2DTOA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 complexed with atp and biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtoA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtoA01
2E41A 2Y90A 4XU2A 5K1PA 5DY9A 3HFVA 2Q7HA 5GANd 3MF2A 4YRSA 4YYEA 2I4OA 4PJOB 4NCXA 1BIAA 4DQ2A 2RHSA 2EWNA 1JJCB 1BBUA 2I4LA 3JCMf 1X55A 2ALYB 2ZR3A 1RIQA 2DTHA 4M77B 4P73C 1BBWA 1SETA 4YRIA 2ARUA 4YDQA 3QTCA 4PJOE 5LJ3e 3JCMP 5GAN4 5GAMj 1E22A 2DEQA 1ADJA 1USYC 4K87A 3L4GB 3LC0A 1KOGA 4XTXA 4QVCA 3LSSA 4YRRA 1QF6A 4RQFA 4M77E 4C92F 2ZIMA 4CH3A 4HVCA 3REUA 4M78A 1KMMA 4M7DD 1H4SA 5KNNA 3FB9A 5GAN7 3A32A 3VU3C 4N0AA 2RHSB 3TEHA 4P72C 2I2LA 1HC7A 3VBBA 4PNOA 3GIBA 4JLIA 3M4PA 3P8YA 5GANf 4M7AG 4YRLA 5C53B 3V7CA 4RCCA 3HFNA 2EJ9A 1H4QA 4WJ3M 5LJ3g 2I4MA 4M7DC 4KR3A 2Q5HA 3VQYA 5GAOn 4C8QE 4YROA 3BY7A 4Q6GA 3JB9D 2E3CA 3RACA 4OP0A 3VQXA 4C92G 4M7AA 3RGLA 2DZCA 2E64A 1E1OA 2ODRC 4K88A 5LJ3d 5C51B 4M78B 2EL9A 2ZR2A 1LNXA 4H2TA 4PG3A 2ZZFA 1J5WA 4MMLA 1EQRA 4PJOG 3QO8A 3V8LA 2IY5A 2YLBA 4C92A 2J3MA 4TTVA 4J6YA 3TEHB 5GAN5 5GAOp 5GAMh 1I4K1 3HSBA 3V8JA 5GMKh 2ZTGA 1EOVA 4C8QF 4H2YA 3ERRA 4M78E 3REXA 1I8FA 2FB7A 3E9IA 3MF1A 1E1TA 4YCWA 3A7UA 1B34A 3PZCA 5GAMe 3RF1A 1U1TA 1NYQA 4P75C 1Y96A 3JCMX 4AH6A 3UFGA 4M7AB 2DU7A 3JCMb 1YCYA 2ZT6A 1VQZA 3NEMA 3HXZA 3P8TA 4H2XA 2EJFA 4HWTA 3HFZA 3HRIA 4E51A 5GAN2 1YFRA 4M75D 4TQDA 4YCUA 3L1AA 4XU3A 2IY5B 3IKLA 3AHUA 5F5WA 1LOJA 4C92B 4C8QG 5LJ3f 1ASYA 3I7FA 3V7RA 2YLCA 3JCMV 5K1XA 3NETA 2ZZEA 4F7UF 5ELOA 1ATIA 1G5HA 3BFMA 3HY1A 1NJ8A 1EVKA 1B34B 5GAMg 4M7DF 3MEYA 4C8QA 1D3BA 4J6WA 1SRYA 5GAN8 4C92E 4WJ4A 2DXTA 4M75C 1Y96B 4H2UA 4TWAA 3OD1A 3HXVA 5GMKm 3W3SA 4CS2A 1X56A 4M78G 2QHUA 4H2XB 1EFWA 4G84A 5LJ5h 4XQ3A 1USYA 2CJAA 3HFZB 4LNSA 2I4NA 3HFOA 5GMKj 4XTUA 2ZT5A 5GANj 3UGTA 3TEGA 4CS3A 4F7UG 4RQEA 1WNLA 3JB9F 3FIFA 5GAOq 5CAIA 4XTZA 4XU1A 3RESA 3RKYA 3INZA 1JBMA 2XTIA 4ZTUB 1LJOA 2RD1A 4P72A 3JCMJ 3A74A 12ASA 4C8QB 1D3BB 1BIBA 1I5LA 4F7UA 4Y91A 3DSQA 3JCMh 2K57A 2Q7GA 4XTYA 2PMEA 5GAOm 1B70A 1X2HA 1LYLA 4HWPA 3QUIA 3QO7A 4CH5A 1WLEA 3RUXA 3JCMe 1GGMA 3SWNC 2DXUA 4NL2A 5GAOr 2ZNJA 3JCMW 4EMHA 11ASA 2QTXA 1FYFA 5E3IA 2DQ0A 4M7AD 4N0AC 4JUVA 1G51A 4XU0A 3CMQA 3V7SA 1G5IA 2XGTA 5GMKl 4ZIBA 4Q15A 1HXDA 3HXYA 4WI1A 1I81A 2G4CA 4BWAA 3FJPA 4F7UB 2VXEA 4M75F 5GAN3 1NJ6A 4C92D 5GAN6 3TUPA 5GANh 1X54A 2ZNIA 1M5Q1 4EMKA 4NL3A 3JB9I 3NELA 5LJ5j 4M7AC 2DDZA 1B70B 3QO3A 3IKMB 4H02A 1ADYA 4TVWA 4H2SA 3HXXA 3HXUA 4PJOD 3JCMg 4EMGA 5GMKe 5GANe 4HT8A 3RIRA 3HTZA 4H2WA 4F7UE 2DKGA 1ASZA 1WU7A 2JN0A 2P0LA 3PCOA 3PGGA 1H4VB 4YP0A 3EFRA 4P3OA 4MMKA 4M7DE 4M77D 3R07A 3JCMd 1E24A 4EX5A 3IG2A 4A54A 4UP7A 1WYDA 5GAOl 4X5OA 2ZT8A 4TQFA 3WQZA 4P71C 1TH7A 3EFSA 4YRKA 5C52B 3JB9J 4PJOC 3G1ZA 1B8AA 4RMFA 2AKWA 2E10A 2ZGWA 1L0WA 4CH6A 4UP9A 4EMKB 1N9SA 3VQWA 2DVEA 4YRCA 4ZTZB 3L2ZA 2RB6A 4V2SA 3QNEA 4M77C 4M75A 3RL6A 3HXWA 5GANg 3QO5A 1YFTA 1C0AA 4YRTA 4C8QD 4XTWA 4P73A 2E5AA 3QHSA 2HNIA 4YREA 1KQ2A 4XTVA 1NYRA 2DTOA 3PCOB 4P74C 2QHVA 5GAMd 4RDXA 4UPAA 3M4GA 2QHSA 3ICAA 4KR2A 1X01A 5I21A 1WQ7A 4HA8A 1QE0A 4UP8A 2ZXFA 2J3LA 2ZINA 4X9CA 5LJ3h 5ELNA 4L87A 4NOYA 2AKWB 2P5IA 2C8MA 2EJGA 4C8QC 5LJ5e 1NJ2A 2CIMA 3A31A 4YRNA 2VXFA 3KFUA 4KQEA 4YCVA 4M7DG 4M78D 4M7AF 2ZT7A 2DZ9A 4M75B 4HWSA 3JCMc 2AMCA 2Q7EA 4J5YA 4J6XA 1H641 3BDUA 2FYKA 4YRGA 1N9RA 2DQ3A 1SERA 3A5YA 3P8VA 2ZIOA 2RM4A 4M7DA 1EIYA 3NENA 1JRIA 1Z7MA 1MGQA 5HGQA 3RKWA 2CGHA 3SWNA 4M75E 4RCBA 4WF2A 3HRKA 4M78C 3RKXA 3SB2A 2E65A 4XEOA 1KMNA 2ARTA 3JB9G 3JB9H 2C7IA 2RHQA 4CS4A 4PJOF 3E9HA 5GAMf 4OLFA 2ODRD 4DPGA 1KQ1A 3LSQA 4HWRA 4PHCA 3V8KA 5LJ5g 4YRMA 1EVLA 4YRQA 1W66A 2DU5A 2DTIA 1IL2A 3JCMQ 1B7YA 4TVYA 4M77F 4K86A 1YFSA 3UGQA 5GMKi 4BW9A 3M4QA 2AMCB 2RA2A 5LJ5d 4HT9A 4EO4A 2Q5IA 4HWOA 4TVAA 4X9DA 1SESA 1PYSA 1H4TA 2EAYA 4M7DB 2CJBA 1EIYB 1X2GA 3HY0A 2E1HA 4P75A 3SWNB 1M8VA 2QHTA 2PMFA 5LJ3j 1HK9A 4CH4A 2RHQB 3VQVA 1Z7NA 1N9WA 2DJZA 4C92C 2CJ9A 4XEMA 4YRPA 1NJ5A 4P71A 4M77G 3BJUA 4YRFA 1B76A 3A7AA 4PJOA 4EMKC 2VC8A 4QVDA 1YB3A 1WQWA 1B7YB 2ZCEA 2ZZGA 4M75G 3A7RA 1WPYA 4JRKA 3QSUA 4JRIA 1JJCA 1YGBA 2YHTA 3IALA 1NNHA 2ALYA 4YPFA 1HTTA 4TVAB 3RERA 1PYSB 1NJ1A 3UH0A 4M77A 2ARSA 4G85A 4A53A 5LJ5f 1U1SA 4YRJA 4H2VA 4M78F 3A5ZA 4P3PA 4O2DA 3BW1A 4P3NA 3L4GA 4J15A 4P74A 4M7AE
chains in the Genus database with same CATH superfamily
1Q86U 4L59A 3OW2S 4RMOA 2DJQA 1YJWA 3UDCA 1RABB 2P84A 2Q7HA 1QWFA 4YRSA 5ECAA 3OSSC 4PJOB 3CCUT 2WSCE 4R55A 4QQDA 4DQ2A 1G3SA 2NUPA 3EG9B 4PJJA 4RG8A 2AIRB 3CD6Q 2OTLT 2J06A 4A4HA 2E5QA 2W10A 2A8EA 1ZSZC 4P73C 5HK0A 1VQ4Q 1BBWA 1WFWA 1IZ6A 4P5NA 4LDXA 2DXCA 4HKEA 5J39A 5GAN4 2CH4W 3A5ZB 5GAMj 3OYKA 1X2QA 4K87A 3L4GB 1RAHB 4PFOA 4RTZA 3RMQA 3WVDB 4XTXA 4QVCA 3LSSA 1JJ2A 5CVIA 3M56A 2F2WA 1KMMA 2L89A 1VQNT 1H4SA 4JDSA 2JUFA 3NTIA 4L5GA 5GAN7 3VU3C 4N0AA 3G4SQ 3VBBA 2E6NA 2KQWA 3P8YA 3H6ZA 4J9FA 5GANf 4M7AG 1R8OB 2LJ3A 1RAGB 4PLIA 5M9OA 4OMPA 1AWWA 2EJ9A 1D1CA 3BDLA 4M7DC 2Q5HA 3VQYA 1PRMC 1QVFP 1VQ9Q 4YROA 4Q6GA 3JB9D 1K8AC 4B9WA 1M2VA 3RGLA 3CCVT 2E64A 4OMNA 3GP8A 2ODRC 3EGDB 2SRCA 2NUTA 5D7UA 5LJ3d 1GRIA 1NZ9A 1OZ2A 5C51B 1LNXA 3PTAA 1J5WA 3QZ5B 2GGRA 2AKKA 1EQRA 4LNPA 4JJCA 2DX1A 2IY5A 1YP5A 5FU6C 2J3MA 4TTVA 5I2MA 5GAN5 3S3NA 5GAMh 1SRLA 3HSBA 3PVLA 4VUBA 3L2UA 2ZTGA 1N8RC 1RADB 3CCQT 4LDYA 4M78E 4LVLA 2FZGB 2D8HA 4YCWA 1TU0B 3VS0A 2BTTA 2QEXA 1KC8U 1VQPT 1YIJQ 3NMZC 1U1TA 1Y7XA 1NM7A 2RI2A 4P75C 3JCMX 4ORZA 4RUGA 2LQNA 2KRNA 4M7AB 3JCMb 4RKUE 2JNGA 1OU8A 3CC7T 2V26A 1RLQC 1VQZA 1SG5A 5CKHA 3CQTA 3C4SA 4HWTA 2P0KA 1PCXA 3EG3A 2F5KA 5F5WA 1X43A 1JXOA 3JCMV 1SRMA 3MP6A 5ELOA 2M02A 1G5HA 3OYYA 2O88A 1VQ8A 1MV0B 2HKQB 2VB6A 4DOWA 2FPDA 3HY1A 1NJ8A 3MEYA 3MCAB 4C8QA 1D3BA 2QQAA 1SRYA 1IREB 1Z9ZA 5GAN8 1MNEA 4C92E 1TOVA 1Y96B 2LNHB 3OD1A 1WHMA 2P4TA 1HYOA 3FDRA 1YJNA 4M78G 3CCST 4WTOB 3P8DA 1GXIE 2QHUA 1BCOA 3RDVA 4E2FB 1WHLA 2E5KA 3X25B 2I4NA 2P4RA 1M27C 3R6OA 2J6KA 1T3LA 4KH1B 1UHFA 3OYJA 1M3CA 2DF6A 3X20B 2K4YA 4BI3A 3CC2Q 1YWOA 4XTZA 1IXDA 1JBMA 1LJOA 6AT1B 2YRDA 3JCMJ 4JS4A 1I5LA 4ESRA 2YUNA 2K57A 4PFPA 2Q7GA 1VQ7Q 1FWZA 3PIOA 2PMEA 2RK1A 5GAOm 4J7IA 3VS3A 1D1BA 3QO7A 3VRZA 4CH5A 3QKJA 3RUXA 3I5RA 5IXBA 3PE0A 2J6FA 1UGSB 2SEMA 3HRTA 5FW9A 5KYYA 2JT4A 1QQJA 4A63B 2QTXA 1K9MU 2DQ0A 3A8HB 1YJ9Q 4BE0A 1WJSA 5D6WA 4XU0A 3CMQA 2KDSA 3C94A 1WX6A 4ELYC 1I81A 4DEXA 2G4CA 1VQOQ 3CD6T 4BWAA 4KULA 4M75F 1NJ6A 1Q82U 2C0TA 4OMOA 1RLPC 3JSCA 1X54A 2ZNIA 1VQ4T 4EMKA 3NELA 3A98A 2HD0A 3TSZA 3JB9I 4M7AC 2V8IA 4QKUA 2DRMA 2DDZA 2ATCB 1B70B 3S3MA 3IKMB 1E6HA 2ROTA 3HXUA 1W2BA 3E9GA 4PJOD 3JCMg 5GMKe 1F1BB 2LCLA 4HT8A 1LPLA 2DETA 2IG0A 1M2OA 2DKGA 2CZ1B 1WU7A 1XNIA 2JN0A 4LN2A 4YP0A 4P3OA 2X4XA 3OSVA 4BDZA 1Q7YC 3TREA 3CMEQ 4A54A 1VQ6A 3E9FA 5GAOl 1PHTA 2V8KA 4TQFA 3G4ST 1K73U 1SEMA 2KMTA 2KI7A 3QIIA 1BU1A 2GF7A 2R57A 2QI2A 2M1HA 4IUPA 3ASKA 2AKWA 1ZBXA 2K6DA 1M9SA 2XD0A 3I35A 1N9SA 2JW4A 3PVQA 4ZTZB 3L2ZA 3QNEA 2VUBA 2YT6A 3QBYA 1VQ9T 4C0GA 4FIBA 4C8QD 4XTWA 3QZ9B 1Y0MA 2LMJA 2HNIA 2RH2A 1SSHA 3G1JA 4XTVA 2DTOA 1PC0A 5KYXB 4M4ZA 1NJIU 2DM1A 4P74C 5GAMd 5I11A 4UPAA 2AT1B 4AFZC 1KHCA 3H0FA 3SEMA 2ZAEA 1QE0A 1GFCA 2ZXFA 2YUOA 3CCMQ 5L23A 4CI0C 1IHWA 2ZINA 1YI2Q 5ELNA 4L87A 1BKBA 2X35A 1I0CA 4C5HA 5LJ5e 3CBMA 1MMGA 4YRNA 1AWXA 4KQEA 1PM3A 1UB4A 2ZT7A 2RQVA 3EFOA 4M75B 1QVFA 3JCMc 4QW2A 2O9SA 1B3QA 4R0KA 2DE0X 2AHJB 4YRGA 3DB3A 2PVGB 2DLPA 3P8HA 1D0ZA 2A7YA 1NLOC 3I55T 1Z7MA 1MGQA 2EBPA 2CGHA 2CSIA 3SWNA 2EYWA 3H8ZA 4RCBA 1RACB 3OMCA 3HRKA 4M78C 3RKXA 2E65A 4XEOA 1W1FA 3JB9G 3UPUA 4B9XA 2YRVA 1BI0A 2RHQA 3MJXA 4CS4A 3HPWA 4D8DA 2DO3A 3LSQA 1YITQ 2OJ2A 4KBMB 1QCNA 3M54A 2LCCA 2DTIA 1KIKA 1PNJA 4LDWA 3GLXA 3JCMQ 4M77F 4K86A 2O31A 1YFSA 1UHCA 5GMKi 1IGQA 1K4US 3VS1A 2KEAA 1MNDA 4HWOA 2OTLQ 1SESA 2ZPHB 1OX8A 1IO6A 2EQKA 1QVPA 1OYXA 1WI7A 1UGPB 1M8VA 3X24B 1AOJA 4HVVA 5LJ3j 1T0HA 5FRMA 4ZNXA 3H0HA 4CH4A 4Z8AA 3VS5A 1KG1A 3CC2T 4C92C 1GBQA 2AZVA 1S72A 4YRPA 5AYFA 8ATCB 4M77G 3BJUA 4DOVA 2X4YA 2X9HA 3H41A 1QKWA 3A7AA 5KYUA 2ZZGA 1WQWA 1B7YB 1SSFA 1WPYA 4JRIA 1XOVA 1VQ7T 1O9SA 3LLRA 1HTTA 2RJDA 2PTKA 1OX9A 3CCRA 2RHXA 4A53A 3GF5A 3LWIA 5LJ5f 1WXUA 1N8RU 4A4FA 5KE2A 2PU9B 4GY5A 1YJ9T 1VQMA 5CKEA 3A8MB 1KJWA 3VS7A 3CCVQ 3OS5A 1X27A 2XHCA 1FMKA 3CCLA 5DY9A 3HFVA 3MF2A 2HQXA 1IB8A 2E6ZA 2CZ7B 1B07A 2OTJA 3EGUA 1VQOT 1VUBA 2VYTA 3I56A 5A0DA 2W0ZA 5KYWA 2E4HA 2F69A 3Q1JA 2RMOA 3JCMf 1JB0E 1ZHIA 1Q7YR 2ZR3A 4M77B 1VQ5Q 1M1GA 4Y92A 2NLUA 3QTCA 3JRZA 4PJOE 1G83A 5D6XA 2O01E 1E22A 2COWA 1H8KA 2DEQA 1NPRA 3TSWA 1USYC 1VIEA 3CCET 3HL8A 4AG2C 2HSEB 1QF6A 1M1KC 4ZTFA 3M59A 1PSEA 5CO7A 3EH2A 4HT4A 3TVTA 5KNNA 2GTOA 1ZUYA 3A32A 2QEXQ 2X4WA 2NUPB 3REBB 4P72C 3TEHA 2HMAA 1HC7A 4PNOA 4PJMA 2DBMA 2LT1A 3G71A 2KR3A 2LVMA 4O6JA 3V7CA 4ZGEB 3M0TA 1BYMA 3PNWC 4OB0B 4KR3A 3HRUA 2H8HA 4RTYA 1MHNA 4C8QE 