4DQ2A

Structure of staphylococcus aureus biotin protein ligase in complex with biotinol-5'-amp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4dq2A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dq2A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dq2A02
3K69A 2Q7EA 3TUPA 3FM3A 4CDGA 2YR2A 3N4MA 5GMKj 4KYWA 3ERRA 4A5NA 1S7OA 3TO7A 4M9XA 1STZA 4EJUA 4EV0A 4P75A 4QWQA 3KP6A 1KU9A 2G7UA 3SZPA 3WE3A 3L4GB 3HFZA 5D6FA 3TEGA 2QBYA 4M9ZA 4M75F 1SFEA 1YCYA 3L7WA 2DK5A 3JCMd 2HDCA 5GAOm 3FXQA 1I27A 3I59A 3HXZA 3QNEA 4YRMA 4CH5A 1K6OA 1Z91A 2MD5A 3HYIA 1SAXA 2H6CA 2A6HF 1LJOA 4YIIA 1F4KA 1IW7F 2X4HA 3CTAA 3EDPA 1O7LA 3TOBA 4LNSA 2KRFA 2R7DA 5D8KB 5F5WA 3JAMK 1FBQA 1USYA 1MKMA 2RD1A 2O0YA 2HKOA 2NAZA 2DXUA 5FD5A 4P96A 1LEBA 4M7AD 2ESNA 5HS8A 2EFNA 1BN5A 2CSOA 3DFGA 2PI0A 3REUA 2ZR3A 2CG4A 3A5ZA 5E20A 2W25A 4M78A 4ZZDA 2DFIA 3C3WA 3HXWA 3E97A 3RKYA 1TNTA 1BM9A 2EJFA 4ZZLA 5F64A 3RJPA 4JQFA 4XBFA 2KJCA 2ZZEA 3MF2A 4C8QB 1B8AA 2E1CA 3I7FA 2XASA 1X01A 3LA2A 1LDKB 3PFIA 3U2RA 5GAMd 5E8IA 1JJCA 4KICA 2ESHA 3EYIA 1FLIA 4YG2F 1R00A 1W7PB 3GEZA 2ZZGA 3MEXA 3KEOA 3M8FA 5BMZA 5CVIA 1R58A 2O8XA 3BDUA 4LLGF 4C8QG 2AXLA 5CVRA 3I64A 3WU1B 3DP7A 4HT9A 1CF7B 3ZN0A 1YYVA 2DPDA 2DU5A 2DTIA 3A7UA 1U5TC 1ODDA 4GYIA 5FLXK 2K57A 1WQWA 1DUXC 4YFNF 4RGSA 1ADYA 4ZYGA 3A74A 5GAOq 3GF2A 3PQKA 3V7CA 2ISYA 3F8CA 1R1VA 2ZZFA 5LJ3g 2ZMEB 4TVYA 5H20A 3BOQA 5D5XB 2O61A 3WODF 1HW2A 2QQ9A 3SWNA 3J81Z 3ZMUA 4WXDA 5LJ5h 4P72C 2P8TA 1U78A 1QF6A 3KP3A 3SXYA 4H2WA 4M78F 5L3BA 1GXPA 4K86A 4YPFA 2R3SA 5LRSA 4G6QA 3JCMV 5A2QZ 5JI6A 1USSA 1YS6A 1BBWA 3R61A 4A53A 4NB5A 4M6YA 3LQQA 2CO5A 3QP5A 1NJ6A 3I53A 1ON2A 1QNTA 5BOXA 3L1AA 3TQNA 4YRSA 4J6XA 2DK8A 1M8VA 1I5ZA 3R4KA 4TQDA 3CO6C 1REPC 2XV4S 2EV5A 1ZYRF 4HF2A 2QENA 1ADJA 2BV6A 4IPAA 5FFXA 1S6LA 1RZ4A 2ZCEA 3U9GA 5BS6A 1WWXA 2RNJA 3WTVC 4V2SA 2VOOA 1SETA 5HDKA 5C53B 1IL2A 3HOSA 3ZN1A 5J8CA 5L3DA 5LJ5j 2PBIA 1ULYA 5ICEA 4M77G 1QO0D 3IL2A 1G3TA 3FWEA 4OINF 3MCZA 4P3OA 1RIOH 1B6AA 4XU2A 1TTYA 1KA8A 4G8XA 4M7AE 1XDUA 1R7JA 3BPVA 3BY6A 1ZGAA 2HGCA 3HY1A 1MDMA 1VTNC 3HTSB 4UP7A 4CXFA 3F23A 4Q5SF 5LJ3h 1EVKA 4PZJA 5KVRA 4UV9A 4XSZF 1QPMA 4YRQA 4X9CA 3E5QA 3OOPA 3AAFA 4KFCA 1CGPA 1XSXA 4M75A 4EMKC 2DJZA 1TQMA 1BC7C 1EH8A 1KQ0A 3NEUA 4L9TA 1XMAA 1P2FA 1WI9A 3WTSC 5FGMA 3I58A 1H9GA 1WKMA 1WLEA 1NYRA 2E10A 3WTYC 4LB6B 3REXA 5ELOA 3MZHA 3RF1A 1KQ1A 4A54A 2L4AA 3RYRA 2DU7A 1B59A 4OU0A 4D0PA 5E17F 4L87A 3WQZA 1KU2A 2ZGWA 1XCVA 1B70B 3IKVA 1T6SA 4TVAA 3J80K 1FWZA 1MDMB 1N9WA 3ML6A 5FO5A 4ENJA 4AIKA 4OIOF 5CVVA 2EFWA 1J7KA 3PZCA 3TKYA 1IN7A 3GFIA 4JRKA 2Q5IA 3G1ZA 3CMQA 2A6EF 4YREA 1WPYA 1USTA 3I4PA 4LMYA 4RMFA 5JHUA 3F8FA 4EM0B 1EIYA 3M8EA 3B73A 1MD0A 2CJ9A 3A7RA 4XEMA 2L02A 1AWCA 1EH7A 1SD4A 1D5VA 3H3ZA 4YRNA 3R6SA 3MFKA 3DPLC 4U88A 5ICGA 1USYC 4RAZA 1LDJA 4OMZA 2ZXFA 5H6RA 1ZAOA 4M78G 2GA2A 2HQNA 2M1BA 3ABTA 4RB3C 2HYFA 1BIBA 1IXCA 2O3FA 3JCMc 4YRPA 1UCRA 1FOKA 1I8FA 2EL9A 5E1ZB 5KNNA 1D8JA 4M75C 2IA1A 5DY9A 4Q48A 3QOPA 4HA8A 5CYVA 2DU9A 4HV5A 5ICFA 1BI3A 4HAMA 1X56A 5D5WB 3BFMA 2P5LC 4HX7A 1JHHA 5D4RA 1R5HA 3DKWA 4A6DA 1EVLA 3IALA 4EO4A 4MQ9F 1JGSA 3LFKA 1H4TA 1MGTA 4UVCA 3E6CC 4XLPF 4ZYDA 1C0AA 2EK5A 1IUYA 3GWZA 3O6BB 4Q4ZF 4LG0B 4IJAA 4N9IA 3R0AA 3HFZB 1OKRA 1MJBA 4ENKA 3CJNA 4M72A 4R8HA 4NQWA 1AOYA 1TQIA 3RKWA 5AIPA 1E22A 5AONA 1RIQA 4ESFA 3JTGA 4GXOA 3DXJF 4A0XA 2EV0A 3JB9G 3JB9F 3REOA 1Z7NA 2RDPA 3IG2A 1HSJA 1PYSA 4FX4A 3QAHA 2I2LA 2DT5A 4ZIBA 3W6JB 4QVDA 5E1XA 5GAOl 4M78C 2VONA 2QVOA 3JCMe 2GQQA 1YG2A 2XUBA 4OIQF 3FZVA 2RB6A 3EUHA 2FQ3A 3E6DA 3PQJA 4CH4A 5K5RA 4A12A 3JAMZ 1LDDA 1O3QA 1KGSA 3HHHA 2AMCA 4HZFA 4WCGA 1ZLKA 4HVCA 3BP8A 4UVAA 4BNCA 4Q6GA 1HTTA 4A0ZA 3M1EA 5L3EA 1SESA 2K7LA 4XU0A 1TBXA 3RIRA 4Y17A 4YROA 1IXRC 3BPXA 3H3UA 3KLNA 1FT9A 1TQPA 4EJWA 3O3KA 2ZT5A 4NCXA 1IN4A 5C51B 4YCWA 4HLXA 5LGUA 2CGHA 5L3FA 4N0BA 3KEQA 4K88A 4CS3A 3P9CA 5IT3A 1B70A 4TVAB 4DPGA 1F5TA 5GANd 3I59B 3PCOB 3WGIA 1OYIA 3A32A 1FNNA 1QQIA 2IA0A 2UXNA 1Q1HA 4M7AA 1PDNC 3KZZA 3IC7A 5GAMj 5H6QA 2EV6A 3P9KA 5DDGA 4UP8A 4UHTA 2ODRC 1GVJA 1XN7A 3JCMX 3K9TA 2ZT6A 3M9AA 5LHGA 1Z7MA 2Q5HA 3D0SA 2FYKA 3M4GA 2RVCA 2F5EA 5HDNA 5E3IA 5F1RA 3GUDA 4FHTA 4I09A 3WTTC 4G6DA 4YRIA 1KYZA 2ARSA 3J80Z 4TV7A 2M87A 2K4BA 1L0WA 1JJCB 3DEUA 3RI4A 4EMKA 1SFXA 1E1OA 1JXSA 3K1NA 2Z5UA 2VBWA 4EGZA 2ETHA 2P5IA 4RQEA 2E1HA 4M7DG 5DYMA 3F72A 4PJOE 4MEYF 1IN6A 4UNOA 3HSEA 5J8FA 2DTRA 2XRNA 3ECOA 1ASZA 3BROA 4PGHA 1U1SA 3HFNA 4C92C 4XLNF 3K1PA 2C8MA 2CW0F 2D1VA 4RQFA 3F3XA 4KIFA 1FSHA 2ZIMA 3VEPA 1QGPA 5GAN8 5DCMA 2MLGA 3K0LA 2XAFA 1B34A 4OMYA 5LHHA 4M75B 3JTHA 4YCVA 4M75E 6PAXA 3VODA 3IWZA 3RGLA 2EA4A 1Z6TA 3VB2A 3MF1A 3VQVA 4RGXA 3B02A 3E6MA 1X3UA 2VXZA 3SWNB 2E5AA 1FZPB 1FYLA 2MA3A 4C92G 4Q15A 3VQXA 2QQBA 4OP0A 3HXVA 1HKTA 1YIOA 2UZKA 2WTEA 1G3WA 5LJ5e 4I01A 1WSUA 5IT9Z 2P7VB 4MQVA 2JZYA 2VN2A 3FHZA 3WGHA 4HBLA 1U2WA 1OPCA 5ELNA 3R60A 5LJ5d 2HTSA 3T5XA 2FA5A 1NYQA 5HDGA 5LJ5f 3BJAA 2D45A 3GLXA 2FNAA 4PGGA 3GFMA 4GCVA 4WF2A 4YP0A 4KMUX 3F22A 