1YGBA

Crystal structure of the catalytic fragment of alanyl-trna synthetase in complex with l-serine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Breaking sieve for steric exclusion of a noncognate amino acid from active site of a tRNA synthetase.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 121
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2005-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1ygbA01
4H2UA 4G84A 1ADYA 4L87A 4PHCA 1BIAA 1QF6A 2DXTA 3UGTA 3QO7A 1EQRA 1X56A 1NJ1A 4H02A 3P8TA 5E3IA 4P75C 3BJUA 2J3LA 4BWAA 12ASA 1C0AA 1BIBA 5HGQA 1HC7A 1Z7MA 2Q7EA 4P73A 2ARSA 1G51A 2PMEA 2QHUA 2ZTGA 2DZ9A 1YFSA 2E41A 1EVLA 2EJGA 3IALA 4G85A 4UP7A 3NELA 1B76A 3RKWA 1YFTA 2AMCA 2DJZA 3V8KA 4XTUA 2AMCB 4YP0A 4XEMA 3QTCA 4XU3A 4YCUA 4YRPA 4HWTA 2ZT5A 4TVAA 3HRKA 4TVAB 1USYC 3E9HA 1WNLA 3HXXA 1X55A 1X2GA 1NYQA 1ADJA 3DSQA 1EIYA 2AKWA 4RMFA 5KNNA 1JJCA 4YRFA 4YRCA 1EIYB 1QE0A 1WU7A 1JJCB 4P72A 4K86A 4PG3A 1EFWA 5ELOA 4CS3A 4H2VA 1B70B 4P74A 2CJAA 3L4GA 2Q7GA 4CH6A 2IY5A 4ZIBA 4K88A 3L4GB 2FYKA 4XEOA 3V7SA 2IY5B 1H4TA 1SETA 4YRRA 4RDXA 2ZNIA 1HXDA 3MEYA 3RACA 3E9IA 3MF2A 3A31A 3HXWA 1ASZA 3I7FA 3HFVA 1YB3A 2DXUA 2ZZFA 3QO5A 1E1TA 1YGBA 2DZCA 3NEMA 1SRYA 2DTHA 3HTZA 4YDQA 3VQWA 3RL6A 2DDZA 4P3OA 3VQVA 4H2TA 4YYEA 2QHTA 2ZZEA 3HY1A 2ARTA 2EAYA 2ALYA 1X2HA 3NETA 3IKLA 1LYLA 2ALYB 1N9WA 3NENA 3BFMA 1YFRA 2XGTA 1IL2A 4J15A 1X01A 5C52B 2DQ3A 4YRSA 4YRNA 3V8JA 4YRQA 2I4LA 2DTIA 3EFSA 3ICAA 3REUA 3A5YA 4CH5A 1WPYA 1WQWA 1VQZA 3TEHA 4EO4A 3A7AA 4H2WA 3VQXA 3A7RA 4XTWA 2EL9A 2PMFA 3A74A 3LSSA 4CS4A 4E51A 2DEQA 4TWAA 4P71C 3LSQA 4YPFA 4YRGA 4XTYA 2Q5HA 4K87A 4HWPA 2DKGA 4WJ4A 3RF1A 4P75A 4XU2A 1NJ5A 4ZTZB 2P5IA 4TQDA 3RGLA 4ZTUB 3W3SA 2ZIMA 1WQ7A 3PCOA 1EVKA 1E1OA 2ZT7A 3PCOB 2AKWB 4WI1A 2E1HA 4YRMA 1KOGA 2EWNA 3RKXA 1ATIA 3R07A 3HXYA 4P3NA 3HXVA 3CMQA 4UPAA 1NJ2A 1G5IA 4H2XA 2I4OA 1KMMA 4H2XB 4UP8A 2CIMA 2EJFA 1NYRA 4YRLA 3P8YA 5C51B 4P73C 4YRIA 1W66A 2E64A 3UFGA 3A7UA 4TVWA 3KFUA 1X54A 2ZXFA 2G4CA 1USYA 3V8LA 4TTVA 5C53B 2I4NA 3UH0A 1G5HA 2E5AA 2DQ0A 1H4QA 2C8MA 4Q15A 2ZNJA 3FJPA 2RHQA 3QNEA 2CJBA 2I4MA 4LNSA 3HFZA 2E65A 3M4QA 3V7CA 1L0WA 3HFZB 1PYSA 4H2SA 3V7RA 4YRTA 4YROA 1PYSB 3UGQA 4HWSA 2EJ9A 2ZCEA 4O2DA 3A32A 3L2ZA 1RIQA 4XU0A 2ZGWA 2P0LA 3LC0A 1BBUA 1HTTA 1GGMA 11ASA 2ARUA 4H2YA 4YCWA 3G1ZA 1J5WA 3TEHB 1H4SA 1NJ6A 2ZIOA 5K1PA 2J3MA 4X5OA 2ZT8A 2E3CA 4KR3A 4DPGA 2E10A 2Q5IA 2ZR2A 4P72C 1E24A 4HVCA 3M4PA 4CH3A 1BBWA 2ODRD 4P3PA 3VQYA 1SESA 2CJ9A 4P74C 4XTZA 4XU1A 3ERRA 3IG2A 4AH6A 4EX5A 3HRIA 5ELNA 1WLEA 3REXA 4KQEA 4RQEA 3P8VA 2DU5A 1ASYA 