1ATIA

Crystal structure of glycyl-trna synthetase from thermus thermophilus
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
505
structure length
437
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
pubmed rcsb
molecule tags Protein biosynthesis
molecule keywords GLYCYL-TRNA SYNTHETASE
total genus 131
structure length 437
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1996-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1atiA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1atiA02
2EJ9A 4OLFA 1H4VB 3L4GA 4CS3A 2Q7GA 2ZTGA 4P73C 3V7CA 3FJPA 4HA8A 2E41A 4P75C 3RKYA 3VQVA 1YFTA 4ZTZB 1HTTA 4YYEA 4Q6GA 4H2XB 1BBUA 4HVCA 1FYFA 2ZT8A 3RIRA 3HXYA 4YRCA 2LW7A 2QHUA 3HXUA 4PG3A 4P72A 1J5WA 4YRJA 4P73A 3RKWA 5ELOA 3LSSA 1B7YA 3HTZA 4KR3A 2E1HA 1C0AA 4P71A 3E9IA 2Q7HA 1H4TA 3QNEA 3HY1A 4P71C 5ELNA 1ADYA 2ZNJA 4J15A 2AKWA 4H2SA 3UFGA 4XTVA 4YCVA 4YPFA 5F5WA 3V8KA 3P8YA 1X01A 2EAYA 1Z7NA 2HNIA 2ZZEA 4P3OA 3L4GB 3TEHB 2ZR3A 4XTUA 12ASA 4XEOA 2ODRD 2ZZGA 1PYSB 2ZGWA 4WI1A 2DXTA 1BBWA 4XU1A 4XU3A 3ICAA 2DKGA 4XTWA 2EL9A 3HXVA 3IG2A 1WU7A 1LYLA 2ZINA 4HWOA 4EX5A 3A74A 4L87A 2DU5A 4CH4A 2DVEA 4AH6A 1EVLA 3RUXA 2CGHA 3RKXA 3NEMA 4ZTUB 4YRIA 2ZT5A 4ZIBA 4H2UA 2QHTA 4EO4A 2DJZA 2EWNA 4G84A 3NENA 3A5ZA 3OD1A 4RQEA 1EFWA 1L0WA 4YRRA 3A31A 2ALYB 1N9WA 1E1TA 2ZZFA 2XGTA 3HFVA 2ARSA 2ALYA 4TVYA 4P3NA 1KMMA 1YFSA 1ASYA 4TVWA 4YRQA 1X2GA 4BW9A 2ZIMA 1VQZA 1WPYA 3TUPA 3LSQA 3QO7A 1SESA 5E3IA 4RQFA 2DQ3A 4CH5A 4YRMA 3TEHA 4HWRA 1QF6A 3A7UA 2C7IA 1X54A 4XEMA 2DEQA 3ERRA 4YRPA 2E5AA 2ODRC 2P0LA 4H2WA 4LNSA 1SERA 1WLEA 1X2HA 4CH6A 2DZ9A 4KQEA 1E24A 2EJGA 3PCOA 4TVAA 5C51B 4WJ3M 1ATIA 1BIBA 4RMFA 4XTXA 4YRNA 1HC7A 1WYDA 4YCWA 2XTIA 3LC0A 2DQ0A 1NYQA 2CJBA 3L2ZA 2RHSB 1W66A 2AMCA 3RL6A 4HWSA 4DQ2A 2PMFA 3V8LA 1NNHA 1B8AA 2ZT7A 1KMNA 2I4OA 3DSQA 4X5OA 4XU2A 4BWAA 2ZIOA 2E65A 3P8TA 1YFRA 4UP9A 3HFZB 4K88A 2AKWB 3IKMB 2ZCEA 4HWPA 4YP0A 2J3LA 4P72C 3VQXA 3I7FA 1E22A 4O2DA 4KR2A 3P8VA 1RIQA 3A32A 4XU0A 3TEGA 1E1OA 1SRYA 3L1AA 4H02A 3UH0A 4H2TA 3V8JA 1USYA 4G85A 2DU7A 4YRGA 1USYC 1EQRA 1H4SA 3HY0A 2FYKA 3NELA 11ASA 4WJ4A 2QHSA 1B7YB 2ZNIA 4XTZA 3E9HA 3WQZA 2I4NA 3MF2A 2E3CA 5C52B 2DZCA 2AMCB 1HXDA 3KFUA 1G5IA 3G1ZA 1V95A 1NJ1A 2ZR2A 3A7RA 2DXUA 4HWTA 3RF1A 1QE0A 4TWAA 1EOVA 4YRTA 2CIMA 4CS4A 3HXWA 2DDZA 4TVAB 2RHQB 1WQ7A 3VQYA 3RACA 2CJAA 3RGLA 4Q15A 2ARUA 3VBBA 5K1PA 2DTOA 3UGTA 3HXZA 4TTVA 4E51A 2Q5HA 4YROA 4UP8A 3A7AA 4H2YA 2E10A 5C53B 4H2VA 1NYRA 1JJCB 1EIYB 3V7RA 3PZCA 1G51A 1EVKA 2CJ9A 2Q7EA 4WF2A 4RDXA 4YRLA 1B76A 3PCOB 2ZT6A 3EFSA 3IKLA 1NJ6A 4P75A 1B70B 2E64A 4YREA 3CMQA 3REUA 1Z7MA 2Q5IA 3NETA 5KNNA 4YRSA 3HRKA 3MEYA 1EIYA 4TQDA 1YGBA 1GGMA 3BJUA 2I4LA 2RHQA 1WNLA 4TQFA 5HGQA 1X56A 3HRIA 4P3PA 2ZXFA 1NJ2A 2J3MA 4P74C 3REXA 2IY5B 1KOGA 1PYSA 4UPAA 2QHVA 5K1XA 2IY5A 3QTCA 4DPGA 1JJCA 3UGQA 1ADJA 3HXXA 3W3SA 2DTHA 4K87A 4H2XA 1ASZA 2I4MA 4OP0A 4PHCA 4YRFA 3M4PA 3VQWA 3QO8A 3EFRA 4XTYA 3M4QA 1WQWA 2P5IA 3IALA 3HFZA 4YCUA 4NCXA 4K86A 1B70A 2DTIA 1IL2A 2RHSA 4P74A 3R07A 2C8MA 1NJ5A 1SETA 2PMEA 4YDQA 4CS2A 3QO5A 2EJFA 1YB3A 3BFMA 4CH3A 1G5HA 2ARTA 4YRKA 3V7SA 1X55A 1H4QA 2G4CA 3A5YA 3MF1A 4UP7A 1BIAA 1NJ8A
chains in the Genus database with same CATH superfamily
4OUDA 2QOEA 3VDRA 4EKGA 2AZDA 1DBQA 1K66A 2B25A 2JJMA 4E11A 2YV3A 2ZAGA 5DXFA 1P4AA 4CS3A 1DEOA 1YS4A 2ZJYA 3WGOA 5ICCA 2DWCA 1EA7A 3NP9A 3PLNA 3MWFA 3ITDA 3TVTA 4MV6A 3E53A 2AXNA 3FJPA 4J0GA 4Y6GB 5EOVA 1U80A 2C3YA 1MMFB 2BFFA 3M4XA 4OF4A 3HCPA 4RCYA 1W52X 4KVGA 3ZKWA 3K9GA 5P21A 4PFSA 1C4XA 2VSXA 2HDNB 2BFMA 2RI0A 1TU0A 3A6JA 3H11B 4J2OA 1WUHS 2YW9A 4KK4A 4YPOA 3D2AA 4Z4FA 2FN8A 5FA5A 1G6KA 2H8GA 4Q3BA 4CF6A 3Q12A 3P26A 2WTXA 2ZT8A 2WAAA 3T1NA 1SNYA 2OLKA 4NBVA 1RHKA 2QRGA 3R4CA 3KFLA 1NATA 1QFZA 3SR4A 4BAUA 3O7MA 1E4VA 4CUZA 4XJSA 3P27A 4LXUA 2ROQA 2K6GA 2FDRA 1L4MA 3CKLA 4YFVA 3X44A 1EWQA 5JSYA 4E4YA 2A0XA 2IYOA 3A3NA 5ALLA 2XBUA 4YRJA 3H5IA 3M6AA 4BCDA 3K31A 1H5QA 1PR4A 2WDPA 3B1WA 3DOFA 4DR2B 2O8CB 5KNLA 3A6PC 2MYPA 4U63A 4MH0R 5IABA 3EMKA 3GAZA 1CY7A 1K4KA 4Q1CA 3GEGA 5KUTA 2CF6A 1VL6A 3GYGA 3G0OA 2Q5EA 3MRTA 3HVUA 3N5CA 4MV1A 1UK6A 2Q28A 5CW2A 4RKFA 4X9XA 3ZU4A 4QM7A 2AC4A 4X20B 4JWKA 3ZWWA 4E88A 1B1AA 1GZHB 5KHAA 3OLWA 1NVBA 5ARCA 2EJWA 4IQFA 4KOAA 4CLDA 1LBEA 1W29A 1BWQA 4DZRA 2ENWA 3WL7A 3TUZC 2JLQA 2X0NA 4YCVA 4I5FA 3DO6A 4H6VA 3GPDG 5HJ2A 4D4GA 1JF8A 2QW8A 4P4UA 1KI9A 5EWJB 5A6SA 2FNAA 3PE3A 3IESA 1EXDA 4K26A 1FBTA 1FPMA 1RXWA 3L46A 4CMIB 2PZBA 2FPRA 1GLNA 1DLJA 5FP0A 3M6XA 4W1SA 4BFXA 3DFFA 3UKJA 2IS1A 2VT7A 3FPEA 1Z25A 2Z2KA 1LSJA 4PY2A 4DUYB 4E1AA 1F8FA 2AMVA 2LE0A 1DX4A 1JILA 3LKZA 3P9RA 4FYXA 2B9VA 1XTVA 5DXJA 3VO2A 2AYZA 2F9LA 3RV3A 4F5ZA 3GMTA 3S7TA 4I8XA 1LI5A 2WU3A 4D8XA 2ZGWA 3FNGA 4QQ8A 5H8WA 4H6WA 3DWEX 4ZARA 5H83A 4MTCA 1GXSB 2QN3A 4X41A 4OFZA 1JWAB 1S8FA 3KHKA 4IHKA 4XWYA 1S8OA 3H3XA 4UAJA 1RWWA 4BIIA 3HCDA 1YHYA 3NW9A 3MELA 1ZY2A 3COWA 4A27A 3A1VA 4Z5XA 2EL9A 2H17A 2PO7A 1KY3A 3F97A 1BCRA 2QVXX 3E8MA 3OT4A 3KXIA 4RE6A 3WP1B 3E0XA 1EFRA 2YWJA 5AI6A 