1ATIA

Crystal structure of glycyl-trna synthetase from thermus thermophilus
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
505
structure length
437
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYL-TRNA SYNTHETASE
publication title Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
pubmed rcsb
molecule tags Protein biosynthesis
total genus 131
structure length 437
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1996-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1atiA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1atiA02
1NJ2A 3VQVA 4YREA 4P3PA 2DXTA 2ZIOA 4P3OA 4XTVA 1GGMA 1YFTA 2ZIMA 3LSQA 2XTIA 4X5OA 3RKXA 2DQ3A 5C52B 2ZZGA 4P74C 3HXYA 2ARTA 4EX5A 2E65A 2ZR2A 1HXDA 1B70B 1EFWA 2E1HA 2DVEA 4TTVA 2E41A 4G84A 3RKYA 1WQ7A 1JJCB 3IKMB 2DTOA 1E1OA 5K1XA 4YRQA 1YFSA 4OLFA 2CIMA 2I4LA 4P74A 4YRCA 5ELOA 4P3NA 3UH0A 1EOVA 1X56A 2J3LA 2P5IA 5KNNA 4DQ2A 4K88A 3OD1A 4YRPA 4Q15A 4TVAA 1WPYA 1FYFA 4H2XB 1QE0A 3UGQA 1E24A 3PCOA 2DDZA 3L4GB 2DKGA 5F5WA 1SRYA 4H2SA 4TVYA 1NYRA 2E10A 3FJPA 4UP7A 2EJ9A 3HFZA 2Q5IA 2QHTA 4AH6A 3RACA 4YRIA 3NETA 2Q7GA 3HXZA 4HWTA 2EWNA 3NELA 3HXUA 1V95A 2DZ9A 1WQWA 3A7RA 3EFRA 2AMCA 4YCUA 2CJBA 1YFRA 3I7FA 2J3MA 2ZZFA 2RHSB 4H2WA 4BWAA 1Z7MA 1EIYA 1ASYA 3V7SA 4YPFA 1EQRA 4RQEA 1BBUA 4YRKA 4P72A 1ADYA 3HXXA 2DU5A 4TQDA 3G1ZA 4EO4A 2DTIA 2DZCA 3P8TA 2Q7EA 3V7CA 3WQZA 3MEYA 4H2UA 4H02A 4Q6GA 4E51A 4CH6A 4G85A 4TVAB 4YRLA 3HY0A 5E3IA 4CS4A 4P71A 1B7YA 2EJGA 1PYSB 4XTYA 3VQYA 4YRNA 1NJ6A 4YRSA 3HXWA 1NJ5A 3A5YA 1G51A 3LSSA 2RHQB 1B8AA 3VQWA 5C51B 12ASA 4PG3A 3QNEA 3A74A 4XU1A 3W3SA 4WF2A 4KR3A 3M4QA 2ZXFA 1USYC 2FYKA 1N9WA 3VBBA 3MF2A 2ALYA 3PZCA 2E5AA 4H2YA 3TEHA 3HRKA 1QF6A 2ZINA 4RMFA 4YROA 2AKWA 2ZT8A 3UGTA 4XEMA 1VQZA 1E22A 2IY5B 1USYA 4H2TA 3RIRA 2C8MA 4YRRA 1WLEA 1EIYB 4YRFA 1H4QA 3RUXA 3RF1A 4HA8A 3E9HA 3EFSA 4OP0A 4YP0A 3LC0A 2DU7A 1H4VB 2ZNIA 3VQXA 1KMNA 3MF1A 1H4TA 3V8KA 4YRJA 2ZGWA 2XGTA 1WNLA 2G4CA 1X55A 3HTZA 3CMQA 3KFUA 4P72C 4L87A 1B7YB 1B70A 1HC7A 3QO7A 1SESA 2I4MA 1X54A 4YRGA 2ZTGA 2PMFA 4YYEA 4YDQA 4O2DA 4PHCA 3DSQA 4TWAA 2PMEA 3BFMA 3ICAA 4BW9A 4J15A 1E1TA 3A5ZA 2HNIA 1EVLA 1NYQA 4XEOA 4P71C 3HFVA 4WJ4A 2ZT7A 1Z7NA 4ZTZB 4P73A 1G5HA 1X2GA 3A31A 1G5IA 1L0WA 4UP8A 3L4GA 3V7RA 4XTZA 2DJZA 4ZTUB 2QHUA 4CH4A 4HWOA 1ASZA 2I4OA 3RGLA 4KQEA 2ARSA 3PCOB 1NJ8A 3RKWA 3QTCA 1J5WA 1YGBA 4DPGA 1C0AA 1LYLA 3M4PA 2DTHA 4ZIBA 3P8YA 4XTUA 2QHSA 4YCWA 4CH5A 1H4SA 2Q5HA 3HFZB 2ZT5A 2ODRD 3BJUA 1WYDA 2ARUA 1KOGA 3REXA 4LNSA 3IALA 1HTTA 2EAYA 3TEGA 3V8LA 11ASA 1SERA 3A32A 1X01A 3HXVA 3P8VA 2AMCB 2RHSA 3TUPA 4XTXA 2I4NA 1X2HA 4HVCA 2LW7A 3UFGA 3E9IA 4RDXA 4CS2A 1B76A 3R07A 1ADJA 4NCXA 4P75C 1WU7A 4XU3A 2ODRC 4HWPA 3QO5A 1NJ1A 3A7UA 4YRMA 2E64A 2Q7HA 4HWRA 2DEQA 4WJ3M 1PYSA 3HY1A 1W66A 3QO8A 2ZR3A 1ATIA 2DXUA 4P75A 4YCVA 2RHQA 4YRTA 2C7IA 2ZZEA 4XTWA 3RL6A 2ZCEA 3L1AA 4P73C 3L2ZA 3IKLA 2CGHA 1IL2A 2ZNJA 1YB3A 2EL9A 5K1PA 4TVWA 1BBWA 4UPAA 1JJCA 4HWSA 3ERRA 4WI1A 4KR2A 2CJ9A 4H2VA 4XU2A 3REUA 1RIQA 3A7AA 1EVKA 5HGQA 4TQFA 2E3CA 2DQ0A 1NNHA 2ALYB 2CJAA 4K86A 4H2XA 4RQFA 2IY5A 3TEHB 1BIBA 2P0LA 1KMMA 3HRIA 5C53B 2QHVA 2AKWB 1BIAA 4UP9A 3V8JA 4XU0A 4CH3A 4CS3A 2ZT6A 3IG2A 5ELNA 3NENA 4K87A 3NEMA 2EJFA 1SETA
chains in the Genus database with same CATH superfamily
1PEAA 2XJ4A 1Y6QA 3CZ9A 3UA3A 3WBBA 3UK1A 4QSMA 2R00C 3I6BA 3T9CA 1N75A 1IY0A 1RYFA 3AZQA 1VYHA 3H2ZA 5LP6A 3W8EA 1R3UA 1T5OA 2AWNA 2PMWB 3AHEA 2YWGA 1OB2A 5ALGA 5K8CA 1SG0A 3FTCA 3SF8B 4IQ8A 5AJXA 4Y7CA 4M1SA 2Z6VA 3V1MA 3VKHA 2OO3A 3ESCA 1YQDA 3W3AD 6CHYA 3S8YA 1XVVA 2PRJA 3BXOA 1TX4B 2VSYA 5LZ9A 2G9UA 4B3MB 1PL6A 3ITEA 5A2QA 4DR7B 3T0FA 3CIOA 2I4RA 4EY6A 3C3PA 2GZSA 4CCAA 5JR3A 5A02A 1FP7A 1OLOA 2AN5A 2MSWA 4QYIA 1IJKA 5DE3A 1AMNA 1BDIA 5KTOA 3FYUB 4RGQA 4NBWA 1GAWA 2ERYA 5DBGA 3CR8A 1Q57A 1YJQA 2NTNA 2PTHA 2XGMA 3C3YA 2VCEA 1GPWB 4JEMA 3JQEA 4MQUA 4YEDA 2AC7A 1QXSA 3SQDA 4EA7A 4JC8A 3L8ZA 1T4CA 2ETVA 3HDTA 1X13A 4BY9E 3NKFA 3FMOB 3NWBA 4YRZA 5AJUA 3L0ZA 3LFTA 1HEYA 2M1ZA 5AKKA 9GPBA 1O87A 3A37A 5TT0A 3IB3A 4PYOA 2C9OA 4LHXA 4UE2A 1IMOA 3TZKA 1Z0IA 3N2KA 5IAOA 1NULA 1IHXA 1AQUA 1O0BA 1UBCA 2R1VA 3DDHA 5FBHA 2CMFA 4DYDA 3ISVA 3PR3A 1D2GA 3F67A 4P3NA 1CD5A 2R8ZA 2XE4A 3CF4G 4TSFD 1HE1C 1UJCA 1ODFA 2H08A 2O3QA 4ER0A 1GFZA 2YJNA 1SKMA 3I92A 4UAJA 4Q15A 4C4AA 3GEEA 2VT7A 9LDTA 5FPTA 3KOXA 4BFUA 1OTYA 1SULA 1VIYA 1DTSA 1D9ZA 2HSDA 2IV2X 4EG0A 5JVDA 3FMPB 5JAPA 2XAAA 1REQB 4KX5A 3NIWA 3ONVA 2P4EA 3BSYA 1P9LA 3H9JA 3X1JA 3GGPA 3V80A 3TM4A 1YAJA 3FUVA 2QGZA 1KQPA 2V45A 1WCIB 5E6UA 5EE5B 1VYTA 3MMNA 3ZWAA 5C5IA 3JZDA 3WYEA 2DR0A 4LHWA 2F9LA 2W42A 3IR6A 3AM4A 1E62A 1GT6A 3K8OE 4NFHA 2PGIA 1JFFA 2CXTA 3HCAA 3LK7A 1KKLA 4OJTA 1ZIXA 4GLBA 2QL6A 4KFUA 1QFJA 3VO9A 1ILEA 1RPTA 2IYYA 1HG0A 3E22A 3LL4A 3OX3A 3QLUA 4NZNA 5FPQA 1EWRA 3RIXA 3WL3A 3U3OA 2YXNA 5KX5A 3QLJA 2GM4A 3WWZA 4AH6A 1CUIA 1YU9A 1XKXA 1AKUA 1RJ9B 1BC5A 3TZ6A 1XJ0A 2ECOA 2EF0A 4O4HF 1LRKA 5F9FA 2X0KA 2YIDA 2PLFA 4QOHA 3VU9B 2B0JA 3LPDA 2FPOA 2Z83A 4FC6A 4P22A 5C8YF 3PUZA 1F7UA 4C2BA 