2DTOA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 complexed with atp and biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtoA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtoA01
1VQZA 1HTTA 4EMKA 4YRNA 5LJ5e 1NJ2A 3PZCA 2XTIA 4XEMA 4C92B 2J3MA 1Z7MA 2QHVA 4P3PA 2I2LA 4TVYA 4H2SA 3TUPA 4ZIBA 3HXXA 4P75C 1QE0A 4M78C 4C92D 1B70A 4M7AG 4Y91A 4HWOA 4WI1A 4UP8A 1H641 3BY7A 4XEOA 2IY5A 4M78F 4WJ3M 1RIQA 1E1TA 4Q6GA 2ARSA 5GAMg 4V2SA 3QO5A 4P3OA 3QHSA 3L4GB 4J6XA 3JB9H 2DZCA 2EJGA 3M4GA 4BW9A 2Y90A 2ZT7A 3IKLA 1MGQA 1E1OA 2EJ9A 1U1SA 2DTHA 3JCMh 1KOGA 4M7DC 3DSQA 4YRRA 4XTWA 2ZZFA 1JJCA 3LSSA 4PJOB 3V7RA 4JUVA 4M7DF 1FYFA 1H4VB 4M77G 2AMCB 4YRTA 1Z7NA 2DVEA 3W3SA 4P74C 3NEMA 4YRKA 2E64A 4P71C 1I81A 2ZGWA 5LJ3e 4PJOD 3ICAA 4M7AA 1G5HA 1ADJA 4KR3A 1X55A 1N9RA 5GAMf 2RHSA 4H2XB 4K86A 3JCMW 4C92C 5LJ5j 4HWTA 3A7RA 1EQRA 4TVAB 2E5AA 5C53B 4M7DE 5DY9A 5GAMe 4C92F 1B8AA 4K88A 4M7AE 1KMMA 4NL2A 4P72C 4A54A 3A74A 2DJZA 4XU3A 3REUA 3RL6A 2ZZGA 4G84A 2QHUA 2CGHA 1WU7A 4CH4A 3SB2A 3HXWA 4OLFA 3A31A 4XTXA 4PHCA 4NOYA 1HK9A 1X01A 3RKXA 3JB9I 4H2VA 4YDQA 4M77A 3REXA 5CAIA 1BBWA 4M75B 3JCMX 1J5WA 1H4SA 4C92E 4CH3A 1E24A 3HFVA 1EIYB 4M75D 4A53A 1B76A 4M77E 3ERRA 4PJOC 3L4GA 4N0AC 4J6YA 3JCMc 4KQEA 1KQ1A 3NENA 1WYDA 4M78G 3L2ZA 3G1ZA 1SERA 4CH5A 4PJOF 3CMQA 2ZT8A 4P73C 5C51B 2YLBA 3EFRA 1I5LA 5HGQA 2Q5IA 3JCMb 3JCMd 2DEQA 4YYEA 2ODRD 1EVKA 3RKYA 1USYC 4YREA 2AMCA 1NYRA 3P8TA 2DU7A 2DZ9A 5ELNA 3PCOB 4YRCA 1ASYA 1B34B 2ZXFA 3INZA 1H4QA 3NELA 1G5IA 1X2GA 4XTVA 5GAMj 5GAN6 4M7DG 4PJOE 2C7IA 1WQWA 3HXYA 1BIBA 5GAOl 2RB6A 5GAN3 4YRLA 2P0LA 3TEHB 5GANh 4H2XA 1PYSB 2PMEA 2E41A 3P8VA 2ZINA 5GMKl 2ALYB 3A5ZA 4TVAA 3RGLA 5GMKi 1NJ5A 3QO3A 1BIAA 5GMKe 1LOJA 3HXUA 3KFUA 3HFZB 4P75A 4C8QB 4M75C 4M78A 2CIMA 4P3NA 11ASA 3BJUA 4QVCA 3JCMJ 2QHSA 5GMKm 2AKWA 1Y96B 1LNXA 4M75F 1M8VA 4C92G 2DXUA 4C8QD 2P5IA 3JCMg 2CJAA 4CH6A 3L1AA 3V8LA 2RHQA 4TVWA 4DPGA 3IG2A 3I7FA 4M78E 4XTZA 4YROA 4MMLA 1B7YA 2ODRC 4HT9A 4XU2A 3V8KA 4HWPA 4H2YA 3EFSA 4X9DA 2E3CA 4RQEA 1ASZA 4M7DA 3VBBA 2YHTA 2I4OA 1E22A 4OP0A 1N9SA 4XU0A 4H2TA 1ATIA 4EMKB 2EJFA 2RM4A 4HT8A 4KR2A 4P74A 1EOVA 3QO8A 2Q7HA 4NL3A 3SWNC 3A5YA 2ZR2A 2DTIA 12ASA 4P71A 4X5OA 4YCUA 2ZNIA 3HY1A 1SRYA 3VQWA 1H4TA 1M5Q1 3AHUA 3MF2A 2XGTA 2ZIOA 2DQ3A 3FB9A 4PJOG 2QHTA 4RCBA 3JCMf 5GAN5 3UH0A 4C92A 1YGBA 2ARTA 2E65A 5I21A 3PCOA 3JCMQ 1IL2A 1D3BB 4CS2A 2DXTA 3JCMe 3E9IA 4YRFA 1TH7A 3R07A 4C8QC 2I4LA 5GMKj 4YCWA 4P72A 5LJ5h 4HA8A 5GAOn 3QO7A 2K57A 1W66A 2ZZEA 5E3IA 5LJ5g 3JB9J 1N9WA 2G4CA 3JCMV 4C8QF 4G85A 4MMKA 2ALYA 4F7UF 5GANd 5GAN2 4YPFA 4JRIA 2RA2A 5GAN7 1JRIA 5ELOA 2Q7EA 5LJ3d 4TQFA 4UP9A 4YRJA 3VQYA 2DQ0A 2YLCA 3UFGA 3VQXA 3HFZA 1JJCB 2ARUA 1YB3A 2EWNA 3HY0A 4BWAA 1Y96A 1SETA 1HC7A 4CS4A 3PGGA 5GAN8 4YRMA 3IALA 2ZNJA 4YRQA 5K1PA 4XQ3A 2DKGA 5GAOp 4PJOA 4M7AB 4N0AA 4EMKC 5C52B 4PG3A 2I4MA 2RHSB 3HXZA 4M75G 3VU3C 3GIBA 3MF1A 3JB9D 3FJPA 3A7UA 4P73A 4XTYA 1X54A 1C0AA 3SWNB 4HWRA 4M7AD 4H2WA 4RQFA 5LJ5f 4H02A 4YCVA 5GAOq 3QUIA 4EMHA 2EL9A 5F5WA 1WLEA 2JN0A 1USYA 4XTUA 5GANg 1YFSA 2ZT5A 5LJ3h 4DQ2A 3M4QA 1JBMA 5LJ3g 2E1HA 5GAOm 2ZR3A 4RMFA 1QF6A 4WJ4A 3JB9G 3OD1A 3HXVA 3MEYA 3HFOA 4M77B 2ZIMA 4F7UB 4TWAA 1X2HA 4EO4A 3RACA 4JLIA 3RF1A 3M4PA 4CS3A 4YRSA 1X56A 5GAMh 1HXDA 1NJ1A 4J6WA 4O2DA 4AH6A 2Q5HA 3RIRA 2ZTGA 4M77D 4LNSA 4YRPA 1D3BA 2FYKA 4HWSA 4RCCA 3E9HA 5K1XA 3QTCA 3NETA 1ADYA 1LYLA 4M75A 4YRIA 3TEGA 4TTVA 4H2UA 1NNHA 5LJ5d 4UPAA 3RERA 4EX5A 3BFMA 4HVCA 4NCXA 1EIYA 3RUXA 5GANf 4RDXA 4M7AC 4Q15A 4M75E 2C8MA 2Q7GA 4L87A 3JB9F 2ZT6A 4YP0A 4C8QG 5LJ3f 4K87A 4JRKA 3LC0A 4UP7A 4F7UG 2J3LA 4M7AF 4TQDA 3WQZA 5GANe 2VXFA 3RESA 3VQVA 2RD1A 1NYQA 1I8FA 4PNOA 3HFNA 3JCMP 2VXEA 2DDZA 1B70B 2PMFA 4J15A 4YRGA 2IY5B 1WQ7A 4QVDA 1YFTA 4J5YA 1B34A 2FB7A 1BBUA 3SWNA 5GAOr 2I4NA 2HNIA 4WF2A 4ZTUB 4XU1A 1U1TA 4M77C 1L0WA 1WPYA 4M78B 3TEHA 1NJ6A 3FIFA 1PYSA 3HRKA 1KQ2A 1EFWA 2CJ9A 3A7AA 2AKWB 3QSUA 4M77F 3V8JA 2DTOA 3IKMB 2QTXA 4X9CA 2CJBA 1YCYA 2E10A 4M78D 4EMGA 3A32A 2RHQB 1YFRA 4C8QA 5KNNA 3RKWA 2ZCEA 2DU5A 3V7CA 4F7UA 1WNLA 1B7YB 1G51A 3P8YA 1GGMA 5GAN4 4ZTZB 3HRIA 3UGTA 1EVLA 5GMKh 3BW1A 4M7DB 4C8QE 1NJ8A 5GAMd 3V7SA 4F7UE 1LJOA 1SESA 2VC8A 2EAYA 1I4K1 3UGQA 1KMNA 4M7DD 3HSBA 3HTZA 5GANj 3QNEA 3LSQA 3BDUA 4E51A 5LJ3j
chains in the Genus database with same CATH superfamily
3MEVA 1VQZA 1QVGS 1VQKQ 5M9OA 1PRMC 1TSFA 3I5SA 3OSSC 1EX4A 4E47A 2KE9A 1QVFP 3PZCA 1VQ9T 5IN1A 2GQIA 2J3MA 2LNVA 2LX9A 2MMPA 3M57A 1N5ZA 1Y57A 1K73U 5CO7A 2O2OA 1QWEA 4ZIBA 1M2OA 2FL7A 4C92D 1W1FA 2ZCFB 4M7AG 2A28A 2XG8D 2DILA 1S72Q 4WJ3M 1RIQA 2PQWA 1AWWA 1RAFB 3REAB 3QHSA 3VS0A 3JB9H 2RJCA 1H92A 2EJGA 2KGTA 4QQ6A 2Y90A 4Z89A 2AK5A 3VV0A 3IKLA 2X35A 1E1OA 4RTYA 2B8AA 1KOGA 1JO8A 2W10A 4M7DC 2RI5A 2SEMA 3HP9A 3GP8A 3FC3A 3FJ5A 2YT6A 1JJCA 1G83A 4PJOB 4IUQA 3V7RA 4KH1B 4JUVA 3CC7Q 4M7DF 4M77G 1YJNQ 1WFWA 1PSFA 1Z7NA 2DVEA 3W3SA 3CCMQ 4P74C 3EG0A 3VS5A 1YJ9Q 2VASA 2E64A 2OI3A 2A8EA 2ZGWA 2K3BA 1RAHB 2K9GA 2ZPFB 2JTMA 1T3SA 3NMZC 1YN8A 1N9RA 2RH2A 4H2XB 1UDLA 3HRUA 4HCBA 4C92C 2NS6A 1SRMA 2A37A 1VQNQ 4JZ3A 1TS9A 4IIOA 5GAMe 1YI2T 4C92F 4M7AE 1KMMA 4P72C 4DEYA 2DJZA 2KRNA 3KBGA 1VQ4Q 1K76A 1RABB 2QXFA 5KYUB 2DYBA 4G84A 4QT7A 4FW1A 2HD0A 3T9NA 2JMCA 4XTXA 4E7JA 3LGLA 4HCZA 1ZBJA 2C06A 4H2VA 1IGQA 3JCMX 2KRSA 2VGMA 4O5VA 1P92A 1KQSA 1IHWA 1E24A 4AFUC 3HFVA 3HKSA 1BYMA 2AIRB 4A53A 4D6WA 4M77E 1X69A 3L4GA 4DBFA 2O9VA 2QYZA 1T3LA 3BDLA 3L2ZA 5C51B 1YWOA 2HDAA 5KE2A 4KGZB 3EH2A 2BE7D 1I5LA 3EG9B 1PC0A 2K5LA 4PLLA 3JCMb 1OYXA 3QIIA 1YNZA 4P5NA 4LXCA 3A98A 4YREA 2AMCA 3P8TA 4PFZA 5ELNA 3PCOB 1VQ6A 3THKA 2ZXFA 3DKMA 3NELA 3QJ6A 1G5IA 1X2GA 1ABOA 4LNPA 4PK4A 4LDUA 4BUGA 4M7DG 4PJOE 1MV3A 1MNDA 1AZGB 5GAN3 4YRLA 1VUBA 2E41A 2YSQA 3P8VA 3A5ZA 3PMIA 4N4HA 3RGLA 2B86A 1VQ5Q 2JM9A 2RJFA 1AEYA 1BIAA 2RPNA 3BE3A 1VQOA 4HVVA 3EHQA 4M78A 1LVKA 4OMMA 3BJUA 3SDZA 2V1QA 3JCMJ 1Y96B 2E5KA 4R0KA 4J9CA 2E4HA 3G6EA 1M8VA 4C92G 3QG1A 1VQPQ 2OAUA 4C8QD 4DBRA 2FRYA 3V8LA 2QI2A 3CPWS 1PCXA 2JS0A 2L3RA 4QQGA 2FO0A 4MMLA 1NEGA 1RAIB 2PUKB 1B7YA 3E9FA 1M3CA 1VQ9Q 4XU2A 3EFSA 1ZUUA 1BI2A 2JW4A 3UT1A 2LX7A 2YRCA 4OP0A 1N9SA 1VQMA 1YHQQ 2QASA 3A8LB 4KR2A 2QDYB 1EOVA 3G1JA 2Q7HA 1CKAA 3VRZA 1Y71A 12ASA 1G3TA 1PSEA 2V1RA 2QA4A 3FRNA 3NHNA 3AHUA 3MF2A 3G71A 4JPBW 3OYGA 1ABQA 3FB9A 2W0ZA 4RCBA 3JCMf 3RBBB 1WYXA 2LP5A 2ARTA 2E65A 5I21A 1B7TA 4PLIA 5J26A 3PTAA 1IL2A 1ZSGA 2DXTA 2QGFB 2K3XA 4C8QC 5GMKj 1AT1B 4YCWA 2PVDB 4HA8A 1M2VA 3SHWA 4KUIA 3QO7A 2K57A 1W66A 5E3IA 5AT1B 1N9WA 2G4CA 4C8QF 1G3YA 2PVOB 2ALYA 1J3TA 1Q86C 5ELOA 1BK2A 2Q7EA 5LJ3d 1YIJA 4TQFA 3QKJA 2DQ0A 3VQXA 4ZGEB 1QVFS 3LW5E 2ARUA 1YB3A 4UC4A 3HY0A 1T0HA 1KFZA 1AHJB 5FWBA 3OB9A 1WHMA 1U3OA 4CS4A 1BU1A 5GAN8 4YRMA 2KAFA 2JMAA 3OSVA 4TVRA 4IUTA 1UB4A 4OGEA 3VU3C 3MF1A 2P0KA 4ANJA 1K9MU 1C0AA 1YBYA 1KD1R 2X4JA 5LJ5f 4H02A 4YCVA 1S1NA 5GAOq 3R6NA 1JU5C 1QW1A 5CCAA 1C0MA 3DLLA 1QKWA 4IIMA 1X43A 4XTUA 2I0NA 2ZT5A 3OYHA 3CD6T 2DMOA 1KHIA 3MEUA 1VIEA 3I55Q 5LJ3g 2NWMA 5IH2A 2KXDA 5GAOm 4RMFA 3X26B 3OD1A 1SKUB 1Q81U 3MEYA 3HFOA 2ZIMA 1WJRA 1MMDA 4EO4A 2ZPGB 3RF1A 3M4PA 2HAXA 1X6OA 1X56A 3OA6A 3MCAB 1V29B 1HXDA 4J6WA 2Q5HA 3RIRA 1QLYA 5EG2A 2FYKA 2LT1A 1Q82C 4HWSA 3E9HA 5K1XA 3QTCA 1TOVA 3OY9A 1ADYA 3UPUA 4XAXB 5KCOA 1LYLA 4YRIA 4H2UA 5AYFA 3CQTA 1W2BP 1VQ6T 4LVMA 2NUPA 3ME9A 3BFMA 4RKUE 2X3XD 3MP8A 3RUXA 1K73R 2CP2A 2LQWA 3CBMA 4AFZC 5L23A 2K6DA 2A7YA 2OTJQ 2DXBA 4C8QG 4K87A 4JRKA 1MMGA 3RESA 2RHUA 3L2WA 3CMAA 1Q7YR 3REBB 4MZPA 2DDZA 1VQOT 4LVLA 4KGVB 3KFVA 1ZX6A 1YFTA 4J5YA 2EGCA 1B34A 1M1GA 3H0FA 2K4YA 3SWNA 2ZPEB 2FEIA 4WF2A 4XU1A 2DVJA 4BI4A 1L0WA 2CP5A 1YJWQ 1KSWA 1WPYA 4FSSA 3FIFA 1KQ2A 2LDMA 3A7AA 3GNFB 4X9CA 1UECA 2CJBA 5FU6C 2EGEA 3CCVA 2RHQB 2BKDN 4KBMB 5ECAA 5C6SA 2LVMA 2D8JA 2QGGA 1VQMT 2DU5A 1NEBA 1ARKA 1AD5A 4JLGA 5CQXA 1K0XA 3UGTA 1OX9A 2O88A 2HQEA 2LZ6B 2QA4T 2DBKA 2EKOA 4C8QE 3G71T 2YRVA 1C6VX 1KMNA 3HSBA 4E7SA 3CCUA 1NJIC 3HTZA 3QNEA 2QQRA 2LNHB 1X6BA 4B6MA 1IXDA 3LSQA 2DRMA 2A3LA 4AMCA 2EKHA 1VA7A 2QK0A 2HSPA 2RNAA 4EMKA 1GL5A 4YRNA 1NE8A 5LJ5e 1X6GA 1WXTA 2GTJA 1YITA 1EZZB 5KYWB 5A0LA 3RMQA 4TVYA 2KSSA 2M0YA 1YIJT 3HXXA 2R58A 3A8MB 1M3BA 2XD0A 4HWOA 2KQWA 4WI1A 2HMAA 1H641 4EIKA 2GNCA 1PG5B 4Q6GA 4C5EA 1YI2A 1B07A 4V2SA 4P3OA 1D09B 2DZCA 3MP6A 3I56Q 4BW9A 2ZT7A 3UATA 4AFSC 1LPLA 1GFCA 2CZ0B 2EJ9A 1U1SA 4RG2A 1I0CA 3MP1A 4LVKA 1VQ8Q 2JM8A 2QG9B 2BIVA 4XTWA 2QQAA 2JT4A 1UGVA 1FYFA 4EDUA 4YRTA 1QCNA 3NEMA 1SHGA 3X20B 1QP3A 2HBWA 2YUOA 3VJPA 4R55A 1WXBA 5CKDA 4P71C 1I81A 4PJOD 1WI7A 4OVAA 5FW9A 3ICAA 4M7AA 3EGDA 2YUQA 2E3IA 2E5QA 1ADJA 1UHCA 4KR3A 1GCQA 5GAMf 2RHSA 1RACB 4K11A 4K86A 2F69A 3GBQA 3CMEA 5DLQE 4E7KA 4TVAB 5FLXE 2QEXT 4IKFA 2O31A 2DO3A 4C0DC 2HKQB 3TSWA 4B9WA 5A0GA 1U5SA 2DNUA 4AG2C 2LTOA 2XDDA 4NL2A 1UGSB 