4DQ2A

Structure of staphylococcus aureus biotin protein ligase in complex with biotinol-5'-amp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4dq2A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dq2A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dq2A02
4A5MA 2GXBA 3GFLA 2ZIMA 4UVAA 5FO5A 2O61A 1C0WA 5GANf 3WGHA 1O3RA 4IXAA 4EM1A 1XB4A 1TH7A 3C7JA 4P73A 4C8QA 3KFUA 1P4WA 2RHQB 3V8JA 3FMRA 4G7HF 2CJBA 1SD7A 1SMTA 3REXA 4XQ3A 5GAMd 2ETHA 4IRHA 3MAJA 1YTYA 3INZA 2DU7A 3F72A 5K1YA 2DJZA 3CJNA 2FNAA 1T0FA 3FM5A 3VQWA 4RCCA 1XGOA 3QHSA 1P6RA 5GAOp 4LNSA 2CSOA 5D8KB 4TVAA 4RB0A 1FT9A 3REOA 4UXNA 3P8VA 3WG9A 5J8CA 2JPCA 4WK8F 4RB1A 2XASA 4OMZA 3WGGA 4IVNA 3LQQA 4XEOA 2FBKA 4PJOF 1U5TB 4OIOF 1QPMA 1CF7A 2BGCA 3LSSA 4TTVA 3LA7A 2M1BA 4M7AA 3KP4A 5K5RA 5CVUA 5GAOr 3J81K 2J5OA 3DPTA 3FM3A 5F1RA 3UGTA 4MEYF 1KOGA 3HYIA 4UHTA 3O3KA 3IKTA 4A12A 3BJ6A 4ESFA 4ZTUB 4YRIA 3GW2A 2IJLA 3SZTA 1UB9A 1IN4A 5C53B 1NJ8A 4GGGA 2P7VB 5E8IA 5GANd 2ODRC 1G3TA 3I53A 2ARUA 3TO9A 4L5IA 4P9FA 2C8MA 1F4KA 1BBYA 4ESBA 1MJAA 3P9CA 4EX5A 2DQ3A 2DQLA 4OMYA 1JRIA 5CYVA 1QF6A 4DNCA 2VXFA 4XU1A 4L9NA 1I1SA 2ZR2A 4M77A 1SFUA 1IRGA 4XLPF 3IKMB 3ZMSA 3A7AA 2Z9OA 4HT8A 3RJPA 2PN6A 2P7CB 1X2GA 2MC3A 2HYFA 3FMSA 1MKMA 1AWCA 3P9IA 3IG2A 4G84A 4M75G 1ZG3A 4ZYGA 4PJOD 1Z7MA 2MLGA 5LEKA 1JGSA 4YRRA 3KP5A 3P8TA 2GZWA 2PFBA 3HSBA 2AS5F 3BJUA 1G3YA 4KUMA 1G4DA 2EFWA 4EMSA 4HWRA 3JCMd 1OMIA 1U3EM 2FOKA 1YS7A 5LHIA 3RPQA 4PHCA 11ASA 4JLIA 4IF4A 2ZGWA 3WU1B 4I01A 2QENA 3R61A 1BIAA 1H4VB 4BWAA 4XBFA 4P3PA 5E18F 1O7LA 2K86A 4C8QB 4YRMA 4MQVA 5GAMg 2F5FA 3H3ZA 3D0SA 1H4SA 3T8RA 3HTZA 5K1XA 2ESNA 3K1MA 4M9ZA 4P71A 1FNNA 5K1PA 5E1WA 4G94A 4Y15A 1RUOA 3K2ZA 2DVEA 5GAN4 5DD4A 2Y48A 3M1EA 2DTIA 4Q47A 1B9NA 2Y75A 2A5YB 2XGTA 4OINF 2NS0A 2F5EA 4L0YB 3SZPA 4LMYA 5FLXK 4IPAA 2P0LA 3C18A 3VQXA 2Y90A 3CUOA 2O3FA 1B59A 3EETA 4C92D 2CYYA 2DAOA 3AHUA 2QQAA 2BYVE 1CF7B 4J6WA 2XAJA 3VB2A 4M7AB 1R23A 5ICGA 2O0YA 2YX4A 4HF2A 4N9HA 4HWPA 1K78A 2DKGA 2M45A 1TNTA 4HWTA 1LDJA 1J2XA 5GANg 3LFKA 4WWCA 4EMKA 2AMCA 2DXTA 4JQFA 1YB3A 1SMYF 2DZ9A 4OIRF 1R00A 4CICA 4A53A 1L0WA 4S04A 3F21A 1FYLA 2RN7A 4G9YA 1JE8A 4MNUA 2NAZA 4KMFA 2MA3A 4H2XA 4M77B 4IHTA 2BBYA 2ZBKA 2EJ9A 2ALYA 4YRTA 1XCBA 4BXUA 4X9CA 1PP7U 2KJBA 1KU2A 4M6XA 3DXJF 3GEZA 5D4RA 2Z33A 1S7OA 4KNYA 4YPFA 1GXPA 4EGZA 4M9XA 1N9WA 1G6NA 2RDPA 4MMKA 3WTZA 3QSUA 4XLNF 4C8QE 3FB9A 2P5IA 1FY7A 1T2KA 4N0BA 1MZBA 5BPDA 3I0TA 5L3FA 5E3IA 3GFMA 1ADJA 4WXDA 3MWMA 4RGUA 3F22A 4M7DA 5LJ5j 2P6TA 1HKTA 3BOQA 3GWZA 1FSEA 5L3GA 2QQ9A 4KT5C 4XTZA 4JUVA 5K5OA 3ICAA 3VEPA 4JK1X 3FXRA 2F5CA 2P8TA 2RM4A 3B73A 4MHGA 1BIBA 5LJ3h 2QBYA 2HS5A 4M78C 3CDHA 4K2EA 3WTXC 1S7AA 3O2PE 12ASA 4P72A 3IWFA 3SXYA 3GVAA 4P9UA 2DBBA 4MGRA 4M78A 3G1ZA 3ZN1A 1W7PD 2L3DA 2OZ6A 4I2OA 1LJOA 2QQBA 4M75D 2DQ0A 4EO4A 1FYFA 1QNTA 4L9TA 3SWNC 4Y13A 1BJAA 4QVCA 4UP9A 1YG2A 4BNCA 1G3SA 1REPC 3T1BA 1YYVA 1P2FA 2ODRD 5GAMe 4GXOA 1MGQA 3CO6C 1UHWA 2V1DA 4RQEA 2QTXA 3BPVA 1HTTA 1IXCA 2STWA 4N0AC 5GAN5 1OYYA 3JCMV 4MTEA 1U2WA 1BI3A 5GMKh 1JXSA 1TBXA 3LA3A 3FIFA 5JR3A 2FNPA 1Z1DA 1K78B 5AIPA 2P5LC 2JSCA 5E17F 1WWXA 3HSRA 3F8CA 4ON0A 1E2XA 4OOIA 2H09A 4EMKB 2ZNJA 3A74A 2AMCB 3HHHA 4U7DA 3V7CA 5GMKi 1EFWA 3DP7A 3KEQA 2EJRA 1RI7A 1EH6A 3P7NA 3BDUA 1HKSA 4F7UA 3FX3A 4HX4A 2VBYA 2CFXA 4KDPA 4H2XB 2EA4A 1FYKA 4Q4ZF 2PMHA 5DEQA 3HFOA 3IL2A 2ALYB 4EMGA 5GANe 3DSQA 4P5OA 4PCQA 1EV7A 3WTSC 2FF4A 1P4XA 5E20A 3HY1A 1EH8A 2DK5A 5FB2A 4UV8A 1ADYA 4M74A 3HXWA 1XDSA 4LB6B 2XROA 4UVBA 3NEMA 4L87A 1YFHA 5DY9A 3EYIA 3A7UA 4IRIA 3RESA 1N9RA 5CAIA 4Q48A 5CVJA 1S3JA 4CXFA 2NNYA 5L3BA 4CYDA 4G6QA 5GMKm 4TWAA 2O6GE 3KLNA 2PMEA 1MD0A 5ELOA 2FEZA 4XRFA 4CH4A 2GQQA 3VU3C 4NB5A 1U5TC 2RVCA 2DI3A 4FX0A 3K1NA 1U1SA 3JCMe 2L4MA 2QBYB 2VC8A 2GAUA 1WNLA 1R58A 2DU5A 4LK0F 3JCMJ 1I6XA 4CH6A 4M78B 1E1TA 2E1NA 2IY5B 4AIKA 1JJCA 2ZT5A 3COAC 3JB9I 4BAYA 5BMZA 4PGHA 3E3VA 2VBXA 3EFSA 1BI0A 1ZGAA 3HTUA 2QUFA 1WYDA 5IT9Z 1Z91A 4WX9A 1KQ2A 3F3XA 5GAOm 1R36A 3R6SA 3WTWC 3TKYA 4M78F 3FJPA 5LGTA 1B8AA 1SETA 2ZO4A 2EFPA 2IVMA 1SFXA 2YPRA 4XU2A 4LGWA 3HFVA 1D5VA 1WQ7A 1OPCA 1BBUA 2K27A 4GCVA 2FQ3A 3I59A 5FD5A 4QLCU 3ROUA 1USYC 3ZMDA 4KN4X 3V4GA 2QWWA 4C92A 4H2YA 2G4CA 2FYKA 2VT2A 3KFWX 1O57A 1EVKA 4UP7A 6PAXA 5GAOn 3JSOA 3Q9SA 4F7UB 4QVDA 1I5LA 1KQ9A 5E8GA 1D3BB 4H2SA 4K88A 4CS3A 4AVPA 5H6QA 1KU9A 4YRJA 4J5YA 2VXEA 1Z6RA 3E9HA 1CGPA 4HQMA 5LJ5d 5GAMh 2E1HA 4M9SA 4BHCA 2JT1A 4P73C 4C8QC 4ENKA 3CO7C 4OIPF 1YW7A 1YO5C 1RNLA 2L4AA 2DPDA 1WRJA 1K6OA 4TQDA 3RDIA 2E7XA 2DPUA 3PQKA 3QP6A 5EEGA 3VFZA 1XSVA 1J0RA 1EIYA 4YREA 1R1UA 3SFZA 4M78E 2IPQX 1RIQA 3EFRA 2A69F 3GXOA 4CDGA 2Q7GA 2ZR3A 4P74A 3TO6A 4U0WA 4WJ3M 3VOEA 4XTWA 1SD6A 4RQFA 2ZIOA 4IRGA 4I7HA 5JI6A 3HXVA 5HDGA 1SD5A 4U0YA 2CQKA 1LEBA 3QU6A 4U7BA 1J75A 1IZ1A 4HOBA 4KFCA 4M7AC 2JRTA 2KRFA 2HZTA 3HSFA 2GIVA 1TLHB 2PMFA 4HDUA 3JCMf 3NETA 3RKWA 4HDVA 4HLXA 5GANh 1FOKA 4YYEA 1Y96B 4PZJA 1HBXG 2ZT7A 3T5XA 5HGQA 1MJ9A 1Q1HA 2K4BA 4M73A 4BHBA 4ZYHA 3A5ZA 4EMHA 4P96A 