1TUDA 3BY7A 3PMTA 2E3CA 2FZCB 4QVZA 3VQXA 2LJ0A 2KT1A 2RJCA 5IXFA 5IT9E 4RTXA 3S3OA 4J9EA 2KY9A 2RF0A 3CPWP 3M9QA 4H2TA 4PG3A 1VQ8Q 2QQRA 4FW2A 3CCMT 3OA6A 4PJOG 3QO8A 3V8LA 1YI2T 4MZTA 1NEGA 2ZPBB 4J6YA 2DBKA 5GAOp 2EYXA 1Q81C 2RNAA 3V8JA 1TS9A 1VIFA 3RNJA 4FCYA 4C8QF 4H2YA 3ERRA 2FB7A 3HTRA 4ZGJB 1VQLA 2JS0A 2OI3A 1E1TA 3ZBDA 2H3JA 1B34A 3PZCA 1TUGB 5GAMe 2GCXA 3CCJA 4AH6A 2D8JA 3UFGA 2DU7A 1M2VB 1YCYA 2NUTB 2ED0A 2MYSA 2RHYA 4ELZC 1ZSGA 3P8TA 3HFZA 1G3YA 4M75D 3OYHA 4TQDA 1MMNA 2F5TX 4XU3A 2IY5B 3IKLA 3AHUA 2I0NA 4FYVB 4C8QG 1RAFB 1H92A 1YITT 3I7FA 2DILA 3V7RA 2YLCA 5K1XA 2X3XD 3AT1B 3NETA 2ZZEA 1CKAA 2JXBA 1ATIA 2PUOB 3CMAA 1FX7A 1FMWA 4PK4A 2E12A 1TWBA 2EKOA 4J6WA 4N4HA 4WJ4A 2YXYA 2DXTA 1ZSZA 1NPPA 4TWAA 3U23A 3DKMA 1ABQA 5GMKm 1YNZA 1R0CB 3NTHA 1YJWT 4CS2A 3M0QA 2LC4A 1W70A 2K9GA 4OB2B 4LNSA 5IN1A 4PL6A 3HFOA 5GANj 2ZCFB 3TEGA 1JJ2S 3FIFA 3LH5A 3RKYA 2L3QA 4LVJA 3FJ5A 3WVEB 3R6NA 4BE2A 1N27A 4C8QB 1D3BB 1BIBA 4F7UA 4Y91A 3DSQA 2E70A 3CXCP 4JJDA 4J9GA 4BY6B 2R58A 1D0XA 3N5BB 2JTFA 1LYLA 2FL7A 1UG1A 3TCJA 5HK3A 2DXUA 5GAOr 1YCSB 4JZ4A 3JCMW 2JOYA 4GBQA 2A36A 1FYFA 4KH0B 5E3IA 3G6EA 1M90U 4N0AC 2BZ8A 4IIMA 1ZA2B 3V7SA 1G5IA 2XGTA 1SKUB 5GMKl 1UUEA 3JV3A 1WJQA 4BE1A 4JZ3A 1K9AA 1C6VX 2FRWA 1QKXA 2LQ8A 2VXEA 1M1KR 4FM4B 5GANh 1VQ5T 2LTOA 4BB7A 2LJ1A 2E3HA 1Y71A 2KK4A 3CCQA 1RAIB 3QO3A 1Q95G 2FO0A 4H02A 1EFNA 4IUTA 2CS7A 2QAZA 5CKFA 1VQPA 4H2WA 2CUDA 4BI8B 5KYYB 2P0LA 2Z0WA 3PGGA 3EFRA 3LH0A 4MMKA 1TG0A 1JXMA 4M77D 3A8OB 4BUGA 2B8AA 3JCMd 3I55Q 3P8BB 1UTIA 1E24A 2KXDA 3L42A 1PD0A 2QEXT 2ZT8A 2QQBA 1QWEA 1TH7A 4KGZB 2RQUA 3O5ZA 5C52B 3EG9A 2CP0A 1I07A 3JB9J 4OB1B 4PJOC 4RMFA 3J7AF 2E10A 1QVGP 3A1PA 3VS2A 2VKNA 1MV3A 4EMKB 3VQWA 2DVEA 4YRCA 4F16A 3EG1A 2CP2A 3M0SA 2CP3A 1Q81R 3VUBA 1C0AA 4ZN1A 3OYNA 2A28A 4YREA 3C95A 1YHQA 2RJEA 2CP7A 2DNUA 3VYGA 4RDXA 3M4GA 1VQ8T 2QHSA 3CCSA 2Y4XA 3UWNA 2L3PA 4HA8A 4UP8A 3EG2A 3THKA 1X75C 2YDLA 4MZPA 2ABLA 2CDTA 3OMGA 2AKWB 2C8MA 4C8QC 1NJ2A 2CIMA 2EYYA 5KCOA 1YJNT 3KFVA 5J26A 3OBYA 1R77A 2OX7A 3QWYA 4TVRA 1EX4A 1IHVA 4Z89A 1K1ZA 3CBPA 2C0IA 2ED1A 4J5YA 4J6XA 2VV5A 1H641 3BDUA 2FYKA 4GLKA 1SERA 1ZQ1A 3A5YA 2LQKA 3CPWA 1EIYA 1NYGA 4J9HA 2CT3A 1UE9A 3NENA 1JRIA 2EYZA 1S72Q 1PKTA 4M75E 4WF2A 1U06A 3JB9H 2A0FB 2DK3A 2C7IA 2OAWA 3E9HA 2ODRD 1WHKA 5LJ5g 2WACA 2K3YA 4ZN3A 2QGFB 3OS1A 4YRQA 1W66A 2DU5A 1CKBA 1WJRA 1IL2A 4TVYA 5IHIA 3EFOB 3O8VA 5I2SA 2ZPIB 2RA2A 5FU7B 2MF2A 4CC3A 1VQMQ 2EAYA 2HDAA 1VQ4A 1AZEA 1RUWA 1X2GA 3HY0A 2E1HA 3SWNB 1W2BS 2PMFA 1KQSS 1OPKA 4RTTA 2OTJQ 1AHJB 5IHKA 2XKOC 5A0GA 1PD1A 1D09B 2RHQB 2RI3A 3CCEQ 1N9WA 4XEMA 3GNGA 2KROA 2DYIA 1G8XA 4YRFA 4QT7A 4EMKC 1YB3A 2ZCEA 4QVDA 5CQYA 2P0PA 4M75G 3A7RA 3G4SA 2LRQA 1Q86C 3QSUA 1JJCA 1YGBA 2YHTA 3LW5E 1YBYA 2ALYA 1AEYA 1LVKA 2K2VA 3UH0A 2L2PA 4F17A 4G85A 3EH1A 1U1SA 1VQ6T 3EHRA 5LL6S 2A08A 1VQ9A 1E6GA 2VWFA 1X6OA 1VYVA 2DEUA 3BW1A 5HKCA 4J9BA 1QCFA 4E7HA 4P74A 4D8KA 1Y57A 4C0FA 4KT0E 2VGMA 2KXCA 4ZGDB 1OOTA 3G71Q 5K1PA 5GANd 4HCKA 2DFUA 5KYUB 2KYBA 2L0AA 3M4YA 2JJ9A 3EGXA 1BIAA 2FG0A 2RHSA 5FLXE 4JRPA 1FXXA 2EWNA 3CXCA 1BBUA 1TXQA 1K0XA 2I4LA 4CC7A 4OF1A 2QQSA 1X55A 4C0ZA 2DTHA 1SETA 2ARUA 3FC3A 1WYXA 1GCQA 1QVFS 5LJ3e 1YIJA 3JCMP 1R0BG 4DEYA 1DJ7B 2XDBA 3UATA 1M3AA 2LZ6B 3NTKA 3LC0A 2BKDN 1QCOA 3I9QA 3ULRB 4YRRA 4RQFA 4M77E 4CH3A 3JAME 3REUA 4M78A 1PWTA 2XDDA 1ZUKA 1ZLMA 3OW2P 3FB9A 2RQTA 3GOXA 4AG1C 1JQQA 1WDXA 1BK2A 5KYWB 4N4GA 4FT4A 4JLIA 4DBFA 3M4PA 4DA4A 2X3WD 4RCCA 2ZPGB 3VRYA 3FRNA 1KD1R 5EC7A 2GTJA 1YN8A 2DPPB 2ZZDA 1I5OB 4J7FA 1A0NB 1O75A 4OP0A 2LDMA 4FYXB 1C1AA 1UJ0A 1KK7A 2LQWA 2JM9A 1E1OA 2KVQG 1KC8C 4K88A 5CR2A 2GBQA 2FVUA 2COZA 2MWPA 1YJWQ 2EL9A 2ZR2A 2PUKB 4AFQC 1U8RA 2AZSA 4C92A 1GFDA 3TEHB 1QVGA 2IIMA 3M55A 4FSXA 2NWMA 5GMKh 1EOVA 2G6FX 1K8AU 3REXA 1I8FA 4RG2A 2K7AA 1UECA 4J83A 3OYEA 1WIEA 2VVKA 3M58A 1S1NA 1NYQA 2CKKA 2QXFA 1M30A 1VQ7A 3RBBB 1S72T 2ZT6A 1U3OA 4J8OA 3NEMA 3HXZA 4H2XA 2M16A 1N5ZA 2YUQA 1GCPA 5GAN2 1YFRA 1YWPA 3L1AA 1EZZB 2DD5A 1NYFA 3TU4K 5LJ3f 1HD3A 4B6MA 2FHDA 4F7UF 3CCRT 4E7JA 4LVIA 1UJYA 2V8JA 1WXBA 1WHJA 3CEYA 1EVKA 1B34B 5GAMg 4M7DF 1VQOA 2FPFA 3QYHB 4M75C 3CC4A 2EQMA 2XMFA 9ATCB 1VQMT 1I1JA 2ZPFB 2EGEA 2HL3A 5FWBA 1EFWA 5LJ5h 2KBTA 5CQXA 1Q86R 4OMLA 4XQ3A 2OTJT 1USYA 2CJAA 4LDUA 4Q5WA 3HFZB 2RI5A 2X51A 4MDWA 4KGVB 3UGTA 4DBQA 4F7UG 2YSQA 1WNLA 3M53A 5GAOq 3TEEA 5CAIA 4Z02A 3CMEA 1SPKA 5CCAA 4A4KA 2RD1A 4P72A 1K9MC 2GQIA 3A74A 3PIPA 1ZSZB 3MO8A 3JCMh 2L3SA 4XTYA 1UGQB 3GPLA 4JS5A 4EIKA 2XICA 4HWPA 4C5GA 3DB4A 1Q82C 2VASA 4ZTJA 2QA4A 1GGMA 2FRYA 3OYDA 1W6XA 11ASA 1G5VA 2EFIA 3UF4A 3G71T 1TUCA 3GNFB 1SHFA 2HEQA 3PMIA 4KUIA 3QDRB 4ZIBA 1TTHB 3CCMA 4WI1A 3FJPA 2XIDA 1YI2A 4F7UB 2ZPEB 1BI1A 2PNIA 5GAN3 2A3LA 4C92D 1AD5A 4AFSC 4DBRA 1UEBA 5GAN6 3QYGB 2LCSA 3EAEA 3X28B 2J6OA 4NL3A 5D6YA 2CH4A 4PJLA 1K73C 1UDLA 1YJNQ 2BE7D 1ADYA 3L2WA 4H2SA 3HXXA 3ZFJA 5GANe 3RIRA 1PG5B 1X6BA 1WLPB 2KRMA 1MMDA 4EPCA 3PCOA 1H4VB 1OU9A 1VQKA 5EG2A 3ME9A 3VKIA 1VQLT 3R07A 4UP7A 3WQZA 4P71C 3M57A 4YRKA 2KYMA 1NJIC 3G1ZA 1OPLA 1B8AA 1KC8R 1PKSA 2ZGWA 1YITA 1L0WA 4UP9A 2BZYA 1NBEB 4F14A 4RTUA 3QPHA 4V2SA 4M77C 2V1QA 3CCUA 3RL6A 3HXWA 2M0YA 4JLGA 1YFTA 1Q7YU 4P73A 1M1FA 2OTLA 2E5AA 2RN8A 3QHSA 2D6FA 1KQ2A 2KE9A 1NYRA 3OW2A 4QQGA 2QHVA 2QDYB 5DM7R 3CMAT 2DRKA 1AWJA 3ICAA 4KR2A 1X01A 2YUPA 4E47A 1WQ7A 4YTLA 3OYBA 3SD4A 3MEUA 4X9CA 1WZOA 3QWXX 1KFZA 2EJGA 3E2UA 4LXCA 2K3XA 4E7IA 3KFUA 2VXFA 2JS2A 1AWOA 2F2XA 2PQWA 1VQNA 4M7AF 4ANJA 2LX9A 3L2QA 4HWSA 2AMCA 2LNVA 2Q7EA 3OYLA 4ATOA 1X2KA 4HCCA 2CT4A 4LUEA 4AMCA 3ZL7C 2O4XA 1WGSA 2WSFE 4E7LA 2HBPA 2RM4A 4M7DA 2JMAA 4J9DA 3MHXA 5HGQA 3RKWA 2D1XA 2K3BA 2JVVA 3VUZA 2EW3A 5KH6A 1VQ6Q 2ARTA 2XK0A 5HY6A 1OQKA 2D0QB 5GAMf 4OLFA 2DL5A 3CCVA 1KQ1A 4HWRA 4HVUA 4PHCA 4OVAA 1J3TA 2JTEA 4YRMA 2HAXA 4KGXB 2KGTA 1EVLA 2DERA 4Z88A 2HQHA 1QP2A 2RK2A 3CBOA 1ZA1B 1MMAA 3UGQA 8AT1B 2Y4YA 5LJ5d 1HJDA 3L2VA 4HT9A 2HKNA 4EO4A 1RAAB 4TVAA 3OS2A 3G6ET 1PYSA 1VQ5A 1XJWB 1Z9QA 1AVZC 1KSWA 1EIYB 2RJFA 4UC4A 1K9MR 4P75A 3OYGA 2L8DA 3ER0A 4OGEA 2D0NA 1HK9A 2O2OA 3M5AA 2F1LA 2DMOA 5J3BA 1BI3A 4O5VA 1D0YA 3VQVA 3MEWA 3OS0A 1Z7NA 2DJZA 1PRLC 3CC7A 2XU8A 2CJ9A 4IUUA 1VYUA 1GBRA 3UA7A 1NJ5A 1Q82R 3LGFA 1V1CA 1XTDA 2PVOB 1C0MA 2MPXC 2RHUA 4CRIA 4PJOA 2VC8A 2GFUA 3HXVA 2JMCA 4JRKA 3OQ5A 3OYCA 3C12A 1OV3A 3SDZA 4YPFA 2HBWA 2LT4A 3RERA 2KAFA 1IGUA 1W4SA 1EIFA 4LDVA 2DA9A 1PSFA 3MKDA 2MWOA 4YRJA 4RTWA 2BE9B 3M0RA 4H2VA 4M78F 3A5ZA 2J05A 4P3PA 4KRTA 4O2DA 2QASA 3BE3A 5IAYA 4P3NA 1AZGB 4FW1A 3L4GA 2M51A 1K73R 2E41A 2Y90A 2EQUA 4XU2A 5CIUA 2C0OA 2ESWA 2EYQA 3SFMA 3VS6A 1V29B 1D1AA 4YYEA 4A4EA 1BCMA 2I4OA 1KD1C 4NCXA 2BIVA 4FSSA 1UFFA 4F04B 2FEIA 1JJCB 2DVJA 4IURA 2NS6A 4A4GA 2ALYB 1YHQT 5FWCA 2DIGA 1RIQA 1RI9A 4JJNK 4YRIA 4YDQA 4BY6C 1ZX6A 3TQ7P 1NJIR 4CC2A 1OZ3A 1V76A 3A8GB 1ADJA 3VYHB 1KOGA 2G3RA 2RQWA 2L3RA 1VA7A 3EGDA 3CPWS 4C92F 2ZIMA 4HVCA 2PZ1A 3KUFA 1FMVA 2K5LA 4M7DD 2DAQA 5GJWB 2AK5A 1OI1A 4MDXA 3EGXB 2RHSB 1E7OA 2I2LA 2MK5A 3MEVA 1AT1B 4E6RA 3OYAA 3M0UA 3GIBA 3MP8A 1XQHA 1U5SA 3ZEHA 4YRLA 5C53B 1IRXA 3HFNA 3CCRQ 2GQVA 3OYMA 1H4QA 4WJ3M 2K2MA 5LJ3g 2I4MA 3OYIA 5KCHA 1M1KU 5GAOn 2KT8A 1QLYA 2QDLA 3PFSA 3CD6A 3RACA 2EKHA 4C92G 4M7AA 2DZCA 4IKFA 1B7TA 4HCZA 3OBWA 2RO0A 4PFZA 1T0JA 1Y07A 4BACA 3HHTB 4M78B 4LUDA 4C0DB 3CCLQ 2ZZFA 2HSPA 4MMLA 2NUZA 2YLBA 1ZUUA 2FPEA 3I56Q 4R56A 4E7ZA 4LVMA 1I4K1 3CC4Q 2MCNA 2CSQA 1G3WA 3F70A 2E3IA 3E9IA 2CZ6B 3MF1A 1NEBA 4JJBA 4X1VA 3A7UA 1NG2A 3J80E 3RF1A 1KQSA 2F2VA 2R5AA 1Y96A 1TSFA 4E7SA 2EQJA 4PKCC 1Q81U 2RHIA 2EJFA 1G2BA 2B86A 2EQIA 3HRIA 4E51A 1K8AR 4YCUA 4OMQA 3OYFA 4FYYB 1ZBJA 1LOJA 4PJNA 4C92B 1ASYA 2H3EB 4RTVA 2EGCA 5GJVB 3BFMA 2PVDB 4N4IA 3VS4A 2QQ9A 4K11A 5HCKA 2JTMA 3T9NA 3CXCS 2DIQA 2GFAA 2JM8A 2M0OA 1JU5C 4IUQA 4DBHA 4NS5A 2QA4Q 5CK9A 1N8RR 4H2UA 3HP9A 2QK0A 2CYZB 1QP3A 4IUVA 3VJPA 3W3SA 1X56A 2DL7A 4H2XB 2LX7A 4G84A 3EHQA 4C5EA 1JEGA 5GMKj 4XTUA 2ZT5A 2RPNA 2RQRA 3I5SA 2DYBA 4CS3A 3SHWA 4RQEA 2KSSA 4XAXB 3KBGA 3JB9F 4J9IA 4XU1A 3RESA 3I55A 3INZA 1M3BA 2ENMA 2XTIA 4ZTUB 1VQLQ 4J9CA 4LD9K 1X69A 1YIJT 2COYA 3H0IA 2MMPA 4KUDK 1WA7A 1M8MA 2J7IA 1M90C 12ASA 2V1RA 1GCQC 3CCJQ 1RAEB 4II1A 1WHGA 5FU7C 3D7SB 1B70A 1X2HA 3C0CA 1VQKQ 2R5MA 3QUIA 2D9TA 3FEOA 1ABOA 5FROA 1WLEA 3JCMe 3SWNC 4FU6A 4C0DC 4NL2A 3NHNA 2ZNJA 2O9VA 4EMHA 3OY9A 2M9UA 5FRNA 4M7AD 2HCKA 4JUVA 1G51A 3META 1JJ2P 1NE8A 3CMAQ 4WCIA 1RI0A 2MIOA 2K5FA 1QW1A 5A2QE 3URGA 4Q15A 1HXDA 3LGLA 3HXYA 4JPBW 3CCUQ 2K79A 2HL5C 4IIOA 1QVGS 5AT1B 2CUBA 2EPDA 2HQEA 1FYNA 1RL2A 3QG1A 3CC2A 3TUPA 2VGNA 3M0PA 1M5Q1 1SF9A 1G3TA 3E19A 3L2RA 4HXJA 4BDYA 5LJ5j 2CZ0B 5KYNA 3X26B 4FL6A 2CP5A 4LE9A 5CKDA 5DLOA 1HSQA 4TVWA 4EMGA 2ROLA 3HTZA 2EVRA 4F7UE 2MOXA 5A0LA 2WSEE 3LYIA 1ASZA 2QTVA 4HVWA 5KYXA 3MPUB 5C6SA 4M7DE 5C0MA 2DD4A 