2DTOA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 complexed with atp and biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 67
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtoA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtoA01
1SESA 3IKMB 4M7AD 1X56A 3FB9A 4PJOG 1X2GA 3V7CA 1VQZA 2I4NA 4P73C 1EQRA 2ARSA 4P3NA 1Z7NA 4X9CA 4H2XB 4M78D 4CH6A 1HC7A 2ODRD 2G4CA 3A5ZA 1H4SA 2AMCB 3PZCA 1D3BB 2DZ9A 4XQ3A 4HWOA 1WQ7A 4EO4A 5LJ5h 3A7RA 1EVKA 1WU7A 1HXDA 1X01A 3DSQA 3HXYA 3IALA 3QO7A 4M77G 4PNOA 2VXEA 3JCMW 4PHCA 4M7AC 4CH5A 3LSQA 4EMKA 3P8YA 1BIBA 1TH7A 5GAN2 4HWSA 2ALYA 4TVYA 2QTXA 4DQ2A 1EOVA 5LJ5d 4M78C 2CJ9A 2ODRC 3CMQA 2ARUA 3VQYA 3BDUA 1LYLA 2RHSA 4HA8A 4F7UA 4Q6GA 3HTZA 4P71C 3NELA 3HY1A 4J6YA 4RCBA 4ZTZB 3BJUA 4OLFA 4X9DA 3LC0A 2E1HA 11ASA 1I4K1 3SWNB 2RHSB 4K88A 1G5IA 5GMKj 3REXA 4XTXA 4YRNA 1ADYA 5LJ5e 4J15A 2DTIA 3QSUA 1JJCB 5LJ5f 1WYDA 1GGMA 2K57A 1Y96B 4HT8A 4H02A 3V8LA 4C8QA 2YLCA 3OD1A 4TVWA 4F7UE 4F7UF 2HNIA 4XU3A 3QO5A 1M5Q1 1YFRA 1YFTA 2I4MA 4P75A 3EFRA 1HTTA 3HXXA 1LJOA 5GAN3 4NL2A 3TEHA 3HFZB 2IY5A 3JCMe 2EJ9A 3MEYA 4M75A 3A74A 4XTUA 3P8VA 4Y91A 3MF2A 4YPFA 3JCMf 4M7DD 1YGBA 4C92B 4M7AG 1PYSA 4JRKA 1RIQA 3RESA 1NJ5A 2FB7A 3FJPA 4C8QE 4C8QF 4M78G 2P5IA 3L2ZA 4DPGA 1H641 4TWAA 4EMKC 4YDQA 4YRKA 4QVCA 2C8MA 4C92E 4C92F 3QO3A 2ZXFA 1NJ6A 4YCUA 4H2XA 4ZIBA 3AHUA 2EJGA 4ZTUB 4M7DC 2AMCA 1D3BA 4M75E 4M75F 4XTWA 1QF6A 3RKYA 5GAMg 4H2TA 2DEQA 1SETA 4PJOB 4HWRA 1QE0A 4NOYA 5GANj 1N9WA 2DU5A 3MF1A 4H2VA 4UPAA 1KOGA 4M77A 2QHVA 3IKLA 3W3SA 1E1OA 4YRJA 5HGQA 4C8QD 4LNSA 2ZNIA 4BW9A 5LJ3e 3R07A 3JB9G 4CH3A 4TTVA 2YLBA 3QHSA 1USYC 1NJ2A 2EAYA 2ARTA 5GAMh 5LJ3f 2ZINA 2I4OA 4M77B 3HY0A 3HXVA 2QHUA 4M75D 1YB3A 5GAOr 3VBBA 4N0AC 3V8KA 4H2SA 4XTZA 3UH0A 3GIBA 2DU7A 1U1SA 2ZT6A 2E41A 1KMMA 5ELOA 5K1PA 5KNNA 3JCMV 3VQXA 1E24A 3EFSA 3TUPA 4YP0A 1W66A 3M4QA 5GAMd 2ZZGA 4C8QC 1WPYA 3V7SA 2RHQB 4XU2A 3HSBA 4KR2A 4P75C 2DVEA 3SWNA 4M77E 4M77F 4XEOA 1NJ1A 5GAN8 1JRIA 1EVLA 2E10A 5F5WA 5GAOq 3A31A 1BBUA 3I7FA 2Q5IA 3IG2A 1WQWA 4M75C 1JJCA 3HXZA 1Y96A 4V2SA 1X55A 2EL9A 12ASA 2Q5HA 4TQFA 2E5AA 4WF2A 5GAOp 5GAOn 1NJ8A 4YRRA 3L4GB 5CAIA 3HFVA 1B34A 4YRMA 1N9RA 4YRTA 3PCOB 4HVCA 3HFOA 4M7DG 3HFZA 4JLIA 1B70B 3RIRA 4K86A 1ASYA 1YFSA 2QHTA 4K87A 5GAN6 2RM4A 3WQZA 1B34B 2E3CA 3VQVA 4C92A 3PGGA 4TQDA 2DTHA 2CIMA 4P74A 3BY7A 3JCMJ 4NL3A 4A53A 1G5HA 4NCXA 4RMFA 1HK9A 1X2HA 4YREA 3G1ZA 1EIYB 4M78A 4UP8A 3L1AA 5GMKm 3INZA 4M7AB 4O2DA 1LOJA 1FYFA 2JN0A 2VC8A 3RF1A 4XU0A 1I81A 4H2WA 4JRIA 3V8JA 3E9IA 2DXUA 4KQEA 4YRLA 4YCVA 1J5WA 1E22A 5K1XA 2ZZEA 5LJ5j 4M78B 4C8QG 3HRIA 4UP9A 1L0WA 5GMKh 2PMFA 4PJOA 3REUA 1X54A 1ASZA 4M7AF 2CJBA 5GMKl 4WJ3M 3JCMb 3JCMQ 2DKGA 2ZR3A 5GAOm 1NYQA 3E9HA 4YRSA 2ZT5A 4CS3A 2FYKA 1EFWA 3VQWA 3RERA 3KFUA 2VXFA 5DY9A 3SWNC 1IL2A 4M78E 4M78F 4YRCA 3LSSA 4AH6A 3NETA 1YCYA 4WI1A 4CS2A 4J6WA 2E64A 2ZIMA 4G84A 3RACA 4YROA 3UGQA 4KR3A 2ZT7A 1B7YB 4P72A 2AKWB 3BFMA 3QUIA 2P0LA 3P8TA 4C92D 5GAOl 5LJ5g 3A7UA 4RQEA 3QTCA 4HT9A 3JCMP 3SB2A 4PJOF 4PJOE 2I4LA 3HXWA 2RHQA 3A5YA 4XTYA 3JCMX 1KQ2A 1ADJA 3HXUA 2C7IA 4RDXA 2ZT8A 1BBWA 5GMKe 5GAN4 4YRPA 3JB9F 4BWAA 2ZTGA 2RA2A 4OP0A 2Q7GA 4YYEA 5GANg 3FIFA 1H4QA 4E51A 5GAN5 1Z7MA 2Q7EA 2Q7HA 5GMKi 4C92C 1WLEA 4Q15A 3JCMg 2E65A 4YCWA 4HWTA 4PJOD 3L4GA 5C51B 4P74C 1MGQA 3UFGA 4UP7A 2Y90A 2RD1A 2DZCA 3PCOA 5I21A 5GANh 3RGLA 4M7DA 1B70A 4RCCA 3QO8A 3JB9D 2ZZFA 1U1TA 5LJ3j 2I2LA 3A7AA 4MMKA 4EMKB 5GAMe 4P73A 5C53B 1H4TA 3JCMh 1M8VA 1SERA 2ALYB 1NYRA 2ZR2A 4YRFA 4M77D 5GAMf 1BIAA 5C52B 4M7DB 2EWNA 2DTOA 4EMHA 4PJOC 5GANd 1KQ1A 1I8FA 1USYA 1C0AA 2QHSA 1KMNA 4F7UG 2ZCEA 2ZIOA 4F7UB 3V7RA 1EIYA 4YRQA 4YRIA 2J3LA 3JCMd 3QNEA 4PG3A 4M7AA 4N0AA 4P3PA 1E1TA 1H4VB 3RKXA 1WNLA 3TEGA 4M7DE 4M7DF 2DQ3A 2DJZA 2CJAA 1B8AA 2ZNJA 3UGTA 4M77C 5LJ3g 1ATIA 1SRYA 4P3OA 1G51A 4WJ4A 2EJFA 5GANe 5GAN7 4P72C 4H2YA 2PMEA 2DXTA 2YHTA 1LNXA 4QVDA 4P71A 4XTVA 1I5LA 3RKWA 4TVAA 5GANf 2CGHA 2XTIA 5E3IA 4EX5A 4X5OA 4CS4A 4C8QB 5GAMj 2J3MA 5LJ3h 4L87A 4A54A 4YRGA 4EMGA 4C92G 4M7AE 3RL6A 3HRKA 4J5YA 3ICAA 3M4PA 4J6XA 1N9SA 4TVAB 3TEHB 4JUVA 2IY5B 1B7YA 3NENA 3ERRA 4HWPA 4M75G 2AKWA 4M75B 3JCMc 2DDZA 3BW1A 4XEMA 3HFNA 1NNHA 4XU1A 4H2UA 3JB9I 1B76A 5LJ3d 3NEMA 2XGTA 4RQFA 3VU3C 4CH4A 2ZGWA 1PYSB 4G85A 2DQ0A 5ELNA 3JB9J 4MMLA 3A32A 3JB9H 3M4GA 2RB6A 3RUXA 1JBMA
chains in the Genus database with same CATH superfamily
4FCYA 4HKEA 1BI3A 1X43A 2HZYA 2F69A 2P0KA 2D1XA 4RTYA 5CK9A 1Z7NA 4ORZA 4X9CA 4H2XB 4M78D 2PQWA 1HC7A 1ABOA 5D6YA 1KJWA 1D3BB 4XQ3A 4HWOA 4KGVB 1QCOA 3QO7A 3CBPA 1B3QA 4ZGEB 1M30A 1CSKA 5KE3A 4M77G 3C12A 3S6WA 3L2RA 2L3RA 2DMOA 4C5HA 2E70A 3P8YA 2R5MA 4PLLA 1NEBA 3DB3A 1BB9A 3EG0A 5GAN2 3VYHB 2M0OA 4KT0E 4DQ2A 1VQLA 1EOVA 2VUBA 4JRPA 2ARUA 4DA4A 1D1AA 1FWZA 1AT1B 2J7IA 3A8HB 3TQ7P 3UDCA 3HRSA 2KI7A 2YUOA 1WDXA 1PD1A 1JEGA 2JTEA 4FT2A 3L2QA 2XDBA 3HY1A 1YWPA 2RI3A 1LVKA 1WI7A 2DA9A 4Z02A 3P8HA 4GLKA 3BJUA 3OYBA 4X9DA 1TG0A 4RTUA 4N4GA 3QDFA 1VQMQ 1I1JA 1VQ5T 1G5IA 5GMKj 1M1FA 4XTXA 1ADYA 2QEXQ 2PU9B 1MMAA 4F17A 4JZ3A 1JJ2P 1OULA 5FWBA 1IGQA 3NMZC 4P5NA 1PNJA 3OYLA 5LJ5f 3A8LB 4ZN1A 3CD6T 1GGMA 5J39A 2QXFA 3A8GB 3UPUA 1OQKA 4TVWA 4F7UF 1ZA2B 3QO5A 2V8KA 1VQ9T 2K3BA 2J06A 1HTTA 3O5ZA 4R55A 2XMFA 2CT3A 1RADB 3ME9A 3HFZB 4B6MA 2IY5A 1QKWA 1OZ3A 2DD4A 3A74A 4LVJA 5FWCA 4RTZA 1VQ5A 4YPFA 3MEWA 4J9HA 3M57A 3J80E 4HT4A 2ZCFB 1NBEB 4BB7A 1PYSA 2OTJT 4BY6C 2O9SA 2ZPEB 2ZPBB 3CC7A 1VIEA 3CD6A 2OTLT 2VGNA 4C8QE 2KXCA 2LRQA 2P5IA 4ELYC 1FX7A 3L2ZA 3GPLA 2MMPA 3EFOB 2QAZA 1RAAB 3NTKA 3OS0A 3U23A 2RNAA 4UC4A 2DX1A 1VOMA 2HKNA 5IHNA 4M75F 1VQNQ 4E7KA 1QE0A 1N9WA 3MF1A 2RJEA 2EQJA 3IKLA 1E1OA 4AMCA 5HGQA 2HBPA 2BUDA 1Y57A 4J9GA 2OTJA 1NYGA 3R07A 3OYFA 4DBHA 3JB9G 2DIQA 3OYKA 2YLBA 3QKJA 2OTLA 1NJ2A 5GAMh 2KDSA 2H3EB 2CP5A 2I4OA 2FG0A 4QQDA 2A8EA 5GAOr 4LE9A 3QXEB 4MZPA 4H2SA 3UH0A 2ZT6A 2E4HA 1KMMA 3CBMA 4F14A 3VQXA 1R77A 2IVWA 3EFSA 4MZMA 4YP0A 4C0ZA 2CKKA 3A1PA 2RHUA 5CCAA 2L89A 4M77F 2RN8A 3CMAT 2DRKA 1JRIA 2RHZA 2MI6A 1KC8C 3A31A 4LUDA 1MNDA 2G6FX 2Q5IA 1WQWA 1JJCA 4JJNK 1K8AC 2YRVA 1Y96A 1VQ6T 3LH0A 1PSFA 1HYOA 2O01E 2Z0WA 4RMOA 4WF2A 1NJ8A 5IHIA 1YHQT 2CH4W 3EGXB 2QQAA 1H3HA 1B70B 2A08A 2DK3A 1OU9A 5CKDA 1SEMA 2QHTA 2LMJA 1KD1C 4A4HA 2E3CA 2L8DA 4C92A 4KBMB 1VQ4Q 2QQSA 3E9FA 1IO6A 1WHGA 2EBPA 4TQDA 2XI9A 1PC0A 3BY7A 2QI2A 4NCXA 1NJIU 2LX9A 3X20B 5KYYA 4GBQA 3G1ZA 3I56T 3LWHA 1EIYB 4C5EA 1GFCA 4UP8A 2DYBA 3QBYA 1YHQA 1UG1A 3MEAA 2NWMA 2FPEA 2K5IA 2DBKA 2JN0A 4QT7A 1FXXA 2F5KA 4H2WA 3V8JA 3E9IA 2DXUA 3LW5E 4KQEA 4HCCA 3CCSQ 1E22A 4M78B 1AZEA 3HRIA 1L0WA 5GMKh 2AKLA 2PMFA 4PJOA 3OYGA 4D6WA 1X54A 1WHKA 5D7UA 4OB0B 2FZCB 3CCMQ 4WJ3M 1VQMT 4YRSA 4AG2C 2ZT5A 2FYKA 1EFWA 3RERA 2VWFA 2QEXT 2YXYA 2HD0A 5I2SA 2HEQA 1IL2A 4M78E 3I56A 2GGRA 3META 3NETA 2DVJA 2KR3A 1YCYA 1YI2A 1MMGA 4LNPA 1K9MR 2M1HA 2DL8A 2OX7A 4G84A 4YROA 3VS4A 2YWWA 2AKWB 3BFMA 2P0LA 1MMNA 4C92D 5GAOl 5LJ5g 3A7UA 3QTCA 1BK2A 1YNZA 3JCMP 4HT9A 3HXWA 1AWXA 3LYIA 4XTYA 1FMWA 3JCMX 5IH2A 3P8DA 1UB4A 4E47A 1BBWA 2R57A 3JB9F 4BWAA 2BZYA 3JSCA 2ZTGA 4OP0A 4HVVA 2E6ZA 3CXCA 1QVFP 3OSSC 4RTVA 3HL8A 2ZZDA 5GMKi 2VKNA 1R8OB 4PJOD 1K0XA 4P74C 1BYMA 2RK1A 1YJ9T 2RD1A 5HK3A 3PCOA 2O9VA 5I21A 2EKOA 2D0QB 4RCCA 3QO8A 1NLPC 2YUQA 4X34A 1U1TA 2WSEE 3H0HA 5C53B 3C94A 2CREA 1Q95G 1VQ8Q 5GANd 1USYA 1C0AA 5I22A 3L2VA 1KMNA 2RI5A 2RO0A 2M9UA 1PKSA 3FC3A 1OU8A 1VA7A 3JCMd 2M02A 3QNEA 2V8JA 4PG3A 4M7AA 2XDPA 3OQ5A 1O9SA 4N0AA 1YJ9A 4CRIA 4P3PA 3RKXA 2EQMA 1N6AA 2XG8D 4PLIA 4LDUA 1OI1A 2JT4A 2ZNJA 2NUPA 1M4ZA 2A3LA 1WA7A 2DPPB 3LLRA 3OYDA 1KQSP 2AHJB 2XK0A 5GJWB 5L8RE 2EIFA 3URGA 1NM7A 5GANe 3PT9A 5IXFA 2EYYA 1HSQA 4P72C 4DEXA 1I5LA 5IXBA 2CGHA 5E3IA 4MZTA 2DF6A 2J3MA 2MK5A 5A0DA 1AWOA 4L87A 4YRGA 3PIOA 1QP2A 4EMGA 1AVZC 1AEYA 4J6XA 2XU8A 1N9SA 4TVAB 2IY5B 1W2BP 4HWPA 1DJ7B 1ZA1B 1ZUKA 1FYNA 1LPLA 4XU1A 3JB9I 1B76A 5LJ3d 3VS2A 5CKEA 3VUBA 3VU3C 1PYSB 1GCQA 4G85A 2D0NA 1IZ6A 5ELNA 3JB9J 4MMLA 3A32A 3RUXA 1SESA 4JLGA 4M7AD 1X56A 1X6GA 2QYZA 3FB9A 5I2MA 2MIOA 1X2GA 3RR6A 3V7CA 4K11A 1VQ4T 4P73C 4KGZB 4Z89A 1YIJT 4KUDK 4C5IA 4KUIA 2HAXA 1Q86U 2CYZB 5CQYA 4EO4A 3H8ZA 1D09B 1ZX6A 2DXCA 1X01A 3DSQA 1XOVA 1ZSGA 2KNBB 2RMOA 1MHNA 2F2VA 4N4HA 4A4EA 2VXEA 1VQPQ 1KSWA 3OB9A 3CCST 1K4US 2E12A 3CMET 2X51A 3KUFA 1I07A 1NJIC 2AIRB 3E19A 4RG8A 5LJ5d 1RAEB 4M78C 3CMQA 3VQYA 4LDVA 1VQ4A 3VJPA 2RHSA 2JZ2A 4F7UA 1YIJA 2B86A 3CCVT 3NELA 1CKBA 4J6YA 3NTHA 3MQZA 4RCBA 2LDMA 5D6XA 2WSFE 4OLFA 2EYWA 2E1HA 1K1ZA 1I4K1 1EZZB 3OMCA 1X75C 1WXUA 3REXA 5LJ5e 2DTIA 3CCSA 3VS5A 1ZUUA 5I11A 3KXTA 2MF2A 4PFOA 3CMEA 1G83A 3QZ9B 1JJCB 1PG5B 1UFFA 4PJJA 4FW1A 3OYAA 1Y96B 3OYYA 4HT8A 4H02A 4KH0B 1BCMA 3V8LA 4HVWA 2LP5A 8ATCB 2W10A 5KYWB 1WIEA 2HNIA 1IGUA 2CZ0B 1M5Q1 2X9HA 1M1KU 1YFTA 4P75A 3PTAA 4J8OA 4IKFA 3BE3A 