2E41A

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with the reaction product analog biotinol-5'-amp, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e41A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e41A01
2ZT8A 1YFRA 4J15A 1NJ1A 4H2TA 3V7SA 4M75G 2ZR2A 4HT9A 11ASA 4C92D 4HWTA 3HXUA 2ZZFA 3QO3A 4F7UF 2QHSA 3JB9G 1Z7NA 2G4CA 4XU2A 1Z7MA 3HY1A 3P8YA 1H4QA 3RGLA 1NNHA 4V2SA 4KQEA 4YRLA 1BBUA 4M77B 3A74A 4BW9A 2RHQB 4RDXA 3QO7A 4X9CA 1ASZA 4TQDA 2ZZEA 2QHTA 3NENA 1GGMA 3CMQA 2AKWA 4M77A 5GMKl 2K57A 4F7UB 5GANf 2ARSA 2RHQA 3VQWA 4AH6A 1KQ1A 1H641 1C0AA 5GAN6 3HY0A 1I4K1 3JCMJ 1N9WA 2J3MA 3QTCA 4XTYA 4F7UA 4DQ2A 1NJ2A 2E64A 4M78F 3MF2A 4ZTUB 2I4NA 4M77G 1WU7A 1N9RA 1X01A 3BY7A 2YHTA 1WYDA 4TVAA 4M7DD 2RD1A 1NYRA 5ELNA 4F7UG 3EFRA 3IALA 1J5WA 2YLCA 4H2SA 3OD1A 5LJ5g 3HFOA 4M7AF 2ALYB 4H02A 1WLEA 2ZT6A 3JB9J 4J5YA 5LJ3e 3RKXA 5GAMe 2ZCEA 4CH4A 4M78B 3QO5A 1Y96B 2VXEA 5ELOA 4YRNA 3RIRA 4JRKA 4XTZA 4C92E 1G5IA 4YRIA 5C52B 1EVLA 4N0AA 2ALYA 4EX5A 3P8TA 4P73A 5KNNA 3JCMc 2E65A 1BIAA 2ZIMA 4M78A 5DY9A 2ZIOA 3M4PA 3EFSA 3TUPA 4HA8A 3HFNA 4UP9A 4EMKB 3JB9I 1WQWA 4Q6GA 2C7IA 3BW1A 1USYC 4G85A 4L87A 4C92C 4C8QG 5GMKh 4CH6A 4M7AB 1EIYB 3RERA 1E24A 4EMKA 1JBMA 5GMKj 4M75C 4XTVA 3RUXA 2EJFA 4C8QD 4YRKA 1X54A 4M78G 4M7AA 3A32A 4TQFA 4MMLA 4NL2A 4RCCA 4DPGA 2DQ3A 4OLFA 2DDZA 1SESA 4YRCA 4HWSA 2DKGA 1I5LA 3LC0A 3SWNB 4UP7A 1G5HA 1E22A 3BDUA 4YRGA 4YRPA 3UGQA 4P72A 3SWNA 2DU5A 1X2GA 4P71A 4EO4A 5CAIA 4A54A 4YCUA 3A5YA 2QHUA 2FB7A 2YLBA 2VC8A 5GAMg 4M7DE 5GANe 3QHSA 1IL2A 1QF6A 4TTVA 2I4OA 3PCOB 3RKYA 1VQZA 2ZINA 4YCWA 2IY5B 5HGQA 3FB9A 4MMKA 3LSQA 3HRKA 4ZIBA 4M75D 4M7DC 1B7YB 2J3LA 2PMFA 3PCOA 3JCMg 4P75C 5F5WA 4M77C 5GAOq 2IY5A 4P3NA 4PJOG 3JB9D 3IG2A 4YREA 2E41A 2AKWB 2ZR3A 4H2XB 2Q7EA 4H2WA 1X2HA 1B7YA 4P3PA 1W66A 1E1TA 4NL3A 5LJ5d 5K1XA 4RQEA 1B70B 4HWRA 2QTXA 5GAOp 4PJOD 1I8FA 3P8VA 4H2XA 4K86A 5GAN2 2EJ9A 2C8MA 1HTTA 1JJCA 3V7RA 1B70A 4QVCA 2RM4A 4RMFA 3ERRA 1X56A 2EJGA 3JCMV 4C8QE 1LNXA 2Q7HA 2DTIA 4P74C 4TVAB 1SRYA 4YRFA 3L1AA 5LJ5h 4RCBA 2CJBA 1WQ7A 3QO8A 3RL6A 5LJ5j 1WPYA 4XEMA 4C8QC 4YRJA 4PHCA 3NELA 4JLIA 1B34B 4K88A 3VQVA 4UPAA 4M77D 2ARTA 4YRMA 2ZNJA 4N0AC 3JCMX 5LJ5f 2XTIA 4WJ4A 5I21A 1B34A 4J6WA 4HVCA 4Q15A 1YGBA 3V8JA 2CJ9A 1BIBA 1LOJA 3A7AA 1RIQA 1JRIA 4XQ3A 4TWAA 4YCVA 3IKLA 2CJAA 4XEOA 3GIBA 4UP8A 4M75E 4X5OA 1YFTA 2Y90A 2CIMA 3L4GB 3REUA 1N9SA 4C92F 1B76A 4O2DA 2Q7GA 1SETA 3JCMb 2DQ0A 3RACA 4J6XA 4XU0A 2DZCA 2ODRD 2I2LA 4Y91A 4WI1A 4M75F 4PJOE 3L4GA 4JRIA 1NJ8A 2PMEA 2RB6A 2HNIA 2CGHA 3TEHB 3HSBA 4EMGA 3JCMQ 3SWNC 3JCMd 4OP0A 1ADYA 1G51A 2ZT5A 3M4QA 3JB9F 4TVWA 4PG3A 5GAMh 3PZCA 3VQXA 1HK9A 5GAN8 3V8KA 2ARUA 4M78D 2E5AA 4PJOC 4TVYA 3TEHA 3RF1A 4EMHA 4KR3A 5GAMj 2E10A 4C92B 3VBBA 2I4LA 3MF1A 5GAOm 4PNOA 3HXWA 4X9DA 3HFVA 4M7AG 3FJPA 1B8AA 1USYA 4C92A 5LJ3g 1L0WA 3JCMh 1WNLA 4XU1A 1EFWA 1KMNA 4M7AD 1LJOA 3JB9H 2ZTGA 4M77E 3G1ZA 2ZNIA 5GMKi 3RKWA 1D3BA 2DVEA 1KQ2A 5GAOr 1ATIA 4QVDA 2DU7A 1NJ6A 4F7UE 4M7DF 1EQRA 4C92G 1HC7A 4CS4A 3JCMf 1X55A 2P0LA 2Q5IA 4ZTZB 5E3IA 5GAN4 3MEYA 4CH3A 4BWAA 1JJCB 1KMMA 3HXYA 4KR2A 1EOVA 3A5ZA 1HXDA 3W3SA 4YDQA 1U1TA 3A7RA 1YCYA 4XTWA 4YROA 2XGTA 5LJ5e 1E1OA 4HT8A 2ZZGA 3VQYA 5GANh 4YRQA 1NYQA 1EVKA 4M7DB 2ZXFA 2RHSB 4A53A 4CS2A 5GANj 3IKMB 4CS3A 3JCMP 4LNSA 3HFZB 4M7DA 1PYSB 2RHSA 3REXA 3KFUA 3ICAA 2ODRC 4P75A 4YRSA 5GANg 4XTUA 3A7UA 4M78E 2DXUA 4C8QF 3V7CA 3V8LA 3HFZA 1BBWA 3HTZA 1PYSA 3NEMA 3FIFA 3DSQA 3L2ZA 4YRTA 2E3CA 3LSSA 4P73C 4RQFA 2DTHA 5GAN7 4M78C 4M7DG 4WF2A 3E9HA 1ASYA 1YFSA 1YB3A 3HXXA 3VU3C 3I7FA 4XTXA 4M7AE 4H2UA 5GMKm 4JUVA 5GMKe 2DZ9A 5GAN5 1M5Q1 3AHUA 12ASA 2RA2A 4EMKC 3HXZA 4K87A 1KOGA 4C8QB 2DJZA 4P74A 3RESA 3INZA 3WQZA 2DTOA 5LJ3d 5GAMd 4HWPA 4M7AC 5K1PA 1LYLA 3TEGA 2AMCB 1FYFA 4C8QA 1U1SA 2E1HA 2DXTA 4CH5A 5C53B 2EWNA 1H4VB 2EAYA 3UFGA 5GAOl 2AMCA 4H2YA 1SERA 2EL9A 4P72C 1Y96A 4P71C 3E9IA 3UH0A 3SB2A 4YYEA 2VXFA 4NOYA 5LJ3h 4H2VA 2FYKA 1M8VA 2JN0A 1QE0A 3JCMe 5LJ3j 4WJ3M 4PJOF 3R07A 4XU3A 3HRIA 1H4TA 2QHVA 1H4SA 2ZT7A 2DEQA 4M75B 3NETA 1EIYA 3QUIA 1D3BB 3HXVA 5LJ3f 3M4GA 5GAMf 5GAN3 4G84A 4P3OA 1TH7A 4YPFA 3UGTA 4HWOA 2I4MA 4YRRA 2Q5HA 5GAOn 2ZGWA 4M75A 3BJUA 4NCXA 3BFMA 1MGQA 3PGGA 1ADJA 4E51A 5C51B 4PJOB 3QSUA 3A31A 5GANd 3QNEA 3JCMW 1I81A 1NJ5A 4J6YA 2P5IA 4YP0A 4M77F 4PJOA
chains in the Genus database with same CATH superfamily
3LH5A 2F2WA 4PLIA 1YFRA 1MNDA 4RTZA 4H2TA 4M75G 4HT9A 11ASA 3HXUA 2ZZFA 1PWTA 3QO3A 2RF0A 1AVZC 1A0NB 1U06A 1YWPA 1Z7NA 2G4CA 1AD5A 3J81E 1D1AA 2KT8A 3RGLA 3VS4A 1M4ZA 3I56A 3VYHB 1YI2T 3A1PA 2DL3A 4M77B 3A74A 4BW9A 1U3OA 2RHQB 4X9CA 1ASZA 3CCRA 2QQAA 3VS6A 2GTOA 2ECZA 1WHMA 3NENA 3CMQA 4M77A 1WJQA 5GMKl 3H0FA 2RHQA 2ARSA 4AH6A 1C0AA 2RK1A 2CUBA 2YUNA 1I4K1 4B6MA 4RTYA 1SSHA 4PJMA 3TVTA 1N9WA 3QTCA 1X75C 3KUFA 2IVWA 2COWA 3MF2A 2K4YA 4X34A 2RHIA 4L5GA 2YHTA 1YJNT 3A98A 1VQLT 3G4SA 3CD6Q 2RD1A 2KVQG 4HVVA 3ZBDA 1E6HA 1QCNA 4IKFA 3CCQQ 3CQTA 1S72A 4J7IA 1IREB 1J5WA 3OD1A 1TWBA 3HRSA 2NUTB 3CXCP 4J9EA 2EGCA 3RMQA 4II1A 3IQLA 1K73R 5FLXE 3RIRA 4XTZA 2LJ0A 4N0AA 2OTLA 2H3JA 4P73A 1RUWA 1GCPA 1SHGA 3OYAA 2ZIMA 2COYA 2ZIOA 1BCOA 1VYUA 3TUPA 3GBQA 4UP9A 3ER0A 3CMEQ 5GMKh 5IXBA 4Z88A 4LD6A 4ELYC 2L3SA 1EIYB 3OBWA 3VUZA 1SSFA 2JTFA 2WACA 3RUXA 1UGSB 3DKMA 1QCFA 4C8QD 4YRKA 1GXIE 3OW2P 4FT2A 4MMLA 3MEVA 4RCCA 1NLOC 2ZPIB 3FC3A 1J3TA 3QYHB 4HWSA 2DKGA 2IG0A 3OSSC 3OMCA 2WSEE 2MAMA 3BDUA 4RTWA 4YRGA 2K79A 2FRYA 4P72A 2DU5A 1KD1C 4P71A 2JT4A 4J83A 1VQ6A 2X51A 1M1FA 5KYYB 1BK2A 2QHUA 1EX4A 4GLMA 5DLOA 1M2VA 4M7DE 5GANe 2OAWA 1T0HA 2BZYA 4F17A 1IL2A 1YJWQ 2A0FB 1QF6A 5AT1B 1JJ2A 1RAEB 4RUGA 2DL7A 2KEAA 4X1VA 3RKYA 2JNGA 2MMPA 2ZINA 4YCWA 3FB9A 1HJDA 1OEBA 4MMKA 3HRKA 1AT1B 4M75D 5CKHA 2MCNA 3CCSQ 1K9MR 1VIFA 1NEBA 4P3NA 3OYBA 4CRIA 1VQNT 2V1RA 1X2HA 1MMNA 2E6ZA 1W66A 2QTXA 2F2XA 3OYNA 3OYEA 3M59A 4PJOD 3J80E 1NPPA 2RQVA 3CC4T 2EJ9A 2C8MA 1HTTA 3V7RA 4BDYA 4OMNA 2YRDA 2HMAA 1X56A 1QKWA 1W2BA 1G3TA 4PFOA 1LNXA 2DBKA 4TVAB 1Y0MA 3OS2A 4YRFA 1WQ7A 3GOXA 1WHGA 3QO8A 4C0FA 3CCET 5LJ5j 4C8QC 3OMGA 4YTLA 1TOVA 3VYGA 4JLIA 4K88A 2CP0A 3VQVA 3S3MA 3RDVA 1PD1A 4YRMA 3CD6A 2ROLA 2ZNJA 2QG9B 1MUZA 4Y92A 3CCQA 4WJ4A 1AWXA 4J6WA 1JJ2P 4R0KA 4LVJA 3E9FA 1M1KU 4LDWA 4Q15A 1YGBA 1LCKA 2KMTA 1BIBA 2LQKA 2YXYA 1N5ZA 4AT1B 2K2MA 3IKLA 1O75A 4HT4A 2CJAA 1VQ8Q 2CZ6B 1KG1A 1IRXA 3LWIA 1YHQQ 4X5OA 3OB9A 1V76A 3SD4A 3VS5A 2HKQB 2AT1B 3SEMA 3CCLQ 2EBPA 3Q1JA 2Q7GA 2CT4A 3JCMb 3CMEA 2PUOB 2O31A 1RI9A 4XU0A 2DZCA 2ODRD 4Y91A 4UC4A 4WI1A 1SF9A 4F14A 1NJ8A 4LD9K 2RB6A 2HNIA 2CGHA 2QK0A 2EFIA 3SWNC 3JCMd 2ZT5A 1Q81C 2AIRB 3M4QA 3VS0A 4M4ZA 1ZSGA 2JM8A 4K11A 4IUTA 2ZPFB 1K1ZA 4PJOC 1VQMT 2V8IA 2I4LA 3MF1A 4PNOA 3CC7Q 1YJ9T 1ZX6A 2HQEA 3UDCA 2PVOB 4XAXB 3PE0A 5LJ3g 2KT1A 1QVFA 2NS6A 2C0OA 3S3NA 1EFWA 2O4XA 1LJOA 3EG9B 3H6ZA 5GMKi 3RKWA 1SHFA 4FYWB 1XTDA 1YJWA 1D3BA 1XJWB 5FRMA 2LJ3A 1TSFA 2FEIA 1N6AA 3WXMB 3EG1A 3EG9A 4CS4A 4KT0E 4BE1A 3JCMf 2P0LA 1KD1R 1WYXA 3CCSA 1C1AA 3REBB 4OB2B 1VQ9T 1JJCB 4MDXA 4OMQA 1YIJQ 1PKSA 5IN1A 3W3SA 1U1TA 4D8DA 1X6GA 5CQXA 4F04B 2CH4A 2FPFA 1E1OA 3GPLA 3QJYA 4LXCA 5GANh 4YRQA 4KRTA 4HXJA 2E5KA 1X43A 3UF4A 3HTRA 3NHNA 2X4JA 1YP5A 4CS2A 3IKMB 2K5LA 1QVGS 1G3YA 2FPEA 3CMAQ 2DF6A 1PYSB 3REXA 4FSXA 1HYOA 2QQSA 2ODRC 1IHWA 4D6WA 1UB4A 3EHQA 2DRKA 3HTZA 1M3AA 1PYSA 4J9BA 2DX1A 3M58A 3I55T 4E6RA 4BY6C 2VWFA 3CBPA 2KNBB 4RQFA 4AFQC 3OQ5A 3NTHA 3X28B 3OSVA 1YFSA 4QQ6A 2DIQA 1RI0A 1X6OA 3FRNA 3PVQA 4XTXA 3VU3C 4M7AE 5GMKm 3NFCA 2MOXA 5GAN5 3QG1A 3AHUA 3OS5A 4C8QB 3P8BB 4BI8B 2RO0A 3WVEB 1G3SA 3WQZA 1VQ8A 1VQ7T 1X2QA 3OA6A 1YHQA 4F16A 2AMCB 2OI3A 4C8QA 2HL3A 1U1SA 2E1HA 4OVAA 3I9QA 2F5TX 2EWNA 3M53A 4QQGA 3CCLA 3UFGA 3LGLA 5GAOl 3ME9A 2R5AA 2AMCA 1BCMA 3A8HB 1WHLA 4FYYB 3I56T 1ARKA 5CKDA 3MPUB 1K9AA 1BI0A 4YYEA 5LJ3h 2QTVA 2RI5A 2D0NA 1PSFA 3CCRT 3VUBA 3CCMT 4ZTFA 4FM4B 3CPWA 3VS2A 4MZPA 2JW4A 4EPCA 3EGXB 3OYFA 4XU3A 4KGXB 5L8RE 1H4SA 2M9UA 1UGVA 4R55A 4FW2A 4M75B 3CC7A 3QUIA 2CT3A 3M4GA 3EGXA 2CZ0B 4YPFA 2AZSA 1KSWA 2H3EB 1U5SA 1Q81R 2DK3A 3QZ5B 4M75A 2KXCA 4PKCC 3M54A 1RACB 1BKBA 1QCOA 3H0HA 4PJOB 2JS0A 3T9NA 3A31A 2R58A 5GANd 3QNEA 1OX9A 1K76A 1NJ5A 4J6YA 3HL8A 3OBYA 1FX7A 2IIMA 2VV5A 4PJOA 1MMGA 2EQIA 1NJ1A 2KYBA 3MKDA 3V7SA 1OPKA 1VQPQ 2ZR2A 2JZ2A 3FDRA 1VQ5Q 4AFUC 2P84A 3HPWA 4F7UF 1YIJA 3M0SA 4EDUA 1LVKA 1Z7MA 1VIEA 1OYXA 2PU9B 3G7ZA 1RAGB 4YRLA 4N4HA 3HRTA 4BI4A 4RDXA 2VGNA 3H8ZA 4TQDA 1MNEA 3L42A 2AKWA 3CMAA 2ZPBB 4RG2A 3FJ5A 2XI9A 5GANf 1H641 1D0XA 1ZA2B 4AFZC 2BIVA 2DXCA 3JCMJ 1SRLA 5CO7A 4L59A 2ZAEA 2EPDA 2EYWA 5HK0A 1JXMA 4E7JA 1W70A 5FU7B 2X4YA 2K3BA 3RBBB 4M78F 4R56A 1WIEA 3LWHA 2F1LA 2QASA 1WU7A 1N9RA 1X01A 3BY7A 4LVMA 2VGMA 4MZMA 1SRMA 5KYUB 2LRQA 5KE2A 3CCJQ 1ABOA 3VS3A 1UFFA 1Z9ZA 1KQSP 2J05A 5D6WA 4F7UG 1AOJA 3JRZA 4JPBW 5KYUA 2E4HA 