4LVMA

Mobm relaxase domain (mobv; mob_pre) bound to plasmid pmv158 orit dna (23nt). mn-bound crystal structure at ph 6.5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
198
structure length
192
Chain Sequence
SYMVARMQKMKAGNLGGAFKHNERVKDINPSRSHLNYELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMADM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a histidine-DNA nicking/joining mechanism for gene transfer and promiscuous spread of antibiotic resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Dna binding protein/dna
molecule keywords Plasmid recombination enzyme
total genus 49
structure length 192
sequence length 198
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.30 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 BirA Bifunctional Protein; domain 2 4lvmA01
4LVMA 2NS6A 4LVKA 4LVJA 4LVLA 4HT4A 4LVIA
chains in the Genus database with same CATH superfamily
2ODRD 4YRJA 2J3MA 4XTVA 3RKWA 4H2SA 4YDQA 4K87A 2DU5A 3VBBA 4LNSA 3HY1A 2Q5IA 4EX5A 4YRKA 2ZT5A 2E3CA 4H2XA 3QO7A 3LC0A 4YRRA 2IY5B 2G4CA 4YRTA 1NYQA 3HXUA 1E24A 3HXZA 2DU7A 5C53B 4YRSA 3UH0A 4H2XB 2AMCA 4NCXA 4H2VA 4HVCA 3RKXA 4P75C 4E51A 4LVIA 4P75A 1EVLA 3TEHA 1EQRA 4BWAA 1BBUA 3PCOA 3RUXA 4RMFA 1WNLA 4LVKA 3REUA 4PG3A 3ERRA 3HXWA 5ELNA 1YFRA 4YRCA 4Q6GA 4WJ4A 4YCVA 4KR3A 4YRGA 4YCUA 4YYEA 1NYRA 1YGBA 2Q5HA 2RHSB 2P0LA 3A7RA 4AH6A 4YRNA 2ZNIA 1HC7A 2CIMA 2ZCEA 2ZNJA 4CS4A 1H4SA 1ADYA 3FJPA 2DTIA 3TUPA 1NJ5A 1X55A 1LYLA 2QHUA 4LVMA 1WQ7A 1C0AA 4K88A 5KNNA 4BW9A 2AKWB 3G1ZA 4TVAB 2E41A 2ZZGA 1WQWA 3A7AA 3CMQA 4YP0A 4P73C 5HGQA 3HXVA 1BIBA 3HXXA 2Q7HA 4XTYA 1EIYA 3LSQA 2DZCA 3BJUA 4TVYA 3A32A 3R07A 2DVEA 1PYSA 2HNIA 4XEOA 1G51A 2QHTA 4P73A 4P72A 2E5AA 3HRKA 4YPFA 2DTOA 4L87A 4XTZA 3P8TA 2DDZA 2A8EA 3E9IA 3HXYA 4RDXA 4P72C 1W66A 1B70A 2CJAA 3KFUA 4YCWA 4UP9A 2DKGA 2ZIOA 3RGLA 4XTWA 2EJ9A 4LVLA 1ASZA 1USYA 3RKYA 2ARUA 1VQZA 4H2TA 3M4QA 1X2HA 2DEQA 1KMNA 3IKLA 4KR2A 4PHCA 2DXUA 2ZINA 2DJZA 4DPGA 12ASA 4H2UA 4YROA 1WU7A 1FYFA 4XU0A 1B8AA 3NELA 3P8YA 4TQDA 2CJ9A 2PMFA 4ZTUB 1SESA 1X54A 4YRFA 1H4QA 2ALYA 3IALA 