1TUDA 3HXXA 3CCVA 2EQKA 5GAN3 3CCUA 5KH6A 4FT4A 1M2OA 2BE7D 1TUGB 4M75A 1D0ZA 3MEYA 1X2KA 3JCMf 4M7DD 1YGBA 1VUBA 3X25B 4C92B 4JRKA 5L23A 1RIQA 4IIOA 1NJ5A 3G71T 2FB7A 5KYYB 3FJPA 4C8QF 4M78G 1SRMA 3TVTA 2DM1A 1VQ8T 2J6FA 4QVCA 3OYIA 4C92E 1N8RU 1NJ6A 4ATOA 2EJGA 1JB0E 2VV5A 2DEQA 4PJOB 1IRXA 2ZPFB 2LNVA 1E7OA 3S3NA 4AG1C 2DU5A 4H2VA 4UPAA 1KOGA 1UGSB 4M77A 2ENMA 1R0BG 1M90R 5KYXA 3OYHA 4B9XA 4TTVA 4CH3A 3DLLA 1C0MA 3G71A 2ARTA 5LJ3f 3L2UA 2HQEA 2ZINA 4JS5A 2ROTA 4M75D 1GRIA 1VQ8A 3VBBA 1GBRA 4LD6A 4F04B 3F70A 3GIBA 2DU7A 3M0RA 5K1PA 3JCMV 4CC3A 1Y07A 1WXTA 4QKUA 3M4QA 2SEMA 2ZZGA 1WPYA 3V7SA 4IUUA 4XU2A 4OMNA 3HSBA 4E7SA 4XEOA 1F1BB 1PHTA 2DRMA 2E10A 4R56A 1EVLA 1IB8A 2EFIA 2CH4A 3QJYA 4JZ4A 1W1FA 1AHJB 7AT1B 2FPFA 5FROA 2Y4YA 1Y71A 3HXZA 2KGTA 2XDDA 3L42A 3VKIA 1EFNA 4V2SA 2EL9A 3A8OB 2JTFA 12ASA 4TQFA 2R58A 1D1BA 1H92A 2E5AA 5GAOn 4L59A 4YRRA 4HCBA 2K3YA 3EAEA 1N9RA 1RAGB 1S72Q 3PCOB 3HFOA 4RKUE 1QVPA 2GF7A 4DEYA 4K86A 4M4ZA 5CVIA 1RL2A 4K87A 3HP9A 3WQZA 1B34B 1J3TA 3CPWP 3VQVA 2RK2A 3HRUA 4LVMA 2FZGB 1JJ2S 3JCMJ 2K2VA 1VQPT 4RMFA 2F2WA 1ZLMA 4YREA 2KT8A 5DLQE 3L1AA 1RAIB 3MP6A 1HD3A 5KCHA 1Q86C 2D6FA 3INZA 4M7AB 4PJLA 4CC2A 1Q81R 4O2DA 1VQ7Q 4XU0A 1I81A 4JRIA 4LVLA 1MV0B 1YWOA 3ZL7C 5K1XA 1FMKA 2NUPB 4GLMA 2ZZEA 1VQKT 3PVQA 5HKCA 5KCOA 4OGCA 1VQ9A 2PVDB 3DKMA 2CJBA 2LJ1A 2HSEB 3JCMQ 2ZR3A 4X1VA 4CS3A 3VQWA 3KFUA 3DLMA 4Q5WA 1VQPA 1W6XA 2BTTA 2L5QA 3CC2Q 4M78F 4YRCA 3OYEA 1RI9A 5FW9A 2H3JA 1RUWA 2CS7A 1RAFB 2E64A 2ZIMA 1JJ2A 3M58A 2O2OA 3G4SQ 3RACA 5KYNA 3UGQA 4KR3A 3P8TA 3FJ5A 2KROA 2K79A 2EGCA 1SKUB 1VQKA 3UF4A 3QG1A 3ZEHA 4LUEA 2RHQA 1GXIE 1KG1A 1KQ2A 1ADJA 2K4YA 2ZT8A 1Q7YU 5GAN4 3QZ5B 1U06A 2RA2A 1OV3A 1WXBA 5GANg 4FYYB 4DBQA 1M1KC 1G5VA 1RLPC 5GAN5 1Z7MA 2RJCA 3FEOA 4OMOA 1QW1A 2K3XA 4C92C 2F1LA 3JCMg 1T0HA 2E65A 4HWTA 2MPXC 4E7IA 2I0NA 1MGQA 4O5VA 4YTLA 1YBYA 2O88A 3JV3A 2Y90A 1WZOA 4UP7A 2DZCA 2JTMA 2NYSA 2QTVA 3CC4Q 2X4YA 2JM8A 3CCRQ 1NZ9A 2QA4Q 3JB9D 1ZBXA 4CC7A 3AT1B 1IREB 1H4TA 1M8VA 2KQWA 4IUVA 3TEEA 4BE0A 5HCKA 2EYXA 5KYUA 2QG9B 1BIAA 4ESRA 4M7DB 1TWBA 2LQNA 2DTOA 4PJOC 1YJWQ 3C0CA 1I8FA 2QHSA 3CMAA 4F7UB 1N8RC 3QJ6A 2CZ1B 2DLPA 4BD3A 1WFWA 2DL4A 2QK0A 3MO8A 4LDXA 2IPOB 1H4VB 1WNLA 2DYIA 4WTOB 4M7DE 2X4WA 1UDLA 1VQ6A 2DILA 2ED0A 4A4GA 1PM3A 5LJ3g 1ATIA 1C6VX 1TU0B 4TVRA 2M16A 3LWIA 1AOJA 1LNXA 1QVGP 1N27A 1ZBJA 2M0YA 4P71A 1W70A 2R5AA 4EX5A 1SHFA 1QKXA 4IURA 2CUBA 3CXCS 1EX4A 2A28A 2VB6A 4C92G 2D8JA 3RL6A 4J5YA 2MCNA 4AFQC 3M4PA 3MHXA 1KC8R 1BU1A 2GTJA 3SHWA 1B7YA 3ERRA 4M75B 3JCMc 3MJXA 3HFNA 1NNHA 1OX8A 3H6ZA 4E7LA 2XGTA 1S72T 2X3WD 4MDXA 1H8KA 4OB2B 4KULA 1M90U 2KT1A 4DOWA 2KY9A 3OBYA 2CSIA 3EGDB 3G1JA 3CCJQ 1YP5A 3VYGA 4PJOG 1NEGA 4FU6A 2ARSA 2W0ZA 1E6HA 3PFSA 5C0MA 4P3NA 2X35A 2ATCB 2EQIA 1VQMA 2ODRD 1KD1R 1H4SA 2HSPA 2DZ9A 2QEXA 3MP8A 1WQ7A 1N5ZA 3A7RA 1EVKA 1WU7A 2KRNA 1RI0A 3IALA 1VQ7T 1S72A 2RQWA 1UGRB 1BI0A 4PNOA 3JCMW 4PHCA 4M7AC 2AK5A 3LSQA 4EMKA 1D0XA 5KYXB 4JJBA 1WYXA 1WJRA 1NPRA 2QTXA 5ECAA 2E3IA 2A7YA 1OPKA 4OMLA 2C06A 1X6BA 5KE2A 2JS2A 3HTRA 5A2QE 1LYLA 1VYVA 1ZUYA 1VQNT 4Q6GA 2A36A 1QVFS 3OW2P 4JS4A 1D0YA 1QLYA 3HTZA 3CC2T 1GL5A 3CCLQ 5CKHA 4ZTZB 5A0LA 11ASA 1PCXA 1WJQA 3G4ST 4K88A 4BUGA 2MWPA 4ANJA 4YRNA 2L0AA 5D6WA 2Y4XA 2L3SA 1G2BA 3EG9A 3QWXX 2DL3A 3NGPA 2KVQG 3QSUA 4OMFB 3RBBB 1WYDA 1ACMB 2AKKA 2K57A 2DD5A 1UECA 4HXJA 1BBZA 4C8QA 3OD1A 1VQNA 1VQLQ 1KHIA 3QPHA 4EIKA 1NYFA 2LX7A 2RJDA 1LJOA 4J9DA 1Q81U 3REBB 3TSZA 1M8MA 4RTTA 3JCMe 1VYTA 2EJ9A 1TSFA 3QWYA 4XTUA 3G4SA 2OAUA 3EG3A 2EYZA 1QVFA 1NLOC 3M54A 1Q7YC 1U3OA 2DXBA 4BI3A 3CC4T 2QGFB 4M7AG 2ABLA 3THKA 1KQSS 1G3WA 2VASA 2QA4T 3RESA 3HPWA 2K6DA 2K7AA 3GOXA 4XK8E 4AFUC 2LTOA 5FRMA 4DPGA 2YUPA 4TWAA 2ZPGB 2C8MA 4C92F 3QO3A 2PNIA 4YCUA 1Q82R 1X2QA 4RTWA 3WVEB 3AHUA 2D9TA 4ZTUB 4ZNXA 4M7DC 2AMCA 1BKBA 4XTWA 1OX9A 4E7HA 1V76A 1K73R 4H2TA 1JXOA 1SETA 4HWRA 2ECZA 4NOYA 5GANj 5A0GA 3H41A 2X4JA 1KHCA 2QHVA 4JJCA 3CC4A 3M0PA 2KYBA 4C8QD 3MKDA 4LNSA 4ZN3A 2RH2A 5LJ3e 2RQVA 4C5GA 4J9EA 2BKDN 4IUPA 1B7TA 3I9QA 1V1CA 4OB3B 4OB1B 5HK0A 4OF1A 2QHUA 1B07A 1KQSA 3CC7Q 3CD6Q 2KRMA 2CP7A 4LD9K 4J7IA 3V8KA 4A4KA 3HRTA 4KH1B 2E41A 5ELOA 4QVZA 1E24A 2SRCA 3CCMT 1MUZA 1W66A 5GAMd 1G8XA 3H0IA 2NUTA 2RHQB 1NPPA 8AT1B 4E2FB 2P0PA 4P75C 3SWNA 2CP3A 3RMSA 1Y7XA 4DBRA 2KE9A 2LC4A 3QDRB 1PWTA 2BZ8A 1BBUA 2EGEA 2PTKA 4M75C 2LT1A 1W2BA 2E3HA 1X55A 2Q5HA 2GQIA 2JXBA 1IXDA 2HQXA 2CT4A 4Z88A 3CCEQ 2P84A 3HFVA 4YRMA 2RF0A 3UA7A 3A98A 1HJDA 3CCMA 4M7DG 4JLIA 5HY6A 2MAMA 2VGMA 1MV3A 1YFSA 3X28B 2LJ3A 2RM4A 1M90C 3FRNA 2XICA 5EC7A 2JUFA 5KYUB 2DTHA 2CIMA 2K5LA 3OYCA 4RTXA 3NHNA 2LCLA 1G5HA 1UTIA 2B8AA 1PD0A 2QASA 1SSFA 3PE0A 1X2HA 4M78A 3H9NA 5GMKm 2MYSA 3M55A 5LL6S 2V26A 4HVUA 1SPKA 2OI3A 2VC8A 2ZAEA 1NE8A 3RF1A 9ATCB 1Y0MA 2HCKA 4PL6A 4YRLA 1O75A 3ASKA 1J5WA 1T3SA 1NJIR 5LJ5j 1ARKA 3QYHB 4UP9A 5IAYA 3CCLT 3MPUB 1ASZA 4RUGA 1K9MU 4M7AF 3E9GA 3ER0A 3RMQA 2HBWA 3E9HA 1UEBA 2FHDA 4C0FA 5C6SA 1X69A 2VXFA 3UT1A 3OY9A 1R0CB 2IG0A 1ZSZA 2RPNA 3GNFB 5DLOA 2PUOB 3LSSA 4AH6A 3LH5A 3S3OA 4CS2A 4J6WA 3QIIA 1MNEA 3CEYA 2ZT7A 1B7YB 3QUIA 4DBFA 4JDSA 3HKSA 1VQLT 4FYWB 1VIFA 1YHQQ 4RQEA 2YRCA 3VS6A 1XQHA 3SB2A 4PJOE 2I4LA 2CZ6B 2QDLA 3X24B 3I5SA 4J9IA 3ZBDA 3CCLA 4MDWA 3LX7A 3HXUA 1AD5A 1JU5C 2RI2A 1RACB 5FU7B 5GMKe 2GTOA 3M0TA 4YRPA 1UHCA 1UGVA 2L3PA 1H4QA 5IHKA 4F16A 1Q81C 1UJ0A 2J05A 5IN1A 1WLEA 2GBQA 4Q15A 1U8RA 4YCWA 2CP2A 3L4GA 5C51B 3I56Q 1UHFA 2F5TX 4NS5A 1PRLC 1YI2Q 5GANh 1YJNQ 3RGLA 4FM4B 2J6OA 3SDZA 2ZZFA 1KFZA 3OYMA 4EMKB 3JCMh 3CCQQ 1SERA 1NYRA 4YRFA 4M77D 4PJNA 5GAMf 2V1RA 5C52B 2YUNA 4EMHA 1K9AA 1KQ1A 2GQVA 2NS6A 1WHJA 2ZCEA 2KBTA 3SD4A 4YRIA 3UA6A 3EHRA 2J3LA 2CP0A 3VRYA 2XHCA 4OMPA 4AT1B 2DE0X 1E1TA 3CC7T 4M7DF 2MOXA 1E6GA 3M56A 4CI0C 5DM7R 1SHGA 1B8AA 1W4SA 4GY5A 3H0FA 2BIVA 3TSWA 3UGTA 4KRTA 4J7FA 2FRWA 1SRYA 4P3OA 3EG9B 4DOVA 4ZTFA 4L5GA 1SG5A 5GAN7 2ED1A 2PMEA 4J9FA 1X6OA 3CPWS 2V1QA 4XTVA 4TVAA 3FLGA 4FIBA 3MEVA 4X5OA 4C0GA 2LJ0A 4CS4A 1XTDA 2FPDA 1M3AA 4AFZC 4C8QB 3OSVA 2KK4A 2EPDA 5LJ3h 2FRYA 4A54A 4M7AE 1UGQB 3NFCA 3HRKA 4HCKA 4PKCC 2DFUA 1Q82U 2V8IA 1AWJA 5AT1B 3T9NA 4JUVA 3RNJA 3NENA 3E2UA 3MP1A 3CCET 1YITQ 3N5BB 1K73U 2RHYA 1GFDA 4ZGDB 1JQQA 3GNGA 3EG2A 3WXMB 1OOTA 4QW2A 4OGEA 2NLUA 3NEMA 1YJ9Q 2FEIA 4E7JA 4H2UA 4RQFA 4CH4A 2EQUA 2ZGWA 2O31A 2FZKB 4L6V5 2DQ0A 1AWWA 4A4FA 3LGLA 3JB9H 4BE2A 3EFRA 2P4TA 2E6NA 1JBMA 3REAB 2COYA 3IKMB 2CUDA 1BCOA 1VQZA 3NPFA 2C0IA 3G6EQ 4BDYA 2I4NA 1EQRA 1QCFA 5GJVB 2PUKB 3GLXA 4BI4A 5CR2A 3CPWA 4CH6A 2G4CA 1XNIA 3A5ZA 2AMCB 3VS3A 3PZCA 3IQLA 3I35A 5LJ5h 3CCEA 1VQOQ 3M0SA 1HXDA 3HXYA 1AZGB 4CH5A 1BIBA 1JO8A 1TH7A 4HWSA 1Q86R 2ALYA 4AFSC 4TVYA 1G3YA 1M1GA 3GBQA 2X4XA 3PVLA 1UUEA 2CJ9A 2ODRC 1OEBA 1TS9A 2EVRA 2AZSA 3OMGA 2FVUA 3BDUA 1WX6A 4HA8A 1TOVA 4LVKA 4II1A 4P71C 6AT1B 4Y92A 2VVKA 2NUTB 2X3XD 3LC0A 3OYNA 1X27A 3SWNB 2RHSB 3M9QA 2PZ1A 1GCPA 1K9MC 2C0OA 1S1NA 1H3ZA 1M2VA 5KYWA 4J15A 4RG2A 3S3MA 4HCZA 4JPBW 2RQRA 5AYFA 2KRSA 3A8MB 2JJ9A 4A63B 1QP3A 3C95A 4VUBA 2J6KA 2YLCA 3PNWC 4F7UE 1I5OB 4XU3A 1YFRA 2I4MA 2DERA 5FU6B 5FU7C 1VYUA 2O4XA 1D1CA 2FO0A 4NL2A 3JAME 3TEHA 2EYQA 3CXCP 1A0NB 3GP8A 2KYMA 2HL3A 1YIJQ 2EGAA 2QQBA 3P8VA 1ZQ1A 4Y91A 3MF2A 1WHLA 2C0TA 1M1KR 3NTIA 1RABB 1YI2T 2CDTA 2CP6A 1YJNT 3EH2A 3ULRB 2JS0A 4J9CA 2EKHA 3OS2A 5FLXE 4Z8AA 2H8HA 3GF5A 1QVGS 3CCQT 1Z9ZA 3OBWA 4PJMA 3HHTB 3O8VA 4ZTJA 3CMEQ 1K8AR 2ROLA 3J7AF 1H641 5CO7A 4EMKC 4YDQA 4YRKA 2GFAA 1KK7A 2HL5C 2ZXFA 2OAWA 2P0QA 3VUZA 4H2XA 4ZIBA 2VYTA 4C0DB 1QCNA 2RHXA 1SF9A 1YCSB 1D3BA 4M75E 4BE1A 1QF6A 3RKYA 3SEMA 5GAMg 2KAFA 4LN2A 3CCVQ 2NUZA 2YSQA 3CCUQ 3W3SA 4YRJA 3VRZA 1YJNA 1N8RR 2ZNIA 4BW9A 2DBMA 1ZHIA 2QQ9A 3I55Q 3TCJA 2LQ8A 3QHSA 1USYC 1LCKA 2AT1B 3J81E 2EAYA 1ZSZB 3CCQA 2LCSA 4Y28E 2XKOC 2LCCA 4M77B 3HY0A 3HXVA 3PMTA 1YB3A 3VS7A 2WACA 4N0AC 1TXQA 3OA6A 4XTZA 2E5QA 3CQTA 3EG1A 4ME7A 1U1SA 1K76A 5KNNA 1WLPB 1QVGA 1MMDA 2COZA 3TUPA 1TUCA 2G3RA 4JJDA 4C8QC 3EGUA 2DAQA 1GBQA 2HDAA 2JNGA 2DEUA 2WSCE 4KR2A 4PK4A 2DVEA 4M77E 1NJ1A 2LNHB 5GAN8 5F5WA 4N4IA 2ZPHB 5GAOq 1YITT 1I0CA 4FL6A 1QMCA 2OJ2A 2MWOA 3I7FA 3IG2A 4FSXA 1BI2A 2HMAA 1VQ7A 3G7ZA 3R6OA 2KSSA 2PVOB 3MEUA 5GAOp 1Q82C 3L4GB 3M53A 5CAIA 3G71Q 1B34A 2EW3A 3BDLA 3G6ET 4YRTA 1K73C 2AZVA 4HVCA 3OW2S 4D8DA 1YFNA 5IT9E 3HFZA 2A37A 1IHVA 4BI8B 3RIRA 2D8HA 1ASYA 1T3LA 4LVIA 1GCQC 5GAN6 2QQRA 1VQOT 1YITA 3M59A 3CC2A 3PGGA 4QQ6A 3LGFA 4P74A 2GCXA 2HQHA 4NL3A 4A53A 3E1SA 1HK9A 1M27C 4ELZC 1G3TA 4KGXB 3JRZA 1SRLA 2LQWA 3EFOA 1OZ2A 1OPLA 3FDRA 4FYVB 2K2MA 1WHMA 2ESWA 1LOJA 1FYFA 4WCIA 3CCRT 4EDUA 3G6EA 2P4RA 1SSHA 4CC4B 2LT4A 4YCVA 3VV0A 1TTHB 2E5KA 2DNUA 4C8QG 2K9GA 2K5FA 1QWFA 3REUA 2BE9B 2DO3A 1KIKA 3TREA 1VQOA 2DIGA 1YJWT 4J9BA 5GMKl 3VS0A 3OW2A 4FW2A 3JCMb 2CSQA 2DKGA 5CIUA 5GAOm 1NYQA 2KMTA 1NG2A 2CZ7B 1T0JA 5DY9A 