4DQ2A

Structure of staphylococcus aureus biotin protein ligase in complex with biotinol-5'-amp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4dq2A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dq2A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dq2A02
1LVAA 1FX7A 4XU2A 2K57A 3HY0A 3TQNA 4RB0A 2DQLA 2YU3A 3FMSA 1SAXA 4U88A 2P7CB 4ZYGA 1K7AA 3FHZA 1B1BA 3CUQB 1S6LA 3RI4A 2XTIA 2VE9A 1F5TA 2EV6A 1U5TB 3DF8A 4EMGA 5DUKA 4PNOA 1ZLKA 2XHKA 5GANg 3FX3A 1LDDA 3EQLF 2HYGD 1SRYA 4KIFA 4A0ZA 1G3SA 1ZG1A 1X01A 2DLLA 1Y96A 2ETHA 2RN7A 4S05A 3MF1A 5F5WA 3LA3A 1UFMA 3DV8A 3V8LA 1BBYA 5BOXA 3JCMg 2ZT5A 3G1ZA 1YQAA 3JCMV 1PYSA 1UHMA 3V7RA 2DFIA 4J5YA 4M9XA 2P5IA 3DXJF 3GFMA 1WPYA 1YW9A 3MFKA 1I27A 1NHAA 3PCOB 2AXLA 2ZZGA 3HOTA 1D3BA 2ZXFA 2D1HA 4U0YA 5CVUA 5EEGA 2V79A 2O6GE 4EGYA 1LNXA 4M77G 3FMQA 3JB9F 3A74A 2XAJA 2PMHA 1KA8A 2DT5A 1FZPB 1USSA 5K5OA 1FOKA 1U5TC 1YB3A 4UNOA 3HFVA 1WQ2A 2EJFA 2AMCA 3RJPA 3Q5FA 4UUVA 2ZZFA 1HKSA 5E1XA 2DKGA 3WTUC 1RUNA 3N4MA 1YO5C 1WRJA 4LJZF 2P6SA 2XVCA 2GZWA 1Z05A 1MGQA 3AHUA 5CYVA 2IY5A 3C18A 3FXUA 3MZHA 2E41A 1QF6A 1QNTA 2FMYA 2E1HA 3WTXC 1J5YA 1N9WA 2ZFWA 4UP9A 2IY5B 3I54A 4WJ3M 1KU3A 3M4PA 4N0AA 4M7DG 1RNLA 2HKXA 3JB9J 1B70B 5I21A 3NEUA 5IT3A 2FEZA 5ICEA 1IN5A 4FT8A 5GAMh 3JAMZ 2RB6A 3ELKA 1YFRA 1BI0A 1R5GA 4L87A 2CFXA 1G3WA 2M30A 3CUOA 1NNHA 5LJ5d 3GWZA 3GXOA 3I58A 2CJ9A 2DDZA 2JZYA 1X2GA 1IW7F 1HSJA 3ZN1A 1YTYA 1LB2A 4C8QA 5FFXA 1LOJA 5LGTA 3KE2A 3WODF 5K1XA 4KFCA 5GAN7 2QYOA 2VXZA 5LEJA 4LLNA 3R60A 1R23A 1A04A 1WU7A 4M74A 3NELA 2E1NA 1ZGAA 2UXNA 2O8XA 1BBWA 5E8GA 1IL2A 1W4MA 2H6BA 3E6MA 5GMKl 1KMMA 2RVCA 3GFLA 1CF7B 4Q48A 4A54A 4UP8A 1B8AA 1IN6A 1PDNC 2ADUA 4HZFA 1FC3A 4WXDA 2ZKZA 1TNTA 2OZ6A 1EIYA 4AIHA 5HS8A 5HDNA 4OIQF 3V8JA 1GGMA 5DCMA 5C52B 4CYDA 2V6CA 2RHQB 4G94A 4G8XA 4G7ZF 3VQVA 1XDSA 2RNJA 1FP1D 5HLIA 1G51A 3I0TA 4IJAA 5D4SA 2VOPA 4HVCA 2QQBA 5D5UB 2ISYA 3I59B 3VQYA 2WTEA 3A31A 2EV5A 1FYKA 3J81Z 3QP5A 4IXAA 3REOA 2HS5A 3B73A 1OR7A 2LKPA 3HY1A 4RB1A 2CYYA 4ZH4F 2J5OA 1SMTA 3O2PE 2ODRC 1J2XA 3RDIA 1S3JA 4C92G 3EUHA 2L3DA 2VC8A 5FLXZ 1O3RA 3O6BB 2QHUA 3GO5A 3A5ZA 2HYFA 1I81A 5LJ5f 2ARUA 4YRJA 2YR2A 4TVAB 2DI3A 5FFZA 2WV0A 1BIAA 3BWGA 4RDXA 1LYLA 4TQDA 3L4GB 4TQFA 3IRRA 3N97A 4UHTA 2XGXA 1JRIA 2AMCB 4HW0A 4K2EA 1JJCB 4HLXA 1U2WA 2Y48A 3FZVA 5L3EA 1DPRA 2MBFA 1TH7A 2BBYA 4F7ZA 1E17A 4NQWA 3KFUA 5ILSA 4BAYA 3WTTC 1SFUA 1E1TA 5D8KB 2CJAA 3JB9D 1B7YB 1EH8A 2RC4A 2K7LA 1U1SA 4RS8A 2O3FA 4M7AD 4M77D 2EJGA 1USYC 5LRRA 2B0LA 3WGIA 1KGSA 1E22A 3CMQA 1J0RA 2X4HA 5JVTA 3JCMX 3RUXA 1EVLA 2IVMA 1JXSA 5HDGA 4XLNF 4U7BA 2JT1A 1U8RA 5K5RA 1WI9A 3RKXA 3P9IA 3HFZB 2JPBA 3CJNA 4M7DF 5GAOn 1YLFA 2FQ3A 3PQKA 2IA2A 2MLKA 2E10A 4P3NA 1UCRA 3F8BA 3P8TA 3QP6A 4EMKA 4MHGA 4IRHA 5A2QK 5HLGA 4O6JA 4YRFA 3BPXA 1Z6TA 2H27A 4Q4ZF 4X9CA 4L9JA 4QWQA 3OV8A 4M7AG 1AOYA 1B34A 4L9NA 2Z3YA 4YRIA 5LJ5j 4RGUA 4X5OA 3QRFF 3O3KA 2VN2A 1PP7U 1J75A 4YYEA 4XSXF 3QO7A 3NQOA 3JB9I 1N9SA 5GANh 5ICFA 4EJTA 4HWOA 1QQIA 2RA2A 5E3IA 2F5CA 3JSOA 1WYDA 1SD5A 2OD5A 2UWMA 3IKTA 4M78D 2EL9A 2ZCEA 2ZIOA 4IHSA 2OU2A 4M71A 5GMKm 2FRHA 5LHGA 3W3SA 3BOQA 4G9YA 4HX4A 3KCCA 3OOPA 1F4KA 2EA4A 3UH0A 4PJOC 2MH2A 4I0BA 4YRTA 4P5OA 3KLOA 1E2XA 2LDUA 2YSRA 5D5WB 3LFKA 4XU3A 3C7JA 5L3GA 4Y17A 3K9TA 4XLPF 4P96A 1G3TA 2QBYB 2DU7A 1HXDA 4C8QC 2I4LA 4YRLA 4ZZDA 5D4RA 1KQ8A 3TEHB 3CTAA 2HWVA 1H4TA 4AD9A 4RQEA 4H2WA 1YCYA 4U0WA 3S2WA 4M78G 1XCBA 4RB2C 3QU6A 3FB9A 4K88A 5CJ9A 3KP3A 4ZYDA 1SD4A 4YRMA 4OMZA 2J5PA 3J80K 3JSPA 1S8NA 4YFNF 4I7HA 4F7UB 3M1EA 2XIGA 3NENA 2H94A 4KIBA 2E65A 1KQ1A 2EFPA 3FJPA 1NJ8A 5F64A 3CO6C 2ZR2A 1R58A 3QOPA 3QO8A 4H2VA 3G73A 3ISPA 2MA3A 5H6QA 3IRQA 5GAMg 3Q9VA 1QZZA 1BJAA 1SD6A 3VFZA 3DSQA 5FGMA 2C6YA 1NJ5A 4O2DA 1U1TA 2L01A 4BW9A 3VB2A 5DYMA 4ESFA 4TVAA 4IPAA 4X9DA 2FNAA 4HF0A 4EJOA 3F8CA 4EQQA 2KKOA 2Y75A 3L4GA 1EFWA 3KP4A 5ILVA 1IN8A 3V7SA 5FD6A 1AWCA 4J15A 2ZNIA 2CGPA 1BOAA 4LD5A 2JPCA 1I5LA 1CF7A 2IA1A 4M7AF 5DCFA 1QGPA 4P71A 4UPAA 3HUGA 2CJBA 4HYEA 3TKYA 2PMUA 5GANd 1EIYB 2E64A 3SZTA 4OINF 3TO7A 4CS2A 4ENKA 2CO5A 4YCVA 2IRFG 1EV7A 5GAMe 1EVKA 3ZMVA 3ERED 3SWNC 1J5WA 4M78B 3RF1A 4KQEA 1UHWA 2E3CA 5HS9A 4PDKA 3IKVA 1ZAOA 4GGGA 3I59A 3M9AA 3ZMTA 2I2LA 2DEQA 1GXQA 2ZZEA 3EYYA 1DPUA 1F9NA 4EGZA 3MAJA 3IWZA 5TRDA 3HFOA 4M7DB 2FBIA 1L0OC 4CDGA 2QHVA 4H2YA 2ZCWA 3KZYA 2A3SA 2F2EA 2K27A 5AONA 4YRSA 5L3DA 1R36A 2PQ8A 2J3LA 2Z9OA 3A7UA 2W57A 4J6XA 1TW3A 3HIFA 4L18B 4KA4A 3U1DA 3ABUA 4RGXA 4CH5A 2YLCA 3CUQA 2LF7A 4HAMA 4HOBA 4U0VA 1QBJA 4NHJA 5J8FA 3HTUA 3KP5A 4I01A 2ISZA 2QENA 2FSWA 3JCMQ 2CW0F 5ELOA 1FYMA 1BI1A 4C92A 4PJOE 4A5MA 1B6AA 3FMRA 3TGNA 4EMSA 5E1WA 1FPQA 4YRQA 4BXUA 4F7UA 2YX7A 2ARSA 3C1DA 2ELHA 4AIJA 1LDKB 3L1AA 1E1OA 1I1GA 3VODA 4G6DA 3ULQB 3VU3C 5J6XA 2P4WA 2CG4A 4WXHA 3AAFA 2CQKA 4WWCA 4KMUX 2DU5A 2HEOA 2HGCA 4NL3A 3RYPA 5LJ5g 4P73A 5H20A 1TTYA 2IP2A 2ZR3A 2FF4A 2P7VB 1MGTA 3WTWC 3IHUA 2NAZA 1HKQA 1Q1HA 3LAPA 3B02A 1W7PB 2VXEA 1P2FA 3T0YA 3F8NA 2G4CA 1FBQA 2IT0A 2A5YB 1W7PA 4F7UE 1ULYA 