4DQ2A

Structure of staphylococcus aureus biotin protein ligase in complex with biotinol-5'-amp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
322
structure length
322
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin-[acetyl-CoA-carboxylase] ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 104
structure length 322
sequence length 322
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2012-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4dq2A01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4dq2A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4dq2A02
3Q9VA 2DVEA 3UH0A 2Y48A 3SXYA 3JCMf 5GAN4 2RGVA 3A7UA 4A54A 4A0YA 4YRKA 1CF7B 1U2WA 2M30A 1SD6A 3M4GA 1D8KA 1S7OA 2H09A 4G9YA 1P4XA 4HDUA 1F5TA 1MDMB 3GUDA 4CDGA 1R1VA 2ELHA 4G6QA 1NNHA 3TGNA 2F5EA 3F72A 2ZBKA 2KIMA 3HHHA 2ZZFA 4HA8A 4QLCU 1ZG1A 2VXZA 4HLYA 2V1DA 2ZZEA 4ON0A 4NCXA 3RESA 1R22A 3M1EA 3JB9H 1Y0UA 4G6DA 4I0AA 4OU0A 4LD5A 2MLGA 2LDUA 4A0XA 1YG2A 4OP0A 2UZKA 3QPHA 2E1NA 4C8QG 4XU0A 2A69F 4KICA 3ZQ7A 4TTVA 3TKYA 1H4TA 5C53B 4FX0A 3V8JA 2O0YA 4A5MA 2PMEA 2MH2A 3LAPA 4ZYHA 3ELKA 5CYVA 2Q5IA 1MKMA 2FYKA 4RB1A 3IG2A 4MMKA 2KJBA 4YCUA 1B7YB 1I8FA 1K78A 5D8KB 4P55A 3RTRA 2P7CB 5LJ5h 4P74C 1BOAA 1KGSA 2ZXJA 4P96A 4LNSA 3CUQC 3CUQB 3K69A 4LK0F 5LHGA 1BBWA 1J7KA 5LRSA 1E1TA 2HOEA 2Z9OA 4PJOC 1CGPA 4K87A 4M77F 1B70B 3R0JA 4LLLA 4AD9A 5FLXK 5GAN3 4YRIA 1IUYA 4YRGA 4V2SA 1J9IA 5FFZA 4YCVA 3JW4A 4P3OA 3ABTA 3BFMA 3JTHA 4ESBA 2HQNA 4XLNF 3UGTA 1UFMA 4XBFA 5GANe 3R6SA 3FM5A 5C52B 1IXSB 4BHPA 5LEKA 3QP6A 5D5XB 3KP4A 2HFHA 2F2EA 3KE2A 5J8CA 1I5ZA 2BBYA 4C8QA 3G1ZA 4NOYA 2E65A 1IN5A 2V1XA 2E1HA 1XSDA 1XCVA 1SD4A 4TVAA 5K5RA 1ON1A 4UXNA 4D0PA 1LQ1A 1XGMA 2EFPA 4OOIA 1V4RA 4RB3C 1W5SA 2FF4A 4TVYA 1HC7A 4HVCA 5H6QA 4K86A 2QQAA 4J6WA 1TW2A 3LSTA 5L3FA 2DXTA 2V9VA 1JRIA 4HLXA 1F4KA 2J3MA 3WG9A 4ZZDA 2UWMA 1UHWA 1KYZA 2L02A 3E6BA 4GGGA 3F8MA 3BW1A 1FYFA 2LSOA 5D8LB 3HOSA 4L87A 3ABUA 4Y91A 2F5FA 1C0WA 1IW7F 3KFUA 4IPAA 4C8QD 1UB9A 3BPVA 3KETA 4L9TA 2ALYA 4GXOA 4EM1A 3RUXA 2C8MA 4ZTUB 5AIPA 5A2QK 1HW2A 5L3DA 1D8JA 4BHCA 5E18F 5BQTA 4XU3A 4Q5SF 1U1SA 4H2SA 4L9JA 4I98B 2MC3A 3E97A 3RPQA 4YRQA 1L0OC 3TOBA 4CHUA 4YRMA 4WXDA 1UHMA 3JCMc 2FU4A 4EM0B 2I2LA 1LDDA 3ZN0A 2KIUA 3DQVC 1DUXC 4JK1X 2W84A 2J5PA 1EVKA 2H6CA 1REPC 2H27A 1Y96A 1PUEE 3JB9I 4HQMA 1MGTA 3I54A 3LQRA 2OZUA 2PFBA 2P4WA 2ZCWA 3QTCA 2BYVE 1UCRA 4HDVA 3BY7A 2GQQA 2Q2EA 5GMKh 4P73A 2HNIA 1ON2A 2PMFA 2I4NA 3GIBA 4WI1A 3WU1B 4UV9A 4CS2A 2AMCA 1WNLA 3FMQA 4ZYDA 1XN7A 4PCQA 2E3CA 3CLOA 3R4KA 4M78F 3QO5A 3REUA 3ICAA 3GZ5A 1S29A 1ZRFA 4M7AG 4JRIA 1KA8A 1SFUA 2Y75A 2I4MA 3QRFF 2FSWA 1N9SA 5FB2A 3JCMe 2CWEA 4ZH4F 2IA2A 1B34A 3M4PA 5AIQA 5K5OA 2R3SA 4ZZLA 4IRIA 4JBAA 3ULQB 1YCYA 2XV4S 1S6LA 4C8QB 4C8QC 3KZZA 2NNYA 4TVAB 4KIBA 4Q15A 2GWRA 3MZHA 2JTVA 4U0WA 1Z05A 3MEYA 1ADYA 2FQ3A 4HBLA 4HX8A 1ZLJA 1ZG3A 2L4AA 2CG4A 2DXUA 2ZJ2A 4CZZA 2JPCA 3QU6A 5GAN2 5A2QZ 1ZH5A 2FMYA 2ZGWA 4BH9A 4WK8F 3HSFA 1KMNA 1LEAA 2OU2A 4H2TA 1FZPB 1ZG5A 5D5UB 4YDQA 2J3LA 2EA2A 4YP0A 2FNPA 4X5OA 2VT2A 5ILUA 3KEQA 2J5OA 1EOVA 2HKOA 3VODA 4Q6GA 1HW5A 4KT5C 2PG4A 3NEUA 1BC8C 4ENMA 3E5UA 3S2WA 3M4QA 1O7FA 1ASYA 1O3QA 1EH7A 3TO9A 2ZCEA 3VQXA 3RGLA 1U78A 1R5GA 2H6BA 3BOQA 3SFZA 3GWZA 3GEZA 1R5HA 3MF2A 1BBYA 3O6BB 3JTGA 4L9NA 1O3SA 3SHFA 5BPDA 1X54A 4XTUA 1MZBA 5LJ3e 3QO8A 2A6EF 4G7OF 1MD0A 5HLHA 2Q0OA 5LEJA 2NS0A 3A31A 3EUHA 4TV7A 3L4GA 4M9ZA 2L4MA 3FMSA 3I59A 2G7UA 3BZ6A 1ZREA 1Y96B 2V79A 3HFZA 3HXWA 3WTVC 4IF4A 2RQPA 5F1RA 1NJ1A 2XASA 3HOTA 3DEUA 1FYMA 3QO3A 1TQMA 3JB9G 4BAYA 1LDKB 5JR3A 3IKMB 5JVTA 5ERIA 3ZMVA 3WE3A 4WJ3M 2ZT6A 3KEOA 3OOPA 3DF8A 2EWNA 4ESJA 4EGYA 1YLFA 4U88A 2CQKA 4G7HF 1N9RA 4M6YA 4M7AD 1DDNA 1ZYRF 5ELNA 1JXSA 2CJBA 3KZYA 3IWZA 2E5AA 3VQVA 2VOOA 1ZGJA 4GCVA 2HZTA 3N97A 4XU1A 2P6SA 1M5Q1 2VC8A 2UXNA 3LC0A 3C1DA 3IKVA 3R0AA 5L3BA 2A5YB 2DK5A 4ETSA 2YHTA 1KQ2A 4L9VA 1HQCA 1FPQA 1B34B 4BYYA 1P4AA 3I4PA 1G3SA 5LJ3g 1YS6A 3ZN1A 5LGUA 4BXUA 3A74A 1XMKA 5LGTA 2VT3A 4HX4A 1NJ5A 2ZNYA 1E24A 2NNNA 2PQ8A 4C8QE 1P2FA 3HXUA 3IHUA 3W6KB 2EFNA 4CXFA 3LAJA 2YLCA 5GMKl 2QHUA 1JHFA 5TJJA 3MAJA 4WXHA 2P6TA 5HDNA 1GXPA 4OMZA 1OKRA 1SETA 1I6XA 2PBIA 4ENNA 4KMUX 1H4SA 5LRRA 3G73A 2YX4A 1SD5A 2DZ9A 3LSSA 5F5WA 1H4VB 2VOPA 1S8NA 3U1DA 2DPDA 5I21A 4YRCA 4P72A 3CO6C 3M7GA 1FOKA 3HY1A 1P92A 3WGHA 4NL2A 4IHSA 1RUOA 3GYHX 5CLSA 1K79A 1BI2A 2IW5A 4QVDA 4NB5A 2HTJA 2K02A 1GVJA 4XEOA 3WE2A 3I64A 3K1NA 3TDZC 3ECOA 4M7AB 4M7AC 1A04A 4EVIA 5L3EA 3ML6A 2FBHA 1QBJA 4RCCA 1WLEA 3FB9A 1I27A 5JI6A 2LNBA 5FFXA 4KYWA 1FBQA 1G6NA 4OIQF 1R1UA 4RCBA 3ZMDA 4Q47A 4EMGA 1TTYA 3L4GB 3M8EA 3F22A 1DP7P 1I4K1 4TWAA 1T6SA 3VEPA 3ZMZA 2EJ9A 1ATIA 3JAMZ 2E10A 3WODF 2OA4A 4KMFA 5LLQA 1YFSA 4C92F 4M75F 4P75A 3EYYA 4LLGF 2R7FA 2PN6A 1W7PA 2HS5A 4H02A 2EFQA 3RKWA 3J80Z 1AOYA 3K1MA 2ESHA 3IALA 4H2WA 4HT9A 4LLNA 4YPFA 2YU3A 1TQPA 2P5KA 2RB6A 3PZCA 3MF1A 3HTZA 2RC4A 3F6VA 2EJRA 5HS8A 1KU7A 1E2XA 3DPLC 5LJ5e 3FMRA 3TO6A 1X55A 4CH6A 1FX7A 1FC3A 2STTA 5E1XA 4M77G 1J75A 2VC0A 1KQ8A 2ZR2A 4NHJA 3SZPA 