2DVEA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, mutation arg51ala
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNAKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords Biotin Protein Ligase
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dveA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dveA01
3HSBA 3MF1A 5LJ5f 2FB7A 4YP0A 3RKWA 4YCWA 2P0LA 2ZZEA 3LSSA 5GAOl 4A53A 4HWTA 5GANj 4P71C 3JB9G 1BIBA 4PJOB 5GAN3 5GAN7 2RD1A 4V2SA 4C92G 4M78B 3A7AA 5GMKj 2DQ3A 2ZTGA 3VBBA 3VU3C 2QHUA 3MEYA 4C8QG 3RKXA 3JCMP 2K57A 2RA2A 4NL2A 4M7AD 4M7AA 2ARSA 3FB9A 4XTVA 1J5WA 2ZIOA 3JCMc 3SB2A 4C8QC 3QTCA 1HC7A 4P72A 3RF1A 5CAIA 1B34A 4A54A 4M7AF 4M77F 1I81A 2E64A 4J5YA 3QHSA 4F7UA 5LJ3d 5GANd 5E3IA 5C51B 4M78E 4JRIA 1SRYA 1Y96A 3VQXA 4H2YA 4YRGA 4MMKA 4YRCA 4M7AC 1G5IA 3V7CA 5GMKh 1WNLA 2J3LA 1KMMA 4H2WA 4YREA 4HVCA 1PYSB 5C52B 1ADJA 1B7YB 5GANh 3LSQA 4P73A 4XTZA 5I21A 2E10A 3ICAA 4YRSA 4P3PA 2DXTA 5GAOp 4PJOE 5GAN4 2AMCA 4HT9A 4M75C 4M78D 2YLBA 1USYA 3SWNB 12ASA 1EVKA 2I4MA 4EMHA 3CMQA 1Z7NA 3HXXA 4TVAA 4M7DA 4KR3A 4TVAB 3V8LA 1G5HA 2RM4A 2E41A 3VQWA 4QVDA 3TEGA 1H4TA 3REUA 4DQ2A 1U1SA 3RERA 2ZZFA 5DY9A 1YFSA 3JCMd 1B70B 4PJOF 4C92A 4X9CA 4XTUA 4P74A 1NNHA 1N9SA 2Q7EA 5GMKm 3GIBA 4G85A 4TWAA 2ALYB 3A5ZA 4ZTUB 5GANe 3RL6A 4X9DA 2Q5IA 1MGQA 1X2HA 3HFOA 3RKYA 1USYC 1LJOA 2DTOA 1H4VB 4H2TA 3ERRA 5GAMf 4M78C 4M75D 2DQ0A 2PMFA 4M7DC 2ZXFA 4RMFA 1HK9A 4XTWA 4J15A 1NJ6A 3IKMB 4XQ3A 3M4QA 3BW1A 5GAMd 4H2VA 3NETA 4CH6A 1WQ7A 3HRIA 5GAMe 2EJ9A 4M78G 4C92C 2ARTA 4RQEA 3JCMV 3JCMX 4JUVA 4LNSA 2AKWA 4CH5A 4JLIA 1ASYA 1B7YA 3IALA 2DZ9A 4WF2A 3UFGA 3P8VA 2VXFA 4PJOD 2YHTA 4HA8A 4EX5A 2ZNJA 4XTYA 4JRKA 3JCMh 3HFZA 4C92F 2ZCEA 3SWNA 1ASZA 3BY7A 2DEQA 4YRLA 3AHUA 2FYKA 1N9RA 4YRQA 4AH6A 2C8MA 2QTXA 2PMEA 4F7UB 4K88A 2ZGWA 5LJ5g 3REXA 4M7AB 2ZT7A 4YRIA 4TTVA 4F7UE 1ADYA 1E1OA 4YRPA 2EJGA 4YRTA 1LOJA 4C92B 1FYFA 5LJ3g 4J6XA 4M75B 3L4GB 4UP8A 4M7AG 3HXZA 5GMKe 4YRNA 4P75A 4HWRA 4PG3A 3M4PA 3WQZA 4M77C 4TQDA 5LJ5h 2ODRC 4Q15A 1H4QA 1M5Q1 3JB9I 3PGGA 4ZTZB 4P3OA 1H641 1YFTA 4WJ4A 2CJBA 3QO7A 1E22A 5LJ5d 2DJZA 1KQ2A 2ZT5A 3L4GA 4Y91A 3JCMW 1KOGA 2QHSA 3JB9D 1WYDA 1B76A 4CS2A 2E3CA 1X2GA 3UGQA 3M4GA 4UP9A 2Y90A 3BDUA 5GAMh 4C8QE 4DPGA 1X55A 2IY5B 1E24A 3JB9H 2EJFA 4XU2A 3I7FA 3JCMJ 4C8QB 1EOVA 1NYQA 4M77A 1VQZA 3OD1A 5GMKi 2I4LA 3UH0A 4EMKC 2ZINA 4RCBA 4YDQA 4HWSA 4BWAA 3QO5A 2I2LA 5KNNA 2ZZGA 3E9IA 4PJOG 3HRKA 1HXDA 1I5LA 2JN0A 1NYRA 4PHCA 3TEHA 3P8YA 2ARUA 1WU7A 4XTXA 2Q7GA 2CJAA 5GAOq 4C8QA 3HY0A 5GANf 4C8QF 3BJUA 5LJ3f 3JB9F 2CGHA 3RUXA 3NEMA 1B34B 4PJOC 4NCXA 4TQFA 2QHTA 1IL2A 2EWNA 2DU7A 4F7UF 3MF2A 4CH3A 3TEHB 5GAN2 1I4K1 1C0AA 4M7DG 3IKLA 5GAN8 5K1PA 1I8FA 4M75G 1YB3A 3V7RA 2CIMA 1QE0A 2XGTA 4YCUA 4J6YA 4KR2A 4CH4A 2DXUA 5LJ3e 4XEOA 1Z7MA 4RCCA 2ZT6A 3RIRA 3VQYA 5K1XA 4H02A 1B8AA 1G51A 4YRJA 1E1TA 2RB6A 3A31A 2DU5A 2I4OA 3V8KA 4K86A 4X5OA 1L0WA 1D3BA 1W66A 3VQVA 3P8TA 1BIAA 2P5IA 1LYLA 3DSQA 3QO3A 3L2ZA 5LJ5j 2DVEA 3QUIA 1PYSA 5LJ3h 3E9HA 1JJCA 3SWNC 1JJCB 4HWOA 2Q5HA 4YCVA 11ASA 4QVCA 2E5AA 4YPFA 4CS4A 4M77B 5LJ3j 1TH7A 1YFRA 3HXVA 4M75A 2EAYA 4M7DE 4HWPA 1EIYB 2YLCA 4PNOA 4L87A 5C53B 3NELA 1EFWA 2ODRD 4WJ3M 1WLEA 1X56A 4M77D 1SESA 1B70A 4YRMA 4BW9A 4YROA 3JCMe 1EQRA 3JCMb 4H2UA 2DKGA 1NJ8A 4HT8A 4OP0A 2E65A 3JB9J 2CJ9A 4YRFA 4UP7A 3PZCA 3FJPA 4EO4A 4EMKB 4YRKA 1BBUA 1WQWA 2QHVA 4TVYA 1JBMA 4M7AE 4M78A 2VXEA 4XU0A 4M77G 1SETA 2G4CA 4CS3A 3V7SA 1YGBA 4KQEA 1RIQA 4M75E 2E1HA 3EFRA 4C92E 4NOYA 4TVWA 1NJ1A 3L1AA 3UGTA 4XU3A 4P73C 4RDXA 3LC0A 4EMKA 3A32A 4P3NA 5GAN5 5HGQA 3TUPA 4G84A 2ZR3A 1QF6A 4C8QD 4Q6GA 4YYEA 5LJ5e 1KQ1A 4H2XA 5GANg 4N0AA 4H2XB 5F5WA 4C92D 1NJ2A 5ELNA 1N9WA 1WPYA 4P72C 3FIFA 2AKWB 3QNEA 3V8JA 5GAOr 3RGLA 4WI1A 4PJOA 4EMGA 2AMCB 3HY1A 2ZIMA 2DDZA 3BFMA 3NENA 1D3BB 1EVLA 1YCYA 4K87A 4P74C 5GAOm 2ZNIA 1H4SA 5GMKl 4M7DB 2HNIA 4OLFA 3W3SA 4F7UG 3RESA 4M77E 1KMNA 3HXUA 5ELOA 4M7DF 2I4NA 1M8VA 3A7RA 4NL3A 4ZIBA 3JCMQ 3KFUA 3INZA 3IG2A 1GGMA 1JRIA 3HFZB 2ZR2A 4M75F 4E51A 1HTTA 4O2DA 4P75C 2DTHA 4N0AC 2RHSA 2EL9A 4M7DD 1ATIA 4YRRA 3JCMg 3HFVA 5GAOn 1X54A 2J3MA 3PCOA 3EFSA 1SERA 4XU1A 3PCOB 3JCMf 4XEMA 4P71A 4H2SA 3A74A 2C7IA 3A5YA 1Y96B 5GAMj 3R07A 1NJ5A 2DZCA 2XTIA 5GAN6 3QSUA 2RHSB 3HTZA 3HXYA 4UPAA 1EIYA 4J6WA 1LNXA 3A7UA 1BBWA 4RQFA 2Q7HA 2RHQB 3HFNA 2DTIA 2RHQA 1U1TA 1X01A 2IY5A 2ALYA 3HXWA 3G1ZA 4MMLA 4M78F 2ZT8A 3RACA 5GAMg 2VC8A 3QO8A
chains in the Genus database with same CATH superfamily
4CC2A 2LZ6B 2ZZEA 1QVFP 5GAOl 3S6WA 2K4YA 1KD1U 1VQOQ 3LX7A 4P71C 1IB8A 1BI0A 2JTMA 1S1NA 1JU5C 1U06A 5CKHA 4C92G 3A7AA 2QA4T 2COZA 2DQ3A 5DLOA 2ZTGA 3HP9A 4AFSC 3VU3C 1Q7YU 1OOTA 3FC3A 3JCMP 1IHVA 3CPWA 2RA2A 2QXFA 1YI2T 3J80E 1NZ9A 1Q82R 1HD3A 2ARSA 3AT1B 3MHXA 2HSPA 1XQHA 3JCMc 3RF1A 1HC7A 1IRXA 2LT4A 4A54A 3PVLA 1RAHB 4M7AF 1R0BG 1I81A 3OYFA 2K5FA 2RHXA 2A28A 3OW2A 3QHSA 5LJ3d 1BKBA 5I22A 4Z02A 2P4TA 5C51B 3EH1A 4DBRA 2K79A 4J9GA 2DL4A 5D6YA 2HAXA 2XI9A 5KYWB 3A8HB 4H2YA 2ZPHB 4MMKA 1Q82C 2J3LA 4YREA 2D0NA 4R0KA 4HVCA 1ADJA 1YHQA 2KROA 2LX9A 1XOVA 4P3PA 1Z9ZA 2DXTA 5GAOp 2QEXT 1OX8A 2V26A 3OSSC 2YLBA 3CCQA 1USYA 3MPUB 2NLUA 1GL5A 2FZGB 2RN8A 1K73R 1WLPB 4JRQA 3CCVA 2D1XA 4RTVA 1Z7NA 4M7DA 4KR3A 1QQJA 4ATOA 3GLXA 1M9SA 2DFUA 4TVRA 2DL5A 1Q95G 2HBWA 2CH4W 3VQWA 4EIKA 3L2VA 4FU6A 3TEGA 3RERA 3TSZA 5DY9A 1YFSA 3JCMd 3I56T 1B70B 3QKJA 4C92A 2HBPA 4XTUA 2E4HA 2SRCA 5GMKm 3CCET 2ALYB 3A5ZA 2JS2A 5GANe 2YRDA 4X9DA 2Q5IA 3MKDA 2COYA 1VYVA 2VKNA 1ZSZC 1H4VB 3OB9A 4FSXA 2F1LA 3CMEQ 1QW1A 1YI2A 1G2BA 5IXBA 4FYWB 3N5BB 3PNWC 2A0FB 3Q1JA 1BYMA 5FU7B 4XQ3A 4RTWA 3M4QA 2EYZA 5GAMd 1WQ7A 2F5TX 2OTJT 3OYCA 3WVEB 1PC0A 2H3EB 1MV0B 2PUKB 4LNSA 1B7YA 4VUBA 4E7LA 3IALA 2DZ9A 3UFGA 3P8VA 3CPWS 1EZZB 2DYBA 4IKFA 1MUZA 2A36A 4HA8A 3FRNA 4JRKA 3JCMh 3M55A 3BY7A 4YRLA 3QWXX 3CPWP 2E12A 4J83A 1FXXA 2QTXA 1YWOA 2CP6A 1B07A 1WI7A 5KCOA 1W2BP 1KC8R 4Z89A 3EGXA 1F1BB 1WJSA 3RMQA 1E1OA 2O4XA 2QQ9A 3L4GB 2RI5A 3VS3A 2XDBA 1N5ZA 1WHJA 1WYXA 1ZBXA 4M77C 4TQDA 4JLGA 4LVMA 5LJ5h 2ODRC 3QXEB 1M5Q1 2CSQA 3PGGA 4WJ4A 1RLPC 2EKHA 4FYYB 4LD9K 3UATA 1M8MA 3A98A 1M90C 2QAZA 3OYJA 1AVZC 3TSWA 1UGVA 3M5AA 5C6SA 3CCQQ 1WYDA 1YNZA 1LCKA 1UGQB 2CT3A 5KYXA 2E3CA 3BDUA 5KYXB 5D7UA 4DPGA 1OZ2A 4A4KA 4LUEA 2XD0A 5I11A 1EOVA 4KGZB 1NYQA 1VQZA 1OU9A 3OD1A 3OY9A 1GFDA 4EMKC 1RI0A 2QQBA 3E9IA 4PJOG 1HXDA 3GF5A 3EG1A 2H3JA 3A5ZB 2RQTA 3FDRA 3CC4A 3TEHA 3G71A 1Y0MA 2VASA 3H6ZA 4C8QF 3BJUA 5IHIA 4ME7A 1U3OA 4OMFB 4PJOC 2HKNA 3UF4A 2RJCA 1FMKA 2QHTA 1KHCA 2EWNA 2YRVA 2FRYA 3MF2A 1M3BA 1M2VB 4M7DG 3KFVA 2QI2A 4JJCA 3VS1A 1SSFA 2D9TA 3H0FA 2OTJA 1XNIA 5L23A 4DEXA 1R0CB 2OAUA 1D0ZA 1K1ZA 5FRNA 4XEOA 3GNGA 2CP5A 4IIOA 1SF9A 2ZT6A 2ZPIB 3I55Q 4KT0E 2ESWA 1X6BA 2EYXA 1VQKQ 2DBKA 4B9XA 2DL3A 1JJ2A 2I4OA 3V8KA 2GGRA 2QASA 3GNFB 1D3BA 3VQVA 3HHTB 4E7HA 3L2ZA 3QUIA 1M1KC 2LTOA 5FU6B 2DNUA 3E9HA 1JJCA 1OX9A 3SWNC 1JJCB 4Y28E 5A2QE 2CSIA 3VS4A 2Q5HA 4YCVA 3H8ZA 3CD6A 2E5AA 4YPFA 2O4XB 2RNAA 3L2RA 3HXVA 2K7AA 1K4US 1EIYB 4HWPA 1KJWA 5GJWB 1M3CA 1VQ4Q 2ODRD 4M77D 4RTZA 4F04B 3CC2A 1SESA 1VQOT 1X69A 3CCEA 2DX1A 2JZ2A 2DJQA 1K73C 2VGMA 3KXTA 4ZN1A 3CC2Q 1IHWA 1V29B 1G3YA 3JCMb 1GBQA 4HT8A 4UP7A 2PVDB 3FJPA 2RQWA 4QT7A 1VQMA 1WQWA 4HCZA 2IVWA 3EFOB 3M56A 3NGPA 1KIKA 2ECZA 1JBMA 4M7AE 2VXEA 4M77G 2G4CA 4CS3A 4DBQA 3V7SA 2P4RA 4M75E 2E1HA 1H92A 4OMMA 4C92E 3CD6Q 2D0QB 3PT9A 3VS0A 1NJ1A 2GCXA 3UGTA 3A1PA 1ZSGA 2O9VA 4EMKA 2BZYA 2E5KA 4OB3B 1X27A 1YJNA 5GAN5 2MIOA 4G84A 4C8QD 1ABOA 5IH2A 1WFWA 3CXCS 5LJ5e 1QCFA 4KUIA 1WJRA 1OPLA 3CMET 5IHNA 4KUDK 2VVKA 1YIJT 1NJ2A 4ZTJA 4KRTA 1EX4A 3OW2S 1B3QA 1RACB 2KQWA 2KYMA 2X51A 4PJOA 2AMCB 4OMOA 3RR6A 1VQKT 4O5VA 2MWPA 3SEMA 2D6FA 1Q82U 2L3PA 1KK7A 4P74C 2ZNIA 3MJXA 2HNIA 1NG2A 3LGLA 3CCVT 2MMPA 2LDMA 3VYGA 1K8AC 1M2OA 5HK0A 4ZIBA 1J3TA 1GCQC 4O2DA 2A7YA 1VQ8Q 4QW2A 4M7DD 1VQ8A 1Y07A 4RG2A 2XG8D 1AWWA 2GFUA 4MZTA 1M1KR 3A8MB 4FM4B 3A74A 3REAB 5FRMA 5GAMj 2JMAA 1NJ5A 3VS6A 4KBMB 2XTIA 3CCST 4QKUA 2LRQA 1ACMB 3HXYA 4UPAA 1EIYA 1XTDA 4D8DA 4EPCA 2AK5A 2L8DA 3HPWA 4GLKA 4IIMA 2DTIA 2M0OA 2MWOA 3CC2T 1Y71A 1KG1A 3G7ZA 1CSKA 1I5OB 5J3BA 3PTAA 3QO8A 2DL7A 4ELYC 3G71T 2FB7A 4YP0A 2P0LA 1YJNT 1D09B 4X1VA 4C0FA 4A53A 4HWTA 3JB9G 2GQVA 2Y4YA 2J6FA 4PFPA 4V2SA 2RD1A 4RTXA 2LCLA 5GMKj 3VBBA 1UDLA 2YUPA 4BB7A 4BE2A 2QHUA 3I56A 1NEBA 4C8QG 1RAFB 3RKXA 2K5LA 3T9NA 2K57A 2QG9B 1M4ZA 4NL2A 2HCKA 2KBTA 4Q5WA 4M7AA 2V8KA 5CVIA 1K9MR 1VQNT 4J9BA 1WXTA 2DIQA 4C8QC 3QTCA 1T3LA 2DD5A 2ZPGB 1B34A 4AMCA 1QKXA 3I55A 3LYIA 3M57A 1LPLA 1E6GA 2VWFA 4E47A 2C0IA 1VQ9A 5GANd 2CP3A 3G1JA 4RMOA 1SRYA 3QG1A 1Y96A 1Q86R 2DMOA 4M7AC 1G5IA 2GFAA 1KMMA 4H2WA 1M27C 2QGGA 2HL3A 2IG0A 4RUGA 5C52B 2K3YA 1N8RR 3LSQA 3ICAA 3A8LB 2ENMA 1HSQA 3OQ5A 2A37A 3M0PA 5GAN4 2AMCA 4M75C 2ED0A 3OSVA 2HEQA 4EMHA 5CKDA 1K9MU 