2XGTA 4CS2A 4P74C 3QTCA 1WYDA 2ZR2A 1H4VB 1L0WA 3VQWA 4OP0A 4YRPA 4HT4A 4UP7A 3QO8A 3REXA 2ZT7A 2ARTA 4HWPA 4P71A 3V8KA 2ZT8A 3RIRA 3RL6A 4WI1A 5C51B 3A74A 4RQFA 2ALYB 2ZR3A 2PMEA 3E9HA 1YFTA 1BBWA 2ARSA 2ZIMA 3VQXA 4CS3A 4P71C 3EFRA 4YRMA 3VQVA 2ZTGA 2AKWA 3A7UA 3ICAA 3EFSA 2QHSA 2C8MA 4P3NA 4TVWA 2EJFA 4YREA 1KOGA 2FYKA 4K86A 2ZZEA 1H4TA 1NJ8A 2Q7GA 2RHQA 2I4LA 4EO4A 4XEMA 3UGQA 2NS6A 1QE0A 3MEYA 5C52B 4YRLA 4WJ3M 1KMMA 1RIQA 1QF6A 3MF2A 1B7YB 3BFMA 4H2WA 4TWAA 3RF1A 1WPYA 1EOVA 5K1PA 1J5WA 3HFZB 3OD1A 4TTVA 4DQ2A 3HFZA 1PYSB 2ZXFA 3NEMA 3L4GB 1ATIA 4P74A 3HRIA 1X2GA 3TEGA 2E64A 1SETA 4P3PA 2DTHA 1G5HA 2J3LA 3A5ZA 2RHSA 3MF1A 1N9WA 4P3OA 2I4OA 3NENA 2DQ3A 3M4PA 1YFSA 3MQZA 3QO5A 3W3SA 4XU3A 4WF2A 3QNEA 4HWTA 3L4GA 4KQEA 4ZIBA 1HXDA 3UGTA 1EVKA 2EAYA 1B76A 2E1HA 3NETA 4TQFA 1E22A 4YRQA 5F5WA 1Z7MA 4CH6A 3V7CA 4J15A 3HY0A 1B7YA 1USYC 4YRIA 1WLEA 3V7RA 4RQEA 1Z7NA 4UP8A 1BIAA 3VQYA 3IKMB 3P8VA 11ASA 1E1OA 4ZTZB 1GGMA 4OLFA 3RACA 2ZT6A 1X56A 3TEHB 4CH4A 2ODRC 3PCOB 3A31A 1G5IA 4X5OA 4HWRA 4LVJA 2EL9A 4XTUA 4XU2A 1X01A 1B70B 3HTZA 2ZZFA 2XTIA 2I4NA 3I7FA 2DZ9A 4H02A 3LSSA 3PZCA 1SRYA 4HWOA 1YB3A 5K1XA 4O2DA 4CH3A 1NJ6A 3V8LA 3A5YA 1NJ1A 2CJBA 2EWNA 4HA8A 3HFVA 2AMCB 2C7IA 4Q15A 4H2YA 2P5IA 3L2ZA 2EJGA 1EIYB 2I4MA 4UPAA 1NJ2A 3IG2A 4HWSA 1EFWA 1SERA 2ZGWA 4TVAA 2E65A 5E3IA 3WQZA 4XU1A 2Q7EA 2E10A 1IL2A 1HTTA 1JJCA 2QHVA 3L1AA 3DSQA 4CH5A 1E1TA 4G85A 3UFGA 2RHQB 1JJCB 2DXTA 4G84A 2DQ0A 2IY5A 1ASYA 5ELOA 3V7SA 3V8JA 4XTXA 1ADJA 2CGHA 1NNHA
chains in the Genus database with same CATH topology
2ODRD 4YRJA 2J3MA 4XTVA 3RKWA 4H2SA 4YDQA 4K87A 2DU5A 3VBBA 4LNSA 3HY1A 2Q5IA 4EX5A 4YRKA 2ZT5A 2E3CA 4H2XA 3QO7A 3LC0A 4YRRA 2IY5B 2G4CA 4YRTA 1NYQA 3HXUA 1E24A 3HXZA 2DU7A 5C53B 4YRSA 3UH0A 4H2XB 2AMCA 4NCXA 4H2VA 4HVCA 3RKXA 4P75C 4E51A 4LVIA 4P75A 1EVLA 3TEHA 1EQRA 4BWAA 1BBUA 3PCOA 3RUXA 4RMFA 1WNLA 4LVKA 3REUA 4PG3A 3ERRA 3HXWA 5ELNA 1YFRA 4YRCA 4Q6GA 4WJ4A 4YCVA 4KR3A 4YRGA 4YCUA 4YYEA 1NYRA 1YGBA 2Q5HA 2RHSB 2P0LA 3A7RA 4AH6A 4YRNA 2ZNIA 1HC7A 2CIMA 2ZCEA 2ZNJA 4CS4A 1H4SA 1ADYA 3FJPA 2DTIA 