2DTOA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 complexed with atp and biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 67
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtoA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtoA01
1U1TA 4M7AG 2ZINA 2ZR2A 4TTVA 4CH4A 4M75D 2DZ9A 2Q5IA 3SWNB 4UP9A 2DKGA 4F7UF 3QO7A 3RESA 4DPGA 3A74A 5K1PA 4RCCA 4PJOC 3PZCA 4YRJA 3JCMd 1EIYB 2QHVA 1H641 1KQ1A 4NL3A 3V8KA 1NJ6A 3TUPA 5I21A 1USYA 4P75A 5LJ5d 4TWAA 4CS4A 3G1ZA 1PYSA 2ARTA 4CH5A 3V7RA 2C7IA 4P71A 2ZNIA 4XTZA 4JRIA 3UGTA 1NYQA 3JB9G 4P75C 3RKYA 1HK9A 2DXUA 3BW1A 2C8MA 2ODRD 3L2ZA 3E9IA 4M77E 3M4GA 4M7AF 3V8LA 1KMMA 2E1HA 4NCXA 3REXA 2DTHA 2E65A 2ZT7A 4C8QE 1X56A 4YRKA 2ODRC 4QVCA 4YCVA 4KR2A 5GAOr 4RQFA 1SESA 4MMKA 3HXVA 1H4VB 4EX5A 2Q7GA 4CS3A 3A7AA 3NENA 4P73A 1C0AA 3VU3C 4EMHA 4C8QB 5ELOA 4XTXA 4PNOA 5LJ5f 3NELA 4M75G 3RKWA 4H2SA 4M77C 4L87A 2XGTA 1Y96B 1WQ7A 1BIBA 3QNEA 3WQZA 1PYSB 5GAN7 3OD1A 4H2YA 5GAMj 1JRIA 2JN0A 5GAN2 4BW9A 1E1OA 4M75F 2DQ3A 3QHSA 5K1XA 1E1TA 4YRQA 1HC7A 1WLEA 4Y91A 4TVYA 5GMKl 1TH7A 1NYRA 4M7AE 1LNXA 3NETA 5E3IA 4KQEA 1ASZA 4YRFA 4XEOA 5GMKh 5GAOq 3I7FA 4G85A 2YLBA 1NJ1A 4YRPA 3TEHB 1J5WA 3JCMX 2Y90A 2EJFA 4M77G 3EFSA 4M77B 5LJ5g 3UGQA 4YRMA 4XTWA 1EIYA 1SERA 4RCBA 4YRGA 4E51A 3VQWA 5GAOp 3RUXA 3RF1A 3HXZA 1B76A 3P8VA 4CH6A 2EWNA 2PMEA 4M77A 5GAOl 4JUVA 3FIFA 1D3BA 2DJZA 5LJ5h 1HTTA 1EFWA 1D3BB 3HXXA 3A7RA 1WQWA 3JCMW 4P71C 2EL9A 3JCMh 1YFSA 5GAMd 4DQ2A 2PMFA 4V2SA 1YFRA 5CAIA 2IY5A 2ZCEA 3JCMc 4PJOB 3DSQA 4PJOA 3AHUA 2ZNJA 4EO4A 5GAOm 4HVCA 3JB9I 2Q5HA 1B7YB 4P74C 4A53A 2DZCA 4M75A 4M7DF 2ZT5A 2E10A 4MMLA 2ZT6A 5GMKi 1EVKA 2ZZEA 4BWAA 4ZIBA 3JB9J 4A54A 3ERRA 1KOGA 4HT9A 2RM4A 5LJ3d 2VC8A 4P3NA 12ASA 2DEQA 3VQVA 4XU0A 3P8TA 4XTVA 5LJ3g 4WJ4A 3SWNC 3JCMP 4CS2A 5KNNA 1KMNA 4QVDA 4RDXA 3QUIA 3JB9H 2AKWB 4K86A 5GAMf 4J6WA 2RB6A 2I4MA 3BFMA 4ZTUB 2ALYB 4M78F 1SETA 2ZTGA 4H2UA 5LJ3h 2ALYA 4RQEA 2CJ9A 2RHQA 5GAN3 3JCMQ 4M7DC 4F7UG 4TVWA 2AMCB 4P3OA 2FYKA 4Q15A 5GMKe 3RKXA 3V7SA 1E22A 4YRLA 4OP0A 1WU7A 3E9HA 1EQRA 4PJOF 1FYFA 4M78A 1I5LA 3LSSA 4X9DA 2I2LA 4KR3A 3JCMV 4NL2A 3A32A 3JB9D 4X5OA 3QTCA 4YRRA 11ASA 3VQXA 4HWTA 1W66A 3HY0A 1QF6A 2VXFA 5LJ3f 3HFOA 4H2VA 4XEMA 1I8FA 1BBUA 1I4K1 3HXWA 1YGBA 3HFZB 2EJGA 4TVAB 4J6YA 3PGGA 4HWOA 4C8QD 3RL6A 1L0WA 4N0AA 2DTOA 1B8AA 1X55A 3L1AA 4P73C 3HSBA 3KFUA 1NJ5A 4F7UB 3RIRA 4J15A 2ZIMA 1KQ2A 4TVAA 1B7YA 3HTZA 1X54A 4K88A 1H4SA 4M7DE 3M4QA 1G51A 1N9WA 4Q6GA 2DTIA 3IG2A 1N9RA 4M7DG 4TQFA 4J6XA 4C92D 2VXEA 1NJ8A 2DQ0A 4PHCA 5HGQA 4G84A 1ASYA 4M7AA 2HNIA 5LJ5j 2RHSB 1QE0A 3FB9A 5LJ5e 2Q7EA 4M7AC 4M75B 3HXYA 5GAOn 4EMGA 5GANf 4UP7A 1USYC 4M75C 1WYDA 3IKMB 3MEYA 3QO3A 3NEMA 4YRTA 4P72C 2EJ9A 3HRIA 2XTIA 4P74A 1JJCA 2QHTA 2J3LA 3A7UA 5GANj 1JJCB 1WNLA 1Y96A 3RACA 1B34B 3LC0A 4M77F 4YRCA 1B34A 1B70B 1NNHA 5DY9A 1Z7NA 2ZZGA 3LSQA 4H2WA 3HFVA 5GMKm 3TEGA 4PJOE 2ZXFA 1HXDA 2RHQB 2E64A 4PJOG 3A5YA 4C8QG 3MF1A 1B70A 1VQZA 1X2HA 4N0AC 3BY7A 4YRNA 4F7UE 1MGQA 4M78B 1WPYA 1JBMA 3JCMf 4H2TA 4M78E 4M77D 2E5AA 3VQYA 3VBBA 1U1SA 4ZTZB 3HFNA 4LNSA 5F5WA 5GAMg 1BIAA 3M4PA 2DXTA 3SB2A 4YCUA 2ARUA 4RMFA 1G5IA 1ADJA 4HWPA 4C8QA 2J3MA 4M7AB 2CJBA 3JCMg 2I4OA 5GANd 4H02A 1BBWA 1Z7MA 3EFRA 2QHSA 5GANg 3PCOB 4M7DB 4OLFA 4C92F 4M7DA 1M8VA 5GAN4 4F7UA 4C92B 3HFZA 3HXUA 4XU2A 2ARSA 4PJOD 3L4GB 4H2XB 4C92E 3SWNA 4HWRA 3R07A 2ZT8A 3JCMe 3BDUA 2RA2A 4JRKA 4P3PA 4XQ3A 1M5Q1 2EAYA 4P72A 5GANh 2DU5A 5GAN6 3REUA 3QSUA 4X9CA 4XTYA 4C92A 3GIBA 3HY1A 2RD1A 2AMCA 4YDQA 5C52B 4M78D 3IALA 4O2DA 4AH6A 4C8QF 2ZGWA 2P5IA 1X01A 2QTXA 2CIMA 5LJ3e 4UP8A 1N9SA 1X2GA 5ELNA 4JLIA 4NOYA 4CH3A 5GAN5 2E41A 2DDZA 1YCYA 2DVEA 2QHUA 1NJ2A 2I4NA 3INZA 3JB9F 3TEHA 4XTUA 4HA8A 1YB3A 2AKWA 4EMKB 4YPFA 5GMKj 4M7DD 2CGHA 3HRKA 4YROA 4HT8A 3PCOA 3A5ZA 3IKLA 4XU3A 1E24A 5GAMe 1EOVA 2P0LA 2ZZFA 1GGMA 1EVLA 1LYLA 4EMKA 1LJOA 4K87A 3UFGA 3MF2A 1ADYA 4C92C 2Q7HA 4XU1A 2ZIOA 5GAN8 3RERA 5GANe 1RIQA 1ATIA 2ZR3A 3CMQA 1YFTA 1LOJA 4M78C 4M7AD 2RHSA 3QO5A 4PG3A 4J5YA 4C8QC 3A31A 2YLCA 3JCMb 3RGLA 4YCWA 4WF2A 4WJ3M 3FJPA 4M75E 2E3CA 3UH0A 1I81A 5C51B 2I4LA 4YP0A 3V8JA 4YYEA 4YRIA 1IL2A 2DU7A 1G5HA 4WI1A 3JCMJ 4YREA 2IY5B 5GAMh 5LJ3j 2YHTA 3V7CA 4H2XA 4C92G 4YRSA 3L4GA 3BJUA 4HWSA 5C53B 3W3SA 1H4TA 3ICAA 2CJAA 2K57A 2G4CA 3P8YA 1H4QA 2FB7A 4UPAA 1SRYA 4TQDA 3QO8A 4M78G 4EMKC
chains in the Genus database with same CATH superfamily
2FVUA 2WSCE 1IGUA 3LX7A 4A4FA 2QI2A 3SWNB 5KYUA 3FJ5A 3OS5A 4J9HA 5K1PA 1S72A 2L3PA 1G5VA 2L2PA 1VQPA 1OPLA 3CXCP 1YCSB 3P8BB 4LDYA 3BDLA 1KQ1A 3URGA 4A4HA 4C0FA 2JJ9A 1VQPT 2ROTA 3A8HB 1PYSA 3QDRB 2C7IA 3U23A 1EFNA 1FYNA 5A0GA 5KYUB 3JB9G 3TEEA 3CC7Q 1QVPA 5A0LA 1HK9A 1WHMA 5KYYB 2C8MA 2YUQA 2ODRD 3L2ZA 3TCJA 3CMAT 5CKHA 4NCXA 2E5KA 2LQNA 4OMFB 2YRDA 1VQPQ 1Q86C 1W2BS 2COYA 4HXJA 2D8JA 3QYHB 3H8ZA 1GL5A 3VRYA 2V8IA 1H4VB 1OEBA 4BB7A 2Q7GA 2JUFA 4BDYA 1V76A 4CS3A 2H3EB 4P73A 1C0AA 2EYXA 3CCLQ 5KYWB 4J9FA 4EMHA 4C8QB 2GFUA 2MYSA 1PD0A 2QYZA 4XTXA 1VYTA 4M75G 2JW4A 5HKCA 2V1QA 3C4SA 5D6XA 1T0JA 2JM8A 1PYSB 4LUEA 4RTZA 5FLXE 5GAN7 5GAMj 3OD1A 3OW2P 1X6BA 1UTIA 1JRIA 2KXCA 5CR2A 4BW9A 2HKNA 3R6NA 2OTLA 2FG0A 2JNGA 1HC7A 3G71A 2HMAA 4Y91A 2DMOA 1KFZA 3I55Q 1LNXA 1ABQA 4Z89A 1VQKT 1VQ5Q 1MHNA 1UHFA 2RJCA 2ZPHB 4J9GA 1YJ9T 3L2RA 3I7FA 2YLBA 2CSIA 1PD1A 3ME9A 1J5WA 2VASA 2AK5A 2DA9A 2LQWA 4XTWA 1SERA 2W0ZA 4E51A 1AD5A 3RUXA 4LVKA 5HY6A 2EFIA 3L42A 5GAOl 1EFWA 1VQ7A 5KH6A 2M0OA 3PIPA 2KDSA 3JCMh 1R77A 3N5BB 1AWXA 4V2SA 2O88A 1GCQC 1B3QA 2DPPB 1JJ2P 4PJJA 2IY5A 4HVUA 1TOVA 3OYGA 4PJOB 4EO4A 4HVCA 4ELZC 2GQIA 4ZGJB 3EAEA 2CP3A 4B6MA 2BE9B 4D8KA 2J05A 3OY9A 3JB9J 1U8RA 4HT9A 2SEMA 3HRTA 4LN2A 12ASA 4LD6A 2PUKB 4WJ4A 2F69A 1SRLA 1X27A 3O8VA 4RG2A 5KNNA 5CKEA 1ZUKA 2KROA 4J6WA 1AZEA 1KD1C 2RB6A 2X9HA 1N5ZA 4FSSA 3I55A 1UGPB 4ZTUB 2DETA 1QKWA 5LJ3h 1YIJT 1VQ8Q 2F1LA 5GAN3 4M7DC 1TSFA 4F7UG 4KRTA 1UGVA 5GMKe 2HKQB 2EYZA 1E22A 4AFUC 4PJOF 4X9DA 2LRQA 3EG1A 3CCQQ 3QTCA 3HPWA 4YRRA 1B7TA 4N4HA 4HWTA 3HY0A 1C0MA 5LJ3f 1RLPC 4H2VA 4E7LA 1W6XA 1PC0A 3PGGA 3QDFA 4HKEA 4BE1A 4HWOA 3PMTA 3RL6A 1N6AA 4N0AA 1FXXA 4P73C 4PFZA 4BI8B 1N8RC 2JMCA 1M1KR 2KRMA 2K6DA 1K9MU 3LWIA 1YWOA 3CMAQ 2LT1A 4Q6GA 2DTIA 3H41A 3OA6A 4ZTFA 4M7DG 4C92D 3EG9A 3X26B 4PHCA 1ASYA 2HNIA 1IZ6A 2MIOA 4QT7A 2RHSB 3LGLA 3I56Q 2HBPA 1PKTA 5LJ5e 3G6EQ 2Q7EA 5FRMA 2RHZA 4M75B 1VQNT 1NJIR 1XOVA 5GAOn 3P8DA 1QP2A 4EMGA 4UC4A 2K3XA 2A0FB 3VYHB 3IKMB 5KYXB 3MEYA 2PTKA 2E6NA 4E7HA 1RI0A 3OS0A 3PTAA 2DYBA 2KY9A 1B34B 2KMTA 1X6OA 3CPWA 2XDBA 2YSQA 4QVZA 2RMOA 2RK1A 5IXFA 4H2WA 3HFVA 2DD5A 2R5MA 3DLLA 1VA7A 1MV0B 2F2VA 1NEBA 3NTKA 2COZA 5FWCA 2ED0A 1KQSP 2QQAA 1WDXA 1Y0MA 1P92A 3WVEB 1YJWT 1YJWA 4M78B 1OZ2A 4JRQA 3JCMf 2K5LA 1KC8R 3QWYA 3HFNA 5F5WA 1WHLA 2FPFA 1BIAA 2H3JA 3M4PA 2QASA 2L3QA 2R57A 2RN8A 5CCAA 3A8GB 2HQEA 5IAYA 4RMFA 3OS2A 4C8QA 2RQUA 2A7YA 3QZ9B 2CJBA 2K9GA 3JCMg 2I4OA 2J6OA 2E6ZA 1BBWA 2QHSA 1UJYA 2LC4A 3MHXA 4KBMB 2DL7A 4F7UA 4XU2A 4H2XB 2B8AA 1X2QA 2CH4A 3SEMA 3R07A 2LTOA 1KQSS 4JRKA 1T3LA 4P72A 1QKXA 3QSUA 4X9CA 3OYFA 2NUPB 3HY1A 5CO7A 3HHTB 2D8HA 2DK3A 3MEUA 2MPXC 2HAXA 2QEXQ 2ZGWA 4C5GA 1ZSGA 2CIMA 5LJ3e 5IN1A 2X3WD 1X2GA 2ZPGB 3CPWP 4CH3A 1RI9A 1VQKA 5GAN5 4FL6A 2E41A 2DDZA 3META 4OVAA 2NYSA 2QHUA 3QG1A 4FU6A 1NJ2A 3JB9F 2KXDA 2KYMA 1VQ6Q 7AT1B 4PL6A 4N4IA 3QKJA 1SPKA 1YHQA 3H6ZA 4QW2A 5CK9A 1G3TA 4E6RA 5GAMe 1QMCA 2ZPFB 1EOVA 1K9MC 2Z0WA 4CI0C 5C6SA 4ORZA 5A2QE 1LYLA 2J06A 1LJOA 2DF6A 3JSCA 4K87A 2AIRB 3DB3A 1I0CA 3WXMB 2EYYA 1H92A 2BUDA 1WZOA 4C0ZA 1KC8C 1NYGA 1BI0A 1D1CA 2ZR3A 3M0TA 4C0DB 4M78C 1RAGB 3FLGA 1B07A 4PG3A 5FROA 3M0RA 4DBHA 3CCET 1UFFA 4J5YA 1ZUYA 1QCFA 1VOMA 3CD6T 1E7OA 2X4JA 4YCWA 3M59A 1ZQ1A 4RTYA 1ABOA 3RDVA 1N8RU 1VQOA 1LPLA 2FPDA 2DU7A 1VQNA 4LDVA 4WI1A 4YREA 1TUCA 5LJ3j 2JOYA 3PIOA 3CMEQ 2GCXA 1M1FA 4YRSA 3BJUA 4HWSA 3ICAA 2CJAA 3CCEQ 4EPCA 2G4CA 2BE7D 2F5KA 3CBMA 1EIFA 4ELYC 4TQDA 3EGXA 4M78G 2M0YA 3EGXB 1U1TA 2RJFA 3PT9A 4TTVA 4ZGEB 4CH4A 1VQ4T 4IUUA 4M75D 2D6FA 1GBQA 5HK3A 1VQ8T 4F7UF 4KH0B 3LH5A 4OGEA 2HL3A 2KQWA 4RCCA 2EQMA 4PJOC 2VKNA 2XK0A 2QDYB 1Y57A 2DL8A 2JVVA 1H641 4NL3A 2EIFA 1YHQQ 3PFSA 2QXFA 1UHCA 5I21A 1USYA 4P75A 4AG1C 4DA4A 2KE9A 4TWAA 1VQ6T 1VQ9T 2DIQA 4P71A 2M9UA 5KE2A 3VKIA 3FC3A 3M55A 3L2QA 5AYFA 3CCUQ 3UF4A 1IB8A 3MKDA 4J7FA 2LMJA 2DXUA 2PU9B 3E9IA 1WIEA 3M4GA 4M7AF 2DM1A 1KMMA 4JJDA 1KHCA 2E65A 4FCYA 3RBBB 2ZT7A 1ZBXA 1M8MA 1YHQT 9ATCB 1GCQA 1VQ7Q 1X56A 4YRKA 2CKKA 2CP2A 2PQWA 1JQQA 4RQFA 2DERA 1GFCA 2O4XB 4MMKA 4II1A 4GBQA 5KCHA 2GQVA 4CC2A 4LVJA 2RHIA 1BB9A 4EX5A 3CCSQ 2LCSA 1VQOT 3NENA 3M56A 1YJ9Q 2O9SA 5LJ5f 3CD6A 3CQTA 4H2SA 2ATCB 1SG5A 3CCEA 1BIBA 4ANJA 3QNEA 3VS4A 3GOXA 1UJ0A 4FYYB 3TSWA 1UECA 1MMAA 2JN0A 5GAN2 3EHQA 2KSSA 2DQ3A 3QHSA 5K1XA 2BZ8A 2P4TA 1FMWA 4TVYA 3MJXA 5GMKl 1LVKA 1TH7A 