4DQ2A

Structure of staphylococcus aureus biotin protein ligase in complex with biotinol-5'-amp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4dq2A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dq2A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dq2A02
2NNNA 1FYMA 4NL3A 4BNCA 5IT3A 1QZYA 4HX7A 4XTVA 2DQLA 1GXQA 3CMQA 1TTYA 1Z6RA 3HXZA 3QAHA 3GX4X 4AH6A 4CYDA 1KMNA 3KE2A 1KA8A 2RDPA 2A6EF 1V4RA 1G3TA 2MLKA 4K2EA 1J9IA 2R7FA 2ZR2A 5DCFA 3SHFA 1QO0D 1WI9A 1ZAOA 4ZYDA 1J0RA 3R0JA 3LAJA 3LSSA 1WSUA 4BH9A 5L3EA 2WV0A 3K1PA 3VOEA 3HIFA 5LJ3j 1S7OA 2VXZA 1B8AA 4L18B 1RUOA 2K02A 2MLGA 1HKTA 4HZFA 4ESJA 4M7AC 2ZT6A 4PNOA 2ADUA 3HUGA 3IKTA 1QNTA 5CVRA 2YR2A 3TEGA 4M77D 5LJ3h 3REUA 5J6XA 1G6NA 4RGXA 5GAMe 4LMYA 1ZRCA 1O3SA 3H3UA 3KP6A 2Z9OA 5LJ3g 3INZA 1P4WA 1Z7UA 2LF8A 1QBJA 3BJ6A 3JCMh 4KR2A 2XASA 2ZR3A 2NAZA 4PJOB 3RI4A 1KQ1A 3V7SA 3FJPA 5GAOl 1CF7A 1DPUA 5LGTA 2G4CA 4C92A 2Z99A 2CSOA 3IWFA 4G7HF 5KNNA 3SWNB 2RHQA 3HRKA 2O61A 3QU6A 3WODF 3MWMA 1ZRDA 1UFMA 2EFOA 4YDQA 5D6FA 1EIYA 3MEXA 5DCMB 1ZGAA 3KEQA 4H2XB 1W7PD 4MEYF 1OYIA 4EJOA 2XGTA 3R0AA 3HFZA 2C6YA 4Q47A 4UV8A 3HTZA 1O7LA 5F64A 1P2FA 3M7GA 2EK5A 2ZT7A 2E1NA 1RUNA 2XTIA 3FHZA 4M78D 1B7YA 2WTEA 4L9JA 2JPBA 3HRMA 1J2XA 2ESHA 4RGUA 2HS5A 2IRFG 5GANj 4C8QE 4TVAB 2VE8A 3FIFA 4HF0A 4B09A 3WGGA 5BOXA 4YRPA 5GANh 3VB2A 2EJ9A 3ISPA 3I7FA 3IALA 2VONA 2ZT8A 4LLLA 4P72A 4EMGA 4YP0A 1IRGA 2HOEA 3F22A 2A07F 3WTWC 3HY0A 1QF6A 4I0AA 2K7LA 5GANg 2Y90A 5FFXA 5HVQC 5D6EA 4YRMA 1X56A 4HDVA 4EM1A 5E20A 5LJ5e 2I4NA 2FSWA 4CS3A 2D1HA 4M7DE 5ERIA 5CAIA 3CUQB 1UCRA 2WC2A 4P74C 3JB9J 3WU0A 5ICGA 4YPFA 2QBYA 3KP5A 4C92G 4YROA 3W6KB 1SD4A 5GAN5 4DQ2A 4D0PA 4KMFA 1J5YA 2E65A 2ZKZA 3ZMSA 3RYPA 2DXUA 4C92B 3LWFA 2ZINA 4M7AE 3QP5A 3NRVA 2AS5F 4C8QF 5LJ3f 5LJ3d 1OKRA 4XU2A 3TO6A 2A6HF 3O2PE 4JLIA 3PCOA 4IJAA 1G51A 3WTUC 3DQVC 1XSDA 3E9IA 4M78B 3SZPA 4HT8A 2DQ0A 4Z2YA 2E64A 2ZCEA 1TQIA 4YRNA 4G94A 1S29A 1IW7F 4V2SA 3W6JB 2YX4A 3JCMd 5J8FA 2GA2A 1GVJA 4UVAA 4UXNA 1C0AA 1UB9A 4HV6A 3QTCA 4RQFA 4IVNA 4BHCA 2HYFA 5E1WA 3GW2A 4XQ3A 4M75D 4EM2A 1HW1A 3E6CC 4XTYA 4UVCA 1ZGJA 3KZZA 2DZ9A 3BJOA 1YCYA 3QNEA 1K78B 4F7UG 4DPGA 3K9TA 3F3XA 2Q0OA 3JW4A 5HS9A 5JFRA 4KQEA 5GAN7 3HY1A 2HNIA 1JGSA 2DPDA 1E24A 1RZ4A 1B70B 4HX8A 3RTRA 4U7BA 5D8LB 1W66A 2ALYB 4F7UB 2YPRA 4ETSA 2FQ3A 5J8CA 3PGGA 2A3SA 1KU2A 3JTGA 2FMLA 4ESFA 2MH2A 1J5WA 2YLCA 5GAN3 5GAOr 4HT9A 4HW0A 3VEPA 2ARUA 3F8NA 1U1TA 2PN6A 5A2QK 2STTA 1FSHA 2W25A 2I4LA 1FBSA 1HQCA 1FLIA 4PZJA 2LDUA 4OIPF 2BBYA 1N9SA 3WTSC 6PAXA 2D1VA 1SFUA 1YIOA 1K6OA 3Q9SA 4HWOA 3UFGA 5CVIA 3HSBA 1BI3A 3ZMDA 3JB9D 2J5PA 1B59A 5GANf 5GANd 3K1NA 4UNOA 5DUIA 3U9GA 4C8QA 2P0LA 3CTAA 5GMKi 4ENKA 1XDSA 2EL9A 4RMFA 1U2WA 1K7AA 5CYVA 3HHHA 4YRGA 3I59B 3HFOA 1DUXC 4BHPA 1Z91A 1FX7A 1T39A 2L01A 4LK1F 3KETA 2J3MA 3BJAA 2ZNIA 2HGCA 1B34B 1BIAA 2YHTA 2PMUA 3TEHA 4AVPA 2Q5HA 5HLIA 3GZ6A 2UXXA 4M74A 4P72C 2V1DA 1YFTA 3MF1A 4M7DA 4HAMA 2CJ9A 3HRUA 1HXDA 4YG2F 4EX5A 1IRFA 1TBXA 3TOBA 4TWAA 3RACA 4ENNA 2RGVA 3HXXA 4MNUA 5K5QA 3QO8A 2KKOA 5HGQA 1FP2A 4TV7A 4R1HA 4BAYA 1I1GA 4HWPA 2XAQA 1ADJA 1W5SA 4BWAA 4WXDA 2RD1A 3K1MA 2UZKA 2ZIMA 2TDXA 2NS0A 5BS6A 1ZG3A 3QSUA 1G4DA 1E1TA 3KFUA 2EFWA 3SZTA 2EV6A 4WI1A 4EMKB 4UV9A 5LJ3e 1BOAA 3K2ZA 4PJOF 3A32A 4YIIA 2ODRD 1FC3A 2FU4A 2JZYA 1XD7A 4M77E 3T5XA 4H2VA 2XAGA 4JBAA 1WWXA 2VT3A 1LDDA 4QLCU 4RGRA 2VBXA 3M8EA 4XU0A 3ECOA 1XCBA 2W85A 3QU3A 4AWXB 1GXPA 4P71C 5K5RA 3KP4A 3DPLC 1XB4A 2XGXA 2Z5UA 4G9YA 1XCVA 1XSXA 3ZMVA 1YLFA 2E41A 2FNAA 3K69A 3JCMe 4ENJA 4P75A 5D5WB 2IA0A 3ELKA 4XTUA 2E10A 1YS6A 1YFHA 4MQ9F 3ML6A 1OYYA 1BC8C 1HSJA 2FOKA 4Q4ZF 1G5HA 4C8QG 1LVAA 5GAN8 2WWYA 3E97A 2AKWA 4IRGA 3TGNA 3ROUA 3IC7A 3DF8A 4G85A 1MD0A 1TNSA 4WXHA 4CS4A 1JJCA 4EVIA 4AIJA 5EEGA 4LG0B 3FMQA 3ERED 1O3RA 1BI2A 2M5WA 1U5TB 1IN5A 5FD6A 1MKMA 5ELOA 5E8IA 4P55A 5GAOm 5GMKl 1R1VA 2DAOA 5LRSA 5DY9A 1MJ9A 1B6AA 1NNHA 2QZ8A 4YRRA 4TVYA 1BJAA 4OMZA 2IA2A 4M7DG 1KQ2A 3O3KA 1Z7MA 4S05A 3JSPA 1ZHFA 2CQKA 2H6CA 4G84A 1G3SA 1YQAA 12ASA 3IRQA 5ILVA 4L5JA 3QO5A 4L9TA 2PQ8A 1B9MA 4MHGA 4I98B 4YFNF 2HDCA 3P8TA 4I0BA 3TKYA 3GEZA 4M9SA 4QVDA 3D0SA 4GO1A 4RAYA 3FF5A 2HKOA 4M71A 4AIHA 1YGBA 4LLGF 4CH5A 1Q1HA 4HV5A 3LA7A 4ZYHA 5GANe 4M7AG 5GAOq 1S7AA 1XMAA 4JQFA 2FB7A 4RB1A 3LA2A 1I6XA 4HX4A 2BGCA 3LC0A 3WGIA 2DW4A 5FLXZ 1Z05A 1LB2A 4M7AB 2XHKA 1D3YA 1RIOH 4N0BA 5LGNA 4C8QC 4N0AA 2LSOA 3DP7A 5H6QA 5ICFA 3M4PA 1REPC 4MGRA 5E8GA 1WQWA 3RDIA 3CJNA 2M30A 2L4AA 1RI7A 4P3OA 2M45A 3VODA 2QUFA 4A0XA 3BJUA 4UPAA 5LHIA 2B0LA 3RKWA 2DU9A 3HRIA 1U6GA 1FY7A 1UHMA 2JRTA 3CDHA 1TH7A 4LD5A 2PMFA 4R79A 1PDNC 4LNSA 4WK8F 4Q5SF 1Z1DA 4M78F 3FXQA 4H0EA 4M7DC 3OD1A 4UVBA 3FM3A 4TQDA 1IL2A 4L9NA 2EJFA 4EJWA 1P6RA 1S3JA 3JCMW 3A5ZA 3GFJA 4K86A 3GZ5A 3KEOA 2O8XA 1XGOA 1ZLKA 3F72A 1XGMA 2LF7A 3IWZA 2IPQX 2CWEA 2IY5B 3BP8A 5K1PA 3WE3A 4M77A 5FGMA 5CLSA 1MZBA 3F8MA 3NELA 5DD8A 1W4MA 1I5LA 2VC1A 5DDGA 1Y96A 1D5VA 3D5LA 2EFPA 3KZYA 1I8FA 4YRFA 4EQQA 4UP8A 4KICA 1SFXA 3WTZA 4F7ZA 4A0YA 3WQZA 