3NETA

Crystal structure of histidyl-trna synthetase from nostoc sp. pcc 7120
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
456
structure length
431
Chain Sequence
KINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQNIIYGLEPILEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGEFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVAADLAEEIKRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of histidyl-tRNA synthetase from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp. pcc 7120
molecule tags Ligase
molecule keywords Histidyl-tRNA synthetase
total genus 134
structure length 431
sequence length 456
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3netA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3netA02
4K87A 5E3IA 4E51A 4XU3A 3L4GA 3LSQA 3TEHA 3RF1A 4WF2A 4YRSA 5F5WA 3MEYA 4YRQA 3NELA 3MF2A 3G1ZA 4L87A 3VQWA 2PMFA 2ZT5A 4LNSA 4P71A 3I7FA 3A32A 2ZNIA 1BBUA 3RIRA 1FYFA 3QO5A 3EFSA 1HTTA 3UH0A 1YFTA 5C53B 4P75A 3PZCA 4XU0A 1KMNA 2Q7EA 5K1XA 3P8VA 4WJ4A 4UP7A 2ZIMA 2EJFA 2ALYB 1ADJA 4TQFA 4XEMA 3LC0A 2IY5A 4P3OA 1HXDA 4YRKA 1EIYA 1SESA 2ZGWA 4RQEA 2E64A 3M4PA 3RKXA 4P73C 1WQWA 3A7UA 1H4SA 4TVYA 3HXVA 4P72C 3UGQA 1QF6A 4XEOA 1Z7NA 1PYSB 4H2VA 4UP8A 1WU7A 4HWTA 4YRJA 2I4OA 4YRIA 4CS3A 1X01A 3HY0A 1KMMA 3L4GB 4P72A 1ASZA 2CJAA 4HA8A 3KFUA 3HFZB 4TTVA 4P74C 5HGQA 4P3NA 3V7RA 3RGLA 3VQXA 3HFVA 4P3PA 3HXZA 3RKYA 1USYC 2I4LA 2P0LA 2QHVA 2XTIA 3HXWA 2ZTGA 1E1OA 2FYKA 2ZINA 4AH6A 1QE0A 4PHCA 3V8JA 1SETA 3A7RA 3P8TA 2ZT6A 4H02A 4WI1A 4KR2A 2EAYA 4DQ2A 2ZT8A 3LSSA 2ZR3A 3E9HA 1LYLA 3V7SA 4HVCA 2ARTA 2DXUA 3A5ZA 1WQ7A 1G51A 3A74A 2I4NA 1J5WA 5ELNA 3A5YA 3UFGA 2QHUA 4YRFA 2DTOA 4H2TA 3L2ZA 3BFMA 4UPAA 1YB3A 4RDXA 1EVLA 4YRCA 3RUXA 2XGTA 4Q6GA 3IKLA 4HWSA 2RHSB 3REXA 4YROA 2C7IA 2QHSA 4YYEA 2DZ9A 3V7CA 2DZCA 2AKWA 2E10A 4CH5A 4TWAA 1VQZA 11ASA 1B70A 4TVAA 1SRYA 1RIQA 2ZZFA 2ZNJA 2PMEA 1YGBA 5KNNA 4G85A 4YCWA 1JJCA 3TUPA 1NJ8A 4KR3A 1B70B 4TVAB 2ZZEA 3VQYA 1H4VB 3A7AA 3IKMB 1JJCB 1YFRA 4XTXA 4ZTUB 1X2HA 4XTVA 4YP0A 4O2DA 1NJ1A 2DTIA 2DTHA 3HFZA 1NJ2A 4ZTZB 3DSQA 3P8YA 4CH3A 1IL2A 1X2GA 4RMFA 4XTYA 4K88A 4TVWA 2DVEA 1N9WA 2AMCB 4EX5A 5ELOA 2ZT7A 4YRTA 4ZIBA 2DKGA 2E65A 4BW9A 1EFWA 2DDZA 1B76A 2HNIA 4XTZA 1WPYA 1EIYB 3E9IA 3EFRA 3M4QA 2EWNA 3L1AA 1YFSA 3NEMA 3V8KA 2AKWB 4YRMA 1H4QA 1W66A 4NCXA 4HWPA 3HXYA 4H2UA 1ATIA 