3OD1A 1BOAA 1B70A 3ZQ7A 2QLZA 3GFIA 3V7RA 5DUKA 5LJ3j 2M8EA 4LFUA 3MF2A 5J6XA 2XTIA 1WKMA 4RDXA 2FSWA 3B02A 4M77C 3HRMA 4ENNA 4F7UE 4EJVA 1KMNA 4YG2F 1H641 3CMQA 1WPYA 3S2WA 3MZHA 4M75A 3RKYA 4TQFA 4HYEA 3GFJA 2GA1A 2HGCA 5FFXA 4CS4A 2VOOA 3WTUC 1G51A 2W24A 3UH0A 1KQ8A 4I02A 3JTHA 1X2HA 1SESA 2ELHA 3HOSA 2KJCA 4Q6GA 3OOPA 2G9WA 2E5AA 2DQRA 2LNBA 3A32A 1NYRA 4B09A 5TRDA 1KU3A 4KIBA 4X5OA 1TQPA 4UUVA 5GAOq 1QE0A 1FBSA 3ERRA 1G5IA 2A6HF 3RYPA 4UP8A 5GMKj 4P3OA 2HTSA 3HIFA 2OQRA 1XSDA 2Q5HA 2ZMEA 1IL2A 5H6RA 3L1AA 3HY0A 5AONA 1WLEA 3V8KA 2DW4A 3JCMb 3BROA 4CH5A 4YFXF 3J80Z 4NL2A 4CZZA 5ELNA 4P71C 2EFOA 3HRIA 2MD5A 3RPUA 3F8MA 3JB9G 1ODDA 4KR3A 1FBUA 2IRFG 2CO5A 2V9VA 3NELA 3M4QA 3CLOA 1D3YA 1EIYB 5ILVA 3HSEA 4YFKF 3HFNA 2E3CA 1JHHA 2VC0A 3T0YA 4HWOA 2QYOA 1X55A 4E70A 3RYRA 2BE5F 5L3DA 4TVAB 3FZVA 3RF1A 1H4TA 4C8QF 1XD7A 2DEQA 1IXSB 4EJUA 4HWSA 3L2CA 1Z9CA 1STZA 4O6JA 1USSA 5GMKl 4JRIA 3LC0A 2XGXA 3A5YA 3RL6A 2Q7EA 1KGSA 2KIUA 3E5UA 3HRSA 5A2QZ 1IAWA 4PG3A 4HX7A 2NYXA 1FZPB 4I0BA 1EVLA 4FHTA 1YS6A 2H94A 1ZYRF 4EMKC 2FA5A 5F64A 1BI1A 1LNXA 4JRKA 3I7FA 2J5PA 2YLBA 1FX7A 3OV8A 1Z7UA 4MMLA 4H2UA 1NNHA 3C3WA 1FP1D 5DV5A 4GYIA 1DP7P 2Q2EA 2ZT8A 1T98A 1YW9A 2HYGD 5BPIA 4OIQF 2FBHA 3TDZC 4M7AF 3CTAA 1I27A 3L00A 2ZNIA 4OLFA 2W57A 4M71A 1QBJA 2Z5UA 5IT3A 1F1ZA 4M75B 3BP8A 5GAOl 2DU9A 5D5XB 3U2RA 1NJ5A 1SD4A 1LOJA 3E6CC 3PGGA 4Q15A 4YRKA 1ZHFA 3QTCA 4O3MA 3L09A 4C8QD 3HOTA 2KKOA 1KU7A 2ZZGA 2OA4A 2D45A 2DTHA 3GF2A 1LVAA 3HFZA 2QHTA 4UPAA 3WTTC 1W66A 3RIRA 4M77F 3JCMg 2ADUA 5HDKA 1ZRDA 4M7DC 1X01A 5GAN8 2DDZA 2OZUA 2L01A 2MLKA 1ZREA 2STTA 3WGIA 2H27A 3E6MA 2E7WA 2ZMEB 4FX4A 3HXXA 1I5ZA 4N9IA 4B8XA 1X54A 1GVJA 3JB9F 4A0ZA 1ON2A 1X56A 2BV6A 3R0JA 4AH6A 4P72C 4S05A 4G7OF 1J59A 2VN2A 4ESJA 1L3LA 1WQ2A 2W84A 3DF8A 3LWFA 1GHCA 4HX8A 3QAHA 3CUQA 3LAJA 2K7LA 4M7AE 3PQJA 2JZYA 1XGSA 5IT9K 4EGYA 4YRLA 3F6VA 2A3SA 2V6CA 3BWGA 1UCRA 1Z6TA 4RB3C 5GAMj 3KEOA 1ON1A 4NOYA 4XTXA 3GYHX 3JCMQ 1X3UA 3A7RA 2PQ8A 3JB9J 2COMA 1M8VA 3JCMc 3NRVA 4LG0A 4XSXF 2FBIA 1B4AA 5ILSA 1WI9A 3EYYA 4G6DA 3RTRA 1B9MA 4YRQA 2H6BA 3ZMTA 1S6LA 5DYMA 2I4MA 1FP2A 5LJ3d 3VQYA 4M78G 4EVIA 4O5VA 4M75E 2EFQA 4M77E 2O03A 1KYWA 1W5SA 3RUXA 4IHSA 3EUHA 3LA2A 4YRSA 1XN7A 5ICEA 3JSPA 2ACJA 2IT0A 4XTUA 3W3SA 1LB2A 4UNOA 1UHMA 3JB9D 2RNJA 3ULQB 1IN8A 1PUEE 1TW2A 3TUPA 4EJWA 5K5QA 5D8LB 5BOXA 1O3SA 2I2LA 1L0OC 2G7HA 1EQRA 1ZLJA 4YCUA 2NRAC 2XRNA 1N9SA 1V4RA 3FXQA 2E10A 4HBLA 2YLCA 4YRCA 2ZZEA 1DDNA 5GANj 1D8JA 2Y0MA 2DXUA 1J5YA 3HXZA 1QZYA 3ABUA 5HLHA 2GXGA 5D5UB 2RA2A 2XAQA 5LHGA 1H9GA 3ABTA 4X9DA 4O2DA 3PFIA 5D4SA 4LLNA 1E17A 1PYSA 1O3TA 4I0AA 4ZIBA 3Q9VA 2FRHA 3K69A 1VTNC 3HFZB 4HV6A 1HK9A 5TJJA 1P92A 1R22A 2O8XA 2JTVA 1B76A 2IW5A 2ZFWA 3JCMX 4M7DB 5JHUA 1RUNA 1ZG1A 4PNOA 1DPRA 1F5TA 2EJFA 4XEMA 2XUBA 3J7AO 1QQIA 2EFNA 4Q5SF 4P75A 5CVVA 1JBMA 2HNIA 1FPQA 4G8XA 4PJOA 1G3WA 1FSHA 4BYYA 5GAN6 2A61A 4CO8A 1XCVA 3LQRA 2HEOA 1USTA 1ZG5A 1YQAA 2YSRA 5HLIA 2HOEA 3IWZA 4M7DF 4YRGA 5EEHA 4ASNA 4LD5A 2UWMA 1TNSA 5ED4A 4YRPA 3G3ZA 3LSQA 5LJ5f 4RB2C 1NJ6A 4F7ZA 4DPGA 3HUGA 4I09A 3I4PA 1B7YA 3DQVC 3JAMZ 3K0LA 1KA8A 2XKOA 4LB5A 4HF1A 3E5XA 4GO1A 3ZN0A 4K86A 1J5WA 3M4GA 4U0VA 3GZ6A 2Q5IA 3WE3A 2FXAA 1B1BA 4CHUA 4KMUX 1IN7A 1H4QA 2QM3A 3HXYA 5HLGA 3JTGA 2D1VA 2RHSA 1TTYA 3BJAA 3TDUC 4KIGA 4HQEA 3ZMUA 3I64A 3BW1A 4C92C 1YCYA 4M72A 4G85A 1LDKB 2EJGA 1S29A 3ZMZA 3NQOA 3FHZA 5ILUA 3RI4A 4LJZF 5HS7A 4HZFA 1C0AA 4XU0A 4V2SA 1VQZA 5LGUA 3FXUA 3GO5A 4MTDA 4JBAA 1V3FA 3W6JB 2FMYA 3M7GA 3HRKA 4M7DE 3VBBA 1PP8F 3D5LA 1KQ1A 3Q5FA 5L3EA 3J80K 5D6EA 1FYMA 3PCOA 2ZCEA 4HT9A 2OD5A 4WI1A 1DPUA 1PYSB 2E65A 3F23A 2LDUA 3H92A 3TOBA 4KQEA 2ZXFA 2PBIA 4F7UF 3MEYA 2J3MA 3E9IA 5L3CA 2PMUA 1HW1A 4M78D 2ESHA 1LNWA 1MGTA 4CS2A 2OQGA 4H2WA 3F8FA 5FFZA 1S8NA 4EV0A 2RB6A 4P74C 3WTYC 2M5WA 3R0AA 3N4MA 1FBQA 1ZLKA 3TO7A 4BH9A 1OKRA 2WTEA 3M8EA 2YU3A 4RS8A 1SAXA 2HKOA 2EWNA 4LLLA 3KP6A 5HS9A 2EV0A 1BC8C 4PJOB 2R3SA 1KMMA 3NEUA 2L54A 4C8QG 5A2QK 1XGMA 3MQ0A 4ZTZB 2CJAA 2EK5A 1E24A 1M5Q1 2YHTA 3WODF 3TQNA 4CH3A 1FLIA 4AIJA 3BZ6A 4L0ZB 1HXDA 1JJCB 4NCXA 3JW4A 3JB9H 4TVYA 3N97A 1B7YB 3VODA 3BJOA 2A6EF 2HTJA 4WXHA 3ZPLA 5LLQA 5DCMA 2DZCA 4YRFA 2CGHA 4RAZA 4A54A 1IW7F 3E5QA 4WJ4A 3QNEA 3R07A 4WF2A 1YW8A 4PGGA 2DO7A 4U88A 3HHGA 4M75C 2VBWA 2EV5A 4M7AG 1W7PA 4HV5A 1TW3A 1Y0UA 3FMQA 4RGRA 1J9IA 2EL9A 2RHSB 5F5WA 2YX7A 1NJ2A 3GIBA 2J3LA 4A0YA 2QZ8A 1OYWA 3ERED 2QHSA 1TQIA 1ZH5A 2I4NA 2VOPA 3ECHA 2E1CA 4XU3A 4A5NA 5J8FA 2VONA 2F2EA 3WU0A 3IHUA 4H2VA 3REUA 3I59B 5DUIA 2PG4A 3HRUA 1LQ1A 3IC7A 1U6GA 3JCMh 4C92B 5LJ3e 1RIOH 3QO8A 5HVQC 1XMKA 5ERIA 3T8TA 4YCWA 3F8NA 4QWQA 3ZP5A 3L4GA 3ELKA 4M77G 2IA2A 5LJ5g 4EQQA 2DFIA 1YFSA 3P9KA 3WTVC 2VT3A 4NHJA 3U9GA 4C92F 4WXCA 3PCOB 4H0EA 4IJAA 1I8FA 4AD9A 2AXLA 3ISPA 4A6DA 2GWRA 2FMLA 2IA1A 4PJOE 3PZCA 1IN6A 2X4HA 5AIQA 3VQVA 2XKPA 3M9AA 5GMKe 1B6AA 4KYWA 2D1HA 4HLYA 4ENMA 3KP3A 3IKLA 3KZZA 2Z99A 4L9VA 5LRSA 5GAN7 1O7FA 2VE8A 3DV8A 2F5DA 1Z7NA 2UXNA 1ONVA 5FD6A 2MH2A 2A68F 4KN7X 3IALA 