2E1HA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111g mutation
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
225
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 225
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e1hA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e1hA01
4M78E 2RHQB 4TQFA 3LSSA 1USYC 3BJUA 4M75G 3SB2A 3E9HA 4TVAB 2E10A 4WI1A 1L0WA 4PJOC 3IKLA 5LJ5d 3RF1A 1I81A 4TQDA 1G5IA 4YRQA 2DU5A 4YRMA 1KOGA 2RHSA 4HVCA 2DJZA 4PJOF 4H2XA 4M7AB 4YRTA 5GMKj 4JUVA 4Q15A 1B34B 1KQ2A 3EFSA 4DQ2A 1EQRA 2AKWB 4C8QB 4TVWA 4XU2A 4PNOA 4F7UA 3GIBA 4M75D 4M7AC 3RERA 3HRIA 5GAMf 3HRKA 5LJ5j 5DY9A 4RQEA 4C92A 4XU0A 1IL2A 4M7DA 3NETA 2DTIA 4M7AF 5GAN4 2EJ9A 5GANf 5C53B 4UPAA 4J6XA 2EL9A 2ZZEA 1VQZA 4HT8A 2E41A 3NEMA 1E24A 2C8MA 3BDUA 5ELNA 4EMGA 3HFNA 4CH3A 4M7AG 1EVLA 2ZT5A 4RMFA 3QO5A 3JCMQ 4PJOD 4C8QC 2P0LA 2DTOA 1U1SA 3PGGA 1X2GA 4K87A 3MF1A 2Q5IA 4P3OA 3HXVA 1NJ2A 3E9IA 4F7UE 4C8QF 4M77B 5HGQA 2EJGA 4RQFA 3CMQA 3JB9G 1H4QA 3RKWA 1EFWA 4C92E 2CGHA 3RKXA 2ODRC 1EIYA 4M7AD 4YREA 3L2ZA 3RIRA 1BBWA 4RCCA 2QTXA 5LJ3f 4BWAA 4P71C 3PZCA 1WNLA 4EMKB 5GAN7 2DXUA 2C7IA 1BIBA 5LJ5g 1HK9A 4M78A 3QNEA 1H4VB 1WLEA 2EAYA 3V8KA 5I21A 3JB9D 4BW9A 2YHTA 4M77C 4ZIBA 1YCYA 5GAN6 2PMFA 5K1PA 1X56A 2RHSB 4RCBA 3JCMh 4X9DA 4H2XB 3JCMP 4C8QD 1I5LA 4J6WA 2FYKA 4XU1A 4XTYA 4G85A 4EMHA 4YP0A 1WYDA 3M4GA 3VQVA 3ICAA 2DXTA 3FB9A 1H641 5GMKi 1WPYA 4YRNA 4NOYA 4M77G 3IG2A 4M7DB 2ODRD 5GAOq 4KQEA 2IY5A 5GAOn 4CS2A 4H2UA 2ZR3A 4YRSA 4YCVA 3BW1A 2DQ3A 1H4SA 2PMEA 4YYEA 1ASYA 1D3BA 4UP7A 4MMLA 2QHSA 4YRLA 3JCMX 3A7AA 4YRJA 3LC0A 1SESA 5GAN8 1YFTA 5GAMh 3FIFA 5GAOp 3JCMb 4EX5A 2K57A 1NJ5A 1GGMA 3L1AA 2CIMA 2ZNIA 5GANh 4M77D 1H4TA 1BBUA 2ZIOA 2J3MA 1WQWA 5CAIA 5LJ5f 2ZT7A 4P73A 4P3PA 4CH6A 4C92C 4M7DC 4YRGA 3QO7A 1I4K1 4K88A 4X5OA 3UH0A 1EIYB 3JCMc 4P72A 3RGLA 1BIAA 4HWPA 5GAN2 4LNSA 1B70A 4RDXA 4QVCA 4F7UG 1LNXA 5GAOm 2QHUA 4A54A 2CJAA 3P8YA 4PJOA 4C92G 4M7DG 1QF6A 4OP0A 4M78B 3HFZA 3QHSA 4J5YA 3QO8A 3A5YA 4H02A 1JJCB 3DSQA 3LSQA 5K1XA 5GANd 5LJ3h 3REUA 3UGQA 4M75E 1JRIA 3ERRA 4CS3A 3JB9F 1NJ6A 3JCMe 2ZNJA 3A5ZA 5ELOA 1X54A 1E1TA 1Y96B 4JLIA 4CH4A 4WF2A 3JB9I 4P74A 1B7YA 1ADJA 2RHQA 1FYFA 4CH5A 4M7DD 5C51B 1B8AA 4XU3A 1X55A 4TVAA 4TWAA 3A31A 4N0AA 3IKMB 1Z7MA 4KR3A 2DQ0A 4YCWA 2IY5B 4M78C 4PJOE 3RESA 2AMCA 1D3BB 1MGQA 4HA8A 1B34A 1RIQA 5LJ3d 2ZZFA 2HNIA 5GAMe 4YROA 4YRPA 1QE0A 2XGTA 5GMKm 3TUPA 2E1HA 3RUXA 3A7UA 2DTHA 5GANe 1LOJA 4M78G 3V8LA 3MF2A 4HWRA 4ZTZB 2VXFA 3HFOA 4M7AE 4G84A 3JB9H 3NELA 2Q7GA 1YFSA 3VQXA 4NCXA 4M77F 3V7SA 5GAN3 1ATIA 5GAOl 2DKGA 3I7FA 3UFGA 5GMKh 4HT9A 2ZR2A 4KR2A 4F7UB 3NENA 4YCUA 4UP8A 5GAN5 5LJ3j 4Q6GA 4XTUA 2Q5HA 3KFUA 1EOVA 4XTVA 1B70B 1NJ1A 1M5Q1 4C92B 3WQZA 4V2SA 4MMKA 2I4OA 3VQWA 1G5HA 3VBBA 1WQ7A 2ZZGA 4M78D 4Y91A 1LJOA 3HY0A 4C8QE 4UP9A 3HFZB 2ZGWA 3HXZA 5GANg 1WU7A 1Z7NA 3HXWA 1PYSA 4P73C 2E65A 4YDQA 5LJ3e 3JCMd 4P3NA 4NL3A 2DU7A 2ARSA 3A7RA 12ASA 4H2VA 2EJFA 2I4NA 2DZCA 2I2LA 4P75A 2YLCA 4M75A 1JBMA 4WJ4A 4JRKA 1NNHA 3TEHA 4EMKA 4F7UF 1X01A 2FB7A 2ALYA 4PHCA 4L87A 2RB6A 1E22A 3W3SA 3SWNA 3RKYA 2RD1A 3R07A 4YRFA 3UGTA 2P5IA 2ZTGA 2Q7EA 3JCMV 1N9SA 4X9CA 4JRIA 4C92F 4M7DF 2QHVA 3P8TA 5GMKl 2ARUA 3QO3A 1HC7A 1USYA 3HSBA 4XEMA 2AMCB 2JN0A 4M77E 3HTZA 4YRRA 1HTTA 2DZ9A 5KNNA 1SETA 4K86A 4O2DA 5LJ3g 4TTVA 1SERA 5GAMd 4HWTA 2ZIMA 3M4QA 3RACA 3M4PA 1LYLA 5C52B 11ASA 4CS4A 1M8VA 3HXXA 4P74C 4PJOG 3REXA 3A74A 1W66A 3PCOA 3L4GA 3V7RA 5GAOr 4XEOA 3HXUA 4N0AC 4XTWA 3HFVA 2J3LA 1KMNA 4YPFA 3AHUA 4M7AA 2I4LA 5GMKe 4WJ3M 5GAMj 4H2TA 4C92D 3VQYA 3HY1A 2EWNA 1B76A 2G4CA 3TEGA 5GANj 4J15A 1J5WA 4HWSA 2DDZA 3QSUA 1NJ8A 5LJ5e 1HXDA 3A32A 1G51A 4XTXA 4XQ3A 2CJBA 1YGBA 2E5AA 1E1OA 1YFRA 3G1ZA 4H2YA 4AH6A 4OLFA 1NYQA 2E3CA 3QTCA 4M78F 3OD1A 1YB3A 4DPGA 3BY7A 2I4MA 3V8JA 1PYSB 3JCMg 2VXEA 2AKWA 4PG3A 4C8QA 4NL2A 5F5WA 4YRIA 4YRKA 1ADYA 3VU3C 4M7DE 2QHTA 3V7CA 1NYRA 1I8FA 3JB9J 1N9WA 4ZTUB 4C8QG 1ASZA 1SRYA 3EFRA 4M75B 2CJ9A 2ZINA 3INZA 3TEHB 3JCMJ 2ALYB 1X2HA 4QVDA 4H2SA 1KQ1A 2RM4A 3SWNB 5E3IA 3IALA 4XTZA 3QUIA 4H2WA 4A53A 2Q7HA 4P71A 2ZXFA 1JJCA 1TH7A 1C0AA 1U1TA 4J6YA 1N9RA 2YLBA 5LJ5h 2ZT6A 2XTIA 5GAMg 4EO4A 2DEQA 2E64A 3P8VA 1Y96A 4PJOB 3JCMW 3HXYA 4M77A 4P75C 2ARTA 3BFMA 4M75C 2VC8A 2ZCEA 2ZT8A 2DVEA 3RL6A 1EVKA 4EMKC 2Y90A 3PCOB 3SWNC 3L4GB 4HWOA 4M75F 2RA2A 4YRCA 4E51A 3MEYA 4P72C 4TVYA 3FJPA 1KMMA 3JCMf 1B7YB
chains in the Genus database with same CATH superfamily
2PVOB 1O9SA 2KE9A 5CKHA 1USYC 2BE9B 2M1HA 4M75G 2HQEA 5KH6A 3OW2P 2NWMA 4WI1A 1W4SA 1I81A 1OULA 2DU5A 1PKSA 2DJZA 2RJEA 1TUCA 1ZSGA 2LQNA 1K8AR 4PFPA 3OYNA 1YJWA 3PTAA 3VS2A 4YRTA 2JMAA 3OBYA 2E12A 3QBYA 1VQ7T 3URGA 2L3PA 1A0NB 1YI2T 1NEGA 2ECZA 4E7KA 4M7AC 3RERA 3C95A 3TEEA 2CP5A 4WTOB 1LCKA 3G7ZA 3CCJQ 2LCLA 2NYSA 3VS3A 3HTRA 2YRCA 2EJ9A 2F1LA 5GANf 3LX7A 5C53B 2FVUA 2EL9A 4LD9K 1VQ8A 2ZZEA 2E41A 1MV0B 2PZ1A 2RJDA 3NEMA 2E3HA 3BDUA 5CK9A 2KEAA 4M7AG 1NPRA 4LUEA 5J3BA 1IHVA 5IAYA 3CCJA 4JPBW 4KGXB 3JCMQ 4FYVB 4C8QC 1JB0E 1UGSB 1D0ZA 2DTOA 3CC7T 2VB6A 5FU6C 1J3TA 5KE2A 1NJ2A 3G6ET 4M77B 3GP8A 3HKSA 4FT2A 4ANJA 2QXFA 2X9HA 3N5BB 4QQGA 1EFWA 2FL7A 2OAWA 3RKXA 2JS2A 4R55A 5HK0A 2MI6A 1EIYA 1HD3A 2O9VA 1V76A 4BDYA 1BBWA 4Z8AA 1YJNT 4BWAA 4AFZC 1Q82U 3EG0A 3CCVQ 5KE3A 1RAEB 1YFNA 2DXUA 1WIEA 2ED1A 3VRYA 3OS5A 3UF4A 3CCRA 3C12A 2ESWA 1WLEA 4BY6C 1GFCA 1OV3A 5I21A 1VQOQ 1VQ5Q 4RCBA 2RI3A 3LH5A 2H3JA 3RMQA 4H2XB 2QASA 1ABOA 2DE0X 3GBQA 3OW2S 3MQZA 4XU1A 4XTYA 2JXBA 1M3AA 3CPWP 1TTHB 1VYVA 5D7UA 3ASKA 1WYDA 3HRUA 3MP8A 3M4GA 1T3LA 2LNHB 1T0HA 3FB9A 3ICAA 1G83A 4JZ3A 4FW1A 4OMPA 3VKIA 5A0LA 4DEXA 1OX9A 1WPYA 1TU0B 4B9WA 3IG2A 4OMOA 4ME7A 1AWWA 4CS2A 3M54A 2ZR3A 1W2BS 4YCVA 2IG0A 4FYYB 1BBZA 2KVQG 1YBYA 1ASYA 1D3BA 2CP3A 2JJ9A 2X4WA 3LC0A 1SESA 1VIEA 1YFTA 1UG1A 1YITQ 3ER0A 3LYIA 1BI1A 2XD0A 4PK4A 3G4SA 2KMTA 1Q81U 4LVKA 2GFUA 1KJWA 5GANh 1ZHIA 2ZIOA 1Q7YR 2OTJQ 4J83A 3ME9A 4P3PA 2V8IA 3WVDB 2L8DA 5A0GA 4M7DC 4FU6A 3QO7A 1YITA 2JT4A 2OTLQ 2LX9A 4RDXA 2ROTA 4F7UG 4IIMA 5GAOm 4DA4A 3QDFA 1JQQA 5KYWA 1ZLMA 1XJWB 2GF7A 4M7DG 2V26A 2RHYA 3X20B 3A5YA 3EGDB 1UHFA 1JJ2A 3LSQA 3CCLQ 4JZ4A 5I2SA 2QK0A 3UGQA 2A08A 4EPCA 3S6WA 3ZL7C 3JCMe 2ZNJA 3CPFA 1Y0MA 2DXBA 5ELOA 2P0PA 2QQAA 2DXCA 1VQ4T 1JO8A 4JLIA 2ZPIB 2F2XA 5IT9E 1PHTA 4QT7A 3CCLA 1BI2A 2A36A 4CH5A 1B8AA 5CIUA 1NPPA 1KC8U 1AZEA 1WHMA 4RG8A 4AFUC 5A2QE 1D1CA 3CPWS 3CC7Q 4HCCA 2COWA 3CCUQ 2HAXA 2BKDN 2RHZA 2E5QA 1XOVA 1NBEB 2K7AA 5FU7C 3VYHB 2HNIA 2CP6A 3GF5A 2XU8A 4XAXB 1FMWA 3RUXA 2HEQA 2DTHA 4KH0B 3OS2A 4ZTZB 5IHKA 2CYZB 3JB9H 2Q7GA 1YFSA 3VQXA 1AVZC 4FIBA 2IIMA 1RLQC 5GAN3 3V7SA 1ATIA 2DKGA 2RHIA 3UFGA 3S3MA 4HT9A 4RTXA 4KR2A 3CCMQ 2RH2A 2JM9A 1WGSA 5LJ3j 4XTUA 1RAIB 1M1FA 1K0XA 1B70B 2JUFA 3OYJA 2YT6A 1AWXA 4D6WA 1NJ1A 1G5HA 1NLOC 2ZZGA 4M78D 3J7AF 4E2FB 5KYYA 2HL5C 3CCMA 3MEVA 3HFZB 2EPDA 5GANg 1MMNA 3M56A 4YDQA 2C06A 2DBMA 5LJ3e 3UA7A 4LVLA 1KSWA 2B86A 4KH1B 4NL3A 1K9MU 4OB1B 4RMOA 5CCAA 2CREA 5GJWB 2DZCA 2COYA 3MO8A 4P75A 2YLCA 3GNFB 4LDXA 1JBMA 3JAME 2CT4A 2V8KA 2L5QA 4EMKA 4L87A 1WX6A 2BE7D 4RTWA 3W3SA 1OZ2A 2RQWA 1UFFA 1SKUB 2VV5A 1Y71A 2SEMA 2DAQA 5KYUA 2XHCA 2ARUA 3CCQA 4ZTJA 1VQKT 4XEMA 2A28A 3T9NA 1YJ9T 3QWYA 5KNNA 4TTVA 1SERA 4OMLA 2EIFA 2ZIMA 3OYAA 1NE8A 3A8GB 1LYLA 2O88A 2EQUA 2ATCB 1M8VA 2HD0A 2AT1B 3VS5A 3THKA 1AWOA 1QCNA 1C6VX 1ZSZC 3L4GA 4XEOA 2LT1A 2FRWA 2LC4A 2X3WD 2RPNA 2NS6A 2J3LA 1KMNA 1UJYA 2EGCA 1R0CB 4JJDA 4H2TA 2V1RA 3HY1A 2XK0A 1B76A 3VS7A 3X25B 2X4JA 2QI2A 2DDZA 1WXUA 1K8AC 2RQVA 2KXCA 2QAZA 2B8AA 3A32A 1YWOA 1OEBA 2DL5A 3MEAA 4XTXA 1G3TA 3CCEQ 1VQLQ 4J9IA 2FZCB 3G1ZA 4H2YA 1AHJB 4E7ZA 4IUUA 4D8DA 4OMNA 1TOVA 4E7SA 2GQVA 3D7SB 4J7FA 4DOWA 2F5KA 5F5WA 2VXEA 2LX7A 1VYUA 5J39A 2QHTA 1G3YA 2V1QA 2VGNA 3TCJA 2EYWA 1SHGA 3CCEA 4ZTUB 1VQLA 5GJVB 1ZBXA 2EFIA 2K6DA 2KRNA 3CBMA 3JCMJ 2ALYB 1M4ZA 2RHXA 2JTFA 4ATOA 3QUIA 1VQPQ 2W10A 2LP5A 4JLGA 1C1AA 4JJNK 3HL8A 2DLPA 2F2VA 1C0AA 2FPDA 2OJ2A 1ZBJA 1QQJA 3FRNA 3M59A 4JRPA 5GAMg 5KYWB 1Y07A 1Y7XA 2ROLA 2JTEA 1Y96A 2FO0A 1VQPA 1G5VA 1T3SA 1ZA1B 5KCOA 2X4XA 1U06A 4M77A 2ARTA 1RAAB 3UPUA 2ZT8A 2DVEA 3MKDA 2EGAA 2L0AA 5IN1A 2H8HA 4JJCA 3EAEA 1PKTA 2DERA 3H9NA 3OMGA 2LJ1A 3H41A 1WHKA 1YIJQ 4OB2B 4M78E 4Z88A 5DM7R 2QQRA 2L3QA 4C5GA 1KQSP 2CZ6B 3BJUA 2EYZA 3E9HA 2C0OA 1EFNA 1QP2A 4PJOC 4TQDA 3H0HA 2QGFB 3PMIA 1K4US 4YRMA 1YIJA 3C0CA 3DB3A 3TSZA 3CCJT 4H2XA 1M1KC 5GMKj 2MCNA 2LRQA 4TVWA 4XU2A 3UA6A 1QVFS 4PNOA 4M75D 4C0ZA 2LZ6B 3HRIA 2LT4A 5LJ5j 5DY9A 1AOJA 3EH1A 2MMPA 3Q1JA 3UT1A 1AD5A 2K79A 3MEUA 1RAGB 2KQWA 2LQ8A 4UPAA 2MAMA 2A0FB 4QQDA 1TS9A 1VQZA 2I0NA 4CI0C 2C8MA 3EG3A 5ELNA 2ABLA 1E7OA 4EMGA 3HFNA 2EQMA 1EVLA 4CC2A 4R0KA 2PQWA 1Q7YC 2DFUA 2GTOA 4KBMB 5FRMA 3PGGA 1QCFA 3PT9A 3LWIA 4FT4A 2Q5IA 1BI0A 4MZTA 4E7IA 3HXVA 2CUDA 3E9IA 3CCVT 4PJNA 2HSEB 1V29B 