1HSTA 3QUIA 5GAMd 3HXVA 4I2OA 1ON1A 1B9NA 4EMKB 4MQVA 4K87A 1WLEA 1SMYF 3QHSA 2YLBA 4H2XA 2VE8A 4ENMA 1KU2A 2G9WA 1HW1A 4CZZA 2QVOA 2RD1A 1BM9A 2TDXA 4HBLA 2ESNA 1Z6RA 4KNYA 3VQXA 2OBPA 3LA2A 3GVAA 4M78F 3A32A 3SQNA 3T1BA 2G7HA 2I4NA 2XAGA 2FMLA 2UXXA 2NRAC 3KLNA 3WTVC 3H3UA 4ZZLA 2JSCA 3IALA 4EVIA 2ZIMA 2IW5A 1HC7A 3FF5A 6PAXA 2M1BA 2DZCA 2ZGWA 4RCCA 1JE8A 2ZMEA 4HLYA 4FHTA 4LLLA 5HDKA 3EDPA 5ICCA 2ZT7A 4L5IA 4KDPA 5C51B 4M7DC 3COAC 1P6RA 3UGQA 1C0WA 4P73C 5LBQA 1FNNA 1W5TA 2KJBA 4G7OF 1U3EM 3RERA 2NNNA 4Q47A 3HTZA 3T8RA 1WNLA 5GAOm 2MLGA 1LEAA 3ICAA 1YFTA 4D0PA 3ZMSA 4YP0A 2QBYA 1G3YA 4YROA 2FA5A 2DTIA 3ZP5A 4MMKA 4LNSA 4P74C 5F1RA 3HSRA 1DDNA 1DP7P 2CSOA 4HA8A 2DTOA 1BN5A 1QE0A 3GFJA 2M45A 2K02A 3MCZA 4EM2A 4CXFA 5EEHA 3K2ZA 1ZG5A 1HKTA 3HRUA 2FBHA 2ZXJA 2FYKA 2QHSA 5FD5A 4ENNA 2Q0OA 2ACJA 5L3CA 4P9FA 3W6KB 4DPGA 1IXSB 2GXGA 3TOAA 2Z33A 4L0YB 4NOYA 3WTYC 4ZTZB 3WE2A 2HR3A 4JBAA 5K5QA 1BC8C 5HVQC 4M75D 4C8QF 3MEXA 2A68F 3BPVA 3V4GA 4M9ZA 1PYSB 2BV6A 3BDDA 4YPFA 5E20A 5JFRA 2VODA 4XEOA 4YIFA 5LHHA 3HXXA 2IA0A 3EETA 1D3BB 2KIFA 1XSDA 4PGGA 3DP7A 3TO9A 1SFXA 3JTGA 4IHTA 1Z7NA 4JQFA 4M72A 2DXUA 4JLIA 1T39A 4DQ2A 3HSEA 5CVIA 2VONA 4TTVA 3F23A 2MC3A 1VTNC 4FX0A 2HFHA 4CS3A 4AWXB 3JW4A 1ONVA 1EH6A 3A7RA 1SFEA 4XBFA 3FWEA 2Q7GA 4P72C 4Q5SF 4H02A 4Q6GA 4WJ4A 2ZINA 1YS6A 4PHCA 1ZREA 3UGTA 2RGVA 1R5HA 1NYRA 2L02A 11ASA 1ZHFA 4CICA 1QO0D 2XAFA 1S7OA 4ASNA 4N0BA 1P92A 2IPQX 5BPIA 5HS7A 1UB9A 5LHIA 2FXAA 2M8EA 1ZH5A 3BJOA 3CUQC 3HRMA 1B70A 3KP7A 1U6GA 2WC2A 4KMFA 3HTSB 2ZNZA 4BNCA 3I7FA 2ODRD 1R1VA 3SHFA 5K1PA 3JCMh 3WTSC 5FO5A 2EJ9A 4M7DA 3F21A 5CVRA 4CO8A 1IRFA 1IUYA 2DPUA 4P55A 5BS6A 1OYIA 2PN6A 5GAMj 4ZTUB 2DQRA 3TDZC 4CHUA 2VBXA 2PI0A 2XAQA 3QSUA 3QU3A 3HOSA 2FB7A 5DD8A 2WWYA 3HXWA 4KR3A 3I4PA 3IL2A 2COMA 4M75A 3H92A 2PG4A 4XQ3A 3E6DA 1JBMA 3NRVA 3RIRA 4M78A 5DCMB 3GEZA 2DQ3A 4OLFA 3E5UA 3DEUA 5A2QZ 3LQQA 1D5VA 1ZRFA 3M8FA 1ZARA 1IXCA 4I09A 3LSQA 3TOBA 4RGSA 4YFXF 4J6YA 2QQ9A 3E5XA 1XMAA 4M7AC 4UVAA 2PBIA 1NJ2A 4TWAA 3DQVC 3BP8A 3BZ6A 2ESHA 2VT2A 5D5XB 3VEPA 1EH7A 1KQ2A 1O3QA 3PGGA 4YCUA 1NJ6A 4M73A 3I64A 4EMKC 4WCGA 2FU4A 2VC1A 4LFUA 1HW5A 12ASA 1MJ9A 2O03A 3LQRA 2P0LA 4GYIA 3SXYA 4XTVA 4RAYA 1R1UA 1X2HA 1W66A 2DBBA 1FY7A 4XEMA 1TQPA 1B76A 1X3UA 2RHSA 5GANe 3WGGA 2J3MA 3ERRA 5GAN8 4P3OA 3QO3A 1ZN2A 3E97A 1N9RA 4C92B 4TVWA 1X55A 4EV0A 4CH6A 2YHTA 4BWAA 4XTZA 4PG3A 4C8QE 3K69A 4RAZA 1T6SA 3HRSA 1O7LA 5GMKi 4H2TA 4NB5A 1JJCA 4XSZF 1GXPA 3BJAA 1X54A 4M75C 2CWEA 1CGPA 2O61A 4PJOA 1P4WA 1IRGA 1BIBA 2PEXA 1K6OA 2GQQA 3V8KA 1ZG3A 1OYYA 4G85A 3DKWA 2DU9A 3HSFA 4TV7A 5LGUA 1FP2A 2RDPA 3P9KA 4PJOG 1G5IA 2E7WA 4P72A 4EMHA 2HQNA 4R79A 2DO7A 5J8CA 4OU0A 2QTXA 2E7XA 3JCMJ 2L54A 1FWZA 3GZ6A 1HK9A 5DV5A 2QWWA 4LMYA 1ZRCA 4ESBA 3L00A 5DUIA 1I6XA 5IT9K 3LWFA 2GWRA 4HT9A 2EK5A 2HKOA 4C92D 1ODDA 3H3ZA 2V9VA 2ZTGA 2V1XA 5BQTA 1R7JA 1T98A 1K79A 1Z91A 5E8IA 3GW2A 2M5WA 3ECHA 1R1TA 4XU1A 2OQRA 5ED4A 3F22A 3Q9SA 1L0WA 3GFIA 4KICA 4XTUA 1PUEE 4C8QG 4RMFA 3HRKA 3HFNA 1C0AA 5JHUA 2W24A 3FM3A 4OIRF 3MQ0A 3P8VA 3TDUC 4HWPA 1T0FA 1LJ9A 1FSHA 5FB2A 4PCQA 5LGNA 3WG9A 1J59A 3VQWA 1MD0A 4PGHA 3BDUA 4P75C 4M78C 4H0EA 3K1NA 3RESA 4YRCA 1J7KA 3VOEA 4WK8F 1W7PD 3HHHA 1ON2A 2LNBA 1YYVA 3FIFA 2JN0A 5LJ3j 3M4GA 1I8FA 4BHCA 5KVRA 4A2UA 4I02A 1ASYA 2Q5HA 5KNNA 2C8MA 4GCVA 3E3VA 3MWMA 3HHGA 3FM5A 4OMYA 3JCMc 4Y13A 1D8KA 3ML6A 3RGLA 4MMLA 5LLQA 3F6VA 3CDHA 5F6FA 1KU9A 5HOOA 4H2UA 3V7CA 4KUMA 2JRTA 5CAIA 4F7UG 3HXYA 4V2SA 2PJPA 5C53B 1XMKA 5H6RA 4GYGA 3SWNA 2EV0A 2W84A 4ESJA 3L9FA 1V4RA 3GUDA 4JUVA 4MNUA 5LEKA 2K4BA 3L7WA 1OPCA 1IN4A 1ZYRF 3JTHA 1LDJA 1KYZA 4EJWA 4EO4A 2A6EF 2ZNJA 4PZJA 2BEOA 1H4VB 4YCWA 5D6FA 5LJ3g 4M77B 3WGHA 3ZPLA 1YIOA 2DVEA 1GHCA 1H9GA 2Q7HA 1H4QA 1DUXC 1HBXG 1G4DA 2STTA 2ALYA 3M8EA 3I71A 1SESA 4CH4A 4OIOF 1KU7A 1MJBA 2FE3A 4O5VA 1B9MA 2FBKA 5TJJA 1K78B 2P5VA 5D8LB 4M6YA 5GAOq 2QHTA 3A7AA 2ZBKA 3DFGA 1Z7MA 3P7NA 5L3FA 1K78A 2GXBA 3JCMP 2DK8A 2H09A 3F8MA 4KIGA 2RHSB 2OQGA 3RKYA 5HGQA 4C8QB 1KYWA 3VBBA 3BY7A 3KEQA 4GO1A 3R07A 2VOOA 2LSOA 4N0AC 1MJAA 3L2ZA 5LJ3e 4P71C 4ZYEA 1RZ4A 2A6HF 2C7IA 3T8TA 4PJOB 3REXA 1J9IA 2BE5F 4M75B 3W6JB 2VBWA 2XKPA 1F1ZA 2R7FA 2QQAA 1O57A 4IVNA 1STZA 1JGSA 3NETA 1WKMA 5D5VB 3D5LA 4IRIA 3I5UA 4P75A 2I4MA 4C8QD 3OD1A 2QUFA 3KP2A 4P9UA 2UZKA 4XTWA 2ZNYA 4HX8A 4YDQA 2LF8A 5LRSA 3LAJA 4K86A 1Z9CA 1MDMB 3E6CC 4M7AE 5HLHA 3TUPA 3KETA 4UVBA 1S7AA 4M7DE 3L2CA 4LK1F 4TVYA 2PLYA 4MTEA 2Y90A 2Z5UA 1TQIA 4QVCA 3SB2A 4WX9A 1JHHA 1P4XA 1XSVA 1JHFA 4UP7A 3M7GA 4N9IA 4YREA 4G6QA 2BGCA 4YIIA 1L3LA 1I4K1 1RIOH 4CS4A 4CGZA 5BMZA 1PP8F 4A6DA 4M78E 3FXRA 5ILUA 2F5DA 3M4QA 4EM0B 3ZMUA 3ROUA 3SZPA 3WQZA 2Y0MA 4O3MA 1HTTA 2P5KA 2R3SA 3LA7A 2EFWA 4YRPA 3PZCA 3RKWA 1O3TA 1FBUA 3C3WA 1IZ1A 3LC0A 4GXOA 1YS7A 3TEGA 3QTCA 5GAOp 3BROA 4PJOD 2PFBA 1ZRDA 4MTDA 2E1CA 3IKLA 1QZYA 3E6BA 4XTYA 1IF1A 4E51A 1ADJA 1TBXA 1GVJA 5KK1A 4MEYF 2DJZA 3GX4X 4H2SA 2EAYA 1OYWA 4KYWA 3QPHA 5LJ3f 3REUA 3KZZA 4R8HA 4QVDA 1TLHB 3EYIA 2HZTA 3K1MA 1XGMA 