3SWNC 3M0UA 1P92A 1W2BS 2RQTA 1PSEA 2JM9A 3RDVA 1IHWA 2L2PA 2L3QA 3EHQA 3MCAB 4WI1A 2KXDA 3M4YA 2QGGA 1U5SA 2LZ6B 3CCRA 5FRNA 1XJWB 2QA4A 1VQ5Q 3R6NA 1UE9A 4P72A 1WHHA 5CQXA 3P8BB 5CKBA 2RJFA 2DETA 2M51A 4FSSA 4PJOF 4FYXB 3SFMA 3A5YA 5EG2A 3C4SA 2PVGB 5CKFA 3VS1A 3CPFA 5FU6C 2C7IA 2JOYA 4RDXA 1YJWA 2YRDA 4LDYA 1CKAA 3EH1A 2RQUA 3Q1JA 4O6JA 2Q7GA 4YYEA 4OMMA 2JVVA 1VQ9Q 1QQJA 3FIFA 4QQGA 2ZPIB 4E51A 2Q7EA 2Q7HA 4LDWA 3D7SB 5J3BA 3A5ZB 1M3CA 2F2XA 1QWEA 1Q7YR 5M9OA 3UFGA 3EGXA 2DL5A 4BY6B 2KEAA 2HKQB 3DB4A 4M7DA 1B70A 4EPCA 2OTJQ 1RLQC 2A0FB 2LVMA 5LJ3j 1BI1A 2I2LA 2OTLQ 3A7AA 4MMKA 5GAMe 3I5RA 4P73A 3CCJT 2GNCA 2IIMA 4C0DC 1WGSA 1OYXA 1PKTA 2YT6A 3L2WA 1JXMA 1VQKQ 2ALYB 2ZR2A 1PRMC 4JRQA 4IUTA 4OMQA 3CCUT 3KBGA 1M9SA 2DL7A 2EWNA 2LQKA 2QDYB 4XAXB 2YDLA 4F7UG 2ZIOA 3I55T 3PMIA 3V7RA 1WJSA 1EIYA 3M5AA 4YRQA 3OS1A 2GFUA 4B9WA 5J26A 1K0SA 1RAHB 3TEGA 1ZSZC 2DQ3A 2DJZA 2CJAA 3PIPA 3OYJA 4M77C 2JMCA 1M2VB 1G3SA 1UJYA 4PFZA 1G51A 4WJ4A 4J83A 4LXCA 2FL7A 3CCJA 2COWA 2EJFA 3UATA 4H2YA 2DXTA 2YHTA 4QVDA 3ZFJA 4BDZA 1KC8U 3RKWA 5GANf 4IUQA 2XTIA 2JW4A 1Z9QA 5GAMj 4R0KA 1K8AU 3I55A 1YN8A 1C1AA 4IIMA 1FMVA 1ABQA 2O4XB 3TU4K 1EIFA 3QYGB 3ICAA 4E6RA 2JMAA 3TEHB 3OS5A 2RHIA 4D8KA 3CMAQ 3X26B 4OVAA 4M75G 2DJQA 2AKWA 2DDZA 4ZGJB 3BW1A 4XEMA 3EGDA 4BACA 3UWNA 4E7ZA 3CBOA 3M0QA 2XD0A 1M3BA 4PFPA 1VQ6Q 1UGPB 1KD1U 2BZXA 1V29B 3KFVA 3M4GA 2XIDA 2RB6A 3WVDB
chains in the Genus database with same CATH topology
4HKEA 1BI3A 2F69A 2P0KA 5CK9A 1Z7NA 4X9CA 4H2XB 4M78D 2PQWA 1HC7A 5D6YA 1D3BB 4XQ3A 4HWOA 3QO7A 3CBPA 4ZGEB 5KE3A 4M77G 3C12A 3S6WA 3L2RA 2L3RA 4C5HA 2E70A 3P8YA 2R5MA 4PLLA 3DB3A 5GAN2 3VYHB 2M0OA 4KT0E 4DQ2A 1VQLA 1EOVA 2VUBA 4JRPA 2ARUA 4DA4A 1FWZA 3A8HB 3UDCA 3HRSA 4FT2A 3L2QA 2XDBA 3HY1A 2RI3A 4Z02A 3P8HA 4GLKA 3BJUA 3OYBA 4X9DA 4N4GA 1VQ5T 1G5IA 5GMKj 1M1FA 4XTXA 1ADYA 2PU9B 4P5NA 3OYLA 5LJ5f 3A8LB 4ZN1A 3CD6T 1GGMA 5J39A 2QXFA 3A8GB 3UPUA 4TVWA 4F7UF 3QO5A 2V8KA 1VQ9T 1HTTA 4R55A 3ME9A 3HFZB 2IY5A 1OZ3A 2DD4A 3A74A 4LVJA 1VQ5A 4YPFA 3MEWA 3M57A 3J80E 4HT4A 2ZCFB 4BB7A 1PYSA 2OTJT 4BY6C 2ZPEB 2ZPBB 3CC7A 1VIEA 3CD6A 2OTLT 2VGNA 4C8QE 2LRQA 2P5IA 4ELYC 1FX7A 3L2ZA 3GPLA 2MMPA 3NTKA 3OS0A 4UC4A 4M75F 4E7KA 1QE0A 1N9WA 3MF1A 2RJEA 2EQJA 3IKLA 1E1OA 5HGQA 2HBPA 2BUDA 2OTJA 3R07A 3OYFA 3JB9G 2DIQA 3OYKA 2YLBA 3QKJA 2OTLA 1NJ2A 5GAMh 2KDSA 2I4OA 4QQDA 2A8EA 5GAOr 3QXEB 4MZPA 4H2SA 3UH0A 2ZT6A 1KMMA 3CBMA 3VQXA 2IVWA 3EFSA 4MZMA 4YP0A 4C0ZA 2CKKA 2RHUA 5CCAA 2L89A 4M77F 3CMAT 1JRIA 2RHZA 2MI6A 1KC8C 3A31A 2Q5IA 1JJCA 1WQWA 4JJNK 1K8AC 2YRVA 1Y96A 1VQ6T 3LH0A 1PSFA 2O01E 4RMOA 4WF2A 1NJ8A 1YHQT 2QQAA 1B70B 2DK3A 5CKDA 2QHTA 1KD1C 4A4HA 2E3CA 2L8DA 4C92A 4KBMB 2QQSA 3E9FA 4TQDA 2XI9A 3BY7A 2QI2A 4NCXA 1NJIU 2LX9A 3X20B 3G1ZA 3I56T 3LWHA 1EIYB 4C5EA 4UP8A 3QBYA 1YHQA 3MEAA 2K5IA 2JN0A 1FXXA 2F5KA 4H2WA 3V8JA 3E9IA 2DXUA 3LW5E 4KQEA 4HCCA 1E22A 4M78B 3HRIA 1L0WA 5GMKh 2PMFA 4PJOA 3OYGA 4D6WA 1X54A 4OB0B 4WJ3M 1VQMT 4YRSA 2ZT5A 2FYKA 1EFWA 3RERA 2QEXT 2HD0A 5I2SA 1IL2A 4M78E 3I56A 3META 3NETA 1YCYA 1YI2A 2M1HA 4G84A 4YROA 2AKWB 3BFMA 2P0LA 4C92D 5GAOl 5LJ5g 3A7UA 3QTCA 4HT9A 3JCMP 3HXWA 3LYIA 4XTYA 3JCMX 3P8DA 1UB4A 4E47A 1BBWA 2R57A 3JB9F 4BWAA 3JSCA 2ZTGA 4OP0A 2E6ZA 3CXCA 3OSSC 3HL8A 2ZZDA 5GMKi 1R8OB 4PJOD 4P74C 1BYMA 2RK1A 1YJ9T 2RD1A 5HK3A 3PCOA 5I21A 2EKOA 2D0QB 4RCCA 3QO8A 4X34A 1U1TA 2WSEE 5C53B 3C94A 5GANd 1USYA 1C0AA 3L2VA 1KMNA 2RI5A 2RO0A 2M9UA 3FC3A 3JCMd 3QNEA 2V8JA 4PG3A 4M7AA 2XDPA 3OQ5A 1O9SA 4N0AA 1YJ9A 4CRIA 4P3PA 3RKXA 2EQMA 1N6AA 2XG8D 4PLIA 4LDUA 1OI1A 2ZNJA 1M4ZA 2A3LA 3OYDA 2DPPB 3LLRA 2AHJB 2XK0A 5L8RE 2EIFA 3URGA 5GANe 3PT9A 4P72C 1I5LA 2CGHA 5E3IA 4MZTA 2J3MA 5A0DA 4L87A 4YRGA 3PIOA 1QP2A 4EMGA 4J6XA 2XU8A 1N9SA 4TVAB 2IY5B 4HWPA 1DJ7B 4XU1A 3JB9I 1B76A 5LJ3d 5CKEA 3VUBA 3VU3C 1PYSB 4G85A 1IZ6A 5ELNA 3JB9J 4MMLA 3A32A 3RUXA 1SESA 4JLGA 4M7AD 1X56A 3FB9A 5I2MA 1X2GA 1VQ4T 3V7CA 4P73C 1YIJT 4KUDK 4C5IA 4KUIA 2HAXA 1Q86U 2CYZB 5CQYA 4EO4A 3H8ZA 2DXCA 1X01A 3DSQA 1XOVA 1MHNA 4N4HA 4A4EA 2VXEA 3OB9A 3CCST 2E12A 3CMET 3KUFA 1NJIC 3E19A 4RG8A 5LJ5d 4M78C 3CMQA 3VQYA 4LDVA 1VQ4A 3VJPA 2RHSA 2JZ2A 4F7UA 1YIJA 3CCVT 3NELA 4J6YA 3NTHA 3MQZA 4RCBA 2LDMA 5D6XA 2WSFE 4OLFA 2E1HA 1I4K1 3OMCA 1X75C 3REXA 5LJ5e 2DTIA 3CCSA 3KXTA 2MF2A 3CMEA 3QZ9B 1JJCB 3OYAA 1Y96B 3OYYA 4HT8A 4H02A 3V8LA 2HNIA 2CZ0B 1M5Q1 1M1KU 1YFTA 4P75A 3PTAA 4J8OA 4IKFA 3HXXA 3CCVA 2EQKA 5GAN3 3CCUA 5KH6A 4FT4A 3MEYA 4M75A 3JCMf 4M7DD 1YGBA 1VUBA 3X25B 4C92B 4JRKA 1RIQA 1NJ5A 3G71T 2FB7A 3FJPA 4C8QF 4M78G 1VQ8T 4QVCA 3OYIA 4C92E 1N8RU 1NJ6A 4ATOA 2EJGA 1JB0E 2VV5A 2DEQA 4PJOB 2ZPFB 2LNVA 3S3NA 2DU5A 4H2VA 4UPAA 1KOGA 1UGSB 4M77A 3OYHA 4B9XA 4TTVA 4CH3A 3DLLA 3G71A 2ARTA 5LJ3f 3L2UA 2HQEA 2ZINA 4JS5A 4M75D 1VQ8A 3VBBA 4LD6A 3F70A 3GIBA 2DU7A 5K1PA 3JCMV 1Y07A 3M4QA 2ZZGA 1WPYA 3V7SA 4IUUA 4XU2A 3HSBA 4XEOA 1EVLA 2E10A 4R56A 2EFIA 3QJYA 1AHJB 5FROA 3HXZA 2Y4YA 1Y71A 2XDDA 3L42A 3VKIA 4V2SA 2EL9A 3A8OB 2JTFA 12ASA 4TQFA 2R58A 2E5AA 5GAOn 4L59A 4YRRA 4HCBA 2K3YA 3EAEA 1N9RA 3PCOB 3HFOA 4RKUE 1QVPA 2GF7A 4K86A 5CVIA 1RL2A 4K87A 3HP9A 3WQZA 1B34B 3VQVA 2RK2A 3HRUA 4LVMA 1JJ2S 3JCMJ 2K2VA 1VQPT 4RMFA 4YREA 5DLQE 3L1AA 3MP6A 5KCHA 1Q86C 2D6FA 3INZA 4M7AB 4O2DA 4XU0A 1I81A 4JRIA 4LVLA 5K1XA 2ZZEA 1VQKT 5HKCA 5KCOA 4OGCA 1VQ9A 2PVDB 3DKMA 2CJBA 3JCMQ 2ZR3A 4CS3A 3VQWA 3KFUA 3DLMA 1VQPA 4Q5WA 2L5QA 4M78F 4YRCA 3OYEA 2H3JA 2CS7A 2E64A 2ZIMA 1JJ2A 3M58A 3RACA 3UGQA 4KR3A 3P8TA 1VQKA 3QG1A 3ZEHA 2RHQA 1GXIE 1KG1A 1KQ2A 1ADJA 2K4YA 2ZT8A 1Q7YU 5GAN4 3QZ5B 2RA2A 5GANg 1M1KC 1G5VA 5GAN5 1Z7MA 2RJCA 3FEOA 4C92C 1QW1A 2K3XA 3JCMg 2E65A 4HWTA 4E7IA 1MGQA 4O5VA 4YTLA 1YBYA 4UP7A 2Y90A 2DZCA 2JTMA 2X4YA 1NZ9A 3JB9D 1ZBXA 1IREB 1H4TA 1M8VA 2KQWA 4IUVA 3TEEA 4BE0A 1BIAA 4M7DB 2DTOA 4PJOC 1I8FA 2QHSA 3CMAA 4F7UB 1N8RC 3QJ6A 2CZ1B 4BD3A 3MO8A 4LDXA 1H4VB 1WNLA 4M7DE 2X4WA 1VQ6A 4A4GA 5LJ3g 1ATIA 4TVRA 2M16A 3LWIA 1LNXA 1N27A 4P71A 2R5AA 4EX5A 4IURA 3CXCS 4C92G 3RL6A 4J5YA 3M4PA 3MHXA 1B7YA 3ERRA 4M75B 3JCMc 3HFNA 1NNHA 3H6ZA 2XGTA 4E7LA 1S72T 4MDXA 4OB2B 4KULA 1M90U 4DOWA 2KY9A 3OBYA 3VYGA 4PJOG 4FU6A 2ARSA 4P3NA 3PFSA 5C0MA 2X35A 1VQMA 2ODRD 1H4SA 2DZ9A 2QEXA 3MP8A 1WQ7A 3A7RA 1EVKA 1WU7A 1RI0A 3IALA 1VQ7T 1S72A 1UGRB 1BI0A 4PNOA 3JCMW 4PHCA 4M7AC 3LSQA 4EMKA 1WJRA 1NPRA 2QTXA 2A7YA 2C06A 5KE2A 5A2QE 1LYLA 1VQNT 4Q6GA 1QVFS 4JS4A 3HTZA 3CC2T 5CKHA 4ZTZB 5A0LA 11ASA 1WJQA 3G4ST 4K88A 4BUGA 2MWPA 4YRNA 5D6WA 2Y4XA 2KVQG 3QSUA 4OMFB 1WYDA 2K57A 2DD5A 4C8QA 3OD1A 1VQNA 1KHIA 3QPHA 2RJDA 1Q81U 1LJOA 3JCMe 2EJ9A 4XTUA 3G4SA 2OAUA 1QVFA 3M54A 1Q7YC 2DXBA 4BI3A 3CC4T 4M7AG 1KQSS 1G3WA 2QA4T 3RESA 3HPWA 3GOXA 4XK8E 2LTOA 5FRMA 4DPGA 4TWAA 2ZPGB 2C8MA 4C92F 3QO3A 4YCUA 3WVEB 3AHUA 2D9TA 4ZTUB 4M7DC 2AMCA 1BKBA 4XTWA 4E7HA 4H2TA 1SETA 4HWRA 4NOYA 5GANj 5A0GA 2X4JA 1KHCA 2QHVA 3CC4A 4C8QD 4LNSA 4ZN3A 2RH2A 5LJ3e 4C5GA 2BKDN 4IUPA 4OB3B 4OB1B 5HK0A 4OF1A 2QHUA 1KQSA 4LD9K 4J7IA 3V8KA 4A4KA 3HRTA 2E41A 5ELOA 4QVZA 1E24A 3CCMT 1W66A 5GAMd 2RHQB 1NPPA 2P0PA 4P75C 3SWNA 3RMSA 1Y7XA 2LC4A 3QDRB 1BBUA 4M75C 2LT1A 1W2BA 1X55A 2Q5HA 2HQXA 3HFVA 4YRMA 3CCMA 4M7DG 4JLIA 5HY6A 2MAMA 2VGMA 1YFSA 3X28B 2RM4A 1M90C 3FRNA 2XICA 2JUFA 2DTHA 2CIMA 2K5LA 3OYCA 2LCLA 1G5HA 2B8AA 1SSFA 1X2HA 4M78A 5GMKm 3M55A 5LL6S 2VC8A 3RF1A 1NE8A 4PL6A 4YRLA 1O75A 3ASKA 1J5WA 5LJ5j 3QYHB 4UP9A 5IAYA 3CCLT 1ASZA 1K9MU 4M7AF 3E9GA 3ER0A 3RMQA 3E9HA 1UEBA 2FHDA 4C0FA 5C6SA 2VXFA 3UT1A 3OY9A 2IG0A 3GNFB 5DLOA 2PUOB 3LSSA 4AH6A 3S3OA 4CS2A 4J6WA 3QIIA 3CEYA 2ZT7A 1B7YB 3QUIA 4JDSA 3HKSA 1VQLT 1VIFA 4RQEA 1XQHA 3SB2A 4PJOE 2I4LA 2CZ6B 3X24B 3ZBDA 3CCLA 4MDWA 3LX7A 3HXUA 2RI2A 5FU7B 5GMKe 4YRPA 1H4QA 1Q81C 5IN1A 1WLEA 4Q15A 1U8RA 4YCWA 3L4GA 5C51B 2F5TX 4NS5A 5GANh 3RGLA 4FM4B 3SDZA 2ZZFA 3OYMA 4EMKB 3JCMh 1SERA 1NYRA 4YRFA 4M77D 5GAMf 5C52B 4EMHA 1KQ1A 2GQVA 2NS6A 2ZCEA 3SD4A 4YRIA 2J3LA 2XHCA 1E1TA 3CC7T 4M7DF 3M56A 4CI0C 5DM7R 1B8AA 1W4SA 4GY5A 2BIVA 3UGTA 4J7FA 1SRYA 4P3OA 4DOVA 4ZTFA 4L5GA 5GAN7 2PMEA 1X6OA 3CPWS 4XTVA 4TVAA 3FLGA 4FIBA 3MEVA 4X5OA 4C0GA 4CS4A 1XTDA 4C8QB 3OSVA 2KK4A 5LJ3h 4A54A 4M7AE 1UGQB 3NFCA 3HRKA 4PKCC 1Q82U 2V8IA 3T9NA 4JUVA 3NENA 3MP1A 3CCET 3N5BB 1K73U 2RHYA 4ZGDB 3GNGA 3WXMB 4QW2A 4H2UA 4OGEA 2NLUA 3NEMA 4E7JA 4RQFA 4CH4A 2EQUA 2ZGWA 4L6V5 2DQ0A 4A4FA 3LGLA 3JB9H 4BE2A 3EFRA 1JBMA 2E6NA 2P4TA 3IKMB 1VQZA 2I4NA 4BDYA 1EQRA 2PUKB 3GLXA 4BI4A 5CR2A 3CPWA 4CH6A 2G4CA 1XNIA 3A5ZA 2AMCB 3PZCA 5LJ5h 3CCEA 1HXDA 3HXYA 4CH5A 1BIBA 1TH7A 4HWSA 2ALYA 4TVYA 1G3YA 1M1GA 2X4XA 2CJ9A 2ODRC 3OMGA 2FVUA 3BDUA 4HA8A 4LVKA 4II1A 4P71C 3LC0A 3OYNA 3SWNB 2RHSB 3M9QA 1K9MC 1H3ZA 4J15A 4RG2A 3S3MA 4HCZA 5AYFA 3A8MB 1QP3A 3C95A 4VUBA 2YLCA 3PNWC 4F7UE 4XU3A 1YFRA 2I4MA 5FU6B 5FU7C 2O4XA 4NL2A 3JAME 3TEHA 2EYQA 3GP8A 2QQBA 3P8VA 