2DVEA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, mutation arg51ala
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNAKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin Protein Ligase
publication title Ligand Structures of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dveA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dveA01
4F7UG 3IG2A 1X56A 4M7AF 3JB9J 2G4CA 4M7AB 3RERA 1EVLA 2DXTA 3P8YA 4M77E 1H4SA 5GANf 3JCMW 2RHSB 4P73C 3QSUA 4YRIA 1B70A 4J6WA 3I7FA 4HWPA 4M75D 1YFRA 2DQ3A 4C8QC 2CJBA 3JCMf 2Q5IA 3FJPA 3HRIA 4HWSA 4M7AA 4J15A 4MMLA 3NENA 4L87A 4RMFA 4M7DG 2RHSA 3JCMb 2DXUA 5GANe 5C51B 1PYSB 1B34B 3REXA 1SERA 2RHQB 1E24A 2YLCA 3LSQA 2Q7HA 1NJ1A 1EIYB 2C7IA 5LJ3j 2P0LA 4K88A 5GAN5 3JCMe 1RIQA 3BY7A 11ASA 4V2SA 4WJ4A 2ZZFA 1I8FA 1LOJA 1PYSA 4M7AE 2RHQA 2DEQA 2ZT5A 4YRLA 1EIYA 3A5YA 4XQ3A 3G1ZA 2I4NA 5GMKm 1H4TA 4Q15A 4X5OA 4EMKB 3NEMA 4XU0A 4AH6A 5GMKi 5GAMd 4C92D 2J3LA 3HTZA 4Q6GA 2ZR2A 2FB7A 2P5IA 1YFSA 2EJFA 2ZZEA 1USYC 3BDUA 2AMCA 2DVEA 2YHTA 4CH5A 3SWNC 1WU7A 4EMKA 4P75C 4UP9A 4KR2A 3HFOA 4DPGA 4XTYA 2ZTGA 5LJ5j 1NJ5A 3L4GB 3HY0A 3PCOB 5GAN3 2AKWB 3TUPA 3JCMd 3E9HA 3L2ZA 2DU7A 2RM4A 3L1AA 4PJOG 1E1OA 3HRKA 1YCYA 1L0WA 4PJOF 3JCMQ 3L4GA 4PJOB 4M77G 3HY1A 1X54A 1WPYA 3PCOA 5LJ5d 5GMKj 2CJAA 4EMGA 3SB2A 1E22A 4M77D 3EFRA 1WQ7A 5F5WA 4RQFA 4PJOA 2ARSA 3HFZB 4P71C 4ZTZB 1HC7A 4UPAA 1Y96B 1WYDA 4QVCA 3BFMA 4YRMA 1E1TA 1JBMA 5GAMf 3QO7A 1G5HA 4NCXA 1NJ6A 1SRYA 5LJ3f 3QO5A 2HNIA 4YRSA 3HFZA 4LNSA 5GAOp 3INZA 1Y96A 2QTXA 2E64A 4RCCA 4C8QG 4M7AG 4XEMA 5CAIA 3QTCA 5GANg 4PJOE 4H02A 4N0AC 5C52B 3RKWA 4C8QF 3HFVA 5GAOl 3IKMB 4C8QB 3MEYA 5GAMe 4PG3A 1KOGA 4J6XA 4YRNA 4M78C 5LJ3e 2ZNJA 3JCMg 4ZTUB 4YRGA 4P73A 2Q7GA 4WI1A 3TEHB 4C8QA 1TH7A 1WNLA 2DZCA 3RF1A 4HT9A 3QO8A 1W66A 4JLIA 2QHSA 1BIBA 3FB9A 3A7AA 2DKGA 3RIRA 2ODRD 5LJ5f 4M7DD 1LYLA 4M75B 4NL2A 5HGQA 4WF2A 4XU1A 5GAN4 4YRKA 4Y91A 1SETA 3W3SA 1B7YB 2VC8A 1B76A 5K1XA 1KMMA 4H2YA 1EOVA 4TVWA 1B34A 4C8QE 5GANh 4P72C 3A7UA 1WQWA 1M5Q1 4M75C 3V8KA 2I4MA 3P8VA 2DTHA 4YREA 3JB9F 2C8MA 4K86A 3MF2A 5LJ5e 2ZXFA 1B7YA 1JRIA 3SWNB 3JCMh 4EMHA 3RGLA 5LJ3d 4HT8A 4XU3A 5GAOr 1ASYA 3LC0A 2Y90A 3A32A 1I5LA 5C53B 2ODRC 4M7DC 1QF6A 3JB9I 4EO4A 4YCVA 1USYA 5GAOq 3SWNA 3HXZA 1M8VA 4P75A 3V8LA 3ERRA 5GMKe 2VXEA 3A31A 2IY5B 4YP0A 4YCWA 1ATIA 4HWRA 3JB9H 3JCMP 1JJCB 1X2HA 1Z7MA 4C92C 2I2LA 4PNOA 3OD1A 1G5IA 3RUXA 2IY5A 5E3IA 3BJUA 4CS4A 5I21A 3RKXA 1SESA 3A7RA 3UGQA 4RDXA 4PJOD 2I4OA 4XTVA 1FYFA 2AKWA 4YDQA 5ELNA 3JCMV 1IL2A 1JJCA 3IALA 3LSSA 4CH6A 3M4GA 1GGMA 2RA2A 3VBBA 1EFWA 4RCBA 4EX5A 1NYQA 5DY9A 4DQ2A 2ZIMA 3NETA 3QNEA 4RQEA 5GAN8 5GAMg 3ICAA 4P71A 3HXYA 1B8AA 3KFUA 5LJ3g 1ADJA 12ASA 2CIMA 1D3BB 3VU3C 1LNXA 1HTTA 1X55A 1U1SA 2EJGA 2J3MA 4M78G 4TVAB 4H2XB 3HXWA 2DQ0A 4CS2A 1X2GA 4M78F 5GAN7 2ZR3A 4M78B 2YLBA 4H2WA 2Q5HA 4HVCA 3RL6A 4P3NA 4XTWA 2CJ9A 1D3BA 3CMQA 4HWOA 4M77C 4JRKA 2ZT6A 2DZ9A 4N0AA 4P3PA 4C8QD 4M7AD 4TVAA 5GMKl 3HXUA 3VQXA 4G84A 4A53A 4XTXA 2DU5A 2QHVA 4YRPA 3TEGA 4M78A 3QO3A 1U1TA 1G51A 4H2VA 3HSBA 2E41A 4TTVA 1J5WA 2RB6A 2E10A 5GAMh 5LJ5g 5LJ3h 4F7UF 4JUVA 3REUA 2FYKA 4F7UB 4YRQA 4M75G 1EQRA 4YCUA 2I4LA 4TQFA 3TEHA 4NOYA 4H2SA 4M75F 1KQ2A 2E3CA 4K87A 4M78E 1LJOA 1N9WA 1ADYA 3JCMc 4WJ3M 4M7AC 1NJ2A 4OLFA 4UP7A 2EL9A 2CGHA 4H2UA 2VXFA 4F7UA 3AHUA 3IKLA 3JB9G 4XEOA 3FIFA 3V7SA 3DSQA 3RKYA 4P72A 1BBUA 1C0AA 1BIAA 3RESA 4M75A 3VQWA 3JB9D 4M7DF 1QE0A 2ZINA 4M7DB 1WLEA 1KMNA 4YRFA 5GAMj 2ZIOA 1HK9A 3GIBA 4CH3A 3JCMX 5GAOn 2QHTA 4X9CA 4UP8A 4ZIBA 2DTOA 5KNNA 4BW9A 3P8TA 5LJ5h 4F7UE 2XTIA 4M7DA 1ASZA 5GAOm 2EWNA 4C92G 2AMCB 3MF1A 1KQ1A 4M75E 2ARTA 2XGTA 2Q7EA 4NL3A 3PZCA 4C92F 5GANj 4C92B 4J5YA 4HWTA 2ARUA 4YPFA 2ZT7A 1NJ8A 2ZGWA 4OP0A 5GAN2 2DJZA 3QUIA 2DDZA 3E9IA 3UH0A 3WQZA 4EMKC 4A54A 2QHUA 3PGGA 1NNHA 5GMKh 2E65A 4XTZA 4YRRA 3VQYA 4MMKA 1HXDA 4C92A 4M7DE 4YRJA 4BWAA 3HXVA 1H4VB 4KR3A 2ZNIA 3EFSA 4G85A 3HFNA 4H2TA 5GANd 3UGTA 1YFTA 2PMEA 4O2DA 4TQDA 2EAYA 4YYEA 4E51A 2E1HA 4X9DA 4PHCA 3M4PA 3QHSA 3JCMJ 3R07A 4J6YA 4XTUA 3VQVA 4KQEA 2JN0A 4YRTA 3A74A 4C92E 4TVYA 1N9SA 3V7RA 2RD1A 3NELA 4M77F 1NYRA 4M77B 4QVDA 1EVKA 3HXXA 3BW1A 4CH4A 3A5ZA 2ZZGA 3UFGA 3RACA 4PJOC 1BBWA 5GAN6 2ALYB 1VQZA 1H641 4M78D 1N9RA 5ELOA 4YRCA 4CS3A 4XU2A 4TWAA 5K1PA 1I4K1 3V7CA 1Z7NA 4M77A 4H2XA 1X01A 3V8JA 1H4QA 2ZT8A 3M4QA 4HA8A 2PMFA 1YB3A 2ALYA 4JRIA 2EJ9A 2K57A 4P3OA 4P74C 2ZCEA 1MGQA 1YGBA 4YROA 2DTIA 4P74A 1B70B 2E5AA 1I81A
chains in the Genus database with same CATH superfamily
4F7UG 2NLUA 3THKA 2V8JA 6AT1B 4KGZB 4M4ZA 1T3LA 2CT4A 4M7AB 2DXTA 2JXBA 4D6WA 1OQKA 5GJVB 2D0NA 1H4SA 4X1VA 2RJCA 1Q86U 1B70A 4C5EA 1Q95G 3CQTA 1N8RR 3FJPA 4HWSA 3GPLA 4RTVA 2CZ0B 1RAIB 4BY6B 3M56A 2XG8D 1TG0A 1NJIC 2RHSA 2L5QA 3QJYA 1R0BG 3PE0A 1PYSB 1SERA 4PJMA 3EGDA 4HCCA 1WJSA 3G6EA 2YLCA 1W2BS 2C0TA 2C7IA 2P0LA 5GAN5 1RIQA 3CCLA 4ZTJA 5DLQE 4WJ4A 4J9CA 3X26B 1UG1A 2ZZFA 3VS2A 1LOJA 2RHQA 2QXFA 3HP9A 2RI5A 3QJ6A 3AT1B 3UA6A 3TQ7P 1BCOA 4YRLA 1EIYA 3G1ZA 1C0MA 4EMKB 4BI3A 1W2BA 4XU0A 4AH6A 1NEGA 2YWWA 3CMEA 3CD6Q 1D09B 3CPWS 1MUZA 2K9GA 2EJFA 4HKEA 1USYC 3EAEA 5CK9A 3TREA 3I55T 4CH5A 1WU7A 3FJ5A 2JNGA 4P75C 3CCRT 1BI2A 4L5GA 3PMIA 1ZUKA 2HBWA 2K2VA 3HFOA 4DPGA 3NTHA 2ZTGA 2HL5C 2AHJB 2DAQA 1C1AA 3L4GB 3UF4A 4FT2A 3HY0A 1SKUB 5GAN3 1SF9A 4FIBA 1G5VA 1S72A 2LJ0A 2DU7A 2RM4A 3L1AA 1E1OA 1XTDA 2MWOA 3VS6A 1YBYA 1MMAA 1WHGA 2M51A 4PJOB 1X54A 2J05A 3PCOA 4J9HA 1NYGA 2LX9A 3E1SA 3A8GB 3CCMA 2X4JA 1MNEA 5FU6C 1EFNA 3M0RA 3KFVA 1VQ6Q 5KYUA 3VYGA 3HFZB 1M90C 4FL6A 2QEXA 1AHJB 1AWJA 2NUPB 1E1TA 5GAMf 3SHWA 1NJ6A 2DL8A 1SRYA 5LJ3f 4BACA 3QO5A 2PVDB 1XJWB 4ZGEB 1VQLA 4IKFA 2CP0A 2LCCA 1AEYA 2WACA 3RMQA 4RTXA 2X4XA 1VQKQ 2KEAA 2KE9A 3CBPA 2MIOA 3QTCA 5GANg 3CXCP 3CC7T 4N0AC 5C52B 4FW1A 3A8LB 1X6BA 3HFVA 3A8MB 2EPDA 4PG3A 3UWNA 1Q81C 3CC2T 4M78C 2ZAEA 4PFZA 2CZ7B 1AWWA 2FO0A 1FWZA 1FYNA 2JM8A 2MMPA 4CC2A 4WI1A 1X69A 4JS5A 2YXYA 1R0CB 2EQIA 2LCLA 1ABQA 1K0SA 2MWPA 3OYBA 2HDAA 1GFDA 1BI3A 1D1CA 1JJ2P 3RR6A 3PTAA 2QGFB 1Y57A 1K4US 2DKGA 2LQWA 2O4XB 1LYLA 3VS1A 1M8MA 4LXCA 4NL2A 1RUWA 2EYXA 3GLXA 1Q86R 3BE3A 2RMOA 3OYDA 1M9SA 2W10A 1M5Q1 2LMJA 2FPDA 2I4MA 3CC4A 1RAHB 2C8MA 4K86A 3OYKA 5LJ5e 3JRZA 2PUOB 5HKCA 1TXQA 1JRIA 1NLOC 1KQSP 4EMHA 2F1LA 4ZNXA 1OZ3A 1K73C 1QVFA 2LCSA 5LJ3d 4AG2C 3LC0A 2Y90A 3A32A 1JQQA 1I5LA 5C53B 4OMPA 3JB9I 4EO4A 5J26A 5GAOq 3VS0A 2LNVA 2RQWA 1M8VA 4RTUA 7AT1B 3CCUQ 2A08A 2YUNA 4B6MA 3G71A 2IY5B 2OTJA 4D8KA 1VQ8A 1HJDA 2F2VA 3DLLA 3I55Q 1IO6A 1X2QA 3CCRQ 1R77A 2GCXA 2ZPEB 3OYYA 3OD1A 1XQHA 5E3IA 2DFUA 3BJUA 3UGQA 5CCAA 1MNDA 2LJ3A 4RDXA 4O5VA 1K9MU 2QQSA 1VQPT 1QVGA 3JCMV 2CZ1B 3CCSA 2C0IA 4KGXB 1AZEA 3VBBA 4QVZA 2L3QA 1ZSZC 4EX5A 1YITA 4DQ2A 3NETA 3QNEA 2GNCA 4BDZA 3HXYA 2CUBA 3M58A 2RI3A 4RG8A 2CIMA 1M30A 3VU3C 1NPPA 2V8IA 1TSFA 2L3RA 2B86A 3PVLA 4M78G 4IURA 2QDLA 2HEQA 1X2GA 1VQMA 2Q5HA 4C0DB 3CMQA 3NTIA 5CKDA 3N5BB 1K9AA 4M77C 2AKLA 2ZT6A 2BKDN 1NPRA 1SSFA 2V26A 3MEVA 4TVAA 3GNFB 3HXUA 2XDBA 4A53A 1Q7YU 4XTXA 4MZMA 2CREA 3EHRA 1VYTA 2RH2A 3HSBA 5HCKA 3RNJA 1WX6A 5FU7B 4Z8AA 3CMAA 5GAMh 5KYXB 5LJ3h 4F7UB 4YRQA 1EQRA 3H0FA 1VQ9T 2LQKA 4TQFA 4PLIA 1A0NB 2K5FA 2X51A 1LJOA 1ADYA 1NJ2A 2CGHA 1Q82U 2VXFA 5CVIA 3IKLA 1VQ4T 3CCQA 4R55A 2IIMA 1BI1A 5HY6A 1BIAA 4FM4B 1D1BA 4M7DF 1WXBA 4CH3A 3EG2A 1OI1A 2DE0X 3JCMX 5GAOn 1T0JA 2BZYA 4UP8A 2RPNA 3CCVA 3HHTB 4EDUA 4WTOB 2JJ9A 2RI2A 1UHCA 1ZUUA 1AOJA 2JW4A 3DB4A 3X28B 5KNNA 1VUBA 3P8TA 2XTIA 4M7DA 2ESWA 2K6DA 4BUGA 5IHKA 3G4ST 1KQ1A 4DBHA 2Q7EA 1KHIA 2EKOA 3E2UA 4GLKA 3RBBB 4JDSA 3HRSA 3MP8A 2ZGWA 5GAN2 1MV3A 2DJZA 3QUIA 1KD1C 2XICA 5CKHA 4A54A 5C6SA 3HKSA 4HCKA 4C0GA 5GMKh 4XTZA 3VQYA 4M7DE 4YRJA 1KJWA 2EIFA 3HXVA 4FCYA 1VQLQ 4A4EA 1WLPB 3QYGB 4P5NA 4PJNA 1RAGB 2BUDA 3OYIA 4Z89A 1GCQA 2FL7A 1NYFA 2DL3A 4LVJA 3M4PA 4LVMA 2GTOA 2K7AA 4J6YA 4K11A 4XTUA 1VQPQ 3A5ZB 3A74A 5I2SA 1RADB 1M1KU 3H0HA 1NG2A 4XAXB 3V7RA 1ARKA 4LVKA 3NELA 4QVDA 3HXXA 4CRIA 1QP2A 2ZZGA 4C0ZA 3VYHB 5I2MA 2DD4A 2ALYB 2EFIA 4M78D 5ELOA 1N9RA 4CS3A 1I4K1 3VS4A 4KUDK 2GGRA 5DM7R 3M0PA 2DLPA 4LDVA 1ZBXA 1H4QA 4FYYB 4LD6A 2KRMA 1GBQA 2D1XA 2MCNA 2M0OA 1MGQA 1IRXA 1BU1A 1B70B 3QZ5B 1I81A 2A8EA 1X56A 1AZGB 2DNUA 1IXDA 2G4CA 3RERA 1EVLA 1G3SA 5IXFA 2KMTA 1ZBJA 1U5SA 2BE9B 5GANf 2GFAA 2RHSB 1M3CA 3QSUA 4YRIA 3M4YA 2F2WA 1T0HA 2DQ3A 3CPWP 3LW5E 1Q7YR 1PSEA 3EGDB 4C8QC 4KT0E 2KT1A 2CJBA 1XOVA 1NJIU 1VQ9Q 3I5RA 3G71Q 1WI7A 4M7DG 2DXUA 3REXA 2RHQB 3OQ5A 3LSQA 2XK0A 3OYEA 1EIYB 5FWBA 5LJ3j 2KAFA 5KYYA 3JCMe 3BY7A 2RHYA 4V2SA 1TUDA 3M0QA 3LWHA 4DEYA 1TOVA 4C5IA 1E6GA 1KC8C 2JTFA 1QCNA 2P4RA 5FW9A 4JRPA 2ENMA 1Q82R 3CCSQ 2D9TA 3SD4A 2RQUA 4XQ3A 3S6WA 2I4NA 1BCMA 4X5OA 3NEMA 3G7ZA 2GBQA 5GMKi 4DBFA 2J3LA 3HTZA 1YITQ 1RL2A 2FB7A 1YFSA 3S3MA 2JMAA 2GF7A 3G4SQ 3SWNC 1G8XA 1E6HA 2EYYA 2DJQA 2HCKA 2PUKB 2RHUA 