2E41A

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with the reaction product analog biotinol-5'-amp, mutations r48a and k111a
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKAIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 69
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e41A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2e41A01
1X2GA 1E24A 4PJOD 5LJ5e 1LJOA 4G84A 4CS2A 4EO4A 2E64A 2DTHA 1B8AA 5GAOn 3FJPA 1U1SA 1USYC 2CJBA 2ZR2A 4PG3A 4C92E 3L2ZA 4P71A 2AKWA 4YRLA 1HXDA 4G85A 3BW1A 4EMKA 4M7AE 2ZT5A 1SESA 3L4GA 3M4QA 2ALYB 4M75B 1YFRA 3HFZB 1NJ1A 5LJ3f 4RDXA 3P8YA 4M7DD 4M7AF 2DU7A 4M7DF 4M7AD 2VXFA 3PCOA 4K87A 5GAOm 3LC0A 4P74C 3EFRA 2FYKA 1N9RA 2ZGWA 4M78E 4F7UG 4X9DA 5GAMd 3JB9F 4XTWA 2I4NA 2RHSB 2VXEA 1H4TA 1WQWA 4K88A 1N9SA 3LSSA 3VQVA 1KQ2A 4YRNA 4YRPA 3UFGA 3DSQA 4M78A 2E65A 5GAMh 3VQWA 1M8VA 2ZNJA 4YRKA 4V2SA 4N0AA 2Q7HA 4YRFA 2CGHA 3RKXA 1HC7A 4PJOF 2E1HA 4F7UF 4EMKB 4NCXA 1IL2A 3QHSA 4CH4A 3I7FA 1G51A 3UGQA 4XU1A 4PJOA 4M78C 3JCMf 4PJOC 1NNHA 1WLEA 3PZCA 3REXA 3M4GA 2EJGA 2I4MA 1B70B 4C8QB 2K57A 3W3SA 5GAMj 2DDZA 5GAN2 5CAIA 3LSQA 4M7DB 5LJ3g 3HFOA 4ZIBA 4H2XB 5LJ3j 4C92F 5GMKe 3RKWA 5GAMg 4YCVA 4XTYA 4MMKA 1Y96A 3RL6A 2J3LA 3ICAA 3G1ZA 1D3BB 1LOJA 1USYA 3PCOB 4C92C 4X5OA 4YRTA 4TVYA 4KR3A 4J5YA 2Q7GA 3RACA 3JB9H 4HWRA 2ZTGA 3E9IA 4C8QF 3E9HA 3JCMV 3ERRA 4M78D 2Y90A 1I81A 2ALYA 5GAN6 4M77G 3REUA 3V8KA 3EFSA 3JB9J 3INZA 5GAN3 1LNXA 3A7RA 5C52B 2ZNIA 3V7SA 1ADYA 3A5YA 4H2VA 4M7AA 3TEGA 2EAYA 4F7UA 2ZZFA 5F5WA 4C8QE 1NJ5A 1ASZA 3WQZA 4EMKC 3JCMd 2Q5IA 4YROA 3JCMJ 3P8TA 3NEMA 2RHQA 4RQEA 1E22A 3JCMc 4H02A 2I4OA 4WJ3M 2CJ9A 4J15A 2RHSA 4TQFA 1YB3A 4C8QD 4CH5A 1I8FA 5GAMf 1NJ2A 2IY5A 2ZXFA 3MF2A 4UP8A 4WI1A 4KR2A 2G4CA 4XTUA 2DEQA 3JCMX 4M75A 2PMEA 3VQXA 1E1TA 3JCMe 4YRIA 3TUPA 2QHUA 2XTIA 5KNNA 1NJ8A 2ZT6A 4M77E 4Q6GA 5ELOA 4AH6A 4M78G 4MMLA 1X01A 4P73C 3IALA 4M75E 4WF2A 4XTVA 2CIMA 3A74A 5LJ3h 1KMNA 1PYSA 3NETA 2DVEA 4A54A 2ZCEA 1W66A 4P3OA 3CMQA 4C8QC 2PMFA 4UP9A 4YRGA 2DQ0A 2AMCB 4J6YA 1B70A 4EMGA 3UGTA 2CJAA 1BBWA 4CH3A 4UPAA 3QO5A 2DZ9A 1JRIA 3HXWA 4C92G 4YRJA 11ASA 5LJ5h 3IKLA 2AKWB 3MF1A 4C92D 1Y96B 4F7UB 4KQEA 2YLBA 3QO3A 4TVAA 1TH7A 3RERA 1GGMA 1JJCB 1M5Q1 1EIYA 4M77A 3TEHA 3VU3C 3A7AA 3M4PA 4M77C 4XEMA 4P3NA 4A53A 2ODRC 3HRKA 2DTIA 2P0LA 3A32A 4NL2A 1NYRA 2DZCA 3BY7A 4H2XA 3AHUA 4P72A 4YPFA 3VBBA 4DPGA 4HWTA 2ZT7A 1X56A 3QSUA 5C51B 1B34B 1QE0A 1NJ6A 2FB7A 1N9WA 3NENA 3GIBA 4PHCA 2JN0A 5ELNA 5GAOl 1YCYA 4P75A 4YCWA 3V8JA 2Q7EA 4JRKA 1WNLA 3QO8A 3RKYA 3HXYA 5DY9A 2QHVA 4CH6A 4M75F 1H4VB 1YFTA 3BJUA 4TVAB 1NYQA 4NOYA 2ARUA 2YHTA 4TQDA 4DQ2A 1J5WA 4JRIA 3V7RA 4L87A 3HSBA 4M78F 1D3BA 3A7UA 2ZR3A 1I5LA 1G5HA 4ZTUB 3RF1A 1JBMA 1B7YB 1PYSB 4YRRA 3QNEA 2AMCA 3JCMQ 4TWAA 1H4QA 4YCUA 3HXUA 2EL9A 5GANj 2C8MA 4TTVA 5GAOq 4H2YA 5LJ5f 5E3IA 2ZZEA 2EWNA 2ZIMA 1EVLA 2DKGA 2ZIOA 4YYEA 4HWPA 5GAN8 4JLIA 4K86A 3RGLA 4M7AB 5GAOr 2ZT8A 4O2DA 2ZZGA 4M7AC 4PJOG 5LJ5d 3L1AA 1L0WA 4HA8A 4WJ4A 2I4LA 4M77B 3TEHB 4YRCA 5GAN7 2IY5B 1KMMA 1SETA 4P73A 5GANh 3V7CA 3JB9I 1HK9A 1X2HA 3BDUA 3JCMh 2DQ3A 2RHQB 12ASA 2DJZA 4YRMA 4H2SA 4CS4A 2RB6A 1Z7MA 3HXZA 3KFUA 1I4K1 2EJ9A 3A31A 2HNIA 2E5AA 5K1XA 3HY0A 1B76A 4Y91A 1C0AA 5GAMe 3HFVA 2VC8A 3HXXA 3JB9D 4M75G 3QTCA 1G5IA 2EJFA 3VQYA 2ODRD 1VQZA 1WU7A 1X55A 3L4GB 4PNOA 1FYFA 2RM4A 1HTTA 1LYLA 4E51A 5C53B 4EX5A 5GANe 4BW9A 1QF6A 2ZINA 4P75C 1EIYB 3RESA 4YRSA 1H641 3FB9A 1YFSA 3HY1A 4HWSA 1BIAA 3SWNA 3V8LA 3R07A 3QUIA 4EMHA 4M77D 1KOGA 2DU5A 5GAOp 5HGQA 5GANd 4X9CA 4QVCA 1ADJA 4Q15A 2J3MA 4HVCA 4C92A 4M7DG 1SRYA 2QHTA 2P5IA 2XGTA 3SWNB 4M7DE 4P3PA 4XU3A 5GANf 5LJ5j 4M7AG 3JB9G 4QVDA 2YLCA 1B34A 1B7YA 4M77F 1ATIA 1RIQA 4J6WA 4C8QG 1WYDA 3HTZA 3UH0A 4ZTZB 4XTZA 2DXUA 3RIRA 1EVKA 4RMFA 3MEYA 4CS3A 4NL3A 5GMKi 4YRQA 4BWAA 4H2WA 4M78B 3JCMP 3HXVA 5LJ5g 3NELA 2DTOA 4J6XA 4OP0A 2ARTA 1EQRA 3HRIA 1BIBA 2C7IA 3PGGA 5GMKj 4P74A 2DXTA 2E3CA 5GAN5 4HWOA 4M75C 4C8QA 1Z7NA 2E41A 3RUXA 3HFZA 4LNSA 1SERA 3FIFA 2E10A 4M75D 2Q5HA 4HT8A 4H2UA 2I2LA 5GMKm 3P8VA 4RQFA 3QO7A 5GANg 1BBUA 3BFMA 3JCMg 4N0AC 4XU2A 1WQ7A 4RCCA 5K1PA 4XTXA 2RD1A 1EOVA 5LJ3e 4H2TA 2QTXA 3SWNC 4XQ3A 4C92B 5I21A 5GMKl 5GAN4 3SB2A 2RA2A 4M7DA 4M7DC 1YGBA 5GMKh 5LJ3d 1ASYA 4RCBA 4YDQA 4XEOA 1H4SA 4HT9A 4PJOB 1JJCA 3JCMb 4XU0A 1MGQA 2QHSA 3IG2A 4YP0A 3HFNA 4TVWA 3A5ZA 2ARSA 4UP7A 1EFWA 1KQ1A 4P72C 4PJOE 4YREA 4JUVA 3JCMW 1X54A 3OD1A 4P71C 1E1OA 4F7UE 4OLFA 1U1TA 1WPYA 3IKMB
chains in the Genus database with same CATH superfamily
5LJ5e 5KYUB 1B8AA 5GAOn 1U1SA 4WCIA 2LRQA 3VS6A 1VA7A 2DXCA 1IGQA 3A8GB 3DB4A 1K0SA 2AKWA 1MMAA 1IO6A 2D6FA 4G85A 3QZ5B 4D8DA 2V26A 3X28B 2ALYB 1YFRA 4E7ZA 5A0LA 3ZBDA 4RDXA 4M7DD 4M7AF 4M7DF 4M7AD 1K8AU 4J7FA 2EYXA 5KYNA 2ZGWA 3JB9F 2X4JA 3I56A 1VUBA 4XTWA 4B6MA 1WQWA 4ZTFA 1N9SA 1KD1C 4LN2A 3VQVA 1M8MA 3CCVQ 2DX1A 1M4ZA 3UFGA 1K9MC 1OV3A 4MZTA 5FROA 2E65A 5I2SA 2ZNJA 3EG9A 1JJ2P 4YRKA 1PD0A 3GNGA 2DRMA 2J06A 2Q7HA 2KDSA 2CGHA 2E1HA 2RF0A 4EMKB 3CC2Q 3O8VA 4DA4A 2JOYA 1YBYA 4PJOA 3QBYA 4M78C 1TSFA 3D7SB 1WLEA 2EFIA 5IAYA 2I4MA 3OYKA 3W3SA 1V29B 1VYTA 1FX7A 4M7DB 4ZIBA 4L59A 2KXDA 3QWXX 4N4GA 1YHQT 2X3WD 1KQSS 2DD5A 2YRVA 5GAMg 2QDLA 4LDWA 4MMKA 4QQ6A 3C0CA 1KC8C 3G1ZA 1M90U 3S3MA 4C92C 4X5OA 2JTMA 3EHQA 2RO0A 4BUGA 2Q7GA 4BE0A 5AYFA 3GF5A 4HWRA 3CCRA 4C8QF 1LVKA 4ELYC 3SDZA 5GAN6 3OW2P 2WSCE 1M30A 3JB9J 2EYZA 4BD3A 3INZA 1WIEA 4FYWB 4IKFA 3A7RA 5C52B 2D0NA 1W6XA 4JJNK 1T0HA 3G1JA 2BZXA 2CP0A 2LNVA 4M7AA 5F5WA 4J9FA 4C8QE 4UC4A 2YWWA 3JCMJ 4KUIA 1PWTA 1E22A 4H02A 4WJ3M 3PTAA 4TQFA 3EFOB 5FU7C 3ZFJA 1I8FA 1NYGA 1CKAA 1PRLC 3MF2A 1N6AA 4FSXA 4HVVA 4Z8AA 5IHIA 3JCMe 2QK0A 1VQKA 2QHUA 1X27A 5KNNA 4PJJA 2ZT6A 1TUCA 4M77E 4AH6A 1Q82R 2RQTA 4WF2A 5KYUA 2D8JA 5LJ3h 1WXUA 1PYSA 3NETA 9ATCB 3NTIA 4MDWA 2DJQA 2FPFA 3CMQA 2PMFA 2XDDA 4O5VA 1AZEA 2DQ0A 2QA4A 3I56Q 2AMCB 2K3XA 3M0UA 2HBPA 3UGTA 4CH3A 2YUPA 2LQKA 2O2OA 1D0YA 3HXWA 2GTOA 1EIFA 3NFCA 3IKLA 3OS0A 1RLPC 2RJEA 2EQUA 5A2QE 2NYSA 2A0FB 2YLBA 1TH7A 1R8OB 4F17A 1V76A 1AEYA 1M5Q1 2KXCA 3CCQA 1EIYA 1YWPA 2JJ9A 4J9IA 4C0DB 3TEHA 3M4PA 4XEMA 2DXBA 2H3EB 2ABLA 2QQBA 2DA9A 2R5MA 2VVKA 2NWMA 5KH6A 2ODRC 5FRNA 4PKCC 3A32A 4NL2A 2DO3A 1NYRA 1JU5C 4OMLA 2MPXC 2IIMA 5DM7R 2ZT7A 5C51B 1ARKA 3VS0A 3UA7A 1ZUUA 3NENA 3VYHB 2JN0A 1JJ2S 1EX4A 1I07A 4P75A 4JRPA 1WNLA 2PVOB 3HXYA 1SHGA 3LGFA 1VQMA 2ARUA 1VQ7T 2GBQA 1QW1A 3ER0A 1G3WA 1UDLA 2M0YA 3ZEHA 3OYIA 1I5LA 1B07A 4FT4A 1AVZC 2RHXA 1YJ9A 1U5SA 4YRRA 1X43A 1K8AC 1X2KA 2CT4A 2GCXA 4R0KA 3JCMQ 3S3OA 1H4QA 1Q81C 2RHYA 3OYLA 2D0QB 2RK1A 5GANj 2C8MA 4RMOA 2ZZEA 2KYMA 1K0XA 3OSSC 4IUTA 2ZIOA 1UGQB 1O75A 2V8IA 3RGLA 4M7AB 1ZSZB 5GAOr 2L5QA 3VS4A 3PT9A 1F1BB 1ZUYA 1YIJT 3EG1A 2QA4T 2QTVA 1YJWA 1PD1A 3L1AA 3OW2S 1JO8A 4PFZA 2I4LA 2JS2A 2F2VA 4M77B 3M58A 2DF6A 2IY5B 2EYWA 4P73A 2R58A 1X2HA 3BDUA 2DQ3A 2QI2A 2RHQB 1PC0A 1T0JA 2DJZA 2BTTA 3X24B 4H2SA 3CCUQ 1M2OA 1Z7MA 5L23A 3KFUA 3L2UA 3CPWA 2EJ9A 2E5AA 3J7AF 2QG9B 4MDXA 2NUTB 3L2VA 3T9NA 1RAFB 2HSPA 3E1SA 3I35A 1TOVA 3EGUA 3HFVA 1M3BA 1UGSB 4M75G 3DLMA 1S1NA 2FRWA 2ODRD 4A4EA 4ZN1A 1X55A 1UE9A 1LYLA 4J83A 2FZKB 5C53B 1VQPQ 2ZINA 1IGUA 3G4SQ 1X6OA 3RESA 4FM4B 1WA7A 4YRSA 1BI1A 1H641 3FB9A 3HY1A 1WYXA 3SWNA 3OYGA 5J39A 3R07A 1VQNA 3VS3A 2CT3A 4Q5WA 1NEBA 2FO0A 1YN8A 5GANd 4X9CA 1ADJA 1U06A 2DL7A 4M7DG 3F70A 2QHTA 4M7DE 4P3PA 4FW2A 4PL6A 1ACMB 3EGDA 2O31A 3PIOA 4M7AG 4QVDA 3J80E 2K3YA 2EYQA 2VYTA 2LCLA 2V8JA 1NEGA 4M77F 3UATA 2E5KA 3GNFB 3EG3A 2BKDN 2CP5A 3CCMA 2DL3A 2DXUA 2F2WA 4BDZA 1VQ4Q 3JCMP 1H3ZA 2COWA 2CZ7B 4J9BA 4DBRA 2L3SA 2DTOA 1IXDA 5CKBA 4OP0A 1V1CA 3VKIA 3GOXA 4QKUA 2LDMA 2Y4XA 5GAN5 1RAAB 2LVMA 4C8QA 1Z7NA 3RUXA 3HFZA 4LNSA 1GBQA 1SERA 3HP9A 2Q5HA 2M0OA 3PVLA 2AHJB 1ZSZA 1QKXA 5FLXE 1BBUA 1ZUKA 5DLQE 3CC4Q 2AKLA 1M90C 2A37A 3O5ZA 4RCCA 4XTXA 2XDBA 5LJ3e 4CI0C 3A1PA 4K11A 3QJYA 1QQJA 1VIEA 2IVWA 2QTXA 3SWNC 4HKEA 2DL8A 1PSEA 3I55Q 4BI8B 2EQKA 1RAEB 5GMKl 4BE2A 4LDXA 2DL5A 3OYJA 2RA2A 2MI6A 4M7DA 1TXQA 5GMKh 5CVIA 1ASYA 2ZPBB 4RCBA 3HPWA 1JQQA 3CCVT 2QQAA 4HT9A 4PJOB 1RL2A 2FVUA 4LDYA 3JCMb 3UPUA 2XMFA 4KGZB 3G71Q 2QHSA 4DOWA 1YJNA 4F14A 3A5ZA 2ARSA 2D1XA 1KQ1A 2FPDA 4P72C 3EH2A 4JUVA 4YREA 3OD1A 1YJNQ 3IKMB 1X6BA 3G6EQ 1E24A 4G84A 1WJSA 2GFUA 4JPBW 4N4IA 4QQGA 3VV0A 1WJQA 3KFVA 4L6V5 2ZR2A 3M0PA 4AFZC 4FSSA 1OU9A 3QYHB 5IH2A 2BZ8A 2KVQG 3A8MB 5AT1B 1AWOA 1J3TA 4P71A 4HT4A 3I55T 1HXDA 2BE9B 3BW1A 3L42A 4LE9A 4J9GA 4M7AE 4GLMA 3L4GA 4M75B 2FPEA 2L89A 5ECAA 3HFZB 3ULRB 5M9OA 2NUTA 1C1AA 2VXFA 4EIKA 4K87A 1WDXA 3LC0A 3EFRA 1N9RA 3UH0A 2I4NA 1ZSGA 3H9NA 4F7UG 1VQ5A 2DERA 3HRUA 4Z88A 2RI5A 1MMGA 3LX7A 1JJ2A 5FW9A 3LSSA 4AT1B 2ZAEA 1KG1A 4YRNA 3DSQA 1KQSA 2JMAA 1NJIU 3VQWA 3CMEA 4OB2B 1OOTA 4LVJA 5KE2A 1VQOA 4RTTA 1SSHA 1HC7A 4CRIA 5C6SA 1EFNA 3TREA 1VQ4T 1KK7A 4RG8A 4ZGEB 3H0FA 