3HY0A 3MF1A 3TUPA 1WYDA 4TVYA 2DU7A 2ZINA 2DTOA 4OP0A 4BW9A 3VBBA 5K1XA 4HA8A 3L1AA 1FYFA 4XTVA 1B7YA 3HXUA 2DVEA 3IKMB 2CGHA 1B7YB 2XTIA 4TQFA 3EFRA 4CS2A 4XTXA 3RKYA 4RQFA 2HNIA 2ZT6A 2ZR3A 4P71A 4WF2A 4CH4A 1B70A 5F5WA 1NNHA 2Q7HA 3RIRA 2ZZGA 1KMNA 4KR2A 2C7IA 4UP9A 3A5ZA 1B8AA 4HWRA 4YRJA 1SERA 3OD1A 4YREA 1NJ8A 3PZCA 2RHSA 4Q6GA 3QO8A 1Z7NA 4NCXA 1H4VB 3TEGA 2QHVA 3RUXA 2RHSB 2QHSA 4HWOA 3HXZA 4DQ2A 3WQZA 2RHQB 4WJ3M 4YCVA 4YRKA 4OLFA 2ODRC 1EOVA 1E22A
chains in the Genus database with same CATH superfamily
4H2UA 4G84A 1ADYA 4L87A 4PHCA 1BIAA 1QF6A 2DXTA 3UGTA 3QO7A 1EQRA 1X56A 1NJ1A 4H02A 3P8TA 5E3IA 4P75C 3BJUA 2J3LA 4BWAA 12ASA 1C0AA 1BIBA 5HGQA 1HC7A 1Z7MA 2Q7EA 4P73A 2ARSA 1G51A 2PMEA 2QHUA 4LVKA 2ZTGA 2DZ9A 1YFSA 2E41A 1EVLA 2EJGA 3IALA 4G85A 4UP7A 3NELA 1B76A 3RKWA 1YFTA 2AMCA 2DJZA 3V8KA 4XTUA 2AMCB 4YP0A 4XEMA 3QTCA 4XU3A 4YCUA 4YRPA 4HWTA 2ZT5A 4TVAA 3HRKA 4TVAB 1USYC 3E9HA 1WNLA 3HXXA 1X55A 1X2GA 1NYQA 1ADJA 3DSQA 1EIYA 2AKWA 4RMFA 5KNNA 1JJCA 4YRFA 4YRCA 1EIYB 1QE0A 1WU7A 1JJCB 4P72A 4K86A 4PG3A 1EFWA 5ELOA 4CS3A 4H2VA 1B70B 4P74A 2CJAA 3L4GA 2Q7GA 4CH6A 2IY5A 4ZIBA 4K88A 3L4GB 2FYKA 4XEOA 3V7SA 2IY5B 1H4TA 1SETA 4YRRA 4RDXA 2ZNIA 1HXDA 3MEYA 3RACA 3E9IA 3MF2A 3A31A 3HXWA 1ASZA 3I7FA 3HFVA 1YB3A 2DXUA 2ZZFA 3QO5A 1E1TA 1YGBA 2DZCA 3NEMA 3MQZA 1SRYA 2DTHA 3HTZA 4YDQA 3VQWA 3RL6A 2DDZA 4P3OA 3VQVA 4H2TA 4YYEA 2QHTA 2ZZEA 3HY1A 2ARTA 2EAYA 2ALYA 1X2HA 3NETA 3IKLA 1LYLA 2ALYB 4LVIA 1N9WA 3NENA 3BFMA 1YFRA 2XGTA 1IL2A 4J15A 1X01A 5C52B 2DQ3A 4YRSA 4YRNA 3V8JA 4YRQA 2I4LA 2DTIA 3EFSA 3ICAA 3REUA 3A5YA 4CH5A 1WPYA 1WQWA 1VQZA 3TEHA 4EO4A 3A7AA 4H2WA 3VQXA 3A7RA 4XTWA 2EL9A 2PMFA 3A74A 3LSSA 4CS4A 4E51A 2DEQA 4TWAA 4P71C 3LSQA 4YPFA 4YRGA 4XTYA 2Q5HA 4K87A 4HWPA 2DKGA 4WJ4A 4HT4A 3RF1A 4P75A 4XU2A 1NJ5A 4ZTZB 2P5IA 4TQDA 3RGLA 4ZTUB 3W3SA 2ZIMA 1WQ7A 3PCOA 1EVKA 1E1OA 2ZT7A 3PCOB 2AKWB 4WI1A 2E1HA 4YRMA 1KOGA 2EWNA 3RKXA 1ATIA 3R07A 3HXYA 4P3NA 3HXVA 3CMQA 4UPAA 1NJ2A 1G5IA 4H2XA 2I4OA 1KMMA 4H2XB 4UP8A 2CIMA 2EJFA 1NYRA 4YRLA 3P8YA 5C51B 4P73C 4YRIA 1W66A 2E64A 3UFGA 3A7UA 4TVWA 3KFUA 1X54A 2ZXFA 2G4CA 1USYA 3V8LA 4LVLA 4TTVA 5C53B 2I4NA 3UH0A 1G5HA 2E5AA 2DQ0A 1H4QA 2C8MA 4Q15A 2ZNJA 3FJPA 2RHQA 3QNEA 2CJBA 2I4MA 4LNSA 3HFZA 2E65A 3M4QA 3V7CA 1L0WA 3HFZB 1PYSA 4H2SA 3V7RA 4YRTA 4YROA 1PYSB 3UGQA 4HWSA 2EJ9A 2ZCEA 4O2DA 3A32A 3L2ZA 1RIQA 4XU0A 2ZGWA 2P0LA 3LC0A 1BBUA 1HTTA 1GGMA 11ASA 2ARUA 4H2YA 4YCWA 3G1ZA 1J5WA 2NS6A 3TEHB 1H4SA 1NJ6A 2ZIOA 5K1PA 2J3MA 4X5OA 2ZT8A 2E3CA 4KR3A 4DPGA 2E10A 2Q5IA 2ZR2A 4P72C 1E24A 4HVCA 2A8EA 3M4PA 4CH3A 1BBWA 