1ZQ1A 4Y91A 3MF2A 3NTIA 1YI2T 1YJNT 3OS2A 5FLXE 3GF5A 1QVGS 3CCQT 3OBWA 3HHTB 3O8VA 4ZTJA 3J7AF 1H641 5CO7A 4EMKC 4YDQA 4YRKA 2GFAA 2ZXFA 2P0QA 3VUZA 4H2XA 4ZIBA 2VYTA 4C0DB 2RHXA 1D3BA 4M75E 4BE1A 1QF6A 3RKYA 5GAMg 2KAFA 3W3SA 4YRJA 1YJNA 2ZNIA 4BW9A 1ZHIA 2QQ9A 3TCJA 2LQ8A 3QHSA 1USYC 3J81E 2EAYA 3CCQA 4Y28E 2XKOC 2LCCA 4M77B 3HY0A 3HXVA 3PMTA 1YB3A 2WACA 4N0AC 3OA6A 4XTZA 2E5QA 4ME7A 1U1SA 5KNNA 1QVGA 3TUPA 2G3RA 4C8QC 2DAQA 2JNGA 2WSCE 4KR2A 2DVEA 4M77E 1NJ1A 5GAN8 5F5WA 4N4IA 2ZPHB 5GAOq 1YITT 4FL6A 2MWOA 3I7FA 3IG2A 4FSXA 1BI2A 1VQ7A 3G7ZA 3R6OA 2KSSA 2PVOB 3MEUA 5GAOp 1Q82C 3L4GB 3M53A 5CAIA 1B34A 3BDLA 3G6ET 4YRTA 1K73C 4HVCA 3OW2S 5IT9E 3HFZA 4BI8B 3RIRA 1ASYA 4LVIA 5GAN6 2QQRA 1VQOT 1YITA 3M59A 3CC2A 3PGGA 4QQ6A 3LGFA 4P74A 2GCXA 4NL3A 4A53A 3E1SA 1HK9A 4ELZC 1G3TA 3JRZA 1OZ2A 3FDRA 1LOJA 1FYFA 3CCRT 4EDUA 3G6EA 2LT4A 4YCVA 3VV0A 4C8QG 2K5FA 3REUA 2DO3A 3TREA 1VQOA 2DIGA 1YJWT 5GMKl 3OW2A 3JCMb 2DKGA 5CIUA 5GAOm 1NYQA 2KMTA 2CZ7B 5DY9A 3SWNC 1P92A 1W2BS 1PSEA 3MCAB 4WI1A 3M4YA 3CCRA 5FRNA 2QA4A 4P72A 5CQXA 3P8BB 5CKBA 2RJFA 4PJOF 3SFMA 3A5YA 5EG2A 3C4SA 2PVGB 5CKFA 3CPFA 5FU6C 2C7IA 2JOYA 4RDXA 1YJWA 4LDYA 3Q1JA 4O6JA 2Q7GA 4YYEA 2JVVA 3FIFA 4QQGA 2ZPIB 4E51A 2Q7EA 2Q7HA 4LDWA 5J3BA 3A5ZB 5M9OA 3UFGA 4BY6B 3DB4A 4M7DA 1B70A 4EPCA 2LVMA 5LJ3j 1BI1A 2I2LA 3A7AA 4MMKA 5GAMe 4P73A 3CCJT 4C0DC 1WGSA 1OYXA 3L2WA 2ALYB 2ZR2A 4JRQA 4IUTA 3CCUT 3KBGA 1M9SA 2EWNA 2LQKA 2QDYB 4XAXB 4F7UG 2ZIOA 3I55T 3PMIA 3V7RA 1WJSA 1EIYA 3M5AA 4YRQA 3OS1A 2GFUA 4B9WA 5J26A 3TEGA 2DQ3A 2DJZA 2CJAA 3PIPA 3OYJA 4M77C 1G3SA 1G51A 4WJ4A 4J83A 2FL7A 3CCJA 2EJFA 4H2YA 2DXTA 2YHTA 4QVDA 3ZFJA 4BDZA 1KC8U 3RKWA 5GANf 4IUQA 2XTIA 5GAMj 1K8AU 3I55A 2O4XB 3TU4K 1EIFA 3QYGB 3ICAA 3TEHB 3OS5A 2RHIA 3X26B 4OVAA 4M75G 2AKWA 2DDZA 4ZGJB 3BW1A 4XEMA 4BACA 3UWNA 3CBOA 2XD0A 1UGPB 1KD1U 1V29B 3M4GA 2XIDA 2RB6A 3WVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SES A;  3IKM B;  4M7A D;  1X56 A;  3FB9 A;  4PJO G;  1X2G A;  3V7C A;  1VQZ A;  2I4N A;  4P73 C;  1EQR A;  2ARS A;  4P3N A;  1Z7N A;  4X9C A;  4H2X B;  4M78 D;  4CH6 A;  1HC7 A;  2ODR D;  2G4C A;  3A5Z A;  1H4S A;  2AMC B;  3PZC A;  1D3B B;  2DZ9 A;  4XQ3 A;  4HWO A;  1WQ7 A;  4EO4 A;  5LJ5 h;  3A7R A;  1EVK A;  1WU7 A;  1HXD A;  1X01 A;  3DSQ A;  3HXY A;  3IAL A;  3QO7 A;  4M77 G;  4PNO A;  2VXE A;  3JCM W;  4PHC A;  4M7A C;  4CH5 A;  3LSQ A;  4EMK A;  3P8Y A;  1BIB A;  1TH7 A;  5GAN 2;  4HWS A;  2ALY A;  4TVY A;  2QTX A;  4DQ2 A;  1EOV A;  5LJ5 d;  4M78 C;  2CJ9 A;  2ODR C;  3CMQ A;  2ARU A;  3VQY A;  3BDU A;  1LYL A;  2RHS A;  4HA8 A;  4F7U A;  4Q6G A;  3HTZ A;  4P71 C;  3NEL A;  3HY1 A;  4J6Y A;  4RCB A;  4ZTZ B;  3BJU A;  4OLF A;  4X9D A;  3LC0 A;  2E1H A;  11AS A;  1I4K 1;  3SWN B;  2RHS B;  4K88 A;  1G5I A;  5GMK j;  3REX A;  4XTX A;  4YRN A;  1ADY A;  5LJ5 e;  4J15 A;  2DTI A;  3QSU A;  1JJC B;  5LJ5 f;  1WYD A;  1GGM A;  2K57 A;  1Y96 B;  4HT8 A;  4H02 A;  3V8L A;  4C8Q A;  2YLC A;  3OD1 A;  4TVW A;  4F7U E;  4F7U F;  2HNI A;  4XU3 A;  3QO5 A;  1M5Q 1;  1YFR A;  1YFT A;  2I4M A;  4P75 A;  3EFR A;  1HTT A;  3HXX A;  1LJO A;  5GAN 3;  4NL2 A;  3TEH A;  3HFZ B;  2IY5 A;  3JCM e;  2EJ9 A;  3MEY A;  4M75 A;  3A74 A;  4XTU A;  3P8V A;  4Y91 A;  3MF2 A;  4YPF A;  3JCM f;  4M7D D;  1YGB A;  4C92 B;  4M7A G;  1PYS A;  4JRK A;  1RIQ A;  3RES A;  1NJ5 A;  2FB7 A;  3FJP A;  4C8Q E;  4C8Q F;  4M78 G;  2P5I A;  3L2Z A;  4DPG A;  1H64 1;  4TWA A;  4EMK C;  4YDQ A;  4YRK A;  4QVC A;  2C8M A;  4C92 E;  4C92 F;  3QO3 A;  2ZXF A;  1NJ6 A;  4YCU A;  4H2X A;  4ZIB A;  3AHU A;  2EJG A;  4ZTU B;  4M7D C;  2AMC A;  1D3B A;  4M75 E;  4M75 F;  4XTW A;  1QF6 A;  3RKY A;  5GAM g;  4H2T A;  2DEQ A;  1SET A;  4PJO B;  4HWR A;  1QE0 A;  4NOY A;  5GAN j;  1N9W A;  2DU5 A;  3MF1 A;  4H2V A;  4UPA A;  1KOG A;  4M77 A;  2QHV A;  3IKL A;  3W3S A;  1E1O A;  4YRJ A;  5HGQ A;  4C8Q D;  4LNS A;  2ZNI A;  4BW9 A;  5LJ3 e;  3R07 A;  3JB9 G;  4CH3 A;  4TTV A;  2YLB A;  3QHS A;  1USY C;  1NJ2 A;  2EAY A;  2ART A;  5GAM h;  5LJ3 f;  2ZIN A;  2I4O A;  4M77 B;  3HY0 A;  3HXV A;  2QHU A;  4M75 D;  1YB3 A;  5GAO r;  3VBB A;  4N0A C;  3V8K A;  4H2S A;  4XTZ A;  3UH0 A;  3GIB A;  2DU7 A;  1U1S A;  2ZT6 A;  2E41 A;  1KMM A;  5ELO A;  5K1P A;  5KNN A;  3JCM V;  3VQX A;  1E24 A;  3EFS A;  3TUP A;  4YP0 A;  1W66 A;  3M4Q A;  5GAM d;  2ZZG A;  4C8Q C;  1WPY A;  3V7S A;  2RHQ B;  4XU2 A;  3HSB A;  4KR2 A;  4P75 C;  2DVE A;  3SWN A;  4M77 E;  4M77 F;  4XEO A;  1NJ1 A;  5GAN 8;  1JRI A;  1EVL A;  2E10 A;  5F5W A;  5GAO q;  3A31 A;  1BBU A;  3I7F A;  2Q5I A;  3IG2 A;  1WQW A;  4M75 C;  1JJC A;  3HXZ A;  1Y96 A;  4V2S A;  1X55 A;  2EL9 A;  12AS A;  2Q5H A;  4TQF A;  2E5A A;  4WF2 A;  5GAO p;  5GAO n;  1NJ8 A;  4YRR A;  3L4G B;  5CAI A;  3HFV A;  1B34 A;  4YRM A;  1N9R A;  4YRT A;  3PCO B;  4HVC A;  3HFO A;  4M7D G;  3HFZ A;  4JLI A;  1B70 B;  3RIR A;  4K86 A;  1ASY A;  1YFS A;  2QHT A;  4K87 A;  5GAN 6;  2RM4 A;  3WQZ A;  1B34 B;  2E3C A;  3VQV A;  4C92 A;  3PGG A;  4TQD A;  2DTH A;  2CIM A;  4P74 A;  3BY7 A;  3JCM J;  4NL3 A;  4A53 A;  1G5H A;  4NCX A;  4RMF A;  1HK9 A;  1X2H A;  4YRE A;  3G1Z A;  1EIY B;  4M78 A;  4UP8 A;  3L1A A;  5GMK m;  3INZ A;  4M7A B;  4O2D A;  1LOJ A;  1FYF A;  2JN0 A;  2VC8 A;  3RF1 A;  4XU0 A;  1I81 A;  4H2W A;  4JRI A;  3V8J A;  3E9I A;  2DXU A;  4KQE A;  4YRL A;  4YCV A;  1J5W A;  1E22 A;  5K1X A;  2ZZE A;  5LJ5 j;  4M78 B;  4C8Q G;  3HRI A;  4UP9 A;  1L0W A;  5GMK h;  2PMF A;  4PJO A;  3REU A;  1X54 A;  1ASZ A;  4M7A F;  2CJB A;  5GMK l;  4WJ3 M;  3JCM b;  3JCM Q;  2DKG A;  2ZR3 A;  5GAO m;  1NYQ A;  3E9H A;  4YRS A;  2ZT5 A;  4CS3 A;  2FYK A;  1EFW A;  3VQW A;  3RER A;  3KFU A;  2VXF A;  5DY9 A;  3SWN C;  1IL2 A;  4M78 E;  4M78 F;  4YRC A;  3LSS A;  4AH6 A;  3NET A;  1YCY A;  4WI1 A;  4CS2 A;  4J6W A;  2E64 A;  2ZIM A;  4G84 A;  3RAC A;  4YRO A;  3UGQ A;  4KR3 A;  2ZT7 A;  1B7Y B;  4P72 A;  2AKW B;  3BFM A;  3QUI A;  2P0L A;  3P8T A;  4C92 D;  5GAO l;  5LJ5 g;  3A7U A;  4RQE A;  3QTC A;  4HT9 A;  3JCM P;  3SB2 A;  4PJO F;  4PJO E;  2I4L A;  3HXW A;  2RHQ A;  3A5Y A;  4XTY A;  3JCM X;  1KQ2 A;  1ADJ A;  3HXU A;  2C7I A;  4RDX A;  2ZT8 A;  1BBW A;  5GMK e;  5GAN 4;  4YRP A;  3JB9 F;  4BWA A;  2ZTG A;  2RA2 A;  4OP0 A;  2Q7G A;  4YYE A;  5GAN g;  3FIF A;  1H4Q A;  4E51 A;  5GAN 5;  1Z7M A;  2Q7E A;  2Q7H A;  5GMK i;  4C92 C;  1WLE A;  4Q15 A;  3JCM g;  2E65 A;  4YCW A;  4HWT A;  4PJO D;  3L4G A;  5C51 B;  4P74 C;  1MGQ A;  3UFG A;  4UP7 A;  2Y90 A;  2RD1 A;  2DZC A;  3PCO A;  5I21 A;  5GAN h;  3RGL A;  4M7D A;  1B70 A;  4RCC A;  3QO8 A;  3JB9 D;  2ZZF A;  1U1T A;  5LJ3 j;  2I2L A;  3A7A A;  4MMK A;  4EMK B;  5GAM e;  4P73 A;  5C53 B;  1H4T A;  3JCM h;  1M8V A;  1SER A;  2ALY B;  1NYR A;  2ZR2 A;  4YRF A;  4M77 D;  5GAM f;  1BIA A;  5C52 B;  4M7D B;  2EWN A;  2DTO A;  4EMH A;  4PJO C;  5GAN d;  1KQ1 A;  1I8F A;  1USY A;  1C0A A;  2QHS A;  1KMN A;  4F7U G;  2ZCE A;  2ZIO A;  4F7U B;  3V7R A;  1EIY A;  4YRQ A;  4YRI A;  2J3L A;  3JCM d;  3QNE A;  4PG3 A;  4M7A A;  4N0A A;  4P3P A;  1E1T A;  1H4V B;  3RKX A;  1WNL A;  3TEG A;  4M7D E;  4M7D F;  2DQ3 A;  2DJZ A;  2CJA A;  1B8A A;  2ZNJ A;  3UGT A;  4M77 C;  5LJ3 g;  1ATI A;  1SRY A;  4P3O A;  1G51 A;  4WJ4 A;  2EJF A;  5GAN e;  5GAN 7;  4P72 C;  4H2Y A;  2PME A;  2DXT A;  2YHT A;  1LNX A;  4QVD A;  4P71 A;  4XTV A;  1I5L A;  3RKW A;  4TVA A;  5GAN f;  2CGH A;  2XTI A;  5E3I A;  4EX5 A;  4X5O A;  4CS4 A;  4C8Q B;  5GAM j;  2J3M A;  5LJ3 h;  4L87 A;  4A54 A;  4YRG A;  4EMG A;  4C92 G;  4M7A E;  3RL6 A;  3HRK A;  4J5Y A;  3ICA A;  3M4P A;  4J6X A;  1N9S A;  4TVA B;  3TEH B;  4JUV A;  2IY5 B;  1B7Y A;  3NEN A;  3ERR A;  4HWP A;  4M75 G;  2AKW A;  4M75 B;  3JCM c;  2DDZ A;  3BW1 A;  4XEM A;  3HFN A;  1NNH A;  4XU1 A;  4H2U A;  3JB9 I;  1B76 A;  5LJ3 d;  3NEM A;  2XGT A;  4RQF A;  3VU3 C;  4CH4 A;  2ZGW A;  1PYS B;  4G85 A;  2DQ0 A;  5ELN A;  3JB9 J;  4MML A;  3A32 A;  3JB9 H;  3M4G A;  2RB6 A;  3RUX A;  1JBM A; 
#chains in the Genus database with same CATH topology