4A4HA 1WZOA 2YDLA 3BDLA 3HXXA 3PE0A 1FWZA 2M0YA 5CO7A 4LDXA 2K9GA 5HK3A 3MQZA 1ZX6A 2J6KA 1H4TA 3MP8A 1G5VA 1UJYA 5HCKA 1YJ9Q 1NE8A 2EPDA 3JSCA 2ZZFA 5KYUA 2O31A 4X9CA 1NJIU 2QGFB 1AZEA 1N9SA 3M9QA 2AHJB 1R8OB 1TWBA 1W1FA 3VJPA 2X3WD 2FO0A 3OA6A 1TUCA 2HMAA 4ZTUB 4C5HA 1K0SA 3NMZC 1USYC 2DTOA 1TS9A 3LWHA 4M78C 2ZXFA 4BY6B 3PIPA 4XTWA 2L3QA 3BW1A 4PLLA 2DF6A 6AT1B 3NETA 1E6HA 4UC4A 1FMVA 4C5GA 3HRIA 3G4SA 4ZGEB 4M78G 2R57A 3CCMA 4C92C 2O2OA 1C1AA 3I5RA 4LVJA 3JCMV 1CKBA 1MMGA 3J81E 4JLIA 4JDSA 1I07A 2DPPB 1NJIR 4O6JA 2RPNA 1NLOC 4PK4A 3CCJT 4PJOD 1HYOA 1UHCA 1AWXA 2F2VA 4F17A 1ZUYA 4XTYA 2O88A 3HFZA 1VIEA 3SWNA 1KD1C 1YN8A 2DEQA 2NUPB 2FYKA 3E9GA 1VQLT 4YRQA 4K88A 3EG3A 4DA4A 5D6WA 3REXA 1G8XA 5EG2A 4M7AB 2F2XA 4YRIA 1OEBA 3J7AF 4F7UE 2L89A 4C5IA 2EJGA 2D8HA 3CBOA 4OGEA 3EH2A 3OYBA 1FYFA 4J6XA 3I9QA 1BCOA 1V1CA 4L6V5 5GMKe 2ZAEA 3CCLA 3KBGA 4PG3A 4LDVA 2ZPFB 4ZTFA 1PSEA 1SHFA 3M4YA 3P8HA 1AWOA 1FX7A 1K9AA 1NLPC 2VV5A 2YUQA 1N8RC 3JB9I 2FRWA 2P84A 2J06A 4P3OA 4ZTZB 1H641 1YFTA 2QQRA 3WXMB 3URGA 3QO7A 1WGSA 3QZ5B 2R5AA 1E22A 5CKFA 5LJ5d 2DJZA 2V1RA 1UTIA 3SD4A 3M59A 1Z9QA 1X6GA 4CS2A 4ZNXA 2KNBB 3M4GA 1Q81R 2QEXQ 4C8QE 3CD6T 2DYIA 2IY5B 1SRMA 3OYGA 4MZPA 1VQPQ 2EJFA 3JV3A 4HXJA 4M77A 4FYXB 1VQ5Q 2I4LA 2EQKA 1UFFA 2ED1A 4RCBA 4YDQA 4HWSA 5KNNA 4CC7A 4AG1C 3HRKA 1UECA 1I5LA 2JN0A 1Q81C 1NYRA 2LJ0A 1M2VA 1VYTA 2LC4A 2AT1B 1YIJQ 5GAOq 4FCYA 5DLQE 4C8QA 3OYDA 3JB9F 3CCJA 3RUXA 3NEMA 3OBWA 3JAME 4NCXA 4TQFA 1IL2A 2V8JA 1QCNA 2DU7A 3PFSA 1I4K1 3IKLA 4PKCC 4E7JA 2RI2A 3OS0A 4OF1A 4E7SA 4M75G 2VYTA 5HKCA 1VQMT 3OYKA 1WIEA 2XGTA 4KR2A 1JJ2S 4CH4A 1O75A 2CUBA 3CCUQ 1OQKA 2AKLA 3RIRA 3VQYA 5K1XA 2DE0X 4WCIA 1YJ9A 2OTLT 1E1TA 1VQLQ 3EGXB 3HKSA 2PZ1A 4YTLA 3CBMA 2DU5A 4J9CA 1L0WA 1BK2A 2K2MA 1SEMA 2P5IA 3ME9A 3QO3A 1YJWQ 1TXQA 3CCMT 1UG1A 5CR2A 1GBRA 4BY6C 1EFNA 2DRMA 1NBEB 2B8AA 5LJ3h 1PYSA 5KYYA 2GNCA 1D1BA 4XAXB 3OYYA 1M1FA 2EFIA 3RMSA 5AT1B 1GXIE 1YFNA 5C0MA 1NYFA 1PKSA 2NUTB 4M7DE 4Y92A 5C53B 1Q86C 1YWPA 4WJ3M 2A3LA 1WLEA 1X56A 4KGVB 4BE1A 3O8VA 2X4JA 1B70A 3CCRA 2LNHB 3CC7A 4A63B 3VS5A 4OB1B 2P0QA 1RI9A 2QTVA 1SSHA 1EQRA 3CPFA 4H2UA 3LH5A 5A0GA 4EMKB 5IHKA 1BBUA 3MEVA 4LE9A 3L42A 1MMDA 4FSSA 2K6DA 1KQSS 4M78A 2XK0A 4FW1A 1GRIA 4CRIA 3CCLT 2FEIA 1G83A 5AYFA 1YGBA 4KQEA 1RIQA 1KC8U 4MZMA 4NOYA 4C5EA 2JM8A 2AKKA 4RDXA 3OW2P 2JM9A 3HTRA 2XIDA 4YYEA 4Q6GA 1QF6A 3EG0A 3OS1A 4H2XA 1VOMA 2DETA 3QJYA 1BU1A 3CMAA 4H2XB 5KE3A 1WX6A 1ZBJA 5ELNA 1Y7XA 1WPYA 2AKWB 3RGLA 3V8JA 5GAOr 2BZXA 2M51A 3BFMA 1D3BB 4HVVA 1KQSP 5GAOm 2O9SA 1H4SA 1CKAA 3QBYA 3CMAT 3W3SA 4OLFA 4F7UG 2L5QA 2C0OA 1W2BA 2DBMA 1RUWA 1AOJA 2BTTA 3CCVQ 2QK0A 4M77E 3VRYA 1KMNA 3HXUA 2HL5C 1M8VA 3QYHB 4NL3A 3KFUA 3CXCP 1GGMA 1JRIA 4LDYA 4JRPA 4P75C 2DTHA 8ATCB 3HFVA 1QVGA 2J3MA 3EFSA 4CC3A 1SERA 3UPUA 4HVUA 4L59A 4H2SA 3ZFJA 5KCHA 4HCCA 4JZ3A 2OI3A 2DZCA 4J9IA 2RHIA 5GAN6 2NUTA 4PJLA 1LNXA 3E9FA 4J7FA 4DOVA 2RHQB 4AFUC 3HFNA 3SDZA 1SG5A 2RHQA 1U1TA 2FPDA 3QYGB 3G1ZA 4MMLA 4HCKA 3OYLA 4DEYA 2JNGA 2VC8A 3X26B 4BDYA 4Z88A 1VQ6T 3RKWA 2E3HA 1OYXA 1VQ4T 3LSSA 1UGRB 1QVFA 2AIRB 3META 2CZ7B 5GANj 1VQ7T 1BIBA 2Z0WA 5GAN7 4B6MA 1QMCA 4M78B 3TCJA 1K76A 2FHDA 3MEYA 1FYNA 3HRUA 2XDDA 3GP8A 2PVOB 2A8EA 2RJDA 4CC4B 1XJWB 3I55T 1VQ6A 1NEGA 1ARKA 4HVWA 1D0YA 2PNIA 2LP5A 4XTVA 5KH6A 1YITA 4K11A 2ZIOA 2QYZA 2KYBA 4OB0B 5CKBA 2ZPEB 2X9HA 4M77F 1YBYA 4J5YA 2LJ1A 4F7UA 3X28B 3M0TA 3P8DA 2QA4A 1KHIA 4M78E 3ZL7C 4JRIA 2COWA 4Z8AA 2Y4XA 3OMGA 2KR3A 4KULA 5FU6C 5GMKh 1WNLA 2WACA 1S72Q 2EGCA 1BB9A 1B7YB 5GANh 4XTZA 5I21A 4YRSA 4OVAA 2K3BA 4PJOE 3NPFA 4M78D 2DL8A 4QQGA 3OYAA 3QJ6A 3R6OA 3X20B 2I4MA 2E70A 4IUTA 1AEYA 2F5KA 4TVAA 3WVDB 2RK1A 1VYUA 4TVAB 1RABB 4OMNA 3CCMQ 3MEWA 2CZ1B 4AFQC 2PU9B 4JPBW 1X6OA 1SHGA 4LVKA 4PJOF 4P74A 1NNHA 2DK3A 1AZGB 3NHNA 4G85A 4TWAA 3VS7A 1ZSZB 1BCMA 3RL6A 1MGQA 2YUNA 5CQYA 3HFOA 1BI1A 3ERRA 3OYHA 4PJNA 2AZSA 2JMCA 4M75D 2PMFA 4RMFA 4ANJA 2HKQB 1HK9A 2CZ0B 4J15A 1NJ6A 3IKMB 2A08A 3OBYA 2JJ9A 2PQWA 3CCUT 4H2VA 4CH6A 4D8KA 3G71Q 1M90R 3DB3A 2OTLQ 5GAMe 2EJ9A 4R55A 1T3SA 1RL2A 2KE9A 4PFZA 2NUPA 3G4SQ 3JCMX 4QQDA 1Q7YC 1W70A 4CH5A 1ASYA 1ZUUA 5CCAA 2P0KA 1VIFA 3E1SA 1M1GA 2YHTA 3CCJQ 2H8HA 2YUOA 4E7IA 1RLQC 4C92F 3EGDB 4AT1B 2CYZB 1YHQQ 2RI3A 1YIJA 3CC4T 2EBPA 2MF2A 2C8MA 2CREA 4F7UB 2LCSA 2ZGWA 2XMFA 3QDFA 1PD0A 2KXDA 4ESRA 1R77A 2CS7A 4AG2C 4BE0A 1JB0E 3C4SA 4TTVA 1JXOA 1ADYA 1JEGA 5IN1A 4YRPA 4IUVA 3I5SA 4RG8A 2L3SA 1WDXA 4YRTA 1LOJA 4C92B 5LJ3g 4M75B 4UP8A 4M7AG 4YRNA 4P75A 2XICA 3LH0A 3H0HA 3M4PA 2EQJA 3WQZA 1N27A 4BI8B 3A8OB 2KDSA 2WSFE 3IQLA 3VKIA 2ZZDA 1ZA1B 2DAQA 5D6XA 4Y91A 1KOGA 2QHSA 3JB9D 1YJNQ 2QDLA 3VRZA 1B76A 3X25B 3I56Q 3CCLQ 1IGUA 2JVVA 1X2GA 3UGQA 2Y90A 2YRCA 1W2BS 1PSFA 2PTKA 3ASKA 1X55A 3JB9H 3S3NA 3I7FA 2BE9B 4C8QB 4BI3A 3QDRB 5GMKi 1QP2A 4M4ZA 3UH0A 2ZINA 4LNPA 1OV3A 2MOXA 4BWAA 4R56A 2ZZGA 1M30A 3EHRA 4PHCA 2ARUA 1WU7A 4XTXA 5CK9A 4PJMA 4RKUE 2DEUA 1OZ3A 1VQ9Q 3TEEA 5GANf 2CGHA 5CKEA 1N8RU 1QP3A 3REBB 1ZHIA 3PMTA 1EIFA 1PD1A 2XKOC 4CH3A 1PNJA 2NUZA 5GAN2 5GAN8 1NM7A 3EFOA 1NJIC 2O01E 4OGCA 1UB4A 2RHUA 2CIMA 4NS5A 5IAYA 4JZ4A 4XK8E 2QA4Q 4J6YA 2BIVA 3EG2A 4KH1B 2DXUA 2JT4A 2PUOB 2RQUA 2HD0A 3MCAB 4CI0C 1K8AU 4H02A 1YI2Q 4YRJA 2MCNA 3ULRB 2RB6A 2V1QA 1YITQ 3PMIA 2ROLA 3CQTA 4X5OA 1AHJB 2M1HA 1W66A 3PVQA 4JJDA 1W6XA 1LYLA 2JTEA 3DSQA 4EDUA 3GPLA 1VA7A 4GLMA 1HJDA 4LDWA 4PFOA 11ASA 2RK2A 3L2UA 4KGXB 5LJ3j 3EGDA 1YFRA 4M75A 2KMTA 2EAYA 2DXBA 1QLYA 1YP5A 1BBZA 2HQHA 1IGQA 5IT9E 3H0IA 2ZCFB 4F14A 3CCSQ 1MNEA 1YCSB 1D1CA 3THKA 1UGSB 2HQEA 4YRMA 2CZ6B 4BW9A 1SRLA 4RTUA 3LLRA 3CCRT 1PRMC 2DD4A 2JS0A 5HY6A 2DKGA 1NJ8A 3JB9J 4YRFA 1H8KA 2KGTA 2LT1A 4LXCA 1IXDA 4YRKA 5J39A 3D7SB 2W10A 2QHVA 4DBHA 3MEAA 2DVJA 4TVYA 2P0PA 1X2QA 4MDWA 4JS5A 3OMCA 2IIMA 1D1AA 3L1AA 1VQPT 1KSWA 4XU3A 4JS4A 3CCEQ 4MDXA 5FWCA 3DKMA 2X35A 3CEYA 4P3NA 5HGQA 3TUPA 2EYWA 2LQKA 2ZR3A 3M0UA 1TG0A 1KQ1A 2OX7A 4BACA 4N0AA 1G3WA 2LJ3A 4C0DB 1PRLC 4E7ZA 2M16A 1VQNQ 1OU8A 4P72C 2BUDA 3FIFA 1U8RA 1UUEA 5A0LA 1I1JA 2MI6A 2B86A 3G6ET 4ELZC 2VGNA 3ER0A 3NENA 1Q81U 1EVLA 4LUDA 4K87A 2HQXA 5GMKl 4HCBA 4GBQA 2DXCA 2RJEA 2KY9A 2NYSA 3CMAQ 2R58A 3RESA 1VQMQ 3BE3A 2ABLA 2D8JA 1RAIB 4M7DF 2AZVA 4FT4A 5KYWA 4HKEA 5J26A 3DLMA 3INZA 3HFZB 4E51A 4M75F 3CXCA 2EKOA 1PWTA 2EL9A 1ATIA 4YRRA 2L3RA 2J05A 1GFCA 4JJBA 1QVFS 4XU1A 3JCMf 2C0TA 1LVKA 1RAAB 3QWYA 1Y96B 1VQ5T 3M0SA 1ZUKA 2ROTA 3F70A 1YJWT 2RMOA 2CKKA 2DILA 2RO0A 2RJFA 1QWEA 2YSQA 3QSUA 2RHSB 1AT1B 1BBWA 2KXCA 4QQ6A 2IY5A 3CCRQ 2EQUA 1VQ7A 2M9UA 3OS2A 2W0ZA 3HXWA 2X4XA 2OJ2A 4A4FA 4JJNK 3RACA 4DBFA 3CMEA 1GCQA 3HRSA 2CH4A 1VQNA 2LQNA 2L0AA 3KUFA 3HSBA 3MF1A 5LJ5f 3C95A 1MV3A 2CP0A 4YCWA 2K5IA 4QVZA 5EC7A 1P92A 3M58A 2ATCB 3G4ST 4PJOB 1VQKA 3OYNA 1QWFA 4J8OA 5GAN3 1OPKA 4P5NA 3EAEA 1H3HA 2KSSA 4D6WA 2C06A 2RHZA 1TSFA 2MPXC 1KFZA 2CP2A 1WHLA 2RF0A 3S3OA 4M7AD 4FYVB 1QKWA 2GF7A 3FB9A 3ZEHA 1J5WA 2SEMA 1TU0B 3SB2A 1VQLA 1G3SA 2KK4A 4P72A 4RTTA 5CAIA 5L8RE 2V8IA 1QCOA 4IURA 4LD6A 3L2WA 2E64A 2EVRA 5FW9A 1SPKA 1M90U 2WSCE 4ORZA 1X75C 2YT6A 5E3IA 1T0HA 2DRKA 4F16A 3CCSA 1KC8C 3R6NA 1WJQA 4AFZC 3C94A 3VQXA 3NTHA 2RQRA 4YRGA 1W4SA 4YRCA 2BKDN 3V7CA 1MHNA 5KYNA 1DJ7B 2XDPA 2NWMA 1PYSB 3E2UA 2QQSA 4P73A 2VUBA 2E10A 2FZKB 2MAMA 3CCQT 3UWNA 3ZBDA 2DLPA 4OMPA 4HT9A 3VV0A 3VUBA 1KQSA 2J6OA 3SWNB 1VUBA 1TUGB 12ASA 1VQ4A 1EVKA 3RNJA 1RADB 3PIOA 3CMQA 2HSEB 3V8LA 1G5HA 2RM4A 5KYYB 2E41A 1ZSZA 4QVDA 1VQ5A 3P8BB 3REUA 5GJVB 4DQ2A 2LQ8A 1U1SA 4A4GA 3SFMA 5FLXE 1KD1R 2RQVA 4BI4A 2CDTA 2KRMA 3LWIA 1X43A 3X24B 1RAEB 1BI2A 1PCXA 2K3XA 2Q7EA 3GIBA 1N6AA 1AWJA 3EHQA 2G3RA 1Q7YR 1WHMA 3FLGA 2FZCB 2DA9A 4FW2A 1X2HA 1OULA 2ZPBB 3RKYA 2JW4A 4ZN3A 1LJOA 2X4WA 3OYIA 4PLIA 3TU4K 9ATCB 4H2TA 4E2FB 5GAMf 3CC7T 2DQ0A 2OAWA 2KVQG 4M7DC 1ZLMA 1WHGA 2M02A 3MP6A 1NPPA 1IZ6A 1UJ0A 3VS2A 2OTJQ 2ARTA 4RQEA 1WXUA 1ABQA 3TREA 4JUVA 3LGFA 2AKWA 1OI1A 3G6EA 4PJJA 4WF2A 2KEAA 2VXFA 1C6VX 4EX5A 1K0XA 2ZNJA 2NS6A 1GCPA 2YXYA 2ZCEA 1ASZA 2I0NA 3AHUA 5CQXA 3H41A 4BUGA 3CC4Q 1N9RA 4AH6A 4BD3A 2PMEA 5LJ5g 5DM7R 1K73U 4J9HA 5CIUA 3OYMA 2ZT7A 2JOYA 3A8GB 3DLLA 3JRZA 4E7KA 3OS5A 1JXMA 2EGEA 2LNVA 3NFCA 5FWBA 4J9FA 3HXZA 3QPHA 1QVGP 4HWRA 1Q86U 1SKUB 2XHCA 1RAGB 1YJWA 4IUQA 2HZYA 4Q15A 1H4QA 2QQAA 1TUDA 1QVPA 5KE2A 2CJBA 2JXBA 1KQ2A 2ZT5A 3L4GA 3JCMW 2LCCA 1MMNA 1VQ7Q 4UP9A 2KAFA 5GAMh 3UDCA 2GBQA 1E24A 2CP7A 3M54A 4XU2A 1TTHB 4LN2A 3JCMJ 2DERA 4WTOB 3QO5A 2I2LA 3HL8A 4LVIA 2MK5A 4LVLA 3P8YA 1X2KA 2JTFA 4IUUA 4ZGJB 2Q7GA 2CJAA 2IPOB 1UEBA 1Y57A 3HY0A 1VQ9T 5I2MA 5LJ3f 2VB6A 1M1KU 2EGAA 5LL6S 1B34B 1TOVA 4OB2B 3VUZA 3TQ7P 4J7IA 5FROA 3G6EQ 4F7UF 2EQMA 4E6RA 7AT1B 3TEHB 5I2SA 1S72A 3M0QA 1C0AA 3TVTA 2GTJA 2EIFA 5K1PA 4FT2A 3RBBB 3LW5E 1I8FA 2PVGB 3RDVA 1C0MA 1YB3A 3V7RA 1MMAA 1WHHA 1UGPB 2LQWA 3UA7A 2FVUA 2KT8A 1QE0A 4YCUA 1VQPA 4II1A 