3QHSA 5DLOA 1G51A 3UGQA 1VOMA 3PZCA 4OMQA 4KT0E 3QYGB 3M4GA 2EJGA 1MV3A 1B70B 1VQ8T 5GAN2 4PJNA 3HFOA 4ANJA 2EQMA 1Q7YC 3CC4A 4H2XB 4DBHA 5LJ3j 3CCLQ 1OZ2A 3RKWA 2QQ9A 5FWBA 2J6OA 4RTWA 1HD3A 4CC2A 2K5FA 2KE9A 3PCOB 4YRTA 3UDCA 4LVKA 4OMNA 4LVMA 4C5GA 3VS2A 3FDRA 4ZN3A 2O4XA 3E9IA 3JCMV 4M78D 1I81A 2DBMA 2ZPIB 2YT6A 3V8KA 2EQIA 4CC3A 3CEYA 3CCSA 3DB3A 2FZCB 5KYYA 3MEVA 5KYXA 1AOJA 1FMVA 3V7SA 2KRMA 1BCMA 4H2VA 4JZ3A 3TEGA 4F7UA 1Q86U 4EMKC 3WQZA 1MV0B 4AMCA 3NEMA 3JCMc 3HRTA 3CC2A 4GLKA 4J15A 4JDSA 1M27C 4JLGA 1TS9A 4C8QD 1U3OA 4E47A 2KQWA 4CH5A 2X4YA 2RI2A 4UP8A 1K1ZA 3KXTA 4XTUA 2DLPA 1QCNA 3VQXA 4OMPA 5CR2A 5IN1A 3TUPA 2G3RA 4OGEA 1D1AA 4Q6GA 2COZA 1NM7A 4MMLA 3CCJA 1I5OB 2LQWA 3IALA 1JXMA 1KMNA 2DVEA 4A54A 4DEXA 3CCVA 1W2BP 1OI1A 1ZHIA 1PM3A 1SRMA 3LYIA 4C8QC 2A28A 1YIJQ 2M16A 1GL5A 4FYVB 1B70A 2ZPEB 4UPAA 2RK2A 2ZPFB 2DZ9A 3J81E 1VQNQ 1KJWA 1SHFA 4LVIA 2LNHB 3G4ST 2AKWB 2NUZA 2DIGA 3M0QA 4F7UB 3OY9A 4ME7A 2DPPB 1JJCB 3M57A 3URGA 5KYYB 3A7AA 4M77C 5CQXA 5CKEA 1S72T 2YUQA 3PNWC 1NLOC 1SPKA 4P72A 3MKDA 4YPFA 1KIKA 4PFPA 1M1KC 4HWTA 1VQ7Q 2HMAA 1X56A 1WJRA 1VQMT 4PHCA 2K79A 1UJ0A 5GAOl 5I22A 1YCYA 1LCKA 1YJWQ 3QDFA 4Y92A 1ABOA 1E6HA 5CKFA 4CH6A 2V8KA 4M75F 4C0GA 1H4VB 2H3JA 1WHKA 3REAB 1KFZA 4TVAB 4LD9K 3SHWA 2YHTA 3I9QA 1KC8U 1J5WA 4JRIA 5GJWB 1X2QA 4M78F 2QA4Q 1H92A 3A7UA 1RI9A 2ZR3A 1G5HA 3RF1A 1JBMA 2LX9A 1TUGB 1B7YB 2PU9B 2HAXA 2HSEB 3QNEA 4TWAA 3REBB 1IZ6A 1ZBXA 3ASKA 4FCYA 4C5HA 4PK4A 2EL9A 2KAFA 2M1HA 5LJ5f 2EWNA 3WVEB 1UFFA 3CCUT 3CMAT 7AT1B 1WHMA 1EVLA 2LQ8A 3MPUB 2QEXA 2BUDA 2ZZGA 3TSZA 4OMOA 3VUBA 1K73U 1QWFA 3VS7A 2DM1A 2XHCA 2GNCA 3C12A 2LT1A 3BE3A 1SETA 1VQKT 2C06A 2K4YA 1M1KR 3LH0A 4RTZA 3MHXA 3M59A 3CCJQ 1QVPA 1OYXA 1I4K1 3A31A 1VQMQ 2HNIA 3HL8A 3HY0A 4Y28E 4AG1C 3S6WA 2F5KA 3CC7A 3G6EA 1SKUB 1C0AA 2DK3A 2HEQA 3E9FA 3HXXA 4C5EA 4KBMB 1SG5A 4DBQA 1VQZA 1Q86R 5J3BA 1VQ9T 2RM4A 1NBEB 1C0MA 1QMCA 2GFAA 4EX5A 2A08A 1YITQ 4L5GA 1GCPA 2RI3A 1X75C 2F69A 2PTKA 3NHNA 4R55A 3CPWS 1BIAA 4EMHA 2QQRA 4YTLA 2DU5A 3M0SA 5HGQA 5L8RE 4Q15A 4HVCA 4ELZC 3EFOA 3EH1A 3EG0A 1ABQA 2DE0X 2P5IA 3NTKA 2XIDA 2VV5A 3OYBA 2ED1A 2L3QA 2YLCA 5IXFA 4BDYA 3OYMA 1B34A 3CCST 1QCOA 2CSIA 5FU6C 1NJIC 1ATIA 1RIQA 1E6GA 3CCLA 1EZZB 3RIRA 1EVKA 4CS3A 4RTUA 5GMKi 4FL6A 3CMAA 4KH1B 1QP3A 3VRYA 4DEYA 5CQYA 1NYFA 3NELA 2MYSA 4J6XA 2DBKA 2MF2A 3VUZA 5GJVB 1TU0B 2GF7A 1C6VX 2PQWA 3PGGA 1W4SA 1MMDA 2DXTA 2O9SA 1Q81U 1LPLA 3CCRT 1D09B 3BDLA 4IUUA 1XJWB 2DILA 1VQLA 2YXYA 2LJ1A 3CXCA 3DKMA 2DIQA 2JNGA 2QQSA 3S3NA 4HT8A 1PKSA 5GMKm 1BCOA 2VUBA 3QO7A 4RQFA 5HK3A 3OQ5A 1GRIA 3BFMA 3M54A 2EQJA 3CBOA 2AZSA 2LC4A 1QVGP 2YRDA 2XKOC 1BKBA 2CZ6B 1UTIA 1Y07A 2CDTA 2VKNA 5CCAA 5GAN4 2WSEE 1BI3A 1WI7A 2A7YA 2G6FX 4IUQA 3A8OB 3GPLA 2EPDA 1N27A 2ENMA 3RNJA 3U23A 2QGFB 2HD0A 1YGBA 2J7IA 2QDYB 5FRMA 3FEOA 3QDRB 3CC7Q 3CCMQ 1H4SA 4IIMA 4TVRA 1BI0A 2JUFA 4JRQA 3IG2A 1G8XA 1WXTA 3HFNA 4TVWA 1EFWA 2XD0A 1PCXA 1OU8A 4MZMA 2X35A 4ORZA 2J6KA 2WACA 3TQ7P 3MP8A 2FG0A 4F04B 4PJOD 4CS2A 4EO4A 4FT2A 1PSFA 2E64A 1PRMC 2ATCB 1DJ7B 1ZA1B 2RN8A 4PG3A 2W10A 4C92E 3L2ZA 1YP5A 4KRTA 3CCQT 3SFMA 3PVQA 4RTXA 1HSQA 4EMKA 2ZT5A 1SESA 3RMSA 3M4QA 4E7KA 5LJ3f 4J7IA 4OB1B 3P8YA 1OPKA 1UG1A 4BI3A 3MQZA 3PCOA 2I0NA 3TEEA 1TG0A 3CPWP 2FYKA 1KQSP 5GAMd 1P92A 2RHSB 3KUFA 4BY6B 3OMGA 4K88A 2P4RA 1KQ2A 1Q7YR 1YI2T 1M3CA 3MCAB 2HKNA 1YJNT 1M8VA 3GP8A 1K8AR 2CZ0B 4V2SA 3EGXA 3UT1A 1H3HA 1H8KA 3KBGA 2VASA 5D7UA 3RKXA 4PJOF 3CQTA 4F7UF 4NCXA 1IL2A 1NG2A 3Q1JA 4CH4A 1VYUA 3P8DA 1WXBA 4XU1A 4B9WA 1CSKA 2E6NA 3JCMf 1QWEA 4PJOC 1NNHA 2JT4A 3REXA 5D6XA 2KROA 1Y71A 4CC7A 2K57A 2DDZA 5CAIA 3LSQA 1PNJA 2RQRA 5LJ3g 1M3AA 1M90R 3OMCA 4C92F 3QG1A 4YCVA 3MEWA 2CZ1B 2J3LA 1D3BB 2W0ZA 1LOJA 2MWPA 1G3YA 2YSQA 1QKWA 3M5AA 4J5YA 2NUPA 4QT7A 1VQ8Q 2ZCFB 2GGRA 3RACA 2E3IA 2OAUA 3LW5E 4E7LA 3E9HA 3ERRA 4LXCA 3EFSA 4HCCA 4EDUA 2SEMA 4XK8E 2JVVA 3L2RA 5GAN3 1LNXA 2ZNIA 5CK9A 3A5YA 1VQPA 2F2XA 1XOVA 2EAYA 5C0MA 2ZZFA 2X51A 2DNUA 3JCMd 2RPNA 3P8TA 1R0BG 1AT1B 4RQEA 2EYYA 3MP1A 2I4OA 2CJ9A 2RHSA 4AFSC 3FLGA 1YB3A 4WI1A 2G4CA 1JB0E 2DEQA 3TCJA 2PUKB 2PMEA 2X4WA 1NJ8A 4RG2A 5ELOA 3TU4K 4M78G 4IUVA 1Q82U 4P73C 4RTVA 4JJBA 2CIMA 2L0AA 1NPPA 2ZCEA 1W66A 4P3OA 2HQXA 3QZ9B 4J6YA 1SSFA 1UEBA 3M0RA 1YFNA 2CJAA 3CBMA 4FU6A 1JRIA 1PHTA 4C92G 11ASA 1VYVA 2COYA 5LJ5h 2R5AA 2VGMA 4C92D 1Y96B 1D0XA 4KQEA 4TVAA 3JAME 3QJ6A 4IUPA 1VQ6Q 3MEUA 3OYAA 2OX7A 1W2BA 3CCEQ 4QQDA 4P3NA 4A53A 1UGVA 2ROLA 3MP6A 1QVGA 3CCRQ 2P0LA 2D8HA 2DZCA 3OYNA 4H2XA 4FYYB 4BY6C 4Z89A 1B34B 1QE0A 4J9EA 3OYDA 2L3RA 2IPOB 3NPFA 2FB7A 1N9WA 3GIBA 6AT1B 2RJCA 2K9GA 1B3QA 3V8JA 2Q7EA 3QO8A 5DY9A 2EBPA 1RADB 2QHVA 2K5IA 2OTJQ 4NOYA 1NYQA 4ZTJA 4TQDA 3V7RA 3HSBA 2O4XB 1O9SA 1BU1A 2P0PA 4HCBA 1VQLT 4ZTUB 2XU8A 3CCET 2CP3A 1WHGA 4ATOA 2M9UA 2SRCA 2E6ZA 3HXUA 3JRZA 2EGEA 5KE3A 4TTVA 2HQHA 5GAOq 1KD1R 3SD4A 4C0DC 5E3IA 2IG0A 2ZIMA 1WGSA 3P8HA 4HWPA 4KULA 4JLIA 5GAN8 1M1GA 2MCNA 1RAIB 2ZT8A 2AK5A 1B7TA 5D6WA 2GQIA 4M7AC 1SRLA 4HA8A 4WJ4A 1W1FA 1UHCA 4YRCA 5A0GA 3FRNA 5GANh 1NZ9A 1S72Q 2CREA 3I5RA 12ASA 3M55A 1PG5B 4YRMA 4HVWA 3ME9A 1TTHB 4CS4A 1HJDA 3HXZA 2RQWA 3CMEQ 4OGCA 1G3SA 5K1XA 2PUOB 1AZGB 3OBWA 1VQNT 4JS5A 1B76A 3E9GA 3I5SA 4II1A 3RBBB 1YJWT 2VC8A 3JB9D 1YIJA 1G5IA 3VQYA 1MHNA 2DMOA 2P0KA 1NE8A 1ZX6A 2CH4A 1WU7A 3L4GB 1VQPT 1SEMA 4PNOA 2CP7A 4P5NA 1FYFA 3DLLA 1IREB 1QVFP 2RHIA 1HTTA 4E51A 1RABB 5GANe 4BW9A 2K3BA 1EIYB 2OI3A 2OJ2A 3H6ZA 3QWYA 4JZ4A 3X26B 1OX8A 4HWSA 1Q82C 2RJDA 3LWHA 1YJ9T 2RJFA 1RLQC 4M77D 1KOGA 2HL3A 5GAOp 4Z02A 2RH2A 2MAMA 2J3MA 2LCCA 1SRYA 4M4ZA 1K9AA 1VQ7A 1A0NB 2NUPB 3JSCA 2K5LA 1M1KU 2CP6A 4OB3B 1UHFA 2QGGA 2YDLA 2KT1A 5GANf 3CCEA 5D6YA 1QVFA 1KD1U 2A36A 3OYEA 2K2VA 5HY6A 4J6WA 5CO7A 4C8QG 1WYDA 2JMCA 1ZQ1A 1UUEA 3HTZA 2HZYA 2A8EA 4RUGA 4XTZA 4ZTZB 4RMFA 3MEYA 1YI2A 4NL3A 4YRQA 2K7AA 1Q86C 4BWAA 4M78B 3VS5A 3HXVA 5LJ5g 1FXXA 2KNBB 1N8RC 1Q95G 4OMMA 1IRXA 1T3SA 1EQRA 3CXCP 2EW3A 1BIBA 2C0TA 2DYBA 2C7IA 2HCKA 1VQ9A 4J9CA 1CKBA 2HDAA 2QEXT 2BIVA 3QKJA 4HWOA 4M75C 5IHNA 4PJMA 2E41A 4KGXB 1MMNA 1AD5A 4OB0B 1YNZA 1KC8R 2XI9A 3FIFA 1Z9ZA 3H8ZA 2DFUA 1OEBA 3SEMA 4RKUE 2I2LA 3P8VA 3VYGA 3EHRA 1FMKA 1G3TA 4XU2A 4FW1A 4LDVA 5K1PA 4QVZA 4C0ZA 1TWBA 2L2PA 3HKSA 1OX9A 4C92B 2B86A 1G5VA 2E12A 5IT9E 2V1RA 4M7DC 2O9VA 2YUNA 1ZA2B 5LJ3d 3OSVA 2K6DA 1RAGB 2EKHA 3HRSA 4DOVA 2LTOA 3CCLT 1JJCA 1YITA 1MGQA 4BE1A 4C5IA 3QIIA 5KYXB 2J05A 2KBTA 4UP7A 2Y4YA 2ESWA 3JCMW 1X54A 1IHWA 2FHDA 4A63B 2P4TA 4F7UE 1U1TA 1WPYA 3CCMT 1X2GA 2LP5A 1LJOA 2LCSA 2DTHA 2JTEA 3FJPA 3IQLA 3FJ5A 1USYC 2CJBA 1QP2A 1MNEA 4YRLA 3NTHA 2LX7A 5IXBA 1SF9A 1D1BA 3QPHA 5FWCA 1WX6A 2GTJA 4E6RA 5EC7A 1NJ1A 3OYHA 2DU7A 2XICA 1M2VB 5GAOm 4P74C 1HYOA 2MK5A 4VUBA 1RUWA 4M78E 1NJIR 4X9DA 4KGVB 2VXEA 3OYFA 2P0QA 5CIUA 1H4TA 1QVFS 1QCFA 1I1JA 3CC2T 2JS0A 4A4KA 4C0FA 4BACA 1YI2Q 2QEXQ 4E7IA 4YRPA 3N5BB 3OYCA 4M78A 1Y7XA 4AFQC 5GAMh 1M2VA 2M51A 2KRNA 3R6NA 4N0AA 5LL6S 2V1QA 5KCHA 4YRFA 1K73C 2JXBA 4X1VA 2E4HA 3EGDB 2RQVA 3I7FA 1M9SA 1N5ZA 5CKDA 1NPRA 2OAWA 3PIPA 4CC4B 3OS1A 1ZSZC 2KT8A 3OW2A 3EG9B 1FYNA 2XG8D 4ZGDB 3CCQQ 4C8QB 1KHCA 4ZGJB 2X9HA 2KR3A 5GAMj 4HCZA 1Z9QA 2ZPGB 1FWZA 1OPLA 3G4SA 5GMKe 1OULA 1GCQC 4XTYA 1Y96A 3RL6A 3ICAA 1YHQA 1USYA 3M4YA 4TVYA 3EAEA 4A4FA 4KR3A 8ATCB 2MOXA 5HCKA 2FL7A 2AKKA 3EG2A 3OS5A 2JM8A 3JB9H 4PLIA 4J9HA 2ZTGA 1YJ9Q 2DRKA 2RHUA 3R6OA 1UJYA 2Y90A 2ECZA 3CXCS 1PKTA 1N8RR 2ALYA 4M77G 3REUA 1UB4A 4J8OA 2MMPA 4BB7A 1VQ4A 4RTYA 1AWJA 2RNAA 2JZ2A 3A8LB 3G7ZA 3E2UA 3CC4T 3H41A 3CC7T 1W2BS 3ZL7C 2VB6A 1T3LA 2O01E 1ADYA 3UWNA 3WXMB 2LJ3A 1ASZA 3C95A 1NJ5A 3PMTA 1RAHB 8AT1B 2M02A 2CSQA 2Q5IA 4YROA 3NGPA 2RHQA 1G83A 2KI7A 1RI0A 3G6ET 4XAXB 3OBYA 5GAMf 3OS2A 1NJ2A 3OYYA 4A4HA 2ZXFA 1XTDA 2LT4A 2IY5A 2Z0WA 4KR2A 3MEAA 4PFOA 3CMET 3A98A 1BBZA 3JCMX 4M75A 2C0IA 3CD6A 1E1TA 2LZ6B 4YRIA 1BK2A 2BZYA 2ROTA 2NS6A 2XTIA 2VWFA 4AG2C 2PVGB 4D8KA 2FEIA 2EVRA 1X01A 2KY9A 4M75E 4XTVA 1AHJB 3A74A 3VRZA 2J6FA 4PJLA 3PE0A 3TVTA 1VQ8A 4UP9A 4YRGA 4R56A 4DBFA 2CH4W 4HVUA 3M56A 4JJDA 2AT1B 4EMGA 1K4US 4B9XA 4KUDK 1BBWA 1R0CB 3CMAQ 3QO5A 4E7SA 4IURA 2R57A 3A5ZB 4YRJA 2JM9A 2HBWA 1GFCA 3L2WA 3MF1A 3QO3A 4GBQA 1Y0MA 2MWOA 3CCSQ 3RERA 1AWWA 1GGMA 2F5TX 4M77A 2QAZA 3VU3C 1X6GA 1VQLQ 3LGLA 2CP2A 3HRKA 5FU7B 5KYWA 3OA6A 2DTIA 4KH0B 1VQKQ 3PMIA 1M1FA 4DPGA 3BY7A 3AHUA 2DYIA 3VBBA 2CS7A 3QSUA 2XDPA 1NJ6A 2CKKA 2RQUA 1BB9A 1UECA 1WFWA 5ELNA 2KRSA 3C4SA 1WHJA 2EGCA 4YCWA 4JRKA 3C94A 3RKYA 1WHHA 1ZBJA 2QASA 1YFTA 3MJXA 3BJUA 3UF4A 2YRCA 4JS4A 1YITT 2PZ1A 1VQ5T 1S72A 2QYZA 1WZOA 3RMQA 4DQ2A 4F16A 1QLYA 4BI4A 1VQ9Q 4L87A 4ZNXA 2KEAA 1D3BA 2OTLT 2NLUA 3THKA 3LH5A 3FC3A 1WHLA 4FIBA 2EIFA 3OB9A 1PYSB 2DETA 2AIRB 2AMCA 4YCUA 2JW4A 3VS1A 1MNDA 1VQOQ 4H2YA 3X20B 4HXJA 1K73R 3CD6T 1VQ6A 1K9MU 2DKGA 3CCJT 4YYEA 1GFDA 2A3LA 2MIOA 4K86A 3E19A 4O2DA 2EGAA 