4DQ2A

Structure of staphylococcus aureus biotin protein ligase in complex with biotinol-5'-amp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4dq2A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dq2A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dq2A02
5FD5A 3QSUA 1LNXA 4BHPA 4WWCA 4EQQA 1XCBA 4RAZA 3L9FA 2DZ9A 4XTVA 4L5IA 3BY7A 3R0JA 2CGHA 3ZMDA 1J59A 3ZP5A 2FF4A 2LKPA 2MH2A 1BBYA 2ODRC 4H2XA 3TEHB 1HKSA 4KT5C 4HAMA 1E24A 2IPQX 3HOSA 4M78F 2PMUA 4ENJA 3JB9I 4UP9A 4EMKB 4LFUA 3UGTA 2H27A 3F8FA 4J6XA 3B73A 2RA2A 4M7AE 2YLCA 1HSTA 5GMKi 2ZIOA 2OAZA 1Y96B 1USSA 4S04A 4UVAA 3MEXA 3E3VA 1LDDA 1WWXA 3GO5A 4EJTA 3SB2A 3SWNC 1Z05A 3TO6A 3V4GA 4A6EA 3T8RA 4U0YA 4ENKA 1KU7A 2L54A 2XAHA 2PN6A 4GO1A 3C18A 2P6TA 1FC3A 4IVNA 1L3LA 3NQOA 1H9TA 5GAOq 5L3CA 4B8XA 2RQPA 4KUMA 2VC0A 4K88A 2MLGA 3ROUA 3KFWX 3F21A 4KN7X 4S05A 2AXLA 2P8TA 2VT3A 2RHSB 1FZPB 5BMZA 5GAOp 3JW4A 2EK5A 4TVYA 2FBIA 2FNAA 1T2KA 2BV6A 2KIUA 4ENNA 4UVCA 1QF6A 2DQRA 1ZH5A 2E10A 4M75C 1OPCA 1BIBA 3BJUA 4U88A 3KP7A 1G3YA 1O7FA 1Z1DA 1Z6TA 3L09A 2A6HF 4PJOB 2ZIMA 1ZLJA 1U8RA 2RB6A 3K69A 2YR2A 5CYVA 2EJFA 3JTGA 4WJ3M 4AWXB 3ZPLA 2FXAA 2VE9A 2G9WA 1Y0UA 3BOQA 1CGPA 4M77A 4M6YA 5LGUA 4JQFA 5ICCA 3ZN1A 3JSOA 1ZYRF 5D5XB 3HHGA 3Q9SA 3OD1A 2O8XA 2IY5A 3WGHA 5GANj 2NS0A 1P4WA 2IRFG 1XSXA 1GXPA 3KZZA 3QRFF 3JCMQ 3N97A 1TNTA 3EFSA 3ISPA 3RIRA 3QUIA 4G6DA 2UXXA 3JCMV 3DEUA 1B9NA 1I1GA 2CG4A 2DKGA 4C92C 4YDQA 4KQEA 2QYOA 2QLZA 1IUYA 3IWFA 2W25A 2JPCA 3WTVC 4AIJA 3V8LA 3REOA 5IT9Z 5KNNA 1D8KA 4F7UF 4HVCA 2ELHA 3HRMA 2JTVA 1YS6A 4K2EA 3HSFA 3GXOA 1SMTA 4PJOG 3HTUA 4CH5A 3HRIA 1IN4A 1V3FA 3QU3A 2ALYB 5D6FA 3JCMf 2RC4A 3A32A 3WODF 2XKOA 5BS6A 4G84A 2HTJA 3HIFA 3T5XA 2RGVA 4YCWA 4BAYA 1G6NA 2DPUA 4PJOD 3ULQB 2O0YA 2F5EA 4HF2A 4IF4A 2EFNA 1FY7A 3IKTA 1W66A 2XRNA 5FFXA 2Z3YA 2RVCA 4M7DA 4XU0A 3ZN0A 2MLKA 1P2FA 4XSZF 3WTSC 3GUDA 1P4AA 1KU2A 5K5QA 3JB9G 1ODDA 4BQAA 5CVRA 5ERIA 1HKTA 2MC3A 4X5OA 5FFZA 1G5IA 1X55A 3MF1A 1ON2A 4AVPA 2B0LA 4Q5SF 2E7XA 3K2ZA 3I71A 1E1OA 1ADYA 1K7AA 1STZA 2ARUA 2VONA 3JCMh 4Y17A 4A53A 3VOEA 4YP0A 4PZJA 3LA3A 1FP1D 3J81Z 1W7PA 1J7KA 4CH4A 4A5NA 3I5UA 1FPQA 5ED4A 4O6JA 5GAMh 2XKPA 3F8MA 4P5OA 5LLQA 3R6SA 4Y91A 3FMSA 4A6DA 3JCMe 2ZCEA 3FX3A 5JI6A 1X2HA 1XGNA 2RKHA 4BHBA 2A6EF 4JBAA 2J3LA 3HSRA 3HFVA 4HBLA 1Z6RA 5GAMe 3R07A 3LWFA 1B76A 2AMCB 2PMFA 3W6JB 1UB9A 1RIOH 1BJAA 4BHCA 4HLYA 3SWNA 3JCMb 2FQ3A 2EFQA 3BROA 2EWNA 4M78B 2ZT7A 2E1NA 3C3WA 4ZH4F 4EMKC 2CSOA 1HW2A 4O5VA 4LK1F 3F8NA 1QE0A 3M4QA 1XMAA 3F8BA 5HLIA 4OIPF 4PHCA 4ZTUB 1RUOA 4OU0A 5GAN2 3K1NA 4TVAB 3IRRA 4HLXA 3HY1A 4IXAA 1LYLA 3E5QA 4XLNF 1YFHA 3ECOA 1K6OA 3SFZA 3MWMA 5I21A 4RGRA 4YROA 2M30A 1JJCB 1GXQA 2FU4A 2HQNA 4M75A 1BN5A 4M9XA 5GAOr 3HSBA 3GF2A 2QHTA 1VQZA 4C8QB 4P71C 1ON1A 5LJ5j 2E41A 4UVBA 2Q7HA 2LDUA 2CQKA 4EV0A 3A7RA 2PLYA 3IWZA 3K1PA 4N0BA 1OYYA 4M72A 1RUNA 3NEUA 4A5MA 4HQMA 2WV0A 2JPBA 3P8VA 3F3XA 1ZG3A 4IRIA 4A0YA 1RI7A 4Y15A 2ESNA 1FSEA 4NL3A 2P0LA 1UHMA 3RJPA 1EIYA 4CXFA 4CZZA 3CUQC 4MHGA 4M78E 3FMRA 5AIPA 3DFGA 3UFGA 5GAMd 2K4BA 3BPXA 1BC7C 1TTYA 2V9VA 3KP3A 2ACJA 4PJOC 4N9HA 4Q4ZF 3QO3A 1D3BA 3FWEA 1YS7A 4L9NA 4OOIA 3JCMg 4L5JA 4C92A 4LLLA 1BI0A 2E1CA 1C0AA 4RCBA 1U1SA 2ZINA 4EVIA 4YRFA 1ZG5A 2K02A 3LSSA 5GMKh 3EUHA 4P3OA 1QZYA 5GAMg 1SD5A 1B70A 4C8QG 2XV4S 5K5OA 3EYYA 3E9HA 2GIVA 5DEQA 3U9GA 4YCVA 2ESHA 2W85A 2LF8A 4IJAA 5GAN5 1EVKA 3ABUA 2I4NA 1EOVA 4HF1A 4C8QD 5JVTA 2ZTGA 2MD5A 1HSJA 3KLNA 1J5YA 3H3UA 3HYIA 1PUEE 3DPLC 4HDUA 5GAOl 3BWGA 3HY0A 3E6CC 1E2XA 4RS8A 4HWOA 1LNWA 1XSVA 1A04A 2W84A 3SZPA 5GAN6 3C7JA 3CTAA 2QHUA 5DUKA 5TRDA 2VOPA 3FMQA 4XRFA 4DNCA 4ZIBA 1NHAA 2LNBA 4U7BA 1TW2A 4KIBA 5FGMA 1IAWA 3A7AA 4P9FA 4TWAA 5GAN8 4PGHA 4ZYDA 3GX4X 1R58A 1S7AA 5JHUA 1B7YB 3IC7A 2W57A 1MGQA 2XUBA 3ML6A 4KIGA 2QQ9A 2ZO4A 5DCMB 5D4SA 3BDDA 4G85A 1JBMA 3I0TA 1ONVA 5DYMA 1K78A 1PDNC 2QTXA 4V2SA 3WTXC 5L3FA 1T39A 3AHUA 3BW1A 4XBFA 2CGPA 2F5FA 1IZ1A 3T0YA 5HS8A 3TEGA 2IW5A 2Y0MA 1WLEA 3HFZB 2ZJ2A 4U0VA 1U6GA 2BE5F 4YFNF 3ZQ7A 3I53A 3GW2A 2EFPA 2HR3A 4HA8A 4J15A 4RMFA 2DLLA 4K86A 2KRFA 1FLIA 3ICAA 4PG3A 2DAOA 1FT9A 2M8EA 2EJRA 2STWA 4M77F 4ZZLA 4CICA 4F7UE 2HDCA 4XTZA 2ZKZA 1HBXG 1F4KA 3V7RA 5L3EA 5CVIA 2KJCA 3D5LA 2IJLA 2C7IA 1S3JA 1ASYA 4M7AB 2Q5HA 2OQGA 1XB4A 1ADJA 1HTTA 2Q8KA 4PNOA 4EMKA 2HEOA 3DQVC 1R5GA 3ECHA 3KCCA 1WU7A 4IRHA 2YX7A 3IL2A 1R22A 1F9NA 2ZBKA 5D5UB 3W3SA 3I4PA 3PZCA 2RDPA 1QO0D 4HOBA 4OP0A 1F1ZA 1R36A 1KMMA 4BYYA 4H2WA 3RESA 5GANf 4ZYHA 4YRQA 2QENA 5E8IA 4BW9A 3HRTA 4OIRF 1EH8A 1KYWA 2BEOA 2ZZGA 2ISYA 4KMUX 4HWTA 4P71A 1J75A 2QHVA 3TOBA 1JRIA 2M1BA 1ZN2A 5LRSA 2Y48A 4L9VA 3SQNA 2CWEA 2RHSA 3VQVA 1AWCA 3GWZA 2JSCA 4WXHA 2ZMEA 3VEPA 5C53B 2QM3A 1ZG1A 2X4HA 3I54A 1C0WA 5HS9A 2QBYB 4PDKA 2JN0A 4HF0A 4M7AG 1MDMA 4M7DF 1FP2A 2NAZA 2L4AA 3U2RA 3CUQA 4LLNA 5HDNA 4X9DA 1REPC 5DY9A 2EV6A 1GHCA 4NQWA 5HLGA 4C8QC 1FWZA 4WCGA 3QPHA 3BJ6A 1XCVA 4ASNA 4M7AD 4H02A 3M9AA 3RF1A 4Q48A 4PJOA 4PGGA 1X3UA 5GANh 1I1SA 1USYC 2RHQB 3BP8A 3S2WA 1BM9A 2EAYA 1M8VA 