4LVMA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (23nt). mn-bound crystal structure at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
198
structure length
192
Chain Sequence
b'SYMVARMQKMKAGNLGGAFKHNERVKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMADM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 49
structure length 192
sequence length 198
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvmA01
4LVIA 4LVKA 2NS6A 4LVMA 4LVJA 4LVLA 4HT4A
chains in the Genus database with same CATH superfamily
2DTHA 1SESA 4YCUA 3HXYA 3P8TA 3BJUA 2I4NA 4P71C 3A31A 2DZ9A 2AKWB 3G1ZA 3HRKA 4YRSA 2ZNIA 3A74A 1EOVA 2Q7HA 1KMNA 2NS6A 4YROA 1Z7MA 11ASA 4EX5A 4P71A 1B70A 4K88A 4CH6A 2E65A 1KOGA 4OLFA 4KQEA 4P73C 2QHSA 3HTZA 4G85A 4P72C 2DZCA 4TTVA 2DU7A 3HXZA 4LVKA 3RKYA 2P0LA 2FYKA 3MQZA 5F5WA 4LVMA 4J15A 2DQ3A 1EQRA 3L4GB 4P73A 4RDXA 4ZTUB 4P72A 1E22A 4HWRA 4P74C 3WQZA 2DQ0A 3UFGA 3UH0A 4XTZA 4EO4A 3EFRA 2DDZA 3HY1A 3PZCA 1L0WA 3QO7A 3NETA 4YRJA 1ATIA 3L4GA 4P3NA 4E51A 2QHUA 4P74A 2DJZA 3A5ZA 4Q6GA 2ZGWA 4PHCA 2DEQA 3QTCA 3BFMA 4XEMA 3UGTA 4XTYA 1G51A 3IKLA 4XU2A 4UP7A 3V7RA 5HGQA 4K87A 4H2TA 1YB3A 2CJAA 2RHQB 4XU1A 3A7RA 3OD1A 3REXA 1JJCA 2ZCEA 1X55A 1QE0A 4OP0A 1YGBA 4G84A 3VQWA 1FYFA 2ZINA 4HT4A 4XTUA 3R07A 3E9HA 4XTXA 4K86A 2ZT7A 1HXDA 3P8YA 2RHSB 1B8AA 1NJ5A 3HFZB 4DQ2A 1VQZA 4CS2A 4H2YA 5K1PA 2EJFA 1PYSA 1B70B 4P3PA 1YFSA 2DKGA 4YREA 3HRIA 3A7UA 3I7FA 3NENA 2RHSA 2XTIA 1WYDA 1SERA 3HFZA 1H4QA 2HNIA 2ZXFA 1WLEA 1X01A 3MF1A 4H2VA 4O2DA 4WI1A 3HXWA 4CS3A 3ICAA 3HFVA 2ZR2A 4AH6A 2E5AA 3ERRA 2XGTA 3REUA 1SRYA 4HWTA 1NYRA 2ZIOA 3RGLA 4LNSA 1BBUA 1WPYA 4NCXA 2G4CA 1X54A 4ZTZB 2CJBA 3QO8A 1Z7NA 3NEMA 4KR3A 3L2ZA 3MEYA 5K1XA 3HXUA 4WJ3M 1EVKA 4YRFA 2QHVA 3MF2A 2ALYA 1H4TA 4LVIA 2EAYA 1EVLA 4H2SA 3V8KA 5C51B 3V8JA 5C52B 3NELA 5C53B 2ZZEA 4H02A 2CGHA 4UPAA 2Q5IA 4UP8A 1H4VB 1C0AA 1JJCB 4YRLA 2IY5B 3P8VA 4H2XB 2ZT8A 4YPFA 4XU0A 4YRRA 1ADJA 4P3OA 4BW9A 1BBWA 4XTWA 1B76A 1NYQA 4XU3A 4HWOA 1NNHA 2EJ9A 2CJ9A 4WJ4A 1G5HA 2DVEA 1YFRA 