2OTLQ 4LNPA 1YWOA 4PJOG 5LJ5d 1GXIE 1L0WA 2L8DA 2CUDA 2JTFA 5EG2A 2WSFE 3TEHB 3RR6A 5GAN7 1KMMA 2ZZDA 1FMWA 3V7CA 3JB9I 1HK9A 3JCMh 5FU6B 2CUBA 2E70A 3UA6A 2RB6A 1KHIA 2XK0A 1I0CA 1OZ3A 2D9TA 1JEGA 3META 1D1CA 4LUDA 1VIFA 3X25B 2OTJA 2DEUA 3A8HB 2HL5C 2LJ0A 1UGRB 4OF1A 4Y91A 4NS5A 2KMTA 4X34A 3L2QA 5GAMe 2P84A 3PFSA 3CD6Q 2QXFA 2EKOA 1GBRA 3QTCA 2EJFA 3I56T 4LD6A 1VQOT 1U8RA 2LQNA 2ZPHB 1QF6A 2FZGB 3QXEB 2DD4A 4P75C 3HHTB 1ZLMA 1Q7YU 1AWXA 1YFSA 3P8BB 3V8LA 3QUIA 4E7HA 2OTJT 2KYBA 4QVCA 5I11A 2CYZB 4C92A 2DL4A 2HQEA 3AT1B 2E5QA 4GY5A 3I55A 2XGTA 3SWNB 1K76A 4XU3A 1YCSB 2K2MA 3G71A 4EPCA 1R77A 5HKCA 1K9MR 5LJ5j 4LVLA 3JB9G 1IHVA 1WLPB 1IB8A 1UGPB 1B7YA 4O6JA 2FRYA 2ED0A 4HCKA 4JJCA 3JV3A 3HTRA 3M9QA 3MO8A 1QVGS 3LLRA 1BYMA 2X3XD 4FYXB 4IIOA 3H0IA 2KK4A 1VQ6T 3CBPA 4LUEA 3TSWA 4H2WA 1KSWA 4J9DA 4QW2A 2GQVA 2ARTA 3HRIA 4MZPA 4E2FB 2VGNA 2L3PA 5GMKj 4P74A 2E3CA 2RMOA 2O88A 5HK0A 2DVJA 1OQKA 1G2BA 2KSSA 1YHQQ 2B8AA 1W70A 1E7OA 3M53A 2AZVA 2DAQA 2E10A 4M75D 4A4GA 2LMJA 4H2UA 3GBQA 5GANg 3VJPA 1TUDA 1Y57A 1NLPC 2F1LA 4WTOB 1VQ5Q 3JCMg 1MUZA 4PLLA 4N0AC 2BE7D 5A0DA 1WQ7A 2X4XA 2RD1A 1EOVA 4H2TA 1RACB 1BI2A 4XQ3A 3M0TA 5I21A 2PVDB 3SB2A 3WVDB 3GLXA 4ESRA 2C0OA 5J26A 1XNIA 2OTLA 3LWIA 3EGXB 2YUOA 4YDQA 4OVAA 4XEOA 5I2MA 3CPFA 5KCOA 1GCQA 2HKQB 4XU0A 1Q81R 1D0ZA 1X69A 3RDVA 4OMFB 3NMZC 3CCUA 5IHKA 4YP0A 4LDUA 1XQHA 3H0HA 2E3HA 1JXOA 5KYWB 2KGTA 2RHZA 1N8RU 4PJOE 3G71T 4N4HA 4P71C 2H8HA 1E1OA 4E7JA 5CKHA 4OLFA 2PNIA 4D6WA 4AFUC
chains in the Genus database with same CATH topology
5LJ5e 1B8AA 5GAOn 1U1SA 2LRQA 2DXCA 3A8GB 3DB4A 2AKWA 2D6FA 4G85A 3QZ5B 3X28B 2ALYB 1YFRA 5A0LA 3ZBDA 4RDXA 4M7DD 4M7AF 4M7DF 4M7AD 1K8AU 4J7FA 2ZGWA 3JB9F 2X4JA 3I56A 1VUBA 4XTWA 1WQWA 4ZTFA 1N9SA 1KD1C 3VQVA 1M4ZA 3UFGA 1K9MC 4MZTA 5FROA 2E65A 5I2SA 2ZNJA 4YRKA 3GNGA 2Q7HA 2KDSA 2CGHA 2E1HA 4EMKB 3O8VA 4DA4A 2JOYA 1YBYA 4PJOA 3QBYA 4M78C 1WLEA 2EFIA 5IAYA 2I4MA 3OYKA 3W3SA 1V29B 1FX7A 4M7DB 4ZIBA 4L59A 1KQSS 4N4GA 1YHQT 2DD5A 2YRVA 5GAMg 4LDWA 4MMKA 4QQ6A 1KC8C 3G1ZA 1M90U 3S3MA 4C92C 4X5OA 2JTMA 2RO0A 4BUGA 2Q7GA 4BE0A 5AYFA 3GF5A 4HWRA 3CCRA 4C8QF 4ELYC 3SDZA 5GAN6 2WSCE 3JB9J 4BD3A 3INZA 4IKFA 3A7RA 5C52B 4JJNK 2LNVA 4M7AA 5F5WA 4C8QE 4UC4A 3JCMJ 4KUIA 1E22A 4H02A 4WJ3M 3PTAA 4TQFA 5FU7C 3ZFJA 1I8FA 3MF2A 1N6AA 4FSXA 3JCMe 1VQKA 2QHUA 5KNNA 2ZT6A 4M77E 4AH6A 4WF2A 5LJ3h 1PYSA 3NETA 3NTIA 4MDWA 3CMQA 2PMFA 2XDDA 4O5VA 2DQ0A 2QA4A 2AMCB 2K3XA 2HBPA 3UGTA 4CH3A 2LQKA 3HXWA 1EIFA 3NFCA 3IKLA 3OS0A 2RJEA 2EQUA 5A2QE 2YLBA 1TH7A 1R8OB 1M5Q1 3CCQA 1EIYA 4C0DB 3TEHA 3M4PA 4XEMA 2DXBA 2QQBA 2R5MA 2ODRC 5KH6A 5FRNA 4PKCC 3A32A 4NL2A 2DO3A 1NYRA 5DM7R 2ZT7A 5C51B 3NENA 3VYHB 2JN0A 1JJ2S 4P75A 4JRPA 1WNLA 2PVOB 3HXYA 3LGFA 1VQMA 2ARUA 1VQ7T 3ER0A 1QW1A 1G3WA 3ZEHA 3OYIA 1I5LA 4FT4A 2RHXA 1YJ9A 4YRRA 1K8AC 2GCXA 3S3OA 3JCMQ 1H4QA 1Q81C 2RHYA 3OYLA 2D0QB 2RK1A 5GANj 2C8MA 4RMOA 2ZZEA 3OSSC 4IUTA 2ZIOA 1UGQB 1O75A 2V8IA 3RGLA 4M7AB 5GAOr 2L5QA 3PT9A 1YIJT 2QA4T 1YJWA 3L1AA 3OW2S 2I4LA 4M77B 3M58A 2IY5B 4P73A 2R58A 1X2HA 3BDUA 2DQ3A 2QI2A 2RHQB 2DJZA 3X24B 4H2SA 1Z7MA 3KFUA 3L2UA 3CPWA 2EJ9A 2E5AA 3J7AF 4MDXA 3L2VA 3T9NA 3E1SA 3HFVA 1UGSB 4M75G 3DLMA 2ODRD 4A4EA 4ZN1A 1X55A 1LYLA 4J83A 5C53B 2ZINA 1X6OA 4FM4B 3RESA 4YRSA 1BI1A 1H641 3FB9A 3HY1A 3SWNA 3OYGA 5J39A 3R07A 1VQNA 4Q5WA 5GANd 4X9CA 1ADJA 4M7DG 3F70A 2QHTA 4M7DE 4P3PA 4PL6A 3PIOA 4M7AG 4QVDA 3J80E 2K3YA 2EYQA 2VYTA 2LCLA 2V8JA 4M77F 3GNFB 2BKDN 3CCMA 2DXUA 4BDZA 3JCMP 1H3ZA 2CZ7B 2DTOA 5CKBA 4OP0A 3VKIA 3GOXA 2LDMA 2Y4XA 5GAN5 2LVMA 4C8QA 1Z7NA 3RUXA 3HFZA 4LNSA 1SERA 3HP9A 2Q5HA 2M0OA 2AHJB 5FLXE 1BBUA 5DLQE 1M90C 4RCCA 4XTXA 2XDBA 5LJ3e 4CI0C 3QJYA 1VIEA 2IVWA 2QTXA 3SWNC 4HKEA 1PSEA 4BI8B 2EQKA 5GMKl 4BE2A 4LDXA 3OYJA 2RA2A 2MI6A 4M7DA 5GMKh 5CVIA 1ASYA 2ZPBB 4RCBA 3HPWA 3CCVT 2QQAA 4PJOB 4HT9A 1RL2A 2FVUA 4LDYA 3JCMb 3UPUA 2QHSA 4DOWA 1YJNA 3A5ZA 2ARSA 1KQ1A 4P72C 4YREA 4JUVA 3OD1A 3IKMB 1E24A 4G84A 1WJSA 2GFUA 4N4IA 4QQGA 3VV0A 1WJQA 4L6V5 2ZR2A 3QYHB 2KVQG 3A8MB 4P71A 4HT4A 3I55T 1HXDA 3BW1A 3L42A 4M7AE 3L4GA 4M75B 2L89A 3HFZB 5M9OA 2VXFA 4K87A 3LC0A 3EFRA 1N9RA 3UH0A 2I4NA 4F7UG 1VQ5A 3HRUA 2RI5A 3LX7A 1JJ2A 3LSSA 1KG1A 4YRNA 3DSQA 1KQSA 1NJIU 3VQWA 3CMEA 4OB2B 4LVJA 5KE2A 1VQOA 1HC7A 4CRIA 5C6SA 3TREA 1VQ4T 4ZGEB 4RG8A 5DLOA 3QHSA 1G51A 3UGQA 3PZCA 4KT0E 3QYGB 3M4GA 2EJGA 1B70B 1VQ8T 5GAN2 3HFOA 2EQMA 1Q7YC 3CC4A 4H2XB 5LJ3j 1OZ2A 3RKWA 2QQ9A 2K5FA 3PCOB 4YRTA 3UDCA 4LVKA 4LVMA 4C5GA 3FDRA 4ZN3A 2O4XA 3E9IA 3JCMV 4M78D 1I81A 2ZPIB 3V8KA 3CEYA 3CCSA 3DB3A 3MEVA 3V7SA 4H2VA 3TEGA 4F7UA 1Q86U 4EMKC 3WQZA 3NEMA 3JCMc 3HRTA 3CC2A 4GLKA 4J15A 4JDSA 4JLGA 4C8QD 4E47A 4CH5A 2KQWA 2X4YA 2RI2A 4UP8A 3KXTA 4XTUA 3VQXA 5CR2A 5IN1A 3TUPA 2G3RA 4OGEA 4Q6GA 4MMLA 3CCJA 3IALA 1KMNA 2DVEA 4A54A 3CCVA 1OI1A 1ZHIA 3LYIA 4C8QC 2M16A 1B70A 2ZPEB 4UPAA 2RK2A 2ZPFB 2DZ9A 3J81E 4LVIA 3G4ST 2AKWB 2DIGA 4F7UB 3OY9A 4ME7A 2DPPB 1JJCB 3M57A 3URGA 3A7AA 4M77C 5CQXA 5CKEA 1S72T 3PNWC 4P72A 4YPFA 1M1KC 4HWTA 1X56A 1WJRA 1VQMT 4PHCA 5GAOl 1YCYA 5CKFA 4CH6A 2V8KA 4M75F 4C0GA 1H4VB 2H3JA 4TVAB 4LD9K 2YHTA 1KC8U 1J5WA 4JRIA 4M78F 3A7UA 2ZR3A 1G5HA 3RF1A 1JBMA 2LX9A 1B7YB 2PU9B 2HAXA 3QNEA 4TWAA 1IZ6A 1ZBXA 3ASKA 4C5HA 2EL9A 2KAFA 2M1HA 5LJ5f 2EWNA 3WVEB 3CCUT 3CMAT 1EVLA 2LQ8A 2QEXA 2BUDA 2ZZGA 3VUBA 1K73U 2XHCA 3C12A 2LT1A 1SETA 1VQKT 2C06A 2K4YA 3LH0A 3MHXA 3M59A 1QVPA 1OYXA 1I4K1 3A31A 2HNIA 3HL8A 3HY0A 4Y28E 3S6WA 2F5KA 3CC7A 3G6EA 1C0AA 2DK3A 3E9FA 3HXXA 4C5EA 4KBMB 1VQZA 5J3BA 1VQ9T 2RM4A 2GFAA 4EX5A 4L5GA 2RI3A 1X75C 2F69A 4R55A 3CPWS 1BIAA 4EMHA 2QQRA 4YTLA 2DU5A 5HGQA 5L8RE 4Q15A 4HVCA 4ELZC 2P5IA 3NTKA 2XIDA 2VV5A 3OYBA 2YLCA 4BDYA 3OYMA 1B34A 3CCST 5FU6C 1NJIC 1ATIA 1RIQA 3CCLA 3RIRA 1EVKA 4CS3A 5GMKi 4FL6A 3CMAA 1QP3A 5CQYA 3NELA 4J6XA 2MF2A 3VUZA 2GF7A 2PQWA 3PGGA 1W4SA 2DXTA 1Q81U 3CCRT 3BDLA 4IUUA 1VQLA 3CXCA 3DKMA 2DIQA 2JNGA 2QQSA 3S3NA 4HT8A 5GMKm 2VUBA 4RQFA 3QO7A 5HK3A 3OQ5A 3BFMA 3M54A 2EQJA 3CBOA 2LC4A 2XKOC 1BKBA 2CZ6B 1Y07A 5CCAA 5GAN4 2WSEE 1BI3A 2A7YA 4IUQA 3A8OB 3GPLA 1N27A 1YGBA 2HD0A 2QDYB 5FRMA 3FEOA 3QDRB 1H4SA 4TVRA 1BI0A 2JUFA 4JRQA 3IG2A 3HFNA 4TVWA 1EFWA 2XD0A 4MZMA 2X35A 2WACA 3MP8A 4PJOD 4CS2A 4EO4A 4FT2A 1PSFA 2E64A 1DJ7B 4PG3A 4C92E 3L2ZA 3CCQT 3SFMA 4EMKA 2ZT5A 1SESA 3RMSA 3M4QA 4E7KA 5LJ3f 4J7IA 4OB1B 3P8YA 4BI3A 3MQZA 3PCOA 3TEEA 2FYKA 2RHSB 1P92A 5GAMd 3KUFA 4BY6B 3OMGA 4K88A 1KQ2A 1YI2T 3MCAB 1YJNT 1M8VA 3GP8A 2CZ0B 4V2SA 3UT1A 3KBGA 3RKXA 4PJOF 4F7UF 4NCXA 1IL2A 3Q1JA 4CH4A 3P8DA 4XU1A 4B9WA 2E6NA 3JCMf 4PJOC 1NNHA 3REXA 5D6XA 1Y71A 2K57A 2DDZA 5CAIA 3LSQA 5LJ3g 3OMCA 4C92F 3QG1A 4YCVA 3MEWA 2CZ1B 2J3LA 1D3BB 1LOJA 2MWPA 1G3YA 3M5AA 4J5YA 2ZCFB 3RACA 2OAUA 3LW5E 4E7LA 3E9HA 3ERRA 3EFSA 4HCCA 4EDUA 4XK8E 2JVVA 3L2RA 5GAN3 1LNXA 2ZNIA 5CK9A 3A5YA 1VQPA 1XOVA 2EAYA 5C0MA 2ZZFA 3JCMd 3P8TA 4RQEA 3MP1A 2I4OA 2CJ9A 2RHSA 3FLGA 1YB3A 4WI1A 2G4CA 1JB0E 2DEQA 3TCJA 2PUKB 2PMEA 2X4WA 1NJ8A 4RG2A 5ELOA 3TU4K 4M78G 4IUVA 1Q82U 4P73C 2CIMA 1NPPA 2ZCEA 1W66A 4P3OA 2HQXA 3QZ9B 4J6YA 1SSFA 1UEBA 2CJAA 3CBMA 4FU6A 1JRIA 4C92G 11ASA 5LJ5h 2R5AA 2VGMA 4C92D 1Y96B 4KQEA 4TVAA 3JAME 3QJ6A 4IUPA 3MEUA 3OYAA 1W2BA 4QQDA 4P3NA 4A53A 3MP6A 1QVGA 2P0LA 4H2XA 2DZCA 3OYNA 4BY6C 1B34B 1QE0A 3OYDA 2L3RA 2FB7A 1N9WA 3GIBA 2RJCA 3V8JA 2Q7EA 3QO8A 5DY9A 2QHVA 2K5IA 4NOYA 1NYQA 4ZTJA 4TQDA 3V7RA 3HSBA 2O4XB 1O9SA 2P0PA 4HCBA 1VQLT 4ZTUB 2XU8A 3CCET 4ATOA 2M9UA 2E6ZA 3HXUA 3JRZA 4TTVA 5KE3A 5GAOq 3SD4A 4C0DC 5E3IA 2IG0A 2ZIMA 1WGSA 3P8HA 4HWPA 4KULA 4JLIA 5GAN8 1M1GA 2ZT8A 4M7AC 5D6WA 4HA8A 4WJ4A 4YRCA 5A0GA 3FRNA 5GANh 1NZ9A 12ASA 3M55A 4YRMA 3ME9A 4CS4A 3HXZA 4OGCA 1G3SA 5K1XA 2PUOB 3OBWA 1VQNT 4JS5A 1B76A 3E9GA 4II1A 1YJWT 2VC8A 3JB9D 1YIJA 1G5IA 3VQYA 1MHNA 2P0KA 1NE8A 1WU7A 3L4GB 1VQPT 4PNOA 4P5NA 1FYFA 3DLLA 1IREB 2RHIA 1HTTA 4E51A 5GANe 4BW9A 1EIYB 3H6ZA 3X26B 4HWSA 1Q82C 2RJDA 3LWHA 1YJ9T 2RJFA 4M77D 1KOGA 5GAOp 4Z02A 2RH2A 2MAMA 2J3MA 2LCCA 1SRYA 1VQ7A 3JSCA 2K5LA 1M1KU 4OB3B 5GANf 3CCEA 5D6YA 1QVFA 1KD1U 3OYEA 2K2VA 5HY6A 4J6WA 5CO7A 4C8QG 1WYDA 1ZQ1A 3HTZA 2A8EA 4ZTZB 4XTZA 4RMFA 3MEYA 1YI2A 4NL3A 4YRQA 1Q86C 4BWAA 4M78B 3HXVA 5LJ5g 1FXXA 1N8RC 1EQRA 1BIBA 2C7IA 1VQ9A 2QEXT 2BIVA 3QKJA 4HWOA 4M75C 2E41A 4OB0B 2XI9A 3FIFA 3H8ZA 4RKUE 2I2LA 3P8VA 3VYGA 1G3TA 4XU2A 4LDVA 5K1PA 4QVZA 4C0ZA 3HKSA 4C92B 1G5VA 2E12A 5IT9E 4M7DC 5LJ3d 3OSVA 3HRSA 1JJCA 2LTOA 4DOVA 3CCLT 1YITA 1MGQA 4BE1A 4C5IA 3QIIA 4UP7A 2Y4YA 3JCMW 1X54A 2FHDA 2P4TA 4F7UE 1U1TA 1WPYA 3CCMT 1X2GA 1LJOA 2DTHA 3FJPA 1USYC 2CJBA 1QP2A 4YRLA 3NTHA 3QPHA 1NJ1A 3OYHA 2DU7A 2XICA 5GAOm 4P74C 4VUBA 4M78E 4X9DA 2VXEA 3OYFA 2P0QA 5CIUA 1H4TA 1QVFS 3CC2T 4A4KA 4C0FA 4BACA 4E7IA 4YRPA 3N5BB 3OYCA 4M78A 1Y7XA 5GAMh 4N0AA 5LL6S 5KCHA 4YRFA 1K73C 3I7FA 1M9SA 5CKDA 1NPRA 3PIPA 3OS1A 