4LVMA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (23nt). mn-bound crystal structure at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
198
structure length
192
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMADM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 49
structure length 192
sequence length 198
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvmA01
2NS6A 4LVIA 4LVLA 4LVKA 4LVMA 4HT4A 4LVJA
chains in the Genus database with same CATH superfamily
3MEYA 3P8VA 4RDXA 2I4MA 3RACA 1B76A 1E1TA 4CS4A 3W3SA 3E9IA 2XGTA 4P3OA 4YRFA 2E41A 3L4GA 3HY0A 3MF2A 1WNLA 2Q5IA 2XTIA 2E1HA 2ZR2A 1YFTA 1SETA 3UFGA 3HY1A 3RKYA 5C51B 2EJFA 2DU5A 3UGQA 1SRYA 4XU3A 1X2HA 1H4QA 4YCWA 2P0LA 2CJBA 3PCOA 2E10A 4YRLA 3RKWA 1PYSB 4XTXA 2RHSA 1JJCA 4G85A 1G5IA 5HGQA 1QF6A 5ELOA 3WQZA 1YFSA 3E9HA 2J3MA 2ARTA 3I7FA 4YYEA 2DZCA 3TEHA 2DQ0A 3A32A 1FYFA 5C52B 2ZIOA 1QE0A 5K1XA 3EFSA 3REXA 4HWSA 3P8TA 3KFUA 1IL2A 4H2XB 3ICAA 1B8AA 3DSQA 1KOGA 2J3LA 1C0AA 2ODRC 4XTYA 3VQXA 3MQZA 2I4OA 1YGBA 2ALYA 2HNIA 4YRCA 4LVLA 4H2YA 2CJAA 1ASZA 4XEMA 2DJZA 2DKGA 1EIYB 2DZ9A 2RHQA 4HWOA 4XU2A 2AMCB 4RQEA 3HRKA 2ZZGA 3A31A 4KR3A 4ZTUB 1E1OA 2G4CA 2CGHA 2AKWB 1X54A 4YRSA 2AKWA 1KMMA 4YCVA 3HXZA 1B70B 2DTIA 4XEOA 3IALA 4HWTA 4YROA 4YP0A 1Z7NA 4OLFA 1NJ8A 1EFWA 4P75A 1NNHA 3CMQA 1PYSA 3LSSA 4HT4A 2ZCEA 2FYKA 4HWRA 4P71A 2ZZFA 4PG3A 4J15A 1YB3A 3REUA 3VQYA 3NETA 2E64A 4YRRA 3P8YA 1HC7A 4UP7A 2ZXFA 5C53B 4LVMA 1EIYA 4PHCA 3V7CA 3FJPA 4H2SA 2DQ3A 4Q15A 5ELNA 4EX5A 2DXUA 2ZINA 4WJ4A 1NJ2A 3BFMA 2IY5B 4UPAA 4X5OA 4EO4A 1RIQA 3TEHB 4G84A 1WQWA 2E65A 3HXYA 4WJ3M 4XU1A 2QHUA 4TWAA 4ZTZB 3OD1A 4XTVA 3BJUA 2ZT7A 3ERRA 1WYDA 4L87A 4YDQA 1KMNA 1H4TA 4K87A 4YCUA 1HXDA 4CS3A 4XU0A 3NENA 3HXVA 2IY5A 1YFRA 2AMCA 1EVLA 4E51A 4HA8A 2RHQB 3RGLA 2EJ9A 3RL6A 1H4VB 4TVWA 3V8JA 2ZNJA 4YRKA 1G51A 2DDZA 1N9WA 3V8LA 3A74A 11ASA 1SERA 2NS6A 4LVKA 3HXUA 4H2WA 1J5WA 3G1ZA 3QO7A 4H2XA 4YRJA 2QHTA 4CH5A 2DEQA 4XTZA 1BIAA 1NJ1A 1L0WA 1W66A 4UP8A 4YPFA 3L1AA 2QHSA 1GGMA 3A7AA 