2E41A

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with the reaction product analog biotinol-5'-amp, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e41A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e41A01
5GANd 4M7AB 2K57A 1X56A 2Q7HA 2RA2A 1YGBA 4K88A 2I4OA 4C92F 2ZXFA 3V8KA 4CH3A 4HWTA 2C7IA 2IY5B 4H2XA 2JN0A 2EJFA 4EMKB 4M75C 4M78B 1EIYB 1HTTA 2ARTA 4Q15A 1HXDA 4M75E 4XQ3A 4PJOE 1Y96A 3UFGA 5K1PA 4NOYA 1X2HA 5GAN5 2RHQB 4YRLA 5GANj 1SETA 4YCWA 3DSQA 4L87A 2DQ3A 4XU0A 4UP9A 4M7AF 4DPGA 1BBUA 2Q7GA 3JCMW 1U1TA 3JB9G 1BBWA 2ZZEA 4E51A 4M7AD 1PYSA 2DU7A 3A31A 1H4TA 3SWNC 1EVLA 4YRKA 1VQZA 4A53A 4M78F 3HXYA 4P74C 4V2SA 4ZTZB 3AHUA 4C8QD 2AMCA 3RKXA 3RKYA 2QHTA 5GAOm 1NJ2A 2ZZFA 1HK9A 1EQRA 4M75B 2DZ9A 4N0AA 4PJOB 3MEYA 3UH0A 5GAMh 4YRNA 1NJ8A 4NL2A 12ASA 3V8LA 3SB2A 1SERA 4M7DC 4HWRA 1I5LA 5GAOr 4UP8A 3JCMQ 3IALA 4RCBA 4LNSA 4M77C 4KR3A 4H02A 2E3CA 4RDXA 4H2WA 1U1SA 1KOGA 5LJ5f 3RACA 3RUXA 1MGQA 1JRIA 4P73C 5I21A 3PCOA 4DQ2A 1L0WA 2I4MA 3EFSA 4PJOF 3HFOA 3TEHA 2E64A 4P72C 1JJCB 4M75D 4C92C 2DQ0A 3HFVA 4KR2A 4C92E 5ELNA 4YRFA 1LOJA 2CJBA 1B7YB 2ARUA 2Y90A 4YP0A 1X2GA 4C8QA 1EIYA 4ZIBA 4M77B 4WI1A 4H2YA 2EWNA 3A7RA 2RM4A 4JRIA 2ZR2A 4Y91A 3JCMc 4X5OA 1X55A 3L4GA 3NENA 1N9WA 2ODRC 1B70B 1YFSA 4M7AC 4TVAA 3M4GA 1LYLA 4P71A 1N9SA 3JCMP 3QO5A 5LJ5e 4CH4A 1FYFA 3P8TA 3P8VA 1NNHA 4EMKC 2EJ9A 4M78C 4C92B 4YRPA 4YRMA 3NELA 4H2TA 3BJUA 4F7UA 5GMKl 4M7DD 1E24A 11ASA 2I2LA 5GANh 4M77D 3LSSA 3HXWA 1SRYA 3HFZB 4PHCA 4HWPA 3HY0A 3RGLA 3JCMb 1TH7A 1WU7A 4CH6A 1WYDA 4XU1A 3LSQA 1D3BB 3V7RA 3FB9A 3L1AA 2ZIMA 4J15A 1QF6A 5LJ5g 4TVWA 3IKLA 3R07A 4H2UA 3I7FA 2E10A 3SWNA 4C92D 3PZCA 3RKWA 4JRKA 4NL3A 1NYQA 4PJOC 4P74A 3P8YA 4EX5A 3V7SA 2ZR3A 4JUVA 4J6XA 1JJCA 2J3MA 3HRKA 1H4VB 2AKWA 1B8AA 4XU2A 2DDZA 4HVCA 3MF2A 2Q5IA 3CMQA 3A74A 3JB9F 4O2DA 1B7YA 4M7DA 2ODRD 1G51A 3JB9H 4M77A 2ALYA 5GMKe 4YRIA 4G85A 1WLEA 2E1HA 4HT8A 1C0AA 2YHTA 3MF1A 4YROA 1B70A 1HC7A 5GMKi 3LC0A 2RHSB 4TQDA 4M78D 1M5Q1 2RD1A 4P73A 3HTZA 3NETA 1X01A 3KFUA 2FB7A 1I81A 5LJ3f 1YCYA 4PG3A 4X9DA 4P72A 4CS4A 1EFWA 2DTHA 1BIBA 1GGMA 5GAMf 4C92A 4XTXA 4UPAA 5GMKm 1I8FA 1M8VA 4YRQA 4C8QG 5DY9A 4JLIA 2XTIA 1NJ1A 4YRGA 1ADJA 5GAOn 4RQFA 1NYRA 4M7AA 2C8MA 1RIQA 4EMHA 3L2ZA 2CJAA 4CH5A 4PJOD 2G4CA 4YREA 2ZNIA 1X54A 5LJ3d 1NJ5A 4P3NA 4P75C 2DVEA 3A5YA 2IY5A 1N9RA 1KQ1A 2VXFA 1J5WA 4EMKA 3WQZA 3TUPA 4M78A 2ZCEA 1EVKA 4RQEA 4F7UG 5LJ3e 5LJ5d 2P0LA 2RHQA 2ZGWA 2J3LA 5KNNA 5GAMe 3G1ZA 4M75G 3M4QA 5K1XA 4OP0A 3VQWA 3QTCA 3BW1A 4XTVA 2ZNJA 1JBMA 3JCMJ 4YDQA 4K86A 3TEGA 1YFRA 5ELOA 1WNLA 1EOVA 2PMEA 4WJ3M 4HA8A 3ICAA 1H4QA 3M4PA 3E9IA 1PYSB 4YRCA 1USYC 1BIAA 5LJ5j 3JB9J 2QHVA 3ERRA 1H641 3A7UA 5GAN4 3REUA 2EAYA 1YFTA 2DZCA 4M75A 4PJOA 4P3PA 1LNXA 2AMCB 5LJ3g 5GANf 2QTXA 4RCCA 1E1TA 2RB6A 5GAMg 1ATIA 2E5AA 3JCMf 4QVDA 2QHSA 3RESA 3NEMA 4P3OA 4X9CA 4YCVA 2DTIA 4XTZA 3GIBA 5C53B 4M7DG 4C8QE 1B76A 1WPYA 2VC8A 3BFMA 4M77G 5E3IA 3QO3A 1G5IA 2CGHA 1E1OA 2YLCA 3PCOB 2I4LA 3RF1A 1B34B 4J6YA 4TQFA 3TEHB 4J5YA 3V8JA 4OLFA 4K87A 3EFRA 4EO4A 4MMLA 3JCMd 3REXA 2DU5A 3JB9D 1SESA 4C92G 4HT9A 4F7UE 3IKMB 4C8QB 5GAN3 2DEQA 3RIRA 5GANe 1KMNA 3A7AA 4AH6A 5GMKj 2I4NA 1IL2A 3JCMe 4PNOA 4YPFA 3L4GB 4TVYA 3FIFA 1W66A 3UGTA 4TVAB 1I4K1 2DKGA 4YRRA 2EL9A 1G5HA 3BY7A 4M7AG 4H2VA 4TWAA 5F5WA 2VXEA 2DXUA 3V7CA 3A5ZA 4KQEA 3VBBA 3RL6A 4P75A 3QSUA 4C8QF 4YRTA 3HSBA 1WQWA 3HFZA 4HWSA 4ZTUB 4F7UB 1Z7MA 2FYKA 4M78G 5LJ3h 2ARSA 5GANg 1ASZA 3E9HA 4YCUA 3JCMg 3A32A 2E65A 4WF2A 1D3BA 4YRJA 3OD1A 4EMGA 3VQXA 3BDUA 5CAIA 5GAN8 2Q5HA 4M7DE 2EJGA 5LJ5h 1WQ7A 4G84A 4M77E 2ZT5A 4XEOA 5C52B 2YLBA 5GAMd 2DJZA 2P5IA 4YYEA 1Z7NA 5GAOp 1ASYA 3HXVA 4F7UF 4WJ4A 4BWAA 1USYA 3SWNB 4TTVA 4XU3A 3IG2A 4H2XB 4A54A 1LJOA 4MMKA 4M75F 4N0AC 3HY1A 1B34A 1KQ2A 3HRIA 2Q7EA 1ADYA 1KMMA 4CS2A 1Y96B 2DTOA 4PJOG 2AKWB 3QHSA 5LJ3j 3HXXA 4XTWA 3W3SA 2ZINA 3FJPA 1NJ6A 2XGTA 4UP7A 5GAMj 3VU3C 4M7DB 4YRSA 2ZZGA 2CIMA 3HXUA 2ZT8A 2ALYB 4CS3A 4J6WA 3QUIA 3HXZA 2RHSA 2DXTA 2PMFA 3JCMV 4XTUA 2ZT6A 3VQYA 2CJ9A 4BW9A 3JB9I 4RMFA 3VQVA 5C51B 3RERA 1QE0A 3QNEA 5GAOl 4QVCA 4M7AE 3HFNA 5GAN2 4XEMA 4M7DF 4C8QC 1YB3A 3QO8A 3INZA 4M77F 5GMKh 3QO7A 2ZTGA 4M78E 1E22A 5GAN6 2HNIA 2E41A 3JCMX 3UGQA 2ZIOA 2QHUA 5GAOq 3JCMh 4Q6GA 5GAN7 5HGQA 4NCXA 2ZT7A 4P71C 4HWOA 3PGGA 4XTYA 4H2SA 1H4SA
chains in the Genus database with same CATH superfamily
2K57A 2MK5A 4ORZA 3CCLT 2HSPA 3SEMA 3E1SA 2PVGB 2RQVA 3TCJA 4H2XA 1R77A 1TUGB 4EMKB 1I5OB 3MP6A 2CT4A 1OU8A 1HTTA 2ARTA 2R57A 2LQNA 1HXDA 1ZLMA 1B07A 1Q7YU 1Y96A 3GNGA 3UFGA 5K1PA 4N4HA 4NOYA 4L6V5 1X2HA 2RHQB 2YDLA 7AT1B 2FPDA 5GANj 1K9AA 4NS5A 3OYHA 2DQ3A 3M54A 1BBUA 2V1RA 4M7AD 1T3LA 4DBRA 3I56Q 1H4TA 3ASKA 1I07A 4P74C 4DBHA 4JPBW 3LLRA 2XK0A 1VQNQ 3EG2A 2NUTB 1EQRA 4M75B 2LTOA 2LVMA 4RUGA 3THKA 3V8LA 3SB2A 1SERA 2W0ZA 4M7DC 5GAOr 4RCBA 2J6FA 4KR3A 3R6NA 2RHZA 3M58A 2E3CA 3EG3A 4R55A 3QJYA 2L8DA 4Z8AA 3A8GB 1AWJA 2CKKA 4LE9A 3KUFA 4HVVA 5CKFA 4PJOF 1VQLT 4HXJA 2FO0A 3HFOA 3OB9A 2DILA 2A36A 2E64A 3QYGB 1NBEB 2HDAA 2XDDA 2LDMA 5A0LA 4C92C 3HFVA 1OQKA 4LN2A 2RJEA 4OB2B 3WXMB 2ARUA 4YP0A 3UA7A 3VS7A 2JZ2A 4M77B 4MZPA 3L2QA 4H2YA 4OMLA 4JRIA 1LPLA 4RKUE 3L4GA 3NENA 2Y4YA 2FEIA 4AFUC 3G4SA 4LNPA 2OI3A 4FYVB 2DLPA 4FSXA 3M4GA 4LD9K 2L89A 1VQ6T 1TU0B 1W2BS 4UC4A 2SRCA 1NNHA 4EMKC 3CCST 1Q82C 2I2LA 4FT4A 3HXWA 1Q95G 2CDTA 1LCKA 1BI1A 1C0MA 3E9GA 4C0DB 1NPRA 1WYDA 4XU1A 2DL5A 3LSQA 3M0UA 1D3BB 2WSFE 3V7RA 3FB9A 3L1AA 4QQGA 2CP3A 3RBBB 1UFFA 4J15A 4AFQC 1QVFP 3IKLA 2EGEA 3SWNA 1T3SA 3MEAA 3MP8A 2COZA 4PJLA 2DIGA 2ZR3A 4J6XA 1QW1A 2PVDB 1G5VA 2V8IA 2PZ1A 1GBQA 2V26A 3A74A 3JV3A 4O2DA 1B7YA 1D0XA 1G51A 3JB9H 5IN1A 1GXIE 4MZTA 4YRIA 4K11A 1UGRB 2MIOA 3EGXA 8ATCB 2JOYA 2ZPEB 4HT8A 3SFMA 3EG9B 4LVIA 4YROA 1VOMA 4ANJA 5GMKi 3PFSA 2RHSB 2VGNA 2A3LA 2NYSA 4TQDA 1I0CA 4M78D 2KXDA 1M5Q1 2DAQA 3NETA 1NG2A 1UECA 5FWBA 2DMOA 1YJ9Q 2CZ7B 3KFUA 2FB7A 1R0BG 1QWEA 1RABB 4PG3A 1T0HA 1ZBJA 4J9IA 4CS4A 1EFWA 1GGMA 1BIBA 5GAMf 4ZN3A 1D1CA 1I8FA 1OPLA 1VQ9A 5A0DA 2IG0A 4YRQA 5DY9A 2DJQA 5EC7A 2EVRA 4PLIA 4PFPA 3HPWA 5KYUB 2C8MA 1CKBA 2DVJA 1RIQA 4YREA 4EDUA 1JJ2P 5LJ3d 3TREA 1VQKQ 2FVUA 4P3NA 3A5YA 2IY5A 1FWZA 1KQ1A 1YI2Q 1J5WA 4M78A 3MKDA 2CS7A 1YNZA 2QQBA 3OYLA 2FPEA 4C0DC 2HSEB 4F7UG 1VQOA 2P0LA 4IUVA 3CC4Q 5KNNA 1WDXA 3G1ZA 3FRNA 2QEXT 5K1XA 4OP0A 1PHTA 4XTVA 3OYIA 2ZNJA 4JZ4A 5KYWA 3CMAQ 1WNLA 1EOVA 4BE2A 3UDCA 3A8MB 3PNWC 3E9IA 1MUZA 1W6XA 2VB6A 4YRCA 1MV3A 2L3SA 2RK1A 4DOVA 1H3HA 4CC4B 1YFTA 1PSEA 2RK2A 2PVOB 3LGLA 2YXYA 1XNIA 5KH6A 1E1TA 5GAMg 2KVQG 3PE0A 4X34A 3M53A 3CD6T 3HRUA 4XK8E 2DTIA 4XTZA 3GIBA 4M7DG 3QG1A 4IKFA 1QKXA 4OB3B 3FDRA 4QQ6A 3H6ZA 2COWA 3M55A 2NLUA 1K73U 4FU6A 1KC8U 3RF1A 2LMJA 2DD4A 4JRPA 4K87A 2DK3A 3CCMA 2DL7A 1GL5A 3JCMd 2FZGB 2MF2A 2CZ6B 4C92G 2F1LA 2P4RA 3TEEA 5KCHA 3H0HA 4OMFB 4Y28E 3ER0A 1ZHIA 5CQYA 1KMNA 2ZAEA 1QCOA 3A7AA 4AH6A 2XG8D 2XICA 3L4GB 1RI9A 2X4XA 2EKHA 3FIFA 2R5AA 3UGTA 3META 2DKGA 3GP8A 1TWBA 2EL9A 4H2VA 4TWAA 3I56T 5F5WA 1UGPB 2VXEA 4PLLA 4Z02A 2FG0A 2J05A 3VS4A 3A5ZA 3VBBA 4ESRA 1XOVA 4P75A 3QSUA 2PUOB 2RJCA 3HSBA 2X3WD 1WQWA 2HQEA 3GLXA 4J83A 5LJ3h 1VQNT 5CK9A 2ARSA 1ASZA 3E9HA 4YCUA 3EFOB 4CC2A 2GGRA 1YITQ 5C6SA 1AOJA 1TSFA 2KEAA 3OYAA 5HK3A 3EHRA 1X2KA 4CRIA 2ED0A 5CAIA 2EJGA 2RHUA 4M77E 2ZT5A 2HBWA 4ATOA 1W2BP 5GAMd 2P5IA 4YYEA 1Z7NA 2CT3A 1IREB 5M9OA 4F7UF 4WJ4A 4J9CA 4B6MA 3SWNB 5D7UA 2NUPB 3IG2A 1CSKA 4A54A 3A98A 1VQMQ 1QVFA 2CP6A 3HRIA 1WXUA 2W10A 2DFUA 2X3XD 3HXXA 3CC7Q 3TSWA 1OV3A 1NJ6A 4GLKA 3CCVA 2FL7A 1X2QA 4YRSA 3OW2S 1RLPC 2ZT8A 2OAWA 4F04B 2GCXA 2RHXA 4J6WA 3QUIA 3EGXB 3HXZA 1VQ6A 2EQUA 1WXTA 4XTUA 1S72A 2D8JA 5KYYA 4HCKA 3QNEA 1Q82R 2JUFA 4ZNXA 2EFIA 3HFNA 2YT6A 2MYSA 3OYBA 4XEMA 2RF0A 3CC2Q 4M7DF 2KT8A 2KRNA 5GMKh 3OBYA 1E22A 3P8DA 5GAN6 5J39A 2HNIA 3UGQA 2P0PA 2ZIOA 3MEUA 3RDVA 2F69A 4KH0B 1VQ5Q 3JCMh 5GAN7 5FU7C 2DRMA 3C94A 1OEBA 2ZT7A 4HWOA 3PGGA 1PCXA 3VS0A 1H4SA 1K8AR 4JLGA 1SHGA 1ZSZA 2RA2A 3CMEQ 1YGBA 4K88A 1M27C 4C92F 3OYEA 3C12A 3V8KA 4CH3A 2KI7A 4HWTA 3PIOA 1VUBA 1D09B 3OQ5A 1BCOA 4ZGEB 2PTKA 2IY5B 4BD3A 4A4GA 1VYVA 4M78B 1EIYB 3VS6A 1FMWA 1XTDA 2E70A 3J80E 1TUCA 2CSQA 2PUKB 4QW2A 4PJOE 3E9FA 3VS2A 1BCMA 1JU5C 1SETA 1VQ8A 3KXTA 4UP9A 2LT1A 3VS1A 2JM9A 1YIJA 3QJ6A 1U1TA 1CKAA 4IURA 5KYWB 3JB9G 1PYSA 2DU7A 2M1HA 3HKSA 3A31A 4E51A 2DX1A 3SWNC 4AFSC 3HXYA 4V2SA 1N27A 1MMAA 4C8QD 2AMCA 3RKXA 3RKYA 5GAOm 1H3ZA 2YUNA 1YJ9T 4N0AA 1E6GA 5GAMh 4LVJA 4FW1A 1HJDA 1I5LA 2DETA 1ABQA 3JCMQ 3IALA 1PRMC 1KD1R 1U3OA 3KBGA 2B8AA 4MZMA 1U1SA 5KYNA 1KOGA 5LJ5f 3RACA 3RUXA 1EFNA 1VYUA 2O9SA 3SD4A 5I21A 3PCOA 4DQ2A 1OULA 2O31A 1BYMA 1WZOA 2E3IA 3X25B 3TEHA 2H3EB 2V1QA 1JJCB 5CKHA 2DQ0A 2RN8A 2X51A 3CQTA 1VQKT 3ZL7C 1M1KR 1ZA1B 2NUZA 3G71A 1YI2T 4C8QA 4BUGA 4ZIBA 1Q86U 1Y57A 1QVGA 4Y91A 3JCMc 1X55A 