4LVMA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (23nt). mn-bound crystal structure at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
198
structure length
192
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMADM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid recombination enzyme
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
total genus 49
structure length 192
sequence length 198
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvmA01
4LVIA 4LVJA 4LVKA 4LVMA 4LVLA 4HT4A 2NS6A
chains in the Genus database with same CATH superfamily
2E3CA 2A8EA 2DEQA 3REXA 1BIAA 1X55A 1PYSA 3HY1A 2P5IA 5ELNA 4Q15A 2DU7A 4WJ3M 4KR2A 1HC7A 2ODRC 4CH5A 2HNIA 4HWOA 2DQ3A 4KR3A 4YYEA 2CJ9A 5C52B 1EQRA 2CIMA 2I4LA 1C0AA 2E65A 4XTYA 4YRJA 1KMMA 2E5AA 5K1XA 1YFTA 3HFZB 4CH6A 1BBWA 2ZT7A 1NJ8A 1USYA 4RQEA 12ASA 2ARTA 4YPFA 1WU7A 4H02A 1IL2A 2ZTGA 3V8JA 4UP8A 3A5ZA 4XU3A 2ALYA 1YB3A 4YRNA 3HFVA 4LVMA 3PZCA 1N9WA 2ZR3A 1SETA 2C7IA 3OD1A 4UP7A 4YDQA 2ZINA 4XEMA 4XU2A 3EFSA 4YRFA 1E1TA 4TVAA 4ZIBA 2E1HA 3RKWA 2DVEA 4TVYA 3NENA 1EFWA 1Z7NA 2ZNIA 3WQZA 4P71C 3QO8A 5KNNA 1QE0A 2C8MA 1ADYA 4OP0A 4EO4A 4TQDA 2ZXFA 1X56A 3HFZA 3QO5A 1LYLA 2ZIOA 3VQYA 1B70B 1NYQA 4HVCA 4P71A 5ELOA 3QNEA 1W66A 2EJGA 2E41A 1NJ2A 2RHSA 3VQXA 4K88A 3ICAA 2ZT5A 4AH6A 1WLEA 1X54A 2DXUA 3L2ZA 4P75C 2ZZEA 3MEYA 4H2WA 4H2TA 3BFMA 1YGBA 3TEHB 2DTOA 3RKYA 4BW9A 1FYFA 4WI1A 4K86A 1YFSA 2ZZFA 2EWNA 4YROA 4P75A 3A31A 4UPAA 5C53B 2QHSA 4L87A 3V8KA 3MQZA 3RL6A 4H2SA 3M4PA 2Q7EA 3R07A 4YCVA 4YRIA 2EJ9A 4LNSA 3L1AA 3I7FA 1USYC 3VQVA 2IY5B 2RHQA 4P3PA 1G5HA 1JJCA 4LVLA 4PG3A 2ARUA 1YFRA 2I4NA 2ZZGA 5F5WA 4CS3A 4K87A 1L0WA 1X2HA 3MF2A 3HXYA 3FJPA 2DQ0A 3HXUA 3RKXA 4G84A 4CS2A 4YRMA 4O2DA 5E3IA 4H2XB 4YRGA 2ZCEA 3V8LA 1ATIA 2P0LA 1G51A 1NJ1A 3VBBA 1WQWA 3PCOB 3IG2A 5C51B 11ASA 4XU0A 1KOGA 2CJAA 1RIQA 4P3OA 3NEMA 4P73C 3UFGA 4YRKA 1X01A 2DTIA 3HXVA 2ZT6A 4UP9A 2PMEA 1E24A 2QHUA 3LSSA 4HWRA 4P72C 1H4QA 4P73A 4LVKA 1E22A 3HXXA 4NCXA 4XTUA 1EVLA 2ZIMA 3UGTA 1HXDA 1GGMA 2AKWB 1WYDA 