1ATIA

Crystal structure of glycyl-trna synthetase from thermus thermophilus
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
505
structure length
437
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYL-TRNA SYNTHETASE
publication title Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
pubmed rcsb
molecule tags Protein biosynthesis
total genus 131
structure length 437
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1996-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1atiA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1atiA02
4H2XB 1V95A 4YRSA 4WJ4A 1USYC 4XTVA 4P73A 1HC7A 3G1ZA 3A31A 3VQXA 2AMCB 2DU7A 3P8YA 2PMEA 4YROA 4YCUA 1G5IA 1Z7NA 5K1XA 2RHQB 3ICAA 1EOVA 3EFRA 4HWOA 2ARSA 1ASZA 1NJ6A 2AKWA 3HFVA 2XGTA 4H2YA 4WJ3M 2P0LA 4XEMA 2PMFA 4KQEA 4YPFA 1QE0A 1VQZA 3QO7A 3MF2A 2DZ9A 3L2ZA 3QO5A 4XTXA 2ZNJA 2C8MA 4ZIBA 4P74A 3ERRA 1EIYB 1WQ7A 3DSQA 4RQEA 3VQVA 1FYFA 2I4LA 3IG2A 4DQ2A 2DEQA 3OD1A 1E24A 4TVAA 4XTWA 1B76A 1E1OA 1X56A 3BJUA 2ZXFA 2Q5IA 1L0WA 1B7YB 2DTOA 3PCOB 1H4SA 2EWNA 2QHSA 2E64A 4H2VA 3QO8A 2DU5A 1WQWA 2QHUA 3E9IA 1BIBA 2ZZFA 4P71C 3HTZA 4YRGA 1EQRA 4YYEA 2DTIA 3I7FA 2DXUA 4P71A 2ALYB 2IY5B 3M4PA 1BBWA 3UH0A 4YP0A 1KMMA 2ZCEA 4YRTA 1KOGA 3HY1A 2ARTA 4NCXA 2Q5HA 2ZT8A 1WYDA 4CH3A 4HWTA 1NNHA 5C52B 2ZTGA 3QNEA 3IALA 4YDQA 4H2UA 3LC0A 3HY0A 2E65A 1NJ2A 3A32A 1ADJA 3W3SA 1ADYA 3HRIA 3HXXA 4P3PA 2J3MA 1NYQA 3RGLA 3UFGA 4K86A 1G5HA 2CIMA 3TEHB 4PHCA 3V7SA 4L87A 4TQDA 4RQFA 1QF6A 1E22A 2ZR2A 3NEMA 3RKXA 3M4QA 4P75C 3A5ZA 2CGHA 1X2GA 4CH5A 1JJCB 3V7CA 1YFSA 4CH4A 1USYA 4XTYA 5KNNA 1H4TA 4HWRA 2ZT5A 1NJ1A 1NYRA 3LSSA 4CS2A 3PZCA 4HVCA 1PYSA 2DJZA 3A7UA 2ZT6A 4YRLA 1EVKA 5E3IA 1SESA 2DZCA 4PG3A 1X2HA 4XU1A 3L4GA 2IY5A 1B70B 3RIRA 1YFTA 2E41A 2RHSB 2I4MA 1H4VB 4YRJA 2ZIMA 4XEOA 1W66A 5ELNA 2CJAA 3TEGA 3NENA 12ASA 2Q7EA 4H2SA 4TVWA 3HFZA 4ZTZB 4H2XA 4YRNA 2EJFA 2DQ0A 4TVYA 2AMCA 2CJBA 4O2DA 4RDXA 2XTIA 4EO4A 3HXZA 1NJ8A 4H2TA 3UGTA 2E10A 4H02A 2HNIA 1X01A 2RHQA 3VBBA 1SERA 5F5WA 1WNLA 3V8JA 3TUPA 1N9WA 1GGMA 1BBUA 1H4QA 2EJGA 1YB3A 4BWAA 3RUXA 3HXVA 5ELOA 1Z7MA 2ZZEA 2QHTA 4YRQA 2AKWB 5HGQA 4EX5A 4XU2A 1ATIA 3HXUA 2E1HA 2I4OA 1J5WA 3P8VA 4ZTUB 2ZZGA 3RKYA 2DDZA 2E5AA 2P5IA 3NELA 2J3LA 2ZT7A 4WF2A 4AH6A 5C53B 11ASA 5C51B 4G85A 4TTVA 3A7AA 1NJ5A 3IKMB 4YRCA 1WLEA 4CS4A 1EIYA 2ZINA 1BIAA 4E51A 3HXYA 2DTHA 3NETA 4UP8A 4YRKA 4J15A 4TVAB 3A5YA 3MF1A 3RACA 4UP7A 1B7YA 4P72C 4H2WA 3V8LA 2I4NA 4Q6GA 3PCOA 4YREA 4P75A 3WQZA 4UPAA 2Q7HA 1YFRA 3A7RA 3LSQA 4P72A 4P3OA 4OP0A 3L1AA 4LNSA 3HRKA 3KFUA 3RKWA 3RL6A 2Q7GA 3R07A 4XU3A 4HWPA 2ALYA 3EFSA 3REXA 2DKGA 4K88A 2FYKA 4HA8A 3VQWA 4YCWA 4XTZA 4DPGA 4KR2A 4HWSA 4Q15A 3A74A 4TWAA 4OLFA 3VQYA 4P74C 3RF1A 1C0AA 3V7RA 4TQFA 4WI1A 2EAYA 4YRMA 2ARUA 1RIQA 1YGBA 2G4CA 5K1PA 3TEHA 2QHVA 1WPYA 1IL2A 4YRFA 3UGQA 2ZIOA 3CMQA 1X55A 4CH6A 1JJCA 3V8KA 3QTCA 4XTUA 3MEYA 3P8TA 2ODRD 1X54A 4K87A 1HXDA 1SETA 1EVLA 3FJPA 2EL9A 2DVEA 4BW9A 4G84A 4UP9A 1ASYA 2ZNIA 1E1TA 1LYLA 1PYSB 2C7IA 3E9HA 4XU0A 1HTTA 2CJ9A 1B70A 2DXTA 2EJ9A 1KMNA 1SRYA 1G51A 2RHSA 2ODRC 4KR3A 3L4GB 3REUA 2ZGWA 1B8AA 2ZR3A 3IKLA 2E3CA 2DQ3A 4CS3A 1EFWA 3BFMA 1WU7A 2LW7A 4P3NA 4YRPA 4YRIA 4RMFA 4YRRA 3HXWA 4P73C 4X5OA 3HFZB 4YCVA
chains in the Genus database with same CATH superfamily
1X1QA 2QTAA 3Q3HA 2ZR8A 4DJ5X 4BO2A 1BVUA 4Y2UA 4K2AA 3QENA 3KQPA 2XXAA 2BMEA 4V1CA 4ZCSA 2WD7B 4GXTA 3ZE6A 4TKMA 4L76A 2PTGA 1NXWA 1G6Q1 1SG9A 5JXGA 2WHPA 3VDMA 4F5WA 1KNXA 2AMCB 2GN8A 5CB4A 4CF4A 2IGBA 3VV2A 1VKRA 5GZ1A 4D9BA 2ZTVA 1NE7A 1GZ3A 4XJXA 5ECWA 1ZRSA 1AUXA 2A8EA 4FTWA 5FO0A 2X0EA 4C7MA 1FF9A 4NL4H 5A62A 2OHFA 5GZ3A 5CW2A 5FNVA 1WOMA 2A0UA 3OCZA 3WJ2A 3FFAA 4MLCA 2HEGA 3HCOA 4EGAA 3DQQA 3O2SB 5C5DA 3BM5A 5TQ2A 1LTKA 1AQ6A 1BE6A 2VBFA 2PT6A 3PQEA 3HWX1 1RLOA 2ISQA 4GWKA 4EG7A 5IW8A 9LDBA 1P0PA 1QBKC 2G04A 2WHRA 1D2RA 4C6SA 1T1GA 4AZ0A 2QQFA 3IRUA 1O57A 4AJNA 5KQMA 3BEDA 3F98A 3AFNA 4WXRA 1A27A 1VRWA 4PAOA 3OLWA 1MNQA 2H1VA 2IUEA 2X1MA 4UASA 5CXSA 3VSEA 3A3KA 3WL4A 2PX8A 2PRIA 4N3GA 1BRMA 3FHOA 3SR3A 3WFJA 1UBEA 5AXCA 5H83A 2PZGA 2VDVE 5CMLA 1N0HA 3DWEX 5J4HA 1MNAA 1YFZA 3UC9A 1Z73A 5AHKA 3V32A 1P45A 4EUSA 4MPRA 2M1XA 5B7QA 4JYZA 2VRCA 2DZ9A 4M60A 1CY4A 2HKIA 1PU2A 5CVUA 3OPQA 4G5QA 3FUUA 4NS4A 4UMDA 3AF4A 2ES4A 4J3FA 1REQA 4QDZA 3HJNA 4D96A 4B81A 4AJKA 3DTVB 3P2YA 5JYBA 1KQNA 3JASA 2PT5A 5E6UA 1C8LA 3DEJA 4H2DA 4NE9A 2XECA 4Q3OA 1VB3A 1YS4A 1ETUA 5I51A 1GUZA 3I9FA 2Q8QA 2Q9AA 4GBMA 3IEKA 4N01A 5HMLA 3WGIA 4JMLA 3UHAA 2I4LA 2OHHA 1IH8A 4LQDA 1MGPA 4P2BA 1GEEA 1L7QA 3ADCA 4G0ZA 3IQWA 4BFUA 3A04A 4MCIA 4MUKA 4OMCA 4BXOB 4MIKA 3MLEA 5ALOA 3ZBUA 3D4PA 4NQRA 3ESXA 4CKEA 1PLLA 1BJRE 4QQKA 1LK0A 2GJKA 2WQ6A 1KY2A 3TE7A 1Y8RB 3NWPA 4MAAA 1RSZA 1QWOA 2JDID 2EARA 2GM9A 3D6VA 3LF1A 2KPOA 1MTZA 2GKOA 4OI2A 5CURA 5EWLA 3VGPA 5LFAA 4YY3B 2FZEA 1KHHA 4UNQA 2UZ3A 1NMSA 3E7XA 3NAQA 3NTLA 4JP3A 1OI2A 4PC7A 4HAYA 3SYMA 2DHDA 1KPGA 1E4OA 1I0ZA 5JCOA 3GRCA 3ZWDA 2CNNA 4J07A 5EC8A 2QI9F 4GT1A 1A3CA 2BMVA 3L9XA 4XYEA 1JJBA 2H1CA 2AJTA 4YDHB 2MHCA 