2PUKB 3CMQA 3OYHA 5I22A 2D8JA 5LL6S 3I55A 1WLPB 1UE9A 4M7AD 2OAUA 1VQOT 1N6AA 4RTYA 1VQ5T 4P71C 2OX7A 1UJ0A 2E5KA 1WNLA 3BE3A 4EMKB 1QP3A 2VWFA 2YSQA 2C7IA 1FXXA 1ABQA 1HK9A 3SDZA 3M0PA 3I56A 2Y4XA 2RQUA 3GNGA 4Y92A 1QVGA 2V8JA 5KYUB 3EG9B 4ZIBA 3CD6A 2RQTA 3TSWA 4C8QD 3JCMP 2M0OA 2ZPBB 2G6FX 5L8RE 1UGVA 3F70A 2XDBA 4TVRA 2M16A 2AZVA 1N27A 2DXTA 3CMAQ 1QWFA 1NJIR 4HCZA 4NOYA 1YITT 4YRNA 5GAOn 2JTMA 3DKMA 4PFZA 4YRSA 1QW1A 4JS5A 1U5SA 1H4SA 2PMEA 4YYEA 4MDXA 2OTJT 4MMLA 3JCMX 3CMAA 1YJWQ 3A7AA 4ZGEB 2X35A 1GCPA 3ZBDA 2K3XA 3FIFA 4JDSA 3JCMb 2O31A 3EG1A 1FMKA 2LTOA 1GGMA 3PFSA 3L1AA 2CIMA 2OI3A 2OTLT 5LJ5f 4A4FA 2BIVA 2ZT7A 1C0MA 2KXDA 8AT1B 4WCIA 4ORZA 3RNJA 4K88A 2WSEE 1W2BP 1VQ8Q 3CBOA 3LWHA 3JCMc 3RGLA 3EFOB 5KYXA 1UGQB 1B70A 3CCLT 4BD3A 3NTHA 2A7YA 3MP1A 2ED0A 1ACMB 3VUZA 2AK5A 2QHUA 4A54A 2VASA 1QF6A 4LDUA 3HFZA 4M78B 2D1XA 3QO8A 4H02A 4KGZB 4E7JA 3S3NA 3REUA 3SFMA 4HXJA 1BU1A 4M75E 3A98A 2EW3A 1YN8A 3JB9F 4FCYA 2E6ZA 1G3SA 2VUBA 1WJRA 5DLOA 1I1JA 1X54A 1Y96B 2CP7A 2CSQA 1ZQ1A 1I0CA 4GY5A 4J9BA 3CCUT 3JB9I 3OYIA 3DLLA 4BE2A 4QVZA 2C0IA 4M7DD 4IUTA 4TWAA 1X55A 1R8OB 4OB0B 3CCRQ 4JRQA 3I5SA 4TVAA 4F17A 3IKMB 1Z7MA 1X2QA 2DVJA 2P4RA 2DYBA 5AT1B 2YDLA 2IY5B 2RF0A 1JJ2P 1QCOA 3M57A 4ZGJB 4BI3A 1E6HA 1MNEA 3MCAB 4HA8A 4BI8B 5LJ3d 3VS0A 5GAMe 4LDWA 5IHNA 4YRPA 3CCMT 3CXCA 2IVWA 1X6BA 2E1HA 1ZUKA 2CZ7B 3V8LA 4HWRA 2VXFA 2K9GA 3HFOA 4M7AE 2HQHA 2HBWA 3M0RA 1D1AA 4M77F 1I07A 2YUNA 1WFWA 3MPUB 2CP2A 4UC4A 5GMKh 3NENA 1M1KR 1W6XA 4Q6GA 3E9FA 1EOVA 4XTVA 3SEMA 1K8AU 4V2SA 4MMKA 1WXTA 4KUIA 2EQKA 2I4OA 1OPKA 2XIDA 3M9QA 3G4SQ 1TUDA 3VBBA 3OW2A 3VRZA 2COZA 1NLPC 1WJSA 1TG0A 4C8QE 3HY0A 3H0IA 3PE0A 4N4GA 1R77A 2FPFA 1Z7NA 2J06A 3UATA 4J9FA 4FL6A 4C0DB 1GCQA 2DO3A 4H2VA 2DYIA 3A5ZB 1PRLC 1YHQQ 1D0XA 2P4TA 2SRCA 3MHXA 2XMFA 1NNHA 4RUGA 1BYMA 4LE9A 2ALYA 3RKYA 3O8VA 2ZTGA 2Q7EA 1UB4A 2O2OA 2E4HA 1CKAA 4Y28E 3CMEA 2AIRB 4MZMA 1YHQA 3QO3A 1HC7A 1WYXA 2AMCB 3R6OA 3HTZA 1MHNA 2DA9A 2W0ZA 3OA6A 4K86A 1CKBA 3SHWA 3RACA 2PU9B 4Z89A 1JJ2S 3HXXA 1W66A 4MDWA 1UTIA 5HCKA 4QW2A 2A8EA 4YPFA 3AHUA 3CCET 1VQLT 1NEBA 1KHCA 1M90R 1M1GA 1KD1C 3C4SA 4C92D 5CKFA 2LJ0A 2QQSA 2QYZA 2G4CA 2AKKA 2LQWA 4HWSA 4A4HA 1NJ8A 4PJLA 3M0TA 1OU9A 1HXDA 2DBKA 2R57A 4XQ3A 3L2VA 2E5AA 1E1OA 1BK2A 4AH6A 4OLFA 1NYQA 1NZ9A 1V1CA 3BY7A 2CP0A 2I4MA 3V8JA 1PYSB 2ZPFB 4NL2A 4B9XA 5CQXA 1VQPT 1Q86C 3NFCA 4M7DE 3V7CA 1NYRA 2XICA 1VUBA 4PKCC 1N9WA 1QVPA 1IB8A 3RMSA 1R0BG 2MPXC 2KNBB 2LNVA 4M75B 2KK4A 2ZINA 3TEHB 4JS4A 4KT0E 1M3BA 4QVDA 3IQLA 3SWNB 5E3IA 3IALA 4XTZA 4A53A 5KYXB 1TH7A 3GOXA 1Q7YU 1U1TA 1N9RA 2MOXA 1WHJA 2ZT6A 1BI3A 1SEMA 2DIGA 4EO4A 4ELYC 2X51A 1VYTA 3JCMW 2GCXA 1HYOA 1YIJT 4P75C 4DOVA 3TREA 2VC8A 3QG1A 3H8ZA 4QKUA 1B07A 2K3BA 1K73R 3RL6A 4EMKC 1RL2A 2VVKA 2Y90A 3PCOB 4M75F 5IHIA 2F2WA 1WJQA 2KGTA 4E51A 3MEYA 4P72C 1RAHB 3CCQQ 3FJPA 4TVYA 3QWXX 2HSPA 2DMOA 4M7AB 3JCMf 2YXYA 4TQFA 5M9OA 1X43A 2DETA 4CC4B 4TVAB 1L0WA 1ZX6A 3KFVA 3E9GA 3OYLA 4AFQC 5LJ5d 3IKLA 4PLIA 3RF1A 3M0SA 3L42A 1SSFA 3EG9A 1KOGA 4HKEA 1UHCA 1GRIA 2J05A 1QKWA 3QJYA 1FYNA 2J6FA 2D8HA 2CZ1B 1NYFA 2LMJA 4E47A 1KQ2A 2CKKA 4DQ2A 2PVDB 4OB3B 1N8RR 1NJIC 4C8QB 2HDAA 5FWCA 3GIBA 1OPLA 5FU6B 3KXTA 1N5ZA 2QQBA 5AYFA 4RQEA 4C92A 1IL2A 3EHRA 3NETA 4M7AF 3A8HB 5GAN4 4J6XA 4FYWB 4HT8A 1E24A 1OOTA 3M55A 4RMFA 1D09B 3HP9A 4PJOD 2P0LA 4PLLA 1QVFP 4RTUA 2HCKA 1X2GA 3NTIA 2WSFE 4K87A 4P3OA 4ZN1A 4C8QF 1M2VA 4HCKA 4RQFA 3JB9G 5CKEA 1H4QA 3RKWA 2JOYA 4C92E 3OYKA 2ODRC 1YP5A 4YREA 3RIRA 4BE1A 3EFOA 4RCCA 2QTXA 5LJ3f 3A8LB 3G71Q 3CCSQ 1M3CA 2HQXA 2E6NA 4ZTFA 1GFDA 5GAN7 3VUBA 4PFOA 2D0QB 2Y4YA 1VIFA 1WA7A 1BIBA 4M78A 3QNEA 1H4VB 2EAYA 2DL8A 4RTZA 3G71A 3CMAT 4M77C 1YCYA 5GAN6 3CCSA 2PMFA 1X56A 2RHSB 3I5RA 1BCMA 3JCMh 4X9DA 2C0TA 1G3WA 1I5LA 4IURA 4A63B 1PSEA 3ZEHA 4J6WA 1VQ9Q 2QA4Q 1YCSB 4EMHA 4YP0A 3OYDA 4EIKA 1P92A 4R56A 1YJWT 1W70A 1TUGB 4RTVA 4FSSA 5GMKi 4M77G 4M7DB 4KQEA 2IY5A 4J9CA 4H2UA 1VQ9A 4IIOA 2QA4A 1QVGP 3BW1A 1T0JA 2D6FA 1AZGB 2GGRA 4UP7A 3QKJA 1JXMA 2QHSA 1OZ3A 4YRJA 2QG9B 4RG2A 4GLKA 3H6ZA 1IZ6A 2IPOB 2EGEA 2R5AA 1VQ8T 1KD1R 2K57A 1WZOA 5KCHA 4C5HA 2DD5A 1S72Q 1H4TA 1BBUA 2J3MA 1WQWA 1Q95G 2HKQB 4J9EA 2X3XD 4P73A 1SRLA 2KROA 4YRGA 4AG1C 3OS1A 1H8KA 1I4K1 4X5OA 3HRTA 3UH0A 1D0YA 1S72A 4QVCA 1LNXA 3QZ5B 4PL6A 1Q86R 4CRIA 4LN2A 5I2MA 2K5FA 4PJOA 3TU4K 4J5YA 2O9SA 2FPEA 5K1XA 3KBGA 2E70A 5LJ3h 3CCRT 5FU7B 2O4XA 3ERRA 4CS3A 2NUPA 1RACB 4BE0A 1NJ6A 3I55Q 2DILA 3A5ZA 1E1TA 2YRDA 2RI2A 4CH4A 2HMAA 4P74A 1RADB 1ADJA 2RHQA 3UWNA 3H0FA 1FYFA 1VQKA 1Y57A 4N0AA 3I56Q 4KR3A 1YJ9A 4Z02A 4OMQA 1TSFA 2DQ0A 3CC4Q 3M0QA 5CR2A 3CD6Q 4OGEA 4PJOE 3OSSC 1MUZA 2KRSA 2DL7A 2AMCA 2RK2A 2RQRA 2RHUA 3J81E 1PC0A 1B34A 4B6MA 2ZZFA 1OI1A 1WI7A 3CC2Q 3NMZC 3EHQA 2XGTA 2FG0A 3CC4A 1QVGS 4O6JA 1K9MC 5GANe 3MF2A 1LOJA 4X34A 2EYXA 4HVWA 1H3HA 2R5MA 2LCSA 4G84A 1QKXA 3NELA 1M90C 1KFZA 3FC3A 3G4ST 1X6GA 4OMFB 3I7FA 4DEYA 1UUEA 3TVTA 2ZR2A 3CC2A 2KR3A 3J80E 4RKUE 1SSHA 1MNDA 3KFUA 2CZ0B 3RR6A 2DJQA 1M5Q1 4C92B 3META 4E7LA 2XDPA 4X1VA 2VYTA 4F16A 1KQSA 3VQWA 1WQ7A 1PD0A 4Y91A 1LJOA 1X2KA 1YHQT 1MV3A 3HXZA 3ZFJA 1Q82R 1PG5B 1PYSA 2E65A 3JCMd 1PSFA 5IXBA 2M02A 4P3NA 2ARSA 3A7RA 5CQYA 2EJFA 2I2LA 2ZPEB 3NTKA 4M75A 1VQNQ 2K3YA 2RNAA 3PIPA 1M2VB 3TEHA 4M4ZA 1X01A 2FB7A 3FDRA 1ZSZB 2RB6A 5D6XA 1E22A 3SWNA 1HJDA 3R07A 3QZ9B 3UGTA 2P5IA 2L89A 4IUVA 2QGGA 4C92F 3P8TA 1VQMQ 4A4GA 5GMKl 1VQNA 2DL3A 4BI4A 4AFSC 4FM4B 1Z9QA 3HSBA 4J9HA 1USYA 3LGFA 2F5TX 1HTTA 1JU5C 1SETA 4O2DA 5LJ3g 4KULA 1K73C 2KY9A 3GLXA 3OMCA 2YUQA 1K9AA 1VQMA 3REXA 2LQKA 4CC7A 2BTTA 4LVMA 3PCOA 3V7RA 3L2UA 5GAOr 2CS7A 2CH4W 2KT1A 4XTWA 2ZZDA 2P0QA 1Q81R 4M7AA 2I4LA 4BB7A 1KIKA 3AT1B 4LXCA 4WJ3M 5GAMj 4O5VA 5FW9A 2L2PA 3VQYA 2EWNA 4D8KA 1CSKA 2DPPB 4HCBA 1RLPC 3QIIA 1J5WA 3EGXB 4J15A 3QSUA 1FMVA 4J8OA 2AZSA 1G51A 2CJBA 1X75C 4FW2A 1N8RC 3P8HA 2E3CA 4M78F 1NJIU 3OD1A 4DPGA 1PRMC 8ATCB 4DBHA 2AHJB 4PG3A 4K11A 1G8XA 4C8QA 3OY9A 4OMMA 1RI0A 2PVGB 4L6V5 2DF6A 3CXCS 2DRKA 4A4EA 3JB9J 2K5LA 4C8QG 1SRYA 3EFRA 2CJ9A 1PM3A 3INZA 3E1SA 4FSXA 3HRSA 4H2SA 3OYBA 5D6WA 2WACA 4H2WA 2RN8A 3OS0A 2Q7HA 2ZXFA 1JJCA 2JNGA 4F14A 2EBPA 1RABB 3M58A 4J6YA 1E6GA 4IUPA 5LJ5h 3CCVA 3VV0A 1GBRA 1KC8R 2E3IA 2XI9A 2E64A 3P8VA 1GCQC 4PJOB 2KRMA 3CCQT 3HXYA 1AWJA 2WSCE 2GNCA 3BFMA 1VQOA 1G2BA 4OGCA 4N4IA 1VQ5A 4LVJA 2O4XB 2F69A 2NUPB 4YRCA 2HZYA 2FHDA 3JSCA 3MEWA 2JMCA 2QQ9A 1TXQA 3CMEQ 1W2BA 1IREB 2YWWA 3A8MB 1KMMA 3OSVA 1I5OB 4HVVA 4N4HA 2JW4A 1X69A 4BUGA 4E6RA 2RHQB 2KT8A 1JXOA 2MWPA 3A1PA 2NUTA 2QEXQ 3LSSA 1KHIA 1RI9A 2M0YA 3SB2A 2E10A 1X27A 2EYYA 4GBQA 1W1FA 1PWTA 1SF9A 1K1ZA 1SG5A 1G5IA 4YRQA 7AT1B 6AT1B 2MWOA 2FZKB 1VQ6Q 2RHSA 2HBPA 4HVCA 4PJOF 2M9UA 2QEXA 3QXEB 4MZPA 4JUVA 4Q15A 5I11A 1B34B 3EFSA 1EQRA 2AKWB 2KDSA 2CDTA 2GBQA 2LCCA 4F7UA 3QPHA 1RUWA 2KAFA 2ZCFB 3DLMA 5GAMf 1BCOA 1VQ6A 3HRKA 1FX7A 2MIOA 3HPWA 2OTJA 4XU0A 4BDZA 4M7DA 2DTIA 4LUDA 1K9MR 2MF2A 1ZUUA 1VQ7Q 4LVIA 1KK7A 1EZZB 1PNJA 1YI2Q 3S3OA 1M27C 1SRMA 2FZGB 4KUDK 2D9TA 1D1BA 1EX4A 1NM7A 4QQ6A 2OTLA 2ZT5A 4CH3A 3QO5A 1GBQA 4HVUA 4A4KA 1U1SA 1VOMA 1Z9ZA 1VQ7A 2EQJA 3MF1A 1PCXA 4RTTA 3G71T 1YI2A 1M1KU 3CCST 4PJMA 4F7UE 1OX8A 2CT3A 5HGQA 2EJGA 3FEOA 2GQIA 5CO7A 3X26B 5DLQE 4ZN3A 2CUBA 2XDDA 2CGHA 1IGUA 2PNIA 3I9QA 1PD1A 3OYYA 3CPWA 3L2ZA 4ZGDB 3VS1A 4Q5WA 3UDCA 3PZCA 3G6EQ 4L59A 2D0NA 2BUDA 4LD6A 2M51A 2BZXA 3LLRA 1VQ9T 2LVMA 3CBPA 2QA4T 5LJ5g 1UGRB 1IGQA 3V8KA 4L5GA 3CC7A 1BKBA 3JB9D 3CCUA 4BW9A 2YHTA 1QWEA 1YJNQ 5K1PA 3G6EA 3E19A 4NS5A 2LDMA 2FYKA 5FLXE 4G85A 2J6OA 1M30A 4AMCA 3A8OB 2DEUA 3REAB 3VQVA 1YJNA 2YRVA 2FEIA 2YUOA 3WXMB 1H641 2ODRD 2EQIA 5GAOq 4GLMA 4ZNXA 5CVIA 5IXFA 2DQ3A 3EG2A 1S72T 2MYSA 1H3ZA 2LJ3A 4C5IA 2ZAEA 4DBQA 4YRLA 1VA7A 3OYMA 2KYBA 2NLUA 5GAN8 2CSIA 2ENMA 5GAMh 2A3LA 5GAOp 1NG2A 4EX5A 5CKBA 1NJ5A 3R6NA 2ZNIA 4M77D 2BZYA 1M90U 1H92A 5CAIA 2K4YA 3OQ5A 1IO6A 3REBB 1MMDA 3DB4A 4CH6A 4C92C 2VGMA 4PJJA 2RO0A 2K2VA 5HY6A 1ZUYA 1EIYB 1YWPA 2RI5A 4P72A 3OB9A 1BIAA 4HWPA 3JRZA 5GAN2 4LNSA 2R58A 3PNWC 2HKNA 3QYGB 1SPKA 4EDUA 3PMTA 3RDVA 1Q82C 3I55T 3P8YA 3VYGA 3OYFA 2CJAA 4C92G 2VKNA 4OP0A 2KBTA 3QHSA 1OQKA 3M5AA 1JJCB 3DSQA 5GANd 3C94A 2X4YA 1B3QA 5C6SA 4BACA 1JRIA 2K2MA 3I56T 1ZA2B 1XTDA 2DK3A 3OBWA 3CC4T 3BDLA 4VUBA 5IH2A 4BY6B 3CD6T 4DBFA 5KYNA 4WF2A 1B7YA 2RJFA 5J26A 1HSQA 1ZSZA 2DX1A 5C51B 4XU3A 1WDXA 3A31A 3OYCA 3M0UA 5EG2A 3CC2T 4YCWA 1UGPB 3FJ5A 2JVVA 4M78C 2K5IA 1VQ4Q 5CKDA 5A0DA 3RESA 3VJPA 1D3BB 1MGQA 1IXDA 1XNIA 2NUTB 1K73U 2PUOB 2DM1A 2FRYA 1XQHA 4P5NA 1LVKA 1RIQA 3LGLA 3NPFA 2JM8A 5D6YA 4C0GA 1S1NA 4YROA 1QE0A 4IKFA 9ATCB 1WHGA 5GMKm 3EH2A 4OVAA 3TUPA 2P0KA 3GPLA 3U23A 3L2QA 1VQ4A 2DIQA 3A7UA 2EKOA 2AKLA 1Q81C 4M78G 3OYGA 4F04B 2ZPGB 2JS0A 3L2WA 2ZPHB 4NCXA 1TWBA 5GAOl 1MMGA 5FWBA 3OYEA 4F7UB 3P8DA 4YCUA 4UP8A 5GAN5 2A37A 5EC7A 