2DTOA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 complexed with atp and biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] lig
total genus 67
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dtoA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dtoA01
5I21A 2AKWA 2EAYA 4H2YA 4PG3A 1HXDA 3A32A 1EVLA 11ASA 1BBUA 1Y96B 2QHSA 3UGTA 4ZTUB 1E24A 2Y90A 4C92B 1USYA 2DXTA 2XTIA 3HXXA 4V2SA 1KMNA 3EFRA 4NL2A 3FIFA 2VC8A 1SRYA 4KQEA 3BW1A 3A7UA 2YHTA 2QHTA 1KMMA 3UGQA 2IY5A 4M75G 3V8LA 3QO8A 4KR2A 5GAMg 1N9RA 2ARUA 2XGTA 3EFSA 5F5WA 4E51A 1B7YB 5LJ5g 3TEHA 4F7UG 3HFNA 2E1HA 4O2DA 5GMKl 3JB9J 1EVKA 4C8QG 3HXUA 4XU1A 4UP8A 1USYC 3HFOA 3JCMg 1KQ2A 3REXA 4H2TA 12ASA 1H4VB 3DSQA 1YFRA 5GAOl 2ZTGA 4K86A 2DTOA 1I81A 2E64A 2CJBA 3JCMX 3P8TA 4M78F 4M7AB 1WQWA 1WYDA 3A74A 5GAOr 4TVWA 2ZZFA 3OD1A 4M77B 3E9IA 4XU2A 1JRIA 3HXVA 4TWAA 1NJ1A 2Q7HA 2FYKA 3RKWA 4TTVA 3JCMJ 2EWNA 4HWPA 3TEHB 4YRGA 4YRNA 2HNIA 2ZZGA 3TUPA 2DZ9A 4EMKB 4TQFA 4XU0A 4ZTZB 2EJGA 4M77E 5GANd 4RDXA 4JLIA 2CJ9A 2ZIMA 3HFVA 4EO4A 3LC0A 2ALYB 5KNNA 4M78E 3HXYA 4P3NA 3LSSA 2ZNJA 4H02A 4YCUA 1Z7MA 1E1OA 3P8YA 4G84A 3V8KA 4WI1A 1NNHA 1JJCA 2C8MA 4P74A 4C8QC 4RQFA 4M75C 1EQRA 4RCCA 4M77F 4NCXA 3JCMV 3JB9H 4CH6A 3HY1A 4DQ2A 1BBWA 1YFSA 4J6WA 1JJCB 3JCMe 3HRIA 2AMCB 2PMEA 1X54A 3V8JA 1NJ8A 2ZR2A 4BWAA 4RMFA 4C92E 1LJOA 2DZCA 4M7DF 2E5AA 1H641 4CS2A 1PYSA 4C8QF 5E3IA 2DDZA 2DQ0A 3ERRA 4J15A 2ALYA 1LNXA 2DTIA 3NENA 4N0AC 4P72A 4YRIA 5GAOq 4M7DC 4C92D 4P75A 4YCVA 1B70B 1HTTA 3UFGA 4PJOD 3I7FA 5GANh 1WNLA 3HXZA 4M77A 4PHCA 5GAN8 4H2VA 4YROA 4QVDA 4YRQA 5K1PA 3QUIA 5GMKi 4J6XA 1LOJA 5GMKm 4UP7A 1G51A 1QE0A 3AHUA 4MMKA 1FYFA 4M7AA 2YLCA 4NL3A 4YREA 3MF1A 1HK9A 5LJ3g 3PCOB 2K57A 4PNOA 2ZT8A 4EMHA 4BW9A 2DEQA 4HA8A 5GMKe 4J6YA 4YRKA 3BY7A 1H4TA 1YGBA 4M7DD 3PZCA 3RGLA 2RB6A 1NJ2A 3V7RA 4M7AG 4CH3A 4HWRA 4M78B 4M7AF 1B7YA 4M75D 1D3BB 4X9CA 4P71A 4K87A 5GANg 4TQDA 2ODRD 2IY5B 2I4OA 2E41A 1QF6A 2ZT5A 1KQ1A 1N9WA 4L87A 4P73A 4WF2A 3PGGA 3SWNA 4PJOA 4OLFA 3RESA 3HSBA 1D3BA 3IKLA 5C53B 5C52B 1NYQA 1WU7A 1Y96A 5ELOA 4A53A 1B76A 1SESA 1X55A 5CAIA 2QHUA 3MF2A 5LJ5f 2DJZA 2G4CA 3NELA 3L2ZA 3PCOA 3BDUA 3RKYA 1NJ6A 4C8QB 3BJUA 2ZT6A 1WLEA 3GIBA 5GAN4 1EIYA 1E22A 2Q7EA 4DPGA 4PJOE 1BIBA 3JCMd 4YRTA 4EMKC 4WJ4A 1B8AA 1ATIA 3V7CA 3WQZA 2CIMA 2CGHA 5LJ5h 3RACA 3RUXA 3JB9I 4XTVA 3A5YA 5LJ3h 2I4NA 4M78C 4YRRA 4C92C 2ARSA 5GMKh 3HFZA 1B34A 3VQVA 1ASZA 2QHVA 2PMFA 3RF1A 4M78D 1I4K1 2FB7A 1G5IA 2JN0A 3M4QA 4TVYA 3VU3C 3A31A 5GAN2 2DVEA 5GMKj 3QO7A 4KR3A 4YRMA 5GAOp 3QHSA 3INZA 3HRKA 3QTCA 3JCMW 3HXWA 1YB3A 4YP0A 3HFZB 4Q6GA 2RHSA 3RERA 4F7UB 4XEOA 1YFTA 2J3LA 1SETA 1MGQA 4XQ3A 3L1AA 3M4GA 5GAOm 1SERA 4M75B 1PYSB 4HWTA 1WPYA 4M75E 4JRKA 3JCMQ 3RIRA 4YRLA 1M8VA 1KOGA 3JCMP 4C8QD 4XTZA 4H2SA 4AH6A 2ZCEA 2AMCA 1NYRA 1YCYA 1RIQA 4K88A 4EMGA 5DY9A 4P3PA 4M7AE 4Q15A 4QVCA 4YRPA 1ADYA 2Q7GA 3SB2A 3TEGA 5GAN5 1E1TA 3JCMh 4HWOA 3A5ZA 4LNSA 3A7AA 5C51B 4F7UA 4XTYA 5LJ5e 1X01A 3VQWA 1X2HA 4EX5A 2QTXA 3IALA 1X56A 2RA2A 2YLBA 4C92A 4M78A 1GGMA 4YRJA 2DXUA 4P3OA 4CH5A 3A7RA 3JB9D 3KFUA 3VQYA 2ZNIA 4EMKA 4M7DG 2ZZEA 3REUA 4M7DB 1Z7NA 2DTHA 3JCMf 3IKMB 1M5Q1 2I4MA 2RHQA 1H4QA 4PJOF 4M77G 4H2XB 2DQ3A 4YYEA 3JB9F 4C92F 1I8FA 5GAN6 3ICAA 3FJPA 5GAMf 2ARTA 2EJFA 4NOYA 5LJ5d 2DU7A 4JRIA 5GAN3 4J5YA 5ELNA 4TVAB 2Q5IA 5LJ3d 2ZXFA 4YRCA 3NETA 3HTZA 4CS3A 3SWNC 4PJOC 1H4SA 4P73C 1U1SA 4C92G 2I4LA 3JB9G 5HGQA 1J5WA 5LJ3j 4PJOG 5K1XA 3CMQA 3SWNB 4PJOB 1X2GA 2RD1A 4YDQA 1BIAA 4P71C 4M77C 2P5IA 4X5OA 3UH0A 4YPFA 1N9SA 4ZIBA 3G1ZA 1JBMA 3R07A 4P75C 4XTUA 4RQEA 2I2LA 3V7SA 4N0AA 2ZR3A 1G5HA 5GAN7 1U1TA 2E3CA 3BFMA 3P8VA 4UP9A 5GAMh 1ASYA 4F7UE 2ODRC 1IL2A 4G85A 2AKWB 1C0AA 3VQXA 3FB9A 2E65A 4M7AC 4HVCA 4X9DA 2DU5A 4M78G 2RM4A 2C7IA 4CH4A 2J3MA 2CJAA 4MMLA 2E10A 4JUVA 2VXFA 4H2WA 3RKXA 3JCMb 3M4PA 3QSUA 4H2XA 3W3SA 2P0LA 4CS4A 2ZIOA 4M75A 1TH7A 3VBBA 4F7UF 4Y91A 2ZINA 4M77D 4P74C 2ZGWA 4XU3A 3L4GB 4OP0A 4M75F 2RHSB 4M7DA 1WQ7A 2Q5HA 4P72C 2ZT7A 4YRFA 4HWSA 4WJ3M 5LJ3e 3QNEA 1B70A 1ADJA 5GAOn 1EFWA 5GANf 5GAMe 3NEMA 4RCBA 3L4GA 4YCWA 1W66A 4XEMA 3LSQA 1L0WA 1NJ5A 1B34B 4TVAA 4UPAA 4C8QE 3QO5A 5LJ5j 4HT8A 5LJ3f 5GANe 5GANj 1I5LA 1HC7A 4H2UA 1EIYB 4M7DE 3IG2A 4XTXA 5GAMd 3MEYA 3QO3A 4XTWA 2EL9A 4HT9A 2VXEA 4M7AD 4YRSA 1VQZA 2DKGA 3RL6A 2EJ9A 4A54A 2RHQB 3JCMc 3E9HA 1LYLA 3HY0A 4C8QA 1EOVA 5GAMj
chains in the Genus database with same CATH superfamily
4D8KA 3JAME 1D1CA 1UE9A 1NJIR 3S6WA 2O9VA 2RNAA 3VJPA 2GFAA 1Y96B 2QHSA 3THKA 1H3ZA 2EKOA 2F69A 2CT4A 3M53A 2NUPB 3VRYA 4CC3A 3CXCP 3HXXA 1KMNA 1NYFA 4RMOA 2E3HA 3FIFA 3CC4T 2O2OA 2VC8A 2K9GA 2XG8D 3CCJQ 1M1KU 1SRYA 4PFPA 3A7UA 2YHTA 2RQUA 2KR3A 2QHTA 3WXMB 3UGQA 4M75G 4KR2A 4OMQA 1WX6A 5GAMg 3X26B 3QPHA 3I55T 5F5WA 3O8VA 2EW3A 1ABQA 3HFNA 1QW1A 3JB9J 2YDLA 2L5QA 2XK0A 2DAQA 3SFMA 3HFOA 1B07A 2W10A 4PJMA 1KQ2A 4VUBA 1YITQ 3REXA 4H2TA 12ASA 1V76A 2RH2A 3ME9A 1YFRA 1JQQA 5GAOl 2RJCA 2E64A 1WFWA 4JS4A 3HTRA 5EC7A 2EQJA 2K3XA 4AMCA 1RAIB 2CKKA 3A8HB 1UJYA 3A74A 1M1FA 4J83A 4JJDA 3OYNA 1VQ9Q 4M77B 5A0LA 1ZSZB 1JRIA 4TTVA 1YJWT 1N6AA 2LJ1A 3H41A 3JCMJ 1PD1A 3LH5A 3TEHB 2HNIA 2DZ9A 4EMKB 3ULRB 4KGZB 4XU0A 4ZTZB 1ZUYA 2LQKA 4JJCA 2ZIMA 4AFQC 3LC0A 5KNNA 5I2MA 2ZNJA 3P8YA 2GNCA 2NYSA 1W1FA 2J6OA 1G3TA 2WSEE 3M5AA 4C8QC 4M75C 1NPRA 4BB7A 4FYXB 4MZMA 3G7ZA 4NCXA 2DYBA 3JB9H 1K4US 1WXBA 8ATCB 1BBWA 4J6WA 1JJCB 3L2VA 1N27A 3H6ZA 2ZR2A 4LVKA 4BWAA 2CYZB 1MNEA 5CVIA 2E5AA 2DX1A 4JPBW 3TSWA 1PYSA 4C8QF 2MI6A 3I5SA 1K9AA 4J9GA 4A4KA 2DTIA 4RG2A 5GAOq 4M7DC 5CQXA 4GLKA 4KGVB 2LCLA 2CUBA 4ANJA 3FJ5A 4XAXB 3EH2A 1O9SA 3UFGA 1K8AC 3E9GA 3I7FA 4H2VA 3DB3A 3QIIA 3WVDB 3SHWA 3QUIA 3G1JA 5GMKm 3HHTB 2ESWA 5FU7B 5CKHA 2JTFA 1MMNA 1PM3A 2A7YA 1FYFA 2RO0A 1XOVA 1BCOA 3CPWS 1QMCA 5LJ3g 3PCOB 4FW2A 5GMKe 1JXOA 4J6YA 5KYYB 4YRKA 3BY7A 1H4TA 2YUQA 1MV0B 1NG2A 2O88A 3PZCA 4KRTA 2XHCA 2QEXT 4F17A 2QEXA 1NJIC 4HWRA 2DRKA 4M7AF 2QXFA 1T3LA 2XDPA 2ZPEB 2JMAA 1PNJA 3G4ST 1PCXA 3M4YA 3OYIA 3M0PA 3VS6A 2JJ9A 4XK8E 1QKXA 2I4OA 2E41A 3P8HA 4OMOA 4WF2A 3SWNA 3OYYA 1K0SA 1TSFA 4C0FA 1MMGA 5C53B 2M0OA 1Y96A 2E4HA 3QKJA 1X55A 3GLXA 5CKBA 1KG1A 3OS2A 1Q7YR 1NM7A 4C0GA 3BDUA 3RKYA 3EGUA 4OB2B 2FO0A 2ZT6A 5GAN4 1E22A 3QDFA 3OYBA 5EG2A 2RK1A 4PJOE 3MEUA 3CCQT 3CCRQ 4EMKC 1B8AA 1ATIA 3V7CA 2CIMA 3AT1B 3EHQA 1YIJQ 4KH0B 1PRLC 1ZA2B 5LJ3h 4C92C 2IIMA 1PSEA 1B34A 1GCQC 4OMMA 3CCVT 3RF1A 5A0GA 4E7HA 2X4YA 3M4QA 1VQNQ 4LVJA 5GAN2 1WIEA 1WJSA 2VYTA 2MIOA 1YB3A 2KK4A 3HFZB 4Q6GA 2HKQB 1VQLA 3QJ6A 2GCXA 3I56T 4YRLA 4JS5A 1VQPQ 2L0AA 1SEMA 5HY6A 1Q86R 2NWMA 1BCMA 3OBWA 4OMPA 1T0JA 1QVGA 4WTOB 4K88A 1GL5A 1G3WA 2DL3A 4YRPA 3L2RA 2FEIA 2ZPIB 2Q7GA 3SB2A 2M02A 2D1XA 4E7LA 1E1TA 3CBPA 3JCMh 2DL7A 4R55A 2KVQG 2DXCA 3H0FA 5LJ5e 3LGLA 1IREB 2BE9B 2QTXA 5GJVB 3CCSQ 4BACA 1HSQA 2Y4XA 1GGMA 4M78A 4MDXA 2HQEA 1AVZC 5D6XA 3KFUA 3M0RA 2ZNIA 2DK3A 4M7DB 1KD1U 1FMWA 4C5EA 4F04B 2LRQA 1UHFA 4M77G 4H2XB 4LVLA 4YYEA 4AG1C 3S3OA 3ICAA 2OTLT 4OF1A 1VIFA 1WLPB 2MWOA 2DU7A 2IVWA 2ATCB 4CI0C 4RTUA 2Q5IA 2L2PA 1W2BA 3HPWA 2L3SA 2CZ1B 1H4SA 2D8JA 2RPNA 4LUEA 4P73C 3O5ZA 4C92G 1NLOC 4ME7A 1WDXA 3A1PA 3KFVA 5I2SA 3MEWA 2X4XA 2LQWA 5IHNA 3SWNB 3NMZC 1X2GA 1VQ6A 3PVQA 3VS7A 1BIAA 4Z89A 3CD6Q 3CPWA 3U23A 3FDRA 1U5SA 2ZCFB 2LT1A 1D0YA 4QQ6A 3CCUQ 1QWEA 1K76A 5GAN7 3CCMT 4Y28E 2EQMA 3BFMA 2E3CA 5GAMh 1E6HA 2ODRC 4HT4A 3GF5A 2EKHA 4HVCA 3UA7A 2QQSA 2RM4A 2FZCB 4PFOA 3CPFA 1TXQA 1UG1A 2JTMA 2E10A 3JCMb 3NPFA 3W3SA 2P0LA 1Y7XA 4CS4A 5A0DA 4M75A 2JM8A 1IGQA 4Y91A 2I0NA 1RAAB 1S72A 1RAHB 3OYCA 2O9SA 1S72T 2HAXA 1WGSA 4M75F 1M2OA 1PG5B 4CC4B 1WQ7A 2Q5HA 1IB8A 2ZT7A 2F1LA 1B70A 3E2UA 2FPFA 9ATCB 2MAMA 2MF2A 1Q95G 2DD4A 4YCWA 3OSSC 2GF7A 3MJXA 4DEXA 1HD3A 2CH4A 1JXMA 3CMAA 4E7IA 1SRLA 4C8QE 4OVAA 4UPAA 5GJWB 1YHQA 5LJ3f 1HC7A 5GANj 4H2UA 4E7JA 4LUDA 1OZ2A 4HVVA 2P0KA 4BI8B 2IPOB 2EL9A 2VXEA 4AG2C 1VQZA 1WJRA 2C0OA 1TS9A 1C0MA 3OMGA 1VQPA 5I21A 2EAYA 2X4JA 2X4WA 4L6V5 1Q86C 1I5OB 1BBUA 2RHUA 1E7OA 2LT4A 2SEMA 3D7SB 2A3LA 4JZ3A 5I11A 2K5IA 2GFUA 4DBRA 3LW5E 3EFRA 4NL2A 4IURA 2L3PA 4FT2A 2K5LA 2XDBA 4KQEA 1M4ZA 2JTEA 1UECA 3BW1A 3MP8A 3URGA 1BI0A 4ZN3A 1KMMA 3E1SA 1SRMA 4IUVA 4TVRA 2MWPA 3V8LA 1N9RA 3CCSA 3EFSA 1VQKQ 1WZOA 1K9MC 5J39A 3TEHA 4O2DA 2QASA 1EVKA 4C8QG 3GOXA 3DKMA 3JSCA 3OYEA 4AFUC 1QP2A 4UP8A 1OULA 1BYMA 2K5FA 2CDTA 5KE2A 1H4VB 3CCEQ 2VV5A 1K9MU 1YJWA 1ZX6A 2DILA 4M78F 1QQJA 1WQWA 1YCSB 1GBRA 1WYDA 1VOMA 2GQVA 1PKSA 1BI3A 1PD0A 4ELZC 3G71Q 4TVWA 1OYXA 2ZZFA 3OD1A 1FWZA 3H9NA 1YNZA 3E9IA 4XU2A 1PHTA 3CCMQ 1NJ1A 2Q7HA 5CCAA 2M51A 1UB4A 1SKUB 4HWPA 4YRGA 1AWJA 1UTIA 2F2WA 2LP5A 1ZSZC 3JRZA 4TQFA 3M54A 2E5KA 1Q82C 4M77E 3MCAB 5IXFA 1M90R 2V26A 4C5HA 2CJ9A 2JM9A 3HFVA 1Z9ZA 4M78E 2A0FB 3HP9A 1EX4A 2M9UA 3OS1A 3PIOA 4WI1A 4P74A 1KC8C 2GGRA 2HD0A 3NFCA 1RLQC 2AKKA 4RQFA 1QKWA 