2ODRD 4P3PA 3VQYA 1SESA 2CJ9A 4P74C 4XTZA 4XU1A 3ERRA 3IG2A 4AH6A 4EX5A 3HRIA 5ELNA 1WLEA 3REXA 4KQEA 4RQEA 3P8VA 2DU5A 1ASYA 3HY0A 3MF1A 3TUPA 1WYDA 4TVYA 2DU7A 2ZINA 2DTOA 4OP0A 4BW9A 3VBBA 5K1XA 4HA8A 3L1AA 1FYFA 4XTVA 1B7YA 3HXUA 2DVEA 3IKMB 2CGHA 1B7YB 2XTIA 4TQFA 3EFRA 4CS2A 4XTXA 3RKYA 4LVMA 4RQFA 2HNIA 2ZT6A 2ZR3A 4P71A 4WF2A 4CH4A 1B70A 5F5WA 1NNHA 2Q7HA 3RIRA 2ZZGA 1KMNA 4KR2A 2C7IA 4UP9A 3A5ZA 1B8AA 4HWRA 4YRJA 1SERA 3OD1A 4YREA 1NJ8A 3PZCA 2RHSA 4Q6GA 3QO8A 1Z7NA 4NCXA 1H4VB 3TEGA 2QHVA 3RUXA 2RHSB 2QHSA 4LVJA 4HWOA 3HXZA 4DQ2A 3WQZA 2RHQB 4WJ3M 4YCVA 4YRKA 4OLFA 2ODRC 1EOVA 1E22A
chains in the Genus database with same CATH topology
4H2UA 4G84A 1ADYA 4L87A 4PHCA 1BIAA 1QF6A 2DXTA 3UGTA 3QO7A 1EQRA 1X56A 1NJ1A 4H02A 3P8TA 5E3IA 4P75C 3BJUA 2J3LA 4BWAA 12ASA 1C0AA 1BIBA 5HGQA 1HC7A 1Z7MA 2Q7EA 4P73A 2ARSA 1G51A 2PMEA 2QHUA 4LVKA 2ZTGA 2DZ9A 1YFSA 2E41A 1EVLA 2EJGA 3IALA 4G85A 4UP7A 3NELA 1B76A 3RKWA 1YFTA 2AMCA 2DJZA 3V8KA 4XTUA 2AMCB 4YP0A 4XEMA 3QTCA 4XU3A 4YCUA 4YRPA 4HWTA 2ZT5A 4TVAA 3HRKA 4TVAB 1USYC 3E9HA 1WNLA 3HXXA 1X55A 1X2GA 1NYQA 1ADJA 3DSQA 1EIYA 2AKWA 4RMFA 5KNNA 1JJCA 4YRFA 4YRCA 1EIYB 1QE0A 1WU7A 1JJCB 4P72A 4K86A 4PG3A 1EFWA 5ELOA 4CS3A 4H2VA 1B70B 4P74A 2CJAA 3L4GA 2Q7GA 4CH6A 2IY5A 4ZIBA 4K88A 3L4GB 2FYKA 4XEOA 3V7SA 2IY5B 1H4TA 1SETA 4YRRA 4RDXA 2ZNIA 1HXDA 3MEYA 3RACA 3E9IA 3MF2A 3A31A 3HXWA 1ASZA 3I7FA 3HFVA 1YB3A 2DXUA 2ZZFA 3QO5A 1E1TA 1YGBA 2DZCA 3NEMA 3MQZA 1SRYA 2DTHA 3HTZA 4YDQA 3VQWA 3RL6A 2DDZA 4P3OA 3VQVA 4H2TA 4YYEA 2QHTA 2ZZEA 3HY1A 2ARTA 2EAYA 2ALYA 1X2HA 3NETA 3IKLA 1LYLA 2ALYB 4LVIA 1N9WA 3NENA 3BFMA 1YFRA 2XGTA 1IL2A 4J15A 1X01A 5C52B 2DQ3A 4YRSA 4YRNA 3V8JA 4YRQA 2I4LA 2DTIA 3EFSA 3ICAA 3REUA 3A5YA 4CH5A 1WPYA 1WQWA 1VQZA 3TEHA 4EO4A 3A7AA 4H2WA 3VQXA 3A7RA 4XTWA 2EL9A 2PMFA 3A74A 3LSSA 4CS4A 4E51A 2DEQA 4TWAA 4P71C 3LSQA 4YPFA 4YRGA 4XTYA 2Q5HA 4K87A 4HWPA 2DKGA 4WJ4A 4HT4A 3RF1A 4P75A 4XU2A 1NJ5A 4ZTZB 2P5IA 4TQDA 3RGLA 4ZTUB 3W3SA 2ZIMA 1WQ7A 3PCOA 1EVKA 1E1OA 2ZT7A 3PCOB 2AKWB 4WI1A 2E1HA 4YRMA 1KOGA 2EWNA 3RKXA 1ATIA 3R07A 3HXYA 4P3NA 3HXVA 3CMQA 4UPAA 1NJ2A 1G5IA 4H2XA 2I4OA 1KMMA 4H2XB 4UP8A 2CIMA 2EJFA 1NYRA 4YRLA 3P8YA 5C51B 4P73C 4YRIA 1W66A 2E64A 3UFGA 3A7UA 4TVWA 3KFUA 1X54A 2ZXFA 2G4CA 1USYA 3V8LA 4LVLA 4TTVA 5C53B 2I4NA 3UH0A 1G5HA 2E5AA 2DQ0A 1H4QA 2C8MA 4Q15A 2ZNJA 3FJPA 2RHQA 3QNEA 2CJBA 2I4MA 4LNSA 3HFZA 2E65A 3M4QA 3V7CA 1L0WA 3HFZB 1PYSA 4H2SA 3V7RA 4YRTA 4YROA 1PYSB 3UGQA 4HWSA 2EJ9A 2ZCEA 4O2DA 3A32A 3L2ZA 1RIQA 4XU0A 2ZGWA 2P0LA 3LC0A 1BBUA 1HTTA 1GGMA 11ASA 2ARUA 4H2YA 4YCWA 3G1ZA 