3NETA

Crystal structure of histidyl-trna synthetase from nostoc sp. pcc 7120
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
456
structure length
431
Chain Sequence
KINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQNIIYGLEPILEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGEFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVAADLAEEIKRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Histidyl-tRNA synthetase
publication title Crystal structure of histidyl-tRNA synthetase from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp. pcc 7120
total genus 134
structure length 431
sequence length 456
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3netA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3netA02
1JJCB 1YGBA 2ODRC 2EL9A 3HXYA 2ZTGA 4TQFA 4XTYA 2Q7EA 3G1ZA 2XGTA 3NETA 3RF1A 5ELOA 4TWAA 5C51B 2ZINA 4AH6A 3HXZA 3FJPA 4YRFA 3KFUA 4TTVA 1EOVA 2ZR3A 4HWPA 1W66A 2DEQA 3BFMA 1G51A 3A74A 2E5AA 4YCWA 4H2SA 5K1XA 1WPYA 2ZR2A 1JJCA 1PYSB 3M4PA 4P75C 2C7IA 1B76A 1HXDA 2E65A 2ZXFA 2ZIOA 1ASZA 1B8AA 2AMCB 2EJFA 3EFSA 4TVYA 4YRIA 4RQFA 1HTTA 3V7RA 1QE0A 3NENA 4YRNA 1NNHA 4CH6A 1VQZA 4UPAA 2ZT5A 1YFSA 4RQEA 2QHVA 2Q7HA 4CS4A 3VBBA 1H4QA 4XTUA 4WJ4A 5KNNA 4KQEA 1USYC 1YB3A 1Z7MA 1EIYB 2ODRD 1V95A 1G5IA 3VQYA 1PYSA 2QHUA 3EFRA 4CS2A 4OLFA 4CH3A 3RACA 2AMCA 4EO4A 2EJ9A 4K86A 3UFGA 2HNIA 3UGTA 4PHCA 2ZNJA 3ICAA 4WF2A 3VQVA 2DU5A 3P8TA 3TEHB 4OP0A 4HA8A 2EAYA 2G4CA 1X2HA 1WYDA 2DTOA 2ZT6A 4YRCA 4H2WA 1KMNA 3HRIA 2E3CA 1E22A 1BBWA 4YRRA 1X55A 5C52B 3IALA 1B7YB 2IY5B 1EIYA 1YFRA 4HWRA 4UP9A 4ZTZB 2AKWA 2DVEA 1GGMA 1X54A 4H2YA 4YDQA 4P73C 4WJ3M 3HFVA 4XEMA 4WI1A 1J5WA 4CS3A 4YRMA 4YYEA 3LSSA 3HXXA 4P74C 5ELNA 1NYRA 3TEHA 4YP0A 2LW7A 1RIQA 3L1AA 1H4SA 3RGLA 4XU0A 2ZNIA 1N9WA 2Q5IA 1HC7A 1KMMA 3HXVA 1H4TA 2IY5A 3E9HA 2RHQB 5E3IA 4BW9A 3OD1A 2CGHA 2ZGWA 1EQRA 3HRKA 3QO7A 4YCVA 2I4LA 4P73A 4G84A 2DQ0A 3IKMB 1E1TA 3E9IA 1C0AA 2DXTA 1SERA 2E10A 2I4NA 4LNSA 4P74A 1WQ7A 3A7AA 4P72C 4P3NA 2DJZA 4PG3A 4X5OA 1WQWA 5C53B 4HWTA 4CH4A 1G5HA 3UGQA 1EVKA 3PCOB 1NJ5A 1IL2A 1B70B 3IKLA 2J3MA 2ZZGA 4YRGA 4E51A 1FYFA 4P75A 3V7CA 3RIRA 3WQZA 3VQWA 3MF1A 4P3PA 3NEMA 2ZZFA 2ARUA 1NJ1A 3A5ZA 3DSQA 2J3LA 12ASA 2RHSB 3L4GB 4YCUA 4ZIBA 2ALYB 4YRPA 11ASA 4ZTUB 3HY1A 4HWOA 4K88A 2DZ9A 4KR3A 2DDZA 2PMEA 4YRSA 3V8JA 3PCOA 3QTCA 3REXA 3PZCA 3V8KA 1NJ6A 1B70A 2C8MA 1USYA 1NJ2A 3P8YA 4P71C 4YRLA 3MEYA 3V8LA 4HVCA 2CIMA 2Q5HA 4RDXA 3QO8A 2P5IA 3P8VA 4UP7A 4TVWA 2ARSA 1ADYA 1EVLA 3CMQA 4XU3A 1SRYA 3NELA 2ZT7A 2RHSA 3RKXA 3A32A 3L4GA 4YRJA 2ALYA 3REUA 3LSQA 3MF2A 4XEOA 5F5WA 1SESA 3BJUA 3RUXA 4NCXA 1YFTA 1BIAA 2QHSA 1KOGA 2ZT8A 1B7YA 3IG2A 3A7RA 1BIBA 5K1PA 2DXUA 3LC0A 1ATIA 2ZIMA 1X01A 2EJGA 4P71A 4BWAA 1SETA 4H02A 4EX5A 1E1OA 2Q7GA 2PMFA 2ARTA 2E1HA 4H2TA 2FYKA 4YRTA 2XTIA 3HFZB 4H2XB 3W3SA 2E41A 5HGQA 3I7FA 1ADJA 4XU2A 3HXWA 2DTIA 3RKYA 4KR2A 2P0LA 1LYLA 2ZZEA 4XU1A 3RL6A 4P3OA 4Q15A 3M4QA 4XTVA 4YREA 3A5YA 3L2ZA 1NJ8A 3QO5A 3R07A 1WU7A 3VQXA 4TVAB 2RHQA 1X56A 1E24A 3QNEA 2QHTA 4YROA 1H4VB 2DTHA 2ZCEA 1QF6A 4K87A 4Q6GA 4DQ2A 3TUPA 4UP8A 1BBUA 3HFZA 4H2XA 4DPGA 1WLEA 4CH5A 1ASYA 2AKWB 2CJBA 4P72A 2E64A 1Z7NA 2EWNA 3HXUA 3HY0A 1NYQA 2DU7A 2I4MA 4YPFA 3RKWA 4TVAA 4YRKA 4HWSA 2CJAA 3HTZA 3UH0A 2I4OA 4H2UA 2DKGA 3ERRA 4XTZA 4XTXA 1WNLA 3A7UA 4YRQA 4J15A 2DQ3A 4XTWA 2DZCA 3A31A 3V7SA 2CJ9A 4RMFA 3TEGA 4G85A 4L87A 4O2DA 1EFWA 1X2GA 4TQDA 1L0WA 4H2VA
chains in the Genus database with same CATH superfamily
2AUNA 2PCLA 4GOXA 4RZXA 2QSYA 1CJCA 4HJXA 4ME6A 5J4YA 1OFGA 1A8SA 1X1DA 3U5ZB 3R9XB 1CX9B 2R6JA 4L27A 1KNXA 1MH1A 2P9BA 4QICA 2X8LA 4K9KA 1ES9A 4TKVB 2BZ1A 2ZINA 5HRCA 3IHLA 3H18A 1EE9A 1RAGA 4DR1B 3FVWA 3TPCA 4YRFA 3BD8A 3HM9A 1K5HA 1PDOA 4FCWA 2BR3A 2LTAA 2OHFA 5CVVA 1SUCA 4LFCB 4EKYA 2PK3A 2W0MA 3OU7A 4D9NA 3VDNB 1EOVA 3ANLA 4MIYA 3RS4A 4F85A 1UEIA 2HDOA 3PPVA 4C4TA 2IZ1A 1G16A 4EHAA 5F35A 3G02A 3TIGA 3F96A 2HAEA 1L5QA 4FW8A 2Q5EA 4RQAA 4ZCQA 1W4BA 1E3JA 3QFHA 3VVLA 1Z6PA 2O0KA 4LNUB 4BO3A 4JHLA 4DARA 2EIXA 2YMLA 2C2ZA 4ARAA 1XMXA 2YJZA 2O8CB 4HEHA 2Q9AA 3M6MD 1WXXA 4KZKA 4RMJA 1SVLA 3RYIA 1N5IA 3WAGA 1X13A 3QPUA 4LK2A 2Z43A 3IE0A 5FAXA 3LC7O 4R1LA 5DN6A 1WETA 4DQUA 2WWRA 4RWEA 1R12A 3RFCA 2GJ8A 5AWFC 2ZULA 1IDN1 3OZCA 1WHTA 2V8OA 3OZWA 3PXEA 4PZAA 4TYQA 3U9LA 1JMYA 4RD2A 1XR3A 4H60A 2OXEA 2I22A 2C7IA 3ENZA 3BIWA 1KK2A 3CUUA 4CI9A 2EBWA 1HYHA 1N9KA 2DQSA 1TUIA 2J0VA 4FFVA 1RXEA 3RS3A 4LSGA 2Y1GA 5HQ3A 1U2ZA 1MP0A 1N8TA 2JF0A 3CYFA 1D8TA 1F4PA 2Y99A 3F5QA 1J0AA 3CZCA 3IC5A 2GRUA 5C34B 1N32B 5LQCA 1J8DA 3ZCXA 4IJUA 4AMBA 1VPTA 5JW6A 3IP6A 3ER9A 3KXLA 1HTTA 1Z4OA 2M6KA 2ODNA 2FF7A 2QE7D 5J1TB 3KQNA 1JEYA 3LGXA 5K8JB 3COJA 4MWZA 1NURA 5C35A 1AGXA 4R8LA 2Q4BA 4CM1A 3OY2A 4EKGA 1FQKA 3ETJA 5AJXA 5AM0A 2RBEA 4MJ3A 4OHBA 3PX3A 2VYND 1SBIA 4BB5A 5ADHA 1UXJA 4KQIA 3KV1A 2A5FA 1QHEA 5GOZA 1V5IA 2FPGA 3HJGA 3NFRA 5JFOA 4KPGA 1YB1A 5TGDA 5KNNA 3Q41A 1EWVA 1HETA 1SMKA 4X8HA 2L69A 3MXTA 1GNQA 3EPJA 1DS6A 1I6WA 1M6EX 3WQRA 4GQIA 4TLBA 3ODPA 4ASUD 4RV5A 1KQFA 2RMKA 2BC9A 1FTNA 3W1EA 4BVGA 