1EQRA 1J3TA 4RCCA 4M77F 3LYIA 3L42A 4CH6A 1TUDA 1YFSA 2BZXA 3P8BB 2ENMA 2AMCB 2HDAA 2PQWA 1X54A 2PMEA 1NJ8A 2LQ8A 1YITA 3QBYA 4J8OA 2YRVA 4CS2A 1TOVA 1YJNQ 4DBFA 2DQ0A 3RBBB 1VQMA 1VQKT 2G3RA 4J15A 2ALYA 1AWOA 1YN8A 3NENA 4P72A 4YRIA 4C92D 4P75A 3CCST 2CH4W 1KSWA 5FROA 4MDWA 4LD9K 1HTTA 4J7FA 2CUDA 1P92A 5GANh 2P0PA 5HCKA 1AEYA 4PHCA 4J9IA 2KBTA 4QVDA 4FU6A 3CMAQ 5GMKi 2X9HA 2K6DA 4E7SA 4JRQA 1TTHB 4IIMA 3AHUA 3GNFB 2LVMA 5HK0A 4M7AA 2KY9A 1PWTA 2YLCA 1VQPT 3MF1A 4HA8A 3REAB 5FLXE 4RTWA 4M7DD 3OB9A 4E6RA 1AT1B 2E6ZA 4CRIA 1QWFA 3C12A 3V7RA 4M7AG 2O4XA 5KE3A 2ZAEA 4OB0B 1YI2Q 4CH3A 2DMOA 2LCCA 1D3BB 3X25B 4E7KA 2DL5A 1VQ7T 2DRMA 5GANg 5J26A 2IY5B 1VQNT 2C0IA 2PU9B 1GBQA 1QF6A 1N9WA 4L87A 1M1GA 4PJOA 3A5ZB 3CC2A 5FU6B 3FLGA 3HSBA 2KROA 3IKLA 1NYQA 3RNJA 3OSVA 5D6WA 5CQYA 2NS6A 2QHUA 3CCQQ 3NELA 1OX9A 2SRCA 3PCOA 2CSQA 2HQHA 1Q7YC 2KRSA 1NJ6A 3RMSA 3CMEA 3BJUA 1OPKA 1M9SA 2YSQA 4DPGA 1FMKA 2C06A 3EGXA 2CGHA 4CC7A 1QP3A 3JB9I 4XTVA 4YRRA 4GBQA 3CXCS 4J9HA 1ASZA 2QHVA 2PMFA 2JUFA 1I4K1 2RJEA 3C0CA 1G5IA 1X6BA 1YJ9Q 2DVEA 3QO7A 1UHCA 3G4SQ 2DO3A 2EBPA 2RHYA 3GP8A 5GAOp 3QHSA 1SHFA 3PE0A 1YJ9A 2XMFA 5M9OA 3EGDA 2GTOA 4YP0A 1YI2T 4Z02A 3EFOA 4F7UB 4IUPA 1YFTA 2COYA 2ZPFB 4Q5WA 3A98A 2NUTA 3M4GA 5IXBA 4HCCA 1UFFA 2PVGB 2EGCA 3R6NA 1WPYA 4M75E 4MZPA 1M1KC 1M8VA 3JCMP 4C8QD 3EG1A 1WHJA 2R58A 4Z8AA 5AYFA 1RIQA 2CREA 4EMGA 1LCKA 5DY9A 2XKOC 4Q15A 2YXYA 1ZBJA 5IT9E 2A8EA 1WXUA 1G3SA 1BK2A 2HEQA 3I5RA 4RKUE 1K73U 2LQNA 2CP7A 5FRMA 1EFNA 4L5GA 1X2HA 4EX5A 1YBYA 4Y92A 3PIPA 2HBWA 3IALA 2RA2A 3OQ5A 2HBPA 4P3OA 1ZSGA 3X20B 4HCKA 2P4TA 5I22A 4OMLA 5CK9A 5HK3A 1Z7NA 2KEAA 1NPPA 4PFZA 2CSIA 1Z9QA 3OA6A 5HKCA 4PJOF 3OYLA 1IHWA 1XNIA 2JZ2A 2QK0A 2O01E 3PVLA 3I55A 5GAMf 2DNUA 2EJFA 4NOYA 2YUNA 1LPLA 4J5YA 2L3QA 4TVAB 2ZXFA 1G3YA 2RI3A 5HGQA 2AZVA 1J5WA 1GFDA 2LX9A 4QQGA 2KDSA 4D8DA 5LJ3j 4PJOG 2G6FX 1Y57A 1VQ8A 1ZBXA 1NE8A 1RACB 3TREA 4P71C 2KMTA 4LD6A 5FW9A 1TU0B 4X5OA 1YJ9T 3I9QA 3MKDA 3G1ZA 1GRIA 3R07A 4XTUA 3DLLA 4RQEA 2ZR3A 2KSSA 4BE1A 4C0DB 1ASYA 4A4EA 1H92A 2R5AA 5KH6A 1X43A 3CCRT 2E65A 3QG1A 4X9DA 2DU5A 3S3NA 5FU7C 2C7IA 4II1A 2EIFA 2M1HA 3PMIA 1Q82R 2J3MA 1FYNA 5AT1B 1UUEA 4FM4B 2F2VA 3CCET 2O31A 2BKDN 3M4PA 1KHIA 5DLOA 3QSUA 4O6JA 2RMOA 4C5GA 2VGNA 2OAWA 3VBBA 5L23A 4LDYA 2DLPA 4M77D 4RTTA 3EH1A 2V8KA 4XU3A 2JNGA 1KIKA 2ROTA 4WJ3M 3QNEA 3UDCA 5GAOn 1UGPB 1QCNA 2HKNA 5CIUA 1UGSB 5GANf 2BE7D 1VQ7Q 2FHDA 3OYFA 3L4GA 4IIOA 3CD6A 1RI0A 3G4SA 4GY5A 2CP0A 2XIDA 1NJ5A 1L0WA 4OMFB 1VQ7A 2QEXQ 4RTVA 3ASKA 2ZPHB 3QO5A 4HT8A 4B9XA 5GANe 2P4RA 3VS2A 3IG2A 5GAMd 2B86A 4XTWA 1B3QA 4HT9A 4YRSA 4ELYC 4EDUA 2K3YA 3M0QA 1Y07A 3VS1A 3OW2S 2JVVA 4A54A 1R0CB 2RHQB 1LYLA 4N4IA 2L3RA 4JDSA 2AKWA 1HXDA 2RQVA 3S3MA 3A32A 1EVLA 3CMAT 2KGTA 3WVEB 3UGTA 2ROLA 2Y90A 2B8AA 4C92B 1E24A 1USYA 2XTIA 3REBB 4V2SA 2K2MA 4LDVA 4LXCA 1QVGS 4KBMB 1XQHA 1JU5C 2K4YA 1GFCA 1YIJA 2ARUA 3BE3A 4E51A 1S72Q 1B7YB 5LJ5g 2NLUA 1K9MR 1YJNT 1EZZB 2E1HA 1KQSP 5GMKl 1T0HA 1GXIE 3HXUA 4XU1A 5CR2A 3J80E 2D0NA 3L2WA 2ZPBB 3DSQA 1D1BA 3LLRA 2K79A 2DTOA 2JS2A 1I81A 4M7AB 2CS7A 4KGXB 1ZUUA 1OI1A 2PNIA 2BTTA 3RDVA 5CO7A 2A28A 3VS3A 2LC4A 4DOVA 1G5VA 4TWAA 3E19A 2FYKA 3CBMA 2R5MA 2FPEA 3CCUT 4KT0E 3TUPA 3LH0A 4LE9A 2YWWA 5GANd 3A8OB 3CD6T 1IXDA 4A4FA 1W6XA 2BUDA 1CKBA 4J9CA 3ZEHA 4JZ4A 4QQDA 3EHRA 3UPUA 1KHCA 3VS0A 4EO4A 3M59A 2ALYB 1M8MA 2V8IA 2LMJA 3HXYA 2RI2A 2CP6A 2F5KA 4P3NA 3LSSA 3EG3A 4YCUA 1Z7MA 1NJIU 1E1OA 2J7IA 3V8KA 3ER0A 3KUFA 2J05A 1JJCA 2C8MA 2DVJA 2ED1A 3CCRA 2FPDA 2OTLA 1R8OB 3G71T 1XTDA 5FWBA 1EIFA 2GBQA 1K73R 2OTLQ 1RL2A 3HY1A 4C5IA 4DQ2A 1U8RA 2K7AA 2RK2A 4ZNXA 1RABB 3HRIA 1Y0MA 1YITT 1HJDA 3V8JA 2JXBA 2AT1B 1R0BG 3P8DA 4C92E 5IHIA 1LJOA 3MEAA 2DZCA 4LDXA 3I35A 1YP5A 4OGEA 4ZGJB 3OYHA 2GQIA 2QTVA 3X24B 2KT8A 2KT1A 2PUKB 4C0ZA 2IG0A 5LL6S 2QQRA 3LX7A 5KYWA 4J9BA 1NLPC 1LNXA 4N0AC 1RAGB 4BDYA 2EGAA 4YCVA 3OYGA 1M3BA 3QDRB 3MO8A 3PTAA 4PJOD 1G83A 4KULA 2EFIA 4M77A 7AT1B 4FT4A 3M55A 5GAN8 4YROA 1IGUA 1UGRB 1XJWB 2L89A 2YT6A 3PFSA 5FU6C 1TUCA 4J6XA 4DA4A 1LOJA 4E2FB 4UP7A 1Q86U 2F2XA 1G51A 3DB4A 4MMKA 4QW2A 4YREA 1HK9A 3I56Q 2HL5C 4RTZA 3L2QA 3LWHA 1VQOA 2MOXA 2EQIA 1OOTA 2XDDA 3J81E 1JEGA 2DXBA 4KH1B 4ZGDB 5D6YA 5J3BA 1M30A 1U3OA 2QYZA 1B7YA 1AZGB 4BI4A 4X9CA 4P71A 4K87A 4E7ZA 3G6EA 2DBMA 2LTOA 2ODRD 1VQ4Q 2HSEB 3G6EQ 2ZT5A 3CCVQ 1KQ1A 1YJNA 3VV0A 2HQXA 4BE0A 4OLFA 1QVGP 1D3BA 3HRSA 5C52B 1YIJT 1HYOA 4A53A 2FVUA 1N8RC 5CAIA 2DJZA 2QQBA 4PKCC 2FZKB 3T9NA 2RHZA 3IQLA 1M2VB 3GIBA 3A8MB 1EIYA 3H8ZA 4PLIA 4JJNK 2HZYA 5DLQE 1BIBA 3JCMd 1QVFP 4WJ4A 2OTJQ 2QGGA 3PT9A 4DBHA 2DL8A 3RUXA 2JS0A 2DEUA 2I4NA 2ECZA 5KCOA 5GMKh 2D6FA 4FCYA 1MMAA 4M78D 3TCJA 2FB7A 4TVYA 4PJNA 3A31A 4J7IA 4DOWA 5GMKj 1AWWA 4KR3A 1VQ5A 1YHQT 4RTYA 4C0DC 3QTCA 3HXWA 4RTXA 2K2VA 4PK4A 3RERA 3UA6A 1MGQA 3C94A 4XQ3A 5GAOm 5CKEA 1W2BP 4M75B 4JJBA 4X34A 2Y4YA 1PYSB 1M90U 1QVPA 4FW1A 4LDWA 4F14A 1M2VA 4JRKA 3JCMQ 3RIRA 4OGCA 4E47A 4L59A 3CCQA 4XTZA 4IUUA 1SG5A 2ZCEA 2AMCA 4FYYB 2W0ZA 1VQNA 3CPWP 4M7AE 2V1RA 4D6WA 1I0CA 4BY6B 1SPKA 1K1ZA 3HRTA 3TEGA 5GAN5 1BI2A 4FSXA 4UC4A 4P5NA 4LDUA 5C51B 1MV3A 4FSSA 1VQ5T 3QXEB 3EFOB 4F7UA 4BE2A 1X01A 3Q1JA 1MHNA 3JV3A 1MUZA 2K3BA 2RN8A 2YLBA 3CCLQ 5IHKA 4YRJA 2DXUA 3EG9B 4CH5A 3OMCA 2ED0A 3A7RA 3NTIA 3OYKA 3VQYA 4M7DG 1OX8A 3RMQA 2QA4A 1X2KA 2P0QA 1NEBA 3JCMf 1WA7A 1KC8U 1M5Q1 1SF9A 1GCPA 2I4MA 3L2UA 4YTLA 2FRYA 1H4QA 1M27C 5ECAA 1VQ6T 1M3CA 3JB9F 4C92F 1QCOA 1PSFA 3FJPA 3H0HA 2ARTA 5LJ5d 2CP3A 3X28B 1ABOA 4PJJA 5LJ3d 2JW4A 3I56A 3HTZA 4CS3A 4PJOC 1U06A 4M4ZA 1U1SA 3VYGA 3CEYA 5K1XA 2DM1A 3LGFA 2KYMA 4MZTA 1RAEB 2EYZA 1NEGA 5C6SA 4M77C 2P5IA 2NUZA 4ATOA 2RJDA 1M90C 3UH0A 4YPFA 2QQAA 4ZN1A 1D09B 2QI2A 4K11A 5FWCA 3E9FA 3V7SA 4N0AA 1G5HA 3CCVA 2D8HA 3P8VA 4UP9A 1VQOT 1KC8R 3G71A 1VQ9T 2AKWB 1YWOA 2QQ9A 1N5ZA 3ZBDA 3VQXA 3FB9A 4M7AC 5C0MA 1WHMA 3HL8A 4X1VA 3GNGA 5DM7R 4CH4A 1TG0A 2DJQA 4H2WA 1ZLMA 3RKXA 4RUGA 1SSFA 2AZSA 1FX7A 1VQLQ 2LZ6B 2ZIOA 3M9QA 5IN1A 3J7AF 2ZZDA 4LN2A 2M0YA 1X6OA 2ZGWA 3L4GB 1QCFA 2KAFA 3I55Q 3EG2A 1X6GA 2PUOB 1I07A 4YRFA 4P72C 3QWYA 5LJ3e 3MHXA 1ADJA 1RUWA 4PL6A 2MK5A 4QT7A 5GAMe 3OYDA 1TWBA 1I1JA 4RCBA 4IKFA 2EYYA 1W66A 4XEMA 2F5TX 3PNWC 1B34B 4OB3B 1R77A 1F1BB 3CC7T 1VQ8Q 3VUBA 2DPPB 4KUDK 1I5LA 4AFZC 5KCHA 2E6NA 4M7DE 1VQ9A 1YWPA 3QO3A 4M7AD 3M0TA 3M0SA 2X51A 4KUIA 2EJ9A 1OZ3A 3JCMc 3M56A 1WI7A 5GAMj 3CQTA 1EOVA 2RJFA 4H2YA 4PG3A 4PLLA 11ASA 3MQZA 1VQ8T 4ZTUB 5CKDA 2RF0A 1UGQB 2DXTA 3NGPA 4HVUA 1Q7YU 1SHGA 3F70A 3OS5A 4N4HA 2QDLA 2IY5A 4A63B 3OY9A 2ZPGB 4ZTJA 3QO8A 2XGTA 2LNHB 1VA7A 4QVZA 3CC2T 4F7UG 2KYBA 4JLGA 2EGEA 2KE9A 1M1KR 1WHKA 1C6VX 1USYC 3JCMg 1NYGA 1W4SA 3HRUA 4WCIA 2ZTGA 4K86A 1FXXA 2CJBA 1MMDA 2MYSA 4B6MA 3JCMX 1JJ2P 3P8TA 4ESRA 2DIGA 4N4GA 2D0QB 4DEYA 3EG0A 3H0IA 5GAOr 3UF4A 3OYAA 2JOYA 4BY6C 1A0NB 2YUOA 3HXVA 2AHJB 2E3IA 2X35A 1UJ0A 3RKWA 2RHXA 1N8RR 1KQSA 2EWNA 2MMPA 4YRNA 2ZZGA 3PMTA 3C95A 2J6KA 5KYWB 5FRNA 3ZL7C 2EJGA 1WYXA 2A36A 4RDXA 5KYUA 1W2BS 4JLIA 3CCEA 1RI9A 1KQSS 1YJWQ 5A2QE 2EQUA 4H02A 2DBKA 1Y71A 2DIQA 3FRNA 4G84A 1S1NA 2VB6A 1E6GA 1NNHA 1NBEB 2FZGB 2RQWA 3QZ9B 3VUZA 4IUQA 3KBGA 4F16A 2VWFA 1G8XA 2PZ1A 3JCMV 1QVFS 4R56A 1B7TA 3JCMe 3TU4K 5IAYA 2R57A 2L8DA 3EAEA 4RMFA 3SEMA 4BD3A 3BDLA 4M7DF 2FRWA 4HCBA 1H641 1QLYA 2OTJA 2FL7A 3FEOA 3M58A 1OV3A 2WSCE 4CC2A 1K0XA 3VYHB 5E3IA 2DDZA 3ERRA 1JJ2A 4RG8A 1UDLA 4HKEA 3OBYA 1D1AA 1JB0E 1RLPC 2FG0A 2KRNA 4B9WA 1B70B 3CC4Q 3CCJT 2DERA 3KXTA 1PKTA 1WNLA 3HXZA 3CC4A 3SDZA 2PVDB 1AWXA 1VYVA 2CP2A 2EPDA 3EGXB 3NTKA 4YRQA 5K1PA 1V1CA 2RQTA 3A8LB 1ZHIA 4EIKA 1NZ9A 1WHGA 2H3EB 1QE0A 1H8KA 2BIVA 1K8AU 3GBQA 3A8GB 1ZQ1A 4NL3A 1VQMQ 2EYQA 3N5BB 2K57A 4PNOA 3TEEA 3UT1A 2ZT8A 4EMHA 4BW9A 2DD5A 2DEQA 2COWA 1YGBA 2OI3A 2QAZA 3CC7Q 3RGLA 3OW2A 2RB6A 1NJ2A 1IRXA 2P84A 2LCSA 4M78B 3CC7A 4FIBA 4M75D 1SSHA 1YHQQ 1Q81R 2EYXA 5IH2A 4TQDA 1QVFA 1BU1A 4BUGA 4O5VA 2DFUA 4J9EA 3OYJA 2V8JA 2O4XB 2KI7A 4P73A 1WHLA 2X3XD 3PGGA 4ZTFA 3RESA 2EYWA 2NUPA 2MCNA 5D7UA 1BB9A 1WU7A 2RI5A 4R0KA 5ELOA 1B76A 1SESA 1WHHA 1VQLT 2QA4Q 3MF2A 5LJ5f 1ARKA 2G4CA 3L2ZA 2A08A 1G2BA 1DJ7B 2PVOB 2DETA 3NTHA 4C8QB 4NS5A 5KYNA 2KQWA 2LJ0A 1WLEA 2XICA 2Q7EA 3UWNA 2M16A 5CKFA 4A4GA 3FC3A 3QZ5B 3QJYA 2QA4T 4YRTA 2A37A 2NUTB 3WQZA 3M0UA 5LJ5h 3RACA 2E5QA 3C4SA 1VQOQ 1VQKA 3A5YA 4M78C 2ARSA 3HFZA 3EGDB 3VQVA 2V1QA 2AKLA 2VGMA 2MPXC 1OU8A 3NHNA 1VYUA 3G6ET 2JN0A 3VU3C 2LDMA 1X75C 1VQ4T 4YRMA 1V29B 3INZA 2XD0A 4JRPA 1YFNA 2YRCA 3JCMW 3HRKA 1OPLA 1X27A 5KYXB 3CMET 3OW2P 2RHSA 2EQKA 4BI3A 4XEOA 1BBZA 1RAFB 2J3LA 1SETA 3UATA 3L1AA 3GPLA 1SERA 3MPUB 2BZYA 4HWTA 3TVTA 1KD1R 3QWXX 1KOGA 1Q81U 2CZ0B 4H2SA 4AH6A 2LX7A 1NYRA 2DA9A 1VQ6Q 1BI1A 1YCYA 1K8AR 1IZ6A 2RQRA 4P3PA 1AOJA 4QVCA 4FYVB 2VASA 1ADYA 1JO8A 1LVKA 3TQ7P 4LVIA 2YUPA 2CP5A 4HWOA 3A5ZA 4LNSA 3CCUA 