2DVEA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, mutation arg51ala
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNAKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin Protein Ligase
publication title Ligand Structures of Biotin Protein Ligase From Pyrococcus Horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 71
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dveA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dveA01
4M78D 5LJ3g 3R07A 1EVKA 1X2GA 3QHSA 4XTWA 2PMFA 3A7AA 1B70A 4F7UF 4DPGA 2AKWA 4BWAA 4PJOF 2DZ9A 3HRKA 3RKXA 4XTUA 4C92F 3NEMA 1LOJA 1YCYA 12ASA 1E22A 4JLIA 3HY0A 2E64A 1E24A 1WNLA 1D3BA 2RD1A 3QUIA 4PNOA 3RESA 4C92B 4XTXA 5I21A 1WU7A 1H4QA 1QF6A 1PYSA 2ARSA 5GMKl 1HTTA 4RCBA 1NJ8A 1B34B 2VXFA 4HWTA 4YRQA 3JCMg 4JRIA 3I7FA 4P73A 4TVAA 4M7DB 2RM4A 3QSUA 1E1OA 2RHSA 2Y90A 1HC7A 1BIAA 5GAOr 4M7AA 3REUA 2DQ0A 1NJ6A 1G5HA 4F7UA 4YREA 4P74C 4PJOA 1JBMA 4M77C 4C92A 3EFRA 3JB9I 4RQFA 3BW1A 1YB3A 3FIFA 1B7YA 2ZT8A 5C52B 5GAOn 3M4GA 1X2HA 4J6WA 4H2SA 5LJ5e 2CJBA 4N0AC 3IKMB 4X9DA 4V2SA 2EWNA 3JB9D 3TEHB 2DTHA 3JCMh 4M77G 1N9SA 3JCMQ 3JCMf 1YFTA 5GANg 3HFZB 3IG2A 4CH6A 1H641 2DJZA 3M4QA 5K1PA 4M75F 5GMKh 3HXWA 3RGLA 3ICAA 2EAYA 3JB9H 2ARUA 3IALA 3BDUA 3L2ZA 3E9HA 4NOYA 2JN0A 1G51A 1EFWA 4M78F 3GIBA 1SESA 5DY9A 4AH6A 4RDXA 3HFVA 3TEHA 3MF2A 4HWRA 4M78B 2ZIOA 3DSQA 4YDQA 3VU3C 3OD1A 1RIQA 3V8JA 4EMHA 3QO7A 1JJCA 3QO5A 5GAN3 5GAMd 1N9WA 4H2UA 1W66A 2I4MA 1I4K1 3L4GB 4P3NA 2Q5HA 4JUVA 4XTZA 5F5WA 4CH5A 1MGQA 4M75A 4OLFA 4Q15A 5GAN7 2J3LA 4KR2A 1YFSA 4Q6GA 3NETA 4C8QC 2DKGA 5GAMh 2ZIMA 4K86A 5E3IA 4EMKB 1H4TA 4XEMA 2ODRD 4M75G 5GAMf 4M78A 3NELA 4WF2A 3HFOA 3MF1A 4YRIA 2DU5A 2CJ9A 2PMEA 2I4LA 4DQ2A 3G1ZA 5LJ5g 1X54A 4C8QG 4WI1A 4YRMA 1SRYA 5GAOl 2E41A 3UGQA 1ADJA 3HSBA 4XU2A 4YCUA 1BIBA 1H4VB 3JCMJ 3HY1A 3PCOA 4E51A 1WPYA 1LJOA 3JB9F 1EIYA 2FYKA 1X55A 5GAN6 3PGGA 4YCWA 3CMQA 4YRTA 5C53B 2DVEA 4Y91A 1EOVA 5LJ3d 2G4CA 2K57A 2ZXFA 2Q5IA 4M7DF 1N9RA 5GMKm 2ZZFA 3FJPA 4P73C 3BJUA 2ZGWA 4M7AC 5GAN5 5LJ3h 2AMCB 2E1HA 4A54A 5LJ3f 1FYFA 2QHTA 3UFGA 4CS2A 2VXEA 4PJOC 3EFSA 1SETA 1NYRA 4C92C 5GAN4 4CS3A 1LNXA 3VQXA 3L1AA 4YYEA 4M77B 4M7AG 3JCMd 1M5Q1 3FB9A 4YRSA 2YHTA 2DZCA 1B34A 4F7UG 4YRGA 4PJOG 1H4SA 4KR3A 4C92G 2QTXA 4M7DA 4XTVA 1JRIA 4PJOE 4YCVA 4QVDA 2AMCA 4P3OA 3JCMW 1BBUA 4NCXA 4HT9A 1C0AA 4M77E 3SWNB 1G5IA 4EX5A 4YRNA 3BFMA 1LYLA 2ZNJA 1NNHA 3VBBA 4H2TA 2RHQB 2ZCEA 1I8FA 1USYA 2Q7GA 3HRIA 2ZR3A 4PJOD 3QO8A 1BBWA 4YROA 3VQYA 2J3MA 3P8YA 2DTOA 4HT8A 4M77D 2FB7A 3LSSA 3RUXA 2I4OA 1E1TA 3VQWA 2ZR2A 4H2YA 2ZINA 1NJ1A 5GAMj 4TQFA 3RACA 2Q7EA 3SWNA 3HFZA 4EMGA 3PZCA 1I81A 3A32A 5GANh 3IKLA 3UH0A 3SB2A 3QO3A 5GANf 4M75C 1U1SA 1QE0A 1HK9A 4BW9A 3A7RA 4X9CA 3JCMe 4LNSA 3A31A 4M78C 3NENA 3P8VA 4K87A 2IY5B 3TUPA 5CAIA 4YRJA 1KOGA 4M75E 4P75A 5ELNA 1YGBA 3V8LA 3BY7A 3JCMV 2RA2A 3ERRA 1KMMA 2XGTA 4XU0A 3JCMb 2RB6A 4P71A 4P3PA 5GAOm 4M78G 2HNIA 3L4GA 2I4NA 4RCCA 2ZTGA 4C8QE 4H2XB 4HVCA 3UGTA 1B70B 4O2DA 4P72A 5ELOA 2AKWB 2DTIA 4UP7A 1ASZA 2ZT7A 4UPAA 3HXVA 4YPFA 4TWAA 4HA8A 4ZTUB 1X01A 2E65A 4J6YA 4M75D 5LJ3j 1L0WA 4EMKA 1Y96B 2EJGA 4NL3A 1IL2A 3V7CA 3A5YA 5LJ5d 5K1XA 3QTCA 3QNEA 1Z7MA 3HXZA 2C7IA 2EJFA 4C8QD 4H2WA 4G84A 4TVAB 1WQWA 2DDZA 5LJ5h 4H2VA 4H2XA 3LC0A 1ATIA 2RHSB 2XTIA 5LJ5f 4UP8A 4M7AB 3V8KA 2CJAA 4XU1A 5GAMe 1VQZA 1WQ7A 3RF1A 2CGHA 4M77F 1Y96A 4F7UB 1GGMA 2ZZGA 5GAOq 4PJOB 1ASYA 4XU3A 4ZIBA 1B7YB 5C51B 5GMKj 1HXDA 4M7AE 2QHVA 5GMKi 4TVYA 1KQ2A 4PG3A 4CS4A 4M7DC 4ZTZB 1I5LA 3JB9G 4JRKA 4F7UE 1ADYA 1NJ5A 2DQ3A 4CH3A 4QVCA 3LSQA 4C92E 4RMFA 4MMKA 1U1TA 3AHUA 4YRRA 3A74A 3HFNA 2YLBA 1EQRA 1YFRA 4M7DG 4WJ3M 4P74A 2Q7HA 4M7AD 3E9IA 2YLCA 3RL6A 4EO4A 2ZNIA 4YRFA 4M77A 1USYC 2ZT6A 4M7DE 4J5YA 4L87A 4TQDA 4YRKA 1B76A 5GANj 3JCMX 3INZA 3HXYA 4OP0A 4A53A 1Z7NA 4X5OA 4HWPA 4RQEA 1B8AA 3HXUA 3VQVA 4C92D 4N0AA 2CIMA 5GANd 5LJ3e 2E5AA 1KQ1A 4TTVA 3SWNC 3MEYA 4M7DD 2ARTA 1JJCB 5GAN8 4XQ3A 3TEGA 2P0LA 2ODRC 4KQEA 4UP9A 2QHSA 2RHQA 4M75B 4G85A 4H02A 4NL2A 4CH4A 1EVLA 5GAMg 4C8QF 3JCMc 4HWOA 1KMNA 1TH7A 1NJ2A 4MMLA 2ZZEA 4XEOA 2DXTA 2ALYB 3JCMP 4YRPA 4J6XA 3RKYA 2C8MA 4C8QB 3HXXA 3P8TA 4YRLA 3RKWA 3RIRA 3RERA 4PHCA 5HGQA 4P75C 1NYQA 3A7UA 1J5WA 2P5IA 3V7SA 4WJ4A 5GAN2 3WQZA 4P71C 5GMKe 1X56A 2ZT5A 2I2LA 11ASA 2DEQA 3A5ZA 3W3SA 1M8VA 4K88A 5GAOp 1SERA 4P72C 4J15A 4XTYA 3KFUA 4M78E 3PCOB 5LJ5j 3V7RA 2EJ9A 3REXA 2DU7A 2ALYA 2EL9A 1WYDA 2VC8A 2E3CA 1EIYB 4EMKC 4TVWA 4C8QA 2IY5A 4HWSA 1D3BB 4YRCA 3M4PA 3HTZA 3JB9J 1WLEA 2DXUA 1PYSB 5GANe 5KNNA 4YP0A 2QHUA 4M7AF 2E10A
chains in the Genus database with same CATH superfamily
5LJ3g 1K8AU 3R07A 3UA7A 2KT1A 3OYEA 2JNGA 3OSSC 3F70A 3A7AA 5L23A 1SG5A 2AKWA 1N27A 4LXCA 1VQLT 3CEYA 3QYGB 4PJLA 2RK1A 1QW1A 2HQHA 4DA4A 2EQIA 1E22A 2E64A 1O75A 1E24A 1D3BA 3A98A 1FMVA 3QUIA 4PNOA 3CCRA 1ACMB 1NEGA 1TUGB 3G6EQ 2XD0A 2ARSA 1Q86R 1NJ8A 4E7HA 1PG5B 4JRIA 3CC7T 2J6FA 3I7FA 2O01E 1I1JA 3QSUA 4HVWA 1HC7A 1BIAA 1GXIE 3REUA 2D9TA 2F1LA 1KK7A 1AWOA 2DQ0A 2V8IA 2NUPB 4LN2A 2F2WA 4YREA 2KEAA 3OW2S 4LDYA 4ANJA 3PVQA 4HXJA 4M77C 2LVMA 3UPUA 1M2VB 4HCZA 3BW1A 3GBQA 2ZT8A 3THKA 3M4GA 3A8OB 2QDLA 4H2SA 5LJ5e 1WHKA 4N0AC 1S1NA 1G3SA 1TTHB 3E9GA 5HKCA 3TEHB 2DTHA 4QQDA 3CCUT 1LVKA 2EYXA 5KYUB 2J6OA 3G4SA 2R5MA 4A4HA 2K3XA 2LRQA 5CKFA 2LNHB 2EKHA 5GMKh 5HY6A 3RGLA 2CP0A 3JB9H 1M2VA 4CC2A 1WHJA 2K3BA 1E6GA 3IALA 1M1KC 3M53A 2WSCE 3CD6Q 4O5VA 2DL3A 2HEQA 4M78F 1WXUA 1ZHIA 3X26B 1RACB 1ZUYA 3OYAA 4AH6A 3HFVA 3TEHA 2R5AA 5DM7R 4ZGEB 2RH2A 2BKDN 3UA6A 2JTFA 1R0CB 1Q82U 4J9CA 4A4EA 4EMHA 1K9MR 3QO5A 5GAN3 5GAMd 4H2UA 2LJ3A 2QEXT 2I4MA 1M2OA 3VRYA 4E2FB 2ZPBB 3NPFA 4Z02A 4P3NA 1QP2A 4CH5A 2YUQA 3TREA 4OLFA 2SEMA 1VIFA 2MWPA 4CC4B 2VKNA 2J6KA 4KULA 3DLLA 3QXEB 3UDCA 5HK3A 4Q6GA 3NETA 1D09B 2YUOA 4K86A 4F17A 2ODRD 2P84A 4IIMA 3NELA 2X51A 2DBKA 3H0IA 4WF2A 2CJ9A 1ZSZA 2PMEA 3G1ZA 5LJ5g 2ZPIB 2ED1A 5GAOl 4FT2A 3I5SA 4KGZB 3S6WA 4XU2A 4HT4A 3PCOA 4E51A 2D8JA 3C95A 3FEOA 3CCLQ 4EDUA 3CPWA 1YBYA 2FYKA 1EIYA 1OX8A 1IHVA 3PGGA 4YCWA 1UG1A 2L3SA 2HAXA 3M58A 1YHQT 2JMAA 3G71A 5LJ3d 2K57A 1VQ7A 2ZXFA 2V26A 3EFOA 1N9RA 3DKMA 1IRXA 2ZZFA 4IKFA 3M0TA 3TVTA 3VYGA 1VQKT 1Q81C 3MEUA 4J7FA 5GAN5 1OX9A 3PVLA 4BE1A 1Q7YU 1M3BA 3UFGA 4CS2A 1N8RC 4ATOA 4PJOC 2M1HA 5GAN4 1NYRA 1RI0A 5C0MA 1KFZA 2OAWA 4M77B 4QQ6A 4PFZA 1M5Q1 1N6AA 1YNZA 4YRSA 1BCOA 4WTOB 1M1FA 4F7UG 2OTJT 3C0CA 1VQLA 4ZGDB 3C12A 3RBBB 3EGUA 4C92G 4E7KA 2QTXA 4LD9K 2HCKA 4QVDA 2NUZA 4P3OA 1QVGA 3M9QA 1NJIU 4EX5A 5KYXB 3CMAA 3BFMA 2CDTA 5I11A 2P4RA 4N4IA 2BE9B 2RHQB 1YWPA 1YJ9T 1TXQA 3G1JA 3HRIA 1OPLA 4IIOA 1QVFA 4PJOD 3QO8A 2EVRA 1RLQC 2KE9A 3LW5E 4YROA 2HQEA 1GL5A 3P8YA 1VQ5Q 2CSIA 2COWA 1K73U 4YTLA 4D8DA 3VQWA 4H2YA 2ZINA 5FWCA 4TQFA 3PIOA 1SKUB 2E70A 2OJ2A 3HFZA 3PZCA 1TSFA 5KYXA 4J7IA 2DNUA 1W2BP 2QA4A 2M16A 1QMCA 3D7SB 2W0ZA 4M75C 2WSFE 3TCJA 2LP5A 4PJJA 1VIEA 2DYIA 4J9BA 5FU6C 2NLUA 1G3YA 2DE0X 3OYDA 1WHLA 1GCPA 3M0RA 2KI7A 1UE9A 3L2WA 4YRJA 4IUQA 1KOGA 2Y4XA 4X1VA 1ZA1B 3P8BB 2HD0A 2D0QB 1KMMA 4LDVA 2RB6A 2DEUA 2F2XA 3OYNA 2KSSA 1YITQ 1QWFA 1VQPQ 3L4GA 2YUNA 2I4NA 2E4HA 4C8QE 3CCET 3UGTA 3VS0A 4UPAA 3HXVA 1I07A 1RADB 4Z88A 1L0WA 4M75D 5CVIA 3FC3A 2EJGA 5LJ5d 1R8OB 3PTAA 2YDLA 2FG0A 1GBRA 3M0QA 2M02A 2BIVA 3CMEA 1W2BS 2K5FA 3PNWC 4G84A 1LCKA 1RAIB 3J7AF 4TVAB 1KG1A 2J05A 3CD6T 2LJ1A 1NYFA 2XK0A 4DBHA 3RF1A 4M77F 1UHFA 3JAME 1VQ4A 4PJOB 1ASYA 3MJXA 3EGDB 1B7YB 1HD3A 3G71Q 3VRZA 2GTJA 2CP6A 4AG2C 3M54A 4RG2A 1M1KU 2YWWA 4ZTZB 4JPBW 4CH3A 1WHGA 4QVCA 3LX7A 3O8VA 1DJ7B 1PKSA 4MMKA 4OB1B 1YIJQ 3SHWA 3AHUA 2PUOB 1BK2A 1EQRA 3GOXA 4M7DG 4WJ3M 4P74A 3E9IA 2DPPB 4M7AD 2HZYA 3ASKA 2MF2A 5A0GA 5HCKA 4HVVA 2ZT6A 3OYCA 1USYC 6AT1B 3HXYA 4OP0A 4A53A 3U23A 1H8KA 1Z7NA 3OYJA 2IG0A 4RQEA 1NLOC 1WZOA 2PVDB 4FSSA 1KQ1A 4OMPA 4A63B 1WX6A 3SWNC 1D1AA 3OYKA 1OPKA 1G2BA 3HKSA 3MEVA 4BI3A 4XQ3A 4FIBA 3OY9A 1HYOA 2P0LA 3A5ZB 4UP9A 4M75B 4CH4A 3NMZC 2RPNA 4C5GA 3OYFA 1VQMA 1EVLA 1MMGA 1NJ2A 5FU6B 5FU7C 1IREB 2RJDA 2DXTA 2RNAA 4YRPA 4J6XA 4JDSA 3P8TA 4YRLA 1YN8A 2RHIA 3QG1A 2LX7A 3RIRA 3RERA 4PHCA 5HGQA 1NYQA 3UF4A 5FLXE 1IB8A 2R57A 2EGCA 4Y28E 3A5ZA 2HSEB 3W3SA 3AT1B 3FLGA 4DOWA 3CCRT 1M8VA 1AHJB 3WXMB 4J15A 2DVJA 2EJ9A 2CZ6B 2P0QA 1Q81U 3I5RA 3E9FA 1WYDA 4EMKC 3CCMQ 3MPUB 2GQVA 2FL7A 4F04B 1SPKA 3QDRB 4HWSA 3OQ5A 2CYZB 1RAEB 1R77A 2LCCA 2EIFA 1UDLA 3TEEA 1T3SA 3EG0A 1VQNA 1N8RU 3HTZA 3G6EA 3JB9J 2Y4YA 2DXUA 4FYWB 3QKJA 4E7LA 1WLEA 5L8RE 5GANe 3CC4Q 2QHUA 4C5HA 1X69A 2CSQA 4M78D 1EVKA 1X2GA 4FW2A 3S3MA 2V8KA 3QHSA 4XTWA 1NLPC 1B70A 4DPGA 4ELYC 1PWTA 4PJOF 2LZ6B 2OTLQ 3RKXA 3H0FA 3HRKA 1VQ5T 2XICA 3NEMA 1TS9A 1LOJA 2RHXA 2F5KA 1EZZB 3QWXX 1NE8A 1WNLA 2A37A 2VV5A 2QG9B 1AD5A 3G4ST 1WU7A 1H4QA 2LTOA 2JW4A 2RN8A 1HTTA 3CMEQ 4YRQA 1WXBA 1OU9A 4TVRA 5IXFA 3JCMg 1MHNA 2QDYB 4IUVA 1E1OA 2RHSA 4A4KA 5GAOr 4M7AA 1U06A 