1S3FA 2GAAA 4A9AA 4YR7A 4DSAA 5TLSA 4OLFA 3I3SR 3PWZA 5THXA 1JKMA 1OZAA 2IIBA 4PC2A 1U0JA 5FEMA 2VA8A 4FXOA 3I5MA 3CE9A 4IHKA 1SVNA 2ACEA 5FOVA 4RLQA 3HFSA 5LJIA 1OH5A 4YAJA 1BRMA 3KKQA 4MR8B 1KBQA 2WSLA 4XCVA 3D0KA 3WZLA 1MEEA 3B2QA 4AC9A 3VUEA 3MVEA 4HWKA 3ZC3A 2OBYA 2BEKA 3N8HA 5LKRA 4TZKA 3DLHA 1J49A 3UWSA 1RJEA 3GQBB 1ZEJA 3N70A 3G8DA 3D59A 4ID9A 5L7YA 4AMUA 3B5EA 4H3HB 4H6WA 3FTCA 5KTMA 1O6GA 1LLDA 3K0AA 1RWVA 1QG6A 1W9HA 1IIRA 2BGIA 1NUSA 2BM9A 2WSYB 2AG0A 3OBIA 2RHWA 4MQ5A 3WRYA 4MQLA 5IC6A 2VT2A 1R4ZA 1II0A 1AF7A 3P32A 4RHUA 5BVGB 2JW5A 3M83A 1GA6A 1CY0A 3QKTA 4XVUA 1SY7A 2JGAA 3U16A 1TNDA 4NL4H 4FSHA 3NM6B 1IWPB 2YBEA 2NGRA 1W9MA 1LSJA 3S2FA 1PR2A 1BQEA 4Q4DA 1EFVA 1U1GA 1ZJYA 3KOYA 5E38A 5EFZA 3FCYA 3UB3A 5CLJA 1ZO8A 5ALPA 1ONOA 5JBNA 1UM9A 1RYBA 2F1RA 1OFTA 1GDTA 4OREX 3SMQA 1JIKA 1DUSA 5INTA 4GWKA 5DP2A 4LMPA 3UWKA 2YZ7A 4H3SA 1U7TA 2AN1A 1DOAA 1IEQA 1CIPA 2IPXA 4K8RB 1JAZA 2ET6A 3LO8A 3PZRA 1OKKD 2GKGA 1SU4A 4QDKA 1PGPA 4CLDA 1H3EA 3CZ9A 4JNCA 4KV9A 4FN5A 1X0XA 1HT0A 2P90A 3ZCUA 1CDDA 1FJ2A 1FQWA 2QD4A 4QJBA 1DQPA 1FS6A 4BNIA 4OMFG 4LVJA 1UDBA 3PX2A 1TCBA 3ZJTA 4RXMA 4BBAA 1JBEA 2I7XA 3AVUA 3HYLA 1CK4A 1E1CA 2AYZA 3AMVA 2Q5IA 3V1NA 3HV2A 2NU9A 2FI1A 3PC7A 1YQTA 5CG2A 3I04M 1TYAE 1W44A 1KPIA 5FWDA 4KI0A 3HXVA 3L8ZA 2FH5B 3P0RA 4LDRA 5JS7A 3DLTA 3H2IA 1G9XA 1U0GA 3MD0A 1K6MA 1ABEA 1U6JA 2QJTA 3PNVA 3ZWNA 5ECDA 1XWIA 1TM7E 4M7RA 4NH4A 2HR1A 3OD1A 2PPVA 2XD4A 2HPAA 3GB9A 4MRNA 3RC7A 4YXWD 2VDRB 2P4QA 5IBQA 3I9V6 5KOHB 1T5LA 1AU9A 4E94A 3PC6A 2R7KA 3GRKA 2GASA 4UVDA 4XFKA 5B1EA 5JDIC 2QAGC 3DHWC 3M6VA 3AY0A 1XDGA 5B4TA 6YASA 1DCMA 2C3PA 3DKIA 2X19A 1WCIA 3GEHA 5DHFA 2O0JA 1SA0A 4QUDA 3P0FA 3CF4G 3ZX5A 1WQ1R 3LYLA 1U94A 2E49A 3VISA 2IP2A 2JAHA 3D8UA 1E64A 5A1TA 4B3TB 4KOAA 4MR9A 4Y2HA 1DXYA 4O2AB 4PFSA 4TLEA 3RIMA 3FDZA 3HUTA 2FHSA 2WWGA 1ZNYA 5HG0A 4DV2B 1EEXB 1BO6A 1ZUNA 2CNOA 3JY6A 4Z9BA 1QR2A 1I13A 2AWNA 3ENVA 4IJWA 4J07A 3S5JA 1T2UA 1MRZA 3TJRA 1A2OA 1N5RA 4Q3BA 4D8UA 1VLVA 4C14A 1IU9A 3O8BA 3ZW8A 1NW9B 1SOAA 3AP2A 1LD3A 5H59A 3P94A 3CEHA 4F60A 5IUJC 2XIQA 1Z5ZA 1EVKA 1DHRA 1Y4AE 1U3WA 4OB7A 4O8CA 2RG7A 1Z08A 5CM8B 4P22A 1HEUA 3WYEA 1VYVA 4F86A 5ER9A 1MV8A 3TECE 4HXGA 1JJVA 4Q16A 2RJNA 4F3NA 2NU6B 1CRQA 2IBSA 1DIBA 2V97A 3QNMA 2JFYA 3JTMA 1BQ4A 3U4CA 1QR6A 3H1AA 4ZO8A 1MNAA 5LZ4A 1DIHA 3ZG6A 1G5RA 4ZA2A 4CFZA 2CF5A 2PVCA 1SRRA 1U0NA 3L9XA 2XA9A 1MFZA 1S7CA 1VP3A 2EEZA 3L49A 5E6RA 3MPUA 3P4UA 1OTHA 2R00A 3N6XA 4BFWA 3WQZA 2IKSA 3MF1A 1Q1AA 4J9UE 1X8LA 4F2DA 5JJKA 3LI2A 4JLNA 5A3VA 1V8BA 2CNKA 1T2EA 3RSFA 4AWXA 4Z2YA 1E0KA 4BNUA 2ARUA 3LLUA 4ZCPA 2PUCA 1XRPA 4PCVA 2GERA 3KB6A 1PKEA 1YKFA 4CL0A 4RMNA 3KXPA 2DWQA 1T26A 3QEKA 3AUAA 1T6YA 3PYXA 4U6SA 4KRXA 1SHLA 2RJ3A 1E98A 3CNEA 4RCVA 3HY1A 3DZ8A 1K4YA 2XCIA 3O6VA 7ABPA 5IH7A 3DBLB 5KOIA 1O94A 4HDNB 2YL2A 3ETHA 3RRXA 3TOVA 2IVFA 3WBFA 2HD4A 4BYGA 5BT8A 2H07A 3ML1A 1TOAA 4LZLA 2VRCD 3JPYA 2ZJBA 3QKUA 1EZ1A 2OOKA 4NBKA 4KO1S 2HPVA 3V8KA 3ZYZA 1G1AA 2CFTA 3Q12A 4JZYA 4MB2A 1XTRA 5K05A 3BORA 4GM1A 2NU7A 3H2GA 5T4FA 1IBCA 1VRVA 1FXUA 1R7RA 1Y8QB 2PR7A 2QMHA 1B00A 5CA0B 3MD9A 1R5JA 1J24A 1ORRA 2VQ6A 4QVKA 3SZGA 2HCTA 3AUSA 5DK4A 1QP0A 4EKIA 4NOLA 1YVUA 2G1PA 2YJGA 4R0MA 3FIUA 4UCFA 3LAWA 1LVUA 3K09A 2JIOA 1QHHB 1XD8A 2J5RA 3TD2A 3OQ1A 1RQ2A 8ADHA 1XPOA 4G2TA 4FX5A 2G28A 4LS3A 2R1VA 1EVLA 3W3ZB 4BC0A 4KMMA 4LOJA 3RE1A 1KOJA 1FE8A 3I9LA 3R9WA 1LY1A 4EYKA 4ZYLA 7MDHA 1Y1KE 3P9RA 3KHTA 1RI1A 3HJRA 1NQXA 2VWPA 1NW6A 4BKUA 1FZTA 1N6LA 3ZR4B 3DLAA 2PUHA 2ZANA 4JJ8A 4ZCTA 1PCXA 5C8YA 5AM1A 1M1XB 4WW0A 1F0YA 1CQWA 1ZBQA 4WVFA 3TCNA 2ZIVB 1EUZA 4LUCA 5F9MA 5M3BA 4DBVO 1CP3A 4PHFA 1LNZA 1IZ7A 5AVSA 3QE9Y 4NCXA 4PIMA 5JSFA 1N9GB 1Q1BA 3H6GA 4BYMA 1KOGA 1H05A 1FXWA 1KO7A 2WU3A 3F7OA 4K1LA 3OZEA 1YUNA 3AEQA 1JWAB 2G25A 3U4DA 4BASA 2JA1A 5T4HA 3G1TA 3NV9A 3HL0A 4IDHA 4Q7KA 3V1YA 5DNWA 2KSQA 5DLYA 4QTXA 1RBYA 4D97A 4ZYTA 2DXUA 2QM8A 1EWQA 1FNBA 3RI3A 3D54D 3NIBA 4H4DA 2F43B 4H02A 1QO0A 1Y48E 3DKVA 3QYAA 4WKPA 2BJWA 2R8XA 2OC4A 4GH5A 4Y2SA 4DSTA 3H9EO 2CV0A 3A14A 3W6NA 4ZYXA 3G7NA 2PMFA 1JJBA 1I1OA 4WY5A 3KEMA 3JPWA 1CS4C 1M1ZA 4A23A 3MWLA 5IT9A 3D31A 3UHAA 3RSSA 5BUSA 3WK5A 3HA7A 4LF9B 1V26A 1Z6TA 5BNFA 5AW6A 5G4KA 4H2XB 1ISIA 5L4NA 4Z53A 5AYVA 1OCEA 4MUXA 3ZN2A 3C14C 1SXGA 1PTJC 3GZJA 5EE0A 3NOQA 4R2MA 3VMMA 3ZWVA 3RYFB 1RAFA 1TJ5A 3MOGA 4YV1A 3GRPA 5BNZA 3AF1A 1G98A 3TOCA 4CL3A 3EA5A 1XPRA 4XTVA 1Z28A 3DYBA 4NMWA 4F06A 5C4IA 1P0IA 3R7WA 3NJ8A 2A9QA 1LX7A 4G1MB 4QBTA 2HJ9A 1OB5A 4HJRA 5JARA 1NFFA 1WPQA 2HYDA 4GKBA 5FYDA 5ICEA 2TMDA 1LK5A 1D9ZA 2X2EA 4MPRA 3GLTA 1M2FA 1UAYA 2HBYA 1Z29A 5BXYA 1XQXA 2QM0A 3KLMX 4KJXA 2R84A 4C3ZA 3HSKA 2RI6A 3IP8A 2EU8A 3OM8A 4MEAA 3NEJA 1PWEA 1TW3A 2M9MA 5F21A 5B53A 5JVDB 2O7SA 2WA2A 3CCCA 3JAKB 1RC0A 3KJGA 4HX9A 1TDJA 1XU4A 1QFZA 3DFMA 5IUKC 2HJSA 5ERGB 2FQYA 2PKWA 3SBXA 4BBJA 3GG2A 2F4VB 4ZN6A 3E5HA 1FSSA 4MUHA 5EHQA 2V7UA 3EXEB 3ETDA 3BEOA 4DLTA 4J1TA 4CMKA 2CGEA 1L4YA 1NSTA 4EQ6B 5IPFA 4PF1A 4NJOA 3KQVA 5KSPA 3SBDA 3OLXA 1I7NA 1W2WB 2ZM6B 1FJXA 1JFSA 3UGJA 4ND2A 3O2JA 2P9YA 