2E1HA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111g mutation
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
225
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 225
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e1hA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e1hA01
3I7FA 4M7DB 1Z7NA 4JLIA 1BIAA 4ZTUB 1JJCB 4P72C 2EJ9A 2C7IA 3JCMc 5GAOl 2ODRD 1E1TA 3MF1A 4M7AE 4C92D 5C53B 2QTXA 1WU7A 2DVEA 2Q7GA 4PJOG 3CMQA 3JCMg 5LJ5e 1NJ2A 2P5IA 4EMKA 3HRIA 4XTYA 1B7YB 2ZINA 5LJ5j 2ZCEA 2DEQA 4YP0A 2DU7A 4YRNA 2G4CA 2HNIA 3R07A 4QVCA 4C8QA 2RHSB 3PCOB 5GAN3 3JB9I 1I5LA 5HGQA 4XTXA 4A53A 4J6XA 1L0WA 2AKWB 2Y90A 4G85A 1NYQA 4UP7A 3REXA 2CJAA 4P3NA 4EMKC 1HTTA 4YRQA 4HT9A 4P71A 1H4VB 5GANe 3TEHA 1HXDA 1BBUA 4YREA 1X2GA 4M77G 1EQRA 4H2XA 5GANj 4C8QC 3JB9G 4HWPA 3V8JA 2FYKA 2E41A 5ELNA 1YFTA 4M75E 5GAN7 2YHTA 2EJFA 4M78A 1D3BA 5LJ5d 4HT8A 2Q5HA 4K88A 4M77F 4M7AG 1E22A 2XTIA 3L1AA 1WPYA 5I21A 3JB9F 2QHSA 4H2UA 4YCVA 3UGQA 4TVAA 2DZCA 4YRCA 1TH7A 1KQ2A 1ASZA 2E1HA 2ODRC 3JB9J 4M7AF 4C92C 1IL2A 3RGLA 4TVWA 3VU3C 4HWRA 4MMKA 1JBMA 1LYLA 5GANd 2ZNJA 5LJ3j 1X54A 3HFZA 1H4SA 4H2TA 2DQ0A 4X9DA 1X2HA 4XTZA 5GAMj 1NJ6A 1I81A 5GAOn 2RB6A 1SRYA 4XU1A 4YRPA 1PYSA 4M77B 4PJOD 5E3IA 2YLCA 4M75G 4EMHA 4H2VA 5LJ5h 1QF6A 4YRTA 4OLFA 4QVDA 4M7AB 3M4PA 5GMKe 4P3PA 4RQEA 4P75C 2CGHA 3INZA 2VXEA 4M75F 4DPGA 5LJ3d 2RHQA 4NL2A 4XTVA 3JB9H 2ALYB 4YPFA 2RM4A 2DXUA 4YCWA 4M77D 5GAMd 1ATIA 5GAN6 1U1TA 1USYC 2ZGWA 4H2XB 2AMCB 3TUPA 4MMLA 1EFWA 5GMKl 5GANh 4K86A 5C52B 2EWNA 3HXZA 1I8FA 4NOYA 3HRKA 3QO5A 4ZTZB 1YCYA 3JCMe 2IY5A 4M78B 4PJOA 1B70A 4TQDA 4M7AD 3TEGA 1GGMA 3VQXA 1X56A 1WYDA 4C8QE 4PG3A 1N9WA 3MEYA 2CJBA 2DXTA 1BBWA 3NENA 4KQEA 2ZR2A 4M75B 3QUIA 3EFRA 1ADYA 1B34A 4PJOC 1G5IA 1Y96A 4J15A 1JRIA 1EIYB 3BDUA 2J3MA 3A31A 3RERA 2FB7A 4M7DD 4H2SA 4CH3A 1MGQA 3RUXA 4P74C 2EL9A 5LJ3h 2ZT8A 4M78E 3HXVA 4V2SA 3HFVA 4DQ2A 1EOVA 3JCMd 3IKLA 1WQ7A 5GAMh 4NL3A 4KR2A 1M5Q1 1HC7A 3RF1A 3SWNC 1YB3A 2ZNIA 1G5HA 1PYSB 2DJZA 3RKYA 2VC8A 4M75D 2E65A 3RIRA 5K1PA 3HY0A 4G84A 4M77C 4C92A 3BJUA 3LSQA 1E1OA 4PHCA 4J6YA 1LJOA 3L4GA 3REUA 5GAN5 4C8QG 4F7UA 5CAIA 1WQWA 4N0AC 4YRIA 4EMGA 2EAYA 1SESA 3AHUA 4YRMA 4CS3A 4M7AC 4YROA 2RHQB 5GMKh 3HXYA 4L87A 2RA2A 3A7AA 4M7DA 3M4GA 4C8QF 1C0AA 2P0LA 4TWAA 4XTUA 5K1XA 3W3SA 4UP8A 4E51A 1JJCA 2ZR3A 2DDZA 5LJ3e 3WQZA 5DY9A 3IG2A 4O2DA 3RKWA 3V7RA 2J3LA 4M78G 5LJ5f 1LOJA 5GAMe 3BY7A 2IY5B 4YRLA 3JCMJ 4HA8A 3RKXA 1B70B 1B7YA 2DTOA 4YYEA 4M7DC 1WLEA 2DTIA 4H2YA 4P75A 3JCMh 4Y91A 3PZCA 4K87A 1B76A 3E9IA 3HXUA 4CH4A 1NYRA 3ERRA 3VQYA 4C92F 2RHSA 4M78F 3NETA 3PCOA 4WJ3M 4EMKB 5GAOm 1YFRA 2AKWA 3HXXA 4TTVA 4H02A 4A54A 3BFMA 4HVCA 1H4QA 3HY1A 3JCMV 3NEMA 4P3OA 3LSSA 4XU2A 1B34B 3QO3A 3L2ZA 4M75C 1Y96B 1USYA 2ZIMA 3JCMW 1HK9A 5GANf 4C8QB 3SB2A 2ZT5A 1H4TA 4RQFA 2CJ9A 2YLBA 3A5YA 3A5ZA 4PJOE 1KQ1A 4KR3A 4CH6A 3TEHB 4YRJA 5GAOq 4CS2A 3JB9D 4CS4A 2Q7HA 1U1SA 1H641 4C92B 4UP9A 4RCCA 1D3BB 1NJ1A 3V7SA 3A7RA 4RMFA 3HFOA 4YRRA 4XTWA 3MF2A 1KMNA 2RD1A 4WI1A 4TVAB 4YRGA 4P74A 2Q5IA 5LJ3f 3HSBA 4JRKA 3JCMQ 2ZTGA 4HWOA 2E5AA 2Q7EA 2DZ9A 1M8VA 2ZZEA 5GAMf 3NELA 2DU5A 4XU0A 1NNHA 3SWNA 3QHSA 1B8AA 4LNSA 3RESA 4J5YA 3G1ZA 4M78D 4M77A 2E10A 3HFZB 3LC0A 11ASA 4RCBA 4C92E 3HXWA 3EFSA 2ZT6A 1Z7MA 4HWTA 4ZIBA 3P8TA 4TQFA 4F7UE 4N0AA 4XEMA 1N9SA 3P8YA 3V8KA 4M7AA 5LJ5g 4XU3A 4PJOF 2CIMA 3RL6A 2E3CA 3FB9A 2K57A 1EVKA 5F5WA 2ZIOA 5GAN2 4EX5A 4M7DE 4UPAA 4WJ4A 2ALYA 3BW1A 2QHTA 2ZXFA 4JRIA 3JCMb 3UFGA 4BW9A 5GAOr 2ARUA 4P73A 4H2WA 4CH5A 4OP0A 1X01A 2I4OA 3VBBA 2AMCA 3HFNA 1N9RA 4WF2A 3E9HA 5GAN8 2I4MA 4YRKA 1KOGA 5GANg 3JCMf 2VXFA 1ADJA 4XQ3A 1I4K1 4RDXA 4HWSA 2PMFA 4P71C 4TVYA 3ICAA 3RACA 1ASYA 3IALA 3QO8A 4P73C 1LNXA 3QSUA 4Q15A 2ZZGA 4J6WA 4XEOA 4C92G 3FJPA 2ARTA 2PMEA 4PJOB 2I4NA 4M75A 4F7UG 3OD1A 5GMKm 4M78C 1NJ8A 2E64A 3VQWA 3UGTA 1YGBA 4JUVA 1EIYA 3JCMX 3UH0A 3KFUA 3VQVA 4M7DG 4PNOA 4F7UF 4Q6GA 2I2LA 3QTCA 4X5OA 5ELOA 1KMMA 5LJ3g 3P8VA 3SWNB 3JCMP 2DTHA 4YRSA 3V7CA 2ZT7A 2ZZFA 3FIFA 4M7DF 5GAOp 1X55A 3QO7A 1EVLA 5GAMg 1QE0A 4YCUA 2C8MA 5GMKi 3M4QA 2DQ3A 3A32A 2QHVA 2XGTA 1W66A 2JN0A 1J5WA 1SETA 1YFSA 3IKMB 1NJ5A 4AH6A 1E24A 2ARSA 2QHUA 3V8LA 2I4LA 4YDQA 3A74A 5GMKj 3A7UA 1RIQA 4NCXA 4C8QD 3DSQA 3L4GB 1G51A 4P72A 2DKGA 4F7UB 4BWAA 4EO4A 5GAN4 5C51B 1BIBA 1WNLA 3GIBA 4X9CA 2EJGA 3HTZA 1VQZA 12ASA 5KNNA 1FYFA 4M77E 3QNEA 1SERA 3PGGA 4YRFA
chains in the Genus database with same CATH superfamily
1Z7NA 4JLIA 1KQSP 1JJCB 3G1JA 1JXMA 3E1SA 4PKCC 2JJ9A 3I5SA 4JRQA 2F5KA 1E1TA 1WFWA 1ZX6A 4L5GA 2Q7GA 3I5RA 1K8AC 1VQOQ 4C5HA 2DL3A 2FZGB 1VQLQ 1B7YB 2KSSA 2RJDA 4FIBA 3UF4A 2COYA 2QTVA 1K76A 1JJ2A 5KCOA 2PUOB 4C8QA 5GAN3 3JB9I 1GL5A 3LGLA 4A53A 4J6XA 2QYZA 4E7HA 2Y90A 3CC4T 4CI0C 1NYQA 3CMET 1G8XA 3REXA 2CJAA 1T3SA 4RG2A 2BE9B 2OAWA 3J7AF 4Y92A 2FZKB 2OI3A 3META 1HXDA 3PFSA 1X27A 4M4ZA 4DA4A 4FYWB 2SEMA 5GANj 2JM8A 3CMAQ 3SEMA 2DBKA 4C8QC 3JB9G 4CC4B 2D8HA 2HBWA 1VQ7Q 4YTLA 4RMOA 2BZYA 3EGDA 4M78A 1P92A 1D3BA 2RQTA 4OMQA 1KK7A 1E22A 3DKMA 1VQ9Q 3UGQA 1IGQA 3QZ9B 4LN2A 3TU4K 1VQ7A 2CZ6B 2X51A 3A8MB 1KSWA 4M7AF 3EGUA 1IL2A 2QASA 3M0SA 3VU3C 3CCLA 3E9FA 3M4YA 1KQSA 2BKDN 2F69A 5GANd 4A4HA 4PLLA 1N8RC 4H2TA 2A0FB 3FDRA 3CCQT 4QKUA 4ZN1A 2RB6A 3NTHA 1GBRA 3H0IA 2HSPA 5D7UA 2E3HA 2GQVA 2LCLA 2SRCA 1KC8R 2HQEA 4LD9K 4BY6B 2K7AA 1MNEA 2CSIA 4OLFA 2NUZA 1TWBA 3M4PA 4P3PA 1WHHA 2CGHA 3OMCA 1M9SA 3MEWA 3INZA 3T9NA 4P75C 5L23A 3OYKA 4XTVA 3JB9H 2DA9A 3VS5A 2K2VA 2RI2A 4MZMA 2PVDB 4HVWA 5CO7A 4XK8E 3OSSC 1BI1A 2K3BA 5GAN6 5I22A 1USYC 3G71A 2AMCB 5GANh 4K86A 2EWNA 1I8FA 1MUZA 1MMGA 2YRCA 8AT1B 2MPXC 2RJCA 2O9SA 4E6RA 1WJSA 3EGDB 4M78B 5FW9A 4M7AD 2COZA 2AZSA 3L2QA 1GGMA 4LDVA 2HDAA 1AT1B 1MMNA 1YNZA 2FL7A 3QZ5B 3PIOA 2E5QA 2GF7A 4C8QE 2QEXQ 1EIFA 3EGXA 3X24B 3CCRT 3M55A 1VQ8T 1N9WA 2CJBA 2OAUA 2HKQB 2E5KA 4GBQA 1G3WA 2KXDA 3NENA 4KQEA 4NS5A 3CCEA 3QUIA 2C06A 1BB9A 5CKHA 3MJXA 4FM4B 2DL4A 2B86A 1YJNQ 2LJ1A 2QEXA 2DBMA 2FB7A 4M7DD 3TQ7P 2XU8A 1GFCA 1OEBA 4M78E 4V2SA 3SDZA 1EOVA 2ZAEA 1FMKA 1UGVA 1QKXA 3RF1A 3OYEA 2V1QA 2E65A 5K1PA 2GTJA 2YDLA 3I9QA 3BJUA 3IQLA 2FZCB 2LT4A 4D8DA 4J6YA 4II1A 4IKFA 1LJOA 2OTLA 3REUA 1D0YA 3CCMT 2D1XA 1BI0A 4F7UA 4HCCA 3P8DA 2XHCA 4N0AC 2DLPA 3SHWA 4CS3A 4M7AC 2IVWA 1BK2A 3HXYA 2L0AA 4L87A 3A7AA 4M7DA 3L2RA 2QQRA 4QQ6A 3W3SA 1U5SA 2EKHA 4UP8A 4ELZC 2ZR3A 1ABQA 4FU6A 2QQ9A 5DY9A 1VOMA 3ZL7C 3OY9A 4O2DA 2D0QB 2LQ8A 3V7RA 2J3LA 2PTKA 4BE2A 3RKXA 3CCJQ 4M7DC 2BE7D 3I35A 5D6WA 4H2YA 3PZCA 2ABLA 1B76A 3E9IA 4CH4A 1X6OA 3CCUT 4EMKB 2D6FA 2AKKA 4TTVA 4JJCA 1RAGB 3CCJA 4HVCA 1H4QA 3HY1A 4XU2A 2P4RA 3H41A 1HSQA 3SB2A 1M1KC 3A98A 4P5NA 2CJ9A 3C95A 2YLBA 4FYYB 1PKTA 2HMAA 1VQNA 1KD1R 3CC7T 4R56A 3DB4A 2A7YA 3PIPA 1LPLA 4BDZA 3CD6A 4YRJA 3OQ5A 3QWXX 3QYHB 1U1SA 3NPFA 4DOWA 1H641 4RCCA 1QVGS 4ME7A 4F14A 4RMFA 3HFOA 3LH5A 3PMIA 5AYFA 2EQMA 3MF2A 4P74A 2Q5IA 3HSBA 1WXBA 2MIOA 1ZQ1A 3JRZA 5KE3A 5D6YA 3OYBA 1QVFA 2K2MA 4HWOA 4DBFA 3LWHA 1M8VA 4DBHA 2RO0A 4JZ4A 5GAMf 4L59A 2OTJT 3UPUA 2KXCA 3G1ZA 4EIKA 1VQMQ 2E10A 2E3IA 3HXWA 4LDYA 4BUGA 2ZT6A 1YIJQ 3MP6A 2FEIA 4F7UE 4XEMA 1N9SA 2KT1A 5KYXB 2RQUA 4A4GA 5LJ5g 3MKDA 2A37A 2R5MA 2XMFA 2XD0A 2O4XB 2ZPGB 2X3WD 1RLPC 1VYTA 1EVKA 2RF0A 4M7DE 5IXBA 2FO0A 1M1FA 2CP3A 4JRIA 3JCMb 1M1KU 1RADB 2P0QA 3VS1A 1T3LA 1IO6A 3CCVQ 1X01A 3VBBA 4HCKA 1NG2A 1YBYA 5KYNA 2DXBA 1O9SA 3M0UA 2LCCA 3QWYA 3VKIA 3CPWP 3L2WA 1V1CA 4ZTJA 1KJWA 1KOGA 1I4K1 3RMQA 1VUBA 4LVMA 2CREA 1ACMB 2L89A 4TVYA 1KQSS 5HKCA 3CCVA 1SF9A 2KYMA 2VWFA 4Q15A 2CH4A 5D6XA 3FJPA 1PNJA 2M0YA 2EW3A 2PMEA 2P4TA 4PJOB 4FW2A 2I4NA 4M75A 1I07A 1VQ5Q 3M57A 5DM7R 3MCAB 4N4HA 5A0GA 1K4US 3G4ST 3JCMX 3KFUA 1A0NB 3HKSA 2L3SA 4GLKA 3HL8A 4PFZA 2I2LA 1OZ2A 5CQYA 1GFDA 1LVKA 2DK3A 5LJ3g 4IIOA 1E6HA 1Q7YC 1RAEB 1WJRA 3JV3A 1TOVA 4PLIA 2ZZFA 2X3XD 3OBWA 2CYZB 1RAAB 3H0FA 3M4QA 4OGCA 3CXCP 3A32A 3HP9A 2QHVA 3M0TA 3BE3A 2JN0A 3CBOA 1GRIA 1ZUYA 2EYXA 3U23A 3CCST 1SETA 4C5GA 4OGEA 4AH6A 2GTOA 2M16A 2HCKA 2QHUA 2KVQG 4OMLA 1PD0A 3A74A 4F16A 5GMKj 4J7FA 1RIQA 3I55T 4AFQC 3CPFA 5KYYB 2DKGA 2ZPEB 2HKNA 3OYLA 4QVZA 3H6ZA 1HYOA 4MZTA 1YHQQ 2LQNA 3CC4A 1FYFA 3CMEA 3QNEA 1WGSA 1H8KA 3DB3A 4LDUA 1IB8A 3MPUB 4IUVA 2EIFA 4ZTUB 2EJ9A 5DLOA 4C92D 1S1NA 3ER0A 2R58A 2COWA 3M0PA 5C0MA 1QCNA 1WU7A 2FRWA 2KEAA 3JCMg 4Z02A 4DEYA 5LJ5e 5FU6C 2KROA 3C94A 1Y7XA 1WHLA 2VGNA 1VIEA 3HRTA 4YRNA 1YI2Q 4PJLA 2X4YA 3PCOB 2K3YA 1X75C 2W10A 5CQXA 1I5LA 5HGQA 4XTXA 1L0WA 1IZ6A 4EPCA 2L2PA 4G85A 4LNPA 5IN1A 3SFMA 1KHIA 1Q7YU 1AZEA 1YITT 2JMAA 4RTXA 4YREA 4M77G 3CC2T 1MMDA 3C4SA 1LCKA 2P0KA 4EDUA 1GBQA 3H0HA 1K9MR 4LVIA 4BI3A 3CCQA 4Y28E 4M75E 5GAN7 2EJFA 1Q82R 2KRMA 1X2QA 4JLGA 2Q5HA 4K88A 1VA7A 2L8DA 2LX7A 4C5IA 4BE1A 4QT7A 4D6WA 1BCMA 3JB9F 2RQWA 2DIQA 4TVAA 1R0BG 2DZCA 4RTZA 1D0XA 3DLLA 1M90U 5KH6A 1UJ0A 5FLXE 