5CVVA 2DTHA 4EJVA 3L09A 2OZUA 4ENJA 4NCXA 3GF2A 3RYRA 2ZT6A 5JI6A 3NEMA 2Q7EA 4LGWA 1KOGA 4ZYHA 1H9TA 1RIQA 5ICGA 4YFKF 1TQMA 1NYQA 3GZ5A 4EM1A 2DK5A 3SWNB 5GAOr 4FX4A 1NJ1A 1B59A 3HXZA 4KT5C 2Q8KA 4RB3C 4WF2A 5K1YA 4C92E 1EOVA 2P8TA 5LJ5h 1FBSA 4YRGA 3U9GA 4KN7X 1YG2A 4J6WA 4I0AA 3F3XA 4AVPA 2K4JA 4RCBA 4H2XB 3JCMe 4C92C 5GANj 4LLGF 1HQCA 5DDGA 4HF2A 4G84A 2ZO4A 3CO7C 2D2WA 2VBZA 2EB7A 3P9CA 3UFGA 5L3BA 4I98B 4IRGA 3DPTA 5GAN5 3WU1B 4A0XA 4B8XA 4A5NA 4DNCA 2ZT8A 5LJ3h 1LNWA 2GA2A 1O3SA 4Y91A 1OKRA 3DPLC 3HYIA 1O7FA 2A61A 3WU0A 1XGNA 3F72A 1KQ9A 2A07F 2K86A 3F6OA 2ZMEB 2V1DA 3GYHX 3FXQA 5E1ZB 2KIMA 3R61A 4P74A 3E5QA 1SD7A 2IJLA 2Q2EA 2X0LA 4MEXF 2STWA 3INZA 3GIBA 3QPTA 3KFWX 1B4AA 4M7AB 1MDMA 3KEOA 4LG0B 3EFSA 4M7DD 2XGTA 1I5ZA 3IKMB 4BHPA 1FYFA 1YW7A 5GMKh 5LJ5e 3JCMf 4Y15A 2HTSA 1XD7A 1D3YA 2EJRA 2NNYA 4YRRA 3K1PA 5ERIA 3RTRA 1W5SA 1USTA 3MF2A 2YPRA 3JCMd 3RL6A 2OA4A 1EQRA 2JTVA 2KIUA 4OIPF 3R0JA 5DY9A 1WSUA 4M77C 4A12A 2BYVE 3KP6A 4XU0A 4UXNA 4BQAA 1QPMA 2L4AA 2RV8A 4HQMA 4UV9A 1P4AA 2D45A 5GANf 2EFQA 4E70A 3TO6A 2EFNA 2M87A 5GAOl 4HWTA 2GAUA 2AKWB 1SETA 1ZGJA 3F8FA 4JRIA 5GAN4 3IG2A 4R1HA 4XRFA 4S04A 4JK1X 1U78A 1XGSA 3SFZA 1B7YA 2HOEA 5BPDA 2EWNA 2XASA 1XGOA 4BYYA 1FSEA 1WWXA 1RUOA 5GAMf 2XV4S 1WQWA 1R00A 2OAZA 4HQEA 5GMKe 3LSTA 3T5XA 1I1SA 5CVJA 4RQFA 4HDVA 4F7UF 4A0YA 3BJUA 2DAOA 4ETSA 2DW4A 4WXCA 3QNEA 3ZMZA 2AS5F 3CLOA 2XKOA 1X56A 3RPUA 2HDCA 2H6CA 1S29A 5LJ3d 1V3FA 1YFHA 1RI7A 5AIPA 3RACA 1T2KA 3HRTA 4M77F 4OP0A 5D6EA 4YG2F 3MEYA 2F5EA 4BHBA 2GA1A 3R6SA 3BFMA 4HT8A 1LJOA 2RHQA 1KQ0A 4M75G 1IAWA 2EFOA 4AH6A 2D1VA 2P5LC 3HRIA 2W85A 3WTZA 3PQJA 5DD4A 3ECOA 3IC7A 2PMFA 1M8VA 1H0MA 4B09A 1XDUA 2XUBA 1Y96B 2CIMA 4A6EA 1R22A 3QO5A 3JAMK 3ABTA 2G7UA 5JR3A 1YW8A 3JCMW 4MGRA 4LB6B 3ZMDA 4LK0F 3EFRA 3G3ZA 4HDUA 4M7AA 5IT9Z 4LG0A 2QM3A 2KJCA 1U5TA 2V1UA 3E9HA 2W25A 2GIVA 1ATIA 1D8JA 1TW2A 1BC7C 4M75F 4L9VA 2RQPA 2VBYA 3GLXA 2DPDA 2I4OA 1XSXA 1ZLJA 2QZ8A 1MKMA 3J80Z 1M5Q1 4Q15A 4YRNA 4M75E 1KMNA 2YX4A 3TEHA 2MD5A 2E5AA 4MQ9F 4HWSA 4NL2A 3JB9H 4UV8A 2HNIA 3IWFA 1E24A 1SERA 5E18F 2CGHA 1FLIA 5GMKj 4P3PA 2DTRA 5ELNA 2A69F 4L5JA 1Z7UA 4UVCA 3D0SA 1WQ7A 4PJOF 1OMIA 4L0ZB 3K0LA 4L9TA 2ARTA 3PCOA 1H4SA 2PMEA 2QLZA 1Y0UA 3R4KA 3E9IA 4Z2YA 1YGBA 4ZIBA 2VC0A 2KRFA 1FT9A 5CLSA 4KN4X 2DXTA 3HSBA 2Z99A 3J81K 4HWRA 3J7AO 3BW1A 3BJ6A 4ON0A 4U7DA 4AIKA 4CH3A 2VT3A 2XAHA 2ZJ2A 3PFIA 1LQ1A 4A53A 4HX7A 2DQ0A 2RKHA 2F5FA 4M77E 1Z1DA 3HXUA 2Q5IA 4HV5A 2EA2A 5FLXK 4IF4A 4HF1A 3ZN0A 3A5YA 1H641 5AIQA 4QLCU 2NYXA 4M6XA 2R7DA 2DZ9A 2AKWA 2XROA 4M77A 1ADYA 2HTJA 2FNPA 5E17F 4EJUA 1USYA 3WE3A 4WI1A 3R0AA 4LB5A 2ALYB 1VQZA 3LSSA 1YFSA 1G5HA 1B34B 1ASZA 5GAN2 4XTXA 5GAN6 4RGRA 3P8YA 2VXFA 5GAN3 4YRKA 1BBUA 1IXRC 1IN7A 3RPQA 3QAHA 1BI2A 1TNSA 1G6NA 4HV6A 4KR2A 1LEBA 2XRNA 3ZQ7A 4JRKA 3MZYA 1HW2A 2HQRA 4G7HF 2P6TA 1FYLA 2FOKA 1REPC 4C92F 3BY6A 3I53A 2O0YA 1XB4A 4EX5A 2NS0A 4BH9A 3JB9G 3HFZA 4M9SA 3JCMb 1MZBA 1T38A 2RM4A 2L4MA 5DEQA 4OOIA 1BI3A 1XN7A 4N9HA 2MH9A 3U2RA 1XCVA
chains in the Genus database with same CATH superfamily
5GADJ 1LVAA 1FX7A 4XU2A 2K57A 3CMAQ 1OCRH 5HCKA 4OMOA 3HY0A 3TQNA 4RB0A 4UP8A 2DQLA 2YU3A 3FMSA 1UHCA 1N75A 1SAXA 3I35A 4U88A 1F36A 1WJBA 5KYXB 3P8BB 2P7CB 4ZYGA 3QODA 1K7AA 3FHZA 2LTOA 1B1BA 3CCST 2ZXWH 1D1AA 1S6LA 1UG0A 3AFHA 3CUQB 3RI4A 2XTIA 2FVUA 2VE9A 1F5TA 2EV6A 3JRBA 1U5TB 1N78A 2W10A 3DF8A 2JA7J 5DUKA 4CC7A 4EMGA 4PNOA 1Z7NA 2CP2A 1ZLKA 4QQDA 2EZLA 2XHKA 5GANg 1ZA2B 3EG1A 3KZIC 1ZQ3P 2KZGA 2DILA 4LDVA 3FX3A 4AIDA 2E6ZA 2O8KA 2LH9A 1ZUUA 4LXCA 5HK3A 1LDDA 2R7QA 4L5GA 4OGEA 2HI3A 1O4XA 3EQLF 1AWOA 3MQZA 2HYGD 1SRYA 4KIFA 4A0ZA 2B9SA 2ZJPF 3UNGC 1Y07A 3EG2A 1UEBA 1KFZA 1NLPC 1G3SA 3ZL7C 3G71T 1ZG1A 3V42A 1X01A 2DLLA 1D1BA 1TWAJ 1Y96A 4GLKA 4FSXA 2ETHA 2RN7A 2M4KA 4S05A 2R7WA 3MF1A 2P0KA 5F5WA 3LA3A 1UFMA 3DV8A 3V8LA 5LFAA 1BBYA 5BOXA 3GTGJ 2HQAA 3JCMg 2ZT5A 2DAQA 2LJ0A 2FL7A 1YQAA 3G1ZA 2GFAA 6AT1B 1FOXA 2DPPB 2NUTA 1DGRM 5J1YA 3JCMV 1PYSA 1UHMA 3V7RA 1VZ0A 2DFIA 4BUPA 2HVRA 3CCSA 1W4SA 2X6XA 4J5YA 5IAYA 4M9XA 3GTQJ 3DXJF 3GFMA 2KRNA 3TSWA 1WPYA 5FWBA 3CXCA 1YW9A 3MFKA 4ZDOA 1ZBJA 1I27A 2J6KA 1NHAA 4D8KA 3PCOB 2AXLA 2ZZGA 3QYBA 3HOTA 1QW1A 1D3BA 4XNFA 3CC4T 2NUTB 2ZXFA 2OJED 4XIDA 1IG7A 2DJIA 3CDIA 2M7AA 3S3NA 2D1HA 2OTLI 4U0YA 5CVUA 1N5ZA 3BR3A 1E3HA 5EEGA 2V79A 1D0XA 4EGYA 2O6GE 1LNXA 3Q0WA 1M4ZA 3P8DA 4M77G 3FMQA 1WZ2A 3LNQA 4QIWN 2KDSA 2QGGA 1TWCJ 2VKNA 3JB9F 3A74A 1K73U 2XAJA 3CMET 2PMHA 5EG0B 1KA8A 2WSEE 2L9NA 5J3LA 2DT5A 4DOVA 2JOYA 3GCMA 3QYHB 5GMKi 2DRMA 2K9GA 1FZPB 1USSA 5K5OA 1FOKA 1U5TC 2O9LA 3ZGKA 3KYDB 1YB3A 2FX0A 4UNOA 3HFVA 1WQ2A 5GAGJ 1J09A 2EJFA 2FZGB 2AMCA 2AO9A 3RJPA 3Q5FA 3G1LA 4UUVA 1FTTA 4NC6A 3THKA 1UZCA 1HKSA 2DMQA 1KD1U 2O7OA 5E1XA 3K4LA 2DKGA 1OISA 2ECCA 4LVKA 3BT9A 3WTUC 1RUNA 3DBRB 5B1BH 3BTIA 3N4MA 1YO5C 1LKXA 1WRJA 4LJZF 2AIRB 2XICA 2P6SA 4DBRA 2HZDA 2OTJI 5BNGA 2M3AA 1X2QA 2XVCA 2GZWA 2DOEA 2A3LA 1Z05A 1MGQA 1RR8C 4M3DA 5CYVA 1FMKA 1QVPA 3AHUA 2IY5A 2XPUA 3OMYA 3C18A 