4M7DF 4J15A 2Z33A 4M7DD 1ONVA 3L9FA 4EJTA 3MEYA 4IVNA 2VC1A 1FX7A 3ZMVA 5GAMf 2H94A 5TRDA 2EB7A 3LSTA 4G7ZF 2VE9A 4IRGA 2E65A 3WTWC 4AIJA 2VBZA 5FFZA 2DEQA 1LQ1A 1M5Q1 2JN0A 5GANj 1SD7A 5LJ3d 4PCQA 4HQEA 2PN6A 2ZFWA 4RB1A 1YFRA 5AIQA 4AD9A 4OLFA 5HVQC 2V1UA 5D5UB 4XRFA 3EYYA 3SB2A 2E1NA 4G85A 1ZH5A 2O03A 4JRIA 1R36A 1SD6A 3I71A 2MLKA 2VXEA 2ELHA 3L2ZA 2H09A 3UFGA 3TOAA 5DEQA 1DP7P 4RB2C 5GAOn 5GAN3 1LJ9A 4B8XA 1NJ8A 1V3FA 2VE8A 1EOVA 5D6EA 3J81K 2AS5F 4YFXF 2CJBA 2RA2A 4LK1F 4G7HF 4HOBA 1N9SA 4O6JA 2J5OA 2H6BA 1BI1A 1IRFA 2XIGA 3SQNA 3JB9J 2RHQB 4XEOA 4M9SA 1I1GA 1PUEE 2G9WA 1FBSA 3HSFA 4KT5C 2EA2A 4JLIA 2LDUA 4A5MA 4BHCA 3V8KA 4C8QE 1K78B 1RI7A 5L3CA 2XAGA 3CO7C 2ADUA 4P3PA 1WQ7A 2E41A 4HX4A 1OYWA 1Y96A 2EFOA 3T0YA 3KLOA 4NL3A 1XMKA 4P5OA 3HRMA 4C92D 5DD4A 2LKPA 1KQ8A 3GYHX 2ISZA 1SFUA 1I1SA 2VT2A 2CQKA 4M7DB 2DVEA 2VODA 3HFVA 2CJAA 3M4QA 4G9YA 3QUIA 2HTJA 5GAMe 5HLIA 3HY0A 3GFLA 4DQ2A 3P9IA 5GANg 4EJOA 4X9DA 1PP8F 4M7AB 4N0AC 4I7HA 1J5YA 1NHAA 2WWYA 2DDZA 1SRYA 2COMA 4CICA 4CYDA 4PJOC 1EH6A 4WJ4A 4ESBA 3E3VA 2D1HA 4G7OF 4F7UE 1UFMA 2Q2EA 2I4NA 2IT0A 3LAPA 4M78B 2ZKZA 1Z6RA 2XHKA 2XGTA 4JBAA 2I4OA 3P8TA 2OBPA 2YU3A 3JCMg 5GANh 1JHFA 2IW5A 2BE5F 2PFBA 2LF8A 2F5FA 2RC4A 1FYKA 1ON1A 4X5OA 1P4AA 4LD5A 3I54A 4M73A 3FB9A 2KJBA 2XKPA 3IRQA 4F7UF 4C8QA 1WU7A 2M30A 3ELKA 5A2QK 4WK8F 4OOIA 2ZBKA 4P9UA 1D3BA 2XVCA 3WGGA 3ZMZA 2YHTA 2FOKA 2ZNJA 3AHUA 1S7AA 1B1BA 1YB3A 2W57A 1TW3A 3QO8A 1B7YA 1I81A 4WXHA 4A6EA 3T1BA 1R22A 3O2PE 4ASNA 3FXUA 1YW7A 2M45A 4EMSA 2CFXA 4PJOB 3FM5A 3GXOA 1FP1D 3JCMP 1H641 1LNXA 1XGNA 4E70A 4KIBA 3VU3C 4C92F 2G7HA 5GMKh 4M7DC 4MGRA 5LHIA 5LJ3j 4ZYHA 2P7CB 2IPQX 5E18F 4ZTZB 3IKLA 5EEGA 2M8EA 2E64A 3BJOA 4P3NA 4EJVA 2Z3YA 2DZ9A 3HRUA 2PJPA 3IKTA 2ZT8A 5BQTA 2FB7A 4EM1A 5CAIA 1B76A 4CH3A 3BDDA 3UGTA 2JT1A 3RPUA 1XSDA 2E7WA 1QE0A 4LK0F 1G5IA 2QQAA 3UGQA 2NYXA 1D3BB 4EMGA 5BPIA 4NOYA 4LFUA 3M4PA 4FT8A 4ENNA 3GO5A 5KK1A 4ETSA 3MAJA 1G4DA 4C8QD 4L9NA 3GZ6A 1U8RA 1IRGA 5HS7A 3L09A 5K5OA 1QBJA 4GO1A 1JRIA 1U3EM 1T0FA 1MGQA 2DQLA 2GIVA 2PLYA 3I5UA 1YW8A 3LA3A 4S05A 2FRHA 4U7DA 4UV8A 1B9NA 4PNOA 4EGYA 3ULQB 4AIHA 3TDZC 4M77B 4ZTUB 3IKMB 1YQAA 5CLSA 2D2WA 2NS0A 1HKQA 2A5YB 2IP2A 4EVIA 4B09A 1C0WA 2ZIOA 5LGTA 1FPQA 2ZT7A 3EQLF 3JCMh 4CS4A 4I0BA 2EFQA 3L00A 3S2WA 2XROA 2PEXA 1W7PA 2EFPA 1GHCA 2DI3A 4J5YA 1X54A 4JK1X 4LJZF 4M77A 1ASYA 2Y75A 1LOJA 2FBIA 3WU0A 4R79A 3SFZA 2PMEA 2ZO4A 4YRRA 4LG0A 2VT3A 1G5HA 3RACA 4P72A 3KP4A 1NJ2A 1HK9A 2DO7A 3C7JA 4LLNA 2RKHA 2LSOA 3R0JA 1U5TA 1ZRCA 2Z9OA 4A0YA 1T2KA 4S04A 1HXDA 4KA4A 3FF5A 1TNSA 4TWAA 4MNUA 2JPBA 1EV7A 1HC7A 4G94A 2QWWA 4H2XB 2STTA 4EMKB 2NRAC 4NL2A 2ACJA 2RV8A 1HW5A 4I0AA 2DTOA 1DDNA 3QPHA 4HWTA 1S8NA 1KOGA 1WRJA 3HXXA 3SHFA 3WE2A 2QTXA 4K2EA 3KFWX 4KR3A 4KNYA 1D8KA 1SMYF 3RDIA 5LJ3e 1IN8A 3P8VA 4H2YA 4R1HA 4LLLA 5ILUA 1XGSA 3T8TA 2Y0MA 2HS5A 4BWAA 2RHQA 3J7AO 2OAZA 1YFTA 2AKWB 2MH9A 3LQRA 2QHVA 3DSQA 1Z1DA 2JSCA 3INZA 1S29A 2VBYA 1HQCA 1T39A 2ODRD 2J5PA 1RUNA 3W3SA 4BH9A 2V9VA 1BI2A 3RUXA 2OA4A 4BYYA 3HSBA 2RN7A 1OMIA 2FF4A 1HKSA 2Z99A 4K87A 3FMSA 4YRGA 2V79A 3KP5A 1YW9A 2STWA 5JFRA 2M5WA 5IT9K 4P74A 4O3MA 2DKGA 2DAOA 1FP2A 4P73C 4OIRF 1YO5C 2UWMA 1W4MA 2DQ3A 1KYWA 2DQRA 4KUMA 2QLZA 3HRKA 5GAN5 1Z05A 1YFSA 3V4GA 3QRFF 4IRHA 3Q9SA 4QVCA 3K2ZA 4M71A 4HW0A 4GGGA 1MJ9A 4LGWA 3JB9I 2J3MA 2DBBA 1ZG3A 2Q0OA 1NJ5A 4HX8A 2PG4A 2QHSA 1P4XA 4M6XA 4U0WA 4HWPA 3TEHB 1MJAA 2AMCB 3KCCA 3NELA 1WNLA 5LJ3f 4C8QF 1FYMA 4L9VA 5GANf 3VBBA 4CZZA 1T38A 3ZMSA 4M7AF 4RCBA 4L5IA 1YGBA 3HXYA 3IWFA 2HZTA 3BJUA 4RGRA 1V4RA 3H92A 3ISPA 1BC8C 1PYSB 2ZR2A 3FIFA 4RCCA 1O7FA 4MTEA 2JTVA 5D5VB 2XAQA 2HEOA 4WI1A 2EAYA 3HTZA 2L3DA 2OZ6A 3RYPA 3GW2A 2XAJA 2Q7HA 1TH7A 4HF0A 3JCMf 4UXNA 2IRFG 3RESA 3A31A 4L0YB 1FY7A 1ZREA 4CGZA 4XTXA 3PCOA 2GA1A 2OZUA 3CUQC 2E3CA 3PGGA 2P5KA 3QO3A 2QHTA 3LAJA 3GX4X 1O3TA 11ASA 4ZH4F 2VC0A 5LRRA 1B7YB 2K86A 1GXQA 5FD6A 5ED4A 5D4SA 4ON0A 5DCMB 4P55A 4MTDA 1Z7UA 1ZRDA 2IJLA 4L0ZB 1LYLA 2RHSB 4BQAA 3L2CA 3KE2A 3ROUA 1RUOA 1P4WA 3QO5A 2QZ8A 1IXSB 4HWOA 1R1UA 4KQEA 2I4MA 2X0LA 3TO9A 4FX0A 5DD8A 4H2VA 3W6KB 3ZMTA 3E5UA 2Y48A 2ARUA 3F6OA 2FE3A 1J59A 4MEXF 2K27A 4IF4A 2QM3A 2IY5B 1L0OC 5LLQA 4M77D 3LSQA 1ZG1A 3IHUA 1P6RA 1F1ZA 1J75A 4IRIA 2XTIA 2JPCA 2W84A 1ZHFA 1YLFA 4EX5A 1A04A 2ALYA 2BBYA 3LWFA 4XTWA 4MHGA 3EFSA 4MMKA 4M77C 4IHSA 2ARTA 4XQ3A 1PP7U 1YFHA 4BHPA 3JCMQ 2GAUA 5F6FA 4H0EA 2JRTA 3N97A 2QYOA 2P6TA 3HUGA 2ZXJA 1H4VB 1SMTA 1SERA 3MQ0A 3TO6A 2FU4A 1DPRA 4UPAA 1D3YA 3G73A 4XTUA 3DV8A 1LNWA 3D5LA 1ZG5A 5GAMh 2HNIA 4WWCA 1UB9A 4YRCA 1KQ9A 1VQZA 4AH6A 1ATIA 4CH6A 3CUOA 4U0YA 2KIUA 3FMRA 4HV6A 4BAYA 4HDUA 2ZNIA 3VFZA 1FBUA 4RS8A 2L01A 3R07A 4M77E 4XTVA 5LBQA 2DZCA 1O57A 3QU3A 4HLYA 4M7DA 5ERIA 5E1WA 5GMKl 3KP2A 4M75G 4Y15A 2E7XA 4M7AG 2GXGA 3BWGA 5DUIA 5GMKm 4H2UA 5GAMg 2PQ8A 2TDXA 4N0AA 3HRTA 1K7AA 2R7FA 4C92E 4RB0A 3V8LA 1KU3A 3RPQA 3FXRA 1E24A 2ZJ2A 2QBYB 1G51A 5LJ5g 4UP9A 4Y13A 4P75C 2FMLA 1LEAA 3RTRA 1I5LA 2P5VA 4UVBA 3KFUA 1XB4A 3JB9H 1W5SA 3ZPLA 