2DVEA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, mutation arg51ala
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNAKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin Protein Ligase
publication title Ligand Structures of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dveA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dveA01
2PMEA 3GIBA 3HXZA 5LJ3g 2VC8A 4C8QA 3VQWA 1L0WA 3JCMX 5GAOn 4G85A 3RIRA 1WNLA 5GANh 1NJ8A 1D3BA 3RL6A 1M5Q1 5GMKm 2E5AA 4M7AE 4EX5A 3V7SA 3TEHA 4C8QD 4NOYA 4M7DB 2E1HA 2CJ9A 3HY0A 4PJOG 4HA8A 1X01A 2IY5A 3WQZA 2QHUA 3JCMh 1B70A 3BDUA 1B76A 2RM4A 3V7RA 4YCWA 4RQEA 4M7DF 2DZCA 3M4GA 1YCYA 1SRYA 5GAMf 2CJAA 3UFGA 2I2LA 4M77E 2ZR2A 2EL9A 3QO7A 1X54A 4K86A 3V8JA 2FYKA 4M78G 4HVCA 3FB9A 4A53A 2RHQA 4N0AC 2I4MA 4WF2A 4C92G 1NJ5A 3A74A 4YP0A 3FJPA 4TWAA 1N9WA 4YRCA 5C53B 5LJ3h 2ZIMA 3UH0A 4JRKA 2QHSA 2J3MA 1LJOA 3IALA 1HK9A 2QHTA 5GANf 2PMFA 4H2XB 1BIAA 1H4QA 1B7YB 4PJOF 4YROA 1EVLA 1H641 1NJ1A 3JCMW 2J3LA 3HXXA 5GAMe 5GAOq 4M78B 5CAIA 4XTZA 4YCUA 4CH3A 5GAOp 1M8VA 4BWAA 5GAN3 2P5IA 4M78F 2RHSB 3TUPA 3BFMA 4C92F 2AMCA 2ZZGA 3JCMP 2DJZA 1HC7A 4RMFA 1WQ7A 4C8QC 4YRJA 5GAMd 4N0AA 4BW9A 5GANe 1U1TA 1KQ2A 2ZNJA 4YRKA 4X9DA 3RKWA 2EJ9A 4P75A 1I4K1 3E9IA 3LSSA 4P3PA 4QVDA 2ZT5A 1TH7A 5GMKi 4M77G 4HWRA 4P73C 2ALYA 4YDQA 4M75B 1WYDA 4YRNA 4F7UE 5GAOm 1B8AA 4M7DC 1PYSB 4A54A 1N9SA 3FIFA 4PHCA 3A32A 5GANd 4XU0A 3HFZB 1YFRA 4JLIA 1HTTA 5GAMj 4K87A 4M7AA 4P74C 1X55A 3EFRA 1Y96B 3I7FA 2YLBA 3RESA 4M7AF 2ODRC 1USYC 4UP9A 4DPGA 1E1TA 3HRKA 3LC0A 2ARUA 4JRIA 3JCMV 4XEMA 4YREA 5GAN5 3QO3A 4TVAA 1H4SA 5HGQA 5LJ3e 2FB7A 5GAN8 2ZT8A 1U1SA 3DSQA 4YRMA 4WJ3M 2EAYA 3SB2A 4H2YA 4P3NA 4M7AD 1EOVA 4O2DA 1LYLA 1QF6A 2ZCEA 4PJOC 4M77F 3V8LA 4EO4A 4M75E 4KR3A 3INZA 5GANj 3QNEA 3JCMJ 2DXUA 4PNOA 2E41A 4H02A 4HWTA 4XTYA 2DDZA 1YFTA 2VXFA 2I4LA 3PGGA 4P73A 5C52B 5LJ3d 2E3CA 5GMKh 1HXDA 5GAN4 3RGLA 4M78C 11ASA 3QO5A 4M7DA 4C92C 5LJ5g 2ZXFA 4EMGA 1NYRA 3JB9J 2ZR3A 1RIQA 1B34A 1WU7A 4MMKA 2C8MA 4P74A 3TEHB 1BIBA 4TQDA 4WJ4A 3HSBA 4M7DD 1B70B 1USYA 4F7UG 4HWOA 1SESA 2RA2A 4P75C 2Q7HA 3QTCA 3JCMb 1WPYA 4P71C 3VQVA 4QVCA 5LJ3j 4HWPA 4YRGA 1Z7MA 2XGTA 1Z7NA 1NJ6A 2I4OA 4XU3A 2Q5HA 2AKWB 3W3SA 3OD1A 1GGMA 1EQRA 4PJOA 2ODRD 2RHQB 3REUA 2Q7EA 5K1XA 3VQXA 3NELA 4XTXA 4E51A 3JB9G 4YRLA 4H2XA 1MGQA 3L4GB 2ZTGA 2ZZFA 4M7AC 4YRTA 1NJ2A 5I21A 4F7UB 4PJOD 4NL3A 2G4CA 3G1ZA 3HFVA 4M78A 3HXUA 1JRIA 12ASA 4M75G 5LJ5h 4V2SA 4C92A 2DU7A 4KR2A 3NEMA 1SERA 3KFUA 1IL2A 3EFSA 4RDXA 4F7UF 3RKYA 3IKLA 4RCCA 3HRIA 3A7AA 3UGTA 2RHSA 2YLCA 4M77C 5DY9A 2E10A 2ZT6A 4M78D 4EMKB 1H4TA 4C92D 2QHVA 5C51B 4P71A 2AMCB 2JN0A 3A31A 4CH6A 3ICAA 1EIYA 4TQFA 2RB6A 5GMKe 3JB9F 2XTIA 3RKXA 4YRRA 2ZNIA 3PCOB 5ELOA 4TTVA 3HXYA 4MMLA 3JCMQ 1ASZA 4L87A 4P3OA 1PYSA 4M75F 2YHTA 3QSUA 1EFWA 1WQWA 2CGHA 1JBMA 5LJ5f 4P72C 4OLFA 5GAN6 3HXWA 4C8QG 3HY1A 3VBBA 3A5YA 4TVWA 1Y96A 4J6YA 1G51A 1KMNA 1NYQA 4G84A 3LSQA 2ARTA 4XTUA 4M77A 4CH4A 3SWNB 3QO8A 3JB9H 2P0LA 4H2UA 3AHUA 4TVAB 2K57A 4DQ2A 3P8TA 1JJCB 4KQEA 4NCXA 2DZ9A 4M77D 1X56A 1ASYA 2Q5IA 4K88A 5KNNA 5GMKj 4XTVA 4C8QB 1ADYA 5LJ5e 3RERA 5GMKl 1KQ1A 1G5IA 1E1OA 4CH5A 2ZIOA 2ZINA 1YFSA 4XTWA 3RUXA 1D3BB 1N9RA 3BW1A 1NNHA 4Y91A 3M4PA 4UP7A 4YPFA 1KOGA 4C8QF 2C7IA 1SETA 1E24A 3A7RA 2EWNA 4P72A 2IY5B 2I4NA 4H2WA 3MF1A 1C0AA 4H2TA 1E22A 4J6WA 4EMKC 5LJ5d 2DTIA 2ZGWA 1X2HA 2CIMA 3A7UA 4YRIA 4ZTUB 4CS2A 1B34B 1ATIA 1G5HA 2DXTA 4UP8A 1H4VB 1J5WA 3HFOA 3M4QA 2ZT7A 3V7CA 2RD1A 4J15A 2DQ3A 4YRQA 3P8VA 1X2GA 4C8QE 4H2SA 3REXA 3RACA 4WI1A 4M75C 2AKWA 1VQZA 4XU1A 4HT9A 3BY7A 4CS3A 3UGQA 1B7YA 4ZTZB 5ELNA 3HXVA 3PZCA 2EJFA 4PG3A 2Y90A 3L4GA 2HNIA 4PJOB 1FYFA 5LJ5j 3JCMc 2DEQA 1QE0A 4F7UA 4XQ3A 4LNSA 4M7DE 3HTZA 3R07A 4AH6A 2E64A 2CJBA 1EVKA 4Q15A 3E9HA 5GAOr 3JB9I 4YRPA 2DKGA 4TVYA 4YRFA 2DTOA 3VU3C 4NL2A 3SWNC 5GAN2 3NETA 3JCMf 2Q7GA 3CMQA 3RF1A 4C92B 1WLEA 5GAMg 3IKMB 4YYEA 4EMKA 4OP0A 5F5WA 3VQYA 4J5YA 4HT8A 5GAN7 2VXEA 4JUVA 1BBWA 1ADJA 5E3IA 1YB3A 2ZZEA 4YRSA 4X5OA 4M7AG 4PJOE 4HWSA 4M75A 3PCOA 3JB9D 4EMHA 1I8FA 1EIYB 3MF2A 3P8YA 5LJ3f 5GAOl 5GANg 2ARSA 3NENA 2ALYB 1BBUA 3ERRA 2EJGA 3BJUA 2DVEA 1YGBA 3HFZA 4UPAA 3L2ZA 1W66A 4M75D 3JCMe 1LOJA 4M78E 1I5LA 3TEGA 4YCVA 3IG2A 4C92E 1LNXA 3JCMg 3HFNA 4J6XA 2E65A 4M7AB 3QUIA 4RQFA 4H2VA 4X9CA 3A5ZA 5GAMh 3SWNA 2QTXA 4XU2A 3L1AA 4Q6GA 2DU5A 1I81A 5K1PA 1KMMA 2DQ0A 4M7DG 3QHSA 4ZIBA 3MEYA 4XEOA 2DTHA 3V8KA 4RCBA 4CS4A 3JCMd 4M77B 1JJCA
chains in the Genus database with same CATH superfamily
2NWMA 1VIEA 1BB9A 1NBEB 1RACB 3HKSA 3CXCP 1W2BP 1SSFA 2K2VA 2VC8A 1PKSA 3CPWP 3URGA 4RG8A 3VQWA 4OGCA 5D6YA 3GPLA 1KHCA 3RIRA 1WNLA 1NJ8A 3MP8A 1ZBJA 2E5AA 1KQSP 4EX5A 3CCLQ 2RQTA 1VQ4Q 2E1HA 4HA8A 2IY5A 2C06A 3L2VA 1B76A 3BDUA 3NFCA 1ZSZB 3V7RA 4IIMA 4YCWA 3D7SB 1TXQA 4N4GA 2DILA 2QK0A 2DL8A 3VJPA 4F16A 3CMEA 3DKMA 3KXTA 2EL9A 2RJCA 4A53A 5GJVB 2RHQA 2JTMA 1X69A 4C92G 4BE2A 4TWAA 3CC7A 2AHJB 4F17A 2NS6A 2KYMA 4L59A 2ZIMA 1ZUYA 4JJDA 2J3MA 2QHSA 2D6FA 2F5TX 3G1JA 4E2FB 3IALA 2FRYA 2JTFA 1BI3A 4FIBA 2QTVA 3N5BB 1Y7XA 2XMFA 1B7TA 4DBRA 2F2XA 2RPNA 1EVLA 4R55A 1NJ1A 2JMCA 2J3LA 4E7IA 2ZPBB 3CC4A 4OB2B 2KROA 3I5RA 5CKBA 4Z88A 5I2MA 1UHCA 2X3XD 4XTZA 3G4ST 3J81E 4CC7A 3CMAA 3M53A 5KYWA 2HMAA 2RN8A 1QP3A 3TUPA 2SEMA 1VQ6T 4LVKA 1Q82U 1HC7A 2JM9A 1ZX6A 1K9MR 1G83A 5GAMd 2OX7A 4N0AA 5FWCA 4BW9A 5GANe 1KQ2A 1PSEA 1R0CB 2EJ9A 2EKHA 2CYZB 2A08A 4HCKA 2JXBA 1OULA 2JZ2A 3TU4K 2ZT5A 4P3PA 3THKA 2ALYA 2RHIA 1VQOA 4OMOA 3CMAT 2LT4A 3R6OA 5EC7A 3EG0A 1B8AA 2E4HA 2W0ZA 2GNCA 1UECA 2IPOB 1YJWT 4PHCA 2O31A 3A32A 1E6HA 3TSZA 2MWPA 4JS5A 3M0PA 5GAMj 3CPFA 2AK5A 1E6GA 3EFRA 1Y96B 3I7FA 3O8VA 3OB9A 4M7AF 2ODRC 1MMAA 2V1RA 4OVAA 4D6WA 4JRIA 3JCMV 4XEMA 5GAN5 1H4SA 1YITT 1XTDA 2FB7A 2ZT8A 1IHVA 1U1SA 3DSQA 1KSWA 4CRIA 4WJ3M 2Z0WA 2HBPA 3QYHB 1WA7A 1VQ9A 3RMQA 3VKIA 1EOVA 1VIFA 2K3XA 3MPUB 1YCSB 3INZA 3TCJA 3QIIA 3CCSA 1Q82R 1BCOA 3CBOA 3M0QA 2RK1A 4PNOA 2JUFA 1ACMB 4HWTA 4F14A 3CCLT 4XTYA 1VQ4T 1K73C 2ED0A 2I4LA 2JT4A 4P73A 2E3CA 5GMKh 1HXDA 2LCCA 11ASA 4M78C 4OMFB 4TVRA 4X34A 3WVDB 4LUEA 5LJ5g 4EMGA 3JB9J 1QKXA 1ZA1B 1ZSZA 1B34A 1UEBA 3WVEB 1NM7A 4FT4A 4P74A 1VQPA 1BIBA 2DMOA 4PJLA 4BE0A 2VASA 2HQXA 4P75C 2QQBA 1UFFA 3NTHA 1PKTA 2A28A 1OPLA 1YNZA 4FW1A 1Z7MA 3JSCA 2XGTA 2I4OA 1UGSB 2GTJA 3FDRA 3OD1A 4PJOA 3REUA 3RDVA 2EGEA 5K1XA 5I11A 3NELA 5FW9A 4II1A 2ZTGA 2ZZFA 1X43A 4YRTA 3HRUA 4NL3A 4PJOD 2G4CA 1Q86C 3G1ZA 1RLQC 3HFVA 3OYIA 2EGAA 2FG0A 4X1VA 5LJ5h 1UGRB 3NEMA 1SERA 5LL6S 3CCQA 3HRIA 3A7AA 2YRCA 4BI8B 1T0HA 2YLCA 4JZ3A 3OYFA 2ZT6A 5CK9A 2HL5C 1UGQB 2LC4A 3MP1A 3VS1A 1M90C 2QHVA 4OGEA 4KBMB 1RAIB 3L2WA 1D0XA 3MP6A 3ICAA 1EIYA 4TQFA 2RB6A 3JB9F 2OTLA 2HAXA 2NUTB 1JJ2S 2ZNIA 2JOYA 3L42A 1M27C 1M2VB 1CKBA 2CZ1B 2KRSA 4K11A 3UATA 1AWOA 5DLQE 3O5ZA 1QMCA 4M75F 2X3WD 2YUQA 1AOJA 2DM1A 3VRZA 2NUPA 1ABQA 3GOXA 5GAN6 2FPDA 2GBQA 2AZSA 4C8QG 2YRDA 4UC4A 4MZMA 1VA7A 1Y96A 2KGTA 3LLRA 1QVGA 2MI6A 1VQNA 1ZA2B 4M77A 4CH4A 4LVJA 1WXBA 4E7ZA 5J39A 1OZ3A 2P0LA 1PWTA 1N5ZA 1YWPA 1UDLA 5HKCA 3AHUA 1NLOC 1WYXA 3NMZC 1JJCB 4NCXA 2CP6A 2ROLA 4M77D 1ASYA 2Q5IA 1OV3A 4K88A 3HHTB 1N6AA 1UTIA 2AZVA 2EYZA 2RJDA 5GMKj 4BDYA 3CC2T 1S1NA 2Y4XA 3RERA 5GMKl 1MV0B 1G5IA 2CKKA 1KJWA 1JB0E 1RUWA 5IN1A 4AFSC 3EGDB 3BW1A 1N9RA 1KOGA 2BZYA 3MCAB 5J26A 1C1AA 3A7RA 4P72A 4ELZC 1K9AA 1C0AA 2K5IA 1KD1C 2EYYA 2VUBA 1E22A 4EMKC 5LJ5d 2DTIA 2R57A 3VYHB 4ELYC 8AT1B 4ZTUB 4FYVB 4CS2A 1PNJA 1JJ2A 2DXTA 1FMKA 1K8AR 2OI3A 1D1CA 3M4QA 4RG2A 3RR6A 2DBKA 3I5SA 2CT3A 4H2SA 2FRWA 1Z9QA 3CD6A 4XU1A 1BI1A 3OBWA 4ZTZB 2YWWA 2KNBB 2OJ2A 3PZCA 5GJWB 2EKOA 2Y90A 1MMDA 2PU9B 5LJ5j 1QE0A 2DEQA 1S72A 4FYWB 3QXEB 3R07A 2RHUA 2K5FA 1TUGB 1EVKA 2K2MA 3E9FA 2HSPA 3OYEA 5KYYB 3JB9I 5KYUA 2V8JA 4YRFA 3TVTA 2DTOA 5CQXA 3UT1A 1ZUUA 3HP9A 5GAN2 3RF1A 2Q7GA 1FMWA 1WIEA 3IKMB 2WSFE 2MK5A 3KFVA 2PNIA 3G6EQ 5CKDA 2L89A 4JUVA 1UHFA 2E6NA 1NLPC 2X4JA 2QQRA 3ZBDA 1YB3A 2K3YA 2XU8A 1WX6A 1YJNA 4M7AG 1TS9A 3FC3A 1QCFA 1OX8A 2KXCA 2NUTA 4N4IA 1MMNA 1QW1A 3MJXA 3WXMB 5HY6A 4J9HA 1HSQA 1TSFA 3ERRA 4UPAA 4FYXB 1VQMT 1W66A 1RADB 5AT1B 1X2KA 3OS5A 3JCMe 4M78E 4YCVA 2C0TA 2LQ8A 3JCMg 2BZXA 3NTIA 2E65A 4KGXB 3QUIA 2A8EA 2ZPEB 2YUOA 3C0CA 2MF2A 5A0DA 1P92A 4XU2A 4J9CA 1GRIA 4RTTA 9ATCB 2DU5A 2DQ0A 3EFOB 1ZSGA 3M55A 3CCEA 4XEOA 3QWXX 1J3TA 1QVGP 4HWSA 2CS7A 1JJCA 4IUVA 5ECAA 1IRXA 5HK3A 3I56T 2X4YA 2YRVA 1BI2A 4QQDA 1WHJA 1NYFA 2KYBA 2HKNA 4F04B 1TUCA 3OYGA 1UGVA 4KGVB 2BKDN 3C12A 1M5Q1 2B8AA 1T3LA 2GFUA 2XICA 3OYJA 3EGUA 3TEHA 4M7DB 2BIVA 3EG9A 2JMAA 2X4WA 2LNHB 3JCMh 5CCAA 1B70A 2XD0A 2RM4A 2VWFA 1W70A 3MEVA 2J6KA 4FL6A 4RQEA 2RI5A 1NJIR 2ZPFB 2A7YA 2J6FA 2ZR2A 3UFGA 1SPKA 3QO7A 4M78G 3FB9A 1OZ2A 4WF2A 4JPBW 1NJ5A 1V1CA 1ZUKA 1KIKA 4BE1A 1WFWA 1IGQA 1JJ2P 4JRKA 3C4SA 3UA6A 1HK9A 5FRMA 3R6NA 3VUZA 1JO8A 3LWIA 2PMFA 