3FRNA 2K5LA 1VQNT 3FEOA 2JZ2A 1YHQA 3ZL7C 5IN1A 2DX1A 1B07A 5D6YA 3PCOB 4UC4A 5HK0A 3IQLA 3L2ZA 2JVVA 1SRLA 2XKOC 3HRKA 2RJEA 1L0WA 3A1PA 1JB0E 2YUPA 3X24B 1VQ5T 2DM1A 4OMLA 2B8AA 2J06A 5LJ5d 4JPBW 5GMKj 4EMGA 3SB2A 2D8HA 2DVJA 2A37A 3CMAQ 4M77D 3OYMA 1JO8A 2Y4YA 3F70A 2V8KA 2YUOA 5EG2A 3KXTA 1M90U 4J8OA 1GXIE 1G83A 1NE8A 2ARSA 4ZTZB 1HC7A 4UPAA 4FU6A 2LQ8A 1LCKA 2HZYA 4QQ6A 1VYUA 8AT1B 1VQOT 1XNIA 1VQKT 1WDXA 4GY5A 2OTLA 5KYNA 2KY9A 3L2VA 4BDYA 1UGVA 3CCQQ 1UGQB 5GAOp 2F69A 4OGCA 1O9SA 4C8QG 1LPLA 9ATCB 4PK4A 3VRYA 3IKMB 4E7ZA 3UDCA 3MEYA 3M59A 1Y07A 3LX7A 1WIEA 4YRNA 3CCVQ 2KT8A 2FG0A 4E7LA 1UGSB 1YIJT 2KSSA 2HAXA 1T3SA 2Q7GA 1MMDA 1M3BA 1N8RC 3TEHB 3TSZA 1QP3A 4MDWA 3CCEQ 2OX7A 5CKFA 2Y4XA 1D0XA 2NUTA 1W66A 4D8DA 4F14A 2QHSA 4OMNA 2ODRD 4M7DD 2QG9B 5HGQA 4WF2A 1FX7A 1B76A 3C0CA 1YJWT 2ZPHB 2K3YA 2ED0A 3VKIA 3MCAB 3VJPA 4P72C 5GANh 3MO8A 4EPCA 3V8KA 3EH1A 1KK7A 2J6FA 3OYFA 3OA6A 3PFSA 3OS2A 2PU9B 2OAWA 4RTWA 1X6GA 3CCUT 4HT8A 2H8HA 2X9HA 4PFOA 1RABB 1YP5A 3VS3A 1QF6A 1USYA 4PLLA 4P75A 2DRKA 3KUFA 2VXEA 3CC2A 2MOXA 2JS0A 1I07A 1RLQC 4YP0A 1JXOA 2OI3A 3I5SA 4L59A 1WHKA 4HWRA 2D0QB 1SG5A 3OW2A 3MEUA 3NFCA 3WXMB 1IGUA 2XHCA 4C92C 2QASA 1U06A 1G5IA 3RUXA 3CBMA 4AT1B 1VQNQ 4FT4A 3Q1JA 5I21A 1ZSZB 2A0FB 3CCJQ 2I4OA 1IL2A 1DJ7B 5ELNA 1YJNQ 4IUUA 1PM3A 3M54A 2RA2A 2ROLA 3C4SA 4RCBA 1WZOA 4FYWB 1VQ5Q 2ZIMA 3I56A 1EZZB 1YI2A 3QIIA 4A4KA 3ICAA 1RLPC 1B8AA 2VVKA 3KFUA 5CIUA 1ADJA 3QXEB 4N4IA 2LJ1A 4HVUA 4F16A 1IHVA 3GOXA 1UJYA 1HTTA 1U1SA 3G6ET 3LWIA 4TVAB 4H2XB 4J7FA 4CS2A 1HSQA 3CCLT 3O8VA 2QQAA 4M78F 2CP5A 1VQOQ 2KRNA 1B7TA 3VS7A 4P3NA 3FLGA 2HQXA 2HSEB 2LX7A 4JRKA 4DBQA 2DL4A 2DZ9A 2HKNA 1NZ9A 2YRCA 4N0AA 4C8QD 4OMQA 5GMKl 4Q5WA 1W4SA 3M0UA 3VS5A 4YRPA 3TEGA 4M78A 3R6NA 3NMZC 3CMET 3QWXX 4H2VA 2ZNIA 2KQWA 2E41A 1KHCA 1M2OA 4LDXA 1J5WA 2MAMA 2GQVA 2DL5A 2XD0A 8ATCB 2AZVA 3OSVA 5LJ5g 4OB3B 1YIJQ 2DXBA 2CH4A 3JV3A 3REUA 4ZN1A 4RTYA 4YCUA 1PRLC 2Z0WA 3TEHA 4NOYA 1PRMC 2E3CA 4M78E 4E7IA 1VYVA 3JCMc 1QVFS 4M7AC 4OLFA 2EL9A 4H2UA 2KR3A 4XEOA 2L0AA 1D1AA 5I22A 3FIFA 1N27A 3UT1A 1YHQQ 5A0LA 2D6FA 1QE0A 4M7DB 1WLEA 4BD3A 1HD3A 3L2RA 1YJWQ 2GFUA 2LNHB 1OU8A 2YUQA 4YRFA 4BY6C 5AYFA 3TEEA 3UA7A 3EG0A 4X9CA 2DBKA 4DEXA 2VB6A 4LDYA 1E7OA 2QA4A 3EG1A 2QEXT 2BTTA 4C92G 2AMCB 3H8ZA 2XGTA 2M0YA 3QBYA 4NL3A 5GANj 4J5YA 4HWTA 2ARUA 1KD1U 2ZT7A 1QVGS 2LZ6B 2SRCA 1VQLT 2YRVA 4EMKC 1FMKA 4DBRA 1NNHA 2MPXC 2RJFA 2JOYA 4BWAA 2COZA 1MHNA 3EFSA 3UPUA 4H2TA 5EC7A 2FEIA 1O75A 4OMOA 2K4YA 1YFTA 2RF0A 2QAZA 3U23A 1VIFA 4TQDA 4YYEA 1YJ9A 4E51A 1G2BA 2C0OA 2X4WA 3NTKA 4B9XA 3RDVA 1VQ7A 2E1HA 4JJBA 4QQGA 1K8AC 1N5ZA 3M9QA 1BK2A 3H0IA 5KYWA 2HQHA 2EKHA 1ZSZA 4BI8B 3NPFA 4KQEA 4YRTA 1SHFA 4B9WA 2DL7A 4KULA 3NHNA 4LVLA 2FZCB 1QMCA 2CP2A 4M77F 1EVKA 1QQJA 3OYHA 4XK8E 2F2XA 4R0KA 4JJNK 3UFGA 4BE1A 2LT4A 4PJOC 1Y71A 1H641 3GP8A 4YRCA 4Z88A 4LDWA 3META 1WHLA 3G6EQ 2KK4A 2BZXA 2EGEA 5IAYA 3CC4T 4M77A 4CC4B 4HVVA 4BE0A 1X01A 4H2XA 3CCLQ 3M4QA 4HA8A 1UFFA 5FROA 2R58A 2HKQB 4JRIA 2EJ9A 1CSKA 1MMNA 1U8RA 3OYGA 3E9FA 1YGBA 3J80E 4YROA 2DTIA 3A8HB 2E5AA 2ATCB 3IG2A 2QQBA 3P8YA 3CMEQ 2CSIA 4OVAA 1IZ6A 4M77E 5HK3A 3SEMA 1I1JA 3JCMW 2K2MA 3G71T 3OYLA 4P73C 4ELYC 1YFRA 2EQKA 3ZBDA 2J7IA 4J7IA 4J9BA 2Q5IA 3HRIA 4AFSC 3NENA 2CH4W 5KYYB 4L87A 2DXCA 4RMFA 3KBGA 1M2VA 5D6XA 4LUDA 5C51B 1RACB 1B34B 4ZGJB 1QCFA 1S72Q 2Q7HA 3CCST 1NJ1A 1YCSB 3D7SB 2LRQA 4K88A 5FRNA 1LVKA 2DIGA 5I11A 1KC8U 11ASA 1WXUA 4ANJA 3HL8A 3OS1A 1I8FA 1YITT 3PIPA 2DYBA 1M27C 2NS6A 2KXDA 1WXTA 3CXCS 2PVGB 1B3QA 2DD5A 2CYZB 2K5IA 3CCMQ 3A5YA 3VRZA 3SFMA 2VGMA 5GMKm 4Q15A 3I35A 3EG9B 3S3OA 4C92D 2PQWA 2K3XA 2HSPA 4HT4A 3I56Q 1FMVA 2P5IA 2A36A 4MZTA 3TCJA 2QEXQ 1X75C 1VQMT 2AMCA 3OB9A 2DVEA 3CXCA 2YHTA 1PKTA 3TSWA 4A4FA 2KBTA 3QYHB 1JJ2S 1Y7XA 4UP9A 4DOVA 4KR2A 5AT1B 3WVDB 2MYSA 1ZX6A 3TVTA 4E2FB 2QQ9A 5A0GA 1TUGB 2FPFA 3VV0A 1NJ5A 2FHDA 2RK2A 4DOWA 1KD1R 3TUPA 3E9HA 1JJ2A 3CMAT 1MMGA 4PJOG 3M5AA 1YCYA 2CDTA 3JCMQ 4M77G 3HY1A 2W0ZA 4IUPA 1KQSS 4IUQA 1OZ2A 2KDSA 2CSQA 1E22A 4HVWA 1K9MR 3LH5A 2QGGA 2L2PA 1WQ7A 5F5WA 4RTTA 3MEWA 4RQFA 2JMCA 3CD6A 4P71C 3CCQT 1GCPA 2E70A 1WYDA 2E6ZA 4QVCA 1KQSA 1UDLA 2X35A 1AVZC 4YRMA 1JBMA 2YSQA 4KGVB 1ABOA 2EQUA 1G5HA 3QO7A 1W2BP 4YRSA 2GTJA 4AFUC 2CUDA 2DERA 2O2OA 3INZA 5J39A 3CCVT 2FZGB 1NLPC 1Y96A 3CC4Q 2QTXA 4XEMA 4RCCA 4H02A 2ZPIB 4C8QF 2OAUA 3CCET 2EW3A 5GAMe 2NUTB 5LJ3e 4JRQA 1FXXA 3JCMg 4C0DC 4ZTUB 3OYJA 2QA4Q 2RQRA 3VUBA 5KE2A 4C8QA 3GNGA 3OMGA 5FLXE 4OB1B 4HT9A 2COYA 3NGPA 2OTJQ 2DETA 1VQ8Q 1BIBA 1YWPA 2M1HA 1VQ6A 5GJWB 5FU7C 2YT6A 1UHFA 5LJ5f 1SPKA 5KH6A 4XU1A 5GAN4 1SETA 2C06A 2VC8A 5K1XA 4ZN3A 3P8HA 1KMMA 1EOVA 3R6OA 1RAAB 2ABLA 1B34A 4C8QE 1NEBA 5J3BA 3SDZA 3A7UA 1WQWA 4M75C 1Q82C 3OBWA 1VQKA 4ME7A 2ZXFA 1JU5C 1K1ZA 1VQ7Q 1KIKA 1B7YA 2RN8A 2J6KA 3RGLA 1UUEA 2QQRA 1WFWA 4KRTA 4XU3A 5GAOr 1ASYA 3M57A 4LNPA 3QKJA 4Y28E 1KC8R 3SWNA 3EG9A 2PNIA 1OX9A 2DA9A 2P0KA 3V8LA 2XDDA 2QDYB 3ERRA 5GMKe 1AWOA 2VYTA 3A31A 1AT1B 4F17A 1I0CA 1JXMA 1VQMQ 5CQYA 5IHNA 4YCWA 1TS9A 4LN2A 5CKBA 3CCJT 3C12A 3JCMP 1BYMA 1UTIA 1YJNT 1K76A 1X2HA 2RK1A 2VWFA 2GQIA 1J3TA 5FU6B 3RKXA 1V76A 3A7RA 1BB9A 2F5TX 4PJOD 4FYXB 1UE9A 1FYFA 1K0XA 1JJCA 3IALA 3LSSA 4CH6A 1RAFB 2AZSA 3REAB 3A8OB 3M4GA 3EHQA 1GGMA 1TTHB 1EFWA 1QVPA 1IREB 2M9UA 1NYQA 3LGFA 4N4GA 4RQEA 5GAN8 3OYNA 5KE3A 3RMSA 5IT9E 1MV0B 1YNZA 3T9NA 3MP1A 1OV3A 4E6RA 2P84A 1M1KR 3HRUA 3CCUA 3ER0A 3HXWA 2P0QA 1QVFP 2ZR3A 4M78B 1P92A 2YLBA 4H2WA 3I55A 3RL6A 5CR2A 4XTWA 4X34A 1VA7A 4A4GA 3QG1A 3EG3A 3CCRA 1D3BA 4FYVB 1EX4A 1Q81U 1R8OB 4P3PA 3CEYA 4E7KA 2NUZA 4PFPA 4G84A 4PL6A 2QHVA 2COWA 1IB8A 3QO3A 1HYOA 1QLYA 1U1TA 4MZPA 3OYAA 3URGA 2RHIA 2M16A 3PVQA 1Z9QA 1I5OB 2E10A 1S1NA 4CI0C 1TU0B 2HL3A 2VGNA 2O88A 4CC7A 4JUVA 2E6NA 2FYKA 4M75G 1ZA1B 1V1CA 4FW2A 2PTKA 3OSSC 3O5ZA 4H2SA 1KQ2A 3EGXA 4ZTFA 3L2UA 1QVGP 1N9WA 1YHQT 2EYWA 1OPLA 2EGAA 2JS2A 4WJ3M 1WA7A 3AHUA 1RI0A 4JZ3A 4P72A 2HMAA 1C0AA 3LLRA 3RESA 1NJIR 2KXCA 3VQWA 3JB9D 2K3BA 4C5GA 2ZINA 1K73U 1RI9A 1V29B 1KMNA 1UJ0A 1HK9A 3GIBA 2QHTA 4LE9A 1KSWA 4MDXA 2NWMA 4PJJA 2L3PA 3OW2S 4BW9A 5LJ5h 1ASZA 3ASKA 4OMFB 3M53A 4AMCA 2E3HA 3CC7A 2K79A 3PT9A 2I0NA 3P8DA 1PNJA 1PCXA 2EVRA 3LH0A 4C92F 2OTLT 2DEUA 4J9IA 4IUVA 3EFOA 1NJ8A 4OP0A 4J9GA 3UATA 2XI9A 2LVMA 3PGGA 2E65A 1HXDA 4IIMA 4C92A 5KYWB 4OB0B 1D0YA 3HFNA 3CPWA 2EAYA 4ORZA 1K8AU 3CBOA 4PHCA 3OS0A 2E3IA 2JUFA 1Z9ZA 2HD0A 1PHTA 3OY9A 1H3HA 2JN0A 3H9NA 4JZ4A 4C92E 1YWOA 2DRMA 2KRSA 1YFNA 3L2QA 4TVYA 5KCHA 3QPHA 2G3RA 1PD0A 4M77B 2MI6A 3BW1A 3LYIA 2X4YA 3MJXA 4CH4A 4ESRA 2L89A 3L2WA 1SEMA 2H3EB 1BBWA 3FC3A 1M1GA 2HBPA 4XU2A 1SSHA 2V1QA 5ECAA 5K1PA 1M90R 3VUZA 3V7CA 1OOTA 2R5MA 2CS7A 2DMOA 2DF6A 1YB3A 3OS5A 2K57A 2ROTA 4P74C 1GFCA 2ZCEA 2VKNA 4JS4A 3EH2A 4P74A 3P8BB 3JSCA 3FDRA 2DIQA 3HRTA 1PKSA 4FSXA 5CQXA 4M7AF 1PD1A 3WVEB 2SEMA 3JB9J 3X20B 2QI2A 1H8KA 2JT4A 1VQPA 3EGUA 1M2VB 1Q81R 2E4HA 4KBMB 4J6WA 3I7FA 4HWPA 4M75D 3E19A 2CKKA 1Q86C 2O9VA 3JAME 3JCMf 4J15A 4M7AA 1S72T 3X25B 4J9EA 4MMLA 3OMCA 3JCMb 4LUEA 5GANe 1EIFA 3HTRA 3H41A 1E24A 1FMWA 3CCMT 1VOMA 2FZKB 3H6ZA 1PG5B 1PYSA 4HXJA 4M7AE 3I56T 2DEQA 1YI2T 2QYZA 2ZT5A 2AK5A 1H4TA 5A2QE 2CT3A 1OEBA 2J6OA 5GAMd 4Q6GA 2IG0A 1RAEB 2ZR2A 4BE2A 1K73R 5IH2A 3A98A 4OMMA 1WHHA 1PSFA 3PIOA 1CKAA 4E7HA 4BI4A 2KROA 2ZZEA 3BDUA 1SHGA 3CPFA 4EMKA 2PZ1A 2OTLQ 1PC0A 1ZA2B 2FRYA 3M0SA 3ULRB 4QT7A 2KI7A 4AG1C 1VQ9A 4OF1A 4XTYA 1QWEA 1NM7A 5LJ5j 1UB4A 4ELZC 3HPWA 1WHJA 4OGEA 2PVOB 1G3WA 2ZPBB 2AKWB 3DB3A 3JCMd 1VQ4A 5L8RE 4CC3A 4F04B 1QKWA 1QWFA 4FSSA 3BDLA 4PJOF 5LL6S 3L4GA 2E5QA 2RQTA 2KYBA 1WPYA 2ED1A 4II1A 4E7SA 4ZGDB 1KFZA 2ZPGB 2X3XD 2CJAA 1M3AA 3MKDA 2BZ8A 3J7AF 3REBB 5CO7A 1AWXA 2P4TA 3GBQA 5D6WA 2KGTA 3EFRA 2EBPA 3J81E 1BKBA 1K8AR 4Y92A 2ZCFB 2FVUA 4PJOA 4PJLA 2EYZA 1Y96B 1ZSGA 2LTOA 1ZQ1A 4HCZA 1YN8A 2RQVA 3BFMA 3G4SA 1X27A 2QTVA 4C5HA 5IXBA 3QZ9B 1N6AA 4RKUE 4NCXA 2HNIA 5A0DA 3HFZA 4LNSA 1ZHIA 1UGPB 2AIRB 4R56A 2O31A 2NUPA 2A3LA 2E64A 4M7AG 5CAIA 4PJOE 4C0FA 2QA4T 3RKWA 5GAOl 4C8QB 4L6V5 4QQDA 1KOGA 4J6XA 1H3ZA 2ZNJA 2OTJT 2MF2A 1VQ8T 1NBEB 4YRGA 4P73A 1SRMA 4BB7A 3PMTA 3CC7Q 2L3SA 2MK5A 2CP6A 4J83A 4KH0B 1TH7A 1WNLA 2DZCA 3CC2Q 1BI0A 3RF1A 3QO8A 1QKXA 4JLIA 1OYXA 3FB9A 3S3NA 3A7AA 2RO0A 3RIRA 4J9FA 3I9QA 2BE7D 4WCIA 3QDFA 2YDLA 4M75B 1YJ9T 4YRKA 5IHIA 4O6JA 4Y91A 3W3SA 1B7YB 3L42A 1VQ7T 4H2YA 1ACMB 4TVWA 4OB2B 5CKEA 2F5KA 2IVWA 2L8DA 3P8VA 2DTHA 4YREA 2O4XA 3JB9F 2EGCA 3MF2A 2P0PA 3GF5A 4N4HA 4VUBA 3SWNB 3JCMh 3TU4K 2V1RA 4TVRA 1WJQA 1X43A 2E12A 3MP6A 4JJCA 1YI2Q 2O9SA 5KCOA 2ODRC 4M7DC 2R5AA 4YCVA 1WGSA 4GLMA 3HXZA 2A7YA 3CCEA 2YRDA 4DA4A 2KYMA 1IGQA 3DKMA 2LQNA 1ATIA 1QCOA 3JB9H 4GBQA 1JJCB 2M02A 2AT1B 5M9OA 1Z7MA 2I2LA 4PNOA 1X2KA 5DLOA 4Z02A 1M1FA 2IY5A 1W1FA 3C94A 4CS4A 1SESA 1JEGA 4PKCC 4XTVA 2AKWA 2BIVA 2CP3A 4YDQA 1H92A 