1YGBA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
457
structure length
448
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
molecule tags Ligase
source organism Aquifex aeolicus
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
total genus 121
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ygbA01
3P8YA 1USYC 4YDQA 1EIYA 1SETA 1NYRA 4H2XB 2E41A 1RIQA 2XTIA 3HY1A 2DQ3A 4K87A 4KR2A 3LSSA 4AH6A 2QHUA 1SRYA 4YROA 5C53B 4G84A 2DZ9A 3NENA 3V8JA 1H4SA 4BW9A 5E3IA 3QNEA 1B8AA 1YFRA 3L1AA 5K1XA 1ASZA 4P74A 3PCOB 2ZIOA 1HTTA 1GGMA 4YRSA 1X2HA 2EJFA 2ZTGA 4WI1A 1WQWA 3MF2A 4XTWA 3HRKA 1E24A 3EFSA 2ZINA 1WQ7A 4P72C 3ERRA 5K1PA 1ADYA 4TQDA 2C8MA 3HXWA 1H4VB 3HRIA 2AKWA 3UH0A 2QHTA 1LYLA 1B7YA 3QO5A 2Q7EA 1E1OA 3V7SA 4ZTUB 3RGLA 4YCUA 3MF1A 1NJ2A 1EFWA 2PMEA 4L87A 3LSQA 1X01A 2EWNA 4ZTZB 4HWOA 5HGQA 2DXUA 4K88A 4YRLA 2ZR2A 2DEQA 3UFGA 3RIRA 3QTCA 3P8VA 1EIYB 1X56A 3UGTA 3ICAA 1B76A 1N9WA 1ATIA 1YGBA 4TQFA 1NJ8A 1YB3A 1KMNA 2EAYA 3BJUA 2ZR3A 1HC7A 3E9IA 4YRCA 1B70B 2Q7GA 3RKWA 3HFZA 3RL6A 4TVAB 1W66A 1HXDA 1PYSB 3HXXA 4PG3A 1NYQA 2ALYB 3HY0A 4YRFA 2DXTA 2E64A 2ZT7A 4P74C 3A7AA 3RF1A 4TTVA 4CS4A 2QHVA 4CH6A 1SESA 2Q5HA 4YRPA 4TVYA 3LC0A 3A5ZA 1QF6A 5F5WA 2AMCB 3A74A 2ZT6A 4XTZA 4CH4A 3WQZA 1WU7A 4YREA 3HXZA 5ELNA 3PCOA 2CJBA 2I4MA 3L4GB 4YCVA 4PHCA 1G5IA 4H2TA 1BBUA 4K86A 1Z7MA 4HWPA 2E3CA 1X2GA 2ODRC 1X55A 1H4QA 4EX5A 4HWSA 2DZCA 1BBWA 4EO4A 4YRNA 4ZIBA 2Q7HA 4DQ2A 4XU3A 4E51A 4P73A 4P71C 3FJPA 2I4NA 4YRMA 3W3SA 4HVCA 3IG2A 1YFSA 4H02A 2C7IA 4XEMA 1L0WA 2ZT5A 3DSQA 3A32A 4H2SA 1NJ5A 1KMMA 4P75A 4YYEA 3I7FA 4WJ3M 4YCWA 2ZCEA 4BWAA 2CJAA 1IL2A 1PYSA 3VQYA 4P71A 2E1HA 2ARSA 2J3LA 4WJ4A 4DPGA 2IY5B 4CS2A 4XU2A 4H2WA 1KOGA 3E9HA 4H2XA 4UP7A 12ASA 3P8TA 4H2YA 3KFUA 3TEHA 1B7YB 2HNIA 4XU1A 2DU5A 1YFTA 3A7RA 3V7CA 3VBBA 4OP0A 2ZT8A 5ELOA 4YRKA 3RKXA 2Q5IA 4XEOA 2AMCA 3A31A 1WYDA 2DTIA 3HXYA 3M4PA 1EVLA 1B70A 1E22A 4P3PA 4J15A 4YP0A 3VQWA 2ARUA 2DQ0A 2ZXFA 2I4LA 1H4TA 2EL9A 1G51A 3A7UA 4NCXA 3NELA 4YRJA 4LNSA 3G1ZA 3HFZB 4CH5A 4P3OA 2DDZA 2RHQB 2ZNJA 2IY5A 1C0AA 4RQEA 1FYFA 3V8KA 1WPYA 3R07A 3IALA 1WNLA 4YRQA 1Z7NA 3NETA 2ZZGA 4XTUA 3IKLA 3RUXA 3QO8A 4TWAA 3TEGA 3VQVA 2ZZEA 4O2DA 4HA8A 1EVKA 2QHSA 2J3MA 2EJ9A 2DU7A 2DVEA 2XGTA 4HWTA 4UPAA 3V8LA 1NJ1A 3TEHB 2ARTA 2DJZA 3L4GA 3HXUA 3A5YA 2RHSA 3HXVA 3EFRA 3MEYA 4P75C 1ADJA 2DTOA 4HWRA 2ZGWA 4H2UA 2FYKA 4XTXA 2G4CA 3NEMA 3OD1A 3IKMB 5C51B 4YRIA 3L2ZA 1JJCA 1E1TA 2CJ9A 3BFMA 1WLEA 2EJGA 4G85A 3M4QA 2ZZFA 2ZNIA 2ALYA 4UP9A 4CS3A 3V7RA 1EOVA 2P5IA 3REUA 3VQXA 3HFVA 3TUPA 5KNNA 2I4OA 3HTZA 4YRTA 4XTYA 2AKWB 3RACA 1VQZA 4P3NA 1NJ6A 3REXA 2E65A 4RDXA 2CGHA 11ASA 2ZIMA 4RQFA 1J5WA 4WF2A 4UP8A 4Q6GA 4H2VA 2P0LA 4KR3A 4YRRA 1SERA 2E5AA 2RHQA 1X54A 4YPFA 4TVWA 4RMFA 3UGQA 2DKGA 2PMFA 3RKYA 2E10A 5C52B 4CH3A 1EQRA 3QO7A 1USYA 4XU0A 3PZCA 4YRGA 2DTHA 4XTVA 1G5HA 2RHSB 1ASYA 4P72A 1QE0A 1JJCB 4TVAA 4P73C 1BIBA 1NNHA 2CIMA 2ODRD 4X5OA 3CMQA 4Q15A 1BIAA 4KQEA 4OLFA