4CH3A 3W3SA 1QF6A 1E1OA 2IY5A 2I4LA 1EIYA 4H2XA 1B7YB 3EFSA 4TQFA 1WU7A 4YRKA 2C7IA 4ZIBA 2ZTGA 2ZZGA 2DXUA 4Q15A 2I4OA 4UP9A 1PYSB 3VQXA 1NJ8A 5E3IA 1J5WA 3A7AA 4L87A 1EFWA 1USYC 4HWPA 3UGQA 1B7YA 2CIMA 3RF1A 2ARSA 4XEOA 2DTIA 1X2HA 1E24A 1HTTA 4YYEA 2E10A 2PMEA 1USYA 4XTVA 1SETA 2ZZFA 2Q5HA 2E1HA 4YRTA 4YRNA 1NJ6A 3VBBA 4HA8A 3RKWA 3HY0A 3RIRA 4YCVA 2C8MA 4LVLA 4CH4A 1RIQA 2ARUA 1LYLA 3M4QA 2ALYB 4RMFA 4BWAA 2ZIMA 3V7CA 3LSSA 4TVYA 1E1TA 3L1AA 12ASA 2J3MA 2AMCB 1HC7A 3E9IA 3M4PA 2EL9A 2ZNJA 4H2WA 3QNEA 4RQEA 2AKWA 4YRGA 3LSQA 2ODRC 3LC0A 4PG3A 3V8LA 2EWNA 1NJ2A 3A5YA 3RUXA 3VQVA 1IL2A 1WQ7A 2AMCA 2Q7GA 1ASYA 1BIAA 4YRPA 3TEHB 1WNLA 3TUPA 1G5IA 2ZT5A 4YRCA 4LVJA 4HWSA 4YP0A 2E3CA 1W66A 3RKXA 2QHTA 2DXTA 2E64A 4YRQA 1YFTA 1EIYB 2PMFA 3IALA 1KMMA 4P75C 3RL6A 3TEHA 1ADYA 2ZT6A 3V7SA 4CH5A 4H2UA 3HXXA 3KFUA 3FJPA 3PCOB 4TWAA 3IKMB 4X5OA 2Q7EA 4KR2A 3IG2A 1WQWA 3TEGA 4HVCA 4P75A 4RQFA 4WF2A 3A32A 2P5IA 4TVWA 1H4SA 3RACA 2ZR3A 1ASZA 3VQYA 2EJGA 3PCOA 2ODRD 2I4MA 3DSQA 5KNNA 1X56A 1GGMA 4CS4A 4TVAB 3CMQA 5ELOA 4YDQA 2E41A 5ELNA 3HXVA 2J3LA 4YCWA 4YRIA 1N9WA 2RHQA 4YRMA 4DPGA 2DU5A 1BIBA 2ARTA 4TQDA 1NJ1A 2A8EA 4TVAA 1X2GA 3QO5A 2DTOA
chains in the Genus database with same CATH topology
2DTHA 1SESA 4YCUA 3HXYA 3P8TA 3BJUA 2I4NA 4P71C 3A31A 2DZ9A 2AKWB 3G1ZA 3HRKA 4YRSA 2ZNIA 3A74A 1EOVA 2Q7HA 1KMNA 2NS6A 4YROA 1Z7MA 11ASA 4EX5A 4P71A 1B70A 4K88A 4CH6A 2E65A 1KOGA 4OLFA 4KQEA 4P73C 2QHSA 3HTZA 4G85A 4P72C 2DZCA 4TTVA 2DU7A 3HXZA 4LVKA 3RKYA 2P0LA 2FYKA 3MQZA 5F5WA 4LVMA 4J15A 2DQ3A 1EQRA 3L4GB 4P73A 4RDXA 4ZTUB 4P72A 1E22A 4HWRA 4P74C 3WQZA 2DQ0A 3UFGA 3UH0A 4XTZA 4EO4A 3EFRA 2DDZA 3HY1A 3PZCA 1L0WA 3QO7A 3NETA 4YRJA 1ATIA 3L4GA 4P3NA 4E51A 2QHUA 4P74A 2DJZA 3A5ZA 4Q6GA 2ZGWA 4PHCA 2DEQA 3QTCA 3BFMA 4XEMA 3UGTA 4XTYA 1G51A 3IKLA 4XU2A 4UP7A 3V7RA 5HGQA 4K87A 4H2TA 1YB3A 2CJAA 2RHQB 4XU1A 3A7RA 3OD1A 3REXA 1JJCA 2ZCEA 1X55A 1QE0A 4OP0A 1YGBA 4G84A 3VQWA 1FYFA 2ZINA 4HT4A 4XTUA 3R07A 3E9HA 4XTXA 4K86A 2ZT7A 1HXDA 3P8YA 2RHSB 1B8AA 1NJ5A 3HFZB 