3UH0A 4H2UA 4P72A 1EVKA 3ERRA 4G85A 3A7UA 3A5YA 4DPGA 1ADJA 1B7YB 4LVIA 4P74C 2ZGWA 2EAYA 1G5IA 3E9IA 5K1PA 2E10A 4HWTA 3KFUA 4OLFA 1E1OA 3PCOA 4YCUA 2DTHA 2Q5IA 4YRPA 3RIRA 4HWPA 4YRQA 1SRYA 3HRIA 4YRCA 4P74A 4BWAA 3P8VA 2CGHA 2DZ9A 3RF1A 2I4MA 3A32A 1BBUA 4ZTUB 4XTXA 4Q6GA 4CS4A 3A7RA 2ZNJA 3A74A 2ALYB 3W3SA 4WJ4A 4TVWA 1H4SA 4XU1A 1EIYB 1NJ5A 2CJBA 3RUXA 2DZCA 3V7SA 1SERA 2DDZA 1NNHA 1EOVA 2QHTA 3IKMB 1KMNA 3TUPA 2J3MA 1B70A 1BIBA 3L4GB 4XTVA 4DQ2A 1NJ6A 2EJFA 4YRTA 3V7RA 3HXWA 3NELA 4TQFA 4XTZA 3RGLA 2AMCB 3DSQA 1J5WA 4H2VA 1B7YA 4CH3A 3LC0A 3M4QA 3IALA 2I4OA 3UGQA 2QHVA 3V7CA 2DJZA 4YRLA 3TEHA 3RACA 4RDXA 1VQZA 2XTIA 4RMFA 2RHSB 3CMQA 2ZR2A 3E9HA 1HTTA 4XEOA 1B8AA 4TTVA 4E51A 2EL9A 4RQFA 4X5OA 4YP0A 3IKLA 3NETA 3TEGA 1X2GA 3BJUA 1EIYA 2PMFA 3QO7A 4HT4A 3G1ZA 4TWAA 2IY5A 4LVJA 1WNLA 5HGQA 3HY0A 2DKGA 3HTZA 3L4GA 4J15A 3EFRA 4YRRA 3VQWA 4XTWA 4YCWA 3QTCA 4CH4A 1Z7MA 1PYSB 2Q7HA 2AMCA 2NS6A 1WPYA 3HXZA 1B76A 3MF1A 2DU5A 1SESA 2Q5HA 1QF6A 4H2XA 2RHQB 1ASZA 1JJCB 4P3NA 3A7AA 3P8TA 4KQEA 2XGTA 4HA8A 4PHCA 1H4TA 3P8YA 2Q7GA 2ARSA 4WF2A 4YRSA 2ZT8A 2DXTA 3HRKA 2E64A 4ZTZB 3REUA 1ASYA 1NYRA 2J3LA 1H4VB 1WQ7A 2G4CA 4EX5A 4TVAB 2FYKA 3LSQA 4YREA 2ODRD 4H2YA 2AKWA 4HWSA
chains in the Genus database with same CATH topology
2E3CA 2A8EA 2DEQA 3REXA 1BIAA 1X55A 1PYSA 3HY1A 2P5IA 5ELNA 4Q15A 2DU7A 4WJ3M 4KR2A 1HC7A 2ODRC 4CH5A 2HNIA 4HWOA 2DQ3A 4KR3A 4YYEA 2CJ9A 5C52B 1EQRA 2CIMA 2I4LA 1C0AA 2E65A 4XTYA 4YRJA 1KMMA 2E5AA 5K1XA 1YFTA 3HFZB 4CH6A 1BBWA 2ZT7A 1NJ8A 1USYA 4RQEA 12ASA 2ARTA 4YPFA 1WU7A 4H02A 1IL2A 2ZTGA 3V8JA 4UP8A 3A5ZA 4XU3A 2ALYA 1YB3A 4YRNA 3HFVA 4LVMA 3PZCA 1N9WA 2ZR3A 1SETA 2C7IA 3OD1A 4UP7A 4YDQA 2ZINA 4XEMA 4XU2A 3EFSA 4YRFA 1E1TA 4TVAA 4ZIBA 2E1HA 3RKWA 2DVEA 4TVYA 3NENA 1EFWA 1Z7NA 2ZNIA 3WQZA 4P71C 3QO8A 5KNNA 1QE0A 2C8MA 1ADYA 4OP0A 4EO4A 4TQDA 2ZXFA 1X56A 3HFZA 3QO5A 1LYLA 2ZIOA 3VQYA 1B70B 1NYQA 4HVCA 4P71A 5ELOA 3QNEA 1W66A 2EJGA 2E41A 1NJ2A 2RHSA 3VQXA 4K88A 3ICAA 2ZT5A 4AH6A 1WLEA 1X54A 2DXUA 3L2ZA 4P75C 2ZZEA 3MEYA 