2E1HA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3, k111g mutation
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
225
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] liga
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 225
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e1hA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e1hA01
2K57A 1H641 3JCMV 2E10A 3TEHA 4M7AF 3LC0A 2ALYB 4P75A 3HRKA 4YREA 4KR2A 4M77B 3RERA 2PMFA 3HFOA 5GAN6 4XTXA 5GMKe 2DXUA 1BBWA 1QF6A 3UH0A 2DTIA 5I21A 5GMKh 4TVWA 3VQVA 3TUPA 4ZIBA 4M75G 3INZA 4YYEA 5GAN5 4OLFA 3JB9G 2I2LA 4Y91A 4HWOA 4PHCA 4NCXA 2Q7GA 4YCWA 1YB3A 3ICAA 1QE0A 3JCMd 4N0AC 4CS4A 3JCMh 5C51B 3I7FA 4CH5A 3A5YA 3UGQA 4XTWA 2E64A 4M78C 4M77F 3RF1A 4G84A 3JCMb 1B70B 2YHTA 4JLIA 2EJ9A 4P71C 4TVYA 1H4SA 4XU0A 3W3SA 2I4NA 1USYA 2RHQA 4UP9A 4YCUA 2QHSA 4RQFA 1LNXA 4HWRA 4F7UE 4P3PA 2CJ9A 1BIAA 3HXXA 2DQ3A 3SWNA 2QTXA 2CIMA 11ASA 3HSBA 5GANf 5GAOm 2Q7HA 4AH6A 2DDZA 2ARUA 5DY9A 2RHSA 2ZCEA 1ASZA 2Q5HA 1J5WA 4WF2A 2CGHA 3HY1A 3SWNC 2ZINA 2E65A 3JCMJ 5GAOl 4TQDA 1E24A 3A5ZA 1NJ6A 4C8QD 3BDUA 1VQZA 5GAOq 4J6YA 5GAMd 1I5LA 5GAMh 1H4VB 1X56A 4H02A 4EMHA 3MF2A 3LSQA 2ODRD 1W66A 4YP0A 5GAN7 1WQ7A 4C8QA 3NENA 5GAOp 4M7DE 4X9CA 5GMKi 1YFSA 3QNEA 4C92E 4M7AC 2YLBA 4J6WA 1HC7A 4H2XB 4F7UB 1D3BA 1WQWA 5GANj 5E3IA 1EQRA 3JCMX 1KMMA 4TTVA 3HFNA 3L4GA 3CMQA 4KR3A 3G1ZA 3NELA 1NJ2A 1NJ8A 2DU5A 1PYSB 3JB9J 3V7CA 1D3BB 4YRMA 1WLEA 1JRIA 1HTTA 2ALYA 5ELNA 1LOJA 4P3NA 3BY7A 2P5IA 1WYDA 1ATIA 4YRKA 3JCMc 1LYLA 4P74A 5F5WA 1N9WA 3RL6A 4UP7A 2DU7A 4PNOA 4A53A 4M77C 4XEOA 3BFMA 5LJ3f 4BWAA 1EVLA 12ASA 1Z7MA 2FYKA 2CJBA 3LSSA 2ZZGA 3AHUA 5LJ5j 1B76A 4H2YA 4YRTA 4C8QF 3QO8A 4YRCA 4CH4A 3WQZA 5GAN4 3VQYA 4M78E 2CJAA 1B34A 4P75C 2XGTA 4M7DB 5GMKm 1X2HA 4CS3A 5GAN2 2E5AA 4YRGA 4C92B 4YCVA 5GAOr 3MF1A 3HFVA 1IL2A 2C8MA 4WJ3M 3A7AA 1WNLA 4M7AG 1KQ2A 4KQEA 5GMKl 3FJPA 1M8VA 1X2GA 1SRYA 1B34B 1B70A 4H2TA 4XEMA 1KOGA 4C8QG 3JCMP 2DZ9A 4Q15A 4NL2A 1NNHA 4EO4A 4Q6GA 4PJOE 4DQ2A 1E22A 1Y96A 2DXTA 4HA8A 5LJ3j 1YCYA 3EFRA 4V2SA 4M7DF 2ZR2A 3RKWA 1SETA 1RIQA 1WU7A 4L87A 1GGMA 3RACA 5LJ5e 2VC8A 4CH6A 1Y96B 1I81A 1EOVA 4YRPA 3V8JA 4PJOD 4M77G 2DZCA 1USYC 2Q5IA 2DKGA 1G5HA 3QSUA 4M78B 2YLCA 5LJ5h 5K1XA 2ZT6A 2DJZA 4DPGA 1JJCB 2QHUA 4YRLA 1KMNA 2ZT8A 1NJ5A 2AKWA 3UGTA 4HT9A 3KFUA 4TQFA 1H4TA 4M75E 4P73A 4J6XA 4HWPA 4PJOA 5GAN3 2ZXFA 4H2WA 3E9HA 1HK9A 4M7AE 3HXZA 4P3OA 2DEQA 2ZTGA 3VQWA 4YRNA 4K87A 2AKWB 1YFTA 3HRIA 4HWTA 2EJFA 3R07A 2ZIOA 4TVAA 3JCMf 4EMKA 4PJOB 4WI1A 1G51A 3NEMA 4M75D 5LJ3e 4H2XA 4RCCA 3JB9D 4YRRA 4F7UA 1E1TA 4UPAA 3JB9H 3JB9I 3MEYA 3HXYA 4HVCA 4TVAB 5HGQA 4EMKB 3V8KA 1PYSA 4XTYA 2Y90A 5LJ5g 4JUVA 3IKLA 1EIYA 4C8QC 4M75A 1B7YA 1I8FA 2ARTA 3P8TA 3PZCA 2IY5B 1L0WA 2EL9A 2QHVA 3JCMW 1X55A 4WJ4A 3BW1A 4HWSA 2Q7EA 5GMKj 5GAN8 4M7DD 3QO5A 2QHTA 1EIYB 4C92D 4PJOF 4P72A 2EJGA 3EFSA 3V8LA 3RKYA 1EVKA 4M75B 1B7YB 1YFRA 4ZTZB 2ODRC 4QVCA 3IG2A 4RQEA 3ERRA 3RUXA 2G4CA 1H4QA 3L2ZA 3VBBA 4YROA 5C53B 4M7DA 3NETA 5GAOn 1N9SA 4C92A 4F7UF 2ZNJA 2ZZEA 4YRFA 3PGGA 2DTHA 1I4K1 5K1PA 5LJ3g 4P74C 2VXFA 1B8AA 2HNIA 4QVDA 4RMFA 3HXWA 4H2VA 5GAMf 4CH3A 4BW9A 4M7DC 3A7RA 4NL3A 4K88A 3DSQA 2J3LA 3IALA 3UFGA 5GANe 2XTIA 3HXVA 3HXUA 4M75F 4HT8A 2DQ0A 3JB9F 4YRSA 4J5YA 4F7UG 3OD1A 4XTVA 5GANd 5GANh 2ZIMA 2RD1A 3A31A 4J15A 4M78D 4G85A 4YDQA 2DTOA 4N0AA 1NJ1A 3TEHB 1N9RA 3FB9A 1EFWA 3JCMe 3REXA 3RESA 3A7UA 4EX5A 4MMLA 2FB7A 5CAIA 3PCOA 4ZTUB 3SB2A 3QO3A 4M78A 4C92F 2I4OA 1X54A 4X9DA 2ZGWA 4P71A 4TWAA 5GAMj 1LJOA 2ZR3A 3V7SA 1JJCA 3QHSA 3REUA 2ZNIA 3PCOB 3VU3C 2E41A 4K86A 5LJ5d 2AMCA 4JRIA 3P8YA 2ZT7A 4A54A 3L1AA 3A74A 4M7DG 1KQ1A 2EWNA 1BIBA 5GANg 4C92G 3RKXA 1U1TA 1NYRA 4XU2A 2AMCB 4H2SA 3V7RA 1ADYA 2PMEA 3E9IA 2RHQB 4X5OA 4C8QE 3GIBA 3JCMQ 2C7IA 4P73C 4PJOC 4EMGA 1SESA 4YRJA 2VXEA 2P0LA 4YRQA 4XTZA 3JCMg 2RA2A 3VQXA 4M78F 3SWNB 4M7AD 4XQ3A 1BBUA 4JRKA 2JN0A 4XU1A 5LJ3d 4EMKC 5LJ3h 4XU3A 5GAMe 1YGBA 2E3CA 2IY5A 1ADJA 2RHSB 4RCBA 3IKMB 1NYQA 1X01A 1ASYA 3FIFA 4RDXA 4NOYA 3M4GA 2ARSA 4H2UA 4YRIA 4O2DA 4OP0A 1G5IA 4M77E 2J3MA 4MMKA 3M4QA 4M78G 4M7AA 3BJUA 3QUIA 1FYFA 3M4PA 5ELOA 5KNNA 3RGLA 3QO7A 4M75C 1E1OA 1U1SA 3A32A 5LJ5f 4LNSA 2DVEA 3HTZA 2I4LA 4XTUA 1WPYA 4M7AB 1HXDA 4M77D 4P72C 1MGQA 4CS2A 3RIRA 1M5Q1 4C8QB 1SERA 1C0AA 5C52B 4E51A 2E1HA 2EAYA 2RB6A 3P8VA 3HFZA 1TH7A 4PJOG 3TEGA 2RM4A 4PG3A 2I4MA 1JBMA 3L4GB 4YPFA 3QTCA 4M77A 4C92C 1Z7NA 5GAMg 2ZZFA 3HY0A 3HFZB 4UP8A 2ZT5A
chains in the Genus database with same CATH superfamily
1H641 1RUWA 2E10A 4KH0B 1WHJA 3HRKA 3RERA 2PMFA 3KBGA 2V26A 1VYVA 1Q81U 1BBWA 1X27A 4PJMA 3I56A 3WXMB 1NE8A 1JEGA 5CKFA 1AWWA 3MEWA 2QA4Q 4AT1B 2LCLA 1VQ4Q 3EG2A 3PMIA 3INZA 1OZ2A 3CBMA 3M0RA 4HWOA 1OYXA 1MMAA 2Q7GA 4YCWA 1KD1R 1YB3A 3CC7Q 3JRZA 3TCJA 4ME7A 3I7FA 4A4EA 4CH5A 1VQLA 5KH6A 2AKLA 2O01E 2E64A 1D1CA 1TTHB 4JLIA 2DIQA 4DOVA 4P71C 2K5IA 3CCVA 2H3EB 5IHNA 4TVYA 1H4SA 4XU0A 3QDRB 1UGRB 5A0DA 1I1JA 2JMCA 4YCUA 4DBRA 1X6BA 4IUUA 1LNXA 2ECZA 4HWRA 3SEMA 3HKSA 4BI8B 1BIAA 1H3ZA 2DQ3A 4PK4A 4LDXA 1WYXA 2QTXA 3GPLA 1AHJB 11ASA 3HSBA 2KNBB 1OOTA 2ZCEA 1K8AR 5CVIA 4WF2A 2PVOB 3HY1A 2DA9A 3OBWA 1Q82R 4J9GA 2E65A 2BZ8A 1UHCA 2E4HA 4TQDA 3EG1A 2DE0X 1AOJA 4BDYA 1E24A 1M2VA 3A5ZA 2FG0A 4XK8E 3C4SA 2RHUA 1BKBA 5GAOq 3R6NA 1I5LA 5GAMh 3M0QA 1AWXA 2X4JA 5D6WA 1YITQ 1GFCA 2A28A 5HK3A 3OYAA 3MF2A 2F5KA 4LDVA 3CCET 2ODRD 1JXMA 3SDZA 3NHNA 1WQ7A 1OU8A 1YFSA 1KIKA 1N8RC 3QNEA 2YLBA 1HC7A 3EAEA 1D3BA 2G3RA 2HBPA 1YNZA 4TTVA 2CP0A 2OTLA 4E47A 4KR3A 2HSPA 5IXFA 3G1ZA 1G83A 3L2VA 2RH2A 2X4WA 1ZA1B 1PNJA 3EG3A 2DBMA 3TSZA 3G4SA 3CD6A 1Z9QA 4KUDK 3BY7A 3HPWA 3QPHA 2R58A 3D7SB 1VQ9T 2P5IA 1R0BG 2LDMA 4FSSA 3JCMc 1M27C 2M1HA 1K0SA 2K9GA 3MKDA 3FJ5A 4D8KA 4E7HA 1W70A 2DNUA 4XEOA 3EFOA 1EVLA 1QKWA 3OW2S 1Z7MA 1ZSGA 2CJBA 2ZZGA 1I0CA 1V76A 3QO8A 4CH4A 1UGVA 5J26A 5GAN4 3CC2Q 1KQSP 1WHMA 3OS5A 2XGTA 4P75C 2OX7A 5GMKm 4YRGA 4C92B 2GQVA 3A7AA 3EH1A 2CT4A 1KC8R 5CKEA 1YJNT 1WNLA 4M7AG 1R8OB 2K6DA 1KQ2A 2HMAA 1LVKA 2GTJA 3FJPA 1X2GA 2RHXA 3VKIA 2OTJT 2RJFA 1BYMA 1N5ZA 2KROA 3OYLA 3JCMP 4AG2C 3BDLA 2ABLA 2HL3A 4NL2A 1O75A 4EO4A 3OYJA 1YJ9T 4PJOE 1M30A 4DQ2A 4PFOA 2KXCA 3M0TA 3VS6A 1UGSB 1BI1A 2Y4YA 1XOVA 2FZCB 1V1CA 1D0YA 3RKWA 1SETA 1WU7A 4L87A 3PVQA 2EKHA 1KSWA 2VC8A 3CC4Q 1EOVA 1XNIA 3CCUA 2KYBA 2KYMA 2DZCA 1M4ZA 2Q5IA 3T9NA 2YWWA 1UECA 3NMZC 5K1XA 3TSWA 2ZT6A 2DMOA 1PD0A 3ZBDA 2QHUA 1WHHA 1RI0A 3KFUA 2ZPHB 1H4TA 4HWPA 3UT1A 4PJOA 1M3AA 3CPFA 3DB3A 4H2WA 3E9HA 3HXZA 4P3OA 4J9HA 4Z8AA 2ZTGA 1RI9A 3VRZA 2EJFA 4J9BA 4FSXA 4Y28E 1H92A 2M51A 3VYGA 3OQ5A 4EDUA 3NEMA 4H2XA 4RCCA 3JB9D 2FO0A 1Q7YU 4F7UA 4YRRA 2EYWA 3M0SA 3JB9H 2GF7A 4LUDA 2EQIA 3HXYA 4HVCA 1ZUKA 1IHVA 4EMKB 5KYXA 2RHZA 4XAXB 1ZLMA 2MK5A 2Y90A 3EHRA 5LJ5g 2R5AA 1EIYA 2GFUA 1B7YA 3MP8A 3PZCA 2FPFA 1XTDA 2J7IA 2Q7EA 2KRSA 4C92D 2A36A 3EFSA 3V8LA 2F2WA 2W10A 1PRMC 4RTUA 2RMOA 4BI3A 2J6KA 4WTOB 5KCHA 4PJLA 3IG2A 3HRUA 3ERRA 3TQ7P 4AFZC 2G4CA 2EQJA 3L2ZA 3OS2A 1AVZC 3CCQQ 3G1JA 3TREA 1VQPA 2QEXT 4M7DA 4HCBA 1W2BA 1WX6A 2DILA 4YRFA 1MHNA 2DTHA 1I4K1 2YXYA 5LJ3g 4P74C 2YDLA 4HVVA 5GAMf 1Q86U 4F04B 4M7DC 3A7RA 3ULRB 5GANe 2PVGB 3RMSA 1K0XA 1SSFA 2QA4A 3M58A 2DVJA 1VQ4A 2NS6A 5L23A 2NLUA 3JB9F 2MPXC 4J5YA 2CP3A 2YRDA 5GANh 2ZIMA 3CC7A 3I56T 1VOMA 4OF1A 5FLXE 3CCLQ 3OS1A 4QT7A 2CP2A 2Y4XA 3A8LB 3CBPA 1KD1C 1NJ1A 1IZ6A 1RAIB 1WHKA 1VYTA 3C94A 4HVUA 2VGNA 2LZ6B 3HHTB 2LNHB 1LPLA 3SFMA 4A4HA 2FB7A 5CKDA 1C0MA 1WDXA 3QO3A 4QQDA 4C92F 4QQ6A 3EG9A 4X9DA 2ZGWA 3MJXA 4JJCA 2LNVA 5GAMj 2DL7A 2WSFE 3VS3A 1VQLT 3CCJQ 4O5VA 4Y92A 4FYVB 1IGQA 3L1AA 3M0PA 5DLQE 3CCVT 4JRPA 4IUTA 1BIBA 4C92G 4IUPA 3A8MB 4VUBA 3NTKA 4B6MA 4H2SA 3OA6A 3E1SA 4HVWA 1ADYA 4HKEA 2KRMA 5CQXA 3H41A 1K8AC 4BE1A 1YJWQ 2YRVA 4X5OA 4PKCC 1KHIA 1CKAA 3JCMQ 4F17A 5KYUB 4YRJA 1N6AA 3GOXA 1RAGB 3JV3A 1Q86C 3VQXA 1YITA 4PJJA 1Q81R 2BIVA 2QASA 4XU1A 3CCMQ 5LJ3h 2EGEA 4XU3A 3CCRQ 3OYBA 1G8XA 2GGRA 3FIFA 2FZGB 3M4GA 4H2UA 4J7IA 4OMLA 1N8RR 2AZSA 3UDCA 4OP0A 1G5IA 1PSFA 4LD9K 4M7AA 4FU6A 3GP8A 3QUIA 3M4PA 3NTHA 3M53A 4M75C 1U1SA 4CC4B 3JSCA 3C95A 5KYWA 3HTZA 4XTUA 1VQ7A 1VQOA 2MI6A 2L3RA 4P72C 3OYGA 2OTLT 3WVEB 3KXTA 1ARKA 2E1HA 4J9DA 2MIOA 2PUOB 1TH7A 1VQMQ 5FU7B 2X4YA 1EFNA 3CPWP 1MMDA 1WHLA 3G4ST 3CD6T 2DD4A 3L4GB 1JBMA 4AG1C 3OBYA 2DX1A 2AIRB 2LQWA 3HY0A 3CC2A 2LJ0A 1HJDA 3HFZB 3J80E 2K7AA 1YCSB 2K57A 2ENMA 3LC0A 4OMMA 4YREA 4JLGA 2HQHA 3HFOA 1SSHA 1RAHB 4R55A 3UH0A 2ZCFB 1KC8C 2X4XA 2WSCE 4RTXA 2RO0A 1X6OA 3FEOA 1M2OA 3VQVA 3TUPA 4ZIBA 4OLFA 2I2LA 1BU1A 1TUDA 1MNDA 2LX9A 4OGEA 2HL5C 4M4ZA 4CC3A 1ZX6A 1QE0A 3OW2P 4FYXB 3CBOA 2EIFA 2GBQA 1U06A 2FPDA 4JDSA 3I5SA 1F1BB 1RADB 5FWCA 3UGQA 3A98A 3CC4A 1AZEA 4M78C 4LN2A 1UJYA 3JCMb 1TS9A 2V8JA 2ATCB 2X35A 3MCAB 1M1FA 4IUVA 4ELYC 2IG0A 4OMFB 2I4NA 1UB4A 1USYA 2RHQA 3MEAA 3MHXA 3LW5E 