1TW3A 1D3BA 5KVRA 3R6SA 5I21A 2PJPA 2F5DA 4IRIA 5DYMA 3F21A 3VU3C 3BFMA 1F1ZA 5LGUA 4M75E 1TLHB 1FPQA 3BPVA 1HTTA 2RVCA 1LEAA 4QVCA 5ICEA 2F5CA 4P75C 3LQQA 4XLPF 4YRTA 4H2TA 1HKSA 2P8TA 3CUOA 3TO9A 4A5NA 5LHHA 1H0MA 5ELNA 2DU5A 1BI0A 4E51A 1R5HA 1H4VB 1SESA 3J80Z 1G3WA 4A0ZA 4KDPA 1YW9A 5K1YA 1D8KA 1W7PA 4KIBA 3QO7A 5AIPA 1H4QA 3RKXA 1DDNA 2EWNA 5FFZA 2FBKA 3T0YA 4C92D 4PGGA 2P6SA 1KYWA 1Z7NA 2Z33A 4GCVA 3M9AA 3P9CA 1YFRA 2V9VA 4AIKA 1WQ7A 2ZMEA 2P4WA 2E1HA 3QP6A 3OV8A 1HW5A 2EFNA 1YO5C 4CHUA 4H2SA 1FBUA 3I4PA 3ZN1A 2RM4A 1R58A 3NEUA 4M75F 3P8VA 3J81Z 2QQBA 2ZXJA 4YIFA 4RAZA 5GMKj 4DNCA 4HVCA 1K79A 1NJ2A 2STWA 5K5OA 2FXAA 1KGSA 4RCBA 4PHCA 3R4KA 3E5XA 2QHVA 1QGPA 4M77G 3ECHA 1MGQA 5E18F 2RKHA 1S6LA 3UGQA 3P9IA 3MAJA 4OLFA 3DXJF 2C7IA 2DTRA 2DQ3A 2EJGA 3BOQA 1QQIA 1HSTA 1LQ1A 3LSTA 4N0AC 4HLYA 1Y96B 4M72A 4H2WA 1KQ9A 2VOPA 3V8KA 2VBWA 1F5TA 1EQRA 5JHUA 1T6SA 2BV6A 2RQPA 2JPCA 3GFLA 2M8EA 1IF1A 3GXOA 1I27A 1NYQA 3L00A 1LYLA 4OMYA 2RNJA 4HA8A 1EV7A 3JAMZ 2QQ9A 2YX7A 3DFGA 3JB9F 4JRKA 1STZA 1GHCA 2I4MA 3B73A 1IUYA 4XU3A 1W5TA 1CF7B 5IT9Z 2HWVA 4RS8A 5DEQA 1FP1D 2RHQB 3BY7A 2ZT5A 2ZZEA 4WJ4A 1HW2A 1O3QA 2ARTA 4P71A 3HSFA 1ZN2A 2YSRA 4TTVA 3EFRA 2O0YA 1R5GA 5D8KB 3IRRA 4Q15A 2NRAC 3GF2A 2DTHA 1EIYB 4EJTA 1I5ZA 3F6VA 3JCMc 2GA1A 3U1DA 4HYEA 1J59A 3L2ZA 2GWRA 2Y48A 2MD5A 3HFZB 4M9XA 4M77C 1L0OC 2V79A 3RL6A 2CJAA 2P7CB 1NYRA 1KQ0A 4LGWA 3DPTA 4L0ZB 3C1DA 2V6CA 4YRKA 3EYYA 4M75A 1XN7A 3A5YA 1B7YB 4GYGA 1OPCA 3WG9A 2OZUA 5GAMj 1WU7A 5C51B 4CDGA 1FZPB 2RHSA 3C3WA 3I58A 3F23A 2ARSA 2MH9A 1M8VA 2VBZA 1IN6A 3AAFA 2W57A 4PCQA 4U7DA 3WTXC 5JI6A 1H9TA 1FSEA 5HDGA 1Y0UA 1LDKB 4ON0A 3MZHA 2XAHA 1ULYA 3TDZC 2L3DA 3J7AO 3NENA 5GAMg 2CIMA 4UHTA 2O6GE 5D4SA 2VE9A 1PP7U 3JB9I 3FXUA 2ESNA 1NJ5A 2P5IA 2AXLA 2Q2EA 1USYC 2OA4A 1JBMA 5JR3A 3HFVA 1B9NA 4KA4A 1ZYRF 4KN7X 4RB2C 2RN7A 2OD5A 2YU3A 5L3CA 2IJLA 4LK0F 1SD7A 2QM3A 3WGHA 1WKMA 3BWGA 4UUVA 1QZZA 2XV4S 3GIBA 4XLNF 3IHUA 2QBYB 4E70A 2EAYA 2GAUA 3F8CA 2OAZA 2LKPA 4IPAA 4HF1A 3RPUA 4XEMA 2HFHA 2DQRA 4YCUA 1HBXG 1XGSA 1NHAA 4WF2A 4HF2A 4PJOE 2X4HA 5CJ9A 1YS7A 3HXYA 1JHFA 3BDDA 3DEUA 1P92A 1LNWA 3HRTA 3M8FA 3ZMZA 1AWCA 5LBQA 2KIMA 5HS7A 2IA1A 3ZQ7A 3C18A 1X55A 1R36A 4ZYEA 3VQXA 3F6OA 3MCZA 3PCOB 1JE8A 1IXCA 3BY6A 1PYSA 4G6QA 5CVVA 1MDMA 4OINF 4P9FA 3I54A 4I02A 4U0WA 3V7CA 4Y91A 3JCMb 1R7JA 4ZZLA 5GAOn 3JCMX 3FMSA 2LNBA 1N9RA 1ONVA 4M6YA 2PMHA 4M75G 2OU2A 3ZMTA 2CYYA 2E1CA 4BQAA 3A74A 1H4TA 2PG4A 2GXGA 1T2KA 1B76A 3I64A 1IXRC 5HLHA 1SFEA 2E5AA 2RHSB 4XEOA 1U3EM 2CW0F 2GZWA 2AMCA 1T98A 3GFMA 3WTTC 4J5YA 2EA4A 2XIGA 3L4GA 3I53A 3C7JA 4FX0A 2DEQA 4JRIA 3CLOA 2W24A 2HQNA 1RIQA 2DU7A 5BQTA 5LJ5g 4ASNA 4RQEA 2F2EA 4XU1A 1H641 2DXTA 2Z3YA 2ZCWA 2QTXA 4M7AD 3L9FA 4OU0A 3KLNA 4YFKF 4HWTA 1WLEA 5K1XA 1R00A 4A53A 3VFZA 2W84A 1IXSB 2H94A 2HZTA 1DPRA 2ZNJA 3F8BA 1DP7P 4CICA 1LJ9A 1RNLA 2CFXA 4WWCA 1FYKA 5GAMf 1ZG5A 5GAMd 1CGPA 3HHGA 5AONA 2CG4A 3QUIA 3ABTA 4M75C 4C8QB 1X2GA 5F1RA 4EGYA 2K86A 2COMA 1FNNA 3BPXA 4UP7A 4XBFA 4L9VA 4LFUA 2VC0A 1BC7C 1XSVA 4H2YA 3PFIA 3GO5A 1EH8A 4LLNA 3L09A 3QRFF 3RF1A 1X54A 4N9IA 3PZCA 3BW1A 3N97A 4G7ZF 3VQVA 3GYHX 2ISZA 1SD5A 3TEHB 1SAXA 3R60A 3JCMJ 1SETA 1ZG1A 4M78E 4YRIA 4M7DB 5E3IA 2XKOA 2VT2A 3G1ZA 4CH4A 5HOOA 4RDXA 4BXUA 4BHBA 3H92A 4A12A 4MTEA 2I2LA 2DBBA 3RERA 3HSEA 3T1BA 3I71A 2PMEA 1BM9A 1ZARA 2EV5A 3RJPA 3T8TA 1JHHA 3QO3A 4PJOA 2F5FA 2Q8KA 2ZZGA 4HWSA 1VTNC 4N9HA 2AMCB 2DI3A 1YB3A 4XTXA 1IAWA 4P73C 1KOGA 1F9NA 3SWNA 3SQNA 1WYDA 5CVUA 2FYKA 3VQWA 1L3LA 1IN4A 4FHTA 3WU1B 1WPYA 3SXYA 5ED4A 5AIQA 1R22A 3E9HA 3HYIA 4C92F 1USTA 2L54A 4YREA 5DD4A 4S04A 2O3FA 4F7UE 1KQ8A 1G3YA 2X0LA 4YYEA 1LJOA 5DCMA 4ZZDA 4OP0A 1E1OA 3COAC 3P7NA 4H2XA 2ZFWA 3REOA 1FYFA 2IVMA 1ON1A 1V3FA 2JT1A 3HTUA 1UHWA 4LB5A 3G73A 1L0WA 4HWRA 4HQEA 2K27A 1QPMA 1FBQA 2RV8A 5LJ5f 4HBLA 2QLZA 4Q48A 2MA3A 1ATIA 2AKWB 2EB7A 3GUDA 1YYVA 2XRNA 3HRSA 3N4MA 3SFZA 4OOIA 1JJCB 1HK9A 3RKYA 5FO5A 4TVAA 4I7HA 3CO7C 4I09A 2I4OA 4P5OA 2XKPA 4OIOF 4HLXA 3TOAA 2J3LA 2ZIOA 2RC4A 2BYVE 5BMZA 1KU9A 2ODRC 2V1XA 3MZYA 3HOTA 2L4MA 2PEXA 1FOKA 4F7UF 2K4JA 5ICCA 5L3GA 1ZRFA 3IG2A 3PQKA 3TDUC 3RIRA 4YFXF 4EGZA 2M1BA 3BZ6A 1EVKA 3LSQA 3L2CA 2ZNYA 5HDNA 2KJBA 1USSA 4EM0B 2G7HA 3CUQA 2PLYA 4RCCA 4Y13A 4IRHA 5GAOp 1PP8F 2FF4A 4U0VA 3A7RA 5F6FA 4PJOG 4QWQA 3GWZA 1ADYA 3Q5FA 3HFNA 2GQQA 3S2WA 4OIQF 1R1TA 5E1XA 4MEXF 3O6BB 1KU3A 2HYGD 2J5OA 1USYA 3LQRA 3V8JA 2DJZA 3F8FA 1WNLA 4YRJA 1E2XA 2QENA 1O7FA 3JCMg 1BI1A 3FM5A 4A6DA 4ENMA 2XAFA 4WXCA 5LRRA 1P4AA 1MJBA 2H09A 3OOPA 1U8RA 3JSOA 3IKVA 4M78A 5A2QZ 2IW5A 3ABUA 3RYRA 1LOJA 2FRHA 2FE3A 2HTSA 3A7AA 3TQNA 1KU7A 4TVWA 1WRJA 1PUEE 4EMSA 2ZBKA 2CJBA 2E7XA 2KIUA 5C52B 4EJUA 1E17A 1LDJA 3WE2A 1YG2A 4ESBA 3ERRA 1FT9A 1YW8A 2OQGA 5HS8A 2HKXA 1OR7A 5GAN4 1E22A 1KYZA 4YCWA 1MGTA 1BN5A 1Z9CA 3ULQB 5CVJA 2KJCA 5GMKh 4EV0A 5FLXK 1K78A 1ODDA 4KIFA 2IP2A 1FWZA 4BW9A 4PJOC 4M77B 4MMLA 1EOVA 1B70A 2C8MA 2ALYA 3E6BA 4F7UA 4IF4A 3EETA 3SWNC 1JRIA 5BPIA 2QYOA 4GGGA 1IZ1A 3KFWX 1IN7A 5DUKA 