3CCJA 3A7AA 2HCKA 2C0TA 4XTYA 3CCLT 2HMAA 3VQWA 1Q82U 1KK7A 2HL3A 1GCQA 1KFZA 4J9DA 1VUBA 1X56A 2XU8A 3QYGB 4QKUA 3TSZA 4C92A 5KYUB 4ZGEB 1OQKA 2BZ8A 1JJ2S 1VQ5Q 3JB9D 4GLMA 3LWIA 3META 1YI2A 4EMKA 1AHJB 2ZZEA 1K73C 3REUA 2DTHA 2VVKA 5KYYA 3IKMB 2PTKA 2RHQA 2WSFE 2J6FA 2LNVA 4BDZA 1PC0A 4HVWA 4J9FA 3QYHB 2DQ3A 1KJWA 2OAUA 1I8FA 2DE0X 5GAN6 3HKSA 1CSKA 4JRIA 5GAN3 5ELNA 1O75A 2HSPA 3ZFJA 4YRCA 3NETA 2H3JA 1ZA1B 3SWNC 2JMCA 3MP6A 3EG9A 2I4LA 4A4HA 2QG9B 3JB9G 2DYIA 3SD4A 3MP1A 2H8HA 3CMEQ 1OEBA 6AT1B 3CMQA 4OMNA 2COZA 1X2QA 1D0ZA 4PJOB 2RD1A 4YDQA 2AK5A 2XI9A 2ABLA 8AT1B 3M57A 1N9SA 4DBQA 4ZIBA 2CZ7B 1UEBA 2DF6A 1N8RU 1Q81C 4OB1B 2YRDA 1JBMA 4P75C 2GTJA 1KD1C 1AD5A 2I2LA 1H3HA 1IHVA 2DL4A 1U1TA 1IO6A 5L8RE 4F7UE 3MEVA 3VS4A 3R6OA 1IL2A 2OJ2A 4EPCA 4G85A 1RADB 2OTJT 2RHIA 4ORZA 1C0AA 1AZEA 4M78G 1BKBA 3CCLA 3CXCA 4HCZA 4FL6A 3DLMA 1WXTA 2X3WD 2CJAA 4Z88A 4MMLA 3CBOA 4JUVA 2VXFA 3VKIA 4PJLA 4IUTA 4H2XA 2EVRA 2OX7A 3OS0A 1PRMC 4HXJA 2KXDA 1VIEA 1W70A 1X69A 1TH7A 2KRMA 4F7UF 1D0XA 2AIRB 2ZINA 1OU9A 3CC2Q 4P74C 3RR6A 4OP0A 5KYXA 2RHSB 4M7DA 3OYMA 1ACMB 2QGFB 4HWSA 4FYWB 2Z0WA 4AFSC 2VUBA 1CKAA 2D9TA 1EFWA 4LNPA 2JT4A 3NEMA 2QDYB 3VRZA 3LSQA 1VYTA 3VS5A 1ZSZA 4TVAA 1UGVA 1T3SA 2CZ6B 2KXCA 1M3AA 1TUGB 2LJ3A 4LVMA 5LJ5j 1FMVA 2VKNA 2WACA 1EIYB 1C1AA 2KNBB 1WJQA 1VQ4A 4XTXA 3MEYA 2E12A 1MNDA 3CCMA 1VQMT 2CT3A 2DKGA 2J06A 2E70A 3RL6A 1ZUKA 4AT1B 3E9HA 3HY0A 4C8QA
chains in the Genus database with same CATH topology
3JAME 3S6WA 3VJPA 2GFAA 1Y96B 2QHSA 1H3ZA 2EKOA 2F69A 3M53A 3HXXA 1KMNA 4RMOA 3FIFA 3CC4T 2VC8A 2XG8D 1SRYA 1M1KU 3A7UA 2YHTA 2QHTA 3WXMB 3UGQA 4M75G 4KR2A 5GAMg 3X26B 3QPHA 3I55T 5F5WA 3O8VA 3HFNA 1QW1A 3JB9J 2L5QA 2XK0A 2DAQA 3SFMA 3HFOA 1KQ2A 4VUBA 3REXA 4H2TA 12ASA 2RH2A 3ME9A 1YFRA 5GAOl 2RJCA 2E64A 4JS4A 2EQJA 2K3XA 2CKKA 3A8HB 3A74A 1M1FA 4J83A 3OYNA 4M77B 5A0LA 1JRIA 4TTVA 1YJWT 1N6AA 3JCMJ 3TEHB 2HNIA 2DZ9A 4EMKB 4XU0A 4ZTZB 2LQKA 2ZIMA 3LC0A 5KNNA 5I2MA 2ZNJA 3P8YA 1G3TA 2WSEE 3M5AA 4C8QC 4M75C 1NPRA 4BB7A 4MZMA 3G7ZA 4NCXA 3JB9H 1BBWA 4J6WA 1JJCB 3L2VA 1N27A 3H6ZA 2ZR2A 4LVKA 4BWAA 2CYZB 5CVIA 2E5AA 1PYSA 4C8QF 2MI6A 4A4KA 2DTIA 4RG2A 5GAOq 4M7DC 5CQXA 4GLKA 2LCLA 4XAXB 1O9SA 3UFGA 1K8AC 3E9GA 3I7FA 4H2VA 3DB3A 3QIIA 3WVDB 3QUIA 5GMKm 3HHTB 5FU7B 5CKHA 2JTFA 2A7YA 1FYFA 2RO0A 1XOVA 3CPWS 5LJ3g 3PCOB 5GMKe 4J6YA 4YRKA 3BY7A 1H4TA 3PZCA 2XHCA 2QEXT 2QEXA 1NJIC 4HWRA 4M7AF 2QXFA 2XDPA 2ZPEB 3G4ST 3M4YA 3OYIA 4XK8E 2I4OA 2E41A 3P8HA 4WF2A 3SWNA 3OYYA 4C0FA 5C53B 2M0OA 1Y96A 3QKJA 1X55A 3GLXA 5CKBA 1KG1A 3OS2A 4C0GA 3BDUA 3RKYA 4OB2B 2ZT6A 5GAN4 1E22A 3OYBA 5EG2A 2RK1A 4PJOE 3MEUA 3CCQT 4EMKC 1B8AA 1ATIA 3V7CA 2CIMA 5LJ3h 4C92C 1PSEA 1B34A 3RF1A 3CCVT 5A0GA 4E7HA 2X4YA 3M4QA 4LVJA 5GAN2 1WJSA 2VYTA 1YB3A 2KK4A 3HFZB 4Q6GA 1VQLA 3QJ6A 2GCXA 3I56T 4YRLA 4JS5A 5HY6A 3OBWA 1QVGA 4K88A 1G3WA 4YRPA 3L2RA 2ZPIB 2Q7GA 3SB2A 4E7LA 1E1TA 3CBPA 3JCMh 4R55A 2KVQG 2DXCA 5LJ5e 3LGLA 1IREB 2QTXA 4BACA 2Y4XA 1GGMA 4M78A 4MDXA 2HQEA 5D6XA 3KFUA 2ZNIA 2DK3A 4M7DB 1KD1U 4C5EA 2LRQA 4M77G 4H2XB 4LVLA 4YYEA 3S3OA 3ICAA 2OTLT 4OF1A 1VIFA 2MWOA 2DU7A 2IVWA 4CI0C 2Q5IA 1W2BA 3HPWA 2CZ1B 1H4SA 4P73C 4C92G 4ME7A 5I2SA 3MEWA 2X4XA 3SWNB 1X2GA 1VQ6A 1BIAA 3CPWA 3FDRA 2ZCFB 2LT1A 4QQ6A 5GAN7 3CCMT 4Y28E 2EQMA 3BFMA 2E3CA 5GAMh 2ODRC 4HT4A 3GF5A 4HVCA 2QQSA 2RM4A 3CPFA 2JTMA 2E10A 3JCMb 3W3SA 2P0LA 1Y7XA 4CS4A 5A0DA 4M75A 4Y91A 1S72A 3OYCA 1S72T 2HAXA 1WGSA 4M75F 1WQ7A 2Q5HA 2ZT7A 1B70A 2MAMA 2MF2A 2DD4A 4YCWA 3OSSC 2GF7A 3CMAA 4E7IA 4UPAA 4C8QE 4OVAA 1YHQA 5LJ3f 1HC7A 5GANj 4H2UA 4E7JA 1OZ2A 2P0KA 4BI8B 2EL9A 2VXEA 1VQZA 1WJRA 3OMGA 1VQPA 5I21A 2EAYA 2X4JA 2X4WA 4L6V5 1Q86C 1BBUA 2RHUA 2LT4A 2A3LA 2K5IA 2GFUA 3LW5E 3EFRA 4NL2A 4IURA 4FT2A 2XDBA 2K5LA 4KQEA 1M4ZA 3BW1A 3MP8A 3URGA 1BI0A 4ZN3A 1KMMA 3E1SA 4IUVA 4TVRA 2MWPA 3V8LA 1N9RA 3CCSA 3EFSA 1K9MC 5J39A 3TEHA 4O2DA 1EVKA 4C8QG 3GOXA 3DKMA 3JSCA 3OYEA 1QP2A 4UP8A 1BYMA 2K5FA 5KE2A 1H4VB 2VV5A 1K9MU 1YJWA 4M78F 1WQWA 1WYDA 2GQVA 1BI3A 4ELZC 4TVWA 1OYXA 2ZZFA 3OD1A 1FWZA 3E9IA 4XU2A 1NJ1A 2Q7HA 5CCAA 1UB4A 4HWPA 4YRGA 3JRZA 4TQFA 3M54A 1Q82C 4M77E 3MCAB 4C5HA 2CJ9A 3HFVA 4M78E 3HP9A 2M9UA 3OS1A 3PIOA 4WI1A 4P74A 1KC8C 2HD0A 3NFCA 4RQFA 1EQRA 4RCCA 4M77F 3LYIA 3L42A 4CH6A 1YFSA 3P8BB 2AMCB 2PQWA 1X54A 2PMEA 1NJ8A 2LQ8A 1YITA 3QBYA 4J8OA 2YRVA 4CS2A 2DQ0A 1VQMA 1VQKT 2G3RA 4J15A 2ALYA 3NENA 4P72A 4YRIA 4C92D 4P75A 3CCST 5FROA 4MDWA 4LD9K 1HTTA 4J7FA 1P92A 5GANh 2P0PA 4PHCA 4QVDA 4FU6A 5GMKi 4JRQA 3AHUA 3GNFB 2LVMA 5HK0A 4M7AA 2KY9A 2YLCA 1VQPT 3MF1A 4HA8A 5FLXE 4M7DD 3OB9A 2E6ZA 4CRIA 3C12A 3V7RA 4M7AG 2O4XA 5KE3A 4OB0B 4CH3A 2LCCA 1D3BB 3X25B 4E7KA 1VQ7T 5GANg 5J26A 2IY5B 1VQNT 2PU9B 1QF6A 1N9WA 4L87A 1M1GA 4PJOA 3A5ZB 3CC2A 5FU6B 3FLGA 3HSBA 3IKLA 1NYQA 3OSVA 5D6WA 2NS6A 5CQYA 2QHUA 3NELA 3PCOA 1Q7YC 1NJ6A 3RMSA 3CMEA 3BJUA 1M9SA 4DPGA 2C06A 2CGHA 1QP3A 3JB9I 4XTVA 4YRRA 3CXCS 1ASZA 2QHVA 2PMFA 2JUFA 1I4K1 2RJEA 1G5IA 2DVEA 3QO7A 2DO3A 2RHYA 3GP8A 5GAOp 3QHSA 1YJ9A 5M9OA 4YP0A 1YI2T 4Z02A 4F7UB 4IUPA 1YFTA 2ZPFB 4Q5WA 3M4GA 4HCCA 2PVGB 1WPYA 4M75E 4MZPA 1M1KC 1M8VA 3JCMP 4C8QD 2R58A 5AYFA 1RIQA 4EMGA 5DY9A 2XKOC 4Q15A 5IT9E 2A8EA 1G3SA 4RKUE 1K73U 5FRMA 4L5GA 1X2HA 4EX5A 1YBYA 3PIPA 3IALA 2RA2A 3OQ5A 2HBPA 4P3OA 3X20B 2P4TA 5CK9A 5HK3A 1Z7NA 1NPPA 3OA6A 5HKCA 4PJOF 3OYLA 1XNIA 2JZ2A 2O01E 3I55A 5GAMf 2EJFA 4NOYA 4J5YA 4TVAB 2ZXFA 1G3YA 2RI3A 5HGQA 1J5WA 2LX9A 4QQGA 2KDSA 5LJ3j 4PJOG 1VQ8A 1ZBXA 1NE8A 3TREA 4P71C 2KMTA 4LD6A 4X5OA 1YJ9T 3G1ZA 3R07A 4XTUA 3DLLA 4RQEA 2ZR3A 2KSSA 4BE1A 4C0DB 1ASYA 4A4EA 2R5AA 5KH6A 3CCRT 2E65A 3QG1A 4X9DA 2DU5A 3S3NA 5FU7C 2C7IA 4II1A 2EIFA 2M1HA 3PMIA 2J3MA 4FM4B 3CCET 2BKDN 3M4PA 1KHIA 5DLOA 3QSUA 4O6JA 4C5GA 2VGNA 3VBBA 4LDYA 4M77D 2V8KA 4XU3A 2JNGA 4WJ3M 3QNEA 3UDCA 5GAOn 1UGPB 5CIUA 1UGSB 5GANf 2FHDA 3OYFA 3L4GA 3CD6A 1RI0A 3G4SA 4GY5A 2XIDA 1NJ5A 1L0WA 4OMFB 1VQ7A 3ASKA 2ZPHB 3QO5A 4HT8A 4B9XA 5GANe 3IG2A 5GAMd 4XTWA 4HT9A 4YRSA 4ELYC 4EDUA 2K3YA 1Y07A 3OW2S 2JVVA 4A54A 2RHQB 1LYLA 4N4IA 2L3RA 4JDSA 2AKWA 1HXDA 3A32A 3S3MA 1EVLA 3CMAT 3WVEB 3UGTA 1E24A 2Y90A 2B8AA 4C92B 1USYA 2XTIA 4V2SA 4LDVA 1QVGS 4KBMB 1XQHA 2K4YA 1YIJA 2ARUA 4E51A 1B7YB 5LJ5g 2NLUA 1YJNT 2E1HA 5GMKl 1GXIE 3HXUA 4XU1A 5CR2A 3J80E 3L2WA 2ZPBB 3DSQA 3LLRA 2DTOA 1I81A 4M7AB 2CS7A 1OI1A 5CO7A 2LC4A 4DOVA 1G5VA 4TWAA 3E19A 2FYKA 3CBMA 2R5MA 3CCUT 4KT0E 3TUPA 3LH0A 5GANd 3CD6T 3A8OB 4A4FA 2BUDA 3ZEHA 4QQDA 3UPUA 1KHCA 4EO4A 3M59A 2ALYB 2V8IA 3HXYA 2RI2A 4P3NA 2F5KA 3LSSA 4YCUA 1Z7MA 1NJIU 1E1OA 3V8KA 3ER0A 3KUFA 1JJCA 2C8MA 3CCRA 2OTLA 1R8OB 3G71T 1XTDA 1EIFA 1RL2A 3HY1A 4C5IA 4DQ2A 1U8RA 2RK2A 3HRIA 1YITT 3V8JA 3P8DA 4C92E 1LJOA 3MEAA 2DZCA 4LDXA 4OGEA 4ZGJB 3OYHA 3X24B 2PUKB 4C0ZA 2IG0A 5LL6S 2QQRA 3LX7A 1LNXA 4N0AC 4BDYA 4YCVA 3OYGA 3QDRB 3MO8A 3PTAA 4PJOD 4KULA 2EFIA 4M77A 4FT4A 3M55A 5GAN8 4YROA 1UGRB 2L89A 3PFSA 5FU6C 4J6XA 4DA4A 1LOJA 4UP7A 1Q86U 1G51A 3DB4A 4MMKA 4QW2A 4YREA 1HK9A 3L2QA 3LWHA 1VQOA 2XDDA 3J81E 2DXBA 4ZGDB 5D6YA 5J3BA 1B7YA 4BI4A 4X9CA 4P71A 4K87A 3G6EA 2LTOA 2ODRD 2ZT5A 1KQ1A 1YJNA 3VV0A 2HQXA 4BE0A 4OLFA 1D3BA 3HRSA 5C52B 1YIJT 4A53A 2FVUA 1N8RC 5CAIA 2DJZA 2QQBA 4PKCC 3T9NA 2RHZA 3GIBA 3A8MB 1EIYA 3H8ZA 4PLIA 4JJNK 5DLQE 1BIBA 3JCMd 4WJ4A 3PT9A 3RUXA 2I4NA 5KCOA 5GMKh 2D6FA 4M78D 3TCJA 2FB7A 4TVYA 3A31A 4J7IA 4DOWA 5GMKj 4KR3A 1VQ5A 1YHQT 4C0DC 3QTCA 3HXWA 2K2VA 3RERA 1MGQA 3C94A 4XQ3A 5GAOm 5CKEA 4M75B 4X34A 2Y4YA 1PYSB 1M90U 1QVPA 4LDWA 4JRKA 3JCMQ 3RIRA 4OGCA 4E47A 4L59A 3CCQA 4XTZA 4IUUA 2ZCEA 2AMCA 1VQNA 4M7AE 4D6WA 4BY6B 3HRTA 3TEGA 5GAN5 1BI2A 4FSXA 4UC4A 4P5NA 4LDUA 5C51B 1VQ5T 3QXEB 4F7UA 4BE2A 1X01A 3Q1JA 1MHNA 2YLBA 4YRJA 2DXUA 4CH5A 3OMCA 3A7RA 3NTIA 3OYKA 3VQYA 4M7DG 3RMQA 2QA4A 2P0QA 3JCMf 1KC8U 1M5Q1 2I4MA 3L2UA 4YTLA 1H4QA 1VQ6T 3JB9F 4C92F 1PSFA 2ARTA 3FJPA 5LJ5d 3X28B 5LJ3d 3I56A 3HTZA 4CS3A 4PJOC 1U1SA 3VYGA 3CEYA 5K1XA 3LGFA 4MZTA 5C6SA 4M77C 2P5IA 4ATOA 2RJDA 1M90C 3UH0A 4YPFA 2QQAA 4ZN1A 2QI2A 3E9FA 3V7SA 4N0AA 1G5HA 3CCVA 3P8VA 4UP9A 1VQOT 3G71A 1VQ9T 2AKWB 2QQ9A 3ZBDA 3VQXA 3FB9A 4M7AC 5C0MA 3HL8A 3GNGA 5DM7R 4CH4A 4H2WA 3RKXA 1SSFA 1FX7A 2ZIOA 3M9QA 5IN1A 3J7AF 2ZZDA 1X6OA 2ZGWA 3L4GB 2KAFA 2PUOB 4YRFA 4P72C 5LJ3e 3MHXA 1ADJA 4PL6A 5GAMe 3OYDA 4IKFA 4RCBA 1W66A 4XEMA 2F5TX 3PNWC 1B34B 4OB3B 3CC7T 3VUBA 2DPPB 4KUDK 1I5LA 5KCHA 2E6NA 4M7DE 1VQ9A 3QO3A 4M7AD 4KUIA 2EJ9A 1OZ3A 3JCMc 3M56A 1EOVA 5GAMj 2RJFA 4H2YA 4PG3A 4PLLA 11ASA 3MQZA 1VQ8T 4ZTUB 5CKDA 1UGQB 2DXTA 1Q7YU 3F70A 3OS5A 4N4HA 2IY5A 3OY9A 2ZPGB 4ZTJA 3QO8A 2XGTA 4QVZA 3CC2T 4F7UG 4JLGA 1USYC 3JCMg 1W4SA 3HRUA 2ZTGA 4K86A 1FXXA 2CJBA 3JCMX 3P8TA 2DIGA 4N4GA 2D0QB 5GAOr 3OYAA 2JOYA 4BY6C 3HXVA 2AHJB 2X35A 3RKWA 2RHXA 1KQSA 2EWNA 2MMPA 4YRNA 2ZZGA 3PMTA 3C95A 5FRNA 2EJGA 4RDXA 1W2BS 4JLIA 