3OYHA 3OMGA 1SF9A 4FM4B 1AT1B 2HSPA 1FWZA 4FW2A 2HBWA 3GLXA 5FW9A 3J81E 2LDMA 1NJ1A 4YRPA 2EJFA 3D7SB 3CBPA 3UGQA 1ZSZB 2RHXA 4YRMA 2QQRA 2NUTB 1D0XA 3P8VA 1SKUB 1OOTA 3VS2A 3JV3A 3VS5A 4E7ZA 1TU0B 3ZBDA 4M77A 2PMEA 3DB4A 5LJ5h 1VQLA 2NUTA 1GFDA 2CS7A 3A7RA 2KRNA 4BE0A 1Y07A 3J80E 1VQNQ 1WQWA 2QQBA 3LYIA 4P71C 3CCQA 5FU7B 3TU4K 2GNCA 2RI5A 1AWOA 2M16A 3VUZA 1KC8U 1RADB 3M53A 5GAMd 3GBQA 3G4ST 3FDRA 1S72T 2RHYA 2HQXA 5CAIA 1ZA1B 4JLGA 4K11A 2YDLA 2KR3A 3AHUA 3OYEA 1KSWA 2XU8A 1EZZB 3MP1A 4M75A 2E10A 2ZT6A 2V1RA 2ENMA 1EVKA 2I0NA 4E47A 3ERRA 1KOGA 2RM4A 1S72Q 3EG9B 3VQVA 3OB9A 2DX1A 4JJNK 1K4US 2D9TA 1AZGB 1QVGS 4CS2A 2YXYA 1UEBA 1KMNA 4J8OA 4QVDA 1PRLC 4Z02A 3OBWA 2AKWB 2PZ1A 5GAMf 1WA7A 2RH2A 1ZA2B 3ZEHA 1SETA 4RQEA 3E1SA 4HVVA 2DXBA 2AMCB 4P3OA 2FYKA 3T9NA 4Q15A 3V7SA 4YRLA 1WU7A 1EQRA 1FYFA 4M78A 3CCMT 2XDDA 1VYVA 2CZ1B 2G3RA 4LE9A 3EGDA 1YBYA 4JZ4A 3JB9D 4X5OA 4O5VA 4L6V5 3VS3A 1PHTA 2PVDB 2CT4A 2ZPBB 1W66A 3ZL7C 3NPFA 4L59A 2BKDN 1BBUA 1I4K1 3HL8A 2E5QA 2JS0A 2EJGA 4F14A 1QVGP 4QQGA 5M9OA 4TVAB 4J6YA 2DEUA 1D0ZA 5DM7R 2L3RA 2A36A 2DTOA 2V26A 3A8LB 3G1JA 2QAZA 1RL2A 4RG8A 3CCJA 5I22A 1KIKA 1NG2A 3RIRA 2AHJB 4IUTA 4J7IA 1B7YA 3EH2A 1X54A 4K88A 2COWA 1KHIA 2LJ3A 4Y92A 1HD3A 3IG2A 3THKA 3ULRB 1AEYA 2M51A 2P0QA 4J6XA 2VXEA 1ARKA 2DQ0A 5HGQA 4G84A 4M7AA 1SSHA 5LJ5j 1M3CA 2K3YA 1G3YA 4M7AC 1WHHA 3BE3A 3HXYA 2L3SA 3WVDB 3VUBA 5GANf 1USYC 5AT1B 4M75C 4P72C 3HRIA 2XTIA 4A4EA 1JJ2A 5GANj 2KEAA 1X69A 3RACA 3S3MA 4M77F 1M3AA 3KFVA 4RKUE 1GBRA 2XIDA 1K9AA 1NNHA 5DY9A 3VYGA 1Q82R 2LQKA 5IT9E 4PJOE 2ZXFA 1IHWA 4JZ3A 2DL4A 2RHQB 3RNJA 2HZYA 4PFPA 2E64A 1X43A 2CDTA 1W2BA 3A5YA 4ZNXA 4E7SA 4ATOA 1B70A 1X2HA 2LJ1A 4N0AC 3BY7A 3H0IA 1MGQA 1NBEB 4RTWA 2OTLQ 4H2TA 2E5AA 3CC2A 3I55T 3VBBA 1D1BA 5C0MA 2LCCA 5GAMg 2RF0A 4MZMA 3EG0A 2DXTA 2VGNA 3CPWS 3VJPA 1NZ9A 2ROLA 2AKLA 1ADJA 4HWPA 1Q95G 3QZ5B 3EGDB 2L0AA 1W1FA 3NTHA 5GANd 1Z7MA 3G6EA 3OQ5A 5CQYA 2XG8D 1G83A 1MMDA 4ME7A 3LW5E 3H0FA 4Q5WA 2VV5A 4M7DB 1QVFA 4M7DA 2X3XD 2LJ0A 4C92B 1BKBA 3HFZA 2C0TA 2F2XA 2DBKA 2P4RA 2GGRA 2VGMA 2Y4XA 3PMIA 4O6JA 1W70A 2ZT8A 3EG3A 2RA2A 3VV0A 3REAB 2EAYA 2MMPA 4KGVB 2MCNA 5GANh 1YIJQ 2DU5A 4BUGA 3REUA 4FYXB 1K9MR 2R58A 4C92A 3CCRA 4YDQA 1NJIU 5D7UA 3ASKA 4M78D 1Y7XA 4AH6A 1WJSA 1Q82C 4C8QF 2AT1B 2RK2A 3G6ET 1X01A 4UP8A 3RMQA 4B9XA 1N9SA 5ELNA 2K7AA 3QBYA 4CC7A 2L5QA 2NUPA 2CP0A 1YCYA 2RQRA 1A0NB 4J83A 3TEHA 1RACB 1T3SA 5KYYA 3LLRA 4PLIA 2HD0A 2GFAA 2ABLA 4YPFA 5GMKj 5FRNA 2QGFB 4M7DD 2CGHA 3M0UA 4J9CA 1NM7A 1BCMA 5KYNA 1NYFA 2RHUA 2KI7A 2ZZFA 1YP5A 2QEXT 2RJEA 3QPHA 3R6OA 1WYXA 1U06A 1NEGA 1K76A 1GCPA 3CPFA 4AG2C 5GANe 2ZPIB 1M2VA 1O75A 3GF5A 1LOJA 4BY6C 4E7KA 2CP6A 3QO5A 3TVTA 4P5NA 1BI3A 4C8QC 2DXCA 3JCMb 4DOWA 1AVZC 2EKOA 4WF2A 2IVWA 4M75E 2E3CA 4WJ3M 2VVKA 4LXCA 1IREB 1VQ4Q 4TVRA 2HCKA 3F70A 3M0PA 4PKCC 3LGFA 1KD1U 2DJQA 3QWXX 3JCMJ 2YRCA 3TREA 1YWPA 2D0QB 1VQOQ 1G3WA 5KYWA 4H2XA 2F2WA 1VQKQ 5C53B 3OYJA 1X6GA 1H4TA 1VQ9A 3CMET 5EC7A 1H4QA 1PNJA 1OV3A 4BD3A 1R0BG 5KYXA 4RMOA 1WJQA 4IKFA 1S1NA 2Q5IA 4KGZB 2K2MA 2DKGA 5EG2A 1NLPC 3OYCA 3QO7A 3KUFA 3RESA 4MDXA 4DPGA 1YJWQ 3A74A 3ER0A 3L2UA 4R0KA 4OMNA 4FYWB 1EIYB 1SRMA 1VYUA 2DO3A 1TTHB 2EQKA 3MO8A 3V8KA 2MI6A 3G1ZA 1PCXA 2ARTA 4AMCA 3V7RA 4CH5A 3X24B 1Q7YR 2P0KA 4JRIA 2KGTA 2CYZB 2EBPA 1SHGA 3OYDA 3UGTA 4P75C 1M9SA 2CSQA 2E12A 2ED1A 2QA4A 8ATCB 2DNUA 2OTJQ 3CXCA 2CZ0B 1C1AA 1Q81U 2RQWA 3X28B 2E1HA 3REXA 2DTHA 2HQHA 2RQTA 2HSEB 1NJIC 3DKMA 5IHNA 2QTVA 2ODRC 4QVCA 4IIOA 1SESA 1RAEB 2ZAEA 2EKHA 2CP7A 3HKSA 1E6HA 2QDLA 3A7AA 1UGQB 2K4YA 4PNOA 3NELA 3RKWA 4DBFA 1W4SA 4M77C 4L87A 2XGTA 3I5SA 3WQZA 5CVIA 1UGSB 1BI1A 4WCIA 2EGEA 1JEGA 1M4ZA 2M02A 1VQMQ 1E1OA 4M75F 4DBRA 4LVLA 4YRQA 1WLEA 4DBQA 2CZ7B 3UT1A 4EDUA 4FT4A 2QEXA 4BI4A 4M7AE 4D8DA 3NETA 2XI9A 4ZN1A 1K0XA 3SFMA 4KQEA 1ASZA 3H9NA 1QLYA 2LQ8A 1Q86U 3CCUA 4M77B 5LJ5g 3M58A 5KE3A 1EIYA 4YRGA 1FMVA 5GAOp 2JZ2A 3RF1A 1ZSZC 2D0NA 1VIFA 5A0DA 3OYKA 1YITQ 2DFUA 4CH6A 4LDXA 2EWNA 1RUWA 2DLPA 4JUVA 2DJZA 1QVFS 1YI2T 4F16A 1HTTA 1VUBA 4OMQA 4XAXB 1AWJA 3JCMW 2DD4A 2FZCB 1HJDA 1WHKA 1YFSA 2A8EA 1K73U 1KK7A 1O9SA 2DBMA 2LVMA 2OJ2A 3C94A 2JT4A 1M30A 4DQ2A 2PMFA 1PSEA 2DRMA 2LP5A 2MAMA 1DJ7B 1YFRA 1WX6A 4R55A 4RTVA 2O01E 4OMPA 3DSQA 3E9FA 2ZNJA 5GAOm 2Q5HA 2XICA 3UDCA 3CC2Q 1OZ3A 4P74C 5CKDA 1K8AC 5DLOA 5J26A 4A54A 5IH2A 1ZLMA 2VC8A 5LJ3d 2DEQA 2MOXA 1YI2Q 5FU6B 3SWNC 3JCMP 2JTEA 4N4GA 4GLKA 4RDXA 1TXQA 1U3OA 4CC3A 5DLQE 4E7IA 3BFMA 3DLMA 2BTTA 1BK2A 4QQ6A 1V29B 5CQXA 4H2UA 3PVLA 2ALYA 3FRNA 1K0SA 1BI2A 1Q7YU 2ESWA 2P84A 1C6VX 4XK8E 1N8RR 1IRXA 4TVWA 1HSQA 1G3SA 1H3ZA 1YN8A 1UG1A 2K79A 4KR3A 1TUDA 2CUBA 3A32A 3G4SA 3GPLA 4HVWA 11ASA 3VQXA 2FL7A 4J9BA 1QF6A 1PRMC 3OSSC 2VXFA 1VIEA 4XEMA 4CRIA 4Z8AA 4E2FB 1JO8A 4LNPA 1YGBA 3EH1A 2ZPEB 3HFZB 1PG5B 4QKUA 2DAQA 4C8QD 1G8XA 2DIGA 2KT8A 1L0WA 3VS1A 1B8AA 3L1AA 3CD6Q 4ZN3A 3S3NA 4J15A 1WLPB 1JJ2S 2C06A 2X51A 5KCOA 1D0YA 3HTZA 1H4SA 3M4QA 1N9WA 2FHDA 3CCJQ 2EQIA 4HCBA 1N9RA 5IHIA 4OGCA 4TQFA 4FT2A 3M54A 1KG1A 1K73R 2FRYA 1ZBJA 1WI7A 1D09B 1OULA 4M4ZA 2EYQA 2M1HA 3FEOA 1RAIB 3CCJT 3S3OA 4WTOB 1VQMA 2G6FX 2A37A 3I35A 4IUPA 5IHKA 2ECZA 3QO3A 2BZXA 3NEMA 4YRTA 2EJ9A 4P74A 2CUDA 3CC4A 1JJCA 1NLOC 3A7UA 3OMCA 1JJCB 1Y96A 3CCRQ 2L89A 2MWPA 1M1KC 1JB0E 1B70B 1MNDA 2PVOB 2O9VA 3LSQA 3NHNA 5GMKm 3OYMA 3CCMA 1OU8A 1RAAB 2X4WA 4JS5A 4A4KA 3MF1A 1RABB 1VQZA 3GNGA 4F7UE 4M78E 4M77D 2RI2A 3VQYA 3M9QA 5I11A 1VQLT 2KYBA 1QWFA 1IO6A 1WFWA 2NWMA 3SB2A 4YCUA 2ARUA 1VQLQ 1G5IA 1VQ5T 2J3MA 4M7AB 4H02A 4AFZC 3EFRA 3ZFJA 1IXDA 5GANg 3PE0A 1MUZA 4OLFA 3G7ZA 2CH4W 5GAN4 1YJNT 3CCST 2WSEE 1VQ7T 2DILA 2ARSA 3JRZA 1D1AA 4PJOD 4BACA 3SWNA 5FU6C 1OX8A 3AT1B 2JMAA 4XQ3A 2IIMA 3CCVT 3OBYA 3MEWA 3EFOA 4KT0E 5GAN6 2LT4A 3OSVA 2E70A 4XTYA 1SSFA 2VYTA 3GIBA 2RD1A 3CCLT 2XMFA 2OAUA 1M1KU 1M2OA 4JJCA 5J39A 2P5IA 3O5ZA 3A98A 2CT3A 3HRSA 4RUGA 2QTXA 4LDUA 1QCNA 4JLIA 3MEAA 1VQ9Q 2ZZDA 2AZSA 4YTLA 3M5AA 2DL5A 2P0PA 4XTUA 2AKWA 1YB3A 2EVRA 3HRKA 4RTTA 3PCOA 3CC7T 1Q82U 3IKLA 5D6YA 1KD1R 1EVLA 2F5TX 4EMKA 1WXUA 2A3LA 2LNHB 4JPBW 1UE9A 1M90R 4C92C 2XKOC 3RMSA 3M57A 5GAN8 1RIQA 4PJMA 1H8KA 3OW2A 8AT1B 2CP5A 2DRKA 1ATIA 3CMQA 1OU9A 1YFTA 1EX4A 2RHSA 5CIUA 1OI1A 2B86A 3EGUA 1YIJA 2EW3A 2Y4YA 3M0QA 3A31A 3CC4T 3OS1A 3CC7A 2SRCA 3RGLA 4J9DA 1M90U 3UH0A 2I4LA 3MPUB 3V8JA 4YP0A 4YYEA 3QXEB 2NLUA 3VRZA 2FRWA 1G5HA 1IHVA 1VQ8A 5FWBA 1G2BA 5GAMh 2RJDA 2YHTA 1VQ4A 4C92G 3L4GA 3W3SA 3CCQT 1CKAA 2QA4Q 1Q7YC 2OTJA 2K57A 3P8YA 1MMGA 1PKSA 2FB7A 2MK5A 4UPAA 2K5FA 1BYMA 4PFOA 3QO8A 4LDWA 4EMKC 1GXIE 4M7AG 2ZINA 2ZR2A 3CCLA 2W10A 2KBTA 2DZ9A 4UP9A 3CCVA 4LUDA 2OTLT 5L8RE 4BE2A 3PZCA 3OYNA 2K3BA 4YRJA 3JCMd 1YJNA 2E4HA 2QHVA 3MQZA 3G71Q 1NJ6A 1MV3A 2EQUA 3TUPA 1T0HA 5LJ5d 5HCKA 4CS4A 4E7JA 2L8DA 1VQ5A 4X34A 1PM3A 4XTZA 2ZNIA 1J3TA 2WACA 4LD9K 4MDWA 1NYQA 2X35A 4C0GA 3RKYA 3J7AF 3BW1A 1K73C 2E3HA 3C0CA 4M77E 4HT4A 3V8LA 2FEIA 3P8HA 3C95A 1M3BA 3NFCA 2X4YA 4C8QE 1M2VB 4KULA 4YCVA 4KR2A 5GAOr 1QQJA 1RAFB 4IURA 2LCLA 4KH1B 1BCOA 5GJWB 3HXVA 1QCOA 3EHRA 1I1JA 1QVGA 1YITT 1Y71A 3QJ6A 4Y28E 2RPNA 2QGGA 1M1GA 1TS9A 1CSKA 3VU3C 5ELOA 2HL5C 3E19A 1NE8A 2VWFA 4AT1B 1Y96B 1WQ7A 4FIBA 1JU5C 1QVFP 1OQKA 4H2YA 3CEYA 1ZSZA 3HTRA 1PWTA 3LH0A 3I5RA 4C5IA 4D6WA 4PJLA 2C0IA 4OMLA 1E1TA 1VQMT 3UPUA 3M4YA 4JS4A 2K5IA 6AT1B 1NYRA 1FMKA 5E3IA 1VQ6A 1W2BP 1RAHB 4YRFA 4XEOA 1NPRA 5GMKh 3A8OB 3VS7A 5GAOq 4G85A 4HCZA 3TEHB 2A28A 1UDLA 2Y90A 3JCMX 3CXCS 3CMAA 4M77G 1OX9A 2JM9A 1K1ZA 4OB2B 3EFSA 3CCRT 1OYXA 4RCBA 1BU1A 3VQWA 3HXZA 1B76A 1UB4A 2OAWA 3CC4Q 3IQLA 4J9EA 2FZKB 3NGPA 5CKBA 3FIFA 1D3BA 2JTMA 4VUBA 1D3BB 3OW2S 3HXXA 3CCUT 3L2VA 1ZUUA 2HEQA 1JXOA 2EGAA 2IPOB 2EL9A 2OTJT 4NS5A 3G4SQ 2FPEA 2AKKA 1XNIA 2VUBA 2NS6A 3G71T 2OX7A 2XDPA 3A1PA 2ZCEA 1XQHA 3JCMc 1I5OB 4F04B 4HCKA 4PJOA 4ESRA 4IUQA 3JB9I 1B7YB 1KJWA 3I56T 2AZVA 4A53A 2DZCA 4M7DF 2ZT5A 4MMLA 1Q81C 1UUEA 5GMKi 4BWAA 2ZZEA 2A08A 3EG2A 4ZIBA 2KVQG 4JDSA 4PLLA 2RI3A 4DEXA 3E9GA 3OYIA 4P3NA 4XU0A 3P8TA 4XTVA 5LJ3g 2YUOA 4AFQC 2QQSA 1U5SA 3RR6A 1ACMB 3REBB 4ZTJA 3QUIA 2CREA 3JB9H 1QP3A 4K86A 1AWWA 4C5HA 2I4MA 2C0OA 1R8OB 4LVMA 5I2MA 3UATA 2O31A 4M78F 2ALYB 2ZTGA 5LL6S 2CJ9A 1M90C 2RHQA 1XJWB 3SDZA 3MCAB 3JCMQ 2DL3A 1NPPA 3RKXA 3CBOA 1TUGB 4X1VA 4C0DC 4OP0A 3GP8A 3E9HA 1OPKA 4OMMA 1I5LA 3LSSA 2I2LA 3JCMV 1YFNA 4NL2A 3UA6A 3PVQA 2OI3A 3I9QA 4BDZA 2KAFA 3Q1JA 4ZGDB 4OB1B 2YT6A 2V8KA 4QQDA 2R5AA 2MWOA 3HFOA 1I8FA 2LNVA 2J6FA 3HXWA 2EGCA 3HRUA 2YUPA 1X2KA 3QYGB 1N27A 4OB0B 4JJBA 1X55A 4LVIA 1K8AR 3HSBA 3KFUA 1NJ5A 1WGSA 2LX7A 4F7UB 2ZIMA 3A8MB 1KQ2A 2XHCA 1WHGA 4TVAA 3CCSA 4HCCA 5HK0A 1ZX6A 4M7DE 4BI3A 1G51A 1MMNA 1R0CB 3MEVA 2J6KA 4GLMA 1X75C 1Z9QA 2D1XA 2RO0A 3JAME 1NJ8A 2WSFE 4DOVA 3OYYA 5L23A 1AOJA 4R56A 4PJNA 3KXTA 2DVJA 1QE0A 3FB9A 3TSZA 2FO0A 1UGRB 5I2SA 2PUOB 1Q86R 