2E1HA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111g mutation
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
225
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 66
structure length 225
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e1hA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e1hA01
4HWTA 4M7AE 2RHQB 2IY5B 4C92F 3L4GA 1Z7NA 2EJ9A 2DXTA 5GAN7 4M7AF 4Q6GA 3TEHB 2I4LA 3FB9A 2FYKA 5GAN4 4H2XB 2AKWB 3IKLA 1ASZA 4P72C 1X01A 4PHCA 4PJOC 4ZTUB 3RKWA 4H2TA 4X9CA 4K88A 4P3NA 2DXUA 3VQWA 4G85A 4EMGA 4X9DA 1LJOA 1D3BA 2ZGWA 3MF2A 1EIYA 4YRIA 1NNHA 4EMHA 4YRFA 4PJOG 5GANd 1BIAA 4KR3A 2C8MA 3SWNA 3JCMe 4CH6A 4TWAA 4CS3A 4K87A 4M75E 2C7IA 1YFSA 4PJOD 1USYA 4PNOA 4WI1A 4M75F 1NJ8A 2J3MA 3TUPA 2DQ0A 4J6WA 3EFRA 2ZIOA 2E65A 4P3OA 5I21A 4WF2A 4QVDA 1M5Q1 2FB7A 1YB3A 3JCMb 4RCCA 5GAOq 3HFZA 3A5YA 4YRQA 1WU7A 1ATIA 2ALYB 4M78F 4YYEA 2ZNJA 4N0AC 2ZT6A 1H4SA 4M77G 4HWPA 4H2VA 4NL2A 4YCUA 1NJ2A 5GAMg 2DKGA 4XTVA 1N9WA 5LJ5h 4EO4A 4NCXA 4YRSA 4PJOB 1TH7A 4M7AG 4NOYA 4EMKC 1ADYA 1GGMA 1W66A 3HFZB 1EOVA 4XEOA 3A7AA 4YRRA 4HT9A 4UP7A 4M77A 3HXXA 5GAMf 4QVCA 4RQEA 1KQ2A 4M7AD 5GANh 4J6YA 2Q7HA 4YRTA 5C52B 4PJOE 1SRYA 3NEMA 2EWNA 4PJOF 4XU1A 1E1TA 4C92A 3REUA 4JUVA 4YCVA 4M7AA 2CGHA 4H2SA 4XU3A 4CS2A 3NENA 4TTVA 3QTCA 3W3SA 3FIFA 2DEQA 1X55A 2YHTA 1B76A 3JB9H 2ZT7A 5GAOm 4M77B 3L2ZA 4M75G 4XTWA 2RHQA 2IY5A 4Q15A 12ASA 1YFRA 3TEHA 4O2DA 2JN0A 4M7DC 3HFOA 1B34B 4H2XA 4M75D 3E9HA 4K86A 3P8TA 4M7AB 4TVWA 3RKYA 3MF1A 1B7YA 1L0WA 2ARSA 3HRKA 4A54A 1X2GA 4M78G 5LJ3j 4M75A 1IL2A 1JBMA 4M7DG 1X56A 4XU0A 3IKMB 1YFTA 3CMQA 5GMKj 4M78D 3NELA 3QO7A 2HNIA 5LJ3e 4M7DD 4A53A 1MGQA 4BW9A 4XTZA 5GAMj 3WQZA 2CJ9A 2DZCA 5F5WA 3BJUA 5GMKe 5LJ5d 1B7YB 2EAYA 2ZNIA 3QO3A 1H4QA 4YP0A 3HXWA 4M75B 1LOJA 4ZTZB 2ZZFA 2E1HA 4WJ4A 3A5ZA 1Z7MA 1LNXA 3RACA 3QNEA 3QSUA 4YRKA 3TEGA 4XTUA 3V8LA 4H2YA 4YREA 2ALYA 2QHVA 4P74A 4C8QC 3QO8A 4JRKA 2QHTA 3LSQA 1ADJA 2ZT8A 4P73A 4M78B 4RQFA 4M7DB 3BW1A 4F7UE 3JCMJ 2I4NA 4HWSA 5C53B 1QF6A 3HTZA 4F7UF 4P72A 2QHUA 5GAN5 4PJOA 1E24A 1WYDA 3HXZA 3OD1A 5LJ3d 1G5IA 2ARUA 3JCMQ 5GANg 2YLBA 3BFMA 3A74A 4P3PA 4UP9A 4M78E 4YPFA 4KR2A 4YRLA 2RHSA 5LJ5f 4M7DE 5DY9A 4M7DF 2PMEA 5GAOr 1H4TA 4UP8A 2AMCA 1C0AA 3UFGA 1I4K1 1YGBA 2DU5A 2DTOA 4HT8A 1JJCB 5K1XA 3JCMW 5GANf 4P71C 4YRGA 4DPGA 1NJ6A 4UPAA 4X5OA 2I2LA 3JCMd 2RD1A 1B70B 5HGQA 2XGTA 3V8KA 2ZCEA 3GIBA 2RHSB 3REXA 5KNNA 3G1ZA 4C92C 3UGQA 3V7SA 1NYQA 3PGGA 2ZZGA 2AMCB 4YRNA 1B34A 2DTHA 2E41A 5GAN6 3MEYA 3JB9F 2DDZA 2G4CA 3A31A 1I81A 1EVLA 1I8FA 3QUIA 3HY0A 4YCWA 3BY7A 4PG3A 3QHSA 2CIMA 2CJBA 1I5LA 1YCYA 4C8QE 5LJ3h 3HXYA 4CH3A 4DQ2A 4C8QF 1EQRA 4EMKA 3SB2A 1KMMA 1SETA 4F7UG 1G51A 11ASA 4OP0A 2EJFA 3LSSA 1B8AA 3JCMf 2QTXA 2ZXFA 1Y96A 5GMKi 4CH4A 2Y90A 4H2UA 4YRCA 1SESA 1VQZA 5GANj 1LYLA 2ARTA 1WPYA 2Q7EA 1NYRA 3QO5A 3VQXA 3JCMh 4F7UA 2ZINA 2ZIMA 2EL9A 3VU3C 2I4OA 4EMKB 1X54A 1PYSB 2EJGA 3V7CA 2VXFA 3M4GA 5GANe 2PMFA 3R07A 1EFWA 4HVCA 5K1PA 4J5YA 2P0LA 4M78A 5E3IA 4M7DA 1Y96B 3HSBA 5ELNA 4XEMA 1N9RA 5GAMe 3SWNC 2Q5HA 4TQFA 4CH5A 3M4PA 2DZ9A 4XTXA 4YRJA 3P8YA 1E22A 4F7UB 4XQ3A 4P75A 4EX5A 4P73C 1USYC 3JB9G 5GAN3 3IG2A 2E10A 1U1SA 2ZTGA 4YRPA 2VC8A 3EFSA 4YROA 5LJ5g 4H02A 2ZT5A 3JB9D 2RM4A 1HK9A 5GAN8 4HWOA 2P5IA 3PZCA 1JJCA 2J3LA 4RDXA 4NL3A 4C8QG 3NETA 4J6XA 3HXUA 1G5HA 4CS4A 3M4QA 3UH0A 4XTYA 2YLCA 4LNSA 3JB9I 3L4GB 3ICAA 2DVEA 1B70A 4TVAA 1EVKA 4C8QD 4ZIBA 2E64A 4RCBA 3RKXA 3I7FA 4C8QA 4L87A 1H641 5GAMd 3P8VA 3A32A 4YDQA 1X2HA 2E3CA 4HWRA 1HTTA 2I4MA 2DQ3A 4M77C 5LJ3g 3UGTA 1D3BB 2DU7A 5GMKm 1EIYB 3HRIA 3JB9J 4TVYA 4RMFA 3SWNB 3IALA 4TVAB 5GMKl 4HA8A 1WQ7A 1WNLA 1BBUA 1KMNA 2Q7GA 3HFNA 3V7RA 5GAOn 4M7AC 2ZR2A 1SERA 1NJ5A 4C8QB 4JRIA 1BBWA 1J5WA 5LJ3f 4N0AA 4M77D 4C92G 5C51B 2CJAA 2ZR3A 3JCMg 1U1TA 1WLEA 1HC7A 1KOGA 3A7UA 4P71A 4YRMA 4MMLA 1N9SA 1M8VA 3JCMc 5GAN2 4V2SA 4C92D 3KFUA 4E51A 1BIBA 4OLFA 1JRIA 4KQEA 3FJPA 3RERA 1PYSA 1RIQA 4MMKA 3RIRA 5LJ5j 4G84A 5GMKh 1HXDA 4M75C 4J15A 3L1AA 2K57A 3ERRA 4JLIA 4BWAA 5GAOp 5GAMh 3DSQA 3PCOA 2XTIA 5LJ5e 2ODRC 3JCMV 1H4VB 3RL6A 5ELOA 1QE0A 4TQDA 2RA2A 2QHSA 3RUXA 1WQWA 2ZZEA 4M78C 5GAOl 2E5AA 3JCMP 3RGLA 3BDUA 3RESA 5CAIA 4WJ3M 3AHUA 3VQVA 3LC0A 4H2WA 3JCMX 2RB6A 4C92B 2AKWA 2Q5IA 3VQYA 3A7RA 2DTIA 3VBBA 2VXEA 3RF1A 2DJZA 4M77E 1KQ1A 3HXVA 1FYFA 3PCOB 3HY1A 4M77F 2ODRD 3INZA 4AH6A 4P75C 1ASYA 1E1OA 3E9IA 4XU2A 1NJ1A 4P74C 3V8JA 3HFVA 4Y91A 4C92E
chains in the Genus database with same CATH superfamily
1UECA 1KQSS 2RHQB 2ZPEB 3FLGA 1Z7NA 2DXTA 2CP2A 5GAN7 3L2UA 1K9MC 3GF5A 2I4LA 1FMKA 3IKLA 4P72C 1WA7A 5A0DA 2O2OA 4H2TA 2E4HA 1B07A 3CMAT 1X43A 1PHTA 1QP3A 4BD3A 3G71A 1E6HA 2GCXA 4C0GA 2ZGWA 3O8VA 5CCAA 1X2KA 1K9MU 1NNHA 1YCSB 4PJOG 1QP2A 4HCCA 1VUBA 3SWNA 2GBQA 3JCMe 2L3QA 1Q7YR 1QCOA 4LD6A 1VQLT 3CC2T 4CH6A 3GP8A 1YHQT 4K87A 4OMNA 3EG9A 2R57A 1S72T 4PJOD 1YFSA 4M75F 1NJ8A 1WI7A 2HBWA 3OYYA 3EFRA 4JZ4A 4BUGA 3LGLA 4KH0B 1OZ3A 1UGQB 1GCQC 5A0LA 2KXDA 4QVDA 3SHWA 3LW5E 3I35A 2WSEE 3JCMb 2EGCA 4RCCA 5GAOq 4B9WA 2K9GA 2VV5A 4KGVB 4YRQA 2R5MA 4BACA 3S3MA 4PL6A 3CCQQ 2ABLA 2ZAEA 1NG2A 1UHFA 3CC7A 4N0AC 3CCSQ 3MHXA 4J9DA 2PQWA 3WVDB 3VS4A 4EO4A 5LJ5h 2V8IA 3QKJA 4KGZB 4PJOB 1TH7A 2R58A 3FRNA 3HRSA 2L3RA 1MNEA 1GGMA 3CCJQ 4YRRA 4HT9A 3H0IA 4UP7A 2ZPGB 1IGQA 1KC8R 4QVCA 5J26A 2AT1B 2Q7HA 4N4GA 4YRTA 5C52B 2K3XA 4PJOE 2X4JA 3M0QA 4JJNK 3JRZA 3NEMA 2COWA 2EWNA 4XU1A 1E1TA 2HSEB 4C92A 3I56A 1VQOQ 1VIFA 4FU6A 4Z89A 2CGHA 1BCMA 5DM7R 5CIUA 4LE9A 1KQSP 2YRVA 3LYIA 3NENA 1UE9A 2E3IA 1ZSZC 2G3RA 2YHTA 1ARKA 5GAOm 2PVOB 2NUPB 2QI2A 2KRNA 1W4SA 1K1ZA 1ZUYA 2JM8A 1K9MR 4Q15A 1YFRA 3TEHA 4O2DA 1VQ5T 4M7DC 3HFOA 1B34B 4PKCC 2KRSA 4TVWA 1L0WA 1B7YA 2LZ6B 3HRKA 2V8JA 3RR6A 2MK5A 1X2GA 4M78G 4F16A 2O88A 1IL2A 5L8RE 2BUDA 3MEVA 2RN8A 3VS3A 1YFTA 4CC4B 4PFOA 1PRMC 3CMQA 2GGRA 4LN2A 4M78D 2HNIA 2CKKA 2LJ0A 3J80E 4LVLA 3WQZA 2C06A 5KYXA 5GMKe 1ABOA 1B7YB 1O9SA 2ZNIA 4MDXA 2G6FX 2WSCE 1YP5A 2E1HA 3A5ZA 1Z7MA 1LNXA 3MKDA 3EHQA 1B7TA 1NLPC 4YRKA 1VQPT 3EGXA 3TEGA 3EG0A 4XTUA 1Y07A 3TEEA 1VQ9A 2ALYA 4P74A 4C8QC 4Z88A 1QVGA 2HL5C 3EG2A 2QQRA 3H0FA 2Y4YA 4M78B 5KYXB 4RQFA 1PSFA 3JCMJ 1GBRA 5C53B 1M3CA 2MCNA 4ATOA 2WACA 4F04B 4P72A 2AK5A 2QHUA 1YJNQ 1E24A 3I55A 1K4US 3A5ZB 3OD1A 1C6VX 1G5IA 2ARUA 3JCMQ 1JJ2S 1KJWA 2D8HA 1XNIA 4M78E 1N8RC 2RHSA 1TSFA 5LJ5f 2J6OA 2K3BA 2V8KA 5C0MA 4OB3B 1M2VB 1RAHB 4JPBW 4QVZA 1C0AA 1I4K1 2DVJA 2RF0A 5K1XA 3RNJA 2RQTA 4DPGA 1N5ZA 4UPAA 1QW1A 3PMIA 1N8RU 2I2LA 2QEXT 2GTOA 1GCQA 3CBOA 1LPLA 4BE1A 1QLYA 2GTJA 2RHSB 3UGQA 3V7SA 3PGGA 5IHKA 2ZZGA 3EG1A 2F69A 3CCET 3MEYA 2RO0A 2DDZA 3A31A 1B3QA 1QVFA 1C0MA 1PC0A 3BY7A 3S3OA 3E9GA 3VS6A 1CKAA 2MOXA 4PG3A 1G83A 1QCFA 1YCYA 3D7SB 3HXYA 3GNFB 1PNJA 1VQ8A 4R56A 3CCRT 3CXCP 1KMMA 1ZBJA 2MPXC 3P8HA 1SETA 4F7UG 1PD1A 4OP0A 2EJFA 1UFFA 3OQ5A 3JCMf 1VQ7A 2PZ1A 3OYKA 2Y90A 3G6ET 4J7IA 2EYYA 1SESA 1IHVA 1TU0B 1M1GA 2E5KA 1WHHA 2O01E 4F7UA 2ZIMA 5FRNA 3E2UA 1IZ6A 2EJGA 2XHCA 3SFMA 1Q82C 2MYSA 2PMFA 3TQ7P 2KY9A 4HVCA 2QQ9A 1D0YA 4ZGJB 4OGEA 2JOYA 1YI2Q 1DJ7B 5CKBA 4M7DA 3OYBA 2P0QA 4JS4A 2CT3A 2RK2A 1N9RA 3OYGA 2GF7A 2M0YA 4IURA 4F7UB 1NBEB 3M0UA 1Q82U 1N8RR 1SHGA 1ZSZB 2XG8D 4QQDA 5FU6C 1YITA 1I0CA 1AZEA 2LCSA 3EFSA 1FMWA 4H02A 4E7ZA 2RM4A 3HRUA 2MI6A 4HWOA 2OTJT 3OBYA 1JJCA 4RDXA 4NL3A 4C8QG 3NETA 3CCSA 1BYMA 1PKSA 4J6XA 4RTUA 2Z0WA 4LUEA 2YLCA 4DA4A 2MWPA 3BDLA 3ICAA 2DVEA 2CZ0B 5LL6S 5KYUB 1AEYA 4C8QD 1F1BB 3EFOA 1YJWA 3OS1A 2CDTA 4QKUA 3L2WA 3RKXA 1IREB 1PRLC 2SEMA 3QYHB 4C8QA 3CMET 3CCJA 4L87A 4II1A 3A32A 1NPPA 3A98A 2E3CA 4E7HA 2I4MA 2GQIA 1M8MA 2DU7A 1WLPB 1VQOA 5CKHA 2AHJB 2RHUA 2E3HA 1KFZA 1CKBA 3EFOB 5A0GA 1UDLA 3HFNA 3V7RA 5GAOn 3NTHA 1Q95G 2X4WA 4Z02A 1NJ5A 4C8QB 1SG5A 4JRIA 3OW2S 1K76A 3QJ6A 2YSQA 3ZBDA 4M77D 4L59A 3WXMB 3OY9A 5FLXE 2EYZA 4QW2A 2DAQA 1K73C 1WLEA 3A7UA 4MMLA 5GAN2 1JB0E 3KFUA 1RACB 1M1FA 1X6GA 1JRIA 1WXUA 3RERA 4E2FB 1QWEA 2P0KA 3E19A 3X28B 2JNGA 2ED1A 4HVWA 3PNWC 1K73U 3ERRA 1YIJT 4E7IA 4PJJA 2ODRC 2EW3A 1AD5A 2GQVA 3M56A 3RL6A 5ELOA 4K11A 2F5TX 1RI0A 2LC4A 3HP9A 2QHSA 1WQWA 2OTLT 2DRMA 3SD4A 5D6WA 2A36A 3ASKA 3VQVA 2ZCFB 4LVIA 1U5SA 3THKA 4CC2A 2VXEA 4IUQA 3RF1A 4M77E 1KQ1A 4MZMA 4FYVB 1AZGB 2O9VA 3I5RA 4C5IA 3NGPA 4ZNXA 4OMOA 3R07A 3G7ZA 4FT2A 1BU1A 2IY5B 3L4GA 1VQ4Q 4M7AF 2V1QA 3FB9A 5A2QE 1E6GA 1YJNA 2D6FA 4MDWA 4H2XB 2ROLA 2M0OA 1UUEA 2K79A 2V26A 2BZ8A 4PHCA 4PJOC 4OF1A 3M0RA 4KGXB 3VYHB 4ZTUB 3VQWA 1X2QA 1MHNA 1R0BG 3WVEB 4C5EA 4G85A 4X9DA 1VQNT 3T9NA 2KSSA 4PLLA 3HTRA 4YRIA 3P8DA 4YRFA 3REAB 2EQMA 2QQAA 2L89A 3CBPA 1WXTA 2DXBA 4TWAA 4HKEA 4CS3A 2X3WD 4M75E 2AIRB 1WHKA 3P8BB 4WI1A 1RLQC 4J6WA 1OU8A 3CMAQ 1RUWA 3O5ZA 3PVLA 2A0FB 2DMOA 3M55A 2ZIOA 4ESRA 1D1CA 2RQUA 1K73R 1YB3A 3HFZA 1WU7A 2H3EB 2EKOA 1M30A 1VQLQ 3CC2Q 4J9BA 2ZT6A 3BE3A 1YHQQ 4Q5WA 1S72Q 2EGEA 2QDYB 5FU6B 