3MIIA 1XDWA 3IUPA 1MIHA 3L5KA 4GSLA 4WKOA 4EZIA 5MN4A 4QQRA 3HI6A 1AA9A 3FPAA 4JAVC 4BIIA 4JXJA 4H35A 5JNWA 1X86B 3K8ZA 2D5CA 4TKUA 1Z0UA 3GELA 4WXEA 3UUEA 4C4AA 4E5DA 4Z5XA 5JCOA 3LDFA 3IPXA 3PFBA 1TMOA 1YACA 3ETNA 3H11A 1IXSB 3LYUA 4JP2A 1XEFA 2L19A 4MUKA 3S5UA 1N5DA 3FWKA 1UPBA 2C0QA 3TL2A 5G41A 4GWLA 4B4VA 4FDUA 4BB9A 1JU9A 1G9TA 4FEAA 2OZVA 1W8DA 3N2GB 1O2DA 3VAZA 2P5SA 2I4OA 1X70A 2RK3A 2A1UB 1D0IA 1O95D 1U7PA 1KAGA 5LA6B 3TFWA 2Y4OA 4EP1A 1Z15A 3CPSA 3K9BA 4TM7A 3AWIA 3N2IA 3K6JA 3SXPA 3UEOA 4QFCA 1KDPA 2JFXA 1I2MA 1QDUA 1IQUA 1W6RA 2A1IA 2J0UA 4AUEA 3JRXA 4JC0A 1NQUA 2WICA 3B9BA 4RGBA 3H99A 3I6QA 4S1PA 4P4UA 2WB2A 2V3VA 2FPIA 2B4AA 4B2LA 1MOZA 4OI1A 2XWSA 5IYZF 4BQEA 5DBIA 3AZOA 3VJLA 4US2R 1H8EA 1GUDA 2XCRB 4UM7A 3GCZA 1S3IA 5FP0A 2WU8A 4IOKA 1Z45A 2Y0EA 3GXBA 3FYSA 3COSA 5IEBA 3KDSE 4AY2A 2HB6A 1C4OA 1XA3A 1GVNB 3PENA 3EMVA 2XGTA 1IY2A 1T5OA 3CX8A 3IQHX 4GNRA 4JLSA 4KE8A 2HHCA 4C4ZA 4JDUA 5CDGA 1AKMA 1KETA 2K4MA 4OA5A 2OGSA 2YH2A 4HZUB 5K8VA 1W25A 2FF5A 4R1UA 3ZDQA 5IRCD 3DNFA 3IAUA 4TQUS 821PA 16PKA 5IKPA 5EMJA 2ZJ6A 5AMXA 4QXPA 5IZCC 4CL8A 2C2YA 1TZKA 3ZU3A 4EJFA 2OV8A 3GJ5A 1GN9A 4GMDA 3NX4A 3TZBA 4WUVA 3VPBA 5HKLA 4PBTA 3FYDA 1Y3CE 1KTVA 3N5CA 2HQBA 5GP1A 5EJ2A 2MYUA 1VJCA 3AFIA 5CCDA 3ZE8A 3ESXA 4BNWA 4HFRA 5I7UA 1PX0A 2GXAA 3LF1A 1DBPA 3N5KA 3QBTA 4TS1A 2FEKA 3FX2A 3MJ4A 4KN9S 4CEHA 2QVCA 1FRQA 1JV2B 2A92A 2WWXA 5GQSA 2X15A 1YZFA 2FMXA 1FZQA 1QF9A 2IYQA 3ILHA 3VSEA 2ENWA 2QS9A 3U4QA 1TCCA 2VDLB 1SIOA 4AU1A 5IM4A 1CTQA 3BAZA 4QG7A 1WNTA 4BAZA 2W6ZA 4GSYA 5G0TA 1TAQA 4A6PA 2JBAA 4CM6A 3OUUA 5IAJA 4BUZA 1N7IA 4WBNF 1N1EA 3FPEA 4CODB 4HYTA 1JPUA 2ZIOA 2C5FA 4PGHA 4NCNA 5IN4A 3QVTA 4JVNA 5IJ9A 1ULSA 4J16A 4JFAA 5ESWA 1MORA 3AF5A 1DBIA 1Q15A 5F7JA 3IXLA 5F1YA 3S2EA 2C2OA 1O6FA 5JAQA 5A7GA 3GLFA 2BPOA 2R8YA 3ZI0A 1X8JA 2TMYA 4EELA 4I5FA 1KR5A 4D3DA 4PYKA 4UE6A 3VDMA 1CRZA 4LVIA 3ZDAA 4P3KA 1NXPA 1KFCB 3M3DA 2N75A 5D6OA 1AHHA 2P4UA 1PGOA 3ONFA 4S0XA 4Y9DA 4NBWA 1ZD2P 5F5NA 5AKYA 4YQFA 4ZTBA 2CLIB 1O3YA 2VP6A 5D3MB 3UXYA 3ZQUA 3D4IA 1GCIA 2AMJA 3N05A 2Z08A 4FYVA 1PLLA 5E1MA 4QYTA 4RKYA 4MWOA 4LF4B 2A0FA 2XZDA 3QF7A 1XRRA 5DCLA 5IWCA 1JQAA 1HFEL 1RI4A 2X9LA 3DDNA 3G5TA 3H9UA 1WSBA 3KG2A 3X1YA 4D8YA 1DRUA 3KU1A 5HOQA 4A73A 1VSUA 3HWWA 5LKAA 3QKWA 1CDOA 4RZSA 2XYHA 4K9QA 1Z2EA 2RGAA 3AUXA 4MITA 4D57A 3RYCA 1XZNA 2NO7A 4U7PB 3GGGA 2C5LA 3A0UA 3C70A 3BE8A 2G80A 2CXPA 1VRCA 2DKOA 2BYTA 4KLAA 4MUNA 2JGIA 5AKXA 2XOEA 1YJAA 1S9DA 3K9LA 3OFJA 1E20A 2H4ZA 3T4UA 5FFMA 3S2UA 3ZQKA 1N6KA 1TJ3A 1T8UA 4RK5A 5IABA 5DM0A 1RJ9A 2FX2A 4II3A 2VF7A 3G5LA 3T3HA 1MAUA 4HB0A 2DFLA 2JLRA 1UWLA 4M0DA 5I4CA 5A6SB 2WIBA 5AIBA 2QQEA 3V1TC 2I29A 2WG1A 1PT5A 2ZNJA 4ND6A 4M1KA 3U3ZA 3PDHA 3NHMA 4JLBA 4Z8YA 2IYEA 1IRXA 1AQUA 1LDEA 1TIBA 2BFCA 1SVMA 2QM3A 4OSOA 1GAQA 2IHNA 3SGLA 4OP0A 1K6EA 3KJIA 2Q21A 3ACBA 5I9NA 4GC9A 1QIEA 5ELXA 2IXTA 4CCWA 3CVVA 2UU9B 3AIKA 2A35A 3R24A 3EUFA 1T4BA 4KYUA 2ZI7A 1VXOA 2HTFA 2RAVA 2H2GA 4HXFB 5TVGA 3UB2A 2I6XA 3UAYA 4EG0A 5L3SB 1YFKA 1W75A 2QTWB 4V38A 4B76A 2NTEA 5KOJB 1T5BA 2WFLA 1Q77A 4MA0A 1ZMRA 3G79A 4UOEA 1ZN2A 4A2PA 2BFMA 3O8QA 1XDZA 5B7PA 1AKWA 5JAPA 4I46A 5BPHA 4YCCA 1BHO1 2P2GA 4Z8XA 2NO9A 1PAUA 1QHFA 1RWNA 3P2OA 3L04A 4GVXA 4PINA 4YN3A 2YOHA 2RIPA 3KB8A 4PZ0A 1TCAA 2J3KA 2VWGA 4PLGA 1IWBB 2J5BA 3ZHRA 3T99A 2W6JA 3UK7A 2F9MA 2XMPA 4IEIA 1ACLA 3WGNA 3M8KA 4WI1A 5CR9A 5ALNA 4AURA 4B0PA 1UQUA 1E94E 2CW5A 3CWQA 4DBLE 1KL7A 1KEUA 5FF9A 1I3CA 3FCUB 4FYWA 10MHA 3L8MA 1GTJ1 5I9IA 1DIAA 1FDWA 1X9HA 3IJEB 3N58A 3LSSA 4ZQCB 4UM9B 3TIVA 1I6LA 3RF6A 5JY1A 1A5AB 2V6FA 4XR9A 1M67A 3DKPA 3WWYA 4C6RA 3JQFC 5F7ZA 1HE8B 2B92A 4CDMA 3AUKA 2GHIA 3RU7A 2VJMA 4D98A 4EF5A 1N2GA 4WKNA 4M55A 2D0DA 3AEXA 4PE5B 1FUYB 1LX6A 1TEHA 2GZ3A 2OHXA 2AQKA 3D7SA 3N8NA 3PXXA 4HH4A 4IO0A 5TGTA 4BVEA 1J23A 4BNGA 2X1HA 3U81A 2C3OA 3H0CA 3QYPA 4OJTA 2O7NA 1F5NA 4C89A 4FONA 4NESA 3LUAA 5HK9A 2DP4E 1FEZA 3K3PA 3VO9A 3WB9A 4DMGA 2V7GA 3EPKA 4M6WA 4AJ4A 4D4LA 3ZCRA 4EHNA 1R74A 4YAIA 4HZIA 3SEAA 3AUTA 2C2KA 1GZ7A 1X7XB 3AUYA 3OICA 2H59A 2GCOB 3F5SA 4PLVA 2CGHA 1TF5A 4P86A 1R0BA 1YE8A 4DOMA 1WCXA 2FFRA 1WX1A 3QMPA 3MT7A 4FYKA 3AZQA 2CBZA 2H6EA 4AS2A 1TZCA 1CT9A 1R5BA 2WU0A 3I2IA 1K75A 3GZNB 4PNEA 5KX5A 1AS2A 2V3WA 4LOAA 3PFHA 5EUMA 1X77A 1L3CA 1OMOA 4IG4A 4YCDA 5CDSA 1SC9A 1SIBE 1DUVG 4Z6KA 4A2CA 3UOGA 2ZTVA 2C99A 3BWCA 4MWGA 3BIOA 3QX7A 1E9BA 4EI9A 2AXNA 4GOLD 3MZ0A 3O3CA 3IT1A 3A7AA 1DFIA 4OMDA 5DTQA 2GUWA 4ZOLA 2V96A 1ZQ9A 2AF4C 5GJCA 3C97A 4A03A 2HNKA 4HGQA 4HN9A 3WGZA 4A0QA 4CCYB 2XCOA 1WQWA 4WESA 1UPFA 2AQHA 3MWDB 1USIA 1B3RA 4TXMA 3Q85A 3W2IA 3AX6A 3IAM1 4KE7A 4PLHA 4OU5A 5I5GA 4Y0NA 4NDNE 2QSUA 2BZ0A 2WPDD 2HZBA 2G0TA 1E1LA 2Y1CA 4MS1A 3M49A 4X63A 1XQWA 1V11B 2VOJA 4BVFA 1IL2A 2O2GA 4PNPA 4J7CA 5K0JA 1MJGM 4R8RA 3BAFA 1QFJA 1YJBA 4PYOA 5F9HA 3WFIA 1J00A 2FR0A 2ZZGA 4IXDA 1HDGO 5IDQA 2HQ1A 3BMXA 1EJ0A 4PC6A 5FR1A 4BLOA 4YRGA 1PQPA 1Q6YA 1T1JA 3N59A 2ORWA 4RACA 2DHCA 5BOSA 3L6DA 3VR3A 3I3OA 3P2KA 4JKIA 4KQWA 4F4IA 1I7QB 1P6QA 4GLJA 4ZAVA 2HN9A 1FFAA 1FVFA 1G4HA 2BTQA 4IZHA 3V8PA 