4IIMA 2NUTA 2NUPA 1WHGA 1JQQA 3CCUT 1U5SA 2HAXA 2CJ9A 5FRMA 1KG1A 1B07A 3PT9A 3SWNA 1OULA 3TVTA 2JTFA 2CIMA 1K1ZA 3QWXX 3L2QA 5GANf 2X9HA 5GAOm 2RHSA 5DY9A 1KHCA 1UJ0A 2CGHA 3SWNC 2CKKA 2JM8A 2ZINA 1UGPB 1SEMA 2A3LA 2F1LA 3PIOA 5GJVB 2JS2A 3GNGA 4LE9A 2RHIA 2HBWA 4DOWA 2DM1A 4KULA 5DLOA 1TG0A 3OYNA 1VQ5Q 3CEYA 3UA7A 1K76A 3LSQA 2RN8A 2OAUA 2EYYA 4ZGJB 5GAN7 4C8QA 1TXQA 3J81E 3NENA 3S6WA 5GAOp 5KYYA 4C92E 4ZTJA 1SKUB 2RI3A 2HQEA 5E3IA 5GANj 4EPCA 1VA7A 4JS5A 4GLKA 3HFNA 1P92A 3NELA 1NJ2A 4MZPA 2EVRA 1BCMA 2O9VA 2O4XB 4FYWB 3LGFA 1JRIA 3O5ZA 1HTTA 5J3BA 2ALYA 4JJNK 1LOJA 2JUFA 4EIKA 4ZGDB 1E7OA 2F2XA 2DL5A 1LYLA 3ASKA 3RL6A 1VQPT 1D1AA 3CMEQ 4CI0C 4ESRA 5CKHA 4A53A 4M77C 2CZ1B 2JTEA 1W6XA 2K3BA 5LJ3f 3LSSA 3AHUA 5LJ5j 1GRIA 4H2YA 3WQZA 3P8DA 3M56A 4E7SA 4RUGA 1D0XA 2CZ7B 2VASA 3VS5A 2O9SA 5GAN2 3CCLA 3HRSA 2XD0A 1IL2A 1VQ4T 3A8OB 2C8MA 4WJ3M 5A0LA 2LX7A 2K79A 4KQEA 1SRYA 1B70A 1PRLC 3CC7T 1FXXA 4XEMA 1YI2Q 1OX9A 4BD3A 2DLPA 1NNHA 1GL5A 3CQTA 3M5AA 1ZSZB 4ORZA 3SD4A 1E22A 4AFUC 1D09B 4HA8A 5LJ3j 1QKXA 2F5TX 3EFRA 5FU6C 4M7DF 4OMOA 2MF2A 1VQ6T 1RIQA 2HZYA 3VUBA 3G71A 1HD3A 1GGMA 2LVMA 4CH6A 1Y96B 2DRKA 1I81A 4YRPA 2L8DA 1S72A 3QSUA 4M78B 2YLCA 2RK1A 4D8DA 3H6ZA 1YJWA 1QVFA 1OU9A 4YRLA 1KMNA 4OVAA 4HT9A 4TQFA 1Q86R 2CH4A 2DPPB 1W2BS 3EHQA 3CCMA 1NYGA 4K87A 2AKWB 3CCRA 3HRIA 1Q81C 4HWTA 3R07A 4J9EA 2ZIOA 1GXIE 3UPUA 2G6FX 4EMKA 4WI1A 2DF6A 4M75D 2L3QA 4LDUA 3QZ9B 2L89A 4UPAA 2RQUA 2MOXA 1Q95G 1XJWB 2K5LA 3JB9I 4TVAB 2LJ3A 3G7ZA 2QAZA 3V8KA 1AWOA 3IQLA 4QW2A 2GFAA 1PYSA 4XTYA 3IKLA 4ZTFA 1VQ8Q 4QVZA 4E6RA 1VYUA 4L5GA 2ARTA 3P8TA 5HKCA 1L0WA 2XKOC 1X55A 3BW1A 5GAN8 3S3MA 4F14A 1QVGS 1RAEB 1QP3A 3RKYA 2R57A 1VQMA 3OYYA 2CUBA 3X26B 4ATOA 4QVCA 4FW2A 2LMJA 1R0CB 3M9QA 5GJWB 1JJ2A 1VQ7T 3RUXA 2DJQA 4Z89A 5C0MA 3CXCA 5CIUA 1VQOT 1NBEB 1WJSA 1NEBA 1A0NB 5IT9E 4YROA 5CCAA 4YTLA 2ZNJA 1N9SA 3DKMA 1ABQA 3M59A 4HT4A 5K1PA 1TSFA 5CKBA 2HNIA 1B8AA 5I2SA 4QVDA 2PNIA 2QQ9A 3HXWA 2QTVA 1QQJA 1IO6A 1VQ9Q 2D6FA 4K88A 5CO7A 4ZGEB 3CC2T 1GBQA 1YIJQ 3UFGA 2XTIA 1FMKA 1NYFA 1G3TA 4M75F 2RI2A 1YFNA 2X3WD 2P0PA 4BE2A 4XTVA 1NPPA 4N4HA 3A31A 3MP1A 4M78D 2A8EA 2MMPA 3UA6A 4C0FA 3RNJA 4FIBA 2R5MA 4OB1B 2EBPA 3F70A 4N0AA 1DJ7B 2EQKA 3FB9A 4PFZA 3JCMe 1YJNQ 3RESA 1WIEA 3A7UA 2DIGA 2KT1A 2YUOA 1NZ9A 5CAIA 2K3XA 5D6YA 4ZTUB 3DB4A 5CQYA 1OI1A 2I4OA 5CK9A 1TUCA 3SHWA 5IHIA 1M1KU 3CCSQ 4KRTA 1JJCA 3QHSA 3REUA 3PCOB 4K86A 2E41A 3P8YA 3MP6A 3A74A 4D6WA 1KQ1A 1YN8A 2ZZDA 1MMGA 5GANg 3E19A 1U1TA 2KR3A 1MV3A 2YUNA 4QKUA 1W4SA 4PFPA 1Z9ZA 5KYUA 1N27A 2YT6A 1NM7A 2PMEA 3OYHA 2KT8A 1NJIU 1C6VX 3C12A 3H0FA 1M90U 1Y7XA 5AT1B 4PJOC 1SESA 4YRQA 4BACA 4HXJA 1SRLA 4XTZA 3P8BB 2KY9A 2BE9B 1V29B 4M78F 1GCPA 1UTIA 3EGXA 4XQ3A 1RAAB 4JS4A 2E3CA 2DXCA 3VUZA 2DK3A 1ADJA 2IY5A 4RCBA 3IKMB 5A0GA 2RJCA 1OQKA 4FM4B 1X01A 2D0NA 2EW3A 2M0YA 4RDXA 4OGCA 1YWPA 5AYFA 2PTKA 3M4QA 3A5ZB 4M78G 1RL2A 2L2PA 4UC4A 1FYFA 4RG2A 5ELOA 3QO7A 1E1OA 4KGVB 1RABB 3A32A 4LNSA 4OMNA 2DVEA 3MEVA 1QCNA 1PWTA 4ZNXA 2EGCA 5KCOA 4M77D 2HDAA 1M1KC 3OYFA 4CS2A 2P84A 1IGUA 5C52B 2IPOB 4LDYA 3P8VA 2F2VA 3HFZA 3TEGA 1PSEA 2C06A 2RM4A 1RLPC 2DD5A 2H3JA 5M9OA 4K11A 2LC4A 1UG1A 3QTCA 3DLLA 2ROTA 4Z88A 4LUEA 3R6OA 4UP8A 2ZT5A 2KQWA 1NJIC 2HKQB 3JCMV 3TEHA 1ZUYA 9ATCB 5GAN6 4XTXA 5GMKe 2FRYA 1Q82U 1AEYA 2JZ2A 3VS2A 2KK4A 1YI2A 1Q7YC 2CS7A 1K4US 2DTIA 5GMKh 1KJWA 3EFOB 2XHCA 4YYEA 5GAN5 3JB9G 4Y91A 1B3QA 1QVGA 2PQWA 2H8HA 4NCXA 3ICAA 1PC0A 4RG8A 3H8ZA 3JCMd 4C5EA 4CS4A 2C0OA 4CC7A 5D7UA 5C51B 1H3HA 1QW1A 8AT1B 2VKNA 3CMAQ 1OX8A 4XTWA 3M4YA 1K9MU 4M77F 3RF1A 3FRNA 1UE9A 2YHTA 2DETA 2K2VA 1G3WA 4FT4A 3HL8A 2FPEA 3W3SA 4JJDA 2BZYA 2J6FA 1VQNQ 1EX4A 3G71T 2VB6A 5I2MA 2AHJB 3RDVA 1FX7A 3X25B 1VQLQ 2RNAA 3O8VA 2QHSA 5DM7R 2QG9B 2LTOA 1M1GA 2LT1A 1S72T 3HXXA 2FZKB 3CCVQ 3QWYA 3MO8A 1UHFA 1YJWT 2Q7HA 4AH6A 2DDZA 3HRTA 1ASZA 4LVKA 1E6GA 1M3CA 2Q5HA 1J5WA 1G3SA 3JAME 2E3IA 4GY5A 3JCMJ 4O6JA 5KE2A 3QJ6A 1NJ6A 2W0ZA 3CCMT 3BDUA 1VQZA 3CCRT 2A08A 4RTVA 3PVLA 3I9QA 4JZ4A 2KAFA 1X56A 4H02A 2DERA 3E9GA 1YWOA 3LLRA 1VQ8A 1MUZA 2RJDA 4EMHA 1VQKQ 4L6V5 4BY6C 5KE3A 1C1AA 1FMWA 1J3TA 1AD5A 4YP0A 2P0KA 1W2BP 4X9CA 5GMKi 4RTYA 2FHDA 4M7AC 1JU5C 2RF0A 4H2XB 1ZBJA 1QCOA 4F7UB 1AZGB 1WQWA 2OI3A 3QKJA 1EQRA 3JCMX 1KMMA 1Y0MA 1PG5B 3CMQA 1JO8A 2E5KA 3L2RA 2RQVA 3AT1B 3I55Q 5FWBA 5KYXB 2DU5A 3EG0A 2F69A 3H9NA 4YRMA 2QQSA 1PD1A 3EH2A 3OY9A 1VQMT 4E7IA 3LWIA 5ELNA 4A63B 2JTMA 2YRCA 1K9AA 3NTIA 5F5WA 1N9WA 4ELZC 1YIJA 2DU7A 2CYZB 5EG2A 3P8HA 1KK7A 3GF5A 3G4SQ 2HQXA 2CDTA 2E70A 4II1A 4PL6A 1QVFS 2KSSA 3E9FA 4YRTA 4M78E 4LVLA 3LYIA 2CJAA 1QWEA 4M7DB 4CS3A 2E5AA 4PJNA 4YCVA 1QWFA 3HFVA 4FT2A 5GMKl 2GNCA 2JW4A 1M8VA 1B34B 1ZSZA 2BTTA 2LRQA 4H2TA 3RR6A 1CKBA 4R0KA 2CP5A 2DZ9A 4ANJA 2LJ1A 4GLMA 3CCSA 4RTTA 5EC7A 3MQZA 3G6EQ 4KGZB 1Y96A 5LL6S 3VS0A 3LX7A 1YP5A 2O31A 2K4YA 1X2QA 1X75C 2EQMA 2E6NA 4Z02A 3J7AF 1SPKA 3PFSA 2L3PA 4PJOD 2YUPA 3KFVA 3OB9A 1USYC 4DBHA 1G5HA 2J05A 2KMTA 3EG9B 2ROLA 4KUIA 2RI5A 1JXOA 2DJZA 3META 1I5OB 2QQRA 4GBQA 2LQNA 1JJ2S 2AKWA 3CXCS 3CCUQ 4P73A 3OMGA 2DEQA 2DXBA 4OMPA 2MYSA 3VQWA 4YRNA 1YFTA 4TVAA 1WLPB 3QYGB 5CR2A 4J9FA 3EGDB 2EGAA 1E1TA 3N5BB 2MAMA 3X20B 2EFIA 3MEYA 3LGLA 5HGQA 4BI4A 4ZN3A 1FYNA 4JUVA 1PKSA 2ZAEA 2FEIA 1YHQQ 3FC3A 4C8QC 1I8FA 4J8OA 2COWA 1SG5A 1WXUA 2M16A 2EL9A 3JCMW 3CCQA 4WJ4A 1WJRA 4HWSA 5GMKj 1M1KR 4M7DD 2XDDA 3QO5A 4PJOF 1EVKA 3M54A 4M75B 4BUGA 2JXBA 2CH4W 4RTWA 2C0IA 2NYSA 2KI7A 2CZ0B 2NUZA 3VBBA 1RLQC 2D1XA 2D0QB 1NPRA 2QI2A 1WA7A 5C53B 2QYZA 5GAOn 4C92A 4F7UF 2ZZEA 3EGUA 3PGGA 2CP7A 4DBFA 1Y07A 2VXFA 1NJIR 2V1RA 4H2VA 4CH3A 1M90R 4NL3A 3DSQA 2D9TA 2ZPEB 2P4TA 2J3LA 4AMCA 2BE7D 2BZXA 3QG1A 2QA4T 3HXVA 2HCKA 4BDZA 2COZA 2HD0A 4HT8A 5L8RE 4YRSA 1Q7YR 3U23A 4BB7A 4F7UG 1X6GA 3OD1A 3ZEHA 2JVVA 2RD1A 1EZZB 1UDLA 4G85A 4YDQA 1WXBA 3Q1JA 1YI2T 2FVUA 2JM9A 2DTOA 3CMAA 4MDWA 3S3NA 1HYOA 2CREA 3REXA 4EX5A 3CCJA 2JOYA 4MZTA 2RQWA 1N8RU 3PCOA 2KRNA 3SB2A 4C0DC 4OB0B 1KQSA 1X54A 7AT1B 2YSQA 1IRXA 4P71A 1LJOA 1VQNA 4IIOA 3GLXA 3V7SA 2K5FA 4C5IA 2ZNIA 1IXDA 2PUKB 3ME9A 4JRIA 2ZT7A 4X34A 4A54A 2AT1B 1VQ6Q 4M7DG 2EWNA 2NWMA 5C6SA 2MWPA 4FCYA 2HSEB 2EKOA 4XU2A 2XMFA 4RMOA 4C0ZA 2VUBA 2AMCB 3V7RA 5A2QE 3E9IA 4C0GA 2RHQB 2JS0A 1GCQA 2CUDA 2C7IA 5HY6A 4EMGA 2VXEA 4A4KA 1VIEA 2NUTB 3OYEA 2NUPB 4LD6A 3PMTA 3JCMg 4J9IA 1YITT 1GCQC 2DFUA 3SWNB 2JT4A 4M7AD 1OPKA 1VQKA 1BBUA 4JRKA 4EMKC 2KVQG 5GAMe 2B8AA 1B7TA 1YGBA 1UUEA 2RHSB 2E6ZA 3A1PA 1K73U 1ASYA 2ARSA 3OSVA 3UATA 2SEMA 4YRIA 2LT4A 1VQ8T 2P0QA 3CCEQ 5IHKA 2AZVA 3I55A 2KBTA 5KNNA 4QQGA 3PTAA 3X28B 3CPWS 2EYQA 2DEUA 1K9MR 4IUQA 2RK2A 2I4LA 2X3XD 3VV0A 3NPFA 3M57A 4KH1B 2QQBA 1MGQA 3GNFB 4C8QB 2L0AA 4E51A 5ECAA 5KYYB 4A4FA 1D1BA 2RB6A 3URGA 1QLYA 3NGPA 4FW1A 2KGTA 4X1VA 1WZOA 4PG3A 1VQ7Q 4YPFA 1VQOQ 1Z7NA 4NS5A 4LVJA 3L42A 3A8HB 4AFQC 1YIJT 2XDPA 2M0OA 1CSKA 4M7AF 2ALYB 4P75A 1E6HA 2DYIA 4KR2A 4M77B 1AT1B 3M55A 2C0TA 4L59A 3RMQA 2VVKA 2DXUA 1QF6A 6AT1B 5I21A 4F16A 3H0HA 4TVWA 5FRNA 3OYCA 3KUFA 2RPNA 4M75G 1OZ3A 3M0UA 2KDSA 4PHCA 2XK0A 4RTZA 5FROA 3G6EA 2QDLA 2LQ8A 1PCXA 2OTJQ 2XU8A 2L5QA 4N0AC 3QIIA 3JCMh 1K73C 3QXEB 1NG2A 1QVFP 1SHGA 1SRMA 4E2FB 3A5YA 1PHTA 1Y71A 1YJ9Q 3CCST 3CC4T 4G84A 1T0JA 1B70B 2EJ9A 5D6XA 2VYTA 5IXBA 3BE3A 4CC2A 2MCNA 5FU6B 4UP9A 4C0DB 2V1QA 1BI2A 2ZPIB 4LDWA 4MDXA 4IURA 1UEBA 4JJBA 2GCXA 2M9UA 4RQFA 2V8KA 2CP6A 4F7UE 4P3PA 1FWZA 2D8JA 2SRCA 4MZMA 2LQKA 2ARUA 2PZ1A 3OYMA 4Q5WA 2IIMA 2D8HA 4JZ3A 1WXTA 4N4GA 2JMAA 1VQ5A 4JPBW 5GAOl 4ZN1A 2XIDA 3OS0A 2RQTA 4C8QD 2RJEA 2XDBA 2XICA 1D0ZA 3VRYA 4J6YA 2CSQA 5GAMd 1VIFA 1H4VB 2KEAA 1ZA2B 4N4IA 1YHQA 2QQAA 4OMQA 1M2VB 1JJ2P 2FL7A 4PLIA 3CXCP 1KD1U 3THKA 3LH0A 3FLGA 1W66A 1RACB 2BUDA 4M7DE 4J6WA 2O88A 2FRWA 1PM3A 2ZPBB 1H8KA 3L4GA 2J6OA 2ED1A 1G5VA 2X51A 4PLLA 3I35A 2XG8D 3CCQT 1NJ8A 2M02A 1PYSB 2KE9A 5FU7C 3JB9J 4FYYB 3CMEA 3V7CA 1D3BB 3A8GB 3ZL7C 1T3SA 4BE0A 1WLEA 1SHFA 2PU9B 4P3NA 1O9SA 2K3YA 2XI9A 1IHWA 2DAQA 1WYDA 1ATIA 4YRKA 1MMNA 4P74A 2QEXQ 4LVMA 2VGMA 4UP7A 1NEGA 3OSSC 4PNOA 1LCKA 5IN1A 5HK0A 3UWNA 3BFMA 1K8AU 1M90C 4BWAA 12ASA 2DO3A 2VV5A 2FYKA 3MPUB 1RAFB 1TOVA 1B76A 2RQRA 4C8QF 4YRCA 3VQYA 1B34A 1X2HA 4LVIA 3CCLT 2COYA 3UF4A 5GAOr 3MF1A 2LCCA 1ZQ1A 4AFSC 1WJQA 3CPWA 2PVDB 1BBZA 3LWHA 3I56Q 2EYZA 2YUQA 2HEQA 4C8QG 1KOGA 1BI0A 2QK0A 4TVRA 1G2BA 4Q15A 3REBB 2JNGA 4Q6GA 3CMAT 5IAYA 5FW9A 3OMCA 3CCJT 4DA4A 1PKTA 2DXTA 2EPDA 2IVWA 1YCYA 4V2SA 2ZR2A 3H0IA 2V8IA 2I0NA 4DBQA 2DRMA 1VQ6A 3L2UA 2WSEE 1ACMB 1VQNT 3RACA 5LJ5e 4OB3B 2EYXA 3V8JA 4M77G 3E2UA 2E5QA 1WGSA 1X43A 2DKGA 3X24B 3OW2A 2A7YA 5LJ5h 1HSQA 1JB0E 3QBYA 3G71Q 4DPGA 1JJCB 1BI3A 2ZT8A 3UGTA 1NJ5A 3VJPA 1QCFA 3OYIA 3L2WA 4M75E 4J6XA 2DL4A 2A37A 5GAN3 3EGDA 4E7ZA 2ZXFA 1S72Q 1HK9A 4M7AE 3S3OA 3TEEA 5J39A 2CT3A 4DEYA 3GBQA 1Q82C 3JCMf 4PJOB 4CRIA 1G51A 3RBBB 2K2MA 5LJ3e 