4H2WA 4H2TA 3BFMA 1YGBA 3TEHB 2DTOA 3RKYA 4BW9A 1FYFA 4WI1A 4K86A 1YFSA 2ZZFA 2EWNA 4YROA 4P75A 3A31A 4UPAA 5C53B 2QHSA 4L87A 3V8KA 3MQZA 3RL6A 4H2SA 3M4PA 2Q7EA 3R07A 4YCVA 4YRIA 2EJ9A 4LNSA 3L1AA 3I7FA 1USYC 3VQVA 2IY5B 2RHQA 4P3PA 1G5HA 1JJCA 4LVLA 4PG3A 2ARUA 1YFRA 2I4NA 2ZZGA 5F5WA 4CS3A 4K87A 1L0WA 1X2HA 3MF2A 3HXYA 3FJPA 2DQ0A 3HXUA 3RKXA 4G84A 4CS2A 4YRMA 4O2DA 5E3IA 4H2XB 4YRGA 2ZCEA 3V8LA 1ATIA 2P0LA 1G51A 1NJ1A 3VBBA 1WQWA 3PCOB 3IG2A 5C51B 11ASA 4XU0A 1KOGA 2CJAA 1RIQA 4P3OA 3NEMA 4P73C 3UFGA 4YRKA 1X01A 2DTIA 3HXVA 2ZT6A 4UP9A 2PMEA 1E24A 2QHUA 3LSSA 4HWRA 4P72C 1H4QA 4P73A 4LVKA 1E22A 3HXXA 4NCXA 4XTUA 1EVLA 2ZIMA 3UGTA 1HXDA 1GGMA 2AKWB 1WYDA 3UH0A 4H2UA 4P72A 1EVKA 3ERRA 4G85A 3A7UA 3A5YA 4DPGA 1ADJA 1B7YB 4LVIA 4P74C 2ZGWA 2EAYA 1G5IA 3E9IA 5K1PA 2E10A 4HWTA 3KFUA 4OLFA 1E1OA 3PCOA 4YCUA 2DTHA 2Q5IA 4YRPA 3RIRA 4HWPA 4YRQA 1SRYA 3HRIA 4YRCA 4P74A 4BWAA 3P8VA 2CGHA 2DZ9A 3RF1A 2I4MA 3A32A 1BBUA 4ZTUB 4XTXA 4Q6GA 4CS4A 3A7RA 2ZNJA 3A74A 2ALYB 3W3SA 4WJ4A 4TVWA 1H4SA 4XU1A 1EIYB 1NJ5A 2CJBA 3RUXA 2DZCA 3V7SA 1SERA 2DDZA 1NNHA 1EOVA 2QHTA 3IKMB 1KMNA 3TUPA 2J3MA 1B70A 1BIBA 3L4GB 4XTVA 4DQ2A 1NJ6A 2EJFA 4YRTA 3V7RA 3HXWA 3NELA 4TQFA 4XTZA 3RGLA 2AMCB 3DSQA 1J5WA 4H2VA 1B7YA 4CH3A 3LC0A 3M4QA 3IALA 2I4OA 3UGQA 2QHVA 3V7CA 2DJZA 4YRLA 3TEHA 3RACA 4RDXA 1VQZA 2XTIA 4RMFA 2RHSB 3CMQA 2ZR2A 3E9HA 1HTTA 4XEOA 1B8AA 4TTVA 4E51A 2EL9A 4RQFA 4X5OA 4YP0A 3IKLA 3NETA 3TEGA 1X2GA 3BJUA 1EIYA 2PMFA 3QO7A 4HT4A 3G1ZA 4TWAA 2IY5A 4LVJA 1WNLA 5HGQA 3HY0A 2DKGA 3HTZA 3L4GA 4J15A 3EFRA 4YRRA 3VQWA 4XTWA 4YCWA 3QTCA 4CH4A 1Z7MA 1PYSB 2Q7HA 2AMCA 2NS6A 1WPYA 3HXZA 1B76A 3MF1A 2DU5A 1SESA 2Q5HA 1QF6A 4H2XA 2RHQB 1ASZA 1JJCB 4P3NA 3A7AA 3P8TA 4KQEA 2XGTA 4HA8A 4PHCA 1H4TA 3P8YA 2Q7GA 2ARSA 4WF2A 4YRSA 2ZT8A 2DXTA 3HRKA 2E64A 4ZTZB 3REUA 1ASYA 1NYRA 2J3LA 1H4VB 1WQ7A 2G4CA 4EX5A 4TVAB 2FYKA 3LSQA 4YREA 2ODRD 4H2YA 2AKWA 4HWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVI A;  4LVJ A;  4LVK A;  4LVM A;  4LVL A;  4HT4 A;  2NS6 A; 