3CC4T 1K76A 4F17A 1B70B 1YFSA 1YFNA 1QVPA 1T0JA 2EYZA 2ENMA 1PNJA 1AD5A 2FRWA 4P71A 1YP5A 4ZTFA 3CMAT 2DRKA 3QO5A 3A8OB 4HT4A 4M78C 5CVIA 2JW4A 4C92B 3A5ZB 3RMSA 4H2TA 5IXFA 1ACMB 11ASA 2ZCFB 1WHGA 2JNGA 3X20B 2R58A 5LL6S 1IRXA 1YJNQ 2J6OA 4PHCA 3HY0A 3RGLA 2KROA 2KBTA 3WVEB 1VQ7Q 2E6NA 2ZZDA 2JTEA 4E6RA 1UHFA 2CZ1B 1VYTA 2RPNA 2DBKA 2DM1A 3LGFA 1YJWQ 5LJ5g 1QF6A 3RMQA 4PK4A 2HKQB 4TVWA 3CCJQ 2M9UA 4H2UA 3I7FA 1TXQA 2QAZA 3QKJA 4A4FA 3H0IA 1TG0A 2DA9A 4EX5A 2I0NA 2EW3A 3V7SA 4JUVA 1W2BA 1WJRA 1PM3A 1V1CA 2LJ0A 3HRKA 1H4VB 1B8AA 4XU2A 2DDZA 1UG1A 2JS0A 4JS5A 3CMQA 3JB9F 3MO8A 3M56A 2RQUA 1QLYA 2FPFA 2ODRD 1H8KA 1NLPC 4J7IA 4PJNA 5GMKe 5I2SA 4B9WA 2G6FX 3CBOA 1WJQA 1WLEA 3GF5A 2E1HA 2JJ9A 2RO0A 2BIVA 1K73C 1RAFB 4RTXA 2DNUA 4BI4A 3QPHA 2KGTA 2Y4XA 5KYYB 1X01A 2LP5A 2D1XA 1Q7YR 5LJ3f 1QVGS 4ELYC 1VQNA 1C1AA 1RLQC 2AKLA 3IQLA 1WYXA 1AVZC 3OW2P 3EHQA 1U5SA 4BI3A 3G6EA 1RAIB 4JLIA 4YRGA 3EH2A 5GAOn 1EX4A 1ADJA 1YITT 2CREA 4RQFA 2QGFB 5KYXA 4M7AA 2C06A 2ZNIA 1N6AA 3EGDA 4P75C 1WXBA 2DVEA 2OTJA 3NPFA 4TVRA 2LNHB 2VXFA 4J7FA 1NZ9A 1BK2A 1NYGA 1VQMT 1OI1A 5LJ5d 4LDXA 2EPDA 2J3LA 5FRMA 3I9QA 1MMGA 5GAMe 3M4QA 1UB4A 1JBMA 3VRYA 3HRTA 4X1VA 3CC7T 3UWNA 3I35A 1EZZB 3X28B 2D8HA 2A0FB 1FYNA 2P0QA 3QXEB 1PYSB 3G4SQ 2PQWA 3M0PA 2QTVA 2MWOA 1H641 3A7UA 5FRNA 2F5KA 1G3WA 1ZBXA 2CSIA 4CI0C 2DZCA 1RAGB 1FX7A 1ZUYA 2AMCB 5LJ3g 2ABLA 2DYIA 1NEGA 1PD0A 2QTXA 3QDFA 1UTIA 2RB6A 2YUPA 1ATIA 3JCMf 3RESA 1RI0A 3CC2T 2FZCB 3L2WA 3NTKA 4LD6A 3GBQA 2LX7A 3BFMA 1BKBA 3J7AF 2HAXA 3DB4A 4M4ZA 1VQ5T 4E7IA 1K8AC 1E1OA 1ZQ1A 2GFAA 3P8HA 3PCOB 2O4XB 1G3TA 4GLMA 4MDWA 4N4IA 1QMCA 4TQFA 3TEHB 3CMET 4ZN1A 3V8JA 4OLFA 1P92A 4OVAA 3REXA 4C5IA 6AT1B 3EG1A 1X27A 4OF1A 1FMVA 4HT9A 4F7UE 2CH4W 2QI2A 1M1GA 4C8QB 1K0XA 2O88A 2AT1B 5GMKj 2I4NA 2BKDN 4JRQA 2AZSA 1ZSZC 1M90U 1IHWA 3M4YA 1KSWA 2DXCA 2DXUA 1K9MU 3I55A 1JQQA 3HFZA 3NGPA 4HWSA 3ZFJA 4M78G 2OTLA 2WSEE 3CCUA 2M0YA 3JCMg 3A32A 2R5MA 4J9GA 4WF2A 1KD1C 4YRJA 1VQ9Q 3ZEHA 3U23A 4EMGA 3BDUA 4L59A 5GAN8 4M7DE 5LJ5h 3M57A 2RHIA 1WQ7A 1IO6A 4XEOA 3OSSC 5C52B 3HTRA 3O5ZA 1W1FA 1ASYA 2K6DA 3HXVA 1U8RA 2ZPBB 4IIMA 4H2XB 4MMKA 1SKUB 4N0AC 1B34A 1GCQA 1QP2A 5DLOA 1KQ2A 3CXCS 1M1KC 1UGQB 4CS2A 1Y96B 2DTOA 3QHSA 3CCEA 3E2UA 2DL4A 2CP7A 1QP3A 1Y71A 3FJPA 2XGTA 4UP7A 3VYGA 5GAMj 1UGSB 3WVDB 3FJ5A 1VQOQ 2NWMA 3HP9A 4CC3A 1MNDA 4D8KA 1M9SA 2K3YA 2DXTA 1YHQA 2V8JA 3JB9I 1MHNA 1RADB 2KRSA 4RMFA 4OB0B 3J81E 3GNFB 4QVCA 3MEVA 3S3NA 2M02A 1AZGB 1NPPA 4IIOA 2RJDA 4E7JA 4C8QC 3REBB 3T9NA 3QO8A 3E19A 2QASA 2AK5A 4HCBA 1XJWB 1QCNA 2ZTGA 4PFZA 4LVKA 1Q86C 2RI5A 1YN8A 3CCLA 1YJNT 2QHUA 5GAOq 2HZYA 3MCAB 3QBYA 4DEYA 3N5BB 4NCXA 2VGMA 1VQ7T 3OW2A 2X35A 4QQDA 4P71C 2LQKA 3Q1JA 4XTYA 1SSFA 3VYHB 2ED1A 5ECAA 2DPPB 4D6WA 4M7AB 3LH5A 4IUUA 2RH2A 2DE0X 1AHJB 3RNJA 1QVGP 3OA6A 2I4OA 1YJWT 1RACB 2M16A 4LDWA 1X69A 3CCJT 1M4ZA 3EGDB 2JT4A 5I2MA 5IHKA 3PTAA 3AT1B 2ZPHB 1QKWA 4FYYB 3GOXA 2OJ2A 4Q15A 4M75E 2RMOA 3CCMQ 4E7LA 3G7ZA 3PVQA 4YCWA 3DSQA 5HKCA 3JSCA 2PU9B 1K73R 4DPGA 5FU7B 1OOTA 1KC8R 1I1JA 3JCMW 2MI6A 2RNAA 1PD1A 2FHDA 3TSZA 1EVLA 1VQZA 1R0CB 2K3BA 4M78F 2K4YA 4ZTZB 3AHUA 1YWOA 1GCPA 1Q7YC 2L3RA 4C5EA 1HK9A 3MEYA 4FSSA 1V29B 1ZUUA 3OS1A 3UH0A 12ASA 1WI7A 1UUEA 3CPWS 3QYHB 1N8RU 1VQLA 1NE8A 2CZ0B 4H2WA 2C0TA 4JZ3A 2HL5C 5IXBA 5GJWB 3I5SA 2JMCA 2LNVA 1MGQA 1JRIA 5FROA 2GF7A 2I4MA 3EFSA 3VS5A 3L2VA 2KXCA 2AZVA 3S3OA 3VKIA 4M75D 4O5VA 2X4WA 2JMAA 1N5ZA 2YWWA 3LW5E 3ZBDA 1RAHB 5ELNA 4YRFA 1PKTA 1B7YB 3CCQQ 2CJBA 1AT1B 1X2GA 1M3CA 5KCOA 4WI1A 3C95A 2F2WA 2EWNA 2K2VA 2ZR2A 3M5AA 2K79A 1HYOA 4RTWA 3M0SA 2KR3A 2RJFA 4QVZA 1JB0E 3CCVQ 2ODRC 1KG1A 3CCSA 4Y92A 1MNEA 4M7AC 1HD3A 1UHCA 4J9BA 3CPFA 1N9SA 4AT1B 5LJ5e 1WFWA 1FYFA 2KAFA 3MP1A 4FT2A 1S72Q 3P8VA 3LH0A 4XAXB 3G4ST 2QDYB 4KGVB 3NELA 4AMCA 3BJUA 5GMKl 1UDLA 3LSSA 4M77D 2NUTA 3HFZB 3QZ9B 1X6OA 5D6XA 3JCMb 4LDUA 1TH7A 2LC4A 1WU7A 4P5NA 4HCCA 1LVKA 3PMTA 2BE9B 4CH6A 4FM4B 1WHHA 1NM7A 5IT9E 3VV0A 3OYDA 1VQ5A 5CIUA 3F70A 1UEBA 3DB3A 3REAB 2H3JA 1U06A 2O01E 1WA7A 3R07A 1D0YA 5GJVB 3FC3A 3PZCA 4JRKA 4NL3A 1NYQA 1J3TA 2E3HA 2O9VA 3EAEA 2J3MA 3FLGA 2AKWA 2ESWA 2P4TA 3UPUA 2GQIA 2HQHA 3D7SB 3C0CA 3L2RA 1SF9A 2B86A 4M77A 2ALYA 2D9TA 1NEBA 4G85A 4DBQA 3L42A 1QWFA 4KGXB 1SG5A 1Q81U 1VQ8Q 1TUDA 2YHTA 4PKCC 4KUDK 5CR2A 1HC7A 4LVMA 2K3XA 2A8EA 2HD0A 2KRMA 3OYGA 1YIJQ 4P73A 2MWPA 1NJIU 1E6HA 4CC7A 5DLQE 3VJPA 3ME9A 3OS0A 4HKEA 1YCYA 3CXCP 2L5QA 4P72A 4J9EA 2DTHA 1BI0A 5I11A 1OU9A 4UPAA 4C0FA 1M8VA 1UE9A 2DO3A 4KULA 2J06A 2H8HA 4C8QG 2GFUA 3HRSA 5DM7R 2F2XA 1WGSA 2XTIA 1NJ1A 1MMNA 2XKOC 3DLMA 2OAUA 2VVKA 2ZPFB 3H9NA 2HKNA 1NYRA 1M90C 1VQ9T 4CH5A 2CJAA 1VQPQ 4PJOD 4LDVA 1PC0A 2EQIA 2G4CA 4OGEA 1AWWA 2A28A 1K9MC 3NTHA 4JJBA 4RG8A 4BDYA 2QEXA 1N9RA 2D0NA 2QA4Q 4Z89A 1RAAB 5CKBA 3JRZA 4LXCA 4RQEA 5LJ3e 1OPKA 2YSQA 1GFCA 2DEUA 1M8MA 2ZGWA 4E7KA 3G71Q 3UF4A 3VQWA 2E12A 3UT1A 4YDQA 4K86A 3TEGA 3S3MA 1YFRA 5ELOA 2PMEA 4WJ3M 1VQOT 4HA8A 5KE2A 2XMFA 3ICAA 2K5IA 3M4PA 3OS5A 2KMTA 3R6OA 1RL2A 3CCRQ 4WTOB 5LJ5j 2QHVA 1KHCA 3ERRA 3OYCA 3REUA 1GCQC 2EAYA 3CD6A 3EH1A 4OGCA 2DXBA 4PJOA 1Q86R 1WIEA 5GANf 2IIMA 1VQ4Q 5CQXA 4QVDA 2KE9A 2MOXA 2QHSA 2QGGA 2FRYA 4P3OA 2ECZA 3NTIA 4X9CA 1PKSA 2VYTA 1D1BA 1WPYA 2VC8A 2QQRA 4YTLA 5E3IA 5J26A 3H8ZA 3QO3A 3OYJA 1G5IA 2LQWA 1X75C 3CCJA 1KQSS 3I5RA 4J6YA 2C0IA 2V8KA 4MMLA 4N4GA 2ROLA 3CPWP 4FW2A 2L3PA 3IKMB 1W4SA 1GFDA 2DEQA 1Y0MA 2YRVA 1O9SA 3CCMT 3I56A 1IL2A 2JM8A 3JCMe 4PNOA 2COYA 1DJ7B 1XQHA 2RQWA 1KC8C 4TVYA 1V76A 5AYFA 4C0ZA 5KE3A 4MDXA 2RI2A 5L23A 1W66A 1I4K1 1IGUA 2SEMA 3C4SA 3BY7A 4M7AG 4OMPA 3TQ7P 3RL6A 4C8QF 1HSQA 2WSCE 4KGZB 1Z9QA 5FU6C 2FYKA 2XI9A 2GQVA 5GANg 1WHMA 4HVWA 2E65A 2L3QA 1M3BA 2BZ8A 3TVTA 3VQXA 2Q5HA 3QWXX 2KQWA 3A1PA 4RTZA 3G6EQ 4E47A 1ZSZB 4BE0A 4A63B 4FL6A 2DJZA 3H41A 2DD5A 2J7IA 5GAOp 4E7SA 1KIKA 2KK4A 3PMIA 1USYA 2RI3A 4XU3A 4HCZA 1BB9A 1LJOA 2XHCA 3HY1A 4ELZC 2EQMA 2OTJQ 1ADYA 3CBPA 1KMMA 1KK7A 1G2BA 2AKWB 2BZYA 5LJ3j 4XTWA 1ZSGA 1N8RC 3CCQT 3MEWA 2ZZGA 2CIMA 2RHYA 5CKEA 4C5HA 1S1NA 2ALYB 2CP5A 1IB8A 4ZGDB 4L5GA 4BY6B 4EIKA 3MPUB 4OMMA 4CS3A 1SRMA 3X26B 4JJDA 2E5QA 2PMFA 2IPOB 2K9GA 3LX7A 3VQYA 2CJ9A 4ZGJB 1MV0B 2LCLA 3CCVT 1AWXA 2F2VA 3VQVA 3RERA 1G3YA 1QE0A 1IGQA 4LUDA 3OYKA 4BI8B 3OS2A 3MHXA 2C0OA 1RAEB 1S72T 3CEYA 2HEQA 3L2UA 3LWIA 3P8BB 1ZUKA 3INZA 3QO7A 4QT7A 3CXCA 2DIQA 4M78E 3MQZA 4II1A 1OX8A 2EQJA 2DL8A 1AZEA 2VUBA 2KY9A 4FIBA 2P0KA 2BTTA 3EFOA 4KUIA 4Q5WA 1TOVA 1X43A 1AWOA 5HGQA 5FWCA 3HL8A 1SRLA 2LT4A 3NMZC 4H2SA 5FW9A 4HVUA 1ABOA 5GANd 1R8OB 1X56A 2Q7HA 4LVLA 1WJSA 2ZXFA 3CBMA 3M59A 3GPLA 1M30A 1X6BA 2C7IA 2ZPIB 2NUPA 2XIDA 2JN0A 2EJFA 2EYQA 4M75C 4A4EA 3QIIA 2HMAA 2QQAA 4JJCA 4XQ3A 4O6JA 5GAN5 4YRLA 3BDLA 5D6WA 3VUZA 5AT1B 4L87A 4XU0A 4M7AF 4RMOA 2K7AA 2LX9A 2AHJB 3VRZA 1TS9A 4R56A 2Q7GA 4IUQA 1BBWA 2ZZEA 1YCSB 1K1ZA 2QYZA 5IH2A 1YJ9A 1PG5B 4YRKA 2RQRA 3OSVA 2DF6A 4D8DA 4A53A 2HBPA 2MMPA 1VQ8T 4ME7A 4Z88A 1YIJT 1TTHB 1GRIA 2JS2A 2OX7A 2QHTA 1NJ2A 2ZZFA 2DZ9A 4PJOB 5IHNA 4YRNA 1NJ8A 4NL2A 5IAYA 3LYIA 1D1AA 2FZKB 5CKDA 4BE1A 4HWRA 4KH1B 4UP8A 4OMOA 3I55Q 4LNSA 2VASA 4M77C 4H02A 3A8LB 2OTLQ 4BY6C 4FCYA 1M90R 1JXMA 3OYFA 3CCUQ 4RDXA 1JXOA 5CO7A 3M0RA 1Q81C 1PSFA 2K2MA 1NYFA 1K9MR 1VQKA 4P73C 5FLXE 1H92A 1L0WA 3DLLA 1NJIC 2VV5A 1YI2A 2J6KA 2BE7D 1G83A 2XD0A 4P72C 3OYNA 1VQPT 2MAMA 1SHFA 1M2VA 1G3SA 4KR2A 3CC4A 4JJNK 4C92E 3FEOA 1LOJA 1QQJA 2QA4T 2Y90A 1EIYA 2LJ1A 1WLPB 2M51A 3CMAA 1Y7XA 2ATCB 3A8HB 3CCEQ 3A7RA 2RM4A 3CPWA 5D6YA 9ATCB 4X5OA 2X4JA 3DKMA 4OMQA 2M0OA 1N9WA 3S6WA 3G71T 1KFZA 1WHKA 2A08A 1KJWA 3RR6A 2BZXA 4TVAA 1LYLA 1YWPA 4GY5A 1KQSP 5L8RE 1B3QA 3JCMP 1BI2A 4CH4A 3P8TA 1YHQQ 1BU1A 2EJ9A 2XDPA 3SHWA 4ZTJA 3UATA 4YRPA 3CCRT 4YRMA 3M9QA 4F7UA 2EQKA 4E2FB 4M7DD 2L0AA 2QXFA 1E24A 1OZ2A 1O75A 2D0QB 5GANh 1FXXA 4E7ZA 1SRYA 3SDZA 4HWPA 1E7OA 2D6FA 3URGA 2JTMA 1VQ4T 4DOWA 2KYMA 1NLOC 2HCKA 2NS6A 1AEYA 3JAME 5KYXB 2YUOA 3CCLQ 3TU4K 2ZIMA 1ARKA 1B7TA 4J9DA 3VUBA 2E10A 4J8OA 4C92D 2EGCA 3RKWA 2E4HA 2QK0A 5EG2A 4PJOC 4P74A 3P8YA 4WCIA 3PIPA 1JJCA 3OY9A 4HVCA 3MF2A 2Q5IA 1FMKA 4F14A 4M7DA 4RTVA 4BACA 1ZA2B 4AG1C 4AG2C 2EKOA 5IHIA 1C0AA 3MF1A 1B70A 3LC0A 2YRCA 2RD1A 3HTZA 2CH4A 2MCNA 1EIFA 1I81A 4KBMB 1IHVA 4X9DA 2CP0A 1K0SA 1JEGA 2AKKA 1SPKA 4C92A 1M2OA 2XDBA 4XTXA 1YITA 2X4YA 4BB7A 5GMKm 3M0QA 2G3RA 4J9FA 1M1FA 4A4KA 4FYXB 1RUWA 3M0TA 2VKNA 1Z9ZA 5HY6A 1VQLQ 2KSSA 4DEXA 2O2OA 4EMHA 3L2ZA 4LDYA 1X54A 1VQMA 1NJ5A 3G6ET 4AFZC 1VA7A 2ZPGB 2CUBA 2F5TX 2BUDA 2ROTA 2GNCA 4EMKA 3WQZA 3TUPA 2ZCEA 3CC7A 1N8RR 2DERA 1Q82U 2KDSA 1EVKA 1W70A 3CCQA 2RHQA 2OTJT 4C0GA 2KNBB 4M75G 2QDLA 3QTCA 3BW1A 3JCMJ 1UJYA 3QWYA 4RTYA 1MMDA 1VQ6Q 3HHTB 1H4QA 3BE3A 2AIRB 2VWFA 3EGUA 4IUTA 3CCSQ 1USYC 3KFVA 1BIAA 3JB9J 2E5KA 2EBPA 2P84A 2YRDA 3O8VA 5GAN4 3CC2A 3OYMA 4RTTA 1K8AU 4M75A 