2E1HA 2F2XA 3JB9J 2JZ2A 1N5ZA 1AWJA 2KK4A 4C92C 4BI8B 3RGLA 4MMKA 2RMOA 3LYIA 5EG2A 4JPBW 4QQGA 1RAHB 2ZNJA 1Y07A 2OX7A 4PL6A 1H3ZA 3HFZA 4ZN3A 2KY9A 4R55A 1HJDA 1YN8A 2WACA 4AG2C 4X9DA 1VQ6Q 5AT1B 2AK5A 1FMWA 4MDXA 4M77B 1PYSA 1UGSB 2CP6A 2EFIA 5E3IA 4A63B 1M27C 2HSEB 4H2VA 3LWIA 4KUIA 3OYCA 1QF6A 4KT0E 4AMCA 1RAFB 2QA4Q 3CCRA 4E7IA 4E7LA 4HVUA 4QVDA 1VQ8A 4YRTA 2DXCA 3FLGA 5GMKe 4RQEA 3MEAA 3QXEB 3G6ET 4DPGA 1UTIA 1SKUB 1S72Q 2YXYA 2Y4YA 5KYUA 2ALYB 1NJIC 2RM4A 2LNHB 2DXUA 1OPLA 1U1TA 1WJQA 5GMKl 3HRKA 2HQHA 3JCMe 4J9CA 4JJNK 1QVGA 3HRUA 2MWOA 4KULA 3TEGA 4K11A 3VQXA 2JMCA 4ZGDB 3ZFJA 1VQ4T 1X56A 1UDLA 2RHUA 4IUPA 1WYDA 2IIMA 4R0KA 2G6FX 2CP2A 5IHNA 3CCMA 3EFRA 1BKBA 3O8VA 1B34A 2NUPB 1G5IA 1ZBJA 2JW4A 1EIYB 2A8EA 3BDUA 1DJ7B 3RERA 3EHRA 2VVKA 2DPPB 1BCOA 1QKWA 1VQKT 3ZBDA 4LVKA 3CBPA 2JTMA 4RKUE 4GY5A 3HXVA 4DEXA 4DQ2A 2ZPHB 4N4IA 3OYIA 3IKLA 3M53A 2L3PA 2ESWA 4KR2A 1M5Q1 2ZNIA 3SWNC 1PYSB 2CZ7B 1G3TA 1PG5B 1NE8A 3RIRA 2LP5A 4ZNXA 1ZUUA 3L4GA 2RPNA 1ZHIA 4C8QG 3CCLQ 3CCUA 5I11A 6AT1B 4EMGA 3AHUA 3NTKA 1NJIU 4YROA 2RA2A 2E6NA 3OS1A 2P0LA 4XTUA 1RL2A 2MAMA 2LQWA 1ZSGA 3X26B 3GOXA 2EKOA 5A2QE 3OA6A 3IG2A 2RJFA 4RUGA 3CC7A 3RKWA 1K73R 2CT3A 4M78G 4YRLA 3JCMJ 2GNCA 1W2BP 3EHQA 3OYNA 4YYEA 1RABB 2QQBA 4PJNA 4P75A 2BIVA 2M51A 1K8AU 2XDBA 4FT2A 3WVEB 3E19A 1ZLMA 1RAIB 4LUDA 3VQYA 4J9EA 1RI0A 2RHSA 2PVOB 2CP7A 3H8ZA 1AHJB 2FRYA 1X6BA 2AKWA 4X34A 4A54A 1NPPA 2MI6A 1M30A 2X35A 4P3OA 1B34B 3QO3A 3L2ZA 1USYA 3JCMW 2E6ZA 5GANf 4C8QB 1PD1A 3M0RA 1VIFA 4RTTA 3G71Q 1YJWT 4RQFA 2H3EB 1G3SA 2ROLA 1W6XA 4OMMA 5IXFA 4JZ3A 1KQ1A 1AVZC 4KR3A 2VB6A 2OTJA 4BB7A 5GAOq 3RBBB 3KXTA 3QYGB 1QCFA 3CPWS 4Z88A 2KI7A 2D8JA 3RMSA 1AOJA 2DRKA 3CCEQ 1D3BB 4MDWA 2XG8D 2E12A 3A8GB 3V7SA 3A7RA 5EC7A 1WHGA 3OYGA 4XTWA 3QBYA 2KAFA 2M0OA 5CK9A 1G5VA 3A8OB 2CT4A 2RNAA 1M3BA 1UUEA 2RJEA 4JRKA 3M59A 4O5VA 2W0ZA 3JCMQ 2LNVA 2ZTGA 3L2VA 3VJPA 4QQDA 5CVIA 2O88A 2ZZEA 2M02A 3TSZA 4LDXA 1B8AA 1N6AA 4J9FA 2B8AA 2IPOB 4J5YA 3I56T 1PWTA 2ZPIB 1N8RU 4JJBA 3UA6A 1VQPT 1W2BA 3NFCA 3LC0A 5KE2A 4RCBA 4ATOA 1M2OA 2EGEA 4RTVA 2OTLQ 3P8TA 4N0AA 2JS0A 1AWOA 1OQKA 4CC2A 3CXCS 2DIGA 4M7AA 2V8IA 4PJOF 2CIMA 1M2VA 2DRMA 2E3CA 3FB9A 2YUNA 1J3TA 1IXDA 4E7SA 4UPAA 3ASKA 2F1LA 1AD5A 3BW1A 2ZXFA 4A4FA 3G4SA 2O2OA 1WXUA 3A8LB 2EQJA 4E7ZA 4CH5A 2CS7A 1PC0A 4PJMA 2K4YA 4ELYC 1UGRB 3CEYA 3QDFA 1ADJA 2V8KA 4HWSA 2PMFA 4P71C 2MK5A 1ASYA 2FPDA 3QO8A 2DNUA 2ROTA 2C0OA 2QDYB 1KFZA 5I2MA 1VQOT 1BI3A 2P0PA 4RTYA 4F7UG 3R6NA 5GMKm 1VQLT 3N5BB 2E64A 3MP1A 3EGXB 3L42A 4JUVA 3J80E 1D1AA 2YUOA 1Q86C 3I55A 3VQVA 3REBB 1VQNQ 4M7DG 3QKJA 2LCSA 4X5OA 2NWMA 3CD6Q 1TUGB 3V7CA 2ZT7A 1M1GA 3FIFA 1CKBA 3OW2P 3TVTA 2EGCA 2BZXA 3CMAT 3OB9A 5GAMg 4Q5WA 1M1KR 2MCNA 3QO7A 1JO8A 3FEOA 4YCUA 2LQKA 1WHKA 3FRNA 4JDSA 1O75A 2DQ3A 2AKLA 2F5TX 1SSFA 3OYYA 2QGGA 3OYJA 1J5WA 3UT1A 3IKMB 2A3LA 1NJ5A 1SHFA 4BACA 1CKAA 2EBPA 4LUEA 2RN8A 1VQ9T 4YDQA 2BTTA 3A7UA 2DD4A 1G51A 4LD6A 4P72A 2DJQA 2MOXA 1ABOA 4F7UB 2MMPA 3HRSA 2CZ0B 1BIBA 4E7JA 4X9CA 2EQKA 3NTIA 2EJGA 4KGZB 3PGGA 1YITA 2CSQA 1MMAA 2MF2A 1Q81R 5CKBA 4M7DB 1IREB 1M3AA 2RHYA 2NYSA 2ED1A 2CH4W 4P72C 2KNBB 1QLYA 3CC2A 1UHFA 5GAOl 3F70A 2ODRD 2O9VA 3MF1A 4M7AE 2O01E 5C53B 2XDDA 1UJYA 4E7KA 1FX7A 2QTXA 2DVEA 4O6JA 4E47A 1D1CA 4PJOG 3P8HA 2P5IA 2KMTA 2M9UA 3MO8A 3HRIA 2GFUA 4XTYA 5LJ5j 2DEQA 4YP0A 1Q86U 3G7ZA 3R07A 2XK0A 4LVLA 1EZZB 3THKA 5FRMA 4UP7A 1WYXA 2Y4XA 2LJ3A 3KUFA 4P3NA 3PE0A 1HTTA 1OU8A 4HT9A 2KYBA 1H4VB 3TEHA 1BBUA 2AZVA 1XJWB 2ZZDA 1BBZA 1EQRA 3RR6A 2EGAA 2K5FA 2KE9A 2K3XA 2FYKA 3C0CA 4IIMA 1R0CB 1YFTA 5LL6S 1HD3A 5IH2A 5LJ5d 2KRNA 4HT8A 4M77F 1G83A 2XTIA 2DMOA 3J81E 1IGUA 2MWPA 2CP5A 3HTRA 1WI7A 2P84A 3JAME 3O5ZA 2QEXT 1KQ2A 1OV3A 3FJ5A 1EX4A 2ODRC 3MEUA 4FYVB 2XI9A 4J9DA 3UDCA 1WDXA 3G6EA 1JBMA 1YJNT 1LYLA 5LJ3j 1BI2A 4FW1A 2WSCE 1X43A 1JEGA 4C0DC 2RHXA 5CKFA 4KGVB 2DQ0A 1NJ6A 1OZ3A 1ZBXA 4XU1A 4YRPA 2J6KA 2PVGB 2FVUA 4C5EA 4M75G 2RI5A 2HL3A 4RG8A 4EMHA 1NLPC 1VQ4A 5CR2A 5LJ5h 2QG9B 1I1JA 2CUDA 1PCXA 2QI2A 3CC4Q 1SHGA 3CMEQ 1M3CA 4MZPA 4PK4A 1KG1A 5LJ3d 2RHQA 4A4EA 4YPFA 1EFNA 4YCWA 4VUBA 2Z0WA 3NMZC 3OYMA 4M77D 1UFFA 3EG2A 1IRXA 3VYHB 1M90R 1K0SA 1ATIA 2BUDA 2G3RA 3CPWA 5FU7C 1OPKA 3OYAA 4MMLA 1VQKA 1W1FA 1EFWA 1QQJA 2IG0A 5HK3A 4NOYA 1WZOA 3QO5A 1NYFA 2IY5A 1ZA1B 4TQDA 1R77A 3LX7A 1GCPA 2HZYA 1NM7A 3EG1A 1W2BS 3OYDA 2DE0X 3EAEA 2ZR2A 1UEBA 4M75B 1SG5A 1FMVA 1ADYA 3REAB 1KHCA 1Y96A 4J15A 1JRIA 1NPRA 1QMCA 2V1RA 4CH3A 3VS3A 4H2SA 4KRTA 4ESRA 1MGQA 3RUXA 4BI4A 5LJ3h 3CCQQ 2ZT8A 2J6OA 2L5QA 5KCHA 2JTFA 3HFVA 4E2FB 2FHDA 3JCMd 1WQ7A 3CBMA 1HC7A 3CXCA 1AWWA 2EPDA 1D09B 2DJZA 1D1BA 1UHCA 2EYYA 2EYZA 4M77C 4C92A 1E1OA 4PHCA 1ZSZC 2E4HA 2DYIA 2NUTA 2D9TA 1K9AA 1GXIE 3R6OA 3X20B 3MQZA 3MEVA 1WQWA 1SESA 2RK1A 4YRMA 2RHQB 5GMKh 4X1VA 2C0IA 3D7SB 4C8QF 1C0AA 2QK0A 4TWAA 5K1XA 2WSFE 2K6DA 2ECZA 1YJWA 1ARKA 1JJCA 2DDZA 5LJ3e 3WQZA 2DYBA 1WHJA 2KDSA 5FU6B 1VQMT 3RDVA 3BY7A 2IY5B 4HA8A 1B7YA 1NLOC 3EG9A 3P8BB 1YIJT 2DTIA 3CCRQ 3JCMh 1VQ8Q 3LGFA 4K87A 2DL7A 5CKDA 3HXUA 1NYRA 1G3YA 1YJ9T 4M78F 1WHMA 4WJ3M 4KH1B 1JJ2P 5GAOm 1YFRA 3HXXA 1NBEB 2A36A 4Z8AA 1XTDA 3BFMA 3JCMV 1BU1A 2J7IA 5CCAA 1U3OA 1Y96B 3M58A 2ZIMA 1XQHA 4AFSC 1OULA 3RNJA 3PVQA 1GCQA 5FRNA 5A0DA 2DM1A 1RUWA 3CCVT 3A5YA 5KYWA 1WXTA 3A5ZA 4AT1B 1CSKA 1PM3A 3I56A 1VQPA 4CS2A 3JB9D 4CS4A 4JJDA 3TSWA 2Q7HA 1GCQC 2CUBA 4C92B 4UP9A 5FWBA 4PJJA 4AFZC 2YRDA 3CCMQ 1NJ1A 3OS2A 2NUTB 1M8MA 1RLQC 2PQWA 1VQ5T 1KMNA 2RD1A 4WI1A 4C0FA 4TVAB 5J26A 1F1BB 2CP0A 2K5IA 1K8AR 2E5AA 2Q7EA 2DZ9A 4C0ZA 4XU0A 3SWNA 3QHSA 1QP3A 5IT9E 3E9GA 1I5OB 4KGXB 4M78D 2HBPA 3HFZB 11ASA 4C92E 1SPKA 2J06A 2JOYA 1B07A 3OW2S 3EG3A 3M56A 3EG9B 4HWTA 1MNDA 1YCSB 3P8YA 3CCUQ 1QW1A 4XU3A 1QWFA 2RHIA 4ANJA 1VQOA 3LLRA 2FPEA 5FROA 2YUQA 1VQLA 2K57A 2HQXA 5F5WA 4EX5A 5GAN2 2QHTA 2LX9A 1OI1A 2QXFA 4BY6C 5GAOr 2ARUA 4P73A 4H2WA 1YHQT 4OP0A 1PKSA 3CC7Q 3HFNA 5GJWB 4KUDK 2AMCA 5KYWB 4OMNA 5KYUB 3A5ZB 4KBMB 4YRKA 4QW2A 5GANg 4XQ3A 4RDXA 4J8OA 4LE9A 3HHTB 2ZPFB 1I0CA 4IUUA 2QQAA 1UE9A 4P73C 3GNFB 3CMAA 1LNXA 3OSVA 2ZZGA 4J6WA 3VS4A 3PMTA 1UECA 1ZA2B 2RH2A 4OB3B 3GP8A 3OD1A 1N8RR 3LW5E 3X28B 4M78C 2L3RA 3VUZA 4IUQA 1NJ8A 1IHVA 1B3QA 1VQ9A 3VS6A 3VQWA 3UGTA 1JQQA 1YI2T 1K73C 1OOTA 2QAZA 2DVJA 3MP8A 4PNOA 4F7UF 3QTCA 4DBQA 3OYFA 5ELOA 2OTJQ 3VYGA 4UC4A 1D0ZA 3SWNB 4PFPA 3JCMP 2H3JA 2DTHA 4OMPA 4M7DF 1KC8C 1X55A 1EVLA 2C8MA 2NS6A 1R8OB 4PFOA 1QP2A 2XGTA 2LMJA 2VYTA 1W66A 1YFSA 1E24A 4AFUC 2ARSA 3ZEHA 3SD4A 3V8LA 1JB0E 2I4LA 2PZ1A 4A4KA 3DSQA 3L4GB 1RI9A 4BWAA 1E6GA 5GAN4 5C51B 2CDTA 1TUCA 2JUFA 5IHIA 3HTZA 3AT1B 12ASA 2CZ1B 3M54A 4HKEA 2KR3A 4LNSA 5A0LA 4YRFA 3I7FA 1BIAA 2MYSA 2HEQA 2C7IA 3JCMc 1VQ6T 3EH1A 3CMQA 2DX1A 1NJ2A 4BE0A 4EMKA 1FWZA 1B7TA 3UA7A 2ZINA 1V29B 1PSFA 2ZCEA 1TG0A 2DU7A 5HY6A 1AZGB 3EG0A 5IHKA 1K73U 1W70A 3G4SQ 1C0MA 2G4CA 1QWEA 1JU5C 2HNIA 4OVAA 4QVCA 2KQWA 2QA4T 2RHSB 2D0NA 2F2VA 2O31A 2AKWB 2GQIA 2X4WA 4EMKC 1S72T 4YRQA 1M4ZA 4P71A 1C6VX 1TUDA 1YJNA 5GANe 2EVRA 1KC8U 3S6WA 3NGPA 3GF5A 1X2GA 3VS7A 4F17A 4H2XA 2DAQA 3KFVA 1V76A 4HWPA 3V8JA 2VKNA 2E41A 1U8RA 5ELNA 2C0TA 2JTEA 2ZCFB 2YT6A 1T0HA 2YHTA 3CCSQ 2DEUA 2VASA 4M7AG 4RTWA 3L1AA 1WPYA 3A1PA 5I21A 2QHSA 4H2UA 4B6MA 2E70A 2JNGA 3PNWC 4YCVA 3GLXA 4YRCA 3I55Q 1TH7A 1UGQB 1UB4A 1ASZA 3CCSA 3VS0A 2GFAA 3JSCA 4TVWA 2J05A 4HWRA 1QVFP 9ATCB 4ZTFA 1VYUA 1X54A 1X6GA 5HK0A 4B9XA 1H4SA 1H3HA 1Q86R 2EYQA 1X2HA 4XTZA 5GAMj 1I81A 2LDMA 5GAOn 5KYXA 1SRYA 3DLMA 4PJOD 2YLCA 1OYXA 4L6V5 1AWXA 3WVDB 1NEBA 1UGPB 1PHTA 1PSEA 4J9BA 2O4XA 3UATA 1VQ7T 2YRVA 2DETA 1YP5A 3ME9A 4FSSA 4M7AB 5GJVB 1KD1C 1M2VB 3CCLT 2VXEA 4M75F 2V8JA 3NHNA 3M9QA 1ZUKA 4JS5A 4NL2A 1YITQ 3WXMB 2XICA 1X69A 1AEYA 1IHWA 2DL5A 1TSFA 3BDLA 2WSEE 3CC2Q 5GAMd 4ZGEB 2ZGWA 4H2XB 3TUPA 1X2KA 2LT1A 5C52B 4WTOB 3HXZA 4IURA 2PU9B 3KBGA 2LC4A 3VS2A 4ZTZB 1YCYA 3OMGA 4PJOA 4FCYA 1B70A 4KH0B 2VV5A 2EYWA 4ZGJB 3A8HB 3Q1JA 4PG3A 3MEYA 2RQRA 2X4XA 1WA7A 2DXTA 1Q81C 1BBWA 3VRYA 1PRMC 4J9HA 1VYVA 3OS0A 2LRQA 1JJ2S 4PJOC 2A08A 1T0JA 1W4SA 3QIIA 2DL8A 2RQVA 2PUKB 4JRPA 4RTUA 3S3NA 2J3MA 3A31A 5L8RE 4DBRA 4IUTA 2HAXA 3G71T 4P74C 2RK2A 2EL9A 4OMFB 4N4GA 1MHNA 3PTAA 3OW2A 3MHXA 3EFOA 5HCKA 2FG0A 4FYXB 3M5AA 5GAMh 4NL3A 1YJ9Q 1VQMA 1G5HA 1YB3A 4JS4A 3RKYA 3EH2A 4M75D 2VC8A 1U06A 2PNIA 2ZPBB 2JS2A 3HY0A 4LXCA 2OJ2A 1QCOA 4G84A 1FYNA 3LSQA 1JXOA 4FL6A 1YIJA 3CCET 1PRLC 5KYYA 3TEEA 5GAN5 1KD1U 2LTOA 3X25B 2XIDA 1RACB 3S3OA 1YJ9A 3G6EQ 5CAIA 4YRIA 2XDPA 2EAYA 1YFNA 1SRLA 1BYMA 4J9GA 2L3QA 3M4GA 4E51A 3PVLA 1MV0B 1QVPA 4F04B 1SEMA 1TU0B 2YUPA 1WX6A 2K9GA 4CC3A 2ATCB 2HD0A 5LJ5f 1LOJA 1K0XA 5GAMe 2J6FA 2KBTA 1B70B 1VQ4Q 2DTOA 2BZ8A 1WLEA 1G2BA 1TTHB 4OF1A 4Y91A 2OTLT 3FC3A 1Q81U 2LJ0A 1Q7YR 3ERRA 4C92F 3NETA 2KGTA 3PCOA 2QDLA 4H02A 2V26A 5ECAA 3QDRB 3NEMA 3LSSA 2DO3A 1VQ5A 4M75C 1NYGA 4FSXA 