1B76A

Glycyl-trna synthetase from thermus thermophilus complexed with atp
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
442
structure length
442
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNAKARYWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glycine--tRNA ligase
publication title Glycyl-tRNA synthetase uses a negatively charged pit for specific recognition and activation of glycine.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 118
structure length 442
sequence length 442
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1999-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1b76A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1b76A02
4NCXA 2DZCA 4DQ2A 4YRKA 1SESA 3RACA 3HFZA 3OD1A 3HXWA 2ARSA 5K1XA 4K86A 4YRTA 2J3MA 3HY0A 4BW9A 4Q15A 4RMFA 3UFGA 4P3NA 2E1HA 4YRGA 4HWPA 4L87A 1KMNA 3MF1A 2QHTA 4TVAB 4K88A 4XTYA 4P74A 1FYFA 1G5HA 2AKWA 2DTHA 3MF2A 4P3PA 5K1PA 3V8JA 3G1ZA 1QF6A 2E64A 2DU5A 3HXYA 1RIQA 2J3LA 1NJ5A 2ODRC 4O2DA 2DU7A 3RIRA 3VQWA 1YGBA 2ALYA 11ASA 2QHSA 3P8TA 2QHVA 2ZR3A 4ZIBA 4PHCA 1YB3A 2RHSB 2I4LA 3V8KA 4H2UA 3P8YA 2EAYA 2ZTGA 4P75C 3A32A 4YCUA 1X2HA 2DJZA 3M4PA 1G51A 1H4VB 3HXUA 2EJ9A 3EFRA 4TWAA 1W66A 12ASA 3HXZA 4HA8A 3A5ZA 3A7AA 2FYKA 2ZT5A 4HWSA 2EL9A 2PMEA 2RHQA 5C51B 3V7RA 1WU7A 1X01A 2DDZA 4P74C 2ZIOA 3HY1A 3TEGA 1J5WA 2ARTA 1JJCB 2PMFA 4CS4A 1EFWA 3P8VA 2IY5A 3HRKA 1L0WA 4YYEA 2I4OA 3LSQA 4KR2A 4YRPA 2Q7EA 1NJ2A 2ZCEA 3REUA 1B70B 2ZR2A 1NNHA 2Q5HA 4LNSA 1WYDA 2DTOA 4H2XB 3RKXA 4YCVA 4Q6GA 3IALA 4XEOA 4YRCA 4YDQA 4P72A 4CS2A 4WI1A 4YRMA 2Q7GA 3VBBA 4H2WA 3TEHB 4XTVA 5E3IA 3QNEA 1ATIA 2EJGA 4AH6A 2AMCB 4DPGA 2DVEA 2P5IA 2ZGWA 4H2XA 2C8MA 1USYA 1C0AA 4WJ4A 1NYRA 1BIAA 2DQ3A 3NELA 4WF2A 2CJBA 2DTIA 3QO7A 4CH5A 4YRQA 2ZINA 3FJPA 3UGQA 1E22A 2DXUA 4H2SA 4YRJA 4TVAA 3VQXA 4CH6A 1B7YB 2AMCA 5C53B 2ZNJA 1EQRA 3HRIA 4OP0A 1EOVA 4P73A 3W3SA 3IG2A 4EX5A 3I7FA 1HC7A 1N9WA 2DXTA 4HWRA 4XU1A 2ZNIA 2QHUA 2Q7HA 4P72C 2ZXFA 4XU0A 4YRLA 3QO5A 4YROA 2RHSA 1Z7NA 1HXDA 1BIBA 4XTUA 2EWNA 1PYSB 3A7UA 2G4CA 4H2TA 4YRFA 2ZT7A 4EO4A 1QE0A 2DKGA 3RUXA 1USYC 4J15A 3A7RA 4XU3A 1HTTA 4G85A 1SETA 1KMMA 3PZCA 4PG3A 1SERA 3MEYA 4YP0A 1Z7MA 3L4GB 1ADYA 3NEMA 3RKWA 4KQEA 3VQVA 3V8LA 3A31A 4YPFA 4TVYA 3ICAA 2ARUA 2DEQA 1WPYA 1JJCA 4UPAA 1ADJA 2DQ0A 4P71A 4XTXA 4XTZA 3UH0A 1ASZA 3L1AA 4WJ3M 1WQWA 4YRRA 1E1TA 4KR3A 3HFVA 1YFSA 3V7SA 2AKWB 3V7CA 3REXA 2CIMA 3KFUA 2EJFA 1E1OA 2CJ9A 4TQDA 1H4SA 1B70A 3LSSA 4OLFA 3UGTA 4G84A 2C7IA 2DZ9A 3ERRA 1YFRA 3M4QA 4YRIA 3IKLA 2ZZEA 3HXVA 4YRSA 1NJ8A 1ASYA 4TQFA 1X55A 3QO8A 4RDXA 2ALYB 4XU2A 1IL2A 4CS3A 3A74A 3TEHA 3NETA 4XTWA 1EVLA 2E65A 4X5OA 1VQZA 3BFMA 3LC0A 1EVKA 4E51A 4TVWA 3RF1A 3RKYA 2E10A 2ODRD 3R07A 1BBUA 3TUPA 3L2ZA 1EIYB 3A5YA 1X2GA 3DSQA 4K87A 4UP7A 2I4MA 4H2YA 4YRNA 3HTZA 1SRYA 2I4NA 3HXXA 4YREA 4HWTA 1X56A 1YFTA 5F5WA 2ZZFA 4P71C 2CJAA 2ZZGA 3RL6A 4HVCA 1H4TA 1B7YA 2RHQB 1WLEA 1GGMA 1B76A 4UP8A 1BBWA 2ZT8A 3RGLA 1EIYA 2P0LA 4RQFA 2Q5IA 2XTIA 2ZIMA 5ELNA 3BJUA 2LW7A 5ELOA 1B8AA 3QTCA 2IY5B 3IKMB 3NENA 3PCOB 3WQZA 1NYQA 1NJ6A 1X54A 1LYLA 5HGQA 3CMQA 1NJ1A 2XGTA 1WQ7A 4ZTZB 3E9IA 3E9HA 5C52B 4YCWA 4XEMA 2ZT6A 1KOGA 1G5IA 3HFZB 3VQYA 1PYSA 4H02A 2CGHA 3PCOA 4RQEA 3EFSA 5KNNA 4CH3A 4BWAA 4P73C 4UP9A 1H4QA 2E5AA 4ZTUB 4CH4A 1V95A 2E41A 4P75A 4H2VA 4TTVA 1WNLA 1E24A 4P3OA 2E3CA 3L4GA 4HWOA 2HNIA
chains in the Genus database with same CATH superfamily
4CG0A 4D9MA 4ER6A 3I1YA 2BGNA 5BYJA 4CEIB 4TWIA 2VWHA 4LWOA 3BIXA 1UFKA 1C1YA 1TYAE 5FUVA 4D0NA 2W6ID 3I01A 1AVTA 1JEQB 4U8HA 1T4CA 4ZEWA 1T2DA 4CCSA 2RGGA 2ISSD 1RPTA 3GLHB 2B8JA 2O2IA 3AB7A 3P0EA 4LKRA 4HFMA 2O48X 4ZYYA 1DIGA 3EFEA 1DFGA 1GYQA 3NCTA 2WJZB 3JRWA 4GPEA 4ACBA 2E1HA 1JDZA 3FVVA 3L7LA 1G20B 1E66A 5TDHA 3QEAZ 4L5CA 4IEEA 3LK6A 1BXGA 2GD1O 1H65A 1SZJG 3K6KA 2MU1A 5KYXB 3P27A 5F2KA 3KU1A 1X1DA 4ZMSA 3NI2A 4TVAB 2VYCA 4W82A 4ADSG 5A4FS 4JDUA 4BVGA 5JU6A 2D59A 4MVJP 1GO2A 1DS6A 3AK4A 2BH9A 3GUCA 3KJEA 4QELA 3I9FA 3CLHA 5IDYA 1HZZC 2WTBA 2YINC 4KV7A 4HDRB 3T3OA 3RYFB 4JYAB 1P2VA 3VYWA 2C92A 3UQZA 4BBAA 3RFTA 3N58A 4ZJUA 5ALPA 1UKAA 2XPCA 3SHVA 1WVGA 1Z83A 2I2XB 3NWEA 2YV2A 3B20A 2CLOB 4BPBA 5EE5B 5LU9A 4H6PA 1SB9A 4W6ZA 2WWHA 3UMCA 3D6TB 3Q7PA 3HJUA 2H57A 3DO8A 5JLAA 3F47A 1JKIA 1Q2UA 4EUSA 5JXWA 4XGIA 1TQ4A 5EJMA 1S7GA 5ICSA 1YGBA 4MPDA 5TR9A 2AGVA 1I7DA 2VS1A 2WP8J 1N32B 5F12A 1CRQA 3F9CA 3AX6A 4HB2A 1Z4LA 1BXRA 1JQEA 1NVAA 2GN8A 3NATA 4PNHA 4BUCA 5KINB 2ZWMA 3G2QA 1FVOA 2BZSA 4QYIB 4X8LA 2C04A 5K0FA 5I6DA 4UHCA 3URMA 1AN9A 3GEGA 1MVOA 2V03A 2GZMA 3QUTA 2JFYA 1DO2A 1Q17A 4FOPA 2R8PA 2W93A 1EVQA 4ACAA 2DFNA 1L1EA 2Q1YA 1HOXA 2FGKA 3TRKA 2B92A 2ZJZA 4YCUA 3WVNA 1OD6A 2EHJA 3QX7A 4RJTA 1GOTA 3HXUA 1M6VB 2PLNA 1TTPB 5HW0A 2D2XA 4IWXA 4LYEA 3AFNA 1A4UA 1BO6A 1KEEA 5FOSA 5KUTA 4RU1A 2X2PA 1EFLA 1EUCA 1GSIA 2CVFA 2WU8A 3QKRA 1XMIA 4MWEA 4KYUA 3A5ZA 1OOEA 4WCFB 4QWMA 4P0PB 1A04A 1FFCA 5AI0A 4ND8B 4CHTA 3QZUA 3SXPA 1NY6A 3N8NA 2QL7A 3FMFA 5EKSA 1VG1A 2L0XA 1YMUA 3EEBA 3UAOA 4CL2A 3E84A 2O23A 1OT5A 1IE3A 4C0WA 3ZCVA 1WTAA 