4L9JA 1LDDA 1ZRCA 5D6FA 2P6SA 4TV7A 4ETSA 3WQZA 2ISYA 5FGMA 3QU3A 1GGMA 2MH9A 4BQAA 3KETA 4P55A 2V1XA 2R7DA 3QP5A 4HW0A 2OBPA 1GXQA 1I81A 3I71A 2DTRA 4BW9A 2XV4S 1LJ9A 5CVRA 2ZNYA 3NENA 3P8YA 1YFTA 1TQMA 4WCGA 4Y91A 5JVTA 2M30A 2E41A 1YFRA 4ZH4F 2P5KA 2HDCA 1LEAA 1YLFA 4R8HA 3U1DA 4RGSA 3TOAA 5DCMB 2QHVA 4LLGF 2YR2A 1W4MA 2ARTA 4C92E 2QHUA 2V79A 1SERA 1B70B 1BI2A 4NQWA 3IRQA 2ZKZA 4KA4A 4CGZA 3LSTA 3MFKA 1ZRFA 2HFHA 3J81Z 1NHAA 2ZCWA 3KZYA 2VE9A 2FE3A 1R5GA 3F6OA 1W7PB 3TEHA 2K4JA 4TVWA 2LF8A 5HDNA 3DEUA 2W85A 2GA2A 1B34A 4MEXF 2HWVA 2JN0A 4L5JA 5LRRA 3ECOA 2LKPA 1YIOA 2ZJ2A 1WU7A 4KR2A 4UV9A 1QO0D 5KK1A 3HXUA 4YIFA 4XTYA 1ASZA 2XIGA 2VBZA 1BM9A 3K9TA 4XSZF 4D0PA 2ZTGA 1W5TA 4YRNA 4AIHA 2XAFA 2HR3A 2ARSA 4H2TA 2X0LA 2RQPA 5LJ3f 1EH7A 2KIMA 3HRTA 4NL3A 2ZINA 1K7AA 4M75F 2RV8A 1T39A 2H6CA 2LF7A 1O3QA 4EJOA 2ZXJA 5C52B 2XAHA 3L4GB 2K02A 1QZZA 3EQLF 3KCCA 3MZYA 2PLYA 5KVRA 5ICFA 4HF0A 1I4K1 1R1VA 3ML6A 3R4KA 1LYLA 1IF1A 4YIIA 1E22A 4RMFA 5F6FA 2DK8A 4KICA 3KP2A 4HVCA 4R1HA 3M4PA 2EAYA 5KNNA 4M7AD 3SHFA 3CUQC 4LK1F 1U1TA 3SB2A 2EV6A 5LBQA 1MDMA 3F8BA 1I1GA 1JHFA 3QOPA 2OU2A 1HSJA 5LJ5e 1FC3A 2DT5A 3QUIA 4L18B 3BY6A 3JAMK 4M7DG 1ZGJA 1G5HA 3E6BA 3JCMP 2C6YA 4DQ2A 2CGPA 4EM0B 1BC7C 3HTSB 2IA0A 4J6XA 1NJ1A 4UVCA 3GLXA 4BHPA 3KLOA 3H3UA 2IY5A 1PDNC 2CIMA 2UZKA 2XVCA 4M77D 2JPBA 2P5VA 4H02A 1HKQA 1HC7A 1XDUA 2K57A 2B0LA 3C1DA 2A07F 5DDGA 1U8RA 3QO5A 3SWNA 3ZMVA 2HQNA 2M87A 3GUDA 5DD8A 1FWZA 3GZ5A 1UFMA 1XSXA 3W6KB 5E1XA 5D5WB 5FLXZ 4PDKA 2NNNA 1E1OA 4J6YA 4J15A 4Y17A 3RKXA 1XMAA 2V1UA 2VXZA 5JFRA 3BPXA 4N0AA 1WQWA 4YP0A 3R60A 5LGNA 3K1PA 1OYIA 1Z05A 4R79A 2ISZA 4ZYEA 1SRYA 2AKWA 3E6DA 3DKWA 2WC2A 4A0XA 3TEHB 5BS6A 3RACA 3FWEA 3JCMW 5I21A 1B34B 2EA2A 4M6YA 5H20A 2Z3YA 2WV0A 1KQ0A 4G7ZF 2PI0A 3QO3A 1H0MA 3BFMA 4YFNF 4OU0A 4HA8A 3L7WA 4A6EA 3BDDA 2D2WA 1J7KA 1R5HA 1D3BA 2XHKA 3RGLA 3DFGA 3AAFA 4YCVA 2VODA 3SQNA 3BY7A 2R7FA 4AWXB 4F7UG 3KP7A 3V7SA 4K87A 3V8LA 1T38A 3GX4X 1AOYA 1YGBA 2Q8KA 1SFEA 2UXXA 2HKXA 4P75C 2RKHA 2RHQA 1HQCA 1QGPA 1HSTA 4ZZLA 4PJOC 2CJ9A 2QVOA 3E97A 3UGQA 2DTOA 1NYQA 2CWEA 2XAGA 2FB7A 4EM2A 5DCFA 1R1TA 2TDXA 1OR7A 2CG4A 1R7JA 2PJPA 4A2UA 3I58A 4GYGA 5CJ9A 1HW5A 1P4AA 1MDMB 2MBFA 3CUQB 2Q0OA 3TEGA 1H9TA 3QRFF 1D8KA 1U78A 2PEXA 5D5VB 5C51B 1WSUA 1EOVA 3KE2A 3EDPA 4MQ9F 4Z2YA 1U5TA 3L2ZA 1DUXC 2ZNZA 2ZT6A 4YROA 2RGVA 2L02A 2CW0F 3QPHA 2I4OA 4KIFA 3WE2A 4ZYDA 4PJOG 1MJBA 2WWYA 4P3NA 3I5UA 4LG0B 1Y96A 1A04A 2W25A 1K79A 2P4WA 5LJ3g 4FT8A 3RERA 3MEXA 2VC1A 4E51A 2BEOA 1ZARA 3DPLC 2HQRA 1XGNA 2I4LA 1IXRC 5ICCA 3IKVA 4ENJA 2EB7A 5LEJA 2FU4A 1KYZA 3FF5A 3SWNB 3UFGA 5GAN2 1BN5A 3M8FA 4ZZDA 4OP0A 5GAMf 3LAPA 1F9NA 3MCZA 1ZAOA 5HS8A 1RZ4A 3A31A 1BBWA 5LHHA 5LJ5h 2IP2A 4RAYA 2AKWB 3QO7A 4M7DD 2OAZA 2LSOA 1T6SA 1HW2A 2KIFA 1IRFA 3G73A 5BQTA 1ATIA 4RGXA 2C7IA 1ZN2A 3L9FA 1ASYA 1IN5A 1USYA 4EJTA 3MF1A 3O6BB 1IUYA 4HAMA 3TGNA 2RD1A 2G7UA 2ZZFA 5CVIA 3IRRA 3I54A 3QPTA 2Q7HA 4YDQA 5CLSA 4C92G 5HOOA 2RC4A 5E1ZB 4RCBA 2E64A 4I98B 5GAN3 1ULYA 4XTVA 2DLLA
chains in the Genus database with same CATH superfamily
2GXBA 1F1BB 3QKJA 5FO5A 5GANf 1O3RA 2AHQA 4D9JA 3IH4A 1MBEA 4E2FB 5DM6F 4G7HF 1LVKA 3EFOA 2CJBA 3CCUA 1BR1A 5GAMd 2EYQA 2DU7A 5K1YA 2DJZA 1UZCA 2FNAA 4OB2B 1YHQA 3GTKJ 3QHSA 2G3RA 5GAOp 3MEUA 4LNSA 2AT1B 2CSOA 2ENMA 2IS4A 2Y2ZA 3HOXJ 4RB1A 4QVZA 3CC7I 4IEJA 1N8RR 3ZBDA 3ZCOA 3LSSA 3LA7A 2DJIA 1B72B 3E0JB 3KP4A 3DPTA 2KRCA 2K2MA 4OMQA 3OS5A 3BJ6A 1WI7A 4ESFA 2MC4A 2RQRA 2A36A 1UB9A 1IN4A 3VPRA 3BTIA 2FPFA 3X28B 4GGGA 5GANd 4DOVA 1YJNT 3WVDB 1K8AR 2ARUA 3TO9A 4L5IA 1ETWA 3P9CA 1TWHJ 1WCMJ 4XU1A 5KHDA 3NGPA 1IRGA 3IKMB 3A7AA 4HT8A 2WAEA 3RJPA 2PN6A 3RR6A 3CF5F 5KCHA 1MKMA 1AWCA 3P9IA 3D1NI 3K6GA 2KQRA 4GLMA 3BTCA 4ZYGA 4PJOD 2E34A 1AZGB 1JKQC 5LEKA 2EBIA 1X27A 1VQ6T 2BUDA 5KYUA 4Z6YA 3HSBA 3EH1A 1G3YA 4EMSA 3K10A 2FOKA 2O9VA 2JVHA 4PHCA 2HBWA 3VSKA 3CCJA 2J05A 1Z21A 2K7AA 3DEEA 2HKNA 1H4VB 4BWAA 1OCPA 4MQVA 5GAMg 3OYCA 3T8RA 3K1MA 3O8GA 1RUOA 3TCJA 4UB8C 2Y48A 1QQJA 1X6OA 3FDRA 2Y75A 2GLOA 5EZGA 4LMYA 3MJXA 3EUAA 3MO8A 2O3FA 4QIWN 4IUVA 3AHUA 3UNGC 3H8ZA 3L2RA 2L8DA 5D7UA 2HVRA 2PNIA 4M7AB 1VQKI 4HWPA 1V1CA 1XNIA 1ETKA 1OCCH 5GANg 4XLAA 2AMCA 4JQFA 2JA5J 2X51A 2AZVA 4CICA 2CUFA 3NARA 1FYLA 4ZJZA 1IUFA 3CCQA 1JE8A 2F4OB 3H1CA 2EGEA 4KMFA 2MA3A 4MDXA 4M77B 4IHTA 2CT4A 2ZBKA 2ALYA 4HCBA 1QVPA 2IGOA 4BXUA 1K0XA 2TCTA 1PP7U 2KJBA 5FU7C 5E3LA 2RHXA 3GEZA 5D4RA 2PMZN 1R0BG 4EGZA 4BL0B 3ME9A 2RDPA 3MQZA 2PUKB 2OTLT 2LD5A 2FRYA 3X24B 3F9KA 3I0TA 5L3FA 1UAAA 4M7DA 1PG5B 1KJWA 1Y57A 5LJ5j 3L2WA 5I11A 3BOQA 3GWZA 2FZCB 1PD1A 3NPFA 4JUVA 1P9QC 3JREA 3S15J 2HOSA 3QBYA 4XTZA 1SG5A 3FXRA 2RQTA 2HDWA 2NS8A 2RM4A 4UUTA 4LUEA 4A63B 3G2BA 2QBYA 2R7SA 3WTXC 1S7AA 3IWFA 2DBBA 4MGRA 4PJLA 3ASNH 3MEVA 3GLLA 4LDUA 1BYMA 1JJ8C 1XC5A 3SEMA 4BNCA 1G3SA 5AYFA 2ODRD 5GAMe 1MGQA 2V1DA 2M0CA 3R6NA 1K9MC 1OYYA 1U2WA 1YIJT 4J9EA 5JR3A 3MPUB 1WPKA 4IX7A 2I10A 5LFAA 3CCUI 2W10A 4ON0A 3JRIA 3A74A 2ZNJA 2HSEB 2QGFB 2YDLA 4XOTA 5FW9A 3KEQA 2V1RA 