4C0DC 4H2SA 2YLCA 4KULA 1NJIU 1DJ7B 1P92A 2NUPA 2CYZB 2MWPA 3N5BB 3JB9J 1V29B 4J5YA 1Y96B 2VXEA 5ELOA 4E7KA 2COZA 4JRKA 4C92E 4E7IA 2FL7A 2D9TA 4XK8E 3P8TA 2E65A 1BIAA 3M4PA 4Q6GA 1TU0B 1UGQB 2DD4A 3BW1A 4B9XA 1W1FA 4L87A 3LH0A 4C8QG 3OYHA 3CCVT 4AMCA 1QVPA 4DBRA 5CKFA 1VOMA 3BDLA 1FMKA 2CP6A 3RERA 5GJVB 1JBMA 5GMKj 4XTVA 2DLPA 2JS2A 4C5GA 4M78G 1GBQA 4DPGA 2PNIA 4L6V5 2QQRA 3P8DA 2O9VA 3C94A 1I5LA 2YRCA 3OYCA 1FMVA 4DEXA 1G5HA 1OZ3A 2D8HA 1E22A 2I0NA 1ZBXA 5IHKA 3A8LB 4EO4A 5CAIA 1XQHA 4A54A 2P0KA 4YCUA 2MI6A 3A5YA 2YUPA 2VC8A 1IGUA 2VYTA 2EQUA 3QHSA 1UTIA 2RHXA 2RJEA 4E7ZA 5D6YA 3CXCA 4O6JA 3UWNA 1MV3A 1VYTA 5ECAA 1VQPA 4FW1A 1VQ5A 2QDYB 4ZIBA 1B7YB 2PMFA 2RQUA 3M56A 3JCMg 5GAOq 3PFSA 1K8AR 2KQWA 4PJOG 2LCSA 2CSQA 5FRNA 3TCJA 4PL6A 3PVLA 3R6NA 1B7YA 3ZL7C 1E1TA 5K1XA 4HWRA 5EG2A 5KH6A 2FPDA 2O9SA 2GFUA 4CC7A 2PZ1A 3I5RA 3LGFA 4ANJA 3GF5A 1TUCA 1Q82U 3OW2A 2RM4A 4RMFA 1M3BA 2IPOB 2LCLA 2QA4Q 2JTMA 4DBHA 3VRYA 2EVRA 2KAFA 3JCMV 2KSSA 2DTIA 3I35A 4P74C 2DE0X 2RQTA 2CJBA 1QVGP 3X20B 2HZYA 5KCHA 2O88A 3RL6A 1WPYA 3L2UA 1YFNA 2KI7A 1TUDA 2DL8A 3EAEA 3CCJA 1OU9A 2E3IA 1I1JA 2A3LA 4J9CA 5D6XA 3C0CA 3JCMX 3KXTA 5J39A 2CZ7B 2LVMA 4E47A 2VVKA 4HVCA 2CP2A 3FEOA 5CQYA 1WA7A 3BE3A 2HDAA 4A4GA 1JRIA 4XQ3A 1TXQA 1B3QA 2DNUA 3PMIA 4OMFB 4XEOA 2MIOA 3A8MB 1K4US 2A7YA 2LT4A 3L4GB 3REUA 2HBWA 4JZ3A 4C0DB 4QVZA 1IGQA 1ZBJA 2DQ0A 3RACA 4J6XA 1K9MU 3C12A 1F1BB 3L4GA 2JXBA 1M90U 2PMEA 4KH0B 3TEHB 3EG3A 2QAZA 3JB9F 1NZ9A 4KBMB 4IURA 1C6VX 1HK9A 4HVUA 5C6SA 2RPNA 4M78D 2E5AA 3TEHA 2EW3A 4GY5A 2AZVA 2JTEA 4PK4A 4ZGJB 1T0JA 1FWZA 1M2VB 1ZQ1A 5GAOm 1QLYA 3HXWA 1EZZB 2EKHA 4X9DA 4JS4A 1WXBA 1WFWA 2ED1A 3JCMh 1WHHA 4Q5WA 2OTJQ 5M9OA 1GBRA 1MMAA 1QP3A 3JB9H 2QGFB 4M77E 3H9NA 2HBPA 2HSPA 1ATIA 5GAOr 1YJNQ 3UA7A 1VQLQ 4QVDA 2R57A 1ACMB 2KY9A 1NYGA 4M7DF 2RQRA 1M2OA 2FZKB 2Q5IA 2EQKA 5E3IA 1NYFA 2X3XD 2EQJA 5GAN4 2RJDA 3MEYA 4BWAA 5L23A 1R0CB 1N27A 2RJFA 4KR2A 3A5ZA 5CK9A 3CCLT 4YDQA 4OB3B 2HCKA 4YROA 4ZGDB 2C0TA 1HD3A 5FWBA 5LJ5e 2L8DA 2XGTA 3VQYA 3OYDA 3M55A 5CR2A 4CC3A 5DM7R 1KFZA 4Z8AA 5GANj 2QA4A 3CPWS 3X25B 4WCIA 2XD0A 2L89A 3KFUA 3ICAA 2ZPEB 4YRSA 2EGAA 2CS7A 5GANg 4XTUA 2DXUA 2FRWA 3V8LA 4FT4A 1BBWA 1NBEB 3NEMA 4LVIA 4J9GA 2L3RA 1JQQA 3R6OA 3URGA 1VQOQ 5IHIA 1VQ4Q 3GNFB 5GAN7 2RMOA 4M78C 4M7DG 3E9HA 1ASYA 2LNHB 2LT1A 1ZUYA 1YB3A 3E2UA 3I7FA 2M1HA 3E1SA 1O9SA 4BDZA 3JAME 1KHIA 4DOWA 2KE9A 2RA2A 4EMKC 3HXZA 4K87A 1QWFA 4P74A 2DTOA 2V26A 1Q86C 2GFAA 4HWPA 2K3YA 3QKJA 4QKUA 3A8GB 2JOYA 3OYYA 2DXTA 2HSEB 1YIJT 1I5OB 1H4VB 1G8XA 2AHJB 5KYXB 1WLPB 2DMOA 4H2YA 1X69A 2RHZA 5GJWB 2CSIA 4E2FB 3E9IA 2B8AA 1VQNQ 3UH0A 3D7SB 5KYXA 3ASKA 2FYKA 1YITQ 5LJ3j 4WJ3M 2AKKA 4OF1A 3CC4Q 3CMAT 5CKEA 2QXFA 3THKA 2O4XB 4LDXA 2LP5A 1D3BB 1ABQA 4QT7A 2KRNA 4FYVB 5GAN3 2ESWA 1TH7A 4JLGA 4HWOA 3OYGA 4P5NA 5HY6A 2OTJA 4NCXA 3CCEQ 2C06A 3PGGA 2RHUA 1AWWA 3TU4K 1M1KR 4E51A 3O5ZA 2RI2A 3QSUA 3PTAA 2A08A 1WXTA 4RMOA 3JCMW 1VQLA 2QDLA 4YP0A 3CEYA 2GTJA 2J06A 2QGGA 2K7AA 3ZFJA 2DJQA 4JJNK 4J15A 1AEYA 1K0XA 4LUEA 3QPHA 1UGPB 3MHXA 1YBYA 1WJSA 1E6GA 4JDSA 1AWOA 4XU2A 3HY1A 3X24B 2XHCA 2YUQA 4KQEA 3DB4A 1D1CA 4OMMA 5I2MA 1Q7YU 3QO7A 3UPUA 4C5EA 1BYMA 5C0MA 5IXFA 3UA6A 4C0GA 1KC8U 2NUZA 5A2QE 1GGMA 2HKNA 2WSCE 4LVLA 5I22A 2MF2A 2K57A 4F7UB 2M0OA 4ELZC 5GAN6 3CCUT 3L2VA 1U8RA 2MPXC 1VQKT 3H41A 1BI2A 2J7IA 4J9FA 4F7UA 4DQ2A 4LUDA 1VQMQ 2E64A 4FIBA 1VQOA 1BI3A 3VRZA 3HKSA 2ABLA 1VQ4A 2RJCA 2PQWA 2K6DA 4ZTUB 3M0PA 3META 2ZPHB 1AZEA 1M8MA 1YJ9Q 3OYIA 1WYDA 4M7DD 1BU1A 1VA7A 1NYRA 1KK7A 2NYSA 5ELNA 3EFRA 2CZ1B 3IALA 3MEAA 1WX6A 4Y28E 3HFOA 4M7AF 2ALYB 4DBFA 4H02A 1VQPT 1WLEA 2LCCA 1VQ5T 2KBTA 3RKXA 5GAMe 4CH4A 4M78B 3QO5A 3PIOA 1G5IA 3MO8A 4YRIA 1EVLA 2ALYA 1XOVA 2KRMA 2GNCA 1WGSA 4M78A 3EFSA 4HA8A 3HFNA 4EMKB 1WQWA 2MK5A 2LQWA 2DM1A 4G85A 2JVVA 1VQNA 2DXBA 2LX7A 3QBYA 1Q86R 4CH6A 1UE9A 1E24A 2DL4A 4EMKA 1YITA 1TS9A 3UT1A 2V8JA 5FU6C 3MJXA 3CC4A 1QW1A 3L2RA 1QP2A 1RL2A 3MP1A 2DQ3A 4OLFA 2DDZA 9ATCB 1SESA 3LC0A 1UHCA 3SWNB 2LQNA 4A63B 4PLLA 2X9HA 5IHNA 1N8RC 2XDDA 4FSSA 2LTOA 3PMTA 3HRUA 3QWXX 2RNAA 3H0IA 1K8AC 3SWNA 3G4ST 4DA4A 1X2GA 2DETA 1KQSA 3CCJT 3I55Q 2ENMA 1S72T 2YLBA 3EGUA 5GAMg 1AHJB 3A8OB 4OGCA 2J6FA 4TTVA 3DLMA 2V1QA 1VQZA 2IY5B 4OGEA 5HGQA 2KRSA 4EIKA 5IH2A 4M7DC 2OTLT 4LNPA 1R77A 4P75C 2IY5A 4M77C 1VQ7Q 4YREA 2P0QA 5KYNA 2E41A 2AKWB 2ZR3A 4H2XB 2Q7EA 5CKBA 1S1NA 1RLPC 4DEYA 4P3PA 5LJ5d 3MP8A 3TEEA 2E5QA 1B70B 4RQEA 2DEUA 1NE8A 5GAOp 2D6FA 1I8FA 3GLXA 3DLLA 3P8VA 4H2XA 1RAHB 2XU8A 5GAN2 2JMCA 3VV0A 1H92A 4QVCA 1B70A 3ERRA 2E12A 4NS5A 2F5KA 3VKIA 4C8QE 4DOVA 3GNGA 2Q7HA 1RADB 3CCMQ 1Y7XA 2D1XA 5KCOA 2E3HA 3G71Q 1VQMA 2QI2A 4KGZB 4XEMA 2FO0A 1VQ6T 3VJPA 4CI0C 4PHCA 2NUPB 3NELA 3OS1A 1SPKA 2CREA 1M3CA 4ZTJA 2BE7D 2ARTA 2RQWA 1JJ2S 2DIGA 4N0AC 1IO6A 2KDSA 1QKXA 5LJ5f 3OYLA 2XTIA 4BY6B 2NWMA 1Y71A 3HP9A 4BI3A 3V8JA 1Q82C 3TQ7P 2YWWA 3A7AA 1LOJA 2PVDB 4TWAA 2M0YA 1RABB 2E70A 4M75E 2HD0A 2EKOA 1YFTA 2W10A 1G3WA 5CVIA 1N9SA 4C92F 4LN2A 4O2DA 3S3OA 3M0QA 8ATCB 4M75F 4PJOE 4JRIA 1W2BS 1MHNA 1GFCA 4EMGA 3HSBA 2QA4T 4FCYA 4JZ4A 1ADYA 1G51A 4TVWA 4RTXA 3G6EQ 5GAMh 3PZCA 3REAB 2LC4A 2DVJA 3V8KA 1EIFA 1AWJA 3RF1A 1QVGA 1I07A 4EMHA 2E10A 2X35A 3MEUA 2EIFA 4IUUA 1G83A 1TUGB 3HFVA 3QDFA 1X27A 1B8AA 3QXEB 3RMSA 5FU6B 5LL6S 3CD6T 1Y07A 4E7SA 2DAQA 3NPFA 3I55A 1WNLA 3CCQT 4JJBA 1GRIA 2QQBA 4M7AD 2ZTGA 1NJIR 2ZNIA 3P8HA 4LDUA 1LPLA 1IZ6A 4ATOA 2H8HA 1VUBA 4IUPA 5A0LA 2DU7A 1M90C 2OAUA 1N8RR 1UEBA 4IIOA 2Y4YA 1NJ6A 3FLGA 1EQRA 4JJDA 4C92G 4PFZA 2KK4A 1W4SA 3M0TA 2PUKB 1VQ7A 2GGRA 1KMMA 3LLRA 5J3BA 1K73U 3CMET 4JJCA 1H3ZA 3M4YA 4PFPA 1HXDA 1C0MA 2HL5C 4XTWA 4GBQA 2DA9A 4HT8A 2G3RA 4ZN1A 1EVKA 4A4EA 4M7DB 2ZXFA 4ZGEB 2RHSB 5FW9A 2M51A 2XG8D 2NLUA 4CS3A 3JCMP 3CCVQ 2FZGB 4LNSA 1R8OB 3CCMA 3HFZB 4IUVA 4M7DA 2L2PA 2RHSA 5EC7A 1X6BA 3DB3A 4HCKA 4P75A 3G71A 3A7UA 1OOTA 2A37A 2JUFA 1M30A 4E7LA 4ZNXA 4J8OA 3V7CA 1GFDA 2LDMA 1OZ2A 4BD3A 1QVFS 3HFZA 2DL5A 3FIFA 3DSQA 4YRTA 3LSSA 2QEXQ 3CC2Q 5A0DA 1IB8A 1ZSZC 2AKLA 2VB6A 2GCXA 2DTHA 2CH4W 2OTJT 4WF2A 1YJWT 3KBGA 3EH1A 2CDTA 4QW2A 4H2UA 1GL5A 4JUVA 2DZ9A 3OYMA 1M5Q1 2YT6A 12ASA 2ZCFB 1KOGA 2DJZA 3CCST 4JS5A 5GAMd 4M7AC 5K1PA 4O5VA 3TEGA 4HCCA 1UJYA 4RTTA 1OQKA 4CH5A 5C53B 4CC4B 4FL6A 2EAYA 2GQIA 1MV0B 4LDYA 3EG0A 2NUTA 5KYWB 5AYFA 2HQHA 1Q82R 1SERA 1YI2Q 7AT1B 2EL9A 1RAAB 5KE3A 2D8JA 4NOYA 3S6WA 1MMDA 5KYWA 1M1KC 3G6EA 1PD0A 1QE0A 1E7OA 1OU8A 1BB9A 4ZN3A 1V1CA 5HKCA 2XDBA 3R07A 1B7TA 3HRIA 1H4TA 3TSWA 2QHVA 2KR3A 1D0YA 2ZT7A 3NMZC 2HQXA 2DD5A 3NETA 1EIYA 2K5IA 4AG1C 3TSZA 1R0BG 5GAMf 4G84A 4P3OA 2BUDA 3PIPA 1BBZA 2I4MA 1GCQC 2A36A 1VQOT 2Q5HA 1VQ4T 3X26B 3BJUA 3BFMA 1MGQA 4RKUE 4D8KA 1I81A 2G6FX 2R5MA 4RG8A 1VQ8T 3M5AA 4M77F 3A5ZB 3INZA 3G1JA 1FMWA 2P4TA 2ZT8A 1M27C 1OPLA 4JRPA 1YHQT 1YCSB 2MWOA 2K2VA 4OMLA 4C92D 4HWTA 5I11A 5KYYA 2QYZA 2QHSA 3JB9G 2GQVA 2DYIA 3GP8A 1T3SA 2X3WD 5A0GA 1PHTA 2AK5A 3P8YA 4J7FA 1H4QA 1G2BA 5DLQE 1M90R 4V2SA 1NNHA 1BBUA 4QQDA 2ZZEA 3CPFA 1JU5C 2QHTA 3CCVA 1AZGB 1YITT 4HCZA 3VQWA 1KQ1A 2EQMA 1QQJA 2E6NA 3CC7T 3HY0A 2Z0WA 1WHJA 4B9WA 2J3MA 3AT1B 4FU6A 3M57A 4OB1B 4HVWA 4XTYA 4KGVB 1NJ2A 2LX9A 2QEXA 3CC2A 4AFSC 5D7UA 1H8KA 1OULA 4KUIA 3KFVA 4M77G 1KQSS 2I4NA 3SFMA 3ULRB 2KYMA 3OS0A 4TVAA 4RTVA 1UUEA 2EYXA 1D1BA 4A4HA 1Q7YC 5LJ5g 2YRVA 1ZSZB 1TTHB 1KC8C 4LVKA 2ZT6A 2RH2A 5LJ3e 2YSQA 2ZCEA 2JMAA 3F70A 4YRNA 1PC0A 2L0AA 1ZSZA 1ZUUA 4BUGA 5C52B 4EX5A 1KD1U 5KNNA 3JCMc 5DY9A 2EYZA 1PM3A 2VUBA 3JB9I 1YI2A 2C7IA 1USYC 2CP3A 4J9IA 4C92C 3OYJA 3VS7A 3EH2A 5FWCA 1XNIA 4M7AB 1VYVA 2C0IA 6AT1B 4M75C 4KUDK 2BTTA 2EJFA 1X54A 4OMPA 4M7AA 3A32A 4TQFA 4NL2A 3OY9A 1W2BP 4YRCA 1QMCA 4OMOA 1X2KA 2DPPB 4UP7A 4YRPA 4ESRA 2RN8A 3UGQA 3LYIA 2J6KA 1B07A 2DO3A 1YJNA 4IIMA 1RLQC 3EGDB 2BE9B 2FB7A 4HKEA 1WI7A 2VASA 1QWEA 3E9GA 3C95A 3EGDA 2I4OA 3JV3A 3PCOB 3MEWA 2CKKA 3LSQA 3SHWA 2J3LA 1WXUA 3PCOA 2EYQA 1M1GA 3M9QA 3TREA 2DERA 3U23A 1G5VA 1OI1A 5F5WA 1GCQA 3JB9D 2XICA 3IG2A 2P0PA 3JSCA 4BE0A 2K5FA 2W0ZA 4H2WA 4NL3A 4PJNA 4C0ZA 1ZA1B 4K86A 4ME7A 1JJCA 3QDRB 2YUOA 1H3HA 5FU7C 2EJGA 2PVGB 4LDVA 1YN8A 4E7HA 3O8VA 2Y4XA 1Q86U 1SRYA 1BI1A 1PRMC 2MYSA 3L1AA 4RCBA 5LJ5h 2KROA 3MQZA 4YRJA 2ATCB 2ZPGB 1FYNA 1UJ0A 4N4GA 2EYYA 1B34B 2WSFE 1RAFB 2FVUA 4UPAA 4M77D 2CUDA 3CXCS 1TG0A 1WZOA 1Q81U 1QVFP 2P4RA 5I21A 1B34A 1WJRA 2X4WA 1UG1A 2CJ9A 3MCAB 1RIQA 2ROTA 1JXOA 4YCVA 3LX7A 3C4SA 3GIBA 4UP8A 1KJWA 2RK2A 1VQ9Q 3M0RA 2KGTA 2Y90A 2X4XA 1EFNA 1WDXA 2CIMA 2CP5A 1B76A 1Q7YR 1SETA 2GF7A 1NEGA 3OW2S 1KC8R 2F69A 2I2LA 2LMJA 3NTKA 1CSKA 4LE9A 4HCBA 3JCMQ 4OP0A 2EGEA 1NJIC 1HSQA 2QQ9A 4PG3A 5HK3A 3VQXA 5GAN8 3ZEHA 2ARUA 3QJ6A 2JJ9A 4TVYA 1UECA 4N4IA 4KR3A 5GAMj 1IXDA 2M02A 4C92B 1SG5A 3CBMA 3G71T 3VBBA 3EG2A 1NPRA 3CCEA 3E19A 3MP6A 4M7AG 3FJPA 3CCUQ 4WTOB 1USYA 1VQKQ 2ED0A 2PTKA 