2VGMA 1HK9A 2ZT5A 2YWWA 1NEGA 3GPLA 1H4TA 2GCXA 4C0GA 2GBQA 1VQKQ 7AT1B 4PJOE 4LVJA 3C12A 4CH6A 3TEHB 3EFOB 2RHZA 2CKKA 1SRMA 3UWNA 2M1HA 4CC7A 2EQUA 1YWOA 4BD3A 2AHJB 5M9OA 1M90C 4AG1C 4OMOA 3CCJT 4YRRA 4J83A 5CIUA 4HCZA 3OBYA 4YRGA 2ED0A 5LJ3f 4HT4A 4TVRA 3LH0A 2K5LA 1MV3A 4C0DB 4B9WA 1VQNT 2R5AA 3ULRB 4HCBA 3L2UA 3NELA 2DU5A 1NNHA 1H92A 1C1AA 1YHQA 3CD6T 3RESA 5C6SA 3QJYA 4M77A 4DOVA 1ZSZA 3EFSA 4LDWA 1Z9ZA 5J39A 1Z7MA 4ZIBA 4HVVA 1N27A 4TQFA 3TREA 4J7IA 3V8KA 2AIRB 3PT9A 2LVMA 1Y71A 3RL6A 2ZIOA 1K1ZA 4WJ4A 1OX9A 2ALYA 3UFGA 2GGRA 4BW9A 5FU7B 1YI2A 1YJWQ 2JT4A 2VUBA 3VUBA 1K9MC 4D8KA 3VV0A 4GLMA 2I4OA 1N9RA 2AT1B 1Q95G 1WLPB 4WF2A 1Q82C 4HXJA 3H9NA 5GAN8 2YSQA 3E9HA 1YWPA 3TCJA 2I4MA 3HPWA 3QJ6A 2VXFA 3JCMf 3GNGA 4OB1B 3QG1A 3QPHA 3E2UA 2KRSA 3OYHA 3ICAA 3RACA 5FWCA 3IALA 1QVGP 3QSUA 2HL5C 4XEOA 4C92G 1UG1A 1OU9A 2ARTA 2F2WA 2XKOC 1SSHA 1XNIA 2FPFA 2NUPA 1KIKA 4J9IA 2NLUA 4BDYA 1WIEA 4OB0B 2QQSA 4FT4A 1YGBA 2JVVA 1EIYA 1TS9A 3UH0A 2X4JA 5CKEA 3OS5A 1XOVA 1Y0MA 4Q6GA 1KMMA 3P8VA 3I56Q 1Y57A 3VRZA 2X9HA 8ATCB 1VQPQ 4YRSA 1FXXA 2QGFB 3URGA 2JXBA 5GAOp 4Z89A 2EQIA 3GBQA 1QE0A 1ZSZB 5GMKi 2K79A 5IAYA 2ENMA 2DILA 3S3MA 1NJIR 1VQ6A 2DERA 5J3BA 2DD5A 2RI3A 4WCIA 2R57A 3M0QA 2JM9A 1TXQA 4NCXA 5DLQE 4C8QD 2LZ6B 4ORZA 1NZ9A 2DF6A 2I0NA 1K9MU 2KT8A 4EO4A 2A28A 2QA4A 4OB2B 4XAXB 1WNLA 3GIBA 2DFUA 1Q82U 1E7OA 3CQTA 1VQZA 1Z9QA 2H8HA 5KNNA 1OX8A 4M77E 1SERA 5I2SA 1S72A 4CRIA 1QVFS
chains in the Genus database with same CATH topology
1Z7NA 4JLIA 1JJCB 3E1SA 4PKCC 4JRQA 2F5KA 1E1TA 4L5GA 2Q7GA 1K8AC 4C5HA 1B7YB 2KSSA 2RJDA 4FIBA 1JJ2A 5KCOA 2PUOB 4C8QA 5GAN3 3JB9I 3LGLA 4A53A 4J6XA 4E7HA 2Y90A 3CC4T 4CI0C 1NYQA 3CMET 3REXA 2CJAA 4RG2A 3J7AF 3META 1HXDA 3PFSA 4DA4A 5GANj 4C8QC 3JB9G 4YTLA 4RMOA 4M78A 1P92A 1D3BA 1E22A 3DKMA 3UGQA 3QZ9B 3TU4K 1VQ7A 2CZ6B 3A8MB 4M7AF 1IL2A 3VU3C 3CCLA 3E9FA 3M4YA 1KQSA 2BKDN 2F69A 5GANd 4A4HA 4PLLA 1N8RC 4H2TA 3FDRA 3CCQT 4ZN1A 2RB6A 3NTHA 2GQVA 2LCLA 4LD9K 2HQEA 4BY6B 4OLFA 3M4PA 4P3PA 4P75C 2CGHA 3OMCA 1M9SA 3MEWA 3INZA 3T9NA 3OYKA 4XTVA 3JB9H 2K2VA 2RI2A 4MZMA 2PVDB 5CO7A 4XK8E 3OSSC 1BI1A 5GAN6 1USYC 3G71A 2AMCB 5GANh 4K86A 2EWNA 1I8FA 2RJCA 1WJSA 4M78B 4M7AD 3L2QA 1GGMA 4LDVA 3PIOA 2FL7A 3QZ5B 2E5QA 2GF7A 4C8QE 1EIFA 3X24B 1N9WA 3CCRT 3M55A 1VQ8T 2CJBA 2OAUA 1G3WA 3NENA 4KQEA 4NS5A 3CCEA 3QUIA 2C06A 5CKHA 4FM4B 2QEXA 2FB7A 4M7DD 2XU8A 4M78E 4V2SA 3SDZA 1EOVA 3RF1A 3OYEA 2E65A 5K1PA 3BJUA 2LT4A 4J6YA 4II1A 4IKFA 1LJOA 2OTLA 3REUA 3CCMT 1BI0A 4F7UA 4HCCA 3P8DA 2XHCA 4N0AC 4CS3A 4M7AC 2IVWA 3HXYA 4L87A 3A7AA 4M7DA 3L2RA 2QQRA 4QQ6A 3W3SA 4UP8A 4ELZC 2ZR3A 4FU6A 2QQ9A 5DY9A 3OY9A 4O2DA 2D0QB 2LQ8A 3V7RA 2J3LA 4BE2A 3RKXA 4M7DC 5D6WA 4H2YA 3PZCA 1B76A 3E9IA 4CH4A 1X6OA 3CCUT 4EMKB 2D6FA 4TTVA 3CCJA 4HVCA 1H4QA 3HY1A 4XU2A 3SB2A 1M1KC 4P5NA 2CJ9A 3C95A 2YLBA 1VQNA 3CC7T 4R56A 3DB4A 2A7YA 3PIPA 4BDZA 3CD6A 4YRJA 3OQ5A 3QYHB 1U1SA 4DOWA 1H641 4RCCA 1QVGS 4ME7A 4RMFA 3HFOA 3PMIA 5AYFA 2EQMA 3MF2A 4P74A 2Q5IA 3HSBA 1ZQ1A 3JRZA 5KE3A 5D6YA 3OYBA 1QVFA 4HWOA 3LWHA 1M8VA 2RO0A 5GAMf 4L59A 2OTJT 3UPUA 3G1ZA 2E10A 3HXWA 4LDYA 4BUGA 2ZT6A 3MP6A 4F7UE 4XEMA 1N9SA 4A4GA 5LJ5g 2R5MA 2XD0A 2O4XB 2ZPGB 1EVKA 4M7DE 1M1FA 4JRIA 3JCMb 1M1KU 2P0QA 1X01A 3VBBA 1YBYA 2DXBA 1O9SA 2LCCA 3VKIA 3L2WA 4ZTJA 1KOGA 1I4K1 3RMQA 1VUBA 4LVMA 2L89A 4TVYA 1KQSS 5HKCA 3CCVA 4Q15A 5D6XA 3FJPA 2PMEA 2P4TA 4PJOB 2I4NA 4M75A 3M57A 5DM7R 3MCAB 4N4HA 5A0GA 3G4ST 3JCMX 3KFUA 3HKSA 4GLKA 3HL8A 2I2LA 1OZ2A 5CQYA 2DK3A 5LJ3g 1Q7YC 1WJRA 4PLIA 2ZZFA 3OBWA 2CYZB 3M4QA 4OGCA 3A32A 3HP9A 2QHVA 2JN0A 3CBOA 1SETA 3CCST 4C5GA 4OGEA 4AH6A 2M16A 2QHUA 2KVQG 3A74A 5GMKj 4J7FA 1RIQA 3I55T 3CPFA 2DKGA 2ZPEB 3OYLA 4QVZA 3H6ZA 4MZTA 3CC4A 1FYFA 3CMEA 3QNEA 1WGSA 3DB3A 4LDUA 4IUVA 2EIFA 4ZTUB 2EJ9A 5DLOA 4C92D 3ER0A 2R58A 5C0MA 1WU7A 3JCMg 4Z02A 5LJ5e 5FU6C 3C94A 1Y7XA 2VGNA 1VIEA 3HRTA 4YRNA 2X4YA 3PCOB 2K3YA 1X75C 5CQXA 1I5LA 5HGQA 4XTXA 1L0WA 1IZ6A 4EPCA 4G85A 5IN1A 3SFMA 1KHIA 1Q7YU 1YITT 4YREA 4M77G 3CC2T 3C4SA 2P0KA 4EDUA 4LVIA 4BI3A 3CCQA 4Y28E 4M75E 5GAN7 2EJFA 4JLGA 2Q5HA 4K88A 2L8DA 4C5IA 4BE1A 4D6WA 3JB9F 2DIQA 4TVAA 2DZCA 3DLLA 1M90U 5KH6A 5FLXE 2E1HA 3JB9J 2JZ2A 2KK4A 4C92C 4BI8B 3RGLA 4MMKA 3LYIA 5EG2A 4QQGA 2ZNJA 1Y07A 4PL6A 1H3ZA 3HFZA 4ZN3A 2KY9A 4R55A 2WACA 4X9DA 4MDXA 4M77B 1PYSA 1UGSB 5E3IA 2EFIA 4H2VA 3LWIA 4KUIA 3OYCA 1QF6A 4KT0E 4YRTA 3CCRA 4E7IA 4E7LA 4QVDA 1VQ8A 2DXCA 3FLGA 5GMKe 4RQEA 3MEAA 3QXEB 3G6ET 4DPGA 2Y4YA 2ALYB 1NJIC 2RM4A 2DXUA 1U1TA 1WJQA 5GMKl 3HRKA 3JCMe 4JJNK 1QVGA 3HRUA 2MWOA 4KULA 3TEGA 3VQXA 1X56A 4ZGDB 3ZFJA 1VQ4T 2RHUA 4IUPA 1WYDA 3CCMA 3EFRA 1BKBA 3O8VA 1B34A 1G5IA 1EIYB 2A8EA 3BDUA 1DJ7B 3RERA 2DPPB 1VQKT 3ZBDA 4LVKA 3CBPA 2JTMA 4RKUE 4GY5A 3HXVA 4DQ2A 2ZPHB 4N4IA 3OYIA 3IKLA 3M53A 4KR2A 1M5Q1 2ZNIA 3SWNC 1PYSB 2CZ7B 1G3TA 1NE8A 3RIRA 3L4GA 1ZHIA 4C8QG 3CCUA 4EMGA 3AHUA 3NTKA 1NJIU 4YROA 2RA2A 2E6NA 3OS1A 2P0LA 4XTUA 1RL2A 2MAMA 3GOXA 3X26B 2EKOA 5A2QE 3OA6A 3IG2A 2RJFA 3CC7A 3RKWA 4M78G 4YRLA 3JCMJ 3OYNA 4YYEA 2QQBA 4P75A 2BIVA 1K8AU 2XDBA 4FT2A 3WVEB 3E19A 3VQYA 1RI0A 2RHSA 2PVOB 3H8ZA 1AHJB 2AKWA 4X34A 4A54A 1NPPA 2MI6A 2X35A 4P3OA 1B34B 3QO3A 3L2ZA 1USYA 3JCMW 2E6ZA 5GANf 4C8QB 1VIFA 1YJWT 4RQFA 1G3SA 1KQ1A 4KR3A 2OTJA 4BB7A 5GAOq 3KXTA 3QYGB 3CPWS 3RMSA 1D3BB 4MDWA 2XG8D 2E12A 3A8GB 3V7SA 3A7RA 3OYGA 4XTWA 3QBYA 2KAFA 2M0OA 5CK9A 1G5VA 3A8OB 2RJEA 4JRKA 3M59A 4O5VA 3JCMQ 2LNVA 2ZTGA 3L2VA 3VJPA 4QQDA 5CVIA 2ZZEA 4LDXA 1B8AA 1N6AA 2B8AA 4J5YA 3I56T 2ZPIB 1N8RU 1VQPT 1W2BA 3NFCA 3LC0A 5KE2A 4RCBA 4ATOA 3P8TA 4N0AA 3CXCS 2DIGA 4M7AA 2V8IA 4PJOF 2CIMA 2E3CA 3FB9A 4UPAA 3ASKA 2ZXFA 3BW1A 4A4FA 3G4SA 3A8LB 4CH5A 2EQJA 2CS7A 2K4YA 4ELYC 1UGRB 3CEYA 1ADJA 2V8KA 4HWSA 2PMFA 4P71C 1ASYA 3QO8A 2QDYB 5I2MA 1VQOT 1BI3A 2P0PA 4F7UG 5GMKm 1VQLT 3N5BB 2E64A 3MP1A 3L42A 4JUVA 3J80E 1Q86C 3I55A 3VQVA 4M7DG 3QKJA 4X5OA 3V7CA 2ZT7A 1M1GA 3FIFA 3CMAT 3QO7A 3OB9A 5GAMg 4Q5WA 3FEOA 4YCUA 2LQKA 3FRNA 4JDSA 1O75A 2DQ3A 2F5TX 1SSFA 3OYYA 3OYJA 1J5WA 3UT1A 3IKMB 2A3LA 1NJ5A 4BACA 1VQ9T 4YDQA 3A7UA 2DD4A 1G51A 4LD6A 4P72A 4F7UB 2MMPA 3HRSA 2CZ0B 1BIBA 4E7JA 4X9CA 2EQKA 3NTIA 2EJGA 3PGGA 1YITA 2MF2A 4M7DB 5CKBA 1IREB 2RHYA 4P72C 3CC2A 5GAOl 3F70A 2ODRD 3MF1A 4M7AE 2O01E 5C53B 2XDDA 4E7KA 1FX7A 2QTXA 2DVEA 4O6JA 4E47A 4PJOG 3P8HA 2P5IA 2KMTA 2M9UA 3MO8A 3HRIA 2GFUA 4XTYA 5LJ5j 2DEQA 4YP0A 1Q86U 3G7ZA 3R07A 2XK0A 4LVLA 5FRMA 4UP7A 2Y4XA 3KUFA 4P3NA 1HTTA 4HT9A 1H4VB 3TEHA 1BBUA 2ZZDA 1EQRA 2K5FA 2K3XA 2FYKA 1YFTA 5LL6S 5LJ5d 4HT8A 4M77F 2XTIA 3J81E 2MWPA 3JAME 2QEXT 1KQ2A 2ODRC 3MEUA 2XI9A 3UDCA 3G6EA 1JBMA 1YJNT 1LYLA 5LJ3j 1BI2A 2WSCE 4C0DC 2RHXA 5CKFA 2DQ0A 1NJ6A 1OZ3A 1ZBXA 4XU1A 4YRPA 2PVGB 2FVUA 4C5EA 4M75G 2RI5A 4RG8A 4EMHA 1VQ4A 5CR2A 5LJ5h 2QI2A 4MZPA 1KG1A 5LJ3d 2RHQA 4A4EA 4YPFA 4YCWA 4VUBA 3OYMA 4M77D 3VYHB 1ATIA 2BUDA 2G3RA 3CPWA 5FU7C 3OYAA 4MMLA 1VQKA 1EFWA 2IG0A 5HK3A 4NOYA 3QO5A 2IY5A 4TQDA 3LX7A 1W2BS 3OYDA 3EAEA 2ZR2A 1UEBA 4M75B 1ADYA 1KHCA 1Y96A 4J15A 1JRIA 1NPRA 4CH3A 4H2SA 1MGQA 3RUXA 4BI4A 5LJ3h 2ZT8A 2L5QA 5KCHA 2JTFA 3HFVA 2FHDA 3JCMd 1WQ7A 3CBMA 1HC7A 3CXCA 2DJZA 4M77C 4C92A 1E1OA 4PHCA 2D9TA 1GXIE 3R6OA 3X20B 3MQZA 3MEVA 1WQWA 1SESA 2RK1A 4YRMA 2RHQB 5GMKh 4C8QF 1C0AA 4TWAA 5K1XA 2WSFE 1JJCA 1YJWA 2DDZA 5LJ3e 3WQZA 2KDSA 5FU6B 1VQMT 3BY7A 2IY5B 4HA8A 1B7YA 3P8BB 1YIJT 2DTIA 3JCMh 4K87A 3LGFA 5CKDA 3HXUA 1NYRA 1G3YA 1YJ9T 4M78F 4WJ3M 5GAOm 1YFRA 3HXXA 1XTDA 3BFMA 3JCMV 5CCAA 2ZIMA 1Y96B 3M58A 1XQHA 5FRNA 5A0DA 3CCVT 3A5YA 3A5ZA 3I56A 1VQPA 4CS2A 3JB9D 4CS4A 2Q7HA 4C92B 4UP9A 1NJ1A 3OS2A 2PQWA 1VQ5T 1KMNA 2RD1A 4WI1A 4C0FA 4TVAB 5J26A 2K5IA 2E5AA 2Q7EA 2DZ9A 4C0ZA 4XU0A 3SWNA 3QHSA 1QP3A 5IT9E 3E9GA 4M78D 2HBPA 3HFZB 11ASA 4C92E 2JOYA 3OW2S 3M56A 4HWTA 3P8YA 1QW1A 4XU3A 2RHIA 1VQOA 3LLRA 5FROA 1VQLA 2K57A 2HQXA 5F5WA 4EX5A 5GAN2 2QHTA 2LX9A 1OI1A 2QXFA 4BY6C 5GAOr 2ARUA 4P73A 4H2WA 1YHQT 4OP0A 4KUDK 2AMCA 3HFNA 3A5ZB 4KBMB 4YRKA 4QW2A 5GANg 4XQ3A 4RDXA 4J8OA 3HHTB 2ZPFB 4IUUA 2QQAA 4P73C 3GNFB 3CMAA 1LNXA 3OSVA 2ZZGA 4J6WA 3PMTA 2RH2A 4OB3B 3GP8A 3OD1A 3LW5E 3X28B 1NJ8A 2L3RA 4M78C 4IUQA 3VUZA 1VQ9A 3VQWA 3UGTA 1YI2T 1K73C 3MP8A 4PNOA 4F7UF 3QTCA 3OYFA 5ELOA 3VYGA 4UC4A 3SWNB 3JCMP 2H3JA 2DTHA 4M7DF 1KC8C 1X55A 1EVLA 2C8MA 2NS6A 1R8OB 1QP2A 2XGTA 2VYTA 1W66A 1YFSA 1E24A 2ARSA 3ZEHA 3SD4A 3V8LA 1JB0E 2I4LA 4A4KA 3DSQA 3L4GB 4BWAA 5GAN4 5C51B 2JUFA 3HTZA 12ASA 2CZ1B 3M54A 4HKEA 4LNSA 5A0LA 4YRFA 3I7FA 1BIAA 2C7IA 3JCMc 1VQ6T 3CMQA 1NJ2A 4BE0A 4EMKA 1FWZA 2ZINA 1V29B 1PSFA 2ZCEA 2DU7A 5HY6A 1K73U 2G4CA 2HNIA 4OVAA 4QVCA 2KQWA 2QA4T 2RHSB 2AKWB 2X4WA 4EMKC 1S72T 4YRQA 1M4ZA 4P71A 1YJNA 5GANe 1KC8U 3S6WA 3GF5A 1X2GA 4H2XA 2DAQA 4HWPA 3V8JA 2E41A 1U8RA 5ELNA 2ZCFB 2YHTA 4M7AG 3L1AA 1WPYA 5I21A 4H2UA 2QHSA 2E70A 2JNGA 3PNWC 