1J5WA 2NS6A 3TEHB 1H4SA 1NJ6A 2ZIOA 5K1PA 2J3MA 4X5OA 2ZT8A 2E3CA 4KR3A 4DPGA 2E10A 2Q5IA 2ZR2A 4P72C 1E24A 4HVCA 2A8EA 3M4PA 4CH3A 1BBWA 2ODRD 4P3PA 3VQYA 1SESA 2CJ9A 4P74C 4XTZA 4XU1A 3ERRA 3IG2A 4AH6A 4EX5A 3HRIA 5ELNA 1WLEA 3REXA 4KQEA 4RQEA 3P8VA 2DU5A 1ASYA 3HY0A 3MF1A 3TUPA 1WYDA 4TVYA 2DU7A 2ZINA 2DTOA 4OP0A 4BW9A 3VBBA 5K1XA 4HA8A 3L1AA 1FYFA 4XTVA 1B7YA 3HXUA 2DVEA 3IKMB 2CGHA 1B7YB 2XTIA 4TQFA 3EFRA 4CS2A 4XTXA 3RKYA 4LVMA 4RQFA 2HNIA 2ZT6A 2ZR3A 4P71A 4WF2A 4CH4A 1B70A 5F5WA 1NNHA 2Q7HA 3RIRA 2ZZGA 1KMNA 4KR2A 2C7IA 4UP9A 3A5ZA 1B8AA 4HWRA 4YRJA 1SERA 3OD1A 4YREA 1NJ8A 3PZCA 2RHSA 4Q6GA 3QO8A 1Z7NA 4NCXA 1H4VB 3TEGA 2QHVA 3RUXA 2RHSB 2QHSA 4LVJA 4HWOA 3HXZA 4DQ2A 3WQZA 2RHQB 4WJ3M 4YCVA 4YRKA 4OLFA 2ODRC 1EOVA 1E22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2U A;  4G84 A;  1ADY A;  4L87 A;  4PHC A;  1BIA A;  1QF6 A;  2DXT A;  3UGT A;  3QO7 A;  1EQR A;  1X56 A;  1NJ1 A;  4H02 A;  3P8T A;  5E3I A;  4P75 C;  3BJU A;  2J3L A;  4BWA A;  12AS A;  1C0A A;  1BIB A;  5HGQ A;  1HC7 A;  1Z7M A;  2Q7E A;  4P73 A;  2ARS A;  1G51 A;  2PME A;  2QHU A;  2ZTG A;  2DZ9 A;  1YFS A;  2E41 A;  1EVL A;  2EJG A;  3IAL A;  4G85 A;  4UP7 A;  3NEL A;  1B76 A;  3RKW A;  1YFT A;  2AMC A;  2DJZ A;  3V8K A;  4XTU A;  2AMC B;  4YP0 A;  4XEM A;  3QTC A;  4XU3 A;  4YCU A;  4YRP A;  4HWT A;  2ZT5 A;  4TVA A;  3HRK A;  4TVA B;  1USY C;  3E9H A;  1WNL A;  3HXX A;  1X55 A;  1X2G A;  1NYQ A;  1ADJ A;  3DSQ A;  1EIY A;  2AKW A;  4RMF A;  5KNN A;  1JJC A;  4YRF A;  4YRC A;  1EIY B;  1QE0 A;  1WU7 A;  1JJC B;  4P72 A;  4K86 A;  4PG3 A;  1EFW A;  5ELO A;  4CS3 A;  4H2V A;  1B70 B;  4P74 A;  2CJA A;  3L4G A;  2Q7G A;  4CH6 A;  2IY5 A;  4ZIB A;  4K88 A;  3L4G B;  2FYK A;  4XEO A;  3V7S A;  2IY5 B;  1H4T A;  1SET A;  4YRR A;  4RDX A;  2ZNI A;  1HXD A;  3MEY A;  3RAC A;  3E9I A;  3MF2 A;  3A31 A;  3HXW A;  1ASZ A;  3I7F A;  3HFV A;  1YB3 A;  2DXU A;  2ZZF A;  3QO5 A;  1E1T A;  1YGB A;  2DZC A;  3NEM A;  1SRY A;  2DTH A;  3HTZ A;  4YDQ A;  3VQW A;  3RL6 A;  2DDZ A;  4P3O A;  3VQV A;  4H2T A;  4YYE A;  2QHT A;  2ZZE A;  3HY1 A;  2ART A;  2EAY A;  2ALY A;  1X2H A;  3NET A;  3IKL A;  1LYL A;  2ALY B;  1N9W A;  3NEN A;  3BFM A;  1YFR A;  2XGT A;  1IL2 A;  4J15 A;  1X01 A;  5C52 B;  2DQ3 A;  4YRS A;  4YRN A;  3V8J A;  4YRQ A;  2I4L A;  2DTI A;  3EFS A;  3ICA A;  3REU A;  3A5Y A;  4CH5 A;  1WPY A;  1WQW A;  1VQZ A;  3TEH A;  4EO4 A;  3A7A A;  4H2W A;  3VQX A;  3A7R A;  4XTW A;  2EL9 A;  2PMF A;  3A74 A;  3LSS A;  4CS4 A;  4E51 A;  2DEQ A;  4TWA A;  4P71 C;  3LSQ A;  4YPF A;  4YRG