1M3BA 1B7YB 4PJOF 1KFZA 4KULA 3CMEQ 2LNVA 3OYHA 2C0OA 1H641 2YUNA 4EIKA 5GAMe 3CCJQ 5GAOq 5KYYA 2X4XA 4IKFA 3OBYA 2KE9A 4LNPA 1QVPA 5CAIA 1ZQ1A 5D7UA 2ROTA 3G6ET 4BWAA 5GAN3 2AT1B 3BFMA 2AMCA 2KBTA 1KC8C 1N8RR 3OYNA 2HCKA 2DJZA 3FLGA 2M9UA 4HVUA 4C8QC 4CC3A 2L2PA 1U1TA 2QASA 2ZNJA 3RKWA 4P75A 1I4K1 1AD5A 3CC4Q 1UJ0A 3LSSA 3CBMA 4QVDA 1C6VX 1TH7A 4P5NA 2GCXA 3LGLA 5GMKi 2MYSA 1M1KC 1U8RA 4OMMA 3TEEA 4F7UE 3QZ5B 1K76A 4HXJA 2X9HA 1ZBXA 1UUEA 2K79A 2O4XA 1SEMA 4LXCA 2DO3A 1H8KA 4GBQA 2HBWA 4J8OA 2FO0A 4TVAA 2LQKA 3EFOA 5HGQA 4YRMA 4IUPA 3LWHA 1Y07A 1VQOQ 4H2YA 4P3NA 1WXTA 4O2DA 4JJCA 1AZGB 1R77A 1WHMA 4M77F 2ABLA 4KR3A 2KXDA 2DRKA 1VQLQ 4AG2C 2JJ9A 1HJDA 1M3AA 2E41A 1QVFS 2DDZA 1YFTA 2VXFA 5I22A 2IG0A 3OQ5A 1Q81R 4QQ6A 5GAN4 2RHZA 3QO5A 4M7DA 2JS2A 2O01E 2COZA 3HPWA 1GFCA 2DJQA 3M9QA 1VQ9Q 1XOVA 1AWJA 1HYOA 2DFUA 4MMKA 5CVIA 2DVJA 4QKUA 5M9OA 3CCJA 1I1JA 4TQDA 3RNJA 4M7DD 1USYA 4F7UG 3CCSQ 4HWOA 3E19A 4JLGA 2RA2A 2Q7HA 3FJ5A 3QTCA 2JM8A 3A8LB 2EQUA 1BYMA 2PUOB 2YUPA 1RAAB 2AIRB 4XU3A 2P4RA 2I0NA 4CC4B 1MMGA 5DM7R 2Q7EA 3OS1A 1NYGA 3M4YA 3VQXA 3CMET 5FWBA 5C0MA 1AZEA 4BDZA 1MGQA 3L4GB 1GCQA 1VQPQ 5FLXE 3EGXB 1BK2A 2VGNA 4M7AC 3NGPA 1VQ8A 2NYSA 1WJRA 3CC7T 1TOVA 1RL2A 4HCBA 1JRIA 1QWFA 2EW3A 4C92A 1PG5B 2DA9A 1IL2A 4J9FA 3EFSA 2IVWA 4RDXA 1TTHB 1D1AA 1QWEA 2KAFA 2HDAA 2HZYA 2E10A 3PVLA 2NUZA 1DJ7B 3NTKA 1KD1U 1H4TA 4C92D 3CC4T 5A0LA 1QVFA 5IHIA 5CKHA 4P71A 2JN0A 3VS6A 5GMKe 3M58A 2E5QA 4KUDK 3EAEA 4RTXA 4YRRA 2QEXA 4PLLA 5FRNA 1YI2Q 2XDPA 3FRNA 3JCMQ 3CCQQ 5D6WA 1XQHA 5A2QE 3OYDA 3JAME 1VQLA 1EFWA 3QSUA 2ZCFB 4E7HA 1YIJA 1RI9A 4B9WA 2P0KA 8ATCB 2CGHA 1SG5A 2KK4A 3SFMA 3M0TA 4OLFA 2E3IA 4OB3B 1I0CA 2BE7D 3A1PA 4TVWA 4BI4A 2RQWA 2RH2A 4J6YA 3Q1JA 4J9GA 1G51A 1VQOT 2OTLQ 2O9SA 3A5ZB 2LMJA 3QO8A 3KUFA 3LH0A 2HQEA 3QKJA 1FXXA 2ATCB 4O6JA 4D8KA 4DQ2A 1MV3A 3I55A 2K3BA 4KQEA 1W6XA 2DZ9A 2V8KA 1X56A 1AWWA 1RAFB 4JRQA 5KYXB 1IREB 4XTVA 4C8QB 1ADYA 5LJ5e 2CUBA 2JNGA 1KQ1A 1X27A 2E12A 2ZIOA 2B86A 4PJJA 2M0OA 4XTWA 1VQ9T 1VQNQ 1NNHA 4ZNXA 4RUGA 2G6FX 2J6OA 3G7ZA 1SETA 3M56A 1ZHIA 1YJ9Q 2EWNA 4A4GA 2SRCA 2H3EB 2D9TA 2R5MA 4AMCA 3CCST 1PM3A 1T3SA 3CQTA 3CCRQ 1U06A 3A7UA 2VVKA 4PFPA 4C5HA 1G5HA 3OYAA 1QVGS 1J5WA 3HFOA 4JZ4A 1A0NB 2OAUA 4B6MA 2DQ3A 5KE2A 2O88A 3P8VA 4C8QE 3RACA 1Y57A 3PMIA 4M75C 1VQZA 4ZTFA 4MZPA 4C5IA 3UGQA 1JEGA 1VQPT 3HXVA 1UGPB 3VUBA 2EJFA 4M4ZA 3L4GA 5FU7C 2DNUA 1OOTA 4JJBA 1VQKA 2K5LA 1PD0A 3JCMc 4GY5A 4IUQA 1YI2A 4A4FA 2OTJA 4GLKA 1QLYA 4LDVA 2QYZA 2DYBA 2E64A 2VV5A 3E2UA 1W1FA 2CP0A 3VS2A 2DL7A 3E9HA 5GAOr 1OU8A 3CD6Q 3P8HA 2QA4A 3SWNC 4OMNA 4YYEA 1G5VA 3GF5A 1WLPB 3G71Q 5F5WA 3VQYA 2VXEA 4DEXA 2KQWA 4RTZA 1BBWA 4RTWA 3H9NA 2KEAA 4J9DA 2CP3A 1FYNA 1B07A 2V8IA 2QI2A 2JTEA 1S72Q 2GQVA 3E1SA 3GNFB 3CCQT 4OF1A 2QAZA 5A0GA 4RMOA 3QZ9B 3MF2A 1QVFP 3PE0A 2LCLA 2BUDA 1KK7A 2EJGA 2MOXA 2DVEA 3ZFJA 3BJUA 4E47A 1M3CA 3QWYA 1Q7YU 4RTVA 5HCKA 1I5LA 1FMVA 2K6DA 1K9MC 1LNXA 4C0DC 2OTLT 1YJNQ 4M7AB 2HD0A 1YJ9A 4DA4A 3A5ZA 2PVGB 2A0FB 4QW2A 2RQRA 3J80E 1I81A 5K1PA 1KHIA 1X75C 3X20B 3MEYA 4A4EA 3VYGA 4CS4A 3CCRA 1SSHA 2E6ZA 2L3SA 1KC8U 1PHTA 3EG2A 2KI7A 4LD9K 4KUIA 1G3SA 3GIBA 3HXZA 5LJ3g 1BCMA 3GNGA 5KYXA 4C8QA 1VQNT 2QGGA 3JCMX 4G85A 4LVLA 2DK3A 3RL6A 3TSWA 2LJ0A 3EHRA 3GLXA 4M7AE 3V7SA 2PTKA 4C8QD 3HY0A 3CCEQ 1X01A 3QPHA 5FU6C 3WQZA 3J7AF 2IIMA 3REAB 4BB7A 1YHQA 1WHLA 4M7DF 2DZCA 4PJNA 1SRYA 1SHGA 3SD4A 1Q82C 1VQ7A 2PVOB 1X54A 5CO7A 4K86A 2CT4A 2P0PA 5EG2A 3V8JA 3X26B 5C6SA 1LCKA 1QCNA 4N0AC 2I4MA 1K0XA 2HL3A 3A74A 3FJPA 4L5GA 4HVWA 1N9WA 2ESWA 3G71A 4YRCA 1R0BG 3A8GB 5C53B 5LJ3h 2CH4W 4C0GA 3UH0A 1D1BA 3CBPA 3IQLA 1X2QA 2RMOA 2QHTA 5GANf 3OYBA 4H2XB 1BIAA 1H4QA 2A36A 3VV0A 3CCUQ 4AT1B 4YROA 1EZZB 2XI9A 4VUBA 3HXXA 1QQJA 3EH1A 3CD6T 1I5OB 3MO8A 2YXYA 3C95A 4M78B 4YCUA 4CH3A 4DEYA 5GAOp 3QYGB 3G71T 4J9BA 3MQZA 2R5AA 3VS7A 2P5IA 2RHSB 2YT6A 3QJ6A 4C92F 4MDWA 2DF6A 3JCMP 4RMFA 1S72T 3UDCA 2FVUA 1IZ6A 2EQKA 2P0QA 1WQ7A 4YRJA 2CSQA 1NEGA 2MAMA 1M2VA 4QQGA 4X9DA 3E9IA 6AT1B 4FYYB 3OYKA 2LP5A 1GCPA 4HWRA 4P73C 3L2QA 2KSSA 4YDQA 4M75B 1AEYA 1WYDA 1QCOA 5FROA 2KRNA 1LPLA 4AG1C 5GAOm 4A54A 1YJNT 1N9SA 2EQJA 4XU0A 2LX7A 5FU7B 1NG2A 1YN8A 5KYNA 1YFRA 3HFZB 1HTTA 4M7AA 2ED1A 1JXOA 4P74C 2CZ6B 3H8ZA 4DPGA 1OEBA 4JJNK 3HRKA 2VGMA 4ORZA 1MHNA 4KT0E 4ZGDB 2EAYA 3CXCA 4OMLA 4M7AD 5HK0A 2D0NA 1WGSA 1LYLA 1QF6A 4PJOC 2CP5A 4EO4A 4M75E 1VYVA 3P8DA 1VQ5A 3EGDA 3QNEA 3JCMJ 4AFZC 5L23A 2DXUA 4H02A 3PGGA 3CCVA 5C52B 2EVRA 5LJ3d 3CCET 3LW5E 3RGLA 1H92A 3PMTA 2M16A 2EIFA 2AKKA 1NYRA 1RIQA 3H0IA 3CCUA 4PK4A 2C0IA 2O2OA 1WU7A 3I35A 3PNWC 4WJ4A 4QT7A 2L3RA 2LCSA 3OA6A 1SESA 1FWZA 3MHXA 1WPYA 2MWOA 3P8BB 4Q5WA 3S6WA 1T0JA 3A8MB 2LT1A 2RJFA 5LJ3j 4YRGA 2EGCA 3HL8A 1Z7NA 1NJ6A 5I2SA 3H0HA 1XNIA 2ODRD 2RHQB 4LDWA 3LH5A 4XTXA 4E51A 3JB9G 2LQWA 1NEBA 1V29B 2HKQB 4BACA 2CUDA 4H2XA 5IH2A 1K73U 4YRLA 3PIOA 3DB3A 2O9VA 5I21A 4F7UB 3ZEHA 4M78A 1K8AC 3HXUA 12ASA 3LX7A 4M75G 4KH0B 4V2SA 2DU7A 4KR2A 1RAEB 1G3WA 2CZ0B 4RCCA 4ZGJB 3UGTA 4LDYA 4PFOA 2RHSA 1G2BA 4FU6A 2KDSA 4M77C 5DY9A 4LDXA 1BI0A 2PUKB 5FU6B 1WZOA 4M78D 4RTYA 4EMKB 2K9GA 3UF4A 1OI1A 2VKNA 2LJ1A 2DD5A 5D6XA 2MCNA 4WTOB 3A31A 1VQ8Q 2RI3A 2DL4A 1EFNA 2XTIA 1V76A 2DAQA 2XIDA 4Y28E 5ELOA 2E70A 3HXYA 1TG0A 2A37A 1ASZA 4P3OA 2H8HA 4BUGA 3M54A 1M1GA 4FM4B 1PRMC 2YDLA 1Q86U 1AVZC 1JBMA 2DYIA 4P72C 2XG8D 4HVVA 3HY1A 3OS2A 1MNDA 1D09B 2Y4YA 1K73R 1KMNA 4G84A 2HEQA 4ME7A 2LVMA 5IXFA 4FW2A 4LD6A 2ARTA 2QEXQ 3OYYA 7AT1B 3A8OB 3TREA 4LVMA 2QQAA 1PRLC 2WSEE 2LZ6B 4E7KA 3VRYA 2D8HA 4H2UA 1M90U 3M5AA 4JDSA 1YIJQ 2K57A 2VYTA 3P8TA 3DLMA 4BY6C 1YITQ 2M51A 3X25B 1BBZA 1TWBA 2L3QA 2F2VA 1CSKA 4CH5A 4EDUA 3OW2S 1JU5C 3OSVA 3A98A 1YFSA 3RUXA 1D3BB 4UP7A 4YPFA 3M4PA 4CC2A 4C8QF 2JW4A 3ASKA 2F1LA 1Z9ZA 2I4NA 4H2WA 2RI2A 3MF1A 4H2TA 1O9SA 1O75A 1Q95G 3I55Q 1K9MU 1C0MA 2ZGWA 3H6ZA 4JRPA 1X2HA 2CIMA 1B34B 1ATIA 1Q86R 1H4VB 2RF0A 2ZT7A 2RD1A 4YRQA 2QXFA 1X2GA 1NPRA 4C0ZA 3ZL7C 2PVDB 4ZN3A 4CI0C 2CZ7B 3BY7A 3G4SA 3CCJT 1B7YA 4RKUE 1G3YA 5ELNA 2CP7A 1NZ9A 4PG3A 3VS4A 4PJOB 1M90R 1VQ6A 3MEAA 1NJIC 2CDTA 3MEUA 4F7UA 4XQ3A 3QJYA 1WJSA 4LNSA 2M0YA 3HTZA 3RMSA 2QQSA 1SRLA 3CCMQ 5CKFA 4YRPA 4TVYA 4LVIA 4KGZB 3FEOA 3VU3C 3TQ7P 3JCMf 5IT9E 1WLEA 1H3ZA 4EMKA 4Z8AA 4OP0A 2EYXA 3S3NA 2X51A 5GAN7 1VQ8T 1JQQA 1ADJA 1VQKQ 3OW2A 3F70A 4L6V5 4J7FA 1GL5A 1K4US 4X5OA 1YJWA 2OTJQ 4IUUA 4PJOE 2GF7A 2DD4A 1I8FA 4ANJA 1EIYB 2QDYB 3P8YA 4GLMA 3MKDA 2GQIA 4ZGEB 1X6GA 5GANg 2ARSA 2QA4Q 1YGBA 1SRMA 2DL5A 2GTOA 1YITA 1WHGA 3L2ZA 3DLLA 1N8RC 3EG1A 4OMQA 1LOJA 2EBPA 2W10A 4FT2A 1M9SA 3TEGA 1M1FA 4RTUA 1WHKA 2QEXT 2FL7A 2FZCB 4IUTA 2EQIA 2WSCE 2NUPB 2HSEB 1OX9A 3QG1A 3OYMA 2J05A 3L2RA 1VOMA 1TUDA 2BTTA 2QTXA 2A3LA 1VQLT 1WDXA 3CCLA 1YIJT 1VQ4A 1KMMA 2QQ9A 3QHSA 4ZIBA 2L3PA 2DTHA 3OMGA 3LGFA 2AKLA 4XAXB 4M77B 2LDMA 1KD1R 2PMEA 3I9QA 2RQVA 2COYA 2FPEA 2L0AA 1L0WA 2F2WA 5GAOn 1IHWA 3VS0A 3KBGA 5GANh 1D3BA 4OMPA 5GMKm 2ECZA 2RJEA 2DE0X 3OY9A 3BDLA 4NOYA 2QGFB 3I55T 3CC2Q 4B9XA 4PJOG 1ARKA 2CJ9A 2XKOC 4PLIA 3UA7A 4LN2A 2QHUA 1YFNA 1PD1A 4A63B 4D8DA 2LQNA 3M4GA 1YCYA 3CCMA 5GAMf 2CJAA 2I2LA 4M77E 4MZTA 2QDLA 2FYKA 2WACA 4HVCA 5J3BA 3PFSA 3HTRA 2RHXA 4YP0A 2VB6A 1Q81C 2ZPIB 2DPPB 4O5VA 4J7IA 5IXBA 4E7SA 4N4HA 1AWXA 3EGXA 1LJOA 1M4ZA 1U5SA 3A8HB 4DOVA 2XHCA 2YSQA 1XJWB 2OAWA 3GP8A 1YHQQ 3CCMT 1WHHA 3PT9A 4BY6B 1EX4A 2XDDA 1B3QA 2RQUA 3JCMW 4R56A 1VQ7Q 3H0FA 2DLPA 2KVQG 2DEUA 1K1ZA 1RI0A 1U3OA 2M02A 4IURA 1M8VA 4WCIA 2BZ8A 2DX1A 4M78F 4JS4A 1VQKT 2ZZGA 5KYUB 1OQKA 4ESRA 1YI2T 2OTJT 1IB8A 5KH6A 3EH2A 3GBQA 4E7LA 4YRKA 1UE9A 1VYTA 2QA4T 4J83A 5CR2A 4IIOA 2L5QA 4ATOA 2FPFA 2ZPHB 4M77G 1SKUB 2CSIA 4HCZA 3OW2P 3CEYA 4YRNA 4M7DC 1PYSB 2JS0A 2D1XA 1GFDA 2JVVA 2ZAEA 1VYUA 2J06A 3FIFA 3OMCA 3M0SA 5GANd 3PVQA 3M0RA 4JLIA 2DIQA 4PJMA 4K87A 2MMPA 1WJQA 1X55A 1K8AU 5IAYA 4KRTA 2YLBA 1Y0MA 3RESA 3VS3A 3U23A 1USYC 4UP9A 1VQMQ 3AT1B 3CC2A 1E1TA 1M8MA 1OPKA 3H41A 2ARUA 3LC0A 4YREA 3QO3A 5LJ3e 5GAN8 5IHNA 1MNEA 4HT4A 3SB2A 2DETA 2MIOA 2LX9A 2ZCEA 2RHYA 2KT1A 3V8LA 2DERA 1AHJB 1RLPC 3UPUA 2PZ1A 3OYCA 5GANj 1YJ9T 2K4YA 1F1BB 1GCQC 1M1KU 2EYWA 3X28B 1RABB 1W4SA 1PSFA 2LRQA 3CCRT 2PQWA 3I56Q 1AT1B 4PKCC 4C92C 2ZXFA 5CIUA 1KG1A 2ZR3A 1N27A 1PCXA 1IXDA 3PIPA 3M59A 1Q7YR 2C8MA 2CP2A 3TEHB 2G3RA 4FSXA 3EG9B 1X6BA 2DIGA 1VQ5Q 3HSBA 1B70B 4XK8E 3JCMb 4P71C 3VQVA 4A4HA 3CCVQ 4QVCA 1BKBA 4HWPA 1D0ZA 1QP2A 4ZTJA 2Q5HA 3S3MA 3CXCS 1W2BS 2AKWB 3W3SA 1GGMA 1EQRA 1YHQT 3CPWS 1KC8R 2P84A 3M57A 1VQ7T 4Y92A 1YBYA 1OYXA 2DXCA 1GXIE 2CH4A 2ZZDA 1IGUA 2KRMA 3BE3A 1NJ2A 2ENMA 1KQSS 1RAHB 5CKEA 4FCYA 2DL3A 3LYIA 3KFUA 1ABOA 1M1KR 2BE9B 4PFZA 4F7UF 3RKYA 3IKLA 2RK2A 3OSSC 2FZGB 3M0UA 3VS5A 3META 1GBRA 5L8RE 2KT8A 1EIFA 1NPPA 1MUZA 1VQMA 5C51B 4BD3A 3HRSA 2AMCB 2COWA 5DLOA 4CH6A 4HCCA 3C94A 3MEWA 1E7OA 4Z89A 3RKXA 1Y71A 3PCOB 1R8OB 2KMTA 