3V7SA 4IXAA 2G4CA 1HW1A 1ZN2A 3Q5FA 1IZ1A 5K1PA 2HR3A 1P92A 4PHCA 1QZYA 4BW9A 3LSSA 2FBKA 3BZ6A 4GYGA 1E17A 1GGMA 2ZINA 2EJRA 4G84A 3P7NA 3P8YA 4M78D 2P4WA 2V1DA 4LB5A 3NETA 4DNCA 3F8MA 3SZTA 4CS2A 3HOTA 3NQOA 4XTZA 4P74C 4P71C 4HF1A 2DQ0A 1XD7A 3MWMA 2PMHA 1K79A 5J6XA 4H2XA 2O6GE 2K4JA 2Q8KA 5L3GA 2KIMA 5GAN4 2W85A 3VOEA 1S3JA 1KQ2A 5GAN6 4RGUA 4JUVA 2OQGA 2C7IA 4KDPA 2GWRA 4YDQA 3VQWA 1QZZA 1EQRA 1XDSA 5K1XA 3NENA 4EM2A 4P9FA 2DXTA 2DPUA 3IRRA 4ESJA 4KN7X 2OD5A 4WJ3M 5K1YA 3JSPA 1FC3A 2YSRA 4YRTA 3WTXC 3DPTA 3GFJA 4HT8A 1XGMA 4M78E 3LC0A 4KMFA 1EIYB 4HWRA 1JE8A 2DW4A 1KMNA 4KIGA 2QUFA 3K1MA 2FMYA 5CVUA 3U1DA 2Y90A 3WTZA 1SD5A 1K78A 1KU7A 1JBMA 1F9NA 4H2SA 2RM4A 1I4K1 4Y91A 2LF7A 4H02A 3BJ6A 5HS9A 4KR2A 2VC8A 4J6WA 1H0MA 1B9MA 3ZP5A 2IVMA 1H4SA 5DCFA 3RKXA 3QTCA 2HYGD 2P6SA 4HYEA 2B0LA 2HKXA 1TW2A 4WXCA 4MMLA 2V1XA 4PG3A 2FBHA 1U5TB 2BYVE 4ZYEA 4UUVA 4YCUA 4QLCU 1IAWA 2ZCWA 4U0VA 3C1DA 3HXUA 3EFRA 4BHBA 4F7UA 3GVAA 2BGCA 1XGOA 1J0RA 2YX7A 4YFKF 3QPTA 2DLLA 1NJ1A 2OU2A 2FSWA 1G3YA 4L18B 2LNBA 1H9TA 4L9JA 3WTUC 3FJPA 2V6CA 3ZMDA 3T8RA 1Z9CA 5C52B 1MZBA 1LB2A 3JW4A 5HGQA 2FXAA 4N9HA 2OQRA 5JR3A 4PDKA 4AWXB 2BEOA 2P0LA 4TQFA 3QO7A 2HWVA 1TLHB 3CUQB 4A2UA 1CF7A 1BJAA 1LVAA 1R23A 2ZTGA 4F7UG 3V7RA 2FNPA 3E9HA 3HSRA 1BIAA 4I98B 1IN5A 3CDHA 3HRIA 2MH2A 1XSVA 2RQPA 4HWSA 1J2XA 3MZYA 1B34B 1U1TA 1WQ2A 2A69F 2NNYA 1UHMA 2WV0A 5DUKA 2A68F 4U7BA 1N9RA 1I6XA 3NEMA 4HQMA 5DV5A 3JB9D 2IY5A 3VQYA 5TJJA 5ICCA 3QP6A 4PJOF 4TTVA 4TVWA 3NRVA 4I02A 4XU1A 2A07F 2ZNZA 2YLCA 3ECHA 2XAHA 1B4AA 3TDUC 4P73A 4C8QC 2YX4A 4HDVA 2HQRA 1ZARA 4XTYA 1X55A 3OV8A 4ENMA 3TEHA 3EETA 1ZRFA 4F7UB 2YPRA 5CJ9A 1BOAA 2RHSA 3E9IA 4YIFA 4H2TA 1HBXG 4EQQA 1FYFA 3DF8A 2AKWA 2XGXA 5LGNA 3ICAA 1BBUA 2PMFA 1KMMA 4L5JA 4BXUA 2RGVA 4XSXF 3ERED 4M7AC 3I0TA 4O5VA 5GMKi 3F8BA 2F2EA 3CUQA 3JCMW 3E6BA 3F8NA 3C18A 2WC2A 5EEHA 2EWNA 3FX3A 4YRLA 2K02A 4M74A 1BBYA 2F5DA 5HLHA 2XKOA 3TGNA 5JVTA 1BI0A 5GMKe 1G6NA 4WX9A 1YTYA 1T98A 5GAN7 1L3LA 4CHUA 4C92B 5E8GA 4IHTA 1Y0UA 4M77F 5GAN2 3HIFA 3SWNC 2VXFA 4YRFA 5I21A 5BPDA 2KIFA 2PMUA 2KKOA 4NHJA 2QHUA 3JCMJ 1HSTA 1UHWA 5CVJA 4CO8A 4XU3A 3GIBA 2VOPA 3UH0A 5GAOr 1J9IA 3ZQ7A 5FB2A 3A5YA 2C6YA 2EJGA 1E1TA 1R5GA 1E2XA 1O3SA 2CIMA 1EFWA 3HTUA 3KP7A 4OIPF 4AVPA 4E51A 5GAOp 2CYYA 1Y96B 4PJOA 4YRJA 2L54A 1RNLA 3JCMb 2F5CA 3V8JA 2NNNA 1W7PD 1G3SA 2MBFA 3HFOA 2A61A 5D8LB 4PJOD 2VBXA 3ABUA 4J6YA 4Z2YA 1ZGJA 1OYYA 2DTHA 3COAC 1IF1A 3KZYA 4YRKA 5ILSA 3RERA 1H4QA 4P71A 2I4LA 3G3ZA 3GZ5A 4KN4X 3LA7A 3QU6A 2A3SA 3BY7A 1U6GA 2L4MA 5FLXZ 4M75D 3F21A 4M7DE 12ASA 1X2HA 1R1TA 3OD1A 5ILVA 4PJOG 1W5TA 1NNHA 4YYEA 2MC3A 2J3LA 3QHSA 2ZMEA 2ZNYA 2FEZA 3F6VA 2H27A 1OR7A 1FSEA 2HOEA 3CLOA 5HOOA 5LEKA 3JSOA 1YS7A 3L4GA 5HLGA 3DQVC 2IA2A 2W24A 4RDXA 4F7ZA 3M7GA 5GANe 4C92A 2UXXA 3RL6A 1XCBA 3Q9VA 1O3RA 4RAYA 2CGPA 2GZWA 3QSUA 3BW1A 2CWEA 5K5QA 3HRSA 3HHGA 5LEJA 3KETA 3FMQA 3A7AA 2Q7GA 4EMHA 2YLBA 1W66A 1J5WA 2ALYB 2EJ9A 2HFHA 4I2OA 3WG9A 1WYDA 3E5XA 1DPUA 4Q47A 4O2DA 1ZLJA 2GXBA 1X2GA
chains in the Genus database with same CATH superfamily
3K69A 1S9HA 2Q7EA 3TUPA 3FM3A 2DDBA 2JOYA 4CDGA 2YR2A 3N4MA 1RADB 4AMCA 5GMKj 4KYWA 1BU1A 2IAIA 3ERRA 5F0FA 4BD3A 2DIGA 1Q86C 1SFOJ 5KYYB 4A5NA 1EKEA 1S7OA 3TO7A 2KHMA 2ECZA 3A03A 4M9XA 1STZA 2N8GA 4EJUA 2KE9A 4X34A 1A0NB 1KHIA 4EV0A 3H9QA 4P75A 2AIRB 1AWXA 2JMWA 2A6TA 2PMZN 3X26B 4QWQA 3KP6A 3J7AF 1KU9A 3CQZJ 1YJNI 2G7UA 3SZPA 3WE3A 4CC4B 3VKIA 1MBFA 3L4GB 3Q1JA 2CQ7A 3HFZA 5D6FA 1PJRA 2JTEA 3TEGA 4FL6A 4V19K 2QBYA 4M9ZA 1WJ5A 4M75F 3DB4A 1SFEA 3FDRA 4DYRA 1BR2A 4ZGDB 1YCYA 3L7WA 1IO6A 2DK5A 2LNHB 3JCMd 1MUZA 3LFUA 2HDCA 2JA5J 4B9WA 3FXQA 1I27A 4XK4A 3JRGA 1PC0A 5GAOm 5GAHJ 4AM3A 3I59A 1TUCA 1WHJA 3HL8A 4J9IA 1KG1A 3HXZA 3QNEA 4YRMA 4CH5A 4J9FA 1FMVA 2DXIA 1K6OA 1Z91A 2JTFA 2R58A 3RZDJ 2MD5A 3G1MA 2LR8A 3HYIA 3S93A 5IYCJ 1OULA 1S7EA 2VPRA 4XMYA 1SAXA 1ENHA 2H6CA 2A6HF 4CCOA 2HBWA 4MFEA 4I6ZA 1LJOA 4YIIA 4FW2A 1QVGA 1K73U 2XGDA 3HOXJ 2CMPA 4WCIA 1F4KA 2GF7A 1IW7F 3CESA 2X4HA 3ZBDA 1YITT 3CTAA 3EDPA 2LJ1A 1O7LA 3TOBA 9ANTA 4PSWA 2D0NA 2KRFA 2R7DA 3U1KA 4LNSA 5D8KB 5DLQE 1ITYA 4IKFA 2K3FA 5F5WA 3JAMK 1FBQA 1USYA 4BS9A 1MKMA 4C3IJ 3TEDA 3UF4A 3FHNA 2O0YA 1S5LC 2VI6A 2HKOA 2LK2A 2RD1A 2NAZA 1CQTA 2HVRA 1UTIA 2DXUA 2CQXA 5FD5A 4P96A 1LEBA 1YIJT 4M7AD 2ESNA 4ITVA 5IYBJ 5HS8A 1Y1VJ 2EFNA 1GDTA 1BN5A 1VQOA 2CSOA 3DFGA 2K6DA 2PI0A 3REUA 1W6XA 1MSFC 2ZR3A 2CG4A 3A5ZA 2WADA 2M0MA 2ID3A 5E20A 1SSHA 2W25A 1E3OC 3G71T 2KMUA 4M78A 4ZZDA 2EBPA 2DFIA 1POGA 3C3WA 1H92A 3E97A 2P0WA 1ACMB 3M1CA 4TVRA 3HXWA 3RKYA 4ABZA 2DT6A 1NYGA 1TNTA 1NM7A 4DYCA 4ZYAA 3CC7T 1FOWA 1I3QJ 4A3DJ 3X25B 1BW6A 1BM9A 2VJJA 4ESRA 1ETYA 2EJFA 2QKLB 4ZZLA 2QGGA 2MCNA 3K2AA 3BTLA 5F64A 2KRCA 4JQFA 3RJPA 4XBFA 1C1AA 2KJCA 2ZZEA 3MF2A 4OMNA 4C8QB 3CDIA 2V9KA 1B8AA 2E1CA 2IIMA 2LP0A 3I7FA 2VQGA 2XASA 3FBNB 3DLLA 1X01A 2NYSA 3OQ5A 3LA2A 3QPSA 1LDKB 3SEZA 3PFIA 4AFUC 1K1ZA 2MG4A 3U2RA 4HVVA 5GAMd 1RR8C 5E8IA 1Y71A 4DZPA 1K73R 3H0DA 2LBFB 3Q0VA 1I39A 4JJCA 