A;  4XTY A;  2Q5H A;  4K87 A;  4HWP A;  2DKG A;  4WJ4 A;  3RF1 A;  4P75 A;  4XU2 A;  1NJ5 A;  4ZTZ B;  2P5I A;  4TQD A;  3RGL A;  4ZTU B;  3W3S A;  2ZIM A;  1WQ7 A;  3PCO A;  1EVK A;  1E1O A;  2ZT7 A;  3PCO B;  2AKW B;  4WI1 A;  2E1H A;  4YRM A;  1KOG A;  2EWN A;  3RKX A;  1ATI A;  3R07 A;  3HXY A;  4P3N A;  3HXV A;  3CMQ A;  4UPA A;  1NJ2 A;  1G5I A;  4H2X A;  2I4O A;  1KMM A;  4H2X B;  4UP8 A;  2CIM A;  2EJF A;  1NYR A;  4YRL A;  3P8Y A;  5C51 B;  4P73 C;  4YRI A;  1W66 A;  2E64 A;  3UFG A;  3A7U A;  4TVW A;  3KFU A;  1X54 A;  2ZXF A;  2G4C A;  1USY A;  3V8L A;  4TTV A;  5C53 B;  2I4N A;  3UH0 A;  1G5H A;  2E5A A;  2DQ0 A;  1H4Q A;  2C8M A;  4Q15 A;  2ZNJ A;  3FJP A;  2RHQ A;  3QNE A;  2CJB A;  2I4M A;  4LNS A;  3HFZ A;  2E65 A;  3M4Q A;  3V7C A;  1L0W A;  3HFZ B;  1PYS A;  4H2S A;  3V7R A;  4YRT A;  4YRO A;  1PYS B;  3UGQ A;  4HWS A;  2EJ9 A;  2ZCE A;  4O2D A;  3A32 A;  3L2Z A;  1RIQ A;  4XU0 A;  2ZGW A;  2P0L A;  3LC0 A;  1BBU A;  1HTT A;  1GGM A;  11AS A;  2ARU A;  4H2Y A;  4YCW A;  3G1Z A;  1J5W A;  3TEH B;  1H4S A;  1NJ6 A;  2ZIO A;  5K1P A;  2J3M A;  4X5O A;  2ZT8 A;  2E3C A;  4KR3 A;  4DPG A;  2E10 A;  2Q5I A;  2ZR2 A;  4P72 C;  1E24 A;  4HVC A;  3M4P A;  4CH3 A;  1BBW A;  2ODR D;  4P3P A;  3VQY A;  1SES A;  2CJ9 A;  4P74 C;  4XTZ A;  4XU1 A;  3ERR A;  3IG2 A;  4AH6 A;  4EX5 A;  3HRI A;  5ELN A;  1WLE A;  3REX A;  4KQE A;  4RQE A;  3P8V A;  2DU5 A;  1ASY A;  3HY0 A;  3MF1 A;  3TUP A;  1WYD A;  4TVY A;  2DU7 A;  2ZIN A;  2DTO A;  4OP0 A;  4BW9 A;  3VBB A;  5K1X A;  4HA8 A;  3L1A A;  1FYF A;  4XTV A;  1B7Y A;  3HXU A;  2DVE A;  3IKM B;  2CGH A;  1B7Y B;  2XTI A;  4TQF A;  3EFR A;  4CS2 A;  4XTX A;  3RKY A;  4RQF A;  2HNI A;  2ZT6 A;  2ZR3 A;  4P71 A;  4WF2 A;  4CH4 A;  1B70 A;  5F5W A;  1NNH A;  2Q7H A;  3RIR A;  2ZZG A;  1KMN A;  4KR2 A;  2C7I A;  4UP9 A;  3A5Z A;  1B8A A;  4HWR A;  4YRJ A;  1SER A;  3OD1 A;  4YRE A;  1NJ8 A;  3PZC A;  2RHS A;  4Q6G A;  3QO8 A;  1Z7N A;  4NCX A;  1H4V B;  3TEG A;  2QHV A;  3RUX A;  2RHS B;  2QHS A;  4HWO A;  3HXZ A;  4DQ2 A;  3WQZ A;  2RHQ B;  4WJ3 M;  4YCV A;  4YRK A;  4OLF A;  2ODR C;  1EOV A;  1E22 A; 
#chains in the Genus database with same CATH topology