chains in the Genus database with same CATH superfamily
3P8YA 1USYC 4YDQA 1EIYA 1SETA 1NYRA 4HT4A 4H2XB 2E41A 1RIQA 2XTIA 3HY1A 2DQ3A 4K87A 4KR2A 3LSSA 4AH6A 2QHUA 1SRYA 4YROA 5C53B 4G84A 2DZ9A 3NENA 3V8JA 1H4SA 4LVJA 4BW9A 5E3IA 3QNEA 1B8AA 1YFRA 3L1AA 5K1XA 1ASZA 4P74A 3PCOB 2ZIOA 1HTTA 1GGMA 4YRSA 1X2HA 2EJFA 2ZTGA 4WI1A 1WQWA 3MF2A 4XTWA 3HRKA 1E24A 3EFSA 2ZINA 1WQ7A 4P72C 3ERRA 5K1PA 1ADYA 4TQDA 2C8MA 3HXWA 1H4VB 3HRIA 4LVLA 2AKWA 3UH0A 2QHTA 1LYLA 1B7YA 3QO5A 2Q7EA 1E1OA 3V7SA 4ZTUB 3RGLA 4YCUA 3MF1A 1NJ2A 1EFWA 2PMEA 4L87A 3LSQA 1X01A 2EWNA 4ZTZB 4HWOA 5HGQA 2DXUA 4K88A 4YRLA 2ZR2A 2DEQA 3MQZA 3UFGA 3RIRA 3QTCA 3P8VA 1EIYB 1X56A 3UGTA 3ICAA 1B76A 1N9WA 1ATIA 1YGBA 4TQFA 1NJ8A 1YB3A 1KMNA 2EAYA 3BJUA 2ZR3A 1HC7A 3E9IA 4YRCA 1B70B 2Q7GA 3RKWA 3HFZA 3RL6A 4TVAB 1W66A 1HXDA 1PYSB 3HXXA 4PG3A 1NYQA 2ALYB 3HY0A 4YRFA 2DXTA 2E64A 2ZT7A 4P74C 3A7AA 3RF1A 4TTVA 4CS4A 2QHVA 4CH6A 1SESA 2Q5HA 4YRPA 4TVYA 3LC0A 3A5ZA 1QF6A 5F5WA 2AMCB 3A74A 2ZT6A 4XTZA 4CH4A 3WQZA 4LVMA 1WU7A 4YREA 3HXZA 5ELNA 3PCOA 2CJBA 2I4MA 3L4GB 4YCVA 4PHCA 1G5IA 2A8EA 4H2TA 1BBUA 4K86A 1Z7MA 4HWPA 2E3CA 1X2GA 2ODRC 1X55A 1H4QA 4EX5A 4HWSA 2DZCA 1BBWA 4EO4A 4YRNA 4ZIBA 2Q7HA 4DQ2A 4XU3A 4E51A 4P73A 4P71C 3FJPA 2I4NA 4YRMA 3W3SA 4HVCA 3IG2A 1YFSA 4H02A 2C7IA 4XEMA 1L0WA 2ZT5A 3DSQA 3A32A 4H2SA 1NJ5A 1KMMA 4P75A 4YYEA 3I7FA 4WJ3M 4YCWA 2ZCEA 4BWAA 2CJAA 1IL2A 1PYSA 3VQYA 4P71A 2E1HA 2ARSA 2NS6A 2J3LA 4WJ4A 4DPGA 2IY5B 4CS2A 4XU2A 4H2WA 1KOGA 3E9HA 4H2XA 4UP7A 12ASA 3P8TA 4H2YA 3KFUA 3TEHA 1B7YB 2HNIA 4XU1A 2DU5A 1YFTA 3A7RA 3V7CA 3VBBA 4OP0A 2ZT8A 5ELOA 4YRKA 3RKXA 2Q5IA 4XEOA 2AMCA 3A31A 1WYDA 2DTIA 3HXYA 3M4PA 1EVLA 1B70A 1E22A 4P3PA 4J15A 4YP0A 3VQWA 2ARUA 2DQ0A 2ZXFA 2I4LA 1H4TA 2EL9A 1G51A 3A7UA 4LVIA 4NCXA 3NELA 4YRJA 4LNSA 3G1ZA 3HFZB 4CH5A 4P3OA 2DDZA 2RHQB 2ZNJA 2IY5A 1C0AA 4RQEA 1FYFA 3V8KA 1WPYA 3R07A 3IALA 1WNLA 4YRQA 1Z7NA 3NETA 2ZZGA 4XTUA 3IKLA 3RUXA 3QO8A 4TWAA 3TEGA 3VQVA 2ZZEA 4O2DA 4HA8A 1EVKA 2QHSA 2J3MA 2EJ9A 2DU7A 2DVEA 2XGTA 4HWTA 4UPAA 3V8LA 1NJ1A 3TEHB 2ARTA 2DJZA 3L4GA 3HXUA 3A5YA 2RHSA 3HXVA 3EFRA 3MEYA 4P75C 1ADJA 2DTOA 4HWRA 2ZGWA 4H2UA 2FYKA 4XTXA 2G4CA 3NEMA 3OD1A 3IKMB 5C51B 4YRIA 