2K79A 2NYSA 1SSHA 3EFOB 3A74A 3REUA 2R5MA 5CKBA 3CC2A 3C94A 4Y28E 4E7IA 4VUBA 5CQYA 2QHUA 1DJ7B 4MZTA 1GFDA 1WU7A 3SB2A 1UHFA 3HXWA 4CH4A 2MIOA 4J7FA 4NOYA 1HK9A 1UGRB 4YDQA 1RUWA 3A1PA 4M77A 3REXA 5CAIA 4M75B 2DE0X 1PHTA 1KIKA 1H4SA 1ZSZB 1YFNA 4FYYB 3CMAT 4GY5A 2VYTA 1EIYB 1BI1A 1VQOQ 4PJOC 2X4WA 4J6YA 2LCCA 3ZEHA 3ZFJA 1NYGA 4KQEA 1KQ1A 1I1JA 1OX8A 4JS4A 1SERA 3G6EQ 4PJOF 3CMQA 2X4YA 4C0ZA 1M90R 4OMFB 3VS4A 2D9TA 2LQKA 2QAZA 3H0IA 1VQ7A 4YYEA 3VYGA 1SG5A 1EVKA 3CC4A 2DU7A 1X2KA 1AVZC 4LVJA 2A36A 3INZA 3CCVT 4C0DB 3CCSQ 2RHIA 4BY6C 1H4QA 3OYFA 5GAMj 2KNBB 5GAN6 3M0SA 1EIFA 2CT3A 2CZ6B 5GAOl 2KT1A 2RB6A 3CCLQ 3TEHB 1D1BA 2P0LA 5GANh 4H2XA 1PYSB 2PMEA 1W2BS 2F2WA 1Q7YU 3A8GB 2RJEA 2GF7A 5GMKl 5CKFA 5IAYA 5KYXB 1NJ5A 2BE9B 1LOJA 3G71Q 1NBEB 3HXUA 1BCOA 3OYCA 3FDRA 2KYBA 4P3NA 11ASA 2AKWA 1LNXA 1TUGB 3CCUT 3F70A 3OYDA 3EGXA 3KXTA 1K9MR 2DXUA 4FIBA 4CH6A 4E6RA 4Y92A 5LL6S 3IG2A 2RQTA 4L59A 1GRIA 5HCKA 3CCEQ 1YITT 4HT9A 2KDSA 1SRLA 4H2YA 4X9DA 3CCJQ 4RQEA 2DEUA 5IHKA 4M7DA 2XICA 4A4HA 1M1KR 1Q81R 1D0YA 1TUDA 2EJFA 3C4SA 2EVRA 1Z9ZA 4P74A 3QO8A 2E3HA 4NL3A 3Q1JA 3A5YA 4GLMA 1E6GA 2DTIA 2P0PA 3G7ZA 4BY6B 4X5OA 2ZNIA 1SRYA 1IB8A 2C0TA 2DRKA 2ECZA 3JV3A 4C0FA 4IUVA 2IPOB 2ZIOA 2DL8A 2MWPA 1GCPA 4PJOG 1SHFA 4PFPA 1M30A 3UH0A 4C92A 3UA7A 2DM1A 3PCOA 2EFIA 4F14A 2WSCE 3E9IA 1LCKA 4YRFA 3R07A 4RTUA 4LD6A 4IUUA 3ULRB 4P72A 4OMLA 5GAOn 2DERA 3LWIA 2HEQA 4DOVA 3JB9J 3JCMV 3OW2A 3E2UA 3CD6A 1WJSA 4MMKA 1HYOA 5GANd 4YPFA 4E7ZA 2QQBA 2PVGB 2RA2A 2OTLA 4YRJA 1XJWB 2YLCA 1JJCB 3CCRQ 2HKNA 2RQVA 3CMET 1Y96A 1NZ9A 4PL6A 3M4YA 2JTFA 1HC7A 3EG2A 3OYYA 1WHKA 2DLPA 2ZNJA 5K1PA 3TSZA 3CC2T 1VYVA 3GIBA 3FJPA 4JJDA 2FZCB 1WHJA 2FPDA 4HWRA 2XHCA 5IXBA 1V76A 2ED0A 2X3WD 4YTLA 4ESRA 2AHJB 3M0RA 1OPLA 5CVIA 1M3AA 2H3JA 1WLEA 2JN0A 2OAWA 4ZN3A 3S3NA 2CSQA 5GANg 2NLUA 1YFSA 5LJ3h 2X4XA 4FT2A 1EFNA 1JBMA 2XK0A 1CSKA 1D0XA 1TTHB 1VQLQ 2ZR3A 1QF6A 1SF9A 2XI9A 1X2HA 3VUZA 3RACA 4JLIA 3QYGB 3QBYA 1V1CA 4LUEA 1NJ1A 4A4KA 4O2DA 4LNSA 2ZTGA 5IT9E 1VQ7T 2Z0WA 3GLXA 1ZBXA 3UF4A 4J9EA 3CC4T 3TEGA 2GGRA 1OEBA 3J7AF 4TTVA 2WSEE 4RTWA 2H3EB 3VS6A 1W6XA 2HL3A 1WGSA 3RERA 1X75C 4HVCA 2O01E 2C8MA 4C5GA 5CKEA 4L87A 2DIQA 2ZT6A 1OU8A 2QDLA 5FROA 3OYBA 2MI6A 5KCHA 4TQDA 4Z02A 1OPKA 2DF6A 3MEAA 1NYQA 1O9SA 3VS3A 2M9UA 4QW2A 1N6AA 2CUDA 1UE9A 2L3PA 1B70B 2EYZA 2IY5B 1QCOA 1KK7A 4QVDA 2PNIA 2CP3A 3E19A 1M90U 1BBUA 2RK2A 2HNIA 3CCQA 2VVKA 3ASKA 3M5AA 4M78B 4QKUA 1G3SA 1OV3A 2KK4A 1KG1A 4HCKA 4FYWB 3HRKA 1TG0A 2RK1A 3CEYA 2DTOA 2QTXA 2JOYA 5KYYA 2JVVA 4EMGA 1D0ZA 2J6FA 4C8QA 3OBWA 5I22A 2O4XA 4KH0B 2L0AA 5GJWB 2XIDA 4F16A 1B7YB 4J9IA 3CC7A 4JJBA 5GAN4 2LQ8A 4ZTZB 4HVWA 1EVLA 4FM4B 5GMKh 1YI2Q 3OYKA 1YJ9A 4AFQC 1QWFA 1Y7XA 1NJ8A 2DK3A 2XKOC 5FWCA 3V7SA 1IO6A 5D6WA 4RUGA 4BACA 3SD4A 1I4K1 4GBQA 4XK8E 4FU6A 3J81E 2WSFE 1R0BG 3BDUA 4JJCA 2KRMA 4LDVA 3QXEB 2CZ7B 1HTTA 2BZYA 1KC8R 3E9GA 2FZKB 1KQSS 2XTIA 4XEMA 2FHDA 1Z7MA 1VQ4A 2R57A 3CXCA 2I2LA 3UA6A 1I5OB 1VIFA 2FPEA 1BKBA 2RHYA 4Q5WA 2OTLT 2RQRA 4H2SA 3QDFA 1M1KU 4CC3A 4P75C 1AWXA 2GTOA 1M2VB 4Y91A 1K8AR 2CH4A 3CMEQ 4UP8A 4WCIA 2AZSA 1K1ZA 4OMPA 2QEXA 4E7HA 2ZAEA 2KYMA 3M53A 4O6JA 3EH1A 3TCJA 1UTIA 3SEMA 1T0JA 3H0HA 1MGQA 4IURA 1RAGB 2CP6A 2DXCA 1AWJA 2DTHA 3HPWA 4KULA 3JCMh 2RI2A 4L6V5 3DSQA 9ATCB 4YRRA 2AZVA 2ZZFA 3VS2A 3M56A 4C5IA 5KYNA 4CC4B 2EW3A 3IQLA 3OQ5A 2GCXA 4FYXB 3S3MA 1ZA2B 1FMWA 2V8IA 2BZXA 3QWXX 4YRKA 2Y4YA 4A4GA 3OYIA 3C0CA 1YCSB 1BI0A 3H8ZA 2K2MA 1VYUA 4RTTA 1MNEA 2COZA 2K7AA 2L89A 3QZ9B 1X55A 3L2QA 1ZUKA 3OMCA 5LJ5j 4F04B 1AWOA 1WHHA 4HWTA 1VQ7Q 1B8AA 4K88A 4J9DA 3VRYA 1VQ5A 4BD3A 1UGPB 3EAEA 3CC4Q 1ACMB 4XU3A 1JJ2A 3RL6A 4A4EA 1PD1A 2VWFA 3U23A 2KT8A 5KYWA 2EQJA 5FU7B 1VQPA 2EYWA 1W70A 2P4RA 1QVGA 1JQQA 2VUBA 1J5WA 1VQKT 2SRCA 1M9SA 1Y07A 1ZHIA 4OB1B 2MOXA 1QCFA 3L42A 2NUPB 3L2VA 4M75D 2CP0A 1PKTA 1B76A 4KRTA 3ERRA 1GXIE 2F5TX 4N0AC 3JCMc 3DB4A 3C12A 3NENA 1WYDA 4F17A 3G1ZA 2ZT8A 1YHQA 4P73C 2ZPBB 1S72T 2RQWA 1RAAB 4J9BA 2VGNA 3EHRA 2Q5IA 3CCQT 3VYHB 3JCMd 1AOJA 2DEQA 4DOWA 3RKYA 1USYC 1NJIU 4PFOA 1NYRA 2LJ0A 4YRCA 1B34B 2MK5A 2LJ1A 1AZEA 4FT4A 2D8HA 1K0SA 4OGCA 1WDXA 1WQWA 4PJJA 3ER0A 2IIMA 2MPXC 5CIUA 3CC7T 2DFUA 2ZINA 4AT1B 3CCMT 4TVAA 3P8DA 3VKIA 3TQ7P 1YJ9T 3QO3A 1NLOC 2DX1A 2L2PA 5C0MA 3KFUA 3NFCA 3HFZB 2M02A 1N8RC 4M75C 1TU0B 3EFOA 2CIMA 5D6YA 4HXJA 4MZMA 2F2XA 1ZSZC 3G4SA 2DIGA 2EIFA 4M75F 1ZA1B 1NYFA 4PKCC 3RR6A 3JCMg 1VQNT 1K4US 2P5IA 3L1AA 1NPRA 4J9HA 3I7FA 2LT4A 5I2SA 3I5RA 2M0OA 4CC2A 2V26A 1BB9A 1SPKA 2HQHA 5DM7R 3M9QA 4DA4A 3CD6Q 4LVIA 2ENMA 1VQ4T 2LCLA 2E3CA 1JEGA 3VBBA 4J9FA 1PM3A 1E22A 2CYZB 1FYNA 4HKEA 2JNGA 1TXQA 2FRWA 4RTZA 3VUBA 4EMKB 2RM4A 3PVLA 1M4ZA 4M4ZA 2ZZDA 2HL5C 1OULA 2JS2A 2ZR2A 4P71A 4YCUA 4BDZA 2YXYA 3I55A 3VQWA 1H4TA 1ZQ1A 1I07A 2DQ3A 2QHTA 1M8MA 5GAN5 2LMJA 1OZ2A 1VQ6Q 4BE1A 4OF1A 2J7IA 1YGBA 2RMOA 3URGA 1D3BB 2EQKA 2M1HA 2DPPB 1TH7A 2CH4W 1KD1C 2CREA 3CBPA 2RQUA 2NUZA 2NUTB 1KC8U 1C1AA 3N5BB 4ME7A 5LJ5g 1D1CA 1NG2A 5I11A 4F7UF 5GAN2 4LD9K 3PT9A 4JRQA 5GAN7 1JRIA 2AKLA 4UP9A 3VQYA 3I35A 3UFGA 1K8AU 1BCMA 2OTJA 1TUCA 2CDTA 2EWNA 3QPHA 3RNJA 3TEEA 3S3OA 2KXCA 1SETA 4ZGJB 4JJNK 4JS5A 2CUBA 1TWBA 1VQ5T 4YRQA 2DL4A 4BE2A 3NTKA 4PJOA 5I2MA 3WXMB 4M7AB 3EGDB 5C52B 4PG3A 2Y4XA 2RHSB 1JJ2S 3P8HA 4M75G 4OB2B 5HK0A 4XTYA 4DBQA 1X54A 4C0GA 4JZ4A 2EQUA 4H2WA 1VQPT 3CPWA 8ATCB 1VQMQ 1KHCA 2LJ3A 4EMHA 4ZTJA 1K73C 2EL9A 2DBMA 1IHVA 3NTIA 3O5ZA 4IUPA 5F5WA 2P0QA 1MUZA 4RTVA 3PIPA 3FLGA 3H9NA 1YJWA 5FRNA 3M4QA 3RDVA 1Q86R 2QA4Q 2E1HA 2M51A 1Q7YC 1SEMA 2DL5A 3JB9G 2A0FB 3HXVA 2EYQA 1G8XA 1G3WA 4OMOA 4BDYA 4ZTFA 4M77B 4F7UB 5KYUA 1KQSP 1YHQT 3C95A 4YRSA 2JJ9A 1OU9A 7AT1B 5GAMh 3OW2P 2DAQA 5D7UA 1BI3A 2D0QB 3CCQQ 4RCCA 1E6HA 3NETA 3FEOA 2RN8A 3TU4K 1B3QA 3L2UA 1NNHA 5CKHA 1H3HA 2L3SA 1ZUYA 2YUNA 1YIJQ 4NCXA 3GOXA 4RDXA 4Q15A 1M27C 2PZ1A 4M75E 2KI7A 1K9AA 2J6KA 5LJ3f 3LC0A 2BTTA 4F7UG 2J3LA 3E1SA 5GANe 3HHTB 1ZLMA 2OJ2A 3EG9A 4FW2A 2PTKA 5FRMA 1R77A 2MCNA 2PMFA 1QVFA 3GPLA 3G4ST 2J05A 4YRGA 4QQDA 2EYYA 3L2RA 1Q82R 3EG3A 5GAOr 1QQJA 4DEXA 4ZTUB 2IG0A 1WZOA 2C0OA 1UG1A 1NJ6A 1EFWA 5J39A 2CJ9A 3I56A 2EYXA 2AKWB 3QSUA 3V8JA 3EGXB 2ZPIB 3QYHB 2AT1B 4M78D 1YFRA 1W4SA 3J80E 1VQ8A 1IREB 2PU9B 3V7CA 3AT1B 1G51A 1A0NB 1GGMA 1SSFA 2QEXQ 3HRIA 2JXBA 3QJYA 1QKXA 4PJLA 2QTVA 4PJMA 3PNWC 2D1XA 3BW1A 3I55T 2KVQG 4M7DB 5GAMd 2OX7A 1CKBA 2RHXA 2ESWA 1X2QA 4F7UE 1SESA 2VC8A 2J06A 3UGQA 3CPFA 2E6NA 2IVWA 4NS5A 2HBPA 1OQKA 3OYJA 4E51A 3JSCA 2L8DA 5LJ3j 2COYA 3VS7A 4BB7A 2HSEB 3R6OA 2H8HA 1NJ2A 3CMAQ 4OB0B 3EGUA 2R5AA 4C92B 2QHVA 4P3PA 1QVPA 4E7LA 3TVTA 1VOMA 4MDXA 2GFUA 3MJXA 4OMQA 3TUPA 5HY6A 2GBQA 2YRDA 2X9HA 1WJQA 1WX6A 1QE0A 3M0PA 1PD0A 4M78C 1U8RA 2O9SA 2OTJT 1B70A 3QZ5B 2LCSA 2M16A 8AT1B 3BY7A 4XEOA 2IY5A 1YWPA 4M78F 1R0CB 1E1TA 2ARSA 5GAMg 3M0UA 3QO5A 2MF2A 4FYVB 3L4GB 4LUDA 4J6XA 2E6ZA 2G6FX 4ORZA 1OI1A 3M4GA 1JXOA 1NJIR 2F5KA 5KE3A 3KUFA 3CCVQ 1WLPB 1UUEA 3HTRA 4OMNA 1PRLC 3LSSA 2BZ8A 1H4VB 1N27A 1YJWT 1VQKA 3LLRA 2AMCB 2CKKA 1IGUA 1M1FA 5LJ3e 5HKCA 1UGQB 3CCSA 2DA9A 4J9GA 4KGXB 2QQSA 1G5HA 4DBHA 2A08A 3CCUQ 3JCMW 3CCLA 2KY9A 3A7RA 5CR2A 1EQRA 3A5ZB 1S72A 2JTEA 2E5AA 5C53B 2MYSA 2F2VA 3CXCP 1M90C 4M7DE 1U06A 5DY9A 2ED1A 5L8RE 1N8RR 4A54A 1YITQ 4RG8A 2E12A 2ZZGA 2EPDA 2LC4A 2GFAA 3RMSA 1WIEA 2CGHA 3SFMA 2LRQA 4OLFA 3A31A 3NPFA 4PHCA 2DL7A 3RKXA 1X01A 3JB9I 2FG0A 2XDPA 3PE0A 1FWZA 3M54A 1BBWA 4HVUA 1HSQA 3GNGA 2EGAA 2CP7A 4C92E 1YJNA 4CH3A 3CCMA 3CCEA 1Q86U 4LE9A 2L5QA 3CCJA 3OS1A 1UFFA 4Z8AA 4KT0E 4GLKA 6AT1B 3G4SQ 2DD4A 4M78G 1Q95G 4X1VA 4LDXA 2ABLA 4CH5A 5IHIA 1NLPC 4A63B 4N4GA 2YLBA 1VQNA 3EFRA 1WHLA 5HGQA 2LQNA 1K9MC 1G5VA 2KROA 2KMTA 3PVQA 3I9QA 2ODRD 3M58A 3A8HB 3I56T 4BE0A 2DETA 2DZ9A 3OW2S 1RI9A 1ASYA 1JB0E 3OBYA 4XTVA 1VQ8T 2C7IA 2ROLA 1BIBA 2V8KA 3HXYA 1MHNA 4FL6A 1BBZA 1M1KC 1Q81C 1MMAA 1JJ2P 5IHNA 3MKDA 3WVEB 4CI0C 3X28B 2ALYB 5KYYB 5FU7C 5GMKi 2C0IA 1UJYA 5GMKe 4FCYA 1IZ6A 1QP2A 4C8QB 3H6ZA 4CC7A 4P75A 4JDSA 2O4XB 4II1A 3CC2Q 1QVGP 3OYMA 3WVDB 4QVCA 2QHSA 4BI3A 5GMKm 3CCRA 3OS2A 1Q82U 2JZ2A 4C5HA 1H8KA 1HJDA 2CJAA 2XMFA 3LH5A 2RHQA 4TVWA 4DPGA 1R8OB 4M78E 3MEWA 2YUPA 4XTZA 4YROA 3OYLA 4Z88A 5GJVB 3LX7A 2ODRC 1E7OA 3V8KA 2HZYA 2BUDA 3P8BB 4HWPA 2FZGB 2VKNA 2ATCB 1ASZA 2YHTA 2I4OA 4XU0A 3UDCA 1H3ZA 2HCKA 4H2TA 5J3BA 1Y0MA 1ATIA 4LDYA 4HT8A 3O8VA 1WA7A 1FXXA 3SWNC 3HY1A 4PJNA 2KBTA 1M5Q1 4J83A 2XGTA 1VQLA 3LH0A 4CRIA 1Z9QA 2PUOB 3VS1A 3G6ET 3JCMQ 3MPUB 4CS2A 1RADB 3JCMe 1RAEB 2I4LA 3CBOA 3OS5A 3TREA 5LJ5h 1UEBA 2VB6A 2ZZEA 2RO0A 1WHGA 2QQ9A 4G85A 2JUFA 2DL3A 1VQ9A 4BI8B 1RL2A 1UJ0A 4D8DA 4JRIA 1PWTA 3M55A 3CCST 4HCCA 2RF0A 3HFZA 2K2VA 3OYEA 3HRSA 3CCLT 1W2BA 3ZBDA 4BWAA 3ZL7C 2EQMA 3D7SB 2KEAA 3PGGA 3IALA 3OMGA 2RJDA 4RTXA 2P84A 2XDBA 4XQ3A 2DKGA 5GAOp 5IXFA 4EMKC 4N0AA 4EPCA 4KUDK 2WACA 4LDWA 