2KY9A 3SEMA 4TTVA 4MMLA 2X35A 4L87A 2XDBA 5KCHA 1PYSA 2YHTA 1ZSZC 1WQWA 1M2OA 2E3HA 2CREA 1BU1A 4ZN1A 5LJ5f 1H3HA 3UWNA 1NJIU 3HXWA 3VBBA 3A5YA 1UJYA 3EG3A 3I56A 1NYQA 4C5EA 1W2BA 3LSQA 4DBFA 3JV3A 4XTUA 4LDUA 2O4XB 3CPWA 3SWNB 2R58A 2KR3A 3JB9H 1WXUA 4PL6A 4QVZA 4TVAB 2RNAA 4OB1B 1G8XA 2H3JA 2FZKB 2GGRA 1KQSA 5KNNA 2V1QA 2EFIA 2MPXC 1OU9A 4R0KA 5AYFA 1E1OA 3ER0A 2M1HA 2ZINA 1TU0B 2E5KA 1YWOA 4KH1B 4Y91A 4MDXA 3REBB 2D8JA 3SDZA 2C7IA 1E24A 4AFQC 2V26A 4AFUC 4J9IA 1FX7A 2IY5B 1VQ5T 1N8RU 3HRTA 3DB4A 4C0DB 1UB4A 4J6WA 1RAGB 3CCVT 4YRIA 2EQMA 2LJ3A 2LTOA 4UP8A 3V7CA 1LVKA 4J9EA 4J15A 2F5KA 3NHNA 3REXA 4A4KA 3ULRB 4WI1A 1PC0A 2AKWA 1D0YA 3CCUT 4HT9A 4FSSA 3SHWA 4CS3A 3PTAA 4NS5A 3G6EA 5CQYA 1G3TA 5KCOA 2HNIA 4HKEA 1QKWA 1I07A 3OS0A 1FYFA 2P4TA 3S3OA 1UG1A 3E9GA 1JXMA 1Q7YC 1NE8A 4M7DE 4AH6A 4DBQA 2CJBA 2DBMA 4Q15A 1YP5A 4YTLA 3X24B 2DKGA 4E6RA 2NLUA 2EYQA 2ZPGB 4NL2A 3NETA 3CMQA 3G4SQ 4C92B 5GAMg 5KYWB 1K0SA 1IO6A 3CC7Q 4DBHA 1VUBA 4J5YA 4HT8A 5E3IA 2ZZEA 1VQ6Q 3EHQA 4YRSA 2J7IA 4EPCA 3JRZA 4LE9A 4C0FA 4M75A 2HQHA 3PCOA 1Q81U 2FEIA 5IHKA 3JB9D 3T9NA 4DOWA 4EMHA 1CKAA 1SHFA 1X6OA 3QBYA 5LJ3f 4BI3A 5KE3A 5GAOl 3NENA 2ALYB 1WI7A 1BBUA 2F69A 2DXBA 2RO0A 4OB0B 3HFZA 2DRMA 2K7AA 1HD3A 4M75D 4C5GA 3CMAQ 2GFAA 3IG2A 4C92E 4E7JA 2QG9B 1M30A 3QDRB 2XK0A 3HFNA 4J6XA 1YJWQ 2FHDA 4RQFA 4H2VA 2L8DA 4X9CA 3L2UA 3RBBB 3OYLA 4LUDA 5GAMh 3SWNA 3L1AA 4Q6GA 1GBQA 2EPDA 3NPFA 4M7DG 3QDFA 4Z02A 2D0QB 3ME9A 1ZLMA 3V8KA 4RCBA 3JCMd 1SF9A
chains in the Genus database with same CATH topology
1VIEA 3HKSA 1SSFA 2K2VA 2VC8A 3URGA 4RG8A 3VQWA 4OGCA 5D6YA 3GPLA 1KHCA 3RIRA 1WNLA 1NJ8A 3MP8A 2E5AA 4EX5A 2E1HA 4HA8A 2IY5A 2C06A 3L2VA 1B76A 3BDUA 3NFCA 3V7RA 4YCWA 4N4GA 3VJPA 3CMEA 3DKMA 3KXTA 2EL9A 2RJCA 4A53A 2RHQA 2JTMA 4C92G 4BE2A 4TWAA 3CC7A 2AHJB 2NS6A 4L59A 2ZIMA 2QHSA 2J3MA 2D6FA 2F5TX 3IALA 2JTFA 1BI3A 4FIBA 3N5BB 1Y7XA 1EVLA 4R55A 2J3LA 1NJ1A 4E7IA 2ZPBB 3CC4A 4OB2B 5CKBA 5I2MA 4XTZA 3G4ST 3J81E 3CMAA 3M53A 3TUPA 1QP3A 1VQ6T 4LVKA 1Q82U 1HC7A 5GAMd 4N0AA 4BW9A 5GANe 1KQ2A 1PSEA 2EJ9A 2CYZB 2JZ2A 3TU4K 2ZT5A 4P3PA 2ALYA 2RHIA 1VQOA 3CMAT 2LT4A 3R6OA 1B8AA 1YJWT 4PHCA 3A32A 2MWPA 4JS5A 5GAMj 3CPFA 3EFRA 1Y96B 3I7FA 3O8VA 3OB9A 4M7AF 2ODRC 4OVAA 4D6WA 4JRIA 3JCMV 4XEMA 5GAN5 1H4SA 1YITT 1XTDA 2FB7A 2ZT8A 1U1SA 3DSQA 4WJ3M 4CRIA 2HBPA 3QYHB 1VQ9A 3RMQA 3VKIA 1EOVA 1VIFA 2K3XA 3INZA 3TCJA 3QIIA 3CCSA 3CBOA 2RK1A 4PNOA 2JUFA 4HWTA 3CCLT 4XTYA 1VQ4T 1K73C 2I4LA 4P73A 2E3CA 5GMKh 1HXDA 2LCCA 11ASA 4M78C 4OMFB 4TVRA 4X34A 3WVDB 5LJ5g 4EMGA 3JB9J 1B34A 1UEBA 3WVEB 4FT4A 4P74A 1VQPA 1BIBA 4BE0A 2HQXA 4P75C 2QQBA 3NTHA 1Z7MA 3JSCA 2XGTA 2I4OA 1UGSB 3FDRA 3OD1A 4PJOA 3REUA 5K1XA 3NELA 4II1A 2ZTGA 2ZZFA 4YRTA 3HRUA 4NL3A 4PJOD 2G4CA 1Q86C 3G1ZA 3HFVA 3OYIA 5LJ5h 1UGRB 3NEMA 1SERA 5LL6S 3CCQA 3HRIA 3A7AA 4BI8B 2YLCA 3OYFA 2ZT6A 5CK9A 1UGQB 2LC4A 3MP1A 1M90C 2QHVA 4OGEA 4KBMB 3L2WA 3MP6A 3ICAA 1EIYA 4TQFA 2RB6A 3JB9F 2OTLA 2HAXA 1JJ2S 2ZNIA 2JOYA 3L42A 2CZ1B 5DLQE 4M75F 3GOXA 5GAN6 4C8QG 4UC4A 4MZMA 1Y96A 3LLRA 1QVGA 2MI6A 1VQNA 4M77A 4CH4A 4LVJA 5J39A 1OZ3A 2P0LA 5HKCA 3AHUA 1JJCB 4NCXA 4M77D 1ASYA 2Q5IA 4K88A 3CC2T 1N6AA 3HHTB 2RJDA 5GMKj 4BDYA 2Y4XA 3RERA 5GMKl 1G5IA 2CKKA 1JB0E 5IN1A 3BW1A 1N9RA 1KOGA 3MCAB 5J26A 3A7RA 4P72A 4ELZC 1C0AA 2K5IA 1KD1C 2VUBA 1E22A 4EMKC 5LJ5d 2DTIA 2R57A 3VYHB 4ELYC 4ZTUB 4CS2A 1JJ2A 2DXTA 3M4QA 4RG2A 4H2SA 3CD6A 4XU1A 1BI1A 3OBWA 4ZTZB 3PZCA 2EKOA 2Y90A 2PU9B 5LJ5j 1QE0A 2DEQA 1S72A 3QXEB 3R07A 2RHUA 2K5FA 1EVKA 3E9FA 3OYEA 3JB9I 2V8JA 4YRFA 2DTOA 5CQXA 3UT1A 3HP9A 5GAN2 3RF1A 2Q7GA 3IKMB 2WSFE 5CKDA 2L89A 4JUVA 2E6NA 2X4JA 2QQRA 3ZBDA 1YB3A 2K3YA 2XU8A 1YJNA 4M7AG 3FC3A 4N4IA 3WXMB 1QW1A 5HY6A 3ERRA 4UPAA 1VQMT 1W66A 3OS5A 3JCMe 4M78E 4YCVA 2LQ8A 3JCMg 3NTIA 2E65A 3QUIA 2A8EA 2ZPEB 2MF2A 5A0DA 1P92A 4XU2A 2DU5A 2DQ0A 3CCEA 3M55A 4XEOA 4HWSA 2CS7A 1JJCA 4IUVA 5HK3A 3I56T 2X4YA 2YRVA 1BI2A 4QQDA 3OYGA 2BKDN 3C12A 1M5Q1 2B8AA 2GFUA 2XICA 3OYJA 3TEHA 4M7DB 2BIVA 2X4WA 3JCMh 5CCAA 1B70A 2XD0A 2RM4A 3MEVA 4FL6A 4RQEA 2RI5A 2ZPFB 2A7YA 3UFGA 2ZR2A 3QO7A 4M78G 3FB9A 1OZ2A 4WF2A 1NJ5A 4BE1A 4JRKA 3C4SA 1HK9A 5FRMA 3VUZA 2PMFA 3LWIA 1B7YB 4PJOF 4KULA 2LNVA 3OYHA 1H641 5GAMe 5GAOq 4IKFA 2X4XA 3OBYA 1QVPA 5CAIA 1ZQ1A 3G6ET 4BWAA 5GAN3 3BFMA 2AMCA 1KC8C 3OYNA 2DJZA 3FLGA 2M9UA 4C8QC 1U1TA 2ZNJA 3RKWA 4P75A 1I4K1 3LSSA 3CBMA 4QVDA 1TH7A 4P5NA 2GCXA 3LGLA 5GMKi 1M1KC 1U8RA 3TEEA 4F7UE 3QZ5B 1ZBXA 2O4XA 2DO3A 4J8OA 4TVAA 2LQKA 5HGQA 4YRMA 4IUPA 3LWHA 1Y07A 4H2YA 4P3NA 4O2DA 4M77F 4KR3A 2E41A 1QVFS 2DDZA 1YFTA 2VXFA 2IG0A 3OQ5A 4QQ6A 5GAN4 2RHZA 3QO5A 4M7DA 2O01E 3HPWA 3M9QA 1XOVA 4MMKA 5CVIA 5M9OA 3CCJA 4TQDA 4M7DD 1USYA 4F7UG 4HWOA 3E19A 4JLGA 2RA2A 2Q7HA 3QTCA 3A8LB 2EQUA 1BYMA 2PUOB 4XU3A 5DM7R 2Q7EA 3OS1A 3M4YA 3VQXA 3CMET 5C0MA 4BDZA 1MGQA 3L4GB 5FLXE 2VGNA 4M7AC 1VQ8A 1WJRA 3CC7T 4HCBA 1RL2A 1JRIA 4C92A 1IL2A 3EFSA 2IVWA 4RDXA 2KAFA 2E10A 1DJ7B 3NTKA 1KD1U 1H4TA 4C92D 3CC4T 5A0LA 1QVFA 5CKHA 4P71A 2JN0A 5GMKe 3M58A 2E5QA 4KUDK 3EAEA 4YRRA 2QEXA 4PLLA 5FRNA 2XDPA 3FRNA 3JCMQ 5D6WA 1XQHA 5A2QE 3OYDA 3JAME 1VQLA 1EFWA 3QSUA 2ZCFB 4E7HA 1YIJA 4B9WA 2P0KA 2CGHA 2KK4A 3SFMA 4OLFA 4OB3B 4TVWA 4BI4A 2RH2A 4J6YA 3Q1JA 1G51A 1VQOT 3A5ZB 3QO8A 3KUFA 3LH0A 2HQEA 3QKJA 1FXXA 4O6JA 4DQ2A 3I55A 4KQEA 2DZ9A 2V8KA 1X56A 4JRQA 1IREB 4XTVA 4C8QB 1ADYA 5LJ5e 2JNGA 1KQ1A 2E12A 2ZIOA 2M0OA 4XTWA 1VQ9T 1NNHA 3G7ZA 1SETA 3M56A 1ZHIA 2EWNA 4A4GA 2D9TA 2R5MA 3CCST 3A7UA 4C5HA 1G5HA 3OYAA 1QVGS 1J5WA 3HFOA 2OAUA 2DQ3A 5KE2A 3P8VA 4C8QE 3RACA 3PMIA 4M75C 1VQZA 4ZTFA 4MZPA 4C5IA 3UGQA 1VQPT 3HXVA 1UGPB 3VUBA 2EJFA 3L4GA 5FU7C 1VQKA 2K5LA 3JCMc 4GY5A 4IUQA 1YI2A 4A4FA 2OTJA 4GLKA 4LDVA 2E64A 2VV5A 3E9HA 5GAOr 3P8HA 2QA4A 3SWNC 4YYEA 1G5VA 3GF5A 5F5WA 3VQYA 2VXEA 2KQWA 1BBWA 2V8IA 2QI2A 2GQVA 3E1SA 3GNFB 3CCQT 4OF1A 5A0GA 4RMOA 3QZ9B 3MF2A 2LCLA 2BUDA 2EJGA 3ZFJA 2DVEA 3BJUA 4E47A 1Q7YU 1I5LA 1K9MC 1LNXA 4C0DC 2OTLT 4M7AB 2HD0A 1YJ9A 4DA4A 3A5ZA 2PVGB 4QW2A 3J80E 1I81A 5K1PA 1KHIA 1X75C 3X20B 3MEYA 4A4EA 3VYGA 4CS4A 3CCRA 2E6ZA 1KC8U 4LD9K 4KUIA 1G3SA 3GIBA 3HXZA 5LJ3g 3GNGA 4C8QA 1VQNT 3JCMX 4G85A 4LVLA 2DK3A 3RL6A 3GLXA 4M7AE 3V7SA 4C8QD 3HY0A 1X01A 3QPHA 5FU6C 3WQZA 3J7AF 4BB7A 1YHQA 4M7DF 2DZCA 1SRYA 3SD4A 1Q82C 1VQ7A 2PVOB 1X54A 5CO7A 4K86A 2P0PA 5EG2A 3V8JA 3X26B 5C6SA 4N0AC 2I4MA 3A74A 3FJPA 4L5GA 1N9WA 3G71A 4YRCA 3A8GB 5C53B 5LJ3h 4C0GA 3UH0A 3CBPA 2QHTA 5GANf 3OYBA 4H2XB 1BIAA 1H4QA 4YROA 3VV0A 2XI9A 4VUBA 3HXXA 3CD6T 3MO8A 3C95A 4M78B 4YCUA 4CH3A 5GAOp 3QYGB 3G71T 3MQZA 2R5AA 2P5IA 2RHSB 3QJ6A 4C92F 4MDWA 3JCMP 4RMFA 1S72T 3UDCA 2FVUA 1IZ6A 2EQKA 2P0QA 1WQ7A 4YRJA 2MAMA 4QQGA 4X9DA 3E9IA 3OYKA 4HWRA 4P73C 3L2QA 2KSSA 4YDQA 4M75B 1WYDA 5FROA 5GAOm 4A54A 1YJNT 1N9SA 2EQJA 4XU0A 5FU7B 3HFZB 1YFRA 1HTTA 4M7AA 4P74C 2CZ6B 3H8ZA 4DPGA 4JJNK 3HRKA 2VGMA 1MHNA 4KT0E 4ZGDB 2EAYA 3CXCA 4M7AD 5HK0A 1WGSA 1LYLA 1QF6A 4PJOC 4EO4A 4M75E 3P8DA 1VQ5A 3QNEA 3JCMJ 2DXUA 4H02A 3PGGA 3CCVA 5C52B 5LJ3d 3CCET 3LW5E 3RGLA 3PMTA 2M16A 2EIFA 1NYRA 1RIQA 3CCUA 1WU7A 3PNWC 4WJ4A 2L3RA 3OA6A 1SESA 1FWZA 3MHXA 1WPYA 2MWOA 3P8BB 4Q5WA 3S6WA 3A8MB 2LT1A 2RJFA 5LJ3j 4YRGA 3HL8A 1Z7NA 1NJ6A 5I2SA 1XNIA 2ODRD 2RHQB 4LDWA 4XTXA 4E51A 3JB9G 1V29B 4BACA 4YRLA 4H2XA 1K73U 3PIOA 3DB3A 5I21A 4F7UB 3ZEHA 4M78A 1K8AC 3HXUA 12ASA 3LX7A 4M75G 4V2SA 2DU7A 4KR2A 1G3WA 2CZ0B 4RCCA 4ZGJB 3UGTA 4LDYA 2RHSA 4M77C 4FU6A 2KDSA 5DY9A 4LDXA 1BI0A 2PUKB 5FU6B 4M78D 4EMKB 1OI1A 2DD5A 5D6XA 3A31A 2RI3A 2XTIA 2DAQA 2XIDA 4Y28E 5ELOA 2E70A 3HXYA 1ASZA 4P3OA 4BUGA 3M54A 1M1GA 4FM4B 1Q86U 1JBMA 4P72C 2XG8D 3HY1A 3OS2A 2Y4YA 1KMNA 4G84A 4ME7A 2LVMA 4LD6A 2ARTA 3OYYA 3A8OB 3TREA 4LVMA 2QQAA 2WSEE 4E7KA 4H2UA 1M90U 3M5AA 4JDSA 2K57A 2VYTA 3P8TA 3DLMA 4BY6C 3X25B 4CH5A 4EDUA 3OW2S 3OSVA 1YFSA 3RUXA 1D3BB 4UP7A 4YPFA 3M4PA 4C8QF 3ASKA 2I4NA 4H2WA 2RI2A 3MF1A 4H2TA 1O9SA 1O75A 1K9MU 2ZGWA 3H6ZA 4JRPA 1X2HA 2CIMA 1B34B 1ATIA 1H4VB 2ZT7A 2RD1A 4YRQA 2QXFA 1X2GA 1NPRA 4C0ZA 2PVDB 4ZN3A 4CI0C 2CZ7B 3BY7A 3G4SA 3CCJT 1B7YA 4RKUE 1G3YA 5ELNA 1NZ9A 4PG3A 4PJOB 1VQ6A 3MEAA 1NJIC 3MEUA 4F7UA 4XQ3A 3QJYA 1WJSA 4LNSA 3HTZA 3RMSA 2QQSA 5CKFA 4YRPA 4TVYA 4LVIA 3FEOA 3VU3C 3JCMf 5IT9E 1WLEA 1H3ZA 4EMKA 4OP0A 3S3NA 5GAN7 1VQ8T 1ADJA 3OW2A 3F70A 4L6V5 4J7FA 4X5OA 1YJWA 4IUUA 4PJOE 2GF7A 2DD4A 1I8FA 1EIYB 2QDYB 3P8YA 4ZGEB 5GANg 2ARSA 1YGBA 1YITA 3L2ZA 3DLLA 1N8RC 1LOJA 4FT2A 3TEGA 1M9SA 1M1FA 2QEXT 2FL7A 4IUTA 2WSCE 3QG1A 3OYMA 3L2RA 1VQLT 2QTXA 2A3LA 3CCLA 1YIJT 1VQ4A 1KMMA 2QQ9A 3QHSA 4ZIBA 2DTHA 3OMGA 3LGFA 4XAXB 4M77B 2LDMA 2PMEA 1L0WA 5GAOn 3KBGA 5GANh 1D3BA 5GMKm 2RJEA 3OY9A 3BDLA 4NOYA 3I55T 2CJ9A 4B9XA 4PJOG 2XKOC 4PLIA 2QHUA 3M4GA 1YCYA 3CCMA 5GAMf 2CJAA 2I2LA 4M77E 4MZTA 2FYKA 2WACA 4HVCA 5J3BA 3PFSA 2RHXA 4YP0A 1Q81C 2ZPIB 2DPPB 4O5VA 4J7IA 