 4FCY A;  4HKE A;  1BI3 A;  1X43 A;  2HZY A;  2F69 A;  2P0K A;  2D1X A;  4RTY A;  5CK9 A;  1Z7N A;  4ORZ A;  4X9C A;  4H2X B;  4M78 D;  2PQW A;  1HC7 A;  1ABO A;  5D6Y A;  1KJW A;  1D3B B;  4XQ3 A;  4HWO A;  4KGV B;  1QCO A;  3QO7 A;  3CBP A;  1B3Q A;  4ZGE B;  1M30 A;  1CSK A;  5KE3 A;  4M77 G;  3C12 A;  3S6W A;  3L2R A;  2L3R A;  2DMO A;  4C5H A;  2E70 A;  3P8Y A;  2R5M A;  4PLL A;  1NEB A;  3DB3 A;  1BB9 A;  3EG0 A;  5GAN 2;  3VYH B;  2M0O A;  4KT0 E;  4DQ2 A;  1VQL A;  1EOV A;  2VUB A;  4JRP A;  2ARU A;  4DA4 A;  1D1A A;  1FWZ A;  1AT1 B;  2J7I A;  3A8H B;  3TQ7 P;  3UDC A;  3HRS A;  2KI7 A;  2YUO A;  1WDX A;  1PD1 A;  1JEG A;  2JTE A;  4FT2 A;  3L2Q A;  2XDB A;  3HY1 A;  1YWP A;  2RI3 A;  1LVK A;  1WI7 A;  2DA9 A;  4Z02 A;  3P8H A;  4GLK A;  3BJU A;  3OYB A;  4X9D A;  1TG0 A;  4RTU A;  4N4G A;  3QDF A;  1VQM Q;  1I1J A;  1VQ5 T;  1G5I A;  5GMK j;  1M1F A;  4XTX A;  1ADY A;  2QEX Q;  2PU9 B;  1MMA A;  4F17 A;  4JZ3 A;  1JJ2 P;  1OUL A;  5FWB A;  1IGQ A;  3NMZ C;  4P5N A;  1PNJ A;  3OYL A;  5LJ5 f;  3A8L B;  4ZN1 A;  3CD6 T;  1GGM A;  5J39 A;  2QXF A;  3A8G B;  3UPU A;  1OQK A;  4TVW A;  4F7U F;  1ZA2 B;  3QO5 A;  2V8K A;  1VQ9 T;  2K3B A;  2J06 A;  1HTT A;  3O5Z A;  4R55 A;  2XMF A;  2CT3 A;  1RAD B;  3ME9 A;  3HFZ B;  4B6M A;  2IY5 A;  1QKW A;  1OZ3 A;  2DD4 A;  3A74 A;  4LVJ A;  5FWC A;  4RTZ A;  1VQ5 A;  4YPF A;  3MEW A;  4J9H A;  3M57 A;  3J80 E;  4HT4 A;  2ZCF B;  1NBE B;  4BB7 A;  1PYS A;  2OTJ T;  4BY6 C;  2O9S A;  2ZPE B;  2ZPB B;  3CC7 A;  1VIE A;  3CD6 A;  2OTL T;  2VGN A;  4C8Q E;  2KXC A;  2LRQ A;  2P5I A;  4ELY C;  1FX7 A;  3L2Z A;  3GPL A;  2MMP A;  3EFO B;  2QAZ A;  1RAA B;  3NTK A;  3OS0 A;  3U23 A;  2RNA A;  4UC4 A;  2DX1 A;  1VOM A;  2HKN A;  5IHN A;  4M75 F;  1VQN Q;  4E7K A;  1QE0 A;  1N9W A;  3MF1 A;  2RJE A;  2EQJ A;  3IKL A;  1E1O A;  4AMC A;  5HGQ A;  2HBP A;  2BUD A;  1Y57 A;  4J9G A;  2OTJ A;  1NYG A;  3R07 A;  3OYF A;  4DBH A;  3JB9 G;  2DIQ A;  3OYK A;  2YLB A;  3QKJ A;  2OTL A;  1NJ2 A;  5GAM h;  2KDS A;  2H3E B;  2CP5 A;  2I4O A;  2FG0 A;  4QQD A;  2A8E A;  5GAO r;  4LE9 A;  3QXE B;  4MZP A;  4H2S A;  3UH0 A;  2ZT6 A;  2E4H A;  1KMM A;  3CBM A;  4F14 A;  3VQX A;  1R77 A;  2IVW A;  3EFS A;  4MZM A;  4YP0 A;  4C0Z A;  2CKK A;  3A1P A;  2RHU A;  5CCA A;  2L89 A;  4M77 F;  2RN8 A;  3CMA T;  2DRK A;  1JRI A;  2RHZ A;  2MI6 A;  1KC8 C;  3A31 A;  4LUD A;  1MND A;  2G6F X;  2Q5I A;  1WQW A;  1JJC A;  4JJN K;  1K8A C;  2YRV A;  1Y96 A;  1VQ6 T;  3LH0 A;  1PSF A;  1HYO A;  2O01 E;  2Z0W A;  4RMO A;  4WF2 A;  1NJ8 A;  5IHI A;  1YHQ T;  2CH4 W;  3EGX B;  2QQA A;  1H3H A;  1B70 B;  2A08 A;  2DK3 A;  1OU9 A;  5CKD A;  1SEM A;  2QHT A;  2LMJ A;  1KD1 C;  4A4H A;  2E3C A;  2L8D A;  4C92 A;  4KBM B;  1VQ4 Q;  2QQS A;  3E9F A;  1IO6 A;  1WHG A;  2EBP A;  4TQD A;  2XI9 A;  1PC0 A;  3BY7 A;  2QI2 A;  4NCX A;  1NJI U;  2LX9 A;  3X20 B;  5KYY A;  4GBQ A;  3G1Z A;  3I56 T;  3LWH A;  1EIY B;  4C5E A;  1GFC A;  4UP8 A;  2DYB A;  3QBY A;  1YHQ A;  1UG1 A;  3MEA A;  2NWM A;  2FPE A;  2K5I A;  2DBK A;  2JN0 A;  4QT7 A;  1FXX A;  2F5K A;  4H2W A;  3V8J A;  3E9I A;  2DXU A;  3LW5 E;  4KQE A;  4HCC A;  3CCS Q;  1E22 A;  4M78 B;  1AZE A;  3HRI A;  1L0W A;  5GMK h;  2AKL A;  2PMF A;  4PJO A;  3OYG A;  4D6W A;  1X54 A;  1WHK A;  5D7U A;  4OB0 B;  2FZC B;  3CCM Q;  4WJ3 M;  1VQM T;  4YRS A;  4AG2 C;  2ZT5 A;  2FYK A;  1EFW A;  3RER A;  2VWF A;  2QEX T;  2YXY A;  2HD0 A;  5I2S A;  2HEQ A;  1IL2 A;  4M78 E;  3I56 A;  2GGR A;  3MET A;  3NET A;  2DVJ A;  2KR3 A;  1YCY A;  1YI2 A;  1MMG A;  4LNP A;  1K9M R;  2M1H A;  2DL8 A;  2OX7 A;  4G84 A;  4YRO A;  3VS4 A;  2YWW A;  2AKW B;  3BFM A;  2P0L A;  1MMN A;  4C92 D;  5GAO l;  5LJ5 g;  3A7U A;  3QTC A;  1BK2 A;  1YNZ A;  3JCM P;  4HT9 A;  3HXW A;  1AWX A;  3LYI A;  4XTY A;  1FMW A;  3JCM X;  5IH2 A;  3P8D A;  1UB4 A;  4E47 A;  1BBW A;  2R57 A;  3JB9 F;  4BWA A;  2BZY A;  3JSC A;  2ZTG A;  4OP0 A;  4HVV A;  2E6Z A;  3CXC A;  1QVF P;  3OSS C;  4RTV A;  3HL8 A;  2ZZD A;  5GMK i;  2VKN A;  1R8O B;  4PJO D;  1K0X A;  4P74 C;  1BYM A;  2RK1 A;  1YJ9 T;  2RD1 A;  5HK3 A;  3PCO A;  2O9V A;  5I21 A;  2EKO A;  2D0Q B;  4RCC A;  3QO8 A;  1NLP C;  2YUQ A;  4X34 A;  1U1T A;  2WSE E;  3H0H A;  5C53 B;  3C94 A;  2CRE A;  1Q95 G;  1VQ8 Q;  5GAN d;  1USY A;  1C0A A;  5I22 A;  3L2V A;  1KMN A;  2RI5 A;  2RO0 A;  2M9U A;  1PKS A;  3FC3 A;  1OU8 A;  1VA7 A;  3JCM d;  2M02 A;  3QNE A;  2V8J A;  4PG3 A;  4M7A A;  2XDP A;  3OQ5 A;  1O9S A;  4N0A A;  1YJ9 A;  4CRI A;  4P3P A;  3RKX A;  2EQM A;  1N6A A;  2XG8 D;  4PLI A;  4LDU A;  1OI1 A;  2JT4 A;  2ZNJ A;  2NUP A;  1M4Z A;  2A3L A;  1WA7 A;  2DPP B;  3LLR A;  3OYD A;  1KQS P;  2AHJ B;  2XK0 A;  5GJW B;  5L8R E;  2EIF A;  3URG A;  1NM7 A;  5GAN e;  3PT9 A;  5IXF A;  2EYY A;  1HSQ A;  4P72 C;  4DEX A;  1I5L A;  5IXB A;  2CGH A;  5E3I A;  4MZT A;  2DF6 A;  2J3M A;  2MK5 A;  5A0D A;  1AWO A;  4L87 A;  4YRG A;  3PIO A;  1QP2 A;  4EMG A;  1AVZ C;  1AEY A;  4J6X A;  2XU8 A;  1N9S A;  4TVA B;  2IY5 B;  1W2B P;  4HWP A;  1DJ7 B;  1ZA1 B;  1ZUK A;  1FYN A;  1LPL A;  4XU1 A;  3JB9 I;  1B76 A;  5LJ3 d;  3VS2 A;  5CKE A;  3VUB A;  3VU3 C;  1PYS B;  1GCQ A;  4G85 A;  2D0N A;  1IZ6 A;  5ELN A;  3JB9 J;  4MML A;  3A32 A;  3RUX A;  1SES A;  4JLG A;  4M7A D;  1X56 A;  1X6G A;  2QYZ A;  3FB9 A;  5I2M A;  2MIO A;  1X2G A;  3RR6 A;  3V7C A;  4K11 A;  1VQ4 T;  4P73 C;  4KGZ B;  4Z89 A;  1YIJ T;  4KUD K;  4C5I A;  4KUI A;  2HAX A;  1Q86 U;  2CYZ B;  5CQY A;  4EO4 A;  3H8Z A;  1D09 B;  1ZX6 A;  2DXC A;  1X01 A;  3DSQ A;  1XOV A;  1ZSG A;  2KNB B;  2RMO A;  1MHN A;  2F2V A;  4N4H A;  4A4E A;  2VXE A;  1VQP Q;  1KSW A;  3OB9 A;  3CCS T;  1K4U S;  2E12 A;  3CME T;  2X51 A;  3KUF A;  1I07 A;  1NJI C;  2AIR B;  3E19 A;  4RG8 A;  5LJ5 d;  1RAE B;  4M78 C;  3CMQ A;  3VQY A;  4LDV A;  1VQ4 A;  3VJP A;  2RHS A;  2JZ2 A;  4F7U A;  1YIJ A;  2B86 A;  3CCV T;  3NEL A;  1CKB A;  4J6Y A;  3NTH A;  3MQZ A;  4RCB A;  2LDM A;  5D6X A;  2WSF E;  4OLF A;  2EYW A;  2E1H A;  1K1Z A;  1I4K 1;  1EZZ B;  3OMC A;  1X75 C;  1WXU A;  3REX A;  5LJ5 e;  2DTI A;  3CCS A;  3VS5 A;  1ZUU A;  5I11 A;  3KXT A;  2MF2 A;  4PFO A;  3CME A;  1G83 A;  3QZ9 B;  1JJC B;  1PG5 B;  1UFF A;  4PJJ A;  4FW1 A;  3OYA A;  1Y96 B;  3OYY A;  4HT8 A;  4H02 A;  4KH0 B;  1BCM A;  3V8L A;  4HVW A;  2LP5 A;  8ATC B;  2W10 A;  5KYW B;  1WIE A;  2HNI A;  1IGU A;  2CZ0 B;  1M5Q 1;  2X9H A;  1M1K U;  1YFT A;  4P75 A;  3PTA A;  4J8O A;  4IKF A;  3BE3 A;  1TUD A;  3HXX A;  3CCV A;  2EQK A;  5GAN 3;  3CCU A;  5KH6 A;  4FT4 A;  1M2O A;  2BE7 D;  1TUG B;  4M75 A;  1D0Z A;  3MEY A;  1X2K A;  3JCM f;  4M7D D;  1YGB A;  1VUB A;  3X25 B;  4C92 B;  4JRK A;  5L23 A;  1RIQ A;  4IIO A;  1NJ5 A;  3G71 T;  2FB7 A;  5KYY B;  3FJP A;  4C8Q F;  4M78 G;  1SRM A;  3TVT A;  2DM1 A;  1VQ8 T;  2J6F A;  4QVC A;  3OYI A;  4C92 E;  1N8R U;  1NJ6 A;  4ATO A;  2EJG A;  1JB0 E;  2VV5 A;  2DEQ A;  4PJO B;  1IRX A;  2ZPF B;  2LNV A;  1E7O A;  3S3N A;  4AG1 C;  2DU5 A;  4H2V A;  4UPA A;  1KOG A;  1UGS B;  4M77 A;  2ENM A;  1R0B G;  1M90 R;  5KYX A;  3OYH A;  4B9X A;  4TTV A;  4CH3 A;  3DLL A;  1C0M A;  3G71 A;  2ART A;  5LJ3 f;  3L2U A;  2HQE A;  2ZIN A;  4JS5 A;  2ROT A;  4M75 D;  1GRI A;  1VQ8 A;  3VBB A;  1GBR A;  4LD6 A;  4F04 B;  3F70 A;  3GIB A;  2DU7 A;  3M0R A;  5K1P A;  3JCM V;  4CC3 A;  1Y07 A;  1WXT A;  4QKU A;  3M4Q A;  2SEM A;  2ZZG A;  1WPY A;  3V7S A;  4IUU A;  4XU2 A;  4OMN A;  3HSB A;  4E7S A;  4XEO A;  1F1B B;  1PHT A;  2DRM A;  2E10 A;  4R56 A;  1EVL A;  1IB8 A;  2EFI A;  2CH4 A;  3QJY A;  4JZ4 A;  1W1F A;  1AHJ B;  7AT1 B;  2FPF A;  5FRO A;  2Y4Y A;  1Y71 A;  3HXZ A;  2KGT A;  2XDD A;  3L42 A;  3VKI A;  1EFN A;  4V2S A;  2EL9 A;  3A8O B;  2JTF A;  12AS A;  4TQF A;  2R58 A;  1D1B A;  1H92 A;  2E5A A;  5GAO n;  4L59 A;  4YRR A;  4HCB A;  2K3Y A;  3EAE A;  1N9R A;  1RAG B;  1S72 Q;  3PCO B;  3HFO A;  4RKU E;  1QVP A;  2GF7 A;  4DEY A;  4K86 A;  4M4Z A;  5CVI A;  1RL2 A;  4K87 A;  3HP9 A;  3WQZ A;  1B34 B;  1J3T A;  3CPW P;  3VQV A;  2RK2 A;  3HRU A;  4LVM A;  2FZG B;  1JJ2 S;  3JCM J;  2K2V A;  1VQP T;  4RMF A;  2F2W A;  1ZLM A;  4YRE A;  2KT8 A;  5DLQ E;  3L1A A;  1RAI B;  3MP6 A;  1HD3 A;  5KCH A;  1Q86 C;  2D6F A;  3INZ A;  4M7A B;  4PJL A;  4CC2 A;  1Q81 R;  4O2D A;  1VQ7 Q;  4XU0 A;  1I81 A;  4JRI A;  4LVL A;  1MV0 B;  1YWO A;  3ZL7 C;  5K1X A;  1FMK A;  2NUP B;  4GLM A;  2ZZE A;  1VQK T;  3PVQ A;  5HKC A;  5KCO A;  4OGC A;  1VQ9 A;  2PVD B;  3DKM A;  2CJB A;  2LJ1 A;  2HSE B;  3JCM Q;  2ZR3 A;  4X1V A;  4CS3 A;  3VQW A;  3KFU A;  3DLM A;  4Q5W A;  1VQP A;  1W6X A;  2BTT A;  2L5Q A;  3CC2 Q;  4M78 F;  4YRC A;  3OYE A;  1RI9 A;  5FW9 A;  2H3J A;  1RUW A;  2CS7 A;  1RAF B;  2E64 A;  2ZIM A;  1JJ2 A;  3M58 A;  2O2O A;  3G4S Q;  3RAC A;  5KYN A;  3UGQ A;  4KR3 A;  3P8T A;  3FJ5 A;  2KRO A;  2K79 A;  2EGC A;  1SKU B;  1VQK A;  3UF4 A;  3QG1 A;  3ZEH A;  4LUE A;  2RHQ A;  1GXI E;  1KG1 A;  1KQ2 A;  1ADJ A;  2K4Y A;  2ZT8 A;  1Q7Y U;  5GAN 4;  3QZ5 B;  1U06 A;  2RA2 A;  1OV3 A;  1WXB A;  5GAN g;  4FYY B;  4DBQ A;  1M1K C;  1G5V A;  1RLP C;  5GAN 5;  1Z7M A;  2RJC A;  3FEO A;  4OMO A;  1QW1 A;  2K3X A;  4C92 C;  2F1L A;  3JCM g;  1T0H A;  2E65 A;  4HWT A;  2MPX C;  4E7I A;  2I0N A;  1MGQ A;  4O5V A;  4YTL A;  1YBY A;  2O88 A;  3JV3 A;  2Y90 A;  1WZO A;  4UP7 A;  