3RSOA 4AICA 1JEYA 3ILXA 3ELYA 5E7JA 2A4MA 3CLUD 2W4MA 3IJPA 2AOTB 2LVBA 4DN6A 1TB4A 2CXOA 3EZXA 1OU4A 5FQNA 3B7GA 3SN6A 2PJZA 1HE3A 1M72A 1PSWA 4EY6A 1EFVB 1QIMA 3BMCA 2O06A 2X7HA 2ZPUA 1SCQA 4RV9A 3SIXA 3DZDA 3HV2A 3PWTA 3ZZNA 1ZUHA 2X41A 3QVMA 1U1DA 1X19A 2GLXA 2P1DA 3E6AA 3NJ4A 2ZTMA 1U99A 3GLUA 4MXDA 3RHFA 4HTFA 3SAJA 1UC9A 2FR8C 2JLYA 221PA 1V0JA 3PEYA 3LHKA 3RC3A 2YHBA 1GPH1 4IIXA 5IKPA 2FWIA 2JCYA 2VHYA 3I8XA 4RHCA 2CL6X 5SYMA 3SZLA 3TLGA 1LF0A 5KQSA 1X8XA 1GN9A 4GPD1 1E32A 4O5OA 3HVRA 4MQUA 4UOEA 3GRZA 2OECA 5FHQA 2H2FA 4CL2A 3W9BA 3VJMA 3EGXA 4V0OA 3DDOA 5AVVA 3LA6A 4BLVA 3A4IA 4IX9A 4XWGA 5C80A 3VNRA 1HKHA 1YRWA 3BGIA 4UULA 2DUNA 1TEXA 8OHMA 1IPEA 3C7DB 1XP8A 4CLEA 1D2MA 3OQMA 3UFGA 1KRXA 2E37A 3GJ5A 3OE5A 1PKEA 2IPOA 1H8EA 3KKLA 3NKLA 4ZQEA 2H5JA 2XADA 5F77A 1E3LA 4EY8A 4DUZB 2R8ZA 4QPNA 1JG4A 1AGNA 1VYUA 2CB0A 2QS9A 1ISHA 4PHCA 1G9XA 4L87A 2A33A 2W90A 4O4IA 3X2EA 5KBYA 4LFCB 1OH6A 3N9IA 2I2FA 2X5NA 4HDAA 2ZW9A 1U63A 4V0QA 1YR7A 4WECA 1NTOA 4FSDA 3LNCA 3IBYA 1VCNA 2DECA 2DULA 4XX1A 3AEQB 3K31A 5IAAA 1AA6A 3V7CA 3IULA 2F3RA 1DKOA 3CNLA 3ILSA 1DPGA 4R1QA 3MILA 3WSTA 1G3RA 2XDYA 3LPLA 1VI2A 4MWDA 3WGYA 3M6AA 3V1LA 1OCEA 1ZWKA 4MA5A 1YB2A 1GPWB 3KYDA 4L5BA 4OTZA 1OB2A 4LIPD 4URYR 1TZJA 2FMKA 4P3KA 4XAQA 4P98A 4F9EA 4JB8A 4L28A 2R7LA 2V7PA 4RFVA 2C8LA 1JFSA 5CBPA 4YASA 1JIQA 4RACA 1MOZA 4M9XA 1PS0A 1UQUA 3G5LA 4CTMA 5HF5A 5C1IA 2J3EA 3HUUA 1C8VB 4LYJA 5EJ7A 3L1IA 4GGPA 4DV0B 1DBQA 1JQ5A 4G65A 1QO0A 1X14A 1FP2A 1XZQA 1SIWA 1RYFA 2VEOA 2W2LD 1Z4IA 3AQIA 1YR9A 2RJOA 2VBGA 5FYDA 1ODJA 5HBGA 4BRUA 1P1RA 1TCAA 2GLUA 3C7KA 3KQQA 4YT5A 2EFEB 1S2DA 2PNFA 4H7JA 3TD2A 1JLRA 3NOXA 1KVUA 5H68A 1XX6A 3TZHA 4B4KA 1MW8X 3RIRA 4NCBA 5MGNA 4HYEA 4TV8A 5C8YB 3KKPA 3M5PA 1U7PA 3AETA 1GAJA 1EE1A 5BUZA 2RHSB 3G2KA 4NG4A 1WMBA 1K6EA 4BN4A 2K2QB 1E2FA 3B70A 1IC6A 1QV6A 1P61B 4XEOA 2I2DA 5EXXA 4PGFA 3AP2A 4EA7A 2PUGA 5IKXA 1TUIA 4YRBA 2ZBEA 2GWRA 3PHIA 3B12A 2RHTA 1OI3A 2RH9B 4NYMQ 3GFGA 4ACAA 4YQFA 5L4LA 3BL8A 3VHXA 3KZKA 6LDHA 4CG3A 4B44A 2WJPA 4NPCA 1F1JA 4KC0A 3KT0A 2Q0SA 2W2OA 2DH6A 1KXJA 2Z58A 1JTFA 5TE9A 1CE8A 2YFHA 1LBSA 5FKJA 3D8RA 1Z8DA 4EZEA 1IULA 2X8AA 4Y6LA 5F1OA 3P9XA 3P27A 2AHRA 4O4HB 2HFKA 3AHDA 2O6LA 1T36B 4TTQA 1PP4A 1NW4A 1HV8A 3NC0C 4HCJA 4X7PA 4LI3X 4TVYA 1DO2A 2I8CA 5ERXA 4CI0B 2IIVA 5KYWA 4GBGA 4PQFA 3FPEA 4LF9B 2GEUA 3KJIA 4NZPA 1R9MA 4CKXA 3NHKA 3WRXA 3MTDA 3QEOA 2PCLA 3PCRB 3OHSX 2JI9A 5EZSA 5B2EA 2E10A 2PWBA 1T29A 2PWPA 3RYIA 4HAOA 3EPPA 4H7PA 1K7CA 3KZOA 4EVRA 3UGJA 1QCCA 4Z7OB 2Y27A 2OUKA 3OC6A 3O47A 4UHCA 2V7QA 4LECA 1USGA 2IZ0A 4XIJA 4M99A 5FXMA 3TFWA 5KSOA 3A4YA 3GVIA 1JJIA 1GAEO 4TMTA 1HT2E 3QY9A 4HRYA 1L9XA 4UCXA 2ZB7A 2W6ZA 2LCQA 3S99A 3WLSA 3G7UA 4G6ZA 2FPGB 2VG8A 3E61A 2J6CA 4GPBA 5A05A 4MKHA 2VA8A 2JVIA 3PC4A 4CQJA 3W5IA 1WDKA 4TTAA 2RIPA 2P9JA 3IP3A 1U0RA 2WUFA 4DGQA 3ESAA 4I99A 1X1RA 5IT0A 5H4GA 4MA4A 3MB5A 3K0BA 4P83A 5M29A 1M1YA 2EHDA 2I4IA 2UZ1A 4EJ2A 1X7WB 1WLSA 1F5NA 3KJQA 4UBJA 5IJ9B 1YMUA 2FHPA 2Z5LA 3B1ZA 1JAYA 4IOLA 3WRYC 2Y99A 2V9PA 3BG5A 3G0DA 1O2DA 5IT9A 2X14A 3DFUA 4MCJA 2WY2D 4YUXA 3ZGNA 5KWVA 2Y93A 3I34X 4BUJA 1U4OA 2MCFA 3J7TA 4M83A 1YV9A 4CMAA 1UH5A 2FZ5A 3QLUA 4EYEA 2C7GA 4DLYA 2PVPA 4S0ZA 4UBIA 5JMPA 3A7AA 1PS8A 1V9SA 5AW0A 2QL9A 3U4GA 4DCSA 1YZGA 4LQCA 4IDHA 1BD3A 3ZQUA 2Q29A 3PA8A 2QGZA 2VFAA 3LU1A 2GPTA 3R7NA 1RHKA 1JDSA 1DBRA 3KTAB 1CB0A 2JIPA 1AS3A 2VWHA 4I4CA 4N7BA 2OWDA 3UA3A 2XHEA 4CV1A 2XF8A 2C4UA 4FYMA 4KE7A 3D5TA 5DISB 1C0KA 1N2CA 3UMGA 4DILA 2WHQA 5C81A 2WWYA 2DERA 5CU7A 1C8KA 2HXGA 2MT9A 1TPZA 4BRSA 4BO7A 1VL8A 1QRTA 2PL5A 1QU3A 3N05A 4U00A 1YWGO 3EXIB 1H42A 1D6NA 4PAQA 4KFCA 2O7SA 4NP6A 1O5OA 2D2EA 2OEPA 3RSQA 5C5IA 1XD2B 5DM60 4URZR 4JL6A 1SU8A 3EE6A 4WHMA 2Q1YA 1FUYB 1FS5A 2BR3A 2FSIA 3R44A 4BFSA 3DLHA 4U3JB 1NL3A 1NRJB 1YOVA 2I03A 3HB0A 3OPYA 4IIYA 4L5CA 8MHTA 1KY3A 1V4NA 1OH5A 4JQOA 1VSBA 5CDYA 3QEJA 3NI2A 1EJ6A 3TTSA 2D54A 1WBBA 3UYKA 4DA8A 3AERA 5E7IA 4PYMA 4YK7A 2HMSA 1N0VC 2W2QA 1WSBA 2WIGA 5ECGC 4BX8A 3RKWA 2YMMA 1C7RA 2A7QA 3E22A 1J5EB 5L7YA 3R07A 3CRVA 4BBAA 3HVJA 2QNBA 3P5BA 1Q1AA 2WKPA 2XQJA 5A7HA 3REXA 1FB5A 4DV4B 5HKLA 3E7PA 4WCDA 3HI6A 4QRHA 3E18A 4Y1RA 4RJKA 2DF8A 3H75A 3QPDA 2FYKA 3REOA 1N25A 5CDFE 4CF7A 2QX8A 2ZI9A 4XVQA 1B3RA 5E3HA 4YT4A 5K5EA 1EQAA 4FR5A 2YRFA 1E20A 1NR1A 2EFHB 3GXOA 1A7UA 4RZIA 4M0MA 3DEZA 4HWSA 5JYCA 3RG8A 2OVBA 3RAPR 4FMCB 5G2OA 4L0DA 1JFTA 2PSHA 2OLEA 1X0VA 4ESOA 4ND4A 4RQTA 1RWMA 4LTMA 1M8KA 1Y9EA 1DTWA 3FLAA 1VJ1A 2Q50A 2R62A 3DZKA 3OUZA 3FOEC 4U2BA 5CM9C 1N5JA 3RF1A 2P3QA 4EGFA 2X8WA 2YDYA 1YZ3A 4TMVA 3TM5A 4BVBA 1GXSA 4RK6A 4Z49A 2IPMA 1XN4A 3KAPA 1V9CA 2ARUA 1OT5A 1M6VA 1SBQA 1XZAA 1YVEI 3PSHA 5IM4F 1XZGA 3OJCA 1XDSA 5JWRA 3GLFA 2HQRA 4OQZA 5AVWA 2KQUA 3G13A 3MJHA 2PGAA 4X1KB 3CN7A 3RASA 4X20A 1XJWA 1KI4A 1KI6A 1P7YA 2Y66A 4RTRA 3P8ZA 2ZU0C 1HYHA 3DBHB 3ORYA 4DTIA 4DDMA 4ENSA 1RKXA 4ZV4A 1I6LA 4AMUA 1G5TA 5DOVA 4EQ6A 1X54A 1KBQA 5D6OA 3EEIA 4MQ5A 1FU8A 4ZD6A 3WGMA 3QHAA 5K8CA 1E8MA 3SBDA 1KQGA 3ZJ5A 5ALJA 1GTG1 3REFA 1Y6RA 1RXYA 