3PT9A 3FLGA 4D6WA 4EX5A 5CKBA 3IG2A 1VQNQ 1WYDA 4X5OA 2MI6A 3QXEB 4AFUC 3NFCA 1ACMB 3EFSA 4XK8E 3RMSA 1KHIA 2ECZA 1CSKA 1BB9A 1YJ9A 4CH6A 2A37A 3J81E 1NLPC 1UGVA 3S6WA 2RB6A 1BI2A 2X4JA 4M75A 3RR6A 2DL4A 4X34A 1OULA 3OB9A 3REAB 5GANg 4AT1B 3QO5A 4YRTA 5I22A 2IPOB 1H3HA 4CC4B 1BBZA 3PCOB 3G6EQ 3CCLT 2DL8A 4BI4A 3E1SA 3HRSA 4ME7A 1LCKA 5I21A 4LD6A 3WXMB 3I56T 2BUDA 3LWHA 2J3LA 3KXTA 3CC4T 5LJ3h 3CCEA 4NOYA 2P5IA 2JZ2A 2EGAA 4L6V5 3A31A 2CREA 4YCVA 1VOMA 4M7DG 3CCQQ 4M78D 1X6GA 4MZMA 5L8RE 2DZ9A 2EIFA 5DLQE 4E7KA 1VQPQ 3DLLA 4PLLA 1N9RA 2DQ3A 1UGRB 1QMCA 1KD1U 2ZIOA 3P8VA 4Y28E 3CC7Q 1JO8A 4OMMA 3A8LB 3CMET 2HZYA 1OEBA 4LVKA 3SB2A 5IH2A 2NYSA 2MAMA 3H9NA 1KMNA 3UT1A 4PJOF 1YFNA 4DPGA 3G7ZA 3V8KA 2YWWA 3IQLA 3MEAA 1H3ZA 3QJ6A 1K0SA 1B7YA 3QDFA 1K76A 4FYWB 4BW9A 3M4QA 2FZKB 2QA4T 2AMCB 2RHZA 4C5IA 4FT2A 2Q5IA 2XG8D 4X9DA 2O4XB 2LP5A 1H4TA 2AKLA 2DXBA 2K5IA 4GLMA 2QGGA 1YHQQ 4M7DB 2CJBA 4OB3B 1VYTA 2C06A 3HKSA 1M90R 1MUZA 2CP6A 7AT1B 2OAUA 2XDPA 3CCSQ 2QHTA 2GNCA 3LX7A 3EG0A 4JRQA 1M4ZA 2QG9B 2KRSA 3UA6A 4OGCA 3GBQA 2IVWA 1SHGA 4P71A 4EDUA 2YRCA 5FU6B 1WXTA 2BZXA 1B76A 3NGPA 1WHHA 2QYZA 3CCJT 3VV0A 3MQZA 1N6AA 2KNBB 3DLMA 3IALA 1NNHA 5KE3A 4BD3A 2DL3A 4OMFB 4TVAB 3CPFA 1PYSB 1NJ1A 3NPFA 4M77A 1VQKT 2ARSA 2L5QA 1ARKA 2XI9A 3MP1A 2P0QA 1W2BP 3QJYA 1P92A 1KQSP 1GL5A 1T3SA 5IHNA 4J15A 4M7AE 4HCBA 4QQ6A
chains in the Genus database with same CATH topology
1Q86U 4L59A 3OW2S 4RMOA 1YJWA 3UDCA 2Q7HA 4YRSA 3OSSC 4PJOB 3CCUT 2WSCE 4R55A 4QQDA 4DQ2A 1G3SA 4RG8A 2OTLT 4A4HA 2E5QA 2A8EA 4P73C 5HK0A 1BBWA 1IZ6A 4P5NA 4LDXA 2DXCA 4HKEA 5J39A 5GAN4 3A5ZB 5GAMj 3OYKA 4K87A 3L4GB 3RMQA 3WVDB 4XTXA 4QVCA 3LSSA 1JJ2A 5CVIA 3M56A 1KMMA 2L89A 1VQNT 1H4SA 4JDSA 2JUFA 3NTIA 4L5GA 5GAN7 3VU3C 4N0AA 3VBBA 2E6NA 2KQWA 3P8YA 3H6ZA 5GANf 4M7AG 1R8OB 4PLIA 5M9OA 2EJ9A 3BDLA 4M7DC 2Q5HA 3VQYA 4YROA 4Q6GA 3JB9D 1K8AC 4B9WA 3RGLA 3CCVT 2E64A 3GP8A 2ODRC 5LJ3d 5C51B 1NZ9A 1OZ2A 1LNXA 3PTAA 1J5WA 3QZ5B 1EQRA 2IY5A 5FU6C 2J3MA 4TTVA 5I2MA 5GAN5 3S3NA 5GAMh 3HSBA 4VUBA 3L2UA 2ZTGA 1N8RC 3CCQT 4LDYA 4M78E 4LVLA 4YCWA 2QEXA 1KC8U 1VQPT 1U1TA 1Y7XA 2RI2A 4P75C 3JCMX 4M7AB 3JCMb 4RKUE 2JNGA 3CC7T 1VQZA 5CKHA 3C4SA 4HWTA 2P0KA 2F5KA 5F5WA 3JCMV 3MP6A 5ELOA 1G5HA 3OYYA 1VQ8A 4DOWA 3HY1A 1NJ8A 3MEYA 3MCAB 4C8QA 1D3BA 2QQAA 1SRYA 1IREB 5GAN8 4C92E 1Y96B 3OD1A 2P4TA 3FDRA 1YJNA 4M78G 3CCST 1GXIE 3P8DA 2QHUA 3X25B 2I4NA 3R6OA 3OYJA 3X20B 2K4YA 4BI3A 4XTZA 1JBMA 1LJOA 3JCMJ 4JS4A 1I5LA 2K57A 2Q7GA 1FWZA 3PIOA 2PMEA 2RK1A 5GAOm 4J7IA 3QO7A 4CH5A 3QKJA 3RUXA 1UGSB 3HRTA 2QTXA 1K9MU 2DQ0A 3A8HB 4BE0A 1WJSA 5D6WA 4XU0A 3CMQA 2KDSA 3C94A 4ELYC 1I81A 2G4CA 3CD6T 4BWAA 4KULA 4M75F 1NJ6A 1Q82U 3JSCA 1X54A 2ZNIA 1VQ4T 4EMKA 3NELA 2HD0A 3JB9I 4M7AC 2V8IA 2DDZA 1B70B 3S3MA 3IKMB 3HXUA 1W2BA 3E9GA 4PJOD 3JCMg 5GMKe 2LCLA 4HT8A 2IG0A 2DKGA 2CZ1B 1WU7A 1XNIA 2JN0A 4YP0A 4P3OA 2X4XA 3OSVA 4BDZA 1Q7YC 3TREA 4A54A 1VQ6A 3E9FA 5GAOl 2V8KA 4TQFA 3G4ST 1K73U 2KMTA 3QIIA 2GF7A 2R57A 2QI2A 2M1HA 4IUPA 3ASKA 2AKWA 1ZBXA 1M9SA 2XD0A 1N9SA 4ZTZB 3L2ZA 3QNEA 2VUBA 3QBYA 1VQ9T 4C0GA 4FIBA 4C8QD 4XTWA 3QZ9B 2HNIA 2RH2A 4XTVA 2DTOA 1NJIU 4P74C 5GAMd 4UPAA 1KHCA 1QE0A 2ZXFA 4CI0C 2ZINA 5ELNA 4L87A 1BKBA 2X35A 4C5HA 5LJ5e 3CBMA 4YRNA 4KQEA 1UB4A 2ZT7A 4M75B 1QVFA 3JCMc 4QW2A 2AHJB 4YRGA 3DB3A 2PVGB 3P8HA 2A7YA 3I55T 1Z7MA 1MGQA 2CGHA 3SWNA 3H8ZA 4RCBA 3OMCA 3HRKA 4M78C 3RKXA 2E65A 4XEOA 3JB9G 3UPUA 4B9XA 2YRVA 1BI0A 2RHQA 4CS4A 3HPWA 2DO3A 3LSQA 4KBMB 3M54A 2LCCA 2DTIA 4LDWA 3GLXA 3JCMQ 4M77F 4K86A 1YFSA 5GMKi 4HWOA 1SESA 2ZPHB 2EQKA 1QVPA 1OYXA 1UGPB 1M8VA 3X24B 5LJ3j 5FRMA 4CH4A 1KG1A 3CC2T 4C92C 1S72A 4YRPA 5AYFA 4M77G 3BJUA 4DOVA 2X4YA 3A7AA 2ZZGA 1WQWA 1B7YB 1SSFA 1WPYA 4JRIA 1XOVA 1VQ7T 1O9SA 3LLRA 1HTTA 2RJDA 3CCRA 2RHXA 4A53A 3GF5A 3LWIA 5LJ5f 1N8RU 4A4FA 5KE2A 2PU9B 4GY5A 1VQMA 1YJ9T 5CKEA 3A8MB 3OS5A 2XHCA 3CCLA 5DY9A 3HFVA 3MF2A 2HQXA 2E6ZA 2CZ7B 2OTJA 1VQOT 1VUBA 2VYTA 3I56A 5A0DA 2F69A 3Q1JA 3JCMf 1JB0E 1ZHIA 2ZR3A 4M77B 1M1GA 2NLUA 3QTCA 3JRZA 4PJOE 5D6XA 2O01E 1E22A 2DEQA 1NPRA 1USYC 1VIEA 3CCET 3HL8A 1QF6A 1M1KC 4ZTFA 3M59A 1PSEA 5CO7A 4HT4A 5KNNA 3A32A 2X4WA 3TEHA 4P72C 1HC7A 4PNOA 2LT1A 3G71A 2LVMA 4O6JA 3V7CA 4ZGEB 1BYMA 3PNWC 4OB0B 4KR3A 3HRUA 1MHNA 4C8QE 3BY7A 3PMTA 2E3CA 4QVZA 3VQXA 5IT9E 2RJCA 3S3OA 2KY9A 3M9QA 4H2TA 4PG3A 2QQRA 3CCMT 3OA6A 4PJOG 3QO8A 3V8LA 1YI2T 4MZTA 2ZPBB 4J6YA 5GAOp 1Q81C 3V8JA 1VIFA 4C8QF 4H2YA 3ERRA 2FB7A 4ZGJB 1VQLA 1E1TA 3ZBDA 2H3JA 1B34A 3PZCA 5GAMe 2GCXA 3CCJA 4AH6A 3UFGA 2DU7A 1YCYA 4ELZC 2RHYA 3P8TA 3HFZA 1G3YA 4M75D 3OYHA 4TQDA 2F5TX 4XU3A 2IY5B 3IKLA 3AHUA 4C8QG 3I7FA 1YITT 3V7RA 2YLCA 5K1XA 3NETA 2ZZEA 1ATIA 2PUOB 3CMAA 1FX7A 2E12A 2EKOA 4J6WA 4N4HA 4WJ4A 2DXTA 1NPPA 4TWAA 3DKMA 5GMKm 3NTHA 1YJWT 4CS2A 2LC4A 4OB2B 4LNSA 5IN1A 4PL6A 3HFOA 5GANj 2ZCFB 3TEGA 1JJ2S 3FIFA 3RKYA 4LVJA 3WVEB 4BE2A 1N27A 4C8QB 1D3BB 1BIBA 4F7UA 4Y91A 3DSQA 2E70A 4BY6B 2R58A 3N5BB 2JTFA 1LYLA 2FL7A 3TCJA 5HK3A 2DXUA 5GAOr 3JCMW 2JOYA 1FYFA 5E3IA 3G6EA 1M90U 4N0AC 3V7SA 1G5IA 2XGTA 5GMKl 1WJQA 4BE1A 2LQ8A 2VXEA 4FM4B 5GANh 1VQ5T 2LTOA 4BB7A 1Y71A 2KK4A 3CCQA 3QO3A 4H02A 4IUTA 2CS7A 5CKFA 1VQPA 4H2WA 4BI8B 2P0LA 3PGGA 3EFRA 3LH0A 4MMKA 4M77D 3A8OB 4BUGA 2B8AA 3JCMd 3P8BB 1E24A 3L42A 2QEXT 2ZT8A 2QQBA 1TH7A 5C52B 3JB9J 4OB1B 4PJOC 4RMFA 3J7AF 2E10A 4EMKB 3VQWA 2DVEA 4YRCA 3VUBA 1C0AA 4ZN1A 3OYNA 4YREA 3C95A 1YHQA 2RJEA 3VYGA 4RDXA 3M4GA 1VQ8T 2QHSA 3CCSA 2Y4XA 3UWNA 4HA8A 4UP8A 1X75C 4MZPA 3OMGA 2AKWB 2C8MA 4C8QC 1NJ2A 2CIMA 5KCOA 1YJNT 5J26A 3OBYA 4TVRA 3CBPA 4J5YA 4J6XA 2VV5A 1H641 3BDUA 2FYKA 4GLKA 1SERA 1ZQ1A 3A5YA 2LQKA 3CPWA 1EIYA 3NENA 1JRIA 4M75E 4WF2A 3JB9H 2C7IA 2DK3A 3E9HA 2ODRD 5LJ5g 2WACA 2K3YA 4ZN3A 3OS1A 4YRQA 1W66A 2DU5A 1WJRA 1IL2A 4TVYA 3O8VA 5I2SA 2ZPIB 2RA2A 5FU7B 2MF2A 2EAYA 1VQ4A 1X2GA 3HY0A 2E1HA 3SWNB 1W2BS 2PMFA 1KQSS 1AHJB 2XKOC 5A0GA 2RHQB 2RI3A 1N9WA 4XEMA 3GNGA 4YRFA 4EMKC 1YB3A 2ZCEA 4QVDA 5CQYA 2P0PA 4M75G 3A7RA 3G4SA 2LRQA 1Q86C 3QSUA 1JJCA 1YGBA 2YHTA 3LW5E 1YBYA 2ALYA 2K2VA 3UH0A 4G85A 1U1SA 1VQ6T 5LL6S 1VQ9A 1X6OA 3BW1A 5HKCA 4E7HA 4P74A 4C0FA 4KT0E 2VGMA 4ZGDB 5K1PA 5GANd 3M4YA 1BIAA 2RHSA 5FLXE 4JRPA 1FXXA 2EWNA 3CXCA 1BBUA 2I4LA 4OF1A 2QQSA 1X55A 4C0ZA 2DTHA 1SETA 2ARUA 3FC3A 1QVFS 5LJ3e 1YIJA 3JCMP 1DJ7B 2XDBA 3NTKA 3LC0A 2BKDN 4YRRA 4RQFA 4M77E 4CH3A 3JAME 3REUA 4M78A 2XDDA 3FB9A 3GOXA 4N4GA 4FT4A 4JLIA 3M4PA 4DA4A 4RCCA 2ZPGB 3FRNA 2DPPB 2ZZDA 4J7FA 1O75A 4OP0A 2LDMA 1E1OA 2KVQG 1KC8C 4K88A 5CR2A 2FVUA 2MWPA 2EL9A 2ZR2A 2PUKB 1U8RA 4C92A 3TEHB 1QVGA 3M55A 4FSXA 5GMKh 1EOVA 1K8AU 3REXA 1I8FA 4RG2A 4J83A 3OYEA 3M58A 1NYQA 2CKKA 2QXFA 1VQ7A 1S72T 2ZT6A 4J8OA 3NEMA 3HXZA 4H2XA 2M16A 5GAN2 1YFRA 3L1AA 2DD5A 3TU4K 5LJ3f 2FHDA 4F7UF 3CCRT 4E7JA 4LVIA 2V8JA 1EVKA 3CEYA 1B34B 5GAMg 4M7DF 1VQOA 3QYHB 4M75C 3CC4A 2EQMA 1VQMT 2ZPFB 1EFWA 5LJ5h 5CQXA 2OTJT 4XQ3A 1USYA 2CJAA 4LDUA 4Q5WA 3HFZB 2RI5A 4MDWA 3UGTA 4F7UG 1WNLA 3M53A 5GAOq 3TEEA 5CAIA 4Z02A 3CMEA 5CCAA 4A4KA 2RD1A 4P72A 1K9MC 3A74A 3PIPA 3MO8A 3JCMh 4XTYA 1UGQB 3GPLA 4JS5A 2XICA 4HWPA 4C5GA 3DB4A 1Q82C 4ZTJA 2QA4A 1GGMA 3OYDA 11ASA 1G5VA 2EFIA 3G71T 3GNFB 3PMIA 4KUIA 3QDRB 4ZIBA 3CCMA 4WI1A 3FJPA 2XIDA 1YI2A 4F7UB 2ZPEB 1BI1A 5GAN3 2A3LA 4C92D 1UEBA 5GAN6 3QYGB 3EAEA 3X28B 4NL3A 5D6YA 1K73C 1ADYA 3L2WA 4H2SA 3HXXA 3ZFJA 5GANe 3RIRA 4EPCA 3PCOA 1H4VB 1VQKA 5EG2A 3ME9A 3VKIA 1VQLT 3R07A 4UP7A 3WQZA 4P71C 3M57A 4YRKA 1NJIC 3G1ZA 1B8AA 2ZGWA 1YITA 1L0WA 4UP9A 3QPHA 4V2SA 4M77C 3CCUA 3RL6A 3HXWA 4JLGA 1YFTA 1Q7YU 4P73A 1M1FA 2OTLA 2E5AA 3QHSA 2D6FA 1KQ2A 1NYRA 3OW2A 4QQGA 2QHVA 2QDYB 5DM7R 3CMAT 3ICAA 4KR2A 1X01A 4E47A 1WQ7A 4YTLA 3OYBA 3SD4A 3MEUA 4X9CA 2EJGA 2K3XA 4E7IA 3KFUA 2VXFA 2PQWA 1VQNA 4M7AF 3L2QA 2LX9A 4HWSA 2AMCA 2LNVA 2Q7EA 3OYLA 4ATOA 4HCCA 2O4XA 1WGSA 2WSFE 4E7LA 2HBPA 2RM4A 4M7DA 3MHXA 5HGQA 3RKWA 2JVVA 3VUZA 5KH6A 2ARTA 2XK0A 5HY6A 2D0QB 5GAMf 4OLFA 3CCVA 1KQ1A 4HWRA 4PHCA 4OVAA 4YRMA 2HAXA 1EVLA 1QP2A 2RK2A 3CBOA 3UGQA 2Y4YA 5LJ5d 3L2VA 4HT9A 4EO4A 4TVAA 3OS2A 3G6ET 1PYSA 1VQ5A 1EIYB 2RJFA 4UC4A 4P75A 3OYGA 2L8DA 3ER0A 4OGEA 1HK9A 3M5AA 5J3BA 1BI3A 4O5VA 3VQVA 3MEWA 3OS0A 1Z7NA 2DJZA 3CC7A 2XU8A 2CJ9A 4IUUA 1NJ5A 3LGFA 1XTDA 2PVOB 2RHUA 3HXVA 4CRIA 4PJOA 2VC8A 2GFUA 4JRKA 3OQ5A 3OYCA 3C12A 3SDZA 4YPFA 2LT4A 3RERA 2KAFA 1W4SA 1EIFA 4LDVA 1PSFA 2MWOA 4YRJA 4H2VA 4M78F 3A5ZA 4P3PA 4O2DA 5IAYA 4P3NA 3L4GA 2E41A 2Y90A 2EQUA 4XU2A 5CIUA 2EYQA 3SFMA 1V29B 4YYEA 4A4EA 2I4OA 1KD1C 4NCXA 2BIVA 1JJCB 4IURA 2NS6A 4A4GA 2ALYB 1YHQT 2DIGA 1RIQA 4JJNK 4YRIA 4YDQA 4BY6C 1OZ3A 3A8GB 1ADJA 3VYHB 1KOGA 2G3RA 2L3RA 3CPWS 4C92F 2ZIMA 4HVCA 3KUFA 2K5LA 4M7DD 2DAQA 1OI1A 4MDXA 2RHSB 2I2LA 3MEVA 3OYAA 3GIBA 3MP8A 1XQHA 3ZEHA 4YRLA 5C53B 3HFNA 2GQVA 3OYMA 1H4QA 4WJ3M 5LJ3g 2I4MA 3OYIA 5KCHA 