 4H2U A;  4G84 A;  1ADY A;  4L87 A;  4PHC A;  1BIA A;  1QF6 A;  2DXT A;  3UGT A;  3QO7 A;  1EQR A;  1X56 A;  1NJ1 A;  4H02 A;  3P8T A;  5E3I A;  4P75 C;  3BJU A;  2J3L A;  4BWA A;  12AS A;  1C0A A;  1BIB A;  5HGQ A;  1HC7 A;  1Z7M A;  2Q7E A;  4P73 A;  2ARS A;  1G51 A;  2PME A;  2QHU A;  4LVK A;  2ZTG A;  2DZ9 A;  1YFS A;  2E41 A;  1EVL A;  2EJG A;  3IAL A;  4G85 A;  4UP7 A;  3NEL A;  1B76 A;  3RKW A;  1YFT A;  2AMC A;  2DJZ A;  3V8K A;  4XTU A;  2AMC B;  4YP0 A;  4XEM A;  3QTC A;  4XU3 A;  4YCU A;  4YRP A;  4HWT A;  2ZT5 A;  4TVA A;  3HRK A;  4TVA B;  1USY C;  3E9H A;  1WNL A;  3HXX A;  1X55 A;  1X2G A;  1NYQ A;  1ADJ A;  3DSQ A;  1EIY A;  2AKW A;  4RMF A;  5KNN A;  1JJC A;  4YRF A;  4YRC A;  1EIY B;  1QE0 A;  1WU7 A;  1JJC B;  4P72 A;  4K86 A;  4PG3 A;  1EFW A;  5ELO A;  4CS3 A;  4H2V A;  1B70 B;  4P74 A;  2CJA A;  3L4G A;  2Q7G A;  4CH6 A;  2IY5 A;  4ZIB A;  4K88 A;  3L4G B;  2FYK A;  4XEO A;  3V7S A;  2IY5 B;  1H4T A;  1SET A;  4YRR A;  4RDX A;  2ZNI A;  1HXD A;  3MEY A;  3RAC A;  3E9I A;  3MF2 A;  3A31 A;  3HXW A;  1ASZ A;  3I7F A;  3HFV A;  1YB3 A;  2DXU A;  2ZZF A;  3QO5 A;  1E1T A;  1YGB A;  2DZC A;  3NEM A;  3MQZ A;  1SRY A;  2DTH A;  3HTZ A;  4YDQ A;  3VQW A;  3RL6 A;  2DDZ A;  4P3O A;  3VQV A;  4H2T A;  4YYE A;  2QHT A;  2ZZE A;  3HY1 A;  2ART A;  2EAY A;  2ALY A;  1X2H A;  3NET A;  3IKL A;  1LYL A;  2ALY B;  4LVI A;  1N9W A;  3NEN A;  3BFM A;  1YFR A;  2XGT A;  1IL2 A;  4J15 A;  1X01 A;  5C52 B;  2DQ3 A;  4YRS A;  4YRN A;  3V8J A;  4YRQ A;  2I4L A;  2DTI A;  3EFS A;  3ICA A;  3REU A;  3A5Y A;  4CH5 A;  1WPY A;  1WQW A;  1VQZ A;  3TEH A;  4EO4 A;  3A7A A;  4H2W A;  3VQX A;  3A7R A;  4XTW A;  2EL9 A;  2PMF A;  3A74 A;  3LSS A;  4CS4 A;  4E51 A;  2DEQ A;  4TWA A;  4P71 C;  3LSQ A;  4YPF A;  4YRG A;  4XTY A;  2Q5H A;  4K87 A;  4HWP A;  2DKG A;  4WJ4 A;  4HT4 A;  3RF1 A;  4P75 A;  4XU2 A;  1NJ5 A;  4ZTZ B;  2P5I A;  4TQD A;  3RGL A;  4ZTU B;  3W3S A;  2ZIM A;  1WQ7 A;  3PCO A;  1EVK A;  1E1O A;  2ZT7 A;  3PCO B;  2AKW B;  4WI1 A;  2E1H A;  4YRM A;  1KOG A;  2EWN A;  3RKX A;  1ATI A;  3R07 A;  3HXY A;  4P3N A;  3HXV A;  3CMQ A;  4UPA A;  1NJ2 A;  1G5I A;  4H2X A;  2I4O A;  1KMM A;  4H2X B;  4UP8 A;  2CIM A;  2EJF A;  1NYR A;  4YRL A;  3P8Y A;  5C51 B;  4P73 C;  4YRI A;  1W66 A;  2E64 A;  3UFG A;  3A7U A;  4TVW A;  3KFU A;  1X54 A;  2ZXF A;  2G4C A;  1USY A;  3V8L A;  4LVL A;  4TTV A;  5C53 B;  2I4N A;  3UH0 A;  1G5H A;  2E5A A;  2DQ0 A;  1H4Q A;  2C8M A;  4Q15 A;  2ZNJ A;  3FJP A;  2RHQ A;  3QNE A;  2CJB A;  2I4M A;  4LNS A;  3HFZ A;  2E65 A;  3M4Q A;  3V7C A;  1L0W A;  3HFZ B;  1PYS A;  4H2S A;  3V7R A;  4YRT A;  4YRO A;  1PYS B;  3UGQ A;  4HWS A;  2EJ9 A;  2ZCE A;  4O2D A;  3A32 A;  3L2Z A;  1RIQ A;  4XU0 A;  2ZGW A;  2P0L A;  3LC0 A;  1BBU A;  1HTT A;  1GGM A;  11AS A;  2ARU A;  4H2Y A;  4YCW A;  3G1Z A;  1J5W A;  2NS6 A;  3TEH B;  1H4S A;  1NJ6 A;  2ZIO A;  5K1P A;  2J3M A;  4X5O A;  2ZT8 A;  