5GONF 2B0JA 2Z5FA 4HWOA 1XRSB 1KI6B 1XMJA 4O2BA 1YVEI 2DWUA 2OFWA 2WIKA 4RVSA 2WU1A 4RHUA 3DCNA 2UVDA 1JL3A 4C7KA 4GO1A 2PAFA 3CW8X 2WUEA 3MINB 3HB0A 1L2TA 2NO5A 1CLUA 4YYZA 5EYPB 4RCVA 4GVXA 4JVSB 1U0RA 1E2JA 3E18A 2WU8A 2OXTA 3PUWA 3OZIA 1NMYA 3WIVA 3GLFA 1C8LA 1IFXA 2I2CA 3FMPB 1SN7A 4GRAA 3Q3CA 4Y8VA 2XLCA 4J76A 1V5GA 4ZQBA 4BFWA 1CRWG 1YJ5A 2JF0A 1DCMA 1MD9A 1YZGA 1L7NA 3LD9A 4ENSA 1BS9A 2FR8A 1I0IA 4U7WA 1QV7A 3JQQA 4GOMD 4Q3KA 3AUTA 3L04A 2QMUA 4RQEA 4H3SA 4Q3DA 1EXVA 4TN5A 1GRVA 2DKNA 2YZ7A 3N2GA 2BIFA 4D3YA 3QVUA 3ZLVA 1KETA 1JHQA 2B8JA 2GD6A 2AT1A 2ALYA 2PLNA 2ZZMA 1HLFA 4LVUA 5EUBA 4AUNA 4OUKX 1KMMA 5L3QA 1W9MA 5K45A 3R6WA 5DMHA 4ASUD 2R8XA 5F2OA 4J91A 4U39A 4MCAA 3UVEA 5KQPA 2DSTA 2ZPUA 1PJZA 1GT91 1X2GA 3TKYA 3VDQA 1VBNA 1AQUA 4PSAA 4PX3A 3LCJA 4ZJYA 4GRIA 4E2ZA 2XTMA 5BUSA 2FWBA 3ZZ0A 3NBKA 4GLOA 2AIRA 1MG5A 4OAPA 1SCNE 2Q3HA 3IIJA 2R751 3O8LA 1EDEA 3X1JA 4Z2YA 2Q8PA 1AKWA 4BZXA 1PL0A 4ZA2A 5AM5A 3DBRA 2I1WA 3ES9A 2MR6A 3HXTA 5G0UA 3TM4A 4LDAA 3OQBA 4Q7LA 3LQ2A 4B4WA 5BW5A 3N9IA 4KX5A 3N2LA 1I9GA 3IMGA 4HWGA 4V39A 4C0JA 5D85A 1QF6A 4ZOLA 4HNGA 4RTPA 3H9QA 1WRBA 2W90A 5AW4A 1DO0A 3QVGA 4EY5A 3VHLB 3OMWA 1V96A 3WQRA 2CNBA 4B76A 2VHQA 1N7IA 2VUHB 2ZSUA 5E7MA 2E4AA 3CLHA 1H0RA 1W87A 4G0MA 2IXEA 2NU7B 3K0AA 3OOYA 4MIKA 1ZGJA 4Z1OA 4M8SA 3VAYA 5LB2A 3O4FA 2DZ9A 1PJSA 3BMNA 3GNLA 2OG1A 4L07A 4I1VA 1AK2A 3GROA 1TQHA 3MS4A 4Q66C 4EL0A 4CFZA 4A6DA 1EBBA 1GTL1 1PYDA 1U8ZA 1XVTA 3S5UA 1M10A 4DT1B 4F21A 3L84A 5DHSA 1H6AA 4WJ3M 4A10A 4CV0A 5K0BA 1MH1A 1ATIA 2EIHA 1JJ7A 2FMKA 2ICAA 2PSJA 1M0TA 2VP6A 4P4NA 3PUJA 3E2IA 5JAPA 3M3PA 2XYQA 5EFZA 2A8EA 2ET6A 2JZNA 3FUTA 4EUFA 5KVVA 4BMPB 3P45A 1KO7A 3HNRA 5JO0A 5D3MB 3KWLA 1MDBA 2QYHA 2YNMD 3MMZA 3HEBA 3OX1A 1DKRA 3VKVA 3WBFA 1EFTA 2DUUA 4C9BA 3TZBA 1SCIA 2IUFA 2VCYA 3HGQA 2FX3A 1P0CA 2ID8A 1W93A 2W2MA 4TMKA 1F2TA 4KQIA 3GJRA 4TV8F 3W2FA 2D1RA 3L1UA 1W66A 4Y1RA 4BLWA 2CNWA 3C39A 2J3DA 3E22B 4KWTA 1O94C 3UMRA 1I3NA 2NO6A 4NH0A 4J7CA 4UP9A 1DUIA 1R12A 3BF8A 1Z17A 2FR8C 3DE5X 4IS3A 4J2HA 3ROKA 3VPBA 4AJKA 1SOUA 2UZAA 4PO1A 4WW0A 2H5JA 4DNPA 3JQGA 4JEIA 3L05A 1KE1A 4CMCA 3VJKA 5KTYA 3OJLA 4A2WA 4KRGA 1N8NA 4YP0A 2OMKA 4LVKA 2QZZA 1BSVA 4BNMA 3G2QA 1R6XA 1UR5A 2QX8A 1E22A 5JNRA 1FYEA 5IKMA 2FPKA 1W49A 2HB6A 2VKTA 3GMIA 5DSTA 1O54A 1WUKS 1L8OA 4O2AB 1F0KA 2GAIA 4I55A 2IP2A 1BWPA 1XRRA 4XU0A 4HGYA 4BOYA 3U61B 1MCZA 2JASA 2IUUA 3VM6A 3WJ2A 4F5EA 4QO7A 4LJYA 2DG2A 1WZNA 2BGNA 1Y8QA 3VZSA 3SBEA 2WIGA 4UDOA 1CULC 1KK3A 4I81A 1J6UA 5C32A 1CS0B 4N3CA 1YULA 4AMVA 1XJ5A 4OXRA 5BSTA 1GGVA 4HUQB 1NVXQ 3HCNA 4CTNA 5GV7A 2HKIA 4G0OA 5MGBA 1N1GA 1Y6FA 1ND6A 3QWHA 4IZHA 4L0DA 4FVTA 2ONZA 1GTJ1 4RZUA 4JU9A 2F64A 1LPOA 1XUOA 3PXDA 1EQRA 4HX5A 2O1XA 3MWGA 5DLEA 4BVHA 3QVTA 4F91B 4ZDIA 2LZ0A 3ITEA 2CHEA 2J85A 5BMVF 2JATA 4XKJA 4HXFB 2NO1A 3MYRA 4PLTA 4QUKA 4K9KA 1IK4A 1XZGA 2VDWB 3U0BA 3DVQX 1G59A 4IEFB 4J8PA 4JLWA 1IDOA 2BZ0A 3UPDA 3BB3A 3JYQA 4MVJD 5B12A 4TV9B 1ODJA 2QTMA 4FGLA 4R2XA 1LPSA 2XODA 4ECEA 1HETA 1ULZA 1TD1A 3SBDA 4B3DA 3I04A 3WLOA 2E3CA 4CDNA 2QV0A 2XKAA 2V7PA 5GINE 1XDUA 3IYLW 2I7CA 2EWWA 3HXPA 4CQMD 4WOKA 4YO7A 1AKEA 4Q3LA 4UW9A 2IHYA 2QN2A 4F7WA 3T3HA 1JIKA 3EIUA 3NDRA 4JXJA 1EU1A 3CH4B 4PX2A 5I9LA 1M67A 1TT5A 4DA9A 4QGBA 3L8ZA 3ND7A 4G0PA 4DA8A 3BC1A 4DW8A 1WOYA 5AJYA 2DQYA 4XYLA 4ZANA 2O6HA 3QMMA 3O1IC 3PPXA 4FDVA 2X2FA 2Y6VA 4MCIA 2FR0A 4PNPA 1A9ZA 3SE7A 3H19A 4YUAA 3I8SA 1FJHA 3GWGA 3QXHA 2ZCJA 1PJ3A 4M7WA 4LBYA 3RACA 2G3YA 3QFHA 2Q6IA 2Y6UA 1U65A 2G6TA 2NXCA 1OV4A 3CF0A 3DULA 3R3UA 5F77A 2XJ9A 2LVBA 3S2UA 5LQCA 1O3YA 3FMGA 1LV7A 1KQOA 2XD4A 2F9MA 4G5FA 1GL6A 4H08A 4NOKA 5LMUB 1N92A 4UXJA 2C83A 4K03A 1SHZA 4JL8A 3UJPA 3RUHA 1FXWA 1T9ZA 3E6AA 4FOTA 1AB5A 1DIRA 3FHCB 2XHEA 3TFQA 3FSGA 3UM9A 1JJCB 1GQQA 3PZCA 3ZDXB 1GYPA 1LI4A 5BQ3A 1XE3A 5AVYA 5JVDA 1RWNA 3CJTA 2IHNA 3H1GA 2GCOB 1OFIA 4HB0A 3MQZA 2IK8A 3ZY6A 4YRLA 1PEAA 2WJIA 2CLKB 5LKRA 1GLVA 3LXXA 1C9DB 2CK3A 2A8YA 4DCPA 1TT7A 1OTXA 3PQ2A 2MSNA 3I6YA 4WXRA 1YDGA 4YV0A 1YT5A 4G01B 1DQPA 3ZU2A 2A86A 4ILKA 1VL8A 4TZ6A 3SYKA 2YASA 1N3YA 3B1XA 1L8QA 4TTTS 4WKPA 3UHFA 1EVJA 4ZJPA 1HORA 1S1CA 5KQRA 5I48A 1VHQA 1HNWB 3FNQA 4OLJA 1JIJA 4F4IA 1JDBB 4P81A 3NHMA 4XR4A 4DDMA 4QOSA 4P53A 2YHUA 4WFJA 2YV1A 2Z5VA 4HDKB 4D4MA 3H11A 1XNJA 4B7ZA 2QTAA 5FWNA 2HGZA 1BC5A 4AZTA 4OYHA 4WD3A 1SCDA 1LWOA 5DDIP 3CRW1 2O7NA 4Z99A 4KFCA 3E5MA 2B3TA 4C30A 4R2WA 4K1LA 1JQDA 4NFYA 2PH7A 4YT5A 3MWYW 5KJEA 5AIBA 2YHBA 3R7DA 1DV2A 1AGPA 1Y8RB 2EERA 2ZZNA 2DBZA 2ZBUA 4BFYA 4BFCA 2ACEA 2WTAA 4ZODA 4LYAA 2PEYA 4EJFA 1NXTA 2PGAA 2RJ3A 1S0UA 1SG6A 3LC2O 3RYHA 3W8NA 3OUUA 2PH1A 4LQ4A 5KOYA 1X56A 4DEXA 3WIUA 4UTZA 4WBNA 4O4HB 3QUTA 1SU8A 1Z0AA 4QTUB 4BIMA 1E1MA 4TZ0A 4KE7A 3T1TA 5AH0A 1M1NA 4AP6A 1E1RA 4OEHA 1SC1A 5H9WA 4I6JA 2H5IA 3O21A 4DNQA 3AYZB 3I64A 4IJ6A 4K9QA 1OREA 1YQWA 2OHVA 4F2HA 5LJLA 4ZMSA 3DVSX 3TNLA 2E0IA 1SBTA 3CLVA 5I7VA 2OYSA 2PR2A 2ODWA 1O95D 1Z2AA 1T15A 2PGIA 3SYRA 5JJ5A 2I4MA 1MABA 1XCGB 4KXLA 4BXOB 4MUAA 2QAGA 3UJ9A 2VVTA 4OK5A 3VJRA 1CWUA 1I3MA 3HTXA 