1YZHA 4BAUA 3NWPA 2OD7A 3LHIA 4RPHA 2VK8A 5IT0A 2IPNA 4RXUA 5ES3A 3WGLA 1ZFNA 3U56A 3E7XA 3CRMA 3X1DA 3CZ5A 2OHGA 4EPTA 4HQ0A 2WAXA 2WMDA 4FGLA 3AJAA 3KVYA 4HUQB 1LC3A 1T0JB 4PYRA 3QUAA 1DLIA 4AZ0B 1PR5A 1NW7A 1UBKS 4CV0A 4QDZA 1DOZA 2OC9A 5F4BA 3K6SB 3AVYA 1MT0A 4I4LA 1MEJA 1MV5A 1ZINA 3AKEA 4JLKA 1CUGA 3DZCA 4PCUA 1PWZA 3A4TA 5EKXA 2BH2A 2YYYA 4FFWA 2VDKB 3K31A 1WW3A 4Y6GB 4B6OA 2JGEA 1GUFA 4FZJA 3PCOA 1TQ8A 2WD9A 3IAM6 4LZAA 2J5KA 5EJAA 2BGJA 1BX3A 1P18A 2VLBA 1T25A 2CJWA 4GKAA 3X44A 3ZDXB 4F12A 1F0PA 1GYRA 1XJWA 1YB6A 2B35A 2ZAYA 3GN1A 3E58A 3QW2A 2QGNA 3K30A 3ZVLA 4B4KA 4DABA 1CXZA 1ZM2A 3B6IA 4DNOA 3K71B 4YRLA 1Z73A 2H2FA 2PSJA 4P5PA 2P69A 5FI1B 4DF3A 1LNSA 3GAMA 1GRQA 4Y7CA 3ADOA 3NTUA 4KIJA 5IKOA 5IUNC 2DFTA 2PN1A 3QWHA 5CK5A 4BBPA 1J0CA 2P78A 2G40A 1OX5A 2P5IA 5ICFA 4Q4HB 2HDWA 2P2SA 1PHRA 2PH7A 2XDYA 4UP7A 1BOFA 4Z86A 1HZJA 5DHTA 2ANCA 2CVOA 1XTSA 3RLIA 2VTDA 1IQRA 1KJNA 2B4RO 1W2GA 3QWFA 3U3OA 4YAKA 1E7RA 2QJRA 2X7JA 3CG4A 4RIGA 2DU8A 3VBCA 1CF9A 4I4TB 4LEIA 4AG5A 1HTBA 1KYXA 4NYJR 2PUWA 1TM4E 3RC1A 3RTDA 2OV4A 4ZVQA 2GPBA 1G8KA 5I7AA 1X7YB 4CEHB 3G7UA 4MAFA 1HWYA 1H0RA 4N5HX 3SG0A 1Y5NA 4L0QA 4KLZA 1V4VA 3REUA 4LDZA 4MKHA 1TVKB 3VU8A 4KWTA 4XCXA 2V7QA 3Q2KA 4CM4A 5B6JA 3SBEA 4IVPA 4ZAFA 3WKCA 1UMBB 2X76A 4JYCA 1VE9A 1OX4A 3EAGA 5BSTA 4D9KA 4Z7QB 1VHQA 1P7YA 4Y9SA 3M6LA 1EVIA 3MLEA 4IDCA 4GMFA 1ZK2A 4HATA 4MHOA 3WKAA 2YFQA 3OJWA 3G5UA 1U3UA 2UKDA 3E3MA 1VKJA 1CHNA 1ODCA 3RRYA 1P9LA 1YZ3A 2C03A 3VHXA 5K1PA 1QUFA 3IJ5A 2E89A 3NHWA 5KSOA 1OR8A 5EWMA 1QHIA 1U11A 1QWSA 1SETA 3DFUA 4POOA 2R47A 4FR0A 4TWBA 4XQGA 1AB6A 2J45A 2BCJQ 1SCKA 4JLMA 5HFJA 1JLHA 4ZEOA 3BRWA 2CEKA 4DE5A 1A1VA 2IJGX 4L73A 2KW5A 2PSDA 3AV3A 4X93A 4AJHA 5A03A 4MAMA 4W6ZA 4J8PA 2P4SA 3GN2A 3JWPA 4LKOA 1H3FA 1KK3A 3AF4A 2HIGA 3F98A 3SXJA 4EABA 4Q03A 4ZMBA 5C9ZA 1NULA 2LBPA 3RYTC 2WILA 4BZQA 3FFAA 1OXTA 3IEMA 2VP0A 2GKOA 4J1NA 1MG0A 2I2WA 3KT0A 3HXQA 3R0XA 2DPHA 1GUAA 2D7CA 3H04A 3CSUA 4D4GA 1IHUA 2CJYA 2CNNA 3GBPA 1CIVA 1Z63A 4J0FA 2CHEA 3EBPA 2X23A 2PFSA 1R6VA 1SZDA 1DTWB 3DZGA 3VQXA 1EMDA 1UXHA 1XVLA 4TUYA 1KZGB 3U80A 3LCCA 3ZDCA 2VPPA 1GKIA 1R50A 3DV0B 1B41A 1SBQA 2W9XA 4EB3A 4XLTA 3HGMA 3QJYA 4IIDA 1C8LA 3TLYA 1G4AE 4OK6A 1Z36A 3EDQA 3M6IA 1QU3A 2L18A 4AX8A 4FB4A 5JYDA 4CQMD 2DTHA 1C9DB 1JDBC 1ECGA 4P4NA 4KE9A 2ZSDA 4PLCA 2ZCEA 4DIKA 3WK7A 3KB1A 4J94A 4P34A 2GEKA 3W9UA 1MPTA 2A88A 2WUFA 3T5BA 4NENA 1ZMOA 1KFKB 4BQQA 5CD9A 5L4LA 2YQ4A 2O19A 3A7DA 2QUHA 2ORYA 4Y98A 3RAJA 3BXHA 2I7DA 3PL5A 5J2TF 4C4YA 1GCGA 3GLHA 3IILA 2QB5A 3GDOA 2FCAA 3BZWA 1SC4A 2HXYA 4NICA 4ETMA 3LY7A 2H51A 3T9FA 2CVHA 3B1KA 4DWVA 5EXXA 1R3UA 2Z2IA 4F9FA 2B0CA 5HMMA 5LLSA 1NW4A 4ROTA 4OAQA 3FOAA 4KAAA 3UMCA 1CJTC 1NYQA 2IW3A 2FG6C 2I4MA 4FT4A 2IEIA 1YMQA 3BULA 4RGVA 4US0R 4TVAA 3HJCA 4AO6A 4Y67A 3T5GA 4G5SA 4PR0A 2RH4A 2OQRA 5FPKA 4JC5A 4G5QA 2CJAA 4MKZA 3OPYI 4IJKA 3DVAB 2HCFA 3V1MA 3WLOA 4D3FA 1F7UA 3CZQA 4MQUA 4NR0A 1WO8A 1PD1A 1SXJA 2QLFA 1FTYA 4KXYA 4LSZA 4AO7A 3DE2X 3O7MA 3GFQA 4O4JB 2BKAA 1J2JA 1TJ4A 3A7UA 3ZWXA 1TEVA 5K8IA 1GZVA 5FBZA 1GKUB 3TVYA 3P97A 1KERA 2NO0A 4R0VA 2EW2A 4L6AA 5JUWA 5HS4A 3H9CA 5FHQA 3PEEA 3KFVA 3WLLA 2UUCB 1UJBA 2PMKA 1OI4A 1WZEA 2ZRIA 2AH5A 3JVIA 5JAOA 4S24A 1E6KA 2BDUA 1Y9EA 2P4EA 1SR8A 2B7LA 2RKWA 5FPQA 1MTOA 2XQJA 3WHIA 4QPZA 1A04A 3F3SA 4YMWA 4DYDA 2O2EA 4HV4A 1ZJ6A 1Y8RB 1NWHA 2ZZKA 5FBQB 2PZAA 1NBMA 3C1TA 3I45A 4QXQA 2Q7EA 2HEIA 2P0YA 2FETA 2RAPA 1SD2A 1SOUA 1QYWA 1N2BA 1YA6A 2JIRA 5B2EA 4IWYA 4NBRA 2GXUA 1CUSA 3HXZA 2RGXA 4FB5A 5HYVA 2FEXA 3DFZA 4P2GA 2ZUCA 2IHKA 3MQ4A 3A9SA 4G1FA 3GYBA 1P4GA 1RP1A 2AI1A 2GF0A 2PNFA 4DIBA 3C3BA 1U0FA 1U2DA 3QVKA 1F8XA 1VKNA 4AZWA 1N2ZA 1W0JA 1Z3CA 2EBUA 1D6JA 1Z2NX 4FHFA 4XVQA 5COQA 1ECBA 2WAMA 3TAHA 1DVRA 3C3JA 3O9ZA 3P9IA 4N6GA 4EITA 1BGVA 2W7TA 2XMQA 4FCCA 1I5EA 3QPBA 5BN5B 3FNBA 2XTMA 1VPVA 3GNTA 4B4WA 1HDCA 2CUZA 2GZAA 3AB3A 3DAFA 3H5RA 4WKGA 4QSHA 1LWOA 1SCUB 1GEGA 2GBLC 3ILXA 5K0EA 4I5EA 4JSRA 3U1TA 1DGQA 3A1UA 1TUBB 1VHLA 3D81A 3G2NA 2CD9A 1V3VA 1EX6A 1YS6A 1M0WA 1A4RA 1PFVA 2JGDA 3DTVA 5DJ5A 4PQEA 3RS9A 2DPYA 4KQXA 4GDMA 3DDHA 2J4FA 5LZ8A 4IR7A 1BE6A 2AFRA 3IEPA 1OGIA 3JRNA 4FQ8A 4QLOA 2F3QA 3WHLA 1OH7A 2A7QA 4EGJA 5FNVF 1V16A 4K9LA 2BEUA 2HL6A 1PYOA 1U0LA 1QX4A 4D3ZA 3NOOA 1HKHA 4FMPA 4R8MA 1QPZA 1VDMA 1LS1A 3IBFA 4BL5A 2JI6A 1RD4A 1U31A 4MOWA 4ZCSA 4CU5A 2JFFA 5ALOA 1FBNA 3P45A 2WUEA 1JP7A 1GZ5A 4E2ZA 1Z7YA 2H11A 4U39A 4ZOBA 4ZEXA 3V8QA 1ZZEA 2NYAA 3GLSA 4AJEA 4M9CA 1OAOA 1QK5A 4DRZA 4U5XA 5G1PA 2Q2WA 1JQBA 1WF3A 3ZWKA 3IVCA 2Q7HA 4BV8A 1AGRA 2DQKA 4EMSA 2OV3A 4XPIB 1JR3D 2QG9A 4D3XA 4JI4B 1YK0A 3HJTA 3QXGA 4XYBA 4MGHA 1K7CA 3BQNB 5FL7A 5ELLA 4BLQA 4CQJA 1TU3A 2BRUC 3E81A 1CV2A 4L02A 4X6YA 1QCCA 3WGIA 3OKFA 1EIYB 2PUDA 5H7XA 3CA8A 3W5DA 3T6KA 1QPBA 3THSA 1XMIA 4ZO7A 1P81A 3PUYA 4BLRA 4ZCMA 4P6VF 5IG2A 5TMDA 2IIQA 1PG5A 2QTMA 3EVBA 3C3MA 3OCCA 1UJ2A 3OP1A 2A5YB 2VYVA 4DIMA 4KTVE 2QU8A 5TVKA 4CM8A 3IAS1 4QGHA 4G5HA 2YNMC 4BFXA 4B45A 2DR2A 1U9YA 4XD7D 2AV6A 4ZVNA 4PS1A 3PFCA 2VS1A 4QD3A 5JSQA 2F1JA 2Q5LA 2DXIA 1Y1LA 3ICAA 