3RKXA 3HRIA 1JJCB 2ZTGA 4BWAA 4RQFA 2EL9A 3VQVA 2ARUA 2Q7EA 3M4QA 3UH0A 1USYC 2DXTA 2ODRD 4CH4A 3LSQA 1NJ5A 2ARSA 2ZT6A 2DTOA 3A7UA 3IKMB 1X2GA 4LNSA 4K86A 3MF1A 4YRTA 3UGTA 3M4PA 3RIRA 4WF2A 2PMFA 4TVAA 1WPYA 2EAYA 2ZT5A 2PMEA 1ASYA 3NEMA 1ATIA 3NELA 3IG2A 1G5HA 3VBBA 3R07A 3HTZA 2ZNIA 1BIBA 4P3PA 2A8EA 1ADYA 3L2ZA 4BW9A 2EWNA 3IKLA 3V7RA 2ZT8A 1NJ6A 2QHVA 2DU7A 1BBWA 1X01A 1EOVA 3EFRA 1EVKA 1EQRA 5KNNA 3TEGA 2ZZEA 2Q7HA 2E3CA 5E3IA 4YRGA 1E24A 1NYRA 4P74C 4KR2A 2C7IA 4HWPA 3HFZA 4RMFA 4NCXA 3A5ZA 1Z7MA 2Q5HA 3A7RA 3L4GB 3PCOB 4KQEA 4P72A 4YRMA 4HVCA 4YRPA 2I4NA 4P74A 3RUXA 4O2DA 3QO8A 1H4SA 1X55A 4P75C 12ASA 3HXWA 1E22A 4YRNA 4P3NA 4TQFA 4P73A 2ALYB 4H02A 3RF1A 1B7YB 1HTTA 4CH3A 5K1PA 2I4LA 4K88A 1X56A 2Q7GA 2P5IA 2CIMA 2RHSB 4YREA 3A5YA 1WLEA 4WI1A 3QO5A 1WQ7A 2CJ9A 4XTWA 4TVYA 4YRIA 2E5AA 2EJGA 4Q6GA 3TUPA 4CH6A 4P72C 1VQZA 1LYLA 3LC0A 4CS2A 4XTUA 3PZCA 3HFZB 4H2TA 2ZGWA 4TTVA 3HFVA 1B7YA 4H2VA 3QTCA 4OP0A 2DVEA 4H2UA 4TVAB 4DPGA 1NYQA 2ZR3A 3VQWA 2DTHA 4YRQA 1USYA 4P73C 3V8KA 1BBUA 1WU7A 4TQDA 4ZIBA 4LVJA 2C8MA 1ADJA 4AH6A 4LVIA 2ZIMA 3QNEA 1B70A 4DQ2A 4UP9A 3HXXA 1SESA 4P71C 5F5WA 3V7SA
chains in the Genus database with same CATH topology
3MEYA 3P8VA 4RDXA 2I4MA 3RACA 1B76A 1E1TA 4CS4A 3W3SA 3E9IA 2XGTA 4P3OA 4YRFA 2E41A 3L4GA 3HY0A 3MF2A 1WNLA 2Q5IA 2XTIA 2E1HA 2ZR2A 1YFTA 1SETA 3UFGA 3HY1A 3RKYA 5C51B 2EJFA 2DU5A 3UGQA 1SRYA 4XU3A 1X2HA 1H4QA 4YCWA 2P0LA 2CJBA 3PCOA 2E10A 4YRLA 3RKWA 1PYSB 4XTXA 2RHSA 1JJCA 4G85A 1G5IA 5HGQA 1QF6A 5ELOA 3WQZA 1YFSA 3E9HA 2J3MA 2ARTA 3I7FA 4YYEA 2DZCA 3TEHA 2DQ0A 3A32A 1FYFA 5C52B 2ZIOA 1QE0A 5K1XA 3EFSA 3REXA 4HWSA 3P8TA 3KFUA 1IL2A 4H2XB 3ICAA 1B8AA 3DSQA 1KOGA 2J3LA 1C0AA 2ODRC 4XTYA 3VQXA 3MQZA 2I4OA 1YGBA 2ALYA 2HNIA 4YRCA 4LVLA 4H2YA 2CJAA 1ASZA 4XEMA 2DJZA 2DKGA 1EIYB 2DZ9A 2RHQA 4HWOA 4XU2A 2AMCB 4RQEA 3HRKA 2ZZGA 3A31A 4KR3A 4ZTUB 1E1OA 2G4CA 2CGHA 2AKWB 1X54A 4YRSA 2AKWA 1KMMA 4YCVA 3HXZA 1B70B 2DTIA 4XEOA 3IALA 4HWTA 4YROA 4YP0A 1Z7NA 4OLFA 1NJ8A 1EFWA 4P75A 1NNHA 3CMQA 1PYSA 