1ATIA

Crystal structure of glycyl-trna synthetase from thermus thermophilus
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
505
structure length
437
Chain Sequence
AASSLDELVALCKRRGFIFQSSEIYGGLQGVYDYGPLGVELKNNLKQAWWRRNVYERDDMEGLDASVLTHRLVLHYSGHEATFADPMVDNWTPPRYFNMMFQDLRGPRGGRGLLAYLRPETAQGIFVNFKNVLDATSRKLGFGIAQIGKAFRNEITPRNFIFRVREFEQMEIEYFVRPGEDEYWHRYWVEERLKWWQEMGLSRENLVPYQQPPESSAHYAKATVDILYRFPHGSLELEGIAQRTDFDLGSHTKDQEALGITARVLRNEHSTQRLAYRDPETGKWFVPYVIEPSAGVDRGVLALLAEAFTREELPNGEERIVLKLKPQLAPIKVAVIPLVKNRPEITEYAKRLKARLLALGLGRVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTIGQSKDGTTRLKDTVTVRDRDTMEQIRLHVDELEGFLRERLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein biosynthesis
molecule keywords GLYCYL-TRNA SYNTHETASE
publication title Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
pubmed rcsb
total genus 131
structure length 437
sequence length 505
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 1996-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1atiA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1atiA02
4AH6A 2EAYA 5KNNA 2DKGA 2Q7EA 4P3OA 4XTWA 1X2GA 1B70A 3RKWA 1GGMA 1NJ5A 2ARUA 2I4NA 4WJ4A 2ZINA 2ZTGA 3V8KA 2EWNA 2PMFA 2RHQB 2Q5IA 1EIYB 2ZT8A 3CMQA 3EFRA 3UGTA 3HXWA 2DTOA 1SETA 3R07A 4CS2A 2ZIOA 4P72C 5C52B 2ZXFA 5E3IA 4XTZA 3NENA 2LW7A 2ZCEA 1H4TA 2I4MA 2DTHA 2ODRC 4P73C 1JJCA 4YRJA 1J5WA 1W66A 2E64A 3RKYA 3P8TA 3IG2A 1LYLA 2C7IA 3A5YA 3IKMB 3HRKA 4XTXA 1E1OA 4BWAA 4XTYA 1IL2A 4YP0A 1FYFA 5K1PA 2CJ9A 1B8AA 1WQWA 3LC0A 3RF1A 12ASA 3TEGA 4HWTA 1RIQA 4UPAA 3M4QA 3WQZA 1YGBA 3G1ZA 3IKLA 2ZZFA 2AKWA 2XGTA 2DTIA 2ZT7A 3V7RA 2ZT6A 1X2HA 1KMMA 1NJ6A 3MEYA 2ZZEA 3PZCA 2DEQA 4X5OA 1NJ8A 3NELA 4CS4A 3DSQA 2ZR3A 2PMEA 4J15A 3UH0A 1B7YA 3A7RA 3TEHA 4H2VA 3P8VA 1WLEA 4H2XB 1H4SA 2EJGA 4HVCA 1BBWA 2EL9A 4YRKA 3MF2A 1G51A 4TVWA 1YB3A 3VQWA 1Z7NA 2DU7A 4CH3A 2QHVA 2ZZGA 3BFMA 1C0AA 2E10A 1NYRA 3E9IA 4XEMA 4XTUA 2ZNJA 4H2WA 4YRPA 2CJBA 1YFSA 3PCOB 4XTVA 3HRIA 3A7UA 4CH4A 1QE0A 1EIYA 3NEMA 1EVLA 5ELNA 4HWRA 4KR3A 2E65A 4TQFA 2QHTA 2I4OA 4YRFA 1YFRA 2RHSB 3RGLA 1SESA 3QO7A 3HXVA 2G4CA 3IALA 4TWAA 4K86A 3VQYA 1QF6A 2DXUA 4UP8A 3A5ZA 2ZR2A 2DJZA 1X56A 2Q7HA 4P75C 2ARSA 1WPYA 4HWSA 4CS3A 1H4QA 3E9HA 3HFZB 3BJUA 4TVAA 2E41A 3RACA 2AMCB 1PYSB 3L1AA 3RIRA 4P71C 4Q6GA 3VBBA 3VQXA 1HC7A 1NJ1A 1G5IA 2ARTA 4H2SA 2ZIMA 3L2ZA 4YRRA 4YRGA 1JJCB 2QHUA 2HNIA 2DVEA 1SRYA 3HXXA 3P8YA 1ASYA 3NETA 3REXA 2DQ3A 4CH5A 3HY1A 4HWPA 2J3MA 2CIMA 4K88A 1BIAA 2ZGWA 4G84A 1EQRA 3LSSA 4WF2A 1EOVA 5F5WA 4TQDA 5HGQA 4ZTZB 4PHCA 1Z7MA 2E1HA 1NNHA 4H2XA 4YCUA 3RKXA 4TVYA 4PG3A 2ALYB 2P0LA 3A32A 3VQVA 4P73A 2AKWB 2DXTA 4WI1A 3HXUA 3KFUA 4H2TA 1ATIA 4LNSA 3HTZA 1ADJA 4UP9A 4Q15A 2EJFA 3QO5A 4OP0A 4YRNA 4H02A 4XU1A 1E24A 3V7CA 4P3NA 2DZ9A 1USYA 3L4GB 3HXYA 1X55A 1NYQA 3UGQA 4O2DA 3LSQA 1B7YB 2I4LA 1H4VB 3TEHB 3OD1A 3ICAA 4ZTUB 2CGHA 1KOGA 2IY5B 5C53B 2RHQA 3A31A 3V7SA 4EO4A 4DQ2A 4UP7A 1WNLA 1ASZA 3W3SA 4YPFA 3ERRA 4YYEA 3I7FA 4KR2A 4NCXA 4L87A 2P5IA 3HXZA 1G5HA 1ADYA 4YREA 4HA8A 1E1TA 2E5AA 4TTVA 2ZNIA 1B70B 3UFGA 2EJ9A 3HFZA 1NJ2A 1B76A 3V8LA 2AMCA 1PYSA 4E51A 4XEOA 1KMNA 3HFVA 4XU0A 1WYDA 2FYKA 4KQEA 4YRLA 1X54A 1X01A 2Q7GA 4XU2A 4YRCA 1WU7A 2Q5HA 4P3PA 4BW9A 4P74A 2J3LA 3EFSA 1WQ7A 1SERA 3QO8A 4YRTA 3V8JA 4YRIA 3MF1A 4RQEA 1EVKA 3RUXA 2E3CA 3FJPA 4RDXA 4TVAB 4YRSA 11ASA 2ODRD 1USYC 1YFTA 4YDQA 1BIBA 1HTTA 5ELOA 3REUA 4YCVA 2ALYA 4P72A 1E22A 2ZT5A 4P75A 4XU3A 1L0WA 3TUPA 2DZCA 4YRQA 1BBUA 4EX5A 4WJ3M 4YRMA 3A7AA 1VQZA 4K87A 4OLFA 3QTCA 4YROA 4ZIBA 4P71A 3L4GA 1EFWA 3QNEA 2QHSA 1N9WA 3PCOA 5C51B 4CH6A 2DU5A 2CJAA 2DDZA 2IY5A 5K1XA 4DPGA 2XTIA 4G85A 1V95A 3A74A 4RMFA 3HY0A 2C8MA 4H2YA 3RL6A 4H2UA 1HXDA 4HWOA 4YCWA 2DQ0A 2RHSA 4RQFA 3M4PA 4P74C
chains in the Genus database with same CATH superfamily
2YWCA 4KO2S 4BJ6A 3U1TA 4GYYA 5KYYB 4AH6A 1J90A 1KK3A 1LS6A 1MQAA 2PKWA 2YMMA 3FMFA 3OTIA 4J0IA 2GZ1A 2Y92A 4OQNA 1PW7A 2JAPA 5BRNA 3EA0A 1XAIA 1RQ7A 1VZ2A 1ND5A 5J5VA 1WF6A 3V3KA 4GLLA 4MVJM 1FVFA 1M67A 4CLHA 2CXOA 5CDTA 1NJ5A 1PLJA 3M0EA 4FCCA 4E4TA 1N6OA 2OHVA 3UPTA 3KZOA 4QU8A 3T9EA 4LV6A 4C30A 1EYZA 1RRKA 2CBXA 1SB8A 2VHYA 2W2LA 3H5VA 4K6GA 4CCYB 4DC1A 1GKYA 2ZKLA 3QXHA 3V8KA 2GYVA 2PRKA 1EUCB 3ZHRA 5ALFA 3D3KA 3NBQA 3OCYA 4P08A 2XY4A 1T2EA 3RAFC 1WB6A 2FJPA 1IXKA 4NI5A 1PYOA 3AJ8A 3LHDA 4N8DA 2ZR9A 1A2BA 5AW9A 1XZBA 2NQ8A 3B6MA 2HPAA 1WNFA 4X7BA 1T3HA 1QHGA 3OEEA 5EJ7A 3G9QA 4D81A 5FTMA 2B2CA 2BF7A 1I2DA 3BMQA 2BFEA 3GD7A 4MGZR 2G3YA 3RBVA 1O94A 1AKRA 4BKRA 2NXNA 3U0VA 3T1YB 1XJWA 5ALLA 2YQ4A 4BKQA 2OSBA 4KQ9A 2BFOA 5E6RB 2RHGB 3SIPA 5DGHA 4DB4A 2IEZA 3ORFA 3LDFA 1VIMA 2IPNA 3DQZA 1HEYA 4ZO9A 3VDQA 4WCFA 3IPXA 2Q4EA 2JJ1D 3DV2A 3LUHA 1FU4A 1H2FA 1U7TA 2QTFA 2W90A 4MIYA 4C22A 4JHLA 1DIOB 4IDEA 4CT4B 2OENG 4Z1MA 3SYNA 3W5DA 1Z9BA 1KP2A 3DV0A 5JH7F 2HOQA 2CHFA 1EVIA 1U1CA 2V7EA 3HB1A 5AD1A 2X8WA 2H4YA 5BN4A 2R7LA 2P35A 2EG9A 2IP2A 1CVRA 2VZEA 4FFVA 1TNDA 3LO8A 5I51A 5C8YA 5I47A 4BB6A 1E1CA 3RFTA 2WJGA 4E21A 2WIFA 4C7JA 4B2PA 1NJGA 3LC0A 2KSQA 2B4QA 3C6QA 3HHPA 3N07A 3EUAA 4PVDA 9LDBA 1L3BA 1QIIA 1T34A 