4YCVA 3GLXA 4YRCA 1TH7A 1UGQB 1UB4A 1ASZA 3CCSA 2GFAA 3JSCA 4TVWA 4HWRA 4ZTFA 1X54A 5HK0A 4B9XA 1H4SA 2EYQA 1X2HA 4XTZA 5GAMj 1I81A 2LDMA 5GAOn 1SRYA 3DLMA 4PJOD 2YLCA 1OYXA 4L6V5 3WVDB 1UGPB 1PSEA 2O4XA 1VQ7T 2YRVA 3ME9A 4M7AB 1KD1C 3CCLT 2VXEA 4M75F 2V8JA 3M9QA 4JS5A 4NL2A 3WXMB 2XICA 3BDLA 2WSEE 5GAMd 4ZGEB 2ZGWA 4H2XB 3TUPA 2LT1A 5C52B 3HXZA 4IURA 2PU9B 3KBGA 2LC4A 4ZTZB 1YCYA 3OMGA 4PJOA 1B70A 2VV5A 4ZGJB 3A8HB 3Q1JA 4PG3A 3MEYA 2X4XA 2DXTA 1Q81C 1BBWA 3OS0A 2LRQA 1JJ2S 4PJOC 3QIIA 1W4SA 2PUKB 4JRPA 3S3NA 2J3MA 3A31A 5L8RE 4IUTA 2HAXA 3G71T 4P74C 2RK2A 2EL9A 4OMFB 4N4GA 1MHNA 3PTAA 3OW2A 3MHXA 3M5AA 5GAMh 4NL3A 1VQMA 1YB3A 1G5HA 4JS4A 3RKYA 2VC8A 4M75D 2ZPBB 3HY0A 4G84A 3LSQA 4FL6A 1YIJA 3CCET 1KD1U 3TEEA 5GAN5 2LTOA 3X25B 2XIDA 3S3OA 1YJ9A 5CAIA 4YRIA 2XDPA 2EAYA 1BYMA 3M4GA 4E51A 1QVPA 2HD0A 5LJ5f 1LOJA 5GAMe 1B70B 2DTOA 1WLEA 4OF1A 4Y91A 2OTLT 3FC3A 1Q81U 3ERRA 4C92F 3NETA 3PCOA 4H02A 3QDRB 3NEMA 3LSSA 2DO3A 1VQ5A 4M75C 4FSXA 2VGMA 1HK9A 2ZT5A 3GPLA 1H4TA 2GCXA 4C0GA 4PJOE 4LVJA 3C12A 4CH6A 3TEHB 2RHZA 2CKKA 3UWNA 2M1HA 2EQUA 4BD3A 2AHJB 5M9OA 1M90C 3CCJT 4YRRA 4J83A 5CIUA 4HCZA 3OBYA 4YRGA 5LJ3f 4HT4A 4TVRA 3LH0A 2K5LA 4C0DB 4B9WA 1VQNT 2R5AA 4HCBA 3L2UA 3NELA 2DU5A 1NNHA 1YHQA 3CD6T 3RESA 5C6SA 3QJYA 4M77A 4DOVA 3EFSA 4LDWA 5J39A 1Z7MA 4ZIBA 1N27A 4TQFA 3TREA 4J7IA 3V8KA 3PT9A 2LVMA 1Y71A 3RL6A 2ZIOA 4WJ4A 2ALYA 3UFGA 4BW9A 5FU7B 1YI2A 2VUBA 3VUBA 1K9MC 3VV0A 2I4OA 1N9RA 4WF2A 1Q82C 3E9HA 5GAN8 3TCJA 2I4MA 3HPWA 3QJ6A 2VXFA 3JCMf 3GNGA 4OB1B 3QG1A 3QPHA 3OYHA 3ICAA 3RACA 3IALA 3QSUA 4XEOA 4C92G 2ARTA 2XKOC 1XNIA 2NLUA 4BDYA 4OB0B 2QQSA 4FT4A 1YGBA 2JVVA 1EIYA 3UH0A 2X4JA 5CKEA 3OS5A 1XOVA 4Q6GA 1KMMA 3P8VA 4YRSA 1FXXA 3URGA 5GAOp 1QE0A 5GMKi 5IAYA 3S3MA 1VQ6A 5J3BA 2DD5A 2RI3A 2R57A 4NCXA 5DLQE 4C8QD 1NZ9A 1K9MU 4EO4A 2QA4A 4OB2B 4XAXB 1WNLA 3GIBA 1Q82U 1VQZA 5KNNA 4M77E 1SERA 5I2SA 1S72A 4CRIA 1QVFS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7F A;  4M7D B;  1Z7N A;  4JLI A;  1BIA A;  4ZTU B;  1JJC B;  4P72 C;  2EJ9 A;  2C7I A;  3JCM c;  5GAO l;  2ODR D;  1E1T A;  3MF1 A;  4M7A E;  4C92 D;  5C53 B;  2QTX A;  1WU7 A;  2DVE A;  2Q7G A;  4PJO G;  3CMQ A;  3JCM g;  5LJ5 e;  1NJ2 A;  2P5I A;  4EMK A;  3HRI A;  4XTY A;  1B7Y B;  2ZIN A;  5LJ5 j;  2ZCE A;  2DEQ A;  4YP0 A;  2DU7 A;  4YRN A;  2G4C A;  2HNI A;  3R07 A;  4QVC A;  4C8Q A;  2RHS B;  3PCO B;  5GAN 3;  3JB9 I;  1I5L A;  5HGQ A;  4XTX A;  4A53 A;  4J6X A;  1L0W A;  2AKW B;  2Y90 A;  4G85 A;  1NYQ A;  4UP7 A;  3REX A;  2CJA A;  4P3N A;  4EMK C;  1HTT A;  4YRQ A;  4HT9 A;  4P71 A;  1H4V B;  5GAN e;  3TEH A;  1HXD A;  1BBU A;  4YRE A;  1X2G A;  4M77 G;  1EQR A;  4H2X A;  5GAN j;  4C8Q C;  3JB9 G;  4HWP A;  3V8J A;  2FYK A;  2E41 A;  5ELN A;  1YFT A;  4M75 E;  5GAN 7;  2YHT A;  2EJF A;  4M78 A;  1D3B A;  5LJ5 d;  4HT8 A;  2Q5H A;  4K88 A;  4M77 F;  4M7A G;  1E22 A;  2XTI A;  3L1A A;  1WPY A;  5I21 A;  3JB9 F;  2QHS A;  4H2U A;  4YCV A;  3UGQ A;  4TVA A;  2DZC A;  4YRC A;  1TH7 A;  1KQ2 A;  1ASZ A;  2E1H A;  2ODR C;  3JB9 J;  4M7A F;  4C92 C;  1IL2 A;  3RGL A;  4TVW A;  3VU3 C;  4HWR A;  4MMK A;  1JBM A;  1LYL A;  5GAN d;  2ZNJ A;  5LJ3 j;  1X54 A;  3HFZ A;  1H4S A;  4H2T A;  2DQ0 A;  4X9D A;  1X2H A;  4XTZ A;  5GAM j;  1NJ6 A;  1I81 A;  5GAO n;  2RB6 A;  1SRY A;  4XU1 A;  4YRP A;  1PYS A;  4M77 B;  4PJO D;  5E3I A;  2YLC A;  4M75 G;  4EMH A;  4H2V A;  5LJ5 h;  1QF6 A;  4YRT A;  4OLF A;  4QVD A;  4M7A B;  3M4P A;  5GMK e;  4P3P A;  4RQE A;  4P75 C;  2CGH A;  3INZ A;  2VXE A;  4M75 F;  4DPG A;  5LJ3 d;  2RHQ A;  4NL2 A;  4XTV A;  3JB9 H;  2ALY B;  4YPF A;  2RM4 A;  2DXU A;  4YCW A;  4M77 D;  5GAM d;  1ATI A;  5GAN 6;  1U1T A;  1USY C;  2ZGW A;  4H2X B;  2AMC B;  3TUP A;  4MML A;  1EFW A;  5GMK l;  5GAN h;  4K86 A;  5C52 B;  2EWN A;  3HXZ A;  1I8F A;  4NOY A;  3HRK A;  3QO5 A;  4ZTZ B;  1YCY A;  3JCM e;  2IY5 A;  4M78 B;  4PJO A;  1B70 A;  4TQD A;  4M7A D;  3TEG A;  1GGM A;  3VQX A;  1X56 A;  1WYD A;  4C8Q E;  4PG3 A;  1N9W A;  3MEY A;  2CJB A;  2DXT A;  1BBW A;  3NEN A;  4KQE A;  2ZR2 A;  4M75 B;  3QUI A;  3EFR A;  1ADY A;  1B34 A;  4PJO C;  1G5I A;  1Y96 A;  4J15 A;  1JRI A;  1EIY B;  3BDU A;  2J3M A;  3A31 A;  3RER A;  2FB7 A;  4M7D D;  4H2S A;  4CH3 A;  1MGQ A;  3RUX A;  4P74 C;  2EL9 A;  5LJ3 h;  2ZT8 A;  4M78 E;  3HXV A;  4V2S A;  3HFV A;  4DQ2 A;  1EOV A;  3JCM d;  3IKL A;  1WQ7 A;  5GAM h;  4NL3 A;  4KR2 A;  1M5Q 1;  1HC7 A;  3RF1 A;  3SWN C;  1YB3 A;  2ZNI A;  1G5H A;  1PYS B;  2DJZ A;  3RKY A;  2VC8 A;  4M75 D;  2E65 A;  3RIR A;  5K1P A;  3HY0 A;  4G84 A;  4M77 C;  4C92 A;  3BJU A;  3LSQ A;  1E1O A;  4PHC A;  4J6Y A;  1LJO A;  3L4G A;  3REU A;  5GAN 5;  4C8Q G;  4F7U A;  5CAI A;  1WQW A;  4N0A C;  4YRI A;  4EMG A;  2EAY A;  1SES A;  3AHU A;  4YRM A;  4CS3 A;  4M7A C;  4YRO A;  2RHQ B;  5GMK h;  3HXY A;  4L87 A;  2RA2 A;  3A7A A;  4M7D A;  3M4G A;  4C8Q F;  1C0A A;  2P0L A;  4TWA A;  4XTU A;  5K1X A;  3W3S A;  4UP8 A;  4E51 A;  1JJC A;  2ZR3 A;  2DDZ A;  5LJ3 e;  3WQZ A;  5DY9 A;  3IG2 A;  4O2D A;  3RKW A;  3V7R A;  2J3L A;  4M78 G;  5LJ5 f;  1LOJ A;  5GAM e;  3BY7 A;  2IY5 B;  4YRL A;  3JCM J;  4HA8 A;  3RKX A;  1B70 B;  1B7Y A;  2DTO A;  4YYE A;  4M7D C;  1WLE A;  2DTI A;  4H2Y A;  4P75 A;  3JCM h;  4Y91 A;  3PZC A;  4K87 A;  1B76 A;  3E9I A;  3HXU A;  4CH4 A;  1NYR A;  3ERR A;  3VQY A;  4C92 F;  2RHS A;  4M78 F;  3NET A;  3PCO A;  4WJ3 M;  4EMK B;  5GAO m;  1YFR A;  2AKW A;  3HXX A;  4TTV A;  4H02 A;  4A54 A;  3BFM A;  4HVC A;  1H4Q A;  3HY1 A;  3JCM V;  3NEM A;  4P3O A;  3LSS A;  4XU2 A;  1B34 B;  3QO3 A;  3L2Z A;  4M75 C;  1Y96 B;  1USY A;  2ZIM A;  3JCM W;  1HK9 A;  5GAN f;  4C8Q B;  3SB2 A;  2ZT5 A;  1H4T A;  4RQF A;  2CJ9 A;  2YLB A;  3A5Y A;  3A5Z A;  4PJO E;  1KQ1 A;  4KR3 A;  4CH6 A;  3TEH B;  4YRJ A;  5GAO q;  4CS2 A;  3JB9 D;  4CS4 A;  2Q7H A;  1U1S A;  1H64 1;  4C92 B;  4UP9 A;  4RCC A;  1D3B B;  1NJ1 A;  3V7S A;  3A7R A;  4RMF A;  3HFO A;  4YRR A;  4XTW A;  3MF2 A;  1KMN A;  2RD1 A;  4WI1 A;  4TVA B;  4YRG A;  4P74 A;  2Q5I A;  5LJ3 f;  3HSB A;  4JRK A;  3JCM Q;  2ZTG A;  4HWO A;  2E5A A;  2Q7E A;  2DZ9 A;  1M8V A;  2ZZE A;  5GAM f;  3NEL A;  2DU5 A;  4XU0 A;  1NNH A;  3SWN A;  3QHS A;  1B8A A;  4LNS A;  3RES A;  4J5Y A;  3G1Z A;  4M78 D;  4M77 A;  2E10 A;  3HFZ B;  3LC0 A;  11AS A;  4RCB A;  4C92 E;  3HXW A;  3EFS A;  2ZT6 A;  1Z7M A;  4HWT A;  4ZIB A;  3P8T A;  4TQF A;  4F7U E;  4N0A A;  4XEM A;  1N9S A;  3P8Y A;  3V8K A;  4M7A A;  5LJ5 g;  4XU3 A;  4PJO F;  2CIM A;  3RL6 A;  2E3C A;  3FB9 A;  2K57 A;  1EVK A;  5F5W A;  2ZIO A;  5GAN 2;  4EX5 A;  4M7D E;  4UPA A;  4WJ4 A;  2ALY A;  3BW1 A;  2QHT A;  2ZXF A;  4JRI A;  3JCM b;  3UFG A;  4BW9 A;  5GAO r;  2ARU A;  4P73 A;  4H2W A;  4CH5 A;  4OP0 A;  1X01 A;  2I4O A;  3VBB A;  2AMC A;  3HFN A;  1N9R A;  4WF2 A;  3E9H A;  5GAN 8;  2I4M A;  4YRK A;  1KOG A;  5GAN g;  3JCM f;  2VXF A;  1ADJ A;  4XQ3 A;  1I4K 1;  4RDX A;  4HWS A;  2PMF A;  4P71 C;  4TVY A;  3ICA A;  3RAC A;  1ASY A;  3IAL A;  3QO8 A;  4P73 C;  1LNX A;  3QSU A;  4Q15 A;  2ZZG A;  4J6W A;  4XEO A;  4C92 G;  3FJP A;  2ART A;  2PME A;  4PJO B;  2I4N A;  4M75 A;  4F7U G;  3OD1 A;  5GMK m;  4M78 C;  1NJ8 A;  2E64 A;  3VQW A;  3UGT A;  1YGB A;  4JUV A;  1EIY A;  3JCM X;  3UH0 A;  3KFU A;  3VQV A;  4M7D G;  4PNO A;  4F7U F;  4Q6G A;  2I2L A;  3QTC A;  4X5O A;  5ELO A;  1KMM A;  5LJ3 g;  3P8V A;  3SWN B;  3JCM P;  2DTH A;  4YRS A;  3V7C A;  2ZT7 A;  2ZZF A;  3FIF A;  4M7D F;  5GAO p;  1X55 A;  3QO7 A;  1EVL A;  5GAM g;  1QE0 A;  4YCU A;  2C8M A;  5GMK i;  3M4Q A;  2DQ3 A;  3A32 A;  2QHV A;  2XGT A;  1W66 A;  2JN0 A;  1J5W A;  1SET A;  1YFS A;  3IKM B;  1NJ5 A;  4AH6 A;  1E24 A;  2ARS A;  2QHU A;  3V8L A;  2I4L A;  4YDQ A;  3A74 A;  5GMK j;  3A7U A;  1RIQ A;  4NCX A;  4C8Q D;  3DSQ A;  3L4G B;  1G51 A;  4P72 A;  2DKG A;  4F7U B;  4BWA A;  4EO4 A;  5GAN 4;  5C51 B;  1BIB A;  1WNL A;  3GIB A;  4X9C A;  2EJG A;  3HTZ A;  1VQZ A;  12AS A;  5KNN A;  1FYF A;  4M77 E;  3QNE A;  1SER A;  3PGG A;  4YRF A; 
#chains in the Genus database with same CATH topology