3OW2A 2XG8D 4ZGDB 4C8QB 1KHCA 4ZGJB 5GAMj 4HCZA 2ZPGB 1FWZA 3G4SA 5GMKe 4XTYA 1Y96A 3RL6A 3ICAA 1YHQA 1USYA 3M4YA 4TVYA 3EAEA 4A4FA 4KR3A 2FL7A 3OS5A 3JB9H 4PLIA 2ZTGA 3R6OA 2RHUA 2Y90A 3CXCS 2ALYA 4M77G 3REUA 1UB4A 4J8OA 2MMPA 4BB7A 1VQ4A 2JZ2A 3A8LB 3G7ZA 3CC4T 3CC7T 1W2BS 2O01E 1ADYA 3UWNA 3WXMB 1ASZA 3C95A 1NJ5A 3PMTA 2Q5IA 4YROA 2RHQA 1RI0A 3G6ET 4XAXB 3OBYA 5GAMf 3OS2A 1NJ2A 3OYYA 4A4HA 2ZXFA 1XTDA 2LT4A 2IY5A 4KR2A 3MEAA 3CMET 3JCMX 4M75A 3CD6A 1E1TA 4YRIA 2NS6A 2XTIA 2PVGB 1X01A 2KY9A 4M75E 4XTVA 1AHJB 3A74A 4UP9A 1VQ8A 4YRGA 4R56A 3M56A 4EMGA 4B9XA 4KUDK 1BBWA 3QO5A 4IURA 2R57A 3A5ZB 4YRJA 3L2WA 3MF1A 3QO3A 2MWOA 3RERA 1GGMA 2F5TX 4M77A 3VU3C 3LGLA 3HRKA 5FU7B 3OA6A 2DTIA 3PMIA 1M1FA 4DPGA 3BY7A 3AHUA 3VBBA 2CS7A 3QSUA 2XDPA 1NJ6A 2CKKA 5ELNA 3C4SA 4YCWA 4JRKA 3C94A 3RKYA 1YFTA 3BJUA 4JS4A 1YITT 1VQ5T 1S72A 3RMQA 4DQ2A 4BI4A 4L87A 1D3BA 2OTLT 2NLUA 3FC3A 4FIBA 2EIFA 3OB9A 1PYSB 2AMCA 4YCUA 4H2YA 3X20B 3CD6T 1VQ6A 1K9MU 2DKGA 3CCJT 4YYEA 2A3LA 4K86A 3E19A 4O2DA 4PJOG 5LJ5d 1GXIE 1L0WA 2L8DA 5EG2A 2JTFA 2WSFE 3TEHB 5GAN7 1KMMA 2ZZDA 3V7CA 3JB9I 1HK9A 3JCMh 5FU6B 2E70A 2RB6A 1KHIA 2XK0A 1OZ3A 2D9TA 3META 2OTJA 1VIFA 3X25B 3A8HB 1UGRB 4OF1A 4Y91A 4NS5A 2KMTA 4X34A 3L2QA 5GAMe 3PFSA 2QXFA 2EKOA 3QTCA 2EJFA 3I56T 4LD6A 1VQOT 1U8RA 2ZPHB 1QF6A 3QXEB 2DD4A 4P75C 3HHTB 1Q7YU 1YFSA 3P8BB 3V8LA 3QUIA 4E7HA 2OTJT 4QVCA 2CYZB 4C92A 2HQEA 2E5QA 4GY5A 3I55A 2XGTA 3SWNB 4XU3A 3G71A 4EPCA 5HKCA 5LJ5j 4LVLA 3JB9G 1UGPB 1B7YA 4O6JA 3M9QA 3MO8A 1QVGS 3LLRA 1BYMA 2KK4A 1VQ6T 3CBPA 4H2WA 4QW2A 2GQVA 2ARTA 3HRIA 4MZPA 2VGNA 5GMKj 4P74A 2E3CA 5HK0A 2KSSA 2B8AA 3M53A 2DAQA 2E10A 4M75D 4A4GA 4H2UA 5GANg 3VJPA 3JCMg 4PLLA 4N0AC 5A0DA 1WQ7A 2X4XA 2RD1A 1EOVA 4H2TA 1BI2A 4XQ3A 5I21A 2PVDB 3SB2A 3WVDB 3GLXA 5J26A 1XNIA 2OTLA 3LWIA 4YDQA 4OVAA 4XEOA 5I2MA 3CPFA 5KCOA 4XU0A 4OMFB 3CCUA 4YP0A 4LDUA 1XQHA 2RHZA 1N8RU 4PJOE 3G71T 4N4HA 4P71C 1E1OA 4E7JA 5CKHA 4OLFA 4D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2G A;  1E24 A;  4PJO D;  5LJ5 e;  1LJO A;  4G84 A;  4CS2 A;  4EO4 A;  2E64 A;  2DTH A;  1B8A A;  5GAO n;  3FJP A;  1U1S A;  1USY C;  2CJB A;  2ZR2 A;  4PG3 A;  4C92 E;  3L2Z A;  4P71 A;  2AKW A;  4YRL A;  1HXD A;  4G85 A;  3BW1 A;  4EMK A;  4M7A E;  2ZT5 A;  1SES A;  3L4G A;  3M4Q A;  2ALY B;  4M75 B;  1YFR A;  3HFZ B;  1NJ1 A;  5LJ3 f;  4RDX A;  3P8Y A;  4M7D D;  4M7A F;  2DU7 A;  4M7D F;  4M7A D;  2VXF A;  3PCO A;  4K87 A;  5GAO m;  3LC0 A;  4P74 C;  3EFR A;  2FYK A;  1N9R A;  2ZGW A;  4M78 E;  4F7U G;  4X9D A;  5GAM d;  3JB9 F;  4XTW A;  2I4N A;  2RHS B;  2VXE A;  1H4T A;  1WQW A;  4K88 A;  1N9S A;  3LSS A;  3VQV A;  1KQ2 A;  4YRN A;  4YRP A;  3UFG A;  3DSQ A;  4M78 A;  2E65 A;  5GAM h;  3VQW A;  1M8V A;  2ZNJ A;  4YRK A;  4V2S A;  4N0A A;  2Q7H A;  4YRF A;  2CGH A;  3RKX A;  1HC7 A;  4PJO F;  2E1H A;  4F7U F;  4EMK B;  4NCX A;  1IL2 A;  3QHS A;  4CH4 A;  3I7F A;  1G51 A;  3UGQ A;  4XU1 A;  4PJO A;  4M78 C;  3JCM f;  4PJO C;  1NNH A;  1WLE A;  3PZC A;  3REX A;  3M4G A;  2EJG A;  2I4M A;  1B70 B;  4C8Q B;  2K57 A;  3W3S A;  5GAM j;  2DDZ A;  5GAN 2;  5CAI A;  3LSQ A;  4M7D B;  5LJ3 g;  3HFO A;  4ZIB A;  4H2X B;  5LJ3 j;  4C92 F;  5GMK e;  3RKW A;  5GAM g;  4YCV A;  4XTY A;  4MMK A;  1Y96 A;  3RL6 A;  2J3L A;  3ICA A;  3G1Z A;  1D3B B;  1LOJ A;  1USY A;  3PCO B;  4C92 C;  4X5O A;  4YRT A;  4TVY A;  4KR3 A;  4J5Y A;  2Q7G A;  3RAC A;  3JB9 H;  4HWR A;  2ZTG A;  3E9I A;  4C8Q F;  3E9H A;  3JCM V;  3ERR A;  4M78 D;  2Y90 A;  1I81 A;  2ALY A;  5GAN 6;  4M77 G;  3REU A;  3V8K A;  3EFS A;  3JB9 J;  3INZ A;  5GAN 3;  1LNX A;  3A7R A;  5C52 B;  2ZNI A;  3V7S A;  1ADY A;  3A5Y A;  4H2V A;  4M7A A;  3TEG A;  2EAY A;  4F7U A;  2ZZF A;  5F5W A;  4C8Q E;  1NJ5 A;  1ASZ A;  3WQZ A;  4EMK C;  3JCM d;  2Q5I A;  4YRO A;  3JCM J;  3P8T A;  3NEM A;  2RHQ A;  4RQE A;  1E22 A;  3JCM c;  4H02 A;  2I4O A;  4WJ3 M;  2CJ9 A;  4J15 A;  2RHS A;  4TQF A;  1YB3 A;  4C8Q D;  4CH5 A;  1I8F A;  5GAM f;  1NJ2 A;  2IY5 A;  2ZXF A;  3MF2 A;  4UP8 A;  4WI1 A;  4KR2 A;  2G4C A;  4XTU A;  2DEQ A;  3JCM X;  4M75 A;  2PME A;  3VQX A;  1E1T A;  3JCM e;  4YRI A;  3TUP A;  2QHU A;  2XTI A;  5KNN A;  1NJ8 A;  2ZT6 A;  4M77 E;  4Q6G A;  5ELO A;  4AH6 A;  4M78 G;  4MML A;  1X01 A;  4P73 C;  3IAL A;  4M75 E;  4WF2 A;  4XTV A;  2CIM A;  3A74 A;  5LJ3 h;  1KMN A;  1PYS A;  3NET A;  2DVE A;  4A54 A;  2ZCE A;  1W66 A;  4P3O A;  3CMQ A;  4C8Q C;  2PMF A;  4UP9 A;  4YRG A;  2DQ0 A;  2AMC B;  4J6Y A;  1B70 A;  4EMG A;  3UGT A;  2CJA A;  1BBW A;  4CH3 A;  4UPA A;  3QO5 A;  2DZ9 A;  1JRI A;  3HXW A;  4C92 G;  4YRJ A;  11AS A;  5LJ5 h;  3IKL A;  2AKW B;  3MF1 A;  4C92 D;  1Y96 B;  4F7U B;  4KQE A;  2YLB A;  3QO3 A;  4TVA A;  1TH7 A;  3RER A;  1GGM A;  1JJC B;  1M5Q 1;  1EIY A;  4M77 A;  3TEH A;  3VU3 C;  3A7A A;  3M4P A;  4M77 C;  4XEM A;  4P3N A;  4A53 A;  2ODR C;  3HRK A;  2DTI A;  2P0L A;  3A32 A;  4NL2 A;  1NYR A;  2DZC A;  3BY7 A;  4H2X A;  3AHU A;  4P72 A;  4YPF A;  3VBB A;  4DPG A;  4HWT A;  2ZT7 A;  1X56 A;  3QSU A;  5C51 B;  1B34 B;  1QE0 A;  1NJ6 A;  2FB7 A;  1N9W A;  3NEN A;  3GIB A;  4PHC A;  2JN0 A;  5ELN A;  5GAO l;  1YCY A;  4P75 A;  4YCW A;  3V8J A;  2Q7E A;  4JRK A;  1WNL A;  3QO8 A;  3RKY A;  3HXY A;  5DY9 A;  2QHV A;  4CH6 A;  4M75 F;  1H4V B;  1YFT A;  3BJU A;  4TVA B;  1NYQ A;  4NOY A;  2ARU A;  2YHT A;  4TQD A;  4DQ2 A;  1J5W A;  4JRI A;  3V7R A;  4L87 A;  3HSB A;  4M78 F;  1D3B A;  3A7U A;  2ZR3 A;  1I5L A;  1G5H A;  4ZTU B;  3RF1 A;  1JBM A;  1B7Y B;  1PYS B;  4YRR A;  3QNE A;  2AMC A;  3JCM Q;  4TWA A;  1H4Q A;  4YCU A;  3HXU A;  2EL9 A;  5GAN j;  2C8M A;  4TTV A;  5GAO q;  4H2Y A;  5LJ5 f;  5E3I A;  2ZZE A;  2EWN A;  2ZIM A;  1EVL A;  2DKG A;  2ZIO A;  4YYE A;  4HWP A;  5GAN 8;  4JLI A;  4K86 A;  3RGL A;  4M7A B;  5GAO r;  2ZT8 A;  4O2D A;  2ZZG A;  4M7A C;  4PJO G;  5LJ5 d;  3L1A A;  1L0W A;  4HA8 A;  4WJ4 A;  2I4L A;  4M77 B;  3TEH B;  4YRC A;  5GAN 7;  2IY5 B;  1KMM A;  1SET A;  4P73 A;  5GAN h;  3V7C A;  3JB9 I;  1HK9 A;  1X2H A;  3BDU A;  3JCM h;  2DQ3 A;  2RHQ B;  12AS A;  2DJZ A;  4YRM A;  4H2S A;  4CS4 A;  2RB6 A;  1Z7M A;  3HXZ A;  3KFU A;  1I4K 1;  2EJ9 A;  3A31 A;  2HNI A;  2E5A A;  5K1X A;  3HY0 A;  1B76 A;  4Y91 A;  1C0A A;  5GAM e;  3HFV A;  2VC8 A;  3HXX A;  3JB9 D;  4M75 G;  3QTC A;  1G5I A;  2EJF A;  3VQY A;  2ODR D;  1VQZ A;  1WU7 A;  1X55 A;  3L4G B;  4PNO A;  1FYF A;  2RM4 A;  1HTT A;  1LYL A;  4E51 A;  5C53 B;  4EX5 A;  5GAN e;  4BW9 A;  1QF6 A;  2ZIN A;  4P75 C;  1EIY B;  3RES A;  4YRS A;  1H64 1;  3FB9 A;  1YFS A;  3HY1 A;  4HWS A;  1BIA A;  3SWN A;  3V8L A;  3R07 A;  3QUI A;  4EMH A;  4M77 D;  1KOG A;  2DU5 A;  5GAO p;  5HGQ A;  5GAN d;  4X9C A;  4QVC A;  1ADJ A;  4Q15 A;  2J3M A;  4HVC A;  4C92 A;  4M7D G;  1SRY A;  2QHT A;  2P5I A;  2XGT A;  3SWN B;  4M7D E;  4P3P A;  4XU3 A;  5GAN f;  5LJ5 j;  4M7A G;  3JB9 G;  4QVD A;  2YLC A;  1B34 A;  1B7Y A;  4M77 F;  1ATI A;  1RIQ A;  4J6W A;  4C8Q G;  1WYD A;  3HTZ A;  3UH0 A;  4ZTZ B;  4XTZ A;  2DXU A;  3RIR A;  1EVK A;  4RMF A;  3MEY A;  4CS3 A;  4NL3 A;  5GMK i;  4YRQ A;  4BWA A;  4H2W A;  4M78 B;  3JCM P;  3HXV A;  5LJ5 g;  3NEL A;  2DTO A;  4J6X A;  4OP0 A;  2ART A;  1EQR A;  3HRI A;  1BIB A;  2C7I A;  3PGG A;  5GMK j;  4P74 A;  2DXT A;  2E3C A;  5GAN 5;  4HWO A;  4M75 C;  4C8Q A;  1Z7N A;  2E41 A;  3RUX A;  3HFZ A;  4LNS A;  1SER A;  3FIF A;  2E10 A;  4M75 D;  2Q5H A;  4HT8 A;  4H2U A;  2I2L A;  5GMK m;  3P8V A;  4RQF A;  3QO7 A;  5GAN g;  1BBU A;  3BFM A;  3JCM g;  4N0A C;  4XU2 A;  1WQ7 A;  4RCC A;  5K1P A;  4XTX A;  2RD1 A;  1EOV A;  5LJ3 e;  4H2T A;  2QTX A;  3SWN C;  4XQ3 A;  4C92 B;  5I21 A;  5GMK l;  5GAN 4;  3SB2 A;  2RA2 A;  4M7D A;  4M7D C;  1YGB A;  5GMK h;  5LJ3 d;  1ASY A;  4RCB A;  4YDQ A;  4XEO A;  1H4S A;  4HT9 A;  4PJO B;  1JJC A;  3JCM b;  4XU0 A;  1MGQ A;  2QHS A;  3IG2 A;  4YP0 A;  3HFN A;  4TVW A;  3A5Z A;  2ARS A;  4UP7 A;  1EFW A;  1KQ1 A;  4P72 C;  4PJO E;  4YRE A;  4JUV A;  3JCM W;  1X54 A;  3OD1 A;  4P71 C;  1E1O A;  4F7U E;  4OLF A;  1U1T A;  1WPY A;  3IKM B; 
#chains in the Genus database with same CATH topology
