2E41A

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with the reaction product analog biotinol-5'-amp, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e41A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e41A01
3L1AA 4M78D 4RCBA 5GANh 3NETA 4M78B 3V7RA 3JCMJ 1GGMA 1WLEA 2E10A 4ZTZB 1B8AA 3JCMP 3UH0A 2Q5HA 4M7DG 3RACA 2EWNA 3RL6A 4YRMA 5GANf 2XGTA 4YRRA 2ZZGA 1ADJA 4TQFA 4EX5A 3QO8A 3TEHB 1B34A 4CH5A 4F7UE 3M4PA 1NJ5A 2EJFA 3FB9A 3PCOA 3V8KA 4K87A 4P75A 4WI1A 3WQZA 4C8QB 2Q7GA 4HT8A 4Q6GA 3SWNA 4M77D 3HY1A 4KR2A 5GMKh 4X9DA 3IG2A 4H2VA 3HXXA 4F7UF 5GAOr 2DXUA 3JB9J 2VXEA 4MMKA 1BBUA 5DY9A 1IL2A 2E1HA 4M75B 4X5OA 3SWNC 4M75E 3QTCA 4JRIA 5GAN3 4PJOE 3P8YA 2ODRC 1RIQA 3L4GA 3A74A 4P75C 3HXUA 4EMKA 5LJ3j 1QE0A 3QUIA 4J6WA 5LJ3h 1TH7A 2ZIMA 4V2SA 3M4QA 3JB9D 3L4GB 4C8QC 4C8QF 4C8QG 3BDUA 4XQ3A 2YLCA 2RHQA 4P72C 4P74A 4ZTUB 2ZINA 4CH3A 3RUXA 1ASYA 5LJ5j 1NYRA 4C92E 4M75C 2I4LA 2ZTGA 1HK9A 4J6XA 4M77C 4K86A 3HTZA 2ZT8A 4XEOA 1H4TA 3LC0A 1JJCA 3VBBA 5GAN6 1BIBA 1YGBA 1Z7NA 2ALYB 4YREA 3V7SA 3JCMe 5CAIA 4RMFA 3LSQA 5ELOA 3JB9F 5GAMh 2ZT6A 2DU5A 4NOYA 4H2SA 1L0WA 1LNXA 3RKXA 4YRJA 2RA2A 1EVKA 2RB6A 3KFUA 1Z7MA 1SERA 1SETA 5K1XA 2Y90A 3IKLA 1SESA 4YRLA 3EFSA 4PG3A 1B7YA 5GAN2 3REXA 1PYSA 1E24A 1NYQA 1KOGA 1EQRA 3UFGA 4BW9A 4HVCA 3BY7A 5GAOl 5GAMe 4UP8A 4OLFA 4F7UG 4P73C 4M78E 4KQEA 4PHCA 4CS2A 4M7AE 3NENA 4YRTA 5C51B 3SB2A 4XU1A 3HFZA 2E65A 1WPYA 4M7DC 1D3BA 4P73A 2AKWB 4M78G 4P71C 3ERRA 2DQ3A 1USYA 3HFZB 4P74C 4JLIA 4P72A 4XTXA 3RKWA 2DVEA 4RDXA 3JCMc 5GANg 1WNLA 3VQWA 3OD1A 4XU3A 1U1TA 2DZ9A 2DTOA 5LJ5e 4M7AC 2PMFA 3CMQA 2RHQB 1J5WA 4WJ3M 1X54A 3FIFA 4M77E 1FYFA 3HXWA 5GAOm 3P8TA 4YDQA 4XTVA 4QVCA 1YB3A 1WYDA 4XEMA 3QO5A 4J5YA 1NJ6A 5ELNA 2J3MA 2JN0A 2DXTA 3QNEA 3M4GA 2J3LA 5GMKi 5LJ5f 2C7IA 1YFSA 3JB9I 3A7UA 3LSSA 1E1TA 5LJ3d 3HFVA 4O2DA 3G1ZA 4M7DA 2Q7EA 1G5IA 4EMKB 2VC8A 4C92B 5C52B 1ADYA 4PNOA 3MF1A 4PJOC 2CJAA 4RCCA 3RESA 1HXDA 1X2GA 1H641 2DQ0A 5GMKl 2QHUA 1YFRA 2ZZEA 4F7UA 3JCMg 5GAN5 2ALYA 2Q7HA 2QTXA 4G84A 1M8VA 3UGTA 4M78C 2PMEA 2Q5IA 2C8MA 4M7DD 4PJOG 2ZCEA 4TVWA 1ASZA 1YFTA 3JCMh 1WU7A 4YRNA 3JB9G 5LJ3e 4M7DF 3JCMf 4Y91A 5GAOn 4J15A 2I4MA 4PJOA 3BJUA 4TVYA 3VQXA 1BBWA 2CJBA 2EJ9A 3V7CA 2G4CA 3ICAA 3IKMB 1LJOA 4H02A 4P3PA 4NL3A 4CH4A 5E3IA 1X55A 2QHVA 1B7YB 3FJPA 3JCMd 4NL2A 2ZZFA 4P3OA 4TWAA 3E9HA 3HRIA 1X2HA 4M7AF 5GANe 4UP7A 5GAMg 3TEHA 1EFWA 3JCMV 2DTHA 4N0AC 4HWPA 3PCOB 4C92D 4BWAA 3EFRA 4PJOB 4C8QA 4G85A 4P3NA 5LJ3g 3IALA 1EIYA 2ZNJA 3V8JA 1JJCB 3PGGA 3TEGA 3SWNB 1G51A 2IY5A 5GMKm 4M75G 2P5IA 4HWOA 1D3BB 1N9RA 3JCMQ 2ZXFA 2YHTA 1HTTA 2RM4A 1B70A 3GIBA 3A5ZA 4YRCA 4M7DE 4H2XB 4JRKA 5GMKj 2ZIOA 4C92A 4OP0A 2CIMA 2AMCB 4M77F 4XTUA 3DSQA 3MEYA 4L87A 1VQZA 3HRKA 3A7RA 2I4OA 2ZGWA 4UPAA 11ASA 3REUA 3BW1A 4XU0A 1B34B 3HSBA 1KMMA 3HXZA 5HGQA 4CS3A 2CJ9A 2ODRD 3P8VA 3A31A 3W3SA 2RD1A 4XTWA 4WF2A 4RQEA 1Y96A 5KNNA 4DPGA 1B70B 2ZR2A 5K1PA 4LNSA 4J6YA 2P0LA 3BFMA 5GAN8 2E3CA 2XTIA 5F5WA 2ZR3A 1BIAA 2ARUA 2VXFA 2AKWA 1M5Q1 3PZCA 3NEMA 4HT9A 2CGHA 1NJ8A 4YRFA 4H2TA 4YRQA 2HNIA 1USYC 3QHSA 4M7DB 3V8LA 4YYEA 1H4QA 5GMKe 4HWSA 1E1OA 1U1SA 4M77G 3NELA 4YCVA 4JUVA 1KMNA 3HXVA 4M78A 5GAN7 4M75F 3E9IA 4TTVA 3UGQA 12ASA 2DEQA 2E5AA 1EOVA 1JBMA 1LYLA 1LOJA 4HWRA 1WQ7A 2ARSA 2EL9A 2IY5B 4EMGA 1I8FA 2ZNIA 4F7UB 5GAOq 3VQYA 1B76A 4M77A 2RHSB 1E22A 4TVAB 2QHSA 2ZT5A 4XTYA 3R07A 2DZCA 4P71A 3L2ZA 1H4SA 5LJ5h 1QF6A 3HFOA 1X01A 3QO7A 3RF1A 2DDZA 4YPFA 4TQDA 3QSUA 4H2UA 5C53B 4YRKA 5LJ5g 4TVAA 5I21A 3RGLA 3A32A 4M7AG 3QO3A 4YRGA 5GAN4 1N9SA 2K57A 4YCWA 3JB9H 5LJ5d 3AHUA 4KR3A 2ZT7A 3A7AA 4C8QD 1I5LA 4PJOD 4H2WA 4RQFA 5GAMd 1C0AA 3JCMX 4HA8A 1KQ1A 4M77B 4CH6A 2ARTA 4MMLA 2AMCA 4YCUA 4E51A 1EIYB 1Y96B 3TUPA 3VQVA 2FB7A 4EO4A 3JCMb 3JCMW 4M78F 2I2LA 2E64A 5GAMf 1WQWA 3INZA 4XTZA 4C92C 3HY0A 1NJ2A 3HFNA 1I81A 4XU2A 4M75D 1JRIA 1W66A 4YP0A 1YCYA 5GAOp 4H2XA 5GANd 1NJ1A 2EAYA 4ZIBA 4PJOF 1MGQA 4YROA 1N9WA 4YRSA 2FYKA 1I4K1 2DJZA 1HC7A 2YLBA 1H4VB 1KQ2A 4M7AD 3HXYA 5LJ3f 4M7AB 1G5HA 4EMKC 4YRPA 2DU7A 4K88A 4H2YA 4X9CA 3RERA 4C92G 5GANj 4N0AA 4UP9A 2RHSA 4A54A 4A53A 4EMHA 1NNHA 3RIRA 1X56A 4DQ2A 4NCXA 4M7AA 4WJ4A 3VU3C 2QHTA 3A5YA 4HWTA 1ATIA 1EVLA 3I7FA 4CS4A 2DTIA 2E41A 4C92F 2DKGA 4QVDA 5GAMj 1SRYA 4M75A 4YRIA 2I4NA 4Q15A 1PYSB 2EJGA 4AH6A 3MF2A 4C8QE 3RKYA
chains in the Genus database with same CATH superfamily
1QCOA 6AT1B 2CP2A 3JCMJ 3E2UA 1I5OB 1TG0A 2E10A 1KFZA 3JCMP 2ZPHB 1UGQB 2M0OA 2XIDA 2AKKA 2RHYA 2SRCA 3H0IA 1ZX6A 1G3TA 2E70A 2NUPB 5CKDA 4YRMA 2KQWA 3RBBB 3I35A 1YIJT 1DJ7B 3OW2A 2DJQA 1OPKA 4CRIA 3EG9A 5IHKA 3OYHA 2Z0WA 1MNEA 1NE8A 1W2BA 4CH5A 5A0GA 5FROA 2L3PA 2HD0A 7AT1B 3FB9A 5FWCA 2J06A 3V8KA 3WQZA 5A0LA 4DEYA 3HY1A 1YNZA 4QT7A 1UUEA 4J9BA 5FRMA 3HXXA 1G2BA 4FYVB 2C0OA 4ZN3A 3A8GB 5DY9A 2O9SA 4F14A 1RAFB 2E1HA 2J7IA 3CMAT 4J9GA 3CCMT 3QTCA 4M75E 4JRIA 4PJOE 1QCFA 3A74A 3OS1A 2VV5A 5LJ3j 2M9UA 1YCSB 2QG9B 2V8JA 4B6MA 3JB9D 1VQOA 3L4GB 2JVVA 1SPKA 4C8QC 2O2OA 2D0NA 2OAUA 3BDUA 4ZTUB 2CS7A 4CH3A 3RUXA 2E6NA 4ZN1A 4M75C 4FCYA 2KI7A 2I4LA 4HCBA 1Y7XA 4K86A 1OX9A 2PTKA 4J9DA 1H4TA 1JJCA 1GCQC 4FW1A 5I2SA 4M4ZA 2HKNA 1VYVA 2MWOA 3JCMe 3F70A 2M16A 2EIFA 5GAMh 3GNFB 2DU5A 1QVFS 1L0WA 2V8IA 3C0CA 5A2QE 1WLPB 2ZPEB 4D8KA 3FJ5A 2RB6A 2HSPA 1K0XA 1SSFA 1ZSZC 2M51A 5IAYA 3M55A 3OYFA 1OU9A 4JS5A 1E24A 4QKUA 2OAWA 4J9CA 1EQRA 4HVCA 3GP8A 5KCHA 4UP8A 3VUZA 1YIJQ 3EGXA 1WXTA 3M0SA 5CVIA 1AZGB 2DXBA 3CCSA 4M7AE 1MHNA 2BZYA 2YRDA 2DEUA 5M9OA 4PLIA 4HCZA 1Q81C 2LMJA 3CCSQ 3HFZB 4P72A 4GLMA 1KD1U 2KROA 3M4YA 1Q82U 4RG8A 1WNLA 3H9NA 3VQWA 4RTXA 2QEXT 2YXYA 1U1TA 2DFUA 2VUBA 3M5AA 2J05A 3CD6Q 4ZGDB 3QIIA 3JV3A 1PWTA 1ZLMA 1X54A 1FWZA 4M77E 5GAOm 4EPCA 2PNIA 1WHMA 1WZOA 4QVCA 3QO5A 1NJ6A 4E47A 1KQSS 2DXTA 1Q81U 2NUPA 4HVUA 1FMVA 1S1NA 2YSQA 4Z8AA 3LSSA 3RNJA 2O01E 5KYXB 3NPFA 4LVLA 1OOTA 5D7UA 1Q82C 3EG9B 3THKA 1Y71A 2V1QA 2QYZA 1QLYA 3NHNA 1ADYA 1VQ8A 2OTJQ 2ZCFB 3CCRA 1MMNA 3NFCA 1H641 5HK3A 1K8AR 8AT1B 1O75A 2QDYB 1BCOA 3JCMg 5GAN5 2Q7HA 4G84A 2H8HA 2PMEA 2WSFE 3C95A 3VS7A 4PFOA 2BKDN 2D9TA 1O9SA 1ZUUA 3REAB 2RF0A 4OMLA 3H0FA 4LVJA 1AWWA 3QKJA 2FHDA 3PVQA 1WU7A 2J6KA 2IIMA 1WA7A 4BDZA 3OYKA 1VQKA 3NMZC 4JRPA 2CJBA 2GGRA 3V7CA 4FT4A 4KRTA 4F16A 2A37A 3IKMB 1LJOA 2SEMA 2O4XA 4CH4A 5E3IA 1B7YB 3JCMd 3E9GA 1WIEA 3E9HA 4M7AF 5GANe 3X26B 3JCMV 3WVDB 4N0AC 2L0AA 2DAQA 4C8QA 5LJ3g 3IALA 1JJCB 3TEGA 3PGGA 2IY5A 4M75G 2EQMA 3GLXA 3M0PA 3QPHA 3CCEQ 2ZXFA 2YHTA 2HBWA 2O9VA 1RADB 3I5SA 4M7DE 5GMKj 1QP2A 4OGEA 1UHFA 4M77F 2Y4XA 4XTUA 2AMCB 2R5MA 2XHCA 3A7RA 1M4ZA 2D8JA 2I4OA 4UPAA 2H3JA 3MHXA 1BYMA 3MP1A 4XU0A 4J83A 1B34B 1QVGA 5HGQA 2RJCA 5IXFA 2RD1A 4E7LA 3KBGA 1HYOA 1VIEA 4WF2A 1X27A 1VQ6T 5KNNA 4LDVA 3CPWS 2ZR2A 1WFWA 4J6YA 2O88A 2E3CA 1JXMA 2XDPA 1OEBA 3G6EA 1VQKT 3OA6A 1M5Q1 3PZCA 1ZSZA 1NJ8A 4H2TA 3H8ZA 3RR6A 2BUDA 4E7ZA 4KGXB 2CKKA 3QHSA 4BI8B 2OTJA 4YYEA 1NLOC 2DL3A 1YHQT 2VGMA 2KE9A 1IHWA 1WHKA 1QQJA 4FT2A 2D1XA 3UGQA 3HXVA 5GAN7 2P0KA 5J39A 3UATA 2V8KA 1IGUA 1LOJA 4XAXB 1WQ7A 2MI6A 2X3WD 4GBQA 3X24B 5CQXA 4EMGA 2ZNIA 4F7UB 1W1FA 2JXBA 1NZ9A 2QK0A 3OYAA 3GF5A 2RHSB 2PQWA 5J3BA 3R07A 1KIKA 3L2ZA 2RH2A 3SEMA 2HL3A 5LJ5h 1HSQA 1X01A 2QTVA 4TQDA 4H2UA 3HRSA 1K9MC 5C53B 1B3QA 1MUZA 3LW5E 4KUDK 4YRKA 4MDWA 2G3RA 4BUGA 3RGLA 2KY9A 3QBYA 1KJWA 3BE3A 3ME9A 1BCMA 1IRXA 4AFZC 3OYBA 4YCWA 2CP3A 1UECA 4KR3A 4RQFA 2NWMA 2COZA 3HTRA 3PVLA 4K11A 1EIYB 1G5VA 3VS2A 1WYXA 4Z02A 2EFIA 4F04B 3JCMW 1AZEA 1JXOA 5C0MA 4O6JA 4KH1B 4BI4A 1R77A 4YTLA 2E64A 2AZVA 1WQWA 1K9MU 1Q7YC 2OTLA 3DB4A 1NJ2A 4X1VA 1I81A 1AWJA 1JRIA 4AMCA 1YCYA 4H2XA 2CT4A 4YROA 5IHNA 1N9WA 1EFNA 3EAEA 1GFCA 3OYEA 3CD6A 2LQNA 2RK2A 3EFOB 2K2MA 2MWPA 2B8AA 1MV3A 2DM1A 4BI3A 4Y28E 3CBOA 5LJ3f 4OMPA 2P0PA 1G5HA 5FU7C 1NYFA 3MPUB 2DU7A 4YRPA 4FSXA 3OYYA 4H2YA 4C92G 5GANj 1Q95G 4A53A 2YUOA 3RIRA 1X56A 4DQ2A 4M7AA 2HMAA 4L6V5 2QASA 3P8HA 1LVKA 2QHTA 4JZ3A 1MV0B 1MMDA 1EVLA 3OSSC 4CS4A 1QVGS 4Y92A 3CCQQ 3CBMA 5A0DA 1BKBA 1KHIA 3CPWP 1VQ8Q 3MF2A 2DL7A 4LD9K 1KSWA 4M78D 2CUBA 2CZ1B 4RCBA 3I56T 1QMCA 1Q86R 4M78B 3V7RA 4E7SA 1GGMA 1B8AA 3C94A 4L59A 3ZEHA 2X4WA 1T3LA 3VYGA 3FEOA 2H3EB 3MCAB 3RL6A 3M9QA 2XGTA 2EKOA 1R0CB 5AT1B 1V1CA 2ZZGA 5AYFA 4PFZA 1PRLC 3PT9A 2QEXA 3OMGA 2DYBA 1D1CA 1B34A 1VYUA 3G71Q 4R0KA 2YT6A 3RMQA 3M4PA 1NJ5A 2EJFA 4KH0B 1NPRA 1YIJA 3PCOA 1M27C 3P8BB 2RI3A 2Q7GA 3PMTA 3SWNA 4KR2A 3EH2A 3HPWA 4JLGA 3IG2A 4H2VA 2X35A 1ZSGA 4F7UF 5GAOr 2D8HA 2VXEA 4IUTA 2FRYA 3LLRA 2RHXA 4B9XA 3MEWA 1IL2A 4QW2A 4A4FA 3QDRB 3VJPA 3SWNC 2CZ7B 3IQLA 3P8YA 2ODRC 4PJLA 3HXUA 1OU8A 3L2UA 1WJSA 2E3HA 3M4QA 1X75C 4JJDA 2DL8A 4C8QG 2QA4T 2YLCA 2RHQA 4P72C 3G71T 1UDLA 4BY6B 5LJ5j 1HJDA 2XD0A 1NJIU 1KC8U 2ZTGA 3QJYA 1NPPA 1K8AC 3M53A 1U3OA 1ZHIA 2HDAA 3E1SA 1KD1R 3QDFA 2ZT8A 3LC0A 2EGEA 4JS4A 1YGBA 1BIBA 1Z7NA 2F5TX 