4C92A 1L0WA 4XU1A 3QWYA 1NM7A 5IT9E 1KMNA 1D09B 4IUQA 3G1ZA 2OJ2A 2HAXA 1ZHIA 2DVEA 3PT9A 1KQ2A 2LZ6B 1CKBA 1CKAA 1UGRB 2K3XA 4F7UE 4AG2C 1HC7A 4MDWA 1X55A 4ZTZB 2B86A 1FXXA 1NG2A 4CH3A 5FROA 4JRQA 3WVDB 2DBMA 4ORZA 3HXYA 2VKNA 1EOVA 2BZXA 2XK0A 2XIDA 1SEMA 2DRMA 3A7RA 4FYXB 1YCYA 2YDLA 2M16A 1OX8A 4OB0B 2ZZGA 3I56Q 1NYQA 2SEMA 2LQ8A 3NGPA 2A8EA 2XMFA 4A53A 3J7AF 1PNJA 3CCRQ 2RI3A 3I5SA 2LNVA 4PJLA 3G6ET 2DILA 3QZ9B 2BZ8A 1NLPC 3RR6A 4VUBA 2DFUA 1WHKA 3CPWP 4GLKA 3RNJA 1JEGA 2V8KA 1PSEA 4M78E 5HCKA 1OV3A 1T3LA 4C8QF 3QIIA 2BKDN 1YJ9A 2DYBA 2GBQA 3HHTB 1ZLMA 3PNWC 2J6OA 3L2ZA 1YNZA 2E3CA 4BB7A 3OYKA 2HEQA 3UATA 3VS1A 4P73C 1KIKA 1PCXA 1D0ZA 4BACA 1K73C 1Y57A 4BE2A 3HXXA 1Q95G 1RAIB 5J26A 1JB0E 3G4SQ 2FZCB 3CBOA 3EFOB 4RTUA 5GMKe 1SKUB 1S72Q 1M9SA 4A4KA 1Z9QA 2JM9A 3RESA 2A28A 3EFOA 5LJ3d 1PKTA 1PRLC 1PG5B 1LYLA 4CC2A 2LJ1A 1VQ9A 1FYFA 2L5QA 2RHYA 3M0UA 1UDLA 5IAYA 1N8RU 1KHCA 2F2VA 2XDPA 2L3QA 2L3PA 4DBQA 3L2WA 2OTLQ 5CCAA 1K8AU 2XKOC 4Z02A 1K0SA 4P72C 1Y96A 4P71C 2FG0A 4J9DA 4C5HA 3SB2A 1JO8A 2VXFA 4KH1B 4H2VA 4TVRA 1M8VA 2JN0A 3JCMe 4PJOF 2O2OA 3QYGB 2SRCA 1YWOA 4A4FA 2DEQA 2CP7A 2O01E 2OX7A 3HXVA 2K9GA 3CCUA 5LJ3f 3L2QA 4J9HA 3UGTA 3LW5E 8AT1B 2QEXT 1VQKA 3CC2T 1I0CA 4YRRA 5GAOn 2D0QB 3EHRA 2ZGWA 3NTIA 1IHVA 4MZTA 2ZZDA 1ADJA 1UHFA 5C51B 1VQ6Q 1K9MC 2FHDA 5CIUA 4PJJA 1W6XA 2KXDA 5I2SA 1ZUKA 4C5IA 2P5IA 3SDZA 4Z89A
chains in the Genus database with same CATH topology
4PLIA 1YFRA 4H2TA 4M75G 4HT9A 11ASA 3HXUA 2ZZFA 3QO3A 1Z7NA 2G4CA 3J81E 3RGLA 1M4ZA 3I56A 3VYHB 1YI2T 4M77B 3A74A 4BW9A 2RHQB 4X9CA 1ASZA 3CCRA 2QQAA 3NENA 3CMQA 4M77A 1WJQA 5GMKl 2RHQA 2ARSA 4AH6A 1C0AA 2RK1A 1I4K1 1N9WA 3QTCA 1X75C 3KUFA 2IVWA 3MF2A 2K4YA 4X34A 2RHIA 4L5GA 2YHTA 1YJNT 1VQLT 3G4SA 2RD1A 2KVQG 3ZBDA 4IKFA 1S72A 4J7IA 1IREB 1J5WA 3OD1A 3HRSA 3RMQA 4II1A 5FLXE 3RIRA 4XTZA 4N0AA 2OTLA 2H3JA 4P73A 3OYAA 2ZIMA 2ZIOA 3TUPA 4UP9A 3ER0A 5GMKh 4LD6A 4ELYC 1EIYB 3OBWA 3VUZA 1SSFA 2JTFA 2WACA 3RUXA 1UGSB 3DKMA 4C8QD 4YRKA 1GXIE 4FT2A 4MMLA 3MEVA 4RCCA 2ZPIB 3FC3A 3QYHB 4HWSA 2DKGA 2IG0A 3OSSC 3OMCA 2WSEE 2MAMA 3BDUA 4YRGA 4P72A 2DU5A 1KD1C 4P71A 4J83A 1VQ6A 1M1FA 2QHUA 5DLOA 4M7DE 5GANe 1IL2A 1QF6A 1JJ2A 3RKYA 2JNGA 2MMPA 2ZINA 4YCWA 3FB9A 4MMKA 3HRKA 4M75D 5CKHA 1VIFA 4P3NA 3OYBA 4CRIA 1VQNT 1X2HA 2E6ZA 1W66A 2QTXA 3OYNA 3OYEA 3M59A 4PJOD 3J80E 1NPPA 3CC4T 2EJ9A 2C8MA 1HTTA 3V7RA 4BDYA 1X56A 1W2BA 1G3TA 1LNXA 4TVAB 3OS2A 4YRFA 1WQ7A 3GOXA 3QO8A 4C0FA 3CCET 5LJ5j 4C8QC 3OMGA 4YTLA 3VYGA 4JLIA 4K88A 3VQVA 3S3MA 4YRMA 3CD6A 2ZNJA 3CCQA 4WJ4A 4J6WA 4LVJA 3E9FA 1M1KU 4LDWA 4Q15A 1YGBA 2KMTA 1BIBA 2LQKA 3IKLA 1O75A 4HT4A 2CJAA 2CZ6B 1KG1A 3LWIA 4X5OA 3OB9A 3SD4A 2Q7GA 3Q1JA 3JCMb 3CMEA 2PUOB 4XU0A 2DZCA 2ODRD 4Y91A 4UC4A 4WI1A 1NJ8A 4LD9K 2RB6A 2HNIA 2CGHA 2EFIA 3SWNC 3JCMd 2ZT5A 1Q81C 3M4QA 4IUTA 2ZPFB 4PJOC 1VQMT 2V8IA 2I4LA 3MF1A 4PNOA 1YJ9T 2HQEA 3UDCA 2PVOB 4XAXB 5LJ3g 1QVFA 2NS6A 1EFWA 3S3NA 2O4XA 1LJOA 3H6ZA 5GMKi 3RKWA 1YJWA 1XTDA 5FRMA 1D3BA 1N6AA 3WXMB 4CS4A 4KT0E 4BE1A 3JCMf 2P0LA 3CCSA 4OB2B 1VQ9T 1JJCB 4MDXA 5IN1A 3W3SA 1U1TA 5CQXA 1E1OA 3GPLA 3QJYA 5GANh 4YRQA 2X4JA 4CS2A 3IKMB 2K5LA 1QVGS 1G3YA 1PYSB 3REXA 4FSXA 2QQSA 2ODRC 4D6WA 1UB4A 3HTZA 1PYSA 3I55T 3M58A 4BY6C 3CBPA 4RQFA 3OQ5A 3NTHA 3X28B 3OSVA 1YFSA 4QQ6A 2DIQA 1RI0A 1X6OA 3FRNA 4XTXA 3VU3C 4M7AE 5GMKm 3NFCA 5GAN5 3QG1A 3AHUA 3OS5A 4C8QB 3P8BB 4BI8B 2RO0A 3WVEB 1G3SA 3WQZA 1VQ8A 1VQ7T 3OA6A 1YHQA 2AMCB 4C8QA 1U1SA 2E1HA 4OVAA 2F5TX 2EWNA 3M53A 4QQGA 3CCLA 3UFGA 3LGLA 5GAOl 3ME9A 2R5AA 2AMCA 3A8HB 3I56T 5CKDA 1BI0A 4YYEA 5LJ3h 2RI5A 1PSFA 3CCRT 3VUBA 3CCMT 4ZTFA 4FM4B 3CPWA 4MZPA 4EPCA 3OYFA 4XU3A 5L8RE 1H4SA 2M9UA 4R55A 4M75B 3CC7A 3QUIA 3M4GA 2CZ0B 4YPFA 2DK3A 3QZ5B 4M75A 4PKCC 3M54A 1BKBA 4PJOB 3T9NA 3A31A 2R58A 5GANd 3QNEA 1NJ5A 4J6YA 3HL8A 3OBYA 1FX7A 2VV5A 4PJOA 1NJ1A 3V7SA 2ZR2A 2JZ2A 3FDRA 3HPWA 4F7UF 1YIJA 4EDUA 1Z7MA 1VIEA 1OYXA 2PU9B 3G7ZA 4YRLA 4N4HA 3HRTA 4BI4A 4RDXA 2VGNA 3H8ZA 4TQDA 3L42A 2AKWA 3CMAA 2ZPBB 4RG2A 5GANf 2XI9A 1H641 2BIVA 2DXCA 3JCMJ 5CO7A 4L59A 5HK0A 4E7JA 5FU7B 2X4YA 4M78F 4R56A 3LWHA 1WU7A 1N9RA 1X01A 3BY7A 4LVMA 2VGMA 4MZMA 2LRQA 5KE2A 5D6WA 4F7UG 3JRZA 4C0DC 4H2SA 2YLCA 4KULA 1NJIU 1DJ7B 1P92A 2CYZB 2MWPA 3N5BB 3JB9J 1V29B 4J5YA 1Y96B 2VXEA 5ELOA 4E7KA 4JRKA 4C92E 4E7IA 2FL7A 2D9TA 4XK8E 3P8TA 2E65A 1BIAA 3M4PA 4Q6GA 2DD4A 1UGQB 3BW1A 4B9XA 4L87A 3LH0A 4C8QG 3OYHA 3CCVT 1QVPA 5CKFA 3BDLA 3RERA 1JBMA 5GMKj 4XTVA 4C5GA 4M78G 4DPGA 4L6V5 2QQRA 3P8DA 3C94A 1I5LA 3OYCA 1G5HA 1OZ3A 1E22A 1ZBXA 3A8LB 4EO4A 5CAIA 1XQHA 4A54A 2P0KA 4YCUA 2MI6A 3A5YA 2VC8A 2VYTA 2EQUA 3QHSA 2RHXA 2RJEA 5D6YA 3CXCA 4O6JA 3UWNA 1VQPA 1VQ5A 2QDYB 4ZIBA 1B7YB 2PMFA 3M56A 3JCMg 5GAOq 3PFSA 2KQWA 4PJOG 5FRNA 3TCJA 4PL6A 1B7YA 1E1TA 5K1XA 4HWRA 5EG2A 5KH6A 2GFUA 3LGFA 3GF5A 1Q82U 3OW2A 2RM4A 4RMFA 2LCLA 2JTMA 2KAFA 3JCMV 2KSSA 2DTIA 4P74C 2CJBA 3X20B 5KCHA 3RL6A 1WPYA 3L2UA 3EAEA 3CCJA 2A3LA 5D6XA 3JCMX 3KXTA 5J39A 2CZ7B 2LVMA 4E47A 4HVCA 3FEOA 5CQYA 4A4GA 1JRIA 4XQ3A 3PMIA 4OMFB 4XEOA 3A8MB 2A7YA 2LT4A 3L4GB 3REUA 4C0DB 4QVZA 2DQ0A 3RACA 4J6XA 1K9MU 3C12A 3L4GA 1M90U 2PMEA 3TEHB 3JB9F 1NZ9A 4KBMB 4IURA 1HK9A 5C6SA 2E5AA 4M78D 3TEHA 4GY5A 4ZGJB 1FWZA 1ZQ1A 5GAOm 3HXWA 4X9DA 4JS4A 3JCMh 4Q5WA 5M9OA 3JB9H 1QP3A 4M77E 2HBPA 1ATIA 5GAOr 4QVDA 2R57A 2KY9A 4M7DF 2Q5IA 2EQKA 5E3IA 2EQJA 5GAN4 2RJDA 3MEYA 4BWAA 1N27A 2RJFA 4KR2A 3A5ZA 5CK9A 3CCLT 4YDQA 4OB3B 4YROA 4ZGDB 2XGTA 5LJ5e 2L8DA 3VQYA 3OYDA 3M55A 5CR2A 5DM7R 5GANj 2QA4A 3CPWS 3X25B 2XD0A 2L89A 3KFUA 3ICAA 2ZPEB 4YRSA 2CS7A 5GANg 4XTUA 2DXUA 3V8LA 4FT4A 1BBWA 3NEMA 4LVIA 2L3RA 3URGA 3R6OA 3GNFB 5GAN7 4M78C 4M7DG 3E9HA 1ASYA 2LT1A 1YB3A 3I7FA 2M1HA 3E1SA 1O9SA 4BDZA 3JAME 1KHIA 4DOWA 2RA2A 4EMKC 3HXZA 4K87A 4P74A 2DTOA 1Q86C 2GFAA 4HWPA 2K3YA 3QKJA 3A8GB 2JOYA 3OYYA 2DXTA 1YIJT 1H4VB 2AHJB 4H2YA 2RHZA 3E9IA 2B8AA 3UH0A 3ASKA 2FYKA 5LJ3j 4WJ3M 4OF1A 3CMAT 5CKEA 2QXFA 2O4XB 4LDXA 1D3BB 5GAN3 1TH7A 4JLGA 4HWOA 3OYGA 4P5NA 5HY6A 2OTJA 4NCXA 2C06A 3PGGA 2RHUA 4E51A 3TU4K 2RI2A 3QSUA 3PTAA 4RMOA 3JCMW 1VQLA 4YP0A 3CEYA 3ZFJA 4JJNK 4J15A 3QPHA 1UGPB 3MHXA 1YBYA 1WJSA 4JDSA 4XU2A 3HY1A 3X24B 2XHCA 4KQEA 3DB4A 5I2MA 1Q7YU 3QO7A 3UPUA 4C5EA 1BYMA 5C0MA 4C0GA 1KC8U 1GGMA 5A2QE 2WSCE 4LVLA 2MF2A 2K57A 4F7UB 2M0OA 4ELZC 5GAN6 3CCUT 3L2VA 1U8RA 1VQKT 1BI2A 4F7UA 4DQ2A 2E64A 4FIBA 1VQOA 1BI3A 3HKSA 1VQ4A 2RJCA 2PQWA 4ZTUB 3META 2ZPHB 3OYIA 1WYDA 4M7DD 1NYRA 5ELNA 3EFRA 2CZ1B 3IALA 3MEAA 4Y28E 3HFOA 4M7AF 2ALYB 4H02A 1VQPT 1WLEA 2LCCA 1VQ5T 3RKXA 5GAMe 4CH4A 4M78B 3QO5A 3PIOA 1G5IA 3MO8A 4YRIA 1EVLA 2ALYA 1XOVA 4M78A 1WGSA 3EFSA 4HA8A 3HFNA 4EMKB 1WQWA 4G85A 2JVVA 1VQNA 2DXBA 3QBYA 4CH6A 1E24A 4EMKA 1YITA 3UT1A 2V8JA 5FU6C 3CC4A 1QW1A 3L2RA 1QP2A 1RL2A 3MP1A 2DQ3A 4OLFA 2DDZA 1SESA 3LC0A 3SWNB 4PLLA 1N8RC 2XDDA 2LTOA 3PMTA 3HRUA 1K8AC 3SWNA 3G4ST 4DA4A 1X2GA 1KQSA 3CCJT 1S72T 2YLBA 5GAMg 1AHJB 3A8OB 4OGCA 4TTVA 3DLMA 1VQZA 2IY5B 4OGEA 5HGQA 4M7DC 2OTLT 4P75C 2IY5A 4M77C 4YREA 2P0QA 2E41A 2AKWB 2ZR3A 4H2XB 2Q7EA 5CKBA 4P3PA 5LJ5d 3MP8A 3TEEA 2E5QA 1B70B 4RQEA 1NE8A 5GAOp 2D6FA 1I8FA 3GLXA 3DLLA 3P8VA 4H2XA 2XU8A 5GAN2 3VV0A 1B70A 4QVCA 3ERRA 2E12A 4NS5A 2F5KA 3VKIA 4C8QE 4DOVA 3GNGA 2Q7HA 1Y7XA 5KCOA 1VQMA 2QI2A 4XEMA 1VQ6T 3VJPA 4CI0C 4PHCA 3NELA 3OS1A 4ZTJA 2ARTA 1JJ2S 2DIGA 4N0AC 2KDSA 5LJ5f 3OYLA 2XTIA 4BY6B 1Y71A 3HP9A 4BI3A 3V8JA 1Q82C 3A7AA 1LOJA 2PVDB 4TWAA 2E70A 4M75E 2HD0A 2EKOA 1YFTA 1G3WA 5CVIA 1N9SA 4C92F 4O2DA 3S3OA 4M75F 4PJOE 4JRIA 1W2BS 1MHNA 3HSBA 4EMGA 2QA4T 1ADYA 1G51A 4TVWA 5GAMh 3PZCA 2LC4A 3V8KA 1EIFA 3RF1A 1QVGA 4EMHA 2E10A 2X35A 3MEUA 2EIFA 4IUUA 3HFVA 1B8AA 3QXEB 3RMSA 5FU6B 5LL6S 3CD6T 1Y07A 2DAQA 3I55A 1WNLA 3CCQT 2QQBA 4M7AD 2ZTGA 2ZNIA 3P8HA 4LDUA 1IZ6A 4ATOA 1VUBA 4IUPA 5A0LA 2DU7A 1M90C 2OAUA 1UEBA 2Y4YA 1NJ6A 3FLGA 1EQRA 4C92G 2KK4A 1W4SA 2PUKB 1VQ7A 1KMMA 3LLRA 5J3BA 1K73U 3CMET 1H3ZA 3M4YA 1HXDA 4XTWA 4HT8A 2G3RA 4ZN1A 1EVKA 4A4EA 4M7DB 2ZXFA 4ZGEB 2RHSB 2XG8D 2NLUA 4CS3A 3JCMP 4LNSA 1R8OB 3CCMA 3HFZB 4IUVA 4M7DA 2RHSA 3DB3A 4P75A 3G71A 3A7UA 2JUFA 4E7LA 4J8OA 3V7CA 2LDMA 1OZ2A 4BD3A 1QVFS 3HFZA 3FIFA 3DSQA 4YRTA 3LSSA 5A0DA 2GCXA 2DTHA 2OTJT 4WF2A 1YJWT 3KBGA 4QW2A 4H2UA 4JUVA 2DZ9A 3OYMA 1M5Q1 12ASA 2ZCFB 1KOGA 2DJZA 3CCST 4JS5A 5GAMd 4M7AC 5K1PA 4O5VA 3TEGA 4HCCA 4CH5A 5C53B 4FL6A 2EAYA 4LDYA 5AYFA 1SERA 2EL9A 5KE3A 4NOYA 3S6WA 1M1KC 3G6EA 1QE0A 4ZN3A 5HKCA 2XDBA 3R07A 3HRIA 1H4TA 2QHVA 2ZT7A 2HQXA 2DD5A 3NETA 1EIYA 2K5IA 5GAMf 4G84A 4P3OA 2BUDA 3PIPA 2I4MA 1VQOT 2Q5HA 1VQ4T 3X26B 3BJUA 3BFMA 1MGQA 4RKUE 1I81A 2R5MA 4RG8A 1VQ8T 3M5AA 4M77F 3A5ZB 3INZA 2P4TA 2ZT8A 4JRPA 1YHQT 2MWOA 2K2VA 4C92D 4HWTA 2QHSA 3JB9G 2GQVA 3GP8A 5A0GA 3P8YA 4J7FA 1H4QA 5DLQE 1NNHA 4V2SA 1BBUA 4QQDA 2ZZEA 3CPFA 2QHTA 3CCVA 1YITT 4HCZA 