4TS3A 3RD5A 5HA5A 1PZFA 3CLKA 2J33A 5J5VA 1CZOA 3NKVA 4JZKA 2FPXA 4KQIA 2OG2A 3PNSA 1EFUA 2BIFA 4ZXPA 3RSOA 4BIIA 3MQZA 2BI8A 4DSZA 2B6HA 3FHLA 1SU7A 3MWJA 5BSGA 5H5JA 4JROA 3THXB 2JF0A 5AUPB 4PBTA 5A9RA 2I4IA 3E03A 3G5LA 4MO2A 4DLPA 1M83A 1VA4A 2JAUA 1XK7A 4FT4A 4QHSA 4WINA 2XDQB 2XMSA 2P9QA 1OWMA 3D4LA 5BN5B 1VPVA 3V7SA 4B4DA 1NKSA 2BEWB 3ZKWB 3CISA 5JHHB 3L0CA 3G68A 3HJUA 3VH2A 5LQDA 3L8CA 4I5IA 2VK8A 1L8OA 2OB2A 3VZCA 2G5TA 2O5VA 3PUKA 2EZ4A 3D6NB 3ANYB 3QFCA 4UTNA 1J70A 1RWWA 2X3UA 1L5YA 3WGGA 1P72A 3OH8A 3OZVA 3BE8A 5DNUA 4ILKA 1IBLB 4TSKA 3KTFA 4MQLA 3SSOA 3CMMA 3DC2A 4BNDB 4WEOA 1EA7A 1FS5A 2GEFA 3QKTA 4XD7A 4NE7A 4YXWA 5SY9A 3Q0IA 4ZZ1A 1IPHA 6Q21A 5EQFA 5JS7A 5K03A 4LF8B 2WSSA 1FMLA 4DIFA 2V7GA 2AUMA 1NW5A 3AY6A 3OECA 4HDRA 2XOEA 3OIYA 1MAVA 3AJ8A 4G0OA 3SOZA 1FL9A 1IDOA 2XWSA 3AI7A 4RSGA 5BN3B 5B58C 1RAHA 4O2AB 3AUKA 3UJPA 2DBVO 4PWYA 4DN6A 2PXAA 1HSOA 1XBTA 1FNCA 2XBUA 3FN4A 1NJ6A 1CT9A 4Q93A 2G9NA 5BPHA 3P5SA 3UMCA 2XQVA 2V7UA 4I50B 1DWOA 1QYWA 4ZCQA 2Q9BA 1CKEA 5DXFA 3JQCA 3FZGA 1VSTA 1C3OB 1O0SA 2CXNA 2Y66A 1E9DA 2IVFA 3C3XA 1TZCA 3GJXC 4QO7A 4O63O 5ALVA 2X76A 4URXR 5HS4A 2GBIA 4WF2A 2C5FA 3WB2A 4AP9A 3FFXA 3I62A 3NBKA 3ZJVA 1E94E 3KR1A 4IMIB 3RVMA 1P2TA 2WUDA 3FSGA 1FP4B 4IR7A 1G42A 2FQYA 3DOIA 1A9ZA 4DGSA 1R6XA 4H4DA 3DO6A 1FFGA 1VDMA 2P77A 4RZSA 3N6VA 2IA5A 3LY7A 4PC7A 4D82A 3GT4A 1RACA 3LDAA 2E4WA 3MD0A 4AJLA 4KREA 3QVVA 2H2WA 1PSDA 3EUWA 3ONNA 2Q4BA 4KVFA 1LDYA 1M8FA 4AICA 3KOOA 1C5KA 3EF3A 1ETUA 2QQ5A 2BFDB 4LOJA 3BAFA 1L4HA 2R0QC 3ZWVA 3BMCB 3U3ZA 5E6SB 2JI6A 5JLJA 4GP7A 3R3ZA 4CLXA 4NJMB 3JR3A 4MHTA 4INZA 1JFVA 5D3ZA 3VNSA 1QCCA 4H4EA 1JLLB 2PRIA 1KQNA 3EDOA 1L7PA 3A04A 4RMGA 1ID8A 5E3HA 1E3LA 1C2YA 3T0GA 3X3HA 4B31A 1N2GA 4DRYA 4KH0A 4C3UA 3GD5A 3M9LA 3PQ3A 4ZVRA 5IT4A 4PV7A 4OLBA 4UDNA 1DAEA 3R0VA 4IDGA 4DM4A 3L9XA 1NNLA 1HM5A 1UFKA 1ESDA 2IYVA 2O5RA 4WK4B 3BMNA 4QUEA 4X97A 3U4IA 4BVBA 3PJEA 3W90A 1A7KA 3EY9A 3VR6H 4FOOA 3UQYS 5IDVA 5B36A 5CXUA 3ZY6A 3TAHA 2WG2A 1QPBA 1ZOLA 4BQFA 1EPUA 2V7QA 5HOQA 5B7QA 4V38A 4XIJA 2VJCA 3RT7A 3FWPA 1FOEB 1FEZA 5K6RA 1QONA 2YMLA 1R88A 4K6CA 1DJMA 2JVJA 1VJ0A 1Z3IX 4MWOA 5A0TA 4DYHA 1ODJA 4IS2A 3SSNA 1V5EA 3K1JA 4NU8X 3WMFA 1AMUA 4J91A 1OZAA 1GA1A 1AKEA 2UXCB 3KTOA 2LP4Y 3BWBA 4BMYA 1NV9A 5DSXA 1JA0A 4KO3S 4AW9A 3PNVA 3RTBA 4M38A 1DRWA 2XUQA 2AOUA 3C3JA 3E9YA 3WRWA 3E9RA 1JEQA 2C2HA 2JLAA 4QWMA 1YDHA 4FONA 1MDFA 3NEJA 2P4SA 3PEUA 1XZKA 3VKVA 4EYQA 3OLCX 2Q29A 5CT8A 5EG5A 1SJ9A 2C8KA 4DEVA 5J4KA 1SQGA 2VWGA 2GEDA 5EAIA 4WY2A 4RA9A 1F8FA 3MXTA 4ZALA 1DG1G 3M83A 1W29A 2FPWA 1W36C 2XCSB 3BJMA 5DTQA 4M0FA 4U7WA 2XZPA 2CYCA 3EC7A 3OFSA 4OHWA 2ZRAA 3LVQE 1KEWA 1TTTA 2HOQA 1U2TA 3I76A 3K4QA 2B1QA 3TKYA 4KNWA 1IIBA 4RGBA 2PM8A 4M1MA 3PG5A 4AL4A 1M0EA 1GTSA 4GOKA 1CFZA 5E9AA 2E4XA 5HQTA 5EIEA 5T67A 1G5IA 4PLFA 2JVIA 3Q8MA 1PNQA 4CIYA 1NLZA 3HTXA 3UV7A 1F2VA 1H8HA 3LNTA 2FR8A 4YAJA 5IMBA 2HJSA 5F4ZA 2DHEA 3UXMA 2HZBA 4A2PA 4DXDA 2PKYX 1Z7GA 3IMCA 3UFBA 5KWIA 1BNCA 1AV7A 1GGFA 3H3XA 3EG9A 3UBTA 4Q3EA 2AE1A 4BUCA 2C54A 3TE7A 1J5WA 3E0QA 4FDAA 2CHEA 3F7MA 3PWSA 4UUOA 4PLTA 1NVVR 4GOOD 1GV0A 2BISA 2BKVA 2JFUA 3OZGA 1IQUA 2C4VA 3BM5A 4WX2B 2VDVE 3E8XA 3TB4A 5KNCH 3P8YA 2C2MA 2XKKA 4DLYA 1BGWA 1VOTA 2IQ5A 3MTBA 3HKCB 5G0SA 4BJ3A 3DL0A 4R1QA 5LIRA 1FDUA 4LNUB 1TK2A 2H1LA 1QH1A 2PLRA 4ZRNA 4C4RA 2BMDA 1MO2A 2B8EA 3OX2A 3VC3A 1NBOA 4PAQA 4TVKA 2CFCA 2Q6LA 3ZGVA 1P1IA 3OQMA 1PNTA 1THGA 5K8TA 2RHOA 4OH7A 3STUA 1Q2UA 2ZRHA 3GMDA 3HWX1 3VHQA 5AHXA 3BXPA 1NT2A 1W8DA 1W6UA 5HIKA 1J8DA 4A5SA 3OF3A 2FFQA 3TGPA 2CN1A 4U7JA 2ZDQA 4DCVA 1DZ3A 5L95A 4HGZA 4C22A 1ODKA 2BY4A 4RNCA 4XTXA 3AP2A 4CMAA 2W7TA 2GJ9A 9ATCA 5BNIA 2IEDA 2KS6A 4EGQA 1Q0TA 4NXNB 2E18A 2JPDA 5KNBD 4BNJA 1JPVA 3MIZA 3V1KA 2QJWA 1C0PA 4G65A 2HQOA 3JWIA 5FTJA 3GBVA 3WP1B 2O0KA 4QDKA 2IHVA 4EW6A 4ZYTA 2IKQA 4JC5A 2POCA 3SJUA 1ZU5A 5GQSA 3QF4B 3AJRA 3B7PA 1QIEA 1JDUA 1OILA 3IMGA 4FN4A 3RROA 4BL5A 3K31A 3N2ZB 2NU9A 1PS8A 1SBIA 4W5WA 4IQGA 5LZ5A 4G01B 1TM2A 1PFQA 3KT6A 2O7VA 1UZLA 3BTUA 3N87A 3UXHA 5DGTA 2FPRA 1TQHA 3MQFA 4TRJA 2BD0A 3R6DA 1DUSA 1Y4SA 2I6SA 3NTVA 3A06A 3Q9NA 1BFKA 2DEUA 1YR3A 1RRFA 2PSFA 3HDVA 1T9GR 2QQ0A 4ZV4A 2BI4A 3HDJA 3ZDYB 3WLFA 1FDSA 1TT7A 1QZ3A 4MULA 1QX3A 1GNQA 1ATIA 1KBOA 1XE3A 1ZXXA 4LDJA 4R41A 4UM5A 4YP1A 3MILA 2OYRA 4D42A 4CMEC 1J0AA 3MAAC 3JU3A 1KU0A 4ZCTA 3WS7A 1Z4LA 1RQNA 5IM4F 2ZJ1A 2ZB8A 4R1SA 3RBAA 1JZSA 4U2BA 1W36B 4ZMRA 4E70A 3C15C 1Y1LA 4IUCS 4P0TA 4KGZA 5KTNA 4P73C 4L9AA 4L0QA 3CY6A 3UT5B 1QORA 2AXPA 1IONA 2D4AA 3FDFA 1E9RA 1IK6A 1JL3A 2GF2A 2P1DA 3T7EA 3EEQA 3EDYA 3R7LA 5BOSA 3NDRA 1BBWA 1PW5A 1ZA2A 3GBPA 4MGYR 1YBAA 3NIGB 4G23A 4GIBA 4CIXA 1OZHA 1FTNA 2C7QA 2G9QA 1QHXA 1O7JA 4C78A 1A82A 1A97A 2OCBA 5FPKA 4RVFA 4G2TA 3SMVA 4H77A 4XU2A 4JEHA 1KAEA 4NCNA 1WCWA 1WV1A 3O1LA 1AZLA 3P9KA 1BEEA 4IQFA 4UCQA 3WMWA 2IE0A 1M6EX 3A6HA 5DPMA 2JGJA 4A6XA 7ADHA 2G06A 5GTDA 3TX6A 2C59A 1XMQB 5JJIA 3C6YA 3MS2A 5E2IA 3GJQA 3G0GA 1GCGA 2F2TA 1YZGA 1YI1A 4ZOLA 1OPXA 2YZ2A 3LUAA 5KYUA 3PXGA 1IK4A 1UWLA 2FSSA 3EFEA 4ALNA 