 1Z7N A;  4JLI A;  1KQS P;  1JJC B;  3G1J A;  1JXM A;  3E1S A;  4PKC C;  2JJ9 A;  3I5S A;  4JRQ A;  2F5K A;  1E1T A;  1WFW A;  1ZX6 A;  4L5G A;  2Q7G A;  3I5R A;  1K8A C;  1VQO Q;  4C5H A;  2DL3 A;  2FZG B;  1VQL Q;  1B7Y B;  2KSS A;  2RJD A;  4FIB A;  3UF4 A;  2COY A;  2QTV A;  1K76 A;  1JJ2 A;  5KCO A;  2PUO B;  4C8Q A;  5GAN 3;  3JB9 I;  1GL5 A;  3LGL A;  4A53 A;  4J6X A;  2QYZ A;  4E7H A;  2Y90 A;  3CC4 T;  4CI0 C;  1NYQ A;  3CME T;  1G8X A;  3REX A;  2CJA A;  1T3S A;  4RG2 A;  2BE9 B;  2OAW A;  3J7A F;  4Y92 A;  2FZK B;  2OI3 A;  3MET A;  1HXD A;  3PFS A;  1X27 A;  4M4Z A;  4DA4 A;  4FYW B;  2SEM A;  5GAN j;  2JM8 A;  3CMA Q;  3SEM A;  2DBK A;  4C8Q C;  3JB9 G;  4CC4 B;  2D8H A;  2HBW A;  1VQ7 Q;  4YTL A;  4RMO A;  2BZY A;  3EGD A;  4M78 A;  1P92 A;  1D3B A;  2RQT A;  4OMQ A;  1KK7 A;  1E22 A;  3DKM A;  1VQ9 Q;  3UGQ A;  1IGQ A;  3QZ9 B;  4LN2 A;  3TU4 K;  1VQ7 A;  2CZ6 B;  2X51 A;  3A8M B;  1KSW A;  4M7A F;  3EGU A;  1IL2 A;  2QAS A;  3M0S A;  3VU3 C;  3CCL A;  3E9F A;  3M4Y A;  1KQS A;  2BKD N;  2F69 A;  5GAN d;  4A4H A;  4PLL A;  1N8R C;  4H2T A;  2A0F B;  3FDR A;  3CCQ T;  4QKU A;  4ZN1 A;  2RB6 A;  3NTH A;  1GBR A;  3H0I A;  2HSP A;  5D7U A;  2E3H A;  2GQV A;  2LCL A;  2SRC A;  1KC8 R;  2HQE A;  4LD9 K;  4BY6 B;  2K7A A;  1MNE A;  2CSI A;  4OLF A;  2NUZ A;  1TWB A;  3M4P A;  4P3P A;  1WHH A;  2CGH A;  3OMC A;  1M9S A;  3MEW A;  3INZ A;  3T9N A;  4P75 C;  5L23 A;  3OYK A;  4XTV A;  3JB9 H;  2DA9 A;  3VS5 A;  2K2V A;  2RI2 A;  4MZM A;  2PVD B;  4HVW A;  5CO7 A;  4XK8 E;  3OSS C;  1BI1 A;  2K3B A;  5GAN 6;  5I22 A;  1USY C;  3G71 A;  2AMC B;  5GAN h;  4K86 A;  2EWN A;  1I8F A;  1MUZ A;  1MMG A;  2YRC A;  8AT1 B;  2MPX C;  2RJC A;  2O9S A;  4E6R A;  1WJS A;  3EGD B;  4M78 B;  5FW9 A;  4M7A D;  2COZ A;  2AZS A;  3L2Q A;  1GGM A;  4LDV A;  2HDA A;  1AT1 B;  1MMN A;  1YNZ A;  2FL7 A;  3QZ5 B;  3PIO A;  2E5Q A;  2GF7 A;  4C8Q E;  2QEX Q;  1EIF A;  3EGX A;  3X24 B;  3CCR T;  3M55 A;  1VQ8 T;  1N9W A;  2CJB A;  2OAU A;  2HKQ B;  2E5K A;  4GBQ A;  1G3W A;  2KXD A;  3NEN A;  4KQE A;  4NS5 A;  3CCE A;  3QUI A;  2C06 A;  1BB9 A;  5CKH A;  3MJX A;  4FM4 B;  2DL4 A;  2B86 A;  1YJN Q;  2LJ1 A;  2QEX A;  2DBM A;  2FB7 A;  4M7D D;  3TQ7 P;  2XU8 A;  1GFC A;  1OEB A;  4M78 E;  4V2S A;  3SDZ A;  1EOV A;  2ZAE A;  1FMK A;  1UGV A;  1QKX A;  3RF1 A;  3OYE A;  2V1Q A;  2E65 A;  5K1P A;  2GTJ A;  2YDL A;  3I9Q A;  3BJU A;  3IQL A;  2FZC B;  2LT4 A;  4D8D A;  4J6Y A;  4II1 A;  4IKF A;  1LJO A;  2OTL A;  3REU A;  1D0Y A;  3CCM T;  2D1X A;  1BI0 A;  4F7U A;  4HCC A;  3P8D A;  2XHC A;  4N0A C;  2DLP A;  3SHW A;  4CS3 A;  4M7A C;  2IVW A;  1BK2 A;  3HXY A;  2L0A A;  4L87 A;  3A7A A;  4M7D A;  3L2R A;  2QQR A;  4QQ6 A;  3W3S A;  1U5S A;  2EKH A;  4UP8 A;  4ELZ C;  2ZR3 A;  1ABQ A;  4FU6 A;  2QQ9 A;  5DY9 A;  1VOM A;  3ZL7 C;  3OY9 A;  4O2D A;  2D0Q B;  2LQ8 A;  3V7R A;  2J3L A;  2PTK A;  4BE2 A;  3RKX A;  3CCJ Q;  4M7D C;  2BE7 D;  3I35 A;  5D6W A;  4H2Y A;  3PZC A;  2ABL A;  1B76 A;  3E9I A;  4CH4 A;  1X6O A;  3CCU T;  4EMK B;  2D6F A;  2AKK A;  4TTV A;  4JJC A;  1RAG B;  3CCJ A;  4HVC A;  1H4Q A;  3HY1 A;  4XU2 A;  2P4R A;  3H41 A;  1HSQ A;  3SB2 A;  1M1K C;  3A98 A;  4P5N A;  2CJ9 A;  3C95 A;  2YLB A;  4FYY B;  1PKT A;  2HMA A;  1VQN A;  1KD1 R;  3CC7 T;  4R56 A;  3DB4 A;  2A7Y A;  3PIP A;  1LPL A;  4BDZ A;  3CD6 A;  4YRJ A;  3OQ5 A;  3QWX X;  3QYH B;  1U1S A;  3NPF A;  4DOW A;  1H64 1;  4RCC A;  1QVG S;  4ME7 A;  4F14 A;  4RMF A;  3HFO A;  3LH5 A;  3PMI A;  5AYF A;  2EQM A;  3MF2 A;  4P74 A;  2Q5I A;  3HSB A;  1WXB A;  2MIO A;  1ZQ1 A;  3JRZ A;  5KE3 A;  5D6Y A;  3OYB A;  1QVF A;  2K2M A;  4HWO A;  4DBF A;  3LWH A;  1M8V A;  4DBH A;  2RO0 A;  4JZ4 A;  5GAM f;  4L59 A;  2OTJ T;  3UPU A;  2KXC A;  3G1Z A;  4EIK A;  1VQM Q;  2E10 A;  2E3I A;  3HXW A;  4LDY A;  4BUG A;  2ZT6 A;  1YIJ Q;  3MP6 A;  2FEI A;  4F7U E;  4XEM A;  1N9S A;  2KT1 A;  5KYX B;  2RQU A;  4A4G A;  5LJ5 g;  3MKD A;  2A37 A;  2R5M A;  2XMF A;  2XD0 A;  2O4X B;  2ZPG B;  2X3W D;  1RLP C;  1VYT A;  1EVK A;  2RF0 A;  4M7D E;  5IXB A;  2FO0 A;  1M1F A;  2CP3 A;  4JRI A;  3JCM b;  1M1K U;  1RAD B;  2P0Q A;  3VS1 A;  1T3L A;  1IO6 A;  3CCV Q;  1X01 A;  3VBB A;  4HCK A;  1NG2 A;  1YBY A;  5KYN A;  2DXB A;  1O9S A;  3M0U A;  2LCC A;  3QWY A;  3VKI A;  3CPW P;  3L2W A;  1V1C A;  4ZTJ A;  1KJW A;  1KOG A;  1I4K 1;  3RMQ A;  1VUB A;  4LVM A;  2CRE A;  1ACM B;  2L89 A;  4TVY A;  1KQS S;  5HKC A;  3CCV A;  1SF9 A;  2KYM A;  2VWF A;  4Q15 A;  2CH4 A;  5D6X A;  3FJP A;  1PNJ A;  2M0Y A;  2EW3 A;  2PME A;  2P4T A;  4PJO B;  4FW2 A;  2I4N A;  4M75 A;  1I07 A;  1VQ5 Q;  3M57 A;  5DM7 R;  3MCA B;  4N4H A;  5A0G A;  1K4U S;  3G4S T;  3JCM X;  3KFU A;  1A0N B;  3HKS A;  2L3S A;  4GLK A;  3HL8 A;  4PFZ A;  2I2L A;  1OZ2 A;  5CQY A;  1GFD A;  1LVK A;  2DK3 A;  5LJ3 g;  4IIO A;  1E6H A;  1Q7Y C;  1RAE B;  1WJR A;  3JV3 A;  1TOV A;  4PLI A;  2ZZF A;  2X3X D;  3OBW A;  2CYZ B;  1RAA B;  3H0F A;  3M4Q A;  4OGC A;  3CXC P;  3A32 A;  3HP9 A;  2QHV A;  3M0T A;  3BE3 A;  2JN0 A;  3CBO A;  1GRI A;  1ZUY A;  2EYX A;  3U23 A;  3CCS T;  1SET A;  4C5G A;  4OGE A;  4AH6 A;  2GTO A;  2M16 A;  2HCK A;  2QHU A;  2KVQ G;  4OML A;  1PD0 A;  3A74 A;  4F16 A;  5GMK j;  4J7F A;  1RIQ A;  3I55 T;  4AFQ C;  3CPF A;  5KYY B;  2DKG A;  2ZPE B;  2HKN A;  3OYL A;  4QVZ A;  3H6Z A;  1HYO A;  4MZT A;  1YHQ Q;  2LQN A;  3CC4 A;  1FYF A;  3CME A;  3QNE A;  1WGS A;  1H8K A;  3DB3 A;  4LDU A;  1IB8 A;  3MPU B;  4IUV A;  2EIF A;  4ZTU B;  2EJ9 A;  5DLO A;  4C92 D;  1S1N A;  3ER0 A;  2R58 A;  2COW A;  3M0P A;  5C0M A;  1QCN A;  1WU7 A;  2FRW A;  2KEA A;  3JCM g;  4Z02 A;  4DEY A;  5LJ5 e;  5FU6 C;  2KRO A;  3C94 A;  1Y7X A;  1WHL A;  2VGN A;  1VIE A;  3HRT A;  4YRN A;  1YI2 Q;  4PJL A;  2X4Y A;  3PCO B;  2K3Y A;  1X75 C;  2W10 A;  5CQX A;  1I5L A;  5HGQ A;  4XTX A;  1L0W A;  1IZ6 A;  4EPC A;  2L2P A;  4G85 A;  4LNP A;  5IN1 A;  3SFM A;  1KHI A;  1Q7Y U;  1AZE A;  1YIT T;  2JMA A;  4RTX A;  4YRE A;  4M77 G;  3CC2 T;  1MMD A;  3C4S A;  1LCK A;  2P0K A;  4EDU A;  1GBQ A;  3H0H A;  1K9M R;  4LVI A;  4BI3 A;  3CCQ A;  4Y28 E;  4M75 E;  5GAN 7;  2EJF A;  1Q82 R;  2KRM A;  1X2Q A;  4JLG A;  2Q5H A;  4K88 A;  1VA7 A;  2L8D A;  2LX7 A;  4C5I A;  4BE1 A;  4QT7 A;  4D6W A;  1BCM A;  3JB9 F;  2RQW A;  2DIQ A;  4TVA A;  1R0B G;  2DZC A;  4RTZ A;  1D0X A;  3DLL A;  1M90 U;  5KH6 A;  1UJ0 A;  5FLX E;  2E1H A;  2F2X A;  3JB9 J;  2JZ2 A;  1N5Z A;  1AWJ A;  2KK4 A;  4C92 C;  4BI8 B;  3RGL A;  4MMK A;  2RMO A;  3LYI A;  5EG2 A;  4JPB W;  4QQG A;  1RAH B;  2ZNJ A;  1Y07 A;  2OX7 A;  4PL6 A;  1H3Z A;  3HFZ A;  4ZN3 A;  2KY9 A;  4R55 A;  1HJD A;  1YN8 A;  2WAC A;  4AG2 C;  4X9D A;  1VQ6 Q;  5AT1 B;  2AK5 A;  1FMW A;  4MDX A;  4M77 B;  1PYS A;  1UGS B;  2CP6 A;  2EFI A;  5E3I A;  4A63 B;  1M27 C;  2HSE B;  4H2V A;  3LWI A;  4KUI A;  3OYC A;  1QF6 A;  4KT0 E;  4AMC A;  1RAF B;  2QA4 Q;  3CCR A;  4E7I A;  4E7L A;  4HVU A;  4QVD A;  1VQ8 A;  4YRT A;  2DXC A;  3FLG A;  5GMK e;  4RQE A;  3MEA A;  3QXE B;  3G6E T;  4DPG A;  1UTI A;  1SKU B;  1S72 Q;  2YXY A;  2Y4Y A;  5KYU A;  2ALY B;  1NJI C;  2RM4 A;  2LNH B;  2DXU A;  1OPL A;  1U1T A;  1WJQ A;  5GMK l;  3HRK A;  2HQH A;  3JCM e;  4J9C A;  4JJN K;  1QVG A;  3HRU A;  2MWO A;  4KUL A;  3TEG A;  4K11 A;  3VQX A;  2JMC A;  4ZGD B;  3ZFJ A;  1VQ4 T;  1X56 A;  1UDL A;  2RHU A;  4IUP A;  1WYD A;  2IIM A;  4R0K A;  2G6F X;  2CP2 A;  5IHN A;  3CCM A;  3EFR A;  1BKB A;  3O8V A;  1B34 A;  2NUP B;  1G5I A;  1ZBJ A;  2JW4 A;  1EIY B;  2A8E A;  3BDU A;  1DJ7 B;  3RER A;  3EHR A;  2VVK A;  2DPP B;  1BCO A;  1QKW A;  1VQK T;  3ZBD A;  4LVK A;  3CBP A;  2JTM A;  4RKU E;  4GY5 A;  3HXV A;  4DEX A;  4DQ2 A;  2ZPH B;  4N4I A;  3OYI A;  3IKL A;  3M53 A;  2L3P A;  2ESW A;  4KR2 A;  1M5Q 1;  2ZNI A;  3SWN C;  1PYS B;  2CZ7 B;  1G3T A;  1PG5 B;  1NE8 A;  3RIR A;  2LP5 A;  4ZNX A;  1ZUU A;  3L4G A;  2RPN A;  1ZHI A;  4C8Q G;  3CCL Q;  3CCU A;  5I11 A;  6AT1 B;  4EMG A;  3AHU A;  3NTK A;  1NJI U;  4YRO A;  2RA2 A;  2E6N A;  3OS1 A;  2P0L A;  4XTU A;  1RL2 A;  2MAM A;  2LQW A;  1ZSG A;  3X26 B;  3GOX A;  2EKO A;  5A2Q E;  3OA6 A;  3IG2 A;  2RJF A;  4RUG A;  3CC7 A;  3RKW A;  1K73 R;  2CT3 A;  4M78 G;  4YRL A;  3JCM J;  2GNC A;  1W2B P;  3EHQ A;  3OYN A;  4YYE A;  1RAB B;  2QQB A;  4PJN A;  4P75 A;  2BIV A;  2M51 A;  1K8A U;  2XDB A;  4FT2 A;  3WVE B;  3E19 A;  1ZLM A;  1RAI B;  4LUD A;  3VQY A;  4J9E A;  1RI0 A;  2RHS A;  2PVO B;  2CP7 A;  3H8Z A;  1AHJ B;  2FRY A;  1X6B A;  2AKW A;  4X34 A;  4A54 A;  1NPP A;  2MI6 A;  1M30 A;  2X35 A;  4P3O A;  1B34 B;  3QO3 A;  3L2Z A;  1USY A;  3JCM W;  2E6Z A;  5GAN f;  4C8Q B;  1PD1 A;  3M0R A;  1VIF A;  4RTT A;  3G71 Q;  1YJW T;  4RQF A;  2H3E B;  1G3S A;  2ROL A;  1W6X A;  4OMM A;  5IXF A;  4JZ3 A;  1KQ1 A;  1AVZ C;  4KR3 A;  2VB6 A;  2OTJ A;  4BB7 A;  5GAO q;  3RBB B;  3KXT A;  3QYG B;  1QCF A;  3CPW S;  4Z88 A;  2KI7 A;  2D8J A;  3RMS A;  1AOJ A;  2DRK A;  3CCE Q;  1D3B B;  4MDW A;  2XG8 D;  2E12 A;  3A8G B;  3V7S A;  3A7R A;  5EC7 A;  1WHG A;  3OYG A;  4XTW A;  3QBY A;  2KAF A;  2M0O A;  5CK9 A;  1G5V A;  3A8O B;  2CT4 A;  2RNA A;  1M3B A;  1UUE A;  2RJE A;  4JRK A;  3M59 A;  4O5V A;  2W0Z A;  3JCM Q;  2LNV A;  2ZTG A;  3L2V A;  3VJP A;  4QQD A;  5CVI A;  2O88 A;  2ZZE A;  2M02 A;  