3DV8A 4GYIA 4N0AC 2EK5A 3E9IA 3C3WA 4X9CA 1ZRCA 1USTA 3D5LA 1B4AA 3BJOA 3BWGA 4HV6A 2I4LA 3AHUA 4A6DA 3FM3A 4LFUA 2UXXA 12ASA 1ULYA 2QLZA 1W7PD 4UPAA 4YRRA 3EDPA 3I71A 2COMA 3SZTA 4U7DA 3FIFA 2HGCA 5GAMe 3F21A 4UHTA 3RF1A 4ZTZB 5LJ3d 3ZP5A 1Z7UA 1BIBA 3J7AO 2RDPA 4EJOA 2L54A 1NYQA 1OYYA 4XTVA 1NYRA 1EIYB 2K27A 4IVNA 2HQRA 4P72C 3J81Z 4PGGA 1SD7A 2GAUA 2ZT7A 4OIRF 3TEHA 2A68F 1B6AA 1FP1D 5E17F 2RHQA 3E5QA 4M73A 3V8LA 2GIVA 1TW3A 2RV8A 1HKSA 4I02A 1U1TA 3FWEA 4M7DF 2ZMEA 5DD8A 2DFIA 1YW8A 3AAFA 4K2EA 2EV0A 2MA3A 1O3TA 4M77A 4F7ZA 2Z33A 4M7AE 2WC2A 3A7RA 1IN8A 1R58A 2G7HA 4A2UA 1XDSA 1X56A 3BY6A 4P9FA 1MJ9A 1YFHA 4M7DA 3GXOA 3TQNA 1ZRDA 3HHGA 2XAHA 5FD6A 3VFZA 3L2ZA 4OMYA 4EMSA 2OQRA 1HSTA 3CJNA 4KIGA 5ED4A 3HRIA 3MFKA 3HXXA 1P4WA 4AIHA 1YTYA 2YSRA 2Z5UA 4P75C 2DK8A 1USYA 5ICEA 1F9NA 3IRRA 4RB0A 1W7PB 4HOBA 4U7BA 1FP2A 1W4MA 4XEMA 5IT3A 4EMKA 2M45A 5J8FA 3DPTA 5K5QA 4A0ZA 4M77D 2EJFA 3R61A 3MQ0A 4BW9A 1ZN2A 4NL3A 5K1XA 1OYIA 3ZMTA 3HRKA 2ESNA 2KJCA 4F7UF 1ADJA 1P6RA 4CYDA 3QNEA 2CJ9A 2IT0A 3KP7A 2C6YA 3HXYA 3M9AA 4J6XA 5GMKe 4MQ9F 3L7WA 4EJWA 1J5WA 2HKXA 5GANg 4J6YA 2M1BA 3HRSA 2P5VA 2AKWA 2K86A 2O61A 4UV8A 2JRTA 4M78G 4G8XA 2VXEA 3GF2A 3RYRA 2Y90A 3BDDA 4S05A 3QHSA 3GFLA 1JGSA 2DKGA 5HDKA 5FLXZ 1K6OA 2NAZA 1WU7A 2RM4A 3INZA 1LJOA 5CVVA 3L00A 1HKQA 4EGZA 1K78B 5GAN8 3HSBA 5GAN7 2RNJA 1X3UA 2VBWA 4I01A 2VXFA 2X4HA 2ZNZA 3K1PA 2ZFWA 5KVRA 2RVCA 4AIKA 4I09A 3OV8A 4CGZA 2F5DA 2RHQB 2XVCA 4XTWA 3U2RA 3HRUA 5KK1A 2VN2A 2P5LC 4O3MA 5K1YA 4EM2A 1LEBA 2WV0A 3KP2A 2QUFA 2QHSA 2ZMEB 4OIPF 5GANj 2XUBA 4H0EA 1R23A 4M74A 3VOEA 4M77B 4M77C 2K57A 5HVQC 1T39A 4WWCA 2P7VB 4R1HA 1Z91A 2PMHA 2Q5HA 4IXAA 4A5NA 4UP8A 5TRDA 3JCMP 4M7DB 5F6FA 3T0YA 4ZYEA 4MEYF 4JRKA 4HX7A 4JUVA 3R07A 1R36A 1HSJA 1OYWA 2XKOA 3E6DA 4HWRA 2MH9A 3V4GA 3QO7A 4M78A 5GAOp 1D5VA 2AS5F 5HGQA 2L3DA 4M6XA 4YG2F 1WI9A 4IJAA 5LBQA 2ZIMA 3I58A 2EV5A 2RN7A 1PP8F 2GXGA 4ESFA 4LGWA 3RDIA 5ICCA 3V7RA 2QTXA 1F1ZA 1RIQA 5BS6A 2F5CA 1USYC 2FMLA 1FBSA 3Q9SA 4HT8A 3CUOA 3HSEA 4EMKB 4EMKC 4KN4X 5GAMd 5GAOq 4KQEA 1QO0D 2K4BA 4EO4A 3TOAA 3C18A 2ACJA 4TQFA 1TH7A 4RGXA 4G7ZF 1WWXA 2CIMA 1XSXA 2R7DA 3QSUA 2RHSA 2FBKA 1SMYF 2O6GE 2EFWA 1FNNA 3IL2A 3O3KA 2EL9A 3WTWC 2CJAA 1JBMA 3WTYC 4M78D 2TDXA 5CVIA 3GFMA 2DBBA 4CS4A 2ALYB 5GMKm 2XRNA 2DW4A 2AKWB 4MHGA 1WRJA 2GA1A 2XGXA 1SRYA 2V1UA 2PI0A 3JCMg 4RQFA 4KR3A 1X2HA 4YIIA 1RIOH 4A53A 1KMMA 3GZ6A 2FEZA 5L3CA 4G94A 2LKPA 3A32A 3P9KA 3RL6A 1B59A 1XD7A 1D3YA 1X2GA 5DDGA 4RGSA 3GW2A 5GAN6 3A7AA 3JB9J 1YB3A 5GANd 5BMZA 4ZYGA 1BIAA 3IC7A 2OBPA 2VODA 1J2XA 2Q8KA 1ASZA 4R8HA 2DU9A 4JLIA 3HYIA 1BN5A 4OINF 3ECHA 1USSA 4YFXF 4P73C 4CO8A 4UUVA 4AVPA 4XTXA 5DUIA 2O3FA 1B9NA 1KQ0A 1FWZA 1L3LA 1YQAA 4XSZF 4EV0A 4YCWA 2ZNJA 2AMCB 5FO5A 4QWQA 1FSHA 3I0TA 3TO7A 2CW0F 1D3BA 2FE3A 5GANf 3MWMA 5IT9K 2L01A 3GFJA 3KP5A 5D5WB 1XDUA 2DU7A 2QHVA 1KQ1A 3JSOA 2G4CA 2FNAA 4M77E 4XTYA 4HYEA 4RDXA 3NRVA 4M78C 4M78B 4J5YA 4QVCA 2MLKA 4DNCA 1MJAA 4M7DE 1G5IA 2CGHA 3REOA 4JQFA 2NRAC 3WGIA 1LNXA 4H2XA 4DPGA 3FF5A 3T8TA 5LJ3h 1MDMA 2GZWA 1ZARA 3L2CA 4YFKF 3CTAA 1SESA 2W57A 4Q48A 3CDHA 3LQQA 4WCGA 3OD1A 3BDUA 3BJAA 4L0YB 1W5TA 1PDNC 1G3WA 1RI7A 2DI3A 1IXCA 1ZAOA 1LNWA 3P8YA 1H641 3JB9F 5E8GA 1IRGA 2DPUA 4RGRA 1U8RA 3UGQA 2RHSB 5H6RA 4HV5A 5E3IA 3IWFA 2EB7A 5CVRA 1WKMA 3HXVA 4O2DA 2DLLA 5K1PA 2K7LA 2VE8A 2ZKZA 3U9GA 3E3VA 5E8IA 3NETA 4PJOF 5HS7A 3VBBA 4KNYA 2QVOA 2RD1A 1B7YA 3M8FA 1RUNA 5BPIA 3MEXA 1W66A 5AONA 2EA4A 4B09A 4I0BA 3Q5FA 1SFEA 2M87A 3IKTA 5LJ3j 1Z1DA 1YS7A 3V7SA 4PJOA 1Z9CA 2DTIA 1PYSA 1KOGA 2E7XA 5DV5A 4UP7A 4KA4A 2W24A 4G85A 1G51A 3L9FA 3EYIA 5HS9A 1O3RA 2NYXA 3JCMd 3I59B 4J15A 3B02A 2W85A 3HFZB 1WQ2A 1OR7A 1XGNA 2DDZA 2ARUA 4PGHA 1V3FA 3H92A 2A61A 1KYWA 3QU3A 5GMKi 4MQVA 3F6OA 4LG0A 1QE0A 4A6EA 1LOJA 2HYGD 4LMYA 5HOOA 2XAJA 3K2ZA 2IVMA 3EETA 4RQEA 1TNSA 1LYLA 1D3BB 4X9DA 1T38A 3NELA 5C51B 3F3XA 1WSUA 3KFWX 3H3UA 1G3YA 3WTTC 4C92A 4M75A 3NQOA 1QPMA 4KFCA 5FGMA 1XGOA 1TQIA 4PZJA 1DPUA 1ZGAA 3GLXA 1R00A 3ZMUA 4H2UA 3HFOA 1LVAA 3E6MA 1NJ2A 4HWTA 3LA2A 2YPRA 5L3GA 1VTNC 3HFVA 4N0BA 4YRLA 2ARSA 1Z7NA 1DPRA 3WTSC 3RKYA 3K0LA 4YRPA 3JCMb 1XGSA 2XAGA 1ODDA 1WPYA 2HTSA 3NEMA 4H2XB 4M7DG 3KP6A 3I5UA 3QUIA 2ZINA 2ZT8A 1FY7A 2AXLA 2WTEA 1FSEA 2D1VA 4AIJA 4M78E 1E17A 4XLPF 1G4DA 2XIGA 2ISZA 3SQNA 2ZR3A 4MEXF 3RPUA 5E1WA 3COAC 4UVBA 1GHCA 2Z3YA 1KU9A 4O5VA 4C92D 4YRJA 4M75D 1G5HA 3NENA 4EQQA 3F8NA 2GA2A 1KU3A 3FXRA 1S7AA 3BJ6A 2PJPA 3DKWA 4EJTA 1JJCA 1YGBA 4CH3A 2A6HF 5GAN5 1AWCA 1K7AA 1R7JA 4YFNF 3IKLA 2M5WA 1C0AA 3IRQA 1BBUA 4BWAA 2RKHA 4MTDA 4UVCA 2VBYA 3FHZA 3F23A 3SWNA 5LJ5g 3HTUA 5GAOl 1PP7U 4M9SA 1B8AA 1YW9A 2JPBA 4HZFA 4Q4ZF 2D45A 5KNNA 3HTSB 4F7UG 2IA0A 4P9UA 4PJOB 5FD5A 4M71A 4U0YA 5LJ3f 4KR2A 1PYSB 4MGRA 2HWVA 5D5VB 2ARTA 3FJPA 2QM3A 4RMFA 2LF7A 3WQZA 3DXJF 3PQKA 2CYYA 4Y17A 1E1OA 4OLFA 3KLOA 4LB5A 4YREA 4LJZF 2CO5A 2P0LA 2GXBA 4PDKA 1EH6A 2ZXFA 4RS8A 5GAMg 4S04A 4ENKA 2IA1A 4L0ZB 5ICFA 4YYEA 2H94A 4CH4A 1YIOA 2BE5F 5GAMh 1XMAA 4C8QF 1JE8A 2Y0MA 5CAIA 5GAOn 5ILVA 4ENJA 4G84A 5D6FA 5E20A 