2E1HA 4XU1A 2EL9A 5C52B 4H2XB 1NNHA 3WQZA 1USYA 1B8AA 1B7YA 3BJUA 3QNEA 1G5HA 4CS4A 3ERRA 4CH6A 3FJPA 1WNLA 1C0AA 2ZR2A 3REUA 3QTCA 3HRKA 3A31A 2CGHA 3UGTA 2Q7HA 2ARSA 5K1PA 1X55A 4H2YA 2ALYA 4YRNA 1WLEA 2ZZGA 2AMCA 2LW7A 2J3LA 4WJ3M 2ZXFA 3RACA 4YRRA 4P73A 1E22A 1WYDA 4YRLA 1E1TA 1EVKA 2QHTA 4XTWA 3HRIA 3V8LA 3VQVA 4KQEA 1SERA 1Z7MA 3CMQA 2CJ9A 4YPFA 2Q5HA 1NYRA 2RHQB 4YREA 2DU5A 3W3SA 1ASYA 12ASA 4HWRA 3HY1A 3PCOA 4XTUA 2EJGA 3RL6A 4P75C 1NJ5A 2CIMA 2RHSA 4YCVA 2J3MA 3HTZA 2E5AA 3QO8A 1X56A 4H2XA 2P5IA 4P71C 4P74A 3MF1A 2DJZA 1KOGA 1BIAA 1E24A 2E41A 4H2WA 4J15A 4XU2A 2ZCEA 2I4MA 4H2SA 4G84A 4CH4A 1X54A 1HC7A 2IY5B 3ICAA 4PG3A 2DU7A 5C51B 3IALA 2RHQA 2G4CA 1GGMA 4TQDA 1ADYA 1H4TA 4UP9A 2Q5IA 4YRGA 4BWAA 4OP0A 1V95A 3PCOB 4Q15A 3TEHB 3RKWA 1EQRA 2C8MA 3HXUA 2CJBA 2DEQA 1BIBA 3HXXA 4RQFA 2ZIOA 3NENA 1L0WA 1EOVA 4YDQA 1NYQA 4YRPA 3VBBA 3TEGA 2Q7GA 1BBWA 4YCUA 2ARUA 3NETA 3IG2A 4DPGA 2ODRD 4X5OA 2ODRC 2DQ0A 2E3CA 3QO7A 2DXTA 3OD1A 4OLFA 1B7YB 4K86A 1G5IA 3R07A 1NJ6A 4EO4A 4CS2A 2EJ9A 1PYSA 2DQ3A 4HWOA
chains in the Genus database with same CATH superfamily
1J07A 5E3IA 1H5UA 4PRYA 3NO4A 5C80A 1AQUA 4Q18A 3GHHA 2H6EA 3WMEA 5A4AA 4P93A 4JT9A 5DGCA 1YA4A 4G09A 5EE0A 1FSPA 3QITA 2WJ4A 1SOVA 3JYPA 4O4IA 1G2PA 1N2CE 1F3LA 3WBKA 4F45A 3THOA 4TSRA 1CPYA 3L8FA 4HEA1 1XX6A 2NU9A 4D3YA 3NAMA 5LLDA 2YV5A 1Y4AE 1UJ6A 2NT3A 3W0LB 4XWYA 4LRQA 2V0GA 4DLRA 5A4FS 4AKIA 2R8RA 1X7WB 4OKIA 3K1TA 3PEVA 1FRZA 5A06A 2PGDA 3VU9B 1N3LA 2ZBUA 1XTTA 2D7JA 1HRDA 1EUQA 3OAAD 4B3HA 3EVTA 2ESRA 4W8GA 4JJEA 2QD4A 3K9GA 5CDSA 1Y80A 4FYXA 3DDCA 4J0IA 4RTQA 3DEYX 5FI3A 3Q10A 3CUTA 1XZJA 4L73A 5HCNA 1EXMA 1UP6A 4DBZA 4GMKA 3T4EA 1XWFA 2MDTA 3AG5A 3AHIA 3ROZA 4DPLA 1V0JA 2DGDA 2FPPA 2HNAA 5EMLA 5G1NA 1I94B 5TRTA 4QEDA 1ZH8A 4H1TA 2AOXA 1V7PC 2D1FA 2Q4DA 3T4PA 3SXPA 1UFQA 2WSIA 3DOJA 1MPXA 2X9LA 4PC1A 1A5ZA 1KNXA 3ZPXA 4A2CA 1O9BA 3LPNA 4OHWA 8ADHA 3S5UA 1N6IA 1UK7A 1UBLS 3HYCA 1GPDG 4UBOA 1LPBB 3UJ7A 2QI9F 3ORRA 4F7WA 4PN3A 5L53A 3QJGA 1ULHA 4CEHA 1PO7A 4EG4A 2BH2A 3IJEB 2WYWA 3G2OA 4D9JA 3X2FA 3CKYA 1GTJ1 3HXPA 4J03A 2QP3A 3HVKA 1JTEA 2R44A 2X4GA 5CNMA 4P73C 5EPOA 2VQSA 5BMVF 4ZEOA 2FMFA 1QPZA 1ZVMA 1ZW1A 1GNVA 4IZ6A 3SMQA 2QRZA 2X86A 2AI2A 5LYJB 4UHHA 4BP9A 1GY8A 3GFBA 3A1DA 3C3BA 4QX6A 2ZUFA 1HNZB 2N46A 2H1FA 2ZWVA 4EX6A 1QYXA 2F59A 1V96A 2A1TR 4HY3A 3GFVA 1ABFA 4ZVUA 