2Q5HA 1NYGA 1OU8A 3FLGA 3WQZA 2EVRA 3EGXA 4YTLA 1N8RU 1EIFA 5HKCA 1IHWA 4UP9A 1VQNT 2ZGWA 3E2UA 1UEBA 3NHNA 1K0SA 1OYXA 2DRMA 3MJXA 2L3SA 1WU7A 3EGUA 3HXWA 4P73C 3I35A 3LW5E 1M8MA 3O5ZA 4KRTA 4LDYA 1U8RA 2J6KA 2DU7A 2NUZA 2MK5A 12ASA 2I4NA 1VQMT 3PIOA 1UDLA 1O75A 4OF1A 3JV3A 4WJ4A 4JRKA 5FROA 4F7UF 2CH4A 4PHCA 2RD1A 4YRFA 1M9SA 3JCMV 1N9SA 3ULRB 4X9CA 4JRIA 3VS4A 1KC8C 4M7DF 2YUPA 2QHVA 2DNUA 4ESRA 1MMAA 3PVLA 4FYXB 2JN0A 1GXIE 4M77E 3M53A 4YRRA 2DZ9A 4J7IA 1SHFA 3KUFA 4C0DC 5GAMd 4HWTA 4HT4A 3WVEB 1WHLA 4IUQA 3M4QA 1QVFA 3M4PA 5C52B 11ASA 4CS4A 2Z0WA 3SD4A 4P74C 4PJOG 1VQKQ 1LPLA 3A74A 5L23A 3QJ6A 1YJ9Q 4AG2C 5ECAA 3VS6A 3HXUA 4N0AC 2QTVA 3HFVA 4AT1B 2L3RA 2H3EB 2P84A 4C0FA 1DJ7B 5GMKe 3RBBB 3X28B 4DBRA 1JEGA 3TEGA 5GANj 4JJBA 1YNZA 1M2OA 2HL3A 3X24B 1X6OA 2RK1A 5LJ5e 4ELZC 1K76A 2XKOC 3MP6A 1YGBA 5KYYB 2RMOA 1YFRA 3QTCA 1YB3A 2EKHA 4CC3A 4J9GA 1IRXA 3JCMg 3TQ7P 2AKWA 2BZ8A 2QDLA 4YRIA 4YRKA 3CQTA 1AEYA 1ADYA 3QDRB 2GFAA 3VU3C 1ARKA 2DD4A 2DL4A 4C5EA 1I8FA 3CEYA 3NGPA 1ASZA 3QYHB 4LDVA 2GTJA 2XG8D 3PVQA 2J7IA 1X2HA 1KQ1A 2RM4A 4XK8E 1KD1U 2G3RA 2RJCA 1RAFB 3EGDA 4P71A 2KI7A 5C0MA 5HK3A 2KSSA 1U3OA 2YLBA 1KQSS 4II1A 2XTIA 2O01E 3L2RA 3CXCP 2DEQA 3P8BB 1QMCA 3CMET 4E7HA 1F1BB 1B7TA 3HHTB 1FWZA 4LNPA 2QDYB 4M75C 1GL5A 2ZCEA 4KGVB 2JZ2A 2QEXT 1Q86U 1EVKA 1KG1A 2EYQA 3LH0A 3SWNC 3L4GB 1UECA 4J9DA 4HWOA 2RA2A 2KYMA 3M4YA 1AT1B 2PTKA 1BB9A 1WXBA 3G1JA 1WHHA 1QLYA 5FRNA 1VQ6T 1B7YB
chains in the Genus database with same CATH topology
2PVOB 1O9SA 5CKHA 1USYC 2M1HA 4M75G 2HQEA 5KH6A 4WI1A 1W4SA 1I81A 2DU5A 2DJZA 2RJEA 1YJWA 3OYNA 4YRTA 3PTAA 3OBYA 2E12A 3QBYA 1VQ7T 3URGA 1YI2T 4E7KA 4M7AC 3RERA 3C95A 3TEEA 3G7ZA 2LCLA 2EJ9A 5GANf 5C53B 3LX7A 2FVUA 2EL9A 4LD9K 1VQ8A 2ZZEA 2E41A 2RJDA 3NEMA 3BDUA 5CK9A 4M7AG 1NPRA 5J3BA 5IAYA 3CCJA 3JCMQ 4C8QC 1JB0E 1UGSB 2DTOA 3CC7T 5FU6C 5KE2A 1NJ2A 3G6ET 4M77B 3GP8A 3HKSA 4FT2A 2QXFA 3N5BB 4QQGA 1EFWA 2FL7A 3RKXA 4R55A 5HK0A 2MI6A 1EIYA 4BDYA 1BBWA 1YJNT 4BWAA 1Q82U 5KE3A 2DXUA 3OS5A 3CCRA 3C12A 1WLEA 4BY6C 5I21A 4RCBA 2RI3A 2H3JA 3RMQA 4H2XB 3OW2S 3MQZA 4XU1A 4XTYA 3ASKA 1WYDA 3HRUA 3MP8A 3M4GA 3ICAA 3FB9A 3VKIA 5A0LA 1WPYA 4B9WA 3IG2A 4ME7A 4CS2A 3M54A 2ZR3A 1W2BS 4YCVA 2IG0A 2KVQG 1YBYA 1ASYA 1D3BA 2X4WA 3LC0A 1SESA 1VIEA 1YFTA 3ER0A 3LYIA 1BI1A 2XD0A 3G4SA 2KMTA 1Q81U 4LVKA 2GFUA 5GANh 1ZHIA 2ZIOA 4J83A 3ME9A 4P3PA 2V8IA 3WVDB 2L8DA 5A0GA 4M7DC 4FU6A 3QO7A 1YITA 2LX9A 4RDXA 4F7UG 5GAOm 4DA4A 4M7DG 2GF7A 2RHYA 3X20B 3A5YA 1JJ2A 3LSQA 5I2SA 3UGQA 4EPCA 3S6WA 2ZNJA 3JCMe 3CPFA 2DXBA 5ELOA 2P0PA 2QQAA 2DXCA 1VQ4T 4JLIA 2ZPIB 5IT9E 3CCLA 1BI2A 4CH5A 1B8AA 5CIUA 1NPPA 1KC8U 4RG8A 5A2QE 3CPWS 4HCCA 2HAXA 2BKDN 2RHZA 2E5QA 1XOVA 5FU7C 3VYHB 2HNIA 3GF5A 2XU8A 4XAXB 3RUXA 2DTHA 3OS2A 4ZTZB 2CYZB 3JB9H 2Q7GA 1YFSA 3VQXA 4FIBA 5GAN3 3V7SA 1ATIA 2DKGA 2RHIA 3UFGA 3S3MA 4HT9A 4KR2A 2RH2A 1WGSA 5LJ3j 4XTUA 1M1FA 1B70B 2JUFA 3OYJA 4D6WA 1NJ1A 1G5HA 2ZZGA 4M78D 3J7AF 3CCMA 3MEVA 3HFZB 5GANg 3M56A 4YDQA 2C06A 5LJ3e 4LVLA 4NL3A 1K9MU 4OB1B 4RMOA 5CCAA 2DZCA 3MO8A 4P75A 2YLCA 3GNFB 4LDXA 1JBMA 3JAME 2V8KA 2L5QA 4EMKA 4L87A 3W3SA 1OZ2A 2VV5A 1Y71A 2DAQA 2XHCA 2ARUA 3CCQA 4ZTJA 1VQKT 4XEMA 3T9NA 1YJ9T 5KNNA 4TTVA 1SERA 2EIFA 2ZIMA 3OYAA 1NE8A 3A8GB 1LYLA 2EQUA 1M8VA 2HD0A 3L4GA 4XEOA 2LT1A 2LC4A 2NS6A 2J3LA 1KMNA 4H2TA 3HY1A 2XK0A 1B76A 3X25B 2X4JA 2QI2A 2DDZA 1K8AC 2B8AA 3A32A 4XTXA 3MEAA 1G3TA 3G1ZA 4H2YA 1AHJB 4IUUA 2GQVA 4J7FA 4DOWA 2F5KA 5F5WA 2VXEA 5J39A 2QHTA 1G3YA 2VGNA 3TCJA 3CCEA 4ZTUB 1VQLA 1ZBXA 2EFIA 3CBMA 3JCMJ 2ALYB 1M4ZA 2RHXA 2JTFA 4ATOA 3QUIA 4JLGA 4JJNK 3HL8A 1C0AA 3FRNA 3M59A 4JRPA 5GAMg 1Y07A 1Y7XA 1Y96A 1VQPA 1G5VA 5KCOA 2X4XA 4M77A 2ARTA 3UPUA 2ZT8A 2DVEA 5IN1A 3EAEA 3OMGA 4OB2B 4M78E 5DM7R 2QQRA 4C5GA 3BJUA 2CZ6B 3E9HA 1QP2A 4PJOC 4TQDA 3PMIA 4YRMA 1YIJA 3DB3A 3CCJT 4H2XA 1M1KC 5GMKj 2LRQA 4TVWA 4XU2A 1QVFS 4PNOA 4M75D 4C0ZA 3HRIA 2LT4A 5LJ5j 5DY9A 2MMPA 3Q1JA 3UT1A 3MEUA 2KQWA 2LQ8A 4UPAA 2MAMA 4QQDA 1VQZA 4CI0C 2C8MA 5ELNA 4EMGA 3HFNA 2EQMA 1EVLA 2PQWA 1Q7YC 4KBMB 5FRMA 3PGGA 3PT9A 3LWIA 4FT4A 2Q5IA 1BI0A 4MZTA 4E7IA 3HXVA 3E9IA 3CCVT 1V29B 2PUKB 3CMQA 3OYHA 5LL6S 3I55A 4M7AD 2OAUA 1VQOT 1N6AA 1VQ5T 4P71C 1WNLA 4EMKB 1QP3A 2C7IA 1FXXA 1HK9A 3SDZA 3I56A 2Y4XA 3GNGA 1QVGA 2V8JA 4ZIBA 3CD6A 3JCMP 4C8QD 2M0OA 2ZPBB 5L8RE 3F70A 2XDBA 4TVRA 2M16A 1N27A 2DXTA 4HCZA 4NOYA 1YITT 4YRNA 5GAOn 2JTMA 3DKMA 4YRSA 1QW1A 4JS5A 1H4SA 2PMEA 4YYEA 4MDXA 2OTJT 4MMLA 3JCMX 3CMAA 3A7AA 4ZGEB 2X35A 3ZBDA 2K3XA 3FIFA 4JDSA 3JCMb 2LTOA 1GGMA 3PFSA 3L1AA 2CIMA 2OTLT 5LJ5f 4A4FA 2BIVA 2ZT7A 4K88A 2WSEE 3CBOA 3LWHA 3JCMc 3RGLA 1UGQB 1B70A 3CCLT 4BD3A 3NTHA 2A7YA 3MP1A 3VUZA 2QHUA 4A54A 1QF6A 4LDUA 3HFZA 4M78B 3QO8A 4H02A 4E7JA 3S3NA 3REUA 3SFMA 4M75E 3JB9F 2E6ZA 1G3SA 2VUBA 1WJRA 5DLOA 1X54A 1Y96B 4GY5A 3CCUT 1ZQ1A 3JB9I 3OYIA 3DLLA 4BE2A 4QVZA 4M7DD 4IUTA 4TWAA 1X55A 1R8OB 4OB0B 4JRQA 4TVAA 3IKMB 1Z7MA 2IY5B 3M57A 4ZGJB 4BI3A 3MCAB 4HA8A 4BI8B 5LJ3d 5GAMe 4LDWA 4YRPA 3CCMT 3CXCA 2IVWA 2E1HA 2CZ7B 3V8LA 4HWRA 2VXFA 3HFOA 4M7AE 4M77F 4UC4A 5GMKh 3NENA 4Q6GA 3E9FA 1EOVA 4XTVA 1K8AU 4V2SA 4MMKA 4KUIA 2EQKA 2I4OA 2XIDA 3VBBA 3M9QA 3OW2A 1WJSA 3HY0A 4C8QE 4N4GA 1Z7NA 4FL6A 4C0DB 2DO3A 4H2VA 3A5ZB 2P4TA 3MHXA 1NNHA 2ALYA 1BYMA 3RKYA 3O8VA 2ZTGA 2Q7EA 1UB4A 4Y28E 3CMEA 4MZMA 1YHQA 3QO3A 1HC7A 2AMCB 3R6OA 3HTZA 1MHNA 3OA6A 4K86A 3RACA 2PU9B 1JJ2S 3HXXA 1W66A 4MDWA 4QW2A 2A8EA 4YPFA 3AHUA 3CCET 1VQLT 1KHCA 1M1GA 1KD1C 3C4SA 4C92D 5CKFA 2QQSA 2G4CA 4HWSA 4A4HA 1NJ8A 1HXDA 2R57A 4XQ3A 3L2VA 2E5AA 1E1OA 4AH6A 4OLFA 1NYQA 1NZ9A 3BY7A 2I4MA 3V8JA 1PYSB 2ZPFB 4NL2A 4B9XA 5CQXA 1VQPT 1Q86C 4M7DE 3NFCA 1NYRA 3V7CA 2XICA 1VUBA 4PKCC 1N9WA 1QVPA 3RMSA 2LNVA 4M75B 2KK4A 2ZINA 3TEHB 4JS4A 4KT0E 4QVDA 3SWNB 5E3IA 3IALA 4XTZA 4A53A 1TH7A 3GOXA 1Q7YU 1U1TA 1N9RA 2ZT6A 1BI3A 2DIGA 4EO4A 4ELYC 3JCMW 2GCXA 1YIJT 4P75C 4DOVA 3TREA 2VC8A 3QG1A 3H8ZA 3RL6A 4EMKC 1RL2A 2Y90A 3PCOB 4M75F 1WJQA 4E51A 3MEYA 4P72C 4TVYA 3FJPA 3JCMf 4M7AB 4TQFA 5M9OA 4TVAB 1L0WA 3E9GA 3OYLA 3IKLA 5LJ5d 4PLIA 3RF1A 3L42A 1SSFA 1KOGA 4HKEA 3QJYA 2CZ1B 4E47A 1KQ2A 2CKKA 4DQ2A 2PVDB 4OB3B 1NJIC 4C8QB 3GIBA 5FU6B 3KXTA 2QQBA 5AYFA 4RQEA 4C92A 1IL2A 3NETA 4M7AF 3A8HB 5GAN4 4J6XA 4HT8A 1E24A 3M55A 4RMFA 3HP9A 4PJOD 2P0LA 4PLLA 1X2GA 3NTIA 2WSFE 4K87A 4P3OA 4ZN1A 4C8QF 4RQFA 3JB9G 5CKEA 1H4QA 3RKWA 2JOYA 4C92E 3OYKA 2ODRC 4YREA 3RIRA 4BE1A 4RCCA 2QTXA 5LJ3f 3A8LB 2HQXA 2E6NA 4ZTFA 5GAN7 3VUBA 2Y4YA 2D0QB 1VIFA 1BIBA 4M78A 3QNEA 1H4VB 2EAYA 3G71A 3CMAT 4M77C 1YCYA 5GAN6 3CCSA 2PMFA 1X56A 2RHSB 3JCMh 4X9DA 1G3WA 1I5LA 4IURA 1PSEA 3ZEHA 4J6WA 4EMHA 4YP0A 3OYDA 1P92A 4R56A 1YJWT 5GMKi 4M77G 4M7DB 4KQEA 2IY5A 4H2UA 1VQ9A 2QA4A 3BW1A 2D6FA 4UP7A 3QKJA 2QHSA 1OZ3A 4YRJA 4RG2A 4GLKA 3H6ZA 1IZ6A 2R5AA 1VQ8T 2K57A 5KCHA 4C5HA 2DD5A 1H4TA 1BBUA 2J3MA 1WQWA 4P73A 4YRGA 3OS1A 1I4K1 4X5OA 3HRTA 3UH0A 1S72A 4QVCA 1LNXA 3QZ5B 4PL6A 4CRIA 5I2MA 2K5FA 4PJOA 3TU4K 4J5YA 5K1XA 3KBGA 2E70A 5LJ3h 3CCRT 5FU7B 2O4XA 3ERRA 4CS3A 4BE0A 1NJ6A 3A5ZA 1E1TA 2RI2A 4CH4A 4P74A 1ADJA 2RHQA 3UWNA 1FYFA 1VQKA 4N0AA 4KR3A 1YJ9A 4Z02A 2DQ0A 5CR2A 4OGEA 4PJOE 3OSSC 2AMCA 2RK2A 2RHUA 3J81E 1B34A 2ZZFA 1OI1A 2XGTA 3CC4A 1QVGS 4O6JA 1K9MC 5GANe 3MF2A 1LOJA 4X34A 2R5MA 4G84A 3NELA 1M90C 3FC3A 3G4ST 4OMFB 3I7FA 2ZR2A 3CC2A 3J80E 4RKUE 3KFUA 2CZ0B 1M5Q1 4C92B 3META 4E7LA 2XDPA 1KQSA 2VYTA 3VQWA 1WQ7A 4Y91A 1LJOA 1YHQT 3HXZA 3ZFJA 1PYSA 2E65A 3JCMd 1PSFA 4P3NA 2ARSA 3A7RA 5CQYA 2EJFA 2I2LA 2ZPEB 3NTKA 4M75A 2K3YA 3PIPA 3TEHA 1X01A 2FB7A 3FDRA 2RB6A 5D6XA 1E22A 3SWNA 3R07A 3QZ9B 3UGTA 2P5IA 2L89A 4IUVA 4C92F 3P8TA 4A4GA 5GMKl 1VQNA 4BI4A 4FM4B 1USYA 3HSBA 3LGFA 2F5TX 1HTTA 1SETA 4O2DA 5LJ3g 4KULA 1K73C 2KY9A 3GLXA 3OMCA 1VQMA 3REXA 2LQKA 4LVMA 3PCOA 3V7RA 3L2UA 5GAOr 2CS7A 4XTWA 2ZZDA 2P0QA 4M7AA 2I4LA 4BB7A 4WJ3M 5GAMj 4O5VA 3VQYA 2EWNA 2DPPB 4HCBA 4J15A 3QIIA 1J5WA 3QSUA 4J8OA 1G51A 2CJBA 1X75C 1N8RC 3P8HA 2E3CA 4M78F 1NJIU 3OD1A 4DPGA 2AHJB 4PG3A 4C8QA 3OY9A 1RI0A 2PVGB 4L6V5 3CXCS 4A4EA 3JB9J 2K5LA 4C8QG 1SRYA 3EFRA 2CJ9A 3INZA 3E1SA 4FSXA 3HRSA 4H2SA 3OYBA 5D6WA 2WACA 4H2WA 3OS0A 2Q7HA 2ZXFA 1JJCA 2JNGA 3M58A 4J6YA 4IUPA 5LJ5h 3CCVA 3VV0A 2XI9A 2E64A 3P8VA 4PJOB 3CCQT 3HXYA 2WSCE 3BFMA 1VQOA 4OGCA 4N4IA 1VQ5A 4LVJA 2O4XB 2F69A 4YRCA 2FHDA 3JSCA 3MEWA 2QQ9A 1W2BA 1IREB 3A8MB 1KMMA 3OSVA 4N4HA 4BUGA 2RHQB 2MWPA 3LSSA 1KHIA 3SB2A 2E10A 4YRQA 1G5IA 2MWOA 2RHSA 2HBPA 4HVCA 4PJOF 2M9UA 2QEXA 3QXEB 4MZPA 4JUVA 4Q15A 1B34B 3EFSA 2AKWB 1EQRA 2KDSA 2LCCA 4F7UA 3QPHA 2KAFA 2ZCFB 3DLMA 5GAMf 1VQ6A 3HRKA 1FX7A 3HPWA 2OTJA 4XU0A 4BDZA 4M7DA 2DTIA 2MF2A 4LVIA 3S3OA 4KUDK 2D9TA 2OTLA 2ZT5A 4QQ6A 4CH3A 3QO5A 4A4KA 1U1SA 1VQ7A 2EQJA 3MF1A 3G71T 1YI2A 1M1KU 3CCST 4F7UE 5HGQA 2EJGA 3FEOA 5CO7A 3X26B 5DLQE 4ZN3A 2XDDA 2CGHA 3OYYA 3CPWA 3L2ZA 