4C0DC 2LT1A 5IXBA 3FXUA 2WAQA 4ELYC 3MZHA 1JT6A 1IRZA 2E41A 1QF6A 1QNTA 2FMYA 2E1HA 3WTXC 4XOPA 1J5YA 1G2HA 5IH2A 1N9WA 1A5JA 2ZFWA 4UP9A 4JP0A 2LT4A 3OYFA 3I54A 4BQNA 1QU3A 3OYLA 2IY5B 4WJ3M 5GTHC 4C2MJ 1KU3A 3M4PA 4LVMA 1UHFA 2PQWA 3C4SA 1PNJA 1YX5A 2K5LA 4N0AA 4M7DG 1RNLA 2HKXA 3JB9J 1B70B 1KJWA 2LKXA 3HPWA 4XKCA 5I21A 2CDTA 3OW2P 3NEUA 2COZA 4J9CA 5IT3A 3H36A 2FEZA 4KGXB 5ICEA 3ASKA 1IN5A 4C3IJ 3C12A 1KIKA 2HDWA 2RJEA 2E2HJ 4FT8A 5GAMh 2A05A 2ZXHA 3JAMZ 3NGPA 5EZGA 2RB6A 3LWIA 3ELKA 2WSFE 3CCRI 1YFRA 1BI0A 1R5GA 4L87A 2CFXA 2J05A 1G3WA 2M30A 3CUOA 1NPRA 2OAWA 1NNHA 3CCEI 3BC8A 3GWZA 3OYCA 3GXOA 2E12A 5LJ5d 1YJNT 3I55I 3I58A 2E70A 2LRDA 2FQ4A 2CJ9A 2DDZA 2JZYA 1X2GA 2M0OA 4IUUA 1IW7F 2E2IJ 1HSJA 3ZN1A 1YTYA 1LB2A 2P0QA 4C8QA 1S72A 2L7MP 1PWTA 2QSHX 1IDZA 1X1PA 1UGSB 1YCSB 2DX1A 2LRQA 5K1XA 5FFXA 1LOJA 2PNIA 5HK0A 2VV5A 5LGTA 4MFEA 4FCYA 2K3FA 3KE2A 2ID6A 1A6QA 2DA2A 4PJJA 5FKKA 3WODF 4KFCA 1K1ZA 2QYOA 4J9FA 5FU6C 4GLMA 2PJRA 5GAN7 1YRNA 2VXZA 5LEJA 1FYNA 1WHKA 3M0TA 4LLNA 3CQTA 2K85A 3R60A 1X75C 1OULA 1R23A 2DO3A 3GTJJ 1A04A 1WJSA 2CP5A 4M74A 2RMOA 2H3JA 1WU7A 1W5CC 2X6WA 2OV7A 2E1NA 3NHNA 3NELA 4PSWA 2V8JA 1ZGAA 2XMFA 2UXNA 2O8XA 3H0IA 5IY5H 1AHJB 3K70D 5J26A 1BBWA 2GOXB 2HQXA 1W2BP 4BDYA 5E8GA 1IL2A 1X6GA 2CU7A 2M8GX 4A3FJ 3WXMB 3MMYB 1W4MA 2H6BA 1D0ZA 3E6MA 3IAM2 2JWTA 4Y28E 5GMKl 1KMMA 2RVCA 3GFLA 1OLTA 3A4CA 2CJJA 1CF7B 4Q48A 1I39A 2F48A 2LLKA 2AHJB 2CUBA 4A54A 3CCQT 3DEEA 1M2VA 1B8AA 1IN6A 1PDNC 3EGDA 2C0TA 2QSGX 2NUPB 1NE8A 2ADUA 2DVJA 2O9SA 2YRCA 3BE3A 4HZFA 1FC3A 4WXDA 3I55A 2ZKZA 1TNTA 2OZ6A 2MW8A 3BR5A 1EIYA 4AIHA 5HS8A 5HDNA 4OIQF 3V8JA 3IQLA 3OYYA 1GGMA 2E36A 5DCMA 2VI6A 3CMAA 5C52B 4CYDA 1PC0A 2V6CA 2BW3B 4AYBN 1H88C 3TQ7P 2RHQB 2K9QA 4G94A 4G8XA 4G7ZF 4FYYB 3VQVA 1XDSA 1R5ID 4JJDA 2NOGA 2RNJA 1FP1D 5HLIA 2X4YA 1G51A 3I0TA 4IJAA 5IP6A 1NG7A 1X19A 3L2VA 3DU6A 2EGCA 4GY5A 5D4SA 4R56A 2VOPA 3C2GA 1JI8A 3TREA 1Y8RB 3QZ5B 4HVCA 2KP6A 2QQBA 4LG3A 2F4IA 2GXAA 5D5UB 2X9HA 1QWFA 4HCCA 1Y1VJ 4IX7A 2ISYA 1TUDA 3I59B 3VQYA 2WTEA 3OR1C 4MFDA 3A31A 2EV5A 1FYKA 2QQSA 3DKYA 2LG4A 3J81Z 3QP5A 2BHZA 1OQKA 4IXAA 3SZGA 2CV2A 3J81E 1YIJT 5F27A 3REOA 1POGA 2HS5A 2OCEA 2ZPIB 3B73A 1OR7A 3ZXSA 2CUDA 2EYXA 4B3AA 2WSCE 1UMQA 2LKPA 4RLQA 2ZAEA 1Y6IA 3HY1A 2LY1A 4RB1A 4UUTA 1OX9A 1B07A 2CYYA 4ZH4F 3A8LB 2CW7A 1F43A 2J5OA 1GUUA 1SMTA 3O2PE 4LIVA 1VA7A 1VQOA 1KC8C 1J2XA 3A5ZB 3M1CA 3RDIA 3JRFA 2JW4A 1VQ9T 1S3JA 4IO9F 3CJRB 3EUHA 1JQQA 2L3DA 2LBFB 2VC8A 4C92G 3S2HJ 4LDUA 4W1UA 5E3MA 5CR2A 1RETA 5FLXZ 1O3RA 3CC7T 3O6BB 5K7FA 1X4OA 3EUAA 3W2VA 2QHUA 3GO5A 4JRQA 2V26A 1VQMQ 4Z89A 3I9QA 3A5ZA 5KYWA 4RAGA 1IV8A 2HYFA 2RAEA 1Z3XA 1I81A 3OYNA 5LJ5f 2ARUA 4YRJA 4LITA 2EYYA 2YR2A 3OS1A 3NTKA 2B86A 2ME6A 1VQNA 3CD6I 4Z8AA 4TVAB 2DI3A 5FFZA 2WV0A 3HGGA 1BIAA 3CPFA 1VQLT 3BWGA 3FIWA 5IHIA 2NS6A 4RDXA 1R49A 2GCXA 3ZQCA 1QVFS 1TWHJ 4F93B 5CK9A 1LYLA 4TQDA 3L4GB 1ZUKA 3IRRA 2GBQA 4TQFA 2JUGA 2RJFA 2YUNA 1JKPC 3N97A 4UHTA 3PIOA 1KZHA 3LWHA 2XHCA 3VS0A 2XGXA 1JRIA 4KRTA 4NNJA 4FT4A 2SEMA 2L3RA 1TZLA 4HW0A 4K2EA 4HLXA 2ED0A 1U2WA 2Y48A 3FZVA 3HJEA 5L3EA 1DPRA 1YJNQ 4L5EA 2QI2A 2MBFA 1YIJI 3Q3SA 2V9KA 2MFZA 1MBGA 2BBYA 3Q0UA 4F7ZA 1AWXA 1TH7A 3OSVA 1EX4A 1E17A 2DOFA 4NQWA 1HJDA 3NARA 2DBMA 3UPUA 2EGEA 3KFUA 1FOWA 1S72T 2VB6A 5ILSA 3HUGB 4BAYA 3WTTC 3IV5A 1SFUA 3HTRA 4FW2A 1E1TA 5D8KB 4IZZA 2CJAA 4DW6A 1OZ3A 3AG4H 3JB9D 3SDGA 1B7YB 1OCZH 4MZMA 4CYCA 1EH8A 2RC4A 1LE8B 1RUWA 2K7LA 1U1SA 4RS8A 2X85A 1AOJA 1WXBA 2O3FA 1VQ4I 4IHYA 4M7AD 2GTOA 3JRIA 4BJTA 3LGFA 4M77D 5LL6S 5EEAA 2EJGA 1UGRB 3PVQA 1OV3A 1JKRC 1K9AA 1RKTA 4ABZA 3S14J 3CC4A 1LUJB 5LRRA 1USYC 1WPKA 2B0LA 3CCLI 4N4IA 3LW5E 1QVFP 3WGIA 1KGSA 1E22A 3CMQA 1J0RA 3E9GA 4BL0B 5KYUB 4BQQA 2X4HA 1VQMT 5JVTA 3JCMX 4QTRA 1MIJA 3RUXA 3CD6T 2IVMA 4MZTA 1EVLA 1JXSA 4XLHA 1HF0A 1F1BB 3VYSB 5HDGA 3WHCA 1BCOA 4Y3OA 1YJ9I 1JT0A 4XLNF 2IS2A 2J6FA 4U7BA 1EFNA 3S6WA 1Y56A 2JT1A 1P7JA 1U8RA 2GF7A 2P0PA 5K5RA 1WI9A 1TT0A 1LCKA 3RKXA 1QKXA 3P9IA 5C0MA 2LKSA 3CCMI 3HFZB 2JPBA 3CJNA 2EW3A 1MBHA 3REBB 2W82A 1SFOJ 1C0MA 4M7DF 3HXLA 1RLPC 4JDSA 4QQ6A 5GAOn 1YLFA 4N4OB 2FQ3A 3PQKA 4CCKA 3H0GJ 2IA2A 3SEZA 4JS4A 1YHQQ 2MLKA 5FU7B 2DM1A 2E10A 2EQJA 1BJZA 2E1MC 1NJIR 1XQHA 2HZYA 3REAB 2O31A 2KRMA 1VQKQ 2R7VA 1UCRA 4IOCF 2EH3A 4P3NA 3CDLA 4Y4RA 3F8BA 1ETYA 3A01B 2HCKA 3I5RA 3M07A 2M0CA 3N05A 5A0LA 3P8TA 5FRNA 2XB0X 4C0DB 3QP6A 4EMKA 2GQVA 4MHGA 4IRHA 2WBMA 5A2QK 5HLGA 4O6JA 1WDXA 3BPXA 2ZPGB 4YRFA 1Z6TA 2H27A 1RESA 4Q4ZF 4X9CA 5I11A 4L9JA 4J9BA 3J7AF 3JRZA 2ZJQF 4QWQA 3OV8A 4BE1A 2RHUA 1AOYA 3N5BB 1VQ7T 4M7AG 3J7AY 1B34A 4L9NA 2Z3YA 3ONQA 4YRIA 4OB2B 4J01A 3CBMA 5LJ5j 4RGUA 4X5OA 1LVKA 3O3KA 3QRFF 1B8IA 1OPKA 2VN2A 3VYRB 1PP7U 5KYUA 1J75A 1YITI 4YYEA 4XSXF 3QO7A 3CF5F 3NQOA 1Z77A 2LFBA 3GZNB 2EILH 2ZSIB 2CP0A 3JB9I 1N9SA 5GANh 5ICFA 5C3EJ 3CMAI 4HVUA 4EJTA 2J7IA 1SHGA 4HWOA 1QQIA 2ROTA 2CP7A 1VQ4T 2RA2A 2EZHA 5E3IA 1H89C 2F5CA 3H8ZA 3DKMA 3JSOA 1WYDA 1ZK8A 5DTDA 4I76A 5DM7F 5GJVB 2QF7A 3L2UA 4BB7A 1SD5A 