3CCEA 1KQSS 5A2QE 2EQUA 4H02A 1Y71A 2DIQA 3FRNA 4G84A 1NNHA 3QZ9B 3VUZA 4IUQA 3KBGA 3JCMV 1QVFS 4R56A 3JCMe 3TU4K 5IAYA 2R57A 2L8DA 3EAEA 4RMFA 4BD3A 3BDLA 4M7DF 4HCBA 1H641 2OTJA 2FL7A 3FEOA 3M58A 2WSCE 5E3IA 3VYHB 2DDZA 3ERRA 1JJ2A 4RG8A 4HKEA 3OBYA 1JB0E 1B70B 4B9WA 3CCJT 3KXTA 1WNLA 3HXZA 3CC4A 3SDZA 2PVDB 3NTKA 4YRQA 5K1PA 3A8LB 1ZHIA 1NZ9A 1QE0A 2BIVA 1K8AU 3A8GB 1ZQ1A 4NL3A 2EYQA 3N5BB 2K57A 4PNOA 3TEEA 3UT1A 2ZT8A 4EMHA 4BW9A 2DD5A 2DEQA 1YGBA 3RGLA 3OW2A 2RB6A 1NJ2A 4M78B 3CC7A 4FIBA 4M75D 4TQDA 1QVFA 4BUGA 4O5VA 3OYJA 2V8JA 2O4XB 4P73A 3PGGA 4ZTFA 3RESA 1WU7A 2RI5A 5ELOA 1B76A 1SESA 1VQLT 3MF2A 5LJ5f 2G4CA 3L2ZA 1DJ7B 2PVOB 3NTHA 4C8QB 4NS5A 2KQWA 1WLEA 2XICA 2Q7EA 3UWNA 2M16A 5CKFA 4A4GA 3FC3A 3QZ5B 3QJYA 2QA4T 4YRTA 3WQZA 5LJ5h 3RACA 2E5QA 3C4SA 1VQKA 3A5YA 4M78C 2ARSA 3HFZA 3VQVA 2VGMA 3G6ET 2JN0A 3VU3C 2LDMA 1X75C 1VQ4T 4YRMA 1V29B 3INZA 2XD0A 4JRPA 3HRKA 3JCMW 2RHSA 3CMET 4XEOA 2EQKA 4BI3A 2J3LA 1SETA 3L1AA 3GPLA 1SERA 4HWTA 1KOGA 1Q81U 2CZ0B 4H2SA 4AH6A 1NYRA 1BI1A 1YCYA 1IZ6A 4P3PA 4QVCA 1ADYA 4LVIA 4LNSA 3A5ZA 4HWOA 3CCUA 3CCJA 3A7AA 4XTYA 3CCLT 3VQWA 1Q82U 1VUBA 1X56A 2XU8A 3QYGB 4C92A 4ZGEB 1JJ2S 3JB9D 3LWIA 3META 1YI2A 4EMKA 1AHJB 2ZZEA 1K73C 3REUA 2DTHA 3IKMB 2RHQA 2WSFE 2LNVA 4BDZA 3QYHB 2DQ3A 2OAUA 1I8FA 5GAN6 3HKSA 4JRIA 5GAN3 5ELNA 1O75A 3ZFJA 4YRCA 3NETA 2H3JA 3SWNC 3MP6A 2I4LA 4A4HA 3JB9G 3SD4A 3MP1A 3CMQA 4PJOB 2RD1A 4YDQA 2XI9A 3M57A 1N9SA 4ZIBA 2CZ7B 1UEBA 1N8RU 1Q81C 4OB1B 1JBMA 4P75C 1KD1C 2I2LA 1U1TA 5L8RE 4F7UE 3MEVA 3R6OA 1IL2A 4G85A 4EPCA 2OTJT 2RHIA 1C0AA 4M78G 1BKBA 3CCLA 3CXCA 4HCZA 4FL6A 3DLMA 2CJAA 4MMLA 3CBOA 4JUVA 2VXFA 3VKIA 4IUTA 4H2XA 3OS0A 1VIEA 1TH7A 4F7UF 2ZINA 4P74C 4OP0A 2RHSB 4M7DA 3OYMA 4HWSA 2VUBA 2D9TA 1EFWA 3NEMA 2QDYB 3LSQA 4TVAA 2CZ6B 4LVMA 5LJ5j 2WACA 1EIYB 1WJQA 1VQ4A 4XTXA 3MEYA 2E12A 3CCMA 1VQMT 2DKGA 2E70A 3RL6A 3E9HA 3HY0A 4C8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I21 A;  2AKW A;  2EAY A;  4H2Y A;  4PG3 A;  1HXD A;  3A32 A;  1EVL A;  11AS A;  1BBU A;  1Y96 B;  2QHS A;  3UGT A;  4ZTU B;  1E24 A;  2Y90 A;  4C92 B;  1USY A;  2DXT A;  2XTI A;  3HXX A;  4V2S A;  1KMN A;  3EFR A;  4NL2 A;  3FIF A;  2VC8 A;  1SRY A;  4KQE A;  3BW1 A;  3A7U A;  2YHT A;  2QHT A;  1KMM A;  3UGQ A;  2IY5 A;  4M75 G;  3V8L A;  3QO8 A;  4KR2 A;  5GAM g;  1N9R A;  2ARU A;  2XGT A;  3EFS A;  5F5W A;  4E51 A;  1B7Y B;  5LJ5 g;  3TEH A;  4F7U G;  3HFN A;  2E1H A;  4O2D A;  5GMK l;  3JB9 J;  1EVK A;  4C8Q G;  3HXU A;  4XU1 A;  4UP8 A;  1USY C;  3HFO A;  3JCM g;  1KQ2 A;  3REX A;  4H2T A;  12AS A;  1H4V B;  3DSQ A;  1YFR A;  5GAO l;  2ZTG A;  4K86 A;  2DTO A;  1I81 A;  2E64 A;  2CJB A;  3JCM X;  3P8T A;  4M78 F;  4M7A B;  1WQW A;  1WYD A;  3A74 A;  5GAO r;  4TVW A;  2ZZF A;  3OD1 A;  4M77 B;  3E9I A;  4XU2 A;  1JRI A;  3HXV A;  4TWA A;  1NJ1 A;  2Q7H A;  2FYK A;  3RKW A;  4TTV A;  3JCM J;  2EWN A;  4HWP A;  3TEH B;  4YRG A;  4YRN A;  2HNI A;  2ZZG A;  3TUP A;  2DZ9 A;  4EMK B;  4TQF A;  4XU0 A;  4ZTZ B;  2EJG A;  4M77 E;  5GAN d;  4RDX A;  4JLI A;  2CJ9 A;  2ZIM A;  3HFV A;  4EO4 A;  3LC0 A;  2ALY B;  5KNN A;  4M78 E;  3HXY A;  4P3N A;  3LSS A;  2ZNJ A;  4H02 A;  4YCU A;  1Z7M A;  1E1O A;  3P8Y A;  4G84 A;  3V8K A;  4WI1 A;  1NNH A;  1JJC A;  2C8M A;  4P74 A;  4C8Q C;  4RQF A;  4M75 C;  1EQR A;  4RCC A;  4M77 F;  4NCX A;  3JCM V;  3JB9 H;  4CH6 A;  3HY1 A;  4DQ2 A;  1BBW A;  1YFS A;  4J6W A;  1JJC B;  3JCM e;  3HRI A;  2AMC B;  2PME A;  1X54 A;  3V8J A;  1NJ8 A;  2ZR2 A;  4BWA A;  4RMF A;  4C92 E;  1LJO A;  2DZC A;  4M7D F;  2E5A A;  1H64 1;  4CS2 A;  1PYS A;  4C8Q F;  5E3I A;  2DDZ A;  2DQ0 A;  3ERR A;  4J15 A;  2ALY A;  1LNX A;  2DTI A;  3NEN A;  4N0A C;  4P72 A;  4YRI A;  5GAO q;  4M7D C;  4C92 D;  4P75 A;  4YCV A;  1B70 B;  1HTT A;  3UFG A;  4PJO D;  3I7F A;  5GAN h;  1WNL A;  3HXZ A;  4M77 A;  4PHC A;  5GAN 8;  4H2V A;  4YRO A;  4QVD A;  4YRQ A;  5K1P A;  3QUI A;  5GMK i;  4J6X A;  1LOJ A;  5GMK m;  4UP7 A;  1G51 A;  1QE0 A;  3AHU A;  4MMK A;  1FYF A;  4M7A A;  2YLC A;  4NL3 A;  4YRE A;  3MF1 A;  1HK9 A;  5LJ3 g;  3PCO B;  2K57 A;  4PNO A;  2ZT8 A;  4EMH A;  4BW9 A;  2DEQ A;  4HA8 A;  5GMK e;  4J6Y A;  4YRK A;  3BY7 A;  1H4T A;  1YGB A;  4M7D D;  3PZC A;  3RGL A;  2RB6 A;  1NJ2 A;  3V7R A;  4M7A G;  4CH3 A;  4HWR A;  4M78 B;  4M7A F;  1B7Y A;  4M75 D;  1D3B B;  4X9C A;  4P71 A;  4K87 A;  5GAN g;  4TQD A;  2ODR D;  2IY5 B;  2I4O A;  2E41 A;  1QF6 A;  2ZT5 A;  1KQ1 A;  1N9W A;  4L87 A;  4P73 A;  4WF2 A;  3PGG A;  3SWN A;  4PJO A;  4OLF A;  3RES A;  3HSB A;  1D3B A;  3IKL A;  5C53 B;  5C52 B;  1NYQ A;  1WU7 A;  1Y96 A;  5ELO A;  4A53 A;  1B76 A;  1SES A;  1X55 A;  5CAI A;  2QHU A;  3MF2 A;  5LJ5 f;  2DJZ A;  2G4C A;  3NEL A;  3L2Z A;  3PCO A;  3BDU A;  3RKY A;  1NJ6 A;  4C8Q B;  3BJU A;  2ZT6 A;  1WLE A;  3GIB A;  5GAN 4;  1EIY A;  1E22 A;  2Q7E A;  4DPG A;  4PJO E;  1BIB A;  3JCM d;  4YRT A;  4EMK C;  4WJ4 A;  1B8A A;  1ATI A;  3V7C A;  3WQZ A;  2CIM A;  2CGH A;  5LJ5 h;  3RAC A;  3RUX A;  3JB9 I;  4XTV A;  3A5Y A;  5LJ3 h;  2I4N A;  4M78 C;  4YRR A;  4C92 C;  2ARS A;  5GMK h;  3HFZ A;  1B34 A;  3VQV A;  1ASZ A;  2QHV A;  2PMF A;  3RF1 A;  4M78 D;  1I4K 1;  2FB7 A;  1G5I A;  2JN0 A;  3M4Q A;  4TVY A;  3VU3 C;  3A31 A;  5GAN 2;  2DVE A;  5GMK j;  3QO7 A;  4KR3 A;  4YRM A;  5GAO p;  3QHS A;  3INZ A;  3HRK A;  3QTC A;  3JCM W;  3HXW A;  1YB3 A;  4YP0 A;  3HFZ B;  4Q6G A;  2RHS A;  3RER A;  4F7U B;  4XEO A;  1YFT A;  2J3L A;  1SET A;  1MGQ A;  4XQ3 A;  3L1A A;  3M4G A;  5GAO m;  1SER A;  4M75 B;  1PYS B;  4HWT A;  1WPY A;  4M75 E;  4JRK A;  3JCM Q;  3RIR A;  4YRL A;  1M8V A;  1KOG A;  3JCM P;  4C8Q D;  4XTZ A;  4H2S A;  4AH6 A;  2ZCE A;  2AMC A;  1NYR A;  1YCY A;  1RIQ A;  4K88 A;  4EMG A;  5DY9 A;  4P3P A;  4M7A E;  4Q15 A;  4QVC A;  4YRP A;  1ADY A;  2Q7G A;  3SB2 A;  3TEG A;  5GAN 5;  1E1T A;  3JCM h;  4HWO A;  3A5Z A;  4LNS A;  3A7A A;  5C51 B;  4F7U A;  4XTY A;  5LJ5 e;  1X01 A;  3VQW A;  1X2H A;  4EX5 A;  2QTX A;  3IAL A;  1X56 A;  2RA2 A;  2YLB A;  4C92 A;  4M78 A;  1GGM A;  4YRJ A;  2DXU A;  4P3O A;  4CH5 A;  3A7R A;  3JB9 D;  3KFU A;  3VQY A;  2ZNI A;  4EMK A;  4M7D G;  2ZZE A;  3REU A;  4M7D B;  1Z7N A;  2DTH A;  3JCM f;  3IKM B;  1M5Q 1;  2I4M A;  2RHQ A;  1H4Q A;  4PJO F;  4M77 G;  4H2X B;  2DQ3 A;  4YYE A;  3JB9 F;  4C92 F;  1I8F A;  5GAN 6;  3ICA A;  3FJP A;  5GAM f;  2ART A;  2EJF A;  4NOY A;  5LJ5 d;  2DU7 A;  4JRI A;  5GAN 3;  4J5Y A;  5ELN A;  4TVA B;  2Q5I A;  5LJ3 d;  2ZXF A;  4YRC A;  3NET A;  3HTZ A;  4CS3 A;  3SWN C;  4PJO C;  1H4S A;  4P73 C;  1U1S A;  4C92 G;  2I4L A;  3JB9 G;  5HGQ A;  1J5W A;  5LJ3 j;  4PJO G;  5K1X A;  3CMQ A;  3SWN B;  4PJO B;  1X2G A;  2RD1 A;  4YDQ A;  1BIA A;  4P71 C;  4M77 C;  2P5I A;  4X5O A;  3UH0 A;  4YPF A;  1N9S A;  4ZIB A;  3G1Z A;  1JBM A;  3R07 A;  4P75 C;  4XTU A;  4RQE A;  2I2L A;  3V7S A;  4N0A A;  2ZR3 A;  1G5H A;  5GAN 7;  1U1T A;  2E3C A;  3BFM A;  3P8V A;  4UP9 A;  5GAM h;  1ASY A;  4F7U E;  2ODR C;  1IL2 A;  4G85 A;  2AKW B;  1C0A A;  3VQX A;  3FB9 A;  2E65 A;  4M7A C;  4HVC A;  4X9D A;  2DU5 A;  4M78 G;  2RM4 A;  2C7I A;  4CH4 A;  2J3M A;  2CJA A;  4MML A;  2E10 A;  4JUV A;  2VXF A;  4H2W A;  3RKX A;  3JCM b;  3M4P A;  3QSU A;  4H2X A;  3W3S A;  2P0L A;  4CS4 A;  2ZIO A;  4M75 A;  1TH7 A;  3VBB A;  4F7U F;  4Y91 A;  2ZIN A;  4M77 D;  4P74 C;  2ZGW A;  4XU3 A;  3L4G B;  4OP0 A;  4M75 F;  2RHS B;  4M7D A;  1WQ7 A;  2Q5H A;  4P72 C;  2ZT7 A;  4YRF A;  4HWS A;  4WJ3 M;  5LJ3 e;  3QNE A;  1B70 A;  1ADJ A;  5GAO n;  1EFW A;  5GAN f;  5GAM e;  3NEM A;  4RCB A;  3L4G A;  4YCW A;  1W66 A;  4XEM A;  3LSQ A;  1L0W A;  1NJ5 A;  1B34 B;  4TVA A;  4UPA A;  4C8Q E;  3QO5 A;  5LJ5 j;  4HT8 A;  5LJ3 f;  5GAN e;  5GAN j;  1I5L A;  1HC7 A;  4H2U A;  1EIY B;  4M7D E;  3IG2 A;  4XTX A;  5GAM d;  3MEY A;  3QO3 A;  4XTW A;  2EL9 A;  4HT9 A;  2VXE A;  4M7A D;  4YRS A;  1VQZ A;  2DKG A;  3RL6 A;  2EJ9 A;  4A54 A;  2RHQ B;  3JCM c;  3E9H A;  1LYL A;  3HY0 A;  4C8Q A;  1EOV A;  5GAM j; 
#chains in the Genus database with same CATH topology