1JJCA 1NLOC 4E7IA 2PMZA 2DK3A 3DTEA 1Q86U 1ZQ1A 1VQKA 1Q1VA 1GBQA 2CS7A 4N4GA 4KICA 3OYEA 1ZKGA 2R5ZA 2VUBA 2ESHA 3AG1H 3EYIA 3OW2P 3CCLA 3K70C 1FLIA 1R00A 2Y2ZA 4YG2F 2OPTA 1LE8B 1W7PB 2IGKA 2EYZA 3TL4X 3GEZA 2FO0A 4IUUA 2ZZGA 4FETA 3MEXA 3KEOA 3TW7A 3M8FA 4YIRX 5BMZA 5IPAA 1YIJI 1OOTA 2NUPA 3S8PA 5CQEA 5CVIA 1NBEB 1R58A 2CUFA 2O8XA 3BDUA 4LLGF 4C8QG 2AXLA 5K1XA 5CVRA 3I64A 1QWEA 1V5FA 2M34A 3WU1B 5FLMJ 2ESWA 2LQKA 3DP7A 4HT9A 1CF7B 2MI6A 1D0ZA 3QYBA 3ZN0A 2VGNA 1YYVA 4RTYA 3VYGA 3CMET 3BZKA 2DPDA 1AT1B 2DTIA 1WIEA 4IZZA 2DU5A 3KYCB 2CKKA 1JT0A 3CCJQ 4CCNA 2GLOA 1QCNA 2J6FA 1YHQA 3A7UA 1U5TC 1ODDA 1V5EA 5E3NA 1ABQA 2BHZA 1UGSB 3G71A 2LQNA 4GYIA 1Y7XA 1QRYA 5IAYA 3GTQJ 1U06A 1JTYA 4XLAA 1G59A 2R7RA 1EJ9A 4L6V5 2HL5C 4D6WA 1UJ8A 5FLXK 2HCKA 2K57A 2EILH 2LFBA 1WQWA 4NS5A 4XR6A 1DUXC 4YFNF 4F17A 4RGSA 4CCKA 2OAWA 3AG2H 3ESWB 4A69C 4ZC3A 4JZ4A 1B7TA 5GJWB 4ZYGA 1UELB 3NTKA 5GAOq 1ADYA 3A74A 3GF2A 2OTJI 3PQKA 4Y3OA 3FXLA 2F5KA 3V7CA 1IRZA 2ISYA 4JX5A 1IGNA 3F8CA 4M77G 2DJIA 3ZEHA 1QVGS 3HB9A 2E35A 3FKJA 4NDLA 2Q1ZB 3J7ZI 2M16A 1HSQA 1R1VA 2X6YA 2ZZFA 4C3HJ 2ZMEB 2EYXA 3LOCA 5LJ3g 4TVYA 2BZ8A 2A8EA 5H20A 3AL0B 4OF1A 4UY8I 4BI4A 3BOQA 3CP8A 5D5XB 5F08A 1UGQB 3IH2A 2WAQA 2O61A 3WODF 1HW2A 2RJDA 2QDLA 3CCMT 2QQ9A 3SWNA 3J81Z 4RTTA 1OCCH 2DCEA 3ZMUA 2E1OA 1VQPA 4WXDA 2MK5A 2V4JC 2ICWG 2RMOA 4BUPA 5LJ5h 2MWPA 4P72C 3PT9A 2P8TA 1U78A 3L2VA 2F69A 1QF6A 3KP3A 1GUUA 1RR7A 3SXYA 4B6MA 2DMNA 4ELZC 3EGDA 4H2WA 1UJYA 2EYQA 4M78F 5L3BA 3OR2C 5KYWB 2E36A 2LY2A 2MGQA 1GXPA 4OGCA 5FU7B 4K86A 1LKXA 5IHIA 4L5GA 2R92J 4GLMA 4YPFA 3IALA 2MWOA 2R3SA 5LRSA 2QTVA 4GDFA 2KPMA 4G6QA 1FOYA 2W0ZA 3H0IA 1X4PA 5JI6A 5A2QZ 4RTXA 3CCLI 3JCMV 2DRMA 2A3LA 1Z9QA 5F1JA 2MPXC 1USSA 2HDAA 4BGDA 1YS6A 5FJ8J 1JGGA 1VA7A 2RJEA 4BY6B 1DQUA 3R61A 4DOVA 1BBWA 2BE7D 4A53A 3ZQGA 1GV2A 3BR1A 3EGXB 4BACA 1W2BP 4NB5A 2G3RA 1BJZA 4M6YA 3LQQA 1JKRC 2CO5A 4FU6A 3QP5A 5ECAA 5IHNA 6AT1B 2NS6A 4FISA 1WXTA 3OYLA 1NJ6A 3I53A 1M3BA 3QYGB 2XPWA 5FU7C 2E3HA 3CCLQ 1ON2A 1QNTA 5BOXA 3KFVA 1N77A 3L1AA 3TQNA 3MHXA 4LUDA 5IP6A 4YRSA 4J6XA 1IO2A 2RO0A 5I2MA 2DK8A 3QYHB 1M8VA 5KAFC 2J6OA 5F0CA 1OX9A 1I5ZA 1QW1A 3R4KA 4TQDA 1Q81U 3CO6C 1REPC 2XV4S 4M7DC 2DL3A 4IQ4A 2EV5A 3M55A 1KC8R 1ZYRF 4HF2A 1VQ4T 1K76A 4LUEA 2QENA 3AL0C 3OSVA 4PFPA 1ADJA 2BV6A 4IPAA 5FFXA 1JU5C 5E79C 4CCMA 2V6EA 3DB3A 1VQMA 1TT0A 1S6LA 4XRMA 1RZ4A 2ZCEA 1ETWA 2ZPHB 4NQWB 4RDUA 3U9GA 5BS6A 5JVGF 9ATCB 1WWXA 2RNJA 3DLAA 3WTVC 2D6FA 1TTHB 1W2BA 4V2SA 2VOOA 1WHUA 1SETA 3CCRI 1N5ZA 5HDKA 4BE2A 1QHHD 4GY5A 3HOSA 5C53B 1IL2A 3ZN1A 5J8CA 5J26A 5L3DA 5LJ5j 2MW8A 4HSTA 3A8OB 3CD6A 3CCLT 3CLQA 2PBIA 2ZSHB 2NOGA 1NEGA 3CCMA 2K2VA 1ULYA 1V54H 2DJNA 5ICEA 1QO0D 5IOYA 3IL2A 2DAQA 1G3TA 1MMNA 2DMPA 2R7OA 2BE9B 2K7AA 2LZ6B 2QASA 1VQPT 3BG9A 3FWEA 2EINH 2E2HJ 3HJEA 3MCZA 4OINF 1VQPI 1RI9A 4R0KA 4P3OA 1RIOH 1B6AA 1Z7LA 4L87A 5GJVB 4XU2A 4E6RA 1TTYA 1KA8A 4G8XA 2JT4A 2ROTA 4Z8AA 2O9SA 2JJ7A 4M7AE 1YNZA 1XDUA 1R7JA 2K5FA 3BPVA 2QAZA 3BY6A 3A0HC 1ZGAA 2EIKH 2HGCA 2VQLA 2DJQA 1FIAA 5HKCA 3LWIA 1JEGA 3HY1A 3IUOA 2RHIA 4IIMA 1MDMA 1VTNC 2JVHA 3OYIA 3HTSB 2L2OA 4UP7A 4AYBA 2HU9A 4CXFA 2ME0A 3HKSA 2JQ7A 3EPZA 3F23A 1B8IA 4XORA 4Q5SF 5LJ3h 3H9NA 4PZJA 1EVKA 5KVRA 1W70A 4UV9A 3AG3H 4XSZF 1M9SA 1QPMA 4YRQA 1AHJB 1WXUA 5LL6S 1MNDA 4X9CA 5EF6A 3E5QA 4LDWA 1MBHA 2XSDC 1MBJA 1IV8A 1SF9A 1WVRA 3OOPA 1VUBA 3C95A 1Q7YC 3AAFA 2GM4A 1XOVA 4XOPA 2RHZA 2ZPGB 4KFCA 2X48A 1XTAA 2KP6A 1CGPA 2L7KA 1XSXA 4M75A 5J1RA 4EMKC 1T0JA 2L9SA 2CP3A 2M0OA 1X1DA 1BCOA 2DJZA 1TQMA 1K4SA 1BC7C 1EH8A 1KQ0A 3NEUA 1Y6IA 2HQEA 3GMEA 4L9TA 1XMAA 1MMDA 1WA7A 2DIQA 1P2FA 1WI9A 3JRHA 4IHWA 3BR5A 5EG0B 4RLFA 1DGRM 5KYYA 2DNUA 3WTSC 1RUWA 5FGMA 4WTOB 3I58A 2GNCA 2KMTA 2YUQA 1H9GA 4J9HA 4LDUA 1QHGA 1WKMA 1PUFB 1AVZC 2HL3A 2IVWA 1S72T 2E10A 1NYRA 1WLEA 2M9HA 2NVYJ 3WTYC 2DOFA 4LB6B 4LOCA 3REXA 2AK5A 1B07A 2OC6A 5ELOA 3GZNB 1A6IA 3MZHA 2X35A 2RHYA 3RF1A 5HGQA 3V42A 1KQ1A 1MNEA 3QYFA 1NG7A 4A54A 2L4AA 3RYRA 2DU7A 1B59A 4OU0A 4D0PA 5E17F 1RRJA 1DP3A 1KU2A 2ZGWA 1XCVA 2X9HA 4LDXA 2RNGA 2XPUA 1X1BA 2ZT7A 1B70B 3IKVA 1T6SA 4TVAA 3G1LA 3TBIA 3J80K 2R7WA 2R57A 1RKTA 1FWZA 2RI5A 1MDMB 2YUPA 1N9WA 3UA6A 1E0EA 2L9RA 1YX3A 4J8OA 3ML6A 2E60A 5FO5A 2YRCA 4ENJA 1PNJA 3QBYA 1IV6A 4AIKA 3BG7A 3PFYA 3P8BB 4OIOF 5CVVA 3GPLA 1X19A 3PNWC 1YI2A 3EG0A 2EFWA 3CC7A 3DPUA 5GAMe 1JJ8C 1J7KA 1X27A 1YJWI 1KONA 3JREA 2CP5A 2O2OA 3TKYA 1KD1R 3PZCA 4ZDPA 1IN7A 3GFIA 2JW4A 4JRKA 2Q5IA 3CMQA 3G1ZA 1BB9A 4UUSB 2A6EF 1YI2Q 2DMUA 4PJ0C 4JYKA 2LC4A 2K3XA 2B63J 5IP9J 3DBLB 2X1DA 4MIMA 2LD5A 2X6XA 2Y9ZA 1U3OA 1WPYA 1USTA 4XN0A 3PVQA 2CQNA 3DKYA 1YWOA 1WPKA 4BUGA 3I4PA 4LMYA 2KNBB 4RMFA 2JUCA 5E3LA 5JHUA 3F8FA 4EM0B 5A0GA 1EIYA 3M8EA 2K9NA 1UHSA 2LH9A 3B73A 2XB5A 1MD0A 2HQHA 4DGWB 4XICA 4CSWA 3PO3J 4Z02A 2CJ9A 4M3GA 3A7RA 3OOUA 4XEMA 2JTMA 2L02A 5I22A 1AWCA 3CC4A 5C4XJ 1EH7A 1SD4A 2XAUA 1D5VA 2CUJA 3H3ZA 4YRNA 2OX7A 2IS1A 3R6SA 5C4JJ 3MFKA 2O9LA 2X3XD 2E3IA 2IG0A 3DBHB 3DPLC 3LSGA 4U88A 5ICGA 1USYC 2ZXIA 