2OD5A 2COBA 1HCRA 4E7SA 3IKTA 2UWMA 4M78D 1YJNA 1VQ6T 2L8DA 2EL9A 2LQWA 2ZCEA 2ZIOA 4RTYA 4IHSA 2OU2A 4M71A 2RHZA 5GMKm 2FRHA 2L2OA 5LHGA 3KEYA 1ERDA 4J00A 3W3SA 3BOQA 3S1MJ 4G9YA 1IDYA 2BUDA 4HX4A 4QQGA 1EA3A 4C5HA 2EKOA 3MEWA 2DFUA 3KCCA 2HMAA 3CCRT 2E5QA 3OOPA 1F4KA 4M4ZA 5CKEA 2EA4A 3D5RC 3UH0A 4XK8E 3E19A 2O9VA 1ETKA 2HOAA 2MH2A 4ZTJA 2A08A 4RG8A 4PJOC 2X1CA 4I0BA 4YRTA 3FRNA 4P5OA 3KLOA 1E2XA 4C9YA 2LDUA 4Z6YA 1R9TJ 2DXIA 1UAAA 3LH0A 2YSRA 5D5WB 3LFKA 2IGMA 1R4MB 4XU3A 2VWFA 3MZ8A 3CBOA 3C7JA 2WY8Q 4Y17A 5L3GA 1YHQA 3K9TA 2NUPA 3DLLA 4XLPF 1WA7A 3CCUQ 1WJ5A 2ELJA 4P96A 2VUMJ 1G3TA 4D1QA 2QBYB 2E71A 2HQEA 3EG0A 1ZLMA 2XKOC 2DU7A 1HXDA 5CKDA 3UKGA 4C8QC 3PTAA 3AKZA 1MNMC 2DT6A 2RF0A 2I4LA 2I8DA 4YRLA 3HKZA 4PSXA 1GRIA 2JQ7A 5CO7A 2FZKB 4ZZDA 5D4RA 1KQ8A 4A3DJ 2RHXA 2OTLT 1H3ZA 4BBSJ 3TEHB 2MF2A 3CTAA 2FHDA 4B1RA 2BOLA 2HWVA 4QT7A 4AD9A 1H4TA 3BTJA 4H2WA 1YCYA 2L7FP 2TCTA 4U0WA 4QSHA 3S2WA 1WJAA 3H41A 1XCBA 4RB2C 4M78G 3QU6A 4A3MJ 1WH5A 3FB9A 3VS5A 5CJ9A 1YJ9A 3KP3A 4ZYDA 2GGRA 1SD4A 4F16A 4OMZA 1IO2A 1R0BG 2ROLA 4YRMA 4UC4A 2R58A 1UGQB 1K8AU 3QXEB 2J5PA 3J80K 4YRVA 3JSPA 1S8NA 4YFNF 4CYCB 2VGMA 2VQLA 1DP3A 4I7HA 1VYUA 4F7UB 3RDVA 3M1EA 2AZSA 4C8QF 1T3SA 3GBGA 1VI0A 4XMYA 1M1EB 2Y4XA 1ZSZA 2YUQA 2YT6A 3KBGA 5DM7R 2QK0A 2XIGA 3NENA 3DTIA 3LSJA 3BR1A 1MHNA 2IPOB 3K10A 4AU7A 3JSCA 2H94A 2BZ8A 4QKUA 1VQ9Q 4KIBA 2E65A 2YU9J 3M4YA 1KQ1A 2EFPA 2RN8A 3FJPA 3MKDA 1NJ8A 3EFOB 3FDRA 5F64A 2FOWA 4BKXA 3CO6C 2VGNA 4J9EA 1R58A 3QOPA 5FROA 1EJ9A 2ZR2A 3HZJA 3QO8A 4H2VA 3FK6A 4CCLA 3G73A 1Z9ZA 4OMQA 2F5TX 2F69A 3WG7H 1SSHA 3RMQA 3G6EA 3ISPA 4C30A 3M58A 4CCOA 2MA3A 3K4JA 5H6QA 3IRQA 1R0CB 2HDAA 3OB9A 3Q9VA 5GAMg 1QZZA 1XC5A 1X6OA 1BJAA 1SD6A 3VFZA 4C3HJ 1BKBA 5FGMA 3DSQA 2C6YA 4N4GA 3MVPA 2BY3A 2IVWA 3VS7A 1N8RU 1NJ5A 4O2DA 1IGQA 2CQXA 2L7ZA 4D7MA 1U1TA 4A4FA 4AFZC 4LVLA 1M9SA 1Q1VA 2L01A 4OMLA 4BW9A 2XPVA 3CCVA 3VB2A 2E60A 2V1NA 3FEOA 5DYMA 2RI2A 1YJ9Q 4ESFA 4II2A 2DA3A 3OMGA 3SHWA 4IPAA 3PIOF 2KT8A 4X9DA 2FNAA 4HF0A 4EJOA 4LDXA 4TVAA 3F8CA 4EQQA 2KKOA 1PKSA 4IQJA 4DYCA 2Y75A 3L4GA 1EFWA 3KP4A 4B3XA 2FRYA 5ILVA 4E7JA 2DMOA 1IN8A 2DL4A 3VS2A 2LY9A 3DTEA 4XR6A 3S15J 1VQ5Q 3V7SA 1M3BA 4LDWA 2DA7A 4RTZA 2PVGB 3OW2A 1VQ6Q 4C5GA 3QYGB 5FD6A 3QWYA 1AWCA 1VYTA 3P8HA 3E0JB 1VQKA 4J15A 2YWWA 2F4OB 1YX3A 4XONA 1VQ4Q 2CGPA 2N8GA 1BOAA 2VYTA 2P5IA 2ZNIA 4LD5A 2JPCA 3DBLB 5J1RA 1I5LA 2NVYJ 1RC9A 1CF7A 2IA1A 1VQ5A 4M7AF 4MIMA 1QGPA 5DCFA 1SF9A 4P71A 1V5GA 4UPAA 4VUBA 3HUGA 1XOVA 1Y8QB 2CJBA 4HYEA 3TKYA 2DJNA 2PMUA 1W36C 5GANd 1EIYB 3CCQQ 2E64A 3H6ZA 3SZTA 4OINF 3OYJA 4FE4A 5IYCJ 2P0WA 3TO7A 5FU6B 3CC2A 1D1CA 4ENKA 4CS2A 4ZC3A 2CO5A 1KHCA 4YCVA 1GDTA 2IRFG 1EV7A 2W0ZA 5GAMe 3S3OA 1UGVA 2LX7A 4ESRA 4JRPA 1PHTA 2C0IA 1EVKA 3ZMVA 4B43A 4XRSA 3ERED 4ORZA 3SWNC 1J5WA 4M78B 4LIUA 1U8BA 3NFCA 2RQRA 4DBFA 1UHWA 2E3CA 4KQEA 3CCMA 3RF1A 5L23A 3CPWP 4FTHA 5HS9A 1E3OC 1OU9A 3ASOH 2LCLA 4PDKA 2PMZA 3IKVA 1IREB 3MEUA 3I3LA 3CZ6A 1O9SA 3R6OA 4J83A 1KQSA 1WX6A 3RPUD 1IV6A 1ZAOA 4GGGA 3A02A 1N8RR 2DEUA 2F5VA 3I59A 3M9AA 1FJLA 1M3CA 3ZMTA 2I2LA 3D7SB 4HKEA 4UUSB 1DGWY 4FYXB 2DEQA 2NYSA 2DFEA 3KYLA 1GXQA 1X58A 3EYYA 4DZJA 3E2UA 2BE9B 2ZZEA 3QDFA 3I56Q 3QWLA 4XRMA 3E1SA 5CQGA 1F9NA 1DPUA 3JRHA 3MAJA 3IWZA 4RLFA 4EGZA 5TRDA 2OI3A 3HFOA 5CKHA 4M7DB 2FBIA 1L0OC 2X6YA 4KJZA 4CDGA 3I9V2 3OYIA 4CC2A 2PUKB 2QHVA 4H2YA 2ZCWA 1Z21A 2A3SA 2F2EA 2K27A 3KZYA 5AONA 3A01A 3CEYA 4AFQC 1M90U 1BYMA 4YRSA 5L3DA 2BKDN 1X43A 2QXFA 1R36A 2EAYA 4LUDA 3ZQQA 2PQ8A 4B44A 1AZGB 3VS3A 2J3LA 1BL0A 2Z9OA 2W57A 3A7UA 1VQOI 2M9UA 4J6XA 1TW3A 3HIFA 4L18B 4KA4A 2DN0A 3U1DA 3ABUA 3CPWS 5IOZA 4RGXA 1Q7YU 2QKMB 3JCMc 2MC4A 3C2BA 4CH5A 3K4NA 1ZR4A 1X1BA 1Y57A 3CUQA 2LF7A 1FEXA 4HAMA 2YLCA 4XKVA 4A3JJ 2RI3A 4HOBA 4U0VA 3I56I 1QBJA 3CCSQ 4NHJA 4E7IA 4QW2A 2LY2A 5J8FA 1VQLI 3HTUA 3KP5A 1FMVA 2DXBA 4I01A 2ISZA 1Q81U 5E3LA 2QENA 4IUQA 3X25B 3ZCOA 2FSWA 2VXDA 2WB1N 3NAUA 4YTLA 3X24B 3JCMQ 2CW0F 1YOVB 5ELOA 3U1KA 1FYMA 1BI1A 4C92A 4PJOE 4A5MA 1JO8A 3HOYJ 1NYGA 1B6AA 3FMRA 3TGNA 3FDYA 4EMSA 5E1WA 1Z0XA 3B6AA 4G12A 1FPQA 3SFIA 1MBJA 3EPZA 4DEXA 3I56T 1JJCB 4YRQA 4BXUA 4F7UA 5B1AH 4ZN1A 1YI2T 2YX7A 1C6VX 1PSEA 2RPNA 1VQNQ 1XPXA 4CSWA 2ARSA 3C1DA 3H1CA 3CP8A 2ELHA 4AIJA 1Q82U 4F92B 2CSQA 2RHYA 2CREA 1LDKB 5KHDA 1CSKA 2D0NA 4BY1J 3L1AA 1QP2A 1ZSZC 1I1GA 1VQ7Q 1E1OA 4TTVA 3VODA 3QYFA 4G6DA 1Y0MA 4HVVA 4LVIA 3ULQB 2XDPA 2RHIA 3VU3C 2QA4A 5J6XA 2P4WA 3GTLJ 2CG4A 1QWEA 4WXHA 3AAFA 2EQUA 1FXXA 2ZPHB 3OBYA 1M2OA 4FYWB 4HXJA 2CQKA 4TVRA 4WWCA 4RG2A 4KMUX 4XKWA 2HEOA 2HGCA 4BJ5C 4NL3A 2DU5A 1ZTRA 4XORA 3RYPA 1NBEB 1MMGA 1MV3A 5LJ5g 4P73A 3VSLA 2HXIA 5H20A 2D8HA 3HOWJ 5LD2C 2FPDA 1TTYA 1VQKT 2IP2A 2ZR3A 2FF4A 4CZCA 2P7VB 1W0TA 4ELZC 4HNVA 1MGTA 3QYEA 3WTWC 3M57A 3IHUA 4EPCA 4J9IA 2NAZA 2Y0SN 1HKQA 4FL6A 1Q1HA 1VQ6I 3LX7A 1MUZA 2R7OA 1VQPI 3LAPA 3B02A 1W7PB 2VXEA 1P2FA 1NYFA 5E3OA 1MW7A 4IIMA 3T0YA 2E3IA 5KYWB 1VQ9A 3F8NA 5K7ZA 3MHXA 2G4CA 1FBQA 5JVGF 2IT0A 2A5YB 2DFHA 2HSEB 4FIBA 4CC3A 4LNSA 1NEBA 