3L2ZA 1JJCA 1E1TA 2CJ9A 3BFMA 1WLEA 2EJGA 4G85A 3M4QA 2ZZFA 2ZNIA 2ALYA 4UP9A 4CS3A 3V7RA 1EOVA 2P5IA 3REUA 3VQXA 3HFVA 3TUPA 5KNNA 2I4OA 3HTZA 4YRTA 4XTYA 2AKWB 3RACA 1VQZA 4P3NA 1NJ6A 3REXA 2E65A 4RDXA 2CGHA 11ASA 2ZIMA 4RQFA 1J5WA 4WF2A 4UP8A 4Q6GA 4H2VA 2P0LA 4KR3A 4YRRA 1SERA 2E5AA 2RHQA 1X54A 4YPFA 4TVWA 4RMFA 3UGQA 2DKGA 2PMFA 3RKYA 2E10A 5C52B 4CH3A 1EQRA 3QO7A 1USYA 4XU0A 3PZCA 4YRGA 2DTHA 4XTVA 1G5HA 2RHSB 1ASYA 4P72A 1QE0A 1JJCB 4TVAA 4LVKA 4P73C 1BIBA 1NNHA 2CIMA 2ODRD 4X5OA 3CMQA 4Q15A 1BIAA 4KQEA 4OLFA
chains in the Genus database with same CATH topology
3P8YA 1USYC 4YDQA 1EIYA 1SETA 1NYRA 4HT4A 4H2XB 2E41A 1RIQA 2XTIA 3HY1A 2DQ3A 4K87A 4KR2A 3LSSA 4AH6A 2QHUA 1SRYA 4YROA 5C53B 4G84A 2DZ9A 3NENA 3V8JA 1H4SA 4LVJA 4BW9A 5E3IA 3QNEA 1B8AA 1YFRA 3L1AA 5K1XA 1ASZA 4P74A 3PCOB 2ZIOA 1HTTA 1GGMA 4YRSA 1X2HA 2EJFA 2ZTGA 4WI1A 1WQWA 3MF2A 4XTWA 3HRKA 1E24A 3EFSA 2ZINA 1WQ7A 4P72C 3ERRA 5K1PA 1ADYA 4TQDA 2C8MA 3HXWA 1H4VB 3HRIA 4LVLA 2AKWA 3UH0A 2QHTA 1LYLA 1B7YA 3QO5A 2Q7EA 1E1OA 3V7SA 4ZTUB 3RGLA 4YCUA 3MF1A 1NJ2A 1EFWA 2PMEA 4L87A 3LSQA 1X01A 2EWNA 4ZTZB 4HWOA 5HGQA 2DXUA 4K88A 4YRLA 2ZR2A 2DEQA 3MQZA 3UFGA 3RIRA 3QTCA 3P8VA 1EIYB 1X56A 3UGTA 3ICAA 1B76A 1N9WA 1ATIA 1YGBA 4TQFA 1NJ8A 1YB3A 1KMNA 2EAYA 3BJUA 2ZR3A 1HC7A 3E9IA 4YRCA 1B70B 2Q7GA 3RKWA 3HFZA 3RL6A 4TVAB 1W66A 1HXDA 1PYSB 3HXXA 4PG3A 1NYQA 2ALYB 3HY0A 4YRFA 2DXTA 2E64A 2ZT7A 4P74C 3A7AA 3RF1A 4TTVA 4CS4A 2QHVA 4CH6A 1SESA 2Q5HA 4YRPA 4TVYA 3LC0A 3A5ZA 1QF6A 5F5WA 2AMCB 3A74A 2ZT6A 4XTZA 4CH4A 3WQZA 4LVMA 1WU7A 4YREA 3HXZA 5ELNA 3PCOA 2CJBA 2I4MA 3L4GB 4YCVA 4PHCA 1G5IA 2A8EA 4H2TA 1BBUA 4K86A 1Z7MA 4HWPA 2E3CA 1X2GA 2ODRC 1X55A 1H4QA 4EX5A 4HWSA 2DZCA 1BBWA 4EO4A 4YRNA 4ZIBA 2Q7HA 4DQ2A 4XU3A 4E51A 4P73A 4P71C 3FJPA 2I4NA 4YRMA 3W3SA 4HVCA 3IG2A 1YFSA 4H02A 2C7IA 4XEMA 1L0WA 2ZT5A 3DSQA 3A32A 4H2SA 1NJ5A 1KMMA 4P75A 4YYEA 3I7FA 4WJ3M 4YCWA 2ZCEA 4BWAA 2CJAA 1IL2A 1PYSA 3VQYA 4P71A 2E1HA 2ARSA 2NS6A 2J3LA 4WJ4A 4DPGA 2IY5B 4CS2A 4XU2A 4H2WA 1KOGA 3E9HA 4H2XA 4UP7A 12ASA 3P8TA 4H2YA 3KFUA 3TEHA 1B7YB 2HNIA 4XU1A 2DU5A 1YFTA 3A7RA 3V7CA 3VBBA 4OP0A 2ZT8A 5ELOA 4YRKA 3RKXA 2Q5IA 4XEOA 2AMCA 3A31A 1WYDA 2DTIA 3HXYA 3M4PA 1EVLA 1B70A 1E22A 4P3PA 4J15A 4YP0A 3VQWA 2ARUA 2DQ0A 2ZXFA 2I4LA 1H4TA 2EL9A 1G51A 3A7UA 4LVIA 4NCXA 3NELA 4YRJA 4LNSA 3G1ZA 3HFZB 4CH5A 4P3OA 2DDZA 2RHQB 2ZNJA 2IY5A 1C0AA 4RQEA 1FYFA 3V8KA 1WPYA 3R07A 3IALA 1WNLA 4YRQA 1Z7NA 3NETA 2ZZGA 4XTUA 3IKLA 3RUXA 3QO8A 4TWAA 3TEGA 3VQVA 2ZZEA 4O2DA 4HA8A 1EVKA 2QHSA 2J3MA 2EJ9A 2DU7A 2DVEA 2XGTA 4HWTA 4UPAA 3V8LA 