2E41A

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with the reaction product analog biotinol-5'-amp, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e41A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e41A01
5LJ5e 3IKLA 3AHUA 1H4VB 1FYFA 1KOGA 5GMKl 4TVAB 3L4GA 2ZIMA 4QVDA 3HXUA 1NYQA 1NNHA 3INZA 1WQWA 1Z7MA 4A54A 2HNIA 2EJGA 3JB9F 4YP0A 4C8QB 3L2ZA 4WJ4A 3P8VA 2ZT8A 4M78D 4XU1A 5LJ3d 3A7RA 3JCMV 2E5AA 3JCMg 1SETA 4F7UG 1KMMA 2DQ3A 2DJZA 4C8QF 2ARTA 2C8MA 3V7RA 1NJ6A 2PMFA 2EWNA 2PMEA 3BW1A 2ZR2A 5GAOr 2ZT6A 1B70B 5GANe 2AMCA 3QTCA 3REUA 4XTVA 1GGMA 3MF1A 4M78A 2E10A 2ZR3A 3M4GA 2ZT7A 1JRIA 1JBMA 1LJOA 5LJ3g 2RHSA 5ELNA 4M78G 3VQVA 4NOYA 4AH6A 4EMGA 1YFTA 4HVCA 4YCWA 1M5Q1 1H4QA 4J6YA 1SERA 2ZT5A 4M77E 3RIRA 3QSUA 5LJ3j 5GAOl 2VXFA 3HFZB 2ZGWA 3KFUA 1ADJA 4M7AB 4UP7A 3E9HA 3M4QA 1U1SA 4KQEA 4M77C 2EL9A 1E22A 1D3BA 1I4K1 5GAMf 4P3OA 4YYEA 1BBWA 4K87A 1Y96B 3HFOA 3PCOA 3BY7A 3VU3C 1RIQA 2CJBA 3A74A 4HWPA 1EIYB 2I4MA 2ZINA 1YGBA 4EMKC 3HXVA 1LOJA 3RUXA 4XEMA 3JCMc 1PYSB 4P72C 4RQEA 2ODRC 1X2HA 3IG2A 3DSQA 4M7DE 4MMLA 2ALYA 2DVEA 1ASYA 2J3MA 4F7UF 2Q5HA 2DXUA 5C51B 3PGGA 3QO3A 4J15A 3UGTA 4UP9A 2RA2A 3NENA 4CH3A 1KQ1A 4M77A 2ODRD 3BFMA 3E9IA 4BWAA 4M77G 1EQRA 1IL2A 4QVCA 5F5WA 5E3IA 4M7DD 3HSBA 3JB9J 3HRKA 3JCMQ 4CH5A 3QHSA 4M78F 4EMKA 5GAMh 3JCMJ 1EOVA 5LJ5d 2AKWA 4M75E 3IKMB 3JCMW 4RDXA 1G5IA 1QE0A 4RCBA 4H2YA 1VQZA 3BDUA 4TTVA 1B7YB 5GMKm 2DU7A 4J6XA 4M75C 4E51A 4CS3A 2Q7GA 2FB7A 4EX5A 4YDQA 4M7DA 4WJ3M 2XGTA 4YPFA 4OP0A 4X5OA 5GMKh 4PJOE 3A5YA 4Q15A 3VQYA 2ZZGA 4M7DG 4HWOA 5LJ5g 3TEHB 4YRSA 3QO7A 4M75D 1B8AA 4C92C 2DXTA 4PJOC 2RHQA 4XQ3A 5GANd 3HXZA 4P71C 4RMFA 1JJCB 4PNOA 2K57A 1Y96A 2YLCA 3FB9A 4LNSA 4J6WA 4H2UA 1N9SA 2IY5A 1EIYA 1HXDA 3UH0A 5LJ5j 4PJOD 4ZIBA 4M75A 3GIBA 3VBBA 1PYSA 5GAMe 1M8VA 3MF2A 2ZXFA 4PHCA 1E1TA 2CJAA 3FJPA 1W66A 2DZCA 3A32A 2DTHA 2DKGA 4M75G 4H2XA 3LSSA 5GANg 4K88A 3REXA 1HK9A 4EO4A 3SWNB 4TWAA 2I4LA 1Z7NA 2QHUA 5GAN6 4YREA 4C8QC 2QHVA 5ELOA 5HGQA 4H2TA 3JCMf 4C92A 1H4TA 3V8LA 5GAOm 4HWTA 3A31A 4PJOA 3LC0A 1HTTA 4BW9A 3HXXA 3HTZA 1B34B 1NJ1A 3V7CA 2C7IA 3BJUA 3LSQA 4NCXA 5GMKe 3QUIA 4P71A 1G5HA 1H641 4C92G 5GAOq 3V8KA 3V8JA 4PJOG 1QF6A 2EJ9A 1B76A 5GANj 3OD1A 2QHSA 2EAYA 4YRPA 2CJ9A 4YRNA 1YFSA 2J3LA 3L4GB 4XEOA 3HFVA 3PZCA 5I21A 2E64A 5GAN8 5KNNA 4MMKA 4F7UB 4M77D 5GAOp 1X01A 4CH4A 2P0LA 4YRMA 4TVAA 3JB9G 5CAIA 1KMNA 4G84A 3RKWA 5K1XA 2DU5A 2Y90A 4M7DF 4K86A 4TVWA 4J5YA 5GAN3 1WNLA 4C8QA 4KR3A 3A7UA 2I4OA 1X55A 1NJ5A 4M7AE 4C8QG 11ASA 5GAN2 4YCUA 4JRKA 3UFGA 4XTXA 3JCMh 4M78B 2ARSA 5GAN7 1N9RA 4M7AC 1WU7A 2E65A 2ZIOA 2RHSB 4JLIA 4TQFA 3I7FA 4N0AC 1B70A 4YRQA 4P75C 4KR2A 3HY0A 3RL6A 4H02A 4YRIA 3RGLA 2ZNJA 4XU2A 4YRJA 1C0AA 2DTIA 3JCMP 4M7AD 4EMHA 4P72A 4CS4A 5LJ3h 1J5WA 4Y91A 3G1ZA 1LYLA 4P73C 2QHTA 5C53B 3FIFA 4YRGA 2Q7EA 3ICAA 1EVKA 1D3BB 2DQ0A 1X54A 3RKXA 4C92E 4P3PA 4DPGA 4PJOF 5C52B 3HFZA 1LNXA 1N9WA 4OLFA 4M7AA 4X9CA 3JCMd 12ASA 4JUVA 1I8FA 2E41A 1WYDA 3RERA 4M78C 1I81A 4X9DA 1L0WA 4M7AG 4YRLA 4YCVA 4P75A 3JCMe 1I5LA 4WI1A 2FYKA 2VXEA 3JCMb 3R07A 1NJ2A 1G51A 5GAMd 4F7UA 4C92D 2ALYB 1HC7A 3HRIA 4JRIA 2ARUA 4UP8A 1X2GA 5GAN5 4P73A 3ERRA 2RB6A 4P74C 3EFSA 1WQ7A 4DQ2A 4YRTA 4M77B 4XTYA 1YCYA 3RACA 1TH7A 4C8QE 3A5ZA 3L1AA 5LJ3e 4HWSA 3NELA 1MGQA 4TVYA 3P8YA 5LJ5f 4XTUA 3HY1A 3HFNA 4RQFA 5GAMg 1YB3A 2G4CA 3JB9D 2EJFA 4M77F 1NJ8A 2ZZEA 2CIMA 3TEGA 4HA8A 1BIBA 1EFWA 2DZ9A 3JB9I 1BBUA 4EMKB 2ZTGA 4CS2A 2VC8A 5GAOn 1EVLA 1SESA 2AKWB 5DY9A 3VQXA 1H4SA 3MEYA 4C8QD 3CMQA 3P8TA 2DEQA 4H2WA 3QO8A 4UPAA 2XTIA 5GMKi 5GAMj 4HT8A 1USYC 4XTWA 4M7DB 1E24A 2RD1A 2RM4A 5LJ3f 3JB9H 4P74A 1WPYA 1B7YA 4ZTUB 4HT9A 1U1TA 4H2SA 3W3SA 4YRRA 5GANf 2ZCEA 1SRYA 3QNEA 4ZTZB 1ATIA 3RESA 3V7SA 2E1HA 2YLBA 2RHQB 3RF1A 1ASZA 3SWNC 4HWRA 5GMKj 2DDZA 3TEHA 2QTXA 3IALA 4M7AF 2IY5B 5LJ5h 2AMCB 4CH6A 4XU0A 1WLEA 1JJCA 1YFRA 4M75B 4YRFA 2DTOA 4XU3A 2E3CA 4RCCA 1USYA 4PG3A 2ZNIA 2I4NA 2Q5IA 3QO5A 1NYRA 3VQWA 3NEMA 4H2XB 4Q6GA 1E1OA 4F7UE 4WF2A 4V2SA 3TUPA 4M7DC 3NETA 2I2LA 4M75F 4TQDA 2CGHA 4NL2A 4L87A 4C92B 2YHTA 4PJOB 3RKYA 1BIAA 2Q7HA 4G85A 3SWNA 5GANh 3JCMX 3M4PA 3EFRA 4XTZA 4H2VA 3HXYA 4P3NA 4YRCA 4C92F 2P5IA 3UGQA 1B34A 4M78E 3WQZA 3A7AA 2ZZFA 4YRKA 3HXWA 5GAN4 3PCOB 4A53A 1KQ2A 2JN0A 4O2DA 4NL3A 1X56A 4YROA 3SB2A 1ADYA 4N0AA 5K1PA
chains in the Genus database with same CATH superfamily
3H8ZA 2DEUA 5LJ5e 2P0PA 2K4YA 1H4VB 2EFIA 3OW2P 4QVDA 2ZPFB 1UHCA 1NYQA 1NNHA 1WQWA 2H3EB 4AFSC 4A54A 1Z7MA 4LVJA 3H9NA 1XNIA 1M3CA 3PT9A 4M78D 4XU1A 1M3AA 1Q82R 2E5AA 1VQ6T 1QVFS 2EQMA 2MIOA 2AKLA 1P92A 2DJZA 4A4KA 2C8MA 1MMGA 3V7RA 1RI0A 2PMFA 2EWNA 2W10A 3BW1A 2DIQA 2LJ0A 1FXXA 2ZR2A 1B70B 5L8RE 3OYKA 3MF1A 4M78A 2E10A 1Y0MA 1U5SA 2ZR3A 1JEGA 1LJOA 5J3BA 5LJ3g 2LNHB 1AZEA 1Z9QA 4ME7A 4M78G 4OF1A 2BZYA 4NOYA 1OX9A 2QEXQ 3I56Q 2XDBA 1QP2A 1V1CA 4FU6A 5C0MA 2VASA 1XJWB 1SERA 1NYFA 2MK5A 3L2QA 1IXDA 1K8AU 1TUGB 3RIRA 3QSUA 3PVLA 1UTIA 2KMTA 5LJ3j 4ESRA 2JS0A 4OMOA 4F17A 2AIRB 3ZL7C 4M7AB 3E9HA 1U1SA 3E1SA 4M77C 5FLXE 2EL9A 1E22A 5EC7A 3OS1A 2KDSA 4YYEA 2EQKA 2PQWA 3UA6A 2XIDA 3BY7A 1KG1A 1RIQA 3A74A 3LWIA 4BD3A 3QPHA 1O75A 3HXVA 1YJNT 3CBOA 2KYMA 3DSQA 3CCLQ 2K7AA 2D9TA 3GPLA 4MMLA 4M7DE 1VQLA 1Y7XA 2CP7A 2EIFA 2G3RA 4F7UF 5DLOA 5C51B 3QO3A 3M5AA 4J15A 3UGTA 1K9AA 3NENA 4E6RA 1WHHA 1VQ4A 1GCPA 5CKDA 4PLIA 3DB3A 4E7IA 1UG1A 1KQSA 1WXTA 4EPCA 3E9IA 1QVGA 4A4EA 2KRSA 4HVUA 4A4FA 3M0QA 4FIBA 5E3IA 1N8RC 5FRNA 2ZPHB 2KY9A 5IHNA 3PIOA 3JCMJ 2MWPA 1EOVA 2AKWA 3TCJA 4KGZB 2NUZA 2A28A 2RHYA 1A0NB 5HK3A 2YDLA 3A8MB 4M75C 2L2PA 4E7JA 4AT1B 3VS6A 4O6JA 2DMOA 4ELZC 3X25B 3CCRT 4HCBA 4IUQA 1PD1A 2HL5C 1W2BP 4PLLA 1X6OA 1U3OA 4Q15A 3EHQA 2ZZGA 1HSQA 1R8OB 2P84A 5LJ5g 3TEHB 5CVIA 3TREA 1OV3A 3M55A 1VQ8T 4F16A 1X27A 3G1JA 3CMAT 3VYHB 1VQMA 4PJOC 4J9BA 3CPWA 1K73R 3LYIA 3HXZA 1JJCB 4BDYA 3JAME 1Y96A 1GXIE 2CP5A 1N9SA 1YHQQ 3L2UA 1VQPA 1AEYA 5HY6A 1PKSA 5D6XA 2LQNA 2DL4A 3CCQT 5LJ5j 3UH0A 2I0NA 8AT1B 3VBBA 2KROA 2JTEA 4OMPA 1VQOQ 1ZSZA 4RG8A 1U06A 4PHCA 1MNEA 3G4ST 1PG5B 1W66A 1PM3A 2DTHA 3QXEB 4EO4A 3EGDB 4GLMA 1NPRA 1PNJA 5GAOm 3OYIA 3QDFA 2DPPB 3NPFA 1AZGB 1W2BS 5C6SA 3QUIA 1KK7A 2EJ9A 4RTXA 2QHSA 3DB4A 2V8KA 2J3LA 2RHUA 4BE0A 1MNDA 4LD6A 2KNBB 1GRIA 2DIGA 1MUZA 1NM7A 2P0LA 5FW9A 4QQDA 2CT3A 3JSCA 1CSKA 3M53A 4LVIA 4K86A 4TVRA 4J5YA 5GAN3 4C8QA 2MCNA 4C0ZA 4E7SA 2OTJT 2VYTA 2FRWA 1B07A 3CPFA 4M7AE 4C8QG 3UFGA 1RUWA 1NE8A 3EG9B 2DYBA 3E2UA 2FPFA 3JCMh 2IVWA 2QA4Q 2Y4XA 2NYSA 2CSQA 4KBMB 1KC8R 2NUPA 2YRVA 4N0AC 3OA6A 3EG1A 3CPWS 3URGA 3OY9A 1ABOA 2RI5A 2B86A 4DBRA 2EW3A 3HY0A 4YRIA 2XMFA 3RR6A 1YIJA 4XU2A 2ZNJA 2QGFB 2QK0A 2JM8A 3G1ZA 4XK8E 3OSSC 5HKCA 4PJMA 1UGRB 5C53B 1K1ZA 2DETA 1YJWQ 2DX1A 3DLMA 1D3BB 2COWA 1X54A 3RKXA 4PJOF 3OYCA 3LX7A 2BTTA 2LTOA 3HFZA 4JUVA 4C0DC 3H41A 1SEMA 2CZ6B 4FT2A 4IUTA 3RERA 3L2WA 1UJ0A 4E2FB 2E4HA 3G6ET 3J80E 4P75A 5CR2A 1YJ9T 1FWZA 1X2KA 1I5LA 5D6YA 3R07A 1N8RU 5DM7R 1NJ2A 3GNGA 2EGAA 2Z0WA 1HC7A 2KAFA 1X2GA 5GAN5 2AKKA 4P73A 1VUBA 3ERRA 4P74C 2QASA 4DQ2A 3OMCA 1VIFA 1KFZA 1D1AA 2LQKA 2FZGB 3MP6A 4J9HA 2X3WD 1FMVA 3CCVA 4J8OA 1XOVA 4HVWA 4QVZA 2KVQG 5M9OA 3C12A 1KIKA 4XTUA 1VQ6Q 1M90C 3HY1A 1C1AA 2RQWA 4D8KA 2PUKB 2EJFA 3X26B 1BIBA 1EFWA 1D1BA 4PK4A 2JTFA 2ESWA 2NWMA 5CO7A 1R0CB 4IIOA 3VQXA 4C5GA 1Q81R 1M8MA 1E24A 2RM4A 3CCLT 1OU8A 1UE9A 2RJFA 5LJ3f 2EPDA 1RL2A 1B7YA 2DYIA 1KHCA 2ZCEA 5IN1A 4BY6C 2E3HA 3V7SA 3L2VA 1VQ5T 1ASZA 3SWNC 2RO0A 4HWRA 1HYOA 2VUBA 1ZX6A 2QTXA 3CQTA 3MEVA 2HQEA 4XU0A 1RAHB 4D8DA 2HQHA 4CC2A 1TUDA 2A8EA 1YFRA 1B3QA 2DBMA 2ENMA 1QCFA 1Q7YC 5CKFA 4PG3A 2J05A 1RAEB 3CD6T 4Q6GA 2GFAA 4WF2A 4LNPA 3ME9A 4FT4A 4PFOA 2P0KA 5CQXA 1YJNQ 4V2SA 5KYWA 1QKXA 4TQDA 2CGHA 3CCUA 4DBFA 2DRMA 1TSFA 5KYXB 1UJYA 3OS0A 1UHFA 3ULRB 3RKYA 1SRLA 2BE7D 2RMOA 5GANh 4GBQA 1ZLMA 1VYUA 1MMDA 2P5IA 2V26A 2CP6A 1B34A 4PL6A 1V29B 3WQZA 3EHRA 2M0OA 2C06A 5GAN4 2WACA 3EGXB 2DL3A 4O2DA 4NL3A 5K1PA 2OI3A 2MYSA 4HCCA 4AG1C 2XDDA 1FYFA 2OX7A 4TVAB 3FDRA 4IUUA 4JZ4A 1VQOT 3INZA 1G3TA 1D1CA 2EJGA 3DKMA 3C95A 3WVEB 1MHNA 2M51A 4CRIA 4CC3A 1M2VB 1X43A 3MHXA 5LJ3d 3A7RA 2L3QA 1YP5A 1SETA 4F7UG 4DOWA 3HHTB 2E5KA 4C8QF 2ARTA 3OSVA 1OZ3A 1YI2A 2JJ9A 4PJJA 4FW2A 3MEWA 4OGCA 1VQ8Q 4OMQA 5GAOr 2ZT6A 3M0RA 2CUBA 3CMAQ 5KYUA 4LDXA 2X4JA 1XQHA 1UECA 2VB6A 1QCOA 9ATCB 4LDUA 3CCQQ 1X75C 3OBYA 3UPUA 4HVCA 1YFNA 1H4QA 3S3MA 3SFMA 4JJCA 1CKBA 1QVFA 1TUCA 3PNWC 1G2BA 3G4SQ 1WJRA 4OMFB 3M54A 5KE2A 4UP7A 2KQWA 1YNZA 2ZPIB 3M4QA 4J9CA 4PFPA 1G3WA 6AT1B 1ZUYA 2M1HA 1I4K1 3M0SA 3G71A 2GQVA 5HCKA 1KD1R 4O5VA 3HKSA 1G8XA 2H8HA 2KYBA 2EYYA 2L8DA 5KYYB 1M90U 3VU3C 1T0JA 5J39A 3CCJA 2EKOA 1YGBA 4EMKC 2SEMA 2LQWA 1NJIR 3JCMc 4P72C 1Q82C 2ODRC 1X2HA 4RQEA 3OW2A 3M9QA 2X35A 2V8JA 1Q95G 3H0HA 2M16A 4AMCA 2ALYA 2DVEA 1ASYA 5AT1B 4HKEA 2DXUA 3OYBA 2OTLA 1WLPB 