3HG9A 1W7PA 2JVHA 1PVEA 1TWFJ 5FLVA 1ULYA 2CV0A 3BTCA 4KT0E 1HSTA 2M0MA 2XF5A 2DF6A 3QUIA 3UWNA 4A3BJ 1VQPT 5GAMd 3PIPA 3CCRQ 1JJ2A 2KYBA 3HXVA 2WAFA 1TT5B 2CS3A 3WHBA 4J9HA 2KL4A 3ULRB 4I2OA 1WIEA 1ON1A 2IGOA 2DERA 1B9NA 4EMKB 4MQVA 4K87A 2NOJB 3OYGA 4NS5A 1WLEA 4A4KA 1SMYF 1IC8A 2YLBA 4D5CA 3M53A 1VQ7I 3QHSA 1YJ9T 4H2XA 2VE8A 3MKWB 2VKVA 4N4NB 4ENMA 1KU2A 2RQWA 2ZPEB 2G9WA 4J19A 1HW1A 5D6YA 3U23A 2XAUA 2IBDA 2OCCH 4CZZA 3QWXX 2QVOA 2RD1A 1BM9A 2TDXA 3A03A 4HBLA 3VRYA 5KE2A 3IP4B 3RZOJ 2KI7A 2ESNA 1Z6RA 2RREA 2G6FX 1ZSGA 1TU0B 4FM4B 4KNYA 2E34A 4AG2C 3VQXA 1NK3P 1SHFA 2K9SA 2OBPA 3LA2A 1D0YA 3MKLA 3A0BC 3GVAA 1IO6A 4M78F 1PJRA 3CMAT 3A32A 2FJ1A 3SQNA 3KUFA 1IHWA 2CUJA 3PNTA 3T1BA 1Q86R 2G7HA 2I4NA 3DBHB 2M51A 4XL9A 2D5VA 2XAGA 2FMLA 2UXXA 2NRAC 1PRLC 3CCJQ 2Z0WA 3KLNA 4AM3A 4ZGDB 4IHXA 2R4GA 3OSGA 2DBKA 3EH1A 3VYTB 4B9XA 3WTVC 3H3UA 4ZZLA 4DOWA 1K4SA 4BI3A 2JSCA 2E2JJ 4OMMA 1WLPB 3WVDB 4A63B 1VQPA 4EVIA 3IALA 2ZIMA 2XDBA 4UUSA 2IW5A 3UR3C 4OAYA 5KAFC 3FF5A 6PAXA 2M1BA 2DZCA 2ZGWA 3P5JA 2X4WA 1JE8A 1PG5B 2YS9A 4RCCA 2BIVA 1ABOA 2ZMEA 1H3HA 1RADB 2VJIA 3M8JA 4FHTA 5F0FA 5TISC 4LLLA 4HLYA 4LUEA 2K3XA 5HDKA 1OFCX 1G2BA 4R0KA 2HBWA 3EDPA 3CC7Q 5ICCA 2ZT7A 2X3WD 4L5IA 5ECAA 1YHQT 4KDPA 1HA8A 2J6OA 4M6VA 1MH3A 3GNFB 4DZPA 2WADA 1P6RA 3COAC 2FPFA 1LFPA 2E19A 3PUFA 2RO0A 1Z9QA 3UGQA 1C0WA 1QHGA 4P73C 1FNNA 1W5TA 2KJBA 2V4JC 5LBQA 5E79C 1U3EM 4G7OF 3RERA 2JM8A 2NNNA 4Q47A 1K8AC 2OTLQ 1QMCA 3HTZA 2ED1A 3T8RA 3G4SI 1WNLA 1QVFA 5GAOm 5LJ3g 2MLGA 2JRMA 1LEAA 4KUIA 3OR2C 3NWTA 3S93A 3ICAA 2LQ8A 1HDDC 2H1LA 4C0FA 1YFTA 4D0PA 2DNUA 4IOAF 3ZMSA 2KT1A 1KC8U 2W4SA 1IGNA 5KNLA 1IXDA 2K6DA 4YP0A 2QBYA 1G3YA 4HSRA 1Y1WJ 2P84A 4F04B 2FA5A 4YROA 2DTIA 3O5ZA 3LOCA 1QRYA 3CLQA 4PLIA 2ZJRF 3ZP5A 2G3RA 2L3PA 4IUPA 3ESWB 4MMKA 2MPXC 5D7UA 4AMCA 5F1RA 4P74C 2CZ1B 3EGDB 1JTXA 1MH4A 3HSRA 1DDNA 1HD3A 5EG2A 2LJ3A 1UG2A 2KXDA 2VKDA 1DP7P 2A28A 1FIAA 2YUPA 2CSOA 4HA8A 2DTOA 1BN5A 2EGAA 2MIOA 4ZNXA 1QE0A 3GFJA 2V7FA 5GP9A 1VIEA 1YI2Q 2M45A 2K02A 3MCZA 3ZQIA 4EM2A 2CW8A 1WI3A 4CXFA 5EEHA 3K2ZA 1ZG5A 1JXMA 1HKTA 2E3HA 2I10A 2XB5A 2BVMA 1G5VA 3BZKA 3HRUA 2FBHA 2ZXJA 2EVRA 2FYKA 5IHNA 2QHSA 2RQTA 5FD5A 4MZPA 4ENNA 3GBQA 3CCQA 2PUOB 3KFVA 1HLVA 3MEAA 2Q0OA 2E5NA 2ACJA 3META 4RTUA 1VNDA 1TWGJ 5L3CA 3HB9A 4P9FA 3W6KB 1GT0C 1IXSB 2GXGA 2CYZB 2HSPA 4Z88A 4DPGA 3TOAA 2Z33A 3AG1H 1EKEA 2DMNA 3ZOBA 4L0YB 4NOYA 2OAUA 4C5IA 4HSTA 5I22A 3WTYC 1JEGA 3L2WA 4ZTZB 3WE2A 2HR3A 4JBAA 5K5QA 2EZKA 5HNFA 1BC8C 1QP3A 1TG0A 5HVQC 2M16A 1UG1A 3OBWA 4M75D 3MEXA 4C0ZA 4E4HA 2A68F 3BPVA 2WV1A 3V4GA 4M9ZA 1K73C 1PYSB 2CFOA 2BV6A 2OC6A 1JJ2S 3BDDA 1NTCA 4I99C 2R5AA 5FLMJ 1AD5A 3E9FA 2EFIA 4YPFA 5E20A 1R4NB 5A0DA 5JFRA 2VODA 4XEOA 4YIFA 5LHHA 1M1KR 2J06A 3HXXA 2IA0A 3EETA 1AWJA 1D3BB 2IS4A 2KIFA 1XSDA 4PGGA 3DP7A 3TO9A 1SFXA 2NS7A 3JTGA 4IHTA 4X6AJ 1YNZA 4JQFA 2F2XA 2M1HA 4M72A 2DXUA 3CC2I 2EPDA 2K2VA 1AHDP 4JLIA 2VQGA 2RNAA 4BXXJ 1EF4A 1T39A 4DQ2A 3HSEA 2KT0A 5CVIA 1IUFA 1V5FA 5JHFA 2VONA 2JTEA 2RJDA 2Y4YA 3MPUB 3BQZA 3F23A 3PT9A 3HHTB 3G4ST 4HEA2 4C5EA 2MC3A 1VTNC 4FX0A 2HFHA 4CS3A 4AWXB 3JW4A 3OYMA 1M8MA 1ONVA 4A69C 2IIMA 1M30A 1EH6A 3A7RA 1SFEA 5IN1A 1AT1B 3VPRA 4RTXA 1RABB 4XBFA 3KIOA 3FWEA 4F14A 2MCNA 4YIRX 2AT1B 1AVZC 1Q7YR 5CKBA 4LNPA 2Q7GA 1RAFB 1YJWQ 2DODA 3W2AA 2JXBA 1TUCA 3TBIA 1BB9A 2LMJA 4P72C 4Q5SF 4H02A 4Q6GA 4WJ4A 2ZINA 2QASA 4LE9A 3CCLQ 1YS6A 3I55Q 3HKSA 4PHCA 1ZREA 3OYEA 1A35A 3UGTA 2RGVA 1R5HA 5A0GA 1NYRA 2DRKA 2FEIA 3SDBA 1WJQA 2SRCA 5KE3A 2L02A 3QOEA 3H9GA 2H8WA 1QLYA 4JJCA 11ASA 3G71I 2HL3A 1ZHFA 4E6KG 4KULA 4CICA 1QO0D 2XAFA 1S7OA 1T08B 1OCCH 4ASNA 2X6OA 4N0BA 5CQXA 3MJXA 1P92A 2IPQX 1T56A 5BPIA 2BE7D 5HS7A 1UB9A 5CKTA 5LHIA 3LSRA 2EBIA 1YFNA 1S7EA 2FXAA 2M8EA 3ABKH 3KX2A 5IP9J 1ZH5A 1OI1A 1TP4A 3BJOA 3CUQC 5EC7A 2WAEA 1JJ2P 3HRMA 1B70A 1A36A 4WCIA 1GXIE 4MLOA 3H0FA 3KP7A 1X6BA 1U6GA 2WC2A 1YI2I 2MMPA 4KMFA 3LSHA 1U0JA 3LMMA 3HTSB 2ZNZA 1HSQA 2ZMEC 2JA2A 4A3KJ 1B7TA 2EPFA 4BNCA 2HKQB 3I7FA 2ODRD 2CQQA 1R1VA 4M3BA 1MNDA 3SHFA 1O75A 2HAXA 5K1PA 5C44J 2LREA 3JCMh 3WTSC 2XGCA 5FO5A 4LVJA 1ACIA 3NTIA 4U87A 3CXCS 2EJ9A 2JUCA 3EHRA 4KH1B 3CCET 5FLXE 3CD6Q 4D5FA 1S72I 1X2KA 4M7DA 4JX6A 4MO7A 3F21A 5CVRA 4CO8A 2R93J 2QG9B 1ZA1B 2L2PA 5JLWA 1M1GA 4HT4A 3FXKA 3M4OJ 1X2MA 2BTTA 2C06A 2JSPA 5M5XJ 2ECZA 2XF6A 1IRFA 1I50J 1T0FC 2DD4A 1W1FA 1IUYA 2DPUA 1W0UA 3CD6A 4P55A 5BS6A 3DEWA 1YRNB 1OYIA 4IEJA 1QVUA 2PN6A 5GAMj 3CESA 2DQRA 5C51B 4ZTUB 3NMZC 5FJ8J 2L9RA 4BY7J 2JN6A 2H3EB 1SVLA 1VQOT 4A3CJ 2JTMA 3TDZC 4RM3A 4CHUA 2F2VA 3CJQB 4XICA 2VBXA 3AL0B 3M54A 2PI0A 4PKCC 2DA4A 2CUZA 4E7HA 2XAQA 2OPTA 3BCBA 4BU2A 3QU3A 4ZGJB 3QSUA 3JRDA 3HOSA 2FB7A 2JUFA 2KK4A 1BOBA 5DD8A 2WWYA 3HXWA 3ABLH 5TGTA 3CC7I 1YITA 4BI8B 4KR3A 3I4PA 4RAFA 3ZRGA 5AYFA 2BZTA 4FT2A 3IL2A 2AKKA 2XD0A 1S9HA 2WACA 2COMA 4M75A 3H92A 3JRCA 4FU6A 4X1EA 1W6XA 4RMNA 5C4XJ 1H8KA 1QHHD 2GNCA 2LJ1A 2DOAA 4PFZA 2PG4A 4XQ3A 3E6DA 1JBMA 1B8IB 2K5IA 3B6CA 3NRVA 5HNHA 1G83A 2LZ6B 3RIRA 4F52A 4M78A 3FXOA 