1YHQI 1AWXA 1EH6A 2BVLA 4PLLA 1WHUA 4F7UA 5ECAA 5F08A 2K40A 4H2XB 4D7MA 3I9QA 2YS9A 5GANe 5CQGA 1I50J 5M5XJ 1EV7A 2LX7A 1P4XA 5E20A 1FIPA 2L2PA 3M5AA 1EH8A 5FB2A 3K4JA 4LB6B 2XROA 4UVBA 2OJ2A 1VQ4A 4HVWA 3NEMA 1VI0A 4OB1B 3EYIA 4IRIA 1WJQA 2PQWA 1N9RA 4CXFA 4CYDA 4LVLA 4X1VA 2FEZA 4XRFA 4X1EA 1G83A 2K3YA 4NB5A 2DI3A 2XDDA 4FX0A 3A8MB 4GRIA 4KISA 4D6WA 5GTIC 4M78B 1VQ7Q 2JM8A 1EFNA 1JJCA 2ZT5A 3COAC 2CH4W 2SRCA 1K61A 4PGHA 3E3VA 1BI0A 1ZGAA 1W5CC 2DDBA 5IT9Z 1QVGA 2LMDA 5IP6A 5GAOm 2ICWG 2A6TA 1BR2A 3WTWC 1Y0MA 1KQSP 1PM3A 1XOVA 1SETA 2BY0A 1SFXA 4RLFA 2YPRA 1T08B 2XIDA 2D6FA 1OPCA 3J7AF 4GCVA 3I59A 3MN2A 2CP2A 4FT4A 4H2YA 1EVKA 6PAXA 3JSOA 1KQ9A 2K9SA 4ANJA 4DZJA 1LE8B 1D3BB 1MMNA 4ZN3A 1Q81R 1KU9A 4YRJA 2CT3A 2VXEA 3E9HA 4HQMA 5LJ5d 2E1HA 1U5SA 2FD5A 4ENKA 2EYZA 2IGNA 4OIPF 1YW7A 3LH5A 2L4AA 5EJCA 1K6OA 1FEXA 2DPUA 2FRWA 3ZXSA 3L2QA 1H92A 5EEGA 2DL7A 2F1LA 1K83J 4X6AJ 3SYTA 2R0QC 3GXOA 2Q7GA 1Y56A 4WJ3M 3CCQI 4BDZA 2E4HA 5HLTA 4MLOA 1SD6A 4RAGA 2ZIOA 3J81E 4IRGA 4I7HA 3HXVA 3HKZA 3FDYA 1UUEA 4U7BA 1IZ1A 4HOBA 4M7AC 2JRTA 2HZTA 4J9IA 2PMFA 4HDUA 3JCMf 2JTMA 3DLAA 2VV5A 3RKWA 2VASA 1FYNA 4XLHA 3CD6A 2HPIA 4F93B 4IHXA 1Y96B 1TG0A 3PT9A 1MJ9A 1Q1HA 3A5ZA 4EMHA 4P96A 1VQ5Q 1BOAA 3OD1A 5F0HA 1FMWA 3NFCA 2RO0A 4AFSC 2QLZA 2LBFA 4LN2A 3TU4K 5LJ3j 4LFUA 5J6XA 1WKMA 5IP9J 2FSWA 4M77C 3T9NA 4F7UE 5CKTA 1H641 1WPYA 4M75A 3WXMB 4CS4A 3C94A 1YITQ 3WTUC 1G51A 4OMFB 1R6RA 1X2HA 1SESA 4DZPA 1A35A 2K6DA 4Q6GA 2E5AA 2DQRA 2W0ZA 3A32A 1NYRA 5TRDA 1KU3A 4UUVA 3ERRA 5B3SH 3RYPA 2HTSA 3HIFA 1NG2A 2DL4A 2Q5HA 4JS5A 5M3FJ 2K9QA 3HY0A 1WLEA 1VQOA 2DW4A 1NYGA 3QPLA 4YFXF 1UECA 1VQNT 4KT6A 3CCRQ 2AHJB 3HRIA 2MD5A 2DA5A 4II2A 3F8MA 3CCMQ 2AZSA 1NJIR 2CO5A 4BS9A 2ROTA 5FLXE 3M4QA 1ZQ3P 2OTLI 4E7KA 3HSEA 2QQSA 3O8VA 2KROA 5L3DA 1KONA 3V42A 3FZVA 4FTHA 4TVAB 1TUCA 3RF1A 1XD7A 4N4GA 4RBOA 1IXSB 1HF0A 1STZA 4RG2A 1K6YA 2Q7EA 2LX9A 3E5UA 3HRSA 4J7FA 3H5RA 2NYXA 4C2TA 1JJ2P 3SDZA 2IEKA 1ORKA 3KZIC 1NG6A 2BZTA 1BI1A 1VQ4I 1VQMQ 3I7FA 1X1CA 1M1KC 7AT1B 3OV8A 4V2FA 4BKXA 1NNHA 3G4ST 4NS5A 4HCKA 1T98A 4KGZB 1YW9A 4M7AF 1ZX6A 3BTLA 1F43A 3EGXB 4PJMA 1U8BA 1WXBA 4IL6C 5GAOl 3W2WA 3OQ5A 1YIJI 1YP5A 1NJ5A 3E6CC 4O3MA 3L09A 5CPRB 4C8QD 3CCSQ 3HOTA 4KJZA 3GF2A 2PU9B 2RK1A 4OMNA 1W66A 4KH0B 4M77F 3JCMg 1ZRDA 5GAN8 3TEEA 2OZUA 2DDZA 1Z7LA 3WGIA 4OAZA 3HXXA 3O5ZA 4BJTA 2QCOA 1XQHA 1VQ9Q 3S3OA 1YJWA 4B8XA 3OSSC 4A0ZA 2DA6A 2P0PA 1ON2A 1X56A 1FMKA 4E47A 4P72C 4S05A 2C0TA 2FPDA 2VN2A 1L3LA 4KGVB 3I55Q 1PVEA 3DLMA 5FRNA 1RRJA 4FYWB 4CUGA 2JZYA 2E6ZA 3MKDA 3F6VA 2V6CA 1Z6TA 2WAQA 4RB3C 5IOYA 3KEOA 1X3UA 2PQ8A 1M8VA 3NRVA 2E2JJ 1B4AA 3EYYA 3JCUC 5DYMA 1S9HA 5LJ3d 4IURA 4C0DC 4M3EA 2EINH 3CEYA 2IGKA 4A3LJ 1X69A 4M75E 3W2AA 4FQGA 1MMGA 3EUHA 1S72Q 3LA2A 3JSPA 3JB9D 2RNJA 2Z1DA 3DLLA 2Q2EB 4EJWA 3TUPA 5BOXA 1ZLJA 2LY9A 4CCOA 2XRNA 4HBLA 2YLCA 4YRCA 3RQIA 1GL5A 1YBYA 1D8JA 2OAWA 2DXUA 2ATCB 5D5UB 2RA2A 2RN8A 3M9QA 4O2DA 3PFIA 5D4SA 1X2MA 3CD6I 4LLNA 1PYSA 1WH7A 4F3QA 4C3IJ 1C6VX 2O9SA 2FRHA 3K69A 2K4YA 1VTNC 3S1RJ 1O4XA 4OGEA 3PSIA 2M16A 2DODA 2M0MA 2JTVA 2IW5A 2ZFWA 5JHUA 1RUNA 1SVOA 5DM7F 1NE8A 1JUMA 2EFNA 2WSEE 2CZ0B 4CO8A 1DP3A 2HEOA 1USTA 4HG2A 2PTKA 5HLIA 2HOEA 5EEHA 4ASNA 2UWMA 4ME7A 3C0CA 3OYDA 3ESWB 3HUGA 3I4PA 4BY6B 1B7YA 1M90C 3DQVC 1KA8A 1ZSGA 3M8JA 3LLRA 1GCQC 3Q1JA 3QWYA 1X58A 3A0BC 1TWFJ 4QQDA 1YWOA 2XDPA 3HC7A 3QJ6A 1SFOJ 2GFUA 2QM3A 5HLGA 2K5IA 4BXXJ 1VQOI 1RAFB 2RHZA 3TDUC 3BCAA 5J1RA 2MWPA 3BW1A 3GTOJ 3GTQJ 2DA1A 2EJGA 1S29A 1X6BA 2HSPA 3GTJJ 1SHGA 2QYZA 2NUPB 3NQOA 3M0RA 1W1FA 3VS1A 3AG3H 3RI4A 2OC6A 1LFBA 3UKGA 5LGUA 2XICA 3FXUA 3GO5A 3JRHA 4XRMA 4CC2A 3PCOA 4CCNA 2ZCEA 4HT9A 4HXJA 3HZJA 2LDUA 3H92A 3TOBA 4KQEA 2ZXFA 3VS7A 3FHNA 4RM3A 1VQ5A 4F55A 5L3CA 1HW1A 3I56Q 2K3BA 2ESHA 1MGTA 3QYBA 4LVMA 4CCJA 4EV0A 3WTYC 2XD0A 2LQ8A 4N4NB 2VJJA 5H2FC 4HT4A 4I99C 1Q7YR 5EG0B 2XPVA 1MMAA 3DPUA 2LTOA 2JOYA 4ZTZB 3M0TA 3SJMA 2HXIA 4CZCA 1Q82R 2YHTA 4BU2A 4CH3A 3ZRGA 4D7NA 1IV8A 3HL8A 2VPRA 2QKMB 3CF2A 5IH2A 1RESA 4WCIA 2HTJA 5LLQA 5KE2A 1ZLMA 2ZXWH 1KHCA 1YW8A 3CCRA 4U88A 2A5WA 1YJWI 4MDWA 3CCMA 4M7AG 4HV5A 1X3ZB 1Y0UA 3FMQA 4RGRA 1J9IA 2EL9A 1TQIA 4X0GA 3ECHA 1VQ8T 2MW8A 3EPZA 1U6GA 4C92B 2GBQA 5LJ3e 5HVQC 2IPOB 4ESRA 1YRNB 1ZR2A 2MG4A 2PVDB 4QWQA 3ZP5A 2G6FX 1RAHB 4M77G 2IA2A 4EQQA 1YFSA 2R7TA 3WTVC 1JUSA 3HPHA 1HD3A 1JJ2A 1U0JA 3VQVA 5DLQE 3PMTA 1UHSA 3G1MA 4HVUA 2ZJPF 2KZGA 3I35A 3IKLA 4L9VA 1R77A 3QJYA 5GAN7 4QPQA 2F5DA 1Z7NA 2QG9B 1YI2Q 3LWHA 4L9JA 3A2KA 1LDDA 3CMET 3CCSA 3OS2A 5D6FA 4ETSA 1VQPA 1GGMA 2MH9A 1LPLA 2R7DA 2OBPA 1IC8A 1PUFB 1VZ0A 2DTRA 1C1AA 5CVRA 1LJ9A 1TT5B 4WCGA 3TBIA 2P5KA 1LEAA 4AG2C 1YLFA 3KXTA 5DCMB 2YR2A 2R5ZA 1VQ9A 2V79A 1B70B 1BI2A 3M56A 2DA2A 3A8HB 3MFKA 1VYUA 3KZYA 3TEHA 2DE0X 2A05A 5HDNA 2VKEA 2VIXA 1YIOA 2O9LA 2MD0A 1UFFA 1X2NA 3HXUA 3FXLA 2XIGA 2VBZA 3OMYA 1H8KA 2R5AA 3CCVQ 3C2HA 4IHVA 2L3RA 3ASKA 3HRTA 1V54H 2RV8A 2Q1ZB 3G6ET 4EJOA 2ZXJA 2XAHA 3RZDJ 4RTXA 3MZYA 2ZSIB 4M3DA 3ML6A 1JKPC 4YIIA 1OX8A 4KICA 4HVCA 