2PKCA 4L5YA 1QF6A 3PWTA 1QYRA 3K09A 1QG0A 3KB2A 5FV7A 2HAEA 3FWHA 3HJCA 3SF8B 3COSA 4DBLC 2HJGA 3T7RA 2I66A 4L5BA 5KTTA 2Z43A 3E3MA 4JP3A 1JN0A 3PLAE 2A9OA 2WQZA 3U9LA 3MWDA 1XR3A 3L1JA 5P8WA 2HJHA 3AKEA 4GU5A 2ZUEA 2Z30A 1E3DA 1ESNA 3V8NA 2CXUA 3VO1A 5KU7A 1OSNA 4LTMA 1YHZA 4BMZA 1EBFA 4P74C 1F9AA 4JKOA 4H7EA 4FEEA 4BNXA 3CRW1 2C5AA 3RU7A 1W4LA 3WZLA 3C7AA 2C29D 3ETHA 3VZBA 3W9SA 2C4NA 4V2IA 1M5RA 1ZDMA 4LWZA 2BFDB 4URUR 1V1MA 4YJFB 1L7QA 1Q1GA 2VAXA 4RTPA 4ROTA 3SZ3A 3AY7A 1EFAA 1CYDA 4O25A 3QBDA 3IQWA 3NCTA 1WDWB 1WJGA 3CZPA 4OJMX 4RFVA 5FWAA 1BSVA 3FZYA 1IBCA 1X1CA 5ALXA 2FQXA 3JVDA 4NF2A 2WIJA 4QXPA 1O94D 4RH3A 4C7BA 2W2NA 4YCJA 1MGOA 2MSNA 4IINA 3ZCXA 3PT9A 4I1IA 2VTEA 4GHWA 1KQGA 1R6UA 2HC9A 2VJMB 3SJUA 1NFFA 2DY1A 4MWOA 1ILWA 2ZYGA 3VOSA 3THSA 3Q7EA 3I01A 2ZT6A 2JIZA 2JCVA 7REQB 1OHHD 2PKYX 5KQLA 1Q3TA 9MHTA 1QGAA 1X1EA 2ZR3A 4LTDA 4C30A 4L4YA 1UFRA 4FJ2A 3RI3A 1GPYA 3CV3A 4HZGA 5TGZA 3A5ZA 4B6OA 4G4IA 1I6LA 2WHYA 3LKBA 1Z06A 4JYBA 4NAUA 4WXHA 5REQB 3AEKB 5D3QA 3SGLA 2FQYA 1KEEA 2CJYA 3DOOA 3CURA 2PKRA 3SHTA 1OFUA 4OM8A 1SAYA 3TMAA 4MDHA 4FWIB 1SG6A 1QPGA 2J07A 3D1VA 4H6XA 4ZCIA 1C8VB 2B6HA 4RPIA 1CP3A 2X22A 2WUVA 3OKPA 1KYIA 2F1KA 4MGZR 1X86B 2D1YA 2OCAA 3QF4A 2PFGA 4MV0A 4WCVA 2C99A 1KS9A 1TC1A 2BTQA 3JR3A 4UM9B 2B8TA 1RE1A 1ZO8A 1GSIA 3O5AA 2HA5A 4MB0A 2Y1GA 3UOGA 3THYA 4H7FA 4ATNA 1XUOA 2NGRA 2AXQA 4LZJA 3W2GA 1ZCZA 1T1GA 1X3LA 4BNHA 1C3JA 2FSUA 2OXFA 4B8ZA 3HWSA 1CUAA 2BMJA 5DMXA 2IYRA 3KKPA 4ZICA 2IYTA 1K7XB 1ZJJA 1YNSA 4PLHA 1TI7A 2JPDA 3I9MA 5BP7A 2R8XA 1YULA 1E1KA 1CS0A 4MP3A 3UKDA 1JQKA 5K8UA 4YMWA 3LW8A 2NUPB 3UA3A 3CUSA 4HS4A 4E5PA 1QH8B 2BCEA 2D3WA 3LX4A 1AS3A 5AW0A 4NS4A 4Q66C 4ZMRA 1JDUA 3KAJA 4C2TA 3AR6A 1D03A 1F4LA 2WJWA 1BVRA 3E70C 4GP7A 1UBOS 1N7JA 4MO9A 4YAOA 1TQ8A 1JG4A 4WA7A 2ZZFA 3AW9A 3HV2A 4QNRA 3WZ2A 2QY6A 2O2GA 4AJ2A 2VJLA 2OCYC 1K68A 4WLVA 2YN2A 5BUSA 2LIPA 4DEYA 3U16A 2OKCA 1YH3A 3IB6A 2Z3ZA 4U1RA 1OIWA 4GI3A 2XXAB 4QJ3A 1O0CA 5DBGA 2WD9A 4RVNA 4ZZ1A 5I7HA 1HX7A 3CS3A 3RRXA 4D02A 4LCJA 4DA8A 2X5NA 5EEGA 5KC9A 2WWTA 1OU4A 3WSVA 3PQ2A 2PX2A 1FLNA 1UFKA 5JNVA 4XTVA 1AZSC 2PWPA 1P9LA 1F5NA 3CNQS 2VXOA 4YO8A 4ZREA 1K5DA 1QS0A 3G3EA 3PWZA 3C7DB 3FZGA 3ROQA 1SU8A 2HEGA 1WBJB 2HHCA 2W2TA 2J0UB 1EUCB 3V7YA 5CYGA 3E8SA 3DVAA 3IOEA 3FVTA 4RABA 3AHHA 2AN1A 1KMHA 4LYEA 1W1UA 2QMYA 4IFTA 2OHFA 4U8HA 4NK4A 3H2JA 