3FI0A 3QOFA 3JU3A 4A2WA 2IZ1A 5B7GA 2JCVA 4CM9D 4DIFA 1A82A 4OLHA 3AHGA 1XZ8A 1BMQA 3O73A 1R66A 1ADGA 3OC0A 2FP3A 1KE1A 4Z4GA 4EGSA 1PQYA 1LYLA 2NUPA 3GJ0A 1V7QA 3EN0A 1EA5A 3E35A 5EE5B 3ENVA 4L9RA 1GZ4A 4D56A 5F2OA 1VP9A 2IU6A 2K7ZA 2PQMA 3DHNA 4BPBA 2B8TA 3EULA 5BQ3A 1YAHA 4MTCA 3EVZA 1EEHA 4GIBA 1L8XA 4C1BA 5DM0A 3HDQA 3IVAA 2GD2A 4EJFA 1RYNA 3KX2A 4B7UA 1W0JA 3DMFA 1EWVA 2H29A 3O2JA 4E08A 5KOJB 3MTGA 4RD6A 2WWTA 1SVOA 2AL7A 2BFDA 1AN0A 4XA8A 3PDIA 4GLOA 3ADDA 2X9LA 2P6OA 1N9GA 2PR7A 3GYGA 1Q0ZA 5KSZA 3HP1A 1XYVA 2W70A 2HAEA 2ZI6A 3E70C 2EJBA 2P9ZA 3A4VA 2BYTA 1A50B 1QH1A 4G5GA 4V03A 3QVJA 1BD4A 3HBMA 5KHAA 1LDGA 1G2QA 1ECJA 3T3OA 4B9EA 2H0QA 3QI7A 1ECCA 3WSWA 4DRZA 4RMFA 4HMOA 4HZGA 3AEZA 1R3UA 1T1RA 1YQ9A 2FEOA 4GH5A 4CKBA 3TIFA 3CLRD 3CR3C 3SQMA 3IEMA 2E7ZA 1UKZA 1ODIA 4ZA2A 2AMYA 1XYGA 3KLBA 4U4AA 4ZOEA 1B6TA 1D6JA 3MQFA 3WHKA 4EPXA 3SJBA 3TL3A 5DHQA 3KCNA 3WXBA 4FLEA 4YRSA 3MOSA 5JZVA 1RBMA 4O5AA 1ZRHA 2P79A 1GQQA 3O9MA 4GOOD 3QF4B 4JVLA 3R76A 2XT0A 1Z2CA 3DH0A 3TGLA 2XAAA 3FCEA 1PV1A 1P2GA 4Y9UA 5COAA 2OOSA 1IB6A 3R6GA 2QTCA 1NVXQ 5SYAA 5EHZA 5SZHB 4F2DA 2ZYTX 2QX4A 5CBKA 1HT1E 2NP7A 4DYVA 4LNHA 3SYRA 1FQJA 3AHJA 3EFOA 3COJA 3TSCA 4PSCA 3NU1A 5CVDA 2RK6A 3M2PA 1NVMB 3D1VA 1QM5A 1T9BA 2IBMA 1T5DX 4IM7A 4NEHB 4HNAB 4P35A 4AN4A 2HWYA 4CZ2A 2JKYA 3IBCA 3QUCA 2JC3A 4K3VA 3ZU4A 4E2YA 3UBTA 1YAJA 5CM8B 2JFWA 3KHSA 3N0XA 2XGTA 5TPWA 2HQBA 1KDVA 4D3YA 4O3FA 1GTJ1 5F12A 3TZEA 4DWOA 3EEQA 1DIHA 5JRDS 5KZMB 4KQEA 4Q19A 2WD9A 1JX6A 5AM0A 3ZTWA 5DWVA 3U49A 4PC6A 5ELLA 5GY7A 3PNOA 4G4SP 1TVKB 5JXWA 1YH3A 2XITA 4KE9A 4ZVTA 2EOAA 5IMBA 1RLIA 3V46A 5E8RA 1UADA 5J4VA 1AMUA 1VQZA 1JEDA 3IPLA 3CZ4A 4QNRA 3X1MA 4F4FA 1XSEA 3D0QA 3MELA 3FYUB 4BZWA 2QI9C 4DCMA 1M7HA 2H11A 1MXHA 3D6NB 5DMHA 3OY7A 5IDQA 1G3MA 3I5MA 3FOZA 4JV5B 4FN5A 4CW7A 2F6RA 1DCMA 2QP4A 3MJSA 4TQGA 5KUTA 1WE2A 2FUG1 2XVAA 4DQLA 1VLZA 1C0LA 2C8MA 2JI8A 4ILKA 5BV0A 5TLSA 1YCHA 3PUWA 2DPYA 1PX0A 1BKYA 4CEIB 1OY1A 3ZHRA 3OKFA 4LVCA 2NNLD 3ZYCA 3WGGA 5AK4A 5JNVA 2ECPA 3VAAA 4F56A 3GZNA 2JHGA 4XIIA 3UMYA 3KJEA 1XCOA 5HUJA 3BMOB 2DLCX 1GA4A 1GGHA 3DPUA 3FPHA 1AGRA 3LFHA 4W5HA 3PU6A 4CGYA 2AKEA 3SIWA 1WPGA 1XB2A 3R1IA 2JCSA 3CX7A 2VDKB 4HS4A 2FN4A 1T9CA 2DTDA 3KQMA 2JJMA 1OHHD 3WADA 4E5MA 3NWJA 1OXBB 2C4NA 5J1TB 1IMJA 5EIWA 2E1PA 1PT7A 4FDMA 2QVZX 4L3VA 1G4AE 3GH3A 1I2MA 3FYTA 5HQJA 4WWHA 1H4SA 3C3BA 4UEQA 2IHZA 3AUTA 4KQGA 2EWNA 4NULA 5ABPA 5EJ6A 2J85A 1MLDA 1QHNA 4M22A 4PLVA 5AR1A 3VAZA 2ILVA 1QBGA 3MJTA 1AM4D 1XUOA 4CM8A 2H1IA 2B8WA 1BS9A 3K1YA 1KVRA 4YCAA 5HF9A 5K4AA 2HC9A 2PJUA 2VBIA 3LC7O 2G4LA 2QRZA 4QU9A 5T7BA 4L16A 4ARCA 3JQEA 1ZH8A 2HOQA 1C9YA 3AVWA 3W8RA 4XM1A 4DSOA 1PZNA 1M8JA 3OI7A 4N47A 1EUDB 1ODCA 3LDFA 3WI7A 3NPMA 5E6SB 2FHSA 3FWKA 4H3KB 4O1HA 3P9NA 3W9UA 1R0BA 2WV7A 3GQBB 3I7FA 3BMQB 2JAXA 4G86A 1L9KA 3IBFA 1XQWA 3VHQA 4U1RA 2DAPA 4Z0NA 2FGKA 2ALYB 2VT2A 1NULA 2DYKA 4JXKA 3CBGA 5THQA 4KMSA 1ZN7A 5DI3B 4YP0A 1FFWA 2ATIA 3O6VA 4F8YA 1HH4A 1DOAA 1Z0KA 2QQEA 1MC5A 3C8MA 1Q1GA 2Z83A 2F3UA 1C9JA 3G1UA 3NC1C 3UUEA 1YIOA 5CITA 1ICEA 1E5QA 2WI8A 3EWNA 5IYZF 4O2BF 4AIIA 2GASA 1CRWG 4KQHA 1AG9A 3CTPA 3FCYA 4LJYA 4MP3A 2ZT8A 1JIVA 1QFYA 5LYJA 4F3KA 2NUBA 4XCVA 1OX6A 4HWTA 1SIUA 2XXJA 1CIPA 4OHVA 2WNHA 5FRDA 3SXJA 3TKAA 4F4UA 2V98A 3L8ZA 4TOIA 2RK4A 1QKKA 3B51X 1TL7C 3BHNA 3WQBA 3QNEA 3KDSE 2FR8A 1EBBA 1UPAA 2FFAA 4NBVA 3C87A 3S5JA 1WB6A 3K09C 4J6EA 1NN5A 1GGVA 3A36A 1VC2A 3KT3A 4CKCA 3D2AA 1SEVA 2WDPA 4RETA 5C31A 3AU8A 3CZ5A 3U7HB 4I7EA 2J5BA 821PA 2FRVA 2H1RA 2W48A 3FBGA 2UZ0A 1KORA 3U4AA 1G5HA 1Z37A 3IE2A 3NT2A 5ALYA 4ZHQF 3Q8KA 1LJUA 2CNKA 1AV6A 2J0UB 1ZC3A 1N6IA 1YKFA 2L2QA 4KMMA 2XRFA 4KUEA 1KIAA 4TQDA 3T9EA 2FQ1A 3OOYA 2VP4A 4EW2A 2OZVA 1U3TA 2HMWA 3Q9SA 3A5ZA 1XRLA 1NR7A 1PJZA 1P4AA 2UUOA 4JVNA 2ZCVA 2E4XA 5SY6A 3E7DA 3EXHC 1AKYA 3W5UA 3ZXSA 2BSQA 1C1XB 1WCIA 2XQFA 3RS7A 3DEHA 3LCUA 3F6SA 4GL2A 3OPNA 3SJAA 3L0SA 1FVFA 1VTKA 1QRDA 3GDHA 5A6SB 1IN4A 1NQWA 2ZWOA 3CVXA 2ZSUA 1PBNA 2DGDA 3KAQA 3NFRA 2HK7A 4X1YB 6YASA 2CLKB 2EBFX 5AKEA 2J7PD 4MWCA 1LBTA 3GJ7A 1NUHA 5ALRA 2FPSA 1KI1A 4B5KA 4V0LA 3PEUA 4UBMA 3TPFA 2DJZA 1OASA 2AMJA 2IHJA 2OHOA 3FMVA 3KOZA 2AT1A 2I76A 1N6KA 2YJNA 4HGZA 1TUBB 4C06A 4JLSA 3MBOA 1UBUS 4PFSA 5EKXA 1K66A 4Y9TA 4YS6A 5EYPB 4MRAA 5CT6A 5LJLA 4GMHA 1TF5A 2XDAA 2FUG6 3F0TA 4FX2A 4E2XA 2P68A 1EE2A 4KIGA 2J67A 2IY5A 3ETNA 3LW7A 4IJ5A 3QEBZ 2ZIEA 4PZDA 1DQYA 1E4EA 1K88A 4PYRA 4HB2A 4DEVA 1FSSA 3COZA 4Q18A 4CMIB 4EVIA 1N5RA 3PICA 4FFBB 5H16A 2VYFA 1NLYA 2CF6A 4AYWA 3OT4A 5CR9A 1BN6A 3KQWA 1O87A 1K7EB 5K20A 2OGUA 1BCSA 2L82A 2I2BA 3RODA 1ZNWA 4X6LA 7AT1A 2VSQA 3IUBA 1G20B 4WNAB 4OP2A 1UJ2A 1Q5PA 1KDRA 2Q7EA 2BBOA 2FW7A 3ETLA 3G9XA 5K0GA 4NS1A 4WCFA 3HO1A 1GV0A 1TECE 4WZBA 2IH4A 1S0UA 2BCGY 4AXXA 1ULAA 5E2IA 2DTXA 1QGYA 1MEEA 1U7XA 3LWDA 4DAEA 5HVNA 2W42A 3ZVMA 1NQOA 5KVVA 1QHXA 1G19A 4J0CA 5ALVA 3SFZA 3P2KA 4MKFA 2DQ0A 4EDFA 2IYQA 3NHUA 4BNTA 4JLWA 2VJOA 1Z0IA 1LTHR 4H7HA 5KMGA 3K70C 2XXAB 4V1CB 3VDNB 4LV8B 4LC1A 1NY6A 3ICPA 4H2TA 2P11A 2HU8A 2WHPB 4BMDA 