4C5HA 2KK4A 2FL7A 1TOVA 1JEGA 2LTOA 5ELOA 3JB9F 4LDUA 2ZT6A 4H2SA 2QQSA 5HK0A 4JDSA 5GJWB 1EVKA 2F2XA 1RAHB 5K1XA 1SESA 4PG3A 2A28A 1ZUYA 4ESRA 2RI5A 2W10A 3FLGA 1T0HA 4BW9A 4RG2A 2DE0X 1VQNQ 5GAOl 2EQKA 3QJ6A 2CP6A 8ATCB 4JJNK 1IB8A 1OZ2A 2GTOA 1RI9A 3G7ZA 4PHCA 1M2VB 3MO8A 1GCPA 3HKSA 1GXIE 3NENA 3SB2A 2WACA 2D6FA 1VQ6Q 2E65A 3EG3A 2XI9A 1WPYA 4M7DC 1Q81R 4P73A 4KT0E 4JLIA 2HQEA 4XTXA 3PTAA 3RKWA 1E6GA 3JCMc 5GANg 1D09B 2VASA 1YHQQ 3OD1A 4XU3A 3MQZA 5ECAA 4LVKA 1Q7YR 2DTOA 1UGRB 2AT1B 2CH4A 1J3TA 1SHGA 2RHQB 4CC3A 1J5WA 2XDDA 2DMOA 1FYFA 1YB3A 2CT3A 1WYDA 1H8KA 3I56Q 3G4ST 5ELNA 1OYXA 4C0GA 3DLMA 3M4GA 4FW2A 5GMKi 1UGVA 1X43A 1XNIA 4A63B 3A7UA 1KD1C 5LJ3d 3HFVA 4O2DA 2EKHA 2EQJA 2KDSA 1VQ5Q 1GBRA 2OTLT 3EG2A 1K9MR 1MMGA 2CJAA 4FYXB 2GF7A 3C12A 2K9GA 3QYHB 5KYWB 1HXDA 3RDVA 1X2GA 3VS1A 1N8RR 4R56A 2JM9A 1EZZB 2ZZEA 4F7UA 2L8DA 3UGTA 2BZXA 4WCIA 4CC4B 1PG5B 3P8DA 4PJOG 4LUDA 2LCLA 2VYTA 4TVWA 3VS6A 1VQKQ 1YFTA 2LQ8A 3TSZA 1N27A 2L3SA 2VGNA 2FZCB 2QAZA 4AFSC 2A08A 3OBYA 1TUDA 2MMPA 1SSHA 2QDLA 4Y91A 5GAOn 2JMCA 2ZPIB 2WSEE 3BJUA 3VQXA 2E4HA 1PCXA 2KEAA 1BBWA 2EJ9A 1VA7A 3L2RA 2VWFA 1NG2A 4P3PA 1K0SA 2JZ2A 2GQIA 2DILA 2PUOB 4KULA 1X55A 2QHVA 3JSCA 4NL2A 4ZGEB 4TWAA 2LJ0A 1QKWA 5IHIA 1WX6A 3HRIA 4ZTJA 1EFWA 1VQOT 3VS5A 4RTVA 3EGXB 4JZ4A 4DBQA 2BE9B 2R57A 2F5KA 4HWPA 1W2BS 1AT1B 1WGSA 3VS4A 3OS0A 1LPLA 4G85A 1WHGA 2NUTA 5KE2A 3X28B 1C0MA 3R6OA 1G51A 3MP8A 4C0DB 1K73C 2KR3A 1ARKA 4LDYA 2LX7A 4HWOA 3T9NA 1VQMA 3EFOA 1N9RA 2RHUA 1NLPC 2KYBA 3M0RA 1HTTA 2JW4A 1B70A 1M1KC 2DX1A 4C5IA 4EIKA 1GCQA 3CQTA 4C92A 2CIMA 3KFVA 1VQMQ 2MIOA 1VQZA 2OX7A 3L42A 4A4HA 3G1JA 4J8OA 1AHJB 3REUA 2XG8D 3E9FA 4OB0B 4PJNA 1YJ9A 3BW1A 1Z9ZA 1VQLA 1M3CA 2W0ZA 4DBHA 2CREA 2CJ9A 2ZPFB 3A31A 3W3SA 4LDXA 4XTWA 3CMAQ 1B70B 5CO7A 4LNSA 5K1PA 1VQOQ 5GAN8 1QWEA 3URGA 4LD6A 2ZR3A 1BIAA 2MCNA 5I2MA 2VXFA 4R55A 5KH6A 4YRFA 3CMAA 1X2KA 4YRQA 2X3XD 5KYYA 4ATOA 2C06A 2KNBB 4LN2A 3V8LA 2OJ2A 4PK4A 3O8VA 4DEXA 1E1OA 3TSWA 2L3QA 3GBQA 4Z88A 3CCLQ 1KMNA 3GPLA 2E5AA 2VB6A 2ARSA 1VQ8T 4OB2B 2IY5B 2F1LA 1E7OA 2A3LA 5GAOq 2LCSA 4M77A 2R58A 2AZSA 2JMAA 1E22A 2QHSA 1NEBA 4MDXA 1H4SA 3HHTB 4C0DC 1JJ2P 3MEAA 3DLLA 1ABOA 4RTTA 5I21A 3M54A 4AFUC 1YJNQ 2XKOC 4BDYA 1IXDA 2X9HA 1FMKA 3CMEA 1A0NB 3A7AA 3A1PA 1VQ9A 2QQAA 1PKTA 2EVRA 4YCUA 5CKFA 2CYZB 3OYIA 2P84A 3VQVA 1S72A 3JCMb 4OMFB 1VIFA 2BIVA 5KYNA 2I2LA 1X6OA 2QGFB 3INZA 4XTZA 2DYIA 3LYIA 4M75D 1UGPB 1W66A 4YP0A 3M0QA 5GANd 4ZIBA 4LVIA 4YRSA 3CCST 2FYKA 2DJZA 1HC7A 1YJWT 4AG1C 4FYYB 2M0YA 4IKFA 3CXCA 4J9EA 1PC0A 1KQ2A 1RAEB 1OX8A 4E7IA 3I55Q 4J7FA 1VQ4Q 3I56A 4N0AA 5KYUA 4UP9A 4A54A 1M30A 2K7AA 4EMHA 3S3OA 2FO0A 2RK1A 1M1FA 4ANJA 1N5ZA 2DA9A 3CPFA 3A5YA 2DO3A 4HWTA 1ATIA 4X34A 3I7FA 1JJ2A 2DTIA 2E41A 3EH1A 1SRYA 1G3YA 4YRIA 2KT1A 2DF6A 4MZTA 2I4NA 4Q15A 2EJGA 3UA7A 1V76A 2ROLA 4BACA 4AH6A 2ZZDA 2JJ9A 4J9HA 3L1AA 1SF9A 2KSSA 4FU6A 1PKSA 4PLLA 5FU7B 4DOWA 3LH0A 3TEEA 2K3BA 4ZTZB 2LX9A 3UH0A 3CCRT 2Q5HA 2BZ8A 5GANf 1NM7A 4YRRA 1MMAA 4FL6A 4ME7A 3VRZA 2DLPA 1TWBA 3I55T 3QO8A 5IXBA 1R0BG 1YITQ 3TEHB 3CEYA 3O5ZA 4RMOA 1YN8A 1WHLA 4F7UE 1VQ7Q 3EG1A 4DBFA 3SDZA 4K87A 1VQ5T 2CZ6B 4HT4A 4NS5A 3SD4A 4C8QB 2DK3A 1RABB 3WXMB 2PZ1A 4M77D 4ZNXA 1UGSB 2YRCA 5EC7A 3LGLA 4IUUA 1VQ6A 2DXUA 1WHJA 5D6WA 4MMKA 3G6ET 4B9WA 1ZBXA 5DM7R 1YI2Q 3OSVA 2EGAA 5KYUB 1KK7A 2FEIA 4TVRA 1RIQA 2MOXA 4EMKA 1QE0A 3QUIA 3CC4A 1YI2A 2J6FA 1QVFA 1BI0A 5LJ3h 2MF2A 1Q86C 2ZIMA 1CKAA 3OQ5A 2HQXA 4FSSA 3OY9A 4C8QF 1Y57A 1SKUB 1UHCA 2EW3A 1TS9A 3AT1B 2EQUA 1M8MA 1C1AA 3FDRA 1YJ9Q 1VQLQ 4J6XA 3WVEB 3ASKA 4IUVA 2O31A 3CXCP 1SG5A 1UB4A 3CCLA 3CCVT 4JJBA 3VV0A 2RJEA 3L2QA 1VQPA 4KGZB 2YUPA 5I22A 1ACMB 3G6EQ 1Q86U 3OYGA 2ED0A 2RA2A 3QWYA 1SETA 4OGCA 4YRLA 1HD3A 3UA6A 5GAN2 3REXA 1AOJA 1NJIC 2DD4A 1PYSA 1YITA 3ULRB 1KOGA 2EYQA 2X4YA 3BY7A 3OYNA 1VQ7A 3N5BB 5GAMe 1YJNA 4OLFA 1M90R 1SHFA 2KRNA 2E6ZA 4M78E 4FYWB 1VUBA 4L5GA 3CMEQ 3S3NA 1S72T 1YWOA 2ZPBB 3CCVA 4CS2A 3CCET 1VQNT 2KYMA 4YRTA 5C51B 1G3WA 5KE3A 1BI2A 1D1AA 3UT1A 1WDXA 1D3BA 2JS2A 5CKEA 3CCVQ 4P71C 3CC4T 2LCCA 2PVDB 4P74C 2G6FX 4ZGJB 2DVEA 5KCOA 2PVOB 3QZ5B 2QQBA 1D1BA 5IH2A 4C0FA 2LZ6B 3LH5A 5LJ5e 4M7AC 3CMQA 2GFAA 2QXFA 4WJ3M 3S6WA 2M1HA 2RJFA 2KT8A 2DETA 3HXWA 4A4EA 4XEMA 3MKDA 1WXUA 2JN0A 1VQPT 1YWPA 3HRTA 3QNEA 2J3LA 2RQVA 5LJ5f 2C7IA 1JO8A 1YFSA 5C6SA 1E1TA 1VQMT 1FYNA 2NUTB 4HCKA 3TVTA 3HL8A 4HVVA 4ELYC 2ROTA 4HKEA 3JAME 2BTTA 2DQ0A 5GMKl 4LVMA 2QTXA 1M8VA 2V1RA 2Q5IA 3A8MB 1PM3A 2CZ0B 2XU8A 5I11A 4M7DD 2ZCEA 1GFDA 2YRVA 1ASZA 3LWHA 3KXTA 3CPWA 3D7SB 4IUQA 4YRNA 3JB9G 5LJ3e 1OZ3A 4A4GA 4M7DF 3L2WA 3PIPA 3CC7A 2I4MA 4J9FA 4TVYA 2NS6A 3A8LB 2G4CA 1ABQA 2K79A 3FRNA 2IPOB 3ICAA 1KC8R 1WJRA 4NL3A 1M1KU 1X2QA 4RUGA 3FJPA 5HCKA 4P3OA 3G4SQ 1X2HA 4GY5A 3X20B 1QVPA 4UP7A 5GAMg 1OI1A 3TEHA 4II1A 1F1BB 1W4SA 2LJ1A 1K76A 2KVQG 4C92D 4BWAA 3JRZA 1M9SA 1EIYA 3H6ZA 2ZNJA 3V8JA 2XDBA 1BI1A 2OTLQ 5FLXE 5GMKm 1PD0A 2O4XB 3U23A 5KYWA 1YI2T 3JCMQ 2K5LA 4IIOA 3VS3A 2L2PA 1QW1A 1KQSP 3GIBA 1U5SA 1OQKA 3A5ZA 4YRCA 4PFPA 4H2XB 3GNGA 3CBPA 2ZIOA 1TUGB 3DSQA 2A0FB 2FRWA 3HRKA 2QGGA 2E12A 4ORZA 1V29B 1B07A 1H92A 4IURA 3HXZA 2GQVA 4JJCA 2FG0A 2ODRD 1MNDA 1M1GA 3LX7A 5FRNA 1QVGP 2RHIA 2FVUA 1H3ZA 2NYSA 3CCQA 3CCMA 1Y96A 3MEUA 1IO6A 4MZMA 3BFMA 2FZKB 4C5GA 2YUQA 4BE1A 1M3BA 2QA4Q 5F5WA 2GFUA 3UWNA 2K2VA 3EGDB 1G3SA 4M7DB 5GMKe 4HWSA 1U1SA 1PSEA 4KUIA 3SHWA 4YCVA 3S3MA 4PJJA 4M78A 4M75F 3OYJA 12ASA 2A36A 9ATCB 1LYLA 2HCKA 3HP9A 1I8FA 4RKUE 3CCLT 2QQRA 3VQYA 3DB3A 1UEBA 4RTYA 1BK2A 2AIRB 3VUBA 3M58A 2RQTA 1K4US 4XTYA 1M2VA 1ZSZB 2DZCA 4P71A 5D6YA 1QKXA 3CMET 5HY6A 3QO7A 1ZUKA 4CI0C 3RF1A 1VQ9T 3QSUA 2LP5A 5LJ5g 4TVAA 2JS0A 3UDCA 2LT1A 3A32A 2RJDA 4BE2A 1FMWA 2ZAEA 1N9SA 1Q82R 1X6GA 2DVJA 2LDMA 3OYCA 2K3YA 5CK9A 1GL5A 5IT9E 2CH4W 2QEXQ 3A5ZB 4C8QD 1I5LA 2A7YA 1UTIA 4MZPA 5GAMd 3JCMX 1M90C 2RQWA 1KQ1A 1YJNT 2AMCA 5FU6C 4E51A 1YJ9T 1VQLT 1GRIA 2PUKB 3TUPA 2RNAA 2HBPA 1ZA2B 4RTZA 1NJIR 5L8RE 4M78F 3TU4K 3TREA 4BY6C 4O5VA 3ZFJA 1JQQA 2ABLA 5EG2A 3HFNA 4XU2A 4KGVB 1RUWA 2NUZA 5GAOp 1FX7A 1ZA1B 3M59A 1NJ1A 4PJOF 1MGQA 2J6OA 2YWWA 1I4K1 1NBEB 2VKNA 1H4VB 4M7AD 1IREB 1M90U 4IUPA 4EMKC 4K88A 2AK5A 3BDLA 5CKHA 1TTHB 4DBRA 1RLQC 2CSQA 3CC2A 1WI7A 2MYSA 4NCXA 1XQHA 3NGPA 3H41A 1Y07A 1Q7YU 1UFFA 2MK5A 2DBKA 4QVDA 2KMTA 5GAMj 1AWOA 2DL5A 2KXCA 1PYSB 2ESWA 2FPDA 4QQ6A 1X6BA 5CCAA 4LNPA 3RKYA 3QZ9B 1NEGA 2QA4A 5GANh 3NETA 1RI0A 5LL6S 1N8RU 2JTEA 1WLEA 4J9IA 3OYLA 2LT4A 4DOVA 2CDTA 3QYGB 3M57A 5CIUA 2X4JA 2X4XA 4M7DG 3RACA 2EWNA 2V26A 5FW9A 1PD1A 1BU1A 2RN8A 4A4KA 2DIQA 2M02A 1QP3A 3A8OB 1ADJA 4TQFA 2LC4A 4EX5A 4OB3B 3EHRA 3CC7Q 1VQ9Q 3HRUA 3X25B 1N6AA 2BE7D 2GNCA 1YJWQ 1OULA 1YP5A 4C0ZA 1LCKA 4P75A 4BE0A 1N8RC 2LNVA 4WI1A 1QWFA 2DPPB 3OBWA 5CR2A 3EGUA 2KRSA 2GBQA 2QQ9A 4HT8A 4Q6GA 2I0NA 5GMKh 4OB1B 4X9DA 3TQ7P 1I0CA 3VRYA 3CCJQ 4E6RA 2DRMA 4WTOB 3VS0A 3JB9J 1XJWB 1OPLA 3UF4A 1BBUA 1KC8C 1BBZA 4OMMA 1QCNA 4OMQA 1M1KR 2Y4YA 4M75B 4X5OA 3MJXA 3OS2A 5GAN3 1YHQA 3L4GA 4P75C 3SFMA 2B86A 1B7TA 1W2BP 1VQ4A 3META 3VYHB 4J6WA 1TH7A 4V2SA 3PMIA 4AFQC 1SRLA 3CCRQ 2K4YA 2L89A 4XQ3A 4HCCA 4P74A 2ZINA 1ASYA 3E19A 3OYDA 2DL4A 3ER0A 4E7JA 1NYRA 2JNGA 2COWA 4C92E 3I5RA 1HK9A 3MP6A 1RL2A 4M77C 3HTZA 1IGQA 3Q1JA 2GCXA 4XEOA 1AD5A 2P0QA 1AWXA 1M3AA 3VBBA 4OMOA 4C5EA 5GAN6 2ATCB 2ALYB 4YREA 3V7SA 4RMFA 5CAIA 2RQUA 1JJ2S 3LSQA 4UC4A 4NOYA 1LNXA 3RKXA 2DBMA 4YRJA 4QVZA 2CP7A 5FWBA 1Z7MA 3KFUA 2C0IA 2JTFA 5DLOA 3GOXA 1SERA 3QG1A 2Y90A 3IKLA 1BB9A 3EFSA 1B7YA 3CCUT 2RI2A 1NYQA 1K8AU 3UFGA 5D6XA 4AT1B 4PL6A 4F7UG 2OTJT 4P73C 3TCJA 5IN1A 4KQEA 3OW2S 2PU9B 1I1JA 2EYXA 4XU1A 3HFZA 4PJMA 2L5QA 3PFSA 4D8DA 3UPUA 1RAIB 1S72Q 2AKWB 4M78G 3R6NA 2LQWA 2DD5A 2DQ3A 3ERRA 1VQ4T 3OS5A 1USYA 3J7AF 1YJWA 2EQIA 2JUFA 1Y0MA 2LQKA 2LNHB 4RDXA 3ZBDA 2HZYA 4HVWA 2DIGA 4RTUA 1TSFA 2DZ9A 2K3XA 2RPNA 1QVFP 1EX4A 2FPEA 1K1ZA 1UE9A 2PMFA 1D0ZA 1WJQA 3J81E 3FIFA 1C6VX 4LE9A 3P8TA 2DERA 4YDQA 4XTVA 5FU6B 4J5YA 3CCEA 2J3MA 4FM4B 1TXQA 1XTDA 3LWIA 1R8OB 3JB9I 3CXCS 3G1ZA 1AEYA 3NTHA 2F2WA 2FPFA 4CC2A 1RAGB 4QQDA 1XOVA 1ZQ1A 4J7IA 2R5AA 4M7DA 2Q7EA 1G5IA 1TUCA 4EMKB 2VC8A 4OVAA 4C92B 5C52B 2EBPA 4PNOA 3MF1A 4PJOC 2QI2A 4RCCA 5KYXA 2EYZA 3RESA 2XMFA 1YITT 3QWXX 4N4HA 2QHUA 4N4IA 1T0JA 1YFRA 3EHQA 4XK8E 5KYYB 3CC2Q 2P4TA 3RMSA 2ALYA 2RHZA 4M78C 3QXEB 2C8MA 3OYMA 2HEQA 2E3IA 2E5QA 3OB9A 1D0YA 3JCMh 1KHCA 3NTIA 4JPBW 2YUNA 2VVKA 1T3SA 2A8EA 3JCMf 1K73R 4J15A 1NYGA 1UG1A 4PJOA 2AHJB 4F17A 1ZBJA 3ZL7C 2L3RA 1KQSA 4N4GA 4H02A 4AG2C 2CSIA 1U06A 2PVGB 2HL5C 1PRMC 2ZZFA 4Z89A 3L2VA 4PKCC 1RACB 2KGTA 2KAFA 1UJYA 2DRKA 2DTHA 1JB0E 2GTJA 1IZ6A 2IG0A 2MAMA 3PCOB 3G71A 3EFRA 4P5NA 4PJOB 3FC3A 1OV3A 1D0XA 3CCJT 1VQ7T 2RO0A 4P3NA 2HSEB 2LRQA 3SWNB 1IHVA 1PHTA 2P5IA 2FZGB 4IIMA 4Q5WA 2DNUA 2DXCA 1RLPC 3A98A 1D3BB 2CP5A 3J80E 