1XQHA 3URGA 3CPWS 1V29B 2O9SA 2F1LA 2FVUA 4YRSA 3NTIA 1RAEB 3HFZB 1MV0B 3L2VA 2H8HA 4HCZA 1BB9A 4JDSA 3CCLT 2LNVA 1TG0A 4CC7A 4RQEA 4J6YA 3TSWA 4RTXA 3ZFJA 1U3OA 5KYYA 3CEYA 2MAMA 4JUVA 4YCVA 7AT1B 2RJCA 8AT1B 4CS2A 4A4FA 4E6RA 2K3YA 2NYSA 1TUGB 3QTCA 1OPKA 3FIFA 1R8OB 2DEQA 1X55A 3JB9H 3L2ZA 4XTWA 1YI2A 2RHZA 2RHQA 3CC4T 4FIBA 4LDUA 12ASA 3MJXA 3NHNA 1K0XA 2JN0A 2QA4T 5KYYB 1W2BP 4K86A 3MF1A 2HMAA 2FL7A 1XTDA 1KSWA 1NE8A 4XU0A 2EIFA 2KQWA 3IKMB 3QIIA 1AWOA 3CCMT 4FYXB 1UG1A 3AT1B 4C0FA 3OYAA 2ZPFB 3NELA 5FW9A 3QO7A 5LJ3e 3QZ5B 3M0SA 4RG2A 3PT9A 2F5KA 4BW9A 2X4XA 1VQ5Q 2COYA 2CJ9A 5F5WA 3A8GB 3EH1A 3QG1A 2X9HA 5LJ5d 3QO3A 3CD6T 2NUTB 1LOJA 3F70A 4ZTZB 4WJ4A 1XOVA 3RACA 1G2BA 2DNUA 1OI1A 3QBYA 3G4SA 5CQXA 1X6OA 3CPWP 3QO8A 2CZ6B 4OVAA 2ZT8A 4DBFA 1BKBA 5CKEA 3C95A 1VQ9T 2I4NA 4HWSA 4BY6C 3HTZA 1IB8A 4PJOA 2DIGA 4OMMA 4D8KA 5LJ3d 4RTTA 5KE3A 2K6DA 2YLBA 3BFMA 1P92A 3FDRA 1W1FA 4RTVA 1VQPQ 4N4HA 4KH1B 4JJCA 1NYFA 2FZKB 1H4TA 1YJ9T 4UP8A 2VB6A 2DL4A 4GY5A 3VS5A 4LDXA 2OX7A 4R0KA 2DU5A 2DTOA 2CH4A 4HT8A 2WSFE 3QDRB 5HCKA 3UWNA 3DKMA 4X5OA 4N4IA 3JCMd 4DBHA 3J81E 2RD1A 1B70B 5HGQA 1NM7A 5AT1B 4RTZA 2RI3A 3V8KA 4CRIA 2ZCEA 3REXA 5KNNA 4ME7A 2GFAA 1YFNA 2NUPA 1IGUA 2JS0A 4HVUA 2LCLA 1B34A 2DTHA 4OB0B 3VS2A 2CSQA 3N5BB 3QUIA 1YNZA 3HY0A 2FO0A 3RMSA 3GNGA 2M51A 2QEXQ 1TWBA 3RBBB 1KHIA 1BI1A 2CJBA 1MMNA 5LJ3h 4CH3A 1EQRA 1ZA1B 3KXTA 3UF4A 2ECZA 3SB2A 2IIMA 3I9QA 5FROA 2MMPA 2KEAA 1G51A 4CC3A 11ASA 2A37A 1VQKA 2EYWA 1AWXA 1G5VA 4FSSA 3CCEQ 3CCUT 2QTXA 5KCOA 2LTOA 3LH5A 1Y96A 1VQ4A 4Z8AA 2KT8A 1IHWA 4KT0E 2CH4W 3U23A 4H2UA 4OMQA 1ZBXA 3LH0A 3QO5A 3JCMh 5I2SA 2ZINA 3FJ5A 3VU3C 1X54A 1PYSB 2LNHB 3CCRQ 5GANe 2C0OA 1RI9A 1EFWA 2DF6A 2JUFA 2KNBB 2P0LA 2HCKA 3VUBA 4PK4A 4M78A 1GBQA 1Y96B 3CXCS 1SPKA 4AG2C 5ELNA 3OYNA 3G6EQ 3H41A 2HAXA 4J9FA 1NLOC 4AG1C 2QTVA 1TUCA 4J9GA 3M4PA 4XTXA 2YRDA 2HQXA 4P73C 3CMAA 4OMLA 3JB9G 5EC7A 4YRPA 3OSVA 3R6NA 1HJDA 1M2VA 1M90U 4YROA 5LJ5g 3M54A 1VYTA 2LJ3A 2Y4XA 3JB9D 3PMTA 3PZCA 1YITT 2VASA 1VQLA 5IXBA 3CC2A 2L3PA 1YHQA 1G5HA 4CS4A 1S72A 3QWXX 4LNSA 2M02A 3GBQA 3FEOA 2DLPA 1OX8A 4HCBA 1WHJA 4RTYA 1WJSA 2JMCA 2KAFA 1H92A 3QZ9B 3P8VA 1MMDA 4YDQA 4B9XA 4E7KA 3VRZA 1YJWT 1X2HA 3KBGA 1HTTA 2DL5A 4M77C 5LJ3g 3UGTA 1D3BB 5I22A 5KYWB 1R77A 1EIYB 1NEBA 5GMKm 4GLKA 4PJLA 1BCOA 4RMFA 2CP3A 4AFUC 4P5NA 1RLPC 5GMKl 1G3YA 1WNLA 1BBUA 3IQLA 2FPEA 1TXQA 2LQWA 1T0HA 3EG3A 3CCVT 3OW2A 2LX7A 1J5WA 3CMEQ 5LJ3f 4N0AA 2HDAA 2COZA 2EBPA 1JU5C 3DLMA 4PJNA 2XDDA 4A63B 2CJAA 2ZR3A 4BE0A 3JCMg 1U1TA 4HT4A 4BY6B 1KOGA 3R6OA 2LQNA 2KGTA 4OMFB 4HXJA 4PLIA 4RG8A 1K8AC 1BIBA 4OLFA 2ED0A 5GJVB 4MMKA 1Q86C 5LJ5j 4G84A 5GMKh 4RUGA 2L0AA 4M75C 4BWAA 4YTLA 2DEUA 3OYJA 2XTIA 2BE7D 1VQ5A 1K8AU 3JCMV 2IVWA 4TQDA 2RA2A 1YN8A 3UA6A 1RL2A 1Q86U 3MPUB 2XICA 2CP7A 2FZCB 1ZSZA 4TVRA 3RESA 1HYOA 5I11A 4H2WA 3JCMX 1BI2A 4BI4A 2AKWA 3A7RA 2DTIA 2LMJA 1UEBA 2GFUA 2J7IA 4FL6A 4BE2A 1YBYA 1YIJQ 3HY1A 2DO3A 3INZA 4P75C 1ASYA 4KBMB 5CR2A 2NUZA 2L2PA 1NJ1A 5HK3A 2ROTA 3OS5A 1KD1C 3HFVA 4HWTA 4M7AE 4C92F 2OTLQ 3H0HA 4Q6GA 5KYUA 2FYKA 2P4RA 2AKWB 1ASZA 4X34A 2D1XA 2EQIA 5IAYA 4P3NA 1M27C 3HL8A 1VQPA 2DILA 3CCQA 1KD1U 3MP8A 2XI9A 3DB3A 2QAZA 1LJOA 2DFUA 1ZX6A 3MF2A 1PG5B 1OPLA 4OB2B 1U8RA 1BIAA 2VGMA 4KR3A 3A8OB 2C8MA 4EPCA 1QMCA 2QASA 1VQMQ 2C7IA 2RQRA 4PNOA 1VQ6T 2J3MA 1V1CA 2DL3A 2YDLA 3TUPA 2JTFA 2VWFA 2JT4A 1UGVA 3MEUA 4C5GA 1H3HA 3X20B 4JS5A 2LCCA 1WZOA 3NTKA 3OYHA 1VQNQ 3TU4K 3H8ZA 2VKNA 4C5HA 1ATIA 2GNCA 3EHRA 3EGUA 2OJ2A 4M78F 4RMOA 3QPHA 2OAUA 2HZYA 3JAME 2ZNJA 1Q81C 6AT1B 1H4SA 4M77G 4HWPA 1OX9A 1NJ2A 3A8LB 2LQ8A 1N9WA 2CUDA 2BIVA 1JO8A 4DEXA 2VUBA 2CYZB 1VA7A 2KI7A 2JXBA 1W66A 1EOVA 2QQSA 3A7AA 3CCEA 3EGDA 1Q81U 2DD4A 4M77A 3HXXA 2O31A 1D0XA 2D0NA 2BKDN 1SRYA 1Q82R 1RAFB 3JV3A 4LUDA 1ZHIA 2ATCB 5FU7C 5IH2A 2E6ZA 2NLUA 3CCRA 2D8JA 2OAWA 1QVFS 1KD1R 4KRTA 3EGDB 2ZT7A 1N6AA 4M77B 4JJBA 4M75G 3CCLQ 2IY5A 2K5IA 2P4TA 4H2XA 2KDSA 2HBPA 4M75D 1R0CB 3P8TA 2W10A 2NS6A 3GPLA 4A54A 1NPRA 4MZTA 4DBQA 2A3LA 4M75A 3M0PA 2HL3A 3PIOA 2LT4A 1QVGP 1KQSA 2LP5A 5GMKj 5I2MA 3CC4Q 2E5QA 3OB9A 2DBMA 4A53A 1UGSB 2CREA 3UPUA 2IG0A 4XTZA 4J83A 2QA4Q 5FWCA 2DZCA 2DRKA 1U06A 2LRQA 2ZZDA 3BJUA 3PIPA 2EAYA 1I1JA 3VRYA 3HXWA 4J9CA 1M4ZA 4M75B 2E12A 1W2BS 1MUZA 2DE0X 3CCMQ 1WDXA 3PVQA 4H2YA 3G71T 2CZ1B 3NMZC 1Q81R 4JRKA 3LSQA 1ADJA 2K5FA 4J7FA 4FCYA 3DB4A 3LGFA 1K0SA 3G4ST 3BW1A 1QF6A 3TCJA 3CD6Q 1MV3A 2DX1A 4F7UF 1WYDA 1VOMA 3HXZA 4UC4A 4AFZC 1SRLA 2BE9B 3A74A 4P3PA 5EG2A 4YPFA 4KR2A 2JZ2A 1RABB 3L2QA 2L5QA 3RDVA 4M7DF 4E7SA 5GAOr 2IPOB 2QXFA 3HHTB 3VJPA 2AMCA 2DPPB 2KXCA 5IN1A 1QVFP 1UGPB 1GRIA 2O4XA 5L23A 1VQ9Q 1SSFA 3CC7T 3JCMW 4IKFA 1QKXA 5DLOA 4YRGA 2D0QB 1NJ6A 4C0DC 2VVKA 5CO7A 2P84A 3C94A 2RHXA 4A4GA 4C92C 2F2XA 3M58A 2E70A 2CT4A 2EQKA 1QQJA 4ZGDB 1YJ9Q 2AMCB 3EH2A 3S3NA 5GAN6 1WFWA 2M9UA 2O4XB 5M9OA 2G4CA 3DLLA 3FC3A 4YCWA 2HD0A 2BZXA 3GOXA 2YT6A 3PFSA 3QHSA 3I56T 1Q7YU 1I5LA 2QGGA 3TVTA 3VS1A 4WTOB 4C8QF 2QQBA 3OSSC 1YIJA 2DIQA 3PE0A 1QCNA 3C0CA 1KK7A 2VYTA 1WXBA 4X1VA 1B8AA 5ECAA 3L42A 2ZXFA 1NYGA 4HVVA 5GMKi 2OTLA 5KYNA 4CH4A 2A7YA 2M1HA 3GLXA 2K2MA 4FSXA 3ULRB 1VQKT 2V1RA 2NUTA 4YRCA 1VQZA 3OBWA 1LYLA 2J6KA 4LDWA 2YUPA 3OYCA 4ZTFA 3VQXA 2EL9A 3V7CA 3VUZA 2VXFA 2EQJA 1AWJA 3CCUQ 4PJMA 3HSBA 2C0TA 4XEMA 2CZ7B 4JJDA 5GAMe 2Q5HA 4TQFA 1H8KA 1VQMA 5FU7B 2RHIA 2DZ9A 4YRJA 3VS7A 3P8YA 3OS0A 4PFPA 2X3XD 4EX5A 1H3ZA 5CVIA 4JRPA 1USYC 5GAN3 1U1SA 2YUOA 3EAEA 2VC8A 3X26B 2ZTGA 2XD0A 1VQNA 2ZT5A 4M4ZA 4KUDK 4Y28E 5GAN8 2P5IA 4IUTA 2J3LA 2KYMA 2F2VA 2JJ9A 4ELZC 3UH0A 4XTYA 1JJ2A 1KG1A 3JB9I 1B70A 4TVAA 1EVKA 2MIOA 2I0NA 4ZIBA 1NZ9A 3I55T 4DOWA 5KCHA 2E64A 4RCBA 1JQQA 1FYNA 3OA6A 1PSEA 5GAMd 2XMFA 1M1KC 1YITQ 4IIMA 4Y92A 4ZN3A 2DQ3A 4BDYA 1LCKA 3I5SA 1T3LA 3HRIA 2KROA 4ANJA 2EGAA 2CSIA 2FG0A 3SWNB 4TVAB 3MP1A 3ZL7C 1KMNA 2Q7GA 2EQUA 2DD5A 3NFCA 4M7AC 4QQGA 3EG9B 5HK0A 4D8DA 1SERA 1M1KU 2LJ1A 4PFZA 2HQEA 2DJQA 3CCLA 4C92G 1YJWQ 3QYGB 1MMGA 1TTHB 1MNDA 2BTTA 4J9IA 3HPWA 1HC7A 4A4EA 1OV3A 2A28A 4AMCA 1M8VA 3JCMc 4V2SA 1ABQA 4C92D 3OYLA 4E51A 2AKLA 1PYSA 1IRXA 1RIQA 1RADB 2DM1A 1WIEA 1UJYA 3LWHA 1HXDA 1OU9A 3CCVQ 3OYFA 3VYGA 2PVGB 1OQKA 4IIOA 2L8DA 4EIKA 4J15A 2K57A 1QWFA 4JLIA 1VQ8T 5GAOp 5GAMh 3PCOA 4ORZA 3CC4A 3MQZA 2ZPBB 5D6YA 1OOTA 5CKFA 4ELYC 1WX6A 4FT4A 2QA4A 3G1JA 4IUVA 1QE0A 2LQKA 1VQ7T 3M57A 2A8EA 4C0DB 2RQWA 3RMQA 2ZZEA 2KK4A 5GAOl 2E5AA 3JCMP 4FYWB 3BDUA 4FM4B 4F14A 1I07A 3A8MB 4C92B 1PKTA 2CP6A 2D9TA 3CCMA 4D6WA 1OZ2A 4IUPA 1M90C 3PCOB 1O75A 1E1OA 3UATA 3E9IA 3MP6A 3JSCA 1G3WA 3SDZA 3MO8A 2E6NA 4Y91A 3V8JA 4C92E 1V76A 3VS0A 2EJ9A 2DA9A 4J9EA 3CD6A 4KULA 3TEHB 4FW2A 3TREA 4AFQC 4OGCA 3HKSA 5GAN4 3ME9A 1PWTA 1RAGB 2PUKB 1X01A 2FPDA 3RKWA 4X9CA 4K88A 3MEAA 1M1KR 5J3BA 2DXUA 1TUDA 1VYUA 5D7UA 3M59A 1W70A 4EMGA 3LX7A 9ATCB 2R5AA 4FW1A 4VUBA 2J6FA 2X4YA 1D3BA 5KYWA 4BI8B 1EIYA 2QGFB 4EMHA 1HSQA 3TSZA 2KBTA 5GANd 4MZPA 3CCQT 3M53A 4DBRA 1SHFA 2DETA 8ATCB 1OEBA 3CCST 4IUUA 1USYA 4FYYB 5CKDA 2DQ0A 3M5AA 4QT7A 2ZPHB 2E65A 4P3OA 5I21A 4WF2A 2OTJQ 5IHNA 1WHMA 1M5Q1 1E7OA 2AZVA 2FB7A 2DERA 2VGNA 4L6V5 1AVZC 1YJ9A 3A5YA 1C1AA 3CCJT 3EGXB 1NJIC 4O6JA 2FPFA 2HEQA 2QDLA 2ALYB 4YYEA 1KIKA 1AOJA 1Y7XA 3QJYA 1UHCA 1SEMA 3C12A 4H2VA 4NL2A 4YCUA 2PUOB 5GAMg 1VQ6Q 1VQOT 2DK3A 1ZSGA 5D6XA 4C0ZA 2DKGA 4XTVA 1TS9A 2PNIA 4NCXA 3KFVA 3QWYA 1CSKA 1JXMA 1GCPA 1NJIU 1EZZB 4M7AG 4NOYA 4EMKC 1ADYA 2AZSA 2YRCA 2HKNA 4XEOA 4AT1B 2YUQA 2FHDA 5DLQE 1M2OA 2DYBA 5CQYA 4HCKA 5GAMf 2RJEA 5GANh 1KQ2A 4M7AD 2RI2A 4J9HA 3UT1A 1D1BA 3LLRA 4A4KA 3OMGA 4PJOF 3MEWA 1J3TA 3REUA 4M7AA 2EPDA 4H2SA 1M90R 1Y0MA 4XU3A 3HRTA 4BI3A 1FXXA 1G8XA 2RI5A 4B6MA 4JRQA 4TTVA 2LX9A 3W3SA 4JLGA 1BI3A 2JVVA 4QQ6A 1B76A 3CCUA 2QYZA 5C6SA 2CP5A 3QDFA 2MWOA 3ZEHA 2MF2A 1EFNA 1ZA2B 1ZUKA 3E9HA 1W6XA 5HKCA 4M7AB 3CQTA 3RKYA 2YWWA 2ARSA 1JXOA 2RH2A 1RAIB 3NPFA 4DOVA 5LJ3j 3S6WA 1JBMA 1YWPA 4LDVA 4M7DG 1X56A 2JS2A 1WHLA 2RHYA 2PVDB 4GLMA 4J8OA 4M7DD 3M4YA 1JEGA 5IT9E 1MGQA 5GAMj 2YUNA 4AFSC 1QVPA 1H4QA 2KVQG 1JJ2P 4YP0A 3OMCA 1W2BA 3VV0A 1Y71A 1YJNT 2ZZFA 2YXYA 3QNEA 3QSUA 2B86A 4KUIA 1NJIR 1BI0A 2EYXA 2JTEA 4ZN1A 1OULA 3V8LA 4YREA 2QHVA 1SF9A 1UTIA 1WHGA 2PU9B 2XU8A 2XDPA 3ER0A 2QHTA 1QVGS 1GFDA 4P73A 4M7DB 4F7UE 1PD0A 4RTWA 4E47A 2SRCA 1VYVA 4CI0C 5GAN5 3J7AF 2X51A 5GANg 1XJWB 2RMOA 4UP9A 4YRLA 5AYFA 4M7DE 1G3TA 1K8AR 2J06A 3G71Q 5DY9A 2PMEA 1WYXA 1UB4A 3M9QA 3A8HB 2K7AA 1D0ZA 1Q86R 2P0PA 2HSPA 2ESWA 3UFGA 3CPWA 2QEXA 3PTAA 1YGBA 3G4SQ 2NWMA 3OYEA 1JJCB 2KYBA 5GANf 4P71C 2M16A 2CP0A 2PTKA 2AKKA 2C0IA 3CCVA 2XGTA 3GIBA 2A08A 3G1ZA 3LWIA 1D1AA 1NYQA 1OYXA 2KR3A 2EKHA 4YRNA 2E41A 1X27A 3H9NA 3JB9F 2RJFA 1PM3A 1I81A 2B8AA 1EVLA 1I8FA 2LT1A 3CC7Q 2RNAA 1AWWA 4NS5A 2LDMA 2XDBA 1WJRA 2CIMA 3C4SA 4C8QE 1AHJB 4R55A 4DQ2A 1QKWA 4EMKA 3OYDA 1A0NB 3E9FA 2KT1A 2ENMA 