;  1ADY A;  4TQF A;  2DXT A;  4L87 A;  4YRF A;  1QF6 A;  3QNE A;  1W66 A;  1J5W A;  4YP0 A;  3VBB A;  3ICA A;  3V8J A;  4H2W A;  3V7C A;  3RKY A;  2ZZF A;  1BIA A;  4P74 A;  4XEO A;  4YRQ A;  1HC7 A;  1X2H A;  3RUX A;  2RHQ B;  1ASZ A;  4YCU A;  2J3L A;  2A8E A;  1BBW A;  3V8L A;  1WPY A;  4YRK A;  4RQE A;  4UP7 A;  4XTX A;  2QHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...