4UP7A 4MZPA 1WYDA 2YUNA 1HYOA 2X4XA 2QHTA 2GTOA 2DYIA 4J9IA 2J3LA 3OYAA 4IUVA 1WNLA 1CKBA 1KQSA 3LC0A 4YRCA 1QW1A 1B34A 4FW1A 2EQJA 1Z7NA 2ZZGA 2HDAA 2O2OA 3HP9A 3GNFB 3TEGA 2V8JA 2BZYA 4KUDK 1HXDA 3C12A 2CZ6B 2RNAA 4PJOG 3SD4A 4PK4A 4RTXA 4B9WA 4C8QG 2E3IA 3E2UA 3QJYA 4IIMA 3A5ZB 4YRNA 4BY6B 1WPYA 3M0SA 1JBMA 2GTJA 2IG0A 2GF7A 2PVGB 5FU7C 1LCKA 3QIIA 3TQ7P 1U1SA 1YI2A 4ZTZB 3I56A 4LNSA 1SEMA 2PNIA 2MF2A 4FYVB 2EPDA 2QA4T 3H0HA 1TWBA 2LZ6B 2XD0A 4F17A 3VS6A 3X20B 4JRPA 3NMZC 3PCOB 1YNZA 1YJ9A 4C92F 1M8VA 1WXTA 3HXUA 2K2VA 3L4GB 3VS0A 4C92E 2KT1A 1GRIA 2JS2A 4HWRA 3UWNA 2J7IA 2H8HA 1WJRA 3BDUA 3JCMe 4KGXB 1BBZA 4P3PA 1M5Q1 3MP6A 2QG9B 5J3BA 3OYBA 2AMCA 5C52B 1MNEA 3IALA 4O2DA 1QWEA 1SHFA 2YWWA 3PNWC 4CC4B 4OB3B 1K8AU 2FZGB 4NOYA 1WHJA 3CMEA 1H3HA 2VB6A 1Z9ZA 4DEYA 2GBQA 2DVEA 1ZHIA 2I4NA 3INZA 4KUIA 1IGQA 4Z88A 1AHJB 1M27C 2YRVA 3L2WA 4HA8A 4EMKB 3S6WA 2KRSA 2RQVA 3CC2T 1XTDA 1FX7A 1TG0A 3SHWA 4YROA 4C5EA 4HT8A 3A5ZA 2QQ9A 4XU3A 1E24A 2P0LA 5D6WA 1GGMA 2ZCFB 3LWHA 1YJNQ 4GY5A 1YITA 3UFGA 2LX9A 2DE0X 1ADYA 3MF2A 1F1BB 1Q81R 2KK4A 2NUZA 2Q7HA 4XU1A 4MZTA 2ZIOA 2JXBA 3CCVQ 3RERA 2QK0A 4FSXA 3KBGA 4EIKA 4M7AD 2O4XA 3MP8A 4RTUA 5CKFA 4AFSC 1V1CA 2YLCA 5ECAA 4OMOA 1PSFA 3FJPA 4OF1A 4A4GA 1I81A 3OYLA 5C51B 2JTFA 5GJVB 1I07A 1JXMA 2BIVA 4YRIA 1IL2A 1WXBA 2IY5B 2EYWA 1RLQC 5IXBA 3EFOB 3V7CA 2KNBB 3NTIA 3UA7A 1E6GA 4A63B 1SRYA 3CCMQ 4L5GA 3X25B
chains in the Genus database with same CATH topology
2FVUA 2WSCE 3LX7A 4A4FA 2QI2A 3SWNB 3OS5A 5K1PA 1S72A 1G5VA 1VQPA 3P8BB 4LDYA 3BDLA 1KQ1A 3URGA 4A4HA 4C0FA 1VQPT 3A8HB 1PYSA 3QDRB 2C7IA 5A0GA 3JB9G 3TEEA 1QVPA 5A0LA 1HK9A 2C8MA 2ODRD 3L2ZA 3TCJA 3CMAT 5CKHA 4NCXA 4OMFB 1Q86C 1W2BS 3QYHB 3H8ZA 2V8IA 1H4VB 4BB7A 2Q7GA 2JUFA 4BDYA 4CS3A 4P73A 1C0AA 4EMHA 4C8QB 2GFUA 4XTXA 4M75G 5HKCA 3C4SA 5D6XA 1PYSB 5FLXE 5GAN7 3OD1A 5GAMj 1JRIA 5CR2A 4BW9A 2OTLA 2JNGA 1HC7A 3G71A 4Y91A 1LNXA 1VQKT 1MHNA 2RJCA 2ZPHB 1YJ9T 3L2RA 3I7FA 2YLBA 3ME9A 1J5WA 4XTWA 1SERA 4E51A 3RUXA 4LVKA 5HY6A 2EFIA 3L42A 5GAOl 1EFWA 1VQ7A 5KH6A 2M0OA 3PIPA 2KDSA 3JCMh 3N5BB 4V2SA 2DPPB 2IY5A 3OYGA 4PJOB 4EO4A 4HVCA 4ELZC 4ZGJB 3EAEA 3OY9A 3JB9J 1U8RA 4HT9A 3HRTA 12ASA 4LD6A 2PUKB 4WJ4A 2F69A 3O8VA 4RG2A 5KNNA 5CKEA 4J6WA 1KD1C 2RB6A 3I55A 1UGPB 4ZTUB 5LJ3h 1YIJT 5GAN3 4M7DC 4F7UG 5GMKe 1E22A 4PJOF 4X9DA 2LRQA 3QTCA 3HPWA 4YRRA 4N4HA 4HWTA 3HY0A 5LJ3f 4H2VA 4E7LA 3PGGA 4HKEA 4BE1A 4HWOA 3PMTA 3RL6A 1N6AA 4N0AA 1FXXA 4P73C 4BI8B 1N8RC 1K9MU 3LWIA 2LT1A 4Q6GA 2DTIA 3OA6A 4M7DG 4ZTFA 4C92D 3X26B 4PHCA 1ASYA 2HNIA 1IZ6A 2RHSB 3LGLA 2HBPA 5LJ5e 2Q7EA 5FRMA 2RHZA 4M75B 1VQNT 5GAOn 1XOVA 3P8DA 1QP2A 4EMGA 4UC4A 2K3XA 3VYHB 3IKMB 3MEYA 2E6NA 4E7HA 1RI0A 3OS0A 3PTAA 2KY9A 1B34B 2KMTA 1X6OA 3CPWA 2XDBA 4QVZA 2RK1A 4H2WA 3HFVA 2DD5A 2R5MA 3DLLA 3NTKA 2QQAA 1P92A 3WVEB 1YJWT 1YJWA 4M78B 1OZ2A 4JRQA 3JCMf 2K5LA 3HFNA 5F5WA 1BIAA 2H3JA 3M4PA 2R57A 5CCAA 3A8GB 2HQEA 5IAYA 4RMFA 3OS2A 4C8QA 2A7YA 3QZ9B 2CJBA 3JCMg 2I4OA 2E6ZA 1BBWA 2QHSA 2LC4A 3MHXA 4KBMB 4F7UA 4XU2A 4H2XB 2B8AA 3R07A 2LTOA 1KQSS 4JRKA 4P72A 3QSUA 4X9CA 3OYFA 3HY1A 5CO7A 3HHTB 2DK3A 3MEUA 2HAXA 2ZGWA 4C5GA 2CIMA 5LJ3e 5IN1A 1X2GA 2ZPGB 4CH3A 1VQKA 5GAN5 4FL6A 2E41A 2DDZA 3META 4OVAA 2QHUA 3QG1A 4FU6A 1NJ2A 3JB9F 4PL6A 4N4IA 3QKJA 1YHQA 3H6ZA 4QW2A 5CK9A 1G3TA 5GAMe 1EOVA 2ZPFB 1K9MC 4CI0C 5C6SA 5A2QE 1LYLA 1LJOA 3JSCA 4K87A 3DB3A 3WXMB 2BUDA 4C0ZA 1KC8C 1BI0A 2ZR3A 4C0DB 4M78C 3FLGA 4PG3A 5FROA 3CCET 4J5YA 3CD6T 2X4JA 4YCWA 3M59A 1ZQ1A 1N8RU 1VQOA 2DU7A 1VQNA 4LDVA 4WI1A 4YREA 5LJ3j 2JOYA 3PIOA 2GCXA 1M1FA 4YRSA 3BJUA 4HWSA 3ICAA 2CJAA 4EPCA 2G4CA 2F5KA 3CBMA 1EIFA 4ELYC 4TQDA 4M78G 1U1TA 2RJFA 3PT9A 4TTVA 4ZGEB 4CH4A 1VQ4T 4IUUA 4M75D 2D6FA 5HK3A 1VQ8T 4F7UF 4OGEA 2KQWA 4RCCA 2EQMA 4PJOC 2XK0A 2QDYB 2JVVA 1H641 4NL3A 2EIFA 3PFSA 2QXFA 5I21A 1USYA 4P75A 4DA4A 4TWAA 1VQ6T 1VQ9T 2DIQA 4P71A 2M9UA 5KE2A 3VKIA 3FC3A 3M55A 3L2QA 5AYFA 4J7FA 2DXUA 2PU9B 3E9IA 3M4GA 4M7AF 1KMMA 1KHCA 2E65A 2ZT7A 1ZBXA 1YHQT 1X56A 4YRKA 2CKKA 2PQWA 4RQFA 2O4XB 4MMKA 4II1A 5KCHA 2GQVA 4LVJA 2RHIA 4EX5A 1VQOT 3NENA 3M56A 5LJ5f 3CD6A 4H2SA 3CCEA 1BIBA 3QNEA 3GOXA 2JN0A 5GAN2 2KSSA 2DQ3A 3QHSA 5K1XA 2P4TA 4TVYA 5GMKl 1TH7A 3OYHA 3OMGA 4FM4B 1FWZA 3GLXA 3J81E 2LDMA 1NJ1A 4YRPA 2EJFA 3CBPA 3UGQA 2RHXA 4YRMA 2QQRA 3P8VA 3ZBDA 4M77A 2PMEA 3DB4A 5LJ5h 1VQLA 2CS7A 3A7RA 4BE0A 1Y07A 3J80E 1WQWA 2QQBA 3LYIA 4P71C 3CCQA 5FU7B 3TU4K 2RI5A 2M16A 3VUZA 1KC8U 3M53A 3G4ST 5GAMd 1S72T 3FDRA 2RHYA 2HQXA 5CAIA 4JLGA 3AHUA 3OYEA 2XU8A 3MP1A 4M75A 2E10A 2ZT6A 1EVKA 4E47A 3ERRA 1KOGA 2RM4A 3VQVA 3OB9A 4JJNK 2D9TA 1QVGS 4CS2A 1UEBA 1KMNA 4J8OA 4QVDA 4Z02A 3OBWA 2AKWB 5GAMf 2RH2A 3ZEHA 1SETA 4RQEA 3E1SA 2DXBA 2AMCB 4P3OA 2FYKA 3T9NA 4Q15A 3V7SA 4YRLA 1WU7A 1EQRA 1FYFA 4M78A 3CCMT 2XDDA 2CZ1B 2G3RA 1YBYA 3JB9D 4X5OA 4O5VA 4L6V5 2PVDB 2ZPBB 1W66A 4L59A 2BKDN 1BBUA 1I4K1 3HL8A 2E5QA 2EJGA 4QQGA 5M9OA 4TVAB 4J6YA 5DM7R 2L3RA 2DTOA 3A8LB 1RL2A 4RG8A 3CCJA 3RIRA 2AHJB 4IUTA 4J7IA 1B7YA 1X54A 4K88A 1KHIA 3IG2A 2P0QA 4J6XA 2VXEA 2DQ0A 5HGQA 4G84A 4M7AA 5LJ5j 2K3YA 1G3YA 4M7AC 3HXYA 3WVDB 3VUBA 5GANf 1USYC 4M75C 4P72C 3HRIA 2XTIA 4A4EA 1JJ2A 5GANj 3RACA 3S3MA 4M77F 4RKUE 2XIDA 1NNHA 5DY9A 3VYGA 2LQKA 5IT9E 4PJOE 2ZXFA 2RHQB 2E64A 1W2BA 3A5YA 4ATOA 1B70A 1X2HA 4N0AC 3BY7A 1MGQA 4H2TA 2E5AA 3CC2A 3I55T 3VBBA 5C0MA 2LCCA 5GAMg 4MZMA 3CPWS 2DXTA 2VGNA 3VJPA 1NZ9A 1ADJA 4HWPA 3QZ5B 3NTHA 5GANd 1Z7MA 3G6EA 3OQ5A 2XG8D 3LW5E 5CQYA 4ME7A 4Q5WA 2VV5A 4M7DB 1QVFA 4M7DA 4C92B 1BKBA 3HFZA 2VGMA 2Y4XA 3PMIA 4O6JA 2ZT8A 2RA2A 3VV0A 2EAYA 2MMPA 5GANh 2DU5A 4BUGA 3REUA 2R58A 4C92A 3CCRA 4YDQA 1NJIU 3ASKA 4M78D 1Y7XA 4AH6A 1WJSA 1Q82C 4C8QF 2RK2A 3G6ET 1X01A 4UP8A 3RMQA 4B9XA 1N9SA 5ELNA 3QBYA 2L5QA 1YCYA 4J83A 3TEHA 3LLRA 4PLIA 2HD0A 2GFAA 4YPFA 5GMKj 5FRNA 4M7DD 2CGHA 2RHUA 2ZZFA 2QEXT 2RJEA 3QPHA 3R6OA 3CPFA 5GANe 2ZPIB 1O75A 3GF5A 1LOJA 4BY6C 4E7KA 3QO5A 4P5NA 1BI3A 4C8QC 2DXCA 3JCMb 4DOWA 2EKOA 2IVWA 4WF2A 4WJ3M 4M75E 2E3CA 1IREB 4TVRA 3F70A 4PKCC 3LGFA 1KD1U 3JCMJ 3TREA 2D0QB 1G3WA 4H2XA 5C53B 3OYJA 1H4TA 1VQ9A 3CMET 1H4QA 4BD3A 4RMOA 1WJQA 4IKFA 2Q5IA 2DKGA 5EG2A 3OYCA 3QO7A 3KUFA 3RESA 4MDXA 4DPGA 3A74A 3ER0A 3L2UA 1EIYB 2DO3A 2EQKA 3MO8A 3V8KA 2MI6A 3G1ZA 2ARTA 4CH5A 3V7RA 3X24B 2P0KA 4JRIA 2CYZB 3OYDA 3UGTA 4P75C 1M9SA 2E12A 2QA4A 3CXCA 2CZ0B 1Q81U 3X28B 2E1HA 3REXA 2DTHA 1NJIC 3DKMA 2ODRC 4QVCA 1SESA 3HKSA 3A7AA 1UGQB 2K4YA 4PNOA 3NELA 3RKWA 1W4SA 4M77C 4L87A 2XGTA 3WQZA 5CVIA 1UGSB 1BI1A 1M4ZA 1E1OA 4M75F 4LVLA 4YRQA 1WLEA 2CZ7B 3UT1A 4EDUA 4FT4A 2QEXA 4BI4A 4M7AE 3NETA 2XI9A 4ZN1A 3SFMA 4KQEA 1ASZA 2LQ8A 1Q86U 3CCUA 4M77B 5LJ5g 3M58A 5KE3A 1EIYA 4YRGA 5GAOp 2JZ2A 3RF1A 1VIFA 5A0DA 3OYKA 4CH6A 4LDXA 2EWNA 4JUVA 2DJZA 1QVFS 1YI2T 1HTTA 1VUBA 4XAXB 3JCMW 2DD4A 1YFSA 2A8EA 1K73U 1O9SA 2LVMA 3C94A 4DQ2A 2PMFA 1PSEA 2MAMA 1DJ7B 1YFRA 4R55A 2O01E 3DSQA 3E9FA 2ZNJA 5GAOm 2Q5HA 2XICA 3UDCA 1OZ3A 4P74C 5CKDA 1K8AC 5DLOA 5J26A 4A54A 5LJ3d 2VC8A 2DEQA 5FU6B 3SWNC 3JCMP 4N4GA 4GLKA 4RDXA 5DLQE 4E7IA 3BFMA 3DLMA 5CQXA 4QQ6A 1V29B 4H2UA 2ALYA 3FRNA 1BI2A 1Q7YU 4XK8E 4TVWA 1G3SA 1H3ZA 4KR3A 3A32A 3G4SA 3GPLA 11ASA 3VQXA 2FL7A 1QF6A 3OSSC 2VXFA 1VIEA 4XEMA 4CRIA 1YGBA 3HFZB 2ZPEB 2DAQA 4C8QD 2DIGA 1L0WA 1B8AA 3L1AA 4ZN3A 3S3NA 4J15A 1JJ2S 2C06A 5KCOA 3HTZA 1H4SA 3M4QA 1N9WA 2FHDA 4HCBA 1N9RA 4OGCA 4TQFA 4FT2A 3M54A 1KG1A 2EYQA 2M1HA 3FEOA 3CCJT 3S3OA 1VQMA 4IUPA 3QO3A 3NEMA 4YRTA 2EJ9A 4P74A 3CC4A 1JJCA 3A7UA 3OMCA 1JJCB 1Y96A 2L89A 2MWPA 1M1KC 1JB0E 1B70B 2PVOB 3LSQA 3OYMA 5GMKm 3CCMA 2X4WA 4JS5A 4A4KA 3MF1A 1VQZA 3GNGA 4F7UE 4M78E 4M77D 2RI2A 3VQYA 3M9QA 1VQLT 3SB2A 4YCUA 2ARUA 1G5IA 1VQ5T 2J3MA 4M7AB 4H02A 3EFRA 3ZFJA 5GANg 4OLFA 3G7ZA 5GAN4 1YJNT 3CCST 2WSEE 1VQ7T 2ARSA 3JRZA 4PJOD 4BACA 3SWNA 5FU6C 4XQ3A 3CCVT 3OBYA 3MEWA 4KT0E 5GAN6 2LT4A 3OSVA 2E70A 4XTYA 3GIBA 1SSFA 2VYTA 2RD1A 3CCLT 2OAUA 1M1KU 5J39A 2P5IA 3HRSA 2QTXA 4LDUA 4JLIA 3MEAA 2ZZDA 4YTLA 3M5AA 2P0PA 4XTUA 2AKWA 1YB3A 3HRKA 3PCOA 3CC7T 1Q82U 3IKLA 5D6YA 1EVLA 2F5TX 4EMKA 2A3LA 4C92C 2XKOC 3RMSA 3M57A 5GAN8 1RIQA 1ATIA 3CMQA 3OW2A 1YFTA 2RHSA 5CIUA 1OI1A 1YIJA 2Y4YA 3A31A 3CC4T 3OS1A 3CC7A 3RGLA 1M90U 3UH0A 2I4LA 4YP0A 3V8JA 4YYEA 3QXEB 2NLUA 1G5HA 1VQ8A 5GAMh 2RJDA 2YHTA 1VQ4A 4C92G 3L4GA 3W3SA 3CCQT 2OTJA 1Q7YC 2K57A 3P8YA 2FB7A 4UPAA 2K5FA 1BYMA 3QO8A 4LDWA 4EMKC 1GXIE 4M7AG 2ZINA 2ZR2A 3CCLA 2DZ9A 4UP9A 3CCVA 2OTLT 5L8RE 4BE2A 3PZCA 3OYNA 4YRJA 3JCMd 1YJNA 2QHVA 3MQZA 1NJ6A 3TUPA 2EQUA 5LJ5d 4CS4A 4E7JA 2L8DA 1VQ5A 4X34A 2ZNIA 4XTZA 2WACA 4LD9K 4MDWA 1NYQA 2X35A 4C0GA 3RKYA 3J7AF 3BW1A 1K73C 4M77E 4HT4A 3V8LA 3P8HA 3C95A 3NFCA 2X4YA 4C8QE 4KULA 4YCVA 4KR2A 5GAOr 4IURA 2LCLA 3HXVA 1QVGA 1YITT 1Y71A 3QJ6A 4Y28E 1M1GA 3VU3C 5ELOA 3E19A 1NE8A 1Y96B 1WQ7A 4FIBA 4H2YA 3CEYA 3LH0A 4C5IA 