1TW3A 1TLHB 2IA0A 2J5PA 3IKVA 1Z7MA 2A3SA 4LLGF 2Q7GA 2M45A 3GFJA 3HRSA 2BYVE 5GANe 4GGGA 3ZMSA 4G7OF 2Y90A 4L87A 1TQIA 3WE2A 4L9TA 2GZWA 1B4AA 3HXYA 2J3MA 4CH6A 2XIGA 1NJ1A 3LSTA 2DO7A 4YRLA 1LOJA 5D5WB 3LQRA 4F7ZA 4AIHA 3WTYC 2DXTA 5A2QK 1PP7U 3HTSB 1G51A 3I7FA 4RGUA 2EV0A 5ILUA 4MMLA 2LF7A 3WQZA 1R5HA 1Z7UA 1YCYA 5ICGA 1R1UA 2XTIA 1FBQA 2RD1A 3KP2A 3M4PA 2XGTA 2J5OA 4RB2C 4KMFA 5FO5A 4YRNA 1H4TA 4TVWA 2HFHA 2VC8A 2YHTA 3P8TA 5CAIA 2ALYA 3K9TA 4P74C 3TKYA 3DKWA 2DFIA 1EV7A 5GAN7 2AKWA 3U1DA 1N9WA 3FB9A 4L0ZB 3LFKA 4CS4A 4ESFA 1YGBA 3TUPA 4YG2F 3N4MA 1X54A 4WXCA 3OV8A 4R8HA 3VQXA 1U5TB 4E70A 1B34B 3IRQA 2K7LA 5HGQA 6PAXA 2R7DA 5LJ3j 3OOPA 4M75F 4AH6A 5K1YA 1PP8F 4KN4X 2ZNZA 4RDXA 4XU3A 1P4XA 4XEMA 5F1RA 2VXEA 3CDHA 1I5LA 2HYGD 2P5VA 5F5WA 2HKXA 4U7DA 1KGSA 3EETA 2QQAA 2H6BA 3MZHA 4DPGA 2OD5A 1TQPA 2Q2EA 2ISZA 1NJ2A 2Y75A 2CO5A 5E8GA 2O61A 3F6OA 2O03A 1KA8A 4DQ2A 5HVQC 3V8KA 3P7NA 2CJBA 4LK0F 5LJ5f 1TBXA 2STTA 5DUIA 4BH9A 4YCUA 5TJJA 1WI9A 1MKMA 4EM1A 4HQEA 5GANg 1R1TA 2EV5A 2WC2A 2ETHA 3LC0A 1IL2A 4HX8A 1LDKB 2GQQA 5F64A 3ZMTA 5LHHA 4C92F 3IKLA 2AMCA 2Q0OA 3E9IA 3PCOB 2DZCA 2HTSA 1KQ0A 4IHSA 1D5VA 2ZR3A 2VODA 4QVDA 3FXUA 2VOOA 1B6AA 2HZTA 4HV5A 4HX4A 1J0RA 4M6XA 3HXVA 2D1HA 2R3SA 3RI4A 4CGZA 4M7AC 3L4GB 1H4SA 1QZZA 1Z7NA 3WGIA 2ZZFA 1N9SA 1KOGA 3I64A 4ZZDA 4ZYGA 3JB9D 4BNCA 1YYVA 3R0AA 5L3DA 1YW9A 2P6SA 2A61A 1E17A 1ZARA 3J80K 2GAUA 4WJ4A 2E64A 2IP2A 4YIIA 1KQ1A 3KFUA 1O57A 1FBUA 1Z9CA 1V4RA 3WU0A 3F72A 3GFMA 2OZUA 2YLBA 3HHHA 5BOXA 1JJCA 2IA2A 2IA1A 1RNLA 5K1XA 3SXYA 1RIQA 2E1HA 3T8TA 4C8QA 3NETA 2L02A 3RUXA 5HOOA 3LA2A 2QWWA 1EVLA 1SERA 1ZHFA 1W5TA 4I7HA 1SFUA 3JB9H 1USTA 1USYA 3A5ZA 3JAMZ 1LQ1A 2GXGA 4L18B 3IG2A 2QHSA 4LD5A 2NNYA 5LBQA 4M77E 4HV6A 3DPTA 1SMYF 1BOAA 4N0AC 1QGPA 4UP7A 4YRSA 3COAC 2PEXA 2FRHA 1S6LA 3I59A 3BJOA 4FHTA 2DT5A 2V1UA 2D2WA 1I6XA 1WYDA 3KLOA 4XTWA 2EFOA 1YFSA 5FD6A 3L00A 5HLHA 4P9UA 4M74A 2V79A 2OBPA 1U78A 5ILSA 2O3FA 3KP6A 4EJVA 4J6WA 4OIQF 3DP7A 4YRRA 4X9CA 2I4OA 3GIBA 2XHKA 5K5RA 3MZYA 5E1XA 1HW5A 1W7PB 1SD4A 3QAHA 1DPUA 3L1AA 1O3RA 2HYFA 2EL9A 2ZT8A 4D0PA 1YB3A 3V7CA 2ZR2A 4YFXF 4P74A 2ZXFA 2KKOA 4H2VA 1DP7P 3LA7A 3CUOA 4UNOA 3JCMd 4AIKA 4LJZF 4M78G 4H0EA 1BI1A 3FM5A 2VBWA 4P3NA 3HXUA 5JFRA 1S7OA 4M7DE 4XTYA 1FYLA 4BXUA 3SWNB 1VTNC 11ASA 4M78D 1JE8A 2OQRA 1S29A 3JCMc 3E6MA 2ZT5A 5GMKl 1D3YA 4NOYA 3VB2A 4UP8A 4WK8F 3JCMP 4KR3A 3WGGA 1Q1HA 3RL6A 2LSOA 3PFIA 1ZREA 5HS7A 3NELA 4HT8A 4KNYA 3HXWA 1BI3A 4ENMA 3A74A 3HRUA 3KE2A 4XTUA 1U5TC 3CLOA 2HGCA 4I01A 2FMYA 4HWRA 1BBWA 2ADUA 3F8CA 2L4MA 1IXCA 2D45A 1SD6A 5GMKe 1WNLA 1LDJA 3D0SA 3GFIA 3VQYA 4YIFA 1BC8C 5IT9K 1H4VB 2DQ3A 3HFZA 1X56A 2V1DA 2FE3A 1R23A 4I0AA 4CO8A 4PJOF 1BIAA 3E5XA 5DD4A 2FOKA 4A2UA 5L3GA 4GCVA 1XD7A 4G8XA 4F7UB 4YRCA 4TTVA 4RQEA 3E97A 1T98A 5AONA 4M71A 5CJ9A 1WSUA 1J2XA 3MQ0A 3K1MA 1G3WA 3FF5A 2M5WA 1MGTA 5J8FA 4RAYA 2L3DA 3E5UA 2DI3A 4M7AA 4HYEA 1KU3A 3TGNA 1SD7A 1RZ4A 5IT3A 1IXSB 2GXBA 1BI2A 1HW1A 2C6YA 3FHZA 4ESJA 4I02A 1XDSA 4R1HA 1ASZA 4A0ZA 1JHHA 3TQNA 4YREA 3P9CA 3FIFA 3HXXA 4EJOA 4AD9A 4IHTA 4LG0A 2DQLA 4JRKA 1D8JA 2JRTA 1B70B 1T38A 2PG4A 5BQTA 1HC7A 3BDUA 4M75E 4I0BA 4NL2A 4OMZA 4KYWA 1P6RA 4H2TA 4HWPA 1T0FA 3J81K 3GZ6A 5F6FA 3KEOA 2ZCWA 4HW0A 3Q5FA 2Z99A 4F7UG 3QP6A 1WKMA 3RYRA 3MCZA 2P5LC 3MF2A 4YRKA 3A7UA 1U3EM 5GAOm 4NHJA 2JT1A 2EB7A 1ULYA 4G6QA 3TEHA 1NJ8A 3GLXA 2O6GE 4N0AA 2MBFA 1ZGJA 2QBYA 5LGNA 1YLFA 4O3MA 1SAXA 1PYSB 3M7GA 3REXA 1IRFA 3FZVA 1I5ZA 1DPRA 1H641 4OLFA 4LGWA 5LEKA 1FYFA 3IHUA 4P55A 1Y96A 1MZBA 2NNNA 2FMLA 3PQKA 4C92E 3RTRA 3BY6A 4UV8A 3F22A 4MTEA 1O3QA 4M9ZA 2FB7A 4XSXF 4YRTA 1K78B 2DJZA 4M78C 2D1VA 2I2LA 4H2UA 1G3SA 2Z5UA 3ERED 1NJ6A 2CW0F 5LJ3f 5CVJA 4TQDA 4WF2A 1CF7B 2VN2A 1IXRC 1KYZA 3QPTA 3M4GA 3W6KB 5LGTA 1O7LA 1QNTA 2DXUA 3GVAA 1NNHA 5E18F 2FA5A 5L3BA 5D6EA 2VXFA 4P75C 4WI1A 4G94A 2F5DA 1OR7A 2EJGA 3DV8A 3JTHA 4P3PA 3LAJA 3RYPA 3T1BA 3H3ZA 4OIOF 5BPIA 2OU2A 3ZMVA 5D8LB 5GAN4 1AOYA 2ZNJA 3G3ZA 1KQ2A 1I27A 5LJ3h 5DD8A 2BBYA 2TDXA 1I8FA 4OINF 2CJ9A 3RDIA 2PFBA 1IN6A 3GFLA 1B1BA 4YFKF 1IF1A 2QUFA 4ON0A 4J5YA 5LEJA 3GZ5A 3B02A 3F23A 4QWQA 3NEMA 1R7JA 4EMHA 5LJ3e 1U5TA 5BPDA 1B34A 3JCMW 2XVCA 1ZRCA 1SFXA 4H2SA 3BPVA 3DSQA 4CS2A 1H9GA 4G7HF 3VFZA 1MJ9A 4OMYA 4C8QF 5H6QA 2HS5A 2XASA 4EGZA 5LRRA 4LB6B 1HXDA 2M87A 1XSDA 4NCXA 4CH3A 2G7UA 1XDUA 4P72C 5LHGA 4YYEA 5ELOA 2ZMEB 3TO7A 4H2XB 4LB5A 2A5YB 3ABTA 3M8EA 1KQ8A 2CYYA 5D8KB 2H09A 1EH7A 3HFOA 1E1TA 1MDMB 1SESA 2YX4A 3CO7C 4P73C 3RKYA 3IKMB 2OZ6A 3CUQB 3EYIA 2HWVA 5J8CA 1WQ2A 2DTOA 4TV7A 1O3TA 1FOKA 2HKOA 2RNJA 5D4RA 2E3CA 4XTXA 3SHFA 4GYGA 2JZYA 1FYMA 2GWRA 2DU5A 3HRKA 4WXDA 5DCFA 2UWMA 1XGSA 2Q7EA 1W5SA 4UPAA 3REUA 4B09A 3UH0A 3CMQA 3M8FA 3PCOA 2DK8A 2HQRA 1QPMA 3KP5A 2K27A 4KIFA 3KP4A 1UFMA 4A12A 5CVVA 2CIMA 2MA3A 4GXOA 3JCMJ 1EFWA 3L4GA 3HUGA 5GANd 3SZTA 3QHSA 4L0YB 3VU3C 4HX7A 2VBXA 2VBZA 3E6BA 3RKWA 3RACA 4ETSA 5LJ3d 3R4KA 1DDNA 1O3SA 1MD0A 1K79A 3CO6C 4Z2YA 3RPUA 1OKRA 1ZRFA 3P9IA 1GGMA 2CJAA 1ZRDA 3DF8A 4Q15A 3HTZA 