4DQ2A 1VQZA 4CS2A 4H2YA 5K1PA 2EJFA 1PYSA 1B70B 4P3PA 1YFSA 2DKGA 4YREA 3HRIA 3A7UA 3I7FA 3NENA 2RHSA 2XTIA 1WYDA 1SERA 3HFZA 1H4QA 2HNIA 2ZXFA 1WLEA 1X01A 3MF1A 4H2VA 4O2DA 4WI1A 3HXWA 4CS3A 3ICAA 3HFVA 2ZR2A 4AH6A 2E5AA 3ERRA 2XGTA 3REUA 1SRYA 4HWTA 1NYRA 2ZIOA 3RGLA 4LNSA 1BBUA 1WPYA 4NCXA 2G4CA 1X54A 4ZTZB 2CJBA 3QO8A 1Z7NA 3NEMA 4KR3A 3L2ZA 3MEYA 5K1XA 3HXUA 4WJ3M 1EVKA 4YRFA 2QHVA 3MF2A 2ALYA 1H4TA 4LVIA 2EAYA 1EVLA 4H2SA 3V8KA 5C51B 3V8JA 5C52B 3NELA 5C53B 2ZZEA 4H02A 2CGHA 4UPAA 2Q5IA 4UP8A 1H4VB 1C0AA 1JJCB 4YRLA 2IY5B 3P8VA 4H2XB 2ZT8A 4YPFA 4XU0A 4YRRA 1ADJA 4P3OA 4BW9A 1BBWA 4XTWA 1B76A 1NYQA 4XU3A 4HWOA 1NNHA 2EJ9A 2CJ9A 4WJ4A 1G5HA 2DVEA 1YFRA 4CH3A 3W3SA 1QF6A 1E1OA 2IY5A 2I4LA 1EIYA 4H2XA 1B7YB 3EFSA 4TQFA 1WU7A 4YRKA 2C7IA 4ZIBA 2ZTGA 2ZZGA 2DXUA 4Q15A 2I4OA 4UP9A 1PYSB 3VQXA 1NJ8A 5E3IA 1J5WA 3A7AA 4L87A 1EFWA 1USYC 4HWPA 3UGQA 1B7YA 2CIMA 3RF1A 2ARSA 4XEOA 2DTIA 1X2HA 1E24A 1HTTA 4YYEA 2E10A 2PMEA 1USYA 4XTVA 1SETA 2ZZFA 2Q5HA 2E1HA 4YRTA 4YRNA 1NJ6A 3VBBA 4HA8A 3RKWA 3HY0A 3RIRA 4YCVA 2C8MA 4LVLA 4CH4A 1RIQA 2ARUA 1LYLA 3M4QA 2ALYB 4RMFA 4BWAA 2ZIMA 3V7CA 3LSSA 4TVYA 1E1TA 3L1AA 12ASA 2J3MA 2AMCB 1HC7A 3E9IA 3M4PA 2EL9A 2ZNJA 4H2WA 3QNEA 4RQEA 2AKWA 4YRGA 3LSQA 2ODRC 3LC0A 4PG3A 3V8LA 2EWNA 1NJ2A 3A5YA 3RUXA 3VQVA 1IL2A 1WQ7A 2AMCA 2Q7GA 1ASYA 1BIAA 4YRPA 3TEHB 1WNLA 3TUPA 1G5IA 2ZT5A 4YRCA 4LVJA 4HWSA 4YP0A 2E3CA 1W66A 3RKXA 2QHTA 2DXTA 2E64A 4YRQA 1YFTA 1EIYB 2PMFA 3IALA 1KMMA 4P75C 3RL6A 3TEHA 1ADYA 2ZT6A 3V7SA 4CH5A 4H2UA 3HXXA 3KFUA 3FJPA 3PCOB 4TWAA 3IKMB 4X5OA 2Q7EA 4KR2A 3IG2A 1WQWA 3TEGA 4HVCA 4P75A 4RQFA 4WF2A 3A32A 2P5IA 4TVWA 1H4SA 3RACA 2ZR3A 1ASZA 3VQYA 2EJGA 3PCOA 2ODRD 2I4MA 3DSQA 5KNNA 1X56A 1GGMA 4CS4A 4TVAB 3CMQA 5ELOA 4YDQA 2E41A 5ELNA 3HXVA 2J3LA 4YCWA 4YRIA 1N9WA 2RHQA 4YRMA 4DPGA 2DU5A 1BIBA 2ARTA 4TQDA 1NJ1A 2A8EA 4TVAA 1X2GA 3QO5A 2DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVI A;  4LVK A;  2NS6 A;  4LVM A;  4LVJ A;  4LVL A;  4HT4 A; 
#chains in the Genus database with same CATH topology