4E7KA 1KC8U 4R56A 1W1FA 3QZ5B 1QP2A 3DLMA 3CCEA 1VUBA 1VQKT 4E7JA 1TWBA 4A4GA 1OEBA 1MV0B 2ESWA 2O4XA 3QJYA 1TUGB 3EGXB 4M75A 4FL6A 4B9XA 1T0HA 2IY5B 2E12A 3VS4A 1K9MC 2QHVA 1G3YA 3I55T 2DL8A 1UGQB 2QHTA 1EIYB 5IH2A 4P72A 2EJGA 1YFRA 1B7YB 4ZTZB 1OV3A 1WI7A 2ODRC 3PE0A 4RQEA 1KQSS 1X2KA 2OTLQ 1VQ9A 1H4QA 1BK2A 3NETA 1WFWA 3CD6Q 2KXDA 2DBKA 3REAB 1QVGP 1M8MA 1OPLA 2BKDN 2QGFB 1KFZA 4RMFA 4BW9A 8ATCB 2RHYA 2ZPFB 3IALA 3HXUA 1NLOC 1ZBXA 2DQ0A 1YJNA 4LNPA 3PIPA 5GANd 2CZ6B 1GBRA 1ABOA 1AWJA 2OTJA 1Y57A 3ZFJA 4J15A 1BCOA 5I11A 2QXFA 1K73R 1ZSZC 3TEHB 2LP5A 1N9RA 1YJ9A 1U3OA 1EFWA 1R77A 5I22A 4LXCA 3G6ET 3OYDA 2Z0WA 4MMLA 2GQIA 4M78A 3MEUA 4J83A 4J9CA 4TWAA 3HP9A 4DEXA 2ZR3A 1T3LA 1IB8A 3FDRA 3VU3C 2P4RA 1M9SA 5LJ5d 1U8RA 1QVPA 2AMCA 2QDYB 4KBMB 1EIFA 3I5RA 4WCIA 3VYHB 1SF9A 1X69A 3RKXA 1NYRA 1MNEA 1IREB 2ED0A 2OAWA 3C0CA 2L3SA 4RKUE 2JJ9A 2WACA 2AKKA 4C8QE 3GIBA 1YBYA 2AK5A 4P73C 2P0LA 2QGGA 3LH5A 2RA2A 3QDFA 4JRQA 2O2OA 1VQ5T 2VWFA 4HCKA 2JN0A 5LJ3d 4HCCA 3VS7A 4P5NA 2DYBA 1TU0B 1GFDA 2OJ2A 1NYQA 1UFFA 1XQHA 3ER0A 1BB9A 4NOYA 5HCKA 4C5GA 4O2DA 1YHQT 2MWOA 4M77E 2J3MA 4MMKA 1S1NA 3BJUA 4C5HA 1ZHIA 4KT0E 2GTOA 4BY6B 3RGLA 3TU4K 5LJ5f 1FMVA 4HCZA 2ZPGB 3HTRA 4IKFA 1WPYA 4M7AB 2CSIA 2E3HA 1HXDA 4OB2B 4J7FA 2HKNA 3OYKA 3RIRA 1M5Q1 1QMCA 1SERA 1C0AA 4B9WA 2A0FB 2J06A 2QEXA 2EAYA 5KYWB 1NLPC 3CMET 2DL3A 4PJOG 3WVDB 5KYNA 2EQUA 2I4MA 3NFCA 1M3BA 1I07A 3QYHB 4M77A 1ZUUA 4C92C 2LCSA 5GAMg 2ZZFA 4KGXB 1VQPQ 3VS1A 4E7LA 2B86A 3PNWC
chains in the Genus database with same CATH topology
1H641 2E10A 3HRKA 3RERA 2PMFA 3KBGA 1Q81U 1BBWA 3I56A 3WXMB 1NE8A 5CKFA 3MEWA 2LCLA 3PMIA 3INZA 1OZ2A 3CBMA 4HWOA 1OYXA 2Q7GA 4YCWA 1YB3A 3JRZA 3TCJA 4ME7A 3I7FA 4A4EA 4CH5A 1VQLA 5KH6A 2O01E 2E64A 4JLIA 2DIQA 4DOVA 4P71C 2K5IA 3CCVA 4TVYA 1H4SA 4XU0A 3QDRB 1UGRB 5A0DA 4YCUA 4IUUA 1LNXA 4HWRA 3HKSA 4BI8B 1BIAA 1H3ZA 2DQ3A 4LDXA 3GPLA 2QTXA 1AHJB 11ASA 3HSBA 2ZCEA 5CVIA 4WF2A 2PVOB 3HY1A 3OBWA 2E65A 4TQDA 4BDYA 1E24A 3A5ZA 4XK8E 3C4SA 2RHUA 1BKBA 5GAOq 1I5LA 5GAMh 2X4JA 5D6WA 5HK3A 3OYAA 3MF2A 2F5KA 4LDVA 3CCET 2ODRD 3SDZA 1WQ7A 1YFSA 1N8RC 3QNEA 2YLBA 1HC7A 3EAEA 1D3BA 2G3RA 2HBPA 4TTVA 2OTLA 4E47A 4KR3A 3G1ZA 3L2VA 2RH2A 2X4WA 3G4SA 3CD6A 4KUDK 3BY7A 3HPWA 3QPHA 2R58A 1VQ9T 2P5IA 2LDMA 3JCMc 2M1HA 4E7HA 4XEOA 1EVLA 3OW2S 1Z7MA 2CJBA 2ZZGA 3QO8A 4CH4A 5J26A 5GAN4 4P75C 3OS5A 2XGTA 5GMKm 4YRGA 4C92B 2GQVA 3A7AA 5CKEA 1YJNT 1WNLA 4M7AG 1R8OB 1KQ2A 3FJPA 1X2GA 2RHXA 3VKIA 2OTJT 2RJFA 1BYMA 3OYLA 3JCMP 3BDLA 4NL2A 1O75A 4EO4A 3OYJA 1YJ9T 4PJOE 4DQ2A 1UGSB 1BI1A 2Y4YA 1XOVA 3RKWA 1SETA 1WU7A 4L87A 2VC8A 1EOVA 1XNIA 3CCUA 2DZCA 1M4ZA 2Q5IA 3T9NA 5K1XA 2ZT6A 3ZBDA 2QHUA 1RI0A 3KFUA 2ZPHB 1H4TA 4HWPA 3UT1A 4PJOA 3CPFA 3DB3A 4H2WA 3E9HA 3HXZA 4P3OA 2ZTGA 2EJFA 4FSXA 4Y28E 3VYGA 3OQ5A 4EDUA 3NEMA 4H2XA 4RCCA 3JB9D 1Q7YU 4YRRA 4F7UA 3JB9H 2GF7A 3HXYA 4HVCA 4EMKB 2RHZA 4XAXB 2Y90A 5LJ5g 2R5AA 1EIYA 2GFUA 1B7YA 3MP8A 3PZCA 1XTDA 2Q7EA 4C92D 3EFSA 3V8LA 4BI3A 3IG2A 5KCHA 3HRUA 3ERRA 2G4CA 2EQJA 3L2ZA 3OS2A 3TREA 1VQPA 2QEXT 4M7DA 4HCBA 1W2BA 4YRFA 1MHNA 2DTHA 1I4K1 5LJ3g 4P74C 5GAMf 1Q86U 4M7DC 3A7RA 5GANe 2PVGB 3RMSA 1SSFA 2QA4A 3M58A 1VQ4A 2NS6A 2NLUA 3JB9F 4J5YA 5GANh 2ZIMA 3CC7A 3I56T 4OF1A 5FLXE 3OS1A 3CBPA 2Y4XA 3A8LB 1KD1C 1NJ1A 1IZ6A 3C94A 2VGNA 3HHTB 4A4HA 3SFMA 2FB7A 5CKDA 3QO3A 4QQDA 4C92F 4QQ6A 4X9DA 2ZGWA 2LNVA 5GAMj 2WSFE 1VQLT 4O5VA 3L1AA 5DLQE 3CCVT 4JRPA 4IUTA 1BIBA 4C92G 4IUPA 3A8MB 4VUBA 3NTKA 4H2SA 3OA6A 3E1SA 1ADYA 4HKEA 5CQXA 1K8AC 4BE1A 2YRVA 4X5OA 4PKCC 1KHIA 3JCMQ 4YRJA 1N6AA 3GOXA 1Q86C 3VQXA 1YITA 2BIVA 4XU1A 5LJ3h 4XU3A 3OYBA 3FIFA 3M4GA 4H2UA 4J7IA 3UDCA 4OP0A 1G5IA 1PSFA 4LD9K 4M7AA 4FU6A 3GP8A 3QUIA 3M4PA 3NTHA 3M53A 4M75C 1U1SA 3JSCA 3C95A 3HTZA 4XTUA 1VQ7A 1VQOA 2MI6A 2L3RA 4P72C 3OYGA 2OTLT 3WVEB 3KXTA 2E1HA 2PUOB 1TH7A 5FU7B 2X4YA 3G4ST 3CD6T 2DD4A 3L4GB 1JBMA 3OBYA 3HY0A 3CC2A 3HFZB 3J80E 2K57A 3LC0A 4YREA 4JLGA 3HFOA 4R55A 3UH0A 2ZCFB 1KC8C 2X4XA 2WSCE 2RO0A 1X6OA 3FEOA 3VQVA 3TUPA 4ZIBA 4OLFA 2I2LA 2LX9A 4OGEA 1QE0A 3CBOA 2EIFA 4JDSA 3UGQA 3CC4A 4M78C 3JCMb 2V8JA 2X35A 3MCAB 1M1FA 4IUVA 4ELYC 2IG0A 4OMFB 2I4NA 1UB4A 1USYA 2RHQA 3MEAA 3MHXA 3LW5E 3CCUT 2HAXA 2CJ9A 5FRMA 1KG1A 3PT9A 3SWNA 2JTFA 2CIMA 3L2QA 5GANf 5GAOm 2RHSA 5DY9A 1KHCA 2CGHA 3SWNC 2CKKA 2ZINA 1UGPB 2A3LA 3PIOA 3GNGA 2RHIA 4DOWA 4KULA 5DLOA 3OYNA 3CEYA 3LSQA 2OAUA 4ZGJB 5GAN7 4C8QA 3J81E 3NENA 3S6WA 5GAOp 4C92E 4ZTJA 2RI3A 2HQEA 5E3IA 5GANj 4EPCA 4JS5A 4GLKA 3HFNA 1P92A 3NELA 1NJ2A 4MZPA 2O4XB 3LGFA 1JRIA 1HTTA 5J3BA 2ALYA 4JJNK 1LOJA 2JUFA 4ZGDB 1LYLA 3ASKA 3RL6A 1VQPT 4CI0C 5CKHA 4A53A 4M77C 2CZ1B 5LJ3f 3LSSA 3AHUA 5LJ5j 4H2YA 3WQZA 3P8DA 3M56A 2CZ7B 5GAN2 3CCLA 3HRSA 2XD0A 1IL2A 1VQ4T 3A8OB 2C8MA 4WJ3M 5A0LA 4KQEA 1SRYA 1B70A 3CC7T 1FXXA 4XEMA 4BD3A 1NNHA 3M5AA 3SD4A 1E22A 4HA8A 5LJ3j 2F5TX 3EFRA 5FU6C 4M7DF 2MF2A 1VQ6T 1RIQA 3VUBA 3G71A 1GGMA 2LVMA 4CH6A 1Y96B 1I81A 4YRPA 2L8DA 1S72A 3QSUA 4M78B 2YLCA 2RK1A 3H6ZA 1YJWA 1QVFA 4YRLA 1KMNA 4OVAA 4HT9A 4TQFA 2DPPB 1W2BS 3CCMA 4K87A 2AKWB 3CCRA 3HRIA 1Q81C 4HWTA 3R07A 2ZIOA 1GXIE 3UPUA 4EMKA 4WI1A 4M75D 4LDUA 3QZ9B 2L89A 4UPAA 2K5LA 3JB9I 4TVAB 3G7ZA 3V8KA 4QW2A 2GFAA 1PYSA 4XTYA 3IKLA 4ZTFA 4QVZA 4L5GA 2ARTA 3P8TA 5HKCA 1L0WA 2XKOC 1X55A 3BW1A 5GAN8 3S3MA 1QVGS 1QP3A 3RKYA 2R57A 1VQMA 3OYYA 3X26B 4ATOA 4QVCA 3M9QA 1JJ2A 1VQ7T 3RUXA 5C0MA 3CXCA 5CIUA 1VQOT 1WJSA 5IT9E 4YROA 5CCAA 4YTLA 2ZNJA 1N9SA 3DKMA 3M59A 4HT4A 5K1PA 5CKBA 2HNIA 1B8AA 5I2SA 4QVDA 2QQ9A 3HXWA 2D6FA 4K88A 5CO7A 4ZGEB 3CC2T 3UFGA 2XTIA 1G3TA 4M75F 2RI2A 2P0PA 4BE2A 4XTVA 1NPPA 4N4HA 3A31A 3MP1A 4M78D 2A8EA 2MMPA 4C0FA 4FIBA 2R5MA 4OB1B 3F70A 4N0AA 1DJ7B 2EQKA 3FB9A 3JCMe 3RESA 3A7UA 2DIGA 1NZ9A 5CAIA 2K3XA 5D6YA 4ZTUB 3DB4A 5CQYA 1OI1A 2I4OA 5CK9A 1M1KU 1JJCA 3QHSA 3REUA 3PCOB 4K86A 2E41A 3P8YA 3MP6A 3A74A 4D6WA 1KQ1A 2ZZDA 5GANg 3E19A 1U1TA 1W4SA 1N27A 2PMEA 3OYHA 1NJIU 3C12A 1M90U 1Y7XA 4PJOC 1SESA 4YRQA 4BACA 4XTZA 3P8BB 2KY9A 1V29B 4M78F 4XQ3A 4JS4A 2E3CA 2DXCA 3VUZA 2DK3A 1ADJA 2IY5A 4RCBA 3IKMB 5A0GA 2RJCA 4FM4B 1X01A 4RDXA 4OGCA 5AYFA 3M4QA 3A5ZB 4M78G 1RL2A 4UC4A 1FYFA 4RG2A 5ELOA 3QO7A 1E1OA 3A32A 4LNSA 2DVEA 3MEVA 5KCOA 4M77D 1M1KC 3OYFA 4CS2A 5C52B 4LDYA 3P8VA 3HFZA 3TEGA 1PSEA 2C06A 2RM4A 2DD5A 2H3JA 5M9OA 2LC4A 3QTCA 3DLLA 3R6OA 4UP8A 2ZT5A 2KQWA 1NJIC 3JCMV 3TEHA 5GAN6 4XTXA 5GMKe 1Q82U 2JZ2A 2KK4A 1YI2A 1Q7YC 2CS7A 2DTIA 5GMKh 2XHCA 4YYEA 5GAN5 3JB9G 4Y91A 1QVGA 2PQWA 4NCXA 3ICAA 4RG8A 3H8ZA 3JCMd 4C5EA 4CS4A 5C51B 1QW1A 4XTWA 3M4YA 1K9MU 4M77F 3RF1A 3FRNA 2YHTA 2K2VA 1G3WA 4FT4A 3HL8A 3W3SA 3G71T 5I2MA 2AHJB 1FX7A 3X25B 3O8VA 2QHSA 5DM7R 2LTOA 1M1GA 2LT1A 1S72T 3HXXA 3MO8A 1YJWT 2Q7HA 4AH6A 2DDZA 3HRTA 1ASZA 4LVKA 2Q5HA 1J5WA 1G3SA 3JAME 4GY5A 3JCMJ 4O6JA 5KE2A 3QJ6A 1NJ6A 3CCMT 3BDUA 1VQZA 3CCRT 2KAFA 1X56A 4H02A 3E9GA 3LLRA 1VQ8A 2RJDA 4EMHA 4L6V5 4BY6C 5KE3A 4YP0A 2P0KA 4X9CA 5GMKi 2FHDA 4M7AC 4H2XB 4F7UB 1WQWA 3QKJA 1EQRA 3JCMX 1KMMA 3CMQA 3L2RA 2DU5A 2F69A 4YRMA 2QQSA 3OY9A 1VQMT 4E7IA 3LWIA 5ELNA 2JTMA 3NTIA 5F5WA 1N9WA 4ELZC 1YIJA 2DU7A 2CYZB 5EG2A 3P8HA 3GF5A 2HQXA 2E70A 4II1A 4PL6A 1QVFS 2KSSA 3E9FA 4YRTA 4M78E 4LVLA 3LYIA 2CJAA 4M7DB 4CS3A 2E5AA 4YCVA 3HFVA 4FT2A 5GMKl 1M8VA 1B34B 2LRQA 4H2TA 2DZ9A 3CCSA 3MQZA 1Y96A 5LL6S 3LX7A 2K4YA 1X75C 2EQMA 2E6NA 4Z02A 3J7AF 3PFSA 4PJOD 3OB9A 1USYC 1G5HA 2KMTA 4KUIA 2RI5A 2DJZA 3META 2QQRA 2AKWA 1JJ2S 3CXCS 4P73A 3OMGA 2DEQA 2DXBA 3VQWA 4YRNA 1YFTA 4TVAA 3QYGB 5CR2A 1E1TA 3N5BB 2MAMA 3X20B 2EFIA 3MEYA 3LGLA 5HGQA 4BI4A 4ZN3A 4JUVA 3FC3A 4C8QC 1I8FA 4J8OA 2M16A 2EL9A 3JCMW 3CCQA 4WJ4A 1WJRA 4HWSA 5GMKj 4M7DD 2XDDA 3QO5A 4PJOF 1EVKA 3M54A 4M75B 4BUGA 2CZ0B 3VBBA 2D0QB 1NPRA 2QI2A 5C53B 5GAOn 4C92A 4F7UF 2ZZEA 3PGGA 1Y07A 2VXFA 4H2VA 4CH3A 4NL3A 3DSQA 2D9TA 2ZPEB 2P4TA 2J3LA 3QG1A 2QA4T 3HXVA 4BDZA 2HD0A 4HT8A 5L8RE 4YRSA 4BB7A 4F7UG 3OD1A 3ZEHA 2JVVA 2RD1A 4G85A 4YDQA 3Q1JA 1YI2T 2FVUA 2DTOA 3CMAA 4MDWA 3S3NA 3REXA 4EX5A 3CCJA 2JOYA 4MZTA 1N8RU 3PCOA 3SB2A 4C0DC 4OB0B 1KQSA 1X54A 4P71A 1LJOA 1VQNA 3GLXA 3V7SA 2K5FA 4C5IA 2ZNIA 2PUKB 3ME9A 4JRIA 2ZT7A 4X34A 4A54A 4M7DG 2EWNA 5C6SA 2MWPA 2EKOA 4XU2A 4RMOA 4C0ZA 2VUBA 2AMCB 3V7RA 5A2QE 3E9IA 4C0GA 2RHQB 2C7IA 5HY6A 4EMGA 2VXEA 4A4KA 1VIEA 3OYEA 4LD6A 3PMTA 3JCMg 1YITT 3SWNB 4M7AD 1VQKA 1BBUA 4JRKA 4EMKC 2KVQG 5GAMe 2B8AA 1YGBA 2RHSB 2E6ZA 1K73U 1ASYA 2ARSA 3OSVA 4YRIA 2LT4A 1VQ8T 2P0QA 3I55A 5KNNA 4QQGA 3PTAA 3X28B 3CPWS 2EYQA 4IUQA 2RK2A 2I4LA 3VV0A 3M57A 2QQBA 1MGQA 3GNFB 4C8QB 4E51A 4A4FA 2RB6A 3URGA 4PG3A 4YPFA 1Z7NA 4NS5A 4LVJA 3L42A 3A8HB 1YIJT 2XDPA 2M0OA 4M7AF 2ALYB 4P75A 4KR2A 4M77B 3M55A 4L59A 3RMQA 2DXUA 1QF6A 5I21A 4TVWA 5FRNA 3OYCA 3KUFA 4M75G 1OZ3A 2KDSA 4PHCA 2XK0A 3G6EA 5FROA 2LQ8A 2XU8A 2L5QA 4N0AC 3QIIA 3JCMh 1K73C 3QXEB 3A5YA 1Y71A 3CCST 