1OHHA 2D1SA 2OO7A 5LU9A 3EDOA 4HRVA 1XEWY 4OAOA 5HA5A 1Z5ZA 1IL2A 1GDHA 1ZIPA 4MSUA 1A9ZA 1I4TD 4DZTA 3D3JA 4DA9A 4NU5A 4GM4A 1NHGA 4NDZA 1Z4NA 2WT4A 1M5TA 2HPAA 5TEVA 2EFDB 2RIRA 4D7AA 4RETA 1H2EA 1IE3A 3CR7A 4RXUA 5A03A 4DW8A 1P73A 1XKXA 3DXZA 2C4KA 2CJXA 4TSFA 3ZE7A 4B3IA 2D4AA 5LQAA 2WLTA 2EW1A 4J0JA 1PLLA 4URZR 1ENPA 3INGA 1Z4LA 2H06A 3GEHA 1V9SA 4XGIA 1AMUA 2HRQA 4BBAA 1FYXA 5KBYA 1I7LA 3G17A 4UCQA 4N6OA 1CQJB 4L9WA 4QICA 3VSEA 4TT8A 3EGWA 4FNAA 2JS7A 3KC2A 4AO6A 3V4PB 5KINB 3LQ2A 2J1LA 4MCHA 4NECA 4GMFA 3M4QA 2R4QA 1ML4A 2CHQA 3TPCA 4JC0A 4ZAYA 1DO2A 2NU7B 4MW9A 3ZK8A 4CKBA 5C4GB 4DR1B 2AKWB 3F6CA 2VK1A 5L51A 3CUUA 1OFUX 1SCIA 2QMUA 2X23A 3UJ3X 4FYKA 4B6QA 4ZI7A 2QN9A 4UTXA 4O0LA 4W1PA 3U7JA 2I3BA 5K01A 3AL0C 2Z58A 2O48X 3CLVA 5J2UB 3TOZA 3B9QA 1ONBA 2QL5A 4CODB 1D6SA 3N74A 4PANA 2DPHA 2REQA 4PTLA 3IUSA 2QX9A 2FWMX 4HB4A 1HE1C 4RAQA 1MEOA 3Q3CA 2E1HA 1LXCA 4UFNA 1VDZA 2KHZA 2Y1CA 4OBXA 4X85A 1KI6A 1LTHR 5J43A 5TE9A 1I5RA 3FZEA 1K7CA 3TRDA 1VGVA 4GR5A 3U4MA 2P4UA 2TMDA 4ISCA 4FFRA 5BW5A 1XRMA 1EQ2A 2VDNB 1MGPA 1MDFA 1WF3A 2CUKA 3NBZC 4EW2A 1PN3A 3L43A 1G21E 2EJCA 2INGX 4D9MA 2H2FA 5EJAA 3NGLA 3QFTA 3UT5A 4AJ4A 2Z57A 1FRNA 1H2YA 3M6LA 1A9QA 3G9ZA 1VPVA 3LFTA 2Y1OA 4LXYA 4TMFA 3UJPA 1MQ8B 1FS5A 1E1DA 3M83A 1MD9A 3I2FA 5LWQA 3JQAB 2Y9PB 4QYIA 5AKKA 2I7VA 3QNEA 4HNAA 1M10A 2ZI4A 3I92A 3LVBA 1VJ1A 2NACA 1ORRA 3HUUA 4RJKA 4CLOA 1Z83A 4M0EA 3LDHA 5BMVB 3FOEC 2ZR2A 5CEEA 2BMFA 5H1YA 4CTJA 3TZLA 4B3BA 4HMQA 2C4VA 4EQ6B 3DL4A 3NHAA 1YZKA 1PWEA 2JGKA 3EZ9A 3HS3A 3IQXA 4OQPA 3DBLA 3TQCA 1B8NA 4B1FA 1U1IA 4NEQA 1Y33E 1W0CA 1ZEMA 4I50A 4NFHA 1XZMA 1NP6A 1AKUA 4ML3A 5HRCA 3K70B 1M2FA 1U04A 1U9JA 3MZ0A 1Z6PA 1Y7TA 7REQA 1C1DB 1YDWA 3WRYC 2YWXA 4CTNA 5DN6D 3LCMA 2C04A 1UM9B 2AJDA 5ALGA 4MRAA 4GBED 1ZK2A 4HGRA 4B2YA 1NVDA 3CUYA 4EW1A 3WJ1A 4DCTA 1X74A 4MW0A 3WK7A 1Z73A 1PCXA 2F1IA 5EKSA 2J6BA 3GWGA 1ZI6A 4IIJF 3FHCB 1SKYB 1E1TA 3LDAA 4MLZA 4UJ5A 4KPFC 5I7RA 1ZONA 4R1TA 2B5WA 1YRWA 3HJBA 2Y1DA 3BK7A 1YC5A 3WLEA 2AD5A 3HQ4O 3PBKA 4KLZA 4WTOA 2OG2A 1FYDA 3V80A 3GH1A 5I5GA 5FLXA 1MW8X 1NMXA 4LVUA 5DYWA 2NYRA 2C2YA 5E8RA 2PLAA 3U39A 1WW2A 4BTLA 1U2EA 3KOOA 3KZXA 4N9WA 2SKEA 5D8DA 1DC3A 3GZJA 4R8VA 3HVRA 3PUXA 1G5QA 4OQMA 4YONB 3UAZA 1TF2A 3QFCA 4ALLA 4FDLA 4HWRA 2CDRA 5JJIA 4PVDA 3L8ZA 2B2XA 1ZUNA 2R8YA 1W47A 3OD5A 1PVOA 3MBKA 4C0WA 5AVUA 5F7JA 1F0YA 