#chains in the Genus database with same CATH topology
 2E3C A;  2A8E A;  2DEQ A;  3REX A;  1BIA A;  1X55 A;  1PYS A;  3HY1 A;  2P5I A;  5ELN A;  4Q15 A;  2DU7 A;  4WJ3 M;  4KR2 A;  1HC7 A;  2ODR C;  4CH5 A;  2HNI A;  4HWO A;  2DQ3 A;  4KR3 A;  4YYE A;  2CJ9 A;  5C52 B;  1EQR A;  2CIM A;  2I4L A;  1C0A A;  2E65 A;  4XTY A;  4YRJ A;  1KMM A;  2E5A A;  5K1X A;  1YFT A;  3HFZ B;  4CH6 A;  1BBW A;  2ZT7 A;  1NJ8 A;  1USY A;  4RQE A;  12AS A;  2ART A;  4YPF A;  1WU7 A;  4H02 A;  1IL2 A;  2ZTG A;  3V8J A;  4UP8 A;  3A5Z A;  4XU3 A;  2ALY A;  1YB3 A;  4YRN A;  3HFV A;  4LVM A;  3PZC A;  1N9W A;  2ZR3 A;  1SET A;  2C7I A;  3OD1 A;  4UP7 A;  4YDQ A;  2ZIN A;  4XEM A;  4XU2 A;  3EFS A;  4YRF A;  1E1T A;  4TVA A;  4ZIB A;  2E1H A;  3RKW A;  2DVE A;  4TVY A;  3NEN A;  1EFW A;  1Z7N A;  2ZNI A;  3WQZ A;  4P71 C;  3QO8 A;  5KNN A;  1QE0 A;  2C8M A;  1ADY A;  4OP0 A;  4EO4 A;  4TQD A;  2ZXF A;  1X56 A;  3HFZ A;  3QO5 A;  1LYL A;  2ZIO A;  3VQY A;  1B70 B;  1NYQ A;  4HVC A;  4P71 A;  5ELO A;  3QNE A;  1W66 A;  2EJG A;  2E41 A;  1NJ2 A;  2RHS A;  3VQX A;  4K88 A;  3ICA A;  2ZT5 A;  4AH6 A;  1WLE A;  1X54 A;  2DXU A;  3L2Z A;  4P75 C;  2ZZE A;  3MEY A;  4H2W A;  4H2T A;  3BFM A;  1YGB A;  3TEH B;  2DTO A;  3RKY A;  4BW9 A;  1FYF A;  4WI1 A;  4K86 A;  1YFS A;  2ZZF A;  2EWN A;  4YRO A;  4P75 A;  3A31 A;  4UPA A;  5C53 B;  2QHS A;  4L87 A;  3V8K A;  3MQZ A;  3RL6 A;  4H2S A;  3M4P A;  2Q7E A;  3R07 A;  4YCV A;  4YRI A;  2EJ9 A;  4LNS A;  3L1A A;  3I7F A;  1USY C;  3VQV A;  2IY5 B;  2RHQ A;  4P3P A;  1G5H A;  1JJC A;  4LVL A;  4PG3 A;  2ARU A;  1YFR A;  2I4N A;  2ZZG A;  5F5W A;  4CS3 A;  4K87 A;  1L0W A;  1X2H A;  3MF2 A;  3HXY A;  3FJP A;  2DQ0 A;  3HXU A;  3RKX A;  4G84 A;  4CS2 A;  4YRM A;  4O2D A;  5E3I A;  4H2X B;  4YRG A;  2ZCE A;  3V8L A;  1ATI A;  2P0L A;  1G51 A;  1NJ1 A;  3VBB A;  1WQW A;  3PCO B;  3IG2 A;  5C51 B;  11AS A;  4XU0 A;  1KOG A;  2CJA A;  1RIQ A;  4P3O A;  3NEM A;  4P73 C;  3UFG A;  4YRK A;  1X01 A;  2DTI A;  3HXV A;  2ZT6 A;  4UP9 A;  2PME A;  1E24 