3LSSA 4HT4A 2ZCEA 2FYKA 4HWRA 4P71A 2ZZFA 4PG3A 4J15A 1YB3A 3REUA 3VQYA 3NETA 2E64A 4YRRA 3P8YA 1HC7A 4UP7A 2ZXFA 5C53B 4LVMA 1EIYA 4PHCA 3V7CA 3FJPA 4H2SA 2DQ3A 4Q15A 5ELNA 4EX5A 2DXUA 2ZINA 4WJ4A 1NJ2A 3BFMA 2IY5B 4UPAA 4X5OA 4EO4A 1RIQA 3TEHB 4G84A 1WQWA 2E65A 3HXYA 4WJ3M 4XU1A 2QHUA 4TWAA 4ZTZB 3OD1A 4XTVA 3BJUA 2ZT7A 3ERRA 1WYDA 4L87A 4YDQA 1KMNA 1H4TA 4K87A 4YCUA 1HXDA 4CS3A 4XU0A 3NENA 3HXVA 2IY5A 1YFRA 2AMCA 1EVLA 4E51A 4HA8A 2RHQB 3RGLA 2EJ9A 3RL6A 1H4VB 4TVWA 3V8JA 2ZNJA 4YRKA 1G51A 2DDZA 1N9WA 3V8LA 3A74A 11ASA 1SERA 2NS6A 4LVKA 3HXUA 4H2WA 1J5WA 3G1ZA 3QO7A 4H2XA 4YRJA 2QHTA 4CH5A 2DEQA 4XTZA 1BIAA 1NJ1A 1L0WA 1W66A 4UP8A 4YPFA 3L1AA 2QHSA 1GGMA 3A7AA 3RKXA 3HRIA 1JJCB 2ZTGA 4BWAA 4RQFA 2EL9A 3VQVA 2ARUA 2Q7EA 3M4QA 3UH0A 1USYC 2DXTA 2ODRD 4CH4A 3LSQA 1NJ5A 2ARSA 2ZT6A 2DTOA 3A7UA 3IKMB 1X2GA 4LNSA 4K86A 3MF1A 4YRTA 3UGTA 3M4PA 3RIRA 4WF2A 2PMFA 4TVAA 1WPYA 2EAYA 2ZT5A 2PMEA 1ASYA 3NEMA 1ATIA 3NELA 3IG2A 1G5HA 3VBBA 3R07A 3HTZA 2ZNIA 1BIBA 4P3PA 2A8EA 1ADYA 3L2ZA 4BW9A 2EWNA 3IKLA 3V7RA 2ZT8A 1NJ6A 2QHVA 2DU7A 1BBWA 1X01A 1EOVA 3EFRA 1EVKA 1EQRA 5KNNA 3TEGA 2ZZEA 2Q7HA 2E3CA 5E3IA 4YRGA 1E24A 1NYRA 4P74C 4KR2A 2C7IA 4HWPA 3HFZA 4RMFA 4NCXA 3A5ZA 1Z7MA 2Q5HA 3A7RA 3L4GB 3PCOB 4KQEA 4P72A 4YRMA 4HVCA 4YRPA 2I4NA 4P74A 3RUXA 4O2DA 3QO8A 1H4SA 1X55A 4P75C 12ASA 3HXWA 1E22A 4YRNA 4P3NA 4TQFA 4P73A 2ALYB 4H02A 3RF1A 1B7YB 1HTTA 4CH3A 5K1PA 2I4LA 4K88A 1X56A 2Q7GA 2P5IA 2CIMA 2RHSB 4YREA 3A5YA 1WLEA 4WI1A 3QO5A 1WQ7A 2CJ9A 4XTWA 4TVYA 4YRIA 2E5AA 2EJGA 4Q6GA 3TUPA 4CH6A 4P72C 1VQZA 1LYLA 3LC0A 4CS2A 4XTUA 3PZCA 3HFZB 4H2TA 2ZGWA 4TTVA 3HFVA 1B7YA 4H2VA 3QTCA 4OP0A 2DVEA 4H2UA 4TVAB 4DPGA 1NYQA 2ZR3A 3VQWA 2DTHA 4YRQA 1USYA 4P73C 3V8KA 1BBUA 1WU7A 4TQDA 4ZIBA 4LVJA 2C8MA 1ADJA 4AH6A 4LVIA 2ZIMA 3QNEA 1B70A 4DQ2A 4UP9A 3HXXA 1SESA 4P71C 5F5WA 3V7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS6 A;  4LVI A;  4LVL A;  4LVK A;  4LVM A;  4HT4 A;  4LVJ A; 
#chains in the Genus database with same CATH topology