1ZIXA 2EC5A 2QN9A 4DJFC 5JARA 1TVEA 2AUNA 2FMUA 1YV9A 5AI9A 1DWUA 4D57A 5NLLA 1NDHA 4BLUA 5KTPA 5CT5A 3KXKA 4IXNA 1XMQB 1Y6FA 4JI2B 1YDGA 3GGJA 2VXOA 3ETJA 2PUEA 3DL2A 2G80A 1UXIA 1PUIA 2IYTA 1CJKC 4Z2YA 2EQAA 2P9GA 1VLHA 1DDGA 4NYIR 4W5WA 4RESA 5KOIA 1QHNA 4NBTA 3PGA1 3LLCA 1E9RA 1OASA 5DASA 2W2NA 4V24A 2G5TA 5J4HA 4LW8A 1Q1GA 5LP6F 2WWTA 1Y5RA 2ZRJA 4RLSA 1PYGA 2ZI5A 4GWKA 5BWCA 2XQVA 2PUCA 1JSCA 3CPHA 3M4XA 4D4IA 2ZRFA 1E2JA 2IPMA 4G4SP 3NG1A 1ZH2A 1IOLA 2ZS9A 3IYLW 4Z4IA 2XE8A 4H35A 4FYXA 1SXJC 1M74A 1DMRA 2WTXA 3REUA 4RSGA 4DIFA 5G53C 1TO2E 3FNHA 5TX7A 3WV4A 4HVLA 3DXFA 3EZGA 3TZBA 4UHKA 1LLUA 3FPSA 2WTUA 4RVFA 1KZHA 1NG9A 2VOEA 5EQFA 1AKTA 3QGMA 1SBZA 2AXQA 4AQYB 4ZD6A 4CDRA 1A9XA 5C9ZA 4P08A 1Q15A 2YRWA 4KGVA 4R7ZA 3EC2A 4YAFA 1ZS9A 1ISFA 1IHXA 2E1PA 2IZ7A 4LJKA 4TV9F 4XPZA 4YDQA 1IAVA 5M7EA 5FOVA 4C88A 2GAOA 1TA4A 5JQGB 1PYOA 2INGX 1G21E 2ZJBA 3OURA 3WFZA 2P3SA 2WQ6A 3PFIA 5DX1A 1QMPA 2GXSA 3LLUA 4J7AA 2VZLA 5HKBA 4CEHA 2BFFA 1YZTA 5HZKA 4OP3A 4QOIA 5AW0A 5HOEA 4RTPA 2VCYA 1PGQA 4J9VA 3D3WA 1V9SA 3OAAD 4F0JA 2FA9A 1BMTA 4OHYA 4Y2PA 1RKVA 4TTJA 1JXAA 2MOKA 2WWWA 3FYHA 4PINA 5F3DA 4O2RA 1D6JA 1QAOA 2ZR9A 3C3KA 2DQKA 1LF0A 3FJOA 3FUTA 3PC6A 4GECA 1L4KA 2HMWA 3L0OA 5I01A 1DBIA 5HFJA 4IDNA 3PKIA 4YCNA 1BHJA 1Z15A 2I7XA 2R6R1 4WJ4A 1UWLA 4N8DA 4HNTA 3HWX1 4PG6A 3UT5A 1GRRA 5HJ7A 2YIMA 3DKKA 1C7ZA 2JVJA 3ELYA 4QU5A 4DLSA 1O7JA 1BH2A 2GD6A 2Q07A 1PJRA 2YYYA 4PQYA 5AM1A 3SF8B 1I4LD 3TLYA 4AAYA 2QQ0A 4JL8A 1WCWA 3MSXA 3B7PA 3FNRA 4EMSA 2DBQA 5GJCA 4PWYA 1EH5A 4KQGA 2VUHB 3K9CA 3D0OA 1MA3A 4BFXA 4BBJA 4HBGA 5HXAA 1OBFO 4PSCA 1C3EA 5H83A 4HFJA 1JYSA 2BH2A 4P4SB 5ABPA 2QN7A 3ENQA 2HO5A 1WABA 2AMVA 1Z4OA 2X8WA 3VC7A 1YFLA 3OQJA 4C3UA 3GQBB 1EFCA 2VRNA 4M88A 3W3SA 3H9QA 4KFSA 3V1YA 1ZC4A 3TLJA 4URFA 1UK8A 3RRYA 1G21A 5LYJB 1G4HA 4EI2A 3WA7A 1M8PA 2D1FA 2J0UB 4M0MA 3TX2A 4DLZA 5EZYB 4KN9S 2K7FA 4MV5A 2DBZA 1XJCA 2ZUVA 3EVGA 1U5CA 4W99A 4LK2A 4XE5A 4CM5A 1X80A 3IVCA 5IT5A 1I9CA 3OTWA 2ZNIA 1NVBA 2ZCUA 3A4YA 4MGIR 4RD1A 1S6YA 2ZIFA 2XW6A 1R0YA 2NPIA 4R71A 1RPAA 1QZXA 1LRJA 1DOHA 4M55A 4ZGBA 2AFIB 4DV6B 1RHQA 3A1DA 4NAUA 1O0SA 4XTCS 1B43A 4CV3A 5AWFC 2X40A 1WDMA 4MYRA 1XJQA 3O3NB 1RYYA 2FJPA 2UUPA 4JX9A 4PZ0A 2A33A 4ZDWA 1T0JB 4F6CA 4WK0B 1DKLA 1V3UA 2W6JD 1J0BA 3AL3A 4WACA 4GMDA 4UXIA 3VDQA 4BFWA 1E89A 2Z4SA 1GD1O 1CDZA 3ILVA 1D2NA 1RFGE 3OUZA 1RJDA 2C2WA 1MOQA 2GAFA 2YYAA 3R0ZA 5DULA 1A2KC 5F3RA 3T5CA 2VTEA 1I3KA 4HDCA 3JQRA 4NK5A 4TS4A 4XX0B 3VX4A 1UH5A 3G13A 5E7MA 1X7WA 3U81A 1V2GA 1OTXA 2AN9A 4M21A 3QVJA 4EO4A 3MINB 4B4DA 4LEIA 2J3IA 4M1KA 4FIZA 5DU2A 5JI3E 4FDTA 1U2GC 1FXWA 1ELOA 3ISTA 1WJGA 5IZCC 2Q1XA 1K0UA 2BMDA 5C8VA 4Q21A 3F6PA 4U7DA 1R0LA 4KQKA 4IYRA 1UDWA 1J00A 1WBJB 3AINA 5GZ6A 5ITVA 3VZDA 3KKEA 1VKZA 2DTDA 1G8SA 1F51E 1P29A 1W4LA 1Z35A 4C5AA 4D6XA 1E2LA 3OM0A 4YCAA 3OBBA 5TGDA 3G0CA 4FWIB 2Y0PA 3PE6A 3QLUA 4GNRA 1IY8A 2GAAA 2QD5A 1H23A 1ZONA 3A37A 4G25A 1YZLA 5PNTA 2LR0A 5JDIA 1ACLA 2DKFA 2FRXA 4HTFB 2OYSA 3VQVA 3FM9A 4PU0A 4C7OB 5A7GA 3GOHA 4TTTS 1Q1NA 1FY2A 3UZUA 1TYEB 1Y9ZA 5KTKA 5DBOA 4TVYA 2VJCA 3I92A 4Y2XA 3C3PA 2ARUA 2I4IA 4GLJA 4C4XA 2QYHA 2JLQA 4TRNA 1E9FA 1M66A 3M2PA 2QSZA 3M6UA 1GTMA 5IBPA 2R6HA 2F8SA 3KDPA 4MVYA 1MTOA 2WI8A 3LMKA 1Q7TA 3LV8A 2E4AA 1DTWA 2DEUA 3UH0A 3AV0B 2ON6A 2WWYA 1II8B 2JIPA 4HUQB 3QEBZ 2XNDA 3D1JA 1DJQA 3AUUA 1NLUA 5EMLA 1E1TA 4QXQA 4E13A 1NTRA 9GPBA 3RF6A 1YHYA 2IHYA 3ANTA 5BOVA 5FT9A 3ZWMA 3NHKA 2QT1A 5FULA 4BL5A 1HQCA 5BSVA 2AOXA 4Q4LA 4DIKA 1HSZA 2ERCA 1HDIA 2PMDA 2W2PA 4JS0A 4YFVA 2VT6A 5KSYA 3BXOA 2RHTA 2B6NA 2WVJA 3LCRA 3R40A 1R6TA 3PCTA 1XTSA 3SNKA 5GOTA 2YH2A 5KYKA 1A7AA 4X8OA 3G8YA 3MWDB 2OCYC 3JQ6A 3NYQA 2C3OA 3GG2A 3I6IA 1LGYA 2FAXA 4G0YA 4F5ZA 3IMEA 1X3SA 4K5QA 4PCUA 3DXZA 2P40A 1U8TA 4XH9B 4BVHA 5LJLA 4R2KA 3WIEA 3NWOA 1GAQA 1EA5A 2OO3A 5IFKA 4JLDA 1Y3IA 5DX8A 3KAQA 5CXXA 5AK0A 3WQQA 1N2HA 3CZCA 4HCJA 4M7RA 4DR2B 3K9NA 1M1NB 2GN4A 4RADA 3I3SR 1FTYA 1ICEA 1QIKA 1RRKA 2R65A 3BH0A 3TKLA 1Q0RA 3I0NA 2ATCA 3DKRA 5AW5A 1BD3A 2JGDA 2Y68A 5A02A 3NETA 1SQFA 3FNIA 4MB6A 3WS7A 5H68A 4WCFC 4X5OA 2V9CA 4Q9IA 4C1BA 2QTHA 3QEJA 3GEEA 4LZZA 5CT8A 1VBKA 5JS6A 3VAAA 2CGEA 1P0PA 2AI2A 2Y05A 4BKOA 1E8NA 3RS9A 4DCOA 3RF1A 1T5TA 3INTA 1B8NA 2P9JA 1OC2A 4E14A 4EK9A 2E10A 1G3RA 1NW7A 2ZSIA 3GFVA 4Y6QA 5L53A 1VBNA 1EIYB 2O9JA 2YJ4A 3NAGA 4G09A 3TDMA 1EE1A 2P9HA 4EI8A 4OBEA 2KB0A 3O94A 5AVUA 3CF0A 2IK8A 3CFYA 4N1AA 4IJUA 4DLLA 1KY4A 3ABRB 3CXRA 1B14A 3TQHA 1Z8FA 3QHAA 5F78A 4RMJA 3NFRA 4NRDA 4YJHB 4V03A 2Q2NA 4LY0A 4FX5A 4YREA 3RTGA 5A7FA 1V39A 1W48A 2F1IA 2QUHA 4XUEA 3ELBA 2P2ZA 2DR2A 4M9ZA 3UHPA 2ZZGA 5A5DA 2QM7A 2QRJA 3PDCA 4ATNA 1CY0A 4CL8A 3TDNA 1E58A 1TECE 1OHHD 2FLKA 1L8LA 5A1JA 1MT3A 2JFGA 3ZQJA 4MLPA 1AMOA 2Q1TA 3RGLA 1XEAA 2E5WA 4EY6A 4KW7A 4RKEA 1WB6A 3U9TA 3A6EA 5ERGB 4C07A 3IP7A 4UTOA 1JAZA 5KMGB 1IWPB 2HCRA 4AYXA 4FOSA 3UV6A 2PAFA 1GDHA 3H11A 1DRWA 3E35A 4FGWA 3G0IA 1WB5A 2QLLA 2Q6OA 4JOBA 3BWMA 3CX8A 3PCOB 1R4NB 1ZICA 1ONNA 3N74A 5DBFA 1H2RS 4P8RA 3U19A 3L40A 3R3JA 1VP9A 3PNQA 1ZAKA 3QX3A 3OTOB 3L4JA 