1QAMA 2PKXA 2ZQ5A 3TW6A 3UMYA 5E1BA 2GN1A 3PQ5A 4WE3A 2N1MA 5ILQA 3W6OA 3WYBA 3ZQUA 3U19A 5FLEX 3U2QA 3ZDXB 1AUQA 5AW8A 2XNCA 2H8GA 3DDOA 2RAUA 4CFSA 3O21A 1E5QA 4K5QA 4CUKA 1EFCA 2F4NA 1UZUA 4RPHA 4CH3A 3O94A 2BGMA 3UPTA 1ZDMA 4KFCA 4ESEA 4LYAA 1OLXA 1IQRA 1Q14A 5B4TA 4AKTA 2A59A 1GL3A 2IVZA 1X87A 4GMGA 2IIPA 3LX6A 1DOZA 3D1JA 3HJGA 3AQIA 1KI4A 1P73A 4PZ9A 5IBPA 3TS1A 5TPZA 4B4UA 4BCBA 4ZCMA 1JYEA 3NTUA 1KA9H 1P18A 1ZEJA 4BO3A 1P29A 2CUTA 1HNWB 2IYRA 3VKFA 5KYGA 5LCXA 1JPNA 1OX5A 1GPNA 3JQBA 3WJ2A 4MR7B 4ES6A 4ZMSA 4P3PA 4C6TB 1KP9A 3F97A 3ME5A 2ZSDA 1JEAA 4BFYA 4WPGA 3VHXA 1Y9DA 4F4DA 4WK2B 5I9NA 1JRLA 1TO2E 3GFFA 3RFTA 4B82A 5FI0B 1RPZA 4GW3A 2RGNC 5JCJD 1CERA 3I9FA 1QRTA 4P9NA 3DDNA 4KIWA 1ZIDA 4N40A 3UTCA 5I4BA 1N7HA 1UXKA 2ZRNA 4UDYX 1ESEA 2UVPB 3GWGA 2R1TA 4YA6A 3IHWA 1ZJ6A 4QE3A 5C1IA 2FN9A 2QRLA 2REXB 3AFNA 5E2BA 8OHMA 4REOA 2VHZA 1Q1GA 4NDAA 1VTKA 2BFFA 2BMWA 1DWUA 4U8GA 5IAKA 3W2TA 5AVQA 3PKZA 5IRCD 4DJAA 2M2IA 2AZTA 2EKBA 4TWIA 1Y81A 2E1HA 5GWXA 4ETNA 1YC2A 1L5VA 1RWPA 4D80A 1MB2A 3ZVRA 3NM6B 2A4MA 2YV1A 3R0XA 3Q11A 3DAOA 1NG9A 1NIJA 3C1AA 3NQ41 1M8PA 3BT7A 4X71A 4BLVA 1XU9A 3DYVA 3F3MA 5K1XA 3VYVA 3ZBQA 1LWOA 5EWLA 1VL2A 1H3EA 2QBYA 4HVAA 2X8JB 3GEIA 1USIA 3NIFB 1F17A 1KGDA 5SZJA 2ZB4A 5K0NA 3S7ZA 4G0ZA 1S7CA 2YYAA 5JZVA 3ZDZB 3KQQA 3K6KA 1JG3A 2J5BA 4AP5A 4LKOA 1IXYA 1UC5B 1QO9A 3L77A 4F3CA 1MU0A 1SKQA 2B20A 4RCZA 3X2SA 3JTMA 4BASA 2ZB2A 5G0TA 3A28A 4D8WA 4TLCA 1SKUA 4KHZA 5JUWA 1VIVA 1NW4A 4RM3A 3UB4A 1G66A 1XLVA 2VNHA 2YMQA 2O4CA 5JRJA 1GTRA 1M3SA 1DKRA 2Z8YM 4J7XA 1XRSB 5AW7A 1I94B 1AQIA 2DRIA 4NFYA 1GL6A 5AUNB 2CV1A 4CG0A 2FVXA 4WBXC 5CFRA 4FEGA 9MHTA 1JKJB 2P2LA 4TYMA 2LBPA 5F33A 2YJ5A 1LA2A 4HTAA 3I53A 1NBMA 4LRQA 3DONA 4N9QA 1NRXA 4GOLD 4N0DA 5EZ5A 2XXAB 1FTYA 1XMOB 4B7UA 4TGLA 5AM0A 4BO6A 3ZWMA 4FXOA 4RVDA 1NLFA 2NLOA 3DCYA 4OSEA 3WICA 4KKXB 4MS1A 1QYXA 4LSWA 2E10A 2HQRA 1F4VA 3P0HA 3FJPA 1YVEI 2R97A 3F7OA 5BV8A 2CDCA 4UVDA 4Y1RA 3KUXA 5GJBA 3UAOA 3H2YA 5TDHA 4H1UA 4BVEA 1AQNA 3TL6A 4RKFA 4N5NA 1TKAA 1HDEA 2WAOA 4AN1A 1CUYA 2YCLA 1GU1A 2WIDA 3DE5X 3KB2A 4GUDA 4LDNA 3AX6A 5LKRA 3WA6A 3ABSB 2HKIA 4RU1A 4O4HB 4LZAA 3S6JA 1U7TA 2HZ7A 3QEAZ 5LL6P 4ND2A 2XQGA 2VP9A 1VSVA 1Z0JA 3FCXA 4RHYA 2HWWA 4RSRA 4WJLA 5L53A 1SCKA 4KHPB 1XRLA 4XCXA 4PLPA 5TF4A 2A4KA 3KAQA 4M21A 5C8YB 2PVCA 2J9YB 2V7PA 3QYAA 5HRCA 4C0AC 2ZW9A 4HATA 2CJBA 2OMEA 1F9EA 4HQOA 2JIMA 4LSGA 5K3BA 3IV7A 3OAAD 4ZZ2A 3KVOA 2E89A 3LHDA 4D92A 5THXA 1PL8A 5F7ZA 2V54A 1A9TA 2JAHA 4A27A 2FJPA 1VCIA 3Q72A 4TRNA 2G1PA 3PLAE 3LKDA 2X8AA 2R3SA 1GU0A 1UBFA 1XYGA 2VPIA 5I8ZA 3VTKA 1XOIA 2GR9A 4B6PA 5KSWB 5EIOA 2HX1A 1UJ6A 3U4GA 3EZFA 4TSFA 2VBCA 4WFIA 2ZPUA 2OPBA 1FPQA 4FSXA 4IL5A 3EVZA 5EXEA 4YPFA 1Y8RB 2AI1A 1H9BA 5KSPA 4Y2RA 4TMFA 1VI6A 3GT0A 4MXDA 4XDYA 1ZZEA 3GAAA 5TQVA 4CODB 3WC4A 5BR8B 1UKAA 3RABA 1IWOA 3K9QO 5L3VA 3DMHA 3LUDA 3S68A 2JH3A 3G1ZA 1GFWA 1FDOA 2A0FA 2DQYA 4FM9A 1Z39A 4ZC1A 2ZK7A 1WD5A 2JKZA 1DBIA 5AI5A 3B89A 2GZMA 1AGXA 3BOSA 4AECA 1HDZA 2R68A 4KK4A 5B6PA 1CJBA 3ST7A 1GPYA 4LTDA 2CDRA 3SVZA 2C03A 3LPLA 3PRYA 1C2TA 2QD1A 1FP2A 1G0NA 1V71A 3BEDA 3PUXA 4QUDA 3SC2A 5KKCA 1YIAA 1P5ZB 3QLVA 3BIOA 3D6VA 2QMUA 2GBFA 3QHQA 3DGEC 3F6PA 3JD4A 1XTSA 3QVMA 4R8KA 3SKYA 3VNRA 4B48A 2V59A 3PEVA 2GTIA 2WU8A 3OQ6A 3R76A 4B17A 1JH8A 1PYSB 2I1LA 4JT9A 1G5RA 3MW8A 3BZBA 5DYIA 3TLCA 4DUPA 4F8EA 1SVSA 1FFEA 5LVAA 4N5LA 3S2EA 1KI8A 3M1LA 2G71A 5K0JA 1O95D 2X8BA 4YLGA 3RS7A 1TZBA 4EUEA 1T4DA 3LSSA 2VDJA 3CLSC 1PG2A 4D79A 3NT5A 3ER8A 2KW5A 3FFTA 2AZXA 1HLGA 4K9MA 4D7AA 5JY1A 3PA8A 3A74A 4G4GA 4M76B 3BEOA 5G4LA 1NQOA 2PZAA 2H5JA 3G7NA 3L43A 3K5PA 1U0SY 2QRHA 1LC0A 1V7PC 3D5EA 3JSXA 4UHKA 4QNMA 1Z7BA 3AWDA 2IW1A 4M1OA 1NMYA 2FFAA 2MOKA 2FYKA 3V5NA 4KV7A 4YCLA 3GPBA 1GQ2A 5IF3A 1X7HA 4DJDC 2R85A 2A0XA 5E6RA 2PU5A 3ANLA 1OU0A 2ZAMA 5ICGA 4LF9B 1XRRA 3MF2A 2YW2A 4KPYA 1YFZA 1V3TA 4P7FA 5BYBA 3TQTA 2WTBA 1PTKA 2ZS8A 3QF7A 2QJRA 1UAGA 4R8LA 4B46A 4BQNA 2YVUA 4C87A 4BB0A 2ZJOA 1Z47A 2FZ4A 3V3TA 1R37A 2UAGA 3NR2A 2FG5A 1VMKA 4IJQA 4YJHA 3WNZA 4RD1A 1IZ7A 1C1YA 4QPJC 4KQKA 3KOUA 4GGPA 2ST1A 1WB6A 1XQVA 3ENZA 3WGNA 5C7IO 1MJHA 1E77A 1SKYB 1WWKA 2GNAA 3BL8A 2W98A 4PGAA 4PZZA 4PZ0A 5HBGA 4BNIA 5DNDA 1DXOA 3O4IA 3WDSA 2IY5B 2CEKA 3ZE7A 2X19A 3VQTA 1LK5A 1M0WA 3ZW9A 2C61A 3H0CA 1M7BA 4DDMA 3OQIB 5JU6A 3AI2A 3RUXA 1G21E 2VF8A 1NGSA 4QXMA 1IWBB 2H1RA 1JSCA 1VXRA 1AS2A 5JYCA 2JI7A 1SC3A 5AKLA 3QSGA 1KSHA 1JHVA 2Q3HA 1FC0A 3R6TA 3SDZA 2MIIA 1QPZA 4RD6A 2UYYA 3L07A 1DJOA 1KMNA 1KL7A 3UFXA 3LDGA 4I2VA 4JC4A 3SF8A 3V46A 3S2ZA 2CFRA 4S1VA 4HQRA 2HXGA 1AQJA 1Q2XA 1ZY2A 1FU4A 5FB3A 1DS6A 4OH1A 4P54A 5CCEA 3ZV5A 2XGOA 4I9HA 3ZE1B 4FYJA 3GP8A 2PUGA 4RTQA 4DILA 1U2EA 3KYCA 1BJTA 2EARA 4DUGA 2G4CA 1FSSA 1W7AA 1QUEA 3SEQA 1FJXA 2WM8A 4ZRMA 4XTRA 1W2GA 4MROA 4ERXA 1L2TA 2OBYA 1MV5A 5DDIP 1P17A 3NBAA 2XRFA 3FYUA 4KXFB 5EKXA 1KZ7B 1JQEA 5AH0A 2VQDA 5BW6B 2W4IA 2P3QA 3IOYA 1ZXBA 3QNMA 4FYHA 3L6UA 4MWSA 5K0ZA 3MT9A 1N1DA 2FOXA 3HKEA 4J90A 4MVXA 4TWJA 5EE9A 3QOYA 2IZ5A 2HWUA 4NBUA 3OBBA 5FUVA 3GB9A 