1NJ1A 3TEHB 2ARTA 2DJZA 3L4GA 3HXUA 3A5YA 2RHSA 3HXVA 3EFRA 3MEYA 4P75C 1ADJA 2DTOA 4HWRA 2ZGWA 4H2UA 2FYKA 4XTXA 2G4CA 3NEMA 3OD1A 3IKMB 5C51B 4YRIA 3L2ZA 1JJCA 1E1TA 2CJ9A 3BFMA 1WLEA 2EJGA 4G85A 3M4QA 2ZZFA 2ZNIA 2ALYA 4UP9A 4CS3A 3V7RA 1EOVA 2P5IA 3REUA 3VQXA 3HFVA 3TUPA 5KNNA 2I4OA 3HTZA 4YRTA 4XTYA 2AKWB 3RACA 1VQZA 4P3NA 1NJ6A 3REXA 2E65A 4RDXA 2CGHA 11ASA 2ZIMA 4RQFA 1J5WA 4WF2A 4UP8A 4Q6GA 4H2VA 2P0LA 4KR3A 4YRRA 1SERA 2E5AA 2RHQA 1X54A 4YPFA 4TVWA 4RMFA 3UGQA 2DKGA 2PMFA 3RKYA 2E10A 5C52B 4CH3A 1EQRA 3QO7A 1USYA 4XU0A 3PZCA 4YRGA 2DTHA 4XTVA 1G5HA 2RHSB 1ASYA 4P72A 1QE0A 1JJCB 4TVAA 4LVKA 4P73C 1BIBA 1NNHA 2CIMA 2ODRD 4X5OA 3CMQA 4Q15A 1BIAA 4KQEA 4OLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8Y A;  1USY C;  4YDQ A;  1EIY A;  1SET A;  1NYR A;  4H2X B;  2E41 A;  1RIQ A;  2XTI A;  3HY1 A;  2DQ3 A;  4K87 A;  4KR2 A;  3LSS A;  4AH6 A;  2QHU A;  1SRY A;  4YRO A;  5C53 B;  4G84 A;  2DZ9 A;  3NEN A;  3V8J A;  1H4S A;  4BW9 A;  5E3I A;  3QNE A;  1B8A A;  1YFR A;  3L1A A;  5K1X A;  1ASZ A;  4P74 A;  3PCO B;  2ZIO A;  1HTT A;  1GGM A;  4YRS A;  1X2H A;  2EJF A;  2ZTG A;  4WI1 A;  1WQW A;  3MF2 A;  4XTW A;  3HRK A;  1E24 A;  3EFS A;  2ZIN A;  1WQ7 A;  4P72 C;  3ERR A;  5K1P A;  1ADY A;  4TQD A;  2C8M A;  3HXW A;  1H4V B;  3HRI A;  2AKW A;  3UH0 A;  2QHT A;  1LYL A;  1B7Y A;  3QO5 A;  2Q7E A;  1E1O A;  3V7S A;  4ZTU B;  3RGL A;  4YCU A;  3MF1 A;  1NJ2 A;  1EFW A;  2PME A;  4L87 A;  3LSQ A;  1X01 A;  2EWN A;  4ZTZ B;  4HWO A;  5HGQ A;  2DXU A;  4K88 A;  4YRL A;  2ZR2 A;  2DEQ A;  3UFG A;  3RIR A;  3QTC A;  3P8V A;  1EIY B;  1X56 A;  3UGT A;  3ICA A;  1B76 A;  1N9W A;  1ATI A;  1YGB A;  4TQF A;  1NJ8 A;  1YB3 A;  1KMN A;  2EAY A;  3BJU A;  2ZR3 A;  1HC7 A;  3E9I A;  4YRC A;  1B70 B;  2Q7G A;  3RKW A;  3HFZ A;  3RL6 A;  4TVA B;  1W66 A;  1HXD A;  1PYS B;  3HXX A;  4PG3 A;  1NYQ A;  2ALY B;  3HY0 A;  4YRF A;  2DXT A;  2E64 A;  2ZT7 A;  4P74 C;  3A7A A;  3RF1 A;  4TTV A;  4CS4 A;  2QHV A;  4CH6 A;  1SES A;  2Q5H A;  4YRP A;  4TVY A;  3LC0 A;  3A5Z A;  1QF6 A;  5F5W A;  2AMC B;  3A74 A;  2ZT6 A;  4XTZ A;  4CH4 A;  3WQZ A;  1WU7 A;  4YRE A;  3HXZ A;  5ELN A;  3PCO A;  2CJB A;  2I4M A;  3L4G B;  4YCV A;  4PHC A;  1G5I A;  4H2T A;  1BBU A;  4K86 A;  1Z7M A;  4HWP A;  2E3C A;  1X2G A;  2ODR C;  1X55 A;  1H4Q A;  4EX5 A;  4HWS A;  2DZC A;  1BBW A;  4EO4 A;  4YRN A;  4ZIB A;  2Q7H A;  4DQ2 A;  4XU3 A;  4E51 A;  4P73 A;  4P71 C;  3FJP A;  2I4N A;  4YRM A;  3W3S A;  4HVC A;  3IG2 A;  1YFS A;  4H02 A;  2C7I A;  4XEM A;  1L0W A;  2ZT5 A;  3DSQ A;  3A32 A;  4H2S A;  1NJ5 A;  1KMM A;  4P75 A;  4YYE A;  3I7F A;  4WJ3 M;  4YCW A;  2ZCE A;  4BWA A;  2CJA A;  1IL2 A;  1PYS A;  3VQY A;  4P71 A;  2E1H A;  2ARS A;  2J3L A;  4WJ4 A;  4DPG A;  2IY5 B;  4CS2 A;  4XU2 A;  4H2W A;  1KOG A;  3E9H A;  4H2X A;  4UP7 A;  12AS A;  3P8T A;  4H2Y A;  3KFU A;  3TEH A;  1B7Y B;  2HNI A;  4XU1 A;  2DU5 A;  1YFT A;  3A7R A;  3V7C A;  3VBB A;  4OP0 A;  2ZT8 A;  5ELO A;  4YRK A;  3RKX A;  2Q5I A;  4XEO A;  2AMC A;  3A31 A;  1WYD A;  2DTI A;  3HXY A;  3M4P A;  1EVL A;  1B70 A;  1E22 A;  4P3P A;  4J15 A;  4YP0 A;  3VQW A;  2ARU A;  2DQ0 A;  2ZXF A;  2I4L A;  1H4T A;  2EL9 A;  1G51 A;  3A7U A;  4NCX A;  3NEL A;  4YRJ A;  4LNS A;  3G1Z A;  3HFZ B;  4CH5 A;  4P3O A;  2DDZ A;  2RHQ B;  2ZNJ A;  2IY5 A;  1C0A A;  4RQE A;  1FYF A;  3V8K A;  1WPY A;  3R07 A;  3IAL A;  1WNL A;  4YRQ A;  1Z7N A;  3NET A;  2ZZG A;  4XTU A;  3IKL A;  3RUX A;  3QO8 A;  4TWA A;  3TEG A;  3VQV A;  2ZZE A;  4O2D A;  4HA8 A;  1EVK A;  2QHS A;  2J3M A;  2EJ9 A;  2DU7 A;  2DVE A;  2XGT A;  4HWT A;  4UPA A;  3V8L A;  1NJ1 A;  3TEH B;  2ART A;  2DJZ A;  3L4G A;  3HXU A;  3A5Y A;  2RHS A;  3HXV A;  3EFR A;  3MEY A;  4P75 C;  1ADJ A;  2DTO A;  4HWR A;  2ZGW A;  4H2U A;  2FYK A;  4XTX A;  2G4C A;  3NEM A;  3OD1 A;  3IKM B;  5C51 B;  4YRI A;  3L2Z A;  1JJC A;  1E1T A;  2CJ9 A;  3BFM A;  1WLE A;  2EJG A;  4G85 A;  3M4Q A;  2ZZF A;  2ZNI A;  2ALY A;  4UP9 A;  4CS3 A;  3V7R A;  1EOV A;  2P5I A;  3REU A;  3VQX A;  3HFV A;  3TUP A;  5KNN A;  2I4O A;  3HTZ A;  4YRT A;  4XTY A;  2AKW B;  3RAC A;  1VQZ A;  4P3N A;  1NJ6 A;  3REX A;  2E65 A;  4RDX A;  2CGH A;  11AS A;  2ZIM A;  4RQF A;  1J5W A;  4WF2 A;  4UP8 A;  4Q6G A;  4H2V A;  2P0L A;  4KR3 A;  4YRR A;  1SER A;  2E5A A;  2RHQ A;  1X54 A;  4YPF A;  4TVW A;  4RMF A;  3UGQ A;  2DKG A;  2PMF A;  3RKY A;  2E10 A;  5C52 B;  4CH3 A;  1EQR A;  3QO7 A;  1USY A;  4XU0 A;  3PZC A;  4YRG A;  2DTH A;  4XTV A;  1G5H A;  2RHS B;  1ASY A;  4P72 A;  1QE0 A;  1JJC B;  4TVA A;  4P73 C;  1BIB A;  1NNH A;  2CIM A;  2ODR D;  4X5O A;  3CMQ A;  4Q15 A;  1BIA A;  4KQE A;  4OLF A; 
#chains in the Genus database with same CATH topology
 3P8Y A;  1USY C;  4YDQ A;  1EIY A;  1SET A;  1NYR A;  4HT4 A;  4H2X B;  2E41 A;  1RIQ A;  2XTI A;  3HY1 A;  2DQ3 A;  4K87 A;  4KR2 A;  3LSS A;  4AH6 A;  2QHU A;  1SRY A;  4YRO A;  5C53 B;  4G84 A;  2DZ9 A;  3NEN A;  3V8J A;  1H4S A;  4LVJ A;  4BW9 A;  5E3I A;  3QNE A;  1B8A A;  1YFR A;  3L1A A;  5K1X A;  1ASZ A;  4P74 A;  3PCO B;  2ZIO A;  1HTT A;  1GGM A;  4YRS A;  1X2H A;  2EJF A;  2ZTG A;  4WI1 