4ZGDB 4Q5WA 3UDCA 3PZCA 4L59A 2BUDA 4LD6A 3LLRA 1VQ9T 2LVMA 3CBPA 2QA4T 5LJ5g 1UGRB 3V8KA 4L5GA 3CC7A 1BKBA 3JB9D 3CCUA 4BW9A 2YHTA 5K1PA 3G6EA 3E19A 4NS5A 2LDMA 2FYKA 5FLXE 4G85A 3A8OB 3VQVA 1YJNA 2YRVA 3WXMB 1H641 2ODRD 5GAOq 5CVIA 2DQ3A 1S72T 1H3ZA 4C5IA 4YRLA 3OYMA 2NLUA 5GAN8 5GAMh 2A3LA 5GAOp 4EX5A 5CKBA 1NJ5A 2ZNIA 4M77D 1M90U 5CAIA 2K4YA 3OQ5A 3DB4A 4CH6A 4C92C 2VGMA 2RO0A 2K2VA 5HY6A 1EIYB 2RI5A 4P72A 3OB9A 1BIAA 4HWPA 3JRZA 5GAN2 4LNSA 2R58A 3PNWC 3QYGB 4EDUA 3PMTA 1Q82C 3I55T 3P8YA 3VYGA 3OYFA 2CJAA 4C92G 4OP0A 3QHSA 3M5AA 1JJCB 3DSQA 5GANd 3C94A 2X4YA 5C6SA 4BACA 1JRIA 3I56T 2DK3A 1XTDA 3OBWA 3CC4T 3BDLA 4VUBA 4BY6B 3CD6T 4WF2A 1B7YA 2RJFA 5J26A 5C51B 4XU3A 3A31A 3OYCA 5EG2A 3CC2T 4YCWA 1UGPB 4M78C 2JVVA 2K5IA 5CKDA 5A0DA 3RESA 3VJPA 1D3BB 1MGQA 1XNIA 1K73U 2PUOB 4P5NA 1XQHA 1RIQA 3LGLA 5D6YA 4C0GA 4YROA 1QE0A 4IKFA 5GMKm 4OVAA 3TUPA 2P0KA 3GPLA 3L2QA 1VQ4A 2DIQA 3A7UA 2EKOA 1Q81C 4M78G 3OYGA 2ZPGB 3L2WA 2ZPHB 4NCXA 5GAOl 3OYEA 4F7UB 3P8DA 4YCUA 4UP8A 5GAN5 2Q5HA 3FLGA 3WQZA 4YTLA 1N8RU 1EIFA 5HKCA 4UP9A 1VQNT 2ZGWA 1UEBA 1OYXA 1WU7A 3HXWA 4P73C 3LW5E 4LDYA 1U8RA 2DU7A 12ASA 2I4NA 1VQMT 3PIOA 1O75A 4OF1A 4WJ4A 4JRKA 5FROA 4F7UF 4PHCA 2RD1A 4YRFA 1M9SA 3JCMV 1N9SA 4X9CA 4JRIA 1KC8C 4M7DF 2QHVA 2JN0A 1GXIE 4M77E 3M53A 4YRRA 2DZ9A 4J7IA 3KUFA 4C0DC 5GAMd 4HWTA 4HT4A 3WVEB 4IUQA 3M4QA 1QVFA 3M4PA 5C52B 11ASA 4CS4A 3SD4A 4P74C 4PJOG 3A74A 3QJ6A 3HXUA 4N0AC 3HFVA 2L3RA 4C0FA 1DJ7B 5GMKe 3X28B 3TEGA 5GANj 3X24B 1X6OA 2RK1A 5LJ5e 4ELZC 2XKOC 3MP6A 1YGBA 1YFRA 3QTCA 1YB3A 3JCMg 2AKWA 4YRIA 4YRKA 1ADYA 3QDRB 2GFAA 3VU3C 2DD4A 4C5EA 1I8FA 3CEYA 1ASZA 3QYHB 4LDVA 2XG8D 1X2HA 1KQ1A 2RM4A 4XK8E 1KD1U 2G3RA 2RJCA 4P71A 5C0MA 5HK3A 2KSSA 2YLBA 1KQSS 4II1A 2XTIA 2O01E 3L2RA 2DEQA 3P8BB 3CMET 4E7HA 3HHTB 1FWZA 2QDYB 4M75C 2ZCEA 2JZ2A 2QEXT 1Q86U 1EVKA 1KG1A 2EYQA 3LH0A 3SWNC 3L4GB 4HWOA 2RA2A 3M4YA 5FRNA 1VQ6T 1B7YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 E;  2RHQ B;  4TQF A;  3LSS A;  1USY C;  3BJU A;  4M75 G;  3SB2 A;  3E9H A;  4TVA B;  2E10 A;  4WI1 A;  1L0W A;  4PJO C;  3IKL A;  5LJ5 d;  3RF1 A;  1I81 A;  4TQD A;  1G5I A;  4YRQ A;  2DU5 A;  4YRM A;  1KOG A;  2RHS A;  4HVC A;  2DJZ A;  4PJO F;  4H2X A;  4M7A B;  4YRT A;  5GMK j;  4JUV A;  4Q15 A;  1B34 B;  1KQ2 A;  3EFS A;  4DQ2 A;  1EQR A;  2AKW B;  4C8Q B;  4TVW A;  4XU2 A;  4PNO A;  4F7U A;  3GIB A;  4M75 D;  4M7A C;  3RER A;  3HRI A;  5GAM f;  3HRK A;  5LJ5 j;  5DY9 A;  4RQE A;  4C92 A;  4XU0 A;  1IL2 A;  4M7D A;  3NET A;  2DTI A;  4M7A F;  5GAN 4;  2EJ9 A;  5GAN f;  5C53 B;  4UPA A;  4J6X A;  2EL9 A;  2ZZE A;  1VQZ A;  4HT8 A;  2E41 A;  3NEM A;  1E24 A;  2C8M A;  3BDU A;  5ELN A;  4EMG A;  3HFN A;  4CH3 A;  4M7A G;  1EVL A;  2ZT5 A;  4RMF A;  3QO5 A;  3JCM Q;  4PJO D;  4C8Q C;  2P0L A;  2DTO A;  1U1S A;  3PGG A;  1X2G A;  4K87 A;  3MF1 A;  2Q5I A;  4P3O A;  3HXV A;  1NJ2 A;  3E9I A;  4F7U E;  4C8Q F;  4M77 B;  5HGQ A;  2EJG A;  4RQF A;  3CMQ A;  3JB9 G;  1H4Q A;  3RKW A;  1EFW A;  4C92 E;  2CGH A;  3RKX A;  2ODR C;  1EIY A;  4M7A D;  4YRE A;  3L2Z A;  3RIR A;  1BBW A;  4RCC A;  2QTX A;  5LJ3 f;  4BWA A;  4P71 C;  3PZC A;  1WNL A;  4EMK B;  5GAN 7;  2DXU A;  2C7I A;  1BIB A;  5LJ5 g;  1HK9 A;  4M78 A;  3QNE A;  1H4V B;  1WLE A;  2EAY A;  3V8K A;  5I21 A;  3JB9 D;  4BW9 A;  2YHT A;  4M77 C;  4ZIB A;  1YCY A;  5GAN 6;  2PMF A;  5K1P A;  1X56 A;  2RHS B;  4RCB A;  3JCM h;  4X9D A;  4H2X B;  3JCM P;  4C8Q D;  1I5L A;  4J6W A;  2FYK A;  4XU1 A;  4XTY A;  4G85 A;  4EMH A;  4YP0 A;  1WYD A;  3M4G A;  3VQV A;  3ICA A;  2DXT A;  3FB9 A;  1H64 1;  5GMK i;  1WPY A;  4YRN A;  4NOY A;  4M77 G;  3IG2 A;  4M7D B;  2ODR D;  5GAO q;  4KQE A;  2IY5 A;  5GAO n;  4CS2 A;  4H2U A;  2ZR3 A;  4YRS A;  4YCV A;  3BW1 A;  2DQ3 A;  1H4S A;  2PME A;  4YYE A;  1ASY A;  1D3B A;  4UP7 A;  4MML A;  2QHS A;  4YRL A;  3JCM X;  3A7A A;  4YRJ A;  3LC0 A;  1SES A;  5GAN 8;  1YFT A;  5GAM h;  3FIF A;  5GAO p;  3JCM b;  4EX5 A;  2K57 A;  1NJ5 A;  1GGM A;  3L1A A;  2CIM A;  2ZNI A;  5GAN h;  4M77 D;  1H4T A;  1BBU A;  2ZIO A;  2J3M A;  1WQW A;  5CAI A;  5LJ5 f;  2ZT7 A;  4P73 A;  4P3P A;  4CH6 A;  4C92 C;  4M7D C;  4YRG A;  3QO7 A;  1I4K 1;  4K88 A;  4X5O A;  3UH0 A;  1EIY B;  3JCM c;  4P72 A;  3RGL A;  1BIA A;  4HWP A;  5GAN 2;  4LNS A;  1B70 A;  4RDX A;  4QVC A;  4F7U G;  1LNX A;  5GAO m;  2QHU A;  4A54 A;  2CJA A;  3P8Y A;  4PJO A;  4C92 G;  4M7D G;  1QF6 A;  4OP0 A;  4M78 B;  3HFZ A;  3QHS A;  4J5Y A;  3QO8 A;  3A5Y A;  4H02 A;  1JJC B;  3DSQ A;  3LSQ A;  5K1X A;  5GAN d;  5LJ3 h;  3REU A;  3UGQ A;  4M75 E;  1JRI A;  3ERR A;  4CS3 A;  3JB9 F;  1NJ6 A;  3JCM e;  2ZNJ A;  3A5Z A;  5ELO A;  1X54 A;  1E1T A;  1Y96 B;  4JLI A;  4CH4 A;  4WF2 A;  3JB9 I;  4P74 A;  1B7Y A;  1ADJ A;  2RHQ A;  1FYF A;  4CH5 A;  4M7D D;  5C51 B;  1B8A A;  4XU3 A;  1X55 A;  4TVA A;  4TWA A;  3A31 A;  4N0A A;  3IKM B;  1Z7M A;  4KR3 A;  2DQ0 A;  4YCW A;  2IY5 B;  4M78 C;  4PJO E;  3RES A;  2AMC A;  1D3B B;  1MGQ A;  4HA8 A;  1B34 A;  1RIQ A;  5LJ3 d;  2ZZF A;  2HNI A;  5GAM e;  4YRO A;  4YRP A;  1QE0 A;  2XGT A;  5GMK m;  3TUP A;  2E1H A;  3RUX A;  3A7U A;  2DTH A;  5GAN e;  1LOJ A;  4M78 G;  3V8L A;  3MF2 A;  4HWR A;  4ZTZ B;  2VXF A;  3HFO A;  4M7A E;  4G84 A;  3JB9 H;  3NEL A;  2Q7G A;  1YFS A;  3VQX A;  4NCX A;  4M77 F;  3V7S A;  5GAN 3;  1ATI A;  5GAO l;  2DKG A;  3I7F A;  3UFG A;  5GMK h;  4HT9 A;  2ZR2 A;  4KR2 A;  4F7U B;  3NEN A;  4YCU A;  4UP8 A;  5GAN 5;  5LJ3 j;  4Q6G A;  4XTU A;  2Q5H A;  3KFU A;  1EOV A;  4XTV A;  1B70 B;  1NJ1 A;  1M5Q 1;  4C92 B;  3WQZ A;  4V2S A;  4MMK A;  2I4O A;  3VQW A;  1G5H A;  3VBB A;  1WQ7 A;  2ZZG A;  4M78 D;  4Y91 A;  1LJO A;  3HY0 A;  4C8Q E;  4UP9 A;  3HFZ B;  2ZGW A;  3HXZ A;  5GAN g;  1WU7 A;  1Z7N A;  3HXW A;  1PYS A;  4P73 C;  2E65 A;  4YDQ A;  5LJ3 e;  3JCM d;  4P3N A;  4NL3 A;  2DU7 A;  2ARS A;  3A7R A;  12AS A;  4H2V A;  2EJF A;  2I4N A;  2DZC A;  2I2L A;  4P75 A;  2YLC A;  4M75 A;  1JBM A;  4WJ4 A;  4JRK A;  1NNH A;  3TEH A;  4EMK A;  4F7U F;  1X01 A;  2FB7 A;  2ALY A;  4PHC A;  4L87 A;  2RB6 A;  1E22 A;  3W3S A;  3SWN A;  3RKY A;  2RD1 A;  3R07 A;  4YRF A;  3UGT A;  2P5I A;  2ZTG A;  2Q7E A;  3JCM V;  1N9S A;  4X9C A;  4JRI A;  4C92 F;  4M7D F;  2QHV A;  3P8T A;  5GMK l;  2ARU A;  3QO3 A;  1HC7 A;  1USY A;  3HSB A;  4XEM A;  2AMC B;  2JN0 A;  4M77 E;  3HTZ A;  4YRR A;  1HTT A;  2DZ9 A;  5KNN A;  1SET A;  4K86 A;  4O2D A;  5LJ3 g;  4TTV A;  1SER A;  5GAM d;  4HWT A;  2ZIM A;  3M4Q A;  3RAC A;  3M4P A;  1LYL A;  5C52 B;  11AS A;  4CS4 A;  1M8V A;  3HXX A;  4P74 C;  4PJO G;  3REX A;  3A74 A;  1W66 A;  3PCO A;  3L4G A;  3V7R A;  5GAO r;  4XEO A;  3HXU A;  4N0A C;  4XTW A;  3HFV A;  2J3L A;  1KMN A;  4YPF A;  3AHU A;  4M7A A;  2I4L A;  5GMK e;  4WJ3 M;  5GAM j;  4H2T A;  4C92 D;  3VQY A;  3HY1 A;  2EWN A;  1B76 A;  2G4C A;  3TEG A;  5GAN j;  4J15 A;  1J5W A;  4HWS A;  2DDZ A;  3QSU A;  1NJ8 A;  5LJ5 e;  1HXD A;  3A32 A;  1G51 A;  4XTX A;  4XQ3 A;  2CJB A;  1YGB A;  2E5A A;  1E1O A;  1YFR A;  3G1Z A;  4H2Y A;  4AH6 A;  4OLF A;  1NYQ A;  2E3C A;  3QTC A;  4M78 F;  3OD1 A;  1YB3 A;  4DPG A;  3BY7 A;  2I4M A;  3V8J A;  1PYS B;  3JCM g;  2VXE A;  2AKW A;  4PG3 A;  4C8Q A;  4NL2 A;  5F5W A;  4YRI A;  4YRK A;  1ADY A;  3VU3 C;  4M7D E;  2QHT A;  3V7C A;  1NYR A;  1I8F A;  3JB9 J;  1N9W A;  4ZTU B;  4C8Q G;  1ASZ A;  1SRY A;  3EFR A;  4M75 B;  2CJ9 A;  2ZIN A;  3INZ A;  3TEH B;  3JCM J;  2ALY B;  1X2H A;  4QVD A;  4H2S A;  1KQ1 A;  2RM4 A;  3SWN B;  5E3I A;  3IAL A;  4XTZ A;  3QUI A;  4H2W A;  4A53 A;  2Q7H A;  4P71 A;  2ZXF A;  1JJC A;  1TH7 A;  1C0A A;  1U1T A;  4J6Y A;  1N9R A;  2YLB A;  5LJ5 h;  2ZT6 A;  2XTI A;  5GAM g;  4EO4 A;  2DEQ A;  2E64 A;  3P8V A;  1Y96 A;  4PJO B;  3JCM W;  3HXY A;  4M77 A;  4P75 C;  2ART A;  3BFM A;  4M75 C;  2VC8 A;  2ZCE A;  2ZT8 A;  2DVE A;  3RL6 A;  1EVK A;  4EMK C;  2Y90 A;  3PCO B;  3SWN C;  3L4G B;  4HWO A;  4M75 F;  2RA2 A;  4YRC A;  4E51 A;  3MEY A;  4P72 C;  4TVY A;  3FJP A;  1KMM A;  3JCM f;  1B7Y B; 
#chains in the Genus database with same CATH topology