1UHFA 5J39A 1O75A 4J9DA 4E7HA 3OB9A 5LBQA 2UUZA 2X6XA 4BY6C 1DU6A 3BG6A 1ZGJA 2DT7B 3JCMP 2MF2A 4EM0B 1BC7C 2KISA 2KDSA 3P5JA 3HTSB 1ZTRA 1YWPA 4BHPA 3CC4A 3BR6A 5B66C 1I39A 1IZ6A 2HKQB 3M3YJ 1IG7A 4AU7A 3IAM2 3K7AJ 2EVRA 1DGRM 1JXOA 2CUZA 2KK4A 4H02A 1HC7A 1XDUA 1TUGB 2B0LA 3PIOF 4CC7A 2DERA 5KAFC 3SWNA 3ZMVA 3GUDA 1RI0A 3GZ5A 4C0FA 4BI3A 1KIKA 1EF4A 2NNNA 4J6YA 3RKXA 2V1UA 4DEXA 5JFRA 1WQWA 2XF7A 1Z05A 4R79A 1B8IA 2ZZDA 1N8RC 3QYHB 3RACA 2NOJB 5I21A 5KYXB 1B34B 3CMAQ 3FBNB 1ZQ1A 1KQ0A 3GBQA 4G7ZF 2PI0A 1TT0A 4DYCA 4CSWA 3L7WA 2NUTB 3IP4B 4GFBA 1I3AA 1D3BA 3NHNA 2WACA 4AWXB 3KP7A 3H9QA 3V7SA 3V8LA 4P75C 2F5VA 2DTOA 3VS3A 1I6HJ 4EM2A 1OR7A 2CG4A 2PJPA 5J47A 3OYMA 4GYGA 1HW5A 1P4AA 3BR0A 2MBFA 3CUQB 2EBPA 1H9TA 4PLIA 3A1YA 1D8KA 1MMDA 2PEXA 5D5VB 2VQHA 4XL9A 2XKOC 3GZNB 1WJRA 2ZNZA 2OF7A 3QPHA 4PJOG 1ERDA 2WWYA 1Y96A 1A04A 3MEXA 3I5RA 1JEGA 3DPLC 2LJ3A 3E9GA 1XGNA 1IXRC 5ICCA 3IKVA 3PO3J 2RJFA 3WU2C 2FU4A 2LQKA 3FF5A 1VQLA 4LVIA 1OPLA 2ID6A 2F2VA 2RAEA 1BN5A 4BB7A 1D1AA 1DGWY 2QK0A 3HDDA 3LAPA 1F9NA 2ME0A 3HL2A 5HS8A 3A31A 1BBWA 5FWCA 2JA2A 1PHTA 2IP2A 2KT0A 2XAUA 4RAYA 4M7DD 1MH4A 2OJED 2LSOA 1T6SA 5BQTA 2IS1A 5K7HA 3CCSI 1USYA 1VQPI 2M51A 2RD1A 2JA8J 3PNVA 1VQ8I 2Q7HA 4YDQA 4XONA 1IHVA 2IGMA 1AWJA 2E64A 4I98B 2YUPA 2DLLA 3VS2A 4A5MA 3ZQFA 1VQ9I 4YIRX 5A2QE 4NC7A 2BZ8A 4EM1A 4P73A 1P4WA 1WJCA 2WAFA 2GIZA 4PSXA 1QW1A 1SD7A 2H3JA 4XQ3A 1NTCA 3MAJA 2MGQA 3CJNA 1K9MR 3GNGA 2ZJRF 1P6RA 9ANTA 5D8KB 4TVAA 3HXLA 4RB0A 4UXNA 3CCET 5J8CA 2JPCA 2LRDA 2XASA 4IOAF 1OOTA 1WA7A 4D5FA 1X1PA 1BCOA 1H89C 2NXNB 1U5TB 4XM3A 3G7ZA 2W48A 5FROA 3PL8A 2PJRB 5K5RA 5CVUA 1W2BP 4ORZA 5F1RA 1ABOA 3UGTA 1KOGA 3O3KA 2C0OA 5GAHJ 2DA7A 1KFZA 3SZTA 1JGGA 1AD5A 2E19A 2WB1N 1NJ8A 1JXMA 4F04B 1G3TA 2C8MA 1BBYA 1OZ3A 2DQLA 5CYVA 1QF6A 2VXFA 1R0CB 3M53A 3RNJA 4XLPF 3MD2A 3ABLH 1X4PA 2CDTA 3ZL7C 1QWFA 3CC4I 3IG2A 4G84A 2HCKA 4BEHB 4A3EJ 1ZG3A 4IUTA 2QAZA 2MLGA 2EZHA 1JGSA 4MZTA 4A3DJ 2XGEA 4UY8I 1KC8U 2PFBA 1Y1VJ 2RQUA 1X1DA 4QKUA 4A3CJ 1M27C 3HPWA 11ASA 4JLIA 2P4RA 2ZGWA 3WU1B 3G6EI 2QENA 1OCTC 1BIAA 4P3PA 2R5MA 4YRMA 2F5FA 3H3ZA 3D0SA 3BR1A 2M1HA 1H4SA 2J7IA 3EFOB 2L0AA 4M9ZA 4N4OB 3K2ZA 3LH0A 4IUPA 1NH3A 2DTIA 1B9NA 4BJ5C 3GPLA 4MZMA 3PVQA 2NS0A 2F5EA 2CQ7A 3EH2A 2P0LA 2Y90A 2KXDA 3OYEA 2QQAA 3HOVJ 2BYVE 3A1PA 4DEYA 3RMQA 2XAJA 4A4GA 4PJNA 4R0KA 5E3MA 1K78A 4I76A 1TNTA 2QA4Q 3P8HA 2EZIA 3LFKA 4WWCA 4EMKA 2DXTA 2RNGA 3JRZA 3PNWC 1R00A 4A53A 1VIEA 4JOMA 4S04A 1M2OA 1U06A 2YUSA 2RN7A 2BHYA 1Z9QA 4MNUA 2CU7A 3META 1QCNA 2MABA 1MHNA 4E6RA 2XGDA 4YRTA 2ECCA 2WBMA 3OBYA 4CRIA 1KU2A 4M6XA 2BW3B 3DXJF 4KBMB 3VYHB 2GF7A 1YCSB 1G6NA 4MMKA 3WTZA 1PRMC 3FB9A 1FY7A 3HM5A 3DKMA 1VQLI 1ADJA 3BG7A 4RGUA 3F22A 2CRGA 1SANA 2P6TA 1RADB 3C2GA 3L1PA 3G1OA 4Y33A 3OL4A 4MHGA 2AXTC 1BIBA 3HP9A 4K2EA 2RHUA 1Q81C 3O2PE 4AFUC 1JU5C 1Z9ZA 3SXYA 3G1ZA 3DWLE 1W7PD 2L3DA 2OZ6A 4XR6A 3CJTB 2QQBA 4M75D 2DAQA 3CPWS 2NYSA 1REPC 3CC7Q 4XICA 4ZN1A 3QPSA 4V2GA 3CO6C 1UHWA 2RQQA 3OSGA 2NS6A 1K1ZA 4UB6C 1IXCA 2M02A 2L7MP 2ZXIA 2NVTJ 4JX5A 1BI3A 5GMKh 3FIFA 1TBXA 1Z1DA 5AIPA 1WWXA 1E2XA 4OOIA 2H09A 2AMCB 4XNFA 3HHHA 4U7DA 2NLUA 2DL3A 3WHCA 3DBLB 2IG0A 3UA6A 1ZA2B 2XSDC 1JT0A 2EYXA 1GUUA 1M3CA 2VBYA 2L9RA 2EW3A 5TGTA 3C12A 2EA4A 1FYKA 3ERMA 4QQ6A 2ALYB 1PKTA 1MBHA 3DSQA 3PUFA 3WTSC 2FF4A 1TWBA 2DK5A 3REBB 2LLKA 2DLPA 4PFPA 1Z3XA 3ZQGA 2KGTA 4L87A 4BBSJ 4A4KA 1QVUA 2ZFUA 2IBDA 5GMKm 2O6GE 1MD0A 1UE9A 8ATCB 1IGQA 2L3PA 1U5TC 3H9JA 2QBYB 1WNLA 2DU5A 1W0UA 2H8WA 1WJAA 4JPBW 3X2QH 4D1QA 2IY5B 1QVFP 4II1A 4G12A 1YITT 3K4KA 4BAYA 2VBXA 2QEXT 4IKFA 2VGNA 1Z91A 2JM9A 1NJIC 5DM7R 1KQ2A 1MH3A 3CCEI 5J3BA 4ZDPA 3TVTA 1T3SA 4A3JJ 1IJWC 4HNUA 1ZUYA 5LGTA 3OYJA 2ZO4A 2RMOA 2EFPA 1VQKQ 1FOWA 3WHBA 4LGWA 1QVGS 3HFVA 4DYQA 1RETA 1WQ7A 1BBUA 2K27A 2DMOA 2JXBA 1K73U 4QLCU 4C92A 1WJBA 1QP2A 4CH7A 4UP7A 4A3BJ 2ZSHB 4F7UB 4QVDA 2LRQA 2KT1A 1S1NA 3TREA 3JR9A 2KDZA 4H2SA 2JS0A 1WH5A 3E7LA 1CGPA 4M9SA 2JT1A 1W2BA 4CC3A 1WRJA 1TS9A 3TP3A 3PQKA 3QP6A 2AQEA 1M30A 1TWGJ 5I2MA 3VFZA 4JDSA 2K2VA 1R1UA 4YREA 3SFZA 3ONQA 2W7NA 4DJAA 2IPQX 4A3GJ 4P74A 2EQKA 1VQMT 1X4OA 1LPQA 4XTWA 4RQFA 3BG5A 2K85A 1GFCA 3A0HC 1SD5A 4U0YA 2CQKA 2KRFA 2OTJA 2LOOA 1FOKA 1PUFA 3EGDB 4PZJA 2ZT7A 2PMZA 3M4YA 2VQGA 2VL8A 4XLEA 1B70A 4IQ4A 4JX6A 2KMTA 3GFIA 5DUKA 2M8EA 2DT6A 1WHJA 1WHKA 3HRMA 3N5BB 3CMQA 3S2WA 3OY9A 4HYEA 2R58A 4U87A 4RDUA 2R7RA 3CCUQ 2VOOA 4C5EA 2BXYA 2BZXA 1KQ8A 4F91B 1R5ID 2DL8A 3LSJA 2LC4A 1RI9A 2CS7A 1YHQQ 2ELHA 3HOSA 4AT1B 3OOPA 2G9WA 5TISC 2M3AA 2DA4A 4C30A 4G6TB 1KD1U 1VNDA 4B09A 2EQRA 5GAOq 1FBSA 3VUBA 3K70C 3KYDB 1WZOA 1XSDA 2WSFE 2QF7A 4ITVA 4CZZA 2YWWA 4KT0E 1M90R 2EFOA 1OQKA 5F04A 3RPUA 2LZ6B 3JB9G 1SVMA 1FBUA 2V9VA 4A93J 1WX6A 4YFKF 3HFNA 1K8AU 4FT2A 3HOYJ 2DEQA 5C3EJ 2FPEA 4EJUA 4HWSA 3L2CA 3H35A 1USSA 3E1SA 1CKAA 5GMKl 2XGXA 3A5YA 5IOZA 1KGSA 1B3QA 5CCAA 1OEBA 1IAWA 4FHTA 2H1KA 2H94A 2LCLA 1ZYRF 2FA5A 1LNXA 4JRKA 2YLBA 4MMLA 3A5ZB 1FP1D 1DP7P 2ZT8A 1J09A 3HKZN 4HSRA 4OIQF 2GNCA 4RTWA 2LBFB 3L00A 