1E32A 4DUGA 1FLNA 4JBWA 1I24A 3I23A 3CF0A 4CN9A 2QX4A 4YDSA 1DX4A 1V8ZA 1G21A 4WN9A 1DJNA 1HNWB 4QFBA 5KMGB 3TEHB 1Y81A 4KIWA 4CV3A 2QRLA 1JG4A 1ZD9A 1WKCA 1UK8A 3E7PA 1WPGA 4G8DA 5LM3A 4RTSA 1Z0ZA 4MVJF 3EFHA 3R41A 1N7JA 2VTBB 4A82A 1AMUA 1P72A 3K9QO 4MIEA 1ZSYA 1S96A 4C2TA 3ELBA 4MPDA 1F5SA 1N2EA 2VJPA 4XOIA 2BL4A 1KS9A 4Y2XA 1A71A 3BD9A 4RIIA 4RS3A 2NUTB 3LQQA 3VR5H 1IB0A 1H1LB 1LPOA 3DDOA 3PWKA 2X2OA 3RO7A 5BRNA 4AZ3A 1SVIA 2NZUG 1PEDA 3DZFA 1I6MA 4ZTZB 4B3SB 4MHTA 2AKWA 1M1NB 3A9WA 4NEQA 4HAOA 4JLPA 1XOIA 3MJCA 3SIXA 2BSAA 2BOVA 4Y0VA 5T8KA 3R3SA 4XLZA 3FFXA 1C3LA 3V4VB 1FDIA 3TRIA 4NU6A 3VR2D 4N41A 4CS3A 1DXHA 3B8HA 2INGX 4AKEA 3D7NA 1KQGA 4EHBA 1D2CA 3IAS6 1T8TA 4BP3A 3HXXA 1OU0A 1Y3DE 1Z4PX 3I9FA 4L3OA 1ZI9A 4BNTA 3L0BA 4BV2A 3EMDA 1QB8A 5TPWA 1GILA 3C3AA 1QLJA 4O2AF 5SICE 1MJ5A 1CLEA 3BMOA 2X5NA 3PEUA 2YY7A 3I5XA 4W1QA 5AXAA 3PYLA 3VYSB 1Y6FA 1VLLA 1Q1GA 1TEXA 1W7AA 1VHJA 1GNSA 1JR3E 5DMHA 1NRIA 2IZ5A 5HIIA 1UPUA 1MABB 1U4OA 1W52X 1E96A 1NUPA 2JJ2D 5F5LA 2HEGA 3GGPA 4MYUA 4MDEA 5A71A 1NONA 1DO2A 1R6BX 3E9HA 1JAXA 1QS0B 4RKQA 1M2HA 4ZVLA 3RRMA 4ZI7B 2SKDA 4KQ1A 3SP1A 1W36D 1KQ3A 2ZGWA 3RWOA 1EQRA 1UBJS 4U7HA 4AF6A 1ILEA 4UHDA 4E2FA 4P08A 5HCNA 5I48A 1Q12A 2ZSFA 1DQSA 4UUMA 2AL7A 4ZPXA 3DCIA 1XZLA 4YGXB 1ORTA 2QI9F 3MSXA 2E85A 1Z8DA 4P73A 3CN9A 3H8WA 3U3JA 2O3UA 3WGQA 1AK1A 5BVHB 1VKOA 3Q7QA 2ILVA 1OASA 3L06A 1ZWLA 2HMVA 2I7CA 2Q5OA 1KDOA 1ESEA 2HADA 4UNIA 2ZRCA 2DXTA 1Z5NA 2WLTA 4FDTA 4YP9A 4C3VA 3H8VA 9GPBA 5IJWA 5LQUA 4GI7A 1DWQA 1GL9B 1M1UA 3CLHA 1JDZA 4CEJA 4MDHA 2IH4A 5ENVA 1NOJA 1URPA 2BHTA 2YW9A 4GR4A 4MUBA 1DAEA 3N0XA 4IJ6A 3KYCB 5J3JA 1M2OB 5IFLA 3A04A 1QAQA 3N0TA 3OCWA 3SHVA 5D7NA 4O2RA 1RS0A 1IBSA 3V2IA 4E21A 2BVNA 3MAGA 5B6IA 5L95A 3OLWA 2ZE7A 1N1GA 1QTIA 4HN2A 3QTLA 1YR1A 4RTLA 1YMUA 1M2WA 4PN7A 2EFCB 2BHSA 3GJSA 2Q9UA 3LPLA 2WJGA 3T4PA 3UGQA 1JTVA 2VH5R 4EMUA 1L3BA 4URHA 1VPEA 2PBLA 2IOHA 4KJZA 1NVMB 4QUGA 2YWXA 3UUFA 4ETWA 3HB7A 1A96A 4GSKA 5CEFA 1DC6A 3RRJA 4ARCA 1UH5A 3N8IA 4HX2A 4W5TA 1M6VB 1PSDA 1NXQA 4OGWA 1MJGA 3G2HA 4QU5A 5HZGA 4C22A 5H4HA 4B6SA 3FBGA 3WQQA 3EOBI 4FD2A 6ABPA 4AZSA 3ESQA 3HP4A 4U3JA 5T4BA 4CTKA 3NAMA 2VQSA 3C87A 1E18A 3DT8A 1BDMA 1FRNA 1F20A 2A5JA 5A5VA 5J2TA 3EEOA 3BMQB 1E2BA 2RHMA 3DHYA 5K0LA 4WK4B 4RNCA 3WB0A 4R7ZA 3OCYA 4OHOA 1I4LD 3NMUF 4G89A 2CYCA 1AGYA 2YHAA 3H4IA 3DUFA 1QOQB 3KE9A 4ZHQA 5BVGA 2NYRA 4J0KA 1U99A 1IZZA 2HJHA 3O1LA 2QVBA 4N7RA 2J3LA 1T8YA 5EIOA 1GR1A 1OGJA 4B74A 4DPKA 4DWJA 1EUDA 3AIMA 3IDSA 2PMWB 4G3XA 4ZWNA 1LK7A 1X94A 3I5AA 3M2TA 2YASA 3OZFA 1CQZA 2BAGA 2NVOA 3N2YA 3HACA 2ZBVA 3OF5A 5FPTA 3DOUA 4D3YA 5A7FA 2OENG 3K8YA 3WKBA 3P0JA 2IUSA 5IKMA 4UMDA 3Q8LA 5EJ9A 2OK7A 1PJQA 2P6MA 3I2FA 4A10A 3MMNA 2HHLA 2VKTA 1MOSA 1PFGA 1NJ6A 3K4HA 1YBMA 4W9RA 1FFYA 3A3OA 5JPIA 3UWPA 3WVNA 3RVQA 5GVSA 4D9JA 1MEOA 4CTOA 3QUSA 1YZTA 1UEJA 1Y6RA 3A26A 3FYUC 3IB3A 1Z0DA 4FSXA 5JO9A 4BO1A 4EG8A 5CT4A 4BGEA 3H5VA 3VU3A 3WXBA 2RCNA 2HQRA 5G3ZA 8ATCA 4UHBA 1M9NA 5A9SA 5DHAA 2JLCA 3I53A 4HNSA 3ZY2A 4F8JA 4OQYA 4IV8A 1B14A 1ZSVA 4W1PA 2D5LA 2OOSA 4RVNA 2B2CA 4YLEA 3RYIB 4CQMB 3JASB 4QEZA 3TRJA 1JHQA 4EOGA 2WTBA 5K51A 2M98A 4NCAA 4R31A 3MJFA 1P61B 2QK4A 4GXRA 3LGAA 4RJJA 5AKIA 4TVOA 3CR7A 1WHTB 5E95A 3EYWA 5E7QA 3W8EA 3L4GA 2YIVX 4YRJA 2JJ1A 3NIFB 2AE2A 1MGPA 5ESRA 3ZZMA 4HT3B 2ZS8A 3WB1A 3K16A 3MF2A 1W87A 4IX9A 4XEOA 4TXJA 3CVOA 1FPMA 4W8OA 3R8CA 1RRKA 4YBRA 4DEVA 1L5LA 1LJLA 3IQDB 3QVGA 2PRKA 4PZ9A 4DY4A 4JP3A 4C20A 1SBTA 3NASA 3DAOA 4Q7LA 5AW0A 5LQMA 1HDZA 4U2DA 5A3RA 5LB2A 3IDFA 4TROA 1KI9A 3ZDEA 1YRYE 2CBGA 1C14A 4U9IS 1NASA 3RVJA 4KR9A 2EX1A 3TLEA 1JEYB 2EJGA 5JXHA 4LWQA 5JVDF 4RANA 1GSIA 2OFWA 2R44A 4ND5A 1WM1A 3ZCQA 2VAWA 4ITRC 1NLUA 2PR2A 3TLKA 2GZSA 1YBHA 2PUGA 5CIQA 1P3JA 1T4CB 2QW8A 4RU1A 1VLMA 1ZISA 3G59A 2C2HA 2VRNA 5FJIA 5DVZA 5EMHA 3IBSA 5I51A 1WIWA 3TTTA 3LBHA 3IPCA 5DU2A 2Q0SA 3KXKA 1KHTA 2AG5A 5HGQA 5BN4B 1RMTA 2XNHA 1P1CA 4C06A 2HUPA 2XUQA 4LG1A 3DJFA 2XY4A 2V1UA 4K6HA 1VG9B 3LYAA 4FFMA 4IILA 2Y1LA 3DZBA 5DCUA 3GO4A 1FLAA 5FIUA 2XCUA 3GA0A 4PYQA 4NU0A 4TN5A 3FOEC 1KDRA 5CXQA 4CR8A 5BURA 2C7RA 1CLUA 1WG8A 4XGRA 1TLTA 1MDFA 1P3DA 3AEYA 3BF8A 4D4MA 1NMZA 5J9FA 2DQYA 5K3OA 3I6MA 5EJ4A 4YAUA 4YP1A 1EFKA 1RQPA 1YGPA 1VCNA 3OQVA 4L76A 1WHSB 4ON9A 3FZYA 1IOVA 2HWUA 3QWIA 4ZVTA 4HVLA 3LECA 3AM4A 3OT5A 1L7RA 4RQUA 4BZWA 1ETUA 2JH8A 2VHUA 3Q4GA 3A2KA 4PW0A 5DLPA 3QNEA 1Z8HA 2GO7A 4IUYA 1MX9A 2W4QA 1C1DA 1TCVA 1LTKA 4R9UC 5KWSA 3ZW7A 4B6EA 3K0CC 5A05A 1PG0A 4ABTA 1BWRA 3K0AB 4R1NA 3MINA 3TSAA 4COOA 2VDPB 2O1SA 4RIHA 3E05A 1HT3A 2PLFA 4N5LA 2XPCA 5EERA 2RB4A 1K92A 1U0RA 4KP7A 1E1RD 3GMSA 5IJAA 4PZYA 1VG0B 1Z74A 2PQ2A 3OWHA 1OY1A 3LQYA 1YT5A 4X71A 1L4LA 4OB6A 2W93A 3S99A 2XUAA 3O8LA 3SZMA 2IGBA 3VGJA 4MMXB 2PKQO 4LZZA 3QUTA 3EFOA 2BMVA 1AURA 1TA0A 1BXRA 2FPLA 2BM1A 4P4LA 1IL0A 3EC7A 3NPMA 4UBMA 2ZAIA 5KYYA 4CIDA 5EESA 4KNYA 1OX6A 4Y1FA 2CNWA 1NDHA 3OZ7A 4UW9A 1E2FA 2IYSA 1FVXA 1OQAA 2E6UX 3DCNA 4BNMA 3I72A 3W4JA 1IEXA 3ENWA 3H16A 4P38A 2D2FA 4LV8B 3HY0A 1T0HB 4R05A 3DFKA 3JAMA 3TSOA 4BE7B 4N0QA 1Y9DA 