A;  1WQW A;  3MF2 A;  4XTW A;  3HRK A;  1E24 A;  3EFS A;  2ZIN A;  1WQ7 A;  4P72 C;  3ERR A;  5K1P A;  1ADY A;  4TQD A;  2C8M A;  3HXW A;  1H4V B;  3HRI A;  4LVL A;  2AKW A;  3UH0 A;  2QHT A;  1LYL A;  1B7Y A;  3QO5 A;  2Q7E A;  1E1O A;  3V7S A;  4ZTU B;  3RGL A;  4YCU A;  3MF1 A;  1NJ2 A;  1EFW A;  2PME A;  4L87 A;  3LSQ A;  1X01 A;  2EWN A;  4ZTZ B;  4HWO A;  5HGQ A;  2DXU A;  4K88 A;  4YRL A;  2ZR2 A;  2DEQ A;  3MQZ A;  3UFG A;  3RIR A;  3QTC A;  3P8V A;  1EIY B;  1X56 A;  3UGT A;  3ICA A;  1B76 A;  1N9W A;  1ATI A;  1YGB A;  4TQF A;  1NJ8 A;  1YB3 A;  1KMN A;  2EAY A;  3BJU A;  2ZR3 A;  1HC7 A;  3E9I A;  4YRC A;  1B70 B;  2Q7G A;  3RKW A;  3HFZ A;  3RL6 A;  4TVA B;  1W66 A;  1HXD A;  1PYS B;  3HXX A;  4PG3 A;  1NYQ A;  2ALY B;  3HY0 A;  4YRF A;  2DXT A;  2E64 A;  2ZT7 A;  4P74 C;  3A7A A;  3RF1 A;  4TTV A;  4CS4 A;  2QHV A;  4CH6 A;  1SES A;  2Q5H A;  4YRP A;  4TVY A;  3LC0 A;  3A5Z A;  1QF6 A;  5F5W A;  2AMC B;  3A74 A;  2ZT6 A;  4XTZ A;  4CH4 A;  3WQZ A;  4LVM A;  1WU7 A;  4YRE A;  3HXZ A;  5ELN A;  3PCO A;  2CJB A;  2I4M A;  3L4G B;  4YCV A;  4PHC A;  1G5I A;  2A8E A;  4H2T A;  1BBU A;  4K86 A;  1Z7M A;  4HWP A;  2E3C A;  1X2G A;  2ODR C;  1X55 A;  1H4Q A;  4EX5 A;  4HWS A;  2DZC A;  1BBW A;  4EO4 A;  4YRN A;  4ZIB A;  2Q7H A;  4DQ2 A;  4XU3 A;  4E51 A;  4P73 A;  4P71 C;  3FJP A;  2I4N A;  4YRM A;  3W3S A;  4HVC A;  3IG2 A;  1YFS A;  4H02 A;  2C7I A;  4XEM A;  1L0W A;  2ZT5 A;  3DSQ A;  3A32 A;  4H2S A;  1NJ5 A;  1KMM A;  4P75 A;  4YYE A;  3I7F A;  4WJ3 M;  4YCW A;  2ZCE A;  4BWA A;  2CJA A;  1IL2 A;  1PYS A;  3VQY A;  4P71 A;  2E1H A;  2ARS A;  2NS6 A;  2J3L A;  4WJ4 A;  4DPG A;  2IY5 B;  4CS2 A;  4XU2 A;  4H2W A;  1KOG A;  3E9H A;  4H2X A;  4UP7 A;  12AS A;  3P8T A;  4H2Y A;  3KFU A;  3TEH A;  1B7Y B;  2HNI A;  4XU1 A;  2DU5 A;  1YFT A;  3A7R A;  3V7C A;  3VBB A;  4OP0 A;  2ZT8 A;  5ELO A;  4YRK A;  3RKX A;  2Q5I A;  4XEO A;  2AMC A;  3A31 A;  1WYD A;  2DTI A;  3HXY A;  3M4P A;  1EVL A;  1B70 A;  1E22 A;  4P3P A;  4J15 A;  4YP0 A;  3VQW A;  2ARU A;  2DQ0 A;  2ZXF A;  2I4L A;  1H4T A;  2EL9 A;  1G51 A;  3A7U A;  4LVI A;  4NCX A;  3NEL A;  4YRJ A;  4LNS A;  3G1Z A;  3HFZ B;  4CH5 A;  4P3O A;  2DDZ A;  2RHQ B;  2ZNJ A;  2IY5 A;  1C0A A;  4RQE A;  1FYF A;  3V8K A;  1WPY A;  3R07 A;  3IAL A;  1WNL A;  4YRQ A;  1Z7N A;  3NET A;  2ZZG A;  4XTU A;  3IKL A;  3RUX A;  3QO8 A;  4TWA A;  3TEG A;  3VQV A;  2ZZE A;  4O2D A;  4HA8 A;  1EVK A;  2QHS A;  2J3M A;  2EJ9 A;  2DU7 A;  2DVE A;  2XGT A;  4HWT A;  4UPA A;  3V8L A;  1NJ1 A;  3TEH B;  