 4D8K A;  3JAM E;  1D1C A;  1UE9 A;  1NJI R;  3S6W A;  2O9V A;  2RNA A;  3VJP A;  2GFA A;  1Y96 B;  2QHS A;  3THK A;  1H3Z A;  2EKO A;  2F69 A;  2CT4 A;  3M53 A;  2NUP B;  3VRY A;  4CC3 A;  3CXC P;  3HXX A;  1KMN A;  1NYF A;  4RMO A;  2E3H A;  3FIF A;  3CC4 T;  2O2O A;  2VC8 A;  2K9G A;  2XG8 D;  3CCJ Q;  1M1K U;  1SRY A;  4PFP A;  3A7U A;  2YHT A;  2RQU A;  2KR3 A;  2QHT A;  3WXM B;  3UGQ A;  4M75 G;  4KR2 A;  4OMQ A;  1WX6 A;  5GAM g;  3X26 B;  3QPH A;  3I55 T;  5F5W A;  3O8V A;  2EW3 A;  1ABQ A;  3HFN A;  1QW1 A;  3JB9 J;  2YDL A;  2L5Q A;  2XK0 A;  2DAQ A;  3SFM A;  3HFO A;  1B07 A;  2W10 A;  4PJM A;  1KQ2 A;  4VUB A;  1YIT Q;  3REX A;  4H2T A;  12AS A;  1V76 A;  2RH2 A;  3ME9 A;  1YFR A;  1JQQ A;  5GAO l;  2RJC A;  2E64 A;  1WFW A;  4JS4 A;  3HTR A;  5EC7 A;  2EQJ A;  2K3X A;  4AMC A;  1RAI B;  2CKK A;  3A8H B;  1UJY A;  3A74 A;  1M1F A;  4J83 A;  4JJD A;  3OYN A;  1VQ9 Q;  4M77 B;  5A0L A;  1ZSZ B;  1JRI A;  4TTV A;  1YJW T;  1N6A A;  2LJ1 A;  3H41 A;  3JCM J;  1PD1 A;  3LH5 A;  3TEH B;  2HNI A;  2DZ9 A;  4EMK B;  3ULR B;  4KGZ B;  4XU0 A;  4ZTZ B;  1ZUY A;  2LQK A;  4JJC A;  2ZIM A;  4AFQ C;  3LC0 A;  5KNN A;  5I2M A;  2ZNJ A;  3P8Y A;  2GNC A;  2NYS A;  1W1F A;  2J6O A;  1G3T A;  2WSE E;  3M5A A;  4C8Q C;  4M75 C;  1NPR A;  4BB7 A;  4FYX B;  4MZM A;  3G7Z A;  4NCX A;  2DYB A;  3JB9 H;  1K4U S;  1WXB A;  8ATC B;  1BBW A;  4J6W A;  1JJC B;  3L2V A;  1N27 A;  3H6Z A;  2ZR2 A;  4LVK A;  4BWA A;  2CYZ B;  1MNE A;  5CVI A;  2E5A A;  2DX1 A;  4JPB W;  3TSW A;  1PYS A;  4C8Q F;  2MI6 A;  3I5S A;  1K9A A;  4J9G A;  4A4K A;  2DTI A;  4RG2 A;  5GAO q;  4M7D C;  5CQX A;  4GLK A;  4KGV B;  2LCL A;  2CUB A;  4ANJ A;  3FJ5 A;  4XAX B;  3EH2 A;  1O9S A;  3UFG A;  1K8A C;  3E9G A;  3I7F A;  4H2V A;  3DB3 A;  3QII A;  3WVD B;  3SHW A;  3QUI A;  3G1J A;  5GMK m;  3HHT B;  2ESW A;  5FU7 B;  5CKH A;  2JTF A;  1MMN A;  1PM3 A;  2A7Y A;  1FYF A;  2RO0 A;  1XOV A;  1BCO A;  3CPW S;  1QMC A;  5LJ3 g;  3PCO B;  4FW2 A;  5GMK e;  1JXO A;  4J6Y A;  5KYY B;  4YRK A;  3BY7 A;  1H4T A;  2YUQ A;  1MV0 B;  1NG2 A;  2O88 A;  3PZC A;  4KRT A;  2XHC A;  2QEX T;  4F17 A;  2QEX A;  1NJI C;  4HWR A;  2DRK A;  4M7A F;  2QXF A;  1T3L A;  2XDP A;  2ZPE B;  2JMA A;  1PNJ A;  3G4S T;  1PCX A;  3M4Y A;  3OYI A;  3M0P A;  3VS6 A;  2JJ9 A;  4XK8 E;  1QKX A;  2I4O A;  2E41 A;  3P8H A;  4OMO A;  4WF2 A;  3SWN A;  3OYY A;  1K0S A;  1TSF A;  4C0F A;  1MMG A;  5C53 B;  2M0O A;  1Y96 A;  2E4H A;  3QKJ A;  1X55 A;  3GLX A;  5CKB A;  1KG1 A;  3OS2 A;  1Q7Y R;  1NM7 A;  4C0G A;  3BDU A;  3RKY A;  3EGU A;  4OB2 B;  2FO0 A;  2ZT6 A;  5GAN 4;  1E22 A;  3QDF A;  3OYB A;  5EG2 A;  2RK1 A;  4PJO E;  3MEU A;  3CCQ T;  3CCR Q;  4EMK C;  1B8A A;  1ATI A;  3V7C A;  2CIM A;  3AT1 B;  3EHQ A;  1YIJ Q;  4KH0 B;  1PRL C;  1ZA2 B;  5LJ3 h;  4C92 C;  2IIM A;  1PSE A;  1B34 A;  1GCQ C;  4OMM A;  3CCV T;  3RF1 A;  5A0G A;  4E7H A;  2X4Y A;  3M4Q A;  1VQN Q;  4LVJ A;  5GAN 2;  1WIE A;  1WJS A;  2VYT A;  2MIO A;  1YB3 A;  2KK4 A;  3HFZ B;  4Q6G A;  2HKQ B;  1VQL A;  3QJ6 A;  2GCX A;  3I56 T;  4YRL A;  4JS5 A;  1VQP Q;  2L0A A;  1SEM A;  5HY6 A;  1Q86 R;  2NWM A;  1BCM A;  3OBW A;  4OMP A;  1T0J A;  1QVG A;  4WTO B;  4K88 A;  1GL5 A;  1G3W A;  2DL3 A;  4YRP A;  3L2R A;  2FEI A;  2ZPI B;  2Q7G A;  3SB2 A;  2M02 A;  2D1X A;  4E7L A;  1E1T A;  3CBP A;  3JCM h;  2DL7 A;  4R55 A;  2KVQ G;  2DXC A;  3H0F A;  5LJ5 e;  3LGL A;  1IRE B;  2BE9 B;  2QTX A;  5GJV B;  3CCS Q;  4BAC A;  1HSQ A;  2Y4X A;  1GGM A;  4M78 A;  4MDX A;  2HQE A;  1AVZ C;  5D6X A;  3KFU A;  3M0R A;  2ZNI A;  2DK3 A;  4M7D B;  1KD1 U;  1FMW A;  4C5E A;  4F04 B;  2LRQ A;  1UHF A;  4M77 G;  4H2X B;  4LVL A;  4YYE A;  4AG1 C;  3S3O A;  3ICA A;  2OTL T;  4OF1 A;  1VIF A;  1WLP B;  2MWO A;  2DU7 A;  2IVW A;  2ATC B;  4CI0 C;  4RTU A;  2Q5I A;  2L2P A;  1W2B A;  3HPW A;  2L3S A;  2CZ1 B;  1H4S A;  2D8J A;  2RPN A;  4LUE A;  4P73 C;  3O5Z A;  4C92 G;  1NLO C;  4ME7 A;  1WDX A;  3A1P A;  3KFV A;  5I2S A;  3MEW A;  2X4X A;  2LQW A;  5IHN A;  3SWN B;  3NMZ C;  1X2G A;  1VQ6 A;  3PVQ A;  3VS7 A;  1BIA A;  4Z89 A;  3CD6 Q;  3CPW A;  3U23 A;  3FDR A;  1U5S A;  2ZCF B;  2LT1 A;  1D0Y A;  4QQ6 A;  3CCU Q;  1QWE A;  1K76 A;  5GAN 7;  3CCM T;  4Y28 E;  2EQM A;  3BFM A;  2E3C A;  5GAM h;  1E6H A;  2ODR C;  4HT4 A;  3GF5 A;  2EKH A;  4HVC A;  3UA7 A;  2QQS A;  2RM4 A;  2FZC B;  4PFO A;  3CPF A;  1TXQ A;  1UG1 A;  2JTM A;  2E10 A;  3JCM b;  3NPF A;  3W3S A;  2P0L A;  1Y7X A;  4CS4 A;  5A0D A;  4M75 A;  2JM8 A;  1IGQ A;  4Y91 A;  2I0N A;  1RAA B;  1S72 A;  1RAH B;  3OYC A;  2O9S A;  1S72 T;  2HAX A;  1WGS A;  4M75 F;  1M2O A;  1PG5 B;  4CC4 B;  1WQ7 A;  2Q5H A;  1IB8 A;  2ZT7 A;  2F1L A;  1B70 A;  3E2U A;  2FPF A;  9ATC B;  2MAM A;  2MF2 A;  1Q95 G;  2DD4 A;  4YCW A;  3OSS C;  2GF7 A;  3MJX A;  4DEX A;  1HD3 A;  2CH4 A;  1JXM A;  3CMA A;  4E7I A;  1SRL A;  4C8Q E;  4OVA A;  4UPA A;  5GJW B;  1YHQ A;  5LJ3 f;  1HC7 A;  5GAN j;  4H2U A;  4E7J A;  4LUD A;  1OZ2 A;  4HVV A;  2P0K A;  4BI8 B;  2IPO B;  2EL9 A;  2VXE A;  4AG2 C;  1VQZ A;  1WJR A;  2C0O A;  1TS9 A;  1C0M A;  3OMG A;  1VQP A;  5I21 A;  2EAY A;  2X4J A;  2X4W A;  4L6V 5;  1Q86 C;  1I5O B;  1BBU A;  2RHU A;  1E7O A;  2LT4 A;  2SEM A;  3D7S B;  2A3L A;  4JZ3 A;  5I11 A;  2K5I A;  2GFU A;  4DBR A;  3LW5 E;  3EFR A;  4NL2 A;  4IUR A;  2L3P A;  4FT2 A;  2K5L A;  2XDB A;  4KQE A;  1M4Z A;  2JTE A;  1UEC A;  3BW1 A;  3MP8 A;  3URG A;  1BI0 A;  4ZN3 A;  1KMM A;  3E1S A;  1SRM A;  4IUV A;  4TVR A;  2MWP A;  3V8L A;  1N9R A;  3CCS A;  3EFS A;  1VQK Q;  1WZO A;  1K9M C;  5J39 A;  3TEH A;  4O2D A;  2QAS A;  1EVK A;  4C8Q G;  3GOX A;  3DKM A;  3JSC A;  3OYE A;  4AFU C;  1QP2 A;  4UP8 A;  1OUL A;  1BYM A;  2K5F A;  2CDT A;  5KE2 A;  1H4V B;  3CCE Q;  2VV5 A;  1K9M U;  1YJW A;  1ZX6 A;  2DIL A;  4M78 F;  1QQJ A;  1WQW A;  1YCS B;  1GBR A;  1WYD A;  1VOM A;  2GQV A;  1PKS A;  1BI3 A;  1PD0 A;  4ELZ C;  3G71 Q;  4TVW A;  1OYX A;  2ZZF A;  3OD1 A;  1FWZ A;  3H9N A;  1YNZ A;  3E9I A;  4XU2 A;  1PHT A;  3CCM Q;  1NJ1 A;  2Q7H A;  5CCA A;  2M51 A;  1UB4 A;  1SKU B;  4HWP A;  4YRG A;  1AWJ A;  1UTI A;  2F2W A;  2LP5 A;  1ZSZ C;  3JRZ A;  4TQF A;  3M54 A;  2E5K A;  1Q82 C;  4M77 E;  3MCA B;  5IXF A;  1M90 R;  2V26 A;  4C5H A;  2CJ9 A;  2JM9 A;  3HFV A;  1Z9Z A;  4M78 E;  2A0F B;  3HP9 A;  1EX4 A;  2M9U A;  3OS1 A;  3PIO A;  4WI1 A;  4P74 A;  1KC8 C;  2GGR A;  2HD0 A;  3NFC A;  1RLQ C;  2AKK A;  4RQF A;  1QKW A;  1EQR A;  1J3T A;  4RCC A;  4M77 F;  3LYI A;  3L42 A;  4CH6 A;  1TUD A;  1YFS A;  2BZX A;  3P8B B;  2ENM A;  2AMC B;  2HDA A;  2PQW A;  1X54 A;  2PME A;  1NJ8 A;  2LQ8 A;  1YIT A;  3QBY A;  4J8O A;  2YRV A;  4CS2 A;  1TOV A;  1YJN Q;  4DBF A;  2DQ0 A;  3RBB B;  1VQM A;  1VQK T;  2G3R A;  4J15 A;  2ALY A;  1AWO A;  1YN8 A;  3NEN A;  4P72 A;  4YRI A;  4C92 D;  4P75 A;  3CCS T;  2CH4 W;  1KSW A;  5FRO A;  4MDW A;  4LD9 K;  1HTT A;  4J7F A;  2CUD A;  1P92 A;  5GAN h;  2P0P A;  5HCK A;  1AEY A;  4PHC A;  4J9I A;  2KBT A;  4QVD A;  4FU6 A;  3CMA Q;  5GMK i;  2X9H A;  2K6D A;  4E7S A;  4JRQ A;  1TTH B;  4IIM A;  3AHU A;  3GNF B;  2LVM A;  5HK0 A;  4M7A A;  2KY9 A;  1PWT A;  2YLC A;  1VQP T;  3MF1 A;  4HA8 A;  3REA B;  5FLX E;  4RTW A;  4M7D D;  3OB9 A;  4E6R A;  1AT1 B;  2E6Z A;  4CRI A;  1QWF A;  3C12 A;  3V7R A;  4M7A G;  2O4X A;  5KE3 A;  2ZAE A;  4OB0 B;  1YI2 Q;  4CH3 A;  2DMO A;  2LCC A;  1D3B B;  3X25 B;  4E7K A;  2DL5 A;  1VQ7 T;  2DRM A;  5GAN g;  5J26 A;  2IY5 B;  1VQN T;  2C0I A;  2PU9 B;  1GBQ A;  1QF6 A;  1N9W A;  4L87 A;  1M1G A;  4PJO A;  3A5Z B;  3CC2 A;  5FU6 B;  3FLG A;  3HSB A;  2KRO A;  3IKL A;  1NYQ A;  3RNJ A;  3OSV A;  5D6W A;  5CQY A;  2NS6 A;  2QHU A;  3CCQ Q;  3NEL A;  1OX9 A;  2SRC A;  3PCO A;  2CSQ A;  2HQH A;  1Q7Y C;  2KRS A;  1NJ6 A;  3RMS A;  3CME A;  3BJU A;  1OPK A;  1M9S A;  2YSQ A;  4DPG A;  1FMK A;  2C06 A;  3EGX A;  2CGH A;  4CC7 A;  1QP3 A;  3JB9 I;  4XTV A;  4YRR A;  4GBQ A;  3CXC S;  4J9H A;  1ASZ A;  2QHV A;  2PMF A;  2JUF A;  1I4K 1;  2RJE A;  3C0C A;  1G5I A;  1X6B A;  1YJ9 Q;  2DVE A;  3QO7 A;  1UHC A;  3G4S Q;  2DO3 A;  2EBP A;  2RHY A;  3GP8 A;  5GAO p;  3QHS A;  1SHF A;  3PE0 A;  1YJ9 A;  2XMF A;  5M9O A;  3EGD A;  2GTO A;  4YP0 A;  1YI2 T;  4Z02 A;  3EFO A;  4F7U B;  4IUP A;  1YFT A;  2COY A;  2ZPF B;  4Q5W A;  3A98 A;  2NUT A;  3M4G A;  5IXB A;  4HCC A;  1UFF A;  2PVG B;  2EGC A;  3R6N A;  1WPY A;  4M75 E;  4MZP A;  1M1K C;  1M8V A;  3JCM P;  4C8Q D;  3EG1 A;  1WHJ A;  2R58 A;  4Z8A A;  5AYF A;  1RIQ A;  2CRE A;  4EMG A;  1LCK A;  5DY9 A;  2XKO C;  4Q15 A;  2YXY A;  1ZBJ A;  5IT9 E;  2A8E A;  1WXU A;  1G3S A;  1BK2 A;  2HEQ A;  3I5R A;  4RKU E;  1K73 U;  2LQN A;  2CP7 A;  5FRM A;  1EFN A;  4L5G A;  1X2H A;  4EX5 A;  1YBY A;  4Y92 A;  3PIP A;  2HBW A;  3IAL A;  2RA2 A;  3OQ5 A;  2HBP A;  4P3O A;  1ZSG A;  3X20 B;  4HCK A;  2P4T A;  5I22 A;  4OML A;  5CK9 A;  5HK3 A;  1Z7N A;  2KEA A;  1NPP A;  4PFZ A;  2CSI A;  1Z9Q A;  3OA6 A;  5HKC A;  4PJO F;  3OYL A;  1IHW A;  1XNI A;  2JZ2 A;  2QK0 A;  2O01 E;  3PVL A;  3I55 A;  5GAM f;  2DNU A;  2EJF A;  4NOY A;  2YUN A;  1LPL A;  4J5Y A;  2L3Q A;  4TVA B;  2ZXF A;  1G3Y A;  2RI3 A;  5HGQ A;  2AZV A;  1J5W A;  1GFD A;  2LX9 A;  4QQG A;  2KDS A;  4D8D A;  5LJ3 j;  4PJO G;  2G6F X;  1Y57 A;  1VQ8 A;  1ZBX A;  1NE8 A;  1RAC B;  