2E3C A;  4KR3 A;  4DPG A;  2E10 A;  2Q5I A;  2ZR2 A;  4P72 C;  1E24 A;  4HVC A;  2A8E A;  3M4P A;  4CH3 A;  1BBW A;  2ODR D;  4P3P A;  3VQY A;  1SES A;  2CJ9 A;  4P74 C;  4XTZ A;  4XU1 A;  3ERR A;  3IG2 A;  4AH6 A;  4EX5 A;  3HRI A;  5ELN A;  1WLE A;  3REX A;  4KQE A;  4RQE A;  3P8V A;  2DU5 A;  1ASY A;  3HY0 A;  3MF1 A;  3TUP A;  1WYD A;  4TVY A;  2DU7 A;  2ZIN A;  2DTO A;  4OP0 A;  4BW9 A;  3VBB A;  5K1X A;  4HA8 A;  3L1A A;  1FYF A;  4XTV A;  1B7Y A;  3HXU A;  2DVE A;  3IKM B;  2CGH A;  1B7Y B;  2XTI A;  4TQF A;  3EFR A;  4CS2 A;  4XTX A;  3RKY A;  4LVM A;  4RQF A;  2HNI A;  2ZT6 A;  2ZR3 A;  4P71 A;  4WF2 A;  4CH4 A;  1B70 A;  5F5W A;  1NNH A;  2Q7H A;  3RIR A;  2ZZG A;  1KMN A;  4KR2 A;  2C7I A;  4UP9 A;  3A5Z A;  1B8A A;  4HWR A;  4YRJ A;  1SER A;  3OD1 A;  4YRE A;  1NJ8 A;  3PZC A;  2RHS A;  4Q6G A;  3QO8 A;  1Z7N A;  4NCX A;  1H4V B;  3TEG A;  2QHV A;  3RUX A;  2RHS B;  2QHS A;  4LVJ A;  4HWO A;  3HXZ A;  4DQ2 A;  3WQZ A;  2RHQ B;  4WJ3 M;  4YCV A;  4YRK A;  4OLF A;  2ODR C;  1EOV A;  1E22 A; 
#chains in the Genus database with same CATH homology
 4H2U A;  4G84 A;  1ADY A;  4L87 A;  4PHC A;  1BIA A;  1QF6 A;  2DXT A;  3UGT A;  3QO7 A;  1EQR A;  1X56 A;  1NJ1 A;  4H02 A;  3P8T A;  5E3I A;  4P75 C;  3BJU A;  2J3L A;  4BWA A;  12AS A;  1C0A A;  1BIB A;  5HGQ A;  1HC7 A;  1Z7M A;  2Q7E A;  4P73 A;  2ARS A;  1G51 A;  2PME A;  2QHU A;  4LVK A;  2ZTG A;  2DZ9 A;  1YFS A;  2E41 A;  1EVL A;  2EJG A;  3IAL A;  4G85 A;  4UP7 A;  3NEL A;  1B76 A;  3RKW A;  1YFT A;  2AMC A;  2DJZ A;  3V8K A;  4XTU A;  2AMC B;  4YP0 A;  4XEM A;  3QTC A;  4XU3 A;  4YCU A;  4YRP A;  4HWT A;  2ZT5 A;  4TVA A;  3HRK A;  4TVA B;  1USY C;  3E9H A;  1WNL A;  3HXX A;  1X55 A;  1X2G A;  1NYQ A;  1ADJ A;  3DSQ A;  1EIY A;  2AKW A;  4RMF A;  5KNN A;  1JJC A;  4YRF A;  4YRC A;  1EIY B;  1QE0 A;  1WU7 A;  1JJC B;  4P72 A;  4K86 A;  4PG3 A;  1EFW A;  5ELO A;  4CS3 A;  4H2V A;  1B70 B;  4P74 A;  2CJA A;  3L4G A;  2Q7G A;  4CH6 A;  2IY5 A;  4ZIB A;  4K88 A;  3L4G B;  2FYK A;  4XEO A;  3V7S A;  2IY5 B;  1H4T A;  1SET A;  4YRR A;  4RDX A;  2ZNI A;  1HXD A;  3MEY A;  3RAC A;  3E9I A;  3MF2 A;  3A31 A;  3HXW A;  1ASZ A;  3I7F A;  3HFV A;  1YB3 A;  2DXU A;  2ZZF A;  3QO5 A;  1E1T A;  1YGB A;  2DZC A;  3NEM A;  3MQZ A;  1SRY A;  2DTH A;  3HTZ A;  4YDQ A;  3VQW A;  3RL6 A;  2DDZ A;  4P3O A;  3VQV A;  4H2T A;  4YYE A;  2QHT A;  2ZZE A;  3HY1 A;  2ART A;  2EAY A;  2ALY A;  1X2H A;  3NET A;  3IKL A;  1LYL A;  2ALY B;  4LVI A;  1N9W A;  3NEN A;  3BFM A;  1YFR A;  2XGT A;  1IL2 A;  4J15 A;  1X01 A;  5C52 