4RAZA 1LDJA 4OMZA 3HOZJ 1BK2A 1B72A 1Y0MA 2ZXFA 5H6RA 1ZAOA 4M78G 2QF7A 2GA2A 2HQNA 2HBPA 5E3OA 2JJ9A 2M1BA 4ZTFA 2BY2A 3ABTA 4RB3C 2Y4XA 2ZZDA 5KCHA 2HYFA 1BIBA 1IXCA 2O3FA 2XTIA 4GLKA 1OCZH 3JCMc 3G71Q 1W1FA 4YRPA 1UCRA 1FOKA 1I8FA 1ZSZC 1WHGA 2EL9A 5E1ZB 4MDXA 2KT0A 1D8JA 2DBKA 5KNNA 4M75C 5DM6F 2IA1A 3OYKA 3ZCOA 3RQ4A 2PVDB 4E6KG 5DY9A 5I2SA 1JUMA 4Q48A 1SANA 1LE8A 2CUDA 3QOPA 2CQQA 4HA8A 1OQYA 5CYVA 4AIDA 2Q2EB 1WFXA 1PRLC 4CZCA 3RKQA 1JKQC 2DU9A 1SG5A 4HV5A 2D8JA 2E6ZA 3OMCA 3SHWA 5ICFA 1BI3A 3MD2A 3A7AA 3DEWA 1ZELA 3OIPA 4HAMA 4B1RA 5K7ZA 4IUVA 3FXMA 5TISC 5D5WB 4OMLA 4PL6A 1NK3P 2P5LC 3BFMA 1X56A 2EZHA 4HX7A 2FX0A 1UMQA 3MKZA 1WH5A 1D09B 1ZTRA 4KH0B 2X9DA 1JHHA 5D4RA 2EQKA 3EAEA 1R5HA 3DKWA 4A6DA 1EVLA 2VV5A 3CC7I 1NJIU 2XF7A 2KZVA 4MQ9F 2RH2A 1JGSA 5KAIC 2L2PA 2M51A 3LFKA 1H4TA 1ETQA 1MGTA 1WGXA 4UVCA 3E6CC 2MYSA 4XLPF 4ZYDA 1C0AA 2EK5A 3PIOF 1RKWA 2DYSH 2DYIA 4D7NA 1IUYA 1M1FA 2ZJPF 2I8DA 3GWZA 2YRVA 3A01A 1BR1A 3I56A 3O6BB 1ZSZA 3NHNA 4Q4ZF 3WHCA 1N78A 4LG0B 4IJAA 3K10A 4N9IA 3R0AA 2CJJA 3HFZB 1OKRA 3PO2J 1ZX6A 2BY3A 2KRSA 2OCEA 1VQPQ 3DWLE 1MJBA 4ENKA 4OB2B 4OMQA 4A93J 3F9KA 3REAB 3CJNA 4M72A 4R8HA 4NQWA 1QU3A 1AOYA 2D5VA 3AT1B 1VYUA 1TQIA 1W1WE 2DMTA 1KZHA 1H88C 3RKWA 5AIPA 2OI3A 1E22A 2BKDN 4R55A 3OMYA 4BXFA 2LLKA 4XOTA 5AONA 2BXYA 4ESFA 3LW5E 4C5EA 2VGMA 3JTGA 2L3QA 4GXOA 2HQXA 1VQNT 3DXJF 4BY1J 3MEUA 3LNQA 2LC2A 2NXNB 1TC3C 3S1NJ 5DM7R 3VS6A 4A0XA 3CMAQ 2EV0A 3BR3A 1XS9A 4QQ6A 4B4CA 2VL8A 5J4YA 3JB9G 1P7IA 2F2XA 3JB9F 5J39A 1Y8QB 3REOA 1Z7NA 2RDPA 3CDLA 3IG2A 1HSJA 2DA6A 4OMPA 4II3A 1S72Q 1VQ7A 1PYSA 2FPEA 4FX4A 2QGUA 5FLXE 3MN2A 5CO7A 3QAHA 1EF4A 2I2LA 4DBFA 4RMOA 2GIZA 3FDYA 3HOYJ 2DT5A 2LMJA 5CKEA 4ZIBA 3W6JB 1JXOA 5E1XA 1WHLA 4M78C 4QVDA 5GAOl 1UHCA 2VONA 4XN3A 2E34A 4LD9K 4HCZA 5KYNA 2HXIA 2QVOA 1AD5A 2EIFA 3JCMe 2GQQA 4BEHA 3EG9A 1YG2A 2O8KA 2XUBA 3J7AY 5GAGJ 3E9FA 4OIQF 2MOXA 1QVFP 3QXEB 3FZVA 2RB6A 5J3BA 1HYOA 3S17J 3MKWB 2KSSA 4M3EA 2DO3A 4C0DB 1TS9A 3EUHA 4ZGEB 2FQ3A 2NVXJ 3I4NJ 3E6DA 3W2VA 5DTDA 3PQJA 3M0SA 1KD1U 1PYVA 4CH4A 1KJWA 5K5RA 3BC8A 2JXBA 4LDVA 2MFZA 4JOMA 3JAMZ 4A12A 4ZTJA 1LDDA 1HCRA 1O3QA 1R8OB 1KGSA 3HHHA 2JSPA 1M3AA 1X75C 3ZGKA 1OPKA 1IDYA 1VQ9Q 1VQLQ 2AMCA 2XB0X 2B8AA 1XTDA 1VQOI 4HZFA 2L0AA 2OF7A 3PFSA 1OLTA 2HVQA 3GBGA 4WCGA 1ZLKA 4YEJA 3BP8A 4GRIA 4UVAA 4BNCA 3O8VA 1HTTA 3HY0A 4Q6GA 4HVCA 4RTWA 1WJCA 4A0ZA 3M1EA 5L3EA 4LXCA 4E7HA 1SESA 3LMMA 2K7LA 4BL0B 4XU0A 1RETA 1TBXA 3RIRA 3GF5A 2A36A 4Y17A 4KT0E 4YROA 3KBGA 4X6AJ 1IXRC 3BPXA 3H3UA 1VQNA 1I50J 3KLNA 1FT9A 1VFCA 1UG1A 1D0XA 1NTCA 3PNYA 3S15J 2NUTB 3TEEA 3VYHB 4EEFG 1TQPA 1AZEA 4EJWA 3O3KA 1SEUA 2ZT5A 4NCXA 1IN4A 5C51B 2JN6A 4YCWA 2A37A 4HLXA 5LGUA 2FUG2 1RIQA 3ABKH 3JR9A 2CGHA 5L3FA 4N0BA 4NBQA 1OPLA 4HCKA 2CYZB 3OR1C 2CV1A 2CRGA 3KEQA 4FYWB 4KH1B 4K88A 1T8IA 4CS3A 4BBRJ 4LVKA 2P0QA 1U9NA 1D5YA 3CJRB 3P9CA 1W5CC 3PSIA 5IT3A 2BIVA 2J05A 4BKXA 4DBRA 3B6AA 5CR2A 1NPPA 3LGFA 1B70A 4TVAB 1WJSA 1GCQA 2OTJT 5FW9A 4DPGA 1M2VA 1F5TA 4S0HB 5B3SH 2R5ZB 5GANd 4JRPA 1WJFA 3I59B 2D8HA 2FZGB 3PCOB 4L5EA 3OYGA 2E71A 2LJ0A 4M3BA 5GTIC 2DYRH 1JUPA 1D1BA 2EQMA 3WGIA 1T95A 2PX9A 1OYIA 3K4CA 1FNNA 1PG5B 1T56A 3BE3A 1QQIA 3A32A 3CMMA 3FRNA 4HCBA 2IA0A 5FRNA 4DIQA 2ZB9A 1VYTA 2K5LA 2UXNA 4M3FA 1Q1HA 2EQJA 4M7AA 1PDNC 3KZZA 3IC7A 5GAMj 4K11A 5H6QA 2IXSA 3G2BA 1C6VX 3OS0A 2EV6A 3HKZN 3P9KA 1UE9A 2HDWA 5DDGA 4UP8A 4UHTA 2QYZA 2ODRC 1GVJA 3QODA 2QSGX 1SHGA 3IH3A 2XICA 1XN7A 2BVMA 5J40A 4CRIA 3JCMX 4YCVA 2O5RA 3K9TA 1E7OA 4ATOA 2ZT6A 3HM5A 2FPFA 5TGTA 1NK2P 2IS4A 1W0UA 1ZUYA 5CKDA 3M9AA 1YITA 5LHGA 3OYCA 1Z7MA 4G12A 4HT4A 1G2BA 2Q5HA 3D0SA 2FYKA 3GTPJ 1EA3A 3MQZA 3E9GA 1TWBA 2UV1A 3HHTB 3JSCA 3CCET 5HCKA 2A5WA 4CA0A 2RVCA 2F5EA 3M4GA 2PQWA 3VSKA 4CCJA 2J7IA 5HDNA 2ZPEB 4JRQA 4HCCA 5E3IA 4X0GA 2QSFX 5DM7F 2DOAA 5D6YA 2V8KA 5EC7A 3C94A 5F1RA 3GUDA 5I11A 4BXXJ 4FHTA 4I09A 3WTTC 4G6DA 1YRNB 3GTLJ 3GOXA 2OCCH 2KRMA 4YRIA 1KYZA 1T08B 2ARSA 1WJDA 2TCTA 2X4YA 1ZQ3P 3MP8A 5CKFA 3J80Z 3ABLH 3JRAA 4KJZA 2M87A 4TV7A 1SC7A 2K4BA 1RAIB 2RQUA 4RG2A 2K9MA 2CT4A 3S6WA 2DMOA 3CC7Q 1YJNQ 2WSFE 1JJCB 3L2UA 5IP7J 3KX2A 3DEUA 3RI4A 4A3JJ 3MP1A 4EMKA 2ZXWH 4Z89A 2KR3A 1SFXA 1E1OA 1YWPA 1JXSA 1BW5A 3K1NA 4E4HA 2Z5UA 1VQOT 2D1XA 2VBWA 3EHRA 2P0KA 2K9QA 4BE1A 4EGZA 3UWNA 1VQ6Q 2ETHA 2V26A 3BG5A 3FISA 5BNGA 2P5IA 4RQEA 2E1HA 3LLRA 2RJCA 4M7DG 5DYMA 4ZN3A 3F72A 3EG1A 3ZQCA 2KROA 3H6ZA 3DBRB 1SKUB 1VQNQ 4MEYF 4PJOE 3GTOJ 3QQAA 1VQ7Q 2DL7A 1DGWY 2MC4A 4OMOA 1YJWT 1IN6A 4UNOA 2EKOA 4N4IA 2YS9A 2CP6A 3HSEA 5J8FA 1YFNA 2DTRA 3SYTA 4RBOA 2XRNA 3ECOA 4JX6A 1ZLMA 5CK9A 3BROA 1ASZA 4PGHA 3HKZA 2ABLA 3A8HB 4KUDK 1U1SA 5HK3A 2DTZA 2DA7A 3HFNA 4C92C 4XLNF 4PJMA 3K1PA 2C8MA 1UUEA 2CW0F 2D1VA 4FIBA 4IURA 3QZ9B 1PVEA 1OCOH 2MABA 3F3XA 3H9GA 1NJIR 4RQFA 3IV5A 3E19A 2A08A 3M58A 4KIFA 3HUGB 1QVTA 1K61A 1FSHA 1RL2A 3VEPA 1GT0C 1QGPA 3A8GB 5DCMA 3EGXA 3VS4A 5GAN8 1NLPC 2MLGA 3CD6T 1GVDA 3K0LA 3CMAT 3NWSA 2XAFA 1B34A 2ATCB 4OMYA 3BG3A 2E5KA 2L0KA 3H35A 5LHHA 2A7YA 4M75B 