2RM4A 3CCJA 1W6XA 2D0QB 4LXCA 2KRMA 1VYTA 5L23A 1RAAB 4JRKA 5CQYA 2JOYA 4OP0A 3MEYA 4L87A 4LUEA 1PNJA 1Z9QA 2MPXC 2ZGWA 3CCQT 2LVMA 11ASA 4CC7A 4JRQA 1VQ5A 3M56A 1P92A 2YDLA 2CP0A 1UJ0A 2F69A 2K6DA 3PE0A 3HSBA 1KMMA 2ENMA 1AVZC 4CS3A 3CCUA 1U8RA 2HQHA 3P8VA 1GBQA 1K73U 1SEMA 4RQEA 2AKLA 2ED1A 4VUBA 4DPGA 2P0LA 3DKMA 2KXDA 2EYWA 2XTIA 3A8HB 4EDUA 2ARUA 2AKWA 1WXBA 4HT9A 2CGHA 3CD6T 3NEMA 1G8XA 2EPDA 2X51A 3REBB 3CCMQ 2HNIA 3KUFA 1H3HA 1USYC 1H4QA 5CKBA 2RQRA 4M77G 3NELA 1CKBA 4JUVA 4TTVA 3E9IA 1VOMA 2DEQA 1VQNA 1EOVA 1X69A 1JBMA 2EYYA 4HWRA 1I07A 3OMCA 5J26A 2EL9A 4RTWA 1JU5C 1B76A 5HKCA 2HAXA 1M2OA 4TVAB 2ZT5A 2NLUA 3EG0A 4GLKA 2CUDA 3PIOA 1QF6A 3HFOA 2DDZA 2LJ3A 4YPFA 3LGFA 1KG1A 3NTKA 1EIFA 1FXXA 2OI3A 1SRMA 4M7AG 3QO3A 4YRGA 4QQGA 5GAN4 2E5KA 2K57A 4E2FB 4KBMB 1E6HA 1K9AA 4E7KA 3JB9H 5LJ5d 3AHUA 2EGCA 2ZT7A 4H2WA 3OW2P 4PJOD 3CC7T 3MEVA 1C0AA 4HA8A 1CSKA 4M77B 4CH6A 3G4SA 2C0TA 2ARTA 4MMLA 1TU0B 2F2VA 1WHHA 1Y96B 2ECZA 2FB7A 3M0TA 4EO4A 2IVWA 2XK0A 3CC4Q 5DLQE 3EGDA 5GAMf 4C92C 3CC2T 2WSCE 3HY0A 2RMOA 4BB7A 4D6WA 2P4RA 1PSFA 3CCUQ 4DA4A 2EAYA 3H0HA 2COYA 4HXJA 2YLBA 2XICA 2HKQB 1BI3A 3HXYA 2K5IA 1YBYA 4OMNA 4M7AB 3C4SA 4X9CA 3RERA 1YFNA 1G83A 2ZPGB 2RHSA 5GJVB 2JM8A 1VQPQ 1W70A 1NNHA 2K5FA 4WJ4A 4ELZC 2JTMA 2JT4A 3I9QA 4OF1A 3I55A 3VU3C 4E7HA 4ZTFA 4C92F 2DKGA 4LDWA 4M75A 3M0UA 2KBTA 3VKIA 4C8QE 3PNWC 4BD3A 4FIBA
chains in the Genus database with same CATH topology
3JCMJ 2E10A 3JCMP 2ZPHB 1UGQB 2M0OA 2XIDA 2RHYA 1G3TA 2E70A 4YRMA 5CKDA 2KQWA 1YIJT 1DJ7B 3OW2A 4CRIA 3OYHA 1NE8A 1W2BA 4CH5A 5A0GA 5FROA 2HD0A 3FB9A 3V8KA 3WQZA 5A0LA 3HY1A 5FRMA 3HXXA 4ZN3A 3A8GB 5DY9A 2E1HA 3CMAT 3CCMT 3QTCA 4M75E 4JRIA 4PJOE 3A74A 3OS1A 2VV5A 5LJ3j 2M9UA 2V8JA 3JB9D 1VQOA 3L4GB 2JVVA 4C8QC 2OAUA 3BDUA 4ZTUB 2CS7A 4CH3A 3RUXA 2E6NA 4ZN1A 4M75C 2I4LA 4HCBA 1Y7XA 4K86A 1H4TA 1JJCA 5I2SA 3JCMe 2MWOA 3F70A 2M16A 2EIFA 5GAMh 3GNFB 2DU5A 1QVFS 1L0WA 2V8IA 5A2QE 2ZPEB 2RB6A 1SSFA 5IAYA 3M55A 3OYFA 4JS5A 1E24A 1EQRA 4HVCA 3GP8A 5KCHA 4UP8A 3VUZA 5CVIA 2DXBA 3CCSA 4M7AE 1MHNA 5M9OA 4PLIA 4HCZA 1Q81C 3HFZB 4P72A 1KD1U 3M4YA 1Q82U 4RG8A 1WNLA 3VQWA 2QEXT 1U1TA 2VUBA 3M5AA 4ZGDB 3QIIA 1X54A 1FWZA 4M77E 5GAOm 4EPCA 4QVCA 3QO5A 1NJ6A 4E47A 1KQSS 2DXTA 1Q81U 3LSSA 2O01E 4LVLA 1Q82C 1Y71A 1ADYA 1VQ8A 2ZCFB 3CCRA 3NFCA 1H641 5HK3A 1O75A 2QDYB 3JCMg 5GAN5 2Q7HA 4G84A 2PMEA 2WSFE 3C95A 2D9TA 2BKDN 1O9SA 4LVJA 3QKJA 2FHDA 1WU7A 4BDZA 3OYKA 1VQKA 4JRPA 2CJBA 3V7CA 4FT4A 3IKMB 1LJOA 2O4XA 4CH4A 5E3IA 1B7YB 3JCMd 3E9GA 3E9HA 4M7AF 5GANe 3X26B 3JCMV 3WVDB 4N0AC 2DAQA 4C8QA 5LJ3g 3IALA 1JJCB 3TEGA 3PGGA 2IY5A 4M75G 2EQMA 3GLXA 3QPHA 2ZXFA 2YHTA 4M7DE 5GMKj 1QP2A 4OGEA 2AMCB 4M77F 2Y4XA 4XTUA 2R5MA 2XHCA 3A7RA 1M4ZA 2I4OA 4UPAA 2H3JA 3MHXA 1BYMA 3MP1A 4XU0A 4J83A 1B34B 1QVGA 5HGQA 2RJCA 2RD1A 4E7LA 3KBGA 1VIEA 4WF2A 1VQ6T 5KNNA 4LDVA 3CPWS 2ZR2A 4J6YA 2E3CA 2XDPA 3G6EA 1VQKT 3OA6A 1M5Q1 3PZCA 1NJ8A 4H2TA 3H8ZA 2BUDA 4BI8B 2CKKA 3QHSA 2OTJA 4YYEA 1YHQT 2VGMA 4FT2A 3UGQA 3HXVA 5GAN7 2P0KA 5J39A 2V8KA 1LOJA 4XAXB 1WQ7A 2MI6A 3X24B 4EMGA 5CQXA 2ZNIA 4F7UB 1NZ9A 3OYAA 3GF5A 2RHSB 2PQWA 5J3BA 3R07A 3L2ZA 2RH2A 5LJ5h 1X01A 4TQDA 4H2UA 3HRSA 1K9MC 5C53B 3LW5E 4KUDK 4YRKA 4MDWA 2G3RA 4BUGA 3RGLA 2KY9A 3QBYA 3ME9A 3OYBA 4YCWA 4KR3A 4RQFA 1EIYB 1G5VA 4Z02A 2EFIA 3JCMW 5C0MA 4O6JA 4BI4A 4YTLA 2E64A 1WQWA 1K9MU 1Q7YC 2OTLA 3DB4A 1NJ2A 1I81A 1JRIA 1YCYA 4H2XA 4YROA 1N9WA 3EAEA 3OYEA 3CD6A 2RK2A 2MWPA 2B8AA 4BI3A 4Y28E 3CBOA 5LJ3f 1G5HA 2P0PA 5FU7C 4YRPA 2DU7A 4FSXA 3OYYA 4H2YA 4C92G 5GANj 4A53A 3RIRA 1X56A 4DQ2A 4M7AA 3P8HA 4L6V5 2QHTA 1EVLA 3OSSC 4CS4A 1QVGS 3CBMA 5A0DA 1BKBA 1KHIA 3MF2A 4LD9K 4M78D 2CZ1B 4RCBA 3I56T 4M78B 3V7RA 1GGMA 1B8AA 3C94A 4L59A 3ZEHA 2X4WA 3VYGA 3FEOA 3MCAB 3RL6A 3M9QA 2XGTA 2EKOA 2ZZGA 5AYFA 3PT9A 2QEXA 3OMGA 1B34A 3RMQA 3M4PA 1NJ5A 2EJFA 1NPRA 1YIJA 3PCOA 3P8BB 2RI3A 2Q7GA 3PMTA 3SWNA 4KR2A 3HPWA 4JLGA 3IG2A 4H2VA 2X35A 4F7UF 5GAOr 2VXEA 4IUTA 3LLRA 2RHXA 4B9XA 3MEWA 1IL2A 4QW2A 4A4FA 3QDRB 3VJPA 3SWNC 2CZ7B 3P8YA 2ODRC 3HXUA 3L2UA 1WJSA 3M4QA 1X75C 4C8QG 2QA4T 2YLCA 2RHQA 4P72C 3G71T 4BY6B 5LJ5j 2XD0A 1NJIU 1KC8U 2ZTGA 3QJYA 1NPPA 1K8AC 3M53A 1ZHIA 3E1SA 2ZT8A 3LC0A 4JS4A 1YGBA 1BIBA 1Z7NA 2F5TX 4C5HA 2KK4A 2FL7A 2LTOA 5ELOA 3JB9F 4LDUA 2ZT6A 4H2SA 2QQSA 5HK0A 4JDSA 1EVKA 5K1XA 1SESA 4PG3A 2RI5A 3FLGA 4BW9A 4RG2A 5GAOl 2EQKA 3QJ6A 4JJNK 1OZ2A 3G7ZA 4PHCA 3MO8A 3HKSA 1GXIE 3NENA 3SB2A 2WACA 2D6FA 2E65A 2XI9A 1WPYA 4M7DC 4P73A 4KT0E 4JLIA 2HQEA 4XTXA 3PTAA 3RKWA 3JCMc 5GANg 3OD1A 4XU3A 3MQZA 4LVKA 2DTOA 1UGRB 2RHQB 1J5WA 2XDDA 1FYFA 1YB3A 1WYDA 3G4ST 5ELNA 1OYXA 4C0GA 3DLMA 3M4GA 5GMKi 1XNIA 3A7UA 1KD1C 5LJ3d 3HFVA 4O2DA 2EQJA 2KDSA 2OTLT 2CJAA 2GF7A 3C12A 3QYHB 1HXDA 1X2GA 4R56A 2ZZEA 4F7UA 2L8DA 3UGTA 3P8DA 4PJOG 2LCLA 2VYTA 4TVWA 1YFTA 2LQ8A 1N27A 2VGNA 3OBYA 2MMPA 4Y91A 5GAOn 2ZPIB 2WSEE 3BJUA 3VQXA 1BBWA 2EJ9A 3L2RA 4P3PA 2JZ2A 2PUOB 4KULA 1X55A 2QHVA 3JSCA 4NL2A 4ZGEB 4TWAA 3HRIA 4ZTJA 1EFWA 1VQOT 2R57A 2F5KA 4HWPA 1W2BS 1WGSA 3OS0A 4G85A 5KE2A 3X28B 3R6OA 1G51A 3MP8A 4C0DB 1K73C 4LDYA 4HWOA 3T9NA 1VQMA 1N9RA 2RHUA 1HTTA 1B70A 1M1KC 4C5IA 4C92A 2CIMA 1VQZA 3L42A 4A4HA 4J8OA 1AHJB 3REUA 2XG8D 3E9FA 1VQLA 4OB0B 1YJ9A 3BW1A 2CJ9A 2ZPFB 3A31A 3W3SA 4LDXA 4XTWA 1B70B 5CO7A 4LNSA 5K1PA 5GAN8 3URGA 4LD6A 2ZR3A 1BIAA 5I2MA 2VXFA 4R55A 5KH6A 4YRFA 3CMAA 4YRQA 4ATOA 2C06A 3V8LA 3O8VA 1E1OA 1KMNA 3GPLA 2E5AA 2ARSA 1VQ8T 4OB2B 2IY5B 2A3LA 5GAOq 4M77A 2R58A 1E22A 2QHSA 4MDXA 1H4SA 3HHTB 4C0DC 3MEAA 3DLLA 5I21A 3M54A 2XKOC 4BDYA 3CMEA 3A7AA 1VQ9A 2QQAA 4YCUA 5CKFA 2CYZB 3OYIA 3VQVA 1S72A 3JCMb 4OMFB 1VIFA 2BIVA 2I2LA 1X6OA 3INZA 4XTZA 3LYIA 4M75D 1UGPB 1W66A 4YP0A 5GANd 4ZIBA 4LVIA 4YRSA 3CCST 2FYKA 2DJZA 1HC7A 1YJWT 4IKFA 3CXCA 1KQ2A 4E7IA 4J7FA 3I56A 4N0AA 4UP9A 4A54A 4EMHA 3S3OA 2RK1A 1M1FA 3CPFA 3A5YA 2DO3A 4HWTA 1ATIA 4X34A 3I7FA 1JJ2A 2DTIA 2E41A 1SRYA 1G3YA 4YRIA 2I4NA 4MZTA 4Q15A 2EJGA 4BACA 4AH6A 2ZZDA 3L1AA 2KSSA 4FU6A 4PLLA 5FU7B 4DOWA 3LH0A 3TEEA 4ZTZB 2LX9A 3UH0A 3CCRT 2Q5HA 5GANf 4YRRA 4FL6A 4ME7A 3I55T 3QO8A 3TEHB 3CEYA 4RMOA 4F7UE 3SDZA 4K87A 1VQ5T 2CZ6B 4HT4A 4NS5A 3SD4A 4C8QB 2DK3A 3WXMB 4M77D 1UGSB 3LGLA 4IUUA 1VQ6A 2DXUA 5D6WA 4MMKA 3G6ET 4B9WA 1ZBXA 5DM7R 3OSVA 4TVRA 1RIQA 4EMKA 1QE0A 3QUIA 3CC4A 1YI2A 1QVFA 1BI0A 5LJ3h 2MF2A 1Q86C 2ZIMA 3OQ5A 2HQXA 3OY9A 4C8QF 2EQUA 3FDRA 4J6XA 3WVEB 3ASKA 4IUVA 1UB4A 3CCLA 3CCVT 3VV0A 2RJEA 3L2QA 1VQPA 1Q86U 3OYGA 2RA2A 1SETA 4OGCA 4YRLA 5GAN2 3REXA 1NJIC 1PYSA 2DD4A 1YITA 1KOGA 2EYQA 2X4YA 3BY7A 3OYNA 1VQ7A 3N5BB 5GAMe 1YJNA 4OLFA 2E6ZA 4M78E 1VUBA 4L5GA 3S3NA 1S72T 2ZPBB 3CCVA 4CS2A 3CCET 1VQNT 4YRTA 5C51B 1G3WA 5KE3A 1BI2A 3UT1A 1D3BA 5CKEA 4P71C 3CC4T 2LCCA 2PVDB 4P74C 4ZGJB 2DVEA 5KCOA 2PVOB 3QZ5B 2QQBA 4C0FA 5LJ5e 4M7AC 3CMQA 2GFAA 2QXFA 4WJ3M 3S6WA 2M1HA 2RJFA 3HXWA 4A4EA 4XEMA 2JN0A 1VQPT 3HRTA 3QNEA 2J3LA 5LJ5f 2C7IA 1YFSA 5C6SA 1E1TA 1VQMT 3HL8A 4ELYC 3JAME 4HKEA 2DQ0A 5GMKl 4LVMA 2QTXA 1M8VA 2Q5IA 3A8MB 2CZ0B 2XU8A 4M7DD 2ZCEA 2YRVA 1ASZA 3LWHA 3KXTA 3CPWA 4IUQA 4YRNA 3JB9G 5LJ3e 1OZ3A 4A4GA 4M7DF 3L2WA 3PIPA 3CC7A 2I4MA 4TVYA 2NS6A 3A8LB 2G4CA 3FRNA 3ICAA 1WJRA 4NL3A 1M1KU 3FJPA 4P3OA 1X2HA 4GY5A 3X20B 1QVPA 4UP7A 5GAMg 1OI1A 3TEHA 4II1A 1W4SA 2KVQG 4C92D 4BWAA 3JRZA 1M9SA 1EIYA 2ZNJA 3H6ZA 3V8JA 2XDBA 1BI1A 5FLXE 5GMKm 2O4XB 1YI2T 3JCMQ 2K5LA 1QW1A 3GIBA 3A5ZA 4YRCA 4H2XB 3GNGA 3CBPA 2ZIOA 3DSQA 3HRKA 2E12A 1V29B 4IURA 3HXZA 2GQVA 2ODRD 1M1GA 3LX7A 5FRNA 2RHIA 2FVUA 1H3ZA 3CCQA 3CCMA 1Y96A 3MEUA 4MZMA 3BFMA 4C5GA 4BE1A 5F5WA 2GFUA 3UWNA 2K2VA 1G3SA 4M7DB 5GMKe 4HWSA 1U1SA 1PSEA 4KUIA 4YCVA 3S3MA 4M78A 4M75F 3OYJA 12ASA 1LYLA 3HP9A 1I8FA 4RKUE 3CCLT 2QQRA 3VQYA 3DB3A 1UEBA 3VUBA 3M58A 4XTYA 2DZCA 4P71A 5D6YA 3CMET 5HY6A 3QO7A 4CI0C 3RF1A 1VQ9T 3QSUA 5LJ5g 4TVAA 3UDCA 2LT1A 3A32A 2RJDA 4BE2A 1N9SA 2LDMA 3OYCA 2K3YA 5CK9A 5IT9E 3A5ZB 4C8QD 1I5LA 2A7YA 5GAMd 4MZPA 3JCMX 1M90C 1KQ1A 1YJNT 2AMCA 5FU6C 4E51A 1YJ9T 1VQLT 2PUKB 3TUPA 2HBPA 5L8RE 4M78F 3TU4K 3TREA 4BY6C 4O5VA 3ZFJA 3HFNA 5EG2A 4XU2A 5GAOp 1FX7A 3M59A 1NJ1A 4PJOF 1MGQA 1I4K1 1H4VB 4M7AD 1IREB 1M90U 4IUPA 4EMKC 4K88A 3BDLA 5CKHA 3CC2A 4NCXA 1XQHA 1Y07A 1Q7YU 4QVDA 2KMTA 5GAMj 1PYSB 4QQ6A 5CCAA 3RKYA 3QZ9B 2QA4A 5GANh 3NETA 1RI0A 5LL6S 1N8RU 1WLEA 3OYLA 2LT4A 4DOVA 3QYGB 5CIUA 3M57A 2X4JA 2X4XA 4M7DG 3RACA 2EWNA 4A4KA 2DIQA 1QP3A 3A8OB 1ADJA 4TQFA 2LC4A 4EX5A 4OB3B 3HRUA 3X25B 1N6AA 4C0ZA 4P75A 4BE0A 1N8RC 4WI1A 2LNVA 2DPPB 3OBWA 5CR2A 2QQ9A 4HT8A 4Q6GA 5GMKh 4OB1B 4X9DA 3JB9J 1BBUA 1KC8C 2Y4YA 4M75B 4X5OA 3OS2A 5GAN3 1YHQA 3L4GA 4P75C 3SFMA 1VQ4A 3META 3VYHB 4J6WA 1TH7A 4V2SA 3PMIA 2K4YA 2L89A 4XQ3A 4HCCA 4P74A 2ZINA 1ASYA 3E19A 3OYDA 3ER0A 4E7JA 1NYRA 2JNGA 4C92E 1HK9A 3MP6A 1RL2A 4M77C 3HTZA 3Q1JA 2GCXA 4XEOA 2P0QA 3VBBA 4C5EA 