1O57A 2XROA 4LG0B 3HRTA 2Q7HA 1EVLA 5D4RA 4P3NA 1I1GA 4U0VA 3E9HA 2FBIA 3QAHA 3E5XA 1HTTA 3JSPA 4KIFA 3R60A 2Q7GA 4P71A 5CVJA 3T5XA 5LJ5j 4C92C 4C92B 4M75B 4M75C 2FA5A 2EFOA 5E1ZB 3WU0A 1H4QA 2I4OA 4M7DD 2ZO4A 5H20A 1NJ6A 1BC7C 3F8CA 5BOXA 2IY5A 4GYGA 2E64A 3TEGA 4E51A 3BP8A 1HBXG 2EV6A 2ZTGA 5DY9A 3WTUC 2E7WA 1JHHA 2ZIOA 1H0MA 1OPCA 2YLBA 5HDGA 4A12A 1LJ9A 4DQ2A 2X0LA 2B0LA 3QOPA 4Y15A 5HLIA 4F7UA 3I7FA 2VBXA 3FXUA 4IRHA 5GANh 3T1BA 2VE9A 2JZYA 4IRGA 3BPXA 5GAMj 1I81A 1U6GA 2KRFA 2VC1A 2IJLA 4KN7X 4WJ4A 1Z7MA 2HR3A 4ZIBA 2V6CA 3RKXA 3K9TA 2KIFA 3HFNA 1QQIA 1VQZA 1FLIA 2Z99A 2O03A 1HW1A 4E70A 3A5ZA 5CJ9A 1JJCB 3G3ZA 4NQWA 5DUKA 3ZMSA 2DTRA 3LA3A 6PAXA 3F8BA 4HF2A 3EQLF 2ZT5A 1YFTA 3TEHB 1ZHFA 1M8VA 1IL2A 1WYDA 3SWNC 2E41A 3SWNB 5LHIA 5ILSA 5ICGA 3LSQA 1FYKA 5D6EA 1E22A 4RAYA 1GGMA 1B1BA 2DQRA 1U3EM 3A5YA 3RERA 4L5JA 2MD5A 5J6XA 2O8XA 3C7JA 3PQJA 4P3PA 1HXDA 3P9CA 5LJ5d 2KKOA 2QBYA 4M7DC 4HWSA 3TDUC 2XAQA 4PJOE 2JT1A 2XGTA 2PLYA 4YRFA 2ZNIA 1FBUA 2DO7A 3MZYA 3EFSA 1QF6A 4BHBA 2P8TA 4M9XA 3KCCA 4HWOA 4I7HA 3LFKA 2XAFA 4YIFA 2RA2A 2ETHA 4ASNA 1GXQA 2C7IA 1T98A 4RGUA 2JSCA 1WQWA 2D1HA 4XSXF 1TNTA 4Y13A 2QYOA 4BQAA 3PCOA 2OQGA 4EJVA 1EFWA 1QGPA 4TQDA 2DU5A 2CGPA 4HW0A 3VQYA 1KQ9A 2QWWA 3RJPA 1IF1A 4P71C 2K4JA 3V8KA 2YX7A 1N9WA 4PHCA 5LJ5f 4M72A 3HRMA 5JHUA 1LB2A 1HKTA 11ASA 2IY5B 5GMKj 3P8TA 3HIFA 4C92E 3CMQA 5DCFA 4M75E 1MJBA 4XQ3A 3DSQA 3RIRA 1T0FA 1TBXA 1HK9A 2DTOA 3PFIA 2FB7A 3JCMV 4PNOA 4MNUA 4F7UB 1XB4A 1MGQA 3H3ZA 5DEQA 2BGCA 1OMIA 3GX4X 3PGGA 3KP3A 2DQ0A 1FYLA 3JCMh 4M7AF 4UNOA 4L5IA 1J5YA 1H9TA 5GAMf 2Q7EA 4YROA 1YW7A 4L18B 2DAOA 3FZVA 4RB2C 1RNLA 1ZLKA 3L09A 3RYPA 4YRNA 1WQ7A 2BV6A 2E1CA 1X01A 4M7AA 2CSOA 2DQ3A 1Z6TA 2XHKA 4H2VA 3V7CA 4N9IA 3ROUA 2VONA 3LA7A 5JFRA 1EQRA 2W25A 3I53A 1NHAA 4LB6B 4PG3A 2FOKA 3UFGA 1IN7A 1H9GA 1FT9A 3JCMJ 3ERRA 1SFXA 1U5TA 4XRFA 2XTIA 2DT5A 1J0RA 3WGGA 2QQBA 1Q1HA 5DCMA 4WX9A 4WXCA 2QZ8A 2ZZGA 2G9WA 4KDPA 1ONVA 2VBZA 4EMHA 2HYFA 5CVUA 2JN0A 4CICA 1BJAA 3W3SA 2QENA 3D0SA 3LWFA 3GFIA 5HLGA 5EEHA 4HWPA 4YRSA 2WWYA 2DJZA 3DFGA 1RZ4A 1R1TA 2P5IA 2ODRD 3O2PE 2QBYB 1Z6RA 2IRFG 4PJOG 1CF7A 1L0WA 2M8EA 2YR2A 4FT8A 2XKPA 2QQ9A 1NJ8A 2OZ6A 1EH8A 2DEQA 3REXA 4R79A 3HUGA 3P8VA 3JAMK 4XU2A 3QPTA 4TVWA 2EJGA 1YO5C 3BROA 1STZA 2HEOA 4K88A 4HF0A 1IAWA 3JCMW 5GAOr 1IXRC 3T8RA 4UVAA 3PCOB 4B8XA 2EAYA 2ISYA 4BNCA 4N0AA 3FX3A 3J80K 2HDCA 4GO1A 5ELOA 3N4MA 3VU3C 3P9IA 3MCZA 1KU2A 1QZZA 3HY0A 4HF1A 2STWA 2DQLA 3TUPA 2BEOA 4CH5A 2D2WA 3FXQA 1G3TA 1XSVA 4I2OA 4EX5A 1QZYA 4HAMA 1IRFA 3KLNA 1TLHB 3P7NA 4C92G 4AH6A 4M75G 2PMUA 4FX4A 1SMTA 3JCMX 3HXZA 2CFXA 1IN6A 2IP2A 5DYMA 4FHTA 1QNTA 3WTZA 1EIYA 4P74A 4P5OA 1S3JA 3CUQA 2ADUA 4WF2A 3QP5A 1IN4A 1YFRA 2QHTA 1T2KA 2LF8A 2A07F 1XCBA 4F7UE 4OIOF 4Z2YA 2PEXA 5DD4A 4XTZA 4IHTA 1B70A 5EEGA 3W6JB 5D4SA 1O7LA 4HQEA 3SB2A 2ODRC 4YRTA 4MTEA 1BM9A 1LDJA 2FRHA 3RACA 2OD5A 4UP9A 4KUMA 4CS3A 3F8FA 1BI3A 3VQWA 3HSRA 5GAOm 5IT9Z 4AWXB 1IZ1A 3JCMQ 2DTHA 1U5TB 1U5TC 3VB2A 3ERED 3ZPLA 3J81K 1I1SA 3JB9D 4EJUA 2IPQX 3RI4A 5DCMB 4N9HA 2MBFA 5LGNA 3L1AA 5F64A 1SAXA 1BI1A 2DZCA 2FXAA 3WTXC 1EV7A 2OAZA 3BJUA 1J59A 1SERA 1I5LA 3B73A 1BI0A 3CO7C 4RAZA 3GVAA 1YYVA 3EFRA 4H2YA 3GO5A 4O6JA 4PJOD 2A3SA 1B76A 1B9MA 3ISPA 4LK1F 4MMLA 3DP7A 3E6CC 5LHHA
chains in the Genus database with same CATH superfamily
3Q9VA 2QGFB 3PIOA 2WSFE 4YRKA 2FUG2 4HNTA 3K2AA 5EG2A 3CCLT 1D8KA 1S7OA 4G9YA 4AFQC 4BKXA 2W10A 1Q1VA 4LUDA 1MDMB 4X0GA 2W7NA 1R1VA 2Y31A 2VVKA 3TGNA 2F5EA 4IUVA 3CC7T 1APLC 1KK7A 4HA8A 3OY9A 1RABB 3QWYA 2VXZA 2XF5A 4XLCA 2V1DA 2XK0A 2A36A 4Y33A 4NCXA 3RESA 3DU5A 2KHMA 2MLGA 5B66C 2LDUA 1E3PA 4N4OB 3CXCS 2E1NA 2RHYA 4C8QG 4XR6A 3A8GB 1H4TA 5C53B 2K5FA 4IIMA 2O0YA 3WG7H 4A5MA 5CYVA 4AFUC 2KJBA 1K78A 4FETA 1UG1A 1C1AA 3CCRT 3K4CA 3K69A 2GFAA 1RR7A 5LRSA 2ZPHB 4IKFA 4DA4A 1V55H 1B70B 3GBGA 3R0JA 2RHZA 4YRGA 3DWLE 2KYMA 1S72Q 1Q86C 1X4OA 4ESBA 2HQNA 4XLNF 3SFIA 2XIDA 3R6SA 3FM5A 4BHPA 1X1BA 2K9MA 3UA7A 1KD1R 2JA2A 2KLOA 3KP4A 2F2EA 3KE2A 2L7FP 1K4US 4J9BA 4C8QA 2E65A 2V1XA 1XSDA 1SD4A 4C3IJ 1ON1A 5JHFA 2V6EA 2M4KA 1E6GA 2QDYB 3CMAA 1T56A 5A0GA 5H6QA 4K86A 4J6WA 5EJCA 1AHDP 4HLXA 2J3MA 3UA6A 1UHCA 1KYZA 2MW8A 4K11A 2LSOA 1PUFA 2RNGA 1GRIA 2KSSA 2VJ4A 1W0TA 4FW2A 2ALYA 2R7VA 4BHCA 3A2KA 5BQTA 2EGCA 4QKUA 1ZTRA 2HI3A 4HSRA 2EQUA 1UHMA 1YJNT 2DXIA 4DGWB 2FU4A 2ATCB 3ZN0A 3H41A 2NLUA 2KIUA 3I4NJ 4MDXA 1MMAA 1VQLI 2K3PA 1Y96A 2SRCA 4HQMA 2KEAA 2OZUA 2PFBA 3O5ZA 2BYVE 1AVZC 1UCRA 1IG7A 2DMOA 5LD2C 1BL0A 4WI1A 1MBKA 4CS2A 1WNLA 3FMQA 2LQKA 3H8ZA 4BGDA 4AMCA 3I3LA 1TT0A 4M78F 1QHGA 1YHQT 1S29A 5FRMA 4JRIA 2I4MA 3QRFF 2FSWA 1K8AC 1WFWA 2JUCA 1SVMA 4XIDA 1TWHJ 2WY7Q 4MIMA 1RLPC 3ULQB 2E2JJ 1RRJA 5GJWB 4C8QB 2KZGA 3KZZA 1D09B 2ZPBB 3QJYA 4FCYA 2GWRA 2Z0WA 1ADYA 4PSWA 5HNFA 3VS5A 1O9SA 1M27C 5A2QZ 1ZH5A 2KGTA 3I55T 4JJDA 1OYXA 2ZGWA 5DLOA 4BH9A 4WK8F 1KMNA 1LEAA 2Y4YA 2OF7A 2VKDA 1FZPB 2R5YA 1YOVB 5D5UB 4RDUA 3W2AA 2J3LA 2EA2A 4DBFA 3PUBA 4D5FA 5FLMJ 4X5OA 2VT2A 3J80E 2ECCA 2HKOA 2DTZA 2KL4A 3ZQHA 3M4QA 2ZCEA 3VQXA 1U78A 