1FRZA 3G3EA 4MR7A 1RBZA 5DCUA 5JH7B 1V4VA 1R4MB 1P6UA 2PX8A 1U90A 2JK1A 3NTQA 1V25A 2CFCA 1MPTA 2FXVA 2JIRA 2OESA 2BHLA 4HYYA 5AUQA 1OU0A 1Y98A 2EF0A 4Y2VA 2NSJA 1A27A 1X87A 1GEGA 2C4VA 2IQ5A 2ST1A 3F90A 2CK3A 3QHPA 4DLNA 3T9CA 2JRCA 2MMCA 1BX0A 2FRVA 2I2CA 3DWEX 3G0DA 3MMPA 4HLUA 4U00A 4ZT4A 3D7RA 3PLNA 1KJQA 1WKCA 2Y67A 4GSYA 5A03A 3HO8A 2PE5A 5LZ5A 4JENA 5KYNA 3QA9A 3W9YA 4UBNA 1QVRA 5F2NA 2FSVC 4X71A 2PMKA 4DARA 3ME5A 2ODWA 4B6FA 3SJUA 2EW1A 2V58A 1Z5VA 5DRYA 1IIRA 4S2EA 2OAGA 3FFXA 4J0QA 3P9ZA 1EFKA 1XDDA 1BDBA 3D9QX 2VK8A 3L5OA 1TB4A 1TKAA 5DI3B 1P9WA 4PS0A 3AB8A 4CCYB 2LVBA 2NXWA 1PE0A 3VZSA 2BKAA 1ZESA 2G77B 3EDRA 3MWGA 4KMOA 1WTCA 4UUAA 3VR5A 1R27A 4IJ5A 3ZK9A 3ZXSA 4KJXA 4F8EA 5EJ5A 1IOZA 5F2OA 4YRKA 2CYBA 3NKVA 2RGBA 1T4MA 1GVNB 5G0VA 3INRA 1P0FA 1QKKA 1T9GS 5C46F 4PHTA 3JZIA 4D4GA 5KU7A 3NHLA 1M73E 1ZUHA 1XZIA 1C3OB 2QG6A 4E1BA 4R3UC 4URUR 5HF8A 2TYSB 3ZK8A 2W6NA 2ZUBA 1B8OA 1MC5A 4YJFB 1OXXK 1G98A 5ARDA 1SQ5A 1TMOA 4DBLC 2JCSA 5U9CA 5CCBA 2XUOA 1W0JD 3SIWA 2Y6VA 4JAVC 2CVOA 1H93A 4WCVA 2YVAA 2ZB4A 2BM8A 4MQFB 2VQ6A 5T8KA 1H2BA 1SKMA 3DVQX 3WG9A 4JVSB 2ZANA 5IH7A 1M0SA 2O1WA 3GXBA 2N75A 2ZJAA 1J1IA 3W3AA 2CFTA 4P74A 3G8CA 2HBQA 3IBGA 2Y1LA 4IIBA 4PZAA 3CLVA 4L3OA 3UYLA 2HLHA 3MCAA 3PL5A 8ADHA 2V6IA 3ZHZA 2QTTA 2X9LA 2XKKA 4MR8A 3O82A 3QELB 2ORWA 2JLXA 2UYCA 2Q8NA 3TBKA 2WKRA 3L01A 3KV3O 5LQMA 4F04A 1P0MA 2C3MA 3FE2A 3ZD9A 3UK2A 2AQKA 3EOAI 4D9NA 2DH5A 1DOZA 3IQFA 1QZ3A 1OH5A 5EHXA 1LH0A 3NOXA 4UC0A 3U6KA 3G1ZA 2XY4A 1L3IA 2DU5A 3F71A 3CLUD 1IL0A 1EVJA 3L0DA 5KOJB 1OE0A 4GMXA 1JR6A 2WJGA 1AZLA 1JG3A 3BIOA 1XROA 5CA0A 4D9FA 3OT4A 1W93A 2O6HA 5T3UA 1UKVY 3MTIA 1YDWA 1ZA1A 2WEKA 2J9FB 2TMKA 4GKBA 2BMWA 5T4EA 2YUTA 4PRZA 5C81A 3I9V6 3IA2A 1YK0A 2QZ4A 4GOOD 3GMSA 2BP7A 5F5XA 2FI1A 4CF5A 5FA6A 4EKIA 3TEFA 4UHDA 1UDRA 3BSSA 3M6MD 4GOXA 1J70A 4YXWD 5IJ0A 4TYWA 5CLQA 2O8DA 3NDBB 4ZHSA 2D62A 5CG1A 3CS3A 2EAYA 1MJFA 2XMCA 1T9HA 3ONEA 4Q9KA 2MJLA 4XDZA 1YI8A 3ZHQA 2G5CA 1E64A 4QD3A 3NHSA 5CFNA 3UGKA 1PDWA 5CCDA 3RK4A 4Z9YA 2HIGA 5ITWA 1RTTA 4YA6A 1FXWF 2W37A 1PL6A 4B8ZA 3DDZX 5EFZA 1BZYA 2EHDA 1GG9A 1UAGA 1WPQA 3I39X 4RKYA 4RAOA 4AURA 3I42A 2QX4A 2CY0A 4F4CA 2D2FA 4YT4A 4J3NA 1C1HA 3K9HA 3D4NA 3HUUA 1XZHA 4UDYX 3IDQA 3ZLJA 1E7YA 1R7RA 2WR8A 3G1UA 4OIMA 4R54A 4LXTA 1MAAA 5C2JB 3UPTA 1KGDA 2BBWA 1EZ4A 5JNSA 1U04A 4L2IA 3TCNA 3O3OB 4ZO7A 2BY4A 1LTKA 3UAGA 2EW2A 3EUEA 3TNDA 3GPBA 3FG9A 2Y4OA 4WEOA 1A7JA 1BXZA 1YZVA 2YZ7A 3GR6A 5KSPA 3TCXB 5JZMA 2QG9A 2P1DA 1WU7A 3MERA 4O2BA 5CHEA 3WYDA 1RBYA 5HS4A 4R83A 1SZDA 3LYUA 3LUAA 2O4UX 1NUTA 3LVBA 4PG4A 4PO8A 5TGZA 5HA5A 1YTUA 1E5TA 3PDIA 4KH0A 2B7LA 1YT5A 1L5ZA 3HL4A 4ZP1A 1B15A 1XB2A 2AJDA 2WT4A 2QZ9A 1DKQA 2GEFA 2FJUA 2OCBA 1E96A 1FQOA 2Z5FA 3AUAA 5E9QA 3NRBA 2IY5A 3BERA 4U3JB 1ZGCA 4C4YA 3E1GA 3GL9A 2AJTA 4CKWB 3P45A 3V34A 2WF6A 3ASUA 2Q5OA 3DUFA 3QA3E 5AW1A 3VH2A 3HLTA 4MLZA 1Y9EA 3MUFA 3KWFA 5BORA 3SM9A 1ZD4A 4M60A 2H11A 5IMSA 2R85A 2WUWE 2RGNC 1QU3A 4EYSA 2NUTB 2DTEA 5TNXA 4F85A 3GD5A 5C1BA 1SKQA 3LQKA 3H9CA 3J7TA 2RIRA 4DV1B 2B20A 1BHSA 2RC6A 5H70A 4GZLA 4HH1A 5EJ9A 2QMHA 4H2DA 4X3OA 4IIXA 4UD6A 1QYRA 5HSGA 4TZ6A 5M3BA 2VHUA 3JWGA 2PA0A 1SXHA 2Y2VA 5CM2Z 4EEKA 4KODA 4EHNA 2OBNA 3Q7EA 2AG5A 3E22B 1SUWA 1TZ2A 2COUA 3GEMA 4YCVA 3TH5A 1V5GA 4ZEVA 3KKZA 4P35A 2QVYX 1SUFA 2KBEA 3PSAA 1OKKD 2QQ5A 2QW8A 2RGWA 3CR7A 4YK7A 4YRCA 5EYPA 4FDLA 1Z6GA 3SZMA 2JDIA 4ER3A 3SVTA 1QP4A 3I1JA 4US1R 1LV8A 1NW8A 1C1XA 3H7AA 5B6JA 1CUXA 4H2WA 5F73A 3SZLA 2FVYA 2PRZA 4JQOA 2NVUA 4XTVA 4KLCA 5CXUA 4U7GA 1AM4D 1N2OA 2G8LA 4LRTB 1P91A 3A9CA 1EGMB 4B47A 2V0GA 1R88A 2E7ZA 3G68A 2XQGA 2X0EA 2EJTA 2GK3A 1H2WA 3IT3A 3WYFA 2WMDA 4RF4A 3OJXA 2RI6A 4AYWA 5L3ZA 1P39A 4UNSA 3W78A 4O1IA 2C0CA 4X64B 4Z9FA 3HP1A 4F11A 3OOYA 3F46A 4F6LA 1C0AA 2AE2A 5FWXB 1Z4PX 3AZPA 2G40A 5C8YB 2NNWB 4HADA 4B3TB 1NYRA 1KJ8A 2XWQA 3GA5A 1WNFA 3EF3A 2BTQA 2DQZA 3EISA 2Q5EA 4DF3A 5K09A 4FC6A 2H92A 3Q3GE 3V42A 2FE4A 2K2QB 1TT5A 2EARA 1NYLA 1ML4A 2QTNA 1HRDA 1AF7A 2QTAA 3L6CA 2EZ9A 3QYAA 4OB6A 4R2MA 4YDSA 4CQNA 2C0QA 1USGA 4ZU1X 5BSUA 4AKTA 1FP6A 2E4VA 2JIZD 2VNAA 3MQFA 3PQ2A 5EWMA 3T4PA 2JW5A 1XFDA 2POCA 2VDMB 3KO8A 3F6YA 5AW9A 1WZIA 4QDZA 1AKRA 5ED0A 3LTEA 4QZVA 2Q9UA 5HF6A 3PRKE 1RWNA 5DE3A 3PFWO 2DUNA 3ESCA 3MTQA 4PEVA 3UK0A 1CJUC 4EQ6A 4ALLA 4M87A 3GJ5A 4GFDA 2BUCA 1LPOA 4BUZA 4ZK6A 4PCLA 4ZC1A 1M33A 1P7ZA 3U13A 3QY9A 4XB6B 3WL6A 3RTCA 4G1EB 1XZQA 4W5JA 5CCEA 1NUQA 2BMFA 3ORHA 4PX3A 4D25A 3JATB 1DFIA 2HUNA 1RJ9A 3S81A 2IEIA 4N47A 4BRZA 2IHJA 2CDNA 4X6YA 1CK4A 5DT2A 3R5TA 4G97A 2VNSA 3U9SA 1PTJC 4FYJA 1GRVA 4PLVA 4EMUA 4M7OA 3OD5A 4OO3A 1TVCA 5DYYA 1P2FA 3BQMB 2QRGA 2G82A 3GT0A 3SXJA 1CRWG 2Z2JA 4BE4A 1GPLA 4G9BA 1ZNZA 2OC9A 4XU0A 1YJCA 1AUXA 5CAEB 3F5MA 3GJZA 1Z4MA 4Q24A 3IPYA 4LHWA 1WL8A 1PO7A 4MW1A 2VDVE 5BN3A 4B0PA 4YUWA 4OUDA 3ZW9A 2X76A 4QDJA 2VPPA 5FB3A 3NJ8A 5LVAA 2BEVA 3LBNA 3RSOA 6CHYA 1PYSB 5K03A 4IHQA 2OR3A 2HGSA 3LY8A 4MV4A 4ZK2A 2QM8A 2FSIA 3KPYA 1Q7RA 3OT1B 5H0IA 4CYMA 4E4RA 1UBGA 3K71B 3STXA 4F6RA 3RUXA 1TIPA 4NBWA 2HU2A 3MT8A 4BQEA 