 3MEY A;  3P8V A;  4RDX A;  2I4M A;  3RAC A;  1B76 A;  1E1T A;  4CS4 A;  3W3S A;  3E9I A;  2XGT A;  4P3O A;  4YRF A;  2E41 A;  3L4G A;  3HY0 A;  3MF2 A;  1WNL A;  2Q5I A;  2XTI A;  2E1H A;  2ZR2 A;  1YFT A;  1SET A;  3UFG A;  3HY1 A;  3RKY A;  5C51 B;  2EJF A;  2DU5 A;  3UGQ A;  1SRY A;  4XU3 A;  1X2H A;  1H4Q A;  4YCW A;  2P0L A;  2CJB A;  3PCO A;  2E10 A;  4YRL A;  3RKW A;  1PYS B;  4XTX A;  2RHS A;  1JJC A;  4G85 A;  1G5I A;  5HGQ A;  1QF6 A;  5ELO A;  3WQZ A;  1YFS A;  3E9H A;  2J3M A;  2ART A;  3I7F A;  4YYE A;  2DZC A;  3TEH A;  2DQ0 A;  3A32 A;  1FYF A;  5C52 B;  2ZIO A;  1QE0 A;  5K1X A;  3EFS A;  3REX A;  4HWS A;  3P8T A;  3KFU A;  1IL2 A;  4H2X B;  3ICA A;  1B8A A;  3DSQ A;  1KOG A;  2J3L A;  1C0A A;  2ODR C;  4XTY A;  3VQX A;  3MQZ A;  2I4O A;  1YGB A;  2ALY A;  2HNI A;  4YRC A;  4LVL A;  4H2Y A;  2CJA A;  1ASZ A;  4XEM A;  2DJZ A;  2DKG A;  1EIY B;  2DZ9 A;  2RHQ A;  4HWO A;  4XU2 A;  2AMC B;  4RQE A;  3HRK A;  2ZZG A;  3A31 A;  4KR3 A;  4ZTU B;  1E1O A;  2G4C A;  2CGH A;  2AKW B;  1X54 A;  4YRS A;  2AKW A;  1KMM A;  4YCV A;  3HXZ A;  1B70 B;  2DTI A;  4XEO A;  3IAL A;  4HWT A;  4YRO A;  4YP0 A;  1Z7N A;  4OLF A;  1NJ8 A;  1EFW A;  4P75 A;  1NNH A;  3CMQ A;  1PYS A;  3LSS A;  4HT4 A;  2ZCE A;  2FYK A;  4HWR A;  4P71 A;  2ZZF A;  4PG3 A;  4J15 A;  1YB3 A;  3REU A;  3VQY A;  3NET A;  2E64 A;  4YRR A;  3P8Y A;  1HC7 A;  4UP7 A;  2ZXF A;  5C53 B;  4LVM A;  1EIY A;  4PHC A;  3V7C A;  3FJP A;  4H2S A;  2DQ3 A;  4Q15 A;  5ELN A;  4EX5 A;  2DXU A;  2ZIN A;  4WJ4 A;  1NJ2 A;  3BFM A;  2IY5 B;  4UPA A;  4X5O A;  4EO4 A;  1RIQ A;  3TEH B;  4G84 A;  1WQW A;  2E65 A;  3HXY A;  4WJ3 M;  4XU1 A;  2QHU A;  4TWA A;  4ZTZ B;  3OD1 A;  4XTV A;  3BJU A;  2ZT7 A;  3ERR A;  1WYD A;  4L87 A;  4YDQ A;  1KMN A;  1H4T A;  4K87 A;  4YCU A;  1HXD A;  4CS3 A;  4XU0 A;  3NEN A;  3HXV A;  2IY5 A;  1YFR A;  2AMC A;  1EVL A;  4E51 A;  4HA8 A;  2RHQ B;  3RGL A;  2EJ9 A;  3RL6 A;  1H4V B;  4TVW A;  3V8J A;  2ZNJ A;  4YRK A;  1G51 A;  2DDZ A;  1N9W A;  3V8L A;  