5LJ3e 2X3XD 3QZ9B 1Z7MA 4RCCA 2G6FX 2CUDA 1U5SA 1VQ8T 1B8AA 2CT4A 2JUFA 1G51A 2J7IA 1VQOA 3A31A 2BE7D 3O5ZA 4K86A 4C0ZA 2WSEE 3P8TA 1BIAA 3M0RA 5IXFA 2LX7A 5LJ5j 1PG5B 4LDUA 2DVEA 2DIGA 3MEUA 3FJ5A 4C0GA 2F69A 5FU7C 2LMJA 4HWOA 4J9EA 2E5QA 1PHTA 1ZQ1A 3SHWA 1YHQT 4OMQA 5M9OA 4QVCA 4CS4A 4M77B 1IREB 1TH7A 1D0XA 2HDAA 2YLCA 4GY5A 1JO8A 4PNOA 2DM1A 4L87A 3NELA 1EFWA 2QDYB 1UHFA 3GBQA 1WHKA 5KYUB 1NYGA 4KH0B 2RHYA 1IO6A 4YROA 3E19A 3JCMe 2FG0A 4L5GA 4X34A 1I0CA 4OP0A 2E65A 1FMWA 2CJ9A 3PZCA 4EO4A 2K2VA 3NTKA 1G3TA 1E7OA 1VQ6Q 1YJ9T 4FIBA 2OTLA 2XU8A 4XU0A 1SETA 1BI3A 4B9WA 3EFRA 4TVWA 3GOXA 4P73C 1A0NB 3LC0A 1NPRA 1T0JA 3A32A 3VYHB 2LVMA 3C12A 1JJ2P 3EG9B 5GANg 2EQIA 3MO8A 3L2QA 2EYYA 3EG9A 3MP1A 4C92D 5F5WA 2YWWA 4PL6A 1ZA2B 1PKTA 4RTYA 1N9WA 3NTIA 4ZGDB 3QNEA 3EGUA 3DB4A 1K9MC 4WI1A 2E6ZA 3H9NA 3U23A 4EMGA 3HY1A 2ZIMA 3CCUA 2DDZA 3FEOA 3UA6A 2KRNA 1YCYA 4N4IA 4N4HA 2F2WA 2FPFA 4OMLA 2L2PA 3I35A 5A0DA 4DOWA 1MNDA 4M7DB 1V76A 2KT1A 5ELOA 1PM3A 1S72T 2I4NA 4HT4A 3A7RA 3S3MA 3JCMQ 4IUPA 3IG2A 4J9DA 1UE9A 2ZR2A 1HTTA 4N0AC 1O9SA 2RHSA 2BZ8A 2R5MA 3JCMg 5GAOn 4BDZA 1X54A 3PCOA 3HRTA 2KI7A 1YITT 3PCOB 4XEMA 1WXBA 2FL7A 4P71A 1B7TA 1H3ZA 1AD5A 2KRSA 2EW3A 2C7IA 3A5YA 2E3IA 3R07A 3M53A 2FPEA 3HTZA 1M3AA 3QIIA 4A4EA 4J6WA 1JQQA 4C0DC 3OYEA 3A7UA 4N4GA 2GQIA 4RQFA 2Q7HA 2RH2A 1X01A 5ECAA 2ALYA 3CC7Q 2GTOA 2QEXA 2X4YA 2DO3A 1QVGS 2EYQA 3CBPA 1WA7A 8AT1B 4FL6A 4M78F 2ZT8A 2E6NA 2MYSA 5GAMg 3UT1A 3C0CA 1K8AR
chains in the Genus database with same CATH topology
2ZZEA 5GAOl 3S6WA 2K4YA 1KD1U 3LX7A 4P71C 1BI0A 2JTMA 5CKHA 4C92G 3A7AA 2QA4T 2ZTGA 5DLOA 2DQ3A 3HP9A 3VU3C 1Q7YU 3FC3A 3JCMP 3CPWA 2RA2A 2QXFA 1YI2T 3J80E 1NZ9A 2ARSA 3MHXA 1XQHA 3JCMc 3RF1A 1HC7A 2LT4A 4A54A 4M7AF 1I81A 3OYFA 2K5FA 2RHXA 3OW2A 3QHSA 5LJ3d 1BKBA 4Z02A 2P4TA 5C51B 5D6YA 2HAXA 2XI9A 3A8HB 4H2YA 2ZPHB 4MMKA 1Q82C 2J3LA 4YREA 4HVCA 1ADJA 1YHQA 2LX9A 1XOVA 4P3PA 2DXTA 5GAOp 2QEXT 3OSSC 2YLBA 3CCQA 1USYA 2NLUA 4JRQA 3CCVA 1Z7NA 4M7DA 4KR3A 4ATOA 3GLXA 1M9SA 4TVRA 3VQWA 3L2VA 4FU6A 3TEGA 3RERA 5DY9A 1YFSA 3JCMd 3I56T 1B70B 3QKJA 4C92A 2HBPA 4XTUA 5GMKm 3CCET 2ALYB 3A5ZA 5GANe 4X9DA 2Q5IA 1H4VB 3OB9A 4FSXA 1QW1A 1YI2A 3N5BB 3PNWC 3Q1JA 1BYMA 5FU7B 4XQ3A 3M4QA 5GAMd 1WQ7A 2F5TX 2OTJT 3OYCA 3WVEB 2PUKB 4LNSA 1B7YA 4VUBA 4E7LA 3IALA 2DZ9A 3UFGA 3P8VA 3CPWS 4IKFA 4HA8A 3FRNA 4JRKA 3JCMh 3M55A 3BY7A 4YRLA 2E12A 4J83A 1FXXA 2QTXA 5KCOA 1WJSA 3RMQA 1E1OA 2O4XA 2QQ9A 3L4GB 2RI5A 2XDBA 1ZBXA 4M77C 4TQDA 4JLGA 4LVMA 5LJ5h 2ODRC 3QXEB 1M5Q1 3PGGA 4WJ4A 4LD9K 1M90C 3OYJA 3M5AA 5C6SA 1WYDA 2E3CA 1UGQB 3BDUA 4DPGA 1OZ2A 4A4KA 2XD0A 1EOVA 1NYQA 1VQZA 3OD1A 3OY9A 4EMKC 1RI0A 2QQBA 3E9IA 4PJOG 1HXDA 3GF5A 2H3JA 3A5ZB 3FDRA 3CC4A 3TEHA 3G71A 3H6ZA 3BJUA 4C8QF 4ME7A 4OMFB 4PJOC 2RJCA 2QHTA 1KHCA 2EWNA 2YRVA 3MF2A 4M7DG 2QI2A 1SSFA 2D9TA 2OTJA 1XNIA 2OAUA 5FRNA 4XEOA 3GNGA 2ZT6A 2ZPIB 4KT0E 4B9XA 1JJ2A 2I4OA 3V8KA 3GNFB 1D3BA 3VQVA 3HHTB 4E7HA 3L2ZA 3QUIA 1M1KC 2LTOA 5FU6B 3E9HA 1JJCA 3SWNC 1JJCB 4Y28E 5A2QE 2Q5HA 4YCVA 3H8ZA 3CD6A 2E5AA 4YPFA 2O4XB 3L2RA 3HXVA 1EIYB 4HWPA 2ODRD 4M77D 3CC2A 1SESA 1VQOT 3CCEA 2JZ2A 1K73C 2VGMA 3KXTA 4ZN1A 1V29B 1G3YA 3JCMb 4HT8A 4UP7A 2PVDB 3FJPA 1VQMA 1WQWA 2IVWA 4HCZA 3M56A 1JBMA 4M7AE 2VXEA 4M77G 2G4CA 4CS3A 3V7SA 4M75E 2E1HA 4C92E 2D0QB 3PT9A 1NJ1A 2GCXA 3UGTA 4EMKA 4OB3B 1YJNA 5GAN5 4G84A 4C8QD 3CXCS 5LJ5e 4KUIA 1WJRA 3CMET 4KUDK 1YIJT 1NJ2A 4ZTJA 3OW2S 2KQWA 4PJOA 2AMCB 1VQKT 4O5VA 2MWPA 2D6FA 1Q82U 4P74C 2ZNIA 2HNIA 3CCVT 3LGLA 2MMPA 2LDMA 3VYGA 1K8AC 5HK0A 4ZIBA 4O2DA 2A7YA 4QW2A 4M7DD 1VQ8A 1Y07A 4RG2A 2XG8D 2GFUA 4MZTA 3A8MB 4FM4B 3A74A 5FRMA 5GAMj 1NJ5A 4KBMB 2XTIA 3CCST 2LRQA 3HXYA 4UPAA 1EIYA 1XTDA 4EPCA 2L8DA 3HPWA 4GLKA 2DTIA 2M0OA 2MWOA 3CC2T 1Y71A 1KG1A 3G7ZA 5J3BA 3PTAA 3QO8A 4ELYC 3G71T 2FB7A 4YP0A 2P0LA 1YJNT 4C0FA 4A53A 4HWTA 3JB9G 2GQVA 2Y4YA 4V2SA 2RD1A 2LCLA 5GMKj 3VBBA 4BB7A 4BE2A 2QHUA 3I56A 4C8QG 3RKXA 2K5LA 3T9NA 2K57A 1M4ZA 4NL2A 4Q5WA 4M7AA 2V8KA 5CVIA 1VQNT 4C8QC 2DIQA 3QTCA 2DD5A 2ZPGB 1B34A 3I55A 3LYIA 3M57A 4E47A 1VQ9A 5GANd 4RMOA 1SRYA 3QG1A 1Y96A 4M7AC 1G5IA 2GFAA 1KMMA 4H2WA 2IG0A 5C52B 2K3YA 3LSQA 3ICAA 3A8LB 3OQ5A 5GAN4 2AMCA 4M75C 3OSVA 4EMHA 5CKDA 1K9MU 4A4HA 3BDLA 3HXXA 1FWZA 5CO7A 4LDXA 5HK3A 3MQZA 1H4TA 3MP8A 1G5VA 1NE8A 3JSCA 2ZZFA 4X9CA 1NJIU 1N9SA 3M9QA 2AHJB 1R8OB 3VJPA 3OA6A 4ZTUB 4C5HA 1USYC 2DTOA 3LWHA 4M78C 2ZXFA 4BY6B 3PIPA 4XTWA 3BW1A 4PLLA 3NETA 4UC4A 4C5GA 3HRIA 3G4SA 4ZGEB 4M78G 2R57A 3CCMA 4C92C 4LVJA 3JCMV 3J81E 4JLIA 4JDSA 2DPPB 4O6JA 3CCJT 4PJOD 4XTYA 3HFZA 1VIEA 3SWNA 1KD1C 2DEQA 2FYKA 3E9GA 1VQLT 4YRQA 4K88A 4DA4A 5D6WA 3REXA 5EG2A 4M7AB 4YRIA 3J7AF 4F7UE 2L89A 4C5IA 2EJGA 3CBOA 4OGEA 3OYBA 1FYFA 4J6XA 4L6V5 5GMKe 3CCLA 3KBGA 4PG3A 4LDVA 2ZPFB 4ZTFA 1PSEA 3M4YA 3P8HA 1FX7A 2VV5A 1N8RC 3JB9I 4ZTZB 4P3OA 1H641 1YFTA 2QQRA 3WXMB 3URGA 3QO7A 1WGSA 3QZ5B 1E22A 2R5AA 5CKFA 5LJ5d 2DJZA 3SD4A 3M59A 4CS2A 3M4GA 4C8QE 3CD6T 2IY5B 3OYGA 4MZPA 2EJFA 4M77A 2I4LA 2EQKA 4RCBA 4YDQA 4HWSA 5KNNA 3HRKA 1I5LA 2JN0A 1Q81C 1NYRA 2LC4A 5GAOq 5DLQE 4C8QA 3OYDA 3JB9F 3CCJA 3RUXA 3NEMA 3OBWA 3JAME 4NCXA 4TQFA 1IL2A 2V8JA 2DU7A 3PFSA 1I4K1 3IKLA 4PKCC 4E7JA 2RI2A 3OS0A 4OF1A 4M75G 2VYTA 5HKCA 1VQMT 3OYKA 2XGTA 4KR2A 1JJ2S 4CH4A 1O75A 3RIRA 3VQYA 5K1XA 1YJ9A 2OTLT 1E1TA 3HKSA 4YTLA 2DU5A 3CBMA 1L0WA 2P5IA 3ME9A 3QO3A 3CCMT 5CR2A 4BY6C 1PYSA 2B8AA 5LJ3h 4XAXB 3OYYA 1M1FA 2EFIA 3RMSA 1GXIE 5C0MA 4M7DE 5C53B 1Q86C 4WJ3M 2A3LA 1WLEA 1X56A 4BE1A 3O8VA 2X4JA 1B70A 3CCRA 3CC7A 4OB1B 2P0QA 1EQRA 3CPFA 4H2UA 5A0GA 4EMKB 1BBUA 3MEVA 3L42A 1KQSS 4M78A 2XK0A 4CRIA 3CCLT 5AYFA 1YGBA 4KQEA 1RIQA 1KC8U 4MZMA 4NOYA 4C5EA 4RDXA 2XIDA 4YYEA 4Q6GA 1QF6A 3OS1A 4H2XA 3QJYA 3CMAA 4H2XB 5KE3A 5ELNA 1Y7XA 1WPYA 2AKWB 3RGLA 3V8JA 5GAOr 3BFMA 1D3BB 5GAOm 1H4SA 3QBYA 3CMAT 3W3SA 4OLFA 4F7UG 2L5QA 1W2BA 4M77E 1KMNA 3HXUA 1M8VA 3QYHB 4NL3A 3KFUA 1GGMA 1JRIA 4LDYA 4JRPA 4P75C 2DTHA 3HFVA 1QVGA 2J3MA 3EFSA 1SERA 3UPUA 4L59A 4H2SA 3ZFJA 5KCHA 4HCCA 2DZCA 2RHIA 5GAN6 1LNXA 3E9FA 4J7FA 4DOVA 2RHQB 3HFNA 3SDZA 2RHQA 1U1TA 3QYGB 3G1ZA 4MMLA 3OYLA 2JNGA 2VC8A 3X26B 4BDYA 1VQ6T 3RKWA 1VQ4T 1OYXA 3LSSA 1UGRB 1QVFA 3META 2CZ7B 5GANj 1VQ7T 1BIBA 5GAN7 4M78B 3TCJA 3MEYA 2FHDA 3HRUA 2XDDA 3GP8A 2PVOB 2A8EA 2RJDA 3I55T 1VQ6A 4XTVA 5KH6A 1YITA 2ZIOA 4OB0B 5CKBA 2ZPEB 4M77F 1YBYA 4J5YA 4F7UA 3X28B 3P8DA 2QA4A 1KHIA 4M78E 4JRIA 2Y4XA 3OMGA 4KULA 5FU6C 5GMKh 1WNLA 2WACA 1B7YB 5GANh 4XTZA 5I21A 4YRSA 4OVAA 4PJOE 4M78D 4QQGA 3OYAA 3QJ6A 3R6OA 3X20B 2I4MA 2E70A 4IUTA 2F5KA 4TVAA 3WVDB 2RK1A 4TVAB 3MEWA 2CZ1B 2PU9B 1X6OA 4LVKA 4PJOF 4P74A 1NNHA 2DK3A 4G85A 4TWAA 3RL6A 1MGQA 5CQYA 3HFOA 1BI1A 3ERRA 3OYHA 4M75D 2PMFA 4RMFA 1HK9A 2CZ0B 4J15A 1NJ6A 3IKMB 3OBYA 2PQWA 3CCUT 4H2VA 4CH6A 3DB3A 5GAMe 2EJ9A 4R55A 1RL2A 3JCMX 4QQDA 1Q7YC 4CH5A 1ASYA 5CCAA 2P0KA 1VIFA 3E1SA 1M1GA 2YHTA 4E7IA 4C92F 2CYZB 2RI3A 1YIJA 3CC4T 2MF2A 2C8MA 4F7UB 2ZGWA 2CS7A 4BE0A 1JB0E 3C4SA 4TTVA 1ADYA 5IN1A 4YRPA 4IUVA 4RG8A 4YRTA 1LOJA 4C92B 5LJ3g 4M75B 4UP8A 4M7AG 4YRNA 4P75A 2XICA 3LH0A 3M4PA 2EQJA 3WQZA 1N27A 4BI8B 3A8OB 2KDSA 2WSFE 3VKIA 2ZZDA 2DAQA 5D6XA 4Y91A 1KOGA 2QHSA 3JB9D 1B76A 3X25B 1X2GA 3UGQA 2JVVA 2Y90A 1W2BS 1PSFA 3ASKA 1X55A 3JB9H 3S3NA 3I7FA 4C8QB 4BI3A 3QDRB 5GMKi 1QP2A 3UH0A 2ZINA 4BWAA 4R56A 2ZZGA 4PHCA 2ARUA 1WU7A 4XTXA 5CK9A 4RKUE 1OZ3A 3TEEA 5GANf 2CGHA 5CKEA 1N8RU 1QP3A 1ZHIA 3PMTA 1EIFA 2XKOC 4CH3A 5GAN2 5GAN8 1NJIC 2O01E 4OGCA 1UB4A 2RHUA 2CIMA 4NS5A 5IAYA 4XK8E 4J6YA 2BIVA 2DXUA 2PUOB 2HD0A 3MCAB 4CI0C 1K8AU 4H02A 4YRJA 2RB6A 3PMIA 4X5OA 1AHJB 2M1HA 1W66A 1LYLA 3DSQA 4EDUA 3GPLA 4LDWA 11ASA 2RK2A 3L2UA 5LJ3j 1YFRA 4M75A 2KMTA 2EAYA 2DXBA 5IT9E 2ZCFB 1UGSB 2HQEA 4YRMA 2CZ6B 4BW9A 3LLRA 3CCRT 2DD4A 5HY6A 2DKGA 1NJ8A 3JB9J 4YRFA 2LT1A 4YRKA 5J39A 2QHVA 3MEAA 4TVYA 2P0PA 4MDWA 4JS5A 3OMCA 3L1AA 1VQPT 4XU3A 4JS4A 4MDXA 3DKMA 2X35A 3CEYA 4P3NA 5HGQA 3TUPA 2LQKA 2ZR3A 1KQ1A 4BACA 1G3WA 4N0AA 4C0DB 2M16A 4P72C 2BUDA 3FIFA 1U8RA 5A0LA 2MI6A 3G6ET 4ELZC 2VGNA 3ER0A 3NENA 1Q81U 1EVLA 4K87A 2HQXA 5GMKl 4HCBA 2DXCA 2RJEA 2KY9A 2R58A 3RESA 4M7DF 4FT4A 4HKEA 5J26A 3DLMA 3INZA 3HFZB 4E51A 4M75F 3CXCA 2EKOA 2EL9A 1ATIA 4YRRA 2L3RA 1QVFS 4XU1A 3JCMf 1VQ5T 1Y96B 3F70A 1YJWT 2CKKA 2RO0A 2RJFA 3QSUA 2RHSB 1BBWA 4QQ6A 2IY5A 2EQUA 1VQ7A 2M9UA 3OS2A 3HXWA 2X4XA 4A4FA 4JJNK 3RACA 3CMEA 3HRSA 1VQNA 3KUFA 3HSBA 3MF1A 5LJ5f 3C95A 4YCWA 2K5IA 4QVZA 1P92A 3M58A 3G4ST 4PJOB 1VQKA 3OYNA 4J8OA 5GAN3 4P5NA 3EAEA 2KSSA 4D6WA 2C06A 2RHZA 4M7AD 3S3OA 2GF7A 3FB9A 3ZEHA 1J5WA 3SB2A 1VQLA 1G3SA 2KK4A 4P72A 5CAIA 5L8RE 2V8IA 4IURA 4LD6A 3L2WA 2E64A 1M90U 2WSCE 1X75C 5E3IA 3CCSA 1KC8C 1WJQA 3C94A 3VQXA 3NTHA 4YRGA 1W4SA 4YRCA 2BKDN 3V7CA 1MHNA 1DJ7B 2XDPA 1PYSB 2QQSA 4P73A 2VUBA 2E10A 2MAMA 3CCQT 3UWNA 3ZBDA 4HT9A 3VV0A 3VUBA 