3CC4T 4G84A 1B70B 2EJ9A 5D6XA 2VYTA 5FU6B 4UP9A 4C0DB 1BI2A 2ZPIB 4LDWA 4MDXA 4IURA 1UEBA 2GCXA 2M9UA 4RQFA 2V8KA 4F7UE 4P3PA 1FWZA 4MZMA 2LQKA 2ARUA 3OYMA 4Q5WA 4N4GA 1VQ5A 5GAOl 4ZN1A 2XIDA 3OS0A 4C8QD 2RJEA 2XDBA 2XICA 4J6YA 5GAMd 1VIFA 1H4VB 4N4IA 1YHQA 2QQAA 2FL7A 4PLIA 1KD1U 3LH0A 3FLGA 1W66A 2BUDA 4M7DE 4J6WA 2ZPBB 3L4GA 1G5VA 4PLLA 2XG8D 3CCQT 1NJ8A 1PYSB 5FU7C 3JB9J 3CMEA 3V7CA 1D3BB 3A8GB 1WLEA 4BE0A 2PU9B 4P3NA 1O9SA 2K3YA 2XI9A 2DAQA 1WYDA 1ATIA 4YRKA 4P74A 4LVMA 2VGMA 4UP7A 3OSSC 4PNOA 5IN1A 5HK0A 3UWNA 3BFMA 1K8AU 1M90C 4BWAA 12ASA 2DO3A 2VV5A 2FYKA 1B76A 4C8QF 4YRCA 3VQYA 1B34A 1X2HA 4LVIA 3CCLT 5GAOr 3MF1A 2LCCA 1ZQ1A 1WJQA 3CPWA 2PVDB 3LWHA 1KOGA 4C8QG 1BI0A 4TVRA 4Q15A 2JNGA 4Q6GA 3CMAT 5IAYA 3OMCA 3CCJT 4DA4A 2DXTA 2IVWA 1YCYA 4V2SA 2ZR2A 2V8IA 1VQ6A 3L2UA 2WSEE 1VQNT 3RACA 5LJ5e 4OB3B 3V8JA 4M77G 2E5QA 1WGSA 2DKGA 3X24B 3OW2A 2A7YA 5LJ5h 1JB0E 3QBYA 4DPGA 1JJCB 1BI3A 2ZT8A 3UGTA 1NJ5A 3VJPA 3OYIA 3L2WA 4M75E 4J6XA 5GAN3 2ZXFA 1HK9A 4M7AE 3S3OA 3TEEA 5J39A 1Q82C 3JCMf 4PJOB 4CRIA 1G51A 5LJ3e 4E7KA 1KC8U 4R56A 3QZ5B 1QP2A 3DLMA 3CCEA 1VUBA 1VQKT 4E7JA 4A4GA 2O4XA 3QJYA 4M75A 4FL6A 4B9XA 2IY5B 2E12A 1K9MC 2QHVA 1G3YA 3I55T 1UGQB 2QHTA 1EIYB 4P72A 2EJGA 1YFRA 1B7YB 4ZTZB 2ODRC 4RQEA 1KQSS 1VQ9A 1H4QA 3NETA 2BKDN 4RMFA 4BW9A 2RHYA 2ZPFB 3IALA 3HXUA 1ZBXA 2DQ0A 1YJNA 3PIPA 5GANd 2CZ6B 2OTJA 4J15A 3ZFJA 2QXFA 3TEHB 1N9RA 1YJ9A 1EFWA 3G6ET 3OYDA 4MMLA 4M78A 3MEUA 4J83A 4TWAA 3HP9A 2ZR3A 3FDRA 3VU3C 1M9SA 5LJ5d 1U8RA 2AMCA 1QVPA 2QDYB 4KBMB 1EIFA 3VYHB 3RKXA 1NYRA 1IREB 4RKUE 2WACA 4C8QE 3GIBA 1YBYA 4P73C 2P0LA 2RA2A 4JRQA 1VQ5T 2JN0A 5LJ3d 4HCCA 4P5NA 1NYQA 1XQHA 3ER0A 4NOYA 4C5GA 4O2DA 1YHQT 2MWOA 4M77E 2J3MA 4MMKA 3BJUA 4C5HA 1ZHIA 4KT0E 4BY6B 3RGLA 3TU4K 5LJ5f 4HCZA 2ZPGB 4IKFA 1WPYA 4M7AB 1HXDA 4OB2B 4J7FA 3OYKA 3RIRA 1M5Q1 1SERA 1C0AA 4B9WA 2QEXA 2EAYA 3CMET 4PJOG 3WVDB 2EQUA 2I4MA 3NFCA 3QYHB 4M77A 4C92C 5GAMg 2ZZFA 4E7LA 3PNWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K57 A;  1H64 1;  3JCM V;  2E10 A;  3TEH A;  4M7A F;  3LC0 A;  2ALY B;  4P75 A;  3HRK A;  4YRE A;  4KR2 A;  4M77 B;  3RER A;  2PMF A;  3HFO A;  5GAN 6;  4XTX A;  5GMK e;  2DXU A;  1BBW A;  1QF6 A;  3UH0 A;  2DTI A;  5I21 A;  5GMK h;  4TVW A;  3VQV A;  3TUP A;  4ZIB A;  4M75 G;  3INZ A;  4YYE A;  5GAN 5;  4OLF A;  3JB9 G;  2I2L A;  4Y91 A;  4HWO A;  4PHC A;  4NCX A;  2Q7G A;  4YCW A;  1YB3 A;  3ICA A;  1QE0 A;  3JCM d;  4N0A C;  4CS4 A;  3JCM h;  5C51 B;  3I7F A;  4CH5 A;  3A5Y A;  3UGQ A;  4XTW A;  2E64 A;  4M78 C;  4M77 F;  3RF1 A;  4G84 A;  3JCM b;  1B70 B;  2YHT A;  4JLI A;  2EJ9 A;  4P71 C;  4TVY A;  1H4S A;  4XU0 A;  3W3S A;  2I4N A;  1USY A;  2RHQ A;  4UP9 A;  4YCU A;  2QHS A;  4RQF A;  1LNX A;  4HWR A;  4F7U E;  4P3P A;  2CJ9 A;  1BIA A;  3HXX A;  2DQ3 A;  3SWN A;  2QTX A;  2CIM A;  11AS A;  3HSB A;  5GAN f;  5GAO m;  2Q7H A;  4AH6 A;  2DDZ A;  2ARU A;  5DY9 A;  2RHS A;  2ZCE A;  1ASZ A;  2Q5H A;  1J5W A;  4WF2 A;  2CGH A;  3HY1 A;  3SWN C;  2ZIN A;  2E65 A;  3JCM J;  5GAO l;  4TQD A;  1E24 A;  3A5Z A;  1NJ6 A;  4C8Q D;  3BDU A;  1VQZ A;  5GAO q;  4J6Y A;  5GAM d;  1I5L A;  5GAM h;  1H4V B;  1X56 A;  4H02 A;  4EMH A;  3MF2 A;  3LSQ A;  2ODR D;  1W66 A;  4YP0 A;  5GAN 7;  1WQ7 A;  4C8Q A;  3NEN A;  5GAO p;  4M7D E;  4X9C A;  5GMK i;  1YFS A;  3QNE A;  4C92 E;  4M7A C;  2YLB A;  4J6W A;  1HC7 A;  4H2X B;  4F7U B;  1D3B A;  1WQW A;  5GAN j;  5E3I A;  1EQR A;  3JCM X;  1KMM A;  4TTV A;  3HFN A;  3L4G A;  3CMQ A;  4KR3 A;  3G1Z A;  3NEL A;  1NJ2 A;  1NJ8 A;  2DU5 A;  1PYS B;  3JB9 J;  3V7C A;  1D3B B;  4YRM A;  1WLE A;  1JRI A;  1HTT A;  2ALY A;  5ELN A;  1LOJ A;  4P3N A;  3BY7 A;  2P5I A;  1WYD A;  1ATI A;  4YRK A;  3JCM c;  1LYL A;  4P74 A;  5F5W A;  1N9W A;  3RL6 A;  4UP7 A;  2DU7 A;  4PNO A;  4A53 A;  4M77 C;  4XEO A;  3BFM A;  5LJ3 f;  4BWA A;  1EVL A;  12AS A;  1Z7M A;  2FYK A;  2CJB A;  3LSS A;  2ZZG A;  3AHU A;  5LJ5 j;  1B76 A;  4H2Y A;  4YRT A;  4C8Q F;  3QO8 A;  4YRC A;  4CH4 A;  3WQZ A;  5GAN 4;  3VQY A;  4M78 E;  2CJA A;  1B34 A;  4P75 C;  2XGT A;  4M7D B;  5GMK m;  1X2H A;  4CS3 A;  5GAN 2;  2E5A A;  4YRG A;  4C92 B;  4YCV A;  5GAO r;  3MF1 A;  3HFV A;  1IL2 A;  2C8M A;  4WJ3 M;  3A7A A;  1WNL A;  4M7A G;  1KQ2 A;  4KQE A;  5GMK l;  3FJP A;  1M8V A;  1X2G A;  1SRY A;  1B34 B;  1B70 A;  4H2T A;  4XEM A;  1KOG A;  4C8Q G;  3JCM P;  2DZ9 A;  4Q15 A;  4NL2 A;  1NNH A;  4EO4 A;  4Q6G A;  4PJO E;  4DQ2 A;  1E22 A;  1Y96 A;  2DXT A;  4HA8 A;  5LJ3 j;  1YCY A;  3EFR A;  4V2S A;  4M7D F;  2ZR2 A;  3RKW A;  1SET A;  1RIQ A;  1WU7 A;  4L87 A;  1GGM A;  3RAC A;  5LJ5 e;  2VC8 A;  4CH6 A;  1Y96 B;  1I81 A;  1EOV A;  4YRP A;  3V8J A;  4PJO D;  4M77 G;  2DZC A;  1USY C;  2Q5I A;  2DKG A;  1G5H A;  3QSU A;  4M78 B;  2YLC A;  5LJ5 h;  5K1X A;  2ZT6 A;  2DJZ A;  4DPG A;  1JJC B;  2QHU A;  4YRL A;  1KMN A;  2ZT8 A;  1NJ5 A;  2AKW A;  3UGT A;  4HT9 A;  3KFU A;  4TQF A;  1H4T A;  4M75 E;  4P73 A;  4J6X A;  4HWP A;  4PJO A;  5GAN 3;  2ZXF A;  4H2W A;  3E9H A;  1HK9 A;  4M7A E;  3HXZ A;  4P3O A;  2DEQ A;  2ZTG A;  3VQW A;  4YRN A;  4K87 A;  2AKW B;  1YFT A;  3HRI A;  4HWT A;  2EJF A;  3R07 A;  2ZIO A;  4TVA A;  3JCM f;  4EMK A;  4PJO B;  4WI1 A;  1G51 A;  3NEM A;  4M75 D;  5LJ3 e;  4H2X A;  4RCC A;  3JB9 D;  4YRR A;  4F7U A;  1E1T A;  4UPA A;  3JB9 H;  3JB9 I;  3MEY A;  3HXY A;  4HVC A;  4TVA B;  5HGQ A;  4EMK B;  3V8K A;  1PYS A;  4XTY A;  2Y90 A;  5LJ5 g;  4JUV A;  3IKL A;  1EIY A;  4C8Q C;  4M75 A;  1B7Y A;  1I8F A;  2ART A;  3P8T A;  3PZC A;  2IY5 B;  1L0W A;  2EL9 A;  2QHV A;  3JCM W;  1X55 A;  4WJ4 A;  3BW1 A;  4HWS A;  2Q7E A;  5GMK j;  5GAN 8;  4M7D D;  3QO5 A;  2QHT A;  1EIY B;  4C92 D;  4PJO F;  4P72 A;  2EJG A;  3EFS A;  3V8L A;  3RKY A;  1EVK A;  4M75 B;  1B7Y B;  1YFR A;  4ZTZ B;  2ODR C;  4QVC A;  3IG2 A;  4RQE A;  3ERR A;  3RUX A;  2G4C A;  1H4Q A;  3L2Z A;  3VBB A;  4YRO A;  5C53 B;  4M7D A;  3NET A;  5GAO n;  1N9S A;  4C92 A;  4F7U F;  2ZNJ A;  2ZZE A;  4YRF A;  3PGG A;  2DTH A;  1I4K 1;  5K1P A;  5LJ3 g;  4P74 C;  2VXF A;  1B8A A;  2HNI A;  4QVD A;  4RMF A;  3HXW A;  4H2V A;  5GAM f;  4CH3 A;  4BW9 A;  4M7D C;  3A7R A;  4NL3 A;  4K88 A;  3DSQ A;  2J3L A;  3IAL A;  3UFG A;  5GAN e;  2XTI A;  3HXV A;  3HXU A;  4M75 F;  4HT8 A;  2DQ0 A;  3JB9 F;  4YRS A;  4J5Y A;  4F7U G;  3OD1 A;  4XTV A;  5GAN d;  5GAN h;  2ZIM A;  2RD1 A;  3A31 A;  4J15 A;  4M78 D;  4G85 A;  4YDQ A;  2DTO A;  4N0A A;  1NJ1 A;  3TEH B;  1N9R A;  3FB9 A;  1EFW A;  3JCM e;  3REX A;  3RES A;  3A7U A;  4EX5 A;  4MML A;  2FB7 A;  5CAI A;  3PCO A;  4ZTU B;  3SB2 A;  3QO3 A;  4M78 A;  4C92 F;  2I4O A;  1X54 A;  4X9D A;  2ZGW A;  4P71 A;  4TWA A;  5GAM j;  1LJO A;  2ZR3 A;  3V7S A;  1JJC A;  3QHS A;  3REU A;  2ZNI A;  3PCO B;  3VU3 C;  2E41 A;  4K86 A;  5LJ5 d;  2AMC A;  4JRI A;  3P8Y A;  2ZT7 A;  4A54 A;  3L1A A;  3A74 A;  4M7D G;  1KQ1 A;  2EWN A;  1BIB A;  5GAN g;  4C92 G;  3RKX A;  1U1T A;  1NYR A;  4XU2 A;  2AMC B;  4H2S A;  3V7R A;  1ADY A;  2PME A;  3E9I A;  2RHQ B;  4X5O A;  4C8Q E;  3GIB A;  3JCM Q;  2C7I A;  4P73 C;  4PJO C;  4EMG A;  1SES A;  4YRJ A;  2VXE A;  2P0L A;  4YRQ A;  4XTZ A;  3JCM g;  2RA2 A;  3VQX A;  4M78 F;  3SWN B;  4M7A D;  4XQ3 A;  1BBU A;  4JRK A;  2JN0 A;  4XU1 A;  5LJ3 d;  4EMK C;  5LJ3 h;  4XU3 A;  5GAM e;  1YGB A;  2E3C A;  2IY5 A;  1ADJ A;  2RHS B;  4RCB A;  3IKM B;  1NYQ A;  1X01 A;  1ASY A;  3FIF A;  4RDX A;  4NOY A;  3M4G A;  2ARS A;  4H2U A;  4YRI A;  4O2D A;  4OP0 A;  1G5I A;  4M77 E;  2J3M A;  4MMK A;  3M4Q A;  4M78 G;  4M7A A;  3BJU A;  3QUI A;  1FYF A;  3M4P A;  5ELO A;  5KNN A;  3RGL A;  3QO7 A;  4M75 C;  1E1O A;  1U1S A;  3A32 A;  5LJ5 f;  4LNS A;  2DVE A;  3HTZ A;  2I4L A;  4XTU A;  1WPY A;  4M7A B;  1HXD A;  4M77 D;  4P72 C;  1MGQ A;  4CS2 A;  3RIR A;  1M5Q 1;  4C8Q B;  1SER A;  1C0A A;  5C52 B;  4E51 A;  2E1H A;  2EAY A;  2RB6 A;  3P8V A;  3HFZ A;  1TH7 A;  4PJO G;  3TEG A;  2RM4 A;  4PG3 A;  2I4M A;  1JBM A;  3L4G B;  4YPF A;  3QTC A;  4M77 A;  4C92 C;  1Z7N A;  5GAM g;  2ZZF A;  3HY0 A;  3HFZ B;  4UP8 A;  2ZT5 A; 
#chains in the Genus database with same CATH topology