2QK0A 1K9MC 1GCQC 1AD5A 2XMFA 3ME9A 1UGRB 2R57A 5DY9A 4AFZC 4RG2A 3G1JA 5GAMg 4P71A 1C6VX 2A28A 2LDMA 3LGLA 2EYQA 5LJ3g 1WYXA 12ASA 1D3BB 1LNXA 1OX8A 2IPOB 1GBRA 2ECZA 2VASA 1D0ZA 2EJGA 1X55A 4LVIA 2J3MA 4KH1B 2DQ0A 1VIEA 5GAN7 4LD9K 4HVCA 1Y0MA 3MEAA 1G3TA 4NS5A 2CJ9A 4HWOA 1OPKA 3DLMA 4JLGA 5FRMA 4M7AD 2NYSA 3QWYA 1GL5A 3VQXA 2HQEA 1PWTA 2DU5A 1VQNA 1N8RU 3M0TA 1Q7YC 1G51A 1WHMA 2KVQG 3CCJA 4TTVA 1YJNA 2RB6A 1M4ZA 3EGXB 1ZUYA 3OW2P 2DK3A 1BBZA 2DPPB 4ATOA 2LP5A 1KG1A 4F7UF 2VUBA 1VQ5A 2I4LA 2RHXA 2LT1A 4M75F 2RJDA 2EQMA 4K87A 1QW1A 2FPEA 2JTMA 4QKUA 1GRIA 1IHWA 1CKBA 5KYXA 4UP7A 3PNWC 2ZPFB 5D7UA 4F7UA 1UECA 1WJRA 3JB9G 3DSQA 3V7SA 3RKYA 1W6XA 2D8JA 1BBUA 4RTZA 4M75A 3OBYA 1VQOA 1YJ9Q 4RMOA 4YTLA 2OJ2A 5GAMj 2ZIOA 1VQ4Q 1G3YA 4RUGA 4ZIBA 2EQJA 4IIOA 2DTOA 3EFOB 3CD6T 4F7UE 2XU8A 4J9DA 2G6FX 3QDRB 2WSFE 2EWNA 5GAOm 4E7JA 3MF1A 1W70A 4M75E 2ARTA 2AKKA 3PZCA 4C92B 3C95A 4E47A 1YIJA 3MHXA 1UEBA 1U3OA 3OYCA 4YPFA 2DDZA 3E9IA 3UH0A 1OU9A 3ZFJA 2DILA 3WQZA 4IUTA 4QW2A 2QHUA 3MQZA 1X6OA 4YRRA 4MMKA 2X3WD 1TUCA 4AFQC 4JJDA 1H4VB 2H3JA 5L23A 4G85A 4A4HA 2ZZDA 4KR3A 2JM9A 5GANd 3UGTA 2PMEA 4O2DA 2O01E 2VV5A 4X9DA 2DBMA 1YJWA 3QHSA 2DO3A 3JCMJ 3R07A 2DYIA 3E9GA 1OULA 2CZ6B 3VQVA 1TWBA 2XIDA 1VQ6T 5KYUB 2WSCE 1N9SA 2RD1A 1M1KC 3MPUB 1NYRA 2LC4A 4KUIA 3ZEHA 3A5ZA 3RACA 2KNBB 5GAN6 1VQZA 4TWAA 3M55A 2RHZA 2JTEA 2WSEE 1Z7NA 2E5KA 5FWCA 2FRWA 2RNAA 2XDPA 4A63B 4EIKA 4LDUA 3V8JA 2ZT8A 2PMFA 1F1BB 1ZLMA 2ALYA 4HCBA 4P3OA 2CP7A 5C0MA
chains in the Genus database with same CATH topology
4F7UG 2NLUA 2V8JA 4M7AB 2DXTA 4D6WA 1H4SA 2RJCA 1Q86U 1B70A 4C5EA 3FJPA 4HWSA 3GPLA 2CZ0B 4BY6B 3M56A 2XG8D 1NJIC 2RHSA 2L5QA 3QJYA 1PYSB 1SERA 4HCCA 1WJSA 3G6EA 2YLCA 1W2BS 2C7IA 2P0LA 5GAN5 1RIQA 3CCLA 4ZTJA 5DLQE 4WJ4A 3X26B 2ZZFA 1LOJA 2RHQA 2QXFA 3HP9A 2RI5A 3QJ6A 4YRLA 1EIYA 3G1ZA 4EMKB 1W2BA 4BI3A 4XU0A 4AH6A 3CMEA 3CPWS 2EJFA 4HKEA 1USYC 3EAEA 5CK9A 3TREA 3I55T 4CH5A 1WU7A 2JNGA 4P75C 3CCRT 1BI2A 4L5GA 3PMIA 2K2VA 3HFOA 4DPGA 3NTHA 2ZTGA 2AHJB 2DAQA 3L4GB 4FT2A 3HY0A 5GAN3 4FIBA 1G5VA 1S72A 2DU7A 2RM4A 3L1AA 1E1OA 1XTDA 2MWOA 1YBYA 4PJOB 1X54A 3PCOA 2LX9A 3E1SA 3A8GB 3CCMA 2X4JA 5FU6C 3VYGA 3HFZB 1M90C 4FL6A 2QEXA 1AHJB 1E1TA 5GAMf 1NJ6A 1SRYA 5LJ3f 4BACA 3QO5A 2PVDB 4ZGEB 1VQLA 4IKFA 2LCCA 2WACA 3RMQA 2X4XA 3CBPA 3QTCA 5GANg 3CC7T 4N0AC 5C52B 3A8LB 3HFVA 3A8MB 4PG3A 3UWNA 1Q81C 3CC2T 4M78C 2CZ7B 1FWZA 2MMPA 4WI1A 4JS5A 2LCLA 2MWPA 3OYBA 1BI3A 3PTAA 2DKGA 2O4XB 1LYLA 4NL2A 3GLXA 3OYDA 1M9SA 1M5Q1 2I4MA 3CC4A 2C8MA 4K86A 3OYKA 5LJ5e 3JRZA 2PUOB 5HKCA 1JRIA 4EMHA 1OZ3A 1K73C 1QVFA 5LJ3d 3LC0A 2Y90A 3A32A 1I5LA 5C53B 3JB9I 4EO4A 5J26A 5GAOq 2LNVA 1M8VA 3G71A 2IY5B 2OTJA 1VQ8A 3DLLA 2GCXA 2ZPEB 3OYYA 3OD1A 1XQHA 5E3IA 3BJUA 3UGQA 5CCAA 4RDXA 4O5VA 1K9MU 2QQSA 1VQPT 1QVGA 3JCMV 2CZ1B 3CCSA 3VBBA 4QVZA 4EX5A 1YITA 4DQ2A 3NETA 3QNEA 4BDZA 3HXYA 3M58A 2RI3A 4RG8A 2CIMA 3VU3C 1NPPA 2V8IA 2L3RA 4M78G 4IURA 1X2GA 1VQMA 2Q5HA 4C0DB 3CMQA 3NTIA 5CKDA 3N5BB 4M77C 2ZT6A 2BKDN 1NPRA 1SSFA 3MEVA 4TVAA 3GNFB 3HXUA 2XDBA 4A53A 1Q7YU 4XTXA 4MZMA 2RH2A 3HSBA 5FU7B 3CMAA 5GAMh 5LJ3h 4F7UB 4YRQA 1EQRA 1VQ9T 2LQKA 4TQFA 4PLIA 2K5FA 1LJOA 1ADYA 1NJ2A 2CGHA 1Q82U 2VXFA 5CVIA 3IKLA 1VQ4T 3CCQA 4R55A 1BI1A 5HY6A 1BIAA 4FM4B 4M7DF 4CH3A 1OI1A 3JCMX 5GAOn 4UP8A 3CCVA 3HHTB 4EDUA 2RI2A 3X28B 5KNNA 3DB4A 1VUBA 3P8TA 2XTIA 4M7DA 4BUGA 3G4ST 1KQ1A 2Q7EA 1KHIA 2EKOA 4GLKA 4JDSA 3HRSA 3MP8A 2ZGWA 5GAN2 2DJZA 3QUIA 1KD1C 2XICA 5CKHA 4A54A 5C6SA 3HKSA 4C0GA 5GMKh 4XTZA 3VQYA 4M7DE 4YRJA 2EIFA 3HXVA 4A4EA 3QYGB 4P5NA 2BUDA 3OYIA 2FL7A 4LVMA 4LVJA 3M4PA 4J6YA 4XTUA 3A5ZB 3A74A 5I2SA 1M1KU 4XAXB 3V7RA 4LVKA 3NELA 4QVDA 3HXXA 4CRIA 1QP2A 2ZZGA 4C0ZA 3VYHB 5I2MA 2DD4A 2ALYB 2EFIA 4M78D 5ELOA 1N9RA 4CS3A 1I4K1 4KUDK 5DM7R 4LDVA 1ZBXA 1H4QA 4LD6A 2M0OA 1MGQA 1B70B 3QZ5B 1I81A 2A8EA 1X56A 2G4CA 3RERA 1EVLA 1G3SA 2KMTA 5GANf 2GFAA 2RHSB 3QSUA 4YRIA 3M4YA 2DQ3A 3LW5E 1PSEA 4C8QC 4KT0E 2CJBA 1XOVA 1NJIU 4M7DG 2DXUA 3REXA 2RHQB 3OQ5A 3LSQA 2XK0A 3OYEA 1EIYB 5LJ3j 2KAFA 3JCMe 3BY7A 2RHYA 4V2SA 3LWHA 4C5IA 1KC8C 2JTFA 4JRPA 2D9TA 3SD4A 4XQ3A 3S6WA 2I4NA 4X5OA 3NEMA 3G7ZA 5GMKi 2J3LA 3HTZA 1RL2A 2FB7A 1YFSA 3S3MA 2GF7A 3SWNC 2PUKB 2RHUA 3FRNA 2K5LA 1VQNT 3FEOA 2JZ2A 1YHQA 5IN1A 5D6YA 3PCOB 4UC4A 5HK0A 3L2ZA 2JVVA 2XKOC 3HRKA 2RJEA 1L0WA 1JB0E 3X24B 1VQ5T 2B8AA 5LJ5d 5GMKj 4EMGA 3SB2A 4M77D 3OYMA 2Y4YA 3F70A 2V8KA 5EG2A 3KXTA 1M90U 4J8OA 1GXIE 1NE8A 2ARSA 4ZTZB 1HC7A 4UPAA 4FU6A 2LQ8A 4QQ6A 1VQOT 1XNIA 1VQKT 4GY5A 2OTLA 2KY9A 3L2VA 4BDYA 1UGQB 5GAOp 2F69A 4OGCA 1O9SA 4C8QG 3IKMB 3UDCA 3MEYA 3M59A 1Y07A 3LX7A 4YRNA 4E7LA 1UGSB 1YIJT 2KSSA 2HAXA 2Q7GA 1N8RC 3TEHB 1QP3A 4MDWA 5CKFA 2Y4XA 1W66A 2QHSA 2ODRD 4M7DD 5HGQA 4WF2A 1FX7A 1B76A 1YJWT 2ZPHB 2K3YA 3VKIA 3MCAB 3VJPA 4P72C 5GANh 3MO8A 4EPCA 3V8KA 3OYFA 3OA6A 3PFSA 3OS2A 2PU9B 3CCUT 4HT8A 1QF6A 1USYA 4PLLA 4P75A 3KUFA 2VXEA 3CC2A 4YP0A 4L59A 4HWRA 2D0QB 3OW2A 3MEUA 3NFCA 3WXMB 2XHCA 4C92C 1G5IA 3RUXA 3CBMA 4FT4A 3Q1JA 5I21A 2I4OA 1IL2A 1DJ7B 5ELNA 4IUUA 3M54A 2RA2A 3C4SA 4RCBA 2ZIMA 3I56A 1YI2A 3QIIA 4A4KA 3ICAA 1B8AA 3KFUA 5CIUA 1ADJA 3QXEB 4N4IA 3GOXA 1HTTA 1U1SA 3G6ET 3LWIA 4TVAB 4H2XB 4J7FA 4CS2A 3CCLT 3O8VA 2QQAA 4M78F 4P3NA 3FLGA 2HQXA 4JRKA 2DZ9A 1NZ9A 4N0AA 4C8QD 5GMKl 4Q5WA 1W4SA 4YRPA 3TEGA 4M78A 3CMET 4H2VA 2KQWA 2E41A 1KHCA 4LDXA 1J5WA 2MAMA 2GQVA 2XD0A 3OSVA 5LJ5g 4OB3B 2DXBA 3REUA 4ZN1A 4YCUA 3TEHA 4NOYA 2E3CA 4M78E 4E7IA 3JCMc 1QVFS 4M7AC 4OLFA 2EL9A 4H2UA 4XEOA 3FIFA 1N27A 3UT1A 5A0LA 2D6FA 1QE0A 4M7DB 1WLEA 4BD3A 3L2RA 2GFUA 4YRFA 4BY6C 5AYFA 3TEEA 4X9CA 4LDYA 2QA4A 2QEXT 4C92G 2AMCB 3H8ZA 2XGTA 3QBYA 4NL3A 5GANj 4J5YA 4HWTA 2ARUA 1KD1U 2ZT7A 1QVGS 1VQLT 2YRVA 4EMKC 1NNHA 2RJFA 2JOYA 4BWAA 1MHNA 3EFSA 3UPUA 4H2TA 1O75A 2K4YA 1YFTA 4TQDA 1VIFA 4YYEA 1YJ9A 4E51A 2X4WA 3NTKA 4B9XA 1VQ7A 2E1HA 4QQGA 1K8AC 3M9QA 4BI8B 4KQEA 4YRTA 4B9WA 4KULA 4LVLA 4M77F 1EVKA 3OYHA 4XK8E 4JJNK 3UFGA 4BE1A 2LT4A 4PJOC 1Y71A 1H641 3GP8A 4YRCA 4LDWA 3META 2KK4A 3CC4T 5IAYA 4M77A 4BE0A 1X01A 4H2XA 3M4QA 4HA8A 5FROA 2R58A 4JRIA 2EJ9A 1U8RA 3OYGA 3E9FA 1YGBA 3J80E 4YROA 2DTIA 3A8HB 2E5AA 3IG2A 2QQBA 3P8YA 4OVAA 1IZ6A 4M77E 5HK3A 3JCMW 3G71T 3OYLA 4P73C 4ELYC 1YFRA 2EQKA 3ZBDA 4J7IA 2Q5IA 3HRIA 3NENA 4L87A 2DXCA 4RMFA 3KBGA 5D6XA 5C51B 1B34B 4ZGJB 2Q7HA 3CCST 1NJ1A 2LRQA 4K88A 5FRNA 2DIGA 1KC8U 11ASA 3HL8A 3OS1A 1I8FA 1YITT 3PIPA 2NS6A 3CXCS 2PVGB 2DD5A 2CYZB 2K5IA 3A5YA 5GMKm 3SFMA 2VGMA 4Q15A 3S3OA 4C92D 2PQWA 2K3XA 4HT4A 2P5IA 4MZTA 3TCJA 1X75C 1VQMT 2AMCA 3OB9A 2DVEA 3CXCA 2YHTA 4A4FA 3QYHB 1JJ2S 1Y7XA 4UP9A 4DOVA 4KR2A 3WVDB 2QQ9A 5A0GA 3VV0A 1NJ5A 2FHDA 2RK2A 4DOWA 3TUPA 3E9HA 1JJ2A 3CMAT 4PJOG 3M5AA 1YCYA 3JCMQ 4M77G 3HY1A 4IUPA 1KQSS 4IUQA 1OZ2A 2KDSA 1E22A 1WQ7A 5F5WA 3MEWA 4RQFA 3CD6A 4P71C 3CCQT 2E70A 1WYDA 2E6ZA 4QVCA 1KQSA 2X35A 4YRMA 1JBMA 2EQUA 1G5HA 3QO7A 4YRSA 3INZA 3CCVT 5J39A 1Y96A 2QTXA 4XEMA 4RCCA 4H02A 2ZPIB 4C8QF 2OAUA 3CCET 5GAMe 5LJ3e 4JRQA 1FXXA 3JCMg 4C0DC 4ZTUB 3OYJA 3VUBA 5KE2A 4C8QA 3GNGA 3OMGA 5FLXE 4OB1B 4HT9A 1BIBA 2M1HA 1VQ6A 5FU7C 5LJ5f 5KH6A 4XU1A 5GAN4 1SETA 2C06A 2VC8A 5K1XA 4ZN3A 3P8HA 1KMMA 1EOVA 3R6OA 1B34A 4C8QE 5J3BA 3SDZA 3A7UA 1WQWA 4M75C 1Q82C 3OBWA 1VQKA 4ME7A 2ZXFA 1B7YA 3RGLA 2QQRA 4XU3A 5GAOr 1ASYA 3M57A 3QKJA 4Y28E 3SWNA 2P0KA 3V8LA 2XDDA 2QDYB 3ERRA 5GMKe 3A31A 2VYTA 5CQYA 4YCWA 5CKBA 3CCJT 3C12A 3JCMP 1BYMA 1YJNT 1X2HA 2RK1A 5FU6B 3RKXA 3A7RA 2F5TX 4PJOD 1FYFA 1JJCA 3IALA 3LSSA 4CH6A 3A8OB 3M4GA 1GGMA 1EFWA 1QVPA 1IREB 2M9UA 1NYQA 3LGFA 4N4GA 4RQEA 5GAN8 3OYNA 5KE3A 3RMSA 5IT9E 3T9NA 3MP1A 3HRUA 3CCUA 3ER0A 3HXWA 2P0QA 2ZR3A 4M78B 1P92A 2YLBA 4H2WA 3I55A 3RL6A 5CR2A 4XTWA 4X34A 4A4GA 3QG1A 3CCRA 1D3BA 1Q81U 1R8OB 4P3PA 3CEYA 4E7KA 4G84A 4PL6A 2QHVA 3QO3A 1U1TA 4MZPA 3OYAA 3URGA 2RHIA 2M16A 2E10A 4CI0C 2VGNA 4JUVA 2E6NA 2FYKA 4M75G 3OSSC 4H2SA 1KQ2A 4ZTFA 3L2UA 1N9WA 1YHQT 4WJ3M 3AHUA 1RI0A 4P72A 1C0AA 3LLRA 3RESA 3VQWA 3JB9D 4C5GA 2ZINA 1K73U 1V29B 1KMNA 1HK9A 3GIBA 2QHTA 4MDXA 3OW2S 4BW9A 5LJ5h 1ASZA 3ASKA 4OMFB 3M53A 3CC7A 3PT9A 3P8DA 3LH0A 4C92F 2OTLT 4IUVA 1NJ8A 4OP0A 2XI9A 2LVMA 3PGGA 2E65A 1HXDA 4C92A 4OB0B 3HFNA 3CPWA 2EAYA 1K8AU 3CBOA 4PHCA 3OS0A 2JUFA 2HD0A 3OY9A 2JN0A 4C92E 3L2QA 4TVYA 5KCHA 3QPHA 2G3RA 4M77B 2MI6A 3BW1A 3LYIA 2X4YA 4CH4A 2L89A 3L2WA 1BBWA 3FC3A 1M1GA 2HBPA 4XU2A 5K1PA 3VUZA 3V7CA 2R5MA 2CS7A 1YB3A 3OS5A 2K57A 4P74C 2ZCEA 4JS4A 4P74A 3P8BB 3JSCA 3FDRA 2DIQA 3HRTA 4FSXA 5CQXA 4M7AF 3JB9J 3WVEB 3X20B 2QI2A 1VQPA 4KBMB 4J6WA 3I7FA 4HWPA 4M75D 3E19A 2CKKA 1Q86C 3JAME 3JCMf 4J15A 4M7AA 1S72T 3X25B 4MMLA 3OMCA 3JCMb 5GANe 1EIFA 1E24A 3CCMT 3H6ZA 1PYSA 4M7AE 3I56T 2DEQA 1YI2T 2ZT5A 1H4TA 5A2QE 5GAMd 4Q6GA 2IG0A 2ZR2A 4BE2A 1PSFA 3PIOA 4E7HA 4BI4A 2ZZEA 3BDUA 3CPFA 4EMKA 1VQ9A 4OF1A 4XTYA 5LJ5j 1UB4A 4ELZC 