3TRE A;  4P71 C;  2KMT A;  4LD6 A;  5FW9 A;  1TU0 B;  4X5O A;  1YJ9 T;  3I9Q A;  3MKD A;  3G1Z A;  1GRI A;  3R07 A;  4XTU A;  3DLL A;  4RQE A;  2ZR3 A;  2KSS A;  4BE1 A;  4C0D B;  1ASY A;  4A4E A;  1H92 A;  2R5A A;  5KH6 A;  1X43 A;  3CCR T;  2E65 A;  3QG1 A;  4X9D A;  2DU5 A;  3S3N A;  5FU7 C;  2C7I A;  4II1 A;  2EIF A;  2M1H A;  3PMI A;  1Q82 R;  2J3M A;  1FYN A;  5AT1 B;  1UUE A;  4FM4 B;  2F2V A;  3CCE T;  2O31 A;  2BKD N;  3M4P A;  1KHI A;  5DLO A;  3QSU A;  4O6J A;  2RMO A;  4C5G A;  2VGN A;  2OAW A;  3VBB A;  5L23 A;  4LDY A;  2DLP A;  4M77 D;  4RTT A;  3EH1 A;  2V8K A;  4XU3 A;  2JNG A;  1KIK A;  2ROT A;  4WJ3 M;  3QNE A;  3UDC A;  5GAO n;  1UGP B;  1QCN A;  2HKN A;  5CIU A;  1UGS B;  5GAN f;  2BE7 D;  1VQ7 Q;  2FHD A;  3OYF A;  3L4G A;  4IIO A;  3CD6 A;  1RI0 A;  3G4S A;  4GY5 A;  2CP0 A;  2XID A;  1NJ5 A;  1L0W A;  4OMF B;  1VQ7 A;  2QEX Q;  4RTV A;  3ASK A;  2ZPH B;  3QO5 A;  4HT8 A;  4B9X A;  5GAN e;  2P4R A;  3VS2 A;  3IG2 A;  5GAM d;  2B86 A;  4XTW A;  1B3Q A;  4HT9 A;  4YRS A;  4ELY C;  4EDU A;  2K3Y A;  3M0Q A;  1Y07 A;  3VS1 A;  3OW2 S;  2JVV A;  4A54 A;  1R0C B;  2RHQ B;  1LYL A;  4N4I A;  2L3R A;  4JDS A;  2AKW A;  1HXD A;  2RQV A;  3S3M A;  3A32 A;  1EVL A;  3CMA T;  2KGT A;  3WVE B;  3UGT A;  2ROL A;  2Y90 A;  2B8A A;  4C92 B;  1E24 A;  1USY A;  2XTI A;  3REB B;  4V2S A;  2K2M A;  4LDV A;  4LXC A;  1QVG S;  4KBM B;  1XQH A;  1JU5 C;  2K4Y A;  1GFC A;  1YIJ A;  2ARU A;  3BE3 A;  4E51 A;  1S72 Q;  1B7Y B;  5LJ5 g;  2NLU A;  1K9M R;  1YJN T;  1EZZ B;  2E1H A;  1KQS P;  5GMK l;  1T0H A;  1GXI E;  3HXU A;  4XU1 A;  5CR2 A;  3J80 E;  2D0N A;  3L2W A;  2ZPB B;  3DSQ A;  1D1B A;  3LLR A;  2K79 A;  2DTO A;  2JS2 A;  1I81 A;  4M7A B;  2CS7 A;  4KGX B;  1ZUU A;  1OI1 A;  2PNI A;  2BTT A;  3RDV A;  5CO7 A;  2A28 A;  3VS3 A;  2LC4 A;  4DOV A;  1G5V A;  4TWA A;  3E19 A;  2FYK A;  3CBM A;  2R5M A;  2FPE A;  3CCU T;  4KT0 E;  3TUP A;  3LH0 A;  4LE9 A;  2YWW A;  5GAN d;  3A8O B;  3CD6 T;  1IXD A;  4A4F A;  1W6X A;  2BUD A;  1CKB A;  4J9C A;  3ZEH A;  4JZ4 A;  4QQD A;  3EHR A;  3UPU A;  1KHC A;  3VS0 A;  4EO4 A;  3M59 A;  2ALY B;  1M8M A;  2V8I A;  2LMJ A;  3HXY A;  2RI2 A;  2CP6 A;  2F5K A;  4P3N A;  3LSS A;  3EG3 A;  4YCU A;  1Z7M A;  1NJI U;  1E1O A;  2J7I A;  3V8K A;  3ER0 A;  3KUF A;  2J05 A;  1JJC A;  2C8M A;  2DVJ A;  2ED1 A;  3CCR A;  2FPD A;  2OTL A;  1R8O B;  3G71 T;  1XTD A;  5FWB A;  1EIF A;  2GBQ A;  1K73 R;  2OTL Q;  1RL2 A;  3HY1 A;  4C5I A;  4DQ2 A;  1U8R A;  2K7A A;  2RK2 A;  4ZNX A;  1RAB B;  3HRI A;  1Y0M A;  1YIT T;  1HJD A;  3V8J A;  2JXB A;  2AT1 B;  1R0B G;  3P8D A;  4C92 E;  5IHI A;  1LJO A;  3MEA A;  2DZC A;  4LDX A;  3I35 A;  1YP5 A;  4OGE A;  4ZGJ B;  3OYH A;  2GQI A;  2QTV A;  3X24 B;  2KT8 A;  2KT1 A;  2PUK B;  4C0Z A;  2IG0 A;  5LL6 S;  2QQR A;  3LX7 A;  5KYW A;  4J9B A;  1NLP C;  1LNX A;  4N0A C;  1RAG B;  4BDY A;  2EGA A;  4YCV A;  3OYG A;  1M3B A;  3QDR B;  3MO8 A;  3PTA A;  4PJO D;  1G83 A;  4KUL A;  2EFI A;  4M77 A;  7AT1 B;  4FT4 A;  3M55 A;  5GAN 8;  4YRO A;  1IGU A;  1UGR B;  1XJW B;  2L89 A;  2YT6 A;  3PFS A;  5FU6 C;  1TUC A;  4J6X A;  4DA4 A;  1LOJ A;  4E2F B;  4UP7 A;  1Q86 U;  2F2X A;  1G51 A;  3DB4 A;  4MMK A;  4QW2 A;  4YRE A;  1HK9 A;  3I56 Q;  2HL5 C;  4RTZ A;  3L2Q A;  3LWH A;  1VQO A;  2MOX A;  2EQI A;  1OOT A;  2XDD A;  3J81 E;  1JEG A;  2DXB A;  4KH1 B;  4ZGD B;  5D6Y A;  5J3B A;  1M30 A;  1U3O A;  2QYZ A;  1B7Y A;  1AZG B;  4BI4 A;  4X9C A;  4P71 A;  4K87 A;  4E7Z A;  3G6E A;  2DBM A;  2LTO A;  2ODR D;  1VQ4 Q;  2HSE B;  3G6E Q;  2ZT5 A;  3CCV Q;  1KQ1 A;  1YJN A;  3VV0 A;  2HQX A;  4BE0 A;  4OLF A;  1QVG P;  1D3B A;  3HRS A;  5C52 B;  1YIJ T;  1HYO A;  4A53 A;  2FVU A;  1N8R C;  5CAI A;  2DJZ A;  2QQB A;  4PKC C;  2FZK B;  3T9N A;  2RHZ A;  3IQL A;  1M2V B;  3GIB A;  3A8M B;  1EIY A;  3H8Z A;  4PLI A;  4JJN K;  2HZY A;  5DLQ E;  1BIB A;  3JCM d;  1QVF P;  4WJ4 A;  2OTJ Q;  2QGG A;  3PT9 A;  4DBH A;  2DL8 A;  3RUX A;  2JS0 A;  2DEU A;  2I4N A;  2ECZ A;  5KCO A;  5GMK h;  2D6F A;  4FCY A;  1MMA A;  4M78 D;  3TCJ A;  2FB7 A;  4TVY A;  4PJN A;  3A31 A;  4J7I A;  4DOW A;  5GMK j;  1AWW A;  4KR3 A;  1VQ5 A;  1YHQ T;  4RTY A;  4C0D C;  3QTC A;  3HXW A;  4RTX A;  2K2V A;  4PK4 A;  3RER A;  3UA6 A;  1MGQ A;  3C94 A;  4XQ3 A;  5GAO m;  5CKE A;  1W2B P;  4M75 B;  4JJB A;  4X34 A;  2Y4Y A;  1PYS B;  1M90 U;  1QVP A;  4FW1 A;  4LDW A;  4F14 A;  1M2V A;  4JRK A;  3JCM Q;  3RIR A;  4OGC A;  4E47 A;  4L59 A;  3CCQ A;  4XTZ A;  4IUU A;  1SG5 A;  2ZCE A;  2AMC A;  4FYY B;  2W0Z A;  1VQN A;  3CPW P;  4M7A E;  2V1R A;  4D6W A;  1I0C A;  4BY6 B;  1SPK A;  1K1Z A;  3HRT A;  3TEG A;  5GAN 5;  1BI2 A;  4FSX A;  4UC4 A;  4P5N A;  4LDU A;  5C51 B;  1MV3 A;  4FSS A;  1VQ5 T;  3QXE B;  3EFO B;  4F7U A;  4BE2 A;  1X01 A;  3Q1J A;  1MHN A;  3JV3 A;  1MUZ A;  2K3B A;  2RN8 A;  2YLB A;  3CCL Q;  5IHK A;  4YRJ A;  2DXU A;  3EG9 B;  4CH5 A;  3OMC A;  2ED0 A;  3A7R A;  3NTI A;  3OYK A;  3VQY A;  4M7D G;  1OX8 A;  3RMQ A;  2QA4 A;  1X2K A;  2P0Q A;  1NEB A;  3JCM f;  1WA7 A;  1KC8 U;  1M5Q 1;  1SF9 A;  1GCP A;  2I4M A;  3L2U A;  4YTL A;  2FRY A;  1H4Q A;  1M27 C;  5ECA A;  1VQ6 T;  1M3C A;  3JB9 F;  4C92 F;  1QCO A;  1PSF A;  3FJP A;  3H0H A;  2ART A;  5LJ5 d;  2CP3 A;  3X28 B;  1ABO A;  4PJJ A;  5LJ3 d;  2JW4 A;  3I56 A;  3HTZ A;  4CS3 A;  4PJO C;  1U06 A;  4M4Z A;  1U1S A;  3VYG A;  3CEY A;  5K1X A;  2DM1 A;  3LGF A;  2KYM A;  4MZT A;  1RAE B;  2EYZ A;  1NEG A;  5C6S A;  4M77 C;  2P5I A;  2NUZ A;  4ATO A;  2RJD A;  1M90 C;  3UH0 A;  4YPF A;  2QQA A;  4ZN1 A;  1D09 B;  2QI2 A;  4K11 A;  5FWC A;  3E9F A;  3V7S A;  4N0A A;  1G5H A;  3CCV A;  2D8H A;  3P8V A;  4UP9 A;  1VQO T;  1KC8 R;  3G71 A;  1VQ9 T;  2AKW B;  1YWO A;  2QQ9 A;  1N5Z A;  3ZBD A;  3VQX A;  3FB9 A;  4M7A C;  5C0M A;  1WHM A;  3HL8 A;  4X1V A;  3GNG A;  5DM7 R;  4CH4 A;  1TG0 A;  2DJQ A;  4H2W A;  1ZLM A;  3RKX A;  4RUG A;  1SSF A;  2AZS A;  1FX7 A;  1VQL Q;  2LZ6 B;  2ZIO A;  3M9Q A;  5IN1 A;  3J7A F;  2ZZD A;  4LN2 A;  2M0Y A;  1X6O A;  2ZGW A;  3L4G B;  1QCF A;  2KAF A;  3I55 Q;  3EG2 A;  1X6G A;  2PUO B;  1I07 A;  4YRF A;  4P72 C;  3QWY A;  5LJ3 e;  3MHX A;  1ADJ A;  1RUW A;  4PL6 A;  2MK5 A;  4QT7 A;  5GAM e;  3OYD A;  1TWB A;  1I1J A;  4RCB A;  4IKF A;  2EYY A;  1W66 A;  4XEM A;  2F5T X;  3PNW C;  1B34 B;  4OB3 B;  1R77 A;  1F1B B;  3CC7 T;  1VQ8 Q;  3VUB A;  2DPP B;  4KUD K;  1I5L A;  4AFZ C;  5KCH A;  2E6N A;  4M7D E;  1VQ9 A;  1YWP A;  3QO3 A;  4M7A D;  3M0T A;  3M0S A;  2X51 A;  4KUI A;  2EJ9 A;  1OZ3 A;  3JCM c;  3M56 A;  1WI7 A;  5GAM j;  3CQT A;  1EOV A;  2RJF A;  4H2Y A;  4PG3 A;  4PLL A;  11AS A;  3MQZ A;  1VQ8 T;  4ZTU B;  5CKD A;  2RF0 A;  1UGQ B;  2DXT A;  3NGP A;  4HVU A;  1Q7Y U;  1SHG A;  3F70 A;  3OS5 A;  4N4H A;  2QDL A;  2IY5 A;  4A63 B;  3OY9 A;  2ZPG B;  4ZTJ A;  3QO8 A;  2XGT A;  2LNH B;  1VA7 A;  4QVZ A;  3CC2 T;  4F7U G;  2KYB A;  4JLG A;  2EGE A;  2KE9 A;  1M1K R;  1WHK A;  1C6V X;  1USY C;  3JCM g;  1NYG A;  1W4S A;  3HRU A;  4WCI A;  2ZTG A;  4K86 A;  1FXX A;  2CJB A;  1MMD A;  2MYS A;  4B6M A;  3JCM X;  1JJ2 P;  3P8T A;  4ESR A;  2DIG A;  4N4G A;  2D0Q B;  4DEY A;  3EG0 A;  3H0I A;  5GAO r;  3UF4 A;  3OYA A;  2JOY A;  4BY6 C;  1A0N B;  2YUO A;  3HXV A;  2AHJ B;  2E3I A;  2X35 A;  1UJ0 A;  3RKW A;  2RHX A;  1N8R R;  1KQS A;  2EWN A;  2MMP A;  4YRN A;  2ZZG A;  3PMT A;  3C95 A;  2J6K A;  5KYW B;  5FRN A;  3ZL7 C;  2EJG A;  1WYX A;  2A36 A;  4RDX A;  5KYU A;  1W2B S;  4JLI A;  3CCE A;  1RI9 A;  1KQS S;  1YJW Q;  5A2Q E;  2EQU A;  4H02 A;  2DBK A;  1Y71 A;  2DIQ A;  3FRN A;  4G84 A;  1S1N A;  2VB6 A;  1E6G A;  1NNH A;  1NBE B;  2FZG B;  2RQW A;  3QZ9 B;  3VUZ A;  4IUQ A;  3KBG A;  4F16 A;  2VWF A;  1G8X A;  2PZ1 A;  3JCM V;  1QVF S;  4R56 A;  1B7T A;  3JCM e;  3TU4 K;  5IAY A;  2R57 A;  2L8D A;  3EAE A;  4RMF A;  3SEM A;  4BD3 A;  3BDL A;  4M7D F;  2FRW A;  4HCB A;  1H64 1;  1QLY A;  2OTJ A;  2FL7 A;  3FEO A;  3M58 A;  1OV3 A;  2WSC E;  4CC2 A;  1K0X A;  3VYH B;  5E3I A;  2DDZ A;  3ERR A;  1JJ2 A;  4RG8 A;  1UDL A;  4HKE A;  3OBY A;  1D1A A;  1JB0 E;  1RLP C;  2FG0 A;  2KRN A;  4B9W A;  1B70 B;  3CC4 Q;  3CCJ T;  2DER A;  3KXT A;  1PKT A;  1WNL A;  3HXZ A;  3CC4 A;  3SDZ A;  2PVD B;  1AWX A;  1VYV A;  2CP2 A;  2EPD A;  3EGX B;  3NTK A;  4YRQ A;  5K1P A;  1V1C A;  2RQT A;  3A8L B;  1ZHI A;  4EIK A;  1NZ9 A;  1WHG A;  2H3E B;  1QE0 A;  1H8K A;  2BIV A;  1K8A U;  3GBQ A;  3A8G B;  1ZQ1 A;  4NL3 A;  1VQM Q;  2EYQ A;  3N5B B;  2K57 A;  4PNO A;  3TEE A;  3UT1 A;  2ZT8 A;  4EMH A;  4BW9 A;  2DD5 A;  2DEQ A;  2COW A;  1YGB A;  2OI3 A;  2QAZ A;  3CC7 Q;  3RGL A;  3OW2 A;  2RB6 A;  1NJ2 A;  1IRX A;  2P84 A;  2LCS A;  4M78 