3TUPA 1NJ5A 1X55A 1LYLA 2QHUA 4LVMA 1WQ7A 1C0AA 4K88A 5KNNA 4BW9A 2AKWB 3G1ZA 4TVAB 2E41A 2ZZGA 1WQWA 3A7AA 3CMQA 4YP0A 4P73C 5HGQA 3HXVA 1BIBA 3HXXA 2Q7HA 4XTYA 1EIYA 3LSQA 2DZCA 3BJUA 4TVYA 3A32A 3R07A 2DVEA 1PYSA 2HNIA 4XEOA 1G51A 2QHTA 4P73A 4P72A 2E5AA 3HRKA 4YPFA 2DTOA 4L87A 4XTZA 3P8TA 2DDZA 2A8EA 3E9IA 3HXYA 4RDXA 4P72C 1W66A 1B70A 2CJAA 3KFUA 4YCWA 4UP9A 2DKGA 2ZIOA 3RGLA 4XTWA 2EJ9A 4LVLA 1ASZA 1USYA 3RKYA 2ARUA 1VQZA 4H2TA 3M4QA 1X2HA 2DEQA 1KMNA 3IKLA 4KR2A 4PHCA 2DXUA 2ZINA 2DJZA 4DPGA 12ASA 4H2UA 4YROA 1WU7A 1FYFA 4XU0A 1B8AA 3NELA 3P8YA 4TQDA 2CJ9A 2PMFA 4ZTUB 1SESA 1X54A 4YRFA 1H4QA 2ALYA 3IALA 2XGTA 4CS2A 4P74C 3QTCA 1WYDA 2ZR2A 1H4VB 1L0WA 3VQWA 4OP0A 4YRPA 4HT4A 4UP7A 3QO8A 3REXA 2ZT7A 2ARTA 4HWPA 4P71A 3V8KA 2ZT8A 3RIRA 3RL6A 4WI1A 5C51B 3A74A 4RQFA 2ALYB 2ZR3A 2PMEA 3E9HA 1YFTA 1BBWA 2ARSA 2ZIMA 3VQXA 4CS3A 4P71C 3EFRA 4YRMA 3VQVA 2ZTGA 2AKWA 3A7UA 3ICAA 3EFSA 2QHSA 2C8MA 4P3NA 4TVWA 2EJFA 4YREA 1KOGA 2FYKA 4K86A 2ZZEA 1H4TA 1NJ8A 2Q7GA 2RHQA 2I4LA 4EO4A 4XEMA 3UGQA 2NS6A 1QE0A 3MEYA 5C52B 4YRLA 4WJ3M 1KMMA 1RIQA 1QF6A 3MF2A 1B7YB 3BFMA 4H2WA 4TWAA 3RF1A 1WPYA 1EOVA 5K1PA 1J5WA 3HFZB 3OD1A 4TTVA 4DQ2A 3HFZA 1PYSB 2ZXFA 3NEMA 3L4GB 1ATIA 4P74A 3HRIA 1X2GA 3TEGA 2E64A 1SETA 4P3PA 2DTHA 1G5HA 2J3LA 3A5ZA 2RHSA 3MF1A 1N9WA 4P3OA 2I4OA 3NENA 2DQ3A 3M4PA 1YFSA 3MQZA 3QO5A 3W3SA 4XU3A 4WF2A 3QNEA 4HWTA 3L4GA 4KQEA 4ZIBA 1HXDA 3UGTA 1EVKA 2EAYA 1B76A 2E1HA 3NETA 4TQFA 1E22A 4YRQA 5F5WA 1Z7MA 4CH6A 3V7CA 4J15A 3HY0A 1B7YA 1USYC 4YRIA 1WLEA 3V7RA 4RQEA 1Z7NA 4UP8A 1BIAA 3VQYA 3IKMB 3P8VA 11ASA 1E1OA 4ZTZB 1GGMA 4OLFA 3RACA 2ZT6A 1X56A 3TEHB 4CH4A 2ODRC 3PCOB 3A31A 1G5IA 4X5OA 4HWRA 4LVJA 2EL9A 4XTUA 4XU2A 1X01A 1B70B 3HTZA 2ZZFA 2XTIA 2I4NA 3I7FA 2DZ9A 4H02A 3LSSA 3PZCA 1SRYA 4HWOA 1YB3A 5K1XA 4O2DA 4CH3A 1NJ6A 3V8LA 3A5YA 1NJ1A 2CJBA 2EWNA 4HA8A 3HFVA 2AMCB 2C7IA 4Q15A 4H2YA 2P5IA 3L2ZA 2EJGA 1EIYB 2I4MA 4UPAA 1NJ2A 3IG2A 4HWSA 1EFWA 1SERA 2ZGWA 4TVAA 2E65A 5E3IA 3WQZA 4XU1A 2Q7EA 2E10A 1IL2A 1HTTA 1JJCA 2QHVA 3L1AA 3DSQA 4CH5A 1E1TA 4G85A 3UFGA 2RHQB 1JJCB 2DXTA 4G84A 2DQ0A 2IY5A 1ASYA 5ELOA 3V7SA 3V8JA 4XTXA 1ADJA 2CGHA 1NNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVM A;  2NS6 A;  4LVK A;  4LVJ A;  4LVL A;  4HT4 A;  4LVI A; 