3HPWA 4OGEA 2PVOB 1G3WA 2ZPBB 2AKWB 3DB3A 3JCMd 1VQ4A 5L8RE 3BDLA 4PJOF 5LL6S 3L4GA 2E5QA 4II1A 1WPYA 4ZGDB 2ZPGB 2CJAA 3J7AF 5CO7A 2P4TA 5D6WA 3EFRA 3J81E 1BKBA 2ZCFB 2FVUA 4PJOA 1Y96B 2LTOA 1ZQ1A 4HCZA 3BFMA 3G4SA 4C5HA 3QZ9B 1N6AA 4RKUE 4NCXA 2HNIA 5A0DA 3HFZA 4LNSA 1ZHIA 1UGPB 4R56A 2A3LA 2E64A 4M7AG 5CAIA 4PJOE 4C0FA 2QA4T 3RKWA 5GAOl 4C8QB 4L6V5 4QQDA 1KOGA 4J6XA 1H3ZA 2ZNJA 2OTJT 2MF2A 1VQ8T 4YRGA 4P73A 4BB7A 3PMTA 4J83A 1TH7A 1WNLA 2DZCA 3RF1A 1BI0A 3QO8A 4JLIA 1OYXA 3FB9A 3S3NA 3A7AA 2RO0A 3RIRA 4M75B 1YJ9T 4YRKA 4O6JA 4Y91A 3W3SA 1B7YB 3L42A 1VQ7T 4H2YA 4TVWA 4OB2B 5CKEA 2F5KA 2IVWA 2L8DA 3P8VA 2DTHA 4YREA 2O4XA 3JB9F 3MF2A 2P0PA 3GF5A 4N4HA 4VUBA 3SWNB 3JCMh 3TU4K 4TVRA 1WJQA 2E12A 3MP6A 5KCOA 2ODRC 4M7DC 2R5AA 4YCVA 1WGSA 3HXZA 2A7YA 3CCEA 4DA4A 3DKMA 1ATIA 3JB9H 1JJCB 5M9OA 1Z7MA 2I2LA 4PNOA 5DLOA 4Z02A 1M1FA 2IY5A 3C94A 4CS4A 1SESA 4PKCC 4XTVA 2AKWA 2BIVA 4YDQA 1K9MC 3ME9A 1UGRB 2R57A 5DY9A 4RG2A 5GAMg 4P71A 2LDMA 3LGLA 2EYQA 5LJ3g 12ASA 1D3BB 1LNXA 1X55A 2EJGA 4LVIA 2J3MA 2DQ0A 1VIEA 5GAN7 4LD9K 4HVCA 3MEAA 1G3TA 4NS5A 2CJ9A 4HWOA 3DLMA 4JLGA 5FRMA 4M7AD 3VQXA 2HQEA 2DU5A 1VQNA 1N8RU 1Q7YC 1G51A 2KVQG 3CCJA 4TTVA 1YJNA 2RB6A 1M4ZA 2DK3A 2DPPB 4ATOA 1KG1A 4F7UF 2VUBA 1VQ5A 2I4LA 2RHXA 2LT1A 4M75F 2RJDA 2EQMA 4K87A 1QW1A 2JTMA 4UP7A 3PNWC 2ZPFB 4F7UA 1WJRA 3JB9G 3DSQA 3V7SA 3RKYA 1BBUA 4M75A 3OBYA 1VQOA 4RMOA 4YTLA 5GAMj 2ZIOA 1G3YA 4ZIBA 2EQJA 2DTOA 3CD6T 4F7UE 2XU8A 3QDRB 2WSFE 2EWNA 5GAOm 4E7JA 3MF1A 4M75E 2ARTA 3PZCA 4C92B 3C95A 4E47A 1YIJA 3MHXA 1UEBA 4YPFA 3OYCA 2DDZA 3E9IA 3UH0A 3ZFJA 3WQZA 4IUTA 4QW2A 2QHUA 3MQZA 1X6OA 4YRRA 4MMKA 1H4VB 4KR3A 2ZNIA 2H3JA 4G85A 4A4HA 2ZZDA 5GANd 3UGTA 2PMEA 4O2DA 2O01E 2VV5A 4X9DA 1YJWA 2DO3A 3QHSA 3JCMJ 3R07A 3E9GA 2CZ6B 3VQVA 2XIDA 1VQ6T 2WSCE 1N9SA 2RD1A 1M1KC 1NYRA 2LC4A 4KUIA 3ZEHA 3A5ZA 3RACA 5GAN6 1VQZA 4TWAA 3M55A 2RHZA 2WSEE 1Z7NA 2XDPA 4LDUA 3V8JA 2ZT8A 2PMFA 2ALYA 4HCBA 4P3OA 5C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U G;  3IG2 A;  1X56 A;  4M7A F;  3JB9 J;  2G4C A;  4M7A B;  3RER A;  1EVL A;  2DXT A;  3P8Y A;  4M77 E;  1H4S A;  5GAN f;  3JCM W;  2RHS B;  4P73 C;  3QSU A;  4YRI A;  1B70 A;  4J6W A;  3I7F A;  4HWP A;  4M75 D;  1YFR A;  2DQ3 A;  4C8Q C;  2CJB A;  3JCM f;  2Q5I A;  3FJP A;  3HRI A;  4HWS A;  4M7A A;  4J15 A;  4MML A;  3NEN A;  4L87 A;  4RMF A;  4M7D G;  2RHS A;  3JCM b;  2DXU A;  5GAN e;  5C51 B;  1PYS B;  1B34 B;  3REX A;  1SER A;  2RHQ B;  1E24 A;  2YLC A;  3LSQ A;  2Q7H A;  1NJ1 A;  1EIY B;  2C7I A;  5LJ3 j;  2P0L A;  4K88 A;  5GAN 5;  3JCM e;  1RIQ A;  3BY7 A;  11AS A;  4V2S A;  4WJ4 A;  2ZZF A;  1I8F A;  1LOJ A;  1PYS A;  4M7A E;  2RHQ A;  2DEQ A;  2ZT5 A;  4YRL A;  1EIY A;  3A5Y A;  4XQ3 A;  3G1Z A;  2I4N A;  5GMK m;  1H4T A;  4Q15 A;  4X5O A;  4EMK B;  3NEM A;  4XU0 A;  4AH6 A;  5GMK i;  5GAM d;  4C92 D;  2J3L A;  3HTZ A;  4Q6G A;  2ZR2 A;  2FB7 A;  2P5I A;  1YFS A;  2EJF A;  2ZZE A;  1USY C;  3BDU A;  2AMC A;  2DVE A;  2YHT A;  4CH5 A;  3SWN C;  1WU7 A;  4EMK A;  4P75 C;  4UP9 A;  4KR2 A;  3HFO A;  4DPG A;  4XTY A;  2ZTG A;  5LJ5 j;  1NJ5 A;  3L4G B;  3HY0 A;  3PCO B;  5GAN 3;  2AKW B;  3TUP A;  3JCM d;  3E9H A;  3L2Z A;  2DU7 A;  2RM4 A;  3L1A A;  4PJO G;  1E1O A;  3HRK A;  1YCY A;  1L0W A;  4PJO F;  3JCM Q;  3L4G A;  4PJO B;  4M77 G;  3HY1 A;  1X54 A;  1WPY A;  3PCO A;  5LJ5 d;  5GMK j;  2CJA A;  4EMG A;  3SB2 A;  1E22 A;  4M77 D;  3EFR A;  1WQ7 A;  5F5W A;  4RQF A;  4PJO A;  2ARS A;  3HFZ B;  4P71 C;  4ZTZ B;  1HC7 A;  4UPA A;  1Y96 B;  1WYD A;  4QVC A;  3BFM A;  4YRM A;  1E1T A;  1JBM A;  5GAM f;  3QO7 A;  1G5H A;  4NCX A;  1NJ6 A;  1SRY A;  5LJ3 f;  3QO5 A;  2HNI A;  4YRS A;  3HFZ A;  4LNS A;  5GAO p;  3INZ A;  1Y96 A;  2QTX A;  2E64 A;  4RCC A;  4C8Q G;  4M7A G;  4XEM A;  5CAI A;  3QTC A;  5GAN g;  4PJO E;  4H02 A;  4N0A C;  5C52 B;  3RKW A;  4C8Q F;  3HFV A;  5GAO l;  3IKM B;  4C8Q B;  3MEY A;  5GAM e;  4PG3 A;  1KOG A;  4J6X A;  4YRN A;  4M78 C;  5LJ3 e;  2ZNJ A;  3JCM g;  4ZTU B;  4YRG A;  4P73 A;  2Q7G A;  4WI1 A;  3TEH B;  4C8Q A;  1TH7 A;  1WNL A;  2DZC A;  3RF1 A;  4HT9 A;  3QO8 A;  1W66 A;  4JLI A;  2QHS A;  1BIB A;  3FB9 A;  3A7A A;  2DKG A;  3RIR A;  2ODR D;  5LJ5 f;  4M7D D;  1LYL A;  4M75 B;  4NL2 A;  5HGQ A;  4WF2 A;  4XU1 A;  5GAN 4;  4YRK A;  4Y91 A;  1SET A;  3W3S A;  1B7Y B;  2VC8 A;  1B76 A;  5K1X A;  1KMM A;  4H2Y A;  1EOV A;  4TVW A;  1B34 A;  4C8Q E;  5GAN h;  4P72 C;  3A7U A;  1WQW A;  1M5Q 1;  4M75 C;  3V8K A;  2I4M A;  3P8V A;  2DTH A;  4YRE A;  3JB9 F;  2C8M A;  4K86 A;  3MF2 A;  5LJ5 e;  2ZXF A;  1B7Y A;  1JRI A;  3SWN B;  3JCM h;  4EMH A;  3RGL A;  5LJ3 d;  4HT8 A;  4XU3 A;  5GAO r;  1ASY A;  3LC0 A;  2Y90 A;  3A32 A;  1I5L A;  5C53 B;  2ODR C;  4M7D C;  1QF6 A;  3JB9 I;  4EO4 A;  4YCV A;  1USY A;  5GAO q;  3SWN A;  3HXZ A;  1M8V A;  4P75 A;  3V8L A;  3ERR A;  5GMK e;  2VXE A;  3A31 A;  2IY5 B;  4YP0 A;  4YCW A;  1ATI A;  4HWR A;  3JB9 H;  3JCM P;  1JJC B;  1X2H A;  1Z7M A;  4C92 C;  2I2L A;  4PNO A;  3OD1 A;  1G5I A;  3RUX A;  2IY5 A;  5E3I A;  3BJU A;  4CS4 A;  5I21 A;  3RKX A;  1SES A;  3A7R A;  3UGQ A;  4RDX A;  4PJO D;  2I4O A;  4XTV A;  1FYF A;  2AKW A;  4YDQ A;  5ELN A;  3JCM V;  1IL2 A;  1JJC A;  3IAL A;  3LSS A;  4CH6 A;  3M4G A;  1GGM A;  2RA2 A;  3VBB A;  1EFW A;  4RCB A;  4EX5 A;  1NYQ A;  5DY9 A;  4DQ2 A;  2ZIM A;  3NET A;  3QNE A;  4RQE A;  5GAN 8;  5GAM g;  3ICA A;  4P71 A;  3HXY A;  1B8A A;  3KFU A;  5LJ3 g;  1ADJ A;  12AS A;  2CIM A;  1D3B B;  3VU3 C;  1LNX A;  1HTT A;  1X55 A;  1U1S A;  2EJG A;  2J3M A;  4M78 G;  4TVA B;  4H2X B;  3HXW A;  2DQ0 A;  4CS2 A;  1X2G A;  4M78 F;  5GAN 7;  2ZR3 A;  4M78 B;  2YLB A;  4H2W A;  2Q5H A;  4HVC A;  3RL6 A;  4P3N A;  4XTW A;  2CJ9 A;  1D3B A;  3CMQ A;  4HWO A;  4M77 C;  4JRK A;  2ZT6 A;  2DZ9 A;  4N0A A;  4P3P A;  4C8Q D;  4M7A D;  4TVA A;  5GMK l;  3HXU A;  3VQX A;  4G84 A;  4A53 A;  4XTX A;  2DU5 A;  2QHV A;  4YRP A;  3TEG A;  4M78 A;  3QO3 A;  1U1T A;  1G51 A;  4H2V A;  3HSB A;  2E41 A;  4TTV A;  1J5W A;  2RB6 A;  2E10 A;  5GAM h;  5LJ5 g;  5LJ3 h;  4F7U F;  4JUV A;  3REU A;  2FYK A;  4F7U B;  4YRQ A;  4M75 G;  1EQR A;  4YCU A;  2I4L A;  4TQF A;  3TEH A;  4NOY A;  4H2S A;  4M75 F;  1KQ2 A;  2E3C A;  4K87 A;  4M78 E;  1LJO A;  1N9W A;  1ADY A;  3JCM c;  4WJ3 M;  4M7A C;  1NJ2 A;  4OLF A;  4UP7 A;  2EL9 A;  2CGH A;  4H2U A;  2VXF A;  4F7U A;  3AHU A;  3IKL A;  3JB9 G;  4XEO A;  3FIF A;  3V7S A;  3DSQ A;  3RKY A;  4P72 A;  1BBU A;  1C0A A;  1BIA A;  3RES A;  4M75 A;  3VQW A;  3JB9 D;  4M7D F;  1QE0 A;  2ZIN A;  4M7D B;  1WLE A;  1KMN A;  4YRF A;  5GAM j;  2ZIO A;  1HK9 A;  3GIB A;  4CH3 A;  3JCM X;  5GAO n;  2QHT A;  4X9C A;  4UP8 A;  4ZIB A;  2DTO A;  5KNN A;  4BW9 A;  3P8T A;  5LJ5 h;  4F7U E;  2XTI A;  4M7D A;  1ASZ A;  5GAO m;  2EWN A;  4C92 G;  2AMC B;  3MF1 A;  1KQ1 A;  4M75 E;  2ART A;  2XGT A;  2Q7E A;  4NL3 A;  3PZC A;  4C92 F;  5GAN j;  4C92 B;  4J5Y A;  4HWT A;  2ARU A;  4YPF A;  2ZT7 A;  1NJ8 A;  2ZGW A;  4OP0 A;  5GAN 2;  2DJZ A;  3QUI A;  2DDZ A;  3E9I A;  3UH0 A;  3WQZ A;  4EMK C;  4A54 A;  2QHU A;  3PGG A;  1NNH A;  5GMK h;  2E65 A;  4XTZ A;  4YRR A;  3VQY A;  4MMK A;  1HXD A;  4C92 A;  4M7D E;  4YRJ A;  4BWA A;  3HXV A;  1H4V B;  4KR3 A;  2ZNI A;  3EFS A;  4G85 A;  3HFN A;  4H2T A;  5GAN d;  3UGT A;  1YFT A;  2PME A;  4O2D A;  4TQD A;  2EAY A;  4YYE A;  4E51 A;  2E1H A;  4X9D A;  4PHC A;  3M4P A;  3QHS A;  3JCM J;  3R07 A;  4J6Y A;  4XTU A;  3VQV A;  4KQE A;  2JN0 A;  4YRT A;  3A74 A;  4C92 E;  4TVY A;  1N9S A;  3V7R A;  2RD1 A;  3NEL A;  4M77 F;  1NYR A;  4M77 B;  4QVD A;  1EVK A;  3HXX A;  3BW1 A;  4CH4 A;  3A5Z A;  2ZZG A;  3UFG A;  3RAC A;  4PJO C;  1BBW A;  5GAN 6;  2ALY B;  1VQZ A;  1H64 1;  4M78 D;  1N9R A;  5ELO A;  4YRC A;  4CS3 A;  4XU2 A;  4TWA A;  5K1P A;  1I4K 1;  3V7C A;  1Z7N A;  4M77 A;  4H2X A;  1X01 A;  3V8J A;  1H4Q A;  2ZT8 A;  3M4Q A;  4HA8 A;  2PMF A;  1YB3 A;  2ALY A;  4JRI A;  2EJ9 A;  2K57 A;  4P3O A;  4P74 C;  2ZCE A;  1MGQ A;  1YGB A;  4YRO A;  2DTI A;  4P74 A;  1B70 B;  2E5A A;  1I81 A; 
#chains in the Genus database with same CATH topology