3VQWA 1KQ1A 2EQMA 2E6NA 3CC7T 3HY0A 4B9WA 2J3MA 4FU6A 3M57A 4OB1B 4XTYA 1NJ2A 2LX9A 2QEXA 3CC2A 4KUIA 2I4NA 4M77G 1KQSS 3SFMA 3OS0A 4TVAA 4A4HA 1Q7YC 5LJ5g 2YRVA 1KC8C 4LVKA 2ZT6A 2RH2A 5LJ3e 2ZCEA 3F70A 4YRNA 4BUGA 5C52B 4EX5A 1KD1U 5KNNA 3JCMc 5DY9A 2VUBA 3JB9I 1YI2A 2C7IA 1USYC 3OYJA 4C92C 1XNIA 4M7AB 4M75C 4KUDK 2EJFA 1X54A 3A32A 4M7AA 4TQFA 4NL2A 3OY9A 4YRCA 2DPPB 4UP7A 4YRPA 3UGQA 3LYIA 2DO3A 1YJNA 2FB7A 4HKEA 3E9GA 3C95A 2I4OA 3PCOB 3MEWA 2CKKA 3LSQA 2J3LA 3PCOA 2EYQA 1M1GA 3M9QA 3TREA 1G5VA 5F5WA 1OI1A 3JB9D 2XICA 3IG2A 2P0PA 3JSCA 4BE0A 2K5FA 4H2WA 4NL3A 4C0ZA 4K86A 4ME7A 1JJCA 3QDRB 5FU7C 2EJGA 2PVGB 4LDVA 4E7HA 3O8VA 2Y4XA 1Q86U 1SRYA 1BI1A 3L1AA 5LJ5h 4RCBA 3MQZA 4YRJA 2ZPGB 4N4GA 1B34B 2WSFE 2FVUA 4UPAA 4M77D 3CXCS 1Q81U 5I21A 1B34A 1WJRA 2X4WA 2CJ9A 3MCAB 1RIQA 4YCVA 3LX7A 3C4SA 3GIBA 4UP8A 2RK2A 2Y90A 2X4XA 2CIMA 1B76A 1SETA 2GF7A 3OW2S 2F69A 2I2LA 3NTKA 4HCBA 3JCMQ 4OP0A 1NJIC 2QQ9A 4PG3A 5HK3A 3VQXA 5GAN8 3ZEHA 2ARUA 3QJ6A 4TVYA 4N4IA 4KR3A 5GAMj 4C92B 3CBMA 3G71T 3VBBA 1NPRA 3CCEA 3E19A 3MP6A 4M7AG 3FJPA 1USYA 4C92A 1L0WA 4XU1A 5IT9E 1KMNA 4IUQA 3G1ZA 2HAXA 1ZHIA 2DVEA 3PT9A 1KQ2A 1UGRB 2K3XA 4F7UE 1HC7A 4MDWA 1X55A 4ZTZB 1FXXA 4CH3A 5FROA 4JRQA 3WVDB 3HXYA 1EOVA 2XK0A 2XIDA 3A7RA 1YCYA 2M16A 4OB0B 2ZZGA 1NYQA 2LQ8A 2A8EA 4A53A 3J7AF 2RI3A 3G6ET 2LNVA 3QZ9B 4VUBA 4GLKA 2V8KA 1PSEA 4M78E 4C8QF 1YJ9A 3QIIA 2BKDN 3PNWC 3HHTB 3L2ZA 2E3CA 4BB7A 3OYKA 4P73C 1K73C 4BACA 4BE2A 3HXXA 5J26A 1JB0E 3CBOA 5GMKe 1M9SA 4A4KA 3RESA 5LJ3d 1LYLA 1VQ9A 1FYFA 2L5QA 2RHYA 5IAYA 1N8RU 1KHCA 2XDPA 3L2WA 5CCAA 1K8AU 2XKOC 4Z02A 4P72C 1Y96A 4P71C 4C5HA 3SB2A 2VXFA 4H2VA 4TVRA 1M8VA 2JN0A 3JCMe 4PJOF 3QYGB 4A4FA 2DEQA 2O01E 3HXVA 3CCUA 5LJ3f 3L2QA 3UGTA 3LW5E 2QEXT 1VQKA 3CC2T 4YRRA 5GAOn 2D0QB 3NTIA 2ZGWA 4MZTA 2ZZDA 1ADJA 5C51B 1K9MC 2FHDA 5CIUA 5I2SA 4C5IA 2P5IA 3SDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT8 A;  1YFR A;  4J15 A;  1NJ1 A;  4H2T A;  3V7S A;  4M75 G;  2ZR2 A;  4HT9 A;  11AS A;  4C92 D;  4HWT A;  3HXU A;  2ZZF A;  3QO3 A;  4F7U F;  2QHS A;  3JB9 G;  1Z7N A;  2G4C A;  4XU2 A;  1Z7M A;  3HY1 A;  3P8Y A;  1H4Q A;  3RGL A;  1NNH A;  4V2S A;  4KQE A;  4YRL A;  1BBU A;  4M77 B;  3A74 A;  4BW9 A;  2RHQ B;  4RDX A;  3QO7 A;  4X9C A;  1ASZ A;  4TQD A;  2ZZE A;  2QHT A;  3NEN A;  1GGM A;  3CMQ A;  2AKW A;  4M77 A;  5GMK l;  2K57 A;  4F7U B;  5GAN f;  2ARS A;  2RHQ A;  3VQW A;  4AH6 A;  1KQ1 A;  1H64 1;  1C0A A;  5GAN 6;  3HY0 A;  1I4K 1;  3JCM J;  1N9W A;  2J3M A;  3QTC A;  4XTY A;  4F7U A;  4DQ2 A;  1NJ2 A;  2E64 A;  4M78 F;  3MF2 A;  4ZTU B;  2I4N A;  4M77 G;  1WU7 A;  1N9R A;  1X01 A;  3BY7 A;  2YHT A;  1WYD A;  4TVA A;  4M7D D;  2RD1 A;  1NYR A;  5ELN A;  4F7U G;  3EFR A;  3IAL A;  1J5W A;  2YLC A;  4H2S A;  3OD1 A;  5LJ5 g;  3HFO A;  4M7A F;  2ALY B;  4H02 A;  1WLE A;  2ZT6 A;  3JB9 J;  4J5Y A;  5LJ3 e;  3RKX A;  5GAM e;  2ZCE A;  4CH4 A;  4M78 B;  3QO5 A;  1Y96 B;  2VXE A;  5ELO A;  4YRN A;  3RIR A;  4JRK A;  4XTZ A;  4C92 E;  1G5I A;  4YRI A;  5C52 B;  1EVL A;  4N0A A;  2ALY A;  4EX5 A;  3P8T A;  4P73 A;  5KNN A;  3JCM c;  2E65 A;  1BIA A;  2ZIM A;  4M78 A;  5DY9 A;  2ZIO A;  3M4P A;  3EFS A;  3TUP A;  4HA8 A;  3HFN A;  4UP9 A;  4EMK B;  3JB9 I;  1WQW A;  4Q6G A;  2C7I A;  3BW1 A;  1USY C;  4G85 A;  4L87 A;  4C92 C;  4C8Q G;  5GMK h;  4CH6 A;  4M7A B;  1EIY B;  3RER A;  1E24 A;  4EMK A;  1JBM A;  5GMK j;  4M75 C;  4XTV A;  3RUX A;  2EJF A;  4C8Q D;  4YRK A;  1X54 A;  4M78 G;  4M7A A;  3A32 A;  4TQF A;  4MML A;  4NL2 A;  4RCC A;  4DPG A;  2DQ3 A;  4OLF A;  2DDZ A;  1SES A;  4YRC A;  4HWS A;  2DKG A;  1I5L A;  3LC0 A;  3SWN B;  4UP7 A;  1G5H A;  1E22 A;  3BDU A;  4YRG A;  4YRP A;  3UGQ A;  4P72 A;  3SWN A;  2DU5 A;  1X2G A;  4P71 A;  4EO4 A;  5CAI A;  4A54 A;  4YCU A;  3A5Y A;  2QHU A;  2FB7 A;  2YLB A;  2VC8 A;  5GAM g;  4M7D E;  5GAN e;  3QHS A;  1IL2 A;  1QF6 A;  4TTV A;  2I4O A;  3PCO B;  3RKY A;  1VQZ A;  2ZIN A;  4YCW A;  2IY5 B;  5HGQ A;  3FB9 A;  4MMK A;  3LSQ A;  3HRK A;  4ZIB A;  4M75 D;  4M7D C;  1B7Y B;  2J3L A;  2PMF A;  3PCO A;  3JCM g;  4P75 C;  5F5W A;  4M77 C;  5GAO q;  2IY5 A;  4P3N A;  4PJO G;  3JB9 D;  3IG2 A;  4YRE A;  2E41 A;  2AKW B;  2ZR3 A;  4H2X B;  2Q7E A;  4H2W A;  1X2H A;  1B7Y A;  4P3P A;  1W66 A;  1E1T A;  4NL3 A;  5LJ5 d;  5K1X A;  4RQE A;  1B70 B;  4HWR A;  2QTX A;  5GAO p;  4PJO D;  1I8F A;  3P8V A;  4H2X A;  4K86 A;  5GAN 2;  2EJ9 A;  2C8M A;  1HTT A;  1JJC A;  3V7R A;  1B70 A;  4QVC A;  2RM4 A;  4RMF A;  3ERR A;  1X56 A;  2EJG A;  3JCM V;  4C8Q E;  1LNX A;  2Q7H A;  2DTI A;  4P74 C;  4TVA B;  1SRY A;  4YRF A;  3L1A A;  5LJ5 h;  4RCB A;  2CJB A;  1WQ7 A;  3QO8 A;  3RL6 A;  5LJ5 j;  1WPY A;  4XEM A;  4C8Q C;  4YRJ A;  4PHC A;  3NEL A;  4JLI A;  1B34 B;  4K88 A;  3VQV A;  4UPA A;  4M77 D;  2ART A;  4YRM A;  2ZNJ A;  4N0A C;  3JCM X;  5LJ5 f;  2XTI A;  4WJ4 A;  5I21 A;  1B34 A;  4J6W A;  4HVC A;  4Q15 A;  1YGB A;  3V8J A;  2CJ9 A;  1BIB A;  1LOJ A;  3A7A A;  1RIQ A;  1JRI A;  4XQ3 A;  4TWA A;  4YCV A;  3IKL A;  2CJA A;  4XEO A;  3GIB A;  4UP8 A;  4M75 E;  4X5O A;  1YFT A;  2Y90 A;  2CIM A;  3L4G B;  3REU A;  1N9S A;  4C92 F;  1B76 A;  4O2D A;  2Q7G A;  1SET A;  3JCM b;  2DQ0 A;  3RAC A;  4J6X A;  4XU0 A;  2DZC A;  2ODR D;  2I2L A;  4Y91 A;  4WI1 A;  4M75 F;  4PJO E;  3L4G A;  4JRI A;  1NJ8 A;  2PME A;  2RB6 A;  2HNI A;  2CGH A;  3TEH B;  3HSB A;  4EMG A;  3JCM Q;  3SWN C;  3JCM d;  4OP0 A;  1ADY A;  1G51 A;  2ZT5 A;  3M4Q A;  3JB9 F;  4TVW A;  4PG3 A;  5GAM h;  3PZC A;  3VQX A;  1HK9 A;  5GAN 8;  3V8K A;  2ARU A;  4M78 D;  2E5A A;  4PJO C;  4TVY A;  3TEH A;  3RF1 A;  4EMH A;  4KR3 A;  5GAM j;  2E10 A;  4C92 B;  3VBB A;  2I4L A;  3MF1 A;  5GAO m;  4PNO A;  3HXW A;  4X9D A;  3HFV A;  4M7A G;  3FJP A;  1B8A A;  1USY A;  4C92 A;  5LJ3 g;  1L0W A;  3JCM h;  1WNL A;  4XU1 A;  1EFW A;  1KMN A;  4M7A D;  1LJO A;  3JB9 H;  2ZTG A;  4M77 E;  3G1Z A;  2ZNI A;  5GMK i;  3RKW A;  1D3B A;  2DVE A;  1KQ2 A;  5GAO r;  1ATI A;  4QVD A;  2DU7 A;  1NJ6 A;  4F7U E;  4M7D F;  1EQR A;  4C92 G;  1HC7 A;  4CS4 A;  3JCM f;  1X55 A;  2P0L A;  2Q5I A;  4ZTZ B;  5E3I A;  5GAN 4;  3MEY A;  4CH3 A;  4BWA A;  1JJC B;  1KMM A;  3HXY A;  4KR2 A;  1EOV A;  3A5Z A;  1HXD A;  3W3S A;  4YDQ A;  1U1T A;  3A7R A;  1YCY A;  4XTW A;  4YRO A;  2XGT A;  5LJ5 e;  1E1O A;  4HT8 A;  2ZZG A;  3VQY A;  5GAN h;  4YRQ A;  1NYQ A;  1EVK A;  4M7D B;  2ZXF A;  2RHS B;  4A53 A;  4CS2 A;  5GAN j;  3IKM B;  4CS3 A;  3JCM P;  4LNS A;  3HFZ B;  4M7D A;  1PYS B;  2RHS A;  3REX A;  3KFU A;  3ICA A;  2ODR C;  4P75 A;  4YRS A;  5GAN g;  4XTU A;  3A7U A;  4M78 E;  2DXU A;  4C8Q F;  3V7C A;  3V8L A;  3HFZ A;  1BBW A;  3HTZ A;  1PYS A;  3NEM A;  3FIF A;  3DSQ A;  3L2Z A;  4YRT A;  2E3C A;  3LSS A;  4P73 C;  4RQF A;  2DTH A;  5GAN 7;  4M78 C;  4M7D G;  4WF2 A;  3E9H A;  1ASY A;  1YFS A;  1YB3 A;  3HXX A;  3VU3 C;  3I7F A;  4XTX A;  4M7A E;  4H2U A;  5GMK m;  4JUV A;  5GMK e;  2DZ9 A;  5GAN 5;  1M5Q 1;  3AHU A;  12AS A;  2RA2 A;  4EMK C;  3HXZ A;  4K87 A;  1KOG A;  4C8Q B;  2DJZ A;  4P74 A;  3RES A;  3INZ A;  3WQZ A;  2DTO A;  5LJ3 d;  5GAM d;  4HWP A;  4M7A C;  5K1P A;  1LYL A;  3TEG A;  2AMC B;  1FYF A;  4C8Q A;  1U1S A;  2E1H A;  2DXT A;  4CH5 A;  5C53 B;  2EWN A;  1H4V B;  2EAY A;  3UFG A;  5GAO l;  2AMC A;  4H2Y A;  1SER A;  2EL9 A;  4P72 C;  1Y96 A;  4P71 C;  3E9I A;  3UH0 A;  3SB2 A;  4YYE A;  2VXF A;  4NOY A;  5LJ3 h;  4H2V A;  2FYK A;  1M8V A;  2JN0 A;  1QE0 A;  3JCM e;  5LJ3 j;  4WJ3 M;  4PJO F;  3R07 A;  4XU3 A;  3HRI A;  1H4T A;  2QHV A;  1H4S A;  2ZT7 A;  2DEQ A;  4M75 B;  3NET A;  1EIY A;  3QUI A;  1D3B B;  3HXV A;  5LJ3 f;  3M4G A;  5GAM f;  5GAN 3;  4G84 A;  4P3O A;  1TH7 A;  4YPF A;  3UGT A;  4HWO A;  2I4M A;  4YRR A;  2Q5H A;  5GAO n;  2ZGW A;  4M75 A;  3BJU A;  4NCX A;  3BFM A;  1MGQ A;  3PGG A;  1ADJ A;  4E51 A;  5C51 B;  4PJO B;  3QSU A;  3A31 A;  5GAN d;  3QNE A;  3JCM W;  1I81 A;  1NJ5 A;  4J6Y A;  2P5I A;  4YP0 A;  4M77 F;  4PJO A; 
#chains in the Genus database with same CATH topology