2XIDA 3G6EA 1G3SA 3LSSA 4LDYA 2ZPIB 4EDUA 1YI2T 3CPFA 2RK1A 1Y57A 1MMAA 1HD3A 5GANj 2ARTA 1WPYA 2Q7EA 2DBKA 3I56Q 2J05A 1NYRA 3OYIA 1T0JA 2H3JA 2I4OA 4EMKB 2RPNA 1M3BA 3M4GA 4LNPA 1X6BA 5K1PA 4J5YA 4L5GA 2KMTA 5E3IA 2W0ZA 2JW4A 1TOVA 2JMAA 2L3SA 1VQKQ 3SWNC 3KUFA 4CH5A 1EIFA 2FZGB 2CS7A 5GJWB 4LVMA 2XK0A 1E22A 1VIEA 4XQ3A 4P75A 1PCXA 3IG2A 2E10A 4OB1B 1SSHA 1X75C 1VQMT 3X24B 5KE2A 3X25B 2OTJA 2HQHA 5J39A 1RAAB 1SRMA 1GXIE 4LVJA 1K9AA 1M9SA 1HK9A 2OI3A 1NEGA 1EX4A 1S1NA 5HY6A 2RQVA 5FWBA 3M0TA 3HXUA 2DYIA 3M4QA 2K2VA 1VQ6A 4LVKA 3L4GB 1SKUB 5IXFA 3CMEA 2RJDA 3OW2P 4LXCA 1FWZA 1T3SA 3I7FA 1D09B 1ZUUA 5KH6A 4JZ3A 3Q1JA 1H641 4RKUE 2EYQA 2QG9B 4XAXB 5IHIA 1BBZA 3SEMA 3OS2A 1IXDA 4HWRA 1FX7A 4ZTJA 3JB9J 2FRWA 2CUBA 3VKIA 4TVYA 2K5LA 3IALA 3QXEB 4HA8A 1WQ7A 2DXCA 2K4YA 1GFCA 2DL8A 1Q7YC 2EFIA 2HKQB 4XK8E 3I55Q 2ZR2A 2FEIA 3E1SA 1BK2A 1GL5A 4GBQA 1BBWA 1UGRB 2JTMA 1M3AA 1KHCA 4LD9K 4O5VA 3H6ZA 5C51B 2QK0A 1Z9QA 4E7LA 3A1PA 1FMVA 4OMPA 4P71A 4YRMA 4E7JA 1N9SA 4A4HA 1UJ0A 3CBMA 1I5OB 1AT1B 4KQEA 3FJPA 3RIRA 1ZLMA 3UDCA 4F17A 1IO6A 3MCAB 1YWOA 3L1AA 1WGSA 2X35A 1ZQ1A 3OYMA 3DSQA 2KRMA 4DEYA 4BB7A 5LJ5e 4BDZA 1X69A 2KE9A 3META 1H4VB 2XKOC 3L2RA 4ZGEB 1Z9ZA 3RUXA 1VQ4T 1KC8C 4M78C 5CK9A 3RGLA 5CAIA 1N27A 3AHUA 4WJ3M 3LC0A 3REBB 2LVMA 2JM9A 2RB6A 5FRMA 2Q5IA 3VQYA 1LVKA 3VBBA 3CXCA 2DJZA 2FRYA 2DL7A 3HXVA 1VQ8Q 1FYFA 4M77F 2ODRD 1WJQA 4AH6A 2BZYA 4WCIA 3UA7A 2EVRA 4XU2A 1ACMB 4P74C 1KC8U 2F2WA 1VQ7Q
chains in the Genus database with same CATH topology
1KQSS 2RHQB 2ZPEB 3FLGA 1Z7NA 2DXTA 5GAN7 3L2UA 1K9MC 3GF5A 2I4LA 3IKLA 4P72C 5A0DA 4H2TA 3CMAT 1QP3A 4BD3A 3G71A 2GCXA 4C0GA 2ZGWA 3O8VA 5CCAA 1K9MU 1NNHA 4PJOG 1QP2A 4HCCA 1VUBA 3SWNA 3JCMe 4LD6A 1VQLT 3CC2T 4CH6A 3GP8A 1YHQT 4K87A 2R57A 1S72T 4PJOD 1YFSA 4M75F 1NJ8A 3OYYA 3EFRA 4BUGA 3LGLA 1OZ3A 1UGQB 5A0LA 4QVDA 3LW5E 2WSEE 3JCMb 4RCCA 5GAOq 4B9WA 4YRQA 2VV5A 2R5MA 4BACA 3S3MA 4PL6A 3CC7A 4N0AC 3MHXA 2PQWA 3WVDB 4EO4A 5LJ5h 2V8IA 3QKJA 4PJOB 1TH7A 2R58A 3FRNA 3HRSA 2L3RA 1GGMA 4YRRA 4HT9A 4UP7A 2ZPGB 4QVCA 5J26A 2Q7HA 4YRTA 4N4GA 5C52B 2K3XA 4PJOE 2X4JA 4JJNK 3JRZA 3NEMA 2EWNA 1E1TA 4XU1A 3I56A 4C92A 1VIFA 4FU6A 2CGHA 5DM7R 5CIUA 2YRVA 3LYIA 3NENA 2G3RA 2YHTA 5GAOm 2PVOB 2QI2A 1W4SA 4Q15A 1YFRA 3TEHA 4O2DA 1VQ5T 4M7DC 3HFOA 1B34B 4PKCC 4TVWA 1L0WA 1B7YA 3HRKA 2V8JA 1X2GA 4M78G 1IL2A 5L8RE 2BUDA 3MEVA 1YFTA 3CMQA 4M78D 2HNIA 2CKKA 3J80E 4LVLA 3WQZA 2C06A 5GMKe 1B7YB 1O9SA 2ZNIA 4MDXA 2WSCE 2E1HA 3A5ZA 1Z7MA 1LNXA 4YRKA 1VQPT 3TEGA 4XTUA 1Y07A 3TEEA 1VQ9A 2ALYA 4P74A 4C8QC 1QVGA 2QQRA 2Y4YA 4M78B 4RQFA 1PSFA 3JCMJ 5C53B 4ATOA 2WACA 4P72A 2QHUA 1E24A 3I55A 3A5ZB 3OD1A 1G5IA 2ARUA 3JCMQ 1JJ2S 1XNIA 4M78E 1N8RC 2RHSA 5LJ5f 2V8KA 5C0MA 4OB3B 4QVZA 1C0AA 1I4K1 5K1XA 4DPGA 4UPAA 1QW1A 3PMIA 1N8RU 2I2LA 2QEXT 3CBOA 4BE1A 2RHSB 3UGQA 3V7SA 3PGGA 2ZZGA 2F69A 3CCET 3MEYA 2RO0A 2DDZA 3A31A 1QVFA 3BY7A 3S3OA 3E9GA 4PG3A 1YCYA 3HXYA 3GNFB 1VQ8A 4R56A 3CCRT 1KMMA 3P8HA 1SETA 4F7UG 4OP0A 2EJFA 3OQ5A 3JCMf 1VQ7A 3OYKA 2Y90A 3G6ET 4J7IA 1SESA 1M1GA 2O01E 4F7UA 2ZIMA 5FRNA 1IZ6A 2EJGA 2XHCA 3SFMA 1Q82C 2PMFA 2KY9A 4HVCA 2QQ9A 4ZGJB 4OGEA 2JOYA 1DJ7B 5CKBA 4M7DA 3OYBA 2P0QA 4JS4A 2RK2A 1N9RA 3OYGA 2GF7A 4IURA 4F7UB 1Q82U 2XG8D 4QQDA 5FU6C 1YITA 3EFSA 4H02A 2RM4A 3HRUA 2MI6A 4HWOA 2OTJT 3OBYA 1JJCA 4RDXA 4NL3A 4C8QG 3NETA 3CCSA 1BYMA 4J6XA 2YLCA 4DA4A 2MWPA 3BDLA 3ICAA 2DVEA 2CZ0B 5LL6S 4C8QD 1YJWA 3OS1A 3L2WA 3RKXA 1IREB 3QYHB 4C8QA 3CMET 3CCJA 4L87A 4II1A 3A32A 1NPPA 2E3CA 4E7HA 2I4MA 2DU7A 1VQOA 5CKHA 2AHJB 2RHUA 5A0GA 3HFNA 3V7RA 5GAOn 3NTHA 2X4WA 4Z02A 1NJ5A 4C8QB 4JRIA 3OW2S 3QJ6A 3ZBDA 4M77D 4L59A 3WXMB 3OY9A 5FLXE 4QW2A 2DAQA 1K73C 1WLEA 3A7UA 4MMLA 5GAN2 1JB0E 3KFUA 1M1FA 1JRIA 3RERA 2P0KA 3E19A 3X28B 2JNGA 3PNWC 1K73U 3ERRA 1YIJT 4E7IA 2ODRC 2GQVA 3M56A 3RL6A 5ELOA 2F5TX 1RI0A 2QHSA 2LC4A 3HP9A 1WQWA 2OTLT 3SD4A 5D6WA 3ASKA 3VQVA 2ZCFB 4LVIA 2VXEA 4IUQA 3RF1A 4M77E 1KQ1A 4MZMA 4C5IA 3R07A 3G7ZA 4FT2A 2IY5B 3L4GA 4M7AF 3FB9A 5A2QE 1YJNA 2D6FA 4H2XB 4MDWA 2M0OA 4PHCA 4PJOC 4OF1A 3VYHB 4ZTUB 3VQWA 1MHNA 3WVEB 4C5EA 4G85A 4X9DA 1VQNT 3T9NA 2KSSA 4PLLA 4YRIA 3P8DA 4YRFA 2EQMA 2QQAA 2L89A 3CBPA 2DXBA 4TWAA 4HKEA 4CS3A 4M75E 3P8BB 4WI1A 4J6WA 3M55A 2ZIOA 1YB3A 3HFZA 1WU7A 2EKOA 2ZT6A 4Q5WA 2QDYB 5FU6B 1XQHA 3URGA 3CPWS 1V29B 2FVUA 4YRSA 3NTIA 3HFZB 3L2VA 4HCZA 4JDSA 3CCLT 2LNVA 4RQEA 4J6YA 3ZFJA 3CEYA 2MAMA 4JUVA 4YCVA 2RJCA 4CS2A 4A4FA 2K3YA 3QTCA 3FIFA 1R8OB 2DEQA 1X55A 3JB9H 3L2ZA 4XTWA 1YI2A 2RHZA 2RHQA 3CC4T 4FIBA 4LDUA 12ASA 2JN0A 2QA4T 4K86A 3MF1A 2FL7A 1XTDA 1NE8A 4XU0A 2EIFA 2KQWA 3IKMB 3QIIA 3CCMT 4C0FA 3OYAA 2ZPFB 3NELA 3QO7A 5LJ3e 3QZ5B 4RG2A 3PT9A 2F5KA 4BW9A 2X4XA 2CJ9A 5F5WA 3A8GB 3QG1A 5LJ5d 3QO3A 3CD6T 1LOJA 3F70A 4ZTZB 4WJ4A 1XOVA 3RACA 1OI1A 3QBYA 3G4SA 5CQXA 1X6OA 3QO8A 2CZ6B 4OVAA 2ZT8A 1BKBA 5CKEA 3C95A 1VQ9T 2I4NA 4HWSA 4BY6C 3HTZA 4PJOA 2DIGA 5LJ3d 5KE3A 2YLBA 3BFMA 1P92A 3FDRA 4N4HA 1H4TA 1YJ9T 4UP8A 4GY5A 4LDXA 2DU5A 2DTOA 4HT8A 2WSFE 3QDRB 3UWNA 3DKMA 4X5OA 4N4IA 3JCMd 3J81E 2RD1A 1B70B 5HGQA 3V8KA 2RI3A 4CRIA 2ZCEA 3REXA 5KNNA 4ME7A 2GFAA 2LCLA 1B34A 2DTHA 4OB0B 3N5BB 3QUIA 3HY0A 3RMSA 3GNGA 1KHIA 1BI1A 2CJBA 5LJ3h 4CH3A 1EQRA 3KXTA 3SB2A 5FROA 2MMPA 1G51A 11ASA 1VQKA 1G5VA 3CCUT 2QTXA 5KCOA 2LTOA 1Y96A 1VQ4A 4KT0E 4H2UA 1ZBXA 3LH0A 3QO5A 3JCMh 5I2SA 2ZINA 3VU3C 1X54A 1PYSB 5GANe 1EFWA 2JUFA 2P0LA 3VUBA 4M78A 1Y96B 3CXCS 5ELNA 3OYNA 2HAXA 3M4PA 4XTXA 2HQXA 4P73C 3CMAA 3JB9G 4YRPA 3OSVA 1M90U 4YROA 5LJ5g 3M54A 2Y4XA 3JB9D 3PMTA 3PZCA 1YITT 1VQLA 3CC2A 1YHQA 1G5HA 4CS4A 1S72A 4LNSA 3FEOA 4HCBA 1WJSA 2KAFA 3QZ9B 3P8VA 4YDQA 4B9XA 4E7KA 1YJWT 1X2HA 3KBGA 1HTTA 4M77C 5LJ3g 3UGTA 1D3BB 1EIYB 5GMKm 4GLKA 4RMFA 4P5NA 5GMKl 1G3YA 1WNLA 1BBUA 3CCVT 3OW2A 1J5WA 5LJ3f 4N0AA 3DLMA 2XDDA 2CJAA 2ZR3A 4BE0A 3JCMg 1U1TA 4HT4A 4BY6B 1KOGA 3R6OA 4OMFB 4PLIA 4RG8A 1K8AC 1BIBA 4OLFA 4MMKA 1Q86C 5LJ5j 4G84A 5GMKh 4M75C 4BWAA 4YTLA 3OYJA 2XTIA 1VQ5A 1K8AU 3JCMV 2IVWA 4TQDA 2RA2A 1RL2A 1Q86U 2XICA 4TVRA 3RESA 4H2WA 3JCMX 1BI2A 4BI4A 2AKWA 3A7RA 2DTIA 1UEBA 2GFUA 4FL6A 4BE2A 1YBYA 3HY1A 2DO3A 3INZA 4P75C 1ASYA 4KBMB 5CR2A 1NJ1A 5HK3A 3OS5A 1KD1C 3HFVA 4HWTA 4M7AE 4C92F 4Q6GA 2FYKA 2AKWB 1ASZA 4X34A 5IAYA 4P3NA 3HL8A 1VQPA 3CCQA 1KD1U 3MP8A 2XI9A 3DB3A 1LJOA 3MF2A 4OB2B 1U8RA 1BIAA 2VGMA 4KR3A 3A8OB 2C8MA 4EPCA 2C7IA 4PNOA 1VQ6T 2J3MA 3TUPA 2JTFA 3MEUA 4C5GA 3X20B 4JS5A 2LCCA 3NTKA 3OYHA 3TU4K 3H8ZA 4C5HA 1ATIA 4M78F 4RMOA 3QPHA 2OAUA 3JAME 2ZNJA 1Q81C 1H4SA 4M77G 4HWPA 1NJ2A 3A8LB 2LQ8A 1N9WA 2BIVA 2VUBA 2CYZB 1W66A 1EOVA 2QQSA 3A7AA 3CCEA 1Q81U 2DD4A 4M77A 3HXXA 2BKDN 1SRYA 1ZHIA 5FU7C 2E6ZA 2NLUA 3CCRA 1QVFS 2ZT7A 1N6AA 4M77B 4M75G 2IY5A 2K5IA 2P4TA 4H2XA 2KDSA 2HBPA 4M75D 3P8TA 2NS6A 3GPLA 4A54A 1NPRA 4MZTA 2A3LA 4M75A 3PIOA 2LT4A 1KQSA 5GMKj 5I2MA 2E5QA 3OB9A 4A53A 1UGSB 3UPUA 2IG0A 4XTZA 4J83A 2DZCA 2LRQA 2ZZDA 3BJUA 3PIPA 2EAYA 3HXWA 1M4ZA 4M75B 2E12A 1W2BS 4H2YA 3G71T 2CZ1B 4JRKA 3LSQA 1ADJA 2K5FA 4J7FA 3DB4A 3LGFA 3G4ST 3BW1A 1QF6A 3TCJA 4F7UF 1WYDA 3HXZA 4UC4A 3A74A 4P3PA 5EG2A 4YPFA 4KR2A 2JZ2A 3L2QA 2L5QA 4M7DF 5GAOr 2QXFA 3HHTB 3VJPA 2AMCA 2DPPB 5IN1A 1UGPB 2O4XA 1SSFA 3CC7T 3JCMW 4IKFA 5DLOA 4YRGA 2D0QB 1NJ6A 4C0DC 5CO7A 3C94A 2RHXA 4A4GA 4C92C 3M58A 2E70A 2EQKA 4ZGDB 2AMCB 3S3NA 5GAN6 2M9UA 2O4XB 5M9OA 2G4CA 3DLLA 3FC3A 4YCWA 2HD0A 3GOXA 3PFSA 3QHSA 3I56T 1Q7YU 1I5LA 4C8QF 2QQBA 3OSSC 1YIJA 2DIQA 2VYTA 1B8AA 3L42A 2ZXFA 2OTLA 5GMKi 4CH4A 2A7YA 2M1HA 3GLXA 4FSXA 4YRCA 1VQKT 1VQZA 3OBWA 1LYLA 4LDWA 3OYCA 4ZTFA 3VQXA 2EL9A 3V7CA 3VUZA 2VXFA 2EQJA 3HSBA 4XEMA 2CZ7B 5GAMe 2Q5HA 4TQFA 1VQMA 5FU7B 2RHIA 2DZ9A 4YRJA 3P8YA 3OS0A 4EX5A 1H3ZA 5CVIA 4JRPA 1USYC 5GAN3 1U1SA 3EAEA 3X26B 2VC8A 2ZTGA 2XD0A 1VQNA 2ZT5A 4KUDK 4Y28E 5GAN8 2P5IA 4IUTA 2J3LA 4ELZC 3UH0A 4XTYA 1JJ2A 1KG1A 3JB9I 1B70A 4TVAA 1EVKA 4ZIBA 1NZ9A 3I55T 4DOWA 5KCHA 2E64A 4RCBA 3OA6A 1PSEA 5GAMd 1M1KC 4ZN3A 2DQ3A 4BDYA 3HRIA 3SWNB 4TVAB 3MP1A 1KMNA 2Q7GA 2EQUA 2DD5A 3NFCA 4M7AC 4QQGA 5HK0A 1SERA 1M1KU 2HQEA 3CCLA 4C92G 3QYGB 1HC7A 3HPWA 4A4EA 1M8VA 3JCMc 4V2SA 4C92D 3OYLA 4E51A 1PYSA 1RIQA 3LWHA 1HXDA 3OYFA 3VYGA 2PVGB 4J15A 2L8DA 2K57A 4JLIA 1VQ8T 5GAOp 5GAMh 3PCOA 3CC4A 3MQZA 2ZPBB 5D6YA 5CKFA 4ELYC 4FT4A 2QA4A 4IUVA 1QE0A 2LQKA 1VQ7T 3M57A 2A8EA 4C0DB 3RMQA 2ZZEA 2KK4A 5GAOl 2E5AA 3JCMP 3BDUA 4FM4B 3A8MB 4C92B 2D9TA 3CCMA 4D6WA 1OZ2A 4IUPA 1M90C 3PCOB 1O75A 1E1OA 3E9IA 3MP6A 3JSCA 1G3WA 3SDZA 3V8JA 3MO8A 2E6NA 4C92E 4Y91A 2EJ9A 3CD6A 4KULA 3TEHB 3TREA 4OGCA 3HKSA 5GAN4 3ME9A 2PUKB 1X01A 3RKWA 4X9CA 4K88A 3MEAA 5J3BA 2DXUA 3M59A 4EMGA 3LX7A 2R5AA 4VUBA 2X4YA 1D3BA 4BI8B 1EIYA 4EMHA 5GANd 4MZPA 3CCQT 3M53A 3CCST 4IUUA 1USYA 5CKDA 2DQ0A 3M5AA 2ZPHB 2E65A 4P3OA 5I21A 4WF2A 1M5Q1 2FB7A 2VGNA 4L6V5 1YJ9A 3A5YA 3CCJT 1NJIC 4O6JA 2ALYB 4YYEA 