3PGGA 1K76A 4UP9A 4K11A 2K9GA 4M77A 2DD4A 3NTIA 4C0FA 2CYZB 4Z8AA 2A3LA 2OTJQ 3EFOB 4M77G 2L0AA 1EQRA 3PVQA 3MEAA 4KH0B 2QQBA 4QVCA 2ED1A 2DE0X 1VQLT 3HRKA 4FSXA 3JCMQ 1TTHB 5GAMh 3OYFA 5LJ5d 2BE9B 1WZOA 3JCMW 2O4XA 1SRMA 1QE0A 4R55A 3M0UA 1OPLA 4H2YA 3BDUA 2COZA 2NS6A 5GMKm 4J6XA 5AYFA 4CS3A 2KGTA 2Q7GA 1Q7YU 1NEGA 2BKDN 4WJ3M 2WSCE 2EQJA 4X5OA 1NBEB 2X3XD 5GMKh 3VQYA 1WHGA 1FMWA 5IHKA 4YRSA 3A8OB 1LVKA 4M75D 3CC4A 4AG2C 4C92C 4BACA 1QMCA 3FC3A 3I55Q 1M1KR 4PNOA 1U8RA 2YLCA 4LNSA 1GCQA 1QW1A 4H2UA 2JT4A 3UT1A 3CCUQ 1WFWA 4JRPA 1X2QA 4ZTFA 3G6EQ 2P0QA 4PJOD 2KRMA 4OMMA 4M75A 1WXUA 1YJ9Q 2E6NA 2NUTA 1M8VA 1KHIA 1X69A 3MPUB 1E1TA 2ECZA 5KE3A 1FMKA 2DBKA 2PTKA 3CCEA 1VQMT 2V1QA 3EH1A 4M75G 3LSSA 2EYQA 1E7OA 4K88A 2LP5A 4LD9K 1HK9A 4TWAA 3RMQA 2F69A 3OW2S 3JCMf 4FW1A 1H4TA 1VQPT 4HWTA 2HQXA 4GLKA 4PJOA 4BW9A 2C7IA 3V7CA 4NCXA 1BI0A 2YSQA 3CC7A 5GAOq 1BB9A 3HTRA 3ER0A 3MKDA 3V8JA 1YITA 4PJOG 1QF6A 2CP3A 2JW4A 2K79A 2EAYA 2LZ6B 3TSZA 2CJ9A 2XU8A 2QTVA 4J9EA 2E5QA 1N6AA 3HFVA 2V1RA 3MQZA 5I21A 3OYAA 4KT0E 4YRMA 5GJWB 3JB9G 5FRMA 1UGSB 3C94A 2QYZA 4G84A 3RKWA 2D6FA 2DU5A 2L3SA 2Y90A 5J26A 5KCHA 4M7DF 2LNVA 2FG0A 3MP8A 4KR3A 1K73C 2H3JA 2BZXA 3LH5A 1W2BA 2I4OA 3A8LB 1TXQA 4QQ6A 4CC7A 4XTXA 3CC2A 3F70A 4M78B 1EZZB 1VQ5Q 2J7IA 4M7AC 2JMCA 2E65A 2ZIOA 4TQFA 4HCZA 3I7FA 1YN8A 1AVZC 4FSSA 1BI3A 3UDCA 3VRZA 3SHWA 3CCMA 2KBTA 2DD5A 2YWWA 3HPWA 1D0YA 3ASKA 4E7KA 3RL6A 4H02A 1KSWA 1ZUUA 2EKHA 1C0AA 2EGEA 4CS4A 2E6ZA 2FHDA 3S3OA 3CD6Q 1LYLA 3G71Q 3FIFA 5I2SA 1Q82U 2ZPBB 2GF7A 3ICAA 1ZUKA 2O9VA 1EVKA 2IG0A 2DQ0A 1RADB 4C92E 4DPGA 3CCJQ 4C0GA 1NPPA 1ARKA 2HMAA 1QQJA 3JCMd 1XTDA 2E41A 1YIJT 1LCKA 4M78C 3OYDA 3RDVA 1I81A 1L0WA 4LDWA 5L23A 2DM1A 3FLGA 5CKHA 3JCMe 2CSIA 1SPKA 2AK5A 1MMAA 1G51A 1ABQA 1I1JA 2FZKB 1OI1A 3CMEA 4FYXB 2AHJB 3QYHB 4JRIA 4MZPA 2RB6A 2X4YA 1UGQB 4YRTA 2A37A 4XTYA 1N27A 1VQ9A 2QDYB 1VQNQ 3RACA 3A5ZA 3L1AA 1BBZA 1K9MR 3OYYA 2WSEE 3P8YA 2QQSA 1H3HA 1KC8C 1FX7A 2LX9A 1T3SA 2HCKA 3HFNA 4RQFA 4D6WA 2K2MA 4M77F 1FYNA 1NJ8A 2ZZEA 3TEGA 2DZ9A 3JB9I 1BBUA 1HD3A 1ZA1B 5GAOn 2AKWB 3P8HA 2CH4A 1SHGA 5DY9A 1Y57A 4A4GA 1Y07A 4QQGA 4C8QD 3CCVT 2CS7A 1WI7A 5GMKi 4HT8A 1H92A 4P74A 1WPYA 4EDUA 2L89A 4PFZA 1U1TA 3W3SA 3NFCA 5GANf 1G83A 2CDTA 2K5FA 2YT6A 3RESA 2E1HA 2YLBA 4N4IA 1C0MA 4OB1B 2QDLA 1W1FA 3H0FA 4M7AF 2RQTA 2AMCB 2B8AA 4RTVA 1SSFA 2E12A 4KGXB 3REAB 1JU5C 4KRTA 1IREB 2RQUA 4RUGA 4RCCA 1ZSZB 3VS4A 3MCAB 4HVVA 3QO5A 2R5MA 1NYRA 8ATCB 1E1OA 1E6HA 2K3XA 3NETA 4M75F 2ABLA 3OYEA 2HAXA 4JDSA 4NL2A 3QWYA 2HSEB 2Q7HA 2CT4A 1RAIB 2KI7A 3SWNA 3EFRA 4XTZA 3I35A 3I55T 1K73U 1NLPC 1Q81C 4M78E 1GFDA 2HKQB 2OAUA 3A7AA 1JJ2P 3PCOB 4IUVA 1ZBJA 1X56A 4YROA 1N9WA 3CCUT 2LCLA 2SRCA 1VQLQ 3VS0A 3AHUA 2LCSA 1KOGA 3L4GA 1JXMA 4B9XA 1NYGA 1WIEA 2LC4A 3M0PA 4PJNA 2HSPA 1JB0E 3HRSA 1OZ2A 2HNIA 4YP0A 3Q1JA 2COYA 3JB9F 4C8QB 1VQ4Q 1JO8A 2PVGB 3CC2Q 3VS3A 1YBYA 3FEOA 1VQKA 3JCMV 2GGRA 3JCMg 2DF6A 5CQYA 1EIFA 1Q86R 2XG8D 1NJ6A 2JM9A 2DA9A 2F5KA 2J6KA 3REUA 5GANe 2EYXA 2RPNA 2LX7A 3M4GA 1JBMA 2EYWA 2RHSA 1ZHIA 1PKTA 2HEQA 1IHWA 3VQVA 3M57A 3R6OA 4EMGA 3QG1A 2C0TA 3HRUA 4YCWA 2CREA 4L59A 1YI2T 1M5Q1 2LCCA 2V8IA 4J6YA 4B9WA 4LN2A 1AHJB 1X6GA 3A8GB 4ZGDB 3VV0A 1VQMQ 1TG0A 5GAOl 1VYTA 3HFZB 2ZGWA 3KFUA 2F2VA 4MZMA 1ADJA 2FPDA 2JMAA 1J3TA 1VQPQ 2FZCB 3GNFB 5GAMf 3TVTA 2LVMA 3CMEQ 4K87A 3OYHA 1KC8U 3EGXA 1YCSB 4ATOA 1BKBA 2R57A 1NLOC 5I2MA 1EIYB 1MMNA 2A7YA 2I4MA 2ZINA 4LVMA 1VQ9Q 3RUXA 1PYSB 2RF0A 1DJ7B 3IG2A 1M1FA 2YUQA 1JQQA 1I07A 4LVKA 3M59A 1G3YA 1SSHA 2J06A 3G71T 1VYVA 2J3MA 3N5BB 3GLXA 2FPEA 3M4YA 4E7HA 2RQRA 4CH3A 1KQ1A 1MV3A 3EG3A 2ODRD 3BFMA 3CCJT 4BWAA 2CH4W 1B7TA 5FU7B 2MPXC 1F1BB 1UB4A 2XDPA 2XHCA 4M7DD 1VIEA 3HSBA 4Q5WA 3JB9J 3VS2A 3FJ5A 4EMKA 4BI3A 3MJXA 3QZ5B 2OTLT 1MV0B 1G5IA 2YRDA 1VQZA 4TTVA 1B7YB 2PZ1A 2DU7A 4PJLA 4M7DA 2DRKA 4EIKA 2QEXA 3A1PA 2JXBA 2XGTA 3I56A 1VQNT 1KD1C 4M7DG 2PVOB 3QO7A 2X4WA 3EG2A 2RI3A 4OMLA 3VUBA 3QZ9B 2RHQA 5I22A 2K2VA 4XQ3A 3AT1B 4P71C 4RMFA 3KUFA 1NJIC 2D0QB 3FB9A 5FU7C 2CUDA 3M56A 4ANJA 1YIJQ 2IY5A 3NGPA 4DOVA 1Q81U 1AWOA 2E3IA 4ZIBA 3EG0A 4KUDK 5KYWB 5GAMe 2DXCA 2QAZA 2OJ2A 1WGSA 3CC4T 2KSSA 2CJAA 3E9GA 2KEAA 2DZCA 2VGNA 1OPKA 3A32A 4H2XA 3SDZA 4FL6A 5GANg 3REXA 4DBHA 2J6FA 2VV5A 2YUPA 3UA7A 3EGUA 1PRMC 2AZSA 5GAN6 4YREA 5HGQA 3BDLA 4H2TA 4C92A 1BCOA 3A31A 2M9UA 3LC0A 3HXXA 3HTZA 1B34B 1NJ1A 3BJUA 3C0CA 3I5RA 5GMKe 1UFFA 1RACB 1G5HA 1H641 4C92G 3GP8A 3HL8A 3QBYA 1GBQA 1B76A 5GANj 2MAMA 2AT1B 4Y92A 4YRNA 2K5LA 1W4SA 4N4HA 4C5EA 1PD0A 2RK1A 3PZCA 3RBBB 1S1NA 5KNNA 4MMKA 3S3NA 4F7UB 4M77D 5GAOp 3CXCP 1HJDA 4CH4A 2RJCA 1TU0B 3CCSA 3I9QA 4OB0B 3CCVQ 3CC7T 5K1XA 1YITT 2CZ7B 2LRQA 1WNLA 1M1KC 2K5IA 1K8AR 2MMPA 4JJDA 2X51A 3A7UA 3OYLA 5D7UA 2P4TA 4OMNA 1LPLA 3UATA 5GAN2 2C0IA 2ROLA 4JRKA 3H0IA 5KYUB 1M4ZA 2HBWA 2JOYA 2LQ8A 5GAN7 1N9RA 1WU7A 1K0XA 5GJVB 2GQIA 2QQAA 1B70A 1QP3A 4FYWB 2EGCA 1IZ6A 1GBRA 5D6WA 2D0NA 1KJWA 4P5NA 3M58A 1YHQA 4ZTJA 3RGLA 4M7AD 2KXDA 5LJ3h 1J5WA 4ZNXA 5IHIA 4Y91A 1VQ4T 4OVAA 3OYNA 3CC2T 2QHTA 3L42A 3CXCS 3PFSA 4BI8B 4LE9A 7AT1B 3JRZA 4P3PA 2F5TX 5C52B 3CCMT 2DFUA 2GTOA 1LNXA 1BI2A 4M7AA 2XKOC 3WVDB 5KH6A 3PMTA 1TS9A 4ZN3A 1WYDA 1I8FA 2IIMA 3T9NA 3RMSA 4J7FA 4X9DA 2DL7A 1M9SA 4M7AG 4YRLA 4GY5A 1IB8A 1RAFB 4AFZC 3OYGA 4NS5A 2D8JA 5KYNA 4RTTA 1S72A 4X34A 2ALYB 1VQ7A 3OS2A 2VWFA 3HRIA 2Y4YA 2ARUA 4UP8A 1AOJA 3KFVA 1WHLA 1GL5A 4M77B 1BCMA 3GBQA 1YCYA 1OQKA 4IKFA 4HWSA 2L3RA 4F14A 1T0HA 1MGQA 4TVYA 2BIVA 4RMOA 3X20B 2DILA 5A0GA 5GAMg 1YB3A 3JB9D 1KD1U 1SKUB 4J9DA 1BK2A 4HA8A 3CMET 4CS2A 2YUNA 2GFUA 2VC8A 1EVLA 3VS5A 4DEXA 2O4XB 2DL8A 2LDMA 4C5IA 3THKA 2QA4A 1VQ9T 1NJIU 3CMQA 2DEQA 4H2WA 3QO8A 5IH2A 4UPAA 4IURA 4E7LA 5GAMj 1USYC 1IO6A 1QCNA 2KK4A 2RD1A 1YWOA 3JB9H 4ZTUB 3A98A 4HT9A 4H2SA 2RK2A 2ROTA 3FRNA 1YI2Q 1SRYA 4WCIA 3OYJA 2D8HA 3QNEA 3P8DA 1D09B 2DJQA 3P8BB 3QJ6A 5GMKj 1YJWA 3TEHA 2YUOA 3CBPA 5LJ5h 4FM4B 3QYGB 2CP0A 1OYXA 1JJCA 3MP1A 3TSWA 4R56A 4M75B 1IGQA 2DNUA 4YRFA 4XU3A 2NUTB 2E3CA 2ZNIA 2K3YA 2I4NA 2JTMA 3NTHA 3VQWA 3NEMA 2EYZA 5IT9E 4F7UE 1RLQC 1AWWA 3C4SA 3TUPA 1K9MC 2I2LA 3L2RA 4OGEA 4LVLA 1UDLA 5I11A 4DBQA 2YHTA 4PJOB 2QG9B 3HRTA 1BIAA 3EGDA 1QWEA 2DK3A 3JCMX 3M4PA 3E9FA 1UGPB 1M1KU 2RHIA 2O2OA 3HXYA 4P3NA 1RABB 4C92F 4JZ3A 1GCQC 1UGVA 1D0XA 2ZZFA 3META 3CCSQ 1VQ6A 4AFQC 4A53A 2JN0A 1R0BG 4N0AA 1QKWA 1NZ9A 1M30A 3GF5A 3IKLA 3EH2A 5GMKl 2F1LA 3IQLA 4E47A 1OULA 2ZIMA 3HXUA 2OTLQ 1UEBA 4CI0C 4IIMA 3L2ZA 4ELYC 4WJ4A 3P8VA 1R77A 4M4ZA 4II1A 3MO8A 2ZT8A 4RTZA 1C6VX 1W6XA 1WHKA 3CEYA 4F04B 4J9IA 1KQSP 2RH2A 2VKNA 1TWBA 2DXBA 1QVGP 1KMMA 2FEIA 2MWOA 2DQ3A 2JUFA 1OEBA 2HBPA 1WDXA 2MI6A 2PMEA 4FYYB 3ZEHA 2AMCA 3QTCA 2XICA 4XTVA 3G7ZA 3UF4A 3EG9A 1GGMA 1I0CA 3PMIA 2ZT7A 3OYMA 1JRIA 2FL7A 2BZ8A 1VQKT 5ELNA 2ZAEA 4WTOB 5A0LA 1N8RR 2ZPGB 4AH6A 1AT1B 2J6OA 1K4US 2KR3A 1YFTA 2PU9B 2M0YA 2R58A 3R6NA 3O8VA 2F2WA 2XI9A 5A0DA 1M2OA 3LH0A 3CC4Q 2ZT5A 2PNIA 4M77E 3SD4A 1YJNA 2VXFA 1D0ZA 5FWBA 2GCXA 3CPWP 4KQEA 2RQVA 2JZ2A 1JXOA 1D3BA 2KE9A 1KQSS 1S72Q 4P3OA 1QVGS 1BBWA 1VQ7Q 1Y96B 3HFOA 3PCOA 2FO0A 2VGMA 3S6WA 1VOMA 3JV3A 1M1GA 2CJBA 1G5VA 4HWPA 1JJ2A 4JS5A 1LOJA 4J83A 4XEMA 3CCEQ 4JRQA 4RTUA 2A0FB 2XK0A 2DO3A 2C0OA 3HP9A 4JJBA 1WX6A 1Q86C 2DERA 3A5ZB 3M0TA 1H8KA 2QQRA 2Q5HA 1PC0A 4ZGEB 1IHVA 1W70A 3CC7Q 2RA2A 1YITQ 4C0DB 3UWNA 1K0SA 4JPBW 3VS7A 3CBMA 1Y71A 1ACMB 3REBB 3CCRA 2O88A 3MEUA 1E6GA 1IL2A 5F5WA 1WJSA 3RNJA 1BI1A 1X6BA 3PE0A 4CH5A 3QHSA 4M78F 3J7AF 1OOTA 1VQ8A 4M75E 1RI9A 3IKMB 3CMAA 4RDXA 2KXCA 4RCBA 4JS4A 2LJ1A 5IXBA 4E51A 2FB7A 1ZSZC 4OB3B 4EX5A 3D7SB 3QIIA 4YDQA 4LDYA 1O9SA 2YRCA 2R5AA 3NMZC 3CCQA 4YPFA 4OP0A 4PKCC 4PJOE 2ATCB 3A5YA 1K9MU 4HWOA 1CKAA 5CK9A 1B8AA 2DXTA 3A8HB 3G4SA 1SF9A 1IGUA 2EQIA 3KBGA 2PVDB 1NEBA 5GANd 2RN8A 3CCMQ 2K57A 4J6WA 2RHXA 2HKNA 2NUPB 4RKUE 3VJPA 1WHMA 2QEXT 1EIYA 4KGVB 3I56T 1HXDA 2CP2A 2ED0A 4YTLA 1OX8A 5IAYA 3GIBA 1PYSA 4OB2B 1RAGB 3ZBDA 4BY6B 3MF2A 1JJ2S 2ZXFA 1AWXA 3FJPA 4DA4A 2DKGA 5FU6B 3QDRB 2K3BA 4A4HA 3PTAA 3OBWA 3SWNB 1VA7A 2I4LA 1Z7NA 2QHUA 4C8QC 2QHVA 5ELOA 5KYXA 3EAEA 3V8LA 1HTTA 4DEYA 2FRYA 1AWJA 4JJNK 3LSQA 3VUZA 2KRNA 4P71A 2HL3A 3V8KA 2O9SA 2IPOB 3OD1A 4ZGJB 4YRPA 2OTJA 1YFSA 2JVVA 4ZN1A 3L4GB 4AFUC 4XEOA 5KCOA 2LT4A 2E64A 5GAN8 2JNGA 1ZA2B 2FVUA 2ZZDA 2CZ0B 1X01A 1YWPA 4TVAA 5CAIA 2D1XA 1KMNA 4TVWA 5FU6C 3ZFJA 4QW2A 1PWTA 3X24B 1M2VA 1I5OB 5FROA 4HCKA 1X55A 1NJ5A 4KUIA 11ASA 1M27C 4YCUA 2KT8A 5CKEA 4BI4A 2KT1A 1T3LA 5CIUA 4LXCA 2ARSA 2OAWA 4BB7A 2G6FX 3BE3A 4LDVA 2RHZA 4FYVB 4Z02A 2XD0A 3CCST 4E7ZA 1WYXA 2RHSB 3I55A 4JLIA 1M90R 1WJQA 2X4XA 4YRQA 1EX4A 4P75C 1OU9A 4RTYA 4KR2A 2DVJA 4Y28E 1SHFA 4Z88A 3VYGA 4BDZA 4YRJA 1QWFA 2DTIA 3LWHA 3JCMP 4EMHA 4P72A 4FCYA 3X28B 3G6EA 1BU1A 2AZVA 2LT1A 4L5GA 1PCXA 1YJ9A 4P73C 2EBPA 1PRLC 3NTKA 4KH1B 1Z9ZA 4YRGA 