3KKKA 4L9SA 4DSOA 1ZI8A 2V3VA 3NHWA 2QN3A 2A9FA 2G5PA 1WUTA 3NEAA 4OGLA 1R0WA 3B6KA 4IDOA 4FFLA 4WLUA 1PFWA 2VQFB 1UKYA 4BWFB 1ZM2A 4G0UA 1HNXB 5CVCA 3L4BC 1EUDB 3LT5A 3HM9A 2Z3ZA 4B6JA 3KUKA 4YV1A 4YP0A 1E3DA 1N5MA 3DT6A 3PRYA 2H1FA 5E7QA 3AJ8A 4WXPA 4Z5XA 3W06A 1OI3A 1U11A 1DKNA 2PR7A 4DDTA 2O8CB 1WEKA 3OFJA 5EXXA 4DAEA 5J4VA 1UJNA 3GG9A 3RKWA 1DQPA 3SWWA 4NCAA 7MHTA 1JHYA 2QM3A 3BTUA 4UDXX 5BXYA 4AS1A 4H7HA 1ZUNA 4BLQA 3LO5A 4WESB 1NVVR 3NHRA 4GOKA 3V6LA 4QDTA 5DNUA 3RKUA 5KKCA 1WE2A 4S1OA 3GMIA 2HRQA 3GMDA 2D7CA 3DKIA 3G0HA 4AF6A 3FKSA 3LL7A 1QGYA 3S55A 3TKAA 2LP4Y 5DWVA 4ZYZA 3ZJYA 3EVBA 2IOYA 3F74A 4MKZA 4LUCA 4JIMA 5LP1A 4GKKB 4R4JA 2HHLA 3LCUA 3HJAA 3GLTA 1UCFA 1RM0A 3T99A 3N6VA 1NBME 3VISA 2D0OB 1MLDA 4G9EA 5ERXA 1IATA 1R8SA 3A4MA 3JQ7B 4EAAA 3WYAA 4KQJA 3S29A 4L4RA 1G59A 4YRRA 1EVYA 1EWTA 4CLXA 4EFLA 1P5FA 3BMNB 1NFQA 2AOUB 1NJSA 4IDQA 3SJAA 3DGFC 3CE9A 4B81A 2W9XA 2V45A 3H1PA 3NANA 3NYIA 4Z0PA 4LPKA 1R6UA 1HKHA 1S4MA 2I2AA 1F2UA 2OQ2A 4JL5A 3T06B 3Q8KA 3N8IA 2AR0A 3LC1O 4R8LA 2A8EA 5TQJA 5CA0F 3OQOA 3RUEA 1DX9A 4TRMA 3LL4A 5EESA 4U7PB 6Q21A 2R79A 1MX1A 4PGHA 4YAUA 1NNLA 4IOJA 4PGAA 3PRHA 4QSMA 4QTUB 4RZXA 2QRHA 1T9CA 4V0QA 5AXDA 3FVRA 3ZXUB 3G02A 4CR6A 2JJ8A 5JLJA 1Z8NA 3D7MA 1WQ3A 1TLTA 2CXUA 1X55A 3QO8A 3LF1A 2FZ5A 3O3CA 3R5XA 5I4BA 2IUYA 4Z9AA 4XX1A 1VE6A 2A0FA 2X1VA 2ZBPA 1U9IA 3K1YA 3LRTA 3OZUA 1JQ5A 4XPIA 5HZGA 5EP2A 5D5PA 1PT7A 3TEHA 1K4KA 3DL0A 1DWPA 3GFPA 3ONFA 3T5TA 4EECA 1YR7A 2W90A 5LUBA 5JV5A 4MRVA 2FPWA 1M6EX 4FNOA 3OPYI 4QIHA 1VQZA 4AY3A 4D80A 3AESB 3LC0A 2CUNA 3B1ZA 3I2YX 1EHCA 4E5SA 3BOSA 2ODPA 2GETA 5KSWB 5BSHA 4ZVVA 1BA2A 5C7IO 1L5MA 5KWEA 3JQFC 1P7CA 2ZB7A 5GQSA 5FKJA 2AYZA 4G5HA 4JLJA 1BBUA 3W0LB 5JZ9A 1SBQA 3U40A 2ZAGA 4AFNA 1NBMA 4NU8X 4YJGA 1UC8A 1WKBA 1LZKA 3AEXA 2VWPA 1FVXA 2PH1A 3HYRA 1GSOA 1UBNA 2HK7A 3AQ4A 4JJ7A 5JD4A 4Z3KA 2D1TA 3DEKA 2JGEA 1Z07A 2RHRA 4KIWA 1E0AA 5LZ9A 1E7SA 3VUEA 1I7QB 2N0SA 2YHSA 3SYNA 2QX9A 4GNKA 3R7DA 1UM9B 4FKMA 3D6MA 4MXDA 4MW5A 4PW0A 1P1JA 1RZRA 1LLDA 4O2BF 1F6WA 2GJ8A 2Z09A 1N0UA 3WIDA 1Q16A 6REQA 2IZ1A 1YFTA 4MUAA 1TI7A 1BKSB 1GA1A 2WA2A 2EIXA 2YDXA 5C3MA 5JJCA 3VR1A 4AX8A 3U3ZA 3ZW8A 3M2TA 3VKUA 1NLZA 1FSGA 2PL9A 5FAXA 1BBWA 1V35A 2W6IA 2WM9B 1M8FA 2UAGA 3O9VA 1R4ZA 3TSYA 1JHRA 4RMGA 1I2BA 2D0IA 3NIBA 4AM8A 2QEQA 5CD9A 2FSSA 2I3ZA 1GIAA 4Q7KA 4R1NA 1FJXA 1W52X 5IPFA 2X0FA 3T8YA 3EAGA 1OIVA 3BGIA 2Q0HA 2QDXA 2IYWA 3KJZA 3M3HA 1DDOA 3NENA 4V2UA 4K05A 3PPVA 2F48A 4YASA 2CLDX 2MWMA 1O4VA 4GX1A 5T4HA 1UZNA 4B34A 1WMSA 3M6WA 2Q0SA 4KWCA 1IZYA 1PZEA 3H2YA 1CUAA 3VZPA 2CNBA 3T7CA 2RD2A 1YVPA 5FWDA 5JZOA 3K05A 3JALB 4XVHA 3C98A 4F3NA 2WLSA 5J4KA 2Y99A 1RYFA 1WQ7A 1XZ8A 1Z2DA 4TZTA 2UXCB 5HE9A 3FROA 3W8RA 3HMQA 1H1TA 3ZG6A 3AERB 3U60B 2O54A 1FFBA 4R9UC 2ZU6A 4M8NE 4CW7A 4WTOA 4Q3CA 2BEJA 4LC9A 1Y34E 1S5PA 4F86A 4CIBA 2VC2B 3ZD6A 4H1UA 1CY6A 2FPLA 3VR6A 4DY4A 4ED9A 4XWKA 1DBRA 5T5QA 3HEAA 2VHZA 4O0MA 4INAA 3LT1A 4M76B 4NI5A 4PS1A 1AZSC 1A69A 1ORTA 3HJHA 4P1ZA 2BR4A 2BDEA 1D4OA 2JGFA 2WA1A 4IP0A 4LXQA 3HKDA 1N5RA 3VAZA 1WBDA 3OZ7A 4BEBA 3A28A 4OQ4A 1YA8A 2HMTA 3ENVA 1H5QA 3DTVB 1GV1A 3B38A 2C29D 4RY9A 7ABPA 1L5OA 2CNDA 3M4NA 4HNAA 3A3YA 2OMEA 1BWRA 3LC7O 3BL5A 3ZQKA 1KVRA 1KAGA 3EOZA 3RUFA 2DB3A 3C7AA 1OILA 2Y3IA 2AMFA 1I1QB 1L3BA 2C03A 4KACA 1O6ZA 2NSHA 2IWHA 1STOA 4YI5A 4DM3A 1NSYA 1U3TA 3BGWA 3HI6A 5K1XA 1MTZA 2IJGX 3JZDA 3HJNA 4IFIA 4W6QA 2MYPA 4Y6GB 4E03A 3HV2A 3LYHA 4E2XA 5EIBD 2ZSFA 2QD4A 3CGWA 5JE8A 5HNKA 2QTLA 2VYQA 4TOIA 4QGHA 4ZHQB 3OQIB 1P1BA 2PWZA 2O7VA 5CEFA 2IELA 4AWAA 3WNQA 5FYDA 2ZYWX 4X65B 1RQPA 1W1IA 2R6JA 2XOKA 1T0PA 4NEQA 1ZMXA 4KZKA 4XTYA 1NSFA 3ESZA 5YASA 1PSDA 1AQUA 4X1IA 5SY9A 4BNUA 2CDAA 1ORVA 1Q0SA 4BZPA 2Q1UA 4P4LA 3MMXA 3FLBA 4HNGA 2RK3A 2DTHA 1KFEB 3MG9A 3EZFA 4QPDA 2JZCA 1SKAA 1T4GA 1JE0A 1UPFA 2XYRA 2FPGA 4TROA 3LIIA 3Q85A 2DLDA 2ZSBA 4TWRA 1JLKA 3O74A 3QXHA 4UQOA 5LPNA 3P2EA 6ADHA 3HDHA 3NBXX 4I4NA 3U7JA 3ZDBA 1KVSA 4AJ1A 3HXYA 4B09A 1H8ED 3JASA 3C6ZA 4TQAA 2CJYA 1N3LA 1XMVA 2AKYA 4F4UA 1KFJB 2WK1A 3OIUA 4XQ9A 5MDHA 3D6HA 3PJFA 4HBZA 2IZ6A 1PQYA 3O31A 1IDN1 3KJIA 2JIMA 4FDMA 1V6SA 4U9HS 4F1JA 2CN1A 5CLFA 1XPRA 1N33B 1JEDA 2VSNA 2Y0CA 4O1HA 2ZPTX 2W2LA 3KSRA 4C2TA 4QU0A 1UZAA 1MV5A 1PJCA 1PL0A 1QR2A 3TXXA 1PCXA 1CUJA 2C54A 4IJMA 2QHVA 2CBGA 1LBSA 3EGEA 1BS1A 1CYDA 3FTDA 4V3BA 6AT1A 6REQB 1C30B 3R41A 3O8OA 1SPXA 3M7IA 4W1QA 1YB7A 4KXQA 5IC6A 4C9BA 1JI0A 5D87A 4EPXA 2B1JA 3HB7A 4JKOA 2C4KA 4N6OA 4EUFA 5JADA 2R5FA 4JT8A 3AJEA 1W85A 4D8YA 3TR5A 1X2HA 2LUOA 4JOQA 4E3ZA 1ZSVA 2FW8A 3PX7A 4AJHA 4JLWA 4A8JC 2ZJ2A 3QPCA 2NSDA 1IXZA 1QYDA 2RGYA 4HDOB 1KC3A 1Y1QA 3PWKA 5HZHA 5HP4A 1N2GA 2A92A 2XYVA 3HXZA 1X14A 1PX2A 3IT1A 3KYIB 1DCMA 3TTXA 1NP7A 2RH8A 4Q1FA 4PIVA 5ED4A 2YWGA 4Y9TA 1E5QA 3UWPA 3CZ4A 3X0DA 5FD8A 2YXDA 4LYYA 2VJPA 5CVJA 4C6RA 2YOFA 2RBKA 4HDMB 3OP4A 3VYUB 3DBHA 2WJAA 4BN5A 4FQ7A 4XCXA 3NX4A 4B7AA 2ATVA 5IF3A 2IHBA 4LGYA 4KFCA 3AEUA 3VDMA 3R5SA 2IPLA 2NACA 1CY7A 1V9LA 2E1RA 4MIKA 3I1FA 1BGWA 4YLYA 2QENA 5CDFE 1JEEA 2H1VA 4A5OA 1Z62A 4GRAA 4A6PA 4C04A 