5EG2A 2JS0A 3CCVQ 2KRNA 1VQ4Q 1VQOQ 3J80E 4PK4A 3JB9I 2GFAA 1YB3A 1CKAA 4LDXA 5C52B 4BB7A 2EYYA 1X2HA 2X35A 4J6WA 2AKKA 2VWFA 4OF1A 1VQPT 1TUDA 1G5VA 3OYHA 3IKMB 4V2SA 2EWNA 3RMQA 2FZKB 2K4YA 2LDMA 3CPWP 3JCMQ 1YFTA 2RI2A 1BBZA 2K79A 5GANg 3IG2A 1OEBA 5CR2A 2FZGB 1Y7XA 4RTXA 1QKXA 4M75F 3HXWA 1RABB 3HTRA 1WHMA 5KYWB 1BI2A 2DXBA 2ARUA 4BDYA 3E9HA 2RO0A 4LVJA 2MWOA 2QGFB 3NGPA 3SEMA 3NTHA 2RI3A 3OB9A 1X2KA 2YUPA 4M78B 2ZIOA 3M55A 2CP3A 2ZPEB 4AT1B 5IN1A 3VU3C 3OD1A 4KBMB 2BE7D 3V8JA 2AK5A 4M4ZA 1RAGB 2XIDA 1OI1A 1W66A 2FEIA 1UGSB 2DA9A 1I4K1 1YCSB 3G71T 4XTZA 1YJWA 1J3TA 2QASA 2QQAA 2JM8A 4Q15A 4K11A 2CREA 3OYIA 1K8AR 3HHTB 5GAN7 2J3LA 4II1A 4KR2A 1RAAB 3CCLA 1QVGP 3OS2A 3UT1A 2EYWA 2DL5A 1D0XA 2G3RA 4OMQA 4EMKB 2DK3A 1H4TA 4XEMA 3CPWS 2AIRB 1ZSZC 1TOVA 3EGXA 2FPDA 4M78A 3MF1A 2DU5A 2BZ8A 1YIJT 3CCQQ 1PCXA 4DQ2A 2PVGB 1M90C 1SRMA 3CBPA 4J9EA 1JXMA 4QVZA 4C8QG 1D1CA 1SRYA 4X34A 3FDRA 2E41A 1MNEA 2A3LA 3UGQA 2EBPA 4YCUA 1BIBA 3R6NA 4GY5A 1W70A 2J06A 5AT1B 2RJCA 1WPYA 1T3LA 1PRLC 3JB9F 5GAN6 4JZ4A 3R6OA 4D8KA 5C53B 2FVUA 4E6RA 4EIKA 1VQNQ 1KHCA 2RQRA 2X9HA 5GMKm 2C0OA 3CMAT 5KCHA 3TQ7P 2ZZDA 4P73C 2LX9A 1AZEA 2KNBB 3BJUA 2AT1B 1KIKA 3LWHA 3JSCA 2KRSA 2VGMA 2E1HA 2E5KA 4A54A 1QVGS 1FYFA 2KROA 1OZ2A 2VXEA 1SETA 2JVVA 4C92C 4CS3A 3ULRB 3L1AA 1M3AA 1K9AA 4ZN3A 3JCMd 4AMCA 1D1BA 1MV0B 2YHTA 2QA4T 1JU5C 1H4SA 1VQ5A 4OMLA 2KYMA 3LGLA 4PJOE 4RTVA 2COZA 1U5SA 4JJDA 1N5ZA 3G7ZA 2H3EB 1BBUA 2CT3A 3GNGA 2RHYA 1BB9A 1X27A 2VASA 3RDVA 4NCXA 1C0AA 3JRZA 4FM4B 1G5IA 2NUPA 1Q82R 3A8HB 2XDDA 2KR3A 3VS2A 3M0PA 2ZCEA 2Q7GA 2LQWA 3QPHA 4JZ3A 5CQYA 2HKNA 3CC4T 2ED0A 3VQYA 1BI3A 5J3BA 3OSVA 4M77D 4LDUA 1E1TA 4C0FA 2GQIA 1SHGA 5A0LA 5KYUA 3RACA 2LCLA 3EG9B 3UATA 4EMGA 1ZBXA 1CKBA 2DRMA 1FMWA 1E7OA 1YITA 1VQPA 5D6YA 4QQGA 1BI1A 2RQWA 2I0NA 3CMET 3A7RA 1TU0B 2YXYA 4J8OA 2CH4W 2M0OA 4UC4A 1PD0A 5DLQE 2IY5B 3P8VA 4J9FA 2CUDA 1Y07A 2BZXA 1VUBA 3EG9A 4M75E 4P75A 3O5ZA 1Y57A 4BUGA 2A8EA 1TG0A 3JCMV 2PQWA 3ERRA 1VQ4T 4P71A 1OZ3A 2RK2A 2HNIA 3Q1JA 4F14A 2ZTGA 1YJWQ 3HL8A 4P72A 5ELOA 2DTIA 4UP7A 2KDSA 1ASZA 2E5QA 2M9UA 3BE3A 3A8LB 4HA8A 4ZTUB 4DBQA 1X01A 2XDPA 1UUEA 1Y96B 3TSZA 3V7CA 5K1XA 3QTCA 1Q7YR 4LNPA 3H9NA 1UJ0A 4OGCA 2EJFA 2RQTA 4H2WA 1T0JA 9ATCB 1WQWA 3MP1A 2DM1A 1Y0MA 4UP8A 1RAFB 1IZ6A 3V8KA 2CJAA 1SHFA 1VQ6A 2J7IA 2O9SA 1FX7A 1YIJA 4C0ZA 1Y96A 4F7UB 2PNIA 1NZ9A 5GAOq 2ZZGA 2ZPGB 4XU3A 1UGPB 1NJIR 4F16A 4LE9A 1IO6A 3M5AA 5GMKj 4RKUE 3QYHB 1KD1C 4M7AE 2K9GA 5GMKi 1Q95G 1IXDA 1KQ2A 4PG3A 4CS4A 4M7DC 2PUKB 2RHUA 2BUDA 1VQMT 1VQ8Q 4L59A 2JM9A 1K73R 3LSQA 1U1TA 3X25B 3M0UA 4YRRA 3A74A 2LQNA 3H41A 2CT4A 5J26A 2Z0WA 2Q7HA 2F69A 3RL6A 3OMCA 4M77A 4L87A 4HKEA 1B76A 2EYQA 1P92A 4KGXB 2L5QA 4N4GA 1KHIA 2DILA 3I55Q 3FJ5A 4KT0E 4PFOA 4N0AA 2CIMA 3CCSA 1WDXA 3VS1A 2B8AA 3QIIA 3OW2A 2NYSA 2KAFA 3DB4A 3A8MB 2XI9A 4M7DD 3OBYA 1JJCB 1D0ZA 1TUCA 5FROA 2A28A 4KQEA 1M90U 2ROTA 2RHQA 2QYZA 4NL2A 3EH1A 1VQNT 2DO3A 1WA7A 3G6ET 1AT1B 1RI9A 1O9SA 2FRYA 1PKTA 2K6DA 2ECZA 3REAB 3CCMA 4E7ZA 2JXBA 2CZ0B 4AFSC 5IH2A 2JZ2A 5IHNA 3RKWA 3HPWA 4OMMA 1RUWA 2M51A 3A7UA 3CC2Q 2P5IA 4FU6A 3OYBA 3V7SA 5CKEA 4DBRA 2EQKA 3CC4A 2JOYA 2VUBA 2DEQA 4OB2B 3M57A 5GAOp 2KRMA 1M27C 2JMCA 4XTYA 4M78E 2OTLA 2K3YA 4A4FA 4TVWA 1XOVA 2EGAA 3M4PA 3META 3M56A 3JV3A 2XMFA 4OVAA 1PYSB 4L5GA 4AFUC 1JXOA 2ROLA 3C94A 3A8GB 4BI8B 1C0MA 3CCJQ 1KC8C 4BY6C 2PMFA 1M1KR 4F7UF 4OB0B 1XJWB 4XTUA 4C92F 5CK9A 1G8XA 2PZ1A 4ESRA 1I5OB 3CCVA 2P0PA 12ASA 3HY0A 4JLIA 4HVUA 1VQOA 3GP8A 2RD1A 3RESA 1NPRA 2DXCA 1QF6A 1PYSA 1MMAA 2MI6A 5GMKl 4RCBA 1BU1A 1B34B 4HWTA 1UFFA 1M4ZA 4TVAA 2HBWA 1IGUA 2RI5A 2RMOA 1V29B 3L2UA 4M7DB 1AOJA 4CC7A 1JJ2P 2Y90A 3TSWA 3CBOA 4OMOA 4JRPA 1VQ6Q 1G5HA 1NJ6A 5CKBA 2YRCA 7AT1B 4IUTA 4PJOA 1PSEA 3EGDA 5D7UA 4LVKA 2IIMA 3FIFA 1B7YA 2X4JA 4FYYB 2MK5A 3DLMA 5KH6A 2DL4A 2E6NA 2CJBA 1JQQA 2JT4A 3JB9D 1YJWT 2B86A 3FRNA 3JCMh 2BTTA 1N9SA 3JCMf 1ARKA 1NEBA 1UJYA 3CCLT 4CH6A 3L2RA 1X43A 5I22A 2CP5A 3ICAA 1YWOA 2JTEA 2KMTA 2LQ8A 4Z89A 2HDAA 3BDUA 3L2ZA 2NWMA 2JN0A 1G51A 1G3WA 3GIBA 1YI2A 2MYSA 4PL6A 5DY9A 4C0DC 1JJ2S 1Q81R 4FT4A 1BYMA 2CZ7B 3CCSQ 1A0NB 2K5LA 2KXDA 3CCQA 1Q86C 3CXCA 5FRNA 1RIQA 3QO7A 3OYYA 4BD3A 1N9WA 1N8RR 2O4XB 2XHCA 3VKIA 3LH5A 2Q5HA 1MGQA 4M75A 1VQ9A 4JJCA 1S72A 2KY9A 1YFSA 2O88A 4C8QC 2DKGA 5GAMh 2ZIMA 5E3IA 4BI4A 4M75G 5GAMf 3ZFJA 1FMKA 4DBFA 3EG1A 2I4LA 2K7AA 2KXCA 4AFZC 5CO7A 1X54A 4B6MA 4WI1A 2IPOB 4C0GA 2P4TA 4MDWA 1KD1U 3CCUQ 1QCFA 1H4VB 2L8DA 2PTKA 1QVPA 5KYYB 3M59A 1LJOA 2F5TX 4DEYA 2MCNA 1X55A 3BDLA 2MMPA 1BI0A 1M30A 3CMQA 3VYHB 1EOVA 3VS5A 2G4CA 4JJNK 4M7DF 3FJPA 3L42A 4Z8AA 2K5IA 2HL3A 2DAQA 2X3XD 2QXFA 2ZGWA 1UGQB 5LJ3h 4ELZC 2AMCB 2X4XA 4JLGA 5KCOA 4R55A 5LJ3f 1K9MC 1V1CA 1FYNA 2QHTA 4JJBA 3EFSA 2DLPA 2QEXQ 3CQTA 2LT4A 1I0CA 3CC2T 4M7AG 3MQZA 3ME9A 1UGRB 1UTIA 1H3ZA 4AG1C 1X75C 2L3PA 4YRGA 3ER0A 1YITT 3OMGA 4GLKA 1K0SA 4KR3A 1JRIA 2QK0A 3N5BB 2AMCA 1ZLMA 4RTWA 4RMOA 1QP3A 2QQBA 5IHKA 4M77E 5CQXA 4QT7A 3SWNB 3UWNA 3WVDB 2DYBA 4YRNA 1KQSA 2ZNJA 3VBBA 1AZGB 2RHZA 3CPFA 2QI2A 2DMOA 1I8FA 5EC7A 3EH2A 1USYA 4KRTA 1BBWA 3H8ZA 5FU7B 1UEBA 2DL8A 4C0DB 1X2QA 1VOMA 3RUXA 1WHHA 3QWYA 5GAMj 2DJQA 4B9WA 2Q7EA 3SWNA 1QCNA 2L3RA 1I81A 3A32A 3S3NA 3IKLA 2BZYA 1ZX6A 3UH0A 1VQKQ 2QQSA 5KYWA 1U1SA 1QE0A 1HK9A 1MMDA 3VS4A 1PM3A 3QDFA 4X9CA 2HKQB 1KC8U 1B7TA 1YI2Q 2EQMA 4IURA 4LUEA 1GFDA 5CAIA 1VQ6T 1FWZA 1SRLA 5ELNA 2VB6A 2NUTB 1YGBA 2DBMA 1M3CA 2RA2A 5ECAA 2XGTA 2W10A 2A7YA 1B07A 3OBWA 1IHWA 4P3PA 4M78G 2IVWA 1QVFP 4Q5WA 4HVCA 4O2DA 1VQ9Q 2AKWB 2DL7A 2JS2A 1CSKA 4LDWA 4RUGA 1S72Q 4TWAA 4OGEA 3VUBA 2E65A 4J6YA 5LJ3j 4EMKA 4QKUA 2DD4A 1C1AA 3QNEA 1YJ9Q 1Z7MA 2NUTA 1AVZC 1K0XA 2C7IA 3P8HA 5J39A 4P5NA 4FL6A 2DERA 4ZTFA 3PMIA 5LJ5h 4H2VA 3LC0A 1ATIA 2XTIA 5LJ5f 3QZ5B 1VQ8A 5FW9A 5C6SA 4XU1A 1VQZA 2XU8A 1WQ7A 3E19A 3OA6A 2AZSA 2VGNA 1WGSA 1GGMA 2DX1A 3CCST 1RL2A 3OS5A 2FHDA 3URGA 3VS3A 5C51B 1H3HA 4ME7A 1HXDA 1GCQA 5KE3A 2QHVA 3RNJA 3I55A 1AWWA 4TVYA 3EG2A 1QVFS 5D6XA 3PT9A 4CC3A 4OB3B 1ADYA 2MAMA 2QTVA 4JS5A 2DETA 4RMFA 5DLOA 4ORZA 4E7JA 3CCMT 2YLBA 2FZCB 2QGGA 1FXXA 1GRIA 1Q86U 4YRFA 1WIEA 3NFCA 4M7DE 2X4WA 3CCEQ 2LQKA 4LVMA 1C6VX 3L2VA 4X5OA 4HWPA 5KYNA 1B8AA 2QQ9A 4C92D 3VQVA 2L3QA 2OI3A 1ZSGA 1SEMA 3MP6A 5GANd 1R0BG 3S3OA 2OTLT 3CC2A 3LGFA 1XNIA 2FPFA 1UHCA 2ARTA 1ZUUA 5CKDA 2KYBA 1YJNA 5A2QE 2ODRC 1OU8A 4G85A 4H02A 1SF9A 4PJNA 4FYXB 2RQUA 4HWOA 2CH4A 4GBQA 3JCMc 4C8QF 1KMNA 1TH7A 4MMLA 4KGVB 2ZZEA 4XEOA 2AHJB 1TWBA 2RJEA 3JCMP 3DB3A 1M1GA 1PHTA 2C8MA 4QW2A 3HXXA 2RQVA 1V76A 3M4YA 1ZSZB 1ZQ1A 1HSQA 2R58A 1PD1A 4PKCC 3EG3A 3CCVT 3WQZA 4A4GA 5GMKe 5KE2A 3P8DA 4RTUA 1VQOT 2DFUA 2ZT5A 2I2LA 4R0KA 11ASA 3I9QA 1WI7A 4K88A 3CCJA 4KH1B 1ABQA 1X6GA 3KFUA 3PCOB 5LJ5j 3MCAB 3V7RA 3OYMA 3REXA 2VC8A 2E3CA 1EIYB 3OS1A 1WJRA 1ZBJA 2KBTA 1QLYA 2IY5A 1K9MU 1JO8A 3HRUA 4YRCA 4PFPA 3EFOB 1XTDA 5KNNA 2H8HA 4J9GA 1W4SA 3I56A 5AYFA 4C5EA 5GJWB 2KT8A 1U8RA 4PLLA 4BWAA 2L89A 2DZ9A 2ZPHB 1K76A 2JJ9A 2MOXA 2YRDA 1YCYA 2ESWA 2XDBA 3CXCP 4R56A 3LH0A 4C92B 5IAYA 4XTXA 4J9HA 5I21A 1NYGA 4ZGJB 4VUBA 1G83A 2VXFA 1QKWA 4JS4A 3OYGA 4P73A 2HBPA 2LC4A 4JRQA 5I2MA 2RM4A 4O6JA 2MPXC 3GLXA 2A36A 3H0HA 2OX7A 4BE2A 1YI2T 4LVIA 4F7UA 4LVLA 4P74C 4FYVB 1JEGA 1JBMA 4C92A 1RAHB 3EFRA 4RQFA 3CCRQ 1ABOA 2SRCA 4B9XA 4Y92A 3CCQT 5GAOn 5FWBA 1WJQA 3C4SA 3SFMA 1M90R 4X9DA 2ABLA 2E12A 3EHRA 5IT9E 2D6FA 4M77G 1VQ9T 3QBYA 8AT1B 2D1XA 1S72T 2CS7A 3HFZB 4GLMA 1ZA2B 1H641 2DJZA 3M4QA 3SDZA 3OS0A 5CIUA 5K1PA 2XG8D 3CXCS 2G6FX 1GBQA 1YP5A 2F2VA 2EAYA 3CC7A 1OULA 3RR6A 3J81E 1X6OA 2V1RA 2EKOA 2DRKA 1PRMC 3MEWA 1WLPB 3VUZA 4NOYA 3X20B 1EFWA 2HL5C 2LCSA 1QQJA 1SESA 2C06A 1B3QA 2RF0A 4HCKA 4RDXA 4RG8A 3MF2A 1NPPA 4HWRA 3DSQA 4YDQA 1KSWA 3G4SQ 2H3JA 3KUFA 1WFWA 2PVOB 5FRMA 2EQUA 2KGTA 1GFCA 2OAUA 4BACA 1JJCA 2E6ZA 2V1QA 1D0YA 3L4GB 4JUVA 2EQJA 2FO0A 3GNFB 4LUDA 1YJNQ 5F5WA 3CCUA 2CUBA 2D0NA 2GF7A 3GF5A 2JTMA 2V8JA 1T0HA 3EAEA 2GNCA 2ZCFB 1UECA 3HFOA 2M0YA 4YRIA 2E3IA 1KQSP 2A08A 2K2MA 2EYZA 2X4YA 2KQWA 2CP2A 1AWJA 1WXTA 4YRMA 1ADJA 3HSBA 4KUIA 4FSXA 3JCMJ 4IUUA 3HY1A 1AEYA 1OQKA 3VS6A 4KUDK 4FCYA 2QEXA 1F1BB 3MO8A 4YRTA 2DVEA 4Y91A 2GBQA 2Q5IA 1PC0A 2CKKA 3I56Q 2GGRA 4M7AC 1H92A 3X28B 2K2VA 4E7SA 1W1FA 1UGVA 2C0TA 3REBB 2WACA 1EFNA 3NHNA 3NTIA 3KBGA 1NM7A 3VJPA 3HRSA 4XAXB 1EX4A 1LNXA 4BE0A 3VQXA 1PNJA 4YYEA 1KQSS 3QJ6A 1Z9QA 4NS5A 2ZPFB 3CBMA 2L2PA 4ZNXA 1K8AC 1VQ7Q 3FB9A 1MNDA 1NG2A 2DZCA 1B34A 3LYIA 4PJOG 2DIQA 1PSFA 4FW1A 2DD5A 5LL6S 4M7DA 4XTVA 1VYTA 1QWEA 3HP9A 4YCVA 1YHQA 1EIFA 1AWXA 3JCMW 1XQHA 2COYA 4RTZA 4EPCA 4HT9A 2O2OA 3E2UA 3H6ZA 2CP7A 2ZAEA 3L2QA 1LYLA 2LMJA 1NNHA 4H2TA 1VQKA 1VYUA 3LWIA 2X3WD 4BDZA 2YT6A 2ZR3A 2HQXA 2DIGA 1VQLQ 2J3MA 2DTOA 4HT8A 5A0DA 2FB7A 1MMNA 4E7IA 2GCXA 3LSSA 2I4OA 2ZR2A 1NJ1A 2PU9B 2P0KA 1JB0E 2CZ1B 2EFIA 3CMAQ 5GANh 2OTJA 1BCMA 3HRTA 1BKBA 