1Q0LA 3WQHA 5BMVF 1CIVA 4F3TA 4PLGA 4Y6OA 2W71A 1EQAA 1KI7A 1R0YA 2BDUA 2Q3MA 3AEQB 1C1DA 3P4YA 1KYVA 4FBLA 2REBA 1FF9A 4WKNA 5JH7F 1CP2A 3DEIA 4II2A 1O94D 3AW9A 1N5IA 1ZD1A 4GT1A 4PC2A 3AHDA 5E8JA 3TGWA 3FOFC 4R2JA 3A5ZA 1T9BA 3HYSA 1M1NB 4K9DA 1HYEA 1ZCFA 2YY7A 3T5GA 3UBMA 2WAYA 1WNFA 4XB2A 3IIJA 2FPLA 1JAHA 1E2FA 1KORA 2ZU6A 3OZCA 3QEMA 1KYXA 4P2GA 1T1RA 4N12A 1ZOOA 2WJWA 2XF8A 3BXEA 1DO0A 1AF4A 1SVKA 1G5HA 3R24A 4FCVA 2GD1O 4M9CA 1A5AB 1O77A 1GL9B 4RACA 1B8UA 3BILA 1YRWA 2H7YA 2IP1A 2GPSA 4L3WA 1FVXA 4KR9A 1YQXA 4OBBA 2VA8A 3FNEA 1UP4A 3KLOA 4JSYA 3RAJA 3TIVA 1F0KA 4B6OA 4DDTA 2OENG 2I3BA 4FYPA 4GMKA 5CH3A 4RQTA 4O1HA 4ZU3A 1E2KA 1EJ6A 1T9GS 3W5CA 3GJ5A 2ETXA 3PCOB 2ZRCA 3WISA 4BO7A 3EIWA 2J41A 4ZDIA 3C0KA 5EMLA 2HL6A 4YI5A 1ZN8A 4P82A 2JGDA 3IOEA 4QQNA 4R8SA 2PRKA 2DULA 4PX3A 5CT6A 3X1KA 3FR7A 1ZBQA 4U6NA 4B5LA 4Z4CA 1W94A 3EFBA 3SFTA 3PUVA 1SMKA 2QQGA 4INPA 3R3UA 3VR6D 4E4TA 8ABPA 2ON6A 3K8YA 3H4TA 3L0OA 5LMZA 1PI3A 1GPUA 3HKBB 4WFKA 5DF1A 4U2EA 5IHPA 4KXNA 3RBZA 1HTBA 1QC5A 3U7JA 6AT1A 3NBXX 4HAIA 4EITA 3WK9A 1EDBA 1MVOA 3E7DA 3EMDA 3FWZA 3UHFA 4UPVA 2NV0A 1A76A 3AFHA 3LZDA 4N1AA 2ARUA 2EBWA 1J56A 2Q1XA 3DG9A 3DZBA 5B53A 3REXA 1QKIA 2CBZA 1AB6A 1DOHA 1JIUA 5GZ1A 2PKQP 2XVAA 5BR1A 3NLLA 4XOUA 2IZ0A 3D54D 5EJMA 3QPUA 4YPOA 3K6SA 2EAYA 4Q1CA 4JS0A 1JFSA 3K73O 2GEBA 1DTWA 7GPBA 1WTCA 5CVVA 4IIGA 1EK2A 2PWPA 2DBZA 3CC8A 1J0DA 4OQYA 1WY5A 4PG6A 4RJIA 2HWXA 3K0BA 3QOWA 3VNAA 1JBKA 4GGOA 4DC0A 2M32A 3JRNA 4YVFA 2WJIA 4ZYWA 4M1TA 4RAQA 4C7VA 2RHHA 4FFRA 4WLNA 1RMYA 3ZKWA 4CS2A 3MMXA 5LQMA 3CRQA 1B4DA 1OH5A 1FU8A 4ZC8A 2C78A 2FEPA 5CA0F 2EXXA 3OU7A 3DSRA 3DOJA 1J0EA 3R07A 1QF9A 5DX1A 1N7GA 3GZTB 4MS3A 4XU3A 1J97A 2G28A 3KJNA 4OVKA 1KE1A 4GKJB 1W4RA 2OECA 1EINA 1JNXX 3OQVA 3MXOA 4NBRA 4AMYA 4MV5A 4K3VA 1ZD4A 4FX2A 4BNDA 5KVCA 3J7AC 1T43A 2GHIA 2B34A 1GAXA 1JKXA 1VB3A 5IKOA 2C5SA 1M9NA 4NPAA 521PA 5TF0A 1E3WB 5JDIA 1C81A 1W46A 4OHBA 4R05A 3SJ7A 1QIFA 4R0VA 4Z3KA 2MSNA 3NAMA 2X5JO 4ARBA 1L4GA 4OQNA 1KVTA 2J9XB 2QZ4A 4A2CA 4B7CA 5DVZA 4DIUA 4MJXA 3IT3A 2G80A 3IVGA 1RYEA 1L6IA 1A69A 1ZI9A 2PRSA 3ND7A 3OEHA 4O2AA 1L8AA 1HQDA 2X40A 2B25A 2RARA 2BBSA 2BF4A 4GUAA 4NYMQ 2B8TA 4EDFA 3WIEA 4YUAA 4CLEA 1Q7TA 2X5XA 1GNPA 3ET5A 1N2ZA 1QYVA 3G1UA 3QU5A 4HF7A 4UU8A 4ALJA 4MITA 1GT91 1TCVA 2D2EA 2Q49A 3D02A 1P8JA 2R6AA 4NECA 2BMVA 2EZTA 2B8NA 3GH1A 2I66A 4C30A 3ER9A 2E87A 3H4VA 5KNCD 3C3BA 3HEMA 1OIWA 4R1OA 4AWBA 4UJ5A 5CVJA 3ONEA 4XWKA 4GYJA 1FP4A 3ANTA 2QDKA 4IXDA 4TVWA 4GI2A 2HGZA 3R40A 2R2AA 4TMZA 3ERRA 1H8ED 3Q6MA 2G8LA 2ZBVA 3W6PA 4YY3B 3FGZA 2O8DB 5FEMA 4F06A 3F96A 1YJXA 3KQVA 4UZFA 4UTVA 1PQUA 1FX1A 4HH3C 4ZVOA 4CL8A 4AB1A 4P0QB 4BV3A 4KO8A 2BFDA 5KNBA 3PRKE 2FWIA 4OD0A 3DMTA 4X7RA 5A9SA 2PQMA 3U4DA 4BP9A 2DQ0A 4Y1GA 4NJMA 4EKYA 1XRQA 1XC7A 5P8WA 3QXHA 5MF6A 1COZA 1V9CA 4ND4A 1SK8A 2Y4OA 1MB3A 2PEYA 1JLLA 2BTQB 3L8HA 4RPKA 3HNRA 3G5AA 1DB3A 2C7VA 2H06A 3FPEA 1EWTA 2X2OA 1ZC3A 2PA0A 1JE1A 4BBAA 1K8XB 4CW7A 4D9HA 2P9HA 3D3WA 3BDIA 5K45A 3WLQA 3Q5GA 1L4MA 3ZG6A 1MP0A 3WYAA 2C4UA 3CE9A 1A2BA 3CLSD 2LPMA 4AULA 1Y8QB 3HNPA 4OMCA 1VHWA 5EMKA 1H6CA 1SA0B 1MW8X 1Z2DA 3OZIA 4HO1X 3H5IA 3OCXA 4L5BA 4MMZB 4NICA 3WV5A 1MXHA 4MVJM 3RU2A 1YUBA 3L84A 1FRNA 4JUAA 4R2LA 2ZUEA 5LZ4A 3O92A 2HCFA 3MK31 3VJRA 1JG7A 3Q0TA 2I2AA 3S1LA 2ASEA 3UJDA 5SY4A 5E7JA 4NZPA 1SBQA 4PQGA 4G41A 1GGMA 1YFTA 3AF4A 3GJTA 5CYFA 3U26A 2AFVA 4DCUA 1HRKA 3ZVLA 1KO5A 3UM9A 2P0EA 2AJ8A 5CAEB 3X1MA 3WG9A 2CXRA 3C97A 4OQLA 5CA1A 5AUOB 4GSKA 3TQIA 3Q10A 1OI4A 5IJ9B 4PR3A 3D0QA 3Q2IA 5D7NA 1BEZA 2QVBA 4ZEOA 4B3GA 2ZUUA 4M8IA 5KAPA 2HTEA 2WWGA 2PGNA 1E3TA 4C21A 3BC1A 2QVLA 4I4LA 3NUZA 3RQSA 5LKAA 3PXAA 3D4OA 4BNWA 2DWOA 3M6LA 1F3LA 4GLJA 3OPNA 2YZNA 3EEFA 3B2EA 3VH4A 2GETA 4DCGA 5B3LA 1R5OA 1Y89A 5ICCA 1R5JA 2GNOA 4REQB 5JJBA 1ECCA 2I8LA 2GPBA 5KU7A 5JSZA 5KSZA 4KE9A 3ZGXA 4Q4JB 1OWOA 3RKYA 3O75A 3G0OA 3IQZA 4TLEA 5TPWB 5D3MB 1B3BA 3U3JA 2YIMA 4P93A 4BP1A 2OBXA 5J2UB 1WS6A 5IAJA 1LC3A 3LBYA 4EY5A 4AF8A 2H1WA 3QUQA 3FDZA 3QK7A 4ND6A 3C5CA 3EQ2A 1W1UA 4MQMA 3TIXB 1TPYA 2WMOB 1R66A 1EIWA 2FU5C 1E2JA 3SFVA 1ZKDA 5ELOA 1AKTA 3LQ2A 1GUBA 4DMMA 5JBQA 1TL7C 2I2XB 5FI1B 1O54A 3MD9A 3IMFA 1PD1A 4C1BA 1KJQA 3UJBA 1W1IA 3ZUPA 1VLLA 2ZSJA 1E2QA 2O7NA 1DO8A 2QX4A 2WYOA 2YZGA 4ENTA 4E5KA 4ECAA 3NBMA 4M8NE 5JEDA 5CEEA 3JV7A 1Q44A 3RRFA 3H0EA 4DJFC 4IJWA 2O2YA 4ZT4A 3LW8A 3WYFA 3PC4A 4XI9A 4PICA 4E12A 1PJTA 1NAIA 4OHCA 2FMIA 4WGFA 1NR1A 3E2IA 3TE6A 1W76A 4BEWA 4GNKA 5FOSA 2OM6A 1XSEA 4NFSA 3QUAA 1GKYA 2NZ8A 4HAZA 4MWEA 4PLVA 1SRYA 3F9RA 5H80A 2YMPA 3FHJA 2C1XA 5AI8A 1QZXA 2B99A 1X9IA 3OC0A 4MGIR 4X1OA 4B0OA 3CSUA 3HKCA 1R6BX 3PGLA 3OKCA 2IYTA 2ANCA 2XQJA 4QQ8A 3RUEA 3F0TA 1WZIA 2XWBF 4CETA 4MW1A 3GFGA 4ZT3A 5K6AC 1TVKA 4D9KA 2ZBFA 2GN4A 1FTWA 2ISQA 2XDAA 5KTRA 1KMIY 2ZSIA 1A4XA 1Z4JA 4OK6A 4WTOA 4G0XA 5EIXA 3U31A 4DIMA 3V8NA 2H1FA 3I9LA 1RM4A 5AXAA 5U4XA 3D2AA 3V33A 3MGGA 3V34A 4C29A 1Z0FA 1ZOIA 2Y76A 2PXCA 4YCSA 3EFRA 1XMVA 2CK3A 1UEJA 4B34A 1DQPA 4P34A 3AFOA 2I2WA 4AY5A 1MC8A 3S7TA 1IN5A 1WCYA 3DE3X 1E2LA 