3C87A 3MPUA 1QCZA 4H3HB 5J5CA 3KEQA 3UCFA 1IWOA 2KW5A 3CJTA 4CMAA 1XYYA 1G7SA 5KX5F 1QFZA 4PGGA 3KJEA 3DMRA 3BMOA 1GFZA 3RTEA 4BGDA 5EKXA 1G4HA 4RHXA 3QO8A 1X56A 1JKJA 2E21A 1KVUA 5K3FA 1LRKA 4I5FA 2VEOA 3CWQA 4G0YA 5J5VA 3UK2A 2I6QA 5KPDA 3F97A 2E4WA 1PR1A 2YQ4A 1TCAA 1GG2A 4LRTB 1U11A 1U65A 3RSSA 5AW1A 1VJTA 1WEKA 5JCOC 4Q4JA 1N25A 1NP3A 1YR7A 1GKKA 3DULA 1BGWA 1U4SA 4WZ6A 2FE1A 4RS3A 2Q7OE 1Z5NA 5BWLA 5JJCA 4NOKA 4DLBA 3R41A 3C98A 1L1EA 4ZCQA 1X54A 1W34A 2PEYA 3LIPA 3WMWA 3WLJA 1NI4B 1YVRA 1LI7A 1L7OA 4IKOA 4KLNA 3ZXIA 1O9GA 2P2YA 1KA9H 2Q9UA 3KR9A 3R3HA 2FMUA 4I1OA 1X8LA 3MUNA 1H6DA 2QE6A 3EFEA 1VP3A 2ZIUB 3LYHA 4AZ3A 4HQOA 1OAAA 1KOJA 5BVGB 4GLLA 1NBAA 3F5SA 1GTMA 1L5RA 1ISFA 2Q2OA 5FUYA 5KQSA 2WE8A 1NKVA 1Y37A 2ZB4A 1LF5A 3M33A 4BWAA 1KO5A 2EEPA 4PLPA 4Q05A 4RK5A 4BX3A 2C8KA 1U0RA 3NVKI 1QE3A 5KHAA 1T2AA 2A88A 3OEEA 4D5EA 4OHYA 4UHBA 1TM5E 2ECFA 3DZCA 2R5NA 5TMDA 3LBIA 2CJBA 2DERA 1G60A 3U44B 2JGJA 3VV3A 1Q50A 1WKBA 1FQJA 2ZITA 5CHYA 1F2VA 3C45A 4EG8A 3I4CA 5D86A 1SUEA 1TZ2A 1U9IC 1YS2X 4TTTS 3T5TA 3W8FA 2TS1A 2ZI9A 1JBKA 3JD0A 1SQGA 2HK9A 4AJEA 1TJ3A 4QFBA 1N4DA 1JQ3A 1SG9A 2BD0A 2FW1A 3EF3A 4LHXA 4WACA 2WU4A 1X7GA 5DSXA 4BFLA 5GV8A 4DV1B 1QR2A 3M1IA 2OAEA 2WSYB 1J0CA 4N40A 4RELA 5B58T 2Q7GA 2CCKA 2O8FB 1OGIA 1G3UA 1XNHA 2QTMA 1H2FA 3W7AA 4O3FA 5GY7A 1SFRA 4N54A 4X5OA 2E3CA 1HGXA 3BWEA 3SX2A 3RYCA 2QE7D 1JQDA 1LZLA 2OCPA 2RBGA 3PJEA 3UG7A 4FOOA 3OD1A 2M2IA 4U8GA 3RE1A 3PNVA 2C97A 3H5TA 5TARA 1KY4A 2FRVA 2G36A 4NJEA 4PPGA 2FSIA 4MKRA 3DEHA 5EIBC 2O4CA 3ER9A 4HO1X 5AVKA 2IZ1A 3WL7A 1KEPA 3N28A 3VR5H 1DCFA 2P68A 1H9CA 1F12A 4US0R 4V1CI 4M0FA 1GT6A 1P29A 1IXRC 5LL6P 2NNLD 2OORC 4K87A 4MAMA 2VT3A 1OLOA 3CSSA 3K30A 4J0QA 5B57C 3IT0A 3J80A 1HNXB 5KTKA 1NDQA 2OD7A 3B5IA 4OBBA 1QR6A 5F9MA 4E03A 3E5NA 3R6GA 1TTTA 2QM3A 3FYHA 3H3FA 4P6VF 4BAGA 2BGJA 3HHEA 3JVUA 2E18A 4EG5A 1GG9A 3OCYA 3VNUA 3P0HA 3N1UA 2H7XA 4DAOA 1ZPDA 1O58A 3HB7A 3IILA 3RBAA 3WIBA 2DBZA 3L0IB 3KLMX 4PLYA 4LY9A 4LHEA 1N0WA 3KJNA 1BVHA 2GPJA 1Q5PA 2I8AA 2CNOA 3EIHA 2ZT5A 1OF1A 5TVKA 3WGIA 2YHIB 2EZTA 1NUUA 3N07A 4R1QA 1VPLA 3FTCA 1N2BA 3SQNA 4BO5A 1N1DA 3V6LA 1NHWA 1Z36A 2Q5OA 3SSMA 3WNQA 4WEOA 4CKEB 3A1VA 4AG5A 4OXXA 3VI3B 1NNSA 4LUCA 3H11B 1ZLYA 4A9AA 1IAVA 1RWNA 3A1NA 5TMEA 1GGJA 1ZIYA 2FPRA 4GD3Q 1T8YA 1WSWA 1NQUA 2WYOA 4G0PA 4KZPA 3FSGA 3O2QB 4OJTA 3SVZA 1EXNA 1YA6A 