4J83A 3SB2A 3QO3A 1OOTA 5GANf 3CC7Q 1SSHA 4BW9A 4N4HA 1Y71A 3LLRA 3SD4A 1KD1R 2O31A 3JCMe 4LNSA 3A31A 4M78C 3NENA 4K87A 1YFNA 2VVKA 2FPEA 3TUPA 1KJWA 1VQ8T 3EHQA 1YJ9A 3MP8A 5I2SA 1WJSA 1M8MA 3BY7A 3V8LA 2QQRA 4MZPA 4DEXA 4XU0A 3JCMb 2QA4Q 2AKLA 2O4XA 5GAOm 2YRVA 4LD6A 8ATCB 4RCCA 4H2XB 1G3TA 2E3HA 1B70B 1OV3A 2LT1A 4BY6B 1VA7A 2ZT7A 4YPFA 2HSPA 3I55T 4IUPA 2EGEA 1Q82C 2FRWA 4NL3A 1IL2A 3A5YA 3M0SA 1K4US 4MZMA 3HXZA 4C8QD 4MZTA 3OYLA 4ZTJA 1W6XA 1MV3A 4HCCA 2DDZA 4H2XA 2RHSB 1IGQA 3KXTA 4M7AB 3A1PA 3VV0A 5GAMe 2O9VA 2CGHA 2L0AA 5KYYA 2XKOC 3E1SA 3QJYA 2HMAA 2A0FB 4ZIBA 1W2BA 3WVEB 1GCQC 4E47A 3CCEA 1LPLA 2AZVA 3MEAA 4RTTA 5M9OA 4J9IA 3ZL7C 4DOVA 1MUZA 2EPDA 1YJNT 1QCOA 1I5LA 3JB9G 4JRKA 4OMFB 2MIOA 4F7UE 4HCBA 5CCAA 1NJ5A 2DQ3A 3T9NA 1U3OA 4C92E 1M9SA 2KK4A 2C0IA 2ENMA 1X6BA 3HFNA 3RMSA 1YFRA 2NS6A 2YLCA 5GJVB 4EO4A 1OYXA 3ZEHA 2ZNIA 4WCIA 4J5YA 3CD6A 4TQDA 4YRKA 5GANj 3JCMX 2LNVA 3INZA 4L6V5 2WSEE 4OMNA 4XK8E 2VYTA 5CKHA 3ZBDA 3HXUA 1RLPC 3CCJT 1Q7YC 3IQLA 5LJ3e 1KC8R 2E5AA 2KVQG 4AFQC 4TTVA 1YHQQ 3VS7A 2GTOA 3MEYA 1Z9ZA 3MKDA 1SSFA 3QZ9B 5GAN8 2DF6A 4J9DA 3TEGA 2YSQA 2QHSA 1NBEB 1ZUKA 2GFUA 5GAMg 3I35A 4PJMA 2D8HA 4D6WA 3KFVA 3I56T 1HJDA 2ALYB 5HK0A 2LJ0A 3RKYA 4KH0B 3MHXA 4C8QB 3EGXB 1NJIC 5IXBA 3NTKA 4P75C 3X24B 1J5WA 2EW3A 2QAZA 4RTYA 4WJ4A 5GAN2 4MDXA 4P71C 3PIPA 5D6WA 2JUFA 3TU4K 1X56A 1VYVA 2OTJQ 1VQ7T 1SERA 4P72C 1VQMQ 1K73C 2RJFA 1JJ2A 4CRIA 4C5IA 2DU7A 2ALYA 2EL9A 4ZN1A 3PFSA 1K1ZA 4C8QA 3PMTA 1WYXA 3OW2P 2ATCB 1D3BB 3GPLA 1UB4A 4PLIA 5IHIA 4CI0C 4YP0A 3PE0A 4M7AF 2E10A 1E6HA
chains in the Genus database with same CATH topology
5LJ3g 1K8AU 3R07A 3OYEA 2JNGA 3OSSC 3F70A 3A7AA 2AKWA 1N27A 1VQLT 3CEYA 3QYGB 2RK1A 1QW1A 4DA4A 1E22A 2E64A 1O75A 1E24A 1D3BA 3QUIA 4PNOA 3CCRA 2XD0A 2ARSA 1NJ8A 4E7HA 4JRIA 3CC7T 3I7FA 2O01E 3QSUA 1HC7A 1BIAA 1GXIE 3REUA 2D9TA 2DQ0A 2V8IA 4YREA 3OW2S 4LDYA 4M77C 2LVMA 3UPUA 4HCZA 3BW1A 2ZT8A 3M4GA 3A8OB 4H2SA 5LJ5e 4N0AC 1G3SA 3E9GA 5HKCA 3TEHB 2DTHA 4QQDA 3CCUT 3G4SA 2R5MA 4A4HA 2K3XA 2LRQA 5CKFA 5GMKh 5HY6A 3RGLA 3JB9H 3IALA 1M1KC 3M53A 2WSCE 4O5VA 4M78F 3X26B 1ZHIA 3OYAA 4AH6A 3HFVA 3TEHA 2R5AA 5DM7R 4ZGEB 2RH2A 2BKDN 2JTFA 1Q82U 4A4EA 4EMHA 3QO5A 5GAN3 5GAMd 4H2UA 2I4MA 2QEXT 2ZPBB 4Z02A 4P3NA 1QP2A 4CH5A 3TREA 4OLFA 1VIFA 2MWPA 4KULA 3DLLA 3QXEB 3UDCA 5HK3A 4Q6GA 3NETA 4K86A 2ODRD 3NELA 4WF2A 2CJ9A 2PMEA 3G1ZA 5LJ5g 2ZPIB 5GAOl 4FT2A 3S6WA 4XU2A 4HT4A 3PCOA 4E51A 3C95A 3FEOA 4EDUA 3CPWA 1YBYA 2FYKA 1EIYA 3PGGA 4YCWA 2HAXA 3M58A 1YHQT 3G71A 5LJ3d 2K57A 1VQ7A 2ZXFA 1N9RA 3DKMA 2ZZFA 4IKFA 3VYGA 1VQKT 1Q81C 3MEUA 4J7FA 5GAN5 4BE1A 1Q7YU 3UFGA 4CS2A 1N8RC 4ATOA 4PJOC 2M1HA 5GAN4 1NYRA 1RI0A 5C0MA 4M77B 4QQ6A 1M5Q1 1N6AA 4YRSA 1M1FA 4F7UG 2OTJT 1VQLA 4ZGDB 3C12A 4C92G 4E7KA 2QTXA 4LD9K 4QVDA 4P3OA 1QVGA 3M9QA 1NJIU 4EX5A 3CMAA 3BFMA 4N4IA 2RHQB 1YJ9T 3HRIA 1QVFA 4PJOD 3QO8A 3LW5E 4YROA 2HQEA 3P8YA 1K73U 4YTLA 3VQWA 4H2YA 2ZINA 4TQFA 3PIOA 2E70A 3HFZA 3PZCA 4J7IA 2QA4A 2M16A 4M75C 3TCJA 2WSFE 1VIEA 5FU6C 2NLUA 1G3YA 3OYDA 3L2WA 4YRJA 4IUQA 1KOGA 2Y4XA 3P8BB 2HD0A 2D0QB 1KMMA 4LDVA 2RB6A 3OYNA 2KSSA 3L4GA 2I4NA 4C8QE 3CCET 3UGTA 4UPAA 3HXVA 1L0WA 4M75D 5CVIA 3FC3A 2EJGA 5LJ5d 1R8OB 3PTAA 2BIVA 3CMEA 1W2BS 2K5FA 3PNWC 4G84A 3J7AF 4TVAB 1KG1A 3CD6T 2XK0A 3RF1A 4M77F 3JAME 1VQ4A 4PJOB 1ASYA 1B7YB 3M54A 4RG2A 1M1KU 4ZTZB 4CH3A 4QVCA 3LX7A 3O8VA 1DJ7B 4MMKA 4OB1B 3AHUA 2PUOB 1EQRA 3GOXA 4M7DG 4WJ3M 4P74A 3E9IA 2DPPB 4M7AD 3ASKA 2MF2A 5A0GA 2ZT6A 3OYCA 1USYC 3HXYA 4OP0A 4A53A 1Z7NA 3OYJA 2IG0A 4RQEA 2PVDB 1KQ1A 3SWNC 3OYKA 3HKSA 3MEVA 4BI3A 4XQ3A 4FIBA 3OY9A 2P0LA 3A5ZB 4UP9A 4M75B 4CH4A 4C5GA 3OYFA 1VQMA 1EVLA 1NJ2A 5FU6B 5FU7C 1IREB 2RJDA 2DXTA 4YRPA 4J6XA 4JDSA 3P8TA 4YRLA 2RHIA 3QG1A 3RIRA 3RERA 4PHCA 5HGQA 1NYQA 5FLXE 2R57A 4Y28E 3A5ZA 3W3SA 3FLGA 4DOWA 3CCRT 1M8VA 1AHJB 3WXMB 4J15A 2EJ9A 2CZ6B 2P0QA 1Q81U 3E9FA 1WYDA 4EMKC 2GQVA 2FL7A 3QDRB 4HWSA 3OQ5A 2CYZB 2LCCA 2EIFA 3TEEA 1VQNA 1N8RU 3HTZA 3G6EA 1WLEA 2Y4YA 2DXUA 4E7LA 3QKJA 3JB9J 5L8RE 5GANe 2QHUA 4C5HA 4M78D 1EVKA 1X2GA 3S3MA 2V8KA 3QHSA 4XTWA 1B70A 4DPGA 4ELYC 4PJOF 3HRKA 3RKXA 1VQ5T 2XICA 3NEMA 1LOJA 2RHXA 2F5KA 1NE8A 1WNLA 2VV5A 3G4ST 1WU7A 1H4QA 2LTOA 1HTTA 4YRQA 4TVRA 3JCMg 1MHNA 2QDYB 4IUVA 1E1OA 2RHSA 4A4KA 5GAOr 4M7AA 5EG2A 3J80E 3JB9I 2GFAA 1YB3A 4LDXA 5C52B 4BB7A 1X2HA 2X35A 4J6WA 4OF1A 1VQPT 1G5VA 3OYHA 3IKMB 4V2SA 2EWNA 3RMQA 2K4YA 2LDMA 3JCMQ 1YFTA 2RI2A 5GANg 3IG2A 5CR2A 1Y7XA 4M75F 3HXWA 1BI2A 2DXBA 2ARUA 4BDYA 3E9HA 2RO0A 4LVJA 2MWOA 3NTHA 2RI3A 3OB9A 4M78B 2ZIOA 3M55A 2ZPEB 5IN1A 3VU3C 3OD1A 4KBMB 3V8JA 2XIDA 1OI1A 1W66A 1UGSB 1I4K1 3G71T 4XTZA 1YJWA 2QQAA 4Q15A 3OYIA 3HHTB 5GAN7 2J3LA 4II1A 4KR2A 3CCLA 3OS2A 3UT1A 4EMKB 2G3RA 1H4TA 4XEMA 2DK3A 3CPWS 4M78A 3MF1A 2DU5A 1YIJT 4DQ2A 2PVGB 1M90C 3CBPA 4QVZA 4C8QG 1SRYA 4X34A 3FDRA 2E41A 2A3LA 3UGQA 4YCUA 1BIBA 4GY5A 2RJCA 1WPYA 3JB9F 5GAN6 3R6OA 5C53B 2FVUA 1KHCA 5GMKm 3CMAT 5KCHA 4P73C 2ZZDA 2LX9A 3BJUA 3LWHA 3JSCA 2VGMA 2E1HA 4A54A 1QVGS 1FYFA 1OZ2A 2VXEA 1SETA 2JVVA 4C92C 4CS3A 3L1AA 4ZN3A 3JCMd 2YHTA 2QA4T 1H4SA 1VQ5A 3LGLA 4PJOE 3G7ZA 1BBUA 3GNGA 2RHYA 4NCXA 1C0AA 3JRZA 4FM4B 1G5IA 3A8HB 2XDDA 2ZCEA 2Q7GA 3QPHA 5CQYA 3CC4T 3VQYA 1BI3A 5J3BA 3OSVA 4M77D 4LDUA 1E1TA 4C0FA 5A0LA 3RACA 2LCLA 4EMGA 1ZBXA 1YITA 1VQPA 5D6YA 4QQGA 1BI1A 3CMET 3A7RA 4J8OA 2M0OA 4UC4A 5DLQE 2IY5B 3P8VA 1Y07A 1VUBA 4M75E 4P75A 4BUGA 2A8EA 3JCMV 2PQWA 3ERRA 1VQ4T 4P71A 1OZ3A 2RK2A 2HNIA 3Q1JA 2ZTGA 3HL8A 4P72A 5ELOA 2DTIA 4UP7A 2KDSA 1ASZA 2E5QA 2M9UA 3A8LB 4HA8A 4ZTUB 1X01A 2XDPA 1Y96B 3V7CA 5K1XA 3QTCA 4OGCA 2EJFA 4H2WA 1WQWA 3MP1A 4UP8A 1IZ6A 3V8KA 2CJAA 1VQ6A 1FX7A 1YIJA 4C0ZA 1Y96A 4F7UB 2ZZGA 1NZ9A 5GAOq 2ZPGB 4XU3A 1UGPB 3M5AA 5GMKj 4RKUE 3QYHB 1KD1C 4M7AE 5GMKi 1KQ2A 4PG3A 4CS4A 4M7DC 2PUKB 2RHUA 2BUDA 1VQMT 4L59A 3LSQA 1U1TA 3X25B 4YRRA 3A74A 5J26A 2Q7HA 2F69A 3RL6A 3OMCA 4M77A 4L87A 4HKEA 1B76A 2EYQA 1P92A 2L5QA 4N4GA 1KHIA 4KT0E 4N0AA 2CIMA 3CCSA 2B8AA 3QIIA 3OW2A 2KAFA 3DB4A 3A8MB 2XI9A 4M7DD 3OBYA 1JJCB 5FROA 4KQEA 1M90U 2RHQA 4NL2A 1VQNT 2DO3A 3G6ET 1O9SA 3CCMA 2CZ0B 2JZ2A 3RKWA 3HPWA 3A7UA 2P5IA 4FU6A 3OYBA 3V7SA 5CKEA 2EQKA 3CC4A 2JOYA 2VUBA 2DEQA 4OB2B 3M57A 5GAOp 4XTYA 4M78E 2OTLA 2K3YA 4A4FA 4TVWA 1XOVA 3M4PA 3META 3M56A 4OVAA 1PYSB 4L5GA 3C94A 3A8GB 4BI8B 1KC8C 4BY6C 2PMFA 4F7UF 4OB0B 4XTUA 4C92F 5CK9A 3CCVA 2P0PA 12ASA 3HY0A 4JLIA 1VQOA 3GP8A 2RD1A 3RESA 1NPRA 2DXCA 1QF6A 1PYSA 2MI6A 5GMKl 4RCBA 1B34B 4HWTA 1M4ZA 4TVAA 2RI5A 1V29B 3L2UA 4M7DB 2Y90A 3CBOA 4JRPA 1NJ6A 1G5HA 5CKBA 4IUTA 4PJOA 1PSEA 4LVKA 3FIFA 1B7YA 2X4JA 3DLMA 5KH6A 2E6NA 2CJBA 3JB9D 1YJWT 3FRNA 3JCMh 1N9SA 3JCMf 3CCLT 4CH6A 3L2RA 3ICAA 2KMTA 2LQ8A 3BDUA 3L2ZA 2JN0A 1G51A 1G3WA 3GIBA 1YI2A 4PL6A 5DY9A 4C0DC 1JJ2S 4FT4A 1BYMA 2CZ7B 2K5LA 3CCQA 1Q86C 3CXCA 5FRNA 1RIQA 3QO7A 3OYYA 4BD3A 1N9WA 2O4XB 2XHCA 3VKIA 2Q5HA 1MGQA 4M75A 1VQ9A 1S72A 2KY9A 1YFSA 4C8QC 2DKGA 5GAMh 2ZIMA 5E3IA 4BI4A 4M75G 5GAMf 3ZFJA 2I4LA 5CO7A 1X54A 4WI1A 4C0GA 2P4TA 4MDWA 1KD1U 1H4VB 2L8DA 1QVPA 3M59A 1LJOA 2F5TX 1X55A 3BDLA 2MMPA 1BI0A 3CMQA 3VYHB 1EOVA 2G4CA 4JJNK 4M7DF 3FJPA 3L42A 2K5IA 2DAQA 2ZGWA 2QXFA 1UGQB 5LJ3h 4ELZC 2AMCB 2X4XA 4JLGA 5KCOA 4R55A 5LJ3f 1K9MC 2QHTA 3EFSA 2LT4A 3CC2T 4M7AG 3MQZA 3ME9A 1UGRB 1H3ZA 1X75C 4YRGA 3ER0A 1YITT 3OMGA 4GLKA 4KR3A 1JRIA 3N5BB 2AMCA 4RMOA 1QP3A 2QQBA 4M77E 5CQXA 3SWNB 3UWNA 3WVDB 4YRNA 1KQSA 2ZNJA 3VBBA 2RHZA 3CPFA 2QI2A 1I8FA 1USYA 1BBWA 3H8ZA 5FU7B 1UEBA 4C0DB 3RUXA 5GAMj 4B9WA 2Q7EA 3SWNA 2L3RA 1I81A 3A32A 3S3NA 3IKLA 3UH0A 2QQSA 1U1SA 1QE0A 1HK9A 4X9CA 1KC8U 2EQMA 4IURA 5CAIA 1VQ6T 1FWZA 5ELNA 1YGBA 2RA2A 2XGTA 2A7YA 3OBWA 4P3PA 4M78G 2IVWA 4Q5WA 4HVCA 4O2DA 2AKWB 4LDWA 4TWAA 4OGEA 3VUBA 2E65A 4J6YA 5LJ3j 4EMKA 2DD4A 3QNEA 1Z7MA 2C7IA 3P8HA 5J39A 4P5NA 4FL6A 4ZTFA 3PMIA 5LJ5h 4H2VA 3LC0A 1ATIA 2XTIA 5LJ5f 3QZ5B 1VQ8A 5C6SA 1VQZA 4XU1A 2XU8A 1WQ7A 3E19A 3OA6A 2VGNA 1WGSA 1GGMA 3CCST 1RL2A 3OS5A 2FHDA 3URGA 5C51B 4ME7A 1HXDA 5KE3A 2QHVA 3I55A 4TVYA 1QVFS 5D6XA 3PT9A 4OB3B 1ADYA 2MAMA 4JS5A 4RMFA 5DLOA 4E7JA 3CCMT 2YLBA 1FXXA 1Q86U 4YRFA 3NFCA 4M7DE 2X4WA 2LQKA 4LVMA 3L2VA 4X5OA 4HWPA 1B8AA 2QQ9A 4C92D 3VQVA 3MP6A 5GANd 3S3OA 2OTLT 3CC2A 3LGFA 1XNIA 2ARTA 1YJNA 5A2QE 2ODRC 4G85A 4H02A 4HWOA 4C8QF 3JCMc 1KMNA 1TH7A 4MMLA 2ZZEA 4XEOA 2AHJB 2RJEA 3JCMP 3DB3A 1M1GA 2C8MA 4QW2A 3HXXA 3M4YA 1ZQ1A 2R58A 4PKCC 3CCVT 3WQZA 4A4GA 5GMKe 5KE2A 3P8DA 1VQOT 2ZT5A 2I2LA 11ASA 4K88A 3CCJA 3KFUA 3PCOB 5LJ5j 3MCAB 3V7RA 3OYMA 3REXA 2VC8A 2E3CA 1EIYB 3OS1A 1WJRA 2IY5A 1K9MU 3HRUA 4YRCA 1XTDA 5KNNA 3I56A 1W4SA 5AYFA 4C5EA 1U8RA 4PLLA 4BWAA 2L89A 2DZ9A 2ZPHB 1YCYA 2XDBA 4R56A 3LH0A 4C92B 5IAYA 4XTXA 5I21A 4ZGJB 4VUBA 2VXFA 4JS4A 3OYGA 4P73A 2HBPA 2LC4A 4JRQA 5I2MA 2RM4A 4O6JA 3GLXA 4BE2A 1YI2T 4LVIA 4F7UA 4LVLA 4P74C 1JBMA 4C92A 3EFRA 