3A74 A;  11AS A;  1SER A;  2NS6 A;  4LVK A;  3HXU A;  4H2W A;  1J5W A;  3G1Z A;  3QO7 A;  4H2X A;  4YRJ A;  2QHT A;  4CH5 A;  2DEQ A;  4XTZ A;  1BIA A;  1NJ1 A;  1L0W A;  1W66 A;  4UP8 A;  4YPF A;  3L1A A;  2QHS A;  1GGM A;  3A7A A;  3RKX A;  3HRI A;  1JJC B;  2ZTG A;  4BWA A;  4RQF A;  2EL9 A;  3VQV A;  2ARU A;  2Q7E A;  3M4Q A;  3UH0 A;  1USY C;  2DXT A;  2ODR D;  4CH4 A;  3LSQ A;  1NJ5 A;  2ARS A;  2ZT6 A;  2DTO A;  3A7U A;  3IKM B;  1X2G A;  4LNS A;  4K86 A;  3MF1 A;  4YRT A;  3UGT A;  3M4P A;  3RIR A;  4WF2 A;  2PMF A;  4TVA A;  1WPY A;  2EAY A;  2ZT5 A;  2PME A;  1ASY A;  3NEM A;  1ATI A;  3NEL A;  3IG2 A;  1G5H A;  3VBB A;  3R07 A;  3HTZ A;  2ZNI A;  1BIB A;  4P3P A;  2A8E A;  1ADY A;  3L2Z A;  4BW9 A;  2EWN A;  3IKL A;  3V7R A;  2ZT8 A;  1NJ6 A;  2QHV A;  2DU7 A;  1BBW A;  1X01 A;  1EOV A;  3EFR A;  1EVK A;  1EQR A;  5KNN A;  3TEG A;  2ZZE A;  2Q7H A;  2E3C A;  5E3I A;  4YRG A;  1E24 A;  1NYR A;  4P74 C;  4KR2 A;  2C7I A;  4HWP A;  3HFZ A;  4RMF A;  4NCX A;  3A5Z A;  1Z7M A;  2Q5H A;  3A7R A;  3L4G B;  3PCO B;  4KQE A;  4P72 A;  4YRM A;  4HVC A;  4YRP A;  2I4N A;  4P74 A;  3RUX A;  4O2D A;  3QO8 A;  1H4S A;  1X55 A;  4P75 C;  12AS A;  3HXW A;  1E22 A;  4YRN A;  4P3N A;  4TQF A;  4P73 A;  2ALY B;  4H02 A;  3RF1 A;  1B7Y B;  1HTT A;  4CH3 A;  5K1P A;  2I4L A;  4K88 A;  1X56 A;  2Q7G A;  2P5I A;  2CIM A;  2RHS B;  4YRE A;  3A5Y A;  1WLE A;  4WI1 A;  3QO5 A;  1WQ7 A;  2CJ9 A;  4XTW A;  4TVY A;  4YRI A;  2E5A A;  2EJG A;  4Q6G A;  3TUP A;  4CH6 A;  4P72 C;  1VQZ A;  1LYL A;  3LC0 A;  4CS2 A;  4XTU A;  3PZC A;  3HFZ B;  4H2T A;  2ZGW A;  4TTV A;  3HFV A;  1B7Y A;  4H2V A;  3QTC A;  4OP0 A;  2DVE A;  4H2U A;  4TVA B;  4DPG A;  1NYQ A;  2ZR3 A;  3VQW A;  2DTH A;  4YRQ A;  1USY A;  4P73 C;  3V8K A;  1BBU A;  1WU7 A;  4TQD A;  4ZIB A;  4LVJ A;  2C8M A;  1ADJ A;  4AH6 A;  4LVI A;  2ZIM A;  3QNE A;  1B70 A;  4DQ2 A;  4UP9 A;  3HXX A;  1SES A;  4P71 C;  5F5W A;  3V7S A; 
#chains in the Genus database with same CATH homology