4Z99A 1SCIA 4J7UA 2ILTA 5HRAA 3G8YA 2YJ3A 1AXEA 2CFSA 3TSWA 4LF4B 3MJSA 2SECE 2R6R1 1RT9A 1QG2A 1U2QA 2GN2A 3F5QA 2CLLB 3FCOA 1WABA 3GJ7A 4RMNA 2A2ZA 3HU5A 4DWJA 8ADHA 1UXHA 5GAJA 2H17A 1QR6A 4H2WA 4HDCA 2P68A 4FGJA 3SVTA 2D00A 4LWPA 1N5MA 5I4IA 3AH8A 1YB5A 3TLYA 3W77A 1YZTA 5JTUA 2DUMA 2RGXA 2BV3A 3G2OA 3T1NA 4W5JA 5UKDA 3P20A 2E5FA 4KSBA 4WOBA 4LYGA 3GVXA 4QO8A 1X1RA 2A58A 1PUXA 3QUTA 4PSKA 4UASA 2O8EB 1MH1A 1GAJA 4XFJA 4YAGA 3MMZA 3GFBA 1XCLA 4F4JA 1G3IA 4IW3B 4QOIA 4JITA 5LMCA 4KR0A 4H1WA 1QGOA 4YX9A 1UQTA 1DINA 3FPGA 2Q0HA 1NHWA 2BM1A 1LBQA 4WCFC 1VP9A 3OLWA 4L07A 4LZZA 4NMLA 4H2UA 3ECSA 3UJNA 3HCNA 3UH1A 2VUIB 2QTCA 4RFLA 3UOAB 3VPGA 3UUGA 4F93B 4R01A 1UJBA 1I3LA 4HKTA 2RHJA 3PYXA 4OU5A 3HY0A 2AI2A 3NUGA 4CS4A 3L0PA 3QWFA 1JLHA 1M2KA 5HM6A 2H0RA 2WFZA 2WWTA 4ZV9A 5IF9A 1MTZA 1E92A 5L45A 5LQJA 1RI5A 1Y5IA 4CKCB 3EA5A 3ORFA 3G8BA 3PC8C 3PXXA 4UMFA 1USVA 4YRNA 1W0JD 1UFOA 1H2FA 1ESCA 2Q62A 2YNMC 2IHYA 3BTVA 4MAMA 4RKEA 3UT5A 1NJ5A 3WLKX 1U3WA 3VGJA 2VO1A 3N58A 3MWGA 3F6EX 3AVUA 2ECKA 2R6HA 2XIJA 3LUFA 5AM5A 2Z1NA 3OM0A 4QD3A 1YFLA 5CFQA 4MMYB 3OAAA 2P4UA 2ID7A 3FG9A 3TTVA 1OTHA 5EWMB 4NJEB 2ZXFA 2CL5A 2BCEA 3CEHA 3CS3A 1PSWA 3NBFA 4MCJA 4BLOA 1QHYA 1TNDA 4HSEA 4IWYA 3IJ5A 1KI1A 4PO1A 5JS6A 3DE2X 3OFJA 2C4WA 1KMHA 5BUCA 5KIAA 1FDTA 3IELA 3NEYA 1QDUA 1SQSA 1TO1E 2YHUA 1SN7A 1XD9A 4FQ5A 2BGRA 4P83A 4DNOA 2PZKA 3HM2A 1FPMA 1S3IA 3F4BA 4GR9A 1BU8A 4RZQA 1QHHB 2F00A 5ENDA 4IHJB 2AFRA 3UO8B 3INNA 5LU9A 2HMUA 1TT5A 1RD4A 3IA7A 4BPBA 5E38A 5KVVA 1T8WA 1G8HA 4PY2A 5KQMA 2IUEA 2NGRA 2W0MA 2PEZA 4JN6B 4RJKA 4F9EA 1WXFA 2J1LA 2R6GA 2BGWA 4FKZA 1JJAA 4Y2QA 4ROSA 1TZKA 4NAVA 3QI2A 4MPTA 1S96A 1LDNA 1LPOA 1NXQA 3A26A 3K35A 3A9SA 1Z6GA 4BTEA 2AB0A 3B9PA 3AHCA 4RE5A 3GJ4A 4XB1A 3ZGOA 5K01A 5LDHA 3BYZA 1JHQA 2BOVA 4PRYA 5AM3A 3CUVA 4UQLA 3JQ8B 3VNQA 3WNBA 4OGGA 3O2JA 2DU7A 3BFXA 2QX7A 2FJUA 2CLIB 3LHSA 5GZ3A 3E48A 4MGHA 1MBZA 2Q6VA 4MR7A 1H4VB 1HOXA 2J7KA 4JASB 2YHIB 4C6TA 2QIOA 4WNAA 2XUAA 3SZLA 4IGIA 1LWNA 3EQZA 4ZOCA 5K0FA 4A4DA 1R4NA 2BKEA 2J7PA 4HVTA 4KFRA 1OY1A 4COKA 1O95A 4R2KA 4R6XA 2MR5A 4NCKA 1RI1A 1TCAA 4YRJA 1CR2A 1DIOB 1URPA 5HZHA 1Z62A 4K9QA 1RWMA 5HFJA 4B76A 3LYLA 2OP1A 4G1UC 4IDDA 2PKCA 4QL3A 4DCPA 1RHMA 2W5UA 2J85A 3H2JA 1V8BA 2R8OA 1ADCA 2VJAA 2WINI 3DS8A 4N49A 5D01A 2DUNA 1Z63A 4X8OA 3NWJA 4E5VA 4QTYA 3GVCA 4JNKA 1OT5A 4H7IA 1YT5A 4YDRA 4IINA 1RXYA 3QJGA 3PQ6A 4AG3A 3NRJA 4B6EA 3DVRX 1CF2O 4YRGA 2Q6TA 2Z57A 3D8UA 3N3AC 1XZBA 4IDPA 3VM6A 4EG8A 4EVRA 4ARVA 2LXNA 2ZPTX 4EBBA 3STYA 3PF9A 4Y2UA 3H65A 4PSUA 5BMVB 2GF0A 1GGJA 2BEVA 2FHSA 4WCFB 1IHUA 3RFVA 3U9TA 2ZRKA 3DFKA 2UZ3A 4ITUA 2X8JA 1H2YA 4JU9A 2Y92A 4WFJA 4YP5A 1EVLA 1I24A 4GE0A 1BG6A 1Y1TA 4PO3X 3V4OA 4CMEA 5ESXA 4RTJA 1LK0A 4BXOA 1KO8A 1KEEA 4P7KA 2WRZA 1OV4A 5BV1A 3I04A 3KB6A 1CRPA 4GI1A 2X8LA 4JJIA 3EVTA 3P52A 3BE6A 2YWJA 3ZGLA 2BFCA 4ZQEA 3B12A 4HEQA 2G36A 3PQDA 4PYMA 4EMTA 4P73A 4CKWB 3K1AB 4MRMB 2P9JA 3KD3A 4HDKB 2H4ZA 5EERA 3F71A 3WKAA 3ZBPA 4CIBA 3H1FA 1NRJB 3Q7QA 5LNK6 2FW8A 5FOVA 1JKJA 1YE8A 2VXBA 5CIQA 5JRDS 3R9XB 3B5EA 2AC4A 1T5SA 5CFLA 2XXAA 4GPIB 1Q0RA 4JL6A 4NOMA 5ITZB 3GJ3A 1P6QA 3QKRB 1ORTA 4PCUA 5JFGA 2ABWA 1PR2A 2EJUA 4IHQA 4A6EA 5CDGA 3SD7A 4D3DA 2P6RA 4AKGA 1O6GA 1HT1E 4MI1A 2OO5C 3COPA 3TMYA 1CNMA 4GOND 2RJNA 3ZCSA 5KNDH 1Z16A 2XKBA 4YALA 2WHRA 1AK9A 3KVNA 4GI7A 4KE7A 1ZHHA 3IKJA 4G1EB 4GMDA 2FSHA 2HC9A 5FO1A 4HDMB 3ZCVA 3B52X 1EJ0A 4FFBB 3O26A 2R4TA 3ZNPA 1YOVB 1HF3A 3ESZA 2NZUG 3GUCA 5JNWA 1QV6A 1Z68A 3UGKA 4O4HA 5JC1A 1USKA 2PNFA 1VDZA 2RGCA 1H2XA 5DNYB 1EFKA 1B14A 1XN4A 3GMTA 3H2BA 3IV9A 5C8YA 1RCTE 1Y5MA 4R2XA 2OWDA 1ST2A 1VLVA 4RC9A 2CHVA 5FNZA 3DEYX 3SFZA 5FQNA 3L6DA 1TRKA 4Z49A 1U11A 3V32A 4U5QA 4MX8A 1N5DA 4PSDA 1EE9A 3GGJA 4LRXA 4TQAA 4ZEXA 1QK5A 1RQPA 1P7WA 1X7XB 1XVUA 3JVIA 4V3CA 2HXYA 4LK3A 5L7YA 2O8EA 1FFHA 2QORA 1V3VA 2VYVD 2QL9A 2ACVA 5IDYA 2DR3A 1JXAA 5CX4A 2GQ0A 1OYYA 1U8XX 1D1SA 4OM7A 5A3RA 4ANFA 1NOKA 2ZVPX 4F3YA 4F5EA 5FWYA 2ONJA 4FMCB 3A4MA 4ZPXA 2JCXA 4TXJA 3IQGX 2F17A 4J43A 4H4CA 3WLNA 2HBQA 2HA4A 4OFXA 3EN0A 1ZK3A 2RGNA 1PKEA 1KFKB 1P0MA 3GYGA 5CA0B 1JLKA 1NATA 2IEBA 3LVRE 4YFVA 4D43A 3MEQA 4QEDA 3KZOA 2EBHX 2GPWA 4ITRC 1YHYA 2Q0XA 5IVHA 1FMCA 4GU5A 5LM3A 5BN4B 1NFRA 1LFAA 3EEIA 4AJ9A 2QT1A 1IZYA 1H69A 1E5XA 3A6EA 3BRQA 4XSGA 4CG3A 1IH8A 2UXBB 2R62A 1XTQA 4PZCA 3I64A 1L7RA 1N6LA 1VCMA 2V1UA 5TMDA 5LZ7A 4EHLA 4ESOA 3V8RA 3TGLA 4JVOA 1MKYA 4XAQA 1DKNA 3IA2A 5IVDA 2OV6A 2QYSA 2WOJA 3V1NA 1I3NA 4EW3A 4WZ6A 3QU9A 2TMKA 4L28A 3OF2A 2XT0A 3OVMA 1PYSA 1QQ7A 2YFHA 2BKXA 4JYCA 2WZCA 5J59A 4B2YA 2HLPA 3PX2A 1C8LA 1XQWA 1JIIA 3ILXA 4N0QA 4EENA 3CIFA 3GI1A 3U0BA 3NZEA 2C3OA 4YH1A 2G1JA 4PGHA 1ULAA 2W93A 1NNSA 3NGLA 2YJ4A 1IUNA 3NH9A 1U1FA 2FF5A 3SC4A 4DTIA 4LAFA 3HLKA 1NF3A 3SJCA 1CV2A 4OLAA 4FX5A 4KSCA 5THQA 1ML4A 1P5HA 1PU2A 3A6ZA 4YWHA 2RH8A 3LT1A 5FNVA 4NG5A 3AEXA 1ZOPA 1OBHA 4ZVVA 2OA0A 1DZIA 1FU7A 4DG8A 2CUKA 4JB3A 4Z1OA 1CYDA 5EHIA 3NM4A 1VKJA 3ZV3A 5CDTA 2WLSA 3JARA 1LSSA 1VRCA 4P4GA 5GGXA 3RUCA 1T8UA 3F5SA 3EW9A 1P7YA 4E94A 1JJCA 