1PHTA 2Q7EA 1PSEA 1QVPA 2P4RA 1Q86U 2CZ1B 2X9HA 5ECAA 2EVRA 2HD0A 2DL5A 4VUBA 2LJ3A 4OLFA 2GTJA 4X9CA 2E70A 4KULA 1YHQT 12ASA 2RNAA 3VS1A 1QLYA 4YCVA 5HK0A 4WI1A 2O01E 2FYKA 5KYYA 2VXEA 2O31A 3QKJA 3JCMb 5GAMd 5LL6S 2GNCA 1UUEA 4F7UA 3GOXA 1K8AC 4C92D 1WXBA 2HZYA 3CXCA 3OB9A 2F2XA 1H3ZA 3VKIA 2PUOB 1Q7YR 3CCRQ 3EFSA 1WQ7A 4RTWA 2EQUA 2L5QA 1TH7A 4C8QE 1TOVA 4CC4B 5LJ3e 3QJYA 2A08A 3NELA 2QQ9A 2A36A 3CCLA 5LJ5f 2MOXA 2GBQA 2RJEA 2YXYA 2G4CA 1WA7A 4QKUA 1ZSGA 1S72T 2CIMA 2NLUA 2ZTGA 4EMKB 5FWCA 1VQ7T 3EFOA 1SESA 1N5ZA 3TEEA 1SG5A 3QWXX 3U23A 4BUGA 1ZQ1A 4ORZA 3J81E 1VQ5A 1H4SA 3MEYA 3P8TA 2L3PA 3CCET 2XTIA 4LUEA 1RLPC 3NHNA 4N4GA 1VQKQ 4XTWA 4M7DB 4J9FA 5CKBA 1NG2A 4HT4A 2CKKA 2M02A 2LMJA 1M3BA 1G3SA 5A2QE 4YRRA 3WXMB 3LW5E 3LGLA 3OS5A 3H6ZA 4ZTZB 2VVKA 2ZCFB 1ATIA 4MDWA 3CD6A 2RHQB 4A63B 3LLRA 2QA4T 4J7IA 4LUDA 5EG2A 2DDZA 2RJDA 3IALA 3OMGA 2QGGA 3TQ7P 2IY5B 4IUPA 1V76A 2HDAA 4CH6A 3DLLA 3I5SA 4X1VA 1WLEA 4C5HA 5IXFA 2W0ZA 2BUDA 4MZTA 2DTOA 4J9GA 4Z89A 4B6MA 1USYA 4MDXA 3E19A 2Q5IA 2JS2A 4XAXB 2RI2A 5CCAA 1PSFA 4H2XB 2K6DA 2QXFA 3LGFA 1AD5A 2MF2A 3VRYA 4BE1A 4QT7A 4M7DC 1QVFP 3OQ5A 1YJWT 1WHJA 4L87A 4C92B 2DLPA 4R0KA 5DLQE 1VQOA 1BYMA 4G85A 1GFCA 3O5ZA 2WSFE 3SEMA 4L6V5 4H2VA 1VQNA 1EFNA 4YRCA 4HXJA 4BE2A 4UC4A 3UGQA 1RAAB 4RG2A 2ZPEB 3TU4K 3HXWA 4YRKA 2DAQA 1ZBXA 1KQ2A 4JLGA 2QI2A 3SB2A 1ADYA 3KXTA 3RF1A 1IRXA 3PIPA
chains in the Genus database with same CATH topology
3H8ZA 5LJ5e 2P0PA 2K4YA 1H4VB 2EFIA 4QVDA 2ZPFB 1NYQA 1NNHA 1WQWA 1Z7MA 4LVJA 4A54A 1XNIA 4M78D 3PT9A 4XU1A 2E5AA 1VQ6T 1QVFS 2EQMA 1P92A 2DJZA 4A4KA 2C8MA 3V7RA 1RI0A 2PMFA 2EWNA 3BW1A 2DIQA 1FXXA 2ZR2A 1B70B 5L8RE 3OYKA 3MF1A 4M78A 2E10A 2ZR3A 1LJOA 5J3BA 5LJ3g 4ME7A 4M78G 4OF1A 4NOYA 2XDBA 1QP2A 4FU6A 5C0MA 1SERA 3L2QA 1K8AU 3RIRA 3QSUA 2KMTA 5LJ3j 4M7AB 3E9HA 1U1SA 3E1SA 4M77C 5FLXE 2EL9A 1E22A 3OS1A 2KDSA 4YYEA 2EQKA 2PQWA 2XIDA 3BY7A 1KG1A 1RIQA 3A74A 3LWIA 4BD3A 3QPHA 1O75A 3HXVA 1YJNT 3CBOA 3DSQA 3GPLA 2D9TA 4M7DE 4MMLA 1VQLA 1Y7XA 2EIFA 2G3RA 4F7UF 5DLOA 5C51B 3QO3A 3M5AA 4J15A 3UGTA 3NENA 1VQ4A 5CKDA 4PLIA 3DB3A 4E7IA 1KQSA 4EPCA 3E9IA 1QVGA 4A4EA 4A4FA 4FIBA 5E3IA 1N8RC 5FRNA 2ZPHB 2KY9A 3PIOA 3JCMJ 2MWPA 1EOVA 2AKWA 3TCJA 2RHYA 5HK3A 3A8MB 4M75C 4E7JA 4O6JA 4ELZC 3X25B 3CCRT 4HCBA 4IUQA 4PLLA 1X6OA 4Q15A 2ZZGA 1R8OB 5LJ5g 3TEHB 5CVIA 3TREA 1VQ8T 3M55A 4PJOC 3CMAT 3VYHB 1VQMA 3CPWA 3LYIA 3HXZA 1JJCB 4BDYA 3JAME 1Y96A 1GXIE 1N9SA 3L2UA 1VQPA 5HY6A 5D6XA 3CCQT 3UH0A 5LJ5j 3VBBA 4RG8A 4PHCA 3G4ST 1W66A 2DTHA 3QXEB 4EO4A 1NPRA 5GAOm 3OYIA 2DPPB 1W2BS 5C6SA 3QUIA 2EJ9A 2QHSA 3DB4A 2V8KA 2J3LA 2RHUA 4BE0A 4LD6A 2DIGA 2P0LA 4QQDA 3JSCA 3M53A 4LVIA 4K86A 4TVRA 4J5YA 5GAN3 4C8QA 4C0ZA 2OTJT 2VYTA 3CPFA 4M7AE 4C8QG 3UFGA 1NE8A 3JCMh 2IVWA 2Y4XA 4KBMB 2YRVA 4N0AC 3OA6A 3CPWS 3URGA 3OY9A 2RI5A 3HY0A 4YRIA 1YIJA 2ZNJA 4XU2A 3G1ZA 4XK8E 3OSSC 5HKCA 1UGRB 5C53B 3DLMA 1D3BB 1X54A 3RKXA 4PJOF 3OYCA 3LX7A 2LTOA 3HFZA 4JUVA 4C0DC 2CZ6B 4FT2A 4IUTA 3RERA 3L2WA 3G6ET 3J80E 4P75A 5CR2A 1YJ9T 1FWZA 1I5LA 5D6YA 3R07A 1N8RU 5DM7R 1NJ2A 3GNGA 1HC7A 2KAFA 1X2GA 5GAN5 4P73A 1VUBA 3ERRA 4P74C 4DQ2A 3OMCA 1VIFA 2LQKA 3MP6A 3CCVA 4J8OA 1XOVA 4QVZA 2KVQG 5M9OA 3C12A 4XTUA 1M90C 3HY1A 2PUKB 2EJFA 3X26B 1BIBA 1EFWA 2JTFA 5CO7A 3VQXA 4C5GA 1E24A 2RM4A 3CCLT 2RJFA 5LJ3f 1RL2A 1B7YA 1KHCA 2ZCEA 5IN1A 4BY6C 3V7SA 3L2VA 1VQ5T 1ASZA 3SWNC 2RO0A 4HWRA 2VUBA 2QTXA 3MEVA 2HQEA 4XU0A 2A8EA 1YFRA 1Q7YC 5CKFA 4PG3A 3CD6T 4Q6GA 2GFAA 4WF2A 3ME9A 4FT4A 5CQXA 2P0KA 4V2SA 4TQDA 2CGHA 3CCUA 3OS0A 3RKYA 5GANh 2P5IA 1B34A 4PL6A 1V29B 3WQZA 2M0OA 2C06A 5GAN4 2WACA 4O2DA 4NL3A 5K1PA 4HCCA 2XDDA 1FYFA 4TVAB 3FDRA 4IUUA 1VQOT 3INZA 1G3TA 2EJGA 3DKMA 3C95A 3WVEB 1MHNA 4CRIA 3MHXA 5LJ3d 3A7RA 1SETA 4F7UG 4DOWA 3HHTB 4C8QF 2ARTA 3OSVA 1OZ3A 1YI2A 3MEWA 4OGCA 5GAOr 2ZT6A 4LDXA 2X4JA 1XQHA 4LDUA 1X75C 3OBYA 3UPUA 4HVCA 1H4QA 3S3MA 3SFMA 1QVFA 3PNWC 1WJRA 4OMFB 3M54A 5KE2A 4UP7A 2KQWA 2ZPIB 3M4QA 1G3WA 2M1HA 1I4K1 3G71A 2GQVA 4O5VA 3HKSA 2L8DA 1M90U 3VU3C 5J39A 3CCJA 2EKOA 1YGBA 4EMKC 3JCMc 4P72C 1Q82C 2ODRC 1X2HA 4RQEA 3OW2A 3M9QA 2X35A 2V8JA 2M16A 2ALYA 2DVEA 1ASYA 4HKEA 2DXUA 3OYBA 2OTLA 3PGGA 4UP9A 4M77A 2DD4A 3NTIA 4C0FA 2CYZB 2A3LA 4M77G 1EQRA 3MEAA 4QVCA 2QQBA 1VQLT 3HRKA 4FSXA 3JCMQ 5GAMh 3OYFA 5LJ5d 3JCMW 2O4XA 1QE0A 4R55A 4H2YA 3BDUA 2NS6A 5GMKm 4J6XA 5AYFA 4CS3A 2Q7GA 1Q7YU 2BKDN 4WJ3M 2WSCE 2EQJA 4X5OA 5GMKh 3VQYA 4YRSA 3A8OB 4M75D 3CC4A 4C92C 4BACA 3FC3A 4PNOA 1U8RA 2YLCA 4LNSA 1QW1A 4H2UA 3UT1A 4JRPA 4ZTFA 2P0QA 4PJOD 4M75A 2E6NA 1M8VA 1KHIA 1E1TA 5KE3A 3CCEA 1VQMT 4M75G 3LSSA 2EYQA 4K88A 4LD9K 1HK9A 4TWAA 3RMQA 2F69A 3OW2S 3JCMf 1H4TA 1VQPT 4HWTA 2HQXA 4GLKA 4PJOA 4BW9A 2C7IA 3V7CA 4NCXA 1BI0A 3CC7A 5GAOq 1YITA 3ER0A 3V8JA 4PJOG 1QF6A 2EAYA 2CJ9A 2XU8A 2E5QA 1N6AA 3HFVA 3MQZA 5I21A 3OYAA 4KT0E 4YRMA 3JB9G 5FRMA 1UGSB 3C94A 4G84A 3RKWA 2D6FA 2DU5A 5J26A 2Y90A 5KCHA 4M7DF 2LNVA 3MP8A 4KR3A 1K73C 2H3JA 1W2BA 2I4OA 3A8LB 4QQ6A 4XTXA 3CC2A 3F70A 4M78B 4M7AC 2E65A 2ZIOA 4TQFA 4HCZA 3I7FA 1BI3A 3UDCA 3CCMA 2DD5A 3HPWA 3ASKA 4E7KA 3RL6A 4H02A 1C0AA 4CS4A 1LYLA 2E6ZA 2FHDA 3S3OA 3FIFA 5I2SA 1Q82U 2ZPBB 2GF7A 3ICAA 1EVKA 2IG0A 2DQ0A 4C92E 4DPGA 4C0GA 1NPPA 3JCMd 1XTDA 2E41A 1YIJT 4M78C 3OYDA 1I81A 1L0WA 4LDWA 3FLGA 5CKHA 3JCMe 1G51A 1OI1A 3CMEA 2AHJB 3QYHB 4JRIA 4MZPA 2RB6A 2X4YA 1UGQB 4YRTA 4XTYA 1N27A 1VQ9A 2QDYB 3RACA 3A5ZA 3L1AA 3OYYA 2WSEE 3P8YA 2QQSA 1KC8C 1FX7A 2LX9A 3HFNA 4RQFA 4D6WA 4M77F 1NJ8A 2ZZEA 3TEGA 2DZ9A 3JB9I 1BBUA 5GAOn 2AKWB 3P8HA 5DY9A 4A4GA 1Y07A 4QQGA 4C8QD 3CCVT 2CS7A 5GMKi 4HT8A 4P74A 1WPYA 4EDUA 2L89A 1U1TA 3W3SA 3NFCA 5GANf 2K5FA 3RESA 2E1HA 2YLBA 4N4IA 4OB1B 4M7AF 2AMCB 2B8AA 1SSFA 2E12A 1IREB 4RCCA 3MCAB 3QO5A 2R5MA 1NYRA 1E1OA 2K3XA 3NETA 4M75F 3OYEA 2HAXA 4JDSA 4NL2A 2Q7HA 3SWNA 3EFRA 4XTZA 3I55T 1K73U 1Q81C 4M78E 2OAUA 3A7AA 3PCOB 4IUVA 1X56A 4YROA 1N9WA 3CCUT 2LCLA 3AHUA 1KOGA 3L4GA 4B9XA 2LC4A 1JB0E 3HRSA 1OZ2A 2HNIA 4YP0A 3Q1JA 3JB9F 4C8QB 2PVGB 1YBYA 3FEOA 1VQKA 3JCMV 3JCMg 5CQYA 1EIFA 2XG8D 1NJ6A 2F5KA 3REUA 5GANe 3M4GA 1JBMA 2RHSA 1ZHIA 3VQVA 3M57A 3R6OA 4EMGA 3QG1A 3HRUA 4YCWA 4L59A 1YI2T 1M5Q1 2LCCA 2V8IA 4J6YA 4B9WA 1AHJB 3A8GB 4ZGDB 3VV0A 5GAOl 3HFZB 2ZGWA 3KFUA 4MZMA 1ADJA 5GAMf 3GNFB 2LVMA 4K87A 3OYHA 1KC8U 4ATOA 1BKBA 2R57A 5I2MA 1EIYB 2I4MA 2A7YA 2ZINA 4LVMA 3RUXA 1PYSB 1DJ7B 3IG2A 1M1FA 4LVKA 3M59A 1G3YA 3G71T 2J3MA 3N5BB 3GLXA 3M4YA 4E7HA 4CH3A 1KQ1A 2ODRD 3BFMA 3CCJT 4BWAA 5FU7B 1UB4A 2XDPA 2XHCA 4M7DD 1VIEA 3HSBA 4Q5WA 3JB9J 4EMKA 4BI3A 3QZ5B 2OTLT 1G5IA 1VQZA 4TTVA 1B7YB 2DU7A 4M7DA 2QEXA 2XGTA 3I56A 1VQNT 1KD1C 4M7DG 2PVOB 3QO7A 2X4WA 2RI3A 3VUBA 3QZ9B 2RHQA 2K2VA 4XQ3A 4P71C 4RMFA 3KUFA 1NJIC 2D0QB 3FB9A 5FU7C 3M56A 2IY5A 4DOVA 1Q81U 4ZIBA 4KUDK 5GAMe 2DXCA 1WGSA 3CC4T 2KSSA 2CJAA 3E9GA 2DZCA 2VGNA 3A32A 4H2XA 3SDZA 4FL6A 5GANg 3REXA 2VV5A 5GAN6 4YREA 5HGQA 3BDLA 4H2TA 4C92A 3A31A 2M9UA 3LC0A 3HXXA 3HTZA 1B34B 1NJ1A 3BJUA 5GMKe 1G5HA 1H641 4C92G 3GP8A 3HL8A 3QBYA 1B76A 5GANj 2MAMA 4YRNA 2K5LA 1W4SA 4N4HA 4C5EA 2RK1A 3PZCA 5KNNA 4MMKA 3S3NA 4F7UB 4M77D 5GAOp 4CH4A 2RJCA 3CCSA 4OB0B 3CC7T 5K1XA 1YITT 2CZ7B 2LRQA 1WNLA 1M1KC 2K5IA 2MMPA 3A7UA 3OYLA 2P4TA 5GAN2 4JRKA 1M4ZA 2JOYA 5GAN7 2LQ8A 1N9RA 1WU7A 2QQAA 1B70A 1QP3A 1IZ6A 5D6WA 4P5NA 3M58A 1YHQA 4ZTJA 3RGLA 4M7AD 5LJ3h 1J5WA 4Y91A 1VQ4T 4OVAA 3OYNA 3CC2T 2QHTA 3L42A 3CXCS 3PFSA 4BI8B 3JRZA 4P3PA 2F5TX 5C52B 3CCMT 1LNXA 1BI2A 4M7AA 2XKOC 3WVDB 5KH6A 3PMTA 4ZN3A 1WYDA 1I8FA 3T9NA 3RMSA 4J7FA 4X9DA 1M9SA 4M7AG 4YRLA 4GY5A 3OYGA 4NS5A 1S72A 4X34A 2ALYB 1VQ7A 3OS2A 3HRIA 2Y4YA 2ARUA 4UP8A 4M77B 1YCYA 4IKFA 4HWSA 2L3RA 1MGQA 4TVYA 2BIVA 4RMOA 3X20B 5A0GA 5GAMg 1YB3A 3JB9D 1KD1U 4HA8A 3CMET 4CS2A 2GFUA 2VC8A 1EVLA 2O4XB 2LDMA 4C5IA 2QA4A 1VQ9T 1NJIU 3CMQA 2DEQA 4H2WA 3QO8A 4UPAA 4IURA 4E7LA 5GAMj 1USYC 2KK4A 2RD1A 3JB9H 4ZTUB 4HT9A 4H2SA 2RK2A 3FRNA 1SRYA 3OYJA 3QNEA 3P8DA 3P8BB 3QJ6A 5GMKj 1YJWA 3TEHA 3CBPA 5LJ5h 4FM4B 3QYGB 1OYXA 1JJCA 3MP1A 4R56A 4M75B 4YRFA 4XU3A 2E3CA 2ZNIA 2K3YA 2I4NA 2JTMA 3NTHA 3VQWA 3NEMA 5IT9E 4F7UE 3C4SA 3TUPA 1K9MC 2I2LA 3L2RA 4OGEA 4LVLA 2YHTA 4PJOB 3HRTA 1BIAA 2DK3A 3JCMX 3M4PA 3E9FA 1UGPB 1M1KU 2RHIA 3HXYA 4P3NA 4C92F 2ZZFA 3META 1VQ6A 4A53A 2JN0A 4N0AA 1NZ9A 3GF5A 3IKLA 5GMKl 4E47A 2ZIMA 3HXUA 1UEBA 4CI0C 3L2ZA 4ELYC 4WJ4A 3P8VA 4II1A 3MO8A 2ZT8A 3CEYA 2RH2A 2DXBA 1KMMA 2MWOA 2DQ3A 2JUFA 2HBPA 2MI6A 2PMEA 3ZEHA 2AMCA 3QTCA 2XICA 4XTVA 3G7ZA 1GGMA 3PMIA 2ZT7A 3OYMA 1JRIA 2FL7A 1VQKT 5ELNA 5A0LA 2ZPGB 4AH6A 1YFTA 2PU9B 2R58A 3O8VA 5A0DA 2XI9A 3LH0A 2ZT5A 4M77E 3SD4A 1YJNA 2VXFA 2GCXA 4KQEA 2JZ2A 1D3BA 1KQSS 4P3OA 1QVGS 1BBWA 1Y96B 3HFOA 3PCOA 3S6WA 2VGMA 2CJBA 1M1GA 4HWPA 1G5VA 1JJ2A 4JS5A 1LOJA 4J83A 4XEMA 4JRQA 2XK0A 2DO3A 3HP9A 1Q86C 3A5ZB 2QQRA 2Q5HA 4ZGEB 2RA2A 4C0DB 