A;  2QHU A;  3LSS A;  4HWR A;  4P72 C;  1H4Q A;  4P73 A;  4LVK A;  1E22 A;  3HXX A;  4NCX A;  4XTU A;  1EVL A;  2ZIM A;  3UGT A;  1HXD A;  1GGM A;  2AKW B;  1WYD A;  3UH0 A;  4H2U A;  4P72 A;  1EVK A;  3ERR A;  4G85 A;  3A7U A;  3A5Y A;  4DPG A;  1ADJ A;  1B7Y B;  4LVI A;  4P74 C;  2ZGW A;  2EAY A;  1G5I A;  3E9I A;  5K1P A;  2E10 A;  4HWT A;  3KFU A;  4OLF A;  1E1O A;  3PCO A;  4YCU A;  2DTH A;  2Q5I A;  4YRP A;  3RIR A;  4HWP A;  4YRQ A;  1SRY A;  3HRI A;  4YRC A;  4P74 A;  4BWA A;  3P8V A;  2CGH A;  2DZ9 A;  3RF1 A;  2I4M A;  3A32 A;  1BBU A;  4ZTU B;  4XTX A;  4Q6G A;  4CS4 A;  3A7R A;  2ZNJ A;  3A74 A;  2ALY B;  3W3S A;  4WJ4 A;  4TVW A;  1H4S A;  4XU1 A;  1EIY B;  1NJ5 A;  2CJB A;  3RUX A;  2DZC A;  3V7S A;  1SER A;  2DDZ A;  1NNH A;  1EOV A;  2QHT A;  3IKM B;  1KMN A;  3TUP A;  2J3M A;  1B70 A;  1BIB A;  3L4G B;  4XTV A;  4DQ2 A;  1NJ6 A;  2EJF A;  4YRT A;  3V7R A;  3HXW A;  3NEL A;  4TQF A;  4XTZ A;  3RGL A;  2AMC B;  3DSQ A;  1J5W A;  4H2V A;  1B7Y A;  4CH3 A;  3LC0 A;  3M4Q A;  3IAL A;  2I4O A;  3UGQ A;  2QHV A;  3V7C A;  2DJZ A;  4YRL A;  3TEH A;  3RAC A;  4RDX A;  1VQZ A;  2XTI A;  4RMF A;  2RHS B;  3CMQ A;  2ZR2 A;  3E9H A;  1HTT A;  4XEO A;  1B8A A;  4TTV A;  4E51 A;  2EL9 A;  4RQF A;  4X5O A;  4YP0 A;  3IKL A;  3NET A;  3TEG A;  1X2G A;  3BJU A;  1EIY A;  2PMF A;  3QO7 A;  4HT4 A;  3G1Z A;  4TWA A;  2IY5 A;  4LVJ A;  1WNL A;  5HGQ A;  3HY0 A;  2DKG A;  3HTZ A;  3L4G A;  4J15 A;  3EFR A;  4YRR A;  3VQW A;  4XTW A;  4YCW A;  3QTC A;  4CH4 A;  1Z7M A;  1PYS B;  2Q7H A;  2AMC A;  2NS6 A;  1WPY A;  3HXZ A;  1B76 A;  3MF1 A;  2DU5 A;  1SES A;  2Q5H A;  1QF6 A;  4H2X A;  2RHQ B;  1ASZ A;  1JJC B;  4P3N A;  3A7A A;  3P8T A;  4KQE A;  2XGT A;  4HA8 A;  4PHC A;  1H4T A;  3P8Y A;  2Q7G A;  2ARS A;  4WF2 A;  4YRS A;  2ZT8 A;  2DXT A;  3HRK A;  2E64 A;  4ZTZ B;  3REU A;  1ASY A;  1NYR A;  2J3L A;  1H4V B;  1WQ7 A;  2G4C A;  4EX5 A;  4TVA B;  2FYK A;  3LSQ A;  4YRE A;  2ODR D;  4H2Y A;  2AKW A;  4HWS A; 
#chains in the Genus database with same CATH homology