B;  2DQ3 A;  4YRS A;  4YRN A;  3V8J A;  4YRQ A;  2I4L A;  2DTI A;  3EFS A;  3ICA A;  3REU A;  3A5Y A;  4CH5 A;  1WPY A;  1WQW A;  1VQZ A;  3TEH A;  4EO4 A;  3A7A A;  4H2W A;  3VQX A;  3A7R A;  4XTW A;  2EL9 A;  2PMF A;  3A74 A;  3LSS A;  4CS4 A;  4E51 A;  2DEQ A;  4TWA A;  4P71 C;  3LSQ A;  4YPF A;  4YRG A;  4XTY A;  2Q5H A;  4K87 A;  4HWP A;  2DKG A;  4WJ4 A;  4HT4 A;  3RF1 A;  4P75 A;  4XU2 A;  1NJ5 A;  4ZTZ B;  2P5I A;  4TQD A;  3RGL A;  4ZTU B;  3W3S A;  2ZIM A;  1WQ7 A;  3PCO A;  1EVK A;  1E1O A;  2ZT7 A;  3PCO B;  2AKW B;  4WI1 A;  2E1H A;  4YRM A;  1KOG A;  2EWN A;  3RKX A;  1ATI A;  3R07 A;  3HXY A;  4P3N A;  3HXV A;  3CMQ A;  4UPA A;  1NJ2 A;  1G5I A;  4H2X A;  2I4O A;  1KMM A;  4H2X B;  4UP8 A;  2CIM A;  2EJF A;  1NYR A;  4YRL A;  3P8Y A;  5C51 B;  4P73 C;  4YRI A;  1W66 A;  2E64 A;  3UFG A;  3A7U A;  4TVW A;  3KFU A;  1X54 A;  2ZXF A;  2G4C A;  1USY A;  3V8L A;  4LVL A;  4TTV A;  5C53 B;  2I4N A;  3UH0 A;  1G5H A;  2E5A A;  2DQ0 A;  1H4Q A;  2C8M A;  4Q15 A;  2ZNJ A;  3FJP A;  2RHQ A;  3QNE A;  2CJB A;  2I4M A;  4LNS A;  3HFZ A;  2E65 A;  3M4Q A;  3V7C A;  1L0W A;  3HFZ B;  1PYS A;  4H2S A;  3V7R A;  4YRT A;  4YRO A;  1PYS B;  3UGQ A;  4HWS A;  2EJ9 A;  2ZCE A;  4O2D A;  3A32 A;  3L2Z A;  1RIQ A;  4XU0 A;  2ZGW A;  2P0L A;  3LC0 A;  1BBU A;  1HTT A;  1GGM A;  11AS A;  2ARU A;  4H2Y A;  4YCW A;  3G1Z A;  1J5W A;  2NS6 A;  3TEH B;  1H4S A;  1NJ6 A;  2ZIO A;  5K1P A;  2J3M A;  4X5O A;  2ZT8 A;  2E3C A;  4KR3 A;  4DPG A;  2E10 A;  2Q5I A;  2ZR2 A;  4P72 C;  1E24 A;  4HVC A;  2A8E A;  3M4P A;  4CH3 A;  1BBW A;  2ODR D;  4P3P A;  3VQY A;  1SES A;  2CJ9 A;  4P74 C;  4XTZ A;  4XU1 A;  3ERR A;  3IG2 A;  4AH6 A;  4EX5 A;  3HRI A;  5ELN A;  1WLE A;  3REX A;  4KQE A;  4RQE A;  3P8V A;  2DU5 A;  1ASY A;  3HY0 A;  3MF1 A;  3TUP A;  1WYD A;  4TVY A;  2DU7 A;  2ZIN A;  2DTO A;  4OP0 A;  4BW9 A;  3VBB A;  5K1X A;  4HA8 A;  3L1A A;  1FYF A;  4XTV A;  1B7Y A;  3HXU A;  2DVE A;  3IKM B;  2CGH A;  1B7Y B;  2XTI A;  4TQF A;  3EFR A;  4CS2 A;  4XTX A;  3RKY A;  4LVM A;  4RQF A;  2HNI A;  2ZT6 A;  2ZR3 A;  4P71 A;  4WF2 A;  4CH4 A;  1B70 A;  5F5W A;  1NNH A;  2Q7H A;  3RIR A;  2ZZG A;  1KMN A;  4KR2 A;  2C7I A;  4UP9 A;  3A5Z A;  1B8A A;  4HWR A;  4YRJ A;  1SER A;  3OD1 A;  4YRE A;  1NJ8 A;  3PZC A;  2RHS A;  4Q6G A;  3QO8 A;  1Z7N A;  4NCX A;  1H4V B;  3TEG A;  2QHV A;  3RUX A;  2RHS B;  2QHS A;  4LVJ A;  4HWO A;  3HXZ A;  4DQ2 A;  3WQZ A;  2RHQ B;  4WJ3 M;  4YCV A;  4YRK A;  4OLF A;  2ODR C;  1EOV A;  1E22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...