1KQSA 3SWNB 1VUBA 12ASA 1EVKA 1VQ4A 3PIOA 3CMQA 3V8LA 1G5HA 2RM4A 2E41A 4QVDA 1VQ5A 3P8BB 3REUA 4DQ2A 2LQ8A 1U1SA 4A4GA 3SFMA 5FLXE 4BI4A 3LWIA 3X24B 1BI2A 2K3XA 2Q7EA 3GIBA 1N6AA 2G3RA 3FLGA 1X2HA 2ZPBB 3RKYA 4ZN3A 3OYIA 1LJOA 2X4WA 3TU4K 4PLIA 4H2TA 5GAMf 3CC7T 2DQ0A 2KVQG 4M7DC 3MP6A 1NPPA 1IZ6A 2ARTA 4RQEA 3TREA 4JUVA 3LGFA 2AKWA 1OI1A 3G6EA 4WF2A 2VXFA 4EX5A 2ZNJA 2NS6A 2ZCEA 1ASZA 3AHUA 5CQXA 4BUGA 1N9RA 4AH6A 4BD3A 2PMEA 5LJ5g 5DM7R 1K73U 5CIUA 3OYMA 2ZT7A 2JOYA 3A8GB 3DLLA 3JRZA 4E7KA 3OS5A 2LNVA 3NFCA 3HXZA 3QPHA 4HWRA 1Q86U 2XHCA 1YJWA 4IUQA 4Q15A 1H4QA 2QQAA 1QVPA 5KE2A 2CJBA 1KQ2A 2ZT5A 3L4GA 3JCMW 2LCCA 4UP9A 2KAFA 5GAMh 3UDCA 1E24A 3M54A 4XU2A 3JCMJ 3QO5A 2I2LA 3HL8A 4LVIA 4LVLA 3P8YA 2JTFA 4IUUA 4ZGJB 2Q7GA 2CJAA 1UEBA 3HY0A 1VQ9T 5I2MA 5LJ3f 1M1KU 5LL6S 1B34B 4OB2B 3VUZA 4J7IA 5FROA 4F7UF 2EQMA 3TEHB 5I2SA 1S72A 1C0AA 2EIFA 5K1PA 4FT2A 3LW5E 1I8FA 2PVGB 1YB3A 3V7RA 1UGPB 2FVUA 1QE0A 4YCUA 1VQPA 4II1A 5LJ3e 3QZ9B 1Z7MA 4RCCA 1VQ8T 1B8AA 1G51A 2JUFA 1VQOA 3A31A 4K86A 4C0ZA 2WSEE 3P8TA 1BIAA 5LJ5j 4LDUA 2DVEA 2DIGA 3MEUA 4C0GA 2F69A 5FU7C 4HWOA 2E5QA 1ZQ1A 1YHQT 5M9OA 4QVCA 4CS4A 4M77B 1IREB 1TH7A 2YLCA 4GY5A 4PNOA 4L87A 3NELA 1EFWA 2QDYB 2RHYA 4YROA 3E19A 3JCMe 4L5GA 4X34A 4OP0A 2E65A 2CJ9A 3PZCA 4EO4A 2K2VA 3NTKA 1G3TA 1YJ9T 4FIBA 2OTLA 2XU8A 4XU0A 1SETA 1BI3A 4B9WA 3EFRA 4TVWA 3GOXA 4P73C 3LC0A 1NPRA 3A32A 3VYHB 2LVMA 3C12A 5GANg 3MO8A 3L2QA 3MP1A 4C92D 5F5WA 4PL6A 1N9WA 3NTIA 4ZGDB 3QNEA 3DB4A 1K9MC 4WI1A 2E6ZA 4EMGA 3HY1A 2ZIMA 3CCUA 2DDZA 3FEOA 1YCYA 4N4IA 4N4HA 5A0DA 4DOWA 4M7DB 5ELOA 1S72T 2I4NA 4HT4A 3A7RA 3S3MA 3JCMQ 4IUPA 3IG2A 2ZR2A 1HTTA 4N0AC 1O9SA 2RHSA 2R5MA 3JCMg 5GAOn 4BDZA 1X54A 3PCOA 3HRTA 1YITT 3PCOB 4XEMA 2FL7A 4P71A 1H3ZA 2C7IA 3A5YA 3R07A 3M53A 3HTZA 3QIIA 4A4EA 4J6WA 4C0DC 3OYEA 3A7UA 4N4GA 4RQFA 2Q7HA 2RH2A 1X01A 2ALYA 2QEXA 2X4YA 2DO3A 1QVGS 2EYQA 3CBPA 4FL6A 4M78F 2ZT8A 2E6NA 5GAMg 3UT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSB A;  3MF1 A;  5LJ5 f;  2FB7 A;  4YP0 A;  3RKW A;  4YCW A;  2P0L A;  2ZZE A;  3LSS A;  5GAO l;  4A53 A;  4HWT A;  5GAN j;  4P71 C;  3JB9 G;  1BIB A;  4PJO B;  5GAN 3;  5GAN 7;  2RD1 A;  4V2S A;  4C92 G;  4M78 B;  3A7A A;  5GMK j;  2DQ3 A;  2ZTG A;  3VBB A;  3VU3 C;  2QHU A;  3MEY A;  4C8Q G;  3RKX A;  3JCM P;  2K57 A;  2RA2 A;  4NL2 A;  4M7A D;  4M7A A;  2ARS A;  3FB9 A;  4XTV A;  1J5W A;  2ZIO A;  3JCM c;  3SB2 A;  4C8Q C;  3QTC A;  1HC7 A;  4P72 A;  3RF1 A;  5CAI A;  1B34 A;  4A54 A;  4M7A F;  4M77 F;  1I81 A;  2E64 A;  4J5Y A;  3QHS A;  4F7U A;  5LJ3 d;  5GAN d;  5E3I A;  5C51 B;  4M78 E;  4JRI A;  1SRY A;  1Y96 A;  3VQX A;  4H2Y A;  4YRG A;  4MMK A;  4YRC A;  4M7A C;  1G5I A;  3V7C A;  5GMK h;  1WNL A;  2J3L A;  1KMM A;  4H2W A;  4YRE A;  4HVC A;  1PYS B;  5C52 B;  1ADJ A;  1B7Y B;  5GAN h;  3LSQ A;  4P73 A;  4XTZ A;  5I21 A;  2E10 A;  3ICA A;  4YRS A;  4P3P A;  2DXT A;  5GAO p;  4PJO E;  5GAN 4;  2AMC A;  4HT9 A;  4M75 C;  4M78 D;  2YLB A;  1USY A;  3SWN B;  12AS A;  1EVK A;  2I4M A;  4EMH A;  3CMQ A;  1Z7N A;  3HXX A;  4TVA A;  4M7D A;  4KR3 A;  4TVA B;  3V8L A;  1G5H A;  2RM4 A;  2E41 A;  3VQW A;  4QVD A;  3TEG A;  1H4T A;  3REU A;  4DQ2 A;  1U1S A;  3RER A;  2ZZF A;  5DY9 A;  1YFS A;  3JCM d;  1B70 B;  4PJO F;  4C92 A;  4X9C A;  4XTU A;  4P74 A;  1NNH A;  1N9S A;  2Q7E A;  5GMK m;  3GIB A;  4G85 A;  4TWA A;  2ALY B;  3A5Z A;  4ZTU B;  5GAN e;  3RL6 A;  4X9D A;  2Q5I A;  1MGQ A;  1X2H A;  3HFO A;  3RKY A;  1USY C;  1LJO A;  2DTO A;  1H4V B;  4H2T A;  3ERR A;  5GAM f;  4M78 C;  4M75 D;  2DQ0 A;  2PMF A;  4M7D C;  2ZXF A;  4RMF A;  1HK9 A;  4XTW A;  4J15 A;  1NJ6 A;  3IKM B;  4XQ3 A;  3M4Q A;  3BW1 A;  5GAM d;  4H2V A;  3NET A;  4CH6 A;  1WQ7 A;  3HRI A;  5GAM e;  2EJ9 A;  4M78 G;  4C92 C;  2ART A;  4RQE A;  3JCM V;  3JCM X;  4JUV A;  4LNS A;  2AKW A;  4CH5 A;  4JLI A;  1ASY A;  1B7Y A;  3IAL A;  2DZ9 A;  4WF2 A;  3UFG A;  3P8V A;  2VXF A;  4PJO D;  2YHT A;  4HA8 A;  4EX5 A;  2ZNJ A;  4XTY A;  4JRK A;  3JCM h;  3HFZ A;  4C92 F;  2ZCE A;  3SWN A;  1ASZ A;  3BY7 A;  2DEQ A;  4YRL A;  3AHU A;  2FYK A;  1N9R A;  4YRQ A;  4AH6 A;  2C8M A;  2QTX A;  2PME A;  4F7U B;  4K88 A;  2ZGW A;  5LJ5 g;  3REX A;  4M7A B;  2ZT7 A;  4YRI A;  4TTV A;  4F7U E;  1ADY A;  1E1O A;  4YRP A;  2EJG A;  4YRT A;  1LOJ A;  4C92 B;  1FYF A;  5LJ3 g;  4J6X A;  4M75 B;  3L4G B;  4UP8 A;  4M7A G;  3HXZ A;  5GMK e;  4YRN A;  4P75 A;  4HWR A;  4PG3 A;  3M4P A;  3WQZ A;  4M77 C;  4TQD A;  5LJ5 h;  2ODR C;  4Q15 A;  1H4Q A;  1M5Q 1;  3JB9 I;  3PGG A;  4ZTZ B;  4P3O A;  1H64 1;  1YFT A;  4WJ4 A;  2CJB A;  3QO7 A;  1E22 A;  5LJ5 d;  2DJZ A;  1KQ2 A;  2ZT5 A;  3L4G A;  4Y91 A;  3JCM W;  1KOG A;  2QHS A;  3JB9 D;  1WYD A;  1B76 A;  4CS2 A;  2E3C A;  1X2G A;  3UGQ A;  3M4G A;  4UP9 A;  2Y90 A;  3BDU A;  5GAM h;  4C8Q E;  4DPG A;  1X55 A;  2IY5 B;  1E24 A;  3JB9 H;  2EJF A;  4XU2 A;  3I7F A;  3JCM J;  4C8Q B;  1EOV A;  1NYQ A;  4M77 A;  1VQZ A;  3OD1 A;  5GMK i;  2I4L A;  3UH0 A;  4EMK C;  2ZIN A;  4RCB A;  4YDQ A;  4HWS A;  4BWA A;  3QO5 A;  2I2L A;  5KNN A;  2ZZG A;  3E9I A;  4PJO G;  3HRK A;  1HXD A;  1I5L A;  2JN0 A;  1NYR A;  4PHC A;  3TEH A;  3P8Y A;  2ARU A;  1WU7 A;  4XTX A;  2Q7G A;  2CJA A;  5GAO q;  4C8Q A;  3HY0 A;  5GAN f;  4C8Q F;  3BJU A;  5LJ3 f;  3JB9 F;  2CGH A;  3RUX A;  3NEM A;  1B34 B;  4PJO C;  4NCX A;  4TQF A;  2QHT A;  1IL2 A;  2EWN A;  2DU7 A;  4F7U F;  3MF2 A;  4CH3 A;  3TEH B;  5GAN 2;  1I4K 1;  1C0A A;  4M7D G;  3IKL A;  5GAN 8;  5K1P A;  1I8F A;  4M75 G;  1YB3 A;  3V7R A;  2CIM A;  1QE0 A;  2XGT A;  4YCU A;  4J6Y A;  4KR2 A;  4CH4 A;  2DXU A;  5LJ3 e;  4XEO A;  1Z7M A;  4RCC A;  2ZT6 A;  3RIR A;  3VQY A;  5K1X A;  4H02 A;  1B8A A;  1G51 A;  4YRJ A;  1E1T A;  2RB6 A;  3A31 A;  2DU5 A;  2I4O A;  3V8K A;  4K86 A;  4X5O A;  1L0W A;  1D3B A;  1W66 A;  3VQV A;  3P8T A;  1BIA A;  2P5I A;  1LYL A;  3DSQ A;  3QO3 A;  3L2Z A;  5LJ5 j;  2DVE A;  3QUI A;  1PYS A;  5LJ3 h;  3E9H A;  1JJC A;  3SWN C;  1JJC B;  4HWO A;  2Q5H A;  4YCV A;  11AS A;  4QVC A;  2E5A A;  4YPF A;  4CS4 A;  4M77 B;  5LJ3 j;  1TH7 A;  1YFR A;  3HXV A;  4M75 A;  2EAY A;  4M7D E;  4HWP A;  1EIY B;  2YLC A;  4PNO A;  4L87 A;  5C53 B;  3NEL A;  1EFW A;  2ODR D;  4WJ3 M;  1WLE A;  1X56 A;  4M77 D;  1SES A;  1B70 A;  4YRM A;  4BW9 A;  4YRO A;  3JCM e;  1EQR A;  3JCM b;  4H2U A;  2DKG A;  1NJ8 A;  4HT8 A;  4OP0 A;  2E65 A;  3JB9 J;  2CJ9 A;  4YRF A;  4UP7 A;  3PZC A;  3FJP A;  4EO4 A;  4EMK B;  4YRK A;  1BBU A;  1WQW A;  2QHV A;  4TVY A;  1JBM A;  4M7A E;  4M78 A;  2VXE A;  4XU0 A;  4M77 G;  1SET A;  2G4C A;  4CS3 A;  3V7S A;  1YGB A;  4KQE A;  1RIQ A;  4M75 E;  2E1H A;  3EFR A;  4C92 E;  4NOY A;  4TVW A;  1NJ1 A;  3L1A A;  3UGT A;  4XU3 A;  4P73 C;  4RDX A;  3LC0 A;  4EMK A;  3A32 A;  4P3N A;  5GAN 5;  5HGQ A;  3TUP A;  4G84 A;  2ZR3 A;  1QF6 A;  4C8Q D;  4Q6G A;  4YYE A;  5LJ5 e;  1KQ1 A;  4H2X A;  5GAN g;  4N0A A;  4H2X B;  5F5W A;  4C92 D;  1NJ2 A;  5ELN A;  1N9W A;  1WPY A;  4P72 C;  3FIF A;  2AKW B;  3QNE A;  3V8J A;  5GAO r;  3RGL A;  4WI1 A;  4PJO A;  4EMG A;  2AMC B;  3HY1 A;  2ZIM A;  2DDZ A;  3BFM A;  3NEN A;  1D3B B;  1EVL A;  1YCY A;  4K87 A;  4P74 C;  5GAO m;  2ZNI A;  1H4S A;  5GMK l;  4M7D B;  2HNI A;  4OLF A;  3W3S A;  4F7U G;  3RES A;  4M77 E;  1KMN A;  3HXU A;  5ELO A;  4M7D F;  2I4N A;  1M8V A;  3A7R A;  4NL3 A;  4ZIB A;  3JCM Q;  3KFU A;  3INZ A;  3IG2 A;  1GGM A;  1JRI A;  3HFZ B;  2ZR2 A;  4M75 F;  4E51 A;  1HTT A;  4O2D A;  4P75 C;  2DTH A;  4N0A C;  2RHS A;  2EL9 A;  4M7D D;  1ATI A;  4YRR A;  3JCM g;  3HFV A;  5GAO n;  1X54 A;  2J3M A;  3PCO A;  3EFS A;  1SER A;  4XU1 A;  3PCO B;  3JCM f;  4XEM A;  4P71 A;  4H2S A;  3A74 A;  2C7I A;  3A5Y A;  1Y96 B;  5GAM j;  3R07 A;  1NJ5 A;  2DZC A;  2XTI A;  5GAN 6;  3QSU A;  2RHS B;  3HTZ A;  3HXY A;  4UPA A;  1EIY A;  4J6W A;  1LNX A;  3A7U A;  1BBW A;  4RQF A;  2Q7H A;  2RHQ B;  3HFN A;  2DTI A;  2RHQ A;  1U1T A;  1X01 A;  2IY5 A;  2ALY A;  3HXW A;  3G1Z A;  4MML A;  4M78 F;  2ZT8 A;  3RAC A;  5GAM g;  2VC8 A;  3QO8 A; 
#chains in the Genus database with same CATH topology