 2DTH A;  1SES A;  4YCU A;  3HXY A;  3P8T A;  3BJU A;  2I4N A;  4P71 C;  3A31 A;  2DZ9 A;  2AKW B;  3G1Z A;  3HRK A;  4YRS A;  2ZNI A;  3A74 A;  1EOV A;  2Q7H A;  1KMN A;  2NS6 A;  4YRO A;  1Z7M A;  11AS A;  4EX5 A;  4P71 A;  1B70 A;  4K88 A;  4CH6 A;  2E65 A;  1KOG A;  4OLF A;  4KQE A;  4P73 C;  2QHS A;  3HTZ A;  4G85 A;  4P72 C;  2DZC A;  4TTV A;  2DU7 A;  3HXZ A;  4LVK A;  3RKY A;  2P0L A;  2FYK A;  3MQZ A;  5F5W A;  4LVM A;  4J15 A;  2DQ3 A;  1EQR A;  3L4G B;  4P73 A;  4RDX A;  4ZTU B;  4P72 A;  1E22 A;  4HWR A;  4P74 C;  3WQZ A;  2DQ0 A;  3UFG A;  3UH0 A;  4XTZ A;  4EO4 A;  3EFR A;  2DDZ A;  3HY1 A;  3PZC A;  1L0W A;  3QO7 A;  3NET A;  4YRJ A;  1ATI A;  3L4G A;  4P3N A;  4E51 A;  2QHU A;  4P74 A;  2DJZ A;  3A5Z A;  4Q6G A;  2ZGW A;  4PHC A;  2DEQ A;  3QTC A;  3BFM A;  4XEM A;  3UGT A;  4XTY A;  1G51 A;  3IKL A;  4XU2 A;  4UP7 A;  3V7R A;  5HGQ A;  4K87 A;  4H2T A;  1YB3 A;  2CJA A;  2RHQ B;  4XU1 A;  3A7R A;  3OD1 A;  3REX A;  1JJC A;  2ZCE A;  1X55 A;  1QE0 A;  4OP0 A;  1YGB A;  4G84 A;  3VQW A;  1FYF A;  2ZIN A;  4HT4 A;  4XTU A;  3R07 A;  3E9H A;  4XTX A;  4K86 A;  2ZT7 A;  1HXD A;  3P8Y A;  2RHS B;  1B8A A;  1NJ5 A;  3HFZ B;  4DQ2 A;  1VQZ A;  4CS2 A;  4H2Y A;  5K1P A;  2EJF A;  1PYS A;  1B70 B;  4P3P A;  1YFS A;  2DKG A;  4YRE A;  3HRI A;  3A7U A;  3I7F A;  3NEN A;  2RHS A;  2XTI A;  1WYD A;  1SER A;  3HFZ A;  1H4Q A;  2HNI A;  2ZXF A;  1WLE A;  1X01 A;  3MF1 A;  4H2V A;  4O2D A;  4WI1 A;  3HXW A;  4CS3 A;  3ICA A;  3HFV A;  2ZR2 A;  4AH6 A;  2E5A A;  3ERR A;  2XGT A;  3REU A;  1SRY A;  4HWT A;  1NYR A;  2ZIO A;  3RGL A;  4LNS A;  1BBU A;  1WPY A;  4NCX A;  2G4C A;  1X54 A;  4ZTZ B;  2CJB A;  3QO8 A;  1Z7N A;  3NEM A;  4KR3 A;  3L2Z A;  3MEY A;  5K1X A;  3HXU A;  4WJ3 M;  1EVK A;  4YRF A;  2QHV A;  3MF2 A;  2ALY A;  1H4T A;  4LVI A;  2EAY A;  1EVL A;  4H2S A;  3V8K A;  5C51 B;  3V8J A;  5C52 B;  3NEL A;  5C53 B;  2ZZE A;  4H02 A;  2CGH A;  4UPA A;  2Q5I A;  4UP8 A;  1H4V B;  1C0A A;  1JJC B;  4YRL A;  2IY5 