1UPBA 4DEYA 1UPFA 2N3ZA 3E8SA 4ENUA 1U11A 2Z8YM 4KVZA 3PYLA 4BC1A 5CB4B 5HZMA 1OILA 5JSZA 2ACWA 4U7HA 4PNPA 1TD1A 3DDSA 1E7SA 3M33A 4HZIA 2XUAA 2XUPA 3I1JA 5FNVB 4DBLE 3UJ7A 1N3BA 1AT1A 2PFGA 4XQGA 5CFPA 2CUTA 1YUNA 2QM0A 1U81A 2QYHA 2BIFA 5K3FA 1Q20A 5TQ2B 1UXHA 2HCJB 3V4ZA 1QF9A 5IAJA 3ETGA 3Q3JB 1IG3A 5C7YA 4II3A 2BKLA 5DMXA 2IQIA 1EMDA 3JZFA 4G0YA 1FTSA 4PXSA 2ON6A 5ECDA 1Z47A 1OFUA 5HGXA 1RFGE 1XALA 5TVKA 4XWAA 3LGXA 4MS1A 4AZ0B 4TYYA 3WAKA 5EHNA 1J2JA 3W4IA 1ATIA 3WSVA 5TMPA 4PWYA 2GPYA 3RC7A 4AMBA 3GB9A 3RKYA 1QYCA 2GNOA 2X9VA 1T5IA 3A4MA 1NOIA 2P5IA 4WZAE 1VA4A 5CLQA 2FDRA 1SOAA 2J9XB 1P31A 4AH6A 5GAJA 1WB4A 3L8MA 1RYEA 521PA 2ZUEA 2FLKA 5EAIA 1VL2A 4J76A 5INTA 2H2WA 1M2VA 3CH5A 2O57A 4MQBA 3WRYA 1ZX1A 2ZINA 5KQLA 1IJBA 3I28A 4DARA 2P5UA 1REQB 2ZBQA 3GNSA 4BCDA 1ZM7A 3DUFB 2QVLA 4ZQCB 3VDXA 4YCCA 2J0QA 1XG5A 3JASB 5E6UB 1TQ2A 3ED1A 3RU9A 4D9IA 2GAIA 3H5OA 1Y6QA 4E94A 3G2OA 3JYLA 4UTXA 4RSGA 3WLJA 4IIDA 3BOSA 5BRNA 2R00A 5BSUA 1YRYE 3ETCA 1PSZA 3AH8A 4YGYA 1O6BA 2Q5CA 2ZDHA 2NVOA 4IV0A 1QAQA 5DJ5A 3EC7A 2PKQO 3Q8XB 1F0YA 4A9AA 3RTDA 4CKEB 2Q1SA 1ZVMA 5TARA 1USIA 4B0OA 4OX9B 1MR3F 2MSNA 1YQEA 1Q84A 3EQ8A 1MIOA 1O9GA 1S8NA 4PHGA 5AKLA 5B1SA 1IY0A 2AZMA 1RKQA 3GRVA 3ADBA 2PSEA 1H93A 5LDDC 3ENQA 4X3CA 3ZY4A 1UJ5A 2BSXA 1B2RA 1GPUA 1JSLA 4E7PA 1AJEA 5EWLB 2VWPA 5LD2B 4HPWA 2FVXA 5AKIA 4IUBS 2W6JD 2P2NA 1RU3A 4OP0A 2AN9A 2C59A 1KO8A 1XTPA 4L57A 4EOGA 3NZEA 1ESEA 3GMTA 2EKZA 5DXFA 5A0VA 5JJIA 3G8CA 3MRTA 3OQ1A 4JHLA 2GJ4A 3D2BA 4E1BA 4AL4A 3VU3A 1WSWA 2XUIA 1NN0A 4YJ2A 1JEYB 1EK0A 1II0A 1ZJ5A 3DCYA 3HKBA 3OSUA 4F5ZA 3ZVKA 1N77A 4MUEA 1IQUA 1RRFA 5F5XA 4GP6A 3HJRA 1DRVA 3ABQB 4F11A 2XA2A 3MVEA 2DKGA 3W2IA 1SHKA 3WLPA 1FDRA 2EFGA 2VP2A 4N3NA 1L0BA 1B4DA 4ZYTA 3BMCB 2YXLA 2H07A 3JPWA 3PYMA 3G5MA 4XTZA 4QG7A 3TK1A 2G70A 3L6RA 1J0DA 1HZZC 2WJYA 2YV1A 3B85A 1L5QA 2GRAA 2XNKA 3EIXA 5DHTA 4P7JA 1KVTA 2G77B 3MS2A 2RMKA 4HTFB 5TVGA 3OPVA 4E07A 4EX6A 4NV0A 4ZMBA 5KDOA 1KXZA 3I39X 1Y7PA 1BVRA 1QQ7A 2OCIA 4MK4A 5EHXA 3DZFA 5IULC 1QQAA 1JP7A 3I5UA 3TLGB 3HHPA 1Z5PA 2ZE5A 1GCIA 1VRVA 5EMNA 5H0IA 5DTQA 4CT5A 1BWSA 1LI5A 1Q50A 3E7WA 4FFNA 3S81A 3TKYA 3CV3A 1JH8A 1E77A 2OHIA 2WFAA 3VDQA 4ARVA 3EGXB 4BKMA 1QPGA 4UCFA 3MF4A 4K0KB 2P6PA 3FMIA 2G4CA 1TKCA 1XJCA 2Q8PA 2X9GA 3IV7A 4HGOA 5B3AA 3ZY6A 1BXGB 2XNDA 1SZDA 3WB9A 4ACBA 4EAQA 2FN3A 4W5JA 1GARA 5BOSA 3I9OA 3SM9A 3LZ6A 2P7IA 1P1JA 4MPTA 4G5HA 4Y0VA 3AI1A 4RMJA 1Q19A 4ZYVA 4O4IB 1R10A 3B5IA 1E4VA 3PP8A 1LNQA 4P4TA 3WGJA 1ZMBA 2VZ0A 5DI9A 5FOSA 4GI3A 4JI5B 4MO2A 1V11B 1R0XA 3EPRA 1J9GA 3FDZA 3DT8A 3GV0A 2JCGA 1VBNA 2XD4A 3QX8A 1YVPA 2EQAA 1BDIA 1CS0A 1ICIA 2BH2A 1GD1O 4L4YA 4EA6A 1XRSB 3P97A 4RKFA 5ILOA 3KYDB 1WMEA 4MW0A 3UEOA 2VTBA 4KQFA 3ER9A 1IOZA 3LYUA 1S1MA 4YCDA 3CEPB 2UDPA 3COWA 3VMFA 3D6UA 3GYBA 4N8EA 2B8EA 3CNHA 3GPBA 1FDWA 3H16A 5EFOA 2HNAA 5CBPB 2WM3A 1V3VA 4AUMA 4QNNA 2C7IA 2ZJAA 4JXZA 4RAQA 1Y6FA 1FTWA 1KI9A 2V4MA 4LOJA 1VLQA 3CX8A 4MVCA 4FC6A 1KQ3A 2JGIA 1GITA 5KNBH 2A3NA 1M75A 3QIAA 1DXHA 1HL7A 2C57A 1BA3A 4AVYA 4GZMA 1VE3A 2RK3A 4G8DA 1TKAA 2FPPA 4WKOA 2P2YA 3N2EA 2P35A 3ET5A 3OP4A 4IJKA 1ZMXA 4UNPA 3A1DA 4R2LA 1T24A 3OWXA 2BUCA 4FD3A 4EEXA 4EGCB 3UMMA 2PKRA 3OFJA 1I9GA 2SICE 4K8OA 1L7XA 3FNRA 4D41A 1E1RD 1J2YA 2E82A 3RGWS 2R5FA 1PJ4A 2COKA 4TV8B 3M4JA 1IVSA 4TL8A 3AETB 4OHMA 4PC2A 2HA5A 1GHTA 2HMVA 2VF8A 3U7IA 2RBKA 1NOKA 2ZR0A 1ZITA 2JW5A 2LD4A 3OT1A 4J0JA 4RHEA 4IDPA 4JSTA 4LWZA 3LQYA 2BFFA 4Q82A 2XTMA 4B6FA 1DAGA 3MCUA 2AXQA 3Q7EA 4LCEA 3IDSA 4FZ3A 3EF0A 3GFTA 4JT4A 3KVOA 4JA2A 1M1ZA 2E4UA 4OHUA 4OHFA 2BY4A 5K0FA 1Q3TA 4TXHA 2ERCA 2R8RA 4FGLA 1MAVA 5AIBA 1E9VA 3Q9LA 2FZ4A 2OMEA 2F9LA 1CE8B 4IHJF 4JJ6A 4L50A 5A5DA 3QU4A 3K3PA 4WJ4A 4FIDA 3V6LA 4OIMA 4IIFA 1IRXA 3G1ZA 4ZT6A 5TQJA 3A31A 5KYWB 3U4DA 2W6PA 4Y6PA 5JH7F 1YONA 3BXFA 3BKXA 5U4QA 2ID8A 3D8TA 1KAMA 2P90A 3WAGA 3NQ41 2ZJ3A 1P17A 1MVNA 1W0CA 2VJKA 3ISVA 4Z86A 3RYIB 1DEOA 4K6FA 1FMFA 1V4BA 3FPFA 2FOLA 3QVKA 2Y9PB 4FZJA 2G9QA 1NVAA 3GT7A 4G37A 1L8QA 1ZFNA 4WT7A 4MVJD 5E3JA 2JD1A 4ZT7A 3HDJA 1J2UA 1FP4A 4EJMA 2Z2KA 3PXEA 4M6WA 1TE2A 5SICE 3T5GA 5JNSA 5CVJA 3DHEA 3ZE2B 4IVPA 2GVDC 1DOHA 5JZMA 2CVHA 3RDPA 1N8SA 1RABA 3DE4X 1PVDA 4IDDA 1U90A 5GGYA 3HGQA 3CKLA 4S05A 2G5TA 3BFVA 3ZKWA 3KBBA 5BUQA 2P27A 3L6OO 3SJUA 1OBCA 4EECA 2OBYA 1T9GS 3MAAC 4QXOA 2BAGA 1E0JA 5CNMA 1M1YB 2UZ1B 1W30A 2EKDA 3FMFA 4A7PA 4PZPA 4Q0MA 4URWR 3UA4A 1VECA 3AUFA 3AGPA 3D2LA 1C3VA 3V4RA 2CMHA 3DHYA 4X7MA 4A16A 2H59A 5BSGA 3M5DA 3F73A 1NFRA 4E32A 2B1IA 2P6UA 1UWLA 4XTXA 1YTUA 2OCKA 2OCAA 2NZJA 1DG9A 1VSTA 4QASA 2HWXA 3NASA 2XE4A 2IIBA 5ECYA 3GAAA 4B6PA 3FNBA 2QRUA 5DO9A 3LL4A 5K0ZA 4RQEA 3GL9A 2RHWA 3VGJA 5JAMA 4DE5A 5L9AA 4RGYA 3ZDQA 2YVAA 2FWPA 2AD5A 2QP3A 4FU0A 3JAMA 4Y6OA 1A1SA 1SB9A 4MP8A 1ELOA 2QRVA 5L3RA 1IRIA 3RS5A 3IG2A 4DQ2A 1T6XA 1YD7A 2IIPA 3CEHA 3EBPA 2HLDA 4GNKA 5JDCC 3T3MB 4XLTA 1N2CB 4TKZA 1OBOA 1U98A 1BMTA 1JHUA 2IEYA 4I4IA 4WERA 2O8CA 1KQOA 1ADBA 1KI3A 4XUDA 4EEZA 3RSSA 3BJUA 4KR9A 2H2IA 4H1HA 2OP1A 1YRHA 3EGWA 4OXIA 3USCS 4X93A 3VSBA 2RHHA 