1GGMA 4O6JA 1D3BB 1Z6TA 2O03A 5GAN6 2A69F 5D5UB 2HR3A 1SMTA 4X9DA 2ZTGA 2CGHA 3P8YA 5EEHA 2FEZA 5L3FA 4O2DA 3L1AA 3V8LA 4L5IA 2QQAA 3B02A 4KFCA 4K88A 2R7DA 2HEOA 3PQJA 2UWMA 4R8HA 2L02A 3GVAA 1H9GA 3ZMUA 4XSZF 1NJ6A 3TUPA 4P3NA 2DPUA 2IT0A 2QHSA 5KK1A 3MEYA 4PGHA 4B8XA 2FBIA 1XMKA 4L87A 3E3VA 4NOYA 3IKLA 1WQ2A 2CO5A 2Q7EA 2DLLA 1W7PB 2P5KA 3KCCA 1XDUA 1X2HA 2VXFA 3I59A 3TO7A 1U1SA 2OZ6A 4M78G 2EV0A 4P3PA 4G8XA 4GXOA 1YFSA 3FX3A 3LA3A 4Q6GA 2DDZA 4WCGA 1P4XA 1B34A 3NETA 4FX4A 2OQRA 2ZMEB 4J15A 2EFQA 2D45A 4NCXA 3MQ0A 4CXFA 2DK5A 3ZPLA 4ZH4F 3GLXA 3HTSB 4NHJA 1OMIA 1KMMA 3FMRA 3Q9VA 3JCMf 1SMYF 4I2OA 4U0YA 1X3UA 4Y15A 2ZXFA 1NJ1A 4M7DF 3KP7A 5GAMh 3CUQC 4I01A 2RB6A 2GXBA 4YRLA 4KMUX 3VQYA 4ZTUB 4HOBA 5GAN2 4M9ZA 1U78A 2A5YB 2H6BA 2VBYA 1ON2A 3J80K 1X01A 1N9WA 2PI0A 4O3MA 2A68F 1EH6A 4LB6B 1C0WA 2JN0A 4EMKA 4UP9A 4MQVA 4KIGA 1YTYA 2XROA 3JCMQ 4KN4X 4L0YB 4M7AF 1B1BA 2K4BA 3NQOA 4M73A 3QPTA 4C92C 3REXA 1O3TA 1R1UA 2F5EA 2OBPA 5GMKm 1XGNA 4KUMA 3LAPA 2BEOA 2XUBA 4XRFA 2V1UA 5L3BA 2NYXA 2P5LC 3VBBA 4M78C 3E5UA 1YW7A 4HQMA 4P73A 2ZJ2A 4ZTZB 2DK8A 3NEMA 1BIBA 2MC3A 3T8RA 2ZGWA 1HKQA 1IN8A 3KP2A 3J81K 2NNYA 3IKMB 5LHGA 3JCMP 3DSQA 1R23A 5D5VB 2ZO4A 2Q7GA 1SERA 3HXVA 3DKWA 2EA2A 5F5WA 2EJRA 3JCMV 3UGTA 4TQFA 4LG0A 4A54A 1EFWA 4GYIA 4C8QD 1J75A 1O57A 1SRYA 4P96A 4EO4A 1U5TA 1FYLA 1VQZA 4EJVA 3M1EA 4XTWA 5E17F 2QHUA 2VXEA 4G7OF 3R07A 2ZNZA 3FZVA 3RGLA 3KP3A 1NJ8A 4MTDA 3EQLF 2DO7A 2UXNA 3U2RA 2MBFA 2Y0MA 4CS2A 2G7UA 1TNTA 1BBWA 2VOOA 3BROA 4KYWA 5LJ5j 3ICAA 4M75B 1LEBA 2RA2A 1S8NA 1OYWA 4PDKA 3E6MA 3JAMK 2JTVA 4RB3C 4M7DD 4H02A 2R3SA 3RPQA 5LJ5h 5DV5A 4PG3A 4KT5C 2P5VA 2KIFA 5IT9K 4H2UA 4IHSA 2QHTA 2PBIA 1MJAA 1T0FA 2ETHA 4A6EA 3BDUA 4EMHA 5E1ZB 1EH7A 5L3DA 4NB5A 5H6RA 4M7AA 5HLGA 3HOSA 1A04A 2A61A 4XSXF 3HXUA 4LJZF 3IL2A 5ILUA 2DT5A 3V4GA 1EVLA 3EDPA 3E6DA 3G3ZA 3HXWA 3AHUA 4IXAA 4CO8A 2GIVA 3ZP5A 3JB9G 3H3ZA 4CZZA 2K57A 1JXSA 3HSRA 4JUVA 1HC7A 4CH6A 2BE5F 4YRCA 2CGPA 3A7UA 3QHSA 1F4KA 2QVOA 4J6WA 2FA5A 2G9WA 4ZIBA 3QPHA 1I81A 2FNPA 2ELHA 3KLOA 4A2UA 4JK1X 2FMYA 2FBHA 3R61A 2YLBA 3A31A 2PFBA 3K0LA 1D8JA 4K87A 4J6XA 1BBUA 4KNYA 5ILSA 2Q7HA 4C92E 2ISYA 3QOPA 3WTVC 1ZLJA 2E3CA 1AOYA 3JTHA 4OIRF 3FB9A 1ZH5A 11ASA 5H20A 4WX9A 5FB2A 3M4GA 2IY5A 3EYIA 1PYSB 1MDMB 4CH3A 5BPDA 3RUXA 1SD6A 1B4AA 2KRFA 2DFIA 4HDUA 2ACJA 4EMKC 4U88A 4M77F 1M5Q1 4FT8A 3CO6C 4J6YA 3FXRA 1QE0A 3GFIA 4G6DA 2HTJA 2ZZFA 1ASZA 1J7KA 5D4RA 3L7WA 5FD5A 2VC8A 1H4SA 3UH0A 5GMKe 4YRQA 4BYYA 3MF2A 3RESA 5HDKA 1G5IA 2M87A 3W3SA 4M6XA 4XTZA 5LEJA 3WTYC 4Y17A 4X5OA 4YCVA 4RGSA 2JSCA 2H27A 4MMKA 3L4GB 2DZCA 2XVCA 3MFKA 2HQRA 5TRDA 4RB0A 5LLQA 1T38A 4CGZA 1TQMA 1TW2A 2QWWA 2DKGA 1BBYA 4NL2A 2E7WA 3P9KA 3DV8A 3V7RA 3FWEA 2VODA 2P7VB 4PJOD 5JVTA 4AD9A 2DTIA 2Y75A 3SB2A 1ASYA 4IHTA 4WJ3M 1ZREA 2DVEA 3EFSA 3E5QA 5C53B 2DTOA 4P9UA 1U5TC 1I1SA 3LFKA 3I0TA 3I5UA 4P74A 3ZN0A 2Q5IA 1LNXA 4ZYGA 2VN2A 1TQPA 5LJ5d 3M4QA 3EUHA 4NQWA 4YRSA 5D5XB 4O5VA 2XAJA 2P6TA 4KR3A 2D2WA 4A5MA 3JB9H 4X9CA 5TJJA 5LEKA 1I4K1
chains in the Genus database with same CATH superfamily
2NNNA 4NL3A 3PMIA 1X2MA 2KT0A 2UUZA 4HX7A 4I76A 5GPAA 2DE0X 3CMQA 3HXZA 3QAHA 4AH6A 5CIUA 4CYDA 1S72A 2NS7A 3HL2A 3KE2A 1G3TA 2MLKA 1W1FA 2ZR2A 3SHFA 1WI9A 4ZYDA 3LSSA 1YHQA 2RI3A 3HIFA 3CCVT 3LGFA 2RN8A 4QW2A 1M1KC 1RUOA 2K02A 1Y0NA 4HZFA 1MMDA 2ADUA 3OIQA 3HUGA 2VWFA 5CVRA 2OTJQ 3C94A 5J6XA 3LLRA 5GAMe 3QZ5B 4MDXA 2Z9OA 4DBRA 3INZA 4NUBA 3CMAA 3TW6A 2CP3A 1Z7UA 1QBJA 1OEBA 1SHGA 3W3CA 1WJCA 4J9HA 3L2UA 4F14A 4IX7A 4C92A 3IWFA 4G7HF 3I56I 1TWHJ 2YT6A 3SWNB 1OU8A 5I2SA 4DEYA 1HDDC 2VB6A 2EFOA 5IP6A 2D8HA 1OJLA 5FU7B 4PJMA 1W7PD 4MEYF 3C4SA 1QVFP 1N5ZA 3EGDB 4EJOA 2VPLA 2EZKA 1YFNA 3G71Q 2X1DA 2GTOA 2UV1A 1MNEA 5F64A 4CSWA 3UT1A 2EK5A 2ZT7A 2OAWA 2XTIA 1G2HA 1B7YA 2AIRB 4L9JA 1A0NB 4CH7A 4IHYA 2HS5A 2IRFG 1H88C 5IPAA 4TVAB 2VE8A 2ZZDA 3S3MA 5BOXA 5GANh 3VB2A 2EJ9A 1BCOA 3ISPA 3I7FA 3IALA 3CCSA 2ZT8A 4EMGA 1IRGA 2HOEA 3HY0A 3KYCB 4BDZA 2K7LA 5GANg 3J7AF 4EM1A 4CS3A 2EZIA 2HEQA 1DGWY 2CH4A 3CUQB 4LN2A 3N5BB 1IZ6A 1MBJA 5F0FA 4YROA 4KMFA 4D0PA 5KHDA 2ZKZA 4C92B 4M7AE 1UELB 2DCEA 2XPVA 1M4ZA 1HCRA 3CDLA 4XU2A 3TO6A 1BB9A 2A6HF 1A35A 1G51A 3CBMA 2MWOA 3SZPA 3HOZJ 2E64A 1GBRA 3I5SA 4R56A 1IW7F 3J80E 3W6JB 3JCMd 2ID6A 4BHCA 3HL8A 2PVOB 4EM2A 1VQ7Q 3L42A 1K9AA 3FHNA 4DPGA 2HYJA 1JGSA 1Z9QA 4HX8A 4CCMA 3MEUA 2J7IA 5J8CA 3PGGA 2A3SA 2DD5A 2GLOA 3CBOA 4R0KA 2CZ1B 1TWGJ 3F8NA 4LD6A 1FSHA 1Z9ZA 1VUBA 2LDUA 1NM7A 6PAXA 2YUQA 1SFUA 1KG1A 1YIOA 3UFGA 1BI3A 3JB9D 3K1NA 4OF1A 3GTMJ 4RAGA 1SF9A 3K7AJ 4ENKA 1XDSA 4RMFA 1U2WA 1K7AA 2JA7J 2M2EA 2R5ZA 4JZ4A 4YRGA 3CCVA 2K3FA 4FISA 2HDWA 2XG8D 1FX7A 1T39A 2OTJI 2L01A 3BJAA 2PMUA 3TEHA 2I10A 1B8IB 2CQQA 2Q5HA 2HNHA 3PVLA 3OW2P 4P72C 3CMET 3MF1A 2DA4A 3HRUA 3H3VK 1TBXA 2QQ8A 5IYBJ 2RGVA 2VJ5A 5K5QA 1WZ2A 2Y4XA 4R1HA 1LCKA 2Y69H 1BW5A 4BWAA 2DODA 3K1MA 4HCBA 2TDXA 4N4IA 2OC6A 5BS6A 1G4DA 2JUGA 1OOTA 3SZTA 2EV6A 4UV9A 2RO0A 1Q82U 2JUCA 5LJ3e 2OJED 2CUDA 3CP2A 1FOWA 3T5XA 3DLLA 2KT8A 