2BONA 4HQFA 2IYZA 3VVBA 1Z4JA 2PUBA 3ZNOA 2NYVA 4MV9A 2WYUA 3EGDA 1NVTA 1T3LA 4BQSA 4N41A 3TNYA 1N77A 4Q3EA 4L8FA 1YKSA 2H1CA 3R0QA 5C4MA 2I80A 2WJ4A 1LCIA 2DM6A 3BHJA 3L7NA 3WKCA 1O87A 4YYEA 3FFTA 1YU6A 2BPOA 3ACCA 4JVNA 3Q2OA 1Z06A 5JYBA 1POWA 5FR1A 1E2QA 2DLCX 1TJPB 3PEYA 2WTMA 1XF9A 2IHKA 4AP5A 2H2AA 2PA3A 4HNHA 2JATA 1TYZA 2PXHA 4Q39A 1Q20A 2IC5A 3HCPA 2X5KO 4BLSA 4DABA 2A30A 1QH0A 2BW0A 2PBLA 3TPZA 5L7WA 5LKRA 1JU4A 4FS3A 3ZS9A 4K6HA 1QQTA 5DF1A 3AM1A 4GUDA 1UC9A 1ABFA 2FPPB 1DOAA 3HWWA 3F49S 1JDBB 5FRDA 2WYWA 1CUSA 2BGKA 3DBRB 4H7KA 5ALLA 1ND5A 3GPLA 4EPTA 4Y7DA 3ES9A 5F23A 3ABQB 3IALA 2O07A 3JSAA 3WWEA 1LI4A 3AFOA 3B3JA 4QPPA 3E3OA 2I76A 2DGDA 2RKOA 3JVIA 3L6BA 1OZGA 3EAFA 4JT9A 4W8GA 1QCZA 3RIYA 4RTOA 3GLFB 3S1AA 1WZCA 1HEIA 1AGPA 3JR3A 4KQCA 1EP1B 1R1DA 2DY0A 2EEPA 2Q4DA 3A6ZA 3ZLBA 1D6SA 3QOXA 8LDHA 4B8WA 5CDFA 2LE0A 1RLOA 3WJ7A 5E3IA 3GARA 3S7ZA 5AKHA 4NV1A 3WI7A 1ATIA 3TBHA 2QP9X 3V48A 1K68A 4PAQA 1UXKA 1NRJB 2NLOA 2X22A 3GUVA 3KK0A 3OZIA 1R8QA 4RYDA 4EENA 2BFDB 4LOHA 2JCGA 1A4RA 4G0PA 4X20B 1U8CB 4ZMBA 1JDUA 3VR4A 1VLQA 4XVCA 2ALJA 2QVXX 4UZSA 5FF9A 1DC6A 3H9UA 3VI3B 3V1UA 1BWQA 3ZY6A 4AMVA 4DC0A 5JATA 2BGGA 3E81A 5E1OA 5JCJD 1YIOA 4NBKA 3CY6A 4KXUA 2JKZA 1URPA 4G67A 4TLEA 4J0KA 2ANBA 5E0KB 1MABA 4ZA2A 2DTIA 3KB1A 4LY9A 4S1TA 3KZ1E 3O8LA 4YRQA 2YS6A 2ZAIA 2ZUTA 3RGGA 2C8VA 3L84A 5THXA 5DYGA 3EVTA 3VVMA 2GDJA 3DMPA 3K9LA 4J6FA 4ZVTA 3LW8A 3OHMA 3QVTA 2MSWA 3H1TA 5LMCA 3PC8A 3RKRA 3SX0A 5HE8A 3SC6A 1SXGA 5G4KB 3ANLA 3NAMA 1HEUA 1PJBA 3CLKA 1CVRA 3QWBA 2HXSA 3KEFA 5CU7A 1XTVA 4GWGA 1O77A 2R9VA 3KIPA 2MSEB 1QFZA 4NBLA 2AF3C 4A6EA 1OLXB 3DM5A 3OE7D 2RHHA 3OOJA 1ZXXA 3PQEA 4TMYA 4HLNA 5GGYA 2MCFA 1R15A 421PA 4HMPA 3BSFA 1DO8A 1UJ5A 1TYDE 1U0OC 5JSHA 3UWOA 5JSZA 4MQMA 4PYLA 4YJ2B 1QIDA 4JGIA 4FMDF 2GS9A 2XGMA 5EAIA 1V1JA 2Z9CA 4DT1A 2A78A 2XKJE 5TEVA 1NZDA 3DDOA 3JD4A 4FGLA 5A4AA 3DVAB 3DBLB 1QF9A 3HJGA 4FEAA 1FTQA 4WZ6A 1Q2XA 4GG1A 4GD3Q 4O2AA 1IHOA 5HQ3B 5CNJA 5FOWA 4HP8A 2DPMA 4HZUA 4O5OA 5ILOA 2PS1A 3JQ8B 4JJGA 3STUA 3ZK7A 5A9RA 2O3UA 2OE2A 4J4BA 1N6RA 3R24A 5K3SA 2RARA 1ISMA 1GR1A 2NUBA 2PRKA 3FTCA 1Z6PA 3L82B 1X42A 1XVAA 2X15A 3LGSA 3IP3A 1JKFA 3TTWA 3U3MA 4XWOA 2R0QC 2RIPA 4G0VA 3B6MA 2XDQA 1ZBDA 3T1YB 2I3GA 2HHHB 3JQGB 5DVZA 3EIEA 2XI4A 4PPGA 1V9CA 2IDKA 4K6OA 3T6KA 1RHRA 1WXGA 3KDSE 4MVJM 1QE0A 2DKGA 3TO5A 3NTXA 1L6RA 2IIQA 3KB8A 4BS9A 4DBVO 3HGMA 3IXQA 1DWQA 1QYXA 1VJDA 2H48A 1PWYE 2QMEA 2XIQA 1CZNA 3WB2A 3WSWA 5JUWA 2F4VB 3PHLA 2QKYA 4IO1A 2O6LA 3R8CA 1SH7A 4RELA 1HTTA 4Q7QA 1CZUA 1WSWA 5HIMA 5K8UA 2YZKA 1BMFD 2WIKA 3K4PA 4OQYA 1A5ZA 1OH6A 3UG7A 2WG1A 3H8VA 1FIUA 1F0NA 1ORWA 5FLYA 3SR4A 1RWOA 1V7PC 1WDKA 3D0RA 3D54D 2C5FA 4PG5A 5FPSA 4BBZA 4C5CA 1EFPA 3KTAA 4RULA 3KYDA 2P2NA 4HPXB 1T3SA 4ZXFA 4Z54A 5LQNA 3UPUA 5P21A 4KQEA 1EAMA 2I3DA 4E11A 1T13A 3F3KA 3LJKA 4UCQA 1I7LA 3UJ3X 5B55A 4UBKA 2E0IA 4BZZA 2JB9A 3UC5A 2VHEA 3O8QB 5CVVA 2GLXA 2QGFA 5K0LA 4B7CA 4BV3A 2EQ5A 2GOYA 4YPFA 1LBIA 4RLHA 4LCJA 1ULBA 4E2FA 2UKDA 5A3SA 2OYCA 2FW1A 1WPGA 2CLLB 1ZK1A 2PXAA 3FMVA 4KOEC 5KAPA 1JJCA 2A0YA 4LRSB 1DBQA 2QI9C 4H6XA 2G0NA 4MVJE 2QVLA 1XLTC 3X1XA 2BFCB 1LXCA 5BVGB 4YXFA 3LKVA 1A97A 3GUUA 1A9OA 2EX4A 4CHGA 3L7CA 1ASZA 1EFUA 4R05A 3ML1A 4U5XA 4DYHA 1ILEA 1TCCA 3ZQUA 4G0QA 1WQWA 2AEJA 4JYBA 3RVBA 4U2DA 4BGVA 2VJOA 1JAIA 3L0SA 3VMFA 5KX5A 3RNLA 1YKGA 5T7BA 3N2NA 1IEQA 1Y3BE 4IYJA 4K2AA 3ZTTA 4AZ3B 2H4YA 4TQDA 1RLUA 3VOAA 5DCYA 4NHEA 3ICVA 5CW1A 3EA4A 3LSSA 3VR3D 3JVEA 4OKIA 3PXGA 4BLOA 3R44A 1IPFA 1S0UA 4AKSA 5EIEA 3M4QA 1IVSA 3F7MA 1OFIA 2NVWA 2HRRA 3O92A 2ZQYA 3W5IA 5KNBA 4NZYA 4C4SA 3LSTA 1XHFA 2VDRB 2B82A 1NJ8A 3I0MA 1C8KA 1FX0B 1ZIOA 3RBVA 3FWPA 3CB2A 1WV0A 2ACKA 2Y1WA 2ZG6A 3Q2KA 1D4AA 5DFAA 3WY9A 4UNRA 2ZOSA 2FF7A 2HUPA 2I3AA 1BCSB 1HSOA 2FNAA 2FOIA 2HA4A 2ZBGA 3FUVA 1VE3A 4IMJB 1JJVA 3LX5A 4G8CA 1RQ7A 4RHCA 5IAEA 1GNQA 1MIOB 1T36B 3AJAA 5CBPA 3I83A 5F33A 3U16A 4LE0A 3RWOA 1DELA 1QTIA 1XRPA 3DTYA 5GADl 2A59A 2NXEA 1EQUA 1LDYA 4CXMA 1Y8RA 4KLZA 4RHEA 1XK7A 5LA6B 3VC2A 5L51A 2IE0A 1V11B 2ZRNA 4I50A 3TLGB 1GL7A 4FTWA 2GHTA 2F1RA 4IUDS 5K3AA 3OMLA 4D82A 1IQRA 1E3MA 1BQEA 1JG1A 1U3FA 2GGSA 2GXQA 2OOKA 4MVJA 2Q8PA 2H1LA 2X8JB 1UBJS 1Y7PA 4MB0A 1Z5NA 1I2CA 1AXGA 3MJRA 2PYZA 1E4OA 2NPFA 4C3ZA 1ISIA 1YL6A 4YUAA 1PG2A 2VSQA 2TMDA 3UJNA 3N76A 2GYWA 4NJEA 4H16A 4QJIA 3FZGA 4N0EA 4HAWA 4ENTA 5LKAA 1RQXA 1NL3A 2OC4A 1E6CA 4ZT3A 5JRDS 4J6EA 5EPOA 1SRYA 3RVSA 3K35A 3RHFA 4XQ0A 3L0YA 1X7XA 4QTZA 3BJRA 4KE8A 3VNVA 2O19A 2HFJA 1PQ4A 2ZM6B 4OHCA 1B7YA 1BKDR 4LSMA 4Q02A 1GGMA 4JU9A 3HJFA 1A9PA 1ORIA 4KYVA 4N3GA 4RSMA 3MGCA 2REQA 2QORA 4OFXA 4TLDA 4ENRA 1NPTO 3COVA 5HKKA 1IMOA 3SFTA 3IEMA 4Q0MA 3BA1A 2Q2VA 4QHSA 4C0XA 3B1WA 2I6FA 1REQB 1X94A 2QX6A 3TW4A 4EF6A 3BJUA 1WA5A 2QIPA 1P1IA 3WZMA 2PXXA 1JDJA 3A3KA 3VNRA 3WA6A 4F3YA 3HP7A 1G291 2ZTVA 1O95D 1XJ0A 2BJVA 4I1SA 3AF6A 1JDBC 1NYQA 3FSGD 4KDRA 1GKYA 1ZH4A 2RCNA 4RA9A 2X1LA 2GCEA 4F9TA 4YR7A 3THWB 4IX1A 1LPAB 2VP5A 4UARA 5HGQA 3B51X 5TVKA 1X1BA 2GZ1A 3S2ZA 1HE5A 3KOZA 5CB4B 4ZCIA 1WXXA 3GBSA 3RYIA 3DOIA 