3JTHA 3VYSB 5F0HA 4M75E 2X4WA 3A1PA 2VXDA 3PNTA 3VODA 6PAXA 3IWZA 3RGLA 4HNVA 1VF9A 1Z6TA 2EA4A 3VB2A 3KYDB 1E3HA 4XKVA 1W36D 1VIEA 1Y07A 4JPBW 3X2QH 3MF1A 3CCQA 3CCUI 1SSFA 4E2FB 3VQVA 4RGXA 2CH4W 1ACIA 2RN8A 4C3JJ 2AXTC 3H0GJ 3BG6A 2VLAA 3B02A 3E6MA 4P1WA 1AKHA 1VQ9T 1X3UA 2VXZA 2Y69H 1WHMA 3J7YJ 1VQLT 3SWNB 1BL0A 2E5AA 4F92B 3AFHA 1FYLA 2MA3A 1FZPB 1VQ4I 2LT1A 2A0FB 4C92G 2K4YA 1M1KR 4Q15A 4IL6C 3VQXA 5JLXA 2XSJC 2XC7A 3EFOA 2QQBA 1T33A 2R7XA 3BDLA 1HKTA 1YIOA 3C4SA 4OP0A 1K8AC 3HXVA 3CMEI 4FTHA 2UZKA 3K6GA 4Z6YA 2WTEA 1G3WA 1H8AC 4UC4A 5LJ5e 4FASD 2CV0A 4JJDA 4I01A 3DCFA 4HKEA 3LSMA 3ONQA 3QYEA 3G4SI 1WSUA 4X1VA 5IT9Z 2P7VB 2DA5A 4MQVA 2HYJA 2JUGA 2JZYA 2VN2A 3I3LA 3FHZA 2DD5A 4RUGA 3WGHA 1YHQT 1NG2A 2PUKB 1MMSA 4G84A 4HBLA 1U2WA 1OPCA 1YN8A 4A4FA 2BY1A 3M07A 1UGPB 7AT1B 2LQ8A 5ELNA 3R60A 2J06A 3FXOA 5LJ5d 4A3KJ 4DBHA 5FKOA 1NE8A 2HTSA 5KYUB 2Z2SB 2WB1N 3T5XA 4BY7J 1GV5A 4B9XA 2Y4YA 4HVWA 2FA5A 2HDDA 3VS1A 1Q95G 2EGCA 1OJLA 3H3VK 1NYQA 2G0EA 5HDGA 5F04A 3PJRA 4YTLA 5LJ5f 3BJAA 1GCPA 2D45A 4AFQC 2OTLT 1VI0A 3GLXA 3O8HA 2KLOA 4YREA 2FNAA 4PGGA 3GFMA 4GCVA 4WF2A 2GQVA 4YP0A 4KMUX 1UB4A 4XRSA 2M0YA 2H1LA 3F22A 4M7DF 2EVRA 2GTOA 5HLTA 2J6KA 2E1MC 3PIPA 2Z33A 4M7DD 4J15A 3CMAA 4H4KC 1ONVA 3L9FA 2KT8A 4EJTA 1OQKA 1OCRH 1Z0XA 2DT7B 3K4LA 1R49A 3MEYA 4IVNA 1R0CB 4HRIA 2VC1A 1KC8U 2LMDA 1FX7A 3ZMVA 1OEBA 5GAMf 1M1KC 1V76A 1ERDA 2H94A 2WB1A 1K4TA 3RR6A 5TRDA 5HK0A 2EB7A 3LSTA 1IG7A 2Y9YA 4PJJA 2R7VA 1VQ6I 3QPLA 4G7ZF 3CC4T 2VE9A 4IRGA 4ZJZA 1MV3A 2E65A 3VYTB 1GFCA 2GFUA 2YUOA 3WTWC 2VB6A 3MKYB 4AIJA 1G83A 2K3YA 2VBZA 3IAS2 2OJED 5FFZA 3JCUC 1LQ1A 1M5Q1 2DEQA 4B43A 3F0CA 4YRGA 2NUTA 2JN0A 2JMAA 5GANj 1SD7A 1MBEA 2QEXI 5LJ3d 4PCQA 2X6WA 3RMSA 1FJLA 4LVMA 4HQEA 2QSHX 4CH7A 3IAM2 4F55A 1RABB 2PN6A 2ZFWA 4RB1A 1T3LA 2BXZA 2CU7A 4XRSG 4A4HA 1YFRA 5AIQA 4AD9A 4OLFA 3M56A 5HVQC 2V1UA 5D5UB 1R4MB 3K7AJ 4XRFA 3EYYA 1ZGWA 2E1NA 1A36A 1TWGJ 1X2MA 1VQ5I 2O03A 1ZH5A 2AZSA 2FL7A 3LWHA 3OW2A 4JRIA 3PUFA 1VQMI 1R36A 3S3MA 1SD6A 3I71A 4XKCA 2MLKA 4F52A 3UT1A 5CKHA 3S3OA 5AYFA 2VXEA 1NYFA 2ELHA 1JQQA 3L2ZA 2H09A 3DKXA 4DW6A 4J9DA 3UFGA 3TOAA 1OFCX 5DEQA 4IX7A 1DP7P 4RB2C 1PUFA 5GAOn 5GAN3 1LJ9A 2DMQA 4B8XA 1IHVA 1NJ8A 4J9EA 3E2UA 1V3FA 4BI3A 2E2IJ 3HDDA 2C06A 2VE8A 1G5VA 1EOVA 5D6EA 2HPIA 3J81K 1XMXA 1LPQA 3CBOA 4C30A 3IH4A 2ZXHA 2CSIA 2AS5F 2CT3A 4YFXF 8ATCB 2CJBA 2V8IA 2RA2A 4A63B 4LK1F 4D1QA 4G7HF 2X51A 2COWA 3CCST 4HOBA 1N9SA 1R71A 2ZMEC 3CJTB 1MMAA 1K8AU 1ARKA 4O6JA 2CP7A 2J5OA 2H6BA 1BI1A 1IRFA 2XIGA 3SQNA 3JB9J 5FWBA 3Q0WA 3CCVT 8AT1B 3H5RA 5CKBA 1Y0NA 2P81A 3G7ZA 3RBBB 2F2WA 2RHQB 2P4RA 4XEOA 4M9SA 1I1GA 1PUEE 3OBWA 2G9WA 2YT6A 1FBSA 4KGXB 3M0QA 3HOUJ 1IC8A 2CZ7B 1K9MR 3HSFA 4KT5C 2EA2A 4HNTA 2D9TA 2LDUA 4A5MA 4BHCA 3V8KA 3BT9A 3NTHA 1P7JA 4JLIA 5M5WJ 3VS5A 4C8QE 3AKZA 4RA2A 1K78B 2EGAA 1RI7A 5L3CA 2V1QA 4C0GA 2XAGA 1X2QA 3CO7C 2ADUA 4P3PA 3WXMB 1H3ZA 3URGA 2LTOA 2EPDA 2IPOB 1WQ7A 2E41A 4HX4A 1OYWA 1Y96A 1ZUUA 3JV3A 1Q81C 2EFOA 2RQVA 2K9SA 2M2EA 1JJ6C 3Q0UA 3T0YA 2EFIA 5L23A 4I76A 3KLOA 1HJDA 4NL3A 1XMKA 3CF5F 1RAGB 2XRLA 4P5OA 3HRMA 1WI7A 1X6GA 5IY5H 5FKLA 4KUIA 5DD4A 4C92D 1K73C 2LKPA 2W1OA 3MMYB 1KQ8A 2EYWA 3GYHX 2ISZA 1AOJA 1SFUA 2JUFA 5FU6C 1A31A 1BKBA 1I1SA 2DODA 2B9SA 1MBGA 1TUGB 2KAFA 3ME9A 1VZ0A 4BJ5C 3UA7A 4AG1C 3SFIA 5L8RE 2ZAEA 3UDCA 2VT2A 2CQKA 1I07A 5C44J 4M7DB 3OL3A 1BA5A 3OBYA 2DVEA 1GLNA 3J80E 2VODA 3HFVA 2FOWA 2LQWA 2CJAA 3ZFJA 3M4QA 2VIXA 1J09A 4G9YA 2HTJA 3QUIA 1BR4A 3M4YA 5KNLA 1UG0A 5HLIA 3GFLA 4DQ2A 3P9IA 4AVZA 1VIFA 3VUBA 1LUJB 4OMMA 3C12A 4EJOA 4W1UA 4X9DA 5GANg 3NTIA 1PP8F 4M7AB 4BEHB 4N0AC 4I7HA 2JVGA 1IDZA 3B6CA 1X69A 1YX5A 1J5YA 1NHAA 2QA4Q 1I1JA 2R7UA 2WWYA 2FJ1A 2KQRA 4GFBA 2L3RA 2GFAA 2LKXA 1SRYA 2DDZA 2COMA 2IS6A 2G6FX 3WHBA 2JRMA 4CICA 2OTJQ 4FE7A 4CYDA 3H5NA 2VWFA 4PJOC 4C9YA 1J3TA 1EH6A 1U8BA 4HVUA 4WJ4A 1MBKA 2Z1DA 5B1BH 4ESBA 1FEXA 4QVZA 1RESA 1GCQC 1RLPC 3E3VA 4OAZA 2D1HA 3RZOJ 2LYCA 2WY8Q 1WI3A 2CV2A 4G7OF 3OMGA 4Z88A 1UFMA 4F7UE 2Q2EA 4M4ZA 5CKTA 2I4NA 2FEIA 5KCMA 2IT0A 2CP2A 3LAPA 5IYDJ 1F1BB 1N8RR 4M78B 2E19A 1D0YA 2EZIA 3QWYA 3UATA 2DFFA 2ZKZA 1Z6RA 2XHKA 3DU5A 2XGTA 2AZVA 1E6HA 4JBAA 2AKKA 2I4OA 2WBMA 2IBDA 3VWBA 3P8TA 1AWOA 2OBPA 2YU3A 3BTCA 1APLC 5IOZA 4FYYB 2DA4A 3G1JA 3JCMg 1JHFA 5GANh 3G4SQ 2IW5A 4DZJA 3OSGA 2R7SA 1IJWC 2L8DA 2BE5F 2KISA 1M3CA 1UZCA 2PFBA 1Z3XA 2QQ8A 1X4OA 1ETKA 1Y8RB 2LF8A 1UDLA 1WDXA 2OTLQ 3OYDA 1YIJQ 2F5FA 2O4XA 3MJXA 2RC4A 1FYKA 4OB0B 1ON1A 4X5OA 1P4AA 4IOAF 2JZ2A 4IUTA 4LD5A 3I54A 2Y0SA 4M73A 3FB9A 3META 4AFZC 2KJBA 4XL9A 3ZQLA 4XNFA 2ELKA 1F36A 2XKPA 4HNUA 3C2HA 3IRQA 4F7UF 4C8QA 1WU7A 3A8LB 3CC4I 3AG4H 2FPDA 3CCQT 3JCMQ 3I4MJ 4JDSA 2HSEB 2M30A 3PM1A 2MAMA 3BTIA 4PKCC 3ELKA 2PTKA 2I0NA 2RPNA 5A2QK 4WK8F 4OGEA 3N05A 1KQSP 1K0XA 3BQYA 4OOIA 2ZBKA 4P9UA 3CCEI 1D3BA 1PSEA 3QOEA 4N4OB 2XVCA 1TU0B 1N8RU 3WGGA 3ZMZA 3L2QA 2K3BA 2FOKA 1MHNA 2YHTA 5C6SA 2ZNJA 2ZPFB 2M7BA 3AHUA 3D5RC 4VUBA 4HWSA 1S7AA 1YE9A 2GOMA 4QQGA 4MZTA 2VQHA 1B1BA 2EGEA 1B3QA 