4N4HA 1LJOA 1M4ZA 3A8HB 4DOVA 2XHCA 3GP8A 3CCMT 3PT9A 4BY6B 2XDDA 3JCMW 4R56A 2KVQG 1RI0A 4IURA 1M8VA 4M78F 4JS4A 1VQKT 2ZZGA 1YI2T 2OTJT 5KH6A 4E7LA 4YRKA 2QA4T 4J83A 5CR2A 2L5QA 4ATOA 2ZPHB 4M77G 4HCZA 3CEYA 4YRNA 4M7DC 1PYSB 2JVVA 3FIFA 3OMCA 5GANd 4JLIA 2DIQA 4K87A 2MMPA 1WJQA 1X55A 1K8AU 5IAYA 2YLBA 3RESA 1USYC 4UP9A 3CC2A 1E1TA 3LC0A 2ARUA 4YREA 3QO3A 5LJ3e 5GAN8 4HT4A 3SB2A 2LX9A 2ZCEA 2RHYA 3V8LA 1AHJB 3UPUA 3OYCA 5GANj 1YJ9T 2K4YA 1M1KU 3X28B 1W4SA 1PSFA 2LRQA 3CCRT 2PQWA 4PKCC 4C92C 2ZXFA 5CIUA 1KG1A 2ZR3A 1N27A 3PIPA 3M59A 2C8MA 3TEHB 2G3RA 4FSXA 2DIGA 3HSBA 1B70B 4XK8E 3JCMb 4P71C 3VQVA 4A4HA 4QVCA 1BKBA 4HWPA 1QP2A 4ZTJA 2Q5HA 3S3MA 3CXCS 1W2BS 2AKWB 3W3SA 1GGMA 1EQRA 1YHQT 3CPWS 3M57A 1VQ7T 1YBYA 1OYXA 2DXCA 1GXIE 2ZZDA 1NJ2A 1KQSS 5CKEA 3LYIA 3KFUA 4F7UF 3RKYA 3IKLA 2RK2A 3OSSC 3META 5L8RE 1EIFA 1NPPA 1VQMA 5C51B 4BD3A 3HRSA 2AMCB 5DLOA 4CH6A 4HCCA 3C94A 3MEWA 3RKXA 1Y71A 3PCOB 1R8OB 2KMTA 2KY9A 4TTVA 4MMLA 2X35A 4L87A 2XDBA 5KCHA 1PYSA 2YHTA 1WQWA 4ZN1A 5LJ5f 3UWNA 1NJIU 3HXWA 3VBBA 3A5YA 3I56A 1NYQA 4C5EA 1W2BA 3LSQA 4XTUA 4LDUA 2O4XB 3CPWA 3SWNB 2R58A 3JB9H 4PL6A 4QVZA 4TVAB 4OB1B 2H3JA 1KQSA 5KNNA 2EFIA 1E1OA 5AYFA 3ER0A 2M1HA 2ZINA 4Y91A 4MDXA 3SDZA 2C7IA 1E24A 2IY5B 1FX7A 1VQ5T 1N8RU 3HRTA 3DB4A 4C0DB 1UB4A 4J6WA 3CCVT 4YRIA 2EQMA 2LTOA 4UP8A 3V7CA 4J15A 2F5KA 3REXA 4A4KA 4WI1A 2AKWA 3CCUT 4HT9A 4CS3A 3PTAA 4NS5A 3G6EA 5CQYA 1G3TA 5KCOA 2HNIA 4HKEA 3OS0A 1FYFA 2P4TA 3S3OA 3E9GA 1Q7YC 1NE8A 4M7DE 4AH6A 2CJBA 4Q15A 4YTLA 3X24B 2DKGA 2NLUA 2EYQA 2ZPGB 4NL2A 3NETA 3CMQA 4C92B 5GAMg 1VUBA 4J5YA 4HT8A 5E3IA 2ZZEA 4YRSA 4EPCA 3JRZA 4C0FA 4M75A 3PCOA 1Q81U 3JB9D 3T9NA 4DOWA 4EMHA 3QBYA 1X6OA 5LJ3f 4BI3A 5KE3A 5GAOl 3NENA 2ALYB 1BBUA 2F69A 2DXBA 2RO0A 4OB0B 3HFZA 4M75D 4C5GA 2GFAA 3IG2A 4C92E 4E7JA 3QDRB 2XK0A 3HFNA 4J6XA 2FHDA 4RQFA 4H2VA 2L8DA 4X9CA 3L2UA 3OYLA 5GAMh 3SWNA 3L1AA 4Q6GA 4M7DG 4Z02A 2D0QB 3ME9A 3V8KA 4RCBA 3JCMd
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PME A;  3GIB A;  3HXZ A;  5LJ3 g;  2VC8 A;  4C8Q A;  3VQW A;  1L0W A;  3JCM X;  5GAO n;  4G85 A;  3RIR A;  1WNL A;  5GAN h;  1NJ8 A;  1D3B A;  3RL6 A;  1M5Q 1;  5GMK m;  2E5A A;  4M7A E;  4EX5 A;  3V7S A;  3TEH A;  4C8Q D;  4NOY A;  4M7D B;  2E1H A;  2CJ9 A;  3HY0 A;  4PJO G;  4HA8 A;  1X01 A;  2IY5 A;  3WQZ A;  2QHU A;  3JCM h;  1B70 A;  3BDU A;  1B76 A;  2RM4 A;  3V7R A;  4YCW A;  4RQE A;  4M7D F;  2DZC A;  3M4G A;  1YCY A;  1SRY A;  5GAM f;  2CJA A;  3UFG A;  2I2L A;  4M77 E;  2ZR2 A;  2EL9 A;  3QO7 A;  1X54 A;  4K86 A;  3V8J A;  2FYK A;  4M78 G;  4HVC A;  3FB9 A;  4A53 A;  2RHQ A;  4N0A C;  2I4M A;  4WF2 A;  4C92 G;  1NJ5 A;  3A74 A;  4YP0 A;  3FJP A;  4TWA A;  1N9W A;  4YRC A;  5C53 B;  5LJ3 h;  2ZIM A;  3UH0 A;  4JRK A;  2QHS A;  2J3M A;  1LJO A;  3IAL A;  1HK9 A;  2QHT A;  5GAN f;  2PMF A;  4H2X B;  1BIA A;  1H4Q A;  1B7Y B;  4PJO F;  4YRO A;  1EVL A;  1H64 1;  1NJ1 A;  3JCM W;  2J3L A;  3HXX A;  5GAM e;  5GAO q;  4M78 B;  5CAI A;  4XTZ A;  4YCU A;  4CH3 A;  5GAO p;  1M8V A;  4BWA A;  5GAN 3;  2P5I A;  4M78 F;  2RHS B;  3TUP A;  3BFM A;  4C92 F;  2AMC A;  2ZZG A;  3JCM P;  2DJZ A;  1HC7 A;  4RMF A;  1WQ7 A;  4C8Q C;  4YRJ A;  5GAM d;  4N0A A;  4BW9 A;  5GAN e;  1U1T A;  1KQ2 A;  2ZNJ A;  4YRK A;  4X9D A;  3RKW A;  2EJ9 A;  4P75 A;  1I4K 1;  3E9I A;  3LSS A;  4P3P A;  4QVD A;  2ZT5 A;  1TH7 A;  5GMK i;  4M77 G;  4HWR A;  4P73 C;  2ALY A;  4YDQ A;  4M75 B;  1WYD A;  4YRN A;  4F7U E;  5GAO m;  1B8A A;  4M7D C;  1PYS B;  4A54 A;  1N9S A;  3FIF A;  4PHC A;  3A32 A;  5GAN d;  4XU0 A;  3HFZ B;  1YFR A;  4JLI A;  1HTT A;  5GAM j;  4K87 A;  4M7A A;  4P74 C;  1X55 A;  3EFR A;  1Y96 B;  3I7F A;  2YLB A;  3RES A;  4M7A F;  2ODR C;  1USY C;  4UP9 A;  4DPG A;  1E1T A;  3HRK A;  3LC0 A;  2ARU A;  4JRI A;  3JCM V;  4XEM A;  4YRE A;  5GAN 5;  3QO3 A;  4TVA A;  1H4S A;  5HGQ A;  5LJ3 e;  2FB7 A;  5GAN 8;  2ZT8 A;  1U1S A;  3DSQ A;  4YRM A;  4WJ3 M;  2EAY A;  3SB2 A;  4H2Y A;  4P3N A;  4M7A D;  1EOV A;  4O2D A;  1LYL A;  1QF6 A;  2ZCE A;  4PJO C;  4M77 F;  3V8L A;  4EO4 A;  4M75 E;  4KR3 A;  3INZ A;  5GAN j;  3QNE A;  3JCM J;  2DXU A;  4PNO A;  2E41 A;  4H02 A;  4HWT A;  4XTY A;  2DDZ A;  1YFT A;  2VXF A;  2I4L A;  3PGG A;  4P73 A;  5C52 B;  5LJ3 d;  2E3C A;  5GMK h;  1HXD A;  5GAN 4;  3RGL A;  4M78 C;  11AS A;  3QO5 A;  4M7D A;  4C92 C;  5LJ5 g;  2ZXF A;  4EMG A;  1NYR A;  3JB9 J;  2ZR3 A;  1RIQ A;  1B34 A;  1WU7 A;  4MMK A;  2C8M A;  4P74 A;  3TEH B;  1BIB A;  4TQD A;  4WJ4 A;  3HSB A;  4M7D D;  1B70 B;  1USY A;  4F7U G;  4HWO A;  1SES A;  2RA2 A;  4P75 C;  2Q7H A;  3QTC A;  3JCM b;  1WPY A;  4P71 C;  3VQV A;  4QVC A;  5LJ3 j;  4HWP A;  4YRG A;  1Z7M A;  2XGT A;  1Z7N A;  1NJ6 A;  2I4O A;  4XU3 A;  2Q5H A;  2AKW B;  3W3S A;  3OD1 A;  1GGM A;  1EQR A;  4PJO A;  2ODR D;  2RHQ B;  3REU A;  2Q7E A;  5K1X A;  3VQX A;  3NEL A;  4XTX A;  4E51 A;  3JB9 G;  4YRL A;  4H2X A;  1MGQ A;  3L4G B;  2ZTG A;  2ZZF A;  4M7A C;  4YRT A;  1NJ2 A;  5I21 A;  4F7U B;  4PJO D;  4NL3 A;  2G4C A;  3G1Z A;  3HFV A;  4M78 A;  3HXU A;  1JRI A;  12AS A;  4M75 G;  5LJ5 h;  4V2S A;  4C92 A;  2DU7 A;  4KR2 A;  3NEM A;  1SER A;  3KFU A;  1IL2 A;  3EFS A;  4RDX A;  4F7U F;  3RKY A;  3IKL A;  4RCC A;  3HRI A;  3A7A A;  3UGT A;  2RHS A;  2YLC A;  4M77 C;  5DY9 A;  2E10 A;  2ZT6 A;  4M78 D;  4EMK B;  1H4T A;  4C92 D;  2QHV A;  5C51 B;  4P71 A;  2AMC B;  2JN0 A;  3A31 A;  4CH6 A;  3ICA A;  1EIY A;  4TQF A;  2RB6 A;  5GMK e;  3JB9 F;  2XTI A;  3RKX A;  4YRR A;  2ZNI A;  3PCO B;  5ELO A;  4TTV A;  3HXY A;  4MML A;  3JCM Q;  1ASZ A;  4L87 A;  4P3O A;  1PYS A;  4M75 F;  2YHT A;  3QSU A;  1EFW A;  1WQW A;  2CGH A;  1JBM A;  5LJ5 f;  4P72 C;  4OLF A;  5GAN 6;  3HXW A;  4C8Q G;  3HY1 A;  3VBB A;  3A5Y A;  4TVW A;  1Y96 A;  4J6Y A;  1G51 A;  1KMN A;  1NYQ A;  4G84 A;  3LSQ A;  2ART A;  4XTU A;  4M77 A;  4CH4 A;  3SWN B;  3QO8 A;  3JB9 H;  2P0L A;  4H2U A;  3AHU A;  4TVA B;  2K57 A;  4DQ2 A;  3P8T A;  1JJC B;  4KQE A;  4NCX A;  2DZ9 A;  4M77 D;  1X56 A;  1ASY A;  2Q5I A;  4K88 A;  5KNN A;  5GMK j;  4XTV A;  4C8Q B;  1ADY A;  5LJ5 e;  3RER A;  5GMK l;  1KQ1 A;  1G5I A;  1E1O A;  4CH5 A;  2ZIO A;  2ZIN A;  1YFS A;  4XTW A;  3RUX A;  1D3B B;  1N9R A;  3BW1 A;  1NNH A;  4Y91 A;  3M4P A;  4UP7 A;  4YPF A;  1KOG A;  4C8Q F;  2C7I A;  1SET A;  1E24 A;  3A7R A;  2EWN A;  4P72 A;  2IY5 B;  2I4N A;  4H2W A;  3MF1 A;  1C0A A;  4H2T A;  1E22 A;  4J6W A;  4EMK C;  5LJ5 d;  2DTI A;  2ZGW A;  1X2H A;  2CIM A;  3A7U A;  4YRI A;  4ZTU B;  4CS2 A;  1B34 B;  1ATI A;  1G5H A;  2DXT A;  4UP8 A;  1H4V B;  1J5W A;  3HFO A;  3M4Q A;  2ZT7 A;  3V7C A;  2RD1 A;  4J15 A;  2DQ3 A;  4YRQ A;  3P8V A;  1X2G A;  4C8Q E;  4H2S A;  3REX A;  3RAC A;  4WI1 A;  4M75 C;  2AKW A;  1VQZ A;  4XU1 A;  4HT9 A;  3BY7 A;  4CS3 A;  3UGQ A;  1B7Y A;  4ZTZ B;  5ELN A;  3HXV A;  3PZC A;  2EJF A;  4PG3 A;  2Y90 A;  3L4G A;  2HNI A;  4PJO B;  1FYF A;  5LJ5 j;  3JCM c;  2DEQ A;  1QE0 A;  4F7U A;  4XQ3 A;  4LNS A;  4M7D E;  3HTZ A;  3R07 A;  4AH6 A;  2E64 A;  2CJB A;  1EVK A;  4Q15 A;  3E9H A;  5GAO r;  3JB9 I;  4YRP A;  2DKG A;  4TVY A;  4YRF A;  2DTO A;  3VU3 C;  4NL2 A;  3SWN C;  5GAN 2;  3NET A;  3JCM f;  2Q7G A;  3CMQ A;  3RF1 A;  4C92 B;  1WLE A;  5GAM g;  3IKM B;  4YYE A;  4EMK A;  4OP0 A;  5F5W A;  3VQY A;  4J5Y A;  4HT8 A;  5GAN 7;  2VXE A;  4JUV A;  1BBW A;  1ADJ A;  5E3I A;  1YB3 A;  2ZZE A;  4YRS A;  4X5O A;  4M7A G;  4PJO E;  4HWS A;  4M75 A;  3PCO A;  3JB9 D;  4EMH A;  1I8F A;  1EIY B;  3MF2 A;  3P8Y A;  5LJ3 f;  5GAO l;  5GAN g;  2ARS A;  3NEN A;  2ALY B;  1BBU A;  3ERR A;  2EJG A;  3BJU A;  2DVE A;  1YGB A;  3HFZ A;  4UPA A;  3L2Z A;  1W66 A;  4M75 D;  3JCM e;  1LOJ A;  4M78 E;  1I5L A;  3TEG A;  4YCV A;  3IG2 A;  4C92 E;  1LNX A;  3JCM g;  3HFN A;  4J6X A;  2E65 A;  4M7A B;  3QUI A;  4RQF A;  4H2V A;  4X9C A;  3A5Z A;  5GAM h;  3SWN A;  2QTX A;  4XU2 A;  3L1A A;  4Q6G A;  2DU5 A;  1I81 A;  5K1P A;  1KMM A;  2DQ0 A;  4M7D G;  3QHS A;  4ZIB A;  3MEY A;  4XEO A;  2DTH A;  3V8K A;  4RCB A;  4CS4 A;  3JCM d;  4M77 B;  1JJC A; 
#chains in the Genus database with same CATH topology