3X1WA 4C2BA 4CYMA 2CLLB 4OKIA 4KOEC 4B3RB 1MHPA 3MS2A 1G0NA 1G63A 5FULA 2D74A 3PPYA 1TYBE 5U9CA 5DGCA 3T1NA 3M4QA 3SMVA 3M5PA 1DMSA 4R1TA 1ESMA 5DHPA 3RTDA 5J4HA 2IXDA 5JLJA 2B1GA 3WQZA 3KQWA 1KGDA 1T9GS 4BX2A 5IHXA 1ISJA 5FADA 3BB4A 4QU0A 1Y9JA 3MJRA 4UXHA 1XUOA 2XGTA 1W88A 2AC7A 2LIPA 4LE0A 1G3UA 3L6RA 4NWIA 5A3VA 2C7RA 2HGZA 1V16A 3HWSA 1Z4IA 3V7RA 4LE1A 3AUSA 3BWXA 3OX1A 1P9OA 4L27A 2JL1A 1NQ5A 1S2NA 3PKZA 3ECAA 3TJRA 4I8DA 4LBWA 3VOSA 1Y1TA 4OFWA 2H9IA 1VLHA 1MB4A 2DHQA 1WPXA 3HWX1 1PHRA 2DVMA 4YJHB 2WM3A 4E4RA 1VG8A 4D80A 1Z2CA 4HNQA 3PGA1 5TARA 3RYFA 4AY6A 5TQVA 4ETWA 1CQIA 2EARA 5GV7A 2NU9B 1G66A 4PC3A 3S55A 3PC4A 3UHJA 2PUTA 3FHOA 3E7WA 4L85A 4MR7B 4HPXB 4CT0A 1RKQA 3HBFA 4Q24A 5F3DA 5ITZB 5B5SA 5C8ZA 1I4LD 3Q3GE 1T6NA 3SIRA 4ZJZA 2XNDA 3NJRA 3EGXA 4FN4A 2BRUC 3OE4A 4RETA 3ZJ5A 3K6JA 3VU1A 5AW0A 1ORTA 5G0TA 2Y4OA 3REOA 2VDQB 4YMGA 3G8YA 2HXYA 4RCVA 1XTBA 4F4CA 2QP9X 2W6NA 2YMLA 3OECA 2IX9A 2Z6VA 1RQGA 3O0DA 3PBKA 3MWGA 1Q44A 3HC7A 4JGBA 1G51A 3TIIA 3THYA 2R6HA 4WOJA 5FBLB 1E3DA 1P29A 3E9EA 3V4PB 4A8TA 3HWWA 1DBIA 2IELA 2WKWA 4XUDA 5TPZA 1G1AA 2Y1EA 4WLEA 1SD1A 5KYYA 1GPBA 3EPPA 4PG8A 4I8XA 2I3ZA 4C07A 2PE5A 2FZWA 5GP1A 3NLLA 2R6FA 2W2OA 4L74A 2NACA 4KQ1A 1QP4A 3MA0A 2Q3MA 3PGKA 5CVDA 2B5OA 3LCJA 4GI3A 5JZBA 4ZAWA 1V3TA 2W8ZA 4BNDB 1DTWA 1UC9A 4DBLC 1M0EA 4XD2A 1U1EA 5KNCH 2GT1A 3UW1A 2H2GA 3UCXA 3U3KA 3DNMA 2VPTA 4BB5A 3AM4A 3ECSA 2JBWA 2YZMA 1ZCAA 4FLMA 3W5VA 4OU4A 4MIOA 1KQNA 3KDSE 3UWOA 3LQ4A 1OGIA 4IIJB 3IVCA 1DLIA 1D2MA 4B6GA 3EMDA 4C4PA 5GZ1A 4NATA 1BH2A 5AJYA 4ABYA 2GF9A 3TD6A 2GZMA 1EFPA 4BB9A 2MSDB 4JI3B 4KE7A 4BZPA 2JKVA 2FK7A 3IOMA 4GEKA 3CF2A 4EJSB 1OH7A 1XK7A 3ISTA 3BD8A 3K6KA 3ERCA 5CJJA 3SZLA 2QHTA 4QELA 3TOXA 1WUJS 3QV2A 5FPSA 2H92A 3OLWA 4PVCA 4QWWA 3FPEA 3MUNA 4RSGA 3W06A 4BRWA 2QUJA 1SESA 2ONCA 4PHFA 2ADFA 2F8LA 2JIOA 4NBSA 2KB0A 2Y77A 3Q3EA 3BXGA 4FE7A 3TVTA 1CY0A 3IUBA 5IHPA 5LDDC 1DQSA 3PT5A 1P18A 4HL6A 4L9RA 3SZUA 3G5TA 2Q27A 3EIWA 5E7IA 4YP9A 3WIDA 3BHJA 5JRJA 3VNVA 2IXTA 4NPCA 5DB4A 3U7GA 1K63A 1TM4E 4I9HA 4G5RA 4WH0A 1RAIA 4X20B 1ID8A 3IO5A 2YVKA 5HIIA 2QTTA 1VTKA 1OB2A 4GLOA 1O0CA 3ZDBA 4J2HA 2XTAA 1RJFA 2OD9A 3LX5A 2CSXA 1RP1A 2Z8YM 3LTEA 5FQNA 4HTFB 3WYDA 2ZTMA 3NAGA 2RHHA 1KDOA 3WGTA 2GBLC 5K01A 5LL6P 1UKVY 1H4QA 2VPWA 3RSLA 1GPYA 2OZVA 4IXWA 5EIWA 3PUKA 3TM4A 1GPNA 4Q21A 5EP3A 1J9GA 2BONA 2GOYA 3MQ4A 1E9DA 3HO8A 3GH3A 4QOHA 4IGFA 4BV3A 1L5NA 1G41A 3P4YA 4D8VA 1YQQA 1II8A 4UOZA 1NHGA 2QPAA 4LCEA 3USCS 1KL7A 4TVOA 2X6TA 3HA2A 3R44A 4Z51A 1IM5A 2JGJA 4AUKA 4CEHB 4A8JB 4CCYA 4UTPA 2P9JA 5A4FS 1GG9A 4JJZA 3WGYA 4HADA 2RJNA 3F4KA 2AK2A 4YN3A 1Y5RA 1I7QB 1DXHA 1TGVA 5J4LA 1M6YA 1RMQA 3GRKA 2GBIA 4KHZA 2FQWA 5JNLA 4Q3OA 3ZD7A 3BTSA 4P7GA 1SXIA 4QSMA 3K9GA 1N2JA 3T5TA 2QM3A 1UMCB 4ER7A 1B93A 1VYHA 4YJHA 1NVVR 2GAIA 5ALSA 4L4XA 3NXKA 3VHRA 4EEZA 2IX3A 3WGHA 1ZI9A 2A30A 3UV7A 3PDIB 3FG9A 2IS1A 4M83A 2QB5A 1Y5IA 1RAEA 3GJ0A 3K8QA 1QGAA 2NU9A 1WZCA 1CKEA 2VYCA 4Z7NB 3KUCA 3VH1A 4EUNA 4W8GA 4HJXA 4MR7A 5LD2B 1W1UA 4GLJA 4I08A 1L7AA 3NGLA 4DIDA 5KEIA 2P62A 5ITZA 2C31A 1XOIA 3CRQA 4HJRA 3NHBA 1NFFA 4L78A 2WJHA 3QEKA 5LC1A 4KPFC 1D7OA 1KEWA 2RGRA 4XUGB 1IOVA 3EOBI 4R0VA 3I92A 2OXTA 3H6HA 1M8GA 4U7WA 5J2TB 5EUQB 1SCDA 3RODA 3OVMA 2I8AA 2O6HA 1XTZA 2AEJA 3QBTA 2YJ3A 5DIFA 2E4XA 2IIBA 2O23A 1BSVA 5FI3A 3TLXA 4MPDA 1ZJ6A 3HB5X 4OJTA 1W7AA 5I9LA 2QX6A 3NAQA 4MQLA 1NVTA 4K0KB 3CZAA 3J81A 4UD2A 3R7SA 4E07A 3M2TA 1IVSA 3B48A 1CJMA 1QYRA 2PZFA 1EA7A 3UJCA 3E5NA 3EF1A 2AVDA 3NHFA 1JG1A 5IAGA 2EJFA 1ZS9A 1MEEA 3LCMA 4XDGA 1RE1A 4BNDA 5DXFA 4MCAA 1OYWA 5AW1A 2NU7B 1DUIA 3HFJA 1JHZA 4OJNA 2CNNA 4FGJA 2BKAA 1ODCA 4XQ9A 2E37A 5HF9A 1KVQA 5CFOA 1U31A 1CB7A 2QQEA 1DAMA 4PNHA 4QDZA 4W5TA 1XKLA 4IIJA 4PWZA 4CF7A 1E2PA 2FZ4A 5B37A 1FFAA 2GPSA 2ZDGA 5IAJA 3U3ZA 5F7XA 2GHIA 4QM7A 4RVDA 4MLCA 1FSFA 2FRDC 1B7YB 3AVWA 3JVDA 3HI4A 4CUZA 2JI9A 1RXIA 2ORIA 3R6TA 3L8YA 4N03A 4EJSA 1Q1ZA 5ES3A 2H1VA 2PSHA 4R7GA 4EA9A 3SJAA 5C53B 1W5AA 3OZXA 4LJ8A 3RSSA 2EQ5A 1EFRA 1DC7A 1YRHA 5ESXA 4ZU6X 3ZWKA 4FHFA 3DKKA 4BVAA 1C8VB 1I80A 2EIXA 2Z9CA 5FOUA 4EI2A 4UHKA 4BLSA 2H4ZA 2Z43A 4L0QA 4ZT6A 3GLFB 5EA2A 1F6BA 4NYIR 4I4TB 1TUBB 4IIYA 4F3TA 2ODBA 3H84A 4BZWA 3B9BA 1F3OA 5BN5B 4K6KA 4B75A 1HE5A 3P9RA 3W6OA 5JAIA 4JXKA 5D7BA 4G1BA 2C7GA 4LGMA 3EVBA 2OFPA 3OIVA 3RRFA 2VEOA 1NI3A 1P8AA 1GGNA 1MJGM 1AU9A 1KZYC 2PCJA 3DVRX 3DXZA 3LW8A 1RC0A 2JI6A 3LQFA 5KPJA 4X20A 2CLIB 3D6TB 4JX9A 1JEOA 3CEHA 3DS8A 4DZZA 2HLHA 2VSOA 4NONA 2E1RA 2J0UB 1MTOA 3U2QA 3WB2A 4F7DA 4HTFA 2ZDQA 2XITA 1QHHA 2WSIA 2UXCB 2QLJA 2PX0A 1I1QB 1Z0FA 1UM9A 1PFVA 1JDUA 4MI6A 1AVTA 1O1YA 2ZWOA 4R2JA 1C30B 3HR7A 2RB4A 5ER9A 4L7VA 1O95A 2CNBA 2PX8A 3D6FA 3GYBA 4RKWA 4YA6A 4RZIA 5HBGA 1T1GA 1IMOA 4D9BA 5J4KA 4JIMA 4QQKA 3ZHBA 4ARZB 2QRVB 3RAEC 3ZZNA 3S28A 4YRLA 1GGEA 2R85A 3IV9A 2O54A 4TMXA 3BQ9A 2BBTA 1ZN9A 5C3MA 2B78A 1SURA 4JSRA 4CMAA 4ZJUA 4PBSA 5JSFA 1E7QA 2NX2A 2QL5A 4NABA 4X63A 4ZCPA 1KRWA 4KFRA 2C9CA 3ZCXA 2C2GA 1T36B 3DL0A 4I5EA 4XYGA 2JIPA 1QZUA 5ALOA 1MMFB 3ABRB 1Z0SA 3KBOA 2XEDA 2QM7A 5AVJA 3L0SA 3QY9A 1L5GB 1YCHA 2WKRA 1SBHA 5CP8A 1GG8A 