 1H64 1;  1RUW A;  2E10 A;  4KH0 B;  1WHJ A;  3HRK A;  3RER A;  2PMF A;  3KBG A;  2V26 A;  1VYV A;  1Q81 U;  1BBW A;  1X27 A;  4PJM A;  3I56 A;  3WXM B;  1NE8 A;  1JEG A;  5CKF A;  1AWW A;  3MEW A;  2QA4 Q;  4AT1 B;  2LCL A;  1VQ4 Q;  3EG2 A;  3PMI A;  3INZ A;  1OZ2 A;  3CBM A;  3M0R A;  4HWO A;  1OYX A;  1MMA A;  2Q7G A;  4YCW A;  1KD1 R;  1YB3 A;  3CC7 Q;  3JRZ A;  3TCJ A;  4ME7 A;  3I7F A;  4A4E A;  4CH5 A;  1VQL A;  5KH6 A;  2AKL A;  2O01 E;  2E64 A;  1D1C A;  1TTH B;  4JLI A;  2DIQ A;  4DOV A;  4P71 C;  2K5I A;  3CCV A;  2H3E B;  5IHN A;  4TVY A;  1H4S A;  4XU0 A;  3QDR B;  1UGR B;  5A0D A;  1I1J A;  2JMC A;  4YCU A;  4DBR A;  1X6B A;  4IUU A;  1LNX A;  2ECZ A;  4HWR A;  3SEM A;  3HKS A;  4BI8 B;  1BIA A;  1H3Z A;  2DQ3 A;  4PK4 A;  4LDX A;  1WYX A;  2QTX A;  3GPL A;  1AHJ B;  11AS A;  3HSB A;  2KNB B;  1OOT A;  2ZCE A;  1K8A R;  5CVI A;  4WF2 A;  2PVO B;  3HY1 A;  2DA9 A;  3OBW A;  1Q82 R;  4J9G A;  2E65 A;  2BZ8 A;  1UHC A;  2E4H A;  4TQD A;  3EG1 A;  2DE0 X;  1AOJ A;  4BDY A;  1E24 A;  1M2V A;  3A5Z A;  2FG0 A;  4XK8 E;  3C4S A;  2RHU A;  1BKB A;  5GAO q;  3R6N A;  1I5L A;  5GAM h;  3M0Q A;  1AWX A;  2X4J A;  5D6W A;  1YIT Q;  1GFC A;  2A28 A;  5HK3 A;  3OYA A;  3MF2 A;  2F5K A;  4LDV A;  3CCE T;  2ODR D;  1JXM A;  3SDZ A;  3NHN A;  1WQ7 A;  1OU8 A;  1YFS A;  1KIK A;  1N8R C;  3QNE A;  2YLB A;  1HC7 A;  3EAE A;  1D3B A;  2G3R A;  2HBP A;  1YNZ A;  4TTV A;  2CP0 A;  2OTL A;  4E47 A;  4KR3 A;  2HSP A;  5IXF A;  3G1Z A;  1G83 A;  3L2V A;  2RH2 A;  2X4W A;  1ZA1 B;  1PNJ A;  3EG3 A;  2DBM A;  3TSZ A;  3G4S A;  3CD6 A;  1Z9Q A;  4KUD K;  3BY7 A;  3HPW A;  3QPH A;  2R58 A;  3D7S B;  1VQ9 T;  2P5I A;  1R0B G;  2LDM A;  4FSS A;  3JCM c;  1M27 C;  2M1H A;  1K0S A;  2K9G A;  3MKD A;  3FJ5 A;  4D8K A;  4E7H A;  1W70 A;  2DNU A;  4XEO A;  3EFO A;  1EVL A;  1QKW A;  3OW2 S;  1Z7M A;  1ZSG A;  2CJB A;  2ZZG A;  1I0C A;  1V76 A;  3QO8 A;  4CH4 A;  1UGV A;  5J26 A;  5GAN 4;  3CC2 Q;  1KQS P;  1WHM A;  3OS5 A;  2XGT A;  4P75 C;  2OX7 A;  5GMK m;  4YRG A;  4C92 B;  2GQV A;  3A7A A;  3EH1 A;  2CT4 A;  1KC8 R;  5CKE A;  1YJN T;  1WNL A;  4M7A G;  1R8O B;  2K6D A;  1KQ2 A;  2HMA A;  1LVK A;  2GTJ A;  3FJP A;  1X2G A;  2RHX A;  3VKI A;  2OTJ T;  2RJF A;  1BYM A;  1N5Z A;  2KRO A;  3OYL A;  3JCM P;  4AG2 C;  3BDL A;  2ABL A;  2HL3 A;  4NL2 A;  1O75 A;  4EO4 A;  3OYJ A;  1YJ9 T;  4PJO E;  1M30 A;  4DQ2 A;  4PFO A;  2KXC A;  3M0T A;  3VS6 A;  1UGS B;  1BI1 A;  2Y4Y A;  1XOV A;  2FZC B;  1V1C A;  1D0Y A;  3RKW A;  1SET A;  1WU7 A;  4L87 A;  3PVQ A;  2EKH A;  1KSW A;  2VC8 A;  3CC4 Q;  1EOV A;  1XNI A;  3CCU A;  2KYB A;  2KYM A;  2DZC A;  1M4Z A;  2Q5I A;  3T9N A;  2YWW A;  1UEC A;  3NMZ C;  5K1X A;  3TSW A;  2ZT6 A;  2DMO A;  1PD0 A;  3ZBD A;  2QHU A;  1WHH A;  1RI0 A;  3KFU A;  2ZPH B;  1H4T A;  4HWP A;  3UT1 A;  4PJO A;  1M3A A;  3CPF A;  3DB3 A;  4H2W A;  3E9H A;  3HXZ A;  4P3O A;  4J9H A;  4Z8A A;  2ZTG A;  1RI9 A;  3VRZ A;  2EJF A;  4J9B A;  4FSX A;  4Y28 E;  1H92 A;  2M51 A;  3VYG A;  3OQ5 A;  4EDU A;  3NEM A;  4H2X A;  4RCC A;  3JB9 D;  2FO0 A;  1Q7Y U;  4F7U A;  4YRR A;  2EYW A;  3M0S A;  3JB9 H;  2GF7 A;  4LUD A;  2EQI A;  3HXY A;  4HVC A;  1ZUK A;  1IHV A;  4EMK B;  5KYX A;  2RHZ A;  4XAX B;  1ZLM A;  2MK5 A;  2Y90 A;  3EHR A;  5LJ5 g;  2R5A A;  1EIY A;  2GFU A;  1B7Y A;  3MP8 A;  3PZC A;  2FPF A;  1XTD A;  2J7I A;  2Q7E A;  2KRS A;  4C92 D;  2A36 A;  3EFS A;  3V8L A;  2F2W A;  2W10 A;  1PRM C;  4RTU A;  2RMO A;  4BI3 A;  2J6K A;  4WTO B;  5KCH A;  4PJL A;  3IG2 A;  3HRU A;  3ERR A;  3TQ7 P;  4AFZ C;  2G4C A;  2EQJ A;  3L2Z A;  3OS2 A;  1AVZ C;  3CCQ Q;  3G1J A;  3TRE A;  1VQP A;  2QEX T;  4M7D A;  4HCB A;  1W2B A;  1WX6 A;  2DIL A;  4YRF A;  1MHN A;  2DTH A;  1I4K 1;  2YXY A;  5LJ3 g;  4P74 C;  2YDL A;  4HVV A;  5GAM f;  1Q86 U;  4F04 B;  4M7D C;  3A7R A;  3ULR B;  5GAN e;  2PVG B;  3RMS A;  1K0X A;  1SSF A;  2QA4 A;  3M58 A;  2DVJ A;  1VQ4 A;  2NS6 A;  5L23 A;  2NLU A;  3JB9 F;  2MPX C;  4J5Y A;  2CP3 A;  2YRD A;  5GAN h;  2ZIM A;  3CC7 A;  3I56 T;  1VOM A;  4OF1 A;  5FLX E;  3CCL Q;  3OS1 A;  4QT7 A;  2CP2 A;  2Y4X A;  3A8L B;  3CBP A;  1KD1 C;  1NJ1 A;  1IZ6 A;  1RAI B;  1WHK A;  1VYT A;  3C94 A;  4HVU A;  2VGN A;  2LZ6 B;  3HHT B;  2LNH B;  1LPL A;  3SFM A;  4A4H A;  2FB7 A;  5CKD A;  1C0M A;  1WDX A;  3QO3 A;  4QQD A;  4C92 F;  4QQ6 A;  3EG9 A;  4X9D A;  2ZGW A;  3MJX A;  4JJC A;  2LNV A;  5GAM j;  2DL7 A;  2WSF E;  3VS3 A;  1VQL T;  3CCJ Q;  4O5V A;  4Y92 A;  4FYV B;  1IGQ A;  3L1A A;  3M0P A;  5DLQ E;  3CCV T;  4JRP A;  4IUT A;  1BIB A;  4C92 G;  4IUP A;  3A8M B;  4VUB A;  3NTK A;  4B6M A;  4H2S A;  3OA6 A;  3E1S A;  4HVW A;  1ADY A;  4HKE A;  2KRM A;  5CQX A;  3H41 A;  1K8A C;  4BE1 A;  1YJW Q;  2YRV A;  4X5O A;  4PKC C;  1KHI A;  1CKA A;  3JCM Q;  4F17 A;  5KYU B;  4YRJ A;  1N6A A;  3GOX A;  1RAG B;  3JV3 A;  1Q86 C;  3VQX A;  1YIT A;  4PJJ A;  1Q81 R;  2BIV A;  2QAS A;  4XU1 A;  3CCM Q;  5LJ3 h;  2EGE A;  4XU3 A;  3CCR Q;  3OYB A;  1G8X A;  2GGR A;  3FIF A;  2FZG B;  3M4G A;  4H2U A;  4J7I A;  4OML A;  1N8R R;  2AZS A;  3UDC A;  4OP0 A;  1G5I A;  1PSF A;  4LD9 K;  4M7A A;  4FU6 A;  3GP8 A;  3QUI A;  3M4P A;  3NTH A;  3M53 A;  4M75 C;  1U1S A;  4CC4 B;  3JSC A;  3C95 A;  5KYW A;  3HTZ A;  4XTU A;  1VQ7 A;  1VQO A;  2MI6 A;  2L3R A;  4P72 C;  3OYG A;  2OTL T;  3WVE B;  3KXT A;  1ARK A;  2E1H A;  4J9D A;  2MIO A;  2PUO B;  1TH7 A;  1VQM Q;  5FU7 B;  2X4Y A;  1EFN A;  3CPW P;  1MMD A;  1WHL A;  3G4S T;  3CD6 T;  2DD4 A;  3L4G B;  1JBM A;  4AG1 C;  3OBY A;  2DX1 A;  2AIR B;  2LQW A;  3HY0 A;  3CC2 A;  2LJ0 A;  1HJD A;  3HFZ B;  3J80 E;  2K7A A;  1YCS B;  2K57 A;  2ENM A;  3LC0 A;  4OMM A;  4YRE A;  4JLG A;  2HQH A;  3HFO A;  1SSH A;  1RAH B;  4R55 A;  3UH0 A;  2ZCF B;  1KC8 C;  2X4X A;  2WSC E;  4RTX A;  2RO0 A;  1X6O A;  3FEO A;  1M2O A;  3VQV A;  3TUP A;  4ZIB A;  4OLF A;  2I2L A;  1BU1 A;  1TUD A;  1MND A;  2LX9 A;  4OGE A;  2HL5 C;  4M4Z A;  4CC3 A;  1ZX6 A;  1QE0 A;  3OW2 P;  4FYX B;  3CBO A;  2EIF A;  2GBQ A;  1U06 A;  2FPD A;  4JDS A;  3I5S A;  1F1B B;  1RAD B;  5FWC A;  3UGQ A;  3A98 A;  3CC4 A;  1AZE A;  4M78 C;  4LN2 A;  1UJY A;  3JCM b;  1TS9 A;  2V8J A;  2ATC B;  2X35 A;  3MCA B;  1M1F A;  4IUV A;  4ELY C;  2IG0 A;  4OMF B;  2I4N A;  1UB4 A;  1USY A;  2RHQ A;  3MEA A;  3MHX A;  3LW5 E;  4IIM A;  2NUT A;  2NUP A;  1WHG A;  1JQQ A;  3CCU T;  1U5S A;  2HAX A;  2CJ9 A;  5FRM A;  1KG1 A;  1B07 A;  3PT9 A;  3SWN A;  1OUL A;  3TVT A;  2JTF A;  2CIM A;  1K1Z A;  3QWX X;  3L2Q A;  5GAN f;  2X9H A;  5GAO m;  2RHS A;  5DY9 A;  1KHC A;  1UJ0 A;  2CGH A;  3SWN C;  2CKK A;  2JM8 A;  2ZIN A;  1UGP B;  1SEM A;  2A3L A;  2F1L A;  3PIO A;  5GJV B;  2JS2 A;  3GNG A;  4LE9 A;  2RHI A;  2HBW A;  4DOW A;  2DM1 A;  4KUL A;  5DLO A;  1TG0 A;  3OYN A;  1VQ5 Q;  3CEY A;  3UA7 A;  1K76 A;  3LSQ A;  2RN8 A;  2OAU A;  2EYY A;  4ZGJ B;  5GAN 7;  4C8Q A;  1TXQ A;  3J81 E;  3NEN A;  3S6W A;  5GAO p;  5KYY A;  4C92 E;  4ZTJ A;  1SKU B;  2RI3 A;  2HQE A;  5E3I A;  5GAN j;  4EPC A;  1VA7 A;  4JS5 A;  4GLK A;  3HFN A;  1P92 A;  3NEL A;  1NJ2 A;  4MZP A;  2EVR A;  1BCM A;  2O9V A;  2O4X B;  4FYW B;  3LGF A;  1JRI A;  3O5Z A;  1HTT A;  5J3B A;  2ALY A;  4JJN K;  1LOJ A;  2JUF A;  4EIK A;  4ZGD B;  1E7O A;  2F2X A;  2DL5 A;  1LYL A;  3ASK A;  3RL6 A;  1VQP T;  1D1A A;  3CME Q;  4CI0 C;  4ESR A;  5CKH A;  4A53 A;  4M77 C;  2CZ1 B;  2JTE A;  1W6X A;  2K3B A;  5LJ3 f;  3LSS A;  3AHU A;  5LJ5 j;  1GRI A;  4H2Y A;  3WQZ A;  3P8D A;  3M56 A;  4E7S A;  4RUG A;  1D0X A;  2CZ7 B;  2VAS A;  3VS5 A;  2O9S A;  5GAN 2;  3CCL A;  3HRS A;  2XD0 A;  1IL2 A;  1VQ4 T;  3A8O B;  2C8M A;  4WJ3 M;  5A0L A;  2LX7 A;  2K79 A;  4KQE A;  1SRY A;  1B70 A;  1PRL C;  3CC7 T;  1FXX A;  4XEM A;  1YI2 Q;  1OX9 A;  4BD3 A;  2DLP A;  1NNH A;  1GL5 A;  3CQT A;  3M5A A;  1ZSZ B;  4ORZ A;  3SD4 A;  1E22 A;  4AFU C;  1D09 B;  4HA8 A;  5LJ3 j;  1QKX A;  2F5T X;  3EFR A;  5FU6 C;  4M7D F;  4OMO A;  2MF2 A;  1VQ6 T;  1RIQ A;  2HZY A;  3VUB A;  3G71 A;  1HD3 A;  1GGM A;  2LVM A;  4CH6 A;  1Y96 B;  2DRK A;  1I81 A;  4YRP A;  2L8D A;  1S72 A;  3QSU A;  4M78 B;  2YLC A;  2RK1 A;  4D8D A;  3H6Z A;  1YJW A;  1QVF A;  1OU9 A;  4YRL A;  1KMN A;  4OVA A;  4HT9 A;  4TQF A;  1Q86 R;  2CH4 A;  2DPP B;  1W2B S;  3EHQ A;  3CCM A;  1NYG A;  4K87 A;  2AKW B;  3CCR A;  3HRI A;  1Q81 C;  4HWT A;  3R07 A;  4J9E A;  2ZIO A;  1GXI E;  3UPU A;  2G6F X;  4EMK A;  4WI1 A;  2DF6 A;  4M75 D;  2L3Q A;  4LDU A;  3QZ9 B;  2L89 A;  4UPA A;  2RQU A;  2MOX A;  1Q95 G;  1XJW B;  2K5L A;  3JB9 I;  4TVA B;  2LJ3 A;  3G7Z A;  2QAZ A;  3V8K A;  1AWO A;  3IQL A;  4QW2 A;  2GFA A;  1PYS A;  4XTY A;  3IKL A;  4ZTF A;  1VQ8 Q;  4QVZ A;  4E6R A;  1VYU A;  4L5G A;  2ART A;  3P8T A;  5HKC A;  1L0W A;  2XKO C;  1X55 A;  3BW1 A;  5GAN 8;  3S3M A;  4F14 A;  1QVG S;  1RAE B;  1QP3 A;  3RKY A;  2R57 A;  1VQM A;  3OYY A;  2CUB A;  3X26 B;  4ATO A;  4QVC A;  4FW2 A;  2LMJ A;  1R0C B;  3M9Q A;  5GJW B;  1JJ2 A;  1VQ7 T;  3RUX A;  2DJQ A;  4Z89 A;  5C0M A;  3CXC A;  5CIU A;  1VQO T;  1NBE B;  1WJS A;  1NEB A;  1A0N B;  5IT9 E;  4YRO A;  5CCA A;  4YTL A;  2ZNJ A;  1N9S A;  3DKM A;  1ABQ A;  3M59 A;  4HT4 A;  5K1P A;  1TSF A;  5CKB A;  2HNI A;  1B8A A;  5I2S A;  4QVD A;  2PNI A;  2QQ9 A;  3HXW A;  2QTV A;  1QQJ A;  1IO6 A;  1VQ9 Q;  2D6F A;  4K88 A;  5CO7 A;  4ZGE B;  3CC2 T;  1GBQ A;  1YIJ Q;  3UFG A;  2XTI A;  1FMK A;  1NYF A;  1G3T A;  4M75 F;  2RI2 A;  1YFN A;  2X3W D;  2P0P A;  4BE2 A;  4XTV A;  1NPP A;  4N4H A;  3A31 A;  3MP1 A;  4M78 D;  2A8E A;  2MMP A;  3UA6 A;  4C0F A;  3RNJ A;  4FIB A;  2R5M A;  4OB1 B;  2EBP A;  3F70 A;  4N0A A;  1DJ7 B;  2EQK A;  3FB9 A;  4PFZ A;  3JCM e;  1YJN Q;  3RES A;  1WIE A;  3A7U A;  2DIG A;  2KT1 A;  2YUO A;  1NZ9 A;  5CAI A;  2K3X A;  5D6Y A;  4ZTU B;  3DB4 A;  5CQY A;  1OI1 A;  2I4O A;  5CK9 A;  1TUC A;  3SHW A;  5IHI A;  1M1K U;  3CCS Q;  4KRT A;  1JJC A;  3QHS A;  3REU A;  3PCO B;  4K86 A;  2E41 A;  3P8Y A;  3MP6 A;  3A74 A;  4D6W A;  1KQ1 A;  1YN8 A;  2ZZD A;  1MMG A;  5GAN g;  3E19 A;  1U1T A;  2KR3 A;  1MV3 A;  2YUN A;  4QKU A;  1W4S A;  4PFP A;  1Z9Z A;  5KYU A;  1N27 A;  2YT6 A;  1NM7 A;  2PME A;  3OYH A;  2KT8 A;  1NJI U;  1C6V X;  3C12 A;  3H0F A;  1M90 U;  1Y7X A;  5AT1 B;  4PJO C;  1SES A;  4YRQ A;  4BAC A;  4HXJ A;  1SRL A;  4XTZ A;  3P8B B;  2KY9 A;  2BE9 B;  1V29 B;  4M78 F;  1GCP A;  1UTI A;  3EGX A;  4XQ3 A;  1RAA B;  4JS4 A;  2E3C A;  2DXC A;  3VUZ A;  2DK3 A;  1ADJ A;  2IY5 A;  4RCB A;  3IKM B;  5A0G A;  2RJC A;  1OQK A;  4FM4 B;  1X01 A;  2D0N A;  2EW3 A;  2M0Y A;  4RDX A;  4OGC A;  1YWP A;  5AYF A;  2PTK A;  3M4Q A;  3A5Z B;  4M78 G;  1RL2 A;  2L2P A;  4UC4 A;  1FYF A;  4RG2 A;  5ELO A;  3QO7 A;  1E1O A;  4KGV B;  1RAB B;  3A32 A;  4LNS A;  4OMN A;  2DVE A;  3MEV A;  1QCN A;  1PWT A;  4ZNX A;  2EGC A;  5KCO A;  4M77 D;  2HDA A;  1M1K C;  3OYF A;  4CS2 A;  2P84 A;  1IGU A;  5C52 B;  2IPO B;  4LDY A;  3P8V A;  2F2V A;  3HFZ A;  3TEG A;  1PSE A;  2C06 A;  2RM4 A;  1RLP C;  2DD5 A;  2H3J A;  5M9O A;  4K11 A;  2LC4 A;  1UG1 A;  3QTC A;  3DLL A;  2ROT A;  4Z88 A;  4LUE A;  3R6O A;  4UP8 A;  2ZT5 A;  2KQW A;  1NJI C;  2HKQ B;  3JCM V;  3TEH A;  1ZUY A;  9ATC B;  5GAN 6;  4XTX A;  5GMK e;  2FRY A;  1Q82 U;  1AEY A;  2JZ2 A;  3VS2 A;  2KK4 A;  1YI2 A;  1Q7Y C;  2CS7 A;  1K4U S;  2DTI A;  5GMK h;  1KJW A;  3EFO B;  2XHC A;  4YYE A;  5GAN 5;  3JB9 G;  4Y91 A;  1B3Q A;  1QVG A;  2PQW A;  2H8H A;  4NCX A;  3ICA A;  1PC0 A;  4RG8 A;  3H8Z A;  3JCM d;  4C5E A;  4CS4 A;  2C0O A;  4CC7 A;  5D7U A;  5C51 B;  1H3H A;  1QW1 A;  8AT1 B;  2VKN A;  3CMA Q;  1OX8 A;  4XTW A;  3M4Y A;  1K9M U;  4M77 F;  3RF1 A;  3FRN A;  1UE9 A;  2YHT A;  2DET A;  2K2V A;  1G3W A;  4FT4 A;  3HL8 A;  2FPE A;  3W3S A;  4JJD A;  2BZY A;  2J6F A;  1VQN Q;  1EX4 A;  3G71 T;  2VB6 A;  5I2M A;  2AHJ B;  3RDV A;  1FX7 A;  3X25 B;  1VQL Q;  2RNA A;  3O8V A;  2QHS A;  5DM7 R;  2QG9 B;  2LTO A;  1M1G A;  2LT1 A;  1S72 T;  3HXX A;  2FZK B;  3CCV Q;  3QWY A;  3MO8 A;  1UHF A;  1YJW T;  2Q7H A;  4AH6 A;  2DDZ A;  3HRT A;  1ASZ A;  4LVK A;  1E6G A;  1M3C A;  2Q5H A;  1J5W A;  1G3S A;  3JAM E;  2E3I A;  4GY5 A;  3JCM J;  4O6J A;  5KE2 A;  3QJ6 A;  1NJ6 A;  2W0Z A;  3CCM T;  3BDU A;  1VQZ A;  3CCR T;  2A08 A;  4RTV A;  3PVL A;  3I9Q A;  4JZ4 A;  2KAF A;  1X56 A;  4H02 A;  2DER A;  3E9G A;  1YWO A;  3LLR A;  1VQ8 A;  1MUZ A;  2RJD A;  4EMH A;  1VQK Q;  4L6V 5;  4BY6 C;  5KE3 A;  1C1A A;  1FMW A;  1J3T A;  1AD5 A;  4YP0 A;  2P0K A;  1W2B P;  4X9C A;  5GMK i;  4RTY A;  2FHD A;  4M7A C;  1JU5 C;  2RF0 A;  4H2X B;  1ZBJ A;  1QCO A;  4F7U B;  1AZG B;  1WQW A;  2OI3 A;  3QKJ A;  1EQR A;  3JCM X;  1KMM A;  1Y0M A;  1PG5 B;  3CMQ A;  1JO8 A;  2E5K A;  3L2R A;  2RQV A;  3AT1 B;  3I55 Q;  5FWB A;  5KYX B;  2DU5 A;  3EG0 A;  2F69 A;  3H9N A;  4YRM A;  2QQS A;  1PD1 A;  3EH2 A;  3OY9 A;  1VQM T;  4E7I A;  3LWI A;  5ELN A;  4A63 B;  2JTM A;  2YRC A;  1K9A A;  3NTI A;  5F5W A;  1N9W A;  4ELZ C;  1YIJ A;  2DU7 A;  2CYZ B;  5EG2 A;  3P8H A;  1KK7 A;  3GF5 A;  3G4S Q;  2HQX A;  2CDT A;  2E70 A;  4II1 A;  4PL6 A;  1QVF S;  2KSS A;  3E9F A;  4YRT A;  4M78 E;  4LVL A;  3LYI A;  2CJA A;  1QWE A;  4M7D B;  4CS3 A;  2E5A A;  4PJN A;  4YCV A;  1QWF A;  3HFV A;  4FT2 A;  5GMK l;  2GNC A;  2JW4 A;  1M8V A;  1B34 B;  1ZSZ A;  2BTT A;  2LRQ A;  4H2T A;  3RR6 A;  1CKB A;  4R0K A;  2CP5 A;  2DZ9 A;  4ANJ A;  2LJ1 A;  4GLM A;  3CCS A;  4RTT A;  5EC7 A;  3MQZ A;  3G6E Q;  4KGZ B;  1Y96 A;  5LL6 S;  3VS0 A;  3LX7 A;  1YP5 A;  2O31 A;  2K4Y A;  1X2Q A;  1X75 C;  2EQM A;  2E6N A;  4Z02 A;  3J7A F;  1SPK A;  3PFS A;  2L3P A;  4PJO D;  2YUP A;  3KFV A;  3OB9 A;  1USY C;  4DBH A;  1G5H A;  2J05 A;  2KMT A;  3EG9 B;  2ROL A;  4KUI A;  2RI5 A;  1JXO A;  2DJZ A;  3MET A;  1I5O B;  2QQR A;  4GBQ A;  2LQN A;  1JJ2 S;  2AKW A;  3CXC S;  3CCU Q;  4P73 A;  3OMG A;  2DEQ A;  2DXB A;  4OMP A;  2MYS A;  3VQW A;  4YRN A;  1YFT A;  4TVA A;  1WLP B;  3QYG B;  5CR2 A;  4J9F A;  3EGD B;  2EGA A;  1E1T A;  3N5B B;  2MAM A;  3X20 B;  2EFI A;  3MEY A;  3LGL A;  5HGQ A;  4BI4 A;  4ZN3 A;  1FYN A;  4JUV A;  1PKS A;  2ZAE A;  2FEI A;  1YHQ Q;  3FC3 A;  4C8Q C;  1I8F A;  4J8O A;  2COW A;  1SG5 A;  1WXU A;  2M16 A;  2EL9 A;  3JCM W;  3CCQ A;  4WJ4 A;  1WJR A;  4HWS A;  5GMK j;  1M1K R;  4M7D D;  2XDD A;  3QO5 A;  4PJO F;  1EVK A;  3M54 A;  4M75 B;  4BUG A;  2JXB A;  2CH4 W;  4RTW A;  2C0I A;  2NYS A;  2KI7 A;  2CZ0 B;  2NUZ A;  3VBB A;  1RLQ C;  2D1X A;  2D0Q B;  1NPR A;  2QI2 A;  1WA7 A;  5C53 B;  2QYZ A;  5GAO n;  4C92 A;  4F7U F;  2ZZE A;  3EGU A;  3PGG A;  2CP7 A;  4DBF A;  1Y07 A;  2VXF A;  1NJI R;  2V1R A;  4H2V A;  4CH3 A;  1M90 R;  4NL3 A;  3DSQ A;  2D9T A;  2ZPE B;  2P4T A;  2J3L A;  4AMC A;  2BE7 D;  2BZX A;  3QG1 A;  2QA4 T;  3HXV A;  2HCK A;  4BDZ A;  2COZ A;  2HD0 A;  4HT8 A;  5L8R E;  4YRS A;  1Q7Y R;  3U23 A;  4BB7 A;  4F7U G;  1X6G A;  3OD1 A;  3ZEH A;  2JVV A;  2RD1 A;  1EZZ B;  1UDL A;  4G85 A;  4YDQ A;  1WXB A;  3Q1J A;  1YI2 T;  2FVU A;  2JM9 A;  2DTO A;  3CMA A;  4MDW A;  3S3N A;  1HYO A;  2CRE A;  3REX A;  4EX5 A;  3CCJ A;  2JOY A;  4MZT A;  2RQW A;  1N8R U;  3PCO A;  2KRN A;  3SB2 A;  4C0D C;  4OB0 B;  1KQS A;  1X54 A;  7AT1 B;  2YSQ A;  1IRX A;  4P71 A;  1LJO A;  1VQN A;  4IIO A;  3GLX A;  3V7S A;  2K5F A;  4C5I A;  2ZNI A;  1IXD A;  2PUK B;  3ME9 A;  4JRI A;  2ZT7 A;  4X34 A;  4A54 A;  2AT1 B;  1VQ6 Q;  4M7D G;  2EWN A;  2NWM A;  5C6S A;  2MWP A;  4FCY A;  2HSE B;  2EKO A;  4XU2 A;  2XMF A;  4RMO A;  4C0Z A;  2VUB A;  2AMC B;  3V7R A;  5A2Q E;  3E9I A;  4C0G A;  2RHQ B;  2JS0 A;  1GCQ A;  2CUD A;  2C7I A;  5HY6 A;  4EMG A;  2VXE A;  4A4K A;  1VIE A;  2NUT B;  3OYE A;  2NUP B;  4LD6 A;  3PMT A;  3JCM g;  4J9I A;  1YIT T;  1GCQ C;  2DFU A;  3SWN B;  2JT4 A;  4M7A D;  1OPK A;  1VQK A;  1BBU A;  4JRK A;  4EMK C;  2KVQ G;  5GAM e;  2B8A A;  1B7T A;  1YGB A;  1UUE A;  2RHS B;  2E6Z A;  3A1P A;  1K73 U;  1ASY A;  2ARS A;  3OSV A;  3UAT A;  2SEM A;  4YRI A;  2LT4 A;  1VQ8 T;  2P0Q A;  3CCE Q;  5IHK A;  2AZV A;  3I55 A;  2KBT A;  5KNN A;  4QQG A;  3PTA A;  3X28 B;  3CPW S;  2EYQ A;  2DEU A;  1K9M R;  4IUQ A;  2RK2 A;  2I4L A;  2X3X D;  3VV0 A;  3NPF A;  3M57 A;  4KH1 B;  2QQB A;  1MGQ A;  3GNF B;  4C8Q B;  2L0A A;  4E51 A;  5ECA A;  5KYY B;  4A4F A;  1D1B A;  2RB6 A;  3URG A;  1QLY A;  3NGP A;  4FW1 A;  2KGT A;  4X1V A;  1WZO A;  4PG3 A;  1VQ7 Q;  4YPF A;  1VQO Q;  1Z7N A;  4NS5 A;  4LVJ A;  3L42 A;  3A8H B;  4AFQ C;  1YIJ T;  2XDP A;  2M0O A;  1CSK A;  4M7A F;  2ALY B;  4P75 A;  1E6H A;  2DYI A;  4KR2 A;  4M77 B;  1AT1 B;  3M55 A;  2C0T A;  4L59 A;  3RMQ A;  2VVK A;  2DXU A;  1QF6 A;  6AT1 B;  5I21 A;  4F16 A;  3H0H A;  4TVW A;  5FRN A;  3OYC A;  3KUF A;  2RPN A;  4M75 G;  1OZ3 A;  3M0U A;  2KDS A;  4PHC A;  2XK0 A;  4RTZ A;  5FRO A;  3G6E A;  2QDL A;  2LQ8 A;  1PCX A;  2OTJ Q;  2XU8 A;  2L5Q A;  4N0A C;  3QII A;  3JCM h;  1K73 C;  3QXE B;  1NG2 A;  1QVF P;  1SHG A;  1SRM A;  4E2F B;  3A5Y A;  1PHT A;  1Y71 A;  1YJ9 Q;  3CCS T;  3CC4 T;  4G84 A;  1T0J A;  1B70 B;  2EJ9 A;  5D6X A;  2VYT A;  5IXB A;  3BE3 A;  4CC2 A;  2MCN A;  5FU6 B;  4UP9 A;  4C0D B;  2V1Q A;  1BI2 A;  2ZPI B;  4LDW A;  4MDX A;  4IUR A;  1UEB A;  4JJB A;  2GCX A;  2M9U A;  4RQF A;  2V8K A;  2CP6 A;  4F7U E;  4P3P A;  1FWZ A;  2D8J A;  2SRC A;  4MZM A;  2LQK A;  2ARU A;  2PZ1 A;  3OYM A;  4Q5W A;  2IIM A;  2D8H A;  4JZ3 A;  1WXT A;  4N4G A;  2JMA A;  1VQ5 A;  4JPB W;  5GAO l;  4ZN1 A;  2XID A;  3OS0 A;  2RQT A;  4C8Q D;  2RJE A;  2XDB A;  2XIC A;  1D0Z A;  3VRY A;  4J6Y A;  2CSQ A;  5GAM d;  1VIF A;  1H4V B;  2KEA A;  1ZA2 B;  4N4I A;  1YHQ A;  2QQA A;  4OMQ A;  1M2V B;  1JJ2 P;  2FL7 A;  4PLI A;  3CXC P;  1KD1 U;  3THK A;  3LH0 A;  3FLG A;  1W66 A;  1RAC B;  2BUD A;  4M7D E;  4J6W A;  2O88 A;  2FRW A;  1PM3 A;  2ZPB B;  1H8K A;  3L4G A;  2J6O A;  2ED1 A;  1G5V A;  2X51 A;  4PLL A;  3I35 A;  2XG8 D;  3CCQ T;  1NJ8 A;  2M02 A;  1PYS B;  2KE9 A;  5FU7 C;  3JB9 J;  4FYY B;  3CME A;  3V7C A;  1D3B B;  3A8G B;  3ZL7 C;  