2I4MA 2DD5A 3HXZA 3JB9D 4N4IA 2XU8A 2YWWA 1GBRA 3A7UA 4P73A 2MWOA 3SWNB 4M7AD 4X34A 5A0DA 4RMOA 4RQFA 3LWHA 2DJQA 3QUIA 3X25B 4J7IA 2P4TA 3MQZA 1JXMA 1XNIA 3A8OB 1USYA 3JRZA 4LN2A 1YJNT 3CCET 4DQ2A 1RI0A 2K3YA 3CCJT 1MMNA 3M59A 2ROTA 1F1BB 1OZ3A 1HD3A 2RHZA 1XQHA 3M0TA 4WJ4A 3NGPA 4TWAA 1IRXA 3DB3A 4J8OA 5A2QE 4CS3A 2GQVA 3OYAA 1RLPC 3LGFA 5HK3A 3M0QA 4AH6A 1WXUA 4M77D 4YRPA 1D3BA 2K5IA 5FU6B 5KH6A 1N8RU 3S6WA 1FMVA 3MHXA 5CK9A 2G3RA 1RLQC 1G2BA 1FX7A 4M75A 2NUTA 5EC7A 1ZSZA 5LJ5d 1OOTA 5D6XA 4UPAA 3CXCS 4EX5A 2OTLQ 4ELZC 1EIYA 1YP5A 3EG1A 4ZNXA 3QDRB 5GANf 4M7AC 4FSXA 4R56A 2Q7GA 2J6OA 1PKSA 3JB9F 2L3QA 3PFSA 5DLOA 1GCQC 3H41A 3MO8A 4YP0A 2V8JA 2E70A 4UP7A 4HT4A 2CZ1B 4D8KA 4M7AF 4ZGDB 3WQZA 2EBPA 2RI3A 2VXFA 3VQVA 3DLMA 2RD1A 4L5GA 1I8FA 4PNOA 3HFNA 1XTDA 4JRPA 3JCMP 3CPWP 2VXEA 3UWNA 3LYIA 4ZN1A 4J15A 3CCRT 1QMCA 1WQ7A 3HL8A 3PMTA 3JAME 2FB7A 2YDLA 3OYNA 2I4NA 2DYIA 2D0NA 1U1TA 4M77C 2ZPHB 3TEHA 2CSIA 2X51A 1PYSA 3NTHA 2HQXA 3PIOA 2F1LA 4M77F 1NPPA 2EQIA 2K5FA 1X27A 3IKMB 1KC8C 1FMKA 1D1AA 1YCYA 2MAMA 1KD1U 2E10A 5KYXA 4MDWA 1KJWA 3A32A 4A4FA 2FVUA 4ELYC 2CT4A 5KNNA 3RKWA 2AKKA 2ZCEA 4AG1C 1PNJA 4F7UA 1VYTA 1WNLA 4B9XA 3P8YA 4ATOA 1K8AC 3QWYA 2VV5A 2CS7A 3GF5A 1NM7A 3META 1VQLT 1LJOA 2KR3A 1XOVA 2EAYA 3HRTA 2FPFA 4M7DD 4E2FB 1GBQA 5GANj 1MV0B 4QVZA 4OB3B 1O75A 2D6FA 4WTOB 2COWA 3X24B 3OS0A
chains in the Genus database with same CATH topology
3MEVA 1VQZA 1QVGS 5M9OA 3OSSC 4E47A 3PZCA 1VQ9T 5IN1A 2J3MA 2LNVA 2LX9A 2MMPA 3M57A 1K73U 5CO7A 4ZIBA 2FL7A 4C92D 2ZCFB 4M7AG 2XG8D 4WJ3M 1RIQA 2PQWA 3QHSA 3JB9H 2RJCA 2EJGA 4QQ6A 2Y90A 3VV0A 3IKLA 2X35A 1E1OA 2B8AA 1KOGA 4M7DC 2RI5A 3HP9A 3GP8A 3FC3A 1JJCA 4PJOB 4IUQA 3V7RA 4JUVA 4M7DF 4M77G 1PSFA 1Z7NA 2DVEA 3W3SA 4P74C 2E64A 2A8EA 2ZGWA 2ZPFB 2JTMA 1N9RA 2RH2A 4H2XB 3HRUA 4HCBA 4C92C 2NS6A 5GAMe 1YI2T 4C92F 4M7AE 1KMMA 4P72C 2DJZA 3KBGA 2QXFA 4G84A 2HD0A 3T9NA 4XTXA 4E7JA 3LGLA 4HCZA 2C06A 4H2VA 3JCMX 4O5VA 2VGMA 1P92A 1KQSA 1E24A 3HFVA 3HKSA 1BYMA 4A53A 4D6WA 4M77E 3L4GA 3BDLA 3L2ZA 5C51B 5KE2A 1I5LA 2K5LA 4PLLA 3JCMb 1OYXA 3QIIA 4P5NA 4YREA 2AMCA 3P8TA 5ELNA 3PCOB 1VQ6A 2ZXFA 3DKMA 3NELA 3QJ6A 1G5IA 1X2GA 4BUGA 4M7DG 4LDUA 4PJOE 5GAN3 4YRLA 1VUBA 2E41A 3P8VA 3A5ZA 3PMIA 4N4HA 3RGLA 2RJFA 1BIAA 1VQOA 4M78A 3BJUA 3SDZA 3JCMJ 1Y96B 3G6EA 1M8VA 4C92G 3QG1A 2OAUA 4C8QD 3V8LA 2QI2A 3CPWS 2L3RA 4QQGA 4MMLA 2PUKB 1B7YA 3E9FA 4XU2A 3EFSA 1BI2A 3UT1A 4OP0A 1N9SA 1VQMA 3A8LB 4KR2A 2QDYB 1EOVA 2Q7HA 1Y71A 12ASA 1G3TA 1PSEA 2QA4A 3FRNA 3AHUA 3MF2A 3G71A 3OYGA 3FB9A 4RCBA 3JCMf 2ARTA 2E65A 5I21A 4PLIA 5J26A 3PTAA 1IL2A 2DXTA 2K3XA 4C8QC 5GMKj 4YCWA 2PVDB 4HA8A 4KUIA 3QO7A 2K57A 1W66A 5E3IA 1N9WA 2G4CA 4C8QF 1G3YA 2PVOB 2ALYA 1Q86C 5ELOA 2Q7EA 5LJ3d 1YIJA 4TQFA 3QKJA 2DQ0A 3VQXA 4ZGEB 1QVFS 3LW5E 2ARUA 1YB3A 4UC4A 3HY0A 1AHJB 3OB9A 4CS4A 5GAN8 4YRMA 2KAFA 3OSVA 4TVRA 4IUTA 1UB4A 4OGEA 3VU3C 3MF1A 2P0KA 1K9MU 1C0AA 1YBYA 2X4JA 5LJ5f 4H02A 4YCVA 5GAOq 1QW1A 5CCAA 3DLLA 4XTUA 2ZT5A 3OYHA 3CD6T 1KHIA 3MEUA 1VIEA 5LJ3g 5GAOm 4RMFA 3X26B 3OD1A 1Q81U 3MEYA 3HFOA 2ZIMA 1WJRA 4EO4A 2ZPGB 3RF1A 3M4PA 2HAXA 1X6OA 1X56A 3OA6A 3MCAB 1V29B 1HXDA 4J6WA 2Q5HA 3RIRA 5EG2A 2FYKA 2LT1A 1Q82C 4HWSA 3E9HA 5K1XA 3QTCA 3OY9A 1ADYA 3UPUA 4XAXB 5KCOA 1LYLA 4YRIA 4H2UA 5AYFA 1VQ6T 4LVMA 3ME9A 3BFMA 4RKUE 3MP8A 3RUXA 3CBMA 2A7YA 2DXBA 4C8QG 4K87A 4JRKA 3RESA 2RHUA 3L2WA 3CMAA 4MZPA 2DDZA 1VQOT 4LVLA 1YFTA 4J5YA 1B34A 1M1GA 2K4YA 3SWNA 2ZPEB 4WF2A 4XU1A 4BI4A 1L0WA 1WPYA 3FIFA 1KQ2A 2LDMA 3A7AA 3GNFB 4X9CA 2CJBA 5FU6C 3CCVA 2RHQB 2BKDN 4KBMB 5C6SA 2LVMA 1VQMT 2DU5A 4JLGA 5CQXA 3UGTA 2HQEA 2QA4T 2EKOA 4C8QE 3G71T 2YRVA 1KMNA 3HSBA 1NJIC 3CCUA 3HTZA 3QNEA 2QQRA 3LSQA 2A3LA 4EMKA 4YRNA 1NE8A 5LJ5e 1YITA 5A0LA 3RMQA 4TVYA 2KSSA 1YIJT 3HXXA 2R58A 3A8MB 2XD0A 4HWOA 2KQWA 4WI1A 1H641 4Q6GA 4C5EA 1YI2A 4V2SA 4P3OA 2DZCA 3MP6A 4BW9A 2ZT7A 2CZ0B 2EJ9A 1U1SA 4RG2A 3MP1A 4LVKA 2BIVA 4XTWA 2QQAA 1FYFA 4EDUA 4YRTA 3NEMA 3X20B 4R55A 1QP3A 3VJPA 5CKDA 4P71C 1I81A 4PJOD 4OVAA 3ICAA 4M7AA 2E5QA 1ADJA 4KR3A 5GAMf 2RHSA 4K86A 2F69A 3CMEA 5DLQE 4E7KA 4TVAB 5FLXE 2QEXT 4IKFA 2DO3A 4C0DC 4B9WA 5A0GA 2LTOA 2XDDA 4NL2A 1UGSB 3A74A 3REUA 2R5MA 5CKBA 3CC2A 3C94A 4Y28E 4E7IA 4VUBA 5CQYA 2QHUA 1DJ7B 4MZTA 1WU7A 4CH4A 3SB2A 3HXWA 4J7FA 4NOYA 1HK9A 1UGRB 4YDQA 4M77A 3REXA 5CAIA 4M75B 1H4SA 3CMAT 4GY5A 2VYTA 1EIYB 1BI1A 4PJOC 2X4WA 4J6YA 2LCCA 3ZEHA 3ZFJA 4KQEA 1KQ1A 4JS4A 1SERA 4PJOF 3CMQA 2X4YA 4C0ZA 4OMFB 2D9TA 2LQKA 1VQ7A 4YYEA 3VYGA 1EVKA 3CC4A 2DU7A 4LVJA 3INZA 3CCVT 4C0DB 1H4QA 2RHIA 4BY6C 3OYFA 5GAMj 5GAN6 1EIFA 2CZ6B 5GAOl 2RB6A 3TEHB 2P0LA 5GANh 4H2XA 1PYSB 2PMEA 1W2BS 1Q7YU 3A8GB 2RJEA 2GF7A 5GMKl 5CKFA 5IAYA 1NJ5A 1LOJA 3HXUA 3OYCA 3FDRA 4P3NA 11ASA 2AKWA 1LNXA 3CCUT 3F70A 3OYDA 3KXTA 2DXUA 4FIBA 4CH6A 5LL6S 3IG2A 4L59A 1YITT 4HT9A 2KDSA 4H2YA 4X9DA 4RQEA 4M7DA 2XICA 4A4HA 3C4SA 2EJFA 4P74A 3QO8A 4NL3A 3Q1JA 3A5YA 2DTIA 4BY6B 2P0PA 3G7ZA 4X5OA 2ZNIA 1SRYA 4C0FA 4IUVA 2ZIOA 2MWPA 4PJOG 3UH0A 4C92A 3PCOA 2EFIA 2WSCE 3E9IA 4YRFA 3R07A 4LD6A 4IUUA 4P72A 5GAOn 3LWIA 4DOVA 3JB9J 3JCMV 3OW2A 3CD6A 1WJSA 4MMKA 5GANd 4YPFA 2QQBA 2PVGB 2RA2A 2OTLA 4YRJA 2YLCA 1JJCB 3CMET 1Y96A 1NZ9A 4PL6A 3M4YA 2JTFA 1HC7A 3OYYA 2ZNJA 5K1PA 3CC2T 3GIBA 3FJPA 4HWRA 2XHCA 4YTLA 2AHJB 5CVIA 2H3JA 1WLEA 2JN0A 4ZN3A 3S3NA 5GANg 2NLUA 1YFSA 5LJ3h 2X4XA 4FT2A 1JBMA 2XK0A 2ZR3A 1QF6A 2XI9A 1X2HA 3VUZA 3RACA 4JLIA 3QYGB 3QBYA 1NJ1A 4A4KA 4O2DA 4LNSA 2ZTGA 5IT9E 1VQ7T 3GLXA 1ZBXA 3CC4T 3TEGA 3J7AF 4TTVA 2WSEE 1WGSA 3RERA 1X75C 4HVCA 2O01E 2C8MA 4C5GA 5CKEA 4L87A 2DIQA 2ZT6A 3OYBA 5FROA 2MI6A 5KCHA 4TQDA 4Z02A 3MEAA 1NYQA 1O9SA 2M9UA 4QW2A 1N6AA 1B70B 2IY5B 4QVDA 1M90U 3E19A 1BBUA 2RK2A 2HNIA 3CCQA 3ASKA 3M5AA 4M78B 1G3SA 1KG1A 2KK4A 3HRKA 2RK1A 3CEYA 2DTOA 2QTXA 2JOYA 2JVVA 4EMGA 4C8QA 3OBWA 2O4XA 2XIDA 1B7YB 3CC7A 5GAN4 2LQ8A 4ZTZB 1EVLA 4FM4B 5GMKh 3OYKA 1YJ9A 1NJ8A 1Y7XA 2DK3A 2XKOC 3V7SA 5D6WA 4BACA 3SD4A 1I4K1 4XK8E 4FU6A 3J81E 2WSFE 3BDUA 4LDVA 3QXEB 2CZ7B 1HTTA 3E9GA 1KQSS 2XTIA 4XEMA 2FHDA 1Z7MA 1VQ4A 2R57A 3CXCA 2I2LA 1VIFA 4H2SA 2OTLT 1BKBA 2RHYA 4Q5WA 1M1KU 4P75C 4Y91A 4UP8A 2QEXA 4E7HA 3M53A 4O6JA 3TCJA 1MGQA 4IURA 2DXCA 2DTHA 3HPWA 4KULA 3JCMh 2RI2A 4L6V5 3DSQA 4YRRA 2ZZFA 3M56A 4C5IA 3OQ5A 2GCXA 3S3MA 2V8IA 4YRKA 2Y4YA 4A4GA 3OYIA 1BI0A 3H8ZA 3QZ9B 1X55A 2L89A 3L2QA 3OMCA 5LJ5j 4HWTA 1B8AA 4K88A 1VQ5A 4BD3A 1UGPB 3EAEA 4XU3A 1JJ2A 3RL6A 4A4EA 2EQJA 5FU7B 1VQPA 1QVGA 2VUBA 1J5WA 1VQKT 1M9SA 1Y07A 1ZHIA 4OB1B 3L42A 3L2VA 4M75D 1B76A 3ERRA 1GXIE 2F5TX 4N0AC 3JCMc 3DB4A 3C12A 3NENA 1WYDA 3G1ZA 2ZT8A 1YHQA 4P73C 2ZPBB 1S72T 2VGNA 2Q5IA 3CCQT 3VYHB 3JCMd 2DEQA 4DOWA 3RKYA 1USYC 1NJIU 1NYRA 4YRCA 1B34B 4FT4A 4OGCA 1WQWA 3ER0A 3CC7T 5CIUA 2ZINA 3CCMT 4TVAA 3P8DA 3VKIA 1YJ9T 3QO3A 5C0MA 3KFUA 3NFCA 3HFZB 1N8RC 4M75C 2CIMA 5D6YA 4MZMA 3G4SA 2DIGA 2EIFA 4M75F 4PKCC 2P5IA 3JCMg 1VQNT 3L1AA 1NPRA 3I7FA 2LT4A 5I2SA 2M0OA 4DA4A 5DM7R 3M9QA 4LVIA 1VQ4T 2LCLA 2E3CA 3VBBA 1E22A 2CYZB 4HKEA 2JNGA 3VUBA 4EMKB 2RM4A 1M4ZA 2ZZDA 2ZR2A 4P71A 4YCUA 4BDZA 3VQWA 3I55A 1H4TA 1ZQ1A 2DQ3A 2QHTA 5GAN5 1OZ2A 4BE1A 4OF1A 1YGBA 3URGA 1D3BB 2EQKA 2M1HA 2DPPB 1TH7A 1KD1C 3CBPA 1KC8U 3N5BB 4ME7A 5LJ5g 4F7UF 5GAN2 4LD9K 3PT9A 4JRQA 5GAN7 1JRIA 4UP9A 3VQYA 3UFGA 1K8AU 2OTJA 2EWNA 3QPHA 3TEEA 3S3OA 1SETA 4ZGJB 4JJNK 4JS5A 1VQ5T 4YRQA 4BE2A 3NTKA 4PJOA 5I2MA 3WXMB 4M7AB 5C52B 4PG3A 2Y4XA 2RHSB 1JJ2S 3P8HA 4M75G 4OB2B 5HK0A 4XTYA 1X54A 4C0GA 2EQUA 4H2WA 1VQPT 3CPWA 1KHCA 4EMHA 4ZTJA 1K73C 2EL9A 5F5WA 3NTIA 4IUPA 2P0QA 3PIPA 1YJWA 3FLGA 5FRNA 3M4QA 2E1HA 1Q7YC 3JB9G 3HXVA 2EYQA 1G3WA 4BDYA 4ZTFA 4M77B 4F7UB 1YHQT 3C95A 4YRSA 5GAMh 2DAQA 1BI3A 2D0QB 4RCCA 3NETA 3FEOA 3TU4K 3L2UA 1NNHA 5CKHA 4NCXA 3GOXA 4RDXA 4Q15A 4M75E 5LJ3f 3LC0A 4F7UG 2J3LA 3E1SA 5GANe 3HHTB 5FRMA 2PMFA 1QVFA 3GPLA 3G4ST 4YRGA 4QQDA 3L2RA 5GAOr 4ZTUB 2IG0A 1NJ6A 1EFWA 5J39A 2CJ9A 3I56A 2AKWB 3QSUA 3V8JA 2ZPIB 3QYHB 4M78D 1YFRA 3J80E 1W4SA 1VQ8A 1IREB 2PU9B 3V7CA 1G51A 1GGMA 1SSFA 3HRIA 3QJYA 3PNWC 3BW1A 3I55T 2KVQG 4M7DB 5GAMd 2RHXA 4F7UE 1SESA 2VC8A 3UGQA 3CPFA 2E6NA 2IVWA 4NS5A 2HBPA 3OYJA 4E51A 3JSCA 2L8DA 5LJ3j 4BB7A 3R6OA 1NJ2A 4OB0B 2R5AA 4C92B 2QHVA 4P3PA 1QVPA 4E7LA 4MDXA 2GFUA 3TUPA 5HY6A 1WJQA 1QE0A 4M78C 1U8RA 1B70A 2OTJT 3QZ5B 2M16A 3BY7A 4XEOA 2IY5A 4M78F 1E1TA 2ARSA 5GAMg 3QO5A 2MF2A 3L4GB 4J6XA 2E6ZA 1OI1A 3M4GA 2F5KA 5KE3A 3KUFA 3LSSA 1H4VB 1N27A 1YJWT 1VQKA 3LLRA 2AMCB 2CKKA 1M1FA 5LJ3e 5HKCA 1UGQB 3CCSA 2QQSA 1G5HA 3JCMW 3CCLA 2KY9A 3A7RA 5CR2A 1EQRA 3A5ZB 1S72A 2E5AA 5C53B 1M90C 4M7DE 5DY9A 5L8RE 4A54A 4RG8A 2E12A 2ZZGA 2LC4A 2GFAA 3RMSA 2CGHA 3SFMA 2LRQA 4OLFA 3A31A 4PHCA 3RKXA 1X01A 3JB9I 2XDPA 1FWZA 3M54A 1BBWA 3GNGA 4C92E 1YJNA 4CH3A 3CCMA 3CCEA 1Q86U 2L5QA 3CCJA 3OS1A 4KT0E 4GLKA 2DD4A 4M78G 4LDXA 