5BVGB 1GNLA 2RKOA 2O2EA 1XPJA 1M72A 4XFKA 5K51A 4GI7A 1YVUA 3DCYA 4D45A 5HTOA 3B1VA 4E46A 3EDYA 4LPKA 5D00A 2J9RA 1ESZA 5LA6F 4H3VA 2W9XA 3LCRA 4CKWB 1EK6A 5CLGA 4EYKA 3KS9A 9GPBA 3GN1A 3DOIA 3VGJA 4UBOA 5LMNB 1GNSA 1K2WA 5C7IO 4LNUA 3FPGA 1R6DA 1P75A 3EZXA 5K0TA 2BGJA 2B5OA 1X14A 2FMFA 2JHFA 3TGWA 4YRBA 1LDYA 1BXGA 2W4MA 5FQNA 3MZ0A 3JAWA 4FYIA 4AL4A 1RJWA 4FGKA 2JIZD 4Q7EA 2OFPA 1H4QA 5F4ZA 3RIEA 4RLSA 2W0SA 1GLGA 4I50F 4PR0A 2KQUA 1NUQA 3ZQKA 5HNKA 4RZXA 2IF2A 1RMQA 4MVJF 4ZQGA 1MC1A 1BIAA 1EGHA 2ISSD 4Z9FA 1RR6A 1MHPA 1CNFA 2I3ZA 3SDZA 4GL2A 2B8WA 4CMGA 3L4GA 2L0XA 4NC9A 4C4ZA 5AESA 4PYKA 1R0YA 4DIDA 4JLAA 1ETHA 4UZEA 4E5PA 4PVDA 3ZZNA 3KEMA 4YCCA 2WUGA 4DM7A 1TW3A 4R1PA 2OV1A 3ZE6A 4ZAGA 2XWBF 4EPRA 1NW4A 3BRQA 3IRUA 3B9PA 4DXHA 2YR0A 2X9LA 1XMPA 4GZ6A 5T5QA 1JZQA 1T8RA 1TMGE 5LFAA 3KFXA 3F7MA 4RK4A 1EXNA 3SNHA 1HTTA 2FPPA 3BGIA 4IQ8A 4OJQA 5FR2A 1NWHA 1O4WA 4IW3B 1NVDA 2E55A 4YAOA 1B8NA 2XUAA 2RGDA 4U5XA 3PUKA 4RPGA 3C3DA 4X20A 2D06A 4EGFA 3RIRA 2XGGA 3TZCA 4GPEA 2VTDA 3VHXA 1KYWA 2ZJ7A 3BOSA 4P72A 2WUWE 1PDOA 3EC7A 4IUYA 4RELA 1L5HB 3HKCB 3L8CA 3CO5A 3QHQA 4UVIA 3TTYA 3WBJA 3TKLA 4QUAA 2ZDGA 5DHAA 4YAIA 3RYCA 1FJGB 4ZCMA 4N7JA 4TRNA 3IJRA 4R3NA 4KLCA 5JO9A 1UH5A 4DNOA 1E5VA 1BYIA 4BEBA 1C1XA 4RVHA 2H07A 2G9NA 4UUOA 4K40A 1IBRA 2NQ8A 6REQA 1GG9A 3RRFA 1X0XA 2EYUA 2PFGA 1J8VA 1FMLA 1PS0A 3QTTA 4FYYA 1T3ZA 4OMFG 2E1HA 3SSOA 3RC2A 2ZGVA 1OOEA 4ZVRA 5AUOB 3U1VA 2VRNA 1BZYA 4MO2A 4J1TA 2OCGA 1G291 4JHLA 3AU9A 5HBGA 2B7LA 2BBOA 2R1TA 3L4BA 1Q1BA 4DR3B 1UPFA 1AE1A 3KYCA 1WMAA 4BWGA 1NAHA 3N6XA 4ZOQI 3FMFA 2UYOA 5JOQA 3GY0A 3FKSD 5FWYB 1WKVA 1ORHA 1YD7A 1DJQA 5AOBA 5AI5A 1R88A 3GRFA 2VJQA 3TLYA 4IGFA 1T91A 4AX8A 1X01A 1OLUB 4HH1A 5KTNA 2ZZEA 2IXBA 4PC3A 2YHIA 3SF0A 3EOAI 4YR9A 4MRRA 2A0FA 5JSZB 1L7AA 2WJJA 3NWEA 5E7JA 1TI7A 3BIOA 2V5VA 1BHO1 3L1IA 3PQFA 3PXUA 3MILA 4IVPA 1T6ZA 3IAEA 1LKZA 3ABOB 1CB7A 1DG3A 2WHPA 4L16A 1RJ9A 5CA0A 1CEEA 3CB2A 4JSRA 2IYTA 5IULC 1X7YA 5ESXA 4ANFA 2P4QA 3MXTA 1R74A 1XAJA 2BP7A 2X1LA 2QQEA 3VC2A 4X1KB 2QENA 3QPWA 3WGLA 2W11A 1SZJG 2KLHA 4W1PA 1FYVA 3RSGA 3OECA 1DOZA 1N5MA 2D4AA 4QDXA 5BNIA 1NNEA 4REMA 3CH7A 1PT9A 5TEVA 3WK8A 3IP7A 2FFRA 4IEIA 1Z5ZA 4ZQIA 4LECA 3S99A 1RACA 5IC6A 3UCFA 2NUTB 3WJ7A 1PFQA 1YOVA 2A0UA 2WF5A 4LCJA 4R2IA 1VJ5A 5THKA 2DWQA 1J5XA 3ENVA 3SZUA 3FWKA 1XN4A 5IFKA 4B6OA 5GAJA 6PFKA 1SVKA 1W4BA 2HT6A 1R3UA 4QYIB 5L7YA 2A94A 3A3YA 3JVIA 2G7MC 3F2VA 3EZ6A 3LPCA 2O2IA 3PHGA 5I9SA 2OM2A 4NL4H 1OBOA 1JEYB 2ORED 1GZ4A 3P9XA 2OO7A 2V6MA 3Q9NA 5BT9A 3U40A 4OXQA 4TS4A 4D5EA 3ENKA 4L2IA 4R1TA 4ARZB 5CCEA 2Z6QA 2WILA 3MWEB 1QC5A 4AY4A 1O89A 3AJ8A 1S2OA 1KEZA 4QD3A 3PA6A 2L2QA 4K9PA 2HR1A 1EQ2A 1H3NA 3H2ZA 1C29B 4FOOA 4YCJA 4L3OA 3O8RA 1CZOA 1SUPA 3F3YA 1KMHA 2WSIA 1QONA 1JJIA 3H6HA 3T7CA 5CLHA 3BMOB 4PAGA 5AKJA 3A5ZA 4MDFA 3A1WA 3E03A 4NBWA 1ZUWA 4CM4A 4XZ3A 3ETDA 3FMOB 4UM8B 1HL7A 2B69A 1QPGA 3B85A 2PLFA 4AK9A 5CVCA 3VKHA 5EE1A 4UOQA 2TRSB 1U0TA 5JRJA 1DIGA 3MUNA 2QRMA 4Q0MA 3X1ZA 2ZWOA 4R1QA 3VNRA 4DY4A 3DDSA 2WFLB 2JLSA 3CONA 4I9NA 5IK2A 3VR4D 2JFXA 5HQ3B 1ZQ9A 1CB0A 2W7TA 3FNEA 2CXRA 4NQZA 5J9FA 5IK2D 1D2AA 1U9IA 1SXJC 1ZIPA 4MI1A 1H2YA 3TUPA 1X7WB 4EKIA 3H8SA 3I5UA 2YN4A 1KVQA 4EEZA 3WLHA 4CT5A 3KKPA 4LKOA 2X8WA 1GSHA 4G9EA 4Q48A 3SLRA 1LU9A 1H2WA 3KRTA 1ADBA 4AKSA 1HYEA 1NVUQ 1ZNWA 1E1YA 2B4TO 3ZDYB 4OYYA 4AQDA 1CFJA 2W6MA 3F4LA 2FW1A 1SC9A 1IB0A 1XEFA 2JFHA 3FIUA 3QLJA 3VZCA 3H9GA 4LC1A 5C5IA 3ZJ5A 4WJZA 3BHIA 1MHTA 3D6MA 3HXMA 2I2WA 4QVIA 3TW8B 1H2XA 4AY6A 4QYTA 4PYIA 4F3RA 1SAYA 2ZE6A 4B75A 1UM8A 1Z5OA 2G9VA 4LXYA 5EJEA 2G83A 3N53A 3WIEA 3T3NA 3ISVA 4PQRA 2P6RA 2GLXA 1NTOA 1LGYA 3DDCA 5K0ZA 1PK8A 1ND5A 1YBVA 2ODRC 3DBLB 3FI0A 1VOTA 2I4RA 5FPQA 1H2HA 5JCOA 3RS0A 1YQTA 4OKSA 3WHIA 5I7EA 1UEXC 4LE2A 3GQBA 1GCAA 1MAVA 2YMPA 3KLOA 4WERA 3VC1A 3OTWA 3GLGB 5IX8A 2OC9A 3NPMA 3NWPA 1U2DC 4LMBA 4UM7A 1T5TA 3D1JA 4JK3A 3AW9A 4MW9A 5CYFA 1PKXA 4EITA 3DC2A 2XDWA 3OE4A 4PLPA 1L7MA 3MS2A 3GRAA 5JW6A 4E08A 3ZWXA 1U8TA 1ZVVA 1QUFA 3ILVA 4ISCA 1A9RA 4MO9A 2PJRA 3FF4A 4F3YA 4EG4A 1U2QA 3PVSA 1AQ6A 4QPDA 3EPPA 3QFTA 3O4VA 2OGSA 1KP3A 2Z5GA 3JAMA 3UMJA 2WF9A 3LC0A 3E9CA 3QZUA 1VE7A 2DQ0A 1V1MB 3NBAA 1K5DA 1SU6A 1VZ3A 3C6XA 1NYQA 1IK6A 4UQOA 3NHLA 3PYMA 3R0IA 1S7GA 3TAXA 2J4CA 1V47A 4RSGA 3P9IA 3M7IA 4PANA 4WA8A 4BKOA 3TI7A 4CRWB 4HWSA 2NV2B 1P4GA 1NNHA 2WU0A 3PB3A 1E60A 1QANA 3IOBA 4X5OA 2M6KA 2ZITA 3PUYA 4MB2A 4DRXA 3CPSA 1TO6A 4L7QA 3ZWYA 1PTJA 2C20A 4BNTA 4D79A 5FLXA 2R00C 5CBPB 1EYZA 4BVFA 4ZYTA 1Q0PA 1PFGA 2JAPA 3HC7A 2BFCB 1MXFA 3IFSA 1I51A 3KYDB 3QLUC 4COKA 3LQKA 3ZWMA 4NCNA 2M98A 4H3HB 1XPUA 1Z4KA 2IC5A 1U28A 2IOYA 3LO5A 3PQ7A 5D3KA 1ZM2A 5AM1A 2I3GA 3QMVA 1UJ6A 4R2LA 3VV2A 1SFRA 3EK2A 1SHTX 5L4SA 3FPKA 2VUIB 5SYMA 1AC5A 2PGXA 1LSUA 4DSAA 3C7DB 1NUUA 3GUYA 4N41A 5I7HA 4HH0A 3RYIB 1T3SA 1A9PA 5LBUA 5LZ8A 4CKCA 5L7TA 1HOXA 4JVNA 3EF1A 1OB2A 3MRSA 2GETA 3ILXA 2O14A 4PCAA 1TZJA 3HYCA 2FUG1 2XVMA 3U3RA 2X5KO 1GPNA 1RYZA 2EWVA 1TYBE 1M5TA 2BEWB 2PU5A 2VK2A 3AZQA 3ITKA 1NW6A 4NZMA 2H59A 1K06A 