1B0ZA 3KR9A 4MJXA 4DBZA 5AVZA 5BSEA 2AOWA 2BHSA 2L42A 4E4TA 2XGJA 4M99A 1H9BA 2FHPA 2YNMD 3JVDA 2R751 2VR1A 2ZYGA 1EK1A 1SC9A 3BH7A 3I8SA 3NIDB 3S44A 3DWIA 5HX7A 2FEWB 1DRUA 1P1KA 2HJVA 1J90A 4FDVA 4XJSA 5IH3A 3SG0A 2O8BB 2C20A 3DLTA 3MMZA 5CIQA 1WXHA 1B6RA 3NH6A 3QJYA 4Q7JB 5E6UA 3LECA 4WJKB 3WLPA 4QFCA 5H1YA 1Y6GA 4LYHA 1GV0A 3TPFA 5FAKA 1N75A 4HXYA 4CV2A 4DA9A 3JYPA 4A2CA 1IHPA 1DIAA 1YR8A 3FPEA 3R0JA 1ZOPA 1EWRA 3I6MA 2FP4B 3ABIA 2HWUA 4CH4A 5ALGA 5L40A 2R11A 1HYGA 1KZGB 1S2GA 4P75A 5CDTA 4H2VA 1N7HA 2AOTB 1NBHA 2V0CA 2M98A 2Z2ZA 5FUXA 3KETA 4MZXA 1WNLA 4I3FA 3ETNA 5P8WA 5M34A 3AHJA 3X2EA 3WGLA 4JT4A 4DB2A 1TC1A 4LV5B 3DYBA 3HB5X 1PJ4A 3N0RA 3ZZUA 3HFZA 3AP1A 3R7WB 5CCXA 4WCDA 4XM1A 1ESMA 4ZYVA 2GHIA 1TUBB 2YN2A 4LX0A 3RIHA 5EJ8A 4B32A 1JPUA 1Z2PX 1T8TA 3TL6A 5EIBC 3K5IA 1ZBQA 1GUZA 2J07A 3FIJA 1TQHA 1F0YA 3OSZA 3UMBA 2H52A 2ZIWB 4WN9A 3T38A 1U81A 1WXDA 4YRGA 3AI2A 3EW7A 1LSSA 3DKVA 3JZMA 2BKXA 4RTJA 3BWBA 3ICCA 4DNOA 2NT3A 4YMTA 2BEWB 1JF8A 1SBHA 4LSGA 4Z0NA 3D3JA 2GXUA 3AHCA 4MYSA 2QLBA 3SD7A 2BM1A 4RJJA 4PSUA 2VAMA 3FCSB 2D00A 4PPYA 1MG0A 2XDYA 3T34A 1KY5A 1ABEA 1T2AA 2JAPA 2LGJA 3P9RA 3QXCA 5JJ5A 3QOYA 5TMEA 2AOVA 4F9GA 1EK2A 1XZKA 1GG5A 2NU8A 1X2BA 3IIMA 4EUHA 4NX2A 3CGGA 1TIBA 3ZWAA 4MVXA 4ZO9A 4URVR 2HI0A 3QMVA 2G0TA 2XOXA 3PKZA 1V8DA 4DNFA 1N2IA 4LOAA 1XMPA 3WL5A 4DGQA 1SCQA 3IEPA 3U6BA 1AMUA 1XD2B 2QTFA 2HF2A 3K1AA 3A1VA 4UUBA 2GYVA 3KS9A 4QTXA 1D1SA 5CGQB 3ZY2A 4O2AF 4Q3LA 3NGLA 4M8SA 2LIPA 3ND6A 4JB2A 5G2OA 2ALYA 4BMXA 4C0AC 1U7ZA 1Q5PA 4U9UA 1UOOA 3NBUA 2PNFA 3OOEA 2O2DA 4QC2A 5EMKA 2I03A 4PY2A 4CM4B 2NQTA 4M1MA 1MX9A 3BJEA 1JPNA 4JIGA 3BRWD 2NTJA 4OKSA 4X6UA 2EDCA 2A58A 4QGGA 3SQXA 1SK8A 3C4VA 3QG5A 3ROXA 3EIFA 2GN9A 3PFKA 3LW7A 2NTEA 1C9JA 2WHYA 3HYSA 3MPOA 3H2GA 2KQUA 2BBTA 2PLWA 3UJHA 4EKDA 5BT8A 3AEQB 1HLGA 5E8JA 4WKPA 1WNTA 2OGSA 5F7ZA 2D4AA 4U8GA 3M4PA 3GEHA 2FPIB 1OKKA 2EJ9A 3BK1A 4KNWA 4II7A 4EPRA 4D8WA 2ZIVB 1W66A 3OFND 2FP3A 1PKEA 4B4OA 2WAXA 3N6RA 5K4HA 3LE8A 1LC3A 3KQPA 4WNAA 3WGJA 3X2FA 4EGCB 1HE2A 1KJJA 4CF3A 4UNPA 2CL7X 3QOWA 4GZ3A 3PT9A 2JI6A 2MIIA 2REXB 3HJBA 2XBLA 1USIA 2ECKA 3I34X 4PXAA 4X6XA 5D01A 3PA6A 4EO7A 1X39A 5K7SA 2YASA 5JMPA 3C48A 2EL9A 3PNMA 3QRWA 1A8UA 4RTSA 4UD2A 3WHLA 1MC1A 3N3AC 2XQJA 1UBHS 2V7VA 1M2HA 5I7HA 2YWDA 1K4YA 1HETA 1CVIA 3PT5A 4DMFA 2PV0A 4RJLA 4IOKA 1FNDA 1PU2A 4X6LA 4XYBA 3UXHA 5LXTB 3MWEB 3VBCA 3G2IA 1HK7A 3WGZA 3ZIAD 4ALMA 4RVGA 5IYZA 5A62A 5E2AA 1SOMA 3QVWA 4YI3A 2OV2A 1B93A 1BQ3A 3LYAA 5CJ2A 3NDRA 3ZZTA 3IMFA 1WHTB 2PVSA 3K0AA 5G0WA 3BXXA 3TTYA 3V1LA 1NVXQ 1FYDA 1SVOA 1NUUA 3F67A 3WMXA 4MK4A 4BQOA 5ICCA 4GWLA 4LGCA 1QGUA 1RYEA 1T24A 4QPJC 5CTAA 2A1UB 3FLMA 1R3UA 4LXIA 4UOQA 5KYUA 4ESEA 5H59A 2JIZA 1XDBA 3V2HA 1GZ3A 4GXQA 4LVIA 3K92A 1QGAA 3Q2IA 5KX5F 4KEAA 2YN4A 3H17A 2HDHA 2VSYA 4JMPA 4F9FA 4BNGA 4DE5A 1AQJA 4TN5A 5JXIA 4NYMR 5LWHA 1KS9A 2O52A 2H31A 5BURA 4BGDA 1Q7CA 4DDMA 2O7QA 1KDYA 4E21A 1ODFA 3O1LA 5KIAA 4ZOLB 3UKJA 5EZSA 4U2CA 3OPNA 4FMBB 3WLQA 2DC1A 2I6XA 1QFYA 4UAJA 5GMOA 4MEAA 5I7OA 5DOZA 4Q9JA 1QH8B 3HB9A 4A1FA 3HADA 4A9AA 1DADA 4H2XB 3WGHA 5CVTA 3IAM1 2C2MA 2HQRA 1N0VC 4TMZA 1UBOS 2ZE6A 2WNSA 2W6QA 3ER9A 1NPYA 2EKQA 1GCAA 2A4KA 1U4NA 1E2IA 1YI0A 2WFLA 5D3KA 2I54A 2PSDA 4X3PA 1RAIA 4B17A 4LF8B 1F7VA 3E6AA 1MKYA 3SAJA 3C24A 1T5IA 1UBRS 1M8GA 2Q5QA 1DU4A 2XNSA 4KWIA 4DLXA 2OFFA 1ZLYA 1OGYA 1KKMA 2E4YA 2RC5A 4MZDA 4PYMA 1QGED 2OILA 1KEPA 3VRHA 1XZFA 2IUFA 3ZHRA 5A2GA 4DR5B 1GFWA 3QNEA 3CJQA 3GDOA 1G8HA 3BMQB 1LNQA 2J46A 3AZQA 4I50F 1J22A 3MB5A 4NCKA 4OFWA 5DHTA 5E9JA 2F1JA 4MW0A 3VVCA 1G2PA 1KAEA 4MVJF 1YL5A 4U9IS 5AJXA 3QI7A 5FWNA 2O0KA 3M0EA 3WL8A 5JXGA 2C7QA 1GKUB 1LI5A 3SQOA 1U3GA 4FWBA 3SS7X 3UWMA 1RHKA 3UTCA 1UXHA 4PQGA 5DNVA 5JT1A 4ZAXA 3O1HB 2PKCA 1L4FA 3R5HA 4DJ5X 2PGNA 2IHZA 3EMDA 4YNBA 1DIBA 3OWHA 4Q05A 1X92A 4BECA 2A84A 3O2QB 5KEIA 3HZZA 4FT4A 4DHEA 1FDWA 3WJ1A 5I9MA 5AJYA 1AGRA 1SCIA 1K66A 2IS4A 2VPQA 4E30A 2M32A 3LX4A 1ZQ9A 1DVRA 1JRLA 3S2GA 3IJEB 4DDUA 3MTJA 3BT7A 3S0JA 4UPDA 3GEIA 2R97A 4JEUA 2DXUA 4EJFA 4H2SA 2VJKA 1KSHA 3CW8X 3NH9A 1Z4IA 2AUMA 2E4XA 1FZTA 2FDRA 3STTA 2LNDA 4EKYA 2QZZA 5KDLA 4W9MC 2PX6A 4LBYA 1TKCA 2NTVA 2SCUB 2WUVA 4IV8A 5EIXA 4G4IA 1AOXA 5BQPA 1EQRA 2QTRA 3WICA 1JBKA 4FINA 1DKMA 2IXEA 5SICE 2OM2A 4HLQB 4URZR 4EGQA 3WWCA 5HQTA 1V37A 1BROA 2I6GA 4JU8A 4D0RA 5KVSA 4E08A 3VR2A 4H7PA 4PLYA 4RQBA 4YQFA 2V1XA 1KAOA 1FUEA 2PT7A 5J23A 1M1XB 1XMXA 3B1FA 1L4LA 1XJWA 1M34E 4I55A 2WFMA 4D9IA 2EBUA 3O7MA 4RF2A 1A5SB 4HMOA 2QHUA 4N0QA 4E5VA 5KJFA 4KWHA 2F3UA 2ZXFA 3D6FA 5AJUA 4A91A 1SBIA 2IY8A 2XD9A 3UMFA 4YROA 2Q6IA 1ZVJA 3ZHTA 4WBXC 4X92A 4IS2A 4K6FA 1G9XA 2CLMB 2I2BA 4KMSA 4KQWA 1EBFA 4MO2A 5EJAA 3THOA 3LVFO 2EGGA 1V4NA 4YCBA 5FFFA 4UNQA 1SKYE 3TW8B 3H8SA 1Q50A 2G17A 4XASA 5CH3A 3FD8A 4BN4A 3P1JA 4X60A 4DWOA 4FJ2A 2UZ1B 4HGRA 4L15A 2EXXA 1E4EB 1S96A 1OVGA 3CH7A 3DB2A 4S1NA 5CM8B 3HCBA 4F3KA 4AMZA 3CVXA 1ICIA 3OY2A 2MYNA 5HJEA 3DEJA 4IIEA 5FTKA 4C14A 2GYUA 3L7DA 4BO7A 1NVDA 2PEZA 1SZCA 3I9LA 1FFYA 1FLAA 4HSEA 4KMMA 4QDXA 1AKUA 4PRYA 2E85A 