4OLFA 1F1ZA 3QDRB 4M75B 4C3HJ 3ZQCA 1LOJA 3PGGA 1D09B 4YRKA 1Y0NA 2RJCA 2OAUA 2PX9A 2NUTA 1KU7A 2ZZGA 1K0SA 3RKQA 3F70A 2DTHA 2COZA 3CC7A 3HFZA 3PE0A 3RIRA 3QDFA 4M7DC 2L01A 5J1UA 4AYBN 3E6MA 1GVJA 5FKMA 2CP5A 2BV6A 2M7AA 3AFHA 4G7OF 1J59A 3LWFA 4FYYB 2EGCA 4HX8A 1VQ6Q 3CUQA 1WLPB 4M7AE 1LFPA 3G71A 3PQJA 4FW2A 1XGSA 2CZ1B 4YRLA 3CCQQ 2A3SA 2TRTA 3SEQA 2KYMA 5A0GA 1A31A 4IUUA 5GAMj 4NOYA 3GYHX 3A7RA 4B44A 2COMA 3JCMc 4XSXF 2FBIA 1KZHA 1SRLA 1WI9A 2E36A 3RTRA 1B9MA 2M2EA 4C5GA 4YRQA 1FP2A 2RNAA 3DU6A 2RPNA 4M77E 4XLCA 2GTJA 1W5SA 3RUXA 1S7EA 5ICEA 4KUDK 2ACJA 4UNOA 2CP3A 2MI6A 3FXKA 4M3GA 1PUEE 5D8LB 1Q82C 3OIOA 2I2LA 2G7HA 2IXSA 3I56T 4LDYA 2O2OA 4B47A 2HOAA 2NRAC 1N9SA 2E10A 2DCEA 2JUGA 3HEFA 5C4XJ 5GANj 1ZKGA 4QPOA 4C0GA 4AG1C 5LHGA 3CJQB 4NDLA 2OTJI 1PYVA 1O3TA 4I0AA 1QVFA 9ATCB 4ZIBA 1WYXA 2ZPHB 2KT8A 4E6KG 5TJJA 3TL4X 2JJ7A 1E3OC 2VKDA 3S93A 3VV0A 2LT4A 2DIQA 4ATOA 1Y6IA 2JRMA 2IS6A 1VF9A 4Q5SF 3LNQA 5DTDA 4PJOA 1G3WA 2CP7A 1FSHA 1W70A 3W6VA 1E3PA 5GAN6 2A61A 3LQRA 3J7ZI 1KQSS 1ZG5A 2OTLQ 1YQAA 3IWZA 4M7DF 4FSSA 4LD5A 1YN8A 2JA7J 3IH3A 4RB2C 1NJ6A 1HOMA 2JMCA 4I09A 5FRMA 1HDPA 3K4MA 4LB5A 4B3AA 2PJRA 4HF1A 4IQJA 2AKKA 4K86A 1X2KA 2DVJA 3WE3A 2FXAA 1B1BA 2CUJA 1IN7A 1H4QA 3HXYA 3JTGA 2E1MC 2D1VA 4KIGA 4HQEA 3PSFA 1BBZA 1M1FA 3ZMUA 3I64A 1VQ4Q 2YSQA 2EIMH 2WAQN 1YCYA 1WHHA 2QQ8A 4G85A 2XB0X 1GBQA 4JRPA 3ZMZA 3CXCP 3J80E 3FHZA 4EATA 4NUBA 3TMOA 3MP1A 4HZFA 1C0AA 1SKUB 1KHIA 4XU0A 3ZEHA 1YIJQ 3ZQHA 1V3FA 2EKHA 1PP8F 1X6GA 1Q95G 2WY8Q 3Q5FA 5L3EA 1YI2T 3J80K 1UELB 5D6EA 2X1DA 4LD9K 1PYSB 2P0KA 3S1MJ 1ZUUA 2PBIA 1OI1A 4F7UF 3MEYA 2PMUA 2CS3A 4M78D 4EIKA 5M5WJ 2FJ1A 1WZ2A 3F8FA 5FFZA 2JA6J 1ZA1B 4IHYA 2JUFA 5CQXA 3M8EA 4RS8A 1SAXA 4JJCA 2HKOA 4XN3A 4QSHA 1MBKA 2CZ6B 5EF6A 1HC8A 2R3SA 2L54A 2AQFA 1XGMA 1BU1A 2MYSA 1E24A 1PJRA 3WODF 1TL8A 3E9FA 3HUGB 3JW4A 3GOXA 4TVYA 1B7YB 2N8GA 3VODA 5E79C 4WXHA 3ZPLA 1H3ZA 3HBLA 2DZCA 2CGHA 4RAZA 4A54A 3EG0A 1IDYA 5CKFA 1TWCJ 3CCVT 4WF2A 2J6OA 2DO7A 5F0FA 3HHGA 4M75C 2CYZB 2MWOA 2DA9A 2CV2A 2X4YA 5F5WA 5FLMJ 2J3LA 3GIBA 1OYWA 2JK3A 3ERED 1WFWA 2QHSA 1ZH5A 4J8OA 3VS4A 3RZOJ 4H2VA 4J9CA 3REUA 5DUIA 1JO8A 3G71I 2FQ4A 3P8BB 4OMOA 3JRCA 2X3XD 1UMQA 5F1JA 3AG1H 4M6VA 3L4GA 2BW3A 2XI9A 3CBMA 1ZSZA 2NUZA 3U9GA 2W1OA 2F5KA 2RI5A 5I22A 4II3A 3PCOB 4H0EA 4IJAA 3CD6Q 2OUMA 2ZAEA 4PJOE 4A4HA 2X4HA 3ZQIA 3M9AA 1B6AA 2DMQA 3KP3A 1JJ2S 5LRSA 3DV8A 4MFEA 2UXNA 1ONVA 2MH2A 3M58A 4KITB 2QI2A 2GOMA 5M9OA 2P6SA 3WQZA 1IRXA 3QU3A 4BQAA 2X9DA 3S1QJ 3KETA 1YJNA 2V1XA 3MKLA 2DJQA 3CMAT 1I81A 2JN6A 2NVQJ 1R8OB 2ZNYA 3NENA 3QIIA 1YFTA 1TQMA 4CCMA 2E41A 1YFRA 4ZH4F 3L2VA 2DFEA 4N4IA 2QHUA 4ZC3A 3QYGB 1SERA 2W82A 4L5GA 4NQWA 3IRQA 2ZKZA 4BDYA 4CCLA 2HFHA 1NHAA 1VQOQ 2ZCWA 1R5GA 2K4JA 1AHDP 4TVWA 2LF8A 1IGNA 2W85A 4MEXF 1VQ6A 4L5JA 5LRRA 4JJDA 3GNFB 1IO6A 3MCAB 5DS9A 1IRZA 1ASZA 1MSEC 1BM9A 1GCPA 2FUG2 4D0PA 2ZTGA 4JP0A 3VS5A 3K4BA 4AIHA 2V8KA 4H2TA 2RQPA 2B8AA 3JRGA 4NL3A 4M75F 2H6CA 1O3QA 1OV3A 1WJFA 2LTPA 1U3OA 4OAYA 3EQLF 2PLYA 2QDYB 3OYNA 1LYLA 5F6FA 3JAME 3KP2A 5IT9E 2EAYA 5KNNA 3VDXA 1U1TA 3SB2A 2DX1A 1I1GA 2L7FP 1HSJA 2OU2A 2DT5A 2LFBA 3QUIA 3BY6A 3JAMK 4M7DG 1HYOA 3K2AA 1G5HA 2ZCFB 2LR8A 1D0ZA 2C6YA 4DQ2A 3CPWA 2OV7A 1NJ1A 3GLXA 3LWIA 2O5RA 1TC3C 3KLOA 5C0MA 3TQ7P 2KP6A 2IY5A 3H6ZA 2P5VA 1BJZA 1HKQA 3C1DA 3QXEB 1T95A 3EUHC 1RKTA 1JQQA 5DD8A 3UATA 1FWZA 5L23A 5D5WB 3ABMH 2CW8A 4PDKA 2XGCA 4ELZC 4J15A 4Y17A 3KYLA 1XMAA 2K9NA 4ZDLA 3BPXA 2R5ZB 1N27A 4N0AA 5LGNA 4RTZA 4DA4A 1OYIA 2ISZA 3LSHA 3OYFA 1K4SA 1SRYA 1YJWQ 1MIJA 3CDIA 3DKWA 2WC2A 3M1CA 3TEHB 5BS6A 1P7IA 2OTLA 2E71A 2EA2A 5H20A 2L9SA 2Z3YA 3FEOA 3QO3A 4YFNF 2M34A 2I0NA 3OSFA 3VKIA 3OL3A 3BDDA 2D2WA 1R5HA 5HY6A 4XKVA 1NK2P 2E2IJ 3RGLA 3DFGA 3TP0A 3CJRB 4IO9F 3HB9A 3SQNA 2DETA 4F7UG 3GX4X 2HZYA 2EIJH 2Q8KA 1SFEA 2UXXA 2Z2SB 4OF1A 4L6V5 2HKXA 2HZDA 5FU6B 2RKHA 2RHQA 1HSTA 4JYKA 3H36A 2QVOA 1VUBA 1WHLA 2A0FB 1R7JA 4FW1A 4IUQA 5CJ9A 1WJSA 2HXOA 1MMSA 1V55H 1GXIE 3R6OA 3CXCA 2NVUB 2BVMA 1U78A 1I1JA 5C51B 1YIJA 1YX3A 3EDPA 4MQ9F 4Z2YA 3L2ZA 2KY9A 4XIDA 2ZT6A 4YROA 4XKWA 2L02A 3HOUJ 4ZYDA 3WE2A 4P3NA 3I5UA 1GDTA 3HTRA 2HD0A 4LG0B 2HOTA 2W25A 3EGDA 1K79A 3EAEA 3OYIA 1KYZA 4RTTA 2M9HA 3SWNB 2CP0A 3UFGA 3CMYA 4OP0A 4KGXB 2A3LA 3MCZA 3DBHB 2Y9ZA 1ZAOA 1RZ4A 5LJ5h 5IN1A 2X3WD 1B8IB 2OAZA 1HW2A 2KIFA 3PVLA 3G73A 1ATIA 2ECBA 4EJTA 3MF1A 2D0QB 2PVGB 3TGNA 2ZZFA 1YJNI 3DLLF 5CVIA 3OR2C 3IRRA 1FOYA 1GVDA 5HOOA 1G5VA 4HRIA 2CV0A 1SSHA 1X1BA 2HQXA 2ZIMA 3SDGA 4UVAA 2KVQG 3EG3A 2O61A 4GDFA 3WGHA 4ABZA 2VKNA 2DM1A 4NNJA 1TH7A 3C7JA 4C8QA 3BDLA 3M0SA 3V8JA 3GTLJ 1QPIA 1SMTA 2V7FA 3REXA 4XMYA 3NWTA 4IRHA 1VQ6I 3FISA 4LE9A 1T0FC 3F72A 1OULA 3VQWA 4RCCA 2QA4T 5IXFA 3K4NA 1FT9A 3P8VA 2V26A 4WK8F 4IIOA 2B63J 3I9V2 3ZQQA 2E70A 4BGDA 3LQQA 4OIOF 1N78A 3D5RC 1QPMA 1CF7A 3N05A 1BW5A 4XRSG 3J81K 2J5OA 2J6FA 3H5AA 3QODA 2K5FA 4MEYF 4UUSB 2AKLA 2L9VA 4UHTA 4BXFA 3IKTA 4ZTUB 2IJLA 5C53B 2WSCE 1B7TA 1PNJA 4NC8A 3I53A 4B4CA 2DQ3A 1YJ9T 3ULRB 3LYIA 2CKKA 1IO2A 4DNCA 