2YRVA 3G71I 4RGRA 4XU0A 3ECOA 5K5RA 3DPLC 2A05A 1OI1A 2XGXA 1XCVA 3MP6A 1Y8QB 3PE0A 3CXCP 1YFHA 2BXYA 3ML6A 1G5HA 1LVAA 3QJ6A 2M9HA 3IC7A 4G85A 1MD0A 1UHFA 3QWYA 1T56A 5IHNA 5EEGA 4LUDA 3TL4X 2EGAA 4P55A 4J9BA 3GF5A 3RZDJ 1H92A 2CYZB 1NNHA 2QZ8A 1YI2T 4YRRA 1M2OA 3WU2C 4TVYA 4OMZA 1NYFA 4S05A 3JSPA 1ZHFA 2CQKA 3HKZA 4ZTFA 1KQSP 4YFNF 3CCJT 3TKYA 3GEZA 4M9SA 2HKOA 1YGBA 1Q1HA 4B44A 3UA6A 2FJ1A 3DKYA 1QKXA 3M56A 3WGIA 2DW4A 5FLXZ 2B9SA 1Z05A 4ABZA 2EYYA 1FMVA 1LB2A 4M7AB 2HI3A 2XHKA 2Y9ZA 2PX9A 1RIOH 2LSOA 3OYCA 1POGA 2D1XA 3KPHA 1WQWA 3RDIA 2K9MA 4YTLA 2RK2A 1FEXA 1QP3A 3BCAA 3H1CA 2VVKA 1FY7A 4XKCA 3CCMQ 3CDHA 3DTKA 4D9JA 2B63J 4R79A 2RNAA 3BCBA 4Z8AA 2DL4A 4M7DC 4BD3A 5KCOA 5IP9J 1P6RA 3W2WA 4OVAA 2ZPBB 3JCMW 2ATCB 1MMGA 1ZLKA 1NJIC 2ZSHB 1CKBA 1IHVA 2L2PA 4M4ZA 5K1PA 3A8HB 2NVUB 3WE3A 2XDPA 3F8MA 1Y96A 1D5VA 4C3IJ 1I5OB 2LQNA 2GBYA 2L3PA 5GJWB 4KICA 3CPWS 1TW3A 1MNMC 3WXMB 2A36A 3VU3C 3BFMA 1BL0A 5C4JJ 3BPVA 5FKLA 1I1JA 4CCOA 1Y7XA 4P75C 2BW3A 5FJ8J 4XLPF 3M0TA 4FQGA 4A5NA 2DU5A 5ELNA 1BI0A 2NS6A 4A0ZA 4B6MA 1Y07A 5CR2A 5K1YA 1S7EA 4NS5A 1W7PA 2MYSA 1DDNA 2FBKA 2W00A 3CLQA 4PGGA 3CMEA 2RK1A 1Z7NA 3M9AA 2E1HA 3OV8A 4XLHA 2DM1A 3RDVA 4MZPA 3NEUA 3QKJA 2PMZA 4JJNK 2QQBA 4EDUA 2XPWA 2MK5A 5K7FA 3P8BB 1M1FA 2KISA 1NJ2A 5K5OA 4RCBA 4PHCA 3K4JA 1QGPA 4A3BJ 1S6LA 2O4XB 4OLFA 5IH2A 4AM3A 3CPWA 4LVLA 1K73R 1Y96B 4M72A 3S3OA 2VOPA 3V8KA 1S5LC 3OOUA 3KXTA 1LYLA 4OMYA 2KROA 4C5HA 2XU8A 2ZC2A 3JB9F 2XAUA 1STZA 1GHCA 4F92B 3B73A 3S2DJ 2K9LA 4XU3A 2KXCA 4RS8A 2L0AA 5IXBA 3FBIB 5DEQA 4PFOA 2ZT5A 3RBBB 1WFWA 2KDOA 5D8KB 2R7TA 4Q15A 2M4KA 3U1DA 3L2ZA 2EYQA 1PRMC 4M9XA 1V29B 1MV3A 5AYFA 1A5JA 2F4IA 3CCJA 3G7ZA 4BL0B 4L0ZB 3C1DA 2DL3A 4W97A 3I4NJ 1TWFJ 1G2BA 3A5YA 1MBKA 1WJQA 2K3BA 3WG9A 3NARA 5GAMj 3FKIJ 3C3WA 2EIJH 2MH9A 5M5WJ 1DJ7B 3AAFA 2IGNA 1SKUB 3WTXC 1H9TA 1GFDA 1FSEA 5HDGA 1LDKB 1U8BA 4HT4A 2XAHA 5M9OA 1PJRA 4IIMA 3ZQFA 2O6GE 2VE9A 1NJ5A 1Q81C 2P5IA 4ZGDB 3HFVA 1ETKA 1TWAJ 4KN7X 4RB2C 2CS3A 2G3RA 1SD7A 1ETOA 3VS5A 4RMOA 3MMYB 2DDAA 3GIBA 3LX7A 1VQ5Q 2QBYB 1K0SA 4PKCC 5FKNA 3F8CA 1YITQ 2JTEA 3U23A 3OQ5A 1U5SA 4PLLA 4HF2A 4PJOE 2X4HA 2CP0A 3HXYA 3BR0A 2CJJA 1YIJT 3BDDA 1LNWA 3HRTA 3M8FA 1Y57A 1O75A 1MBGA 2KIMA 5HS7A 1R36A 3PCOB 2OTLA 3BY6A 5CVVA 1OCTC 4OINF 2LQWA 4P9FA 3I54A 4Y28E 1RKTA 1ZA2B 4ZYAA 3OL3A 3GP8A 2R7RA 5GAOn 5DLQE 2LNBA 4M6YA 1RACB 1UG1A 3ZMTA 2CYYA 2AXTC 4JPBW 3A74A 2QKMB 2GXGA 1T2KA 4AFUC 3REAB 4OMOA 5HLHA 4IKFA 1SFEA 1M1KR 1IGUA 2RNGA 4BI3A 2CW0F 3A8MB 2L0KA 1UB4A 3WTTC 1MV0B 2XIGA 4LVMA 3C7JA 1ZA1B 3ASKA 2HQNA 5LJ5g 2VKVA 4ASNA 1KONA 2DYRH 1UJ8A 2CRGA 2L89A 2ZCWA 3CCYA 2BTTA 2R92J 2ZJPF 3KLNA 4FE7A 5DTDA 9ANTA 2H94A 2LTOA 1DPRA 5EZHA 2M4GA 2BXZA 3OY9A 1RNLA 1FYKA 5GAMf 5GAMd 1K73U 1CGPA 3S17J 4L59A 2VASA 3BR2A 4I99C 2NUPB 1XPXA 1JUMA 4C8QB 3BPXA 4XBFA 4XMYA 4H2YA 3GO5A 1EH8A 1ZBXA 2B8AA 3M0UA 3QRFF 3PZCA 3S14J 3N97A 3AKZA 2ISZA 3JCMJ 2L5QA 1WJRA 3WHCA 3FKJA 3EG9A 3VPRA 1E6HA 4M6VA 4RDXA 4MO7A 1ZELA 4A12A 2I2LA 2DBBA 1QKWA 4KUIA 1N27A 4ZDOA 1X1AA 3TQ7P 2QI2A 1BM9A 3U21A 1ZARA 1JHHA 4PJOA 2ZZGA 4N9HA 1W2BP 4XTXA 1KOGA 1F9NA 1L3LA 3QWLA 2C0OA 2CUEA 2CREA 4HG2A 3PJRA 1BOBA 2WAEA 4H2XA 1WJBA 2IVMA 1UHWA 3D1NI 1L0WA 5M3MJ 2NVQJ 2G6FX 3MN2A 1AWOA 2AKWB 4B3XA 3N4MA 3Q1JA 3K4KA 3SFZA 2H3EB 1JJCB 2W82A 3OYYA 5FO5A 5D6XA 5KYWB 3REBB 2I4OA 1HA8A 4OIOF 1KU9A 3CCQQ 4AYBN 2R7QA 4AMCA 1ZRFA 3IG2A 2WY8Q 1YJWT 3RIRA 4AFSC 3GTGJ 3K4CA 1RUWA 1QVGS 2K4YA 2KJBA 4B9WA 2PLYA 4RCCA 5K7HA 1XOVA 5F6FA 5LL6S 1UFFA 3Q5FA 1YIJA 3HFNA 2GQQA 3S2WA 5EZGA 2DX1A 1VQLQ 2E4HA 3F8FA 1M1KU 1E2XA 3JCMg 1EIFA 3ZQGA 1K83J 4A3CJ 4RTWA 1P4AA 1ETVA 3NHNA 3MKDA 2H09A 2H1KA 2A8EA 3IKVA 3M0QA 5A2QZ 2IW5A 1LOJA 3ASOH 2E7XA 3CCUT 1ERDA 3KFVA 1YG2A 3ERRA 4C2UA 2QQRA 2E19A 5HS8A 1JEGA 3A5ZB 5GAN4 8ATCB 1E22A 1LKXA 1MGTA 1BN5A 3A1YA 3ULQB 1X2QA 1ABQA 1BKBA 2IP2A 4FSSA 5KYYA 1UZCA 2CP5A 3CZ6A 4M77B 1DGRM 1B7TA 2ALYA 4RBOA 2RF0A 1UTIA 1QVGA 3DB4A 5BPIA 2QYOA 1TU0B 4D5FA 2X3WD 1IZ1A 1Y39A 2MC4A 2O03A 2A69F 3CPFA 4RKUE 2FEZA 4O2DA 3V8LA 2QQAA 2KGTA 4OMPA 3X20B 3BZCA 2N8GA 2IT0A 2QHSA 4FYVB 3MEYA 3AL0B 3OWTA 3IV5A 1XTDA 1TXQA 4B8XA 4KGVB 2A28A 3TMOA 2QA4Q 4NOYA 1WQ2A 2CO5A 2DLLA 3FLGA 1J09A 2E6NA 3TEDA 4UC4A 1X2HA 2VXFA 3I59A 4BUPA 1R0BG 1RC9A 1IHWA 2I5UA 2KP6A 3PO3J 4DZPA 2DMUA 4GXOA 2DDZA 1B34A 2ZMEB 4N4NB 2D45A 2EZLA 4CXFA 2DK5A 4ZH4F 4NHJA 1OMIA 4J9DA 2JWTA 1QVTA 2BIVA 4Y15A 1WX6A 2AZVA 4M7DF 4E4HA 3U1KA 4F93B 2XGDA 1S72Q 1VNDA 4DA4A 1JT0A 4ZTUB 5GAN2 1U78A 2H6BA 1IXDA 1Z3YA 4FCYA 3J80K 2K40A 2PI0A 1YHQQ 1EH6A 2JN0A 4MQVA 2XROA 4KN4X 2K4BA 4M73A 1SEMA 2EQUA 5C6SA 4HCCA 1R1UA 5EJCA 1M9SA 2QYZA 2F5EA 2OBPA 1QWFA 3VYRB 2XUBA 3CC4I 2P5LC 4M78C 3CMAQ 2ZJ2A 3M55A 2CP7A 1LE8B 1BIBA 5B66C 4Y7NJ 1HKQA 3BLYA 1R23A 4JX6A 3CC2Q 2KYMA 3SFMA 3CCQI 2ZO4A 2Q7GA 5EGOA 1SERA 3PNVA 1X75C 2HQHA 2ED1A 1OR7C 2KZVA 4TQFA 1OZ3A 2EPDA 3MEAA 2E5QA 4EJVA 2X6XA 2QHUA 3NTIA 2BE9B 3UWNA 1YJWA 2V26A 2JS0A 3U2RA 2MBFA 3QG1A 1VQOI 1NJIR 4M75B 1S8NA 2BHZA 2EGCA 4PDKA 3WVDB 