3QZ5B 4P3PA 1LNXA 1SSHA 2PNIA 4PJMA 4RCCA 1OYXA 2E5AA 4PL6A 3X24B 1C6VX 3NEMA 4YCVA 2LJ3A 1Y07A 2E6ZA 5C53B 4C8QE 1B76A 4M77G 3CMEA 2WACA 2QQSA 2CGHA 1F1BB 2KT1A 2X9HA 3MJXA 2YLCA 2JTFA 2I4LA 2A37A 1B34B 5I22A 1K4US 1QCFA 4A4HA 1UJ0A 2YUQA 4J5YA 2K5FA 5HK0A 3EFRA 4EO4A 1M2VB 3PT9A 2DU5A 3JB9D 1SESA 1D0ZA 2Z0WA 2CYZB 3OBWA 5A0GA 2IVWA 1JJ2A 4RG2A 5GAN3 3RIRA 1KHIA 2LZ6B 5GANe 4OMNA 4DBFA 5CCAA 1WX6A 4YPFA 1ZX6A 4DA4A 4E7HA 1G8XA 1KD1U 4PFOA 4TVAB 2EGAA 5C0MA 4YRRA 2EYWA 1VIFA 1G5HA 1QVFS 3G1JA 2CP2A 3V7CA 1BI3A 4KQEA 1KQSA 4YRTA 4RTUA 4ZTUB 4F7UB 1Z7MA 2RQTA 2GBQA 2XU8A 2GTOA 3PVLA 1SEMA 1Q81R 1M1KU 1X6GA 1D3BA 4F16A 3OD1A 3I55T 3QDRB 1PWTA 4KT0E 1NJIR 2OTLT 2EYYA 3NFCA 3EG0A 4VUBA 2QG9B 1BBZA 4G84A 3CCUT 8AT1B 2EIFA 2YLBA 3LWHA 1VQPA 4JS4A 1WHLA 4BDZA 2KYBA 4IUPA 4BWAA 2JXBA 4TTVA 2A7YA 2LCSA 3H0FA 2O4XA 2MPXC 4M75F 1JO8A 2LQ8A 2QA4A 1A0NB 2Q7EA 5FU6B 2QEXQ 4PJOG 2DL3A 2LRQA 4QKUA 3W3SA 2ZINA 2K5LA 4PJJA 2JVVA 1GBRA 2L2PA 3VU3C 5J3BA 4M7DB 3HXUA 3OMGA 4JDSA 1VIEA 4LUEA 4C5GA 3EG9A 3CCET 3OYYA 2RHSA 2HQXA 3JCMV 2ZT6A 2HL3A 4BW9A 1WHJA 1OZ3A 2QQ9A 2DBMA 3CCRA 3NHNA 4B9XA 5C51B 1M3AA 3VS3A 3OMCA 5GAOl 1OX9A 1YBYA 5HCKA 1JJ2S 4M7AE 2GTJA 1YJNA 5GAN2 1YHQT 4EPCA 3UA6A 3CD6Q 4J9HA 2CUDA 1YB3A 4OB1B 2LCCA 1VQ7A 4M77F 1UGVA 4R0KA 1VQ4A 5A2QE 2EYXA 1IXDA 2E41A 3JCMX 2DYBA 1IZ6A 1YJWA 1PRLC 4Q6GA 4FYWB 4GBQA 5KYUA 3ULRB 4KRTA
chains in the Genus database with same CATH topology
2K57A 3CCLT 3E1SA 2PVGB 3TCJA 4H2XA 4EMKB 3MP6A 1HTTA 2ARTA 2R57A 1HXDA 1Q7YU 1Y96A 3GNGA 3UFGA 5K1PA 4N4HA 4NOYA 4L6V5 1X2HA 2RHQB 5GANj 4NS5A 3OYHA 2DQ3A 3M54A 1BBUA 4M7AD 1H4TA 3ASKA 4P74C 3LLRA 2XK0A 1EQRA 4M75B 2LTOA 2LVMA 3V8LA 3SB2A 1SERA 4M7DC 5GAOr 4RCBA 4KR3A 2RHZA 3M58A 2E3CA 4R55A 3QJYA 2L8DA 3A8GB 2CKKA 3KUFA 5CKFA 4PJOF 1VQLT 3HFOA 3OB9A 2E64A 3QYGB 2XDDA 2LDMA 5A0LA 4C92C 3HFVA 2RJEA 4OB2B 3WXMB 2ARUA 4YP0A 2JZ2A 4M77B 4MZPA 3L2QA 4H2YA 4JRIA 4RKUE 3L4GA 3NENA 2Y4YA 3G4SA 4FSXA 3M4GA 4LD9K 2L89A 1VQ6T 1W2BS 4UC4A 1NNHA 4EMKC 3CCST 1Q82C 2I2LA 4FT4A 3HXWA 1BI1A 3E9GA 4C0DB 1NPRA 1WYDA 4XU1A 3LSQA 1D3BB 2WSFE 3V7RA 3FB9A 3L1AA 4QQGA 4J15A 3IKLA 3SWNA 3MEAA 3MP8A 2DIGA 2ZR3A 4J6XA 1QW1A 2PVDB 1G5VA 2V8IA 3A74A 4O2DA 1B7YA 1G51A 3JB9H 5IN1A 1GXIE 4MZTA 4YRIA 1UGRB 2JOYA 2ZPEB 4HT8A 3SFMA 4LVIA 4YROA 5GMKi 3PFSA 2RHSB 2VGNA 2A3LA 4TQDA 4M78D 1M5Q1 2DAQA 3NETA 2CZ7B 3KFUA 2FB7A 4PG3A 4CS4A 1EFWA 1GGMA 1BIBA 5GAMf 4ZN3A 1I8FA 1VQ9A 5A0DA 2IG0A 4YRQA 5DY9A 4PLIA 3HPWA 2C8MA 1RIQA 4YREA 4EDUA 5LJ3d 3TREA 4P3NA 2FVUA 3A5YA 2IY5A 1FWZA 1KQ1A 1J5WA 4M78A 2CS7A 2QQBA 3OYLA 4C0DC 4F7UG 1VQOA 2P0LA 4IUVA 5KNNA 3G1ZA 5K1XA 3FRNA 2QEXT 4OP0A 4XTVA 3OYIA 2ZNJA 1WNLA 1EOVA 4BE2A 3UDCA 3A8MB 3PNWC 3E9IA 4YRCA 2RK1A 4DOVA 1YFTA 1PSEA 2RK2A 2PVOB 3LGLA 1XNIA 5KH6A 1E1TA 5GAMg 2KVQG 4X34A 3M53A 3CD6T 3HRUA 4XK8E 2DTIA 4XTZA 3GIBA 4M7DG 3QG1A 4IKFA 4OB3B 3FDRA 4QQ6A 3H6ZA 1K73U 3M55A 2NLUA 4FU6A 1KC8U 3RF1A 2DD4A 4JRPA 4K87A 2DK3A 3CCMA 3JCMd 2MF2A 2CZ6B 4C92G 3TEEA 5KCHA 4OMFB 4Y28E 3ER0A 1ZHIA 5CQYA 1KMNA 3A7AA 4AH6A 2XG8D 2XICA 3L4GB 2X4XA 3FIFA 2R5AA 3UGTA 3META 2DKGA 3GP8A 2EL9A 4H2VA 4TWAA 3I56T 5F5WA 1UGPB 2VXEA 4PLLA 4Z02A 3A5ZA 3VBBA 1XOVA 4P75A 3QSUA 2PUOB 2RJCA 3HSBA 1WQWA 2HQEA 3GLXA 4J83A 5LJ3h 1VQNT 5CK9A 2ARSA 1ASZA 3E9HA 4YCUA 5C6SA 3OYAA 5HK3A 4CRIA 5CAIA 2EJGA 2RHUA 4M77E 2ZT5A 4ATOA 5GAMd 2P5IA 4YYEA 1Z7NA 1IREB 5M9OA 4F7UF 4WJ4A 3SWNB 3IG2A 4A54A 1QVFA 3HRIA 3HXXA 1NJ6A 4GLKA 3CCVA 2FL7A 4YRSA 3OW2S 2ZT8A 2GCXA 2RHXA 4J6WA 3QUIA 3HXZA 1VQ6A 2EQUA 4XTUA 1S72A 3QNEA 2JUFA 2EFIA 3HFNA 3OYBA 4XEMA 4M7DF 5GMKh 3OBYA 1E22A 3P8DA 5GAN6 5J39A 2HNIA 3UGQA 2P0PA 2ZIOA 3MEUA 2F69A 3JCMh 5GAN7 5FU7C 3C94A 2ZT7A 4HWOA 3PGGA 1H4SA 4JLGA 2RA2A 1YGBA 4K88A 4C92F 3OYEA 3C12A 3V8KA 4CH3A 4HWTA 3PIOA 1VUBA 3OQ5A 4ZGEB 2IY5B 4BD3A 4A4GA 4M78B 1EIYB 1XTDA 2E70A 3J80E 2PUKB 4QW2A 4PJOE 3E9FA 1SETA 1VQ8A 3KXTA 4UP9A 2LT1A 1YIJA 3QJ6A 1U1TA 4IURA 3JB9G 4E51A 1PYSA 2DU7A 2M1HA 3HKSA 3A31A 3SWNC 3HXYA 4V2SA 1N27A 4C8QD 2AMCA 3RKXA 3RKYA 5GAOm 1H3ZA 1YJ9T 4N0AA 5GAMh 4LVJA 1I5LA 3JCMQ 3IALA 3KBGA 2B8AA 4MZMA 1U1SA 1KOGA 5LJ5f 3RACA 3RUXA 3SD4A 5I21A 3PCOA 4DQ2A 1BYMA 3X25B 3TEHA 1JJCB 5CKHA 2DQ0A 1VQKT 3G71A 1YI2T 4C8QA 4BUGA 4ZIBA 1Q86U 1QVGA 4Y91A 3JCMc 1X55A 3CC4T 1B70B 1YFSA 1QVPA 4P71A 4ZTFA 3CMAT 3QO5A 3A8OB 4HT4A 4M78C 5CVIA 4C92B 3A5ZB 3RMSA 4H2TA 11ASA 2ZCFB 2JNGA 3X20B 2R58A 5LL6S 4PHCA 3HY0A 3RGLA 3WVEB 2E6NA 2ZZDA 2CZ1B 3LGFA 1QF6A 5LJ5g 3RMQA 4TVWA 2M9UA 4H2UA 3I7FA 3QKJA 4A4FA 4EX5A 3V7SA 4JUVA 1W2BA 1WJRA 3HRKA 1H4VB 1B8AA 4XU2A 2DDZA 4JS5A 3CMQA 3JB9F 3MO8A 3M56A 2ODRD 4J7IA 5GMKe 5I2SA 4B9WA 3CBOA 1WJQA 1WLEA 3GF5A 2E1HA 2RO0A 2BIVA 1K73C 4BI4A 3QPHA 2Y4XA 1X01A 1QVGS 5LJ3f 4ELYC 1VQNA 4BI3A 3G6EA 4JLIA 4YRGA 1ADJA 5GAOn 4RQFA 1YITT 4M7AA 2C06A 2ZNIA 1N6AA 4P75C 2DVEA 2OTJA 4TVRA 2VXFA 4J7FA 1NZ9A 1VQMT 1OI1A 5LJ5d 4LDXA 2J3LA 5FRMA 5GAMe 3M4QA 1UB4A 1JBMA 3HRTA 3CC7T 3UWNA 3X28B 2P0QA 3QXEB 1PYSB 2PQWA 2MWOA 1H641 3A7UA 5FRNA 2F5KA 1G3WA 1ZBXA 4CI0C 2DZCA 1FX7A 2AMCB 5LJ3g 2QTXA 2RB6A 1ATIA 3JCMf 3RESA 1RI0A 3CC2T 3L2WA 3NTKA 4LD6A 3BFMA 1BKBA 3J7AF 2HAXA 3DB4A 1VQ5T 4E7IA 1K8AC 1E1OA 1ZQ1A 2GFAA 3P8HA 3PCOB 2O4XB 1G3TA 4MDWA 4N4IA 4TQFA 3TEHB 3CMET 4ZN1A 3V8JA 4OLFA 1P92A 4OVAA 3REXA 4C5IA 4OF1A 4HT9A 4F7UE 4C8QB 2QI2A 1M1GA 5GMKj 2I4NA 2BKDN 4JRQA 1M90U 3M4YA 2DXCA 2DXUA 1K9MU 3I55A 3HFZA 4HWSA 3ZFJA 4M78G 2OTLA 2WSEE 3CCUA 3JCMg 3A32A 2R5MA 4WF2A 1KD1C 4YRJA 3ZEHA 4EMGA 3BDUA 4L59A 5GAN8 4M7DE 5LJ5h 3M57A 2RHIA 1WQ7A 4XEOA 3OSSC 5C52B 1ASYA 3HXVA 1U8RA 2ZPBB 4H2XB 4MMKA 4N0AC 1B34A 1QP2A 5DLOA 1KQ2A 3CXCS 1M1KC 1UGQB 4CS2A 1Y96B 2DTOA 3QHSA 3CCEA 1QP3A 1Y71A 3FJPA 2XGTA 4UP7A 3VYGA 5GAMj 1UGSB 3WVDB 3HP9A 1M9SA 2K3YA 2DXTA 1YHQA 2V8JA 3JB9I 1MHNA 4RMFA 4OB0B 3J81E 3GNFB 4QVCA 3MEVA 3S3NA 1NPPA 2RJDA 4E7JA 4C8QC 3T9NA 3QO8A 3E19A 4HCBA 2ZTGA 4LVKA 1Q86C 2RI5A 3CCLA 1YJNT 2QHUA 5GAOq 3MCAB 3QBYA 3N5BB 4NCXA 2VGMA 1VQ7T 3OW2A 2X35A 4QQDA 4P71C 2LQKA 3Q1JA 4XTYA 1SSFA 3VYHB 2DPPB 4D6WA 4M7AB 4IUUA 2RH2A 1AHJB 3OA6A 2I4OA 1YJWT 2M16A 4LDWA 3CCJT 1M4ZA 5I2MA 3PTAA 2ZPHB 3GOXA 4Q15A 4M75E 4E7LA 3G7ZA 4YCWA 3DSQA 5HKCA 3JSCA 2PU9B 4DPGA 5FU7B 3JCMW 2MI6A 2FHDA 1EVLA 1VQZA 4M78F 2K4YA 4ZTZB 3AHUA 1Q7YC 2L3RA 4C5EA 1HK9A 3MEYA 1V29B 3UH0A 3OS1A 12ASA 3CPWS 3QYHB 1N8RU 1VQLA 1NE8A 2CZ0B 4H2WA 2LNVA 1MGQA 1JRIA 5FROA 2GF7A 2I4MA 3EFSA 3L2VA 3S3OA 3VKIA 4M75D 4O5VA 2X4WA 3LW5E 3ZBDA 5ELNA 4YRFA 2CJBA 1B7YB 1X2GA 5KCOA 4WI1A 3C95A 2EWNA 2K2VA 2ZR2A 3M5AA 2RJFA 4QVZA 1JB0E 2ODRC 1KG1A 3CCSA 4M7AC 3CPFA 1N9SA 5LJ5e 1FYFA 2KAFA 3MP1A 4FT2A 3P8VA 3LH0A 4XAXB 3G4ST 2QDYB 3NELA 3BJUA 5GMKl 3LSSA 4M77D 3HFZB 3QZ9B 1X6OA 5D6XA 3JCMb 4LDUA 1TH7A 2LC4A 1WU7A 4P5NA 4HCCA 3PMTA 4CH6A 4FM4B 5IT9E 3VV0A 3OYDA 1VQ5A 5CIUA 3F70A 1UEBA 3DB3A 2H3JA 2O01E 3R07A 3FC3A 3PZCA 4JRKA 4NL3A 1NYQA 3EAEA 2J3MA 3FLGA 2AKWA 2P4TA 3UPUA 3L2RA 4M77A 2ALYA 2D9TA 4G85A 3L42A 1Q81U 2YHTA 4PKCC 4KUDK 5CR2A 1HC7A 4LVMA 2K3XA 2A8EA 2HD0A 3OYGA 4P73A 2MWPA 1NJIU 5DLQE 3VJPA 3ME9A 3OS0A 4HKEA 1YCYA 2L5QA 4P72A 2DTHA 1BI0A 4UPAA 4C0FA 1M8VA 2DO3A 4KULA 4C8QG 2GFUA 3HRSA 5DM7R 2XTIA 1WGSA 1NJ1A 2XKOC 3DLMA 2OAUA 2ZPFB 1NYRA 1M90C 1VQ9T 4CH5A 2CJAA 4PJOD 4LDVA 2G4CA 4OGEA 1K9MC 3NTHA 4RG8A 4BDYA 2QEXA 1N9RA 5CKBA 3JRZA 4RQEA 5LJ3e 2ZGWA 4E7KA 3VQWA 2E12A 3UT1A 4YDQA 4K86A 3TEGA 3S3MA 1YFRA 5ELOA 2PMEA 4WJ3M 1VQOT 4HA8A 5KE2A 3ICAA 2K5IA 3M4PA 3OS5A 2KMTA 3R6OA 1RL2A 5LJ5j 2QHVA 1KHCA 3ERRA 3OYCA 3REUA 2EAYA 3CD6A 4OGCA 2DXBA 4PJOA 5GANf 5CQXA 4QVDA 2QHSA 4P3OA 3NTIA 4X9CA 2VYTA 1WPYA 2VC8A 2QQRA 4YTLA 5E3IA 5J26A 3H8ZA 3QO3A 3OYJA 1G5IA 1X75C 3CCJA 1KQSS 4J6YA 2V8KA 4MMLA 4N4GA 3IKMB 1W4SA 2DEQA 2YRVA 1O9SA 3CCMT 3I56A 1IL2A 3JCMe 4PNOA 1DJ7B 1XQHA 1KC8C 4TVYA 4C0ZA 5AYFA 5KE3A 4MDXA 2RI2A 1W66A 1I4K1 3C4SA 3BY7A 4M7AG 3RL6A 4C8QF 2WSCE 5FU6C 2FYKA 2XI9A 2GQVA 5GANg 2E65A 3VQXA 2Q5HA 2KQWA 4E47A 4BE0A 4FL6A 2DJZA 2DD5A 5GAOp 2KK4A 3PMIA 1USYA 2RI3A 4XU3A 4HCZA 1LJOA 2XHCA 3HY1A 4ELZC 2EQMA 1ADYA 1KMMA 3CBPA 2AKWB 5LJ3j 4XTWA 1N8RC 3CCQT 3MEWA 2ZZGA 2CIMA 2RHYA 5CKEA 4C5HA 2ALYB 4ZGDB 4L5GA 4BY6B 4CS3A 3X26B 2E5QA 2PMFA 3LX7A 3VQYA 2CJ9A 4ZGJB 2LCLA 3CCVT 3VQVA 3RERA 1G3YA 1QE0A 3OYKA 4BI8B 3OS2A 3MHXA 1S72T 3CEYA 3L2UA 3LWIA 3P8BB 3INZA 3QO7A 3CXCA 2DIQA 4M78E 3MQZA 4II1A 2EQJA 2VUBA 2KY9A 4FIBA 2P0KA 4KUIA 4Q5WA 5HGQA 3HL8A 2LT4A 4H2SA 5GANd 1R8OB 1X56A 2Q7HA 4LVLA 1WJSA 2ZXFA 3CBMA 3M59A 3GPLA 2C7IA 2ZPIB 2XIDA 2JN0A 2EJFA 2EYQA 4M75C 4A4EA 3QIIA 2QQAA 4XQ3A 4O6JA 5GAN5 4YRLA 3BDLA 5D6WA 3VUZA 4L87A 4XU0A 4M7AF 4RMOA 2LX9A 2AHJB 4R56A 2Q7GA 4IUQA 1BBWA 2ZZEA 1YJ9A 4YRKA 3OSVA 4A53A 2HBPA 2MMPA 1VQ8T 4ME7A 1YIJT 2QHTA 1NJ2A 2ZZFA 2DZ9A 4PJOB 4YRNA 1NJ8A 4NL2A 5IAYA 3LYIA 5CKDA 4BE1A 4HWRA 4UP8A 4LNSA 