 4F7U G;  2NLU A;  3THK A;  2V8J A;  6AT1 B;  4KGZ B;  4M4Z A;  1T3L A;  2CT4 A;  4M7A B;  2DXT A;  2JXB A;  4D6W A;  1OQK A;  5GJV B;  2D0N A;  1H4S A;  4X1V A;  2RJC A;  1Q86 U;  1B70 A;  4C5E A;  1Q95 G;  3CQT A;  1N8R R;  3FJP A;  4HWS A;  3GPL A;  4RTV A;  2CZ0 B;  1RAI B;  4BY6 B;  3M56 A;  2XG8 D;  1TG0 A;  1NJI C;  2RHS A;  2L5Q A;  3QJY A;  1R0B G;  3PE0 A;  1PYS B;  1SER A;  4PJM A;  3EGD A;  4HCC A;  1WJS A;  3G6E A;  2YLC A;  1W2B S;  2C0T A;  2C7I A;  2P0L A;  5GAN 5;  1RIQ A;  3CCL A;  4ZTJ A;  5DLQ E;  4WJ4 A;  4J9C A;  3X26 B;  1UG1 A;  2ZZF A;  3VS2 A;  1LOJ A;  2RHQ A;  2QXF A;  3HP9 A;  2RI5 A;  3QJ6 A;  3AT1 B;  3UA6 A;  3TQ7 P;  1BCO A;  4YRL A;  1EIY A;  3G1Z A;  1C0M A;  4EMK B;  4BI3 A;  1W2B A;  4XU0 A;  4AH6 A;  1NEG A;  2YWW A;  3CME A;  3CD6 Q;  1D09 B;  3CPW S;  1MUZ A;  2K9G A;  2EJF A;  4HKE A;  1USY C;  3EAE A;  5CK9 A;  3TRE A;  3I55 T;  4CH5 A;  1WU7 A;  3FJ5 A;  2JNG A;  4P75 C;  3CCR T;  1BI2 A;  4L5G A;  3PMI A;  1ZUK A;  2HBW A;  2K2V A;  3HFO A;  4DPG A;  3NTH A;  2ZTG A;  2HL5 C;  2AHJ B;  2DAQ A;  1C1A A;  3L4G B;  3UF4 A;  4FT2 A;  3HY0 A;  1SKU B;  5GAN 3;  1SF9 A;  4FIB A;  1G5V A;  1S72 A;  2LJ0 A;  2DU7 A;  2RM4 A;  3L1A A;  1E1O A;  1XTD A;  2MWO A;  3VS6 A;  1YBY A;  1MMA A;  1WHG A;  2M51 A;  4PJO B;  1X54 A;  2J05 A;  3PCO A;  4J9H A;  1NYG A;  2LX9 A;  3E1S A;  3A8G B;  3CCM A;  2X4J A;  1MNE A;  5FU6 C;  1EFN A;  3M0R A;  3KFV A;  1VQ6 Q;  5KYU A;  3VYG A;  3HFZ B;  1M90 C;  4FL6 A;  2QEX A;  1AHJ B;  1AWJ A;  2NUP B;  1E1T A;  5GAM f;  3SHW A;  1NJ6 A;  2DL8 A;  1SRY A;  5LJ3 f;  4BAC A;  3QO5 A;  2PVD B;  1XJW B;  4ZGE B;  1VQL A;  4IKF A;  2CP0 A;  2LCC A;  1AEY A;  2WAC A;  3RMQ A;  4RTX A;  2X4X A;  1VQK Q;  2KEA A;  2KE9 A;  3CBP A;  2MIO A;  3QTC A;  5GAN g;  3CXC P;  3CC7 T;  4N0A C;  5C52 B;  4FW1 A;  3A8L B;  1X6B A;  3HFV A;  3A8M B;  2EPD A;  4PG3 A;  3UWN A;  1Q81 C;  3CC2 T;  4M78 C;  2ZAE A;  4PFZ A;  2CZ7 B;  1AWW A;  2FO0 A;  1FWZ A;  1FYN A;  2JM8 A;  2MMP A;  4CC2 A;  4WI1 A;  1X69 A;  4JS5 A;  2YXY A;  1R0C B;  2EQI A;  2LCL A;  1ABQ A;  1K0S A;  2MWP A;  3OYB A;  2HDA A;  1GFD A;  1BI3 A;  1D1C A;  1JJ2 P;  3RR6 A;  3PTA A;  2QGF B;  1Y57 A;  1K4U S;  2DKG A;  2LQW A;  2O4X B;  1LYL A;  3VS1 A;  1M8M A;  4LXC A;  4NL2 A;  1RUW A;  2EYX A;  3GLX A;  1Q86 R;  3BE3 A;  2RMO A;  3OYD A;  1M9S A;  2W10 A;  1M5Q 1;  2LMJ A;  2FPD A;  2I4M A;  3CC4 A;  1RAH B;  2C8M A;  4K86 A;  3OYK A;  5LJ5 e;  3JRZ A;  2PUO B;  5HKC A;  1TXQ A;  1JRI A;  1NLO C;  1KQS P;  4EMH A;  2F1L A;  4ZNX A;  1OZ3 A;  1K73 C;  1QVF A;  2LCS A;  5LJ3 d;  4AG2 C;  3LC0 A;  2Y90 A;  3A32 A;  1JQQ A;  1I5L A;  5C53 B;  4OMP A;  3JB9 I;  4EO4 A;  5J26 A;  5GAO q;  3VS0 A;  2LNV A;  2RQW A;  1M8V A;  4RTU A;  7AT1 B;  3CCU Q;  2A08 A;  2YUN A;  4B6M A;  3G71 A;  2IY5 B;  2OTJ A;  4D8K A;  1VQ8 A;  1HJD A;  2F2V A;  3DLL A;  3I55 Q;  1IO6 A;  1X2Q A;  3CCR Q;  1R77 A;  2GCX A;  2ZPE B;  3OYY A;  3OD1 A;  1XQH A;  5E3I A;  2DFU A;  3BJU A;  3UGQ A;  5CCA A;  1MND A;  2LJ3 A;  4RDX A;  4O5V A;  1K9M U;  2QQS A;  1VQP T;  1QVG A;  3JCM V;  2CZ1 B;  3CCS A;  2C0I A;  4KGX B;  1AZE A;  3VBB A;  4QVZ A;  2L3Q A;  1ZSZ C;  4EX5 A;  1YIT A;  4DQ2 A;  3NET A;  3QNE A;  2GNC A;  4BDZ A;  3HXY A;  2CUB A;  3M58 A;  2RI3 A;  4RG8 A;  2CIM A;  1M30 A;  3VU3 C;  1NPP A;  2V8I A;  1TSF A;  2L3R A;  2B86 A;  3PVL A;  4M78 G;  4IUR A;  2QDL A;  2HEQ A;  1X2G A;  1VQM A;  2Q5H A;  4C0D B;  3CMQ A;  3NTI A;  5CKD A;  3N5B B;  1K9A A;  4M77 C;  2AKL A;  2ZT6 A;  2BKD N;  1NPR A;  1SSF A;  2V26 A;  3MEV A;  4TVA A;  3GNF B;  3HXU A;  2XDB A;  4A53 A;  1Q7Y U;  4XTX A;  4MZM A;  2CRE A;  3EHR A;  1VYT A;  2RH2 A;  3HSB A;  5HCK A;  3RNJ A;  1WX6 A;  5FU7 B;  4Z8A A;  3CMA A;  5GAM h;  5KYX B;  5LJ3 h;  4F7U B;  4YRQ A;  1EQR A;  3H0F A;  1VQ9 T;  2LQK A;  4TQF A;  4PLI A;  1A0N B;  2K5F A;  2X51 A;  1LJO A;  1ADY A;  1NJ2 A;  2CGH A;  1Q82 U;  2VXF A;  5CVI A;  3IKL A;  1VQ4 T;  3CCQ A;  4R55 A;  2IIM A;  1BI1 A;  5HY6 A;  1BIA A;  4FM4 B;  1D1B A;  4M7D F;  1WXB A;  4CH3 A;  3EG2 A;  1OI1 A;  2DE0 X;  3JCM X;  5GAO n;  1T0J A;  2BZY A;  4UP8 A;  2RPN A;  3CCV A;  3HHT B;  4EDU A;  4WTO B;  2JJ9 A;  2RI2 A;  1UHC A;  1ZUU A;  1AOJ A;  2JW4 A;  3DB4 A;  3X28 B;  5KNN A;  1VUB A;  3P8T A;  2XTI A;  4M7D A;  2ESW A;  2K6D A;  4BUG A;  5IHK A;  3G4S T;  1KQ1 A;  4DBH A;  2Q7E A;  1KHI A;  2EKO A;  3E2U A;  4GLK A;  3RBB B;  4JDS A;  3HRS A;  3MP8 A;  2ZGW A;  5GAN 2;  1MV3 A;  2DJZ A;  3QUI A;  1KD1 C;  2XIC A;  5CKH A;  4A54 A;  5C6S A;  3HKS A;  4HCK A;  4C0G A;  5GMK h;  4XTZ A;  3VQY A;  4M7D E;  4YRJ A;  1KJW A;  2EIF A;  3HXV A;  4FCY A;  1VQL Q;  4A4E A;  1WLP B;  3QYG B;  4P5N A;  4PJN A;  1RAG B;  2BUD A;  3OYI A;  4Z89 A;  1GCQ A;  2FL7 A;  1NYF A;  2DL3 A;  4LVJ A;  3M4P A;  4LVM A;  2GTO A;  2K7A A;  4J6Y A;  4K11 A;  4XTU A;  1VQP Q;  3A5Z B;  3A74 A;  5I2S A;  1RAD B;  1M1K U;  3H0H A;  1NG2 A;  4XAX B;  3V7R A;  1ARK A;  4LVK A;  3NEL A;  4QVD A;  3HXX A;  4CRI A;  1QP2 A;  2ZZG A;  4C0Z A;  3VYH B;  5I2M A;  2DD4 A;  2ALY B;  2EFI A;  4M78 D;  5ELO A;  1N9R A;  4CS3 A;  1I4K 1;  3VS4 A;  4KUD K;  2GGR A;  5DM7 R;  3M0P A;  2DLP A;  4LDV A;  1ZBX A;  1H4Q A;  4FYY B;  4LD6 A;  2KRM A;  1GBQ A;  2D1X A;  2MCN A;  2M0O A;  1MGQ A;  1IRX A;  1BU1 A;  1B70 B;  3QZ5 B;  1I81 A;  2A8E A;  1X56 A;  1AZG B;  2DNU A;  1IXD A;  2G4C A;  3RER A;  1EVL A;  1G3S A;  5IXF A;  2KMT A;  1ZBJ A;  1U5S A;  2BE9 B;  5GAN f;  2GFA A;  2RHS B;  1M3C A;  3QSU A;  4YRI A;  3M4Y A;  2F2W A;  1T0H A;  2DQ3 A;  3CPW P;  3LW5 E;  1Q7Y R;  1PSE A;  3EGD B;  4C8Q C;  4KT0 E;  2KT1 A;  2CJB A;  1XOV A;  1NJI U;  1VQ9 Q;  3I5R A;  3G71 Q;  1WI7 A;  4M7D G;  2DXU A;  3REX A;  2RHQ B;  3OQ5 A;  3LSQ A;  2XK0 A;  3OYE A;  1EIY B;  5FWB A;  5LJ3 j;  2KAF A;  5KYY A;  3JCM e;  3BY7 A;  2RHY A;  4V2S A;  1TUD A;  3M0Q A;  3LWH A;  4DEY A;  1TOV A;  4C5I A;  1E6G A;  1KC8 C;  2JTF A;  1QCN A;  2P4R A;  5FW9 A;  4JRP A;  2ENM A;  1Q82 R;  3CCS Q;  2D9T A;  3SD4 A;  2RQU A;  4XQ3 A;  3S6W A;  2I4N A;  1BCM A;  4X5O A;  3NEM A;  3G7Z A;  2GBQ A;  5GMK i;  4DBF A;  2J3L A;  3HTZ A;  1YIT Q;  1RL2 A;  2FB7 A;  1YFS A;  3S3M A;  2JMA A;  2GF7 A;  3G4S Q;  3SWN C;  1G8X A;  1E6H A;  2EYY A;  2DJQ A;  2HCK A;  2PUK B;  2RHU A;  3FRN A;  2K5L A;  1VQN T;  3FEO A;  2JZ2 A;  1YHQ A;  3ZL7 C;  5IN1 A;  2DX1 A;  1B07 A;  5D6Y A;  3PCO B;  4UC4 A;  5HK0 A;  3IQL A;  3L2Z A;  2JVV A;  1SRL A;  2XKO C;  3HRK A;  2RJE A;  1L0W A;  3A1P A;  1JB0 E;  2YUP A;  3X24 B;  1VQ5 T;  2DM1 A;  4OML A;  2B8A A;  2J06 A;  5LJ5 d;  4JPB W;  5GMK j;  4EMG A;  3SB2 A;  2D8H A;  2DVJ A;  2A37 A;  3CMA Q;  4M77 D;  3OYM A;  1JO8 A;  2Y4Y A;  3F70 A;  2V8K A;  2YUO A;  5EG2 A;  3KXT A;  1M90 U;  4J8O A;  1GXI E;  1G83 A;  1NE8 A;  2ARS A;  4ZTZ B;  1HC7 A;  4UPA A;  4FU6 A;  2LQ8 A;  1LCK A;  2HZY A;  4QQ6 A;  1VYU A;  8AT1 B;  1VQO T;  1XNI A;  1VQK T;  1WDX A;  4GY5 A;  2OTL A;  5KYN A;  2KY9 A;  3L2V A;  4BDY A;  1UGV A;  3CCQ Q;  1UGQ B;  5GAO p;  2F69 A;  4OGC A;  1O9S A;  4C8Q G;  1LPL A;  9ATC B;  4PK4 A;  3VRY A;  3IKM B;  4E7Z A;  3UDC A;  3MEY A;  3M59 A;  1Y07 A;  3LX7 A;  1WIE A;  4YRN A;  3CCV Q;  2KT8 A;  2FG0 A;  4E7L A;  1UGS B;  1YIJ T;  2KSS A;  2HAX A;  1T3S A;  2Q7G A;  1MMD A;  1M3B A;  1N8R C;  3TEH B;  3TSZ A;  1QP3 A;  4MDW A;  3CCE Q;  2OX7 A;  5CKF A;  2Y4X A;  1D0X A;  2NUT A;  1W66 A;  4D8D A;  4F14 A;  2QHS A;  4OMN A;  2ODR D;  4M7D D;  2QG9 B;  5HGQ A;  4WF2 A;  1FX7 A;  1B76 A;  3C0C A;  1YJW T;  2ZPH B;  2K3Y A;  2ED0 A;  3VKI A;  3MCA B;  3VJP A;  4P72 C;  5GAN h;  3MO8 A;  4EPC A;  3V8K A;  3EH1 A;  1KK7 A;  2J6F A;  3OYF A;  3OA6 A;  3PFS A;  3OS2 A;  2PU9 B;  2OAW A;  4RTW A;  1X6G A;  3CCU T;  4HT8 A;  2H8H A;  2X9H A;  4PFO A;  1RAB B;  1YP5 A;  3VS3 A;  1QF6 A;  1USY A;  4PLL A;  4P75 A;  2DRK A;  3KUF A;  2VXE A;  3CC2 A;  2MOX A;  2JS0 A;  1I07 A;  1RLQ C;  4YP0 A;  1JXO A;  2OI3 A;  3I5S A;  4L59 A;  1WHK A;  4HWR A;  2D0Q B;  1SG5 A;  3OW2 A;  3MEU A;  3NFC A;  3WXM B;  1IGU A;  2XHC A;  4C92 C;  2QAS A;  1U06 A;  1G5I A;  3RUX A;  3CBM A;  4AT1 B;  1VQN Q;  4FT4 A;  3Q1J A;  5I21 A;  1ZSZ B;  2A0F B;  3CCJ Q;  2I4O A;  1IL2 A;  1DJ7 B;  5ELN A;  1YJN Q;  4IUU A;  1PM3 A;  3M54 A;  2RA2 A;  2ROL A;  3C4S A;  4RCB A;  1WZO A;  4FYW B;  1VQ5 Q;  2ZIM A;  3I56 A;  1EZZ B;  1YI2 A;  3QII A;  4A4K A;  3ICA A;  1RLP C;  1B8A A;  2VVK A;  3KFU A;  5CIU A;  1ADJ A;  3QXE B;  4N4I A;  2LJ1 A;  4HVU A;  4F16 A;  1IHV A;  3GOX A;  1UJY A;  1HTT A;  1U1S A;  3G6E T;  3LWI A;  4TVA B;  4H2X B;  4J7F A;  4CS2 A;  1HSQ A;  3CCL T;  3O8V A;  2QQA A;  4M78 F;  2CP5 A;  1VQO Q;  2KRN A;  1B7T A;  3VS7 A;  4P3N A;  3FLG A;  2HQX A;  2HSE B;  2LX7 A;  4JRK A;  4DBQ A;  2DL4 A;  2DZ9 A;  2HKN A;  1NZ9 A;  2YRC A;  4N0A A;  4C8Q D;  4OMQ A;  5GMK l;  4Q5W A;  1W4S A;  3M0U A;  3VS5 A;  4YRP A;  3TEG A;  4M78 A;  3R6N A;  3NMZ C;  3CME T;  3QWX X;  4H2V A;  2ZNI A;  2KQW A;  2E41 A;  1KHC A;  1M2O A;  4LDX A;  1J5W A;  2MAM A;  2GQV A;  2DL5 A;  2XD0 A;  8ATC B;  2AZV A;  3OSV A;  5LJ5 g;  4OB3 B;  1YIJ Q;  2DXB A;  2CH4 A;  3JV3 A;  3REU A;  4ZN1 A;  4RTY A;  4YCU A;  1PRL C;  2Z0W A;  3TEH A;  4NOY A;  1PRM C;  2E3C