3JAMK 1EFNA 2R3SA 3M0SA 3RPQA 2ME6A 1VQLI 3GTPJ 1NH3A 2P5VA 3ZQLA 2KIFA 4IHSA 1T0FA 2ETHA 4EMHA 1EH7A 2CFOA 5H6RA 3OYEA 2A61A 1VIFA 5ILUA 2DT5A 3THKA 2Q2EB 2K57A 4QPOA 3HSRA 2M9UA 1YJNT 3JSCA 4BY7J 3CCUA 1YBYA 3EFOB 2K9QA 2GNCA 1E3OC 2E1MC 4JJCA 3LSMA 4XLAA 2G9WA 2M34A 2XRLA 1I81A 2O7OA 2FNPA 2ELHA 3KLOA 2QSGX 2COBA 3OYAA 2FMYA 3G4ST 2PFBA 1D8JA 4IURA 1Z7LA 1AU7A 4ZGJB 5ILSA 4KGXB 2FO0A 3OL4A 2O9SA 2ISYA 3QOPA 2ECBA 3ABLH 1MH4A 2M3AA 1ZH5A 1M90R 2DJIA 5FB2A 3EYIA 1YRNA 4CH3A 1JJ6C 5BPDA 2RJEA 3ZGKA 2XDBA 1B4AA 4HDUA 1SSHA 2LC4A 2JOYA 4A93J 2E5ZA 4J6YA 1K8AC 4AFQC 1ASZA 2OPTA 4BYYA 3MF2A 3RESA 2Z2SB 4YCVA 4KISA 3CC7Q 5HNFA 4M3EA 3CJTB 1UJYA 1O4XA 1T38A 4CGZA 5LLQA 3W6VA 4UY8I 1T3SA 1ZK8A 2DKGA 3PTAA 5GPCA 1SFKA 3M53A 1WXTA 3FWEA 5HCKA 2DTIA 2Y75A 2IS1A 4IHTA 1WJSA 2DVEA 4PJNA 1TUDA 2HQ5A 5C53B 3CCRQ 2VQHA 3M4OJ 3LFKA 2LREA 3I0TA 3OYHA 1JUSA 1LNXA 4PJ0C 1TQPA 4YRSA 4O5VA 2JTFA 3K4NA 3JRCA 2P6TA 5J39A 2GFAA 3JB9H 1S72I 1FYMA 4BNCA 1GXQA 3TVTA 1YHQI 2PJRA 2C06A 1KMNA 2RDPA 3F70A 3CCVQ 1V4RA 1OISA 1NK3P 1J0RA 3R0JA 4BH9A 2WV0A 2WV1A 2VXZA 1CKAA 3EUAA 1B8AA 5J4YA 3IKTA 1QNTA 3CP8A 1VOMA 2YR2A 3CMAI 2DMTA 2NXNB 2AT1B 3BTJA 4RGXA 2GOMA 3KZIC 1HF0A 2LX7A 1VQPT 2LY1A 4B47A 1EZZB 3CC2I 3L1PA 2P0WA 1Q81R 4CC4B 2NAZA 1ZBJA 1NJIU 2KY9A 1DPUA 2G4CA 2CSOA 3HRKA 2RHQA 1BYMA 2O61A 3QU6A 3CMYA 1GV2A 4K11A 3MWMA 1V5FA 5J26A 4Y33A 1AA7A 1UFMA 1PNJA 3ZEHA 1EIYA 1ZGAA 4BBRJ 3SHWA 4KGZB 3VDXA 1OYIA 4HKEA 2LMJA 3S3NA 3HFZA 2C6YA 2A08A 2QAZA 3NPFA 3HTZA 5FRMA 2IG0A 3M58A 1O7LA 3I55T 1P2FA 1NLPC 3M7GA 2E1NA 4M78D 3PL8A 1BJZA 4F16A 4A4FA 1SSFA 4J01A 3HRMA 1TG0A 3FBNB 4RGUA 1Y0MA 4C3JJ 5GANj 2HOSA 4A63B 5CPRB 4B09A 4JS5A 2IS2A 1S9HA 4QQGA 2IAIA 3A01B 1YJNA 4BUGA 5HVQC 1NPPA 5GP9A 4F91B 1JXMA 4RM3A 5LJ5e 2FSWA 2D1HA 2DBMA 2JNGA 5CAIA 4XQFA 1ZSZA 4MZTA 1IV8A 4CC3A 4FW2A 3VRZA 4P74C 3G4SA 2GM4A 3BZKA 1YX5A 1LFBA 5GTHC 4DGWB 2BUDA 3W6KB 1Q86R 5GAN5 4OGCA 4IUUA 3ZMSA 2WB1A 1EX4A 2DXUA 2K5CA 2AS5F 5GAEJ 1TC3C 2O88A 2O9LA 1VF9A 1OU9A 2F5TX 3E9IA 1VQNT 2PU9B 3MHXA 4D6WA 4HT8A 4Z2YA 1ZX6A 2ZCEA 3ONQA 5CKBA 2YX4A 2GA2A 1G8XA 3X2QH 1IO6A 3CC7I 3QTCA 1T0HA 4RQFA 3GTJJ 2LMDA 4XQ3A 4MIMA 1QPIA 3BT9A 3E6CC 4UVCA 1ZGJA 3KZZA 2DZ9A 1YCYA 2KE9A 3QNEA 2K3PA 1K78B 4F7UG 3K9TA 1YJ9Q 2FZKB 5HS9A 5JFRA 1XMXA 1B70B 3RTRA 3CCRI 4ETSA 4BU2A 5CKFA 2K9SA 2FMLA 2DFUA 3HPWA 4C5GA 2MH2A 2K2VA 2YLCA 5GAOr 4HT9A 2RH2A 1U1TA 2STTA 3CCEQ 2CH0A 2V1RA 1FLIA 4PZJA 1ZSZB 1T95A 2BBYA 1N9SA 3CCVI 3Q9SA 4PL6A 5CVIA 3HSBA 3ZMDA 4OMNA 2K79A 1B59A 5GANf 5GANd 1IB8A 4UNOA 3H0GJ 4IHXA 4OB0B 2L7ZA 5GMKi 3AFHA 1WPKA 1VQ8T 5CYVA 4J7FA 5F1JA 2KT1A 2IS6A 1Q81U 3NMZC 2YSQA 3EG1A 5E3OA 3HZJA 3I56T 3HOVJ 4V2FA 4AVPA 3GZ6A 4LG3A 2V1DA 5DM7R 3ZCOA 4CI0C 1VQPA 2DOEA 2CJ9A 2VV5A 1HXDA 2DTZA 3HKZN 4TWAA 4HNUA 2KRSA 3K4MA 2KKOA 1FP2A 4B48A 3CD6T 2L7MP 2FEIA 1QCNA 3E9GA 3QSUA 2EFWA 1QHGA 4EMKB 1BOAA 3K2ZA 2X48A 4YIIA 2JZYA 1XD7A 1PKSA 2LR8A 4OMQA 4JBAA 1WWXA 4Y92A 1LDDA 4QLCU 2VBXA 1XCBA 4CYCB 1R4NB 2RQUA 1XB4A 1ITYA 1M3AA 3BTLA 1XSXA 4JRQA 2E41A 3I55A 2FNAA 3JCMe 3S1RJ 1ARKA 3ELKA 4XTUA 2E10A 2HOTA 1OYYA 1BC8C 1HSJA 4C8QG 2GFUA 4KULA 3E97A 2MGQA 2MW8A 2R93J 2KBTA 2X4WA 1TNSA 1ZQ1A 4WXHA 4CS4A 3K70C 1IRZA 1OCRH 4EVIA 2RHIA 1YI2Q 2LJ3A 3ERED 2A6TA 1BI2A 1U5TB 1Z67A 1B72B 2FQ4A 1TUGB 5K7ZA 1Q86U 4YRVA 1R1VA 3HXLA 2Y0SA 4DJAA 2O8KA 2H8RA 4EEFG 2IA2A 3JV3A 2ZPFB 3O3KA 3CCJQ 1X6OA 2H6CA 4G84A 5CQGA 5JVGF 4L9TA 1Z3XA 1B9MA 3BG6A 4NC6A 4MHGA 2LY2A 3P8TA 2LYCA 4I0BA 1WHKA 3D0SA 1NBEB 3FF5A 4M71A 4CH5A 4HV5A 1JJ2S 5GAOq 1PUFA 3I9V2 4DEXA 4E6RA 4HX4A 2DMPA 3S93A 3VS6A 2XI9A 3H8ZA 3KYDB 1VQNA 5ICFA 3M4PA 4MGRA 2XF5A 2L4AA 2COZA 4MFDA 1RI7A 4P3OA 3RCOA 5DM6F 5FROA 4A0XA 1I3QJ 5LHIA 2B0LA 3TEEA 2JK3A 3HRIA 1UHMA 2HVQA 4HEA2 2PMFA 3FDYA 3QYEA 1PDNC 3P5JA 1Z1DA 1K9MR 4M78F 1W36C 4H0EA 5KE2A 1N8RR 3OD1A 2MG4A 1YJ9I 1IL2A 3C2HA 4L9NA 2BY3A 2MCNA 1B07A 3GFJA 1PWTA 2PMZN 1W6XA 1XGOA 3CESA 2E70A 1XGMA 2AHJB 1TT0A 3IWZA 2IPQX 2CWEA 2IY5B 3IAS2 5CLSA 1VQKT 4HNTA 3D5LA 2EFPA 4YRFA 4EQQA 2V8JA 4GLMA 4UP8A 2ZSIB 1D3BA 1G83A 4L5EA 1SAUA 5DYMA 1F1ZA 1JJ2A 1TLHB 1QHHD 4A3FJ 1LEAA 2DA5A 5ICEA 1HLVA 3LQQA 5J3BA 4YRTA 4H2TA 1JGGA 2P8TA 1H0MA 3H35A 4AC0A 1H4VB 2LJ1A 2M0OA 5EDNA 1D8KA 2EKHA 4DYCA 3QO7A 3I56A 5AIPA 4V2GA 4C92D 2F48A 1KYWA 2XHCA 5FKKA 1K76A 2ECZA 3DLMA 1FIPA 3S2HJ 4NQWB 1AHJB 4E7HA 4XAXB 4AIKA 3O8VA 2P4WA 2FX0A 1HW5A 5KH6A 1X1CA 3HGGA 1WHMA 1QLYA 2YRDA 2KQWA 1AWWA 3G71T 4A69C 3CD6A 2RM4A 2LBFA 3J81Z 1V54H 3MP8A 4BQNA 3A02A 5J3LA 5KCHA 4P1WA 4QSHA 2STWA 2F5KA 2NUTA 3E5XA 4F04B 1H8KA 2QHVA 4M77G 3ECHA 1MGQA 1SVOA 3FJ5A 1FIAA 3MAJA 4DOVA 5F0CA 2CZ0B 2DTRA 2DQ3A 3BTCA 2L7KA 2QGUA 1HSTA 4L6V5 4HLYA 1KQ9A 1F5TA 3VS4A 2BV6A 2LCCA 4BXXJ 3L00A 2W48A 2RNJA 3ME9A 4FM4B 2EH3A 2KXDA 2YX7A 3DFGA 2D8JA 5CKDA 1CF7B 2WBMA 5IT9Z 1PSFA 2X6OA 1YI2I 3BR5A 3BY7A 1S1NA 2HQXA 2QASA 3JRIA 2O0YA 2KMUA 3CCJI 4ZGEB 4EJTA 1Q7YC 1I5ZA 3F6VA 4D1QA 4HYEA 4Z6YA 4LDYA 4CUGA 2ZPIB 2YS9A 2Y48A 2DF6A 2L3SA 2KRCA 2D6FA 1U9OA 4AVZA 1NYRA 