2W57A 1TW3A 1YB3A 3QO8A 4LD6A 2CUBA 1I81A 3RCOA 1B7YA 4WXHA 3HGGA 2X3WD 4A6EA 3T1BA 1YITI 1R22A 1WX6A 1YJ9A 2EZLA 3O2PE 3UR3C 4ASNA 1FYNA 3FXKA 3ASOH 2LTPA 5JHFA 3CMYA 3FXUA 1I6HJ 1YW7A 2M45A 4B48A 4EMSA 3JRIA 4BY6C 2RREA 2CFXA 3HOWJ 4PJOB 4MZMA 3FM5A 1PCXA 2V9PA 3GXOA 3TP3A 5GAEJ 4Q5WA 2KEAA 3RNJA 4YCUA 1SHFA 5D7UA 3OSSC 1FP1D 2HQ5A 1QWFA 2ZJQF 1H641 1LNXA 3JCMP 3LGLA 1XGNA 3FBIB 4E70A 4KIBA 1Q86R 3CCJA 4RLQA 2KDOA 3VU3C 1VQNI 4C92F 2G7HA 5EG2A 5GMKh 5M5YJ 4MGRA 5LHIA 5LJ3j 4B44A 4KISA 2NS7A 4B47A 4ZYHA 2IPQX 5E18F 2P7CB 4XK8E 4ZTZB 1WZOA 3IKLA 2O88A 2VJ4A 5EEGA 2M8EA 2BHYA 2K5CA 2E64A 3BJOA 3QJYA 4P3NA 4EJVA 5EG0A 4BDYA 5HY6A 2Z3YA 2DZ9A 1K0SA 3HRUA 2NOJB 2PJPA 1TWHJ 3I56I 3IKTA 2KVQG 5BQTA 3OB9A 2ZT8A 4PFOA 4EM1A 5FKNA 1LCKA 4BDZA 4BQNA 2FB7A 4RKUE 1PHTA 5CAIA 1B76A 4CH3A 3BDDA 1VQKQ 2JT1A 3UGTA 3RPUA 2W00A 1XSDA 2E7WA 2RAEA 2RI3A 3OYHA 1QE0A 4J01A 4HG2A 3NPFA 4LK0F 3FKIJ 3CXCA 3K4JA 1G5IA 2BW3A 1HLVA 3GBQA 2QQAA 1R9TJ 4C0DC 2NYXA 3JRFA 1D3BB 4EMGA 3UGQA 1YJNA 3ZQFA 2KRHA 5BPIA 1F43A 4NOYA 1M90R 1VQ7T 3R6NA 1N8RC 1SVOA 2KFDA 4FT8A 4LFUA 1OI1A 3M4PA 2PZ1A 2E2JJ 4LVJA 3D1NI 4ENNA 3GO5A 4ZGJB 5KK1A 4ETSA 3MAJA 1G4DA 2ELJA 4MDWA 4C8QD 4L9NA 3GZ6A 1U8RA 1IRGA 1VQKT 5HS7A 3D7SB 1XX5A 5EGOB 1E6GA 2AKLA 4QPOA 2F5TX 3L09A 3E7LA 5K5OA 4GO1A 1QBJA 1Q82R 1JRIA 1LFPA 1U3EM 1T0FA 1MGQA 2DQLA 2GIVA 4Y92A 5FROA 3VS3A 3CCEA 2PLYA 4OWRB 3OYFA 3I5UA 1YW8A 3LA3A 4S05A 2FRHA 4U7DA 4UV8A 1B9NA 3OYAA 2DRKA 4PNOA 2LREA 4EGYA 3ULQB 5GP9A 4AIHA 4PSXA 3TDZC 1MSEC 2L7MP 1TSFA 4M77B 2CS3A 2ZCFB 4ZTUB 3NMZC 3IKMB 1YQAA 5CLSA 2D2WA 2NS0A 2B86A 1HKQA 2A5YB 2DM1A 2X1CA 1TXQA 4QPQA 2IP2A 4EVIA 4V2GA 4B09A 1C0WA 2ZIOA 1W4SA 2MSYA 3M53A 3CCQI 2GCXA 3O5ZA 5LGTA 1FPQA 4MLOA 1QKWA 3EQLF 3JCMh 3I56T 1BYMA 2W7NA 3CZ6A 1JKPC 3EUAA 3GTMJ 4CS4A 4I0BA 2EFQA 3L00A 3S2WA 2XROA 2PEXA 3MKLA 4A3CJ 1TUDA 2DXCA 2R5MA 3PTAA 1Q7YU 2XGEA 2DE0X 2VASA 1W7PA 2EFPA 1GHCA 1R6RA 5FKMA 1VQ4A 2CUZA 2DI3A 4J5YA 1X54A 2O31A 2OJ2A 3K4NA 1VQMQ 4JK1X 4LJZF 4M77A 1ZR2A 1ASYA 2Y75A 1LOJA 2FBIA 3WU0A 4R79A 3E0JB 3L2RA 3P8HA 2F6CA 2KYMA 3PMIA 3SFZA 1WJAA 1EFNA 2PMEA 2ZO4A 4YRRA 1X2GA 4BQQA 4LG0A 2VT3A 4J9BA 2QCOA 1G5HA 2XD0A 3RACA 2YDLA 4P72A 5IXFA 1O9SA 1Z3YA 3KP4A 4A3EJ 5CCAA 1NJ2A 1BBZA 1HK9A 2DO7A 3C7JA 4LLNA 3M5AA 1IREB 2RKHA 2WACA 3CCRA 2LSOA 3R0JA 1U5TA 3HBLA 1ZRCA 2R7TA 2KY9A 3GLLA 1KQSS 2Z9OA 4A0YA 1YHQQ 4FM4B 1T2KA 2VKNA 5J47A 1HXDA 4S04A 1R5ID 3FF5A 4KA4A 3CCVA 3UPUA 1TNSA 1JXMA 2W10A 4TWAA 1RPWA 4MNUA 1GXIE 3M8JA 2JPBA 3LSJA 1EV7A 3Q3SA 4IEJA 1VQ8I 3OS5A 3CD6Q 1HC7A 4G94A 3ZR8X 1OV3A 2QWWA 1X2KA 2FZKB 3FIWA 2LT4A 4H2XB 5F27A 2STTA 4MZPA 2NRAC 4EMKB 1V55H 4NL2A 2ACJA 4IHVA 2L7FP 2EW3A 3N5BB 4DBQA 3EG3A 2RV8A 1HW5A 3PE0A 3HPWA 3ULRB 4I0AA 2XDVA 2DTOA 4MO7A 1RAHB 1DDNA 1M1KU 4W97A 3QPHA 2QDYB 1M1EB 4HWTA 2DBMA 2DPPB 1S8NA 4IQJA 1KOGA 1WRJA 3HXXA 3SHFA 2ZC2A 3WE2A 3ZQHA 4IIOA 3BR6A 2HKNA 2LJ3A 3LL7A 2QTXA 3MO8A 1K6YA 4K2EA 1HDDC 2Y0SN 1HF0A 2XU8A 2YUNA 3KFWX 1K9MC 4KR3A 4KNYA 4CUGA 4IUQA 1SMYF 1D8KA 3RDIA 5JLWA 3HP9A 1UGVA 5LJ3e 4UB6C 1ZBXA 2BTTA 1IN8A 4PFZA 3P8VA 4H2YA 4R1HA 4LLLA 5ILUA 1VQ7I 1QCFA 2YRDA 1M27C 1XGSA 3DLLF 3CC4Q 2BZTA 3T8TA 1TOVA 4XIDA 2C0OA 2Y0MA 3LSKA 5HNFA 2V1NA 2HS5A 5FKKA 2PUOB 4BWAA 2V7FA 2DL5A 4C5GA 3J7AO 2OAZA 2RHQA 1QZEA 2P0PA 4X1EA 2V1RA 3G6EQ 2MH9A 4I99C 4J83A 1YFTA 2AKWB 3LQRA 4J7IA 3CCQQ 3WG7H 1K9MU 4ZDOA 3OS2A 4M6VA 2QHVA 1KC8C 2BZYA 2FVUA 1Z1DA 3DSQA 2JSCA 2EQUA 4RAFA 1Z67A 2NVUB 2BY0A 2FRWA 3GTJJ 3INZA 1S29A 2LKSA 2JMCA 2VBYA 1HQCA 3CCJI 5CQYA 1VQ8T 1T39A 4XONA 2ODRD 2J5PA 1RUNA 2K2MA 3I55I 4BH9A 3W3SA 1XJWB 3LH5A 2V9VA 4E7ZA 3S1RJ 4LVLA 1YITQ 4E47A 3CCSI 3BLYA 1BI2A 4JX4A 2DILA 1OU9A 1QVFS 4OAYA 4OMFB 3RUXA 2OA4A 4BYYA 2EPFA 3VYRB 4E7SA 1U5SA 4A3FJ 4ORZA 2RK1A 2CW7A 2XF6A 3HSBA 1Q7YR 2NVTJ 3W3CA 3H8ZA 2RN7A 3LSHA 1OMIA 3CCVI 3KUFA 4GBQA 1TWCJ 1WZ2A 2JVVA 2FF4A 1HKSA 2Z99A 5EJCA 3FMSA 4K87A 2V79A 3BTJA 3KP5A 3NAUA 2P84A 4DEYA 4II1A 3GNFB 4OB1B 1YW9A 3GNGA 2B7EA 4E7LA 5JFRA 2DOEA 4ZDLA 2STWA 1PD0A 1RAFB 1Z9ZA 2XHCA 2OTLA 2M5WA 1HC8A 5IT9K 1CKAA 1CSKA 4P74A 2QA4I 4O3MA 2DKGA 3K4KA 4BE0A 3OY9A 2DAOA 1O4XA 1FP2A 2KL4A 1UECA 4P73C 3LYIA 4OIRF 1YO5C 2UWMA 1W4MA 3W6VA 2R5AA 2XDPA 2DQ3A 1XNIA 1KYWA 1UJ0A 1VYVA 3X28B 2DQRA 2HI3A 1X1PA 4KUMA 2QLZA 3JAME 3HRKA 1Y57A 1K83J 2CFOA 5GAN5 1Z05A 2R93J 1SEMA 1FIPA 3V4GA 3QRFF 1YFSA 4IRHA 3KPHA 1XPXA 3EH2A 3Q9SA 2VUMJ 4QVCA 1R77A 1WXBA 3A98A 3K2ZA 3DLMA 4M71A 3MEAA 4HW0A 4GGGA 3D5SC 1X2NA 1MJ9A 1ZA1B 4LGWA 3CC2I 3JB9I 2J3MA 1YIJA 2CH0A 4A3BJ 3WVEB 2DBBA 3KZIC 1ZG3A 2Q0OA 1NJ5A 4HX8A 2PG4A 4B3AA 2QHSA 1P4XA 4M6XA 4U0WA 5A0DA 4HWPA 3TEHB 4JLGA 1MJAA 2YUSA 3RMQA 1VQ6A 2AMCB 3KCCA 3NELA 3PL8A 1WNLA 2HD0A 5LJ3f 2L89A 4C8QF 3L1PA 1FYMA 4L9VA 5GANf 3VBBA 4CZZA 1T38A 4CC7A 3ZMSA 2E5ZA 4RCBA 4L5IA 2IS2A 5KH6A 4M7AF 1YGBA 3HXYA 2NWMA 3TCJA 4JS4A 2HXOA 2HZTA 3IWFA 3M3YJ 2O7OA 2GBYA 3G71I 1ETVA 4YELA 3CCYA 4RGRA 2FRYA 5HODA 3A5ZB 3BJUA 4M3DA 4KRTA 1V4RA 4AC0A 2KGTA 2K85A 3H92A 3ISPA 1BC8C 4ELYC 3A1YA 