2NT4A 2RDMA 4UVDA 3SKVA 4N76A 3ND8A 4WWHA 2DBYA 3UBMA 3I6MA 1Z7BA 2C99A 3PE6A 4D46A 1QMGA 1GL9B 1JR3E 2OHOA 2QRLA 2GF9A 1XN1A 2XZTA 3N28A 5EUMA 5LQSA 2OZKA 5EI5A 1TTTA 4RU1A 4V0OA 1N2CA 2EQBA 1KDRA 11ASA 3KBBA 1B7YB 4MW5A 3EC1A 1K7YA 2D2XA 3PYLA 4CM8A 1T9CA 3JARB 3SYMA 4DIUA 1ZIDA 5DWDA 3TBFA 5JMWA 3EUWA 4I50B 2WSMA 2Q3DA 1IHUA 1NR5A 2N42A 4MLDA 3IEKA 4A6EA 3SC2B 2UXCB 1P1IA 1PT7A 1YJAA 4PYRA 3K70C 4KYIB 2DZCA 2JZOA 3N2IA 5KZMB 2JARA 5K0NA 3V32A 1JDBC 4QNRA 1J25A 4HG2A 3IDQA 2QRHA 2G1UA 1VJGA 3IBYA 4HVTA 2Y2VA 3L79A 4KMOA 2RAPA 4FJ1A 1YB4A 1J0BA 2Y3IA 4OQ4A 4QBKA 1OWPA 2G76A 1PWHA 4K9NA 5J5AA 3ZU6A 1RWXA 4PGAA 3UNXA 4ALNA 4HHEA 4DYDA 5HS4A 5I3ZA 2FWNA 4G24A 4AD8A 4DMLA 1QR6A 1ICIA 1U9CA 3AEYA 4YUXA 3B5EA 3WA7A 2UUCB 3BMNB 2ANCA 3HXLA 3O95A 2GYWA 3ZCSA 2KX7A 1RKVA 3T52A 1KIAA 3LV8A 3SHFA 2MSCB 1DARA 4Z4EA 1WPQA 2KSQA 3QJGA 5KNDA 1B2LA 1U3VA 3UWDA 5AW8A 1Z29A 1I2DA 4C0HA 1BFKA 5BUCA 3O82A 2FUG6 4XDZA 2NGRA 4F72A 5TQ0B 1SIOA 1VRVA 5GZ3A 4LOHA 3M6FA 3ONDA 5DNYB 2ZRIA 4L6CA 5BWNA 1A8QA 4TL6A 4P1ZA 1MFZA 3VR6H 3HBLA 3OOSA 3AL2A 4D43A 2FQWA 4H3KB 3RQSA 1XMOB 2IXGA 4DLZA 4EUNA 4TZTA 5IRCD 1RWVA 4KZKA 4P7BA 2P6NA 3DR3A 3NIGB 4Z0PA 4IZOA 4NICA 5KJ1A 2RB4A 3EIEA 1EVKA 1A2QA 1J07A 4XX0B 1HNXB 3OHPA 3OQJA 2ATCA 2CJ9A 3DNMA 2KBFA 4I8DA 4YP1A 1IRXA 4W6QA 3WFZA 2PGLA 3LT4A 4K6MA 3PE4A 3U4CA 2ZU6A 2D2IA 2Z2ZA 2DR0A 5F21A 3D4PA 1IN5A 2HCFA 3PPWA 3LSTA 3ICOA 4O4HA 3DV9A 3WLSA 3CSDA 4PZLA 4LTMA 3O5AA 1ENOA 3TJZA 2DKFA 2BFBB 3UWOA 3A10A 1RZRD 2CNOA 4MUMA 3V2GA 4NVRA 1GEEA 1WVIA 4BPBA 3F1KA 4MZDA 1E32A 1TEVA 3PFGA 2CCGA 3V2UA 2CL0X 4Q4LA 1A69A 4HPWA 3T54A 2GNAA 4J6EA 2TMKA 4HNTA 4MA4A 4JROA 2PK3A 3GZ4A 1QXSA 2W2XA 3LKBA 3SJBA 1U94A 3RRMA 3MD0A 3IIEA 4KNWA 1A4IA 3AIMA 1YQQA 5DM4A 3AZOA 3TEFA 4L6AA 4M8KA 3IO5A 2XCRB 4WASA 3UK6A 1YOBA 3GU3A 4JBYA 3H9JA 4OHWA 4ZTBA 4L6IA 3D81A 1QBKC 1V25A 1PZNA 2RH5A 2RAFA 3QEMB 1A2KC 2LGJA 4K6CA 2REXB 3WRXC 4L5JA 1ZD8A 3MSXA 4M21A 4CMEC 4JP8A 4OREX 1CKEA 3OIGA 5HGQA 4S3MA 4UDYX 1QHSA 4PPYA 2A33A 4MRPA 2VAWA 1UUFA 4CG2A 4TWBA 4DADA 1PZFA 1HDXA 1WB5A 3D6TB 1M2FA 2HQRA 2QJOA 3NYWA 1TB4A 3O1HB 4MAMA 3C97A 3SEQA 1BVHA 1BE0A 5EYPA 4BWYA 5CB4F 3U9SA 2CD7A 2OHXA 4UUBA 2IY5B 4NABA 1K8YB 2QD4A 3OT1A 1BU5A 3PQ4A 1U0HC 1VI5A 1N8TA 3I1YA 3PIRA 4KIWA 3V1NA 2YXEA 4WE3A 5JY1A 1NQ5A 4BFLA 2RGNA 1S9DA 2CLMB 2IOFK 1ADJA 2P1RA 1GGEA 4KWCA 1JSXA 3OFVA 4BL5A 1IB6A 1H2AS 2GHQA 2IKSA 2WICA 5E3HA 1TA4A 1X1BA 3G2IA 1A9YA 5G1NA 5IVKA 3BIFA 1TM7E 2YIVX 2C2MA 4HDNA 3UJ7A 4F84A 2GTIA 2QD1A 2Q2WA 5AVUA 1ZVQA 3P8ZA 1KBZA 5IBRA 3S28A 4CG3A 3OZCA 1NLFA 2FPXA 4H7KA 4JI5B 2XDQA 4WOPA 5G41A 1HFWA 1L3CA 3BZWA 2XZOA 1W30A 5C31A 4PC1A 1E1RD 2D00A 4XLLA 1Z5NA 1Z6GA 1OILA 1RKQA 2Q2QA 4TMXA 3UHJA 4DJFC 2Q27A 4L9RA 4RLQA 3AVPA 4B4OA 3A0RB 1R4MA 3E5RA 1JQBA 1C1HA 1PUXA 1SUIA 2DH6A 2ZRBA 3BHMA 3IUQA 4GSYA 1Z37A 4G1FA 5HJEA 3WDSA 5TJHA 2OB1A 2VZ0A 3FYUC 3OQIA 4O59O 1VECA 3LUBA 1X7YB 1TE2A 4XX0A 4X62B 3EZYA 2WMYA 1MXHA 4MW0A 2F3RA 1L5FA 5JFOA 5COBA 4H6XA 3FDJA 1XXHA 2VJMB 4FQ5A 4HLCA 4AUEA 1JGTA 2RMKA 3IQGX 3LT1A 2GVZC 1S2MA 2FFBA 4O02B 3TUJC 4Z6KA 1SVUA 2BH2A 4DDUA 3NJRA 5HIKA 1WXHA 2Y66A 3KKNA 4U1RA 1MZVA 1SCAA 3OFND 3MJHA 3U7HB 2CV2A 5FBKA 3DMRA 4HA8A 1EAMA 1MB4A 1WMFA 3D7KA 1TM3E 5CH3A 4ZVQA 5KJCA 1MNQA 1UMCA 1UXGA 4C0WA 1ZA1A 3PC6A 5GONB 4RK7A 5KJFA 2ZVJA 1TQ8A 1K86A 4II2A 3DZGA 1GGKA 3EG9B 4CR7A 2ZB7A 1Z15A 2XMZA 4EARA 2GXSA 2JDID 3CPJB 3JQPA 3RNOA 1JG2A 3SY8A 1K3UB 2ZSIA 3I52A 1FP4A 2OV6A 3F47A 2ECPA 4MR9B 4W8GA 2H0AA 2F3UA 2FEMA 3HRHA 4ITUA 3WYNA 4ENRA 4KZPA 3H5OA 1E9BA 3EIHA 3GLHB 4LK3A 3WS7A 2VPZA 3EDOA 3N86A 3B9RA 5I5GA 5F9HA 3OICA 3PF9A 2PKEA 3L7CA 4F1JA 1KC3A 3A9VA 3RU9A 1PS8A 1DKOA 1W46A 1ZUNA 3CW2A 4L08A 4O2AA 4XJXA 5E8RA 5J2TF 3SAJA 1OFVA 3MVEA 1VE9A 3PGMA 4YA6A 1JEQB 3EEIA 1SXIA 1E98A 4F4UA 1C9JA 1XZHA 3COZA 3W5DA 5AVVA 1IEVA 1T2DA 4F60A 1O6ZA 1NQUA 2QX4A 3BD9A 3H2JA 4JBXA 5DF1A 3SN6A 3KAJA 4E07A 1PE0A 4D9GA 2XITA 2ZKLA 3E9IA 4B6EA 2DXIA 4F3TA 4JUBA 3ET5A 3UCXA 1N8KA 3DEKA 5EHZA 1SHKA 1UK8A 1QYDA 1XZCA 1PG5A 2J3JA 3R40A 3EUFA 4QUHA 1G63A 2L19A 1Y0BA 5K0CA 4P71C 1ECBA 2IEAA 1FFXA 5LNK6 3N8IA 1ZG3A 1V7CA 4XB2A 1YS1X 5AKIA 1PGQA 4D98A 3H5NA 3KX2A 1HM5A 2GBIA 2CT8A 3I9OA 1ZC4A 2YIMA 5EJGA 2JIDA 2XCIA 1J2EA 2B6NA 3K0CA 1JR6A 1O95C 3T5DA 1GAJA 5AD1A 5HM8A 3WWCA 5C4IA 2BCJQ 3GVIA 4Q7KA 1SKMA 4B2PA 1DWUA 3NX4A 1Z74A 4I99A 5ECYA 3VX4A 4BY9E 3HP1A 3EGDB 4RESA 1IBSA 5K0EA 1ULSA 3AM1A 1DKNA 3HHPA 1IAQA 1R4MB 3UMBA 4W1RA 1B4DA 2A1UA 4JU8A 2Z1DA 3LT0A 4KXUA 1W8DA 2ERXA 4DF3A 3BT7A 3LVQE 1V5FA 1LK7A 1FS5A 3QX9A 2VBGA 1Z8FA 4FSDA 4X1IA 3U17A 4L15A 3CLUD 2Z04A 1G8FA 2Y92A 3CUEF 2VPWA 2MR5A 1I33A 3ZQ4A 1P3DA 2WMDA 3I9MA 5J2UB 1W36C 1Z62A 2JC3A 2YJNA 3WMWA 4JA0A 1K9SA 4YWHA 4N0PA 5JI2E 1ORVA 3LHSA 1Y1QA 4RGVA 5DBGA 2HADA 1RABA 1YQGA 4FSHA 3C8ZA 2UZ4A 2XYRA 4KDRA 1GPAA 4MKZA 5LP6B 3EVDA 5HX7A 5JEDA 5TPWA 4DV4B 1COWD 1B3RA 2HDOA 3T7IA 3UQZA 2DVEA 4BMNA 1JFFB 4O1HA 1S89A 1NPDA 1WSDA 5KVAA 1OZ0A 2PS9A 3VO9A 1SVNA 2W2LA 1JB9A 5KX5A 4LXTA 1RWMA 4REOA 5KWSA 2GESA 3HLTA 