4RQFA 4B9XA 3CCQT 5GAOn 1WJQA 3C4SA 3SFMA 4X9DA 2E12A 5IT9E 2D6FA 4M77G 1VQ9T 3QBYA 1S72T 2CS7A 3HFZB 1H641 2DJZA 3M4QA 3SDZA 3OS0A 5CIUA 5K1PA 2XG8D 3CXCS 2EAYA 3CC7A 3J81E 1X6OA 2EKOA 3MEWA 3VUZA 4NOYA 3X20B 1EFWA 1SESA 2C06A 4RDXA 4RG8A 3MF2A 1NPPA 4HWRA 3DSQA 4YDQA 2H3JA 3KUFA 2PVOB 5FRMA 2EQUA 2OAUA 4BACA 1JJCA 2E6ZA 3L4GB 4JUVA 2EQJA 3GNFB 5F5WA 3CCUA 2GF7A 3GF5A 2JTMA 2V8JA 3EAEA 2ZCFB 3HFOA 4YRIA 2X4YA 2KQWA 4YRMA 1ADJA 3HSBA 4KUIA 4FSXA 3JCMJ 4IUUA 3HY1A 4KUDK 2QEXA 3MO8A 4YRTA 2DVEA 4Y91A 2Q5IA 2CKKA 4M7AC 3X28B 2K2VA 2WACA 3NTIA 3KBGA 3VJPA 3HRSA 4XAXB 1LNXA 4BE0A 3VQXA 4YYEA 1KQSS 3QJ6A 1K8AC 4NS5A 2ZPFB 3CBMA 3FB9A 2DZCA 1B34A 3LYIA 4PJOG 2DIQA 1PSFA 2DD5A 5LL6S 4M7DA 4XTVA 3HP9A 4YCVA 1YHQA 1EIFA 3JCMW 1XQHA 4EPCA 4HT9A 3H6ZA 3L2QA 1LYLA 1NNHA 4H2TA 1VQKA 3LWIA 4BDZA 2ZR3A 2HQXA 2DIGA 2J3MA 2DTOA 4HT8A 5A0DA 2FB7A 4E7IA 2GCXA 3LSSA 2I4OA 2ZR2A 1NJ1A 2PU9B 2P0KA 1JB0E 2CZ1B 2EFIA 5GANh 2OTJA 3HRTA 1BKBA 4J83A 3SB2A 3QO3A 5GANf 4BW9A 4N4HA 1Y71A 3LLRA 3SD4A 3JCMe 4LNSA 3A31A 4M78C 3NENA 4K87A 3TUPA 1VQ8T 1YJ9A 3MP8A 5I2SA 1WJSA 3V8LA 3BY7A 2QQRA 4MZPA 4XU0A 3JCMb 2O4XA 5GAOm 2YRVA 4LD6A 4RCCA 4H2XB 1G3TA 1B70B 2LT1A 4BY6B 2ZT7A 4YPFA 3I55T 4IUPA 1Q82C 4NL3A 1IL2A 3A5YA 4MZMA 3HXZA 4C8QD 4MZTA 3OYLA 4ZTJA 4HCCA 2DDZA 4H2XA 2RHSB 3KXTA 4M7AB 3VV0A 5GAMe 2CGHA 2XKOC 3E1SA 3QJYA 4ZIBA 1W2BA 3WVEB 4E47A 3CCEA 5M9OA 3MEAA 4DOVA 1YJNT 1I5LA 3JB9G 4JRKA 4OMFB 4F7UE 4HCBA 5CCAA 1NJ5A 2DQ3A 3T9NA 4C92E 1M9SA 2KK4A 3HFNA 3RMSA 1YFRA 2NS6A 2YLCA 4EO4A 1OYXA 3ZEHA 2ZNIA 4J5YA 3CD6A 4TQDA 4YRKA 5GANj 3JCMX 2LNVA 3INZA 4L6V5 2WSEE 4XK8E 2VYTA 5CKHA 3ZBDA 3HXUA 3CCJT 1Q7YC 5LJ3e 2E5AA 2KVQG 4TTVA 3MEYA 1SSFA 3QZ9B 5GAN8 3TEGA 2QHSA 2GFUA 5GAMg 4D6WA 3I56T 2ALYB 5HK0A 3RKYA 3MHXA 4C8QB 1NJIC 3NTKA 4P75C 3X24B 1J5WA 4WJ4A 5GAN2 4MDXA 4P71C 3PIPA 5D6WA 1X56A 2JUFA 3TU4K 1VQ7T 1SERA 4P72C 1K73C 1JJ2A 2RJFA 4CRIA 4C5IA 2DU7A 2ALYA 2EL9A 4ZN1A 3PFSA 4C8QA 3PMTA 1D3BB 3GPLA 1UB4A 4PLIA 4CI0C 4YP0A 5CKDA 4M7AF 2E10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 D;  5LJ3 g;  3R07 A;  1EVK A;  1X2G A;  3QHS A;  4XTW A;  2PMF A;  3A7A A;  1B70 A;  4F7U F;  4DPG A;  2AKW A;  4BWA A;  4PJO F;  2DZ9 A;  3HRK A;  3RKX A;  4XTU A;  4C92 F;  3NEM A;  1LOJ A;  1YCY A;  12AS A;  1E22 A;  4JLI A;  3HY0 A;  2E64 A;  1E24 A;  1WNL A;  1D3B A;  2RD1 A;  3QUI A;  4PNO A;  3RES A;  4C92 B;  4XTX A;  5I21 A;  1WU7 A;  1H4Q A;  1QF6 A;  1PYS A;  2ARS A;  5GMK l;  1HTT A;  4RCB A;  1NJ8 A;  1B34 B;  2VXF A;  4HWT A;  4YRQ A;  3JCM g;  4JRI A;  3I7F A;  4P73 A;  4TVA A;  4M7D B;  2RM4 A;  3QSU A;  1E1O A;  2RHS A;  2Y90 A;  1HC7 A;  1BIA A;  5GAO r;  4M7A A;  3REU A;  2DQ0 A;  1NJ6 A;  1G5H A;  4F7U A;  4YRE A;  4P74 C;  4PJO A;  1JBM A;  4M77 C;  4C92 A;  3EFR A;  3JB9 I;  4RQF A;  3BW1 A;  1YB3 A;  3FIF A;  1B7Y A;  2ZT8 A;  5C52 B;  5GAO n;  3M4G A;  1X2H A;  4J6W A;  4H2S A;  5LJ5 e;  2CJB A;  4N0A C;  3IKM B;  4X9D A;  4V2S A;  2EWN A;  3JB9 D;  3TEH B;  2DTH A;  3JCM h;  4M77 G;  1N9S A;  3JCM Q;  3JCM f;  1YFT A;  5GAN g;  3HFZ B;  3IG2 A;  4CH6 A;  1H64 1;  2DJZ A;  3M4Q A;  5K1P A;  4M75 F;  5GMK h;  3HXW A;  3RGL A;  3ICA A;  2EAY A;  3JB9 H;  2ARU A;  3IAL A;  3BDU A;  3L2Z A;  3E9H A;  4NOY A;  2JN0 A;  1G51 A;  1EFW A;  4M78 F;  3GIB A;  1SES A;  5DY9 A;  4AH6 A;  4RDX A;  3HFV A;  3TEH A;  3MF2 A;  4HWR A;  4M78 B;  2ZIO A;  3DSQ A;  4YDQ A;  3VU3 C;  3OD1 A;  1RIQ A;  3V8J A;  4EMH A;  3QO7 A;  1JJC A;  3QO5 A;  5GAN 3;  5GAM d;  1N9W A;  4H2U A;  1W66 A;  2I4M A;  1I4K 1;  3L4G B;  4P3N A;  2Q5H A;  4JUV A;  4XTZ A;  5F5W A;  4CH5 A;  1MGQ A;  4M75 A;  4OLF A;  4Q15 A;  5GAN 7;  2J3L A;  4KR2 A;  1YFS A;  4Q6G A;  3NET A;  4C8Q C;  2DKG A;  5GAM h;  2ZIM A;  4K86 A;  5E3I A;  4EMK B;  1H4T A;  4XEM A;  2ODR D;  4M75 G;  5GAM f;  4M78 A;  3NEL A;  4WF2 A;  3HFO A;  3MF1 A;  4YRI A;  2DU5 A;  2CJ9 A;  2PME A;  2I4L A;  4DQ2 A;  3G1Z A;  5LJ5 g;  1X54 A;  4C8Q G;  4WI1 A;  4YRM A;  1SRY A;  5GAO l;  2E41 A;  3UGQ A;  1ADJ A;  3HSB A;  4XU2 A;  4YCU A;  1BIB A;  1H4V B;  3JCM J;  3HY1 A;  3PCO A;  4E51 A;  1WPY A;  1LJO A;  3JB9 F;  1EIY A;  2FYK A;  1X55 A;  5GAN 6;  3PGG A;  4YCW A;  3CMQ A;  4YRT A;  5C53 B;  2DVE A;  4Y91 A;  1EOV A;  5LJ3 d;  2G4C A;  2K57 A;  2ZXF A;  2Q5I A;  4M7D F;  1N9R A;  5GMK m;  2ZZF A;  3FJP A;  4P73 C;  3BJU A;  2ZGW A;  4M7A C;  5GAN 5;  5LJ3 h;  2AMC B;  2E1H A;  4A54 A;  5LJ3 f;  1FYF A;  2QHT A;  3UFG A;  4CS2 A;  2VXE A;  4PJO C;  3EFS A;  1SET A;  1NYR A;  4C92 C;  5GAN 4;  4CS3 A;  1LNX A;  3VQX A;  3L1A A;  4YYE A;  4M77 B;  4M7A G;  3JCM d;  1M5Q 1;  3FB9 A;  4YRS A;  2YHT A;  2DZC A;  1B34 A;  4F7U G;  4YRG A;  4PJO G;  1H4S A;  4KR3 A;  4C92 G;  2QTX A;  4M7D A;  4XTV A;  1JRI A;  4PJO E;  4YCV A;  4QVD A;  2AMC A;  4P3O A;  3JCM W;  1BBU A;  4NCX A;  4HT9 A;  1C0A A;  4M77 E;  3SWN B;  1G5I A;  4EX5 A;  4YRN A;  3BFM A;  1LYL A;  2ZNJ A;  1NNH A;  3VBB A;  4H2T A;  2RHQ B;  2ZCE A;  1I8F A;  1USY A;  2Q7G A;  3HRI A;  2ZR3 A;  4PJO D;  3QO8 A;  1BBW A;  4YRO A;  3VQY A;  2J3M A;  3P8Y A;  2DTO A;  4HT8 A;  4M77 D;  2FB7 A;  3LSS A;  3RUX A;  2I4O A;  1E1T A;  3VQW A;  2ZR2 A;  4H2Y A;  2ZIN A;  1NJ1 A;  5GAM j;  4TQF A;  3RAC A;  2Q7E A;  3SWN A;  3HFZ A;  4EMG A;  3PZC A;  1I81 A;  3A32 A;  5GAN h;  3IKL A;  3UH0 A;  3SB2 A;  3QO3 A;  5GAN f;  4M75 C;  1U1S A;  1QE0 A;  1HK9 A;  4BW9 A;  3A7R A;  4X9C A;  3JCM e;  4LNS A;  3A31 A;  4M78 C;  3NEN A;  3P8V A;  4K87 A;  2IY5 B;  3TUP A;  5CAI A;  4YRJ A;  1KOG A;  4M75 E;  4P75 A;  5ELN A;  1YGB A;  3V8L A;  3BY7 A;  3JCM V;  2RA2 A;  3ERR A;  1KMM A;  2XGT A;  4XU0 A;  3JCM b;  2RB6 A;  4P71 A;  4P3P A;  5GAO m;  4M78 G;  2HNI A;  3L4G A;  2I4N A;  4RCC A;  2ZTG A;  4C8Q E;  4H2X B;  4HVC A;  3UGT A;  1B70 B;  4O2D A;  4P72 A;  5ELO A;  2AKW B;  2DTI A;  4UP7 A;  1ASZ A;  2ZT7 A;  4UPA A;  3HXV A;  4YPF A;  4TWA A;  4HA8 A;  4ZTU B;  1X01 A;  2E65 A;  4J6Y A;  4M75 D;  5LJ3 j;  1L0W A;  4EMK A;  1Y96 B;  2EJG A;  4NL3 A;  1IL2 A;  3V7C A;  3A5Y A;  5LJ5 d;  5K1X A;  3QTC A;  3QNE A;  1Z7M A;  3HXZ A;  2C7I A;  2EJF A;  4C8Q D;  4H2W A;  4G84 A;  4TVA B;  1WQW A;  2DDZ A;  5LJ5 h;  4H2V A;  4H2X A;  3LC0 A;  1ATI A;  2RHS B;  2XTI A;  5LJ5 f;  4UP8 A;  4M7A B;  3V8K A;  2CJA A;  4XU1 A;  5GAM e;  1VQZ A;  1WQ7 A;  3RF1 A;  2CGH A;  4M77 F;  1Y96 A;  4F7U B;  1GGM A;  2ZZG A;  5GAO q;  4PJO B;  1ASY A;  4XU3 A;  4ZIB A;  1B7Y B;  5C51 B;  5GMK j;  1HXD A;  4M7A E;  2QHV A;  5GMK i;  4TVY A;  1KQ2 A;  4PG3 A;  4CS4 A;  4M7D C;  4ZTZ B;  1I5L A;  3JB9 G;  4JRK A;  4F7U E;  1ADY A;  1NJ5 A;  2DQ3 A;  4CH3 A;  4QVC A;  3LSQ A;  4C92 E;  4RMF A;  4MMK A;  1U1T A;  3AHU A;  4YRR A;  3A74 A;  3HFN A;  2YLB A;  1EQR A;  1YFR A;  4M7D G;  4WJ3 M;  4P74 A;  2Q7H A;  4M7A D;  3E9I A;  2YLC A;  3RL6 A;  4EO4 A;  2ZNI A;  4YRF A;  4M77 A;  1USY C;  2ZT6 A;  4M7D E;  4J5Y A;  4L87 A;  4TQD A;  4YRK A;  1B76 A;  5GAN j;  3JCM X;  3INZ A;  3HXY A;  4OP0 A;  4A53 A;  1Z7N A;  4X5O A;  4HWP A;  4RQE A;  1B8A A;  3HXU A;  3VQV A;  4C92 D;  4N0A A;  2CIM A;  5GAN d;  5LJ3 e;  2E5A A;  1KQ1 A;  4TTV A;  3SWN C;  3MEY A;  4M7D D;  2ART A;  1JJC B;  5GAN 8;  4XQ3 A;  3TEG A;  2P0L A;  2ODR C;  4KQE A;  4UP9 A;  2QHS A;  2RHQ A;  4M75 B;  4G85 A;  4H02 A;  4NL2 A;  4CH4 A;  1EVL A;  5GAM g;  4C8Q F;  3JCM c;  4HWO A;  1KMN A;  1TH7 A;  1NJ2 A;  4MML A;  2ZZE A;  4XEO A;  2DXT A;  2ALY B;  3JCM P;  4YRP A;  4J6X A;  3RKY A;  2C8M A;  4C8Q B;  3HXX A;  3P8T A;  4YRL A;  3RKW A;  3RIR A;  3RER A;  4PHC A;  5HGQ A;  4P75 C;  1NYQ A;  3A7U A;  1J5W A;  2P5I A;  3V7S A;  4WJ4 A;  5GAN 2;  3WQZ A;  4P71 C;  5GMK e;  1X56 A;  2ZT5 A;  2I2L A;  11AS A;  2DEQ A;  3A5Z A;  3W3S A;  1M8V A;  4K88 A;  5GAO p;  1SER A;  4P72 C;  4J15 A;  4XTY A;  3KFU A;  4M78 E;  3PCO B;  5LJ5 j;  3V7R A;  2EJ9 A;  3REX A;  2DU7 A;  2ALY A;  2EL9 A;  1WYD A;  2VC8 A;  2E3C A;  1EIY B;  4EMK C;  4TVW A;  4C8Q A;  2IY5 A;  4HWS A;  1D3B B;  4YRC A;  3M4P A;  3HTZ A;  3JB9 J;  1WLE A;  2DXU A;  1PYS B;  5GAN e;  5KNN A;  4YP0 A;  2QHU A;  4M7A F;  2E10 A; 
#chains in the Genus database with same CATH topology