 5LJ5 e;  5KYU B;  1B8A A;  5GAO n;  1U1S A;  4WCI A;  2LRQ A;  3VS6 A;  1VA7 A;  2DXC A;  1IGQ A;  3A8G B;  3DB4 A;  1K0S A;  2AKW A;  1MMA A;  1IO6 A;  2D6F A;  4G85 A;  3QZ5 B;  4D8D A;  2V26 A;  3X28 B;  2ALY B;  1YFR A;  4E7Z A;  5A0L A;  3ZBD A;  4RDX A;  4M7D D;  4M7A F;  4M7D F;  4M7A D;  1K8A U;  4J7F A;  2EYX A;  5KYN A;  2ZGW A;  3JB9 F;  2X4J A;  3I56 A;  1VUB A;  4XTW A;  4B6M A;  1WQW A;  4ZTF A;  1N9S A;  1KD1 C;  4LN2 A;  3VQV A;  1M8M A;  3CCV Q;  2DX1 A;  1M4Z A;  3UFG A;  1K9M C;  1OV3 A;  4MZT A;  5FRO A;  2E65 A;  5I2S A;  2ZNJ A;  3EG9 A;  1JJ2 P;  4YRK A;  1PD0 A;  3GNG A;  2DRM A;  2J06 A;  2Q7H A;  2KDS A;  2CGH A;  2E1H A;  2RF0 A;  4EMK B;  3CC2 Q;  3O8V A;  4DA4 A;  2JOY A;  1YBY A;  4PJO A;  3QBY A;  4M78 C;  1TSF A;  3D7S B;  1WLE A;  2EFI A;  5IAY A;  2I4M A;  3OYK A;  3W3S A;  1V29 B;  1VYT A;  1FX7 A;  4M7D B;  4ZIB A;  4L59 A;  2KXD A;  3QWX X;  4N4G A;  1YHQ T;  2X3W D;  1KQS S;  2DD5 A;  2YRV A;  5GAM g;  2QDL A;  4LDW A;  4MMK A;  4QQ6 A;  3C0C A;  1KC8 C;  3G1Z A;  1M90 U;  3S3M A;  4C92 C;  4X5O A;  2JTM A;  3EHQ A;  2RO0 A;  4BUG A;  2Q7G A;  4BE0 A;  5AYF A;  3GF5 A;  4HWR A;  3CCR A;  4C8Q F;  1LVK A;  4ELY C;  3SDZ A;  5GAN 6;  3OW2 P;  2WSC E;  1M30 A;  3JB9 J;  2EYZ A;  4BD3 A;  3INZ A;  1WIE A;  4FYW B;  4IKF A;  3A7R A;  5C52 B;  2D0N A;  1W6X A;  4JJN K;  1T0H A;  3G1J A;  2BZX A;  2CP0 A;  2LNV A;  4M7A A;  5F5W A;  4J9F A;  4C8Q E;  4UC4 A;  2YWW A;  3JCM J;  4KUI A;  1PWT A;  1E22 A;  4H02 A;  4WJ3 M;  3PTA A;  4TQF A;  3EFO B;  5FU7 C;  3ZFJ A;  1I8F A;  1NYG A;  1CKA A;  1PRL C;  3MF2 A;  1N6A A;  4FSX A;  4HVV A;  4Z8A A;  5IHI A;  3JCM e;  2QK0 A;  1VQK A;  2QHU A;  1X27 A;  5KNN A;  4PJJ A;  2ZT6 A;  1TUC A;  4M77 E;  4AH6 A;  1Q82 R;  2RQT A;  4WF2 A;  5KYU A;  2D8J A;  5LJ3 h;  1WXU A;  1PYS A;  3NET A;  9ATC B;  3NTI A;  4MDW A;  2DJQ A;  2FPF A;  3CMQ A;  2PMF A;  2XDD A;  4O5V A;  1AZE A;  2DQ0 A;  2QA4 A;  3I56 Q;  2AMC B;  2K3X A;  3M0U A;  2HBP A;  3UGT A;  4CH3 A;  2YUP A;  2LQK A;  2O2O A;  1D0Y A;  3HXW A;  2GTO A;  1EIF A;  3NFC A;  3IKL A;  3OS0 A;  1RLP C;  2RJE A;  2EQU A;  5A2Q E;  2NYS A;  2A0F B;  2YLB A;  1TH7 A;  1R8O B;  4F17 A;  1V76 A;  1AEY A;  1M5Q 1;  2KXC A;  3CCQ A;  1EIY A;  1YWP A;  2JJ9 A;  4J9I A;  4C0D B;  3TEH A;  3M4P A;  4XEM A;  2DXB A;  2H3E B;  2ABL A;  2QQB A;  2DA9 A;  2R5M A;  2VVK A;  2NWM A;  5KH6 A;  2ODR C;  5FRN A;  4PKC C;  3A32 A;  4NL2 A;  2DO3 A;  1NYR A;  1JU5 C;  4OML A;  2MPX C;  2IIM A;  5DM7 R;  2ZT7 A;  5C51 B;  1ARK A;  3VS0 A;  3UA7 A;  1ZUU A;  3NEN A;  3VYH B;  2JN0 A;  1JJ2 S;  1EX4 A;  1I07 A;  4P75 A;  4JRP A;  1WNL A;  2PVO B;  3HXY A;  1SHG A;  3LGF A;  1VQM A;  2ARU A;  1VQ7 T;  2GBQ A;  1QW1 A;  3ER0 A;  1G3W A;  1UDL A;  2M0Y A;  3ZEH A;  3OYI A;  1I5L A;  1B07 A;  4FT4 A;  1AVZ C;  2RHX A;  1YJ9 A;  1U5S A;  4YRR A;  1X43 A;  1K8A C;  1X2K A;  2CT4 A;  2GCX A;  4R0K A;  3JCM Q;  3S3O A;  1H4Q A;  1Q81 C;  2RHY A;  3OYL A;  2D0Q B;  2RK1 A;  5GAN j;  2C8M A;  4RMO A;  2ZZE A;  2KYM A;  1K0X A;  3OSS C;  4IUT A;  2ZIO A;  1UGQ B;  1O75 A;  2V8I A;  3RGL A;  4M7A B;  1ZSZ B;  5GAO r;  2L5Q A;  3VS4 A;  3PT9 A;  1F1B B;  1ZUY A;  1YIJ T;  3EG1 A;  2QA4 T;  2QTV A;  1YJW A;  1PD1 A;  3L1A A;  3OW2 S;  1JO8 A;  4PFZ A;  2I4L A;  2JS2 A;  2F2V A;  4M77 B;  3M58 A;  2DF6 A;  2IY5 B;  2EYW A;  4P73 A;  2R58 A;  1X2H A;  3BDU A;  2DQ3 A;  2QI2 A;  2RHQ B;  1PC0 A;  1T0J A;  2DJZ A;  2BTT A;  3X24 B;  4H2S A;  3CCU Q;  1M2O A;  1Z7M A;  5L23 A;  3KFU A;  3L2U A;  3CPW A;  2EJ9 A;  2E5A A;  3J7A F;  2QG9 B;  4MDX A;  2NUT B;  3L2V A;  3T9N A;  1RAF B;  2HSP A;  3E1S A;  3I35 A;  1TOV A;  3EGU A;  3HFV A;  1M3B A;  1UGS B;  4M75 G;  3DLM A;  1S1N A;  2FRW A;  2ODR D;  4A4E A;  4ZN1 A;  1X55 A;  1UE9 A;  1LYL A;  4J83 A;  2FZK B;  5C53 B;  1VQP Q;  2ZIN A;  1IGU A;  3G4S Q;  1X6O A;  3RES A;  4FM4 B;  1WA7 A;  4YRS A;  1BI1 A;  1H64 1;  3FB9 A;  3HY1 A;  1WYX A;  3SWN A;  3OYG A;  5J39 A;  3R07 A;  1VQN A;  3VS3 A;  2CT3 A;  4Q5W A;  1NEB A;  2FO0 A;  1YN8 A;  5GAN d;  4X9C A;  1ADJ A;  1U06 A;  2DL7 A;  4M7D G;  3F70 A;  2QHT A;  4M7D E;  4P3P A;  4FW2 A;  4PL6 A;  1ACM B;  3EGD A;  2O31 A;  3PIO A;  4M7A G;  4QVD A;  3J80 E;  2K3Y A;  2EYQ A;  2VYT A;  2LCL A;  2V8J A;  1NEG A;  4M77 F;  3UAT A;  2E5K A;  3GNF B;  3EG3 A;  2BKD N;  2CP5 A;  3CCM A;  2DL3 A;  2DXU A;  2F2W A;  4BDZ A;  1VQ4 Q;  3JCM P;  1H3Z A;  2COW A;  2CZ7 B;  4J9B A;  4DBR A;  2L3S A;  2DTO A;  1IXD A;  5CKB A;  4OP0 A;  1V1C A;  3VKI A;  3GOX A;  4QKU A;  2LDM A;  2Y4X A;  5GAN 5;  1RAA B;  2LVM A;  4C8Q A;  1Z7N A;  3RUX A;  3HFZ A;  4LNS A;  1GBQ A;  1SER A;  3HP9 A;  2Q5H A;  2M0O A;  3PVL A;  2AHJ B;  1ZSZ A;  1QKX A;  5FLX E;  1BBU A;  1ZUK A;  5DLQ E;  3CC4 Q;  2AKL A;  1M90 C;  2A37 A;  3O5Z A;  4RCC A;  4XTX A;  2XDB A;  5LJ3 e;  4CI0 C;  3A1P A;  4K11 A;  3QJY A;  1QQJ A;  1VIE A;  2IVW A;  2QTX A;  3SWN C;  4HKE A;  2DL8 A;  1PSE A;  3I55 Q;  4BI8 B;  2EQK A;  1RAE B;  5GMK l;  4BE2 A;  4LDX A;  2DL5 A;  3OYJ A;  2RA2 A;  2MI6 A;  4M7D A;  1TXQ A;  5GMK h;  5CVI A;  1ASY A;  2ZPB B;  4RCB A;  3HPW A;  1JQQ A;  3CCV T;  2QQA A;  4HT9 A;  4PJO B;  1RL2 A;  2FVU A;  4LDY A;  3JCM b;  3UPU A;  2XMF A;  4KGZ B;  3G71 Q;  2QHS A;  4DOW A;  1YJN A;  4F14 A;  3A5Z A;  2ARS A;  2D1X A;  1KQ1 A;  2FPD A;  4P72 C;  3EH2 A;  4JUV A;  4YRE A;  3OD1 A;  1YJN Q;  3IKM B;  1X6B A;  3G6E Q;  1E24 A;  4G84 A;  1WJS A;  2GFU A;  4JPB W;  4N4I A;  4QQG A;  3VV0 A;  1WJQ A;  3KFV A;  4L6V 5;  2ZR2 A;  3M0P A;  4AFZ C;  4FSS A;  1OU9 A;  3QYH B;  5IH2 A;  2BZ8 A;  2KVQ G;  3A8M B;  5AT1 B;  1AWO A;  1J3T A;  4P71 A;  4HT4 A;  3I55 T;  1HXD A;  2BE9 B;  3BW1 A;  3L42 A;  4LE9 A;  4J9G A;  4M7A E;  4GLM A;  3L4G A;  4M75 B;  2FPE A;  2L89 A;  5ECA A;  3HFZ B;  3ULR B;  5M9O A;  2NUT A;  1C1A A;  2VXF A;  4EIK A;  4K87 A;  1WDX A;  3LC0 A;  3EFR A;  1N9R A;  3UH0 A;  2I4N A;  1ZSG A;  3H9N A;  4F7U G;  1VQ5 A;  2DER A;  3HRU A;  4Z88 A;  2RI5 A;  1MMG A;  3LX7 A;  1JJ2 A;  5FW9 A;  3LSS A;  4AT1 B;  2ZAE A;  1KG1 A;  4YRN A;  3DSQ A;  1KQS A;  2JMA A;  1NJI U;  3VQW A;  3CME A;  4OB2 B;  1OOT A;  4LVJ A;  5KE2 A;  1VQO A;  4RTT A;  1SSH A;  1HC7 A;  4CRI A;  5C6S A;  1EFN A;  3TRE A;  1VQ4 T;  1KK7 A;  4RG8 A;  4ZGE B;  3H0F A;  3QHS A;  5DLO A;  1G51 A;  3UGQ A;  1VOM A;  3PZC A;  4OMQ A;  4KT0 E;  3QYG B;  3M4G A;  2EJG A;  1MV3 A;  1B70 B;  1VQ8 T;  5GAN 2;  4PJN A;  3HFO A;  4ANJ A;  2EQM A;  1Q7Y C;  3CC4 A;  4H2X B;  4DBH A;  5LJ3 j;  3CCL Q;  1OZ2 A;  3RKW A;  2QQ9 A;  5FWB A;  2J6O A;  4RTW A;  1HD3 A;  4CC2 A;  2K5F A;  2KE9 A;  3PCO B;  4YRT A;  3UDC A;  4LVK A;  4OMN A;  4LVM A;  4C5G A;  3VS2 A;  3FDR A;  4ZN3 A;  2O4X A;  3E9I A;  3JCM V;  4M78 D;  1I81 A;  2DBM A;  2ZPI B;  2YT6 A;  3V8K A;  2EQI A;  4CC3 A;  3CEY A;  3CCS A;  3DB3 A;  2FZC B;  5KYY A;  3MEV A;  5KYX A;  1AOJ A;  1FMV A;  3V7S A;  2KRM A;  1BCM A;  4H2V A;  4JZ3 A;  3TEG A;  4F7U A;  1Q86 U;  4EMK C;  3WQZ A;  1MV0 B;  4AMC A;  3NEM A;  3JCM c;  3HRT A;  3CC2 A;  4GLK A;  4J15 A;  4JDS A;  1M27 C;  4JLG A;  1TS9 A;  4C8Q D;  1U3O A;  4E47 A;  2KQW A;  4CH5 A;  2X4Y A;  2RI2 A;  4UP8 A;  1K1Z A;  3KXT A;  4XTU A;  2DLP A;  1QCN A;  3VQX A;  4OMP A;  5CR2 A;  5IN1 A;  3TUP A;  2G3R A;  4OGE A;  1D1A A;  4Q6G A;  2COZ A;  1NM7 A;  4MML A;  3CCJ A;  1I5O B;  2LQW A;  3IAL A;  1JXM A;  1KMN A;  2DVE A;  4A54 A;  4DEX A;  3CCV A;  1W2B P;  1OI1 A;  1ZHI A;  1PM3 A;  1SRM A;  3LYI A;  4C8Q C;  2A28 A;  1YIJ Q;  2M16 A;  1GL5 A;  4FYV B;  1B70 A;  2ZPE B;  4UPA A;  2RK2 A;  2ZPF B;  2DZ9 A;  3J81 E;  1VQN Q;  1KJW A;  1SHF A;  4LVI A;  2LNH B;  3G4S T;  2AKW B;  2NUZ A;  2DIG A;  3M0Q A;  4F7U B;  3OY9 A;  4ME7 A;  2DPP B;  1JJC B;  3M57 A;  3URG A;  5KYY B;  3A7A A;  4M77 C;  5CQX A;  5CKE A;  1S72 T;  2YUQ A;  3PNW C;  1NLO C;  1SPK A;  4P72 A;  3MKD A;  4YPF A;  1KIK A;  4PFP A;  1M1K C;  4HWT A;  1VQ7 Q;  2HMA A;  1X56 A;  1WJR A;  1VQM T;  4PHC A;  2K79 A;  1UJ0 A;  5GAO l;  5I22 A;  1YCY A;  1LCK A;  1YJW Q;  3QDF A;  4Y92 A;  1ABO A;  1E6H A;  5CKF A;  4CH6 A;  2V8K A;  4M75 F;  4C0G A;  1H4V B;  2H3J A;  1WHK A;  3REA B;  1KFZ A;  4TVA B;  4LD9 K;  3SHW A;  2YHT A;  3I9Q A;  1KC8 U;  1J5W A;  4JRI A;  5GJW B;  1X2Q A;  4M78 F;  2QA4 Q;  1H92 A;  3A7U A;  1RI9 A;  2ZR3 A;  1G5H A;  3RF1 A;  1JBM A;  2LX9 A;  1TUG B;  1B7Y B;  2PU9 B;  2HAX A;  2HSE B;  3QNE A;  4TWA A;  3REB B;  1IZ6 A;  1ZBX A;  3ASK A;  4FCY A;  4C5H A;  4PK4 A;  2EL9 A;  2KAF A;  2M1H A;  5LJ5 f;  2EWN A;  3WVE B;  1UFF A;  3CCU T;  3CMA T;  7AT1 B;  1WHM A;  1EVL A;  2LQ8 A;  3MPU B;  2QEX A;  2BUD A;  2ZZG A;  3TSZ A;  4OMO A;  3VUB A;  1K73 U;  1QWF A;  3VS7 A;  2DM1 A;  2XHC A;  2GNC A;  3C12 A;  2LT1 A;  3BE3 A;  1SET A;  1VQK T;  2C06 A;  2K4Y A;  1M1K R;  3LH0 A;  4RTZ A;  3MHX A;  3M59 A;  3CCJ Q;  1QVP A;  1OYX A;  1I4K 1;  3A31 A;  1VQM Q;  2HNI A;  3HL8 A;  3HY0 A;  4Y28 E;  4AG1 C;  3S6W A;  2F5K A;  3CC7 A;  3G6E A;  1SKU B;  1C0A A;  2DK3 A;  2HEQ A;  3E9F A;  3HXX A;  4C5E A;  4KBM B;  1SG5 A;  4DBQ A;  1VQZ A;  1Q86 R;  5J3B A;  1VQ9 T;  2RM4 A;  1NBE B;  1C0M A;  1QMC A;  2GFA A;  4EX5 A;  2A08 A;  1YIT Q;  4L5G A;  1GCP A;  2RI3 A;  1X75 C;  2F69 A;  2PTK