5GAN6 2ALYB 4YREA 3V7SA 4RMFA 5CAIA 1JJ2S 3LSQA 4UC4A 4NOYA 1LNXA 3RKXA 4YRJA 4QVZA 3KFUA 1Z7MA 1SERA 2JTFA 5DLOA 3GOXA 3QG1A 2Y90A 3IKLA 3EFSA 1B7YA 3CCUT 2RI2A 1NYQA 1K8AU 3UFGA 5D6XA 4PL6A 4F7UG 2OTJT 4P73C 3TCJA 5IN1A 4KQEA 3OW2S 2PU9B 4XU1A 3HFZA 2L5QA 3PFSA 3UPUA 2AKWB 4M78G 3ERRA 2DD5A 2DQ3A 1VQ4T 3OS5A 1USYA 3J7AF 1YJWA 2JUFA 2LQKA 4RDXA 3ZBDA 2DIGA 2DZ9A 2K3XA 2PMFA 1WJQA 3J81E 3FIFA 3P8TA 4YDQA 4XTVA 5FU6B 4J5YA 3CCEA 2J3MA 4FM4B 1XTDA 3LWIA 1R8OB 3JB9I 3CXCS 3G1ZA 3NTHA 4QQDA 1XOVA 1ZQ1A 4J7IA 2R5AA 4M7DA 2Q7EA 1G5IA 4EMKB 2VC8A 4OVAA 4C92B 5C52B 4PNOA 3MF1A 4PJOC 2QI2A 4RCCA 3RESA 1YITT 4N4HA 2QHUA 4N4IA 1YFRA 4XK8E 2P4TA 3RMSA 2ALYA 2RHZA 4M78C 3QXEB 2C8MA 3OYMA 2E5QA 3OB9A 3JCMh 1KHCA 3NTIA 2A8EA 3JCMf 4J15A 4PJOA 2AHJB 2L3RA 1KQSA 4N4GA 4H02A 2PVGB 2ZZFA 3L2VA 4PKCC 2KAFA 2DTHA 1JB0E 1IZ6A 2IG0A 3PCOB 2MAMA 3G71A 3EFRA 4P5NA 4PJOB 3FC3A 3CCJT 1VQ7T 2RO0A 4P3NA 2LRQA 3SWNB 2P5IA 4Q5WA 2DXCA 1D3BB 3J80E 2RM4A 3CCJA 2D0QB 4JRKA 5CQYA 2JOYA 4OP0A 4L87A 3MEYA 2ZGWA 3CCQT 2LVMA 11ASA 4JRQA 1VQ5A 3M56A 1P92A 2F69A 3HSBA 1KMMA 4CS3A 3CCUA 1U8RA 3P8VA 1K73U 4RQEA 4VUBA 4DPGA 2P0LA 3DKMA 2XTIA 3A8HB 4EDUA 2ARUA 2AKWA 3NEMA 4HT9A 2CGHA 3CD6T 2HNIA 3KUFA 1USYC 1H4QA 5CKBA 4M77G 3NELA 4JUVA 4TTVA 3E9IA 2DEQA 1VQNA 1EOVA 1JBMA 4HWRA 3OMCA 5J26A 2EL9A 1B76A 5HKCA 2HAXA 4TVAB 2ZT5A 2NLUA 4GLKA 3PIOA 1QF6A 3HFOA 2DDZA 4YPFA 3LGFA 1KG1A 3NTKA 1EIFA 1FXXA 4M7AG 3QO3A 4YRGA 4QQGA 5GAN4 2K57A 4KBMB 4E7KA 3JB9H 5LJ5d 3AHUA 2ZT7A 4H2WA 4PJOD 3CC7T 3MEVA 1C0AA 4HA8A 4M77B 4CH6A 3G4SA 2ARTA 4MMLA 1Y96B 2FB7A 4EO4A 2IVWA 2XK0A 5DLQE 5GAMf 4C92C 3CC2T 2WSCE 3HY0A 4BB7A 4D6WA 1PSFA 4DA4A 2EAYA 2YLBA 2XICA 1BI3A 3HXYA 2K5IA 1YBYA 4M7AB 3C4SA 4X9CA 3RERA 2ZPGB 2RHSA 1NNHA 2K5FA 4WJ4A 4ELZC 2JTMA 4OF1A 3I55A 3VU3C 4E7HA 4ZTFA 4C92F 2DKGA 4LDWA 4M75A 3VKIA 4C8QE 3PNWC 4BD3A 4FIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1A A;  4M78 D;  4RCB A;  5GAN h;  3NET A;  4M78 B;  3V7R A;  3JCM J;  1GGM A;  1WLE A;  2E10 A;  4ZTZ B;  1B8A A;  3JCM P;  3UH0 A;  2Q5H A;  4M7D G;  3RAC A;  2EWN A;  3RL6 A;  4YRM A;  5GAN f;  2XGT A;  4YRR A;  2ZZG A;  1ADJ A;  4TQF A;  4EX5 A;  3QO8 A;  3TEH B;  1B34 A;  4CH5 A;  4F7U E;  3M4P A;  1NJ5 A;  2EJF A;  3FB9 A;  3PCO A;  3V8K A;  4K87 A;  4P75 A;  4WI1 A;  3WQZ A;  4C8Q B;  2Q7G A;  4HT8 A;  4Q6G A;  3SWN A;  4M77 D;  3HY1 A;  4KR2 A;  5GMK h;  4X9D A;  3IG2 A;  4H2V A;  3HXX A;  4F7U F;  5GAO r;  2DXU A;  3JB9 J;  2VXE A;  4MMK A;  1BBU A;  5DY9 A;  1IL2 A;  2E1H A;  4M75 B;  4X5O A;  3SWN C;  4M75 E;  3QTC A;  4JRI A;  5GAN 3;  4PJO E;  3P8Y A;  2ODR C;  1RIQ A;  3L4G A;  3A74 A;  4P75 C;  3HXU A;  4EMK A;  5LJ3 j;  1QE0 A;  3QUI A;  4J6W A;  5LJ3 h;  1TH7 A;  2ZIM A;  4V2S A;  3M4Q A;  3JB9 D;  3L4G B;  4C8Q C;  4C8Q F;  4C8Q G;  3BDU A;  4XQ3 A;  2YLC A;  2RHQ A;  4P72 C;  4P74 A;  4ZTU B;  2ZIN A;  4CH3 A;  3RUX A;  1ASY A;  5LJ5 j;  1NYR A;  4C92 E;  4M75 C;  2I4L A;  2ZTG A;  1HK9 A;  4J6X A;  4M77 C;  4K86 A;  3HTZ A;  2ZT8 A;  4XEO A;  1H4T A;  3LC0 A;  1JJC A;  3VBB A;  5GAN 6;  1BIB A;  1YGB A;  1Z7N A;  2ALY B;  4YRE A;  3V7S A;  3JCM e;  5CAI A;  4RMF A;  3LSQ A;  5ELO A;  3JB9 F;  5GAM h;  2ZT6 A;  2DU5 A;  4NOY A;  4H2S A;  1L0W A;  1LNX A;  3RKX A;  4YRJ A;  2RA2 A;  1EVK A;  2RB6 A;  3KFU A;  1Z7M A;  1SER A;  1SET A;  5K1X A;  2Y90 A;  3IKL A;  1SES A;  4YRL A;  3EFS A;  4PG3 A;  1B7Y A;  5GAN 2;  3REX A;  1PYS A;  1E24 A;  1NYQ A;  1KOG A;  1EQR A;  3UFG A;  4BW9 A;  4HVC A;  3BY7 A;  5GAO l;  5GAM e;  4UP8 A;  4OLF A;  4F7U G;  4P73 C;  4M78 E;  4KQE A;  4PHC A;  4CS2 A;  4M7A E;  3NEN A;  4YRT A;  5C51 B;  3SB2 A;  4XU1 A;  3HFZ A;  2E65 A;  1WPY A;  4M7D C;  1D3B A;  4P73 A;  2AKW B;  4M78 G;  4P71 C;  3ERR A;  2DQ3 A;  1USY A;  3HFZ B;  4P74 C;  4JLI A;  4P72 A;  4XTX A;  3RKW A;  2DVE A;  4RDX A;  3JCM c;  5GAN g;  1WNL A;  3VQW A;  3OD1 A;  4XU3 A;  1U1T A;  2DZ9 A;  2DTO A;  5LJ5 e;  4M7A C;  2PMF A;  3CMQ A;  2RHQ B;  1J5W A;  4WJ3 M;  1X54 A;  3FIF A;  4M77 E;  1FYF A;  3HXW A;  5GAO m;  3P8T A;  4YDQ A;  4XTV A;  4QVC A;  1YB3 A;  1WYD A;  4XEM A;  3QO5 A;  4J5Y A;  1NJ6 A;  5ELN A;  2J3M A;  2JN0 A;  2DXT A;  3QNE A;  3M4G A;  2J3L A;  5GMK i;  5LJ5 f;  2C7I A;  1YFS A;  3JB9 I;  3A7U A;  3LSS A;  1E1T A;  5LJ3 d;  3HFV A;  4O2D A;  3G1Z A;  4M7D A;  2Q7E A;  1G5I A;  4EMK B;  2VC8 A;  4C92 B;  5C52 B;  1ADY A;  4PNO A;  3MF1 A;  4PJO C;  2CJA A;  4RCC A;  3RES A;  1HXD A;  1X2G A;  1H64 1;  2DQ0 A;  5GMK l;  2QHU A;  1YFR A;  2ZZE A;  4F7U A;  3JCM g;  5GAN 5;  2ALY A;  2Q7H A;  2QTX A;  4G84 A;  1M8V A;  3UGT A;  4M78 C;  2PME A;  2Q5I A;  2C8M A;  4M7D D;  4PJO G;  2ZCE A;  4TVW A;  1ASZ A;  1YFT A;  3JCM h;  1WU7 A;  4YRN A;  3JB9 G;  5LJ3 e;  4M7D F;  3JCM f;  4Y91 A;  5GAO n;  4J15 A;  2I4M A;  4PJO A;  3BJU A;  4TVY A;  3VQX A;  1BBW A;  2CJB A;  2EJ9 A;  3V7C A;  2G4C A;  3ICA A;  3IKM B;  1LJO A;  4H02 A;  4P3P A;  4NL3 A;  4CH4 A;  5E3I A;  1X55 A;  2QHV A;  1B7Y B;  3FJP A;  3JCM d;  4NL2 A;  2ZZF A;  4P3O A;  4TWA A;  3E9H A;  3HRI A;  1X2H A;  4M7A F;  5GAN e;  4UP7 A;  5GAM g;  3TEH A;  1EFW A;  3JCM V;  2DTH A;  4N0A C;  4HWP A;  3PCO B;  4C92 D;  4BWA A;  3EFR A;  4PJO B;  4C8Q A;  4G85 A;  4P3N A;  5LJ3 g;  3IAL A;  1EIY A;  2ZNJ A;  3V8J A;  1JJC B;  3PGG A;  3TEG A;  3SWN B;  1G51 A;  2IY5 A;  5GMK m;  4M75 G;  2P5I A;  4HWO A;  1D3B B;  1N9R A;  3JCM Q;  2ZXF A;  2YHT A;  1HTT A;  2RM4 A;  1B70 A;  3GIB A;  3A5Z A;  4YRC A;  4M7D E;  4H2X B;  4JRK A;  5GMK j;  2ZIO A;  4C92 A;  4OP0 A;  2CIM A;  2AMC B;  4M77 F;  4XTU A;  3DSQ A;  3MEY A;  4L87 A;  1VQZ A;  3HRK A;  3A7R A;  2I4O A;  2ZGW A;  4UPA A;  11AS A;  3REU A;  3BW1 A;  4XU0 A;  1B34 B;  3HSB A;  1KMM A;  3HXZ A;  5HGQ A;  4CS3 A;  2CJ9 A;  2ODR D;  3P8V A;  3A31 A;  3W3S A;  2RD1 A;  4XTW A;  4WF2 A;  4RQE A;  1Y96 A;  5KNN A;  4DPG A;  1B70 B;  2ZR2 A;  5K1P A;  4LNS A;  4J6Y A;  2P0L A;  3BFM A;  5GAN 8;  2E3C A;  2XTI A;  5F5W A;  2ZR3 A;  1BIA A;  2ARU A;  2VXF A;  2AKW A;  1M5Q 1;  3PZC A;  3NEM A;  4HT9 A;  2CGH A;  1NJ8 A;  4YRF A;  4H2T A;  4YRQ A;  2HNI A;  1USY C;  3QHS A;  4M7D B;  3V8L A;  4YYE A;  1H4Q A;  5GMK e;  4HWS A;  1E1O A;  1U1S A;  4M77 G;  3NEL A;  4YCV A;  4JUV A;  1KMN A;  3HXV A;  4M78 A;  5GAN 7;  4M75 F;  3E9I A;  4TTV A;  3UGQ A;  12AS A;  2DEQ A;  2E5A A;  1EOV A;  1JBM A;  1LYL A;  1LOJ A;  4HWR A;  1WQ7 A;  2ARS A;  2EL9 A;  2IY5 B;  4EMG A;  1I8F A;  2ZNI A;  4F7U B;  5GAO q;  3VQY A;  1B76 A;  4M77 A;  2RHS B;  1E22 A;  4TVA B;  2QHS A;  2ZT5 A;  4XTY A;  3R07 A;  2DZC A;  4P71 A;  3L2Z A;  1H4S A;  5LJ5 h;  1QF6 A;  3HFO A;  1X01 A;  3QO7 A;  3RF1 A;  2DDZ A;  4YPF A;  4TQD A;  3QSU A;  4H2U A;  5C53 B;  4YRK A;  5LJ5 g;  4TVA A;  5I21 A;  3RGL A;  3A32 A;  4M7A G;  3QO3 A;  4YRG A;  5GAN 4;  1N9S A;  2K57 A;  4YCW A;  3JB9 H;  5LJ5 d;  3AHU A;  4KR3 A;  2ZT7 A;  3A7A A;  4C8Q D;  1I5L A;  4PJO D;  4H2W A;  4RQF A;  5GAM d;  1C0A A;  3JCM X;  4HA8 A;  1KQ1 A;  4M77 B;  4CH6 A;  2ART A;  4MML A;  2AMC A;  4YCU A;  4E51 A;  1EIY B;  1Y96 B;  3TUP A;  3VQV A;  2FB7 A;  4EO4 A;  3JCM b;  3JCM W;  4M78 F;  2I2L A;  2E64 A;  5GAM f;  1WQW A;  3INZ A;  4XTZ A;  4C92 C;  3HY0 A;  1NJ2 A;  3HFN A;  1I81 A;  4XU2 A;  4M75 D;  1JRI A;  1W66 A;  4YP0 A;  1YCY A;  5GAO p;  4H2X A;  5GAN d;  1NJ1 A;  2EAY A;  4ZIB A;  4PJO F;  1MGQ A;  4YRO A;  1N9W A;  4YRS A;  2FYK A;  1I4K 1;  2DJZ A;  1HC7 A;  2YLB A;  1H4V B;  1KQ2 A;  4M7A D;  3HXY A;  5LJ3 f;  4M7A B;  1G5H A;  4EMK C;  4YRP A;  2DU7 A;  4K88 A;  4H2Y A;  4X9C A;  3RER A;  4C92 G;  5GAN j;  4N0A A;  4UP9 A;  2RHS A;  4A54 A;  4A53 A;  4EMH A;  1NNH A;  3RIR A;  1X56 A;  4DQ2 A;  4NCX A;  4M7A A;  4WJ4 A;  3VU3 C;  2QHT A;  3A5Y A;  4HWT A;  1ATI A;  1EVL A;  3I7F A;  4CS4 A;  2DTI A;  2E41 A;  4C92 F;  2DKG A;  4QVD A;  5GAM j;  1SRY A;  4M75 A;  4YRI A;  2I4N A;  4Q15 A;  1PYS B;  2EJG A;  4AH6 A;  3MF2 A;  4C8Q E;  3RKY A; 
#chains in the Genus database with same CATH topology