 5LJ3 g;  1K8A U;  3R07 A;  3UA7 A;  2KT1 A;  3OYE A;  2JNG A;  3OSS C;  3F70 A;  3A7A A;  5L23 A;  1SG5 A;  2AKW A;  1N27 A;  4LXC A;  1VQL T;  3CEY A;  3QYG B;  4PJL A;  2RK1 A;  1QW1 A;  2HQH A;  4DA4 A;  2EQI A;  1E22 A;  2E64 A;  1O75 A;  1E24 A;  1D3B A;  3A98 A;  1FMV A;  3QUI A;  4PNO A;  3CCR A;  1ACM B;  1NEG A;  1TUG B;  3G6E Q;  2XD0 A;  2ARS A;  1Q86 R;  1NJ8 A;  4E7H A;  1PG5 B;  4JRI A;  3CC7 T;  2J6F A;  3I7F A;  2O01 E;  1I1J A;  3QSU A;  4HVW A;  1HC7 A;  1BIA A;  1GXI E;  3REU A;  2D9T A;  2F1L A;  1KK7 A;  1AWO A;  2DQ0 A;  2V8I A;  2NUP B;  4LN2 A;  2F2W A;  4YRE A;  2KEA A;  3OW2 S;  4LDY A;  4ANJ A;  3PVQ A;  4HXJ A;  4M77 C;  2LVM A;  3UPU A;  1M2V B;  4HCZ A;  3BW1 A;  3GBQ A;  2ZT8 A;  3THK A;  3M4G A;  3A8O B;  2QDL A;  4H2S A;  5LJ5 e;  1WHK A;  4N0A C;  1S1N A;  1G3S A;  1TTH B;  3E9G A;  5HKC A;  3TEH B;  2DTH A;  4QQD A;  3CCU T;  1LVK A;  2EYX A;  5KYU B;  2J6O A;  3G4S A;  2R5M A;  4A4H A;  2K3X A;  2LRQ A;  5CKF A;  2LNH B;  2EKH A;  5GMK h;  5HY6 A;  3RGL A;  2CP0 A;  3JB9 H;  1M2V A;  4CC2 A;  1WHJ A;  2K3B A;  1E6G A;  3IAL A;  1M1K C;  3M53 A;  2WSC E;  3CD6 Q;  4O5V A;  2DL3 A;  2HEQ A;  4M78 F;  1WXU A;  1ZHI A;  3X26 B;  1RAC B;  1ZUY A;  3OYA A;  4AH6 A;  3HFV A;  3TEH A;  2R5A A;  5DM7 R;  4ZGE B;  2RH2 A;  2BKD N;  3UA6 A;  2JTF A;  1R0C B;  1Q82 U;  4J9C A;  4A4E A;  4EMH A;  1K9M R;  3QO5 A;  5GAN 3;  5GAM d;  4H2U A;  2LJ3 A;  2QEX T;  2I4M A;  1M2O A;  3VRY A;  4E2F B;  2ZPB B;  3NPF A;  4Z02 A;  4P3N A;  1QP2 A;  4CH5 A;  2YUQ A;  3TRE A;  4OLF A;  2SEM A;  1VIF A;  2MWP A;  4CC4 B;  2VKN A;  2J6K A;  4KUL A;  3DLL A;  3QXE B;  3UDC A;  5HK3 A;  4Q6G A;  3NET A;  1D09 B;  2YUO A;  4K86 A;  4F17 A;  2ODR D;  2P84 A;  4IIM A;  3NEL A;  2X51 A;  2DBK A;  3H0I A;  4WF2 A;  2CJ9 A;  1ZSZ A;  2PME A;  3G1Z A;  5LJ5 g;  2ZPI B;  2ED1 A;  5GAO l;  4FT2 A;  3I5S A;  4KGZ B;  3S6W A;  4XU2 A;  4HT4 A;  3PCO A;  4E51 A;  2D8J A;  3C95 A;  3FEO A;  3CCL Q;  4EDU A;  3CPW A;  1YBY A;  2FYK A;  1EIY A;  1OX8 A;  1IHV A;  3PGG A;  4YCW A;  1UG1 A;  2L3S A;  2HAX A;  3M58 A;  1YHQ T;  2JMA A;  3G71 A;  5LJ3 d;  2K57 A;  1VQ7 A;  2ZXF A;  2V26 A;  3EFO A;  1N9R A;  3DKM A;  1IRX A;  2ZZF A;  4IKF A;  3M0T A;  3TVT A;  3VYG A;  1VQK T;  1Q81 C;  3MEU A;  4J7F A;  5GAN 5;  1OX9 A;  3PVL A;  4BE1 A;  1Q7Y U;  1M3B A;  3UFG A;  4CS2 A;  1N8R C;  4ATO A;  4PJO C;  2M1H A;  5GAN 4;  1NYR A;  1RI0 A;  5C0M A;  1KFZ A;  2OAW A;  4M77 B;  4QQ6 A;  4PFZ A;  1M5Q 1;  1N6A A;  1YNZ A;  4YRS A;  1BCO A;  4WTO B;  1M1F A;  4F7U G;  2OTJ T;  3C0C A;  1VQL A;  4ZGD B;  3C12 A;  3RBB B;  3EGU A;  4C92 G;  4E7K A;  2QTX A;  4LD9 K;  2HCK A;  4QVD A;  2NUZ A;  4P3O A;  1QVG A;  3M9Q A;  1NJI U;  4EX5 A;  5KYX B;  3CMA A;  3BFM A;  2CDT A;  5I11 A;  2P4R A;  4N4I A;  2BE9 B;  2RHQ B;  1YWP A;  1YJ9 T;  1TXQ A;  3G1J A;  3HRI A;  1OPL A;  4IIO A;  1QVF A;  4PJO D;  3QO8 A;  2EVR A;  1RLQ C;  2KE9 A;  3LW5 E;  4YRO A;  2HQE A;  1GL5 A;  3P8Y A;  1VQ5 Q;  2CSI A;  2COW A;  1K73 U;  4YTL A;  4D8D A;  3VQW A;  4H2Y A;  2ZIN A;  5FWC A;  4TQF A;  3PIO A;  1SKU B;  2E70 A;  2OJ2 A;  3HFZ A;  3PZC A;  1TSF A;  5KYX A;  4J7I A;  2DNU A;  1W2B P;  2QA4 A;  2M16 A;  1QMC A;  3D7S B;  2W0Z A;  4M75 C;  2WSF E;  3TCJ A;  2LP5 A;  4PJJ A;  1VIE A;  2DYI A;  4J9B A;  5FU6 C;  2NLU A;  1G3Y A;  2DE0 X;  3OYD A;  1WHL A;  1GCP A;  3M0R A;  2KI7 A;  1UE9 A;  3L2W A;  4YRJ A;  4IUQ A;  1KOG A;  2Y4X A;  4X1V A;  1ZA1 B;  3P8B B;  2HD0 A;  2D0Q B;  1KMM A;  4LDV A;  2RB6 A;  2DEU A;  2F2X A;  3OYN A;  2KSS A;  1YIT Q;  1QWF A;  1VQP Q;  3L4G A;  2YUN A;  2I4N A;  2E4H A;  4C8Q E;  3CCE T;  3UGT A;  3VS0 A;  4UPA A;  3HXV A;  1I07 A;  1RAD B;  4Z88 A;  1L0W A;  4M75 D;  5CVI A;  3FC3 A;  2EJG A;  5LJ5 d;  1R8O B;  3PTA A;  2YDL A;  2FG0 A;  1GBR A;  3M0Q A;  2M02 A;  2BIV A;  3CME A;  1W2B S;  2K5F A;  3PNW C;  4G84 A;  1LCK A;  1RAI B;  3J7A F;  4TVA B;  1KG1 A;  2J05 A;  3CD6 T;  2LJ1 A;  1NYF A;  2XK0 A;  4DBH A;  3RF1 A;  4M77 F;  1UHF A;  3JAM E;  1VQ4 A;  4PJO B;  1ASY A;  3MJX A;  3EGD B;  1B7Y B;  1HD3 A;  3G71 Q;  3VRZ A;  2GTJ A;  2CP6 A;  4AG2 C;  3M54 A;  4RG2 A;  1M1K U;  2YWW A;  4ZTZ B;  4JPB W;  4CH3 A;  1WHG A;  4QVC A;  3LX7 A;  3O8V A;  1DJ7 B;  1PKS A;  4MMK A;  4OB1 B;  1YIJ Q;  3SHW A;  3AHU A;  2PUO B;  1BK2 A;  1EQR A;  3GOX A;  4M7D G;  4WJ3 M;  4P74 A;  3E9I A;  2DPP B;  4M7A D;  2HZY A;  3ASK A;  2MF2 A;  5A0G A;  5HCK A;  4HVV A;  2ZT6 A;  3OYC A;  1USY C;  6AT1 B;  3HXY A;  4OP0 A;  4A53 A;  3U23 A;  1H8K A;  1Z7N A;  3OYJ A;  2IG0 A;  4RQE A;  1NLO C;  1WZO A;  2PVD B;  4FSS A;  1KQ1 A;  4OMP A;  4A63 B;  1WX6 A;  3SWN C;  1D1A A;  3OYK A;  1OPK A;  1G2B A;  3HKS A;  3MEV A;  4BI3 A;  4XQ3 A;  4FIB A;  3OY9 A;  1HYO A;  2P0L A;  3A5Z B;  4UP9 A;  4M75 B;  4CH4 A;  3NMZ C;  2RPN A;  4C5G A;  3OYF A;  1VQM A;  1EVL A;  1MMG A;  1NJ2 A;  5FU6 B;  5FU7 C;  1IRE B;  2RJD A;  2DXT A;  2RNA A;  4YRP A;  4J6X A;  4JDS A;  3P8T A;  4YRL A;  1YN8 A;  2RHI A;  3QG1 A;  2LX7 A;  3RIR A;  3RER A;  4PHC A;  5HGQ A;  1NYQ A;  3UF4 A;  5FLX E;  1IB8 A;  2R57 A;  2EGC A;  4Y28 E;  3A5Z A;  2HSE B;  3W3S A;  3AT1 B;  3FLG A;  4DOW A;  3CCR T;  1M8V A;  1AHJ B;  3WXM B;  4J15 A;  2DVJ A;  2EJ9 A;  2CZ6 B;  2P0Q A;  1Q81 U;  3I5R A;  3E9F A;  1WYD A;  4EMK C;  3CCM Q;  3MPU B;  2GQV A;  2FL7 A;  4F04 B;  1SPK A;  3QDR B;  4HWS A;  3OQ5 A;  2CYZ B;  1RAE B;  1R77 A;  2LCC A;  2EIF A;  1UDL A;  3TEE A;  1T3S A;  3EG0 A;  1VQN A;  1N8R U;  3HTZ A;  3G6E A;  3JB9 J;  2Y4Y A;  2DXU A;  4FYW B;  3QKJ A;  4E7L A;  1WLE A;  5L8R E;  5GAN e;  3CC4 Q;  2QHU A;  4C5H A;  1X69 A;  2CSQ A;  4M78 D;  1EVK A;  1X2G A;  4FW2 A;  3S3M A;  2V8K A;  3QHS A;  4XTW A;  1NLP C;  1B70 A;  4DPG A;  4ELY C;  1PWT A;  4PJO F;  2LZ6 B;  2OTL Q;  3RKX A;  3H0F A;  3HRK A;  1VQ5 T;  2XIC A;  3NEM A;  1TS9 A;  1LOJ A;  2RHX A;  2F5K A;  1EZZ B;  3QWX X;  1NE8 A;  1WNL A;  2A37 A;  2VV5 A;  2QG9 B;  1AD5 A;  3G4S T;  1WU7 A;  1H4Q A;  2LTO A;  2JW4 A;  2RN8 A;  1HTT A;  3CME Q;  4YRQ A;  1WXB A;  1OU9 A;  4TVR A;  5IXF A;  3JCM g;  1MHN A;  2QDY B;  4IUV A;  1E1O A;  2RHS A;  4A4K A;  5GAO r;  4M7A A;  1U06 A;  5EG2 A;  2JS0 A;  3CCV Q;  2KRN A;  1VQ4 Q;  1VQO Q;  3J80 E;  4PK4 A;  3JB9 I;  2GFA A;  1YB3 A;  1CKA A;  4LDX A;  5C52 B;  4BB7 A;  2EYY A;  1X2H A;  2X35 A;  4J6W A;  2AKK A;  2VWF A;  4OF1 A;  1VQP T;  1TUD A;  1G5V A;  3OYH A;  3IKM B;  4V2S A;  2EWN A;  3RMQ A;  2FZK B;  2K4Y A;  2LDM A;  3CPW P;  3JCM Q;  1YFT A;  2RI2 A;  1BBZ A;  2K79 A;  5GAN g;  3IG2 A;  1OEB A;  5CR2 A;  2FZG B;  1Y7X A;  4RTX A;  1QKX A;  4M75 F;  3HXW A;  1RAB B;  3HTR A;  1WHM A;  5KYW B;  1BI2 A;  2DXB A;  2ARU A;  4BDY A;  3E9H A;  2RO0 A;  4LVJ A;  2MWO A;  2QGF B;  3NGP A;  3SEM A;  3NTH A;  2RI3 A;  3OB9 A;  1X2K A;  2YUP A;  4M78 B;  2ZIO A;  3M55 A;  2CP3 A;  2ZPE B;  4AT1 B;  5IN1 A;  3VU3 C;  3OD1 A;  4KBM B;  2BE7 D;  3V8J A;  2AK5 A;  4M4Z A;  1RAG B;  2XID A;  1OI1 A;  1W66 A;  2FEI A;  1UGS B;  2DA9 A;  1I4K 1;  1YCS B;  3G71 T;  4XTZ A;  1YJW A;  1J3T A;  2QAS A;  2QQA A;  2JM8 A;  4Q15 A;  4K11 A;  2CRE A;  3OYI A;  1K8A R;  3HHT B;  5GAN 7;  2J3L A;  4II1 A;  4KR2 A;  1RAA B;  3CCL A;  1QVG P;  3OS2 A;  3UT1 A;  2EYW A;  2DL5 A;  1D0X A;  2G3R A;  4OMQ A;  4EMK B;  2DK3 A;  1H4T A;  4XEM A;  3CPW S;  2AIR B;  1ZSZ C;  1TOV A;  3EGX A;  2FPD A;  4M78 A;  3MF1 A;  2DU5 A;  2BZ8 A;  1YIJ T;  3CCQ Q;  1PCX A;  4DQ2 A;  2PVG B;  1M90 C;  1SRM A;  3CBP A;  4J9E A;  1JXM A;  4QVZ A;  4C8Q G;  1D1C A;  1SRY A;  4X34 A;  3FDR A;  2E41 A;  1MNE A;  2A3L A;  3UGQ A;  2EBP A;  4YCU A;  1BIB A;  3R6N A;  4GY5 A;  1W70 A;  2J06 A;  5AT1 B;  2RJC A;  1WPY A;  1T3L A;  1PRL C;  3JB9 F;  5GAN 6;  4JZ4 A;  3R6O A;  4D8K A;  5C53 B;  2FVU A;  4E6R A;  4EIK A;  1VQN Q;  1KHC A;  2RQR A;  2X9H A;  5GMK m;  2C0O A;  3CMA T;  5KCH A;  3TQ7 P;  2ZZD A;  4P73 C;  2LX9 A;  1AZE A;  2KNB B;  3BJU A;  2AT1 B;  1KIK A;  3LWH A;  3JSC A;  2KRS A;  2VGM A;  2E1H A;  2E5K A;  4A54 A;  1QVG S;  1FYF A;  2KRO A;  1OZ2 A;  2VXE A;  1SET A;  2JVV A;  4C92 C;  4CS3 A;  3ULR B;  3L1A A;  1M3A A;  1K9A A;  4ZN3 A;  3JCM d;  4AMC A;  1D1B A;  1MV0 B;  2YHT A;  2QA4 T;  1JU5 C;  1H4S A;  1VQ5 A;  4OML A;  2KYM A;  3LGL A;  4PJO E;  4RTV A;  2COZ A;  1U5S A;  4JJD A;  1N5Z A;  3G7Z A;  2H3E B;  1BBU A;  2CT3 A;  3GNG A;  2RHY A;  1BB9 A;  1X27 A;  2VAS A;  3RDV A;  4NCX A;  1C0A A;  3JRZ A;  4FM4 B;  1G5I A;  2NUP A;  1Q82 R;  3A8H B;  2XDD A;  2KR3 A;  3VS2 A;  3M0P A;  2ZCE A;  2Q7G A;  2LQW A;  3QPH A;  4JZ3 A;  5CQY A;  2HKN A;  3CC4 T;  2ED0 A;  3VQY A;  1BI3 A;  5J3B A;  3OSV A;  4M77 D;  4LDU A;  1E1T A;  4C0F A;  2GQI A;  1SHG A;  5A0L A;  5KYU A;  3RAC A;  2LCL A;  3EG9 B;  3UAT A;  4EMG A;  1ZBX A;  1CKB A;  2DRM A;  1FMW A;  1E7O A;  1YIT A;  1VQP A;  5D6Y A;  4QQG A;  1BI1 A;  2RQW A;  2I0N A;  3CME T;  3A7R A;  1TU0 B;  2YXY A;  4J8O A;  2CH4 W;  2M0O A;  4UC4 A;  1PD0 A;  5DLQ E;  2IY5 B;  3P8V A;  4J9F A;  2CUD A;  1Y07 A;  2BZX A;  1VUB A;  3EG9 A;  4M75 E;  4P75 A;  3O5Z A;  1Y57 A;  4BUG A;  2A8E A;  1TG0 A;  3JCM V;  2PQW A;  3ERR A;  1VQ4 T;  4P71 A;  1OZ3 A;  2RK2 A;  2HNI A;  3Q1J A;  4F14 A;  2ZTG