 4CC2 A;  2LZ6 B;  2ZZE A;  1QVF P;  5GAO l;  3S6W A;  2K4Y A;  1KD1 U;  1VQO Q;  3LX7 A;  4P71 C;  1IB8 A;  1BI0 A;  2JTM A;  1S1N A;  1JU5 C;  1U06 A;  5CKH A;  4C92 G;  3A7A A;  2QA4 T;  2COZ A;  2DQ3 A;  5DLO A;  2ZTG A;  3HP9 A;  4AFS C;  3VU3 C;  1Q7Y U;  1OOT A;  3FC3 A;  3JCM P;  1IHV A;  3CPW A;  2RA2 A;  2QXF A;  1YI2 T;  3J80 E;  1NZ9 A;  1Q82 R;  1HD3 A;  2ARS A;  3AT1 B;  3MHX A;  2HSP A;  1XQH A;  3JCM c;  3RF1 A;  1HC7 A;  1IRX A;  2LT4 A;  4A54 A;  3PVL A;  1RAH B;  4M7A F;  1R0B G;  1I81 A;  3OYF A;  2K5F A;  2RHX A;  2A28 A;  3OW2 A;  3QHS A;  5LJ3 d;  1BKB A;  5I22 A;  4Z02 A;  2P4T A;  5C51 B;  3EH1 A;  4DBR A;  2K79 A;  4J9G A;  2DL4 A;  5D6Y A;  2HAX A;  2XI9 A;  5KYW B;  3A8H B;  4H2Y A;  2ZPH B;  4MMK A;  1Q82 C;  2J3L A;  4YRE A;  2D0N A;  4R0K A;  4HVC A;  1ADJ A;  1YHQ A;  2KRO A;  2LX9 A;  1XOV A;  4P3P A;  1Z9Z A;  2DXT A;  5GAO p;  2QEX T;  1OX8 A;  2V26 A;  3OSS C;  2YLB A;  3CCQ A;  1USY A;  3MPU B;  2NLU A;  1GL5 A;  2FZG B;  2RN8 A;  1K73 R;  1WLP B;  4JRQ A;  3CCV A;  2D1X A;  4RTV A;  1Z7N A;  4M7D A;  4KR3 A;  1QQJ A;  4ATO A;  3GLX A;  1M9S A;  2DFU A;  4TVR A;  2DL5 A;  1Q95 G;  2HBW A;  2CH4 W;  3VQW A;  4EIK A;  3L2V A;  4FU6 A;  3TEG A;  3RER A;  3TSZ A;  5DY9 A;  1YFS A;  3JCM d;  3I56 T;  1B70 B;  3QKJ A;  4C92 A;  2HBP A;  4XTU A;  2E4H A;  2SRC A;  5GMK m;  3CCE T;  2ALY B;  3A5Z A;  2JS2 A;  5GAN e;  2YRD A;  4X9D A;  2Q5I A;  3MKD A;  2COY A;  1VYV A;  2VKN A;  1ZSZ C;  1H4V B;  3OB9 A;  4FSX A;  2F1L A;  3CME Q;  1QW1 A;  1YI2 A;  1G2B A;  5IXB A;  4FYW B;  3N5B B;  3PNW C;  2A0F B;  3Q1J A;  1BYM A;  5FU7 B;  4XQ3 A;  4RTW A;  3M4Q A;  2EYZ A;  5GAM d;  1WQ7 A;  2F5T X;  2OTJ T;  3OYC A;  3WVE B;  1PC0 A;  2H3E B;  1MV0 B;  2PUK B;  4LNS A;  1B7Y A;  4VUB A;  4E7L A;  3IAL A;  2DZ9 A;  3UFG A;  3P8V A;  3CPW S;  1EZZ B;  2DYB A;  4IKF A;  1MUZ A;  2A36 A;  4HA8 A;  3FRN A;  4JRK A;  3JCM h;  3M55 A;  3BY7 A;  4YRL A;  3QWX X;  3CPW P;  2E12 A;  4J83 A;  1FXX A;  2QTX A;  1YWO A;  2CP6 A;  1B07 A;  1WI7 A;  5KCO A;  1W2B P;  1KC8 R;  4Z89 A;  3EGX A;  1F1B B;  1WJS A;  3RMQ A;  1E1O A;  2O4X A;  2QQ9 A;  3L4G B;  2RI5 A;  3VS3 A;  2XDB A;  1N5Z A;  1WHJ A;  1WYX A;  1ZBX A;  4M77 C;  4TQD A;  4JLG A;  4LVM A;  5LJ5 h;  2ODR C;  3QXE B;  1M5Q 1;  2CSQ A;  3PGG A;  4WJ4 A;  1RLP C;  2EKH A;  4FYY B;  4LD9 K;  3UAT A;  1M8M A;  3A98 A;  1M90 C;  2QAZ A;  3OYJ A;  1AVZ C;  3TSW A;  1UGV A;  3M5A A;  5C6S A;  3CCQ Q;  1WYD A;  1YNZ A;  1LCK A;  1UGQ B;  2CT3 A;  5KYX A;  2E3C A;  3BDU A;  5KYX B;  5D7U A;  4DPG A;  1OZ2 A;  4A4K A;  4LUE A;  2XD0 A;  5I11 A;  1EOV A;  4KGZ B;  1NYQ A;  1VQZ A;  1OU9 A;  3OD1 A;  3OY9 A;  1GFD A;  4EMK C;  1RI0 A;  2QQB A;  3E9I A;  4PJO G;  1HXD A;  3GF5 A;  3EG1 A;  2H3J A;  3A5Z B;  2RQT A;  3FDR A;  3CC4 A;  3TEH A;  3G71 A;  1Y0M A;  2VAS A;  3H6Z A;  4C8Q F;  3BJU A;  5IHI A;  4ME7 A;  1U3O A;  4OMF B;  4PJO C;  2HKN A;  3UF4 A;  2RJC A;  1FMK A;  2QHT A;  1KHC A;  2EWN A;  2YRV A;  2FRY A;  3MF2 A;  1M3B A;  1M2V B;  4M7D G;  3KFV A;  2QI2 A;  4JJC A;  3VS1 A;  1SSF A;  2D9T A;  3H0F A;  2OTJ A;  1XNI A;  5L23 A;  4DEX A;  1R0C B;  2OAU A;  1D0Z A;  1K1Z A;  5FRN A;  4XEO A;  3GNG A;  2CP5 A;  4IIO A;  1SF9 A;  2ZT6 A;  2ZPI B;  3I55 Q;  4KT0 E;  2ESW A;  1X6B A;  2EYX A;  1VQK Q;  2DBK A;  4B9X A;  2DL3 A;  1JJ2 A;  2I4O A;  3V8K A;  2GGR A;  2QAS A;  3GNF B;  1D3B A;  3VQV A;  3HHT B;  4E7H A;  3L2Z A;  3QUI A;  1M1K C;  2LTO A;  5FU6 B;  2DNU A;  3E9H A;  1JJC A;  1OX9 A;  3SWN C;  1JJC B;  4Y28 E;  5A2Q E;  2CSI A;  3VS4 A;  2Q5H A;  4YCV A;  3H8Z A;  3CD6 A;  2E5A A;  4YPF A;  2O4X B;  2RNA A;  3L2R A;  3HXV A;  2K7A A;  1K4U S;  1EIY B;  4HWP A;  1KJW A;  5GJW B;  1M3C A;  1VQ4 Q;  2ODR D;  4M77 D;  4RTZ A;  4F04 B;  3CC2 A;  1SES A;  1VQO T;  1X69 A;  3CCE A;  2DX1 A;  2JZ2 A;  2DJQ A;  1K73 C;  2VGM A;  3KXT A;  4ZN1 A;  3CC2 Q;  1IHW A;  1V29 B;  1G3Y A;  3JCM b;  1GBQ A;  4HT8 A;  4UP7 A;  2PVD B;  3FJP A;  2RQW A;  4QT7 A;  1VQM A;  1WQW A;  4HCZ A;  2IVW A;  3EFO B;  3M56 A;  3NGP A;  1KIK A;  2ECZ A;  1JBM A;  4M7A E;  2VXE A;  4M77 G;  2G4C A;  4CS3 A;  4DBQ A;  3V7S A;  2P4R A;  4M75 E;  2E1H A;  1H92 A;  4OMM A;  4C92 E;  3CD6 Q;  2D0Q B;  3PT9 A;  3VS0 A;  1NJ1 A;  2GCX A;  3UGT A;  3A1P A;  1ZSG A;  2O9V A;  4EMK A;  2BZY A;  2E5K A;  4OB3 B;  1X27 A;  1YJN A;  5GAN 5;  2MIO A;  4G84 A;  4C8Q D;  1ABO A;  5IH2 A;  1WFW A;  3CXC S;  5LJ5 e;  1QCF A;  4KUI A;  1WJR A;  1OPL A;  3CME T;  5IHN A;  4KUD K;  2VVK A;  1YIJ T;  1NJ2 A;  4ZTJ A;  4KRT A;  1EX4 A;  3OW2 S;  1B3Q A;  1RAC B;  2KQW A;  2KYM A;  2X51 A;  4PJO A;  2AMC B;  4OMO A;  3RR6 A;  1VQK T;  4O5V A;  2MWP A;  3SEM A;  2D6F A;  1Q82 U;  2L3P A;  1KK7 A;  4P74 C;  2ZNI A;  3MJX A;  2HNI A;  1NG2 A;  3LGL A;  3CCV T;  2MMP A;  2LDM A;  3VYG A;  1K8A C;  1M2O A;  5HK0 A;  4ZIB A;  1J3T A;  1GCQ C;  4O2D A;  2A7Y A;  1VQ8 Q;  4QW2 A;  4M7D D;  1VQ8 A;  1Y07 A;  4RG2 A;  2XG8 D;  1AWW A;  2GFU A;  4MZT A;  1M1K R;  3A8M B;  4FM4 B;  3A74 A;  3REA B;  5FRM A;  5GAM j;  2JMA A;  1NJ5 A;  3VS6 A;  4KBM B;  2XTI A;  3CCS T;  4QKU A;  2LRQ A;  1ACM B;  3HXY A;  4UPA A;  1EIY A;  1XTD A;  4D8D A;  4EPC A;  2AK5 A;  2L8D A;  3HPW A;  4GLK A;  4IIM A;  2DTI A;  2M0O A;  2MWO A;  3CC2 T;  1Y71 A;  1KG1 A;  3G7Z A;  1CSK A;  1I5O B;  5J3B A;  3PTA A;  3QO8 A;  2DL7 A;  4ELY C;  3G71 T;  2FB7 A;  4YP0 A;  2P0L A;  1YJN T;  1D09 B;  4X1V A;  4C0F A;  4A53 A;  4HWT A;  3JB9 G;  2GQV A;  2Y4Y A;  2J6F A;  4PFP A;  4V2S A;  2RD1 A;  4RTX A;  2LCL A;  5GMK j;  3VBB A;  1UDL A;  2YUP A;  4BB7 A;  4BE2 A;  2QHU A;  3I56 A;  1NEB A;  4C8Q G;  1RAF B;  3RKX A;  2K5L A;  3T9N A;  2K57 A;  2QG9 B;  1M4Z A;  4NL2 A;  2HCK A;  2KBT A;  4Q5W A;  4M7A A;  2V8K A;  5CVI A;  1K9M R;  1VQN T;  4J9B A;  1WXT A;  2DIQ A;  4C8Q C;  3QTC A;  1T3L A;  2DD5 A;  2ZPG B;  1B34 A;  4AMC A;  1QKX A;  3I55 A;  3LYI A;  3M57 A;  1LPL A;  1E6G A;  2VWF A;  4E47 A;  2C0I A;  1VQ9 A;  5GAN d;  2CP3 A;  3G1J A;  4RMO A;  1SRY A;  3QG1 A;  1Y96 A;  1Q86 R;  2DMO A;  4M7A C;  1G5I A;  2GFA A;  1KMM A;  4H2W A;  1M27 C;  2QGG A;  2HL3 A;  2IG0 A;  4RUG A;  5C52 B;  2K3Y A;  1N8R R;  3LSQ A;  3ICA A;  3A8L B;  2ENM A;  1HSQ A;  3OQ5 A;  2A37 A;  3M0P A;  5GAN 4;  2AMC A;  4M75 C;  2ED0 A;  3OSV A;  2HEQ A;  4EMH A;  5CKD A;  1K9M U;  4A4H A;  1WZO A;  2YDL A;  3BDL A;  3HXX A;  3PE0 A;  1FWZ A;  2M0Y A;  5CO7 A;  4LDX A;  2K9G A;  5HK3 A;  3MQZ A;  1ZX6 A;  2J6K A;  1H4T A;  3MP8 A;  1G5V A;  1UJY A;  5HCK A;  1YJ9 Q;  1NE8 A;  2EPD A;  3JSC A;  2ZZF A;  5KYU A;  2O31 A;  4X9C A;  1NJI U;  2QGF B;  1AZE A;  1N9S A;  3M9Q A;  2AHJ B;  1R8O B;  1TWB A;  1W1F A;  3VJP A;  2X3W D;  2FO0 A;  3OA6 A;  1TUC A;  2HMA A;  4ZTU B;  4C5H A;  1K0S A;  3NMZ C;  1USY C;  2DTO A;  1TS9 A;  3LWH A;  4M78 C;  2ZXF A;  4BY6 B;  3PIP A;  4XTW A;  2L3Q A;  3BW1 A;  4PLL A;  2DF6 A;  6AT1 B;  3NET A;  1E6H A;  4UC4 A;  1FMV A;  4C5G A;  3HRI A;  3G4S A;  4ZGE B;  4M78 G;  2R57 A;  3CCM A;  4C92 C;  2O2O A;  1C1A A;  3I5R A;  4LVJ A;  3JCM V;  1CKB A;  1MMG A;  3J81 E;  4JLI A;  4JDS A;  1I07 A;  2DPP B;  1NJI R;  4O6J A;  2RPN A;  1NLO C;  4PK4 A;  3CCJ T;  4PJO D;  1HYO A;  1UHC A;  1AWX A;  2F2V A;  4F17 A;  1ZUY A;  4XTY A;  2O88 A;  3HFZ A;  1VIE A;  3SWN A;  1KD1 C;  1YN8 A;  2DEQ A;  2NUP B;  2FYK A;  3E9G A;  1VQL T;  4YRQ A;  4K88 A;  3EG3 A;  4DA4 A;  5D6W A;  3REX A;  1G8X A;  5EG2 A;  4M7A B;  2F2X A;  4YRI A;  1OEB A;  3J7A F;  4F7U E;  2L89 A;  4C5I A;  2EJG A;  2D8H A;  3CBO A;  4OGE A;  3EH2 A;  3OYB A;  1FYF A;  4J6X A;  3I9Q A;  1BCO A;  1V1C A;  4L6V 5;  5GMK e;  2ZAE A;  3CCL A;  3KBG A;  4PG3 A;  4LDV A;  2ZPF B;  4ZTF A;  1PSE A;  1SHF A;  3M4Y A;  3P8H A;  1AWO A;  1FX7 A;  1K9A A;  1NLP C;  2VV5 A;  2YUQ A;  1N8R C;  3JB9 I;  2FRW A;  2P84 A;  2J06 A;  4P3O A;  4ZTZ B;  1H64 1;  1YFT A;  2QQR A;  3WXM B;  3URG A;  3QO7 A;  1WGS A;  3QZ5 B;  2R5A A;  1E22 A;  5CKF A;  5LJ5 d;  2DJZ A;  2V1R A;  1UTI A;  3SD4 A;  3M59 A;  1Z9Q A;  1X6G A;  4CS2 A;  4ZNX A;  2KNB B;  3M4G A;  1Q81 R;  2QEX Q;  4C8Q E;  3CD6 T;  2DYI A;  2IY5 B;  1SRM A;  3OYG A;  4MZP A;  1VQP Q;  2EJF A;  3JV3 A;  4HXJ A;  4M77 A;  4FYX B;  1VQ5 Q;  2I4L A;  2EQK A;  1UFF A;  2ED1 A;  4RCB A;  4YDQ A;  4HWS A;  5KNN A;  4CC7 A;  4AG1 C;  3HRK A;  1UEC A;  1I5L A;  2JN0 A;  1Q81 C;  1NYR A;  2LJ0 A;  1M2V A;  1VYT A;  2LC4 A;  2AT1 B;  1YIJ Q;  5GAO q;  4FCY A;  5DLQ E;  4C8Q A;  3OYD A;  3JB9 F;  3CCJ A;  3RUX A;  3NEM A;  3OBW A;  3JAM E;  4NCX A;  4TQF A;  1IL2 A;  2V8J A;  1QCN A;  2DU7 A;  3PFS A;  1I4K 1;  3IKL A;  4PKC C;  4E7J A;  2RI2 A;  3OS0 A;  4OF1 A;  4E7S A;  4M75 G;  2VYT A;  5HKC A;  1VQM T;  3OYK A;  1WIE A;  2XGT A;  4KR2 A;  1JJ2 S;  4CH4 A;  1O75 A;  2CUB A;  3CCU Q;  1OQK A;  2AKL A;  3RIR A;  3VQY A;  5K1X A;  2DE0 X;  4WCI A;  1YJ9 A;  2OTL T;  1E1T A;  1VQL Q;  3EGX B;  3HKS A;  2PZ1 A;  4YTL A;  3CBM A;  2DU5 A;  4J9C A;  1L0W A;  1BK2 A;  2K2M A;  1SEM A;  2P5I A;  3ME9 A;  3QO3 A;  1YJW Q;  1TXQ A;  3CCM T;  1UG1 A;  5CR2 A;  1GBR A;  4BY6 C;  1EFN A;  2DRM A;  1NBE B;  2B8A A;  5LJ3 h;  1PYS A;  5KYY A;  2GNC A;  1D1B A;  4XAX B;  3OYY A;  1M1F A;  2EFI A;  3RMS A;  5AT1 B;  1GXI E;  1YFN A;  5C0M A;  