A;  4M78 E;  4E7I A;  1VYV A;  3JCM c;  1QVF S;  4M7A C;  4OLF A;  2EL9 A;  4H2U A;  2KR3 A;  4XEO A;  2L0A A;  1D1A A;  5I22 A;  3FIF A;  1N27 A;  3UT1 A;  1YHQ Q;  5A0L A;  2D6F A;  1QE0 A;  4M7D B;  1WLE A;  4BD3 A;  1HD3 A;  3L2R A;  1YJW Q;  2GFU A;  2LNH B;  1OU8 A;  2YUQ A;  4YRF A;  4BY6 C;  5AYF A;  3TEE A;  3UA7 A;  3EG0 A;  4X9C A;  2DBK A;  4DEX A;  2VB6 A;  4LDY A;  1E7O A;  2QA4 A;  3EG1 A;  2QEX T;  2BTT A;  4C92 G;  2AMC B;  3H8Z A;  2XGT A;  2M0Y A;  3QBY A;  4NL3 A;  5GAN j;  4J5Y A;  4HWT A;  2ARU A;  1KD1 U;  2ZT7 A;  1QVG S;  2LZ6 B;  2SRC A;  1VQL T;  2YRV A;  4EMK C;  1FMK A;  4DBR A;  1NNH A;  2MPX C;  2RJF A;  2JOY A;  4BWA A;  2COZ A;  1MHN A;  3EFS A;  3UPU A;  4H2T A;  5EC7 A;  2FEI A;  1O75 A;  4OMO A;  2K4Y A;  1YFT A;  2RF0 A;  2QAZ A;  3U23 A;  1VIF A;  4TQD A;  4YYE A;  1YJ9 A;  4E51 A;  1G2B A;  2C0O A;  2X4W A;  3NTK A;  4B9X A;  3RDV A;  1VQ7 A;  2E1H A;  4JJB A;  4QQG A;  1K8A C;  1N5Z A;  3M9Q A;  1BK2 A;  3H0I A;  5KYW A;  2HQH A;  2EKH A;  1ZSZ A;  4BI8 B;  3NPF A;  4KQE A;  4YRT A;  1SHF A;  4B9W A;  2DL7 A;  4KUL A;  3NHN A;  4LVL A;  2FZC B;  1QMC A;  2CP2 A;  4M77 F;  1EVK A;  1QQJ A;  3OYH A;  4XK8 E;  2F2X A;  4R0K A;  4JJN K;  3UFG A;  4BE1 A;  2LT4 A;  4PJO C;  1Y71 A;  1H64 1;  3GP8 A;  4YRC A;  4Z88 A;  4LDW A;  3MET A;  1WHL A;  3G6E Q;  2KK4 A;  2BZX A;  2EGE A;  5IAY A;  3CC4 T;  4M77 A;  4CC4 B;  4HVV A;  4BE0 A;  1X01 A;  4H2X A;  3CCL Q;  3M4Q A;  4HA8 A;  1UFF A;  5FRO A;  2R58 A;  2HKQ B;  4JRI A;  2EJ9 A;  1CSK A;  1MMN A;  1U8R A;  3OYG A;  3E9F A;  1YGB A;  3J80 E;  4YRO A;  2DTI A;  3A8H B;  2E5A A;  2ATC B;  3IG2 A;  2QQB A;  3P8Y A;  3CME Q;  2CSI A;  4OVA A;  1IZ6 A;  4M77 E;  5HK3 A;  3SEM A;  1I1J A;  3JCM W;  2K2M A;  3G71 T;  3OYL A;  4P73 C;  4ELY C;  1YFR A;  2EQK A;  3ZBD A;  2J7I A;  4J7I A;  4J9B A;  2Q5I A;  3HRI A;  4AFS C;  3NEN A;  2CH4 W;  5KYY B;  4L87 A;  2DXC A;  4RMF A;  3KBG A;  1M2V A;  5D6X A;  4LUD A;  5C51 B;  1RAC B;  1B34 B;  4ZGJ B;  1QCF A;  1S72 Q;  2Q7H A;  3CCS T;  1NJ1 A;  1YCS B;  3D7S B;  2LRQ A;  4K88 A;  5FRN A;  1LVK A;  2DIG A;  5I11 A;  1KC8 U;  11AS A;  1WXU A;  4ANJ A;  3HL8 A;  3OS1 A;  1I8F A;  1YIT T;  3PIP A;  2DYB A;  1M27 C;  2NS6 A;  2KXD A;  1WXT A;  3CXC S;  2PVG B;  1B3Q A;  2DD5 A;  2CYZ B;  2K5I A;  3CCM Q;  3A5Y A;  3VRZ A;  3SFM A;  2VGM A;  5GMK m;  4Q15 A;  3I35 A;  3EG9 B;  3S3O A;  4C92 D;  2PQW A;  2K3X A;  2HSP A;  4HT4 A;  3I56 Q;  1FMV A;  2P5I A;  2A36 A;  4MZT A;  3TCJ A;  2QEX Q;  1X75 C;  1VQM T;  2AMC A;  3OB9 A;  2DVE A;  3CXC A;  2YHT A;  1PKT A;  3TSW A;  4A4F A;  2KBT A;  3QYH B;  1JJ2 S;  1Y7X A;  4UP9 A;  4DOV A;  4KR2 A;  5AT1 B;  3WVD B;  2MYS A;  1ZX6 A;  3TVT A;  4E2F B;  2QQ9 A;  5A0G A;  1TUG B;  2FPF A;  3VV0 A;  1NJ5 A;  2FHD A;  2RK2 A;  4DOW A;  1KD1 R;  3TUP A;  3E9H A;  1JJ2 A;  3CMA T;  1MMG A;  4PJO G;  3M5A A;  1YCY A;  2CDT A;  3JCM Q;  4M77 G;  3HY1 A;  2W0Z A;  4IUP A;  1KQS S;  4IUQ A;  1OZ2 A;  2KDS A;  2CSQ A;  1E22 A;  4HVW A;  1K9M R;  3LH5 A;  2QGG A;  2L2P A;  1WQ7 A;  5F5W A;  4RTT A;  3MEW A;  4RQF A;  2JMC A;  3CD6 A;  4P71 C;  3CCQ T;  1GCP A;  2E70 A;  1WYD A;  2E6Z A;  4QVC A;  1KQS A;  1UDL A;  2X35 A;  1AVZ C;  4YRM A;  1JBM A;  2YSQ A;  4KGV B;  1ABO A;  2EQU A;  1G5H A;  3QO7 A;  1W2B P;  4YRS A;  2GTJ A;  4AFU C;  2CUD A;  2DER A;  2O2O A;  3INZ A;  5J39 A;  3CCV T;  2FZG B;  1NLP C;  1Y96 A;  3CC4 Q;  2QTX A;  4XEM A;  4RCC A;  4H02 A;  2ZPI B;  4C8Q F;  2OAU A;  3CCE T;  2EW3 A;  5GAM e;  2NUT B;  5LJ3 e;  4JRQ A;  1FXX A;  3JCM g;  4C0D C;  4ZTU B;  3OYJ A;  2QA4 Q;  2RQR A;  3VUB A;  5KE2 A;  4C8Q A;  3GNG A;  3OMG A;  5FLX E;  4OB1 B;  4HT9 A;  2COY A;  3NGP A;  2OTJ Q;  2DET A;  1VQ8 Q;  1BIB A;  1YWP A;  2M1H A;  1VQ6 A;  5GJW B;  5FU7 C;  2YT6 A;  1UHF A;  5LJ5 f;  1SPK A;  5KH6 A;  4XU1 A;  5GAN 4;  1SET A;  2C06 A;  2VC8 A;  5K1X A;  4ZN3 A;  3P8H A;  1KMM A;  1EOV A;  3R6O A;  1RAA B;  2ABL A;  1B34 A;  4C8Q E;  1NEB A;  5J3B A;  3SDZ A;  3A7U A;  1WQW A;  4M75 C;  1Q82 C;  3OBW A;  1VQK A;  4ME7 A;  2ZXF A;  1JU5 C;  1K1Z A;  1VQ7 Q;  1KIK A;  1B7Y A;  2RN8 A;  2J6K A;  3RGL A;  1UUE A;  2QQR A;  1WFW A;  4KRT A;  4XU3 A;  5GAO r;  1ASY A;  3M57 A;  4LNP A;  3QKJ A;  4Y28 E;  1KC8 R;  3SWN A;  3EG9 A;  2PNI A;  1OX9 A;  2DA9 A;  2P0K A;  3V8L A;  2XDD A;  2QDY B;  3ERR A;  5GMK e;  1AWO A;  2VYT A;  3A31 A;  1AT1 B;  4F17 A;  1I0C A;  1JXM A;  1VQM Q;  5CQY A;  5IHN A;  4YCW A;  1TS9 A;  4LN2 A;  5CKB A;  3CCJ T;  3C12 A;  3JCM P;  1BYM A;  1UTI A;  1YJN T;  1K76 A;  1X2H A;  2RK1 A;  2VWF A;  2GQI A;  1J3T A;  5FU6 B;  3RKX A;  1V76 A;  3A7R A;  1BB9 A;  2F5T X;  4PJO D;  4FYX B;  1UE9 A;  1FYF A;  1K0X A;  1JJC A;  3IAL A;  3LSS A;  4CH6 A;  1RAF B;  2AZS A;  3REA B;  3A8O B;  3M4G A;  3EHQ A;  1GGM A;  1TTH B;  1EFW A;  1QVP A;  1IRE B;  2M9U A;  1NYQ A;  3LGF A;  4N4G A;  4RQE A;  5GAN 8;  3OYN A;  5KE3 A;  3RMS A;  5IT9 E;  1MV0 B;  1YNZ A;  3T9N A;  3MP1 A;  1OV3 A;  4E6R A;  2P84 A;  1M1K R;  3HRU A;  3CCU A;  3ER0 A;  3HXW A;  2P0Q A;  1QVF P;  2ZR3 A;  4M78 B;  1P92 A;  2YLB A;  4H2W A;  3I55 A;  3RL6 A;  5CR2 A;  4XTW A;  4X34 A;  1VA7 A;  4A4G A;  3QG1 A;  3EG3 A;  3CCR A;  1D3B A;  4FYV B;  1EX4 A;  1Q81 U;  1R8O B;  4P3P A;  3CEY A;  4E7K A;  2NUZ A;  4PFP A;  4G84 A;  4PL6 A;  2QHV A;  2COW A;  1IB8 A;  3QO3 A;  1HYO A;  1QLY A;  1U1T A;  4MZP A;  3OYA A;  3URG A;  2RHI A;  2M16 A;  3PVQ A;  1Z9Q A;  1I5O B;  2E10 A;  1S1N A;  4CI0 C;  1TU0 B;  2HL3 A;  2VGN A;  2O88 A;  4CC7 A;  4JUV A;  2E6N A;  2FYK A;  4M75 G;  1ZA1 B;  1V1C A;  4FW2 A;  2PTK A;  3OSS C;  3O5Z A;  4H2S A;  1KQ2 A;  3EGX A;  4ZTF A;  3L2U A;  1QVG P;  1N9W A;  1YHQ T;  2EYW A;  1OPL A;  2EGA A;  2JS2 A;  4WJ3 M;  1WA7 A;  3AHU A;  1RI0 A;  4JZ3 A;  4P72 A;  2HMA A;  1C0A A;  3LLR A;  3RES A;  1NJI R;  2KXC A;  3VQW A;  3JB9 D;  2K3B A;  4C5G A;  2ZIN A;  1K73 U;  1RI9 A;  1V29 B;  1KMN A;  1UJ0 A;  1HK9 A;  3GIB A;  2QHT A;  4LE9 A;  1KSW A;  4MDX A;  2NWM A;  4PJJ A;  2L3P A;  3OW2 S;  4BW9 A;  5LJ5 h;  1ASZ A;  3ASK A;  4OMF B;  3M53 A;  4AMC A;  2E3H A;  3CC7 A;  2K79 A;  3PT9 A;  2I0N A;  3P8D A;  1PNJ A;  1PCX A;  2EVR A;  3LH0 A;  4C92 F;  2OTL T;  2DEU A;  4J9I A;  4IUV A;  3EFO A;  1NJ8 A;  4OP0 A;  4J9G A;  3UAT A;  2XI9 A;  2LVM A;  3PGG A;  2E65 A;  1HXD A;  4IIM A;  4C92 A;  5KYW B;  4OB0 B;  1D0Y A;  3HFN A;  3CPW A;  2EAY A;  4ORZ A;  1K8A U;  3CBO A;  4PHC A;  3OS0 A;  2E3I A;  2JUF A;  1Z9Z A;  2HD0 A;  1PHT A;  3OY9 A;  1H3H A;  2JN0 A;  3H9N A;  4JZ4 A;  4C92 E;  1YWO A;  2DRM A;  2KRS A;  1YFN A;  3L2Q A;  4TVY A;  5KCH A;  3QPH A;  2G3R A;  1PD0 A;  4M77 B;  2MI6 A;  3BW1 A;  3LYI A;  2X4Y A;  3MJX A;  4CH4 A;  4ESR A;  2L89 A;  3L2W A;  1SEM A;  2H3E B;  1BBW A;  3FC3 A;  1M1G A;  2HBP A;  4XU2 A;  1SSH A;  2V1Q A;  5ECA A;  5K1P A;  1M90 R;  3VUZ A;  3V7C A;  1OOT A;  2R5M A;  2CS7 A;  2DMO A;  2DF6 A;  1YB3 A;  3OS5 A;  2K57 A;  2ROT A;  4P74 C;  1GFC A;  2ZCE A;  2VKN A;  4JS4 A;  3EH2 A;  4P74 A;  3P8B B;  3JSC A;  3FDR A;  2DIQ A;  3HRT A;  1PKS A;  4FSX A;  5CQX A;  4M7A F;  1PD1 A;  3WVE B;  2SEM A;  3JB9 J;  3X20 B;  2QI2 A;  1H8K A;  2JT4 A;  1VQP A;  3EGU A;  1M2V B;  1Q81 R;  2E4H A;  4KBM B;  4J6W A;  3I7F A;  4HWP A;  4M75 D;  3E19 A;  2CKK A;  1Q86 C;  2O9V A;  3JAM E;  3JCM f;  4J15 A;  4M7A A;  1S72 T;  3X25 B;  4J9E A;  4MML A;  3OMC A;  3JCM b;  4LUE A;  5GAN e;  1EIF A;  3HTR A;  3H41 A;  1E24 A;  1FMW A;  3CCM T;  1VOM A;  2FZK B;  3H6Z A;  1PG5 B;  1PYS A;  4HXJ A;  4M7A E;  3I56 T;  2DEQ A;  1YI2 T;  2QYZ A;  2ZT5 A;  2AK5 A;  1H4T A;  5A2Q E;  2CT3 A;  1OEB A;  2J6O A;  5GAM d;  4Q6G A;  2IG0 A;  1RAE B;  2ZR2 A;  4BE2 A;  1K73 R;  5IH2 A;  3A98 A;  4OMM A;  1WHH A;  1PSF A;  3PIO A;  1CKA A;  4E7H A;  4BI4 A;  2KRO A;  2ZZE A;  3BDU A;  1SHG A;  3CPF A;  4EMK A;  2PZ1 A;  2OTL Q;  1PC0 A;  1ZA2 B;  2FRY A;  3M0S A;  3ULR B;  4QT7 A;  2KI7 A;  4AG1 C;  1VQ9 A;  4OF1 A;  4XTY A;  1QWE A;  1NM7 A;  5LJ5 j;  1UB4 A;  4ELZ C;  3HPW A;  1WHJ A;  4OGE A;  2PVO B;  1G3W A;  2ZPB B;  2AKW B;  3DB3 A;  3JCM d;  1VQ4 A;  5L8R E;  4CC3 A;  4F04 B;  1QKW A;  1QWF A;  4FSS A;  3BDL A;  4PJO F;  5LL6 S;  3L4G A;  2E5Q A;  2RQT A;  2KYB A;  1WPY A;  2ED1 A;  4II1 A;  4E7S A;  4ZGD B;  1KFZ A;  2ZPG B;  2X3X D;  2CJA A;  1M3A A;  3MKD A;  2BZ8 A;  3J7A F;  3REB B;  5CO7 A;  1AWX A;  2P4T A;  3GBQ A;  5D6W A;  2KGT A;  3EFR A;  2EBP A;  3J81 E;  1BKB A;  1K8A R;  4Y92 A;  2ZCF B;  2FVU A;  4PJO A;  4PJL A;  2EYZ A;  1Y96 B;  1ZSG A;  2LTO A;  1ZQ1 A;  4HCZ A;  1YN8 A;  2RQV A;  3BFM A;  3G4S A;  1X27 A;  2QTV A;  4C5H A;  5IXB A;  3QZ9 B;  