2C4TA 2SCUB 1RPNA 3SEZA 4HAVA 2IVZA 3CY6A 4UM7A 3PRYA 4RHFA 1JBQA 4ZYLA 1KFEB 1O5IA 2DHEA 3PDIA 4I46A 2QM0A 1RVDA 1E62A 1NY6A 2G1AA 3MFQA 4G2TA 3DMNA 3OSUA 4MK4A 4QOEA 3DA8A 3U3DA 3UGJA 4KNVA 2YWRA 3RUXA 4NQZA 1E58A 1TA4A 4JJEA 4CU5A 5FLXA 2JAOA 3DQPA 4CMGA 1TQ6A 1W48A 3ZCQA 4D26A 3E2IA 3G23A 4JK3A 1YFTA 4OL9A 3P9PA 2WPDA 3CVUA 1M8PA 4HQLA 5L45A 3TX2A 4JEMA 4PPYA 4Q3LA 4ZVNA 4BNLA 1QC5B 1SOAA 1GNPA 4M0CA 5HDBB 2FPIB 3BDIA 1RRVA 4IDPA 5J2TA 4A0GA 3ZCRA 4KFCA 2C00A 4EPTA 1CEQA 3DONA 3R0XA 1V8ZA 1AUVA 2QAIA 2YVUA 3E9RA 1ZJZA 3H7AA 4JI5B 1G60A 2DPGA 4LWPA 2AR9A 2C2OA 3RVMA 3KEGA 4FYHA 2J45A 4UEQA 3UJ3X 3R0QA 3KHUA 3BJMA 4XU3A 4MHTA 4CPDA 3IVAA 1VIDA 1VE3A 3PXGA 3GCXA 5CIYA 1NURA 3G1UA 4I7EA 2DERA 2A4KA 4JLDA 3DV9A 3I01M 4IZIA 3OD5A 3ESQA 4GMFA 5DBIA 5KNBH 1P1CA 4WJ3M 1PIWA 1XE3A 2Q46A 4CBVA 3B3GA 3EXIB 3L0YA 5F9FA 3MIIA 4EY8A 3O91A 1JZTA 3A7AA 3WBBA 1V6SA 4MQMA 1LI5A 3OIWA 4MUYA 3AMVA 1I0IA 5IUJC 1RYYA 1YF3A 3QNEA 2WJPA 4B45A 2WFAA 5JJIA 2D4AA 2JHCA 4BLRA 1VL8A 3BXFA 4KMOA 4H1WA 4KMMA 4MUIA 4PANA 1KMQA 4YJ2B 2P6OA 4UOEA 4EUHA 4MS4A 1VE6A 4PQYA 4IHJB 1ND6A 5T6MA 1RTKA 4NG4A 3FPSA 4YGXB 3AOGA 2ET6A 4B4OA 1XPOA 1NBME 2AUTA 3JAKB 4DLBA 4Z2AA 5IDWA 3GLFA 2VYQA 4X0EA 4MUMA 3HXTA 4TXJA 3X1XA 4DFDA 4I4TA 1TUBA 2GJ8A 1A1SA 3C8MA 3NEPX 3Q4GA 5ALEA 3AF0A 3B2NA 2VPZA 5H9WA 3BL6A 5DNYB 4IRUB 2WHYA 1MW8X 2Q0XA 4FFRA 2ZJ6A 3H1GA 1TC2A 2WUGA 4MW7A 4NJEB 4WX2B 4AUMA 3D3JA 4QNMA 2C5LA 3C4JA 4DS3A 1JG3A 1XMSA 1OB5A 2WM8A 4JQOA 1XRSB 1CS0B 1A4XA 1EXMA 4U7PB 4XCQA 4BKOA 3Q9LA 2J0UA 4XGQA 4XTWA 1QDEA 4NEQA 4GPD1 4A2PA 2J5XA 3P9ZA 3DVAB 1JU4A 4C0KA 1R8JA 2BJWA 2PXHA 1ZUHA 1JIJA 5A06A 3L77A 1NDUA 2J9FB 2CFSA 2J5RA 4ZT4A 4I1PA 2XXAA 3K8OE 3TLGA 1QP0A 2I66A 4PM4A 5DBGA 2HA6A 2IHYA 3OM0A 3OFSA 3SQXA 2AG8A 2HYIC 4YPVA 1LSJA 1ZAKA 2R4UA 3DHWC 2OBXA 2OFXA 2YS6A 1TTHA 2QRVA 3O2JA 4R2HA 3ZDDA 2HHCA 2F6RA 3VYWA 3PVZA 3EPLA 1WDWB 3K8ZA 1QIJA 5KSPA 1E2UA 2G70A 4TXNA 4BN5A 5KTYA 2YWEA 2F1IA 1SUDA 3OX2A 3PRHA 3EJ6A 3QTBA 3CG0A 1IXSB 4L3VA 3T4UA 5DNWA 4WWHA 3Q0EA 4EMUA 3PNKA 1SUEA 3CURA 2X5NA 2CHVA 3B1KA 5C52B 3A6KA 4RVSA 4JVNA 1JE0A 2B5WA 4LOHA 5EQDA 1HLFA 4ZD6A 1LDEA 2OMEA 4K9SA 5BR4A 2SCUA 4Q4HB 3IQZA 2WWTA 2ODRC 4OJMX 1Z13A 3ZU5A 1ZIXA 3E22A 3QYPA 1I6LA 2NV2B 1XDWA 4P4UA 1L6IA 4PEVA 3VR1A 4S2UA 4B3BA 4QBTA 4LOIA 5CVTA 1EIWA 3WHKA 2YH2A 2DTXA 3G5MA 5C37A 3VI3B 3TTSA 4Q7LA 2JIZA 5CYPA 4Q9JA 5BSUA 5LQUA 3DDZX 2AOUB 1YC5A 2RJ3A 3I23A 1G3IA 3LZCA 3RI3A 3ZEIA 4PYMA 3IKMB 1OMOA 3F2VA 3MN1A 1WR8A 2JDID 4TTTS 1I9GA 1RI4A 3PPWA 4D3DA 2G63A 1GCGA 4RDCA 2AKEA 4A1OA 1NXXA 1WAMA 1W76A 1A72A 1Y3AA 2WSSA 3RFCA 4EKEA 3A58B 3CCBA 1QC5A 3B1JA 4NMHA 5SY9A 1DCKA 1QPZA 2FPIA 2VBIA 5IH3A 2ZR0A 2XCSB 5EMMA 4WBSA 5F4ZA 4CE6A 1SUPA 2OCPA 3ZHQA 3WLSA 5K4GA 4HWTA 4N76A 3SHFA 3BN3A 4ND3A 2H18A 3VNAA 3BH7A 4QO7A 1QGUB 4YT4A 2C7BA 3OOWA 4UNRA 3G1ZA 4KVZA 5LMUB 3RDPA 3RSOA 1W4BA 5JU6A 1DDIA 5EFZA 5AR1A 2WU4A 1LLUA 2ZZKA 3R9WA 4RJLA 2FDCA 2CXUA 3E2PA 3WB9A 1Z7BA 5EJ4A 2JLAA 2GSWA 4OBEA 1DC3A 2BD0A 4PSDA 4JLVA 3FWHA 4HN9A 4GPBA 4E2YA 5JVDA 3BHMA 3L3BA 3OQVA 5JOQA 2OV8A 4EQZA 3A9UA 3C3CA 3OM1A 1P81A 4B6JA 1QQ7A 2QMOA 4BU1A 3PDHA 2M98A 1L7XA 2QL9A 4IHQA 4OQPA 4R8KA 4Y0AA 3ZLBA 3RWOA 5DHFA 3ZHUA 3JQ9A 3ST7A 5CCDA 4JL5A 4R1LA 5T7BA 2VQFB 3DZGA 5AIAA 2W2TA 2HREA 2ZSFA 4NOMA 1E4EA 1U9ZA 4A4DA 4HVLA 2JHFA 2Q8NA 2IKQA 3WHLA 3R5FA 2X58A 5F12A 3K1YA 4PNZA 2CCJA 4Y2PA 4YJ2A 2PPVA 3OZCA 1X1EA 4IHJA 1A9QA 3WO1A 2YHSA 4KDEA 1XYGA 2Q9CA 3FD8A 1EUYA 2RKOA 3JAKA 1PVDA 2CUTA 4IO1A 5H68A 1BDIA 4PBRA 4CIWA 4GPIB 4O2BB 1A50B 4HVCA 1O7JA 2EL9A 2LGJA 4EYSA 5JDIA 1N2HA 3GARA 1ZD9A 2OPHA 3TX6A 3O83A 5C8YF 3PQDA 1Y82A 1EUQA 4I1RA 3ZGVA 5BWLA 3KJXA 1U7XA 1BQ4A 5HOQA 4UAGA 4JYPA 2XXBA 4HMQA 1J0DA 2DU7A 4NJEA 4QBHA 5C4MA 4U6QA 3PC8A 2JFUA 2CJWA 2O2JA 1C0AA 2EL7A 3IODA 2OFWA 3OJ0A 1HRKA 4FGLA 3G59A 4K9PA 5BSTA 1CS0A 3T7IA 3VO8A 4DWOA 1P2UA 2VSXA 4H2WA 1UEIA 3GPIA 1SB9A 5F2NA 2I4TA 1RWWA 4NDZA 4LDRA 4C0HA 1CUIA 3IH5A 4J0CA 2H5JA 3WGIA 2CMFA 3V2IA 1EXVA 3HI6A 3JS5A 2HK8A 5CH3A 3V4RA 2XDYA 2ZIZA 3WZMA 1CHNA 4IW3B 1IVNA 1QIFA 3D81A 1IATA 1UJNA 2FDRA 5MFPA 4R98A 4WKCA 2RIRA 1KP9A 2O2HA 5CX1B 1QE0A 3TZHA 3NDBB 3STXA 3NG1A 4DKXA 1K4MA 1P4GA 3BWEA 4YJFB 4JC8A 4JA2A 1HOXA 4CDMA 4KR3A 3I53A 2XBLA 3PQ6A 4ZGWA 3R7WB 3PD1A 5KDOA 4JYAB 1U9IC 1DCFA 4GR4A 2XUOA 1ZK4A 3LT0A 4D25A 3RGLA 3GEPA 1IEQA 4AJ4A 3BXHA 2CYAA 2FE1A 3FUVA 3PQ8A 4QODA 4CM5A 2NTYC 2W83A 2NYVA 2VK8A 5FI0B 1GYRA 3B5IA 1B1CA 3AI3A 3P0EA 2H65A 2B94A 1A0OA 1TTTA 1P0PA 3PK0A 2O7NA 4Q4HA 4DABA 4DV7B 4CVNA 4KODA 2AZTA 2D5CA 4Q02A 3SM9A 5JS7A 5LLDA 1GYPA 4UDOA 3GEIA 4Z3OA 1GRVA 2X22A 4NHEA 1RMTA 3E70C 4ZAZA 1QOPB 3RIXA 3WIBA 2BFPA 4FMDB 3RHZA 4OHRA 1CF2O 2YUTA 3P94A 2IDJA 1FNNA 2IZ7A 2TRSB 2YW9A 3RCBA 1C9KA 2FLKA 3SN6A 3L7MA 3AVUA 2FRDA 3W2TA 4JUCA 1SOMA 2XBUA 2BJVA 3K0EA 5IJWA 1AGYA 3A2KA 2GCEA 2IIQA 3EUEA 1PVVA 4PZ0A 1SUWA 2PKXA 4GPZA 4MP6A 4X8OA 1KY3A 2WKPA 2V4MA 2FKNA 4CM9A 3X1MA 1Y5MA 1NY5A 2O1WA 4NVRA 3T06B 4M8SA 4EUSA 2BVNA 2ZYRA 5CPBA 4L72A 3SYMA 1W35A 1QGUA 4KG7A 1HDRA 4TV9A 3R7FA 2ZZMA 1PT6A 1QYVA 2ZBRA 1QHYA 3O47A 2ZIMA 5FPQA 4F2WA 