1MJBA 2E65A 3P9KA 1F5TA 2G4CA 2FBKA 3EQLF 3TO9A 5E1ZB 4EM0B 1U1TA 3QTCA 3GEZA 4E51A 3ZMZA 3WTWC 1OMIA 2XAJA 5LJ3g 4PJOE 4CDGA 1JGSA 2Z9OA 1KQ9A 4RGXA 4M77B 1UCRA 2AKWB 2DQ0A 1LJ9A 3E6DA 1FSHA 5CLSA 5GAMf 4A0XA 12ASA 2IY5B 1YFTA 2COMA 1YFRA 5HDKA 4M78A 4YRJA 5H6RA 2FNPA 4K87A 1G3TA 2MH9A 3LSQA 1YG2A 1KU9A 2FEZA 2YPRA 4YRIA 3O3KA 1IN8A 3MEYA 1M5Q1 4Y13A 1IN5A 4CHUA 3IALA 3BFMA 4MTDA 1XMKA 1H0MA 4UUVA 5EEGA 1BBUA 1B59A 4HDVA 4KICA 3LQQA 1FBSA 5LJ5h 4UXNA 3RPQA 3A31A 4MEXF 4TVAA 3RERA 1N9RA 1LEBA 2KIFA 4P75A 5C52B 4UHTA 2K86A 4FX0A 5GAN3 5DDGA 2F2EA 2VT2A 5J6XA 4Q6GA 3VODA 2DEQA 2XAGA 4YRPA 4QLCU 5LJ5e 1YIOA 1G5HA 5C51B 4EX5A 1B9MA 4XU1A 4GYIA 1ZLKA 5FB2A 2NRAC 2IT0A 4H2YA 2DTIA 4M77G 4M7AF 3UGQA 4MMKA 5K1PA 3HXZA 3P8YA 5JR3A 2RV8A 2P7VB 1P92A 2L01A 3F6VA 5KK1A 4RB1A 5CVUA 4M77D 4M7DB 1E22A 2HOEA 3NENA 3FXQA 4NB5A 2P7CB 1YW8A 2PQ8A 2EJ9A 1R00A 3Q9VA 1EQRA 5FLXZ 2FYKA 5D5VB 5ICFA 3HSEA 1H4QA 2ZXJA 3VQWA 1QBJA 3WTZA 2XAQA 1ATIA 1W4MA 2ARTA 2ZT6A 2V6CA 3R61A 2ZFWA 2A69F 3O2PE 2P5IA 3G1ZA 2PJPA 5ICEA 2V1XA 1FNNA 4MEYF 4PCQA 1X2GA 1SRYA 1B8AA 1YW7A 1WQ7A 4TQFA 2DK5A 4EJWA 4P72A 5E1WA 5LHIA 2CFXA 5EEHA 4U0WA 2QVOA 2I4MA 3H92A 1NYQA 2DU7A 3WU1B 3QO5A 2ZNYA 4L9JA 3KEQA 4P73A 4RB0A 3LAPA 3EDPA 3TDZC 4UV9A 3KZYA 3M1EA 4FX4A 2H94A 2OA4A 3BJAA 4WX9A 5GAOn 4M7DG 3FM3A 1J5WA 2DW4A 5GAMj 4YRMA 2DTHA 5LJ5d 3O6BB 1UHWA 1LVAA 1SETA 3QO7A 2UXNA 3NRVA 2G7HA 2I4LA 4F7UA 1WRJA 4M7DD 2VBYA 4RQFA 3FJPA 2XAFA 1ZGAA 1YQAA 1I81A 3I59B 4HWSA 3INZA 3WTTC 4MNUA 1X01A 4JRIA 1SFEA 4I09A 2Q5IA 2DDZA 3L2CA 2HNIA 1OYWA 4ZYEA 3JSPA 5KVRA 1HQCA 4EJUA 4A54A 1B7YA 5LJ5g 4RGSA 1J9IA 2RN7A 2PBIA 3L7WA 3TOAA 3MFKA 1YO5C 5E17F 4J6YA 4KR2A 2EA2A 3V8JA 5DCMA 2IVMA 1R1VA 3K0LA 3QP5A 1OYIA 2F5CA 2C8MA 1L0WA 3WTUC 1W7PD 3TDUC 4JK1X 3C1DA 4CS3A 4EM2A 2VE8A 1MJAA 2DTRA 2P5KA 2RM4A 4M75B 2ODRD 4HT9A 3RGLA 1KMNA 4M9SA 2XGXA 4MQVA 5A2QZ 3R60A 2DU9A 3QU6A 4EGYA 1IRGA 3BZ6A 1FYKA 4XEOA 3HFNA 4C8QE 3A5YA 2UZKA 2K57A 4MQ9F 2DVEA 1QQIA 3RKXA 4XU2A 3FXRA 2NYXA 3JCMX 4CYDA 4G9YA 1EIYB 1G4DA 1U2WA 4R79A 3PQJA 2PI0A 3WG9A 4KFCA 4JUVA 4ZTZB 1NJ5A 5DV5A 2QQBA 3L2ZA 1GVJA 1L0OC 3ZMUA 1JXSA 3AAFA 2WTEA 4XQ3A 1PYSA 4KA4A 4EO4A 3CJNA 2ARSA 2YU3A 1D3BB 4LNSA 2FSWA 5H20A 3JB9F 1FX7A 4C92B 5GMKm 2H6CA 5E3IA 5ELNA 4M77C 4IPAA 4M75G 1T6SA 1XN7A 4LMYA 4ESBA 4O2DA 3VBBA 1EH6A 3KETA 3QO8A 1DUXC 3JB9J 4RB3C 4M75D 2W24A 1WPYA 3ELKA 4QVCA 1CF7A 5E20A 2FBHA 3J7AO 5GMKj 1ZAOA 3EFRA 4JLIA 2BGCA 1LJOA 4KDPA 1WQWA 1HKQA 2E5AA 1IW7F 2VXZA 2QZ8A 4BWAA 1Z91A 2WWYA 4Q47A 1S8NA 1I4K1 4EMSA 2E7WA 1TNSA 1JHFA 3QOPA 5ILVA 2K4JA 3HOTA 4IRGA 3WE3A 2EFWA 3JAMK 1IN7A 2X0LA 2ZNIA 2YSRA 4C92G 2GA1A 2A68F 1HK9A 2RHQA 3QNEA 1LEAA 2P4WA 3ERRA 3PGGA 2Z33A 5HDGA 1NYRA 4G7ZF 4HZFA 4RCCA 3V7SA 3G73A 4C92D 3I58A 5FLXK 2GA2A 2EA4A 3GYHX 2PMHA 4M7DC 2KJBA 1XGMA 1LB2A 4YRGA 2DPDA 4I2OA 4I98B 4M73A 2R7FA 4EMGA 4LG0B 4YPFA 2ZGWA 1YTYA 3DXJF 1XGOA 2DBBA 4P96A 4MGRA 4N9IA 2AS5F 4XLPF 2VC1A 2A07F 1TH7A 1TQMA 5AIQA 2ZZEA 3J80Z 3MAJA 4FT8A 2XROA 2KIMA 2PMEA
chains in the Genus database with same CATH superfamily
1LNXA 4BHPA 2KVQG 4WWCA 4OB3B 1VQ9A 1D0ZA 4C2UA 4ZNXA 3O5ZA 4TVRA 3BY7A 2O5RA 1OCOH 2FF4A 3CCJT 2MH2A 2E35A 1BBYA 2B9SA 3TMOA 3JRZA 1CKAA 1S1NA 1E24A 5CKTA 3HOSA 4M78F 5DS9A 1UDLA 3MKWB 4UP9A 5DM6F 4EMKB 2WA0A 1SHGA 2YLCA 1HDDC 2OF7A 2VKDA 3RSNA 1USSA 1UZCA 1YJNQ 2LK2A 1UE9A 4S04A 1OCTC 3EPZA 4DW6A 2Y0SN 4A3DJ 4A6EA 3T8RA 4U0YA 4ENKA 4C2TA 2OAUA 5IXBA 3C18A 1KC8U 2P6TA 2KP6A 3NQOA 2MABA 1H9TA 3M0PA 5GAOq 2VC0A 3NARA 4OF1A 2CW7A 4EPCA 1VQOT 2X9DA 2TRTA 2VJJA 4TVYA 2JA2A 1M30A 1BIBA 1JTXA 1TWBA 3L09A 2EYXA 2BW3B 1ZLJA 2R4GA 1U8RA 2X4JA 3TW6A 2CDTA 1K9MR 1CGPA 4M6YA 3ZN1A 3HHGA 1PWTA 3VWBA 3OMCA 3HL8A 3VRZA 2MFZA 3S15J 3N97A 3I56A 4IHYA 3I55T 2UXXA 1B9NA 2CG4A 4C92C 4YDQA 2BZYA 3CC7I 2W25A 3WTVC 4AIJA 1OCZH 3BG7A 1LUJB 3LYIA 1V1CA 1AWXA 1VQ4T 5EG0A 1RI9A 3MPUB 1YS6A 3ZEHA 3GXOA 3TCJA 2BOLA 3HRIA 1V3FA 3QU3A 4FYXB 2ALYB 2AT1B 2QASA 3T5XA 2VQGA 2H1LA 2CKKA 4PJOD 2LTOA 2O0YA 4C3JJ 2E2IJ 2CSQA 2GTJA 1SRMA 4D8KA 5EJCA 2VYTA 2RHXA 1ODDA 3MF1A 1ON2A 3VRYA 4AVPA 2VKVA 1Y71A 4KITB 4Q5SF 3ZXSA 1K7AA 3JCMh 4ANJA 3J81Z 2DL7A 3UT1A 2Q2EB 2A28A 1VQ7I 1GBRA 5I2MA 5ED4A 3FMSA 4GLMA 1TSFA 1X19A 3FX3A 1WVRA 1X6BA 2MWOA 3ZQQA 1K83J 2FPEA 2XGCA 3M55A 2J3LA 3MEUA 3R07A 2EQUA 4BXXJ 2L9SA 1BJAA 2X9HA 3H9JA 3SWNA 4BY7J 2EFQA 2UV1A 2EWNA 1GUUA 2GOMA 2IIMA 1QHGA 4C0ZA 1XMAA 3F8BA 1RLPC 4ZTUB 1YRNA 2K79A 4OU0A 5GAN2 4DBRA 1GBQA 1SKUB 4DA4A 3CPFA 3OS1A 4OMMA 5I21A 4YROA 1JJCB 2HQNA 4BQQA 4M75A 3CCUA 3GF2A 4C8QB 4P71C 2I0NA 3FBIB 4MDWA 2E41A 2IGMA 4EV0A 1SVMA 1M1KC 2PLYA 1RUNA 2ZMEC 2KIQA 5KAIC 3F3XA 2FVUA 1ZG3A 2N8GA 3HPHA 1KQSP 2M7BA 1Q7YC 5AIPA 3DFGA 3E1SA 3E7LA 1TTYA 2X1CA 2KT1A 1AU7A 3KP3A 4PJOC 1BU1A 2I8DA 1A36A 3I9QA 3X26B 3FWEA 4L9NA 2OI3A 2PX9A 4OOIA 4AUXA 1VQKA 2AXTC 1U1SA 1T33A 2JUCA 1D0XA 5GMKh 2YS9A 3EUHA 1SD5A 1B70A 1QVPA 4C8QG 2LVSA 2F2VA 4B6MA 2GIVA 1AZEA 2HSEB 4YCVA 1BCMA 3M54A 3ASKA 2LF8A 5J1RA 1MV0B 3S6WA 1EOVA 1KSWA 