3OIVA 2BI8A 1QH1A 3KTDA 3PZRA 1TAGA 2HNBA 1RJGA 3MB8A 4LKRA 3M5CA 4MNTA 4WOBA 5H7XA 3TZEA 2X0KA 4CU2A 4EZEA 3AG6A 3GARA 1KWGA 2RHTA 3MTAA 4IIXA 4R8LA 2J09A 4OIMA 1FUIA 3NQ41 1TMKA 4EVIA 5KTTA 3DP9A 2UXDB 3E1SA 3EQZA 1NXQA 3MUOA 3B7GA 3WRWA 3KLPX 1VM6A 2OV8A 5ALTA 4KMSA 2FY8A 1R10A 1D8AA 1XTSA 5CNJA 1JN0A 1QRTA 2IDMA 4UMEA 1IYZA 1JA1A 1HE8B 3JQ9C 4DA6A 3DEYX 4DUPA 1LCIA 3I9KA 4CNBA 5L53A 1L5OA 1QLHA 3FWNA 2IYXA 1C1YA 4B82A 1N4AA 2GBGA 3ZY4A 1ZH8A 1YRWA 2A9FA 2IPOA 4PIVA 2G72A 1L7OA 2WD9A 3FMIA 5CDSA 5TMEA 3FGNA 1Y81A 3EGXA 5CPFA 3N74A 3VISA 2KS6A 3Q7RA 2VJOA 5ER9A 4PTLA 3V4PB 4BQSA 1G38A 3LFUA 1PQUA 2AWNA 1WPYA 1I2ZA 5IKEA 4DMHA 1NMEA 1NM5A 3IV7A 2HJGA 5AJWA 4ZGGA 1CUVA 1LUAA 1IUKA 4ZEWA 4UM9B 1CUJA 2OD7A 3BGOS 3EY9A 5I01A 1ZMBA 1AS0A 5HK8A 4FHDA 3NGLA 5BWBA 1KO1A 1AG9A 4PBRA 3FI9A 1G3IA 1O6CA 5ELXA 2ZLBA 1L3BA 3T5TA 1KL7A 1ZOOA 2XWPA 2BH9A 4O8ZA 3RO7A 5C8YB 1CQZA 1FFBA 1NI5A 4HI0E 4HN9A 5HF9A 2E89A 3IUNA 3IT0A 1DBIA 2WFLA 4NENA 1OTYA 4UHKA 2CVFA 1VSTA 4NWIA 1PEDA 4Z4QA 2Z6UA 5JDIA 2UUPA 5FOVA 2EL7A 4C7XA 4MARA 1QK5A 1HK7A 2HIHA 3GBPA 1OBCA 4JLSA 4RKYA 5HXAA 3THYB 1YL5A 1DFHA 3CZAA 4KIFA 2XXBA 4KQFA 3QMWA 3CRQA 1NQXA 2UYQA 2BW0A 2G08A 1T9DA 1VSBA 3KWJA 4QLAA 5DM0A 1FNCA 3JASB 5FYQA 4KUHA 5EP4A 4ZVKA 3QY9A 2HNKA 1BD3A 2IEZA 4JB2A 3V8BA 4ZYVA 2EXXA 1Z4JA 3T41A 1CYDA 1DAPA 1USVA 3AUFA 2JPDA 5AK5A 1YFKA 4ZAWA 4ZHQF 3CJQA 3F7TA 3AGQA 1JQLB 1O58A 3FOEC 3ACBA 1RLIA 3JQCA 4YVFA 1E9VA 5M7EA 1NVVQ 5KWVA 3QVVA 5TXGA 2ZUWA 2NVUB 2OFXA 1QV9A 4O4LF 1IPEA 3G1WA 1GAWA 3FMVA 1E1DA 1NBMA 4RMFA 1QZ3A 4UASA 3EEQA 1HC7A 3ZZ1A 2BFBA 3UTDA 1VGRA 1U63A 3LGAA 1FFEA 5K3BA 3TPFA 1PJ4A 1RQ2A 3V5NA 1WYDA 1MH9A 3U48A 4EELA 4NMXB 1YS6A 5TVGA 1T4MA 5BMOA 1XC7A 2R60A 3M9XA 3JQDA 3NHAA 1M2VA 2XUGA 2WKSA 4RZIA 3EVGA 3MFQA 5DX8A 5BRAA 4DFDA 2IS4A 2AMCA 4PZYA 1O94D 1Q0QA 3C8MA 3DHYA 3IQXA 4FGZA 2PMFA 2I4TA 4IDOA 4JKYA 3G9TA 4BWAA 5LVAA 4D4JA 1V4BA 3NWBA 1T2CA 3Q0IA 3AIKA 4DQUA 1GUZA 5L40A 4P0QB 3FOZA 1AGRA 3UH1A 2FXVA 2PUWA 2QRZA 1WZIA 4OD0A 1TM4E 1Z5WA 2HK7A 3HZZA 2E4XA 5ADVA 3OZ7A 5DN6D 1Z2NX 2J6CA 3EAGA 3G2HA 3I83A 4H4EA 4TX1A 3SF8A 4O4JF 3ZWCA 5ED4A 5EJ7A 4HGPA 3VQXA 1OYYA 2BM0A 3AI3A 3KDAA 3FH0A 4PYOA 3I2YX 4QGSA 5C1OA 4Y9DA 3V1UA 4ITVA 5EP1A 3KAQA 1BMFA 2HBZA 4MPRA 2VP5A 5DI9A 4DMKA 4N3AA 3QUAA 5E0OA 3CVYA 3NAQA 1RRPA 1U3WA 3U9LA 1SRYA 1YO6A 3C3XA 4ZI7B 2ZSDA 3KELA 3ZVNA 4RFLA 2DSNA 1CRPA 4GC9A 4B31A 3DMPA 4PYLA 5AUQA 4INOA 1W4LA 4II7A 3TNFA 1BQ3A 4XUEA 3NDJA 1HG1A 4AFNA 2Q9CA 3QA3E 1A72A 2OCLA 3HFJA 3RUCA 4H7FA 4Q1VA 4OHOA 3G0IA 2IV2X 2ZJ3A 4BLPA 1NOIA 3A14A 3LC7O 1I7DA 4B8YA 4DJEC 3VMMA 1SOMA 3MAAC 3OKFA 4P92A 4JV5B 3D6VA 4MR9A 4WHMA 3R5XA 2VSYA 4C08A 4DVJA 4WOCA 1QB8A 1B2RA 3ADKA 1V3TA 1OT5A 4ONEA 3R20A 1MOPA 3QKRA 5F3RA 1I4OA 1QOZA 5LLSA 4L0QA 2BONA 1C7IA 2HSDA 3F5MA 3RGGA 5JNTA 2FZLA 4FFRA 1E63A 4DV6B 2Q4EA 4D9MA 4C6SA 2H0RA 1H6DA 1YFZA 4AROA 3MWKA 3LCCA 1AQIA 1QZTA 1RXIA 1XDZA 1ZH0A 1JHMA 1HYGA 4R51A 5BSEA 4EHBA 5K3FA 3VKUA 1T1IA 2AN3A 1PLKA 4KH0A 1YS9A 1V95A 3WHPA 2ZI6A 3RPEA 3G82C 4J03A 1NVEA 1T5BA 1G98A 1NNLA 1QWOA 2H29A 2P9EA 3JQ7A 3LY7A 1MOSA 1ZX1A 3T9CA 5CA1A 4XX1A 4Z9YA 4EAQA 1P1FA 4TTJA 4LYYA 4BRWA 4CS4A 5JZOA 3GLGA 5JXIA 5HP4A 3PGVA 1UC8A 3EQ8A 3F90A 4KMRA 4IJMA 1ZL2A 4QU0A 4ZT2A 1LFDB 4QEDA 4ZHQA 1AMUA 3VQYA 2WJYA 2WFAA 2JGKA 1LY1A 1BMTA 3EW7A 4P8RA 4FDUA 2E5WA 2J0EA 3HU3A 3GMSA 3L8MA 1SQFA 4ZT5A 4RL6A 4OYRA 1C3LA 4XVCA 5FUMA 4AW9A 2E4WA 4M54A 3S0JA 3ZWNA 3WK6A 3AHGA 1WMBA 1YV9A 4FT2A 1HDGO 4LXHA 1CUHA 1WKBA 5I4BA 1RQRA 3AGPA 4OI1A 4NZPA 2QE7D 4ZHSA 1KEUA 1O0CA 4FNAA 4UARA 2RGEA 2PRJA 4KITB 1GQOA 5FDFA 1LNQA 4K05A 1DG9A 1YJXA 2JHPA 2EGUA 3K15A 2X1VA 2OCPA 5G2OA 1AUQA 1TCUA 1F0YA 2GBLA 1L1EA 3MBOA 1H2ZA 4A2PA 3EFSA 4DIFA 1MO2A 1TECE 4MAAA 2RH4A 1CZHA 1R9NA 3PDIB 5JC1A 1PG2A 4FHFA 1AA6A 5BXYA 1YACA 4AJ1A 3T4EA 3O2QB 4JUCA 4Q9NA 1ZLXA 1N3LA 5D51S 1RRKA 4PYQA 1GG5A 4JJ8A 2WZBA 4H0FA 2ISCA 1EFLA 4IXWA 1P7VA 3ED1A 4KUGA 3LY9A 2ZROA 4YECA 4RX1A 3BWDD 1WQ3A 4Y7DA 5AK0A 3MEYA 1OU4A 3VTZA 5A0TA 3EAFA 2Z4TA 1ZZGA 3AIIA 4GGOA 2Y68A 1YGBA 1PL8A 2AW5A 2MINA 3DOHA 3F98A 2KE5A 3O92A 2PZLA 3BMOA 3W6UA 5KPDA 1BQEA 2VSOA 2HW8A 2XMQA 2VJDA 3T99A 2C29D 4UNIA 1PD0A 3WHKA 5CVEA 4R40A 4C4XA 4C7VA 3CIFA 3VPCA 2ZBEA 2P2YA 5COQA 3OCVA 5SY4A 1PF7E 3HRIA 4E12A 1IEQA 4TZKA 3TCXB 3N0RA 1G6HA 5KNBA 3TL2A 3X1XA 3UMSA 4PRZA 2FJ0A 5FKJA 2I2AA 3FWPA 1L6RA 4UEOA 2JBWA 1PYSA 5JQGB 1JE0A 2NT3A 1QP4A 1YDWA 4G4SO 4P32A 3QTCA 4M6WB 1PVVA 4TTSA 3V4ZA 2XZLA 3GLFB 2I78A 4JGGA 2NO0A 3NOQA 3PHBE 1G8YA 2J6IA 4LAFA 2H1IA 3GVCA 3ZE7A 4EY8A 4U2BA 1MT0A 4HYQA 1GUDA 4KLAA 2CVZA 1NW7A 1P0FA 1T2VA 2L42A 2XIJA 3G5LA 1RPJA 1YDFA 3OU6A 8OHMA 3H5VA 3AHCA 3IEVA 1KAEA 3LQFA 5DN6A 3WMGA 2BF7A 3MGBA 2QQFA 1LA2A 4WIAA 3Q6MA 1KEWA 3VQWA 3V46A 1SELA 3DZ8A 2I9PA 3W3ZB 5HIMA 3LUJA 1T0BA 4BQNA 5C1IA 4OOFA 1VYUA 4G26A 1QTIA 1QKJA 3ZCPA 2P6MA 4ESHA 5ALZA 3JWGA 1AV6A 1X7GA 1B70A 2H4WA 3ECAA 4CF4A 3EIFA 4MQ5A 4GMXA 4BDSA 3GLVA 1P6UA 1Z5PA 2VJCA 2RHSA 4ZVUA 1IBLB 1H0HA 1W85B 3P32A 2R8BA 3WO1A 2P68A 2ZULA 4XGQA 