 3LH5 A;  2F2W A;  4PLI A;  1YFR A;  1MND A;  4RTZ A;  4H2T A;  4M75 G;  4HT9 A;  11AS A;  3HXU A;  2ZZF A;  1PWT A;  3QO3 A;  2RF0 A;  1AVZ C;  1A0N B;  1U06 A;  1YWP A;  1Z7N A;  2G4C A;  1AD5 A;  3J81 E;  1D1A A;  2KT8 A;  3RGL A;  3VS4 A;  1M4Z A;  3I56 A;  3VYH B;  1YI2 T;  3A1P A;  2DL3 A;  4M77 B;  3A74 A;  4BW9 A;  1U3O A;  2RHQ B;  4X9C A;  1ASZ A;  3CCR A;  2QQA A;  3VS6 A;  2GTO A;  2ECZ A;  1WHM A;  3NEN A;  3CMQ A;  4M77 A;  1WJQ A;  5GMK l;  3H0F A;  2RHQ A;  2ARS A;  4AH6 A;  1C0A A;  2RK1 A;  2CUB A;  2YUN A;  1I4K 1;  4B6M A;  4RTY A;  1SSH A;  4PJM A;  3TVT A;  1N9W A;  3QTC A;  1X75 C;  3KUF A;  2IVW A;  2COW A;  3MF2 A;  2K4Y A;  4X34 A;  2RHI A;  4L5G A;  2YHT A;  1YJN T;  3A98 A;  1VQL T;  3G4S A;  3CD6 Q;  2RD1 A;  2KVQ G;  4HVV A;  3ZBD A;  1E6H A;  1QCN A;  4IKF A;  3CCQ Q;  3CQT A;  1S72 A;  4J7I A;  1IRE B;  1J5W A;  3OD1 A;  1TWB A;  3HRS A;  2NUT B;  3CXC P;  4J9E A;  2EGC A;  3RMQ A;  4II1 A;  3IQL A;  1K73 R;  5FLX E;  3RIR A;  4XTZ A;  2LJ0 A;  4N0A A;  2OTL A;  2H3J A;  4P73 A;  1RUW A;  1GCP A;  1SHG A;  3OYA A;  2ZIM A;  2COY A;  2ZIO A;  1BCO A;  1VYU A;  3TUP A;  3GBQ A;  4UP9 A;  3ER0 A;  3CME Q;  5GMK h;  5IXB A;  4Z88 A;  4LD6 A;  4ELY C;  2L3S A;  1EIY B;  3OBW A;  3VUZ A;  1SSF A;  2JTF A;  2WAC A;  3RUX A;  1UGS B;  3DKM A;  1QCF A;  4C8Q D;  4YRK A;  1GXI E;  3OW2 P;  4FT2 A;  4MML A;  3MEV A;  4RCC A;  1NLO C;  2ZPI B;  3FC3 A;  1J3T A;  3QYH B;  4HWS A;  2DKG A;  2IG0 A;  3OSS C;  3OMC A;  2WSE E;  2MAM A;  3BDU A;  4RTW A;  4YRG A;  2K79 A;  2FRY A;  4P72 A;  2DU5 A;  1KD1 C;  4P71 A;  2JT4 A;  4J83 A;  1VQ6 A;  2X51 A;  1M1F A;  5KYY B;  1BK2 A;  2QHU A;  1EX4 A;  4GLM A;  5DLO A;  1M2V A;  4M7D E;  5GAN e;  2OAW A;  1T0H A;  2BZY A;  4F17 A;  1IL2 A;  1YJW Q;  2A0F B;  1QF6 A;  5AT1 B;  1JJ2 A;  1RAE B;  4RUG A;  2DL7 A;  2KEA A;  4X1V A;  3RKY A;  2JNG A;  2MMP A;  2ZIN A;  4YCW A;  3FB9 A;  1HJD A;  1OEB A;  4MMK A;  3HRK A;  1AT1 B;  4M75 D;  5CKH A;  2MCN A;  3CCS Q;  1K9M R;  1VIF A;  1NEB A;  4P3N A;  3OYB A;  4CRI A;  1VQN T;  2V1R A;  1X2H A;  1MMN A;  2E6Z A;  1W66 A;  2QTX A;  2F2X A;  3OYN A;  3OYE A;  3M59 A;  4PJO D;  3J80 E;  1NPP A;  2RQV A;  3CC4 T;  2EJ9 A;  2C8M A;  1HTT A;  3V7R A;  4BDY A;  4OMN A;  2YRD A;  2HMA A;  1X56 A;  1QKW A;  1W2B A;  1G3T A;  4PFO A;  1LNX A;  2DBK A;  4TVA B;  1Y0M A;  3OS2 A;  4YRF A;  1WQ7 A;  3GOX A;  1WHG A;  3QO8 A;  4C0F A;  3CCE T;  5LJ5 j;  4C8Q C;  3OMG A;  4YTL A;  1TOV A;  3VYG A;  4JLI A;  4K88 A;  2CP0 A;  3VQV A;  3S3M A;  3RDV A;  1PD1 A;  4YRM A;  3CD6 A;  2ROL A;  2ZNJ A;  2QG9 B;  1MUZ A;  4Y92 A;  3CCQ A;  4WJ4 A;  1AWX A;  4J6W A;  1JJ2 P;  4R0K A;  4LVJ A;  3E9F A;  1M1K U;  4LDW A;  4Q15 A;  1YGB A;  1LCK A;  2KMT A;  1BIB A;  2LQK A;  2YXY A;  1N5Z A;  4AT1 B;  2K2M A;  3IKL A;  1O75 A;  4HT4 A;  2CJA A;  1VQ8 Q;  2CZ6 B;  1KG1 A;  1IRX A;  3LWI A;  1YHQ Q;  4X5O A;  3OB9 A;  1V76 A;  3SD4 A;  3VS5 A;  2HKQ B;  2AT1 B;  3SEM A;  3CCL Q;  2EBP A;  3Q1J A;  2Q7G A;  2CT4 A;  3JCM b;  3CME A;  2PUO B;  2O31 A;  1RI9 A;  4XU0 A;  2DZC A;  2ODR D;  4Y91 A;  4UC4 A;  4WI1 A;  1SF9 A;  4F14 A;  1NJ8 A;  4LD9 K;  2RB6 A;  2HNI A;  2CGH A;  2QK0 A;  2EFI A;  3SWN C;  3JCM d;  2ZT5 A;  1Q81 C;  2AIR B;  3M4Q A;  3VS0 A;  4M4Z A;  1ZSG A;  2JM8 A;  4K11 A;  4IUT A;  2ZPF B;  1K1Z A;  4PJO C;  1VQM T;  2V8I A;  2I4L A;  3MF1 A;  4PNO A;  3CC7 Q;  1YJ9 T;  1ZX6 A;  2HQE A;  3UDC A;  2PVO B;  4XAX B;  3PE0 A;  5LJ3 g;  2KT1 A;  1QVF A;  2NS6 A;  2C0O A;  3S3N A;  1EFW A;  2O4X A;  1LJO A;  3EG9 B;  3H6Z A;  5GMK i;  3RKW A;  1SHF A;  4FYW B;  1XTD A;  1YJW A;  1D3B A;  1XJW B;  5FRM A;  2LJ3 A;  1TSF A;  2FEI A;  1N6A A;  3WXM B;  3EG1 A;  3EG9 A;  4CS4 A;  4KT0 E;  4BE1 A;  3JCM f;  2P0L A;  1KD1 R;  1WYX A;  3CCS A;  1C1A A;  3REB B;  4OB2 B;  1VQ9 T;  1JJC B;  4MDX A;  4OMQ A;  1YIJ Q;  1PKS A;  5IN1 A;  3W3S A;  1U1T A;  4D8D A;  1X6G A;  5CQX A;  4F04 B;  2CH4 A;  2FPF A;  1E1O A;  3GPL A;  3QJY A;  4LXC A;  5GAN h;  4YRQ A;  4KRT A;  4HXJ A;  2E5K A;  1X43 A;  3UF4 A;  3HTR A;  3NHN A;  2X4J A;  1YP5 A;  4CS2 A;  3IKM B;  2K5L A;  1QVG S;  1G3Y A;  2FPE A;  3CMA Q;  2DF6 A;  1PYS B;  3REX A;  4FSX A;  1HYO A;  2QQS A;  2ODR C;  1IHW A;  4D6W A;  1UB4 A;  3EHQ A;  2DRK A;  3HTZ A;  1M3A A;  1PYS A;  4J9B A;  2DX1 A;  3M58 A;  3I55 T;  4E6R A;  4BY6 C;  2VWF A;  3CBP A;  2KNB B;  4RQF A;  4AFQ C;  3OQ5 A;  3NTH A;  3X28 B;  3OSV A;  1YFS A;  4QQ6 A;  2DIQ A;  1RI0 A;  1X6O A;  3FRN A;  3PVQ A;  4XTX A;  3VU3 C;  4M7A E;  5GMK m;  3NFC A;  2MOX A;  5GAN 5;  3QG1 A;  3AHU A;  3OS5 A;  4C8Q B;  3P8B B;  4BI8 B;  2RO0 A;  3WVE B;  1G3S A;  3WQZ A;  1VQ8 A;  1VQ7 T;  1X2Q A;  3OA6 A;  1YHQ A;  4F16 A;  2AMC B;  2OI3 A;  4C8Q A;  2HL3 A;  1U1S A;  2E1H A;  4OVA A;  3I9Q A;  2F5T X;  2EWN A;  3M53 A;  4QQG A;  3CCL A;  3UFG A;  3LGL A;  5GAO l;  3ME9 A;  2R5A A;  2AMC A;  1BCM A;  3A8H B;  1WHL A;  4FYY B;  3I56 T;  1ARK A;  5CKD A;  3MPU B;  1K9A A;  1BI0 A;  4YYE A;  5LJ3 h;  2QTV A;  2RI5 A;  2D0N A;  1PSF A;  3CCR T;  3VUB A;  3CCM T;  4ZTF A;  4FM4 B;  3CPW A;  3VS2 A;  4MZP A;  2JW4 A;  4EPC A;  3EGX B;  3OYF A;  4XU3 A;  4KGX B;  5L8R E;  1H4S A;  2M9U A;  1UGV A;  4R55 A;  4FW2 A;  4M75 B;  3CC7 A;  3QUI A;  2CT3 A;  3M4G A;  3EGX A;  2CZ0 B;  4YPF A;  2AZS A;  1KSW A;  2H3E B;  1U5S A;  1Q81 R;  2DK3 A;  3QZ5 B;  4M75 A;  2KXC A;  4PKC C;  3M54 A;  1RAC B;  1BKB A;  1QCO A;  3H0H A;  4PJO B;  2JS0 A;  3T9N A;  3A31 A;  2R58 A;  5GAN d;  3QNE A;  1OX9 A;  1K76 A;  1NJ5 A;  4J6Y A;  3HL8 A;  3OBY A;  1FX7 A;  2IIM A;  2VV5 A;  4PJO A;  1MMG A;  2EQI A;  1NJ1 A;  2KYB A;  3MKD A;  3V7S A;  1OPK A;  1VQP Q;  2ZR2 A;  2JZ2 A;  3FDR A;  1VQ5 Q;  4AFU C;  2P84 A;  3HPW A;  4F7U F;  1YIJ A;  3M0S A;  4EDU A;  1LVK A;  1Z7M A;  1VIE A;  1OYX A;  2PU9 B;  3G7Z A;  1RAG B;  4YRL A;  4N4H A;  3HRT A;  4BI4 A;  4RDX A;  2VGN A;  3H8Z A;  4TQD A;  1MNE A;  3L42 A;  2AKW A;  3CMA A;  2ZPB B;  4RG2 A;  3FJ5 A;  2XI9 A;  5GAN f;  1H64 1;  1D0X A;  1ZA2 B;  4AFZ C;  2BIV A;  2DXC A;  3JCM J;  1SRL A;  5CO7 A;  4L59 A;  2ZAE A;  2EPD A;  2EYW A;  5HK0 A;  1JXM A;  4E7J A;  1W70 A;  5FU7 B;  2X4Y A;  2K3B A;  3RBB B;  4M78 F;  4R56 A;  1WIE A;  3LWH A;  2F1L A;  2QAS A;  1WU7 A;  1N9R A;  1X01 A;  3BY7 A;  4LVM A;  2VGM A;  4MZM A;  1SRM A;  5KYU B;  2LRQ A;  5KE2 A;  3CCJ Q;  1ABO A;  3VS3 A;  1UFF A;  1Z9Z A;  1KQS P;  2J05 A;  5D6W A;  4F7U G;  1AOJ A;  3JRZ A;  4JPB W;  5KYU A;  2E4H A;  4C0D C;  4H2S A;  2YLC A;  4KUL A;  1NJI U;  1DJ7 B;  1P92 A;  2NUP A;  2CYZ B;  2MWP A;  3N5B B;  3JB9 J;  1V29 B;  4J5Y A;  1Y96 B;  2VXE A;  5ELO A;  4E7K A;  2COZ A;  4JRK A;  4C92 E;  4E7I A;  2FL7 A;  2D9T A;  4XK8 E;  3P8T A;  2E65 A;  1BIA A;  3M4P A;  4Q6G A;  1TU0 B;  1UGQ B;  2DD4 A;  3BW1 A;  4B9X A;  1W1F A;  4L87 A;  3LH0 A;  4C8Q G;  3OYH A;  3CCV T;  4AMC A;  1QVP A;  4DBR A;  5CKF A;  1VOM A;  3BDL A;  1FMK A;  2CP6 A;  3RER A;  5GJV B;  1JBM A;  5GMK j;  4XTV A;  2DLP A;  2JS2 A;  4C5G A;  4M78 G;  1GBQ A;  4DPG A;  2PNI A;  4L6V 5;  2QQR A;  3P8D A;  2O9V A;  3C94 A;  1I5L A;  2YRC A;  3OYC A;  1FMV A;  4DEX A;  1G5H A;  1OZ3 A;  2D8H A;  1E22 A;  2I0N A;  1ZBX A;  5IHK A;  3A8L B;  4EO4 A;  5CAI A;  1XQH A;  4A54 A;  2P0K A;  4YCU A;  2MI6 A;  3A5Y A;  2YUP A;  2VC8 A;  1IGU A;  2VYT A;  2EQU A;  3QHS A;  1UTI A;  2RHX A;  2RJE A;  4E7Z A;  5D6Y A;  3CXC A;  4O6J A;  3UWN A;  1MV3 A;  1VYT A;  5ECA A;  1VQP A;  4FW1 A;  1VQ5 A;  2QDY B;  4ZIB A;  1B7Y B;  2PMF A;  2RQU A;  3M56 A;  3JCM g;  5GAO q;  3PFS A;  1K8A R;  2KQW A;  4PJO G;  2LCS A;  2CSQ A;  5FRN A;  3TCJ A;  4PL6 A;  3PVL A;  3R6N A;  1B7Y A;  3ZL7 C;  1E1T A;  5K1X A;  4HWR A;  5EG2 A;  5KH6 A;  2FPD A;  2O9S A;  2GFU A;  4CC7 A;  2PZ1 A;  3I5R A;  3LGF A;  4ANJ A;  3GF5 A;  1TUC A;  1Q82 U;  3OW2 A;  2RM4 A;  4RMF A;  1M3B A;  2IPO B;  2LCL A;  2QA4 Q;  2JTM A;  4DBH A;  3VRY A;  2EVR A;  2KAF A;  3JCM V;  2KSS A;  2DTI A;  3I35 A;  4P74 C;  2DE0 X;  2RQT A;  2CJB A;  1QVG P;  3X20 B;  2HZY A;  5KCH A;  2O88 A;  3RL6 A;  1WPY A;  3L2U A;  1YFN A;  2KI7 A;  1TUD A;  2DL8 A;  3EAE A;  3CCJ A;  1OU9 A;  2E3I A;  1I1J A;  2A3L A;  4J9C A;  5D6X A;  3C0C A;  3JCM X;  3KXT A;  5J39 A;  2CZ7 B;  2LVM A;  4E47 A;  2VVK A;  4HVC A;  2CP2 A;  3FEO A;  5CQY A;  1WA7 A;  3BE3 A;  2HDA A;  4A4G A;  1JRI A;  4XQ3 A;  1TXQ A;  1B3Q A;  2DNU A;  3PMI A;  4OMF B;  4XEO A;  2MIO A;  3A8M B;  1K4U S;  2A7Y A;  2LT4 A;  3L4G B;  3REU A;  2HBW A;  4JZ3 A;  4C0D B;  4QVZ A;  1IGQ A;  1ZBJ A;  2DQ0 A;  3RAC A;  4J6X A;  1K9M U;  3C12 A;  1F1B B;  3L4G A;  2JXB A;  1M90 U;  2PME A;  4KH0 B;  3TEH B;  3EG3 A;  2QAZ A;  3JB9 F;  1NZ9 A;  4KBM B;  4IUR A;  1C6V X;  1HK9 A;  4HVU A;  5C6S A;  2RPN A;  4M78 D;  2E5A A;  3TEH A;  2EW3 A;  4GY5 A;  2AZV A;  2JTE A;  4PK4 A;  4ZGJ B;  1T0J A;  1FWZ A;  1M2V B;  1ZQ1 A;  5GAO m;  1QLY A;  3HXW A;  1EZZ B;  2EKH A;  4X9D A;  4JS4 A;  1WXB A;  1WFW A;  2ED1 A;  3JCM h;  1WHH A;  4Q5W A;  2OTJ Q;  5M9O A;  1GBR A;  1MMA A;  1QP3 A;  3JB9 H;  2QGF B;  4M77 E;  3H9N A;  2HBP A;  2HSP A;  1ATI A;  5GAO r;  1YJN Q;  3UA7 A;  1VQL Q;  4QVD A;  2R57 A;  1ACM B;  2KY9 A;  1NYG A;  4M7D F;  2RQR A;  1M2O A;  2FZK B;  2Q5I A;  2EQK A;  5E3I A;  1NYF A;  2X3X D;  2EQJ A;  5GAN 