3TSZ A;  4LDX A;  1B8A A;  1N6A A;  4J9F A;  2B8A A;  2IPO B;  4J5Y A;  3I56 T;  1PWT A;  2ZPI B;  1N8R U;  4JJB A;  3UA6 A;  1VQP T;  1W2B A;  3NFC A;  3LC0 A;  5KE2 A;  4RCB A;  4ATO A;  1M2O A;  2EGE A;  4RTV A;  2OTL Q;  3P8T A;  4N0A A;  2JS0 A;  1AWO A;  1OQK A;  4CC2 A;  3CXC S;  2DIG A;  4M7A A;  2V8I A;  4PJO F;  2CIM A;  1M2V A;  2DRM A;  2E3C A;  3FB9 A;  2YUN A;  1J3T A;  1IXD A;  4E7S A;  4UPA A;  3ASK A;  2F1L A;  1AD5 A;  3BW1 A;  2ZXF A;  4A4F A;  3G4S A;  2O2O A;  1WXU A;  3A8L B;  2EQJ A;  4E7Z A;  4CH5 A;  2CS7 A;  1PC0 A;  4PJM A;  2K4Y A;  4ELY C;  1UGR B;  3CEY A;  3QDF A;  1ADJ A;  2V8K A;  4HWS A;  2PMF A;  4P71 C;  2MK5 A;  1ASY A;  2FPD A;  3QO8 A;  2DNU A;  2ROT A;  2C0O A;  2QDY B;  1KFZ A;  5I2M A;  1VQO T;  1BI3 A;  2P0P A;  4RTY A;  4F7U G;  3R6N A;  5GMK m;  1VQL T;  3N5B B;  2E64 A;  3MP1 A;  3EGX B;  3L42 A;  4JUV A;  3J80 E;  1D1A A;  2YUO A;  1Q86 C;  3I55 A;  3VQV A;  3REB B;  1VQN Q;  4M7D G;  3QKJ A;  2LCS A;  4X5O A;  2NWM A;  3CD6 Q;  1TUG B;  3V7C A;  2ZT7 A;  1M1G A;  3FIF A;  1CKB A;  3OW2 P;  3TVT A;  2EGC A;  2BZX A;  3CMA T;  3OB9 A;  5GAM g;  4Q5W A;  1M1K R;  2MCN A;  3QO7 A;  1JO8 A;  3FEO A;  4YCU A;  2LQK A;  1WHK A;  3FRN A;  4JDS A;  1O75 A;  2DQ3 A;  2AKL A;  2F5T X;  1SSF A;  3OYY A;  2QGG A;  3OYJ A;  1J5W A;  3UT1 A;  3IKM B;  2A3L A;  1NJ5 A;  1SHF A;  4BAC A;  1CKA A;  2EBP A;  4LUE A;  2RN8 A;  1VQ9 T;  4YDQ A;  2BTT A;  3A7U A;  2DD4 A;  1G51 A;  4LD6 A;  4P72 A;  2DJQ A;  2MOX A;  1ABO A;  4F7U B;  2MMP A;  3HRS A;  2CZ0 B;  1BIB A;  4E7J A;  4X9C A;  2EQK A;  3NTI A;  2EJG A;  4KGZ B;  3PGG A;  1YIT A;  2CSQ A;  1MMA A;  2MF2 A;  1Q81 R;  5CKB A;  4M7D B;  1IRE B;  1M3A A;  2RHY A;  2NYS A;  2ED1 A;  2CH4 W;  4P72 C;  2KNB B;  1QLY A;  3CC2 A;  1UHF A;  5GAO l;  3F70 A;  2ODR D;  2O9V A;  3MF1 A;  4M7A E;  2O01 E;  5C53 B;  2XDD A;  1UJY A;  4E7K A;  1FX7 A;  2QTX A;  2DVE A;  4O6J A;  4E47 A;  1D1C A;  4PJO G;  3P8H A;  2P5I A;  2KMT A;  2M9U A;  3MO8 A;  3HRI A;  2GFU A;  4XTY A;  5LJ5 j;  2DEQ A;  4YP0 A;  1Q86 U;  3G7Z A;  3R07 A;  2XK0 A;  4LVL A;  1EZZ B;  3THK A;  5FRM A;  4UP7 A;  1WYX A;  2Y4X A;  2LJ3 A;  3KUF A;  4P3N A;  3PE0 A;  1HTT A;  1OU8 A;  4HT9 A;  2KYB A;  1H4V B;  3TEH A;  1BBU A;  2AZV A;  1XJW B;  2ZZD A;  1BBZ A;  1EQR A;  3RR6 A;  2EGA A;  2K5F A;  2KE9 A;  2K3X A;  2FYK A;  3C0C A;  4IIM A;  1R0C B;  1YFT A;  5LL6 S;  1HD3 A;  5IH2 A;  5LJ5 d;  2KRN A;  4HT8 A;  4M77 F;  1G83 A;  2XTI A;  2DMO A;  3J81 E;  1IGU A;  2MWP A;  2CP5 A;  3HTR A;  1WI7 A;  2P84 A;  3JAM E;  3O5Z A;  2QEX T;  1KQ2 A;  1OV3 A;  3FJ5 A;  1EX4 A;  2ODR C;  3MEU A;  4FYV B;  2XI9 A;  4J9D A;  3UDC A;  1WDX A;  3G6E A;  1JBM A;  1YJN T;  1LYL A;  5LJ3 j;  1BI2 A;  4FW1 A;  2WSC E;  1X43 A;  1JEG A;  4C0D C;  2RHX A;  5CKF A;  4KGV B;  2DQ0 A;  1NJ6 A;  1OZ3 A;  1ZBX A;  4XU1 A;  4YRP A;  2J6K A;  2PVG B;  2FVU A;  4C5E A;  4M75 G;  2RI5 A;  2HL3 A;  4RG8 A;  4EMH A;  1NLP C;  1VQ4 A;  5CR2 A;  5LJ5 h;  2QG9 B;  1I1J A;  2CUD A;  1PCX A;  2QI2 A;  3CC4 Q;  1SHG A;  3CME Q;  1M3C A;  4MZP A;  4PK4 A;  1KG1 A;  5LJ3 d;  2RHQ A;  4A4E A;  4YPF A;  1EFN A;  4YCW A;  4VUB A;  2Z0W A;  3NMZ C;  3OYM A;  4M77 D;  1UFF A;  3EG2 A;  1IRX A;  3VYH B;  1M90 R;  1K0S A;  1ATI A;  2BUD A;  2G3R A;  3CPW A;  5FU7 C;  1OPK A;  3OYA A;  4MML A;  1VQK A;  1W1F A;  1EFW A;  1QQJ A;  2IG0 A;  5HK3 A;  4NOY A;  1WZO A;  3QO5 A;  1NYF A;  2IY5 A;  1ZA1 B;  4TQD A;  1R77 A;  3LX7 A;  1GCP A;  2HZY A;  1NM7 A;  3EG1 A;  1W2B S;  3OYD A;  2DE0 X;  3EAE A;  2ZR2 A;  1UEB A;  4M75 B;  1SG5 A;  1FMV A;  1ADY A;  3REA B;  1KHC A;  1Y96 A;  4J15 A;  1JRI A;  1NPR A;  1QMC A;  2V1R A;  4CH3 A;  3VS3 A;  4H2S A;  4KRT A;  4ESR A;  1MGQ A;  3RUX A;  4BI4 A;  5LJ3 h;  3CCQ Q;  2ZT8 A;  2J6O A;  2L5Q A;  5KCH A;  2JTF A;  3HFV A;  4E2F B;  2FHD A;  3JCM d;  1WQ7 A;  3CBM A;  1HC7 A;  3CXC A;  1AWW A;  2EPD A;  1D09 B;  2DJZ A;  1D1B A;  1UHC A;  2EYY A;  2EYZ A;  4M77 C;  4C92 A;  1E1O A;  4PHC A;  1ZSZ C;  2E4H A;  2DYI A;  2NUT A;  2D9T A;  1K9A A;  1GXI E;  3R6O A;  3X20 B;  3MQZ A;  3MEV A;  1WQW A;  1SES A;  2RK1 A;  4YRM A;  2RHQ B;  5GMK h;  4X1V A;  2C0I A;  3D7S B;  4C8Q F;  1C0A A;  2QK0 A;  4TWA A;  5K1X A;  2WSF E;  2K6D A;  2ECZ A;  1YJW A;  1ARK A;  1JJC A;  2DDZ A;  5LJ3 e;  3WQZ A;  2DYB A;  1WHJ A;  2KDS A;  5FU6 B;  1VQM T;  3RDV A;  3BY7 A;  2IY5 B;  4HA8 A;  1B7Y A;  1NLO C;  3EG9 A;  3P8B B;  1YIJ T;  2DTI A;  3CCR Q;  3JCM h;  1VQ8 Q;  3LGF A;  4K87 A;  2DL7 A;  5CKD A;  3HXU A;  1NYR A;  1G3Y A;  1YJ9 T;  4M78 F;  1WHM A;  4WJ3 M;  4KH1 B;  1JJ2 P;  5GAO m;  1YFR A;  3HXX A;  1NBE B;  2A36 A;  4Z8A A;  1XTD A;  3BFM A;  3JCM V;  1BU1 A;  2J7I A;  5CCA A;  1U3O A;  1Y96 B;  3M58 A;  2ZIM A;  1XQH A;  4AFS C;  1OUL A;  3RNJ A;  3PVQ A;  1GCQ A;  5FRN A;  5A0D A;  2DM1 A;  1RUW A;  3CCV T;  3A5Y A;  5KYW A;  1WXT A;  3A5Z A;  4AT1 B;  1CSK A;  1PM3 A;  3I56 A;  1VQP A;  4CS2 A;  3JB9 D;  4CS4 A;  4JJD A;  3TSW A;  2Q7H A;  1GCQ C;  2CUB A;  4C92 B;  4UP9 A;  5FWB A;  4PJJ A;  4AFZ C;  2YRD A;  3CCM Q;  1NJ1 A;  3OS2 A;  2NUT B;  1M8M A;  1RLQ C;  2PQW A;  1VQ5 T;  1KMN A;  2RD1 A;  4WI1 A;  4C0F A;  4TVA B;  5J26 A;  1F1B B;  2CP0 A;  2K5I A;  1K8A R;  2E5A A;  2Q7E A;  2DZ9 A;  4C0Z A;  4XU0 A;  3SWN A;  3QHS A;  1QP3 A;  5IT9 E;  3E9G A;  1I5O B;  4KGX B;  4M78 D;  2HBP A;  3HFZ B;  11AS A;  4C92 E;  1SPK A;  2J06 A;  2JOY A;  1B07 A;  3OW2 S;  3EG3 A;  3M56 A;  3EG9 B;  4HWT A;  1MND A;  1YCS B;  3P8Y A;  3CCU Q;  1QW1 A;  4XU3 A;  1QWF A;  2RHI A;  4ANJ A;  1VQO A;  3LLR A;  2FPE A;  5FRO A;  2YUQ A;  1VQL A;  2K57 A;  2HQX A;  5F5W A;  4EX5 A;  5GAN 2;  2QHT A;  2LX9 A;  1OI1 A;  2QXF A;  4BY6 C;  5GAO r;  2ARU A;  4P73 A;  4H2W A;  1YHQ T;  4OP0 A;  1PKS A;  3CC7 Q;  3HFN A;  5GJW B;  4KUD K;  2AMC A;  5KYW B;  4OMN A;  5KYU B;  3A5Z B;  4KBM B;  4YRK A;  4QW2 A;  5GAN g;  4XQ3 A;  4RDX A;  4J8O A;  4LE9 A;  3HHT B;  2ZPF B;  1I0C A;  4IUU A;  2QQA A;  1UE9 A;  4P73 C;  3GNF B;  3CMA A;  1LNX A;  3OSV A;  2ZZG A;  4J6W A;  3VS4 A;  3PMT A;  1UEC A;  1ZA2 B;  2RH2 A;  4OB3 B;  3GP8 A;  3OD1 A;  1N8R R;  3LW5 E;  3X28 B;  4M78 C;  2L3R A;  3VUZ A;  4IUQ A;  1NJ8 A;  1IHV A;  1B3Q A;  1VQ9 A;  3VS6 A;  3VQW A;  3UGT A;  1JQQ A;  1YI2 T;  1K73 C;  1OOT A;  2QAZ A;  2DVJ A;  3MP8 A;  4PNO A;  4F7U F;  3QTC A;  4DBQ A;  3OYF A;  5ELO A;  2OTJ Q;  3VYG A;  4UC4 A;  1D0Z A;  3SWN B;  4PFP A;  3JCM P;  2H3J A;  2DTH A;  4OMP A;  4M7D F;  1KC8 C;  1X55 A;  1EVL A;  2C8M A;  2NS6 A;  1R8O B;  4PFO A;  1QP2 A;  2XGT A;  2LMJ A;  2VYT A;  1W66 A;  1YFS A;  1E24 A;  4AFU C;  2ARS A;  3ZEH A;  3SD4 A;  3V8L A;  1JB0 E;  2I4L A;  2PZ1 A;  4A4K A;  3DSQ A;  3L4G B;  1RI9 A;  4BWA A;  1E6G A;  5GAN 4;  5C51 B;  2CDT A;  1TUC A;  2JUF A;  5IHI A;  3HTZ A;  3AT1 B;  12AS A;  2CZ1 B;  3M54 A;  4HKE A;  2KR3 A;  4LNS A;  5A0L A;  4YRF A;  3I7F A;  1BIA A;  2MYS A;  2HEQ A;  2C7I A;  3JCM c;  1VQ6 T;  3EH1 A;  3CMQ A;  2DX1 A;  1NJ2 A;  4BE0 A;  4EMK A;  1FWZ A;  1B7T A;  3UA7 A;  2ZIN A;  1V29 B;  1PSF A;  2ZCE A;  1TG0 A;  2DU7 A;  5HY6 A;  1AZG B;  3EG0 A;  5IHK A;  1K73 U;  1W70 A;  3G4S Q;  1C0M A;  2G4C A;  1QWE A;  1JU5 C;  2HNI A;  4OVA A;  4QVC A;  2KQW A;  2QA4 T;  2RHS B;  2D0N A;  2F2V A;  2O31 A;  2AKW B;  2GQI A;  2X4W A;  4EMK C;  1S72 T;  4YRQ A;  1M4Z A;  4P71 A;  1C6V X;  1TUD A;  1YJN A;  5GAN e;  2EVR A;  1KC8 U;  3S6W A;  3NGP A;  3GF5 A;  1X2G A;  3VS7 A;  4F17 A;  4H2X A;  2DAQ A;  3KFV A;  1V76 A;  4HWP A;  3V8J A;  2VKN A;  2E41 A;  1U8R A;  5ELN A;  2C0T A;  2JTE A;  2ZCF B;  2YT6 A;  1T0H A;  2YHT A;  3CCS Q;  2DEU A;  2VAS A;  4M7A G;  4RTW A;  3L1A A;  1WPY A;  3A1P A;  5I21 A;  2QHS A;  4H2U A;  4B6M A;  2E70 A;  2JNG A;  3PNW C;  4YCV A;  3GLX A;  4YRC A;  3I55 Q;  1TH7 A;  1UGQ B;  1UB4 A;  1ASZ A;  3CCS A;  3VS0 A;  2GFA A;  3JSC A;  4TVW A;  2J05 A;  4HWR A;  1QVF P;  9ATC B;  4ZTF A;  1VYU A;  1X54 A;  1X6G A;  5HK0 A;  4B9X A;  1H4S A;  1H3H A;  1Q86 R;  2EYQ A;  1X2H A;  4XTZ A;  5GAM j;  1I81 A;  2LDM A;  5GAO n;  5KYX A;  1SRY A;  3DLM A;  4PJO D;  2YLC A;  1OYX A;  4L6V 5;  1AWX A;  3WVD B;  1NEB A;  1UGP B;  1PHT A;  1PSE A;  4J9B A;  2O4X A;  3UAT A;  1VQ7 T;  2YRV A;  2DET A;  1YP5 A;  3ME9 A;  4FSS A;  4M7A B;  5GJV B;  1KD1 C;  1M2V B;  3CCL T;  2VXE A;  4M75 F;  2V8J A;  3NHN A;  3M9Q A;  1ZUK A;  4JS5 A;  4NL2 A;  1YIT Q;  3WXM B;  2XIC A;  1X69 A;  1AEY A;  1IHW A;  2DL5 A;  1TSF A;  3BDL A;  2WSE E;  3CC2 Q;  5GAM d;  4ZGE B;  2ZGW A;  4H2X B;  3TUP A;  1X2K A;  2LT1 A;  5C52 B;  4WTO B;  3HXZ A;  4IUR A;  2PU9 B;  3KBG A;  2LC4 A;  3VS2 A;  4ZTZ B;  1YCY A;  3OMG A;  4PJO A;  4FCY A;  1B70 A;  4KH0 B;  2VV5 A;  2EYW A;  4ZGJ B;  3A8H B;  3Q1J A;  4PG3 A;  3MEY A;  2RQR A;  2X4X A;  1WA7 A;  2DXT A;  1Q81 C;  1BBW A;  3VRY A;  1PRM C;  4J9H A;  1VYV A;  3OS0 A;  2LRQ A;  1JJ2 S;  4PJO C;  2A08 A;  1T0J A;  1W4S A;  3QII A;  2DL8 A;  2RQV A;  2PUK B;  4JRP A;  4RTU A;  3S3N A;  2J3M A;  3A31 A;  5L8R E;  4DBR A;  4IUT A;  2HAX A;  3G71 T;  4P74 C;  2RK2 A;  2EL9 A;  4OMF B;  4N4G A;  1MHN A;  3PTA A;  3OW2 A;  3MHX A;  3EFO A;  5HCK A;  2FG0 A;  4FYX B;  3M5A A;  5GAM h;  4NL3 A;  1YJ9 Q;  1VQM A;  1G5H A;  1YB3 A;  4JS4 A;  3RKY A;  3EH2 A;  4M75 D;  2VC8 A;  1U06 A;  2PNI A;  2ZPB B;  2JS2 A;  3HY0 A;  4LXC A;  2OJ2 A;  1QCO A;  4G84 A;  1FYN A;  3LSQ A;  1JXO A;  4FL6 A;  1YIJ A;  3CCE T;  1PRL C;  5KYY A;  3TEE A;  5GAN 5;  1KD1 U;  2LTO A;  3X25 B;  2XID A;  1RAC B;  3S3O A;  1YJ9 A;  3G6E Q;  5CAI A;  4YRI A;  2XDP A;  2EAY A;  1YFN A;  1SRL A;  1BYM A;  4J9G A;  2L3Q A;  3M4G A;  4E51 A;  3PVL A;  1MV0 B;  1QVP A;  4F04 B;  1SEM A;  1TU0 B;  2YUP A;  1WX6 A;  2K9G A;  4CC3 A;  2ATC B;  2HD0 A;  5LJ5 f;  1LOJ A;  1K0X A;  5GAM e;  2J6F A;  2KBT A;  1B70 B;  1VQ4 Q;  2DTO A;  2BZ8 A;  1WLE A;  1G2B A;  1TTH B;  4OF1 A;  4Y91 A;  2OTL T;  3FC3 A;  1Q81 U;  2LJ0 A;  1Q7Y R;  3ERR A;  4C92 F;  3NET A;  2KGT A;  3PCO A;  2QDL A;  4H02 A;  2V26 A;  5ECA A;  3QDR B;  3NEM A;  3LSS A;  2DO3 A;  1VQ5 A;  4M75 C;  1NYG A;  4FSX A;  2VGM A;  1HK9 A;  2ZT5 A;  2YWW A;  1NEG A;  3GPL A;  1H4T A;  2GCX A;  4C0G A;  2GBQ A;  1VQK Q;  7AT1 B;  4PJO E;  4LVJ A;  3C12 A;  4CH6 A;  3TEH B;  3EFO B;  2RHZ A;  2CKK A;  1SRM A;  3UWN A;  2M1H A;  4CC7 A;  2EQU A;  1YWO A;  4BD3 A;  2AHJ B;  5M9O A;  1M90 C;  4AG1 C;  4OMO A;  3CCJ T;  4YRR A;  4J83 A;  5CIU A;  4HCZ A;  3OBY A;  4YRG A;  2ED0 A;  5LJ3 f;  4HT4 A;  4TVR A;  3LH0 A;  2K5L A;  1MV3 A;  4C0D B;  4B9W A;  1VQN T;  2R5A A;  3ULR B;  4HCB A;  3L2U A;  3NEL A;  2DU5 A;  1NNH A;  1H92 A;  1C1A A;  1YHQ A;  3CD6 T;  3RES A;  5C6S A;  3QJY A;  4M77 A;  4DOV A;  1ZSZ A;  3EFS A;  4LDW A;  1Z9Z A;  5J39 A;  1Z7M A;  4ZIB A;  4HVV A;  1N27 A;  4TQF A;  3TRE A;  4J7I A;  3V8K A;  2AIR B;  3PT9 A;  2LVM A;  1Y71 A;  3RL6 A;  2ZIO A;  1K1Z A;  4WJ4 A;  1OX9 A;  2ALY A;  3UFG A;  2GGR A;  4BW9 A;  5FU7 B;  1YI2 A;  1YJW Q;  2JT4 A;  2VUB A;  3VUB A;  1K9M C;  4D8K A;  3VV0 A;  4GLM A;  2I4O A;  1N9R A;  2AT1 B;  1Q95 G;  1WLP B;  4WF2 A;  1Q82 C;  4HXJ A;  3H9N A;  5GAN 8;  2YSQ A;  3E9H A;  1YWP A;  3TCJ A;  2I4M A;  3HPW A;  3QJ6 A;  2VXF A;  3JCM f;  3GNG A;  4OB1 B;  3QG1 A;  3QPH A;  3E2U A;  2KRS A;  3OYH A;  3ICA A;  3RAC A;  5FWC A;  3IAL A;  1QVG P;  3QSU A;  2HL5 C;  4XEO A;  4C92 G;  1UG1 A;  1OU9 A;  2ART A;  2F2W A;  2XKO C;  1SSH A;  1XNI A;  2FPF A;  2NUP A;  1KIK A;  4J9I A;  2NLU A;  4BDY A;  1WIE A;  4OB0 B;  2QQS A;  4FT4 A;  1YGB A;  2JVV A;  1EIY A;  1TS9 A;  3UH0 A;  2X4J A;  5CKE A;  3OS5 A;  1XOV A;  1Y0M A;  4Q6G A;  1KMM A;  3P8V A;  3I56 Q;  1Y57 A;  3VRZ A;  2X9H A;  8ATC B;  1VQP Q;  4YRS A;  1FXX A;  2QGF B;  3URG A;  2JXB A;  5GAO p;  4Z89 A;  2EQI A;  3GBQ A;  1QE0 A;  1ZSZ B;  5GMK i;  2K79 A;  5IAY A;  2ENM A;  2DIL A;  3S3M A;  1NJI R;  1VQ6 A;  2DER A;  5J3B A;  2DD5 A;  2RI3 A;  4WCI A;  2R57 A;  3M0Q A;  2JM9 A;  1TXQ A;  4NCX A;  5DLQ E;  4C8Q D;  2LZ6 B;  4ORZ A;  1NZ9 A;  2DF6 A;  2I0N A;  1K9M U;  2KT8 A;  4EO4 A;  2A28 A;  2QA4 A;  4OB2 B;  4XAX B;  1WNL A;  3GIB A;  2DFU A;  1Q82 U;  1E7O A;  3CQT A;  1VQZ A;  1Z9Q A;  2H8H A;  5KNN A;  1OX8 A;  4M77 E;  1SER A;  5I2S A;  1S72 A;  4CRI A;  1QVF S; 
#chains in the Genus database with same CATH homology
 1Z7N A;  4JLI A;  1JJC B;  3E1S A;  4PKC C;  4JRQ A;  2F5K A;  1E1T A;  4L5G A;  2Q7G A;  1K8A C;  4C5H A;  1B7Y B;  2KSS A;  2RJD A;  4FIB A;  1JJ2 A;  5KCO A;  2PUO B;  4C8Q A;  5GAN 3;  3JB9 I;  3LGL A;  4A53 A;  4J6X A;  4E7H A;  2Y90 A;  3CC4 T;  4CI0 C;  1NYQ A;  3CME T;  3REX A;  2CJA A;  4RG2 A;  3J7A F;  3MET A;  1HXD A;  3PFS A;  4DA4 A;  5GAN j;  4C8Q C;  3JB9 G;  4YTL A;  4RMO A;  4M78 A;  1P92 A;  1D3B A;  1E22 A;  3DKM A;  3UGQ A;  3QZ9 B;  3TU4 K;  1VQ7 A;  2CZ6 B;  3A8M B;  4M7A F;  1IL2 A;  3VU3 C;  3CCL A;  3E9F A;  3M4Y A;  1KQS A;  2BKD N;  2F69 A;  5GAN d;  4A4H A;  4PLL A;  1N8R C;  4H2T A;  3FDR A;  3CCQ T;  4ZN1 A;  2RB6 A;  3NTH A;  2GQV A;  2LCL A;  4LD9 K;  2HQE A;  4BY6 B;  4OLF A;  3M4P A;  4P3P A;  4P75 C;  2CGH A;  3OMC A;  1M9S A;  3MEW A;  3INZ A;  3T9N A;  3OYK A;  4XTV A;  3JB9 H;  2K2V A;  2RI2 A;  4MZM A;  2PVD B;  5CO7 A;  4XK8 E;  3OSS C;  1BI1 A;  5GAN 6;  1USY C;  3G71 A;  2AMC B;  5GAN h;  4K86 A;  2EWN A;  1I8F A;  2RJC A;  1WJS A;  4M78 B;  4M7A D;  3L2Q A;  1GGM A;  4LDV A;  3PIO A;  2FL7 A;  3QZ5 B;  2E5Q A;  2GF7 A;  4C8Q E;  1EIF A;  3X24 B;  1N9W A;  3CCR T;  3M55 A;  1VQ8 T;  2CJB A;  2OAU A;  1G3W A;  3NEN A;  4KQE A;  4NS5 A;  3CCE A;  3QUI A;  2C06 A;  5CKH A;  4FM4 B;  2QEX A;  2FB7 A;  4M7D D;  2XU8 A;  4M78 E;  4V2S A;  3SDZ A;  1EOV A;  3RF1 A;  3OYE A;  2E65 A;  5K1P A;  3BJU A;  2LT4 A;  4J6Y A;  4II1 A;  4IKF A;  1LJO A;  2OTL A;  3REU A;  3CCM T;  1BI0 A;  4F7U A;  4HCC A;  3P8D A;  2XHC A;  4N0A C;  4CS3 A;  4M7A C;  2IVW A;  3HXY A;  4L87 A;  3A7A A;  4M7D A;  3L2R A;  2QQR A;  4QQ6 A;  3W3S A;  4UP8 A;  4ELZ C;  2ZR3 A;  4FU6 A;  2QQ9 A;  5DY9 A;  3OY9 A;  4O2D A;  2D0Q B;  2LQ8 A;  3V7R A;  2J3L A;  4BE2 A;  3RKX A;  4M7D C;  5D6W A;  4H2Y A;  3PZC A;  1B76 A;  3E9I A;  4CH4 A;  1X6O A;  3CCU T;  4EMK B;  2D6F A;  4TTV A;  3CCJ A;  4HVC A;  1H4Q A;  3HY1 A;  4XU2 A;  3SB2 A;  1M1K C;  4P5N A;  2CJ9 A;  3C95 A;  2YLB A;  1VQN A;  3CC7 T;  4R56 A;  3DB4 A;  2A7Y A;  3PIP A;  4BDZ A;  3CD6 A;  4YRJ A;  3OQ5 A;  3QYH B;  1U1S A;  4DOW A;  1H64 1;  4RCC A;  1QVG S;  4ME7 A;  4RMF A;  3HFO A;  3PMI A;  5AYF A;  2EQM A;  3MF2 A;  4P74 A;  2Q5I A;  3HSB A;  1ZQ1 A;  3JRZ A;  5KE3 A;  5D6Y A;  3OYB A;  1QVF A;  4HWO A;  3LWH A;  1M8V A;  2RO0 A;  5GAM f;  4L59 A;  2OTJ T;  3UPU A;  3G1Z A;  2E10 A;  3HXW A;  4LDY A;  4BUG A;  2ZT6 A;  3MP6 A;  4F7U E;  4XEM A;  1N9S A;  4A4G A;  5LJ5 g;  2R5M A;  2XD0 A;  2O4X B;  2ZPG B;  1EVK A;  4M7D E;  1M1F A;  4JRI A;  3JCM b;  1M1K U;  2P0Q A;  1X01 A;  3VBB A;  1YBY A;  2DXB A;  1O9S A;  2LCC A;  3VKI A;  3L2W A;  4ZTJ A;  1KOG A;  1I4K 1;  3RMQ A;  1VUB A;  4LVM A;  2L89 A;  4TVY A;  1KQS S;  5HKC A;  3CCV A;  4Q15 A;  5D6X A;  3FJP A;  2PME A;  2P4T A;  4PJO B;  2I4N A;  4M75 A;  3M57 A;  5DM7 R;  3MCA B;  4N4H A;  5A0G A;  3G4S T;  3JCM X;  3KFU A;  3HKS A;  4GLK A;  3HL8 A;  2I2L A;  1OZ2 A;  5CQY A;  2DK3 A;  5LJ3 g;  1Q7Y C;  1WJR A;  4PLI A;  2ZZF A;  3OBW A;  2CYZ B;  3M4Q A;  4OGC A;  3A32 A;  3HP9 A;  2QHV A;  2JN0 A;  3CBO A;  1SET A;  3CCS T;  4C5G A;  4OGE A;  4AH6 A;  2M16 A;  2QHU A;  2KVQ G;  3A74 A;  5GMK j;  4J7F A;  1RIQ A;  3I55 T;  3CPF A;  2DKG A;  2ZPE B;  3OYL A;  4QVZ A;  3H6Z A;  4MZT A;  3CC4 A;  1FYF A;  3CME A;  3QNE A;  1WGS A;  3DB3 A;  4LDU A;  4IUV A;  2EIF A;  4ZTU B;  2EJ9 A;  5DLO A;  4C92 D;  3ER0 A;  2R58 A;  5C0M A;  1WU7 A;  3JCM g;  4Z02 A;  5LJ5 e;  5FU6 C;  3C94 A;  1Y7X A;  2VGN A;  1VIE A;  3HRT A;  4YRN A;  2X4Y A;  3PCO B;  2K3Y A;  1X75 C;  5CQX A;  1I5L A;  5HGQ A;  4XTX A;  1L0W A;  1IZ6 A;  4EPC A;  4G85 A;  5IN1 A;  3SFM A;  1KHI A;  1Q7Y U;  1YIT T;  4YRE A;  4M77 G;  3CC2 T;  3C4S A;  2P0K A;  4EDU A;  4LVI A;  4BI3 A;  3CCQ A;  4Y28 E;  4M75 E;  5GAN 7;  2EJF A;  4JLG A;  2Q5H A;  4K88 A;  2L8D A;  4C5I A;  4BE1 A;  4D6W A;  3JB9 F;  2DIQ A;  4TVA A;  2DZC A;  3DLL A;  1M90 U;  5KH6 A;  5FLX E;  2E1H A;  3JB9 J;  2JZ2 A;  2KK4 A;  4C92 C;  4BI8 B;  3RGL A;  4MMK A;  3LYI A;  5EG2 A;  4QQG A;  2ZNJ A;  1Y07 A;  4PL6 A;  1H3Z A;  3HFZ A;  4ZN3 A;  2KY9 A;  4R55 A;  2WAC A;  4X9D A;  4MDX A;  4M77 B;  1PYS A;  1UGS B;  5E3I A;  2EFI A;  4H2V A;  3LWI A;  4KUI A;  3OYC A;  1QF6 A;  4KT0 E;  4YRT A;  3CCR A;  4E7I A;  4E7L A;  4QVD A;  1VQ8 A;  2DXC A;  3FLG A;  5GMK e;  4RQE A;  3MEA A;  3QXE B;  3G6E T;  4DPG A;  2Y4Y A;  2ALY B;  1NJI C;  2RM4 A;  2DXU A;  1U1T A;  1WJQ A;  5GMK l;  3HRK A;  3JCM e;  4JJN K;  1QVG A;  3HRU A;  2MWO A;  4KUL A;  3TEG A;  3VQX A;  1X56 A;  4ZGD B;  3ZFJ A;  1VQ4 T;  2RHU A;  4IUP A;  1WYD A;  3CCM A;  3EFR A;  1BKB A;  3O8V A;  1B34 A;  1G5I A;  1EIY B;  2A8E A;  3BDU A;  1DJ7 B;  3RER A;  2DPP B;  1VQK T;  3ZBD A;  4LVK A;  3CBP A;  2JTM A;  4RKU E;  4GY5 A;  3HXV A;  4DQ2 A;  2ZPH B;  4N4I A;  3OYI A;  3IKL A;  3M53 A;  4KR2 A;  1M5Q 1;  2ZNI A;  3SWN C;  1PYS B;  2CZ7 B;  1G3T A;  1NE8 A;  3RIR A;  3L4G A;  1ZHI A;  4C8Q G;  3CCU A;  4EMG A;  3AHU A;  3NTK A;  