A;  3NHN A;  4R55 A;  3CPW S;  1BIA A;  4EMH A;  2QQR A;  4YTL A;  2DU5 A;  3M0S A;  5HGQ A;  5L8R E;  4Q15 A;  4HVC A;  4ELZ C;  3EFO A;  3EH1 A;  3EG0 A;  1ABQ A;  2DE0 X;  2P5I A;  3NTK A;  2XID A;  2VV5 A;  3OYB A;  2ED1 A;  2L3Q A;  2YLC A;  5IXF A;  4BDY A;  3OYM A;  1B34 A;  3CCS T;  1QCO A;  2CSI A;  5FU6 C;  1NJI C;  1ATI A;  1RIQ A;  1E6G A;  3CCL A;  1EZZ B;  3RIR A;  1EVK A;  4CS3 A;  4RTU A;  5GMK i;  4FL6 A;  3CMA A;  4KH1 B;  1QP3 A;  3VRY A;  4DEY A;  5CQY A;  1NYF A;  3NEL A;  2MYS A;  4J6X A;  2DBK A;  2MF2 A;  3VUZ A;  5GJV B;  1TU0 B;  2GF7 A;  1C6V X;  2PQW A;  3PGG A;  1W4S A;  1MMD A;  2DXT A;  2O9S A;  1Q81 U;  1LPL A;  3CCR T;  1D09 B;  3BDL A;  4IUU A;  1XJW B;  2DIL A;  1VQL A;  2YXY A;  2LJ1 A;  3CXC A;  3DKM A;  2DIQ A;  2JNG A;  2QQS A;  3S3N A;  4HT8 A;  1PKS A;  5GMK m;  1BCO A;  2VUB A;  3QO7 A;  4RQF A;  5HK3 A;  3OQ5 A;  1GRI A;  3BFM A;  3M54 A;  2EQJ A;  3CBO A;  2AZS A;  2LC4 A;  1QVG P;  2YRD A;  2XKO C;  1BKB A;  2CZ6 B;  1UTI A;  1Y07 A;  2CDT A;  2VKN A;  5CCA A;  5GAN 4;  2WSE E;  1BI3 A;  1WI7 A;  2A7Y A;  2G6F X;  4IUQ A;  3A8O B;  3GPL A;  2EPD A;  1N27 A;  2ENM A;  3RNJ A;  3U23 A;  2QGF B;  2HD0 A;  1YGB A;  2J7I A;  2QDY B;  5FRM A;  3FEO A;  3QDR B;  3CC7 Q;  3CCM Q;  1H4S A;  4IIM A;  4TVR A;  1BI0 A;  2JUF A;  4JRQ A;  3IG2 A;  1G8X A;  1WXT A;  3HFN A;  4TVW A;  1EFW A;  2XD0 A;  1PCX A;  1OU8 A;  4MZM A;  2X35 A;  4ORZ A;  2J6K A;  2WAC A;  3TQ7 P;  3MP8 A;  2FG0 A;  4F04 B;  4PJO D;  4CS2 A;  4EO4 A;  4FT2 A;  1PSF A;  2E64 A;  1PRM C;  2ATC B;  1DJ7 B;  1ZA1 B;  2RN8 A;  4PG3 A;  2W10 A;  4C92 E;  3L2Z A;  1YP5 A;  4KRT A;  3CCQ T;  3SFM A;  3PVQ A;  4RTX A;  1HSQ A;  4EMK A;  2ZT5 A;  1SES A;  3RMS A;  3M4Q A;  4E7K A;  5LJ3 f;  4J7I A;  4OB1 B;  3P8Y A;  1OPK A;  1UG1 A;  4BI3 A;  3MQZ A;  3PCO A;  2I0N A;  3TEE A;  1TG0 A;  3CPW P;  2FYK A;  1KQS P;  5GAM d;  1P92 A;  2RHS B;  3KUF A;  4BY6 B;  3OMG A;  4K88 A;  2P4R A;  1KQ2 A;  1Q7Y R;  1YI2 T;  1M3C A;  3MCA B;  2HKN A;  1YJN T;  1M8V A;  3GP8 A;  1K8A R;  2CZ0 B;  4V2S A;  3EGX A;  3UT1 A;  1H3H A;  1H8K A;  3KBG A;  2VAS A;  5D7U A;  3RKX A;  4PJO F;  3CQT A;  4F7U F;  4NCX A;  1IL2 A;  1NG2 A;  3Q1J A;  4CH4 A;  1VYU A;  3P8D A;  1WXB A;  4XU1 A;  4B9W A;  1CSK A;  2E6N A;  3JCM f;  1QWE A;  4PJO C;  1NNH A;  2JT4 A;  3REX A;  5D6X A;  2KRO A;  1Y71 A;  4CC7 A;  2K57 A;  2DDZ A;  5CAI A;  3LSQ A;  1PNJ A;  2RQR A;  5LJ3 g;  1M3A A;  1M90 R;  3OMC A;  4C92 F;  3QG1 A;  4YCV A;  3MEW A;  2CZ1 B;  2J3L A;  1D3B B;  2W0Z A;  1LOJ A;  2MWP A;  1G3Y A;  2YSQ A;  1QKW A;  3M5A A;  4J5Y A;  2NUP A;  4QT7 A;  1VQ8 Q;  2ZCF B;  2GGR A;  3RAC A;  2E3I A;  2OAU A;  3LW5 E;  4E7L A;  3E9H A;  3ERR A;  4LXC A;  3EFS A;  4HCC A;  4EDU A;  2SEM A;  4XK8 E;  2JVV A;  3L2R A;  5GAN 3;  1LNX A;  2ZNI A;  5CK9 A;  3A5Y A;  1VQP A;  2F2X A;  1XOV A;  2EAY A;  5C0M A;  2ZZF A;  2X51 A;  2DNU A;  3JCM d;  2RPN A;  3P8T A;  1R0B G;  1AT1 B;  4RQE A;  2EYY A;  3MP1 A;  2I4O A;  2CJ9 A;  2RHS A;  4AFS C;  3FLG A;  1YB3 A;  4WI1 A;  2G4C A;  1JB0 E;  2DEQ A;  3TCJ A;  2PUK B;  2PME A;  2X4W A;  1NJ8 A;  4RG2 A;  5ELO A;  3TU4 K;  4M78 G;  4IUV A;  1Q82 U;  4P73 C;  4RTV A;  4JJB A;  2CIM A;  2L0A A;  1NPP A;  2ZCE A;  1W66 A;  4P3O A;  2HQX A;  3QZ9 B;  4J6Y A;  1SSF A;  1UEB A;  3M0R A;  1YFN A;  2CJA A;  3CBM A;  4FU6 A;  1JRI A;  1PHT A;  4C92 G;  11AS A;  1VYV A;  2COY A;  5LJ5 h;  2R5A A;  2VGM A;  4C92 D;  1Y96 B;  1D0X A;  4KQE A;  4TVA A;  3JAM E;  3QJ6 A;  4IUP A;  1VQ6 Q;  3MEU A;  3OYA A;  2OX7 A;  1W2B A;  3CCE Q;  4QQD A;  4P3N A;  4A53 A;  1UGV A;  2ROL A;  3MP6 A;  1QVG A;  3CCR Q;  2P0L A;  2D8H A;  2DZC A;  3OYN A;  4H2X A;  4FYY B;  4BY6 C;  4Z89 A;  1B34 B;  1QE0 A;  4J9E A;  3OYD A;  2L3R A;  2IPO B;  3NPF A;  2FB7 A;  1N9W A;  3GIB A;  6AT1 B;  2RJC A;  2K9G A;  1B3Q A;  3V8J A;  2Q7E A;  3QO8 A;  5DY9 A;  2EBP A;  1RAD B;  2QHV A;  2K5I A;  2OTJ Q;  4NOY A;  1NYQ A;  4ZTJ A;  4TQD A;  3V7R A;  3HSB A;  2O4X B;  1O9S A;  1BU1 A;  2P0P A;  4HCB A;  1VQL T;  4ZTU B;  2XU8 A;  3CCE T;  2CP3 A;  1WHG A;  4ATO A;  2M9U A;  2SRC A;  2E6Z A;  3HXU A;  3JRZ A;  2EGE A;  5KE3 A;  4TTV A;  2HQH A;  5GAO q;  1KD1 R;  3SD4 A;  4C0D C;  5E3I A;  2IG0 A;  2ZIM A;  1WGS A;  3P8H A;  4HWP A;  4KUL A;  4JLI A;  5GAN 8;  1M1G A;  2MCN A;  1RAI B;  2ZT8 A;  2AK5 A;  1B7T A;  5D6W A;  2GQI A;  4M7A C;  1SRL A;  4HA8 A;  4WJ4 A;  1W1F A;  1UHC A;  4YRC A;  5A0G A;  3FRN A;  5GAN h;  1NZ9 A;  1S72 Q;  2CRE A;  3I5R A;  12AS A;  3M55 A;  1PG5 B;  4YRM A;  4HVW A;  3ME9 A;  1TTH B;  4CS4 A;  1HJD A;  3HXZ A;  2RQW A;  3CME Q;  4OGC A;  1G3S A;  5K1X A;  2PUO B;  1AZG B;  3OBW A;  1VQN T;  4JS5 A;  1B76 A;  3E9G A;  3I5S A;  4II1 A;  3RBB B;  1YJW T;  2VC8 A;  3JB9 D;  1YIJ A;  1G5I A;  3VQY A;  1MHN A;  2DMO A;  2P0K A;  1NE8 A;  1ZX6 A;  2CH4 A;  1WU7 A;  3L4G B;  1VQP T;  1SEM A;  4PNO A;  2CP7 A;  4P5N A;  1FYF A;  3DLL A;  1IRE B;  1QVF P;  2RHI A;  1HTT A;  4E51 A;  1RAB B;  5GAN e;  4BW9 A;  2K3B A;  1EIY B;  2OI3 A;  2OJ2 A;  3H6Z A;  3QWY A;  4JZ4 A;  3X26 B;  1OX8 A;  4HWS A;  1Q82 C;  2RJD A;  3LWH A;  1YJ9 T;  2RJF A;  1RLQ C;  4M77 D;  1KOG A;  2HL3 A;  5GAO p;  4Z02 A;  2RH2 A;  2MAM A;  2J3M A;  2LCC A;  1SRY A;  4M4Z A;  1K9A A;  1VQ7 A;  1A0N B;  2NUP B;  3JSC A;  2K5L A;  1M1K U;  2CP6 A;  4OB3 B;  1UHF A;  2QGG A;  2YDL A;  2KT1 A;  5GAN f;  3CCE A;  5D6Y A;  1QVF A;  1KD1 U;  2A36 A;  3OYE A;  2K2V A;  5HY6 A;  4J6W A;  5CO7 A;  4C8Q G;  1WYD A;  2JMC A;  1ZQ1 A;  1UUE A;  3HTZ A;  2HZY A;  2A8E A;  4RUG A;  4XTZ A;  4ZTZ B;  4RMF A;  3MEY A;  1YI2 A;  4NL3 A;  4YRQ A;  2K7A A;  1Q86 C;  4BWA A;  4M78 B;  3VS5 A;  3HXV A;  5LJ5 g;  1FXX A;  2KNB B;  1N8R C;  1Q95 G;  4OMM A;  1IRX A;  1T3S A;  1EQR A;  3CXC P;  2EW3 A;  1BIB A;  2C0T A;  2DYB A;  2C7I A;  2HCK A;  1VQ9 A;  4J9C A;  1CKB A;  2HDA A;  2QEX T;  2BIV A;  3QKJ A;  4HWO A;  4M75 C;  5IHN A;  4PJM A;  2E41 A;  4KGX B;  1MMN A;  1AD5 A;  4OB0 B;  1YNZ A;  1KC8 R;  2XI9 A;  3FIF A;  1Z9Z A;  3H8Z A;  2DFU A;  1OEB A;  3SEM A;  4RKU E;  2I2L A;  3P8V A;  3VYG A;  3EHR A;  1FMK A;  1G3T A;  4XU2 A;  4FW1 A;  4LDV A;  5K1P A;  4QVZ A;  4C0Z A;  1TWB A;  2L2P A;  3HKS A;  1OX9 A;  4C92 B;  2B86 A;  1G5V A;  2E12 A;  5IT9 E;  2V1R A;  4M7D C;  2O9V A;  2YUN A;  1ZA2 B;  5LJ3 d;  3OSV A;  2K6D A;  1RAG B;  2EKH A;  3HRS A;  4DOV A;  2LTO A;  3CCL T;  1JJC A;  1YIT A;  1MGQ A;  4BE1 A;  4C5I A;  3QII A;  5KYX B;  2J05 A;  2KBT A;  4UP7 A;  2Y4Y A;  2ESW A;  3JCM W;  1X54 A;  1IHW A;  2FHD A;  4A63 B;  2P4T A;  4F7U E;  1U1T A;  1WPY A;  3CCM T;  1X2G A;  2LP5 A;  1LJO A;  2LCS A;  2DTH A;  2JTE A;  3FJP A;  3IQL A;  3FJ5 A;  1USY C;  2CJB A;  1QP2 A;  1MNE A;  4YRL A;  3NTH A;  2LX7 A;  5IXB A;  1SF9 A;  1D1B A;  3QPH A;  5FWC A;  1WX6 A;  2GTJ A;  4E6R A;  5EC7 A;  1NJ1 A;  3OYH A;  2DU7 A;  2XIC A;  1M2V B;  5GAO m;  4P74 C;  1HYO A;  2MK5 A;  4VUB A;  1RUW A;  4M78 E;  1NJI R;  4X9D A;  4KGV B;  2VXE A;  3OYF A;  2P0Q A;  5CIU A;  1H4T A;  1QVF S;  1QCF A;  1I1J A;  3CC2 T;  2JS0 A;  4A4K A;  4C0F A;  4BAC A;  1YI2 Q;  2QEX Q;  4E7I A;  4YRP A;  3N5B B;  3OYC A;  4M78 A;  1Y7X A;  4AFQ C;  5GAM h;  1M2V A;  2M51 A;  2KRN A;  3R6N A;  4N0A A;  5LL6 S;  2V1Q A;  5KCH A;  4YRF A;  1K73 C;  2JXB A;  4X1V A;  2E4H A;  3EGD B;  2RQV A;  3I7F A;  1M9S A;  1N5Z A;  5CKD A;  1NPR A;  2OAW A;  3PIP A;  4CC4 B;  3OS1 A;  1ZSZ C;  2KT8 A;  3OW2 A;  3EG9 B;  1FYN A;  2XG8 D;  4ZGD B;  3CCQ Q;  4C8Q B;  1KHC A;  4ZGJ B;  2X9H A;  2KR3 A;  5GAM j;  4HCZ A;  1Z9Q A;  2ZPG B;  1FWZ A;  1OPL A;  3G4S A;  5GMK e;  1OUL A;  1GCQ C;  4XTY A;  1Y96 A;  3RL6 A;  3ICA A;  1YHQ A;  1USY A;  3M4Y A;  4TVY A;  3EAE A;  4A4F A;  4KR3 A;  8ATC B;  2MOX A;  5HCK A;  2FL7 A;  2AKK A;  3EG2 A;  3OS5 A;  2JM8 A;  3JB9 H;  4PLI A;  4J9H A;  2ZTG A;  1YJ9 Q;  2DRK A;  2RHU A;  3R6O A;  1UJY A;  2Y90 A;  2ECZ A;  3CXC S;  1PKT A;  1N8R R;  2ALY A;  4M77 G;  3REU A;  1UB4 A;  4J8O A;  2MMP A;  4BB7 A;  1VQ4 A;  4RTY A;  1AWJ A;  2RNA A;  2JZ2 A;  3A8L B;  3G7Z A;  3E2U A;  3CC4 T;  3H41 A;  3CC7 T;  1W2B S;  3ZL7 C;  2VB6 A;  1T3L A;  2O01 E;  1ADY A;  3UWN A;  3WXM B;  2LJ3 A;  1ASZ A;  3C95 A;  1NJ5 A;  3PMT A;  1RAH B;  8AT1 B;  2M02 A;  2CSQ A;  2Q5I A;  4YRO A;  3NGP A;  2RHQ A;  1G83 A;  2KI7 A;  1RI0 A;  3G6E T;  4XAX B;  3OBY A;  5GAM f;  3OS2 A;  1NJ2 A;  3OYY A;  4A4H A;  2ZXF A;  1XTD A;  2LT4 A;  2IY5 A;  2Z0W A;  4KR2 A;  3MEA A;  4PFO A;  3CME T;  3A98 A;  1BBZ A;  3JCM X;  4M75 A;  2C0I A;  3CD6 A;  1E1T A;  2LZ6 B;  4YRI A;  1BK2 A;  2BZY A;  2ROT A;  2NS6 A;  2XTI A;  2VWF A;  4AG2 C;  2PVG B;  