3UWNA 3CBMA 1Y71A 3CCRA 3MEUA 1IL2A 5F5WA 1WJSA 1BI1A 4CH5A 3QHSA 4M78F 3J7AF 1VQ8A 4M75E 3IKMB 3CMAA 4RDXA 4RCBA 4JS4A 4E51A 2FB7A 4OB3B 4EX5A 3QIIA 4YDQA 4LDYA 1O9SA 2R5AA 3CCQA 4YPFA 4OP0A 4PKCC 4PJOE 3A5YA 1K9MU 4HWOA 5CK9A 1B8AA 2DXTA 3A8HB 3G4SA 3KBGA 2PVDB 5GANd 2K57A 4J6WA 2RHXA 4RKUE 3VJPA 1EIYA 2QEXT 3I56T 1HXDA 4YTLA 5IAYA 3GIBA 1PYSA 4OB2B 3ZBDA 4BY6B 3MF2A 1JJ2S 2ZXFA 3FJPA 4DA4A 2DKGA 5FU6B 3QDRB 4A4HA 3PTAA 3OBWA 3SWNB 2I4LA 1Z7NA 2QHUA 4C8QC 2QHVA 5ELOA 3EAEA 3V8LA 1HTTA 4JJNK 3LSQA 3VUZA 4P71A 3V8KA 3OD1A 4ZGJB 4YRPA 2OTJA 1YFSA 2JVVA 4ZN1A 3L4GB 4XEOA 5KCOA 2LT4A 2E64A 5GAN8 2JNGA 2FVUA 2ZZDA 2CZ0B 1X01A 4TVAA 5CAIA 1KMNA 4TVWA 5FU6C 3ZFJA 4QW2A 3X24B 5FROA 1X55A 1NJ5A 4KUIA 11ASA 4YCUA 5CKEA 4BI4A 5CIUA 2ARSA 4BB7A 4LDVA 2RHZA 4Z02A 2XD0A 3CCST 2RHSB 3I55A 4JLIA 1WJQA 2X4XA 4YRQA 4P75C 4KR2A 4Y28E 3VYGA 4BDZA 4YRJA 2DTIA 3LWHA 3JCMP 4EMHA 4P72A 3X28B 3G6EA 2LT1A 4L5GA 1YJ9A 4P73C 3NTKA 4YRGA 2Q7EA 1PSEA 1QVPA 1Q86U 2CZ1B 2HD0A 4VUBA 4OLFA 4X9CA 2E70A 4KULA 1YHQT 12ASA 4YCVA 5HK0A 4WI1A 2O01E 2FYKA 2VXEA 3QKJA 3JCMb 5GAMd 5LL6S 3GOXA 4F7UA 1K8AC 4C92D 3CXCA 3OB9A 1H3ZA 3VKIA 2PUOB 3EFSA 1WQ7A 2EQUA 2L5QA 1TH7A 4C8QE 5LJ3e 3QJYA 3NELA 2QQ9A 3CCLA 5LJ5f 2RJEA 2G4CA 1S72T 2CIMA 2NLUA 2ZTGA 4EMKB 1VQ7T 1SESA 3TEEA 4BUGA 1ZQ1A 3J81E 1VQ5A 1H4SA 3MEYA 3P8TA 3CCET 2XTIA 4N4GA 4XTWA 4M7DB 5CKBA 4HT4A 2CKKA 1G3SA 5A2QE 4YRRA 3WXMB 3LW5E 3LGLA 3OS5A 3H6ZA 4ZTZB 2ZCFB 1ATIA 4MDWA 3CD6A 2RHQB 3LLRA 2QA4T 4J7IA 5EG2A 2DDZA 2RJDA 3IALA 3OMGA 2IY5B 4IUPA 4CH6A 3DLLA 1WLEA 4C5HA 2BUDA 4MZTA 2DTOA 1USYA 4MDXA 3E19A 2Q5IA 4XAXB 2RI2A 5CCAA 1PSFA 4H2XB 2QXFA 3LGFA 2MF2A 4BE1A 4M7DC 3OQ5A 1YJWT 4L87A 4C92B 5DLQE 1VQOA 1BYMA 4G85A 2WSFE 4L6V5 4H2VA 1VQNA 4YRCA 4BE2A 4UC4A 3UGQA 4RG2A 2ZPEB 3TU4K 3HXWA 4YRKA 2DAQA 1ZBXA 1KQ2A 4JLGA 2QI2A 3SB2A 1ADYA 3KXTA 3RF1A 3PIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ5 e;  3IKL A;  3AHU A;  1H4V B;  1FYF A;  1KOG A;  5GMK l;  4TVA B;  3L4G A;  2ZIM A;  4QVD A;  3HXU A;  1NYQ A;  1NNH A;  3INZ A;  1WQW A;  1Z7M A;  4A54 A;  2HNI A;  2EJG A;  3JB9 F;  4YP0 A;  4C8Q B;  3L2Z A;  4WJ4 A;  3P8V A;  2ZT8 A;  4M78 D;  4XU1 A;  5LJ3 d;  3A7R A;  3JCM V;  2E5A A;  3JCM g;  1SET A;  4F7U G;  1KMM A;  2DQ3 A;  2DJZ A;  4C8Q F;  2ART A;  2C8M A;  3V7R A;  1NJ6 A;  2PMF A;  2EWN A;  2PME A;  3BW1 A;  2ZR2 A;  5GAO r;  2ZT6 A;  1B70 B;  5GAN e;  2AMC A;  3QTC A;  3REU A;  4XTV A;  1GGM A;  3MF1 A;  4M78 A;  2E10 A;  2ZR3 A;  3M4G A;  2ZT7 A;  1JRI A;  1JBM A;  1LJO A;  5LJ3 g;  2RHS A;  5ELN A;  4M78 G;  3VQV A;  4NOY A;  4AH6 A;  4EMG A;  1YFT A;  4HVC A;  4YCW A;  1M5Q 1;  1H4Q A;  4J6Y A;  1SER A;  2ZT5 A;  4M77 E;  3RIR A;  3QSU A;  5LJ3 j;  5GAO l;  2VXF A;  3HFZ B;  2ZGW A;  3KFU A;  1ADJ A;  4M7A B;  4UP7 A;  3E9H A;  3M4Q A;  1U1S A;  4KQE A;  4M77 C;  2EL9 A;  1E22 A;  1D3B A;  1I4K 1;  5GAM f;  4P3O A;  4YYE A;  1BBW A;  4K87 A;  1Y96 B;  3HFO A;  3PCO A;  3BY7 A;  3VU3 C;  1RIQ A;  2CJB A;  3A74 A;  4HWP A;  1EIY B;  2I4M A;  2ZIN A;  1YGB A;  4EMK C;  3HXV A;  1LOJ A;  3RUX A;  4XEM A;  3JCM c;  1PYS B;  4P72 C;  4RQE A;  2ODR C;  1X2H A;  3IG2 A;  3DSQ A;  4M7D E;  4MML A;  2ALY A;  2DVE A;  1ASY A;  2J3M A;  4F7U F;  2Q5H A;  2DXU A;  5C51 B;  3PGG A;  3QO3 A;  4J15 A;  3UGT A;  4UP9 A;  2RA2 A;  3NEN A;  4CH3 A;  1KQ1 A;  4M77 A;  2ODR D;  3BFM A;  3E9I A;  4BWA A;  4M77 G;  1EQR A;  1IL2 A;  4QVC A;  5F5W A;  5E3I A;  4M7D D;  3HSB A;  3JB9 J;  3HRK A;  3JCM Q;  4CH5 A;  3QHS A;  4M78 F;  4EMK A;  5GAM h;  3JCM J;  1EOV A;  5LJ5 d;  2AKW A;  4M75 E;  3IKM B;  3JCM W;  4RDX A;  1G5I A;  1QE0 A;  4RCB A;  4H2Y A;  1VQZ A;  3BDU A;  4TTV A;  1B7Y B;  5GMK m;  2DU7 A;  4J6X A;  4M75 C;  4E51 A;  4CS3 A;  2Q7G A;  2FB7 A;  4EX5 A;  4YDQ A;  4M7D A;  4WJ3 M;  2XGT A;  4YPF A;  4OP0 A;  4X5O A;  5GMK h;  4PJO E;  3A5Y A;  4Q15 A;  3VQY A;  2ZZG A;  4M7D G;  4HWO A;  5LJ5 g;  3TEH B;  4YRS A;  3QO7 A;  4M75 D;  1B8A A;  4C92 C;  2DXT A;  4PJO C;  2RHQ A;  4XQ3 A;  5GAN d;  3HXZ A;  4P71 C;  4RMF A;  1JJC B;  4PNO A;  2K57 A;  1Y96 A;  2YLC A;  3FB9 A;  4LNS A;  4J6W A;  4H2U A;  1N9S A;  2IY5 A;  1EIY A;  1HXD A;  3UH0 A;  5LJ5 j;  4PJO D;  4ZIB A;  4M75 A;  3GIB A;  3VBB A;  1PYS A;  5GAM e;  1M8V A;  3MF2 A;  2ZXF A;  4PHC A;  1E1T A;  2CJA A;  3FJP A;  1W66 A;  2DZC A;  3A32 A;  2DTH A;  2DKG A;  4M75 G;  4H2X A;  3LSS A;  5GAN g;  4K88 A;  3REX A;  1HK9 A;  4EO4 A;  3SWN B;  4TWA A;  2I4L A;  1Z7N A;  2QHU A;  5GAN 6;  4YRE A;  4C8Q C;  2QHV A;  5ELO A;  5HGQ A;  4H2T A;  3JCM f;  4C92 A;  1H4T A;  3V8L A;  5GAO m;  4HWT A;  3A31 A;  4PJO A;  3LC0 A;  1HTT A;  4BW9 A;  3HXX A;  3HTZ A;  1B34 B;  1NJ1 A;  3V7C A;  2C7I A;  3BJU A;  3LSQ A;  4NCX A;  5GMK e;  3QUI A;  4P71 A;  1G5H A;  1H64 1;  4C92 G;  5GAO q;  3V8K A;  3V8J A;  4PJO G;  1QF6 A;  2EJ9 A;  1B76 A;  5GAN j;  3OD1 A;  2QHS A;  2EAY A;  4YRP A;  2CJ9 A;  4YRN A;  1YFS A;  2J3L A;  3L4G B;  4XEO A;  3HFV A;  3PZC A;  5I21 A;  2E64 A;  5GAN 8;  5KNN A;  4MMK A;  4F7U B;  4M77 D;  5GAO p;  1X01 A;  4CH4 A;  2P0L A;  4YRM A;  4TVA A;  3JB9 G;  5CAI A;  1KMN A;  4G84 A;  3RKW A;  5K1X A;  2DU5 A;  2Y90 A;  4M7D F;  4K86 A;  4TVW A;  4J5Y A;  5GAN 3;  1WNL A;  4C8Q A;  4KR3 A;  3A7U A;  2I4O A;  1X55 A;  1NJ5 A;  4M7A E;  4C8Q G;  11AS A;  5GAN 2;  4YCU A;  4JRK A;  3UFG A;  4XTX A;  3JCM h;  4M78 B;  2ARS A;  5GAN 7;  1N9R A;  4M7A C;  1WU7 A;  2E65 A;  2ZIO A;  2RHS B;  4JLI A;  4TQF A;  3I7F A;  4N0A C;  1B70 A;  4YRQ A;  4P75 C;  4KR2 A;  3HY0 A;  3RL6 A;  4H02 A;  4YRI A;  3RGL A;  2ZNJ A;  4XU2 A;  4YRJ A;  1C0A A;  2DTI A;  3JCM P;  4M7A D;  4EMH A;  4P72 A;  4CS4 A;  5LJ3 h;  1J5W A;  4Y91 A;  3G1Z A;  1LYL A;  4P73 C;  2QHT A;  5C53 B;  3FIF A;  4YRG A;  2Q7E A;  3ICA A;  1EVK A;  1D3B B;  2DQ0 A;  1X54 A;  3RKX A;  4C92 E;  4P3P A;  4DPG A;  4PJO F;  5C52 B;  3HFZ A;  1LNX A;  1N9W A;  4OLF A;  4M7A A;  4X9C A;  3JCM d;  12AS A;  4JUV A;  1I8F A;  2E41 A;  1WYD A;  3RER A;  4M78 C;  1I81 A;  4X9D A;  1L0W A;  4M7A G;  4YRL A;  4YCV A;  4P75 A;  3JCM e;  1I5L A;  4WI1 A;  2FYK A;  2VXE A;  3JCM b;  3R07 A;  1NJ2 A;  1G51 A;  5GAM d;  4F7U A;  4C92 D;  2ALY B;  1HC7 A;  3HRI A;  4JRI A;  2ARU A;  4UP8 A;  1X2G A;  5GAN 5;  4P73 A;  3ERR A;  2RB6 A;  4P74 C;  3EFS A;  1WQ7 A;  4DQ2 A;  4YRT A;  4M77 B;  4XTY A;  1YCY A;  3RAC A;  1TH7 A;  4C8Q E;  3A5Z A;  3L1A A;  5LJ3 e;  4HWS A;  3NEL A;  1MGQ A;  4TVY A;  3P8Y A;  5LJ5 f;  4XTU A;  3HY1 A;  3HFN A;  4RQF A;  5GAM g;  1YB3 A;  2G4C A;  3JB9 D;  2EJF A;  4M77 F;  1NJ8 A;  2ZZE A;  2CIM A;  3TEG A;  4HA8 A;  1BIB A;  1EFW A;  2DZ9 A;  3JB9 I;  1BBU A;  4EMK B;  2ZTG A;  4CS2 A;  2VC8 A;  5GAO n;  1EVL A;  1SES A;  2AKW B;  5DY9 A;  3VQX A;  1H4S A;  3MEY A;  4C8Q D;  3CMQ A;  3P8T A;  2DEQ A;  4H2W A;  3QO8 A;  4UPA A;  2XTI A;  5GMK i;  5GAM j;  4HT8 A;  1USY C;  4XTW A;  4M7D B;  1E24 A;  2RD1 A;  2RM4 A;  5LJ3 f;  3JB9 H;  4P74 A;  1WPY A;  1B7Y A;  4ZTU B;  4HT9 A;  1U1T A;  4H2S A;  3W3S A;  4YRR A;  5GAN f;  2ZCE A;  1SRY A;  3QNE A;  4ZTZ B;  1ATI A;  3RES A;  3V7S A;  2E1H A;  2YLB A;  2RHQ B;  3RF1 A;  1ASZ A;  3SWN C;  4HWR A;  5GMK j;  2DDZ A;  3TEH A;  2QTX A;  3IAL A;  4M7A F;  2IY5 B;  5LJ5 h;  2AMC B;  4CH6 A;  4XU0 A;  1WLE A;  1JJC A;  1YFR A;  4M75 B;  4YRF A;  2DTO A;  4XU3 A;  2E3C A;  4RCC A;  1USY A;  4PG3 A;  2ZNI A;  2I4N A;  2Q5I A;  3QO5 A;  1NYR A;  3VQW A;  3NEM A;  4H2X B;  4Q6G A;  1E1O A;  4F7U E;  4WF2 A;  4V2S A;  3TUP A;  4M7D C;  3NET A;  2I2L A;  4M75 F;  4TQD A;  2CGH A;  4NL2 A;  4L87 A;  4C92 B;  2YHT A;  4PJO B;  3RKY A;  1BIA A;  2Q7H A;  4G85 A;  3SWN A;  5GAN h;  3JCM X;  3M4P A;  3EFR A;  4XTZ A;  4H2V A;  3HXY A;  4P3N A;  4YRC A;  4C92 F;  2P5I A;  3UGQ A;  1B34 A;  4M78 E;  3WQZ A;  3A7A A;  2ZZF A;  4YRK A;  3HXW A;  5GAN 4;  3PCO B;  4A53 A;  1KQ2 A;  2JN0 A;  4O2D A;  4NL3 A;  1X56 A;  4YRO A;  3SB2 A;  1ADY A;  4N0A A;  5K1P A; 
#chains in the Genus database with same CATH topology