1M1KU 5GAOn 3PFSA 3CD6A 3RACA 4C92G 4M7AA 2DZCA 4IKFA 4HCZA 3OBWA 2RO0A 1Y07A 4BACA 3HHTB 4M78B 4C0DB 2ZZFA 4MMLA 2YLBA 4R56A 4LVMA 1I4K1 1G3WA 3F70A 3E9IA 2CZ6B 3MF1A 3A7UA 3J80E 3RF1A 1KQSA 2R5AA 1Y96A 2EQJA 4PKCC 1Q81U 2RHIA 2EJFA 3HRIA 4E51A 4YCUA 3OYFA 1LOJA 4C92B 1ASYA 3BFMA 2PVDB 4N4IA 2QQ9A 2JTMA 3T9NA 3CXCS 2DIQA 2M0OA 2GFAA 4H2UA 4IUQA 4NS5A 5CK9A 3HP9A 2CYZB 1QP3A 4IUVA 3VJPA 3W3SA 1X56A 4H2XB 4G84A 4C5EA 5GMKj 4XTUA 2ZT5A 4CS3A 4RQEA 2KSSA 4XAXB 3KBGA 3JB9F 4XU1A 3RESA 3I55A 3INZA 2XTIA 4ZTUB 4LD9K 1YIJT 2MMPA 4KUDK 1M90C 12ASA 4II1A 5FU7C 1B70A 1X2HA 2R5MA 3QUIA 2D9TA 3FEOA 5FROA 1WLEA 3JCMe 3SWNC 4FU6A 4C0DC 4NL2A 2ZNJA 4EMHA 3OY9A 2M9UA 5FRNA 4M7AD 4JUVA 1G51A 3META 1NE8A 1RI0A 4Q15A 2K5FA 1QW1A 5A2QE 3URGA 1HXDA 3LGLA 3HXYA 1QVGS 2HQEA 1RL2A 3QG1A 3CC2A 3TUPA 2VGNA 1M5Q1 3E19A 1G3TA 3L2RA 4BDYA 5LJ5j 2CZ0B 3X26B 4FL6A 5CKDA 5DLOA 4TVWA 4EMGA 3HTZA 4F7UE 5A0LA 2WSEE 3LYIA 1ASZA 5C6SA 4M7DE 5C0MA 2DD4A 3PT9A 3FLGA 4D6WA 4EX5A 5CKBA 3IG2A 1WYDA 4X5OA 2MI6A 3QXEB 3NFCA 3EFSA 4XK8E 3RMSA 1KHIA 1YJ9A 4CH6A 3J81E 3S6WA 2RB6A 1BI2A 2X4JA 4M75A 4X34A 3OB9A 5GANg 3QO5A 4YRTA 3PCOB 3CCLT 4BI4A 3E1SA 3HRSA 4ME7A 5I21A 4LD6A 3WXMB 3I56T 2BUDA 3LWHA 2J3LA 3KXTA 3CC4T 5LJ3h 3CCEA 4NOYA 2P5IA 2JZ2A 4L6V5 3A31A 4YCVA 4M7DG 4M78D 4MZMA 5L8RE 2DZ9A 2EIFA 5DLQE 4E7KA 3DLLA 4PLLA 1N9RA 2DQ3A 1UGRB 1KD1U 3P8VA 2ZIOA 4Y28E 3CMET 3A8LB 4LVKA 3SB2A 2MAMA 1KMNA 3UT1A 4PJOF 4DPGA 3G7ZA 3V8KA 3MEAA 1H3ZA 3QJ6A 1B7YA 4BW9A 3M4QA 2QA4T 2AMCB 2RHZA 4C5IA 4FT2A 2Q5IA 2XG8D 4X9DA 2O4XB 1H4TA 2DXBA 2K5IA 4M7DB 2CJBA 4OB3B 2C06A 3HKSA 2OAUA 2XDPA 2QHTA 3LX7A 4JRQA 1M4ZA 4OGCA 2IVWA 4P71A 4EDUA 5FU6B 1B76A 3CCJT 3VV0A 3MQZA 1N6AA 3DLMA 3IALA 1NNHA 5KE3A 4BD3A 4OMFB 4TVAB 3CPFA 1PYSB 1NJ1A 4M77A 1VQKT 2ARSA 2L5QA 2XI9A 3MP1A 2P0QA 3QJYA 1P92A 4J15A 4M7AE 4HCBA 4QQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E41 A;  2Y90 A;  4XU2 A;  5K1P A;  5DY9 A;  3HFV A;  2Q7H A;  5GAN d;  3MF2 A;  4YRS A;  4YYE A;  2I4O A;  4PJO B;  4NCX A;  1BIA A;  4DQ2 A;  2RHS A;  2EWN A;  1JJC B;  1BBU A;  2I4L A;  3JCM f;  1X55 A;  2ALY B;  2ZR3 A;  1RIQ A;  2DTH A;  4M77 B;  4P73 C;  1BBW A;  1SET A;  4YRI A;  2ARU A;  4YDQ A;  3QTC A;  4PJO E;  5LJ3 e;  3JCM P;  5GAN 4;  5GAM j;  1E22 A;  2DEQ A;  1ADJ A;  1USY C;  4K87 A;  3L4G B;  3LC0 A;  1KOG A;  4XTX A;  4QVC A;  3LSS A;  4YRR A;  1QF6 A;  4RQF A;  4M77 E;  4C92 F;  2ZIM A;  4CH3 A;  4HVC A;  3REU A;  4M78 A;  1KMM A;  4M7D D;  1H4S A;  5KNN A;  3FB9 A;  5GAN 7;  3A32 A;  3VU3 C;  4N0A A;  2RHS B;  3TEH A;  4P72 C;  2I2L A;  1HC7 A;  3VBB A;  4PNO A;  3GIB A;  4JLI A;  3M4P A;  3P8Y A;  5GAN f;  4M7A G;  4YRL A;  5C53 B;  3V7C A;  4RCC A;  3HFN A;  2EJ9 A;  1H4Q A;  4WJ3 M;  5LJ3 g;  2I4M A;  4M7D C;  4KR3 A;  2Q5H A;  3VQY A;  5GAO n;  4C8Q E;  4YRO A;  3BY7 A;  4Q6G A;  3JB9 D;  2E3C A;  3RAC A;  4OP0 A;  3VQX A;  4C92 G;  4M7A A;  3RGL A;  2DZC A;  2E64 A;  1E1O A;  2ODR C;  4K88 A;  5LJ3 d;  5C51 B;  4M78 B;  2EL9 A;  2ZR2 A;  1LNX A;  4H2T A;  4PG3 A;  2ZZF A;  1J5W A;  4MML A;  1EQR A;  4PJO G;  3QO8 A;  3V8L A;  2IY5 A;  2YLB A;  4C92 A;  2J3M A;  4TTV A;  4J6Y A;  3TEH B;  5GAN 5;  5GAO p;  5GAM h;  1I4K 1;  3HSB A;  3V8J A;  5GMK h;  2ZTG A;  1EOV A;  4C8Q F;  4H2Y A;  3ERR A;  4M78 E;  3REX A;  1I8F A;  2FB7 A;  3E9I A;  3MF1 A;  1E1T A;  4YCW A;  3A7U A;  1B34 A;  3PZC A;  5GAM e;  3RF1 A;  1U1T A;  1NYQ A;  4P75 C;  1Y96 A;  3JCM X;  4AH6 A;  3UFG A;  4M7A B;  2DU7 A;  3JCM b;  1YCY A;  2ZT6 A;  1VQZ A;  3NEM A;  3HXZ A;  3P8T A;  4H2X A;  2EJF A;  4HWT A;  3HFZ A;  3HRI A;  4E51 A;  5GAN 2;  1YFR A;  4M75 D;  4TQD A;  4YCU A;  3L1A A;  4XU3 A;  2IY5 B;  3IKL A;  3AHU A;  5F5W A;  1LOJ A;  4C92 B;  4C8Q G;  5LJ3 f;  1ASY A;  3I7F A;  3V7R A;  2YLC A;  3JCM V;  5K1X A;  3NET A;  2ZZE A;  4F7U F;  5ELO A;  1ATI A;  1G5H A;  3BFM A;  3HY1 A;  1NJ8 A;  1EVK A;  1B34 B;  5GAM g;  4M7D F;  3MEY A;  4C8Q A;  1D3B A;  4J6W A;  1SRY A;  5GAN 8;  4C92 E;  4WJ4 A;  2DXT A;  4M75 C;  1Y96 B;  4H2U A;  4TWA A;  3OD1 A;  3HXV A;  5GMK m;  3W3S A;  4CS2 A;  1X56 A;  4M78 G;  2QHU A;  4H2X B;  1EFW A;  4G84 A;  5LJ5 h;  4XQ3 A;  1USY A;  2CJA A;  3HFZ B;  4LNS A;  2I4N A;  3HFO A;  5GMK j;  4XTU A;  2ZT5 A;  5GAN j;  3UGT A;  3TEG A;  4CS3 A;  4F7U G;  4RQE A;  1WNL A;  3JB9 F;  3FIF A;  5GAO q;  5CAI A;  4XTZ A;  4XU1 A;  3RES A;  3RKY A;  3INZ A;  1JBM A;  2XTI A;  4ZTU B;  1LJO A;  2RD1 A;  4P72 A;  3JCM J;  3A74 A;  12AS A;  4C8Q B;  1D3B B;  1BIB A;  1I5L A;  4F7U A;  4Y91 A;  3DSQ A;  3JCM h;  2K57 A;  2Q7G A;  4XTY A;  2PME A;  5GAO m;  1B70 A;  1X2H A;  1LYL A;  4HWP A;  3QUI A;  3QO7 A;  4CH5 A;  1WLE A;  3RUX A;  3JCM e;  1GGM A;  3SWN C;  2DXU A;  4NL2 A;  5GAO r;  2ZNJ A;  3JCM W;  4EMH A;  11AS A;  2QTX A;  1FYF A;  5E3I A;  2DQ0 A;  4M7A D;  4N0A C;  4JUV A;  1G51 A;  4XU0 A;  3CMQ A;  3V7S A;  1G5I A;  2XGT A;  5GMK l;  4ZIB A;  4Q15 A;  1HXD A;  3HXY A;  4WI1 A;  1I81 A;  2G4C A;  4BWA A;  3FJP A;  4F7U B;  2VXE A;  4M75 F;  5GAN 3;  1NJ6 A;  4C92 D;  5GAN 6;  3TUP A;  5GAN h;  1X54 A;  2ZNI A;  1M5Q 1;  4EMK A;  4NL3 A;  3JB9 I;  3NEL A;  5LJ5 j;  4M7A C;  2DDZ A;  1B70 B;  3QO3 A;  3IKM B;  4H02 A;  1ADY A;  4TVW A;  4H2S A;  3HXX A;  3HXU A;  4PJO D;  3JCM g;  4EMG A;  5GMK e;  5GAN e;  4HT8 A;  3RIR A;  3HTZ A;  4H2W A;  4F7U E;  2DKG A;  1ASZ A;  1WU7 A;  2JN0 A;  2P0L A;  3PCO A;  3PGG A;  1H4V B;  4YP0 A;  3EFR A;  4P3O A;  4MMK A;  4M7D E;  4M77 D;  3R07 A;  3JCM d;  1E24 A;  4EX5 A;  3IG2 A;  4A54 A;  4UP7 A;  1WYD A;  5GAO l;  4X5O A;  2ZT8 A;  4TQF A;  3WQZ A;  4P71 C;  1TH7 A;  3EFS A;  4YRK A;  5C52 B;  3JB9 J;  4PJO C;  3G1Z A;  1B8A A;  4RMF A;  2AKW A;  2E10 A;  2ZGW A;  1L0W A;  4CH6 A;  4UP9 A;  4EMK B;  1N9S A;  3VQW A;  2DVE A;  4YRC A;  4ZTZ B;  3L2Z A;  2RB6 A;  4V2S A;  3QNE A;  4M77 C;  4M75 A;  3RL6 A;  3HXW A;  5GAN g;  3QO5 A;  1YFT A;  1C0A A;  4YRT A;  4C8Q D;  4XTW A;  4P73 A;  2E5A A;  3QHS A;  2HNI A;  4YRE A;  1KQ2 A;  4XTV A;  1NYR A;  2DTO A;  3PCO B;  4P74 C;  2QHV A;  5GAM d;  4RDX A;  4UPA A;  3M4G A;  2QHS A;  3ICA A;  4KR2 A;  1X01 A;  5I21 A;  1WQ7 A;  4HA8 A;  1QE0 A;  4UP8 A;  2ZXF A;  2J3L A;  2ZIN A;  4X9C A;  5LJ3 h;  5ELN A;  4L87 A;  4NOY A;  2AKW B;  2P5I A;  2C8M A;  2EJG A;  4C8Q C;  5LJ5 e;  1NJ2 A;  2CIM A;  3A31 A;  4YRN A;  2VXF A;  3KFU A;  4KQE A;  4YCV A;  4M7D G;  4M78 D;  4M7A F;  2ZT7 A;  2DZ9 A;  4M75 B;  4HWS A;  3JCM c;  2AMC A;  2Q7E A;  4J5Y A;  4J6X A;  1H64 1;  3BDU A;  2FYK A;  4YRG A;  1N9R A;  2DQ3 A;  1SER A;  3A5Y A;  3P8V A;  2ZIO A;  2RM4 A;  4M7D A;  1EIY A;  3NEN A;  1JRI A;  1Z7M A;  1MGQ A;  5HGQ A;  3RKW A;  2CGH A;  3SWN A;  4M75 E;  4RCB A;  4WF2 A;  3HRK A;  4M78 C;  3RKX A;  3SB2 A;  2E65 A;  4XEO A;  1KMN A;  2ART A;  3JB9 G;  3JB9 H;  2C7I A;  2RHQ A;  4CS4 A;  4PJO F;  3E9H A;  5GAM f;  4OLF A;  2ODR D;  4DPG A;  1KQ1 A;  3LSQ A;  4HWR A;  4PHC A;  3V8K A;  5LJ5 g;  4YRM A;  1EVL A;  4YRQ A;  1W66 A;  2DU5 A;  2DTI A;  1IL2 A;  3JCM Q;  1B7Y A;  4TVY A;  4M77 F;  4K86 A;  1YFS A;  3UGQ A;  5GMK i;  4BW9 A;  3M4Q A;  2AMC B;  2RA2 A;  5LJ5 d;  4HT9 A;  4EO4 A;  2Q5I A;  4HWO A;  4TVA A;  4X9D A;  1SES A;  1PYS A;  1H4T A;  2EAY A;  4M7D B;  2CJB A;  1EIY B;  1X2G A;  3HY0 A;  2E1H A;  4P75 A;  3SWN B;  1M8V A;  2QHT A;  2PMF A;  5LJ3 j;  1HK9 A;  4CH4 A;  2RHQ B;  3VQV A;  1Z7N A;  1N9W A;  2DJZ A;  4C92 C;  2CJ9 A;  4XEM A;  4YRP A;  1NJ5 A;  4P71 A;  4M77 G;  3BJU A;  4YRF A;  1B76 A;  3A7A A;  4PJO A;  4EMK C;  2VC8 A;  4QVD A;  1YB3 A;  1WQW A;  1B7Y B;  2ZCE A;  2ZZG A;  4M75 G;  3A7R A;  1WPY A;  4JRK A;  3QSU A;  4JRI A;  1JJC A;  1YGB A;  2YHT A;  3IAL A;  1NNH A;  2ALY A;  4YPF A;  1HTT A;  4TVA B;  3RER A;  1PYS B;  1NJ1 A;  3UH0 A;  4M77 A;  2ARS A;  4G85 A;  4A53 A;  5LJ5 f;  1U1S A;  4YRJ A;  4H2V A;  4M78 F;  3A5Z A;  4P3P A;  4O2D A;  3BW1 A;  4P3N A;  3L4G A;  4J15 A;  4P74 A;  4M7A E; 
#chains in the Genus database with same CATH topology