1L5GB 3RRZA 4BLQA 3LRPA 2HD4A 1K27A 3FFBA 2BJHA 3HLTA 4HKTA 3ADBA 2A1UB 3CNBA 5CJJA 4IFEA 3W6UA 2EJFA 1MABA 2XVXA 3OFSA 3PL1A 2BLNA 4KK4A 5JI2E 1XJ0A 6ABPA 2B7CA 1PNTA 5JG7A 2FZEA 3K9BA 1KZ6A 4CL8A 1I3MA 1XI2A 2FPIB 3LCRA 4HLDA 1TUEA 4A8JC 2VP5A 3G13A 3HFSA 3KPYA 4AIIA 1XZBA 1H6CA 2QTNA 2G6TA 5HFNA 3RKXA 3TLGA 1PJRA 2VZ0A 2ZWOA 1VYTA 4JL8A 4LI3X 4MQEB 1A4RA 3PFCA 4R31A 4OLBA 1Y98A 2H8KA 2BGMA 4G2NA 4PCUA 5HF6A 4BVAA 2E3JA 2FWBA 4O4IF 4Q16A 1FYWA 3L7DA 4XOUA 2A1IA 4FYJA 1AIPA 5H7XA 4YIHA 5C5DA 1Z18A 3H5WA 5JOQA 1Q0TA 2GMWA 2J45A 4UQOA 3QJ5A 1YL6A 3N6RA 4WWHA 3D59A 1RQPA 1FP7A 1X9GA 3D6VA 3DDUA 3LX8A 1DARA 2EGUA 4Q37A 1RVV1 2BGUA 2X13A 3TW4A 3URMA 1JVBA 4H3KB 5KKNB 1KKMA 1XMOB 1A8SA 1C14A 2PNJA 5ALKA 2I2BA 2WMDA 2HHAA 3NEYA 4Z6KA 3L0YA 2VJAA 1XMIA 5JPCA 1EWVA 2BISA 3L4GB 4FJ1A 4CCSA 4JS0A 2R47A 5AI6A 1ZRMA 2H16A 4M6WA 4M1QA 1EB9A 3I76A 1SBCA 2XDYA 1N9KA 1AXRA 4OYLA 1Q7BA 1BNCA 1JIIA 4IMIB 2PS0A 4M9CA 1QFJA 1WB6A 3RGLA 3HP4A 2CL7X 1RQLA 4K28A 2G9RA 5CYPA 4IFBA 4KO2S 4DG5A 2CLMB 3AY3A 1HLFA 1VJCA 1TZKA 4EI2A 1UXJA 4NU0A 5JNTA 3L8GA 2IUYA 5JCJD 5KEIA 3PQ3A 2I6UA 2ZINA 4GOMD 1G63A 2ON6A 3GHYA 4LX8A 3BERA 4QYTA 3V33A 2EHDA 1U2GA 4O2BF 3NBAA 2PLFA 4KACA 2QTVA 4M8SA 5DU2A 2X3YA 5JD3A 5LXTA 2ISSD 3GWZA 3HL0A 1IRXA 4BLPA 3VVBA 1VG8A 3E5MA 3QFSA 3HFRA 1Y4DE 3TM4A 5CA1F 1P0MA 1P2BA 3JW8A 1M8PA 1UBCA 4FCWA 1VCOA 2ATVA 4ZV4A 1U0GA 1P19A 2X8LA 1ZA1A 3JRXA 4G5GA 3R8XA 4Z0PA 3HR7A 5DWQA 2P9ZA 1ZC4A 1IBSA 2AVNA 2NOAA 1PV1A 1NXTA 1QTNA 1ODIA 1WXHA 1ZNQO 3LF2A 4NZ9A 5CHEA 3VR4D 3LECA 5JTUA 1QHGA 3BA6A 3EZ2A 4UNNA 1BX1A 5EUQB 1NVKA 1Z2EA 3QQ5A 4MA4A 3IIJA 4XA8A 3TKLA 3CE9A 2I4NA 4O2AF 4JXJA 1GPJA 2QGFA 1YCHA 2PRSA 2QPAA 2ZPTX 2RC5A 1GGEA 3HY4A 1MJHA 4QODA 2XQIA 3HMQA 4H1VA 2IK8A 4IL5A 5FUXA 2DFNA 1U8AA 4E4RA 1R2QA 3H2IA 3LSTA 2IXBA 4MHOA 4I5EA 1QMGA 2JA2A 1W4CA 2J3IA 1YQEA 2XMSA 5BN1A 4BNLA 4LHWA 4UUBA 3BFMA 2HGZA 5LB2A 4EBBA 5BSVA 4RQBA 4MS4A 4X7BA 3OIDA 4L76A 1BXRA 2FN3A 4JAVC 3D4NA 5A5EA 1FDOA 3BH6A 2GYYA 2HU8A 3CNLA 3EPJA 1UADA 2FJPA 5EJ2A 5EHQA 3OEYA 2ZU0C 5ULLA 3B1ZA 1PAUA 3JQBC 5BVHB 5KQPA 2JIZD 2QPTA 4JUAA 4KE6A 5JNSA 3U37A 1JS1X 3ABRB 6GPBA 1T3ZA 2BELA 3C6QA 3AUXA 3C3EA 1EP3B 4O2AA 4X1YA 4M9UA 3UUGA 3UUEA 1F8XA 4EG1A 1M6YA 1Y8RB 5E6UB 4F56A 2AKWA 4QBGB 4X6XA 4A26A 1YE5A 3U09A 3DZ8A 3K5WA 5L8VA 5GM2A 2O20A 2QV7A 3G5MA 2HA3A 1FUKA 1E9EA 1E5VA 