1N6A A;  4RKU E;  4NCX A;  2HNI A;  5A0D A;  3HFZ A;  4LNS A;  1ZHI A;  1UGP B;  2AIR B;  4R56 A;  2O31 A;  2NUP A;  2A3L A;  2E64 A;  4M7A G;  5CAI A;  4PJO E;  4C0F A;  2QA4 T;  3RKW A;  5GAO l;  4C8Q B;  4L6V 5;  4QQD A;  1KOG A;  4J6X A;  1H3Z A;  2ZNJ A;  2OTJ T;  2MF2 A;  1VQ8 T;  1NBE B;  4YRG A;  4P73 A;  1SRM A;  4BB7 A;  3PMT A;  3CC7 Q;  2L3S A;  2MK5 A;  2CP6 A;  4J83 A;  4KH0 B;  1TH7 A;  1WNL A;  2DZC A;  3CC2 Q;  1BI0 A;  3RF1 A;  3QO8 A;  1QKX A;  4JLI A;  1OYX A;  3FB9 A;  3S3N A;  3A7A A;  2RO0 A;  3RIR A;  4J9F A;  3I9Q A;  2BE7 D;  4WCI A;  3QDF A;  2YDL A;  4M75 B;  1YJ9 T;  4YRK A;  5IHI A;  4O6J A;  4Y91 A;  3W3S A;  1B7Y B;  3L42 A;  1VQ7 T;  4H2Y A;  1ACM B;  4TVW A;  4OB2 B;  5CKE A;  2F5K A;  2IVW A;  2L8D A;  3P8V A;  2DTH A;  4YRE A;  2O4X A;  3JB9 F;  2EGC A;  3MF2 A;  2P0P A;  3GF5 A;  4N4H A;  4VUB A;  3SWN B;  3JCM h;  3TU4 K;  2V1R A;  4TVR A;  1WJQ A;  1X43 A;  2E12 A;  3MP6 A;  4JJC A;  1YI2 Q;  2O9S A;  5KCO A;  2ODR C;  4M7D C;  2R5A A;  4YCV A;  1WGS A;  4GLM A;  3HXZ A;  2A7Y A;  3CCE A;  2YRD A;  4DA4 A;  2KYM A;  1IGQ A;  3DKM A;  2LQN A;  1ATI A;  1QCO A;  3JB9 H;  4GBQ A;  1JJC B;  2M02 A;  2AT1 B;  5M9O A;  1Z7M A;  2I2L A;  4PNO A;  1X2K A;  5DLO A;  4Z02 A;  1M1F A;  2IY5 A;  1W1F A;  3C94 A;  4CS4 A;  1SES A;  1JEG A;  4PKC C;  4XTV A;  2AKW A;  2BIV A;  2CP3 A;  4YDQ A;  1H92 A;  2QK0 A;  1K9M C;  1GCQ C;  1AD5 A;  2XMF A;  3ME9 A;  1UGR B;  2R57 A;  5DY9 A;  4AFZ C;  4RG2 A;  3G1J A;  5GAM g;  4P71 A;  1C6V X;  2A28 A;  2LDM A;  3LGL A;  2EYQ A;  5LJ3 g;  1WYX A;  12AS A;  1D3B B;  1LNX A;  1OX8 A;  2IPO B;  1GBR A;  2ECZ A;  2VAS A;  1D0Z A;  2EJG A;  1X55 A;  4LVI A;  2J3M A;  4KH1 B;  2DQ0 A;  1VIE A;  5GAN 7;  4LD9 K;  4HVC A;  1Y0M A;  3MEA A;  1G3T A;  4NS5 A;  2CJ9 A;  4HWO A;  1OPK A;  3DLM A;  4JLG A;  5FRM A;  4M7A D;  2NYS A;  3QWY A;  1GL5 A;  3VQX A;  2HQE A;  1PWT A;  2DU5 A;  1VQN A;  1N8R U;  3M0T A;  1Q7Y C;  1G51 A;  1WHM A;  2KVQ G;  3CCJ A;  4TTV A;  1YJN A;  2RB6 A;  1M4Z A;  3EGX B;  1ZUY A;  3OW2 P;  2DK3 A;  1BBZ A;  2DPP B;  4ATO A;  2LP5 A;  1KG1 A;  4F7U F;  2VUB A;  1VQ5 A;  2I4L A;  2RHX A;  2LT1 A;  4M75 F;  2RJD A;  2EQM A;  4K87 A;  1QW1 A;  2FPE A;  2JTM A;  4QKU A;  1GRI A;  1IHW A;  1CKB A;  5KYX A;  4UP7 A;  3PNW C;  2ZPF B;  5D7U A;  4F7U A;  1UEC A;  1WJR A;  3JB9 G;  3DSQ A;  3V7S A;  3RKY A;  1W6X A;  2D8J A;  1BBU A;  4RTZ A;  4M75 A;  3OBY A;  1VQO A;  1YJ9 Q;  4RMO A;  4YTL A;  2OJ2 A;  5GAM j;  2ZIO A;  1VQ4 Q;  1G3Y A;  4RUG A;  4ZIB A;  2EQJ A;  4IIO A;  2DTO A;  3EFO B;  3CD6 T;  4F7U E;  2XU8 A;  4J9D A;  2G6F X;  3QDR B;  2WSF E;  2EWN A;  5GAO m;  4E7J A;  3MF1 A;  1W70 A;  4M75 E;  2ART A;  2AKK A;  3PZC A;  4C92 B;  3C95 A;  4E47 A;  1YIJ A;  3MHX A;  1UEB A;  1U3O A;  3OYC A;  4YPF A;  2DDZ A;  3E9I A;  3UH0 A;  1OU9 A;  3ZFJ A;  2DIL A;  3WQZ A;  4IUT A;  4QW2 A;  2QHU A;  3MQZ A;  1X6O A;  4YRR A;  4MMK A;  2X3W D;  1TUC A;  4AFQ C;  4JJD A;  1H4V B;  2H3J A;  5L23 A;  4G85 A;  4A4H A;  2ZZD A;  4KR3 A;  2JM9 A;  5GAN d;  3UGT A;  2PME A;  4O2D A;  2O01 E;  2VV5 A;  4X9D A;  2DBM A;  1YJW A;  3QHS A;  2DO3 A;  3JCM J;  3R07 A;  2DYI A;  3E9G A;  1OUL A;  2CZ6 B;  3VQV A;  1TWB A;  2XID A;  1VQ6 T;  5KYU B;  2WSC E;  1N9S A;  2RD1 A;  1M1K C;  3MPU B;  1NYR A;  2LC4 A;  4KUI A;  3ZEH A;  3A5Z A;  3RAC A;  2KNB B;  5GAN 6;  1VQZ A;  4TWA A;  3M55 A;  2RHZ A;  2JTE A;  2WSE E;  1Z7N A;  2E5K A;  5FWC A;  2FRW A;  2RNA A;  2XDP A;  4A63 B;  4EIK A;  4LDU A;  3V8J A;  2ZT8 A;  2PMF A;  1F1B B;  1ZLM A;  2ALY A;  4HCB A;  4P3O A;  2CP7 A;  5C0M A; 
#chains in the Genus database with same CATH homology
 4F7U G;  2NLU A;  2V8J A;  4M7A B;  2DXT A;  4D6W A;  1H4S A;  2RJC A;  1Q86 U;  1B70 A;  4C5E A;  3FJP A;  4HWS A;  3GPL A;  2CZ0 B;  4BY6 B;  3M56 A;  2XG8 D;  1NJI C;  2RHS A;  2L5Q A;  3QJY A;  1PYS B;  1SER A;  4HCC A;  1WJS A;  3G6E A;  2YLC A;  1W2B S;  2C7I A;  2P0L A;  5GAN 5;  1RIQ A;  3CCL A;  4ZTJ A;  5DLQ E;  4WJ4 A;  3X26 B;  2ZZF A;  1LOJ A;  2RHQ A;  2QXF A;  3HP9 A;  2RI5 A;  3QJ6 A;  4YRL A;  1EIY A;  3G1Z A;  4EMK B;  1W2B A;  4BI3 A;  4XU0 A;  4AH6 A;  3CME A;  3CPW S;  2EJF A;  4HKE A;  1USY C;  3EAE A;  5CK9 A;  3TRE A;  3I55 T;  4CH5 A;  1WU7 A;  2JNG A;  4P75 C;  3CCR T;  1BI2 A;  4L5G A;  3PMI A;  2K2V A;  3HFO A;  4DPG A;  3NTH A;  2ZTG A;  2AHJ B;  2DAQ A;  3L4G B;  4FT2 A;  3HY0 A;  5GAN 3;  4FIB A;  1G5V A;  1S72 A;  2DU7 A;  2RM4 A;  3L1A A;  1E1O A;  1XTD A;  2MWO A;  1YBY A;  4PJO B;  1X54 A;  3PCO A;  2LX9 A;  3E1S A;  3A8G B;  3CCM A;  2X4J A;  5FU6 C;  3VYG A;  3HFZ B;  1M90 C;  4FL6 A;  2QEX A;  1AHJ B;  1E1T A;  5GAM f;  1NJ6 A;  1SRY A;  5LJ3 f;  4BAC A;  3QO5 A;  2PVD B;  4ZGE B;  1VQL A;  4IKF A;  2LCC A;  2WAC A;  3RMQ A;  2X4X A;  3CBP A;  3QTC A;  5GAN g;  3CC7 T;  4N0A C;  5C52 B;  3A8L B;  3HFV A;  3A8M B;  4PG3 A;  3UWN A;  1Q81 C;  3CC2 T;  4M78 C;  2CZ7 B;  1FWZ A;  2MMP A;  4WI1 A;  4JS5 A;  2LCL A;  2MWP A;  3OYB A;  1BI3 A;  3PTA A;  2DKG A;  2O4X B;  1LYL A;  4NL2 A;  3GLX A;  3OYD A;  1M9S A;  1M5Q 1;  2I4M A;  3CC4 A;  2C8M A;  4K86 A;  3OYK A;  5LJ5 e;  3JRZ A;  2PUO B;  5HKC A;  1JRI A;  4EMH A;  1OZ3 A;  1K73 C;  1QVF A;  5LJ3 d;  3LC0 A;  2Y90 A;  3A32 A;  1I5L A;  5C53 B;  3JB9 I;  4EO4 A;  5J26 A;  5GAO q;  2LNV A;  1M8V A;  3G71 A;  2IY5 B;  2OTJ A;  1VQ8 A;  3DLL A;  2GCX A;  2ZPE B;  3OYY A;  3OD1 A;  1XQH A;  5E3I A;  3BJU A;  3UGQ A;  5CCA A;  4RDX A;  4O5V A;  1K9M U;  2QQS A;  1VQP T;  1QVG A;  3JCM V;  2CZ1 B;  3CCS A;  3VBB A;  4QVZ A;  4EX5 A;  1YIT A;  4DQ2 A;  3NET A;  3QNE A;  4BDZ A;  3HXY A;  3M58 A;  2RI3 A;  4RG8 A;  2CIM A;  3VU3 C;  1NPP A;  2V8I A;  2L3R A;  4M78 G;  4IUR A;  1X2G A;  1VQM A;  2Q5H A;  4C0D B;  3CMQ A;  3NTI A;  5CKD A;  3N5B B;  4M77 C;  2ZT6 A;  2BKD N;  1NPR A;  1SSF A;  3MEV A;  4TVA A;  3GNF B;  3HXU A;  2XDB A;  4A53 A;  1Q7Y U;  4XTX A;  4MZM A;  2RH2 A;  3HSB A;  5FU7 B;  3CMA A;  5GAM h;  5LJ3 h;  4F7U B;  4YRQ A;  1EQR A;  1VQ9 T;  2LQK A;  4TQF A;  4PLI A;  2K5F A;  1LJO A;  1ADY A;  1NJ2 A;  2CGH A;  1Q82 U;  2VXF A;  5CVI A;  3IKL A;  1VQ4 T;  3CCQ A;  4R55 A;  1BI1 A;  5HY6 A;  1BIA A;  4FM4 B;  4M7D F;  4CH3 A;  1OI1 A;  3JCM X;  5GAO n;  4UP8 A;  3CCV A;  3HHT B;  4EDU A;  2RI2 A;  3X28 B;  5KNN A;  3DB4 A;  1VUB A;  3P8T A;  2XTI A;  4M7D A;  4BUG A;  3G4S T;  1KQ1 A;  2Q7E A;  1KHI A;  2EKO A;  4GLK A;  4JDS A;  3HRS A;  3MP8 A;  2ZGW A;  5GAN 2;  2DJZ A;  3QUI A;  1KD1 C;  2XIC A;  5CKH A;  4A54 A;  5C6S A;  3HKS A;  4C0G A;  5GMK h;  4XTZ A;  3VQY A;  4M7D E;  4YRJ A;  2EIF A;  3HXV A;  4A4E A;  3QYG B;  4P5N A;  2BUD A;  3OYI A;  2FL7 A;  4LVM A;  4LVJ A;  3M4P A;  4J6Y A;  4XTU A;  3A5Z B;  3A74 A;  5I2S A;  1M1K U;  4XAX B;  3V7R A;  4LVK A;  3NEL A;  4QVD A;  3HXX A;  4CRI A;  1QP2 A;  2ZZG A;  4C0Z A;  3VYH B;  5I2M A;  2DD4 A;  2ALY B;  2EFI A;  4M78 D;  5ELO A;  1N9R A;  4CS3 A;  1I4K 1;  4KUD K;  5DM7 R;  4LDV A;  1ZBX A;  1H4Q A;  4LD6 A;  2M0O A;  1MGQ A;  1B70 B;  3QZ5 B;  1I81 A;  2A8E A;  1X56 A;  2G4C A;  3RER A;  1EVL A;  1G3S A;  2KMT A;  5GAN f;  2GFA A;  2RHS B;  3QSU A;  4YRI A;  3M4Y A;  2DQ3 A;  3LW5 E;  1PSE A;  4C8Q C;  4KT0 E;  2CJB A;  1XOV A;  1NJI U;  4M7D G;  2DXU A;  3REX A;  2RHQ B;  3OQ5 A;  3LSQ A;  2XK0 A;  3OYE A;  1EIY B;  5LJ3 j;  2KAF A;  3JCM e;  3BY7 A;  2RHY A;  4V2S A;  3LWH A;  4C5I A;  1KC8 C;  2JTF A;  4JRP A;  2D9T A;  3SD4 A;  4XQ3 A;  3S6W A;  2I4N A;  4X5O A;  3NEM A;  3G7Z A;  5GMK i;  2J3L A;  3HTZ A;  1RL2 A;  2FB7 A;  1YFS A;  3S3M A;  2GF7 A;  3SWN C;  2PUK B;  2RHU A;  3FRN A;  2K5L A;  1VQN T;  3FEO A;  2JZ2 A;  1YHQ A;  5IN1 A;  5D6Y A;  3PCO B;  4UC4 A;  5HK0 A;  3L2Z A;  2JVV A;  2XKO C;  3HRK A;  2RJE A;  1L0W A;  1JB0 E;  3X24 B;  1VQ5 T;  2B8A A;  5LJ5 d;  5GMK j;  4EMG A;  3SB2 A;  4M77 D;  3OYM A;  2Y4Y A;  3F70 A;  2V8K A;  5EG2 A;  3KXT A;  1M90 U;  4J8O A;  1GXI E;  1NE8 A;  2ARS A;  4ZTZ B;  1HC7 A;  4UPA A;  4FU6 A;  2LQ8 A;  4QQ6 A;  1VQO T;  1XNI A;  1VQK T;  4GY5 A;  2OTL A;  2KY9 A;  3L2V A;  4BDY A;  1UGQ B;  5GAO p;  2F69 A;  4OGC A;  1O9S A;  4C8Q G;  3IKM B;  3UDC A;  3MEY A;  3M59 A;  1Y07 A;  3LX7 A;  4YRN A;  4E7L A;  1UGS B;  1YIJ T;  2KSS A;  2HAX A;  2Q7G A;  1N8R C;  3TEH B;  1QP3 A;  4MDW A;  5CKF A;  2Y4X A;  1W66 A;  2QHS A;  2ODR D;  4M7D D;  5HGQ A;  4WF2 A;  1FX7 A;  1B76 A;  1YJW T;  2ZPH B;  2K3Y A;  3VKI A;  3MCA B;  3VJP A;  4P72 C;  5GAN h;  3MO8 A;  4EPC A;  3V8K A;  3OYF A;  3OA6 A;  3PFS A;  3OS2 A;  2PU9 B;  3CCU T;  4HT8 A;  1QF6 A;  1USY A;  4PLL A;  4P75 A;  3KUF A;  2VXE A;  3CC2 A;  4YP0 A;  4L59 A;  4HWR A;  2D0Q B;  