4DR3B 1NPTO 3KKQA 2IITA 4TMKA 4DMCA 1E5TA 1G3UA 1M2NA 2E64A 3A4NA 2ZYUX 3DJYA 1YOVB 2XB8A 3O4RA 4N7MA 2J9ZB 3OPYB 3TI9A 3VJLA 1YS7A 5JADA 3LH5A 2VDLB 5EQDA 3GLGE 3MWLA 5A5EA 3CC8A 3RVDA 4WGGA 1QP0A 2FK7A 5ALXA 1VMIA 4GOND 4P1ZA 4HVLA 3W77A 4YYEA 3AERB 3NNDA 1OYYA 3U09A 1GNTA 2DRIA 1YFJA 4RYLA 3K8YA 3AT1A 3JD4A 4HX9A 4OSEA 3UMJA 4BWFB 1C1HA 2QN2A 3E22B 3H4MA 3LOQA 5A5VA 2AW3A 4M1ZA 5TMBA 4AUEA 2PXHA 3LTNC 1BDBA 3BJRA 4LQLA 1BRTA 1I7NA 4TQAA 1MAAA 4E3ZA 4B6SA 1P81A 1SXJC 4Y1RB 4DCTA 2ZCEA 1EK2A 3TI7A 2IDMA 3D9QX 4GM1A 5F1KA 2B34A 2GZAA 2HRDA 5BSEA 5EIBD 1NKTA 3FPGA 4QDOA 1AH2A 3VR1A 1WZ2A 4CH3A 3ZR4B 1BN7A 1HYGA 4K1LA 5B36A 5JALA 2PLWA 4Z53A 1UPXA 4QE3A 1IPFA 2B20A 4RMGA 4NICA 3C70A 4D9JA 3LHSA 1DTWB 1F8XA 1Z07A 2J3IA 3V7WA 5C1DA 1PJRA 3MLAA 4XVHA 3D7RA 5KWIA 1C29B 1LD3A 2DLNA 4P3PA 1GXSB 2YWCA 4ZCQA 2J3MA 1BMFA 5FI5A 2JFOA 3WO1A 3TLKA 1M6VB 2WMNB 1YFKA 3LI2A 1E79D 2OFOA 4FQ8A 3HDVA 3MINA 2CXSA 2Z04A 3L6DA 2PNJA 3K09A 4KYVA 4UVIA 3GLFB 1NW8A 5C8ZA 4D74A 1W48A 3DVQX 1PDOA 1PNTA 4PSVA 4WRRA 3LO8A 3PL5A 2W6NA 3IOMA 4X20B 2QTBA 1WEHA 1KI6B 1ORDA 2P5TB 1X6VA 1SUSA 5ANRB 2YJ6A 4RA6A 3W05A 3P26A 1BE1A 1H2BA 3OU2A 1IWPB 2Q4TA 5AHOA 1N1GA 1F8GA 4EQ6B 3GR6A 3P9ZA 4X54A 3GDGA 3JQFC 2OLJA 4PG8A 3U3XA 4MKZA 3PGLA 4Q1DA 2EL7A 4KQXA 4P2GA 4BNWA 3QOWA 2PYDA 1Z7BA 3EXHA 1Q7GA 3AM4A 1SCKA 2OFXA 2PJRA 1PYSA 1PR1A 2WK1A 3K7EA 4TS9A 3UAWA 2CEAA 4ZJUA 1WXIA 3ZWQA 3EMVA 3LPMA 2B1RA 2C4WA 1KBOA 2QR5A 3HPRA 3T7RA 4CDMA 2HSEA 5KSWB 2NUPB 3O75A 2YX1A 2P2GA 4NV3A 3DZIA 1V71A 3PQ8A 5DLEA 1G8JA 1JYEA 2A1UA 4KRGA 1TM2A 4Q39A 3R3ZA 4KX5A 3BIFA 1IZZA 2K6GA 3TGWA 3JW8A 3ZBQA 2CD9A 3KSMA 4LXTA 3D59A 3ZCTA 4ND3A 1LDEA 4OHXA 1PQ4A 4U9HS 3OG9A 5FV7A 4Z4EA 3OZTA 4PYIA 1VHWA 3HJHA 1MZPA 3K15A 1IJEA 1HTWA 1BHSA 2VPTA 3B1YA 2OZEA 1CRQA 2BFDB 3PDIB 2QGNA 1NP3A 2X1LA 1N9GB 3E81A 1QTNA 2ZDQA 2I1LA 1CD5A 1P9OA 2GK6A 5GJVC 2V4UA 1QH1B 2C2BA 4HFNA 4LYFA 5AHRA 4D42A 1Q92A 2WQZA 3EEOA 2GHRA 4MMXB 1SOUA 2RONA 4QATA 3S1LA 3HK2A 1AO0A 3LYAA 3NM5A 1V26A 1RRVA 2ZGVA 4K6CA 3UFXA 4WBNF 5C34B 3UO8B 1W8DA 1D0VA 1GPJA 4CKBB 2V5AA 3AUJB 4GUAA 3PFFA 3OQJA 3QFHA 4MPJA 3V1TC 3AY0A 3NPAA 1K6JA 2PS0A 1W87A 1BYIA 3BMXA 3N3BC 3TEMA 4BQOA 1KY4A 1NNLA 1R00A 4Q3DA 3VMMA 6CHYA 1AKQA 3HYCA 1DC5A 2PMDA 2FEKA 2PKYX 4OK5A 5L3VA 4NNJA 3FSRA 4B3SB 1TEHA 2QUZA 4LSGA 3RU2A 4MDEA 2FFBA 2OO7A 3FVWA 4M0EA 3RVLA 4LV5B 3WL6A 5DP1A 4EFMA 1Y4AE 4QFMA 3IGFA 4RVGA 2X2EA 2QL7A 1TU0A 2A58A 3MGAA 3ED5A 4JVMA 1VBKA 1SY7A 4TMFA 5JAQA 5I3ZA 4G9EA 4XQ9A 1W96A 3SHOA 1DLJA 5KIAA 5FTLA 3U3RA 3ESCA 3EFOB 1BBUA 2X22A 1OTHA 3ESZA 3NAZA 4W1RA 4XIGS 1GEGA 3WQSB 3OX3A 1ULSA 4GPEA 4PU0A 3BH6A 2C3YA 3LBHA 4NE7A 1XFAA 2D2IA 1CFJA 2XW6A 3ZS9A 5F2EA 4HAIA 4E46A 4BV3A 1WETA 5HGQA 5TPWB 1EXVA 3UW1A 1L6IA 2HQOA 3DW1X 5FBVB 2RG7A 2FN9A 3UJCA 4G89A 3REQA 1MENA 5LQDA 2E1HA 2I4OA 1E66A 3KFVA 3ZJUA 1EXMA 1YBHA 4LY3A 5HOQA 5CD9A 3NHLA 4ETMA 2XNHA 3ULKA 3ROPA 4ITVA 4ERXA 4CM5A 4MVJM 3IMKA 4JI6B 2AUMA 3TQIA 4WF2A 2RI6A 2HX1A 2QPLA 3PUKA 1HLDA 1PT8A 3GELA 3LK7A 1T4DA 2REXB 2MJLA 3MT7A 5C51B 3DLCA 4MJLA 1G63A 5F33A 2ADFA 3WWPA 3NOVA 2IYYA 2CVFA 1G3QA 5DN6A 4RPKA 5J9FA 4LZZA 1J5PA 2GLTA 4DHWA 1JDTA 2HPZA 3AI7A 4X64B 1DBWA 3P2MA 4C7VA 2IS4A 2P77A 2QZ4A 5BSMA 1ZM3A 3D3EA 2F7SA 3KV1A 1A8PA 5FPPA 3WL7A 3CVWA 2TMKA 3LBFA 3FDXA 4LXXA 3WQQA 3ZDYB 3LX4A 1QYVA 3E8XA 3IR6A 3QPUA 3DL0A 2V58A 1ZM9A 2ZRPA 1QOPB 3GZJA 3GZNB 4YCMA 4W9RA 1HKUA 1UXKA 2QX7A 3FBTA 1J39A 2GXSA 2G9UA 4HDKA 1JU4A 2AN1A 2NO6A 3L84A 4LUCA 4BL5A 4D4IA 1O58A 2JHFA 1ESDA 1DIRA 4EUEA 3PCOA 3HZHA 3V6MA 5M34A 1N34B 3N70A 5C1BA 3BSSA 1MORA 4IDFA 1X77A 2IHYA 3EXFA 2XUJA 3KZCA 3M6UA 4TMYA 4DLAA 5JUWA 3MTQA 3PWKA 2O8NA 2BUBA 2QN9A 4ND2A 2OBBA 1XK7A 3RAGA 2CFSA 1XF1A 2H18A 2W6MA 3PFCA 3DE7X 4LHWA 4PLWA 3I8OA 3LT4A 4AECA 4CM8B 1W49A 4E5SA 4QBHA 1Y6GA 2ZZNA 4QYWA 2J4FA 1B8OA 3OFNA 3ZH9B 4G97A 421PA 1U0GA 3PENA 1H3FA 5LL6P 3B6KA 1NAHA 3FIUA 4GF5A 3F7MA 5AJZA 2A86A 4B71A 1T1EA 3E3MA 3TWOA 1SZJG 3I8SA 3VU9B 5IHXA 5IMSA 3SR0A 5IM4A 5CK4A 1S5PA 2LWIA 2P0YA 3AEYA 3FDFA 5DX8A 3N8NA 3VDRA 4DSZA 1ECFA 2MYUA 3AUAA 4KHZA 4MIEA 3V4OA 4F12A 3RFVA 3EUAA 1Z12A 1FUUA 5AESA 5K3EA 2GD0A 2ZE6A 3DAYA 4CIXA 5LMZA 2VKTA 1W5EA 1NI5A 2NXWA 4AJ4A 3A1WA 2IT1A 4WOCA 5E0OA 5KC9A 3RANA 2BFCA 2G4VA 5DNCA 1P7CA 2LUOA 4D8XA 2X6QA 3CRW1 1CY8A 2YWHA 1XL0A 4LBYA 1FSGA 2AVDA 3H5RA 3QMMA 1US8B 1X7ZA 3WL3A 5LYJB 1J49A 1QZ3A 1UAGA 4KAAA 1URPA 4KTVE 4PSDA 3G7SA 3U44B 2ZREA 5CFLA 3TTTA 4NEGA 3WTBA 1JEQA 4OYLA 2V7TA 3O38A 2HQSA 5D3KA 2HA0A 2PH3A 1G8PA 1R6VA 2YIJA 1N92A 1USVA 3EAGA 4KE8A 4HQNA 4Q7KA 2IP4A 4AXBA 4BLWA 2PX0A 3GRYA 3L77A 1E60A 1BJKA 5HS6A 5BR8B 1GQ2A 3H9GA 3PXCX 4W5WA 3IEIA 3T61A 2OENG 3BTSA 5BWBA 3RRJA 4P80A 3K32A 1D2GA 1PG5A 4IDQA 1TM7E 2OQVA 2VJQA 5CFNA 1I14A 4GDFA 3BKWA 3UN1A 1MJFA 2JVKA 5P8WA 1PJAA 4QGHA 4Q1EA 1NVEA 2XKJE 3IV9A 1NVUQ 1W94A 4C6RA 1AHHA 2C03A 1ZXLA 5EVCA 5LQKA 4JBXA 2ZRQA 2F1HA 4W6QA 2E4VA 4AQDA 1N33B 2ZR7A 1PR0A 2OCXA 1R0WA 1DKPA 1WCIB 2VDNB 3CLSD 4M1EA 3I3OA 3VZPA 4NCKA 2O8BA 4C20A 5DTIA 2RGNC 3JQ6A 1XQ9A 4O4LF 