4;  2RJD A;  3MEY A;  4BWA A;  5L23 A;  1R0C B;  1N27 A;  2RJF A;  4KR2 A;  3A5Z A;  5CK9 A;  3CCL T;  4YDQ A;  4OB3 B;  2HCK A;  4YRO A;  4ZGD B;  2C0T A;  1HD3 A;  5FWB A;  5LJ5 e;  2L8D A;  2XGT A;  3VQY A;  3OYD A;  3M55 A;  5CR2 A;  4CC3 A;  5DM7 R;  1KFZ A;  4Z8A A;  5GAN j;  2QA4 A;  3CPW S;  3X25 B;  4WCI A;  2XD0 A;  2L89 A;  3KFU A;  3ICA A;  2ZPE B;  4YRS A;  2EGA A;  2CS7 A;  5GAN g;  4XTU A;  2DXU A;  2FRW A;  3V8L A;  4FT4 A;  1BBW A;  1NBE B;  3NEM A;  4LVI A;  4J9G A;  2L3R A;  1JQQ A;  3R6O A;  3URG A;  1VQO Q;  5IHI A;  1VQ4 Q;  3GNF B;  5GAN 7;  2RMO A;  4M78 C;  4M7D G;  3E9H A;  1ASY A;  2LNH B;  2LT1 A;  1ZUY A;  1YB3 A;  3E2U A;  3I7F A;  2M1H A;  3E1S A;  1O9S A;  4BDZ A;  3JAM E;  1KHI A;  4DOW A;  2KE9 A;  2RA2 A;  4EMK C;  3HXZ A;  4K87 A;  1QWF A;  4P74 A;  2DTO A;  2V26 A;  1Q86 C;  2GFA A;  4HWP A;  2K3Y A;  3QKJ A;  4QKU A;  3A8G B;  2JOY A;  3OYY A;  2DXT A;  2HSE B;  1YIJ T;  1I5O B;  1H4V B;  1G8X A;  2AHJ B;  5KYX B;  1WLP B;  2DMO A;  4H2Y A;  1X69 A;  2RHZ A;  5GJW B;  2CSI A;  4E2F B;  3E9I A;  2B8A A;  1VQN Q;  3UH0 A;  3D7S B;  5KYX A;  3ASK A;  2FYK A;  1YIT Q;  5LJ3 j;  4WJ3 M;  2AKK A;  4OF1 A;  3CC4 Q;  3CMA T;  5CKE A;  2QXF A;  3THK A;  2O4X B;  4LDX A;  2LP5 A;  1D3B B;  1ABQ A;  4QT7 A;  2KRN A;  4FYV B;  5GAN 3;  2ESW A;  1TH7 A;  4JLG A;  4HWO A;  3OYG A;  4P5N A;  5HY6 A;  2OTJ A;  4NCX A;  3CCE Q;  2C06 A;  3PGG A;  2RHU A;  1AWW A;  3TU4 K;  1M1K R;  4E51 A;  3O5Z A;  2RI2 A;  3QSU A;  3PTA A;  2A08 A;  1WXT A;  4RMO A;  3JCM W;  1VQL A;  2QDL A;  4YP0 A;  3CEY A;  2GTJ A;  2J06 A;  2QGG A;  2K7A A;  3ZFJ A;  2DJQ A;  4JJN K;  4J15 A;  1AEY A;  1K0X A;  4LUE A;  3QPH A;  1UGP B;  3MHX A;  1YBY A;  1WJS A;  1E6G A;  4JDS A;  1AWO A;  4XU2 A;  3HY1 A;  3X24 B;  2XHC A;  2YUQ A;  4KQE A;  3DB4 A;  1D1C A;  4OMM A;  5I2M A;  1Q7Y U;  3QO7 A;  3UPU A;  4C5E A;  1BYM A;  5C0M A;  5IXF A;  3UA6 A;  4C0G A;  1KC8 U;  2NUZ A;  5A2Q E;  1GGM A;  2HKN A;  2WSC E;  4LVL A;  5I22 A;  2MF2 A;  2K57 A;  4F7U B;  2M0O A;  4ELZ C;  5GAN 6;  3CCU T;  3L2V A;  1U8R A;  2MPX C;  1VQK T;  3H41 A;  1BI2 A;  2J7I A;  4J9F A;  4F7U A;  4DQ2 A;  4LUD A;  1VQM Q;  2E64 A;  4FIB A;  1VQO A;  1BI3 A;  3VRZ A;  3HKS A;  2ABL A;  1VQ4 A;  2RJC A;  2PQW A;  2K6D A;  4ZTU B;  3M0P A;  3MET A;  2ZPH B;  1AZE A;  1M8M A;  1YJ9 Q;  3OYI A;  1WYD A;  4M7D D;  1BU1 A;  1VA7 A;  1NYR A;  1KK7 A;  2NYS A;  5ELN A;  3EFR A;  2CZ1 B;  3IAL A;  3MEA A;  1WX6 A;  4Y28 E;  3HFO A;  4M7A F;  2ALY B;  4DBF A;  4H02 A;  1VQP T;  1WLE A;  2LCC A;  1VQ5 T;  2KBT A;  3RKX A;  5GAM e;  4CH4 A;  4M78 B;  3QO5 A;  3PIO A;  1G5I A;  3MO8 A;  4YRI A;  1EVL A;  2ALY A;  1XOV A;  2KRM A;  2GNC A;  1WGS A;  4M78 A;  3EFS A;  4HA8 A;  3HFN A;  4EMK B;  1WQW A;  2MK5 A;  2LQW A;  2DM1 A;  4G85 A;  2JVV A;  1VQN A;  2DXB A;  2LX7 A;  3QBY A;  1Q86 R;  4CH6 A;  1UE9 A;  1E24 A;  2DL4 A;  4EMK A;  1YIT A;  1TS9 A;  3UT1 A;  2V8J A;  5FU6 C;  3MJX A;  3CC4 A;  1QW1 A;  3L2R A;  1QP2 A;  1RL2 A;  3MP1 A;  2DQ3 A;  4OLF A;  2DDZ A;  9ATC B;  1SES A;  3LC0 A;  1UHC A;  3SWN B;  2LQN A;  4A63 B;  4PLL A;  2X9H A;  5IHN A;  1N8R C;  2XDD A;  4FSS A;  2LTO A;  3PMT A;  3HRU A;  3QWX X;  2RNA A;  3H0I A;  1K8A C;  3SWN A;  3G4S T;  4DA4 A;  1X2G A;  2DET A;  1KQS A;  3CCJ T;  3I55 Q;  2ENM A;  1S72 T;  2YLB A;  3EGU A;  5GAM g;  1AHJ B;  3A8O B;  4OGC A;  2J6F A;  4TTV A;  3DLM A;  2V1Q A;  1VQZ A;  2IY5 B;  4OGE A;  5HGQ A;  2KRS A;  4EIK A;  5IH2 A;  4M7D C;  2OTL T;  4LNP A;  1R77 A;  4P75 C;  2IY5 A;  4M77 C;  1VQ7 Q;  4YRE A;  2P0Q A;  5KYN A;  2E41 A;  2AKW B;  2ZR3 A;  4H2X B;  2Q7E A;  5CKB A;  1S1N A;  1RLP C;  4DEY A;  4P3P A;  5LJ5 d;  3MP8 A;  3TEE A;  2E5Q A;  1B70 B;  4RQE A;  2DEU A;  1NE8 A;  5GAO p;  2D6F A;  1I8F A;  3GLX A;  3DLL A;  3P8V A;  4H2X A;  1RAH B;  2XU8 A;  5GAN 2;  2JMC A;  3VV0 A;  1H92 A;  4QVC A;  1B70 A;  3ERR A;  2E12 A;  4NS5 A;  2F5K A;  3VKI A;  4C8Q E;  4DOV A;  3GNG A;  2Q7H A;  1RAD B;  3CCM Q;  1Y7X A;  2D1X A;  5KCO A;  2E3H A;  3G71 Q;  1VQM A;  2QI2 A;  4KGZ B;  4XEM A;  2FO0 A;  1VQ6 T;  3VJP A;  4CI0 C;  4PHC A;  2NUP B;  3NEL A;  3OS1 A;  1SPK A;  2CRE A;  1M3C A;  4ZTJ A;  2BE7 D;  2ART A;  2RQW A;  1JJ2 S;  2DIG A;  4N0A C;  1IO6 A;  2KDS A;  1QKX A;  5LJ5 f;  3OYL A;  2XTI A;  4BY6 B;  2NWM A;  1Y71 A;  3HP9 A;  4BI3 A;  3V8J A;  1Q82 C;  3TQ7 P;  2YWW A;  3A7A A;  1LOJ A;  2PVD B;  4TWA A;  2M0Y A;  1RAB B;  2E70 A;  4M75 E;  2HD0 A;  2EKO A;  1YFT A;  2W10 A;  1G3W A;  5CVI A;  1N9S A;  4C92 F;  4LN2 A;  4O2D A;  3S3O A;  3M0Q A;  8ATC B;  4M75 F;  4PJO E;  4JRI A;  1W2B S;  1MHN A;  1GFC A;  4EMG A;  3HSB A;  2QA4 T;  4FCY A;  4JZ4 A;  1ADY A;  1G51 A;  4TVW A;  4RTX A;  3G6E Q;  5GAM h;  3PZC A;  3REA B;  2LC4 A;  2DVJ A;  3V8K A;  1EIF A;  1AWJ A;  3RF1 A;  1QVG A;  1I07 A;  4EMH A;  2E10 A;  2X35 A;  3MEU A;  2EIF A;  4IUU A;  1G83 A;  1TUG B;  3HFV A;  3QDF A;  1X27 A;  1B8A A;  3QXE B;  3RMS A;  5FU6 B;  5LL6 S;  3CD6 T;  1Y07 A;  4E7S A;  2DAQ A;  3NPF A;  3I55 A;  1WNL A;  3CCQ T;  4JJB A;  1GRI A;  2QQB A;  4M7A D;  2ZTG A;  1NJI R;  2ZNI A;  3P8H A;  4LDU A;  1LPL A;  1IZ6 A;  4ATO A;  2H8H A;  1VUB A;  4IUP A;  5A0L A;  2DU7 A;  1M90 C;  2OAU A;  1N8R R;  1UEB A;  4IIO A;  2Y4Y A;  1NJ6 A;  3FLG A;  1EQR A;  4JJD A;  4C92 G;  4PFZ A;  2KK4 A;  1W4S A;  3M0T A;  2PUK B;  1VQ7 A;  2GGR A;  1KMM A;  3LLR A;  5J3B A;  1K73 U;  3CME T;  4JJC A;  1H3Z A;  3M4Y A;  4PFP A;  1HXD A;  1C0M A;  2HL5 C;  4XTW A;  4GBQ A;  2DA9 A;  4HT8 A;  2G3R A;  4ZN1 A;  1EVK A;  4A4E A;  4M7D B;  2ZXF A;  4ZGE B;  2RHS B;  5FW9 A;  2M51 A;  2XG8 D;  2NLU A;  4CS3 A;  3JCM P;  3CCV Q;  2FZG B;  4LNS A;  1R8O B;  3CCM A;  3HFZ B;  4IUV A;  4M7D A;  2L2P A;  2RHS A;  5EC7 A;  1X6B A;  3DB3 A;  4HCK A;  4P75 A;  3G71 A;  3A7U A;  1OOT A;  2A37 A;  2JUF A;  1M30 A;  4E7L A;  4ZNX A;  4J8O A;  3V7C A;  1GFD A;  2LDM A;  1OZ2 A;  4BD3 A;  1QVF S;  3HFZ A;  2DL5 A;  3FIF A;  3DSQ A;  4YRT A;  3LSS A;  2QEX Q;  3CC2 Q;  5A0D A;  1IB8 A;  1ZSZ C;  2AKL A;  2VB6 A;  2GCX A;  2DTH A;  2CH4 W;  2OTJ T;  4WF2 A;  1YJW T;  3KBG A;  3EH1 A;  2CDT A;  4QW2 A;  4H2U A;  1GL5 A;  4JUV A;  2DZ9 A;  3OYM A;  1M5Q 1;  2YT6 A;  12AS A;  2ZCF B;  1KOG A;  2DJZ A;  3CCS T;  4JS5 A;  5GAM d;  4M7A C;  5K1P A;  4O5V A;  3TEG A;  4HCC A;  1UJY A;  4RTT A;  1OQK A;  4CH5 A;  5C53 B;  4CC4 B;  4FL6 A;  2EAY A;  2GQI A;  1MV0 B;  4LDY A;  3EG0 A;  2NUT A;  5KYW B;  5AYF A;  2HQH A;  1Q82 R;  1SER A;  1YI2 Q;  7AT1 B;  2EL9 A;  1RAA B;  5KE3 A;  2D8J A;  4NOY A;  3S6W A;  1MMD A;  5KYW A;  1M1K C;  3G6E A;  1PD0 A;  1QE0 A;  1E7O A;  1OU8 A;  1BB9 A;  4ZN3 A;  1V1C A;  5HKC A;  2XDB A;  3R07 A;  1B7T A;  3HRI A;  1H4T A;  3TSW A;  2QHV A;  2KR3 A;  1D0Y A;  2ZT7 A;  3NMZ C;  2HQX A;  2DD5 A;  3NET A;  1EIY A;  2K5I A;  4AG1 C;  3TSZ A;  1R0B G;  5GAM f;  4G84 A;  4P3O A;  2BUD A;  3PIP A;  1BBZ A;  2I4M A;  1GCQ C;  2A36 A;  1VQO T;  2Q5H A;  1VQ4 T;  3X26 B;  3BJU A;  3BFM A;  1MGQ A;  4RKU E;  4D8K A;  1I81 A;  2G6F X;  2R5M A;  4RG8 A;  1VQ8 T;  3M5A A;  4M77 F;  3A5Z B;  3INZ A;  3G1J A;  1FMW A;  2P4T A;  2ZT8 A;  1M27 C;  1OPL A;  4JRP A;  1YHQ T;  1YCS B;  2MWO A;  2K2V A;  4OML A;  4C92 D;  4HWT A;  5I11 A;  5KYY A;  2QYZ A;  2QHS A;  3JB9 G;  2GQV A;  2DYI A;  3GP8 A;  1T3S A;  2X3W D;  5A0G A;  1PHT A;  2AK5 A;  3P8Y A;  4J7F A;  1H4Q A;  1G2B A;  5DLQ E;  1M90 R;  4V2S A;  1NNH A;  1BBU A;  4QQD A;  2ZZE A;  3CPF A;  1JU5 C;  2QHT A;  3CCV A;  1AZG B;  1YIT T;  4HCZ A;  3VQW A;  1KQ1 A;  2EQM A;  1QQJ A;  2E6N A;  3CC7 T;  3HY0 A;  2Z0W A;  1WHJ A;  4B9W A;  2J3M A;  3AT1 B;  4FU6 A;  3M57 A;  4OB1 B;  4HVW A;  4XTY A;  4KGV B;  1NJ2 A;  2LX9 A;  2QEX A;  3CC2 A;  4AFS C;  5D7U A;  1H8K A;  1OUL A;  4KUI A;  3KFV A;  4M77 G;  1KQS S;  2I4N A;  3SFM A;  3ULR B;  2KYM A;  3OS0 A;  4TVA A;  4RTV A;  1UUE A;  2EYX A;  1D1B A;  4A4H A;  1Q7Y C;  5LJ5 g;  2YRV A;  1ZSZ B;  1TTH B;  1KC8 C;  4LVK A;  2ZT6 A;  2RH2 A;  5LJ3 e;  2YSQ A;  2ZCE A;  2JMA A;  3F70 A;  4YRN A;  1PC0 A;  2L0A A;  1ZSZ A;  1ZUU A;  4BUG A;  5C52 B;  4EX5 A;  1KD1 U;  5KNN A;  3JCM c;  5DY9 A;  2EYZ A;  1PM3 A;  2VUB A;  3JB9 I;  1YI2 A;  2C7I A;  1USY C;  2CP3 A;  4J9I A;  4C92 C;  3OYJ A;  3VS7 A;  3EH2 A;  5FWC A;  1XNI A;  4M7A B;  1VYV A;  2C0I A;  6AT1 B;  4M75 C;  4KUD K;  2BTT A;  2EJF A;  1X54 A;  4OMP A;  4M7A A;  3A32 A;  4TQF A;  4NL2 A;  3OY9 A;  1W2B P;  4YRC A;  1QMC A;  4OMO A;  1X2K A;  2DPP B;  4UP7 A;  4YRP A;  4ESR A;  2RN8 A;  3UGQ A;  3LYI A;  2J6K A;  1B07 A;  2DO3 A;  1YJN A;  4IIM A;  1RLQ C;  3EGD B;  2BE9 B;  2FB7 