A;  1YJW Q;  3HL8 A;  4P72 A;  5ELO A;  2DTI A;  4UP7 A;  2KDS A;  1ASZ A;  2E5Q A;  2M9U A;  3BE3 A;  3A8L B;  4HA8 A;  4ZTU B;  4DBQ A;  1X01 A;  2XDP A;  1UUE A;  1Y96 B;  3TSZ A;  3V7C A;  5K1X A;  3QTC A;  1Q7Y R;  4LNP A;  3H9N A;  1UJ0 A;  4OGC A;  2EJF A;  2RQT A;  4H2W A;  1T0J A;  9ATC B;  1WQW A;  3MP1 A;  2DM1 A;  1Y0M A;  4UP8 A;  1RAF B;  1IZ6 A;  3V8K A;  2CJA A;  1SHF A;  1VQ6 A;  2J7I A;  2O9S A;  1FX7 A;  1YIJ A;  4C0Z A;  1Y96 A;  4F7U B;  2PNI A;  1NZ9 A;  5GAO q;  2ZZG A;  2ZPG B;  4XU3 A;  1UGP B;  1NJI R;  4F16 A;  4LE9 A;  1IO6 A;  3M5A A;  5GMK j;  4RKU E;  3QYH B;  1KD1 C;  4M7A E;  2K9G A;  5GMK i;  1Q95 G;  1IXD A;  1KQ2 A;  4PG3 A;  4CS4 A;  4M7D C;  2PUK B;  2RHU A;  2BUD A;  1VQM T;  1VQ8 Q;  4L59 A;  2JM9 A;  1K73 R;  3LSQ A;  1U1T A;  3X25 B;  3M0U A;  4YRR A;  3A74 A;  2LQN A;  3H41 A;  2CT4 A;  5J26 A;  2Z0W A;  2Q7H A;  2F69 A;  3RL6 A;  3OMC A;  4M77 A;  4L87 A;  4HKE A;  1B76 A;  2EYQ A;  1P92 A;  4KGX B;  2L5Q A;  4N4G A;  1KHI A;  2DIL A;  3I55 Q;  3FJ5 A;  4KT0 E;  4PFO A;  4N0A A;  2CIM A;  3CCS A;  1WDX A;  3VS1 A;  2B8A A;  3QII A;  3OW2 A;  2NYS A;  2KAF A;  3DB4 A;  3A8M B;  2XI9 A;  4M7D D;  3OBY A;  1JJC B;  1D0Z A;  1TUC A;  5FRO A;  2A28 A;  4KQE A;  1M90 U;  2ROT A;  2RHQ A;  2QYZ A;  4NL2 A;  3EH1 A;  1VQN T;  2DO3 A;  1WA7 A;  3G6E T;  1AT1 B;  1RI9 A;  1O9S A;  2FRY A;  1PKT A;  2K6D A;  2ECZ A;  3REA B;  3CCM A;  4E7Z A;  2JXB A;  2CZ0 B;  4AFS C;  5IH2 A;  2JZ2 A;  5IHN A;  3RKW A;  3HPW A;  4OMM A;  1RUW A;  2M51 A;  3A7U A;  3CC2 Q;  2P5I A;  4FU6 A;  3OYB A;  3V7S A;  5CKE A;  4DBR A;  2EQK A;  3CC4 A;  2JOY A;  2VUB A;  2DEQ A;  4OB2 B;  3M57 A;  5GAO p;  2KRM A;  1M27 C;  2JMC A;  4XTY A;  4M78 E;  2OTL A;  2K3Y A;  4A4F A;  4TVW A;  1XOV A;  2EGA A;  3M4P A;  3MET A;  3M56 A;  3JV3 A;  2XMF A;  4OVA A;  1PYS B;  4L5G A;  4AFU C;  1JXO A;  2ROL A;  3C94 A;  3A8G B;  4BI8 B;  1C0M A;  3CCJ Q;  1KC8 C;  4BY6 C;  2PMF A;  1M1K R;  4F7U F;  4OB0 B;  1XJW B;  4XTU A;  4C92 F;  5CK9 A;  1G8X A;  2PZ1 A;  4ESR A;  1I5O B;  3CCV A;  2P0P A;  12AS A;  3HY0 A;  4JLI A;  4HVU A;  1VQO A;  3GP8 A;  2RD1 A;  3RES A;  1NPR A;  2DXC A;  1QF6 A;  1PYS A;  1MMA A;  2MI6 A;  5GMK l;  4RCB A;  1BU1 A;  1B34 B;  4HWT A;  1UFF A;  1M4Z A;  4TVA A;  2HBW A;  1IGU A;  2RI5 A;  2RMO A;  1V29 B;  3L2U A;  4M7D B;  1AOJ A;  4CC7 A;  1JJ2 P;  2Y90 A;  3TSW A;  3CBO A;  4OMO A;  4JRP A;  1VQ6 Q;  1G5H A;  1NJ6 A;  5CKB A;  2YRC A;  7AT1 B;  4IUT A;  4PJO A;  1PSE A;  3EGD A;  5D7U A;  4LVK A;  2IIM A;  3FIF A;  1B7Y A;  2X4J A;  4FYY B;  2MK5 A;  3DLM A;  5KH6 A;  2DL4 A;  2E6N A;  2CJB A;  1JQQ A;  2JT4 A;  3JB9 D;  1YJW T;  2B86 A;  3FRN A;  3JCM h;  2BTT A;  1N9S A;  3JCM f;  1ARK A;  1NEB A;  1UJY A;  3CCL T;  4CH6 A;  3L2R A;  1X43 A;  5I22 A;  2CP5 A;  3ICA A;  1YWO A;  2JTE A;  2KMT A;  2LQ8 A;  4Z89 A;  2HDA A;  3BDU A;  3L2Z A;  2NWM A;  2JN0 A;  1G51 A;  1G3W A;  3GIB A;  1YI2 A;  2MYS A;  4PL6 A;  5DY9 A;  4C0D C;  1JJ2 S;  1Q81 R;  4FT4 A;  1BYM A;  2CZ7 B;  3CCS Q;  1A0N B;  2K5L A;  2KXD A;  3CCQ A;  1Q86 C;  3CXC A;  5FRN A;  1RIQ A;  3QO7 A;  3OYY A;  4BD3 A;  1N9W A;  1N8R R;  2O4X B;  2XHC A;  3VKI A;  3LH5 A;  2Q5H A;  1MGQ A;  4M75 A;  1VQ9 A;  4JJC A;  1S72 A;  2KY9 A;  1YFS A;  2O88 A;  4C8Q C;  2DKG A;  5GAM h;  2ZIM A;  5E3I A;  4BI4 A;  4M75 G;  5GAM f;  3ZFJ A;  1FMK A;  4DBF A;  3EG1 A;  2I4L A;  2K7A A;  2KXC A;  4AFZ C;  5CO7 A;  1X54 A;  4B6M A;  4WI1 A;  2IPO B;  4C0G A;  2P4T A;  4MDW A;  1KD1 U;  3CCU Q;  1QCF A;  1H4V B;  2L8D A;  2PTK A;  1QVP A;  5KYY B;  3M59 A;  1LJO A;  2F5T X;  4DEY A;  2MCN A;  1X55 A;  3BDL A;  2MMP A;  1BI0 A;  1M30 A;  3CMQ A;  3VYH B;  1EOV A;  3VS5 A;  2G4C A;  4JJN K;  4M7D F;  3FJP A;  3L42 A;  4Z8A A;  2K5I A;  2HL3 A;  2DAQ A;  2X3X D;  2QXF A;  2ZGW A;  1UGQ B;  5LJ3 h;  4ELZ C;  2AMC B;  2X4X A;  4JLG A;  5KCO A;  4R55 A;  5LJ3 f;  1K9M C;  1V1C A;  1FYN A;  2QHT A;  4JJB A;  3EFS A;  2DLP A;  2QEX Q;  3CQT A;  2LT4 A;  1I0C A;  3CC2 T;  4M7A G;  3MQZ A;  3ME9 A;  1UGR B;  1UTI A;  1H3Z A;  4AG1 C;  1X75 C;  2L3P A;  4YRG A;  3ER0 A;  1YIT T;  3OMG A;  4GLK A;  1K0S A;  4KR3 A;  1JRI A;  2QK0 A;  3N5B B;  2AMC A;  1ZLM A;  4RTW A;  4RMO A;  1QP3 A;  2QQB A;  5IHK A;  4M77 E;  5CQX A;  4QT7 A;  3SWN B;  3UWN A;  3WVD B;  2DYB A;  4YRN A;  1KQS A;  2ZNJ A;  3VBB A;  1AZG B;  2RHZ A;  3CPF A;  2QI2 A;  2DMO A;  1I8F A;  5EC7 A;  3EH2 A;  1USY A;  4KRT A;  1BBW A;  3H8Z A;  5FU7 B;  1UEB A;  2DL8 A;  4C0D B;  1X2Q A;  1VOM A;  3RUX A;  1WHH A;  3QWY A;  5GAM j;  2DJQ A;  4B9W A;  2Q7E A;  3SWN A;  1QCN A;  2L3R A;  1I81 A;  3A32 A;  3S3N A;  3IKL A;  2BZY A;  1ZX6 A;  3UH0 A;  1VQK Q;  2QQS A;  5KYW A;  1U1S A;  1QE0 A;  1HK9 A;  1MMD A;  3VS4 A;  1PM3 A;  3QDF A;  4X9C A;  2HKQ B;  1KC8 U;  1B7T A;  1YI2 Q;  2EQM A;  4IUR A;  4LUE A;  1GFD A;  5CAI A;  1VQ6 T;  1FWZ A;  1SRL A;  5ELN A;  2VB6 A;  2NUT B;  1YGB A;  2DBM A;  1M3C A;  2RA2 A;  5ECA A;  2XGT A;  2W10 A;  2A7Y A;  1B07 A;  3OBW A;  1IHW A;  4P3P A;  4M78 G;  2IVW A;  1QVF P;  4Q5W A;  4HVC A;  4O2D A;  1VQ9 Q;  2AKW B;  2DL7 A;  2JS2 A;  1CSK A;  4LDW A;  4RUG A;  1S72 Q;  4TWA A;  4OGE A;  3VUB A;  2E65 A;  4J6Y A;  5LJ3 j;  4EMK A;  4QKU A;  2DD4 A;  1C1A A;  3QNE A;  1YJ9 Q;  1Z7M A;  2NUT A;  1AVZ C;  1K0X A;  2C7I A;  3P8H A;  5J39 A;  4P5N A;  4FL6 A;  2DER A;  4ZTF A;  3PMI A;  5LJ5 h;  4H2V A;  3LC0 A;  1ATI A;  2XTI A;  5LJ5 f;  3QZ5 B;  1VQ8 A;  5FW9 A;  5C6S A;  4XU1 A;  1VQZ A;  2XU8 A;  1WQ7 A;  3E19 A;  3OA6 A;  2AZS A;  2VGN A;  1WGS A;  1GGM A;  2DX1 A;  3CCS T;  1RL2 A;  3OS5 A;  2FHD A;  3URG A;  3VS3 A;  5C51 B;  1H3H A;  4ME7 A;  1HXD A;  1GCQ A;  5KE3 A;  2QHV A;  3RNJ A;  3I55 A;  1AWW A;  4TVY A;  3EG2 A;  1QVF S;  5D6X A;  3PT9 A;  4CC3 A;  4OB3 B;  1ADY A;  2MAM A;  2QTV A;  4JS5 A;  2DET A;  4RMF A;  5DLO A;  4ORZ A;  4E7J A;  3CCM T;  2YLB A;  2FZC B;  2QGG A;  1FXX A;  1GRI A;  1Q86 U;  4YRF A;  1WIE A;  3NFC A;  4M7D E;  2X4W A;  3CCE Q;  2LQK A;  4LVM A;  1C6V X;  3L2V A;  4X5O A;  4HWP A;  5KYN A;  1B8A A;  2QQ9 A;  4C92 D;  3VQV A;  2L3Q A;  2OI3 A;  1ZSG A;  1SEM A;  3MP6 A;  5GAN d;  1R0B G;  3S3O A;  2OTL T;  3CC2 A;  3LGF A;  1XNI A;  2FPF A;  1UHC A;  2ART A;  1ZUU A;  5CKD A;  2KYB A;  1YJN A;  5A2Q E;  2ODR C;  1OU8 A;  4G85 A;  4H02 A;  1SF9 A;  4PJN A;  4FYX B;  2RQU A;  4HWO A;  2CH4 A;  4GBQ A;  3JCM c;  4C8Q F;  1KMN A;  1TH7 A;  4MML A;  4KGV B;  2ZZE A;  4XEO A;  2AHJ B;  1TWB A;  2RJE A;  3JCM P;  3DB3 A;  1M1G A;  1PHT A;  2C8M A;  4QW2 A;  3HXX A;  2RQV A;  1V76 A;  3M4Y A;  1ZSZ B;  1ZQ1 A;  1HSQ A;  2R58 A;  1PD1 A;  4PKC C;  3EG3 A;  3CCV T;  3WQZ A;  4A4G A;  5GMK e;  5KE2 A;  3P8D A;  4RTU A;  1VQO T;  2DFU A;  2ZT5 A;  2I2L A;  4R0K A;  11AS A;  3I9Q A;  1WI7 A;  4K88 A;  3CCJ A;  4KH1 B;  1ABQ A;  1X6G A;  3KFU A;  3PCO B;  5LJ5 j;  3MCA B;  3V7R A;  3OYM A;  3REX A;  2VC8 A;  2E3C A;  1EIY B;  3OS1 A;  1WJR A;  1ZBJ A;  2KBT A;  1QLY A;  2IY5 A;  1K9M U;  1JO8 A;  3HRU A;  4YRC A;  4PFP A;  3EFO B;  1XTD A;  5KNN A;  2H8H A;  4J9G A;  1W4S A;  3I56 A;  5AYF A;  4C5E A;  5GJW B;  2KT8 A;  1U8R A;  4PLL A;  4BWA A;  2L89 A;  2DZ9 A;  2ZPH B;  1K76 A;  2JJ9 A;  2MOX A;  2YRD A;  1YCY A;  2ESW A;  2XDB A;  3CXC P;  4R56 A;  3LH0 A;  4C92 B;  5IAY A;  4XTX A;  4J9H A;  5I21 A;  1NYG A;  4ZGJ B;  4VUB A;  1G83 A;  2VXF A;  1QKW A;  4JS4 A;  3OYG A;  4P73 A;  2HBP A;  2LC4 A;  4JRQ A;  5I2M A;  2RM4 A;  4O6J A;  2MPX C;  3GLX A;  2A36 A;  3H0H A;  2OX7 A;  4BE2 A;  1YI2 T;  4LVI A;  4F7U A;  4LVL A;  4P74 C;  4FYV B;  1JEG A;  1JBM A;  4C92 A;  1RAH B;  3EFR A;  4RQF A;  3CCR Q;  1ABO A;  2SRC A;  4B9X A;  4Y92 A;  3CCQ T;  5GAO n;  5FWB A;  1WJQ A;  3C4S A;  3SFM A;  1M90 R;  4X9D A;  2ABL A;  2E12 A;  3EHR A;  5IT9 E;  2D6F A;  4M77 G;  1VQ9 T;  3QBY A;  8AT1 B;  2D1X A;  1S72 T;  2CS7 A;  3HFZ B;  4GLM A;  1ZA2 B;  1H64 1;  2DJZ A;  3M4Q A;  3SDZ A;  3OS0 A;  5CIU A;  5K1P A;  2XG8 D;  3CXC S;  2G6F X;  1GBQ A;  1YP5 A;  2F2V A;  2EAY A;  3CC7 A;  1OUL A;  3RR6 A;  3J81 E;  1X6O A;  2V1R A;  2EKO A;  2DRK A;  1PRM C;  3MEW A;  1WLP B;  3VUZ A;  4NOY A;  3X20 B;  1EFW A;  2HL5 C;  2LCS A;  1QQJ A;  1SES A;  2C06 A;  1B3Q A;  2RF0 A;  4HCK A;  4RDX A;  4RG8 A;  3MF2 A;  1NPP A;  4HWR A;  3DSQ A;  4YDQ A;  1KSW A;  3G4S Q;  2H3J A;  3KUF A;  1WFW A;  2PVO B;  5FRM A;  2EQU A;  2KGT A;  1GFC A;  2OAU A;  4BAC A;  1JJC A;  2E6Z A;  2V1Q A;  1D0Y A;  3L4G B;  4JUV A;  2EQJ A;  2FO0 A;  3GNF B;  4LUD A;  1YJN Q;  5F5W A;  3CCU A;  2CUB A;  2D0N A;  2GF7 A;  3GF5 A;  2JTM A;  2V8J A;  1T0H A;  3EAE A;  2GNC A;  2ZCF B;  1UEC A;  3HFO A;  2M0Y