 2NWM A;  1VIE A;  1BB9 A;  1NBE B;  1RAC B;  3HKS A;  3CXC P;  1W2B P;  1SSF A;  2K2V A;  2VC8 A;  1PKS A;  3CPW P;  3URG A;  4RG8 A;  3VQW A;  4OGC A;  5D6Y A;  3GPL A;  1KHC A;  3RIR A;  1WNL A;  1NJ8 A;  3MP8 A;  1ZBJ A;  2E5A A;  1KQS P;  4EX5 A;  3CCL Q;  2RQT A;  1VQ4 Q;  2E1H A;  4HA8 A;  2IY5 A;  2C06 A;  3L2V A;  1B76 A;  3BDU A;  3NFC A;  1ZSZ B;  3V7R A;  4IIM A;  4YCW A;  3D7S B;  1TXQ A;  4N4G A;  2DIL A;  2QK0 A;  2DL8 A;  3VJP A;  4F16 A;  3CME A;  3DKM A;  3KXT A;  2EL9 A;  2RJC A;  4A53 A;  5GJV B;  2RHQ A;  2JTM A;  1X69 A;  4C92 G;  4BE2 A;  4TWA A;  3CC7 A;  2AHJ B;  4F17 A;  2NS6 A;  2KYM A;  4L59 A;  2ZIM A;  1ZUY A;  4JJD A;  2J3M A;  2QHS A;  2D6F A;  2F5T X;  3G1J A;  4E2F B;  3IAL A;  2FRY A;  2JTF A;  1BI3 A;  4FIB A;  2QTV A;  3N5B B;  1Y7X A;  2XMF A;  1B7T A;  4DBR A;  2F2X A;  2RPN A;  1EVL A;  4R55 A;  1NJ1 A;  2JMC A;  2J3L A;  4E7I A;  2ZPB B;  3CC4 A;  4OB2 B;  2KRO A;  3I5R A;  5CKB A;  4Z88 A;  5I2M A;  1UHC A;  2X3X D;  4XTZ A;  3G4S T;  3J81 E;  4CC7 A;  3CMA A;  3M53 A;  5KYW A;  2HMA A;  2RN8 A;  1QP3 A;  3TUP A;  2SEM A;  1VQ6 T;  4LVK A;  1Q82 U;  1HC7 A;  2JM9 A;  1ZX6 A;  1K9M R;  1G83 A;  5GAM d;  2OX7 A;  4N0A A;  5FWC A;  4BW9 A;  5GAN e;  1KQ2 A;  1PSE A;  1R0C B;  2EJ9 A;  2EKH A;  2CYZ B;  2A08 A;  4HCK A;  2JXB A;  1OUL A;  2JZ2 A;  3TU4 K;  2ZT5 A;  4P3P A;  3THK A;  2ALY A;  2RHI A;  1VQO A;  4OMO A;  3CMA T;  2LT4 A;  3R6O A;  5EC7 A;  3EG0 A;  1B8A A;  2E4H A;  2W0Z A;  2GNC A;  1UEC A;  2IPO B;  1YJW T;  4PHC A;  2O31 A;  3A32 A;  1E6H A;  3TSZ A;  2MWP A;  4JS5 A;  3M0P A;  5GAM j;  3CPF A;  2AK5 A;  1E6G A;  3EFR A;  1Y96 B;  3I7F A;  3O8V A;  3OB9 A;  4M7A F;  2ODR C;  1MMA A;  2V1R A;  4OVA A;  4D6W A;  4JRI A;  3JCM V;  4XEM A;  5GAN 5;  1H4S A;  1YIT T;  1XTD A;  2FB7 A;  2ZT8 A;  1IHV A;  1U1S A;  3DSQ A;  1KSW A;  4CRI A;  4WJ3 M;  2Z0W A;  2HBP A;  3QYH B;  1WA7 A;  1VQ9 A;  3RMQ A;  3VKI A;  1EOV A;  1VIF A;  2K3X A;  3MPU B;  1YCS B;  3INZ A;  3TCJ A;  3QII A;  3CCS A;  1Q82 R;  1BCO A;  3CBO A;  3M0Q A;  2RK1 A;  4PNO A;  2JUF A;  1ACM B;  4HWT A;  4F14 A;  3CCL T;  4XTY A;  1VQ4 T;  1K73 C;  2ED0 A;  2I4L A;  2JT4 A;  4P73 A;  2E3C A;  5GMK h;  1HXD A;  2LCC A;  11AS A;  4M78 C;  4OMF B;  4TVR A;  4X34 A;  3WVD B;  4LUE A;  5LJ5 g;  4EMG A;  3JB9 J;  1QKX A;  1ZA1 B;  1ZSZ A;  1B34 A;  1UEB A;  3WVE B;  1NM7 A;  4FT4 A;  4P74 A;  1VQP A;  1BIB A;  2DMO A;  4PJL A;  4BE0 A;  2VAS A;  2HQX A;  4P75 C;  2QQB A;  1UFF A;  3NTH A;  1PKT A;  2A28 A;  1OPL A;  1YNZ A;  4FW1 A;  1Z7M A;  3JSC A;  2XGT A;  2I4O A;  1UGS B;  2GTJ A;  3FDR A;  3OD1 A;  4PJO A;  3REU A;  3RDV A;  2EGE A;  5K1X A;  5I11 A;  3NEL A;  5FW9 A;  4II1 A;  2ZTG A;  2ZZF A;  1X43 A;  4YRT A;  3HRU A;  4NL3 A;  4PJO D;  2G4C A;  1Q86 C;  3G1Z A;  1RLQ C;  3HFV A;  3OYI A;  2EGA A;  2FG0 A;  4X1V A;  5LJ5 h;  1UGR B;  3NEM A;  1SER A;  5LL6 S;  3CCQ A;  3HRI A;  3A7A A;  2YRC A;  4BI8 B;  1T0H A;  2YLC A;  4JZ3 A;  3OYF A;  2ZT6 A;  5CK9 A;  2HL5 C;  1UGQ B;  2LC4 A;  3MP1 A;  3VS1 A;  1M90 C;  2QHV A;  4OGE A;  4KBM B;  1RAI B;  3L2W A;  1D0X A;  3MP6 A;  3ICA A;  1EIY A;  4TQF A;  2RB6 A;  3JB9 F;  2OTL A;  2HAX A;  2NUT B;  1JJ2 S;  2ZNI A;  2JOY A;  3L42 A;  1M27 C;  1M2V B;  1CKB A;  2CZ1 B;  2KRS A;  4K11 A;  3UAT A;  1AWO A;  5DLQ E;  3O5Z A;  1QMC A;  4M75 F;  2X3W D;  2YUQ A;  1AOJ A;  2DM1 A;  3VRZ A;  2NUP A;  1ABQ A;  3GOX A;  5GAN 6;  2FPD A;  2GBQ A;  2AZS A;  4C8Q G;  2YRD A;  4UC4 A;  4MZM A;  1VA7 A;  1Y96 A;  2KGT A;  3LLR A;  1QVG A;  2MI6 A;  1VQN A;  1ZA2 B;  4M77 A;  4CH4 A;  4LVJ A;  1WXB A;  4E7Z A;  5J39 A;  1OZ3 A;  2P0L A;  1PWT A;  1N5Z A;  1YWP A;  1UDL A;  5HKC A;  3AHU A;  1NLO C;  1WYX A;  3NMZ C;  1JJC B;  4NCX A;  2CP6 A;  2ROL A;  4M77 D;  1ASY A;  2Q5I A;  1OV3 A;  4K88 A;  3HHT B;  1N6A A;  1UTI A;  2AZV A;  2EYZ A;  2RJD A;  5GMK j;  4BDY A;  3CC2 T;  1S1N A;  2Y4X A;  3RER A;  5GMK l;  1MV0 B;  1G5I A;  2CKK A;  1KJW A;  1JB0 E;  1RUW A;  5IN1 A;  4AFS C;  3EGD B;  3BW1 A;  1N9R A;  1KOG A;  2BZY A;  3MCA B;  5J26 A;  1C1A A;  3A7R A;  4P72 A;  4ELZ C;  1K9A A;  1C0A A;  2K5I A;  1KD1 C;  2EYY A;  2VUB A;  1E22 A;  4EMK C;  5LJ5 d;  2DTI A;  2R57 A;  3VYH B;  4ELY C;  8AT1 B;  4ZTU B;  4FYV B;  4CS2 A;  1PNJ A;  1JJ2 A;  2DXT A;  1FMK A;  1K8A R;  2OI3 A;  1D1C A;  3M4Q A;  4RG2 A;  3RR6 A;  2DBK A;  3I5S A;  2CT3 A;  4H2S A;  2FRW A;  1Z9Q A;  3CD6 A;  4XU1 A;  1BI1 A;  3OBW A;  4ZTZ B;  2YWW A;  2KNB B;  2OJ2 A;  3PZC A;  5GJW B;  2EKO A;  2Y90 A;  1MMD A;  2PU9 B;  5LJ5 j;  1QE0 A;  2DEQ A;  1S72 A;  4FYW B;  3QXE B;  3R07 A;  2RHU A;  2K5F A;  1TUG B;  1EVK A;  2K2M A;  3E9F A;  2HSP A;  3OYE A;  5KYY B;  3JB9 I;  5KYU A;  2V8J A;  4YRF A;  3TVT A;  2DTO A;  5CQX A;  3UT1 A;  1ZUU A;  3HP9 A;  5GAN 2;  3RF1 A;  2Q7G A;  1FMW A;  1WIE A;  3IKM B;  2WSF E;  2MK5 A;  3KFV A;  2PNI A;  3G6E Q;  5CKD A;  2L89 A;  4JUV A;  1UHF A;  2E6N A;  1NLP C;  2X4J A;  2QQR A;  3ZBD A;  1YB3 A;  2K3Y A;  2XU8 A;  1WX6 A;  1YJN A;  4M7A G;  1TS9 A;  3FC3 A;  1QCF A;  1OX8 A;  2KXC A;  2NUT A;  4N4I A;  1MMN A;  1QW1 A;  3MJX A;  3WXM B;  5HY6 A;  4J9H A;  1HSQ A;  1TSF A;  3ERR A;  4UPA A;  4FYX B;  1VQM T;  1W66 A;  1RAD B;  5AT1 B;  1X2K A;  3OS5 A;  3JCM e;  4M78 E;  4YCV A;  2C0T A;  2LQ8 A;  3JCM g;  2BZX A;  3NTI A;  2E65 A;  4KGX B;  3QUI A;  2A8E A;  2ZPE B;  2YUO A;  3C0C A;  2MF2 A;  5A0D A;  1P92 A;  4XU2 A;  4J9C A;  1GRI A;  4RTT A;  9ATC B;  2DU5 A;  2DQ0 A;  3EFO B;  1ZSG A;  3M55 A;  3CCE A;  4XEO A;  3QWX X;  1J3T A;  1QVG P;  4HWS A;  2CS7 A;  1JJC A;  4IUV A;  5ECA A;  1IRX A;  5HK3 A;  3I56 T;  2X4Y A;  2YRV A;  1BI2 A;  4QQD A;  1WHJ A;  1NYF A;  2KYB A;  2HKN A;  4F04 B;  1TUC A;  3OYG A;  1UGV A;  4KGV B;  2BKD N;  3C12 A;  1M5Q 1;  2B8A A;  1T3L A;  2GFU A;  2XIC A;  3OYJ A;  3EGU A;  3TEH A;  4M7D B;  2BIV A;  3EG9 A;  2JMA A;  2X4W A;  2LNH B;  3JCM h;  5CCA A;  1B70 A;  2XD0 A;  2RM4 A;  2VWF A;  1W70 A;  3MEV A;  2J6K A;  4FL6 A;  4RQE A;  2RI5 A;  1NJI R;  2ZPF B;  2A7Y A;  2J6F A;  2ZR2 A;  3UFG A;  1SPK A;  3QO7 A;  4M78 G;  3FB9 A;  1OZ2 A;  4WF2 A;  4JPB W;  1NJ5 A;  1V1C A;  1ZUK A;  1KIK A;  4BE1 A;  1WFW A;  1IGQ A;  1JJ2 P;  4JRK A;  3C4S A;  3UA6 A;  1HK9 A;  5FRM A;  3R6N A;  3VUZ A;  1JO8 A;  3LWI A;  2PMF A;  1M3B A;  1B7Y B;  4PJO F;  1KFZ A;  4KUL A;  3CME Q;  2LNV A;  3OYH A;  2C0O A;  1H64 1;  2YUN A;  4EIK A;  5GAM e;  3CCJ Q;  5GAO q;  5KYY A;  2X4X A;  4IKF A;  3OBY A;  2KE9 A;  4LNP A;  1QVP A;  5CAI A;  1ZQ1 A;  5D7U A;  2ROT A;  3G6E T;  4BWA A;  5GAN 3;  2AT1 B;  3BFM A;  2AMC A;  2KBT A;  1KC8 C;  1N8R R;  3OYN A;  2HCK A;  2DJZ A;  3FLG A;  2M9U A;  4HVU A;  4C8Q C;  4CC3 A;  2L2P A;  1U1T A;  2QAS A;  2ZNJ A;  3RKW A;  4P75 A;  1I4K 1;  1AD5 A;  3CC4 Q;  1UJ0 A;  3LSS A;  3CBM A;  4QVD A;  1C6V X;  1TH7 A;  4P5N A;  2GCX A;  3LGL A;  5GMK i;  2MYS A;  1M1K C;  1U8R A;  4OMM A;  3TEE A;  4F7U E;  3QZ5 B;  1K76 A;  4HXJ A;  2X9H A;  1ZBX A;  1UUE A;  2K79 A;  2O4X A;  1SEM A;  4LXC A;  2DO3 A;  1H8K A;  4GBQ A;  2HBW A;  4J8O A;  2FO0 A;  4TVA A;  2LQK A;  3EFO A;  5HGQ A;  4YRM A;  4IUP A;  3LWH A;  1Y07 A;  1VQO Q;  4H2Y A;  4P3N A;  1WXT A;  4O2D A;  4JJC A;  1AZG B;  1R77 A;  1WHM A;  4M77 F;  2ABL A;  4KR3 A;  2KXD A;  2DRK A;  1VQL Q;  4AG2 C;  2JJ9 A;  1HJD A;  1M3A A;  2E41 A;  1QVF S;  2DDZ A;  1YFT A;  2VXF A;  5I22 A;  2IG0 A;  3OQ5 A;  1Q81 R;  4QQ6 A;  5GAN 4;  2RHZ A;  3QO5 A;  4M7D A;  2JS2 A;  2O01 E;  2COZ A;  3HPW A;  1GFC A;  2DJQ A;  3M9Q A;  1VQ9 Q;  1XOV A;  1AWJ A;  1HYO A;  2DFU A;  4MMK A;  5CVI A;  2DVJ A;  4QKU A;  5M9O A;  3CCJ A;  1I1J A;  4TQD A;  3RNJ A;  4M7D D;  1USY A;  4F7U G;  3CCS Q;  4HWO A;  3E19 A;  4JLG A;  2RA2 A;  2Q7H A;  3FJ5 A;  3QTC A;  2JM8 A;  3A8L B;  2EQU A;  1BYM A;  2PUO B;  2YUP A;  1RAA B;  2AIR B;  4XU3 A;  2P4R A;  2I0N A;  4CC4 B;  1MMG A;  5DM7 R;  2Q7E A;  3OS1 A;  1NYG A;  3M4Y A;  3VQX A;  3CME T;  5FWB A;  5C0M A;  1AZE A;  4BDZ A;  1MGQ A;  3L4G B;  1GCQ A;  1VQP Q;  5FLX E;  3EGX B;  1BK2 A;  2VGN A;  4M7A C;  3NGP A;  1VQ8 A;  2NYS A;  1WJR A;  3CC7 T;  1TOV A;  1RL2 A;  4HCB A;  1JRI A;  1QWF A;  2EW3 A;  4C92 A;  1PG5 B;  2DA9 A;  1IL2 A;  4J9F A;  3EFS A;  2IVW A;  4RDX A;  1TTH B;  1D1A A;  1QWE A;  2KAF A;  2HDA A;  2HZY A;  2E10 A;  3PVL A;  2NUZ A;  1DJ7 B;  3NTK A;  1KD1 U;  1H4T A;  4C92 D;  3CC4 T;  5A0L A;  1QVF A;  5IHI A;  5CKH A;  4P71 A;  2JN0 A;  3VS6 A;  5GMK e;  3M58 A;  2E5Q A;  4KUD K;  3EAE A;  4RTX A;  4YRR A;  2QEX A;  4PLL A;  5FRN A;  1YI2 Q;  2XDP A;  3FRN A;  3JCM Q;  3CCQ Q;  5D6W A;  1XQH A;  5A2Q E;  3OYD A;  3JAM E;  1VQL A;  1EFW A;  3QSU A;  2ZCF B;  4E7H A;  1YIJ A;  1RI9 A;  4B9W A;  2P0K A;  8ATC B;  2CGH A;  1SG5 A;  2KK4 A;  3SFM A;  3M0T A;  4OLF A;  2E3I A;  4OB3 B;  1I0C A;  2BE7 D;  3A1P A;  4TVW A;  4BI4 A;  2RQW A;  2RH2 A;  4J6Y A;  3Q1J A;  4J9G A;  1G51 A;  1VQO T;  2OTL Q;  2O9S A;  3A5Z B;  2LMJ A;  3QO8 A;  3KUF A;  3LH0 A;  2HQE A;  3QKJ A;  1FXX A;  2ATC B;  4O6J A;  4D8K A;  4DQ2 A;  1MV3 A;  3I55 A;  2K3B A;  4KQE A;  1W6X A;  2DZ9 A;  2V8K A;  1X56 A;  1AWW A;  1RAF B;  4JRQ A;  5KYX B;  1IRE B;  4XTV A;  4C8Q B;  1ADY A;  5LJ5 e;  2CUB A;  2JNG A;  1KQ1 A;  1X27 