 3H8Z A;  2DEU A;  5LJ5 e;  2P0P A;  2K4Y A;  1H4V B;  2EFI A;  3OW2 P;  4QVD A;  2ZPF B;  1UHC A;  1NYQ A;  1NNH A;  1WQW A;  2H3E B;  4AFS C;  4A54 A;  1Z7M A;  4LVJ A;  3H9N A;  1XNI A;  1M3C A;  3PT9 A;  4M78 D;  4XU1 A;  1M3A A;  1Q82 R;  2E5A A;  1VQ6 T;  1QVF S;  2EQM A;  2MIO A;  2AKL A;  1P92 A;  2DJZ A;  4A4K A;  2C8M A;  1MMG A;  3V7R A;  1RI0 A;  2PMF A;  2EWN A;  2W10 A;  3BW1 A;  2DIQ A;  2LJ0 A;  1FXX A;  2ZR2 A;  1B70 B;  5L8R E;  3OYK A;  3MF1 A;  4M78 A;  2E10 A;  1Y0M A;  1U5S A;  2ZR3 A;  1JEG A;  1LJO A;  5J3B A;  5LJ3 g;  2LNH B;  1AZE A;  1Z9Q A;  4ME7 A;  4M78 G;  4OF1 A;  2BZY A;  4NOY A;  1OX9 A;  2QEX Q;  3I56 Q;  2XDB A;  1QP2 A;  1V1C A;  4FU6 A;  5C0M A;  2VAS A;  1XJW B;  1SER A;  1NYF A;  2MK5 A;  3L2Q A;  1IXD A;  1K8A U;  1TUG B;  3RIR A;  3QSU A;  3PVL A;  1UTI A;  2KMT A;  5LJ3 j;  4ESR A;  2JS0 A;  4OMO A;  4F17 A;  2AIR B;  3ZL7 C;  4M7A B;  3E9H A;  1U1S A;  3E1S A;  4M77 C;  5FLX E;  2EL9 A;  1E22 A;  5EC7 A;  3OS1 A;  2KDS A;  4YYE A;  2EQK A;  2PQW A;  3UA6 A;  2XID A;  3BY7 A;  1KG1 A;  1RIQ A;  3A74 A;  3LWI A;  4BD3 A;  3QPH A;  1O75 A;  3HXV A;  1YJN T;  3CBO A;  2KYM A;  3DSQ A;  3CCL Q;  2K7A A;  2D9T A;  3GPL A;  4MML A;  4M7D E;  1VQL A;  1Y7X A;  2CP7 A;  2EIF A;  2G3R A;  4F7U F;  5DLO A;  5C51 B;  3QO3 A;  3M5A A;  4J15 A;  3UGT A;  1K9A A;  3NEN A;  4E6R A;  1WHH A;  1VQ4 A;  1GCP A;  5CKD A;  4PLI A;  3DB3 A;  4E7I A;  1UG1 A;  1KQS A;  1WXT A;  4EPC A;  3E9I A;  1QVG A;  4A4E A;  2KRS A;  4HVU A;  4A4F A;  3M0Q A;  4FIB A;  5E3I A;  1N8R C;  5FRN A;  2ZPH B;  2KY9 A;  5IHN A;  3PIO A;  3JCM J;  2MWP A;  1EOV A;  2AKW A;  3TCJ A;  4KGZ B;  2NUZ A;  2A28 A;  2RHY A;  1A0N B;  5HK3 A;  2YDL A;  3A8M B;  4M75 C;  2L2P A;  4E7J A;  4AT1 B;  3VS6 A;  4O6J A;  2DMO A;  4ELZ C;  3X25 B;  3CCR T;  4HCB A;  4IUQ A;  1PD1 A;  2HL5 C;  1W2B P;  4PLL A;  1X6O A;  1U3O A;  4Q15 A;  3EHQ A;  2ZZG A;  1HSQ A;  1R8O B;  2P84 A;  5LJ5 g;  3TEH B;  5CVI A;  3TRE A;  1OV3 A;  3M55 A;  1VQ8 T;  4F16 A;  1X27 A;  3G1J A;  3CMA T;  3VYH B;  1VQM A;  4PJO C;  4J9B A;  3CPW A;  1K73 R;  3LYI A;  3HXZ A;  1JJC B;  4BDY A;  3JAM E;  1Y96 A;  1GXI E;  2CP5 A;  1N9S A;  1YHQ Q;  3L2U A;  1VQP A;  1AEY A;  5HY6 A;  1PKS A;  5D6X A;  2LQN A;  2DL4 A;  3CCQ T;  5LJ5 j;  3UH0 A;  2I0N A;  8AT1 B;  3VBB A;  2KRO A;  2JTE A;  4OMP A;  1VQO Q;  1ZSZ A;  4RG8 A;  1U06 A;  4PHC A;  1MNE A;  3G4S T;  1PG5 B;  1W66 A;  1PM3 A;  2DTH A;  3QXE B;  4EO4 A;  3EGD B;  4GLM A;  1NPR A;  1PNJ A;  5GAO m;  3OYI A;  3QDF A;  2DPP B;  3NPF A;  1AZG B;  1W2B S;  5C6S A;  3QUI A;  1KK7 A;  2EJ9 A;  4RTX A;  2QHS A;  3DB4 A;  2V8K A;  2J3L A;  2RHU A;  4BE0 A;  1MND A;  4LD6 A;  2KNB B;  1GRI A;  2DIG A;  1MUZ A;  1NM7 A;  2P0L A;  5FW9 A;  4QQD A;  2CT3 A;  3JSC A;  1CSK A;  3M53 A;  4LVI A;  4K86 A;  4TVR A;  4J5Y A;  5GAN 3;  4C8Q A;  2MCN A;  4C0Z A;  4E7S A;  2OTJ T;  2VYT A;  2FRW A;  1B07 A;  3CPF A;  4M7A E;  4C8Q G;  3UFG A;  1RUW A;  1NE8 A;  3EG9 B;  2DYB A;  3E2U A;  2FPF A;  3JCM h;  2IVW A;  2QA4 Q;  2Y4X A;  2NYS A;  2CSQ A;  4KBM B;  1KC8 R;  2NUP A;  2YRV A;  4N0A C;  3OA6 A;  3EG1 A;  3CPW S;  3URG A;  3OY9 A;  1ABO A;  2RI5 A;  2B86 A;  4DBR A;  2EW3 A;  3HY0 A;  4YRI A;  2XMF A;  3RR6 A;  1YIJ A;  4XU2 A;  2ZNJ A;  2QGF B;  2QK0 A;  2JM8 A;  3G1Z A;  4XK8 E;  3OSS C;  5HKC A;  4PJM A;  1UGR B;  5C53 B;  1K1Z A;  2DET A;  1YJW Q;  2DX1 A;  3DLM A;  1D3B B;  2COW A;  1X54 A;  3RKX A;  4PJO F;  3OYC A;  3LX7 A;  2BTT A;  2LTO A;  3HFZ A;  4JUV A;  4C0D C;  3H41 A;  1SEM A;  2CZ6 B;  4FT2 A;  4IUT A;  3RER A;  3L2W A;  1UJ0 A;  4E2F B;  2E4H A;  3G6E T;  3J80 E;  4P75 A;  5CR2 A;  1YJ9 T;  1FWZ A;  1X2K A;  1I5L A;  5D6Y A;  3R07 A;  1N8R U;  5DM7 R;  1NJ2 A;  3GNG A;  2EGA A;  2Z0W A;  1HC7 A;  2KAF A;  1X2G A;  5GAN 5;  2AKK A;  4P73 A;  1VUB A;  3ERR A;  4P74 C;  2QAS A;  4DQ2 A;  3OMC A;  1VIF A;  1KFZ A;  1D1A A;  2LQK A;  2FZG B;  3MP6 A;  4J9H A;  2X3W D;  1FMV A;  3CCV A;  4J8O A;  1XOV A;  4HVW A;  4QVZ A;  2KVQ G;  5M9O A;  3C12 A;  1KIK A;  4XTU A;  1VQ6 Q;  1M90 C;  3HY1 A;  1C1A A;  2RQW A;  4D8K A;  2PUK B;  2EJF A;  3X26 B;  1BIB A;  1EFW A;  1D1B A;  4PK4 A;  2JTF A;  2ESW A;  2NWM A;  5CO7 A;  1R0C B;  4IIO A;  3VQX A;  4C5G A;  1Q81 R;  1M8M A;  1E24 A;  2RM4 A;  3CCL T;  1OU8 A;  1UE9 A;  2RJF A;  5LJ3 f;  2EPD A;  1RL2 A;  1B7Y A;  2DYI A;  1KHC A;  2ZCE A;  5IN1 A;  4BY6 C;  2E3H A;  3V7S A;  3L2V A;  1VQ5 T;  1ASZ A;  3SWN C;  2RO0 A;  4HWR A;  1HYO A;  2VUB A;  1ZX6 A;  2QTX A;  3CQT A;  3MEV A;  2HQE A;  4XU0 A;  1RAH B;  4D8D A;  2HQH A;  4CC2 A;  1TUD A;  2A8E A;  1YFR A;  1B3Q A;  2DBM A;  2ENM A;  1QCF A;  1Q7Y C;  5CKF A;  4PG3 A;  2J05 A;  1RAE B;  3CD6 T;  4Q6G A;  2GFA A;  4WF2 A;  4LNP A;  3ME9 A;  4FT4 A;  4PFO A;  2P0K A;  5CQX A;  1YJN Q;  4V2S A;  5KYW A;  1QKX A;  4TQD A;  2CGH A;  3CCU A;  4DBF A;  2DRM A;  1TSF A;  5KYX B;  1UJY A;  3OS0 A;  1UHF A;  3ULR B;  3RKY A;  1SRL A;  2BE7 D;  2RMO A;  5GAN h;  4GBQ A;  1ZLM A;  1VYU A;  1MMD A;  2P5I A;  2V26 A;  2CP6 A;  1B34 A;  4PL6 A;  1V29 B;  3WQZ A;  3EHR A;  2M0O A;  2C06 A;  5GAN 4;  2WAC A;  3EGX B;  2DL3 A;  4O2D A;  4NL3 A;  5K1P A;  2OI3 A;  2MYS A;  4HCC A;  4AG1 C;  2XDD A;  1FYF A;  2OX7 A;  4TVA B;  3FDR A;  4IUU A;  4JZ4 A;  1VQO T;  3INZ A;  1G3T A;  1D1C A;  2EJG A;  3DKM A;  3C95 A;  3WVE B;  1MHN A;  2M51 A;  4CRI A;  4CC3 A;  1M2V B;  1X43 A;  3MHX A;  5LJ3 d;  3A7R A;  2L3Q A;  1YP5 A;  1SET A;  4F7U G;  4DOW A;  3HHT B;  2E5K A;  4C8Q F;  2ART A;  3OSV A;  1OZ3 A;  1YI2 A;  2JJ9 A;  4PJJ A;  4FW2 A;  3MEW A;  4OGC A;  1VQ8 Q;  4OMQ A;  5GAO r;  2ZT6 A;  3M0R A;  2CUB A;  3CMA Q;  5KYU A;  4LDX A;  2X4J A;  1XQH A;  1UEC A;  2VB6 A;  1QCO A;  9ATC B;  4LDU A;  3CCQ Q;  1X75 C;  3OBY A;  3UPU A;  4HVC A;  1YFN A;  1H4Q A;  3S3M A;  3SFM A;  4JJC A;  1CKB A;  1QVF A;  1TUC A;  3PNW C;  1G2B A;  3G4S Q;  1WJR A;  4OMF B;  3M54 A;  5KE2 A;  4UP7 A;  2KQW A;  1YNZ A;  2ZPI B;  3M4Q A;  4J9C A;  4PFP A;  1G3W A;  6AT1 B;  1ZUY A;  2M1H A;  1I4K 1;  3M0S A;  3G71 A;  2GQV A;  5HCK A;  1KD1 R;  4O5V A;  3HKS A;  1G8X A;  2H8H A;  2KYB A;  2EYY A;  2L8D A;  5KYY B;  1M90 U;  3VU3 C;  1T0J A;  5J39 A;  3CCJ A;  2EKO A;  1YGB A;  4EMK C;  2SEM A;  2LQW A;  1NJI R;  3JCM c;  4P72 C;  1Q82 C;  2ODR C;  1X2H A;  4RQE A;  3OW2 A;  3M9Q A;  2X35 A;  2V8J A;  1Q95 G;  3H0H A;  2M16 A;  4AMC A;  2ALY A;  2DVE A;  1ASY A;  5AT1 B;  4HKE A;  2DXU A;  3OYB A;  2OTL A;  1WLP B;  3PGG A;  1K76 A;  4UP9 A;  4K11 A;  2K9G A;  4M77 A;  2DD4 A;  3NTI A;  4C0F A;  2CYZ B;  4Z8A A;  2A3L A;  2OTJ Q;  3EFO B;  4M77 G;  2L0A A;  1EQR A;  3PVQ A;  3MEA A;  4KH0 B;  2QQB A;  4QVC A;  2ED1 A;  2DE0 X;  1VQL T;  3HRK A;  4FSX A;  3JCM Q;  1TTH B;  5GAM h;  3OYF A;  5LJ5 d;  2BE9 B;  1WZO A;  3JCM W;  2O4X A;  1SRM A;  1QE0 A;  4R55 A;  3M0U A;  1OPL A;  4H2Y A;  3BDU A;  2COZ A;  2NS6 A;  5GMK m;  4J6X A;  5AYF A;  4CS3 A;  2KGT A;  2Q7G A;  1Q7Y U;  1NEG A;  2BKD N;  4WJ3 M;  2WSC E;  2EQJ A;  4X5O A;  1NBE B;  2X3X D;  5GMK h;  3VQY A;  1WHG A;  1FMW A;  5IHK A;  4YRS A;  3A8O B;  1LVK A;  4M75 D;  3CC4 A;  4AG2 C;  4C92 C;  4BAC A;  1QMC A;  3FC3 A;  3I55 Q;  1M1K R;  4PNO A;  1U8R A;  2YLC A;  4LNS A;  1GCQ A;  1QW1 A;  4H2U A;  2JT4 A;  3UT1 A;  3CCU Q;  1WFW A;  4JRP A;  1X2Q A;  4ZTF A;  3G6E Q;  2P0Q A;  4PJO D;  2KRM A;  4OMM A;  4M75 A;  1WXU A;  1YJ9 Q;  2E6N A;  2NUT A;  1M8V A;  1KHI A;  1X69 A;  3MPU B;  1E1T A;  2ECZ A;  5KE3 A;  1FMK A;  2DBK A;  2PTK A;  3CCE A;  1VQM T;  2V1Q A;  3EH1 A;  4M75 G;  3LSS A;  2EYQ A;  1E7O A;  4K88 A;  2LP5 A;  4LD9 K;  1HK9 A;  4TWA A;  3RMQ A;  2F69 A;  3OW2 S;  3JCM f;  4FW1 A;  1H4T A;  1VQP T;  4HWT A;  2HQX A;  4GLK A;  4PJO A;  4BW9 A;  2C7I A;  3V7C A;  4NCX A;  1BI0 A;  2YSQ A;  3CC7 A;  5GAO q;  1BB9 A;  3HTR A;  3ER0 A;  3MKD A;  3V8J A;  1YIT A;  4PJO G;  1QF6 A;  2CP3 A;  2JW4 A;  2K79 A;  2EAY A;  2LZ6 B;  3TSZ A;  2CJ9 A;  2XU8 A;  2QTV A;  4J9E A;  2E5Q A;  1N6A A;  3HFV A;  2V1R A;  3MQZ A;  5I21 A;  3OYA A;  4KT0 E;  4YRM A;  5GJW B;  3JB9 G;  5FRM A;  1UGS B;  3C94 A;  2QYZ A;  4G84 A;  3RKW A;  2D6F A;  2DU5 A;  2L3S A;  2Y90 A;  5J26 A;  5KCH A;  4M7D F;  2LNV A;  2FG0 A;  3MP8 A;  4KR3 A;  1K73 C;  2H3J A;  2BZX A;  3LH5 A;  1W2B A;  2I4O A;  3A8L B;  1TXQ A;  4QQ6 A;  4CC7 A;  4XTX A;  3CC2 A;  3F70 A;  4M78 B;  1EZZ B;  1VQ5 Q;  2J7I A;  4M7A C;  2JMC A;  2E65 A;  2ZIO A;  4TQF A;  4HCZ A;  3I7F A;  1YN8 A;  1AVZ C;  4FSS A;  1BI3 A;  3UDC A;  3VRZ A;  3SHW A;  3CCM A;  2KBT A;  2DD5 A;  2YWW A;  3HPW A;  1D0Y A;  3ASK A;  4E7K A;  3RL6 A;  4H02 A;  1KSW A;  1ZUU A;  2EKH A;  1C0A A;  2EGE A;  4CS4 A;  2E6Z A;  2FHD A;  3S3O A;  3CD6 Q;  1LYL A;  3G71 Q;  3FIF A;  5I2S A;  1Q82 U;  2ZPB B;  2GF7 A;  3ICA A;  1ZUK A;  2O9V A;  1EVK A;  2IG0 A;  2DQ0 A;  1RAD B;  4C92 E;  4DPG A;  3CCJ Q;  4C0G A;  1NPP A;  1ARK A;  2HMA A;  1QQJ A;  3JCM d;  1XTD A;  2E41 A;  1YIJ T;  1LCK A;  4M78 C;  3OYD A;  3RDV A;  1I81 A;  1L0W A;  4LDW A;  5L23 A;  2DM1 A;  3FLG A;  5CKH A;  3JCM e;  2CSI A;  1SPK A;  2AK5 A;  1MMA A;  1G51 A;  1ABQ A;  1I1J A;  2FZK B;  1OI1 A;  3CME A;  4FYX B;  2AHJ B;  3QYH B;  4JRI A;  4MZP A;  2RB6 A;  2X4Y A;  1UGQ B;  4YRT A;  2A37 A;  4XTY A;  1N27 A;  1VQ9 A;  2QDY