4CH5A 4N4GA 2YLBA 1VQNA 3EFRA 5HGQA 1K9MC 1G5VA 2KMTA 2ODRD 3M58A 3A8HB 3I56T 4BE0A 2DZ9A 3OW2S 1ASYA 1JB0E 3OBYA 4XTVA 1VQ8T 2C7IA 3HXYA 1BIBA 2V8KA 1MHNA 4FL6A 1M1KC 1Q81C 3WVEB 4CI0C 3X28B 2ALYB 5FU7C 5GMKi 5GMKe 1IZ6A 1QP2A 4C8QB 3H6ZA 4P75A 4JDSA 2O4XB 4II1A 3OYMA 3WVDB 4QVCA 2QHSA 4BI3A 5GMKm 3CCRA 3OS2A 1Q82U 2JZ2A 4C5HA 2CJAA 2RHQA 4TVWA 4DPGA 1R8OB 4M78E 3MEWA 4XTZA 4YROA 3OYLA 2ODRC 3LX7A 3V8KA 2BUDA 3P8BB 4HWPA 1ASZA 2YHTA 2I4OA 4XU0A 3UDCA 1H3ZA 4H2TA 5J3BA 1ATIA 4LDYA 4HT8A 3O8VA 1FXXA 3SWNC 3HY1A 4J83A 1M5Q1 2XGTA 1VQLA 3LH0A 4CRIA 2PUOB 3G6ET 3JCMQ 4CS2A 3JCMe 2I4LA 3CBOA 3OS5A 3TREA 5LJ5h 1UEBA 2ZZEA 2RO0A 2QQ9A 4G85A 2JUFA 1VQ9A 4BI8B 1RL2A 4JRIA 3M55A 3CCST 4HCCA 3HFZA 2K2VA 3OYEA 3HRSA 3CCLT 1W2BA 3ZBDA 4BWAA 2EQMA 3PGGA 3IALA 3OMGA 2RJDA 2XDBA 4XQ3A 2DKGA 5GAOp 4EMKC 4N0AA 4EPCA 4KUDK 2WACA 4LDWA 2I4MA 2DD5A 3HXZA 3JB9D 4N4IA 2XU8A 3A7UA 4P73A 2MWOA 3SWNB 4M7AD 4X34A 5A0DA 4RMOA 4RQFA 3LWHA 3QUIA 3X25B 4J7IA 2P4TA 3MQZA 1XNIA 3A8OB 1USYA 3JRZA 1YJNT 3CCET 4DQ2A 1RI0A 2K3YA 3CCJT 3M59A 1OZ3A 2RHZA 1XQHA 4WJ4A 4TWAA 3DB3A 4J8OA 5A2QE 4CS3A 2GQVA 3OYAA 3LGFA 5HK3A 4AH6A 4M77D 4YRPA 1D3BA 2K5IA 5FU6B 5KH6A 1N8RU 3S6WA 3MHXA 5CK9A 2G3RA 1FX7A 4M75A 5LJ5d 5D6XA 4UPAA 3CXCS 4EX5A 4ELZC 1EIYA 3QDRB 5GANf 4M7AC 4FSXA 4R56A 2Q7GA 3JB9F 3PFSA 5DLOA 3MO8A 4YP0A 2V8JA 2E70A 4UP7A 4HT4A 2CZ1B 4M7AF 4ZGDB 3WQZA 2RI3A 2VXFA 3VQVA 3DLMA 2RD1A 4L5GA 1I8FA 4PNOA 3HFNA 1XTDA 4JRPA 3JCMP 2VXEA 3UWNA 3LYIA 4ZN1A 4J15A 3CCRT 1WQ7A 3HL8A 3PMTA 3JAME 2FB7A 3OYNA 2I4NA 1U1TA 4M77C 2ZPHB 3TEHA 1PYSA 3NTHA 2HQXA 3PIOA 4M77F 1NPPA 2K5FA 3IKMB 1KC8C 1YCYA 2MAMA 1KD1U 2E10A 4MDWA 3A32A 4A4FA 2FVUA 4ELYC 5KNNA 3RKWA 2ZCEA 4F7UA 1WNLA 4B9XA 3P8YA 4ATOA 1K8AC 2VV5A 2CS7A 3GF5A 3META 1VQLT 1LJOA 1XOVA 2EAYA 3HRTA 4M7DD 5GANj 4QVZA 4OB3B 1O75A 2D6FA 3X24B 3OS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQZ A;  1HTT A;  4EMK A;  4YRN A;  5LJ5 e;  1NJ2 A;  3PZC A;  2XTI A;  4XEM A;  4C92 B;  2J3M A;  1Z7M A;  2QHV A;  4P3P A;  2I2L A;  4TVY A;  4H2S A;  3TUP A;  4ZIB A;  3HXX A;  4P75 C;  1QE0 A;  4M78 C;  4C92 D;  1B70 A;  4M7A G;  4Y91 A;  4HWO A;  4WI1 A;  4UP8 A;  1H64 1;  3BY7 A;  4XEO A;  2IY5 A;  4M78 F;  4WJ3 M;  1RIQ A;  1E1T A;  4Q6G A;  2ARS A;  5GAM g;  4V2S A;  3QO5 A;  4P3O A;  3QHS A;  3L4G B;  4J6X A;  3JB9 H;  2DZC A;  2EJG A;  3M4G A;  4BW9 A;  2Y90 A;  2ZT7 A;  3IKL A;  1MGQ A;  1E1O A;  2EJ9 A;  1U1S A;  2DTH A;  3JCM h;  1KOG A;  4M7D C;  3DSQ A;  4YRR A;  4XTW A;  2ZZF A;  1JJC A;  3LSS A;  4PJO B;  3V7R A;  4JUV A;  4M7D F;  1FYF A;  1H4V B;  4M77 G;  2AMC B;  4YRT A;  1Z7N A;  2DVE A;  3W3S A;  4P74 C;  3NEM A;  4YRK A;  2E64 A;  4P71 C;  1I81 A;  2ZGW A;  5LJ3 e;  4PJO D;  3ICA A;  4M7A A;  1G5H A;  1ADJ A;  4KR3 A;  1X55 A;  1N9R A;  5GAM f;  2RHS A;  4H2X B;  4K86 A;  3JCM W;  4C92 C;  5LJ5 j;  4HWT A;  3A7R A;  1EQR A;  4TVA B;  2E5A A;  5C53 B;  4M7D E;  5DY9 A;  5GAM e;  4C92 F;  1B8A A;  4K88 A;  4M7A E;  1KMM A;  4NL2 A;  4P72 C;  4A54 A;  3A74 A;  2DJZ A;  4XU3 A;  3REU A;  3RL6 A;  2ZZG A;  4G84 A;  2QHU A;  2CGH A;  1WU7 A;  4CH4 A;  3SB2 A;  3HXW A;  4OLF A;  3A31 A;  4XTX A;  4PHC A;  4NOY A;  1HK9 A;  1X01 A;  3RKX A;  3JB9 I;  4H2V A;  4YDQ A;  4M77 A;  3REX A;  5CAI A;  1BBW A;  4M75 B;  3JCM X;  1J5W A;  1H4S A;  4C92 E;  4CH3 A;  1E24 A;  3HFV A;  1EIY B;  4M75 D;  4A53 A;  1B76 A;  4M77 E;  3ERR A;  4PJO C;  3L4G A;  4N0A C;  4J6Y A;  3JCM c;  4KQE A;  1KQ1 A;  3NEN A;  1WYD A;  4M78 G;  3L2Z A;  3G1Z A;  1SER A;  4CH5 A;  4PJO F;  3CMQ A;  2ZT8 A;  4P73 C;  5C51 B;  2YLB A;  3EFR A;  1I5L A;  5HGQ A;  2Q5I A;  3JCM b;  3JCM d;  2DEQ A;  4YYE A;  2ODR D;  1EVK A;  3RKY A;  1USY C;  4YRE A;  2AMC A;  1NYR A;  3P8T A;  2DU7 A;  2DZ9 A;  5ELN A;  3PCO B;  4YRC A;  1ASY A;  1B34 B;  2ZXF A;  3INZ A;  1H4Q A;  3NEL A;  1G5I A;  1X2G A;  4XTV A;  5GAM j;  5GAN 6;  4M7D G;  4PJO E;  2C7I A;  1WQW A;  3HXY A;  1BIB A;  5GAO l;  2RB6 A;  5GAN 3;  4YRL A;  2P0L A;  3TEH B;  5GAN h;  4H2X A;  1PYS B;  2PME A;  2E41 A;  3P8V A;  2ZIN A;  5GMK l;  2ALY B;  3A5Z A;  4TVA A;  3RGL A;  5GMK i;  1NJ5 A;  3QO3 A;  1BIA A;  5GMK e;  1LOJ A;  3HXU A;  3KFU A;  3HFZ B;  4P75 A;  4C8Q B;  4M75 C;  4M78 A;  2CIM A;  4P3N A;  11AS A;  3BJU A;  4QVC A;  3JCM J;  2QHS A;  5GMK m;  2AKW A;  1Y96 B;  1LNX A;  4M75 F;  1M8V A;  4C92 G;  2DXU A;  4C8Q D;  2P5I A;  3JCM g;  2CJA A;  4CH6 A;  3L1A A;  3V8L A;  2RHQ A;  4TVW A;  4DPG A;  3IG2 A;  3I7F A;  4M78 E;  4XTZ A;  4YRO A;  4MML A;  1B7Y A;  2ODR C;  4HT9 A;  4XU2 A;  3V8K A;  4HWP A;  4H2Y A;  3EFS A;  4X9D A;  2E3C A;  4RQE A;  1ASZ A;  4M7D A;  3VBB A;  2YHT A;  2I4O A;  1E22 A;  4OP0 A;  1N9S A;  4XU0 A;  4H2T A;  1ATI A;  4EMK B;  2EJF A;  2RM4 A;  4HT8 A;  4KR2 A;  4P74 A;  1EOV A;  3QO8 A;  2Q7H A;  4NL3 A;  3SWN C;  3A5Y A;  2ZR2 A;  2DTI A;  12AS A;  4P71 A;  4X5O A;  4YCU A;  2ZNI A;  3HY1 A;  1SRY A;  3VQW A;  1H4T A;  1M5Q 1;  3AHU A;  3MF2 A;  2XGT A;  2ZIO A;  2DQ3 A;  3FB9 A;  4PJO G;  2QHT A;  4RCB A;  3JCM f;  5GAN 5;  3UH0 A;  4C92 A;  1YGB A;  2ART A;  2E65 A;  5I21 A;  3PCO A;  3JCM Q;  1IL2 A;  1D3B B;  4CS2 A;  2DXT A;  3JCM e;  3E9I A;  4YRF A;  1TH7 A;  3R07 A;  4C8Q C;  2I4L A;  5GMK j;  4YCW A;  4P72 A;  5LJ5 h;  4HA8 A;  5GAO n;  3QO7 A;  2K57 A;  1W66 A;  2ZZE A;  5E3I A;  5LJ5 g;  3JB9 J;  1N9W A;  2G4C A;  3JCM V;  4C8Q F;  4G85 A;  4MMK A;  2ALY A;  4F7U F;  5GAN d;  5GAN 2;  4YPF A;  4JRI A;  2RA2 A;  5GAN 7;  1JRI A;  5ELO A;  2Q7E A;  5LJ3 d;  4TQF A;  4UP9 A;  4YRJ A;  3VQY A;  2DQ0 A;  2YLC A;  3UFG A;  3VQX A;  3HFZ A;  1JJC B;  2ARU A;  1YB3 A;  2EWN A;  3HY0 A;  4BWA A;  1Y96 A;  1SET A;  1HC7 A;  4CS4 A;  3PGG A;  5GAN 8;  4YRM A;  3IAL A;  2ZNJ A;  4YRQ A;  5K1P A;  4XQ3 A;  2DKG A;  5GAO p;  4PJO A;  4M7A B;  4N0A A;  4EMK C;  5C52 B;  4PG3 A;  2I4M A;  2RHS B;  3HXZ A;  4M75 G;  3VU3 C;  3GIB A;  3MF1 A;  3JB9 D;  3FJP A;  3A7U A;  4P73 A;  4XTY A;  1X54 A;  1C0A A;  3SWN B;  4HWR A;  4M7A D;  4H2W A;  4RQF A;  5LJ5 f;  4H02 A;  4YCV A;  5GAO q;  3QUI A;  4EMH A;  2EL9 A;  5F5W A;  1WLE A;  2JN0 A;  1USY A;  4XTU A;  5GAN g;  1YFS A;  2ZT5 A;  5LJ3 h;  4DQ2 A;  3M4Q A;  1JBM A;  5LJ3 g;  2E1H A;  5GAO m;  2ZR3 A;  4RMF A;  1QF6 A;  4WJ4 A;  3JB9 G;  3OD1 A;  3HXV A;  3MEY A;  3HFO A;  4M77 B;  2ZIM A;  4F7U B;  4TWA A;  1X2H A;  4EO4 A;  3RAC A;  4JLI A;  3RF1 A;  3M4P A;  4CS3 A;  4YRS A;  1X56 A;  5GAM h;  1HXD A;  1NJ1 A;  4J6W A;  4O2D A;  4AH6 A;  2Q5H A;  3RIR A;  2ZTG A;  4M77 D;  4LNS A;  4YRP A;  1D3B A;  2FYK A;  4HWS A;  4RCC A;  3E9H A;  5K1X A;  3QTC A;  3NET A;  1ADY A;  1LYL A;  4M75 A;  4YRI A;  3TEG A;  4TTV A;  4H2U A;  1NNH A;  5LJ5 d;  4UPA A;  3RER A;  4EX5 A;  3BFM A;  4HVC A;  4NCX A;  1EIY A;  3RUX A;  5GAN f;  4RDX A;  4M7A C;  4Q15 A;  4M75 E;  2C8M A;  2Q7G A;  4L87 A;  3JB9 F;  2ZT6 A;  4YP0 A;  4C8Q G;  5LJ3 f;  4K87 A;  4JRK A;  3LC0 A;  4UP7 A;  4F7U G;  2J3L A;  4M7A F;  4TQD A;  3WQZ A;  5GAN e;  2VXF A;  3RES A;  3VQV A;  2RD1 A;  1NYQ A;  1I8F A;  4PNO A;  3HFN A;  3JCM P;  2VXE A;  2DDZ A;  1B70 B;  2PMF A;  4J15 A;  4YRG A;  2IY5 B;  1WQ7 A;  4QVD A;  1YFT A;  4J5Y A;  1B34 A;  2FB7 A;  1BBU A;  3SWN A;  5GAO r;  2I4N A;  2HNI A;  4WF2 A;  4ZTU B;  4XU1 A;  1U1T A;  4M77 C;  1L0W A;  1WPY A;  4M78 B;  3TEH A;  1NJ6 A;  3FIF A;  1PYS A;  3HRK A;  1KQ2 A;  1EFW A;  2CJ9 A;  3A7A A;  2AKW B;  3QSU A;  4M77 F;  3V8J A;  2DTO A;  3IKM B;  2QTX A;  4X9C A;  2CJB A;  1YCY A;  2E10 A;  4M78 D;  4EMG A;  3A32 A;  2RHQ B;  1YFR A;  4C8Q A;  5KNN A;  3RKW A;  2ZCE A;  2DU5 A;  3V7C A;  4F7U A;  1WNL A;  1B7Y B;  1G51 A;  3P8Y A;  1GGM A;  5GAN 4;  4ZTZ B;  3HRI A;  3UGT A;  1EVL A;  5GMK h;  3BW1 A;  4M7D B;  4C8Q E;  1NJ8 A;  5GAM d;  3V7S A;  4F7U E;  1LJO A;  1SES A;  2VC8 A;  2EAY A;  1I4K 1;  3UGQ A;  1KMN A;  4M7D D;  3HSB A;  3HTZ A;  5GAN j;  3QNE A;  3LSQ A;  3BDU A;  4E51 A;  5LJ3 j; 
#chains in the Genus database with same CATH topology