 1QCO A;  6AT1 B;  2CP2 A;  3JCM J;  3E2U A;  1I5O B;  1TG0 A;  2E10 A;  1KFZ A;  3JCM P;  2ZPH B;  1UGQ B;  2M0O A;  2XID A;  2AKK A;  2RHY A;  2SRC A;  3H0I A;  1ZX6 A;  1G3T A;  2E70 A;  2NUP B;  5CKD A;  4YRM A;  2KQW A;  3RBB B;  3I35 A;  1YIJ T;  1DJ7 B;  3OW2 A;  2DJQ A;  1OPK A;  4CRI A;  3EG9 A;  5IHK A;  3OYH A;  2Z0W A;  1MNE A;  1NE8 A;  1W2B A;  4CH5 A;  5A0G A;  5FRO A;  2L3P A;  2HD0 A;  7AT1 B;  3FB9 A;  5FWC A;  2J06 A;  3V8K A;  3WQZ A;  5A0L A;  4DEY A;  3HY1 A;  1YNZ A;  4QT7 A;  1UUE A;  4J9B A;  5FRM A;  3HXX A;  1G2B A;  4FYV B;  2C0O A;  4ZN3 A;  3A8G B;  5DY9 A;  2O9S A;  4F14 A;  1RAF B;  2E1H A;  2J7I A;  3CMA T;  4J9G A;  3CCM T;  3QTC A;  4M75 E;  4JRI A;  4PJO E;  1QCF A;  3A74 A;  3OS1 A;  2VV5 A;  5LJ3 j;  2M9U A;  1YCS B;  2QG9 B;  2V8J A;  4B6M A;  3JB9 D;  1VQO A;  3L4G B;  2JVV A;  1SPK A;  4C8Q C;  2O2O A;  2D0N A;  2OAU A;  3BDU A;  4ZTU B;  2CS7 A;  4CH3 A;  3RUX A;  2E6N A;  4ZN1 A;  4M75 C;  4FCY A;  2KI7 A;  2I4L A;  4HCB A;  1Y7X A;  4K86 A;  1OX9 A;  2PTK A;  4J9D A;  1H4T A;  1JJC A;  1GCQ C;  4FW1 A;  5I2S A;  4M4Z A;  2HKN A;  1VYV A;  2MWO A;  3JCM e;  3F70 A;  2M16 A;  2EIF A;  5GAM h;  3GNF B;  2DU5 A;  1QVF S;  1L0W A;  2V8I A;  3C0C A;  5A2Q E;  1WLP B;  2ZPE B;  4D8K A;  3FJ5 A;  2RB6 A;  2HSP A;  1K0X A;  1SSF A;  1ZSZ C;  2M51 A;  5IAY A;  3M55 A;  3OYF A;  1OU9 A;  4JS5 A;  1E24 A;  4QKU A;  2OAW A;  4J9C A;  1EQR A;  4HVC A;  3GP8 A;  5KCH A;  4UP8 A;  3VUZ A;  1YIJ Q;  3EGX A;  1WXT A;  3M0S A;  5CVI A;  1AZG B;  2DXB A;  3CCS A;  4M7A E;  1MHN A;  2BZY A;  2YRD A;  2DEU A;  5M9O A;  4PLI A;  4HCZ A;  1Q81 C;  2LMJ A;  3CCS Q;  3HFZ B;  4P72 A;  4GLM A;  1KD1 U;  2KRO A;  3M4Y A;  1Q82 U;  4RG8 A;  1WNL A;  3H9N A;  3VQW A;  4RTX A;  2QEX T;  2YXY A;  1U1T A;  2DFU A;  2VUB A;  3M5A A;  2J05 A;  3CD6 Q;  4ZGD B;  3QII A;  3JV3 A;  1PWT A;  1ZLM A;  1X54 A;  1FWZ A;  4M77 E;  5GAO m;  4EPC A;  2PNI A;  1WHM A;  1WZO A;  4QVC A;  3QO5 A;  1NJ6 A;  4E47 A;  1KQS S;  2DXT A;  1Q81 U;  2NUP A;  4HVU A;  1FMV A;  1S1N A;  2YSQ A;  4Z8A A;  3LSS A;  3RNJ A;  2O01 E;  5KYX B;  3NPF A;  4LVL A;  1OOT A;  5D7U A;  1Q82 C;  3EG9 B;  3THK A;  1Y71 A;  2V1Q A;  2QYZ A;  1QLY A;  3NHN A;  1ADY A;  1VQ8 A;  2OTJ Q;  2ZCF B;  3CCR A;  1MMN A;  3NFC A;  1H64 1;  5HK3 A;  1K8A R;  8AT1 B;  1O75 A;  2QDY B;  1BCO A;  3JCM g;  5GAN 5;  2Q7H A;  4G84 A;  2H8H A;  2PME A;  2WSF E;  3C95 A;  3VS7 A;  4PFO A;  2BKD N;  2D9T A;  1O9S A;  1ZUU A;  3REA B;  2RF0 A;  4OML A;  3H0F A;  4LVJ A;  1AWW A;  3QKJ A;  2FHD A;  3PVQ A;  1WU7 A;  2J6K A;  2IIM A;  1WA7 A;  4BDZ A;  3OYK A;  1VQK A;  3NMZ C;  4JRP A;  2CJB A;  2GGR A;  3V7C A;  4FT4 A;  4KRT A;  4F16 A;  2A37 A;  3IKM B;  1LJO A;  2SEM A;  2O4X A;  4CH4 A;  5E3I A;  1B7Y B;  3JCM d;  3E9G A;  1WIE A;  3E9H A;  4M7A F;  5GAN e;  3X26 B;  3JCM V;  3WVD B;  4N0A C;  2L0A A;  2DAQ A;  4C8Q A;  5LJ3 g;  3IAL A;  1JJC B;  3TEG A;  3PGG A;  2IY5 A;  4M75 G;  2EQM A;  3GLX A;  3M0P A;  3QPH A;  3CCE Q;  2ZXF A;  2YHT A;  2HBW A;  2O9V A;  1RAD B;  3I5S A;  4M7D E;  5GMK j;  1QP2 A;  4OGE A;  1UHF A;  4M77 F;  2Y4X A;  4XTU A;  2AMC B;  2R5M A;  2XHC A;  3A7R A;  1M4Z A;  2D8J A;  2I4O A;  4UPA A;  2H3J A;  3MHX A;  1BYM A;  3MP1 A;  4XU0 A;  4J83 A;  1B34 B;  1QVG A;  5HGQ A;  2RJC A;  5IXF A;  2RD1 A;  4E7L A;  3KBG A;  1HYO A;  1VIE A;  4WF2 A;  1X27 A;  1VQ6 T;  5KNN A;  4LDV A;  3CPW S;  2ZR2 A;  1WFW A;  4J6Y A;  2O88 A;  2E3C A;  1JXM A;  2XDP A;  1OEB A;  3G6E A;  1VQK T;  3OA6 A;  1M5Q 1;  3PZC A;  1ZSZ A;  1NJ8 A;  4H2T A;  3H8Z A;  3RR6 A;  2BUD A;  4E7Z A;  4KGX B;  2CKK A;  3QHS A;  4BI8 B;  2OTJ A;  4YYE A;  1NLO C;  2DL3 A;  1YHQ T;  2VGM A;  2KE9 A;  1IHW A;  1WHK A;  1QQJ A;  4FT2 A;  2D1X A;  3UGQ A;  3HXV A;  5GAN 7;  2P0K A;  5J39 A;  3UAT A;  2V8K A;  1IGU A;  1LOJ A;  4XAX B;  1WQ7 A;  2MI6 A;  2X3W D;  4GBQ A;  3X24 B;  5CQX A;  4EMG A;  2ZNI A;  4F7U B;  1W1F A;  2JXB A;  1NZ9 A;  2QK0 A;  3OYA A;  3GF5 A;  2RHS B;  2PQW A;  5J3B A;  3R07 A;  1KIK A;  3L2Z A;  2RH2 A;  3SEM A;  2HL3 A;  5LJ5 h;  1HSQ A;  1X01 A;  2QTV A;  4TQD A;  4H2U A;  3HRS A;  1K9M C;  5C53 B;  1B3Q A;  1MUZ A;  3LW5 E;  4KUD K;  4YRK A;  4MDW A;  2G3R A;  4BUG A;  3RGL A;  2KY9 A;  3QBY A;  1KJW A;  3BE3 A;  3ME9 A;  1BCM A;  1IRX A;  4AFZ C;  3OYB A;  4YCW A;  2CP3 A;  1UEC A;  4KR3 A;  4RQF A;  2NWM A;  2COZ A;  3HTR A;  3PVL A;  4K11 A;  1EIY B;  1G5V A;  3VS2 A;  1WYX A;  4Z02 A;  2EFI A;  4F04 B;  3JCM W;  1AZE A;  1JXO A;  5C0M A;  4O6J A;  4KH1 B;  4BI4 A;  1R77 A;  4YTL A;  2E64 A;  2AZV A;  1WQW A;  1K9M U;  1Q7Y C;  2OTL A;  3DB4 A;  1NJ2 A;  4X1V A;  1I81 A;  1AWJ A;  1JRI A;  4AMC A;  1YCY A;  4H2X A;  2CT4 A;  4YRO A;  5IHN A;  1N9W A;  1EFN A;  3EAE A;  1GFC A;  3OYE A;  3CD6 A;  2LQN A;  2RK2 A;  3EFO B;  2K2M A;  2MWP A;  2B8A A;  1MV3 A;  2DM1 A;  4BI3 A;  4Y28 E;  3CBO A;  5LJ3 f;  4OMP A;  2P0P A;  1G5H A;  5FU7 C;  1NYF A;  3MPU B;  2DU7 A;  4YRP A;  4FSX A;  3OYY A;  4H2Y A;  4C92 G;  5GAN j;  1Q95 G;  4A53 A;  2YUO A;  3RIR A;  1X56 A;  4DQ2 A;  4M7A A;  2HMA A;  4L6V 5;  2QAS A;  3P8H A;  1LVK A;  2QHT A;  4JZ3 A;  1MV0 B;  1MMD A;  1EVL A;  3OSS C;  4CS4 A;  1QVG S;  4Y92 A;  3CCQ Q;  3CBM A;  5A0D A;  1BKB A;  1KHI A;  3CPW P;  1VQ8 Q;  3MF2 A;  2DL7 A;  4LD9 K;  1KSW A;  4M78 D;  2CUB A;  2CZ1 B;  4RCB A;  3I56 T;  1QMC A;  1Q86 R;  4M78 B;  3V7R A;  4E7S A;  1GGM A;  1B8A A;  3C94 A;  4L59 A;  3ZEH A;  2X4W A;  1T3L A;  3VYG A;  3FEO A;  2H3E B;  3MCA B;  3RL6 A;  3M9Q A;  2XGT A;  2EKO A;  1R0C B;  5AT1 B;  1V1C A;  2ZZG A;  5AYF A;  4PFZ A;  1PRL C;  3PT9 A;  2QEX A;  3OMG A;  2DYB A;  1D1C A;  1B34 A;  1VYU A;  3G71 Q;  4R0K A;  2YT6 A;  3RMQ A;  3M4P A;  1NJ5 A;  2EJF A;  4KH0 B;  1NPR A;  1YIJ A;  3PCO A;  1M27 C;  3P8B B;  2RI3 A;  2Q7G A;  3PMT A;  3SWN A;  4KR2 A;  3EH2 A;  3HPW A;  4JLG A;  3IG2 A;  4H2V A;  2X35 A;  1ZSG A;  4F7U F;  5GAO r;  2D8H A;  2VXE A;  4IUT A;  2FRY A;  3LLR A;  2RHX A;  4B9X A;  3MEW A;  1IL2 A;  4QW2 A;  4A4F A;  3QDR B;  3VJP A;  3SWN C;  2CZ7 B;  3IQL A;  3P8Y A;  2ODR C;  4PJL A;  3HXU A;  1OU8 A;  3L2U A;  1WJS A;  2E3H A;  3M4Q A;  1X75 C;  4JJD A;  2DL8 A;  4C8Q G;  2QA4 T;  2YLC A;  2RHQ A;  4P72 C;  3G71 T;  1UDL A;  4BY6 B;  5LJ5 j;  1HJD A;  2XD0 A;  1NJI U;  1KC8 U;  2ZTG A;  3QJY A;  1NPP A;  1K8A C;  3M53 A;  1U3O A;  1ZHI A;  2HDA A;  3E1S A;  1KD1 R;  3QDF A;  2ZT8 A;  3LC0 A;  2EGE A;  4JS4 A;  1YGB A;  1BIB A;  1Z7N A;  2F5T X;  4C5H A;  2KK4 A;  2FL7 A;  1TOV A;  1JEG A;  2LTO A;  5ELO A;  3JB9 F;  4LDU A;  2ZT6 A;  4H2S A;  2QQS A;  5HK0 A;  4JDS A;  5GJW B;  1EVK A;  2F2X A;  1RAH B;  5K1X A;  1SES A;  4PG3 A;  2A28 A;  1ZUY A;  4ESR A;  2RI5 A;  2W10 A;  3FLG A;  1T0H A;  4BW9 A;  4RG2 A;  2DE0 X;  1VQN Q;  5GAO l;  2EQK A;  3QJ6 A;  2CP6 A;  8ATC B;  4JJN K;  1IB8 A;  1OZ2 A;  2GTO A;  1RI9 A;  3G7Z A;  4PHC A;  1M2V B;  3MO8 A;  1GCP A;  3HKS A;  1GXI E;  3NEN A;  3SB2 A;  2WAC A;  2D6F A;  1VQ6 Q;  2E65 A;  3EG3 A;  2XI9 A;  1WPY A;  4M7D C;  1Q81 R;  4P73 A;  4KT0 E;  4JLI A;  2HQE A;  4XTX A;  3PTA A;  3RKW A;  1E6G A;  3JCM c;  5GAN g;  1D09 B;  2VAS A;  1YHQ Q;  3OD1 A;  4XU3 A;  3MQZ A;  5ECA A;  4LVK A;  1Q7Y R;  2DTO A;  1UGR B;  2AT1 B;  2CH4 A;  1J3T A;  1SHG A;  2RHQ B;  4CC3 A;  1J5W A;  2XDD A;  2DMO A;  1FYF A;  1YB3 A;  2CT3 A;  1WYD A;  1H8K A;  3I56 Q;  3G4S T;  5ELN A;  1OYX A;  4C0G A;  3DLM A;  3M4G A;  4FW2 A;  5GMK i;  1UGV A;  1X43 A;  1XNI A;  4A63 B;  3A7U A;  1KD1 C;  5LJ3 d;  3HFV A;  4O2D A;  2EKH A;  2EQJ A;  2KDS A;  1VQ5 Q;  1GBR A;  2OTL T;  3EG2 A;  1K9M R;  1MMG A;  2CJA A;  4FYX B;  2GF7 A;  3C12 A;  2K9G A;  3QYH B;  5KYW B;  1HXD A;  3RDV A;  1X2G A;  3VS1 A;  1N8R R;  4R56 A;  2JM9 A;  1EZZ B;  2ZZE A;  4F7U A;  2L8D A;  3UGT A;  2BZX A;  4WCI A;  4CC4 B;  1PG5 B;  3P8D A;  4PJO G;  4LUD A;  2LCL A;  2VYT A;  4TVW A;  3VS6 A;  1VQK Q;  1YFT A;  2LQ8 A;  3TSZ A;  1N27 A;  2L3S A;  2VGN A;  2FZC B;  2QAZ A;  4AFS C;  2A08 A;  3OBY A;  1TUD A;  2MMP A;  1SSH A;  2QDL A;  4Y91 A;  5GAO n;  2JMC A;  2ZPI B;  2WSE E;  3BJU A;  3VQX A;  2E4H A;  1PCX A;  2KEA A;  1BBW A;  2EJ9 A;  1VA7 A;  3L2R A;  2VWF A;  1NG2 A;  4P3P A;  1K0S A;  2JZ2 A;  2GQI A;  2DIL A;  2PUO B;  4KUL A;  1X55 A;  2QHV A;  3JSC A;  4NL2 A;  4ZGE B;  4TWA A;  2LJ0 A;  1QKW A;  5IHI A;  1WX6 A;  3HRI A;  4ZTJ A;  1EFW A;  1VQO T;  3VS5 A;  4RTV A;  3EGX B;  4JZ4 A;  4DBQ A;  2BE9 B;  2R57 A;  2F5K A;  4HWP A;  1W2B S;  1AT1 B;  1WGS A;  3VS4 A;  3OS0 A;  1LPL A;  4G85 A;  1WHG A;  2NUT A;  5KE2 A;  3X28 B;  1C0M A;  3R6O A;  1G51 A;  3MP8 A;  4C0D B;  1K73 C;  2KR3 A;  1ARK A;  4LDY A;  2LX7 A;  4HWO A;  3T9N A;  1VQM A;  3EFO A;  1N9R A;  2RHU A;  1NLP C;  2KYB A;  3M0R A;  1HTT A;  2JW4 A;  1B70 A;  1M1K C;  2DX1 A;  4C5I A;  4EIK A;  1GCQ A;  3CQT A;  4C92 A;  2CIM A;  3KFV A;  1VQM Q;  2MIO A;  1VQZ A;  2OX7 A;  3L42 A;  4A4H A;  3G1J A;  4J8O A;  1AHJ B;  3REU A;  2XG8 D;  3E9F A;  4OB0 B;  4PJN A;  1YJ9 A;  3BW1 A;  1Z9Z A;  1VQL A;  1M3C A;  2W0Z A;  4DBH A;  2CRE A;  2CJ9 A;  2ZPF B;  3A31 A;  3W3S A;  4LDX A;  4XTW A;  3CMA Q;  1B70 B;  5CO7 A;  4LNS A;  5K1P A;  1VQO Q;  5GAN 8;  1QWE A;  3URG A;  4LD6 A;  2ZR3 A;  1BIA A;  2MCN A;  5I2M A;  2VXF A;  4R55 A;  5KH6 A;  4YRF