#chains in the Genus database with same CATH topology
 2ODR D;  4YRJ A;  2J3M A;  4XTV A;  3RKW A;  4H2S A;  4YDQ A;  4K87 A;  2DU5 A;  3VBB A;  4LNS A;  3HY1 A;  2Q5I A;  4EX5 A;  4YRK A;  2ZT5 A;  2E3C A;  4H2X A;  3QO7 A;  3LC0 A;  4YRR A;  2IY5 B;  2G4C A;  4YRT A;  1NYQ A;  3HXU A;  1E24 A;  3HXZ A;  2DU7 A;  5C53 B;  4YRS A;  3UH0 A;  4H2X B;  2AMC A;  4NCX A;  4H2V A;  4HVC A;  3RKX A;  4P75 C;  4E51 A;  4LVI A;  4P75 A;  1EVL A;  3TEH A;  1EQR A;  4BWA A;  1BBU A;  3PCO A;  3RUX A;  4RMF A;  1WNL A;  4LVK A;  3REU A;  4PG3 A;  3ERR A;  3HXW A;  5ELN A;  1YFR A;  4YRC A;  4Q6G A;  4WJ4 A;  4YCV A;  4KR3 A;  4YRG A;  4YCU A;  4YYE A;  1NYR A;  1YGB A;  2Q5H A;  2RHS B;  2P0L A;  3A7R A;  4AH6 A;  4YRN A;  2ZNI A;  1HC7 A;  2CIM A;  2ZCE A;  2ZNJ A;  4CS4 A;  1H4S A;  1ADY A;  3FJP A;  2DTI A;  3TUP A;  1NJ5 A;  1X55 A;  1LYL A;  2QHU A;  4LVM A;  1WQ7 A;  1C0A A;  4K88 A;  5KNN A;  4BW9 A;  2AKW B;  3G1Z A;  4TVA B;  2E41 A;  2ZZG A;  1WQW A;  3A7A A;  3CMQ A;  4YP0 A;  4P73 C;  5HGQ A;  3HXV A;  1BIB A;  3HXX A;  2Q7H A;  4XTY A;  1EIY A;  3LSQ A;  2DZC A;  3BJU A;  4TVY A;  3A32 A;  3R07 A;  2DVE A;  1PYS A;  2HNI A;  4XEO A;  1G51 A;  2QHT A;  4P73 A;  4P72 A;  2E5A A;  3HRK A;  4YPF A;  2DTO A;  4L87 A;  4XTZ A;  3P8T A;  2DDZ A;  2A8E A;  3E9I A;  3HXY A;  4RDX A;  4P72 C;  1W66 A;  1B70 A;  2CJA A;  3KFU A;  4YCW A;  4UP9 A;  2DKG A;  2ZIO A;  3RGL A;  4XTW A;  2EJ9 A;  4LVL A;  1ASZ A;  1USY A;  3RKY A;  2ARU A;  1VQZ A;  4H2T A;  3M4Q A;  1X2H A;  2DEQ A;  1KMN A;  3IKL A;  4KR2 A;  4PHC A;  2DXU A;  2ZIN A;  2DJZ A;  4DPG A;  12AS A;  4H2U A;  4YRO A;  1WU7 A;  1FYF A;  4XU0 A;  1B8A A;  3NEL A;  3P8Y A;  4TQD A;  2CJ9 A;  2PMF A;  4ZTU B;  1SES A;  1X54 A;  4YRF A;  1H4Q A;  2ALY A;  3IAL A;  2XGT A;  4CS2 A;  4P74 C;  3QTC A;  1WYD A;  2ZR2 A;  1H4V B;  1L0W A;  3VQW A;  4OP0 A;  4YRP A;  4HT4 A;  