 2E3C A;  2A8E A;  2DEQ A;  3REX A;  1BIA A;  1X55 A;  1PYS A;  3HY1 A;  2P5I A;  5ELN A;  4Q15 A;  2DU7 A;  4WJ3 M;  4KR2 A;  1HC7 A;  2ODR C;  4CH5 A;  2HNI A;  4HWO A;  2DQ3 A;  4KR3 A;  4YYE A;  2CJ9 A;  5C52 B;  1EQR A;  2CIM A;  2I4L A;  1C0A A;  2E65 A;  4XTY A;  4YRJ A;  1KMM A;  2E5A A;  5K1X A;  1YFT A;  3HFZ B;  4CH6 A;  1BBW A;  2ZT7 A;  1NJ8 A;  1USY A;  4RQE A;  12AS A;  2ART A;  4YPF A;  1WU7 A;  4H02 A;  1IL2 A;  2ZTG A;  3V8J A;  4UP8 A;  3A5Z A;  4XU3 A;  2ALY A;  1YB3 A;  4YRN A;  3HFV A;  4LVM A;  3PZC A;  1N9W A;  2ZR3 A;  1SET A;  2C7I A;  3OD1 A;  4UP7 A;  4YDQ A;  2ZIN A;  4XEM A;  4XU2 A;  3EFS A;  4YRF A;  1E1T A;  4TVA A;  4ZIB A;  2E1H A;  3RKW A;  2DVE A;  4TVY A;  3NEN A;  1EFW A;  1Z7N A;  2ZNI A;  3WQZ A;  4P71 C;  3QO8 A;  5KNN A;  1QE0 A;  2C8M A;  1ADY A;  4OP0 A;  4EO4 A;  4TQD A;  2ZXF A;  1X56 A;  3HFZ A;  3QO5 A;  1LYL A;  2ZIO A;  3VQY A;  1B70 B;  1NYQ A;  4HVC A;  4P71 A;  5ELO A;  3QNE A;  1W66 A;  2EJG A;  2E41 A;  1NJ2 A;  2RHS A;  3VQX A;  4K88 A;  3ICA A;  2ZT5 A;  4AH6 A;  1WLE A;  1X54 A;  2DXU A;  3L2Z A;  4P75 C;  2ZZE A;  3MEY A;  4H2W A;  4H2T A;  3BFM A;  1YGB A;  3TEH B;  2DTO A;  3RKY A;  4BW9 A;  1FYF A;  4WI1 A;  4K86 A;  1YFS A;  2ZZF A;  2EWN A;  4YRO A;  4P75 A;  3A31 A;  4UPA A;  5C53 B;  2QHS A;  4L87 A;  3V8K A;  3MQZ A;  3RL6 A;  4H2S A;  3M4P A;  2Q7E A;  3R07 A;  4YCV A;  4YRI A;  2EJ9 A;  4LNS A;  3L1A A;  3I7F A;  1USY C;  3VQV A;  2IY5 B;  2RHQ A;  4P3P A;  1G5H A;  1JJC A;  4LVL A;  4PG3 A;  2ARU A;  1YFR A;  2I4N A;  2ZZG A;  5F5W A;  4CS3 A;  4K87 A;  1L0W A;  1X2H A;  3MF2 A;  3HXY A;  3FJP A;  2DQ0 A;  3HXU A;  3RKX A;  4G84 A;  4CS2 A;  4YRM A;  4O2D A;  5E3I A;  4H2X B;  4YRG A;  2ZCE A;  3V8L A;  1ATI A;  2P0L A;  1G51 A;  1NJ1 A;  3VBB A;  1WQW A;  3PCO B;  3IG2 A;  5C51 B;  11AS A;  4XU0 A;  1KOG A;  2CJA A;  1RIQ A;  4P3O A;  3NEM A;  4P73 C;  3UFG A;  4YRK A;  1X01 A;  2DTI A;  3HXV A;  2ZT6 A;  4UP9 A;  2PME A;  1E24 A;  2QHU A;  3LSS