3I4MJ 2ZTGA 3F70A 1HSJA 3KLNA 4D5FA 3OR2C 3HYIA 3DPLC 4HDUA 5GAOl 5GPCA 1POGA 3CCET 3E6CC 4RS8A 1CKBA 4HWOA 1S9HA 3SZPA 2R93J 2QHUA 3U1KA 4XRFA 3EG1A 4E6KG 4D6WA 2MD0A 4U7BA 4KIBA 3K70D 3LX7A 2LC4A 4AYBA 1WA7A 3VUBA 3LFUA 4RAGA 2LJ1A 1MGQA 5DCMB 2NS6A 4G85A 1V29B 1PDNC 1K78A 2ZZDA 4V2SA 5L3FA 3AHUA 3U21A 3BW1A 3TEEA 3T0YA 3VSLA 3ESWB 1FOYA 3TEGA 2Y0MA 1WLEA 3HFZB 2ZJ2A 4U0VA 2BE5F 2FX0A 4K11A 3ZQ7A 2R58A 4J15A 1LE8B 4RMFA 2DLLA 4K86A 2KRFA 1OU9A 2K7AA 2LT4A 2ED1A 2STWA 4ZZLA 4F7UE 1HBXG 3V7RA 2KJCA 2C7IA 5E3OA 1WI3A 1ADJA 1HTTA 4X1EA 2Q8KA 2R5ZB 1ZSZA 4PNOA 3KIOA 3M8JA 3DQVC 2VI6A 1R5GA 2VB6A 2YX7A 2D8HA 4B9XA 3I4PA 3PZCA 4OP0A 5B66C 2XB5A 5EF6A 1H3HA 1FOWA 3RESA 2NOJB 1VQLQ 5E8IA 3HRTA 1EH8A 2DTZA 1FOXA 1VQPQ 3JV3A 4HWTA 5FU6C 1GVDA 2WB1A 4N4OB 1JI8A 1H8KA 2DF6A 1MMAA 5A2QE 3OYEA 3VEPA 2QM3A 1TT5B 1C0WA 5HS9A 2QBYB 4A4FA 4PDKA 3ZQGA 2VV5A 4KT0E 1FMKA 3REBB 2P0QA 2E71A 2GF7A 3U2RA 5HDNA 2CP0A 1GHCA 5HLGA 2WSFE 1FWZA 4H02A 2F4MB 3A1PA 1WZ2A 2IG0A 4PGGA 3GTQJ 4A4EA 5I11A 1TUDA 1M8VA 1IRZA 1TW3A 1TLHB 3MEVA 4OB1B 2HDWA 2Q7GA 3GFJA 3HRSA 4JJCA 4XOTA 5GANe 3K70C 1IGUA 5ECAA 2W4SA 2J3MA 3HXYA 2XIGA 1RUWA 3LSTA 1TT0A 3HC7A 5CPRB 4LVLA 4F7ZA 3WTYC 2W1OA 2VQCA 3I7FA 2EV0A 1X43A 2MWPA 1ETQA 2LF7A 3OYBA 5ICGA 3MJXA 3M4PA 3BR5A 3OYJA 2XGTA 2J5OA 3L2UA 5FO5A 4YRNA 5CAIA 3TKYA 2DFIA 3V42A 1YHQQ 1R8OB 3FB9A 2HOSA 4CS4A 4ESFA 1M1EB 1VQNQ 4XN3A 2QSGX 5LJ3j 4HNTA 4XMYA 1M90C 4C5GA 3BTCA 4CA0A 4KN4X 3CCLT 2I10A 4XEMA 2CH4A 1BR2A 1I5LA 2EYZA 1DGWY 2HL3A 3OSSC 2P5VA 3CCMQ 3EG3A 5F5WA 2H6BA 3MZHA 2SEMA 3OBYA 3ASNH 3FIWA 4RA2A 2O4XA 1R0BG 2CO5A 5E8GA 2O03A 3V8KA 3P7NA 4J83A 4KH1B 3JRFA 4LK0F 4ZC3A 2J7IA 1FMVA 2ETHA 4PJMA 3E9IA 1RKTA 1NPRA 4R56A 1JJ8C 3OA6A 2OCCH 2G3RA 4OB0B 1D5VA 4QVDA 2VOOA 3CC7A 3OBWA 2P84A 2HZTA 2RREA 4HV5A 4HX4A 4BI4A 2DA1A 3CC4I 4CGZA 3L4GB 3H0DA 3HPGA 1Z7NA 5D7UA 1KOGA 5FU7B 4BNCA 4HSTA 1YYVA 3R0AA 5L3DA 2V8JA 1YW9A 1YJ9I 1RL2A 4BBSJ 1E17A 3VDXA 2WSEE 1MMDA 2Y2ZA 2EKHA 3GBQA 4GDFA 1XNIA 3KFUA 2L9NA 2BVMA 2V8IA 5J3BA 3S2HJ 1O57A 2O31A 4KISA 2VPLA 3WU0A 3GFMA 2PMZN 3HHHA 2RN8A 4B9WA 1JUSA 2IA1A 1RNLA 2E1OA 1RIQA 1UTIA 3RUXA 1XG1A 4ZTFA 1VQOI 4C2MJ 1USTA 3A5ZA 3TP0A 5HCKA 3TSWA 4CUGA 4LD5A 4LIVA 4C3IJ 4XRSG 2DM1A 1VIFA 4N0AC 4UP7A 1AT1B 3COAC 2FRHA 3I59A 1AWWA 2DT5A 2D2WA 1WJ5A 1VQMT 1YHQA 1U8BA 2BZTA 3KLOA 4I76A 1VQ7A 2EFOA 3RDVA 1UECA 5FD6A 3S1NJ 1GRIA 4ME7A 3EUKL 1VQNA 2DYIA 4B47A 2RK2A 1YIJI 4PL6A 4XAXB 1SD4A 2NVQJ 4ATOA 5IT9E 2ZR2A 4YFXF 1AWJA 2A6TA 1DP7P 4UNOA 1Z9QA 3U23A 1OR7C 1BI1A 1D1AA 1HJDA 1H89C 2JSPA 1GV2A 4BXUA 3SWNB 1VTNC 1W36D 3EG0A 2KFDA 1XTDA 4RMOA 1R6RA 4M3FA 2C0IA 1EF4A 1WH5A 2CP7A 1K9AA 2J6FA 5KAFC 3NELA 5KCMA 4XTUA 4GBQA 2JMAA 4X6AJ 1BBWA 2ADUA 3F8CA 2L4MA 4J8OA 2EFIA 1XMXA 3TVTA 3D0SA 3GFIA 1MSFC 4YIFA 1MHNA 1X56A 2FE3A 2LFBA 4I0AA 3M58A 3E5XA 1V5EA 2VUMJ 4I6ZA 4G8XA 2ZPEB 4M71A 2CYZB 3CESA 1AHDP 1J2XA 1JUPA 4JYKA 2XPVA 4JJBA 2RJEA 2M5WA 4HYEA 2DIQA 2LH9A 2HQEA 3EGXB 1SD7A 1IXSB 1BI2A 2JMWA 5D6YA 4I02A 4A93J 3ASOH 2DMTA 3BQYA 2K5CA 2M9HA 4QVZA 4IHTA 2L89A 1NJIC 2DQLA 4JRKA 4B43A 1B70B 1T38A 4NL2A 4M75E 1VYTA 2ECZA 4PLIA 1P6RA 1ERDA 1XPXA 4HW0A 2KL4A 3CMMA 1V55H 1WKMA 1WHUA 4NHJA 2JT1A 2EB7A 3TEHA 1BYMA 1YLFA 5IYCJ 2CRGA 2ATCB 1KC8R 2DA6A 1I5ZA 1H641 3LGLA 4OLFA 4FQGA 3CBMA 5LEKA 1FYFA 2K9SA 3G71I 4GLKA 1MZBA 1A35A 3NTIA 4UV8A 3LW5E 1O3QA 2KNBB 2XDDA 4E2FB 3W2VA 1K78B 1W36C 1VA7A 2HQHA 4X34A 3QZ9B 4TQDA 5LJ3f 3BG5A 4WF2A 2VN2A 4FYWB 2HXOA 2JZ2A 1NNHA 3FISA 1FMWA 2FA5A 5L3BA 2DODA 1NYGA 2EJGA 3CMAT 2OU2A 1TWGJ 1U5SA 2WV1A 3SEQA 2G6FX 3G3ZA 2YWWA 2LZ6B 3OMGA 4X0GA 1O9SA 3AG3H 2K3XA 1PD0A 1GXIE 5IYDJ 2TDXA 1N8RC 5J4YA 1I8FA 1T56A 2LMJA 2WACA 3RDIA 2PFBA 1IN6A 2M2EA 3CCVT 4C5HA 3GZ5A 3B02A 5C0MA 1ZKGA 1U5TA 2LJ3A 1SFXA 1NPPA 1VQ5I 4H2SA 3OQ5A 1G5VA 3HOYJ 3FLGA 1H9GA 4W97A 3G1MA 4C8QF 5H6QA 2HS5A 4F55A 2XASA 1HYOA 4LB6B 2M87A 4NCXA 4PKCC 3ZQIA 2RJCA 1XDUA 2HQXA 5ELOA 3CCJQ 2HD0A 3RQ4A 4OWRB 2MMPA 2R57A 1EH7A 1E1TA 2RQWA 3EFOB 2HWVA 3NGPA 1UJ0A 2CUBA 1QQJA 2K9GA 1FOKA 2D6FA 3CF2A 5D4RA 2RJFA 4XTXA 4GYGA 2JZYA 2DU5A 3HRKA 5DCFA 3KPHA 3REUA 3PCOA 1QPMA 2K27A 1UFMA 4A12A 3S32A 1NM7A 4E7LA 1VQOQ 1EFWA 4FETA 4HX7A 2VBZA 5CKHA 2K4YA 1RAAB 2K9NA 1K79A 3S3MA 3IQLA 1ZRFA 1GGMA 3DTIA 1YITI 1BBZA 4ZTJA 3HTZA 1F5TA 4CH7A 3TO9A 5E1ZB 3UWNA 3GEZA 1FXXA 2XAJA 4IUPA 1APLC 1RAEB 1Z3XA 2IS1A 1KQ9A 4M77B 2DQ0A 2IEKA 4A0XA 2IY5B 1ACMB 4M78A 4Z8AA 2FNPA 3MN2A 5I2SA 4Y13A 2ESWA 3BFMA 3I55Q 2E3HA 4HDVA 5LJ5h 1YJWI 1FBSA 1NYFA 4UXNA 1XQHA 1QU3A 4U87A 3RERA 2HNHA 5C52B 2KDOA 2TCTA 5M5WJ 3QYBA 4FX0A 4I99C 1VQ4Q 3OYMA 3HOVJ 2VT2A 9ANTA 3VODA 2F5KA 2XAGA 2O4XB 3SDBA 2LKXA 2HPIA 1WHJA 4XU1A 2JVGA 3PE0A 4M77G 2JNGA 3X20B 2CMPA 2MPXC 1UHSA 3CC4A 2L5QA 2RV8A 3BLYA 2BY2A 2F1LA 4YIRX 5KK1A 3F6VA 2B7EA 3NENA 2LY2A 1YW8A 4HG2A 1R00A 5ICFA 1H4QA 1Y8QB 3DKXA 2MG4A 2ARTA 2AKLA 2ZT6A 2ZFWA 2EGEA 4CCKA 4GRIA 3G1ZA 4FASD 4TQFA 2DK5A 2GM4A 2BTTA 5E1WA 3HPWA 5EEHA 1VQOA 4U0WA 2Y30A 4L5EA 2I4MA 5E79C 4XIDA 3H1CA 4L9JA 2LCSA 