1Y7XA 3QJYA 3C12A 4H2VA 4NL2A 4YCUA 2PUOB 5GAMg 1VQOT 2DK3A 5D6XA 4C0ZA 2DKGA 4XTVA 4NCXA 1NJIU 4M7AG 4NOYA 4EMKC 1ADYA 4XEOA 2FHDA 5DLQE 5CQYA 5GAMf 2RJEA 5GANh 1KQ2A 4M7AD 2RI2A 3UT1A 3LLRA 4A4KA 3OMGA 4PJOF 3MEWA 3REUA 4M7AA 4H2SA 4XU3A 3HRTA 4BI3A 1FXXA 4JRQA 2RI5A 4TTVA 2LX9A 3W3SA 4JLGA 1BI3A 2JVVA 4QQ6A 1B76A 3CCUA 5C6SA 2MWOA 3ZEHA 2MF2A 3E9HA 5HKCA 4M7AB 3RKYA 2ARSA 2RH2A 4DOVA 5LJ3j 3S6WA 1JBMA 4LDVA 4M7DG 1X56A 2RHYA 2PVDB 4J8OA 4M7DD 3M4YA 5IT9E 1MGQA 5GAMj 1QVPA 1H4QA 2KVQG 4YP0A 3OMCA 1W2BA 3VV0A 1Y71A 1YJNT 2ZZFA 3QNEA 3QSUA 4KUIA 1BI0A 4ZN1A 3V8LA 4YREA 2QHVA 2XU8A 2PU9B 2XDPA 3ER0A 2QHTA 1QVGS 4P73A 4M7DB 4F7UE 4E47A 4CI0C 5GAN5 3J7AF 5GANg 4UP9A 4YRLA 5AYFA 4M7DE 1G3TA 5DY9A 2PMEA 1UB4A 3M9QA 3A8HB 2P0PA 3UFGA 3CPWA 2QEXA 3PTAA 1YGBA 3OYEA 1JJCB 5GANf 4P71C 2M16A 3CCVA 2XGTA 3GIBA 3G1ZA 3LWIA 1NYQA 1OYXA 4YRNA 2E41A 3JB9F 2RJFA 1I81A 2B8AA 1EVLA 1I8FA 2LT1A 4NS5A 2LDMA 2XDBA 1WJRA 2CIMA 3C4SA 4C8QE 1AHJB 4R55A 4DQ2A 4EMKA 3OYDA 3E9FA 2XIDA 3G6EA 1G3SA 3LSSA 4LDYA 2ZPIB 4EDUA 1YI2T 3CPFA 2RK1A 5GANj 2ARTA 1WPYA 2Q7EA 1NYRA 3OYIA 2H3JA 2I4OA 4EMKB 3M4GA 5K1PA 4J5YA 4L5GA 2KMTA 5E3IA 3SWNC 3KUFA 4CH5A 1EIFA 2CS7A 4LVMA 2XK0A 1E22A 1VIEA 4XQ3A 4P75A 3IG2A 2E10A 4OB1B 1X75C 2OTJA 1VQMT 3X24B 5KE2A 3X25B 5J39A 1GXIE 4LVJA 1M9SA 1HK9A 5HY6A 3HXUA 3M4QA 2K2VA 1VQ6A 4LVKA 3L4GB 3CMEA 2RJDA 1FWZA 3I7FA 5KH6A 3Q1JA 1H641 4RKUE 2EYQA 3OS2A 4XAXB 4HWRA 1FX7A 4ZTJA 3JB9J 3VKIA 4TVYA 2K5LA 3IALA 3QXEB 4HA8A 1WQ7A 2DXCA 2K4YA 1Q7YC 2EFIA 2ZR2A 4XK8E 3E1SA 1BBWA 1UGRB 2JTMA 1KHCA 4LD9K 4O5VA 3H6ZA 5C51B 4E7LA 4P71A 4YRMA 4E7JA 1N9SA 4A4HA 3CBMA 4KQEA 3FJPA 3RIRA 3UDCA 3MCAB 3L1AA 1WGSA 2X35A 1ZQ1A 3OYMA 3DSQA 4BB7A 5LJ5e 4BDZA 3META 1H4VB 2XKOC 3L2RA 4ZGEB 3RUXA 1VQ4T 1KC8C 4M78C 5CK9A 3RGLA 5CAIA 1N27A 3AHUA 4WJ3M 3LC0A 2LVMA 5FRMA 2RB6A 2Q5IA 3VQYA 3VBBA 3CXCA 2DJZA 3HXVA 1FYFA 4M77F 2ODRD 1WJQA 4AH6A 4XU2A 4P74C 1KC8U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWT A;  4M7A E;  2RHQ B;  2IY5 B;  4C92 F;  3L4G A;  1Z7N A;  2EJ9 A;  2DXT A;  5GAN 7;  4M7A F;  4Q6G A;  3TEH B;  2I4L A;  3FB9 A;  2FYK A;  5GAN 4;  4H2X B;  2AKW B;  3IKL A;  1ASZ A;  4P72 C;  1X01 A;  4PHC A;  4PJO C;  4ZTU B;  3RKW A;  4H2T A;  4X9C A;  4K88 A;  4P3N A;  2DXU A;  3VQW A;  4G85 A;  4EMG A;  4X9D A;  1LJO A;  1D3B A;  2ZGW A;  3MF2 A;  1EIY A;  4YRI A;  1NNH A;  4EMH A;  4YRF A;  4PJO G;  5GAN d;  1BIA A;  4KR3 A;  2C8M A;  3SWN A;  3JCM e;  4CH6 A;  4TWA A;  4CS3 A;  4K87 A;  4M75 E;  2C7I A;  1YFS A;  4PJO D;  1USY A;  4PNO A;  4WI1 A;  4M75 F;  1NJ8 A;  2J3M A;  3TUP A;  2DQ0 A;  4J6W A;  3EFR A;  2ZIO A;  2E65 A;  4P3O A;  5I21 A;  4WF2 A;  4QVD A;  1M5Q 1;  2FB7 A;  1YB3 A;  3JCM b;  4RCC A;  5GAO q;  3HFZ A;  3A5Y A;  4YRQ A;  1WU7 A;  1ATI A;  2ALY B;  4M78 F;  4YYE A;  2ZNJ A;  4N0A C;  2ZT6 A;  1H4S A;  4M77 G;  4HWP A;  4H2V A;  4NL2 A;  4YCU A;  1NJ2 A;  5GAM g;  2DKG A;  4XTV A;  1N9W A;  5LJ5 h;  4EO4 A;  4NCX A;  4YRS A;  4PJO B;  1TH7 A;  4M7A G;  4NOY A;  4EMK C;  1ADY A;  1GGM A;  1W66 A;  3HFZ B;  1EOV A;  4XEO A;  3A7A A;  4YRR A;  4HT9 A;  4UP7 A;  4M77 A;  3HXX A;  5GAM f;  4QVC A;  4RQE A;  1KQ2 A;  4M7A D;  5GAN h;  4J6Y A;  2Q7H A;  4YRT A;  5C52 B;  4PJO E;  1SRY A;  3NEM A;  2EWN A;  4PJO F;  4XU1 A;  1E1T A;  4C92 A;  3REU A;  4JUV A;  4YCV A;  4M7A A;  2CGH A;  4H2S A;  4XU3 A;  4CS2 A;  3NEN A;  4TTV A;  3QTC A;  3W3S A;  3FIF A;  2DEQ A;  1X55 A;  2YHT A;  1B76 A;  3JB9 H;  2ZT7 A;  5GAO m;  4M77 B;  3L2Z A;  4M75 G;  4XTW A;  2RHQ A;  2IY5 A;  4Q15 A;  12AS A;  1YFR A;  3TEH A;  4O2D A;  2JN0 A;  4M7D C;  3HFO A;  1B34 B;  4H2X A;  4M75 D;  3E9H A;  4K86 A;  3P8T A;  4M7A B;  4TVW A;  3RKY A;  3MF1 A;  1B7Y A;  1L0W A;  2ARS A;  3HRK A;  4A54 A;  1X2G A;  4M78 G;  5LJ3 j;  4M75 A;  1IL2 A;  1JBM A;  4M7D G;  1X56 A;  4XU0 A;  3IKM B;  1YFT A;  3CMQ A;  5GMK j;  4M78 D;  3NEL A;  3QO7 A;  2HNI A;  5LJ3 e;  4M7D D;  4A53 A;  1MGQ A;  4BW9 A;  4XTZ A;  5GAM j;  3WQZ A;  2CJ9 A;  2DZC A;  5F5W A;  3BJU A;  5GMK e;  5LJ5 d;  1B7Y B;  2EAY A;  2ZNI A;  3QO3 A;  1H4Q A;  4YP0 A;  3HXW A;  4M75 B;  1LOJ A;  4ZTZ B;  2ZZF A;  2E1H A;  4WJ4 A;  3A5Z A;  1Z7M A;  1LNX A;  3RAC A;  3QNE A;  3QSU A;  4YRK A;  3TEG A;  4XTU A;  3V8L A;  4H2Y A;  4YRE A;  2ALY A;  2QHV A;  4P74 A;  4C8Q C;  3QO8 A;  4JRK A;  2QHT A;  3LSQ A;  1ADJ A;  2ZT8 A;  4P73 A;  4M78 B;  4RQF A;  4M7D B;  3BW1 A;  4F7U E;  3JCM J;  2I4N A;  4HWS A;  5C53 B;  1QF6 A;  3HTZ A;  4F7U F;  4P72 A;  2QHU A;  5GAN 5;  4PJO A;  1E24 A;  1WYD A;  3HXZ A;  3OD1 A;  5LJ3 d;  1G5I A;  2ARU A;  3JCM Q;  5GAN g;  2YLB A;  3BFM A;  3A74 A;  4P3P A;  4UP9 A;  4M78 E;  4YPF A;  4KR2 A;  4YRL A;  2RHS A;  5LJ5 f;  4M7D E;  5DY9 A;  4M7D F;  2PME A;  5GAO r;  1H4T A;  4UP8 A;  2AMC A;  1C0A A;  3UFG A;  1I4K 1;  1YGB A;  2DU5 A;  2DTO A;  4HT8 A;  1JJC B;  5K1X A;  3JCM W;  5GAN f;  4P71 C;  4YRG A;  4DPG A;  1NJ6 A;  4UPA A;  4X5O A;  2I2L A;  3JCM d;  2RD1 A;  1B70 B;  5HGQ A;  2XGT A;  3V8K A;  2ZCE A;  3GIB A;  2RHS B;  3REX A;  5KNN A;  3G1Z A;  4C92 C;  3UGQ A;  3V7S A;  1NYQ A;  3PGG A;  2ZZG A;  2AMC B;  4YRN A;  1B34 A;  2DTH A;  2E41 A;  5GAN 6;  3MEY A;  3JB9 F;  2DDZ A;  2G4C A;  3A31 A;  1I81 A;  1EVL A;  1I8F A;  3QUI A;  3HY0 A;  4YCW A;  3BY7 A;  4PG3 A;  3QHS A;  2CIM A;  2CJB A;  1I5L A;  1YCY A;  4C8Q E;  5LJ3 h;  3HXY A;  4CH3 A;  4DQ2 A;  4C8Q F;  1EQR A;  4EMK A;  3SB2 A;  1KMM A;  1SET A;  4F7U G;  1G51 A;  11AS A;  4OP0 A;  2EJF A;  3LSS A;  1B8A A;  3JCM f;  2QTX A;  2ZXF A;  1Y96 A;  5GMK i;  4CH4 A;  2Y90 A;  4H2U A;  4YRC A;  1SES A;  1VQZ A;  5GAN j;  1LYL A;  2ART A;  1WPY A;  2Q7E A;  1NYR A;  3QO5 A;  3VQX A;  3JCM h;  4F7U A;  2ZIN A;  2ZIM A;  2EL9 A;  3VU3 C;  2I4O A;  4EMK B;  1X54 A;  1PYS B;  2EJG A;  3V7C A;  2VXF A;  3M4G A;  5GAN e;  2PMF A;  3R07 A;  1EFW A;  4HVC A;  5K1P A;  4J5Y A;  2P0L A;  4M78 A;  5E3I A;  4M7D A;  1Y96 B;  3HSB A;  5ELN A;  4XEM A;  1N9R A;  5GAM e;  3SWN C;  2Q5H A;  4TQF A;  4CH5 A;  3M4P A;  2DZ9 A;  4XTX A;  4YRJ A;  3P8Y A;  1E22 A;  4F7U B;  4XQ3 A;  4P75 A;  4EX5 A;  4P73 C;  1USY C;  3JB9 G;  5GAN 3;  3IG2 A;  2E10 A;  1U1S A;  2ZTG A;  4YRP A;  2VC8 A;  3EFS A;  4YRO A;  5LJ5 g;  4H02 A;  2ZT5 A;  3JB9 D;  2RM4 A;  1HK9 A;  5GAN 8;  4HWO A;  2P5I A;  3PZC A;  1JJC A;  2J3L A;  4RDX A;  4NL3 A;  4C8Q G;  3NET A;  4J6X A;  3HXU A;  1G5H A;  4CS4 A;  3M4Q A;  3UH0 A;  4XTY A;  2YLC A;  4LNS A;  3JB9 I;  3L4G B;  3ICA A;  2DVE A;  1B70 A;  4TVA A;  1EVK A;  4C8Q D;  4ZIB A;  2E64 A;  4RCB A;  3RKX A;  3I7F A;  4C8Q A;  4L87 A;  1H64 1;  5GAM d;  3P8V A;  3A32 A;  4YDQ A;  1X2H A;  2E3C A;  4HWR A;  1HTT A;  2I4M A;  2DQ3 A;  4M77 C;  5LJ3 g;  3UGT A;  1D3B B;  2DU7 A;  5GMK m;  1EIY B;  3HRI A;  3JB9 J;  4TVY A;  4RMF A;  3SWN B;  3IAL A;  4TVA B;  5GMK l;  4HA8 A;  1WQ7 A;  1WNL A;  1BBU A;  1KMN A;  2Q7G A;  3HFN A;  3V7R A;  5GAO n;  4M7A C;  2ZR2 A;  1SER A;  1NJ5 A;  4C8Q B;  4JRI A;  1BBW A;  1J5W A;  5LJ3 f;  4N0A A;  4M77 D;  4C92 G;  5C51 B;  2CJA A;  2ZR3 A;  3JCM g;  1U1T A;  1WLE A;  1HC7 A;  1KOG A;  3A7U A;  4P71 A;  4YRM A;  4MML A;  1N9S A;  1M8V A;  3JCM c;  5GAN 2;  4V2S A;  4C92 D;  3KFU A;  4E51 A;  1BIB A;  4OLF A;  1JRI A;  4KQE A;  3FJP A;  3RER A;  1PYS A;  1RIQ A;  4MMK A;  3RIR A;  5LJ5 j;  4G84 A;  5GMK h;  1HXD A;  4M75 C;  4J15 A;  3L1A A;  2K57 A;  3ERR A;  4JLI A;  4BWA A;  5GAO p;  5GAM h;  3DSQ A;  3PCO A;  2XTI A;  5LJ5 e;  2ODR C;  3JCM V;  1H4V B;  3RL6 A;  5ELO A;  1QE0 A;  4TQD A;  2RA2 A;  2QHS A;  3RUX A;  1WQW A;  2ZZE A;  4M78 C;  5GAO l;  2E5A A;  3JCM P;  3RGL A;  3BDU A;  3RES A;  5CAI A;  4WJ3 M;  3AHU A;  3VQV A;  3LC0 A;  4H2W A;  3JCM X;  2RB6 A;  4C92 B;  2AKW A;  2Q5I A;  3VQY A;  3A7R A;  2DTI A;  3VBB A;  2VXE A;  3RF1 A;  2DJZ A;  4M77 E;  1KQ1 A;  3HXV A;  1FYF A;  3PCO B;  3HY1 A;  4M77 F;  2ODR D;  3INZ A;  4AH6 A;  4P75 C;  1ASY A;  1E1O A;  3E9I A;  4XU2 A;  1NJ1 A;  4P74 C;  3V8J A;  3HFV A;  4Y91 A;  4C92 E; 
#chains in the Genus database with same CATH topology