2YXEA 3RHTA 3OE4A 1C81A 1M7BA 1DX6A 1Z07A 2X2OA 3K0HA 4F96A 1B70A 4TVAA 2JJ2D 5AKYA 2BDEA 2WQ7A 4IIYA 4LVIA 2B4RO 2JGNA 4F3NA 3B1KA 1E79A 1GAQA 3CONA 2YJ6A 2P5YA 4ZO4A 2H31A 2OAGA 2ODWA 4ZQGA 2CDBA 4AUEA 5BN5B 1DIRA 2H4YA 2VUSA 3IVGA 4N18A 3LVRE 3ZQ6A 4H1UA 5DHQA 5LA6F 2BT4A 4B3DA 3VQYA 4E6PA 4EB6A 4L4XA 3ZHBA 4N5HX 2G77B 2FFBA 5A1JA 1Z63A 4DUYB 1GQRA 3MCZA 4EHNA 2XMGA 4GOJA 1NX9A 1X2HA 2PGJA 3IPYA 4OL0A 4DVJA 1PJQA 2IF0A 4MCIA 4ZOLA 1IOVA 1K2VN 2V65A 1C50A 3DP7A 3MRSA 3QM1A 3ZU6A 4JLBA 3ZWMA 1P6UA 1C5KA 3AERB 3OPYA 3UK1A 1NJ1A 2O57A 3ZXXA 2I03A 1SC6A 4TUYB 5FBLB 3GELA 2DTHA 1KP3A 2KLBA 3R9XA 1RD4A 3E22A 3GJ4A 1FPMA 2C5EA 3BA1A 1KPIA 3B6EA 4CM5A 1RC0A 2Y9MB 4BGUA 4J07A 2NM0A 2AOWA 1I3NA 4J16A 1VRWA 4XTYA 2GHTA 4K88A 2NSDA 3BWVA 3JTEA 4I50B 4XEHA 4Y0NA 1TYCA 4MVCA 3RIXA 1Y81A 5FT9A 3EVFA 3VOBA 1PJ2A 5I9LA 4HHEA 1JB9A 1J56A 1VL1A 4N8SA 3TLCA 3UMBA 1E63A 3OHMA 2PM8A 3DTNA 2BYTA 3GLVA 1Z4OA 3AH8A 4OVKA 1QP4A 4GWLA 4MVJG 3LUJA 1D0SA 2Q41A 5GONF 4KIJA 4DV2B 3FKQA 4DA7A 1Q2XA 1BA2A 1YDHA 2GVZC 1SCUB 1M6EX 5KYTA 1EDEA 3FMGA 4EHIA 1DL5A 4RMNA 1PUJA 4TYQA 1P9WA 4BXOA 5K9ZA 4X92A 4RJTA 4PG5A 2XECA 2EJBA 1GGKA 3H1AA 1NQTA 4XUCA 4CETA 4KW7A 4RZUA 1BVYF 4H35A 3GP8A 2JFGA 1JHQA 4DLUA 4YRMA 2ZDQA 4MTLA 4ZZ2A 3CUVA 3DD5A 2XUPA 1JJFA 1KJ8A 2HBRA 3SK0A 3WBBA 1E7MA 3KZCA 2W58A 4Q1CA 4B3JA 1RYZA 5CM8B 1YE8A 4MINA 2O52A 1XRPA 3I72A 5LXTB 4EDFA 4ND1A 3U17A 3DOUA 3MTAA 1XMPA 5DE3A 3OKAA 3ZJVA 4IHQA 1NURA 3DWFA 3QJYA 3EG9B 3KLPX 1J21A 3IR5A 1HSZA 1PT8A 4LZOA 3IMCA 3CNNA 1PG0A 2ZSKA 2MU1A 3NJ8A 4KR9A 2DHCA 4LQ4A 2IEIA 2HMYB 3HWWA 2UYYA 1NM5A 4FGKA 2Q3EA 4LJ7A 4XPIB 4NOMA 4UCFA 1UKZA 2YWGA 3VO9A 1F06A 1R5JA 2FEOA 2AFHB 4X3OA 4EYOA 5KJFA 2D62A 2OESA 4II3A 3ACCA 1XYGA 4QGFA 4NCKA 5B1DA 1RFLA 3ELWA 3PNYA 2HDHA 1B00A 1BEUB 3FW1A 1GNLA 3CJQA 3LRTA 4YRAA 1ZHFA 1WXXA 3B36A 1DKMA 3FYTA 1RKBA 4N3BA 1UINA 2YW2A 4BLOA 2R8EA 1IY2A 4N03A 3DEFA 3VHLB 3I3OA 2YJZA 5KAPA 5IYZB 4M1MA 1R0SA 1S7CA 4CLEA 2JZOA 3OY7A 1MC1A 2WUWE 4F92B 3OOYA 4KODA 3H2YA 2Q2VA 4ZO8A 3L9XA 2IQ5A 1ZRNA 3W34A 3NKVA 1YR9A 2ZREA 5B4UA 4CF7A 1LW6E 2OMEA 3DBRB 3R3WA 3EZYA 4JVMA 4XWGA 4YCNA 4AN1A 1RPNA 4NESA 3JY6A 2GGSA 4QFMA 2GVNA 3GJQA 1JMKC 3RIYA 5DGIA 3JPWA 1JR3E 4EUNA 1G3IA 1VI6A 3MOSA 2QYTA 4QUAA 4BC0A 3A2LA 1NKTA 1DSSG 5EMMA 3RACA 4HPWA 3GPLA 4DSAA 4P73A 2KQUA 4PYMA 4NKRA 4BNDB 1X8KA 1PQPA 4GXTA 4XWWA 