2DZC A;  2JTM A;  2NYS A;  2QTV A;  3CC4 Q;  2X4Y A;  2JM8 A;  3CCR Q;  1NZ9 A;  2QA4 Q;  3JB9 D;  1ZBX A;  4CC7 A;  3AT1 B;  1IRE B;  1H4T A;  1M8V A;  2KQW A;  4IUV A;  3TEE A;  4BE0 A;  5HCK A;  2EYX A;  5KYU A;  2QG9 B;  1BIA A;  4ESR A;  4M7D B;  1TWB A;  2LQN A;  2DTO A;  4PJO C;  1YJW Q;  3C0C A;  1I8F A;  2QHS A;  3CMA A;  4F7U B;  1N8R C;  3QJ6 A;  2CZ1 B;  2DLP A;  4BD3 A;  1WFW A;  2DL4 A;  2QK0 A;  3MO8 A;  4LDX A;  2IPO B;  1H4V B;  1WNL A;  2DYI A;  4WTO B;  4M7D E;  2X4W A;  1UDL A;  1VQ6 A;  2DIL A;  2ED0 A;  4A4G A;  1PM3 A;  5LJ3 g;  1ATI A;  1C6V X;  1TU0 B;  4TVR A;  2M16 A;  3LWI A;  1AOJ A;  1LNX A;  1QVG P;  1N27 A;  1ZBJ A;  2M0Y A;  4P71 A;  1W70 A;  2R5A A;  4EX5 A;  1SHF A;  1QKX A;  4IUR A;  2CUB A;  3CXC S;  1EX4 A;  2A28 A;  2VB6 A;  4C92 G;  2D8J A;  3RL6 A;  4J5Y A;  2MCN A;  4AFQ C;  3M4P A;  3MHX A;  1KC8 R;  1BU1 A;  2GTJ A;  3SHW A;  1B7Y A;  3ERR A;  4M75 B;  3JCM c;  3MJX A;  3HFN A;  1NNH A;  1OX8 A;  3H6Z A;  4E7L A;  2XGT A;  1S72 T;  2X3W D;  4MDX A;  1H8K A;  4OB2 B;  4KUL A;  1M90 U;  2KT1 A;  4DOW A;  2KY9 A;  3OBY A;  2CSI A;  3EGD B;  3G1J A;  3CCJ Q;  1YP5 A;  3VYG A;  4PJO G;  1NEG A;  4FU6 A;  2ARS A;  2W0Z A;  1E6H A;  3PFS A;  5C0M A;  4P3N A;  2X35 A;  2ATC B;  2EQI A;  1VQM A;  2ODR D;  1KD1 R;  1H4S A;  2HSP A;  2DZ9 A;  2QEX A;  3MP8 A;  1WQ7 A;  1N5Z A;  3A7R A;  1EVK A;  1WU7 A;  2KRN A;  1RI0 A;  3IAL A;  1VQ7 T;  1S72 A;  2RQW A;  1UGR B;  1BI0 A;  4PNO A;  3JCM W;  4PHC A;  4M7A C;  2AK5 A;  3LSQ A;  4EMK A;  1D0X A;  5KYX B;  4JJB A;  1WYX A;  1WJR A;  1NPR A;  2QTX A;  5ECA A;  2E3I A;  2A7Y A;  1OPK A;  4OML A;  2C06 A;  1X6B A;  5KE2 A;  2JS2 A;  3HTR A;  5A2Q E;  1LYL A;  1VYV A;  1ZUY A;  1VQN T;  4Q6G A;  2A36 A;  1QVF S;  3OW2 P;  4JS4 A;  1D0Y A;  1QLY A;  3HTZ A;  3CC2 T;  1GL5 A;  3CCL Q;  5CKH A;  4ZTZ B;  5A0L A;  11AS A;  1PCX A;  1WJQ A;  3G4S T;  4K88 A;  4BUG A;  2MWP A;  4ANJ A;  4YRN A;  2L0A A;  5D6W A;  2Y4X A;  2L3S A;  1G2B A;  3EG9 A;  3QWX X;  2DL3 A;  3NGP A;  2KVQ G;  3QSU A;  4OMF B;  3RBB B;  1WYD A;  1ACM B;  2AKK A;  2K57 A;  2DD5 A;  1UEC A;  4HXJ A;  1BBZ A;  4C8Q A;  3OD1 A;  1VQN A;  1VQL Q;  1KHI A;  3QPH A;  4EIK A;  1NYF A;  2LX7 A;  2RJD A;  1LJO A;  4J9D A;  1Q81 U;  3REB B;  3TSZ A;  1M8M A;  4RTT A;  3JCM e;  1VYT A;  2EJ9 A;  1TSF A;  3QWY A;  4XTU A;  3G4S A;  2OAU A;  3EG3 A;  2EYZ A;  1QVF A;  1NLO C;  3M54 A;  1Q7Y C;  1U3O A;  2DXB A;  4BI3 A;  3CC4 T;  2QGF B;  4M7A G;  2ABL A;  3THK A;  1KQS S;  1G3W A;  2VAS A;  2QA4 T;  3RES A;  3HPW A;  2K6D A;  2K7A A;  3GOX A;  4XK8 E;  4AFU C;  2LTO A;  5FRM A;  4DPG A;  2YUP A;  4TWA A;  2ZPG B;  2C8M A;  4C92 F;  3QO3 A;  2PNI A;  4YCU A;  1Q82 R;  1X2Q A;  4RTW A;  3WVE B;  3AHU A;  2D9T A;  4ZTU B;  4ZNX A;  4M7D C;  2AMC A;  1BKB A;  4XTW A;  1OX9 A;  4E7H A;  1V76 A;  1K73 R;  4H2T A;  1JXO A;  1SET A;  4HWR A;  2ECZ A;  4NOY A;  5GAN j;  5A0G A;  3H41 A;  2X4J A;  1KHC A;  2QHV A;  4JJC A;  3CC4 A;  3M0P A;  2KYB A;  4C8Q D;  3MKD A;  4LNS A;  4ZN3 A;  2RH2 A;  5LJ3 e;  2RQV A;  4C5G A;  4J9E A;  2BKD N;  4IUP A;  1B7T A;  3I9Q A;  1V1C A;  4OB3 B;  4OB1 B;  5HK0 A;  4OF1 A;  2QHU A;  1B07 A;  1KQS A;  3CC7 Q;  3CD6 Q;  2KRM A;  2CP7 A;  4LD9 K;  4J7I A;  3V8K A;  4A4K A;  3HRT A;  4KH1 B;  2E41 A;  5ELO A;  4QVZ A;  1E24 A;  2SRC A;  3CCM T;  1MUZ A;  1W66 A;  5GAM d;  1G8X A;  3H0I A;  2NUT A;  2RHQ B;  1NPP A;  8AT1 B;  4E2F B;  2P0P A;  4P75 C;  3SWN A;  2CP3 A;  3RMS A;  1Y7X A;  4DBR A;  2KE9 A;  2LC4 A;  3QDR B;  1PWT A;  2BZ8 A;  1BBU A;  2EGE A;  2PTK A;  4M75 C;  2LT1 A;  1W2B A;  2E3H A;  1X55 A;  2Q5H A;  2GQI A;  2JXB A;  1IXD A;  2HQX A;  2CT4 A;  4Z88 A;  3CCE Q;  2P84 A;  3HFV A;  4YRM A;  2RF0 A;  3UA7 A;  3A98 A;  1HJD A;  3CCM A;  4M7D G;  4JLI A;  5HY6 A;  2MAM A;  2VGM A;  1MV3 A;  1YFS A;  3X28 B;  2LJ3 A;  2RM4 A;  1M90 C;  3FRN A;  2XIC A;  5EC7 A;  2JUF A;  5KYU B;  2DTH A;  2CIM A;  2K5L A;  3OYC A;  4RTX A;  3NHN A;  2LCL A;  1G5H A;  1UTI A;  2B8A A;  1PD0 A;  2QAS A;  1SSF A;  3PE0 A;  1X2H A;  4M78 A;  3H9N A;  5GMK m;  2MYS A;  3M55 A;  5LL6 S;  2V26 A;  4HVU A;  1SPK A;  2OI3 A;  2VC8 A;  2ZAE A;  1NE8 A;  3RF1 A;  9ATC B;  1Y0M A;  2HCK A;  4PL6 A;  4YRL A;  1O75 A;  3ASK A;  1J5W A;  1T3S A;  1NJI R;  5LJ5 j;  1ARK A;  3QYH B;  4UP9 A;  5IAY A;  3CCL T;  3MPU B;  1ASZ A;  4RUG A;  1K9M U;  4M7A F;  3E9G A;  3ER0 A;  3RMQ A;  2HBW A;  3E9H A;  1UEB A;  2FHD A;  4C0F A;  5C6S A;  1X69 A;  2VXF A;  3UT1 A;  3OY9 A;  1R0C B;  2IG0 A;  1ZSZ A;  2RPN A;  3GNF B;  5DLO A;  2PUO B;  3LSS A;  4AH6 A;  3LH5 A;  3S3O A;  4CS2 A;  4J6W A;  3QII A;  1MNE A;  3CEY A;  2ZT7 A;  1B7Y B;  3QUI A;  4DBF A;  4JDS A;  3HKS A;  1VQL T;  4FYW B;  1VIF A;  1YHQ Q;  4RQE A;  2YRC A;  3VS6 A;  1XQH A;  3SB2 A;  4PJO E;  2I4L A;  2CZ6 B;  2QDL A;  3X24 B;  3I5S A;  4J9I A;  3ZBD A;  3CCL A;  4MDW A;  3LX7 A;  3HXU A;  1AD5 A;  1JU5 C;  2RI2 A;  1RAC B;  5FU7 B;  5GMK e;  2GTO A;  3M0T A;  4YRP A;  1UHC A;  1UGV A;  2L3P A;  1H4Q A;  5IHK A;  4F16 A;  1Q81 C;  1UJ0 A;  2J05 A;  5IN1 A;  1WLE A;  2GBQ A;  4Q15 A;  1U8R A;  4YCW A;  2CP2 A;  3L4G A;  5C51 B;  3I56 Q;  1UHF A;  2F5T X;  4NS5 A;  1PRL C;  1YI2 Q;  5GAN h;  1YJN Q;  3RGL A;  4FM4 B;  2J6O A;  3SDZ A;  2ZZF A;  1KFZ A;  3OYM A;  4EMK B;  3JCM h;  3CCQ Q;  1SER A;  1NYR A;  4YRF A;  4M77 D;  4PJN A;  5GAM f;  2V1R A;  5C52 B;  2YUN A;  4EMH A;  1K9A A;  1KQ1 A;  2GQV A;  2NS6 A;  1WHJ A;  2ZCE A;  2KBT A;  3SD4 A;  4YRI A;  3UA6 A;  3EHR A;  2J3L A;  2CP0 A;  3VRY A;  2XHC A;  4OMP A;  4AT1 B;  2DE0 X;  1E1T A;  3CC7 T;  4M7D F;  2MOX A;  1E6G A;  3M56 A;  4CI0 C;  5DM7 R;  1SHG A;  1B8A A;  1W4S A;  4GY5 A;  3H0F A;  2BIV A;  3TSW A;  3UGT A;  4KRT A;  4J7F A;  2FRW A;  1SRY A;  4P3O A;  3EG9 B;  4DOV A;  4ZTF A;  4L5G A;  1SG5 A;  5GAN 7;  2ED1 A;  2PME A;  4J9F A;  1X6O A;  3CPW S;  2V1Q A;  4XTV A;  4TVA A;  3FLG A;  4FIB A;  3MEV A;  4X5O A;  4C0G A;  2LJ0 A;  4CS4 A;  1XTD A;  2FPD A;  1M3A A;  4AFZ C;  4C8Q B;  3OSV A;  2KK4 A;  2EPD A;  5LJ3 h;  2FRY A;  4A54 A;  4M7A E;  1UGQ B;  3NFC A;  3HRK A;  4HCK A;  4PKC C;  2DFU A;  1Q82 U;  2V8I A;  1AWJ A;  5AT1 B;  3T9N A;  4JUV A;  3RNJ A;  3NEN A;  3E2U A;  3MP1 A;  3CCE T;  1YIT Q;  3N5B B;  1K73 U;  2RHY A;  1GFD A;  4ZGD B;  1JQQ A;  3GNG A;  3EG2 A;  3WXM B;  1OOT A;  4QW2 A;  4OGE A;  2NLU A;  3NEM A;  1YJ9 Q;  2FEI A;  4E7J A;  4H2U A;  4RQF A;  4CH4 A;  2EQU A;  2ZGW A;  2O31 A;  2FZK B;  4L6V 5;  2DQ0 A;  1AWW A;  4A4F A;  3LGL A;  3JB9 H;  4BE2 A;  3EFR A;  2P4T A;  2E6N A;  1JBM A;  3REA B;  2COY A;  3IKM B;  2CUD A;  1BCO A;  1VQZ A;  3NPF A;  2C0I A;  3G6E Q;  4BDY A;  2I4N A;  1EQR A;  1QCF A;  5GJV B;  2PUK B;  3GLX A;  4BI4 A;  5CR2 A;  3CPW A;  4CH6 A;  2G4C A;  1XNI A;  3A5Z A;  2AMC B;  3VS3 A;  3PZC A;  3IQL A;  3I35 A;  5LJ5 h;  3CCE A;  1VQO Q;  3M0S A;  1HXD A;  3HXY A;  1AZG B;  4CH5 A;  1BIB A;  1JO8 A;  1TH7 A;  4HWS A;  1Q86 R;  2ALY A;  4AFS C;  4TVY A;  1G3Y A;  1M1G A;  3GBQ A;  2X4X A;  3PVL A;  1UUE A;  2CJ9 A;  2ODR C;  1OEB A;  1TS9 A;  2EVR A;  2AZS A;  3OMG A;  2FVU A;  3BDU A;  1WX6 A;  4HA8 A;  1TOV A;  4LVK A;  4II1 A;  4P71 C;  6AT1 B;  4Y92 A;  2VVK A;  2NUT B;  2X3X D;  3LC0 A;  3OYN A;  1X27 A;  3SWN B;  2RHS B;  3M9Q A;  2PZ1 A;  1GCP A;  1K9M C;  2C0O A;  1S1N A;  1H3Z A;  1M2V A;  5KYW A;  4J15 A;  4RG2 A;  3S3M A;  4HCZ A;  4JPB W;  2RQR A;  5AYF A;  2KRS A;  3A8M B;  2JJ9 A;  4A63 B;  1QP3 A;  3C95 A;  4VUB A;  2J6K A;  2YLC A;  3PNW C;  4F7U E;  1I5O B;  4XU3 A;  1YFR A;  2I4M A;  2DER A;  5FU6 B;  5FU7 C;  1VYU A;  2O4X A;  1D1C A;  2FO0 A;  4NL2 A;  3JAM E;  3TEH A;  2EYQ A;  3CXC P;  1A0N B;  3GP8 A;  2KYM A;  2HL3 A;  1YIJ Q;  2EGA A;  2QQB A;  3P8V A;  1ZQ1 A;  4Y91 A;  3MF2 A;  1WHL A;  2C0T A;  1M1K R;  3NTI A;  1RAB B;  1YI2 T;  2CDT A;  2CP6 A;  1YJN T;  3EH2 A;  3ULR B;  2JS0 A;  4J9C A;  2EKH A;  3OS2 A;  5FLX E;  4Z8A A;  2H8H A;  3GF5 A;  1QVG S;  3CCQ T;  1Z9Z A;  3OBW A;  4PJM A;  3HHT B;  3O8V A;  4ZTJ A;  3CME Q;  1K8A R;  2ROL A;  3J7A F;  1H64 1;  5CO7 A;  4EMK C;  4YDQ A;  4YRK A;  2GFA A;  1KK7 A;  2HL5 C;  2ZXF A;  2OAW A;  2P0Q A;  3VUZ A;  4H2X A;  4ZIB A;  2VYT A;  4C0D B;  1QCN A;  2RHX A;  1SF9 A;  1YCS B;  1D3B A;  4M75 E;  4BE1 A;  1QF6 A;  3RKY A;  3SEM A;  5GAM g;  2KAF A;  4LN2 A;  3CCV Q;  2NUZ A;  2YSQ A;  3CCU Q;  3W3S A;  4YRJ A;  3VRZ A;  1YJN A;  1N8R R;  2ZNI A;  4BW9 A;  2DBM A;  1ZHI A;  2QQ9 A;  3I55 Q;  3TCJ A;  2LQ8 A;  3QHS A;  1USY C;  1LCK A;  2AT1 B;  3J81 E;  2EAY A;  1ZSZ B;  3CCQ A;  2LCS A;  4Y28 E;  2XKO C;  2LCC A;  4M77 B;  3HY0 A;  3HXV A;  