 1Q86 U;  4L59 A;  3OW2 S;  4RMO A;  2DJQ A;  1YJW A;  3UDC A;  1RAB B;  2P84 A;  2Q7H A;  1QWF A;  4YRS A;  5ECA A;  3OSS C;  4PJO B;  3CCU T;  2WSC E;  4R55 A;  4QQD A;  4DQ2 A;  1G3S A;  2NUP A;  3EG9 B;  4PJJ A;  4RG8 A;  2AIR B;  3CD6 Q;  2OTL T;  2J06 A;  4A4H A;  2E5Q A;  2W10 A;  2A8E A;  1ZSZ C;  4P73 C;  5HK0 A;  1VQ4 Q;  1BBW A;  1WFW A;  1IZ6 A;  4P5N A;  4LDX A;  2DXC A;  4HKE A;  5J39 A;  5GAN 4;  2CH4 W;  3A5Z B;  5GAM j;  3OYK A;  1X2Q A;  4K87 A;  3L4G B;  1RAH B;  4PFO A;  4RTZ A;  3RMQ A;  3WVD B;  4XTX A;  4QVC A;  3LSS A;  1JJ2 A;  5CVI A;  3M56 A;  2F2W A;  1KMM A;  2L89 A;  1VQN T;  1H4S A;  4JDS A;  2JUF A;  3NTI A;  4L5G A;  5GAN 7;  3VU3 C;  4N0A A;  3G4S Q;  3VBB A;  2E6N A;  2KQW A;  3P8Y A;  3H6Z A;  4J9F A;  5GAN f;  4M7A G;  1R8O B;  2LJ3 A;  1RAG B;  4PLI A;  5M9O A;  4OMP A;  1AWW A;  2EJ9 A;  1D1C A;  3BDL A;  4M7D C;  2Q5H A;  3VQY A;  1PRM C;  1QVF P;  1VQ9 Q;  4YRO A;  4Q6G A;  3JB9 D;  1K8A C;  4B9W A;  1M2V A;  3RGL A;  3CCV T;  2E64 A;  4OMN A;  3GP8 A;  2ODR C;  3EGD B;  2SRC A;  2NUT A;  5D7U A;  5LJ3 d;  1GRI A;  1NZ9 A;  1OZ2 A;  5C51 B;  1LNX A;  3PTA A;  1J5W A;  3QZ5 B;  2GGR A;  2AKK A;  1EQR A;  4LNP A;  4JJC A;  2DX1 A;  2IY5 A;  1YP5 A;  5FU6 C;  2J3M A;  4TTV A;  5I2M A;  5GAN 5;  3S3N A;  5GAM h;  1SRL A;  3HSB A;  3PVL A;  4VUB A;  3L2U A;  2ZTG A;  1N8R C;  1RAD B;  3CCQ T;  4LDY A;  4M78 E;  4LVL A;  2FZG B;  2D8H A;  4YCW A;  1TU0 B;  3VS0 A;  2BTT A;  2QEX A;  1KC8 U;  1VQP T;  1YIJ Q;  3NMZ C;  1U1T A;  1Y7X A;  1NM7 A;  2RI2 A;  4P75 C;  3JCM X;  4ORZ A;  4RUG A;  2LQN A;  2KRN A;  4M7A B;  3JCM b;  4RKU E;  2JNG A;  1OU8 A;  3CC7 T;  2V26 A;  1RLQ C;  1VQZ A;  1SG5 A;  5CKH A;  3CQT A;  3C4S A;  4HWT A;  2P0K A;  1PCX A;  3EG3 A;  2F5K A;  5F5W A;  1X43 A;  1JXO A;  3JCM V;  1SRM A;  3MP6 A;  5ELO A;  2M02 A;  1G5H A;  3OYY A;  2O88 A;  1VQ8 A;  1MV0 B;  2HKQ B;  2VB6 A;  4DOW A;  2FPD A;  3HY1 A;  1NJ8 A;  3MEY A;  3MCA B;  4C8Q A;  1D3B A;  2QQA A;  1SRY A;  1IRE B;  1Z9Z A;  5GAN 8;  1MNE A;  4C92 E;  1TOV A;  1Y96 B;  2LNH B;  3OD1 A;  1WHM A;  2P4T A;  1HYO A;  3FDR A;  1YJN A;  4M78 G;  3CCS T;  4WTO B;  3P8D A;  1GXI E;  2QHU A;  1BCO A;  3RDV A;  4E2F B;  1WHL A;  2E5K A;  3X25 B;  2I4N A;  2P4R A;  1M27 C;  3R6O A;  2J6K A;  1T3L A;  4KH1 B;  1UHF A;  3OYJ A;  1M3C A;  2DF6 A;  3X20 B;  2K4Y A;  4BI3 A;  3CC2 Q;  1YWO A;  4XTZ A;  1IXD A;  1JBM A;  1LJO A;  6AT1 B;  2YRD A;  3JCM J;  4JS4 A;  1I5L A;  4ESR A;  2YUN A;  2K57 A;  4PFP A;  2Q7G A;  1VQ7 Q;  1FWZ A;  3PIO A;  2PME A;  2RK1 A;  5GAO m;  4J7I A;  3VS3 A;  1D1B A;  3QO7 A;  3VRZ A;  4CH5 A;  3QKJ A;  3RUX A;  3I5R A;  5IXB A;  3PE0 A;  2J6F A;  1UGS B;  2SEM A;  3HRT A;  5FW9 A;  5KYY A;  2JT4 A;  1QQJ A;  4A63 B;  2QTX A;  1K9M U;  2DQ0 A;  3A8H B;  1YJ9 Q;  4BE0 A;  1WJS A;  5D6W A;  4XU0 A;  3CMQ A;  2KDS A;  3C94 A;  1WX6 A;  4ELY C;  1I81 A;  4DEX A;  2G4C A;  1VQO Q;  3CD6 T;  4BWA A;  4KUL A;  4M75 F;  1NJ6 A;  1Q82 U;  2C0T A;  4OMO A;  1RLP C;  3JSC A;  1X54 A;  2ZNI A;  1VQ4 T;  4EMK A;  3NEL A;  3A98 A;  2HD0 A;  3TSZ A;  3JB9 I;  4M7A C;  2V8I A;  4QKU A;  2DRM A;  2DDZ A;  2ATC B;  1B70 B;  3S3M A;  3IKM B;  1E6H A;  2ROT A;  3HXU A;  1W2B A;  3E9G A;  4PJO D;  3JCM g;  5GMK e;  1F1B B;  2LCL A;  4HT8 A;  1LPL A;  2DET A;  2IG0 A;  1M2O A;  2DKG A;  2CZ1 B;  1WU7 A;  1XNI A;  2JN0 A;  4LN2 A;  4YP0 A;  4P3O A;  2X4X A;  3OSV A;  4BDZ A;  1Q7Y C;  3TRE A;  3CME Q;  4A54 A;  1VQ6 A;  3E9F A;  5GAO l;  1PHT A;  2V8K A;  4TQF A;  3G4S T;  1K73 U;  1SEM A;  2KMT A;  2KI7 A;  3QII A;  1BU1 A;  2GF7 A;  2R57 A;  2QI2 A;  2M1H A;  4IUP A;  3ASK A;  2AKW A;  1ZBX A;  2K6D A;  1M9S A;  2XD0 A;  3I35 A;  1N9S A;  2JW4 A;  3PVQ A;  4ZTZ B;  3L2Z A;  3QNE A;  2VUB A;  2YT6 A;  3QBY A;  1VQ9 T;  4C0G A;  4FIB A;  4C8Q D;  4XTW A;  3QZ9 B;  1Y0M A;  2LMJ A;  2HNI A;  2RH2 A;  1SSH A;  3G1J A;  4XTV A;  2DTO A;  1PC0 A;  5KYX B;  4M4Z A;  1NJI U;  2DM1 A;  4P74 C;  5GAM d;  5I11 A;  4UPA A;  2AT1 B;  4AFZ C;  1KHC A;  3H0F A;  3SEM A;  2ZAE A;  1QE0 A;  1GFC A;  2ZXF A;  2YUO A;  3CCM Q;  5L23 A;  4CI0 C;  1IHW A;  2ZIN A;  1YI2 Q;  5ELN A;  4L87 A;  1BKB A;  2X35 A;  1I0C A;  4C5H A;  5LJ5 e;  3CBM A;  1MMG A;  4YRN A;  1AWX A;  4KQE A;  1PM3 A;  1UB4 A;  2ZT7 A;  2RQV A;  3EFO A;  4M75 B;  1QVF A;  3JCM c;  4QW2 A;  2O9S A;  1B3Q A;  4R0K A;  2DE0 X;  2AHJ B;  4YRG A;  3DB3 A;  2PVG B;  2DLP A;  3P8H A;  1D0Z A;  2A7Y A;  1NLO C;  3I55 T;  1Z7M A;  1MGQ A;  2EBP A;  2CGH A;  2CSI A;  3SWN A;  2EYW A;  3H8Z A;  4RCB A;  1RAC B;  3OMC A;  3HRK A;  4M78 C;  3RKX A;  2E65 A;  4XEO A;  1W1F A;  3JB9 G;  3UPU A;  4B9X A;  2YRV A;  1BI0 A;  2RHQ A;  3MJX A;  4CS4 A;  3HPW A;  4D8D A;  2DO3 A;  3LSQ A;  1YIT Q;  2OJ2 A;  4KBM B;  1QCN A;  3M54 A;  2LCC A;  2DTI A;  1KIK A;  1PNJ A;  4LDW A;  3GLX A;  3JCM Q;  4M77 F;  4K86 A;  2O31 A;  1YFS A;  1UHC A;  5GMK i;  1IGQ A;  1K4U S;  3VS1 A;  2KEA A;  1MND A;  4HWO A;  2OTL Q;  1SES A;  2ZPH B;  1OX8 A;  1IO6 A;  2EQK A;  1QVP A;  1OYX A;  1WI7 A;  1UGP B;  1M8V A;  3X24 B;  1AOJ A;  4HVV A;  5LJ3 j;  1T0H A;  5FRM A;  4ZNX A;  3H0H A;  4CH4 A;  4Z8A A;  3VS5 A;  1KG1 A;  3CC2 T;  4C92 C;  1GBQ A;  2AZV A;  1S72 A;  4YRP A;  5AYF A;  8ATC B;  4M77 G;  3BJU A;  4DOV A;  2X4Y A;  2X9H A;  3H41 A;  1QKW A;  3A7A A;  5KYU A;  2ZZG A;  1WQW A;  1B7Y B;  1SSF A;  1WPY A;  4JRI A;  1XOV A;  1VQ7 T;  1O9S A;  3LLR A;  1HTT A;  2RJD A;  2PTK A;  1OX9 A;  3CCR A;  2RHX A;  4A53 A;  3GF5 A;  3LWI A;  5LJ5 f;  1WXU A;  1N8R U;  4A4F A;  5KE2 A;  2PU9 B;  4GY5 A;  1YJ9 T;  1VQM A;  5CKE A;  3A8M B;  1KJW A;  3VS7 A;  3CCV Q;  3OS5 A;  1X27 A;  2XHC A;  1FMK A;  3CCL A;  5DY9 A;  3HFV A;  3MF2 A;  2HQX A;  1IB8 A;  2E6Z A;  2CZ7 B;  1B07 A;  2OTJ A;  3EGU A;  1VQO T;  1VUB A;  2VYT A;  3I56 A;  5A0D A;  2W0Z A;  5KYW A;  2E4H A;  2F69 A;  3Q1J A;  2RMO A;  3JCM f;  1JB0 E;  1ZHI A;  1Q7Y R;  2ZR3 A;  4M77 B;  1VQ5 Q;  1M1G A;  4Y92 A;  2NLU A;  3QTC A;  3JRZ A;  4PJO E;  1G83 A;  5D6X A;  2O01 E;  1E22 A;  2COW A;  1H8K A;  2DEQ A;  1NPR A;  3TSW A;  1USY C;  1VIE A;  3CCE T;  3HL8 A;  4AG2 C;  2HSE B;  1QF6 A;  1M1K C;  4ZTF A;  3M59 A;  1PSE A;  5CO7 A;  3EH2 A;  4HT4 A;  3TVT A;  5KNN A;  2GTO A;  1ZUY A;  3A32 A;  2QEX Q;  2X4W A;  2NUP B;  3REB B;  4P72 C;  3TEH A;  2HMA A;  1HC7 A;  4PNO A;  4PJM A;  2DBM A;  2LT1 A;  3G71 A;  2KR3 A;  2LVM A;  4O6J A;  3V7C A;  4ZGE B;  3M0T A;  1BYM A;  3PNW C;  4OB0 B;  4KR3 A;  3HRU A;  2H8H A;  4RTY A;  1MHN A;  4C8Q E;  1TUD A;  3BY7 A;  3PMT A;  2E3C A;  2FZC B;  4QVZ A;  3VQX A;  2LJ0 A;  2KT1 A;  2RJC A;  5IXF A;  5IT9 E;  4RTX A;  3S3O A;  4J9E A;  2KY9 A;  2RF0 A;  3CPW P;  3M9Q A;  4H2T A;  4PG3 A;  1VQ8 Q;  2QQR A;  4FW2 A;  3CCM T;  3OA6 A;  4PJO G;  3QO8 A;  3V8L A;  1YI2 T;  4MZT A;  1NEG A;  2ZPB B;  4J6Y A;  2DBK A;  5GAO p;  2EYX A;  1Q81 C;  2RNA A;  3V8J A;  1TS9 A;  1VIF A;  3RNJ A;  4FCY A;  4C8Q F;  4H2Y A;  3ERR A;  2FB7 A;  3HTR A;  4ZGJ B;  1VQL A;  2JS0 A;  2OI3 A;  1E1T A;  3ZBD A;  2H3J A;  1B34 A;  3PZC A;  1TUG B;  5GAM e;  2GCX A;  3CCJ A;  4AH6 A;  2D8J A;  3UFG A;  2DU7 A;  1M2V B;  1YCY A;  2NUT B;  2ED0 A;  2MYS A;  2RHY A;  4ELZ C;  1ZSG A;  3P8T A;  3HFZ A;  1G3Y A;  4M75 D;  3OYH A;  4TQD A;  1MMN A;  2F5T X;  4XU3 A;  2IY5 B;  3IKL A;  3AHU A;  2I0N A;  4FYV B;  4C8Q G;  1RAF B;  1H92 A;  1YIT T;  3I7F A;  2DIL A;  3V7R A;  2YLC A;  5K1X A;  2X3X D;  3AT1 B;  3NET A;  2ZZE A;  1CKA A;  2JXB A;  1ATI A;  2PUO B;  3CMA A;  1FX7 A;  1FMW A;  4PK4 A;  2E12 A;  1TWB A;  2EKO A;  4J6W A;  4N4H A;  4WJ4 A;  2YXY A;  2DXT A;  1ZSZ A;  1NPP A;  4TWA A;  3U23 A;  3DKM A;  1ABQ A;  5GMK m;  1YNZ A;  1R0C B;  3NTH A;  1YJW T;  4CS2 A;  3M0Q A;  2LC4 A;  1W70 A;  2K9G A;  4OB2 B;  4LNS A;  5IN1 A;  4PL6 A;  3HFO A;  5GAN j;  2ZCF B;  3TEG A;  1JJ2 S;  3FIF A;  3LH5 A;  3RKY A;  2L3Q A;  4LVJ A;  3FJ5 A;  3WVE B;  3R6N A;  4BE2 A;  1N27 A;  4C8Q B;  1D3B B;  1BIB A;  4F7U A;  4Y91 A;  3DSQ A;  2E70 A;  3CXC P;  4JJD A;  4J9G A;  4BY6 B;  2R58 A;  1D0X A;  3N5B B;  2JTF A;  1LYL A;  2FL7 A;  1UG1 A;  3TCJ A;  5HK3 A;  2DXU A;  5GAO r;  1YCS B;  4JZ4 A;  3JCM W;  2JOY A;  4GBQ A;  2A36 A;  1FYF A;  4KH0 B;  5E3I A;  3G6E A;  1M90 U;  4N0A C;  2BZ8 A;  4IIM A;  1ZA2 B;  3V7S A;  1G5I A;  2XGT A;  1SKU B;  5GMK l;  1UUE A;  3JV3 A;  1WJQ A;  4BE1 A;  4JZ3 A;  1K9A A;  1C6V X;  2FRW A;  1QKX A;  2LQ8 A;  2VXE A;  1M1K R;  4FM4 B;  5GAN h;  1VQ5 T;  2LTO A;  4BB7 A;  2LJ1 A;  2E3H A;  1Y71 A;  2KK4 A;  3CCQ A;  1RAI B;  3QO3 A;  1Q95 G;  2FO0 A;  4H02 A;  1EFN A;  4IUT A;  2CS7 A;  2QAZ A;  5CKF A;  1VQP A;  4H2W A;  2CUD A;  4BI8 B;  5KYY B;  2P0L A;  2Z0W A;  3PGG A;  3EFR A;  3LH0 A;  4MMK A;  1TG0 A;  1JXM A;  4M77 D;  3A8O B;  4BUG A;  2B8A A;  3JCM d;  3I55 Q;  3P8B B;  1UTI A;  1E24 A;  2KXD A;  3L42 A;  1PD0 A;  2QEX T;  2ZT8 A;  2QQB A;  1QWE A;  1TH7 A;  4KGZ B;  2RQU A;  3O5Z A;  5C52 B;  3EG9 A;  2CP0 A;  1I07 A;  3JB9 J;  4OB1 B;  4PJO C;  4RMF A;  3J7A F;  2E10 A;  1QVG P;  3A1P A;  3VS2 A;  2VKN A;  1MV3 A;  4EMK B;  3VQW A;  2DVE A;  4YRC A;  4F16 A;  3EG1 A;  2CP2 A;  3M0S A;  2CP3 A;  1Q81 R;  3VUB A;  1C0A A;  4ZN1 A;  3OYN A;  2A28 A;  4YRE A;  3C95 A;  1YHQ A;  2RJE A;  2CP7 A;  2DNU A;  3VYG A;  4RDX A;  3M4G A;  1VQ8 