1NYF A;  1PKS A;  2NUT B;  4M7D E;  4Y92 A;  5C53 B;  1Q86 C;  1YWP A;  4WJ3 M;  2A3L A;  1WLE A;  1X56 A;  4KGV B;  4BE1 A;  3O8V A;  2X4J A;  1B70 A;  3CCR A;  2LNH B;  3CC7 A;  4A63 B;  3VS5 A;  4OB1 B;  2P0Q A;  1RI9 A;  2QTV A;  1SSH A;  1EQR A;  3CPF A;  4H2U A;  3LH5 A;  5A0G A;  4EMK B;  5IHK A;  1BBU A;  3MEV A;  4LE9 A;  3L42 A;  1MMD A;  4FSS A;  2K6D A;  1KQS S;  4M78 A;  2XK0 A;  4FW1 A;  1GRI A;  4CRI A;  3CCL T;  2FEI A;  1G83 A;  5AYF A;  1YGB A;  4KQE A;  1RIQ A;  1KC8 U;  4MZM A;  4NOY A;  4C5E A;  2JM8 A;  2AKK A;  4RDX A;  3OW2 P;  2JM9 A;  3HTR A;  2XID A;  4YYE A;  4Q6G A;  1QF6 A;  3EG0 A;  3OS1 A;  4H2X A;  1VOM A;  2DET A;  3QJY A;  1BU1 A;  3CMA A;  4H2X B;  5KE3 A;  1WX6 A;  1ZBJ A;  5ELN A;  1Y7X A;  1WPY A;  2AKW B;  3RGL A;  3V8J A;  5GAO r;  2BZX A;  2M51 A;  3BFM A;  1D3B B;  4HVV A;  1KQS P;  5GAO m;  2O9S A;  1H4S A;  1CKA A;  3QBY A;  3CMA T;  3W3S A;  4OLF A;  4F7U G;  2L5Q A;  2C0O A;  1W2B A;  2DBM A;  1RUW A;  1AOJ A;  2BTT A;  3CCV Q;  2QK0 A;  4M77 E;  3VRY A;  1KMN A;  3HXU A;  2HL5 C;  1M8V A;  3QYH B;  4NL3 A;  3KFU A;  3CXC P;  1GGM A;  1JRI A;  4LDY A;  4JRP A;  4P75 C;  2DTH A;  8ATC B;  3HFV A;  1QVG A;  2J3M A;  3EFS A;  4CC3 A;  1SER A;  3UPU A;  4HVU A;  4L59 A;  4H2S A;  3ZFJ A;  5KCH A;  4HCC A;  4JZ3 A;  2OI3 A;  2DZC A;  4J9I A;  2RHI A;  5GAN 6;  2NUT A;  4PJL A;  1LNX A;  3E9F A;  4J7F A;  4DOV A;  2RHQ B;  4AFU C;  3HFN A;  3SDZ A;  1SG5 A;  2RHQ A;  1U1T A;  2FPD A;  3QYG B;  3G1Z A;  4MML A;  4HCK A;  3OYL A;  4DEY A;  2JNG A;  2VC8 A;  3X26 B;  4BDY A;  4Z88 A;  1VQ6 T;  3RKW A;  2E3H A;  1OYX A;  1VQ4 T;  3LSS A;  1UGR B;  1QVF A;  2AIR B;  3MET A;  2CZ7 B;  5GAN j;  1VQ7 T;  1BIB A;  2Z0W A;  5GAN 7;  4B6M A;  1QMC A;  4M78 B;  3TCJ A;  1K76 A;  2FHD A;  3MEY A;  1FYN A;  3HRU A;  2XDD A;  3GP8 A;  2PVO B;  2A8E A;  2RJD A;  4CC4 B;  1XJW B;  3I55 T;  1VQ6 A;  1NEG A;  1ARK A;  4HVW A;  1D0Y A;  2PNI A;  2LP5 A;  4XTV A;  5KH6 A;  1YIT A;  4K11 A;  2ZIO A;  2QYZ A;  2KYB A;  4OB0 B;  5CKB A;  2ZPE B;  2X9H A;  4M77 F;  1YBY A;  4J5Y A;  2LJ1 A;  4F7U A;  3X28 B;  3M0T A;  3P8D A;  2QA4 A;  1KHI A;  4M78 E;  3ZL7 C;  4JRI A;  2COW A;  4Z8A A;  2Y4X A;  3OMG A;  2KR3 A;  4KUL A;  5FU6 C;  5GMK h;  1WNL A;  2WAC A;  1S72 Q;  2EGC A;  1BB9 A;  1B7Y B;  5GAN h;  4XTZ A;  5I21 A;  4YRS A;  4OVA A;  2K3B A;  4PJO E;  3NPF A;  4M78 D;  2DL8 A;  4QQG A;  3OYA A;  3QJ6 A;  3R6O A;  3X20 B;  2I4M A;  2E70 A;  4IUT A;  1AEY A;  2F5K A;  4TVA A;  3WVD B;  2RK1 A;  1VYU A;  4TVA B;  1RAB B;  4OMN A;  3CCM Q;  3MEW A;  2CZ1 B;  4AFQ C;  2PU9 B;  4JPB W;  1X6O A;  1SHG A;  4LVK A;  4PJO F;  4P74 A;  1NNH A;  2DK3 A;  1AZG B;  3NHN A;  4G85 A;  4TWA A;  3VS7 A;  1ZSZ B;  1BCM A;  3RL6 A;  1MGQ A;  2YUN A;  5CQY A;  3HFO A;  1BI1 A;  3ERR A;  3OYH A;  4PJN A;  2AZS A;  2JMC A;  4M75 D;  2PMF A;  4RMF A;  4ANJ A;  2HKQ B;  1HK9 A;  2CZ0 B;  4J15 A;  1NJ6 A;  3IKM B;  2A08 A;  3OBY A;  2JJ9 A;  2PQW A;  3CCU T;  4H2V A;  4CH6 A;  4D8K A;  3G71 Q;  1M90 R;  3DB3 A;  2OTL Q;  5GAM e;  2EJ9 A;  4R55 A;  1T3S A;  1RL2 A;  2KE9 A;  4PFZ A;  2NUP A;  3G4S Q;  3JCM X;  4QQD A;  1Q7Y C;  1W70 A;  4CH5 A;  1ASY A;  1ZUU A;  5CCA A;  2P0K A;  1VIF A;  3E1S A;  1M1G A;  2YHT A;  3CCJ Q;  2H8H A;  2YUO A;  4E7I A;  1RLQ C;  4C92 F;  3EGD B;  4AT1 B;  2CYZ B;  1YHQ Q;  2RI3 A;  1YIJ A;  3CC4 T;  2EBP A;  2MF2 A;  2C8M A;  2CRE A;  4F7U B;  2LCS A;  2ZGW A;  2XMF A;  3QDF A;  1PD0 A;  2KXD A;  4ESR A;  1R77 A;  2CS7 A;  4AG2 C;  4BE0 A;  1JB0 E;  3C4S A;  4TTV A;  1JXO A;  1ADY A;  1JEG A;  5IN1 A;  4YRP A;  4IUV A;  3I5S A;  4RG8 A;  2L3S A;  1WDX A;  4YRT A;  1LOJ A;  4C92 B;  5LJ3 g;  4M75 B;  4UP8 A;  4M7A G;  4YRN A;  4P75 A;  2XIC A;  3LH0 A;  3H0H A;  3M4P A;  2EQJ A;  3WQZ A;  1N27 A;  4BI8 B;  3A8O B;  2KDS A;  2WSF E;  3IQL A;  3VKI A;  2ZZD A;  1ZA1 B;  2DAQ A;  5D6X A;  4Y91 A;  1KOG A;  2QHS A;  3JB9 D;  1YJN Q;  2QDL A;  3VRZ A;  1B76 A;  3X25 B;  3I56 Q;  3CCL Q;  1IGU A;  2JVV A;  1X2G A;  3UGQ A;  2Y90 A;  2YRC A;  1W2B S;  1PSF A;  2PTK A;  3ASK A;  1X55 A;  3JB9 H;  3S3N A;  3I7F A;  2BE9 B;  4C8Q B;  4BI3 A;  3QDR B;  5GMK i;  1QP2 A;  4M4Z A;  3UH0 A;  2ZIN A;  4LNP A;  1OV3 A;  2MOX A;  4BWA A;  4R56 A;  2ZZG A;  1M30 A;  3EHR A;  4PHC A;  2ARU A;  1WU7 A;  4XTX A;  5CK9 A;  4PJM A;  4RKU E;  2DEU A;  1OZ3 A;  1VQ9 Q;  3TEE A;  5GAN f;  2CGH A;  5CKE A;  1N8R U;  1QP3 A;  3REB B;  1ZHI A;  3PMT A;  1EIF A;  1PD1 A;  2XKO C;  4CH3 A;  1PNJ A;  2NUZ A;  5GAN 2;  5GAN 8;  1NM7 A;  3EFO A;  1NJI C;  2O01 E;  4OGC A;  1UB4 A;  2RHU A;  2CIM A;  4NS5 A;  5IAY A;  4JZ4 A;  4XK8 E;  2QA4 Q;  4J6Y A;  2BIV A;  3EG2 A;  4KH1 B;  2DXU A;  2JT4 A;  2PUO B;  2RQU A;  2HD0 A;  3MCA B;  4CI0 C;  1K8A U;  4H02 A;  1YI2 Q;  4YRJ A;  2MCN A;  3ULR B;  2RB6 A;  2V1Q A;  1YIT Q;  3PMI A;  2ROL A;  3CQT A;  4X5O A;  1AHJ B;  2M1H A;  1W66 A;  3PVQ A;  4JJD A;  1W6X A;  1LYL A;  2JTE A;  3DSQ A;  4EDU A;  3GPL A;  1VA7 A;  4GLM A;  1HJD A;  4LDW A;  4PFO A;  11AS A;  2RK2 A;  3L2U A;  4KGX B;  5LJ3 j;  3EGD A;  1YFR A;  4M75 A;  2KMT A;  2EAY A;  2DXB A;  1QLY A;  1YP5 A;  1BBZ A;  2HQH A;  1IGQ A;  5IT9 E;  3H0I A;  2ZCF B;  4F14 A;  3CCS Q;  1MNE A;  1YCS B;  1D1C A;  3THK A;  1UGS B;  2HQE A;  4YRM A;  2CZ6 B;  4BW9 A;  1SRL A;  4RTU A;  3LLR A;  3CCR T;  1PRM C;  2DD4 A;  2JS0 A;  5HY6 A;  2DKG A;  1NJ8 A;  3JB9 J;  4YRF A;  1H8K A;  2KGT A;  2LT1 A;  4LXC A;  1IXD A;  4YRK A;  5J39 A;  3D7S B;  2W10 A;  2QHV A;  4DBH A;  3MEA A;  2DVJ A;  4TVY A;  2P0P A;  1X2Q A;  4MDW A;  4JS5 A;  3OMC A;  2IIM A;  1D1A A;  3L1A A;  1VQP T;  1KSW A;  4XU3 A;  4JS4 A;  3CCE Q;  4MDX A;  5FWC A;  3DKM A;  2X35 A;  3CEY A;  4P3N A;  5HGQ A;  3TUP A;  2EYW A;  2LQK A;  2ZR3 A;  3M0U A;  1TG0 A;  1KQ1 A;  2OX7 A;  4BAC A;  4N0A A;  1G3W A;  2LJ3 A;  4C0D B;  1PRL C;  4E7Z A;  2M16 A;  1VQN Q;  1OU8 A;  4P72 C;  2BUD A;  3FIF A;  1U8R A;  1UUE A;  5A0L A;  1I1J A;  2MI6 A;  2B86 A;  3G6E T;  4ELZ C;  2VGN A;  3ER0 A;  3NEN A;  1Q81 U;  1EVL A;  4LUD A;  4K87 A;  2HQX A;  5GMK l;  4HCB A;  4GBQ A;  2DXC A;  2RJE A;  2KY9 A;  2NYS A;  3CMA Q;  2R58 A;  3RES A;  1VQM Q;  3BE3 A;  2ABL A;  2D8J A;  1RAI B;  4M7D F;  2AZV A;  4FT4 A;  5KYW A;  4HKE A;  5J26 A;  3DLM A;  3INZ A;  3HFZ B;  4E51 A;  4M75 F;  3CXC A;  2EKO A;  1PWT A;  2EL9 A;  1ATI A;  4YRR A;  2L3R A;  2J05 A;  1GFC A;  4JJB A;  1QVF S;  4XU1 A;  3JCM f;  2C0T A;  1LVK A;  1RAA B;  3QWY A;  1Y96 B;  1VQ5 T;  3M0S A;  1ZUK A;  2ROT A;  3F70 A;  1YJW T;  2RMO A;  2CKK A;  2DIL A;  2RO0 A;  2RJF A;  1QWE A;  2YSQ A;  3QSU A;  2RHS B;  1AT1 B;  1BBW A;  2KXC A;  4QQ6 A;  2IY5 A;  3CCR Q;  2EQU A;  1VQ7 A;  2M9U A;  3OS2 A;  2W0Z A;  3HXW A;  2X4X A;  2OJ2 A;  4A4F A;  4JJN K;  3RAC A;  4DBF A;  3CME A;  1GCQ A;  3HRS A;  2CH4 A;  1VQN A;  2LQN A;  2L0A A;  3KUF A;  3HSB A;  3MF1 A;  5LJ5 f;  3C95 A;  1MV3 A;  2CP0 A;  4YCW A;  2K5I A;  4QVZ A;  5EC7 A;  1P92 A;  3M58 A;  2ATC B;  3G4S T;  4PJO B;  1VQK A;  3OYN A;  1QWF A;  4J8O A;  5GAN 3;  1OPK A;  4P5N A;  3EAE A;  1H3H A;  2KSS A;  4D6W A;  2C06 A;  2RHZ A;  1TSF A;  2MPX C;  1KFZ A;  2CP2 A;  1WHL A;  2RF0 A;  3S3O A;  4M7A D;  4FYV B;  1QKW A;  2GF7 A;  3FB9 A;  3ZEH A;  1J5W A;  2SEM A;  1TU0 B;  3SB2 A;  1VQL A;  1G3S A;  2KK4 A;  4P72 A;  4RTT A;  5CAI A;  5L8R E;  2V8I A;  1QCO A;  4IUR A;  4LD6 A;  3L2W A;  2E64 A;  2EVR A;  5FW9 A;  1SPK A;  1M90 U;  2WSC E;  4ORZ A;  1X75 C;  2YT6 A;  5E3I A;  1T0H A;  2DRK A;  4F16 A;  3CCS A;  1KC8 C;  3R6N A;  1WJQ A;  4AFZ C;  3C94 A;  3VQX A;  3NTH A;  2RQR A;  4YRG A;  1W4S A;  4YRC A;  2BKD N;  3V7C A;  1MHN A;  5KYN A;  1DJ7 B;  2XDP A;  2NWM A;  1PYS B;  3E2U A;  2QQS A;  4P73 A;  2VUB A;  2E10 A;  2FZK B;  2MAM A;  3CCQ T;  3UWN A;  3ZBD A;  2DLP A;  4OMP A;  4HT9 A;  3VV0 A;  3VUB A;  1KQS A;  2J6O A;  3SWN B;  1VUB A;  1TUG B;  12AS A;  1VQ4 A;  1EVK A;  3RNJ A;  1RAD B;  3PIO A;  3CMQ A;  2HSE B;  3V8L A;  1G5H A;  2RM4 A;  5KYY B;  2E41 A;  1ZSZ A;  4QVD A;  1VQ5 A;  3P8B B;  3REU A;  5GJV B;  4DQ2 A;  2LQ8 A;  1U1S A;  4A4G A;  3SFM A;  5FLX E;  1KD1 R;  2RQV A;  4BI4 A;  2CDT A;  2KRM A;  3LWI A;  1X43 A;  3X24 B;  1RAE B;  1BI2 A;  1PCX A;  2K3X A;  2Q7E A;  3GIB A;  1N6A A;  1AWJ A;  3EHQ A;  2G3R A;  1Q7Y R;  1WHM A;  3FLG A;  2FZC B;  2DA9 A;  4FW2 A;  1X2H A;  1OUL A;  2ZPB B;  3RKY A;  2JW4 A;  4ZN3 A;  1LJO A;  2X4W A;  3OYI A;  4PLI A;  3TU4 K;  9ATC B;  4H2T A;  4E2F B;  5GAM f;  3CC7 T;  2DQ0 A;  2OAW A;  2KVQ G;  4M7D C;  1ZLM A;  1WHG A;  2M02 A;  3MP6 A;  1NPP A;  1IZ6 A;  1UJ0 A;  3VS2 A;  2OTJ Q;  2ART A;  4RQE A;  1WXU A;  1ABQ A;  