A;  2E12 A;  2ZIO A;  2B86 A;  4PJJ A;  2M0O A;  4XTW A;  1VQ9 T;  1VQN Q;  1NNH A;  4ZNX A;  4RUG A;  2G6F X;  2J6O A;  3G7Z A;  1SET A;  3M56 A;  1ZHI A;  1YJ9 Q;  2EWN A;  4A4G A;  2SRC A;  2H3E B;  2D9T A;  2R5M A;  4AMC A;  3CCS T;  1PM3 A;  1T3S A;  3CQT A;  3CCR Q;  1U06 A;  3A7U A;  2VVK A;  4PFP A;  4C5H A;  1G5H A;  3OYA A;  1QVG S;  1J5W A;  3HFO A;  4JZ4 A;  1A0N B;  2OAU A;  4B6M A;  2DQ3 A;  5KE2 A;  2O88 A;  3P8V A;  4C8Q E;  3RAC A;  1Y57 A;  3PMI A;  4M75 C;  1VQZ A;  4ZTF A;  4MZP A;  4C5I A;  3UGQ A;  1JEG A;  1VQP T;  3HXV A;  1UGP B;  3VUB A;  2EJF A;  4M4Z A;  3L4G A;  5FU7 C;  2DNU A;  1OOT A;  4JJB A;  1VQK A;  2K5L A;  1PD0 A;  3JCM c;  4GY5 A;  4IUQ A;  1YI2 A;  4A4F A;  2OTJ A;  4GLK A;  1QLY A;  4LDV A;  2QYZ A;  2DYB A;  2E64 A;  2VV5 A;  3E2U A;  1W1F A;  2CP0 A;  3VS2 A;  2DL7 A;  3E9H A;  5GAO r;  1OU8 A;  3CD6 Q;  3P8H A;  2QA4 A;  3SWN C;  4OMN A;  4YYE A;  1G5V A;  3GF5 A;  1WLP B;  3G71 Q;  5F5W A;  3VQY A;  2VXE A;  4DEX A;  2KQW A;  4RTZ A;  1BBW A;  4RTW A;  3H9N A;  2KEA A;  4J9D A;  2CP3 A;  1FYN A;  1B07 A;  2V8I A;  2QI2 A;  2JTE A;  1S72 Q;  2GQV A;  3E1S A;  3GNF B;  3CCQ T;  4OF1 A;  2QAZ A;  5A0G A;  4RMO A;  3QZ9 B;  3MF2 A;  1QVF P;  3PE0 A;  2LCL A;  2BUD A;  1KK7 A;  2EJG A;  2MOX A;  2DVE A;  3ZFJ A;  3BJU A;  4E47 A;  1M3C A;  3QWY A;  1Q7Y U;  4RTV A;  5HCK A;  1I5L A;  1FMV A;  2K6D A;  1K9M C;  1LNX A;  4C0D C;  2OTL T;  1YJN Q;  4M7A B;  2HD0 A;  1YJ9 A;  4DA4 A;  3A5Z A;  2PVG B;  2A0F B;  4QW2 A;  2RQR A;  3J80 E;  1I81 A;  5K1P A;  1KHI A;  1X75 C;  3X20 B;  3MEY A;  4A4E A;  3VYG A;  4CS4 A;  3CCR A;  1SSH A;  2E6Z A;  2L3S A;  1KC8 U;  1PHT A;  3EG2 A;  2KI7 A;  4LD9 K;  4KUI A;  1G3S A;  3GIB A;  3HXZ A;  5LJ3 g;  1BCM A;  3GNG A;  5KYX A;  4C8Q A;  1VQN T;  2QGG A;  3JCM X;  4G85 A;  4LVL A;  2DK3 A;  3RL6 A;  3TSW A;  2LJ0 A;  3EHR A;  3GLX A;  4M7A E;  3V7S A;  2PTK A;  4C8Q D;  3HY0 A;  3CCE Q;  1X01 A;  3QPH A;  5FU6 C;  3WQZ A;  3J7A F;  2IIM A;  3REA B;  4BB7 A;  1YHQ A;  1WHL A;  4M7D F;  2DZC A;  4PJN A;  1SRY A;  1SHG A;  3SD4 A;  1Q82 C;  1VQ7 A;  2PVO B;  1X54 A;  5CO7 A;  4K86 A;  2CT4 A;  2P0P A;  5EG2 A;  3V8J A;  3X26 B;  5C6S A;  1LCK A;  1QCN A;  4N0A C;  2I4M A;  1K0X A;  2HL3 A;  3A74 A;  3FJP A;  4L5G A;  4HVW A;  1N9W A;  2ESW A;  3G71 A;  4YRC A;  1R0B G;  3A8G B;  5C53 B;  5LJ3 h;  2CH4 W;  4C0G A;  3UH0 A;  1D1B A;  3CBP A;  3IQL A;  1X2Q A;  2RMO A;  2QHT A;  5GAN f;  3OYB A;  4H2X B;  1BIA A;  1H4Q A;  2A36 A;  3VV0 A;  3CCU Q;  4AT1 B;  4YRO A;  1EZZ B;  2XI9 A;  4VUB A;  3HXX A;  1QQJ A;  3EH1 A;  3CD6 T;  1I5O B;  3MO8 A;  2YXY A;  3C95 A;  4M78 B;  4YCU A;  4CH3 A;  4DEY A;  5GAO p;  3QYG B;  3G71 T;  4J9B A;  3MQZ A;  2R5A A;  3VS7 A;  2P5I A;  2RHS B;  2YT6 A;  3QJ6 A;  4C92 F;  4MDW A;  2DF6 A;  3JCM P;  4RMF A;  1S72 T;  3UDC A;  2FVU A;  1IZ6 A;  2EQK A;  2P0Q A;  1WQ7 A;  4YRJ A;  2CSQ A;  1NEG A;  2MAM A;  1M2V A;  4QQG A;  4X9D A;  3E9I A;  6AT1 B;  4FYY B;  3OYK A;  2LP5 A;  1GCP A;  4HWR A;  4P73 C;  3L2Q A;  2KSS A;  4YDQ A;  4M75 B;  1AEY A;  1WYD A;  1QCO A;  5FRO A;  2KRN A;  1LPL A;  4AG1 C;  5GAO m;  4A54 A;  1YJN T;  1N9S A;  2EQJ A;  4XU0 A;  2LX7 A;  5FU7 B;  1NG2 A;  1YN8 A;  5KYN A;  1YFR A;  3HFZ B;  1HTT A;  4M7A A;  2ED1 A;  1JXO A;  4P74 C;  2CZ6 B;  3H8Z A;  4DPG A;  1OEB A;  4JJN K;  3HRK A;  2VGM A;  4ORZ A;  1MHN A;  4KT0 E;  4ZGD B;  2EAY A;  3CXC A;  4OML A;  4M7A D;  5HK0 A;  2D0N A;  1WGS A;  1LYL A;  1QF6 A;  4PJO C;  2CP5 A;  4EO4 A;  4M75 E;  1VYV A;  3P8D A;  1VQ5 A;  3EGD A;  3QNE A;  3JCM J;  4AFZ C;  5L23 A;  2DXU A;  4H02 A;  3PGG A;  3CCV A;  5C52 B;  2EVR A;  5LJ3 d;  3CCE T;  3LW5 E;  3RGL A;  1H92 A;  3PMT A;  2M16 A;  2EIF A;  2AKK A;  1NYR A;  1RIQ A;  3H0I A;  3CCU A;  4PK4 A;  2C0I A;  2O2O A;  1WU7 A;  3I35 A;  3PNW C;  4WJ4 A;  4QT7 A;  2L3R A;  2LCS A;  3OA6 A;  1SES A;  1FWZ A;  3MHX A;  1WPY A;  2MWO A;  3P8B B;  4Q5W A;  3S6W A;  1T0J A;  3A8M B;  2LT1 A;  2RJF A;  5LJ3 j;  4YRG A;  2EGC A;  3HL8 A;  1Z7N A;  1NJ6 A;  5I2S A;  3H0H A;  1XNI A;  2ODR D;  2RHQ B;  4LDW A;  3LH5 A;  4XTX A;  4E51 A;  3JB9 G;  2LQW A;  1NEB A;  1V29 B;  2HKQ B;  4BAC A;  2CUD A;  4H2X A;  5IH2 A;  1K73 U;  4YRL A;  3PIO A;  3DB3 A;  2O9V A;  5I21 A;  4F7U B;  3ZEH A;  4M78 A;  1K8A C;  3HXU A;  12AS A;  3LX7 A;  4M75 G;  4KH0 B;  4V2S A;  2DU7 A;  4KR2 A;  1RAE B;  1G3W A;  2CZ0 B;  4RCC A;  4ZGJ B;  3UGT A;  4LDY A;  4PFO A;  2RHS A;  1G2B A;  4FU6 A;  2KDS A;  4M77 C;  5DY9 A;  4LDX A;  1BI0 A;  2PUK B;  5FU6 B;  1WZO A;  4M78 D;  4RTY A;  4EMK B;  2K9G A;  3UF4 A;  1OI1 A;  2VKN A;  2LJ1 A;  2DD5 A;  5D6X A;  2MCN A;  4WTO B;  3A31 A;  1VQ8 Q;  2RI3 A;  2DL4 A;  1EFN A;  2XTI A;  1V76 A;  2DAQ A;  2XID A;  4Y28 E;  5ELO A;  2E70 A;  3HXY A;  1TG0 A;  2A37 A;  1ASZ A;  4P3O A;  2H8H A;  4BUG A;  3M54 A;  1M1G A;  4FM4 B;  1PRM C;  2YDL A;  1Q86 U;  1AVZ C;  1JBM A;  2DYI A;  4P72 C;  2XG8 D;  4HVV A;  3HY1 A;  3OS2 A;  1MND A;  1D09 B;  2Y4Y A;  1K73 R;  1KMN A;  4G84 A;  2HEQ A;  4ME7 A;  2LVM A;  5IXF A;  4FW2 A;  4LD6 A;  2ART A;  2QEX Q;  3OYY A;  7AT1 B;  3A8O B;  3TRE A;  4LVM A;  2QQA A;  1PRL C;  2WSE E;  2LZ6 B;  4E7K A;  3VRY A;  2D8H A;  4H2U A;  1M90 U;  3M5A A;  4JDS A;  1YIJ Q;  2K57 A;  2VYT A;  3P8T A;  3DLM A;  4BY6 C;  1YIT Q;  2M51 A;  3X25 B;  1BBZ A;  1TWB A;  2L3Q A;  2F2V A;  1CSK A;  4CH5 A;  4EDU A;  3OW2 S;  1JU5 C;  3OSV A;  3A98 A;  1YFS A;  3RUX A;  1D3B B;  4UP7 A;  4YPF A;  3M4P A;  4CC2 A;  4C8Q F;  2JW4 A;  3ASK A;  2F1L A;  1Z9Z A;  2I4N A;  4H2W A;  2RI2 A;  3MF1 A;  4H2T A;  1O9S A;  1O75 A;  1Q95 G;  3I55 Q;  1K9M U;  1C0M A;  2ZGW A;  3H6Z A;  4JRP A;  1X2H A;  2CIM A;  1B34 B;  1ATI A;  1Q86 R;  1H4V B;  2RF0 A;  2ZT7 A;  2RD1 A;  4YRQ A;  2QXF A;  1X2G A;  1NPR A;  4C0Z A;  3ZL7 C;  2PVD B;  4ZN3 A;  4CI0 C;  2CZ7 B;  3BY7 A;  3G4S A;  3CCJ T;  1B7Y A;  4RKU E;  1G3Y A;  5ELN A;  2CP7 A;  1NZ9 A;  4PG3 A;  3VS4 A;  4PJO B;  1M90 R;  1VQ6 A;  3MEA A;  1NJI C;  2CDT A;  3MEU A;  4F7U A;  4XQ3 A;  3QJY A;  1WJS A;  4LNS A;  2M0Y A;  3HTZ A;  3RMS A;  2QQS A;  1SRL A;  3CCM Q;  5CKF A;  4YRP A;  4TVY A;  4LVI A;  4KGZ B;  3FEO A;  3VU3 C;  3TQ7 P;  3JCM f;  5IT9 E;  1WLE A;  1H3Z A;  4EMK A;  4Z8A A;  4OP0 A;  2EYX A;  3S3N A;  2X51 A;  5GAN 7;  1VQ8 T;  1JQQ A;  1ADJ A;  1VQK Q;  3OW2 A;  3F70 A;  4L6V 5;  4J7F A;  1GL5 A;  1K4U S;  4X5O A;  1YJW A;  2OTJ Q;  4IUU A;  4PJO E;  2GF7 A;  2DD4 A;  1I8F A;  4ANJ A;  1EIY B;  2QDY B;  3P8Y A;  4GLM A;  3MKD A;  2GQI A;  4ZGE B;  1X6G A;  5GAN g;  2ARS A;  2QA4 Q;  1YGB A;  1SRM A;  2DL5 A;  2GTO A;  1YIT A;  1WHG A;  3L2Z A;  3DLL A;  1N8R C;  3EG1 A;  4OMQ A;  1LOJ A;  2EBP A;  2W10 A;  4FT2 A;  1M9S A;  3TEG A;  1M1F A;  4RTU A;  1WHK A;  2QEX T;  2FL7 A;  2FZC B;  4IUT A;  2EQI A;  2WSC E;  2NUP B;  2HSE B;  1OX9 A;  3QG1 A;  3OYM A;  2J05 A;  3L2R A;  1VOM A;  1TUD A;  2BTT A;  2QTX A;  2A3L A;  1VQL T;  1WDX A;  3CCL A;  1YIJ T;  1VQ4 A;  1KMM A;  2QQ9 A;  3QHS A;  4ZIB A;  2L3P A;  2DTH A;  3OMG A;  3LGF A;  2AKL A;  4XAX B;  4M77 B;  2LDM A;  1KD1 R;  2PME A;  3I9Q A;  2RQV A;  2COY A;  2FPE A;  2L0A A;  1L0W A;  2F2W A;  5GAO n;  1IHW A;  3VS0 A;  3KBG A;  5GAN h;  1D3B A;  4OMP A;  5GMK m;  2ECZ A;  2RJE A;  2DE0 X;  3OY9 A;  3BDL A;  4NOY A;  2QGF B;  3I55 T;  3CC2 Q;  4B9X A;  4PJO G;  1ARK A;  2CJ9 A;  2XKO C;  4PLI A;  3UA7 A;  4LN2 A;  2QHU A;  1YFN A;  1PD1 A;  4A63 B;  4D8D A;  2LQN A;  3M4G A;  1YCY A;  3CCM A;  5GAM f;  2CJA A;  2I2L A;  4M77 E;  4MZT A;  2QDL A;  2FYK A;  2WAC A;  4HVC A;  5J3B A;  3PFS A;  3HTR A;  2RHX A;  4YP0 A;  2VB6 A;  1Q81 C;  2ZPI B;  2DPP B;  4O5V A;  4J7I A;  5IXB A;  4E7S A;  4N4H A;  1AWX A;  3EGX A;  1LJO A;  1M4Z A;  1U5S A;  3A8H B;  4DOV A;  2XHC A;  2YSQ A;  1XJW B;  2OAW A;  3GP8 A;  1YHQ Q;  3CCM T;  1WHH A;  3PT9 A;  4BY6 B;  1EX4 A;  2XDD A;  1B3Q A;  2RQU A;  3JCM W;  4R56 A;  1VQ7 Q;  3H0F A;  2DLP A;  2KVQ G;  2DEU A;  1K1Z A;  1RI0 A;  1U3O A;  2M02 A;  4IUR A;  1M8V A;  4WCI A;  2BZ8 A;  2DX1 A;  4M78 F;  4JS4 A;  1VQK T;  2ZZG A;  5KYU B;  1OQK A;  4ESR A;  1YI2 T;  2OTJ T;  1IB8 A;  5KH6 A;  3EH2 A;  3GBQ A;  4E7L A;  4YRK A;  1UE9 A;  1VYT A;  2QA4 T;  4J83 A;  5CR2 A;  4IIO A;  2L5Q A;  4ATO A;  2FPF A;  2ZPH B;  4M77 G;  1SKU B;  2CSI A;  4HCZ A;  3OW2 P;  3CEY A;  4YRN A;  4M7D C;  1PYS B;  2JS0 A;  2D1X A;  1GFD A;  2JVV A;  2ZAE A;  1VYU A;  2J06 A;  3FIF A;  3OMC A;  3M0S A;  5GAN d;  3PVQ A;  3M0R A;  4JLI A;  2DIQ A;  4PJM A;  4K87 A;  2MMP A;  1WJQ A;  1X55 A;  1K8A U;  5IAY A;  4KRT A;  2YLB A;  1Y0M A;  3RES A;  3VS3 A;  3U23 A;  1USY C;  4UP9 A;  