T;  2QHS A;  3CCS A;  2Y4X A;  3UWN A;  2L3P A;  4HA8 A;  4UP8 A;  3EG2 A;  3THK A;  1X75 C;  2YDL A;  4MZP A;  2ABL A;  2CDT A;  3OMG A;  2AKW B;  2C8M A;  4C8Q C;  1NJ2 A;  2CIM A;  2EYY A;  5KCO A;  1YJN T;  3KFV A;  5J26 A;  3OBY A;  1R77 A;  2OX7 A;  3QWY A;  4TVR A;  1EX4 A;  1IHV A;  4Z89 A;  1K1Z A;  3CBP A;  2C0I A;  2ED1 A;  4J5Y A;  4J6X A;  2VV5 A;  1H64 1;  3BDU A;  2FYK A;  4GLK A;  1SER A;  1ZQ1 A;  3A5Y A;  2LQK A;  3CPW A;  1EIY A;  1NYG A;  4J9H A;  2CT3 A;  1UE9 A;  3NEN A;  1JRI A;  2EYZ A;  1S72 Q;  1PKT A;  4M75 E;  4WF2 A;  1U06 A;  3JB9 H;  2A0F B;  2DK3 A;  2C7I A;  2OAW A;  3E9H A;  2ODR D;  1WHK A;  5LJ5 g;  2WAC A;  2K3Y A;  4ZN3 A;  2QGF B;  3OS1 A;  4YRQ A;  1W66 A;  2DU5 A;  1CKB A;  1WJR A;  1IL2 A;  4TVY A;  5IHI A;  3EFO B;  3O8V A;  5I2S A;  2ZPI B;  2RA2 A;  5FU7 B;  2MF2 A;  4CC3 A;  1VQM Q;  2EAY A;  2HDA A;  1VQ4 A;  1AZE A;  1RUW A;  1X2G A;  3HY0 A;  2E1H A;  3SWN B;  1W2B S;  2PMF A;  1KQS S;  1OPK A;  4RTT A;  2OTJ Q;  1AHJ B;  5IHK A;  2XKO C;  5A0G A;  1PD1 A;  1D09 B;  2RHQ B;  2RI3 A;  3CCE Q;  1N9W A;  4XEM A;  3GNG A;  2KRO A;  2DYI A;  1G8X A;  4YRF A;  4QT7 A;  4EMK C;  1YB3 A;  2ZCE A;  4QVD A;  5CQY A;  2P0P A;  4M75 G;  3A7R A;  3G4S A;  2LRQ A;  1Q86 C;  3QSU A;  1JJC A;  1YGB A;  2YHT A;  3LW5 E;  1YBY A;  2ALY A;  1AEY A;  1LVK A;  2K2V A;  3UH0 A;  2L2P A;  4F17 A;  4G85 A;  3EH1 A;  1U1S A;  1VQ6 T;  3EHR A;  5LL6 S;  2A08 A;  1VQ9 A;  1E6G A;  2VWF A;  1X6O A;  1VYV A;  2DEU A;  3BW1 A;  5HKC A;  4J9B A;  1QCF A;  4E7H A;  4P74 A;  4D8K A;  1Y57 A;  4C0F A;  4KT0 E;  2VGM A;  2KXC A;  4ZGD B;  1OOT A;  3G71 Q;  5K1P A;  5GAN d;  4HCK A;  2DFU A;  5KYU B;  2KYB A;  2L0A A;  3M4Y A;  2JJ9 A;  3EGX A;  1BIA A;  2FG0 A;  2RHS A;  5FLX E;  4JRP A;  1FXX A;  2EWN A;  3CXC A;  1BBU A;  1TXQ A;  1K0X A;  2I4L A;  4CC7 A;  4OF1 A;  2QQS A;  1X55 A;  4C0Z A;  2DTH A;  1SET A;  2ARU A;  3FC3 A;  1WYX A;  1GCQ A;  1QVF S;  5LJ3 e;  1YIJ A;  3JCM P;  1R0B G;  4DEY A;  1DJ7 B;  2XDB A;  3UAT A;  1M3A A;  2LZ6 B;  3NTK A;  3LC0 A;  2BKD N;  1QCO A;  3I9Q A;  3ULR B;  4YRR A;  4RQF A;  4M77 E;  4CH3 A;  3JAM E;  3REU A;  4M78 A;  1PWT A;  2XDD A;  1ZUK A;  1ZLM A;  3OW2 P;  3FB9 A;  2RQT A;  3GOX A;  4AG1 C;  1JQQ A;  1WDX A;  1BK2 A;  5KYW B;  4N4G A;  4FT4 A;  4JLI A;  4DBF A;  3M4P A;  4DA4 A;  2X3W D;  4RCC A;  2ZPG B;  3VRY A;  3FRN A;  1KD1 R;  5EC7 A;  2GTJ A;  1YN8 A;  2DPP B;  2ZZD A;  1I5O B;  4J7F A;  1A0N B;  1O75 A;  4OP0 A;  2LDM A;  4FYX B;  1C1A A;  1UJ0 A;  1KK7 A;  2LQW A;  2JM9 A;  1E1O A;  2KVQ G;  1KC8 C;  4K88 A;  5CR2 A;  2GBQ A;  2FVU A;  2COZ A;  2MWP A;  1YJW Q;  2EL9 A;  2ZR2 A;  2PUK B;  4AFQ C;  1U8R A;  2AZS A;  4C92 A;  1GFD A;  3TEH B;  1QVG A;  2IIM A;  3M55 A;  4FSX A;  2NWM A;  5GMK h;  1EOV A;  2G6F X;  1K8A U;  3REX A;  1I8F A;  4RG2 A;  2K7A A;  1UEC A;  4J83 A;  3OYE A;  1WIE A;  2VVK A;  3M58 A;  1S1N A;  1NYQ A;  2CKK A;  2QXF A;  1M30 A;  1VQ7 A;  3RBB B;  1S72 T;  2ZT6 A;  1U3O A;  4J8O A;  3NEM A;  3HXZ A;  4H2X A;  2M16 A;  1N5Z A;  2YUQ A;  1GCP A;  5GAN 2;  1YFR A;  1YWP A;  3L1A A;  1EZZ B;  2DD5 A;  1NYF A;  3TU4 K;  5LJ3 f;  1HD3 A;  4B6M A;  2FHD A;  4F7U F;  3CCR T;  4E7J A;  4LVI A;  1UJY A;  2V8J A;  1WXB A;  1WHJ A;  3CEY A;  1EVK A;  1B34 B;  5GAM g;  4M7D F;  1VQO A;  2FPF A;  3QYH B;  4M75 C;  3CC4 A;  2EQM A;  2XMF A;  9ATC B;  1VQM T;  1I1J A;  2ZPF B;  2EGE A;  2HL3 A;  5FWB A;  1EFW A;  5LJ5 h;  2KBT A;  5CQX A;  1Q86 R;  4OML A;  4XQ3 A;  2OTJ T;  1USY A;  2CJA A;  4LDU A;  4Q5W A;  3HFZ B;  2RI5 A;  2X51 A;  4MDW A;  4KGV B;  3UGT A;  4DBQ A;  4F7U G;  2YSQ A;  1WNL A;  3M53 A;  5GAO q;  3TEE A;  5CAI A;  4Z02 A;  3CME A;  1SPK A;  5CCA A;  4A4K A;  2RD1 A;  4P72 A;  1K9M C;  2GQI A;  3A74 A;  3PIP A;  1ZSZ B;  3MO8 A;  3JCM h;  2L3S A;  4XTY A;  1UGQ B;  3GPL A;  4JS5 A;  4EIK A;  2XIC A;  4HWP A;  4C5G A;  3DB4 A;  1Q82 C;  2VAS A;  4ZTJ A;  2QA4 A;  1GGM A;  2FRY A;  3OYD A;  1W6X A;  11AS A;  1G5V A;  2EFI A;  3UF4 A;  3G71 T;  1TUC A;  3GNF B;  1SHF A;  2HEQ A;  3PMI A;  4KUI A;  3QDR B;  4ZIB A;  1TTH B;  3CCM A;  4WI1 A;  3FJP A;  2XID A;  1YI2 A;  4F7U B;  2ZPE B;  1BI1 A;  2PNI A;  5GAN 3;  2A3L A;  4C92 D;  1AD5 A;  4AFS C;  4DBR A;  1UEB A;  5GAN 6;  3QYG B;  2LCS A;  3EAE A;  3X28 B;  2J6O A;  4NL3 A;  5D6Y A;  2CH4 A;  4PJL A;  1K73 C;  1UDL A;  1YJN Q;  2BE7 D;  1ADY A;  3L2W A;  4H2S A;  3HXX A;  3ZFJ A;  5GAN e;  3RIR A;  1PG5 B;  1X6B A;  1WLP B;  2KRM A;  1MMD A;  4EPC A;  3PCO A;  1H4V B;  1OU9 A;  1VQK A;  5EG2 A;  3ME9 A;  3VKI A;  1VQL T;  3R07 A;  4UP7 A;  3WQZ A;  4P71 C;  3M57 A;  4YRK A;  2KYM A;  1NJI C;  3G1Z A;  1OPL A;  1B8A A;  1KC8 R;  1PKS A;  2ZGW A;  1YIT A;  1L0W A;  4UP9 A;  2BZY A;  1NBE B;  4F14 A;  4RTU A;  3QPH A;  4V2S A;  4M77 C;  2V1Q A;  3CCU A;  3RL6 A;  3HXW A;  2M0Y A;  4JLG A;  1YFT A;  1Q7Y U;  4P73 A;  1M1F A;  2OTL A;  2E5A A;  2RN8 A;  3QHS A;  2D6F A;  1KQ2 A;  2KE9 A;  1NYR A;  3OW2 A;  4QQG A;  2QHV A;  2QDY B;  5DM7 R;  3CMA T;  2DRK A;  1AWJ A;  3ICA A;  4KR2 A;  1X01 A;  2YUP A;  4E47 A;  1WQ7 A;  4YTL A;  3OYB A;  3SD4 A;  3MEU A;  4X9C A;  1WZO A;  3QWX X;  1KFZ A;  2EJG A;  3E2U A;  4LXC A;  2K3X A;  4E7I A;  3KFU A;  2VXF A;  2JS2 A;  1AWO A;  2F2X A;  2PQW A;  1VQN A;  4M7A F;  4ANJ A;  2LX9 A;  3L2Q A;  4HWS A;  2AMC A;  2LNV A;  2Q7E A;  3OYL A;  4ATO A;  1X2K A;  4HCC A;  2CT4 A;  4LUE A;  4AMC A;  3ZL7 C;  2O4X A;  1WGS A;  2WSF E;  4E7L A;  2HBP A;  2RM4 A;  4M7D A;  2JMA A;  4J9D A;  3MHX A;  5HGQ A;  3RKW A;  2D1X A;  2K3B A;  2JVV A;  3VUZ A;  2EW3 A;  5KH6 A;  1VQ6 Q;  2ART A;  2XK0 A;  5HY6 A;  1OQK A;  2D0Q B;  5GAM f;  4OLF A;  2DL5 A;  3CCV A;  1KQ1 A;  4HWR A;  4HVU A;  4PHC A;  4OVA A;  1J3T A;  2JTE A;  4YRM A;  2HAX A;  4KGX B;  2KGT A;  1EVL A;  2DER A;  4Z88 A;  2HQH A;  1QP2 A;  2RK2 A;  3CBO A;  1ZA1 B;  1MMA A;  3UGQ A;  8AT1 B;  2Y4Y A;  5LJ5 d;  1HJD A;  3L2V A;  4HT9 A;  2HKN A;  4EO4 A;  1RAA B;  4TVA A;  3OS2 A;  3G6E T;  1PYS A;  1VQ5 A;  1XJW B;  1Z9Q A;  1AVZ C;  1KSW A;  1EIY B;  2RJF A;  4UC4 A;  1K9M R;  4P75 A;  3OYG A;  2L8D A;  3ER0 A;  4OGE A;  2D0N A;  1HK9 A;  2O2O A;  3M5A A;  2F1L A;  2DMO A;  5J3B A;  1BI3 A;  4O5V A;  1D0Y A;  3VQV A;  3MEW A;  3OS0 A;  1Z7N A;  2DJZ A;  1PRL C;  3CC7 A;  2XU8 A;  2CJ9 A;  4IUU A;  1VYU A;  1GBR A;  3UA7 A;  1NJ5 A;  1Q82 R;  3LGF A;  1V1C A;  1XTD A;  2PVO B;  1C0M A;  2MPX C;  2RHU A;  4CRI A;  4PJO A;  2VC8 A;  2GFU A;  3HXV A;  2JMC A;  4JRK A;  3OQ5 A;  3OYC A;  3C12 A;  1OV3 A;  3SDZ A;  4YPF A;  2HBW A;  2LT4 A;  3RER A;  2KAF A;  1IGU A;  1W4S A;  1EIF A;  4LDV A;  2DA9 A;  1PSF A;  3MKD A;  2MWO A;  4YRJ A;  4RTW A;  2BE9 B;  3M0R A;  4H2V A;  4M78 F;  3A5Z A;  2J05 A;  4P3P A;  4KRT A;  4O2D A;  2QAS A;  3BE3 A;  5IAY A;  4P3N A;  1AZG B;  4FW1 A;  3L4G A;  2M51 A;  1K73 R;  2E41 A;  2Y90 A;  2EQU A;  4XU2 A;  5CIU A;  2C0O A;  2ESW A;  2EYQ A;  3SFM A;  3VS6 A;  1V29 B;  1D1A A;  4YYE A;  4A4E A;  1BCM A;  2I4O A;  1KD1 C;  4NCX A;  2BIV A;  4FSS A;  1UFF A;  4F04 B;  2FEI A;  1JJC B;  2DVJ A;  4IUR A;  2NS6 A;  4A4G A;  2ALY B;  1YHQ T;  5FWC A;  2DIG A;  1RIQ A;  1RI9 A;  4JJN K;  4YRI A;  4YDQ A;  4BY6 C;  1ZX6 A;  3TQ7 P;  1NJI R;  4CC2 A;  1OZ3 A;  1V76 A;  3A8G B;  1ADJ A;  3VYH B;  1KOG A;  2G3R A;  2RQW A;  2L3R A;  1VA7 A;  3EGD A;  3CPW S;  4C92 F;  2ZIM A;  4HVC A;  2PZ1 A;  3KUF A;  1FMV A;  2K5L A;  4M7D D;  2DAQ A;  5GJW B;  2AK5 A;  1OI1 A;  4MDX A;  3EGX B;  2RHS B;  1E7O A;  2I2L A;  2MK5 A;  3MEV A;  1AT1 B;  4E6R A;  3OYA A;  3M0U A;  3GIB A;  3MP8 A;  1XQH A;  1U5S A;  3ZEH A;  4YRL A;  5C53 B;  1IRX A;  3HFN A;  3CCR Q;  2GQV A;  3OYM A;  1H4Q A;  4WJ3 M;  2K2M A;  5LJ3 g;  2I4M A;  3OYI A;  5KCH A;  1M1K U;  5GAO n;  2KT8 A;  1QLY A;  2QDL A;  3PFS A;  3CD6 A;  3RAC A;  2EKH A;  4C92 G;  4M7A A;  2DZC A;  4IKF A;  1B7T A;  4HCZ A;  3OBW A;  2RO0 A;  4PFZ A;  1T0J A;  1Y07 A;  4BAC A;  3HHT B;  4M78 B;  4LUD A;  4C0D B;  3CCL Q;  2ZZF A;  2HSP A;  4MML A;  2NUZ A;  2YLB A;  1ZUU A;  2FPE A;  3I56 Q;  4R56 A;  4E7Z A;  4LVM A;  1I4K 1;  3CC4 Q;  2MCN A;  2CSQ A;  1G3W A;  3F70 A;  2E3I A;  3E9I A;  2CZ6 B;  3MF1 A;  1NEB A;  4JJB A;  4X1V A;  3A7U A;  1NG2 A;  3J80 E;  3RF1 A;  1KQS A;  2F2V A;  2R5A A;  1Y96 A;  1TSF A;  4E7S A;  2EQJ A;  4PKC C;  1Q81 U;  2RHI A;  2EJF A;  1G2B A;  2B86 A;  2EQI A;  3HRI A;  4E51 A;  1K8A R;  4YCU A;  4OMQ A;  3OYF A;  4FYY B;  1ZBJ A;  1LOJ A;  4PJN A;  4C92 B;  1ASY A;  2H3E B;  4RTV A;  2EGC A;  5GJV B;  3BFM A;  2PVD B;  4N4I A;  3VS4 A;  2QQ9 A;  4K11 A;  5HCK A;  2JTM A;  3T9N A;  3CXC S;  2DIQ A;  2GFA A;  2JM8 A;  2M0O A;  1JU5 C;  4IUQ A;  4DBH A;  4NS5 A;  2QA4 Q;  5CK9 A;  1N8R R;  4H2U A;  3HP9 A;  2QK0 A;  2CYZ B;  1QP3 A;  4IUV A;  3VJP A;  3W3S A;  1X56 A;  2DL7 A;  4H2X B;  2LX7 A;  4G84 A;  3EHQ A;  4C5E A;  1JEG A;  5GMK j;  4XTU A;  2ZT5 A;  2RPN A;  2RQR A;  3I5S A;  2DYB A;  4CS3 A;  3SHW A;  4RQE A;  2KSS A;  4XAX B;  3KBG A;  3JB9 F;  4J9I A;  4XU1 A;  3RES A;  3I55 A;  3INZ A;  1M3B A;  2ENM A;  2XTI A;  4ZTU B;  1VQL Q;  4J9C A;  4LD9 K;  1X69 A;  1YIJ T;  2COY A;  3H0I A;  2MMP A;  4KUD K;  1WA7 A;  1M8M A;  2J7I A;  1M90 C;  12AS A;  2V1R A;  1GCQ C;  3CCJ Q;  1RAE B;  4II1 A;  1WHG A;  5FU7 C;  3D7S B;  1B70 A;  1X2H A;  3C0C A;  1VQK Q;  2R5M A;  3QUI A;  2D9T A;  3FEO A;  1ABO A;  5FRO A;  1WLE A;  3JCM e;  3SWN C;  4FU6 A;  4C0D C;  4NL2 A;  3NHN A;  2ZNJ A;  2O9V A;  4EMH A;  3OY9 A;  2M9U A;  5FRN A;  4M7A D;  2HCK A;  4JUV A;  1G51 A;  3MET A;  1JJ2 P;  1NE8 A;  3CMA Q;  4WCI A;  1RI0 A;  2MIO A;  2K5F A;  1QW1 A;  5A2Q E;  3URG A;  4Q15 A;  1HXD A;  3LGL A;  3HXY A;  4JPB W;  3CCU Q;  2K79 A;  2HL5 C;  4IIO A;  1QVG S;  5AT1 B;  2CUB A;  2EPD A;  2HQE A;  1FYN A;  1RL2 A;  3QG1 A;  3CC2 A;  3TUP A;  2VGN A;  3M0P A;  1M5Q 1;  1SF9 A;  1G3T A;  3E19 A;  3L2R A;  4HXJ A;  4BDY A;  5LJ5 j;  2CZ0 B;  5KYN A;  3X26 B;  4FL6 A;  2CP5 A;  4LE9 A;  5CKD A;  5DLO A;  1HSQ A;  4TVW A;  4EMG A;  2ROL A;  3HTZ A;  2EVR A;  4F7U E;  2MOX A;  5A0L A;  2WSE E;  3LYI A;  1ASZ A;  2QTV A;  4HVW A;  5KYX A;  3MPU B;  5C6S A;  4M7D E;  5C0M A;  2DD4 A;  3PT9 A;  3FLG A;  4D6W A;  4EX5 A;  5CKB A;  3IG2 A;  1VQN Q;  1WYD A;  4X5O A;  2MI6 A;  3QXE B;  4AFU C;  3NFC A;  1ACM B;  3EFS A;  4XK8 E;  3RMS A;  1KHI A;  2ECZ A;  1CSK A;  1BB9 A;  1YJ9 A;  4CH6 A;  2A37 A;  3J81 E;  1NLP C;  1UGV A;  3S6W A;  2RB6 A;  1BI2 A;  2X4J A;  4M75 A;  3RR6 A;  2DL4 A;  4X34 A;  1OUL A;  3OB9 A;  3REA B;  5GAN g;  4AT1 B;  3QO5 A;  4YRT A;  5I22 A;  2IPO B;  1H3H A;  4CC4 B;  1BBZ A;  3PCO B;  3G6E Q;  3CCL T;  2DL8 A;  4BI4 A;  3E1S A;  3HRS A;  4ME7 A;  1LCK A;  5I21 A;  4LD6 A;  3WXM B;  3I56 T;  2BUD A;  3LWH A;  2J3L A;  3KXT A;  3CC4 T;  5LJ3 h;  3CCE A;  4NOY A;  2P5I A;  2JZ2 A;  2EGA A;  4L6V 5;  3A31 A;  2CRE A;  4YCV A;  1VOM A;  4M7D G;  3CCQ Q;  4M78 D;  1X6G A;  4MZM A;  5L8R E;  2DZ9 A;  2EIF A;  5DLQ E;  4E7K A;  1VQP Q;  3DLL A;  4PLL A;  1N9R A;  2DQ3 A;  1UGR B;  1QMC A;  1KD1 U;  2ZIO A;  3P8V A;  4Y28 E;  3CC7 Q;  1JO8 A;  4OMM A;  3A8L B;  3CME T;  2HZY A;  1OEB A;  4LVK A;  3SB2 A;  5IH2 A;  2NYS A;  2MAM A;  3H9N A;  1KMN A;  3UT1 A;  4PJO F;  1YFN A;  4DPG A;  3G7Z A;  3V8K A;  2YWW A;  3IQL A;  3MEA A;  1H3Z A;  3QJ6 A;  1K0S A;  1B7Y A;  3QDF A;  1K76 A;  4FYW B;  4BW9 A;  3M4Q A;  2FZK B;  2QA4 T;  2AMC B;  2RHZ A;  4C5I A;  4FT2 A;  2Q5I A;  2XG8 D;  4X9D A;  2O4X B;  2LP5 A;  1H4T A;  2AKL A;  2DXB A;  2K5I A;  4GLM A;  2QGG A;  1YHQ Q;  4M7D B;  2CJB A;  4OB3 B;  1VYT A;  2C06 A;  3HKS A;  1M90 R;  1MUZ A;  2CP6 A;  7AT1 B;  2OAU A;  2XDP A;  3CCS Q;  2QHT A;  2GNC A;  3LX7 A;  3EG0 A;  4JRQ A;  1M4Z A;  2QG9 B;  2KRS A;  3UA6 A;  4OGC A;  3GBQ A;  2IVW A;  1SHG A;  4P71 A;  4EDU A;  2YRC A;  5FU6 B;  1WXT A;  2BZX A;  1B76 A;  3NGP A;  1WHH A;  2QYZ A;  3CCJ T;  3VV0 A;  3MQZ A;  1N6A A;  2KNB B;  3DLM A;  3IAL A;  1NNH A;  5KE3 A;  4BD3 A;  2DL3 A;  4OMF B;  4TVA B;  3CPF A;  1PYS B;  1NJ1 A;  3NPF A;  4M77 A;  1VQK T;  2ARS A;  2L5Q A;  1ARK A;  2XI9 A;  3MP1 A;  2P0Q A;  1W2B P;  3QJY A;  1P92 A;  1KQS P;  1GL5 A;  1T3S A;  5IHN A;  4J15 A;  4M7A E;  4HCB A;  4QQ6 A; 
#chains in the Genus database with same CATH homology
 1Q86 U;  4L59 A;  3OW2 S;  4RMO A;  1YJW A;  3UDC A;  2Q7H A;  4YRS A;  3OSS C;  4PJO B;  3CCU T;  2WSC E;  4R55 A;  4QQD A;  4DQ2 A;  1G3S A;  4RG8 A;  2OTL T;  4A4H A;  2E5Q A;  2A8E A;  4P73 C;  5HK0 A;  1BBW A;  1IZ6 A;  4P5N A;  4LDX A;  2DXC A;  4HKE A;  5J39 A;  5GAN 4;  3A5Z B;  5GAM j;  3OYK A;  4K87 A;  3L4G B;  3RMQ A;  3WVD B;  4XTX A;  4QVC A;  3LSS A;  1JJ2 A;  5CVI A;  3M56 A;  1KMM A;  2L89 A;  1VQN T;  1H4S A;  4JDS A;  2JUF A;  3NTI A;  4L5G A;  5GAN 7;  3VU3 C;  4N0A A;  3VBB A;  2E6N A;  2KQW A;  3P8Y A;  3H6Z A;  5GAN f;  4M7A G;  1R8O B;  4PLI A;  5M9O A;  2EJ9 A;  3BDL A;  4M7D C;  2Q5H A;  3VQY A;  4YRO A;  4Q6G A;  3JB9 D;  1K8A C;  4B9W A;  3RGL A;  3CCV T;  2E64 A;  3GP8 A;  2ODR C;  5LJ3 d;  5C51 B;  1NZ9 A;  1OZ2 A;  1LNX A;  3PTA A;  1J5W A;  3QZ5 B;  1EQR A;  2IY5 A;  5FU6 C;  2J3M A;  4TTV A;  5I2M A;  5GAN 5;  3S3N A;  5GAM h;  3HSB A;  4VUB A;  3L2U A;  2ZTG A;  1N8R C;  3CCQ T;  4LDY A;  4M78 E;  4LVL A;  4YCW A;  2QEX A;  1KC8 U;  1VQP T;  1U1T A;  1Y7X A;  2RI2 A;  4P75 C;  3JCM X;  4M7A B;  3JCM b;  4RKU E;  2JNG A;  3CC7 T;  1VQZ A;  5CKH A;  3C4S A;  4HWT A;  2P0K A;  2F5K A;  5F5W A;  3JCM V;  3MP6 A;  5ELO A;  1G5H A;  3OYY A;  1VQ8 A;  4DOW A;  3HY1 A;  1NJ8 A;  3MEY A;  3MCA B;  4C8Q A;  1D3B A;  2QQA A;  1SRY A;  1IRE B;  5GAN 8;  4C92 E;  1Y96 B;  3OD1 A;  2P4T A;  3FDR A;  1YJN A;  4M78 G;  3CCS T;  1GXI E;  3P8D A;  2QHU A;  3X25 B;  2I4N A;  3R6O A;  3OYJ A;  3X20 B;  2K4Y A;  4BI3 A;  4XTZ A;  1JBM A;  1LJO A;  3JCM J;  4JS4 A;  1I5L A;  2K57 A;  2Q7G A;  1FWZ A;  3PIO A;  2PME A;  2RK1 A;  5GAO m;  4J7I A;  3QO7 A;  4CH5 A;  3QKJ A;  3RUX A;  1UGS B;  3HRT A;  2QTX A;  1K9M U;  2DQ0 A;  3A8H B;  4BE0 A;  1WJS A;  5D6W A;  4XU0 A;  3CMQ A;  2KDS A;  3C94 A;  4ELY C;  1I81 A;  2G4C A;  3CD6 T;  4BWA A;  4KUL A;  4M75 F;  1NJ6 A;  1Q82 U;  3JSC A;  1X54 A;  2ZNI A;  1VQ4 T;  4EMK A;  3NEL A;  2HD0 A;  3JB9 I;  4M7A C;  2V8I A;  2DDZ A;  1B70 B;  3S3M A;  3IKM B;  3HXU A;  1W2B A;  3E9G A;  4PJO D;  3JCM g;  5GMK e;  2LCL A;  4HT8 A;  2IG0 A;  2DKG A;  2CZ1 B;  1WU7 A;  1XNI A;  2JN0 A;  4YP0 A;  4P3O A;  2X4X A;  3OSV A;  4BDZ A;  1Q7Y C;  3TRE A;  4A54 A;  1VQ6 A;  3E9F A;  5GAO l;  2V8K A;  4TQF A;  3G4S T;  1K73 U;  2KMT A;  3QII A;  2GF7 A;  2R57 A;  2QI2 A;  2M1H A;  4IUP A;  3ASK A;  2AKW A;  1ZBX A;  1M9S A;  2XD0 A;  1N9S A;  4ZTZ B;  3L2Z A;  3QNE A;  2VUB A;  3QBY A;  1VQ9 T;  4C0G A;  4FIB A;  4C8Q D;  4XTW A;  3QZ9 B;  2HNI A;  2RH2 A;  4XTV A;  2DTO A;  1NJI U;  4P74 C;  5GAM d;  4UPA A;  1KHC A;  1QE0 A;  2ZXF A;  4CI0 C;  2ZIN A;  5ELN A;  4L87 A;  1BKB A;  2X35 A;  4C5H A;  5LJ5 e;  3CBM A;  4YRN A;  4KQE A;  1UB4 A;  2ZT7 A;  4M75 B;  1QVF A;  3JCM c;  4QW2 A;  2AHJ B;  4YRG A;  3DB3 A;  2PVG B;  3P8H A;  2A7Y A;  3I55 T;  1Z7M A;  1MGQ A;  2CGH A;  3SWN A;  3H8Z A;  4RCB A;  3OMC A;  3HRK A;  4M78 C;  3RKX A;  2E65 A;  4XEO A;  3JB9 G;  3UPU A;  4B9X A;  2YRV A;  1BI0 A;  2RHQ A;  4CS4 A;  3HPW A;  2DO3 A;  3LSQ A;  4KBM B;  3M54 A;  2LCC A;  2DTI A;  4LDW A;  3GLX A;  3JCM Q;  4M77 F;  4K86 A;  1YFS A;  5GMK i;  4HWO A;  1SES A;  2ZPH B;  2EQK A;  1QVP A;  1OYX A;  1UGP B;  1M8V A;  3X24 B;  5LJ3 j;  5FRM A;  4CH4 A;  1KG1 A;  3CC2 T;  4C92 C;  1S72 A;  4YRP A;  5AYF A;  4M77 G;  3BJU A;  4DOV A;  2X4Y A;  3A7A A;  2ZZG A;  1WQW A;  1B7Y B;  1SSF A;  1WPY A;  4JRI A;  1XOV A;  1VQ7 T;  1O9S A;  3LLR A;  1HTT A;  2RJD A;  3CCR A;  2RHX A;  4A53 A;  3GF5 A;  3LWI A;  5LJ5 f;  1N8R U;  4A4F A;  5KE2 A;  2PU9 B;  4GY5 A;  1VQM A;  1YJ9 T;  5CKE A;  3A8M B;  3OS5 A;  2XHC A;  3CCL A;  5DY9 A;  3HFV A;  3MF2 A;  2HQX A;  2E6Z A;  2CZ7 B;  2OTJ A;  1VQO T;  1VUB A;  2VYT A;  3I56 A;  5A0D A;  2F69 A;  3Q1J A;  3JCM f;  1JB0 E;  1ZHI A;  2ZR3 A;  4M77 B;  1M1G A;  2NLU A;  3QTC A;  3JRZ A;  4PJO E;  5D6X A;  2O01 E;  1E22 A;  2DEQ A;  1NPR A;  1USY C;  1VIE A;  3CCE T;  3HL8 A;  1QF6 A;  1M1K C;  4ZTF A;  3M59 A;  1PSE A;  5CO7 A;  4HT4 A;  5KNN A;  3A32 A;  2X4W A;  3TEH A;  4P72 C;  1HC7 A;  4PNO A;  2LT1 A;  3G71 A;  2LVM A;  4O6J A;  3V7C A;  4ZGE B;  1BYM A;  3PNW C;  4OB0 B;  4KR3 A;  3HRU A;  1MHN A;  4C8Q E;  3BY7 A;  3PMT A;  2E3C A;  4QVZ A;  3VQX A;  5IT9 E;  2RJC A;  3S3O A;  2KY9 A;  3M9Q A;  4H2T A;  4PG3 A;  2QQR A;  3CCM T;  3OA6 A;  4PJO G;  3QO8 A;  3V8L A;  1YI2 T;  4MZT A;  2ZPB B;  4J6Y A;  5GAO p;  1Q81 C;  3V8J A;  1VIF A;  4C8Q F;  4H2Y A;  3ERR A;  2FB7 A;  4ZGJ B;  1VQL A;  1E1T A;  3ZBD A;  2H3J A;  1B34 A;  3PZC A;  5GAM e;  2GCX A;  3CCJ A;  4AH6 A;  3UFG A;  2DU7 A;  1YCY A;  4ELZ C;  2RHY A;  3P8T A;  3HFZ A;  1G3Y A;  4M75 D;  3OYH A;  4TQD A;  2F5T X;  4XU3 A;  2IY5 B;  3IKL A;  3AHU A;  4C8Q G;  3I7F A;  1YIT T;  3V7R A;  2YLC A;  5K1X A;  3NET A;  2ZZE A;  1ATI A;  2PUO B;  3CMA A;  1FX7 A;  2E12 A;  2EKO A;  4J6W A;  4N4H A;  4WJ4 A;  2DXT A;  1NPP A;  4TWA A;  3DKM A;  5GMK m;  3NTH A;  1YJW T;  4CS2 A;  2LC4 A;  4OB2 B;  4LNS A;  5IN1 A;  4PL6 A;  3HFO A;  5GAN