1R5GA 3KFVA 1R5HA 3VS1A 3O6BB 4IUPA 1JUPA 4XTUA 1MZBA 2CV1A 3DCFA 4J00A 5BNGA 2Q0OA 5LEJA 2L4MA 2DA7A 2WV1A 1ZREA 1Y96B 3HXWA 2V79A 5CQEA 3HFZA 3BDLA 2EIFA 4IHYA 1M2VA 4BAYA 2Z1DA 5F08A 4WJ3M 2ZT6A 3BR1A 3DF8A 5FKKA 4EGYA 4U88A 1UGSB 4EEFG 3BC8A 1DDNA 5ELNA 2E5AA 4HCBA 2VOOA 3L42A 4CYCB 3OIPA 4XU1A 2P6SA 3OYCA 5KYXA 2NUTB 4X34A 3QBYA 1FIPA 2A5YB 4W1UA 2R7WA 4L9VA 1HQCA 2PX9A 1JT0A 2L3SA 2G6FX 4BXUA 3A74A 1G2HA 4A3IJ 1VQ7A 1Q81U 1GFCA 2VT3A 2DERA 1E24A 4HVVA 4C8QE 4LDYA 3PTAA 1JUSA 2AQEA 5GMKl 1JT6A 1JHFA 2KT8A 3J7ZI 3MAJA 2CUDA 1VQMA 1UMQA 3CMAI 1OKRA 1I6XA 2PBIA 2EBIA 3G73A 2YX4A 2QEXQ 3U1DA 2DPDA 3HG9A 2X3XD 3CO6C 4Y28E 4IHSA 5CLSA 3VDXA 3OR2C 2K02A 1WHHA 3K1NA 3TDZC 4DZJA 2MC4A 2JMWA 5L3EA 2DNUA 1WLEA 2LTPA 4NC6A 1G6NA 1R1UA 1RI0A 1A36A 4Z88A 1TTYA 1WCMJ 3F22A 1T6SA 4BE0A 1WJEA 1VQNQ 3D7SB 2E10A 3AG2H 4OB3B 5LLQA 4P75A 1YJWQ 3EYYA 2OI3A 2R7FA 2X1DA 1SAUA 3JRCA 2EFQA 1Y1VJ 2ESHA 4H2WA 4HT9A 2DL8A 1TQPA 5CR2A 3MF1A 3WVEB 4LDVA 2DXCA 5LJ5e 3FMRA 3TO6A 4CH6A 4ESRA 1FC3A 5KE3A 5EZGA 2KRSA 2DYRH 2FVUA 2HDDA 3G1LA 2BZXA 3C3WA 2CUJA 1ZRCA 3D5LA 1B4AA 2BVLA 1KZHA 2I4LA 3CMEI 3FM3A 4LFUA 4CI0C 4UPAA 4U7DA 3FIFA 3F21A 4IUUA 2VPRA 2E2IJ 1UHSA 1Z7UA 2L54A 1R71A 2HVQA 4IVNA 3VSKA 1IZ6A 2HQRA 4C3JJ 3J81Z 4PGGA 1S72A 2DILA 3M5AA 3GTPJ 2K2VA 4X1VA 1EFNA 3FWEA 1TT5B 2J6KA 1MIJA 2ZMEA 4KGXB 1MBJA 4IQ4A 5DD8A 4KT0E 2DJQA 3OSSC 3AAFA 4OAZA 1JXOA 2MA3A 3FISA 2ZPFB 3GTLJ 2OJ2A 4XRMA 1M9SA 1R0CB 3BCBA 3TSZA 3BTJA 2CT3A 4B9WA 2CH0A 1ZSZC 4EMSA 1F43A 4RTVA 2XB0X 4C0FA 1SSHA 5I11A 5IYDJ 1K61A 3ERMA 1H8AC 3K4BA 4A3FJ 1F9NA 1MW7A 4HOBA 4U7BA 4XEMA 5IT3A 3DPTA 1IV8A 5GJVB 1I07A 4M77D 5EC7A 3MQ0A 4BW9A 1OYIA 1ADJA 4CYDA 1N8RC 2JS2A 3PUFA 1OISA 1XC5A 4A3JJ 2KP6A 2M34A 3ZCOA 2ELKA 1PSFA 2K86A 4A3LJ 3I56T 4M78G 2P84A 4G8XA 2VXEA 3RYRA 1ZQ1A 1VQ7I 4S05A 4G12A 2EYZA 1KC8C 2DKGA 4QQDA 3EUKL 2M4GA 5EYRA 2KMUA 2QKMB 3HC7A 3HSBA 1VQMI 3FBIB 2CP3A 5KYUA 1UAAA 1IJWC 2MMPA 3QDRB 4I09A 3S1MJ 4CGZA 2FHDA 2R5AA 3JRDA 4XTWA 5K1YA 4ELZC 2DODA 4EM2A 1LEBA 3KP2A 2ZMEB 3HOYJ 2LT4A 3QIIA 3H1CA 2ZXHA 1OV3A 2XUBA 2JUGA 3NAUA 4M74A 4M77C 5HVQC 1T39A 5GPCA 4WWCA 4ABZA 3OYMA 2OCEA 5TRDA 5F6FA 2GBYA 2CS7A 3HHTB 1R36A 4NC7A 3S2HJ 2MH9A 3V4GA 4M78A 1VQOQ 1ZR2A 4IJAA 2O4XB 5FJ8J 5J40A 3V7RA 4QSHA 1F1ZA 1RIQA 3CPWA 3GTOJ 2JA6J 1XNIA 5DM7R 5J3BA 1KQSS 2PUOB 4EMKC 3HSEA 4KQEA 4KN4X 3TL4X 3TOAA 4DOWA 1JJ2A 1TH7A 3HJEA 2QSFX 3QSUA 1SMYF 3DKXA 1FNNA 2CJAA 2XMFA 2QQSA 1BBZA 1HCRA 1E3OC 1TC3C 3S14J 2XRNA 4A3MJ 2X6WA 1Y7XA 1JO8A 4D9JA 4RQFA 2J05A 4A53A 2DMPA 2CP6A 1FJLA 3G1OA 1XD7A 2CS3A 3EGUA 3JB9J 3DTEA 4ZYGA 2A6TA 3ZQCA 3FHNA 4JS5A 5KYUB 3LNQA 5M3FJ 4AYBA 3QYBA 4AVPA 1S72I 1Y0MA 5J39A 4BS9A 2AMCB 2OTJQ 3QG1A 2AT1B 3MEAA 3MKLA 3H9QA 3C2BA 1YIJQ 1QVFS 3GFJA 2JA7J 2L0AA 4IQJA 3JSOA 1RETA 4QT7A 4M78B 4QVCA 2MLKA 3M55A 1D0YA 4DYCA 5CO7A 2CGHA 2NRAC 1LNXA 2E70A 2RQUA 5C44J 4JZ4A 2GZWA 1QVTA 1ZARA 2HOTA 2DA5A 2QEXA 2EILH 4ZGJB 3OD1A 5GADJ 3BJAA 4L0YB 1RLQC 5KAFC 1G3WA 3FXLA 3JB9F 1AWJA 1X3WB 1ZHIA 5E3IA 3HGGA 1WZOA 5IP6A 2D0QB 3DU6A 4XKCA 3OYNA 2EB7A 1PCXA 2VV5A 4O2DA 3AFHA 2DL3A 1T0HA 5E8IA 4PJOF 1HC8A 2HL5C 4KNYA 2QVOA 2HKNA 2R7OA 1WHGA 1B7YA 3M8FA 1LVKA 1WXTA 4B09A 2KMTA 2VQHA 1XX5A 1ETQA 3IKTA 1UEBA 1X1AA 2E5NA 1YS7A 1VQNA 1Z9CA 1KOGA 3RQIA 2E7XA 1IRXA 4IUTA 4UP7A 2XDVA 1G51A 1YJWA 4LD9K 2RREA 2ED0A 3ESWB 1O3RA 2NYXA 4HG2A 2W85A 2FZGB 4BB7A 3OYBA 2DDZA 4PGHA 1KD1U 1K83J 2LZ6B 4B6MA 3QU3A 5GMKi 4MQVA 1YI2Q 4A6EA 1LOJA 2HYGD 2FD5A 5LL6S 3ZFJA 4RQEA 1OZ3A 1GUUA 4UC4A 4X9DA 3PT9A 3KFWX 5ECAA 2J6OA 4KFCA 5FGMA 1XGOA 1TQIA 4PZJA 4KGVB 2EQKA 3VS3A 2AHJB 4HWTA 4YRLA 1VTNC 2ARSA 5IPAA 2JMCA 4YRPA 3JCMb 1WPYA 5GAHJ 1BA5A 3QUIA 1FY7A 2AXLA 2FZCB 2LY2A 3ER0A 4M78E 4AC0A 1AWOA 4BEHA 1G4DA 2ISZA 4J9GA 4UVBA 1KU9A 4C92D 2DN0A 1T95A 2CRGA 3QZ5B 3BJ6A 3DKWA 2WY8Q 4J9EA 4KULA 1Q7YR 1TOVA 2VQGA 2WA0A 2W00A 3OYHA 3M58A 2DA4A 1QVUA 1U8BA 3HOUJ 4FYWB 3FHZA 2LDMA 1OU9A 5LJ5g 5GAOl 1YW9A 2JPBA 4HZFA 3R6OA 3W3CA 5KNNA 3HXLA 4P9UA 3CEYA 5FD5A 1TWBA 2XF7A 2E6ZA 5D5VB 4A4FA 2QM3A 1MMNA 3MQZA 2VUMJ 3PQKA 4Y17A 1E1OA 2X51A 4QPQA 3KLOA 4PJ0C 3QODA 4ZTJA 2I5UA 1EH6A 1OR7C 4S04A 2E19A 2X4JA 4YYEA 1YIOA 1YJ9Q 1XMAA 3P8BB 5GAOn 4ENJA 3W2WA 1O57A 3RCOA 3JRFA 3HRTA 1EVLA 2QASA 1BR4A 3S8PA 1I1GA 2GXAA 3E9HA 3CP2A 1BU1A 2Q7GA 3H9GA 1TUGB 4C92C 4YTLA 1OI1A 2OAUA 2VB6A 2A0FB 2OUMA 1NJ6A 4XKWA 5BOXA 3VS4A 2L7MP 2ZTGA 5IAYA 5DY9A 1H0MA 4DQ2A 3VYUB 3M0RA 1M8MA 2L8DA 1NEGA 4ZNXA 2F2WA 4JX6A 5IHKA 1U6GA 2VXDA 2IJLA 2NUZA 2QEXI 1UGRB 4RM2A 3RKXA 2BY1A 1X69A 1FLIA 4E70A 2UUZA 4LDUA 4NQWA 5DUKA 2BXZA 1H3HA 1VFCA 2DA9A 4XORA 4CC7A 2KRNA 1EZZB 3QWXX 2ZT5A 3TEHB 1CKAA 3KX2A 4PSXA 3VYRB 2E41A 4UB8C 5LHIA 3K7AJ 1N27A 5KYNA 5ICGA 4CCLA 5J47A 4ANJA 3CCVQ 1E22A 1B8IB 1RPWA 4RAYA 3LSMA 4BDZA 1RC9A 2DQRA 3CC2Q 1U3EM 2H1KA 1VQOA 1RADB 3MEWA 2XDPA 1P7IA 1VQPT 2MWOA 5J6XA 2CH4A 3C7JA 5LJ5d 1IGUA 2M51A 1VQNI 3CF2A 1SC7A 4A3BJ 2XAQA 3OW2S 3BZCA 2CZ1B 3HKZN 2PLYA 1QZEA 1WJFA 4B43A 1YJWI 4I7HA 3LFKA 2FZKB 2RA2A 4ASNA 4KH1B 1T98A 2LRQA 2W0ZA 4RGUA 1TNTA 4XKVA 2K5CA 