1ZA1B 1SFKA 4E7JA 3KZYA 2QEXT 2OA4A 3BJAA 4KGXB 1OJLA 2DW4A 4C5IA 4AYBN 1W5CC 5LJ5d 3A5ZB 3ABLH 1LVAA 2QQSA 2QQRA 3QO7A 2OTLI 2G7HA 1WRJA 4DEXA 2VQLA 3KEYA 3I59B 3VYTB 2FHDA 2HNIA 1QVFS 1H3ZA 1D5YA 3JSPA 2CREA 1HQCA 4BE1A 1J9IA 3WVDB 2E5ZA 4R55A 5E17F 4J6YA 2RHZA 4KR2A 3V8JA 1NEBA 2IVMA 4M3DA 2OJED 2R92J 2F5CA 3C1DA 2XSDC 4UY8I 4CS3A 2P5KA 2XICA 2ODRD 4M9SA 3UA6A 2HDAA 4IIMA 3G71Q 4EGYA 1FYKA 3HFNA 1VQ4A 2K57A 4MQ9F 2DVEA 2RHIA 3RKXA 2L9VA 2F2XA 3FXRA 1WHLA 5KHDA 1EIYB 2X4WA 4LDVA 3OS2A 4ZTZB 4C0DC 4LE9A 1ABOA 3L2ZA 2JA5J 3JAME 2H3JA 4OB2B 4XQ3A 4EO4A 2ARSA 1D3BB 2DPPB 1O4XA 1RAHB 5H20A 4J01A 3JB9F 1WHGA 3M3YJ 1M1GA 2WB1N 2H6CA 3VS7A 3ZRGA 1XN7A 2CH4W 3CD6I 2LRQA 1EH6A 2LLKA 4BQOA 2HL5C 5GTHC 4M75D 4LVJA 2X1EA 1RETA 5FU7C 3FDRA 2LQKA 4QVCA 1PC0A 3J7AO 1UEBA 3EFRA 1LJOA 4KDPA 5LL6S 3CCEQ 1IW7F 4BWAA 2R7XA 4ZDPA 4Q47A 5HKCA 2IXSA 2E3IA 2E7WA 1JHFA 3QOPA 3HOTA 2X3XD 3JRDA 1IN7A 1D1CA 3MP1A 2CQXA 1HK9A 1CSKA 4PFPA 1LEAA 2P4WA 3LGFA 4FISA 4RCCA 4G7ZF 2CV0A 1T3SA 2L0KA 3H0FA 1PD1A 5KE2A 2CZ7B 3GYHX 5CQXA 1NBEB 2LMDA 1LB2A 4YRGA 3OIQA 2R7FA 1XGOA 4MGRA 4N9IA 4XLPF 1TH7A 2CUZA 5AIQA 2ZZEA 2EPDA 3J80Z 3OL4A 1NE8A 2XK0A 3A01A 4RAZA 3L9FA 3GTKJ 2CGHA 1JB0E 2DXBA 3G71A 3A03A 2LKPA 1IXDA 2ODRC 3TEHB 1MNMC 4KT5C 2IPQX 2YUOA 3DKYA 4ENJA 4FW1A 3S14J 4EIKA 2H27A 3F8FA 2A0FB 5GMKi 3H6ZA 2OAZA 4E4HA 4OGEA 4UVAA 3VS6A 2YSQA 1LDDA 1WWXA 3SB2A 1CQTA 2W00A 3SWNC 3V4GA 4XK4A 2B8AA 1BKBA 4JDSA 3DB4A 3CCQI 1QCNA 5FWCA 3ROUA 3KFWX 3F21A 1R49A 4S05A 2AXLA 2VT3A 5BMZA 4B4CA 2FQ4A 2EK5A 3UA7A 2FBIA 2FNAA 2EINH 2JJ7A 1T2KA 2KIUA 2O9VA 3EHQA 4UVCA 2DQRA 1SEMA 3G7ZA 4M75C 2XF5A 4AIDA 2JM9A 3W2AA 3OSGA 1G3YA 1O7FA 1ETOA 3JSCA 1Z6TA 2ZIMA 2RB6A 2JUFA 2EJFA 2KROA 2EBPA 1OULA 1VQ5A 4WJ3M 3PFYA 2G9WA 2DJQA 2L8DA 4E7KA 2DL8A 2DX1A 1ZYRF 3QWYA 2NVUB 2VXDA 2QAZA 2KRCA 3Q9SA 1VQ8T 3OD1A 4ZGEB 2O8XA 5J1YA 3WGHA 2NS0A 1PKTA 3GNGA 1Y1WJ 2H1KA 5TGTA 1ZHIA 3KZZA 3QRFF 5HLTA 3VV0A 3ISPA 3KX2A 3JCMV 3C95A 2DKGA 4XKCA 1A6IA 1T3LA 3H0IA 2OTJT 3CCRI 3EUHC 2KBTA 3V8LA 5KNNA 4XONA 2ELHA 3HSFA 1UGRB 5D6FA 1O75A 2RC4A 2J05A 4BAYA 3D5SC 2DPUA 4DOVA 1I3AA 4HF2A 3ZR8X 1FY7A 4QPQA 3M53A 1D09B 1W66A 3BG3A 3B6AA 2XRNA 3VS2A 3H5RA 4RM3A 4XU0A 3CMAI 1P2FA 3WTSC 3GUDA 2FPFA 1SHFA 2W0ZA 4MFDA 5ERIA 2Z0WA 2MC3A 1ABQA 1G5IA 1JKOC 2YDLA 2ROTA 1E1OA 1ADYA 2VONA 4HVUA 2A3LA 4A53A 4ESRA 3VOEA 1FP1D 1K9MU 1OQKA 4M3GA 1UMQA 2V26A 4O6JA 5GAMh 1ZUUA 4P5OA 5LLQA 4DYQA 4JPBW 3R6SA 4Y91A 1RACB 3JCMe 1PRLC 2CSIA 5FROA 4BHBA 2DJIA 4JBAA 3HFVA 3VS4A 2RI2A 4LNPA 3LWFA 2YRVA 2AMCB 1UB9A 4P1WA 1TWAJ 2ZPFB 4A4HA 1OEBA 2DAQA 3EGDA 2FQ3A 4LUDA 3I35A 1QVFA 2JA6J 4M78B 2ZT7A 2E1NA 1MBFA 1ZSZC 4ZH4F 2KXDA 2CSOA 1HW2A 4O5VA 4LK1F 3F8NA 3M4QA 1KONA 4PHCA 4CRIA 3BTLA 3RKQA 1X1PA 1RUOA 3JREA 2DE0X 2KZVA 5CIUA 1WCMJ 1YI2I 5CCAA 1BR1A 3SFZA 1X3WB 4J00A 3PO2J 2HQAA 2JUGA 1BN5A 4M9XA 2MF2A 4BY1J 3PNYA 2V1RA 5LJ5j 3MEAA 4BE0A 2Q7HA 2LDUA 5B1AH 2FUG2 4M72A 4S0HB 4HQMA 2WV0A 1N27A 4HKEA 5FKKA 3OYGA 4IRIA 1RLQC 2OUMA 2ESNA 2ZPIB 4NL3A 2F5TX 2K9QA 3ZFJA 4CZZA 3O8GA 4MHGA 4M78E 3FMRA 1VQMQ 5GAMd 1YE9A 2K4BA 4E6RA 1JUMA 2YRCA 2V9VA 3VYHB 4ZN3A 1SFOJ 3SEMA 4Q4ZF 2ZPGB 3L2QA 2L7ZA 1B72A 1WYXA 1YS7A 4J7IA 2E1CA 1C0AA 4RCBA 4YRFA 1QVTA 1WHMA 3LSSA 1TC3C 1FYNA 1PCXA 2XV4S 4II1A 3EYYA 2OTLA 2ID6A 5JVTA 1Q86R 1J5YA 3H3UA 1PUEE 3KXTA 1E2XA 4PJNA 3BTJA 1XSVA 1A04A 5GAN6 3C7JA 3CTAA 2VOPA 3FMQA 5AT1B 3TW7A 2LNBA 5FGMA 3A7AA 2JVHA 4P9FA 3I4NJ 4JOMA 5GAN8 3AKZA 4LUEA 1IHVA 1R58A 1PG5B 1S7AA 2DYBA 3PTAA 4A4KA 3VKIA 4RTUA 2NVYJ 3BDDA 2PUKB 2F6CA 4AC0A 3WTXC 3PSIA 1MUZA 2JQ7A 2VGNA 5HS8A 3ZQHA 2IW5A 4A3KJ 3JRHA 1U6GA 3LL7A 2DBKA 3I53A 1TWCJ 4HA8A 5C6SA 2JWTA 2ABLA 2D1XA 3ICAA 1KD1C 2DOEA 3S8PA 2EJRA 4M77F 4KGVB 4CICA 2HDCA 3CCQQ 2ZKZA 2FPDA 2G0EA 5CVIA 4M7AB 4F16A 4E7SA 2E5NA 1A0NB 1VQ9I 4QW2A 4EMKA 3VS0A 1OLTA 2X4YA 2OX7A 4QT7A 1WU7A 4IRHA 4LD9K 2CV1A 1VQMA 4MO7A 4LN2A 2KE9A 3MHXA 2HVRA 3GTOJ 1QO0D 2XMFA 1UHFA 4AG1C 5KYXA 1R36A 1RESA 4H2WA 4ZYHA 1WH7A 4JP0A 4XNFA 1UAAA 4OIRF 3OYLA 1OQYA 1JRIA 1ZN2A 5LRSA 2Y48A 3SHWA 4L9VA 3GWZA 4XL9A 5C53B 4FCYA 1ZG1A 1Z7LA 2DJNA 4M7AG 2CZ0B 3LH0A 4LLNA 3I9V2 1REPC 5DY9A 3AL0B 4NQWA 3QDRB 3M0SA 3QPHA 3M56A 2M9UA 2V1NA 2BW3A 1I1SA 3CCRQ 3S2WA 1BM9A 2GOXB 1U9OA 1VQ6T 3S16J 2E6NA 2AQFA 3MCAB 1E6GA 2RMOA 2J5PA 4LLGF 2ZXHA 3IAM2 2K5IA 4UC4A 3A8OB 4MLOA 1TG0A 2VKNA 1TL8A 3WE2A 4CH6A 3A01B 3DU6A 1G51A 2M4KA 2XD0A 2HZYA 3CMAQ 1J09A 2XTIA 2C0TA 3KP2A 3I56I 1OX8A 4RB2C 4PUSA 4PSWA 2ALYA 3K9TA 2E60A 2JTMA 2LNVA 3CCQA 2H8WA 1MBHA 2AKWA 3KYLA 1RADB 4G6TB 4XKBA 1YGBA 3CCVQ 3TUPA 4YG2F 3H8ZA 3G4ST 4FW2A 3OV8A 1B34B 2BE7D 1JXMA 5HGQA 1U3OA 2VLAA 2QI2A 3FHNA 3E9FA 2JMCA 2WADA 1S72T 2VXEA 4XN0A 3CDHA 3TBIA 2HYGD 2A37A 1D1BA 2AHJB 2ECCA 2QQAA 1NEGA 1R4MB 1WLPB 1YJNI 2Q2EA 2GGRA 3QPSA 2Y75A 2X1DA 2O61A 1T95A 2LC2A 5CQEA 5LJ5f 1TBXA 4HQEA 5GANg 1R1TA 2WC2A 2H3EB 3E2UA 4AG2C 4D9JA 1IL2A 1YI2Q 4HX8A 3HOWJ 5LHHA 2NLUA 2Q0OA 4F92B 3SFIA 4Y3OA 4F93B 4IHSA 4LDUA 3FXUA 2LBFB 1B6AA 3H41A 3CCRA 4HCZA 5GP9A 