5CDYA 3IDSA 3VR3A 3HKCA 2W2VA 1DT3A 4YRGA 2PL3A 5KQPA 3KPJA 2RBGA 2W6JD 1U8UA 2V7TA 1MT0A 3NORA 3W5CA 4LSGA 1YXMA 1FSSA 5T6BA 1RQ2A 3C8UA 3INYA 2DJIA 5HIMA 4CH5A 2HBZA 3GOQA 2HLDA 3LWZA 1O9HA 3CUWA 1T2NA 3M34A 3OWOA 4EWLA 1R4NB 3T1HB 1V8BA 3UK1A 2E82A 3I6BA 3W6UA 2XGOA 5FHRA 2F1RA 3NHKA 1Z5ZA 2C54A 1HYEA 3CF0A 3II6X 3JQ7B 2MMCA 3PT9A 3TL2A 3G5LA 4WBXC 4DV4B 4PHHA 1EOVA 1QYWA 2N47A 4BJ5A 1QSGA 3QZUA 2I8CA 5INTA 4OV6B 1TM5E 3PTZA 4N12A 1DEOA 1IEWA 4QU9A 2UV8A 2XMCA 5BUZA 3ER9A 3GCDA 4BUCA 2CXXA 4BJ1A 6AT1A 3UYKA 1NV9A 2Q1XA 4O2BA 3BFKA 2BTQB 2CHEA 2PL5A 4G23A 2P0EA 3WK8A 1T1JA 16PKA 2J3IA 4XJXA 2P9QA 1Z5OA 4FR0A 1P9WA 4KXWA 4WI1A 2OHHA 4MAFA 4OBWA 3F6EX 2XVYA 4RPIA 4AXBA 2WNIA 5JZ9A 2GN4A 2I1VB 4TVBA 4EFMA 5SYMA 4Z4CA 4IF4A 1Q3KA 5M34A 3RJMA 1NW9B 1AUPA 3ROXA 3HTZA 2GAAA 3I3OA 3FY4A 3OUZA 5TF4A 1O96A 1AO0A 3F0TA 2I2CA 2ON6A 4RLHA 5EZ5A 2QJWA 4C76A 1H05A 1E61A 2P6UA 4QUBA 2EHDA 3S1AA 3G1TA 3CRNA 2AW3A 4LGYA 4X91A 2A78A 4R2KA 3DEFA 1FYXA 1EWQA 2ISCA 4EFDA 2WMDA 3NFYA 1Y8QB 2QI9C 2GMWA 3VR2D 3MT8A 5A6SB 3WE7A 4A8HA 2P67A 1OX6A 2JGAA 5JNSA 4DUYB 4RUKA 2Q3FA 1Q1NA 2OO5C 4XXHA 5CX1A 4IOMA 3F3KA 1VFNA 2BGJA 3CLSC 4J7CA 2FW9A 1FTYA 2OBLA 1XMXA 3K31A 5F51A 1TEHA 2I29A 3DD1A 1E5QA 2XGGA 1GOTA 3R7WA 4DHEA 1RM3A 2WYWA 4F2HA 2JAHA 4KN9S 4TKMA 4FZRA 1Z88A 3PFNA 4W5NA 2OWEA 1I2MA 3GUUA 4R8LA 3F5QA 1C2YA 4WADA 5EPUA 4G6ZA 4EHJA 3QVLA 2YCLA 3BWYA 3K6RA 3I7FA 2NZ8A 4MWTA 1F14A 1VMEA 2JFWA 2J9RA 1M6VA 4NU5A 3SFTA 3OCZA 4KI7A 2ZQYA 4D9EA 4JY7A 4K0RA 3PUVA 1M7BA 4L87A 3EXFB 3W79A 1RZRA 2DFDA 3RVRA 1EINA 1Z25A 3EIXA 1V1JA 1GXSB 821PA 4MVJE 2VP6A 1GZDA 4HA8A 1RHRA 2ZJ8A 2X5KO 2ZJBA 2R8EA 5LBIA 1N2CE 5M3BA 4REMA 4TTVA 1J25A 2G1KA 3UFGA 1N2ZA 2XZPA 4QDJA 5FL7A 3T3DA 1GUDA 3HQ4O 2QENA 3VTFA 2VHEA 2WSYB 3QYFA 1NN3A 2BBOA 2WHPB 1BVYF 4G36A 4ZV7A 1CD5A 1ZUNB 3DO6A 5TJHA 3TVYA 4BLPA 2R5WA 1QF9A 2JHGA 2OCAA 3FPCA 4IDDA 2DUJA 1YDMA 1YZLA 2JFPA 1X38A 2J32A 4UBOA 2AJBA 3ZCTA 5BQXA 4M9XA 3RR2A 1VHJA 1EXDA 2GN9A 1K8QA 2RAPA 4H08A 2QYTA 2YRWA 1JJAA 4W5OA 3J80A 3OHPA 5LZ9A 2J59A 2Y9PB 1F12A 1UMDB 2GESA 4D0RA 5KC9A 1C3OB 2IA5A 2V0NA 2V7PA 4IIJF 4F5ZA 3HCFA 5BXQC 1ZK1A 1EDEA 2JAUA 5HFNA 4JHXA 1J8YF 2R47A 3FNHA 2GTIA 1ZMXA 4B3JA 4UUMA 1DC5A 3O2SB 3P0IA 2OWDA 2Z5LA 1R8YA 2XCQA 2D7JA 1U0TA 2X6RA 4G4JA 3I0ZA 2IYWA 2GBPA 2WU1A 2V3CC 1STOA 4BBZA 4GUAA 1NYTA 5IVPA 3KKEA 1H8EA 4EA6A 1PV4A 1HUQA 3KLMX 1HTBA 3U4IA 2ZFUA 3S44A 1DKRA 3GJ5A 1UBMS 2I6UA 4OP3A 1G6OA 3D59A 1ATZA 3GOHA 5LIRA 4OH1A 4LSMA 3OKFA 4ZCSA 3JQ7A 5EHQA 3SYKA 2NVUA 4EG4A 3O0TA 2Q6IA 2HSGA 2Q8QA 3G49A 4UQPA 4BVEA 4IAOA 3TIXB 5KYWA 4K6CA 5DE3A 3EH2A 1DOHA 3RAPR 3TQOA 1MZPA 5G0VA 4CN9A 3RC8A 2C83A 5ELOA 1NVUQ 1FC0A 1ZM7A 3FIJA 1FW6A 2YHIB 6Q21A 4F93B 1AXRA 3DR3A 5FUYA 1SBCA 5DX8A 2EJUA 2IIVA 2KYRA 2BTQA 1KJ8A 3MRSA 3KAPA 2HO5A 2AN4A 5DHRA 1C7FA 1JBEA 5CLQA 4G5XA 3D5TA 1ZGCA 4CKEA 4UTNA 4RM2A 5L3QB 1GV0A 1R0YA 1ZNQO 2CXPA 3B38A 3I05A 4N7BA 5F9MA 5A9TA 4B48A 4P75A 3ZZMA 5BQ5A 5CFQA 4QGSA 3U37A 1RRPA 4PLYA 2LNDA 1SR8A 5A0TA 1L8QA 1RAAA 2P4UA 4RZHA 2Q3HA 5I7UA 2XVMA 1CRLA 2XCIA 1E7WA 1Q0QA 3AO0B 3EZ6A 1OV6A 3SQLA 1LWNA 4M22A 3SNHA 1MGOA 3HR8A 4YONB 1FQJA 5CDGA 1RXUA 1QYCA 4GECA 3IUNA 5FLYA 2P2CA 2PXAA 2IEAA 4KXXA 2QRHA 2EJTA 1EWYA 3EA5A 1OA0A 5KJEA 1OQAA 2F1KA 2VUTA 4LN1A 5A7GA 5TGTA 1UJ6A 1G7RA 1PO7A 4KV9A 2WF8A 3EVTA 1IQUA 1UT5A 1K5PA 2P4QA 2RARA 1I9CA 1E66A 1ULTA 1DIRA 2ZAYA 3QHQA 4PPGA 3W8EA 3CINA 1QFMA 3ZE7A 5K6AC 3GEGA 2HA2A 4L5CA 4KVAA 5JS1A 2YV4A 3G79A 3A28A 2IOQA 3AT1A 2ODQA 2Q6LA 4D42A 2CFIA 1ANKA 3FH0A 4NNJA 1EEXB 1O03A 4K6OA 4KUEA 4RXMA 4M76B 4OHBA 3HXPA 3P4XA 3QV1A 1RM4A 2JI4A 1NF3A 3LYAA 1DBWA 1BDBA 4HWOA 2J07A 2J4CA 3DBRB 3NTUA 1S89A 3GMDA 5A5DA 5BW5A 3UXHA 2DPLA 4QE3A 1LDMA 4AROA 5KQGA 1H0SA 1W5EA 2IY7A 4QHTA 3MCTA 1Z7WA 2MCFA 1O57A 3WL5A 3IR5A 2C97A 5J2TF 4LQLA 2J87A 3GJQA 3R2JA 4RF4A 4JR1A 1CNEA 2QRKA 2VJNA 3RWBA 5JAPA 2GCGA 1HL7A 4EHIA 4OB7A 2IKSA 4HRVA 3FYTA 1AE1A 4DJFC 4CG2A 3E3LA 4XX0B 1KIAA 1UWLA 2NSYA 2WF7A 3DDCA 3UW3A 4EA8A 5LU9A 3L8FA 1PJAA 3AQIA 3MTDA 1SVMA 1NIJA 3OOYA 2WHPA 1UP7A 3KXLA 5KC8A 5I9TA 5AVOA 1C7IA 2HQOA 3BICA 4WJ4A 4OJYA 1NX9A 2R96A 4GQBA 1RWKA 1BZYA 1XP8A 2JJ8A 2X4LA 2ASVA 4TZTA 4V0ME 3WLTA 1TA9A 3ZNQA 4ZMRA 5KREA 3MWKA 5LJLA 2D7DA 2YW2A 3ILHA 5IKPA 1WCYA 1XG5A 1UMDA 3MTQA 4Z6KA 1N57A 2DTOA 5LUAA 1C3OA 1H8HD 2O8VA 2GA8A 4XUCA 4BUZA 4EK9A 1E0KA 4CV3A 1YDWA 4LPSA 4N1AA 1KJZA 4CS2A 4Y6QA 4WZ6A 3GH1A 5ALUA 1M0SA 4G81A 1YZQA 2BT4A 2GK7A 5I7HA 1OAOC 6ABPA 2IH5A 5E3IA 3KXDA 3SZRA 1XL1A 2B9EA 2IF0A 4PXSA 5FP0A 4MVJP 4F1KA 5IVHA 3MGGA 4DUZB 2QT0A 2ZE6A 4JEHA 4PQEA 3K1JA 5T4FA 4CF4A 4EAAA 3EWSA 3PXAA 1IJEA 4QBKA 4YJDA 1N2OA 3VZPA 3RYIB 2VHTA 2BUBA 1AOXA 2JLWA 1JXAA 1JIKA 1DAHA 2IUYA 4I4TF 4EHLA 4IJWA 3FPAA 4IQ0A 2PGDA 1J5EB 1UIRA 5JCZA 2XWPA 5CU7A 1K6JA 3BXEA 4UUOA 1LYLA 2OP0A 3AYZB 3A5YA 1Q16A 4EIWA 3NTRA 2NZJA 3RTCA 1SA0B 2F90A 4E15A 1CUJA 2IBTA 3E7XA 4GMGA 2AD5A 2EEPA 1IWBB 2WWVD 2VZ8A 2CDAA 1TJNA 5KYUB 1B8AA 1F2DA 1IY2A 2A33A 2D2XA 1YNSA 2YHIA 1R16A 3B6KA 3UJ9A 1T9BA 1X1AA 2KLBA 2WDZA 5LLSA 2BKEA 2JW5A 3AC0A 3KT3A 4J3FA 4X7RA 3QX9A 2FV8A 4BFSA 1OX4B 