B;  3CC7 A;  4FIB A;  4M75 D;  1SSH A;  1YHQ Q;  1Q81 R;  2EYX A;  5IH2 A;  4TQD A;  1QVF A;  1BU1 A;  4BUG A;  4O5V A;  2DFU A;  4J9E A;  3OYJ A;  2V8J A;  2O4X B;  2KI7 A;  4P73 A;  1WHL A;  2X3X D;  3PGG A;  4ZTF A;  3RES A;  2EYW A;  2NUP A;  2MCN A;  5D7U A;  1BB9 A;  1WU7 A;  2RI5 A;  4R0K A;  5ELO A;  1B76 A;  1SES A;  1WHH A;  1VQL T;  2QA4 Q;  3MF2 A;  5LJ5 f;  1ARK A;  2G4C A;  3L2Z A;  2A08 A;  1G2B A;  1DJ7 B;  2PVO B;  2DET A;  3NTH A;  4C8Q B;  4NS5 A;  5KYN A;  2KQW A;  2LJ0 A;  1WLE A;  2XIC A;  2Q7E A;  3UWN A;  2M16 A;  5CKF A;  4A4G A;  3FC3 A;  3QZ5 B;  3QJY A;  2QA4 T;  4YRT A;  2A37 A;  2NUT B;  3WQZ A;  3M0U A;  5LJ5 h;  3RAC A;  2E5Q A;  3C4S A;  1VQO Q;  1VQK A;  3A5Y A;  4M78 C;  2ARS A;  3HFZ A;  3EGD B;  3VQV A;  2V1Q A;  2AKL A;  2VGM A;  2MPX C;  1OU8 A;  3NHN A;  1VYU A;  3G6E T;  2JN0 A;  3VU3 C;  2LDM A;  1X75 C;  1VQ4 T;  4YRM A;  1V29 B;  3INZ A;  2XD0 A;  4JRP A;  1YFN A;  2YRC A;  3JCM W;  3HRK A;  1OPL A;  1X27 A;  5KYX B;  3CME T;  3OW2 P;  2RHS A;  2EQK A;  4BI3 A;  4XEO A;  1BBZ A;  1RAF B;  2J3L A;  1SET A;  3UAT A;  3L1A A;  3GPL A;  1SER A;  3MPU B;  2BZY A;  4HWT A;  3TVT A;  1KD1 R;  3QWX X;  1KOG A;  1Q81 U;  2CZ0 B;  4H2S A;  4AH6 A;  2LX7 A;  1NYR A;  2DA9 A;  1VQ6 Q;  1BI1 A;  1YCY A;  1K8A R;  1IZ6 A;  2RQR A;  4P3P A;  1AOJ A;  4QVC A;  4FYV B;  2VAS A;  1ADY A;  1JO8 A;  1LVK A;  3TQ7 P;  4LVI A;  2YUP A;  2CP5 A;  4HWO A;  3A5Z A;  4LNS A;  3CCU A;  3CCJ A;  3A7A A;  2HCK A;  2C0T A;  4XTY A;  3CCL T;  2HMA A;  3VQW A;  1Q82 U;  1KK7 A;  2HL3 A;  1GCQ A;  1KFZ A;  4J9D A;  1VUB A;  1X56 A;  2XU8 A;  3QYG B;  4QKU A;  3TSZ A;  4C92 A;  5KYU B;  4ZGE B;  1OQK A;  2BZ8 A;  1JJ2 S;  1VQ5 Q;  3JB9 D;  4GLM A;  3LWI A;  3MET A;  1YI2 A;  4EMK A;  1AHJ B;  2ZZE A;  1K73 C;  3REU A;  2DTH A;  2VVK A;  5KYY A;  3IKM B;  2PTK A;  2RHQ A;  2WSF E;  2J6F A;  2LNV A;  4BDZ A;  1PC0 A;  4HVW A;  4J9F A;  3QYH B;  2DQ3 A;  1KJW A;  2OAU A;  1I8F A;  2DE0 X;  5GAN 6;  3HKS A;  1CSK A;  4JRI A;  5GAN 3;  5ELN A;  1O75 A;  2HSP A;  3ZFJ A;  4YRC A;  3NET A;  2H3J A;  1ZA1 B;  3SWN C;  2JMC A;  3MP6 A;  3EG9 A;  2I4L A;  4A4H A;  2QG9 B;  3JB9 G;  2DYI A;  3SD4 A;  3MP1 A;  2H8H A;  3CME Q;  1OEB A;  6AT1 B;  3CMQ A;  4OMN A;  2COZ A;  1X2Q A;  1D0Z A;  4PJO B;  2RD1 A;  4YDQ A;  2AK5 A;  2XI9 A;  2ABL A;  8AT1 B;  3M57 A;  1N9S A;  4DBQ A;  4ZIB A;  2CZ7 B;  1UEB A;  2DF6 A;  1N8R U;  1Q81 C;  4OB1 B;  2YRD A;  1JBM A;  4P75 C;  2GTJ A;  1KD1 C;  1AD5 A;  2I2L A;  1H3H A;  1IHV A;  2DL4 A;  1U1T A;  1IO6 A;  5L8R E;  4F7U E;  3MEV A;  3VS4 A;  3R6O A;  1IL2 A;  2OJ2 A;  4EPC A;  4G85 A;  1RAD B;  2OTJ T;  2RHI A;  4ORZ A;  1C0A A;  1AZE A;  4M78 G;  1BKB A;  3CCL A;  3CXC A;  4HCZ A;  4FL6 A;  3DLM A;  1WXT A;  2X3W D;  2CJA A;  4Z88 A;  4MML A;  3CBO A;  4JUV A;  2VXF A;  3VKI A;  4PJL A;  4IUT A;  4H2X A;  2EVR A;  2OX7 A;  3OS0 A;  1PRM C;  4HXJ A;  2KXD A;  1VIE A;  1W70 A;  1X69 A;  1TH7 A;  2KRM A;  4F7U F;  1D0X A;  2AIR B;  2ZIN A;  1OU9 A;  3CC2 Q;  4P74 C;  3RR6 A;  4OP0 A;  5KYX A;  2RHS B;  4M7D A;  3OYM A;  1ACM B;  2QGF B;  4HWS A;  4FYW B;  2Z0W A;  4AFS C;  2VUB A;  1CKA A;  2D9T A;  1EFW A;  4LNP A;  2JT4 A;  3NEM A;  2QDY B;  3VRZ A;  3LSQ A;  1VYT A;  3VS5 A;  1ZSZ A;  4TVA A;  1UGV A;  1T3S A;  2CZ6 B;  2KXC A;  1M3A A;  1TUG B;  2LJ3 A;  4LVM A;  5LJ5 j;  1FMV A;  2VKN A;  2WAC A;  1EIY B;  1C1A A;  2KNB B;  1WJQ A;  1VQ4 A;  4XTX A;  3MEY A;  2E12 A;  1MND A;  3CCM A;  1VQM T;  2CT3 A;  2DKG A;  2J06 A;  2E70 A;  3RL6 A;  1ZUK A;  4AT1 B;  3E9H A;  3HY0 A;  4C8Q A; 
#chains in the Genus database with same CATH homology
 3JAM E;  3S6W A;  3VJP A;  2GFA A;  1Y96 B;  2QHS A;  1H3Z A;  2EKO A;  2F69 A;  3M53 A;  3HXX A;  1KMN A;  4RMO A;  3FIF A;  3CC4 T;  2VC8 A;  2XG8 D;  1SRY A;  1M1K U;  3A7U A;  2YHT A;  2QHT A;  3WXM B;  3UGQ A;  4M75 G;  4KR2 A;  5GAM g;  3X26 B;  3QPH A;  3I55 T;  5F5W A;  3O8V A;  3HFN A;  1QW1 A;  3JB9 J;  2L5Q A;  2XK0 A;  2DAQ A;  3SFM A;  3HFO A;  1KQ2 A;  4VUB A;  3REX A;  4H2T A;  12AS A;  2RH2 A;  3ME9 A;  1YFR A;  5GAO l;  2RJC A;  2E64 A;  4JS4 A;  2EQJ A;  2K3X A;  2CKK A;  3A8H B;  3A74 A;  1M1F A;  4J83 A;  3OYN A;  4M77 B;  5A0L A;  1JRI A;  4TTV A;  1YJW T;  1N6A A;  3JCM J;  3TEH B;  2HNI A;  2DZ9 A;  4EMK B;  4XU0 A;  4ZTZ B;  2LQK A;  2ZIM A;  3LC0 A;  5KNN A;  5I2M A;  2ZNJ A;  3P8Y A;  1G3T A;  2WSE E;  3M5A A;  4C8Q C;  4M75 C;  1NPR A;  4BB7 A;  4MZM A;  3G7Z A;  4NCX A;  3JB9 H;  1BBW A;  4J6W A;  1JJC B;  3L2V A;  1N27 A;  3H6Z A;  2ZR2 A;  4LVK A;  4BWA A;  2CYZ B;  5CVI A;  2E5A A;  1PYS A;  4C8Q F;  2MI6 A;  4A4K A;  2DTI A;  4RG2 A;  5GAO q;  4M7D C;  5CQX A;  4GLK A;  2LCL A;  4XAX B;  1O9S A;  3UFG A;  1K8A C;  3E9G A;  3I7F A;  4H2V A;  3DB3 A;  3QII A;  3WVD B;  3QUI A;  5GMK m;  3HHT B;  5FU7 B;  5CKH A;  2JTF A;  2A7Y A;  1FYF A;  2RO0 A;  1XOV A;  3CPW S;  5LJ3 g;  3PCO B;  5GMK e;  4J6Y A;  4YRK A;  3BY7 A;  1H4T A;  3PZC A;  2XHC A;  2QEX T;  2QEX A;  1NJI C;  4HWR A;  4M7A F;  2QXF A;  2XDP A;  2ZPE B;  3G4S T;  3M4Y A;  3OYI A;  4XK8 E;  2I4O A;  2E41 A;  3P8H A;  4WF2 A;  3SWN A;  3OYY A;  4C0F A;  5C53 B;  2M0O A;  1Y96 A;  3QKJ A;  1X55 A;  3GLX A;  5CKB A;  1KG1 A;  3OS2 A;  4C0G A;  3BDU A;  3RKY A;  4OB2 B;  2ZT6 A;  5GAN 4;  1E22 A;  3OYB A;  5EG2 A;  2RK1 A;  4PJO E;  3MEU A;  3CCQ T;  4EMK C;  1B8A A;  1ATI A;  3V7C A;  2CIM A;  5LJ3 h;  4C92 C;  1PSE A;  1B34 A;  3RF1 A;  3CCV T;  5A0G A;  4E7H A;  2X4Y A;  3M4Q A;  4LVJ A;  5GAN 2;  1WJS A;  2VYT A;  1YB3 A;  2KK4 A;  3HFZ B;  4Q6G A;  1VQL A;  3QJ6 A;  2GCX A;  3I56 T;  4YRL A;  4JS5 A;  5HY6 A;  3OBW A;  1QVG A;  4K88 A;  1G3W A;  4YRP A;  3L2R A;  2ZPI B;  2Q7G A;  3SB2 A;  4E7L A;  1E1T A;  3CBP A;  3JCM h;  4R55 A;  2KVQ G;  2DXC A;  5LJ5 e;  3LGL A;  1IRE B;  2QTX A;  4BAC A;  2Y4X A;  1GGM A;  4M78 A;  4MDX A;  2HQE A;  5D6X A;  3KFU A;  2ZNI A;  2DK3 A;  4M7D B;  1KD1 U;  4C5E A;  2LRQ A;  4M77 G;  4H2X B;  4LVL A;  4YYE A;  3S3O A;  3ICA A;  2OTL T;  4OF1 A;  1VIF A;  2MWO A;  2DU7 A;  2IVW A;  4CI0 C;  2Q5I A;  1W2B A;  3HPW A;  2CZ1 B;  1H4S A;  4P73 C;  4C92 G;  4ME7 A;  5I2S A;  3MEW A;  2X4X A;  3SWN B;  1X2G A;  1VQ6 A;  1BIA A;  3CPW A;  3FDR A;  2ZCF B;  2LT1 A;  4QQ6 A;  5GAN 7;  3CCM T;  4Y28 E;  2EQM A;  3BFM A;  2E3C A;  5GAM h;  2ODR C;  4HT4 A;  3GF5 A;  4HVC A;  2QQS A;  2RM4 A;  3CPF A;  2JTM A;  2E10 A;  3JCM b;  3W3S A;  2P0L A;  1Y7X A;  4CS4 A;  5A0D A;  4M75 A;  4Y91 A;  1S72 A;  3OYC A;  1S72 T;  2HAX A;  1WGS A;  4M75 F;  1WQ7 A;  2Q5H A;  2ZT7 A;  1B70 A;  2MAM A;  2MF2 A;  2DD4 A;  4YCW A;  3OSS C;  2GF7 A;  3CMA A;  4E7I A;  4UPA A;  4C8Q E;  4OVA A;  1YHQ A;  5LJ3 f;  1HC7 A;  5GAN j;  4H2U A;  4E7J A;  1OZ2 A;  2P0K A;  4BI8 B;  2EL9 A;  2VXE A;  1VQZ A;  1WJR A;  3OMG A;  1VQP A;  5I21 A;  2EAY A;  2X4J A;  2X4W A;  4L6V 5;  1Q86 C;  1BBU A;  2RHU A;  2LT4 A;  2A3L A;  2K5I A;  2GFU A;  3LW5 E;  3EFR A;  4NL2 A;  4IUR A;  4FT2 A;  2XDB A;  2K5L A;  4KQE A;  1M4Z A;  3BW1 A;  3MP8 A;  3URG A;  1BI0 A;  4ZN3 A;  1KMM A;  3E1S A;  4IUV A;  4TVR A;  2MWP A;  3V8L A;  1N9R A;  3CCS A;  3EFS A;  1K9M C;  5J39 A;  3TEH A;  4O2D A;  1EVK A;  4C8Q G;  3GOX A;  3DKM A;  3JSC A;  3OYE A;  1QP2 A;  4UP8 A;  1BYM A;  2K5F A;  5KE2 A;  1H4V B;  2VV5 A;  1K9M U;  1YJW A;  4M78 F;  1WQW A;  1WYD A;  2GQV A;  1BI3 A;  4ELZ C;  4TVW A;  1OYX A;  2ZZF A;  3OD1 A;  1FWZ A;  3E9I A;  4XU2 A;  1NJ1 A;  2Q7H A;  5CCA A;  1UB4 A;  4HWP A;  4YRG A;  3JRZ A;  4TQF A;  3M54 A;  1Q82 C;  4M77 E;  3MCA B;  4C5H A;  2CJ9 A;  3HFV A;  4M78 E;  3HP9 A;  2M9U A;  3OS1 A;  3PIO A;  4WI1 A;  4P74 A;  1KC8 C;  2HD0 A;  3NFC A;  4RQF A;  1EQR A;  4RCC A;  4M77 F;  3LYI A;  3L42 A;  4CH6 A;  1YFS A;  3P8B B;  2AMC B;  2PQW A;  1X54 A;  2PME A;  1NJ8 A;  2LQ8 A;  1YIT A;  3QBY A;  4J8O A;  2YRV A;  4CS2 A;  2DQ0 A;  1VQM A;  1VQK T;  2G3R A;  4J15 A;  2ALY A;  3NEN A;  4P72 A;  4YRI A;  4C92 D;  4P75 A;  3CCS T;  5FRO A;  4MDW A;  4LD9 K;  1HTT A;  4J7F A;  1P92 A;  5GAN h;  2P0P A;  4PHC A;  4QVD A;  4FU6 A;  5GMK i;  4JRQ A;  3AHU A;  3GNF B;  2LVM A;  5HK0 A;  4M7A A;  2KY9 A;  2YLC A;  1VQP T;  3MF1 A;  4HA8 A;  5FLX E;  4M7D D;  3OB9 A;  2E6Z A;  4CRI A;  3C12 A;  3V7R A;  4M7A G;  2O4X A;  5KE3 A;  4OB0 B;  4CH3 A;  2LCC A;  1D3B B;  3X25 B;  4E7K A;  1VQ7 T;  5GAN g;  5J26 A;  2IY5 B;  1VQN T;  2PU9 B;  1QF6 A;  1N9W A;  4L87 A;  1M1G A;  4PJO A;  3A5Z B;  3CC2 A;  5FU6 B;  3FLG A;  3HSB A;  3IKL A;  1NYQ A;  3OSV A;  5D6W A;  2NS6 A;  5CQY A;  2QHU A;  3NEL A;  3PCO A;  1Q7Y C;  1NJ6 A;  3RMS A;  3CME A;  3BJU A;  1M9S A;  4DPG A;  2C06 