A;  4HWR A;  4P72 C;  1H4Q A;  4P73 A;  4LVK A;  1E22 A;  3HXX A;  4NCX A;  4XTU A;  1EVL A;  2ZIM A;  3UGT A;  1HXD A;  1GGM A;  2AKW B;  1WYD A;  3UH0 A;  4H2U A;  4P72 A;  1EVK A;  3ERR A;  4G85 A;  3A7U A;  3A5Y A;  4DPG A;  1ADJ A;  1B7Y B;  4LVI A;  4P74 C;  2ZGW A;  2EAY A;  1G5I A;  3E9I A;  5K1P A;  2E10 A;  4HWT A;  3KFU A;  4OLF A;  1E1O A;  3PCO A;  4YCU A;  2DTH A;  2Q5I A;  4YRP A;  3RIR A;  4HWP A;  4YRQ A;  1SRY A;  3HRI A;  4YRC A;  4P74 A;  4BWA A;  3P8V A;  2CGH A;  2DZ9 A;  3RF1 A;  2I4M A;  3A32 A;  1BBU A;  4ZTU B;  4XTX A;  4Q6G A;  4CS4 A;  3A7R A;  2ZNJ A;  3A74 A;  2ALY B;  3W3S A;  4WJ4 A;  4TVW A;  1H4S A;  4XU1 A;  1EIY B;  1NJ5 A;  2CJB A;  3RUX A;  2DZC A;  3V7S A;  1SER A;  2DDZ A;  1NNH A;  1EOV A;  2QHT A;  3IKM B;  1KMN A;  3TUP A;  2J3M A;  1B70 A;  1BIB A;  3L4G B;  4XTV A;  4DQ2 A;  1NJ6 A;  2EJF A;  4YRT A;  3V7R A;  3HXW A;  3NEL A;  4TQF A;  4XTZ A;  3RGL A;  2AMC B;  3DSQ A;  1J5W A;  4H2V A;  1B7Y A;  4CH3 A;  3LC0 A;  3M4Q A;  3IAL A;  2I4O A;  3UGQ A;  2QHV A;  3V7C A;  2DJZ A;  4YRL A;  3TEH A;  3RAC A;  4RDX A;  1VQZ A;  2XTI A;  4RMF A;  2RHS B;  3CMQ A;  2ZR2 A;  3E9H A;  1HTT A;  4XEO A;  1B8A A;  4TTV A;  4E51 A;  2EL9 A;  4RQF A;  4X5O A;  4YP0 A;  3IKL A;  3NET A;  3TEG A;  1X2G A;  3BJU A;  1EIY A;  2PMF A;  3QO7 A;  4HT4 A;  3G1Z A;  4TWA A;  2IY5 A;  4LVJ A;  1WNL A;  5HGQ A;  3HY0 A;  2DKG A;  3HTZ A;  3L4G A;  4J15 A;  3EFR A;  4YRR A;  3VQW A;  4XTW A;  4YCW A;  3QTC A;  4CH4 A;  1Z7M A;  1PYS B;  2Q7H A;  2AMC A;  2NS6 A;  1WPY A;  3HXZ A;  1B76 A;  3MF1 A;  2DU5 A;  1SES A;  2Q5H A;  1QF6 A;  4H2X A;  2RHQ B;  1ASZ A;  1JJC B;  4P3N A;  3A7A A;  3P8T A;  4KQE A;  2XGT A;  4HA8 A;  4PHC A;  1H4T A;  3P8Y A;  2Q7G A;  2ARS A;  4WF2 A;  4YRS A;  2ZT8 A;  2DXT A;  3HRK A;  2E64 A;  4ZTZ B;  3REU A;  1ASY A;  1NYR A;  2J3L A;  1H4V B;  1WQ7 A;  2G4C A;  4EX5 A;  4TVA B;  2FYK A;  3LSQ A;  4YRE A;  2ODR D;  4H2Y A;  2AKW A;  4HWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...