2HBRA 4BW9A 4BFXA 1E63A 3CSDA 2PV0A 3LSYA 3EZYA 2CJXA 4DA7A 2ZRJA 2CWWA 4WMLA 5FWAA 2Y1XA 1SCUA 2EQBA 4G0NA 4RLHA 1NHWA 1UMBA 1WXQA 2UVQA 1VBFA 1X7XA 3HB4X 3TPCA 5IVIA 4XCQA 4ZYLA 1JIXA 4P5EA 3X1JA 2JIZA 1VOTA 1AKVA 1TA9A 3R41A 3L9WA 1KU6A 2DXTA 5DBEX 2HDWA 2FEMA 1GKYA 3WJ1A 3EIQA 3M6FA 5FT9A 3IMFA 2B9VA 3FD8A 1RLMA 2WWHA 4KO3S 4RKWA 5J5AA 3V97A 1Y5NA 1L4GA 5BT8A 4OXYA 4CIWA 2FWJA 2B2NA 3NDPA 4MS4A 4QWWA 1MKYA 3PXDA 4PX2A 5AKYA 3TRIA 4B35A 4PS1A 2ZR3A 3IKLA 1BKSB 4LYAA 1LBHA 1YC2A 4D3XA 4EUNA 3U5TA 3O8BA 1QHHA 1GRQA 3KXDA 1P2TA 1GZUA 3DTNA 5AUPB 3PITA 1YL5A 1WZNA 2P75A 4TTJA 3UJ6A 3O90A 1OF1A 3HB9A 4P9NA 1YHYA 4GR9A 1V16A 1F6DA 4K9KA 3ZWCA 1BCSB 1GA6A 1N2EA 1ODLA 2JD2A 3OTGA 4BNFA 4BVLA 4BMXA 2ERXA 4PVDA 5FUXA 3RVPA 5HE9A 2IXBA 2PG3A 1RW4A 4OH1A 3OF2A 4BB0A 1GUYA 4LFAB 4P73C 4KE6A 1QP8A 2F4NA 2WSLA 3EARA 3QKSA 4I36A 4WCFB 4WZBB 4FCVA 3TQHA 3VO1A 1KDZA 1IU9A 1VYVA 5IK2D 2NOAA 3GIDA 3H19A 2Y0BA 1I4TD 4ZOLB 4X60A 1ZM2A 2WOJA 2HTFA 1ISGA 2G1UA 1USYC 3X1WA 2C82A 1R0RE 1E3DA 4G0UA 3PRYA 3IOYA 1J0XO 3EFHA 3KSUA 4MQMA 5T41A 4ISCA 1LPAB 5AP9A 1KAQA 4DC0A 4LSMA 1Q2UA 1ZGGA 1WSAA 4BO8A 4BHTA 4Z1MD 3E3OA 2WM9B 5TB5A 3WJAA 4IF6A 3ZIDA 1QG0A 4MHSA 5JSZB 1L5GB 3TGPA 1YRBA 2O7NA 3E23A 5GQSA 5FPTA 5BV1A 2R6ZA 1WCYA 1OUMA 1FTQA 4QOGA 5ESDA 4BO0A 4RTMA 1KYYA 1PKXA 3KQYA 2Z6AA 3I2JA 4HXFB 4NECA 1H94A 1F0KA 4DUYB 1JFFA 4KQWA 3UK7A 5JJBA 2ARSA 5B7NA 1NJ6A 1O0SA 2F8MA 1IOWA 5EZ6B 5K3FB 3DUWA 3KOMA 1Z45A 4WJ3M 1TU3A 1ESMA 3QYPA 2WWIA 4L22A 4HWKA 3TZQA 1VCOA 2BPOA 3GG9A 1B41A 1COWD 3M9WA 5A2GA 4M9ZA 1A5SB 3GJTA 4QEZA 1D07A 5BORA 4MS1B 1HORA 1MEOA 3BJZA 4UU8A 1Y4SA 1WDMA 3NTOA 3UMBA 4BCBA 3HXMA 1P4JA 5HNKA 3BFXA 1ML4A 2JJ2D 3JCZA 3ANLA 3LT5A 1MO6A 5LB2A 5T57A 1VE1A 5CDTA 1EUQA 2C88A 1J56A 2HK9A 4BLPA 2QXYA 2Q7XA 2ZTLA 2QJTA 3BRCA 4KWIA 4QDUA 3ZWNA 4RC9A 2IODA 2PQ2A 3ZUGA 3G2MA 5AI0A 1J8FA 3T1TA 1ZR4A 1D03A 1CRPA 1GKUB 4M0FA 1TZMA 1I80A 3COYA 2VYQA 4ZIBA 4P74A 1IOLA 2ATCA 2D1TA 2VJDA 5I7OA 5IC4A 1M2VB 2WU4A 1EBUA 1UBRS 5KYUA 3CF4G 3LPCA 2O7RA 5CA0A 1GFWA 1SXGA 2HEIA 2JK0A 3IS3A 4DSTA 1DJQA 1DC7A 2FI1A 2Y6UA 4MB0A 5DHAA 2G40A 4F45A 3N2IA 3K5IA 3DB2A 1RQPA 3NIWA 4NBRA 4QPZA 1YB7A 4QREA 3A11A 2P2CA 4W1PA 4OQMA 3ROEA 2ZUSA 1PS9A 1E5VA 1J2EA 1P4GA 3B13B 3T7JA 3HLYA 3U37A 1GZSA 3AVTA 1P5ZB 3TCXB 2IXFA 4G4JA 5I5EA 2JJ8A 3N86A 1S8AA 4OKIA 1SQ5A 3RBZA 3SQNA 5BUCA 5JDCA 3U4QA 3QTBA 4IIGA 2BN4A 1SC6A 2ACKA 3EDCA 1NP6A 1MIOB 3FTNA 3KOOA 4HL6A 4RS4A 5GJCA 4XB1A 4C78A 1DRUA 1MB9A 3SS8A 4O2BA 5IYZA 2Q9UA 1HSOA 4J49A 4C04A 4B7XA 2BF7A 1PFQA 3BXEA 3PWSA 5LR6A 1EI9A 2GN2A 2ZJYA 3L6BA 3MYRA 1X94A 3PTZA 2RGDA 4L9AA 1Z6AA 3W8EA 5ALFA 1P91A 3HDGA 4FFPA 4OQPA 4J0QA 3RSHA 2XGMA 5JANA 2IHTA 3ZBTA 3ONWA 4TUYF 4OJQA 1XGKA 3F7OA 4NJMA 1DWPA 3I04M 1EQRA 1NKVA 1P7ZA 5KWSA 2HSJA 4MYTA 4RH1A 1A98A 1JHAA 3BF7A 3S68A 4AC9A 1EX1A 5A4FS 3ADKA 2JAQA 3LVBA 4YJ2B 4PYKA 2C9CA 3W1WA 4HUJA 2OORC 4BZZA 4QO8A 1YR8A 3WICA 3JR7A 1GDDA 4GX1A 4WKBA 1OPRA 2OO3A 4J9UE 3T5BA 4B4VA 1BSVA 1E1NA 2RGUA 2II6A 3HU2A 2GA9A 1W35A 2YWJA 3HKEA 4QUAA 4ZJYA 1KMMA 3MWDA 2UV8A 3GBSA 1XT6A 4C5CA 2AR9A 1GAXA 1LFDB 2Q5HA 2RGYA 4U7GA 1OPXA 2BKEA 5ALSA 1YOBA 3FZQA 3W7BA 1TOAA 4INPA 2NZWA 4X3OA 2E3JA 4G8JA 3HZRA 1NATA 5EXPA 1WPQA 5C52B 1E2GA 4L8FA 1SXJA 3V2IA 4KWEA 4O59O 3N8GA 6REQA 4ZVVA 1BO6A 5H3LA 3I6ZA 4DM7A 1HTBA 1E1MA 1ZG3A 2ZIUB 4RKYA 5K03A 4XEHA 2E87A 3K9CA 4LJ9A 3FGZA 4BX2A 1QHEA 2AQ8A 2LZ0A 4R51A 4X8LA 5FLYA 1E1QA 5FEMA 3WMGA 4ASUA 3IL2A 1ADYA 2FE1A 4W7IA 1JWAB 1OWLA 4FCCA 4A5OA 1Y1RA 1RXVA 2E6KA 5DGTA 3VQTA 2FPLA 4HH1A 2OVFA 1GOTA 2BZGA 2IYWA 3SX2A 1Y89A 4ZMSA 3TXXA 3PQ3A 1OH7A 4YHHB 3ZKAA 3JQ9A 4FW8A 4R9UC 2DWPA 3ZWKA 3HUFA 1E92A 1QHYA 2RGXA 5BOSB 4NCJA 4BYMA 4G5YA 5TF0A 3MBKA 4E33A 4AJJA 3NHBA 5CYGA 4QGFA 2AFIE 2QLBA 1DX4A 4RKQA 4BRZA 4Q9JA 1G291 4BB9A 4D46A 2XZTA 1F7VA 1EVIA 4K2HA 4I4LA 2GF9A 4N9QA 3TW4A 2IYOA 1XOIA 2CFIA 3DPSA 4HKTA 2VAPA 5EHQA 1S2IA 2DQKA 1KYQA 2JIOA 4CFZA 5EXDA 1IN5A 3L8HA 3FDZB 4V0RA 3OQNA 1K0FA 4BGDA 2GBGA 3C74A 1AKUA 2Q9CA 3B7WA 5ICCA 4L3OA 4R2HA 3UMCA 1CS0B 1DAFA 3UHPA 2VTBB 2ATEA 2GB4A 4URHA 2V8BA 1RCFA 2GEFA 4XGQA 5JBIA 2XWJI 1FYVA 2FUKA 4MJ3A 5AKZA 3JQFA 5DWDA 5K8TA 3PFGA 3TIXB 4XTCS 5FFNA 3Q0EA 4BFLA 3IJEB 1MO3A 5I6DA 4L8YA 3ZNQA 2UU9B 4B3XA 1BHO1 1SQGA 4P7BA 2QG9A 1D4AA 5BWLA 1NVBA 4GEGA 4UATA 2NU9A 2IYRA 2QUBA 2WC1A 3CX6A 4E4RA 4F9GA 1EHCA 1PJ3A 2QR2A 1SOMA 1R74A 4RIHA 2FPPB 4WL0A 4ZXFA 5EZYF 2G1PA 3TQOA 3K70D 2LE0A 2P9TA 4PPFA 2I4MA 1YASA 1MJGM 3HGTA 3V80A 3O4VA 2J41A 2YNMA 4RELA 3ZD9A 5IX8A 2B8NA 5ICGA 1CHDA 2HGZA 2IPXA 3DG9A 4ZT3A 5K6AA 3DMDA 2OL4A 1HDOA 1USWA 2Z5FA 3IKVA 3TEGA 1Z0JA 3OT1B 4EI9A 4PAGA 2F43A 4XLZA 2HXSA 2WABA 2EIXA 3B1WA 3ZYZA 2BFFB 4LXGA 4FNGA 1JR3D 4P53A 3UCFA 2J87A 2VOEA 3DB1A 3JQAA 3DPIA 3IP6A 2FDXA 3FUXA 3WMWA 5DCWA 5NLLA 3V48A 4NEQA 1C1YA 2VYVA 4ZT4A 2VPPA 4JEIA 4Y67A 3O4JA 4DC1A 2PMBA 4XGIA 2FEXA 1Y1KE 2JAOA 4BFZA 4U7WA 3U39A 3KOWA 1M6HA 5LUBA 4E4YA 1GVHA 4BC0A 2WKSA 2VRBA 4IL5A 1YUBA 4C7KA 5IUJC 1M0EA 1ZISA 2O5VA 4G0WA 1CF2O 3WBKA 2FCRA 2PRJA 2FJUA 