5IH3A 1CVRA 2HU5A 4G8JA 4B3XA 4WKBA 2PRKA 3UFXB 1E5LA 1KGSA 1Y8ZA 2R44A 1AF7A 4YI5A 3ODGA 1FNBA 4H4CA 3WB9A 4F12A 2AI1A 3FSGD 3FOWA 2FCAA 4A4DA 3V7SA 1V37A 2C8LA 4G4SP 4PO8A 4UTOA 1AHHA 2ZSFA 4P5PA 4NMHA 5E4FA 3R7BA 2B6HA 4D3DA 1J7JA 2WFZA 1Y4ZA 4P34A 4AXBA 3H8VA 4GC5A 4D3XA 5CP8A 2YWFA 4FB5A 2FZ4A 1LPAB 4Q34A 3VPSA 3KQYA 1CQIB 1O6GA 1UMKA 2B0CA 2D7CA 4MGIR 1Z0UA 4JGBA 4ALLA 4CCYA 3ETGA 3UAXA 2ACVA 1N0HA 4QFDA 4QPCA 3NTUA 4NULA 1OGYA 1YR8A 5DU2A 3OJXA 1IZ0A 2A9OA 4WN3A 1J0CA 1TAHA 2K2QB 3RIMA 1BOOA 3T4UA 5LN1A 1HR0B 3GVPA 3PVZA 1Y6RA 3GJ5A 2IUEA 4OH1A 2JH3A 3ZH9B 2A5LA 4YAEA 3VU9A 1VSVA 3N0XA 4I50A 1IEWA 1ZKMA 3L1VA 4HQFA 4QQRA 3MA0A 1IC6A 2WHYA 4CM8B 1LVUA 3AEQB 4FLFA 2HX1A 1L4NA 3IIIA 3U80A 4ETMA 1U2GA 2XUDA 5AVTA 4YYEA 1H65A 4PN3A 1P80A 1QJCA 5AXAA 3MMXA 3ZYZA 4KGZA 3QVWA 3TW4A 1G7SA 3I92A 4UVHA 4ZRMA 4YRCA 1RWOA 1I8TA 1PL6A 1W73A 5JH7B 2BMAA 5C80A 2A7XA 1Q1ZA 4LPSA 1R0KA 4V0NA 3HACA 3P9KA 3JZMA 1YHZA 4KAFA 5I51A 5JTTA 1YXMA 1P1BA 4ZVSA 1TJ4A 3KQQA 1EM8A 3A6HA 1J00A 1GD1O 4HT4A 3CWQA 4G5SA 5JSKA 2Y9MB 1WMEA 3IIMA 4XYBA 4EBFA 4F04A 3U7JA 2RHOA 4WCFA 2PE5A 4P73A 4XSGA 4CG0A 3EA4A 1VG9B 7YASA 4JQOA 1B6TA 1RLTA 2W6PA 4L4RA 2SHKA 3EXIB 1K7CA 4FOPA 1F9EA 3LSSA 2FETA 1C41A 1OX4A 2PMDA 3CTPA 1SMKA 2PCJA 3I2JA 4JITA 3U26A 7ADHA 4G1MB 5K8UA 5K4HA 3H65A 2Y0DA 4D5GA 5IM4A 5FL7A 1C0AA 1F6WA 1W5BA 2CZCA 3I45A 3U3OA 2GNPA 4MUNA 3O4IA 1H4TA 3EIXA 4JMPA 2O7VA 4OBEA 5DM70 2RGNC 3T3GA 5LOVF 1UBGA 1DELA 4Q19A 3OHSX 3B6KA 1P29A 3IQEA 1REQB 3EVBA 4QPNA 1E7QA 5BY2A 1Z2PX 4J1QA 3WB1A 3L4BC 1HZZA 5FULA 4NONA 1F60A 1W47A 3KJHA 4ZVOA 5IEJA 3EB9A 1CP3A 2ES4A 2Q0HA 5BN1A 4I9FA 2DHEA 4OGWA 3IP3A 4U3JB 2PNFA 1WUYA 4N6OA 1Z73A 4P3OA 1U1GA 3TPZA 1EB8A 1NLMA 2XB4A 1GNRA 2P4HX 3NVDA 3ONWA 4MYDA 4JJKA 3ENQA 4ATNA 2V4ZA 2VO1A 2F1HA 2P8SA 4HYEA 5ALYA 5JRZA 1LNZA 2A6PA 3E7WA 3D2CA 4KIGA 2HA2A 1NMXA 3TOXA 1BRTA 1M2JA 2ZKIA 1E3IA 5TF0A 4S0ZA 5JCJA 2P9HA 1B00A 4EG6A 1VKNA 1OUMA 1U0GA 2B5VA 5EIOA 1AMOA 3UUWA 1ZR2A 1Z63A 1JEYA 1E9DA 1SKYB 1UBJS 1QE3A 1MF7A 3DVAB 3IP9A 3CNNA 4S24A 4FZRA 5DT2A 3R7SA 5KOHB 1ODLA 3DXFA 3GUZA 4HQKA 4E13A 4AMGA 1Y6QA 2C2ZA 3FCUB 1PBNA 5AKGA 4AO6A 1LVGA 3BCHA 3C4VA 3ONNA 1SQSA 4MR7A 2E87A 2C3UA 3UK2A 3WIDA 3H3FA 4XGIA 3D64A 4ND5A 2VWPA 4OSEA 1UQUA 2AN9A 2OKGA 2TMYA 4MQLA 3Q7EA 4FU0A 3AY3A 1UK9A 1EWTA 1YOVB 2Q3FA 1UJ2A 1WMDA 2AJLI 2XNDD 4F6LA 5I7AA 9LDBA 3HSYA 3M6IA 1UODA 2TS1A 2CVQA 3TTVA 3T15A 3ZVMA 3LY5A 1L5VA 3WWZA 2J3KA 4QXMA 4V2IA 4D4IA 4Q3EA 1QRAA 5F9FA 5ALFA 3UHAA 3R8FA 4RZQA 1AKRA 4I4CA 4KRXA 1OGJA 3DTYA 3L0YA 2O0HA 3LUHA 3LX8A 3NKFA 3OX3A 5FHRA 3DTTA 1M2VB 4RGQA 1LH0A 1WM1A 1MKYA 1XCLA 2WHPB 5MHTA 3N7UA 3M0EA 2PBRA 2Q5OA 2V6BA 4LRUA 4XIGS 5L3ZA 2GDZA 3OQPA 2HPVA 1A5TA 2QP3A 2RAUA 2YICA 3OQHA 1NU6A 3DMNA 4IMPA 2IYLD 4M2LA 4NBTA 3VTFA 1DB3A 3HY4A 4LDQA 2O0LA 3BB1A 2QHTA 4UTNA 5AVKA 2P79A 1NA5A 3LOPA 2G1AA 2ZJFA 1D7AA 5H68A 2DFNA 2FB9A 4KO4S 2FMIA 3KE8A 2A58A 4S05A 1BCSA 3FLAA 1U3UA 5IJZA 2CSXA 3K4PA 1UWLA 3L01A 4D80A 2OXFA 2PUCA 2XE7A 3BWBA 5JJCA 5L6LB 1UPUA 4UEJA 3THSA 3MRXA 2TYSB 2VYQA 3AKYA 2FSSA 1LS1A 1NV9A 1XR3A 3L4SO 2A1TS 5TGZA 1VMAA 3VZQA 3KUUA 5KEIA 5ARDA 1A3CA 2OXCA 3EVCA 1O8BA 1JHOA 3AUKA 1GAQA 3MOSA 4YLGA 1Z07A 4MUJA 2GAJA 4DKJA 3QWFA 2ACKA 4G25A 1NP7A 2N3ZA 1PU2A 3EEOA 1DHTA 3F6EX 4RANA 2BFDA 1OIWA 2R9VA 3K1YA 1ZHFA 3PNSA 4JJIA 4WXYB 2PMBA 3OLXA 3NJ8A 3IR6A 3QNMA 4RENA 5DX1A 4RQFA 2DQ3A 1PLLA 3QVOA 1PZGA 1GGHA 3ESYA 4X91A 1QHIA 2EFEB 4UM9D 4V0QA 4NPCA 4KREA 3AFHA 1VP9A 5H81A 1O9BA 4NCIA 4Z3DA 1GRQA 4QBFA 5C34B 4Z0HO 5ESDA 4II3A 4YRMA 1UJMA 1M74A 4JKIA 4MAFA 5JADA 4U2KA 5TMDA 3BL6A 2XWJI 4W9NA 3A6ZA 2XQJA 3TL6A 1ZM9A 4MRVA 4PIPA 4XFJA 3MT7A 3ROEA 4U7JA 1WO8A 1CJSA 2ZUSA 5EZSA 2PVSA 4DCJA 1C80A 1RI4A 3P2EA 1HLGA 2VHCA 3UYKA 1OZFA 1RPTA 1T5IA 2F1OA 1UDAA 1M2HA 3I8OA 1SHUX 3JQ8A 3QKSB 5EE3A 4CR8A 1KJ8A 2PKQO 3OLQA 1UBFA 2GKOA 2V7EA 5LQNA 3IELA 3AKDA 3K8YA 2ZRGA 2P9GA 2VDJA 4D2IA 3FOFC 2C82A 3N07A 5A5FA 2JI8A 3HLKA 3HP4A 1QHXA 2PKRA 4G81A 5IHXA 4LX0A 1Q0HA 1FYWA 5C35A 2DC1A 1I4DD 2G8LA 4OL0A 1P0QA 5I8ZA 1M6VB 2DQ4A 4BAGA 5I9BA 2YC4C 1Q7GA 1LQUA 1FPQA 4QGFA 1D03A 1U28C 5JWOA 3DZIA 3ILHA 1BIBA 3L9WA 5JZBA 3MINA 1IIBA 2ZRDA 2ILTA 1PKEA 3IULA 4B2LA 3O9MA 1KP2A 5KC9A 4BE9A 4IIFA 1FX1A 5BR8B 2P2DA 3LBHA 1VE1A 1N0IA 1G5TA 4FFNA 4O08A 3THWA 3F8WA 1JW9B 1SVMA 1SU7A 1TLLA 5A62A 3KV1A 3QX3A 1XP5A 1POWA 5AKHA 4DANA 1E4OA 1Y63A 1X1DA 2VXBA 4N5HX 4KEAA 5ECWA 3V8LA 3I2IA 4ZKEA 1QGOA 3ABSB 2RHLA 1H0KA 4W5WA 4OHYA 1VYTA 4BLRA 1XEXA 5CK5A 3EA0A 4WKOA 1J56A 1ENYA 4RVDA 3LTNC 1G2QA 1Y9JA 4NE9A 2PUGA 1IWPB 1E9FA 4TVBA 3RRXA 1TVCA 2IIPA 1SM4A 2IZ5A 3I5AA 4TYMA 4AZ0A 5JROA 1BE6A 3SEFA 4OGKA 3HBMA 4JD5A 3IKVA 4UZSA 4W82A 3VSAA 3UJBA 1XIVA 2EBWA 2O4CA 3NGMA 4FCTA 5CJ2A 2C4KA 5A7HA 1AQJA 4ZVVA 4URZR 1T29A 4ND4A 4CQNA 3AM5A 2A9VA 5FI3A 3SM3A 4X61A 3ONEA 5JXWA 2ZQYA 1AS2A 4P38A 1OWNA 3WVNA 1N1EA 3BS4A 4R01A 1KJ9A 2Z09A 3K5IA 2CHFA 4BQEA 4KHZA 3J81k 5LD2C 2R1UA 4XIYA 3VPAA 3ZWVA 1GZ5A 1V7ZA 2X14A 2X1MA 2V7WA 3RS2A 1G60A 3RBZA 1RHUA 4HD8A 5DLQC 