3CO5A 3EIOA 5DSZA 1TF7A 3PSAA 3MUOA 2OMKA 3UH0A 3URMA 5H8WA 2QBYB 4H2UA 2XVXA 4XTZA 1QZ3A 4EFKA 2PD4A 2VHVA 5KYVA 3FB4A 3EQ9A 4MINA 2J46A 2ZYSA 4G4IA 1WNLA 3FYUB 2YMMA 1UINA 4JLVA 2VDNB 4US1R 3ZWMA 1FUIA 1KC3A 1VZ2A 3IIIA 1J5EB 2O50A 1C9JA 1D7AA 4XTWA 3T4XA 5EJ5A 6NULA 5FT9A 2NAPA 3G8BA 3ZV3A 4TLCA 2CWWA 1VDZA 4XJXA 2PQ0A 4OHVA 3TNYA 3IODA 3RADC 2VT3A 3OESA 4WZAA 4KKXB 4QU8A 3UJNA 4BO4A 3VH4A 3AHDA 3AHIA 2Q49A 3P9ZA 5EL0A 2H85A 5H9VA 5FB3A 3RHSA 3WOHA 3EGDB 4TXHA 4UTPA 1H2RS 4H08A 3M82A 2YOGA 3AL3A 3F71A 3Q8XB 2E5FA 2H2WA 4D44A 1FTSA 1REQB 1GRVA 1UBNA 2OT3B 1D4ZA 2RK4A 5BSRA 1QRRA 3JQ8B 4EY4A 1EFRA 2BKUA 4HPWA 5ELOA 5FNZA 4TWAA 2VQ3A 1JEEA 3SJCA 2DFDA 5DRYA 4ALNA 2R97A 3DKRA 2QL7A 4Q21A 1J0BA 2X8BA 3CRRA 3DGEC 2XVYA 4JVMA 3NDRA 4QUHA 2G82A 1SA0B 2YQZA 4XH9B 1AXEA 2CXQA 5IAGA 5SZJA 1KMQA 1L5ZA 3BQ9A 2D1FA 4N54A 1J1UA 5CHYA 2BKXA 1OHHD 4DMUB 3A37A 3JQGB 4JMPA 3FAZA 2F00A 4MRSA 3U4AA 4Y3UA 1BN7A 1I7LA 2GAFA 4KOEC 4EUHA 2AIRA 4B32A 5JSUA 1GU1A 1US8A 3AOEA 1BMFA 1ZK3A 3IHTA 4L8YA 1K08A 1OIXA 1K86A 2H4JA 2UZ1A 3M81A 2J3QA 5EPOA 4YMGA 1TF2A 1YS2X 3K1AA 2F8MA 4B3IA 2NP6A 3U31A 2OCDA 5CX1B 3A74A 1KORA 2WHQA 4WNAB 3TEMA 4C6TB 2D54A 1VB3A 2K6GA 4YCWA 2NADA 1NI4B 4Y6OA 3RJTA 1EDEA 1GCAA 1XN4A 4IXTA 5C7YA 1FQJA 4JV5B 2X40A 4A7PA 4YV0A 1YIDA 2XJ4A 3BH0A 4CV2A 5EMMA 3EA4A 3T3IA 4F21A 3B7WA 5EHXA 2W2LD 1DX9A 3BGOS 5DO9A 1T91A 5DW0A 1RPNA 5L3QB 1AO0A 3ZIAD 4W1RA 1G6HA 4OLHA 3G0HA 1E3TA 4ED9A 2VDWA 3RVDA 3PRHA 4Q6BA 1A76A 2W6QA 2BUAA 4RZQA 4ENVA 2OMEA 4WFJA 3SC2B 3WJ7A 4IDOA 5CX4A 3QUQA 1N7HA 2C2MA 2J9FB 2RGNA 3ENQA 3LOQA 3OOSA 4CG3A 4ER7A 3GLFE 4PSAA 1VECA 5EXSA 4A8HA 2EKZA 2CDBA 1TU0A 3IUEA 3MS4A 3RR2A 3TLXA 4JX8A 3WWPA 4K3UA 2QMEA 3RKSA 1J2RA 3LWDA 3FZEA 4WLVA 1P0MA 5ALTA 5JZMA 1M83A 3MOIA 5DEOA 2DAPA 2XUPA 5EJIA 1USUA 2PZJA 2IDZA 3QY0A 3AERA 2OPBA 1LUAA 1T0UA 3IHKA 3NEAA 2DC1A 3U3MA 3NGMA 1EVYA 2XA2A 4A0SA 4LHYA 1SKYB 3EYAA 5B4UA 1XDDA 2VXCA 3BCRA 2DSNA 3LBFA 2QMZA 1ZY2A 4I1OA 4WY8A 3VC7A 4C7JA 1K7FB 3U09A 1PF7E 1Z18A 1M6HA 2ERXA 3TXAA 4CFYA 2Z98A 1GZDA 1O6CA 5IYZA 3AJDA 5JQGB 3MGKA 2CMGA 1SHZA 3UA3A 1QVVA 4CDNA 3OQJA 3DKKA 4IJ5A 1JQ5A 5LC1A 3F8SA 4EHKA 3EPHA 1Y8ZA 1UDWA 3LOPA 2GA8A 4YJGA 2EWVA 3KXDA 4EL0A 1P73A 2EVWX 1FLDA 4XX1A 3SEQA 4EW1A 3AI3A 4BTEA 5ICMA 4OK3A 2Q6LA 3D02A 3NPAA 1WR8A 3DBHA 3UXMA 5DNUA 2VNKA 1CE8B 4F9TA 4FDVA 4IX1A 5JANA 4UJ3A 3RUAA 3DMTC 3A4VA 3TSWA 3UXHA 4YUWA 5JV5A 2WUGA 1H85A 1Y1QA 3CURA 5IDXA 1HG1A 3QX3A 3B7PA 2KS6A 4K7JA 4QGBA 3RACA 1QB7A 1NVUQ 3F6YA 3TLBA 4Q4CA 2VHCA 1JXMA 1QGOA 2QLTA 3PPWA 5AM4A 4XDYA 4PLTA 3QELA 2ONKA 1ORIA 1W1UA 3CLRC 4K26A 4KIFA 1OSNA 5KEIA 4PIPA 3T41A 4BVAA 2VHYA 4D9CA 5K0ZA 1BVRA 1HGXA 1QVAA 4WF2A 5EXDA 3W8DA 3LX8A 2P41A 4N39A 4UFOA 2Y6UA 3DBOB 3ZHOA 3CLUD 3VVMA 2CLSA 5KJEA 2P8JA 3IQZA 3OTHA 4GPTA 5KVCA 5M04A 1MB3A 4LE2A 2VSYA 4AP5A 3HBFA 2I99A 5TC4A 1Q57A 3ZQJA 5LQAA 5B55A 4EENA 1QCZA 2PO5A 3O75A 4DC0A 4V1CI 4HQNA 1WUIS 3GJ4A 3EBOA 5DGXA 1VCIA 2DMRA 3L4BC 2RHLA 4UU0A 4NY1A 1Q0LA 5BN1A 5CAEA 5C1OA 4DXHA 1OWLA 5E9WA 2ZROA 5PNTA 3NBZC 3FFWA 3USZA 2VHJA 3HDYA 1PK9A 1GPLA 2VH1A 3UATA 2XQIA 2XYVA 3EB9A 5CXSA 4ZK6A 1LSOA 3AO0B 4WBNA 3LPMA 3ESBA 4XEHA 4WJ3M 4EGSA 4JC4A 2JDID 1Y3AA 4XEMA 3LUFA 3DOFA 1PGNA 4KI7A 4MI6A 2PIDA 5CHEA 3WSVA 2JG3A 5CIWA 1CY8A 4HTFB 3DP7A 4I0WB 1BU5A 3N28A 5JAUA 3BQMB 2Q0XA 1ZS9A 2ZREA 1TZ2A 1F60A 2HU7A 3HCPA 4FU0A 4H0NA 5EIBD 1MW8X 3L7LA 4NYJQ 4IZOA 4LPSA 1L4BA 4DMFA 4BWYA 5I01A 1F4LA 2BBWA 2VJKA 3ETCA 3X1KA 4PBSA 4JP5A 2FN3A 2CMHA 1KAOA 1LPNA 3MCUA 3Q3CA 4MRVA 1SURA 1XLTC 3EDYA 3IX7A 3NDJA 4GM0A 3FBWA 5T6MA 2ZAOA 1ORVA 4XU0A 3BIFA 4HY3A 1SIUA 3KR0A 1N9WA 5AW4A 3ZVNA 3FSEA 4EJMA 2NP7A 1WWKA 2L17A 2OR3A 1DRJA 3IVMA 5LP6C 1IQPA 1K3UB 1KSFX 2UVDA 2GYVA 2FUKA 2TYSB 2YXLA 3TIXB 3ND9A 4D8WA 1AGPA 2CJXA 4UHEA 6LDHA 3TQSA 2ZRNA 3VI4B 2MINA 4D0LB 1LCIA 3DOHA 4YUYA 1NQVA 1WMBA 2IZZA 3R3JA 4G4SO 1X1QA 2YFKA 4LGMA 2UZAA 3T7JA 3VR0A 3ORQA 4C29A 5B7NA 4EW3A 2FRDC 1GQ2A 3HRKA 2G09A 1JYFA 1OV6A 1QVZA 1E5XA 2XF8A 3G2KA 1OTXA 5JNUA 5JSZA 3M6UA 1PJZA 5JJCA 5LZ9A 4XWGA 1GZ4A 2G5PA 2XOKA 4IXNA 1CSEE 1T6ZA 4UASA 2FRXA 4DS3A 5K0GA 1P2DA 5FWXB 4QOHA 1VSBA 1Z38A 5GTDA 3A70A 4NHEA 1GA1A 3GLGE 1H5UA 3K9WA 3OLQA 2ID4A 2G4VA 3WRVA 2I4NA 2GJ9A 3UH1A 1ZEMA 3WK9A 4MVJM 1Y5LA 2XEXA 4I1SA 1XZHA 4IGKA 4OGLA 3COVA 4IH1A 2MCFA 2FW7A 1P33A 2HJGA 1ZA2A 5FI0B 1CQJA 3UMYA 1D2GA 5AKLA 4EPYA 3JXEA 3UPUA 1UBMS 2PX0A 3THYA 3T95A 2G1UA 4XQ9A 4YP5A 3HB9A 1ECPA 5AOAA 3RIGA 3BK7A 4O5AA 2OYCA 8LDHA 1C7FA 1GZ6A 5F3WB 4ZYVA 5LDHA 1PLJA 3RUPA 2G1JA 4PG5A 4EEXA 2O2DA 2YOFA 1ML4A 1QGUA 2VHQA 4EY5A 5A1JA 1ANKA 3FD8A 3I8OA 5TR9A 4K40A 1B2LA 4M0EA 5IDVA 3SI7A 2SBTA 1G38A 4QPNA 3MBOA 4QEKA 2ZRMA 1RXSA 4Q1DA 4TXNA 2GNAA 3N7TA 5CA0F 3QYJA 3P2MA 4O2LA 1QHXA 3UMBA 3DZIA 3K0HA 2WSBA 5DHQA 5JADA 1Q92A 1OIVA 2C9OA 2OHJA 3JYHA 1GDDA 1NMSA 4KIGA 4JJGA 4QQNA 3TZ6A 4GBED 1PK7A 1NV8A 2RONA 1SKUA 1QTNA 3U2QA 1ZM3A 5FWAA 2JZCA 2FZEA 4MLPA 4A16A 3BHJA 2NZ8A 2IU6A 2VSNA 4F3YA 2QAJA 5IH3A 2NV0A 3H3JA 4PAQA 3OJ0A 4GBMA 4LHSA 1R18A 4W82A 2Y3IA 1NLMA 4QGFA 4RK4A 3D3WB 2BHLA 