A;  4HKE A;  1WI7 A;  2VAS A;  1QWE A;  3E9G A;  3C95 A;  3EGD A;  2I4O A;  3JV3 A;  3PCO B;  3MEW A;  2CKK A;  3LSQ A;  3SHW A;  2J3L A;  1WXU A;  3PCO A;  2EYQ A;  1M1G A;  3M9Q A;  3TRE A;  2DER A;  3U23 A;  1G5V A;  1OI1 A;  5F5W A;  1GCQ A;  3JB9 D;  2XIC A;  3IG2 A;  2P0P A;  3JSC A;  4BE0 A;  2K5F A;  2W0Z A;  4H2W A;  4NL3 A;  4PJN A;  4C0Z A;  1ZA1 B;  4K86 A;  4ME7 A;  1JJC A;  3QDR B;  2YUO A;  1H3H A;  5FU7 C;  2EJG A;  2PVG B;  4LDV A;  1YN8 A;  4E7H A;  3O8V A;  2Y4X A;  1Q86 U;  1SRY A;  1BI1 A;  1PRM C;  2MYS A;  3L1A A;  4RCB A;  5LJ5 h;  2KRO A;  3MQZ A;  4YRJ A;  2ATC B;  2ZPG B;  1FYN A;  1UJ0 A;  4N4G A;  2EYY A;  1B34 B;  2WSF E;  1RAF B;  2FVU A;  4UPA A;  4M77 D;  2CUD A;  3CXC S;  1TG0 A;  1WZO A;  1Q81 U;  1QVF P;  2P4R A;  5I21 A;  1B34 A;  1WJR A;  2X4W A;  1UG1 A;  2CJ9 A;  3MCA B;  1RIQ A;  2ROT A;  1JXO A;  4YCV A;  3LX7 A;  3C4S A;  3GIB A;  4UP8 A;  1KJW A;  2RK2 A;  1VQ9 Q;  3M0R A;  2KGT A;  2Y90 A;  2X4X A;  1EFN A;  1WDX A;  2CIM A;  2CP5 A;  1B76 A;  1Q7Y R;  1SET A;  2GF7 A;  1NEG A;  3OW2 S;  1KC8 R;  2F69 A;  2I2L A;  2LMJ A;  3NTK A;  1CSK A;  4LE9 A;  4HCB A;  3JCM Q;  4OP0 A;  2EGE A;  1NJI C;  1HSQ A;  2QQ9 A;  4PG3 A;  5HK3 A;  3VQX A;  5GAN 8;  3ZEH A;  2ARU A;  3QJ6 A;  2JJ9 A;  4TVY A;  1UEC A;  4N4I A;  4KR3 A;  5GAM j;  1IXD A;  2M02 A;  4C92 B;  1SG5 A;  3CBM A;  3G71 T;  3VBB A;  3EG2 A;  1NPR A;  3CCE A;  3E19 A;  3MP6 A;  4M7A G;  3FJP A;  3CCU Q;  4WTO B;  1USY A;  1VQK Q;  2ED0 A;  2PTK A;  4C92 A;  1L0W A;  4XU1 A;  3QWY A;  1NM7 A;  5IT9 E;  1KMN A;  1D09 B;  4IUQ A;  3G1Z A;  2OJ2 A;  2HAX A;  1ZHI A;  2DVE A;  3PT9 A;  1KQ2 A;  2LZ6 B;  1CKB A;  1CKA A;  1UGR B;  2K3X A;  4F7U E;  4AG2 C;  1HC7 A;  4MDW A;  1X55 A;  4ZTZ B;  2B86 A;  1FXX A;  1NG2 A;  4CH3 A;  5FRO A;  4JRQ A;  3WVD B;  2DBM A;  4ORZ A;  3HXY A;  2VKN A;  1EOV A;  2BZX A;  2XK0 A;  2XID A;  1SEM A;  2DRM A;  3A7R A;  4FYX B;  1YCY A;  2YDL A;  2M16 A;  1OX8 A;  4OB0 B;  2ZZG A;  3I56 Q;  1NYQ A;  2SEM A;  2LQ8 A;  3NGP A;  2A8E A;  2XMF A;  4A53 A;  3J7A F;  1PNJ A;  3CCR Q;  2RI3 A;  3I5S A;  2LNV A;  4PJL A;  3G6E T;  2DIL A;  3QZ9 B;  2BZ8 A;  1NLP C;  3RR6 A;  4VUB A;  2DFU A;  1WHK A;  3CPW P;  4GLK A;  3RNJ A;  1JEG A;  2V8K A;  1PSE A;  4M78 E;  5HCK A;  1OV3 A;  1T3L A;  4C8Q F;  3QII A;  2BKD N;  1YJ9 A;  2DYB A;  2GBQ A;  3HHT B;  1ZLM A;  3PNW C;  2J6O A;  3L2Z A;  1YNZ A;  2E3C A;  4BB7 A;  3OYK A;  2HEQ A;  3UAT A;  3VS1 A;  4P73 C;  1KIK A;  1PCX A;  1D0Z A;  4BAC A;  1K73 C;  1Y57 A;  4BE2 A;  3HXX A;  1Q95 G;  1RAI B;  5J26 A;  1JB0 E;  3G4S Q;  2FZC B;  3CBO A;  3EFO B;  4RTU A;  5GMK e;  1SKU B;  1S72 Q;  1M9S A;  4A4K A;  1Z9Q A;  2JM9 A;  3RES A;  2A28 A;  3EFO A;  5LJ3 d;  1PKT A;  1PRL C;  1PG5 B;  1LYL A;  4CC2 A;  2LJ1 A;  1VQ9 A;  1FYF A;  2L5Q A;  2RHY A;  3M0U A;  1UDL A;  5IAY A;  1N8R U;  1KHC A;  2F2V A;  2XDP A;  2L3Q A;  2L3P A;  4DBQ A;  3L2W A;  2OTL Q;  5CCA A;  1K8A U;  2XKO C;  4Z02 A;  1K0S A;  4P72 C;  1Y96 A;  4P71 C;  2FG0 A;  4J9D A;  4C5H A;  3SB2 A;  1JO8 A;  2VXF A;  4KH1 B;  4H2V A;  4TVR A;  1M8V A;  2JN0 A;  3JCM e;  4PJO F;  2O2O A;  3QYG B;  2SRC A;  1YWO A;  4A4F A;  2DEQ A;  2CP7 A;  2O01 E;  2OX7 A;  3HXV A;  2K9G A;  3CCU A;  5LJ3 f;  3L2Q A;  4J9H A;  3UGT A;  3LW5 E;  8AT1 B;  2QEX T;  1VQK A;  3CC2 T;  1I0C A;  4YRR A;  5GAO n;  2D0Q B;  3EHR A;  2ZGW A;  3NTI A;  1IHV A;  4MZT A;  2ZZD A;  1ADJ A;  1UHF A;  5C51 B;  1VQ6 Q;  1K9M C;  2FHD A;  5CIU A;  4PJJ A;  1W6X A;  2KXD A;  5I2S A;  1ZUK A;  4C5I A;  2P5I A;  3SDZ A;  4Z89 A; 
#chains in the Genus database with same CATH homology
 4PLI A;  1YFR A;  4H2T A;  4M75 G;  4HT9 A;  11AS A;  3HXU A;  2ZZF A;  3QO3 A;  1Z7N A;  2G4C A;  3J81 E;  3RGL A;  1M4Z A;  3I56 A;  3VYH B;  1YI2 T;  4M77 B;  3A74 A;  4BW9 A;  2RHQ B;  4X9C A;  1ASZ A;  3CCR A;  2QQA A;  3NEN A;  3CMQ A;  4M77 A;  1WJQ A;  5GMK l;  2RHQ A;  2ARS A;  4AH6 A;  1C0A A;  2RK1 A;  1I4K 1;  1N9W A;  3QTC A;  1X75 C;  3KUF A;  2IVW A;  3MF2 A;  2K4Y A;  4X34 A;  2RHI A;  4L5G A;  2YHT A;  1YJN T;  1VQL T;  3G4S A;  2RD1 A;  2KVQ G;  3ZBD A;  4IKF A;  1S72 A;  4J7I A;  1IRE B;  1J5W A;  3OD1 A;  3HRS A;  3RMQ A;  4II1 A;  5FLX E;  3RIR A;  4XTZ A;  4N0A A;  2OTL A;  2H3J A;  4P73 A;  3OYA A;  2ZIM A;  2ZIO A;  3TUP A;  4UP9 A;  3ER0 A;  5GMK h;  4LD6 A;  4ELY C;  1EIY B;  3OBW A;  3VUZ A;  1SSF A;  2JTF A;  2WAC A;  3RUX A;  1UGS B;  3DKM A;  4C8Q D;  4YRK A;  1GXI E;  4FT2 A;  4MML A;  3MEV A;  4RCC A;  2ZPI B;  3FC3 A;  3QYH B;  4HWS A;  2DKG A;  2IG0 A;  3OSS C;  3OMC A;  2WSE E;  2MAM A;  3BDU A;  4YRG A;  4P72 A;  2DU5 A;  1KD1 C;  4P71 A;  4J83 A;  1VQ6 A;  1M1F A;  2QHU A;  5DLO A;  4M7D E;  5GAN e;  1IL2 A;  1QF6 A;  1JJ2 A;  3RKY A;  2JNG A;  2MMP A;  2ZIN A;  4YCW A;  3FB9 A;  4MMK A;  3HRK A;  4M75 D;  5CKH A;  1VIF A;  4P3N A;  3OYB A;  4CRI A;  1VQN T;  1X2H A;  2E6Z A;  1W66 A;  2QTX A;  3OYN A;  3OYE A;  3M59 A;  4PJO D;  3J80 E;  1NPP A;  3CC4 T;  2EJ9 A;  2C8M A;  1HTT A;  3V7R A;  4BDY A;  1X56 A;  1W2B A;  1G3T A;  1LNX A;  4TVA B;  3OS2 A;  4YRF A;  1WQ7 A;  3GOX A;  3QO8 A;  4C0F A;  3CCE T;  5LJ5 j;  4C8Q C;  3OMG A;  4YTL A;  3VYG A;  4JLI A;  4K88 A;  3VQV A;  3S3M A;  4YRM A;  3CD6 A;  2ZNJ A;  3CCQ A;  4WJ4 A;  4J6W A;  4LVJ A;  3E9F A;  1M1K U;  4LDW A;  4Q15 A;  1YGB A;  2KMT A;  1BIB A;  2LQK A;  3IKL A;  1O75 A;  4HT4 A;  2CJA A;  2CZ6 B;  1KG1 A;  3LWI A;  4X5O A;  3OB9 A;  3SD4 A;  2Q7G A;  3Q1J A;  3JCM b;  3CME A;  2PUO B;  4XU0 A;  2DZC A;  2ODR D;  4Y91 A;  4UC4 A;  4WI1 A;  1NJ8 A;  4LD9 K;  2RB6 A;  2HNI A;  2CGH A;  2EFI A;  3SWN C;  3JCM d;  2ZT5 A;  1Q81 C;  3M4Q A;  4IUT A;  2ZPF B;  4PJO C;  1VQM T;  2V8I A;  2I4L A;  3MF1 A;  4PNO A;  1YJ9 T;  2HQE A;  3UDC A;  2PVO B;  4XAX B;  5LJ3 g;  1QVF A;  2NS6 A;  1EFW A;  3S3N A;  2O4X A;  1LJO A;  3H6Z A;  5GMK i;  3RKW A;  1YJW A;  1XTD A;  5FRM A;  1D3B A;  1N6A A;  3WXM B;  4CS4 A;  4KT0 E;  4BE1 A;  3JCM f;  2P0L A;  3CCS A;  4OB2 B;  1VQ9 T;  1JJC B;  4MDX A;  5IN1 A;  3W3S A;  1U1T A;  5CQX A;  1E1O A;  3GPL A;  3QJY A;  5GAN h;  4YRQ A;  2X4J A;  4CS2 A;  3IKM B;  2K5L A;  1QVG S;  1G3Y A;  1PYS B;  3REX A;  4FSX A;  2QQS A;  2ODR C;  4D6W A;  1UB4 A;  3HTZ A;  1PYS A;  3I55 T;  3M58 A;  4BY6 C;  3CBP A;  4RQF A;  3OQ5 A;  3NTH A;  3X28 B;  3OSV A;  1YFS A;  4QQ6 A;  2DIQ A;  1RI0 A;  1X6O A;  3FRN A;  4XTX A;  3VU3 C;  4M7A E;  5GMK m;  3NFC A;  5GAN 5;  3QG1 A;  3AHU A;  3OS5 A;  4C8Q B;  3P8B B;  4BI8 B;  2RO0 A;  3WVE B;  1G3S A;  3WQZ A;  1VQ8 A;  1VQ7 T;  3OA6 A;  1YHQ A;  2AMC B;  4C8Q A;  1U1S A;  2E1H A;  4OVA A;  2F5T X;  2EWN A;  3M53 A;  4QQG A;  3CCL A;  3UFG A;  3LGL A;  5GAO l;  3ME9 A;  2R5A A;  2AMC A;  3A8H B;  3I56 T;  5CKD A;  1BI0 A;  4YYE A;  5LJ3 h;  2RI5 A;  1PSF A;  3CCR T;  3VUB A;  3CCM T;  4ZTF A;  4FM4 B;  3CPW A;  4MZP A;  4EPC A;  3OYF A;  4XU3 A;  5L8R E;  1H4S A;  2M9U A;  4R55 A;  4M75 B;  3CC7 A;  3QUI A;  3M4G A;  2CZ0 B;  4YPF A;  2DK3 A;  3QZ5 B;  4M75 A;  4PKC C;  3M54 A;  1BKB A;  4PJO B;  3T9N A;  3A31 A;  2R58 A;  5GAN d;  3QNE A;  1NJ5 A;  4J6Y A;  3HL8 A;  3OBY A;  1FX7 A;  2VV5 A;  4PJO A;  1NJ1 A;  3V7S A;  2ZR2 A;  2JZ2 A;  3FDR A;  3HPW A;  4F7U F;  1YIJ A;  4EDU A;  1Z7M A;  1VIE A;  1OYX A;  2PU9 B;  3G7Z A;  4YRL A;  4N4H A;  3HRT A;  4BI4 A;  4RDX A;  2VGN A;  3H8Z A;  4TQD A;  3L42 A;  2AKW A;  3CMA A;  2ZPB B;  4RG2 A;  5GAN f;  2XI9 A;  1H64 1;  2BIV A;  2DXC A;  3JCM J;  5CO7 A;  4L59 A;  5HK0 A;  4E7J A;  5FU7 B;  2X4Y A;  4M78 F;  4R56 A;  3LWH A;  1WU7 A;  1N9R A;  1X01 A;  3BY7 A;  4LVM A;  2VGM A;  4MZM A;  2LRQ A;  5KE2 A;  5D6W A;  4F7U G;  3JRZ A;  4C0D C;  4H2S A;  2YLC A;  4KUL A;  1NJI U;  1DJ7 B;  1P92 A;  2CYZ B;  2MWP A;  3N5B B;  3JB9 J;  1V29 B;  4J5Y A;  1Y96 B;  2VXE A;  5ELO A;  4E7K A;  4JRK A;  4C92 E;  4E7I A;  2FL7 A;  2D9T A;  4XK8 E;  3P8T A;  2E65 A;  1BIA A;  3M4P A;  4Q6G A;  2DD4 A;  1UGQ B;  3BW1 A;  4B9X A;  4L87 A;  3LH0 A;  4C8Q G;  3OYH A;  3CCV T;  1QVP A;  5CKF A;  3BDL A;  3RER A;  1JBM A;  5GMK j;  4XTV A;  4C5G A;  4M78 G;  4DPG A;  4L6V 5;  2QQR A;  3P8D A;  3C94 A;  1I5L A;  3OYC A;  1G5H A;  1OZ3 A;  1E22 A;  1ZBX A;  3A8L B;  4EO4 A;  5CAI A;  1XQH A;  4A54 A;  2P0K A;  4YCU A;  2MI6 A;  3A5Y A;  2VC8 A;  2VYT A;  2EQU A;  3QHS A;  2RHX A;  2RJE A;  5D6Y A;  3CXC A;  4O6J A;  3UWN A;  1VQP A;  1VQ5 A;  2QDY B;  4ZIB A;  1B7Y B;  2PMF A;  3M56 A;  3JCM g;  5GAO q;  3PFS A;  2KQW A;  4PJO G;  5FRN A;  3TCJ A;  4PL6 A;  1B7Y A;  1E1T A;  5K1X A;  4HWR A;  5EG2 A;  5KH6 A;  2GFU A;  3LGF A;  3GF5 A;  1Q82 U;  3OW2 A;  2RM4 A;  4RMF A;  