B;  3P8V A;  4H2X B;  2ZT8 A;  4YPF A;  4XU0 A;  4YRR A;  1ADJ A;  4P3O A;  4BW9 A;  1BBW A;  4XTW A;  1B76 A;  1NYQ A;  4XU3 A;  4HWO A;  1NNH A;  2EJ9 A;  2CJ9 A;  4WJ4 A;  1G5H A;  2DVE A;  1YFR A;  4CH3 A;  3W3S A;  1QF6 A;  1E1O A;  2IY5 A;  2I4L A;  1EIY A;  4H2X A;  1B7Y B;  3EFS A;  4TQF A;  1WU7 A;  4YRK A;  2C7I A;  4ZIB A;  2ZTG A;  2ZZG A;  2DXU A;  4Q15 A;  2I4O A;  4UP9 A;  1PYS B;  3VQX A;  1NJ8 A;  5E3I A;  1J5W A;  3A7A A;  4L87 A;  1EFW A;  1USY C;  4HWP A;  3UGQ A;  1B7Y A;  2CIM A;  3RF1 A;  2ARS A;  4XEO A;  2DTI A;  1X2H A;  1E24 A;  1HTT A;  4YYE A;  2E10 A;  2PME A;  1USY A;  4XTV A;  1SET A;  2ZZF A;  2Q5H A;  2E1H A;  4YRT A;  4YRN A;  1NJ6 A;  3VBB A;  4HA8 A;  3RKW A;  3HY0 A;  3RIR A;  4YCV A;  2C8M A;  4LVL A;  4CH4 A;  1RIQ A;  2ARU A;  1LYL A;  3M4Q A;  2ALY B;  4RMF A;  4BWA A;  2ZIM A;  3V7C A;  3LSS A;  4TVY A;  1E1T A;  3L1A A;  12AS A;  2J3M A;  2AMC B;  1HC7 A;  3E9I A;  3M4P A;  2EL9 A;  2ZNJ A;  4H2W A;  3QNE A;  4RQE A;  2AKW A;  4YRG A;  3LSQ A;  2ODR C;  3LC0 A;  4PG3 A;  3V8L A;  2EWN A;  1NJ2 A;  3A5Y A;  3RUX A;  3VQV A;  1IL2 A;  1WQ7 A;  2AMC A;  2Q7G A;  1ASY A;  1BIA A;  4YRP A;  3TEH B;  1WNL A;  3TUP A;  1G5I A;  2ZT5 A;  4YRC A;  4LVJ A;  4HWS A;  4YP0 A;  2E3C A;  1W66 A;  3RKX A;  2QHT A;  2DXT A;  2E64 A;  4YRQ A;  1YFT A;  1EIY B;  2PMF A;  3IAL A;  1KMM A;  4P75 C;  3RL6 A;  3TEH A;  1ADY A;  2ZT6 A;  3V7S A;  4CH5 A;  4H2U A;  3HXX A;  3KFU A;  3FJP A;  3PCO B;  4TWA A;  3IKM B;  4X5O A;  2Q7E A;  4KR2 A;  3IG2 A;  1WQW A;  3TEG A;  4HVC A;  4P75 A;  4RQF A;  4WF2 A;  3A32 A;  2P5I A;  4TVW A;  1H4S A;  3RAC A;  2ZR3 A;  1ASZ A;  3VQY A;  2EJG A;  3PCO A;  2ODR D;  2I4M A;  3DSQ A;  5KNN A;  1X56 A;  1GGM A;  4CS4 A;  4TVA B;  3CMQ A;  5ELO A;  4YDQ A;  2E41 A;  5ELN A;  3HXV A;  2J3L A;  4YCW A;  4YRI A;  1N9W A;  2RHQ A;  4YRM A;  4DPG A;  2DU5 A;  1BIB A;  2ART A;  4TQD A;  1NJ1 A;  2A8E A;  4TVA A;  1X2G A;  3QO5 A;  2DTO A; 
#chains in the Genus database with same CATH homology