 3MEY A;  3P8V A;  4RDX A;  2I4M A;  3RAC A;  1B76 A;  1E1T A;  4CS4 A;  3W3S A;  3E9I A;  2XGT A;  4P3O A;  4YRF A;  2E41 A;  3L4G A;  3HY0 A;  3MF2 A;  1WNL A;  2Q5I A;  2XTI A;  2E1H A;  2ZR2 A;  1YFT A;  1SET A;  3UFG A;  3HY1 A;  3RKY A;  5C51 B;  2EJF A;  2DU5 A;  3UGQ A;  1SRY A;  4XU3 A;  1X2H A;  1H4Q A;  4YCW A;  2P0L A;  2CJB A;  3PCO A;  2E10 A;  4YRL A;  3RKW A;  1PYS B;  4XTX A;  2RHS A;  1JJC A;  4G85 A;  1G5I A;  5HGQ A;  1QF6 A;  5ELO A;  3WQZ A;  1YFS A;  3E9H A;  2J3M A;  2ART A;  3I7F A;  4YYE A;  2DZC A;  3TEH A;  2DQ0 A;  3A32 A;  1FYF A;  5C52 B;  2ZIO A;  1QE0 A;  5K1X A;  3EFS A;  3REX A;  4HWS A;  3P8T A;  3KFU A;  1IL2 A;  4H2X B;  3ICA A;  1B8A A;  3DSQ A;  1KOG A;  2J3L A;  1C0A A;  2ODR C;  4XTY A;  3VQX A;  3MQZ A;  2I4O A;  1YGB A;  2ALY A;  2HNI A;  4YRC A;  4LVL A;  4H2Y A;  2CJA A;  1ASZ A;  4XEM A;  2DJZ A;  2DKG A;  1EIY B;  2DZ9 A;  2RHQ A;  4HWO A;  4XU2 A;  2AMC B;  4RQE A;  3HRK A;  2ZZG A;  3A31 A;  4KR3 A;  4ZTU B;  1E1O A;  2G4C A;  2CGH A;  2AKW B;  1X54 A;  4YRS A;  2AKW A;  1KMM A;  4YCV A;  3HXZ A;  1B70 B;  2DTI A;  4XEO A;  3IAL A;  4HWT A;  4YRO A;  4YP0 A;  1Z7N A;  4OLF A;  1NJ8 A;  1EFW A;  4P75 A;  1NNH A;  3CMQ A;  1PYS A;  3LSS A;  4HT4 A;  2ZCE A;  2FYK A;  4HWR A;  4P71 A;  2ZZF A;  4PG3 A;  4J15 A;  1YB3 A;  3REU A;  3VQY A;  3NET A;  2E64 A;  4YRR A;  3P8Y A;  1HC7 A;  4UP7 A;  2ZXF A;  5C53 B;  4LVM A;  1EIY A;  4PHC A;  3V7C A;  3FJP A;  4H2S A;  2DQ3 A;  4Q15 A;  5ELN A;  4EX5 A;  2DXU A;  2ZIN A;  4WJ4 A;  1NJ2 A;  3BFM A;  2IY5 B;  4UPA A;  4X5O A;  4EO4 A;  1RIQ A;  3TEH B;  4G84 A;  1WQW A;  2E65 A;  3HXY A;  4WJ3 M;  4XU1 A;  2QHU A;  4TWA A;  4ZTZ B;  3OD1 A;  4XTV A;  3BJU A;  2ZT7 A;  3ERR A;  1WYD A;  4L87 A;  4YDQ A;  1KMN A;  1H4T A;  4K87 A;  4YCU A;  1HXD A;  4CS3 A;  4XU0 A;  3NEN A;  3HXV A;  2IY5 A;  1YFR A;  2AMC A;  1EVL A;  4E51 A;  4HA8 A;  2RHQ B;  3RGL A;  2EJ9 A;  3RL6 A;  1H4V B;  4TVW A;  3V8J A;  2ZNJ A;  4YRK A;  1G51 A;  2DDZ A;  1N9W A;  