2LCL A;  2JTM A;  2KAF A;  3JCM V;  2KSS A;  2DTI A;  4P74 C;  2CJB A;  3X20 B;  5KCH A;  3RL6 A;  1WPY A;  3L2U A;  3EAE A;  3CCJ A;  2A3L A;  5D6X A;  3JCM X;  3KXT A;  5J39 A;  2CZ7 B;  2LVM A;  4E47 A;  4HVC A;  3FEO A;  5CQY A;  4A4G A;  1JRI A;  4XQ3 A;  3PMI A;  4OMF B;  4XEO A;  3A8M B;  2A7Y A;  2LT4 A;  3L4G B;  3REU A;  4C0D B;  4QVZ A;  2DQ0 A;  3RAC A;  4J6X A;  1K9M U;  3C12 A;  3L4G A;  1M90 U;  2PME A;  3TEH B;  3JB9 F;  1NZ9 A;  4KBM B;  4IUR A;  1HK9 A;  5C6S A;  2E5A A;  4M78 D;  3TEH A;  4GY5 A;  4ZGJ B;  1FWZ A;  1ZQ1 A;  5GAO m;  3HXW A;  4X9D A;  4JS4 A;  3JCM h;  4Q5W A;  5M9O A;  3JB9 H;  1QP3 A;  4M77 E;  2HBP A;  1ATI A;  5GAO r;  4QVD A;  2R57 A;  2KY9 A;  4M7D F;  2Q5I A;  2EQK A;  5E3I A;  2EQJ A;  5GAN 4;  2RJD A;  3MEY A;  4BWA A;  1N27 A;  2RJF A;  4KR2 A;  3A5Z A;  5CK9 A;  3CCL T;  4YDQ A;  4OB3 B;  4YRO A;  4ZGD B;  2XGT A;  5LJ5 e;  2L8D A;  3VQY A;  3OYD A;  3M55 A;  5CR2 A;  5DM7 R;  5GAN j;  2QA4 A;  3CPW S;  3X25 B;  2XD0 A;  2L89 A;  3KFU A;  3ICA A;  2ZPE B;  4YRS A;  2CS7 A;  5GAN g;  4XTU A;  2DXU A;  3V8L A;  4FT4 A;  1BBW A;  3NEM A;  4LVI A;  2L3R A;  3URG A;  3R6O A;  3GNF B;  5GAN 7;  4M78 C;  4M7D G;  3E9H A;  1ASY A;  2LT1 A;  1YB3 A;  3I7F A;  2M1H A;  3E1S A;  1O9S A;  4BDZ A;  3JAM E;  1KHI A;  4DOW A;  2RA2 A;  4EMK C;  3HXZ A;  4K87 A;  4P74 A;  2DTO A;  1Q86 C;  2GFA A;  4HWP A;  2K3Y A;  3QKJ A;  3A8G B;  2JOY A;  3OYY A;  2DXT A;  1YIJ T;  1H4V B;  2AHJ B;  4H2Y A;  2RHZ A;  3E9I A;  2B8A A;  3UH0 A;  3ASK A;  2FYK A;  5LJ3 j;  4WJ3 M;  4OF1 A;  3CMA T;  5CKE A;  2QXF A;  2O4X B;  4LDX A;  1D3B B;  5GAN 3;  1TH7 A;  4JLG A;  4HWO A;  3OYG A;  4P5N A;  5HY6 A;  2OTJ A;  4NCX A;  2C06 A;  3PGG A;  2RHU A;  4E51 A;  3TU4 K;  2RI2 A;  3QSU A;  3PTA A;  4RMO A;  3JCM W;  1VQL A;  4YP0 A;  3CEY A;  3ZFJ A;  4JJN K;  4J15 A;  3QPH A;  1UGP B;  3MHX A;  1YBY A;  1WJS A;  4JDS A;  4XU2 A;  3HY1 A;  3X24 B;  2XHC A;  4KQE A;  3DB4 A;  5I2M A;  1Q7Y U;  3QO7 A;  3UPU A;  4C5E A;  1BYM A;  5C0M A;  4C0G A;  1KC8 U;  1GGM A;  5A2Q E;  2WSC E;  4LVL A;  2MF2 A;  2K57 A;  4F7U B;  2M0O A;  4ELZ C;  5GAN 6;  3CCU T;  3L2V A;  1U8R A;  1VQK T;  1BI2 A;  4F7U A;  4DQ2 A;  2E64 A;  4FIB A;  1VQO A;  1BI3 A;  3HKS A;  1VQ4 A;  2RJC A;  2PQW A;  4ZTU B;  3MET A;  2ZPH B;  3OYI A;  1WYD A;  4M7D D;  1NYR A;  5ELN A;  3EFR A;  2CZ1 B;  3IAL A;  3MEA A;  4Y28 E;  3HFO A;  4M7A F;  2ALY B;  4H02 A;  1VQP T;  1WLE A;  2LCC A;  1VQ5 T;  3RKX A;  5GAM e;  4CH4 A;  4M78 B;  3QO5 A;  3PIO A;  1G5I A;  3MO8 A;  4YRI A;  1EVL A;  2ALY A;  1XOV A;  4M78 A;  1WGS A;  3EFS A;  4HA8 A;  3HFN A;  4EMK B;  1WQW A;  4G85 A;  2JVV A;  1VQN A;  2DXB A;  3QBY A;  4CH6 A;  1E24 A;  4EMK A;  1YIT A;  3UT1 A;  2V8J A;  5FU6 C;  3CC4 A;  1QW1 A;  3L2R A;  1QP2 A;  1RL2 A;  3MP1 A;  2DQ3 A;  4OLF A;  2DDZ A;  1SES A;  3LC0 A;  3SWN B;  4PLL A;  1N8R C;  2XDD A;  2LTO A;  3PMT A;  3HRU A;  1K8A C;  3SWN A;  3G4S T;  4DA4 A;  1X2G A;  1KQS A;  3CCJ T;  1S72 T;  2YLB A;  5GAM g;  1AHJ B;  3A8O B;  4OGC A;  4TTV A;  3DLM A;  1VQZ A;  2IY5 B;  4OGE A;  5HGQ A;  4M7D C;  2OTL T;  4P75 C;  2IY5 A;  4M77 C;  4YRE A;  2P0Q A;  2E41 A;  2AKW B;  2ZR3 A;  4H2X B;  2Q7E A;  5CKB A;  4P3P A;  5LJ5 d;  3MP8 A;  3TEE A;  2E5Q A;  1B70 B;  4RQE A;  1NE8 A;  5GAO p;  2D6F A;  1I8F A;  3GLX A;  3DLL A;  3P8V A;  4H2X A;  2XU8 A;  5GAN 2;  3VV0 A;  1B70 A;  4QVC A;  3ERR A;  2E12 A;  4NS5 A;  2F5K A;  3VKI A;  4C8Q E;  4DOV A;  3GNG A;  2Q7H A;  1Y7X A;  5KCO A;  1VQM A;  2QI2 A;  4XEM A;  1VQ6 T;  3VJP A;  4CI0 C;  4PHC A;  3NEL A;  3OS1 A;  4ZTJ A;  2ART A;  1JJ2 S;  2DIG A;  4N0A C;  2KDS A;  5LJ5 f;  3OYL A;  2XTI A;  4BY6 B;  1Y71 A;  3HP9 A;  4BI3 A;  3V8J A;  1Q82 C;  3A7A A;  1LOJ A;  2PVD B;  4TWA A;  2E70 A;  4M75 E;  2HD0 A;  2EKO A;  1YFT A;  1G3W A;  5CVI A;  1N9S A;  4C92 F;  4O2D A;  3S3O A;  4M75 F;  4PJO E;  4JRI A;  1W2B S;  1MHN A;  3HSB A;  4EMG A;  2QA4 T;  1ADY A;  1G51 A;  4TVW A;  5GAM h;  3PZC A;  2LC4 A;  3V8K A;  1EIF A;  3RF1 A;  1QVG A;  4EMH A;  2E10 A;  2X35 A;  3MEU A;  2EIF A;  4IUU A;  3HFV A;  1B8A A;  3QXE B;  3RMS A;  5FU6 B;  5LL6 S;  3CD6 T;  1Y07 A;  2DAQ A;  3I55 A;  1WNL A;  3CCQ T;  2QQB A;  4M7A D;  2ZTG A;  2ZNI A;  3P8H A;  4LDU A;  1IZ6 A;  4ATO A;  1VUB A;  4IUP A;  5A0L A;  2DU7 A;  1M90 C;  2OAU A;  1UEB A;  2Y4Y A;  1NJ6 A;  3FLG A;  1EQR A;  4C92 G;  2KK4 A;  1W4S A;  2PUK B;  1VQ7 A;  1KMM A;  3LLR A;  5J3B A;  1K73 U;  3CME T;  1H3Z A;  3M4Y A;  1HXD A;  4XTW A;  4HT8 A;  2G3R A;  4ZN1 A;  1EVK A;  4A4E A;  4M7D B;  2ZXF A;  4ZGE B;  2RHS B;  2XG8 D;  2NLU A;  4CS3 A;  3JCM P;  4LNS A;  1R8O B;  3CCM A;  3HFZ B;  4IUV A;  4M7D A;  2RHS A;  3DB3 A;  4P75 A;  3G71 A;  3A7U A;  2JUF A;  4E7L A;  4J8O A;  3V7C A;  2LDM A;  1OZ2 A;  4BD3 A;  1QVF S;  3HFZ A;  3FIF A;  3DSQ A;  4YRT A;  3LSS A;  5A0D A;  2GCX A;  2DTH A;  2OTJ T;  4WF2 A;  1YJW T;  3KBG A;  4QW2 A;  4H2U A;  4JUV A;  2DZ9 A;  3OYM A;  1M5Q 1;  12AS A;  2ZCF B;  1KOG A;  2DJZ A;  3CCS T;  4JS5 A;  5GAM d;  4M7A C;  5K1P A;  4O5V A;  3TEG A;  4HCC A;  4CH5 A;  5C53 B;  4FL6 A;  2EAY A;  4LDY A;  5AYF A;  1SER A;  2EL9 A;  5KE3 A;  4NOY A;  3S6W A;  1M1K C;  3G6E A;  1QE0 A;  4ZN3 A;  5HKC A;  2XDB A;  3R07 A;  3HRI A;  1H4T A;  2QHV A;  2ZT7 A;  2HQX A;  2DD5 A;  3NET A;  1EIY A;  2K5I A;  5GAM f;  4G84 A;  4P3O A;  2BUD A;  3PIP A;  2I4M A;  1VQO T;  2Q5H A;  1VQ4 T;  3X26 B;  3BJU A;  3BFM A;  1MGQ A;  4RKU E;  1I81 A;  2R5M A;  4RG8 A;  1VQ8 T;  3M5A A;  4M77 F;  3A5Z B;  3INZ A;  2P4T A;  2ZT8 A;  4JRP A;  1YHQ T;  2MWO A;  2K2V A;  4C92 D;  4HWT A;  2QHS A;  3JB9 G;  2GQV A;  3GP8 A;  5A0G A;  3P8Y A;  4J7F A;  1H4Q A;  5DLQ E;  1NNH A;  4V2S A;  1BBU A;  4QQD A;  2ZZE A;  3CPF A;  2QHT A;  3CCV A;  1YIT T;  4HCZ A;  3VQW A;  1KQ1 A;  2EQM A;  2E6N A;  3CC7 T;  3HY0 A;  4B9W A;  2J3M A;  4FU6 A;  3M57 A;  4OB1 B;  4XTY A;  1NJ2 A;  2LX9 A;  2QEX A;  3CC2 A;  4KUI A;  2I4N A;  4M77 G;  1KQS S;  3SFM A;  3OS0 A;  4TVA A;  4A4H A;  1Q7Y C;  5LJ5 g;  2YRV A;  1KC8 C;  4LVK A;  2ZT6 A;  2RH2 A;  5LJ3 e;  2ZCE A;  3F70 A;  4YRN A;  4BUG A;  5C52 B;  4EX5 A;  1KD1 U;  5KNN A;  3JCM c;  5DY9 A;  2VUB A;  3JB9 I;  1YI2 A;  2C7I A;  1USY C;  3OYJ A;  4C92 C;  1XNI A;  4M7A B;  4M75 C;  4KUD K;  2EJF A;  1X54 A;  3A32 A;  4M7A A;  4TQF A;  4NL2 A;  3OY9 A;  4YRC A;  2DPP B;  4UP7 A;  4YRP A;  3UGQ A;  3LYI A;  2DO3 A;  1YJN A;  2FB7 A;  4HKE A;  3E9G A;  3C95 A;  2I4O A;  3PCO B;  3MEW A;  2CKK A;  3LSQ A;  2J3L A;  3PCO A;  2EYQ A;  1M1G A;  3M9Q A;  3TRE A;  1G5V A;  5F5W A;  1OI1 A;  3JB9 D;  2XIC A;  3IG2 A;  2P0P A;  3JSC A;  4BE0 A;  2K5F A;  4H2W A;  4NL3 A;  4C0Z A;  4K86 A;  4ME7 A;  1JJC A;  3QDR B;  5FU7 C;  2EJG A;  2PVG B;  4LDV A;  4E7H A;  3O8V A;  2Y4X A;  1Q86 U;  1SRY A;  1BI1 A;  3L1A A;  5LJ5 h;  4RCB A;  3MQZ A;  4YRJ A;  2ZPG B;  4N4G A;  1B34 B;  2WSF E;  2FVU A;  4UPA A;  4M77 D;  3CXC S;  1Q81 U;  5I21 A;  1B34 A;  1WJR A;  2X4W A;  2CJ9 A;  3MCA B;  1RIQ A;  4YCV A;  3LX7 A;  3C4S A;  3GIB A;  4UP8 A;  2RK2 A;  2Y90 A;  2X4X A;  2CIM A;  1B76 A;  1SET A;  2GF7 A;  3OW2 S;  2F69 A;  2I2L A;  3NTK A;  4HCB A;  3JCM Q;  4OP0 A;  1NJI C;  2QQ9 A;  4PG3 A;  5HK3 A;  3VQX A;  5GAN 8;  3ZEH A;  2ARU A;  3QJ6 A;  4TVY A;  4N4I A;  4KR3 A;  5GAM j;  4C92 B;  3CBM A;  3G71 T;  3VBB A;  1NPR A;  3CCE A;  3E19 A;  3MP6 A;  4M7A G;  3FJP A;  1USY A;  4C92 A;  1L0W A;  4XU1 A;  5IT9 E;  1KMN A;  4IUQ A;  3G1Z A;  2HAX A;  1ZHI A;  2DVE A;  3PT9 A;  1KQ2 A;  1UGR B;  2K3X A;  4F7U E;  1HC7 A;  4MDW A;  1X55 A;  4ZTZ B;  1FXX A;  4CH3 A;  5FRO A;  4JRQ A;  3WVD B;  3HXY A;  1EOV A;  2XK0 A;  2XID A;  3A7R A;  1YCY A;  2M16 A;  4OB0 B;  2ZZG A;  1NYQ A;  2LQ8 A;  2A8E A;  4A53 A;  3J7A F;  2RI3 A;  3G6E T;  2LNV A;  3QZ9 B;  4VUB A;  4GLK A;  2V8K A;  1PSE A;  4M78 E;  4C8Q F;  1YJ9 A;  3QII A;  2BKD N;  3PNW C;  3HHT B;  3L2Z A;  2E3C A;  4BB7 A;  3OYK A;  4P73 C;  1K73 C;  4BAC A;  4BE2 A;  3HXX A;  5J26 A;  1JB0 E;  3CBO A;  5GMK e;  1M9S A;  4A4K A;  3RES A;  5LJ3 d;  1LYL A;  1VQ9 A;  1FYF A;  2L5Q A;  2RHY A;  5IAY A;  1N8R U;  1KHC A;  2XDP A;  3L2W A;  5CCA A;  1K8A U;  2XKO C;  4Z02 A;  4P72 C;  1Y96 A;  4P71 C;  4C5H A;  3SB2 A;  2VXF A;  4H2V A;  4TVR A;  1M8V A;  2JN0 A;  3JCM e;  4PJO F;  3QYG B;  4A4F A;  2DEQ A;  2O01 E;  3HXV A;  3CCU A;  5LJ3 f;  3L2Q A;  3UGT A;  3LW5 E;  2QEX T;  1VQK A;  3CC2 T;  4YRR A;  5GAO n;  2D0Q B;  3NTI A;  2ZGW A;  4MZT A;  2ZZD A;  1ADJ A;  5C51 B;  1K9M C;  2FHD A;  5CIU A;  5I2S A;  4C5I A;  2P5I A;  3SDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...