A;  3CMA A;  1X2K A;  4YRQ A;  2X3X D;  5KYY A;  4ATO A;  2C06 A;  2KNB B;  4LN2 A;  3V8L A;  2OJ2 A;  4PK4 A;  3O8V A;  4DEX A;  1E1O A;  3TSW A;  2L3Q A;  3GBQ A;  4Z88 A;  3CCL Q;  1KMN A;  3GPL A;  2E5A A;  2VB6 A;  2ARS A;  1VQ8 T;  4OB2 B;  2IY5 B;  2F1L A;  1E7O A;  2A3L A;  5GAO q;  2LCS A;  4M77 A;  2R58 A;  2AZS A;  2JMA A;  1E22 A;  2QHS A;  1NEB A;  4MDX A;  1H4S A;  3HHT B;  4C0D C;  1JJ2 P;  3MEA A;  3DLL A;  1ABO A;  4RTT A;  5I21 A;  3M54 A;  4AFU C;  1YJN Q;  2XKO C;  4BDY A;  1IXD A;  2X9H A;  1FMK A;  3CME A;  1A0N B;  3A7A A;  3A1P A;  1VQ9 A;  2QQA A;  1PKT A;  2EVR A;  4YCU A;  5CKF A;  2CYZ B;  3OYI A;  2P84 A;  3VQV A;  1S72 A;  3JCM b;  4OMF B;  1VIF A;  2BIV A;  5KYN A;  2I2L A;  1X6O A;  2QGF B;  3INZ A;  4XTZ A;  2DYI A;  3LYI A;  4M75 D;  1UGP B;  1W66 A;  4YP0 A;  3M0Q A;  5GAN d;  4ZIB A;  4LVI A;  4YRS A;  3CCS T;  2FYK A;  2DJZ A;  1HC7 A;  1YJW T;  4AG1 C;  4FYY B;  2M0Y A;  4IKF A;  3CXC A;  4J9E A;  1PC0 A;  1KQ2 A;  1RAE B;  1OX8 A;  4E7I A;  3I55 Q;  4J7F A;  1VQ4 Q;  3I56 A;  4N0A A;  5KYU A;  4UP9 A;  4A54 A;  1M30 A;  2K7A A;  4EMH A;  3S3O A;  2FO0 A;  2RK1 A;  1M1F A;  4ANJ A;  1N5Z A;  2DA9 A;  3CPF A;  3A5Y A;  2DO3 A;  4HWT A;  1ATI A;  4X34 A;  3I7F A;  1JJ2 A;  2DTI A;  2E41 A;  3EH1 A;  1SRY A;  1G3Y A;  4YRI A;  2KT1 A;  2DF6 A;  4MZT A;  2I4N A;  4Q15 A;  2EJG A;  3UA7 A;  1V76 A;  2ROL A;  4BAC A;  4AH6 A;  2ZZD A;  2JJ9 A;  4J9H A;  3L1A A;  1SF9 A;  2KSS A;  4FU6 A;  1PKS A;  4PLL A;  5FU7 B;  4DOW A;  3LH0 A;  3TEE A;  2K3B A;  4ZTZ B;  2LX9 A;  3UH0 A;  3CCR T;  2Q5H A;  2BZ8 A;  5GAN f;  1NM7 A;  4YRR A;  1MMA A;  4FL6 A;  4ME7 A;  3VRZ A;  2DLP A;  1TWB A;  3I55 T;  3QO8 A;  5IXB A;  1R0B G;  1YIT Q;  3TEH B;  3CEY A;  3O5Z A;  4RMO A;  1YN8 A;  1WHL A;  4F7U E;  1VQ7 Q;  3EG1 A;  4DBF A;  3SDZ A;  4K87 A;  1VQ5 T;  2CZ6 B;  4HT4 A;  4NS5 A;  3SD4 A;  4C8Q B;  2DK3 A;  1RAB B;  3WXM B;  2PZ1 A;  4M77 D;  4ZNX A;  1UGS B;  2YRC A;  5EC7 A;  3LGL A;  4IUU A;  1VQ6 A;  2DXU A;  1WHJ A;  5D6W A;  4MMK A;  3G6E T;  4B9W A;  1ZBX A;  5DM7 R;  1YI2 Q;  3OSV A;  2EGA A;  5KYU B;  1KK7 A;  2FEI A;  4TVR A;  1RIQ A;  2MOX A;  4EMK A;  1QE0 A;  3QUI A;  3CC4 A;  1YI2 A;  2J6F A;  1QVF A;  1BI0 A;  5LJ3 h;  2MF2 A;  1Q86 C;  2ZIM A;  1CKA A;  3OQ5 A;  2HQX A;  4FSS A;  3OY9 A;  4C8Q F;  1Y57 A;  1SKU B;  1UHC A;  2EW3 A;  1TS9 A;  3AT1 B;  2EQU A;  1M8M A;  1C1A A;  3FDR A;  1YJ9 Q;  1VQL Q;  4J6X A;  3WVE B;  3ASK A;  4IUV A;  2O31 A;  3CXC P;  1SG5 A;  1UB4 A;  3CCL A;  3CCV T;  4JJB A;  3VV0 A;  2RJE A;  3L2Q A;  1VQP A;  4KGZ B;  2YUP A;  5I22 A;  1ACM B;  3G6E Q;  1Q86 U;  3OYG A;  2ED0 A;  2RA2 A;  3QWY A;  1SET A;  4OGC A;  4YRL A;  1HD3 A;  3UA6 A;  5GAN 2;  3REX A;  1AOJ A;  1NJI C;  2DD4 A;  1PYS A;  1YIT A;  3ULR B;  1KOG A;  2EYQ A;  2X4Y A;  3BY7 A;  3OYN A;  1VQ7 A;  3N5B B;  5GAM e;  1YJN A;  4OLF A;  1M90 R;  1SHF A;  2KRN A;  2E6Z A;  4M78 E;  4FYW B;  1VUB A;  4L5G A;  3CME Q;  3S3N A;  1S72 T;  1YWO A;  2ZPB B;  3CCV A;  4CS2 A;  3CCE T;  1VQN T;  2KYM A;  4YRT A;  5C51 B;  1G3W A;  5KE3 A;  1BI2 A;  1D1A A;  3UT1 A;  1WDX A;  1D3B A;  2JS2 A;  5CKE A;  3CCV Q;  4P71 C;  3CC4 T;  2LCC A;  2PVD B;  4P74 C;  2G6F X;  4ZGJ B;  2DVE A;  5KCO A;  2PVO B;  3QZ5 B;  2QQB A;  1D1B A;  5IH2 A;  4C0F A;  2LZ6 B;  3LH5 A;  5LJ5 e;  4M7A C;  3CMQ A;  2GFA A;  2QXF A;  4WJ3 M;  3S6W A;  2M1H A;  2RJF A;  2KT8 A;  2DET A;  3HXW A;  4A4E A;  4XEM A;  3MKD A;  1WXU A;  2JN0 A;  1VQP T;  1YWP A;  3HRT A;  3QNE A;  2J3L A;  2RQV A;  5LJ5 f;  2C7I A;  1JO8 A;  1YFS A;  5C6S A;  1E1T A;  1VQM T;  1FYN A;  2NUT B;  4HCK A;  3TVT A;  3HL8 A;  4HVV A;  4ELY C;  2ROT A;  4HKE A;  3JAM E;  2BTT A;  2DQ0 A;  5GMK l;  4LVM A;  2QTX A;  1M8V A;  2V1R A;  2Q5I A;  3A8M B;  1PM3 A;  2CZ0 B;  2XU8 A;  5I11 A;  4M7D D;  2ZCE A;  1GFD A;  2YRV A;  1ASZ A;  3LWH A;  3KXT A;  3CPW A;  3D7S B;  4IUQ A;  4YRN A;  3JB9 G;  5LJ3 e;  1OZ3 A;  4A4G A;  4M7D F;  3L2W A;  3PIP A;  3CC7 A;  2I4M A;  4J9F A;  4TVY A;  2NS6 A;  3A8L B;  2G4C A;  1ABQ A;  2K79 A;  3FRN A;  2IPO B;  3ICA A;  1KC8 R;  1WJR A;  4NL3 A;  1M1K U;  1X2Q A;  4RUG A;  3FJP A;  5HCK A;  4P3O A;  3G4S Q;  1X2H A;  4GY5 A;  3X20 B;  1QVP A;  4UP7 A;  5GAM g;  1OI1 A;  3TEH A;  4II1 A;  1F1B B;  1W4S A;  2LJ1 A;  1K76 A;  2KVQ G;  4C92 D;  4BWA A;  3JRZ A;  1M9S A;  1EIY A;  3H6Z A;  2ZNJ A;  3V8J A;  2XDB A;  1BI1 A;  2OTL Q;  5FLX E;  5GMK m;  1PD0 A;  2O4X B;  3U23 A;  5KYW A;  1YI2 T;  3JCM Q;  2K5L A;  4IIO A;  3VS3 A;  2L2P A;  1QW1 A;  1KQS P;  3GIB A;  1U5S A;  1OQK A;  3A5Z A;  4YRC A;  4PFP A;  4H2X B;  3GNG A;  3CBP A;  2ZIO A;  1TUG B;  3DSQ A;  2A0F B;  2FRW A;  3HRK A;  2QGG A;  2E12 A;  4ORZ A;  1V29 B;  1B07 A;  1H92 A;  4IUR A;  3HXZ A;  2GQV A;  4JJC A;  2FG0 A;  2ODR D;  1MND A;  1M1G A;  3LX7 A;  5FRN A;  1QVG P;  2RHI A;  2FVU A;  1H3Z A;  2NYS A;  3CCQ A;  3CCM A;  1Y96 A;  3MEU A;  1IO6 A;  4MZM A;  3BFM A;  2FZK B;  4C5G A;  2YUQ A;  4BE1 A;  1M3B A;  2QA4 Q;  5F5W A;  2GFU A;  3UWN A;  2K2V A;  3EGD B;  1G3S A;  4M7D B;  5GMK e;  4HWS A;  1U1S A;  1PSE A;  4KUI A;  3SHW A;  4YCV A;  3S3M A;  4PJJ A;  4M78 A;  4M75 F;  3OYJ A;  12AS A;  2A36 A;  9ATC B;  1LYL A;  2HCK A;  3HP9 A;  1I8F A;  4RKU E;  3CCL T;  2QQR A;  3VQY A;  3DB3 A;  1UEB A;  4RTY A;  1BK2 A;  2AIR B;  3VUB A;  3M58 A;  2RQT A;  1K4U S;  4XTY A;  1M2V A;  1ZSZ B;  2DZC A;  4P71 A;  5D6Y A;  1QKX A;  3CME T;  5HY6 A;  3QO7 A;  1ZUK A;  4CI0 C;  3RF1 A;  1VQ9 T;  3QSU A;  2LP5 A;  5LJ5 g;  4TVA A;  2JS0 A;  3UDC A;  2LT1 A;  3A32 A;  2RJD A;  4BE2 A;  1FMW A;  2ZAE A;  1N9S A;  1Q82 R;  1X6G A;  2DVJ A;  2LDM A;  3OYC A;  2K3Y A;  5CK9 A;  1GL5 A;  5IT9 E;  2CH4 W;  2QEX Q;  3A5Z B;  4C8Q D;  1I5L A;  2A7Y A;  1UTI A;  4MZP A;  5GAM d;  3JCM X;  1M90 C;  2RQW A;  1KQ1 A;  1YJN T;  2AMC A;  5FU6 C;  4E51 A;  1YJ9 T;  1VQL T;  1GRI A;  2PUK B;  3TUP A;  2RNA A;  2HBP A;  1ZA2 B;  4RTZ A;  1NJI R;  5L8R E;  4M78 F;  3TU4 K;  3TRE A;  4BY6 C;  4O5V A;  3ZFJ A;  1JQQ A;  2ABL A;  5EG2 A;  3HFN A;  4XU2 A;  4KGV B;  1RUW A;  2NUZ A;  5GAO p;  1FX7 A;  1ZA1 B;  3M59 A;  1NJ1 A;  4PJO F;  1MGQ A;  2J6O A;  2YWW A;  1I4K 1;  1NBE B;  2VKN A;  1H4V B;  4M7A D;  1IRE B;  1M90 U;  4IUP A;  4EMK C;  4K88 A;  2AK5 A;  3BDL A;  5CKH A;  1TTH B;  4DBR A;  1RLQ C;  2CSQ A;  3CC2 A;  1WI7 A;  2MYS A;  4NCX A;  1XQH A;  3NGP A;  3H41 A;  1Y07 A;  1Q7Y U;  1UFF A;  2MK5 A;  2DBK A;  4QVD A;  2KMT A;  5GAM j;  1AWO A;  2DL5 A;  2KXC A;  1PYS B;  2ESW A;  2FPD A;  4QQ6 A;  1X6B A;  5CCA A;  4LNP A;  3RKY A;  3QZ9 B;  1NEG A;  2QA4 A;  5GAN h;  3NET A;  1RI0 A;  5LL6 S;  1N8R U;  2JTE A;  1WLE A;  4J9I A;  3OYL A;  2LT4 A;  4DOV A;  2CDT A;  3QYG B;  3M57 A;  5CIU A;  2X4J A;  2X4X A;  4M7D G;  3RAC A;  2EWN A;  2V26 A;  5FW9 A;  1PD1 A;  1BU1 A;  2RN8 A;  4A4K A;  2DIQ A;  2M02 A;  1QP3 A;  3A8O B;  1ADJ A;  4TQF A;  2LC4 A;  4EX5 A;  4OB3 B;  3EHR A;  3CC7 Q;  1VQ9 Q;  3HRU A;  3X25 B;  1N6A A;  2BE7 D;  2GNC A;  1YJW Q;  1OUL A;  1YP5 A;  4C0Z A;  1LCK A;  4P75 A;  4BE0 A;  1N8R C;  2LNV A;  4WI1 A;  1QWF A;  2DPP B;  3OBW A;  5CR2 A;  3EGU A;  2KRS A;  2GBQ A;  2QQ9 A;  4HT8 A;  4Q6G A;  2I0N A;  5GMK h;  4OB1 B;  4X9D A;  3TQ7 P;  1I0C A;  3VRY A;  3CCJ Q;  4E6R A;  2DRM A;  4WTO B;  3VS0 A;  3JB9 J;  1XJW B;  1OPL A;  3UF4 A;  1BBU A;  1KC8 C;  1BBZ A;  4OMM A;  1QCN A;  4OMQ A;  1M1K R;  2Y4Y A;  4M75 B;  4X5O A;  3MJX A;  3OS2 A;  5GAN 3;  1YHQ A;  3L4G A;  4P75 C;  3SFM A;  2B86 A;  1B7T A;  1W2B P;  1VQ4 A;  3MET A;  3VYH B;  4J6W A;  1TH7 A;  4V2S A;  3PMI A;  4AFQ C;  1SRL A;  3CCR Q;  2K4Y A;  2L89 A;  4XQ3 A;  4HCC A;  4P74 A;  2ZIN A;  1ASY A;  3E19 A;  3OYD A;  2DL4 A;  3ER0 A;  4E7J A;  1NYR A;  2JNG A;  2COW A;  4C92 E;  3I5R A;  1HK9 A;  3MP6 A;  1RL2 A;  4M77 C;  3HTZ A;  1IGQ A;  3Q1J A;  2GCX A;  4XEO A;  1AD5 A;  2P0Q A;  1AWX A;  1M3A A;  3VBB A;  4OMO A;  4C5E A;  5GAN 6;  2ATC B;  2ALY B;  4YRE A;  3V7S A;  4RMF A;  5CAI A;  2RQU A;  1JJ2 S;  3LSQ A;  4UC4 A;  4NOY A;  1LNX A;  3RKX A;  2DBM A;  4YRJ A;  4QVZ A;  2CP7 A;  5FWB A;  1Z7M A;  3KFU A;  2C0I A;  2JTF A;  5DLO A;  3GOX A;  1SER A;  3QG1 A;  2Y90 A;  3IKL A;  1BB9 A;  3EFS A;  1B7Y A;  3CCU T;  2RI2 A;  1NYQ A;  1K8A U;  3UFG A;  5D6X A;  4AT1 B;  4PL6 A;  4F7U G;  2OTJ T;  4P73 C;  3TCJ A;  5IN1 A;  4KQE A;  3OW2 S;  2PU9 B;  1I1J A;  2EYX A;  4XU1 A;  3HFZ A;  4PJM A;  2L5Q A;  3PFS A;  4D8D A;  3UPU A;  1RAI B;  1S72 Q;  2AKW B;  4M78 G;  3R6N A;  2LQW A;  2DD5 A;  2DQ3 A;  3ERR A;  1VQ4 T;  3OS5 A;  1USY A;  3J7A F;  1YJW A;  2EQI A;  2JUF A;  1Y0M A;  2LQK A;  2LNH