 2PVO B;  1O9S A;  2KE9 A;  5CKH A;  1USY C;  2BE9 B;  2M1H A;  4M75 G;  2HQE A;  5KH6 A;  3OW2 P;  2NWM A;  4WI1 A;  1W4S A;  1I81 A;  1OUL A;  2DU5 A;  1PKS A;  2DJZ A;  2RJE A;  1TUC A;  1ZSG A;  2LQN A;  1K8A R;  4PFP A;  3OYN A;  1YJW A;  3PTA A;  3VS2 A;  4YRT A;  2JMA A;  3OBY A;  2E12 A;  3QBY A;  1VQ7 T;  3URG A;  2L3P A;  1A0N B;  1YI2 T;  1NEG A;  2ECZ A;  4E7K A;  4M7A C;  3RER A;  3C95 A;  3TEE A;  2CP5 A;  4WTO B;  1LCK A;  3G7Z A;  3CCJ Q;  2LCL A;  2NYS A;  3VS3 A;  3HTR A;  2YRC A;  2EJ9 A;  2F1L A;  5GAN f;  3LX7 A;  5C53 B;  2FVU A;  2EL9 A;  4LD9 K;  1VQ8 A;  2ZZE A;  2E41 A;  1MV0 B;  2PZ1 A;  2RJD A;  3NEM A;  2E3H A;  3BDU A;  5CK9 A;  2KEA A;  4M7A G;  1NPR A;  4LUE A;  5J3B A;  1IHV A;  5IAY A;  3CCJ A;  4JPB W;  4KGX B;  3JCM Q;  4FYV B;  4C8Q C;  1JB0 E;  1UGS B;  1D0Z A;  2DTO A;  3CC7 T;  2VB6 A;  5FU6 C;  1J3T A;  5KE2 A;  1NJ2 A;  3G6E T;  4M77 B;  3GP8 A;  3HKS A;  4FT2 A;  4ANJ A;  2QXF A;  2X9H A;  3N5B B;  4QQG A;  1EFW A;  2FL7 A;  2OAW A;  3RKX A;  2JS2 A;  4R55 A;  5HK0 A;  2MI6 A;  1EIY A;  1HD3 A;  2O9V A;  1V76 A;  4BDY A;  1BBW A;  4Z8A A;  1YJN T;  4BWA A;  4AFZ C;  1Q82 U;  3EG0 A;  3CCV Q;  5KE3 A;  1RAE B;  1YFN A;  2DXU A;  1WIE A;  2ED1 A;  3VRY A;  3OS5 A;  3UF4 A;  3CCR A;  3C12 A;  2ESW A;  1WLE A;  4BY6 C;  1GFC A;  1OV3 A;  5I21 A;  1VQO Q;  1VQ5 Q;  4RCB A;  2RI3 A;  3LH5 A;  2H3J A;  3RMQ A;  4H2X B;  2QAS A;  1ABO A;  2DE0 X;  3GBQ A;  3OW2 S;  3MQZ A;  4XU1 A;  4XTY A;  2JXB A;  1M3A A;  3CPW P;  1TTH B;  1VYV A;  5D7U A;  3ASK A;  1WYD A;  3HRU A;  3MP8 A;  3M4G A;  1T3L A;  2LNH B;  1T0H A;  3FB9 A;  3ICA A;  1G83 A;  4JZ3 A;  4FW1 A;  4OMP A;  3VKI A;  5A0L A;  4DEX A;  1OX9 A;  1WPY A;  1TU0 B;  4B9W A;  3IG2 A;  4OMO A;  4ME7 A;  1AWW A;  4CS2 A;  3M54 A;  2ZR3 A;  1W2B S;  4YCV A;  2IG0 A;  4FYY B;  1BBZ A;  2KVQ G;  1YBY A;  1ASY A;  1D3B A;  2CP3 A;  2JJ9 A;  2X4W A;  3LC0 A;  1SES A;  1VIE A;  1YFT A;  1UG1 A;  1YIT Q;  3ER0 A;  3LYI A;  1BI1 A;  2XD0 A;  4PK4 A;  3G4S A;  2KMT A;  1Q81 U;  4LVK A;  2GFU A;  1KJW A;  5GAN h;  1ZHI A;  2ZIO A;  1Q7Y R;  2OTJ Q;  4J83 A;  3ME9 A;  4P3P A;  2V8I A;  3WVD B;  2L8D A;  5A0G A;  4M7D C;  4FU6 A;  3QO7 A;  1YIT A;  2JT4 A;  2OTL Q;  2LX9 A;  4RDX A;  2ROT A;  4F7U G;  4IIM A;  5GAO m;  4DA4 A;  3QDF A;  1JQQ A;  5KYW A;  1ZLM A;  1XJW B;  2GF7 A;  4M7D G;  2V26 A;  2RHY A;  3X20 B;  3A5Y A;  3EGD B;  1UHF A;  1JJ2 A;  3LSQ A;  3CCL Q;  4JZ4 A;  5I2S A;  2QK0 A;  3UGQ A;  2A08 A;  4EPC A;  3S6W A;  3ZL7 C;  3JCM e;  2ZNJ A;  3CPF A;  1Y0M A;  2DXB A;  5ELO A;  2P0P A;  2QQA A;  2DXC A;  1VQ4 T;  1JO8 A;  4JLI A;  2ZPI B;  2F2X A;  5IT9 E;  1PHT A;  4QT7 A;  3CCL A;  1BI2 A;  2A36 A;  4CH5 A;  1B8A A;  5CIU A;  1NPP A;  1KC8 U;  1AZE A;  1WHM A;  4RG8 A;  4AFU C;  5A2Q E;  1D1C A;  3CPW S;  3CC7 Q;  4HCC A;  2COW A;  3CCU Q;  2HAX A;  2BKD N;  2RHZ A;  2E5Q A;  1XOV A;  1NBE B;  2K7A A;  5FU7 C;  3VYH B;  2HNI A;  2CP6 A;  3GF5 A;  2XU8 A;  4XAX B;  1FMW A;  3RUX A;  2HEQ A;  2DTH A;  4KH0 B;  3OS2 A;  4ZTZ B;  5IHK A;  2CYZ B;  3JB9 H;  2Q7G A;  1YFS A;  3VQX A;  1AVZ C;  4FIB A;  2IIM A;  1RLQ C;  5GAN 3;  3V7S A;  1ATI A;  2DKG A;  2RHI A;  3UFG A;  3S3M A;  4HT9 A;  4RTX A;  4KR2 A;  3CCM Q;  2RH2 A;  2JM9 A;  1WGS A;  5LJ3 j;  4XTU A;  1RAI B;  1M1F A;  1K0X A;  1B70 B;  2JUF A;  3OYJ A;  2YT6 A;  1AWX A;  4D6W A;  1NJ1 A;  1G5H A;  1NLO C;  2ZZG A;  4M78 D;  3J7A F;  4E2F B;  5KYY A;  2HL5 C;  3CCM A;  3MEV A;  3HFZ B;  2EPD A;  5GAN g;  1MMN A;  3M56 A;  4YDQ A;  2C06 A;  2DBM A;  5LJ3 e;  3UA7 A;  4LVL A;  1KSW A;  2B86 A;  4KH1 B;  4NL3 A;  1K9M U;  4OB1 B;  4RMO A;  5CCA A;  2CRE A;  5GJW B;  2DZC A;  2COY A;  3MO8 A;  4P75 A;  2YLC A;  3GNF B;  4LDX A;  1JBM A;  3JAM E;  2CT4 A;  2V8K A;  2L5Q A;  4EMK A;  4L87 A;  1WX6 A;  2BE7 D;  4RTW A;  3W3S A;  1OZ2 A;  2RQW A;  1UFF A;  1SKU B;  2VV5 A;  1Y71 A;  2SEM A;  2DAQ A;  5KYU A;  2XHC A;  2ARU A;  3CCQ A;  4ZTJ A;  1VQK T;  4XEM A;  2A28 A;  3T9N A;  1YJ9 T;  3QWY A;  5KNN A;  4TTV A;  1SER A;  4OML A;  2EIF A;  2ZIM A;  3OYA A;  1NE8 A;  3A8G B;  1LYL A;  2O88 A;  2EQU A;  2ATC B;  1M8V A;  2HD0 A;  2AT1 B;  3VS5 A;  3THK A;  1AWO A;  1QCN A;  1C6V X;  1ZSZ C;  3L4G A;  4XEO A;  2LT1 A;  2FRW A;  2LC4 A;  2X3W D;  2RPN A;  2NS6 A;  2J3L A;  1KMN A;  1UJY A;  2EGC A;  1R0C B;  4JJD A;  4H2T A;  2V1R A;  3HY1 A;  2XK0 A;  1B76 A;  3VS7 A;  3X25 B;  2X4J A;  2QI2 A;  2DDZ A;  1WXU A;  1K8A C;  2RQV A;  2KXC A;  2QAZ A;  2B8A A;  3A32 A;  1YWO A;  1OEB A;  2DL5 A;  3MEA A;  4XTX A;  1G3T A;  3CCE Q;  1VQL Q;  4J9I A;  2FZC B;  3G1Z A;  4H2Y A;  1AHJ B;  4E7Z A;  4IUU A;  4D8D A;  4OMN A;  1TOV A;  4E7S A;  2GQV A;  3D7S B;  4J7F A;  4DOW A;  2F5K A;  5F5W A;  2VXE A;  2LX7 A;  1VYU A;  5J39 A;  2QHT A;  1G3Y A;  2V1Q A;  2VGN A;  3TCJ A;  2EYW A;  1SHG A;  3CCE A;  4ZTU B;  1VQL A;  5GJV B;  1ZBX A;  2EFI A;  2K6D A;  2KRN A;  3CBM A;  3JCM J;  2ALY B;  1M4Z A;  2RHX A;  2JTF A;  4ATO A;  3QUI A;  1VQP Q;  2W10 A;  2LP5 A;  4JLG A;  1C1A A;  4JJN K;  3HL8 A;  2DLP A;  2F2V A;  1C0A A;  2FPD A;  2OJ2 A;  1ZBJ A;  1QQJ A;  3FRN A;  3M59 A;  4JRP A;  5GAM g;  5KYW B;  1Y07 A;  1Y7X A;  2ROL A;  2JTE A;  1Y96 A;  2FO0 A;  1VQP A;  1G5V A;  1T3S A;  1ZA1 B;  5KCO A;  2X4X A;  1U06 A;  4M77 A;  2ART A;  1RAA B;  3UPU A;  2ZT8 A;  2DVE A;  3MKD A;  2EGA A;  2L0A A;  5IN1 A;  2H8H A;  4JJC A;  3EAE A;  1PKT A;  2DER A;  3H9N A;  3OMG A;  2LJ1 A;  3H41 A;  1WHK A;  1YIJ Q;  4OB2 B;  4M78 E;  4Z88 A;  5DM7 R;  2QQR A;  2L3Q A;  4C5G A;  1KQS P;  2CZ6 B;  3BJU A;  2EYZ A;  3E9H A;  2C0O A;  1EFN A;  1QP2 A;  4PJO C;  4TQD A;  3H0H A;  2QGF B;  3PMI A;  1K4U S;  4YRM A;  1YIJ A;  3C0C A;  3DB3 A;  3TSZ A;  3CCJ T;  4H2X A;  1M1K C;  5GMK j;  2MCN A;  2LRQ A;  4TVW A;  4XU2 A;  3UA6 A;  1QVF S;  4PNO A;  4M75 D;  4C0Z A;  2LZ6 B;  3HRI A;  2LT4 A;  5LJ5 j;  5DY9 A;  1AOJ A;  3EH1 A;  2MMP A;  3Q1J A;  3UT1 A;  1AD5 A;  2K79 A;  3MEU A;  1RAG B;  2KQW A;  2LQ8 A;  4UPA A;  2MAM A;  2A0F B;  4QQD A;  1TS9 A;  1VQZ A;  2I0N A;  4CI0 C;  2C8M A;  3EG3 A;  5ELN A;  2ABL A;  1E7O A;  4EMG A;  3HFN A;  2EQM A;  1EVL A;  4CC2 A;  4R0K A;  2PQW A;  1Q7Y C;  2DFU A;  2GTO A;  4KBM B;  5FRM A;  3PGG A;  1QCF A;  3PT9 A;  3LWI A;  4FT4 A;  2Q5I A;  1BI0 A;  4MZT A;  4E7I A;  3HXV A;  2CUD A;  3E9I A;  3CCV T;  4PJN A;  2HSE B;  1V29 B;  2PUK B;  3CMQ A;  3OYH A;  5I22 A;  2D8J A;  5LL6 S;  3I55 A;  1WLP B;  1UE9 A;  4M7A D;  2OAU A;  1VQO T;  1N6A A;  4RTY A;  1VQ5 T;  4P71 C;  2OX7 A;  1UJ0 A;  2E5K A;  1WNL A;  3BE3 A;  4EMK B;  1QP3 A;  2VWF A;  2YSQ A;  2C7I A;  1FXX A;  1ABQ A;  1HK9 A;  3SDZ A;  3M0P A;  3I56 A;  2Y4X A;  2RQU A;  3GNG A;  4Y92 A;  1QVG A;  2V8J A;  5KYU B;  3EG9 B;  4ZIB A;  3CD6 A;  2RQT A;  3TSW A;  4C8Q D;  3JCM P;  2M0O A;  2ZPB B;  2G6F X;  5L8R E;  1UGV A;  3F70 A;  2XDB A;  4TVR A;  2M16 A;  2AZV A;  1N27 A;  2DXT A;  3CMA Q;  1QWF A;  1NJI R;  4HCZ A;  4NOY A;  1YIT T;  4YRN A;  5GAO n;  2JTM A;  3DKM A;  4PFZ A;  4YRS A;  1QW1 A;  4JS5 A;  1U5S A;  1H4S A;  2PME A;  4YYE A;  4MDX A;  2OTJ T;  4MML A;  3JCM X;  3CMA A;  1YJW Q;  3A7A A;  4ZGE B;  2X35 A;  1GCP A;  3ZBD A;  2K3X A;  3FIF A;  4JDS A;  3JCM b;  2O31 A;  3EG1 A;  1FMK A;  2LTO A;  1GGM A;  3PFS A;  3L1A A;  2CIM A;  2OI3 A;  2OTL T;  5LJ5 f;  4A4F A;  2BIV A;  2ZT7 A;  1C0M A;  2KXD A;  8AT1 B;  4WCI A;  4ORZ A;  3RNJ A;  4K88 A;  2WSE E;  1W2B P;  1VQ8 Q;  3CBO A;  3LWH A;  3JCM c;  3RGL A;  3EFO B;  5KYX A;  1UGQ B;  1B70 A;  3CCL T;  4BD3 A;  3NTH A;  2A7Y A;  3MP1 A;  2ED0 A;  1ACM B;  3VUZ A;  2AK5 A;  2QHU A;  4A54 A;  2VAS A;  1QF6 A;  4LDU A;  3HFZ A;  4M78 B;  2D1X A;  3QO8 A;  4H02 A;  4KGZ B;  4E7J A;  3S3N A;  3REU A;  3SFM A;  4HXJ A;  1BU1 A;  4M75 E;  3A98 A;  2EW3 A;  1YN8 A;  3JB9 F;  4FCY A;  2E6Z A;  1G3S A;  2VUB A;  1WJR A;  5DLO A;  1I1J A;  1X54 A;  1Y96 B;  2CP7 A;  2CSQ A;  1ZQ1 A;  1I0C A;  4GY5 A;  4J9B A;  3CCU T;  3JB9 I;  3OYI A;  3DLL A;  4BE2 A;  4QVZ A;  2C0I A;  4M7D D;  4IUT A;  4TWA A;  1X55 A;  1R8O B;  4OB0 B;  3CCR Q;  4JRQ A;  3I5S A;  4TVA A;  4F17 A;  3IKM B;  1Z7M A;  1X2Q A;  2DVJ A;  2P4R A;  2DYB A;  5AT1 B;  2YDL A;  2IY5 B;  2RF0 A;  1JJ2 P;  1QCO A;  3M57 A;  4ZGJ B;  4BI3 A;  1E6H A;  1MNE A;  3MCA B;  4HA8 A;  4BI8 B;  5LJ3 d;  3VS0 A;  5GAM e;  4LDW A;  5IHN A;  4YRP A;  3CCM T;  3CXC A;  2IVW A;  1X6B A;  2E1H A;  1ZUK A;  2CZ7 B;  3V8L A;  4HWR A;  2VXF A;  2K9G A;  3HFO A;  4M7A E;  2HQH A;  2HBW A;  3M0R A;  1D1A A;  4M77 F;  1I07 A;  2YUN A;  1WFW A;  3MPU B;  2CP2 A;  4UC4 A;  5GMK h;  3NEN A;  1M1K R;  1W6X A;  4Q6G A;  3E9F A;  1EOV A;  4XTV A;  3SEM A;  1K8A U;  4V2S A;  4MMK A;  1WXT A;  4KUI A;  2EQK A;  2I4O A;  1OPK A;  2XID A;  3M9Q A;  3G4S Q;  1TUD A;  3VBB A;  3OW2 A;  3VRZ A;  2COZ A;  1NLP C;  1WJS A;  1TG0 A;  4C8Q E;  3HY0 A;  3H0I A;  3PE0 A;  4N4G A;  1R77 A;  2FPF A;  1Z7N A;  2J06 A;  3UAT A;  4J9F A;  4FL6 A;  4C0D B;  1GCQ A;  2DO3 A;  4H2V A;  2DYI A;  3A5Z B;  1PRL C;  1YHQ Q;  1D0X A;  2P4T A;  2SRC A;  3MHX A;  2XMF A;  1NNH A;  4RUG A;  1BYM A;  4LE9 A;  2ALY A;  3RKY A;  3O8V A;  2ZTG A;  2Q7E A;  1UB4 A;  2O2O A;  2E4H A;  1CKA A;  4Y28 E;  3CME A;  2AIR B;  4MZM A;  1YHQ A;  3QO3 A;  1HC7 A;  