4UP7 A;  3QO8 A;  3REX A;  2ZT7 A;  2ART A;  4HWP A;  4P71 A;  3V8K A;  2ZT8 A;  3RIR A;  3RL6 A;  4WI1 A;  5C51 B;  3A74 A;  4RQF A;  2ALY B;  2ZR3 A;  2PME A;  3E9H A;  1YFT A;  1BBW A;  2ARS A;  2ZIM A;  3VQX A;  4CS3 A;  4P71 C;  3EFR A;  4YRM A;  3VQV A;  2ZTG A;  2AKW A;  3A7U A;  3ICA A;  3EFS A;  2QHS A;  2C8M A;  4P3N A;  4TVW A;  2EJF A;  4YRE A;  1KOG A;  2FYK A;  4K86 A;  2ZZE A;  1H4T A;  1NJ8 A;  2Q7G A;  2RHQ A;  2I4L A;  4EO4 A;  4XEM A;  3UGQ A;  2NS6 A;  1QE0 A;  3MEY A;  5C52 B;  4YRL A;  4WJ3 M;  1KMM A;  1RIQ A;  1QF6 A;  3MF2 A;  1B7Y B;  3BFM A;  4H2W A;  4TWA A;  3RF1 A;  1WPY A;  1EOV A;  5K1P A;  1J5W A;  3HFZ B;  3OD1 A;  4TTV A;  4DQ2 A;  3HFZ A;  1PYS B;  2ZXF A;  3NEM A;  3L4G B;  1ATI A;  4P74 A;  3HRI A;  1X2G A;  3TEG A;  2E64 A;  1SET A;  4P3P A;  2DTH A;  1G5H A;  2J3L A;  3A5Z A;  2RHS A;  3MF1 A;  1N9W A;  4P3O A;  2I4O A;  3NEN A;  2DQ3 A;  3M4P A;  1YFS A;  3MQZ A;  3QO5 A;  3W3S A;  4XU3 A;  4WF2 A;  3QNE A;  4HWT A;  3L4G A;  4KQE A;  4ZIB A;  1HXD A;  3UGT A;  1EVK A;  2EAY A;  1B76 A;  2E1H A;  3NET A;  4TQF A;  1E22 A;  4YRQ A;  5F5W A;  1Z7M A;  4CH6 A;  3V7C A;  4J15 A;  3HY0 A;  1B7Y A;  1USY C;  4YRI A;  1WLE A;  3V7R A;  4RQE A;  1Z7N A;  4UP8 A;  1BIA A;  3VQY A;  3IKM B;  3P8V A;  11AS A;  1E1O A;  4ZTZ B;  1GGM A;  4OLF A;  3RAC A;  2ZT6 A;  1X56 A;  3TEH B;  4CH4 A;  2ODR C;  3PCO B;  3A31 A;  1G5I A;  4X5O A;  4HWR A;  4LVJ A;  2EL9 A;  4XTU A;  4XU2 A;  1X01 A;  1B70 B;  3HTZ A;  2ZZF A;  2XTI A;  2I4N A;  3I7F A;  2DZ9 A;  4H02 A;  3LSS A;  3PZC A;  1SRY A;  4HWO A;  1YB3 A;  5K1X A;  4O2D A;  4CH3 A;  1NJ6 A;  3V8L A;  3A5Y A;  1NJ1 A;  2CJB A;  2EWN A;  4HA8 A;  3HFV A;  2AMC B;  2C7I A;  4Q15 A;  4H2Y A;  2P5I A;  3L2Z A;  2EJG A;  1EIY B;  2I4M A;  4UPA A;  1NJ2 A;  3IG2 A;  4HWS A;  1EFW A;  1SER A;  2ZGW A;  4TVA A;  2E65 A;  5E3I A;  3WQZ A;  4XU1 A;  2Q7E A;  2E10 A;  1IL2 A;  1HTT A;  1JJC A;  2QHV A;  3L1A A;  3DSQ A;  4CH5 A;  1E1T A;  4G85 A;  3UFG A;  2RHQ B;  1JJC B;  2DXT A;  4G84 A;  2DQ0 A;  2IY5 A;  1ASY A;  5ELO A;  3V7S A;  3V8J A;  4XTX A;  1ADJ A;  2CGH A;  1NNH A; 