 3MEV A;  1VQZ A;  1QVG S;  1VQK Q;  5M9O A;  1PRM C;  1TSF A;  3I5S A;  3OSS C;  1EX4 A;  4E47 A;  2KE9 A;  1QVF P;  3PZC A;  1VQ9 T;  5IN1 A;  2GQI A;  2J3M A;  2LNV A;  2LX9 A;  2MMP A;  3M57 A;  1N5Z A;  1Y57 A;  1K73 U;  5CO7 A;  2O2O A;  1QWE A;  4ZIB A;  1M2O A;  2FL7 A;  4C92 D;  1W1F A;  2ZCF B;  4M7A G;  2A28 A;  2XG8 D;  2DIL A;  1S72 Q;  4WJ3 M;  1RIQ A;  2PQW A;  1AWW A;  1RAF B;  3REA B;  3QHS A;  3VS0 A;  3JB9 H;  2RJC A;  1H92 A;  2EJG A;  2KGT A;  4QQ6 A;  2Y90 A;  4Z89 A;  2AK5 A;  3VV0 A;  3IKL A;  2X35 A;  1E1O A;  4RTY A;  2B8A A;  1KOG A;  1JO8 A;  2W10 A;  4M7D C;  2RI5 A;  2SEM A;  3HP9 A;  3GP8 A;  3FC3 A;  3FJ5 A;  2YT6 A;  1JJC A;  1G83 A;  4PJO B;  4IUQ A;  3V7R A;  4KH1 B;  4JUV A;  3CC7 Q;  4M7D F;  4M77 G;  1YJN Q;  1WFW A;  1PSF A;  1Z7N A;  2DVE A;  3W3S A;  3CCM Q;  4P74 C;  3EG0 A;  3VS5 A;  1YJ9 Q;  2VAS A;  2E64 A;  2OI3 A;  2A8E A;  2ZGW A;  2K3B A;  1RAH B;  2K9G A;  2ZPF B;  2JTM A;  1T3S A;  3NMZ C;  1YN8 A;  1N9R A;  2RH2 A;  4H2X B;  1UDL A;  3HRU A;  4HCB A;  4C92 C;  2NS6 A;  1SRM A;  2A37 A;  1VQN Q;  4JZ3 A;  1TS9 A;  4IIO A;  5GAM e;  1YI2 T;  4C92 F;  4M7A E;  1KMM A;  4P72 C;  4DEY A;  2DJZ A;  2KRN A;  3KBG A;  1VQ4 Q;  1K76 A;  1RAB B;  2QXF A;  5KYU B;  2DYB A;  4G84 A;  4QT7 A;  4FW1 A;  2HD0 A;  3T9N A;  2JMC A;  4XTX A;  4E7J A;  3LGL A;  4HCZ A;  1ZBJ A;  2C06 A;  4H2V A;  1IGQ A;  3JCM X;  2KRS A;  2VGM A;  4O5V A;  1P92 A;  1KQS A;  1IHW A;  1E24 A;  4AFU C;  3HFV A;  3HKS A;  1BYM A;  2AIR B;  4A53 A;  4D6W A;  4M77 E;  1X69 A;  3L4G A;  4DBF A;  2O9V A;  2QYZ A;  1T3L A;  3BDL A;  3L2Z A;  5C51 B;  1YWO A;  2HDA A;  5KE2 A;  4KGZ B;  3EH2 A;  2BE7 D;  1I5L A;  3EG9 B;  1PC0 A;  2K5L A;  4PLL A;  3JCM b;  1OYX A;  3QII A;  1YNZ A;  4P5N A;  4LXC A;  3A98 A;  4YRE A;  2AMC A;  3P8T A;  4PFZ A;  5ELN A;  3PCO B;  1VQ6 A;  3THK A;  2ZXF A;  3DKM A;  3NEL A;  3QJ6 A;  1G5I A;  1X2G A;  1ABO A;  4LNP A;  4PK4 A;  4LDU A;  4BUG A;  4M7D G;  4PJO E;  1MV3 A;  1MND A;  1AZG B;  5GAN 3;  4YRL A;  1VUB A;  2E41 A;  2YSQ A;  3P8V A;  3A5Z A;  3PMI A;  4N4H A;  3RGL A;  2B86 A;  1VQ5 Q;  2JM9 A;  2RJF A;  1AEY A;  1BIA A;  2RPN A;  3BE3 A;  1VQO A;  4HVV A;  3EHQ A;  4M78 A;  1LVK A;  4OMM A;  3BJU A;  3SDZ A;  2V1Q A;  3JCM J;  1Y96 B;  2E5K A;  4R0K A;  4J9C A;  2E4H A;  3G6E A;  1M8V A;  4C92 G;  3QG1 A;  1VQP Q;  2OAU A;  4C8Q D;  4DBR A;  2FRY A;  3V8L A;  2QI2 A;  3CPW S;  1PCX A;  2JS0 A;  2L3R A;  4QQG A;  2FO0 A;  4MML A;  1NEG A;  1RAI B;  2PUK B;  1B7Y A;  3E9F A;  1M3C A;  1VQ9 Q;  4XU2 A;  3EFS A;  1ZUU A;  1BI2 A;  2JW4 A;  3UT1 A;  2LX7 A;  2YRC A;  4OP0 A;  1N9S A;  1VQM A;  1YHQ Q;  2QAS A;  3A8L B;  4KR2 A;  2QDY B;  1EOV A;  3G1J A;  2Q7H A;  1CKA A;  3VRZ A;  1Y71 A;  12AS A;  1G3T A;  1PSE A;  2V1R A;  2QA4 A;  3FRN A;  3NHN A;  3AHU A;  3MF2 A;  3G71 A;  4JPB W;  3OYG A;  1ABQ A;  3FB9 A;  2W0Z A;  4RCB A;  3JCM f;  3RBB B;  1WYX A;  2LP5 A;  2ART A;  2E65 A;  5I21 A;  1B7T A;  4PLI A;  5J26 A;  3PTA A;  1IL2 A;  1ZSG A;  2DXT A;  2QGF B;  2K3X A;  4C8Q C;  5GMK j;  1AT1 B;  4YCW A;  2PVD B;  4HA8 A;  1M2V A;  3SHW A;  4KUI A;  3QO7 A;  2K57 A;  1W66 A;  5E3I A;  5AT1 B;  1N9W A;  2G4C A;  4C8Q F;  1G3Y A;  2PVO B;  2ALY A;  1J3T A;  1Q86 C;  5ELO A;  1BK2 A;  2Q7E A;  5LJ3 d;  1YIJ A;  4TQF A;  3QKJ A;  2DQ0 A;  3VQX A;  4ZGE B;  1QVF S;  3LW5 E;  2ARU A;  1YB3 A;  4UC4 A;  3HY0 A;  1T0H A;  1KFZ A;  1AHJ B;  5FWB A;  3OB9 A;  1WHM A;  1U3O A;  4CS4 A;  1BU1 A;  5GAN 8;  4YRM A;  2KAF A;  2JMA A;  3OSV A;  4TVR A;  4IUT A;  1UB4 A;  4OGE A;  3VU3 C;  3MF1 A;  2P0K A;  4ANJ A;  1K9M U;  1C0A A;  1YBY A;  1KD1 R;  2X4J A;  5LJ5 f;  4H02 A;  4YCV A;  1S1N A;  5GAO q;  3R6N A;  1JU5 C;  1QW1 A;  5CCA A;  1C0M A;  3DLL A;  1QKW A;  4IIM A;  1X43 A;  4XTU A;  2I0N A;  2ZT5 A;  3OYH A;  3CD6 T;  2DMO A;  1KHI A;  3MEU A;  1VIE A;  3I55 Q;  5LJ3 g;  2NWM A;  5IH2 A;  2KXD A;  5GAO m;  4RMF A;  3X26 B;  3OD1 A;  1SKU B;  1Q81 U;  3MEY A;  3HFO A;  2ZIM A;  1WJR A;  1MMD A;  4EO4 A;  2ZPG B;  3RF1 A;  3M4P A;  2HAX A;  1X6O A;  1X56 A;  3OA6 A;  3MCA B;  1V29 B;  1HXD A;  4J6W A;  2Q5H A;  3RIR A;  1QLY A;  5EG2 A;  2FYK A;  2LT1 A;  1Q82 C;  4HWS A;  3E9H A;  5K1X A;  3QTC A;  1TOV A;  3OY9 A;  1ADY A;  3UPU A;  4XAX B;  5KCO A;  1LYL A;  4YRI A;  4H2U A;  5AYF A;  3CQT A;  1W2B P;  1VQ6 T;  4LVM A;  2NUP A;  3ME9 A;  3BFM A;  4RKU E;  2X3X D;  3MP8 A;  3RUX A;  1K73 R;  2CP2 A;  2LQW A;  3CBM A;  4AFZ C;  5L23 A;  2K6D A;  2A7Y A;  2OTJ Q;  2DXB A;  4C8Q G;  4K87 A;  4JRK A;  1MMG A;  3RES A;  2RHU A;  3L2W A;  3CMA A;  1Q7Y R;  3REB B;  4MZP A;  2DDZ A;  1VQO T;  4LVL A;  4KGV B;  3KFV A;  1ZX6 A;  1YFT A;  4J5Y A;  2EGC A;  1B34 A;  1M1G A;  3H0F A;  2K4Y A;  3SWN A;  2ZPE B;  2FEI A;  4WF2 A;  4XU1 A;  2DVJ A;  4BI4 A;  1L0W A;  2CP5 A;  1YJW Q;  1KSW A;  1WPY A;  4FSS A;  3FIF A;  1KQ2 A;  2LDM A;  3A7A A;  3GNF B;  4X9C A;  1UEC A;  2CJB A;  5FU6 C;  2EGE A;  3CCV A;  2RHQ B;  2BKD N;  4KBM B;  5ECA A;  5C6S A;  2LVM A;  2D8J A;  2QGG A;  1VQM T;  2DU5 A;  1NEB A;  1ARK A;  1AD5 A;  4JLG A;  5CQX A;  1K0X A;  3UGT A;  1OX9 A;  2O88 A;  2HQE A;  2LZ6 B;  2QA4 T;  2DBK A;  2EKO A;  4C8Q E;  3G71 T;  2YRV A;  1C6V X;  1KMN A;  3HSB A;  4E7S A;  3CCU A;  1NJI C;  3HTZ A;  3QNE A;  2QQR A;  2LNH B;  1X6B A;  4B6M A;  1IXD A;  3LSQ A;  2DRM A;  2A3L A;  4AMC A;  2EKH A;  1VA7 A;  2QK0 A;  2HSP A;  2RNA A;  4EMK A;  1GL5 A;  4YRN A;  1NE8 A;  5LJ5 e;  1X6G A;  1WXT A;  2GTJ A;  1YIT A;  1EZZ B;  5KYW B;  5A0L A;  3RMQ A;  4TVY A;  2KSS A;  2M0Y A;  1YIJ T;  3HXX A;  2R58 A;  3A8M B;  1M3B A;  2XD0 A;  4HWO A;  2KQW A;  4WI1 A;  2HMA A;  1H64 1;  4EIK A;  2GNC A;  1PG5 B;  4Q6G A;  4C5E A;  1YI2 A;  1B07 A;  4V2S A;  4P3O A;  1D09 B;  2DZC A;  3MP6 A;  3I56 Q;  4BW9 A;  2ZT7 A;  3UAT A;  4AFS C;  1LPL A;  1GFC A;  2CZ0 B;  2EJ9 A;  1U1S A;  4RG2 A;  1I0C A;  3MP1 A;  4LVK A;  1VQ8 Q;  2JM8 A;  2QG9 B;  2BIV A;  4XTW A;  2QQA A;  2JT4 A;  1UGV A;  1FYF A;  4EDU A;  4YRT A;  1QCN A;  3NEM A;  1SHG A;  3X20 B;  1QP3 A;  2HBW A;  2YUO A;  3VJP A;  4R55 A;  1WXB A;  5CKD A;  4P71 C;  1I81 A;  4PJO D;  1WI7 A;  4OVA A;  5FW9 A;  3ICA A;  4M7A A;  3EGD A;  2YUQ A;  2E3I A;  2E5Q A;  1ADJ A;  1UHC A;  4KR3 A;  1GCQ A;  5GAM f;  2RHS A;  1RAC B;  4K11 A;  4K86 A;  2F69 A;  3GBQ A;  3CME A;  5DLQ E;  4E7K A;  4TVA B;  5FLX E;  2QEX T;  4IKF A;  2O31 A;  2DO3 A;  4C0D C;  2HKQ B;  3TSW A;  4B9W A;  5A0G A;  1U5S A;  2DNU A;  4AG2 C;  2LTO A;  2XDD A;  4NL2 A;  1UGS B;  2K79 A;  2NYS A;  1SSH A;  3EFO B;  3A74 A;  3REU A;  2R5M A;  5CKB A;  3CC2 A;  3C94 A;  4Y28 E;  4E7I A;  4VUB A;  5CQY A;  2QHU A;  1DJ7 B;  4MZT A;  1GFD A;  1WU7 A;  3SB2 A;  1UHF A;  3HXW A;  4CH4 A;  2MIO A;  4J7F A;  4NOY A;  1HK9 A;  1UGR B;  4YDQ A;  1RUW A;  3A1P A;  4M77 A;  3REX A;  5CAI A;  4M75 B;  2DE0 X;  1PHT A;  1KIK A;  1H4S A;  1ZSZ B;  1YFN A;  4FYY B;  3CMA T;  4GY5 A;  2VYT A;  1EIY B;  1BI1 A;  1VQO Q;  4PJO C;  2X4W A;  4J6Y A;  2LCC A;  3ZEH A;  3ZFJ A;  1NYG A;  4KQE A;  1KQ1 A;  1I1J A;  1OX8 A;  4JS4 A;  1SER A;  3G6E Q;  4PJO F;  3CMQ A;  2X4Y A;  4C0Z A;  1M90 R;  4OMF B;  3VS4 A;  2D9T A;  2LQK A;  2QAZ A;  3H0I A;  1VQ7 A;  4YYE A;  3VYG A;  1SG5 A;  1EVK A;  3CC4 A;  2DU7 A;  1X2K A;  1AVZ C;  4LVJ A;  2A36 A;  3INZ A;  3CCV T;  4C0D B;  3CCS Q;  2RHI A;  4BY6 C;  1H4Q A;  3OYF A;  5GAM j;  2KNB B;  5GAN 6;  3M0S A;  1EIF A;  2CT3 A;  2CZ6 B;  5GAO l;  2KT1 A;  2RB6 A;  3CCL Q;  3TEH B;  1D1B A;  2P0L A;  5GAN h;  4H2X A;  1PYS B;  2PME A;  1W2B S;  2F2W A;  1Q7Y U;  3A8G B;  2RJE A;  2GF7 A;  5GMK l;  5CKF A;  5IAY A;  5KYX B;  1NJ5 A;  2BE9 B;  1LOJ A;  3G71 Q;  1NBE B;  3HXU A;  1BCO A;  3OYC A;  3FDR A;  2KYB A;  4P3N A;  11AS A;  2AKW A;  1LNX A;  1TUG B;  3CCU T;  3F70 A;  3OYD A;  3EGX A;  3KXT A;  1K9M R;  2DXU A;  4FIB A;  4CH6 A;  4E6R A;  4Y92 A;  5LL6 S;  3IG2 A;  2RQT A;  4L59 A;  1GRI A;  5HCK A;  3CCE Q;  1YIT T;  4HT9 A;  2KDS A;  1SRL A;  4H2Y A;  4X9D A;  3CCJ Q;  4RQE A;  2DEU A;  5IHK A;  4M7D A;  2XIC A;  4A4H A;  1M1K R;  1Q81 R;  1D0Y A;  1TUD A;  2EJF A;  3C4S A;  2EVR A;  1Z9Z A;  4P74 A;  3QO8 A;  2E3H A;  4NL3 A;  3Q1J A;  3A5Y A;  4GLM A;  1E6G A;  2DTI A;  2P0P A;  3G7Z A;  4BY6 B;  4X5O A;  2ZNI A;  1SRY A;  1IB8 A;  2C0T A;  2DRK A;  2ECZ A;  3JV3 A;  4C0F A;  4IUV A;  2IPO B;  2ZIO A;  2DL8 A;  2MWP A;  1GCP A;  4PJO G;  1SHF A;  4PFP A;  1M30 A;  3UH0 A;  4C92 A;  3UA7 A;  2DM1 A;  3PCO A;  2EFI A;  4F14 A;  2WSC E;  3E9I A;  1LCK A;  4YRF A;  3R07 A;  4RTU A;  4LD6 A;  4IUU A;  3ULR B;  4P72 A;  4OML A;  5GAO n;  2DER A;  3LWI A;  2HEQ A;  4DOV A;  3JB9 J;  3JCM V;  3OW2 A;  3E2U A;  3CD6 A;  1WJS A;  4MMK A;  1HYO A;  5GAN d;  4YPF A;  4E7Z A;  2QQB A;  2PVG B;  2RA2 A;  2OTL A;  4YRJ A;  1XJW B;  2YLC A;  1JJC B;  3CCR Q;  2HKN A;  2RQV A;  3CME T;  1Y96 A;  1NZ9 A;  4PL6 A;  3M4Y A;  2JTF A;  1HC7 A;  3EG2 A;  3OYY A;  1WHK A;  2DLP A;  2ZNJ A;  5K1P A;  3TSZ A;  3CC2 T;  1VYV A;  3GIB A;  3FJP A;  4JJD A;  2FZC B;  1WHJ A;  2FPD A;  4HWR A;  2XHC A;  5IXB A;  1V76 A;  2ED0 A;  2X3W D;  4YTL A;  4ESR A;  2AHJ B;  3M0R A;  1OPL A;  5CVI A;  1M3A A;  2H3J A;  1WLE A;  2JN0 A;  2OAW A;  4ZN3 A;  3S3N A;  2CSQ A;  5GAN g;  2NLU A;  1YFS A;  5LJ3 h;  2X4X A;  4FT2 A;  1EFN A;  1JBM A;  2XK0 A;  1CSK A;  1D0X A;  1TTH B;  1VQL Q;  2ZR3 A;  1QF6 A;  1SF9 A;  2XI9 A;  1X2H A;  3VUZ A;  3RAC A;  4JLI A;  3QYG B;  3QBY A;  1V1C A;  4LUE A;  1NJ1 A;  4A4K A;  4O2D A;  4LNS A;  2ZTG A;  5IT9 E;  1VQ7 T;  2Z0W A;  3GLX A;  1ZBX A;  3UF4 A;  4J9E A;  3CC4 T;  3TEG A;  2GGR A;  1OEB A;  3J7A F;  4TTV A;  2WSE E;  4RTW A;  2H3E B;  3VS6 A;  1W6X A;  2HL3 A;  1WGS A;  3RER A;  1X75 C;  4HVC A;  2O01 E;  2C8M A;  4C5G A;  5CKE A;  4L87 A;  2DIQ A;  2ZT6 A;  1OU8 A;  2QDL A;  5FRO A;  3OYB A;  2MI6 A;  5KCH A;  4TQD A;  4Z02 A;  1OPK A;  2DF6 A;  3MEA A;  1NYQ A;  1O9S A;  3VS3 A;  2M9U A;  4QW2 A;  1N6A A;  2CUD A;  1UE9 A;  2L3P A;  1B70 B;  2EYZ A;  2IY5 B;  1QCO A;  1KK7 A;  4QVD A;  2PNI A;  2CP3 A;  3E19 A;  1M90 U;  1BBU A;  2RK2 A;  2HNI A;  3CCQ A;  2VVK A;  3ASK A;  3M5A A;  4M78 B;  4QKU A;  1G3S A;  1OV3 A;  2KK4 A;  1KG1 A;  4HCK A;  4FYW B;  3HRK A;  1TG0 A;  2RK1 A;  3CEY A;  2DTO A;  2QTX A;  2JOY A;  5KYY A;  2JVV A;  4EMG A;  1D0Z A;  2J6F A;  4C8Q A;  3OBW A;  5I22 A;  2O4X A;  4KH0 B;  2L0A A;  5GJW B;  2XID A;  4F16 A;  1B7Y B;  4J9I A;  3CC7 A;  4JJB A;  5GAN 4;  2LQ8 A;  4ZTZ B;  4HVW A;  1EVL A;  4FM4 B;  5GMK h;  1YI2 Q;  3OYK A;  1YJ9 A;  4AFQ C;  1QWF A;  1Y7X A;  1NJ8 A;  2DK3 A;  2XKO C;  5FWC A;  3V7S A;  1IO6 A;  5D6W A;  4RUG A;  4BAC A;  3SD4 A;  1I4K 1;  4GBQ A;  4XK8 E;  4FU6 A;  3J81 E;  2WSF E;  1R0B G;  3BDU A;  4JJC A;  2KRM A;  4LDV A;  3QXE B;  2CZ7 B;  1HTT A;  2BZY A;  1KC8 R;  3E9G A;  2FZK B;  1KQS S;  2XTI A;  4XEM A;  2FHD A;  1Z7M A;  1VQ4 A;  2R57 A;  3CXC A;  2I2L A;  3UA6 A;  1I5O B;  1VIF A;  2FPE A;  1BKB A;  2RHY A;  4Q5W A;  2OTL T;  2RQR A;  4H2S A;  3QDF A;  1M1K U;  4CC3 A;  4P75 C;  1AWX A;  2GTO A;  1M2V B;  4Y91 A;  1K8A R;  2CH4 A;  3CME Q;  4UP8 A;  4WCI A;  2AZS A;  1K1Z A;  4OMP A;  2QEX A;  4E7H A;  2ZAE A;  2KYM A;  3M53 A;  4O6J A;  3EH1 A;  3TCJ A;  1UTI A;  3SEM A;  1T0J A;  3H0H A;  1MGQ A;  4IUR A;  1RAG B;  2CP6 A;  2DXC A;  1AWJ A;  2DTH A;  3HPW A;  4KUL A;  3JCM h;  2RI2 A;  4L6V 5;  3DSQ A;  9ATC B;  4YRR A;  2AZV A;  2ZZF A;  3VS2 A;  3M56 A;  4C5I A;  5KYN A;  4CC4 B;  2EW3 A;  3IQL A;  3OQ5 A;  2GCX A;  4FYX B;  3S3M A;  1ZA2 B;  1FMW A;  2V8I A;  2BZX A;  3QWX X;  4YRK A;  2Y4Y A;  4A4G A;  3OYI A;  3C0C A;  1YCS B;  1BI0 A;  3H8Z A;  2K2M A;  1VYU A;  4RTT A;  1MNE A;  2COZ A;  2K7A A;  2L89 A;  3QZ9 B;  1X55 A;  3L2Q A;  1ZUK A;  3OMC A;  5LJ5 j;  4F04 B;  1AWO A;  1WHH A;  4HWT A;  1VQ7 Q;  1B8A A;  4K88 A;  4J9D A;  3VRY A;  1VQ5 A;  4BD3 A;  1UGP B;  3EAE A;  3CC4 Q;  1ACM B;  4XU3 A;  1JJ2 A;  3RL6 A;  4A4E A;  1PD1 A;  2VWF A;  3U23 A;  2KT8 A;  5KYW A;  2EQJ A;  5FU7 B;  1VQP A;  2EYW A;  1W70 A;  2P4R A;  1QVG A;  1JQQ A;  2VUB A;  1J5W A;  1VQK T;  2SRC A;  1M9S A;  1Y07 A;  1ZHI A;  4OB1 B;  2MOX A;  1QCF A;  3L42 A;  2NUP B;  3L2V A;  4M75 D;  2CP0 A;  1PKT A;  1B76 A;  4KRT A;  3ERR A;  1GXI E;  2F5T X;  4N0A C;  3JCM c;  3DB4 A;  3C12 A;  3NEN A;  1WYD A;  4F17 A;  3G1Z A;  2ZT8 A;  1YHQ A;  4P73 C;  2ZPB B;  1S72 T;  2RQW A;  1RAA B;  4J9B A;  2VGN A;  3EHR A;  2Q5I A;  3CCQ T;  3VYH B;  3JCM d;  1AOJ A;  2DEQ A;  4DOW A;  3RKY A;  1USY C;  1NJI U;  4PFO A;  1NYR A;  2LJ0 A;  4YRC A;  1B34 B;  2MK5 A;  2LJ1 A;  1AZE A;  4FT4 A;  2D8H A;  1K0S A;  4OGC A;  1WDX A;  1WQW A;  4PJJ A;  3ER0 A;  2IIM A;  2MPX C;  5CIU A;  3CC7 T;  2DFU A;  2ZIN A;  4AT1 B;  3CCM T;  4TVA A;  3P8D A;  3VKI A;  3TQ7 P;  1YJ9 T;  3QO3 A;  1NLO C;  2DX1 A;  2L2P A;  5C0M A;  3KFU A;  3NFC A;  3HFZ B;  2M02 A;  1N8R C;  4M75 C;  1TU0 B;  3EFO A;  2CIM A;  5D6Y A;  4HXJ A;  4MZM A;  2F2X A;  1ZSZ C;  3G4S A;  2DIG A;  2EIF A;  4M75 F;  1ZA1 B;  1NYF A;  4PKC C;  3RR6 A;  3JCM g;  1VQN T;  1K4U S;  2P5I A;  3L1A A;  1NPR A;  4J9H A;  3I7F A;  2LT4 A;  5I2S A;  3I5R A;  2M0O A;  4CC2 A;  2V26 A;  1BB9 A;  1SPK A;  2HQH A;  5DM7 R;  3M9Q A;  4DA4 A;  3CD6 Q;  4LVI A;  2ENM A;  1VQ4 T;  2LCL A;  2E3C A;  1JEG A;  3VBB A;  4J9F A;  1PM3 A;  1E22 A;  2CYZ B;  1FYN A;  4HKE A;  2JNG A;  1TXQ A;  2FRW A;  4RTZ A;  3VUB A;  4EMK B;  2RM4 A;  3PVL A;  1M4Z A;  4M4Z A;  2ZZD A;  2HL5 C;  1OUL A;  2JS2 A;  2ZR2 A;  4P71 A;  4YCU A;  4BDZ A;  2YXY A;  3I55 A;  3VQW A;  1H4T A;  1ZQ1 A;  1I07 A;  2DQ3 A;  2QHT A;  1M8M A;  5GAN 5;  2LMJ A;  1OZ2 A;  1VQ6 Q;  4BE1 A;  4OF1 A;  2J7I A;  1YGB A;  2RMO A;  3URG A;  1D3B B;  2EQK A;  2M1H A;  2DPP B;  1TH7 A;  2CH4 W;  1KD1 C;  2CRE A;  3CBP A;  2RQU A;  2NUZ A;  2NUT B;  1KC8 U;  1C1A A;  3N5B B;  4ME7 A;  5LJ5 g;  1D1C A;  1NG2 A;  5I11 A;  4F7U F;  5GAN 2;  4LD9 K;  3PT9 A;  4JRQ A;  5GAN 7;  1JRI A;  2AKL A;  4UP9 A;  3VQY A;  3I35 A;  3UFG A;  1K8A U;  1BCM A;  2OTJ A;  1TUC A;  2CDT A;  2EWN A;  3QPH A;  3RNJ A;  3TEE A;  3S3O A;  2KXC A;  1SET A;  4ZGJ B;  4JJN K;  4JS5 A;  2CUB A;  1TWB A;  1VQ5 T;  4YRQ A;  2DL4 A;  4BE2 A;  3NTK A;  4PJO A;  5I2M A;  3WXM B;  4M7A B;  3EGD B;  5C52 B;  4PG3 A;  2Y4X A;  2RHS B;  1JJ2 S;  3P8H A;  4M75 G;  4OB2 B;  5HK0 A;  4XTY A;  4DBQ A;  1X54 A;  4C0G A;  4JZ4 A;  2EQU A;  4H2W A;  1VQP T;  3CPW A;  8ATC B;  1VQM Q;  1KHC A;  2LJ3 A;  4EMH A;  4ZTJ A;  1K73 C;  2EL9 A;  2DBM A;  1IHV A;  3NTI A;  3O5Z A;  4IUP A;  5F5W A;  2P0Q A;  1MUZ A;  4RTV A;  3PIP A;  3FLG A;  3H9N A;  1YJW A;  5FRN A;  3M4Q A;  3RDV A;  1Q86 R;  2QA4 Q;  2E1H A;  2M51 A;  1Q7Y C;  1SEM A;  2DL5 A;  3JB9 G;  2A0F B;  3HXV A;  2EYQ A;  1G8X A;  1G3W A;  4OMO A;  4BDY A;  4ZTF A;  4M77 B;  4F7U B;  5KYU A;  1KQS P;  1YHQ T;  3C95 A;  4YRS A;  2JJ9 A;  1OU9 A;  7AT1 B;  5GAM h;  3OW2 P;  2DAQ A;  5D7U A;  1BI3 A;  2D0Q B;  3CCQ Q;  4RCC A;  1E6H A;  3NET A;  3FEO A;  2RN8 A;  3TU4 K;  1B3Q A;  3L2U A;  1NNH A;  5CKH A;  1H3H A;  2L3S A;  1ZUY A;  2YUN A;  1YIJ Q;  4NCX A;  3GOX A;  4RDX A;  4Q15 A;  1M27 C;  2PZ1 A;  4M75 E;  2KI7 A;  1K9A A;  2J6K A;  5LJ3 f;  3LC0 A;  2BTT A;  4F7U G;  2J3L A;  3E1S A;  5GAN e;  3HHT B;  1ZLM A;  2OJ2 A;  3EG9 A;  4FW2 A;  2PTK A;  5FRM A;  1R77 A;  2MCN A;  2PMF A;  1QVF A;  3GPL A;  3G4S T;  2J05 A;  4YRG A;  4QQD A;  2EYY A;  3L2R A;  1Q82 R;  3EG3 A;  5GAO r;  1QQJ A;  4DEX A;  4ZTU B;  2IG0 A;  1WZO A;  2C0O A;  1UG1 A;  1NJ6 A;  1EFW A;  5J39 A;  2CJ9 A;  3I56 A;  2EYX A;  2AKW B;  3QSU A;  3V8J A;  3EGX B;  2ZPI B;  3QYH B;  2AT1 B;  4M78 D;  1YFR A;  1W4S A;  3J80 E;  1VQ8 A;  1IRE B;  2PU9 B;  3V7C A;  3AT1 B;  1G51 A;  1A0N B;  1GGM A;  1SSF A;  2QEX Q;  3HRI A;  2JXB A;  3QJY A;  1QKX A;  4PJL A;  2QTV A;  4PJM A;  3PNW C;  2D1X A;  3BW1 A;  3I55 T;  2KVQ G;  4M7D B;  5GAM d;  2OX7 A;  1CKB A;  2RHX A;  2ESW A;  1X2Q A;  4F7U E;  1SES A;  2VC8 A;  2J06 A;  3UGQ A;  3CPF A;  2E6N A;  2IVW A;  4NS5 A;  2HBP A;  1OQK A;  3OYJ A;  4E51 A;  3JSC A;  2L8D A;  5LJ3 j;  2COY A;  3VS7 A;  4BB7 A;  2HSE B;  3R6O A;  2H8H A;  1NJ2 A;  3CMA Q;  4OB0 B;  3EGU A;  2R5A A;  4C92 B;  2QHV A;  4P3P A;  1QVP A;  4E7L A;  3TVT A;  1VOM A;  4MDX A;  2GFU A;  3MJX A;  4OMQ A;  3TUP A;  5HY6 A;  2GBQ A;  2YRD A;  2X9H A;  1WJQ A;  1WX6 A;  1QE0 A;  3M0P A;  1PD0 A;  4M78 C;  1U8R A;  2O9S A;  2OTJ T;  1B70 A;  3QZ5 B;  2LCS A;  2M16 A;  8AT1 B;  3BY7 A;  4XEO A;  2IY5 A;  1YWP A;  4M78 F;  1R0C B;  1E1T A;  2ARS A;  5GAM g;  3M0U A;  3QO5 A;  2MF2 A;  4FYV B;  3L4G B;  4LUD A;  4J6X A;  2E6Z A;  2G6F X;  4ORZ A;  1OI1 A;  3M4G A;  1JXO A;  1NJI R;  2F5K A;  5KE3 A;  3KUF A;  3CCV Q;  1WLP B;  1UUE A;  3HTR A;  4OMN A;  1PRL C;  3LSS A;  2BZ8 A;  1H4V B;  1N27 A;  1YJW T;  1VQK A;  3LLR A;  2AMC B;  2CKK A;  1IGU A;  1M1F A;  5LJ3 e;  5HKC A;  1UGQ B;  3CCS A;  2DA9 A;  4J9G A;  4KGX B;  2QQS A;  1G5H A;  4DBH A;  2A08 A;  3CCU Q;  3JCM W;  3CCL A;  2KY9 A;  3A7R A;  5CR2 A;  1EQR A;  3A5Z B;  1S72 A;  2JTE A;  2E5A A;  5C53 B;  2MYS A;  2F2V A;  3CXC P;  1M90 C;  4M7D E;  1U06 A;  5DY9 A;  2ED1 A;  5L8R E;  1N8R R;  4A54 A;  1YIT Q;  4RG8 A;  2E12 A;  2ZZG A;  2EPD A;  2LC4 A;  2GFA A;  3RMS A;  1WIE A;  2CGH A;  3SFM A;  2LRQ A;  4OLF A;  3A31 A;  3NPF A;  4PHC A;  2DL7 A;  3RKX A;  1X01 A;  3JB9 I;  2FG0 A;  2XDP A;  3PE0 A;  1FWZ A;  3M54 A;  1BBW A;  4HVU A;  1HSQ A;  3GNG A;  2EGA A;  2CP7 A;  4C92 E;  1YJN A;  4CH3 A;  3CCM A;  3CCE A;  1Q86 U;  4LE9 A;  2L5Q A;  3CCJ A;  3OS1 A;  1UFF A;  4Z8A A;  4KT0 E;  4GLK A;  6AT1 B;  3G4S Q;  2DD4 A;  4M78 G;  1Q95 G;  4X1V A;  4LDX A;  2ABL A;  4CH5 A;  5IHI A;  1NLP C;  4A63 B;  4N4G A;  2YLB A;  1VQN A;  3EFR A;  1WHL A;  5HGQ A;  2LQN A;  1K9M C;  1G5V A;  2KRO A;  2KMT A;  3PVQ A;  3I9Q A;  2ODR D;  3M58 A;  3A8H B;  3I56 T;  4BE0 A;  2DET A;  2DZ9 A;  3OW2 S;  1RI9 A;  1ASY A;  1JB0 E;  3OBY A;  4XTV