4D6WA 1E1TA 1VQMT 3UPUA 3M4YA 4JS4A 2K5IA 1NYRA 5E3IA 1VQ6A 4YRFA 4XEOA 1NPRA 5GMKh 4G85A 3A8OB 5GAOq 4HCZA 3TEHB 3JCMX 2Y90A 3CXCS 3CMAA 4M77G 4OB2B 3EFSA 3CCRT 1OYXA 4RCBA 3VQWA 3HXZA 1B76A 1UB4A 5CKBA 3FIFA 1D3BA 2JTMA 4VUBA 1D3BB 3OW2S 3HXXA 3CCUT 3L2VA 2EL9A 2OTJT 4NS5A 1XNIA 2VUBA 2NS6A 3G71T 2XDPA 2ZCEA 1XQHA 3JCMc 4PJOA 4IUQA 3JB9I 1B7YB 3I56T 4A53A 2DZCA 4M7DF 2ZT5A 4MMLA 1Q81C 5GMKi 4BWAA 2ZZEA 4ZIBA 2KVQG 4JDSA 4PLLA 2RI3A 3E9GA 3OYIA 4P3NA 4XU0A 3P8TA 4XTVA 5LJ3g 2QQSA 4ZTJA 3QUIA 3JB9H 1QP3A 4K86A 2I4MA 4C5HA 1R8OB 4LVMA 5I2MA 2ALYB 4M78F 2ZTGA 5LL6S 2CJ9A 1M90C 2RHQA 3SDZA 3MCAB 3JCMQ 1NPPA 3RKXA 3CBOA 4C0DC 4OP0A 3GP8A 3E9HA 1I5LA 3LSSA 2I2LA 3JCMV 4NL2A 4BDZA 2KAFA 3Q1JA 4ZGDB 4OB1B 2V8KA 4QQDA 2R5AA 2MWOA 3HFOA 1I8FA 2LNVA 3HXWA 3HRUA 3QYGB 1N27A 4OB0B 1X55A 4LVIA 3HSBA 3KFUA 1NJ5A 1WGSA 4F7UB 2ZIMA 3A8MB 1KQ2A 2XHCA 4TVAA 3CCSA 4HCCA 5HK0A 4M7DE 4BI3A 1G51A 3MEVA 1X75C 2RO0A 3JAME 1NJ8A 2WSFE 4DOVA 3OYYA 4R56A 3KXTA 1QE0A 3FB9A 1UGRB 5I2SA 2PUOB 4UP7A 4MZPA 1WYDA 2X4XA 2QHTA 2J3LA 3OYAA 4IUVA 1WNLA 1KQSA 3LC0A 4YRCA 1QW1A 1B34A 2EQJA 1Z7NA 2ZZGA 3HP9A 3GNFB 3TEGA 2V8JA 4KUDK 1HXDA 3C12A 2CZ6B 4PJOG 3SD4A 4B9WA 4C8QG 3QJYA 3A5ZB 4YRNA 4BY6B 1WPYA 1JBMA 2IG0A 2GF7A 2PVGB 5FU7C 3QIIA 1U1SA 1YI2A 4ZTZB 3I56A 4LNSA 2MF2A 2QA4T 2XD0A 3X20B 4JRPA 3PCOB 1YJ9A 4C92F 1M8VA 3HXUA 2K2VA 3L4GB 4C92E 4HWRA 3UWNA 1WJRA 3BDUA 3JCMe 4P3PA 1M5Q1 3MP6A 5J3BA 3OYBA 2AMCA 5C52B 3IALA 4O2DA 3PNWC 4OB3B 1K8AU 4NOYA 3CMEA 2DVEA 1ZHIA 2I4NA 3INZA 4KUIA 1AHJB 2YRVA 3L2WA 4HA8A 4EMKB 3S6WA 3CC2T 1XTDA 1FX7A 4YROA 4C5EA 4HT8A 3A5ZA 2QQ9A 4XU3A 1E24A 2P0LA 5D6WA 1GGMA 2ZCFB 3LWHA 4GY5A 1YITA 3UFGA 2LX9A 3MF2A 1ADYA 2KK4A 2Q7HA 4XU1A 4MZTA 2ZIOA 3RERA 4FSXA 3KBGA 4M7AD 2O4XA 3MP8A 5CKFA 2YLCA 1PSFA 3FJPA 4OF1A 4A4GA 1I81A 3OYLA 5C51B 2JTFA 2BIVA 4YRIA 1IL2A 2IY5B 3V7CA 3NTIA 1SRYA 4L5GA 3X25B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U1T A;  4M7A G;  2ZIN A;  2ZR2 A;  4TTV A;  4CH4 A;  4M75 D;  2DZ9 A;  2Q5I A;  3SWN B;  4UP9 A;  2DKG A;  4F7U F;  3QO7 A;  3RES A;  4DPG A;  3A74 A;  5K1P A;  4RCC A;  4PJO C;  3PZC A;  4YRJ A;  3JCM d;  1EIY B;  2QHV A;  1H64 1;  1KQ1 A;  4NL3 A;  3V8K A;  1NJ6 A;  3TUP A;  5I21 A;  1USY A;  4P75 A;  5LJ5 d;  4TWA A;  4CS4 A;  3G1Z A;  1PYS A;  2ART A;  4CH5 A;  3V7R A;  2C7I A;  4P71 A;  2ZNI A;  4XTZ A;  4JRI A;  3UGT A;  1NYQ A;  3JB9 G;  4P75 C;  3RKY A;  1HK9 A;  2DXU A;  3BW1 A;  2C8M A;  2ODR D;  3L2Z A;  3E9I A;  4M77 E;  3M4G A;  4M7A F;  3V8L A;  1KMM A;  2E1H A;  4NCX A;  3REX A;  2DTH A;  2E65 A;  2ZT7 A;  4C8Q E;  1X56 A;  4YRK A;  2ODR C;  4QVC A;  4YCV A;  4KR2 A;  5GAO r;  4RQF A;  1SES A;  4MMK A;  3HXV A;  1H4V B;  4EX5 A;  2Q7G A;  4CS3 A;  3A7A A;  3NEN A;  4P73 A;  1C0A A;  3VU3 C;  4EMH A;  4C8Q B;  5ELO A;  4XTX A;  4PNO A;  5LJ5 f;  3NEL A;  4M75 G;  3RKW A;  4H2S A;  4M77 C;  4L87 A;  2XGT A;  1Y96 B;  1WQ7 A;  1BIB A;  3QNE A;  3WQZ A;  1PYS B;  5GAN 7;  3OD1 A;  4H2Y A;  5GAM j;  1JRI A;  2JN0 A;  5GAN 2;  4BW9 A;  1E1O A;  4M75 F;  2DQ3 A;  3QHS A;  5K1X A;  1E1T A;  4YRQ A;  1HC7 A;  1WLE A;  4Y91 A;  4TVY A;  5GMK l;  1TH7 A;  1NYR A;  4M7A E;  1LNX A;  3NET A;  5E3I A;  4KQE A;  1ASZ A;  4YRF A;  4XEO A;  5GMK h;  5GAO q;  3I7F A;  4G85 A;  2YLB A;  1NJ1 A;  4YRP A;  3TEH B;  1J5W A;  3JCM X;  2Y90 A;  2EJF A;  4M77 G;  3EFS A;  4M77 B;  5LJ5 g;  3UGQ A;  4YRM A;  4XTW A;  1EIY A;  1SER A;  4RCB A;  4YRG A;  4E51 A;  3VQW A;  5GAO p;  3RUX A;  3RF1 A;  3HXZ A;  1B76 A;  3P8V A;  4CH6 A;  2EWN A;  2PME A;  4M77 A;  5GAO l;  4JUV A;  3FIF A;  1D3B A;  2DJZ A;  5LJ5 h;  1HTT A;  1EFW A;  1D3B B;  3HXX A;  3A7R A;  1WQW A;  3JCM W;  4P71 C;  2EL9 A;  3JCM h;  1YFS A;  5GAM d;  4DQ2 A;  2PMF A;  4V2S A;  1YFR A;  5CAI A;  2IY5 A;  2ZCE A;  3JCM c;  4PJO B;  3DSQ A;  4PJO A;  3AHU A;  2ZNJ A;  4EO4 A;  5GAO m;  4HVC A;  3JB9 I;  2Q5H A;  1B7Y B;  4P74 C;  4A53 A;  2DZC A;  4M75 A;  4M7D F;  2ZT5 A;  2E10 A;  4MML A;  2ZT6 A;  5GMK i;  1EVK A;  2ZZE A;  4BWA A;  4ZIB A;  3JB9 J;  4A54 A;  3ERR A;  1KOG A;  4HT9 A;  2RM4 A;  5LJ3 d;  2VC8 A;  4P3N A;  12AS A;  2DEQ A;  3VQV A;  4XU0 A;  3P8T A;  4XTV A;  5LJ3 g;  4WJ4 A;  3SWN C;  3JCM P;  4CS2 A;  5KNN A;  1KMN A;  4QVD A;  4RDX A;  3QUI A;  3JB9 H;  2AKW B;  4K86 A;  5GAM f;  4J6W A;  2RB6 A;  2I4M A;  3BFM A;  4ZTU B;  2ALY B;  4M78 F;  1SET A;  2ZTG A;  4H2U A;  5LJ3 h;  2ALY A;  4RQE A;  2CJ9 A;  2RHQ A;  5GAN 3;  3JCM Q;  4M7D C;  4F7U G;  4TVW A;  2AMC B;  4P3O A;  2FYK A;  4Q15 A;  5GMK e;  3RKX A;  3V7S A;  1E22 A;  4YRL A;  4OP0 A;  1WU7 A;  3E9H A;  1EQR A;  4PJO F;  1FYF A;  4M78 A;  1I5L A;  3LSS A;  4X9D A;  2I2L A;  4KR3 A;  3JCM V;  4NL2 A;  3A32 A;  3JB9 D;  4X5O A;  3QTC A;  4YRR A;  11AS A;  3VQX A;  4HWT A;  1W66 A;  3HY0 A;  1QF6 A;  2VXF A;  5LJ3 f;  3HFO A;  4H2V A;  4XEM A;  1I8F A;  1BBU A;  1I4K 1;  3HXW A;  1YGB A;  3HFZ B;  2EJG A;  4TVA B;  4J6Y A;  3PGG A;  4HWO A;  4C8Q D;  3RL6 A;  1L0W A;  4N0A A;  2DTO A;  1B8A A;  1X55 A;  3L1A A;  4P73 C;  3HSB A;  3KFU A;  1NJ5 A;  4F7U B;  3RIR A;  4J15 A;  2ZIM A;  1KQ2 A;  4TVA A;  1B7Y A;  3HTZ A;  1X54 A;  4K88 A;  1H4S A;  4M7D E;  3M4Q A;  1G51 A;  1N9W A;  4Q6G A;  2DTI A;  3IG2 A;  1N9R A;  4M7D G;  4TQF A;  4J6X A;  4C92 D;  2VXE A;  1NJ8 A;  2DQ0 A;  4PHC A;  5HGQ A;  4G84 A;  1ASY A;  4M7A A;  2HNI A;  5LJ5 j;  2RHS B;  1QE0 A;  3FB9 A;  5LJ5 e;  2Q7E A;  4M7A C;  4M75 B;  3HXY A;  5GAO n;  4EMG A;  5GAN f;  4UP7 A;  1USY C;  4M75 C;  1WYD A;  3IKM B;  3MEY A;  3QO3 A;  3NEM A;  4YRT A;  4P72 C;  2EJ9 A;  3HRI A;  2XTI A;  4P74 A;  1JJC A;  2QHT A;  2J3L A;  3A7U A;  5GAN j;  1JJC B;  1WNL A;  1Y96 A;  3RAC A;  1B34 B;  3LC0 A;  4M77 F;  4YRC A;  1B34 A;  1B70 B;  1NNH A;  5DY9 A;  1Z7N A;  2ZZG A;  3LSQ A;  4H2W A;  3HFV A;  5GMK m;  3TEG A;  4PJO E;  2ZXF A;  1HXD A;  2RHQ B;  2E64 A;  4PJO G;  3A5Y A;  4C8Q G;  3MF1 A;  1B70 A;  1VQZ A;  1X2H A;  4N0A C;  3BY7 A;  4YRN A;  4F7U E;  1MGQ A;  4M78 B;  1WPY A;  1JBM A;  3JCM f;  4H2T A;  4M78 E;  4M77 D;  2E5A A;  3VQY A;  3VBB A;  1U1S A;  4ZTZ B;  3HFN A;  4LNS A;  5F5W A;  5GAM g;  1BIA A;  3M4P A;  2DXT A;  3SB2 A;  4YCU A;  2ARU A;  4RMF A;  1G5I A;  1ADJ A;  4HWP A;  4C8Q A;  2J3M A;  4M7A B;  2CJB A;  3JCM g;  2I4O A;  5GAN d;  4H02 A;  1BBW A;  1Z7M A;  3EFR A;  2QHS A;  5GAN g;  3PCO B;  4M7D B;  4OLF A;  4C92 F;  4M7D A;  1M8V A;  5GAN 4;  4F7U A;  4C92 B;  3HFZ A;  3HXU A;  4XU2 A;  2ARS A;  4PJO D;  3L4G B;  4H2X B;  4C92 E;  3SWN A;  4HWR A;  3R07 A;  2ZT8 A;  3JCM e;  3BDU A;  2RA2 A;  4JRK A;  4P3P A;  4XQ3 A;  1M5Q 1;  2EAY A;  4P72 A;  5GAN h;  2DU5 A;  5GAN 6;  3REU A;  3QSU A;  4X9C A;  4XTY A;  4C92 A;  3GIB A;  3HY1 A;  2RD1 A;  2AMC A;  4YDQ A;  5C52 B;  4M78 D;  3IAL A;  4O2D A;  4AH6 A;  4C8Q F;  2ZGW A;  2P5I A;  1X01 A;  2QTX A;  2CIM A;  5LJ3 e;  4UP8 A;  1N9S A;  1X2G A;  5ELN A;  4JLI A;  4NOY A;  4CH3 A;  5GAN 5;  2E41 A;  2DDZ A;  1YCY A;  2DVE A;  2QHU A;  1NJ2 A;  2I4N A;  3INZ A;  3JB9 F;  3TEH A;  4XTU A;  4HA8 A;  1YB3 A;  2AKW A;  4EMK B;  4YPF A;  5GMK j;  4M7D D;  2CGH A;  3HRK A;  4YRO A;  4HT8 A;  3PCO A;  3A5Z A;  3IKL A;  4XU3 A;  1E24 A;  5GAM e;  1EOV A;  2P0L A;  2ZZF A;  1GGM A;  1EVL A;  1LYL A;  4EMK A;  1LJO A;  4K87 A;  3UFG A;  3MF2 A;  1ADY A;  4C92 C;  2Q7H A;  4XU1 A;  2ZIO A;  5GAN 8;  3RER A;  5GAN e;  1RIQ A;  1ATI A;  2ZR3 A;  3CMQ A;  1YFT A;  1LOJ A;  4M78 C;  4M7A D;  2RHS A;  3QO5 A;  4PG3 A;  4J5Y A;  4C8Q C;  3A31 A;  2YLC A;  3JCM b;  3RGL A;  4YCW A;  4WF2 A;  4WJ3 M;  3FJP A;  4M75 E;  2E3C A;  3UH0 A;  1I81 A;  5C51 B;  2I4L A;  4YP0 A;  3V8J A;  4YYE A;  4YRI A;  1IL2 A;  2DU7 A;  1G5H A;  4WI1 A;  3JCM J;  4YRE A;  2IY5 B;  5GAM h;  5LJ3 j;  2YHT A;  3V7C A;  4H2X A;  4C92 G;  4YRS A;  3L4G A;  3BJU A;  4HWS A;  5C53 B;  3W3S A;  1H4T A;  3ICA A;  2CJA A;  2K57 A;  2G4C A;  3P8Y A;  1H4Q A;  2FB7 A;  4UPA A;  1SRY A;  4TQD A;  3QO8 A;  4M78 G;  4EMK C; 
#chains in the Genus database with same CATH topology