j;  2ZCF B;  3TEG A;  1JJ2 S;  3FIF A;  3RKY A;  4LVJ A;  3WVE B;  4BE2 A;  1N27 A;  4C8Q B;  1D3B B;  1BIB A;  4F7U A;  4Y91 A;  3DSQ A;  2E70 A;  4BY6 B;  2R58 A;  3N5B B;  2JTF A;  1LYL A;  2FL7 A;  3TCJ A;  5HK3 A;  2DXU A;  5GAO r;  3JCM W;  2JOY A;  1FYF A;  5E3I A;  3G6E A;  1M90 U;  4N0A C;  3V7S A;  1G5I A;  2XGT A;  5GMK l;  1WJQ A;  4BE1 A;  2LQ8 A;  2VXE A;  4FM4 B;  5GAN h;  1VQ5 T;  2LTO A;  4BB7 A;  1Y71 A;  2KK4 A;  3CCQ A;  3QO3 A;  4H02 A;  4IUT A;  2CS7 A;  5CKF A;  1VQP A;  4H2W A;  4BI8 B;  2P0L A;  3PGG A;  3EFR A;  3LH0 A;  4MMK A;  4M77 D;  3A8O B;  4BUG A;  2B8A A;  3JCM d;  3P8B B;  1E24 A;  3L42 A;  2QEX T;  2ZT8 A;  2QQB A;  1TH7 A;  5C52 B;  3JB9 J;  4OB1 B;  4PJO C;  4RMF A;  3J7A F;  2E10 A;  4EMK B;  3VQW A;  2DVE A;  4YRC A;  3VUB A;  1C0A A;  4ZN1 A;  3OYN A;  4YRE A;  3C95 A;  1YHQ A;  2RJE A;  3VYG A;  4RDX A;  3M4G A;  1VQ8 T;  2QHS A;  3CCS A;  2Y4X A;  3UWN A;  4HA8 A;  4UP8 A;  1X75 C;  4MZP A;  3OMG A;  2AKW B;  2C8M A;  4C8Q C;  1NJ2 A;  2CIM A;  5KCO A;  1YJN T;  5J26 A;  3OBY A;  4TVR A;  3CBP A;  4J5Y A;  4J6X A;  2VV5 A;  1H64 1;  3BDU A;  2FYK A;  4GLK A;  1SER A;  1ZQ1 A;  3A5Y A;  2LQK A;  3CPW A;  1EIY A;  3NEN A;  1JRI A;  4M75 E;  4WF2 A;  3JB9 H;  2C7I A;  2DK3 A;  3E9H A;  2ODR D;  5LJ5 g;  2WAC A;  2K3Y A;  4ZN3 A;  3OS1 A;  4YRQ A;  1W66 A;  2DU5 A;  1WJR A;  1IL2 A;  4TVY A;  3O8V A;  5I2S A;  2ZPI B;  2RA2 A;  5FU7 B;  2MF2 A;  2EAY A;  1VQ4 A;  1X2G A;  3HY0 A;  2E1H A;  3SWN B;  1W2B S;  2PMF A;  1KQS S;  1AHJ B;  2XKO C;  5A0G A;  2RHQ B;  2RI3 A;  1N9W A;  4XEM A;  3GNG A;  4YRF A;  4EMK C;  1YB3 A;  2ZCE A;  4QVD A;  5CQY A;  2P0P A;  4M75 G;  3A7R A;  3G4S A;  2LRQ A;  1Q86 C;  3QSU A;  1JJC A;  1YGB A;  2YHT A;  3LW5 E;  1YBY A;  2ALY A;  2K2V A;  3UH0 A;  4G85 A;  1U1S A;  1VQ6 T;  5LL6 S;  1VQ9 A;  1X6O A;  3BW1 A;  5HKC A;  4E7H A;  4P74 A;  4C0F A;  4KT0 E;  2VGM A;  4ZGD B;  5K1P A;  5GAN d;  3M4Y A;  1BIA A;  2RHS A;  5FLX E;  4JRP A;  1FXX A;  2EWN A;  3CXC A;  1BBU A;  2I4L A;  4OF1 A;  2QQS A;  1X55 A;  4C0Z A;  2DTH A;  1SET A;  2ARU A;  3FC3 A;  1QVF S;  5LJ3 e;  1YIJ A;  3JCM P;  1DJ7 B;  2XDB A;  3NTK A;  3LC0 A;  2BKD N;  4YRR A;  4RQF A;  4M77 E;  4CH3 A;  3JAM E;  3REU A;  4M78 A;  2XDD A;  3FB9 A;  3GOX A;  4N4G A;  4FT4 A;  4JLI A;  3M4P A;  4DA4 A;  4RCC A;  2ZPG B;  3FRN A;  2DPP B;  2ZZD A;  4J7F A;  1O75 A;  4OP0 A;  2LDM A;  1E1O A;  2KVQ G;  1KC8 C;  4K88 A;  5CR2 A;  2FVU A;  2MWP A;  2EL9 A;  2ZR2 A;  2PUK B;  1U8R A;  4C92 A;  3TEH B;  1QVG A;  3M55 A;  4FSX A;  5GMK h;  1EOV A;  1K8A U;  3REX A;  1I8F A;  4RG2 A;  4J83 A;  3OYE A;  3M58 A;  1NYQ A;  2CKK A;  2QXF A;  1VQ7 A;  1S72 T;  2ZT6 A;  4J8O A;  3NEM A;  3HXZ A;  4H2X A;  2M16 A;  5GAN 2;  1YFR A;  3L1A A;  2DD5 A;  3TU4 K;  5LJ3 f;  2FHD A;  4F7U F;  3CCR T;  4E7J A;  4LVI A;  2V8J A;  1EVK A;  3CEY A;  1B34 B;  5GAM g;  4M7D F;  1VQO A;  3QYH B;  4M75 C;  3CC4 A;  2EQM A;  1VQM T;  2ZPF B;  1EFW A;  5LJ5 h;  5CQX A;  2OTJ T;  4XQ3 A;  1USY A;  2CJA A;  4LDU A;  4Q5W A;  3HFZ B;  2RI5 A;  4MDW A;  3UGT A;  4F7U G;  1WNL A;  3M53 A;  5GAO q;  3TEE A;  5CAI A;  4Z02 A;  3CME A;  5CCA A;  4A4K A;  2RD1 A;  4P72 A;  1K9M C;  3A74 A;  3PIP A;  3MO8 A;  3JCM h;  4XTY A;  1UGQ B;  3GPL A;  4JS5 A;  2XIC A;  4HWP A;  4C5G A;  3DB4 A;  1Q82 C;  4ZTJ A;  2QA4 A;  1GGM A;  3OYD A;  11AS A;  1G5V A;  2EFI A;  3G71 T;  3GNF B;  3PMI A;  4KUI A;  3QDR B;  4ZIB A;  3CCM A;  4WI1 A;  3FJP A;  2XID A;  1YI2 A;  4F7U B;  2ZPE B;  1BI1 A;  5GAN 3;  2A3L A;  4C92 D;  1UEB A;  5GAN 6;  3QYG B;  3EAE A;  3X28 B;  4NL3 A;  5D6Y A;  1K73 C;  1ADY A;  3L2W A;  4H2S A;  3HXX A;  3ZFJ A;  5GAN e;  3RIR A;  4EPC A;  3PCO A;  1H4V B;  1VQK A;  5EG2 A;  3ME9 A;  3VKI A;  1VQL T;  3R07 A;  4UP7 A;  3WQZ A;  4P71 C;  3M57 A;  4YRK A;  1NJI C;  3G1Z A;  1B8A A;  2ZGW A;  1YIT A;  1L0W A;  4UP9 A;  3QPH A;  4V2S A;  4M77 C;  3CCU A;  3RL6 A;  3HXW A;  4JLG A;  1YFT A;  1Q7Y U;  4P73 A;  1M1F A;  2OTL A;  2E5A A;  3QHS A;  2D6F A;  1KQ2 A;  1NYR A;  3OW2 A;  4QQG A;  2QHV A;  2QDY B;  5DM7 R;  3CMA T;  3ICA A;  4KR2 A;  1X01 A;  4E47 A;  1WQ7 A;  4YTL A;  3OYB A;  3SD4 A;  3MEU A;  4X9C A;  2EJG A;  2K3X A;  4E7I A;  3KFU A;  2VXF A;  2PQW A;  1VQN A;  4M7A F;  3L2Q A;  2LX9 A;  4HWS A;  2AMC A;  2LNV A;  2Q7E A;  3OYL A;  4ATO A;  4HCC A;  2O4X A;  1WGS A;  2WSF E;  4E7L A;  2HBP A;  2RM4 A;  4M7D A;  3MHX A;  5HGQ A;  3RKW A;  2JVV A;  3VUZ A;  5KH6 A;  2ART A;  2XK0 A;  5HY6 A;  2D0Q B;  5GAM f;  4OLF A;  3CCV A;  1KQ1 A;  4HWR A;  4PHC A;  4OVA A;  4YRM A;  2HAX A;  1EVL A;  1QP2 A;  2RK2 A;  3CBO A;  3UGQ A;  2Y4Y A;  5LJ5 d;  3L2V A;  4HT9 A;  4EO4 A;  4TVA A;  3OS2 A;  3G6E T;  1PYS A;  1VQ5 A;  1EIY B;  2RJF A;  4UC4 A;  4P75 A;  3OYG A;  2L8D A;  3ER0 A;  4OGE A;  1HK9 A;  3M5A A;  5J3B A;  1BI3 A;  4O5V A;  3VQV A;  3MEW A;  3OS0 A;  1Z7N A;  2DJZ A;  3CC7 A;  2XU8 A;  2CJ9 A;  4IUU A;  1NJ5 A;  3LGF A;  1XTD A;  2PVO B;  2RHU A;  3HXV A;  4CRI A;  4PJO A;  2VC8 A;  2GFU A;  4JRK A;  3OQ5 A;  3OYC A;  3C12 A;  3SDZ A;  4YPF A;  2LT4 A;  3RER A;  2KAF A;  1W4S A;  1EIF A;  4LDV A;  1PSF A;  2MWO A;  4YRJ A;  4H2V A;  4M78 F;  3A5Z A;  4P3P A;  4O2D A;  5IAY A;  4P3N A;  3L4G A;  2E41 A;  2Y90 A;  2EQU A;  4XU2 A;  5CIU A;  2EYQ A;  3SFM A;  1V29 B;  4YYE A;  4A4E A;  2I4O A;  1KD1 C;  4NCX A;  2BIV A;  1JJC B;  4IUR A;  2NS6 A;  4A4G A;  2ALY B;  1YHQ T;  2DIG A;  1RIQ A;  4JJN K;  4YRI A;  4YDQ A;  4BY6 C;  1OZ3 A;  3A8G B;  1ADJ A;  3VYH B;  1KOG A;  2G3R A;  2L3R A;  3CPW S;  4C92 F;  2ZIM A;  4HVC A;  3KUF A;  2K5L A;  4M7D D;  2DAQ A;  1OI1 A;  4MDX A;  2RHS B;  2I2L A;  3MEV A;  3OYA A;  3GIB A;  3MP8 A;  1XQH A;  3ZEH A;  4YRL A;  5C53 B;  3HFN A;  2GQV A;  3OYM A;  1H4Q A;  4WJ3 M;  5LJ3 g;  2I4M A;  3OYI A;  5KCH A;  1M1K U;  5GAO n;  3PFS A;  3CD6 A;  3RAC A;  4C92 G;  4M7A A;  2DZC A;  4IKF A;  4HCZ A;  3OBW A;  2RO0 A;  1Y07 A;  4BAC A;  3HHT B;  4M78 B;  4C0D B;  2ZZF A;  4MML A;  2YLB A;  4R56 A;  4LVM A;  1I4K 1;  1G3W A;  3F70 A;  3E9I A;  2CZ6 B;  3MF1 A;  3A7U A;  3J80 E;  3RF1 A;  1KQS A;  2R5A A;  1Y96 A;  2EQJ A;  4PKC C;  1Q81 U;  2RHI A;  2EJF A;  3HRI A;  4E51 A;  4YCU A;  3OYF A;  1LOJ A;  4C92 B;  1ASY A;  3BFM A;  2PVD B;  4N4I A;  2QQ9 A;  2JTM A;  3T9N A;  3CXC S;  2DIQ A;  2M0O A;  2GFA A;  4H2U A;  4IUQ A;  4NS5 A;  5CK9 A;  3HP9 A;  2CYZ B;  1QP3 A;  4IUV A;  3VJP A;  3W3S A;  1X56 A;  4H2X B;  4G84 A;  4C5E A;  5GMK j;  4XTU A;  2ZT5 A;  4CS3 A;  4RQE A;  2KSS A;  4XAX B;  3KBG A;  3JB9 F;  4XU1 A;  3RES A;  3I55 A;  3INZ A;  2XTI A;  4ZTU B;  4LD9 K;  1YIJ T;  2MMP A;  4KUD K;  1M90 C;  12AS A;  4II1 A;  5FU7 C;  1B70 A;  1X2H A;  2R5M A;  3QUI A;  2D9T A;  3FEO A;  5FRO A;  1WLE A;  3JCM e;  3SWN C;  4FU6 A;  4C0D C;  4NL2 A;  2ZNJ A;  4EMH A;  3OY9 A;  2M9U A;  5FRN A;  4M7A D;  4JUV A;  1G51 A;  3MET A;  1NE8 A;  1RI0 A;  4Q15 A;  2K5F A;  1QW1 A;  5A2Q E;  3URG A;  1HXD A;  3LGL A;  3HXY A;  1QVG S;  2HQE A;  1RL2 A;  3QG1 A;  3CC2 A;  3TUP A;  2VGN A;  1M5Q 1;  3E19 A;  1G3T A;  3L2R A;  4BDY A;  5LJ5 j;  2CZ0 B;  3X26 B;  4FL6 A;  5CKD A;  5DLO A;  4TVW A;  4EMG A;  3HTZ A;  4F7U E;  5A0L A;  2WSE E;  3LYI A;  1ASZ A;  5C6S A;  4M7D E;  5C0M A;  2DD4 A;  3PT9 A;  3FLG A;  4D6W A;  4EX5 A;  5CKB A;  3IG2 A;  1WYD A;  4X5O A;  2MI6 A;  3QXE B;  3NFC A;  3EFS A;  4XK8 E;  3RMS A;  1KHI A;  1YJ9 A;  4CH6 A;  3J81 E;  3S6W A;  2RB6 A;  1BI2 A;  2X4J A;  4M75 A;  4X34 A;  3OB9 A;  5GAN g;  3QO5 A;  4YRT A;  3PCO B;  3CCL T;  4BI4 A;  3E1S A;  3HRS A;  4ME7 A;  5I21 A;  4LD6 A;  3WXM B;  3I56 T;  2BUD A;  3LWH A;  2J3L A;  3KXT A;  3CC4 T;  5LJ3 h;  3CCE A;  4NOY A;  2P5I A;  2JZ2 A;  4L6V 5;  3A31 A;  4YCV A;  4M7D G;  4M78 D;  4MZM A;  5L8R E;  2DZ9 A;  2EIF A;  5DLQ E;  4E7K A;  3DLL A;  4PLL A;  1N9R A;  2DQ3 A;  1UGR B;  1KD1 U;  3P8V A;  2ZIO A;  4Y28 E;  3CME T;  3A8L B;  4LVK A;  3SB2 A;  2MAM A;  1KMN A;  3UT1 A;  4PJO F;  4DPG A;  3G7Z A;  3V8K A;  3MEA A;  1H3Z A;  3QJ6 A;  1B7Y A;  4BW9 A;  3M4Q A;  2QA4 T;  2AMC B;  2RHZ A;  4C5I A;  4FT2 A;  2Q5I A;  2XG8 D;  4X9D A;  2O4X B;  1H4T A;  2DXB A;  2K5I A;  4M7D B;  2CJB A;  4OB3 B;  2C06 A;  3HKS A;  2OAU A;  2XDP A;  2QHT A;  3LX7 A;  4JRQ A;  1M4Z A;  4OGC A;  2IVW A;  4P71 A;  4EDU A;  5FU6 B;  1B76 A;  3CCJ T;  3VV0 A;  3MQZ A;  1N6A A;  3DLM A;  3IAL A;  1NNH A;  5KE3 A;  4BD3 A;  4OMF B;  4TVA B;  3CPF A;  1PYS B;  1NJ1 A;  4M77 A;  1VQK T;  2ARS A;  2L5Q A;  2XI9 A;  3MP1 A;  2P0Q A;  3QJY A;  1P92 A;  4J15 A;  4M7A E;  4HCB A;  4QQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...