1T3S A;  4BE0 A;  1WLE A;  1SHF A;  2PU9 B;  4P3N A;  1O9S A;  2K3Y A;  2XI9 A;  1IHW A;  2DAQ A;  1WYD A;  1ATI A;  4YRK A;  1MMN A;  4P74 A;  2QEX Q;  4LVM A;  2VGM A;  4UP7 A;  1NEG A;  3OSS C;  4PNO A;  1LCK A;  5IN1 A;  5HK0 A;  3UWN A;  3BFM A;  1K8A U;  1M90 C;  4BWA A;  12AS A;  2DO3 A;  2VV5 A;  2FYK A;  3MPU B;  1RAF B;  1TOV A;  1B76 A;  2RQR A;  4C8Q F;  4YRC A;  3VQY A;  1B34 A;  1X2H A;  4LVI A;  3CCL T;  2COY A;  3UF4 A;  5GAO r;  3MF1 A;  2LCC A;  1ZQ1 A;  4AFS C;  1WJQ A;  3CPW A;  2PVD B;  1BBZ A;  3LWH A;  3I56 Q;  2EYZ A;  2YUQ A;  2HEQ A;  4C8Q G;  1KOG A;  1BI0 A;  2QK0 A;  4TVR A;  1G2B A;  4Q15 A;  3REB B;  2JNG A;  4Q6G A;  3CMA T;  5IAY A;  5FW9 A;  3OMC A;  3CCJ T;  4DA4 A;  1PKT A;  2DXT A;  2EPD A;  2IVW A;  1YCY A;  4V2S A;  2ZR2 A;  3H0I A;  2V8I A;  2I0N A;  4DBQ A;  2DRM A;  1VQ6 A;  3L2U A;  2WSE E;  1ACM B;  1VQN T;  3RAC A;  5LJ5 e;  4OB3 B;  2EYX A;  3V8J A;  4M77 G;  3E2U A;  2E5Q A;  1WGS A;  1X43 A;  2DKG A;  3X24 B;  3OW2 A;  2A7Y A;  5LJ5 h;  1HSQ A;  1JB0 E;  3QBY A;  3G71 Q;  4DPG A;  1JJC B;  1BI3 A;  2ZT8 A;  3UGT A;  1NJ5 A;  3VJP A;  1QCF A;  3OYI A;  3L2W A;  4M75 E;  4J6X A;  2DL4 A;  2A37 A;  5GAN 3;  3EGD A;  4E7Z A;  2ZXF A;  1S72 Q;  1HK9 A;  4M7A E;  3S3O A;  3TEE A;  5J39 A;  2CT3 A;  4DEY A;  3GBQ A;  1Q82 C;  3JCM f;  4PJO B;  4CRI A;  1G51 A;  3RBB B;  2K2M A;  5LJ3 e;  4E7K A;  1KC8 U;  4R56 A;  1W1F A;  3QZ5 B;  1QP2 A;  3DLM A;  3CCE A;  1VUB A;  1VQK T;  4E7J A;  1TWB A;  4A4G A;  1OEB A;  1MV0 B;  2ESW A;  2O4X A;  3QJY A;  1TUG B;  3EGX B;  4M75 A;  4FL6 A;  4B9X A;  1T0H A;  2IY5 B;  2E12 A;  3VS4 A;  1K9M C;  2QHV A;  1G3Y A;  3I55 T;  2DL8 A;  1UGQ B;  2QHT A;  1EIY B;  5IH2 A;  4P72 A;  2EJG A;  1YFR A;  1B7Y B;  4ZTZ B;  1OV3 A;  1WI7 A;  2ODR C;  3PE0 A;  4RQE A;  1KQS S;  1X2K A;  2OTL Q;  1VQ9 A;  1H4Q A;  1BK2 A;  3NET A;  1WFW A;  3CD6 Q;  2KXD A;  2DBK A;  3REA B;  1QVG P;  1M8M A;  1OPL A;  2BKD N;  2QGF B;  1KFZ A;  4RMF A;  4BW9 A;  8ATC B;  2RHY A;  2ZPF B;  3IAL A;  3HXU A;  1NLO C;  1ZBX A;  2DQ0 A;  1YJN A;  4LNP A;  3PIP A;  5GAN d;  2CZ6 B;  1GBR A;  1ABO A;  1AWJ A;  2OTJ A;  1Y57 A;  3ZFJ A;  4J15 A;  1BCO A;  5I11 A;  2QXF A;  1K73 R;  1ZSZ C;  3TEH B;  2LP5 A;  1N9R A;  1YJ9 A;  1U3O A;  1EFW A;  1R77 A;  5I22 A;  4LXC A;  3G6E T;  3OYD A;  2Z0W A;  4MML A;  2GQI A;  4M78 A;  3MEU A;  4J83 A;  4J9C A;  4TWA A;  3HP9 A;  4DEX A;  2ZR3 A;  1T3L A;  1IB8 A;  3FDR A;  3VU3 C;  2P4R A;  1M9S A;  5LJ5 d;  1U8R A;  1QVP A;  2AMC A;  2QDY B;  4KBM B;  1EIF A;  3I5R A;  4WCI A;  3VYH B;  1SF9 A;  1X69 A;  3RKX A;  1NYR A;  1MNE A;  1IRE B;  2ED0 A;  2OAW A;  3C0C A;  2L3S A;  4RKU E;  2JJ9 A;  2WAC A;  2AKK A;  4C8Q E;  3GIB A;  1YBY A;  2AK5 A;  4P73 C;  2P0L A;  2QGG A;  3LH5 A;  2RA2 A;  3QDF A;  4JRQ A;  2O2O A;  1VQ5 T;  2VWF A;  4HCK A;  2JN0 A;  5LJ3 d;  4HCC A;  3VS7 A;  4P5N A;  2DYB A;  1TU0 B;  1GFD A;  2OJ2 A;  1NYQ A;  1UFF A;  1XQH A;  3ER0 A;  1BB9 A;  4NOY A;  5HCK A;  4C5G A;  4O2D A;  1YHQ T;  2MWO A;  4M77 E;  2J3M A;  4MMK A;  1S1N A;  3BJU A;  4C5H A;  1ZHI A;  4KT0 E;  2GTO A;  4BY6 B;  3RGL A;  3TU4 K;  5LJ5 f;  1FMV A;  4HCZ A;  2ZPG B;  3HTR A;  4IKF A;  1WPY A;  4M7A B;  2CSI A;  2E3H A;  1HXD A;  4OB2 B;  4J7F A;  2HKN A;  3OYK A;  3RIR A;  1M5Q 1;  1QMC A;  1SER A;  1C0A A;  4B9W A;  2A0F B;  2J06 A;  2QEX A;  2EAY A;  5KYW B;  1NLP C;  3CME T;  2DL3 A;  4PJO G;  3WVD B;  5KYN A;  2EQU A;  2I4M A;  3NFC A;  1M3B A;  1I07 A;  3QYH B;  4M77 A;  1ZUU A;  4C92 C;  2LCS A;  5GAM g;  2ZZF A;  4KGX B;  1VQP Q;  3VS1 A;  4E7L A;  2B86 A;  3PNW C; 
#chains in the Genus database with same CATH homology
 1H64 1;  2E10 A;  3HRK A;  3RER A;  2PMF A;  3KBG A;  1Q81 U;  1BBW A;  3I56 A;  3WXM B;  1NE8 A;  5CKF A;  3MEW A;  2LCL A;  3PMI A;  3INZ A;  1OZ2 A;  3CBM A;  4HWO A;  1OYX A;  2Q7G A;  4YCW A;  1YB3 A;  3JRZ A;  3TCJ A;  4ME7 A;  3I7F A;  4A4E A;  4CH5 A;  1VQL A;  5KH6 A;  2O01 E;  2E64 A;  4JLI A;  2DIQ A;  4DOV A;  4P71 C;  2K5I A;  3CCV A;  4TVY A;  1H4S A;  4XU0 A;  3QDR B;  1UGR B;  5A0D A;  4YCU A;  4IUU A;  1LNX A;  4HWR A;  3HKS A;  4BI8 B;  1BIA A;  1H3Z A;  2DQ3 A;  4LDX A;  3GPL A;  2QTX A;  1AHJ B;  11AS A;  3HSB A;  2ZCE A;  5CVI A;  4WF2 A;  2PVO B;  3HY1 A;  3OBW A;  2E65 A;  4TQD A;  4BDY A;  1E24 A;  3A5Z A;  4XK8 E;  3C4S A;  2RHU A;  1BKB A;  5GAO q;  1I5L A;  5GAM h;  2X4J A;  5D6W A;  5HK3 A;  3OYA A;  3MF2 A;  2F5K A;  4LDV A;  3CCE T;  2ODR D;  3SDZ A;  1WQ7 A;  1YFS A;  1N8R C;  3QNE A;  2YLB A;  1HC7 A;  3EAE A;  1D3B A;  2G3R A;  2HBP A;  4TTV A;  2OTL A;  4E47 A;  4KR3 A;  3G1Z A;  3L2V A;  2RH2 A;  2X4W A;  3G4S A;  3CD6 A;  4KUD K;  3BY7 A;  3HPW A;  3QPH A;  2R58 A;  1VQ9 T;  2P5I A;  2LDM A;  3JCM c;  2M1H A;  4E7H A;  4XEO A;  1EVL A;  3OW2 S;  1Z7M A;  2CJB A;  2ZZG A;  3QO8 A;  4CH4 A;  5J26 A;  5GAN 4;  4P75 C;  3OS5 A;  2XGT A;  5GMK m;  4YRG A;  4C92 B;  2GQV A;  3A7A A;  5CKE A;  1YJN T;  1WNL A;  4M7A G;  1R8O B;  1KQ2 A;  3FJP A;  1X2G A;  2RHX A;  3VKI A;  2OTJ T;  2RJF A;  1BYM A;  3OYL A;  3JCM P;  3BDL A;  4NL2 A;  1O75 A;  4EO4 A;  3OYJ A;  1YJ9 T;  4PJO E;  4DQ2 A;  1UGS B;  1BI1 A;  2Y4Y A;  1XOV A;  3RKW A;  1SET A;  1WU7 A;  4L87 A;  2VC8 A;  1EOV A;  1XNI A;  3CCU A;  2DZC A;  1M4Z A;  2Q5I A;  3T9N A;  5K1X A;  2ZT6 A;  3ZBD A;  2QHU A;  1RI0 A;  3KFU A;  2ZPH B;  1H4T A;  4HWP A;  3UT1 A;  4PJO A;  3CPF A;  3DB3 A;  4H2W A;  3E9H A;  3HXZ A;  4P3O A;  2ZTG A;  2EJF A;  4FSX A;  4Y28 E;  3VYG A;  3OQ5 A;  4EDU A;  3NEM A;  4H2X A;  4RCC A;  3JB9 D;  1Q7Y U;  4YRR A;  4F7U A;  3JB9 H;  2GF7 A;  3HXY A;  4HVC A;  4EMK B;  2RHZ A;  4XAX B;  2Y90 A;  5LJ5 g;  2R5A A;  1EIY A;  2GFU A;  1B7Y A;  3MP8 A;  3PZC A;  1XTD A;  2Q7E A;  4C92 D;  3EFS A;  3V8L A;  4BI3 A;  3IG2 A;  5KCH A;  3HRU A;  3ERR A;  2G4C A;  2EQJ A;  3L2Z A;  3OS2 A;  3TRE A;  1VQP A;  2QEX T;  4M7D A;  4HCB A;  1W2B A;  4YRF A;  1MHN A;  2DTH A;  1I4K 1;  5LJ3 g;  4P74 C;  5GAM f;  1Q86 U;  4M7D C;  3A7R A;  5GAN e;  2PVG B;  3RMS A;  1SSF A;  2QA4 A;  3M58 A;  1VQ4 A;  2NS6 A;  2NLU A;  3JB9 F;  4J5Y A;  5GAN h;  2ZIM A;  3CC7 A;  3I56 T;  4OF1 A;  5FLX E;  3OS1 A;  3CBP A;  2Y4X A;  3A8L B;  1KD1 C;  1NJ1 A;  1IZ6 A;  3C94 A;  2VGN A;  3HHT B;  4A4H A;  3SFM A;  2FB7 A;  5CKD A;  3QO3 A;  4QQD A;  4C92 F;  4QQ6 A;  4X9D A;  2ZGW A;  2LNV A;  5GAM j;  2WSF E;  1VQL T;  4O5V A;  3L1A A;  5DLQ E;  3CCV T;  4JRP A;  4IUT A;  1BIB A;  4C92 G;  4IUP A;  3A8M B;  4VUB A;  3NTK A;  4H2S A;  3OA6 A;  3E1S A;  1ADY A;  4HKE A;  5CQX A;  1K8A C;  4BE1 A;  2YRV A;  4X5O A;  4PKC C;  1KHI A;  3JCM Q;  4YRJ A;  1N6A A;  3GOX A;  1Q86 C;  3VQX A;  1YIT A;  2BIV A;  4XU1 A;  5LJ3 h;  4XU3 A;  3OYB A;  3FIF A;  3M4G A;  4H2U A;  4J7I A;  3UDC A;  4OP0 A;  1G5I A;  1PSF A;  4LD9 K;  4M7A A;  4FU6 A;  3GP8 A;  3QUI A;  3M4P A;  3NTH A;  3M53 A;  4M75 C;  1U1S A;  3JSC A;  3C95 A;  3HTZ A;  4XTU A;  1VQ7 A;  1VQO A;  2MI6 A;  2L3R A;  4P72 C;  3OYG A;  2OTL T;  3WVE B;  3KXT A;  2E1H A;  2PUO B;  1TH7 A;  5FU7 B;  2X4Y A;  3G4S T;  3CD6 T;  2DD4 A;  3L4G B;  1JBM A;  3OBY A;  3HY0 A;  3CC2 A;  3HFZ B;  3J80 E;  2K57 A;  3LC0 A;  4YRE A;  4JLG A;  3HFO A;  4R55 A;  3UH0 A;  2ZCF B;  1KC8 C;  2X4X A;  2WSC E;  2RO0 A;  1X6O A;  3FEO A;  3VQV A;  3TUP A;  4ZIB A;  4OLF A;  2I2L A;  2LX9 A;  4OGE A;  1QE0 A;  3CBO A;  2EIF A;  4JDS A;  3UGQ A;  3CC4 A;  4M78 C;  3JCM b;  2V8J A;  2X35 A;  3MCA B;  1M1F A;  4IUV A;  4ELY C;  2IG0 A;  4OMF B;  2I4N A;  1UB4 A;  1USY A;  2RHQ A;  3MEA A;  3MHX A;  3LW5 E;  3CCU T;  2HAX A;  2CJ9 A;  5FRM A;  1KG1 A;  3PT9 A;  3SWN A;  2JTF A;  2CIM A;  3L2Q A;  5GAN f;  5GAO m;  2RHS A;  5DY9 A;  1KHC A;  2CGH A;  3SWN C;  2CKK A;  2ZIN A;  1UGP B;  2A3L A;  3PIO A;  3GNG A;  2RHI A;  4DOW A;  4KUL A;  5DLO A;  3OYN A;  3CEY A;  3LSQ A;  2OAU A;  4ZGJ B;  5GAN 7;  4C8Q A;  3J81 E;  3NEN A;  3S6W A;  5GAO p;  4C92 E;  4ZTJ A;  2RI3 A;  2HQE A;  5E3I A;  5GAN j;  4EPC A;  4JS5 A;  4GLK A;  3HFN A;  1P92 A;  3NEL A;  1NJ2 A;  4MZP A;  2O4X B;  3LGF A;  1JRI A;  1HTT A;  5J3B A;  2ALY A;  4JJN K;  1LOJ A;  2JUF A;  4ZGD B;  1LYL A;  3ASK A;  3RL6 A;  1VQP T;  4CI0 C;  5CKH A;  4A53 A;  4M77 C;  2CZ1 B;  5LJ3 f;  3LSS A;  3AHU A;  5LJ5 j;  4H2Y A;  3WQZ A;  3P8D A;  3M56 A;  2CZ7 B;  5GAN 2;  3CCL A;  3HRS A;  2XD0 A;  1IL2 A;  1VQ4 T;  3A8O B;  2C8M A;  4WJ3 M;  5A0L A;  4KQE A;  1SRY A;  1B70 A;  3CC7 T;  1FXX A;  4XEM A;  4BD3 A;  1NNH A;  3M5A A;  3SD4 A;  1E22 A;  4HA8 A;  5LJ3 j;  2F5T X;  3EFR A;  5FU6 C;  4M7D F;  2MF2 A;  1VQ6 T;  1RIQ A;  3VUB A;  3G71 A;  1GGM A;  2LVM A;  4CH6 A;  1Y96 B;  1I81 A;  