B;  1VQN Q;  3RAC A;  3A5Z A;  3L1A A;  1BBZ A;  1K9M R;  3OYY A;  2WSE E;  3P8Y A;  2QQS A;  1H3H A;  1KC8 C;  1FX7 A;  2LX9 A;  1T3S A;  2HCK A;  3HFN A;  4RQF A;  4D6W A;  2K2M A;  4M77 F;  1FYN A;  1NJ8 A;  2ZZE A;  3TEG A;  2DZ9 A;  3JB9 I;  1BBU A;  1HD3 A;  1ZA1 B;  5GAO n;  2AKW B;  3P8H A;  2CH4 A;  1SHG A;  5DY9 A;  1Y57 A;  4A4G A;  1Y07 A;  4QQG A;  4C8Q D;  3CCV T;  2CS7 A;  1WI7 A;  5GMK i;  4HT8 A;  1H92 A;  4P74 A;  1WPY A;  4EDU A;  2L89 A;  4PFZ A;  1U1T A;  3W3S A;  3NFC A;  5GAN f;  1G83 A;  2CDT A;  2K5F A;  2YT6 A;  3RES A;  2E1H A;  2YLB A;  4N4I A;  1C0M A;  4OB1 B;  2QDL A;  1W1F A;  3H0F A;  4M7A F;  2RQT A;  2AMC B;  2B8A A;  4RTV A;  1SSF A;  2E12 A;  4KGX B;  3REA B;  1JU5 C;  4KRT A;  1IRE B;  2RQU A;  4RUG A;  4RCC A;  1ZSZ B;  3VS4 A;  3MCA B;  4HVV A;  3QO5 A;  2R5M A;  1NYR A;  8ATC B;  1E1O A;  1E6H A;  2K3X A;  3NET A;  4M75 F;  2ABL A;  3OYE A;  2HAX A;  4JDS A;  4NL2 A;  3QWY A;  2HSE B;  2Q7H A;  2CT4 A;  1RAI B;  2KI7 A;  3SWN A;  3EFR A;  4XTZ A;  3I35 A;  3I55 T;  1K73 U;  1NLP C;  1Q81 C;  4M78 E;  1GFD A;  2HKQ B;  2OAU A;  3A7A A;  1JJ2 P;  3PCO B;  4IUV A;  1ZBJ A;  1X56 A;  4YRO A;  1N9W A;  3CCU T;  2LCL A;  2SRC A;  1VQL Q;  3VS0 A;  3AHU A;  2LCS A;  1KOG A;  3L4G A;  1JXM A;  4B9X A;  1NYG A;  1WIE A;  2LC4 A;  3M0P A;  4PJN A;  2HSP A;  1JB0 E;  3HRS A;  1OZ2 A;  2HNI A;  4YP0 A;  3Q1J A;  2COY A;  3JB9 F;  4C8Q B;  1VQ4 Q;  1JO8 A;  2PVG B;  3CC2 Q;  3VS3 A;  1YBY A;  3FEO A;  1VQK A;  3JCM V;  2GGR A;  3JCM g;  2DF6 A;  5CQY A;  1EIF A;  1Q86 R;  2XG8 D;  1NJ6 A;  2JM9 A;  2DA9 A;  2F5K A;  2J6K A;  3REU A;  5GAN e;  2EYX A;  2RPN A;  2LX7 A;  3M4G A;  1JBM A;  2EYW A;  2RHS A;  1ZHI A;  1PKT A;  2HEQ A;  1IHW A;  3VQV A;  3M57 A;  3R6O A;  4EMG A;  3QG1 A;  2C0T A;  3HRU A;  4YCW A;  2CRE A;  4L59 A;  1YI2 T;  1M5Q 1;  2LCC A;  2V8I A;  4J6Y A;  4B9W A;  4LN2 A;  1AHJ B;  1X6G A;  3A8G B;  4ZGD B;  3VV0 A;  1VQM Q;  1TG0 A;  5GAO l;  1VYT A;  3HFZ B;  2ZGW A;  3KFU A;  2F2V A;  4MZM A;  1ADJ A;  2FPD A;  2JMA A;  1J3T A;  1VQP Q;  2FZC B;  3GNF B;  5GAM f;  3TVT A;  2LVM A;  3CME Q;  4K87 A;  3OYH A;  1KC8 U;  3EGX A;  1YCS B;  4ATO A;  1BKB A;  2R57 A;  1NLO C;  5I2M A;  1EIY B;  1MMN A;  2A7Y A;  2I4M A;  2ZIN A;  4LVM A;  1VQ9 Q;  3RUX A;  1PYS B;  2RF0 A;  1DJ7 B;  3IG2 A;  1M1F A;  2YUQ A;  1JQQ A;  1I07 A;  4LVK A;  3M59 A;  1G3Y A;  1SSH A;  2J06 A;  3G71 T;  1VYV A;  2J3M A;  3N5B B;  3GLX A;  2FPE A;  3M4Y A;  4E7H A;  2RQR A;  4CH3 A;  1KQ1 A;  1MV3 A;  3EG3 A;  2ODR D;  3BFM A;  3CCJ T;  4BWA A;  2CH4 W;  1B7T A;  5FU7 B;  2MPX C;  1F1B B;  1UB4 A;  2XDP A;  2XHC A;  4M7D D;  1VIE A;  3HSB A;  4Q5W A;  3JB9 J;  3VS2 A;  3FJ5 A;  4EMK A;  4BI3 A;  3MJX A;  3QZ5 B;  2OTL T;  1MV0 B;  1G5I A;  2YRD A;  1VQZ A;  4TTV A;  1B7Y B;  2PZ1 A;  2DU7 A;  4PJL A;  4M7D A;  2DRK A;  4EIK A;  2QEX A;  3A1P A;  2JXB A;  2XGT A;  3I56 A;  1VQN T;  1KD1 C;  4M7D G;  2PVO B;  3QO7 A;  2X4W A;  3EG2 A;  2RI3 A;  4OML A;  3VUB A;  3QZ9 B;  2RHQ A;  5I22 A;  2K2V A;  4XQ3 A;  3AT1 B;  4P71 C;  4RMF A;  3KUF A;  1NJI C;  2D0Q B;  3FB9 A;  5FU7 C;  2CUD A;  3M56 A;  4ANJ A;  1YIJ Q;  2IY5 A;  3NGP A;  4DOV A;  1Q81 U;  1AWO A;  2E3I A;  4ZIB A;  3EG0 A;  4KUD K;  5KYW B;  5GAM e;  2DXC A;  2QAZ A;  2OJ2 A;  1WGS A;  3CC4 T;  2KSS A;  2CJA A;  3E9G A;  2KEA A;  2DZC A;  2VGN A;  1OPK A;  3A32 A;  4H2X A;  3SDZ A;  4FL6 A;  5GAN g;  3REX A;  4DBH A;  2J6F A;  2VV5 A;  2YUP A;  3UA7 A;  3EGU A;  1PRM C;  2AZS A;  5GAN 6;  4YRE A;  5HGQ A;  3BDL A;  4H2T A;  4C92 A;  1BCO A;  3A31 A;  2M9U A;  3LC0 A;  3HXX A;  3HTZ A;  1B34 B;  1NJ1 A;  3BJU A;  3C0C A;  3I5R A;  5GMK e;  1UFF A;  1RAC B;  1G5H A;  1H64 1;  4C92 G;  3GP8 A;  3HL8 A;  3QBY A;  1GBQ A;  1B76 A;  5GAN j;  2MAM A;  2AT1 B;  4Y92 A;  4YRN A;  2K5L A;  1W4S A;  4N4H A;  4C5E A;  1PD0 A;  2RK1 A;  3PZC A;  3RBB B;  1S1N A;  5KNN A;  4MMK A;  3S3N A;  4F7U B;  4M77 D;  5GAO p;  3CXC P;  1HJD A;  4CH4 A;  2RJC A;  1TU0 B;  3CCS A;  3I9Q A;  4OB0 B;  3CCV Q;  3CC7 T;  5K1X A;  1YIT T;  2CZ7 B;  2LRQ A;  1WNL A;  1M1K C;  2K5I A;  1K8A R;  2MMP A;  4JJD A;  2X51 A;  3A7U A;  3OYL A;  5D7U A;  2P4T A;  4OMN A;  1LPL A;  3UAT A;  5GAN 2;  2C0I A;  2ROL A;  4JRK A;  3H0I A;  5KYU B;  1M4Z A;  2HBW A;  2JOY A;  2LQ8 A;  5GAN 7;  1N9R A;  1WU7 A;  1K0X A;  5GJV B;  2GQI A;  2QQA A;  1B70 A;  1QP3 A;  4FYW B;  2EGC A;  1IZ6 A;  1GBR A;  5D6W A;  2D0N A;  1KJW A;  4P5N A;  3M58 A;  1YHQ A;  4ZTJ A;  3RGL A;  4M7A D;  2KXD A;  5LJ3 h;  1J5W A;  4ZNX A;  5IHI A;  4Y91 A;  1VQ4 T;  4OVA A;  3OYN A;  3CC2 T;  2QHT A;  3L42 A;  3CXC S;  3PFS A;  4BI8 B;  4LE9 A;  7AT1 B;  3JRZ A;  4P3P A;  2F5T X;  5C52 B;  3CCM T;  2DFU A;  2GTO A;  1LNX A;  1BI2 A;  4M7A A;  2XKO C;  3WVD B;  5KH6 A;  3PMT A;  1TS9 A;  4ZN3 A;  1WYD A;  1I8F A;  2IIM A;  3T9N A;  3RMS A;  4J7F A;  4X9D A;  2DL7 A;  1M9S A;  4M7A G;  4YRL A;  4GY5 A;  1IB8 A;  1RAF B;  4AFZ C;  3OYG A;  4NS5 A;  2D8J A;  5KYN A;  4RTT A;  1S72 A;  4X34 A;  2ALY B;  1VQ7 A;  3OS2 A;  2VWF A;  3HRI A;  2Y4Y A;  2ARU A;  4UP8 A;  1AOJ A;  3KFV A;  1WHL A;  1GL5 A;  4M77 B;  1BCM A;  3GBQ A;  1YCY A;  1OQK A;  4IKF A;  4HWS A;  2L3R A;  4F14 A;  1T0H A;  1MGQ A;  4TVY A;  2BIV A;  4RMO A;  3X20 B;  2DIL A;  5A0G A;  5GAM g;  1YB3 A;  3JB9 D;  1KD1 U;  1SKU B;  4J9D A;  1BK2 A;  4HA8 A;  3CME T;  4CS2 A;  2YUN A;  2GFU A;  2VC8 A;  1EVL A;  3VS5 A;  4DEX A;  2O4X B;  2DL8 A;  2LDM A;  4C5I A;  3THK A;  2QA4 A;  1VQ9 T;  1NJI U;  3CMQ A;  2DEQ A;  4H2W A;  3QO8 A;  5IH2 A;  4UPA A;  4IUR A;  4E7L A;  5GAM j;  1USY C;  1IO6 A;  1QCN A;  2KK4 A;  2RD1 A;  1YWO A;  3JB9 H;  4ZTU B;  3A98 A;  4HT9 A;  4H2S A;  2RK2 A;  2ROT A;  3FRN A;  1YI2 Q;  1SRY A;  4WCI A;  3OYJ A;  2D8H A;  3QNE A;  3P8D A;  1D09 B;  2DJQ A;  3P8B B;  3QJ6 A;  5GMK j;  1YJW A;  3TEH A;  2YUO A;  3CBP A;  5LJ5 h;  4FM4 B;  3QYG B;  2CP0 A;  1OYX A;  1JJC A;  3MP1 A;  3TSW A;  4R56 A;  4M75 B;  1IGQ A;  2DNU A;  4YRF A;  4XU3 A;  2NUT B;  2E3C A;  2ZNI A;  2K3Y A;  2I4N A;  2JTM A;  3NTH A;  3VQW A;  3NEM A;  2EYZ A;  5IT9 E;  4F7U E;  1RLQ C;  1AWW A;  3C4S A;  3TUP A;  1K9M C;  2I2L A;  3L2R A;  4OGE A;  4LVL A;  1UDL A;  5I11 A;  4DBQ A;  2YHT A;  4PJO B;  2QG9 B;  3HRT A;  1BIA A;  3EGD A;  1QWE A;  2DK3 A;  3JCM X;  3M4P A;  3E9F A;  1UGP B;  1M1K U;  2RHI A;  2O2O A;  3HXY A;  4P3N A;  1RAB B;  4C92 F;  4JZ3 A;  1GCQ C;  1UGV A;  1D0X A;  2ZZF A;  3MET A;  3CCS Q;  1VQ6 A;  4AFQ C;  4A53 A;  2JN0 A;  1R0B G;  4N0A A;  1QKW A;  1NZ9 A;  1M30 A;  3GF5 A;  3IKL A;  3EH2 A;  5GMK l;  2F1L A;  3IQL A;  4E47 A;  1OUL A;  2ZIM A;  3HXU A;  2OTL Q;  1UEB A;  4CI0 C;  4IIM A;  3L2Z A;  4ELY C;  4WJ4 A;  3P8V A;  1R77 A;  4M4Z A;  4II1 A;  3MO8 A;  2ZT8 A;  4RTZ A;  1C6V X;  1W6X A;  1WHK A;  3CEY A;  4F04 B;  4J9I A;  1KQS P;  2RH2 A;  2VKN A;  1TWB A;  2DXB A;  1QVG P;  1KMM A;  2FEI A;  2MWO A;  2DQ3 A;  2JUF A;  1OEB A;  2HBP A;  1WDX A;  2MI6 A;  2PME A;  4FYY B;  3ZEH A;  2AMC A;  3QTC A;  2XIC A;  4XTV A;  3G7Z A;  3UF4 A;  3EG9 A;  1GGM A;  1I0C A;  3PMI A;  2ZT7 A;  3OYM A;  1JRI A;  2FL7 A;  2BZ8 A;  1VQK T;  5ELN A;  2ZAE A;  4WTO B;  5A0L A;  1N8R R;  2ZPG B;  4AH6 A;  1AT1 B;  2J6O A;  1K4U S;  2KR3 A;  1YFT A;  2PU9 B;  2M0Y A;  2R58 A;  3R6N A;  3O8V A;  2F2W A;  2XI9 A;  5A0D A;  1M2O A;  3LH0 A;  3CC4 Q;  2ZT5 A;  2PNI A;  4M77 E;  3SD4 A;  1YJN A;  2VXF A;  1D0Z A;  5FWB A;  2GCX A;  3CPW P;  4KQE A;  2RQV A;  2JZ2 A;  1JXO A;  1D3B A;  2KE9 A;  1KQS S;  1S72 Q;  4P3O A;  1QVG S;  1BBW A;  1VQ7 Q;  1Y96 B;  3HFO A;  3PCO A;  2FO0 A;  2VGM A;  3S6W A;  1VOM A;  3JV3 A;  1M1G A;  2CJB A;  1G5V A;  4HWP A;  1JJ2 A;  4JS5 A;  1LOJ A;  4J83 A;  4XEM A;  3CCE Q;  4JRQ A;  4RTU A;  2A0F B;  2XK0 A;  2DO3 A;  2C0O A;  3HP9 A;  4JJB A;  1WX6 A;  1Q86 C;  2DER A;  3A5Z B;  3M0T A;  1H8K A;  2QQR A;  2Q5H A;  1PC0 A;  4ZGE B;  1IHV A;  1W70 A;  3CC7 Q;  2RA2 A;  1YIT Q;  4C0D B;  3UWN A;  1K0S A;  4JPB W;  3VS7 A;  3CBM A;  1Y71 A;  1ACM B;  3REB B;  3CCR A;  2O88 A;  3MEU A;  1E6G A;  1IL2 A;  5F5W A;  1WJS A;  3RNJ A;  1BI1 A;  1X6B A;  3PE0 A;  4CH5 A;  3QHS A;  4M78 F;  3J7A F;  1OOT A;  1VQ8 A;  4M75 E;  1RI9 A;  3IKM B;  3CMA A;  4RDX A;  2KXC A;  4RCB A;  4JS4 A;  2LJ1 A;  5IXB A;  4E51 A;  2FB7 A;  1ZSZ C;  4OB3 B;  4EX5 A;  3D7S B;  3QII A;  4YDQ A;  4LDY A;  1O9S A;  2YRC A;  2R5A A;  3NMZ C;  3CCQ A;  4YPF A;  4OP0 A;  4PKC C;  4PJO E;  2ATC B;  3A5Y A;  1K9M U;  4HWO A;  1CKA A;  5CK9 A;  1B8A A;  2DXT A;  3A8H B;  3G4S A;  1SF9 A;  1IGU A;  2EQI A;  3KBG A;  2PVD B;  1NEB A;  5GAN d;  2RN8 A;  3CCM