4M77C 4H02A 3A8LB 4BY6C 3OYFA 4RDXA 5CO7A 1Q81C 1PSFA 1VQKA 4P73C 5FLXE 1L0WA 3DLLA 1NJIC 2VV5A 1YI2A 2XD0A 4P72C 3OYNA 1VQPT 2MAMA 1G3SA 4KR2A 3CC4A 4JJNK 4C92E 3FEOA 1LOJA 2QA4T 2Y90A 1EIYA 3CMAA 1Y7XA 3A8HB 3A7RA 2RM4A 3CPWA 5D6YA 4X5OA 2X4JA 3DKMA 2M0OA 1N9WA 3S6WA 3G71T 4TVAA 1LYLA 4GY5A 5L8RE 3JCMP 1BI2A 4CH4A 3P8TA 2EJ9A 2XDPA 4ZTJA 4YRPA 3CCRT 4YRMA 3M9QA 4F7UA 2EQKA 4M7DD 2QXFA 1E24A 1OZ2A 1O75A 2D0QB 5GANh 1FXXA 1SRYA 3SDZA 4HWPA 2D6FA 3URGA 2JTMA 1VQ4T 4DOWA 2NS6A 3JAME 3TU4K 2ZIMA 3VUBA 2E10A 4J8OA 4C92D 3RKWA 5EG2A 4PJOC 4P74A 3P8YA 3PIPA 1JJCA 3OY9A 4HVCA 3MF2A 2Q5IA 4M7DA 4BACA 2EKOA 1C0AA 3MF1A 1B70A 3LC0A 2RD1A 3HTZA 1EIFA 1I81A 4KBMB 4X9DA 4C92A 2XDBA 4XTXA 1YITA 2X4YA 4BB7A 5GMKm 2G3RA 1M1FA 4A4KA 5HY6A 2KSSA 4EMHA 3L2ZA 4LDYA 1X54A 1VQMA 1NJ5A 3G6ET 2ZPGB 2F5TX 2BUDA 4EMKA 3WQZA 3TUPA 2ZCEA 3CC7A 1Q82U 2KDSA 1EVKA 3CCQA 2RHQA 2OTJT 4C0GA 4M75G 3QTCA 3BW1A 3JCMJ 3HHTB 1H4QA 4IUTA 1USYC 1BIAA 3JB9J 5GAN4 3O8VA 3CC2A 3OYMA 1K8AU 4M75A 3QZ5B 4P3PA 1LNXA 4RCCA 1OYXA 2E5AA 4PL6A 3X24B 3NEMA 4YCVA 1Y07A 2E6ZA 5C53B 4C8QE 1B76A 4M77G 3CMEA 2WACA 2QQSA 2CGHA 2YLCA 2JTFA 2I4LA 1B34B 4A4HA 4J5YA 2K5FA 5HK0A 3EFRA 4EO4A 3PT9A 2DU5A 3JB9D 1SESA 2CYZB 3OBWA 5A0GA 2IVWA 1JJ2A 5GAN3 4RG2A 3RIRA 1KHIA 5GANe 5CCAA 4YPFA 4DA4A 4E7HA 1KD1U 4TVAB 5C0MA 4YRRA 1VIFA 1G5HA 1QVFS 3V7CA 1BI3A 4KQEA 1KQSA 4YRTA 4ZTUB 4F7UB 1Z7MA 2XU8A 1M1KU 1D3BA 3OD1A 3I55T 3QDRB 4KT0E 2OTLT 3NFCA 4VUBA 4G84A 3CCUT 2EIFA 2YLBA 3LWHA 1VQPA 4JS4A 4BDZA 4IUPA 4BWAA 4TTVA 2A7YA 2O4XA 4M75F 2LQ8A 2QA4A 2Q7EA 5FU6B 4PJOG 2LRQA 3W3SA 2ZINA 2K5LA 2JVVA 3VU3C 5J3BA 4M7DB 3HXUA 3OMGA 4JDSA 1VIEA 4C5GA 3CCET 2RHSA 3OYYA 2HQXA 3JCMV 2ZT6A 4BW9A 1OZ3A 2QQ9A 3CCRA 4B9XA 5C51B 3OMCA 5GAOl 1YBYA 1JJ2S 4M7AE 1YJNA 5GAN2 1YHQT 4EPCA 1YB3A 4OB1B 2LCCA 1VQ7A 4M77F 1VQ4A 5A2QE 2E41A 3JCMX 1IZ6A 1YJWA 4Q6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN d;  4M7A B;  2K57 A;  1X56 A;  2Q7H A;  2RA2 A;  1YGB A;  4K88 A;  2I4O A;  4C92 F;  2ZXF A;  3V8K A;  4CH3 A;  4HWT A;  2C7I A;  2IY5 B;  4H2X A;  2JN0 A;  2EJF A;  4EMK B;  4M75 C;  4M78 B;  1EIY B;  1HTT A;  2ART A;  4Q15 A;  1HXD A;  4M75 E;  4XQ3 A;  4PJO E;  1Y96 A;  3UFG A;  5K1P A;  4NOY A;  1X2H A;  5GAN 5;  2RHQ B;  4YRL A;  5GAN j;  1SET A;  4YCW A;  3DSQ A;  4L87 A;  2DQ3 A;  4XU0 A;  4UP9 A;  4M7A F;  4DPG A;  1BBU A;  2Q7G A;  3JCM W;  1U1T A;  3JB9 G;  1BBW A;  2ZZE A;  4E51 A;  4M7A D;  1PYS A;  2DU7 A;  3A31 A;  1H4T A;  3SWN C;  1EVL A;  4YRK A;  1VQZ A;  4A53 A;  4M78 F;  3HXY A;  4P74 C;  4V2S A;  4ZTZ B;  3AHU A;  4C8Q D;  2AMC A;  3RKX A;  3RKY A;  2QHT A;  5GAO m;  1NJ2 A;  2ZZF A;  1HK9 A;  1EQR A;  4M75 B;  2DZ9 A;  4N0A A;  4PJO B;  3MEY A;  3UH0 A;  5GAM h;  4YRN A;  1NJ8 A;  4NL2 A;  12AS A;  3V8L A;  3SB2 A;  1SER A;  4M7D C;  4HWR A;  1I5L A;  5GAO r;  4UP8 A;  3JCM Q;  3IAL A;  4RCB A;  4LNS A;  4M77 C;  4KR3 A;  4H02 A;  2E3C A;  4RDX A;  4H2W A;  1U1S A;  1KOG A;  5LJ5 f;  3RAC A;  3RUX A;  1MGQ A;  1JRI A;  4P73 C;  5I21 A;  3PCO A;  4DQ2 A;  1L0W A;  2I4M A;  3EFS A;  4PJO F;  3HFO A;  3TEH A;  2E64 A;  4P72 C;  1JJC B;  4M75 D;  4C92 C;  2DQ0 A;  3HFV A;  4KR2 A;  4C92 E;  5ELN A;  4YRF A;  1LOJ A;  2CJB A;  1B7Y B;  2ARU A;  2Y90 A;  4YP0 A;  1X2G A;  4C8Q A;  1EIY A;  4ZIB A;  4M77 B;  4WI1 A;  4H2Y A;  2EWN A;  3A7R A;  2RM4 A;  4JRI A;  2ZR2 A;  4Y91 A;  3JCM c;  4X5O A;  1X55 A;  3L4G A;  3NEN A;  1N9W A;  2ODR C;  1B70 B;  1YFS A;  4M7A C;  4TVA A;  3M4G A;  1LYL A;  4P71 A;  1N9S A;  3JCM P;  3QO5 A;  5LJ5 e;  4CH4 A;  1FYF A;  3P8T A;  3P8V A;  1NNH A;  4EMK C;  2EJ9 A;  4M78 C;  4C92 B;  4YRP A;  4YRM A;  3NEL A;  4H2T A;  3BJU A;  4F7U A;  5GMK l;  4M7D D;  1E24 A;  11AS A;  2I2L A;  5GAN h;  4M77 D;  3LSS A;  3HXW A;  1SRY A;  3HFZ B;  4PHC A;  4HWP A;  3HY0 A;  3RGL A;  3JCM b;  1TH7 A;  1WU7 A;  4CH6 A;  1WYD A;  4XU1 A;  3LSQ A;  1D3B B;  3V7R A;  3FB9 A;  3L1A A;  2ZIM A;  4J15 A;  1QF6 A;  5LJ5 g;  4TVW A;  3IKL A;  3R07 A;  4H2U A;  3I7F A;  2E10 A;  3SWN A;  4C92 D;  3PZC A;  3RKW A;  4JRK A;  4NL3 A;  1NYQ A;  4PJO C;  4P74 A;  3P8Y A;  4EX5 A;  3V7S A;  2ZR3 A;  4JUV A;  4J6X A;  1JJC A;  2J3M A;  3HRK A;  1H4V B;  2AKW A;  1B8A A;  4XU2 A;  2DDZ A;  4HVC A;  3MF2 A;  2Q5I A;  3CMQ A;  3A74 A;  3JB9 F;  4O2D A;  1B7Y A;  4M7D A;  2ODR D;  1G51 A;  3JB9 H;  4M77 A;  2ALY A;  5GMK e;  4YRI A;  4G85 A;  1WLE A;  2E1H A;  4HT8 A;  1C0A A;  2YHT A;  3MF1 A;  4YRO A;  1B70 A;  1HC7 A;  5GMK i;  3LC0 A;  2RHS B;  4TQD A;  4M78 D;  1M5Q 1;  2RD1 A;  4P73 A;  3HTZ A;  3NET A;  1X01 A;  3KFU A;  2FB7 A;  1I81 A;  5LJ3 f;  1YCY A;  4PG3 A;  4X9D A;  4P72 A;  4CS4 A;  1EFW A;  2DTH A;  1BIB A;  1GGM A;  5GAM f;  4C92 A;  4XTX A;  4UPA A;  5GMK m;  1I8F A;  1M8V A;  4YRQ A;  4C8Q G;  5DY9 A;  4JLI A;  2XTI A;  1NJ1 A;  4YRG A;  1ADJ A;  5GAO n;  4RQF A;  1NYR A;  4M7A A;  2C8M A;  1RIQ A;  4EMH A;  3L2Z A;  2CJA A;  4CH5 A;  4PJO D;  2G4C A;  4YRE A;  2ZNI A;  1X54 A;  5LJ3 d;  1NJ5 A;  4P3N A;  4P75 C;  2DVE A;  3A5Y A;  2IY5 A;  1N9R A;  1KQ1 A;  2VXF A;  1J5W A;  4EMK A;  3WQZ A;  3TUP A;  4M78 A;  2ZCE A;  1EVK A;  4RQE A;  4F7U G;  5LJ3 e;  5LJ5 d;  2P0L A;  2RHQ A;  2ZGW A;  2J3L A;  5KNN A;  5GAM e;  3G1Z A;  4M75 G;  3M4Q A;  5K1X A;  4OP0 A;  3VQW A;  3QTC A;  3BW1 A;  4XTV A;  2ZNJ A;  1JBM A;  3JCM J;  4YDQ A;  4K86 A;  3TEG A;  1YFR A;  5ELO A;  1WNL A;  1EOV A;  2PME A;  4WJ3 M;  4HA8 A;  3ICA A;  1H4Q A;  3M4P A;  3E9I A;  1PYS B;  4YRC A;  1USY C;  1BIA A;  5LJ5 j;  3JB9 J;  2QHV A;  3ERR A;  1H64 1;  3A7U A;  5GAN 4;  3REU A;  2EAY A;  1YFT A;  2DZC A;  4M75 A;  4PJO A;  4P3P A;  1LNX A;  2AMC B;  5LJ3 g;  5GAN f;  2QTX A;  4RCC A;  1E1T A;  2RB6 A;  5GAM g;  1ATI A;  2E5A A;  3JCM f;  4QVD A;  2QHS A;  3RES A;  3NEM A;  4P3O A;  4X9C A;  4YCV A;  2DTI A;  4XTZ A;  3GIB A;  5C53 B;  4M7D G;  4C8Q E;  1B76 A;  1WPY A;  2VC8 A;  3BFM A;  4M77 G;  5E3I A;  3QO3 A;  1G5I A;  2CGH A;  1E1O A;  2YLC A;  3PCO B;  2I4L A;  3RF1 A;  1B34 B;  4J6Y A;  4TQF A;  3TEH B;  4J5Y A;  3V8J A;  4OLF A;  4K87 A;  3EFR A;  4EO4 A;  4MML A;  3JCM d;  3REX A;  2DU5 A;  3JB9 D;  1SES A;  4C92 G;  4HT9 A;  4F7U E;  3IKM B;  4C8Q B;  5GAN 3;  2DEQ A;  3RIR A;  5GAN e;  1KMN A;  3A7A A;  4AH6 A;  5GMK j;  2I4N A;  1IL2 A;  3JCM e;  4PNO A;  4YPF A;  3L4G B;  4TVY A;  3FIF A;  1W66 A;  3UGT A;  4TVA B;  1I4K 1;  2DKG A;  4YRR A;  2EL9 A;  1G5H A;  3BY7 A;  4M7A G;  4H2V A;  4TWA A;  5F5W A;  2VXE A;  2DXU A;  3V7C A;  3A5Z A;  4KQE A;  3VBB A;  3RL6 A;  4P75 A;  3QSU A;  4C8Q F;  4YRT A;  3HSB A;  1WQW A;  3HFZ A;  4HWS A;  4ZTU B;  4F7U B;  1Z7M A;  2FYK A;  4M78 G;  5LJ3 h;  2ARS A;  5GAN g;  1ASZ A;  3E9H A;  4YCU A;  3JCM g;  3A32 A;  2E65 A;  4WF2 A;  1D3B A;  4YRJ A;  3OD1 A;  4EMG A;  3VQX A;  3BDU A;  5CAI A;  5GAN 8;  2Q5H A;  4M7D E;  2EJG A;  5LJ5 h;  1WQ7 A;  4G84 A;  4M77 E;  2ZT5 A;  4XEO A;  5C52 B;  2YLB A;  5GAM d;  2DJZ A;  2P5I A;  4YYE A;  1Z7N A;  5GAO p;  1ASY A;  3HXV A;  4F7U F;  4WJ4 A;  4BWA A;  1USY A;  3SWN B;  4TTV A;  4XU3 A;  3IG2 A;  4H2X B;  4A54 A;  1LJO A;  4MMK A;  4M75 F;  4N0A C;  3HY1 A;  1B34 A;  1KQ2 A;  3HRI A;  2Q7E A;  1ADY A;  1KMM A;  4CS2 A;  1Y96 B;  2DTO A;  4PJO G;  2AKW B;  3QHS A;  5LJ3 j;  3HXX A;  4XTW A;  3W3S A;  2ZIN A;  3FJP A;  1NJ6 A;  2XGT A;  4UP7 A;  5GAM j;  3VU3 C;  4M7D B;  4YRS A;  2ZZG A;  2CIM A;  3HXU A;  2ZT8 A;  2ALY B;  4CS3 A;  4J6W A;  3QUI A;  3HXZ A;  2RHS A;  2DXT A;  2PMF A;  3JCM V;  4XTU A;  2ZT6 A;  3VQY A;  2CJ9 A;  4BW9 A;  3JB9 I;  4RMF A;  3VQV A;  5C51 B;  3RER A;  1QE0 A;  3QNE A;  5GAO l;  4QVC A;  4M7A E;  3HFN A;  5GAN 2;  4XEM A;  4M7D F;  4C8Q C;  1YB3 A;  3QO8 A;  3INZ A;  4M77 F;  5GMK h;  3QO7 A;  2ZTG A;  4M78 E;  1E22 A;  5GAN 6;  2HNI A;  2E41 A;  3JCM X;  3UGQ A;  2ZIO A;  2QHU A;  5GAO q;  3JCM h;  4Q6G A;  5GAN 7;  5HGQ A;  4NCX A;  2ZT7 A;  4P71 C;  4HWO A;  3PGG A;  4XTY A;  4H2S A;  1H4S A; 
#chains in the Genus database with same CATH topology