B;  4RDX A;  3ZBD A;  2HZY A;  4HVW A;  2DIG A;  4RTU A;  1TSF A;  2DZ9 A;  2K3X A;  2RPN A;  1QVF P;  1EX4 A;  2FPE A;  1K1Z A;  1UE9 A;  2PMF A;  1D0Z A;  1WJQ A;  3J81 E;  3FIF A;  1C6V X;  4LE9 A;  3P8T A;  2DER A;  4YDQ A;  4XTV A;  5FU6 B;  4J5Y A;  3CCE A;  2J3M A;  4FM4 B;  1TXQ A;  1XTD A;  3LWI A;  1R8O B;  3JB9 I;  3CXC S;  3G1Z A;  1AEY A;  3NTH A;  2F2W A;  2FPF A;  4CC2 A;  1RAG B;  4QQD A;  1XOV A;  1ZQ1 A;  4J7I A;  2R5A A;  4M7D A;  2Q7E A;  1G5I A;  1TUC A;  4EMK B;  2VC8 A;  4OVA A;  4C92 B;  5C52 B;  2EBP A;  4PNO A;  3MF1 A;  4PJO C;  2QI2 A;  4RCC A;  5KYX A;  2EYZ A;  3RES A;  2XMF A;  1YIT T;  3QWX X;  4N4H A;  2QHU A;  4N4I A;  1T0J A;  1YFR A;  3EHQ A;  4XK8 E;  5KYY B;  3CC2 Q;  2P4T A;  3RMS A;  2ALY A;  2RHZ A;  4M78 C;  3QXE B;  2C8M A;  3OYM A;  2HEQ A;  2E3I A;  2E5Q A;  3OB9 A;  1D0Y A;  3JCM h;  1KHC A;  3NTI A;  4JPB W;  2YUN A;  2VVK A;  1T3S A;  2A8E A;  3JCM f;  1K73 R;  4J15 A;  1NYG A;  1UG1 A;  4PJO A;  2AHJ B;  4F17 A;  1ZBJ A;  3ZL7 C;  2L3R A;  1KQS A;  4N4G A;  4H02 A;  4AG2 C;  2CSI A;  1U06 A;  2PVG B;  2HL5 C;  1PRM C;  2ZZF A;  4Z89 A;  3L2V A;  4PKC C;  1RAC B;  2KGT A;  2KAF A;  1UJY A;  2DRK A;  2DTH A;  1JB0 E;  2GTJ A;  1IZ6 A;  2IG0 A;  2MAM A;  3PCO B;  3G71 A;  3EFR A;  4P5N A;  4PJO B;  3FC3 A;  1OV3 A;  1D0X A;  3CCJ T;  1VQ7 T;  2RO0 A;  4P3N A;  2HSE B;  2LRQ A;  3SWN B;  1IHV A;  1PHT A;  2P5I A;  2FZG B;  4IIM A;  4Q5W A;  2DNU A;  2DXC A;  1RLP C;  3A98 A;  1D3B B;  2CP5 A;  3J80 E;  2RM4 A;  3CCJ A;  1W6X A;  2D0Q B;  4LXC A;  2KRM A;  1VYT A;  5L23 A;  1RAA B;  4JRK A;  5CQY A;  2JOY A;  4OP0 A;  3MEY A;  4L87 A;  4LUE A;  1PNJ A;  1Z9Q A;  2MPX C;  2ZGW A;  3CCQ T;  2LVM A;  11AS A;  4CC7 A;  4JRQ A;  1VQ5 A;  3M56 A;  1P92 A;  2YDL A;  2CP0 A;  1UJ0 A;  2F69 A;  2K6D A;  3PE0 A;  3HSB A;  1KMM A;  2ENM A;  1AVZ C;  4CS3 A;  3CCU A;  1U8R A;  2HQH A;  3P8V A;  1GBQ A;  1K73 U;  1SEM A;  4RQE A;  2AKL A;  2ED1 A;  4VUB A;  4DPG A;  2P0L A;  3DKM A;  2KXD A;  2EYW A;  2XTI A;  3A8H B;  4EDU A;  2ARU A;  2AKW A;  1WXB A;  4HT9 A;  2CGH A;  3CD6 T;  3NEM A;  1G8X A;  2EPD A;  2X51 A;  3REB B;  3CCM Q;  2HNI A;  3KUF A;  1H3H A;  1USY C;  1H4Q A;  5CKB A;  2RQR A;  4M77 G;  3NEL A;  1CKB A;  4JUV A;  4TTV A;  3E9I A;  1VOM A;  2DEQ A;  1VQN A;  1EOV A;  1X69 A;  1JBM A;  2EYY A;  4HWR A;  1I07 A;  3OMC A;  5J26 A;  2EL9 A;  4RTW A;  1JU5 C;  1B76 A;  5HKC A;  2HAX A;  1M2O A;  4TVA B;  2ZT5 A;  2NLU A;  3EG0 A;  4GLK A;  2CUD A;  3PIO A;  1QF6 A;  3HFO A;  2DDZ A;  2LJ3 A;  4YPF A;  3LGF A;  1KG1 A;  3NTK A;  1EIF A;  1FXX A;  2OI3 A;  1SRM A;  4M7A G;  3QO3 A;  4YRG A;  4QQG A;  5GAN 4;  2E5K A;  2K57 A;  4E2F B;  4KBM B;  1E6H A;  1K9A A;  4E7K A;  3JB9 H;  5LJ5 d;  3AHU A;  2EGC A;  2ZT7 A;  4H2W A;  3OW2 P;  4PJO D;  3CC7 T;  3MEV A;  1C0A A;  4HA8 A;  1CSK A;  4M77 B;  4CH6 A;  3G4S A;  2C0T A;  2ART A;  4MML A;  1TU0 B;  2F2V A;  1WHH A;  1Y96 B;  2ECZ A;  2FB7 A;  3M0T A;  4EO4 A;  2IVW A;  2XK0 A;  3CC4 Q;  5DLQ E;  3EGD A;  5GAM f;  4C92 C;  3CC2 T;  2WSC E;  3HY0 A;  2RMO A;  4BB7 A;  4D6W A;  2P4R A;  1PSF A;  3CCU Q;  4DA4 A;  2EAY A;  3H0H A;  2COY A;  4HXJ A;  2YLB A;  2XIC A;  2HKQ B;  1BI3 A;  3HXY A;  2K5I A;  1YBY A;  4OMN A;  4M7A B;  3C4S A;  4X9C A;  3RER A;  1YFN A;  1G83 A;  2ZPG B;  2RHS A;  5GJV B;  2JM8 A;  1VQP Q;  1W70 A;  1NNH A;  2K5F A;  4WJ4 A;  4ELZ C;  2JTM A;  2JT4 A;  3I9Q A;  4OF1 A;  3I55 A;  3VU3 C;  4E7H A;  4ZTF A;  4C92 F;  2DKG A;  4LDW A;  4M75 A;  3M0U A;  2KBT A;  3VKI A;  4C8Q E;  3PNW C;  4BD3 A;  4FIB A; 
#chains in the Genus database with same CATH homology
 3JCM J;  2E10 A;  3JCM P;  2ZPH B;  1UGQ B;  2M0O A;  2XID A;  2RHY A;  1G3T A;  2E70 A;  4YRM A;  5CKD A;  2KQW A;  1YIJ T;  1DJ7 B;  3OW2 A;  4CRI A;  3OYH A;  1NE8 A;  1W2B A;  4CH5 A;  5A0G A;  5FRO A;  2HD0 A;  3FB9 A;  3V8K A;  3WQZ A;  5A0L A;  3HY1 A;  5FRM A;  3HXX A;  4ZN3 A;  3A8G B;  5DY9 A;  2E1H A;  3CMA T;  3CCM T;  3QTC A;  4M75 E;  4JRI A;  4PJO E;  3A74 A;  3OS1 A;  2VV5 A;  5LJ3 j;  2M9U A;  2V8J A;  3JB9 D;  1VQO A;  3L4G B;  2JVV A;  4C8Q C;  2OAU A;  3BDU A;  4ZTU B;  2CS7 A;  4CH3 A;  3RUX A;  2E6N A;  4ZN1 A;  4M75 C;  2I4L A;  4HCB A;  1Y7X A;  4K86 A;  1H4T A;  1JJC A;  5I2S A;  3JCM e;  2MWO A;  3F70 A;  2M16 A;  2EIF A;  5GAM h;  3GNF B;  2DU5 A;  1QVF S;  1L0W A;  2V8I A;  5A2Q E;  2ZPE B;  2RB6 A;  1SSF A;  5IAY A;  3M55 A;  3OYF A;  4JS5 A;  1E24 A;  1EQR A;  4HVC A;  3GP8 A;  5KCH A;  4UP8 A;  3VUZ A;  5CVI A;  2DXB A;  3CCS A;  4M7A E;  1MHN A;  5M9O A;  4PLI A;  4HCZ A;  1Q81 C;  3HFZ B;  4P72 A;  1KD1 U;  3M4Y A;  1Q82 U;  4RG8 A;  1WNL A;  3VQW A;  2QEX T;  1U1T A;  2VUB A;  3M5A A;  4ZGD B;  3QII A;  1X54 A;  1FWZ A;  4M77 E;  5GAO m;  4EPC A;  4QVC A;  3QO5 A;  1NJ6 A;  4E47 A;  1KQS S;  2DXT A;  1Q81 U;  3LSS A;  2O01 E;  4LVL A;  1Q82 C;  1Y71 A;  1ADY A;  1VQ8 A;  2ZCF B;  3CCR A;  3NFC A;  1H64 1;  5HK3 A;  1O75 A;  2QDY B;  3JCM g;  5GAN 5;  2Q7H A;  4G84 A;  2PME A;  2WSF E;  3C95 A;  2D9T A;  2BKD N;  1O9S A;  4LVJ A;  3QKJ A;  2FHD A;  1WU7 A;  4BDZ A;  3OYK A;  1VQK A;  4JRP A;  2CJB A;  3V7C A;  4FT4 A;  3IKM B;  1LJO A;  2O4X A;  4CH4 A;  5E3I A;  1B7Y B;  3JCM d;  3E9G A;  3E9H A;  4M7A F;  5GAN e;  3X26 B;  3JCM V;  3WVD B;  4N0A C;  2DAQ A;  4C8Q A;  5LJ3 g;  3IAL A;  1JJC B;  3TEG A;  3PGG A;  2IY5 A;  4M75 G;  2EQM A;  3GLX A;  3QPH A;  2ZXF A;  2YHT A;  4M7D E;  5GMK j;  1QP2 A;  4OGE A;  2AMC B;  4M77 F;  2Y4X A;  4XTU A;  2R5M A;  2XHC A;  3A7R A;  1M4Z A;  2I4O A;  4UPA A;  2H3J A;  3MHX A;  1BYM A;  3MP1 A;  4XU0 A;  4J83 A;  1B34 B;  1QVG A;  5HGQ A;  2RJC A;  2RD1 A;  4E7L A;  3KBG A;  1VIE A;  4WF2 A;  1VQ6 T;  5KNN A;  4LDV A;  3CPW S;  2ZR2 A;  4J6Y A;  2E3C A;  2XDP A;  3G6E A;  1VQK T;  3OA6 A;  1M5Q 1;  3PZC A;  1NJ8 A;  4H2T A;  3H8Z A;  2BUD A;  4BI8 B;  2CKK A;  3QHS A;  2OTJ A;  4YYE A;  1YHQ T;  2VGM A;  4FT2 A;  3UGQ A;  3HXV A;  5GAN 7;  2P0K A;  5J39 A;  2V8K A;  1LOJ A;  4XAX B;  1WQ7 A;  2MI6 A;  3X24 B;  4EMG A;  5CQX A;  2ZNI A;  4F7U B;  1NZ9 A;  3OYA A;  3GF5 A;  2RHS B;  2PQW A;  5J3B A;  3R07 A;  3L2Z A;  2RH2 A;  5LJ5 h;  1X01 A;  4TQD A;  4H2U A;  3HRS A;  1K9M C;  5C53 B;  3LW5 E;  4KUD K;  4YRK A;  4MDW A;  2G3R A;  4BUG A;  3RGL A;  2KY9 A;  3QBY A;  3ME9 A;  3OYB A;  4YCW A;  4KR3 A;  4RQF A;  1EIY B;  1G5V A;  4Z02 A;  2EFI A;  3JCM W;  5C0M A;  4O6J A;  4BI4 A;  4YTL A;  2E64 A;  1WQW A;  1K9M U;  1Q7Y C;  2OTL A;  3DB4 A;  1NJ2 A;  1I81 A;  1JRI A;  1YCY A;  4H2X A;  4YRO A;  1N9W A;  3EAE A;  3OYE A;  3CD6 A;  2RK2 A;  2MWP A;  2B8A A;  4BI3 A;  4Y28 E;  3CBO A;  5LJ3 f;  1G5H A;  2P0P A;  5FU7 C;  4YRP A;  2DU7 A;  4FSX A;  3OYY A;  4H2Y A;  4C92 G;  5GAN j;  4A53 A;  3RIR A;  1X56 A;  4DQ2 A;  4M7A A;  3P8H A;  4L6V 5;  2QHT A;  1EVL A;  3OSS C;  4CS4 A;  1QVG S;  3CBM A;  5A0D A;  1BKB A;  1KHI A;  3MF2 A;  4LD9 K;  4M78 D;  2CZ1 B;  4RCB A;  3I56 T;  4M78 B;  3V7R A;  1GGM A;  1B8A A;  3C94 A;  4L59 A;  3ZEH A;  2X4W A;  3VYG A;  3FEO A;  3MCA B;  3RL6 A;  3M9Q A;  2XGT A;  2EKO A;  2ZZG A;  5AYF A;  3PT9 A;  2QEX A;  3OMG A;  1B34 A;  3RMQ A;  3M4P A;  1NJ5 A;  2EJF A;  1NPR A;  1YIJ A;  3PCO A;  3P8B B;  2RI3 A;  2Q7G A;  3PMT A;  3SWN A;  4KR2 A;  3HPW A;  4JLG A;  3IG2 A;  4H2V A;  2X35 A;  4F7U F;  5GAO r;  2VXE A;  4IUT A;  3LLR A;  2RHX A;  4B9X A;  3MEW A;  1IL2 A;  4QW2 A;  4A4F A;  3QDR B;  3VJP A;  3SWN C;  2CZ7 B;  3P8Y A;  2ODR C;  3HXU A;  3L2U A;  1WJS A;  3M4Q A;  1X75 C;  4C8Q G;  2QA4 T;  2YLC A;  2RHQ A;  4P72 C;  3G71 T;  4BY6 B;  5LJ5 j;  2XD0 A;  1NJI U;  1KC8 U;  2ZTG A;  3QJY A;  1NPP A;  1K8A C;  3M53 A;  1ZHI A;  3E1S A;  2ZT8 A;  3LC0 A;  4JS4 A;  1YGB A;  1BIB A;  1Z7N A;  2F5T X;  4C5H A;  2KK4 A;  2FL7 A;  2LTO A;  5ELO A;  3JB9 F;  4LDU A;  2ZT6 A;  4H2S A;  2QQS A;  5HK0 A;  4JDS A;  1EVK A;  5K1X A;  1SES A;  4PG3 A;  2RI5 A;  3FLG A;  4BW9 A;  4RG2 A;  5GAO l;  2EQK A;  3QJ6 A;  4JJN K;  1OZ2 A;  3G7Z A;  4PHC A;  3MO8 A;  3HKS A;  1GXI E;  3NEN A;  3SB2 A;  2WAC A;  2D6F A;  2E65 A;  2XI9 A;  1WPY A;  4M7D C;  4P73 A;  4KT0 E;  4JLI A;  2HQE A;  4XTX A;  3PTA A;  3RKW A;  3JCM c;  5GAN g;  3OD1 A;  4XU3 A;  3MQZ A;  4LVK A;  2DTO A;  1UGR B;  2RHQ B;  1J5W A;  2XDD A;  1FYF A;  1YB3 A;  1WYD A;  3G4S T;  5ELN A;  1OYX A;  4C0G A;  3DLM A;  3M4G A;  5GMK i;  1XNI A;  3A7U A;  1KD1 C;  5LJ3 d;  3HFV A;  4O2D A;  2EQJ A;  2KDS A;  2OTL T;  2CJA A;  2GF7 A;  3C12 A;  3QYH B;  1HXD A;  1X2G A;  4R56 A;  2ZZE A;  4F7U A;  2L8D A;  3UGT A;  3P8D A;  4PJO G;  2LCL A;  2VYT A;  4TVW A;  1YFT A;  2LQ8 A;  1N27 A;  2VGN A;  3OBY A;  