4JLKA 4D41A 4W6QA 3N1UA 4BATA 1BN7A 3HCOA 2WPDA 4MUHA 4IF6A 5DSZA 2VUUA 1PGNA 2C00A 3C3DA 1FXSA 2JLBA 1B7GO 3DC7A 3HBMA 4GICA 4CEIB 2C42A 5JZMA 3REUA 4CM7A 2Y1DA 4LHZA 3ZZMA 1EVKA 4XM0A 2E6KA 4J0GA 1J8QA 1X1SA 3AR8A 1RCFA 2EKDA 2CE7A 2A84A 3OU6A 4FPXA 2APJA 5AQ1A 5C4GB 3ICQB 1BXRB 1TAHA 2AA3A 1B6GA 4QXPA 2IY5A 1QO0A 4LGMA 2JZOA 1T36A 1MAAA 4IDEA 4RYDA 3ZHUA 4M9RA 2CT8A 1CUJA 3QE2A 4G0YA 5ALMA 5KREA 4ERNA 3GFRA 2EFEB 3UJ3X 3OQIA 5EINA 4BQIA 3WV4A 1L3CA 3NVMB 4KE6A 4GS5A 4WNCA 3NRCA 4WLFA 2O50A 4QAJA 1DX4A 2JIZD 3M5CA 1N6OA 1FS4A 2V4UA 1P0FA 1VGQA 2ZT6A 2FTKE 1DAKA 3EXG2 1KKUA 1XVLA 4NBNA 1RZRA 5HJ7A 3CPJB 1Q11A 4AQ7A 1BSVA 1JLSA 2LKCA 4DIOA 3HCRA 3DWGA 3UUFA 4CM4B 3Q7TA 4L2IA 1KAMA 2QUBA 2O2SA 3H9CA 2HJHA 1E5TA 4QASA 4Q82A 4I08A 3RYHA 2C3MA 1OQAA 2OHHA 3HDYA 3SHQA 1SO8A 4BVJA 4E5PA 3P9ZA 4KN9S 5LFAA 1KDRA 4N0MA 2BCGY 1NVGA 2D8MA 3JWPA 4KIUA 3C3MA 4TKLA 4Q9NA 1L7DA 2R8XA 4ZCPA 4CBVA 4ZYZA 1DQZA 1U7ZA 3ESRA 2ZJ5A 1VBKA 2CB9A 3THSA 4DLRA 4HH4A 4XWOA 2I5PO 2KQUA 1J00A 1R4MB 2O07A 1UJNA 4QX6A 4QEKA 5FTNA 3D31A 3KEMA 4F21A 3SSAA 4CF7A 1EFVB 1KYZA 1MVNA 1PIWA 2A94A 3AXTA 1SXJC 4X66B 2Z6QA 1YCFA 3ICPA 3JY6A 4XDGA 4ENWA 1VJCA 4J7CA 4LFAB 1H8EA 3CB4A 5LD2C 1M2JA 2QJOA 4RTSA 2WF8A 5DHPA 2VNKA 1T5DX 1KAGA 4QXRA 2FJ0A 3I2JA 1W75A 2XD9A 1E4OA 2P2CA 3AEQA 5EMJA 3OPMA 4BNUA 2EHDA 5CW1A 2R25B 3T7JA 1LPSA 4OI4A 4BJHB 4MA4A 2V55B 4ZVPA 1LQTA 2ATIA 4BNMA 2PUFA 2QR3A 1EFHA 1S02A 3EARA 1BROA 1HFKA 1NBWB 3L3BA 1KO7A 1D04A 2BKUA 2OZKA 2YRFA 4MV4A 4K9PA 3GFSA 4UXHA 3VH1A 2E41A 1ZQ9A 3F8SA 1X74A 1ZN2A 4R4JA 4BKMA 5AI6A 2PMCA 2ZROA 2A7QA 4FQ8A 4TMVA 1ZICA 5D5PA 1C14A 2O3UA 2FFJA 1TLLA 1ZM4A 2XGSA 2YW9A 3AUSA 1AKMA 3Q8WA 4DBLC 1YFSA 5EP3A 1CEYA 1SUCA 4QYTA 1NZJA 1QRUA 5G1OA 4C7OB 2RHLA 1KR2A 5G3YA 2E82A 2J5QA 1GPBA 4JUBA 1E4EA 4O0LA 4YONB 3ZE9A 2XI4A 3LY5A 1IB6A 2DU8A 1R6DA 3CX7A 1NXOA 1LVUA 1X56A 1VHQA 4ZYVA 2VTKA 3EMKA 4WESB 3RVBA 1ULTA 1ZJ5A 2ZJ2A 3L92A 4JQOA 2OMKA 2Y1OA 3GCWA 3QBEA 1J9GA 3U4MA 1A4IA 4FYXA 2JGMA 1FYFA 2AR0A 4NV0A 4AS1A 2PZBA 3H2HA 4OLJA 4FOSA 5CMLA 2AXNA 3PCOA 2Q3DA 5D6NA 4OTZA 1R27A 1Z07A 3IE0A 1NVBA 4IIEA 5K3FA 3OC6A 1N25A 1CR6A 1SCDA 4MYRA 4D3XA 1NUTA 5ICFA 2P40A 1HEIA 2R5WA 3EVGA 2UKDA 5F5WA 2VNJA 2HQSA 3G8AA 1SBYA 3AK4A 3GARA 4BWYA 4Q4HB 3ODPA 4J2TA 5DLDA 1U7XA 1AUOA 1KY3A 1P39A 2Y68A 1HKHA 1R50A 2MYNA 1JDVA 1TU4A 3H99A 4FR0A 3SMQA 2ZIUB 1L5HB 2VYND 1DEXA 1BKSB 2GA8A 1ZLYA 1NN1A 2L69A 4JZYA 3UNXA 4AK9A 1T6ZA 1TMKA 4LJ6A 2YN4A 2IE8A 1DWQA 2QTVB 4X64B 4FMPA 1HSZA 3KSBC 1U8FO 3UKOA 1X80A 4LY3A 3OPQA 1F6DA 5BSVA 3ESXA 4UATA 4L8YA 2ZUCA 3C43A 3E2MA 3OIGA 5EWJB 2D5IA 3Q41A 2FEAA 4POAA 1PNVA 4TROA 4RJ2A 4A0RA 4AJJA 4GDFA 1G5TA 2PU7A 4MP8A 4OSPA 1JEYB 1HWYA 4YCUA 1JSXA 3HA5A 1F38A 1HEUA 3LIPA 3M89A 5BSHA 1KO1A 3NPAA 2ZUFA 3NT4A 1COWD 1FVOA 2EHJA 2ZR0A 3HB0A 4N03A 4WZBE 4IXTA 5JRZA 3TQOA 2IXBA 1QDEA 1T1JA 2DLNA 3G9UA 1YJCA 1O8CA 4MYDA 5BOVA 3A1FA 4B33A 3WK6A 4KO2S 1SUWA 3CKMA 1Z2EA 2RHSB 4IMPA 3LQKA 1CYEA 3SX0A 1TAQA 1CZLA 2YV2A 1YD7A 3DXXA 3QPVA 1UANA 1XDZA 3IT0A 4FYKA 3GEDA 1ZVVA 1VJRA 4Y9TA 3HXQA 1UBMS 3EF0A 4FS8A 1QTIA 3JAWB 4A73A 2LZ0A 2PUCA 3QE0A 1PD0A 3KV3O 1OOEA 3FW1A 4X45A 3BH6A 5IK2A 1I7QB 3VH3A 1WB9A 1P2VA 1JIKA 4G4IA 2ZBEA 1SXJB 1C0EA 1FUEA 2PMKA 1FX0A 5LD2B 4NULA 3VSDA 2GLUA 4KFTA 4XIFA 2NTJA 4EFMA 1QRDA 2QPLA 1THMA 2W2KA 4O08A 5EVJA 2RD2A 1JQBA 4IP0A 4TRMA 1S2OA 3H42B 1OT3A 3CRVA 1NMQA 1X38A 3ACCA 1MH9A 4UBJA 2C07A 5HE8A 1MQ8B 2UU9B 3V4SA 1AGPA 5LIPA 3ZQJA 5J5AA 1SR8A 4QZVA 2QT0A 1A71A 4BEVA 1NMEA 4X6XA 1NUHA 1WEKA 3H18A 4OGFA 2YCBA 1I14A 3MUEA 1QP4A 1RPAA 3DMFA 4NMWA 3ROQA 4P58A 5CTJA 1CLEA 3LY8A 4CTKA 1VE5A 3JVVA 2QR5A 2WJGA 5IC5A 5KZMB 3G8CA 2R44A 2ET6A 3KTDA 4JELA 3RV4A 4BAZA 3D0RA 4EG3A 3IP9A 4XKJA 4JX8A 4UNIA 3MFQA 1S9DA 3TB6A 3AYXB 4UPEA 3GOHA 3PGMA 1BHSA 3VNUA 5LOVF 1A72A 1Y5LA 4R81A 1G20E 2AJTA 2BZSA 1JFTA 5HCIA 1LS6A 4TT3A 1O6ZA 3NG1A 5LPNA 2NO6A 3P2YA 2DTEA 4FNOA 1IOLA 3CRZA 1N5RA 1M1XB 3MJ4A 1AKWA 4DCCA 2BKLA 2WNSA 2ZZNA 1XWIA 4YAWA 1QKJA 2CF5A 2BTQA 2FG6C 2ZU0C 4IVRA 4UUNA 3ZJYA 4YO7A 3HO8A 3KPYA 1S4QA 2HMYB 4JLPA 3WZ2A 5KJ1A 2VDPB 3PNKA 2PH1A 3CF0A 3B3GA 4PVDA 5TLSA 1QF7A 3SQXA 4RMFA 4YMGA 3S2GA 2VP2A 3OOSA 4IDFA 1VKOA 3EULA 1EKXA 4IV8A 3GZNB 1KDTA 5KNDA 3MUFA 1Y8QA 3CZRA 1USYA 3M6XA 3W79A 1GTMA 2G07A 3O3MB 5JCPA 2YVLA 3AUJB 1HX7A 2JLXA 4PANA 3KNZA 2AXQA 3TZEA 4MR8B 5K8IA 4KIFA 5F1OA 2QVXX 3RT9A 2X0EA 3DDWA 3I2IA 3EHEA 3OD5A 4ND7A 4DV4B 1B8NA 3IDQA 3E8MA 5AW1A 5DCYA 1JHRA 3NBUA 3VPSA 3WL7A 221PA 3HA3A 3UJCA 2ZYWX 2HLDD 1F2UB 4CWAA 4E4YA 5TVGA 4CL3A 4TYWA 3FWNA 1U0RA 1Q1ZA 1W0JA 3ILYA 4M0LA 4PC3A 3BQNB 3L8FA 2GEVA 5CAEA 3WAJA 5LJLA 4ZOAA 2I03A 2XMCA 5AESA 3WGMA 1QVVA 1P60A 3LUBA 4OL9A 4BAUA 2ZGWA 3KKNA 4EA6A 4NEGA 1CUDA 3RLIA 5BSMA 2WJYA 1WLYA 4L0MA 4PIMA 4R8VA 4FD3A 3LL7A 2C0PA 1WY7A 2FDRA 4M88A 1NQAO 3IAFA 3QU4A 3RGWS 3IHLA 3TL2A 1Y7HA 3A2MA 2EGUA 3P8ZA 2G0TA 2G5PA 1PDOA 1IN6A 2BHRA 1G7RA 4HN9A 4TXHA 2LWIA 4L8VA 3WGHA 5IEJA 4XQCA 3PU6A 3UMBA 2C2YA 2NO4A 2I7TA 1JTEA 3OZFA 3ILHA 3L7YA 4REQA 1ECLA 3ZBUA 3HJNA 