3JRHA 1EFWA 1QGPA 4XRSA 3O8GA 2DU5A 2CGPA 4HW0A 3VQYA 1KQ9A 4I6ZA 1NYGA 2K4JA 2YX7A 2X9DA 5LJ5f 5JHUA 3BTCA 3CMET 2HBWA 2JSPA 3A98A 2BIVA 3CMQA 5DCFA 1QCOA 5CKHA 3HOVJ 5IN1A 3PFIA 3F0CA 1VQ5T 3I9V2 1D0XA 3OYLA 2IG0A 2JA8J 1JUMA 1FYLA 4M7AF 1H9TA 3PVQA 4YROA 1PKSA 3H35A 4II2A 2CT4A 4XM3A 2EYXA 1AWXA 1ZLKA 1X1PA 4HT4A 1HJDA 3E0JB 2E12A 4NQWB 1JKQC 2CSOA 4DYRA 1Z6TA 2XHKA 4H2VA 4N9IA 3ROUA 4F16A 2VONA 2OTJA 3LA7A 4PG3A 3VUZA 2COBA 1U5TA 2VUBA 2V1NA 3IUOA 2JOYA 1J0RA 1YIJA 2QQBA 2ZZGA 1VUBA 2VBZA 9ANTA 4EMHA 4FASD 1IC8A 1K9MC 5HLGA 2DJZA 1VQ9Q 1RZ4A 3CMMA 2CSIA 2MG4A 4PJOG 1CF7A 5IXFA 2LJ0A 2XKPA 1QU3A 3GTMJ 1NJ8A 1EH8A 3TQ7P 3REXA 1NG6A 3HUGA 3P8VA 2ZZDA 3JAMK 3E7LA 4TVWA 2HEOA 1UG0A 4HF0A 3JCMW 1IXRC 1WZ2A 4B8XA 1UJYA 4R56A 1WXUA 3G6EI 2DFUA 5ELOA 4BY1J 4PK4A 2FG0A 2MI6A 1VQKQ 5FU6C 3RZDJ 2F6CA 1KFZA 3IP4B 2HEQA 4CH5A 3FXQA 3X25B 1PD1A 1QZYA 4C92G 4L5GA 2PMUA 1G83A 3VJPA 1JTXA 1QLYA 3HXZA 2CFXA 1P9QC 4FHTA 2LX7A 1LFPA 1QNTA 1EIYA 4P5OA 1S3JA 2ADUA 1VQMT 2QHTA 2FOWA 1ZX6A 2RO0A 2X3WD 2PEXA 4BY6C 5DD4A 1BYMA 1X3ZB 2M0OA 1BW5A 3SB2A 1SKUB 4NNJA 4MTEA 1YI2A 1BM9A 4NC8A 4CC3A 2OD5A 1BI3A 3VYHB 3NHNA 2M7AA 1U5TB 2OJED 3ZOBA 2IPQX 1QKXA 5LGNA 4N9HA 4C0DB 3OYIA 1E7OA 1M30A 1M90R 2IGMA 2L7ZA 2K2MA 3B73A 4RTUA 4RAZA 3GVAA 3EFRA 3GO5A 1EIFA 2NYSA 4MMLA 3DP7A 5M9OA 1QCFA 3EG9A 2Y48A 1VOMA 1VQOI 2RGVA 3LFUA 1ZA1B 1CF7B 1U2WA 2VJIA 1X6BA 3M53A 3CC4Q 2E34A 2HDAA 1P4XA 3HUGB 3GUDA 4G6QA 1TTHB 2KPMA 3F72A 3ZQFA 2LCCA 3U23A 1X27A 1XG1A 1G2BA 4QLCU 2HQ5A 1OJLA 2OTLT 3JB9H 4G6DA 1MBFA 3SEZA 4LD5A 2NUPA 1YG2A 1VIFA 3S93A 2DXBA 3CDIA 1VQ6T 4KICA 2DA3A 3ZQ7A 3TKYA 2BHYA 4FX0A 4V19K 3LAPA 2ENMA 3A1YA 1MKMA 1Q95G 1LKXA 1QVGA 4FQGA 1LPLA 1NJIR 4YCUA 3META 5D8KB 4P55A 4P74C 4LNSA 3CUQC 4LK0F 5LHGA 3W6VA 1J7KA 2BZYA 2O9LA 1CGPA 3EUAA 1YJ9A 1ZK8A 1Z0XA 2X1CA 1U9NA 4WTOB 3X20B 5GAN3 2LVMA 4V2SA 2E35A 1SHFA 3CCEQ 1O75A 3LLRA 1YN8A 2JT4A 5EGOA 3FRNA 3UGTA 3CCUT 2OTJI 4RTXA 2LC2A 3QP6A 5D5XB 3LGFA 2PVDB 4IUQA 1AZEA 1WA7A 1YIJI 5GAGJ 2GGRA 2YDLA 2X6YA 5J8CA 1EX4A 4NOYA 1IN5A 2E1HA 2EW3A 5K5RA 1W2BA 1LQ1A 2EFPA 4OOIA 4RB3C 1FYNA 4KBMB 4TVYA 4XQFA 3PNWC 1HC7A 4OMNA 5L3FA 2DXTA 1AU7A 5B3SH 2XD0A 1ORKA 2KROA 3HOSA 3ABUA 2F5FA 5AYFA 3KETA 2F1LA 4L9TA 3RUXA 4EM1A 4ZTUB 4OMOA 3OL3A 2NUPB 5L3DA 1E6HA 4H2SA 2O5RA 4HVUA 3CCVA 3E97A 3VYGA 2MYSA 3TOBA 4YRMA 4WXDA 1PHTA 2W48A 1UTIA 4EM0B 1BK2A 3DQVC 1REPC 3OYFA 4FYYB 4J9CA 3JB9I 2PJRA 3LQRA 1MMSA 1DU6A 2GQQA 4P5NA 1Y56A 2PMFA 5FKNA 1DJ7B 2I4NA 4UV9A 4PUSA 2Y69H 2ID3A 4PCQA 5EGOB 3R4KA 2AO9A 2BW3A 1E0EA 2EYWA 1YI2I 2D8HA 3ICAA 3GTJJ 4JRPA 4M7AG 2YXYA 3MKDA 2CWEA 4MZTA 3C95A 2JWTA 5K5OA 1YCYA 2XV4S 1S6LA 2BHZA 2NNYA 2V8KA 4XAXB 3BR2A 3MZHA 4PKCC 4BL0B 4U0WA 1BCOA 2KE9A 2DL5A 5FROA 1TG0A 3O8HA 3OOUA 1ZLJA 2VPLA 5B1AH 1ZG3A 2L4AA 2CG4A 2OX7A 4IEJA 2JPCA 4PJLA 3QU6A 5GAN2 2QQ8A 3S3NA 3FC3A 3VRZA 3HSFA 2OU2A 3HTRA 1HA8A 4AFZC 4YDQA 4UUTA 1VQ4Q 4YP0A 5ILUA 1ACIA 1U0JA 2K5LA 1EOVA 3VODA 2JM9A 4RTYA 4KT5C 2PG4A 4AVZA 1G5VA 4E7LA 4YRVA 1TWGJ 1O7FA 1O3QA 3S1QJ 3TO9A 1Y71A 3QJ6A 3RGLA 2PQWA 5J1RA 3BOQA 2LTOA 3SFZA 5F0FA 5L8RE 3GWZA 2WAFA 4J9DA 3A02A 1UB4A 4DOZA 2QGGA 3SHFA 5LJ3e 3TEEA 3QO8A 2A6EF 4G7OF 1WJQA 1ABOA 3EUHA 1VQ9A 1QCNA 2EPFA 1WH5A 5HKCA 3BZ6A 3X28B 3WTVC 2R92J 4PFPA 5F1RA 1NJ1A 2PJRB 3DEUA 1DU0A 4F04B 1LDKB 5JVTA 4PJNA 4FSSA 2IVWA 1MNDA 1T3LA 3GF5A 4FE4A 2CQKA 1YJ9I 1ZYRF 1JXSA 2CJBA 3QWLA 2MD0A 2BW3B 1IHWA 5I2MA 3FIWA 4GCVA 1X43A 4KITB 3N97A 2VC8A 1VQKA 3QYHB 3C1DA 4BYYA 1QKWA 1P4AA 3I4PA 1G3SA 1T33A 1YS6A 3JREA 1SVLA 1RAEB 2ZNYA 2PQ8A 3CZ6A 5F0HA 1P2FA 3IHUA 2COZA 2HZDA 3W6KB 2EFNA 2HQHA 3VYTB 4LD6A 2RJCA 2K9SA 3I4MJ 2DPPB 1SETA 2CW8A 5LRRA 2HAXA 4ZJZA 2LRDA 4RMOA 3FDYA 4P72A 3HOZJ 3DLLF 2CREA 3IH2A 4EIKA 4NL2A 3A8HB 5FKLA 3CCQQ 3GYHX 4BI3A 2QGUA 1BI2A 4NB5A 1H8KA 3BR6A 1WJCA 1RR8C 4M7AB 2RI3A 3ML6A 1V5GA 2R7XA 4J9HA 3FB9A 2Y9ZA 1I27A 3PFYA 2EGEA 1OX9A 3BTIA 5FFXA 3LSJA 3CCVI 2CDTA 4RCBA 4LN2A 4Q47A 1FOWA 3M8EA 4LUEA 4C0DC 3VEPA 3DKYA 3CCST 3BZKA 1VQNT 2ROLA 3JAMZ 2KBTA 3L2WA 3CC4A 3G71I 2R7ZJ 2OA4A 1YJWT 4M75F 2RHXA 4LLGF 2PN6A 1W7PA 3MJXA 3RKWA 1AOYA 2V9KA 3IALA 1UECA 3E9GA 3CCLQ 3ASOH 2RC4A 1V54H 2EJRA 5HS8A 1DQUA 1HLVA 1R6RA 2STTA 2GLOA 4NHJA 3PMIA 4BACA 3CC7Q 3SZPA 3E9IA 2BXYA 3PJRA 2LKSA 3BJOA 3LMMA 3BWGA 3EHRA 12ASA 1ULYA 2QLZA 4WCIA 4YRRA 2XPVA 1Q81R 1N78A 2RI2A 2HGCA 2DFFA 5GAMe 2EZHA 4F92B 2WB1A 4ZTZB 1NZ9A 2KQWA 4QPOA 2RDPA 4EJOA 3QPSA 2DBMA 1OYYA 3OYGA 3J7AY 2DVJA 4XTVA 3CCEA 3G1JA 3ZQLA 3CCRQ 1SD7A 2ZT7A 4OIRF 2A68F 1B6AA 5J1UA 2HBPA 3V8LA 2GIVA 2RV8A 4I02A 1QRYA 2NVUB 1U1TA 2M3AA 4AIDA 3SJMA 2JVHA 2HZYA 1NK3P 1YW8A 4K2EA 2EV0A 3LSHA 4C5EA 1BOBA 4F7ZA 2Z33A 3H5RA 4M7AE 2WC2A 2Y0SN 2G7HA 3PO3J 1IV6A 2IBDA 3HKSA 1YFHA 4OGEA 4M7DA 3PO2J 1B72A 3TQNA 3MKZA 2F5TX 5FD6A 1B07A 3VFZA 3EAEA 2OQRA 3A8MB 2XDDA 3JRGA 3OMGA 3HXXA 2COWA 4AIHA 4HCZA 1YTYA 2YSRA 1HDPA 1USYA 3PIPF 5ICEA 1W7PB 4BQNA 1IGQA 1W4MA 2M45A 5J8FA 5K5QA 1R5ID 3R61A 3UATA 4RKUE 1ZN2A 3G6ET 3ZMTA 3HRKA 5IYBJ 2KJCA 2CJ9A 1RKWA 3KP7A 2TRTA 2C6YA 3HXYA 4J6XA 4MQ9F 