3GT0A 4CXMA 1JPVA 1EX7A 3RJTA 1AKTA 1XTBA 2C2KA 2G3YA 2ZATA 1B0UA 5FI0B 2R11A 2ZUTA 3AXTA 1L1QA 2ZBFA 4V0ME 3RSGA 1VMKA 4OQLA 4CT4B 5TRTA 3S2ZA 5F78A 2YN4A 2JRCA 4Q34A 4FFOA 4MINA 5EUBA 1HDIA 1A76A 4HP8A 1DC3A 4J2TA 3EEFA 3QM1A 2CL7X 2CNWD 4C0BA 1OKKD 1UEXC 3DKIA 2AFHE 4HQOA 4PANA 3CEAA 1YZKA 4RHYA 2EJUA 5KVSA 4CKCB 1D0IA 1W4AA 2QMZA 4GE0A 1FP4B 4DHEA 1LPPA 4PQEA 2H2GA 4M6WB 4X61A 3ZLTA 3Q10A 1IK4A 5F9FA 4U0JA 5ERYA 3WV4A 1JDZA 3F9RA 4OA8A 4PTZA 3DLPX 5DFAA 4QM6A 5JD6A 3DV0A 1CJMA 1I7LA 3LDHA 4R8RA 3U7EB 1JR4A 1OX5A 1Q3KA 4H0CA 4CKYA 3PGA1 5FUMA 2EYQA 2QV7A 3T15A 1RNLA 4RL4A 3ZKWB 4RCYA 1WM1A 1ZO8A 5FOVA 1NSYA 3UC5A 3WRXC 4CRWB 5CFZA 5AKKA 4RSRA 1SUAA 4RNCA 5KJ1A 3OQ6A 2QJWA 2IX9A 5K01A 5DNWA 4FFSA 5BWMA 1PZMA 3NEJA 3PNVA 3AJ9A 3WWCA 4PX9A 1V35A 4MMYB 1GSIA 2ZT7A 5JE8A 4BWYA 1SBZA 3PK0A 2OFFA 4EMTA 1NY5A 2JLCA 5F7XA 3OF3A 4EG5A 4BVGA 2IELA 3D4OA 3HYTA 1WLEA 4CM7A 1Y8QA 3H2BA 4HAWA 1GTZA 2DMRA 3HYLA 3PI7A 4H3HB 4BATA 5A4AA 3VPSA 4ARZA 3B1FA 1KMQA 1OBFO 4K6KA 1ML3A 1KK3A 5CCXA 5EJ4A 4LXUA 2BVNA 2F59A 1XVLA 3MIZA 1OWPA 1QZZA 1P2BA 2QRVB 5KJ6A 1CUGA 1T0JB 4Q37A 4BZXA 3ZLJA 4O8ZA 4R1OA 1JBEA 1UANA 4NV1A 1XWIA 3MF1A 1JRLA 4P72C 1EVYA 4UZEA 2QRHA 4HDSA 1Z63A 3V1KA 4MW9A 1V8PA 3KQVA 4OHOA 4EKEA 5JASA 1ZJZA 3B82A 5KNBA 4EBBA 1NVDA 1WTCA 3L0PA 5T4BA 4H59A 3KHKA 4QBGB 1A1VA 4JODA 1L8OA 2OC9A 1W2HA 2PD6A 2VIIA 4LISA 2CV2A 1O1YA 1R15A 2MSDB 1DS6A 4FILA 4TL7A 1HDCA 1DV2A 2CWDA 1ORWA 3FUCA 3WLEA 3SLGA 4EO9A 1WXWA 4L95C 1PJTA 3B5EA 1I5EA 2QBYA 3N2NA 1J1UA 3ZE7A 2HJWA 5ALZA 4CLXA 3GGPA 1WZEA 2JIDA 1KOFA 1R9NA 3E27A 4Y3UA 1I2DA 1BQEA 1O4WA 2XRYA 2C00A 3AIOA 4MUMA 3JYHA 3I9JA 1ZGHA 4LOIA 3OOEA 4U7PB 2V6GA 5TR9A 4ER5A 5JAUA 2WJVA 4UQPA 4C76A 5LWQA 3ANNA 3K2BA 4ZZ2A 1QANA 4F1WA 4PO1A 3LW8A 4FFDA 4RIEA 5FUYA 2YY7A 3ES9A 2PT7A 5EPEA 3PHHA 4WOBA 4ETWA 1TVEA 4S0XA 1CNEA 4AJLA 1QHSA 2FUCA 3R8CA 3A37A 4DADA 4KLAA 5FOTA 4Q7LA 3F67A 1E2MA 3HFJA 3EZ2A 4G1CA 5HBRA 1M2GA 2G5GX 4M0UA 4UBLA 1QYWA 4ZO8A 4IJUA 2XBUA 3MEQA 2N9UA 1T5HX 2PN1A 3IQXA 1NXOA 2PO7A 4AZSA 2XYGA 4BV9A 2EX4A 1ZJJA 3FNFA 1P6QA 2PEZA 2HHCA 4FYVA 1IL0A 3PZBA 4WI1A 4AD8A 5JQGF 2IKSA 4FQ7A 5FWDA 1HDZA 2OCDA 4BVEA 1UZMA 5ULLA 4C21A 1XCPA 2QAJA 3EGIA 1XZCA 3EJ6A 4CEHA 2PUWA 1MTOA 1FTYA 4I4TF 4N6OA 1L5MA 1GYQA 1QE5A 3WK4A 3R23A 3WNQA 3MINB 1L5HA 4ZXPA 3CKKA 5F3RA 3SU8A 1IBLB 5AW5A 2H1LA 2HN9A 3MERA 4XM0A 4I55F 3QKTA 4TVSA 1K3TA 4XTUA 2W43A 4YXFA 1LCIA 2GAOA 4LJRA 2V59A 2QDKA 4LC0A 3P8TA 1S01A 2SKCA 3TZBA 3GA0A 3IUYA 1YQGA 3CUWA 4RA6B 2IOQA 3E5RA 3OTOB 3A2NA 4KLNA 3AFOA 4MRVA 3ZXXA 2YZKA 3IMCA 1PT5A 4UTRA 3F97A 4I5FA 3FDJA 5LIRA 1Q7TA 1EGVB 4NZOA 1F5SA 5DM2A 1STOA 1FFBA 4QU5A 5B4UA 1R2QA 1IYZA 1AQLA 3I01M 2V7EA 4JL8A 3LT0A 3WLOA 4L8LA 2AI2A 3EXHB 2RHJA 3SHFA 4IIJF 3MRVA 5KTRA 1JHQA 1PYSB 1IDOA 3C6MA 3DDCA 1A9YA 1KKLA 2WSSA 3HWRA 4TRNA 2RGNA 1DIAA 4RHFA 3RABA 3RF6A 3TTUA 2ET6A 1G2PA 4JCOA 2JLUA 3F9CA 4H0FA 5HQ3A 3OZXA 1I1HA 1G8MA 4RX1A 4DVGA 3VC7A 1KU0A 2QZ9A 4RGVA 1GFZA 2O7QA 3LWZA 3PLRA 4RTPA 4TMXA 1VLHA 3KT6A 1TMGE 4FD2A 1EH5A 4M1QA 4N39A 4G1FA 2GCIA 1SKYB 4GKAA 5LYYA 3NUGA 5JH7A 4Z6KA 5FR1A 1SVMA 1KJIA 4FWBA 3L46A 3OA2A 3ERCA 5HKBA 4IYRA 1JJFA 2BUAA 4BNJA 1E7RA 1XXLA 2H4HA 1EFWA 4ADSG 1TW2A 4NR0A 5CJJA 4M1SA 2C5EA 4LCJA 4EBFA 2YJ5A 3FYDA 1U7UA 4M46A 4OYRA 4A6DA 4HRAA 1EESA 5HGJA 1VYTA 2QTMA 3K0EA 1E62A 3FVTA 3BHIA 4G8CA 5ER9A 1NF9A 1KDOA 2ODQA 3LDAA 4YRDA 5EIAA 2R7NA 3Q5DA 3JZIA 5ENVA 2O1XA 4FZ5A 2PL1A 3FTCA 4GPZA 1SBIA 5KYXA 1WBJB 3L0CA 4FBMA 1XMVA 1P9LA 4Q3LA 1FVHA 4URFA 5MN4A 4AMGA 3KM0A 4P73A 1WOYA 2Y1OA 4Z7JA 2HQ1A 1W5AA 3ZLBA 1R6BX 3F9IA 5G1OA 3THRA 1LI7A 1XZFA 4A1OA 1Z5GA 3BWMA 4DCCA 4LOHA 3F74A 1CG6A 2A0FA 1CJUC 4UUNA 4TZTA 1G5IA 3NT5A 4H9GA 1L8AA 2NACA 4E31A 3EOBI 2WKRA 5K1XA 1Z4PX 3DLAA 3EF3A 1B7GO 3CZ9A 2IL1A 5LP6F 1MH9A 3SNKA 5FIUA 1EOVA 3TFQA 3GWGA 3JD0A 1CDOA 3O5AA 3SKXA 4DANA 3HB1A 5DCYA 5JS1A 3LY9A 2XMRA 3N8KA 1J09A 1ZCZA 1KS9A 2B69A 1SPBS 2I1VB 2ZI3A 3ANMA 3KZNA 3MJFA 1JIKA 2VNIA 3QXHA 5TGTA 4QUGA 2DR2A 4HWOA 1UCFA 2IYUA 5IXSA 3T0FA 3EEYA 3UT6A 3ZOZA 4BMSA 3CH6A 3D6JA 4HTAA 3Q6NA 3JWPA 3LRPA 2NX2A 3V7YA 2FA9A 1EDZA 3QNWA 4LA4A 3RSCA 3K9GA 1M34E 3PJRA 2NU6A 4TGLA 4LYYA 2FR1A 1J0CA 2IV3A 2NUTA 3VYRB 4EWLA 3GJZA 4ZMRA 5JMWA 4JI0B 1MOQA 3WHIA 2ZTHA 5FFFA 2HA6A 1CLEA 2WPDD 5CM2Z 1ZCBA 3REQB 3MK31 1ZZEA 1KEZA 1L5VA 3K8QA 2ZULA 1Z33A 3FTDA 5DE3A 2VP9A 2XCIA 3L49A 2QAGC 4YGXB 5F2NA 2X4LA 3OJWA 3TN7A 4K40A 4JGIA 4QOEA 3ROTA 2IXDA 2QPAA 3L2ZA 4LDJA 4ZEWA 3QO5A 3DBVO 3OEYA 1EUYA 3CZRA 3QLEA 1LDNA 3UK6A 1PJQA 1K5HA 1K0UA 4QJ3A 2SKDA 5F35A 5KDLA 1ZWLA 4ZRNA 1JIUA 5G0TA 1GTRA 2CK3D 1WQ7A 3HNPA 1P0IA 3GEPA 3GMSA 4OHKA 5KNDD 1YI0A 2VH5R 7GPBA 4QYIB 2VJAA 5ICMA 5JWOA 4BLSA 1EFKA 1U0EA 4JKYA 4N5LA 4OXNA 3PLAE 1U0BB 1JHOA 1QNFA 1XTZA 4I9NA 4L4UA 5CX4A 1ISPA 2B30A 1XDBA 2Q1UA 1T2AA 2P65A 1KZYC 2QE7D 3L7YA 4FMDF 3NNSA 3KB8A 3FPJA 4PYOA 4HDKB 4PZYA 4EATA 3I9V1 1QQ6A 4LY6A 2B3DA 3R9WA 1NMEA 4RIGA 4Q9DA 3K9QO 3BDAA 3KUUA 3REGA 1DWUA 3KJNA 3PCOB 2V9ZA 2IRWA 3M1IA 5F9MA 5G0UA 3UM9A 4HNHA 3OTWA 3EXFB 1VPWA 