1VQM Q;  3AT1 B;  3CC2 A;  1E1T A;  1M8M A;  1OPK A;  3H41 A;  2ARU A;  3LC0 A;  4YRE A;  3QO3 A;  5LJ3 e;  5GAN 8;  5IHN A;  1MNE A;  4HT4 A;  3SB2 A;  2DET A;  2MIO A;  2LX9 A;  2ZCE A;  2RHY A;  2KT1 A;  3V8L A;  2DER A;  1AHJ B;  1RLP C;  3UPU A;  2PZ1 A;  3OYC A;  5GAN j;  1YJ9 T;  2K4Y A;  1F1B B;  1GCQ C;  1M1K U;  2EYW A;  3X28 B;  1RAB B;  1W4S A;  1PSF A;  2LRQ A;  3CCR T;  2PQW A;  3I56 Q;  1AT1 B;  4PKC C;  4C92 C;  2ZXF A;  5CIU A;  1KG1 A;  2ZR3 A;  1N27 A;  1PCX A;  1IXD A;  3PIP A;  3M59 A;  1Q7Y R;  2C8M A;  2CP2 A;  3TEH B;  2G3R A;  4FSX A;  3EG9 B;  1X6B A;  2DIG A;  1VQ5 Q;  3HSB A;  1B70 B;  4XK8 E;  3JCM b;  4P71 C;  3VQV A;  4A4H A;  3CCV Q;  4QVC A;  1BKB A;  4HWP A;  1D0Z A;  1QP2 A;  4ZTJ A;  2Q5H A;  3S3M A;  3CXC S;  1W2B S;  2AKW B;  3W3S A;  1GGM A;  1EQR A;  1YHQ T;  3CPW S;  1KC8 R;  2P84 A;  3M57 A;  1VQ7 T;  4Y92 A;  1YBY A;  1OYX A;  2DXC A;  1GXI E;  2CH4 A;  2ZZD A;  1IGU A;  2KRM A;  3BE3 A;  1NJ2 A;  2ENM A;  1KQS S;  1RAH B;  5CKE A;  4FCY A;  2DL3 A;  3LYI A;  3KFU A;  1ABO A;  1M1K R;  2BE9 B;  4PFZ A;  4F7U F;  3RKY A;  3IKL A;  2RK2 A;  3OSS C;  2FZG B;  3M0U A;  3VS5 A;  3MET A;  1GBR A;  5L8R E;  2KT8 A;  1EIF A;  1NPP A;  1MUZ A;  1VQM A;  5C51 B;  4BD3 A;  3HRS A;  2AMC B;  2COW A;  5DLO A;  4CH6 A;  4HCC A;  3C94 A;  3MEW A;  1E7O A;  4Z89 A;  3RKX A;  1Y71 A;  3PCO B;  1R8O B;  2KMT A;  2KY9 A;  3SEM A;  4TTV A;  4MML A;  2X35 A;  4L87 A;  2XDB A;  5KCH A;  1PYS A;  2YHT A;  1ZSZ C;  1WQW A;  1M2O A;  2E3H A;  2CRE A;  1BU1 A;  4ZN1 A;  5LJ5 f;  1H3H A;  3UWN A;  1NJI U;  3HXW A;  3VBB A;  3A5Y A;  1UJY A;  3EG3 A;  3I56 A;  1NYQ A;  4C5E A;  1W2B A;  3LSQ A;  4DBF A;  3JV3 A;  4XTU A;  4LDU A;  2O4X B;  3CPW A;  3SWN B;  2R58 A;  2KR3 A;  3JB9 H;  1WXU A;  4PL6 A;  4QVZ A;  4TVA B;  2RNA A;  4OB1 B;  1G8X A;  2H3J A;  2FZK B;  2GGR A;  1KQS A;  5KNN A;  2V1Q A;  2EFI A;  2MPX C;  1OU9 A;  4R0K A;  5AYF A;  1E1O A;  3ER0 A;  2M1H A;  2ZIN A;  1TU0 B;  2E5K A;  1YWO A;  4KH1 B;  4Y91 A;  4MDX A;  3REB B;  2D8J A;  3SDZ A;  2C7I A;  1E24 A;  4AFQ C;  2V26 A;  4AFU C;  4J9I A;  1FX7 A;  2IY5 B;  1VQ5 T;  1N8R U;  3HRT A;  3DB4 A;  4C0D B;  1UB4 A;  4J6W A;  1RAG B;  3CCV T;  4YRI A;  2EQM A;  2LJ3 A;  2LTO A;  4UP8 A;  3V7C A;  1LVK A;  4J9E A;  4J15 A;  2F5K A;  3NHN A;  3REX A;  4A4K A;  3ULR B;  4WI1 A;  1PC0 A;  2AKW A;  1D0Y A;  3CCU T;  4HT9 A;  4FSS A;  3SHW A;  4CS3 A;  3PTA A;  4NS5 A;  3G6E A;  5CQY A;  1G3T A;  5KCO A;  2HNI A;  4HKE A;  1QKW A;  1I07 A;  3OS0 A;  1FYF A;  2P4T A;  3S3O A;  1UG1 A;  3E9G A;  1JXM A;  1Q7Y C;  1NE8 A;  4M7D E;  4AH6 A;  4DBQ A;  2CJB A;  2DBM A;  4Q15 A;  1YP5 A;  4YTL A;  3X24 B;  2DKG A;  4E6R A;  2NLU A;  2EYQ A;  2ZPG B;  4NL2 A;  3NET A;  3CMQ A;  3G4S Q;  4C92 B;  5GAM g;  5KYW B;  1K0S A;  1IO6 A;  3CC7 Q;  4DBH A;  1VUB A;  4J5Y A;  4HT8 A;  5E3I A;  2ZZE A;  1VQ6 Q;  3EHQ A;  4YRS A;  2J7I A;  4EPC A;  3JRZ A;  4LE9 A;  4C0F A;  4M75 A;  2HQH A;  3PCO A;  1Q81 U;  2FEI A;  5IHK A;  3JB9 D;  3T9N A;  4DOW A;  4EMH A;  1CKA A;  1SHF A;  1X6O A;  3QBY A;  5LJ3 f;  4BI3 A;  5KE3 A;  5GAO l;  3NEN A;  2ALY B;  1WI7 A;  1BBU A;  2F69 A;  2DXB A;  2RO0 A;  4OB0 B;  3HFZ A;  2DRM A;  2K7A A;  1HD3 A;  4M75 D;  4C5G A;  3CMA Q;  2GFA A;  3IG2 A;  4C92 E;  4E7J A;  2QG9 B;  1M30 A;  3QDR B;  2XK0 A;  3HFN A;  4J6X A;  1YJW Q;  2FHD A;  4RQF A;  4H2V A;  2L8D A;  4X9C A;  3L2U A;  3RBB B;  3OYL A;  4LUD A;  5GAM h;  3SWN A;  3L1A A;  4Q6G A;  1GBQ A;  2EPD A;  3NPF A;  4M7D G;  3QDF A;  4Z02 A;  2D0Q B;  3ME9 A;  1ZLM A;  3V8K A;  4RCB A;  3JCM d;  1SF9 A; 
#chains in the Genus database with same CATH homology
 1VIE A;  3HKS A;  1SSF A;  2K2V A;  2VC8 A;  3URG A;  4RG8 A;  3VQW A;  4OGC A;  5D6Y A;  3GPL A;  1KHC A;  3RIR A;  1WNL A;  1NJ8 A;  3MP8 A;  2E5A A;  4EX5 A;  2E1H A;  4HA8 A;  2IY5 A;  2C06 A;  3L2V A;  1B76 A;  3BDU A;  3NFC A;  3V7R A;  4YCW A;  4N4G A;  3VJP A;  3CME A;  3DKM A;  3KXT A;  2EL9 A;  2RJC A;  4A53 A;  2RHQ A;  2JTM A;  4C92 G;  4BE2 A;  4TWA A;  3CC7 A;  2AHJ B;  2NS6 A;  4L59 A;  2ZIM A;  2QHS A;  2J3M A;  2D6F A;  2F5T X;  3IAL A;  2JTF A;  1BI3 A;  4FIB A;  3N5B B;  1Y7X A;  1EVL A;  4R55 A;  2J3L A;  1NJ1 A;  4E7I A;  2ZPB B;  3CC4 A;  4OB2 B;  5CKB A;  5I2M A;  4XTZ A;  3G4S T;  3J81 E;  3CMA A;  3M53 A;  3TUP A;  1QP3 A;  1VQ6 T;  4LVK A;  1Q82 U;  1HC7 A;  5GAM d;  4N0A A;  4BW9 A;  5GAN e;  1KQ2 A;  1PSE A;  2EJ9 A;  2CYZ B;  2JZ2 A;  3TU4 K;  2ZT5 A;  4P3P A;  2ALY A;  2RHI A;  1VQO A;  3CMA T;  2LT4 A;  3R6O A;  1B8A A;  1YJW T;  4PHC A;  3A32 A;  2MWP A;  4JS5 A;  5GAM j;  3CPF A;  3EFR A;  1Y96 B;  3I7F A;  3O8V A;  3OB9 A;  4M7A F;  2ODR C;  4OVA A;  4D6W A;  4JRI A;  3JCM V;  4XEM A;  5GAN 5;  1H4S A;  1YIT T;  1XTD A;  2FB7 A;  2ZT8 A;  1U1S A;  3DSQ A;  4WJ3 M;  4CRI A;  2HBP A;  3QYH B;  1VQ9 A;  3RMQ A;  3VKI A;  1EOV A;  1VIF A;  2K3X A;  3INZ A;  3TCJ A;  3QII A;  3CCS A;  3CBO A;  2RK1 A;  4PNO A;  2JUF A;  4HWT A;  3CCL T;  4XTY A;  1VQ4 T;  1K73 C;  2I4L A;  4P73 A;  2E3C A;  5GMK h;  1HXD A;  2LCC A;  11AS A;  4M78 C;  4OMF B;  4TVR A;  4X34 A;  3WVD B;  5LJ5 g;  4EMG A;  3JB9 J;  1B34 A;  1UEB A;  3WVE B;  4FT4 A;  4P74 A;  1VQP A;  1BIB A;  4BE0 A;  2HQX A;  4P75 C;  2QQB A;  3NTH A;  1Z7M A;  3JSC A;  2XGT A;  2I4O A;  1UGS B;  3FDR A;  3OD1 A;  4PJO A;  3REU A;  5K1X A;  3NEL A;  4II1 A;  2ZTG A;  2ZZF A;  4YRT A;  3HRU A;  4NL3 A;  4PJO D;  2G4C A;  1Q86 C;  3G1Z A;  3HFV A;  3OYI A;  5LJ5 h;  1UGR B;  3NEM A;  1SER A;  5LL6 S;  3CCQ A;  3HRI A;  3A7A A;  4BI8 B;  2YLC A;  3OYF A;  2ZT6 A;  5CK9 A;  1UGQ B;  2LC4 A;  3MP1 A;  1M90 C;  2QHV A;  4OGE A;  4KBM B;  3L2W A;  3MP6 A;  3ICA A;  1EIY A;  4TQF A;  2RB6 A;  3JB9 F;  2OTL A;  2HAX A;  1JJ2 S;  2ZNI A;  2JOY A;  3L42 A;  2CZ1 B;  5DLQ E;  4M75 F;  3GOX A;  5GAN 6;  4C8Q G;  4UC4 A;  4MZM A;  1Y96 A;  3LLR A;  1QVG A;  2MI6 A;  1VQN A;  4M77 A;  4CH4 A;  4LVJ A;  5J39 A;  1OZ3 A;  2P0L A;  5HKC A;  3AHU A;  1JJC B;  4NCX A;  4M77 D;  1ASY A;  2Q5I A;  4K88 A;  3CC2 T;  1N6A A;  3HHT B;  2RJD A;  5GMK j;  4BDY A;  2Y4X A;  3RER A;  5GMK l;  1G5I A;  2CKK A;  1JB0 E;  5IN1 A;  3BW1 A;  1N9R A;  1KOG A;  3MCA B;  5J26 A;  3A7R A;  4P72 A;  4ELZ C;  1C0A A;  2K5I A;  1KD1 C;  2VUB A;  1E22 A;  4EMK C;  5LJ5 d;  2DTI A;  2R57 A;  3VYH B;  4ELY C;  4ZTU B;  4CS2 A;  1JJ2 A;  2DXT A;  3M4Q A;  4RG2 A;  4H2S A;  3CD6 A;  4XU1 A;  1BI1 A;  3OBW A;  4ZTZ B;  3PZC A;  2EKO A;  2Y90 A;  2PU9 B;  5LJ5 j;  1QE0 A;  2DEQ A;  1S72 A;  3QXE B;  3R07 A;  2RHU A;  2K5F A;  1EVK A;  3E9F A;  3OYE A;  3JB9 I;  2V8J A;  4YRF A;  2DTO A;  5CQX A;  3UT1 A;  3HP9 A;  5GAN 2;  3RF1 A;  2Q7G A;  3IKM B;  2WSF E;  5CKD A;  2L89 A;  4JUV A;  2E6N A;  2X4J A;  2QQR A;  3ZBD A;  1YB3 A;  2K3Y A;  2XU8 A;  1YJN A;  4M7A G;  3FC3 A;  4N4I A;  3WXM B;  1QW1 A;  5HY6 A;  3ERR A;  4UPA A;  1VQM T;  1W66 A;  3OS5 A;  3JCM e;  4M78 E;  4YCV A;  2LQ8 A;  3JCM g;  3NTI A;  2E65 A;  3QUI A;  2A8E A;  2ZPE B;  2MF2 A;  5A0D A;  1P92 A;  4XU2 A;  2DU5 A;  2DQ0 A;  3CCE A;  3M55 A;  4XEO A;  4HWS A;  2CS7 A;  1JJC A;  4IUV A;  5HK3 A;  3I56 T;  2X4Y A;  2YRV A;  1BI2 A;  4QQD A;  3OYG A;  2BKD N;  3C12 A;  1M5Q 1;  2B8A A;  2GFU A;  2XIC A;  3OYJ A;  3TEH A;  4M7D B;  2BIV A;  2X4W A;  3JCM h;  5CCA A;  1B70 A;  2XD0 A;  2RM4 A;  3MEV A;  4FL6 A;  4RQE A;  2RI5 A;  2ZPF B;  2A7Y A;  3UFG A;  2ZR2 A;  3QO7 A;  4M78 G;  3FB9 A;  1OZ2 A;  4WF2 A;  1NJ5 A;  4BE1 A;  4JRK A;  3C4S A;  1HK9 A;  5FRM A;  3VUZ A;  2PMF A;  3LWI A;  1B7Y B;  4PJO F;  4KUL A;  2LNV A;  3OYH A;  1H64 1;  5GAM e;  5GAO q;  4IKF A;  2X4X A;  3OBY A;  1QVP A;  5CAI A;  1ZQ1 A;  3G6E T;  4BWA A;  5GAN 3;  3BFM A;  2AMC A;  1KC8 C;  3OYN A;  2DJZ A;  3FLG A;  2M9U A;  4C8Q C;  1U1T A;  2ZNJ A;  3RKW A;  4P75 A;  1I4K 1;  3LSS A;  3CBM A;  4QVD A;  1TH7 A;  4P5N A;  2GCX A;  3LGL A;  5GMK i;  1M1K C;  1U8R A;  3TEE A;  4F7U E;  3QZ5 B;  1ZBX A;  2O4X A;  2DO3 A;  4J8O A;  4TVA A;  2LQK A;  5HGQ A;  4YRM A;  4IUP A;  3LWH A;  1Y07 A;  4H2Y A;  4P3N A;  4O2D A;  4M77 F;  4KR3 A;  2E41 A;  1QVF S;  2DDZ A;  1YFT A;  2VXF A;  2IG0 A;  3OQ5 A;  4QQ6 A;  5GAN 4;  2RHZ A;  3QO5 A;  4M7D A;  2O01 E;  3HPW A;  3M9Q A;  1XOV A;  4MMK A;  5CVI A;  5M9O A;  3CCJ A;  4TQD A;  4M7D D;  1USY A;  4F7U G;  4HWO A;  3E19 A;  4JLG A;  2RA2 A;  2Q7H A;  3QTC A;  3A8L B;  2EQU A;  1BYM A;  2PUO B;  4XU3 A;  5DM7 R;  2Q7E A;  3OS1 A;  3M4Y A;  3VQX A;  3CME T;  5C0M A;  4BDZ A;  1MGQ A;  3L4G B;  5FLX E;  2VGN A;  4M7A C;  1VQ8 A;  1WJR A;  3CC7 T;  4HCB A;  1RL2 A;  1JRI A;  4C92 A;  1IL2 A;  3EFS A;  2IVW A;  4RDX A;  2KAF A;  2E10 