2ART A;  2DJZ A;  3L4G A;  3HXU A;  3A5Y A;  2RHS A;  3HXV A;  3EFR A;  3MEY A;  4P75 C;  1ADJ A;  2DTO A;  4HWR A;  2ZGW A;  4H2U A;  2FYK A;  4XTX A;  2G4C A;  3NEM A;  3OD1 A;  3IKM B;  5C51 B;  4YRI A;  3L2Z A;  1JJC A;  1E1T A;  2CJ9 A;  3BFM A;  1WLE A;  2EJG A;  4G85 A;  3M4Q A;  2ZZF A;  2ZNI A;  2ALY A;  4UP9 A;  4CS3 A;  3V7R A;  1EOV A;  2P5I A;  3REU A;  3VQX A;  3HFV A;  3TUP A;  5KNN A;  2I4O A;  3HTZ A;  4YRT A;  4XTY A;  2AKW B;  3RAC A;  1VQZ A;  4P3N A;  1NJ6 A;  3REX A;  2E65 A;  4RDX A;  2CGH A;  11AS A;  2ZIM A;  4RQF A;  1J5W A;  4WF2 A;  4UP8 A;  4Q6G A;  4H2V A;  2P0L A;  4KR3 A;  4YRR A;  1SER A;  2E5A A;  2RHQ A;  1X54 A;  4YPF A;  4TVW A;  4RMF A;  3UGQ A;  2DKG A;  2PMF A;  3RKY A;  2E10 A;  5C52 B;  4CH3 A;  1EQR A;  3QO7 A;  1USY A;  4XU0 A;  3PZC A;  4YRG A;  2DTH A;  4XTV A;  1G5H A;  2RHS B;  1ASY A;  4P72 A;  1QE0 A;  1JJC B;  4TVA A;  4LVK A;  4P73 C;  1BIB A;  1NNH A;  2CIM A;  2ODR D;  4X5O A;  3CMQ A;  4Q15 A;  1BIA A;  4KQE A;  4OLF A; 
#chains in the Genus database with same CATH homology
 3P8Y A;  1USY C;  4YDQ A;  1EIY A;  1SET A;  1NYR A;  4HT4 A;  4H2X B;  2E41 A;  1RIQ A;  2XTI A;  3HY1 A;  2DQ3 A;  4K87 A;  4KR2 A;  3LSS A;  4AH6 A;  2QHU A;  1SRY A;  4YRO A;  5C53 B;  4G84 A;  2DZ9 A;  3NEN A;  3V8J A;  1H4S A;  4LVJ A;  4BW9 A;  5E3I A;  3QNE A;  1B8A A;  1YFR A;  3L1A A;  5K1X A;  1ASZ A;  4P74 A;  3PCO B;  2ZIO A;  1HTT A;  1GGM A;  4YRS A;  1X2H A;  2EJF A;  2ZTG A;  4WI1 A;  1WQW A;  3MF2 A;  4XTW A;  3HRK A;  1E24 A;  3EFS A;  2ZIN A;  1WQ7 A;  4P72 C;  3ERR A;  5K1P A;  1ADY A;  4TQD A;  2C8M A;  3HXW A;  1H4V B;  3HRI A;  4LVL A;  2AKW A;  3UH0 A;  2QHT A;  1LYL A;  1B7Y A;  3QO5 A;  2Q7E A;  1E1O A;  3V7S A;  4ZTU B;  3RGL A;  4YCU A;  3MF1 A;  1NJ2 A;  1EFW A;  2PME A;  4L87 A;  3LSQ A;  1X01 A;  2EWN A;  4ZTZ B;  4HWO A;  5HGQ A;  2DXU A;  4K88 A;  4YRL A;  2ZR2 A;  2DEQ A;  3MQZ A;  3UFG A;  3RIR A;  3QTC A;  3P8V A;  1EIY B;  1X56 A;  3UGT A;  3ICA A;  1B76 A;  1N9W A;  1ATI A;  1YGB A;  4TQF A;  1NJ8 A;  1YB3 A;  1KMN A;  2EAY A;  3BJU A;  2ZR3 A;  1HC7 A;  3E9I A;  4YRC A;  1B70 B;  2Q7G A;  3RKW A;  3HFZ A;  3RL6 A;  4TVA B;  1W66 A;  1HXD A;  1PYS B;  3HXX A;  4PG3 A;  1NYQ A;  2ALY B;  3HY0 A;  4YRF A;  2DXT A;  2E64 A;  2ZT7 A;  4P74 C;  3A7A A;  3RF1 A;  4TTV A;  4CS4 A;  2QHV A;  4CH6 A;  1SES A;  2Q5H A;  4YRP A;  4TVY A;  3LC0 A;  3A5Z A;  1QF6 A;  5F5W A;  2AMC B;  3A74 A;  2ZT6 A;  4XTZ A;  4CH4 A;  3WQZ A;  4LVM A;  1WU7 A;  4YRE A;  3HXZ A;  5ELN A;  3PCO A;  2CJB A;  2I4M A;  3L4G B;  4YCV A;  4PHC A;  1G5I A;  2A8E A;  4H2T A;  1BBU A;  4K86 A;  1Z7M A;  4HWP A;  2E3C A;  1X2G A;  2ODR C;  1X55 A;  1H4Q A;  4EX5 A;  4HWS A;  2DZC A;  1BBW A;  4EO4 A;  4YRN A;  4ZIB A;  2Q7H A;  4DQ2 A;  4XU3 A;  4E51 A;  4P73 A;  4P71 C;  3FJP A;  2I4N A;  4YRM A;  3W3S A;  4HVC A;  3IG2 A;  1YFS A;  4H02 A;  2C7I A;  4XEM A;  1L0W A;  2ZT5 A;  3DSQ A;  3A32 A;  4H2S A;  1NJ5 A;  1KMM A;  4P75 A;  4YYE A;  3I7F A;  4WJ3 M;  4YCW A;  2ZCE A;  4BWA A;  2CJA A;  1IL2 A;  1PYS A;  3VQY A;  4P71 A;  2E1H A;  2ARS A;  2NS6 A;  2J3L A;  4WJ4 A;  4DPG A;  2IY5 B;  4CS2 A;  4XU2 A;  4H2W A;  1KOG A;  3E9H A;  4H2X A;  4UP7 A;  12AS A;  3P8T A;  4H2Y A;  3KFU A;  3TEH A;  1B7Y B;  2HNI A;  4XU1 A;  2DU5 A;  1YFT A;  3A7R A;  3V7C A;  3VBB A;  4OP0 A;  2ZT8 A;  5ELO A;  4YRK A;  3RKX A;  2Q5I A;  4XEO A;  2AMC A;  3A31 A;  1WYD A;  2DTI A;  3HXY A;  3M4P A;  1EVL A;  1B70 A;  1E22 A;  4P3P A;  4J15 A;  4YP0 A;  3VQW A;  2ARU A;  2DQ0 A;  2ZXF A;  2I4L A;  1H4T A;  2EL9 A;  1G51 A;  3A7U A;  4LVI A;  4NCX A;  3NEL A;  4YRJ A;  4LNS A;  3G1Z A;  3HFZ B;  4CH5 A;  4P3O A;  2DDZ A;  2RHQ B;  2ZNJ A;  2IY5 A;  1C0A A;  4RQE A;  1FYF A;  3V8K A;  1WPY A;  3R07 A;  3IAL A;  1WNL A;  4YRQ A;  1Z7N A;  3NET A;  2ZZG A;  4XTU A;  3IKL A;  3RUX A;  3QO8 A;  4TWA A;  3TEG A;  3VQV A;  2ZZE A;  4O2D A;  4HA8 A;  1EVK A;  2QHS A;  2J3M A;  2EJ9 A;  2DU7 A;  2DVE A;  2XGT A;  4HWT A;  4UPA A;  3V8L A;  1NJ1 A;  3TEH B;  2ART A;  2DJZ A;  3L4G A;  3HXU A;  3A5Y A;  2RHS A;  3HXV A;  3EFR A;  3MEY A;  4P75 C;  1ADJ A;  2DTO A;  4HWR A;  2ZGW A;  4H2U A;  2FYK A;  4XTX A;  2G4C A;  3NEM A;  3OD1 A;  3IKM B;  5C51 B;  4YRI A;  3L2Z A;  1JJC A;  1E1T A;  2CJ9 A;  3BFM A;  1WLE A;  2EJG A;  4G85 A;  3M4Q A;  2ZZF A;  2ZNI A;  2ALY A;  4UP9 A;  4CS3 A;  3V7R A;  1EOV A;  2P5I A;  3REU A;  3VQX A;  3HFV A;  3TUP A;  5KNN A;  2I4O A;  3HTZ A;  4YRT A;  4XTY A;  2AKW B;  3RAC A;  1VQZ A;  4P3N A;  1NJ6 A;  3REX A;  2E65 A;  4RDX A;  2CGH A;  11AS A;  2ZIM A;  4RQF A;  1J5W A;  4WF2 A;  4UP8 A;  4Q6G A;  4H2V A;  2P0L A;  4KR3 A;  4YRR A;  1SER A;  2E5A A;  2RHQ A;  1X54 A;  4YPF A;  4TVW A;  4RMF A;  3UGQ A;  2DKG A;  2PMF A;  3RKY A;  2E10 A;  5C52 B;  4CH3 A;  1EQR A;  3QO7 A;  1USY A;  4XU0 A;  3PZC A;  4YRG A;  2DTH A;  4XTV A;  1G5H A;  2RHS B;  1ASY A;  4P72 A;  1QE0 A;  1JJC B;  4TVA A;  4LVK A;  4P73 C;  1BIB A;  1NNH A;  2CIM A;  2ODR D;  4X5O A;  3CMQ A;  4Q15 A;  1BIA A;  4KQE A;  4OLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...