3PMT A;  1YB3 A;  3VS7 A;  2WAC A;  4N0A C;  1TXQ A;  3OA6 A;  4XTZ A;  2E5Q A;  3CQT A;  3EG1 A;  4ME7 A;  1U1S A;  1K76 A;  5KNN A;  1WLP B;  1QVG A;  1MMD A;  2COZ A;  3TUP A;  1TUC A;  2G3R A;  4JJD A;  4C8Q C;  3EGU A;  2DAQ A;  1GBQ A;  2HDA A;  2JNG A;  2DEU A;  2WSC E;  4KR2 A;  4PK4 A;  2DVE A;  4M77 E;  1NJ1 A;  2LNH B;  5GAN 8;  5F5W A;  4N4I A;  2ZPH B;  5GAO q;  1YIT T;  1I0C A;  4FL6 A;  1QMC A;  2OJ2 A;  2MWO A;  3I7F A;  3IG2 A;  4FSX A;  1BI2 A;  2HMA A;  1VQ7 A;  3G7Z A;  3R6O A;  2KSS A;  2PVO B;  3MEU A;  5GAO p;  1Q82 C;  3L4G B;  3M53 A;  5CAI A;  3G71 Q;  1B34 A;  2EW3 A;  3BDL A;  3G6E T;  4YRT A;  1K73 C;  2AZV A;  4HVC A;  3OW2 S;  4D8D A;  1YFN A;  5IT9 E;  3HFZ A;  2A37 A;  1IHV A;  4BI8 B;  3RIR A;  2D8H A;  1ASY A;  1T3L A;  4LVI A;  1GCQ C;  5GAN 6;  2QQR A;  1VQO T;  1YIT A;  3M59 A;  3CC2 A;  3PGG A;  4QQ6 A;  3LGF A;  4P74 A;  2GCX A;  2HQH A;  4NL3 A;  4A53 A;  3E1S A;  1HK9 A;  1M27 C;  4ELZ C;  1G3T A;  4KGX B;  3JRZ A;  1SRL A;  2LQW A;  3EFO A;  1OZ2 A;  1OPL A;  3FDR A;  4FYV B;  2K2M A;  1WHM A;  2ESW A;  1LOJ A;  1FYF A;  4WCI A;  3CCR T;  4EDU A;  3G6E A;  2P4R A;  1SSH A;  4CC4 B;  2LT4 A;  4YCV A;  3VV0 A;  1TTH B;  2E5K A;  2DNU A;  4C8Q G;  2K9G A;  2K5F A;  1QWF A;  3REU A;  2BE9 B;  2DO3 A;  1KIK A;  3TRE A;  1VQO A;  2DIG A;  1YJW T;  4J9B A;  5GMK l;  3VS0 A;  3OW2 A;  4FW2 A;  3JCM b;  2CSQ A;  2DKG A;  5CIU A;  5GAO m;  1NYQ A;  2KMT A;  1NG2 A;  2CZ7 B;  1T0J A;  5DY9 A;  3SWN C;  3M0U A;  1P92 A;  1W2B S;  2RQT A;  1PSE A;  2JM9 A;  3RDV A;  1IHW A;  2L2P A;  2L3Q A;  3EHQ A;  3MCA B;  4WI1 A;  2KXD A;  3M4Y A;  2QGG A;  1U5S A;  2LZ6 B;  3CCR A;  5FRN A;  1XJW B;  2QA4 A;  1VQ5 Q;  3R6N A;  1UE9 A;  4P72 A;  1WHH A;  5CQX A;  3P8B B;  5CKB A;  2RJF A;  2DET A;  2M51 A;  4FSS A;  4PJO F;  4FYX B;  3SFM A;  3A5Y A;  5EG2 A;  3C4S A;  2PVG B;  5CKF A;  3VS1 A;  3CPF A;  5FU6 C;  2C7I A;  2JOY A;  4RDX A;  1YJW A;  2YRD A;  4LDY A;  1CKA A;  3EH1 A;  2RQU A;  3Q1J A;  4O6J A;  2Q7G A;  4YYE A;  4OMM A;  2JVV A;  1VQ9 Q;  1QQJ A;  3FIF A;  4QQG A;  2ZPI B;  4E51 A;  2Q7E A;  2Q7H A;  4LDW A;  3D7S B;  5J3B A;  3A5Z B;  1M3C A;  2F2X A;  1QWE A;  1Q7Y R;  5M9O A;  3UFG A;  3EGX A;  2DL5 A;  4BY6 B;  2KEA A;  2HKQ B;  3DB4 A;  4M7D A;  1B70 A;  4EPC A;  2OTJ Q;  1RLQ C;  2A0F B;  2LVM A;  5LJ3 j;  1BI1 A;  2I2L A;  2OTL Q;  3A7A A;  4MMK A;  5GAM e;  3I5R A;  4P73 A;  3CCJ T;  2GNC A;  2IIM A;  4C0D C;  1WGS A;  1OYX A;  1PKT A;  2YT6 A;  3L2W A;  1JXM A;  1VQK Q;  2ALY B;  2ZR2 A;  1PRM C;  4JRQ A;  4IUT A;  4OMQ A;  3CCU T;  3KBG A;  1M9S A;  2DL7 A;  2EWN A;  2LQK A;  2QDY B;  4XAX B;  2YDL A;  4F7U G;  2ZIO A;  3I55 T;  3PMI A;  3V7R A;  1WJS A;  1EIY A;  3M5A A;  4YRQ A;  3OS1 A;  2GFU A;  4B9W A;  5J26 A;  1K0S A;  1RAH B;  3TEG A;  1ZSZ C;  2DQ3 A;  2DJZ A;  2CJA A;  3PIP A;  3OYJ A;  4M77 C;  2JMC A;  1M2V B;  1G3S A;  1UJY A;  4PFZ A;  1G51 A;  4WJ4 A;  4J83 A;  4LXC A;  2FL7 A;  3CCJ A;  2COW A;  2EJF A;  3UAT A;  4H2Y A;  2DXT A;  2YHT A;  4QVD A;  3ZFJ A;  4BDZ A;  1KC8 U;  3RKW A;  5GAN f;  4IUQ A;  2XTI A;  2JW4 A;  1Z9Q A;  5GAM j;  4R0K A;  1K8A U;  3I55 A;  1YN8 A;  1C1A A;  4IIM A;  1FMV A;  1ABQ A;  2O4X B;  3TU4 K;  1EIF A;  3QYG B;  3ICA A;  4E6R A;  2JMA A;  3TEH B;  3OS5 A;  2RHI A;  4D8K A;  3CMA Q;  3X26 B;  4OVA A;  4M75 G;  2DJQ A;  2AKW A;  2DDZ A;  4ZGJ B;  3BW1 A;  4XEM A;  3EGD A;  4BAC A;  3UWN A;  4E7Z A;  3CBO A;  3M0Q A;  2XD0 A;  1M3B A;  4PFP A;  1VQ6 Q;  1UGP B;  1KD1 U;  2BZX A;  1V29 B;  3KFV A;  3M4G A;  2XID A;  2RB6 A;  3WVD B; 
#chains in the Genus database with same CATH homology
 4HKE A;  1BI3 A;  2F69 A;  2P0K A;  5CK9 A;  1Z7N A;  4X9C A;  4H2X B;  4M78 D;  2PQW A;  1HC7 A;  5D6Y A;  1D3B B;  4XQ3 A;  4HWO A;  3QO7 A;  3CBP A;  4ZGE B;  5KE3 A;  4M77 G;  3C12 A;  3S6W A;  3L2R A;  2L3R A;  4C5H A;  2E70 A;  3P8Y A;  2R5M A;  4PLL A;  3DB3 A;  5GAN 2;  3VYH B;  2M0O A;  4KT0 E;  4DQ2 A;  1VQL A;  1EOV A;  2VUB A;  4JRP A;  2ARU A;  4DA4 A;  1FWZ A;  3A8H B;  3UDC A;  3HRS A;  4FT2 A;  3L2Q A;  2XDB A;  3HY1 A;  2RI3 A;  4Z02 A;  3P8H A;  4GLK A;  3BJU A;  3OYB A;  4X9D A;  4N4G A;  1VQ5 T;  1G5I A;  5GMK j;  1M1F A;  4XTX A;  1ADY A;  2PU9 B;  4P5N A;  3OYL A;  5LJ5 f;  3A8L B;  4ZN1 A;  3CD6 T;  1GGM A;  5J39 A;  2QXF A;  3A8G B;  3UPU A;  4TVW A;  4F7U F;  3QO5 A;  2V8K A;  1VQ9 T;  1HTT A;  4R55 A;  3ME9 A;  3HFZ B;  2IY5 A;  1OZ3 A;  2DD4 A;  3A74 A;  4LVJ A;  1VQ5 A;  4YPF A;  3MEW A;  3M57 A;  3J80 E;  4HT4 A;  2ZCF B;  4BB7 A;  1PYS A;  2OTJ T;  4BY6 C;  2ZPE B;  2ZPB B;  3CC7 A;  1VIE A;  3CD6 A;  2OTL T;  2VGN A;  4C8Q E;  2LRQ A;  2P5I A;  4ELY C;  1FX7 A;  3L2Z A;  3GPL A;  2MMP A;  3NTK A;  3OS0 A;  4UC4 A;  4M75 F;  4E7K A;  1QE0 A;  1N9W A;  3MF1 A;  2RJE A;  2EQJ A;  3IKL A;  1E1O A;  5HGQ A;  2HBP A;  2BUD A;  2OTJ A;  3R07 A;  3OYF A;  3JB9 G;  2DIQ A;  3OYK A;  2YLB A;  3QKJ A;  2OTL A;  1NJ2 A;  5GAM h;  2KDS A;  2I4O A;  4QQD A;  2A8E A;  5GAO r;  3QXE B;  4MZP A;  4H2S A;  3UH0 A;  2ZT6 A;  1KMM A;  3CBM A;  3VQX A;  2IVW A;  3EFS A;  4MZM A;  4YP0 A;  4C0Z A;  2CKK A;  2RHU A;  5CCA A;  2L89 A;  4M77 F;  3CMA T;  1JRI A;  2RHZ A;  2MI6 A;  1KC8 C;  3A31 A;  2Q5I A;  1JJC A;  1WQW A;  4JJN K;  1K8A C;  2YRV A;  1Y96 A;  1VQ6 T;  3LH0 A;  1PSF A;  2O01 E;  4RMO A;  4WF2 A;  1NJ8 A;  1YHQ T;  2QQA A;  1B70 B;  2DK3 A;  5CKD A;  2QHT A;  1KD1 C;  4A4H A;  2E3C A;  2L8D A;  4C92 A;  4KBM B;  2QQS A;  3E9F A;  4TQD A;  2XI9 A;  3BY7 A;  2QI2 A;  4NCX A;  1NJI U;  2LX9 A;  3X20 B;  3G1Z A;  3I56 T;  3LWH A;  1EIY B;  4C5E A;  4UP8 A;  3QBY A;  1YHQ A;  3MEA A;  2K5I A;  2JN0 A;  1FXX A;  2F5K A;  4H2W A;  3V8J A;  3E9I A;  2DXU A;  3LW5 E;  4KQE A;  4HCC A;  1E22 A;  4M78 B;  3HRI A;  1L0W A;  5GMK h;  2PMF A;  4PJO A;  3OYG A;  4D6W A;  1X54 A;  4OB0 B;  4WJ3 M;  1VQM T;  4YRS A;  2ZT5 A;  2FYK A;  1EFW A;  3RER A;  2QEX T;  2HD0 A;  5I2S A;  1IL2 A;  4M78 E;  3I56 A;  3MET A;  3NET A;  1YCY A;  1YI2 A;  2M1H A;  4G84 A;  4YRO A;  2AKW B;  3BFM A;  2P0L A;  4C92 D;  5GAO l;  5LJ5 g;  3A7U A;  3QTC A;  4HT9 A;  3JCM P;  3HXW A;  3LYI A;  4XTY A;  3JCM X;  3P8D A;  1UB4 A;  4E47 A;  1BBW A;  2R57 A;  3JB9 F;  4BWA A;  3JSC A;  2ZTG A;  4OP0 A;  2E6Z A;  3CXC A;  3OSS C;  3HL8 A;  2ZZD A;  5GMK i;  1R8O B;  4PJO D;  4P74 C;  1BYM A;  2RK1 A;  1YJ9 T;  2RD1 A;  5HK3 A;  3PCO A;  5I21 A;  2EKO A;  2D0Q B;  4RCC A;  3QO8 A;  4X34 A;  1U1T A;  2WSE E;  5C53 B;  3C94 A;  5GAN d;  1USY A;  1C0A A;  3L2V A;  1KMN A;  2RI5 A;  2RO0 A;  2M9U A;  3FC3 A;  3JCM d;  3QNE A;  2V8J A;  4PG3 A;  4M7A A;  2XDP A;  3OQ5 A;  1O9S A;  4N0A A;  1YJ9 A;  4CRI A;  4P3P A;  3RKX A;  2EQM A;  1N6A A;  2XG8 D;  4PLI A;  4LDU A;  1OI1 A;  2ZNJ A;  1M4Z A;  2A3L A;  3OYD A;  2DPP B;  3LLR A;  2AHJ B;  2XK0 A;  5L8R E;  2EIF A;  3URG A;  5GAN e;  3PT9 A;  4P72 C;  1I5L A;  2CGH A;  5E3I A;  4MZT A;  2J3M A;  5A0D A;  4L87 A;  4YRG A;  3PIO A;  1QP2 A;  4EMG A;  4J6X A;  2XU8 A;  1N9S A;  4TVA B;  2IY5 B;  4HWP A;  1DJ7 B;  4XU1 A;  3JB9 I;  1B76 A;  5LJ3 d;  5CKE A;  3VUB A;  3VU3 C;  1PYS B;  4G85 A;  1IZ6 A;  5ELN A;  3JB9 J;  4MML A;  3A32 A;  3RUX A;  1SES A;  4JLG A;  4M7A D;  1X56 A;  3FB9 A;  5I2M A;  1X2G A;  1VQ4 T;  3V7C A;  4P73 C;  1YIJ T;  4KUD K;  4C5I A;  4KUI A;  2HAX A;  1Q86 U;  2CYZ B;  5CQY A;  4EO4 A;  3H8Z A;  2DXC A;  1X01 A;  3DSQ A;  1XOV A;  1MHN A;  4N4H A;  4A4E A;  2VXE A;  3OB9 A;  3CCS T;  2E12 A;  3CME T;  3KUF A;  1NJI C;  3E19 A;  4RG8 A;  5LJ5 d;  4M78 C;  3CMQ A;  3VQY A;  4LDV A;  1VQ4 A;  3VJP A;  2RHS A;  2JZ2 A;  4F7U A;  1YIJ A;  3CCV T;  3NEL A;  4J6Y A;  3NTH A;  3MQZ A;  4RCB A;  2LDM A;  5D6X A;  2WSF E;  4OLF A;  2E1H A;  1I4K 1;  3OMC A;  1X75 C;  3REX A;  5LJ5 e;  2DTI A;  3CCS A;  3KXT A;  2MF2 A;  3CME A;  3QZ9 B;  1JJC B;  3OYA A;  1Y96 B;  3OYY A;  4HT8 A;  4H02 A;  3V8L A;  2HNI A;  2CZ0 B;  1M5Q 1;  1M1K U;  1YFT A;  4P75 A;  3PTA A;  4J8O A;  4IKF A;  3HXX A;  3CCV A;  2EQK A;  5GAN 3;  3CCU A;  5KH6 A;  4FT4 A;  3MEY A;  4M75 A;  3JCM f;  4M7D D;  1YGB A;  1VUB A;  3X25 B;  4C92 B;  4JRK A;  1RIQ A;  1NJ5 A;  3G71 T;  2FB7 A;  3FJP A;  4C8Q F;  4M78 G;  1VQ8 T;  4QVC A;  3OYI A;  4C92 E;  1N8R U;  1NJ6 A;  4ATO A;  2EJG A;  1JB0 E;  2VV5 A;  2DEQ A;  4PJO B;  2ZPF B;  2LNV A;  3S3N A;  2DU5 A;  4H2V A;  4UPA A;  1KOG A;  1UGS B;  4M77 A;  3OYH A;  4B9X A;  4TTV A;  4CH3 A;  3DLL A;  3G71 A;  2ART A;  5LJ3 f;  3L2U A;  2HQE A;  2ZIN A;  4JS5 A;  4M75 D;  1VQ8 A;  3VBB A;  4LD6 A;  3F70 A;  3GIB A;  2DU7 A;  5K1P A;  3JCM V;  1Y07 A;  3M4Q A;  2ZZG A;  1WPY A;  3V7S A;  4IUU A;  4XU2 