A;  1VQ8 T;  2C7I A;  2ROL A;  1BIB A;  2V8K A;  3HXY A;  1MHN A;  4FL6 A;  1BBZ A;  1M1K C;  1Q81 C;  1MMA A;  1JJ2 P;  5IHN A;  3MKD A;  3WVE B;  4CI0 C;  3X28 B;  2ALY B;  5KYY B;  5FU7 C;  5GMK i;  2C0I A;  1UJY A;  5GMK e;  4FCY A;  1IZ6 A;  1QP2 A;  4C8Q B;  3H6Z A;  4CC7 A;  4P75 A;  4JDS A;  2O4X B;  4II1 A;  3CC2 Q;  1QVG P;  3OYM A;  3WVD B;  4QVC A;  2QHS A;  4BI3 A;  5GMK m;  3CCR A;  3OS2 A;  1Q82 U;  2JZ2 A;  4C5H A;  1H8K A;  1HJD A;  2CJA A;  2XMF A;  3LH5 A;  2RHQ A;  4TVW A;  4DPG A;  1R8O B;  4M78 E;  3MEW A;  2YUP A;  4XTZ A;  4YRO A;  3OYL A;  4Z88 A;  5GJV B;  3LX7 A;  2ODR C;  1E7O A;  3V8K A;  2HZY A;  2BUD A;  3P8B B;  4HWP A;  2FZG B;  2VKN A;  2ATC B;  1ASZ A;  2YHT A;  2I4O A;  4XU0 A;  3UDC A;  1H3Z A;  2HCK A;  4H2T A;  5J3B A;  1Y0M A;  1ATI A;  4LDY A;  4HT8 A;  3O8V A;  1WA7 A;  1FXX A;  3SWN C;  3HY1 A;  4PJN A;  2KBT A;  1M5Q 1;  4J83 A;  2XGT A;  1VQL A;  3LH0 A;  4CRI A;  1Z9Q A;  2PUO B;  3VS1 A;  3G6E T;  3JCM Q;  3MPU B;  4CS2 A;  1RAD B;  3JCM e;  1RAE B;  2I4L A;  3CBO A;  3OS5 A;  3TRE A;  5LJ5 h;  1UEB A;  2VB6 A;  2ZZE A;  2RO0 A;  1WHG A;  2QQ9 A;  4G85 A;  2JUF A;  2DL3 A;  1VQ9 A;  4BI8 B;  1RL2 A;  1UJ0 A;  4D8D A;  4JRI A;  1PWT A;  3M55 A;  3CCS T;  4HCC A;  2RF0 A;  3HFZ A;  2K2V A;  3OYE A;  3HRS A;  3CCL T;  1W2B A;  3ZBD A;  4BWA A;  3ZL7 C;  2EQM A;  3D7S B;  2KEA A;  3PGG A;  3IAL A;  3OMG A;  2RJD A;  4RTX A;  2P84 A;  2XDB A;  4XQ3 A;  2DKG A;  5GAO p;  5IXF A;  4EMK C;  4N0A A;  4EPC A;  4KUD K;  2WAC A;  4LDW A;  2I4M A;  2DD5 A;  3HXZ A;  3JB9 D;  4N4I A;  2XU8 A;  2YWW A;  1GBR A;  3A7U A;  4P73 A;  2MWO A;  3SWN B;  4M7A D;  4X34 A;  5A0D A;  4RMO A;  4RQF A;  3LWH A;  2DJQ A;  3QUI A;  3X25 B;  4J7I A;  2P4T A;  3MQZ A;  1JXM A;  1XNI A;  3A8O B;  1USY A;  3JRZ A;  4LN2 A;  1YJN T;  3CCE T;  4DQ2 A;  1RI0 A;  2K3Y A;  3CCJ T;  1MMN A;  3M59 A;  2ROT A;  1F1B B;  1OZ3 A;  1HD3 A;  2RHZ A;  1XQH A;  3M0T A;  4WJ4 A;  3NGP A;  4TWA A;  1IRX A;  3DB3 A;  4J8O A;  5A2Q E;  4CS3 A;  2GQV A;  3OYA A;  1RLP C;  3LGF A;  5HK3 A;  3M0Q A;  4AH6 A;  1WXU A;  4M77 D;  4YRP A;  1D3B A;  2K5I A;  5FU6 B;  5KH6 A;  1N8R U;  3S6W A;  1FMV A;  3MHX A;  5CK9 A;  2G3R A;  1RLQ C;  1G2B A;  1FX7 A;  4M75 A;  2NUT A;  5EC7 A;  1ZSZ A;  5LJ5 d;  1OOT A;  5D6X A;  4UPA A;  3CXC S;  4EX5 A;  2OTL Q;  4ELZ C;  1EIY A;  1YP5 A;  3EG1 A;  4ZNX A;  3QDR B;  5GAN f;  4M7A C;  4FSX A;  4R56 A;  2Q7G A;  2J6O A;  1PKS A;  3JB9 F;  2L3Q A;  3PFS A;  5DLO A;  1GCQ C;  3H41 A;  3MO8 A;  4YP0 A;  2V8J A;  2E70 A;  4UP7 A;  4HT4 A;  2CZ1 B;  4D8K A;  4M7A F;  4ZGD B;  3WQZ A;  2EBP A;  2RI3 A;  2VXF A;  3VQV A;  3DLM A;  2RD1 A;  4L5G A;  1I8F A;  4PNO A;  3HFN A;  1XTD A;  4JRP A;  3JCM P;  3CPW P;  2VXE A;  3UWN A;  3LYI A;  4ZN1 A;  4J15 A;  3CCR T;  1QMC A;  1WQ7 A;  3HL8 A;  3PMT A;  3JAM E;  2FB7 A;  2YDL A;  3OYN A;  2I4N A;  2DYI A;  2D0N A;  1U1T A;  4M77 C;  2ZPH B;  3TEH A;  2CSI A;  2X51 A;  1PYS A;  3NTH A;  2HQX A;  3PIO A;  2F1L A;  4M77 F;  1NPP A;  2EQI A;  2K5F A;  1X27 A;  3IKM B;  1KC8 C;  1FMK A;  1D1A A;  1YCY A;  2MAM A;  1KD1 U;  2E10 A;  5KYX A;  4MDW A;  1KJW A;  3A32 A;  4A4F A;  2FVU A;  4ELY C;  2CT4 A;  5KNN A;  3RKW A;  2AKK A;  2ZCE A;  4AG1 C;  1PNJ A;  4F7U A;  1VYT A;  1WNL A;  4B9X A;  3P8Y A;  4ATO A;  1K8A C;  3QWY A;  2VV5 A;  2CS7 A;  3GF5 A;  1NM7 A;  3MET A;  1VQL T;  1LJO A;  2KR3 A;  1XOV A;  2EAY A;  3HRT A;  2FPF A;  4M7D D;  4E2F B;  1GBQ A;  5GAN j;  1MV0 B;  4QVZ A;  4OB3 B;  1O75 A;  2D6F A;  4WTO B;  2COW A;  3X24 B;  3OS0 A; 
#chains in the Genus database with same CATH homology
 3MEV A;  1VQZ A;  1QVG S;  5M9O A;  3OSS C;  4E47 A;  3PZC A;  1VQ9 T;  5IN1 A;  2J3M A;  2LNV A;  2LX9 A;  2MMP A;  3M57 A;  1K73 U;  5CO7 A;  4ZIB A;  2FL7 A;  4C92 D;  2ZCF B;  4M7A G;  2XG8 D;  4WJ3 M;  1RIQ A;  2PQW A;  3QHS A;  3JB9 H;  2RJC A;  2EJG A;  4QQ6 A;  2Y90 A;  3VV0 A;  3IKL A;  2X35 A;  1E1O A;  2B8A A;  1KOG A;  4M7D C;  2RI5 A;  3HP9 A;  3GP8 A;  3FC3 A;  1JJC A;  4PJO B;  4IUQ A;  3V7R A;  4JUV A;  4M7D F;  4M77 G;  1PSF A;  1Z7N A;  2DVE A;  3W3S A;  4P74 C;  2E64 A;  2A8E A;  2ZGW A;  2ZPF B;  2JTM A;  1N9R A;  2RH2 A;  4H2X B;  3HRU A;  4HCB A;  4C92 C;  2NS6 A;  5GAM e;  1YI2 T;  4C92 F;  4M7A E;  1KMM A;  4P72 C;  2DJZ A;  3KBG A;  2QXF A;  4G84 A;  2HD0 A;  3T9N A;  4XTX A;  4E7J A;  3LGL A;  4HCZ A;  2C06 A;  4H2V A;  3JCM X;  4O5V A;  2VGM A;  1P92 A;  1KQS A;  1E24 A;  3HFV A;  3HKS A;  1BYM A;  4A53 A;  4D6W A;  4M77 E;  3L4G A;  3BDL A;  3L2Z A;  5C51 B;  5KE2 A;  1I5L A;  2K5L A;  4PLL A;  3JCM b;  1OYX A;  3QII A;  4P5N A;  4YRE A;  2AMC A;  3P8T A;  5ELN A;  3PCO B;  1VQ6 A;  2ZXF A;  3DKM A;  3NEL A;  3QJ6 A;  1G5I A;  1X2G A;  4BUG A;  4M7D G;  4LDU A;  4PJO E;  5GAN 3;  4YRL A;  1VUB A;  2E41 A;  3P8V A;  3A5Z A;  3PMI A;  4N4H A;  3RGL A;  2RJF A;  1BIA A;  1VQO A;  4M78 A;  3BJU A;  3SDZ A;  3JCM J;  1Y96 B;  3G6E A;  1M8V A;  4C92 G;  3QG1 A;  2OAU A;  4C8Q D;  3V8L A;  2QI2 A;  3CPW S;  2L3R A;  4QQG A;  4MML A;  2PUK B;  1B7Y A;  3E9F A;  4XU2 A;  3EFS A;  1BI2 A;  3UT1 A;  4OP0 A;  1N9S A;  1VQM A;  3A8L B;  4KR2 A;  2QDY B;  1EOV A;  2Q7H A;  1Y71 A;  12AS A;  1G3T A;  1PSE A;  2QA4 A;  3FRN A;  3AHU A;  3MF2 A;  3G71 A;  3OYG A;  3FB9 A;  4RCB A;  3JCM f;  2ART A;  2E65 A;  5I21 A;  4PLI A;  5J26 A;  3PTA A;  1IL2 A;  2DXT A;  2K3X A;  4C8Q C;  5GMK j;  4YCW A;  2PVD B;  4HA8 A;  4KUI A;  3QO7 A;  2K57 A;  1W66 A;  5E3I A;  1N9W A;  2G4C A;  4C8Q F;  1G3Y A;  2PVO B;  2ALY A;  1Q86 C;  5ELO A;  2Q7E A;  5LJ3 d;  1YIJ A;  4TQF A;  3QKJ A;  2DQ0 A;  3VQX A;  4ZGE B;  1QVF S;  3LW5 E;  2ARU A;  1YB3 A;  4UC4 A;  3HY0 A;  1AHJ B;  3OB9 A;  4CS4 A;  5GAN 8;  4YRM A;  2KAF A;  3OSV A;  4TVR A;  4IUT A;  1UB4 A;  4OGE A;  3VU3 C;  3MF1 A;  2P0K A;  1K9M U;  1C0A A;  1YBY A;  2X4J A;  5LJ5 f;  4H02 A;  4YCV A;  5GAO q;  1QW1 A;  5CCA A;  3DLL A;  4XTU A;  2ZT5 A;  3OYH A;  3CD6 T;  1KHI A;  3MEU A;  1VIE A;  5LJ3 g;  5GAO m;  4RMF A;  3X26 B;  3OD1 A;  1Q81 U;  3MEY A;  3HFO A;  2ZIM A;  1WJR A;  4EO4 A;  2ZPG B;  3RF1 A;  3M4P A;  2HAX A;  1X6O A;  1X56 A;  3OA6 A;  3MCA B;  1V29 B;  1HXD A;  4J6W A;  2Q5H A;  3RIR A;  5EG2 A;  2FYK A;  2LT1 A;  1Q82 C;  4HWS A;  3E9H A;  5K1X A;  3QTC A;  3OY9 A;  1ADY A;  3UPU A;  4XAX B;  5KCO A;  1LYL A;  4YRI A;  4H2U A;  5AYF A;  1VQ6 T;  4LVM A;  3ME9 A;  3BFM A;  4RKU E;  3MP8 A;  3RUX A;  3CBM A;  2A7Y A;  2DXB A;  4C8Q G;  4K87 A;  4JRK A;  3RES A;  2RHU A;  3L2W A;  3CMA A;  4MZP A;  2DDZ A;  1VQO T;  4LVL A;  1YFT A;  4J5Y A;  1B34 A;  1M1G A;  2K4Y A;  3SWN A;  2ZPE B;  4WF2 A;  4XU1 A;  4BI4 A;  1L0W A;  1WPY A;  3FIF A;  1KQ2 A;  2LDM A;  3A7A A;  3GNF B;  4X9C A;  2CJB A;  5FU6 C;  3CCV A;  2RHQ B;  2BKD N;  4KBM B;  5C6S A;  2LVM A;  1VQM T;  2DU5 A;  4JLG A;  5CQX A;  3UGT A;  2HQE A;  2QA4 T;  2EKO A;  4C8Q E;  3G71 T;  2YRV A;  1KMN A;  3HSB A;  1NJI C;  3CCU A;  3HTZ A;  3QNE A;  2QQR A;  3LSQ A;  2A3L A;  4EMK A;  4YRN A;  1NE8 A;  5LJ5 e;  1YIT A;  5A0L A;  3RMQ A;  4TVY A;  2KSS A;  1YIJ T;  3HXX A;  2R58 A;  3A8M B;  2XD0 A;  4HWO A;  2KQW A;  4WI1 A;  1H64 1;  4Q6G A;  4C5E A;  1YI2 A;  4V2S A;  4P3O A;  2DZC A;  3MP6 A;  4BW9 A;  2ZT7 A;  2CZ0 B;  2EJ9 A;  1U1S A;  4RG2 A;  3MP1 A;  4LVK A;  2BIV A;  4XTW A;  2QQA A;  1FYF A;  4EDU A;  4YRT A;  3NEM A;  3X20 B;  4R55 A;  1QP3 A;  3VJP A;  5CKD A;  4P71 C;  1I81 A;  4PJO D;  4OVA A;  3ICA A;  4M7A A;  2E5Q A;  1ADJ A;  4KR3 A;  5GAM f;  2RHS A;  4K86 A;  2F69 A;  3CME A;  5DLQ E;  4E7K A;  4TVA B;  5FLX E;  2QEX T;  4IKF A;  2DO3 A;  4C0D C;  4B9W A;  5A0G A;  2LTO A;  2XDD A;  4NL2 A;  1UGS B;  3A74 A;  3REU A;  2R5M A;  5CKB A;  3CC2 A;  3C94 A;  4Y28 E;  4E7I A;  4VUB A;  5CQY A;  2QHU A;  1DJ7 B;  4MZT A;  1WU7 A;  4CH4 A;  3SB2 A;  3HXW A;  4J7F A;  4NOY A;  1HK9 A;  1UGR B;  4YDQ A;  4M77 A;  3REX A;  5CAI A;  4M75 B;  1H4S A;  3CMA T;  4GY5 A;  2VYT A;  1EIY B;  1BI1 A;  4PJO C;  2X4W A;  4J6Y A;  2LCC A;  3ZEH A;  3ZFJ A;  4KQE A;  1KQ1 A;  4JS4 A;  1SER A;  4PJO F;  3CMQ A;  2X4Y A;  4C0Z A;  4OMF B;  2D9T A;  2LQK A;  1VQ7 A;  4YYE A;  3VYG A;  1EVK A;  3CC4 A;  2DU7 A;  4LVJ A;  3INZ A;  3CCV T;  4C0D B;  1H4Q A;  2RHI A;  4BY6 C;  3OYF A;  5GAM j;  5GAN 6;  1EIF A;  2CZ6 B;  5GAO l;  2RB6 A;  3TEH B;  2P0L A;  5GAN h;  4H2X A;  1PYS B;  2PME A;  1W2B S;  1Q7Y U;  3A8G B;  2RJE A;  2GF7 A;  5GMK l;  5CKF A;  5IAY A;  1NJ5 A;  1LOJ A;  3HXU A;  3OYC A;  3FDR A;  4P3N A;  11AS A;  2AKW A;  1LNX A;  3CCU T;  3F70 A;  3OYD A;  3KXT A;  2DXU A;  4FIB A;  4CH6 A;  5LL6 S;  3IG2 A;  4L59 A;  1YIT T;  4HT9 