3OW2 A;  3MEU A;  3NFC A;  3WXM B;  2XHC A;  4C92 C;  1G5I A;  3RUX A;  3CBM A;  4FT4 A;  3Q1J A;  5I21 A;  2I4O A;  1IL2 A;  1DJ7 B;  5ELN A;  4IUU A;  3M54 A;  2RA2 A;  3C4S A;  4RCB A;  2ZIM A;  3I56 A;  1YI2 A;  3QII A;  4A4K A;  3ICA A;  1B8A A;  3KFU A;  5CIU A;  1ADJ A;  3QXE B;  4N4I A;  3GOX A;  1HTT A;  1U1S A;  3G6E T;  3LWI A;  4TVA B;  4H2X B;  4J7F A;  4CS2 A;  3CCL T;  3O8V A;  2QQA A;  4M78 F;  4P3N A;  3FLG A;  2HQX A;  4JRK A;  2DZ9 A;  1NZ9 A;  4N0A A;  4C8Q D;  5GMK l;  4Q5W A;  1W4S A;  4YRP A;  3TEG A;  4M78 A;  3CME T;  4H2V A;  2KQW A;  2E41 A;  1KHC A;  4LDX A;  1J5W A;  2MAM A;  2GQV A;  2XD0 A;  3OSV A;  5LJ5 g;  4OB3 B;  2DXB A;  3REU A;  4ZN1 A;  4YCU A;  3TEH A;  4NOY A;  2E3C A;  4M78 E;  4E7I A;  3JCM c;  1QVF S;  4M7A C;  4OLF A;  2EL9 A;  4H2U A;  4XEO A;  3FIF A;  1N27 A;  3UT1 A;  5A0L A;  2D6F A;  1QE0 A;  4M7D B;  1WLE A;  4BD3 A;  3L2R A;  2GFU A;  4YRF A;  4BY6 C;  5AYF A;  3TEE A;  4X9C A;  4LDY A;  2QA4 A;  2QEX T;  4C92 G;  2AMC B;  3H8Z A;  2XGT A;  3QBY A;  4NL3 A;  5GAN j;  4J5Y A;  4HWT A;  2ARU A;  1KD1 U;  2ZT7 A;  1QVG S;  1VQL T;  2YRV A;  4EMK C;  1NNH A;  2RJF A;  2JOY A;  4BWA A;  1MHN A;  3EFS A;  3UPU A;  4H2T A;  1O75 A;  2K4Y A;  1YFT A;  4TQD A;  1VIF A;  4YYE A;  1YJ9 A;  4E51 A;  2X4W A;  3NTK A;  4B9X A;  1VQ7 A;  2E1H A;  4QQG A;  1K8A C;  3M9Q A;  4BI8 B;  4KQE A;  4YRT A;  4B9W A;  4KUL A;  4LVL A;  4M77 F;  1EVK A;  3OYH A;  4XK8 E;  4JJN K;  3UFG A;  4BE1 A;  2LT4 A;  4PJO C;  1Y71 A;  1H64 1;  3GP8 A;  4YRC A;  4LDW A;  3MET A;  2KK4 A;  3CC4 T;  5IAY A;  4M77 A;  4BE0 A;  1X01 A;  4H2X A;  3M4Q A;  4HA8 A;  5FRO A;  2R58 A;  4JRI A;  2EJ9 A;  1U8R A;  3OYG A;  3E9F A;  1YGB A;  3J80 E;  4YRO A;  2DTI A;  3A8H B;  2E5A A;  3IG2 A;  2QQB A;  3P8Y A;  4OVA A;  1IZ6 A;  4M77 E;  5HK3 A;  3JCM W;  3G71 T;  3OYL A;  4P73 C;  4ELY C;  1YFR A;  2EQK A;  3ZBD A;  4J7I A;  2Q5I A;  3HRI A;  3NEN A;  4L87 A;  2DXC A;  4RMF A;  3KBG A;  5D6X A;  5C51 B;  1B34 B;  4ZGJ B;  2Q7H A;  3CCS T;  1NJ1 A;  2LRQ A;  4K88 A;  5FRN A;  2DIG A;  1KC8 U;  11AS A;  3HL8 A;  3OS1 A;  1I8F A;  1YIT T;  3PIP A;  2NS6 A;  3CXC S;  2PVG B;  2DD5 A;  2CYZ B;  2K5I A;  3A5Y A;  5GMK m;  3SFM A;  2VGM A;  4Q15 A;  3S3O A;  4C92 D;  2PQW A;  2K3X A;  4HT4 A;  2P5I A;  4MZT A;  3TCJ A;  1X75 C;  1VQM T;  2AMC A;  3OB9 A;  2DVE A;  3CXC A;  2YHT A;  4A4F A;  3QYH B;  1JJ2 S;  1Y7X A;  4UP9 A;  4DOV A;  4KR2 A;  3WVD B;  2QQ9 A;  5A0G A;  3VV0 A;  1NJ5 A;  2FHD A;  2RK2 A;  4DOW A;  3TUP A;  3E9H A;  1JJ2 A;  3CMA T;  4PJO G;  3M5A A;  1YCY A;  3JCM Q;  4M77 G;  3HY1 A;  4IUP A;  1KQS S;  4IUQ A;  1OZ2 A;  2KDS A;  1E22 A;  1WQ7 A;  5F5W A;  3MEW A;  4RQF A;  3CD6 A;  4P71 C;  3CCQ T;  2E70 A;  1WYD A;  2E6Z A;  4QVC A;  1KQS A;  2X35 A;  4YRM A;  1JBM A;  2EQU A;  1G5H A;  3QO7 A;  4YRS A;  3INZ A;  3CCV T;  5J39 A;  1Y96 A;  2QTX A;  4XEM A;  4RCC A;  4H02 A;  2ZPI B;  4C8Q F;  2OAU A;  3CCE T;  5GAM e;  5LJ3 e;  4JRQ A;  1FXX A;  3JCM g;  4C0D C;  4ZTU B;  3OYJ A;  3VUB A;  5KE2 A;  4C8Q A;  3GNG A;  3OMG A;  5FLX E;  4OB1 B;  4HT9 A;  1BIB A;  2M1H A;  1VQ6 A;  5FU7 C;  5LJ5 f;  5KH6 A;  4XU1 A;  5GAN 4;  1SET A;  2C06 A;  2VC8 A;  5K1X A;  4ZN3 A;  3P8H A;  1KMM A;  1EOV A;  3R6O A;  1B34 A;  4C8Q E;  5J3B A;  3SDZ A;  3A7U A;  1WQW A;  4M75 C;  1Q82 C;  3OBW A;  1VQK A;  4ME7 A;  2ZXF A;  1B7Y A;  3RGL A;  2QQR A;  4XU3 A;  5GAO r;  1ASY A;  3M57 A;  3QKJ A;  4Y28 E;  3SWN A;  2P0K A;  3V8L A;  2XDD A;  2QDY B;  3ERR A;  5GMK e;  3A31 A;  2VYT A;  5CQY A;  4YCW A;  5CKB A;  3CCJ T;  3C12 A;  3JCM P;  1BYM A;  1YJN T;  1X2H A;  2RK1 A;  5FU6 B;  3RKX A;  3A7R A;  2F5T X;  4PJO D;  1FYF A;  1JJC A;  3IAL A;  3LSS A;  4CH6 A;  3A8O B;  3M4G A;  1GGM A;  1EFW A;  1QVP A;  1IRE B;  2M9U A;  1NYQ A;  3LGF A;  4N4G A;  4RQE A;  5GAN 8;  3OYN A;  5KE3 A;  3RMS A;  5IT9 E;  3T9N A;  3MP1 A;  3HRU A;  3CCU A;  3ER0 A;  3HXW A;  2P0Q A;  2ZR3 A;  4M78 B;  1P92 A;  2YLB A;  4H2W A;  3I55 A;  3RL6 A;  5CR2 A;  4XTW A;  4X34 A;  4A4G A;  3QG1 A;  3CCR A;  1D3B A;  1Q81 U;  1R8O B;  4P3P A;  3CEY A;  4E7K A;  4G84 A;  4PL6 A;  2QHV A;  3QO3 A;  1U1T A;  4MZP A;  3OYA A;  3URG A;  2RHI A;  2M16 A;  2E10 A;  4CI0 C;  2VGN A;  4JUV A;  2E6N A;  2FYK A;  4M75 G;  3OSS C;  4H2S A;  1KQ2 A;  4ZTF A;  3L2U A;  1N9W A;  1YHQ T;  4WJ3 M;  3AHU A;  1RI0 A;  4P72 A;  1C0A A;  3LLR A;  3RES A;  3VQW A;  3JB9 D;  4C5G A;  2ZIN A;  1K73 U;  1V29 B;  1KMN A;  1HK9 A;  3GIB A;  2QHT A;  4MDX A;  3OW2 S;  4BW9 A;  5LJ5 h;  1ASZ A;  3ASK A;  4OMF B;  3M53 A;  3CC7 A;  3PT9 A;  3P8D A;  3LH0 A;  4C92 F;  2OTL T;  4IUV A;  1NJ8 A;  4OP0 A;  2XI9 A;  2LVM A;  3PGG A;  2E65 A;  1HXD A;  4C92 A;  4OB0 B;  3HFN A;  3CPW A;  2EAY A;  1K8A U;  3CBO A;  4PHC A;  3OS0 A;  2JUF A;  2HD0 A;  3OY9 A;  2JN0 A;  4C92 E;  3L2Q A;  4TVY A;  5KCH A;  3QPH A;  2G3R A;  4M77 B;  2MI6 A;  3BW1 A;  3LYI A;  2X4Y A;  4CH4 A;  2L89 A;  3L2W A;  1BBW A;  3FC3 A;  1M1G A;  2HBP A;  4XU2 A;  5K1P A;  3VUZ A;  3V7C A;  2R5M A;  2CS7 A;  1YB3 A;  3OS5 A;  2K57 A;  4P74 C;  2ZCE A;  4JS4 A;  4P74 A;  3P8B B;  3JSC A;  3FDR A;  2DIQ A;  3HRT A;  4FSX A;  5CQX A;  4M7A F;  3JB9 J;  3WVE B;  3X20 B;  2QI2 A;  1VQP A;  4KBM B;  4J6W A;  3I7F A;  4HWP A;  4M75 D;  3E19 A;  2CKK A;  1Q86 C;  3JAM E;  3JCM f;  4J15 A;  4M7A A;  1S72 T;  3X25 B;  4MML A;  3OMC A;  3JCM b;  5GAN e;  1EIF A;  1E24 A;  3CCM T;  3H6Z A;  1PYS A;  4M7A E;  3I56 T;  2DEQ A;  1YI2 T;  2ZT5 A;  1H4T A;  5A2Q E;  5GAM d;  4Q6G A;  2IG0 A;  2ZR2 A;  4BE2 A;  1PSF A;  3PIO A;  4E7H A;  4BI4 A;  2ZZE A;  3BDU A;  3CPF A;  4EMK A;  1VQ9 A;  4OF1 A;  4XTY A;  5LJ5 j;  1UB4 A;  4ELZ C;  3HPW A;  4OGE A;  2PVO B;  1G3W A;  2ZPB B;  2AKW B;  3DB3 A;  3JCM d;  1VQ4 A;  5L8R E;  3BDL A;  4PJO F;  5LL6 S;  3L4G A;  2E5Q A;  4II1 A;  1WPY A;  4ZGD B;  2ZPG B;  2CJA A;  3J7A F;  5CO7 A;  2P4T A;  5D6W A;  3EFR A;  3J81 E;  1BKB A;  2ZCF B;  2FVU A;  4PJO A;  1Y96 B;  2LTO A;  1ZQ1 A;  4HCZ A;  3BFM A;  3G4S A;  4C5H A;  3QZ9 B;  1N6A A;  4RKU E;  4NCX A;  2HNI A;  5A0D A;  3HFZ A;  4LNS A;  1ZHI A;  1UGP B;  4R56 A;  2A3L A;  2E64 A;  4M7A G;  5CAI A;  4PJO E;  4C0F A;  2QA4 T;  3RKW A;  5GAO l;  4C8Q B;  4L6V 5;  4QQD A;  1KOG A;  4J6X A;  1H3Z A;  2ZNJ A;  2OTJ T;  2MF2 A;  1VQ8 T;  4YRG A;  4P73 A;  4BB7 A;  3PMT A;  4J83 A;  1TH7 A;  1WNL A;  2DZC A;  3RF1 A;  1BI0 A;  3QO8 A;  4JLI A;  1OYX A;  3FB9 A;  3S3N A;  3A7A A;  2RO0 A;  3RIR A;  4M75 B;  1YJ9 T;  4YRK A;  4O6J A;  4Y91 A;  3W3S A;  1B7Y B;  3L42 A;  1VQ7 T;  4H2Y A;  4TVW A;  4OB2 B;  5CKE A;  2F5K A;  2IVW A;  2L8D A;  3P8V A;  2DTH A;  4YRE A;  2O4X A;  3JB9 F;  3MF2 A;  2P0P A;  3GF5 A;  4N4H A;  4VUB A;  3SWN B;  3JCM h;  3TU4 K;  4TVR A;  1WJQ A;  2E12 A;  3MP6 A;  5KCO A;  2ODR C;  4M7D C;  2R5A A;  4YCV A;  1WGS A;  3HXZ A;  2A7Y A;  3CCE A;  4DA4 A;  3DKM A;  1ATI A;  3JB9 H;  1JJC B;  5M9O A;  1Z7M A;  2I2L A;  4PNO A;  5DLO A;  4Z02 A;  1M1F A;  2IY5 A;  3C94 A;  4CS4 A;  1SES A;  4PKC C;  4XTV A;  2AKW A;  2BIV A;  4YDQ A;  1K9M C;  3ME9 A;  1UGR B;  2R57 A;  5DY9 A;  4RG2 A;  5GAM g;  4P71 A;  2LDM A;  3LGL A;  2EYQ A;  5LJ3 g;  12AS A;  1D3B B;  1LNX A;  1X55 A;  2EJG A;  4LVI A;  2J3M A;  2DQ0 A;  1VIE A;  5GAN 7;  4LD9 K;  4HVC A;  3MEA A;  1G3T A;  4NS5 A;  2CJ9 A;  4HWO A;  3DLM A;  4JLG A;  5FRM A;  4M7A D;  3VQX A;  2HQE A;  2DU5 A;  1VQN A;  1N8R U;  1Q7Y C;  1G51 A;  2KVQ G;  3CCJ A;  4TTV A;  1YJN A;  2RB6 A;  1M4Z A;  2DK3 A;  2DPP B;  4ATO A;  1KG1 A;  4F7U F;  2VUB A;  1VQ5 A;  2I4L A;  2RHX A;  2LT1 A;  4M75 F;  2RJD A;  2EQM A;  4K87 A;  1QW1 A;  2JTM A;  4UP7 A;  3PNW C;  2ZPF B;  4F7U A;  1WJR A;  3JB9 G;  3DSQ A;  3V7S A;  3RKY A;  1BBU A;  4M75 A;  3OBY A;  1VQO A;  4RMO A;  4YTL A;  5GAM j;  2ZIO A;  1G3Y A;  4ZIB A;  2EQJ A;  2DTO A;  3CD6 T;  4F7U E;  2XU8 A;  3QDR B;  2WSF E;  2EWN A;  5GAO m;  4E7J A;  3MF1 A;  4M75 E;  2ART A;  3PZC A;  4C92 B;  3C95 A;  4E47 A;  1YIJ A;  3MHX A;  1UEB A;  4YPF A;  3OYC A;  2DDZ A;  3E9I A;  3UH0 A;  3ZFJ A;  3WQZ A;  4IUT A;  4QW2 A;  2QHU A;  3MQZ A;  1X6O A;  4YRR A;  4MMK A;  1H4V B;  4KR3 A;  2ZNI A;  2H3J A;  4G85 A;  4A4H A;  2ZZD A;  5GAN d;  3UGT A;  2PME A;  4O2D A;  2O01 E;  2VV5 A;  4X9D A;  1YJW A;  2DO3 A;  3QHS A;  3JCM J;  3R07 A;  3E9G A;  2CZ6 B;  3VQV A;  2XID A;  1VQ6 T;  2WSC E;  1N9S A;  2RD1 A;  1M1K C;  1NYR A;  2LC4 A;  4KUI A;  3ZEH A;  3A5Z A;  3RAC A;  5GAN 6;  1VQZ A;  4TWA A;  3M55 A;  2RHZ A;  2WSE E;  1Z7N A;  2XDP A;  4LDU A;  3V8J A;  2ZT8 A;  2PMF A;  2ALY A;  4HCB A;  4P3O A;  5C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...