1EIFA 3W2WA 3HEFA 1BCMA 4J9CA 4C5HA 4ZN1A 1IXDA 3CCSA 1PYSB 1S72I 2ZR2A 1WGSA 3FIFA 1ZBJA 3WVDB 1DU6A 1O7FA 4MTEA 2JTVA 5D5VB 2VYTA 2TRTA 2XAQA 2HEOA 2X4XA 2JA6J 2EAYA 3FC3A 3HTZA 4WI1A 2L3DA 2OZ6A 3RYPA 2V8JA 2BW3B 3GW2A 2XAJA 4MFDA 1IB8A 2QI2A 3TSWA 1X3ZB 2LRQA 1TH7A 2Q7HA 4HF0A 3JCMf 5KYXB 4UXNA 3TMOA 2IRFG 3M54A 3RESA 2QQSA 2F4MB 3A31A 1H3HA 1Y56A 4L0YB 1FY7A 1RAAB 3QKJA 3M4OJ 1ZREA 4CGZA 4XTXA 1R4NB 3PCOA 1VQ5Q 2GA1A 2GQIA 2PNIA 4D5FA 1V5GA 2QA4A 2OZUA 3CUQC 2E3CA 4RG8A 3PGGA 2P5KA 3QO3A 1QA6A 2QHTA 5B1AH 3LAJA 3GX4X 1O3TA 3DTIA 1ZK8A 4ZH4F 3X24B 2VC0A 5LRRA 2PVOB 4BBSJ 2F2VA 4N4HA 4XKWA 2DA9A 4AFSC 2K86A 4EDUA 5KYWA 1B7YB 1VQ9I 1VQLI 1SRLA 1GXQA 5FD6A 5ED4A 3M0RA 5D4SA 4KGZB 2BZXA 1D1CA 3SDGA 1V29B 4ON0A 2K9GA 3CBPA 2DA3A 5DCMB 4P55A 5KHDA 4MTDA 2CREA 1Z7UA 2ZIMA 1KFZA 2BOLA 1ZRDA 2IJLA 4L0ZB 4XM3A 2DFHA 2K79A 1LYLA 2F4OB 2BUDA 2RHSB 4BQAA 3TQ7P 3E1SA 4G85A 4LITA 2W4SA 3KE2A 3L2CA 1K9AA 2UUZA 4XLCA 2W48A 1M8MA 2KYBA 4E7JA 2HOSA 3ROUA 5IH2A 1RUOA 2HZYA 1P4WA 2PU9B 3QO5A 3A01B 2QZ8A 3HL2A 2LVMA 1IXSB 1UG2A 3PMTA 4HWOA 1R1UA 2CSQA 4KQEA 3G6ET 2I4MA 1WH7A 2X0LA 3TO9A 3JRBA 4FX0A 5DD8A 3VYUB 3JRDA 4A3MJ 5IN1A 3W6KB 4H2VA 3ZMTA 2GTJA 2DERA 3E5UA 2QKMB 2Y48A 5A0LA 2ARUA 4FQGA 5CQGA 3F6OA 4RTVA 2FE3A 4RTZA 1J59A 2M9UA 3J81E 1KD1C 4MEXF 2Y31A 2K27A 4IF4A 3GTKJ 2QM3A 1QP3A 2LCLA 3SDZA 1L0OC 2IY5B 5LLQA 4M77D 3LSQA 3A2KA 1ETXA 2M4KA 1TWFJ 3ABMH 1ZG1A 5HNHA 3QZ5B 1X1CA 1RC9A 3IHUA 1P6RA 1F1ZA 1J75A 1EZZB 5CPRB 4IRIA 2E12A 4QW2A 5KYXA 1AU7A 2JPCA 2VKDA 3CC2Q 2W84A 2R4GA 1LFBA 2EH3A 3ASNH 5CIUA 3CCRT 1ZHFA 1AZGB 1YLFA 4XAXB 1A04A 4EX5A 2ALYA 2BBYA 3LWFA 4XTWA 3PIPF 4CYCA 2FZCB 4IHXA 4MHGA 1FOXA 2ZSIB 3EFSA 4MMKA 3R6OA 2KBTA 4M77C 4IHSA 1Z21A 2ARTA 2WAQN 2RNAA 2CW8A 1PP7U 3U21A 1YFHA 4BHPA 2AO9A 2FD5A 4XQ3A 2XIDA 2DA1A 2GAUA 4RAGA 2PJRB 2ZJRF 2RJFA 2M02A 3KYLA 5F6FA 3K4BA 4H0EA 1PSFA 2JRTA 3CP2A 3N97A 3FXJA 2QYOA 2FQ4A 2CUEA 2P6TA 2LVSA 1ZR4A 3EG2A 3I9QA 1YJWA 2IY5A 3HUGA 2LNVA 2ZXJA 2COYA 4RM2A 3DKMA 2EBIA 1H4VB 1SMTA 4KBMB 1SERA 3MQ0A 3MEVA 4EIKA 3TO6A 3CPWP 2FU4A 3NGPA 1DPRA 1WJBA 4UPAA 1D3YA 1PKTA 3K4MA 5J1UA 3G73A 5LD2C 3DV8A 4XTUA 3H0HA 1LNWA 3D5LA 1ZG5A 5GAMh 4FE4A 3CCVQ 2XF5A 4II2A 5IXBA 2Z16A 2HNIA 4WWCA 2VJ5A 1YOVB 2WSCE 1UB9A 4YRCA 1KQ9A 2KQWA 5GMKe 5K7HA 1LVKA 1VQZA 2JA2A 5AT1B 1ATIA 3CUOA 4U0YA 2KIUA 2M4GA 3FMRA 1HOMA 2ENMA 4HV6A 4BAYA 2GBQA 4HDUA 2LP5A 3VFZA 3A8MB 2ZNIA 1MNMC 1FBUA 4RS8A 2L01A 2LOOA 3R07A 4M77E 3M0UA 2MMPA 4E7KA 4XTVA 4ZNXA 5LBQA 3UNGC 3S16J 2DZCA 3FJ5A 2WA0A 3TVTA 1O57A 3QU3A 1SAUA 3BR2A 3BQZA 5GPCA 4HLYA 4IO9F 2WY7Q 1QMCA 2NLUA 1M2VB 4M7DA 5EEAA 4A3GJ 2CH4A 2HQAA 5ERIA 5E1WA 3I9V2 1AKHB 5GMKl 3KP2A 1QCOA 3BR0A 4FW1A 4M75G 4Y15A 2E7XA 1YJNT 4BJ6C 4M7AG 2GXGA 3FK7A 1Z77A 3G6EA 4PK4A 2NVQJ 2ME6A 3VJPA 3BWGA 5DUIA 5GMKm 4H2UA 2QXFA 1YBYA 3M0TA 4AYBN 3EUHC 2XKOC 5GAMg 1JUSA 2LG4A 3ZXSA 2PQ8A 2TDXA 5EZHA 4N0AA 2DETA 1K8AR 4RMNA 3HRTA 1K7AA 5M9OA 4XLHA 2R7FA 1UEBA 3VV0A 1P9QC 3SFMA 2VKEA 4PLLA 3H5AA 4C92E 4RB0A 3V8LA 3BCAA 2JA7J 1KU3A 2C0IA 4J7FA 1M90C 3DEEA 3RPQA 3FXRA 2AHJB 5M3FJ 3ZL7C 1E24A 2SEMA 5C52B 3OWTA 2RHXA 1KQSA 2ZJ2A 2QBYB 1Q82U 1G51A 2NUPB 5LJ5g 3OW2S 4Y13A 4P75C 4UP9A 4QTRA 1N6AA 3MEWA 5CQXA 2FMLA 1LEAA 3RTRA 1FMKA 1V1CA 1ZUKA 2COZA 11ASA 1I5LA 1H8KA 5DLOA 3UKGA 3ZRGA 3CMEQ 4JP0A 4BQOA 2P5VA 5GTHC 1CKBA 4UVBA 3KFUA 1GBRA 5D6WA 1XB4A 2YWWA 3P8DA 4D8KA 2QEXQ 3CCJT 2VQCA 1YI2I 2KT1A 1W5SA 2GOXB 1YJ9I 4KT6A 3CQTA 3ER0A 3VS7A 3JB9H 1B8IB 3ZPLA 3I56Q 2DYBA 3V7SA 4IXAA 1UGRB 3CBMA 4LDYA 5M5XJ 3LSIA 2R5YB 2XI9A 4EPCA 2ROLA 2G4CA 1X43A 1HW1A 1IRXA 2VJIA 1ZN2A 3Q5FA 1IZ1A 2O4XB 2EQIA 5K1PA 2HR3A 1P92A 4ME7A 4LG3A 3SDBA 4PHCA 1QZYA 2RQQA 3LSSA 2HOTA 2FBKA 2F48A 4BW9A 2LRDA 3BZ6A 4GYGA 4XQFA 1E17A 1N27A 1GGMA 3OIOA 2M3AA 4LN2A 1JKOC 4DOWA 3TP0A 4QIWN 2ZINA 2EJRA 2COBA 1M1GA 3CCEQ 3DU6A 3P7NA 2KIQA 1MH4A 4M78D 3CXCP 2VPLA 3P8YA 2P4WA 3HOVJ 4C0ZA 2V1DA 4LB5A 3NETA 4DNCA 3F8MA 3SZTA 3G4SA 3ASKA 3OS1A 1N75A 2MD0A 3NQOA 3VDXA 3HOTA 4CS2A 4XTZA 4P74C 2IGNA 1TG0A 4HF1A 5E3MA 1FTTA 2M1HA 4QQDA 2DQ0A 4P71C 2L7ZA 1XD7A 3MWMA 2PMHA 1VQMT 2ECCA 4C2MJ 3K70D 1K79A 3G1OA 5J6XA 1VQKI 1UHFA 5FU6B 2O6GE 2YSQA 4BI8B 4H2XA 2K4JA 2Q8KA 2R7QA 2RI2A 5L3GA 2KIMA 4CYCB 2BVLA 2W85A 5GAN4 4DJAA 1KSWA 4Y4RA 3ZQIA 3VOEA 3EGDB 1Q82C 1S3JA 4J00A 4BB7A 2EQRA 1KQ2A 1ZSGA 3A4CA 1TP4A 3OYBA 5GAN6 4YRVA 4RGUA 4JUVA 1W36C 1N25A 1WJEA 3HC7A 1NEBA 4F91B 1WYXA 2RHUA 2OQGA 2YXYA 3CC2T 3H41A 3CXCS 3ERMA 3L42A 2C7IA 4KDPA 2I10A 2GWRA 2WV1A 4J9GA 1QZZA 4D9JA 1XDSA 1EQRA 3NENA 3VQWA 4YDQA 2CZ1B 1G8XA 2R5YA 1MIJA 3C2GA 2GGRA 4EM2A 4KULA 4P9FA 3VS0A 3HXLA 2NS8A 2DXTA 4RCCA 1VOMA 1TWAJ 1Y1WJ 3IRRA 2DPUA 1FMWA 5LFAA 4UUSA 4ESJA 2XDDA 4KN7X 1W2BS 2OD5A 4WJ3M 5K1YA 3JSPA 1FC3A 2YSRA 2EKHA 4YRTA 3WTXC 3I55A 3DPTA 1D1AA 3GFJA 3O8GA 2JS2A 2ED0A 2HKQB 4FYVB 1JJ2P 1JJ2S 1HD3A 2ZFUA 1KK7A 4HT8A 3CCUQ 2NUZA 1XGMA 3I5SA 2LX7A 4M78E 3LC0A 4KMFA 1EIYB 1I5OB 4HWRA 1JE8A 3EGUA 2M8GX 2DW4A 1WJQA 4PJNA 2DFUA 1KMNA 2E70A 4KIGA 2QUFA 3K1MA