1H4SA 4ZZDA 2YRDA 2EH3A 5C3EJ 2P6SA 2ZCFB 1Y07A 2RQVA 1LFPA 3JRIA 4WJ4A 2IP2A 4QQ6A 2KEAA 3RZOJ 3GTJJ 1IDZA 1FBUA 3NAUA 1MBJA 3CCYA 4OVAA 1Z9CA 4B48A 5EC7A 1JJCA 4AFQC 2ME0A 2VL8A 4OMQA 5K1XA 5GADJ 2JTEA 3T8TA 4C30A 4C8QA 3NETA 3CMAA 2L02A 1MV3A 5HOOA 1ZHFA 1W5TA 2E2HJ 4I7HA 2QHSA 3EGUA 3K4NA 1SMYF 1BOAA 1ZQ1A 5J47A 1SRLA 2HMAA 2JOYA 3DU5A 1JGGA 3IH3A 5CK9A 5CQGA 3L00A 5HLHA 3AT1B 4M74A 3CCVA 3DB3A 3DP7A 4YRRA 4X9CA 1TOVA 1B8IA 4W1UA 4AFZC 1HW5A 1Y0NA 2BIVA 4IEJA 3QAHA 3L1AA 2QSHX 2HYFA 1VQ8I 2EL9A 2ZT8A 5CQYA 1K76A 5E3LA 4FE7A 2XF6A 1ZTRA 1Q82U 2ZXFA 4H2VA 3LA7A 3CUOA 4A63B 4AIKA 2DD4A 2LKSA 1QVFP 2WBMA 4M78D 3EGDB 2EGCA 4AMCA 1GT0C 2E12A 1YI2A 3K4CA 4ZYAA 4NOYA 4UP8A 3OS5A 3WGGA 3RL6A 4HT8A 1C6VX 4JX5A 1BI3A 3HRUA 1U5TC 4I01A 1X27A 4HWRA 5IH2A 1IXCA 2BZXA 2DYRH 1H4VB 2DQ3A 3HFZA 4NBQA 1R23A 2BE9B 4CO8A 4Z6YA 1LE8A 2HU9A 4GCVA 4HCBA 4TTVA 4A3EJ 3E97A 1Q81R 5AONA 1WXUA 3M4OJ 3K1MA 2HI3A 1IGQA 2DOAA 1G3WA 4IZZA 1IC8A 1MGTA 1WFXA 2VIXA 3QKJA 4QQDA 3TGNA 2JM8A 4FYVB 1RZ4A 2GXBA 1B72B 2R5ZA 1XDSA 4A0ZA 4FU6A 3CPWS 4YREA 4EJOA 3ABMH 5E3NA 3PIPF 2E6ZA 3OYDA 1JU5C 2JRTA 2XU8A 2PG4A 2JXBA 3CJRB 3BDUA 4I0BA 3S3OA 4A3IJ 3J81K 5F6FA 2DMNA 2Z99A 3AG2H 3ZCOA 2IGNA 1QW1A 3MCZA 1X69A 4YRKA 1U3EM 2AIRB 4RM2A 2E19A 1ULYA 4G6QA 1NJ8A 3GLXA 2QBYA 5LGNA 1PYSB 1B3QA 1IRFA 3FZVA 4OMFB 4RG8A 4P55A 2VVKA 2FMLA 1W2BS 4KUDK 2M4GA 3K4MA 3J7AY 3P5JA 3S17J 5A0DA 4M78C 5EDNA 4H2UA 1G3SA 4RG2A 1DU6A 1GCPA 2CW0F 5CVJA 4BXFA 1CF7B 3CC2I 2X6XA 1Y6IA 2EIMH 3EHRA 3QPTA 2DXUA 3GVAA 3S3NA 2WAEA 2V8KA 2VXFA 3NTKA 1SF9A 4WI1A 5M3MJ 4G94A 2AQEA 4PFZA 2F5DA 3JRBA 4N4IA 3DV8A 3JTHA 2DVJA 3NMZC 3FDYA 2JS2A 2BY0A 3BR1A 4C0GA 1JKRC 5J26A 2Y4YA 1M27C 2LY1A 3GTMJ 3RMSA 3PNWC 5LJ3h 3DCFA 1AWOA 3UATA 1MMGA 3RCOA 1X2NA 2CJ9A 3GFLA 1NLPC 2QUFA 2IS6A 3MKZA 4ON0A 5KYXB 3F23A 4QWQA 1R7JA 5BPDA 2XVCA 1ZRCA 1IO6A 4H4KC 1MIJA 4E7ZA 4XKVA 1K1ZA 2X6OA 3Q1JA 4OMYA 1K8AU 3CCUT 1HXDA 2QA4T 4M3BA 3KYCB 4YYEA 1HDPA 4H2XB 2A5YB 2V9PA 3M8EA 5EG2A 1KQ8A 3CDIA 2NUZA 2KYMA 4B1RA 2EKOA 3IKMB 2OZ6A 1BW5A 1WQ2A 1K9MC 4NQWB 2DTOA 1O3TA 1VQLI 1VQPI 2GWRA 1WXBA 2HCKA 1XGSA 4UPAA 1VQKT 1XC5A 2HQRA 4KIFA 3KP4A 2CIMA 4XRSA 3BR3A 2DL3A 5I22A 3CEYA 3L4GA 3CMYA 5GANd 3SZTA 3VU3C 3L1PA 1ZBJA 5H2FC 2DETA 4BACA 3DLAA 3RACA 4ETSA 5LJ3d 4HEA2 1DDNA 1MD0A 3CO6C 1R4NB 4Z2YA 1OKRA 1DJ7B 3P9IA 2CJAA 3K10A 4NC6A 3EQLF 2XIDA 3LOCA 3DKMA 2ROLA 3WTWC 1OCRH 4IOAF 3OWTA 1JGSA 1PJRA 4HSRA 3CMET 4RGXA 2X3WD 3M1CA 2AKWB 3BTIA 1FSHA 5GAMf 4LVMA 3NWTA 12ASA 1VQ8Q 1YFRA 5HDKA 3CQZJ 4X1VA 2COBA 4DEYA 1G3TA 3QQAA 2FEZA 2YPRA 4D7MA 3O3KA 3MEYA 1M5Q1 1YJNA 1BBUA 1X75C 4KICA 4IURA 2JA7J 2OTJQ 4B3AA 3TQ7P 4CSWA 4UHTA 2Q1ZB 2F2EA 1WDXA 1YHQI 2RPNA 4Q6GA 5LJ5e 1YIOA 2Y31A 4EX5A 2GNCA 4GYIA 2IT0A 4H2YA 4II2A 1VQNI 4M7AF 4MMKA 3HXZA 3P8YA 5IHKA 2XPUA 4II3A 2DXCA 2L01A 2WAQN 4M7DB 1E22A 1IV8A 4B44A 4NB5A 2MGQA 2KISA 2XF7A 3G2BA 3Q9VA 3VS3A 1HOMA 4PK4A 3CCMI 3VQWA 3I5SA 1W4MA 2E5KA 4DGWB 2PJPA 2XRLA 1FNNA 4MEYF 2CP2A 1YW7A 4EJWA 2GQIA 5LHIA 4OMNA 3EAEA 5K7FA 2DU7A 3WU1B 2VJIA 3KEQA 4RB0A 3PIOF 3EDPA 3TDZC 2F48A 4DZJA 2H94A 4FX4A 3BC8A 4M7DG 3FM3A 2DTHA 4IX7A 3O6BB 4BU2A 1UHWA 5AYFA 5K7ZA 2LG4A 4FIBA 2VBYA 3OSVA 1YQAA 5HNFA 1QRYA 4HCCA 2KY9A 4I09A 1GCQA 1QP3A 4ZYEA 1BR4A 5KVRA 3CPWA 4RGSA 1HD3A 3RQIA 2DIGA 1VQ8A 3EGXA 3L7WA 3TOAA 1YO5C 4A3CJ 2EA2A 1R1VA 3K0LA 3QP5A 3WTUC 1B8IB 3TDUC 4A3LJ 3PNTA 1MJAA 3HDDA 4HT9A 2XGXA 5A2QZ 2DU9A 3QU6A 2BXYA 1E3PA 4C8QE 1ZLMA 4RTYA 1RI0A 3REAB 4XU2A 4NUBA 3JCMX 4CYDA 1X6GA 2MK5A 4G9YA 1G4DA 3PQJA 2J06A 3WG9A 4JUVA 2IAIA 3CC2Q 5DV5A 2JTFA 1L0OC 1JXSA 1P7JA 3AAFA 2WTEA 4FM4B 2JRMA 2YU3A 2FSWA 1GLNA 1W2BA 3OS0A 2B63J 4C92B 4UB8C 5GMKm 5E3IA 5ELNA 2CV2A 4IPAA 3EH1A 1M1KU 4LMYA 3E9GA 3FXLA 4O2DA 3KETA 2DXIA 2W24A 5E20A 3AFHA 2LCLA 5KH6A 3LSGA 1JKPC 4XLEA 1ZAOA 4BEHB 2KZGA 2QK0A 2E5AA 1WJFA 1T8IA 2F2WA 1Z91A 1Z3YA 3W6VA 2K3BA 2FO0A 3UR3C 2EZKA 4OAZA 5L8RE 1M2OA 5ILVA 4IRGA 5M5YJ 2X0LA 2ZNIA 4C92G 2A68F 3CC7T 3DBRB 1AZGB 3QNEA 3ERRA 4HZFA 3HM5A 4JRQA 3V7SA 4E7HA 2ENMA 2IGOA 4CYCA 2EA4A 2PMHA 2EIKH 1BJZA 4I2OA 4A3BJ 1YCSB 4YPFA 1UUEA 1R71A 2AS5F 3HL2A 5IXFA 1KFZA 3MAJA 1E7OA 4VUBA 2WY8Q 1WXTA 1E3OC 3QSUA 4EQQA 5IPAA 1XCBA 5C44J 2M0CA 1HA8A 2DZ9A 4PLLA 4XTVA 4L5IA 3CCSI 5FRMA 3ZMDA 3ERMA 2UUZA 3ZP5A 2L2OA 3GMEA 2KMTA 3LH5A 4HAMA 1JT6A 3L2WA 2OPTA 3UGTA 3EFOA 2EW3A 3B73A 3VYUB 2DMPA 2E1MC 2KK4A 1T08B 5IHIA 1K73R 2PJRA 1QPIA 1VQ7T 2QDYB 3CC2A 1A6QA 1AA7A 2L54A 2XAHA 2PN6A 4GO1A 2ZAEA 2LVMA 1FC3A 2FD5A 2K3FA 2MCNA 3Q0VA 3X28B 2KR3A 3QPLA 1XX5A 2RHSB 3M57A 5GAOp 2Z2SB 2YUPA 2BV6A 4GFBA 4DIQA 2E10A 1QVGS 4Y4RA 3IH4A 4U88A 1YNZA 1Z1DA 4XQFA 4PJOB 5F0FA 2A5WA 3L42A 3K69A 3DBHB 2YR2A 1ETVA 5CYVA 3JTGA 4AWXB 2FXAA 2VE9A 2A08A 1Y0UA 5J1UA 1EFNA 2EIJH 4M77A 4DBFA 3M07A 5LGUA 1OZ3A 4OMPA 5ICCA 2CP5A 5D5XB 2IY5A 5GANj 1P4WA 1QKWA 2IRFG 4KUIA 1GXPA 3JCMQ 4RDUA 3QUIA 4G6DA 3K2AA 1I1GA 2GCXA 4KQEA 2QYOA 2QLZA 3Q0UA 3IWFA 3DEWA 1X2KA 2D5VA 3KBGA 1VQLA 5IT9Z 1XTAA 2DOFA 1VIEA 2V9KA 4HVCA 1OV3A 1VQPA 