A;  1DJ7 B;  3NTK A;  1KD1 U;  1H4T A;  4C92 D;  3CC4 T;  5A0L A;  1QVF A;  5CKH A;  4P71 A;  2JN0 A;  5GMK e;  3M58 A;  2E5Q A;  4KUD K;  3EAE A;  4YRR A;  2QEX A;  4PLL A;  5FRN A;  2XDP A;  3FRN A;  3JCM Q;  5D6W A;  1XQH A;  5A2Q E;  3OYD A;  3JAM E;  1VQL A;  1EFW A;  3QSU A;  2ZCF B;  4E7H A;  1YIJ A;  4B9W A;  2P0K A;  2CGH A;  2KK4 A;  3SFM A;  4OLF A;  4OB3 B;  4TVW A;  4BI4 A;  2RH2 A;  4J6Y A;  3Q1J A;  1G51 A;  1VQO T;  3A5Z B;  3QO8 A;  3KUF A;  3LH0 A;  2HQE A;  3QKJ A;  1FXX A;  4O6J A;  4DQ2 A;  3I55 A;  4KQE A;  2DZ9 A;  2V8K A;  1X56 A;  4JRQ A;  1IRE B;  4XTV A;  4C8Q B;  1ADY A;  5LJ5 e;  2JNG A;  1KQ1 A;  2E12 A;  2ZIO A;  2M0O A;  4XTW A;  1VQ9 T;  1NNH A;  3G7Z A;  1SET A;  3M56 A;  1ZHI A;  2EWN A;  4A4G A;  2D9T A;  2R5M A;  3CCS T;  3A7U A;  4C5H A;  1G5H A;  3OYA A;  1QVG S;  1J5W A;  3HFO A;  2OAU A;  2DQ3 A;  5KE2 A;  3P8V A;  4C8Q E;  3RAC A;  3PMI A;  4M75 C;  1VQZ A;  4ZTF A;  4MZP A;  4C5I A;  3UGQ A;  1VQP T;  3HXV A;  1UGP B;  3VUB A;  2EJF A;  3L4G A;  5FU7 C;  1VQK A;  2K5L A;  3JCM c;  4GY5 A;  4IUQ A;  1YI2 A;  4A4F A;  2OTJ A;  4GLK A;  4LDV A;  2E64 A;  2VV5 A;  3E9H A;  5GAO r;  3P8H A;  2QA4 A;  3SWN C;  4YYE A;  1G5V A;  3GF5 A;  5F5W A;  3VQY A;  2VXE A;  2KQW A;  1BBW A;  2V8I A;  2QI2 A;  2GQV A;  3E1S A;  3GNF B;  3CCQ T;  4OF1 A;  5A0G A;  4RMO A;  3QZ9 B;  3MF2 A;  2LCL A;  2BUD A;  2EJG A;  3ZFJ A;  2DVE A;  3BJU A;  4E47 A;  1Q7Y U;  1I5L A;  1K9M C;  1LNX A;  4C0D C;  2OTL T;  4M7A B;  2HD0 A;  1YJ9 A;  4DA4 A;  3A5Z A;  2PVG B;  4QW2 A;  3J80 E;  1I81 A;  5K1P A;  1KHI A;  1X75 C;  3X20 B;  3MEY A;  4A4E A;  3VYG A;  4CS4 A;  3CCR A;  2E6Z A;  1KC8 U;  4LD9 K;  4KUI A;  1G3S A;  3GIB A;  3HXZ A;  5LJ3 g;  3GNG A;  4C8Q A;  1VQN T;  3JCM X;  4G85 A;  4LVL A;  2DK3 A;  3RL6 A;  3GLX A;  4M7A E;  3V7S A;  4C8Q D;  3HY0 A;  1X01 A;  3QPH A;  5FU6 C;  3WQZ A;  3J7A F;  4BB7 A;  1YHQ A;  4M7D F;  2DZC A;  1SRY A;  3SD4 A;  1Q82 C;  1VQ7 A;  2PVO B;  1X54 A;  5CO7 A;  4K86 A;  2P0P A;  5EG2 A;  3V8J A;  3X26 B;  5C6S A;  4N0A C;  2I4M A;  3A74 A;  3FJP A;  4L5G A;  1N9W A;  3G71 A;  4YRC A;  3A8G B;  5C53 B;  5LJ3 h;  4C0G A;  3UH0 A;  3CBP A;  2QHT A;  5GAN f;  3OYB A;  4H2X B;  1BIA A;  1H4Q A;  4YRO A;  3VV0 A;  2XI9 A;  4VUB A;  3HXX A;  3CD6 T;  3MO8 A;  3C95 A;  4M78 B;  4YCU A;  4CH3 A;  5GAO p;  3QYG B;  3G71 T;  3MQZ A;  2R5A A;  2P5I A;  2RHS B;  3QJ6 A;  4C92 F;  4MDW A;  3JCM P;  4RMF A;  1S72 T;  3UDC A;  2FVU A;  1IZ6 A;  2EQK A;  2P0Q A;  1WQ7 A;  4YRJ A;  2MAM A;  4QQG A;  4X9D A;  3E9I A;  3OYK A;  4HWR A;  4P73 C;  3L2Q A;  2KSS A;  4YDQ A;  4M75 B;  1WYD A;  5FRO A;  5GAO m;  4A54 A;  1YJN T;  1N9S A;  2EQJ A;  4XU0 A;  5FU7 B;  3HFZ B;  1YFR A;  1HTT A;  4M7A A;  4P74 C;  2CZ6 B;  3H8Z A;  4DPG A;  4JJN K;  3HRK A;  2VGM A;  1MHN A;  4KT0 E;  4ZGD B;  2EAY A;  3CXC A;  4M7A D;  5HK0 A;  1WGS A;  1LYL A;  1QF6 A;  4PJO C;  4EO4 A;  4M75 E;  3P8D A;  1VQ5 A;  3QNE A;  3JCM J;  2DXU A;  4H02 A;  3PGG A;  3CCV A;  5C52 B;  5LJ3 d;  3CCE T;  3LW5 E;  3RGL A;  3PMT A;  2M16 A;  2EIF A;  1NYR A;  1RIQ A;  3CCU A;  1WU7 A;  3PNW C;  4WJ4 A;  2L3R A;  3OA6 A;  1SES A;  1FWZ A;  3MHX A;  1WPY A;  2MWO A;  3P8B B;  4Q5W A;  3S6W A;  3A8M B;  2LT1 A;  2RJF A;  5LJ3 j;  4YRG A;  3HL8 A;  1Z7N A;  1NJ6 A;  5I2S A;  1XNI A;  2ODR D;  2RHQ B;  4LDW A;  4XTX A;  4E51 A;  3JB9 G;  1V29 B;  4BAC A;  4YRL A;  4H2X A;  1K73 U;  3PIO A;  3DB3 A;  5I21 A;  4F7U B;  3ZEH A;  4M78 A;  1K8A C;  3HXU A;  12AS A;  3LX7 A;  4M75 G;  4V2S A;  2DU7 A;  4KR2 A;  1G3W A;  2CZ0 B;  4RCC A;  4ZGJ B;  3UGT A;  4LDY A;  2RHS A;  4M77 C;  4FU6 A;  2KDS A;  5DY9 A;  4LDX A;  1BI0 A;  2PUK B;  5FU6 B;  4M78 D;  4EMK B;  1OI1 A;  2DD5 A;  5D6X A;  3A31 A;  2RI3 A;  2XTI A;  2DAQ A;  2XID A;  4Y28 E;  5ELO A;  2E70 A;  3HXY A;  1ASZ A;  4P3O A;  4BUG A;  3M54 A;  1M1G A;  4FM4 B;  1Q86 U;  1JBM A;  4P72 C;  2XG8 D;  3HY1 A;  3OS2 A;  2Y4Y A;  1KMN A;  4G84 A;  4ME7 A;  2LVM A;  4LD6 A;  2ART A;  3OYY A;  3A8O B;  3TRE A;  4LVM A;  2QQA A;  2WSE E;  4E7K A;  4H2U A;  1M90 U;  3M5A A;  4JDS A;  2K57 A;  2VYT A;  3P8T A;  3DLM A;  4BY6 C;  3X25 B;  4CH5 A;  4EDU A;  3OW2 S;  3OSV A;  1YFS A;  3RUX A;  1D3B B;  4UP7 A;  4YPF A;  3M4P A;  4C8Q F;  3ASK A;  2I4N A;  4H2W A;  2RI2 A;  3MF1 A;  4H2T A;  1O9S A;  1O75 A;  1K9M U;  2ZGW A;  3H6Z A;  4JRP A;  1X2H A;  2CIM A;  1B34 B;  1ATI A;  1H4V B;  2ZT7 A;  2RD1 A;  4YRQ A;  2QXF A;  1X2G A;  1NPR A;  4C0Z A;  2PVD B;  4ZN3 A;  4CI0 C;  2CZ7 B;  3BY7 A;  3G4S A;  3CCJ T;  1B7Y A;  4RKU E;  1G3Y A;  5ELN A;  1NZ9 A;  4PG3 A;  4PJO B;  1VQ6 A;  3MEA A;  1NJI C;  3MEU A;  4F7U A;  4XQ3 A;  3QJY A;  1WJS A;  4LNS A;  3HTZ A;  3RMS A;  2QQS A;  5CKF A;  4YRP A;  4TVY A;  4LVI A;  3FEO A;  3VU3 C;  3JCM f;  5IT9 E;  1WLE A;  1H3Z A;  4EMK A;  4OP0 A;  3S3N A;  5GAN 7;  1VQ8 T;  1ADJ A;  3OW2 A;  3F70 A;  4L6V 5;  4J7F A;  4X5O A;  1YJW A;  4IUU A;  4PJO E;  2GF7 A;  2DD4 A;  1I8F A;  1EIY B;  2QDY B;  3P8Y A;  4ZGE B;  5GAN g;  2ARS A;  1YGB A;  1YIT A;  3L2Z A;  3DLL A;  1N8R C;  1LOJ A;  4FT2 A;  3TEG A;  1M9S A;  1M1F A;  2QEX T;  2FL7 A;  4IUT A;  2WSC E;  3QG1 A;  3OYM A;  3L2R A;  1VQL T;  2QTX A;  2A3L A;  3CCL A;  1YIJ T;  1VQ4 A;  1KMM A;  2QQ9 A;  3QHS A;  4ZIB A;  2DTH A;  3OMG A;  3LGF A;  4XAX B;  4M77 B;  2LDM A;  2PME A;  1L0W A;  5GAO n;  3KBG A;  5GAN h;  1D3B A;  5GMK m;  2RJE A;  3OY9 A;  3BDL A;  4NOY A;  3I55 T;  2CJ9 A;  4B9X A;  4PJO G;  2XKO C;  4PLI A;  2QHU A;  3M4G A;  1YCY A;  3CCM A;  5GAM f;  2CJA A;  2I2L A;  4M77 E;  4MZT A;  2FYK A;  2WAC A;  4HVC A;  5J3B A;  3PFS A;  2RHX A;  4YP0 A;  1Q81 C;  2ZPI B;  2DPP B;  4O5V A;  4J7I A;  4N4H A;  1LJO A;  1M4Z A;  3A8H B;  4DOV A;  2XHC A;  3GP8 A;  3CCM T;  3PT9 A;  4BY6 B;  2XDD A;  3JCM W;  4R56 A;  2KVQ G;  1RI0 A;  4IUR A;  1M8V A;  4M78 F;  4JS4 A;  1VQK T;  2ZZG A;  1YI2 T;  2OTJ T;  5KH6 A;  4E7L A;  4YRK A;  2QA4 T;  4J83 A;  5CR2 A;  2L5Q A;  4ATO A;  2ZPH B;  4M77 G;  4HCZ A;  3CEY A;  4YRN A;  4M7D C;  1PYS B;  2JVV A;  3FIF A;  3OMC A;  5GAN d;  4JLI A;  2DIQ A;  4K87 A;  2MMP A;  1WJQ A;  1X55 A;  1K8A U;  5IAY A;  2YLB A;  3RES A;  1USY C;  4UP9 A;  3CC2 A;  1E1T A;  3LC0 A;  2ARU A;  4YRE A;  3QO3 A;  5LJ3 e;  5GAN 8;  4HT4 A;  3SB2 A;  2LX9 A;  2ZCE A;  2RHY A;  3V8L A;  1AHJ B;  3UPU A;  3OYC A;  5GAN j;  1YJ9 T;  2K4Y A;  1M1K U;  3X28 B;  1W4S A;  1PSF A;  2LRQ A;  3CCR T;  2PQW A;  4PKC C;  4C92 C;  2ZXF A;  5CIU A;  1KG1 A;  2ZR3 A;  1N27 A;  3PIP A;  3M59 A;  2C8M A;  3TEH B;  2G3R A;  4FSX A;  2DIG A;  3HSB A;  1B70 B;  4XK8 E;  3JCM b;  4P71 C;  3VQV A;  4A4H A;  4QVC A;  1BKB A;  4HWP A;  1QP2 A;  4ZTJ A;  2Q5H A;  3S3M A;  3CXC S;  1W2B S;  2AKW B;  3W3S A;  1GGM A;  1EQR A;  1YHQ T;  3CPW S;  3M57 A;  1VQ7 T;  1YBY A;  1OYX A;  2DXC A;  1GXI E;  2ZZD A;  1NJ2 A;  1KQS S;  5CKE A;  3LYI A;  3KFU A;  4F7U F;  3RKY A;  3IKL A;  2RK2 A;  3OSS C;  3MET A;  5L8R E;  1EIF A;  1NPP A;  1VQM A;  5C51 B;  4BD3 A;  3HRS A;  2AMC B;  5DLO A;  4CH6 A;  4HCC A;  3C94 A;  3MEW A;  3RKX A;  1Y71 A;  3PCO B;  1R8O B;  2KMT A;  2KY9 A;  4TTV A;  4MML A;  2X35 A;  4L87 A;  2XDB A;  5KCH A;  1PYS A;  2YHT A;  1WQW A;  4ZN1 A;  5LJ5 f;  3UWN A;  1NJI U;  3HXW A;  3VBB A;  3A5Y A;  3I56 A;  1NYQ A;  4C5E A;  1W2B A;  3LSQ A;  4XTU A;  4LDU A;  2O4X B;  3CPW A;  3SWN B;  2R58 A;  3JB9 H;  4PL6 A;  4QVZ A;  4TVA B;  4OB1 B;  2H3J A;  1KQS A;  5KNN A;  2EFI A;  1E1O A;  5AYF A;  3ER0 A;  2M1H A;  2ZIN A;  4Y91 A;  4MDX A;  3SDZ A;  2C7I A;  1E24 A;  2IY5 B;  1FX7 A;  1VQ5 T;  1N8R U;  3HRT A;  3DB4 A;  4C0D B;  1UB4 A;  4J6W A;  3CCV T;  4YRI A;  2EQM A;  2LTO A;  4UP8 A;  3V7C A;  4J15 A;  2F5K A;  3REX A;  4A4K A;  4WI1 A;  2AKW A;  3CCU T;  4HT9 A;  4CS3 A;  3PTA A;  4NS5 A;  3G6E A;  5CQY A;  1G3T A;  5KCO A;  2HNI A;  4HKE A;  3OS0 A;  1FYF A;  2P4T A;  3S3O A;  3E9G A;  1Q7Y C;  1NE8 A;  4M7D E;  4AH6 A;  2CJB A;  4Q15 A;  4YTL A;  3X24 B;  2DKG A;  2NLU A;  2EYQ A;  2ZPG B;  4NL2 A;  3NET A;  3CMQ A;  4C92 B;  5GAM g;  1VUB A;  4J5Y A;  4HT8 A;  5E3I A;  2ZZE A;  4YRS A;  4EPC A;  3JRZ A;  4C0F A;  4M75 A;  3PCO A;  1Q81 U;  3JB9 D;  3T9N A;  4DOW A;  4EMH A;  3QBY A;  1X6O A;  5LJ3 f;  4BI3 A;  5KE3 A;  5GAO l;  3NEN A;  2ALY B;  1BBU A;  2F69 A;  2DXB A;  2RO0 A;  4OB0 B;  3HFZ A;  4M75 D;  4C5G A;  2GFA A;  3IG2 A;  4C92 E;  4E7J A;  3QDR B;  2XK0 A;  3HFN A;  4J6X A;  2FHD A;  4RQF A;  4H2V A;  2L8D A;  4X9C A;  3L2U A;  3OYL A;  5GAM h;  3SWN A;  3L1A A;  4Q6G A;  4M7D G;  4Z02 A;  2D0Q B;  3ME9 A;  3V8K A;  4RCB A;  3JCM d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...