3L7YA 4B7ZA 2Q7OE 4ZCRA 3N2KA 4FDLA 4CHGA 4XSHA 2WJWA 5KWIA 3TGLA 1IG0A 3DMNA 4I4TF 1BHSA 2IUUA 5IVHA 3A3YA 3O4RA 2A33A 4L95C 1EGVB 5EEGA 5KKNB 2F7SA 2RC6A 1L7QA 4MROA 2AN5A 3TUIC 1PUJA 2PX2A 2ST1A 3LFTA 3E15A 4REQB 4WDQA 4LYEA 4JK3A 3OEED 2WWHA 1E5QA 3PGVA 3QKRA 1C9NA 2YYZA 4HQKA 3JCZA 1GO2A 4RCZA 1ZK0A 4FBGA 3KAJA 2G3YA 4M7OA 5TJ9A 3MRXA 5DM2A 4CLRB 4ZV4A 4F9EA 1PN3A 3VYRB 1USYA 5HIJA 2O1XA 2VTKA 3P8YA 2FN8A 2KJQA 3N7AA 2Z8YM 4ZIRB 3AW9A 2YW2A 3I05A 5TIIA 4GLLA 1J90A 1W581 1YR6A 2IOYA 2OAQ1 1Z17A 3IV6A 4NYMQ 3UCEA 5DBFA 3A6HA 3ZHCA 1Z0FA 3PGLA 3UANA 4AX4A 4KFCA 4F5ZA 4DCJA 1M1YE 1AZLA 3OFNA 4OKIA 4D02A 3EXIA 1JA0A 4RADA 4HDCA 5JZ9A 1QGDA 1L7PA 1ZIOA 4TVWA 1GG2A 2FSVA 2C3YA 3F2IA 3QWAA 4GW3A 4IFBA 4ND1A 4NBTA 4CM9D 3ETEA 1A8HA 1NR1A 2Z4RA 3BD6A 4XD2A 5IEJA 4DV3B 3G49A 1P9RA 1GQSA 1W6UA 2REQB 3LBYA 2YV1A 3U4QB 1OXUA 1JKXA 2PVSA 4LE1A 4Q48A 2DR3A 3AUJB 5I45A 2A4KA 3LSQA 1TGYA 2XADA 4WJKB 1QYRA 5K03A 2YC4C 2ATVA 2YV2A 3CG0A 2H29A 4IGEA 3T1YB 1HOXA 4WOBA 4NKRA 5CCEA 1ORWA 3PQ2A 3FWNA 3PDCA 4QUEA 3EQ6A 3L7MA 4EHFA 4W9MC 1EU1A 3OF3A 1M0TA 1V39A 1R10A 4BVLA 3UIEA 1DEXA 1R6XA 4AKIA 3F49S 2G6TA 4QHSA 3ZNPA 3PUKA 1BCSB 4OHYA 1BE1A 2P2DA 4K9MA 3VR5A 4S1VA 5TMPA 2XGJA 3HA3A 3SY8A 1NAIA 4DANA 4H31A 2JK0A 1KVRA 1FXSA 1GRRA 2M6SA 1P4SA 3IQFA 4B44A 2VIIA 1JFTA 3DH0A 3KQKA 4JODA 2XNKA 3M5PA 3VRHA 4AULA 2O57A 1RI2A 2EFDB 4MW9A 4EW2A 2VQDA 3JD4A 2JEZA 2J48A 4IH9A 4TWZA 3FNIA 4RW0A 1HNXB 3WIBA 1Z0JA 2YTZA 1AXGA 4BUCA 2XDWA 1WABA 4PYJA 1E61A 1B4DA 4IV0A 5CBPB 3KT3A 2B3DA 2AN4A 3TBFA 2X0JA 4PAGA 4QRDA 2IIVA 1TQ2A 3PDJA 1U5BA 3F47A 1B8PA 2BMJA 2JFUA 3WWZA 4HH3C 3RIHA 3RFUA 2NSDA 5A5FA 2KPOA 2NQ8A 1X9GA 1LYLA 3FSRA 5EZYB 1G3MA 3UJ9A 1CCWA 4RTNA 1ISFA 3PUVA 3ICCA 2D00A 1ZC4A 3K70C 1ZN9A 3MJSA 2Q6OA 1K6JA 4YJ3B 4ZQHA 1RJ9B 4D9FA 2C96A 5F33A 1RADA 5K0BA 1UZUA 2VYCA 1NDQA 2Q29A 2XX3A 4PQRA 4AWBA 1FLVA 4ARBA 4EG4A 1UJNA 1PJAA 1BFKA 4ISCA 3I34X 3SZRA 1WV0A 1AVTA 3TAUA 1Q2XA 3RM3A 3MUNA 2YZGA 3Q1KA 5EIBC 1YR7A 2QR3A 2VK4A 4AN1A 1BXKA 1W49A 3DWEX 1XUOA 1XL1A 4AG3A 1PD0A 1WL8A 2P3OA 3W5SA 3EZFA 5JD3A 1PW5A 5KWEA 2WAOA 3RVBA 4O4JF 3QHQA 1X3LA 4BBZA 4KXVA 5HMLA 1SPBS 4FIDA 3OPQA 3LRTA 3CKKA 1A5BB 1G4UR 2FWIA 5A4AA 3ZD9A 4DRXB 3LXUX 3GLIA 3TTUA 5CFRA 4H59A 1ASYA 2JLSA 2H2HA 2VDUE 4XJTA 5FH9A 3M9LA 1RWMA 4MQ6A 5K0CA 1VJTA 1NU6A 3SC4A 4ABYA 4ZPJA 1WW8A 2CVPA 3OF2A 2AZTA 1N3IA 3LU1A 3QLVC 5A04A 5CEEA 5LOVA 2PE5A 1KO5A 4IUDS 4QAJA 3C85A 1KP3A 4MAAA 4CXMA 2L2QA 1RYHA 2BI7A 1CF4A 4NPHA 4PO8A 3WLTA 1BW9B 2EOAA 3E48A 2FRVA 2YWGA 2O8EA 2A7XA 1Y4ZA 4PG6A 1UBTS 2A5DA 2GAOA 3PITA 4ZOCA 1KJJA 3SXUA 5J2UF 1JDJA 4R71A 4C1NA 3FPHA 1MOPA 2WT8A 3MGCA 4OL0A 2PBFA 4B8ZA 4EARA 4RTOA 2WJPA 4QNNA 1U1DA 3ERRA 2QW0X 3ASUA 3OECA 2B61A 4MUFA 1FFXA 1ODSA 3KVOA 3RIEA 1W0KD 3CXUA 4G86A 4XM0A 3S2ZA 3RS0A 3LLCA 3IR5A 3OM9A 5EUQB 5EAIA 4LJYA 1UJ5A 1T9BA 3W3AD 5DEIA 4E1VA 3KPUA 4ZKDA 3DXZA 4C76A 3G0IA 4OXNA 2HO5A 4FZ5A 4A8TA 1QK4A 1Q91A 2DT5A 1SC1A 4Y2UA 2LZ0A 3GCWA 4GGMX 2ECPA 1BE0A 2BFFA 3UMJA 4DUPA 1E2QA 4GE0A 3K8QA 5TRTA 3VH2A 1M5TA 5ALUA 2PX4A 1HM5A 1YZKA 1EB9A 3BFKA 2DVMA 1IK4A 1NBME 4GYYA 3ON5A 4H17A 1X74A 4V02A 1SQ0A 4WL0A 1RMQA 2BGRA 4RVSA 5IBPA 5BW4A 4UJ5A 3EXHB 1JSLA 1SG0A 4M9QA 2IYFA 2PS9A 1V3TA 3I42A 4NOJA 1JQLB 3DV9A 4IQ4A 1ZH8A 4UTOA 1L5GB 2X6TA 4BQNA 4FD3A 2QL9A 2V45A 2H16A 1V0JA 5ECWA 3NT2A 4KGZA 2GYUA 3BHNA 4C0KA 1JLLA 4AJIA 3FJPA 3K94A 1WBBA 4PC7A 1QLHA 4I3HA 2GM3A 2ZIZA 2EBFX 4EDFA 3H5LA 1P8AA 4ZYWA 2RB5A 3BSYA 4FR5A 1JE0A 3GLGB 4CIXA 1DEKA 3B12A 4W7HA 3QEJA 3M0EA 1G6Q1 4AMGA 4MIOA 4IRXA 1E59A 1L5FA 4F5EA 2BW0A 2I6UA 3OQMA 1HE5A 3OQ6A 3EXG1 2UXCB 4IOMA 1OFIA 3WGHA 3SSOA 1ENZA 2EFHB 5HKAA 1MH9A 1GFZA 3PNBA 5L6MB 1UKEA 2HA6A 3GEPA 4EGFA 3UYKA 3PNOA 2WSSD 1ZWKA 2OGZA 4YFVA 4DJAA 1JZQA 3HO6A 4PTLA 3RBVA 3ZHTA 3B89A 2MR6A 4QJ5A 3DWGA 4MS1B 4RVFA 4NPCA 2Q5CA 4U4AA 5DYGA 2IY8A 5F77A 1D1QA 3SSMA 5KYXA 3HKBB 2CK3A 2D5BA 4TTAA 2OM6A 4KC0A 5BYKA 4LE0A 5BO5A 3RV4A 5LU8A 5EE1A 3RUEA 1F2DA 1M72A 4AKHA 1DXQA 1JG2A 1XF1A 1P44A 2FX3A 4QBFA 1N78A 3NHJA 3KTOA 2N42A 1D2EA 2PT7A 1B76A 1KVUA 1LLQA 3DTTA 4BVKA 1GPNA 1E89A 1ZGZA 2I3BA 2HZ7A 3R9XA 1K98A 2X5KO 1N2HA 1X7HA 3BE5A 1YTUA 4TKVA 4N18A 1GITA 4MO2A 4U7TB 1SEPA 5IW8A 3ZCPA 2QYHA 2RGYA 1ENYA 2XUKA 4BCBA 5EVCA 4F92B 3OZDA 4TVYA 4HDQB 3WLRA 1NHWA 4MWDA 3HKDB 2FMFA 3CRNA 3INGA 1P0PA 1IH8A 3B1ZA 3TAXA 2QAIA 3G82C 1IN6A 5A6VA 2RGCA 4LCEA 1QE0A 1T8PA 2G77B 1MOQA 1D2NA 1QG4A 4HGPA 1PR3A 4OP2A 4C9BA 2GAIA 4JI3B 2AMFA 4NCBA 2ZB7A 4N3AA 1VE6A 5COAA 1E2HA 3N1UA 5ALEA 5KNCD 1PR0A 5IBCA 3PNQA 4QTTB 4LNUA 5HBGA 3TNJA 4GNKA 1CJMA 4WZZA 4L3WA 4Z9FA 5M2QA 2O8CA 3R5XA 3K05A 1XZBA 4RFSB 1U7DA 4JBHA 1NXWA 3WICA 3SICE 1UXOA 1G8YA 2FE4A 4KVFA 5A4JA 1VSVA 5L45A 2PPLA 2JGJA 2EJBA 2D1YA 2GBFA 3WZMA 4B4DA 1BX0A 2ODBA 2OV2A 2QD1A 4WK0B 5C5DA 2QVGA 3LW8A 4MCIA 3TTYA 2F17A 5E6SB 1B8UA 3SLGA 3VQYA 1ZGAA 3BHIA 1GZ3A 1IJBA 3R6GA 3F5DA 3EFRA 5K6AC 4AY4A 5A2GA 4EJ2A 4AJOA 3LPAA 3VV2A 1PQWA 3D3EA 1USVA 1YBVA 1LF0A 2ASVA 2XKJE 1LK0A 4P7JA 5LVAA 1E9RA 4EG3A 2D4HA 3F8TA 1YR9A 3SNHA 1PW7A 4IRUB 2O1EA 