 1UEC A;  1KQS S;  2RHQ B;  2ZPE B;  3FLG A;  1Z7N A;  2DXT A;  2CP2 A;  5GAN 7;  3L2U A;  1K9M C;  3GF5 A;  2I4L A;  1FMK A;  3IKL A;  4P72 C;  1WA7 A;  5A0D A;  2O2O A;  4H2T A;  2E4H A;  1B07 A;  3CMA T;  1X43 A;  1PHT A;  1QP3 A;  4BD3 A;  3G71 A;  1E6H A;  2GCX A;  4C0G A;  2ZGW A;  3O8V A;  5CCA A;  1X2K A;  1K9M U;  1NNH A;  1YCS B;  4PJO G;  1QP2 A;  4HCC A;  1VUB A;  3SWN A;  2GBQ A;  3JCM e;  2L3Q A;  1Q7Y R;  1QCO A;  4LD6 A;  1VQL T;  3CC2 T;  4CH6 A;  3GP8 A;  1YHQ T;  4K87 A;  4OMN A;  3EG9 A;  2R57 A;  1S72 T;  4PJO D;  1YFS A;  4M75 F;  1NJ8 A;  1WI7 A;  2HBW A;  3OYY A;  3EFR A;  4JZ4 A;  4BUG A;  3LGL A;  4KH0 B;  1OZ3 A;  1UGQ B;  1GCQ C;  5A0L A;  2KXD A;  4QVD A;  3SHW A;  3LW5 E;  3I35 A;  2WSE E;  3JCM b;  2EGC A;  4RCC A;  5GAO q;  4B9W A;  2K9G A;  2VV5 A;  4KGV B;  4YRQ A;  2R5M A;  4BAC A;  3S3M A;  4PL6 A;  3CCQ Q;  2ABL A;  2ZAE A;  1NG2 A;  1UHF A;  3CC7 A;  4N0A C;  3CCS Q;  3MHX A;  4J9D A;  2PQW A;  3WVD B;  3VS4 A;  4EO4 A;  5LJ5 h;  2V8I A;  3QKJ A;  4KGZ B;  4PJO B;  1TH7 A;  2R58 A;  3FRN A;  3HRS A;  2L3R A;  1MNE A;  1GGM A;  3CCJ Q;  4YRR A;  4HT9 A;  3H0I A;  4UP7 A;  2ZPG B;  1IGQ A;  1KC8 R;  4QVC A;  5J26 A;  2AT1 B;  2Q7H A;  4N4G A;  4YRT A;  5C52 B;  2K3X A;  4PJO E;  2X4J A;  3M0Q A;  4JJN K;  3JRZ A;  3NEM A;  2COW A;  2EWN A;  4XU1 A;  1E1T A;  2HSE B;  4C92 A;  3I56 A;  1VQO Q;  1VIF A;  4FU6 A;  4Z89 A;  2CGH A;  1BCM A;  5DM7 R;  5CIU A;  4LE9 A;  1KQS P;  2YRV A;  3LYI A;  3NEN A;  1UE9 A;  2E3I A;  1ZSZ C;  2G3R A;  2YHT A;  1ARK A;  5GAO m;  2PVO B;  2NUP B;  2QI2 A;  2KRN A;  1W4S A;  1K1Z A;  1ZUY A;  2JM8 A;  1K9M R;  4Q15 A;  1YFR A;  3TEH A;  4O2D A;  1VQ5 T;  4M7D C;  3HFO A;  1B34 B;  4PKC C;  2KRS A;  4TVW A;  1L0W A;  1B7Y A;  2LZ6 B;  3HRK A;  2V8J A;  3RR6 A;  2MK5 A;  1X2G A;  4M78 G;  4F16 A;  2O88 A;  1IL2 A;  5L8R E;  2BUD A;  3MEV A;  2RN8 A;  3VS3 A;  1YFT A;  4CC4 B;  4PFO A;  1PRM C;  3CMQ A;  2GGR A;  4LN2 A;  4M78 D;  2HNI A;  2CKK A;  2LJ0 A;  3J80 E;  4LVL A;  3WQZ A;  2C06 A;  5KYX A;  5GMK e;  1ABO A;  1B7Y B;  1O9S A;  2ZNI A;  4MDX A;  2G6F X;  2WSC E;  1YP5 A;  2E1H A;  3A5Z A;  1Z7M A;  1LNX A;  3MKD A;  3EHQ A;  1B7T A;  1NLP C;  4YRK A;  1VQP T;  3EGX A;  3TEG A;  3EG0 A;  4XTU A;  1Y07 A;  3TEE A;  1VQ9 A;  2ALY A;  4P74 A;  4C8Q C;  4Z88 A;  1QVG A;  2HL5 C;  3EG2 A;  2QQR A;  3H0F A;  2Y4Y A;  4M78 B;  5KYX B;  4RQF A;  1PSF A;  3JCM J;  1GBR A;  5C53 B;  1M3C A;  2MCN A;  4ATO A;  2WAC A;  4F04 B;  4P72 A;  2AK5 A;  2QHU A;  1YJN Q;  1E24 A;  3I55 A;  1K4U S;  3A5Z B;  3OD1 A;  1C6V X;  1G5I A;  2ARU A;  3JCM Q;  1JJ2 S;  1KJW A;  2D8H A;  1XNI A;  4M78 E;  1N8R C;  2RHS A;  1TSF A;  5LJ5 f;  2J6O A;  2K3B A;  2V8K A;  5C0M A;  4OB3 B;  1M2V B;  1RAH B;  4JPB W;  4QVZ A;  1C0A A;  1I4K 1;  2DVJ A;  2RF0 A;  5K1X A;  3RNJ A;  2RQT A;  4DPG A;  1N5Z A;  4UPA A;  1QW1 A;  3PMI A;  1N8R U;  2I2L A;  2QEX T;  2GTO A;  1GCQ A;  3CBO A;  1LPL A;  4BE1 A;  1QLY A;  2GTJ A;  2RHS B;  3UGQ A;  3V7S A;  3PGG A;  5IHK A;  2ZZG A;  3EG1 A;  2F69 A;  3CCE T;  3MEY A;  2RO0 A;  2DDZ A;  3A31 A;  1B3Q A;  1QVF A;  1C0M A;  1PC0 A;  3BY7 A;  3S3O A;  3E9G A;  3VS6 A;  1CKA A;  2MOX A;  4PG3 A;  1G83 A;  1QCF A;  1YCY A;  3D7S B;  3HXY A;  3GNF B;  1PNJ A;  1VQ8 A;  4R56 A;  3CCR T;  3CXC P;  1KMM A;  1ZBJ A;  2MPX C;  3P8H A;  1SET A;  4F7U G;  1PD1 A;  4OP0 A;  2EJF A;  1UFF A;  3OQ5 A;  3JCM f;  1VQ7 A;  2PZ1 A;  3OYK A;  2Y90 A;  3G6E T;  4J7I A;  2EYY A;  1SES A;  1IHV A;  1TU0 B;  1M1G A;  2E5K A;  1WHH A;  2O01 E;  4F7U A;  2ZIM A;  5FRN A;  3E2U A;  1IZ6 A;  2EJG A;  2XHC A;  3SFM A;  1Q82 C;  2MYS A;  2PMF A;  3TQ7 P;  2KY9 A;  4HVC A;  2QQ9 A;  1D0Y A;  4ZGJ B;  4OGE A;  2JOY A;  1YI2 Q;  1DJ7 B;  5CKB A;  4M7D A;  3OYB A;  2P0Q A;  4JS4 A;  2CT3 A;  2RK2 A;  1N9R A;  3OYG A;  2GF7 A;  2M0Y A;  4IUR A;  4F7U B;  1NBE B;  3M0U A;  1Q82 U;  1N8R R;  1SHG A;  1ZSZ B;  2XG8 D;  4QQD A;  5FU6 C;  1YIT A;  1I0C A;  1AZE A;  2LCS A;  3EFS A;  1FMW A;  4H02 A;  4E7Z A;  2RM4 A;  3HRU A;  2MI6 A;  4HWO A;  2OTJ T;  3OBY A;  1JJC A;  4RDX A;  4NL3 A;  4C8Q G;  3NET A;  3CCS A;  1BYM A;  1PKS A;  4J6X A;  4RTU A;  2Z0W A;  4LUE A;  2YLC A;  4DA4 A;  2MWP A;  3BDL A;  3ICA A;  2DVE A;  2CZ0 B;  5LL6 S;  5KYU B;  1AEY A;  4C8Q D;  1F1B B;  3EFO A;  1YJW A;  3OS1 A;  2CDT A;  4QKU A;  3L2W A;  3RKX A;  1IRE B;  1PRL C;  2SEM A;  3QYH B;  4C8Q A;  3CME T;  3CCJ A;  4L87 A;  4II1 A;  3A32 A;  1NPP A;  3A98 A;  2E3C A;  4E7H A;  2I4M A;  2GQI A;  1M8M A;  2DU7 A;  1WLP B;  1VQO A;  5CKH A;  2AHJ B;  2RHU A;  2E3H A;  1KFZ A;  1CKB A;  3EFO B;  5A0G A;  1UDL A;  3HFN A;  3V7R A;  5GAO n;  3NTH A;  1Q95 G;  2X4W A;  4Z02 A;  1NJ5 A;  4C8Q B;  1SG5 A;  4JRI A;  3OW2 S;  1K76 A;  3QJ6 A;  2YSQ A;  3ZBD A;  4M77 D;  4L59 A;  3WXM B;  3OY9 A;  5FLX E;  2EYZ A;  4QW2 A;  2DAQ A;  1K73 C;  1WLE A;  3A7U A;  4MML A;  5GAN 2;  1JB0 E;  3KFU A;  1RAC B;  1M1F A;  1X6G A;  1JRI A;  1WXU A;  3RER A;  4E2F B;  1QWE A;  2P0K A;  3E19 A;  3X28 B;  2JNG A;  2ED1 A;  4HVW A;  3PNW C;  1K73 U;  3ERR A;  1YIJ T;  4E7I A;  4PJJ A;  2ODR C;  2EW3 A;  1AD5 A;  2GQV A;  3M56 A;  3RL6 A;  5ELO A;  4K11 A;  2F5T X;  1RI0 A;  2LC4 A;  3HP9 A;  2QHS A;  1WQW A;  2OTL T;  2DRM A;  3SD4 A;  5D6W A;  2A36 A;  3ASK A;  3VQV A;  2ZCF B;  4LVI A;  1U5S A;  3THK A;  4CC2 A;  2VXE A;  4IUQ A;  3RF1 A;  4M77 E;  1KQ1 A;  4MZM A;  4FYV B;  1AZG B;  2O9V A;  3I5R A;  4C5I A;  3NGP A;  4ZNX A;  4OMO A;  3R07 A;  3G7Z A;  4FT2 A;  1BU1 A;  2IY5 B;  3L4G A;  1VQ4 Q;  4M7A F;  2V1Q A;  3FB9 A;  5A2Q E;  1E6G A;  1YJN A;  2D6F A;  4MDW A;  4H2X B;  2ROL A;  2M0O A;  1UUE A;  2K79 A;  2V26 A;  2BZ8 A;  4PHC A;  4PJO C;  4OF1 A;  3M0R A;  4KGX B;  3VYH B;  4ZTU B;  3VQW A;  1X2Q A;  1MHN A;  1R0B G;  3WVE B;  4C5E A;  4G85 A;  4X9D A;  1VQN T;  3T9N A;  2KSS A;  4PLL A;  3HTR A;  4YRI A;  3P8D A;  4YRF A;  3REA B;  2EQM A;  2QQA A;  2L89 A;  3CBP A;  1WXT A;  2DXB A;  4TWA A;  4HKE A;  4CS3 A;  2X3W D;  4M75 E;  2AIR B;  1WHK A;  3P8B B;  4WI1 A;  1RLQ C;  4J6W A;  1OU8 A;  3CMA Q;  1RUW A;  3O5Z A;  3PVL A;  2A0F B;  2DMO A;  3M55 A;  2ZIO A;  4ESR A;  1D1C A;  2RQU A;  1K73 R;  1YB3 A;  3HFZ A;  1WU7 A;  2H3E B;  2EKO A;  1M30 A;  1VQL Q;  3CC2 Q;  4J9B A;  2ZT6 A;  3BE3 A;  1YHQ Q;  4Q5W A;  1S72 Q;  2EGE A;  2QDY B;  5FU6 B;  1XQH A;  3URG A;  3CPW S;  1V29 B;  2O9S A;  2F1L A;  2FVU A;  4YRS A;  3NTI A;  1RAE B;  3HFZ B;  1MV0 B;  3L2V A;  2H8H A;  4HCZ A;  1BB9 A;  4JDS A;  3CCL T;  2LNV A;  1TG0 A;  4CC7 A;  4RQE A;  4J6Y A;  3TSW A;  4RTX A;  3ZFJ A;  1U3O A;  5KYY A;  3CEY A;  2MAM A;  4JUV A;  4YCV A;  7AT1 B;  2RJC A;  8AT1 B;  4CS2 A;  4A4F A;  4E6R A;  2K3Y A;  2NYS A;  1TUG B;  3QTC A;  1OPK A;  3FIF A;  1R8O B;  2DEQ A;  1X55 A;  3JB9 H;  3L2Z A;  4XTW A;  1YI2 A;  2RHZ A;  2RHQ A;  3CC4 T;  4FIB A;  4LDU A;  12AS A;  3MJX A;  3NHN A;  1K0X A;  2JN0 A;  2QA4 T;  5KYY B;  1W2B P;  4K86 A;  3MF1 A;  2HMA A;  2FL7 A;  1XTD A;  1KSW A;  1NE8 A;  4XU0 A;  2EIF A;  2KQW A;  3IKM B;  3QII A;  1AWO A;  3CCM T;  4FYX B;  1UG1 A;  3AT1 B;  4C0F A;  3OYA A;  2ZPF B;  3NEL A;  5FW9 A;  3QO7 A;  5LJ3 e;  3QZ5 B;  3M0S A;  4RG2 A;  3PT9 A;  2F5K A;  4BW9 A;  2X4X A;  1VQ5 Q;  2COY A;  2CJ9 A;  5F5W A;  3A8G B;  3EH1 A;  3QG1 A;  2X9H A;  5LJ5 d;  3QO3 A;  3CD6 T;  2NUT B;  1LOJ A;  3F70 A;  4ZTZ B;  4WJ4 A;  1XOV A;  3RAC A;  1G2B A;  2DNU A;  1OI1 A;  3QBY A;  3G4S A;  5CQX A;  1X6O A;  3CPW P;  3QO8 A;  2CZ6 B;  4OVA A;  2ZT8 A;  4DBF A;  1BKB A;  5CKE A;  3C95 A;  1VQ9 T;  2I4N A;  4HWS A;  4BY6 C;  3HTZ A;  1IB8 A;  4PJO A;  2DIG A;  4OMM A;  4D8K A;  5LJ3 d;  4RTT A;  5KE3 A;  2K6D A;  2YLB A;  3BFM A;  1P92 A;  3FDR A;  1W1F A;  4RTV A;  1VQP Q;  4N4H A;  4KH1 B;  4JJC A;  1NYF A;  2FZK B;  1H4T A;  1YJ9 T;  4UP8 A;  2VB6 A;  2DL4 A;  4GY5 A;  3VS5 A;  4LDX A;  2OX7 A;  4R0K A;  2DU5 A;  2DTO A;  2CH4 A;  4HT8 A;  2WSF E;  3QDR B;  5HCK A;  3UWN A;  3DKM A;  4X5O A;  4N4I A;  3JCM d;  4DBH A;  3J81 E;  2RD1 A;  1B70 B;  5HGQ A;  1NM7 A;  5AT1 B;  4RTZ A;  2RI3 A;  3V8K A;  4CRI A;  2ZCE A;  3REX A;  5KNN A;  4ME7 A;  2GFA A;  1YFN A;  2NUP A;  1IGU A;  2JS0 A;  4HVU A;  2LCL A;  1B34 A;  2DTH A;  4OB0 B;  3VS2 A;  2CSQ A;  3N5B B;  3QUI A;  1YNZ A;  3HY0 A;  2FO0 A;  3RMS A;  3GNG A;  2M51 A;  2QEX Q;  1TWB A;  3RBB B;  1KHI A;  1BI1 A;  2CJB A;  1MMN A;  5LJ3 h;  4CH3 A;  1EQR A;  1ZA1 B;  3KXT A;  3UF4 A;  2ECZ A;  3SB2 A;  2IIM A;  3I9Q A;  5FRO A;  2MMP A;  2KEA A;  1G51 A;  4CC3 A;  11AS A;  2A37 A;  1VQK A;  2EYW A;  1AWX A;  1G5V A;  4FSS A;  3CCE Q;  3CCU T;  2QTX A;  5KCO A;  2LTO A;  3LH5 A;  1Y96 A;  1VQ4 A;  4Z8A A;  2KT8 A;  1IHW A;  4KT0 E;  2CH4 W;  3U23 A;  4H2U A;  4OMQ A;  1ZBX A;  3LH0 A;  3QO5 A;  3JCM h;  5I2S A;  2ZIN A;  3FJ5 A;  3VU3 C;  1X54 A;  1PYS B;  2LNH B;  3CCR Q;  5GAN e;  2C0O A;  1RI9 A;  1EFW A;  2DF6 A;  2JUF A;  2KNB B;  2P0L A;  2HCK A;  3VUB A;  4PK4 A;  4M78 A;  1GBQ A;  1Y96 B;  3CXC S;  1SPK A;  4AG2 C;  5ELN A;  3OYN A;  3G6E Q;  3H41 A;  2HAX A;  4J9F A;  1NLO C;  4AG1 C;  2QTV A;  1TUC A;  4J9G A;  3M4P A;  4XTX A;  2YRD A;  2HQX A;  4P73 C;  3CMA A;  4OML A;  3JB9 G;  5EC7 A;  4YRP A;  3OSV A;  3R6N A;  1HJD A;  1M2V A;  1M90 U;  