2BUDA 3L7WA 4AFSC 4EJWA 4JJNK 1SF9A 1JKOC 3H0HA 3CXCA 1KG1A 3BDDA 2OAWA 2ZAEA 3UR3C 1K8AU 2ECBA 1K6OA 1YJNQ 2NAZA 4C2UA 1LJOA 2JVGA 3L00A 1HKQA 5GAN8 3X24B 3TW6A 2CV0A 5GAN7 4I01A 2VBWA 4II1A 2ZNZA 3K1PA 3N5BB 1JI8A 2F5DA 2RQWA 3MP6A 5KK1A 2VN2A 3K4MA 4Z02A 1OOTA 2QUFA 2L2PA 2VGNA 4RAGA 5GANj 4UY8I 4CCNA 2XAUA 1Z91A 2WSCE 1I3AA 1F36A 4UP8A 2ME0A 3JCMP 4M7DB 1LPQA 1ERDA 4ZYEA 3RBBB 2LVSA 1OYWA 2XKOA 2QCOA 4HWRA 3QO7A 3CBPA 5HGQA 4YG2F 1WI9A 3AG1H 1XOVA 1PP8F 2GXGA 1BR1A 2IGNA 1S9HA 1I6HJ 3CC4I 4LVLA 3Q9SA 1MH4A 1VQ4A 4HT8A 3CUOA 3X26B 2K4BA 4PJJA 3C18A 2ZJRF 2IS2A 5D6XA 2CIMA 1XSXA 2FBKA 1FMVA 2CQQA 3K70D 3O3KA 3WTWC 2GIZA 1JBMA 3M56A 2D6FA 2TDXA 5CVIA 5A0LA 3GFMA 2DBBA 4CS4A 5GMKm 2DW4A 4MHGA 3EGXA 1WRJA 1SRYA 1X6OA 2V1UA 2PI0A 3FBNB 2FEZA 3SHWA 3A32A 1D3YA 5DDGA 1Q82C 4NDLA 2M2EA 5BMZA 4J7IA 1BIAA 2LR8A 5HCKA 4JLIA 2L3PA 2MF2A 1BN5A 4OINF 1QHHD 4CO8A 4UUVA 3CCEI 5C4JJ 5DUIA 2O3FA 1B9NA 5F27A 3S3OA 1FWZA 2LH9A 2ZFUA 4BD3A 1YQAA 2OTJT 4YCWA 1H3ZA 2ZNJA 1QA6A 2WAQA 4CRIA 3TO7A 5KCHA 1YIJT 4J7FA 5DTDA 1OCZH 3MWMA 4A4KA 3KP5A 2RQTA 1XDUA 4BI8B 1LCKA 2DU7A 5K7HA 3K70C 1KQ1A 3NTIA 1R49A 2ROTA 4II3A 2QA4T 3VUBA 1MJAA 2R57A 4M7DE 1G5IA 4ZGEB 2NXNB 3REOA 4DPGA 4A4HA 3T8TA 5LJ3h 1MDMA 1OEBA 4YFKF 3CTAA 1SESA 1YWPA 4Q48A 2AKKA 1TWCJ 3IAM2 2E2HJ 3HL8A 1W5TA 1RI7A 3BG7A 1N5ZA 3P8YA 1H641 3CCQA 4A69C 2DPUA 2X35A 1ETVA 4RGRA 3M0TA 4IHVA 3UGQA 4DIQA 4RG8A 1XTDA 3IWFA 2AK5A 4A93J 1NJIU 3RSNA 5CVRA 5K1PA 2A8EA 2VE8A 5H2FC 1W1FA 2FEIA 3RMSA 3EGXB 5HS7A 1K9MR 2RD1A 5BPIA 4ELYC 1MV0B 4L5EA 1SFEA 2M87A 4AT1B 1QPIA 1NTCA 3V7SA 2DTIA 4OMFB 1PYSA 4RM3A 1MBEA 2W24A 4KA4A 4G85A 3L9FA 1ZGWA 3EYIA 3L2UA 3I59B 4J15A 4LE9A 1WQ2A 2ARUA 4LXCA 1YNZA 3CCLA 4ZN3A 3MP1A 4N4IA 2E3HA 3M0PA 2CYZB 1D1CA 3EETA 3N05A 1TNSA 1LYLA 3VS2A 5DM6F 4ZC3A 5C51B 3DLMA 3CC7A 3WTTC 1WH7A 2QXFA 4M75A 3REBB 3NQOA 1DPUA 3GLXA 1R00A 3ZMUA 2KY9A 2BKDN 5M3MJ 1Y8QB 5L3GA 4N0BA 4CZCA 2BTTA 1A31A 2X4YA 1DPRA 4J9FA 1M2OA 2D1XA 3I5UA 3I35A 4ME7A 4BJ6C 3HPGA 1KD1C 5E79C 4AIJA 1ZBXA 1E17A 4XLPF 2XIGA 3VSLA 2DMNA 3CCRA 2LP5A 4O5VA 2CFOA 3NENA 1VQ4I 4EQQA 3F8NA 2GA2A 5HLTA 1S7AA 2VL8A 1ABQA 4EJTA 1CSKA 2A6HF 5GAN5 1K7AA 2L89A 1TUDA 1IO6A 4G6TB 2V1RA 3CPWP 4YFNF 3WXMB 3IRQA 2K3YA 4MFDA 4JZ3A 3SWNA 3HTUA 1JJ2P 1PP7U 4M9SA 2XPUA 3GP8A 4LVJA 5F1JA 1QQJA 1I3QJ 3VRYA 3M8JA 5LJ3f 1ZBJA 3KUFA 1PYSB 2HWVA 4RMFA 2LF7A 3WQZA 4E6KG 2DK3A 4YREA 2GXBA 4PDKA 4RS8A 2LBFB 5GAMg 4PL6A 4L0ZB 1IO2A 4CH4A 2BE5F 5GAMh 3B6CA 2Y0MA 5CAIA 4F93B 5D6FA 1X75C 2XROA 2DCEA 3CD6Q 2QF7A 1KC8U 2DE0X 4P3NA 4U0VA 4HNUA 3CP8A 3R60A 2B9SA 4M75B 3WU0A 3PIPA 2I4OA 4M7DD 2ZO4A 5H20A 2KT0A 2E64A 5FU7B 1UZCA 4M3BA 2EV6A 2LCLA 1PM3A 2E7WA 4KUDK 4AG1C 2ZIOA 2F48A 4A12A 1LJ9A 2F4OB 3QOPA 1YJNA 2VBXA 5GANh 3Q0WA 2JZYA 4IRGA 1U9OA 2X4XA 1I81A 3I56Q 5CIUA 2KRFA 3TP3A 4N4GA 3D5SC 4KN7X 2Z16A 4WJ4A 3NTHA 1Z7MA 4ZIBA 2E1MB 2QTVA 2EKHA 3HFNA 2LREA 1ETKA 3PNYA 3A5ZA 2DEUA 2ME6A 3OWTA 1Z21A 3CCQI 2ABLA 3NWTA 4AM3A 4BBRJ 1Y8RB 3F8BA 2RF0A 3BLYA 1N25A 2L9RA 1NLOC 2B8AA 1IL2A 1WYDA 3SWNB 4E47A 1VZ0A 4OMPA 1GGMA 1B1BA 2E5KA 1Z9ZA 3RERA 2DDBA 3MEUA 3ZQGA 4KJZA 3BG3A 2C06A 1WHLA 4PFZA 3G71T 4P3PA 2V7FA 1VQ8T 2EQMA 1WX6A 4M7DC 2K3BA 3TDUC 2JT1A 2P81A 2XGTA 2ZNIA 4BHBA 2JUFA 2ZSHB 4HWOA 4CYCA 2XAFA 2C7IA 2NUTA 1AHJB 4LDWA 3A01B 1Y57A 2D1HA 3CCJI 4XSXF 4BQAA 3CCLI 3LSKA 4EJVA 4TQDA 2HOSA 2O01E 1PSEA 2HSEB 1IF1A 4P71C 3B6AA 3LSRA 1N9WA 4PHCA 3AL0B 5KCOA 1JKRC 4M72A 3HRMA 1R9TJ 5KNLA 3LWIA 5GMKj 4M75E 1MJBA 2ZSIB 2DJIA 3DSQA 1K76A 1T0FA 2KYBA 1TBXA 1HK9A 1PVEA 2FB7A 3JCMV 4FL6A 2QAZA 4PNOA 1MGQA 4UB6C 3GX4X 2DQ0A 2ZC2A 3URGA 1WJAA 3JCMh 5GAMf 2Q7EA 1YW7A 1SFOJ 2DAOA 5TISC 3FZVA 1WHKA 4OB1B 1RNLA 3RYPA 4YRNA 2IEKA 4CC2A 1WQ7A 3A5ZB 2BV6A 3CCRI 4Y52J 2E1CA 1X01A 2CP0A 1JJ6C 4LB6B 1NHAA 3UFGA 1IN7A 4Z8AA 1AKHA 2DT5A 3WGGA 4WX9A 4WXCA 1JB0E 2GOXB 4V2FA 4PJMA 2G3RA 2PUKB 4XOPA 1DGWY 1BJAA 4JDSA 4XN0A 4LIUA 2QENA 3D0SA 1AZGB 3SD4A 3GFIA 3EH1A 4HWPA 1NBEB 2W4SA 4OMQA 2XGEA 2ODRD 4BU2A 1WVRA 1JGGA 1Z6RA 2M8EA 2XKOC 2DIGA 4FT8A 2QQ9A 1OPKA 1GDTA 3OYJA 1Y39A 3QPTA 4XICA 3RR6A 2LJ3A 3T8RA 4Q5WA 1UDLA 1RL2A 1KQSA 4N0AA 3FX3A 2HDCA 3H36A 2BZTA 1R4MB 2DX1A 3P9IA 5E3MA 2C0TA 4D5CA 3HY0A 4HF1A 3TUPA 3CJRB 1U3OA 3CCMQ 1G3TA 4EX5A 1R0BG 2IPOB 3KLNA 4AH6A 1ZR4A 1PC0A 3JCMX 1IN6A 3BG9A 2DA6A 2LK2A 2PMZA 3WTZA 2MPXC 2CKKA 1I39A 4WF2A 1GCQA 1IN4A 1XCBA 5FKOA 2HNHA 2VLAA 2YUPA 2NS6A 4IHTA 4RMNA 5EF6A 4C0GA 4DYQA 4CC4B 2ODRC 4D8KA 1QMCA 4KUMA 4CS3A 4L59A 2HCKA 4GFBA 3H0FA 5GAOm 3CDLA 2RJDA 3VB2A 3ERED 3A03A 1AKHB 5I2SA 4EJUA 2MBFA 3L1AA 3ZL7C 1SAXA 1BB9A 2DZCA 2FXAA 2KXCA 2V9PA 3CO7C 1YYVA 4H2YA 1GV2A 2K79A 1KHCA 2A3SA 3E6CC 2EQRA 1QVFA 2DVEA 1OULA 2L3QA 3SXYA 3JCMf 1TWAJ 3UDCA 1UJ8A 2M30A 4FT4A 1SD6A 2EQJA 2L2OA 4IOAF 2VWFA 1GL5A 4CDGA 2ELHA 5IH2A 1NNHA 3LWHA 3FXJA 2IIMA 2ZBKA 2KIMA 4H4KC 3HHHA 2P0WA 5DS9A 4HLYA 3LL7A 4ON0A 3DBLB 1R22A 1WJDA 1YITT 1Y0UA 2VKNA 4OU0A 3M1CA 4U87A 4OP0A 1GBRA 3MCAB 3THKA 1WGSA 3QPHA 2YUNA 5KAIC 2PVOB 4TTVA 1WDXA 2AQFA 4C5GA 3V8JA 2PMEA 4ZYHA 4J9IA 3ELKA 