1BK2A 3K2AA 5DCMB 3GEZA 1Q82R 2DQ3A 4OLFA 3E5UA 4A4EA 3ABMH 3DEUA 1IJWC 5A2QZ 3CJTB 3LQQA 4PJLA 3M8FA 1ZRFA 1D5VA 1ZARA 1IXCA 4I09A 2JT4A 2NUZA 4RM2A 1RAHB 2I0NA 3LSQA 3H5RA 3TOBA 4RGSA 4YFXF 3S3MA 4HPQA 4J6YA 2AHQA 4ME7A 2QQ9A 3E5XA 7AT1B 2L9VA 1XMAA 3I55T 4M7AC 4UVAA 2PBIA 1NJ2A 4TWAA 3DQVC 3BP8A 3ZBDA 1X27A 1T0HA 8AT1B 5IOYA 3SJMA 2MI6A 3BZ6A 2ESHA 1RI9A 2VVKA 1DU6A 1I5OB 2VT2A 1D09B 4OMNA 5H2FC 4FSSA 5D5XB 1SG5A 3FXMA 5JLXA 3VEPA 1EH7A 1MV0B 2O2OA 3FXJA 4X0GA 1KQ2A 1U9NA 1MSEC 4GBQA 1O3QA 3MP8A 2JVGA 3PGGA 2KROA 4YCUA 1W2BS 3LSPA 1NJ6A 4M73A 3EUHC 1T8IA 2CQ7A 2HOSA 3X26B 2R5YB 3ZQHA 3CF2A 3CCMQ 4BE0A 2X51A 3I64A 3FXLA 3L2QA 3ZQLA 3HOVJ 1V54H 4WCGA 2FU4A 1NM7A 4XLCA 2VUBA 4EEFG 2VC1A 3BTLA 4LFUA 4BEHB 5C4JJ 1HW5A 2DMTA 2K9NA 1N6AA 2ABLA 1XG1A 3LYIA 4F7UE 1MJ9A 1X1AA 2O03A 1VQ8T 3BG7A 3G1MA 3LQRA 2P0LA 2LNVA 3HC7A 2KRCA 1B72B 1LFBA 4GYIA 3JR9A 3SXYA 2E35A 4RAYA 1R1UA 3ME9A 1BW6A 4XTVA 2DBBA 2K9MA 1M90R 1FY7A 1W66A 1X2HA 1U5SA 3OIQA 2B7EA 4XEMA 4KGZB 3MEVA 1TQPA 3A8OB 2LTPA 3I5SA 3RKQA 3Q1JA 4OMPA 1B76A 3PSFA 5HY6A 1X3UA 2RHSA 4IL6C 3JAME 2IG0A 2PU9B 5GANe 3WGGA 2CUEA 2J3MA 5GAN8 3ERRA 3QO3A 4P3OA 2OF7A 1ZN2A 1PD1A 3E97A 1IHVA 1N9RA 4Y33A 2EQMA 1TC3C 2IS1A 2L89A 2QTVA 4OVAA 4C92B 3CCEQ 4TVWA 2ME0A 3HGYA 3G1OA 4EV0A 2YHTA 1YIJA 1X55A 4CH6A 4BWAA 4XTZA 4PG3A 1NJIU 1RKWA 1KHIA 3GF5A 4C8QE 3SEQA 3K69A 4A3IJ 4IUVA 4QVZA 3CMMA 1S5LC 1T6SA 3HRSA 1O7LA 4RAZA 2DIQA 4NB5A 2NVTJ 2LQNA 4XSZF 3CMYA 1GXPA 2RQVA 1QQJA 3M0PA 3BJAA 2R7ZJ 2X48A 4AYBA 1YIJQ 1IRXA 4M75C 3D5SC 4ZYAA 5FKLA 1X54A 1YJWI 2CWEA 1CGPA 2O61A 4PJOA 1YJNI 2KYMA 1P4WA 4XN0A 2NVXJ 1BIBA 1IRGA 4BJ6C 3CMEI 4NQWB 3OYHA 2PEXA 2JA5J 2W00A 1K6OA 2GQQA 1WZOA 2MOXA 3V8KA 5M9OA 4PFOA 1KSWA 1TUGB 1ZG3A 1OYYA 1UJYA 1ZSZB 1UDLA 4Z02A 2R0QC 3DKWA 2DU9A 3HSFA 4TV7A 3JV3A 1WI7A 5LGUA 4RTTA 1FP2A 2RDPA 3OSFA 2QA4T 3P9KA 3HP9A 1VQLA 1LFUP 2Y30A 2ZFUA 1SEMA 3BR2A 4PJOG 2E7WA 4MDXA 1G5IA 4BS9A 4P72A 4EMHA 2JJ7A 3CCLA 1NG6A 2L3SA 4MDWA 2OTJQ 3RMSA 5D6XA 2HQNA 3PFYA 1JUPA 4R79A 2DO7A 3KXTA 5J8CA 4OU0A 2QTXA 2E7XA 3JCMJ 3VUZA 4LD9K 2L54A 2LOOA 3PVLA 4BGDA 2FG0A 1JUMA 1OZ2A 4R55A 3OMCA 1FWZA 3GZ6A 1HK9A 5DV5A 2QWWA 1VFCA 4L59A 3OW2S 4LMYA 2K5CA 1ZRCA 3W6VA 2UUZA 2V8KA 3A98A 4BACA 5F0HA 4ESBA 4P1WA 3L00A 5DUIA 1I6XA 2EYWA 3LGLA 5IT9K 3LWFA 3FK7A 2GWRA 1VQOQ 3EH2A 4HT9A 4Q5WA 1ITYA 2EK5A 3UF4A 2HKOA 4LDYA 4C92D 3L42A 1ODDA 3H3ZA 4G85A 2IEKA 2V6EA 2V9VA 2WA0A 1WJRA 2CH4W 2ZTGA 2KZVA 2V1XA 4H4KC 3ASNH 5BQTA 1R7JA 1T98A 1K79A 1Z91A 3E7LA 5E8IA 2LC4A 4JJBA 2XDDA 4JX4A 3GW2A 3GPLA 2M5WA 4BE2A 3TEDA 3VS4A 1UJ8A 3ECHA 1LPQA 4A3GJ 5CQYA 1R1TA 3HBLA 4XU1A 2OQRA 5ED4A 2EKHA 2DYSH 2LVMA 3F22A 2YRDA 3FJ5A 1Q82C 1WHUA 2Z16A 3Q9SA 3CCJA 4V19K 2ZC2A 1L0WA 1PM3A 3GFIA 4KICA 4XTUA 1PUEE 2F1LA 1N77A 2AK5A 4C8QG 4RMFA 1RAIB 3LSIA 3VUBA 5IYDJ 2MG4A 3HFNA 3HRKA 1OOTA 4XM3A 1ETQA 2YSQA 1C0AA 1V76A 1SVMA 3RSNA 5JHUA 3SEMA 2W24A 2KRHA 3FM3A 3FISA 1EIFA 4OIRF 3MQ0A 1EZZB 2JS0A 5KCMA 2KR3A 1FIPA 2IS6A 3P8VA 3LSKA 3TDUC 3TEGA 2AXTC 2A8EA 3H5AA 4HWPA 4XOTA 4H2TA 3PUBA 1T0FA 1LJ9A 3IAS2 1FSHA 4Y7NJ 2XF7A 5FB2A 3H9QA 4PCQA 5LGNA 2KRSA 3WG9A 2R7RA 3H0DA 3LH5A 4E7ZA 3PSIA 4A3LJ 1SVOA 2WAQN 1J59A 1KQSS 1MD0A 4PGHA 1CQTA 3BDUA 3VQWA 4P75C 1GCQC 1WFXA 1TWBA 2BXYA 4H0EA 4M78C 3K1NA 1GBRA 1PYVA 3K4BA 3RESA 1OX8A 1KG1A 4YRCA 3HPHA 4C2TA 1ZX6A 2HEQA 2KXCA 3PE0A 5FW9A 2D0QB 2D9TA 4D8DA 2KIQA 1J7KA 3BDLA 4KISA 3VOEA 4D9JA 4WK8F 4DBQA 1W7PD 3FBNB 3HHHA 1ON2A 1I3AA 2HVQA 1YYVA 2LNBA 5KAIC 3EG3A 1QKWA 3FIFA 5CIUA 2D6FA 3DLLF 1RR7A 2JN0A 4QPOA 3SDZA 2CUFA 4F3QA 9ANTA 3M4GA 5LJ3j 4K88A 3CCMT 3JREA 1I8FA 1VQNT 4BHCA 5KVRA 4A2UA 4I02A 1MMNA 2ATCB 1ASYA 1VQ7A 4M3EA 2Q5HA 2Y9YA 2RK1A 5KNNA 2C8MA 1TXQA 1G59A 4GCVA 4HCZA 1GFCA 2EIFA 3E3VA 3J7ZI 2CSIA 3MWMA 3HHGA 1MBKA 4II3A 3FM5A 1BA5A 2COYA 5J47A 5FRMA 4OMYA 2DD5A 4Y13A 1D8KA 3ML6A 2CZ0B 2VKHA 2JJ9A 3QIIA 3QJ6A 4MMLA 2QEXQ 5LLQA 2Z1DA 1A0NB 3F6VA 1SAUA 3CDHA 2M7BA 3VDXA 5E3NA 1GLNA 1KU9A 5F6FA 5HOOA 1S1NA 3TCJA 3G6EI 4H2UA 3V7CA 4KUMA 2JRTA 5CAIA 5J4YA 3H9JA 2A37A 1SSFA 5EG0A 2AKLA 4F7UG 5DLOA 3HXYA 4D7NA 4V2SA 4B48A 4E7LA 2PJPA 2DA1A 5C53B 1XMKA 4KITB 5H6RA 3HOXJ 5M5WJ 3URGA 4BY6B 4GYGA 1B72A 3SWNA 2EV0A 2W84A 4AVZA 4DYRA 4ESJA 3L9FA 3PNVA 5F0CA 2R92J 3QKJA 1V4RA 3GUDA 4Y52J 3X28B 1JB0E 3CCVT 2Q1ZB 5GPCA 1WHHA 1Q86U 4JUVA 2RI5A 4MNUA 1WXUA 5FKOA 5LEKA 2K4BA 1S72Q 3L7WA 1OPCA 2KPMA 2KQRA 1IN4A 4I6ZA 5J3BA 3ERMA 1ZYRF 2L5QA 2IAIA 4D6WA 3JTHA 2EIMH 1BU1A 1LDJA 1KYZA 3JCUC 4EJWA 2A6EF 2ZNJA 4EO4A 4PZJA 3IH2A 2BEOA 3M56A 4E47A 3VYGA 1H4VB 4YCWA 3H9NA 1YJWA 3JRGA 5D6FA 1JXOA 2EZIA 4M77B 3WGHA 3ZPLA 2R7SA 4BY6C 1YIOA 2ECBA 2DVEA 4JJNK 1GHCA 4PJ0C 1H9GA 2DL8A 2Q7HA 1X2NA 1H4QA 2X1DA 3S1QJ 3HEFA 4ZGEB 1KD1C 1E6HA 2LD5A 1DUXC 1HBXG 1G4DA 2STTA 2ALYA 1WJEA 3F70A 3M8EA 3I71A 1H92A 1SESA 4CH4A 4OIOF 2DJQA 4UY8I 1VQ8A 2E4HA 4AT1B 1KU7A 1MJBA 2FE3A 2DL3A 4O5VA 3OL3A 4KT6A 3K6GA 1B9MA 2FBKA 1WHGA 1UTIA 5TJJA 1K78B 1GV5A 5KYYA 2P5VA 5D8LB 1K9MC 2O88A 3ZEHA 1SRLA 3OYBA 4M6YA 2B63J 