Q;  2K57 A;  4J6W A;  2RHX A;  2HKN A;  2NUP B;  4RKU E;  3VJP A;  1WHM A;  2QEX T;  1EIY A;  4KGV B;  3I56 T;  1HXD A;  2CP2 A;  2ED0 A;  4YTL A;  1OX8 A;  5IAY A;  3GIB A;  1PYS A;  4OB2 B;  1RAG B;  3ZBD A;  4BY6 B;  3MF2 A;  1JJ2 S;  2ZXF A;  1AWX A;  3FJP A;  4DA4 A;  2DKG A;  5FU6 B;  3QDR B;  2K3B A;  4A4H A;  3PTA A;  3OBW A;  3SWN B;  1VA7 A;  2I4L A;  1Z7N A;  2QHU A;  4C8Q C;  2QHV A;  5ELO A;  5KYX A;  3EAE A;  3V8L A;  1HTT A;  4DEY A;  2FRY A;  1AWJ A;  4JJN K;  3LSQ A;  3VUZ A;  2KRN A;  4P71 A;  2HL3 A;  3V8K A;  2O9S A;  2IPO B;  3OD1 A;  4ZGJ B;  4YRP A;  2OTJ A;  1YFS A;  2JVV A;  4ZN1 A;  3L4G B;  4AFU C;  4XEO A;  5KCO A;  2LT4 A;  2E64 A;  5GAN 8;  2JNG A;  1ZA2 B;  2FVU A;  2ZZD A;  2CZ0 B;  1X01 A;  1YWP A;  4TVA A;  5CAI A;  2D1X A;  1KMN A;  4TVW A;  5FU6 C;  3ZFJ A;  4QW2 A;  1PWT A;  3X24 B;  1M2V A;  1I5O B;  5FRO A;  4HCK A;  1X55 A;  1NJ5 A;  4KUI A;  11AS A;  1M27 C;  4YCU A;  2KT8 A;  5CKE A;  4BI4 A;  2KT1 A;  1T3L A;  5CIU A;  4LXC A;  2ARS A;  2OAW A;  4BB7 A;  2G6F X;  3BE3 A;  4LDV A;  2RHZ A;  4FYV B;  4Z02 A;  2XD0 A;  3CCS T;  4E7Z A;  1WYX A;  2RHS B;  3I55 A;  4JLI A;  1M90 R;  1WJQ A;  2X4X A;  4YRQ A;  1EX4 A;  4P75 C;  1OU9 A;  4RTY A;  4KR2 A;  2DVJ A;  4Y28 E;  1SHF A;  4Z88 A;  3VYG A;  4BDZ A;  4YRJ A;  1QWF A;  2DTI A;  3LWH A;  3JCM P;  4EMH A;  4P72 A;  4FCY A;  3X28 B;  3G6E A;  1BU1 A;  2AZV A;  2LT1 A;  4L5G A;  1PCX A;  1YJ9 A;  4P73 C;  2EBP A;  1PRL C;  3NTK A;  4KH1 B;  1Z9Z A;  4YRG A;  1PHT A;  2Q7E A;  1PSE A;  1QVP A;  2P4R A;  1Q86 U;  2CZ1 B;  2X9H A;  5ECA A;  2EVR A;  2HD0 A;  2DL5 A;  4VUB A;  2LJ3 A;  4OLF A;  2GTJ A;  4X9C A;  2E70 A;  4KUL A;  1YHQ T;  12AS A;  2RNA A;  3VS1 A;  1QLY A;  4YCV A;  5HK0 A;  4WI1 A;  2O01 E;  2FYK A;  5KYY A;  2VXE A;  2O31 A;  3QKJ A;  3JCM b;  5GAM d;  5LL6 S;  2GNC A;  1UUE A;  4F7U A;  3GOX A;  1K8A C;  4C92 D;  1WXB A;  2HZY A;  3CXC A;  3OB9 A;  2F2X A;  1H3Z A;  3VKI A;  2PUO B;  1Q7Y R;  3CCR Q;  3EFS A;  1WQ7 A;  4RTW A;  2EQU A;  2L5Q A;  1TH7 A;  4C8Q E;  1TOV A;  4CC4 B;  5LJ3 e;  3QJY A;  2A08 A;  3NEL A;  2QQ9 A;  2A36 A;  3CCL A;  5LJ5 f;  2MOX A;  2GBQ A;  2RJE A;  2YXY A;  2G4C A;  1WA7 A;  4QKU A;  1ZSG A;  1S72 T;  2CIM A;  2NLU A;  2ZTG A;  4EMK B;  5FWC A;  1VQ7 T;  3EFO A;  1SES A;  1N5Z A;  3TEE A;  1SG5 A;  3QWX X;  3U23 A;  4BUG A;  1ZQ1 A;  4ORZ A;  3J81 E;  1VQ5 A;  1H4S A;  3MEY A;  3P8T A;  2L3P A;  3CCE T;  2XTI A;  4LUE A;  1RLP C;  3NHN A;  4N4G A;  1VQK Q;  4XTW A;  4M7D B;  4J9F A;  5CKB A;  1NG2 A;  4HT4 A;  2CKK A;  2M02 A;  2LMJ A;  1M3B A;  1G3S A;  5A2Q E;  4YRR A;  3WXM B;  3LW5 E;  3LGL A;  3OS5 A;  3H6Z A;  4ZTZ B;  2VVK A;  2ZCF B;  1ATI A;  4MDW A;  3CD6 A;  2RHQ B;  4A63 B;  3LLR A;  2QA4 T;  4J7I A;  4LUD A;  5EG2 A;  2DDZ A;  2RJD A;  3IAL A;  3OMG A;  2QGG A;  3TQ7 P;  2IY5 B;  4IUP A;  1V76 A;  2HDA A;  4CH6 A;  3DLL A;  3I5S A;  4X1V A;  1WLE A;  4C5H A;  5IXF A;  2W0Z A;  2BUD A;  4MZT A;  2DTO A;  4J9G A;  4Z89 A;  4B6M A;  1USY A;  4MDX A;  3E19 A;  2Q5I A;  2JS2 A;  4XAX B;  2RI2 A;  5CCA A;  1PSF A;  4H2X B;  2K6D A;  2QXF A;  3LGF A;  1AD5 A;  2MF2 A;  3VRY A;  4BE1 A;  4QT7 A;  4M7D C;  1QVF P;  3OQ5 A;  1YJW T;  1WHJ A;  4L87 A;  4C92 B;  2DLP A;  4R0K A;  5DLQ E;  1VQO A;  1BYM A;  4G85 A;  1GFC A;  3O5Z A;  2WSF E;  3SEM A;  4L6V 5;  4H2V A;  1VQN A;  1EFN A;  4YRC A;  4HXJ A;  4BE2 A;  4UC4 A;  3UGQ A;  1RAA B;  4RG2 A;  2ZPE B;  3TU4 K;  3HXW A;  4YRK A;  2DAQ A;  1ZBX A;  1KQ2 A;  4JLG A;  2QI2 A;  3SB2 A;  1ADY A;  3KXT A;  3RF1 A;  1IRX A;  3PIP A; 
#chains in the Genus database with same CATH homology
 3H8Z A;  5LJ5 e;  2P0P A;  2K4Y A;  1H4V B;  2EFI A;  4QVD A;  2ZPF B;  1NYQ A;  1NNH A;  1WQW A;  1Z7M A;  4LVJ A;  4A54 A;  1XNI A;  4M78 D;  3PT9 A;  4XU1 A;  2E5A A;  1VQ6 T;  1QVF S;  2EQM A;  1P92 A;  2DJZ A;  4A4K A;  2C8M A;  3V7R A;  1RI0 A;  2PMF A;  2EWN A;  3BW1 A;  2DIQ A;  1FXX A;  2ZR2 A;  1B70 B;  5L8R E;  3OYK A;  3MF1 A;  4M78 A;  2E10 A;  2ZR3 A;  1LJO A;  5J3B A;  5LJ3 g;  4ME7 A;  4M78 G;  4OF1 A;  4NOY A;  2XDB A;  1QP2 A;  4FU6 A;  5C0M A;  1SER A;  3L2Q A;  1K8A U;  3RIR A;  3QSU A;  2KMT A;  5LJ3 j;  4M7A B;  3E9H A;  1U1S A;  3E1S A;  4M77 C;  5FLX E;  2EL9 A;  1E22 A;  3OS1 A;  2KDS A;  4YYE A;  2EQK A;  2PQW A;  2XID A;  3BY7 A;  1KG1 A;  1RIQ A;  3A74 A;  3LWI A;  4BD3 A;  3QPH A;  1O75 A;  3HXV A;  1YJN T;  3CBO A;  3DSQ A;  3GPL A;  2D9T A;  4M7D E;  4MML A;  1VQL A;  1Y7X A;  2EIF A;  2G3R A;  4F7U F;  5DLO A;  5C51 B;  3QO3 A;  3M5A A;  4J15 A;  3UGT A;  3NEN A;  1VQ4 A;  5CKD A;  4PLI A;  3DB3 A;  4E7I A;  1KQS A;  4EPC A;  3E9I A;  1QVG A;  4A4E A;  4A4F A;  4FIB A;  5E3I A;  1N8R C;  5FRN A;  2ZPH B;  2KY9 A;  3PIO A;  3JCM J;  2MWP A;  1EOV A;  2AKW A;  3TCJ A;  2RHY A;  5HK3 A;  3A8M B;  4M75 C;  4E7J A;  4O6J A;  4ELZ C;  3X25 B;  3CCR T;  4HCB A;  4IUQ A;  4PLL A;  1X6O A;  4Q15 A;  2ZZG A;  1R8O B;  5LJ5 g;  3TEH B;  5CVI A;  3TRE A;  1VQ8 T;  3M55 A;  4PJO C;  3CMA T;  3VYH B;  1VQM A;  3CPW A;  3LYI A;  3HXZ A;  1JJC B;  4BDY A;  3JAM E;  1Y96 A;  1GXI E;  1N9S A;  3L2U A;  1VQP A;  5HY6 A;  5D6X A;  3CCQ T;  3UH0 A;  5LJ5 j;  3VBB A;  4RG8 A;  4PHC A;  3G4S T;  1W66 A;  2DTH A;  3QXE B;  4EO4 A;  1NPR A;  5GAO m;  3OYI A;  2DPP B;  1W2B S;  5C6S A;  3QUI A;  2EJ9 A;  2QHS A;  3DB4 A;  2V8K A;  2J3L A;  2RHU A;  4BE0 A;  4LD6 A;  2DIG A;  2P0L A;  4QQD A;  3JSC A;  3M53 A;  4LVI A;  4K86 A;  4TVR A;  4J5Y A;  5GAN 3;  4C8Q A;  4C0Z A;  2OTJ T;  2VYT A;  3CPF A;  4M7A E;  4C8Q G;  3UFG A;  1NE8 A;  3JCM h;  2IVW A;  2Y4X A;  4KBM B;  2YRV A;  4N0A C;  3OA6 A;  3CPW S;  3URG A;  3OY9 A;  2RI5 A;  3HY0 A;  4YRI A;  1YIJ A;  2ZNJ A;  4XU2 A;  3G1Z A;  4XK8 E;  3OSS C;  5HKC A;  1UGR B;  5C53 B;  3DLM A;  1D3B B;  1X54 A;  3RKX A;  4PJO F;  3OYC A;  3LX7 A;  2LTO A;  3HFZ A;  4JUV A;  4C0D C;  2CZ6 B;  4FT2 A;  4IUT A;  3RER A;  3L2W A;  3G6E T;  3J80 E;  4P75 A;  5CR2 A;  1YJ9 T;  1FWZ A;  1I5L A;  5D6Y A;  3R07 A;  1N8R U;  5DM7 R;  1NJ2 A;  3GNG A;  1HC7 A;  2KAF A;  1X2G A;  5GAN 5;  4P73 A;  1VUB A;  3ERR A;  4P74 C;  4DQ2 A;  3OMC A;  1VIF A;  2LQK A;  3MP6 A;  3CCV A;  4J8O A;  1XOV A;  4QVZ A;  2KVQ G;  5M9O A;  3C12 A;  4XTU A;  1M90 C;  3HY1 A;  2PUK B;  2EJF A;  3X26 B;  1BIB A;  1EFW A;  2JTF A;  5CO7 A;  3VQX A;  4C5G A;  1E24 A;  2RM4 A;  3CCL T;  2RJF A;  5LJ3 f;  1RL2 A;  1B7Y A;  1KHC A;  2ZCE A;  5IN1 A;  4BY6 C;  3V7S A;  3L2V A;  1VQ5 T;  1ASZ A;  3SWN C;  2RO0 A;  4HWR A;  2VUB A;  2QTX A;  3MEV A;  2HQE A;  4XU0 A;  2A8E A;  1YFR A;  1Q7Y C;  5CKF A;  4PG3 A;  3CD6 T;  4Q6G A;  2GFA A;  4WF2 A;  3ME9 A;  4FT4 A;  5CQX A;  2P0K A;  4V2S A;  4TQD A;  2CGH A;  3CCU A;  3OS0 A;  3RKY A;  5GAN h;  2P5I A;  1B34 A;  4PL6 A;  1V29 B;  3WQZ A;  2M0O A;  2C06 A;  5GAN 4;  2WAC A;  4O2D A;  4NL3 A;  5K1P A;  4HCC A;  2XDD A;  1FYF A;  4TVA B;  3FDR A;  4IUU A;  1VQO T;  3INZ A;  1G3T A;  2EJG A;  3DKM A;  3C95 A;  3WVE B;  1MHN A;  4CRI A;  3MHX A;  5LJ3 d;  3A7R A;  1SET A;  4F7U G;  4DOW A;  3HHT B;  4C8Q F;  2ART A;  3OSV A;  1OZ3 A;  1YI2 A;  3MEW A;  4OGC A;  5GAO r;  2ZT6 A;  4LDX A;  2X4J A;  1XQH A;  4LDU A;  1X75 C;  3OBY A;  3UPU A;  4HVC A;  1H4Q A;  3S3M A;  3SFM A;  1QVF A;  3PNW C;  1WJR A;  4OMF B;  3M54 A;  5KE2 A;  4UP7 A;  2KQW A;  2ZPI B;  3M4Q A;  1G3W A;  2M1H A;  1I4K 1;  3G71 A;  2GQV A;  4O5V A;  3HKS A;  2L8D A;  1M90 U;  3VU3 C;  5J39 A;  3CCJ A;  2EKO A;  1YGB A;  4EMK C;  3JCM c;  4P72 C;  1Q82 C;  2ODR C;  1X2H A;  4RQE A;  3OW2 A;  3M9Q A;  2X35 A;  2V8J A;  2M16 A;  2ALY A;  2DVE A;  1ASY A;  4HKE A;  2DXU A;  3OYB A;  2OTL A;  3PGG A;  4UP9 A;  4M77 A;  2DD4 A;  3NTI A;  4C0F A;  2CYZ B;  2A3L A;  4M77 G;  1EQR A;  3MEA A;  4QVC A;  2QQB A;  1VQL T;  3HRK A;  4FSX A;  3JCM Q;  5GAM h;  3OYF A;  5LJ5 d;  3JCM W;  2O4X A;  1QE0 A;  4R55 A;  4H2Y A;  3BDU A;  2NS6 A;  5GMK m;  4J6X A;  5AYF A;  4CS3 A;  2Q7G A;  1Q7Y U;  2BKD N;  4WJ3 M;  2WSC E;  2EQJ A;  4X5O A;  5GMK h;  3VQY A;  4YRS A;  3A8O B;  4M75 D;  3CC4 A;  4C92 C;  4BAC A;  3FC3 A;  4PNO A;  1U8R A;  2YLC A;  4LNS A;  1QW1 A;  4H2U A;  3UT1 A;  4JRP A;  4ZTF A;  2P0Q A;  4PJO D;  4M75 A;  2E6N A;  1M8V A;  1KHI A;  1E1T A;  5KE3 A;  3CCE A;  1VQM T;  4M75 G;  3LSS A;  2EYQ A;  4K88 A;  4LD9 K;  1HK9 A;  4TWA A;  3RMQ A;  2F69 A;  3OW2 S;  3JCM f;  1H4T A;  1VQP T;  4HWT A;  2HQX A;  4GLK A;  4PJO A;  4BW9 A;  2C7I A;  3V7C A;  4NCX A;  1BI0 A;  3CC7 A;  5GAO q;  1YIT A;  3ER0 A;  3V8J A;  4PJO G;  1QF6 A;  2EAY A;  2CJ9 A;  2XU8 A;  2E5Q A;  1N6A A;  3HFV A;  3MQZ A;  5I21 A;  3OYA A;  4KT0 E;  4YRM A;  3JB9 G;  5FRM A;  1UGS B;  3C94 A;  4G84 A;  3RKW A;  2D6F A;  2DU5 A;  5J26 A;  2Y90 A;  5KCH A;  4M7D F;  2LNV A;  3MP8 A;  4KR3 A;  1K73 C;  2H3J A;  1W2B A;  2I4O A;  3A8L B;  4QQ6 A;  4XTX A;  3CC2 A;  3F70 A;  4M78 B;  4M7A C;  2E65 A;  2ZIO A;  4TQF A;  4HCZ A;  3I7F A;  1BI3 A;  3UDC A;  3CCM A;  2DD5 A;  3HPW A;  3ASK A;  4E7K A;  3RL6 A;  4H02 A;  1C0A A;  4CS4 A;  1LYL A;  2E6Z A;  2FHD A;  3S3O A;  3FIF A;  5I2S A;  1Q82 U;  2ZPB B;  2GF7 A;  3ICA A;  1EVK A;  2IG0 A;  2DQ0 A;  4C92 E;  4DPG A;  4C0G A;  1NPP A;  3JCM d;  1XTD A;  2E41 A;  1YIJ T;  4M78 C;  3OYD A;  1I81 A;  1L0W A;  4LDW A;  3FLG A;  5CKH A;  3JCM e;  1G51 A;  1OI1 A;  3CME A;  2AHJ B;  3QYH B;  4JRI A;  4MZP A;  2RB6 A;  2X4Y A;  1UGQ B;  4YRT A;  4XTY A;  1N27 A;  1VQ9 A;  2QDY B;  3RAC A;  3A5Z A;  3L1A A;  3OYY A;  2WSE E;  3P8Y A;  2QQS A;  1KC8 C;  1FX7 A;  2LX9 A;  3HFN A;  4RQF A;  4D6W A;  4M77 F;  1NJ8 A;  2ZZE A;  3TEG A;  2DZ9 A;  3JB9 I;  1BBU A;  5GAO n;  2AKW B;  3P8H A;  5DY9 A;  4A4G A;  1Y07 A;  4QQG A;  4C8Q D;  3CCV T;  2CS7 A;  5GMK i;  4HT8 A;  4P74 A;  1WPY A;  4EDU A;  2L89 A;  1U1T A;  3W3S A;  3NFC A;  5GAN f;  2K5F A;  3RES A;  2E1H A;  2YLB A;  4N4I A;  4OB1 B;  4M7A F;  2AMC B;  2B8A A;  1SSF A;  2E12 A;  1IRE B;  4RCC A;  3MCA B;  3QO5 A;  2R5M A;  1NYR A;  1E1O A;  2K3X A;  3NET A;  4M75 F;  3OYE A;  2HAX A;  4JDS A;  4NL2 A;  2Q7H A;  3SWN A;  3EFR A;  4XTZ A;  3I55 T;  1K73 U;  1Q81 C;  4M78 E;  2OAU A;  3A7A A;  3PCO B;  4IUV A;  1X56 A;  4YRO A;  1N9W A;  3CCU T;  2LCL A;  3AHU A;  1KOG A;  3L4G A;  4B9X A;  2LC4 A;  1JB0 E;  3HRS A;  1OZ2 A;  2HNI A;  4YP0 A;  3Q1J A;  3JB9 F;  4C8Q B;  2PVG B;  1YBY A;  3FEO A;  1VQK A;  3JCM V;  3JCM g;  5CQY A;  1EIF A;  2XG8 D;  1NJ6 A;  2F5K A;  3REU A;  5GAN e;  3M4G A;  1JBM A;  2RHS A;  1ZHI A;  3VQV A;  3M57 A;  3R6O A;  4EMG A;  3QG1 A;  3HRU A;  4YCW A;  4L59 A;  1YI2 T;  1M5Q 1;  2LCC A;  2V8I A;  4J6Y A;  4B9W A;  1AHJ B;  3A8G B;  4ZGD B;  3VV0 A;  5GAO l;  3HFZ B;  2ZGW A;  3KFU A;  4MZM A;  1ADJ A;  5GAM f;  3GNF B;  2LVM A;  4K87 A;  3OYH A;  1KC8 U;  4ATO A;  1BKB A;  2R57 A;  5I2M A;  1EIY B;  2I4M A;  2A7Y A;  2ZIN A;  4LVM A;  3RUX A;  1PYS B;  1DJ7 B;  3IG2 A;  1M1F A;  4LVK A;  3M59 A;  1G3Y A;  3G71 T;  2J3M A;  3N5B B;  3GLX A;  3M4Y A;  4E7H A;  4CH3 A;  1KQ1 A;  2ODR D;  3BFM A;  3CCJ T;  4BWA A;  5FU7 B;  1UB4 A;  2XDP A;  2XHC A;  4M7D D;  1VIE A;  3HSB A;  4Q5W A;  3JB9 J;  4EMK A;  4BI3 A;  3QZ5 B;  2OTL T;  1G5I A;  1VQZ A;  4TTV A;  1B7Y B;  2DU7 A;  4M7D A;  2QEX A;  2XGT A;  3I56 A;  1VQN T;  1KD1 C;  4M7D G;  2PVO B;  3QO7 A;  2X4W A;  2RI3 A;  3VUB A;  3QZ9 B;  2RHQ A;  2K2V A;  4XQ3 A;  4P71 C;  4RMF A;  3KUF A;  1NJI C;  2D0Q B;  3FB9 A;  5FU7 C;  3M56 A;  2IY5 A;  4DOV A;  1Q81 U;  4ZIB A;  4KUD K;  5GAM e;  2DXC A;  1WGS A;  3CC4 T;  2KSS A;  2CJA A;  3E9G A;  2DZC A;  2VGN A;  3A32 A;  4H2X A;  3SDZ A;  4FL6 A;  5GAN g;  3REX A;  2VV5 A;  5GAN 6;  4YRE A;  5HGQ A;  3BDL A;  4H2T A;  4C92 A;  3A31 A;  2M9U A;  3LC0 A;  3HXX A;  3HTZ A;  1B34 B;  1NJ1 A;  3BJU A;  5GMK e;  1G5H A;  1H64 1;  4C92 G;  3GP8 A;  3HL8 A;  3QBY A;  1B76 A;  5GAN j;  2MAM A;  4YRN A;  2K5L A;  1W4S A;  4N4H A;  4C5E A;  2RK1 A;  3PZC A;  5KNN A;  4MMK A;  3S3N A;  4F7U B;  4M77 D;  5GAO p;  4CH4 A;  2RJC A;  3CCS A;  4OB0 B;  3CC7 T;  5K1X A;  1YIT T;  2CZ7 B;  2LRQ A;  1WNL A;  1M1K C;  2K5I A;  2MMP A;  3A7U A;  3OYL A;  2P4T A;  5GAN 2;  4JRK A;  1M4Z A;  2JOY A;  5GAN 7;  2LQ8 A;  1N9R A;  1WU7 A;  2QQA A;  1B70 A;  1QP3 A;  1IZ6 A;  5D6W A;  4P5N A;  3M58 A;  1YHQ A;  4ZTJ A;  3RGL A;  4M7A D;  5LJ3 h;  1J5W A;  4Y91 A;  1VQ4 T;  4OVA A;  3OYN A;  3CC2 T;  2QHT A;  3L42 A;  3CXC S;  3PFS A;  4BI8 B;  3JRZ A;  4P3P A;  2F5T X;  5C52 B;  3CCM T;  1LNX A;  1BI2 A;  4M7A A;  2XKO C;  3WVD B;  5KH6 A;  3PMT A;  4ZN3 A;  1WYD A;  1I8F A;  3T9N A;  3RMS A;  4J7F A;  4X9D A;  1M9S A;  4M7A G;  4YRL A;  4GY5 A;  3OYG A;  4NS5 A;  1S72 A;  4X34 A;  2ALY B;  1VQ7 A;  3OS2 A;  3HRI A;  2Y4Y A;  2ARU A;  4UP8 A;  4M77 B;  1YCY A;  4IKF A;  4HWS A;  2L3R A;  1MGQ A;  4TVY A;  2BIV A;  4RMO A;  3X20 B;  5A0G A;  5GAM g;  1YB3 A;  3JB9 D;  1KD1 U;  4HA8 A;  3CME T;  4CS2 A;  2GFU A;  2VC8 A;  1EVL A;  2O4X B;  2LDM A;  4C5I A;  2QA4 A;  1VQ9 T;  1NJI U;  3CMQ A;  2DEQ A;  4H2W A;  3QO8 A;  4UPA A;  4IUR A;  4E7L A;  5GAM j;  1USY C;  2KK4 A;  2RD1 A;  3JB9 H;  4ZTU B;  4HT9 A;  4H2S A;  2RK2 A;  3FRN A;  1SRY A;  3OYJ A;  3QNE A;  3P8D A;  3P8B B;  3QJ6 A;  5GMK j;  1YJW A;  3TEH A;  3CBP A;  5LJ5 h;  4FM4 B;  3QYG B;  1OYX A;  1JJC A;  3MP1 A;  4R56 A;  4M75 B;  4YRF A;  4XU3 A;  2E3C A;  2ZNI A;  2K3Y A;  2I4N A;  2JTM A;  3NTH A;  3VQW A;  3NEM A;  5IT9 E;  4F7U E;  3C4S A;  3TUP A;  1K9M C;  2I2L A;  3L2R A;  4OGE A;  4LVL A;  2YHT A;  4PJO B;  3HRT A;  1BIA A;  2DK3 A;  3JCM X;  3M4P A;  3E9F A;  1UGP B;  1M1K U;  2RHI A;  3HXY A;  4P3N A;  4C92 F;  2ZZF A;  3MET A;  1VQ6 A;  4A53 A;  2JN0 A;  4N0A A;  1NZ9 A;  3GF5 A;  3IKL A;  5GMK l;  4E47 A;  2ZIM A;  3HXU A;  1UEB A;  4CI0 C;  3L2Z A;  4ELY C;  4WJ4 A;  3P8V A;  4II1 A;  3MO8 A;  2ZT8 A;  3CEY A;  2RH2 A;  2DXB A;  1KMM A;  2MWO A;  2DQ3 A;  2JUF A;  2HBP A;  2MI6 A;  2PME A;  3ZEH A;  2AMC A;  3QTC A;  2XIC A;  4XTV A;  3G7Z A;  1GGM A;  3PMI A;  2ZT7 A;  3OYM A;  1JRI A;  2FL7 A;  1VQK T;  5ELN A;  5A0L A;  2ZPG B;  4AH6 A;  1YFT A;  2PU9 B;  2R58 A;  3O8V A;  5A0D A;  2XI9 A;  3LH0 A;  2ZT5 A;  4M77 E;  3SD4 A;  1YJN A;  2VXF A;  2GCX A;  4KQE A;  2JZ2 A;  1D3B A;  1KQS S;  4P3O A;  1QVG S;  1BBW A;  1Y96 B;  3HFO A;  3PCO A;  3S6W A;  2VGM A;  2CJB A;  1M1G A;  4HWP A;  1G5V A;  1JJ2 A;  4JS5 A;  1LOJ A;  4J83 A;  4XEM A;  4JRQ A;  2XK0 A;  2DO3 A;  3HP9 A;  1Q86 C;  3A5Z B;  2QQR A;  2Q5H A;  4ZGE B;  2RA2 A;  4C0D B;  3UWN A;  3CBM A;  1Y71 A;  3CCR A;  3MEU A;  1IL2 A;  5F5W A;  1WJS A;  1BI1 A;  4CH5 A;  3QHS A;  4M78 F;  3J7A F;  1VQ8 A;  4M75 E;  3IKM B;  3CMA A;  4RDX A;  4RCB A;  4JS4 A;  4E51 A;  2FB7 A;  4OB3 B;  4EX5 A;  3QII A;  4YDQ A;  4LDY A;  1O9S A;  2R5A A;  3CCQ A;  4YPF A;  4OP0 A;  4PKC C;  4PJO E;  3A5Y A;  1K9M U;  4HWO A;  5CK9 A;  1B8A A;  2DXT A;  3A8H B;  3G4S A;  3KBG A;  2PVD B;  5GAN d;  2K57 A;  4J6W A;  2RHX A;  4RKU E;  3VJP A;  1EIY A;  2QEX T;  3I56 T;  1HXD A;  4YTL A;  5IAY A;  3GIB A;  1PYS A;  4OB2 B;  3ZBD A;  4BY6 B;  3MF2 A;  1JJ2 S;  2ZXF A;  3FJP A;  4DA4 A;  2DKG A;  5FU6 B;  3QDR B;  4A4H A;  3PTA A;  3OBW A;  3SWN B;  2I4L A;  1Z7N A;  2QHU A;  4C8Q C;  2QHV A;  5ELO A;  3EAE A;  3V8L A;  1HTT A;  4JJN K;  3LSQ A;  3VUZ A;  4P71 A;  3V8K A;  3OD1 A;  4ZGJ B;  4YRP A;  2OTJ A;  1YFS A;  2JVV A;  4ZN1 A;  3L4G B;  4XEO A;  5KCO A;  2LT4 A;  2E64 A;  5GAN 8;  2JNG A;  2FVU A;  2ZZD A;  2CZ0 B;  1X01 A;  4TVA A;  5CAI A;  1KMN A;  4TVW A;  5FU6 C;  3ZFJ A;  4QW2 A;  3X24 B;  5FRO A;  1X55 A;  1NJ5 A;  4KUI A;  11AS A;  4YCU A;  5CKE A;  4BI4 A;  5CIU A;  2ARS A;  4BB7 A;  4LDV A;  2RHZ A;  4Z02 A;  2XD0 A;  3CCS T;  2RHS B;  3I55 A;  4JLI A;  1WJQ A;  2X4X A;  4YRQ A;  4P75 C;  4KR2 A;  4Y28 E;  3VYG A;  4BDZ A;  4YRJ A;  2DTI A;  3LWH A;  3JCM P;  4EMH A;  4P72 A;  3X28 B;  3G6E A;  2LT1 A;  4L5G A;  1YJ9 A;  4P73 C;  3NTK A;  4YRG A;  2Q7E A;  1PSE A;  1QVP A;  1Q86 U;  2CZ1 B;  2HD0 A;  4VUB A;  4OLF A;  4X9C A;  2E70 A;  4KUL A;  1YHQ T;  12AS A;  4YCV A;  5HK0 A;  4WI1 A;  2O01 E;  2FYK A;  2VXE A;  3QKJ A;  3JCM b;  5GAM d;  5LL6 S;  3GOX A;  4F7U A;  1K8A C;  4C92 D;  3CXC A;  3OB9 A;  1H3Z A;  3VKI A;  2PUO B;  3EFS A;  1WQ7 A;  2EQU A;  2L5Q A;  1TH7 A;  4C8Q E;  5LJ3 e;  3QJY A;  3NEL A;  2QQ9 A;  3CCL A;  5LJ5 f;  2RJE A;  2G4C A;  1S72 T;  2CIM A;  2NLU A;  2ZTG A;  4EMK B;  1VQ7 T;  1SES A;  3TEE A;  4BUG A;  1ZQ1 A;  3J81 E;  1VQ5 A;  1H4S A;  3MEY A;  3P8T A;  3CCE T;  2XTI A;  4N4G A;  4XTW A;  4M7D B;  5CKB A;  4HT4 A;  2CKK A;  1G3S A;  5A2Q E;  4YRR A;  3WXM B;  3LW5 E;  3LGL A;  3OS5 A;  3H6Z A;  4ZTZ B;  2ZCF B;  1ATI A;  4MDW A;  3CD6 A;  2RHQ B;  3LLR A;  2QA4 T;  4J7I A;  5EG2 A;  2DDZ A;  2RJD A;  3IAL A;  3OMG A;  2IY5 B;  4IUP A;  4CH6 A;  3DLL A;  1WLE A;  4C5H A;  2BUD A;  4MZT A;  2DTO A;  1USY A;  4MDX A;  3E19 A;  2Q5I A;  4XAX B;  2RI2 A;  5CCA A;  1PSF A;  4H2X B;  2QXF A;  3LGF A;  2MF2 A;  4BE1 A;  4M7D C;  3OQ5 A;  1YJW T;  4L87 A;  4C92 B;  5DLQ E;  1VQO A;  1BYM A;  4G85 A;  2WSF E;  4L6V 5;  4H2V A;  1VQN A;  4YRC A;  4BE2 A;  4UC4 A;  3UGQ A;  4RG2 A;  2ZPE B;  3TU4 K;  3HXW A;  4YRK A;  2DAQ A;  1ZBX A;  1KQ2 A;  4JLG A;  2QI2 A;  3SB2 A;  1ADY A;  3KXT A;  3RF1 A;  3PIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...