A;  4YRI A;  2E3I A;  1KQS P;  2A08 A;  2K2M A;  2EYZ A;  2X4Y A;  2KQW A;  2CP2 A;  1AWJ A;  1WXT A;  4YRM A;  1ADJ A;  3HSB A;  4KUI A;  4FSX A;  3JCM J;  4IUU A;  3HY1 A;  1AEY A;  1OQK A;  3VS6 A;  4KUD K;  4FCY A;  2QEX A;  1F1B B;  3MO8 A;  4YRT A;  2DVE A;  4Y91 A;  2GBQ A;  2Q5I A;  1PC0 A;  2CKK A;  3I56 Q;  2GGR A;  4M7A C;  1H92 A;  3X28 B;  2K2V A;  4E7S A;  1W1F A;  1UGV A;  2C0T A;  3REB B;  2WAC A;  1EFN A;  3NHN A;  3NTI A;  3KBG A;  1NM7 A;  3VJP A;  3HRS A;  4XAX B;  1EX4 A;  1LNX A;  4BE0 A;  3VQX A;  1PNJ A;  4YYE A;  1KQS S;  3QJ6 A;  1Z9Q A;  4NS5 A;  2ZPF B;  3CBM A;  2L2P A;  4ZNX A;  1K8A C;  1VQ7 Q;  3FB9 A;  1MND A;  1NG2 A;  2DZC A;  1B34 A;  3LYI A;  4PJO G;  2DIQ A;  1PSF A;  4FW1 A;  2DD5 A;  5LL6 S;  4M7D A;  4XTV A;  1VYT A;  1QWE A;  3HP9 A;  4YCV A;  1YHQ A;  1EIF A;  1AWX A;  3JCM W;  1XQH A;  2COY A;  4RTZ A;  4EPC A;  4HT9 A;  2O2O A;  3E2U A;  3H6Z A;  2CP7 A;  2ZAE A;  3L2Q A;  1LYL A;  2LMJ A;  1NNH A;  4H2T A;  1VQK A;  1VYU A;  3LWI A;  2X3W D;  4BDZ A;  2YT6 A;  2ZR3 A;  2HQX A;  2DIG A;  1VQL Q;  2J3M A;  2DTO A;  4HT8 A;  5A0D A;  2FB7 A;  1MMN A;  4E7I A;  2GCX A;  3LSS A;  2I4O A;  2ZR2 A;  1NJ1 A;  2PU9 B;  2P0K A;  1JB0 E;  2CZ1 B;  2EFI A;  3CMA Q;  5GAN h;  2OTJ A;  1BCM A;  3HRT A;  1BKB A;  4J83 A;  3SB2 A;  3QO3 A;  1OOT A;  5GAN f;  3CC7 Q;  1SSH A;  4BW9 A;  4N4H A;  1Y71 A;  3LLR A;  3SD4 A;  1KD1 R;  2O31 A;  3JCM e;  4LNS A;  3A31 A;  4M78 C;  3NEN A;  4K87 A;  1YFN A;  2VVK A;  2FPE A;  3TUP A;  1KJW A;  1VQ8 T;  3EHQ A;  1YJ9 A;  3MP8 A;  5I2S A;  1WJS A;  1M8M A;  3BY7 A;  3V8L A;  2QQR A;  4MZP A;  4DEX A;  4XU0 A;  3JCM b;  2QA4 Q;  2AKL A;  2O4X A;  5GAO m;  2YRV A;  4LD6 A;  8ATC B;  4RCC A;  4H2X B;  1G3T A;  2E3H A;  1B70 B;  1OV3 A;  2LT1 A;  4BY6 B;  1VA7 A;  2ZT7 A;  4YPF A;  2HSP A;  3I55 T;  4IUP A;  2EGE A;  1Q82 C;  2FRW A;  4NL3 A;  1IL2 A;  3A5Y A;  3M0S A;  1K4U S;  4MZM A;  3HXZ A;  4C8Q D;  4MZT A;  3OYL A;  4ZTJ A;  1W6X A;  1MV3 A;  4HCC A;  2DDZ A;  4H2X A;  2RHS B;  1IGQ A;  3KXT A;  4M7A B;  3A1P A;  3VV0 A;  5GAM e;  2O9V A;  2CGH A;  2L0A A;  5KYY A;  2XKO C;  3E1S A;  3QJY A;  2HMA A;  2A0F B;  4ZIB A;  1W2B A;  3WVE B;  1GCQ C;  4E47 A;  3CCE A;  1LPL A;  2AZV A;  3MEA A;  4RTT A;  5M9O A;  4J9I A;  3ZL7 C;  4DOV A;  1MUZ A;  2EPD A;  1YJN T;  1QCO A;  1I5L A;  3JB9 G;  4JRK A;  4OMF B;  2MIO A;  4F7U E;  4HCB A;  5CCA A;  1NJ5 A;  2DQ3 A;  3T9N A;  1U3O A;  4C92 E;  1M9S A;  2KK4 A;  2C0I A;  2ENM A;  1X6B A;  3HFN A;  3RMS A;  1YFR A;  2NS6 A;  2YLC A;  5GJV B;  4EO4 A;  1OYX A;  3ZEH A;  2ZNI A;  4WCI A;  4J5Y A;  3CD6 A;  4TQD A;  4YRK A;  5GAN j;  3JCM X;  2LNV A;  3INZ A;  4L6V 5;  2WSE E;  4OMN A;  4XK8 E;  2VYT A;  5CKH A;  3ZBD A;  3HXU A;  1RLP C;  3CCJ T;  1Q7Y C;  3IQL A;  5LJ3 e;  1KC8 R;  2E5A A;  2KVQ G;  4AFQ C;  4TTV A;  1YHQ Q;  3VS7 A;  2GTO A;  3MEY A;  1Z9Z A;  3MKD A;  1SSF A;  3QZ9 B;  5GAN 8;  2DF6 A;  4J9D A;  3TEG A;  2YSQ A;  2QHS A;  1NBE B;  1ZUK A;  2GFU A;  5GAM g;  3I35 A;  4PJM A;  2D8H A;  4D6W A;  3KFV A;  3I56 T;  1HJD A;  2ALY B;  5HK0 A;  2LJ0 A;  3RKY A;  4KH0 B;  3MHX A;  4C8Q B;  3EGX B;  1NJI C;  5IXB A;  3NTK A;  4P75 C;  3X24 B;  1J5W A;  2EW3 A;  2QAZ A;  4RTY A;  4WJ4 A;  5GAN 2;  4MDX A;  4P71 C;  3PIP A;  5D6W A;  2JUF A;  3TU4 K;  1X56 A;  1VYV A;  2OTJ Q;  1VQ7 T;  1SER A;  4P72 C;  1VQM Q;  1K73 C;  2RJF A;  1JJ2 A;  4CRI A;  4C5I A;  2DU7 A;  2ALY A;  2EL9 A;  4ZN1 A;  3PFS A;  1K1Z A;  4C8Q A;  3PMT A;  1WYX A;  3OW2 P;  2ATC B;  1D3B B;  3GPL A;  1UB4 A;  4PLI A;  5IHI A;  4CI0 C;  4YP0 A;  3PE0 A;  4M7A F;  2E10 A;  1E6H A; 
#chains in the Genus database with same CATH homology
 5LJ3 g;  1K8A U;  3R07 A;  3OYE A;  2JNG A;  3OSS C;  3F70 A;  3A7A A;  2AKW A;  1N27 A;  1VQL T;  3CEY A;  3QYG B;  2RK1 A;  1QW1 A;  4DA4 A;  1E22 A;  2E64 A;  1O75 A;  1E24 A;  1D3B A;  3QUI A;  4PNO A;  3CCR A;  2XD0 A;  2ARS A;  1NJ8 A;  4E7H A;  4JRI A;  3CC7 T;  3I7F A;  2O01 E;  3QSU A;  1HC7 A;  1BIA A;  1GXI E;  3REU A;  2D9T A;  2DQ0 A;  2V8I A;  4YRE A;  3OW2 S;  4LDY A;  4M77 C;  2LVM A;  3UPU A;  4HCZ A;  3BW1 A;  2ZT8 A;  3M4G A;  3A8O B;  4H2S A;  5LJ5 e;  4N0A C;  1G3S A;  3E9G A;  5HKC A;  3TEH B;  2DTH A;  4QQD A;  3CCU T;  3G4S A;  2R5M A;  4A4H A;  2K3X A;  2LRQ A;  5CKF A;  5GMK h;  5HY6 A;  3RGL A;  3JB9 H;  3IAL A;  1M1K C;  3M53 A;  2WSC E;  4O5V A;  4M78 F;  3X26 B;  1ZHI A;  3OYA A;  4AH6 A;  3HFV A;  3TEH A;  2R5A A;  5DM7 R;  4ZGE B;  2RH2 A;  2BKD N;  2JTF A;  1Q82 U;  4A4E A;  4EMH A;  3QO5 A;  5GAN 3;  5GAM d;  4H2U A;  2I4M A;  2QEX T;  2ZPB B;  4Z02 A;  4P3N A;  1QP2 A;  4CH5 A;  3TRE A;  4OLF A;  1VIF A;  2MWP A;  4KUL A;  3DLL A;  3QXE B;  3UDC A;  5HK3 A;  4Q6G A;  3NET A;  4K86 A;  2ODR D;  3NEL A;  4WF2 A;  2CJ9 A;  2PME A;  3G1Z A;  5LJ5 g;  2ZPI B;  5GAO l;  4FT2 A;  3S6W A;  4XU2 A;  4HT4 A;  3PCO A;  4E51 A;  3C95 A;  3FEO A;  4EDU A;  3CPW A;  1YBY A;  2FYK A;  1EIY A;  3PGG A;  4YCW A;  2HAX A;  3M58 A;  1YHQ T;  3G71 A;  5LJ3 d;  2K57 A;  1VQ7 A;  2ZXF A;  1N9R A;  3DKM A;  2ZZF A;  4IKF A;  3VYG A;  1VQK T;  1Q81 C;  3MEU A;  4J7F A;  5GAN 5;  4BE1 A;  1Q7Y U;  3UFG A;  4CS2 A;  1N8R C;  4ATO A;  4PJO C;  2M1H A;  5GAN 4;  1NYR A;  1RI0 A;  5C0M A;  4M77 B;  4QQ6 A;  1M5Q 1;  1N6A A;  4YRS A;  1M1F A;  4F7U G;  2OTJ T;  1VQL A;  4ZGD B;  3C12 A;  4C92 G;  4E7K A;  2QTX A;  4LD9 K;  4QVD A;  4P3O A;  1QVG A;  3M9Q A;  1NJI U;  4EX5 A;  3CMA A;  3BFM A;  4N4I A;  2RHQ B;  1YJ9 T;  3HRI A;  1QVF A;  4PJO D;  3QO8 A;  3LW5 E;  4YRO A;  2HQE A;  3P8Y A;  1K73 U;  4YTL A;  3VQW A;  4H2Y A;  2ZIN A;  4TQF A;  3PIO A;  2E70 A;  3HFZ A;  3PZC A;  4J7I A;  2QA4 A;  2M16 A;  4M75 C;  3TCJ A;  2WSF E;  1VIE A;  5FU6 C;  2NLU A;  1G3Y A;  3OYD A;  3L2W A;  4YRJ A;  4IUQ A;  1KOG A;  2Y4X A;  3P8B B;  2HD0 A;  2D0Q B;  1KMM A;  4LDV A;  2RB6 A;  3OYN A;  2KSS A;  3L4G A;  2I4N A;  4C8Q E;  3CCE T;  3UGT A;  4UPA A;  3HXV A;  1L0W A;  4M75 D;  5CVI A;  3FC3 A;  2EJG A;  5LJ5 d;  1R8O B;  3PTA A;  2BIV A;  3CME A;  1W2B S;  2K5F A;  3PNW C;  4G84 A;  3J7A F;  4TVA B;  1KG1 A;  3CD6 T;  2XK0 A;  3RF1 A;  4M77 F;  3JAM E;  1VQ4 A;  4PJO B;  1ASY A;  1B7Y B;  3M54 A;  4RG2 A;  1M1K U;  4ZTZ B;  4CH3 A;  4QVC A;  3LX7 A;  3O8V A;  1DJ7 B;  4MMK A;  4OB1 B;  3AHU A;  2PUO B;  1EQR A;  3GOX A;  4M7D G;  4WJ3 M;  4P74 A;  3E9I A;  2DPP B;  4M7A D;  3ASK A;  2MF2 A;  5A0G A;  2ZT6 A;  3OYC A;  1USY C;  3HXY A;  4OP0 A;  4A53 A;  1Z7N A;  3OYJ A;  2IG0 A;  4RQE A;  2PVD B;  1KQ1 A;  3SWN C;  3OYK A;  3HKS A;  3MEV A;  4BI3 A;  4XQ3 A;  4FIB A;  3OY9 A;  2P0L A;  3A5Z B;  4UP9 A;  4M75 B;  4CH4 A;  4C5G A;  3OYF A;  1VQM A;  1EVL A;  1NJ2 A;  5FU6 B;  5FU7 C;  1IRE B;  2RJD A;  2DXT A;  4YRP A;  4J6X A;  4JDS A;  3P8T A;  4YRL A;  2RHI A;  3QG1 A;  3RIR A;  3RER A;  4PHC A;  5HGQ A;  1NYQ A;  5FLX E;  2R57 A;  4Y28 E;  3A5Z A;  3W3S A;  3FLG A;  4DOW A;  3CCR T;  1M8V A;  1AHJ B;  3WXM B;  4J15 A;  2EJ9 A;  2CZ6 B;  2P0Q A;  1Q81 U;  3E9F A;  1WYD A;  4EMK C;  2GQV A;  2FL7 A;  3QDR B;  4HWS A;  3OQ5 A;  2CYZ B;  2LCC A;  2EIF A;  3TEE A;  1VQN A;  1N8R U;  3HTZ A;  3G6E A;  1WLE A;  2Y4Y A;  2DXU A;  4E7L A;  3QKJ A;  3JB9 J;  5L8R E;  5GAN e;  2QHU A;  4C5H A;  4M78 D;  1EVK A;  1X2G A;  3S3M A;  2V8K A;  3QHS A;  4XTW A;  1B70 A;  4DPG A;  4ELY C;  4PJO F;  3HRK A;  3RKX A;  1VQ5 T;  2XIC A;  3NEM A;  1LOJ A;  2RHX A;  2F5K A;  1NE8 A;  1WNL A;  2VV5 A;  3G4S T;  1WU7 A;  1H4Q A;  2LTO A;  1HTT A;  4YRQ A;  4TVR A;  3JCM g;  1MHN A;  2QDY B;  4IUV A;  1E1O A;  2RHS A;  4A4K A;  5GAO r;  4M7A A;  5EG2 A;  3J80 E;  3JB9 I;  2GFA A;  1YB3 A;  4LDX A;  5C52 B;  4BB7 A;  1X2H A;  2X35 A;  4J6W A;  4OF1 A;  1VQP T;  1G5V A;  3OYH A;  3IKM B;  4V2S A;  2EWN A;  3RMQ A;  2K4Y A;  2LDM A;  3JCM Q;  1YFT A;  2RI2 A;  5GAN g;  3IG2 A;  5CR2 A;  1Y7X A;  4M75 F;  3HXW A;  1BI2 A;  2DXB A;  2ARU A;  4BDY A;  3E9H A;  2RO0 A;  4LVJ A;  2MWO A;  3NTH A;  2RI3 A;  3OB9 A;  4M78 B;  2ZIO A;  3M55 A;  2ZPE B;  5IN1 A;  3VU3 C;  3OD1 A;  4KBM B;  3V8J A;  2XID A;  1OI1 A;  1W66 A;  1UGS B;  1I4K 1;  3G71 T;  4XTZ A;  1YJW A;  2QQA A;  4Q15 A;  3OYI A;  3HHT B;  5GAN 7;  2J3L A;  4II1 A;  4KR2 A;  3CCL A;  3OS2 A;  3UT1 A;  4EMK B;  2G3R A;  1H4T A;  4XEM A;  2DK3 A;  3CPW S;  4M78 A;  3MF1 A;  2DU5 A;  1YIJ T;  4DQ2 A;  2PVG B;  1M90 C;  3CBP A;  4QVZ A;  4C8Q G;  1SRY A;  4X34 A;  3FDR A;  2E41 A;  2A3L A;  3UGQ A;  4YCU A;  1BIB A;  4GY5 A;  2RJC A;  1WPY A;  3JB9 F;  5GAN 6;  3R6O A;  5C53 B;  2FVU A;  1KHC A;  5GMK m;  3CMA T;  5KCH A;  4P73 C;  2ZZD A;  2LX9 A;  3BJU A;  3LWH A;  3JSC A;  2VGM A;  2E1H A;  4A54 A;  