 2FVU A;  2WSC E;  1IGU A;  3LX7 A;  4A4F A;  2QI2 A;  3SWN B;  5KYU A;  3FJ5 A;  3OS5 A;  4J9H A;  5K1P A;  1S72 A;  2L3P A;  1G5V A;  2L2P A;  1VQP A;  1OPL A;  3CXC P;  1YCS B;  3P8B B;  4LDY A;  3BDL A;  1KQ1 A;  3URG A;  4A4H A;  4C0F A;  2JJ9 A;  1VQP T;  2ROT A;  3A8H B;  1PYS A;  3QDR B;  2C7I A;  3U23 A;  1EFN A;  1FYN A;  5A0G A;  5KYU B;  3JB9 G;  3TEE A;  3CC7 Q;  1QVP A;  5A0L A;  1HK9 A;  1WHM A;  5KYY B;  2C8M A;  2YUQ A;  2ODR D;  3L2Z A;  3TCJ A;  3CMA T;  5CKH A;  4NCX A;  2E5K A;  2LQN A;  4OMF B;  2YRD A;  1VQP Q;  1Q86 C;  1W2B S;  2COY A;  4HXJ A;  2D8J A;  3QYH B;  3H8Z A;  1GL5 A;  3VRY A;  2V8I A;  1H4V B;  1OEB A;  4BB7 A;  2Q7G A;  2JUF A;  4BDY A;  1V76 A;  4CS3 A;  2H3E B;  4P73 A;  1C0A A;  2EYX A;  3CCL Q;  5KYW B;  4J9F A;  4EMH A;  4C8Q B;  2GFU A;  2MYS A;  1PD0 A;  2QYZ A;  4XTX A;  1VYT A;  4M75 G;  2JW4 A;  5HKC A;  2V1Q A;  3C4S A;  5D6X A;  1T0J A;  2JM8 A;  1PYS B;  4LUE A;  4RTZ A;  5FLX E;  5GAN 7;  5GAM j;  3OD1 A;  3OW2 P;  1X6B A;  1UTI A;  1JRI A;  2KXC A;  5CR2 A;  4BW9 A;  2HKN A;  3R6N A;  2OTL A;  2FG0 A;  2JNG A;  1HC7 A;  3G71 A;  2HMA A;  4Y91 A;  2DMO A;  1KFZ A;  3I55 Q;  1LNX A;  1ABQ A;  4Z89 A;  1VQK T;  1VQ5 Q;  1MHN A;  1UHF A;  2RJC A;  2ZPH B;  4J9G A;  1YJ9 T;  3L2R A;  3I7F A;  2YLB A;  2CSI A;  1PD1 A;  3ME9 A;  1J5W A;  2VAS A;  2AK5 A;  2DA9 A;  2LQW A;  4XTW A;  1SER A;  2W0Z A;  4E51 A;  1AD5 A;  3RUX A;  4LVK A;  5HY6 A;  2EFI A;  3L42 A;  5GAO l;  1EFW A;  1VQ7 A;  5KH6 A;  2M0O A;  3PIP A;  2KDS A;  3JCM h;  1R77 A;  3N5B B;  1AWX A;  4V2S A;  2O88 A;  1GCQ C;  1B3Q A;  2DPP B;  1JJ2 P;  4PJJ A;  2IY5 A;  4HVU A;  1TOV A;  3OYG A;  4PJO B;  4EO4 A;  4HVC A;  4ELZ C;  2GQI A;  4ZGJ B;  3EAE A;  2CP3 A;  4B6M A;  2BE9 B;  4D8K A;  2J05 A;  3OY9 A;  3JB9 J;  1U8R A;  4HT9 A;  2SEM A;  3HRT A;  4LN2 A;  12AS A;  4LD6 A;  2PUK B;  4WJ4 A;  2F69 A;  1SRL A;  1X27 A;  3O8V A;  4RG2 A;  5KNN A;  5CKE A;  1ZUK A;  2KRO A;  4J6W A;  1AZE A;  1KD1 C;  2RB6 A;  2X9H A;  1N5Z A;  4FSS A;  3I55 A;  1UGP B;  4ZTU B;  2DET A;  1QKW A;  5LJ3 h;  1YIJ T;  1VQ8 Q;  2F1L A;  5GAN 3;  4M7D C;  1TSF A;  4F7U G;  4KRT A;  1UGV A;  5GMK e;  2HKQ B;  2EYZ A;  1E22 A;  4AFU C;  4PJO F;  4X9D A;  2LRQ A;  3EG1 A;  3CCQ Q;  3QTC A;  3HPW A;  4YRR A;  1B7T A;  4N4H A;  4HWT A;  3HY0 A;  1C0M A;  5LJ3 f;  1RLP C;  4H2V A;  4E7L A;  1W6X A;  1PC0 A;  3PGG A;  3QDF A;  4HKE A;  4BE1 A;  4HWO A;  3PMT A;  3RL6 A;  1N6A A;  4N0A A;  1FXX A;  4P73 C;  4PFZ A;  4BI8 B;  1N8R C;  2JMC A;  1M1K R;  2KRM A;  2K6D A;  1K9M U;  3LWI A;  1YWO A;  3CMA Q;  2LT1 A;  4Q6G A;  2DTI A;  3H41 A;  3OA6 A;  4ZTF A;  4M7D G;  4C92 D;  3EG9 A;  3X26 B;  4PHC A;  1ASY A;  2HNI A;  1IZ6 A;  2MIO A;  4QT7 A;  2RHS B;  3LGL A;  3I56 Q;  2HBP A;  1PKT A;  5LJ5 e;  3G6E Q;  2Q7E A;  5FRM A;  2RHZ A;  4M75 B;  1VQN T;  1NJI R;  1XOV A;  5GAO n;  3P8D A;  1QP2 A;  4EMG A;  4UC4 A;  2K3X A;  2A0F B;  3VYH B;  3IKM B;  5KYX B;  3MEY A;  2PTK A;  2E6N A;  4E7H A;  1RI0 A;  3OS0 A;  3PTA A;  2DYB A;  2KY9 A;  1B34 B;  2KMT A;  1X6O A;  3CPW A;  2XDB A;  2YSQ A;  4QVZ A;  2RMO A;  2RK1 A;  5IXF A;  4H2W A;  3HFV A;  2DD5 A;  2R5M A;  3DLL A;  1VA7 A;  1MV0 B;  2F2V A;  1NEB A;  3NTK A;  2COZ A;  5FWC A;  2ED0 A;  1KQS P;  2QQA A;  1WDX A;  1Y0M A;  1P92 A;  3WVE B;  1YJW T;  1YJW A;  4M78 B;  1OZ2 A;  4JRQ A;  3JCM f;  2K5L A;  1KC8 R;  3QWY A;  3HFN A;  5F5W A;  1WHL A;  2FPF A;  1BIA A;  2H3J A;  3M4P A;  2QAS A;  2L3Q A;  2R57 A;  2RN8 A;  5CCA A;  3A8G B;  2HQE A;  5IAY A;  4RMF A;  3OS2 A;  4C8Q A;  2RQU A;  2A7Y A;  3QZ9 B;  2CJB A;  2K9G A;  3JCM g;  2I4O A;  2J6O A;  2E6Z A;  1BBW A;  2QHS A;  1UJY A;  2LC4 A;  3MHX A;  4KBM B;  2DL7 A;  4F7U A;  4XU2 A;  4H2X B;  2B8A A;  1X2Q A;  2CH4 A;  3SEM A;  3R07 A;  2LTO A;  1KQS S;  4JRK A;  1T3L A;  4P72 A;  1QKX A;  3QSU A;  4X9C A;  3OYF A;  2NUP B;  3HY1 A;  5CO7 A;  3HHT B;  2D8H A;  2DK3 A;  3MEU A;  2MPX C;  2HAX A;  2QEX Q;  2ZGW A;  4C5G A;  1ZSG A;  2CIM A;  5LJ3 e;  5IN1 A;  2X3W D;  1X2G A;  2ZPG B;  3CPW P;  4CH3 A;  1RI9 A;  1VQK A;  5GAN 5;  4FL6 A;  2E41 A;  2DDZ A;  3MET A;  4OVA A;  2NYS A;  2QHU A;  3QG1 A;  4FU6 A;  1NJ2 A;  3JB9 F;  2KXD A;  2KYM A;  1VQ6 Q;  7AT1 B;  4PL6 A;  4N4I A;  3QKJ A;  1SPK A;  1YHQ A;  3H6Z A;  4QW2 A;  5CK9 A;  1G3T A;  4E6R A;  5GAM e;  1QMC A;  2ZPF B;  1EOV A;  1K9M C;  2Z0W A;  4CI0 C;  5C6S A;  4ORZ A;  5A2Q E;  1LYL A;  2J06 A;  1LJO A;  2DF6 A;  3JSC A;  4K87 A;  2AIR B;  3DB3 A;  1I0C A;  3WXM B;  2EYY A;  1H92 A;  2BUD A;  1WZO A;  4C0Z A;  1KC8 C;  1NYG A;  1BI0 A;  1D1C A;  2ZR3 A;  3M0T A;  4C0D B;  4M78 C;  1RAG B;  3FLG A;  1B07 A;  4PG3 A;  5FRO A;  3M0R A;  4DBH A;  3CCE T;  1UFF A;  4J5Y A;  1ZUY A;  1QCF A;  1VOM A;  3CD6 T;  1E7O A;  2X4J A;  4YCW A;  3M59 A;  1ZQ1 A;  4RTY A;  1ABO A;  3RDV A;  1N8R U;  1VQO A;  1LPL A;  2FPD A;  2DU7 A;  1VQN A;  4LDV A;  4WI1 A;  4YRE A;  1TUC A;  5LJ3 j;  2JOY A;  3PIO A;  3CME Q;  2GCX A;  1M1F A;  4YRS A;  3BJU A;  4HWS A;  3ICA A;  2CJA A;  3CCE Q;  4EPC A;  2G4C A;  2BE7 D;  2F5K A;  3CBM A;  1EIF A;  4ELY C;  4TQD A;  3EGX A;  4M78 G;  2M0Y A;  3EGX B;  1U1T A;  2RJF A;  3PT9 A;  4TTV A;  4ZGE B;  4CH4 A;  1VQ4 T;  4IUU A;  4M75 D;  2D6F A;  1GBQ A;  5HK3 A;  1VQ8 T;  4F7U F;  4KH0 B;  3LH5 A;  4OGE A;  2HL3 A;  2KQW A;  4RCC A;  2EQM A;  4PJO C;  2VKN A;  2XK0 A;  2QDY B;  1Y57 A;  2DL8 A;  2JVV A;  1H64 1;  4NL3 A;  2EIF A;  1YHQ Q;  3PFS A;  2QXF A;  1UHC A;  5I21 A;  1USY A;  4P75 A;  4AG1 C;  4DA4 A;  2KE9 A;  4TWA A;  1VQ6 T;  1VQ9 T;  2DIQ A;  4P71 A;  2M9U A;  5KE2 A;  3VKI A;  3FC3 A;  3M55 A;  3L2Q A;  5AYF A;  3CCU Q;  3UF4 A;  1IB8 A;  3MKD A;  4J7F A;  2LMJ A;  2DXU A;  2PU9 B;  3E9I A;  1WIE A;  3M4G A;  4M7A F;  2DM1 A;  1KMM A;  4JJD A;  1KHC A;  2E65 A;  4FCY A;  3RBB B;  2ZT7 A;  1ZBX A;  1M8M A;  1YHQ T;  9ATC B;  1GCQ A;  1VQ7 Q;  1X56 A;  4YRK A;  2CKK A;  2CP2 A;  2PQW A;  1JQQ A;  4RQF A;  2DER A;  1GFC A;  2O4X B;  4MMK A;  4II1 A;  4GBQ A;  5KCH A;  2GQV A;  4CC2 A;  4LVJ A;  2RHI A;  1BB9 A;  4EX5 A;  3CCS Q;  2LCS A;  1VQO T;  3NEN A;  3M56 A;  1YJ9 Q;  2O9S A;  5LJ5 f;  3CD6 A;  3CQT A;  4H2S A;  2ATC B;  1SG5 A;  3CCE A;  1BIB A;  4ANJ A;  3QNE A;  3VS4 A;  3GOX A;  1UJ0 A;  4FYY B;  3TSW A;  1UEC A;  1MMA A;  2JN0 A;  5GAN 2;  3EHQ A;  2KSS A;  2DQ3 A;  3QHS A;  5K1X A;  2BZ8 A;  2P4T A;  1FMW A;  4TVY A;  3MJX A;  5GMK l;  1LVK A;  1TH7 A;  3OYH A;  3OMG A;  1SF9 A;  4FM4 B;  1AT1 B;  2HSP A;  1FWZ A;  4FW2 A;  2HBW A;  3GLX A;  5FW9 A;  3J81 E;  2LDM A;  1NJ1 A;  4YRP A;  2EJF A;  3D7S B;  3CBP A;  3UGQ A;  1ZSZ B;  2RHX A;  4YRM A;  2QQR A;  2NUT B;  1D0X A;  3P8V A;  1SKU B;  1OOT A;  3VS2 A;  3JV3 A;  3VS5 A;  4E7Z A;  1TU0 B;  3ZBD A;  4M77 A;  2PME A;  3DB4 A;  5LJ5 h;  1VQL A;  2NUT A;  1GFD A;  2CS7 A;  3A7R A;  2KRN A;  4BE0 A;  1Y07 A;  3J80 E;  1VQN Q;  1WQW A;  2QQB A;  3LYI A;  4P71 C;  3CCQ A;  5FU7 B;  3TU4 K;  2GNC A;  2RI5 A;  1AWO A;  2M16 A;  3VUZ A;  1KC8 U;  1RAD B;  3M53 A;  5GAM d;  3GBQ A;  3G4S T;  3FDR A;  1S72 T;  2RHY A;  2HQX A;  5CAI A;  1ZA1 B;  4JLG A;  4K11 A;  2YDL A;  2KR3 A;  3AHU A;  3OYE A;  1KSW A;  2XU8 A;  1EZZ B;  3MP1 A;  4M75 A;  2E10 A;  2ZT6 A;  2V1R A;  2ENM A;  1EVK A;  2I0N A;  4E47 A;  3ERR A;  1KOG A;  2RM4 A;  1S72 Q;  3EG9 B;  3VQV A;  3OB9 A;  2DX1 A;  4JJN K;  1K4U S;  2D9T A;  1AZG B;  1QVG S;  4CS2 A;  2YXY A;  1UEB A;  1KMN A;  4J8O A;  4QVD A;  1PRL C;  4Z02 A;  3OBW A;  2AKW B;  2PZ1 A;  5GAM f;  1WA7 A;  2RH2 A;  1ZA2 B;  3ZEH A;  1SET A;  4RQE A;  3E1S A;  4HVV A;  2DXB A;  2AMC B;  4P3O A;  2FYK A;  3T9N A;  4Q15 A;  3V7S A;  4YRL A;  1WU7 A;  1EQR A;  1FYF A;  4M78 A;  3CCM T;  2XDD A;  1VYV A;  2CZ1 B;  2G3R A;  4LE9 A;  3EGD A;  1YBY A;  4JZ4 A;  3JB9 D;  4X5O A;  4O5V A;  4L6V 5;  3VS3 A;  1PHT A;  2PVD B;  2CT4 A;  2ZPB B;  1W66 A;  3ZL7 C;  3NPF A;  4L59 A;  2BKD N;  1BBU A;  1I4K 1;  3HL8 A;  2E5Q A;  2JS0 A;  2EJG A;  4F14 A;  1QVG P;  4QQG A;  5M9O A;  4TVA B;  4J6Y A;  2DEU A;  1D0Z A;  5DM7 R;  2L3R A;  2A36 A;  2DTO A;  2V26 A;  3A8L B;  3G1J A;  2QAZ A;  1RL2 A;  4RG8 A;  3CCJ A;  5I22 A;  1KIK A;  1NG2 A;  3RIR A;  2AHJ B;  4IUT A;  4J7I A;  1B7Y A;  3EH2 A;  1X54 A;  4K88 A;  2COW A;  1KHI A;  2LJ3 A;  4Y92 A;  1HD3 A;  3IG2 A;  3THK A;  3ULR B;  1AEY A;  2M51 A;  2P0Q A;  4J6X A;  2VXE A;  1ARK A;  2DQ0 A;  5HGQ A;  4G84 A;  4M7A A;  1SSH A;  5LJ5 j;  1M3C A;  2K3Y A;  1G3Y A;  4M7A C;  1WHH A;  3BE3 A;  3HXY A;  2L3S A;  3WVD B;  3VUB A;  5GAN f;  1USY C;  5AT1 B;  4M75 C;  4P72 C;  3HRI A;  2XTI A;  4A4E A;  1JJ2 A;  5GAN j;  2KEA A;  1X69 A;  3RAC A;  3S3M A;  4M77 F;  1M3A A;  3KFV A;  4RKU E;  1GBR A;  2XID A;  1K9A A;  1NNH A;  5DY9 A;  3VYG A;  1Q82 R;  2LQK A;  5IT9 E;  4PJO E;  2ZXF A;  1IHW A;  4JZ3 A;  2DL4 A;  2RHQ B;  3RNJ A;  2HZY A;  4PFP A;  2E64 A;  1X43 A;  2CDT A;  1W2B A;  3A5Y A;  4ZNX A;  4E7S A;  4ATO A;  1B70 A;  1X2H A;  2LJ1 A;  4N0A C;  3BY7 A;  3H0I A;  1MGQ A;  1NBE B;  4RTW A;  2OTL Q;  4H2T A;  2E5A A;  3CC2 A;  3I55 T;  3VBB A;  1D1B A;  5C0M A;  2LCC A;  5GAM g;  2RF0 A;  4MZM A;  3EG0 A;  2DXT A;  2VGN A;  3CPW S;  3VJP A;  1NZ9 A;  2ROL A;  2AKL A;  1ADJ A;  4HWP A;  1Q95 G;  3QZ5 B;  3EGD B;  2L0A A;  1W1F A;  3NTH A;  