3CSSA 3S1AA 2COEA 3N8GA 1IUKA 2OXRA 4IFBA 4NNJA 3SLKA 2EX4A 1L4NA 4KXWA 3ZX5A 4DJEC 1A8IA 2JGKA 1FYVA 4X7MA 1Z4IA 1MEJA 3OUUA 5TPWA 4DVGA 1VRVA 4Z4HA 1RIFA 2HA3A 1G8YA 4MI6A 5EEHA 4RA6A 3UG6A 3RT1A 5C7YA 2J9FB 2E4YA 2RKOA 2ZE6A 3CJTA 2AOWA 4JYPA 1NYQA 1GTJ1 4MK4A 3HDHA 4NQZA 1SCBA 3N8IA 4M2LA 4G37A 1EI9A 1N2CE 2ICAA 2VBIA 1CIJA 3H2IA 5K2MA 3Q3IA 4JP1A 2DERA 2JLCA 2P0YA 5JYEA 3M5DA 5F78A 1LLFA 2QAGA 3NHZA 3KWLA 2Q28A 4HZUB 1SUPA 4JVSB 3UVEA 4ZYYA 4IDBA 4Q4DA 3DNMA 3UCEA 1X2GA 5BQXA 3LA6A 1VPDA 2ZKLA 4X6YA 3R5TA 3HB5X 3PEFA 1I36A 5E3JA 2WJ4A 4XGRA 3ZXXA 1G17A 2Q46A 4FCCA 2BR5A 3C5WP 4L3OA 3ZN2A 1EAYA 1UKEA 1G4AE 4JIMA 4WMLA 2CJFA 3CMCO 4TTAA 3SICE 4D0LB 1E0KA 2WNIA 1H0HA 1ASZA 2FHPA 4L4RA 2QWXA 3OQOA 3PZBA 4D02A 4Q7QA 5K7SA 3ZE6A 1J8FA 2F59A 3TRFA 5DKFA 1PEYA 3BX1A 3FVQA 3EXHA 4TM7A 3DMPA 1XJ5A 4LXYA 1YNSA 2R6CA 3RGGA 1ECGA 5IT0A 2IU6A 3KPUA 3RUPA 1XRPA 3PPWA 5CFPA 1G6Q1 3KYBA 1KKMA 3T7CA 4N9WA 3DLIA 2QHSA 5AKXA 1XXHB 4C7XA 1L5OA 2HHHB 1VP3A 3AIOA 5DFAA 2V65A 3EZXA 5JY6A 2W6CX 5EIBC 5IHXA 3HB4X 1C50A 2HJGA 1UXGA 1G9XA 2IZZA 4MUJA 1GQRA 5E4FA 4EPWA 3N8DA 4OJKA 3V42A 3KQOA 4LJ9A 1QHGA 3A7DA 2HF8A 3W6ZA 3K30A 3KRTA 3A05A 1XROA 2ZJ6A 3AVOA 4HPWA 4NL4H 4BGVA 3QNUA 3D0OA 2G6BA 2IZ1A 2JFOA 4D4GA 2O59A 4PBSA 4V0KA 1M5UA 1R0LA 3F98A 1TRHA 3RF6A 4RTOA 1OFIA 3CNEA 3AF6A 1RP1A 1AHIA 2PT6A 4ZHSA 4YV0A 4BZWA 2OKCA 4RGYA 2WR8A 2BEJA 2EFCB 2ZWOA 3FBGA 3TH5A 2QGFA 4TN1A 3H5WA 4Z3DA 4DM7A 3IEMA 1ITZA 4I1SA 5KOJB 2BE7A 3A1NA 1HT0A 2LW7A 3T1YB 2IBTA 4L4UA 3VZPA 1UBEA 4AU1A 2ZI6A 4AUNA 1VJ1A 4OB8A 2Q7DA 3DZHA 3NORA 2NUPB 3R5KA 3RJZA 5FUMA 1MRZA 1PVVA 4L22A 5CHYA 3TX2A 5FXMA 4NENB 5KS2A 2A8EA 1QYRA 1ODLA 1AKQA 3EBLA 3GJRA 1RLJA 1ZUIA 4RW0A 3WLLA 2W6NA 2MR6A 4HWPA 1BVRA 1QGZA 3ETEA 1NF8A 2ZRGA 3CW2A 4FFVA 4NABA 2GMWA 2JFFA 3SNKA 3TZQA 4CFYA 2OLJA 2AEEA 4DLBA 1ADGA 1UBKS 1NY5A 1M2WA 4C89A 4DQ0A 3IKTA 4Z7NB 3FTQA 1RQXA 3BWEA 1GUFA 3O90A 3R0IA 5AOCA 1TYCA 1K89A 1UOOA 3TLAA 5IS2A 2YTZA 4E30A 1UINA 1OA0A 1ZCAA 2DEQA 4FHFA 3W8RA 3U40A 5EJ6A 1CLUA 3M5WA 4LC9A 1HR0B 1KOJA 2CNBA 3AJAA 2O14A 4CKCA 4ZZIA 3LA8A 1W66A 4O02B 2A9PA 1AZWA 3C3EA 3ZCUA 2FI1A 2QMEA 3PXUA 4BKRA 3UK7A 1PV2A 1I0ZA 2WIAA 3I2YX 5IUNC 3A1WA 5TY0A 1CVLA 3H3FA 2A3NA 1KFEB 3I34X 5JE8A 2WG0A 4XWTA 2GZHA 1SHTX 2C4NA 4FFNA 4DV5B 1I3KA 3DFZA 2XBMA 3SXJA 1G5PA 4DAEA 2DBRA 1UMCB 3L1AA 2H9YA 2GD0A 4ZJZA 4S04A 2ES4A 2YN2A 4OY3A 4WUVA 3ZHQA 4YJGA 2XADA 1CRLA 1EM8B 4D6PA 2O2EA 3HUUA 3IKLA 3DZCA 4NJEA 3ZU5A 5B57C 1RXWA 2CSXA 4WDQA 1P7VA 3NHMA 2Q2VA 3SU8A 3A6PC 2VYVA 1BVHA 3UJ9A 4XEHA 5DTRA 5AW5A 3UAVA 1S89A 4QDTA 1II0A 1AF7A 1ONSA 4OJQA 5H68A 3BB3A 3SC6A 5IVKA 4TOIA 4DBZA 1XHLA 1N1EA 2QE7D 5EFOA 1DC6A 4Q16A 4RLQA 3TMKA 3IFSA 9LDBA 3B6EA 4OFBA 1X9GA 1IG0A 2AYXA 5C3UA 1GTVA 4YRAA 2XDWA 3CN9A 4MQEB 2JCVA 5NLLA 4CKEB 4JP5A 4E08A 1K9SA 3RJ9A 5CDFA 3IUYA 3P9SA 3KHUA 3B1VA 3FRIA 4EZIA 2H6EA 3OG9A 4TQFA 4R3WA 2DHRA 2G4VA 2XD4A 2XUHA 3ELBA 5T8KA 4LVOA 3OI7A 4MR9B 4RCYA 2GHRA 1DCTA 1TM3E 4H2XA 1CPYA 2X0RA 1DEOA 4BQOA 1TAGA 3EXIB 3TEHB 2ESRA 5K6AA 3P4XA 5D2CA 1KWKA 1CUWA 1JQ5A 1B16A 1PJ2A 3KJFA 3OHMA 5I7RA 3RSFA 5J4VA 5C53B 4I55F 4QUBA 1A9PA 3X2EA 3BE5A 3DTVD 4NDZA 6REQB 1P77A 4EG6A 3JQ7A 1LVGA 4UP9A 1GV1A 5FPSA 3HSYA 2QTRA 3RRXA 3SZOA 4Y6SA 1G2IA 4A8JC 3ASZA 1VHDA 5FOXA 2JA2A 5HW0A 2RH4A 3RSLA 4RTMA 2I34A 2YHIA 1IN7A 4DANA 3V7UA 3FCYA 3QFHA 3HCDA 3QEJA 4GBED 4RLHA 2NIPA 3LD9A 3G2LA 4X6UA 5JECA 1OFUA 5TEVA 1G18A 3DNFA 2NWQA 5HGJA 2YV5A 1ZK4A 2QMZA 3CKYA 2I3DA 3FF4A 4FI3F 1XU7A 2WQ6A 1XZCA 4MUMA 4YMIA 4FBMA 5DK6A 5GONB 1PAUA 3B82A 1DJPA 3MWKA 5KVSA 3K1YA 1JBQA 1XVAA 2EBFX 4PG7A 1R15A 4RO0A 3WAKA 2P3SA 4KLAA 4LBZA 4F6CA 3LSQA 2CUNA 5TRTA 3B78A 4EK9A 3P0EA 4MIKA 3PFFA 2PWYA 2OFWA 1XFAA 3D6UA 4JT4A 1HMPA 2FXIA 3H05A 3LPNA 1V11B 3B3AA 4HBGA 4LOAA 5T41A 2HRDA 2HXSA 3VGPA 3O3NB 3E1GA 3KLMX 3I72A 3R5FA 2OCAA 3L1UA 4GQIA 1EM6A 5EJIA 3W05A 1RRCA 5C52B 1EFLA 1XEXA 2HAEA 1NXVA 3HR7A 3R09A 3SJBA 3VYWA 5IABA 1N32B 2MSDB 3BCSA 2YBEA 2DFVA 2QA5A 4NCJA 5IARA 3TNFA 3VOSA 1C1HA 3PICA 5BMVA 1B70B 2IYZA 3D3QA 1XKTA 1ZD5A 2X7JA 2SHKA 3HZRA 1RYDA 4LCBA 1IVNA 4MARA 1OASA 4HGQA 1SWVA 1E0DA 4FZ5A 5DM0A 5JH7A 5A0VA 3EPRA 2R7NA 1G8PA 1P7PA 3BGSA 4JB0A 4DUYB 2YN0A 3KE9A 4G84A 4O6VA 1T29A 1LV7A 1WQ7A 2ID8A 2XMDA 1D0SA 2GT1A 3DWIA 2L17A 4PZAA 3IBSA 4ER5A 5I5EA 3QHAA 1MORA 3OZAA 3K9HA 3H1PA 4ML3A 4DSTA 5H70A 5AJYA 1ZD9A 2VPTA 4LBWA 5A4JA 1ZWLA 2YJZA 2SCUB 3E18A 2HHLA 3K1AA 3NHYA 4YRCA 2JIZA 4HDKA 4MRMA 5GM1A 1WZUA 3HKDA 3ZIUA 3NWPA 4TZ0A 3TIGA 1EVYA 5HQ3B 3N53A 2EQAA 3U80A 3SXUA 5C32A 4V3BA 2CDBA 2D0PB 2WJHA 2KBFA 4B3IA 1RU3A 4EELA 1J24A 3EGEA 1KI9A 1O1YA 3ESYA 3NYWA 1CUCA 3KQLA 2G63A 2JL1A 4NZYA 5BYAA 2FKAA 5C8XA 4JXXA 3D0KA 3L04A 1MNQA 3I4FA 3DEHA 3HABA 1H6BA 1JEDA 2X41A 2J3EA 3DHEA 2ZCVA 1I6MA 4LWQA 2IXGA 2AFIB 5CCDA 4JJ4A 2P62A 2BM8A 4HDMA 2K2WA 5KSYA 3AUTA 1E7YA 2UZ1A 3OZRA 4I4TF 4ZREA 5JAQA 4FFBA 3H6GA 1NYRA 4ZDKA 2QDXA 2ZRMA 1YOVA 3TSZA 4XVUA 3CXUA 5LMUB 2CLDX 2DFNA 2WD8A 4BMOB 4PCLA 3FLEA 1N77A 1IY2A 1MX5A 1U65A 5G0VA 2NUAB 3RV3A 3MOSA 4PZUA 