 2K57 A;  2MK5 A;  4ORZ A;  3CCL T;  2HSP A;  3SEM A;  3E1S A;  2PVG B;  2RQV A;  3TCJ A;  4H2X A;  1R77 A;  1TUG B;  4EMK B;  1I5O B;  3MP6 A;  2CT4 A;  1OU8 A;  1HTT A;  2ART A;  2R57 A;  2LQN A;  1HXD A;  1ZLM A;  1B07 A;  1Q7Y U;  1Y96 A;  3GNG A;  3UFG A;  5K1P A;  4N4H A;  4NOY A;  4L6V 5;  1X2H A;  2RHQ B;  2YDL A;  7AT1 B;  2FPD A;  5GAN j;  1K9A A;  4NS5 A;  3OYH A;  2DQ3 A;  3M54 A;  1BBU A;  2V1R A;  4M7A D;  1T3L A;  4DBR A;  3I56 Q;  1H4T A;  3ASK A;  1I07 A;  4P74 C;  4DBH A;  4JPB W;  3LLR A;  2XK0 A;  1VQN Q;  3EG2 A;  2NUT B;  1EQR A;  4M75 B;  2LTO A;  2LVM A;  4RUG A;  3THK A;  3V8L A;  3SB2 A;  1SER A;  2W0Z A;  4M7D C;  5GAO r;  4RCB A;  2J6F A;  4KR3 A;  3R6N A;  2RHZ A;  3M58 A;  2E3C A;  3EG3 A;  4R55 A;  3QJY A;  2L8D A;  4Z8A A;  3A8G B;  1AWJ A;  2CKK A;  4LE9 A;  3KUF A;  4HVV A;  5CKF A;  4PJO F;  1VQL T;  4HXJ A;  2FO0 A;  3HFO A;  3OB9 A;  2DIL A;  2A36 A;  2E64 A;  3QYG B;  1NBE B;  2HDA A;  2XDD A;  2LDM A;  5A0L A;  4C92 C;  3HFV A;  1OQK A;  4LN2 A;  2RJE A;  4OB2 B;  3WXM B;  2ARU A;  4YP0 A;  3UA7 A;  3VS7 A;  2JZ2 A;  4M77 B;  4MZP A;  3L2Q A;  4H2Y A;  4OML A;  4JRI A;  1LPL A;  4RKU E;  3L4G A;  3NEN A;  2Y4Y A;  2FEI A;  4AFU C;  3G4S A;  4LNP A;  2OI3 A;  4FYV B;  2DLP A;  4FSX A;  3M4G A;  4LD9 K;  2L89 A;  1VQ6 T;  1TU0 B;  1W2B S;  4UC4 A;  2SRC A;  1NNH A;  4EMK C;  3CCS T;  1Q82 C;  2I2L A;  4FT4 A;  3HXW A;  1Q95 G;  2CDT A;  1LCK A;  1BI1 A;  1C0M A;  3E9G A;  4C0D B;  1NPR A;  1WYD A;  4XU1 A;  2DL5 A;  3LSQ A;  3M0U A;  1D3B B;  2WSF E;  3V7R A;  3FB9 A;  3L1A A;  4QQG A;  2CP3 A;  3RBB B;  1UFF A;  4J15 A;  4AFQ C;  1QVF P;  3IKL A;  2EGE A;  3SWN A;  1T3S A;  3MEA A;  3MP8 A;  2COZ A;  4PJL A;  2DIG A;  2ZR3 A;  4J6X A;  1QW1 A;  2PVD B;  1G5V A;  2V8I A;  2PZ1 A;  1GBQ A;  2V26 A;  3A74 A;  3JV3 A;  4O2D A;  1B7Y A;  1D0X A;  1G51 A;  3JB9 H;  5IN1 A;  1GXI E;  4MZT A;  4YRI A;  4K11 A;  1UGR B;  2MIO A;  3EGX A;  8ATC B;  2JOY A;  2ZPE B;  4HT8 A;  3SFM A;  3EG9 B;  4LVI A;  4YRO A;  1VOM A;  4ANJ A;  5GMK i;  3PFS A;  2RHS B;  2VGN A;  2A3L A;  2NYS A;  4TQD A;  1I0C A;  4M78 D;  2KXD A;  1M5Q 1;  2DAQ A;  3NET A;  1NG2 A;  1UEC A;  5FWB A;  2DMO A;  1YJ9 Q;  2CZ7 B;  3KFU A;  2FB7 A;  1R0B G;  1QWE A;  1RAB B;  4PG3 A;  1T0H A;  1ZBJ A;  4J9I A;  4CS4 A;  1EFW A;  1GGM A;  1BIB A;  5GAM f;  4ZN3 A;  1D1C A;  1I8F A;  1OPL A;  1VQ9 A;  5A0D A;  2IG0 A;  4YRQ A;  5DY9 A;  2DJQ A;  5EC7 A;  2EVR A;  4PLI A;  4PFP A;  3HPW A;  5KYU B;  2C8M A;  1CKB A;  2DVJ A;  1RIQ A;  4YRE A;  4EDU A;  1JJ2 P;  5LJ3 d;  3TRE A;  1VQK Q;  2FVU A;  4P3N A;  3A5Y A;  2IY5 A;  1FWZ A;  1KQ1 A;  1YI2 Q;  1J5W A;  4M78 A;  3MKD A;  2CS7 A;  1YNZ A;  2QQB A;  3OYL A;  2FPE A;  4C0D C;  2HSE B;  4F7U G;  1VQO A;  2P0L A;  4IUV A;  3CC4 Q;  5KNN A;  1WDX A;  3G1Z A;  3FRN A;  2QEX T;  5K1X A;  4OP0 A;  1PHT A;  4XTV A;  3OYI A;  2ZNJ A;  4JZ4 A;  5KYW A;  3CMA Q;  1WNL A;  1EOV A;  4BE2 A;  3UDC A;  3A8M B;  3PNW C;  3E9I A;  1MUZ A;  1W6X A;  2VB6 A;  4YRC A;  1MV3 A;  2L3S A;  2RK1 A;  4DOV A;  1H3H A;  4CC4 B;  1YFT A;  1PSE A;  2RK2 A;  2PVO B;  3LGL A;  2YXY A;  1XNI A;  5KH6 A;  1E1T A;  5GAM g;  2KVQ G;  3PE0 A;  4X34 A;  3M53 A;  3CD6 T;  3HRU A;  4XK8 E;  2DTI A;  4XTZ A;  3GIB A;  4M7D G;  3QG1 A;  4IKF A;  1QKX A;  4OB3 B;  3FDR A;  4QQ6 A;  3H6Z A;  2COW A;  3M55 A;  2NLU A;  1K73 U;  4FU6 A;  1KC8 U;  3RF1 A;  2LMJ A;  2DD4 A;  4JRP A;  4K87 A;  2DK3 A;  3CCM A;  2DL7 A;  1GL5 A;  3JCM d;  2FZG B;  2MF2 A;  2CZ6 B;  4C92 G;  2F1L A;  2P4R A;  3TEE A;  5KCH A;  3H0H A;  4OMF B;  4Y28 E;  3ER0 A;  1ZHI A;  5CQY A;  1KMN A;  2ZAE A;  1QCO A;  3A7A A;  4AH6 A;  2XG8 D;  2XIC A;  3L4G B;  1RI9 A;  2X4X A;  2EKH A;  3FIF A;  2R5A A;  3UGT A;  3MET A;  2DKG A;  3GP8 A;  1TWB A;  2EL9 A;  4H2V A;  4TWA A;  3I56 T;  5F5W A;  1UGP B;  2VXE A;  4PLL A;  4Z02 A;  2FG0 A;  2J05 A;  3VS4 A;  3A5Z A;  3VBB A;  4ESR A;  1XOV A;  4P75 A;  3QSU A;  2PUO B;  2RJC A;  3HSB A;  2X3W D;  1WQW A;  2HQE A;  3GLX A;  4J83 A;  5LJ3 h;  1VQN T;  5CK9 A;  2ARS A;  1ASZ A;  3E9H A;  4YCU A;  3EFO B;  4CC2 A;  2GGR A;  1YIT Q;  5C6S A;  1AOJ A;  1TSF A;  2KEA A;  3OYA A;  5HK3 A;  3EHR A;  1X2K A;  4CRI A;  2ED0 A;  5CAI A;  2EJG A;  2RHU A;  4M77 E;  2ZT5 A;  2HBW A;  4ATO A;  1W2B P;  5GAM d;  2P5I A;  4YYE A;  1Z7N A;  2CT3 A;  1IRE B;  5M9O A;  4F7U F;  4WJ4 A;  4J9C A;  4B6M A;  3SWN B;  5D7U A;  2NUP B;  3IG2 A;  1CSK A;  4A54 A;  3A98 A;  1VQM Q;  1QVF A;  2CP6 A;  3HRI A;  1WXU A;  2W10 A;  2DFU A;  2X3X D;  3HXX A;  3CC7 Q;  3TSW A;  1OV3 A;  1NJ6 A;  4GLK A;  3CCV A;  2FL7 A;  1X2Q A;  4YRS A;  3OW2 S;  1RLP C;  2ZT8 A;  2OAW A;  4F04 B;  2GCX A;  2RHX A;  4J6W A;  3QUI A;  3EGX B;  3HXZ A;  1VQ6 A;  2EQU A;  1WXT A;  4XTU A;  1S72 A;  2D8J A;  5KYY A;  4HCK A;  3QNE A;  1Q82 R;  2JUF A;  4ZNX A;  2EFI A;  3HFN A;  2YT6 A;  2MYS A;  3OYB A;  4XEM A;  2RF0 A;  3CC2 Q;  4M7D F;  2KT8 A;  2KRN A;  5GMK h;  3OBY A;  1E22 A;  3P8D A;  5GAN 6;  5J39 A;  2HNI A;  3UGQ A;  2P0P A;  2ZIO A;  3MEU A;  3RDV A;  2F69 A;  4KH0 B;  1VQ5 Q;  3JCM h;  5GAN 7;  5FU7 C;  2DRM A;  3C94 A;  1OEB A;  2ZT7 A;  4HWO A;  3PGG A;  1PCX A;  3VS0 A;  1H4S A;  1K8A R;  4JLG A;  1SHG A;  1ZSZ A;  2RA2 A;  3CME Q;  1YGB A;  4K88 A;  1M27 C;  4C92 F;  3OYE A;  3C12 A;  3V8K A;  4CH3 A;  2KI7 A;  4HWT A;  3PIO A;  1VUB A;  1D09 B;  3OQ5 A;  1BCO A;  4ZGE B;  2PTK A;  2IY5 B;  4BD3 A;  4A4G A;  1VYV A;  4M78 B;  1EIY B;  3VS6 A;  1FMW A;  1XTD A;  2E70 A;  3J80 E;  1TUC A;  2CSQ A;  2PUK B;  4QW2 A;  4PJO E;  3E9F A;  3VS2 A;  1BCM A;  1JU5 C;  1SET A;  1VQ8 A;  3KXT A;  4UP9 A;  2LT1 A;  3VS1 A;  2JM9 A;  1YIJ A;  3QJ6 A;  1U1T A;  1CKA A;  4IUR A;  5KYW B;  3JB9 G;  1PYS A;  2DU7 A;  2M1H A;  3HKS A;  3A31 A;  4E51 A;  2DX1 A;  3SWN C;  4AFS C;  3HXY A;  4V2S A;  1N27 A;  1MMA A;  4C8Q D;  2AMC A;  3RKX A;  3RKY A;  5GAO m;  1H3Z A;  2YUN A;  1YJ9 T;  4N0A A;  1E6G A;  5GAM h;  4LVJ A;  4FW1 A;  1HJD A;  1I5L A;  2DET A;  1ABQ A;  3JCM Q;  3IAL A;  1PRM C;  1KD1 R;  1U3O A;  3KBG A;  2B8A A;  4MZM A;  1U1S A;  5KYN A;  1KOG A;  5LJ5 f;  3RAC A;  3RUX A;  1EFN A;  1VYU A;  2O9S A;  3SD4 A;  5I21 A;  3PCO A;  4DQ2 A;  1OUL A;  2O31 A;  1BYM A;  1WZO A;  2E3I A;  3X25 B;  3TEH A;  2H3E B;  2V1Q A;  1JJC B;  5CKH A;  2DQ0 A;  2RN8 A;  2X51 A;  3CQT A;  1VQK T;  3ZL7 C;  1M1K R;  1ZA1 B;  2NUZ A;  3G71 A;  1YI2 T;  4C8Q A;  4BUG A;  4ZIB A;  1Q86 U;  1Y57 A;  1QVG A;  4Y91 A;  3JCM c;  1X55 A;  3CC4 T;  1K76 A;  4F17 A;  1B70 B;  1YFS A;  1YFN A;  1QVP A;  1T0J A;  2EYZ A;  2ENM A;  1PNJ A;  1AD5 A;  2FRW A;  4P71 A;  1YP5 A;  4ZTF A;  3CMA T;  2DRK A;  3QO5 A;  3A8O B;  4HT4 A;  4M78 C;  5CVI A;  2JW4 A;  4C92 B;  3A5Z B;  3RMS A;  4H2T A;  5IXF A;  1ACM B;  11AS A;  2ZCF B;  1WHG A;  2JNG A;  3X20 B;  2R58 A;  5LL6 S;  1IRX A;  1YJN Q;  2J6O A;  4PHC A;  3HY0 A;  3RGL A;  2KRO A;  2KBT A;  3WVE B;  1VQ7 Q;  2E6N A;  2ZZD A;  2JTE A;  4E6R A;  1UHF A;  2CZ1 B;  1VYT A;  2RPN A;  2DBK A;  2DM1 A;  3LGF A;  1YJW Q;  5LJ5 g;  1QF6 A;  3RMQ A;  4PK4 A;  2HKQ B;  4TVW A;  3CCJ Q;  2M9U A;  4H2U A;  3I7F A;  1TXQ A;  2QAZ A;  3QKJ A;  4A4F A;  3H0I A;  1TG0 A;  2DA9 A;  4EX5 A;  2I0N A;  2EW3 A;  3V7S A;  4JUV A;  1W2B A;  1WJR A;  1PM3 A;  1V1C A;  2LJ0 A;  3HRK A;  1H4V B;  1B8A A;  4XU2 A;  2DDZ A;  1UG1 A;  2JS0 A;  4JS5 A;  3CMQ A;  3JB9 F;  3MO8 A;  3M56 A;  2RQU A;  1QLY A;  2FPF A;  2ODR D;  1H8K A;  1NLP C;  4J7I A;  4PJN A;  5GMK e;  5I2S A;  4B9W A;  2G6F X;  3CBO A;  1WJQ A;  1WLE A;  3GF5 A;  2E1H A;  2JJ9 A;  2RO0 A;  2BIV A;  1K73 C;  1RAF B;  4RTX A;  2DNU A;  4BI4 A;  3QPH A;  2KGT A;  2Y4X A;  5KYY B;  1X01 A;  2LP5 A;  2D1X A;  1Q7Y R;  5LJ3 f;  1QVG S;  4ELY C;  1VQN A;  1C1A A;  1RLQ C;  2AKL A;  3IQL A;  1WYX A;  1AVZ C;  3OW2 P;  3EHQ A;  1U5S A;  4BI3 A;  3G6E A;  1RAI B;  4JLI A;  4YRG A;  3EH2 A;  5GAO n;  1EX4 A;  1ADJ A;  1YIT T;  2CRE A;  4RQF A;  2QGF B;  5KYX A;  4M7A A;  2C06 A;  2ZNI A;  1N6A A;  3EGD A;  4P75 C;  1WXB A;  2DVE A;  2OTJ A;  3NPF A;  4TVR A;  2LNH B;  2VXF A;  4J7F A;  1NZ9 A;  1BK2 A;  1NYG A;  1VQM T;  1OI1 A;  5LJ5 d;  4LDX A;  2EPD A;  2J3L A;  5FRM A;  3I9Q A;  1MMG A;  5GAM e;  3M4Q A;  1UB4 A;  1JBM A;  3VRY A;  3HRT A;  4X1V A;  3CC7 T;  3UWN A;  3I35 A;  1EZZ B;  3X28 B;  2D8H A;  2A0F B;  1FYN A;  2P0Q A;  3QXE B;  1PYS B;  3G4S Q;  2PQW A;  3M0P A;  2QTV A;  2MWO A;  1H64 1;  3A7U A;  5FRN A;  2F5K A;  1G3W A;  1ZBX A;  2CSI A;  4CI0 C;  2DZC A;  1RAG B;  1FX7 A;  1ZUY A;  2AMC B;  5LJ3 g;  2ABL A;  2DYI A;  1NEG A;  1PD0 A;  2QTX A;  3QDF A;  1UTI A;  2RB6 A;  2YUP A;  1ATI A;  3JCM f;  3RES A;  1RI0 A;  3CC2 T;  2FZC B;  3L2W A;  3NTK A;  4LD6 A;  3GBQ A;  2LX7 A;  3BFM A;  1BKB A;  3J7A F;  2HAX A;  3DB4 A;  4M4Z A;  1VQ5 T;  4E7I A;  1K8A C;  1E1O A;  1ZQ1 A;  2GFA A;  3P8H A;  3PCO B;  2O4X B;  1G3T A;  4GLM A;  4MDW A;  4N4I A;  1QMC A;  4TQF A;  3TEH B;  3CME T;  4ZN1 A;  3V8J A;  4OLF A;  1P92 A;  4OVA A;  3REX A;  4C5I A;  6AT1 B;  3EG1 A;  1X27 A;  4OF1 A;  1FMV A;  4HT9 A;  4F7U E;  2CH4 W;  2QI2 A;  1M1G A;  4C8Q B;  1K0X A;  2O88 A;  2AT1 B;  5GMK j;  2I4N A;  2BKD N;  4JRQ A;  2AZS A;  1ZSZ C;  1M90 U;  1IHW A;  3M4Y A;  1KSW A;  2DXC A;  2DXU A;  1K9M U;  3I55 A;  1JQQ A;  3HFZ A;  3NGP