2JTVA 4K2EA 4KJZA 3MP8A 1SMTA 4PJOG 3PVLA 3HTUA 4CH5A 3WHCA 2CP6A 3A32A 3WODF 1UELB 3HIFA 1Y0MA 4YCWA 1G6NA 3A98A 3N5BB 2F5EA 4IF4A 2NS8A 2FEIA 4BI3A 1E3HA 3IKTA 3IAS2 4P5NA 2EGAA 3G4SQ 5FFXA 3THKA 2RVCA 3FXOA 3ZN0A 2MLKA 3D5RC 1P4AA 4OMLA 1WJCA 1KU2A 2VPRA 3CCJI 5K5QA 3JB9G 4BQAA 4X5OA 4BUGA 5FFZA 1X55A 1NG7A 1D0YA 2B0LA 3K2ZA 4ZGDB 3I71A 2A05A 2LD5A 1Q82R 4HT4A 1WZOA 3OYCA 2F5VA 5KCHA 4YP0A 4PZJA 1W7PA 1YP5A 3F8MA 2RQRA 5JI6A 1XGNA 2RKHA 4LDYA 2A6EF 2MYSA 4HBLA 4HRIA 1Z6RA 5GAMe 1B76A 2PMFA 3W6JB 2YXYA 1RIOH 4HLYA 2CT3A 1C1AA 3UNGC 1HLVA 2HYJA 1IGNA 3R6OA 1WI7A 2CW8A 4EMKC 2KT0A 3C12A 3ZBDA 2EPFA 3HXLA 4RMNA 1QP2A 1QE0A 3ZQFA 4F52A 4OIPF 5BNGA 1H92A 1IO2A 4JX6A 3IRRA 4HLXA 2YU9J 3HY1A 1EKEA 4XLNF 1YFHA 3ECOA 3QXEB 3PNVA 4QTRA 2ZJRF 3MWMA 4KGZB 3LSRA 1GXQA 2FU4A 2AKKA 1WFWA 5GAOr 3HSBA 5KYYA 1EIFA 1ON1A 1M1FA 2Z1DA 4UVBA 4J7FA 5FWBA 2WY7Q 4GY5A 3CCMA 4Y7NJ 3IWZA 1YWOA 3K1PA 3FXKA 3NEUA 1JJ2S 3P8VA 1XJWB 4Y15A 3I55I 1EIYA 1V54H 4CXFA 2FL7A 4A4GA 2D9TA 1BC7C 1VQ4I 2A36A 3G4SA 3QO3A 1D3BA 4BL0B 1ZK8A 1SSHA 1QCFA 3PM1A 3JCMg 4L5JA 4LLLA 1BI0A 3P8HA 3BZCA 2R7RA 5GPAA 4LIUA 4LG3A 5KYUA 3GZNB 1M9SA 2ZPBB 5K5OA 3K4JA 3E9HA 3N05A 3JRGA 3JR9A 5DEQA 1X4PA 1UJ8A 1IG7A 5GAN5 4HF1A 4C8QD 5DTDA 2DFUA 2IS2A 3OYYA 2L2PA 3PVQA 2DK3A 4EATA 5FRNA 3HY0A 2Y9ZA 2VUBA 1R5ID 3GTPJ 5DUKA 4JJDA 3OB9A 1W70A 5TRDA 1ENHA 3CPWP 5GAHJ 2K9LA 4MFEA 4PGHA 4ZYDA 3GX4X 4A3MJ 5JHUA 2KRSA 3CCSQ 4IQJA 2XUBA 3ML6A 2QQ9A 3MKLA 5HY6A 4OGCA 3I0TA 5DYMA 2LQWA 2QTXA 4J9DA 4D8DA 2NVXJ 4XBFA 2K5FA 2F5FA 1IZ1A 1K0SA 1W1WE 2QF7A 2DMQA 2EFPA 2HR3A 5IYBJ 1PRMC 1MMSA 1KC8C 4PG3A 2M8EA 1SSFA 2GFUA 2IJLA 1S3JA 1W2BP 2K85A 4J9HA 2Q5HA 4FE4A 1XB4A 3HKSA 2HEOA 3KCCA 1K8AR 1WJQA 1R22A 1F9NA 5D5UB 1Q86U 3W3SA 2LOOA 4HOBA 3CJTB 1F1ZA 1KMMA 1TZLA 4BYYA 5GANf 2F69A 4F91B 4YELA 1UFFA 2DCEA 1PHTA 1KYWA 2ZZGA 1WHHA 4KMUX 2QHVA 1Z67A 3TOBA 4FYYB 3C2GA 1GDTA 3VQVA 2CWEA 1AWCA 4WXHA 4QQGA 1QVGA 1NLOC 2X4HA 2XG8D 3I54A 3CC4T 2JN0A 4HF0A 1MDMA 4M7DF 3ZOBA 1UJYA 2NAZA 3CDLA 4D7NA 1IRXA 3CUQA 4X9DA 1UGVA 2DERA 1YJ9T 1MMNA 4C8QC 1NJIU 1XCVA 4ASNA 3RF1A 4LDXA 4Q48A 2VJ5A 2QKLB 3RR6A 2EILH 2EAYA 1QLYA 4L6V5 3UDCA 5J3LA 4CYCB 2COZA 1M3AA 1LFBA 1Z7MA 2A3SA 2M45A 2BYVE 2DRMA 3CCEI 4GGGA 2LDMA 2FZCB 3CCSA 4G7OF 4L87A 1TQIA 3IV5A 2GZWA 1JQQA 2DO7A 5D5WB 3HTSB 5J4VA 4RGUA 4MMLA 3PIPA 4DBHA 1YCYA 2RQTA 2RQUA 1FBQA 2RD1A 2COWA 2R7SA 4KMFA 4TVWA 2CUFA 5CKBA 2HFHA 2VC8A 2YHTA 3PUBA 3S93A 4C0FA 2BY3A 3HJEA 3DKWA 1YIJT 3TP3A 1WHKA 2K2MA 1AEYA 5GAN7 2PJRB 3SZGA 2AO9A 4L0ZB 1VYUA 1N77A 2CU7A 1X54A 4WXCA 5IN1A 3VQXA 4E70A 3IRQA 6PAXA 3OOPA 1YN8A 1BOBA 4AH6A 5K1YA 1PP8F 3CF5F 2ZNZA 4BJTA 4XU3A 1IREB 3CCUQ 5F1RA 2QA4Q 3H35A 1ZQ3P 2LR8A 1PKSA 3K4BA 1WJBA 3EETA 4U7DA 4DPGA 2M8GX 1N8RU 2ISZA 4C5EA 2RNGA 1YFNA 4UUSB 3F6OA 2NUPA 4ABZA 5TJJA 4JX4A 1WI9A 3AG1H 1MKMA 4EM1A 2EV5A 2VASA 1LDKB 2GQQA 5FLVA 1PUFA 2CP3A 5F64A 3ZMTA 4C92F 2XDBA 5E3MA 4XKWA 2AMCA 4J9FA 1VQKQ 1A5JA 1RPWA 2VODA 3QJYA 1J0RA 4AU7A 2HDDA 3HXVA 2D1HA 2R3SA 4WTOB 3HUGB 4IO9F 2ZZFA 3I64A 4BDYA 2QQ8A 2O2OA 4ZYGA 5HNHA 3JB9D 1SG5A 2CT4A 5EGOA 2A61A 3SYTA 1M8MA 2LRDA 2GBYA 4XLHA 3J80K 2GAUA 2E64A 1X2MA 3VYGA 3MVPA 3F72A 2OZUA 2FRWA 2YLBA 5HODA 3TU4K 2IA2A 3K4KA 4RLFA 2ZFUA 3SXYA 2E1HA 4L5GA 1JJ2A 3LA2A 2HPMA 3CMEQ 3CCJA 1U0JA 1USYA 1SVLA 3JAMZ 5L23A 4L18B 3IG2A 2NNYA 5LBQA 4M77E 2X51A 4YRSA 2DL4A 2PEXA 3BJOA 4FHTA 4KBMB 2V1UA 1JTYA 5J40A 4XTWA 2V79A 3HZJA 4FT2A 5ILSA 2O3FA 3KP6A 3A8LB 2I4OA 3J7ZI 1HCRA 3GIBA 5K5RA 3MZYA 5E1XA 1W7PB 3H3VK 3G71T 1DPUA 2QA4A 2IPOB 3MMYB 4D0PA 1YB3A 1KZHA 5M3FJ 3HOUJ 4CC4B 1X1DA 3HHTB 4P74A 2V4JC 2KKOA 3JCMd 3QG1A 3LSKA 2DLPA 3CCLI 3VPRA 3FM5A 2VBWA 4P3NA 2I5UA 3HXUA 5JFRA 1M1KR 1WPKA 3CBPA 4NDLA 3FBNB 4XTYA 3S1MJ 4AFUC 1FTZA 11ASA 1JE8A 3S2DJ 4J9GA 3FXJA 4J9IA 2ZT5A 1Q7YR 1MBGA 2ECBA 3VB2A 3JCMP 1F1BB 1J3TA 1Q1HA 3PFIA 2M0YA 1MNEA 4ENMA 1SEUA 3A74A 3MO8A 4JRPA 1T0HA 3CLOA 2HGCA 1Y1VJ 2ZSIB 4D5CA 4HVVA 3I55A 1Z77A 1WNLA 5KYYB 4JS4A 3J81E 1BC8C 1EZZB 1NH3A 1G2BA 1Q95G 5IOZA 4PJOF 1BIAA 1VUBA 4A2UA 2DA7A 4F7UB 1OU8A 1FJLA 2ZJQF 1T98A 1OYXA 4N4GA 1VQ5T 2A7YA 2RAEA 1PYVA 1QZEA 4YTLA 3A8GB 1M2VB 1IHWA 3CMEA 4C3HJ 2GBQA 2VKEA 3FC3A 5J8FA 4RAYA 2L3DA 3E5UA 3OYAA 4M7AA 5IT3A 1HW1A 2C6YA 3FHZA 4ESJA 3H9QA 3Q3SA 4R1HA 1ASZA 1JHHA 3TQNA 3P9CA 3FIFA 5JLXA 4AD9A 4RTTA 4XLFA 3CBOA 4Z02A 1D8JA 4IUQA 2LY9A 5KYUB 5BQTA 1HC7A 4OMZA 4KYWA 1Z9ZA 4H2TA 4RUGA 4HWPA 2GFAA 2KYBA 1T0FA 2X85A 2ED0A 3LSPA 2DD5A 3GZ6A 2ZCWA 4DBQA 3Q5FA 1VQMI 4F7UG 1B07A 3QP6A 1AKHB 2P5LC 3MF2A 2IVWA 5GAOm 3D7SB 4IKFA 1F36A 4DOZA 5GTIC 1ZUYA 3A4CA 2MBFA 4NC7A 5EEAA 4FSXA 3REXA 3PIOA 1DPRA 5IY5H 3CXCS 1TS9A 1DQUA 3IHUA 1Y96A 1OCPA 2NNNA 1TUCA 3PQKA 1YITT 3FXMA 2XGEA 3BY6A 3F22A 4IHWA 4XSXF 2R5AA 2D1VA 1Q81U 1NJ6A 2JA8J 1NK3P 1IXRC 1KYZA 3M4GA 3W6KB 1O7LA 3H9GA 3ONQA 2PVDB 4IUUA 1ETWA 1RRJA 1G2HA 3PJRA 4P3PA 3LAJA 3RYPA 2DEUA 3H3ZA 5BPIA 3FKJA 1XOVA 5D6XA 5F0CA 5GAN4 1H8AC 1YJWT 2DBMA 1TP4A 1VZ0A 1KQ2A 3OY9A 1W4SA 1RR8C 3FRNA 3CC7Q 5FKLA 1I27A 