2MMP A;  4Y91 A;  5GAO n;  2ZPI B;  2WSE E;  3BJU A;  3VQX A;  1BBW A;  2EJ9 A;  3L2R A;  4P3P A;  2JZ2 A;  2PUO B;  4KUL A;  1X55 A;  2QHV A;  3JSC A;  4NL2 A;  4ZGE B;  4TWA A;  3HRI A;  4ZTJ A;  1EFW A;  1VQO T;  2R57 A;  2F5K A;  4HWP A;  1W2B S;  1WGS A;  3OS0 A;  4G85 A;  5KE2 A;  3X28 B;  3R6O A;  1G51 A;  3MP8 A;  4C0D B;  1K73 C;  4LDY A;  4HWO A;  3T9N A;  1VQM A;  1N9R A;  2RHU A;  1HTT A;  1B70 A;  1M1K C;  4C5I A;  4C92 A;  2CIM A;  1VQZ A;  3L42 A;  4A4H A;  4J8O A;  1AHJ B;  3REU A;  2XG8 D;  3E9F A;  1VQL A;  4OB0 B;  1YJ9 A;  3BW1 A;  2CJ9 A;  2ZPF B;  3A31 A;  3W3S A;  4LDX A;  4XTW A;  1B70 B;  5CO7 A;  4LNS A;  5K1P A;  5GAN 8;  3URG A;  4LD6 A;  2ZR3 A;  1BIA A;  5I2M A;  2VXF A;  4R55 A;  5KH6 A;  4YRF A;  3CMA A;  4YRQ A;  4ATO A;  2C06 A;  3V8L A;  3O8V A;  1E1O A;  1KMN A;  3GPL A;  2E5A A;  2ARS A;  1VQ8 T;  4OB2 B;  2IY5 B;  2A3L A;  5GAO q;  4M77 A;  2R58 A;  1E22 A;  2QHS A;  4MDX A;  1H4S A;  3HHT B;  4C0D C;  3MEA A;  3DLL A;  5I21 A;  3M54 A;  2XKO C;  4BDY A;  3CME A;  3A7A A;  1VQ9 A;  2QQA A;  4YCU A;  5CKF A;  2CYZ B;  3OYI A;  3VQV A;  1S72 A;  3JCM b;  4OMF B;  1VIF A;  2BIV A;  2I2L A;  1X6O A;  3INZ A;  4XTZ A;  3LYI A;  4M75 D;  1UGP B;  1W66 A;  4YP0 A;  5GAN d;  4ZIB A;  4LVI A;  4YRS A;  3CCS T;  2FYK A;  2DJZ A;  1HC7 A;  1YJW T;  4IKF A;  3CXC A;  1KQ2 A;  4E7I A;  4J7F A;  3I56 A;  4N0A A;  4UP9 A;  4A54 A;  4EMH A;  3S3O A;  2RK1 A;  1M1F A;  3CPF A;  3A5Y A;  2DO3 A;  4HWT A;  1ATI A;  4X34 A;  3I7F A;  1JJ2 A;  2DTI A;  2E41 A;  1SRY A;  1G3Y A;  4YRI A;  2I4N A;  4MZT A;  4Q15 A;  2EJG A;  4BAC A;  4AH6 A;  2ZZD A;  3L1A A;  2KSS A;  4FU6 A;  4PLL A;  5FU7 B;  4DOW A;  3LH0 A;  3TEE A;  4ZTZ B;  2LX9 A;  3UH0 A;  3CCR T;  2Q5H A;  5GAN f;  4YRR A;  4FL6 A;  4ME7 A;  3I55 T;  3QO8 A;  3TEH B;  3CEY A;  4RMO A;  4F7U E;  3SDZ A;  4K87 A;  1VQ5 T;  2CZ6 B;  4HT4 A;  4NS5 A;  3SD4 A;  4C8Q B;  2DK3 A;  3WXM B;  4M77 D;  1UGS B;  3LGL A;  4IUU A;  1VQ6 A;  2DXU A;  5D6W A;  4MMK A;  3G6E T;  4B9W A;  1ZBX A;  5DM7 R;  3OSV A;  4TVR A;  1RIQ A;  4EMK A;  1QE0 A;  3QUI A;  3CC4 A;  1YI2 A;  1QVF A;  1BI0 A;  5LJ3 h;  2MF2 A;  1Q86 C;  2ZIM A;  3OQ5 A;  2HQX A;  3OY9 A;  4C8Q F;  2EQU A;  3FDR A;  4J6X A;  3WVE B;  3ASK A;  4IUV A;  1UB4 A;  3CCL A;  3CCV T;  3VV0 A;  2RJE A;  3L2Q A;  1VQP A;  1Q86 U;  3OYG A;  2RA2 A;  1SET A;  4OGC A;  4YRL A;  5GAN 2;  3REX A;  1NJI C;  1PYS A;  2DD4 A;  1YIT A;  1KOG A;  2EYQ A;  2X4Y A;  3BY7 A;  3OYN A;  1VQ7 A;  3N5B B;  5GAM e;  1YJN A;  4OLF A;  2E6Z A;  4M78 E;  1VUB A;  4L5G A;  3S3N A;  1S72 T;  2ZPB B;  3CCV A;  4CS2 A;  3CCE T;  1VQN T;  4YRT A;  5C51 B;  1G3W A;  5KE3 A;  1BI2 A;  3UT1 A;  1D3B A;  5CKE A;  4P71 C;  3CC4 T;  2LCC A;  2PVD B;  4P74 C;  4ZGJ B;  2DVE A;  5KCO A;  2PVO B;  3QZ5 B;  2QQB A;  4C0F A;  5LJ5 e;  4M7A C;  3CMQ A;  2GFA A;  2QXF A;  4WJ3 M;  3S6W A;  2M1H A;  2RJF A;  3HXW A;  4A4E A;  4XEM A;  2JN0 A;  1VQP T;  3HRT A;  3QNE A;  2J3L A;  5LJ5 f;  2C7I A;  1YFS A;  5C6S A;  1E1T A;  1VQM T;  3HL8 A;  4ELY C;  3JAM E;  4HKE A;  2DQ0 A;  5GMK l;  4LVM A;  2QTX A;  1M8V A;  2Q5I A;  3A8M B;  2CZ0 B;  2XU8 A;  4M7D D;  2ZCE A;  2YRV A;  1ASZ A;  3LWH A;  3KXT A;  3CPW A;  4IUQ A;  4YRN A;  3JB9 G;  5LJ3 e;  1OZ3 A;  4A4G A;  4M7D F;  3L2W A;  3PIP A;  3CC7 A;  2I4M A;  4TVY A;  2NS6 A;  3A8L B;  2G4C A;  3FRN A;  3ICA A;  1WJR A;  4NL3 A;  1M1K U;  3FJP A;  4P3O A;  1X2H A;  4GY5 A;  3X20 B;  1QVP A;  4UP7 A;  5GAM g;  1OI1 A;  3TEH A;  4II1 A;  1W4S A;  2KVQ G;  4C92 D;  4BWA A;  3JRZ A;  1M9S A;  1EIY A;  2ZNJ A;  3H6Z A;  3V8J A;  2XDB A;  1BI1 A;  5FLX E;  5GMK m;  2O4X B;  1YI2 T;  3JCM Q;  2K5L A;  1QW1 A;  3GIB A;  3A5Z A;  4YRC A;  4H2X B;  3GNG A;  3CBP A;  2ZIO A;  3DSQ A;  3HRK A;  2E12 A;  1V29 B;  4IUR A;  3HXZ A;  2GQV A;  2ODR D;  1M1G A;  3LX7 A;  5FRN A;  2RHI A;  2FVU A;  1H3Z A;  3CCQ A;  3CCM A;  1Y96 A;  3MEU A;  4MZM A;  3BFM A;  4C5G A;  4BE1 A;  5F5W A;  2GFU A;  3UWN A;  2K2V A;  1G3S A;  4M7D B;  5GMK e;  4HWS A;  1U1S A;  1PSE A;  4KUI A;  4YCV A;  3S3M A;  4M78 A;  4M75 F;  3OYJ A;  12AS A;  1LYL A;  3HP9 A;  1I8F A;  4RKU E;  3CCL T;  2QQR A;  3VQY A;  3DB3 A;  1UEB A;  3VUB A;  3M58 A;  4XTY A;  2DZC A;  4P71 A;  5D6Y A;  3CME T;  5HY6 A;  3QO7 A;  4CI0 C;  3RF1 A;  1VQ9 T;  3QSU A;  5LJ5 g;  4TVA A;  3UDC A;  2LT1 A;  3A32 A;  2RJD A;  4BE2 A;  1N9S A;  2LDM A;  3OYC A;  2K3Y A;  5CK9 A;  5IT9 E;  3A5Z B;  4C8Q D;  1I5L A;  2A7Y A;  5GAM d;  4MZP A;  3JCM X;  1M90 C;  1KQ1 A;  1YJN T;  2AMC A;  5FU6 C;  4E51 A;  1YJ9 T;  1VQL T;  2PUK B;  3TUP A;  2HBP A;  5L8R E;  4M78 F;  3TU4 K;  3TRE A;  4BY6 C;  4O5V A;  3ZFJ A;  3HFN A;  5EG2 A;  4XU2 A;  5GAO p;  1FX7 A;  3M59 A;  1NJ1 A;  4PJO F;  1MGQ A;  1I4K 1;  1H4V B;  4M7A D;  1IRE B;  1M90 U;  4IUP A;  4EMK C;  4K88 A;  3BDL A;  5CKH A;  3CC2 A;  4NCX A;  1XQH A;  1Y07 A;  1Q7Y U;  4QVD A;  2KMT A;  5GAM j;  1PYS B;  4QQ6 A;  5CCA A;  3RKY A;  3QZ9 B;  2QA4 A;  5GAN h;  3NET A;  1RI0 A;  5LL6 S;  1N8R U;  1WLE A;  3OYL A;  2LT4 A;  4DOV A;  3QYG B;  5CIU A;  3M57 A;  2X4J A;  2X4X A;  4M7D G;  3RAC A;  2EWN A;  4A4K A;  2DIQ A;  1QP3 A;  3A8O B;  1ADJ A;  4TQF A;  2LC4 A;  4EX5 A;  4OB3 B;  3HRU A;  3X25 B;  1N6A A;  4C0Z A;  4P75 A;  4BE0 A;  1N8R C;  4WI1 A;  2LNV A;  2DPP B;  3OBW A;  5CR2 A;  2QQ9 A;  4HT8 A;  4Q6G A;  5GMK h;  4OB1 B;  4X9D A;  3JB9 J;  1BBU A;  1KC8 C;  2Y4Y A;  4M75 B;  4X5O A;  3OS2 A;  5GAN 3;  1YHQ A;  3L4G A;  4P75 C;  3SFM A;  1VQ4 A;  3MET A;  3VYH B;  4J6W A;  1TH7 A;  4V2S A;  3PMI A;  2K4Y A;  2L89 A;  4XQ3 A;  4HCC A;  4P74 A;  2ZIN A;  1ASY A;  3E19 A;  3OYD A;  3ER0 A;  4E7J A;  1NYR A;  2JNG A;  4C92 E;  1HK9 A;  3MP6 A;  1RL2 A;  4M77 C;  3HTZ A;  3Q1J A;  2GCX A;  4XEO A;  2P0Q A;  3VBB A;  4C5E A;  5GAN 6;  2ALY B;  4YRE A;  3V7S A;  4RMF A;  5CAI A;  1JJ2 S;  3LSQ A;  4UC4 A;  4NOY A;  1LNX A;  3RKX A;  4YRJ A;  4QVZ A;  3KFU A;  1Z7M A;  1SER A;  2JTF A;  5DLO A;  3GOX A;  3QG1 A;  2Y90 A;  3IKL A;  3EFS A;  1B7Y A;  3CCU T;  2RI2 A;  1NYQ A;  1K8A U;  3UFG A;  5D6X A;  4PL6 A;  4F7U G;  2OTJ T;  4P73 C;  3TCJ A;  5IN1 A;  4KQE A;  3OW2 S;  2PU9 B;  4XU1 A;  3HFZ A;  2L5Q A;  3PFS A;  3UPU A;  2AKW B;  4M78 G;  3ERR A;  2DD5 A;  2DQ3 A;  1VQ4 T;  3OS5 A;  1USY A;  3J7A F;  1YJW A;  2JUF A;  2LQK A;  4RDX A;  3ZBD A;  2DIG A;  2DZ9 A;  2K3X A;  2PMF A;  1WJQ A;  3J81 E;  3FIF A;  3P8T A;  4YDQ A;  4XTV A;  5FU6 B;  4J5Y A;  3CCE A;  2J3M A;  4FM4 B;  1XTD A;  3LWI A;  1R8O B;  3JB9 I;  3CXC S;  3G1Z A;  3NTH A;  4QQD A;  1XOV A;  1ZQ1 A;  4J7I A;  2R5A A;  4M7D A;  2Q7E A;  1G5I A;  4EMK B;  2VC8 A;  4OVA A;  4C92 B;  5C52 B;  4PNO A;  3MF1 A;  4PJO C;  2QI2 A;  4RCC A;  3RES A;  1YIT T;  4N4H A;  2QHU A;  4N4I A;  1YFR A;  4XK8 E;  2P4T A;  3RMS A;  2ALY A;  2RHZ A;  4M78 C;  3QXE B;  2C8M A;  3OYM A;  2E5Q A;  3OB9 A;  3JCM h;  1KHC A;  3NTI A;  2A8E A;  3JCM f;  4J15 A;  4PJO A;  2AHJ B;  2L3R A;  1KQS A;  4N4G A;  4H02 A;  2PVG B;  2ZZF A;  3L2V A;  4PKC C;  2KAF A;  2DTH A;  1JB0 E;  1IZ6 A;  2IG0 A;  3PCO B;  2MAM A;  3G71 A;  3EFR A;  4P5N A;  4PJO B;  3FC3 A;  3CCJ T;  1VQ7 T;  2RO0 A;  4P3N A;  2LRQ A;  3SWN B;  2P5I A;  4Q5W A;  2DXC A;  1D3B B;  3J80 E;  2RM4 A;  3CCJ A;  2D0Q B;  4JRK A;  5CQY A;  2JOY A;  4OP0 A;  4L87 A;  3MEY A;  2ZGW A;  3CCQ T;  2LVM A;  11AS A;  4JRQ A;  1VQ5 A;  3M56 A;  1P92 A;  2F69 A;  3HSB A;  1KMM A;  4CS3 A;  3CCU A;  1U8R A;  3P8V A;  1K73 U;  4RQE A;  4VUB A;  4DPG A;  2P0L A;  3DKM A;  2XTI A;  3A8H B;  4EDU A;  2ARU A;  2AKW A;  3NEM A;  4HT9 A;  2CGH A;  3CD6 T;  2HNI A;  3KUF A;  1USY C;  1H4Q A;  5CKB A;  4M77 G;  3NEL A;  4JUV A;  4TTV A;  3E9I A;  2DEQ A;  1VQN A;  1EOV A;  1JBM A;  4HWR A;  3OMC A;  5J26 A;  2EL9 A;  1B76 A;  5HKC A;  2HAX A;  4TVA B;  2ZT5 A;  2NLU A;  4GLK A;  3PIO A;  1QF6 A;  3HFO A;  2DDZ A;  4YPF A;  3LGF A;  1KG1 A;  3NTK A;  1EIF A;  1FXX A;  4M7A G;  3QO3 A;  4YRG A;  4QQG A;  5GAN 4;  2K57 A;  4KBM B;  4E7K A;  3JB9 H;  5LJ5 d;  3AHU A;  2ZT7 A;  4H2W A;  4PJO D;  3CC7 T;  3MEV A;  1C0A A;  4HA8 A;  4M77 B;  4CH6 A;  3G4S A;  2ART A;  4MML A;  1Y96 B;  2FB7 A;  4EO4 A;  2IVW A;  2XK0 A;  5DLQ E;  5GAM f;  4C92 C;  3CC2 T;  2WSC E;  3HY0 A;  4BB7 A;  4D6W A;  1PSF A;  4DA4 A;  2EAY A;  2YLB A;  2XIC A;  1BI3 A;  3HXY A;  2K5I A;  1YBY A;  4M7A B;  3C4S A;  4X9C A;  3RER A;  2ZPG B;  2RHS A;  1NNH A;  2K5F A;  4WJ4 A;  4ELZ C;  2JTM A;  4OF1 A;  3I55 A;  3VU3 C;  4E7H A;  4ZTF A;  4C92 F;  2DKG A;  4LDW A;  4M75 A;  3VKI A;  4C8Q E;  3PNW C;  4BD3 A;  4FIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...