3BG6A 2Q5IA 4IL6C 3JRZA 4RB1A 2R5ZA 3IG2A 4MMKA 2EVRA 1I8FA 4BJ5C 2P7CB 1KGSA 4P96A 3BQZA 1E1TA 2HOEA 1MNMC 2XC7A 2E4HA 4M77F 3W2VA 3OMYA 4LLLA 4AD9A 4YRIA 1IUYA 1PNJA 2V26A 3CD6A 5FFZA 4YCVA 4XKBA 5JLXA 4P3OA 4IIOA 4E6RA 2R7RA 1UFMA 3I9QA 2GM4A 5C52B 1IXSB 1IB8A 2PTKA 1BJZA 1PD0A 1KJWA 2HSPA 2HFHA 2IS1A 2EZIA 2R5MA 2VGMA 2BBYA 5IP7J 4XNFA 2O4XA 2CQXA 1X2MA 4UXNA 4D0PA 3GOXA 2RK1A 3K10A 3PSIA 1W5SA 2FF4A 1VIEA 5C6SA 2QDLA 3I56A 1WJ5A 3LSTA 4TVRA 3HEFA 1FMWA 2RJEA 3UNGC 1JRIA 1F4KA 2YUOA 4ZZDA 2DBKA 1UHWA 1K73C 2L02A 3E6BA 3BW1A 1FYFA 3LSGA 2JJ9A 4Y91A 2F5VA 1B7TA 1IW7F 5F0CA 4IPAA 4C8QD 1UB9A 1U06A 2K7AA 1M1KC 1VA7A 2E1MC 1R8OB 2HL3A 3ONQA 5A2QK 1HW2A 5E18F 2DD5A 1NE8A 4XU3A 4Q5SF 1GXIE 2R7SA 2MC3A 4E7JA 3OYEA 1UFFA 5JVGF 2AXTC 1LDDA 2R5ZB 2J5PA 7AT1B 1EVKA 2H6CA 1AA7A 3KBGA 1PUEE 1MGTA 1HDDC 2DMUA 2P4WA 2ZCWA 5J3LA 5AT1B 2PVGB 5GMKh 2HNIA 1ON2A 1VQPQ 3UT1A 3CQTA 4XLEA 2VQLA 3MD2A 4FTHA 2AMCA 6AT1B 3BQYA 3GCMA 2E3CA 2RQVA 1RUWA 3QO5A 3E1SA 3NGPA 2MCNA 1SFUA 5FB2A 5CCAA 4ZH4F 3QZ9B 2IA2A 2A08A 4C30A 1N77A 3IV5A 5AIQA 2R3SA 4R0KA 2DM1A 2JVVA 4C8QC 4LIVA 4HRIA 2DLPA 3OSVA 5JLWA 4KIBA 2XI9A 2A7YA 3SDGA 2FQ3A 2XG8D 3CMEQ 4PLLA 3BT9A 1YWOA 2M9UA 3JAME 2IS6A 2J6FA 2MAMA 4XLHA 3VS7A 4H2TA 1ZG5A 1VQ5Q 3HOWJ 1K9MU 2EIKH 2F4IA 3NEUA 4ENMA 3E5UA 3S2WA 2DOAA 4F14A 2WSEE 2H6BA 4BJTA 1S5LC 3MF2A 1O3SA 3IAS2 4BUGA 1X19A 5HLHA 5IHNA 2NS0A 4TV7A 1C6VX 3L4GA 4M9ZA 2KRMA 2G7UA 4IF4A 3CCYA 1BW6A 1TQMA 2CV2A 3BR3A 2EIJH 4DW6A 2DF6A 5JR3A 2D8JA 1ZKGA 3IKMB 3ZMVA 3WE3A 3KEOA 4YEJA 3OOPA 2EWNA 4ESJA 4NUBA 2EYQA 4G7HF 1QVGP 3OW2A 2VASA 3NWSA 1WI7A 1LFBA 3S6WA 3MHXA 3HGYA 3CD6I 2LCSA 1M5Q1 1R77A 3R0AA 1I1JA 5L3BA 2DK5A 2YHTA 1KQ2A 1YE9A 4FISA 1FPQA 2KIQA 3CCMA 3PL8A 2XGDA 4BI4A 3OIQA 3IH4A 2HMAA 5D6YA 2CW7A 1XMKA 5LGTA 4HX4A 3J7AF 4CXFA 3LAJA 2HQEA 5TJJA 4WXHA 2P6TA 5HDNA 4OMZA 2LLKA 4ENNA 4KMUX 1H4SA 3H0IA 3I56I 1SD5A 3MKWB 2DZ9A 3LSSA 1W2BP 5I21A 1BKBA 2ZPEB 3M7GA 5IYCJ 3HY1A 5I22A 2DMTA 2E36A 2QG9B 1NM7A 2CP5A 1GVJA 4YIRX 3WE2A 3UPUA 1HF0A 1M1GA 1VQLT 2FBHA 1QBJA 4RCCA 5JI6A 3I5SA 2LNBA 1FBQA 4OIQF 2X85A 3VS0A 3ZMDA 2AZVA 4EMGA 4M3EA 1Q7YC 3L4GB 1DP7P 4TWAA 3FXMA 2C0IA 1ZSZA 2EJ9A 3F9KA 3Q0UA 3CBMA 3GBQA 2GQIA 1YBYA 2SEMA 1K9AA 4C92F 2VKVA 4FU6A 3FLGA 1XMXA 2HS5A 2LMDA 1UGPB 1H88C 4RTZA 3CCJT 3K1MA 2HYJA 1AWWA 4LLNA 4YPFA 4IHXA 4HSTA 2KFDA 3V42A 4BQOA 2JM8A 3F6VA 1QWEA 1E2XA 1X55A 1FX7A 2DFEA 5E1XA 4M77G 2ZR2A 1M4ZA 2JN6A 3DV8A 4GYIA 4N0AC 1HD3A 4X9CA 1DP3A 1K0XA 4HV6A 2OTLQ 2PZ1A 3AHUA 4A3EJ 2UXXA 4B9XA 2YUSA 2COMA 3I71A 3SZTA 1VQ6Q 4GRIA 3ABKH 3ZP5A 2HQXA 2EKOA 1WIEA 3A1PA 2IXSA 2K27A 3H0GJ 1GCQC 3Q1JA 3HP9A 2GAUA 1YRNA 3TEHA 1FP1D 3VPRA 3E5QA 5IP9J 1TW3A 3A4CA 1HKSA 3EPZA 1GFDA 5HK3A 3HPHA 2I8DA 1UGVA 1Z7LA 3U1KA 1B8IA 3BG5A 2F2XA 2DFIA 1O3TA 4M77A 3A7RA 1IN8A 4A2UA 1XDSA 1FOYA 2TCTA 4P9FA 3CCUQ 3L2QA 1ZRDA 2XAHA 5F04A 4OMYA 1ZSZB 2M0MA 1FEXA 1HSTA 3HRIA 1P4WA 4P75C 4FYXB 2Z5UA 2Z2SB 2HOAA 1VYVA 3IRRA 3AT1B 4EMKA 2WACA 4A0ZA 2EJFA 3MMYB 4NL3A 5K1XA 2DOEA 2K9NA 2WADA 1P6RA 3QNEA 3A8OB 2LNHB 4DBRA 4MZPA 4BY7J 3ME9A 3S2DJ 4FE7A 2JTFA 4LOCA 1J5WA 2X1EA 2GTJA 4J6YA 3CCMI 3HRSA 2P5VA 3CMAT 2AKWA 4JJBA 2JRTA 2K40A 4BE2A 4HXJA 2XGCA 3L1PA 1TP4A 3PNTA 3QHSA 1XQHA 2EH3A 1JGSA 2DOFA 1Q86R 2CUEA 2FQ4A 1WU7A 2RM4A 5FWBA 1VQPA 4EGZA 1K78B 1OQKA 1X3UA 2VXFA 2X4HA 3G7ZA 4AIKA 3HL2A 1YRNB 1KHIA 2ECZA 1NEBA 3M59A 3HRUA 4O3MA 3KYDB 4GLMA 3BR5A 3BR0A 2WV0A 1FIAA 4A4EA 2JTMA 2HDWA 2ZMEC 2LNVA 5GTHC 2O31A 5FWCA 1AD5A 1R23A 1NPRA 2DIQA 4M77B 2K57A 1Z9QA 2Q5HA 4IXAA 2KZVA 4D1QA 4AG2C 3T0YA 4DJAA 3X2QH 3R07A 1W6XA 3BTLA 3E6DA 3JSCA 1IDZA 3CMEA 1D5VA 3T9NA 4M6XA 5LBQA 1K1ZA 2ZIMA 2EV5A 3PMTA 4ESFA 4LGWA 3RDIA 1OQYA 2KT1A 2QTXA 3QQAA 2NVXJ 1VQ5A 1TL8A 2H8WA 1FOXA 4EMKB 4BQQA 5GAOq 3S32A 1QO0D 4TQFA 4JOMA 4RGXA 4G7ZF 5EG0A 1WWXA 2JK3A 4BE1A 2R7DA 1MSFC 2RHSA 2JJ7A 2EIMH 2O6GE 1PUFB 2EFWA 4GY5A 2YUQA 1FTTA 4M78D 1H89C 2DETA 1QWFA 2VYTA 1IHVA 2ALYB 4LVKA 2AKWB 1MSEC 3SDZA 3G4SQ 2GA1A 2VJ5A 2EQIA 3C2HA 2BE9B 1OFCX 1X58A 2MABA 1RIOH 1OCTC 1KMMA 3GZ6A 5L3CA 4G94A 2OPTA 2LKPA 9ATCB 3P9KA 3RL6A 1B59A 1X2GA 2JXBA 3GW2A 5GAN6 3A7AA 1YB3A 1F1BB 4KISA 4E7ZA 3IC7A 3C12A 3GTKJ 4JRQA 5C3EJ 2A37A 2VODA 2RI5A 2VJJA 1K8AR 4BXXJ 2ZCFB 3HYIA 5B5EC 3OYDA 2WBMA 3Q3SA 2QI2A 4YFXF 2KAFA 2NVYJ 3HDDA 4AYBN 4XTXA 1KQ0A 1QW1A 1Z77A 4IURA 1SVOA 3JR9A 2FPFA 4EV0A 1X1CA 3RQ4A 5FO5A 3I0TA 1D3BA 4B4CA 1SRLA 1JU5C 5LFAA 4CCOA 3WU2C 1J3TA 1POGA 1X2QA 4GLKA 2K4YA 5E3NA 4M77E 4XTYA 3ZQIA 2CZ7B 1C0MA 4HCKA 4M78C 4DNCA 3M54A 4QQGA 4H2XA 1X2KA 3FF5A 2OV7A 1FTZA 1M90C 3K4LA 3L2CA 2RN8A 3CDHA 3LQQA 4WCGA 1W70A 4JLGA 2DI3A 2M16A 1ZAOA 1IXDA 5EG0B 3TMOA 1IRGA 2RHSB 5H6RA 2R5YB 2CU7A 1WKMA 2LP0A 1VQ7T 3EH2A 3FXOA 2K7LA 2ZKZA 3NETA 4XL9A 2FX0A 2MFZA 5CK9A 3CPFA 3MEXA 4E7IA 2FRYA 2EA4A 4XN3A 1WLPB 3HM5A 1VYTA 3IQLA 4PJOA 5HK0A 3U21A 3K6GA 3H6ZA 1ZUYA 1FMKA 2O8KA 1V1CA 2AHQA 3B02A 3HFZB 2PU9B 1OR7A 2ESWA 1BR2A 3CCSQ 1M2VB 1VQPI 3H92A 3CXCP 4JYKA 5IY5H 1NJIC 1KYWA 5FLXE 4LG0A 1LUJB 1QE0A 4LMYA 2XAJA 2DA2A 2IVMA 2N8GA 1D3BB 4X1EA 