4RIGA 2OBNA 3AJ9A 2QQ5A 4DVGA 2VA8A 4U2GA 5CCBA 3N6RA 5TQJA 1NW8A 2DU7A 1AKNA 3NALA 3HKCA 1ESDA 2BFNA 2IOQA 5AIAA 5FBQB 4ROTA 1W2WB 1L5HA 3WGNA 5AI8A 1ZH2A 2B4AA 3T6KA 4DREA 1P7WA 2PLRA 1AHPA 3I6ZA 3IERA 1Z5VA 1DI0A 1MJHA 2M9MA 2PANA 4HDNB 1K6EA 4HNHA 2HPHA 2FN3A 4DLYA 2ZNIA 3D43A 4WNCA 5G40A 3U4AA 1KFJB 2H3EA 2VDWA 4I7EA 2CYBA 3OX4A 4YGXB 4FHEA 5JD5A 4OX9B 3DNPA 1MQ9A 5TEWA 3KR1A 1NN1A 1E6CA 3PD1A 2ZDQA 4G2NA 1R8XA 1C7FA 3O26A 1QRDA 1XX6A 3AX6A 3B51X 4I46A 1W88A 5F7XA 1NSFA 2QW0X 3LBYA 1WHSA 4XPIA 5AI4A 1IN8A 2V3WA 1G5IA 1T6YA 3EIOA 1NJ1A 3LDAA 1GNTA 3KOXA 2DHDA 4TTPA 1N6RA 5TR9A 3IV6A 4KLRA 1KU6A 2ECOA 3CZ9A 1YB7A 3M2PA 5AW5A 4D6PA 5KX5F 2CLIB 2DAPA 3R24A 2NYRA 1RVDA 5EJAA 2IYWA 2WKRA 3RVDA 2DWPA 4EGJA 4EG0A 4MQ6A 1ZICA 4HTFA 1K4MA 3CKYA 3WKBA 5K0LA 2J9XB 2JI6A 3KVOA 3AB8A 4TVAB 3DMDA 1DIBA 3Q1LA 2I03A 5TPWB 3V4RA 5AKZA 4DUGD 1KU0A 3VFDA 1P1JA 2N9UA 2VHEA 5FLYA 3NB0A 3WSTA 4ASUA 2CJAA 3DHNA 3NS7A 5LL6P 3IAAA 1F20A 1ZIXA 4UBKA 4AKEA 4PPGA 3QOXA 3K71B 2IZZA 1CRQA 1AO3A 3A58B 4TTVA 1OKKA 4S2EA 4HPXB 2HH9A 1Q44A 2FTKE 3D7NA 1JZTA 2JVJA 3NAMA 3E3NA 4H2YA 3QYPA 4PFQA 4U9UA 2A67A 4H2VA 3G8YA 3ZH2A 3WLLA 4RTSA 2ZTUA 1Q3KA 3I9NA 4Q4HA 1WZ2A 1P73A 3QF4A 1W5EA 4LF7B 1WBBA 4I3FA 1EB9A 2Q2OA 2R5NA 2RSLA 4HDRA 3CZ5A 1IXZA 4G5XA 4FXOA 4QT4A 2FLKA 1SU4A 4V0MA 3UV7A 5IDYA 2GOYA 3ESRA 3BFPA 3KJFA 3K70B 1CJKC 1NF3A 1R8QA 3RVLA 1NVTA 2AOXA 2IXAA 5B7QA 4Q9JA 1ZONA 3GIDA 2DPMA 2NV6A 3LJKA 2GTHA 2WYOA 1OWOA 3MQ4A 1GU7A 4F92B 2V8BA 1RKBA 5J5CA 4NG5A 4R0NA 4PF1A 3BHNA 3IVMA 3KKZA 4AJHA 1EFCA 1GR0A 3LA6A 3SDBA 5B1YA 2PKXA 4MICA 4QYXA 1E3DA 1NVGA 1Q3TA 2NX2A 2WSSD 2ZCUA 4LGMA 4DNFA 2RHGB 2FMHA 4RJIA 3REFA 3GJQA 3NVAA 4WZZA 4URYR 4ARIA 3DTVA 3U1TA 4RZHA 5TT0A 3ETJA 4WUVA 3FKSA 4TYQA 2QVCA 3GOHA 1S3SA 2YS7A 3DMGA 2JVIA 3ZIAA 4NU5A 5JD6A 1L1RA 1XEXB 2A35A 4C1BA 4C0LA 4ZYZA 2NO7A 2XYGA 3S40A 2V9ZA 3A6KA 5ICEA 1GKLA 4PZZA 2I4LA 4EY7A 2ZR8A 3CKKA 1KFCB 2RHQA 1BEUB 4HFMA 1LPPA 3HV0A 1CJCA 4ABYA 1PNRA 3TE6A 2HRZA 1N5DA 3PJFA 1PZMA 2AH5A 4RD3A 1V6CA 3II6X 4PLHA 1A8IA 3RUDA 3TZ6A 4GX2A 1T9GR 2B5WA 1IJBA 2DUWA 3TLMA 5ADUS 2WY2D 3U6BA 4OMCA 1SCUB 1W6UA 1Z8HA 4O0LA 4CIVA 1OI7A 3VOSA 4DXAA 4JIGA 3RM3A 2CB9A 1CCWA 2J0SA 4HK4A 3FZNA 1M6EX 2P41A 1Y3IA 2Z30A 2L69A 1T2UA 1FFSA 4QOFA 3IKTA 2EW1A 1U3CA 2R25B 3E4CA 4MYCA 4WZBB 4Y1GA 3UWKA 2P9CA 1O08A 2ZUBA 5CW1A 3C1UA 1AN0A 1D0SA 3AUJB 4XTRA 3JQFA 1IY2A 3T12A 3TMAA 2QV7A 4OP0A 3FSJX 4BNJA 3KALA 4QSMA 4DQVA 2XIQA 4PCLA 3D8NA 3GV0A 3MGCA 4WFQA 3IMKA 3KV3O 3W3AH 3CVJA 3KVYA 2ADFA 2B8EA 2CKMA 3GC6A 1SBHA 2GRJA 5EZYA 3MTBA 3KOMA 1VYVA 4Q24A 3T8YA 3K9HA 4BVGA 5KNDD 2DUMA 2X3YA 5BW6B 4ZCPA 3STWA 4TKMA 4HNQA 3I1JA 2PQ6A 3KJGA 4ZVPA 2ZAOA 4PRKA 1EP1B 2E2WA 4DLRA 4E7OA 2AOTB 2V6IA 3ELYA 3WLJA 5BMVB 4XYEA 2QJRA 3H05A 4CS2A 1N1DA 2XMCA 1QH8A 2R1ZA 4JASB 4L28A 4NR0A 1S2GA 4RQBA 5DI3B 3I61A 1U0BB 2P1ZA 1GYRA 4XI9A 4MDYA 4R41A 4G5YA 4ZZIA 1Q91A 2VCHA 5U9CA 5GM2A 1M34A 4UNNA 4AULA 3K2IA 1N2XA 4OBBA 4B48A 2VJLA 3ABZA 1M5UA 3K35A 4BZQA 1THGA 1XA3A 1LPNA 2KMLA 2EJ9A 3FPHA 5DGCA 5KREA 4JH0A 3BTSA 1RP1A 1B16A 1XU9A 5EKUA 5TPZD 1NY6A 1GQYA 1NYLA 1PCXA 2CHGA 3E3AA 4TROA 5JXJA 5K3EA 5CM8B 2VT2A 4R1OA 4UFPA 1KPHA 1U7HA 1C9KA 2HTEA 3H0KA 3MLEA 1SC6A 4M0FA 1JLLB 4BLSA 2WKPA 3E3MA 4PYMA 4I5IA 2XDQB 1SCJA 4A1FA 2LDBA 1A1VA 3EGWA 3K16A 4O2LA 5DH9A 3KQNA 3IVXA 1GYQA 2XECA 3QV2A 1Z88A 2ZI4A 3K0EA 4KVFA 5ALKA 4CBVA 4EFKA 4ENWA 1Y1PA 3VNVA 2EJBA 2ZANA 1JFSA 1D4ZA 4IMJB 3RS8A 1DBRA 2CNNA 1UT5A 4NYJQ 1EJ2A 1QDUA 3B7WA 3EH1A 2WK1A 2PMWB 4TQ9A 2QPAA 4OA5A 2YS6A 3BMQB 2C58A 3PDJA 2H1LA 4JYZA 3P4UA 3DEFA 2Z8YM 3K53A 4RY2A 2RHDA 4WAUA 5JNUA 2QHUA 3HXUA 1J49A 5KB3A 1FNSA 2VQSA 3FUXA 4HC4A 3D5QA 1UMBB 3R75A 1E61A 3WA6A 3TLZA 5KYXB 7MHTA 1ODKA 1XTKA 3HA2A 4TSRA 1UJCA 1EPUA 1VCOA 4Q1EA 4CV3A 2C95A 3JYPA 3BORA 1CIVA 4L8GA 2RFLA 3A9UA 1BMFD 2GZ2A 4YRZA 2PRZA 5F73A 1JYEA 3UXYA 1KH2A 2QY9A 3F2IA 3THWB 2I3AA 4EKYA 2FEOA 4QUJA 5INTA 2WWIA 1OX6A 2ZB2A 3OZAA 3RF6A 4YJ2A 3IJ5A 1F9AA 2FEPA 2RG7A 1NW5A 2C3OA 4TRRA 2FLVA 2H1RA 5EE0A 1F4LA 4GKVA 2C2WA 3BL8A 3F3KA 2HYIC 3U4GA 1PT8A 5JFTA 4M86A 4QJ3A 1FS6A 1U3TA 2P1DA 3UG6A 3PGA1 3I6IA 5BQPA 3KJNA 1EFPB 2IYSA 2P2SA 3HY1A 3MHPA 3VU0A 1V8DA 1AUVA 4LSMA 3H1AA 2P5TB 1A8PA 1IJEA 3QJYA 1BA3A 5CB8A 1J70A 3OCZA 3R9XB 3NHRA 3KU1A 2FOLA 2VOEA 1QTNA 1M76A 1QIKA 2QR5A 4A8JB 2IHZA 1B73A 4Q6WA 2Z58A 2JGDB 1ZD9A 1SUWA 4Y9TA 5A4DA 3M3DA 3OMLA 1LBIA 6AT1A 1JDNA 1AQYA 1OA0A 1T0PA 3ZXUB 1TK3A 5F4BA 1JEQA 1JAYA 2POCA 2VYND 3PFHA 1FRQA 1H1DA 4H9GA 3UKDA 4CTOA 2ONYA 3D9QX 5D3MA 5GJCA 2XA2A 1RXYA 2QVYX 3IQFA 1Z0JA 2ZZGA 4EWLA 1WUJS 3EGEA 1FTGA 1UDWA 5CAEB 3TECE 2AR7A 1WDLA 3WNQA 1WL8A 1BW9B 2XAUA 2PWZA 2F00A 4OGGA 2CDRA 3GRVA 3H42B 4RF4A 5D5QA 5DM1A 3SZLA 4MUFA 4MUEA 5LDDC 1E2KA 5CFZA 4R2JA 1T35A 2X9VA 5BORA 3AKZA 1GKUB 4QARA 1BBWA 1ARZA 3QU5A 3ESDA 1QP8A 1UPXA 2WF6A 3LT2A 5CNKA 2Q1UA 3ICAA 1CW2B 5DISB 2YN0A 1GSOA 5DN9A 4JUFA 1ONBA 5SV2A 3K5PA 3TCNA 2OBXA 1RRGA 1XLUA 2I5PO 1QOQB 2QB5A 2Q3CA 4ZPJA 4KO2S 3LP6A 1Q11A 3KDSE 3H4MA 4FMBB 5KWIA 3OJWA 3LRPA 