3C3AA 1M2GA 5JS8A 1L4NA 1T25A 1IJFA 4RPKA 2VF7A 4URUR 3PJDA 1FUKA 1AXGA 2AN3A 1JKFA 1YGPA 2GEVA 3FOAA 2QW0X 5L3QA 5BPFA 4CQMB 1NLUA 1YQUA 3G0GA 3GJ7A 3NX4A 4K9MA 3L6EA 5EINA 4NAHA 2QVYX 3TCNA 2ZROA 4YO7A 1L5YA 4MYTA 3RS8A 4HLDA 4BRZA 4TQAA 4JI7B 1H6BA 3HS3A 2B25A 4N41A 4YECA 3GVPA 4JB0A 1X2HA 3TH5A 1Y7PA 3LLMA 4JELA 2OE2A 3M6VA 1EGHA 4ND8B 5JISA 4ALNA 3T12A 1FYWA 3B7PA 1TZCA 4OGFA 4FBMA 5IT0A 1QIDA 1Z62A 4RFVA 2ZRMA 2H2DA 4ROSA 1I14A 3B13B 1LY1A 1M34B 5JY6A 1JJIA 1PBTA 2OA0A 1AZWA 4JJ8A 4FWTA 2JZCA 5U1PA 2XB2A 1C0KA 1V37A 1Z6XA 3H4TA 4KVGA 3TBHA 5C2JB 3O4FA 4MYHA 1LX7A 2RHWA 4JI0B 1KK2A 1WLEA 1MJNA 4FNAA 5LZ7A 1Z63A 2R2AA 1Q2XA 2O3JA 2Z9BA 4ZQGA 5KWSA 3DBRA 5ESDA 1YRLA 3MB5A 3OU7A 1FFYA 1HY3A 1C9JA 4Q12A 1Y3CE 3AP1A 5TR9A 3DTNA 2JFGA 4FDLA 3AWIA 4DADA 5FTKA 1L7NA 1L1FA 1FIUA 4L4ZA 2WJAA 2H11A 2NNWB 5DYIA 1JWAB 1AUOA 3PZBA 3JZFA 4KK3A 4TLAA 5JNTA 2PX2A 1UKYA 3EISA 3E9IA 5E1BA 3ZTTA 4C7MA 1N0VC 5JADA 3SFVA 4Q19A 3AKYA 1BMQA 3OZGA 3JQFA 3N2KA 4XDZA 4XX0A 1T8TA 1PGOA 1ZOPA 5ADHA 3VKHA 4IG4A 5JBIA 1CUCA 5JSHA 4F6LA 5A03A 3BGSA 3ZDFA 5L7YA 1PU2A 2Z95A 3RD5A 2LTAA 1NXSA 2ZJ3A 3V4OA 3K5PA 1Y6GA 3ZXXA 1VKRA 3W8DA 1E9BA 3BXPA 1HMYA 4IRMA 2IY9A 4I3GA 3ZYZA 3Q7IA 2JLUA 3VR4D 3ZWYA 1J2TA 1XTVA 3JQAD 3LP5A 1TO6A 3NFRA 5J9FA 1Z2OX 4A2WA 1AXEA 3IP9A 5DM1A 3WK4A 6LDHA 1FRVA 2C3OA 2PGIA 5FCDA 1R0RE 4LYJA 1YBAA 4L0DA 3AZOA 1KU0A 3PQ5A 4MV0A 4MW9A 4BVJA 4ENPA 1M3SA 1C4KA 5C35A 5M29A 1ODIA 2OB1A 2UKDA 2YY7A 3A9RA 2HPVA 4YJ2F 3EOAI 4BFYA 2LBPA 4KO4S 5CCXA 2IT1A 4HLUA 2O2DA 1OILA 3OOSA 4UE2A 1RRFA 4IHJF 4OQEA 1ENYA 3ELBA 2A0KA 1ZAYA 1LQTA 1C9DB 1X13A 1QE3A 2Z3ZA 3CGWA 3FR8A 4PHTA 3VISA 1IYZA 3UG6A 4QGAA 4E94A 3MMNA 3RYIA 4HEA6 3G82C 4WXHA 2FFBA 3ILSA 4AD8A 4J2TA 2CNOA 5KHOC 4MYDA 3P2JA 4Z8XA 1R4ZA 1KARA 2DBYA 4G0VA 2A84A 2DBRA 3O90A 1XYVA 2OO5A 4RPCA 1SA0A 2QX4A 4YJ3B 1YVPA 2B1QA 1JAYA 1YFJA 1AUQA 1ORVA 1Q21A 1QVWA 2O59A 2HKIA 1M0TA 2IV2X 4F38A 3SM3A 5AK4A 4IGIA 4GVPA 1EIZA 5KYUA 1H42A 4F84A 1NFQA 5ICCA 2V03A 5E2BA 1TF7A 4KAAA 4XFDA 1MD9A 1YB4A 3IMFA 3VSCA 3GRRA 1EK6A 1OX4A 4O33A 3VDRA 2NYAA 3IAFA 4LRSB 1HC7A 4PG7A 1A95A 1PGPA 2A5GA 1UZUA 4LXHA 1QGED 3UIEA 4B4KA 3V8RA 5JS6A 3KV3O 2QTVB 3CR7A 3PD7A 1WV1A 4ZGGA 4CQMA 1QQAA 3JZIA 2Z83A 4AQDA 2V5UA 4BAZA 3QU2A 4K5QA 5F33A 3TFQA 1WPGA 1VPVA 2CDNA 4GKVA 4MB6A 2YNMA 3A4TA 1CERA 1ZLYA 3QNWA 2FP3A 3WMEA 5IZ4A 2J9YB 3IAEA 2VWGA 4Q9KA 1F17A 1BW9B 5B1DA 4YUXA 1QR2A 3STVA 3EC7A 3QLEA 2JRCA 3OZDA 4IQFA 4R69A 4AP9A 1U65A 1Y6QA 4H0CA 3KJNA 2EBFX 4ND8A 3PFIA 1SZDA 2FU5C 3LPDA 4J4BA 4A6DA 4AG5A 3H13A 1L2TA 3VJLA 3EG5A 1VQ1A 4B0PA 4KYUA 1EK5A 2BLNA 1KBQA 2CXQA 2BFNA 2FW8A 4W1QA 1ZD2P 4GC9A 4D5EA 1E98A 1M34A 2VUSA 3FCAA 4DA8A 4EF4A 1UBFA 1CQPA 2PKEA 4EVSA 1A9YA 1E1RD 2I0FA 2V1XA 5FA6A 1RLIA 4KV7A 1WVMA 1ZOOA 3F8SA 3UNXA 3UT0A 2V65A 3TEJA 3WX0A 4LVKA 1L5FA 3CRMA 3MPOA 1B7GO 3N0TA 3OBIA 4UTVA 2P30A 4ZJYA 2PGAA 2ORYA 3SQDA 2CV2A 2RFLA 1FFGA 1ZZGA 1O6FA 1S2OA 2R7KA 4PS0A 1AA6A 2AKWB 4R9VA 1XR3A 1PEAA 2KMLA 4LHZA 4BO4A 4EITA 1Q1QA 3U9TA 1MO3A 1DXOA 3H9JA 2CLHB 3NDIA 1T0JB 3O8CA 4KN8A 4OOFA 2Y0BA 2OZEA 2A0UA 1GDTA 1DAGA 3WYBA 4J49A 4NBWA 2XE4A 4PBTA 2P9FA 3AIMA 4H17A 3OQJA 2D4HA 2FEAA 2YINC 2JFFA 5AVZA 5HHTA 5KBYA 1T9ZA 5IMBA 1CP2A 1TKAA 3A2NA 2ID9A 2FMIA 3IV7A 1A98A 1KOJA 3KYCB 4DLRA 1QU3A 4N5DA 3ASYA 2A92A 1L7RA 1N3YA 2MWMA 3B9PA 1TKRA 4X84A 5LJIA 1J1IA 3LJKA 3PJFA 2HSJA 4YRNA 4RHCA 2H48A 3T41A 5A3QA 4W8HA 1P62B 1H2RS 4ARBA 3R0ZA 2G5CA 5BV7A 2PZAA 1B23P 5IXYA 1RYFA 4YY3B 1LC3A 1Z22A 2PZJA 3HFRA 3A6JA 3W6NA 3N0VA 3SWWA 1QAQA 5CJ2A 2OP1A 3BUSA 4UXJA 1O97C 1Y6RA 5I7EA 1R0ZA 1X55A 2F1HA 4U7TB 3U81A 2HGSA 3C3YA 4CDGA 4D57A 2NO5A 5KOHB 3LSQA 1JG7A 1VMIA 2RC5A 2Q6VA 4WFJA 1CEYA 3TEHB 4AMZA 3OD1A 1MB3A 1IUKA 3G9XA 3V7UA 4A10A 2J5QA 5LZ4A 1NL3A 2EX1A 2F67A 3W34A 2FFHA 4HDNB 4D45A 2GN6A 2LE0A 5K3FB 5U4QA 2ANBA 5DU2A 2BC9A 4AICA 5BSWA 5CM8B 2FEKA 3LX4A 1BOFA 1KAEA 1YVDA 3O92A 3HZRA 3P2MA 4L4RA 4NP6A 4QARA 4AZVA 4LVIA 1EHYA 4PW0A 4KHPB 2CFTA 3RSHA 1JJ7A 1AGNA 3G9UA 2LRHA 3VDMA 4CEJA 3WTCA 2NPOA 2R7AA 3CH7A 4RHYA 3TPCA 4BOYA 3T3NA 2VQEB 1SXJB 2FXIA 4J16C 3R3HA 5BWNA 1I0LA 3TOSA 3B5EA 4DBZA 1WF3A 1SKUA 3R0JA 4O2BF 1Q91A 5JZMA 2WB2A 1HLDA 1CJKC 4MRPA 1IOZA 1ADYA 3OX3A 3U7HB 2FQYA 4M0UA 5IDYA 3ER8A 4AMGA 2E5AA 2WUEA 3CGGA 3FNEA 4OHPA 4LZOA 1TF5A 4YJ3A 4OM7A 4DC0A 3MCWA 2WNHA 2ACWA 1L1QA 4IWYA 1WXIA 3ICOA 3LK6A 2PD4A 4D9FA 1ORDA 4G8BA 2GJ9A 1J0EA 3CYFA 4FI3C 6PFKA 2FZEA 3R7DA 2NSLA 1WEHA 4M7WA 4B81A 4JQYA 2I78A 3H8WA 1KI1A 2VQ6A 4G63A 4L4YA 2JFHA 3REQB 4F9FA 5HWSA 3GNTA 3NNSA 5B1YA 4UQOA 3WSWA 2W4MA 4KAJA 3KUXA 3NWJA 3AL2A 3OLXA 3R6WA 4LQCA 2B34A 2FEXA 4RD4A 1NQWA 1LB1B 1RE0A 1V7QA 2QTVA 4BBPA 5FLKA 3RVOA 4AJOA 1DIGA 4HFJA 4TTJA 3VPHA 3D6HA 1C3EA 3BSFA 4R8RA 3IBYA 1KHTA 3RG8A 1TX4B 1GGHA 1GR1A 1M2NA 4AN4A 1G4HA 1II9A 2WHRA 5DF1A 1E3TA 2BKVA 3OP1A 3V4FA 3E6AA 2ZYHA 3E27A 4ZFNA 3IUYA 5AM4A 3B9QA 1LJUA 4QTYA 3ZU4A 3A3OA 1FLAA 4MCIA 2QEQA 3UB3A 3J81k 5DPMA 2XE7A 1AQ6A 5A3RA 4LV5B 4BGEA 1E1QD 1WDTA 2MSNA 1GTJ1 2NOAA 3OURA 4LMRA 4BY9E 4W5RA 4RORA 1QNFA 1M1YE 1U2ZA 3HL4A 2E3CA 4J2OA 1JFRA 1JMVA 2AFIB 3FF1A 