A;  2KDS A;  4H2Y A;  4X9D A;  4RQE A;  4M7D A;  2XIC A;  4A4H A;  3C4S A;  2EJF A;  4P74 A;  3QO8 A;  4NL3 A;  3Q1J A;  3A5Y A;  2DTI A;  4BY6 B;  2P0P A;  3G7Z A;  4X5O A;  2ZNI A;  1SRY A;  4C0F A;  4IUV A;  2ZIO A;  2MWP A;  4PJO G;  3UH0 A;  4C92 A;  3PCO A;  2EFI A;  2WSC E;  3E9I A;  4YRF A;  3R07 A;  4LD6 A;  4IUU A;  4P72 A;  5GAO n;  3LWI A;  4DOV A;  3JB9 J;  3JCM V;  3OW2 A;  3CD6 A;  1WJS A;  4MMK A;  5GAN d;  4YPF A;  2QQB A;  2PVG B;  2RA2 A;  2OTL A;  4YRJ A;  2YLC A;  1JJC B;  3CME T;  1Y96 A;  1NZ9 A;  4PL6 A;  3M4Y A;  2JTF A;  1HC7 A;  3OYY A;  2ZNJ A;  5K1P A;  3CC2 T;  3GIB A;  3FJP A;  4HWR A;  2XHC A;  4YTL A;  2AHJ B;  5CVI A;  2H3J A;  1WLE A;  2JN0 A;  4ZN3 A;  3S3N A;  5GAN g;  2NLU A;  1YFS A;  5LJ3 h;  2X4X A;  4FT2 A;  1JBM A;  2XK0 A;  2ZR3 A;  1QF6 A;  2XI9 A;  1X2H A;  3VUZ A;  3RAC A;  4JLI A;  3QYG B;  3QBY A;  1NJ1 A;  4A4K A;  4O2D A;  4LNS A;  2ZTG A;  5IT9 E;  1VQ7 T;  3GLX A;  1ZBX A;  3CC4 T;  3TEG A;  3J7A F;  4TTV A;  2WSE E;  1WGS A;  3RER A;  1X75 C;  4HVC A;  2O01 E;  2C8M A;  4C5G A;  5CKE A;  4L87 A;  2DIQ A;  2ZT6 A;  3OYB A;  5FRO A;  2MI6 A;  5KCH A;  4TQD A;  4Z02 A;  3MEA A;  1NYQ A;  1O9S A;  2M9U A;  4QW2 A;  1N6A A;  1B70 B;  2IY5 B;  4QVD A;  1M90 U;  3E19 A;  1BBU A;  2RK2 A;  2HNI A;  3CCQ A;  3ASK A;  3M5A A;  4M78 B;  1G3S A;  1KG1 A;  2KK4 A;  3HRK A;  2RK1 A;  3CEY A;  2DTO A;  2QTX A;  2JOY A;  2JVV A;  4EMG A;  4C8Q A;  3OBW A;  2O4X A;  2XID A;  1B7Y B;  3CC7 A;  5GAN 4;  2LQ8 A;  4ZTZ B;  1EVL A;  4FM4 B;  5GMK h;  3OYK A;  1YJ9 A;  1NJ8 A;  1Y7X A;  2DK3 A;  2XKO C;  3V7S A;  5D6W A;  4BAC A;  3SD4 A;  1I4K 1;  4XK8 E;  4FU6 A;  3J81 E;  2WSF E;  3BDU A;  4LDV A;  3QXE B;  2CZ7 B;  1HTT A;  3E9G A;  1KQS S;  2XTI A;  4XEM A;  2FHD A;  1Z7M A;  1VQ4 A;  2R57 A;  3CXC A;  2I2L A;  1VIF A;  4H2S A;  2OTL T;  1BKB A;  2RHY A;  4Q5W A;  1M1K U;  4P75 C;  4Y91 A;  4UP8 A;  2QEX A;  4E7H A;  3M53 A;  4O6J A;  3TCJ A;  1MGQ A;  4IUR A;  2DXC A;  2DTH A;  3HPW A;  4KUL A;  3JCM h;  2RI2 A;  4L6V 5;  3DSQ A;  4YRR A;  2ZZF A;  3M56 A;  4C5I A;  3OQ5 A;  2GCX A;  3S3M A;  2V8I A;  4YRK A;  2Y4Y A;  4A4G A;  3OYI A;  1BI0 A;  3H8Z A;  3QZ9 B;  1X55 A;  2L89 A;  3L2Q A;  3OMC A;  5LJ5 j;  4HWT A;  1B8A A;  4K88 A;  1VQ5 A;  4BD3 A;  1UGP B;  3EAE A;  4XU3 A;  1JJ2 A;  3RL6 A;  4A4E A;  2EQJ A;  5FU7 B;  1VQP A;  1QVG A;  2VUB A;  1J5W A;  1VQK T;  1M9S A;  1Y07 A;  1ZHI A;  4OB1 B;  3L42 A;  3L2V A;  4M75 D;  1B76 A;  3ERR A;  1GXI E;  2F5T X;  4N0A C;  3JCM c;  3DB4 A;  3C12 A;  3NEN A;  1WYD A;  3G1Z A;  2ZT8 A;  1YHQ A;  4P73 C;  2ZPB B;  1S72 T;  2VGN A;  2Q5I A;  3CCQ T;  3VYH B;  3JCM d;  2DEQ A;  4DOW A;  3RKY A;  1USY C;  1NJI U;  1NYR A;  4YRC A;  1B34 B;  4FT4 A;  4OGC A;  1WQW A;  3ER0 A;  3CC7 T;  5CIU A;  2ZIN A;  3CCM T;  4TVA A;  3P8D A;  3VKI A;  1YJ9 T;  3QO3 A;  5C0M A;  3KFU A;  3NFC A;  3HFZ B;  1N8R C;  4M75 C;  2CIM A;  5D6Y A;  4MZM A;  3G4S A;  2DIG A;  2EIF A;  4M75 F;  4PKC C;  2P5I A;  3JCM g;  1VQN T;  3L1A A;  1NPR A;  3I7F A;  2LT4 A;  5I2S A;  2M0O A;  4DA4 A;  5DM7 R;  3M9Q A;  4LVI A;  1VQ4 T;  2LCL A;  2E3C A;  3VBB A;  1E22 A;  2CYZ B;  4HKE A;  2JNG A;  3VUB A;  4EMK B;  2RM4 A;  1M4Z A;  2ZZD A;  2ZR2 A;  4P71 A;  4YCU A;  4BDZ A;  3VQW A;  3I55 A;  1H4T A;  1ZQ1 A;  2DQ3 A;  2QHT A;  5GAN 5;  1OZ2 A;  4BE1 A;  4OF1 A;  1YGB A;  3URG A;  1D3B B;  2EQK A;  2M1H A;  2DPP B;  1TH7 A;  1KD1 C;  3CBP A;  1KC8 U;  3N5B B;  4ME7 A;  5LJ5 g;  4F7U F;  5GAN 2;  4LD9 K;  3PT9 A;  4JRQ A;  5GAN 7;  1JRI A;  4UP9 A;  3VQY A;  3UFG A;  1K8A U;  2OTJ A;  2EWN A;  3QPH A;  3TEE A;  3S3O A;  1SET A;  4ZGJ B;  4JJN K;  4JS5 A;  1VQ5 T;  4YRQ A;  4BE2 A;  3NTK A;  4PJO A;  5I2M A;  3WXM B;  4M7A B;  5C52 B;  4PG3 A;  2Y4X A;  2RHS B;  1JJ2 S;  3P8H A;  4M75 G;  4OB2 B;  5HK0 A;  4XTY A;  1X54 A;  4C0G A;  2EQU A;  4H2W A;  1VQP T;  3CPW A;  1KHC A;  4EMH A;  4ZTJ A;  1K73 C;  2EL9 A;  5F5W A;  3NTI A;  4IUP A;  2P0Q A;  3PIP A;  1YJW A;  3FLG A;  5FRN A;  3M4Q A;  2E1H A;  1Q7Y C;  3JB9 G;  3HXV A;  2EYQ A;  1G3W A;  4BDY A;  4ZTF A;  4M77 B;  4F7U B;  1YHQ T;  3C95 A;  4YRS A;  5GAM h;  2DAQ A;  1BI3 A;  2D0Q B;  4RCC A;  3NET A;  3FEO A;  3TU4 K;  3L2U A;  1NNH A;  5CKH A;  4NCX A;  3GOX A;  4RDX A;  4Q15 A;  4M75 E;  5LJ3 f;  3LC0 A;  4F7U G;  2J3L A;  3E1S A;  5GAN e;  3HHT B;  5FRM A;  2PMF A;  1QVF A;  3GPL A;  3G4S T;  4YRG A;  4QQD A;  3L2R A;  5GAO r;  4ZTU B;  2IG0 A;  1NJ6 A;  1EFW A;  5J39 A;  2CJ9 A;  3I56 A;  2AKW B;  3QSU A;  3V8J A;  2ZPI B;  3QYH B;  4M78 D;  1YFR A;  3J80 E;  1W4S A;  1VQ8 A;  1IRE B;  2PU9 B;  3V7C A;  1G51 A;  1GGM A;  1SSF A;  3HRI A;  3QJY A;  3PNW C;  3BW1 A;  3I55 T;  2KVQ G;  4M7D B;  5GAM d;  2RHX A;  4F7U E;  1SES A;  2VC8 A;  3UGQ A;  3CPF A;  2E6N A;  2IVW A;  4NS5 A;  2HBP A;  3OYJ A;  4E51 A;  3JSC A;  2L8D A;  5LJ3 j;  4BB7 A;  3R6O A;  1NJ2 A;  4OB0 B;  2R5A A;  4C92 B;  2QHV A;  4P3P A;  1QVP A;  4E7L A;  4MDX A;  2GFU A;  3TUP A;  5HY6 A;  1WJQ A;  1QE0 A;  4M78 C;  1U8R A;  1B70 A;  2OTJ T;  3QZ5 B;  2M16 A;  3BY7 A;  4XEO A;  2IY5 A;  4M78 F;  1E1T A;  2ARS A;  5GAM g;  3QO5 A;  2MF2 A;  3L4G B;  4J6X A;  2E6Z A;  1OI1 A;  3M4G A;  2F5K A;  5KE3 A;  3KUF A;  3LSS A;  1H4V B;  1N27 A;  1YJW T;  1VQK A;  3LLR A;  2AMC B;  2CKK A;  1M1F A;  5LJ3 e;  5HKC A;  1UGQ B;  3CCS A;  2QQS A;  1G5H A;  3JCM W;  3CCL A;  2KY9 A;  3A7R A;  5CR2 A;  1EQR A;  3A5Z B;  1S72 A;  2E5A A;  5C53 B;  1M90 C;  4M7D E;  5DY9 A;  5L8R E;  4A54 A;  4RG8 A;  2E12 A;  2ZZG A;  2LC4 A;  2GFA A;  3RMS A;  2CGH A;  3SFM A;  2LRQ A;  4OLF A;  3A31 A;  4PHC A;  3RKX A;  1X01 A;  3JB9 I;  2XDP A;  1FWZ A;  3M54 A;  1BBW A;  3GNG A;  4C92 E;  1YJN A;  4CH3 A;  3CCM A;  3CCE A;  1Q86 U;  2L5Q A;  3CCJ A;  3OS1 A;  4KT0 E;  4GLK A;  2DD4 A;  4M78 G;  4LDX A;  4CH5 A;  4N4G A;  2YLB A;  1VQN A;  3EFR A;  5HGQ A;  1K9M C;  1G5V A;  2KMT A;  2ODR D;  3M58 A;  3A8H B;  3I56 T;  4BE0 A;  2DZ9 A;  3OW2 S;  1ASY A;  1JB0 E;  3OBY A;  4XTV A;  1VQ8 T;  2C7I A;  3HXY A;  1BIB A;  2V8K A;  1MHN A;  4FL6 A;  1M1K C;  1Q81 C;  3WVE B;  4CI0 C;  3X28 B;  2ALY B;  5FU7 C;  5GMK i;  5GMK e;  1IZ6 A;  1QP2 A;  4C8Q B;  3H6Z A;  4P75 A;  4JDS A;  2O4X B;  4II1 A;  3OYM A;  3WVD B;  4QVC A;  2QHS A;  4BI3 A;  5GMK m;  3CCR A;  3OS2 A;  1Q82 U;  2JZ2 A;  4C5H A;  2CJA A;  2RHQ A;  4TVW A;  4DPG A;  1R8O B;  4M78 E;  3MEW A;  4XTZ A;  4YRO A;  3OYL A;  2ODR C;  3LX7 A;  3V8K A;  2BUD A;  3P8B B;  4HWP A;  1ASZ A;  2YHT A;  2I4O A;  4XU0 A;  3UDC A;  1H3Z A;  4H2T A;  5J3B A;  1ATI A;  4LDY A;  4HT8 A;  3O8V A;  1FXX A;  3SWN C;  3HY1 A;  4J83 A;  1M5Q 1;  2XGT A;  1VQL A;  3LH0 A;  4CRI A;  2PUO B;  3G6E T;  3JCM Q;  4CS2 A;  3JCM e;  2I4L A;  3CBO A;  3OS5 A;  3TRE A;  5LJ5 h;  1UEB A;  2ZZE A;  2RO0 A;  2QQ9 A;  4G85 A;  2JUF A;  1VQ9 A;  4BI8 B;  1RL2 A;  4JRI A;  3M55 A;  3CCS T;  4HCC A;  3HFZ A;  2K2V A;  3OYE A;  3HRS A;  3CCL T;  1W2B A;  3ZBD A;  4BWA A;  2EQM A;  3PGG A;  3IAL A;  3OMG A;  2RJD A;  2XDB A;  4XQ3 A;  2DKG A;  5GAO p;  4EMK C;  4N0A A;  4EPC A;  4KUD K;  2WAC A;  4LDW A;  2I4M A;  2DD5 A;  3HXZ A;  3JB9 D;  4N4I A;  2XU8 A;  3A7U A;  4P73 A;  2MWO A;  3SWN B;  4M7A D;  4X34 A;  5A0D A;  4RMO A;  4RQF A;  3LWH A;  3QUI A;  3X25 B;  4J7I A;  2P4T A;  3MQZ A;  1XNI A;  3A8O B;  1USY A;  3JRZ A;  1YJN T;  3CCE T;  4DQ2 A;  1RI0 A;  2K3Y A;  3CCJ T;  3M59 A;  1OZ3 A;  2RHZ A;  1XQH A;  4WJ4 A;  4TWA A;  3DB3 A;  4J8O A;  5A2Q E;  4CS3 A;  2GQV A;  3OYA A;  3LGF A;  5HK3 A;  4AH6 A;  4M77 D;  4YRP A;  1D3B A;  2K5I A;  5FU6 B;  5KH6 A;  1N8R U;  3S6W A;  3MHX A;  5CK9 A;  2G3R A;  1FX7 A;  4M75 A;  5LJ5 d;  5D6X A;  4UPA A;  3CXC S;  4EX5 A;  4ELZ C;  1EIY A;  3QDR B;  5GAN f;  4M7A C;  4FSX A;  4R56 A;  2Q7G A;  3JB9 F;  3PFS A;  5DLO A;  3MO8 A;  4YP0 A;  2V8J A;  2E70 A;  4UP7 A;  4HT4 A;  2CZ1 B;  4M7A F;  4ZGD B;  3WQZ A;  2RI3 A;  2VXF A;  3VQV A;  3DLM A;  2RD1 A;  4L5G A;  1I8F A;  4PNO A;  3HFN A;  1XTD A;  4JRP A;  3JCM P;  2VXE A;  3UWN A;  3LYI A;  4ZN1 A;  4J15 A;  3CCR T;  1WQ7 A;  3HL8 A;  3PMT A;  3JAM E;  2FB7 A;  3OYN A;  2I4N A;  1U1T A;  4M77 C;  2ZPH B;  3TEH A;  1PYS A;  3NTH A;  2HQX A;  3PIO A;  4M77 F;  1NPP A;  2K5F A;  3IKM B;  1KC8 C;  1YCY A;  2MAM A;  1KD1 U;  2E10 A;  4MDW A;  3A32 A;  4A4F A;  2FVU A;  4ELY C;  5KNN A;  3RKW A;  2ZCE A;  4F7U A;  1WNL A;  4B9X A;  3P8Y A;  4ATO A;  1K8A C;  2VV5 A;  2CS7 A;  3GF5 A;  3MET A;  1VQL T;  1LJO A;  1XOV A;  2EAY A;  3HRT A;  4M7D D;  5GAN j;  4QVZ A;  4OB3 B;  1O75 A;  2D6F A;  3X24 B;  3OS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...