5GAN d;  1Z7M A;  3G6E A;  3OQ5 A;  5CQY A;  2XG8 D;  1G83 A;  1MMD A;  4ME7 A;  3LW5 E;  3H0F A;  4Q5W A;  2VV5 A;  4M7D B;  1QVF A;  4M7D A;  2X3X D;  2LJ0 A;  4C92 B;  1BKB A;  3HFZ A;  2C0T A;  2F2X A;  2DBK A;  2P4R A;  2GGR A;  2VGM A;  2Y4X A;  3PMI A;  4O6J A;  1W70 A;  2ZT8 A;  3EG3 A;  2RA2 A;  3VV0 A;  3REA B;  2EAY A;  2MMP A;  4KGV B;  2MCN A;  5GAN h;  1YIJ Q;  2DU5 A;  4BUG A;  3REU A;  4FYX B;  1K9M R;  2R58 A;  4C92 A;  3CCR A;  4YDQ A;  1NJI U;  5D7U A;  3ASK A;  4M78 D;  1Y7X A;  4AH6 A;  1WJS A;  1Q82 C;  4C8Q F;  2AT1 B;  2RK2 A;  3G6E T;  1X01 A;  4UP8 A;  3RMQ A;  4B9X A;  1N9S A;  5ELN A;  2K7A A;  3QBY A;  4CC7 A;  2L5Q A;  2NUP A;  2CP0 A;  1YCY A;  2RQR A;  1A0N B;  4J83 A;  3TEH A;  1RAC B;  1T3S A;  5KYY A;  3LLR A;  4PLI A;  2HD0 A;  2GFA A;  2ABL A;  4YPF A;  5GMK j;  5FRN A;  2QGF B;  4M7D D;  2CGH A;  3M0U A;  4J9C A;  1NM7 A;  1BCM A;  5KYN A;  1NYF A;  2RHU A;  2KI7 A;  2ZZF A;  1YP5 A;  2QEX T;  2RJE A;  3QPH A;  3R6O A;  1WYX A;  1U06 A;  1NEG A;  1K76 A;  1GCP A;  3CPF A;  4AG2 C;  5GAN e;  2ZPI B;  1M2V A;  1O75 A;  3GF5 A;  1LOJ A;  4BY6 C;  4E7K A;  2CP6 A;  3QO5 A;  3TVT A;  4P5N A;  1BI3 A;  4C8Q C;  2DXC A;  3JCM b;  4DOW A;  1AVZ C;  2EKO A;  4WF2 A;  2IVW A;  4M75 E;  2E3C A;  4WJ3 M;  2VVK A;  4LXC A;  1IRE B;  1VQ4 Q;  4TVR A;  2HCK A;  3F70 A;  3M0P A;  4PKC C;  3LGF A;  1KD1 U;  2DJQ A;  3QWX X;  3JCM J;  2YRC A;  3TRE A;  1YWP A;  2D0Q B;  1VQO Q;  1G3W A;  5KYW A;  4H2X A;  2F2W A;  1VQK Q;  5C53 B;  3OYJ A;  1X6G A;  1H4T A;  1VQ9 A;  3CME T;  5EC7 A;  1H4Q A;  1PNJ A;  1OV3 A;  4BD3 A;  1R0B G;  5KYX A;  4RMO A;  1WJQ A;  4IKF A;  1S1N A;  2Q5I A;  4KGZ B;  2K2M A;  2DKG A;  5EG2 A;  1NLP C;  3OYC A;  3QO7 A;  3KUF A;  3RES A;  4MDX A;  4DPG A;  1YJW Q;  3A74 A;  3ER0 A;  3L2U A;  4R0K A;  4OMN A;  4FYW B;  1EIY B;  1SRM A;  1VYU A;  2DO3 A;  1TTH B;  2EQK A;  3MO8 A;  3V8K A;  2MI6 A;  3G1Z A;  1PCX A;  2ART A;  4AMC A;  3V7R A;  4CH5 A;  3X24 B;  1Q7Y R;  2P0K A;  4JRI A;  2KGT A;  2CYZ B;  2EBP A;  1SHG A;  3OYD A;  3UGT A;  4P75 C;  1M9S A;  2CSQ A;  2E12 A;  2ED1 A;  2QA4 A;  8ATC B;  2DNU A;  2OTJ Q;  3CXC A;  2CZ0 B;  1C1A A;  1Q81 U;  2RQW A;  3X28 B;  2E1H A;  3REX A;  2DTH A;  2HQH A;  2RQT A;  2HSE B;  1NJI C;  3DKM A;  5IHN A;  2QTV A;  2ODR C;  4QVC A;  4IIO A;  1SES A;  1RAE B;  2ZAE A;  2EKH A;  2CP7 A;  3HKS A;  1E6H A;  2QDL A;  3A7A A;  1UGQ B;  2K4Y A;  4PNO A;  3NEL A;  3RKW A;  4DBF A;  1W4S A;  4M77 C;  4L87 A;  2XGT A;  3I5S A;  3WQZ A;  5CVI A;  1UGS B;  1BI1 A;  4WCI A;  2EGE A;  1JEG A;  1M4Z A;  2M02 A;  1VQM Q;  1E1O A;  4M75 F;  4DBR A;  4LVL A;  4YRQ A;  1WLE A;  4DBQ A;  2CZ7 B;  3UT1 A;  4EDU A;  4FT4 A;  2QEX A;  4BI4 A;  4M7A E;  4D8D A;  3NET A;  2XI9 A;  4ZN1 A;  1K0X A;  3SFM A;  4KQE A;  1ASZ A;  3H9N A;  1QLY A;  2LQ8 A;  1Q86 U;  3CCU A;  4M77 B;  5LJ5 g;  3M58 A;  5KE3 A;  1EIY A;  4YRG A;  1FMV A;  5GAO p;  2JZ2 A;  3RF1 A;  1ZSZ C;  2D0N A;  1VIF A;  5A0D A;  3OYK A;  1YIT Q;  2DFU A;  4CH6 A;  4LDX A;  2EWN A;  1RUW A;  2DLP A;  4JUV A;  2DJZ A;  1QVF S;  1YI2 T;  4F16 A;  1HTT A;  1VUB A;  4OMQ A;  4XAX B;  1AWJ A;  3JCM W;  2DD4 A;  2FZC B;  1HJD A;  1WHK A;  1YFS A;  2A8E A;  1K73 U;  1KK7 A;  1O9S A;  2DBM A;  2LVM A;  2OJ2 A;  3C94 A;  2JT4 A;  1M30 A;  4DQ2 A;  2PMF A;  1PSE A;  2DRM A;  2LP5 A;  2MAM A;  1DJ7 B;  1YFR A;  1WX6 A;  4R55 A;  4RTV A;  2O01 E;  4OMP A;  3DSQ A;  3E9F A;  2ZNJ A;  5GAO m;  2Q5H A;  2XIC A;  3UDC A;  3CC2 Q;  1OZ3 A;  4P74 C;  5CKD A;  1K8A C;  5DLO A;  5J26 A;  4A54 A;  5IH2 A;  1ZLM A;  2VC8 A;  5LJ3 d;  2DEQ A;  2MOX A;  1YI2 Q;  5FU6 B;  3SWN C;  3JCM P;  2JTE A;  4N4G A;  4GLK A;  4RDX A;  1TXQ A;  1U3O A;  4CC3 A;  5DLQ E;  4E7I A;  3BFM A;  3DLM A;  2BTT A;  1BK2 A;  4QQ6 A;  1V29 B;  5CQX A;  4H2U A;  3PVL A;  2ALY A;  3FRN A;  1K0S A;  1BI2 A;  1Q7Y U;  2ESW A;  2P84 A;  1C6V X;  4XK8 E;  1N8R R;  1IRX A;  4TVW A;  1HSQ A;  1G3S A;  1H3Z A;  1YN8 A;  1UG1 A;  2K79 A;  4KR3 A;  1TUD A;  2CUB A;  3A32 A;  3G4S A;  3GPL A;  4HVW A;  11AS A;  3VQX A;  2FL7 A;  4J9B A;  1QF6 A;  1PRM C;  3OSS C;  2VXF A;  1VIE A;  4XEM A;  4CRI A;  4Z8A A;  4E2F B;  1JO8 A;  4LNP A;  1YGB A;  3EH1 A;  2ZPE B;  3HFZ B;  1PG5 B;  4QKU A;  2DAQ A;  4C8Q D;  1G8X A;  2DIG A;  2KT8 A;  1L0W A;  3VS1 A;  1B8A A;  3L1A A;  3CD6 Q;  4ZN3 A;  3S3N A;  4J15 A;  1WLP B;  1JJ2 S;  2C06 A;  2X51 A;  5KCO A;  1D0Y A;  3HTZ A;  1H4S A;  3M4Q A;  1N9W A;  2FHD A;  3CCJ Q;  2EQI A;  4HCB A;  1N9R A;  5IHI A;  4OGC A;  4TQF A;  4FT2 A;  3M54 A;  1KG1 A;  1K73 R;  2FRY A;  1ZBJ A;  1WI7 A;  1D09 B;  1OUL A;  4M4Z A;  2EYQ A;  2M1H A;  3FEO A;  1RAI B;  3CCJ T;  3S3O A;  4WTO B;  1VQM A;  2G6F X;  2A37 A;  3I35 A;  4IUP A;  5IHK A;  2ECZ A;  3QO3 A;  2BZX A;  3NEM A;  4YRT A;  2EJ9 A;  4P74 A;  2CUD A;  3CC4 A;  1JJC A;  1NLO C;  3A7U A;  3OMC A;  1JJC B;  1Y96 A;  3CCR Q;  2L89 A;  2MWP A;  1M1K C;  1JB0 E;  1B70 B;  1MND A;  2PVO B;  2O9V A;  3LSQ A;  3NHN A;  5GMK m;  3OYM A;  3CCM A;  1OU8 A;  1RAA B;  2X4W A;  4JS5 A;  4A4K A;  3MF1 A;  1RAB B;  1VQZ A;  3GNG A;  4F7U E;  4M78 E;  4M77 D;  2RI2 A;  3VQY A;  3M9Q A;  5I11 A;  1VQL T;  2KYB A;  1QWF A;  1IO6 A;  1WFW A;  2NWM A;  3SB2 A;  4YCU A;  2ARU A;  1VQL Q;  1G5I A;  1VQ5 T;  2J3M A;  4M7A B;  4H02 A;  4AFZ C;  3EFR A;  3ZFJ A;  1IXD A;  5GAN g;  3PE0 A;  1MUZ A;  4OLF A;  3G7Z A;  2CH4 W;  5GAN 4;  1YJN T;  3CCS T;  2WSE E;  1VQ7 T;  2DIL A;  2ARS A;  3JRZ A;  1D1A A;  4PJO D;  4BAC A;  3SWN A;  5FU6 C;  1OX8 A;  3AT1 B;  2JMA A;  4XQ3 A;  2IIM A;  3CCV T;  3OBY A;  3MEW A;  3EFO A;  4KT0 E;  5GAN 6;  2LT4 A;  3OSV A;  2E70 A;  4XTY A;  1SSF A;  2VYT A;  3GIB A;  2RD1 A;  3CCL T;  2XMF A;  2OAU A;  1M1K U;  1M2O A;  4JJC A;  5J39 A;  2P5I A;  3O5Z A;  3A98 A;  2CT3 A;  3HRS A;  4RUG A;  2QTX A;  4LDU A;  1QCN A;  4JLI A;  3MEA A;  1VQ9 Q;  2ZZD A;  2AZS A;  4YTL A;  3M5A A;  2DL5 A;  2P0P A;  4XTU A;  2AKW A;  1YB3 A;  2EVR A;  3HRK A;  4RTT A;  3PCO A;  3CC7 T;  1Q82 U;  3IKL A;  5D6Y A;  1KD1 R;  1EVL A;  2F5T X;  4EMK A;  1WXU A;  2A3L A;  2LNH B;  4JPB W;  1UE9 A;  1M90 R;  4C92 C;  2XKO C;  3RMS A;  3M57 A;  5GAN 8;  1RIQ A;  4PJM A;  1H8K A;  3OW2 A;  8AT1 B;  2CP5 A;  2DRK A;  1ATI A;  3CMQ A;  1OU9 A;  1YFT A;  1EX4 A;  2RHS A;  5CIU A;  1OI1 A;  2B86 A;  3EGU A;  1YIJ A;  2EW3 A;  2Y4Y A;  3M0Q A;  3A31 A;  3CC4 T;  3OS1 A;  3CC7 A;  2SRC A;  3RGL A;  4J9D A;  1M90 U;  3UH0 A;  2I4L A;  3MPU B;  3V8J A;  4YP0 A;  4YYE A;  3QXE B;  2NLU A;  3VRZ A;  2FRW A;  1G5H A;  1IHV A;  1VQ8 A;  5FWB A;  1G2B A;  5GAM h;  2RJD A;  2YHT A;  1VQ4 A;  4C92 G;  3L4G A;  3W3S A;  3CCQ T;  1CKA A;  2QA4 Q;  1Q7Y C;  2OTJ A;  2K57 A;  3P8Y A;  1MMG A;  1PKS A;  2FB7 A;  2MK5 A;  4UPA A;  2K5F A;  1BYM A;  4PFO A;  3QO8 A;  4LDW A;  4EMK C;  1GXI E;  4M7A G;  2ZIN A;  2ZR2 A;  3CCL A;  2W10 A;  2KBT A;  2DZ9 A;  4UP9 A;  3CCV A;  4LUD A;  2OTL T;  5L8R E;  4BE2 A;  3PZC A;  3OYN A;  2K3B A;  4YRJ A;  3JCM d;  1YJN A;  2E4H A;  2QHV A;  3MQZ A;  3G71 Q;  1NJ6 A;  1MV3 A;  2EQU A;  3TUP A;  1T0H A;  5LJ5 d;  5HCK A;  4CS4 A;  4E7J A;  2L8D A;  1VQ5 A;  4X34 A;  1PM3 A;  4XTZ A;  2ZNI A;  1J3T A;  2WAC A;  4LD9 K;  4MDW A;  1NYQ A;  2X35 A;  4C0G A;  3RKY A;  3J7A F;  3BW1 A;  1K73 C;  2E3H A;  3C0C A;  4M77 E;  4HT4 A;  3V8L A;  2FEI A;  3P8H A;  3C95 A;  1M3B A;  3NFC A;  2X4Y A;  4C8Q E;  1M2V B;  4KUL A;  4YCV A;  4KR2 A;  5GAO r;  1QQJ A;  1RAF B;  4IUR A;  2LCL A;  4KH1 B;  1BCO A;  5GJW B;  3HXV A;  1QCO A;  3EHR A;  1I1J A;  1QVG A;  1YIT T;  1Y71 A;  3QJ6 A;  4Y28 E;  2RPN A;  2QGG A;  1M1G A;  1TS9 A;  1CSK A;  3VU3 C;  5ELO A;  2HL5 C;  3E19 A;  1NE8 A;  2VWF A;  4AT1 B;  1Y96 B;  1WQ7 A;  4FIB A;  1JU5 C;  1QVF P;  1OQK A;  4H2Y A;  3CEY A;  1ZSZ A;  3HTR A;  1PWT A;  3LH0 A;  3I5R A;  4C5I A;  4D6W A;  4PJL A;  2C0I A;  4OML A;  1E1T A;  1VQM T;  3UPU A;  3M4Y A;  4JS4 A;  2K5I A;  6AT1 B;  1NYR A;  1FMK A;  5E3I A;  1VQ6 A;  1W2B P;  1RAH B;  4YRF A;  4XEO A;  1NPR A;  5GMK h;  3A8O B;  3VS7 A;  5GAO q;  4G85 A;  4HCZ A;  3TEH B;  2A28 A;  1UDL A;  2Y90 A;  3JCM X;  3CXC S;  3CMA A;  4M77 G;  1OX9 A;  2JM9 A;  1K1Z A;  4OB2 B;  3EFS A;  3CCR T;  1OYX A;  4RCB A;  1BU1 A;  3VQW A;  3HXZ A;  1B76 A;  1UB4 A;  2OAW A;  3CC4 Q;  3IQL A;  4J9E A;  2FZK B;  3NGP A;  5CKB A;  3FIF A;  1D3B A;  2JTM A;  4VUB A;  1D3B B;  3OW2 S;  3HXX A;  3CCU T;  3L2V A;  1ZUU A;  2HEQ A;  1JXO A;  2EGA A;  2IPO B;  2EL9 A;  2OTJ T;  4NS5 A;  3G4S Q;  2FPE A;  2AKK A;  1XNI A;  2VUB A;  2NS6 A;  3G71 T;  2OX7 A;  2XDP A;  3A1P A;  2ZCE A;  1XQH A;  3JCM c;  1I5O B;  4F04 B;  4HCK A;  