5K3FB 2I3DA 4EB6B 4JP8A 1RHKA 2LKDA 4IJMA 3W8NA 4XJSA 1OZHA 1RFLA 4IS3A 4XQ0A 1M1YB 4OXXA 3NTQA 2BFDB 3PQ3A 2G9ZA 3OPYB 4TLAA 3DP9A 1FS5A 3R2JA 3PEVA 4YCLA 2GHQA 3UAGA 1FP7A 1Z5UA 2C8VA 2Z09A 4WLNA 1HEYA 5IP5A 4BO7A 3NU1A 2EJUA 2EWWA 3R0IA 5CTAA 2O3SA 1FJHA 2ODAA 3AKYA 4YNBA 3ZLTA 1PFKA 1JFFA 1S4QA 1WU8A 3HU3A 1EFPB 3HRIA 1TKRA 2I6GA 4OQFA 1I1NA 4MX8A 2HMUA 4LMBA 2AKYA 2PA0A 1OI2A 3MGBA 4RL6A 1GPMA 1EFHA 2X4IA 5E4TA 4DJDC 4RK1A 1XZJA 3RNOA 2V7BA 2VPQA 1EINA 3VNVA 1ITZA 3EAFA 4UP9A 4TM8A 1Q14A 3ITNA 4L8LA 4LJLA 3F8WA 3VC2A 4URVR 5IC4A 2A67A 4JP1A 1P60A 2OE2A 3DEFA 1SKAA 1RP7A 1T2CA 2GJKA 4JJAA 5DBGA 2ZUDA 1P7ZA 3LFHA 2JGLA 3P9CA 3PQ4A 1M66A 2X5JO 5KDLA 2HC9A 4F7WA 1J5WA 1L5SA 4AKTA 1GNVA 4HAXA 1KI2A 5TDHA 1K8QA 2C5AA 1LNQA 5K4GA 4A1OA 2GI4A 5ELNA 4MR8A 3DMYA 1HYBA 4BECA 2HDHA 3CLTD 1E2IA 4B46A 9LDTA 3AHEA 3ZU4A 3PIDA 4UTXA 3E5RA 1DB3A 3GQBA 4G0PA 2WA1A 5FUYA 3OKPA 4BWGA 1T3SA 1YL6A 4YIHA 1K7XB 5IWAB 1IXYA 4MGKR 4F9GA 1UC5B 1HF3A 1I3NA 1IM5A 4TV9B 3CJQA 2C00A 4D74A 4E31A 4B3GA 3E2MA 1ODIA 1RM0A 1XROA 2IODA 1GNPA 3EF1A 1DADA 1O9GA 5MFZA 2BFBA 1H22A 2YV3A 2ACWA 5BSGA 1EUYA 4P1ZA 1AS0A 5DE3A 3QFCA 1R6AA 3H84A 5DNAA 4Z54A 4M83A 3MTEA 2FW6A 3MQ2A 2FUG6 1GRNA 5BV1A 3ECCA 1MPXA 3H05A 2JATA 2QPAA 1NNEA 1QANA 4JJ6A 1IMJA 3V1LA 5A4DA 2XWPA 3RDPA 2IXGA 2HYIC 3TG8A 1V6SA 4HL6A 1HOTA 2HK6A 3DBVO 4P4TA 5I7EA 4YDRA 4BMPB 2CZCA 2QTAA 3CR8A 3NH9A 2QN6A 1ZM4A 2ZE5A 1IN7A 5DRTA 5TJHA 1ZSNA 3E0XA 3JX9A 4B79A 4YT8A 2ZVJA 2GN2A 4MV4A 2J31A 2IYLD 3PK0A 4B6FA 1ZGJA 1X7ZB 2VO1A 4YHHB 4N03A 4C0SA 3MBKA 2B4YA 4OUKX 4W9NC 4JI5B 1SB8A 5KYUB 4R16A 3QG5A 1LPSA 1O8BA 4XDZA 3R6DA 3ZBPA 1NVKA 3QE2A 4DIUA 2H1RA 3OA0A 4AP6A 3F1KA 1U63A 4KFSA 1XN1A 1SH7A 4G37A 4P7KA 3EZNA 3KSDO 4Q3LA 3VX3A 1QIFA 2CF6A 2ZSJA 3OOJA 3ZKAA 3PVSA 3DDWA 1GU7A 2DBRA 5CXUA 3IP5A 2XE4A 2YXEA 3HJBA 3ESCA 5C53B 1K8XB 3I32A 2TS1A 1O7JA 1SUPA 2GLXA 4FMCF 2B1QA 3H7IA 4G5FA 4LKRA 5EKTA 5HCIA 2JFPA 3DSRA 3KZNA 4BO9A 3BF7A 4GU5A 1QP7A 4K2AA 3P71T 3ZH2A 1PLKA 4MW5A 2PUTA 3P9XA 3WYGA 1N77A 4M1YA 2V4ZA 3VKVA 1EESA 4FFNA 5B4VA 2GK4A 4JB0A 2J3MA 3L82B 3TR0A 3QSYA 2EF1A 3CNNA 4IIXA 5KOHA 4OG2A 2OESA 4E51A 1V9CA 4RKRA 4KSYA 1Z9BA 3PA6A 1WE2A 4IHJF 4QOEA 4DV7B 3H1BA 2EYQA 3ZPXA 4AKSA 1FFHA 4ICIA 1I2DA 2R8PA 1NXXA 1DKOA 1ZHHA 2GR9A 2QTVA 2W2MA 2XSZD 2GA9A 3AP3A 3O94A 4FWIB 4YEDA 5IK2A 3TKAA 4P3PA 2KI5A 4HDAA 3WWOA 2WE8A 1A0OA 1YE3A 1NBHA 1HLPA 2C8JA 3SVZA 5F76A 2V6IA 2CB0A 4O2AA 2XT0A 3K0SA 4A8JC 2QD2A 1WOYA 3H5OA 1NC1A 3I1IA 5DGIA 4GBJA 3BILA 5E4YA 3SOPA 4L8WB 4NATA 3EF0A 5H83A 1N34B 1IBMB 4LFBB 2RHOA 3NATA 3OSZA 2YFHA 4LVUA 3KQUA 4J7AA 2DZ9A 4MA5A 4NSNA 4CF5A 1P7VA 3LWZA 5DYYA 1DV2A 3S2SA 2DWUA 3TMYA 3BWDD 1UIMA 3EEFA 4TKMA 4ZVMA 1KK0A 4AICA 4KLNA 3DVLA 3JYNA 4ZICA 1W5EA 5DLDA 3OTIA 2C8MA 1Z06A 4V0SA 4J4BA 1C2TA 3T9CA 1ODFA 3AGQA 3ODGA 2NU6A 4CG0A 2PUFA 3FI0A 1FFGA 1A88A 4JL6A 2LWIA 3ZNNA 2Y66A 3W8RA 4CMJA 1U7HA 1NQOA 3INNA 3V8LA 2CFCA 3R76A 1VMEA 2C3UA 1E3EA 1YAHA 1YS7A 3RC9A 3EGEA 3DBIA 4Q9NA 1GUZA 4HG2A 4NNPA 4QZVA 4NJEB 2NXJA 2CN1A 1DTEA 3ELUA 1JEJA 4M1ZA 4YX9A 5J23A 2Z5LA 5CJPA 1ISMA 4YH1A 3QXJA 3DFFA 1SVUA 4BMDA 2ARSA 4IEFB 2R5WA 1DMSA 3E7FA 3PCTA 1KI7A 4YCBA 3WISA 1WZ2A 1C0LA 3O2NA 2IF0A 2JAOA 5CVTA 4NF2A 1R1DA 2VJAA 2EAUA 1L8LA 1SQ6A 2JHAA 2OGTA 5J47A 3CLSD 1X7GA 3DV2A 5AW3A 4TZ6A 2ZT7A 2FEMA 2XJ9A 3TQOA 1EAMA 3CEAA 3R3VA 4Z51A 1UKCA 2J33A 1U2SA 3E2IA 1Z16A 1IJKA 3HVJA 4C2AA 4ZDIA 2XMDA 3GEEA 4JCOA 1I32A 5AJHA 3DBLA 3GUHA 2AG8A 1TAGA 2OO5A 3AV0B 3CONA 1JBQA 3MTGA 4HDNA 4BHTA 3IT2A 2XT9A 4WOKA 2DHDA 2R6ZA 2X77A 3KKKA 3T94A 2JJMA 5MFPA 3SSAA 1NG1A 2G9QA 3HO8A 3L02A 5FUXA 3TNFA 4EG6A 4YMUA 5JCJD 5LP1A 1TK2A 1Y8QA 2NM0A 4KMSA 1AE1A 2XYGA 1M0SA 3EA0A 4M1QA 2CMDA 4PHHA 4PPYA 4U63A 3UJAA 5HF9A 2HREA 4GECA 4L8FA 5CB6A 1A98A 2VVTA 3V8EA 2OGUA 4P71A 5A7HA 4YYZA 2R25B 2BV3A 3HEAA 4KO3S 5AHOA 3FOFC 3R0QA 5M34A 4MVJI 3LRPA 1NT4A 3ABIA 3IVXA 3MCVA 2IOQA 3GGDA 4K46A 5CNKA 1D9XA 1ZJZA 5F1KA 3S0JA 3THRA 2WP8J 2V7EA 4QUKA 3TQRA 4BTVA 1QHHA 4EVRA 5DNYB 1RXWA 2C7PA 4UZSA 5GOTA 2N0SA 4XM2A 4D0RA 3PPIA 1IC6A 5AR1A 4KXFB 4X92A 4EKNB 2F8SA 1PJLA 1MX5A 5HBRA 5KVSA 4MQFB 3HE3A 1Z0AA 1PV4A 2GBGA 4HCJA 3C3WA 5AVOA 2PCJA 1IN4A 5K09A 1EFRD 4IXWA 1BVUA 1FW6A 1U3FA 2HSJA 2QIPA 1S2OA 3KOOA 2PUEA 2P0LA 1KMHB 1AV6A 4GP6A 1MR3F 1YCDA 5EHIA 1JE1A 4QJ3A 5HKOA 5M29A 4NBSA 4DCCA 3OLCX 1JQJC 2PWZA 1N9GA 4JT2A 5AJZA 1GEEA 2QLMA 1R8YA 1V37A 4D9IA 2WHYA 3ZDZB 1SM4A 4GI1A 3NTOA 1L4EA 3DUWA 5CDTA 1DJPA 1S0UA 3I2JA 3HVKA 4LVCA 2OA0A 2WWYA 2Q1WA 2GVNA 2XXJA 4GXQA 2SCUB 4P36A 4QWMA 3TUZC 1MHPA 2GEDA 2IHYA 2ZS7A 5F64A 2GD6A 4DG5A 1JS1X 3CSSA 3D1VA 4WECA 3ZWCA 2F43A 1IN8A 1G3IA 3ROTA 3FMPB 1OLSB 5HZKA 1C4WA 1RWWA 1CDEA 1YVPA 1P4AA 2P65A 4Q7JB 2VHZA 4JI6B 3PXGA 5CITA 4Q5IA 1RCFA 2C4MA 3DULA 4C0XA 1P29A 4CNQA 5C81A 1SFRA 2CC2A 5A3JA 3JZMA 3KWFA 2CLEB 3B70A 5K3AA 4YONB 4DA4A 1TX4B 4UPEA 2QN7A 1CVRA 4KQ2A 1J70A 1F51E 1N2SA 1SBHA 1UR5A 4H2XA 3DMFA 3QJ5A 2HFKA 1B93A 1NIPA 2V58A 2FUNB 3T3DA 3NUQA 4MYDA 3P9KA 2J3IA 4M46A 4TRJA 2AKWB 5A4KA 3RYFA 1TYCA 1OT3A 4R01A 2P9ZA 4BLWA 1LDNA