5EMJA 1RWXA 1Z37A 1PW5A 1VJ1A 1XZ8A 3ZUGA 5BWMA 3WHIA 3F71A 2NYUA 3BMNB 3B9RA 4W63A 4FB4A 1H93A 2Y4NA 5FLEX 1DEXA 3LPCA 3ZHTA 4IUDS 4FMDF 1Z83A 2O8CB 2ZCUA 1ULUA 2E5LB 1RM5A 5K51A 4ZRDA 2WNSA 3W5JA 3EZ9A 2O4UX 3HB4X 2GYWA 5HCIA 3ZHOA 5IRCD 1XMVA 4YCVA 3UUFA 4AN1A 2E48A 3O93A 5DDIP 4EEXA 1E22A 1NW3A 1TM1E 2HMVA 2XCTB 1JWBB 4M8KA 3O8BA 3T9FA 5IULC 3LXRA 5DSTA 1IMJA 1K5DA 1N7GA 3PIDA 2VJLA 3QVXA 4DW8A 5EJ5A 2BEUB 3ZV4A 3UJDA 1DV1A 2UUAB 1U2GC 2QS9A 1J4AA 3HK2A 2VCYA 2PLWA 2DETA 4OFXA 1JPNA 3KYCA 4NK4A 3L49A 5DWQA 4CIDA 3I3SR 3C16C 4J0GA 3KOYA 1NASA 1USVA 4Q1FA 3GT3A 4A9AA 3L7LA 2EP5A 4DG8A 3TW4A 1JPVA 4DR1B 2DFVA 3QUSA 2ZI5A 3L84A 3NATA 1X1BA 4QUHA 5AJZA 4CGZA 1WIWA 4Y6RA 4YROA 4F06A 2VSQA 1BWPA 1QCDA 3V7FA 4D8YA 5AM3A 1M2OA 2P5TB 4BCCA 4J7AA 3PCOA 5IJZA 2BI4A 2ZPUA 1IUOA 5LM3A 1NFRA 4RAQA 4CL8A 5KOHA 1PJTA 1E2KA 1QFJA 3WKAA 2H1IA 1EESA 3EWAA 4N47A 2DUUA 3S2IA 2GH1A 1ZRNA 3TE6A 5SV2A 3RS2A 2APJA 4ZO7A 1RQLA 4DPGA 1MUUA 4HDNA 5K3FA 2JLXA 1LLFA 3W4JA 5L7WA 4RMFA 2GILA 5CUQA 4CNBA 2HWWA 1VBNA 3P97A 1LPSA 4OI0A 5KAPA 4OXYA 3ZTYA 4Z9YA 3IPCA 1PNTA 1GCIA 2HDOA 5HQJA 4C0XA 4UFPA 1SXJA 2RHSA 3C24A 3KS9A 4PYKA 1VYVA 1ZBDA 3G0IA 1UKBA 5T8KC 2HIMA 4H7JA 4EHDA 2PV0A 1KO1A 2J0QA 1NOJA 4CCSA 1UP4A 5KVAA 1ZW1A 1MX1A 1KRHA 4P2BA 5BRJA 1Z6GA 3ETEA 1IC6A 2IYNA 3PWTA 4IJ6A 3JWHA 3SVTA 2QZSA 3IQEA 1WCWA 5FFFA 1YCDA 1Z7YA 3ZOZA 3FOZA 4U02A 3I1IA 3DKVA 1DG1G 3IIIA 4NJOA 4ESHA 4LYGA 1AK2A 1LGYA 1M2WA 2FMHA 2Q9UA 2VAVA 2NAFA 4HDAA 1BHSA 4TKLA 3UANA 1IY1A 3B6JA 1HDOA 1EPUA 1GTMA 1Z28A 2QTWB 3NRBA 3REQA 1K7SN 2R79A 3ZWBA 4QHSA 4QEKA 2PUAA 4IL5A 5D87A 2VAMA 2B99A 3ZE8A 1YE3A 2R5FA 4FYYA 3LOPA 3EFRA 4OPMA 4QQ8A 4MMYB 5D85A 3DOEA 1J2UA 1S5PA 2HJWA 4LZNA 2GNOA 2IZ1A 4XYLA 4FC6A 1JG2A 2ZRLA 1I0ZA 1PFUA 3LXMA 4L5YA 4LHXA 4B34A 3BGWA 4DTIA 4IWNA 2FEWB 1E63A 4TL9A 3EARA 3RC3A 1BVRA 5AVWA 2PD6A 4BN0A 4BO5A 3BTUA 4FINA 3GP8A 5C34B 1ZHOA 4Q4LA 1Z5VA 3EUWA 3ZY2A 3ANLA 1W96A 2ZCEA 4L28A 3O2NA 1ZC4A 4HVAA 1KPHA 1GDHA 1LQ2A 2CLMB 3BULA 4P73C 3CR3C 1U5CA 3FYUA 3PL1A 4G5HA 5BV2P 3BZUA 5KVQA 1EGMB 2HEIA 1C80A 2IPLA 1ODFA 1FBTA 5EMLA 3RC2A 3C43A 4I55B 4K03A 3P8TA 3MWDB 4LMBA 4RD2A 1M10A 1NBEA 2AFHE 2AFIA 3R5HA 3TL3A 2WIGA 2WUFA 2VT7A 3DHEA 4YAEA 3ZQUA 4Z7QB 2Z30A 4ZT3A 2QD2A 4OMCA 1P31A 3NKLA 1Y8AA 4LRTB 3QX3A 2R65A 1ZO8A 2GARA 3RYHB 3CN7A 4IYRA 5EY5B 1Z3CA 2QOEA 4QC2A 3U4DA 3UKJA 3V8QA 3W7VA 3ZIUA 3U3OA 4EAQA 1VYUA 2B8JA 3L0ZA 5KQRA 4PSKA 3IJEB 4E5UA 4YCLA 4ZREA 4ZVOA 4ZAVA 4IEFB 2ONKA 2FWMX 3RF1A 12ASA 3KQMA 2H2IA 4GX0A 3NM4A 4MARA 5D84A 4AQ7A 1RRMA 1H22A 4J29A 4R0MA 1XXHA 3CONA 1YK1A 1OI2A 2C61A 1P3Y1 1KMHB 1U80A 5TE9A 5ALNA 2DWOA 3ND7A 4AW9A 3LGXA 1FFHA 1P9LA 4BC0A 2BEUA 3AEYA 1ZRMA 5MHTA 2HWKA 1BH6A 3PQ3A 4OBXA 4GLFA 4BNXA 4CKXA 5C5EA 3VR5A 2CVHA 1WUIS 3AJ9A 4BAGA 2EVWX 4TQ9A 5BQ3A 4QPZA 2C0QA 4P7BA 3TJMA 1T15A 2G25A 3G2LA 4NBUA 2RGNA 4CKZA 1PWZA 5SZIA 1NE7A 4V1CB 3B7GA 2RC6A 4DSTA 2AFVA 3IELA 4R7ZA 4P86A 1AV6A 2DEQA 1LXCA 4LDZA 4BS9A 3KQQA 3CQ9A 4X3PA 4DTCA 2QMUA 4KJXA 1JDNA 3G2PA 3MG9A 1OV4A 3C6KA 1UOOA 4QTXA 1N9KA 4NZYA 1USWA 3WWPA 1BKSB 2I6FA 2VHWA 3VKGA 3LQRA 3ABSB 4DDKA 2WMNB 3DL4A 5ALYA 4M87A 4M3NA 1JT9A 2WYUA 3D4NA 5FD8A 4ESOA 1W47A 3GXOA 5DYGA 1X7HA 2HD4A 2XUHA 4HR7A 4MWZA 3ENVA 1D2AA 4O1IA 3TW6A 1T9KA 4UPEA 3M6UA 2A9KA 2ZI3A 3H83A 1VCNA 2CJPA 3VJMA 4EL5A 1Q83A 4KXNA 3T3MB 1KEUA 1OFIA 3K0SA 3K2BA 1X87A 1Z6ZA 3IUEA 2QWXA 2B30A 2HU7A 1R0KA 5MDHA 3FRHA 5DT9A 1O4WA 1DBPA 1W6UA 1CPYA 4OQFA 3VQWA 2VWHA 4RBNA 1JQ3A 1M7GA 2Q1TA 1L5MA 3PSAA 4KQMA 3RIYA 1KJWA 3FLBA 1SVSA 3TR6A 4Y7DA 4BLTA 3ZVMA 4WXMA 3BFMA 3T7TA 4EKGA 1J7KA 5AKEA 4MR9B 1JHXA 4E70A 1I94B 3QVUA 3V2GA 4JBLA 3PWSA 2QQFA 4Q7MB 3A3PA 1K7YA 2ZNJA 1OASA 1V3QE 2RGXA 3AW9A 3S2YA 4D8WA 2J31A 5IUKC 1XL0A 4ZI3A 1DFHA 4EF5A 3FOCA 2PRZA 4JLWA 2R9VA 2ZBDA 1HZZA 2NM0A 3L1HA 1HBJA 1XAJA 4JOCA 2OV1A 1F60A 1BAPA 1TM3E 2JA2A 3D7NA 3PUWA 4M88A 5HFAA 3KETA 5FJIA 3VH4A 2ETXA 3UJAA 4EJ0A 1C4XA 1N34B 4CLRB 4GX1A 1QTIA 4C3UA 1COWD 4S1NA 4MRRA 1KC3A 1IHOA 1EP1B 1KYVA 3NIGB 5I3CA 1A27A 1Y1RA 1KTIA 5JJCA 3GAAA 3QX8A 3ICQB 4KAXA 2ZUVA 1MEOA 2WTXA 3JARB 1YBHA 1WS6A 2JHAA 4YB8A 2VP9A 2OD7A 3M83A 1V35A 3LE8A 4DHWA 1KMIY 1C9EA 3IHKA 4GQIA 2BLLA 4NYJQ 2VJKA 3ZV3A 1W46A 1ZD4A 3QBDA 3WY9A 4OQZA 3TAHA 4HGYA 3G2QA 1Z6TA 1FFDA 1QZXA 4M98A 3LP8A 3STHA 3FW1A 1SU4A 2ATIA 1NM5A 1BJTA 4C0LA 2GEFA 5K4HA 2AOVA 3HU3A 4HAIA 3L5OA 1JEYB 5THQA 3AVVA 4LTDA 2D13A 3KLNA 1K75A 1OC2A 1UH5A 1R8QA 4E5YA 5TRTA 3AF1A 3T9BA 2DJZA 3EFOB 4LYEA 2P77A 3WMXA 3ZNNA 1NVMB 2VRWA 3QBJA 4FS3A 4I55A 1C1HA 1XDDA 3MWDA 1DQZA 1FB5A 3GVHA 4HWSA 3PHBE 4FCTA 3HO1A 1IEXA 4HMOA 3L7OA 4BNZA 1Z45A 1PYGA 3N0RA 3RRJA 1MR3F 3IJ5A 3MIZA 1VPWA 4KXYA 4PIVA 4M9SA 1XEWY 5FO1A 4DNFA 4PPQA 2OGTA 3PDWA 4A0QA 2HADA 3E9HA 2SICE 4I3HA 4E08A 3C6YA 1OLXA 2HSWA 2GDZA 2X1MA 1GZ4A 3FPGA 2PLAA 5H5JA 2G9NA 3SG0A 1PJRA 4IIDA 4DN6A 5BNWA 1H2AS 5CH5A 1VOTA 3PFKA 1P5ZB 3AZQA 2AE1A 1DJQA 4HLNA 4DNXA 4ER5A 3HSKA 4ZV4A 3JR3A 1Q0SA 2HW8A 2Q5QA 4KR6A 2JZNA 3DNPA 1S3SA 3PHJA 3A4MA 4NE7A 2ZUUA 4EDHA 2FNAA 4R84A 1KMHA 2QRPA 1NJ1A 1F0YA 3AUUA 2JEYA 4QU5A 3FZQA 1VECA 1Z6PA 5K99A 