1QVG S;  1FYF A;  1OZ2 A;  2VXE A;  1SET A;  2JVV A;  4C92 C;  4CS3 A;  3L1A A;  4ZN3 A;  3JCM d;  2YHT A;  2QA4 T;  1H4S A;  1VQ5 A;  3LGL A;  4PJO E;  3G7Z A;  1BBU A;  3GNG A;  2RHY A;  4NCX A;  1C0A A;  3JRZ A;  4FM4 B;  1G5I A;  3A8H B;  2XDD A;  2ZCE A;  2Q7G A;  3QPH A;  5CQY A;  3CC4 T;  3VQY A;  1BI3 A;  5J3B A;  3OSV A;  4M77 D;  4LDU A;  1E1T A;  4C0F A;  5A0L A;  3RAC A;  2LCL A;  4EMG A;  1ZBX A;  1YIT A;  1VQP A;  5D6Y A;  4QQG A;  1BI1 A;  3CME T;  3A7R A;  4J8O A;  2M0O A;  4UC4 A;  5DLQ E;  2IY5 B;  3P8V A;  1Y07 A;  1VUB A;  4M75 E;  4P75 A;  4BUG A;  2A8E A;  3JCM V;  2PQW A;  3ERR A;  1VQ4 T;  4P71 A;  1OZ3 A;  2RK2 A;  2HNI A;  3Q1J A;  2ZTG A;  3HL8 A;  4P72 A;  5ELO A;  2DTI A;  4UP7 A;  2KDS A;  1ASZ A;  2E5Q A;  2M9U A;  3A8L B;  4HA8 A;  4ZTU B;  1X01 A;  2XDP A;  1Y96 B;  3V7C A;  5K1X A;  3QTC A;  4OGC A;  2EJF A;  4H2W A;  1WQW A;  3MP1 A;  4UP8 A;  1IZ6 A;  3V8K A;  2CJA A;  1VQ6 A;  1FX7 A;  1YIJ A;  4C0Z A;  1Y96 A;  4F7U B;  2ZZG A;  1NZ9 A;  5GAO q;  2ZPG B;  4XU3 A;  1UGP B;  3M5A A;  5GMK j;  4RKU E;  3QYH B;  1KD1 C;  4M7A E;  5GMK i;  1KQ2 A;  4PG3 A;  4CS4 A;  4M7D C;  2PUK B;  2RHU A;  2BUD A;  1VQM T;  4L59 A;  3LSQ A;  1U1T A;  3X25 B;  4YRR A;  3A74 A;  5J26 A;  2Q7H A;  2F69 A;  3RL6 A;  3OMC A;  4M77 A;  4L87 A;  4HKE A;  1B76 A;  2EYQ A;  1P92 A;  2L5Q A;  4N4G A;  1KHI A;  4KT0 E;  4N0A A;  2CIM A;  3CCS A;  2B8A A;  3QII A;  3OW2 A;  2KAF A;  3DB4 A;  3A8M B;  2XI9 A;  4M7D D;  3OBY A;  1JJC B;  5FRO A;  4KQE A;  1M90 U;  2RHQ A;  4NL2 A;  1VQN T;  2DO3 A;  3G6E T;  1O9S A;  3CCM A;  2CZ0 B;  2JZ2 A;  3RKW A;  3HPW A;  3A7U A;  2P5I A;  4FU6 A;  3OYB A;  3V7S A;  5CKE A;  2EQK A;  3CC4 A;  2JOY A;  2VUB A;  2DEQ A;  4OB2 B;  3M57 A;  5GAO p;  4XTY A;  4M78 E;  2OTL A;  2K3Y A;  4A4F A;  4TVW A;  1XOV A;  3M4P A;  3MET A;  3M56 A;  4OVA A;  1PYS B;  4L5G A;  3C94 A;  3A8G B;  4BI8 B;  1KC8 C;  4BY6 C;  2PMF A;  4F7U F;  4OB0 B;  4XTU A;  4C92 F;  5CK9 A;  3CCV A;  2P0P A;  12AS A;  3HY0 A;  4JLI A;  1VQO A;  3GP8 A;  2RD1 A;  3RES A;  1NPR A;  2DXC A;  1QF6 A;  1PYS A;  2MI6 A;  5GMK l;  4RCB A;  1B34 B;  4HWT A;  1M4Z A;  4TVA A;  2RI5 A;  1V29 B;  3L2U A;  4M7D B;  2Y90 A;  3CBO A;  4JRP A;  1NJ6 A;  1G5H A;  5CKB A;  4IUT A;  4PJO A;  1PSE A;  4LVK A;  3FIF A;  1B7Y A;  2X4J A;  3DLM A;  5KH6 A;  2E6N A;  2CJB A;  3JB9 D;  1YJW T;  3FRN A;  3JCM h;  1N9S A;  3JCM f;  3CCL T;  4CH6 A;  3L2R A;  3ICA A;  2KMT A;  2LQ8 A;  3BDU A;  3L2Z A;  2JN0 A;  1G51 A;  1G3W A;  3GIB A;  1YI2 A;  4PL6 A;  5DY9 A;  4C0D C;  1JJ2 S;  4FT4 A;  1BYM A;  2CZ7 B;  2K5L A;  3CCQ A;  1Q86 C;  3CXC A;  5FRN A;  1RIQ A;  3QO7 A;  3OYY A;  4BD3 A;  1N9W A;  2O4X B;  2XHC A;  3VKI A;  2Q5H A;  1MGQ A;  4M75 A;  1VQ9 A;  1S72 A;  2KY9 A;  1YFS A;  4C8Q C;  2DKG A;  5GAM h;  2ZIM A;  5E3I A;  4BI4 A;  4M75 G;  5GAM f;  3ZFJ A;  2I4L A;  5CO7 A;  1X54 A;  4WI1 A;  4C0G A;  2P4T A;  4MDW A;  1KD1 U;  1H4V B;  2L8D A;  1QVP A;  3M59 A;  1LJO A;  2F5T X;  1X55 A;  3BDL A;  2MMP A;  1BI0 A;  3CMQ A;  3VYH B;  1EOV A;  2G4C A;  4JJN K;  4M7D F;  3FJP A;  3L42 A;  2K5I A;  2DAQ A;  2ZGW A;  2QXF A;  1UGQ B;  5LJ3 h;  4ELZ C;  2AMC B;  2X4X A;  4JLG A;  5KCO A;  4R55 A;  5LJ3 f;  1K9M C;  2QHT A;  3EFS A;  2LT4 A;  3CC2 T;  4M7A G;  3MQZ A;  3ME9 A;  1UGR B;  1H3Z A;  1X75 C;  4YRG A;  3ER0 A;  1YIT T;  3OMG A;  4GLK A;  4KR3 A;  1JRI A;  3N5B B;  2AMC A;  4RMO A;  1QP3 A;  2QQB A;  4M77 E;  5CQX A;  3SWN B;  3UWN A;  3WVD B;  4YRN A;  1KQS A;  2ZNJ A;  3VBB A;  2RHZ A;  3CPF A;  2QI2 A;  1I8F A;  1USY A;  1BBW A;  3H8Z A;  5FU7 B;  1UEB A;  4C0D B;  3RUX A;  5GAM j;  4B9W A;  2Q7E A;  3SWN A;  2L3R A;  1I81 A;  3A32 A;  3S3N A;  3IKL A;  3UH0 A;  2QQS A;  1U1S A;  1QE0 A;  1HK9 A;  4X9C A;  1KC8 U;  2EQM A;  4IUR A;  5CAI A;  1VQ6 T;  1FWZ A;  5ELN A;  1YGB A;  2RA2 A;  2XGT A;  2A7Y A;  3OBW A;  4P3P A;  4M78 G;  2IVW A;  4Q5W A;  4HVC A;  4O2D A;  2AKW B;  4LDW A;  4TWA A;  4OGE A;  3VUB A;  2E65 A;  4J6Y A;  5LJ3 j;  4EMK A;  2DD4 A;  3QNE A;  1Z7M A;  2C7I A;  3P8H A;  5J39 A;  4P5N A;  4FL6 A;  4ZTF A;  3PMI A;  5LJ5 h;  4H2V A;  3LC0 A;  1ATI A;  2XTI A;  5LJ5 f;  3QZ5 B;  1VQ8 A;  5C6S A;  1VQZ A;  4XU1 A;  2XU8 A;  1WQ7 A;  3E19 A;  3OA6 A;  2VGN A;  1WGS A;  1GGM A;  3CCS T;  1RL2 A;  3OS5 A;  2FHD A;  3URG A;  5C51 B;  4ME7 A;  1HXD A;  5KE3 A;  2QHV A;  3I55 A;  4TVY A;  1QVF S;  5D6X A;  3PT9 A;  4OB3 B;  1ADY A;  2MAM A;  4JS5 A;  4RMF A;  5DLO A;  4E7J A;  3CCM T;  2YLB A;  1FXX A;  1Q86 U;  4YRF A;  3NFC A;  4M7D E;  2X4W A;  2LQK A;  4LVM A;  3L2V A;  4X5O A;  4HWP A;  1B8A A;  2QQ9 A;  4C92 D;  3VQV A;  3MP6 A;  5GAN d;  3S3O A;  2OTL T;  3CC2 A;  3LGF A;  1XNI A;  2ART A;  1YJN A;  5A2Q E;  2ODR C;  4G85 A;  4H02 A;  4HWO A;  4C8Q F;  3JCM c;  1KMN A;  1TH7 A;  4MML A;  2ZZE A;  4XEO A;  2AHJ B;  2RJE A;  3JCM P;  3DB3 A;  1M1G A;  2C8M A;  4QW2 A;  3HXX A;  3M4Y A;  1ZQ1 A;  2R58 A;  4PKC C;  3CCV T;  3WQZ A;  4A4G A;  5GMK e;  5KE2 A;  3P8D A;  1VQO T;  2ZT5 A;  2I2L A;  11AS A;  4K88 A;  3CCJ A;  3KFU A;  3PCO B;  5LJ5 j;  3MCA B;  3V7R A;  3OYM A;  3REX A;  2VC8 A;  2E3C A;  1EIY B;  3OS1 A;  1WJR A;  2IY5 A;  1K9M U;  3HRU A;  4YRC A;  1XTD A;  5KNN A;  3I56 A;  1W4S A;  5AYF A;  4C5E A;  1U8R A;  4PLL A;  4BWA A;  2L89 A;  2DZ9 A;  2ZPH B;  1YCY A;  2XDB A;  4R56 A;  3LH0 A;  4C92 B;  5IAY A;  4XTX A;  5I21 A;  4ZGJ B;  4VUB A;  2VXF A;  4JS4 A;  3OYG A;  4P73 A;  2HBP A;  2LC4 A;  4JRQ A;  5I2M A;  2RM4 A;  4O6J A;  3GLX A;  4BE2 A;  1YI2 T;  4LVI A;  4F7U A;  4LVL A;  4P74 C;  1JBM A;  4C92 A;  3EFR A;  4RQF A;  4B9X A;  3CCQ T;  5GAO n;  1WJQ A;  3C4S A;  3SFM A;  4X9D A;  2E12 A;  5IT9 E;  2D6F A;  4M77 G;  1VQ9 T;  3QBY A;  1S72 T;  2CS7 A;  3HFZ B;  1H64 1;  2DJZ A;  3M4Q A;  3SDZ A;  3OS0 A;  5CIU A;  5K1P A;  2XG8 D;  3CXC S;  2EAY A;  3CC7 A;  3J81 E;  1X6O A;  2EKO A;  3MEW A;  3VUZ A;  4NOY A;  3X20 B;  1EFW A;  1SES A;  2C06 A;  4RDX A;  4RG8 A;  3MF2 A;  1NPP A;  4HWR A;  3DSQ A;  4YDQ A;  2H3J A;  3KUF A;  2PVO B;  5FRM A;  2EQU A;  2OAU A;  4BAC A;  1JJC A;  2E6Z A;  3L4G B;  4JUV A;  2EQJ A;  3GNF B;  5F5W A;  3CCU A;  2GF7 A;  3GF5 A;  2JTM A;  2V8J A;  3EAE A;  2ZCF B;  3HFO A;  4YRI A;  2X4Y A;  2KQW A;  4YRM A;  1ADJ A;  3HSB A;  4KUI A;  4FSX A;  3JCM J;  4IUU A;  3HY1 A;  4KUD K;  2QEX A;  3MO8 A;  4YRT A;  2DVE A;  4Y91 A;  2Q5I A;  2CKK A;  4M7A C;  3X28 B;  2K2V A;  2WAC A;  3NTI A;  3KBG A;  3VJP A;  3HRS A;  4XAX B;  1LNX A;  4BE0 A;  3VQX A;  4YYE A;  1KQS S;  3QJ6 A;  1K8A C;  4NS5 A;  2ZPF B;  3CBM A;  3FB9 A;  2DZC A;  1B34 A;  3LYI A;  4PJO G;  2DIQ A;  1PSF A;  2DD5 A;  5LL6 S;  4M7D A;  4XTV A;  3HP9 A;  4YCV A;  1YHQ A;  1EIF A;  3JCM W;  1XQH A;  4EPC A;  4HT9 A;  3H6Z A;  3L2Q A;  1LYL A;  1NNH A;  4H2T A;  1VQK A;  3LWI A;  4BDZ A;  2ZR3 A;  2HQX A;  2DIG A;  2J3M A;  2DTO A;  4HT8 A;  5A0D A;  2FB7 A;  4E7I A;  2GCX A;  3LSS A;  2I4O A;  2ZR2 A;  1NJ1 A;  2PU9 B;  2P0K A;  1JB0 E;  2CZ1 B;  2EFI A;  5GAN h;  2OTJ A;  3HRT A;  1BKB A;  4J83 A;  3SB2 A;  3QO3 A;  5GAN f;  4BW9 A;  4N4H A;  1Y71 A;  3LLR A;  3SD4 A;  3JCM e;  4LNS A;  3A31 A;  4M78 C;  3NEN A;  4K87 A;  3TUP A;  1VQ8 T;  1YJ9 A;  3MP8 A;  5I2S A;  1WJS A;  3V8L A;  3BY7 A;  2QQR A;  4MZP A;  4XU0 A;  3JCM b;  2O4X A;  5GAO m;  2YRV A;  4LD6 A;  4RCC A;  4H2X B;  1G3T A;  1B70 B;  2LT1 A;  4BY6 B;  2ZT7 A;  4YPF A;  3I55 T;  4IUP A;  1Q82 C;  4NL3 A;  1IL2 A;  3A5Y A;  4MZM A;  3HXZ A;  4C8Q D;  4MZT A;  3OYL A;  4ZTJ A;  4HCC A;  2DDZ A;  4H2X A;  2RHS B;  3KXT A;  4M7A B;  3VV0 A;  5GAM e;  2CGH A;  2XKO C;  3E1S A;  3QJY A;  4ZIB A;  1W2B A;  3WVE B;  4E47 A;  3CCE A;  5M9O A;  3MEA A;  4DOV A;  1YJN T;  1I5L A;  3JB9 G;  4JRK A;  4OMF B;  4F7U E;  4HCB A;  5CCA A;  1NJ5 A;  2DQ3 A;  3T9N A;  4C92 E;  1M9S A;  2KK4 A;  3HFN A;  3RMS A;  1YFR A;  2NS6 A;  2YLC A;  4EO4 A;  1OYX A;  3ZEH A;  2ZNI A;  4J5Y A;  3CD6 A;  4TQD A;  4YRK A;  5GAN j;  3JCM X;  2LNV A;  3INZ A;  4L6V 5;  2WSE E;  4XK8 E;  2VYT A;  5CKH A;  3ZBD A;  3HXU A;  3CCJ T;  1Q7Y C;  5LJ3 e;  2E5A A;  2KVQ G;  4TTV A;  3MEY A;  1SSF A;  3QZ9 B;  5GAN 8;  3TEG A;  2QHS A;  2GFU A;  5GAM g;  4D6W A;  3I56 T;  2ALY B;  5HK0 A;  3RKY A;  3MHX A;  4C8Q B;  1NJI C;  3NTK A;  4P75 C;  3X24 B;  1J5W A;  4WJ4 A;  5GAN 2;  4MDX A;  4P71 C;  3PIP A;  5D6W A;  1X56 A;  2JUF A;  3TU4 K;  1VQ7 T;  1SER A;  4P72 C;  1K73 C;  1JJ2 A;  2RJF A;  4CRI A;  4C5I A;  2DU7 A;  2ALY A;  2EL9 A;  4ZN1 A;  3PFS A;  4C8Q A;  3PMT A;  1D3B B;  3GPL A;  1UB4 A;  4PLI A;  4CI0 C;  4YP0 A;  5CKD A;  4M7A F;  2E10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...