4PJO A;  4ESR A;  4IUQ A;  3JB9 I;  1B7Y B;  1KJW A;  3I56 T;  2AZV A;  4A53 A;  2DZC A;  4M7D F;  2ZT5 A;  4MML A;  1Q81 C;  1UUE A;  5GMK i;  4BWA A;  2ZZE A;  2A08 A;  3EG2 A;  4ZIB A;  2KVQ G;  4JDS A;  4PLL A;  2RI3 A;  4DEX A;  3E9G A;  3OYI A;  4P3N A;  4XU0 A;  3P8T A;  4XTV A;  5LJ3 g;  2YUO A;  4AFQ C;  2QQS A;  1U5S A;  3RR6 A;  1ACM B;  3REB B;  4ZTJ A;  3QUI A;  2CRE A;  3JB9 H;  1QP3 A;  4K86 A;  1AWW A;  4C5H A;  2I4M A;  2C0O A;  1R8O B;  4LVM A;  5I2M A;  3UAT A;  2O31 A;  4M78 F;  2ALY B;  2ZTG A;  5LL6 S;  2CJ9 A;  1M90 C;  2RHQ A;  1XJW B;  3SDZ A;  3MCA B;  3JCM Q;  2DL3 A;  1NPP A;  3RKX A;  3CBO A;  1TUG B;  4X1V A;  4C0D C;  4OP0 A;  3GP8 A;  3E9H A;  1OPK A;  4OMM A;  1I5L A;  3LSS A;  2I2L A;  3JCM V;  1YFN A;  4NL2 A;  3UA6 A;  3PVQ A;  2OI3 A;  3I9Q A;  4BDZ A;  2KAF A;  3Q1J A;  4ZGD B;  4OB1 B;  2YT6 A;  2V8K A;  4QQD A;  2R5A A;  2MWO A;  3HFO A;  1I8F A;  2LNV A;  2J6F A;  3HXW A;  2EGC A;  3HRU A;  2YUP A;  1X2K A;  3QYG B;  1N27 A;  4OB0 B;  4JJB A;  1X55 A;  4LVI A;  1K8A R;  3HSB A;  3KFU A;  1NJ5 A;  1WGS A;  2LX7 A;  4F7U B;  2ZIM A;  3A8M B;  1KQ2 A;  2XHC A;  1WHG A;  4TVA A;  3CCS A;  4HCC A;  5HK0 A;  1ZX6 A;  4M7D E;  4BI3 A;  1G51 A;  1MMN A;  1R0C B;  3MEV A;  2J6K A;  4GLM A;  1X75 C;  1Z9Q A;  2D1X A;  2RO0 A;  3JAM E;  1NJ8 A;  2WSF E;  4DOV A;  3OYY A;  5L23 A;  1AOJ A;  4R56 A;  4PJN A;  3KXT A;  2DVJ A;  1QE0 A;  3FB9 A;  3TSZ A;  2FO0 A;  1UGR B;  5I2S A;  2PUO B;  1Q86 R;  4UP7 A;  4MZP A;  1WYD A;  2YUN A;  1HYO A;  2X4X A;  2QHT A;  2GTO A;  2DYI A;  4J9I A;  2J3L A;  3OYA A;  4IUV A;  1WNL A;  1CKB A;  1KQS A;  3LC0 A;  4YRC A;  1QW1 A;  1B34 A;  4FW1 A;  2EQJ A;  1Z7N A;  2ZZG A;  2HDA A;  2O2O A;  3HP9 A;  3GNF B;  3TEG A;  2V8J A;  2BZY A;  4KUD K;  1HXD A;  3C12 A;  2CZ6 B;  2RNA A;  4PJO G;  3SD4 A;  4PK4 A;  4RTX A;  4B9W A;  4C8Q G;  2E3I A;  3E2U A;  3QJY A;  4IIM A;  3A5Z B;  4YRN A;  4BY6 B;  1WPY A;  3M0S A;  1JBM A;  2GTJ A;  2IG0 A;  2GF7 A;  2PVG B;  5FU7 C;  1LCK A;  3QII A;  3TQ7 P;  1U1S A;  1YI2 A;  4ZTZ B;  3I56 A;  4LNS A;  1SEM A;  2PNI A;  2MF2 A;  4FYV B;  2EPD A;  2QA4 T;  3H0H A;  1TWB A;  2LZ6 B;  2XD0 A;  4F17 A;  3VS6 A;  3X20 B;  4JRP A;  3NMZ C;  3PCO B;  1YNZ A;  1YJ9 A;  4C92 F;  1M8V A;  1WXT A;  3HXU A;  2K2V A;  3L4G B;  3VS0 A;  4C92 E;  2KT1 A;  1GRI A;  2JS2 A;  4HWR A;  3UWN A;  2J7I A;  2H8H A;  1WJR A;  3BDU A;  3JCM e;  4KGX B;  1BBZ A;  4P3P A;  1M5Q 1;  3MP6 A;  2QG9 B;  5J3B A;  3OYB A;  2AMC A;  5C52 B;  1MNE A;  3IAL A;  4O2D A;  1QWE A;  1SHF A;  2YWW A;  3PNW C;  4CC4 B;  4OB3 B;  1K8A U;  2FZG B;  4NOY A;  1WHJ A;  3CME A;  1H3H A;  2VB6 A;  1Z9Z A;  4DEY A;  2GBQ A;  2DVE A;  1ZHI A;  2I4N A;  3INZ A;  4KUI A;  1IGQ A;  4Z88 A;  1AHJ B;  1M27 C;  2YRV A;  3L2W A;  4HA8 A;  4EMK B;  3S6W A;  2KRS A;  2RQV A;  3CC2 T;  1XTD A;  1FX7 A;  1TG0 A;  3SHW A;  4YRO A;  4C5E A;  4HT8 A;  3A5Z A;  2QQ9 A;  4XU3 A;  1E24 A;  2P0L A;  5D6W A;  1GGM A;  2ZCF B;  3LWH A;  1YJN Q;  4GY5 A;  1YIT A;  3UFG A;  2LX9 A;  2DE0 X;  1ADY A;  3MF2 A;  1F1B B;  1Q81 R;  2KK4 A;  2NUZ A;  2Q7H A;  4XU1 A;  4MZT A;  2ZIO A;  2JXB A;  3CCV Q;  3RER A;  2QK0 A;  4FSX A;  3KBG A;  4EIK A;  4M7A D;  2O4X A;  3MP8 A;  4RTU A;  5CKF A;  4AFS C;  1V1C A;  2YLC A;  5ECA A;  4OMO A;  1PSF A;  3FJP A;  4OF1 A;  4A4G A;  1I81 A;  3OYL A;  5C51 B;  2JTF A;  5GJV B;  1I07 A;  1JXM A;  2BIV A;  4YRI A;  1IL2 A;  1WXB A;  2IY5 B;  2EYW A;  1RLQ C;  5IXB A;  3EFO B;  3V7C A;  2KNB B;  3NTI A;  3UA7 A;  1E6G A;  4A63 B;  1SRY A;  3CCM Q;  4L5G A;  3X25 B; 
#chains in the Genus database with same CATH homology
 2FVU A;  2WSC E;  3LX7 A;  4A4F A;  2QI2 A;  3SWN B;  3OS5 A;  5K1P A;  1S72 A;  1G5V A;  1VQP A;  3P8B B;  4LDY A;  3BDL A;  1KQ1 A;  3URG A;  4A4H A;  4C0F A;  1VQP T;  3A8H B;  1PYS A;  3QDR B;  2C7I A;  5A0G A;  3JB9 G;  3TEE A;  1QVP A;  5A0L A;  1HK9 A;  2C8M A;  2ODR D;  3L2Z A;  3TCJ A;  3CMA T;  5CKH A;  4NCX A;  4OMF B;  1Q86 C;  1W2B S;  3QYH B;  3H8Z A;  2V8I A;  1H4V B;  4BB7 A;  2Q7G A;  2JUF A;  4BDY A;  4CS3 A;  4P73 A;  1C0A A;  4EMH A;  4C8Q B;  2GFU A;  4XTX A;  4M75 G;  5HKC A;  3C4S A;  5D6X A;  1PYS B;  5FLX E;  5GAN 7;  3OD1 A;  5GAM j;  1JRI A;  5CR2 A;  4BW9 A;  2OTL A;  2JNG A;  1HC7 A;  3G71 A;  4Y91 A;  1LNX A;  1VQK T;  1MHN A;  2RJC A;  2ZPH B;  1YJ9 T;  3L2R A;  3I7F A;  2YLB A;  3ME9 A;  1J5W A;  4XTW A;  1SER A;  4E51 A;  3RUX A;  4LVK A;  5HY6 A;  2EFI A;  3L42 A;  5GAO l;  1EFW A;  1VQ7 A;  5KH6 A;  2M0O A;  3PIP A;  2KDS A;  3JCM h;  3N5B B;  4V2S A;  2DPP B;  2IY5 A;  3OYG A;  4PJO B;  4EO4 A;  4HVC A;  4ELZ C;  4ZGJ B;  3EAE A;  3OY9 A;  3JB9 J;  1U8R A;  4HT9 A;  3HRT A;  12AS A;  4LD6 A;  2PUK B;  4WJ4 A;  2F69 A;  3O8V A;  4RG2 A;  5KNN A;  5CKE A;  4J6W A;  1KD1 C;  2RB6 A;  3I55 A;  1UGP B;  4ZTU B;  5LJ3 h;  1YIJ T;  5GAN 3;  4M7D C;  4F7U G;  5GMK e;  1E22 A;  4PJO F;  4X9D A;  2LRQ A;  3QTC A;  3HPW A;  4YRR A;  4N4H A;  4HWT A;  3HY0 A;  5LJ3 f;  4H2V A;  4E7L A;  3PGG A;  4HKE A;  4BE1 A;  4HWO A;  3PMT A;  3RL6 A;  1N6A A;  4N0A A;  1FXX A;  4P73 C;  4BI8 B;  1N8R C;  1K9M U;  3LWI A;  2LT1 A;  4Q6G A;  2DTI A;  3OA6 A;  4M7D G;  4ZTF A;  4C92 D;  3X26 B;  4PHC A;  1ASY A;  2HNI A;  1IZ6 A;  2RHS B;  3LGL A;  2HBP A;  5LJ5 e;  2Q7E A;  5FRM A;  2RHZ A;  4M75 B;  1VQN T;  5GAO n;  1XOV A;  3P8D A;  1QP2 A;  4EMG A;  4UC4 A;  2K3X A;  3VYH B;  3IKM B;  3MEY A;  2E6N A;  4E7H A;  1RI0 A;  3OS0 A;  3PTA A;  2KY9 A;  1B34 B;  2KMT A;  1X6O A;  3CPW A;  2XDB A;  4QVZ A;  2RK1 A;  4H2W A;  3HFV A;  2DD5 A;  2R5M A;  3DLL A;  3NTK A;  2QQA A;  1P92 A;  3WVE B;  1YJW T;  1YJW A;  4M78 B;  1OZ2 A;  4JRQ A;  3JCM f;  2K5L A;  3HFN A;  5F5W A;  1BIA A;  2H3J A;  3M4P A;  2R57 A;  5CCA A;  3A8G B;  2HQE A;  5IAY A;  4RMF A;  3OS2 A;  4C8Q A;  2A7Y A;  3QZ9 B;  2CJB A;  3JCM g;  2I4O A;  2E6Z A;  1BBW A;  2QHS A;  2LC4 A;  3MHX A;  4KBM B;  4F7U A;  4XU2 A;  4H2X B;  2B8A A;  3R07 A;  2LTO A;  1KQS S;  4JRK A;  4P72 A;  3QSU A;  4X9C A;  3OYF A;  3HY1 A;  5CO7 A;  3HHT B;  2DK3 A;  3MEU A;  2HAX A;  2ZGW A;  4C5G A;  2CIM A;  5LJ3 e;  5IN1 A;  1X2G A;  2ZPG B;  4CH3 A;  1VQK A;  5GAN 5;  4FL6 A;  2E41 A;  2DDZ A;  3MET A;  4OVA A;  2QHU A;  3QG1 A;  4FU6 A;  1NJ2 A;  3JB9 F;  4PL6 A;  4N4I A;  3QKJ A;  1YHQ A;  3H6Z A;  4QW2 A;  5CK9 A;  1G3T A;  5GAM e;  1EOV A;  2ZPF B;  1K9M C;  4CI0 C;  5C6S A;  5A2Q E;  1LYL A;  1LJO A;  3JSC A;  4K87 A;  3DB3 A;  3WXM B;  2BUD A;  4C0Z A;  1KC8 C;  1BI0 A;  2ZR3 A;  4C0D B;  4M78 C;  3FLG A;  4PG3 A;  5FRO A;  3CCE T;  4J5Y A;  3CD6 T;  2X4J A;  4YCW A;  3M59 A;  1ZQ1 A;  1N8R U;  1VQO A;  2DU7 A;  1VQN A;  4LDV A;  4WI1 A;  4YRE A;  5LJ3 j;  2JOY A;  3PIO A;  2GCX A;  1M1F A;  4YRS A;  3BJU A;  4HWS A;  3ICA A;  2CJA A;  4EPC A;  2G4C A;  2F5K A;  3CBM A;  1EIF A;  4ELY C;  4TQD A;  4M78 G;  1U1T A;  2RJF A;  3PT9 A;  4TTV A;  4ZGE B;  4CH4 A;  1VQ4 T;  4IUU A;  4M75 D;  2D6F A;  5HK3 A;  1VQ8 T;  4F7U F;  4OGE A;  2KQW A;  4RCC A;  2EQM A;  4PJO C;  2XK0 A;  2QDY B;  2JVV A;  1H64 1;  4NL3 A;  2EIF A;  3PFS A;  2QXF A;  5I21 A;  1USY A;  4P75 A;  4DA4 A;  4TWA A;  1VQ6 T;  1VQ9 T;  2DIQ A;  4P71 A;  2M9U A;  5KE2 A;  3VKI A;  3FC3 A;  3M55 A;  3L2Q A;  5AYF A;  4J7F A;  2DXU A;  2PU9 B;  3E9I A;  3M4G A;  4M7A F;  1KMM A;  1KHC A;  2E65 A;  2ZT7 A;  1ZBX A;  1YHQ T;  1X56 A;  4YRK A;  2CKK A;  2PQW A;  4RQF A;  2O4X B;  4MMK A;  4II1 A;  5KCH A;  2GQV A;  4LVJ A;  2RHI A;  4EX5 A;  1VQO T;  3NEN A;  3M56 A;  5LJ5 f;  3CD6 A;  4H2S A;  3CCE A;  1BIB A;  3QNE A;  3GOX A;  2JN0 A;  5GAN 2;  2KSS A;  2DQ3 A;  3QHS A;  5K1X A;  2P4T A;  4TVY A;  5GMK l;  1TH7 A;  3OYH A;  3OMG A;  4FM4 B;  1FWZ A;  3GLX A;  3J81 E;  2LDM A;  1NJ1 A;  4YRP A;  2EJF A;  3CBP A;  3UGQ A;  2RHX A;  4YRM A;  2QQR A;  3P8V A;  3ZBD A;  4M77 A;  2PME A;  3DB4 A;  5LJ5 h;  1VQL A;  2CS7 A;  3A7R A;  4BE0 A;  1Y07 A;  3J80 E;  1WQW A;  2QQB A;  3LYI A;  4P71 C;  3CCQ A;  5FU7 B;  3TU4 K;  2RI5 A;  2M16 A;  3VUZ A;  1KC8 U;  3M53 A;  3G4S T;  5GAM d;  1S72 T;  3FDR A;  2RHY A;  2HQX A;  5CAI A;  4JLG A;  3AHU A;  3OYE A;  2XU8 A;  3MP1 A;  4M75 A;  2E10 A;  2ZT6 A;  1EVK A;  4E47 A;  3ERR A;  1KOG A;  2RM4 A;  3VQV A;  3OB9 A;  4JJN K;  2D9T A;  1QVG S;  4CS2 A;  1UEB A;  1KMN A;  4J8O A;  4QVD A;  4Z02 A;  3OBW A;  2AKW B;  5GAM f;  2RH2 A;  3ZEH A;  1SET A;  4RQE A;  3E1S A;  2DXB A;  2AMC B;  4P3O A;  2FYK A;  3T9N A;  4Q15 A;  3V7S A;  4YRL A;  1WU7 A;  1EQR A;  1FYF A;  4M78 A;  3CCM T;  2XDD A;  2CZ1 B;  2G3R A;  1YBY A;  3JB9 D;  4X5O A;  4O5V A;  4L6V 5;  2PVD B;  2ZPB B;  1W66 A;  4L59 A;  2BKD N;  