2SEMA 4LGWA 3DPTA 2V6CA 3AG4H 2CUBA 4GYGA 1OPCA 5D6YA 2LNHB 1FZPB 4FYWB 4IUQA 1WHLA 1HDPA 2FVUA 2X85A 2ARSA 5I2MA 4CC2A 1VQ7T 4PCQA 4U7DA 1K9MU 4J9FA 3E1SA 2JA5J 2ZCFB 1N8RU 3MZHA 3TDZC 2L3DA 3J81E 2EPFA 2CIMA 1PP7U 2FHDA 3JB9I 4RTVA 9ATCB 4MLOA 3NGPA 5JR3A 3BTIA 1ZYRF 3LOCA 4BY1J 5TISC 5CO7A 5M5XJ 4LK0F 4BEHB 2QM3A 4ITVA 4RMNA 4FETA 2XV4S 3H5RA 2E2HJ 4E7ZA 3NWSA 4OAYA 4OAZA 4BB7A 4E70A 2EAYA 2GAUA 4C0DC 2OAZA 3CBPA 4XEMA 1XJWB 2J06A 2XC7A 1JHFA 1P92A 2DAQA 5FWCA 1AD5A 1AWCA 2K5LA 1VQKA 3C18A 1JE8A 1IXCA 2PZ1A 5IT9E 3LSJA 2R7ZJ 2H1LA 4G6QA 2XSJC 4I02A 2OTJA 3PT9A 3V7CA 4XNFA 3JCMb 1LPLA 3JCMX 3FMSA 1N9RA 4M75G 2MOXA 2OU2A 1N75A 2E1CA 4BQAA 1MH3A 3QXEB 3EGUA 2L9VA 4NNJA 1B76A 1TL8A 2NOGA 4FE4A 1HD3A 1MW7A 1T98A 5KAFC 2AKKA 4P5NA 3L4GA 2YUSA 2A3LA 2X35A 2W24A 2DU7A 4RQEA 1NLOC 1PYVA 2F2EA 5E3NA 2NVXJ 2QDLA 4M7AD 2DLPA 2ESWA 4HWTA 3CCST 5K1XA 4A53A 3M9QA 3G71A 2R5YA 1GCQA 2KYBA 3MEWA 4CICA 2RHUA 2LC2A 1ZG5A 5AONA 3QUIA 3JRBA 3ABTA 2X51A 4G6TB 3FXLA 5F1RA 2WACA 2K86A 4LFUA 4A4EA 4C2MJ 4PK4A 1MUZA 4FIBA 1OPKA 4LLNA 3RF1A 4N9IA 3OS0A 3BW1A 1D0XA 4I6ZA 3HHTB 2RQVA 1SETA 4YRIA 4M7DB 1OPLA 3DBHB 3S32A 3G1ZA 2LKSA 1RABB 2JSPA 4MTEA 1JU5C 2DA7A 2EW3A 4JRPA 1FOYA 3T1BA 2PMEA 2EV5A 5EG2A 2QGFB 2LT4A 5KCMA 1TP4A 4HWSA 3NAUA 3LGLA 2GOXB 4RA2A 1NPRA 3SWNA 5CVUA 1VA7A 2FYKA 4LVKA 3VQWA 2I0NA 3WU1B 5ED4A 4BE1A 1R22A 4C92F 4YREA 5DD4A 2HXOA 1SANA 2DYSH 3D5RC 1KQ8A 3Q3SA 1LPQA 1LJOA 1HJDA 2AZSA 4C5IA 3COAC 2ZFWA 1K8AU 1ON1A 2L8DA 3EGDA 4LB5A 2VQGA 3G73A 2NS8A 4HWRA 4HQEA 5M3FJ 1QPMA 1FBQA 1K0XA 3CCMT 5LJ5f 1QW1A 2QLZA 4Q48A 2MA3A 1X4PA 3PM1A 3HPHA 1Y6IA 3BR6A 1VQ7A 3GUDA 3CF2A 3HRSA 4WCIA 2KR3A 1I39A 1TWBA 1HK9A 3BC8A 1PC0A 4TVAA 4I7HA 3CO7C 1I0CA 4I09A 4P5OA 2XKPA 2EGEA 3BR3A 4HLXA 1LFPA 3TOAA 2RC4A 5BMZA 1WI3A 4D8DA 2JMCA 1UDLA 2VQCA 3QYGB 3VV0A 2X4YA 5L3GA 3PQKA 4EGZA 1YIJI 2GTJA 1WFXA 5BNGA 3L2CA 1USSA 3CUQA 4IRHA 3OSFA 3LSPA 3EGXB 4U0VA 1UEBA 2J6KA 4QWQA 3GWZA 3PO2J 1HOMA 1QQJA 2XDDA 4OIQF 1R1TA 2HYGD 2J5OA 3V8JA 3LSGA 4YRJA 2HQEA 1Z0XA 3RMQA 1O7FA 2HDAA 3FM5A 2RQTA 4M3BA 2XAFA 4WXCA 1N78A 3OOPA 5I22A 2OV7A 1U8RA 3CCUQ 4AT1B 3R6NA 1VYUA 1PUEE 4EMSA 2DRKA 2L9NA 2KIUA 5C52B 1H8AC 4ESBA 3AT1B 1Q82R 4DBQA 1AZGB 4YCWA 2DILA 5CVJA 1ODDA 4PJOC 2L2OA 4MMLA 2C8MA 3E6BA 4IF4A 3PNYA 3I4MJ 4XLFA 3AG2H 5GADJ 1JRIA 2P84A 5EC7A 3KFWX 5DUKA 1GGMA 2XB0X 1Z6TA 5J40A 4X9DA 1V55H 2VXDA 2CGHA 5EEHA 3LNQA 4CC7A 3L1AA 4L5IA 1OLTA 4K88A 2W1OA 1IG7A 2X6YA 2UWMA 3EH2A 4R8HA 3IUOA 1K4SA 2L02A 2IIMA 1NJ6A 4P3NA 2DPUA 3R6OA 1AT1B 4IQJA 4PGHA 3MKWB 3OYMA 3GTQJ 3PSIA 3OSGA 3FRNA 4BS9A 2Q7EA 2KL4A 3KCCA 1XDUA 3SJMA 3QWXX 5IXFA 2RQQA 3TO7A 2OI3A 2VJJA 2MD0A 2OZ6A 2EV0A 1YFSA 4Q6GA 4KT6A 4WCGA 2GXAA 1SRLA 3EHQA 1B8IA 2OQRA 4U87A 4MDWA 4ZTJA 3ZPLA 2E36A 3HTSB 1E3HA 4DBFA 3JCMf 2R7WA 1WJDA 5HLTA 4I2OA 1JQQA 3OBWA 2ZXFA 4LVJA 2L9RA 2W10A 4LITA 1BK2A 5GAMh 4YELA 2LLKA 3G6EQ 2E1OA 2GXBA 2TCTA 2A5YB 1ON2A 1X01A 5HODA 2A68F 2A0FB 1HYOA 2HKQB 3N05A 4KIGA 3TBIA 4M7AF 1B1BA 2XF7A 5CQXA 4H4KC 1UGSB 1EKEA 2VLAA 5GMKm 3CCMA 1XGNA 4KUMA 3DLLF 3SD4A 3VBBA 3E5UA 2BE7D 1YW7A 2ED0A 1JKQC 4OMMA 4RLQA 3OYIA 2DK8A 2KVQG 3NEMA 1VQ5T 1FOXA 2XB5A 2NNYA 3JCMP 5D5VB 1YITT 5F27A 1YJWI 1GV5A 5EG0B 5FKMA 2EJRA 4J8OA 4BBSJ 4A54A 4C8QD 2XGCA 1IGQA 1O57A 2KEAA 4P96A 4XTWA 1ZLMA 4Y52J 1D1AA 2HDDA 3CEYA 3RGLA 3SZGA 2JJ7A 1TNTA 4M3FA 3BROA 1ZQ3P 2DJNA 4UUSB 2P0PA 2RMOA 2F69A 1VFCA 1OYWA 3E6MA 4QVZA 3G1JA 1KC8R 1N77A 5DV5A 1EF4A 2JTMA 3H6ZA 4KT5C 4H2UA 2PBIA 2VYTA 4KT0E 1OCPA 5E1ZB 1IJWC 1TSFA 1Y71A 2VGNA 1XG1A 4M7AA 4XSXF 3CCUI 1YJNQ 3I35A 3V4GA 2OX7A 1APLC 3HXWA 4IXAA 2GIVA 3ZP5A 3JB9G 1AEYA 1HC7A 3UDCA 2DMQA 3ZXSA 3A1PA 2YRCA 4ZJZA 3QHSA 2WAQA 1U3OA 4J6WA 5KYUA 4WTOB 4QT7A 3OS2A 2FBHA 1VQ6T 1KHIA 3A31A 3K0LA 4KNYA 2Q7HA 3ULRB 3CPWP 3EPZA 1ZLJA 2LKXA 3X26B 4OIRF 1T3LA 3FB9A 5H20A 1OFCX 1PYSB 1MDMB 3RUXA 2ACJA 2V8IA 3NTKA 1O9SA 4A3MJ 4FT8A 3CO6C 4PSXA 5DS9A 1J7KA 2FPDA 2CZ6B 3X28B 1H4SA 2JT4A 3UH0A 5GMKe 1JTXA 1G5IA 2M87A 5IP7J 3W3SA 4M6XA 4XTZA 3LMMA 4QQ6A 4BQQA 4X5OA 1R6RA 2H27A 2BVMA 4MMKA 2DZCA 5TRDA 2WSEE 4RB0A 1TW2A 5A0DA 4NL2A 3DV8A 3FEOA 2F1LA 2VODA 4PJOD 2VKNA 5E79C 5IYDJ 4ZN1A 3UPUA 4XKWA 2DTOA 5TGTA 1RPWA 4ZYGA 4FYXB 2K5IA 4JX5A 2XAJA 2E34A 3JRFA 4X9CA 5TJJA 2P4RA 5LEKA 4E7IA 1I4K1 3G6EI 3UNGC 1Q7YR 5KYUB 5IT3A 3K10A 1QZYA 2CW7A 3JCUC 3Q0WA 1W0TA 3GX4X 2EKOA 1KA8A 2A6EF 2RAEA 3ER0A 4K2EA 3IAM2 2R7FA 5DCFA 1QO0D 1NZ9A 2FD5A 2ZXWH 1WSUA 5L3EA 5AT1B 4HPQA 3K1PA 3VOEA 6AT1B 2O4XA 4F55A 2CV2A 1BR2A 4L18B 2MLGA 4XN3A 2MABA 1HKTA 3A0BC 3JRDA 3CCQT 4PNOA 2CKKA 1QZEA 4M77D 2LJ0A 5LJ3h 3TEGA 2OTLT 3NFCA 2E2JJ 1H89C 4LMYA 1ETYA 2VJIA 1ZRCA 3H3UA 4J9CA 1VQ5A 4QKUA 5LJ3g 1WZOA 3A98A 1YITA 3WHBA 4DOWA 3OMYA 4CA0A 4KR2A 1KQ1A 5EYRA 3V7SA 5GAOl 4BKXA 2Z99A 5KNNA 3DWLE 1KC8U 3WODF 4Z02A 4AU7A 1OYXA 2WB1N 3O8GA 5D6FA 1D1CA 4ELYC 1OV3A 5DCMB 1RKWA 3SDBA 4XM3A 3W2VA 2XGTA 3R0AA 3DCFA 2M7AA 5FLXE 2RHZA 2X9HA 1U9NA 2P0QA 3ZR8X 2JVVA 2JVHA 2ROTA 2CP2A 3G1OA 4J19A 2WTEA 4B43A 2JPBA 1J2XA 