4YRP A;  2L8D A;  1S72 A;  3QSU A;  4M78 B;  2YLC A;  2RK1 A;  3H6Z A;  1YJW A;  1QVF A;  4YRL A;  1KMN A;  4OVA A;  4HT9 A;  4TQF A;  2DPP B;  1W2B S;  3CCM A;  4K87 A;  2AKW B;  3CCR A;  3HRI A;  1Q81 C;  4HWT A;  3R07 A;  2ZIO A;  1GXI E;  3UPU A;  4EMK A;  4WI1 A;  4M75 D;  4LDU A;  3QZ9 B;  2L89 A;  4UPA A;  2K5L A;  3JB9 I;  4TVA B;  3G7Z A;  3V8K A;  4QW2 A;  2GFA A;  1PYS A;  4XTY A;  3IKL A;  4ZTF A;  4QVZ A;  4L5G A;  2ART A;  3P8T A;  5HKC A;  1L0W A;  2XKO C;  1X55 A;  3BW1 A;  5GAN 8;  3S3M A;  1QVG S;  1QP3 A;  3RKY A;  2R57 A;  1VQM A;  3OYY A;  3X26 B;  4ATO A;  4QVC A;  3M9Q A;  1JJ2 A;  1VQ7 T;  3RUX A;  5C0M A;  3CXC A;  5CIU A;  1VQO T;  1WJS A;  5IT9 E;  4YRO A;  5CCA A;  4YTL A;  2ZNJ A;  1N9S A;  3DKM A;  3M59 A;  4HT4 A;  5K1P A;  5CKB A;  2HNI A;  1B8A A;  5I2S A;  4QVD A;  2QQ9 A;  3HXW A;  2D6F A;  4K88 A;  5CO7 A;  4ZGE B;  3CC2 T;  3UFG A;  2XTI A;  1G3T A;  4M75 F;  2RI2 A;  2P0P A;  4BE2 A;  4XTV A;  1NPP A;  4N4H A;  3A31 A;  3MP1 A;  4M78 D;  2A8E A;  2MMP A;  4C0F A;  4FIB A;  2R5M A;  4OB1 B;  3F70 A;  4N0A A;  1DJ7 B;  2EQK A;  3FB9 A;  3JCM e;  3RES A;  3A7U A;  2DIG A;  1NZ9 A;  5CAI A;  2K3X A;  5D6Y A;  4ZTU B;  3DB4 A;  5CQY A;  1OI1 A;  2I4O A;  5CK9 A;  1M1K U;  1JJC A;  3QHS A;  3REU A;  3PCO B;  4K86 A;  2E41 A;  3P8Y A;  3MP6 A;  3A74 A;  4D6W A;  1KQ1 A;  2ZZD A;  5GAN g;  3E19 A;  1U1T A;  1W4S A;  1N27 A;  2PME A;  3OYH A;  1NJI U;  3C12 A;  1M90 U;  1Y7X A;  4PJO C;  1SES A;  4YRQ A;  4BAC A;  4XTZ A;  3P8B B;  2KY9 A;  1V29 B;  4M78 F;  4XQ3 A;  4JS4 A;  2E3C A;  2DXC A;  3VUZ A;  2DK3 A;  1ADJ A;  2IY5 A;  4RCB A;  3IKM B;  5A0G A;  2RJC A;  4FM4 B;  1X01 A;  4RDX A;  4OGC A;  5AYF A;  3M4Q A;  3A5Z B;  4M78 G;  1RL2 A;  4UC4 A;  1FYF A;  4RG2 A;  5ELO A;  3QO7 A;  1E1O A;  3A32 A;  4LNS A;  2DVE A;  3MEV A;  5KCO A;  4M77 D;  1M1K C;  3OYF A;  4CS2 A;  5C52 B;  4LDY A;  3P8V A;  3HFZ A;  3TEG A;  1PSE A;  2C06 A;  2RM4 A;  2DD5 A;  2H3J A;  5M9O A;  2LC4 A;  3QTC A;  3DLL A;  3R6O A;  4UP8 A;  2ZT5 A;  2KQW A;  1NJI C;  3JCM V;  3TEH A;  5GAN 6;  4XTX A;  5GMK e;  1Q82 U;  2JZ2 A;  2KK4 A;  1YI2 A;  1Q7Y C;  2CS7 A;  2DTI A;  5GMK h;  2XHC A;  4YYE A;  5GAN 5;  3JB9 G;  4Y91 A;  1QVG A;  2PQW A;  4NCX A;  3ICA A;  4RG8 A;  3H8Z A;  3JCM d;  4C5E A;  4CS4 A;  5C51 B;  1QW1 A;  4XTW A;  3M4Y A;  1K9M U;  4M77 F;  3RF1 A;  3FRN A;  2YHT A;  2K2V A;  1G3W A;  4FT4 A;  3HL8 A;  3W3S A;  3G71 T;  5I2M A;  2AHJ B;  1FX7 A;  3X25 B;  3O8V A;  2QHS A;  5DM7 R;  2LTO A;  1M1G A;  2LT1 A;  1S72 T;  3HXX A;  3MO8 A;  1YJW T;  2Q7H A;  4AH6 A;  2DDZ A;  3HRT A;  1ASZ A;  4LVK A;  2Q5H A;  1J5W A;  1G3S A;  3JAM E;  4GY5 A;  3JCM J;  4O6J A;  5KE2 A;  3QJ6 A;  1NJ6 A;  3CCM T;  3BDU A;  1VQZ A;  3CCR T;  2KAF A;  1X56 A;  4H02 A;  3E9G A;  3LLR A;  1VQ8 A;  2RJD A;  4EMH A;  4L6V 5;  4BY6 C;  5KE3 A;  4YP0 A;  2P0K A;  4X9C A;  5GMK i;  2FHD A;  4M7A C;  4H2X B;  4F7U B;  1WQW A;  3QKJ A;  1EQR A;  3JCM X;  1KMM A;  3CMQ A;  3L2R A;  2DU5 A;  2F69 A;  4YRM A;  2QQS A;  3OY9 A;  1VQM T;  4E7I A;  3LWI A;  5ELN A;  2JTM A;  3NTI A;  5F5W A;  1N9W A;  4ELZ C;  1YIJ A;  2DU7 A;  2CYZ B;  5EG2 A;  3P8H A;  3GF5 A;  2HQX A;  2E70 A;  4II1 A;  4PL6 A;  1QVF S;  2KSS A;  3E9F A;  4YRT A;  4M78 E;  4LVL A;  3LYI A;  2CJA A;  4M7D B;  4CS3 A;  2E5A A;  4YCV A;  3HFV A;  4FT2 A;  5GMK l;  1M8V A;  1B34 B;  2LRQ A;  4H2T A;  2DZ9 A;  3CCS A;  3MQZ A;  1Y96 A;  5LL6 S;  3LX7 A;  2K4Y A;  1X75 C;  2EQM A;  2E6N A;  4Z02 A;  3J7A F;  3PFS A;  4PJO D;  3OB9 A;  1USY C;  1G5H A;  2KMT A;  4KUI A;  2RI5 A;  2DJZ A;  3MET A;  2QQR A;  2AKW A;  1JJ2 S;  3CXC S;  4P73 A;  3OMG A;  2DEQ A;  2DXB A;  3VQW A;  4YRN A;  1YFT A;  4TVA A;  3QYG B;  5CR2 A;  1E1T A;  3N5B B;  2MAM A;  3X20 B;  2EFI A;  3MEY A;  3LGL A;  5HGQ A;  4BI4 A;  4ZN3 A;  4JUV A;  3FC3 A;  4C8Q C;  1I8F A;  4J8O A;  2M16 A;  2EL9 A;  3JCM W;  3CCQ A;  4WJ4 A;  1WJR A;  4HWS A;  5GMK j;  4M7D D;  2XDD A;  3QO5 A;  4PJO F;  1EVK A;  3M54 A;  4M75 B;  4BUG A;  2CZ0 B;  3VBB A;  2D0Q B;  1NPR A;  2QI2 A;  5C53 B;  5GAO n;  4C92 A;  4F7U F;  2ZZE A;  3PGG A;  1Y07 A;  2VXF A;  4H2V A;  4CH3 A;  4NL3 A;  3DSQ A;  2D9T A;  2ZPE B;  2P4T A;  2J3L A;  3QG1 A;  2QA4 T;  3HXV A;  4BDZ A;  2HD0 A;  4HT8 A;  5L8R E;  4YRS A;  4BB7 A;  4F7U G;  3OD1 A;  3ZEH A;  2JVV A;  2RD1 A;  4G85 A;  4YDQ A;  3Q1J A;  1YI2 T;  2FVU A;  2DTO A;  3CMA A;  4MDW A;  3S3N A;  3REX A;  4EX5 A;  3CCJ A;  2JOY A;  4MZT A;  1N8R U;  3PCO A;  3SB2 A;  4C0D C;  4OB0 B;  1KQS A;  1X54 A;  4P71 A;  1LJO A;  1VQN A;  3GLX A;  3V7S A;  2K5F A;  4C5I A;  2ZNI A;  2PUK B;  3ME9 A;  4JRI A;  2ZT7 A;  4X34 A;  4A54 A;  4M7D G;  2EWN A;  5C6S A;  2MWP A;  2EKO A;  4XU2 A;  4RMO A;  4C0Z A;  2VUB A;  2AMC B;  3V7R A;  5A2Q E;  3E9I A;  4C0G A;  2RHQ B;  2C7I A;  5HY6 A;  4EMG A;  2VXE A;  4A4K A;  1VIE A;  3OYE A;  4LD6 A;  3PMT A;  3JCM g;  1YIT T;  3SWN B;  4M7A D;  1VQK A;  1BBU A;  4JRK A;  4EMK C;  2KVQ G;  5GAM e;  2B8A A;  1YGB A;  2RHS B;  2E6Z A;  1K73 U;  1ASY A;  2ARS A;  3OSV A;  4YRI A;  2LT4 A;  1VQ8 T;  2P0Q A;  3I55 A;  5KNN A;  4QQG A;  3PTA A;  3X28 B;  3CPW S;  2EYQ A;  4IUQ A;  2RK2 A;  2I4L A;  3VV0 A;  3M57 A;  2QQB A;  1MGQ A;  3GNF B;  4C8Q B;  4E51 A;  4A4F A;  2RB6 A;  3URG A;  4PG3 A;  4YPF A;  1Z7N A;  4NS5 A;  4LVJ A;  3L42 A;  3A8H B;  1YIJ T;  2XDP A;  2M0O A;  4M7A F;  2ALY B;  4P75 A;  4KR2 A;  4M77 B;  3M55 A;  4L59 A;  3RMQ A;  2DXU A;  1QF6 A;  5I21 A;  4TVW A;  5FRN A;  3OYC A;  3KUF A;  4M75 G;  1OZ3 A;  2KDS A;  4PHC A;  2XK0 A;  3G6E A;  5FRO A;  2LQ8 A;  2XU8 A;  2L5Q A;  4N0A C;  3QII A;  3JCM h;  1K73 C;  3QXE B;  3A5Y A;  1Y71 A;  3CCS T;  3CC4 T;  4G84 A;  1B70 B;  2EJ9 A;  5D6X A;  2VYT A;  5FU6 B;  4UP9 A;  4C0D B;  1BI2 A;  2ZPI B;  4LDW A;  4MDX A;  4IUR A;  1UEB A;  2GCX A;  2M9U A;  4RQF A;  2V8K A;  4F7U E;  4P3P A;  1FWZ A;  4MZM A;  2LQK A;  2ARU A;  3OYM A;  4Q5W A;  4N4G A;  1VQ5 A;  5GAO l;  4ZN1 A;  2XID A;  3OS0 A;  4C8Q D;  2RJE A;  2XDB A;  2XIC A;  4J6Y A;  5GAM d;  1VIF A;  1H4V B;  4N4I A;  1YHQ A;  2QQA A;  2FL7 A;  4PLI A;  1KD1 U;  3LH0 A;  3FLG A;  1W66 A;  2BUD A;  4M7D E;  4J6W A;  2ZPB B;  3L4G A;  1G5V A;  4PLL A;  2XG8 D;  3CCQ T;  1NJ8 A;  1PYS B;  5FU7 C;  3JB9 J;  3CME A;  3V7C A;  1D3B B;  3A8G B;  1WLE A;  4BE0 A;  2PU9 B;  4P3N A;  1O9S A;  2K3Y A;  2XI9 A;  2DAQ A;  1WYD A;  1ATI A;  4YRK A;  4P74 A;  4LVM A;  2VGM A;  4UP7 A;  3OSS C;  4PNO A;  5IN1 A;  5HK0 A;  3UWN A;  3BFM A;  1K8A U;  1M90 C;  4BWA A;  12AS A;  2DO3 A;  2VV5 A;  2FYK A;  1B76 A;  4C8Q F;  4YRC A;  3VQY A;  1B34 A;  1X2H A;  4LVI A;  3CCL T;  5GAO r;  3MF1 A;  2LCC A;  1ZQ1 A;  1WJQ A;  3CPW A;  2PVD B;  3LWH A;  1KOG A;  4C8Q G;  1BI0 A;  4TVR A;  4Q15 A;  2JNG A;  4Q6G A;  3CMA T;  5IAY A;  3OMC A;  3CCJ T;  4DA4 A;  2DXT A;  2IVW A;  1YCY A;  4V2S A;  2ZR2 A;  2V8I A;  1VQ6 A;  3L2U A;  2WSE E;  1VQN T;  3RAC A;  5LJ5 e;  4OB3 B;  3V8J A;  4M77 G;  2E5Q A;  1WGS A;  2DKG A;  3X24 B;  3OW2 A;  2A7Y A;  5LJ5 h;  1JB0 E;  3QBY A;  4DPG A;  1JJC B;  1BI3 A;  2ZT8 A;  3UGT A;  1NJ5 A;  3VJP A;  3OYI A;  3L2W A;  4M75 E;  4J6X A;  5GAN 3;  2ZXF A;  1HK9 A;  4M7A E;  3S3O A;  3TEE A;  5J39 A;  1Q82 C;  3JCM f;  4PJO B;  4CRI A;  1G51 A;  5LJ3 e;  4E7K A;  1KC8 U;  4R56 A;  3QZ5 B;  1QP2 A;  3DLM A;  3CCE A;  1VUB A;  1VQK T;  4E7J A;  4A4G A;  2O4X A;  3QJY A;  4M75 A;  4FL6 A;  4B9X A;  2IY5 B;  2E12 A;  1K9M C;  2QHV A;  1G3Y A;  3I55 T;  1UGQ B;  2QHT A;  1EIY B;  4P72 A;  2EJG A;  1YFR A;  1B7Y B;  4ZTZ B;  2ODR C;  4RQE A;  1KQS S;  1VQ9 A;  1H4Q A;  3NET A;  2BKD N;  4RMF A;  4BW9 A;  2RHY A;  2ZPF B;  3IAL A;  3HXU A;  1ZBX A;  2DQ0 A;  1YJN A;  3PIP A;  5GAN d;  2CZ6 B;  2OTJ A;  4J15 A;  3ZFJ A;  2QXF A;  3TEH B;  1N9R A;  1YJ9 A;  1EFW A;  3G6E T;  3OYD A;  4MML A;  4M78 A;  3MEU A;  4J83 A;  4TWA A;  3HP9 A;  2ZR3 A;  3FDR A;  3VU3 C;  1M9S A;  5LJ5 d;  1U8R A;  2AMC A;  1QVP A;  2QDY B;  4KBM B;  1EIF A;  3VYH B;  3RKX A;  1NYR A;  1IRE B;  4RKU E;  2WAC A;  4C8Q E;  3GIB A;  1YBY A;  4P73 C;  2P0L A;  2RA2 A;  4JRQ A;  1VQ5 T;  2JN0 A;  5LJ3 d;  4HCC A;  4P5N A;  1NYQ A;  1XQH A;  3ER0 A;  4NOY A;  4C5G A;  4O2D A;  1YHQ T;  2MWO A;  4M77 E;  2J3M A;  4MMK A;  3BJU A;  4C5H A;  1ZHI A;  4KT0 E;  4BY6 B;  3RGL A;  3TU4 K;  5LJ5 f;  4HCZ A;  2ZPG B;  4IKF A;  1WPY A;  4M7A B;  1HXD A;  4OB2 B;  4J7F A;  3OYK A;  3RIR A;  1M5Q 1;  1SER A;  1C0A A;  4B9W A;  2QEX A;  2EAY A;  3CME T;  4PJO G;  3WVD B;  2EQU A;  2I4M A;  3NFC A;  3QYH B;  4M77 A;  4C92 C;  5GAM g;  2ZZF A;  4E7L A;  3PNW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...