#chains in the Genus database with same CATH homology
 2ODR D;  4YRJ A;  2J3M A;  4XTV A;  3RKW A;  4H2S A;  4YDQ A;  4K87 A;  2DU5 A;  3VBB A;  4LNS A;  3HY1 A;  2Q5I A;  4EX5 A;  4YRK A;  2ZT5 A;  2E3C A;  4H2X A;  3QO7 A;  3LC0 A;  4YRR A;  2IY5 B;  2G4C A;  4YRT A;  1NYQ A;  3HXU A;  1E24 A;  3HXZ A;  2DU7 A;  5C53 B;  4YRS A;  3UH0 A;  4H2X B;  2AMC A;  4NCX A;  4H2V A;  4HVC A;  3RKX A;  4P75 C;  4E51 A;  4LVI A;  4P75 A;  1EVL A;  3TEH A;  1EQR A;  4BWA A;  1BBU A;  3PCO A;  3RUX A;  4RMF A;  1WNL A;  4LVK A;  3REU A;  4PG3 A;  3ERR A;  3HXW A;  5ELN A;  1YFR A;  4YRC A;  4Q6G A;  4WJ4 A;  4YCV A;  4KR3 A;  4YRG A;  4YCU A;  4YYE A;  1NYR A;  1YGB A;  2Q5H A;  2RHS B;  2P0L A;  3A7R A;  4AH6 A;  4YRN A;  2ZNI A;  1HC7 A;  2CIM A;  2ZCE A;  2ZNJ A;  4CS4 A;  1H4S A;  1ADY A;  3FJP A;  2DTI A;  3TUP A;  1NJ5 A;  1X55 A;  1LYL A;  2QHU A;  4LVM A;  1WQ7 A;  1C0A A;  4K88 A;  5KNN A;  4BW9 A;  2AKW B;  3G1Z A;  4TVA B;  2E41 A;  2ZZG A;  1WQW A;  3A7A A;  3CMQ A;  4YP0 A;  4P73 C;  5HGQ A;  3HXV A;  1BIB A;  3HXX A;  2Q7H A;  4XTY A;  1EIY A;  3LSQ A;  2DZC A;  3BJU A;  4TVY A;  3A32 A;  3R07 A;  2DVE A;  1PYS A;  2HNI A;  4XEO A;  1G51 A;  2QHT A;  4P73 A;  4P72 A;  2E5A A;  3HRK A;  4YPF A;  2DTO A;  4L87 A;  4XTZ A;  3P8T A;  2DDZ A;  2A8E A;  3E9I A;  3HXY A;  4RDX A;  4P72 C;  1W66 A;  1B70 A;  2CJA A;  3KFU A;  4YCW A;  4UP9 A;  2DKG A;  2ZIO A;  3RGL A;  4XTW A;  2EJ9 A;  4LVL A;  1ASZ A;  1USY A;  3RKY A;  2ARU A;  1VQZ A;  4H2T A;  3M4Q A;  1X2H A;  2DEQ A;  1KMN A;  3IKL A;  4KR2 A;  4PHC A;  2DXU A;  2ZIN A;  2DJZ A;  4DPG A;  12AS A;  4H2U A;  4YRO A;  1WU7 A;  1FYF A;  4XU0 A;  1B8A A;  3NEL A;  3P8Y A;  4TQD A;  2CJ9 A;  2PMF A;  4ZTU B;  1SES A;  1X54 A;  4YRF A;  1H4Q A;  2ALY A;  3IAL A;  2XGT A;  4CS2 A;  4P74 C;  3QTC A;  1WYD A;  2ZR2 A;  1H4V B;  1L0W A;  3VQW A;  4OP0 A;  4YRP A;  4HT4 A;  4UP7 A;  3QO8 A;  3REX A;  2ZT7 A;  2ART A;  4HWP A;  4P71 A;  3V8K A;  2ZT8 A;  3RIR A;  3RL6 A;  4WI1 A;  5C51 