4D8K A;  2FEI A;  2EVR A;  1X01 A;  2KY9 A;  4M75 E;  4XTV A;  1AHJ B;  3A74 A;  3VRZ A;  2J6F A;  4PJL A;  3PE0 A;  3TVT A;  1VQ8 A;  4UP9 A;  4YRG A;  4R56 A;  4DBF A;  2CH4 W;  4HVU A;  3M56 A;  4JJD A;  2AT1 B;  4EMG A;  1K4U S;  4B9X A;  4KUD K;  1BBW A;  1R0C B;  3CMA Q;  3QO5 A;  4E7S A;  4IUR A;  2R57 A;  3A5Z B;  4YRJ A;  2JM9 A;  2HBW A;  1GFC A;  3L2W A;  3MF1 A;  3QO3 A;  4GBQ A;  1Y0M A;  2MWO A;  3CCS Q;  3RER A;  1AWW A;  1GGM A;  2F5T X;  4M77 A;  2QAZ A;  3VU3 C;  1X6G A;  1VQL Q;  3LGL A;  2CP2 A;  3HRK A;  5FU7 B;  5KYW A;  3OA6 A;  2DTI A;  4KH0 B;  1VQK Q;  3PMI A;  1M1F A;  4DPG A;  3BY7 A;  3AHU A;  2DYI A;  3VBB A;  2CS7 A;  3QSU A;  2XDP A;  1NJ6 A;  2CKK A;  2RQU A;  1BB9 A;  1UEC A;  1WFW A;  5ELN A;  2KRS A;  3C4S A;  1WHJ A;  2EGC A;  4YCW A;  4JRK A;  3C94 A;  3RKY A;  1WHH A;  1ZBJ A;  2QAS A;  1YFT A;  3MJX A;  3BJU A;  3UF4 A;  2YRC A;  4JS4 A;  1YIT T;  2PZ1 A;  1VQ5 T;  1S72 A;  2QYZ A;  1WZO A;  3RMQ A;  4DQ2 A;  4F16 A;  1QLY A;  4BI4 A;  1VQ9 Q;  4L87 A;  4ZNX A;  2KEA A;  1D3B A;  2OTL T;  2NLU A;  3THK A;  3LH5 A;  3FC3 A;  1WHL A;  4FIB A;  2EIF A;  3OB9 A;  1PYS B;  2DET A;  2AIR B;  2AMC A;  4YCU A;  2JW4 A;  3VS1 A;  1MND A;  1VQO Q;  4H2Y A;  3X20 B;  4HXJ A;  1K73 R;  3CD6 T;  1VQ6 A;  1K9M U;  2DKG A;  3CCJ T;  4YYE A;  1GFD A;  2A3L A;  2MIO A;  4K86 A;  3E19 A;  4O2D A;  2EGA A;  2OTL Q;  4LNP A;  1YWO A;  4PJO G;  5LJ5 d;  1GXI E;  1L0W A;  2L8D A;  2CUD A;  2JTF A;  5EG2 A;  2WSF E;  3TEH B;  3RR6 A;  5GAN 7;  1KMM A;  2ZZD A;  1FMW A;  3V7C A;  3JB9 I;  1HK9 A;  3JCM h;  5FU6 B;  2CUB A;  2E70 A;  3UA6 A;  2RB6 A;  1KHI A;  2XK0 A;  1I0C A;  1OZ3 A;  2D9T A;  1JEG A;  3MET A;  1D1C A;  4LUD A;  1VIF A;  3X25 B;  2OTJ A;  2DEU A;  3A8H B;  2HL5 C;  2LJ0 A;  1UGR B;  4OF1 A;  4Y91 A;  4NS5 A;  2KMT A;  4X34 A;  3L2Q A;  5GAM e;  2P84 A;  3PFS A;  3CD6 Q;  2QXF A;  2EKO A;  1GBR A;  3QTC A;  2EJF A;  3I56 T;  4LD6 A;  1VQO T;  1U8R A;  2LQN A;  2ZPH B;  1QF6 A;  2FZG B;  3QXE B;  2DD4 A;  4P75 C;  3HHT B;  1ZLM A;  1Q7Y U;  1AWX A;  1YFS A;  3P8B B;  3V8L A;  3QUI A;  4E7H A;  2OTJ T;  2KYB A;  4QVC A;  5I11 A;  2CYZ B;  4C92 A;  2DL4 A;  2HQE A;  3AT1 B;  2E5Q A;  4GY5 A;  3I55 A;  2XGT A;  3SWN B;  1K76 A;  4XU3 A;  1YCS B;  2K2M A;  3G71 A;  4EPC A;  1R77 A;  5HKC A;  1K9M R;  5LJ5 j;  4LVL A;  3JB9 G;  1IHV A;  1WLP B;  1IB8 A;  1UGP B;  1B7Y A;  4O6J A;  2FRY A;  2ED0 A;  4HCK A;  4JJC A;  3JV3 A;  3HTR A;  3M9Q A;  3MO8 A;  1QVG S;  3LLR A;  1BYM A;  2X3X D;  4FYX B;  4IIO A;  3H0I A;  2KK4 A;  1VQ6 T;  3CBP A;  4LUE A;  3TSW A;  4H2W A;  1KSW A;  4J9D A;  4QW2 A;  2GQV A;  2ART A;  3HRI A;  4MZP A;  4E2F B;  2VGN A;  2L3P A;  5GMK j;  4P74 A;  2E3C A;  2RMO A;  2O88 A;  5HK0 A;  2DVJ A;  1OQK A;  1G2B A;  2KSS A;  1YHQ Q;  2B8A A;  1W70 A;  1E7O A;  3M53 A;  2AZV A;  2DAQ A;  2E10 A;  4M75 D;  4A4G A;  2LMJ A;  4H2U A;  3GBQ A;  5GAN g;  3VJP A;  1TUD A;  1Y57 A;  1NLP C;  2F1L A;  4WTO B;  1VQ5 Q;  3JCM g;  1MUZ A;  4PLL A;  4N0A C;  2BE7 D;  5A0D A;  1WQ7 A;  2X4X A;  2RD1 A;  1EOV A;  4H2T A;  1RAC B;  1BI2 A;  4XQ3 A;  3M0T A;  5I21 A;  2PVD B;  3SB2 A;  3WVD B;  3GLX A;  4ESR A;  2C0O A;  5J26 A;  1XNI A;  2OTL A;  3LWI A;  3EGX B;  2YUO A;  4YDQ A;  4OVA A;  4XEO A;  5I2M A;  3CPF A;  5KCO A;  1GCQ A;  2HKQ B;  4XU0 A;  1Q81 R;  1D0Z A;  1X69 A;  3RDV A;  4OMF B;  3NMZ C;  3CCU A;  5IHK A;  4YP0 A;  4LDU A;  1XQH A;  3H0H A;  2E3H A;  1JXO A;  5KYW B;  2KGT A;  2RHZ A;  1N8R U;  4PJO E;  3G71 T;  4N4H A;  4P71 C;  2H8H A;  1E1O A;  4E7J A;  5CKH A;  4OLF A;  2PNI A;  4D6W A;  4AFU C; 
#chains in the Genus database with same CATH homology
 5LJ5 e;  1B8A A;  5GAO n;  1U1S A;  2LRQ A;  2DXC A;  3A8G B;  3DB4 A;  2AKW A;  2D6F A;  4G85 A;  3QZ5 B;  3X28 B;  2ALY B;  1YFR A;  5A0L A;  3ZBD A;  4RDX A;  4M7D D;  4M7A F;  4M7D F;  4M7A D;  1K8A U;  4J7F A;  2ZGW A;  3JB9 F;  2X4J A;  3I56 A;  1VUB A;  4XTW A;  1WQW A;  4ZTF A;  1N9S A;  1KD1 C;  3VQV A;  1M4Z A;  3UFG A;  1K9M C;  4MZT A;  5FRO A;  2E65 A;  5I2S A;  2ZNJ A;  4YRK A;  3GNG A;  2Q7H A;  2KDS A;  2CGH A;  2E1H A;  4EMK B;  3O8V A;  4DA4 A;  2JOY A;  1YBY A;  4PJO A;  3QBY A;  4M78 C;  1WLE A;  2EFI A;  5IAY A;  2I4M A;  3OYK A;  3W3S A;  1V29 B;  1FX7 A;  4M7D B;  4ZIB A;  4L59 A;  1KQS S;  4N4G A;  1YHQ T;  2DD5 A;  2YRV A;  5GAM g;  4LDW A;  4MMK A;  4QQ6 A;  1KC8 C;  3G1Z A;  1M90 U;  3S3M A;  4C92 C;  4X5O A;  2JTM A;  2RO0 A;  4BUG A;  2Q7G A;  4BE0 A;  5AYF A;  3GF5 A;  4HWR A;  3CCR A;  4C8Q F;  4ELY C;  3SDZ A;  5GAN 6;  2WSC E;  3JB9 J;  4BD3 A;  3INZ A;  4IKF A;  3A7R A;  5C52 B;  4JJN K;  2LNV A;  4M7A A;  5F5W A;  4C8Q E;  4UC4 A;  3JCM J;  4KUI A;  1E22 A;  4H02 A;  4WJ3 M;  3PTA A;  4TQF A;  5FU7 C;  3ZFJ A;  1I8F A;  3MF2 A;  1N6A A;  4FSX A;  3JCM e;  1VQK A;  2QHU A;  5KNN A;  2ZT6 A;  4M77 E;  4AH6 A;  4WF2 A;  5LJ3 h;  1PYS A;  3NET A;  3NTI A;  4MDW A;  3CMQ A;  2PMF A;  2XDD A;  4O5V A;  2DQ0 A;  2QA4 A;  2AMC B;  2K3X A;  2HBP A;  3UGT A;  4CH3 A;  2LQK A;  3HXW A;  1EIF A;  3NFC A;  3IKL A;  3OS0 A;  2RJE A;  2EQU A;  5A2Q E;  2YLB A;  1TH7 A;  1R8O B;  1M5Q 1;  3CCQ A;  1EIY A;  4C0D B;  3TEH A;  3M4P A;  4XEM A;  2DXB A;  2QQB A;  2R5M A;  2ODR C;  5KH6 A;  5FRN A;  4PKC C;  3A32 A;  4NL2 A;  2DO3 A;  1NYR A;  5DM7 R;  2ZT7 A;  5C51 B;  3NEN A;  3VYH B;  2JN0 A;  1JJ2 S;  4P75 A;  4JRP A;  1WNL A;  2PVO B;  3HXY A;  3LGF A;  1VQM A;  2ARU A;  1VQ7 T;  3ER0 A;  1QW1 A;  1G3W A;  3ZEH A;  3OYI A;  1I5L A;  4FT4 A;  2RHX A;  1YJ9 A;  4YRR A;  1K8A C;  2GCX A;  3S3O A;  3JCM Q;  1H4Q A;  1Q81 C;  2RHY A;  3OYL A;  2D0Q B;  2RK1 A;  5GAN j;  2C8M A;  4RMO A;  2ZZE A;  3OSS C;  4IUT A;  2ZIO A;  1UGQ B;  1O75 A;  2V8I A;  3RGL A;  4M7A B;  5GAO r;  2L5Q A;  3PT9 A;  1YIJ T;  2QA4 T;  1YJW A;  3L1A A;  3OW2 S;  2I4L A;  4M77 B;  3M58 A;  2IY5 B;  4P73 A;  2R58 A;  1X2H A;  3BDU A;  2DQ3 A;  2QI2 A;  2RHQ B;  2DJZ A;  3X24 B;  4H2S A;  1Z7M A;  3KFU A;  3L2U A;  3CPW A;  2EJ9 A;  2E5A A;  3J7A F;  4MDX A;  3L2V A;  3T9N A;  3E1S A;  3HFV A;  1UGS B;  4M75 G;  3DLM A;  2ODR D;  4A4E A;  4ZN1 A;  1X55 A;  1LYL A;  4J83 A;  5C53 B;  2ZIN A;  1X6O A;  4FM4 B;  3RES A;  4YRS A;  1BI1 A;  1H64 1;  3FB9 A;  3HY1 A;  3SWN A;  3OYG A;  5J39 A;  3R07 A;  1VQN A;  4Q5W A;  5GAN d;  4X9C A;  1ADJ A;  4M7D G;  3F70 A;  2QHT A;  4M7D E;  4P3P A;  4PL6 A;  3PIO A;  4M7A G;  4QVD A;  3J80 E;  2K3Y A;  2EYQ A;  2VYT A;  2LCL A;  2V8J A;  4M77 F;  3GNF B;  2BKD N;  3CCM A;  2DXU A;  4BDZ A;  3JCM P;  1H3Z A;  2CZ7 B;  2DTO A;  5CKB A;  4OP0 A;  3VKI A;  3GOX A;  2LDM A;  2Y4X A;  5GAN 5;  2LVM A;  4C8Q A;  1Z7N A;  3RUX A;  3HFZ A;  4LNS A;  1SER A;  3HP9 A;  2Q5H A;  2M0O A;  2AHJ B;  5FLX E;  1BBU A;  5DLQ E;  1M90 C;  4RCC A;  4XTX A;  2XDB A;  5LJ3 e;  4CI0 C;  3QJY A;  1VIE A;  2IVW A;  2QTX A;  3SWN C;  4HKE A;  1PSE A;  4BI8 B;  2EQK A;  5GMK l;  4BE2 A;  4LDX A;  3OYJ A;  2RA2 A;  2MI6 A;  4M7D A;  5GMK h;  5CVI A;  1ASY A;  2ZPB B;  4RCB A;  3HPW A;  3CCV T;  2QQA A;  4PJO B;  4HT9 A;  1RL2 A;  2FVU A;  4LDY A;  3JCM b;  3UPU A;  2QHS A;  4DOW A;  1YJN A;  3A5Z A;  2ARS A;  1KQ1 A;  4P72 C;  4YRE A;  4JUV A;  3OD1 A;  3IKM B;  1E24 A;  4G84 A;  1WJS A;  2GFU A;  4N4I A;  4QQG A;  3VV0 A;  1WJQ A;  4L6V 5;  2ZR2 A;  3QYH B;  2KVQ G;  3A8M B;  4P71 A;  4HT4 A;  3I55 T;  1HXD A;  3BW1 A;  3L42 A;  4M7A E;  3L4G A;  4M75 B;  2L89 A;  3HFZ B;  5M9O A;  2VXF A;  4K87 A;  3LC0 A;  3EFR A;  1N9R A;  3UH0 A;  2I4N A;  4F7U G;  1VQ5 A;  3HRU A;  2RI5 A;  3LX7 A;  1JJ2 A;  3LSS A;  1KG1 A;  4YRN A;  3DSQ A;  1KQS A;  1NJI U;  3VQW A;  3CME A;  4OB2 B;  4LVJ A;  5KE2 A;  1VQO A;  1HC7 A;  4CRI A;  5C6S A;  3TRE A;  1VQ4 T;  4ZGE B;  4RG8 A;  5DLO A;  3QHS A;  1G51 A;  3UGQ A;  3PZC A;  4KT0 E;  3QYG B;  3M4G A;  2EJG A;  1B70 B;  1VQ8 T;  5GAN 2;  3HFO A;  2EQM A;  1Q7Y C;  3CC4 A;  4H2X B;  5LJ3 j;  1OZ2 A;  3RKW A;  2QQ9 A;  2K5F A;  3PCO B;  4YRT A;  3UDC A;  4LVK A;  4LVM A;  4C5G A;  3FDR A;  4ZN3 A;  2O4X A;  3E9I A;  3JCM V;  4M78 D;  1I81 A;  2ZPI B;  3V8K A;  3CEY A;  3CCS A;  3DB3 A;  3MEV A;  3V7S A;  4H2V A;  3TEG A;  4F7U A;  1Q86 U;  4EMK C;  3WQZ A;  3NEM A;  3JCM c;  3HRT A;  3CC2 A;  4GLK A;  4J15 A;  4JDS A;  4JLG A;  4C8Q D;  4E47 A;  4CH5 A;  2KQW A;  2X4Y A;  2RI2 A;  4UP8 A;  3KXT A;  4XTU A;  3VQX A;  5CR2 A;  5IN1 A;  3TUP A;  2G3R A;  4OGE A;  4Q6G A;  4MML A;  3CCJ A;  3IAL A;  1KMN A;  2DVE A;  4A54 A;  3CCV A;  1OI1 A;  1ZHI A;  3LYI A;  4C8Q C;  2M16 A;  1B70 A;  2ZPE B;  4UPA A;  2RK2 A;  2ZPF B;  2DZ9 A;  3J81 E;  4LVI A;  3G4S T;  2AKW B;  2DIG A;  4F7U B;  3OY9 A;  4ME7 A;  2DPP B;  