1FFCA 3OE7A 1PR1A 1DTEA 3PFBA 3II6X 1OBCA 1YR2A 5HIMA 2CD7A 2FOLA 3RFXA 4LKRA 1NXPA 1PJ3A 1WDWB 2PUBA 3LJKA 3GRFA 2BPOA 1ULZA 1ZH0A 1FFAA 5T4HA 3NETA 1PT5A 4YECA 1CEQA 1I7LA 4X92A 2VXYA 3DE6X 2IIBA 4PONA 2VOEA 1S8FA 2FW9A 1V1MB 2R60A 3DBHA 3KDSE 4KX3A 2JHPA 8MHTA 1B0AA 1Y98A 1B8OA 4K9NA 1EAMA 1ZA1A 4LOIA 2AQKA 3VR3D 4E1VA 3N75A 4M22A 1JX6A 3D5QA 3TSCA 4A8JB 2HY7A 1GPAA 1S8OA 2P2GA 3IXQA 1UT6A 1HUQA 2FW6A 4WN9B 4KU4A 5CYOA 5ELXA 3WBJA 2FWRA 4BKPA 4C3VA 2IDJA 1BYUA 1E4VA 3TLXA 3SYRA 3WDMA 3E7FA 5K0SA 4L5JA 4YLEA 1U4OA 5F98A 3E23A 3UAZA 3THYB 2NSYA 4LGYA 4ZO8A 5CA0A 3B7WA 5IFLA 5KWEA 2PX3A 3PPYA 1D2RA 1QKKA 2DGDA 3PVZA 4ALKA 4HRXA 5ESWA 1T0BA 2I54A 4KZKA 3IEUA 3MOGA 2VP0A 3RS9A 2PKRA 3NTOA 3D1LA 3DH0A 2JFQA 4BWFB 4IZOA 4F1KA 4M1EA 5LQRA 1AE1A 2ZAGA 3T61A 2OLEA 5HCNA 5IX8A 2EOAA 4DMCA 1TKRA 2XA2A 4Q12A 1MPXA 3VTFA 3P8TA 1T9DA 3NAQA 2Y0EA 5DI3B 2V5UA 4FDLA 4KLCA 5FA8A 5C80A 4TWZA 5EY5B 3H11A 2IWHA 2QX9A 4F9TA 2A0YA 1ZEMA 1SELA 1ZONA 2H63A 3HMKA 2DT5A 2QB5A 4NHOA 2BFWA 3FBTA 2C9YA 4HZIA 4KMMA 3X44A 5MFPA 4G9BA 4TZKA 4EYEA 3P27A 5HUQA 5KDDA 3VYSB 2JA1A 4QYSA 4W1RA 3T41A 1NR7A 3P94A 2WJZB 4JGBA 5I7UA 4AZ3B 3WY9A 1CY6A 3RIYA 5A62A 3H8WA 1JR2A 4U3JB 5CLFA 1K3UB 3NANA 1PWEA 3M6UA 5CT5A 3PQ4A 1ZO8A 1Z2OX 2I7VA 4HP8A 3T4UA 4KJXA 1ZOSA 4GC9A 3ZY3A 1U63A 1FNSA 4C08A 3JQGB 4HUQA 2B9EA 1BTOA 3FFBA 4KDRA 2BUCA 3HDGA 1IXKA 3L79A 3QV2A 4F4UA 4BB5A 1COWA 1RKBA 4QUKA 3QBVA 4XYLA 2V6GA 2HIAA 2KM1A 4ZEWA 3WLJA 1DX6A 3AI3A 2HR1A 4N3CA 4CEIA 2Y6VA 1UAYA 2PPLA 1QG4A 1NJSA 5LOVB 5C3MA 4NOLA 2ZREA 1IXRC 2OO5A 3IBFA 3Q3HA 5L4SA 1Q22A 4UFOA 1JJIA 1GY8A 4DQLA 3PJGA 4K40A 2OC9A 3GAMA 1V4NA 1NLUA 2EAUA 3A7EA 2AFHB 4H2YA 3IS3A 1NXWA 3EJWA 3L7LA 4XA8A 5EUMA 1XQ9A 4BLWA 3MLAA 2IYPA 4N8DA 2QUJA 3L82B 3PUHA 3WL4A 2JGAA 1NC3A 2FFBA 3BVPA 1UMKA 2VWHA 1VCOA 1X1QA 2RH9B 1BXZA 1IQ0A 5AVRA 2OGZA 4ZZ3A 2ZT8A 5DCUA 4LQLA 3C16C 4Y9UA 1UMDA 2IP4A 1YDFA 1OCEA 3PRJA 3RIRA 4TZTA 4BNHA 2IPAB 3VTZA 3WGLA 4V0RA 4PFJA 4EY3A 1PFWA 3QVOA 2OBMA 4J0CA 4CM4A 2EEPA 1A3CA 2A92A 1DLIA 2FP4A 3EIQA 3L93A 3TYXA 4BO4A 5I9IA 3WK8A 3ZHYA 4OP0A 5AD1A 4IRMA 4QFDA 3A3PA 5B7NA 1AHPA 3PNQA 3UWMA 3C6XA 1EFDN 2H31A 4URYR 4Z51A 3FUXA 3GQBB 1QGDA 1FJGB 3VQXA 1QOZA 5D86A 3UICA 3NHWA 3E70C 3H8JA 1P2UA 2KB0A 3WYDA 1R4MA 2EATA 4PG5A 4JDPA 2FW7A 3CNHA 1ZSVA 1QOPB 1EGAA 2GRUA 2X14A 5T4EA 1L8LA 3VSAA 1DAMA 4BHTA 2BN4A 2PGXA 1RM0A 1AS3A 3P9YA 2R7LA 2F7SA 3PIDA 1XDSA 3P2EA 1J06A 2V5VA 4E32A 1L5QA 2XUKA 2DPLA 3V8QA 2B61A 3K9FC 2VKTA 4AG6A 1CZNA 1DVRA 4TYYA 2I65A 1G6HA 1I1HA 1GAEO 2HRQA 1L4YA 2ZWVA 3KYDB 4A0QA 5YASA 2O5CA 2EW2A 5LLSA 3VVBA 5LQUA 1Z75A 1F5NA 4F3NA 5GP1A 3ETJA 2COKA 3E9MA 2CWDA 3I2KA 5M3BA 3DLBA 1YR9A 4XJVA 4F2HA 3EFOB 4WK0B 4UJ3A 1HQCA 1LZKA 4RK1A 4PYNA 2W11A 4YMWA 4FXPA 3VMFA 3W2FA 2PBZA 4C0XA 3OOYA 1EXWA 2QVGA 4JOQA 4HQ0A 4JXKA 3RC9A 3RTGA 2H07A 5FCDA 4CZ2A 4F8JA 5DRTA 3T54A 1HDOA 1JT2A 3BGIA 3B5JA 3DV2A 4IFTA 2DETA 2O2JA 3LX5A 1DARA 2O20A 4N3NA 3TTYA 1B0UA 2ZAIA 2EX1A 4MV7A 4HEA6 5H0IA 2R65A 3WMXA 1P4RA 3T3MB 4NV1A 1FUYB 1I7NA 3EODA 3VSEA 5CD9A 4C7OA 1H9AA 4TKVB 3TXXA 1FYDA 2QLFA 4E33A 3O4RA 4O33A 5D5HA 5CGQB 1YKFA 2I1WA 4UM9B 1SZCA 4E13A 5K4HA 1YBFA 3DBRB 2QJTA 2J3IA 3BIXA 4IDCA 3TDMA 3L1JA 4B1FA 3B8EA 3AXSA 4I9FA 4NCIA 4F5WA 4IIXA 3ROXA 1CE8B 1DV2A 1Y42X 3CH7A 1GWNA 1X70A 4FLFA 4TSRA 3N6XA 1W4AA 4PX5A 2BMAA 1UBLS 1G1MA 1JGTA 1DKOA 3LUJA 4DQUA 4B7ZA 4PM4A 3CLRD 1P5RA 3C48A 2OLKA 2DJZA 4KDFA 2D1TA 1BMFA 1VGRA 1SIWA 3DM9B 1MLDA 2FRDC 1BCSB 3D7MA 5HK8A 1F12A 1UJ2A 3P19A 3UXYA 4HWOA 5E6SA 4WOJA 2JFHA 2XOXA 2H2FA 4C0LA 4Q4HA 1TZ2A 5GOTA 2NNWB 3AB7A 3E15A 4FKMA 4XH9B 3ZI0A 2FQQA 2Z95A 3H1BA 4UEOA 3H2SA 4DLLA 2V74B 3EIHA 4YGYA 2R6JA 1VMDA 2PUJA 1L5HA 3RVNA 2VTDA 4EJFA 4M8KA 3B20A 4BVHA 1LYLA 2DUJA 2C9BA 3OPXA 2A0KA 2CLKB 1VE3A 4JGIA 4F71A 2PWAA 2QTVA 4XPZA 4Y2PA 5CRIA 3MTGA 3WGJA 1DJLA 1EG2A 2FV8A 1VL6A 4HAXA 1NQWA 5FWXB 1ZM2A 3I2GA 2IV3A 4FW9A 3KS9A 2WI8A 2Q5HA 2ZWMA 4NF2A 1OAOC 4GE3A 3NCTA 1VHJA 4DB2A 3Q3GE 4MRPA 2TMDA 3LCJA 1N3LA 1P4GA 3T7SA 1DELA 2DBQA 4DZTA 1SUDA 4XJTA 5JWRA 3U16A 1K5GA 3NRBA 5AI0A 4XSVA 2I3ZA 5BSFA 1QUFA 2O1EA 2Q4RA 3GLRA 2NW6A 4LNSA 5I7EA 4KOAA 3R7DA 2O8BB 1X19A 1XLTC 1RW4A 2XLCA 4BRZA 1AC5A 5CVEA 1C0LA 4BCDA 1M8JA 4DV7B 7ABPA 1JQAA 3P8VA 3TWOA 1QWSA 2GKGA 1SUFA 4KQFA 5DLYA 2RHSA 4FI3C 4JBIA 5BW4A 1R0BA 3UV6A 3OJEA 3WKEA 3BMQA 5SV2A 2WHPB 3RFFA 3UIEA 1P1JA 1T10A 1ZUD1 2H7CA 2XUPA 1UPXA 3QKIA 3PHIA 3WO1A 2IZOA 3JAWA 2H1CA 4LRTB 1T4BA 4C01A 3MCVA 4CMHA 1FNNA 1PLJA 5F35A 5GGYA 3ZV7A 1OFVA 3F78A 3EYWA 5E1MA 2RHGB 4IDOA 3RRMA 3MTQA 1SXJA 1I2MA 2RJOA 4TXMA 5J4HA 3GJ8A 3NHKA 4DT1B 5TT1A 3EIOA 5M5BA 1WVMA 1I8TA 3K16A 3M2PA 4KYUA 4Z9XA 3QO5A 4NG4A 4ED9A 1XP5A 4Y7DA 3WHPA 1CQIB 3GU3A 2CJWB 3FCAA 5B7PA 1IM8A 1YU6A 3L0DA 4LECA 1QFXA 2E37A 3MHPA 3TEFA 3WBFA 1U1GA 1QCZA 5AP9A 1GHTA 2H2GA 2E64A 4L5AA 1MABB 4D99A 3C7DB 3L9WA 2GK7A 5AXCA 3H86A 1P7ZA 1XTJA 1HY3A 1ECFA 2RGRA 5MN6A 1H65A 1TIBA 1KJYA 5T64A 2HJWA 1ENZA 4QUHA 4JI0B 2ZR3A 2FPPB 3F8TA 3BFVA 3OOWA 4D9FA 2P4QA 3KVYA 2LV8A 1KS9A 3T3EA 3OO0A