3TRE A;  4JUV A;  3LGF A;  2AKW A;  1OI1 A;  3G6E A;  4PJJ A;  4WF2 A;  2KEA A;  2VXF A;  1C6V X;  4EX5 A;  1K0X A;  2ZNJ A;  2NS6 A;  1GCP A;  2YXY A;  2ZCE A;  1ASZ A;  2I0N A;  3AHU A;  5CQX A;  3H41 A;  4BUG A;  3CC4 Q;  1N9R A;  4AH6 A;  4BD3 A;  2PME A;  5LJ5 g;  5DM7 R;  1K73 U;  4J9H A;  5CIU A;  3OYM A;  2ZT7 A;  2JOY A;  3A8G B;  3DLL A;  3JRZ A;  4E7K A;  3OS5 A;  1JXM A;  2EGE A;  2LNV A;  3NFC A;  5FWB A;  4J9F A;  3HXZ A;  3QPH A;  1QVG P;  4HWR A;  1Q86 U;  1SKU B;  2XHC A;  1RAG B;  1YJW A;  4IUQ A;  2HZY A;  4Q15 A;  1H4Q A;  2QQA A;  1TUD A;  1QVP A;  5KE2 A;  2CJB A;  2JXB A;  1KQ2 A;  2ZT5 A;  3L4G A;  3JCM W;  2LCC A;  1MMN A;  1VQ7 Q;  4UP9 A;  2KAF A;  5GAM h;  3UDC A;  2GBQ A;  1E24 A;  2CP7 A;  3M54 A;  4XU2 A;  1TTH B;  4LN2 A;  3JCM J;  2DER A;  4WTO B;  3QO5 A;  2I2L A;  3HL8 A;  4LVI A;  2MK5 A;  4LVL A;  3P8Y A;  1X2K A;  2JTF A;  4IUU A;  4ZGJ B;  2Q7G A;  2CJA A;  2IPO B;  1UEB A;  1Y57 A;  3HY0 A;  1VQ9 T;  5I2M A;  5LJ3 f;  2VB6 A;  1M1K U;  2EGA A;  5LL6 S;  1B34 B;  1TOV A;  4OB2 B;  3VUZ A;  3TQ7 P;  4J7I A;  5FRO A;  3G6E Q;  4F7U F;  2EQM A;  4E6R A;  7AT1 B;  3TEH B;  5I2S A;  1S72 A;  3M0Q A;  1C0A A;  3TVT A;  2GTJ A;  2EIF A;  5K1P A;  4FT2 A;  3RBB B;  3LW5 E;  1I8F A;  2PVG B;  3RDV A;  1C0M A;  1YB3 A;  3V7R A;  1MMA A;  1WHH A;  1UGP B;  2LQW A;  3UA7 A;  2FVU A;  2KT8 A;  1QE0 A;  4YCU A;  1VQP A;  4II1 A;  5LJ3 e;  2X3X D;  3QZ9 B;  1Z7M A;  4RCC A;  2G6F X;  2CUD A;  1U5S A;  1VQ8 T;  1B8A A;  2CT4 A;  2JUF A;  1G51 A;  2J7I A;  1VQO A;  3A31 A;  2BE7 D;  3O5Z A;  4K86 A;  4C0Z A;  2WSE E;  3P8T A;  1BIA A;  3M0R A;  5IXF A;  2LX7 A;  5LJ5 j;  1PG5 B;  4LDU A;  2DVE A;  2DIG A;  3MEU A;  3FJ5 A;  4C0G A;  2F69 A;  5FU7 C;  2LMJ A;  4HWO A;  4J9E A;  2E5Q A;  1PHT A;  1ZQ1 A;  3SHW A;  1YHQ T;  4OMQ A;  5M9O A;  4QVC A;  4CS4 A;  4M77 B;  1IRE B;  1TH7 A;  1D0X A;  2HDA A;  2YLC A;  4GY5 A;  1JO8 A;  4PNO A;  2DM1 A;  4L87 A;  3NEL A;  1EFW A;  2QDY B;  1UHF A;  3GBQ A;  1WHK A;  5KYU B;  1NYG A;  4KH0 B;  2RHY A;  1IO6 A;  4YRO A;  3E19 A;  3JCM e;  2FG0 A;  4L5G A;  4X34 A;  1I0C A;  4OP0 A;  2E65 A;  1FMW A;  2CJ9 A;  3PZC A;  4EO4 A;  2K2V A;  3NTK A;  1G3T A;  1E7O A;  1VQ6 Q;  1YJ9 T;  4FIB A;  2OTL A;  2XU8 A;  4XU0 A;  1SET A;  1BI3 A;  4B9W A;  3EFR A;  4TVW A;  3GOX A;  4P73 C;  1A0N B;  3LC0 A;  1NPR A;  1T0J A;  3A32 A;  3VYH B;  2LVM A;  3C12 A;  1JJ2 P;  3EG9 B;  5GAN g;  2EQI A;  3MO8 A;  3L2Q A;  2EYY A;  3EG9 A;  3MP1 A;  4C92 D;  5F5W A;  2YWW A;  4PL6 A;  1ZA2 B;  1PKT A;  4RTY A;  1N9W A;  3NTI A;  4ZGD B;  3QNE A;  3EGU A;  3DB4 A;  1K9M C;  4WI1 A;  2E6Z A;  3H9N A;  3U23 A;  4EMG A;  3HY1 A;  2ZIM A;  3CCU A;  2DDZ A;  3FEO A;  3UA6 A;  2KRN A;  1YCY A;  4N4I A;  4N4H A;  2F2W A;  2FPF A;  4OML A;  2L2P A;  3I35 A;  5A0D A;  4DOW A;  1MND A;  4M7D B;  1V76 A;  2KT1 A;  5ELO A;  1PM3 A;  1S72 T;  2I4N A;  4HT4 A;  3A7R A;  3S3M A;  3JCM Q;  4IUP A;  3IG2 A;  4J9D A;  1UE9 A;  2ZR2 A;  1HTT A;  4N0A C;  1O9S A;  2RHS A;  2BZ8 A;  2R5M A;  3JCM g;  5GAO n;  4BDZ A;  1X54 A;  3PCO A;  3HRT A;  2KI7 A;  1YIT T;  3PCO B;  4XEM A;  1WXB A;  2FL7 A;  4P71 A;  1B7T A;  1H3Z A;  1AD5 A;  2KRS A;  2EW3 A;  2C7I A;  3A5Y A;  2E3I A;  3R07 A;  3M53 A;  2FPE A;  3HTZ A;  1M3A A;  3QII A;  4A4E A;  4J6W A;  1JQQ A;  4C0D C;  3OYE A;  3A7U A;  4N4G A;  2GQI A;  4RQF A;  2Q7H A;  2RH2 A;  1X01 A;  5ECA A;  2ALY A;  3CC7 Q;  2GTO A;  2QEX A;  2X4Y A;  2DO3 A;  1QVG S;  2EYQ A;  3CBP A;  1WA7 A;  8AT1 B;  4FL6 A;  4M78 F;  2ZT8 A;  2E6N A;  2MYS A;  5GAM g;  3UT1 A;  3C0C A;  1K8A R; 
#chains in the Genus database with same CATH homology
 2ZZE A;  5GAO l;  3S6W A;  2K4Y A;  1KD1 U;  3LX7 A;  4P71 C;  1BI0 A;  2JTM A;  5CKH A;  4C92 G;  3A7A A;  2QA4 T;  2ZTG A;  5DLO A;  2DQ3 A;  3HP9 A;  3VU3 C;  1Q7Y U;  3FC3 A;  3JCM P;  3CPW A;  2RA2 A;  2QXF A;  1YI2 T;  3J80 E;  1NZ9 A;  2ARS A;  3MHX A;  1XQH A;  3JCM c;  3RF1 A;  1HC7 A;  2LT4 A;  4A54 A;  4M7A F;  1I81 A;  3OYF A;  2K5F A;  2RHX A;  3OW2 A;  3QHS A;  5LJ3 d;  1BKB A;  4Z02 A;  2P4T A;  5C51 B;  5D6Y A;  2HAX A;  2XI9 A;  3A8H B;  4H2Y A;  2ZPH B;  4MMK A;  1Q82 C;  2J3L A;  4YRE A;  4HVC A;  1ADJ A;  1YHQ A;  2LX9 A;  1XOV A;  4P3P A;  2DXT A;  5GAO p;  2QEX T;  3OSS C;  2YLB A;  3CCQ A;  1USY A;  2NLU A;  4JRQ A;  3CCV A;  1Z7N A;  4M7D A;  4KR3 A;  4ATO A;  3GLX A;  1M9S A;  4TVR A;  3VQW A;  3L2V A;  4FU6 A;  3TEG A;  3RER A;  5DY9 A;  1YFS A;  3JCM d;  3I56 T;  1B70 B;  3QKJ A;  4C92 A;  2HBP A;  4XTU A;  5GMK m;  3CCE T;  2ALY B;  3A5Z A;  5GAN e;  4X9D A;  2Q5I A;  1H4V B;  3OB9 A;  4FSX A;  1QW1 A;  1YI2 A;  3N5B B;  3PNW C;  3Q1J A;  1BYM A;  5FU7 B;  4XQ3 A;  3M4Q A;  5GAM d;  1WQ7 A;  2F5T X;  2OTJ T;  3OYC A;  3WVE B;  2PUK B;  4LNS A;  1B7Y A;  4VUB A;  4E7L A;  3IAL A;  2DZ9 A;  3UFG A;  3P8V A;  3CPW S;  4IKF A;  4HA8 A;  3FRN A;  4JRK A;  3JCM h;  3M55 A;  3BY7 A;  4YRL A;  2E12 A;  4J83 A;  1FXX A;  2QTX A;  5KCO A;  1WJS A;  3RMQ A;  1E1O A;  2O4X A;  2QQ9 A;  3L4G B;  2RI5 A;  2XDB A;  1ZBX A;  4M77 C;  4TQD A;  4JLG A;  4LVM A;  5LJ5 h;  2ODR C;  3QXE B;  1M5Q 1;  3PGG A;  4WJ4 A;  4LD9 K;  1M90 C;  3OYJ A;  3M5A A;  5C6S A;  1WYD A;  2E3C A;  1UGQ B;  3BDU A;  4DPG A;  1OZ2 A;  4A4K A;  2XD0 A;  1EOV A;  1NYQ A;  1VQZ A;  3OD1 A;  3OY9 A;  4EMK C;  1RI0 A;  2QQB A;  3E9I A;  4PJO G;  1HXD A;  3GF5 A;  2H3J A;  3A5Z B;  3FDR A;  3CC4 A;  3TEH A;  3G71 A;  3H6Z A;  3BJU A;  4C8Q F;  4ME7 A;  4OMF B;  4PJO C;  2RJC A;  2QHT A;  1KHC A;  2EWN A;  2YRV A;  3MF2 A;  4M7D G;  2QI2 A;  1SSF A;  2D9T A;  2OTJ A;  1XNI A;  2OAU A;  5FRN A;  4XEO A;  3GNG A;  2ZT6 A;  2ZPI B;  4KT0 E;  4B9X A;  1JJ2 A;  2I4O A;  3V8K A;  3GNF B;  1D3B A;  3VQV A;  3HHT B;  4E7H A;  3L2Z A;  3QUI A;  1M1K C;  2LTO A;  5FU6 B;  3E9H A;  1JJC A;  3SWN C;  1JJC B;  4Y28 E;  5A2Q E;  2Q5H A;  4YCV A;  3H8Z A;  3CD6 A;  2E5A A;  4YPF A;  2O4X B;  3L2R A;  3HXV A;  1EIY B;  4HWP A;  2ODR D;  4M77 D;  3CC2 A;  1SES A;  1VQO T;  3CCE A;  2JZ2 A;  1K73 C;  2VGM A;  3KXT A;  4ZN1 A;  1V29 B;  1G3Y A;  3JCM b;  4HT8 A;  4UP7 A;  2PVD B;  3FJP A;  1VQM A;  1WQW A;  2IVW A;  4HCZ A;  3M56 A;  1JBM A;  4M7A E;  2VXE A;  4M77 G;  2G4C A;  4CS3 A;  3V7S A;  4M75 E;  2E1H A;  4C92 E;  2D0Q B;  3PT9 A;  1NJ1 A;  2GCX A;  3UGT A;  4EMK A;  4OB3 B;  1YJN A;  5GAN 5;  4G84 A;  4C8Q D;  3CXC S;  5LJ5 e;  4KUI A;  1WJR A;  3CME T;  4KUD K;  1YIJ T;  1NJ2 A;  4ZTJ A;  3OW2 S;  2KQW A;  4PJO A;  2AMC B;  1VQK T;  4O5V A;  2MWP A;  2D6F A;  1Q82 U;  4P74 C;  2ZNI A;  2HNI A;  3CCV T;  3LGL A;  2MMP A;  2LDM A;  3VYG A;  1K8A C;  5HK0 A;  4ZIB A;  4O2D A;  2A7Y A;  4QW2 A;  4M7D D;  1VQ8 A;  1Y07 A;  4RG2 A;  2XG8 D;  2GFU A;  4MZT A;  3A8M B;  4FM4 B;  3A74 A;  5FRM A;  5GAM j;  1NJ5 A;  4KBM B;  2XTI A;  3CCS T;  2LRQ A;  3HXY A;  4UPA A;  1EIY A;  1XTD A;  4EPC A;  2L8D A;  3HPW A;  4GLK A;  2DTI A;  2M0O A;  2MWO A;  3CC2 T;  1Y71 A;  1KG1 A;  3G7Z A;  5J3B A;  3PTA A;  3QO8 A;  4ELY C;  3G71 T;  2FB7 A;  4YP0 A;  2P0L A;  1YJN T;  4C0F A;  4A53 A;  4HWT A;  3JB9 G;  2GQV A;  2Y4Y A;  4V2S A;  2RD1 A;  2LCL A;  5GMK j;  3VBB A;  4BB7 A;  4BE2 A;  2QHU A;  3I56 A;  4C8Q G;  3RKX A;  2K5L A;  3T9N A;  2K57 A;  1M4Z A;  4NL2 A;  4Q5W A;  4M7A A;  2V8K A;  5CVI A;  1VQN T;  4C8Q C;  2DIQ A;  3QTC A;  2DD5 A;  2ZPG B;  1B34 A;  3I55 A;  3LYI A;  3M57 A;  4E47 A;  1VQ9 A;  5GAN d;  4RMO A;  1SRY A;  3QG1 A;  1Y96 A;  4M7A C;  1G5I A;  2GFA A;  1KMM A;  4H2W A;  2IG0 A;  5C52 B;  2K3Y A;  3LSQ A;  3ICA A;  3A8L B;  3OQ5 A;  5GAN 4;  2AMC A;  4M75 C;  3OSV A;  4EMH A;  5CKD A;  1K9M U;  4A4H A;  3BDL A;  3HXX A;  1FWZ A;  5CO7 A;  4LDX A;  5HK3 A;  3MQZ A;  1H4T A;  3MP8 A;  1G5V A;  1NE8 A;  3JSC A;  2ZZF A;  4X9C A;  1NJI U;  1N9S A;  3M9Q A;  2AHJ B;  1R8O B;  3VJP A;  3OA6 A;  4ZTU B;  4C5H A;  1USY C;  2DTO A;  3LWH A;  4M78 C;  2ZXF A;  4BY6 B;  3PIP A;  4XTW A;  3BW1 A;  4PLL A;  3NET A;  4UC4 A;  4C5G A;  3HRI A;  3G4S A;  4ZGE B;  4M78 G;  2R57 A;  3CCM A;  4C92 C;  4LVJ A;  3JCM V;  3J81 E;  4JLI A;  4JDS A;  2DPP B;  4O6J A;  3CCJ T;  4PJO D;  4XTY A;  3HFZ A;  1VIE A;  3SWN A;  1KD1 C;  2DEQ A;  2FYK A;  3E9G A;  1VQL T;  4YRQ A;  4K88 A;  4DA4 A;  5D6W A;  3REX A;  5EG2 A;  4M7A B;  4YRI A;  3J7A F;  4F7U E;  2L89 A;  4C5I A;  2EJG A;  3CBO A;  4OGE A;  3OYB A;  1FYF A;  4J6X A;  4L6V 5;  5GMK e;  3CCL A;  3KBG A;  4PG3 A;  4LDV A;  2ZPF B;  4ZTF A;  1PSE A;  3M4Y A;  3P8H A;  1FX7 A;  2VV5 A;  1N8R C;  3JB9 I;  4ZTZ B;  4P3O A;  1H64 1;  1YFT A;  2QQR A;  3WXM B;  3URG A;  3QO7 A;  1WGS A;  3QZ5 B;  1E22 A;  2R5A A;  5CKF A;  5LJ5 d;  2DJZ A;  3SD4 A;  3M59 A;  4CS2 A;  3M4G A;  4C8Q E;  3CD6 T;  2IY5 B;  3OYG A;  4MZP A;  2EJF A;  4M77 A;  2I4L A;  2EQK A;  4RCB A;  4YDQ A;  4HWS A;  5KNN A;  3HRK A;  1I5L A;  2JN0 A;  1Q81 C;  1NYR A;  2LC4 A;  5GAO q;  5DLQ E;  4C8Q A;  3OYD A;  3JB9 F;  3CCJ A;  3RUX A;  3NEM A;  3OBW A;  3JAM E;  4NCX A;  4TQF A;  1IL2 A;  2V8J A;  2DU7 A;  3PFS A;  1I4K 1;  3IKL A;  4PKC C;  4E7J A;  2RI2 A;  3OS0 A;  4OF1 A;  4M75 G;  2VYT A;  5HKC A;  1VQM T;  3OYK A;  2XGT A;  4KR2 A;  1JJ2 S;  4CH4 A;  1O75 A;  3RIR A;  3VQY A;  5K1X A;  1YJ9 A;  2OTL T;  1E1T A;  3HKS A;  4YTL A;  2DU5 A;  3CBM A;  1L0W A;  2P5I A;  3ME9 A;  3QO3 A;  3CCM T;  5CR2 A;  4BY6 C;  1PYS A;  2B8A A;  5LJ3 h;  4XAX B;  3OYY A;  1M1F A;  2EFI A;  3RMS A;  1GXI E;  5C0M A;  4M7D E;  5C53 B;  1Q86 C;  4WJ3 M;  2A3L A;  1WLE A;  1X56 A;  4BE1 A;  3O8V A;  2X4J A;  1B70 A;  3CCR A;  3CC7 A;  4OB1 B;  2P0Q A;  1EQR A;  3CPF A;  4H2U A;  5A0G A;  4EMK B;  1BBU A;  3MEV A;  3L42 A;  1KQS S;  4M78 A;  2XK0 A;  4CRI A;  3CCL T;  5AYF A;  1YGB A;  4KQE A;  1RIQ A;  1KC8 U;  4MZM A;  4NOY A;  4C5E A;  4RDX A;  2XID A;  4YYE A;  4Q6G A;  1QF6 A;  3OS1 A;  4H2X A;  3QJY A;  3CMA A;  4H2X B;  5KE3 A;  5ELN A;  1Y7X A;  1WPY A;  2AKW B;  3RGL A;  3V8J A;  5GAO r;  3BFM A;  1D3B B;  5GAO m;  1H4S A;  3QBY A;  3CMA T;  3W3S A;  4OLF A;  4F7U G;  2L5Q A;  1W2B A;  4M77 E;  1KMN A;  3HXU A;  1M8V A;  3QYH B;  4NL3 A;  3KFU A;  1GGM A;  1JRI A;  4LDY A;  4JRP A;  4P75 C;  2DTH A;  3HFV A;  1QVG A;  2J3M A;  3EFS A;  1SER A;  3UPU A;  4L59 A;  4H2S A;  3ZFJ A;  5KCH A;  4HCC A;  2DZC A;  2RHI A;  5GAN 6;  1LNX A;  3E9F A;  4J7F A;  4DOV A;  2RHQ B;  3HFN A;  3SDZ A;  2RHQ A;  1U1T A;  3QYG B;  3G1Z A;  4MML A;  3OYL A;  2JNG A;  2VC8 A;  3X26 B;  4BDY A;  1VQ6 T;  3RKW A;  1VQ4 T;  1OYX A;  3LSS A;  1UGR B;  1QVF A;  3MET A;  2CZ7 B;  5GAN j;  1VQ7 T;  1BIB A;  5GAN 7;  4M78 B;  3TCJ A;  3MEY A;  2FHD A;  3HRU A;  2XDD A;  3GP8 A;  2PVO B;  2A8E A;  2RJD A;  3I55 T;  1VQ6 A;  4XTV A;  5KH6 A;  1YIT A;  2ZIO A;  4OB0 B;  5CKB A;  2ZPE B;  4M77 F;  1YBY A;  4J5Y A;  4F7U A;  3X28 B;  3P8D A;  2QA4 A;  1KHI A;  4M78 E;  4JRI A;  2Y4X A;  3OMG A;  4KUL A;  5FU6 C;  5GMK h;  1WNL A;  2WAC A;  1B7Y B;  5GAN h;  4XTZ A;  5I21 A;  4YRS A;  4OVA A;  4PJO E;  4M78 D;  4QQG A;  3OYA A;  3QJ6 A;  3R6O A;  3X20 B;  2I4M A;  2E70 A;  4IUT A;  2F5K A;  4TVA A;  3WVD B;  2RK1 A;  4TVA B;  3MEW A;  2CZ1 B;  2PU9 B;  1X6O A;  4LVK A;  4PJO F;  4P74 A;  1NNH A;  2DK3 A;  4G85 A;  4TWA A;  3RL6 A;  1MGQ A;  5CQY A;  3HFO A;  1BI1 A;  3ERR A;  3OYH A;  4M75 D;  2PMF A;  4RMF A;  1HK9 A;  2CZ0 B;  4J15 A;  1NJ6 A;  3IKM B;  3OBY A;  2PQW A;  3CCU T;  4H2V A;  4CH6 A;  3DB3 A;  5GAM e;  2EJ9 A;  4R55 A;  1RL2 A;  3JCM X;  4QQD A;  1Q7Y C;  4CH5 A;  1ASY A;  5CCA A;  2P0K A;  1VIF A;  3E1S A;  1M1G A;  2YHT A;  4E7I A;  4C92 F;  2CYZ B;  2RI3 A;  1YIJ A;  3CC4 T;  2MF2 A;  2C8M A;  4F7U B;  2ZGW A;  2CS7 A;  4BE0 A;  1JB0 E;  3C4S A;  4TTV A;  1ADY A;  5IN1 A;  4YRP A;  4IUV A;  4RG8 A;  4YRT A;  1LOJ A;  4C92 B;  5LJ3 g;  4M75 B;  4UP8 A;  4M7A G;  4YRN A;  4P75 A;  2XIC A;  3LH0 A;  3M4P A;  2EQJ A;  3WQZ A;  1N27 A;  4BI8 B;  3A8O B;  2KDS A;  2WSF E;  3VKI A;  2ZZD A;  2DAQ A;  5D6X A;  4Y91 A;  1KOG A;  2QHS A;  3JB9 D;  1B76 A;  3X25 B;  1X2G A;  3UGQ A;  2JVV A;  2Y90 A;  1W2B S;  1PSF A;  3ASK A;  1X55 A;  3JB9 H;  3S3N A;  3I7F A;  4C8Q B;  4BI3 A;  3QDR B;  5GMK i;  1QP2 A;  3UH0 A;  2ZIN A;  4BWA A;  4R56 A;  2ZZG A;  4PHC A;  2ARU A;  1WU7 A;  4XTX A;  5CK9 A;  4RKU E;  1OZ3 A;  3TEE A;  5GAN f;  2CGH A;  5CKE A;  1N8R U;  1QP3 A;  1ZHI A;  3PMT A;  1EIF A;  2XKO C;  4CH3 A;  5GAN 2;  5GAN 8;  1NJI C;  2O01 E;  4OGC A;  1UB4 A;  2RHU A;  2CIM A;  4NS5 A;  5IAY A;  4XK8 E;  4J6Y A;  2BIV A;  2DXU A;  2PUO B;  2HD0 A;  3MCA B;  4CI0 C;  1K8A U;  4H02 A;  4YRJ A;  2RB6 A;  3PMI A;  4X5O A;  1AHJ B;  2M1H A;  1W66 A;  1LYL A;  3DSQ A;  4EDU A;  3GPL A;  4LDW A;  11AS A;  2RK2 A;  3L2U A;  5LJ3 j;  1YFR A;  4M75 A;  2KMT A;  2EAY A;  2DXB A;  5IT9 E;  2ZCF B;  1UGS B;  2HQE A;  4YRM A;  2CZ6 B;  4BW9 A;  3LLR A;  3CCR T;  2DD4 A;  5HY6 A;  2DKG A;  1NJ8 A;  3JB9 J;  4YRF A;  2LT1 A;  4YRK A;  5J39 A;  2QHV A;  3MEA A;  4TVY A;  2P0P A;  4MDW A;  4JS5 A;  3OMC A;  3L1A A;  1VQP T;  4XU3 A;  4JS4 A;  4MDX A;  3DKM A;  2X35 A;  3CEY A;  4P3N A;  5HGQ A;  3TUP A;  2LQK A;  2ZR3 A;  1KQ1 A;  4BAC A;  1G3W A;  4N0A A;  4C0D B;  2M16 A;  4P72 C;  2BUD A;  3FIF A;  1U8R A;  5A0L A;  2MI6 A;  3G6E T;  4ELZ C;  2VGN A;  3ER0 A;  3NEN A;  1Q81 U;  1EVL A;  4K87 A;  2HQX A;  5GMK l;  4HCB A;  2DXC A;  2RJE A;  2KY9 A;  2R58 A;  3RES A;  4M7D F;  4FT4 A;  4HKE A;  5J26 A;  3DLM A;  3INZ A;  3HFZ B;  4E51 A;  4M75 F;  3CXC A;  2EKO A;  2EL9 A;  1ATI A;  4YRR A;  2L3R A;  1QVF S;  4XU1 A;  3JCM f;  1VQ5 T;  1Y96 B;  3F70 A;  1YJW T;  2CKK A;  2RO0 A;  2RJF A;  3QSU A;  2RHS B;  1BBW A;  4QQ6 A;  2IY5 A;  2EQU A;  1VQ7 A;  2M9U A;  3OS2 A;  3HXW A;  2X4X A;  4A4F A;  4JJN K;  3RAC A;  3CME A;  3HRS A;  1VQN A;  3KUF A;  3HSB A;  3MF1 A;  5LJ5 f;  3C95 A;  4YCW A;  2K5I A;  4QVZ A;  1P92 A;  3M58 A;  3G4S T;  4PJO B;  1VQK A;  3OYN A;  4J8O A;  5GAN 3;  4P5N A;  3EAE A;  2KSS A;  4D6W A;  2C06 A;  2RHZ A;  4M7A D;  3S3O A;  2GF7 A;  3FB9 A;  3ZEH A;  1J5W A;  3SB2 A;  1VQL A;  1G3S A;  2KK4 A;  4P72 A;  5CAI A;  5L8R E;  2V8I A;  4IUR A;  4LD6 A;  3L2W A;  2E64 A;  1M90 U;  2WSC E;  1X75 C;  5E3I A;  3CCS A;  1KC8 C;  1WJQ A;  3C94 A;  3VQX A;  3NTH A;  4YRG A;  1W4S A;  4YRC A;  2BKD N;  3V7C A;  1MHN A;  1DJ7 B;  2XDP A;  1PYS B;  2QQS A;  4P73 A;  2VUB A;  2E10 A;  2MAM A;  3CCQ T;  3UWN A;  3ZBD A;  4HT9 A;  3VV0 A;  3VUB A;  1KQS A;  3SWN B;  1VUB A;  12AS A;  1EVK A;  1VQ4 A;  3PIO A;  3CMQ A;  3V8L A;  1G5H A;  2RM4 A;  2E41 A;  4QVD A;  1VQ5 A;  3P8B B;  3REU A;  4DQ2 A;  2LQ8 A;  1U1S A;  4A4G A;  3SFM A;  5FLX E;  4BI4 A;  3LWI A;  3X24 B;  1BI2 A;  2K3X A;  2Q7E A;  3GIB A;  1N6A A;  2G3R A;  3FLG A;  1X2H A;  2ZPB B;  3RKY A;  4ZN3 A;  3OYI A;  1LJO A;  2X4W A;  3TU4 K;  4PLI A;  4H2T A;  5GAM f;  3CC7 T;  2DQ0 A;  2KVQ G;  4M7D C;  3MP6 A;  1NPP A;  1IZ6 A;  2ART A;  4RQE A;  3TRE A;  4JUV A;  3LGF A;  2AKW A;  1OI1 A;  3G6E A;  4WF2 A;  2VXF A;  4EX5 A;  2ZNJ A;  2NS6 A;  2ZCE A;  1ASZ A;  3AHU A;  5CQX A;  4BUG A;  1N9R A;  4AH6 A;  4BD3 A;  2PME A;  5LJ5 g;  5DM7 R;  1K73 U;  5CIU A;  3OYM A;  2ZT7 A;  2JOY A;  3A8G B;  3DLL A;  3JRZ A;  4E7K A;  3OS5 A;  2LNV A;  3NFC A;  3HXZ A;  3QPH A;  4HWR A;  1Q86 U;  2XHC A;  1YJW A;  4IUQ A;  4Q15 A;  1H4Q A;  2QQA A;  1QVP A;  5KE2 A;  2CJB A;  1KQ2 A;  2ZT5 A;  3L4G A;  3JCM W;  2LCC A;  4UP9 A;  2KAF A;  5GAM h;  3UDC A;  1E24 A;  3M54 A;  4XU2 A;  3JCM J;  3QO5 A;  2I2L A;  3HL8 A;  4LVI A;  4LVL A;  3P8Y A;  2JTF A;  4IUU A;  4ZGJ B;  2Q7G A;  2CJA A;  1UEB A;  3HY0 A;  1VQ9 T;  5I2M A;  5LJ3 f;  1M1K U;  5LL6 S;  1B34 B;  4OB2 B;  3VUZ A;  4J7I A;  5FRO A;  4F7U F;  2EQM A;  3TEH B;  5I2S A;  1S72 A;  1C0A A;  2EIF A;  5K1P A;  4FT2 A;  3LW5 E;  1I8F A;  2PVG B;  1YB3 A;  3V7R A;  1UGP B;  2FVU A;  1QE0 A;  4YCU A;  1VQP A;  4II1 A;  5LJ3 e;  3QZ9 B;  1Z7M A;  4RCC A;  1VQ8 T;  1B8A A;  1G51 A;  2JUF A;  1VQO A;  3A31 A;  4K86 A;  4C0Z A;  2WSE E;  3P8T A;  1BIA A;  5LJ5 j;  4LDU A;  2DVE A;  2DIG A;  3MEU A;  4C0G A;  2F69 A;  5FU7 C;  4HWO A;  2E5Q A;  1ZQ1 A;  1YHQ T;  5M9O A;  4QVC A;  4CS4 A;  4M77 B;  1IRE B;  1TH7 A;  2YLC A;  4GY5 A;  4PNO A;  4L87 A;  3NEL A;  1EFW A;  2QDY B;  2RHY A;  4YRO A;  3E19 A;  3JCM e;  4L5G A;  4X34 A;  4OP0 A;  2E65 A;  2CJ9 A;  3PZC A;  4EO4 A;  2K2V A;  3NTK A;  1G3T A;  1YJ9 T;  4FIB A;  2OTL A;  2XU8 A;  4XU0 A;  1SET A;  1BI3 A;  4B9W A;  3EFR A;  4TVW A;  3GOX A;  4P73 C;  3LC0 A;  1NPR A;  3A32 A;  3VYH B;  2LVM A;  3C12 A;  5GAN g;  3MO8 A;  3L2Q A;  3MP1 A;  4C92 D;  5F5W A;  4PL6 A;  1N9W A;  3NTI A;  4ZGD B;  3QNE A;  3DB4 A;  1K9M C;  4WI1 A;  2E6Z A;  4EMG A;  3HY1 A;  2ZIM A;  3CCU A;  2DDZ A;  3FEO A;  1YCY A;  4N4I A;  4N4H A;  5A0D A;  4DOW A;  4M7D B;  5ELO A;  1S72 T;  2I4N A;  4HT4 A;  3A7R A;  3S3M A;  3JCM Q;  4IUP A;  3IG2 A;  2ZR2 A;  1HTT A;  4N0A C;  1O9S A;  2RHS A;  2R5M A;  3JCM g;  5GAO n;  4BDZ A;  1X54 A;  3PCO A;  3HRT A;  1YIT T;  3PCO B;  4XEM A;  2FL7 A;  4P71 A;  1H3Z A;  2C7I A;  3A5Y A;  3R07 A;  3M53 A;  3HTZ A;  3QII A;  4A4E A;  4J6W A;  4C0D C;  3OYE A;  3A7U A;  4N4G A;  4RQF A;  2Q7H A;  2RH2 A;  1X01 A;  2ALY A;  2QEX A;  2X4Y A;  2DO3 A;  1QVG S;  2EYQ A;  3CBP A;  4FL6 A;  4M78 F;  2ZT8 A;  2E6N A;  5GAM g;  3UT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...