 2DTH A;  1SES A;  4YCU A;  3HXY A;  3P8T A;  3BJU A;  2I4N A;  4P71 C;  3A31 A;  2DZ9 A;  2AKW B;  3G1Z A;  3HRK A;  4YRS A;  2ZNI A;  3A74 A;  1EOV A;  2Q7H A;  1KMN A;  2NS6 A;  4YRO A;  1Z7M A;  11AS A;  4EX5 A;  4P71 A;  1B70 A;  4K88 A;  4CH6 A;  2E65 A;  1KOG A;  4OLF A;  4KQE A;  4P73 C;  2QHS A;  3HTZ A;  4G85 A;  4P72 C;  2DZC A;  4TTV A;  2DU7 A;  3HXZ A;  4LVK A;  3RKY A;  2P0L A;  2FYK A;  3MQZ A;  5F5W A;  4LVM A;  4J15 A;  2DQ3 A;  1EQR A;  3L4G B;  4P73 A;  4RDX A;  4ZTU B;  4P72 A;  1E22 A;  4HWR A;  4P74 C;  3WQZ A;  2DQ0 A;  3UFG A;  3UH0 A;  4XTZ A;  4EO4 A;  3EFR A;  2DDZ A;  3HY1 A;  3PZC A;  1L0W A;  3QO7 A;  3NET A;  4YRJ A;  1ATI A;  3L4G A;  4P3N A;  4E51 A;  2QHU A;  4P74 A;  2DJZ A;  3A5Z A;  4Q6G A;  2ZGW A;  4PHC A;  2DEQ A;  3QTC A;  3BFM A;  4XEM A;  3UGT A;  4XTY A;  1G51 A;  3IKL A;  4XU2 A;  4UP7 A;  3V7R A;  5HGQ A;  4K87 A;  4H2T A;  1YB3 A;  2CJA A;  2RHQ B;  4XU1 A;  3A7R A;  3OD1 A;  3REX A;  1JJC A;  2ZCE A;  1X55 A;  1QE0 A;  4OP0 A;  1YGB A;  4G84 A;  3VQW A;  1FYF A;  2ZIN A;  4HT4 A;  4XTU A;  3R07 A;  3E9H A;  4XTX A;  4K86 A;  2ZT7 A;  1HXD A;  3P8Y A;  2RHS B;  1B8A A;  1NJ5 A;  3HFZ B;  4DQ2 A;  1VQZ A;  4CS2 A;  4H2Y A;  5K1P A;  2EJF A;  1PYS A;  1B70 B;  4P3P A;  1YFS A;  2DKG A;  4YRE A;  3HRI A;  3A7U A;  3I7F A;  3NEN A;  2RHS A;  2XTI A;  1WYD A;  1SER A;  3HFZ A;  1H4Q A;  2HNI A;  2ZXF A;  1WLE A;  1X01 A;  3MF1 A;  4H2V A;  4O2D A;  4WI1 A;  3HXW A;  4CS3 A;  3ICA A;  3HFV A;  2ZR2 A;  4AH6 A;  2E5A A;  3ERR A;  2XGT A;  3REU A;  1SRY A;  4HWT A;  1NYR A;  2ZIO A;  3RGL A;  4LNS A;  1BBU A;  1WPY A;  4NCX A;  2G4C A;  1X54 A;  4ZTZ B;  2CJB A;  3QO8 A;  1Z7N A;  3NEM A;  4KR3 A;  3L2Z A;  3MEY A;  5K1X A;  3HXU A;  4WJ3 M;  1EVK A;  4YRF A;  2QHV A;  3MF2 A;  2ALY A;  1H4T A;  4LVI A;  2EAY A;  1EVL A;  4H2S A;  3V8K A;  5C51 B;  3V8J A;  5C52 B;  3NEL A;  5C53 B;  2ZZE A;  4H02 A;  2CGH A;  4UPA A;  2Q5I A;  4UP8 A;  1H4V B;  1C0A A;  1JJC B;  4YRL A;  2IY5 B;  