3V8L A;  3A74 A;  11AS A;  1SER A;  2NS6 A;  4LVK A;  3HXU A;  4H2W A;  1J5W A;  3G1Z A;  3QO7 A;  4H2X A;  4YRJ A;  2QHT A;  4CH5 A;  2DEQ A;  4XTZ A;  1BIA A;  1NJ1 A;  1L0W A;  1W66 A;  4UP8 A;  4YPF A;  3L1A A;  2QHS A;  1GGM A;  3A7A A;  3RKX A;  3HRI A;  1JJC B;  2ZTG A;  4BWA A;  4RQF A;  2EL9 A;  3VQV A;  2ARU A;  2Q7E A;  3M4Q A;  3UH0 A;  1USY C;  2DXT A;  2ODR D;  4CH4 A;  3LSQ A;  1NJ5 A;  2ARS A;  2ZT6 A;  2DTO A;  3A7U A;  3IKM B;  1X2G A;  4LNS A;  4K86 A;  3MF1 A;  4YRT A;  3UGT A;  3M4P A;  3RIR A;  4WF2 A;  2PMF A;  4TVA A;  1WPY A;  2EAY A;  2ZT5 A;  2PME A;  1ASY A;  3NEM A;  1ATI A;  3NEL A;  3IG2 A;  1G5H A;  3VBB A;  3R07 A;  3HTZ A;  2ZNI A;  1BIB A;  4P3P A;  2A8E A;  1ADY A;  3L2Z A;  4BW9 A;  2EWN A;  3IKL A;  3V7R A;  2ZT8 A;  1NJ6 A;  2QHV A;  2DU7 A;  1BBW A;  1X01 A;  1EOV A;  3EFR A;  1EVK A;  1EQR A;  5KNN A;  3TEG A;  2ZZE A;  2Q7H A;  2E3C A;  5E3I A;  4YRG A;  1E24 A;  1NYR A;  4P74 C;  4KR2 A;  2C7I A;  4HWP A;  3HFZ A;  4RMF A;  4NCX A;  3A5Z A;  1Z7M A;  2Q5H A;  3A7R A;  3L4G B;  3PCO B;  4KQE A;  4P72 A;  4YRM A;  4HVC A;  4YRP A;  2I4N A;  4P74 A;  3RUX A;  4O2D A;  3QO8 A;  1H4S A;  1X55 A;  4P75 C;  12AS A;  3HXW A;  1E22 A;  4YRN A;  4P3N A;  4TQF A;  4P73 A;  2ALY B;  4H02 A;  3RF1 A;  1B7Y B;  1HTT A;  4CH3 A;  5K1P A;  2I4L A;  4K88 A;  1X56 A;  2Q7G A;  2P5I A;  2CIM A;  2RHS B;  4YRE A;  3A5Y A;  1WLE A;  4WI1 A;  3QO5 A;  1WQ7 A;  2CJ9 A;  4XTW A;  4TVY A;  4YRI A;  2E5A A;  2EJG A;  4Q6G A;  3TUP A;  4CH6 A;  4P72 C;  1VQZ A;  1LYL A;  3LC0 A;  4CS2 A;  4XTU A;  3PZC A;  3HFZ B;  4H2T A;  2ZGW A;  4TTV A;  3HFV A;  1B7Y A;  4H2V A;  3QTC A;  4OP0 A;  2DVE A;  4H2U A;  4TVA B;  4DPG A;  1NYQ A;  2ZR3 A;  3VQW A;  2DTH A;  4YRQ A;  1USY A;  4P73 C;  3V8K A;  1BBU A;  1WU7 A;  4TQD A;  4ZIB A;  4LVJ A;  2C8M A;  1ADJ A;  4AH6 A;  4LVI A;  2ZIM A;  3QNE A;  1B70 A;  4DQ2 A;  4UP9 A;  3HXX A;  1SES A;  4P71 C;  5F5W A;  3V7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...