4YRO A;  5LJ5 g;  3M54 A;  1VYT A;  2LJ3 A;  2Y4X A;  3JB9 D;  3PMT A;  3PZC A;  1YIT T;  2VAS A;  1VQL A;  5IXB A;  3CC2 A;  2L3P A;  1YHQ A;  1G5H A;  4CS4 A;  1S72 A;  3QWX X;  4LNS A;  2M02 A;  3GBQ A;  3FEO A;  2DLP A;  1OX8 A;  4HCB A;  1WHJ A;  4RTY A;  1WJS A;  2JMC A;  2KAF A;  1H92 A;  3QZ9 B;  3P8V A;  1MMD A;  4YDQ A;  4B9X A;  4E7K A;  3VRZ A;  1YJW T;  1X2H A;  3KBG A;  1HTT A;  2DL5 A;  4M77 C;  5LJ3 g;  3UGT A;  1D3B B;  5I22 A;  5KYW B;  1R77 A;  1EIY B;  1NEB A;  5GMK m;  4GLK A;  4PJL A;  1BCO A;  4RMF A;  2CP3 A;  4AFU C;  4P5N A;  1RLP C;  5GMK l;  1G3Y A;  1WNL A;  1BBU A;  3IQL A;  2FPE A;  1TXQ A;  2LQW A;  1T0H A;  3EG3 A;  3CCV T;  3OW2 A;  2LX7 A;  1J5W A;  3CME Q;  5LJ3 f;  4N0A A;  2HDA A;  2COZ A;  2EBP A;  1JU5 C;  3DLM A;  4PJN A;  2XDD A;  4A63 B;  2CJA A;  2ZR3 A;  4BE0 A;  3JCM g;  1U1T A;  4HT4 A;  4BY6 B;  1KOG A;  3R6O A;  2LQN A;  2KGT A;  4OMF B;  4HXJ A;  4PLI A;  4RG8 A;  1K8A C;  1BIB A;  4OLF A;  2ED0 A;  5GJV B;  4MMK A;  1Q86 C;  5LJ5 j;  4G84 A;  5GMK h;  4RUG A;  2L0A A;  4M75 C;  4BWA A;  4YTL A;  2DEU A;  3OYJ A;  2XTI A;  2BE7 D;  1VQ5 A;  1K8A U;  3JCM V;  2IVW A;  4TQD A;  2RA2 A;  1YN8 A;  3UA6 A;  1RL2 A;  1Q86 U;  3MPU B;  2XIC A;  2CP7 A;  2FZC B;  1ZSZ A;  4TVR A;  3RES A;  1HYO A;  5I11 A;  4H2W A;  3JCM X;  1BI2 A;  4BI4 A;  2AKW A;  3A7R A;  2DTI A;  2LMJ A;  1UEB A;  2GFU A;  2J7I A;  4FL6 A;  4BE2 A;  1YBY A;  1YIJ Q;  3HY1 A;  2DO3 A;  3INZ A;  4P75 C;  1ASY A;  4KBM B;  5CR2 A;  2NUZ A;  2L2P A;  1NJ1 A;  5HK3 A;  2ROT A;  3OS5 A;  1KD1 C;  3HFV A;  4HWT A;  4M7A E;  4C92 F;  2OTL Q;  3H0H A;  4Q6G A;  5KYU A;  2FYK A;  2P4R A;  2AKW B;  1ASZ A;  4X34 A;  2D1X A;  2EQI A;  5IAY A;  4P3N A;  1M27 C;  3HL8 A;  1VQP A;  2DIL A;  3CCQ A;  1KD1 U;  3MP8 A;  2XI9 A;  3DB3 A;  2QAZ A;  1LJO A;  2DFU A;  1ZX6 A;  3MF2 A;  1PG5 B;  1OPL A;  4OB2 B;  1U8R A;  1BIA A;  2VGM A;  4KR3 A;  3A8O B;  2C8M A;  4EPC A;  1QMC A;  2QAS A;  1VQM Q;  2C7I A;  2RQR A;  4PNO A;  1VQ6 T;  2J3M A;  1V1C A;  2DL3 A;  2YDL A;  3TUP A;  2JTF A;  2VWF A;  2JT4 A;  1UGV A;  3MEU A;  4C5G A;  1H3H A;  3X20 B;  4JS5 A;  2LCC A;  1WZO A;  3NTK A;  3OYH A;  1VQN Q;  3TU4 K;  3H8Z A;  2VKN A;  4C5H A;  1ATI A;  2GNC A;  3EHR A;  3EGU A;  2OJ2 A;  4M78 F;  4RMO A;  3QPH A;  2OAU A;  2HZY A;  3JAM E;  2ZNJ A;  1Q81 C;  6AT1 B;  1H4S A;  4M77 G;  4HWP A;  1OX9 A;  1NJ2 A;  3A8L B;  2LQ8 A;  1N9W A;  2CUD A;  2BIV A;  1JO8 A;  4DEX A;  2VUB A;  2CYZ B;  1VA7 A;  2KI7 A;  2JXB A;  1W66 A;  1EOV A;  2QQS A;  3A7A A;  3CCE A;  3EGD A;  1Q81 U;  2DD4 A;  4M77 A;  3HXX A;  2O31 A;  1D0X A;  2D0N A;  2BKD N;  1SRY A;  1Q82 R;  1RAF B;  3JV3 A;  4LUD A;  1ZHI A;  2ATC B;  5FU7 C;  5IH2 A;  2E6Z A;  2NLU A;  3CCR A;  2D8J A;  2OAW A;  1QVF S;  1KD1 R;  4KRT A;  3EGD B;  2ZT7 A;  1N6A A;  4M77 B;  4JJB A;  4M75 G;  3CCL Q;  2IY5 A;  2K5I A;  2P4T A;  4H2X A;  2KDS A;  2HBP A;  4M75 D;  1R0C B;  3P8T A;  2W10 A;  2NS6 A;  3GPL A;  4A54 A;  1NPR A;  4MZT A;  4DBQ A;  2A3L A;  4M75 A;  3M0P A;  2HL3 A;  3PIO A;  2LT4 A;  1QVG P;  1KQS A;  2LP5 A;  5GMK j;  5I2M A;  3CC4 Q;  2E5Q A;  3OB9 A;  2DBM A;  4A53 A;  1UGS B;  2CRE A;  3UPU A;  2IG0 A;  4XTZ A;  4J83 A;  2QA4 Q;  5FWC A;  2DZC A;  2DRK A;  1U06 A;  2LRQ A;  2ZZD A;  3BJU A;  3PIP A;  2EAY A;  1I1J A;  3VRY A;  3HXW A;  4J9C A;  1M4Z A;  4M75 B;  2E12 A;  1W2B S;  1MUZ A;  2DE0 X;  3CCM Q;  1WDX A;  3PVQ A;  4H2Y A;  3G71 T;  2CZ1 B;  3NMZ C;  1Q81 R;  4JRK A;  3LSQ A;  1ADJ A;  2K5F A;  4J7F A;  4FCY A;  3DB4 A;  3LGF A;  1K0S A;  3G4S T;  3BW1 A;  1QF6 A;  3TCJ A;  3CD6 Q;  1MV3 A;  2DX1 A;  4F7U F;  1WYD A;  1VOM A;  3HXZ A;  4UC4 A;  4AFZ C;  1SRL A;  2BE9 B;  3A74 A;  4P3P A;  5EG2 A;  4YPF A;  4KR2 A;  2JZ2 A;  1RAB B;  3L2Q A;  2L5Q A;  3RDV A;  4M7D F;  4E7S A;  5GAO r;  2IPO B;  2QXF A;  3HHT B;  3VJP A;  2AMC A;  2DPP B;  2KXC A;  5IN1 A;  1QVF P;  1UGP B;  1GRI A;  2O4X A;  5L23 A;  1VQ9 Q;  1SSF A;  3CC7 T;  3JCM W;  4IKF A;  1QKX A;  5DLO A;  4YRG A;  2D0Q B;  1NJ6 A;  4C0D C;  2VVK A;  5CO7 A;  2P84 A;  3C94 A;  2RHX A;  4A4G A;  4C92 C;  2F2X A;  3M58 A;  2E70 A;  2CT4 A;  2EQK A;  1QQJ A;  4ZGD B;  1YJ9 Q;  2AMC B;  3EH2 A;  3S3N A;  5GAN 6;  1WFW A;  2M9U A;  2O4X B;  5M9O A;  2G4C A;  3DLL A;  3FC3 A;  4YCW A;  2HD0 A;  2BZX A;  3GOX A;  2YT6 A;  3PFS A;  3QHS A;  3I56 T;  1Q7Y U;  1I5L A;  2QGG A;  3TVT A;  3VS1 A;  4WTO B;  4C8Q F;  2QQB A;  3OSS C;  1YIJ A;  2DIQ A;  3PE0 A;  1QCN A;  3C0C A;  1KK7 A;  2VYT A;  1WXB A;  4X1V A;  1B8A A;  5ECA A;  3L42 A;  2ZXF A;  1NYG A;  4HVV A;  5GMK i;  2OTL A;  5KYN A;  4CH4 A;  2A7Y A;  2M1H A;  3GLX A;  2K2M A;  4FSX A;  3ULR B;  1VQK T;  2V1R A;  2NUT A;  4YRC A;  1VQZ A;  3OBW A;  1LYL A;  2J6K A;  4LDW A;  2YUP A;  3OYC A;  4ZTF A;  3VQX A;  2EL9 A;  3V7C A;  3VUZ A;  2VXF A;  2EQJ A;  1AWJ A;  3CCU Q;  4PJM A;  3HSB A;  2C0T A;  4XEM A;  2CZ7 B;  4JJD A;  5GAM e;  2Q5H A;  4TQF A;  1H8K A;  1VQM A;  5FU7 B;  2RHI A;  2DZ9 A;  4YRJ A;  3VS7 A;  3P8Y A;  3OS0 A;  4PFP A;  2X3X D;  4EX5 A;  1H3Z A;  5CVI A;  4JRP A;  1USY C;  5GAN 3;  1U1S A;  2YUO A;  3EAE A;  2VC8 A;  3X26 B;  2ZTG A;  2XD0 A;  1VQN A;  2ZT5 A;  4M4Z A;  4KUD K;  4Y28 E;  5GAN 8;  2P5I A;  4IUT A;  2J3L A;  2KYM A;  2F2V A;  2JJ9 A;  4ELZ C;  3UH0 A;  4XTY A;  1JJ2 A;  1KG1 A;  3JB9 I;  1B70 A;  4TVA A;  1EVK A;  2MIO A;  2I0N A;  4ZIB A;  1NZ9 A;  3I55 T;  4DOW A;  5KCH A;  2E64 A;  4RCB A;  1JQQ A;  1FYN A;  3OA6 A;  1PSE A;  5GAM d;  2XMF A;  1M1K C;  1YIT Q;  4IIM A;  4Y92 A;  4ZN3 A;  2DQ3 A;  4BDY A;  1LCK A;  3I5S A;  1T3L A;  3HRI A;  2KRO A;  4ANJ A;  2EGA A;  2CSI A;  2FG0 A;  3SWN B;  4TVA B;  3MP1 A;  3ZL7 C;  1KMN A;  2Q7G A;  2EQU A;  2DD5 A;  3NFC A;  4M7A C;  4QQG A;  3EG9 B;  5HK0 A;  4D8D A;  1SER A;  1M1K U;  2LJ1 A;  4PFZ A;  2HQE A;  2DJQ A;  3CCL A;  4C92 G;  1YJW Q;  3QYG B;  1MMG A;  1TTH B;  1MND A;  2BTT A;  4J9I A;  3HPW A;  1HC7 A;  4A4E A;  1OV3 A;  2A28 A;  4AMC A;  1M8V A;  3JCM c;  4V2S A;  1ABQ A;  4C92 D;  3OYL A;  4E51 A;  2AKL A;  1PYS A;  1IRX A;  1RIQ A;  1RAD B;  2DM1 A;  1WIE A;  1UJY A;  3LWH A;  1HXD A;  1OU9 A;  3CCV Q;  3OYF A;  3VYG A;  2PVG B;  1OQK A;  4IIO A;  2L8D A;  4EIK A;  4J15 A;  2K57 A;  1QWF A;  4JLI A;  1VQ8 T;  5GAO p;  5GAM h;  3PCO A;  4ORZ A;  3CC4 A;  3MQZ A;  2ZPB B;  5D6Y A;  1OOT A;  5CKF A;  4ELY C;  1WX6 A;  4FT4 A;  2QA4 A;  3G1J A;  4IUV A;  1QE0 A;  2LQK A;  1VQ7 T;  3M57 A;  2A8E A;  4C0D B;  2RQW A;  3RMQ A;  2ZZE A;  2KK4 A;  5GAO l;  2E5A A;  3JCM P;  4FYW B;  3BDU A;  4FM4 B;  4F14 A;  1I07 A;  3A8M B;  4C92 B;  1PKT A;  2CP6 A;  2D9T A;  3CCM A;  4D6W A;  1OZ2 A;  4IUP A;  1M90 C;  3PCO B;  1O75 A;  1E1O A;  3UAT A;  3E9I A;  3MP6 A;  3JSC A;  1G3W A;  3SDZ A;  3MO8 A;  2E6N A;  4Y91 A;  3V8J A;  4C92 E;  1V76 A;  3VS0 A;  2EJ9 A;  2DA9 A;  4J9E A;  3CD6 A;  4KUL A;  3TEH B;  4FW2 A;  3TRE A;  4AFQ C;  4OGC A;  3HKS A;  5GAN 4;  3ME9 A;  1PWT A;  1RAG B;  2PUK B;  1X01 A;  2FPD A;  3RKW A;  4X9C A;  4K88 A;  3MEA A;  1M1K R;  5J3B A;  2DXU A;  1TUD A;  1VYU A;  5D7U A;  3M59 A;  1W70 A;  4EMG A;  3LX7 A;  9ATC B;  2R5A A;  4FW1 A;  4VUB A;  2J6F A;  2X4Y A;  1D3B A;  5KYW A;  4BI8 B;  1EIY A;  2QGF B;  4EMH A;  1HSQ A;  3TSZ A;  2KBT A;  5GAN d;  4MZP A;  3CCQ T;  3M53 A;  4DBR A;  1SHF A;  2DET A;  8ATC B;  1OEB A;  3CCS T;  4IUU A;  1USY A;  4FYY B;  5CKD A;  2DQ0 A;  3M5A A;  4QT7 A;  2ZPH B;  2E65 A;  4P3O A;  5I21 A;  4WF2 A;  2OTJ Q;  5IHN A;  1WHM A;  1M5Q 1;  1E7O A;  2AZV A;  2FB7 A;  2DER A;  2VGN A;  4L6V 5;  1AVZ C;  1YJ9 A;  3A5Y A;  1C1A A;  3CCJ T;  3EGX B;  1NJI C;  4O6J A;  2FPF A;  2HEQ A;  2QDL A;  2ALY B;  4YYE A;  1KIK A;  1AOJ A;  1Y7X A;  3QJY A;  1UHC A;  1SEM A;  3C12 A;  4H2V A;  4NL2 A;  4YCU A;  2PUO B;  5GAM g;  1VQ6 Q;  1VQO T;  2DK3 A;  1ZSG A;  5D6X A;  4C0Z A;  2DKG A;  4XTV A;  1TS9 A;  2PNI A;  4NCX A;  3KFV A;  3QWY A;  1CSK A;  1JXM A;  1GCP A;  1NJI U;  1EZZ B;  4M7A G;  4NOY A;  4EMK C;  1ADY A;  2AZS A;  2YRC A;  2HKN A;  4XEO A;  4AT1 B;  2YUQ A;  2FHD A;  5DLQ E;  1M2O A;  2DYB A;  5CQY A;  4HCK A;  5GAM f;  2RJE A;  5GAN h;  1KQ2 A;  4M7A D;  2RI2 A;  4J9H A;  3UT1 A;  1D1B A;  3LLR A;  4A4K A;  3OMG A;  4PJO F;  3MEW A;  1J3T A;  3REU A;  4M7A A;  2EPD A;  4H2S A;  1M90 R;  1Y0M A;  4XU3 A;  3HRT A;  4BI3 A;  1FXX A;  1G8X A;  2RI5 A;  4B6M A;  4JRQ A;  4TTV A;  2LX9 A;  3W3S A;  4JLG A;  1BI3 A;  2JVV A;  4QQ6 A;  1B76 A;  3CCU A;  2QYZ A;  5C6S A;  2CP5 A;  3QDF A;  2MWO A;  3ZEH A;  2MF2 A;  1EFN A;  1ZA2 B;  1ZUK A;  3E9H A;  1W6X A;  5HKC A;  4M7A B;  3CQT A;  3RKY A;  2YWW A;  2ARS A;  1JXO A;  2RH2 A;  