3LC7O 4PGHA 1XJ0A 4J16A 3EOZA 2FSVA 3P7MA 3DUFA 2XD4A 4MA4A 5CLGA 1BMFA 4WW0A 1JNXX 5LP1A 1H9CA 1KEKA 1VHQA 2FMTA 3W2FA 3HXXA 1LVGA 5G1OA 4HK4A 3QU7A 3UWPA 1N6NA 3GGOA 1WO8A 4HX9A 4RXUA 5HGJA 3RU2A 2QN2A 3WIEA 1N5OX 4V1CA 1GUBA 1F0NA 3P2IA 4ZYTA 2C2XA 2I3DA 1WQ4A 3M4ZA 5TQJA 4H3VA 5IP5A 1TVEA 1U6JA 4YXWA 4UHFA 5ITSA 3KKLA 1JSRA 2TMGA 5J1TB 4L5IA 1KIMA 4WKBA 2P40A 1N2BA 5BURA 1WLYA 4OLBA 1AT1A 2WSBA 2QT9A 3CEPB 3WLAA 5D8DA 1I4EB 4BDTA 1KA9H 4NZZA 4BFXA 3DFFA 5KS2A 1EGQA 3ZI4A 2ECPA 2ZUEA 3S8EA 4JP1A 5GM2A 4JJGA 2P3LA 2WZBA 1MOPA 3ZCUA 2PUBA 3VZCA 4AJNA 4H3HB 3H2SA 4PC7A 4QECA 2CDCA 2VXYA 3Q5GA 1KYIA 4EECA 3VZSA 5K45A 1A7AA 4Z86A 5HKLA 1O54A 2I7TA 3O1LA 4IICA 1QCYA 1IXRC 3A25A 4N65A 4N39A 4DDMA 1W29A 2RH8A 1UBSB 1VKOA 5DTEA 4NESA 3HJRA 4DIEA 4LCBA 3H2KA 1AZTA 1X1DA 5SYAA 3S68A 3KFUA 3E15A 5JAZA 4MR9A 4M0MA 3E48A 1WZNA 2IDZA 2G4LA 2K5UA 1DCMA 3BA6A 5TS2A 1WDKA 4OP0A 3HVHA 4TYYA 2HCRA 3HBJA 3A37A 1ZMBA 4BX9A 1PJCA 2BFFB 1WEKA 1SHJA 2QY9A 4IIVA 4P3NA 2NYRA 1MIHA 4ISCA 1TAHA 5AJTA 2DZ9A 1RYBA 10MHA 2B36A 2ECKA 3TTXA 4CLRA 3TR0A 1Q0TA 3LQ1A 5TEVA 1K3TA 2CDBA 4FB5A 1PTJA 3UOGA 4TYQA 3SEQA 5L7TA 3D8BA 1MAAA 3T38A 2JLZA 3ODPA 4LJ9A 2PZBA 3MWLA 4NBVA 1H4VB 3PFCA 4NTZA 5BMVB 2GK3A 2FG7C 2WE8A 2REQB 3JARA 2RMKA 4MWDA 4RIIA 1XVIA 5ED0A 5IJXA 2Y99A 1XZHA 4LS3A 4BMXA 2HTEA 3V3TA 5E3JA 3OQOA 3QPAA 5EKUA 1D1TA 1YB7A 3BWMA 1GLGA 1PZNA 2GD0A 3UWMA 3V1YA 4DXAA 3RIEA 5HIAA 2FUKA 2RGBA 1WNLA 2WZDA 2ZS8A 3CT4A 4G25A 1YQTA 2PSFA 3CFYA 2NSJA 5CH8A 2DLDA 2A1TS 3F3MA 4LF5B 4HB3A 1Z0JA 3IPAA 2MYPA 3E23A 1Z4PX 5AKYA 1MDFA 3OEHD 3P26A 2J46A 4RNCA 3ROTA 1JG4A 4TTPA 3GNQA 5AI9A 3H5WA 3LFUA 4M86A 4RU1A 1QIGA 4BTVA 4HV4A 1DT5A 4RY2A 5C32A 1ENZA 4K1XA 4UHCA 4RYLA 3OC6A 2PSJA 3IIEA 2FXVA 4YBZA 1SBYA 2ZRJA 3RF7A 4N7MA 1U5AA 2Y76A 3QH4A 2KM1A 1IN6A 4LY0A 5EE0A 3F7NA 4AIRA 1XQXA 4R1QA 4TKUB 2EGGA 3ITEA 3OLQA 5AK6A 4BGIA 4CG1A 1D03A 5C7IO 3CW8X 7MDHA 1Z35A 1BFDA 2GGSA 3MT9A 3WKCA 1RZ3A 5JSUA 1WG8A 3QEAZ 1I4DD 4XWGA 5DLPA 4AYXA 1H2ZA 3DO8A 1NMSA 1A5BB 1Q77A 2FYKA 1DRUA 3ESDA 1X9IA 4Q1VA 3HN7A 2RONA 2F3SA 3ETDA 3K70D 4B7XA 2ETVA 3RNLA 5F52A 8MHTA 1LI4A 2V96A 1OCEA 4PAOA 5T8KA 4NCAA 1XPRA 4Q03A 4MP3A 2AJCA 5A3JA 3OPMA 3G5AA 4JA0A 3JQAB 2Q6KA 3UOWA 1Z34A 4E31A 1N0UA 1FW8A 3LBFA 4QQNA 3ZWNA 2CYBA 2WB4A 4DF3A 2X2EA 4M0LA 2XYQA 4REOA 3LC2O 4TWBA 1YMQA 3PICA 5L3RA 1Y1PA 1OZAA 3BXOA 1WKCA 1KR5A 2XHEA 3AF5A 4QD3A 1IONA 3G1WA 4R3WA 1LQUA 1I4TD 5AI8A 4AZWA 5IZCA 1FUEA 1JS1X 4J4HA 5F7ZA 5DOVA 1KJYA 1LTKA 4ZYUA 1EFAA 1JQEA 4B3XA 3IR6A 4NMWA 2OQ2A 3G0BA 4NZ9A 4QXPA 4C0WA 1USKA 1ZHHA 2OLEA 3LUCA 3O4IA 4WCDA 4WZAE 3UA3A 2WT9A 1SXQA 3EAFA 3BSWA 1C3LA 1DIAA 1ZIPA 2UYHA 3AY0A 3B8EA 2RD2A 1ZPDA 4KBGA 1KWGA 4OXQA 1LPPA 4YDQA 2GBFA 3BIOA 1XTKA 4XM2A 1HM5A 5HZKA 3CNNA 3Q6MA 4JT4A 4LBZA 1WETA 1A97A 2B98A 4AMUA 1BD3A 2J0EA 1L6RA 1AURA 3ICEA 4PAMA 1BVUA 2HJ9A 1PGJA 3OM9A 3M4XA 4RXTA 1L5OA 4DV0B 4YJ3F 1V5WA 1YQ9A 2PT6A 2PX6A 3HHEA 3WLIA 3ZWQA 1C0LA 3RUPA 3K4HA 2W6ZA 1XAHA 2IZOA 4CCWA 3PGVA 2VDNB 5J58A 5ULLA 3QMWA 4B1FA 4GKBA 3FFTA 3KVYA 3T9CA 3HDQA 4MS1A 3QW4B 2VTEA 3MHPA 5JHHB 1RQRA 1GYQA 1YJQA 1X0VA 2ZKIA 3ACDA 5FNZA 5DX1A 3KZNA 3DSRA 4FIZA 4BO1A 1E1KA 4HYYA 3I6MA 4ICIA 4LNAA 5BSFA 3O3MB 1EP2B 3R3JA 3EY4A 4S2EA 3PFBA 3WIUA 4UUQA 1W9MA 2PU7A 3ANXA 1MVLA 2I71A 4NHOA 4BDSA 3RFFA 4E2FA 1KWKA 4TOIA 2Y0PA 3GX1A 5AOAA 3O8QB 4GMDA 4QGHA 2BFFA 4JFRA 3SF8B 1BXKA 3UENA 2DM6A 2ACVA 4RVGA 3RFXA 3ZHXA 3CUEF 5ITWA 4CM7A 1F38A 2W2XA 1MO2A 1EFWA 5AXAA 1NBHA 4NS4A 1RJGA 2XX3A 2VOEA 3AP3A 4QRDA 3UTDA 4AKGA 3LK7A 1H2WA 1Y63A 1PF7E 1SG6A 2D8MA 1HPLA 3EGIA 5EIFA 3BIJA 3GQBB 4OLHA 4S24A 4X44A 1AQJA 4R1UA 4LF6B 2IBSA 4HPWA 1Z8FA 2B20A 4R40A 3TZEA 1U0NA 1JU3A 2P9TA 4GSLA 3UAZA 1YC2A 3Q2KA 4K6FA 4A23A 4C4AA 1V25A 4ZYWA 4L73A 3ZIAD 2F2TA 5I01A 3N6VA 3U5ZB 1LDYA 4HNSA 3AY3A 4P7KA 1LS1A 2NWQA 3GLHB 4P4TA 4PLGA 2IU6A 5JTTA 1TZMA 5ELMA 2JGKA 3HP4A 4LRQA 1NN1A 4D6XA 4YT8A 4X8MA 3O3NB 3NTVA 3Q9NA 2BMJA 4LFBB 2Z4SA 2XRMA 4B40A 3SHOA 3K30A 5LR6A 5ERYA 1XRLA 4L51A 4P6VF 3EIUA 3SVLA 3OTHA 4JP8A 3IAS1 4UTOA 4YC7A 3U5TA 1OHHD 2SHKA 2VNKA 2EAYA 5GIOE 3TIVA 2WSMA 4RTQA 3I52A 3PIIA 2VRNA 2Q2VA 3LAWA 2AQIA 4MUKA 4CTMA 3FMGA 3PFWO 5AW7A 4I2VA 3EEYA 1V9CA 5C3UA 3JWPA 3TFWA 5BYJA 4F72A 4WBNB 5LCXA 2J3EA 4GE3A 4TKUA 3T0FA 5LVAA 4AY2A 1FDVA 2I76A 2VPYA 3F6BX 4G01B 5AVRA 3T4XA 2NN3C 2JGNA 1UJBA 4RZ2A 5BNFA 2UUPA 4CMJA 2GCPA 1K98A 4JVSB 4LXGA 4GI2A 3VFDA 1PS8A 3M6WA 5EERA 2RHOA 3Q40A 5A4DA 4MDEA 4OGKA 5JYCA 1MF7A 4BN4A 1NQUA 3RTAA 2X3UA 4ECEA 2YDYA 1HEUA 3LS2A 2UAGA 3QKRA 1T2DA 4M0EA 3VPDA 3JQDA 1A7KA 4D43A 2ZVJA 2BH9A 1G8FA 1E60A 1PX2A 2W58A 2GBCA 4NR0A 3VR4A 4YV2A 4FYPA 2WE7A 4IQGA 3NIDB 2ZXFA 3JQAA 3V5NA 4W4TA 1RI3A 1GT91 1XX6A 3Q2IA 1R64A 2AJLI 2IUFA 2P41A 4XTRA 4OATA 2MYTA 3AHHA 3ESYA 4J91A 2WAYA 1UZMA 5DNAA 2AH5A 4IYJA 3D8HA 2J7PA 5B1EA 4N6NA 2E64A 3RKYA 1FNBA 1GQSA 5KU7A 4LX8A 4XB2A 3IDQA 4Z2YA 3RIMA 2D06A 4QLAA 3LRTA 5AXBA 1NULA 5D1NA 3AEUB 1M2FA 3ROQA 3ZYCA 4COOA 2RK6A 2FZGA 3LIPA 4R1PA 4JBXA 1K4KA 2QXYA 5B6JA 2BEKA 4XTYA 1ULZA 2FN3A 3DDHA 3LVRE 4AVYA 3LVQE 1W73A 3ONWA 5JNWA 4F0JA 4AY5A 4MWCA 1GILA 3Q8WA 1VCHA 2PQ6A 5EP2A 1TD9A 5J40A 5EWLB 2DQ4A 3TM5A 4TV8B 2H51A 4Q9DA 5CYFA 3DE6X 3U0BA 1J70A 2BGMA 1KSHA 1NMYA 1RT9A 3BQMB 4FNMA 4U6NA 3RBAA 2XGJA 4J07A 4DA4A 4X7MA 3U31A 1UBNA 4U3JB 1G38A 1ADBA 3R9KA 3FE2A 4UZEA 1S8OA 1Y4SA 3V6LA 1Q0ZA 5DM0A 1VE5A 5KHLB 2WWHA 1J7JA 3LHKA 4G07A 4GP6A 3OPYB 2HCFA 3EZFA 1NVDA 1LFDB 2VP2A 4RQTA 1DWPA 4D2IA 1PZXA 2L69A 2QRQA 2VNSA 3E1SA 1FP2A 1H2EA 3O8QA 2A9VA 3D6AA 1N92A 2ZCVA 1KVTA 5CBPB 2O7QA 3LLUA 1DAEA 2JJMA 1QB8A 1SEPA 3M9XA 3MJSA 3QKUA 1Y5LA 2XUPA 2I91A 1T1IA 1DX9A 3NHRA 2CB0A 4GM4A 4CF6A 3GQBA 3G85A 5AQEA 3SY8A 1JHRA 1FMJA 4PIMA 1XMOB 2X9NA 1DG3A 4UDXX 4D6PA 3HACA 3UWSA 3HWRA 3FTQA 2QBYB 3LY7A 4U7JA 4YLYA 1D2NA 5HK9A 2O2EA 1E0AA 4H2VA 1MIOB 3WB0A 2CHQA 3DZHA 4I1IA 3W2EA 2DR2A 2WIBA 2IXBA 3BL5A 3COPA 3GLHA 1BFUA 2WWRA 3HEBA 1BBWA 3FPBA 5E1OA 1K27A 2W37A 1O6GA 1W8DA 3SX4A 2UYCA 4DLAA 3FVTA 3VU8A 3COWA 1Z7NA 4MKZA 4ER6A 1X7YB 3UJBA 2O5EA 4EB0A 3AHDA 2AR7A 3FZNA 4HH4A 4R41A 2NT4A 2VJMB 2QV7A 1H3FA 4Z4FA 2ERYA 2E10A 2M6KA 1ZA1A 2C9OA 3IPYA 3SZOA 1S96A 2BGRA 2NTJA 2Z1DA 3SNKA 1SQ5A 4HRYA 4BFVA 3KCQA 1WULS 4OQQA 4R1MA 2P8JA 3WGUA 3L9WA 2O0HA 3BQNB 1F4PA 3RS4A 2OR3A 4TM8A 1NSFA 4WBNA 1D6MA 5EOVA 1EWTA 5HGXA 3U09A 2GO1A 1WJGA 2PK3A 3PUJA 1J2RA 4JD5A 3FMVA 4KCGA 1NF9A 1TVKA 4KOAA 5AJUA 3BWBA 4DG5A 5CDHA 4AKEA 4IF6A 4FNGA 5JANA 1E2QA 4Z4HA 1YFLA 4PO8A 3DH0A 1NRWA 4LY9A 4CQJA 2O8DB 1BWRA 5DV9A 4Y1EA 4ZOQI 5EG5A 4JLUA 4DA9A 3R3WA 3OQNA 1CQJB 4Q05A 5HKOA 4A6XA 1B0AA 1RNLA 3QXJA 5FA5A 1R0SA 3IMCA 1GU0A 3TOVA 2YZNA 2ZYWX 4HZUA 3LBIA 2BDEA 5EVJA 2VO1A 1V3VA 2QD5A 3CXRA 3LL7A 2A5YB 2EW8A 4KJZA 4OUDB 3OO0A 5FNVB 1XA4A 5C4IA 2CVQA 1Q7EA 4LHSA 4JAVC 1N25A 4G5FA 4W9NA 4OHUA 2D54A 2VSFA 1IBKB 4GM0A 1L5SA 1KEVA 1XQ6A 3TRDA 1QUEA 3I32A 1V5GA 2XWSA 4E5SA 3HO6A 3RQSA 1OAKA 4F3NA 3NHSA 2VR1A 3MS7A 2CLFB 5TGDA 3JXEA 2ARSA 4QXRA 4WAUA 3DEAA 1D3AA 3QIVA 4RWEA 3H2YA 1G5RA 1UPCA 2LP4Y 2PBFA 2J48A 1VJGA 3KXIA 3T8YA 4B44A 1HSZA 1TA0A 3JZMA 1OSNA 4Y6GB 5AKZA 4GOOD 5ALXA 5HIJA 1Q22A 1W6RA 4JJKA 4QJ5A 3H05A 5LQDA 3WNVA 3GMTA 3MCZA 1QH9A 3URKA 3KEFA 2CMKA 2NO9A 3GHHA 4IV8A 3PV0A 1EDDA 3MT0A 5FR1A 5D5PA 3EF3A 4B47A 1N9GB 1SU8A 2Y2UA 1JR3E 2YMPA 1UMBB 2H6EA 3BCUA 3F74A 2B2NA 4V3BA 4B84A 2FMXA 2OG2A 1Y6ZA 3FJYA 3S27A 4DLPA 5BV1A 1BROA 1XLWA 4XOIA 3PA6A 2OXFA 2LCQA 5G3YA 2IZ6A 3R6LA 2CNLA 2JG3A 4WLUA 1G7SA 2A9JA 1OUMA 2RJOA 3L7KA 3SXJA 4B6PA 2ZTHA 4IMRA 1ZNZA 1ORWA 3OPYA 1AKTA 3PG5A 2IY8A 1JJCB 1NWHA 1NMEA 3KBBA 1ZZEA 3CIOA 2XBMA 3KR9A 2Q3BA 4NE9A 4XZ3A 3IDOA 3EXG2 4KWTA 1EBUA 3RGGA 4MZXA 1N4AA 2EYUA 3L0DA 3N2GB 3PQCA 4MUBA 4FCWA 2DQ3A 1QX4A 3PLRA 5K0FA 2E4ZA 3HY6A 3IILA 3RUAA 4LXQA 4N7JA 1ZKDA 3RSCA 3AUAA 4EG0A 3WYCA 2GNAA 1VPDA 1IQPA 1VE1A 4UW9A 3J7AC 1K9VF 3P9SA 1EQRA 2SECE 3LSSA 2R3SA 1P7CA 3DB1A 5CYOA 3OSZA 4WF2A 2PBLA 4EPVA 4WINA 3R3VA 5EZYB 2H2HA 3EGOA 3HB0A 1P7ZA 1VHLA 3K9CA 5AXDA 3ASVA 4Q3KA 4I55F 3W7AA 3QOWA 1V1RB 1E1QA 2BM8A 4IXNA 4PO1A 1EAMA 2QBYA 5G4LA 3KTAA 1I7PA 1MIOA 2C92A 3RS3A 4P31A 5LUBA 4KPUB 2C57A 3KZMA 4MKRA 4MV4A 4W5JA 3VR6A 1DZ3A 3R20A 3KE9A 4MRNA 1SEVA 3N2NA 5HPYB 4BPBA 1ZRSA 2D2FA 5ILQA 4RV9A 4PSCA 5E2AA 4QRHA 1PFGA 1X7YA 1Z5UA 4J0DA 1R9JA 3TBKA 2VJMA 3UMGA 4DA7A 1ATIA 2WYHA 1NUHA 3R7BA 3T54A 1IHPA 2FB9A 1B0ZA 3QMVA 5JROA 2XR1A 3FJ1A 4YACA 1VG9B 1RXWA 3EIOA 5K3BA 3ZV5A 2PMBA 4BRUA 5EIBC 2VBCA 2H8KA 1VL6A 3JQ8B 4FHCA 3JVIA 1KS9A 2FMKA 1X3SA 2OLJA 3KKKA 4ENSA 1HNWB 3FSGD 4ABTA 4PLFA 4YS6A 4P3KA 3LL4A 3EDMA 2IHVA 1OKKD 4TVKA 3UGQA 5G02A 2PWAA 3QEMA 3TTVA 4I9GA 4Y0VA 4CRWB 1U3VA 1CQJA 1ZGZA 1ZK0A 2CNDA 1YBFA 3HCEA 3L6OO 5E38A 4DIKA 4Q9LA 3GFSA 1QRTA 1LLDA 1JDVA 4F2PA 1V8FA 2QN7A 1NTRA 1NIPA 2VDVE 2R86A 3AVOA 1G8PA 3KRTA 4UAUA 1G21B 1OREA 2H52A 5FNVA 4OUDA 1B0PA 1L9XA 3P9YA 5LNK1 4P0PB 4RF5A 4I6GA 2IPAB 3GEBA 3NM5A 1JHMA 5A1JA 3PLAE 3ANMA 1KZ7B 5DXJA 4RH3A 1E6UA 2FLVA 2Q5EA 2VHQA 3RRBA 3S5UA 2R25B 4O08A 2P5IA 3QELB 4DIBA 4I8IA 5LKRA 2GDJA 1XTUA 4MZDA 1TZJA 1Z75A 1GQ2A 3C3WA 4M21A 4KUHA 3T52A 4RZ3A 4BO9A 3UMVA 2AV6A 2COUA 2XTNA 4CV2A 2GVNA 3CUTA 4OO3A 4D74A 3VO1A 3EZLA 5IM4A 3CVXA 3TZCA 2E89A 4D3XA 1GITA 1L4MA 1EQUA 1VHWA 1WXDA 2VQSA 4V0LA 2EJ9A 4D7AA 3LPMA 2PYZA 2COEA 4LQDA 4D02A 1QG0A 3D0KA 1S2GA 4E3ZA 1YBMA 1JWLA 3V8LA 1WB5A 1QX3A 3DDWA 1P60A 5K20A 4FD2A 4RL6A 4ER3A 1ZD3A 4UUPA 1N9GA 1IXZA 1NR7A 1UMBA 3SQNA 2VG8A 1TAQA 2QN8A 3TLZA 1WM1A 3RFVA 3KOUA 1QGZA 1MNQA 2X42A 4PPNA 3ID6C 5K3OA 3RIGA 4WN3A 2Y1FA 1Y7HA 3DOIA 3N3BC 1JU9A 1UFQA 2QUHA 3KQVA 4JYCA 6NULA 3UCEA 2O06A 2X5JO 4Q9NA 1Z08A 3UC5A 5I4KA 3VNUA 1E7RA 2HUNA 3KOOA 3OUUA 4MVYA 3QO8A 1KBZA 1WW8A 4OXXA 3N2GA 4EM6A 3DZ8A 4NU8X 4OQYA 1KI6B 1A4UA 3IURA 1YNOA 3IPLA 5FUVA 5JATA 1DWOA 5J1SB 3CZCA 2CK3A 2ZRDA 1E9AA 2R48A 1VKZA 2ZJ4A 3OJCA 3ZG6A 4N6OA 4ALKA 3QSYA 2FX3A 1JF8A 4XRRA 3C74A 1UDXA 1IN5A 4PCVA 2B1RA 2ZQZA 3T1VA 1U2SA 5EJMA 4EZBA 5KQMA 3GT0A 2G4VA 5FBRB 2ZJ0A 5EZYA 1GTL1 2QPTA 4FDAA 2II6A 1QVVA 5JFTA 1CVIA 1U2RA 2RAFA 5EUBA 1KDVA 4UBIA 4UNNA 1SU6A 4DIFA 5EKXA 3L46A 1KKUA 3REUA 3NOQA 3D6JA 3Q9UA 2XVZA 2REOA 2FSHA 3KJZA 1R5OA 4JWTA 3DAFA 2NUAB 1LRJA 1XJ5A 5GQSA 5EWJB 3HUFA 1E8DA 1PZFA 1JFLA 1SUSA 3LYLA 5HRCA<