A;  4HWS A;  3ZFJ A;  4M78 G;  2OTL A;  2WSE E;  3CCU A;  2M0Y A;  3JCM g;  3A32 A;  2R5M A;  4J9G A;  4WF2 A;  1KD1 C;  4YRJ A;  1VQ9 Q;  3ZEH A;  3U23 A;  4EMG A;  3BDU A;  4L59 A;  5GAN 8;  4M7D E;  5LJ5 h;  3M57 A;  2RHI A;  1WQ7 A;  1IO6 A;  4XEO A;  3OSS C;  5C52 B;  3HTR A;  3O5Z A;  1W1F A;  1ASY A;  2K6D A;  3HXV A;  1U8R A;  2ZPB B;  4IIM A;  4H2X B;  4MMK A;  1SKU B;  4N0A C;  1B34 A;  1GCQ A;  1QP2 A;  5DLO A;  1KQ2 A;  3CXC S;  1M1K C;  1UGQ B;  4CS2 A;  1Y96 B;  2DTO A;  3QHS A;  3CCE A;  3E2U A;  2DL4 A;  2CP7 A;  1QP3 A;  1Y71 A;  3FJP A;  2XGT A;  4UP7 A;  3VYG A;  5GAM j;  1UGS B;  3WVD B;  3FJ5 A;  1VQO Q;  2NWM A;  3HP9 A;  4CC3 A;  1MND A;  4D8K A;  1M9S A;  2K3Y A;  2DXT A;  1YHQ A;  2V8J A;  3JB9 I;  1MHN A;  1RAD B;  2KRS A;  4RMF A;  4OB0 B;  3J81 E;  3GNF B;  4QVC A;  3MEV A;  3S3N A;  2M02 A;  1AZG B;  1NPP A;  4IIO A;  2RJD A;  4E7J A;  4C8Q C;  3REB B;  3T9N A;  3QO8 A;  3E19 A;  2QAS A;  2AK5 A;  4HCB A;  1XJW B;  1QCN A;  2ZTG A;  4PFZ A;  4LVK A;  1Q86 C;  2RI5 A;  1YN8 A;  3CCL A;  1YJN T;  2QHU A;  5GAO q;  2HZY A;  3MCA B;  3QBY A;  4DEY A;  3N5B B;  4NCX A;  2VGM A;  1VQ7 T;  3OW2 A;  2X35 A;  4QQD A;  4P71 C;  2LQK A;  3Q1J A;  4XTY A;  1SSF A;  3VYH B;  2ED1 A;  5ECA A;  2DPP B;  4D6W A;  4M7A B;  3LH5 A;  4IUU A;  2RH2 A;  2DE0 X;  1AHJ B;  3RNJ A;  1QVG P;  3OA6 A;  2I4O A;  1YJW T;  1RAC B;  2M16 A;  4LDW A;  1X69 A;  3CCJ T;  1M4Z A;  3EGD B;  2JT4 A;  5I2M A;  5IHK A;  3PTA A;  3AT1 B;  2ZPH B;  1QKW A;  4FYY B;  3GOX A;  2OJ2 A;  4Q15 A;  4M75 E;  2RMO A;  3CCM Q;  4E7L A;  3G7Z A;  3PVQ A;  4YCW A;  3DSQ A;  5HKC A;  3JSC A;  2PU9 B;  1K73 R;  4DPG A;  5FU7 B;  1OOT A;  1KC8 R;  1I1J A;  3JCM W;  2MI6 A;  2RNA A;  1PD1 A;  2FHD A;  3TSZ A;  1EVL A;  1VQZ A;  1R0C B;  2K3B A;  4M78 F;  2K4Y A;  4ZTZ B;  3AHU A;  1YWO A;  1GCP A;  1Q7Y C;  2L3R A;  4C5E A;  1HK9 A;  3MEY A;  4FSS A;  1V29 B;  1ZUU A;  3OS1 A;  3UH0 A;  12AS A;  1WI7 A;  1UUE A;  3CPW S;  3QYH B;  1N8R U;  1VQL A;  1NE8 A;  2CZ0 B;  4H2W A;  2C0T A;  4JZ3 A;  2HL5 C;  5IXB A;  5GJW B;  3I5S A;  2JMC A;  2LNV A;  1MGQ A;  1JRI A;  5FRO A;  2GF7 A;  2I4M A;  3EFS A;  3VS5 A;  3L2V A;  2KXC A;  2AZV A;  3S3O A;  3VKI A;  4M75 D;  4O5V A;  2X4W A;  2JMA A;  1N5Z A;  2YWW A;  3LW5 E;  3ZBD A;  1RAH B;  5ELN A;  4YRF A;  1PKT A;  1B7Y B;  3CCQ Q;  2CJB A;  1AT1 B;  1X2G A;  1M3C A;  5KCO A;  4WI1 A;  3C95 A;  2F2W A;  2EWN A;  2K2V A;  2ZR2 A;  3M5A A;  2K79 A;  1HYO A;  4RTW A;  3M0S A;  2KR3 A;  2RJF A;  4QVZ A;  1JB0 E;  3CCV Q;  2ODR C;  1KG1 A;  3CCS A;  4Y92 A;  1MNE A;  4M7A C;  1HD3 A;  1UHC A;  4J9B A;  3CPF A;  1N9S A;  4AT1 B;  5LJ5 e;  1WFW A;  1FYF A;  2KAF A;  3MP1 A;  4FT2 A;  1S72 Q;  3P8V A;  3LH0 A;  4XAX B;  3G4S T;  2QDY B;  4KGV B;  3NEL A;  4AMC A;  3BJU A;  5GMK l;  1UDL A;  3LSS A;  4M77 D;  2NUT A;  3HFZ B;  3QZ9 B;  1X6O A;  5D6X A;  3JCM b;  4LDU A;  1TH7 A;  2LC4 A;  1WU7 A;  4P5N A;  4HCC A;  1LVK A;  3PMT A;  2BE9 B;  4CH6 A;  4FM4 B;  1WHH A;  1NM7 A;  5IT9 E;  3VV0 A;  3OYD A;  1VQ5 A;  5CIU A;  3F70 A;  1UEB A;  3DB3 A;  3REA B;  2H3J A;  1U06 A;  2O01 E;  1WA7 A;  3R07 A;  1D0Y A;  5GJV B;  3FC3 A;  3PZC A;  4JRK A;  4NL3 A;  1NYQ A;  1J3T A;  2E3H A;  2O9V A;  3EAE A;  2J3M A;  3FLG A;  2AKW A;  2ESW A;  2P4T A;  3UPU A;  2GQI A;  2HQH A;  3D7S B;  3C0C A;  3L2R A;  1SF9 A;  2B86 A;  4M77 A;  2ALY A;  2D9T A;  1NEB A;  4G85 A;  4DBQ A;  3L42 A;  1QWF A;  4KGX B;  1SG5 A;  1Q81 U;  1VQ8 Q;  1TUD A;  2YHT A;  4PKC C;  4KUD K;  5CR2 A;  1HC7 A;  4LVM A;  2K3X A;  2A8E A;  2HD0 A;  2KRM A;  3OYG A;  1YIJ Q;  4P73 A;  2MWP A;  1NJI U;  1E6H A;  4CC7 A;  5DLQ E;  3VJP A;  3ME9 A;  3OS0 A;  4HKE A;  1YCY A;  3CXC P;  2L5Q A;  4P72 A;  4J9E A;  2DTH A;  1BI0 A;  5I11 A;  1OU9 A;  4UPA A;  4C0F A;  1M8V A;  1UE9 A;  2DO3 A;  4KUL A;  2J06 A;  2H8H A;  4C8Q G;  2GFU A;  3HRS A;  5DM7 R;  2F2X A;  1WGS A;  2XTI A;  1NJ1 A;  1MMN A;  2XKO C;  3DLM A;  2OAU A;  2VVK A;  2ZPF B;  3H9N A;  2HKN A;  1NYR A;  1M90 C;  1VQ9 T;  4CH5 A;  2CJA A;  1VQP Q;  4PJO D;  4LDV A;  1PC0 A;  2EQI A;  2G4C A;  4OGE A;  1AWW A;  2A28 A;  1K9M C;  3NTH A;  4JJB A;  4RG8 A;  4BDY A;  2QEX A;  1N9R A;  2D0N A;  2QA4 Q;  4Z89 A;  1RAA B;  5CKB A;  3JRZ A;  4LXC A;  4RQE A;  5LJ3 e;  1OPK A;  2YSQ A;  1GFC A;  2DEU A;  1M8M A;  2ZGW A;  4E7K A;  3G71 Q;  3UF4 A;  3VQW A;  2E12 A;  3UT1 A;  4YDQ A;  4K86 A;  3TEG A;  3S3M A;  1YFR A;  5ELO A;  2PME A;  4WJ3 M;  1VQO T;  4HA8 A;  5KE2 A;  2XMF A;  3ICA A;  2K5I A;  3M4P A;  3OS5 A;  2KMT A;  3R6O A;  1RL2 A;  3CCR Q;  4WTO B;  5LJ5 j;  2QHV A;  1KHC A;  3ERR A;  3OYC A;  3REU A;  1GCQ C;  2EAY A;  3CD6 A;  3EH1 A;  4OGC A;  2DXB A;  4PJO A;  1Q86 R;  1WIE A;  5GAN f;  2IIM A;  1VQ4 Q;  5CQX A;  4QVD A;  2KE9 A;  2MOX A;  2QHS A;  2QGG A;  2FRY A;  4P3O A;  2ECZ A;  3NTI A;  4X9C A;  1PKS A;  2VYT A;  1D1B A;  1WPY A;  2VC8 A;  2QQR A;  4YTL A;  5E3I A;  5J26 A;  3H8Z A;  3QO3 A;  3OYJ A;  1G5I A;  2LQW A;  1X75 C;  3CCJ A;  1KQS S;  3I5R A;  4J6Y A;  2C0I A;  2V8K A;  4MML A;  4N4G A;  2ROL A;  3CPW P;  4FW2 A;  2L3P A;  3IKM B;  1W4S A;  1GFD A;  2DEQ A;  1Y0M A;  2YRV A;  1O9S A;  3CCM T;  3I56 A;  1IL2 A;  2JM8 A;  3JCM e;  4PNO A;  2COY A;  1DJ7 B;  1XQH A;  2RQW A;  1KC8 C;  4TVY A;  1V76 A;  5AYF A;  4C0Z A;  5KE3 A;  4MDX A;  2RI2 A;  5L23 A;  1W66 A;  1I4K 1;  1IGU A;  2SEM A;  3C4S A;  3BY7 A;  4M7A G;  4OMP A;  3TQ7 P;  3RL6 A;  4C8Q F;  1HSQ A;  2WSC E;  4KGZ B;  1Z9Q A;  5FU6 C;  2FYK A;  2XI9 A;  2GQV A;  5GAN g;  1WHM A;  4HVW A;  2E65 A;  2L3Q A;  1M3B A;  2BZ8 A;  3TVT A;  3VQX A;  2Q5H A;  3QWX X;  2KQW A;  3A1P A;  4RTZ A;  3G6E Q;  4E47 A;  1ZSZ B;  4BE0 A;  4A63 B;  4FL6 A;  2DJZ A;  3H41 A;  2DD5 A;  2J7I A;  5GAO p;  4E7S A;  1KIK A;  2KK4 A;  3PMI A;  1USY A;  2RI3 A;  4XU3 A;  4HCZ A;  1BB9 A;  1LJO A;  2XHC A;  3HY1 A;  4ELZ C;  2EQM A;  2OTJ Q;  1ADY A;  3CBP A;  1KMM A;  1KK7 A;  1G2B A;  2AKW B;  2BZY A;  5LJ3 j;  4XTW A;  1ZSG A;  1N8R C;  3CCQ T;  3MEW A;  2ZZG A;  2CIM A;  2RHY A;  5CKE A;  4C5H A;  1S1N A;  2ALY B;  2CP5 A;  1IB8 A;  4ZGD B;  4L5G A;  4BY6 B;  4EIK A;  3MPU B;  4OMM A;  4CS3 A;  1SRM A;  3X26 B;  4JJD A;  2E5Q A;  2PMF A;  2IPO B;  2K9G A;  3LX7 A;  3VQY A;  2CJ9 A;  4ZGJ B;  1MV0 B;  2LCL A;  3CCV T;  1AWX A;  2F2V A;  3VQV A;  3RER A;  1G3Y A;  1QE0 A;  1IGQ A;  4LUD A;  3OYK A;  4BI8 B;  3OS2 A;  3MHX A;  2C0O A;  1RAE B;  1S72 T;  3CEY A;  2HEQ A;  3L2U A;  3LWI A;  3P8B B;  1ZUK A;  3INZ A;  3QO7 A;  4QT7 A;  3CXC A;  2DIQ A;  4M78 E;  3MQZ A;  4II1 A;  1OX8 A;  2EQJ A;  2DL8 A;  1AZE A;  2VUB A;  2KY9 A;  4FIB A;  2P0K A;  2BTT A;  3EFO A;  4KUI A;  4Q5W A;  1TOV A;  1X43 A;  1AWO A;  5HGQ A;  5FWC A;  3HL8 A;  1SRL A;  2LT4 A;  3NMZ C;  4H2S A;  5FW9 A;  4HVU A;  1ABO A;  5GAN d;  1R8O B;  1X56 A;  2Q7H A;  4LVL A;  1WJS A;  2ZXF A;  3CBM A;  3M59 A;  3GPL A;  1M30 A;  1X6B A;  2C7I A;  2ZPI B;  2NUP A;  2XID A;  2JN0 A;  2EJF A;  2EYQ A;  4M75 C;  4A4E A;  3QII A;  2HMA A;  2QQA A;  4JJC A;  4XQ3 A;  4O6J A;  5GAN 5;  4YRL A;  3BDL A;  5D6W A;  3VUZ A;  5AT1 B;  4L87 A;  4XU0 A;  4M7A F;  4RMO A;  2K7A A;  2LX9 A;  2AHJ B;  3VRZ A;  1TS9 A;  4R56 A;  2Q7G A;  4IUQ A;  1BBW A;  2ZZE A;  1YCS B;  1K1Z A;  2QYZ A;  5IH2 A;  1YJ9 A;  1PG5 B;  4YRK A;  2RQR A;  3OSV A;  2DF6 A;  4D8D A;  4A53 A;  2HBP A;  2MMP A;  1VQ8 T;  4ME7 A;  4Z88 A;  1YIJ T;  1TTH B;  1GRI A;  2JS2 A;  2OX7 A;  2QHT A;  1NJ2 A;  2ZZF A;  2DZ9 A;  4PJO B;  5IHN A;  4YRN A;  1NJ8 A;  4NL2 A;  5IAY A;  3LYI A;  1D1A A;  2FZK B;  5CKD A;  4BE1 A;  4HWR A;  4KH1 B;  4UP8 A;  4OMO A;  3I55 Q;  4LNS A;  2VAS A;  4M77 C;  4H02 A;  3A8L B;  2OTL Q;  4BY6 C;  4FCY A;  1M90 R;  1JXM A;  3OYF A;  3CCU Q;  4RDX A;  1JXO A;  5CO7 A;  3M0R A;  1Q81 C;  1PSF A;  2K2M A;  1NYF A;  1K9M R;  1VQK A;  4P73 C;  5FLX E;  1H92 A;  1L0W A;  3DLL A;  1NJI C;  2VV5 A;  1YI2 A;  2J6K A;  2BE7 D;  1G83 A;  2XD0 A;  4P72 C;  3OYN A;  1VQP T;  2MAM A;  1SHF A;  1M2V A;  1G3S A;  4KR2 A;  3CC4 A;  4JJN K;  4C92 E;  3FEO A;  1LOJ A;  1QQJ A;  2QA4 T;  2Y90 A;  1EIY A;  2LJ1 A;  1WLP B;  2M51 A;  3CMA A;  1Y7X A;  2ATC B;  3A8H B;  3CCE Q;  3A7R A;  2RM4 A;  3CPW A;  5D6Y A;  9ATC B;  4X5O A;  2X4J A;  3DKM A;  4OMQ A;  2M0O A;  1N9W A;  3S6W A;  3G71 T;  1KFZ A;  1WHK A;  2A08 A;  1KJW A;  3RR6 A;  2BZX A;  4TVA A;  1LYL A;  1YWP A;  4GY5 A;  1KQS P;  5L8R E;  1B3Q A;  3JCM P;  1BI2 A;  4CH4 A;  3P8T A;  1YHQ Q;  1BU1 A;  2EJ9 A;  2XDP A;  3SHW A;  4ZTJ A;  3UAT A;  4YRP A;  3CCR T;  4YRM A;  3M9Q A;  4F7U A;  2EQK A;  4E2F B;  4M7D D;  2L0A A;  2QXF A;  1E24 A;  1OZ2 