2ESHA 4ZC3A 5CKHA 3ZQIA 4C8QE 2QEXT 1Q1VA 1YJNI 4PJJA 3VJPA 4HF0A 3WGGA 2LP0A 1SVMA 1XX5A 1FYNA 2VONA 2LCLA 4BJ6C 5CKTA 2HVSA 1TT5B 2RHXA 1IUFA 1DU0A 1R8OB 4I0AA 4BQOA 3DEWA 2JA2A 1X43A 2Y90A 5FFXA 5D6EA 4YRMA 5E20A 2LRQA 5ERIA 3HM5A 3KUFA 1UCRA 2K3YA 2WC2A 5E3MA 1VQ6A 1WJ5A 1OQKA 2EINH 5ICGA 2QBYA 3LW5E 1SD4A 2PQWA 1J5YA 2JA6J 1KJWA 3RYPA 3LWFA 3NRVA 1BR4A 4C8QF 2QA4T 3ZQCA 1QRYA 2EYWA 3PIOF 1OKRA 1SG5A 1XC5A 2HSPA 2Y4YA 3PCOA 4IJAA 3WTUC 3QZ9B 3DQVC 1GT0C 2ZJQF 4M78B 4OB2B 1UHCA 2DQ0A 1TQIA 4G94A 1MSEC 2MF2A 1RAIB 4V2SA 1MNDA 1H3ZA 1WHUA 3FK6A 5J8FA 3RMSA 1GVJA 4UXNA 3H9NA 2JRMA 4S0HB 2HYFA 3RSNA 1IV6A 1QCOA 1ZR2A 4M75D 4XTYA 2M0CA 2DIGA 1I3AA 3BJOA 2VJ4A 2IGOA 5KE3A 1J3TA 5GJVB 5HNHA 4LNPA 1Q7YU 3HGYA 3HY1A 2HNIA 2DPDA 1E24A 3LFUA 2CP6A 3DEEA 2YPRA 4IEJA 4GLKA 4F7UB 4BI4A 1WJAA 1R77A 3JTGA 1KD1R 1K4TA 1J5WA 3VEPA 1JKRC 3KYLA 2ARUA 2PN6A 3M59A 2W25A 3H41A 1ZUKA 5F04A 2NYSA 4OIPF 5D6WA 2ICWG 4FU6A 1K6OA 4HWOA 3M07A 1VQ8Q 2VQLA 2NUPA 1ORKA 2HMAA 5DUIA 3U9GA 4C8QA 2P0LA 1D1BA 3HHHA 1R9TJ 3PIOA 3RPUD 2C0TA 3CC2T 5C44J 2HU9A 4BHPA 4XRSG 2J6OA 3HOWJ 3CCQA 1WGXA 3LSRA 4LK1F 2DEUA 2E1MB 2J3MA 2ZNIA 2YHTA 4DBHA 5HLIA 2UXXA 2K9GA 4M74A 2Y0SN 1AHDP 1YFTA 2LVMA 3RACA 3CD6Q 2L7FP 4MNUA 3EH1A 5HGQA 1VQ9Q 1K73C 4TV7A 3S1MJ 4BAYA 4HWPA 3BE3A 1W5SA 2XGEA 1ZG3A 1VQLA 1VQMT 1E1TA 2CUZA 5FU6C 4PJOF 3A32A 2ODRD 1FC3A 1PKTA 4M77E 4NC7A 4AWXB 3QU3A 1GXPA 2FRWA 4P71C 1G59A 4G9YA 2FZGB 2PUOB 1YLFA 2WSFE 1WHHA 3GOXA 2QTVA 3JR9A 3DTEA 2FOKA 4Q4ZF 2IGKA 3FK7A 2QEXA 5GAN8 2WWYA 2K7AA 1W1WE 2AKWA 4IRGA 4HCKA 3ROUA 3DF8A 4CZCA 4BY6C 2V4JC 4RLFA 1QVGP 1JJCA 4AIJA 1AKHB 4LG0B 4IIOA 5KYWA 1CQTA 1IN5A 5FD6A 3RKQA 1W0UA 3Q0VA 1R0CB 5GAOm 2DAOA 5LRSA 1MJ9A 4R55A 1BR1A 1BJAA 4M7DG 1KQ2A 4VUBA 1Z7MA 5L23A 1HSQA 4N4GA 12ASA 5KYXB 3IRQA 5ILVA 4L5JA 3QO5A 1VQ4Q 1RETA 4I98B 5IAYA 1OCOH 5KAIC 3UATA 4RAYA 1PHTA 4LLGF 3VS2A 2DT6A 4ZYHA 5GANe 2LZ6B 3MZ8A 1XMAA 3LA2A 2QA4A 2BGCA 4QIWN 3UF4A 1Y1VJ 1UUEA 4N0BA 1P7IA 1JJ8C 4N0AA 1X6BA 5H6QA 1ZKGA 3CJNA 1M2VB 2M45A 3VODA 3KBGA 3META 1U6GA 3CCRT 3PFYA 4WK8F 4Q5SF 1KD1U 3FXQA 2DMNA 4UVBA 4XOPA 2ZXHA 4EJWA 1S3JA 2EIMH 2RREA 1TOVA 3CC4Q 3A5ZA 2OCCH 4K86A 3DBRB 3KEOA 4DW6A 3BQYA 1VQKQ 3F72A 1MBHA 2LF7A 3BP8A 2ZB9A 2HXIA 4PLIA 4M77A 3I5RA 4LDXA 2GGRA 1SC7A 3NELA 5DD8A 1W4MA 5DDGA 3KZYA 1I8FA 2LVSA 3WTZA 2IBDA 4F7ZA 5B1AH 3HC7A 1VQ8I 1GLNA 5KVRA 2F5DA 4RTXA 5CQEA 5LGUA 4M75E 5C4XJ 1HTTA 5JLXA 2COWA 1X69A 2P4TA 1VQOQ 1HKSA 3CUOA 5LHHA 3CC2A 3HPGA 4E51A 2CV0A 1SVLA 4A3DJ 4BJTA 3J80Z 1G3WA 4KDPA 4KIBA 2VGMA 1H4QA 1R49A 2EWNA 4D5CA 3T0YA 1RAEB 2P6SA 1SEUA 2Z33A 4RM2A 3CD6I 4GCVA 2LP5A 2FPEA 2LK2A 2GQIA 3P9CA 1YFRA 1VQ9I 4HXJA 2ZMEA 3H0FA 2EFNA 4CHUA 3GBGA 1FBUA 1FJLA 4ORZA 1R58A 2E5NA 4M75F 3P8VA 1NTCA 4YIFA 1VQMA 5GMKj 1R71A 4HVCA 5F08A 2W0ZA 1KGSA 3LWHA 5E18F 2RKHA 4EPCA 1FTTA 3P9IA 1D5YA 2CH4W 2C7IA 3PSFA 5GAHJ 3GLLA 3BOQA 3SDZA 1P7JA 3HUGB 4M3GA 1LQ1A 1DQUA 4IOCF 4H2WA 5B3SH 3G1LA 1EQRA 5JHUA 1T6SA 2KSSA 3C95A 3ASNH 1I27A 1NYQA 3OSVA 2AKLA 1MIJA 2YDLA 4V19K 3JAMZ 4JRKA 2I4MA 1IUYA 5CK9A 1W5TA 1LE8A 2HWVA 2K2MA 2ARTA 3ZBDA 1ZN2A 2YSRA 3EFRA 1R5GA 3IRRA 3PUFA 2QG9B 2YWWA 2GA1A 1VQ4I 2EBPA 2RJCA 2M51A 3VYUB 2LNVA 3OYGA 3CCLT 2BHYA 3M5AA 3VYGA 3QPLA 1OQYA 1U0JA 4M75A 1XN7A 4DYRA 1B7YB 1T33A 2OZUA 5C51B 2RHSA 3LSIA 3CC7A 1SRMA 2KPMA 2X9DA 3F23A 1M8VA 2VBZA 1QVFS 5A2QE 1IN6A 2W57A 4IUVA 2HPIA 4XKVA 3FXJA 1YJ9T 2F2WA 2CT4A 3J7AO 3NENA 4UHTA 3FXUA 2Q2EA 4X0GA 1USYC 1JBMA 2AK5A 3CCRA 1B9NA 2RN7A 1QU3A 5L3CA 1WXUA 1WKMA 4FSXA 3EFOA 1QZZA 2VIXA 3CCET 2OCEA 2B7EA 1ETWA 2E35A 2LKPA 4IPAA 3QQAA 1VQKI 3RPUA 1XNIA 3QDFA 2DQRA 1XGSA 1NHAA 4WF2A 2CU7A 5CJ9A 2WSCE 3DEUA 2FUG2 2JUFA 3JAME 2JA8J 4IUTA 4RTZA 5LBQA 1IDYA 4ZYEA 3VQXA 4E2FB 4A4HA 1RAAB 4X6AJ 4ATOA 3OMGA 2R58A 4U0WA 4Y91A 4ZDPA 3CJRB 2EQKA 1H4TA 2DBKA 2PG4A 3I64A 1IXRC 1K61A 3BG9A 1QVFA 2QDYB 4DZJA 2RHSB 4XEOA 2FL7A 1U3EM 3GFMA 3I53A 4FX0A 4JRIA 3CLOA 3OYBA 2IS4A 3VYSB 5BQTA 1MHNA 3GTLJ 2A37A 4XU1A 3CCSQ 2DXTA 3PFSA 1TWCJ 4YFKF 3ZL7C 4HVWA 1R00A 4J9IA 1GXIE 3VFZA 2W84A 3VS0A 2MSYA 2DL5A 1OCZH 1Q95G 2ZNJA 3F8BA 4PUSA 2KFDA 1DP7P 4KH1B 2CFXA 4WWCA 4C0FA 3HHGA 2LQKA 2O9VA 2LG4A 3K6GA 2VC0A 4XR6A 2R5ZB 2ZJRF 3QDRB 3PFIA 4PFPA 1K6YA 3L09A 3OYFA 2D0NA 1X54A 3SDGA 4XK4A 2PVDB 1X6GA 2B86A 1JXOA 3VQVA 3GYHX 1SD5A 4BACA 3TEHB 4A4KA 1X2KA 3R60A 4J83A 1T0JA 4J7IA 3OMCA 2XKOA 2CW8A 4CH4A 4BXUA 2DXIA 4BHBA 2AO9A 3H92A 3PVQA 3RERA 3V42A 4OB3B 3I71A 3RJPA 3QO3A 1AOJA 3S16J 7AT1B 1VTNC 3OW2S 1OZ2A 2X4JA 2EQIA 3C12A 1IAWA 4P73C 3SQNA 1WYDA 1KSWA 3EAEA 4FHTA 3VSLA 2QCOA 3E9HA 1USTA 2E3HA 4Z89A 3M0PA 4YYEA 2DOFA 3CCLA 4OP0A 1X2NA 4N4OB 2ZPEB 1VQ7I 3S6WA 4F52A 2RV8A 4LVIA 3HDDA 3S8PA 4HBLA 3QODA 3OIOA 2W4SA 2EB7A 1YYVA 2JZ2A 3TREA 4QTRA 4OOIA 3OYKA 3CDIA 2DETA 1YJ9A 3RKYA 4KUDK 3CXCS 1PSEA 2J3LA 2BYVE 2V1XA 3MZYA 3HOTA 2K5FA 4CCNA 2L4MA 2X1CA 3A01A 1X27A 2PEXA 3M8JA 2K4JA 5ICCA 3DU5A 3TDUC 4YFXF 1EA3A 2KMTA 2M1BA 3CCEA 1LFUP 3BZ6A 2C0IA 5IOZA 1OULA 3LSQA 4EM0B 1PP8F 2FF4A 2KRHA 