A;  3HSB A;  4XEO A;  1EVL A;  2E10 A;  4R56 A;  2EFI A;  3QJY A;  1AHJ B;  5FRO A;  3HXZ A;  2Y4Y A;  1Y71 A;  2XDD A;  3L42 A;  3VKI A;  4V2S A;  2EL9 A;  3A8O B;  2JTF A;  12AS A;  4TQF A;  2R58 A;  2E5A A;  5GAO n;  4L59 A;  4YRR A;  4HCB A;  2K3Y A;  3EAE A;  1N9R A;  3PCO B;  3HFO A;  4RKU E;  1QVP A;  2GF7 A;  4K86 A;  5CVI A;  1RL2 A;  4K87 A;  3HP9 A;  3WQZ A;  1B34 B;  3VQV A;  2RK2 A;  3HRU A;  4LVM A;  1JJ2 S;  3JCM J;  2K2V A;  1VQP T;  4RMF A;  4YRE A;  5DLQ E;  3L1A A;  3MP6 A;  5KCH A;  1Q86 C;  2D6F A;  3INZ A;  4M7A B;  4O2D A;  4XU0 A;  1I81 A;  4JRI A;  4LVL A;  5K1X A;  2ZZE A;  1VQK T;  5HKC A;  5KCO A;  4OGC A;  1VQ9 A;  2PVD B;  3DKM A;  2CJB A;  3JCM Q;  2ZR3 A;  4CS3 A;  3VQW A;  3KFU A;  3DLM A;  1VQP A;  4Q5W A;  2L5Q A;  4M78 F;  4YRC A;  3OYE A;  2H3J A;  2CS7 A;  2E64 A;  2ZIM A;  1JJ2 A;  3M58 A;  3RAC A;  3UGQ A;  4KR3 A;  3P8T A;  1VQK A;  3QG1 A;  3ZEH A;  2RHQ A;  1GXI E;  1KG1 A;  1KQ2 A;  1ADJ A;  2K4Y A;  2ZT8 A;  1Q7Y U;  5GAN 4;  3QZ5 B;  2RA2 A;  5GAN g;  1M1K C;  1G5V A;  5GAN 5;  1Z7M A;  2RJC A;  3FEO A;  4C92 C;  1QW1 A;  2K3X A;  3JCM g;  2E65 A;  4HWT A;  4E7I A;  1MGQ A;  4O5V A;  4YTL A;  1YBY A;  4UP7 A;  2Y90 A;  2DZC A;  2JTM A;  2X4Y A;  1NZ9 A;  3JB9 D;  1ZBX A;  1IRE B;  1H4T A;  1M8V A;  2KQW A;  4IUV A;  3TEE A;  4BE0 A;  1BIA A;  4M7D B;  2DTO A;  4PJO C;  1I8F A;  2QHS A;  3CMA A;  4F7U B;  1N8R C;  3QJ6 A;  2CZ1 B;  4BD3 A;  3MO8 A;  4LDX A;  1H4V B;  1WNL A;  4M7D E;  2X4W A;  1VQ6 A;  4A4G A;  5LJ3 g;  1ATI A;  4TVR A;  2M16 A;  3LWI A;  1LNX A;  1N27 A;  4P71 A;  2R5A A;  4EX5 A;  4IUR A;  3CXC S;  4C92 G;  3RL6 A;  4J5Y A;  3M4P A;  3MHX A;  1B7Y A;  3ERR A;  4M75 B;  3JCM c;  3HFN A;  1NNH A;  3H6Z A;  2XGT A;  4E7L A;  1S72 T;  4MDX A;  4OB2 B;  4KUL A;  1M90 U;  4DOW A;  2KY9 A;  3OBY A;  3VYG A;  4PJO G;  4FU6 A;  2ARS A;  4P3N A;  3PFS A;  5C0M A;  2X35 A;  1VQM A;  2ODR D;  1H4S A;  2DZ9 A;  2QEX A;  3MP8 A;  1WQ7 A;  3A7R A;  1EVK A;  1WU7 A;  1RI0 A;  3IAL A;  1VQ7 T;  1S72 A;  1UGR B;  1BI0 A;  4PNO A;  3JCM W;  4PHC A;  4M7A C;  3LSQ A;  4EMK A;  1WJR A;  1NPR A;  2QTX A;  2A7Y A;  2C06 A;  5KE2 A;  5A2Q E;  1LYL A;  1VQN T;  4Q6G A;  1QVF S;  4JS4 A;  3HTZ A;  3CC2 T;  5CKH A;  4ZTZ B;  5A0L A;  11AS A;  1WJQ A;  3G4S T;  4K88 A;  4BUG A;  2MWP A;  4YRN A;  5D6W A;  2Y4X A;  2KVQ G;  3QSU A;  4OMF B;  1WYD A;  2K57 A;  2DD5 A;  4C8Q A;  3OD1 A;  1VQN A;  1KHI A;  3QPH A;  2RJD A;  1Q81 U;  1LJO A;  3JCM e;  2EJ9 A;  4XTU A;  3G4S A;  2OAU A;  1QVF A;  3M54 A;  1Q7Y C;  2DXB A;  4BI3 A;  3CC4 T;  4M7A G;  1KQS S;  1G3W A;  2QA4 T;  3RES A;  3HPW A;  3GOX A;  4XK8 E;  2LTO A;  5FRM A;  4DPG A;  4TWA A;  2ZPG B;  2C8M A;  4C92 F;  3QO3 A;  4YCU A;  3WVE B;  3AHU A;  2D9T A;  4ZTU B;  4M7D C;  2AMC A;  1BKB A;  4XTW A;  4E7H A;  4H2T A;  1SET A;  4HWR A;  4NOY A;  5GAN j;  5A0G A;  2X4J A;  1KHC A;  2QHV A;  3CC4 A;  4C8Q D;  4LNS A;  4ZN3 A;  2RH2 A;  5LJ3 e;  4C5G A;  2BKD N;  4IUP A;  4OB3 B;  4OB1 B;  5HK0 A;  4OF1 A;  2QHU A;  1KQS A;  4LD9 K;  4J7I A;  3V8K A;  4A4K A;  3HRT A;  2E41 A;  5ELO A;  4QVZ A;  1E24 A;  3CCM T;  1W66 A;  5GAM d;  2RHQ B;  1NPP A;  2P0P A;  4P75 C;  3SWN A;  3RMS A;  1Y7X A;  2LC4 A;  3QDR B;  1BBU A;  4M75 C;  2LT1 A;  1W2B A;  1X55 A;  2Q5H A;  2HQX A;  3HFV A;  4YRM A;  3CCM A;  4M7D G;  4JLI A;  5HY6 A;  2MAM A;  2VGM A;  1YFS A;  3X28 B;  2RM4 A;  1M90 C;  3FRN A;  2XIC A;  2JUF A;  2DTH A;  2CIM A;  2K5L A;  3OYC A;  2LCL A;  1G5H A;  2B8A A;  1SSF A;  1X2H A;  4M78 A;  5GMK m;  3M55 A;  5LL6 S;  2VC8 A;  3RF1 A;  1NE8 A;  4PL6 A;  4YRL A;  1O75 A;  3ASK A;  1J5W A;  5LJ5 j;  3QYH B;  4UP9 A;  5IAY A;  3CCL T;  1ASZ A;  1K9M U;  4M7A F;  3E9G A;  3ER0 A;  3RMQ A;  3E9H A;  1UEB A;  2FHD A;  4C0F A;  5C6S A;  2VXF A;  3UT1 A;  3OY9 A;  2IG0 A;  3GNF B;  5DLO A;  2PUO B;  3LSS A;  4AH6 A;  3S3O A;  4CS2 A;  4J6W A;  3QII A;  3CEY A;  2ZT7 A;  1B7Y B;  3QUI A;  4JDS A;  3HKS A;  1VQL T;  1VIF A;  4RQE A;  1XQH A;  3SB2 A;  4PJO E;  2I4L A;  2CZ6 B;  3X24 B;  3ZBD A;  3CCL A;  4MDW A;  3LX7 A;  3HXU A;  2RI2 A;  5FU7 B;  5GMK e;  4YRP A;  1H4Q A;  1Q81 C;  5IN1 A;  1WLE A;  4Q15 A;  1U8R A;  4YCW A;  3L4G A;  5C51 B;  2F5T X;  4NS5 A;  5GAN h;  3RGL A;  4FM4 B;  3SDZ A;  2ZZF A;  3OYM A;  4EMK B;  3JCM h;  1SER A;  1NYR A;  4YRF A;  4M77 D;  5GAM f;  5C52 B;  4EMH A;  1KQ1 A;  2GQV A;  2NS6 A;  2ZCE A;  3SD4 A;  4YRI A;  2J3L A;  2XHC A;  1E1T A;  3CC7 T;  4M7D F;  3M56 A;  4CI0 C;  5DM7 R;  1B8A A;  1W4S A;  4GY5 A;  2BIV A;  3UGT A;  4J7F A;  1SRY A;  4P3O A;  4DOV A;  4ZTF A;  4L5G A;  5GAN 7;  2PME A;  1X6O A;  3CPW S;  4XTV A;  4TVA A;  3FLG A;  4FIB A;  3MEV A;  4X5O A;  4C0G A;  4CS4 A;  1XTD A;  4C8Q B;  3OSV A;  2KK4 A;  5LJ3 h;  4A54 A;  4M7A E;  1UGQ B;  3NFC A;  3HRK A;  4PKC C;  1Q82 U;  2V8I A;  3T9N A;  4JUV A;  3NEN A;  3MP1 A;  3CCE T;  3N5B B;  1K73 U;  2RHY A;  4ZGD B;  3GNG A;  3WXM B;  4QW2 A;  4H2U A;  4OGE A;  2NLU A;  3NEM A;  4E7J A;  4RQF A;  4CH4 A;  2EQU A;  2ZGW A;  4L6V 5;  2DQ0 A;  4A4F A;  3LGL A;  3JB9 H;  4BE2 A;  3EFR A;  1JBM A;  2E6N A;  2P4T A;  3IKM B;  1VQZ A;  2I4N A;  4BDY A;  1EQR A;  2PUK B;  3GLX A;  4BI4 A;  5CR2 A;  3CPW A;  4CH6 A;  2G4C A;  1XNI A;  3A5Z A;  2AMC B;  3PZC A;  5LJ5 h;  3CCE A;  1HXD A;  3HXY A;  4CH5 A;  1BIB A;  1TH7 A;  4HWS A;  2ALY A;  4TVY A;  1G3Y A;  1M1G A;  2X4X A;  2CJ9 A;  2ODR C;  3OMG A;  2FVU A;  3BDU A;  4HA8 A;  4LVK A;  4II1 A;  4P71 C;  3LC0 A;  3OYN A;  3SWN B;  2RHS B;  3M9Q A;  1K9M C;  1H3Z A;  4J15 A;  4RG2 A;  3S3M A;  4HCZ A;  5AYF A;  3A8M B;  1QP3 A;  3C95 A;  4VUB A;  2YLC A;  3PNW C;  4F7U E;  4XU3 A;  1YFR A;  2I4M A;  5FU6 B;  5FU7 C;  2O4X A;  4NL2 A;  3JAM E;  3TEH A;  2EYQ A;  3GP8 A;  2QQB A;  3P8V A;  1ZQ1 A;  4Y91 A;  3MF2 A;  3NTI A;  1YI2 T;  1YJN T;  3OS2 A;  5FLX E;  3GF5 A;  1QVG S;  3CCQ T;  3OBW A;  3HHT B;  3O8V A;  4ZTJ A;  3J7A F;  1H64 1;  5CO7 A;  4EMK C;  4YDQ A;  4YRK A;  2GFA A;  2ZXF A;  2P0Q A;  3VUZ A;  4H2X A;  4ZIB A;  2VYT A;  4C0D B;  2RHX A;  1D3B A;  4M75 E;  4BE1 A;  1QF6 A;  3RKY A;  5GAM g;  2KAF A;  3W3S A;  4YRJ A;  1YJN A;  2ZNI A;  4BW9 A;  1ZHI A;  2QQ9 A;  3TCJ A;  2LQ8 A;  3QHS A;  1USY C;  3J81 E;  2EAY A;  3CCQ A;  4Y28 E;  2XKO C;  2LCC A;  4M77 B;  3HY0 A;  3HXV A;  3PMT A;  1YB3 A;  2WAC A;  4N0A C;  3OA6 A;  4XTZ A;  2E5Q A;  4ME7 A;  1U1S A;  5KNN A;  1QVG A;  3TUP A;  2G3R A;  4C8Q C;  2DAQ A;  2JNG A;  2WSC E;  4KR2 A;  2DVE A;  4M77 E;  1NJ1 A;  5GAN 8;  5F5W A;  4N4I A;  2ZPH B;  5GAO q;  1YIT T;  4FL6 A;  2MWO A;  3I7F A;  3IG2 A;  4FSX A;  1BI2 A;  1VQ7 A;  3G7Z A;  3R6O A;  2KSS A;  2PVO B;  3MEU A;  5GAO p;  1Q82 C;  3L4G B;  3M53 A;  5CAI A;  1B34 A;  3BDL A;  3G6E T;  4YRT A;  1K73 C;  4HVC A;  3OW2 S;  5IT9 E;  3HFZ A;  4BI8 B;  3RIR A;  1ASY A;  4LVI A;  5GAN 6;  2QQR A;  1VQO T;  1YIT A;  3M59 A;  3CC2 A;  3PGG A;  4QQ6 A;  3LGF A;  4P74 A;  2GCX A;  4NL3 A;  4A53 A;  3E1S A;  1HK9 A;  4ELZ C;  1G3T A;  3JRZ A;  1OZ2 A;  3FDR A;  1LOJ A;  1FYF A;  3CCR T;  4EDU A;  3G6E A;  2LT4 A;  4YCV A;  3VV0 A;  4C8Q G;  2K5F A;  3REU A;  2DO3 A;  3TRE A;  1VQO A;  2DIG A;  1YJW T;  5GMK l;  3OW2 A;  3JCM b;  2DKG A;  5CIU A;  5GAO m;  1NYQ A;  2KMT A;  2CZ7 B;  5DY9 A;  3SWN C;  1P92 A;  1W2B S;  1PSE A;  3MCA B;  4WI1 A;  3M4Y A;  3CCR A;  5FRN A;  2QA4 A;  4P72 A;  5CQX A;  3P8B B;  5CKB A;  2RJF A;  4PJO F;  3SFM A;  3A5Y A;  5EG2 A;  3C4S A;  2PVG B;  5CKF A;  3CPF A;  5FU6 C;  2C7I A;  2JOY A;  4RDX A;  1YJW A;  4LDY A;  3Q1J A;  4O6J A;  2Q7G A;  4YYE A;  2JVV A;  3FIF A;  4QQG A;  2ZPI B;  4E51 A;  2Q7E A;  2Q7H A;  4LDW A;  5J3B A;  3A5Z B;  5M9O A;  3UFG A;  4BY6 B;  3DB4 A;  4M7D A;  1B70 A;  4EPC A;  2LVM A;  5LJ3 j;  1BI1 A;  2I2L A;  3A7A A;  4MMK A;  5GAM e;  4P73 A;  3CCJ T;  4C0D C;  1WGS A;  1OYX A;  3L2W A;  2ALY B;  2ZR2 A;  4JRQ A;  4IUT A;  3CCU T;  3KBG A;  1M9S A;  2EWN A;  2LQK A;  2QDY B;  4XAX B;  4F7U G;  2ZIO A;  3I55 T;  3PMI A;  3V7R A;  1WJS A;  1EIY A;  3M5A A;  4YRQ A;  3OS1 A;  2GFU A;  4B9W A;  5J26 A;  3TEG A;  2DQ3 A;  2DJZ A;  2CJA A;  3PIP A;  3OYJ A;  4M77 C;  1G3S A;  1G51 A;  4WJ4 A;  4J83 A;  2FL7 A;  3CCJ A;  2EJF A;  4H2Y A;  2DXT A;  2YHT A;  4QVD A;  3ZFJ A;  4BDZ A;  1KC8 U;  3RKW A;  5GAN f;  4IUQ A;  2XTI A;  5GAM j;  1K8A U;  3I55 A;  2O4X B;  3TU4 K;  1EIF A;  3QYG B;  3ICA A;  3TEH B;  3OS5 A;  2RHI A;  3X26 B;  4OVA A;  4M75 G;  2AKW A;  2DDZ A;  4ZGJ B;  3BW1 A;  4XEM A;  4BAC A;  3UWN A;  3CBO A;  2XD0 A;  1UGP B;  1KD1 U;  1V29 B;  3M4G A;  2XID A;  2RB6 A;  3WVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...