B;  3A74 A;  4RQF A;  2ALY B;  2ZR3 A;  2PME A;  3E9H A;  1YFT A;  1BBW A;  2ARS A;  2ZIM A;  3VQX A;  4CS3 A;  4P71 C;  3EFR A;  4YRM A;  3VQV A;  2ZTG A;  2AKW A;  3A7U A;  3ICA A;  3EFS A;  2QHS A;  2C8M A;  4P3N A;  4TVW A;  2EJF A;  4YRE A;  1KOG A;  2FYK A;  4K86 A;  2ZZE A;  1H4T A;  1NJ8 A;  2Q7G A;  2RHQ A;  2I4L A;  4EO4 A;  4XEM A;  3UGQ A;  2NS6 A;  1QE0 A;  3MEY A;  5C52 B;  4YRL A;  4WJ3 M;  1KMM A;  1RIQ A;  1QF6 A;  3MF2 A;  1B7Y B;  3BFM A;  4H2W A;  4TWA A;  3RF1 A;  1WPY A;  1EOV A;  5K1P A;  1J5W A;  3HFZ B;  3OD1 A;  4TTV A;  4DQ2 A;  3HFZ A;  1PYS B;  2ZXF A;  3NEM A;  3L4G B;  1ATI A;  4P74 A;  3HRI A;  1X2G A;  3TEG A;  2E64 A;  1SET A;  4P3P A;  2DTH A;  1G5H A;  2J3L A;  3A5Z A;  2RHS A;  3MF1 A;  1N9W A;  4P3O A;  2I4O A;  3NEN A;  2DQ3 A;  3M4P A;  1YFS A;  3MQZ A;  3QO5 A;  3W3S A;  4XU3 A;  4WF2 A;  3QNE A;  4HWT A;  3L4G A;  4KQE A;  4ZIB A;  1HXD A;  3UGT A;  1EVK A;  2EAY A;  1B76 A;  2E1H A;  3NET A;  4TQF A;  1E22 A;  4YRQ A;  5F5W A;  1Z7M A;  4CH6 A;  3V7C A;  4J15 A;  3HY0 A;  1B7Y A;  1USY C;  4YRI A;  1WLE A;  3V7R A;  4RQE A;  1Z7N A;  4UP8 A;  1BIA A;  3VQY A;  3IKM B;  3P8V A;  11AS A;  1E1O A;  4ZTZ B;  1GGM A;  4OLF A;  3RAC A;  2ZT6 A;  1X56 A;  3TEH B;  4CH4 A;  2ODR C;  3PCO B;  3A31 A;  1G5I A;  4X5O A;  4HWR A;  4LVJ A;  2EL9 A;  4XTU A;  4XU2 A;  1X01 A;  1B70 B;  3HTZ A;  2ZZF A;  2XTI A;  2I4N A;  3I7F A;  2DZ9 A;  4H02 A;  3LSS A;  3PZC A;  1SRY A;  4HWO A;  1YB3 A;  5K1X A;  4O2D A;  4CH3 A;  1NJ6 A;  3V8L A;  3A5Y A;  1NJ1 A;  2CJB A;  2EWN A;  4HA8 A;  3HFV A;  2AMC B;  2C7I A;  4Q15 A;  4H2Y A;  2P5I A;  3L2Z A;  2EJG A;  1EIY B;  2I4M A;  4UPA A;  1NJ2 A;  3IG2 A;  4HWS A;  1EFW A;  1SER A;  2ZGW A;  4TVA A;  2E65 A;  5E3I A;  3WQZ A;  4XU1 A;  2Q7E A;  2E10 A;  1IL2 A;  1HTT A;  1JJC A;  2QHV A;  3L1A A;  3DSQ A;  4CH5 A;  1E1T A;  4G85 A;  3UFG A;  2RHQ B;  1JJC B;  2DXT A;  4G84 A;  2DQ0 A;  2IY5 A;  1ASY A;  5ELO A;  3V7S A;  3V8J A;  4XTX A;  1ADJ A;  2CGH A;  1NNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...