1BBU A;  1I4K 1;  3HL8 A;  2E5Q A;  2EJG A;  4QQG A;  5M9O A;  4TVA B;  4J6Y A;  5DM7 R;  2L3R A;  2DTO A;  3A8L B;  1RL2 A;  4RG8 A;  3CCJ A;  3RIR A;  2AHJ B;  4IUT A;  4J7I A;  1B7Y A;  1X54 A;  4K88 A;  1KHI A;  3IG2 A;  2P0Q A;  4J6X A;  2VXE A;  2DQ0 A;  5HGQ A;  4G84 A;  4M7A A;  5LJ5 j;  2K3Y A;  1G3Y A;  4M7A C;  3HXY A;  3WVD B;  3VUB A;  5GAN f;  1USY C;  4M75 C;  4P72 C;  3HRI A;  2XTI A;  4A4E A;  1JJ2 A;  5GAN j;  3RAC A;  3S3M A;  4M77 F;  4RKU E;  2XID A;  1NNH A;  5DY9 A;  3VYG A;  2LQK A;  5IT9 E;  4PJO E;  2ZXF A;  2RHQ B;  2E64 A;  1W2B A;  3A5Y A;  4ATO A;  1B70 A;  1X2H A;  4N0A C;  3BY7 A;  1MGQ A;  4H2T A;  2E5A A;  3CC2 A;  3I55 T;  3VBB A;  5C0M A;  2LCC A;  5GAM g;  4MZM A;  3CPW S;  2DXT A;  2VGN A;  3VJP A;  1NZ9 A;  1ADJ A;  4HWP A;  3QZ5 B;  3NTH A;  5GAN d;  1Z7M A;  3G6E A;  3OQ5 A;  2XG8 D;  3LW5 E;  5CQY A;  4ME7 A;  4Q5W A;  2VV5 A;  4M7D B;  1QVF A;  4M7D A;  4C92 B;  1BKB A;  3HFZ A;  2VGM A;  2Y4X A;  3PMI A;  4O6J A;  2ZT8 A;  2RA2 A;  3VV0 A;  2EAY A;  2MMP A;  5GAN h;  2DU5 A;  4BUG A;  3REU A;  2R58 A;  4C92 A;  3CCR A;  4YDQ A;  1NJI U;  3ASK A;  4M78 D;  1Y7X A;  4AH6 A;  1WJS A;  1Q82 C;  4C8Q F;  2RK2 A;  3G6E T;  1X01 A;  4UP8 A;  3RMQ A;  4B9X A;  1N9S A;  5ELN A;  3QBY A;  2L5Q A;  1YCY A;  4J83 A;  3TEH A;  3LLR A;  4PLI A;  2HD0 A;  2GFA A;  4YPF A;  5GMK j;  5FRN A;  4M7D D;  2CGH A;  2RHU A;  2ZZF A;  2QEX T;  2RJE A;  3QPH A;  3R6O A;  3CPF A;  5GAN e;  2ZPI B;  1O75 A;  3GF5 A;  1LOJ A;  4BY6 C;  4E7K A;  3QO5 A;  4P5N A;  1BI3 A;  4C8Q C;  2DXC A;  3JCM b;  4DOW A;  2EKO A;  2IVW A;  4WF2 A;  4WJ3 M;  4M75 E;  2E3C A;  1IRE B;  4TVR A;  3F70 A;  4PKC C;  3LGF A;  1KD1 U;  3JCM J;  3TRE A;  2D0Q B;  1G3W A;  4H2X A;  5C53 B;  3OYJ A;  1H4T A;  1VQ9 A;  3CME T;  1H4Q A;  4BD3 A;  4RMO A;  1WJQ A;  4IKF A;  2Q5I A;  2DKG A;  5EG2 A;  3OYC A;  3QO7 A;  3KUF A;  3RES A;  4MDX A;  4DPG A;  3A74 A;  3ER0 A;  3L2U A;  1EIY B;  2DO3 A;  2EQK A;  3MO8 A;  3V8K A;  2MI6 A;  3G1Z A;  2ART A;  4CH5 A;  3V7R A;  3X24 B;  2P0K A;  4JRI A;  2CYZ B;  3OYD A;  3UGT A;  4P75 C;  1M9S A;  2E12 A;  2QA4 A;  3CXC A;  2CZ0 B;  1Q81 U;  3X28 B;  2E1H A;  3REX A;  2DTH A;  1NJI C;  3DKM A;  2ODR C;  4QVC A;  1SES A;  3HKS A;  3A7A A;  1UGQ B;  2K4Y A;  4PNO A;  3NEL A;  3RKW A;  1W4S A;  4M77 C;  4L87 A;  2XGT A;  3WQZ A;  5CVI A;  1UGS B;  1BI1 A;  1M4Z A;  1E1O A;  4M75 F;  4LVL A;  4YRQ A;  1WLE A;  2CZ7 B;  3UT1 A;  4EDU A;  4FT4 A;  2QEX A;  4BI4 A;  4M7A E;  3NET A;  2XI9 A;  4ZN1 A;  3SFM A;  4KQE A;  1ASZ A;  2LQ8 A;  1Q86 U;  3CCU A;  4M77 B;  5LJ5 g;  3M58 A;  5KE3 A;  1EIY A;  4YRG A;  5GAO p;  2JZ2 A;  3RF1 A;  1VIF A;  5A0D A;  3OYK A;  4CH6 A;  4LDX A;  2EWN A;  4JUV A;  2DJZ A;  1QVF S;  1YI2 T;  1HTT A;  1VUB A;  4XAX B;  3JCM W;  2DD4 A;  1YFS A;  2A8E A;  1K73 U;  1O9S A;  2LVM A;  3C94 A;  4DQ2 A;  2PMF A;  1PSE A;  2MAM A;  1DJ7 B;  1YFR A;  4R55 A;  2O01 E;  3DSQ A;  3E9F A;  2ZNJ A;  5GAO m;  2Q5H A;  2XIC A;  3UDC A;  1OZ3 A;  4P74 C;  5CKD A;  1K8A C;  5DLO A;  5J26 A;  4A54 A;  5LJ3 d;  2VC8 A;  2DEQ A;  5FU6 B;  3SWN C;  3JCM P;  4N4G A;  4GLK A;  4RDX A;  5DLQ E;  4E7I A;  3BFM A;  3DLM A;  5CQX A;  4QQ6 A;  1V29 B;  4H2U A;  2ALY A;  3FRN A;  1BI2 A;  1Q7Y U;  4XK8 E;  4TVW A;  1G3S A;  1H3Z A;  4KR3 A;  3A32 A;  3G4S A;  3GPL A;  11AS A;  3VQX A;  2FL7 A;  1QF6 A;  3OSS C;  2VXF A;  1VIE A;  4XEM A;  4CRI A;  1YGB A;  3HFZ B;  2ZPE B;  2DAQ A;  4C8Q D;  2DIG A;  1L0W A;  1B8A A;  3L1A A;  4ZN3 A;  3S3N A;  4J15 A;  1JJ2 S;  2C06 A;  5KCO A;  3HTZ A;  1H4S A;  3M4Q A;  1N9W A;  2FHD A;  4HCB A;  1N9R A;  4OGC A;  4TQF A;  4FT2 A;  3M54 A;  1KG1 A;  2EYQ A;  2M1H A;  3FEO A;  3CCJ T;  3S3O A;  1VQM A;  4IUP A;  3QO3 A;  3NEM A;  4YRT A;  2EJ9 A;  4P74 A;  3CC4 A;  1JJC A;  3A7U A;  3OMC A;  1JJC B;  1Y96 A;  2L89 A;  2MWP A;  1M1K C;  1JB0 E;  1B70 B;  2PVO B;  3LSQ A;  3OYM A;  5GMK m;  3CCM A;  2X4W A;  4JS5 A;  4A4K A;  3MF1 A;  1VQZ A;  3GNG A;  4F7U E;  4M78 E;  4M77 D;  2RI2 A;  3VQY A;  3M9Q A;  1VQL T;  3SB2 A;  4YCU A;  2ARU A;  1G5I A;  1VQ5 T;  2J3M A;  4M7A B;  4H02 A;  3EFR A;  3ZFJ A;  5GAN g;  4OLF A;  3G7Z A;  5GAN 4;  1YJN T;  3CCS T;  2WSE E;  1VQ7 T;  2ARS A;  3JRZ A;  4PJO D;  4BAC A;  3SWN A;  5FU6 C;  4XQ3 A;  3CCV T;  3OBY A;  3MEW A;  4KT0 E;  5GAN 6;  2LT4 A;  3OSV A;  2E70 A;  4XTY A;  3GIB A;  1SSF A;  2VYT A;  2RD1 A;  3CCL T;  2OAU A;  1M1K U;  5J39 A;  2P5I A;  3HRS A;  2QTX A;  4LDU A;  4JLI A;  3MEA A;  2ZZD A;  4YTL A;  3M5A A;  2P0P A;  4XTU A;  2AKW A;  1YB3 A;  3HRK A;  3PCO A;  3CC7 T;  1Q82 U;  3IKL A;  5D6Y A;  1EVL A;  2F5T X;  4EMK A;  2A3L A;  4C92 C;  2XKO C;  3RMS A;  3M57 A;  5GAN 8;  1RIQ A;  1ATI A;  3CMQ A;  3OW2 A;  1YFT A;  2RHS A;  5CIU A;  1OI1 A;  1YIJ A;  2Y4Y A;  3A31 A;  3CC4 T;  3OS1 A;  3CC7 A;  3RGL A;  1M90 U;  3UH0 A;  2I4L A;  4YP0 A;  3V8J A;  4YYE A;  3QXE B;  2NLU A;  1G5H A;  1VQ8 A;  5GAM h;  2RJD A;  2YHT A;  1VQ4 A;  4C92 G;  3L4G A;  3W3S A;  3CCQ T;  2OTJ A;  1Q7Y C;  2K57 A;  3P8Y A;  2FB7 A;  4UPA A;  2K5F A;  1BYM A;  3QO8 A;  4LDW A;  4EMK C;  1GXI E;  4M7A G;  2ZIN A;  2ZR2 A;  3CCL A;  2DZ9 A;  4UP9 A;  3CCV A;  2OTL T;  5L8R E;  4BE2 A;  3PZC A;  3OYN A;  4YRJ A;  3JCM d;  1YJN A;  2QHV A;  3MQZ A;  1NJ6 A;  3TUP A;  2EQU A;  5LJ5 d;  4CS4 A;  4E7J A;  2L8D A;  1VQ5 A;  4X34 A;  2ZNI A;  4XTZ A;  2WAC A;  4LD9 K;  4MDW A;  1NYQ A;  2X35 A;  4C0G A;  3RKY A;  3J7A F;  3BW1 A;  1K73 C;  4M77 E;  4HT4 A;  3V8L A;  3P8H A;  3C95 A;  3NFC A;  2X4Y A;  4C8Q E;  4KUL A;  4YCV A;  4KR2 A;  5GAO r;  4IUR A;  2LCL A;  3HXV A;  1QVG A;  1YIT T;  1Y71 A;  3QJ6 A;  4Y28 E;  1M1G A;  3VU3 C;  5ELO A;  3E19 A;  1NE8 A;  1Y96 B;  1WQ7 A;  4FIB A;  4H2Y A;  3CEY A;  3LH0 A;  4C5I A;  4D6W A;  1E1T A;  1VQM T;  3UPU A;  3M4Y A;  4JS4 A;  2K5I A;  1NYR A;  5E3I A;  1VQ6 A;  4YRF A;  4XEO A;  1NPR A;  5GMK h;  4G85 A;  3A8O B;  5GAO q;  4HCZ A;  3TEH B;  3JCM X;  2Y90 A;  3CXC S;  3CMA A;  4M77 G;  4OB2 B;  3EFS A;  3CCR T;  1OYX A;  4RCB A;  3VQW A;  3HXZ A;  1B76 A;  1UB4 A;  5CKB A;  3FIF A;  1D3B A;  2JTM A;  4VUB A;  1D3B B;  3OW2 S;  3HXX A;  3CCU T;  3L2V A;  2EL9 A;  2OTJ T;  4NS5 A;  1XNI A;  2VUB A;  2NS6 A;  3G71 T;  2XDP A;  2ZCE A;  1XQH A;  3JCM c;  4PJO A;  4IUQ A;  3JB9 I;  1B7Y B;  3I56 T;  4A53 A;  2DZC A;  4M7D F;  2ZT5 A;  4MML A;  1Q81 C;  5GMK i;  4BWA A;  2ZZE A;  4ZIB A;  2KVQ G;  4JDS A;  4PLL A;  2RI3 A;  3E9G A;  3OYI A;  4P3N A;  4XU0 A;  3P8T A;  4XTV A;  5LJ3 g;  2QQS A;  4ZTJ A;  3QUI A;  3JB9 H;  1QP3 A;  4K86 A;  2I4M A;  4C5H A;  1R8O B;  4LVM A;  5I2M A;  2ALY B;  4M78 F;  2ZTG A;  5LL6 S;  2CJ9 A;  1M90 C;  2RHQ A;  3SDZ A;  3MCA B;  3JCM Q;  1NPP A;  3RKX A;  3CBO A;  4C0D C;  4OP0 A;  3GP8 A;  3E9H A;  1I5L A;  3LSS A;  2I2L A;  3JCM V;  4NL2 A;  4BDZ A;  2KAF A;  3Q1J A;  4ZGD B;  4OB1 B;  2V8K A;  4QQD A;  2R5A A;  2MWO A;  3HFO A;  1I8F A;  2LNV A;  3HXW A;  3HRU A;  3QYG B;  1N27 A;  4OB0 B;  1X55 A;  4LVI A;  3HSB A;  3KFU A;  1NJ5 A;  1WGS A;  4F7U B;  2ZIM A;  3A8M B;  1KQ2 A;  2XHC A;  4TVA A;  3CCS A;  4HCC A;  5HK0 A;  4M7D E;  4BI3 A;  1G51 A;  3MEV A;  1X75 C;  2RO0 A;  3JAM E;  1NJ8 A;  2WSF E;  4DOV A;  3OYY A;  4R56 A;  3KXT A;  1QE0 A;  3FB9 A;  1UGR B;  5I2S A;  2PUO B;  4UP7 A;  4MZP A;  1WYD A;  2X4X A;  2QHT A;  2J3L A;  3OYA A;  4IUV A;  1WNL A;  1KQS A;  3LC0 A;  4YRC A;  1QW1 A;  1B34 A;  2EQJ A;  1Z7N A;  2ZZG A;  3HP9 A;  3GNF B;  3TEG A;  2V8J A;  4KUD K;  1HXD A;  3C12 A;  2CZ6 B;  4PJO G;  3SD4 A;  4B9W A;  4C8Q G;  3QJY A;  3A5Z B;  4YRN A;  4BY6 B;  1WPY A;  1JBM A;  2IG0 A;  2GF7 A;  2PVG B;  5FU7 C;  3QII A;  1U1S A;  1YI2 A;  4ZTZ B;  3I56 A;  4LNS A;  2MF2 A;  2QA4 T;  2XD0 A;  3X20 B;  4JRP A;  3PCO B;  1YJ9 A;  4C92 F;  1M8V A;  3HXU A;  2K2V A;  3L4G B;  4C92 E;  4HWR A;  3UWN A;  1WJR A;  3BDU A;  3JCM e;  4P3P A;  1M5Q 1;  3MP6 A;  5J3B A;  3OYB A;  2AMC A;  5C52 B;  3IAL A;  4O2D A;  3PNW C;  4OB3 B;  1K8A U;  4NOY A;  3CME A;  2DVE A;  1ZHI A;  2I4N A;  3INZ A;  4KUI A;  1AHJ B;  2YRV A;  3L2W A;  4HA8 A;  4EMK B;  3S6W A;  3CC2 T;  1XTD A;  1FX7 A;  4YRO A;  4C5E A;  4HT8 A;  3A5Z A;  2QQ9 A;  4XU3 A;  1E24 A;  2P0L A;  5D6W A;  1GGM A;  2ZCF B;  3LWH A;  4GY5 A;  1YIT A;  3UFG A;  2LX9 A;  3MF2 A;  1ADY A;  2KK4 A;  2Q7H A;  4XU1 A;  4MZT A;  2ZIO A;  3RER A;  4FSX A;  3KBG A;  4M7A D;  2O4X A;  3MP8 A;  5CKF A;  2YLC A;  1PSF A;  3FJP A;  4OF1 A;  4A4G A;  1I81 A;  3OYL A;  5C51 B;  2JTF A;  2BIV A;  4YRI A;  1IL2 A;  2IY5 B;  3V7C A;  3NTI A;  1SRY A;  4L5G A;  3X25 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...