1RAI B;  3NPF A;  4DOV A;  5LJ3 j;  3S6W A;  1JBM A;  1YWP A;  4LDV A;  4M7D G;  1X56 A;  2JS2 A;  1WHL A;  2RHY A;  2PVD B;  4GLM A;  4J8O A;  4M7D D;  3M4Y A;  1JEG A;  5IT9 E;  1MGQ A;  5GAM j;  2YUN A;  4AFS C;  1QVP A;  1H4Q A;  2KVQ G;  1JJ2 P;  4YP0 A;  3OMC A;  1W2B A;  3VV0 A;  1Y71 A;  1YJN T;  2ZZF A;  2YXY A;  3QNE A;  3QSU A;  2B86 A;  4KUI A;  1NJI R;  1BI0 A;  2EYX A;  2JTE A;  4ZN1 A;  1OUL A;  3V8L A;  4YRE A;  2QHV A;  1SF9 A;  1UTI A;  1WHG A;  2PU9 B;  2XU8 A;  2XDP A;  3ER0 A;  2QHT A;  1QVG S;  1GFD A;  4P73 A;  4M7D B;  4F7U E;  1PD0 A;  4RTW A;  4E47 A;  2SRC A;  1VYV A;  4CI0 C;  5GAN 5;  3J7A F;  2X51 A;  5GAN g;  1XJW B;  2RMO A;  4UP9 A;  4YRL A;  5AYF A;  4M7D E;  1G3T A;  1K8A R;  2J06 A;  3G71 Q;  5DY9 A;  2PME A;  1WYX A;  1UB4 A;  3M9Q A;  3A8H B;  2K7A A;  1D0Z A;  1Q86 R;  2P0P A;  2HSP A;  2ESW A;  3UFG A;  3CPW A;  2QEX A;  3PTA A;  1YGB A;  3G4S Q;  2NWM A;  3OYE A;  1JJC B;  2KYB A;  5GAN f;  4P71 C;  2M16 A;  2CP0 A;  2PTK A;  2AKK A;  2C0I A;  3CCV A;  2XGT A;  3GIB A;  2A08 A;  3G1Z A;  3LWI A;  1D1A A;  1NYQ A;  1OYX A;  2KR3 A;  2EKH A;  4YRN A;  2E41 A;  1X27 A;  3H9N A;  3JB9 F;  2RJF A;  1PM3 A;  1I81 A;  2B8A A;  1EVL A;  1I8F A;  2LT1 A;  3CC7 Q;  2RNA A;  1AWW A;  4NS5 A;  2LDM A;  2XDB A;  1WJR A;  2CIM A;  3C4S A;  4C8Q E;  1AHJ B;  4R55 A;  4DQ2 A;  1QKW A;  4EMK A;  3OYD A;  1A0N B;  3E9F A;  2KT1 A;  2ENM A;  2XID A;  3G6E A;  1G3S A;  3LSS A;  4LDY A;  2ZPI B;  4EDU A;  1YI2 T;  3CPF A;  2RK1 A;  1Y57 A;  1MMA A;  1HD3 A;  5GAN j;  2ART A;  1WPY A;  2Q7E A;  2DBK A;  3I56 Q;  2J05 A;  1NYR A;  3OYI A;  1T0J A;  2H3J A;  2I4O A;  4EMK B;  2RPN A;  1M3B A;  3M4G A;  4LNP A;  1X6B A;  5K1P A;  4J5Y A;  4L5G A;  2KMT A;  5E3I A;  2W0Z A;  2JW4 A;  1TOV A;  2JMA A;  2L3S A;  1VQK Q;  3SWN C;  3KUF A;  4CH5 A;  1EIF A;  2FZG B;  2CS7 A;  5GJW B;  4LVM A;  2XK0 A;  1E22 A;  1VIE A;  4XQ3 A;  4P75 A;  1PCX A;  3IG2 A;  2E10 A;  4OB1 B;  1SSH A;  1X75 C;  1VQM T;  3X24 B;  5KE2 A;  3X25 B;  2OTJ A;  2HQH A;  5J39 A;  1RAA B;  1SRM A;  1GXI E;  4LVJ A;  1K9A A;  1M9S A;  1HK9 A;  2OI3 A;  1NEG A;  1EX4 A;  1S1N A;  5HY6 A;  2RQV A;  5FWB A;  3M0T A;  3HXU A;  2DYI A;  3M4Q A;  2K2V A;  1VQ6 A;  4LVK A;  3L4G B;  1SKU B;  5IXF A;  3CME A;  2RJD A;  3OW2 P;  4LXC A;  1FWZ A;  1T3S A;  3I7F A;  1D09 B;  1ZUU A;  5KH6 A;  4JZ3 A;  3Q1J A;  1H64 1;  4RKU E;  2EYQ A;  2QG9 B;  4XAX B;  5IHI A;  1BBZ A;  3SEM A;  3OS2 A;  1IXD A;  4HWR A;  1FX7 A;  4ZTJ A;  3JB9 J;  2FRW A;  2CUB A;  3VKI A;  4TVY A;  2K5L A;  3IAL A;  3QXE B;  4HA8 A;  1WQ7 A;  2DXC A;  2K4Y A;  1GFC A;  2DL8 A;  1Q7Y C;  2EFI A;  2HKQ B;  4XK8 E;  3I55 Q;  2ZR2 A;  2FEI A;  3E1S A;  1BK2 A;  1GL5 A;  4GBQ A;  1BBW A;  1UGR B;  2JTM A;  1M3A A;  1KHC A;  4LD9 K;  4O5V A;  3H6Z A;  5C51 B;  2QK0 A;  1Z9Q A;  4E7L A;  3A1P A;  1FMV A;  4OMP A;  4P71 A;  4YRM A;  4E7J A;  1N9S A;  4A4H A;  1UJ0 A;  3CBM A;  1I5O B;  1AT1 B;  4KQE A;  3FJP A;  3RIR A;  1ZLM A;  3UDC A;  4F17 A;  1IO6 A;  3MCA B;  1YWO A;  3L1A A;  1WGS A;  2X35 A;  1ZQ1 A;  3OYM A;  3DSQ A;  2KRM A;  4DEY A;  4BB7 A;  5LJ5 e;  4BDZ A;  1X69 A;  2KE9 A;  3MET A;  1H4V B;  2XKO C;  3L2R A;  4ZGE B;  1Z9Z A;  3RUX A;  1VQ4 T;  1KC8 C;  4M78 C;  5CK9 A;  3RGL A;  5CAI A;  1N27 A;  3AHU A;  4WJ3 M;  3LC0 A;  3REB B;  2LVM A;  2JM9 A;  2RB6 A;  5FRM A;  2Q5I A;  3VQY A;  1LVK A;  3VBB A;  3CXC A;  2DJZ A;  2FRY A;  2DL7 A;  3HXV A;  1VQ8 Q;  1FYF A;  4M77 F;  2ODR D;  1WJQ A;  4AH6 A;  2BZY A;  4WCI A;  3UA7 A;  2EVR A;  4XU2 A;  1ACM B;  4P74 C;  1KC8 U;  2F2W A;  1VQ7 Q; 
#chains in the Genus database with same CATH homology
 1KQS S;  2RHQ B;  2ZPE B;  3FLG A;  1Z7N A;  2DXT A;  5GAN 7;  3L2U A;  1K9M C;  3GF5 A;  2I4L A;  3IKL A;  4P72 C;  5A0D A;  4H2T A;  3CMA T;  1QP3 A;  4BD3 A;  3G71 A;  2GCX A;  4C0G A;  2ZGW A;  3O8V A;  5CCA A;  1K9M U;  1NNH A;  4PJO G;  1QP2 A;  4HCC A;  1VUB A;  3SWN A;  3JCM e;  4LD6 A;  1VQL T;  3CC2 T;  4CH6 A;  3GP8 A;  1YHQ T;  4K87 A;  2R57 A;  1S72 T;  4PJO D;  1YFS A;  4M75 F;  1NJ8 A;  3OYY A;  3EFR A;  4BUG A;  3LGL A;  1OZ3 A;  1UGQ B;  5A0L A;  4QVD A;  3LW5 E;  2WSE E;  3JCM b;  4RCC A;  5GAO q;  4B9W A;  4YRQ A;  2VV5 A;  2R5M A;  4BAC A;  3S3M A;  4PL6 A;  3CC7 A;  4N0A C;  3MHX A;  2PQW A;  3WVD B;  4EO4 A;  5LJ5 h;  2V8I A;  3QKJ A;  4PJO B;  1TH7 A;  2R58 A;  3FRN A;  3HRS A;  2L3R A;  1GGM A;  4YRR A;  4HT9 A;  4UP7 A;  2ZPG B;  4QVC A;  5J26 A;  2Q7H A;  4YRT A;  4N4G A;  5C52 B;  2K3X A;  4PJO E;  2X4J A;  4JJN K;  3JRZ A;  3NEM A;  2EWN A;  1E1T A;  4XU1 A;  3I56 A;  4C92 A;  1VIF A;  4FU6 A;  2CGH A;  5DM7 R;  5CIU A;  2YRV A;  3LYI A;  3NEN A;  2G3R A;  2YHT A;  5GAO m;  2PVO B;  2QI2 A;  1W4S A;  4Q15 A;  1YFR A;  3TEH A;  4O2D A;  1VQ5 T;  4M7D C;  3HFO A;  1B34 B;  4PKC C;  4TVW A;  1L0W A;  1B7Y A;  3HRK A;  2V8J A;  1X2G A;  4M78 G;  1IL2 A;  5L8R E;  2BUD A;  3MEV A;  1YFT A;  3CMQ A;  4M78 D;  2HNI A;  2CKK A;  3J80 E;  4LVL A;  3WQZ A;  2C06 A;  5GMK e;  1B7Y B;  1O9S A;  2ZNI A;  4MDX A;  2WSC E;  2E1H A;  3A5Z A;  1Z7M A;  1LNX A;  4YRK A;  1VQP T;  3TEG A;  4XTU A;  1Y07 A;  3TEE A;  1VQ9 A;  2ALY A;  4P74 A;  4C8Q C;  1QVG A;  2QQR A;  2Y4Y A;  4M78 B;  4RQF A;  1PSF A;  3JCM J;  5C53 B;  4ATO A;  2WAC A;  4P72 A;  2QHU A;  1E24 A;  3I55 A;  3A5Z B;  3OD1 A;  1G5I A;  2ARU A;  3JCM Q;  1JJ2 S;  1XNI A;  4M78 E;  1N8R C;  2RHS A;  5LJ5 f;  2V8K A;  5C0M A;  4OB3 B;  4QVZ A;  1C0A A;  1I4K 1;  5K1X A;  4DPG A;  4UPA A;  1QW1 A;  3PMI A;  1N8R U;  2I2L A;  2QEX T;  3CBO A;  4BE1 A;  2RHS B;  3UGQ A;  3V7S A;  3PGG A;  2ZZG A;  2F69 A;  3CCE T;  3MEY A;  2RO0 A;  2DDZ A;  3A31 A;  1QVF A;  3BY7 A;  3S3O A;  3E9G A;  4PG3 A;  1YCY A;  3HXY A;  3GNF B;  1VQ8 A;  4R56 A;  3CCR T;  1KMM A;  3P8H A;  1SET A;  4F7U G;  4OP0 A;  2EJF A;  3OQ5 A;  3JCM f;  1VQ7 A;  3OYK A;  2Y90 A;  3G6E T;  4J7I A;  1SES A;  1M1G A;  2O01 E;  4F7U A;  2ZIM A;  5FRN A;  1IZ6 A;  2EJG A;  2XHC A;  3SFM A;  1Q82 C;  2PMF A;  2KY9 A;  4HVC A;  2QQ9 A;  4ZGJ B;  4OGE A;  2JOY A;  1DJ7 B;  5CKB A;  4M7D A;  3OYB A;  2P0Q A;  4JS4 A;  2RK2 A;  1N9R A;  3OYG A;  2GF7 A;  4IUR A;  4F7U B;  1Q82 U;  2XG8 D;  4QQD A;  5FU6 C;  1YIT A;  3EFS A;  4H02 A;  2RM4 A;  3HRU A;  2MI6 A;  4HWO A;  2OTJ T;  3OBY A;  1JJC A;  4RDX A;  4NL3 A;  4C8Q G;  3NET A;  3CCS A;  1BYM A;  4J6X A;  2YLC A;  4DA4 A;  2MWP A;  3BDL A;  3ICA A;  2DVE A;  2CZ0 B;  5LL6 S;  4C8Q D;  1YJW A;  3OS1 A;  3L2W A;  3RKX A;  1IRE B;  3QYH B;  4C8Q A;  3CME T;  3CCJ A;  4L87 A;  4II1 A;  3A32 A;  1NPP A;  2E3C A;  4E7H A;  2I4M A;  2DU7 A;  1VQO A;  5CKH A;  2AHJ B;  2RHU A;  5A0G A;  3HFN A;  3V7R A;  5GAO n;  3NTH A;  2X4W A;  4Z02 A;  1NJ5 A;  4C8Q B;  4JRI A;  3OW2 S;  3QJ6 A;  3ZBD A;  4M77 D;  4L59 A;  3WXM B;  3OY9 A;  5FLX E;  4QW2 A;  2DAQ A;  1K73 C;  1WLE A;  3A7U A;  4MML A;  5GAN 2;  1JB0 E;  3KFU A;  1M1F A;  1JRI A;  3RER A;  2P0K A;  3E19 A;  3X28 B;  2JNG A;  3PNW C;  1K73 U;  3ERR A;  1YIJ T;  4E7I A;  2ODR C;  2GQV A;  3M56 A;  3RL6 A;  5ELO A;  2F5T X;  1RI0 A;  2QHS A;  2LC4 A;  3HP9 A;  1WQW A;  2OTL T;  3SD4 A;  5D6W A;  3ASK A;  3VQV A;  2ZCF B;  4LVI A;  2VXE A;  4IUQ A;  3RF1 A;  4M77 E;  1KQ1 A;  4MZM A;  4C5I A;  3R07 A;  3G7Z A;  4FT2 A;  2IY5 B;  3L4G A;  4M7A F;  3FB9 A;  5A2Q E;  1YJN A;  2D6F A;  4H2X B;  4MDW A;  2M0O A;  4PHC A;  4PJO C;  4OF1 A;  3VYH B;  4ZTU B;  3VQW A;  1MHN A;  3WVE B;  4C5E A;  4G85 A;  4X9D A;  1VQN T;  3T9N A;  2KSS A;  4PLL A;  4YRI A;  3P8D A;  4YRF A;  2EQM A;  2QQA A;  2L89 A;  3CBP A;  2DXB A;  4TWA A;  4HKE A;  4CS3 A;  4M75 E;  3P8B B;  4WI1 A;  4J6W A;  3M55 A;  2ZIO A;  1YB3 A;  3HFZ A;  1WU7 A;  2EKO A;  2ZT6 A;  4Q5W A;  2QDY B;  5FU6 B;  1XQH A;  3URG A;  3CPW S;  1V29 B;  2FVU A;  4YRS A;  3NTI A;  3HFZ B;  3L2V A;  4HCZ A;  4JDS A;  3CCL T;  2LNV A;  4RQE A;  4J6Y A;  3ZFJ A;  3CEY A;  2MAM A;  4JUV A;  4YCV A;  2RJC A;  4CS2 A;  4A4F A;  2K3Y A;  3QTC A;  3FIF A;  1R8O B;  2DEQ A;  1X55 A;  3JB9 H;  3L2Z A;  4XTW A;  1YI2 A;  2RHZ A;  2RHQ A;  3CC4 T;  4FIB A;  4LDU A;  12AS A;  2JN0 A;  2QA4 T;  4K86 A;  3MF1 A;  2FL7 A;  1XTD A;  1NE8 A;  4XU0 A;  2EIF A;  2KQW A;  3IKM B;  3QII A;  3CCM T;  4C0F A;  3OYA A;  2ZPF B;  3NEL A;  3QO7 A;  5LJ3 e;  3QZ5 B;  4RG2 A;  3PT9 A;  2F5K A;  4BW9 A;  2X4X A;  2CJ9 A;  5F5W A;  3A8G B;  3QG1 A;  5LJ5 d;  3QO3 A;  3CD6 T;  1LOJ A;  3F70 A;  4ZTZ B;  4WJ4 A;  1XOV A;  3RAC A;  1OI1 A;  3QBY A;  3G4S A;  5CQX A;  1X6O A;  3QO8 A;  2CZ6 B;  4OVA A;  2ZT8 A;  1BKB A;  5CKE A;  3C95 A;  1VQ9 T;  2I4N A;  4HWS A;  4BY6 C;  3HTZ A;  4PJO A;  2DIG A;  5LJ3 d;  5KE3 A;  