1A0NB 3F3XA 1Z3XA 3H3UA 1G3YA 2KISA 5J4VA 4C92A 1QPMA 5KYXB 2OTLA 1ZGAA 4H2UA 2YWWA 1LVAA 1NJ2A 3LA2A 2YPRA 2DO3A 3WTSC 3RKYA 3K0LA 1XGSA 1VQ6A 2XAGA 4H2XB 3KP6A 2ZINA 5C4XJ 4V2GA 3GLLA 1M3CA 2X9HA 2WTEA 1HSQA 1FSEA 1RAHB 4KRTA 2D1VA 2LC4A 4E4HA 1Y1WJ 4MEXF 3RPUA 1LE8A 4C2TA 3COAC 3F70A 1GHCA 1VQ5I 4YRJA 2L3RA 4M4ZA 2NOGA 3FXRA 4A3KJ 2PJPA 1YGBA 1T08B 4F91B 1AWCA 1R7JA 2E5ZA 3QDFA 4N4HA 1A6QA 3IKLA 2M5WA 1BBUA 4BWAA 4MTDA 2LD5A 1UUEA 3CCUA 1B8AA 5KHDA 2L9VA 2XPWA 1OCPA 3HTSB 2JS0A 4PJOB 4M71A 4KR2A 4Z6YA 3FJPA 2M02A 2CQNA 3DXJF 5CKFA 3DTIA 1E3HA 2FPDA 2K9LA 3MZ8A 1S72T 3TBIA 4OLFA 2ICWG 4LJZF 2CO5A 2P4TA 4ENKA 2IA1A 3SYTA 5ICFA 5FW9A 2DL7A 5CKEA 1S1NA 1JE8A 4G84A 4Y3OA 5CKTA 2ELJA 3CD6T 2YU9J 4JS4A 4LG0B 1U5SA 2EBPA 2Q7HA 4FW1A 5D4RA 1GBQA 3OB9A 4LITA 1HTTA 3UF4A 3JSPA 4KIFA 5CVJA 3T5XA 5LJ5j 4C92B 1Y07A 1UE9A 4LVIA 2FA5A 1H4QA 1VYUA 4RLQA 3G6EQ 2CUZA 4KT6A 1BC7C 4GYGA 3REAB 3TEGA 2BY3A 4E51A 1HBXG 3WTUC 5HDGA 3K4JA 2B0LA 4Y15A 3PM1A 3I7FA 4IRHA 2R93J 3BPXA 3G1MA 2IS4A 3OSGA 1LE8B 1TS9A 3D5RC 2HR3A 3LH5A 2V6CA 3DB3A 3QKJA 1WPKA 1VQZA 2Z99A 2O03A 1HW1A 5GAEJ 5CJ9A 1G8XA 3G3ZA 4Y92A 3FDRA 3ZMSA 4NBQA 2DTRA 6PAXA 2LJ1A 3CC2A 3EQLF 3K4KA 3OIOA 1M8VA 8ATCB 3LSQA 2MWPA 2XB5A 1FYKA 5D6EA 1PKTA 2DFHA 1PRMC 2DT7B 3A5YA 4L5JA 2MD5A 2E71A 1R4NB 3HKZA 1HXDA 1WJSA 2KKOA 1AT1B 2QBYA 4HWSA 1MNEA 4PJOE 1K73R 1N8RR 4FSXA 4YRFA 1FBUA 2DO7A 3MZYA 3EFSA 3QYGB 2HPIA 1K4TA 3FK7A 4C2MJ 1GXQA 1M1KR 1TZLA 3LOCA 5KE2A 3ZR8X 1WQWA 4HNVA 4Y13A 2QYOA 1WHJA 1Q82U 3PCOA 2OQGA 4LDXA 2AIRB 2RJFA 3ABMH 2D5VA 2FO0A 3MO8A 4E2FB 1KC8R 3V8KA 3A8LB 3CBOA 3NARA 3G4SA 4XK8E 1HKTA 11ASA 3GNFB 1EJ9A 4C92E 4M3DA 2OTLI 4XQ3A 3RIRA 3GTQJ 1JTYA 2RHIA 1VQ6I 5DEQA 2BGCA 1OMIA 1HYOA 3KP3A 4UNOA 2GBQA 2H3JA 4L18B 2VKHA 4LNPA 2CZ6B 4EPCA 4IO9F 4M7AA 3TVTA 3RZOJ 5E3OA 1W0UA 4XLAA 5KCMA 1RACB 2FOKA 4M6VA 3M0UA 2JMAA 1FT9A 1SFXA 2E3IA 5HNHA 1Q1HA 5DCMA 1YCSB 3TSWA 1ONVA 2KXDA 2HYFA 5CVUA 2L7KA 3CCUI 4YRSA 3OS2A 2CP2A 3CQZJ 3IH3A 2WWYA 1R1TA 2P5IA 4RA2A 2XHCA 3O2PE 2QBYB 1L0WA 2YR2A 2QA4Q 4JP0A 3ZRGA 4R79A 4RLFA 2Y4XA 2LYCA 3SFMA 2DYSH 2A28A 3BCAA 4ATOA 2EJGA 1YO5C 3BROA 3FJ5A 4K88A 1IAWA 3MEVA 1NYFA 5GAOr 3EFOA 3FKJA 4UVAA 2NS7A 3PCOB 2ISYA 4BNCA 5M5XJ 2WAEA 3J80K 4OMMA 1A5JA 2P4RA 3N4MA 3VU3C 2RH2A 5FU6B 2PNIA 3CCMT 1KU2A 2FRWA 1QZZA 3QYFA 1P7JA 2BEOA 1I5OB 4ZGDB 2KRCA 4W97A 1XSVA 4I2OA 1TLHB 3ASNH 3P7NA 2QEXT 2YRVA 5J26A 2Q1ZB 2IP2A 4OAYA 2F2VA 3DB4A 1VF9A 4P74A 4QW2A 3Q0VA 3CUQA 2LQ8A 4MZMA 1T2KA 2V1QA 2A07F 3CCSA 4OIOF 1SHGA 1BCMA 4BY6B 4XTZA 1SPKA 1ZLMA 3ZXSA 2LQNA 4D8DA 1Q81C 2FRHA 3RACA 2JNGA 2B86A 4UP9A 5IXBA 3VQWA 3HSRA 4J01A 3WHCA 1IZ1A 4C5IA 2DTHA 1W1WE 1U5TC 1I1SA 3UWNA 3JB9D 5D6WA 4BUPA 4JPBW 3RI4A 5DCMB 2DRMA 3CC2I 3P8HA 3WTXC 1EV7A 1J59A 3MP8A 1I5LA 2BY0A 2KDZA 1BI0A 4PJOD 2A5WA 1B76A 1B9MA 4LK1F 5CKDA 4XMYA 1PRLC 3UH0A 1CKBA 2RPNA 5TGTA 5GAN4 3A7UA 4A54A 4A0YA 2P0PA 3M4GA 1TXQA 2H09A 4HDUA 1F5TA 2R0QC 3A0HC 4RAFA 3EFOB 2K9QA 1MHNA 2ZZFA 1ZG1A 5FRNA 4PLIA 2ZZEA 3KEYA 1ZUUA 3M1EA 4I0AA 2EFIA 2VQCA 3RKQA 4A0XA 3FK6A 1NK2P 2UZKA 1UGQB 1Q86U 3E9FA 3VWBA 4XU0A 2A69F 1OX8A 5KYYA 3G4SI 2MH2A 1M1EB 5CQYA 2FYKA 2H3EB 2XSDC 2O2OA 1B7YB 3ABLH 4ZDPA 3RTRA 5LJ5h 1BOAA 2ZXJA 3CUQB 2R7QA 4BBSJ 1BBWA 3RPUD 2Z9OA 2MIOA 2GQVA 4PJOC 4K87A 1K0SA 2Y2ZA 4ZTFA 4MFEA 5FLXK 4DEYA 1SSFA 1SFKA 2JZ2A 4GBQA 1J9IA 2ZB9A 3DPUA 2HVSA 3JW4A 3ABTA 3BFMA 1ZA2B 3JTHA 1K6YA 1ARKA 1KSWA 4XBFA 5GANe 2IAIA 3RDVA 5C0MA 5LEKA 1NH3A 1WI3A 1N75A 3G6EA 1JXMA 4OMLA 1VQ9I 1I5ZA 3G1ZA 4RBOA 2CMPA 1XCVA 4TVAA 2HXIA 1D1BA 4D6WA 1XGMA 3CPWS 1QVPA 1V4RA 2DT6A 1MMGA 4HVCA 2QQAA 1TW2A 2KNBB 1JJ2S 1UG2A 2GF7A 2V9VA 3WG9A 2K9GA 2UWMA 2CUFA 4GGGA 2DRKA 3F8MA 1WJBA 5CPRB 5D8LB 4L87A 2VKEA 4BEHB 1JKPC 1C0WA 3KFUA 2R4GA 4HKEA 1VQKI 4XONA 3BPVA 1YX3A 1OZ2A 4GXOA 2C8MA 1VI0A 4RG2A 5AIPA 1D8JA 3EG1A 4XRSG 1U1SA 2BY2A 4L9JA 3EGDA 4I98B 2CH4W 3DKMA 1SEMA 3RPQA 4YRQA 1L0OC 4CHUA 5KYYB 3JCMc 3M4OJ 2I2LA 3DEWA 1SANA 4J8OA 3LGLA 1KQSP 1DUXC 2G0EA 4JK1X 2W84A 1ETOA 1W4SA 4A3GJ 1I50J 1ETYA 2H27A 3PVLA 1SRMA 3I54A 5KH6A 3QTCA 4JX4A 1GCPA 4HDVA 3BY7A 2DDAA 2Q2EA 1HOMA 4P73A 2M1HA 2Y30A 3GIBA 3WU1B 3G71Q 3CCSI 2M0CA 3SZGA 1VQ8Q 4ZYDA 5A0DA 1XN7A 3CLOA 3REUA 3GZ5A 1YHQQ 1ZRFA 5E3LA 3TCJA 1DGRM 1XJWB 1KA8A 4ORZA 2Y75A 1SG5A 1N9SA 3WHBA 3JCMe 1Z3YA 1D5YA 4BXFA 2LFBA 1VQOT 1B34A 3M4PA 4ZZLA 1IUFA 4AU7A 4IRIA 4JBAA 3CMYA 2K6DA 4TVAB 5IT9E 1MBGA 5EEAA 2KI7A 4Q15A 2JTVA 2COYA 1Z05A 1NPPA 3MEYA 4HBLA 4HX8A 4KUIA 2DXUA 2ZJ2A 4CZZA 5D7UA 2KRHA 2RNAA 2FMYA 3JCUC 1T3SA 3I55Q 2F69A 3O8VA 1QVFP 2FNPA 3KEQA 2J5OA 4Q6GA 5L23A 1HW5A 3CESA 3ZQQA 1BC8C 3OA6A 3EG2A 4Y7NJ 3LSPA 1ASYA 1EH7A 2MK5A 1J09A 3EGDB 1MBHA 5HODA 2YSQA 3GEZA 4A63B 1IRZA 1BBYA 3JTGA 4L9NA 5BPDA 1X54A 1Y0NA 3H3VK 1MD0A 2LY1A 1A6IA 3HPWA 2BE7D 3A31A 2C0OA 3JRBA 4OF1A 3FMSA 1MUZA 3I59A 2ZPGB 4C3HJ 2RQPA 2XASA 3HOTA 1FYMA 3QO3A 3WVDB 3JB9G 1CQTA 5ERIA 2QA4A 2Q2EB 3L2RA 2I10A 2VI6A 1YLFA 4MDWA 1N9RA 4M6YA 4M7AD 4E7HA 2KK4A 1B3QA 3KZYA 3IWZA 3VQVA 3BE3A 1ZGJA 2HZTA 2EINH 2LOOA 4OWRB 2UXNA 3LC0A 3IKVA