1NJI U;  4YRO A;  2RA2 A;  2E6N A;  3OS1 A;  2P0L A;  4XTU A;  1RL2 A;  2MAM A;  3GOX A;  3X26 B;  2EKO A;  5A2Q E;  3OA6 A;  3IG2 A;  2RJF A;  3CC7 A;  3RKW A;  4M78 G;  4YRL A;  3JCM J;  3OYN A;  4YYE A;  2QQB A;  4P75 A;  2BIV A;  1K8A U;  2XDB A;  4FT2 A;  3WVE B;  3E19 A;  3VQY A;  1RI0 A;  2RHS A;  2PVO B;  3H8Z A;  1AHJ B;  2AKW A;  4X34 A;  4A54 A;  1NPP A;  2MI6 A;  2X35 A;  4P3O A;  1B34 B;  3QO3 A;  3L2Z A;  1USY A;  3JCM W;  2E6Z A;  5GAN f;  4C8Q B;  1VIF A;  1YJW T;  4RQF A;  1G3S A;  1KQ1 A;  4KR3 A;  2OTJ A;  4BB7 A;  5GAO q;  3KXT A;  3QYG B;  3CPW S;  3RMS A;  1D3B B;  4MDW A;  2XG8 D;  2E12 A;  3A8G B;  3V7S A;  3A7R A;  3OYG A;  4XTW A;  3QBY A;  2KAF A;  2M0O A;  5CK9 A;  1G5V A;  3A8O B;  2RJE A;  4JRK A;  3M59 A;  4O5V A;  3JCM Q;  2LNV A;  2ZTG A;  3L2V A;  3VJP A;  4QQD A;  5CVI A;  2ZZE A;  4LDX A;  1B8A A;  1N6A A;  2B8A A;  4J5Y A;  3I56 T;  2ZPI B;  1N8R U;  1VQP T;  1W2B A;  3NFC A;  3LC0 A;  5KE2 A;  4RCB A;  4ATO A;  3P8T A;  4N0A A;  3CXC S;  2DIG A;  4M7A A;  2V8I A;  4PJO F;  2CIM A;  2E3C A;  3FB9 A;  4UPA A;  3ASK A;  2ZXF A;  3BW1 A;  4A4F A;  3G4S A;  3A8L B;  4CH5 A;  2EQJ A;  2CS7 A;  2K4Y A;  4ELY C;  1UGR B;  3CEY A;  1ADJ A;  2V8K A;  4HWS A;  2PMF A;  4P71 C;  1ASY A;  3QO8 A;  2QDY B;  5I2M A;  1VQO T;  1BI3 A;  2P0P A;  4F7U G;  5GMK m;  1VQL T;  3N5B B;  2E64 A;  3MP1 A;  3L42 A;  4JUV A;  3J80 E;  1Q86 C;  3I55 A;  3VQV A;  4M7D G;  3QKJ A;  4X5O A;  3V7C A;  2ZT7 A;  1M1G A;  3FIF A;  3CMA T;  3QO7 A;  3OB9 A;  5GAM g;  4Q5W A;  3FEO A;  4YCU A;  2LQK A;  3FRN A;  4JDS A;  1O75 A;  2DQ3 A;  2F5T X;  1SSF A;  3OYY A;  3OYJ A;  1J5W A;  3UT1 A;  3IKM B;  2A3L A;  1NJ5 A;  4BAC A;  1VQ9 T;  4YDQ A;  3A7U A;  2DD4 A;  1G51 A;  4LD6 A;  4P72 A;  4F7U B;  2MMP A;  3HRS A;  2CZ0 B;  1BIB A;  4E7J A;  4X9C A;  2EQK A;  3NTI A;  2EJG A;  3PGG A;  1YIT A;  2MF2 A;  4M7D B;  5CKB A;  1IRE B;  2RHY A;  4P72 C;  3CC2 A;  5GAO l;  3F70 A;  2ODR D;  3MF1 A;  4M7A E;  2O01 E;  5C53 B;  2XDD A;  4E7K A;  1FX7 A;  2QTX A;  2DVE A;  4O6J A;  4E47 A;  4PJO G;  3P8H A;  2P5I A;  2KMT A;  2M9U A;  3MO8 A;  3HRI A;  2GFU A;  4XTY A;  5LJ5 j;  2DEQ A;  4YP0 A;  1Q86 U;  3G7Z A;  3R07 A;  2XK0 A;  4LVL A;  5FRM A;  4UP7 A;  2Y4X A;  3KUF A;  4P3N A;  1HTT A;  4HT9 A;  1H4V B;  3TEH A;  1BBU A;  2ZZD A;  1EQR A;  2K5F A;  2K3X A;  2FYK A;  1YFT A;  5LL6 S;  5LJ5 d;  4HT8 A;  4M77 F;  2XTI A;  3J81 E;  2MWP A;  3JAM E;  2QEX T;  1KQ2 A;  2ODR C;  3MEU A;  2XI9 A;  3UDC A;  3G6E A;  1JBM A;  1YJN T;  1LYL A;  5LJ3 j;  1BI2 A;  2WSC E;  4C0D C;  2RHX A;  5CKF A;  2DQ0 A;  1NJ6 A;  1OZ3 A;  1ZBX A;  4XU1 A;  4YRP A;  2PVG B;  2FVU A;  4C5E A;  4M75 G;  2RI5 A;  4RG8 A;  4EMH A;  1VQ4 A;  5CR2 A;  5LJ5 h;  2QI2 A;  4MZP A;  1KG1 A;  5LJ3 d;  2RHQ A;  4A4E A;  4YPF A;  4YCW A;  4VUB A;  3OYM A;  4M77 D;  3VYH B;  1ATI A;  2BUD A;  2G3R A;  3CPW A;  5FU7 C;  3OYA A;  4MML A;  1VQK A;  1EFW A;  2IG0 A;  5HK3 A;  4NOY A;  3QO5 A;  2IY5 A;  4TQD A;  3LX7 A;  1W2B S;  3OYD A;  3EAE A;  2ZR2 A;  1UEB A;  4M75 B;  1ADY A;  1KHC A;  1Y96 A;  4J15 A;  1JRI A;  1NPR A;  4CH3 A;  4H2S A;  1MGQ A;  3RUX A;  4BI4 A;  5LJ3 h;  2ZT8 A;  2L5Q A;  5KCH A;  2JTF A;  3HFV A;  2FHD A;  3JCM d;  1WQ7 A;  3CBM A;  1HC7 A;  3CXC A;  2DJZ A;  4M77 C;  4C92 A;  1E1O A;  4PHC A;  2D9T A;  1GXI E;  3R6O A;  3X20 B;  3MQZ A;  3MEV A;  1WQW A;  1SES A;  2RK1 A;  4YRM A;  2RHQ B;  5GMK h;  4C8Q F;  1C0A A;  4TWA A;  5K1X A;  2WSF E;  1JJC A;  1YJW A;  2DDZ A;  5LJ3 e;  3WQZ A;  2KDS A;  5FU6 B;  1VQM T;  3BY7 A;  2IY5 B;  4HA8 A;  1B7Y A;  3P8B B;  1YIJ T;  2DTI A;  3JCM h;  4K87 A;  3LGF A;  5CKD A;  3HXU A;  1NYR A;  1G3Y A;  1YJ9 T;  4M78 F;  4WJ3 M;  5GAO m;  1YFR A;  3HXX A;  1XTD A;  3BFM A;  3JCM V;  5CCA A;  2ZIM A;  1Y96 B;  3M58 A;  1XQH A;  5FRN A;  5A0D A;  3CCV T;  3A5Y A;  3A5Z A;  3I56 A;  1VQP A;  4CS2 A;  3JB9 D;  4CS4 A;  2Q7H A;  4C92 B;  4UP9 A;  1NJ1 A;  3OS2 A;  2PQW A;  1VQ5 T;  1KMN A;  2RD1 A;  4WI1 A;  4C0F A;  4TVA B;  5J26 A;  2K5I A;  2E5A A;  2Q7E A;  2DZ9 A;  4C0Z A;  4XU0 A;  3SWN A;  3QHS A;  1QP3 A;  5IT9 E;  3E9G A;  4M78 D;  2HBP A;  3HFZ B;  11AS A;  4C92 E;  2JOY A;  3OW2 S;  3M56 A;  4HWT A;  3P8Y A;  1QW1 A;  4XU3 A;  2RHI A;  1VQO A;  3LLR A;  5FRO A;  1VQL A;  2K57 A;  2HQX A;  5F5W A;  4EX5 A;  5GAN 2;  2QHT A;  2LX9 A;  1OI1 A;  2QXF A;  4BY6 C;  5GAO r;  2ARU A;  4P73 A;  4H2W A;  1YHQ T;  4OP0 A;  4KUD K;  2AMC A;  3HFN A;  3A5Z B;  4KBM B;  4YRK A;  4QW2 A;  5GAN g;  4XQ3 A;  4RDX A;  4J8O A;  3HHT B;  2ZPF B;  4IUU A;  2QQA A;  4P73 C;  3GNF B;  3CMA A;  1LNX A;  3OSV A;  2ZZG A;  4J6W A;  3PMT A;  2RH2 A;  4OB3 B;  3GP8 A;  3OD1 A;  3LW5 E;  3X28 B;  1NJ8 A;  2L3R A;  4M78 C;  4IUQ A;  3VUZ A;  1VQ9 A;  3VQW A;  3UGT A;  1YI2 T;  1K73 C;  3MP8 A;  4PNO A;  4F7U F;  3QTC A;  3OYF A;  5ELO A;  3VYG A;  4UC4 A;  3SWN B;  3JCM P;  2H3J A;  2DTH A;  4M7D F;  1KC8 C;  1X55 A;  1EVL A;  2C8M A;  2NS6 A;  1R8O B;  1QP2 A;  2XGT A;  2VYT A;  1W66 A;  1YFS A;  1E24 A;  2ARS A;  3ZEH A;  3SD4 A;  3V8L A;  1JB0 E;  2I4L A;  4A4K A;  3DSQ A;  3L4G B;  4BWA A;  5GAN 4;  5C51 B;  2JUF A;  3HTZ A;  12AS A;  2CZ1 B;  3M54 A;  4HKE A;  4LNS A;  5A0L A;  4YRF A;  3I7F A;  1BIA A;  2C7I A;  3JCM c;  1VQ6 T;  3CMQ A;  1NJ2 A;  4BE0 A;  4EMK A;  1FWZ A;  2ZIN A;  1V29 B;  1PSF A;  2ZCE A;  2DU7 A;  5HY6 A;  1K73 U;  2G4C A;  2HNI A;  4OVA A;  4QVC A;  2KQW A;  2QA4 T;  2RHS B;  2AKW B;  2X4W A;  4EMK C;  1S72 T;  4YRQ A;  1M4Z A;  4P71 A;  1YJN A;  5GAN e;  1KC8 U;  3S6W A;  3GF5 A;  1X2G A;  4H2X A;  2DAQ A;  4HWP A;  3V8J A;  2E41 A;  1U8R A;  5ELN A;  2ZCF B;  2YHT A;  4M7A G;  3L1A A;  1WPY A;  5I21 A;  4H2U A;  2QHS A;  2E70 A;  2JNG A;  3PNW C;  4YCV A;  3GLX A;  4YRC A;  1TH7 A;  1UGQ B;  1UB4 A;  1ASZ A;  3CCS A;  2GFA A;  3JSC A;  4TVW A;  4HWR A;  4ZTF A;  1X54 A;  5HK0 A;  4B9X A;  1H4S A;  2EYQ A;  1X2H A;  4XTZ A;  5GAM j;  1I81 A;  2LDM A;  5GAO n;  1SRY A;  3DLM A;  4PJO D;  2YLC A;  1OYX A;  4L6V 5;  3WVD B;  1UGP B;  1PSE A;  2O4X A;  1VQ7 T;  2YRV A;  3ME9 A;  4M7A B;  1KD1 C;  3CCL T;  2VXE A;  4M75 F;  2V8J A;  3M9Q A;  4JS5 A;  4NL2 A;  3WXM B;  2XIC A;  3BDL A;  2WSE E;  5GAM d;  4ZGE B;  2ZGW A;  4H2X B;  3TUP A;  2LT1 A;  5C52 B;  3HXZ A;  4IUR A;  2PU9 B;  3KBG A;  2LC4 A;  4ZTZ B;  1YCY A;  3OMG A;  4PJO A;  1B70 A;  2VV5 A;  4ZGJ B;  3A8H B;  3Q1J A;  4PG3 A;  3MEY A;  2X4X A;  2DXT A;  1Q81 C;  1BBW A;  3OS0 A;  2LRQ A;  1JJ2 S;  4PJO C;  3QII A;  1W4S A;  2PUK B;  4JRP A;  3S3N A;  2J3M A;  3A31 A;  5L8R E;  4IUT A;  2HAX A;  3G71 T;  4P74 C;  2RK2 A;  2EL9 A;  4OMF B;  4N4G A;  1MHN A;  3PTA A;  3OW2 A;  3MHX A;  3M5A A;  5GAM h;  4NL3 A;  1VQM A;  1YB3 A;  1G5H A;  4JS4 A;  3RKY A;  2VC8 A;  4M75 D;  2ZPB B;  3HY0 A;  4G84 A;  3LSQ A;  4FL6 A;  1YIJ A;  3CCE T;  1KD1 U;  3TEE A;  5GAN 5;  2LTO A;  3X25 B;  2XID A;  3S3O A;  1YJ9 A;  5CAI A;  4YRI A;  2XDP A;  2EAY A;  1BYM A;  3M4G A;  4E51 A;  1QVP A;  2HD0 A;  5LJ5 f;  1LOJ A;  5GAM e;  1B70 B;  2DTO A;  1WLE A;  4OF1 A;  4Y91 A;  2OTL T;  3FC3 A;  1Q81 U;  3ERR A;  4C92 F;  3NET A;  3PCO A;  4H02 A;  3QDR B;  3NEM A;  3LSS A;  2DO3 A;  1VQ5 A;  4M75 C;  4FSX A;  2VGM A;  1HK9 A;  2ZT5 A;  3GPL A;  1H4T A;  2GCX A;  4C0G A;  4PJO E;  4LVJ A;  3C12 A;  4CH6 A;  3TEH B;  2RHZ A;  2CKK A;  3UWN A;  2M1H A;  2EQU A;  4BD3 A;  2AHJ B;  5M9O A;  1M90 C;  3CCJ T;  4YRR A;  4J83 A;  5CIU A;  4HCZ A;  3OBY A;  4YRG A;  5LJ3 f;  4HT4 A;  4TVR A;  3LH0 A;  2K5L A;  4C0D B;  4B9W A;  1VQN T;  2R5A A;  4HCB A;  3L2U A;  3NEL A;  2DU5 A;  1NNH A;  1YHQ A;  3CD6 T;  3RES A;  5C6S A;  3QJY A;  4M77 A;  4DOV A;  3EFS A;  4LDW A;  5J39 A;  1Z7M A;  4ZIB A;  1N27 A;  4TQF A;  3TRE A;  4J7I A;  3V8K A;  3PT9 A;  2LVM A;  1Y71 A;  3RL6 A;  2ZIO A;  4WJ4 A;  2ALY A;  3UFG A;  4BW9 A;  5FU7 B;  1YI2 A;  2VUB A;  3VUB A;  1K9M C;  3VV0 A;  2I4O A;  1N9R A;  4WF2 A;  1Q82 C;  3E9H A;  5GAN 8;  3TCJ A;  2I4M A;  3HPW A;  3QJ6 A;  2VXF A;  3JCM f;  3GNG A;  4OB1 B;  3QG1 A;  3QPH A;  3OYH A;  3ICA A;  3RAC A;  3IAL A;  3QSU A;  4XEO A;  4C92 G;  2ART A;  2XKO C;  1XNI A;  2NLU A;  4BDY A;  4OB0 B;  2QQS A;  4FT4 A;  1YGB A;  2JVV A;  1EIY A;  3UH0 A;  2X4J A;  5CKE A;  3OS5 A;  1XOV A;  4Q6G A;  1KMM A;  3P8V A;  4YRS A;  1FXX A;  3URG A;  5GAO p;  1QE0 A;  5GMK i;  5IAY A;  3S3M A;  1VQ6 A;  5J3B A;  2DD5 A;  2RI3 A;  2R57 A;  4NCX A;  5DLQ E;  4C8Q D;  1NZ9 A;  1K9M U;  4EO4 A;  2QA4 A;  4OB2 B;  4XAX B;  1WNL A;  3GIB A;  1Q82 U;  1VQZ A;  5KNN A;  4M77 E;  1SER A;  5I2S A;  1S72 A;  4CRI A;  1QVF S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...