2YLB A;  3BFM A;  1P92 A;  3FDR A;  4N4H A;  1H4T A;  1YJ9 T;  4UP8 A;  4GY5 A;  4LDX A;  2DU5 A;  2DTO A;  4HT8 A;  2WSF E;  3QDR B;  3UWN A;  3DKM A;  4X5O A;  4N4I A;  3JCM d;  3J81 E;  2RD1 A;  1B70 B;  5HGQ A;  3V8K A;  2RI3 A;  4CRI A;  2ZCE A;  3REX A;  5KNN A;  4ME7 A;  2GFA A;  2LCL A;  1B34 A;  2DTH A;  4OB0 B;  3N5B B;  3QUI A;  3HY0 A;  3RMS A;  3GNG A;  1KHI A;  1BI1 A;  2CJB A;  5LJ3 h;  4CH3 A;  1EQR A;  3KXT A;  3SB2 A;  5FRO A;  2MMP A;  1G51 A;  11AS A;  1VQK A;  1G5V A;  3CCU T;  2QTX A;  5KCO A;  2LTO A;  1Y96 A;  1VQ4 A;  4KT0 E;  4H2U A;  1ZBX A;  3LH0 A;  3QO5 A;  3JCM h;  5I2S A;  2ZIN A;  3VU3 C;  1X54 A;  1PYS B;  5GAN e;  1EFW A;  2JUF A;  2P0L A;  3VUB A;  4M78 A;  1Y96 B;  3CXC S;  5ELN A;  3OYN A;  2HAX A;  3M4P A;  4XTX A;  2HQX A;  4P73 C;  3CMA A;  3JB9 G;  4YRP A;  3OSV A;  1M90 U;  4YRO A;  5LJ5 g;  3M54 A;  2Y4X A;  3JB9 D;  3PMT A;  3PZC A;  1YIT T;  1VQL A;  3CC2 A;  1YHQ A;  1G5H A;  4CS4 A;  1S72 A;  4LNS A;  3FEO A;  4HCB A;  1WJS A;  2KAF A;  3QZ9 B;  3P8V A;  4YDQ A;  4B9X A;  4E7K A;  1YJW T;  1X2H A;  3KBG A;  1HTT A;  4M77 C;  5LJ3 g;  3UGT A;  1D3B B;  1EIY B;  5GMK m;  4GLK A;  4RMF A;  4P5N A;  5GMK l;  1G3Y A;  1WNL A;  1BBU A;  3CCV T;  3OW2 A;  1J5W A;  5LJ3 f;  4N0A A;  3DLM A;  2XDD A;  2CJA A;  2ZR3 A;  4BE0 A;  3JCM g;  1U1T A;  4HT4 A;  4BY6 B;  1KOG A;  3R6O A;  4OMF B;  4PLI A;  4RG8 A;  1K8A C;  1BIB A;  4OLF A;  4MMK A;  1Q86 C;  5LJ5 j;  4G84 A;  5GMK h;  4M75 C;  4BWA A;  4YTL A;  3OYJ A;  2XTI A;  1VQ5 A;  1K8A U;  3JCM V;  2IVW A;  4TQD A;  2RA2 A;  1RL2 A;  1Q86 U;  2XIC A;  4TVR A;  3RES A;  4H2W A;  3JCM X;  1BI2 A;  4BI4 A;  2AKW A;  3A7R A;  2DTI A;  1UEB A;  2GFU A;  4FL6 A;  4BE2 A;  1YBY A;  3HY1 A;  2DO3 A;  3INZ A;  4P75 C;  1ASY A;  4KBM B;  5CR2 A;  1NJ1 A;  5HK3 A;  3OS5 A;  1KD1 C;  3HFV A;  4HWT A;  4M7A E;  4C92 F;  4Q6G A;  2FYK A;  2AKW B;  1ASZ A;  4X34 A;  5IAY A;  4P3N A;  3HL8 A;  1VQP A;  3CCQ A;  1KD1 U;  3MP8 A;  2XI9 A;  3DB3 A;  1LJO A;  3MF2 A;  4OB2 B;  1U8R A;  1BIA A;  2VGM A;  4KR3 A;  3A8O B;  2C8M A;  4EPC A;  2C7I A;  4PNO A;  1VQ6 T;  2J3M A;  3TUP A;  2JTF A;  3MEU A;  4C5G A;  3X20 B;  4JS5 A;  2LCC A;  3NTK A;  3OYH A;  3TU4 K;  3H8Z A;  4C5H A;  1ATI A;  4M78 F;  4RMO A;  3QPH A;  2OAU A;  3JAM E;  2ZNJ A;  1Q81 C;  1H4S A;  4M77 G;  4HWP A;  1NJ2 A;  3A8L B;  2LQ8 A;  1N9W A;  2BIV A;  2VUB A;  2CYZ B;  1W66 A;  1EOV A;  2QQS A;  3A7A A;  3CCE A;  1Q81 U;  2DD4 A;  4M77 A;  3HXX A;  2BKD N;  1SRY A;  1ZHI A;  5FU7 C;  2E6Z A;  2NLU A;  3CCR A;  1QVF S;  2ZT7 A;  1N6A A;  4M77 B;  4M75 G;  2IY5 A;  2K5I A;  2P4T A;  4H2X A;  2KDS A;  2HBP A;  4M75 D;  3P8T A;  2NS6 A;  3GPL A;  4A54 A;  1NPR A;  4MZT A;  2A3L A;  4M75 A;  3PIO A;  2LT4 A;  1KQS A;  5GMK j;  5I2M A;  2E5Q A;  3OB9 A;  4A53 A;  1UGS B;  3UPU A;  2IG0 A;  4XTZ A;  4J83 A;  2DZC A;  2LRQ A;  2ZZD A;  3BJU A;  3PIP A;  2EAY A;  3HXW A;  1M4Z A;  4M75 B;  2E12 A;  1W2B S;  4H2Y A;  3G71 T;  2CZ1 B;  4JRK A;  3LSQ A;  1ADJ A;  2K5F A;  4J7F A;  3DB4 A;  3LGF A;  3G4S T;  3BW1 A;  1QF6 A;  3TCJ A;  4F7U F;  1WYD A;  3HXZ A;  4UC4 A;  3A74 A;  4P3P A;  5EG2 A;  4YPF A;  4KR2 A;  2JZ2 A;  3L2Q A;  2L5Q A;  4M7D F;  5GAO r;  2QXF A;  3HHT B;  3VJP A;  2AMC A;  2DPP B;  5IN1 A;  1UGP B;  2O4X A;  1SSF A;  3CC7 T;  3JCM W;  4IKF A;  5DLO A;  4YRG A;  2D0Q B;  1NJ6 A;  4C0D C;  5CO7 A;  3C94 A;  2RHX A;  4A4G A;  4C92 C;  3M58 A;  2E70 A;  2EQK A;  4ZGD B;  2AMC B;  3S3N A;  5GAN 6;  2M9U A;  2O4X B;  5M9O A;  2G4C A;  3DLL A;  3FC3 A;  4YCW A;  2HD0 A;  3GOX A;  3PFS A;  3QHS A;  3I56 T;  1Q7Y U;  1I5L A;  4C8Q F;  2QQB A;  3OSS C;  1YIJ A;  2DIQ A;  2VYT A;  1B8A A;  3L42 A;  2ZXF A;  2OTL A;  5GMK i;  4CH4 A;  2A7Y A;  2M1H A;  3GLX A;  4FSX A;  4YRC A;  1VQK T;  1VQZ A;  3OBW A;  1LYL A;  4LDW A;  3OYC A;  4ZTF A;  3VQX A;  2EL9 A;  3V7C A;  3VUZ A;  2VXF A;  2EQJ A;  3HSB A;  4XEM A;  2CZ7 B;  5GAM e;  2Q5H A;  4TQF A;  1VQM A;  5FU7 B;  2RHI A;  2DZ9 A;  4YRJ A;  3P8Y A;  3OS0 A;  4EX5 A;  1H3Z A;  5CVI A;  4JRP A;  1USY C;  5GAN 3;  1U1S A;  3EAE A;  3X26 B;  2VC8 A;  2ZTG A;  2XD0 A;  1VQN A;  2ZT5 A;  4KUD K;  4Y28 E;  5GAN 8;  2P5I A;  4IUT A;  2J3L A;  4ELZ C;  3UH0 A;  4XTY A;  1JJ2 A;  1KG1 A;  3JB9 I;  1B70 A;  4TVA A;  1EVK A;  4ZIB A;  1NZ9 A;  3I55 T;  4DOW A;  5KCH A;  2E64 A;  4RCB A;  3OA6 A;  1PSE A;  5GAM d;  1M1K C;  4ZN3 A;  2DQ3 A;  4BDY A;  3HRI A;  3SWN B;  4TVA B;  3MP1 A;  1KMN A;  2Q7G A;  2EQU A;  2DD5 A;  3NFC A;  4M7A C;  4QQG A;  5HK0 A;  1SER A;  1M1K U;  2HQE A;  3CCL A;  4C92 G;  3QYG B;  1HC7 A;  3HPW A;  4A4E A;  1M8V A;  3JCM c;  4V2S A;  4C92 D;  3OYL A;  4E51 A;  1PYS A;  1RIQ A;  3LWH A;  1HXD A;  3OYF A;  3VYG A;  2PVG B;  4J15 A;  2L8D A;  2K57 A;  4JLI A;  1VQ8 T;  5GAO p;  5GAM h;  3PCO A;  3CC4 A;  3MQZ A;  2ZPB B;  5D6Y A;  5CKF A;  4ELY C;  4FT4 A;  2QA4 A;  4IUV A;  1QE0 A;  2LQK A;  1VQ7 T;  3M57 A;  2A8E A;  4C0D B;  3RMQ A;  2ZZE A;  2KK4 A;  5GAO l;  2E5A A;  3JCM P;  3BDU A;  4FM4 B;  3A8M B;  4C92 B;  2D9T A;  3CCM A;  4D6W A;  1OZ2 A;  4IUP A;  1M90 C;  3PCO B;  1O75 A;  1E1O A;  3E9I A;  3MP6 A;  3JSC A;  1G3W A;  3SDZ A;  3V8J A;  3MO8 A;  2E6N A;  4C92 E;  4Y91 A;  2EJ9 A;  3CD6 A;  4KUL A;  3TEH B;  3TRE A;  4OGC A;  3HKS A;  5GAN 4;  3ME9 A;  2PUK B;  1X01 A;  3RKW A;  4X9C A;  4K88 A;  3MEA A;  5J3B A;  2DXU A;  3M59 A;  4EMG A;  3LX7 A;  2R5A A;  4VUB A;  2X4Y A;  1D3B A;  4BI8 B;  1EIY A;  4EMH A;  5GAN d;  4MZP A;  3CCQ T;  3M53 A;  3CCS T;  4IUU A;  1USY A;  5CKD A;  2DQ0 A;  3M5A A;  2ZPH B;  2E65 A;  4P3O A;  5I21 A;  4WF2 A;  1M5Q 1;  2FB7 A;  2VGN A;  4L6V 5;  1YJ9 A;  3A5Y A;  3CCJ T;  1NJI C;  4O6J A;  2ALY B;  4YYE A;  1Y7X A;  3QJY A;  3C12 A;  4H2V A;  4NL2 A;  4YCU A;  2PUO B;  5GAM g;  1VQO T;  2DK3 A;  5D6X A;  4C0Z A;  2DKG A;  4XTV A;  4NCX A;  1NJI U;  4M7A G;  4NOY A;  4EMK C;  1ADY A;  4XEO A;  2FHD A;  5DLQ E;  5CQY A;  5GAM f;  2RJE A;  5GAN h;  1KQ2 A;  4M7A D;  2RI2 A;  3UT1 A;  3LLR A;  4A4K A;  3OMG A;  4PJO F;  3MEW A;  3REU A;  4M7A A;  4H2S A;  4XU3 A;  3HRT A;  4BI3 A;  1FXX A;  4JRQ A;  2RI5 A;  4TTV A;  2LX9 A;  3W3S A;  4JLG A;  1BI3 A;  2JVV A;  4QQ6 A;  1B76 A;  3CCU A;  5C6S A;  2MWO A;  3ZEH A;  2MF2 A;  3E9H A;  5HKC A;  4M7A B;  3RKY A;  2ARS A;  2RH2 A;  4DOV A;  5LJ3 j;  3S6W A;  1JBM A;  4LDV A;  4M7D G;  1X56 A;  2RHY A;  2PVD B;  4J8O A;  4M7D D;  3M4Y A;  5IT9 E;  1MGQ A;  5GAM j;  1QVP A;  1H4Q A;  2KVQ G;  4YP0 A;  3OMC A;  1W2B A;  3VV0 A;  1Y71 A;  1YJN T;  2ZZF A;  3QNE A;  3QSU A;  4KUI A;  1BI0 A;  4ZN1 A;  3V8L A;  4YRE A;  2QHV A;  2XU8 A;  2PU9 B;  2XDP A;  3ER0 A;  2QHT A;  1QVG S;  4P73 A;  4M7D B;  4F7U E;  4E47 A;  4CI0 C;  5GAN 5;  3J7A F;  5GAN g;  4UP9 A;  4YRL A;  5AYF A;  4M7D E;  1G3T A;  5DY9 A;  2PME A;  1UB4 A;  3M9Q A;  3A8H B;  2P0P A;  3UFG A;  3CPW A;  2QEX A;  3PTA A;  1YGB A;  3OYE A;  1JJC B;  5GAN f;  4P71 C;  2M16 A;  3CCV A;  2XGT A;  3GIB A;  3G1Z A;  3LWI A;  1NYQ A;  1OYX A;  4YRN A;  2E41 A;  3JB9 F;  2RJF A;  1I81 A;  2B8A A;  1EVL A;  1I8F A;  2LT1 A;  4NS5 A;  2LDM A;  2XDB A;  1WJR A;  2CIM A;  3C4S A;  4C8Q E;  1AHJ B;  4R55 A;  4DQ2 A;  4EMK A;  3OYD A;  3E9F A;  2XID A;  3G6E A;  1G3S A;  3LSS A;  4LDY A;  2ZPI B;  4EDU A;  1YI2 T;  3CPF A;  2RK1 A;  5GAN j;  2ART A;  1WPY A;  2Q7E A;  1NYR A;  3OYI A;  2H3J A;  2I4O A;  4EMK B;  3M4G A;  5K1P A;  4J5Y A;  4L5G A;  2KMT A;  5E3I A;  3SWN C;  3KUF A;  4CH5 A;  1EIF A;  2CS7 A;  4LVM A;  2XK0 A;  1E22 A;  1VIE A;  4XQ3 A;  4P75 A;  3IG2 A;  2E10 A;  4OB1 B;  1X75 C;  2OTJ A;  1VQM T;  3X24 B;  5KE2 A;  3X25 B;  5J39 A;  1GXI E;  4LVJ A;  1M9S A;  1HK9 A;  5HY6 A;  3HXU A;  3M4Q A;  2K2V A;  1VQ6 A;  4LVK A;  3L4G B;  3CME A;  2RJD A;  1FWZ A;  3I7F A;  5KH6 A;  3Q1J A;  1H64 1;  4RKU E;  2EYQ A;  3OS2 A;  4XAX B;  4HWR A;  1FX7 A;  4ZTJ A;  3JB9 J;  3VKI A;  4TVY A;  2K5L A;  3IAL A;  3QXE B;  4HA8 A;  1WQ7 A;  2DXC A;  2K4Y A;  1Q7Y C;  2EFI A;  2ZR2 A;  4XK8 E;  3E1S A;  1BBW A;  1UGR B;  2JTM A;  1KHC A;  4LD9 K;  4O5V A;  3H6Z A;  5C51 B;  4E7L A;  4P71 A;  4YRM A;  4E7J A;  1N9S A;  4A4H A;  3CBM A;  4KQE A;  3FJP A;  3RIR A;  3UDC A;  3MCA B;  3L1A A;  1WGS A;  2X35 A;  1ZQ1 A;  3OYM A;  3DSQ A;  4BB7 A;  5LJ5 e;  4BDZ A;  3MET A;  1H4V B;  2XKO C;  3L2R A;  4ZGE B;  3RUX A;  1VQ4 T;  1KC8 C;  4M78 C;  5CK9 A;  3RGL A;  5CAI A;  1N27 A;  3AHU A;  4WJ3 M;  3LC0 A;  2LVM A;  5FRM A;  2RB6 A;  2Q5I A;  3VQY A;  3VBB A;  3CXC A;  2DJZ A;  3HXV A;  1FYF A;  4M77 F;  2ODR D;  1WJQ A;  4AH6 A;  4XU2 A;  4P74 C;  1KC8 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...