A;  2CGH A;  1QP3 A;  3JB9 I;  4XTV A;  4YRR A;  3CXC S;  1ASZ A;  2QHV A;  2PMF A;  2JUF A;  1I4K 1;  2RJE A;  1G5I A;  2DVE A;  3QO7 A;  2DO3 A;  2RHY A;  3GP8 A;  5GAO p;  3QHS A;  1YJ9 A;  5M9O A;  4YP0 A;  1YI2 T;  4Z02 A;  4F7U B;  4IUP A;  1YFT A;  2ZPF B;  4Q5W A;  3M4G A;  4HCC A;  2PVG B;  1WPY A;  4M75 E;  4MZP A;  1M1K C;  1M8V A;  3JCM P;  4C8Q D;  2R58 A;  5AYF A;  1RIQ A;  4EMG A;  5DY9 A;  2XKO C;  4Q15 A;  5IT9 E;  2A8E A;  1G3S A;  4RKU E;  1K73 U;  5FRM A;  4L5G A;  1X2H A;  4EX5 A;  1YBY A;  3PIP A;  3IAL A;  2RA2 A;  3OQ5 A;  2HBP A;  4P3O A;  3X20 B;  2P4T A;  5CK9 A;  5HK3 A;  1Z7N A;  1NPP A;  3OA6 A;  5HKC A;  4PJO F;  3OYL A;  1XNI A;  2JZ2 A;  2O01 E;  3I55 A;  5GAM f;  2EJF A;  4NOY A;  4J5Y A;  4TVA B;  2ZXF A;  1G3Y A;  2RI3 A;  5HGQ A;  1J5W A;  2LX9 A;  4QQG A;  2KDS A;  5LJ3 j;  4PJO G;  1VQ8 A;  1ZBX A;  1NE8 A;  3TRE A;  4P71 C;  2KMT A;  4LD6 A;  4X5O A;  1YJ9 T;  3G1Z A;  3R07 A;  4XTU A;  3DLL A;  4RQE A;  2ZR3 A;  2KSS A;  4BE1 A;  4C0D B;  1ASY A;  4A4E A;  2R5A A;  5KH6 A;  3CCR T;  2E65 A;  3QG1 A;  4X9D A;  2DU5 A;  3S3N A;  5FU7 C;  2C7I A;  4II1 A;  2EIF A;  2M1H A;  3PMI A;  2J3M A;  4FM4 B;  3CCE T;  2BKD N;  3M4P A;  1KHI A;  5DLO A;  3QSU A;  4O6J A;  4C5G A;  2VGN A;  3VBB A;  4LDY A;  4M77 D;  2V8K A;  4XU3 A;  2JNG A;  4WJ3 M;  3QNE A;  3UDC A;  5GAO n;  1UGP B;  5CIU A;  1UGS B;  5GAN f;  2FHD A;  3OYF A;  3L4G A;  3CD6 A;  1RI0 A;  3G4S A;  4GY5 A;  2XID A;  1NJ5 A;  1L0W A;  4OMF B;  1VQ7 A;  3ASK A;  2ZPH B;  3QO5 A;  4HT8 A;  4B9X A;  5GAN e;  3IG2 A;  5GAM d;  4XTW A;  4HT9 A;  4YRS A;  4ELY C;  4EDU A;  2K3Y A;  1Y07 A;  3OW2 S;  2JVV A;  4A54 A;  2RHQ B;  1LYL A;  4N4I A;  2L3R A;  4JDS A;  2AKW A;  1HXD A;  3A32 A;  3S3M A;  1EVL A;  3CMA T;  3WVE B;  3UGT A;  1E24 A;  2Y90 A;  2B8A A;  4C92 B;  1USY A;  2XTI A;  4V2S A;  4LDV A;  1QVG S;  4KBM B;  1XQH A;  2K4Y A;  1YIJ A;  2ARU A;  4E51 A;  1B7Y B;  5LJ5 g;  2NLU A;  1YJN T;  2E1H A;  5GMK l;  1GXI E;  3HXU A;  4XU1 A;  5CR2 A;  3J80 E;  3L2W A;  2ZPB B;  3DSQ A;  3LLR A;  2DTO A;  1I81 A;  4M7A B;  2CS7 A;  1OI1 A;  5CO7 A;  2LC4 A;  4DOV A;  1G5V A;  4TWA A;  3E19 A;  2FYK A;  3CBM A;  2R5M A;  3CCU T;  4KT0 E;  3TUP A;  3LH0 A;  5GAN d;  3CD6 T;  3A8O B;  4A4F A;  2BUD A;  3ZEH A;  4QQD A;  3UPU A;  1KHC A;  4EO4 A;  3M59 A;  2ALY B;  2V8I A;  3HXY A;  2RI2 A;  4P3N A;  2F5K A;  3LSS A;  4YCU A;  1Z7M A;  1NJI U;  1E1O A;  3V8K A;  3ER0 A;  3KUF A;  1JJC A;  2C8M A;  3CCR A;  2OTL A;  1R8O B;  3G71 T;  1XTD A;  1EIF A;  1RL2 A;  3HY1 A;  4C5I A;  4DQ2 A;  1U8R A;  2RK2 A;  3HRI A;  1YIT T;  3V8J A;  3P8D A;  4C92 E;  1LJO A;  3MEA A;  2DZC A;  4LDX A;  4OGE A;  4ZGJ B;  3OYH A;  3X24 B;  2PUK B;  4C0Z A;  2IG0 A;  5LL6 S;  2QQR A;  3LX7 A;  1LNX A;  4N0A C;  4BDY A;  4YCV A;  3OYG A;  3QDR B;  3MO8 A;  3PTA A;  4PJO D;  4KUL A;  2EFI A;  4M77 A;  4FT4 A;  3M55 A;  5GAN 8;  4YRO A;  1UGR B;  2L89 A;  3PFS A;  5FU6 C;  4J6X A;  4DA4 A;  1LOJ A;  4UP7 A;  1Q86 U;  1G51 A;  3DB4 A;  4MMK A;  4QW2 A;  4YRE A;  1HK9 A;  3L2Q A;  3LWH A;  1VQO A;  2XDD A;  3J81 E;  2DXB A;  4ZGD B;  5D6Y A;  5J3B A;  1B7Y A;  4BI4 A;  4X9C A;  4P71 A;  4K87 A;  3G6E A;  2LTO A;  2ODR D;  2ZT5 A;  1KQ1 A;  1YJN A;  3VV0 A;  2HQX A;  4BE0 A;  4OLF A;  1D3B A;  3HRS A;  5C52 B;  1YIJ T;  4A53 A;  2FVU A;  1N8R C;  5CAI A;  2DJZ A;  2QQB A;  4PKC C;  3T9N A;  2RHZ A;  3GIB A;  3A8M B;  1EIY A;  3H8Z A;  4PLI A;  4JJN K;  5DLQ E;  1BIB A;  3JCM d;  4WJ4 A;  3PT9 A;  3RUX A;  2I4N A;  5KCO A;  5GMK h;  2D6F A;  4M78 D;  3TCJ A;  2FB7 A;  4TVY A;  3A31 A;  4J7I A;  4DOW A;  5GMK j;  4KR3 A;  1VQ5 A;  1YHQ T;  4C0D C;  3QTC A;  3HXW A;  2K2V A;  3RER A;  1MGQ A;  3C94 A;  4XQ3 A;  5GAO m;  5CKE A;  4M75 B;  4X34 A;  2Y4Y A;  1PYS B;  1M90 U;  1QVP A;  4LDW A;  4JRK A;  3JCM Q;  3RIR A;  4OGC A;  4E47 A;  4L59 A;  3CCQ A;  4XTZ A;  4IUU A;  2ZCE A;  2AMC A;  1VQN A;  4M7A E;  4D6W A;  4BY6 B;  3HRT A;  3TEG A;  5GAN 5;  1BI2 A;  4FSX A;  4UC4 A;  4P5N A;  4LDU A;  5C51 B;  1VQ5 T;  3QXE B;  4F7U A;  4BE2 A;  1X01 A;  3Q1J A;  1MHN A;  2YLB A;  4YRJ A;  2DXU A;  4CH5 A;  3OMC A;  3A7R A;  3NTI A;  3OYK A;  3VQY A;  4M7D G;  3RMQ A;  2QA4 A;  2P0Q A;  3JCM f;  1KC8 U;  1M5Q 1;  2I4M A;  3L2U A;  4YTL A;  1H4Q A;  1VQ6 T;  3JB9 F;  4C92 F;  1PSF A;  2ART A;  3FJP A;  5LJ5 d;  3X28 B;  5LJ3 d;  3I56 A;  3HTZ A;  4CS3 A;  4PJO C;  1U1S A;  3VYG A;  3CEY A;  5K1X A;  3LGF A;  4MZT A;  5C6S A;  4M77 C;  2P5I A;  4ATO A;  2RJD A;  1M90 C;  3UH0 A;  4YPF A;  2QQA A;  4ZN1 A;  2QI2 A;  3E9F A;  3V7S A;  4N0A A;  1G5H A;  3CCV A;  3P8V A;  4UP9 A;  1VQO T;  3G71 A;  1VQ9 T;  2AKW B;  2QQ9 A;  3ZBD A;  3VQX A;  3FB9 A;  4M7A C;  5C0M A;  3HL8 A;  3GNG A;  5DM7 R;  4CH4 A;  4H2W A;  3RKX A;  1SSF A;  1FX7 A;  2ZIO A;  3M9Q A;  5IN1 A;  3J7A F;  2ZZD A;  1X6O A;  2ZGW A;  3L4G B;  2KAF A;  2PUO B;  4YRF A;  4P72 C;  5LJ3 e;  3MHX A;  1ADJ A;  4PL6 A;  5GAM e;  3OYD A;  4IKF A;  4RCB A;  1W66 A;  4XEM A;  2F5T X;  3PNW C;  1B34 B;  4OB3 B;  3CC7 T;  3VUB A;  2DPP B;  4KUD K;  1I5L A;  5KCH A;  2E6N A;  4M7D E;  1VQ9 A;  3QO3 A;  4M7A D;  4KUI A;  2EJ9 A;  1OZ3 A;  3JCM c;  3M56 A;  1EOV A;  5GAM j;  2RJF A;  4H2Y A;  4PG3 A;  4PLL A;  11AS A;  3MQZ A;  1VQ8 T;  4ZTU B;  5CKD A;  1UGQ B;  2DXT A;  1Q7Y U;  3F70 A;  3OS5 A;  4N4H A;  2IY5 A;  3OY9 A;  2ZPG B;  4ZTJ A;  3QO8 A;  2XGT A;  4QVZ A;  3CC2 T;  4F7U G;  4JLG A;  1USY C;  3JCM g;  1W4S A;  3HRU A;  2ZTG A;  4K86 A;  1FXX A;  2CJB A;  3JCM X;  3P8T A;  2DIG A;  4N4G A;  2D0Q B;  5GAO r;  3OYA A;  2JOY A;  4BY6 C;  3HXV A;  2AHJ B;  2X35 A;  3RKW A;  2RHX A;  1KQS A;  2EWN A;  2MMP A;  4YRN A;  2ZZG A;  3PMT A;  3C95 A;  5FRN A;  2EJG A;  4RDX A;  1W2B S;  4JLI A;  3CCE A;  1KQS S;  5A2Q E;  2EQU A;  4H02 A;  1Y71 A;  2DIQ A;  3FRN A;  4G84 A;  1NNH A;  3QZ9 B;  3VUZ A;  4IUQ A;  3KBG A;  3JCM V;  1QVF S;  4R56 A;  3JCM e;  3TU4 K;  5IAY A;  2R57 A;  2L8D A;  3EAE A;  4RMF A;  4BD3 A;  3BDL A;  4M7D F;  4HCB A;  1H64 1;  2OTJ A;  2FL7 A;  3FEO A;  3M58 A;  2WSC E;  5E3I A;  3VYH B;  2DDZ A;  3ERR A;  1JJ2 A;  4RG8 A;  4HKE A;  3OBY A;  1JB0 E;  1B70 B;  4B9W A;  3CCJ T;  3KXT A;  1WNL A;  3HXZ A;  3CC4 A;  3SDZ A;  2PVD B;  3NTK A;  4YRQ A;  5K1P A;  3A8L B;  1ZHI A;  1NZ9 A;  1QE0 A;  2BIV A;  1K8A U;  3A8G B;  1ZQ1 A;  4NL3 A;  2EYQ A;  3N5B B;  2K57 A;  4PNO A;  3TEE A;  3UT1 A;  2ZT8 A;  4EMH A;  4BW9 A;  2DD5 A;  2DEQ A;  1YGB A;  3RGL A;  3OW2 A;  2RB6 A;  1NJ2 A;  4M78 B;  3CC7 A;  4FIB A;  4M75 D;  4TQD A;  1QVF A;  4BUG A;  4O5V A;  3OYJ A;  2V8J A;  2O4X B;  4P73 A;  3PGG A;  4ZTF A;  3RES A;  1WU7 A;  2RI5 A;  5ELO A;  1B76 A;  1SES A;  1VQL T;  3MF2 A;  5LJ5 f;  2G4C A;  3L2Z A;  1DJ7 B;  2PVO B;  3NTH A;  4C8Q B;  4NS5 A;  2KQW A;  1WLE A;  2XIC A;  2Q7E A;  3UWN A;  2M16 A;  5CKF A;  4A4G A;  3FC3 A;  3QZ5 B;  3QJY A;  2QA4 T;  4YRT A;  3WQZ A;  5LJ5 h;  3RAC A;  2E5Q A;  3C4S A;  1VQK A;  3A5Y A;  4M78 C;  2ARS A;  3HFZ A;  3VQV A;  2VGM A;  3G6E T;  2JN0 A;  3VU3 C;  2LDM A;  1X75 C;  1VQ4 T;  4YRM A;  1V29 B;  3INZ A;  2XD0 A;  4JRP A;  3HRK A;  3JCM W;  2RHS A;  3CME T;  4XEO A;  2EQK A;  4BI3 A;  2J3L A;  1SET A;  3L1A A;  3GPL A;  1SER A;  4HWT A;  1KOG A;  1Q81 U;  2CZ0 B;  4H2S A;  4AH6 A;  1NYR A;  1BI1 A;  1YCY A;  1IZ6 A;  4P3P A;  4QVC A;  1ADY A;  4LVI A;  4LNS A;  3A5Z A;  4HWO A;  3CCU A;  3CCJ A;  3A7A A;  4XTY A;  3CCL T;  3VQW A;  1Q82 U;  1VUB A;  1X56 A;  2XU8 A;  3QYG B;  4C92 A;  4ZGE B;  1JJ2 S;  3JB9 D;  3LWI A;  3MET A;  1YI2 A;  4EMK A;  1AHJ B;  2ZZE A;  1K73 C;  3REU A;  2DTH A;  3IKM B;  2RHQ A;  2WSF E;  2LNV A;  4BDZ A;  3QYH B;  2DQ3 A;  2OAU A;  1I8F A;  5GAN 6;  3HKS A;  4JRI A;  5GAN 3;  5ELN A;  1O75 A;  3ZFJ A;  4YRC A;  3NET A;  2H3J A;  3SWN C;  3MP6 A;  2I4L A;  4A4H A;  3JB9 G;  3SD4 A;  3MP1 A;  3CMQ A;  4PJO B;  2RD1 A;  4YDQ A;  2XI9 A;  3M57 A;  1N9S A;  4ZIB A;  2CZ7 B;  1UEB A;  1N8R U;  1Q81 C;  4OB1 B;  1JBM A;  4P75 C;  1KD1 C;  2I2L A;  1U1T A;  5L8R E;  4F7U E;  3MEV A;  3R6O A;  1IL2 A;  4G85 A;  4EPC A;  2OTJ T;  2RHI A;  1C0A A;  4M78 G;  1BKB A;  3CCL A;  3CXC A;  4HCZ A;  4FL6 A;  3DLM A;  2CJA A;  4MML A;  3CBO A;  4JUV A;  2VXF A;  3VKI A;  4IUT A;  4H2X A;  3OS0 A;  1VIE A;  1TH7 A;  4F7U F;  2ZIN A;  4P74 C;  4OP0 A;  2RHS B;  4M7D A;  3OYM A;  4HWS A;  2VUB A;  2D9T A;  1EFW A;  3NEM A;  2QDY B;  3LSQ A;  4TVA A;  2CZ6 B;  4LVM A;  5LJ5 j;  2WAC A;  1EIY B;  1WJQ A;  1VQ4 A;  4XTX A;  3MEY A;  2E12 A;  3CCM A;  1VQM T;  2DKG A;  2E70 A;  3RL6 A;  3E9H A;  3HY0 A;  4C8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...