A;  1O75 A;  2D0Q B;  5GAN h;  1FXX A;  4E7Z A;  1SRY A;  3SDZ A;  4HWP A;  1E7O A;  2D6F A;  3URG A;  2JTM A;  1VQ4 T;  4DOW A;  2KYM A;  1NLO C;  2HCK A;  2NS6 A;  1AEY A;  3JAM E;  5KYX B;  2YUO A;  3CCL Q;  3TU4 K;  2ZIM A;  1ARK A;  1B7T A;  4J9D A;  3VUB A;  2E10 A;  4J8O A;  4C92 D;  2EGC A;  3RKW A;  2E4H A;  2QK0 A;  5EG2 A;  4PJO C;  4P74 A;  3P8Y A;  4WCI A;  3PIP A;  1JJC A;  3OY9 A;  4HVC A;  3MF2 A;  2Q5I A;  1FMK A;  4F14 A;  4M7D A;  4RTV A;  4BAC A;  1ZA2 B;  4AG1 C;  4AG2 C;  2EKO A;  5IHI A;  1C0A A;  3MF1 A;  1B70 A;  3LC0 A;  2YRC A;  2RD1 A;  3HTZ A;  2CH4 A;  2MCN A;  1EIF A;  1I81 A;  4KBM B;  1IHV A;  4X9D A;  2CP0 A;  1K0S A;  1JEG A;  2AKK A;  1SPK A;  4C92 A;  1M2O A;  2XDB A;  4XTX A;  1YIT A;  2X4Y A;  4BB7 A;  5GMK m;  3M0Q A;  2G3R A;  4J9F A;  1M1F A;  4A4K A;  4FYX B;  1RUW A;  3M0T A;  2VKN A;  1Z9Z A;  5HY6 A;  1VQL Q;  2KSS A;  4DEX A;  2O2O A;  4EMH A;  3L2Z A;  4LDY A;  1X54 A;  1VQM A;  1NJ5 A;  3G6E T;  4AFZ C;  1VA7 A;  2ZPG B;  2CUB A;  2F5T X;  2BUD A;  2ROT A;  2GNC A;  4EMK A;  3WQZ A;  3TUP A;  2ZCE A;  3CC7 A;  1N8R R;  2DER A;  1Q82 U;  2KDS A;  1EVK A;  1W70 A;  3CCQ A;  2RHQ A;  2OTJ T;  4C0G A;  2KNB B;  4M75 G;  2QDL A;  3QTC A;  3BW1 A;  3JCM J;  1UJY A;  3QWY A;  4RTY A;  1MMD A;  1VQ6 Q;  3HHT B;  1H4Q A;  3BE3 A;  2AIR B;  2VWF A;  3EGU A;  4IUT A;  3CCS Q;  1USY C;  3KFV A;  1BIA A;  3JB9 J;  2E5K A;  2EBP A;  2P84 A;  2YRD A;  3O8V A;  5GAN 4;  3CC2 A;  3OYM A;  4RTT A;  1K8A U;  4M75 A;  3QZ5 B;  4P3P A;  1LNX A;  1SSH A;  2PNI A;  4PJM A;  4RCC A;  1OYX A;  2E5A A;  4PL6 A;  3X24 B;  1C6V X;  3NEM A;  4YCV A;  2LJ3 A;  1Y07 A;  2E6Z A;  5C53 B;  4C8Q E;  1B76 A;  4M77 G;  3CME A;  2WAC A;  2QQS A;  2CGH A;  1F1B B;  2KT1 A;  2X9H A;  3MJX A;  2YLC A;  2JTF A;  2I4L A;  2A37 A;  1B34 B;  5I22 A;  1K4U S;  1QCF A;  4A4H A;  1UJ0 A;  2YUQ A;  4J5Y A;  2K5F A;  5HK0 A;  3EFR A;  4EO4 A;  1M2V B;  3PT9 A;  2DU5 A;  3JB9 D;  1SES A;  1D0Z A;  2Z0W A;  2CYZ B;  3OBW A;  5A0G A;  2IVW A;  1JJ2 A;  4RG2 A;  5GAN 3;  3RIR A;  1KHI A;  2LZ6 B;  5GAN e;  4OMN A;  4DBF A;  5CCA A;  1WX6 A;  4YPF A;  1ZX6 A;  4DA4 A;  4E7H A;  1G8X A;  1KD1 U;  4PFO A;  4TVA B;  2EGA A;  5C0M A;  4YRR A;  2EYW A;  1VIF A;  1G5H A;  1QVF S;  3G1J A;  2CP2 A;  3V7C A;  1BI3 A;  4KQE A;  1KQS A;  4YRT A;  4RTU A;  4ZTU B;  4F7U B;  1Z7M A;  2RQT A;  2GBQ A;  2XU8 A;  2GTO A;  3PVL A;  1SEM A;  1Q81 R;  1M1K U;  1X6G A;  1D3B A;  4F16 A;  3OD1 A;  3I55 T;  3QDR B;  1PWT A;  4KT0 E;  1NJI R;  2OTL T;  2EYY A;  3NFC A;  3EG0 A;  4VUB A;  2QG9 B;  1BBZ A;  4G84 A;  3CCU T;  8AT1 B;  2EIF A;  2YLB A;  3LWH A;  1VQP A;  4JS4 A;  1WHL A;  4BDZ A;  2KYB A;  4IUP A;  4BWA A;  2JXB A;  4TTV A;  2A7Y A;  2LCS A;  3H0F A;  2O4X A;  2MPX C;  4M75 F;  1JO8 A;  2LQ8 A;  2QA4 A;  1A0N B;  2Q7E A;  5FU6 B;  2QEX Q;  4PJO G;  2DL3 A;  2LRQ A;  4QKU A;  3W3S A;  2ZIN A;  2K5L A;  4PJJ A;  2JVV A;  1GBR A;  2L2P A;  3VU3 C;  5J3B A;  4M7D B;  3HXU A;  3OMG A;  4JDS A;  1VIE A;  4LUE A;  4C5G A;  3EG9 A;  3CCE T;  3OYY A;  2RHS A;  2HQX A;  3JCM V;  2ZT6 A;  2HL3 A;  4BW9 A;  1WHJ A;  1OZ3 A;  2QQ9 A;  2DBM A;  3CCR A;  3NHN A;  4B9X A;  5C51 B;  1M3A A;  3VS3 A;  3OMC A;  5GAO l;  1OX9 A;  1YBY A;  5HCK A;  1JJ2 S;  4M7A E;  2GTJ A;  1YJN A;  5GAN 2;  1YHQ T;  4EPC A;  3UA6 A;  3CD6 Q;  4J9H A;  2CUD A;  1YB3 A;  4OB1 B;  2LCC A;  1VQ7 A;  4M77 F;  1UGV A;  4R0K A;  1VQ4 A;  5A2Q E;  2EYX A;  1IXD A;  2E41 A;  3JCM X;  2DYB A;  1IZ6 A;  1YJW A;  1PRL C;  4Q6G A;  4FYW B;  4GBQ A;  5KYU A;  3ULR B;  4KRT A; 
#chains in the Genus database with same CATH homology
 2K57 A;  3CCL T;  3E1S A;  2PVG B;  3TCJ A;  4H2X A;  4EMK B;  3MP6 A;  1HTT A;  2ART A;  2R57 A;  1HXD A;  1Q7Y U;  1Y96 A;  3GNG A;  3UFG A;  5K1P A;  4N4H A;  4NOY A;  4L6V 5;  1X2H A;  2RHQ B;  5GAN j;  4NS5 A;  3OYH A;  2DQ3 A;  3M54 A;  1BBU A;  4M7A D;  1H4T A;  3ASK A;  4P74 C;  3LLR A;  2XK0 A;  1EQR A;  4M75 B;  2LTO A;  2LVM A;  3V8L A;  3SB2 A;  1SER A;  4M7D C;  5GAO r;  4RCB A;  4KR3 A;  2RHZ A;  3M58 A;  2E3C A;  4R55 A;  3QJY A;  2L8D A;  3A8G B;  2CKK A;  3KUF A;  5CKF A;  4PJO F;  1VQL T;  3HFO A;  3OB9 A;  2E64 A;  3QYG B;  2XDD A;  2LDM A;  5A0L A;  4C92 C;  3HFV A;  2RJE A;  4OB2 B;  3WXM B;  2ARU A;  4YP0 A;  2JZ2 A;  4M77 B;  4MZP A;  3L2Q A;  4H2Y A;  4JRI A;  4RKU E;  3L4G A;  3NEN A;  2Y4Y A;  3G4S A;  4FSX A;  3M4G A;  4LD9 K;  2L89 A;  1VQ6 T;  1W2B S;  4UC4 A;  1NNH A;  4EMK C;  3CCS T;  1Q82 C;  2I2L A;  4FT4 A;  3HXW A;  1BI1 A;  3E9G A;  4C0D B;  1NPR A;  1WYD A;  4XU1 A;  3LSQ A;  1D3B B;  2WSF E;  3V7R A;  3FB9 A;  3L1A A;  4QQG A;  4J15 A;  3IKL A;  3SWN A;  3MEA A;  3MP8 A;  2DIG A;  2ZR3 A;  4J6X A;  1QW1 A;  2PVD B;  1G5V A;  2V8I A;  3A74 A;  4O2D A;  1B7Y A;  1G51 A;  3JB9 H;  5IN1 A;  1GXI E;  4MZT A;  4YRI A;  1UGR B;  2JOY A;  2ZPE B;  4HT8 A;  3SFM A;  4LVI A;  4YRO A;  5GMK i;  3PFS A;  2RHS B;  2VGN A;  2A3L A;  4TQD A;  4M78 D;  1M5Q 1;  2DAQ A;  3NET A;  2CZ7 B;  3KFU A;  2FB7 A;  4PG3 A;  4CS4 A;  1EFW A;  1GGM A;  1BIB A;  5GAM f;  4ZN3 A;  1I8F A;  1VQ9 A;  5A0D A;  2IG0 A;  4YRQ A;  5DY9 A;  4PLI A;  3HPW A;  2C8M A;  1RIQ A;  4YRE A;  4EDU A;  5LJ3 d;  3TRE A;  4P3N A;  2FVU A;  3A5Y A;  2IY5 A;  1FWZ A;  1KQ1 A;  1J5W A;  4M78 A;  2CS7 A;  2QQB A;  3OYL A;  4C0D C;  4F7U G;  1VQO A;  2P0L A;  4IUV A;  5KNN A;  3G1Z A;  5K1X A;  3FRN A;  2QEX T;  4OP0 A;  4XTV A;  3OYI A;  2ZNJ A;  1WNL A;  1EOV A;  4BE2 A;  3UDC A;  3A8M B;  3PNW C;  3E9I A;  4YRC A;  2RK1 A;  4DOV A;  1YFT A;  1PSE A;  2RK2 A;  2PVO B;  3LGL A;  1XNI A;  5KH6 A;  1E1T A;  5GAM g;  2KVQ G;  4X34 A;  3M53 A;  3CD6 T;  3HRU A;  4XK8 E;  2DTI A;  4XTZ A;  3GIB A;  4M7D G;  3QG1 A;  4IKF A;  4OB3 B;  3FDR A;  4QQ6 A;  3H6Z A;  1K73 U;  3M55 A;  2NLU A;  4FU6 A;  1KC8 U;  3RF1 A;  2DD4 A;  4JRP A;  4K87 A;  2DK3 A;  3CCM A;  3JCM d;  2MF2 A;  2CZ6 B;  4C92 G;  3TEE A;  5KCH A;  4OMF B;  4Y28 E;  3ER0 A;  1ZHI A;  5CQY A;  1KMN A;  3A7A A;  4AH6 A;  2XG8 D;  2XIC A;  3L4G B;  2X4X A;  3FIF A;  2R5A A;  3UGT A;  3MET A;  2DKG A;  3GP8 A;  2EL9 A;  4H2V A;  4TWA A;  3I56 T;  5F5W A;  1UGP B;  2VXE A;  4PLL A;  4Z02 A;  3A5Z A;  3VBB A;  1XOV A;  4P75 A;  3QSU A;  2PUO B;  2RJC A;  3HSB A;  1WQW A;  2HQE A;  3GLX A;  4J83 A;  5LJ3 h;  1VQN T;  5CK9 A;  2ARS A;  1ASZ A;  3E9H A;  4YCU A;  5C6S A;  3OYA A;  5HK3 A;  4CRI A;  5CAI A;  2EJG A;  2RHU A;  4M77 E;  2ZT5 A;  4ATO A;  5GAM d;  2P5I A;  4YYE A;  1Z7N A;  1IRE B;  5M9O A;  4F7U F;  4WJ4 A;  3SWN B;  3IG2 A;  4A54 A;  1QVF A;  3HRI A;  3HXX A;  1NJ6 A;  4GLK A;  3CCV A;  2FL7 A;  4YRS A;  3OW2 S;  2ZT8 A;  2GCX A;  2RHX A;  4J6W A;  3QUI A;  3HXZ A;  1VQ6 A;  2EQU A;  4XTU A;  1S72 A;  3QNE A;  2JUF A;  2EFI A;  3HFN A;  3OYB A;  4XEM A;  4M7D F;  5GMK h;  3OBY A;  1E22 A;  3P8D A;  5GAN 6;  5J39 A;  2HNI A;  3UGQ A;  2P0P A;  2ZIO A;  3MEU A;  2F69 A;  3JCM h;  5GAN 7;  5FU7 C;  3C94 A;  2ZT7 A;  4HWO A;  3PGG A;  1H4S A;  4JLG A;  2RA2 A;  1YGB A;  4K88 A;  4C92 F;  3OYE A;  3C12 A;  3V8K A;  4CH3 A;  4HWT A;  3PIO A;  1VUB A;  3OQ5 A;  4ZGE B;  2IY5 B;  4BD3 A;  4A4G A;  4M78 B;  1EIY B;  1XTD A;  2E70 A;  3J80 E;  2PUK B;  4QW2 A;  4PJO E;  3E9F A;  1SET A;  1VQ8 A;  3KXT A;  4UP9 A;  2LT1 A;  1YIJ A;  3QJ6 A;  1U1T A;  4IUR A;  3JB9 G;  4E51 A;  1PYS A;  2DU7 A;  2M1H A;  3HKS A;  3A31 A;  3SWN C;  3HXY A;  4V2S A;  1N27 A;  4C8Q D;  2AMC A;  3RKX A;  3RKY A;  5GAO m;  1H3Z A;  1YJ9 T;  4N0A A;  5GAM h;  4LVJ A;  1I5L A;  3JCM Q;  3IAL A;  3KBG A;  2B8A A;  4MZM A;  1U1S A;  1KOG A;  5LJ5 f;  3RAC A;  3RUX A;  3SD4 A;  5I21 A;  3PCO A;  4DQ2 A;  1BYM A;  3X25 B;  3TEH A;  1JJC B;  5CKH A;  2DQ0 A;  1VQK T;  3G71 A;  1YI2 T;  4C8Q A;  4BUG A;  4ZIB A;  1Q86 U;  1QVG A;  4Y91 A;  3JCM c;  1X55 A;  3CC4 T;  1B70 B;  1YFS A;  1QVP A;  4P71 A;  4ZTF A;  3CMA T;  3QO5 A;  3A8O B;  4HT4 A;  4M78 C;  5CVI A;  4C92 B;  3A5Z B;  3RMS A;  4H2T A;  11AS A;  2ZCF B;  2JNG A;  3X20 B;  2R58 A;  5LL6 S;  4PHC A;  3HY0 A;  3RGL A;  3WVE B;  2E6N A;  2ZZD A;  2CZ1 B;  3LGF A;  1QF6 A;  5LJ5 g;  3RMQ A;  4TVW A;  2M9U A;  4H2U A;  3I7F A;  3QKJ A;  4A4F A;  4EX5 A;  3V7S A;  4JUV A;  1W2B A;  1WJR A;  3HRK A;  1H4V B;  1B8A A;  4XU2 A;  2DDZ A;  4JS5 A;  3CMQ A;  3JB9 F;  3MO8 A;  3M56 A;  2ODR D;  4J7I A;  5GMK e;  5I2S A;  4B9W A;  3CBO A;  1WJQ A;  1WLE A;  3GF5 A;  2E1H A;  2RO0 A;  2BIV A;  1K73 C;  4BI4 A;  3QPH A;  2Y4X A;  1X01 A;  1QVG S;  5LJ3 f;  4ELY C;  1VQN A;  4BI3 A;  3G6E A;  4JLI A;  4YRG A;  1ADJ A;  5GAO n;  4RQF A;  1YIT T;  4M7A A;  2C06 A;  2ZNI A;  1N6A A;  4P75 C;  2DVE A;  