1WYX A;  2AMC B;  3R6O A;  3HTZ A;  1MHN A;  2DA9 A;  2W0Z A;  3OA6 A;  4K86 A;  1CKB A;  3SHW A;  3RAC A;  2PU9 B;  4Z89 A;  1JJ2 S;  3HXX A;  1W66 A;  4MDW A;  1UTI A;  5HCK A;  4QW2 A;  2A8E A;  4YPF A;  3AHU A;  3CCE T;  1VQL T;  1NEB A;  1KHC A;  1M90 R;  1M1G A;  1KD1 C;  3C4S A;  4C92 D;  5CKF A;  2LJ0 A;  2QQS A;  2QYZ A;  2G4C A;  2AKK A;  2LQW A;  4HWS A;  4A4H A;  1NJ8 A;  4PJL A;  3M0T A;  1OU9 A;  1HXD A;  2DBK A;  2R57 A;  4XQ3 A;  3L2V A;  2E5A A;  1E1O A;  1BK2 A;  4AH6 A;  4OLF A;  1NYQ A;  1NZ9 A;  1V1C A;  3BY7 A;  2CP0 A;  2I4M A;  3V8J A;  1PYS B;  2ZPF B;  4NL2 A;  4B9X A;  5CQX A;  1VQP T;  1Q86 C;  3NFC A;  4M7D E;  3V7C A;  1NYR A;  2XIC A;  1VUB A;  4PKC C;  1N9W A;  1QVP A;  1IB8 A;  3RMS A;  1R0B G;  2MPX C;  2KNB B;  2LNV A;  4M75 B;  2KK4 A;  2ZIN A;  3TEH B;  4JS4 A;  4KT0 E;  1M3B A;  4QVD A;  3IQL A;  3SWN B;  5E3I A;  3IAL A;  4XTZ A;  4A53 A;  5KYX B;  1TH7 A;  3GOX A;  1Q7Y U;  1U1T A;  1N9R A;  2MOX A;  1WHJ A;  2ZT6 A;  1BI3 A;  1SEM A;  2DIG A;  4EO4 A;  4ELY C;  2X51 A;  1VYT A;  3JCM W;  2GCX A;  1HYO A;  1YIJ T;  4P75 C;  4DOV A;  3TRE A;  2VC8 A;  3QG1 A;  3H8Z A;  4QKU A;  1B07 A;  2K3B A;  1K73 R;  3RL6 A;  4EMK C;  1RL2 A;  2VVK A;  2Y90 A;  3PCO B;  4M75 F;  5IHI A;  2F2W A;  1WJQ A;  2KGT A;  4E51 A;  3MEY A;  4P72 C;  1RAH B;  3CCQ Q;  3FJP A;  4TVY A;  3QWX X;  2HSP A;  2DMO A;  4M7A B;  3JCM f;  2YXY A;  4TQF A;  5M9O A;  1X43 A;  2DET A;  4CC4 B;  4TVA B;  1L0W A;  1ZX6 A;  3KFV A;  3E9G A;  3OYL A;  4AFQ C;  5LJ5 d;  3IKL A;  4PLI A;  3RF1 A;  3M0S A;  3L42 A;  1SSF A;  3EG9 A;  1KOG A;  4HKE A;  1UHC A;  1GRI A;  2J05 A;  1QKW A;  3QJY A;  1FYN A;  2J6F A;  2D8H A;  2CZ1 B;  1NYF A;  2LMJ A;  4E47 A;  1KQ2 A;  2CKK A;  4DQ2 A;  2PVD B;  4OB3 B;  1N8R R;  1NJI C;  4C8Q B;  2HDA A;  5FWC A;  3GIB A;  1OPL A;  5FU6 B;  3KXT A;  1N5Z A;  2QQB A;  5AYF A;  4RQE A;  4C92 A;  1IL2 A;  3EHR A;  3NET A;  4M7A F;  3A8H B;  5GAN 4;  4J6X A;  4FYW B;  4HT8 A;  1E24 A;  1OOT A;  3M55 A;  4RMF A;  1D09 B;  3HP9 A;  4PJO D;  2P0L A;  4PLL A;  1QVF P;  4RTU A;  2HCK A;  1X2G A;  3NTI A;  2WSF E;  4K87 A;  4P3O A;  4ZN1 A;  4C8Q F;  1M2V A;  4HCK A;  4RQF A;  3JB9 G;  5CKE A;  1H4Q A;  3RKW A;  2JOY A;  4C92 E;  3OYK A;  2ODR C;  1YP5 A;  4YRE A;  3RIR A;  4BE1 A;  3EFO A;  4RCC A;  2QTX A;  5LJ3 f;  3A8L B;  3G71 Q;  3CCS Q;  1M3C A;  2HQX A;  2E6N A;  4ZTF A;  1GFD A;  5GAN 7;  3VUB A;  4PFO A;  2D0Q B;  2Y4Y A;  1VIF A;  1WA7 A;  1BIB A;  4M78 A;  3QNE A;  1H4V B;  2EAY A;  2DL8 A;  4RTZ A;  3G71 A;  3CMA T;  4M77 C;  1YCY A;  5GAN 6;  3CCS A;  2PMF A;  1X56 A;  2RHS B;  3I5R A;  1BCM A;  3JCM h;  4X9D A;  2C0T A;  1G3W A;  1I5L A;  4IUR A;  4A63 B;  1PSE A;  3ZEH A;  4J6W A;  1VQ9 Q;  2QA4 Q;  1YCS B;  4EMH A;  4YP0 A;  3OYD A;  4EIK A;  1P92 A;  4R56 A;  1YJW T;  1W70 A;  1TUG B;  4RTV A;  4FSS A;  5GMK i;  4M77 G;  4M7D B;  4KQE A;  2IY5 A;  4J9C A;  4H2U A;  1VQ9 A;  4IIO A;  2QA4 A;  1QVG P;  3BW1 A;  1T0J A;  2D6F A;  1AZG B;  2GGR A;  4UP7 A;  3QKJ A;  1JXM A;  2QHS A;  1OZ3 A;  4YRJ A;  2QG9 B;  4RG2 A;  4GLK A;  3H6Z A;  1IZ6 A;  2IPO B;  2EGE A;  2R5A A;  1VQ8 T;  1KD1 R;  2K57 A;  1WZO A;  5KCH A;  4C5H A;  2DD5 A;  1S72 Q;  1H4T A;  1BBU A;  2J3M A;  1WQW A;  1Q95 G;  2HKQ B;  4J9E A;  2X3X D;  4P73 A;  1SRL A;  2KRO A;  4YRG A;  4AG1 C;  3OS1 A;  1H8K A;  1I4K 1;  4X5O A;  3HRT A;  3UH0 A;  1D0Y A;  1S72 A;  4QVC A;  1LNX A;  3QZ5 B;  4PL6 A;  1Q86 R;  4CRI A;  4LN2 A;  5I2M A;  2K5F A;  4PJO A;  3TU4 K;  4J5Y A;  2O9S A;  2FPE A;  5K1X A;  3KBG A;  2E70 A;  5LJ3 h;  3CCR T;  5FU7 B;  2O4X A;  3ERR A;  4CS3 A;  2NUP A;  1RAC B;  4BE0 A;  1NJ6 A;  3I55 Q;  2DIL A;  3A5Z A;  1E1T A;  2YRD A;  2RI2 A;  4CH4 A;  2HMA A;  4P74 A;  1RAD B;  1ADJ A;  2RHQ A;  3UWN A;  3H0F A;  1FYF A;  1VQK A;  1Y57 A;  4N0A A;  3I56 Q;  4KR3 A;  1YJ9 A;  4Z02 A;  4OMQ A;  1TSF A;  2DQ0 A;  3CC4 Q;  3M0Q A;  5CR2 A;  3CD6 Q;  4OGE A;  4PJO E;  3OSS C;  1MUZ A;  2KRS A;  2DL7 A;  2AMC A;  2RK2 A;  2RQR A;  2RHU A;  3J81 E;  1PC0 A;  1B34 A;  4B6M A;  2ZZF A;  1OI1 A;  1WI7 A;  3CC2 Q;  3NMZ C;  3EHQ A;  2XGT A;  2FG0 A;  3CC4 A;  1QVG S;  4O6J A;  1K9M C;  5GAN e;  3MF2 A;  1LOJ A;  4X34 A;  2EYX A;  4HVW A;  1H3H A;  2R5M A;  2LCS A;  4G84 A;  1QKX A;  3NEL A;  1M90 C;  1KFZ A;  3FC3 A;  3G4S T;  1X6G A;  4OMF B;  3I7F A;  4DEY A;  1UUE A;  3TVT A;  2ZR2 A;  3CC2 A;  2KR3 A;  3J80 E;  4RKU E;  1SSH A;  1MND A;  3KFU A;  2CZ0 B;  3RR6 A;  2DJQ A;  1M5Q 1;  4C92 B;  3MET A;  4E7L A;  2XDP A;  4X1V A;  2VYT A;  4F16 A;  1KQS A;  3VQW A;  1WQ7 A;  1PD0 A;  4Y91 A;  1LJO A;  1X2K A;  1YHQ T;  1MV3 A;  3HXZ A;  3ZFJ A;  1Q82 R;  1PG5 B;  1PYS A;  2E65 A;  3JCM d;  1PSF A;  5IXB A;  2M02 A;  4P3N A;  2ARS A;  3A7R A;  5CQY A;  2EJF A;  2I2L A;  2ZPE B;  3NTK A;  4M75 A;  1VQN Q;  2K3Y A;  2RNA A;  3PIP A;  1M2V B;  3TEH A;  4M4Z A;  1X01 A;  2FB7 A;  3FDR A;  1ZSZ B;  2RB6 A;  5D6X A;  1E22 A;  3SWN A;  1HJD A;  3R07 A;  3QZ9 B;  3UGT A;  2P5I A;  2L89 A;  4IUV A;  2QGG A;  4C92 F;  3P8T A;  1VQM Q;  4A4G A;  5GMK l;  1VQN A;  2DL3 A;  4BI4 A;  4AFS C;  4FM4 B;  1Z9Q A;  3HSB A;  4J9H A;  1USY A;  3LGF A;  2F5T X;  1HTT A;  1JU5 C;  1SET A;  4O2D A;  5LJ3 g;  4KUL A;  1K73 C;  2KY9 A;  3GLX A;  3OMC A;  2YUQ A;  1K9A A;  1VQM A;  3REX A;  2LQK A;  4CC7 A;  2BTT A;  4LVM A;  3PCO A;  3V7R A;  3L2U A;  5GAO r;  2CS7 A;  2CH4 W;  2KT1 A;  4XTW A;  2ZZD A;  2P0Q A;  1Q81 R;  4M7A A;  2I4L A;  4BB7 A;  1KIK A;  3AT1 B;  4LXC A;  4WJ3 M;  5GAM j;  4O5V A;  5FW9 A;  2L2P A;  3VQY A;  2EWN A;  4D8K A;  1CSK A;  2DPP B;  4HCB A;  1RLP C;  3QII A;  1J5W A;  3EGX B;  4J15 A;  3QSU A;  1FMV A;  4J8O A;  2AZS A;  1G51 A;  2CJB A;  1X75 C;  4FW2 A;  1N8R C;  3P8H A;  2E3C A;  4M78 F;  1NJI U;  3OD1 A;  4DPG A;  1PRM C;  8ATC B;  4DBH A;  2AHJ B;  4PG3 A;  4K11 A;  1G8X A;  4C8Q A;  3OY9 A;  4OMM A;  1RI0 A;  2PVG B;  4L6V 5;  2DF6 A;  3CXC S;  2DRK A;  4A4E A;  3JB9 J;  2K5L A;  4C8Q G;  1SRY A;  3EFR A;  2CJ9 A;  1PM3 A;  3INZ A;  3E1S A;  4FSX A;  3HRS A;  4H2S A;  3OYB A;  5D6W A;  2WAC A;  4H2W A;  2RN8 A;  3OS0 A;  2Q7H A;  2ZXF A;  1JJC A;  2JNG A;  4F14 A;  2EBP A;  1RAB B;  3M58 A;  4J6Y A;  1E6G A;  4IUP A;  5LJ5 h;  3CCV A;  3VV0 A;  1GBR A;  1KC8 R;  2E3I A;  2XI9 A;  2E64 A;  3P8V A;  1GCQ C;  4PJO B;  2KRM A;  3CCQ T;  3HXY A;  1AWJ A;  2WSC E;  2GNC A;  3BFM A;  1VQO A;  1G2B A;  4OGC A;  4N4I A;  1VQ5 A;  4LVJ A;  2O4X B;  2F69 A;  2NUP B;  4YRC A;  2HZY A;  2FHD A;  3JSC A;  3MEW A;  2JMC A;  2QQ9 A;  1TXQ A;  3CME Q;  1W2B A;  1IRE B;  2YWW A;  3A8M B;  1KMM A;  3OSV A;  1I5O B;  4HVV A;  4N4H A;  2JW4 A;  1X69 A;  4BUG A;  4E6R A;  2RHQ B;  2KT8 A;  1JXO A;  2MWP A;  3A1P A;  2NUT A;  2QEX Q;  3LSS A;  1KHI A;  1RI9 A;  2M0Y A;  3SB2 A;  2E10 A;  1X27 A;  2EYY A;  4GBQ A;  1W1F A;  1PWT A;  1SF9 A;  1K1Z A;  1SG5 A;  1G5I A;  4YRQ A;  7AT1 B;  6AT1 B;  2MWO A;  2FZK B;  1VQ6 Q;  2RHS A;  2HBP A;  4HVC A;  4PJO F;  2M9U A;  2QEX A;  3QXE B;  4MZP A;  4JUV A;  4Q15 A;  5I11 A;  1B34 B;  3EFS A;  1EQR A;  2AKW B;  2KDS A;  2CDT A;  2GBQ A;  2LCC A;  4F7U A;  3QPH A;  1RUW A;  2KAF A;  2ZCF B;  3DLM A;  5GAM f;  1BCO A;  1VQ6 A;  3HRK A;  1FX7 A;  2MIO A;  3HPW A;  2OTJ A;  4XU0 A;  4BDZ A;  4M7D A;  2DTI A;  4LUD A;  1K9M R;  2MF2 A;  1ZUU A;  1VQ7 Q;  4LVI A;  1KK7 A;  1EZZ B;  1PNJ A;  1YI2 Q;  3S3O A;  1M27 C;  1SRM A;  2FZG B;  4KUD K;  2D9T A;  1D1B A;  1EX4 A;  1NM7 A;  4QQ6 A;  2OTL A;  2ZT5 A;  4CH3 A;  3QO5 A;  1GBQ A;  4HVU A;  4A4K A;  1U1S A;  1VOM A;  1Z9Z A;  1VQ7 A;  2EQJ A;  3MF1 A;  1PCX A;  4RTT A;  3G71 T;  1YI2 A;  1M1K U;  3CCS T;  4PJM A;  4F7U E;  1OX8 A;  2CT3 A;  5HGQ A;  2EJG A;  3FEO A;  2GQI A;  5CO7 A;  3X26 B;  5DLQ E;  4ZN3 A;  2CUB A;  2XDD A;  2CGH A;  1IGU A;  2PNI A;  3I9Q A;  1PD1 A;  3OYY A;  3CPW A;  3L2Z A;  4ZGD B;  3VS1 A;  4Q5W A;  3UDC A;  3PZC A;  3G6E Q;  4L59 A;  2D0N A;  2BUD A;  4LD6 A;  2M51 A;  2BZX A;  3LLR A;  1VQ9 T;  2LVM A;  3CBP A;  2QA4 T;  5LJ5 g;  1UGR B;  1IGQ A;  3V8K A;  4L5G A;  3CC7 A;  1BKB A;  3JB9 D;  3CCU A;  4BW9 A;  2YHT A;  1QWE A;  1YJN Q;  5K1P A;  3G6E A;  3E19 A;  4NS5 A;  2LDM A;  2FYK A;  5FLX E;  4G85 A;  2J6O A;  1M30 A;  4AMC A;  3A8O B;  2DEU A;  3REA B;  3VQV A;  1YJN A;  2YRV A;  2FEI A;  2YUO A;  3WXM B;  1H64 1;  2ODR D;  2EQI A;  5GAO q;  4GLM A;  4ZNX A;  5CVI A;  5IXF A;  2DQ3 A;  3EG2 A;  1S72 T;  2MYS A;  1H3Z A;  2LJ3 A;  4C5I A;  2ZAE A;  4DBQ A;  4YRL A;  1VA7 A;  3OYM A;  2KYB A;  2NLU A;  5GAN 8;  2CSI A;  2ENM A;  5GAM h;  2A3L A;  5GAO p;  1NG2 A;  4EX5 A;  5CKB A;  1NJ5 A;  3R6N A;  2ZNI A;  4M77 D;  2BZY