5EDNA 2A37A 1RR7A 4FIBA 1ETOA 1SFUA 2HQEA 2Z9OA 1X2GA 2MC3A 4LD6A 3MKYB 2EILH 2JQ7A 4M75G 2GQVA 1WXTA 1Q7YU 1Z7MA 1NYFA 5KNLA 1P7JA 4QW2A 2DFFA 1UDLA 2GZWA 3CP8A 2AS5F 4OGCA 1G4DA 2EFWA 4HWRA 3JCMd 1U3EM 1YS7A 2LKSA 5LHIA 2HQHA 3RPQA 4IF4A 2P0WA 5FKLA 3R61A 1O7LA 2K86A 3HTZA 4HNVA 1SRMA 4P71A 1FNNA 5K1PA 5E1WA 5FKOA 5GAN4 2VJ5A 5DD4A 3M1EA 2R5YB 4RUGA 1OX9A 2F5TX 2A5YB 1QWEA 4J9FA 5FLXK 1YJ9A 1V76A 3VQXA 3NMZC 3EETA 4C92D 2DO3A 1C0MA 2XK0A 3PJRA 3EHRA 4YEJA 2EPDA 2K79A 4BACA 5ICGA 4HF2A 4N9HA 1E6HA 2HPMA 2DKGA 5KE3A 2M45A 4HWTA 1LDJA 1J2XA 4PJ0C 2HVSA 1NLPC 1YB3A 4OIRF 1L0WA 3RMSA 2K3XA 4PJJA 2NAZA 2KL4A 2CZ7B 1ETQA 2BBYA 2EJ9A 2IS2A 2LVMA 1VQNA 4X9CA 1LUJB 5GAEJ 5FU6C 2XRLA 1VQPQ 1S7OA 4KNYA 4YPFA 4ZTJA 3EG2A 4FSXA 4C8QE 1VQ8Q 4N0BA 5BPDA 3DBRB 2X4XA 5E3IA 3GFMA 3MWMA 1TXQA 5HNFA 1HKTA 2CV1A 1FSEA 4ZGJB 1WJDA 4KT5C 2B9SA 2VPLA 5K5OA 5J3LA 1WI3A 3ICAA 3VEPA 2HQAA 3OS0A 2P81A 2EIFA 5CKHA 4PK4A 2D1XA 3B73A 5LJ3h 4M78C 3CDHA 2IVWA 3GVAA 4P9UA 2H8RA 1VQKT 2K3PA 3ZN1A 5B5EC 3G4SA 3QOEA 3IUOA 4I2OA 4B1RA 3B6CA 2BE7D 4EO4A 4Z8AA 4L9TA 3SWNC 4QVCA 2XPWA 3H0HA 3T1BA 5FJ8J 1P2FA 3X26B 4GXOA 3MP6A 1T0HA 1PSEA 1QKXA 4RQEA 4NBQA 3Q3SA 4D5CA 2QTXA 3BPVA 1UG1A 1HTTA 2STWA 3GTGJ 1R4MB 5GAN5 4E7JA 3EG9A 2KZVA 4ZDOA 3LA3A 2JWTA 2FNPA 1K78B 1H88C 2JSCA 5E17F 2BY1A 3HSRA 3NWSA 4EMKB 4LOCA 4AFZC 3V7CA 5GMKi 2XPUA 2EJRA 1RI7A 3BDUA 3FX3A 3D7SB 4HX4A 1X43A 4KDPA 4LVKA 3LSRA 5DEQA 3TW7A 2C0IA 2QSHX 4EMGA 2E6NA 1XS9A 2EQUA 2HDAA 1IV6A 3CC4Q 3HY1A 3UDCA 2DK3A 1S5LC 4CYCB 2QTVA 3E2UA 4M74A 3HXWA 1XDSA 5DY9A 1OR7C 3S3NA 3A7UA 3RESA 4Q48A 4LNPA 3FKIJ 2YT6A 1WFXA 1VFCA 4DGWB 1KQSA 3A01A 2M8GX 4TWAA 5ELOA 3LX7A 3G6EQ 4CH4A 3VU3C 3OW2P 4BQNA 2GOXB 2JZ2A 3JCMe 2VC8A 2YUNA 4FYVB 3M59A 1R58A 1I6XA 3CCYA 1AWOA 4MFDA 1E1TA 2H8HA 2ELKA 4AIKA 1WHGA 3CCUT 3JB9I 4A3FJ 5BMZA 2KSSA 3LSMA 4AVZA 3EFSA 2QUFA 2XMFA 2LMJA 4J9BA 5CKEA 4WX9A 3F3XA 2CJJA 5F0CA 1R36A 3R6SA 4JLGA 3TKYA 2EGAA 4M78F 3SFMA 3FJPA 3I4NJ 3VUZA 1ZK8A 1RPWA 1D5VA 3SEZA 2FQ3A 1USYC 3ZMDA 4KN4X 2VI6A 2QWWA 2G4CA 2CFOA 1GV5A 2FYKA 3KFWX 3CCLT 1O57A 3AT1B 3NTIA 2KE9A 2HU9A 3CC2T 3Q9SA 1YJ9I 5E8GA 1IB8A 2ZPGB 4H4KC 4CS3A 4J9GA 2OCEA 3JSCA 2AK5A 1YX5A 1Z6RA 1RAAB 3S6WA 2FX0A 3BCBA 4P73C 2EQIA 1YO5C 1SF9A 1UB4A 4TQDA 3MEWA 3EUKL 1XSVA 1VQLQ 1EIYA 1W2BS 1RIQA 2ZR3A 1KD1R 4U0WA 4P5NA 3TW6A 1Y1WJ 5JI6A 5HDGA 1LEBA 3QU6A 5EG2A 2W00A 1TSFA 1VQNI 2QQRA 3HSFA 3CCJT 4RLQA 2VUBA 5K7FA 1EKEA 3NETA 4A3IJ 4HLXA 1ZBXA 4FM4B 2E2HJ 1HBXG 3CCLA 3CBOA 2CREA 5HGQA 1GBRA 2K4BA 4BHBA 3LL7A 3CC2A 3KEYA 2DFHA 1WGSA 2VKVA 4GLKA 3MF2A 2XTIA 4RDXA 4ENNA 4RAFA 1FMVA 1KMNA 5FFXA 1YFNA 3CQTA 3PUBA 2LCCA 2KRHA 1RAIB 2B7EA 4I02A 1RLQC 3JTHA 4C2MJ 1EA3A 3G4SI 2GCXA 3JV3A 2KJCA 1M2VA 2LNBA 1OCZH 1K9MU 1PWTA 4KIBA 2MPXC 1TQPA 1G5IA 4BY1J 1Y7XA 3HKSA 1QVTA 4P3OA 3CCQT 2OQRA 4HEA2 2ZMEA 5H6RA 1UJYA 5AONA 3BROA 3H9GA 5KCMA 3J80Z 4NL2A 5ELNA 1E3HA 4OMLA 2UV1A 4YELA 1KK7A 2LCSA 5IAYA 1ODDA 5E3NA 2IRFG 5IYBJ 1G8XA 2BXZA 3PIPA 5ILVA 3S16J 2VC0A 2E60A 3T0YA 4HWOA 2QYOA 2MMPA 2BE5F 1W0TA 2DIGA 4JRIA 1Y8RB 5IY5H 2O8KA 3I3LA 3RL6A 4PSWA 2P0QA 1VOMA 2FZKB 2KIUA 1VQ8A 2R7QA 1WIEA 4PG3A 4HX7A 1FZPB 1EVLA 4EMKC 5F64A 3A03A 4WTOB 2J5PA 3MEAA 5J4VA 3C3WA 3CCEQ 5DV5A 4GYIA 2HYGD 5BPIA 2FBHA 2YU9J 2HQ5A 2GGRA 3BZCA 3OIPA 4B3XA 2W57A 1QBJA 2Z5UA 3MZ8A 3BP8A 3HGGA 3U2RA 1NM7A 3KIOA 1Y39A 2R7WA 2KKOA 1X2QA 2OA4A 3IAS2 3A8OB 2QHTA 4UPAA 2OI3A 1YNZA 2MLKA 1ZREA 2YUQA 3A8LB 3CMEA 2BHZA 3BLYA 4DBQA 2E7WA 4FX4A 5GJWB 2VKHA 3JRBA 1I5ZA 1X54A 3R0JA 3OMGA 4AH6A 4ZNXA 4D8DA 1WQ2A 2W84A 3DF8A 1GHCA 2E5QA 3QAHA 4DOWA 2K7LA 3MP8A 1M3AA 4EGYA 5KYYA 1VQ4T 1SHFA 1JT6A 3BWGA 1UCRA 1LCKA 2RREA 3JCMQ 2VGMA 2LQNA 3JB9J 4LG0A 2RHIA 4XK4A 2EZKA 4C5IA 3VYTB 5ILSA 3HPGA 2LH9A 1S6LA 2I4MA 1X1AA 3VQYA 4M78G 3A4CA 3VYRB 3AL0B 1RR8C 1KYWA 1QU3A 2A08A 2RI2A 2EIKH 4YRSA 4XTUA 1BCMA 3W2VA 1LB2A 1DQUA 1TU0B 1IN8A 3G6EA 1WGXA 1TW2A 1BR4A 1L0OC 3HOZJ 2XHCA 2DPPB 5FKNA 3WG7H 2DJNA 5EYRA 2GM4A 3OW2A 1DDNA 3OBWA 2F69A 3K70D 1J5YA 3ABUA 2MFZA 5HLHA 2GXGA 3KPHA 2EH3A 3PFYA 2GTOA 3HFZB 2H3EB 3CCLI 4HV6A 1UG2A 1HK9A 4Z88A 2CH0A 4IZZA 1R22A 3CC2I 3LSKA 4CI0C 5IXBA 1B76A 3JCMX 1QVFS 4PNOA 1ZG1A 1DPRA 1F5TA 2EJFA 4XEMA 2XUBA 3J7AO 3H3VK 1K4TA 5CVVA 1JBMA 2HNIA 4G8XA 3I4MJ 1CKBA 2VJ4A 5IYCJ 1CSKA 1XCVA 2NVXJ 2DBMA 3CMMA 4YRGA 4MIMA 4PKCC 3F0CA 1UGPB 2KNBB 3EGUA 3G3ZA 4YRPA 5LJ5f 4F7ZA 3WVEB 3JAMZ 4BE0A 2Y0SA 3FLGA 2M9UA 2HNHA 3E5XA 2Z0WA 3EHQA 5GPCA 3GZ6A 4LXCA 3QQAA 4UUSA 2Q5IA 2DFUA 2R7OA 5GADJ 4KMUX 3CCJI 1QZEA 2RHSA 3BTJA 1TTYA 2AO9A 1PCXA 1A6IA 2RI3A 4LITA 4C0DB 4M3BA 3BR2A 4C92C 3CD6T 1K4US 3H0FA 1LDKB 2ZC2A 3CQZJ 3OYKA 3BE3A 1SEUA 4V19K 3RQ4A 1SFKA 2FHDA 5HS7A 2Y4XA 5HK0A 1EX4A 4V2SA 1VQZA 4JBAA 3W6JB 3M7GA 4M7DE 3VBBA 3D5LA 1KQ1A 1M1KU 5D6XA 3DTKA 2Y4YA 4WI1A 2HEQA 2RK2A 4CS2A 4H2WA 1S8NA 2E1OA 2RB6A 2VJIA 4P74C 2M5WA 1FBQA 1ZLKA 1ETXA 4BH9A 2PZ1A 1OKRA 2WTEA 3LSPA 1RL2A 2YU3A 2GXAA 2JMAA 5HODA 1JKOC 1JTXA 3KP6A 5HS9A 4XN0A 2EV0A 1R9TJ 1A0NB 4PJOB 4XRSA 1UJ0A 2R5YA 