2OTJ A;  4TVR A;  2VXF A;  4J7F A;  1NZ9 A;  1VQM T;  1OI1 A;  5LJ5 d;  4LDX A;  2J3L A;  5FRM A;  5GAM e;  3M4Q A;  1UB4 A;  1JBM A;  3HRT A;  3CC7 T;  3UWN A;  3X28 B;  2P0Q A;  3QXE B;  1PYS B;  2PQW A;  2MWO A;  1H64 1;  3A7U A;  5FRN A;  2F5K A;  1G3W A;  1ZBX A;  4CI0 C;  2DZC A;  1FX7 A;  2AMC B;  5LJ3 g;  2QTX A;  2RB6 A;  1ATI A;  3JCM f;  3RES A;  1RI0 A;  3CC2 T;  3L2W A;  3NTK A;  4LD6 A;  3BFM A;  1BKB A;  3J7A F;  2HAX A;  3DB4 A;  1VQ5 T;  4E7I A;  1K8A C;  1E1O A;  1ZQ1 A;  2GFA A;  3P8H A;  3PCO B;  2O4X B;  1G3T A;  4MDW A;  4N4I A;  4TQF A;  3TEH B;  3CME T;  4ZN1 A;  3V8J A;  4OLF A;  1P92 A;  4OVA A;  3REX A;  4C5I A;  4OF1 A;  4HT9 A;  4F7U E;  4C8Q B;  2QI2 A;  1M1G A;  5GMK j;  2I4N A;  2BKD N;  4JRQ A;  1M90 U;  3M4Y A;  2DXC A;  2DXU A;  1K9M U;  3I55 A;  3HFZ A;  4HWS A;  3ZFJ A;  4M78 G;  2OTL A;  2WSE E;  3CCU A;  3JCM g;  3A32 A;  2R5M A;  4WF2 A;  1KD1 C;  4YRJ A;  3ZEH A;  4EMG A;  3BDU A;  4L59 A;  5GAN 8;  4M7D E;  5LJ5 h;  3M57 A;  2RHI A;  1WQ7 A;  4XEO A;  3OSS C;  5C52 B;  1ASY A;  3HXV A;  1U8R A;  2ZPB B;  4H2X B;  4MMK A;  4N0A C;  1B34 A;  1QP2 A;  5DLO A;  1KQ2 A;  3CXC S;  1M1K C;  1UGQ B;  4CS2 A;  1Y96 B;  2DTO A;  3QHS A;  3CCE A;  1QP3 A;  1Y71 A;  3FJP A;  2XGT A;  4UP7 A;  3VYG A;  5GAM j;  1UGS B;  3WVD B;  3HP9 A;  1M9S A;  2K3Y A;  2DXT A;  1YHQ A;  2V8J A;  3JB9 I;  1MHN A;  4RMF A;  4OB0 B;  3J81 E;  3GNF B;  4QVC A;  3MEV A;  3S3N A;  1NPP A;  2RJD A;  4E7J A;  4C8Q C;  3T9N A;  3QO8 A;  3E19 A;  4HCB A;  2ZTG A;  4LVK A;  1Q86 C;  2RI5 A;  3CCL A;  1YJN T;  2QHU A;  5GAO q;  3MCA B;  3QBY A;  3N5B B;  4NCX A;  2VGM A;  1VQ7 T;  3OW2 A;  2X35 A;  4QQD A;  4P71 C;  2LQK A;  3Q1J A;  4XTY A;  1SSF A;  3VYH B;  2DPP B;  4D6W A;  4M7A B;  4IUU A;  2RH2 A;  1AHJ B;  3OA6 A;  2I4O A;  1YJW T;  2M16 A;  4LDW A;  3CCJ T;  1M4Z A;  5I2M A;  3PTA A;  2ZPH B;  3GOX A;  4Q15 A;  4M75 E;  4E7L A;  3G7Z A;  4YCW A;  3DSQ A;  5HKC A;  3JSC A;  2PU9 B;  4DPG A;  5FU7 B;  3JCM W;  2MI6 A;  2FHD A;  1EVL A;  1VQZ A;  4M78 F;  2K4Y A;  4ZTZ B;  3AHU A;  1Q7Y C;  2L3R A;  4C5E A;  1HK9 A;  3MEY A;  1V29 B;  3UH0 A;  3OS1 A;  12AS A;  3CPW S;  3QYH B;  1N8R U;  1VQL A;  1NE8 A;  2CZ0 B;  4H2W A;  2LNV A;  1MGQ A;  1JRI A;  5FRO A;  2GF7 A;  2I4M A;  3EFS A;  3L2V A;  3S3O A;  3VKI A;  4M75 D;  4O5V A;  2X4W A;  3LW5 E;  3ZBD A;  5ELN A;  4YRF A;  2CJB A;  1B7Y B;  1X2G A;  5KCO A;  4WI1 A;  3C95 A;  2EWN A;  2K2V A;  2ZR2 A;  3M5A A;  2RJF A;  4QVZ A;  1JB0 E;  2ODR C;  1KG1 A;  3CCS A;  4M7A C;  3CPF A;  1N9S A;  5LJ5 e;  1FYF A;  2KAF A;  3MP1 A;  4FT2 A;  3P8V A;  3LH0 A;  4XAX B;  3G4S T;  2QDY B;  3NEL A;  3BJU A;  5GMK l;  3LSS A;  4M77 D;  3HFZ B;  3QZ9 B;  1X6O A;  5D6X A;  3JCM b;  4LDU A;  1TH7 A;  2LC4 A;  1WU7 A;  4P5N A;  4HCC A;  3PMT A;  4CH6 A;  4FM4 B;  5IT9 E;  3VV0 A;  3OYD A;  1VQ5 A;  5CIU A;  3F70 A;  1UEB A;  3DB3 A;  2H3J A;  2O01 E;  3R07 A;  3FC3 A;  3PZC A;  4JRK A;  4NL3 A;  1NYQ A;  3EAE A;  2J3M A;  3FLG A;  2AKW A;  2P4T A;  3UPU A;  3L2R A;  4M77 A;  2ALY A;  2D9T A;  4G85 A;  3L42 A;  1Q81 U;  2YHT A;  4PKC C;  4KUD K;  5CR2 A;  1HC7 A;  4LVM A;  2K3X A;  2A8E A;  2HD0 A;  3OYG A;  4P73 A;  2MWP A;  1NJI U;  5DLQ E;  3VJP A;  3ME9 A;  3OS0 A;  4HKE A;  1YCY A;  2L5Q A;  4P72 A;  2DTH A;  1BI0 A;  4UPA A;  4C0F A;  1M8V A;  2DO3 A;  4KUL A;  4C8Q G;  2GFU A;  3HRS A;  5DM7 R;  2XTI A;  1WGS A;  1NJ1 A;  2XKO C;  3DLM A;  2OAU A;  2ZPF B;  1NYR A;  1M90 C;  1VQ9 T;  4CH5 A;  2CJA A;  4PJO D;  4LDV A;  2G4C A;  4OGE A;  1K9M C;  3NTH A;  4RG8 A;  4BDY A;  2QEX A;  1N9R A;  5CKB A;  3JRZ A;  4RQE A;  5LJ3 e;  2ZGW A;  4E7K A;  3VQW A;  2E12 A;  3UT1 A;  4YDQ A;  4K86 A;  3TEG A;  3S3M A;  1YFR A;  5ELO A;  2PME A;  4WJ3 M;  1VQO T;  4HA8 A;  5KE2 A;  3ICA A;  2K5I A;  3M4P A;  3OS5 A;  2KMT A;  3R6O A;  1RL2 A;  5LJ5 j;  2QHV A;  1KHC A;  3ERR A;  3OYC A;  3REU A;  2EAY A;  3CD6 A;  4OGC A;  2DXB A;  4PJO A;  5GAN f;  5CQX A;  4QVD A;  2QHS A;  4P3O A;  3NTI A;  4X9C A;  2VYT A;  1WPY A;  2VC8 A;  2QQR A;  4YTL A;  5E3I A;  5J26 A;  3H8Z A;  3QO3 A;  3OYJ A;  1G5I A;  1X75 C;  3CCJ A;  1KQS S;  4J6Y A;  2V8K A;  4MML A;  4N4G A;  3IKM B;  1W4S A;  2DEQ A;  2YRV A;  1O9S A;  3CCM T;  3I56 A;  1IL2 A;  3JCM e;  4PNO A;  1DJ7 B;  1XQH A;  1KC8 C;  4TVY A;  4C0Z A;  5AYF A;  5KE3 A;  4MDX A;  2RI2 A;  1W66 A;  1I4K 1;  3C4S A;  3BY7 A;  4M7A G;  3RL6 A;  4C8Q F;  2WSC E;  5FU6 C;  2FYK A;  2XI9 A;  2GQV A;  5GAN g;  2E65 A;  3VQX A;  2Q5H A;  2KQW A;  4E47 A;  4BE0 A;  4FL6 A;  2DJZ A;  2DD5 A;  5GAO p;  2KK4 A;  3PMI A;  1USY A;  2RI3 A;  4XU3 A;  4HCZ A;  1LJO A;  2XHC A;  3HY1 A;  4ELZ C;  2EQM A;  1ADY A;  1KMM A;  3CBP A;  2AKW B;  5LJ3 j;  4XTW A;  1N8R C;  3CCQ T;  3MEW A;  2ZZG A;  2CIM A;  2RHY A;  5CKE A;  4C5H A;  2ALY B;  4ZGD B;  4L5G A;  4BY6 B;  4CS3 A;  3X26 B;  2E5Q A;  2PMF A;  3LX7 A;  3VQY A;  2CJ9 A;  4ZGJ B;  2LCL A;  3CCV T;  3VQV A;  3RER A;  1G3Y A;  1QE0 A;  3OYK A;  4BI8 B;  3OS2 A;  3MHX A;  1S72 T;  3CEY A;  3L2U A;  3LWI A;  3P8B B;  3INZ A;  3QO7 A;  3CXC A;  2DIQ A;  4M78 E;  3MQZ A;  4II1 A;  2EQJ A;  2VUB A;  2KY9 A;  4FIB A;  2P0K A;  4KUI A;  4Q5W A;  5HGQ A;  3HL8 A;  2LT4 A;  4H2S A;  5GAN d;  1R8O B;  1X56 A;  2Q7H A;  4LVL A;  1WJS A;  2ZXF A;  3CBM A;  3M59 A;  3GPL A;  2C7I A;  2ZPI B;  2XID A;  2JN0 A;  2EJF A;  2EYQ A;  4M75 C;  4A4E A;  3QII A;  2QQA A;  4XQ3 A;  4O6J A;  5GAN 5;  4YRL A;  3BDL A;  5D6W A;  3VUZ A;  4L87 A;  4XU0 A;  4M7A F;  4RMO A;  2LX9 A;  2AHJ B;  4R56 A;  2Q7G A;  4IUQ A;  1BBW A;  2ZZE A;  1YJ9 A;  4YRK A;  3OSV A;  4A53 A;  2HBP A;  2MMP A;  1VQ8 T;  4ME7 A;  1YIJ T;  2QHT A;  1NJ2 A;  2ZZF A;  2DZ9 A;  4PJO B;  4YRN A;  1NJ8 A;  4NL2 A;  5IAY A;  3LYI A;  5CKD A;  4BE1 A;  4HWR A;  4UP8 A;  4LNS A;  4M77 C;  4H02 A;  3A8L B;  4BY6 C;  3OYF A;  4RDX A;  5CO7 A;  1Q81 C;  1PSF A;  1VQK A;  4P73 C;  5FLX E;  1L0W A;  3DLL A;  1NJI C;  2VV5 A;  1YI2 A;  2XD0 A;  4P72 C;  3OYN A;  1VQP T;  2MAM A;  1G3S A;  4KR2 A;  3CC4 A;  4JJN K;  4C92 E;  3FEO A;  1LOJ A;  2QA4 T;  2Y90 A;  1EIY A;  3CMA A;  1Y7X A;  3A8H B;  3A7R A;  2RM4 A;  3CPW A;  5D6Y A;  4X5O A;  2X4J A;  3DKM A;  2M0O A;  1N9W A;  3S6W A;  3G71 T;  4TVA A;  1LYL A;  4GY5 A;  5L8R E;  3JCM P;  1BI2 A;  4CH4 A;  3P8T A;  2EJ9 A;  2XDP A;  4ZTJ A;  4YRP A;  3CCR T;  4YRM A;  3M9Q A;  4F7U A;  2EQK A;  4M7D D;  2QXF A;  1E24 A;  1OZ2 A;  1O75 A;  2D0Q B;  5GAN h;  1FXX A;  1SRY A;  3SDZ A;  4HWP A;  2D6F A;  3URG A;  2JTM A;  1VQ4 T;  4DOW A;  2NS6 A;  3JAM E;  3TU4 K;  2ZIM A;  3VUB A;  2E10 A;  4J8O A;  4C92 D;  3RKW A;  5EG2 A;  4PJO C;  4P74 A;  3P8Y A;  3PIP A;  1JJC A;  3OY9 A;  4HVC A;  3MF2 A;  2Q5I A;  4M7D A;  4BAC A;  2EKO A;  1C0A A;  3MF1 A;  1B70 A;  3LC0 A;  2RD1 A;  3HTZ A;  1EIF A;  1I81 A;  4KBM B;  4X9D A;  4C92 A;  2XDB A;  4XTX A;  1YIT A;  2X4Y A;  4BB7 A;  5GMK m;  2G3R A;  1M1F A;  4A4K A;  5HY6 A;  2KSS A;  4EMH A;  3L2Z A;  4LDY A;  1X54 A;  1VQM A;  1NJ5 A;  3G6E T;  2ZPG B;  2F5T X;  2BUD A;  4EMK A;  3WQZ A;  3TUP A;  2ZCE A;  3CC7 A;  1Q82 U;  2KDS A;  1EVK A;  3CCQ A;  2RHQ A;  2OTJ T;  4C0G A;  4M75 G;  3QTC A;  3BW1 A;  3JCM J;  3HHT B;  1H4Q A;  4IUT A;  1USY C;  1BIA A;  3JB9 J;  5GAN 4;  3O8V A;  3CC2 A;  3OYM A;  1K8A U;  4M75 A;  3QZ5 B;  4P3P A;  1LNX A;  4RCC A;  1OYX A;  2E5A A;  4PL6 A;  3X24 B;  3NEM A;  4YCV A;  1Y07 A;  2E6Z A;  5C53 B;  4C8Q E;  1B76 A;  4M77 G;  3CME A;  2WAC A;  2QQS A;  2CGH A;  2YLC A;  2JTF A;  2I4L A;  1B34 B;  4A4H A;  4J5Y A;  2K5F A;  5HK0 A;  3EFR A;  4EO4 A;  3PT9 A;  2DU5 A;  3JB9 D;  1SES A;  2CYZ B;  3OBW A;  5A0G A;  2IVW A;  1JJ2 A;  5GAN 3;  4RG2 A;  3RIR A;  1KHI A;  5GAN e;  5CCA A;  4YPF A;  4DA4 A;  4E7H A;  1KD1 U;  4TVA B;  5C0M A;  4YRR A;  1VIF A;  1G5H A;  1QVF S;  3V7C A;  1BI3 A;  4KQE A;  1KQS A;  4YRT A;  4ZTU B;  4F7U B;  1Z7M A;  2XU8 A;  1M1K U;  1D3B A;  3OD1 A;  3I55 T;  3QDR B;  4KT0 E;  2OTL T;  3NFC A;  4VUB A;  4G84 A;  3CCU T;  2EIF A;  2YLB A;  3LWH A;  1VQP A;  4JS4 A;  4BDZ A;  4IUP A;  4BWA A;  4TTV A;  2A7Y A;  2O4X A;  4M75 F;  2LQ8 A;  2QA4 A;  2Q7E A;  5FU6 B;  4PJO G;  2LRQ A;  3W3S A;  2ZIN A;  2K5L A;  2JVV A;  3VU3 C;  5J3B A;  4M7D B;  3HXU A;  3OMG A;  4JDS A;  1VIE A;  4C5G A;  3CCE T;  2RHS A;  3OYY A;  2HQX A;  3JCM V;  2ZT6 A;  4BW9 A;  1OZ3 A;  2QQ9 A;  3CCR A;  4B9X A;  5C51 B;  3OMC A;  5GAO l;  1YBY A;  1JJ2 S;  4M7A E;  1YJN A;  5GAN 2;  1YHQ T;  4EPC A;  1YB3 A;  4OB1 B;  2LCC A;  1VQ7 A;  4M77 F;  1VQ4 A;  5A2Q E;  2E41 A;  3JCM X;  1IZ6 A;  1YJW A;  4Q6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...