1JJC B;  3M57 A;  3URG A;  3A7A A;  4M77 C;  5CQX A;  5CKE A;  1S72 T;  3PNW C;  4P72 A;  4YPF A;  1M1K C;  4HWT A;  1X56 A;  1WJR A;  1VQM T;  4PHC A;  5GAO l;  1YCY A;  5CKF A;  4CH6 A;  2V8K A;  4M75 F;  4C0G A;  1H4V B;  2H3J A;  4TVA B;  4LD9 K;  2YHT A;  1KC8 U;  1J5W A;  4JRI A;  4M78 F;  3A7U A;  2ZR3 A;  1G5H A;  3RF1 A;  1JBM A;  2LX9 A;  1B7Y B;  2PU9 B;  2HAX A;  3QNE A;  4TWA A;  1IZ6 A;  1ZBX A;  3ASK A;  4C5H A;  2EL9 A;  2KAF A;  2M1H A;  5LJ5 f;  2EWN A;  3WVE B;  3CCU T;  3CMA T;  1EVL A;  2LQ8 A;  2QEX A;  2BUD A;  2ZZG A;  3VUB A;  1K73 U;  2XHC A;  3C12 A;  2LT1 A;  1SET A;  1VQK T;  2C06 A;  2K4Y A;  3LH0 A;  3MHX A;  3M59 A;  1QVP A;  1OYX A;  1I4K 1;  3A31 A;  2HNI A;  3HL8 A;  3HY0 A;  4Y28 E;  3S6W A;  2F5K A;  3CC7 A;  3G6E A;  1C0A A;  2DK3 A;  3E9F A;  3HXX A;  4C5E A;  4KBM B;  1VQZ A;  5J3B A;  1VQ9 T;  2RM4 A;  2GFA A;  4EX5 A;  4L5G A;  2RI3 A;  1X75 C;  2F69 A;  4R55 A;  3CPW S;  1BIA A;  4EMH A;  2QQR A;  4YTL A;  2DU5 A;  5HGQ A;  5L8R E;  4Q15 A;  4HVC A;  4ELZ C;  2P5I A;  3NTK A;  2XID A;  2VV5 A;  3OYB A;  2YLC A;  4BDY A;  3OYM A;  1B34 A;  3CCS T;  5FU6 C;  1NJI C;  1ATI A;  1RIQ A;  3CCL A;  3RIR A;  1EVK A;  4CS3 A;  5GMK i;  4FL6 A;  3CMA A;  1QP3 A;  5CQY A;  3NEL A;  4J6X A;  2MF2 A;  3VUZ A;  2GF7 A;  2PQW A;  3PGG A;  1W4S A;  2DXT A;  1Q81 U;  3CCR T;  3BDL A;  4IUU A;  1VQL A;  3CXC A;  3DKM A;  2DIQ A;  2JNG A;  2QQS A;  3S3N A;  4HT8 A;  5GMK m;  2VUB A;  4RQF A;  3QO7 A;  5HK3 A;  3OQ5 A;  3BFM A;  3M54 A;  2EQJ A;  3CBO A;  2LC4 A;  2XKO C;  1BKB A;  2CZ6 B;  1Y07 A;  5CCA A;  5GAN 4;  2WSE E;  1BI3 A;  2A7Y A;  4IUQ A;  3A8O B;  3GPL A;  1N27 A;  1YGB A;  2HD0 A;  2QDY B;  5FRM A;  3FEO A;  3QDR B;  1H4S A;  4TVR A;  1BI0 A;  2JUF A;  4JRQ A;  3IG2 A;  3HFN A;  4TVW A;  1EFW A;  2XD0 A;  4MZM A;  2X35 A;  2WAC A;  3MP8 A;  4PJO D;  4CS2 A;  4EO4 A;  4FT2 A;  1PSF A;  2E64 A;  1DJ7 B;  4PG3 A;  4C92 E;  3L2Z A;  3CCQ T;  3SFM A;  4EMK A;  2ZT5 A;  1SES A;  3RMS A;  3M4Q A;  4E7K A;  5LJ3 f;  4J7I A;  4OB1 B;  3P8Y A;  4BI3 A;  3MQZ A;  3PCO A;  3TEE A;  2FYK A;  2RHS B;  1P92 A;  5GAM d;  3KUF A;  4BY6 B;  3OMG A;  4K88 A;  1KQ2 A;  1YI2 T;  3MCA B;  1YJN T;  1M8V A;  3GP8 A;  2CZ0 B;  4V2S A;  3UT1 A;  3KBG A;  3RKX A;  4PJO F;  4F7U F;  4NCX A;  1IL2 A;  3Q1J A;  4CH4 A;  3P8D A;  4XU1 A;  4B9W A;  2E6N A;  3JCM f;  4PJO C;  1NNH A;  3REX A;  5D6X A;  1Y71 A;  2K57 A;  2DDZ A;  5CAI A;  3LSQ A;  5LJ3 g;  3OMC A;  4C92 F;  3QG1 A;  4YCV A;  3MEW A;  2CZ1 B;  2J3L A;  1D3B B;  1LOJ A;  2MWP A;  1G3Y A;  3M5A A;  4J5Y A;  2ZCF B;  3RAC A;  2OAU A;  3LW5 E;  4E7L A;  3E9H A;  3ERR A;  3EFS A;  4HCC A;  4EDU A;  4XK8 E;  2JVV A;  3L2R A;  5GAN 3;  1LNX A;  2ZNI A;  5CK9 A;  3A5Y A;  1VQP A;  1XOV A;  2EAY A;  5C0M A;  2ZZF A;  3JCM d;  3P8T A;  4RQE A;  3MP1 A;  2I4O A;  2CJ9 A;  2RHS A;  3FLG A;  1YB3 A;  4WI1 A;  2G4C A;  1JB0 E;  2DEQ A;  3TCJ A;  2PUK B;  2PME A;  2X4W A;  1NJ8 A;  4RG2 A;  5ELO A;  3TU4 K;  4M78 G;  4IUV A;  1Q82 U;  4P73 C;  2CIM A;  1NPP A;  2ZCE A;  1W66 A;  4P3O A;  2HQX A;  3QZ9 B;  4J6Y A;  1SSF A;  1UEB A;  2CJA A;  3CBM A;  4FU6 A;  1JRI A;  4C92 G;  11AS A;  5LJ5 h;  2R5A A;  2VGM A;  4C92 D;  1Y96 B;  4KQE A;  4TVA A;  3JAM E;  3QJ6 A;  4IUP A;  3MEU A;  3OYA A;  1W2B A;  4QQD A;  4P3N A;  4A53 A;  3MP6 A;  1QVG A;  2P0L A;  4H2X A;  2DZC A;  3OYN A;  4BY6 C;  1B34 B;  1QE0 A;  3OYD A;  2L3R A;  2FB7 A;  1N9W A;  3GIB A;  2RJC A;  3V8J A;  2Q7E A;  3QO8 A;  5DY9 A;  2QHV A;  2K5I A;  4NOY A;  1NYQ A;  4ZTJ A;  4TQD A;  3V7R A;  3HSB A;  2O4X B;  1O9S A;  2P0P A;  4HCB A;  1VQL T;  4ZTU B;  2XU8 A;  3CCE T;  4ATO A;  2M9U A;  2E6Z A;  3HXU A;  3JRZ A;  4TTV A;  5KE3 A;  5GAO q;  3SD4 A;  4C0D C;  5E3I A;  2IG0 A;  2ZIM A;  1WGS A;  3P8H A;  4HWP A;  4KUL A;  4JLI A;  5GAN 8;  1M1G A;  2ZT8 A;  4M7A C;  5D6W A;  4HA8 A;  4WJ4 A;  4YRC A;  5A0G A;  3FRN A;  5GAN h;  1NZ9 A;  12AS A;  3M55 A;  4YRM A;  3ME9 A;  4CS4 A;  3HXZ A;  4OGC A;  1G3S A;  5K1X A;  2PUO B;  3OBW A;  1VQN T;  4JS5 A;  1B76 A;  3E9G A;  4II1 A;  1YJW T;  2VC8 A;  3JB9 D;  1YIJ A;  1G5I A;  3VQY A;  1MHN A;  2P0K A;  1NE8 A;  1WU7 A;  3L4G B;  1VQP T;  4PNO A;  4P5N A;  1FYF A;  3DLL A;  1IRE B;  2RHI A;  1HTT A;  4E51 A;  5GAN e;  4BW9 A;  1EIY B;  3H6Z A;  3X26 B;  4HWS A;  1Q82 C;  2RJD A;  3LWH A;  1YJ9 T;  2RJF A;  4M77 D;  1KOG A;  5GAO p;  4Z02 A;  2RH2 A;  2MAM A;  2J3M A;  2LCC A;  1SRY A;  1VQ7 A;  3JSC A;  2K5L A;  1M1K U;  4OB3 B;  5GAN f;  3CCE A;  5D6Y A;  1QVF A;  1KD1 U;  3OYE A;  2K2V A;  5HY6 A;  4J6W A;  5CO7 A;  4C8Q G;  1WYD A;  1ZQ1 A;  3HTZ A;  2A8E A;  4ZTZ B;  4XTZ A;  4RMF A;  3MEY A;  1YI2 A;  4NL3 A;  4YRQ A;  1Q86 C;  4BWA A;  4M78 B;  3HXV A;  5LJ5 g;  1FXX A;  1N8R C;  1EQR A;  1BIB A;  2C7I A;  1VQ9 A;  2QEX T;  2BIV A;  3QKJ A;  4HWO A;  4M75 C;  2E41 A;  4OB0 B;  2XI9 A;  3FIF A;  3H8Z A;  4RKU E;  2I2L A;  3P8V A;  3VYG A;  1G3T A;  4XU2 A;  4LDV A;  5K1P A;  4QVZ A;  4C0Z A;  3HKS A;  4C92 B;  1G5V A;  2E12 A;  5IT9 E;  4M7D C;  5LJ3 d;  3OSV A;  3HRS A;  1JJC A;  2LTO A;  4DOV A;  3CCL T;  1YIT A;  1MGQ A;  4BE1 A;  4C5I A;  3QII A;  4UP7 A;  2Y4Y A;  3JCM W;  1X54 A;  2FHD A;  2P4T A;  4F7U E;  1U1T A;  1WPY A;  3CCM T;  1X2G A;  1LJO A;  2DTH A;  3FJP A;  1USY C;  2CJB A;  1QP2 A;  4YRL A;  3NTH A;  3QPH A;  1NJ1 A;  3OYH A;  2DU7 A;  2XIC A;  5GAO m;  4P74 C;  4VUB A;  4M78 E;  4X9D A;  2VXE A;  3OYF A;  2P0Q A;  5CIU A;  1H4T A;  1QVF S;  3CC2 T;  4A4K A;  4C0F A;  4BAC A;  4E7I A;  4YRP A;  3N5B B;  3OYC A;  4M78 A;  1Y7X A;  5GAM h;  4N0A A;  5LL6 S;  5KCH A;  4YRF A;  1K73 C;  3I7F A;  1M9S A;  5CKD A;  1NPR A;  3PIP A;  3OS1 A;  3OW2 A;  2XG8 D;  4ZGD B;  4C8Q B;  1KHC A;  4ZGJ B;  5GAM j;  4HCZ A;  2ZPG B;  1FWZ A;  3G4S A;  5GMK e;  4XTY A;  1Y96 A;  3RL6 A;  3ICA A;  1YHQ A;  1USY A;  3M4Y A;  4TVY A;  3EAE A;  4A4F A;  4KR3 A;  2FL7 A;  3OS5 A;  3JB9 H;  4PLI A;  2ZTG A;  3R6O A;  2RHU A;  2Y90 A;  3CXC S;  2ALY A;  4M77 G;  3REU A;  1UB4 A;  4J8O A;  2MMP A;  4BB7 A;  1VQ4 A;  2JZ2 A;  3A8L B;  3G7Z A;  3CC4 T;  3CC7 T;  1W2B S;  2O01 E;  1ADY A;  3UWN A;  3WXM B;  1ASZ A;  3C95 A;  1NJ5 A;  3PMT A;  2Q5I A;  4YRO A;  2RHQ A;  1RI0 A;  3G6E T;  4XAX B;  3OBY A;  5GAM f;  3OS2 A;  1NJ2 A;  3OYY A;  4A4H A;  2ZXF A;  1XTD A;  2LT4 A;  2IY5 A;  4KR2 A;  3MEA A;  3CME T;  3JCM X;  4M75 A;  3CD6 A;  1E1T A;  4YRI A;  2NS6 A;  2XTI A;  2PVG B;  1X01 A;  2KY9 A;  4M75 E;  4XTV A;  1AHJ B;  3A74 A;  4UP9 A;  1VQ8 A;  4YRG A;  4R56 A;  3M56 A;  4EMG A;  4B9X A;  4KUD K;  1BBW A;  3QO5 A;  4IUR A;  2R57 A;  3A5Z B;  4YRJ A;  3L2W A;  3MF1 A;  3QO3 A;  2MWO A;  3RER A;  1GGM A;  2F5T X;  4M77 A;  3VU3 C;  3LGL A;  3HRK A;  5FU7 B;  3OA6 A;  2DTI A;  3PMI A;  1M1F A;  4DPG A;  3BY7 A;  3AHU A;  3VBB A;  2CS7 A;  3QSU A;  2XDP A;  1NJ6 A;  2CKK A;  5ELN A;  3C4S A;  4YCW A;  4JRK A;  3C94 A;  3RKY A;  1YFT A;  3BJU A;  4JS4 A;  1YIT T;  1VQ5 T;  1S72 A;  3RMQ A;  4DQ2 A;  4BI4 A;  4L87 A;  1D3B A;  2OTL T;  2NLU A;  3FC3 A;  4FIB A;  2EIF A;  3OB9 A;  1PYS B;  2AMC A;  4YCU A;  4H2Y A;  3X20 B;  3CD6 T;  1VQ6 A;  1K9M U;  2DKG A;  3CCJ T;  4YYE A;  2A3L A;  4K86 A;  3E19 A;  4O2D A;  4PJO G;  5LJ5 d;  1GXI E;  1L0W A;  2L8D A;  5EG2 A;  2JTF A;  2WSF E;  3TEH B;  5GAN 7;  1KMM A;  2ZZD A;  3V7C A;  3JB9 I;  1HK9 A;  3JCM h;  5FU6 B;  2E70 A;  2RB6 A;  1KHI A;  2XK0 A;  1OZ3 A;  2D9T A;  3MET A;  2OTJ A;  1VIF A;  3X25 B;  3A8H B;  1UGR B;  4OF1 A;  4Y91 A;  4NS5 A;  2KMT A;  4X34 A;  3L2Q A;  5GAM e;  3PFS A;  2QXF A;  2EKO A;  3QTC A;  2EJF A;  3I56 T;  4LD6 A;  1VQO T;  1U8R A;  2ZPH B;  1QF6 A;  3QXE B;  2DD4 A;  4P75 C;  3HHT B;  1Q7Y U;  1YFS A;  3P8B B;  3V8L A;  3QUI A;  4E7H A;  2OTJ T;  4QVC A;  2CYZ B;  4C92 A;  2HQE A;  2E5Q A;  4GY5 A;  3I55 A;  2XGT A;  3SWN B;  4XU3 A;  3G71 A;  4EPC A;  5HKC A;  5LJ5 j;  4LVL A;  3JB9 G;  1UGP B;  1B7Y A;  4O6J A;  3M9Q A;  3MO8 A;  1QVG S;  3LLR A;  1BYM A;  2KK4 A;  1VQ6 T;  3CBP A;  4H2W A;  4QW2 A;  2GQV A;  2ART A;  3HRI A;  4MZP A;  2VGN A;  5GMK j;  4P74 A;  2E3C A;  5HK0 A;  2KSS A;  2B8A A;  3M53 A;  2DAQ A;  2E10 A;  4M75 D;  4A4G A;  4H2U A;  5GAN g;  3VJP A;  3JCM g;  4PLL A;  4N0A C;  5A0D A;  1WQ7 A;  2X4X A;  2RD1 A;  1EOV A;  4H2T A;  1BI2 A;  4XQ3 A;  5I21 A;  2PVD B;  3SB2 A;  3WVD B;  3GLX A;  5J26 A;  1XNI A;  2OTL A;  3LWI A;  4YDQ A;  4OVA A;  4XEO A;  5I2M A;  3CPF A;  5KCO A;  4XU0 A;  4OMF B;  3CCU A;  4YP0 A;  4LDU A;  1XQH A;  2RHZ A;  1N8R U;  4PJO E;  3G71 T;  4N4H A;  4P71 C;  1E1O A;  4E7J A;  5CKH A;  4OLF A;  4D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...