3P8V A;  4H2X B;  2ZT8 A;  4YPF A;  4XU0 A;  4YRR A;  1ADJ A;  4P3O A;  4BW9 A;  1BBW A;  4XTW A;  1B76 A;  1NYQ A;  4XU3 A;  4HWO A;  1NNH A;  2EJ9 A;  2CJ9 A;  4WJ4 A;  1G5H A;  2DVE A;  1YFR A;  4CH3 A;  3W3S A;  1QF6 A;  1E1O A;  2IY5 A;  2I4L A;  1EIY A;  4H2X A;  1B7Y B;  3EFS A;  4TQF A;  1WU7 A;  4YRK A;  2C7I A;  4ZIB A;  2ZTG A;  2ZZG A;  2DXU A;  4Q15 A;  2I4O A;  4UP9 A;  1PYS B;  3VQX A;  1NJ8 A;  5E3I A;  1J5W A;  3A7A A;  4L87 A;  1EFW A;  1USY C;  4HWP A;  3UGQ A;  1B7Y A;  2CIM A;  3RF1 A;  2ARS A;  4XEO A;  2DTI A;  1X2H A;  1E24 A;  1HTT A;  4YYE A;  2E10 A;  2PME A;  1USY A;  4XTV A;  1SET A;  2ZZF A;  2Q5H A;  2E1H A;  4YRT A;  4YRN A;  1NJ6 A;  3VBB A;  4HA8 A;  3RKW A;  3HY0 A;  3RIR A;  4YCV A;  2C8M A;  4LVL A;  4CH4 A;  1RIQ A;  2ARU A;  1LYL A;  3M4Q A;  2ALY B;  4RMF A;  4BWA A;  2ZIM A;  3V7C A;  3LSS A;  4TVY A;  1E1T A;  3L1A A;  12AS A;  2J3M A;  2AMC B;  1HC7 A;  3E9I A;  3M4P A;  2EL9 A;  2ZNJ A;  4H2W A;  3QNE A;  4RQE A;  2AKW A;  4YRG A;  3LSQ A;  2ODR C;  3LC0 A;  4PG3 A;  3V8L A;  2EWN A;  1NJ2 A;  3A5Y A;  3RUX A;  3VQV A;  1IL2 A;  1WQ7 A;  2AMC A;  2Q7G A;  1ASY A;  1BIA A;  4YRP A;  3TEH B;  1WNL A;  3TUP A;  1G5I A;  2ZT5 A;  4YRC A;  4LVJ A;  4HWS A;  4YP0 A;  2E3C A;  1W66 A;  3RKX A;  2QHT A;  2DXT A;  2E64 A;  4YRQ A;  1YFT A;  1EIY B;  2PMF A;  3IAL A;  1KMM A;  4P75 C;  3RL6 A;  3TEH A;  1ADY A;  2ZT6 A;  3V7S A;  4CH5 A;  4H2U A;  3HXX A;  3KFU A;  3FJP A;  3PCO B;  4TWA A;  3IKM B;  4X5O A;  2Q7E A;  4KR2 A;  3IG2 A;  1WQW A;  3TEG A;  4HVC A;  4P75 A;  4RQF A;  4WF2 A;  3A32 A;  2P5I A;  4TVW A;  1H4S A;  3RAC A;  2ZR3 A;  1ASZ A;  3VQY A;  2EJG A;  3PCO A;  2ODR D;  2I4M A;  3DSQ A;  5KNN A;  1X56 A;  1GGM A;  4CS4 A;  4TVA B;  3CMQ A;  5ELO A;  4YDQ A;  2E41 A;  5ELN A;  3HXV A;  2J3L A;  4YCW A;  4YRI A;  1N9W A;  2RHQ A;  4YRM A;  4DPG A;  2DU5 A;  1BIB A;  2ART A;  4TQD A;  1NJ1 A;  2A8E A;  4TVA A;  1X2G A;  3QO5 A;  2DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...