3AHIA 4I2VA 1U5BB 2DUWA 2VQSA 3JWPA 4RVSA 2R4UA 4DLYA 2B6HA 2YMMA 3Q12A 3RM3A 4BWVA 4CQMB 3FF1A 2OZLA 1JNXX 1OWNA 1PL8A 2YZGA 3SMQA 4DVGA 4X7MA 4PAMA 5J47A 3OM9A 1T8SA 3R0IA 4ZEXA 2ZLBA 4DQXA 5FEMA 4Y6RA 1PWXA 2QXYA 2VT7A 1C7IA 4QFMA 2WIGA 5HM8A 3TRHA 5KC9A 1XA0A 3TL3A 1R12A 4RGVA 1J8DA 1L5NA 1OAAA 1M2NA 3BXGA 1CV2A 2EJCA 4U02A 1UQTA 2A94A 1XXHB 3K0FA 4FYVA 4EEXA 1O8CA 5FR2A 4TMFA 1M34A 3ISVA 4HYQA 2BCGY 1KMCA 4LHXA 3B48A 1KSJA 3RU9A 5HGXA 2H4XA 3N2ZB 3C16C 2LCFA 3GJRA 4BN0A 3ZDCA 1K5DA 1WB4A 3GGOA 3FKJA 4UULA 2JANA 3G85A 5JS8A 3NNNA 4UHJA 4NZ9A 2VTDA 3CC8A 4J2HA 4HATA 2OZPA 4IIYA 5K6AC 4YJDA 1BVUA 1SKUA 4WJ3M 3LAWA 3CM0A 1B2LA 4MUYA 3E9CA 1IUPA 1RMTA 1T6BY 1PZNA 1UBKS 2GPAA 2PD3A 2YVLA 5IK2D 1KBZA 4KR3A 3HFVA 5A9SA 2Q1SA 2JZOA 1NF2A 4OV6B 2C2KA 3MS4A 4URWR 1TTQB 2XWPA 2GNAA 4K8OA 1GRNA 4YRDA 3HU3A 4CKBA 1Y89A 1XTBA 4WDRA 3ZLUA 5KCMA 2VYND 3OECA 4QDKA 4O3MA 2XZLA 2FZVA 3OCZA 3HUDA 4FYKA 1E60A 4OI2A 3LUPA 3J81A 1VIAA 1UMBB 2JKVA 3UGTA 3W5UA 3GLIB 1YOVB 1P17A 4L6IA 1UP6A 1E3WB 2GEJA 2WSSD 3EXAA 4NP6A 4R31A 4D3YA 2CHFA 1BC5A 4WX2B 3ROKA 1DP4A 3RAJA 3TJRA 3Q3HA 5ICGA 2CJWB 3PUVA 1H05A 3H75A 1A88A 3HS3A 2FQXA 2J45A 2QM0A 4NL4H 3T7DA 4QUEA 4HWGA 3UUEA 5ER6A 1O3YA 1R5NA 1DGQA 5AUNB 4I4CA 4NPCA 3ZWBA 3N7UA 4IZ6A 4BU1A 4EX6A 3TE6A 2PZEA 5K8IA 1OZAA 3QY0A 4POAA 1DIRA 1RKQA 1BEUB 3H5VA 3Q3CA 3R9WA 2F9FA 3FBWA 3TB4A 3BIWA 4MLCA 2YHUA 3GP3A 3PZRA 3UOWA 3VKWA 2P4UA 3CV3A 4QJBA 1DBWA 4EQZA 4ZAVA 4ALJA 1HFEL 4B31A 2VJNA 5AVTA 1E9SA 1QIEA 5CITA 1U02A 4S1VA 1ZOLA 3GAFA 3HNRA 4KSYA 5CDYA 4Y6PA 4CMGA 4AJIA 4WBSA 3HU5A 1KRHA 3O91A 4BXOB 1CS0B 5L3SA 2DULA 4MGZR 4UMDA 2QU7A 2GCIA 4DJTA 4XTRA 3V80A 1WSBA 5JAPA 2CLHB 5CBKA 1N2ZA 3AXTA 4K87A 1JIIA 1E3SA 1ISPA 4BO8A 4MITA 2BMVA 2G9ZA 3OCYA 2NO7A 1BA3A 4G2NA 1MO5A 2W2QA 3GT4A 3IDAA 4M0UA 2CF6A 1E6KA 3COZA 2YZNA 2J3HA 2JJQA 1U8EA 3GRYA 4JN6B 3DCNA 4C2BA 2RHQB 3VI4B 1Y5LA 3RQSA 5JO0A 1QE3A 3GJXC 4ARIA 1MXFA 4CKXA 1XEWX 1GCUA 3GFTA 1ULUA 2P41A 1EWYA 4RORA 1VG0B 4G5GA 2JLCA 2FQ1A 1TM4E 1XCOA 2J9XB 5IYZF 3V8QA 3RRZA 3EBOA 1Z2OX 4EFMA 4BPRA 3DVSX 1T43A 1EZ1A 3V2GA 3PC2A 1S3IA 4Y1RB 2DG2A 2XVXA 1EFRD 4BB5A 5C34B 3RNOA 3GK3A 1NOJA 1PVDA 1VKJA 2PFGA 3R0VA 2WOJA 2Q5IA 3P94A 4HG2A 1T5DX 4FE7A 3VM6A 4BMPB 4GVLA 3OCXA 1OQAA 5EJ2A 4CF6A 5JAMA 5FA5A 2PUHA 1UFQA 1JQLB 1ZCFA 1Z4KA 3AR7A 2YMQA 1XVLA 2EZ4A 1XYVA 2FPRA 3BMOA 3HCDA 4N0DA 4ENUA 3U56A 3S27A 1L5QA 2J3JA 3MC1A 1BW9A 4NCJA 2C31A 2YJGA 2Z5GA 4MRSA 4DCSA 3IDFA 1OA1A 1RWPA 3R5FA 5JWOA 3K1ZA 3U4QA 1EM8B 1U2EA 1OLSB 2MR5A 4XIIA 4H59A 4D56A 1HZZA 1XYYA 2JLAA 1CLUA 5BMVA 4AZ0A 1UOQA 2HWYA 3SJZA 2DSTA 4ER0A 4CKEA 5BP7A 1QU2A 2AC2A 4WZBE 4CG2A 2Z30A 1ZVMA 2C5HA 4KGDA 1FBNA 1OC4A 4ZTZB 3IV6A 3KR0A 1JFVA 3VDXA 4DPLA 3JQPA 3MELA 2GJ4A 3DLCA 1MQ8B 4ZVSA 3LKBA 1ZY2A 1AXRA 2L18A 2P67A 2R86A 2BDTA 3OP1A 2Q3DA 2ODTX 3BFPA 1QQBA 3IQZA 1NXTA 1WD5A 2RH9B 2F2TA 4JLPA 1QRAA 4OHFA 1QIMA 4GICA 4RK6A 4RPCA 1KR5A 1XWFA 4XD7D 1EFDN 3UK7A 4MYCA 4JH0A 4MV3A 3R9IA 4DLWA 2ZCJA 4G5YA 4MRMB 4QYXA 4C4PA 5A06A 5GM2A 4CL0A 1XUOA 2GARA 1R9MA 5I8PA 3AIIA 4HV4A 2Z04A 1XRNA 3KR1A 1X7ZA 3LY7A 5FFNA 4KAFA 4ZCPA 3PEEA 1CR2A 1BAPA 1C3XA 1O08A 1SOVA 4I3GA 5REQA 3KSAC 3C70A 3HCWA 4RSHA 2E41A 5B2EA 3NVDA 4V1CA 4JLVA 3PITA 2O2EA 1LQTA 1SQGA 3B60A 5AUOB 1QX3A 3G6WA 4TTVA 1H94A 3R1IA 3QK7A 5TQ0A 3IEVA 1ACMA 2VUIB 1BVRA 1YZYA 2PZGA 4G23A 3U7QA 4PZ9A 3SR3A 1SXJE 3WKEA 3H2JA 2Q2WA 4FFVA 4FR0A 3G2LA 2B4YA 3HXWA 4NNOA 3TGPA 2C88A 2ET6A 2E55A 3CRW1 3TD6A 2C8JA 5B57C 2YVQA 3LHFA 2BR5A 4ZIRA 3DQQA 1AN0A 3GJYA 1MORA 1QLHA 3HY0A 4JUDX 4YN3A 1MEJA 3QW4B 1HNNA 1ZM7A 4YCJA 3VU9B 3WIBA 4HTAA 1CQJA 4P3NA 4M22A 3UUWA 4OEHA 5TE9A 2IS1A 4HGQA 4WZBA 3LNCA 1L7AA 1XWWA 4DNQA 1XTUA 3QWFA 3ROMA 2RG1A 3E5RA 4IR7A 2AT1A 1Q0UA 3FPJA 4BNHA 3ZOKA 4CQLA 2WJVA 3L07A 3KZMA 4ZQBA 5LDHA 1ZCZA 2DE0X 4LVUA 3IQDB 4UHFA 3PWTA 3PVSA 1CZHA 2O2YA 2DHCA 3AU8A 1S1MA 2HK9A 5K3OA 1VIVA 2LTAA 2HYDA 2YS7A 4IIDA 4DJAA 4P3PA 1GUAA 2AF4C 1FDSA 4NFLA 4PZPA 4QPCA 2IBSA 3M6FA 3H6GA 1FSPA 2CNNA 5FUYA 1EK0A 1YS1X 5BN4A 2XB9A 1IJEA 3LBYA 3PVZA 4ZGWA 1JGTA 2IF0A 2QTMA 2XYPA 3WLIA 4C0LA 2FU5C 3AHDA 4TKUB 3TQSA 2V1UA 4I55F 4YAOA 5SZIA 4Y2UA 3KP1A 3TCKA 2FMIA 3VQWA 3BE8A 3S2UA 4I4TB 4GL4A 3FOZA 1D0SA 1WLYA 3K2IA 2QRLA 5H9VA 5FOTA 1ZMTA 3DC7A 4L78A 2EKPA 1PDOA 3EQZA 3ICWA 2FEPA 2XMGA 3L0IB 2VAPA 1SA0A 1SXJA 1VCMA 2CFSA 2OLEA 2DFTA 2PMCA 3R3HA 2JKYA 5DHSA 2GPBA 1IB6A 3ORRA 3AL0C 2A9VA 3IAXA 5KJEA 1OFHA 2FPMA 1M2OB 2CNWD 4AYTA 3NVMB 4OLJA 1I36A 2GKSA 2Y0BA 4BIIA 1A0OA 5I5EA 2UUOA 1AS0A 1AKEA 4LYJA 2B98A 2B21A 4FZJA 4IICA 2VRCD 1EXDA 3B6EA 3EG5A 3S4YA 3TIGA 1VLLA 3RG8A 1QGOA 1TAUA 4MGKR 5TRTA 1JHAA 3MJFA 3HKEB 3LS2A 3WWOA 4EVQA 1KMHB 1U94A 2W8BB 3IO5A 3JWIA 5EGNA 3I76A 3IRVA 3DL7A 2BM0A 2PSEA 3RFFA 3A7AA 2ERXA 3H3FA 2HD4A 4YPOA 5K0GA 2IITA 4IXWA 3NBKA 4QQFA 4RCZA 1JILA 2IEBA 4TRJA 2D06A 3EY9A 4RPGA 4D8XA 2AC7A 5B4VA 1KI4A 3ELWA 4MRRA 1H3EA 4MUGA 5C51B 3V7RA 3F1LA 3CKMA 3WP1B 2ZVQX 1AUOA 2DFKB 2L2QA 4LVCA 1SD5A 3D43A 5I9SA 2ZAYA 1KI2A 1U4SA 2C78A 2VF4X 4OHXA 2NV0A 4CKCB 1DKOA 5D5QA 2F1OA 