5L8RE 5A2QK 1QA6A 2EK5A 1VQOT 5CR2A 3TQNA 2BIVA 2MSYA 1IDZA 2E3IA 3Q0WA 1HXDA 2R92J 4NCXA 3JB9H 3N97A 1F36A 2X6YA 3BJOA 2A6EF 3GMEA 2DA3A 2LT1A 4YRFA 5E3OA 3S1NJ 2G0EA 1IW7F 4PUSA 1UGSB 3CMEI 4WJ4A 3R07A 4C3JJ 4PGGA 1NG7A 1W7PA 3M0PA 1TW3A 2YX7A 1NJ2A 2QZ8A 2HYJA 3BQZA 2I4NA 2VOPA 4AYBA 4A5NA 5J8FA 4M3FA 2VONA 1UTIA 3X25B 3WU0A 5CQEA 3IHUA 2QEXQ 3HRUA 1LQ1A 1RLPC 3IC7A 2COBA 1RIOH 3QO8A 1XMKA 3SD4A 3T8TA 4YCWA 3C4SA 3VYGA 3F8NA 1G59A 1V5GA 3MKWB 2EPFA 3JRDA 3ELKA 5LJ5g 4BQOA 3VYSB 2VT3A 3FXJA 4C92F 4WXCA 2OTJQ 1Y07A 2AXLA 4UC4A 5D6YA 3ISPA 4A6DA 2GWRA 3MHXA 5EGOA 3OYAA 3PZCA 1IN6A 2DXCA 3CCEA 2XKPA 4YTLA 1BKBA 4KYWA 4RM2A 2BTTA 4ENMA 3M57A 1O7FA 2DL5A 1W36D 4ZTFA 5FD6A 2A68F 1MBJA 1ZRCA 2ESWA 2JTFA 5FGMA 1YJWT 4P55A 4J01A 3B6AA 3QP5A 1NBEB 3AL0C 4HW0A 4D8KA 4J83A 3FXOA 2BY3A 4CCKA 4Y91A 2M30A 4FE7A 1H8AC 2HDCA 4R8HA 3U1DA 5LL6S 4RGSA 3TOAA 2QHVA 4LLGF 5JLWA 5JHFA 3G1LA 4KA4A 4F16A 3LSTA 3J81Z 2WA0A 3DEUA 2KI7A 1Q86U 3I5SA 2HWVA 3ECOA 2ZJ2A 4I6ZA 1W6XA 4UV9A 1M90U 2DRMA 1QO0D 4YIFA 3PNTA 3K9TA 2BOLA 2OPTA 2X0LA 5LJ3f 2O4XB 4OB3B 2ZINA 1TZLA 2LF7A 5C52B 3L4GB 3NTKA 1QZZA 2LP0A 1AZEA 1ZSZB 2O01E 4CYCA 3LGFA 5ICFA 4HF0A 1I4K1 1R1VA 3R4KA 1IF1A 2ROLA 2D8JA 1FTZA 2DK8A 3M4PA 2JW4A 1VQ7T 1QCOA 3SHFA 4XKBA 1AA7A 3CUQC 4JX4A 2EV6A 4NC6A 1MDMA 2QASA 3F8BA 5LJ5e 4L18B 1SEMA 3PM1A 4YRVA 3S2DJ 3KBGA 4E7IA 4A3MJ 3S3MA 4HCZA 3SFIA 2IA0A 4J6XA 2V9PA 2DD4A 5FKKA 1OCOH 1MSFC 1AKHA 2R7VA 2CIMA 2UZKA 4AM3A 1VYVA 2V1QA 1RABB 1U9NA 2A07F 5DDGA 4LDVA 1U8RA 3QO5A 5KYNA 2HQNA 2M87A 1MV3A 5FLXZ 1E1OA 1E7OA 1ETVA 3M07A 2ECZA 1KC8C 2V1NA 4YP0A 3R60A 3K1PA 4NQWB 2X1CA 2DMPA 2AKWA 2E35A 4JJBA 3E6DA 1BW6A 3FWEA 1E6GA 4N4HA 2LDMA 1VQ7A 3QWLA 4OU0A 2R4GA 4HA8A 4A6EA 2KRMA 3G71Q 1J7KA 3DB4A 1V5EA 1NLOC 4J9HA 1N75A 2VODA 2X35A 3BY7A 1E0EA 5JLXA 2OCCH 3SZGA 2M4KA 1T38A 1MBFA 1QP3A 3LOCA 1AOYA 5IPAA 2A8EA 4Y3OA 4BJ6C 2LY2A 3GTMJ 1HQCA 1QGPA 2V6EA 4ZZLA 4PJOC 3MMYB 2CJ9A 1SVLA 1R4NB 3E97A 3UGQA 2F2WA 1KSWA 5DCFA 1R1TA 2TDXA 4RTVA 5B1BH 1GT0C 4AIDA 3IQLA 3ABKH 2L5QA 1PKSA 2Q0OA 3TEGA 1VQ5T 4BE1A 3QRFF 1Q86C 1A6QA 2XF5A 2XG8D 3BZKA 3KE2A 1Z67A 1DUXC 3QWXX 1B72A 2BZYA 4KIFA 5B1AH 1VA7A 1MJBA 5A0LA 2DYSH 1K76A 5LJ3g 2P4WA 3CXCS 3MVPA 4FT8A 2CW7A 4IIMA 4E51A 2I4LA 1ZR4A 3M0QA 5C6SA 2ZXHA 3M8FA 3RSNA 2ME6A 4ZZDA 2E12A 4AFQC 4RTYA 3QZ5B 1NPRA 2KQWA 1JKRC 4DBRA 5LHHA 2ABLA 1HJDA 2XSJC 4RGXA 2C7IA 1ASYA 1IN5A 1WHMA 3O6BB 3CCRT 4HAMA 2CUDA 1WJEA 3CCMT 2YUOA 1D1BA 2G7UA 1XMXA 2EQMA 5CLSA 3BR3A 2MCNA 4C92G 1I5OB 2RC4A 1OYXA 5E1ZB 4RCBA 4DBHA 1WXUA 2KRSA 6AT1B 5GAN3 4XTVA 3IH2A 3GFLA 4EDUA 4S0HB 1C0WA 1X75C 4LUDA 4IXAA 1XB4A 1PC0A 1UGQB 1SC7A 3KFUA 2RHQB 3FMRA 3QYEA 4BBRJ 1YITA 1H3HA 4F17A 3FBIB 2ETHA 1YTYA 2QEXA 3INZA 2X9HA 3HJEA 3PNYA 4E7ZA 3CBPA 1T0FA 3FM5A 5CO7A 1XGOA 1YE9A 3A8GB 3URGA 4FETA 3REOA 3WG9A 4OMZA 3WGGA 4IVNA 2DMNA 4XEOA 1NPPA 2QKLB 2FBKA 4PJOF 2BGCA 4TTVA 2M1BA 2LG4A 4M7AA 3OWTA 5GAOr 3FM3A 2D9TA 3OYLA 5GAGJ 3HYIA 5J40A 4A12A 4YRIA 3GW2A 3CCST 2HVQA 4HKEA 2ZB9A 4MO7A 1VQPT 3QZ9B 2PUOB 5CKDA 2P7VB 5E8IA 2ODRC 2ZPFB 4P9FA 1F4KA 4J19A 4ESBA 1MJAA 4EX5A 4OMYA 1JRIA 1HSQA 4L9NA 1I1SA 3MKZA 2ZR2A 1R49A 4M77A 3ZMSA 2KAFA 2P7CB 2LVSA 1XTAA 2A7YA 2HYFA 3BT9A 3FMSA 1ZSZC 1VQ9T 2P84A 3RDVA 1FTTA 3I55T 1N6AA 1ZUKA 4YRRA 3KP5A 2RF0A 3P8TA 1VQMA 1XTDA 3BJUA 4KUMA 2RJEA 1WDXA 4RTUA 2Y31A 1OMIA 3HGYA 1N8RU 1OZ2A 4I01A 4FE4A 2L7KA 4J00A 4XBFA 3K4LA 5E18F 2ZPIB 4C8QB 4FL6A 5K1XA 4BUPA 2ESNA 2LK2A 1FOXA 3PTAA 4G94A 4Y15A 3VRYA 4Y52J 1XX5A 2DVEA 2LREA 3FIWA 4FU6A 2DYIA 1VQ7I 1Z3YA 4Q47A 1JI8A 2DYRH 1S72T 2XGTA 4OINF 4L0YB 1K73C 3C95A 3ZFJA 3SZPA 4IPAA 3C18A 3CUOA 1B59A 2CYYA 2DAOA 2K3FA 1CF7B 4J6WA 3VB2A 3L2UA 1TWAJ 1R23A 3LSIA 2O0YA 2YX4A 3M54A 2GFAA 4ELYC 3CC4T 1PD0A 1MNMC 3I55A 1SMYF 2DZ9A 2MK5A 2HL3A 3OMCA 3F21A 2LJ0A 4G9YA 2DBKA 4OWRB 5IYDJ 3U1KA 1TTHB 2PVOB 2L89A 4H2XA 2ED1A 3DEWA 1OISA 2KPMA 2J06A 1XCBA 4QQGA 4Z02A 3S8PA 1MNDA 4JZ3A 2Z33A 3LMMA 1GXPA 1JB0E 3CESA 4M9XA 1N9WA 4ZGDB 3QSUA 1YJNQ 4XLNF 2P5IA 2YRDA 1T2KA 1MZBA 1S72A 2E3HA 1ACIA 4HVVA 4WXDA 3Q0UA 2YRVA 1DJ7B 1T56A 3HG9A 5L3GA 2QQ9A 3FXMA 3GP8A 2RH2A 4JK1X 5EZHA 2F5CA 2P8TA 2YRCA 2HS5A 2FOWA 2LC2A 12ASA 4P72A 1NEGA 3UF4A 3OA6A 4M78A 2LY1A 2F4IA 1LJOA 2DQ0A 1D0XA 1T3LA 1FYFA 1QKWA 1QNTA 4Y13A 1BJAA 4UP9A 1YG2A 1YYVA 1O9SA 1VQ5I 4J7IA 4N0AC 1KD1C 2CH4A 4CC4B 3JCMV 4MTEA 1B07A 2H1LA 4EPCA 1JXSA 2I8DA 3GBGA 2P5LC 1UEBA 1OU8A 3F8CA 1YITI 5GJVB 2QEXI 3W3CA 1UGVA 2DN0A 3KX2A 1V29B 1Y8QB 1EFWA 3L42A 3DP7A 2QDLA 2X6WA 3P7NA 1MW7A 1HKSA 1VQLT 3NTHA 3THKA 2CFXA 1LE8A 2KMUA 4Q4ZF 2PMHA 4LIUA 2KIQA 3HFOA 3IL2A 2J6KA 1HCRA 3QYFA 4P5OA 4PCQA 2LNVA 1K8AC 2KXCA 4UV8A 3RBBB 2QXFA 1ADYA 3CCRI 5HCKA 4PL6A 2V9KA 3CCMI 1YFHA 3DTEA 4DBFA 1QHGA 1I0CA 5CAIA 3H0IA 3PFSA 1N25A 5CVJA 1S3JA 2NNYA 5L3BA 2CUBA 1AWWA 4G6QA 2K9GA 3KLNA 2PMEA 3LSGA 3SDBA 1GRIA 4A4FA 4JS4A 2L0KA 2JNGA 3PMIA 2GQQA 2RVCA 3FRNA 1MUZA 3K1NA 1U1SA 3OYBA 2L4MA 2GAUA 4F92B 1NZ9A 4LK0F 4X34A 3JCMJ 4CH6A 2E1NA 2EYYA 3TSZA 2RQVA 4Z89A 1QRYA