3A7RA 3HKSA 3OW2A 1GCQC 1Z21A 3S1NJ 2PUKB 2HCKA 1WHGA 2V9KA 2XMFA 4KITB 4MEXF 1KU3A 2F4MB 5ECAA 1KQSS 2DJZA 4HRIA 1WNLA 4QPQA 2QENA 4Y3OA 3VUZA 4IZZA 1RLPC 4ENMA 5FRNA 1G5VA 1N6AA 2FRHA 2FE3A 3A7AA 3TQNA 1KU7A 1M90C 3OBYA 2ZBKA 2DPPB 1GUUA 1E17A 3C2BA 5HY6A 5GTIC 2M16A 1FT9A 4FT4A 2Q1ZB 4BGDA 2HKXA 3H5NA 1NEBA 2DMOA 1KYZA 3CXCA 2ZPHB 3TSWA 4W1UA 1M1EB 3CCSI 4KRTA 4EV0A 5FLXK 1K78A 4BW9A 2RI5A 2JXBA 1EOVA 1B70A 3GPLA 3FIWA 3EETA 1JB0E 3SWNC 1RL2A 3G2BA 4GGGA 4BI8B 2RPNA 1IN7A 3GMEA 4O6JA 5HK0A 5GAN6 5D5UB 2HR3A 1SMTA 1F43A 3P8YA 5L3FA 5FU7C 2KIQA 2R7DA 2QXFA 2HEOA 2DFEA 4A3IJ 2EBIA 2GF7A 1NEGA 4HVVA 3GVAA 1H9GA 5LD2C 3ZMUA 3TUPA 2BW3B 5KK1A 4YIRX 3EUHC 3ESWB 2BY0A 3L2QA 1KQSA 5C3EJ 5C0MA 2FBIA 3MKYB 1W70A 4LE9A 3IKLA 1YOVB 1W7PB 2P5KA 1YI2A 2Y31A 4D8KA 1KK7A 1UGPB 1U1SA 4M78G 1DU6A 4P3PA 2ROLA 5HKCA 2L9SA 3LA3A 1X19A 1P4XA 3NETA 4J15A 4C0DB 2EFQA 1C0MA 1IREB 1VZ0A 3GLXA 3GBQA 3Q9VA 1SMYF 3RZOJ 2O5RA 3KP7A 5IHKA 2JM8A 3CUQC 4I01A 2E5KA 2HZYA 2RB6A 3MVPA 4KMUX 1YWPA 3VQYA 4HOBA 2VBYA 1N9WA 3T9NA 3DU6A 1VYTA 3CCMI 4EMKA 1X4OA 1YTYA 3JCMQ 3NQOA 3QIIA 3QPTA 2QKLB 4C92C 3REXA 1ACMB 1O3TA 1X1DA 2X6WA 4CYCA 4OMFB 3LAPA 3VS1A 2BEOA 3D7SB 2EIKH 2V1UA 2NYXA 1JT6A 2CZ7B 4HQMA 2BKDN 2CSQA 3DKXA 2WAQN 3VSKA 2MC3A 3T8RA 2ZGWA 5LHGA 4E7LA 3DSQA 1E3PA 1Y1WJ 3DKWA 2EA2A 4HSRA 3OR2C 3UGTA 2DJQA 1EFWA 4GYIA 1X3WB 2J6FA 1J75A 1SRYA 4FT2A 1U5TA 1FYLA 1RR8C 1B72A 1VQZA 3M1EA 3R07A 1JJ2P 3CMEQ 2UXNA 5FWBA 1BBWA 3X25B 2VOOA 3CQZJ 4KYWA 1LEBA 2RA2A 1UG2A 2AQFA 2JTVA 4M7DD 1YCSB 5LJ5h 3O5ZA 4HVUA 4PG3A 2QHTA 4A6EA 3BDUA 5L3DA 4NB5A 3M57A 4RG2A 1MSFC 3JRAA 3HOSA 2BY2A 2JMAA 4LJZF 2XIDA 4BXFA 1JUPA 3IL2A 3EG0A 1EVLA 3MO8A 1Q86C 5KYNA 4RDUA 3E6DA 3E0JB 1PG5B 3OS1A 4CO8A 2ID3A 2DK3A 4ELZC 1N25A 4CH6A 1NYGA 1AWJA 1H3HA 3P8HA 2CGPA 2VL8A 4GDFA 3A7UA 1E0EA 1VQ6Q 3DB3A 3OS5A 2HVRA 2KI7A 4ZIBA 3QPHA 4XN0A 4D7MA 3EUKL 4JK1X 3QOEA 3QBYA 3R61A 1JTYA 4K87A 4J6XA 3CQTA 2EYXA 1BBUA 2VI6A 5J1RA 2E3CA 4LIUA 1AOYA 3NWTA 3PIPF 3PNTA 3M4GA 3VYTB 2IY5A 2RQWA 3TW7A 3J7ZI 2AHQA 1SD6A 2KRFA 2DFIA 2HZDA 4U88A 4AFZC 2EIFA 3FXRA 3GFIA 2WAFA 4G6DA 4C5EA 2ZZFA 2EQJA 4ZNXA 2VC8A 4YRQA 5LEJA 4Y17A 4RGSA 2JSCA 4QQDA 4NBQA 2HQRA 3LWIA 3GCMA 1TQMA 3HOYJ 2KK4A 1FTZA 2HOAA 2QWWA 1BBYA 1D0YA 1Y56A 2E7WA 3P9KA 3V7RA 2KLOA 2P7VB 2ELKA 2DYIA 5JVTA 2YUOA 3SB2A 4WJ3M 1NG6A 2R4GA 1UJ0A 3I5UA 3ZN0A 3E19A 4NQWA 3WVEB 2F2XA 4DYQA 4C3HJ 4CCKA 2R7SA 4XTVA 2DQLA 1TTYA 1HC8A 1Z6RA 1ZSGA 4CRIA 3PIPA 1J9IA 5EF6A 1LVKA 1ZAOA 3LAJA 2R5MA 5LJ3j 1S7OA 5CCAA 2OTLQ 1KIKA 4ESJA 3ZFJA 1VQ5I 4M7AC 2ZT6A 3OYNA 3DTIA 1YITI 3REUA 2CMPA 3EG9B 1G6NA 1O3SA 2OTJT 3KP6A 3GTKJ 4BJ5C 4XLCA 1GDTA 1P4WA 4IHWA 3J7YJ 3KX2A 1T08B 2LF8A 4N4HA 4E7SA 3BJ6A 3JCMh 3CMMA 2XASA 2ZR3A 4PJOB 3RI4A 3FJPA 1CF7A 5LGTA 4AG2C 5FLVA 1K1ZA 1OX9A 1Z77A 2DA1A 1ZRDA 3CMEI 4B9XA 4YDQA 1I50J 3EG3A 3MEXA 3LYIA 3KEQA 4H2XB 2KRMA 4BE2A 3JRZA 1MMNA 4GFBA 3PNWC 2Y9YA 1W2BS 4Q47A 4UV8A 2JM9A 3HEFA 1C1AA 2COYA 1V5GA 1RUNA 3FHZA 4IUPA 2QEXQ 1KHCA 3RR6A 2ENMA 2KRNA 4X1VA 3VWBA 1XTAA 4E47A 3IH4A 3HB9A 3MKZA 3FIFA 2CQNA 3GTOJ 4YRPA 3H36A 3ZQHA 5IN1A 2DOAA 4LLLA 1D09B 4P72A 1A6QA 4YP0A 2A07F 3F22A 5J47A 1BCMA 3WTWC 1QF6A 1VQ6I 4PFZA 1X56A 4HDVA 2I4NA 4M7DE 4BEHA 4GBQA 3JB9J 3H9GA 3WU0A 2DA2A 3M0RA 4YPFA 3KP5A 5A0LA 4C92G 1A31A 1OX8A 2HBPA 1WLPB 4DQ2A 2CSIA 2E65A 2FOWA 2X4XA 2DFHA 2ZINA 3H5AA 3A0HC 4LDVA 4UB8C 3QP5A 1K9MC 1C6VX 1JO8A 1ENHA 3OYLA 1N8RC 4RAFA 5LJ3f 5LJ3d 2ZFUA 2K3XA 1YNZA 3ERMA 2LQ8A 3O2PE 3S15J 3PUBA 2AQEA 3BG5A 3K4LA 4JLIA 1RAGB 4XRSA 4II2A 1W2BA 1XSDA 3E9FA 3MP1A 4CCLA 3QYBA 2GQVA 4YRNA 2R5AA 1S29A 3L2WA 2VKEA 4UVAA 1C0AA 1UB9A 4HV6A 2EQRA 3VUBA 5IOYA 4IO9F 3S1QJ 4JS4A 4IVNA 1U06A 1WGSA 5E1WA 3CF5F 3VS3A 3FXOA 3GW2A 1HW1A 3C0CA 1KFZA 1RR7A 4AUXA 3G6ET 3QPSA 3F3XA 2Q0OA 5KYYB 3JW4A 4RG8A 2V1NA 5GAN7 4KQEA 4XL9A 1RZ4A 4U7BA 5D8LB 1W66A 2ALYB 5CKEA 1K8AR 2FQ3A 1KU2A 1QMCA 4A4GA 2DFFA 3AG1H 4ESFA 5GAN3 2E6ZA 4HW0A 4XRMA 4IHVA 2M7BA 5A2QK 1UE9A 2L3QA 4Y4RA 2I4LA 1X3ZB 2CV1A 1FBSA 1HQCA 3OYDA 3WTSC 3H0DA 2X3XD 2D1VA 3NTHA 4X34A 5E3LA 2J5PA 1YIJQ 5IYCJ 2DT7B 3CTAA 2EL9A 2OTLI 3I59B 4AG1C 4Z88A 3HFOA 2J05A 2M0MA 1DUXC 1Z91A 4KBMB 1NG7A 3KETA 4HNVA 2HGCA 4II3A 1B34B 1BIAA 1M1GA 1R4MB 3G1MA 1WHJA 2LOOA 4M7DA 4HAMA 1E6GA 1PRLC 4YG2F 4EX5A 1IRFA 4NC8A 3MEVA 4B1RA 2HL3A 3TOBA 4ENNA 4KH0B 3HXXA 4PJLA 3QO8A 3M4YA 5GAGJ 1WJEA 1FXXA 1VQMQ 3ZOBA 1I1GA 2XAQA 1BU1A 1ADJA 4B3AA 4WXDA 1LUJB 2RD1A 3QYFA 3SEQA 2CUJA 2UZKA 1JKPC 2ZIMA 3LL7A 3GNFB 4ME7A 2NS0A 1VI0A 1WVRA 3KFUA 5EEAA 4WI1A 5J1UA 1QA6A 2DDBA 3LSHA 2FU4A 3BR1A 4HCZA 4H2VA 2XAGA 3Q0UA 2VT3A 1QCFA 3M8EA 2W85A 3KP4A 2Z5UA 3ZMVA 1JI8A 2QEXI 2DIQA 3K69A 5F0HA 4ENJA 4P75A 5D5WB 2IA0A 1YS6A 2HPMA 5IHIA 4MQ9F 2H3JA 1UHSA 2BVLA 1SHFA 5FW9A 3OA6A 1OCCH 2A7YA 3TGNA 1RESA 5EGOB 2SRCA 2RQRA 3FMQA 2DA9A 3E7LA 2R57A 1O3RA 2M5WA 2KQRA 3B6CA 1MKMA 1MMAA 5ELOA 5E8IA 5GMKl 5DY9A 1AWXA 1B6AA 1F1BB 4YEJA 3DLAA 4MZMA 1ETQA 1G3SA 3RQIA 1YQAA 2PQ8A 2HDCA 2QA4I 3ABMH 4C9YA 4QVDA 1R5ID 3IQLA 4GO1