2JLWA 5JAUA 3WK7A 1K88A 1D2HA 2RMKA 4F84A 3GFOA 3P9SA 5JCJA 1CJCA 2BKVA 2YBDA 1EFVB 2QD1A 4A6XA 2EP7A 3QVVA 2QT0A 4M98A 4ZDKA 5BW5A 3ONWA 4LAFA 4B40A 2ZWVA 4TVKA 1E1NA 1K8YB 2FSHA 2OVBA 2ZRBA 3JSXA 5JAQA 4AP6A 1OYOA 2GJKA 2I67A 4DRXA 3GLHE 3GT7A 5KTRA 1HRKA 5JNLA 4EMTA 3G79A 3NHZA 1ES9A 2H4WA 3I2KA 5EFOA 4BV9A 5B58C 2HU7A 4PFKA 5ANRB 4AICA 1H8HA 1P5ZB 2VF2A 3V32A 2UYGA 3FFBA 2OAP1 3PYLA 2D5AA 2PPVA 3C74A 3IHWA 4RCYA 5TC4A 5FDFA 1QCCA 1PL7A 2IYUA 1G2OA 1QK5A 2XA1A 4MWOA 3V4OA 3V7WA 5FI0B 1D6NA 4IKOA 4BAZA 2ZCEA 5DXJA 3WGOA 1E1RD 1KSFX 1E2MA 1D07A 4LOLA 4O3FA 3RC7A 2H9YA 3GGSA 2H2DA 4INZA 1RDFA 4Q1VA 5FNZA 3A6JA 3RS5A 1FK8A 1Y1SA 3RFCA 1QKJA 3K5PA 1UPXA 1Y6RA 3USES 4B4WA 4ECAA 2IU0A 1MXHA 1YKFA 2XDWA 4KE9A 5TJHA 1NW9B 4PAGA 2VCHA 3JQDA 2NO4A 4DA8A 3A3OA 4S0ZA 3BGSA 4G89A 1I0LA 4MVJG 1FTSA 1AS2A 3RBXA 3WLNA 1DEOA 3V4PB 1QNFA 2ZBDA 4EHHA 1NR1A 4QHYA 3H8JA 4BASA 2QJRA 4JSRA 2A4MA 2O2SA 3IJ5A 3QUBA 2PGIA 3MF4A 1JTEA 2DKOA 2HRZA 2GPYA 1OX4B 2CW5A 1GEEA 1QX4A 2VH1A 2W6CX 3B85A 2Z98A 4DZZA 2Q4TA 2GZHA 3G89A 3R7LA 5K2OA 1YZHA 1UPBA 3O8BA 4HQKA 1XCMA 4HQ0A 4FUTA 3MCVA 4JJIA 4LGVA 4EPYA 1HUQA 2XT6A 4ZVRA 1S01A 3TMKA 4KHPB 2AJBA 2DVEA 3HE3A 4G6ZA 1E32A 3B82A 4AY4A 3F2IA 3KKLA 4LRQA 4OAQA 4LYGA 2G88A 3RTDA 5EMNA 5JOQA 1V0JA 1Z2AA 2P7IA 4BMSA 1JEQA 3N0XA 1U2GA 1XLWA 2TS1A 5AM5A 3U4IA 4KMRA 4DC1A 3FWZA 1G7CA 3GLHA 1I8TA 4LXXA 3OICA 1ZJZA 5IZCA 1LD3A 5HRCA 3L18A 1M6WA 4JHXA 1OX6A 5CGZA 7AT1A 3ONNA 1EMDA 4YAKA 3SMVA 5FO1A 4FI3F 3TIXB 3EGVA 4ILKA 1ONPA 4D3ZA 1F14A 3E48A 2ATXA 1HT2E 1Y7LA 1N2CB 2FFQA 3PICA 4M9SA 3BICA 3VYRB 2YJTD 4WY2A 3TPCA 4HEA6 3VNAA 4N0PA 5KYXA 3OOHA 3IQIX 1E69A 3H2IA 3ABSB 5B1IA 4CGYA 4TVAA 3PD1A 5E95A 2EEZA 3ENKA 1G1AA 2CKMA 3MBKA 4L8GA 1RI1A 4DCTA 2AMCA 4E3WA 2HR1A 1CUDA 1FUYB 1CRPA 2GJ9A 1ZGBA 4U7WA 5EXEA 2OXFA 5LJIA 2OB1A 2C9DA 4OJYA 5FLKA 4DV4B 1WM1A 2C59A 2FZLA 3EEQA 4HDRA 3I62A 3A9TA 3AVXA 2FZWA 1PQPA 2OBYA 5C1IA 1AA6A 1EOVA 3X1YA 1AHHA 4P73A 4NQZA 5DWQA 2GPWA 4C06A 1Z37A 3L1HA 3NONA 4EX5A 3OBIA 2WC1A 4RVUA 3LQYA 1JALA 4UJ5A 4B4VA 2WM3A 3QU9A 5LLTA 1P75A 1YACA 3QVKA 3E70C 1J6UA 2V6MA 1UWKA 3B9PA 1U6KA 5BMVF 2PS3A 3P71T 3JPYA 4ARUA 3DOJA 1UPCA 2IYAA 2HMVA 4KPUB 4R98A 1MBZA 4P32A 2JGMA 3EC1A 4ZCSA 3MUEA 3SSAA 4JA0A 4I3HA 3A7EA 1IBRA 1P6XA 1RHMA 4GU5A 1FMCA 2G6TA 2QAGB 4DFDA 1YQQA 4QOSA 4QYIA 3HDTA 1DAOA 1YAHA 2R1TB 2FZGA 1E2PA 4WPGA 3OOSA 2GO7A 3CSUA 1FTGA 3ODGA 3GHYA 4MYHA 4GM4A 4Y2JA 3NEJA 1QLWA 3FNQA 1N5DA 2JASA 1UZMA 4ZVLA 3SIXA 3OY7A 3NS7A 3DYVA 4RPKA 5A4MS 4F46A 4FYPA 4CV1A 3F4BA 1N4AA 3JWEA 1M6VA 1L4GA 2EGHA 1IY1A 1SCBA 1XKQA 2P2YA 2PRJA 2YHBA 1R0KA 2PCJA 3GEPA 5THKA 2W0SA 2CXTA 4UZFA 3SVZA 4RIIA 4CPDA 3OEEA 1P2GA 3ZNPA 4EGSA 1DARA 1SVLA 5DRTA 4I66A 5CYPA 4WCFA 3ZHOA 4KO1S 4ETIA 3WX0A 1X19A 2GEUA 4RIFA 1KMMA 2VDLB 3T52A 4GX2A 3MWLA 4EW3A 2PYIA 2R68A 4CMEC 1G6HA 2XKBA 3JARB 2I8AA 4KXVA 5JZSA 1X1RA 3HBJA 3VR5H 4P33A 1J25A 4II2A 4P3XA 1YS7A 4XYMA 3JU3A 4D4LA 1U5AA 3TSOA 1JL3A 3A14A 4UUOA 2DBVO 1ILWA 4PHGA 3Q98A 3GOQA 4L8YA 3UJ7A 2RAFA 3ZZ0A 4PBRA 3A31A 3NBMA 4UQPA 1LDNA 3ND5A 3WLSA 3H9GA 4FYIA 5H82A 4CTNA 1WBBA 4R7GA 3HC7A 5I3CA 3JWHA 3FVWA 5C4IA 1BIFA 1KI9A 3BBLA 3OM1A 4W5HA 4CLHA 4QUJA 4Y8VA 3HN6A 1CXZA 4LWPA 3A10A 4LHZA 1XTIA 1E6EA 2AV6A 1UMDB 3DJYA 5F64A 1X9HA 5C5CA 3VMMA 4KQFA 2V7TA 2IVZA 5BYBA 4COOA 2AG0A 3ANMA 1WAMA 1LPBB 4ETWA 1NTOA 1I4DD 3KOOA 2JEZA 1V26A 3E8XA 3W3AH 4TV9B 3ZQ6A 2CXOA 1CULC 5CM9C 3OEHD 4AJPA 2J67A 3R5JA 4JYZA 1V5IA 2CIMA 3EIHA 2YWRA 4V02A 1CQXA 2CJ9A 4TL9A 3FJYA 4EY8A 4BATA 3DOHA 3WHIA 3IKVA 3OTIA 2RGRA 2BHTA 4NOMA 4LWQA 2NX2A 2W58A 4IRXA 3ERRA 3C6QA 3BA6A 2R2GA 3M5PA 4MRPA 1L7MA 3LWZA 3IB6A 3VKFA 3BE5A 1VJCA 3D3KA 3M89A 3EXHB 1Q91A 1QGZA 2AJLI 2PWPA 3M6AA 4JJZA 3NTLA 3GO4A 5FQOA 1TX4B 1BGVA 3G2NA 4DBLE 1I01A 5L9AA 1WIWA 2XE4A 1CX9B 4UEOA 2B5WA 2P9FA 4P92A 2O5VA 4PN3A 3DLHA 3K9WA 4BRSA 5JQGA 1E1QD 1H1DA 1FRNA 3CO5A 2RHDA 3HHPA 1KI7A 1L7RA 5D3MB 3RTEA 1GT91 3M3DA 1ULZA 1D6MA 4PSKA 4MVCA 4D2IA 2P9EA 2VDUE 3DP9A 2IUTA 3C3BA 1T4DA 2Z2YA 3F9IA 3ZE2B 2AWOA 4IDCA 3OLCX 4DQVA 1ZD8A 4QRIA 1W2HA 4KXMA 1KPHA 1VCOA 2RHMA 2W2KB 4JKIA 1GQ2A 4JI4B 1E6MA 2AFIE 3FPLA 1NULA 2NSYA 4GEKA 3RRFA 5EUMA 2FSVA 5HMMA 4D5EA 5K0ZA 1OJ7A 2VIIA 5IN5A 2G25A 1FYXA 5JCPA 2PXCA 4R1PA 2APJA 1VPLA 1ZJ6A 1G66A 2F1HA 2FWPA 2OLJA 3EOBI 1ESEA 3KVVA 3JQ9C 1L7DA 1AS3A 4DCVA 3INNA 4RQUA 2IP1A 1N1MA 1JPVA 1N5JA 3WB0A 1SVKA 1VB5A 1G8MA 1IEVA 4W8HA 2B8EA 5A71A 1P4HA 1UQRA 1YS6A 4DSZA 3NORA 5DK6A 4AT1A 4FDUA 4JXJA 4KI0A 4KXLA 4NONA 4MAAA 5EUQB 3SF8A 5DM60 4BZXA 1OPXA 2NZWA 1XDWA 3PXXA 5TJ9A 2NU9B 2R6CA 1WOMA 4CIYA 4LJRA 3LKZA 5IXJA 2OMKA 2YQZA 3V2UA 3GIDA 4JLBA 4L28A 1GPKA 2D4HA 3O4RA 4Q37A 3WJAA 4ZICA 1J21A 4YTEA 4TSFA 5CLLA 2WD7B 3ETGA 2XYGA 3JYLA 5D8DA 4D0SA 5A0VA 4IH9A 4P4SA 4DIMA 1YS2X 2A0WA 1G7SA 1W1UA 2HJHA 3KSMA 3P7MA 4GOND 1FFEA 4LQ4A 1UT8A 1AUQA 2PMBA 1I6LA 4UXJA 2WNHA 4XJTA 5H8WA 3EC7A 2XTIA 1YVEI 4WLFA 5AIAA 5JROA 3WGTA 1CYEA 2VQDA 2B2NA 4C22A 1DBPA 1X1SA 3CCBA 4JNKA 2OHGA 2ROQA 3IXLA 4LZNA 3MWYW 3VH4A 5EZYA 3TSCA 3GX1A 4ASUA 2Y1GA 3IKMB