4KH0A 5KVAA 4BKQA 4UM9D 1TK2A 4EIWA 3QF7A 1DJLA 1FY2A 2HU2A 3BGVA 5KSPA 5T3YA 2ST1A 1OAOC 2PMWB 4IDCA 4Y9SA 2I8AA 4N6NA 4RTLA 4DMGA 3HCWA 4NC9A 1JKJB 2RB4A 3NGXA 2IP1A 4HT4A 1M1XB 1APBA 2VK1A 2B78A 3UWSA 2FH5B 2REQA 1P2DA 4UTVA 3FG9A 2Z2JA 2M6LA 1Y3BE 3V00A 3HJGA 3OEED 3BT7A 1FQWA 1MT3A 1PUXA 1VKHA 1Y6ZA 2HT6A 3BERA 3RU3A 5A4MS 4AKIA 2BLNA 3IVMA 1P5FA 2VQ3A 4BMVA 5KNCH 3ZQJA 4TT8A 3ZIAD 1JAXA 4DJFC 2JG3A 3TTVA 4DRYA 1LZLA 1Q6ZA 1RAAA 2OORA 3OLZA 1TKRA 4QYTA 4KFTA 4XR4A 1IHUA 4KPFC 1OYOA 2BFCB 1HUQA 3KL4A 1OIWA 3ZCRA 1NNHA 1T3LA 3FCAA 1EGAA 3OO1A 4G0XA 4MLDA 1PEKE 2XTJA 1FDSA 4G4IA 3M4ZA 3ZBPA 2PTHA 4OM7A 5DT2A 2DVMA 4NCIA 5CAEA 3CJTA 1R9GA 4RA9A 3VYSB 4JU9A 1JEQB 3I45A 2P4HX 5ITZA 4KVAA 4PY2A 3IT0A 3WBJA 4FYKA 1NYQA 2IV7A 4G0VA 1K75A 5BT9A 3GVHA 3DZ8A 1AA9A 3GRRA 4M0CA 4RQFA 2ZKIA 3LCVB 5JNRA 4QPCA 2HDOA 1HDGO 5EXEA 1VPTA 7YASA 5C8XA 1NMQA 3EQ2A 3CO5A 1OGJA 3AZPA 3AONB 1ZU5A 4UE3S 2ZT5A 1YDHA 5F76A 2HIAA 3VZSA 4AUKA 4R1UA 1XNHA 3BZUA 1M2OA 2B5VA 1G8SA 1GRCA 2QUKA 3QPCA 4B6EA 3C6YA 1UAAA 4JEUA 5GMOA 1LLUA 1Z7WA 1RRPA 1WAMA 4LPSA 4RAOA 1NYRA 1DAOA 4XDHA 3ZN2A 5JDIC 3KV3O 3HFRA 3D4IA 4CS2A 1YQDA 2K5UA 3IFSA 4IYJA 5FOWA 3TQRA 4ZVLA 3ZZUA 1VIDA 4DLSA 1ZGCA 4E5YA 2O8BB 5C7OO 4B47A 3SEAA 5C37A 4H7FA 1NQTA 2Q4EA 5J63A 3VKHA 4FT2A 2AQIA 4JJAA 3II6X 4XD7D 5JAHA 1IATA 4M98A 3VR5D 3MJDA 1EVKA 4B3JA 1PUJA 4N3AA 1EDOA 2GESA 4A0GA 5AK6A 1SCUB 5DGCA 4ZQHA 3SMQA 1UMBB 4BDTA 4WK6A 5BN3A 4CUZA 1MA3A 1X7XB 2FLVA 4JU8A 4RJJA 4PG3A 1X2HA 5JY6A 4P08A 1IEWA 1O54A 4PRKA 4WBNA 4WXHA 2IJGX 3UT5A 5ALNA 1M5TA 2QD1A 3FWYA 5J23A 1VPDA 2W58A 3TAHA 3CLKA 3PKJA 3RTCA 1V96A 1EFPA 3FRHA 4E30A 5CDUA 4GSYA 3CF4A 5CLFA 1ZA2A 3TRJA 3CCCA 3PUVA 2FF7A 2VP0A 4HEQA 3KOXA 4PG6A 4MS4B 1C1DB 4JLJA 4FIZA 3OM1A 2X0FA 2FETA 1T15A 2OAP1 5ELNA 1I8TA 2RBGA 4XFDA 4YV1A 3P2IA 1QHHB 3RQIA 1R64A 1YZVA 3ICCA 1I2AA 3KZXA 8ABPA 4FLFA 1UKBA 2XBLA 3GLHE 4G36A 2ZE8A 2ZI5A 2O2EA 2R2AA 4M7RA 5TGDA 3RKRA 4X6YA 3I9V6 1V16B 2Z2IA 5DHPA 1E58A 2GN9A 4QL3A 4ZQGA 1JUDA 1VHDA 3JQCA 2E5LB 3OZBA 4X65B 1NF3A 2Z2XA 4E5PA 5F2KA 4PCVA 4DR7B 2VP5A 2YJ4A 3R75A 1RWVA 1G60A 2OZLA 5JT1A 3R7SA 4DNXA 2D5AA 5KKCA 1ORHA 3ITNA 4U7FA 2V7VA 3QUQA 2QM3A 5B4TA 4YMGA 3QKSB 4PRLA 4C0JA 2FOIA 3V4VB 2DE0X 5G0VA 4F3RA 1SG0A 3FOBA 2XLCA 2PX6A 4ZCLA 3WMRA 1C7QA 1P39A 4G26A 5FTWA 1P8AA 2FY8A 2JGNA 3PQCA 3AR4A 3DE0X 4W1QA 3QSGA 5AXAA 3S40A 4DMRA 2V65A 1DQRA 1QLHA 2J3KA 2PWAA 4YJDA 2A9OA 2VDQB 3JVVA 4OHWA 1QG6A 3N0RA 1RBQA 2QTWB 4P0PB 4I1RA 2KYRA 1CNMA 2PH7A 3BQNB 2RFLA 3CRMA 3R0ZA 3SDZA 4JP2A 2BBTA 3ETHA 3U80A 1VZ2A 5D3QA 7MDHA 4Q3KA 4C03A 4B8ZA 4RPIA 5FAKA 2ZWAA 1SA0B 4KRFA 3V8JA 1EUCA 4EHNA 3F8WA 3TUPA 2NVBA 4H7EA 4WKPA 4HNTA 5GVRA 1Y63A 2MSCB 4C7OB 4HV4A 1GSAA 2H31A 3K05A 4BVKA 2GYVA 4AX4A 5MDHA 4DZTA 4FWIB 4KH1A 1GG5A 1JQAA 1FVOA 2EKPA 4L72A 1MT0A 4JJ8A 1CWUA 2QF7A 1QX4A 2IXAA 4Q3NA 2DUWA 2FMUA 5ENZA 4R8VA 5JG7A 3VZCA 4BLTA 2CL0X 3HM2A 1VJGA 3CFYA 2VSOA 1WMFA 2HL6A 3CZCA 5EWJA 1NQUA 1IK6A 4GS5A 5JLAA 4BMOB 3ZWAA 3O3CA 5EJGA 1YIDA 3NIGB 1RIFA 3P9CA 4FEAA 4QLBA 4ZICA 5CDSA 2BHSA 3WBFA 4IZ6A 5F98A 1WXXA 4TYQA 4GOKA 1R0LA 4AJEA 1J6UA 2GXQA 3VC3A 1JJVA 3DZGA 2D74A 2OV2A 4XDZA 5H5JA 3C5VA 3L4BC 2MINA 1G16A 4Z0TA 1NJ5A 1EIYA 3OBBA 1OI7A 2FZVA 4NJEA 2XMQA 2I5PO 3R4CA 4HQ0A 3HO6A 1QRUA 1N4AA 3RCBA 1RXCA 2PDAA 3A27A 1AZWA 4U6NA 1H66A 1KDYA 3BRSA 1N6RA 2NYVA 2XZDA 2YXNA 3OESA 3GRKA 4HX5A 4DLUA 5JNUA 4LG1A 5KU1A 2C3PA 5DNUA 1D2AA 3N2ZB 4CCSA 4WJZA 3NETA 5EJIA 1K3UB 3BWEA 4RS3A 2CBGA 3F49S 4FDVA 3ZY2A 4BO4A 3LCRA 5KYUB 2JLSA 5B3KA 2CFOA 2VK2A 3DULA 1EUZA 1IHYA 3LP8A 3AB7A 1IZ7A 3QA9A 5FLXA 4DREA 5B64A 1P5HA 2UKDA 3SQOA 1K27A 1O97C 2A67A 4NBKA 1QS0A 2GAJA 4OEHA 4ZDKA 3P9KA 3DTTA 1Y5IA 4XB2A 1JMVA 3D8SA 1DIBA 3EZNA 4R2WA 5AI8A 4AJ1A 3LLSA 5JSFA 4HB0A 3HZZA 1RLUA 4XJVA 1XKLA 1U1GA 2NZ2A 2QB5A 2XLBA 3QE0A 4HF7A 1AK9A 1J2RA 3WNVA 1G59A 5A1TA 4TKLA 3SC4A 2OM2A 4P72A 4B80A 4KSCA 5FOQA 3N7TA 1FNNA 4KBFA 2QRGA 5IYZB 4O2BB 4AI6A 2C83A 4BVJA 4GR5A 2PGNA 1LLCA 3GAZA 1UZAA 4QYSA 2XOEA 4AMZA 1K4KA 2FX5A 1VG9B 3JD1A 2YWEA 5ARCA 4WFQA 1WPXA 4HFMA 4ABYA 4FEGA 4A2PA 4UD6A 4NJMB 4PW0A 5K2OA 2REBA 3LC2O 4TSKA 5K09A 3EFSA 2ZBGA 4BNUA 2FPKA 3UJDA 4N54A 2CJFA 4V0NA 2JIBA 2QEQA 2WUWE 1W88B 2HJRA 2ODTX 1M8FA 2QT9A 4IR7A 1QIFA 3OLVA 2XBMA 4YCWA 3QBEA 1R7RA 1N5IA 3ZEAA 4BFVA 3KXPA 4BX0A 4ZHQB 2PGJA 3HKEB 4QULA 4Q15A 1A8HA 1FNCA 2QLFA 3MWDB 3NTQA 4HNRA 4JELA 4Q3AA 2G8LA 4KXNA 4QQRA 4UPEA 1O5TA 1XRJA 2A9KA 1IHPA 2QROA 5AHXA 5JSQA 1NIJA 4EG1A 5BW6B 2GT1A 2JATA 2JL1A 2X0KA 2P7HA 4FFLA 3ON5A 4M88A 1SXJB 3QU5A 4GVPA 3A1SA 4I6EA 6REQB 3R6LA 1NHGA 3QVTA 1Z75A 3A3PA 4EJ0A 5BR7A 1NF8A 1JNYA 2PM8A 4HNGA 4O4LA 2Y4NA 2MYTA 5JPCA 1UP7A 2KWIA 5KQGA 1XU4A 3SEQA 5LZ9A 1EFTA 3ZZMA 4BMZA 1QGAA 3E03A 4A27A 3E9RA 4X66B 4X8HA 3T1OA 3EDRA 4DCPA 1HNZB 1S8FA 2XPCA 5KJFA 1AE1A 2V6IA 3DMTC 3SX4A 5C3MA 3F4BA 3ESQA 1B26A 1T1JA 3M3PA 4BDSA 3GLVA 5TS3A 4MROA 4HNSA 4ZJPA 4UM5A 1EM8A 2Q07A 4A6PA 2FRDA 2X5KO 1YNSA 2JEOA 2AMVA 3ENZA 3MA0A 4QQNA 4A6EA 4MB2A 3SEZA 5JRJA 4JOBA 4AX8A 1KJ9A 1WDLA 2DQYA