5GAOq 2QHTA 2JVVA 3A7AA 4CRIA 2JZ2A 2HXOA 3KPHA 2M9HA 1SANA 1YI2A 2ZBKA 3DFGA 4HRIA 1Z7MA 3P7NA 1VUBA 2ZZDA 3VKIA 4A93J 5M3FJ 1VF9A 1NG2A 3EUKL 1K9MU 5L3FA 1K78A 2GXBA 3AT1B 4KUDK 3FKJA 4RA2A 3JCMP 2DK8A 2H09A 2Y31A 3CP2A 3F8MA 4KIGA 3DB4A 2RHSB 4OGCA 2OQGA 3RKYA 1K73R 2QGUA 5HGQA 4C8QB 1KYWA 1QPIA 1AU7A 2FRWA 3VBBA 3RQ4A 2VPLA 3BY7A 3KEQA 3W3CA 3JRAA 4ZN3A 1Z67A 2Q2EB 2F4MB 3MO8A 4GO1A 2GQIA 3R07A 3RZDJ 1PSFA 2EIJH 2X4JA 3QDRB 2OTJA 2VOOA 2PJRB 1R77A 2DA5A 2LSOA 4N0AC 3HM5A 1MJAA 2GIZA 1V55H 1V29B 1GFDA 3L2ZA 5LJ3e 1NPPA 3RBBB 2KSSA 2R57A 4ZYEA 4P71C 2DXCA 1RZ4A 2A6HF 1I6HJ 2C7IA 3T8TA 3M3YJ 2XSJC 2A5WA 4E2FB 4PJOB 3REXA 3F0CA 3I4NJ 1J9IA 2BE5F 3TL4X 1T33A 1ENHA 3OY9A 4M75B 4X34A 4FE7A 2NS8A 2YUSA 3W6JB 2M34A 3O8VA 2QA4Q 1B3QA 3G71A 2VBWA 1J3TA 2XKPA 1F1ZA 3L1PA 5J4VA 1IGUA 2RNGA 1QVGP 4BDZA 3C2HA 2R7FA 1BR2A 2QQAA 1MSFC 3HL8A 4JPBW 3TU4K 1O57A 2V9PA 2Y0SA 1M2VB 1AWWA 2R5ZB 2XSDC 2XGDA 4IVNA 1STZA 1Z7LA 1JGSA 2KISA 2QKLB 4NC7A 1WHJA 3NETA 2KHMA 1WKMA 2YUOA 5D5VB 3A8MB 3D5LA 4IRIA 1UE9A 1VOMA 3BLYA 3I5UA 1RL2A 1YITQ 4P75A 2F6CA 1Y7XA 2I4MA 3A1PA 1M1KC 4C8QD 3TP3A 2OTLA 2CP6A 2QUFA 3KP2A 4P9UA 3OD1A 2UZKA 4XTWA 1C1AA 2ZNYA 4RUGA 4HX8A 4YDQA 2P4RA 4ZTFA 2CQNA 3GLLA 1FTZA 2NXNB 2Y69H 4OWRB 3I56A 1V5EA 2W7NA 4PL6A 2LF8A 5LRSA 3LAJA 1CKBA 1WHLA 4K86A 1K6YA 3BR6A 1Z9CA 1MDMB 1Y39A 2BHYA 3E6CC 4JLGA 4M7AE 2VASA 5HLHA 3TUPA 1CKAA 5HLTA 4UVBA 1S7AA 3KETA 4M7DE 2ODRC 3EGXA 3OL4A 2HPIA 4LK1F 3L2CA 3I4MJ 4BUGA 4TVYA 2NWMA 2XDVA 5KCOA 2PLYA 4MTEA 1M1FA 2Y90A 9ATCB 4A4HA 2ELKA 2Z5UA 1VQKI 4OF1A 1TQIA 3OQ5A 3SB2A 4QVCA 4WX9A 1RPWA 2DK3A 1JHHA 1P4XA 1HYOA 1XSVA 5B66C 2MWOA 2O01E 1JHFA 2K5FA 4UP7A 3BR0A 2KNBB 2MD0A 3M7GA 3OIPA 4N9IA 4YREA 4G6QA 2BGCA 4YIIA 4OB0B 3CMEA 1L3LA 1I4K1 1RIOH 2FZCB 3M55A 1K9MR 4CS4A 1KONA 4CGZA 4NBQA 5BMZA 3OYKA 1E7OA 2KY9A 3K7AJ 5F04A 1PP8F 3PMTA 1ETWA 4A6DA 5IPAA 1OYXA 1MBFA 2MWPA 3NTHA 3R6NA 2JTFA 4M78E 1MMAA 4UB8C 3FXRA 3M59A 5ILUA 2F5DA 2DIGA 5GPAA 2H1KA 3M4QA 4EM0B 3ZMUA 1BBZA 3ROUA 3DCFA 2LYCA 3BG9A 2DYRH 3RCOA 3SZPA 2Y0MA 5KCHA 3DLAA 1KD1R 3WQZA 4O3MA 1HTTA 4J9GA 2P5KA 2R3SA 3LA7A 2EFWA 3EG9B 4NDLA 1ZQ1A 5C6SA 3PZCA 5CCAA 3RKWA 2V1QA 4YRPA 3G4SQ 1X4PA 3CCQI 1VQ4A 1UB4A 2MAMA 1O3TA 1FBUA 3C3WA 1TL8A 3ZQFA 2NVQJ 2L3QA 3DPUA 1IZ1A 2BY2A 2LR8A 2QGFB 4GXOA 4JOMA 2JA8J 2XI9A 1R71A 1AZEA 3LC0A 2EINH 1YS7A 2DA6A 5DS9A 2KDZA 1TSFA 4EDUA 3BROA 2W48A 1A31A 5GAOp 2P4TA 1Q81R 3QTCA 2E6NA 4PJOD 3GTMJ 4J7IA 1XTAA 2PFBA 1ZRDA 5J39A 4XKBA 2DLPA 4MTDA 3G71Q 2QYZA 2E1CA 3IKLA 1QZYA 3E6BA 1ZKGA 1OCTC 4XTYA 5L8RE 5D6WA 1K8AR 2X9DA 1IF1A 3M0UA 4E51A 3BCAA 1N8RC 3PNYA 1ADJA 1TBXA 2YRVA 1GVJA 4PJMA 4MEYF 3A1YA 5KK1A 2LX9A 2DJZA 1HOMA 2KBTA 3GX4X 4H2SA 1M27C 1YE9A 4UB6C 2L9SA 1OYWA 5J1UA 2GM4A 2DFFA 3QPHA 4KYWA 1Y71A 3EAEA 3M0QA 3M0RA 5LJ3f 2BZXA 1QA6A 1Q81C 4B4CA 3REUA 1U3OA 4BXFA 3KZZA 4R8HA 1UGPB 1X1DA 1XTDA 1TLHB 5EYRA 3EYIA 1YN8A 4QVDA 3IH3A 2PX9A 3CCJI 1UJ0A 4DJAA 1ZBXA 2HZTA 3K1MA 4IQ4A 1XGMA 1JKQC 4PLLA 4EMKC 4RMOA 4F91B 2LDMA 5CVVA 2DTHA 4EJVA 3L09A 2OZUA 1VQ8I 4ENJA 2KLOA 1K4TA 4C2UA 3H5NA 1BR1A 2JNGA 2PZ1A 2ZPBB 3GF2A 4YEJA 3RYRA 3VV0A 4BEHA 1IZ6A 4NCXA 2ZT6A 3CCUT 3NWSA 5JI6A 3NEMA 2Q7EA 3CMEQ 1AKHA 2X35A 4LGWA 3VSKA 4CCNA 3OA6A 2QQRA 1VQMI 4IKFA 5K7HA 1KOGA 3H35A 4ZYHA 3GTPJ 1H9TA 2CRGA 2LC2A 1RIQA 5EJCA 5ICGA 4YFKF 3Q0VA 4RQEA 1TQMA 4B9WA 1NYQA 3GZ5A 2R7TA 1K0XA 2O4XA 4EM1A 2DK5A 3SWNB 3CCVQ 5GAOr 2FD5A 4OAZA 2CZ6B 2D8JA 4QPQA 4FX4A 3TW7A 1NJ1A 4JZ4A 1B59A 1WGSA 4PJNA 4KT5C 2IGNA 2Q8KA 1GCQA 2COWA 4WTOB 4RB3C 3FC3A 3HXZA 1WVRA 4WF2A 5K1YA 1YWPA 4C92E 1K4US 1EOVA 2MGQA 3U21A 2DA9A 1NJIC 2CT4A 2P8TA 5LJ5h 1FBSA 1WFWA 4YRGA 4IHWA 3U9GA 4KN7X 1OQYA 1YG2A 3S32A 4J6WA 4I0AA 1NLOC 3FHNA 4PK4A 3F3XA 4AVPA 3VWBA 2DYIA 2EYZA 2F2WA 3UA7A 2AMCB 3VS6A 2K4JA 2Y9ZA 4RCBA 2MYSA 4H2XB 3HPGA 3G4SA 3JCMe 1MBEA 5HODA 3S17J 4LLGF 4XK4A 4C92C 1X3ZB 1HQCA 5DDGA 5GANj 4HF2A 1BCMA 3ZR8X 4G84A 2ZO4A 3CO7C 3IUOA 4AC0A 2D2WA 3BG5A 3PO2J 3MP1A 2VBZA 2HVSA 3LLRA 1UECA 3DB3A 2EB7A 1E3PA 3VYUB 3P9CA 4PUSA 3UFGA 1A6IA 3GP8A 2WY7Q 4ZDPA 5L3BA 3GTOJ 4I98B 2HQ5A 3DPTA 4IRGA 5EDNA 3QPLA 2GFUA 3WU1B 5GAN5 1OCPA 3MN2A 4A0XA 2R5MA 3NPFA 1Y0NA 4A5NA 4B8XA 4DNCA 2O5RA 1SRMA 3VYHB 5LJ3h 2ZT8A 1LNWA 2MABA 4RTWA 2GA2A 4NUBA 3GTKJ 1O3SA 1QCOA 4Y91A 3TMOA 1WJCA 1K76A 5CQEA 4AFUC 3CCRA 1OKRA 3DPLC 3HYIA 4M3GA 1O7FA 2GBYA 2DETA 2A61A 3WU0A 2K9LA 1SEUA 2FPEA 2LVSA 5FWCA 1T0JA 1SFKA 2DCEA 1XGNA 2E5ZA 3UT1A 3F72A 1KQ9A 2A07F 2K86A 3EGXB 3F6OA 1JU5C 2ZMEB 2V1DA 3GYHX 3FXQA 5E1ZB 2ZPFB 4OB1B 1NH3A 2KIMA 4ANJA 3D1NI 3R61A 4P74A 3E5QA 4A4GA 2M2EA 3RR6A 1SD7A 2IJLA 3PJRA 2Q2EA 2X0LA 2DDBA 5IYBJ 3OYDA 1W36D 4MEXF 2CV1A 2STWA 1ABQA 1RI0A 3MKYB 2A7YA 3INZA 1K83J 3O8HA 3GIBA 3QPTA 4YELA 1PD0A 2GLOA 3KFWX 1Z3YA 3ZQGA 4AUXA 2EIKH 2HOTA 1B4AA 3C94A 4M7AB 2L7KA 1MDMA 3KEOA 4FISA 4LG0B 1OPLA 3EFSA 2ESWA 4XRSG 1OEBA 1VQLQ 1FMWA 1R8OB 3FBIB 1HC8A 1KK7A 3CC2T 4FASD 2GTJA 4M7DD 1OU8A 2XGTA 1RACB 1I5ZA 2ZXIA 3IKMB 4BHPA 1MMDA 4L6V5 4CC4B 1FYFA 1WJFA 1YW7A