A;  1M90 U;  1H92 A;  5CAI A;  2K4Y A;  3OQ5 A;  1IO6 A;  3REB B;  1MMD A;  3DB4 A;  4CH6 A;  4C92 C;  2VGM A;  4PJJ A;  2RO0 A;  2K2V A;  5HY6 A;  1ZUY A;  1EIY B;  1YWP A;  2RI5 A;  4P72 A;  3OB9 A;  1BIA A;  4HWP A;  3JRZ A;  5GAN 2;  4LNS A;  2R58 A;  3PNW C;  2HKN A;  3QYG B;  1SPK A;  4EDU A;  3PMT A;  3RDV A;  1Q82 C;  3I55 T;  3P8Y A;  3VYG A;  3OYF A;  2CJA A;  4C92 G;  2VKN A;  4OP0 A;  2KBT A;  3QHS A;  1OQK A;  3M5A A;  1JJC B;  3DSQ A;  5GAN d;  3C94 A;  2X4Y A;  1B3Q A;  5C6S A;  4BAC A;  1JRI A;  2K2M A;  3I56 T;  1ZA2 B;  1XTD A;  2DK3 A;  3OBW A;  3CC4 T;  3BDL A;  4VUB A;  5IH2 A;  4BY6 B;  3CD6 T;  4DBF A;  5KYN A;  4WF2 A;  1B7Y A;  2RJF A;  5J26 A;  1HSQ A;  1ZSZ A;  2DX1 A;  5C51 B;  4XU3 A;  1WDX A;  3A31 A;  3OYC A;  3M0U A;  5EG2 A;  3CC2 T;  4YCW A;  1UGP B;  3FJ5 A;  2JVV A;  4M78 C;  2K5I A;  1VQ4 Q;  5CKD A;  5A0D A;  3RES A;  3VJP A;  1D3B B;  1MGQ A;  1IXD A;  1XNI A;  2NUT B;  1K73 U;  2PUO B;  2DM1 A;  2FRY A;  1XQH A;  4P5N A;  1LVK A;  1RIQ A;  3LGL A;  3NPF A;  2JM8 A;  5D6Y A;  4C0G A;  1S1N A;  4YRO A;  1QE0 A;  4IKF A;  9ATC B;  1WHG A;  5GMK m;  3EH2 A;  4OVA A;  3TUP A;  2P0K A;  3GPL A;  3U23 A;  3L2Q A;  1VQ4 A;  2DIQ A;  3A7U A;  2EKO A;  2AKL A;  1Q81 C;  4M78 G;  3OYG A;  4F04 B;  2ZPG B;  2JS0 A;  3L2W A;  2ZPH B;  4NCX A;  1TWB A;  5GAO l;  1MMG A;  5FWB A;  3OYE A;  4F7U B;  3P8D A;  4YCU A;  4UP8 A;  5GAN 5;  2A37 A;  5EC7 A;  2Q5H A;  1NYG A;  1OU8 A;  3FLG A;  3WQZ A;  2EVR A;  3EGX A;  4YTL A;  1N8R U;  1EIF A;  5HKC A;  1IHW A;  4UP9 A;  1VQN T;  2ZGW A;  3E2U A;  1UEB A;  3NHN A;  1K0S A;  1OYX A;  2DRM A;  3MJX A;  2L3S A;  1WU7 A;  3EGU A;  3HXW A;  4P73 C;  3I35 A;  3LW5 E;  1M8M A;  3O5Z A;  4KRT A;  4LDY A;  1U8R A;  2J6K A;  2DU7 A;  2NUZ A;  2MK5 A;  12AS A;  2I4N A;  1VQM T;  3PIO A;  1UDL A;  1O75 A;  4OF1 A;  3JV3 A;  4WJ4 A;  4JRK A;  5FRO A;  4F7U F;  2CH4 A;  4PHC A;  2RD1 A;  4YRF A;  1M9S A;  3JCM V;  1N9S A;  3ULR B;  4X9C A;  4JRI A;  3VS4 A;  1KC8 C;  4M7D F;  2YUP A;  2QHV A;  2DNU A;  4ESR A;  1MMA A;  3PVL A;  4FYX B;  2JN0 A;  1GXI E;  4M77 E;  3M53 A;  4YRR A;  2DZ9 A;  4J7I A;  1SHF A;  3KUF A;  4C0D C;  5GAM d;  4HWT A;  4HT4 A;  3WVE B;  1WHL A;  4IUQ A;  3M4Q A;  1QVF A;  3M4P A;  5C52 B;  11AS A;  4CS4 A;  2Z0W A;  3SD4 A;  4P74 C;  4PJO G;  1VQK Q;  1LPL A;  3A74 A;  5L23 A;  3QJ6 A;  1YJ9 Q;  4AG2 C;  5ECA A;  3VS6 A;  3HXU A;  4N0A C;  2QTV A;  3HFV A;  4AT1 B;  2L3R A;  2H3E B;  2P84 A;  4C0F A;  1DJ7 B;  5GMK e;  3RBB B;  3X28 B;  4DBR A;  1JEG A;  3TEG A;  5GAN j;  4JJB A;  1YNZ A;  1M2O A;  2HL3 A;  3X24 B;  1X6O A;  2RK1 A;  5LJ5 e;  4ELZ C;  1K76 A;  2XKO C;  3MP6 A;  1YGB A;  5KYY B;  2RMO A;  1YFR A;  3QTC A;  1YB3 A;  2EKH A;  4CC3 A;  4J9G A;  1IRX A;  3JCM g;  3TQ7 P;  2AKW A;  2BZ8 A;  2QDL A;  4YRI A;  4YRK A;  3CQT A;  1AEY A;  1ADY A;  3QDR B;  2GFA A;  3VU3 C;  1ARK A;  2DD4 A;  2DL4 A;  4C5E A;  1I8F A;  3CEY A;  3NGP A;  1ASZ A;  3QYH B;  4LDV A;  2GTJ A;  2XG8 D;  3PVQ A;  2J7I A;  1X2H A;  1KQ1 A;  2RM4 A;  4XK8 E;  1KD1 U;  2G3R A;  2RJC A;  1RAF B;  3EGD A;  4P71 A;  2KI7 A;  5C0M A;  5HK3 A;  2KSS A;  1U3O A;  2YLB A;  1KQS S;  4II1 A;  2XTI A;  2O01 E;  3L2R A;  3CXC P;  2DEQ A;  3P8B B;  1QMC A;  3CME T;  4E7H A;  1F1B B;  1B7T A;  3HHT B;  1FWZ A;  4LNP A;  2QDY B;  4M75 C;  1GL5 A;  2ZCE A;  4KGV B;  2JZ2 A;  2QEX T;  1Q86 U;  1EVK A;  1KG1 A;  2EYQ A;  3LH0 A;  3SWN C;  3L4G B;  1UEC A;  4J9D A;  4HWO A;  2RA2 A;  2KYM A;  3M4Y A;  1AT1 B;  2PTK A;  1BB9 A;  1WXB A;  3G1J A;  1WHH A;  1QLY A;  5FRN A;  1VQ6 T;  1B7Y B; 
#chains in the Genus database with same CATH homology
 2PVO B;  1O9S A;  5CKH A;  1USY C;  2M1H A;  4M75 G;  2HQE A;  5KH6 A;  4WI1 A;  1W4S A;  1I81 A;  2DU5 A;  2DJZ A;  2RJE A;  1YJW A;  3OYN A;  4YRT A;  3PTA A;  3OBY A;  2E12 A;  3QBY A;  1VQ7 T;  3URG A;  1YI2 T;  4E7K A;  4M7A C;  3RER A;  3C95 A;  3TEE A;  3G7Z A;  2LCL A;  2EJ9 A;  5GAN f;  5C53 B;  3LX7 A;  2FVU A;  2EL9 A;  4LD9 K;  1VQ8 A;  2ZZE A;  2E41 A;  2RJD A;  3NEM A;  3BDU A;  5CK9 A;  4M7A G;  1NPR A;  5J3B A;  5IAY A;  3CCJ A;  3JCM Q;  4C8Q C;  1JB0 E;  1UGS B;  2DTO A;  3CC7 T;  5FU6 C;  5KE2 A;  1NJ2 A;  3G6E T;  4M77 B;  3GP8 A;  3HKS A;  4FT2 A;  2QXF A;  3N5B B;  4QQG A;  1EFW A;  2FL7 A;  3RKX A;  4R55 A;  5HK0 A;  2MI6 A;  1EIY A;  4BDY A;  1BBW A;  1YJN T;  4BWA A;  1Q82 U;  5KE3 A;  2DXU A;  3OS5 A;  3CCR A;  3C12 A;  1WLE A;  4BY6 C;  5I21 A;  4RCB A;  2RI3 A;  2H3J A;  3RMQ A;  4H2X B;  3OW2 S;  3MQZ A;  4XU1 A;  4XTY A;  3ASK A;  1WYD A;  3HRU A;  3MP8 A;  3M4G A;  3ICA A;  3FB9 A;  3VKI A;  5A0L A;  1WPY A;  4B9W A;  3IG2 A;  4ME7 A;  4CS2 A;  3M54 A;  2ZR3 A;  1W2B S;  4YCV A;  2IG0 A;  2KVQ G;  1YBY A;  1ASY A;  1D3B A;  2X4W A;  3LC0 A;  1SES A;  1VIE A;  1YFT A;  3ER0 A;  3LYI A;  1BI1 A;  2XD0 A;  3G4S A;  2KMT A;  1Q81 U;  4LVK A;  2GFU A;  5GAN h;  1ZHI A;  2ZIO A;  4J83 A;  3ME9 A;  4P3P A;  2V8I A;  3WVD B;  2L8D A;  5A0G A;  4M7D C;  4FU6 A;  3QO7 A;  1YIT A;  2LX9 A;  4RDX A;  4F7U G;  5GAO m;  4DA4 A;  4M7D G;  2GF7 A;  2RHY A;  3X20 B;  3A5Y A;  1JJ2 A;  3LSQ A;  5I2S A;  3UGQ A;  4EPC A;  3S6W A;  2ZNJ A;  3JCM e;  3CPF A;  2DXB A;  5ELO A;  2P0P A;  2QQA A;  2DXC A;  1VQ4 T;  4JLI A;  2ZPI B;  5IT9 E;  3CCL A;  1BI2 A;  4CH5 A;  1B8A A;  5CIU A;  1NPP A;  1KC8 U;  4RG8 A;  5A2Q E;  3CPW S;  4HCC A;  2HAX A;  2BKD N;  2RHZ A;  2E5Q A;  1XOV A;  5FU7 C;  3VYH B;  2HNI A;  3GF5 A;  2XU8 A;  4XAX B;  3RUX A;  2DTH A;  3OS2 A;  4ZTZ B;  2CYZ B;  3JB9 H;  2Q7G A;  1YFS A;  3VQX A;  4FIB A;  5GAN 3;  3V7S A;  1ATI A;  2DKG A;  2RHI A;  3UFG A;  3S3M A;  4HT9 A;  4KR2 A;  2RH2 A;  1WGS A;  5LJ3 j;  4XTU A;  1M1F A;  1B70 B;  2JUF A;  3OYJ A;  4D6W A;  1NJ1 A;  1G5H A;  2ZZG A;  4M78 D;  3J7A F;  3CCM A;  3MEV A;  3HFZ B;  5GAN g;  3M56 A;  4YDQ A;  2C06 A;  5LJ3 e;  4LVL A;  4NL3 A;  1K9M U;  4OB1 B;  4RMO A;  5CCA A;  2DZC A;  3MO8 A;  4P75 A;  2YLC A;  3GNF B;  4LDX A;  1JBM A;  3JAM E;  2V8K A;  2L5Q A;  4EMK A;  4L87 A;  3W3S A;  1OZ2 A;  2VV5 A;  1Y71 A;  2DAQ A;  2XHC A;  2ARU A;  3CCQ A;  4ZTJ A;  1VQK T;  4XEM A;  3T9N A;  1YJ9 T;  5KNN A;  4TTV A;  1SER A;  2EIF A;  2ZIM A;  3OYA A;  1NE8 A;  3A8G B;  1LYL A;  2EQU A;  1M8V A;  2HD0 A;  3L4G A;  4XEO A;  2LT1 A;  2LC4 A;  2NS6 A;  2J3L A;  1KMN A;  4H2T A;  3HY1 A;  2XK0 A;  1B76 A;  3X25 B;  2X4J A;  2QI2 A;  2DDZ A;  1K8A C;  2B8A A;  3A32 A;  4XTX A;  3MEA A;  1G3T A;  3G1Z A;  4H2Y A;  1AHJ B;  4IUU A;  2GQV A;  4J7F A;  4DOW A;  2F5K A;  5F5W A;  2VXE A;  5J39 A;  2QHT A;  1G3Y A;  2VGN A;  3TCJ A;  3CCE A;  4ZTU B;  1VQL A;  1ZBX A;  2EFI A;  3CBM A;  3JCM J;  2ALY B;  1M4Z A;  2RHX A;  2JTF A;  4ATO A;  3QUI A;  4JLG A;  4JJN K;  3HL8 A;  1C0A A;  3FRN A;  3M59 A;  4JRP A;  5GAM g;  1Y07 A;  1Y7X A;  1Y96 A;  1VQP A;  1G5V A;  5KCO A;  2X4X A;  4M77 A;  2ART A;  3UPU A;  2ZT8 A;  2DVE A;  5IN1 A;  3EAE A;  3OMG A;  4OB2 B;  4M78 E;  5DM7 R;  2QQR A;  4C5G A;  3BJU A;  2CZ6 B;  3E9H A;  1QP2 A;  4PJO C;  4TQD A;  3PMI A;  4YRM A;  1YIJ A;  3DB3 A;  3CCJ T;  4H2X A;  1M1K C;  5GMK j;  2LRQ A;  4TVW A;  4XU2 A;  1QVF S;  4PNO A;  4M75 D;  4C0Z A;  3HRI A;  2LT4 A;  5LJ5 j;  5DY9 A;  2MMP A;  3Q1J A;  3UT1 A;  3MEU A;  2KQW A;  2LQ8 A;  4UPA A;  2MAM A;  4QQD A;  1VQZ A;  4CI0 C;  2C8M A;  5ELN A;  4EMG A;  3HFN A;  2EQM A;  1EVL A;  2PQW A;  1Q7Y C;  4KBM B;  5FRM A;  3PGG A;  3PT9 A;  3LWI A;  4FT4 A;  2Q5I A;  1BI0 A;  4MZT A;  4E7I A;  3HXV A;  3E9I A;  3CCV T;  1V29 B;  2PUK B;  3CMQ A;  3OYH A;  5LL6 S;  3I55 A;  4M7A D;  2OAU A;  1VQO T;  1N6A A;  1VQ5 T;  4P71 C;  1WNL A;  4EMK B;  1QP3 A;  2C7I A;  1FXX A;  1HK9 A;  3SDZ A;  3I56 A;  2Y4X A;  3GNG A;  1QVG A;  2V8J A;  4ZIB A;  3CD6 A;  3JCM P;  4C8Q D;  2M0O A;  2ZPB B;  5L8R E;  3F70 A;  2XDB A;  4TVR A;  2M16 A;  1N27 A;  2DXT A;  4HCZ A;  4NOY A;  1YIT T;  4YRN A;  5GAO n;  2JTM A;  3DKM A;  4YRS A;  1QW1 A;  4JS5 A;  1H4S A;  2PME A;  4YYE A;  4MDX A;  2OTJ T;  4MML A;  3JCM X;  3CMA A;  3A7A A;  4ZGE B;  2X35 A;  3ZBD A;  2K3X A;  3FIF A;  4JDS A;  3JCM b;  2LTO A;  1GGM A;  3PFS A;  3L1A A;  2CIM A;  2OTL T;  5LJ5 f;  4A4F A;  2BIV A;  2ZT7 A;  4K88 A;  2WSE E;  3CBO A;  3LWH A;  3JCM c;  3RGL A;  1UGQ B;  1B70 A;  3CCL T;  4BD3 A;  3NTH A;  2A7Y A;  3MP1 A;  3VUZ A;  2QHU A;  4A54 A;  1QF6 A;  4LDU A;  3HFZ A;  4M78 B;  3QO8 A;  4H02 A;  4E7J A;  3S3N A;  3REU A;  3SFM A;  4M75 E;  3JB9 F;  2E6Z A;  1G3S A;  2VUB A;  1WJR A;  5DLO A;  1X54 A;  1Y96 B;  4GY5 A;  3CCU T;  1ZQ1 A;  3JB9 I;  3OYI A;  3DLL A;  4BE2 A;  4QVZ A;  4M7D D;  4IUT A;  4TWA A;  1X55 A;  1R8O B;  4OB0 B;  