1Z21A 3QDFA 2BBYA 4J9CA 4OINF 2M34A 4AFSC 2YUNA 2L3SA 2YT6A 2M0OA 3CZ6A 4J5YA 5LEJA 3NEMA 4EMHA 5LJ3e 1B34A 3JCMW 4FTHA 5M5XJ 3BPVA 3FJ5A 4RLQA 1MNDA 4XK8E 3OYKA 4CS2A 1RR7A 1JKQC 4G7HF 2MC4A 1MJ9A 3VFZA 1S7EA 1JXOA 1QVGP 5LRRA 4EGZA 1XSDA 4CH3A 1QA6A 1NG2A 2ZB9A 2G7UA 2ICWG 4IHXA 4QIWN 4LB5A 4CCMA 3ABTA 2V1QA 1MDMB 1SESA 2YX4A 3CO7C 4MZPA 3CUQB 4XICA 3A0HC 3FEOA 3QOEA 3CCEA 4Z89A 1VQ7Q 2R5YA 2KAFA 4RTWA 4IL6C 3BQZA 4WXDA 4RTXA 2DA4A 1PM3A 2UWMA 2Q7EA 4BUPA 5F1JA 3BCBA 4B09A 3M5AA 5DLQE 3CMQA 3M8FA 1IZ6A 1BCOA 3KP5A 1GCQC 4Y92A 3SEZA 3ZQCA 4XLAA 2PU9B 2LBFA 4GXOA 1V76A 3UF4A 3JCMJ 2YUQA 3HEFA 3QHSA 2OTLT 3E6BA 1M90R 4CC3A 1X3ZB 1O3SA 2Z16A 2LJ0A 3RPUA 2FRYA 1PVEA 1ZRDA 4C0DB 3DF8A 2NVTJ 4AM3A 1SAUA 2E65A 4FSSA 2G4CA 1QHHD 2FBKA 2L7KA 2ZXIA 1N78A 1UG1A 1U9NA 4EM0B 3QTCA 4E51A 1JT0A 3G6ET 1OMIA 1ETXA 1ORKA 2Z9OA 3HGGA 1LJ9A 3WXMB 3OIOA 3MQZA 1YFTA 1IB8A 3TSZA 4K87A 2MH9A 4BY6B 3LSQA 1YG2A 1KU9A 3I3LA 4YRIA 5F08A 1IN8A 4CHUA 4MTDA 3RBBB 5EEGA 1B59A 3CCLQ 3KZIC 4F3QA 2GIZA 2ME6A 3RPQA 3RZDJ 3A31A 4MEXF 4TVAA 1N9RA 1LEBA 4P75A 3VSKA 5EG0B 2K86A 3S1QJ 5GAN3 5DDGA 2FJ1A 4BJ5C 4YRPA 1UG2A 4YEJA 4LITA 1G5HA 3BDLA 2NUPB 3BG9A 3CCVI 1ZLKA 5FB2A 3X2QH 3PT9A 2CH0A 3UGQA 4ZGJB 3CD6T 5K1PA 3NTHA 5JR3A 2X48A 2JW4A 2P7VB 3ZL7C 1PUFB 1P92A 1JJ6C 4RB1A 5CVUA 4M77D 3C94A 2HOEA 3A1YA 2P7CB 5EYRA 2EJ9A 1EQRA 2FYKA 5D5VB 3HSEA 3WTZA 1ATIA 2HBPA 1W0UA 1YWPA 2A69F 3O2PE 2P5IA 5EGOB 1X2GA 2PUOB 1B8AA 1SRYA 1WQ7A 4P72A 2CFXA 2F4OB 2LCCA 2QVOA 2KQRA 3QWXX 4UUTA 1PSFA 3QO5A 1JJ2P 2ZNYA 4P73A 4WX9A 2DO3A 3QODA 1J5WA 4YRMA 1RKWA 1U06A 2UXNA 2LX9A 1Q1VA 5DLOA 2A8EA 4RQFA 3CQTA 1I81A 4MNUA 1X01A 2DA9A 2DDZA 3L2CA 1OYWA 5JLWA 4RAFA 1YRNB 1B7YA 5LJ5g 3MKDA 5KYWA 2K9MA 2MAMA 2WAQA 1KHIA 2DYSH 3FKIJ 4HXJA 1RAGB 2LX7A 2C8MA 1ZUKA 1W7PD 4JK1X 4EM2A 2VE8A 2RM4A 4M75B 2NOGA 1TTHB 3CCLA 3RGLA 1R9TJ 1Q86C 2CUEA 1K0XA 3GPLA 4BDZA 4NNJA 4KULA 3BZ6A 4XEOA 2YUSA 3A5YA 2UZKA 2P0KA 2VWFA 2NYXA 3M0QA 2OCEA 1U2WA 3CCQT 3NWSA 3CJQB 2PI0A 4KFCA 3H36A 1NJ5A 2KGTA 3Q0WA 1MBKA 3X25B 3CXCA 2QQBA 3R6NA 1GVJA 3ZMUA 2JS0A 3DWLE 1PYSA 4KA4A 4PJ0C 4MZTA 2K40A 4D1QA 1FX7A 4Z88A 4M77C 4A3FJ 2DNUA 3VYRB 2QDLA 3LSHA 4M75G 1T6SA 2LQNA 2M02A 5A0LA 3VBBA 4MIMA 3TREA 3QO8A 1DUXC 4RB3C 3PMIA 2R7ZJ 2PNIA 2L3RA 3ELKA 4LVKA 4PJLA 1CF7A 1NJIR 2FBHA 5GMKj 4JLIA 2DFFA 1LPLA 1WQWA 2C06A 2RHUA 2VXZA 2CUDA 2DA3A 1I4K1 1BB9A 3FK6A 3WE3A 2EFWA 2ID3A 2E34A 2ZJPF 2NUTA 3C2BA 2GA1A 3HOXJ 2P81A 5F04A 3CCRT 2RHQA 2Z33A 5HDGA 1NYRA 2LP0A 5IP6A 3QZ5B 1JO8A 4B3XA 5FLXK 4F04B 2GA2A 2QEXI 2DPDA 4NS5A 3TL4X 4M73A 2L7FP 4EMGA 4XM3A 2ZGWA 3DXJF 2DT7B 1JEGA 4P96A 2XAUA 2VC1A 1TQMA 3BR2A 1OCCH 2KIMA 2PMEA 5FD5A 4IUVA 1IDYA 3M59A 4ELZC 1I0CA 4BI8B 3R0JA 1H88C 2R7QA 2GXAA 1J59A 4Y52J 2JJ9A 4H2XA 1HKSA 1UG0A 2PMUA 3JB9I 1ZSZB 4IHVA 4LFUA 2VGMA 4J6XA 4M7AE 2RA2A 1HSTA 3GOXA 3SFMA 2ZIOA 1Y96B 2CQ7A 3MEXA 3E3VA 4EJTA 3GO5A 4M3EA 2D0QB 1I3QJ 4CCLA 2QYZA 3QYHB 1Z05A 1G8XA 3TO6A 4OMOA 1KU7A 2EQJA 2L3QA 3QWLA 2GQVA 4IVNA 1L3LA 1N8RR 1KD1U 3DLLF 5L3CA 4B8XA 2RQPA 4KUMA 3OYIA 4K88A 2MLGA 1X1BA 1UGSB 4KN7X 2KHMA 2P8TA 3ME9A 1FZPB 1X1CA 3JW4A 2Y69H 4ENNA 3CC4Q 3GBGA 1QF6A 1ZH5A 1ETKA 1OPCA 4BGDA 2EYQA 2DFEA 2FZGB 3JRCA 1YJ9Q 3BJUA 2KMUA 3KP7A 2A6HF 1FIPA 2H8RA 2DA2A 5LD2C 1YI2T 5B1BH 3ZPLA 3BOQA 4JQFA 3JSOA 2M16A 3CLQA 1BK2A 5C4XJ 1XSXA 2K3YA 2VJ4A 1Y57A 2X35A 1TNTA 3EFSA 2DT6A 3RIRA 3OW2S 4J19A 3DEUA 1Y39A 3DTEA 1K73U 1RABB 1IUYA 2JPCA 1WJAA 2SRCA 3REOA 4WCIA 2BHYA 1D8KA 3VS1A 4F7UF 1X58A 3HRMA 2KLOA 2E70A 2DMUA 2CQQA 1K4US 2O9SA 4IOCF 1IN4A 3ULRB 1ARKA 3JCMf 2HZDA 2ZXWH 1A31A 4RTZA 2XKOA 5BS6A 3SJMA 4G84A 2HTJA 1YIJQ 2RGVA 4BQNA 2M0MA 4RKUE 3ULQB 2EIFA 3EUAA 2R5YB 3F0CA 2EFNA 3AG4H 5GAEJ 2Z3YA 2K3PA 2ZC2A 4NC8A 4M7DA 4QPOA 1XS9A 3S1RJ 1ZGWA 3GTGJ 4XSZF 4DYRA 5CVRA 1RC9A 1HKTA 3M0RA 2KRHA 3EG9A 3X24B 1WIEA 2E7XA 1EA3A 1K6YA 1QVUA 1STZA 2ARUA 4Y17A 3G1JA 2OJ2A 3LA3A 4BKXA 2ELKA 4CH4A 1J7KA 1F43A 4A5NA 3H5AA 2HOAA 3I5UA 1FPQA 3I5RA 2XKPA 3NFCA 4A6DA 2ZCEA 1X2HA 1GFDA 3HBLA 5A0GA 2MW8A 3HSRA 2RI3A 1NG6A 4YRVA 4MZMA 1YJ9A 2JT4A 1LCKA 4BHCA 3BZKA 2PTKA 2DL5A 3PMTA 3JCMb 3LWHA 3BROA 2HKQB 3C3WA 2O01E 2V6EA 3F9KA 3L2RA 2P4TA 3VJPA 1VNDA 2QTVA 5HLIA 2QGFB 2DA5A 2RO0A 2BY1A 2AHQA 3K1NA 4TVAB 4IXAA 1LYLA 3HKZA 3E5QA 1K6OA 3ZGKA 1VQ9T 4RGRA 3P8BB 2M30A 1C0MA 2E36A 2QHTA 1VQZA 1DP3A 1G59A 1UGPB 2CQKA 3A7RA 4N0BA 1OYYA 1MH4A 4A5MA 2JPBA 1I07A 3PSFA 2J6KA 4A0YA 1RI7A 1NK2P 1FSEA 3LSIA 2P0LA 1AHJB 3OYFA 1UHMA 3RJPA 1YIJA 1ITYA 3CUQC 2QCOA 2OTJI 3VS5A 3UFGA 3BPXA 2ACJA 3QYEA 4KH0B 4N9HA 2L3PA 2P4RA 3G6EI 3MD2A 4C92A 2ZINA 4EVIA 2LTPA 1ZG5A 2K02A 4P3OA 1QZYA 5GAMg 2EQMA 5JVGF 2RK1A 3U9GA 2ESHA 2W85A 3QYGB 4IJAA 1EVKA 3ABUA 4DJAA 2I4NA 4E7IA 4ORZA 2VKHA 1Q81C 1BL0A 3WHBA 3O8HA 2MD5A 3PL8A 2QEXQ 3BWGA 4BEHA 2XI9A 2O9LA 1LNWA 2W84A 2CQNA 4AT1B 2R7VA 4DNCA 4ZIBA 5CKDA 1NHAA 1YX3A 1K4SA 2EZIA 1TW2A 2BKDN 1IAWA 4TWAA 2RJDA 3W3CA 2M51A 4R0KA 1B7YB 2X6WA 3W2WA 4ZDOA 5KYWB 3IC7A 2W57A 3A2KA 2KT8A 4KIGA 2ZO4A 3NHNA 5D4SA 3I56T