2YUTA 5BSFA 2ZXUA 2NYUA 3GPCA 2FJPA 3N75A 4UXIA 1EVLA 2Z8YA 4WSOA 1IM2A 3UAYA 4XRGA 3AVYA 3WDLA 1R3DA 5A9TA 1T25A 3PNQA 2Q5LA 1OWMA 4OFWA 1TM5E 1IOZA 2QMOA 1XWWA 1UZUA 3KWMA 4N3BA 1HX7A 2B7BA 2HGSA 1HFJA 3FHJA 4JLKA 4WUTA 2Z1MA 5AP9A 4BLQA 3DE4X 4D9KA 4CIWA 1QO9A 5EEHA 2DJZA 1PQ4A 1K8XB 1TCBA 2C98A 2J9GA 3LXRA 3OJEA 3WB2A 1JU3A 5C46F 4HS9A 3KXPA 2X3UA 3A1EA 3OD1A 4NESA 2HZ7A 2WIAA 4MX8A 4NCJA 1BU8A 2R7KA 4RHEA 1NPYA 3RG2A 4CTKA 1LQTA 4DY6A 5KDDA 1EUCA 2NTJA 1U7OA 4HAWA 3TLJA 2TMGA 4KN6A 3GPIA 4QC2A 2R6JA 4TVYA 1Z8NA 1XQWA 3AUAA 1JPNA 3O0TA 1V2GA 3SXUB 2CVPA 3QA9A 3VR6D 3L92A 2OV2A 1CUEA 1SBZA 1E9EA 5CX1B 1G8PA 1VA5A 3U5ZB 2W6QA 2RJNA 4WZAB 1ZCAA 3PUVA 3SOPA 1ZM3A 1ECJA 2OVFA 2NQ2C 3TK1A 4NG4A 4L51A 4EFLA 4Z4HA 2ZM6B 1BXRB 2FSVC 2HF9A 2FMTA 3D5EA 2XOKA 4P4TA 4PSKA 4BNLA 1M2GA 1N2SA 4IIEA 4IKEA 3QBTA 4OMUA 5CDTA 5FL7D 4EJ6A 2CYAA 1CTQA 1DUSA 1PFYA 1M8PA 1TFUA 1XVVA 1SKYE 2DCMA 2FEKA 2W37A 1YQUA 1PQYA 2H7CA 1WULS 3HG7A 4MQBA 4WKGA 5KYYB 1A5ZA 1Y33E 4B73A 1EZ1A 1IVYA 3OBIA 4M1WA 1W2GA 3I9V1 2J41A 1C2TA 2GPAA 2VJYA 4U3JA 1RXVA 3CUTA 1OFUX 4ZAXA 2Z4RA 1UP7A 4OCZA 5M04A 2YRXA 2C9BA 1M2KA 1B3BA 2NXWA 4C14A 6LDHA 3NDIA 3LCUA 1U98A 4LMPA 4C6TA 1GR1A 2IU0A 2IUYA 1NT2A 4GOND 4UQLA 1BNCA 1E5XA 1GP2A 2NXJA 2D5BA 4TUYF 4Z4IA 3Q8XB 3LMKA 1ZISA 3QK7A 3IOCA 3N0TA 3QYFA 5K8TA 4WKNA 4RTNA 1T5LA 2AG6A 4XWTA 4CR6A 4DB4A 2E5AA 3AF6A 3VNBA 3UA4A 3OPYB 5D5HA 3C8DA 4LNSA 3NC1C 4DC1A 4FFWA 1I2AA 2O8DB 1F2DA 1GPUA 2P7HA 4QDJA 1H9CA 5JY6A 4MPDA 3TIGA 4CFYA 3CEHA 6CHYA 1YBMA 2X4GA 3S44A 4FXPA 4GI2A 5TDHA 3TIIA 1NRWA 3WLNA 3EULA 3GVXA 3W1EA 2X41A 3F7OA 4M8LA 3HDGA 3MOGA 3NP7A 2KHZA 3K8ZA 4OHKA 1C3OA 5C1DA 3PSAA 1H23A 2ODQA 3FKQA 3JW8A 1OV6A 4X97A 3URMA 2QAIA 3HJUA 1IEXA 4FGJA 2WAXA 4Q4JA 3AM4A 3LWZA 3AY0A 1FVFA 1G7RA 3LX4A 3EXIA 5HILA 1V8BA 4P36A 1ULBA 1PD1A 1ZZEA 3DDZX 3WLQA 4TWJA 4FI3F 4YJ3A 1Z3CA 1TVKA 2B2XA 2XR1A 1P9WA 4I5GA 2VHUA 2YN2A 5FPTA 3TOSA 2C1EA 3F5FA 5IT5A 4CJXA 4UMVA 4QXPA 4XEHA 5HF5A 1XL0A 2OD9A 1QJ4A 5JSFA 4FZJA 1GSIA 1XTIA 4ER5A 3QE2A 5J59A 1L5QA 3O8QB 2X5XA 1CJUC 3VSCA 3EXFA 2BMDA 5AW3A 5EJ2A 1HT1E 4OSPA 2FWIA 4IS2A 1N5LA 2GZ1A 1GUYA 5KYWA 2J7PA 1E5TA 1NNSA 3PRKE 5B3LA 4F8YA 5CFQA 3EN0A 4K88A 1ONOA 3T1VA 4J0HA 3ORSA 2W0MA 1N6OA 3PDWA 4MQFA 4UHDA 4UMFA 5AOCA 2G63A 3U62A 1TKBA 1S3GA 2FYTA 2IXDA 2Z2JA 4XDHA 2H2HA 5ALWA 3CNQS 4P72C 1N0VC 1QGYA 2ZTSA 1QQ5A 3AJDA 3EJWA 4IRMA 4Q05A 4U7HA 5D87A 3RC9A 5HKBA 3R6LA 5CTJA 4EVQA 4ZALA 2CC2A 4BN5A 3DSRA 3FFTA 4LJ6A 4PHGA 1E3QA 1P39A 3SX4A 3U49A 1RIQA 1ABEA 5ALJA 2BTEA 3A32A 1JRLA 2JFVA 5D3ZA 4Q4JB 1RQGA 1X94A 1VKRA 2Z43A 3HEMA 1Y3FE 2W6OA 3EMVA 2WVJA 3WDKA 5CITA 1XD2B 2OAEA 1KO4A 5FJIA 3ZLUA 3TZHA 4Y6RA 2VHXA 2ZBFA 1FP7A 3M6LA 1JDUA 4FOSA 1E77A 2X15A 2A5YB 4J29A 4CIYA 2WC1A 2W2KA 1N6IA 3V8JA 1X7WA 2PV7A 5ILOA 1YIOA 4KXQA 1OVGA 1P2FA 2HXGA 2GKSA 3V42A 5TC4A 5ITSA 1T43A 1X1CA 3Q7IA 1XZPA 2LCFA 3INNA 3WYDA 3WQHA 4H31A 1VKJA 5GVSA 1XZQA 1H42A 1QR2A 1U2EA 3RROA 5KKCA 2IUSA 3REGA 1BKDR 1XDGA 2CXSA 3QKUA 3HQ4O 2FRVA 4EGSA 3ADBA 3H5WA 4XQ0A 2AD5A 2PSSA 4MSUA 1EWRA 3UMMA 3NUZA 1JTEA 4Q1BA 2VF7A 2OESA 4C6TB 5KSWB 3K7EA 4Y6OA 5LUAA 3UAZA 1YR9A 3HKDB 1W0CA 2OEPA 2OD2A 3A9SA 3I2FA 3CH5A 1JIVA 4GWKA 4RO0A 1Y7TA 3JQBA 3DEHA 3GNSA 3RFXA 2FG7C 2HEIA 1U7DA 3RYFA 3KUXA 2C4MA 4YUWA 3SCZA 2VC2B 2C2BA 3V9AA 3MJSA 2VNAA 3WYEA 3WXMA 4AYTA 2XKKA 4H35A 5COAA 5DSZA 3HMKA 1KR5A 1F3OA 4XCQA 1LBTA 4URFA 5FWDA 3DE3X 3WO0A 3VRHA 1HH4A 2FK7A 4B6QA 2X13A 4QKQA 4CEJA 2BRUA 3LLSA 1D2NA 3NLLA 1ENZA 5DKFA 2ILVA 1YR2A 1YVDA 2OCKA 4DJTA 1GU1A 1K6MA 2ZG6A 4M1YA 5KNDH 3E84A 2VBIA 1NLYA 2WW8A 4EYSA 3IMFA 1A71A 3AR9A 1M2OA 4UUPA 4DGSA 3G2JA 5F52A 1VGVA 5BNWA 5LP1A 4F4HA 3VOTA 4ZI2A 1MVLA 3RGLA 4UMDA 4C7JA 1G9TA 4GECA 3LOQA 4Q15A 3R77A 4GOJA 3I4FA 4D57A 4RZ2A 5K1PA 3OBBA 4M46A 5I4CA 4XD2A 4F1WA 3T3DA 4BFSA 4D0LB 8ADHA 1RS0A 1F2TB 3C3PA 4N0QA 4P08A 4PS0A 3H5LA 3A7AA 1S5PA 5ENDA 3X1DA 3JWJA 3KCQA 1RM4A 3L6OO 1KDTA 5H4HA 1MAWA 4IDGA 1IOLA 3UXMA 3WADA 2WE8A 4DRXB 3L0IB 3L0PA 1QGDA 3F6PA 1LC3A 2VWQA 2C7QA 1G1AA 1H1LB 2CLDX 2BOVA 4GQIA 4TN1A 2OQIA 1ODCA 3T7DA 2DTDA 1JWBB 1O97D 2FOIA 5NLLA 2QZ9A 1VBFA 5IXYA 4QASA 1QHHA 3OZWA 2NIPA 1JFRA 1XZNA 1MPXA 1OAOA 2BWJA 3I34X 1B43A 2A5FA 2WWYA 5T41A 5ICGA 4B3MB 3W6OA 3ZDDA 3C4QA 3G8DA 4WY5A 4ACAA 3JQ6A 1QYXA 2ZUDA 1TW2A 3L8FA 4CI9A 1S9HA 2WAYA 2A92A 1CUCA 2F1JA 2V45A 2ZCVA 5KU1A 1J39A 1NI4A 2UZ1B 4LHZA 3IJEB 3DMYA 5TVKA 3GWZA 1FVHA 1P7YA 3V7YA 2G36A 2QUIA 3K0AB 2JD1A 3FR7A 3FYHA 3EDCA 2CLOB 2VUUA 4LSWA 1THMA 3ZHVA 4DDVA 5EERA 6ABPA 2PAAA 3W1WA 2ZI5A 3KPYA 4A8PA 4EGAA 3KKMA 1ORIA 5CIYA 1KI1A 3LX5A 2AC2A 3EPLA 3AFMA 2C4TA 4PZDA 2EDCA 3N39C 1E1LA 2ODPA 4JLDA 5KO2A 3D6JA 3MMSA 4N0DA 3DZKA 3F6RA 2B99A 4IHJB 1Y4SA 1T34A 2YDYA 3HPQA 4LRQA 5BVGA 5JDCC 3EYWA 4JOBA 3VBCA 1S4MA 2NG1A 3HKBA 5IARA 1IY1A 3I73A 1ZCFA 1OBHA 3R3YA 4YV7A 2WT4A 3HJAA 1R2QA 1BFUA 3C43A 4J0DA 4MQEA 4XOUA 5DGXA 1GQFA 4XQEA 4BS9A 1JPJA 4TXHA 5CT9A 2JCVA 1OLOA 3QUCA 5KMGB 1B6RA 3HS3A 1FDIA 3LDFA 3ZGYA 2GJKA 3REXA 2FG6C 1ADFA 2O3RA 5JQGA 4HNAA 3CLSD