4JRQ A;  4TVA A;  3IKM B;  1Z7M A;  2IY5 B;  3M57 A;  4ZGJ B;  4BI3 A;  3MCA B;  4HA8 A;  4BI8 B;  5LJ3 d;  5GAM e;  4LDW A;  4YRP A;  3CCM T;  3CXC A;  2IVW A;  2E1H A;  2CZ7 B;  3V8L A;  4HWR A;  2VXF A;  3HFO A;  4M7A E;  4M77 F;  4UC4 A;  5GMK h;  3NEN A;  4Q6G A;  3E9F A;  1EOV A;  4XTV A;  1K8A U;  4V2S A;  4MMK A;  4KUI A;  2EQK A;  2I4O A;  2XID A;  3VBB A;  3M9Q A;  3OW2 A;  1WJS A;  3HY0 A;  4C8Q E;  4N4G A;  1Z7N A;  4FL6 A;  4C0D B;  2DO3 A;  4H2V A;  3A5Z B;  2P4T A;  3MHX A;  1NNH A;  2ALY A;  1BYM A;  3RKY A;  3O8V A;  2ZTG A;  2Q7E A;  1UB4 A;  4Y28 E;  3CME A;  4MZM A;  1YHQ A;  3QO3 A;  1HC7 A;  2AMC B;  3R6O A;  3HTZ A;  1MHN A;  3OA6 A;  4K86 A;  3RAC A;  2PU9 B;  1JJ2 S;  3HXX A;  1W66 A;  4MDW A;  4QW2 A;  2A8E A;  4YPF A;  3AHU A;  3CCE T;  1VQL T;  1KHC A;  1M1G A;  1KD1 C;  3C4S A;  4C92 D;  5CKF A;  2QQS A;  2G4C A;  4HWS A;  4A4H A;  1NJ8 A;  1HXD A;  2R57 A;  4XQ3 A;  3L2V A;  2E5A A;  1E1O A;  4AH6 A;  4OLF A;  1NYQ A;  1NZ9 A;  3BY7 A;  2I4M A;  3V8J A;  1PYS B;  2ZPF B;  4NL2 A;  4B9X A;  5CQX A;  1VQP T;  1Q86 C;  4M7D E;  3NFC A;  1NYR A;  3V7C A;  2XIC A;  1VUB A;  4PKC C;  1N9W A;  1QVP A;  3RMS A;  2LNV A;  4M75 B;  2KK4 A;  2ZIN A;  3TEH B;  4JS4 A;  4KT0 E;  4QVD A;  3SWN B;  5E3I A;  3IAL A;  4XTZ A;  4A53 A;  1TH7 A;  3GOX A;  1Q7Y U;  1U1T A;  1N9R A;  2ZT6 A;  1BI3 A;  2DIG A;  4EO4 A;  4ELY C;  3JCM W;  2GCX A;  1YIJ T;  4P75 C;  4DOV A;  3TRE A;  2VC8 A;  3QG1 A;  3H8Z A;  3RL6 A;  4EMK C;  1RL2 A;  2Y90 A;  3PCO B;  4M75 F;  1WJQ A;  4E51 A;  3MEY A;  4P72 C;  4TVY A;  3FJP A;  3JCM f;  4M7A B;  4TQF A;  5M9O A;  4TVA B;  1L0W A;  3E9G A;  3OYL A;  3IKL A;  5LJ5 d;  4PLI A;  3RF1 A;  3L42 A;  1SSF A;  1KOG A;  4HKE A;  3QJY A;  2CZ1 B;  4E47 A;  1KQ2 A;  2CKK A;  4DQ2 A;  2PVD B;  4OB3 B;  1NJI C;  4C8Q B;  3GIB A;  5FU6 B;  3KXT A;  2QQB A;  5AYF A;  4RQE A;  4C92 A;  1IL2 A;  3NET A;  4M7A F;  3A8H B;  5GAN 4;  4J6X A;  4HT8 A;  1E24 A;  3M55 A;  4RMF A;  3HP9 A;  4PJO D;  2P0L A;  4PLL A;  1X2G A;  3NTI A;  2WSF E;  4K87 A;  4P3O A;  4ZN1 A;  4C8Q F;  4RQF A;  3JB9 G;  5CKE A;  1H4Q A;  3RKW A;  2JOY A;  4C92 E;  3OYK A;  2ODR C;  4YRE A;  3RIR A;  4BE1 A;  4RCC A;  2QTX A;  5LJ3 f;  3A8L B;  2HQX A;  2E6N A;  4ZTF A;  5GAN 7;  3VUB A;  2Y4Y A;  2D0Q B;  1VIF A;  1BIB A;  4M78 A;  3QNE A;  1H4V B;  2EAY A;  3G71 A;  3CMA T;  4M77 C;  1YCY A;  5GAN 6;  3CCS A;  2PMF A;  1X56 A;  2RHS B;  3JCM h;  4X9D A;  1G3W A;  1I5L A;  4IUR A;  1PSE A;  3ZEH A;  4J6W A;  4EMH A;  4YP0 A;  3OYD A;  1P92 A;  4R56 A;  1YJW T;  5GMK i;  4M77 G;  4M7D B;  4KQE A;  2IY5 A;  4H2U A;  1VQ9 A;  2QA4 A;  3BW1 A;  2D6F A;  4UP7 A;  3QKJ A;  2QHS A;  1OZ3 A;  4YRJ A;  4RG2 A;  4GLK A;  3H6Z A;  1IZ6 A;  2R5A A;  1VQ8 T;  2K57 A;  5KCH A;  4C5H A;  2DD5 A;  1H4T A;  1BBU A;  2J3M A;  1WQW A;  4P73 A;  4YRG A;  3OS1 A;  1I4K 1;  4X5O A;  3HRT A;  3UH0 A;  1S72 A;  4QVC A;  1LNX A;  3QZ5 B;  4PL6 A;  4CRI A;  5I2M A;  2K5F A;  4PJO A;  3TU4 K;  4J5Y A;  5K1X A;  3KBG A;  2E70 A;  5LJ3 h;  3CCR T;  5FU7 B;  2O4X A;  3ERR A;  4CS3 A;  4BE0 A;  1NJ6 A;  3A5Z A;  1E1T A;  2RI2 A;  4CH4 A;  4P74 A;  1ADJ A;  2RHQ A;  3UWN A;  1FYF A;  1VQK A;  4N0A A;  4KR3 A;  1YJ9 A;  4Z02 A;  2DQ0 A;  5CR2 A;  4OGE A;  4PJO E;  3OSS C;  2AMC A;  2RK2 A;  2RHU A;  3J81 E;  1B34 A;  2ZZF A;  1OI1 A;  2XGT A;  3CC4 A;  1QVG S;  4O6J A;  1K9M C;  5GAN e;  3MF2 A;  1LOJ A;  4X34 A;  2R5M A;  4G84 A;  3NEL A;  1M90 C;  3FC3 A;  3G4S T;  4OMF B;  3I7F A;  2ZR2 A;  3CC2 A;  3J80 E;  4RKU E;  3KFU A;  2CZ0 B;  1M5Q 1;  4C92 B;  3MET A;  4E7L A;  2XDP A;  1KQS A;  2VYT A;  3VQW A;  1WQ7 A;  4Y91 A;  1LJO A;  1YHQ T;  3HXZ A;  3ZFJ A;  1PYS A;  2E65 A;  3JCM d;  1PSF A;  4P3N A;  2ARS A;  3A7R A;  5CQY A;  2EJF A;  2I2L A;  2ZPE B;  3NTK A;  4M75 A;  2K3Y A;  3PIP A;  3TEH A;  1X01 A;  2FB7 A;  3FDR A;  2RB6 A;  5D6X A;  1E22 A;  3SWN A;  3R07 A;  3QZ9 B;  3UGT A;  2P5I A;  2L89 A;  4IUV A;  4C92 F;  3P8T A;  4A4G A;  5GMK l;  1VQN A;  4BI4 A;  4FM4 B;  1USY A;  3HSB A;  3LGF A;  2F5T X;  1HTT A;  1SET A;  4O2D A;  5LJ3 g;  4KUL A;  1K73 C;  2KY9 A;  3GLX A;  3OMC A;  1VQM A;  3REX A;  2LQK A;  4LVM A;  3PCO A;  3V7R A;  3L2U A;  5GAO r;  2CS7 A;  4XTW A;  2ZZD A;  2P0Q A;  4M7A A;  2I4L A;  4BB7 A;  4WJ3 M;  5GAM j;  4O5V A;  3VQY A;  2EWN A;  2DPP B;  4HCB A;  4J15 A;  3QII A;  1J5W A;  3QSU A;  4J8O A;  1G51 A;  2CJB A;  1X75 C;  1N8R C;  3P8H A;  2E3C A;  4M78 F;  1NJI U;  3OD1 A;  4DPG A;  2AHJ B;  4PG3 A;  4C8Q A;  3OY9 A;  1RI0 A;  2PVG B;  4L6V 5;  3CXC S;  4A4E A;  3JB9 J;  2K5L A;  4C8Q G;  1SRY A;  3EFR A;  2CJ9 A;  3INZ A;  3E1S A;  4FSX A;  3HRS A;  4H2S A;  3OYB A;  5D6W A;  2WAC A;  4H2W A;  3OS0 A;  2Q7H A;  2ZXF A;  1JJC A;  2JNG A;  3M58 A;  4J6Y A;  4IUP A;  5LJ5 h;  3CCV A;  3VV0 A;  2XI9 A;  2E64 A;  3P8V A;  4PJO B;  3CCQ T;  3HXY A;  2WSC E;  3BFM A;  1VQO A;  4OGC A;  4N4I A;  1VQ5 A;  4LVJ A;  2O4X B;  2F69 A;  4YRC A;  2FHD A;  3JSC A;  3MEW A;  2QQ9 A;  1W2B A;  1IRE B;  3A8M B;  1KMM A;  3OSV A;  4N4H A;  4BUG A;  2RHQ B;  2MWP A;  3LSS A;  1KHI A;  3SB2 A;  2E10 A;  4YRQ A;  1G5I A;  2MWO A;  2RHS A;  2HBP A;  4HVC A;  4PJO F;  2M9U A;  2QEX A;  3QXE B;  4MZP A;  4JUV A;  4Q15 A;  1B34 B;  3EFS A;  2AKW B;  1EQR A;  2KDS A;  2LCC A;  4F7U A;  3QPH A;  2KAF A;  2ZCF B;  3DLM A;  5GAM f;  1VQ6 A;  3HRK A;  1FX7 A;  3HPW A;  2OTJ A;  4XU0 A;  4BDZ A;  4M7D A;  2DTI A;  2MF2 A;  4LVI A;  3S3O A;  4KUD K;  2D9T A;  2OTL A;  2ZT5 A;  4QQ6 A;  4CH3 A;  3QO5 A;  4A4K A;  1U1S A;  1VQ7 A;  2EQJ A;  3MF1 A;  3G71 T;  1YI2 A;  1M1K U;  3CCS T;  4F7U E;  5HGQ A;  2EJG A;  3FEO A;  5CO7 A;  3X26 B;  5DLQ E;  4ZN3 A;  2XDD A;  2CGH A;  3OYY A;  3CPW A;  3L2Z A;  4ZGD B;  4Q5W A;  3UDC A;  3PZC A;  4L59 A;  2BUD A;  4LD6 A;  3LLR A;  1VQ9 T;  2LVM A;  3CBP A;  2QA4 T;  5LJ5 g;  1UGR B;  3V8K A;  4L5G A;  3CC7 A;  1BKB A;  3JB9 D;  3CCU A;  4BW9 A;  2YHT A;  5K1P A;  3G6E A;  3E19 A;  4NS5 A;  2LDM A;  2FYK A;  5FLX E;  4G85 A;  3A8O B;  3VQV A;  1YJN A;  2YRV A;  3WXM B;  1H64 1;  2ODR D;  5GAO q;  5CVI A;  2DQ3 A;  1S72 T;  1H3Z A;  4C5I A;  4YRL A;  3OYM A;  2NLU A;  5GAN 8;  5GAM h;  2A3L A;  5GAO p;  4EX5 A;  5CKB A;  1NJ5 A;  2ZNI A;  4M77 D;  1M90 U;  5CAI A;  2K4Y A;  3OQ5 A;  3DB4 A;  4CH6 A;  4C92 C;  2VGM A;  2RO0 A;  2K2V A;  5HY6 A;  1EIY B;  2RI5 A;  4P72 A;  3OB9 A;  1BIA A;  4HWP A;  3JRZ A;  5GAN 2;  4LNS A;  2R58 A;  3PNW C;  3QYG B;  4EDU A;  3PMT A;  1Q82 C;  3I55 T;  3P8Y A;  3VYG A;  3OYF A;  2CJA A;  4C92 G;  4OP0 A;  3QHS A;  3M5A A;  1JJC B;  3DSQ A;  5GAN d;  3C94 A;  2X4Y A;  5C6S A;  4BAC A;  1JRI A;  3I56 T;  2DK3 A;  1XTD A;  3OBW A;  3CC4 T;  3BDL A;  4VUB A;  4BY6 B;  3CD6 T;  4WF2 A;  1B7Y A;  2RJF A;  5J26 A;  5C51 B;  4XU3 A;  3A31 A;  3OYC A;  5EG2 A;  3CC2 T;  4YCW A;  1UGP B;  4M78 C;  2JVV A;  2K5I A;  5CKD A;  5A0D A;  3RES A;  3VJP A;  1D3B B;  1MGQ A;  1XNI A;  1K73 U;  2PUO B;  4P5N A;  1XQH A;  1RIQ A;  3LGL A;  5D6Y A;  4C0G A;  4YRO A;  1QE0 A;  4IKF A;  5GMK m;  4OVA A;  3TUP A;  2P0K A;  3GPL A;  3L2Q A;  1VQ4 A;  2DIQ A;  3A7U A;  2EKO A;  1Q81 C;  4M78 G;  3OYG A;  2ZPG B;  3L2W A;  2ZPH B;  4NCX A;  5GAO l;  3OYE A;  4F7U B;  3P8D A;  4YCU A;  4UP8 A;  5GAN 5;  2Q5H A;  3FLG A;  3WQZ A;  4YTL A;  1N8R U;  1EIF A;  5HKC A;  4UP9 A;  1VQN T;  2ZGW A;  1UEB A;  1OYX A;  1WU7 A;  3HXW A;  4P73 C;  3LW5 E;  4LDY A;  1U8R A;  2DU7 A;  12AS A;  2I4N A;  1VQM T;  3PIO A;  1O75 A;  4OF1 A;  4WJ4 A;  4JRK A;  5FRO A;  4F7U F;  4PHC A;  2RD1 A;  4YRF A;  1M9S A;  3JCM V;  1N9S A;  4X9C A;  4JRI A;  1KC8 C;  4M7D F;  2QHV A;  2JN0 A;  1GXI E;  4M77 E;  3M53 A;  4YRR A;  2DZ9 A;  4J7I A;  3KUF A;  4C0D C;  5GAM d;  4HWT A;  4HT4 A;  3WVE B;  4IUQ A;  3M4Q A;  1QVF A;  3M4P A;  5C52 B;  11AS A;  4CS4 A;  3SD4 A;  4P74 C;  4PJO G;  3A74 A;  3QJ6 A;  3HXU A;  4N0A C;  3HFV A;  2L3R A;  4C0F A;  1DJ7 B;  5GMK e;  3X28 B;  3TEG A;  5GAN j;  3X24 B;  1X6O A;  2RK1 A;  5LJ5 e;  4ELZ C;  2XKO C;  3MP6 A;  1YGB A;  1YFR A;  3QTC A;  1YB3 A;  3JCM g;  2AKW A;  4YRI A;  4YRK A;  1ADY A;  3QDR B;  2GFA A;  3VU3 C;  2DD4 A;  4C5E A;  1I8F A;  3CEY A;  1ASZ A;  3QYH B;  4LDV A;  2XG8 D;  1X2H A;  1KQ1 A;  2RM4 A;  4XK8 E;  1KD1 U;  2G3R A;  2RJC A;  4P71 A;  5C0M A;  5HK3 A;  2KSS A;  2YLB A;  1KQS S;  4II1 A;  2XTI A;  2O01 E;  3L2R A;  2DEQ A;  3P8B B;  3CME T;  4E7H A;  3HHT B;  1FWZ A;  2QDY B;  4M75 C;  2ZCE A;  2JZ2 A;  2QEX T;  1Q86 U;  1EVK A;  1KG1 A;  2EYQ A;  3LH0 A;  3SWN C;  3L4G B;  4HWO A;  2RA2 A;  3M4Y A;  5FRN A;  1VQ6 T;  1B7Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...