4PQYA 1J0DA 1YVDA 2AMFA 1TMKA 3H9UA 4MKZA 4UEOA 3EY9A 2BKAA 4XX0B 2JIRA 3UJBA 5F4BA 4FYYA 2QZ4A 3NYRA 3E2IA 1Y3AA 1VPTA 1YRQA 2I80A 3OJFA 4OP2A 5ESDA 1CP2A 4LMAA 1H1LA 1P74A 1E2PA 1JDPA 1JQEA 2DPMA 2H5IA 2C3OA 1ZRSA 2R00C 3G6WA 3NFYA 4IS3A 4KO3S 3TIXB 4WADA 3I9KA 2ZAIA 4NVRA 3SBXA 1E4EA 1YDEA 4QVIA 2HUPA 3D3EA 4CM4B 1CZOA 5EOVA 3K1JA 3N6XA 1GCIA 2O8BA 1OI7A 3LBNA 4X24A 5HJEA 1CUVA 2QJFA 4GPD1 3FBGA 1G8SA 4IGIA 4R8KA 3R7WA 3TLKA 5AVWA 4RTMA 4FQ7A 3VXKA 1A7UA 1YVUA 3I1IA 2CIMA 1QYIA 2MJLA 3RW9A 3CRQA 3TUJC 4BC1A 1ZSNA 3RIHA 3RJ9A 2JLWA 2NMVA 1ZS9A 4CKZA 1Z34A 1A9YA 3I1FA 3LHIA 2A5LA 2HBZA 4YCVA 3NIWA 4ZCTA 2RE8A 1PK7A 2HWUA 2BCJQ 4E7OA 1YQUA 1Q0LA 1YACA 2C54A 3KAPA 3SS8A 5AQ1A 5HKOA 3MJEA 2IHZA 5DTRA 5ITWA 2R6CA 2W8BA 4DQXA 1IOZA 4JJZA 4A4DA 3AVPA 1E3JA 2FQWA 2XYVA 4AYTA 3MNFA 1FFDA 4DBVO 1MQAA 3WKAA 2GNOA 3IHKA 3V4SA 4Z1MD 5B2EA 1F8YA 2NUTB 5HQ3A 5LR6A 1H05A 5LUAA 1TYDE 2FX5A 4DSZA 3RKSA 2GXSA 1H9AA 1SXJE 3GNQA 2B37A 3OPYI 4TWIA 5DEIA 3FGZA 2B4QA 1UDAA 2ATIA 4OIMA 2JAOA 2GEJA 1KTIA 2BWJA 4DUGD 4QATA 3M6IA 1F4VA 3DHVA 2BFCA 2ZE7A 2W6JD 3CZCA 4JC4A 4M9SA 4EKYA 5C18A 1EP2B 3HJUA 4YFVA 4ALJA 4DLSA 1CLUA 4MH0R 5L7WA 2PUBA 5FA6A 1Z3CA 3C97A 2CNWD 4C2AA 1QIEA 5KJ1A 4MQFB 1T24A 1PK8A 1Z7GA 2H5LA 4KXVA 3GCZA 1UWVA 4K1LA 3U7QB 1JHAA 3WAKA 1XROA 1U6KA 2YS7A 4JJKA 4MGIR 4EP1A 4BVHA 2JLQA 3L1HA 4JLUA 1AXEA 3AM4A 3JQFA 2G76A 1JU3A 1XQYA 5IHPA 3I61A 5AXBA 2FU5C 3OE7A 3IS3A 1AUXA 1O97D 2GTIA 3E03A 3TD6A 5I7OA 2BE7A 4H6WA 1GPMA 4C4PA 3PC2A 2VYND 2PZKA 3FMPB 5L7YA 2G63A 1M2WA 1DOZA 1FNNA 1JSCA 1PHPA 3L8DA 1SELA 2Z1DA 3QVTA 3LQRA 3EB9A 1I4EB 1W5BA 4ZVSA 3JCZA 3NOXA 2AOUA 4LQDA 3RS8A 3UQYS 4AM8A 4CE6A 2GJSA 4Q4HA 2PUTA 2YDXA 3NHSA 5EAIA 4EOGA 3Q3IA 5EP3A 1PW5A 1NYQA 4YRPA 4M1WA 3UTCA 3B6ZA 5JBIA 4CNQA 1X1SA 3IV9A 3WIEA 1GG5A 2AZDA 1T5DX 3IB3A 3VFDA 1UJCA 2P9YA 1I01A 2W2LD 2PSJA 3U48A 1OTXA 2OLJA 1PZXA 1QG2A 1U2TA 4GXRA 1VG0B 4KRYA 3W5AA 3UXYA 5IBRA 2E89A 5BPHA 4KHPB 3NBUA 5SZJA 4B48A 1CRWG 4B4VA 5JAPA 1QAMA 4OJQA 1ZFNA 2VHEA 4Q3KA 5DF1A 5IVIA 3FOFC 3LRXA 2DXIA 2O0HA 4LTNA 1EA5A 1RSZA 4FILA 1C4WA 4NJMA 4B7CA 2Z2XA 5FTMA 2VRCD 5BWMA 7AT1A 5I6DA 3K0KA 3U81A 1CVIA 4MUKA 1SPXA 2VF4X 1P9RA 4HX2A 3IAHA 1EU1A 4CCWA 1UKCA 3K0EA 1L7NA 4GOLD 1Z13A 1KVRA 1LDMA 1Z74A 2I67A 4RJJA 3KJGA 4YASA 1QAOA 1C41A 3DE3X 1NJ6A 3DM9B 4MUBA 3EARA 1LLQA 2D74A 4N7BA 1DINA 1Q3HA 4RA9B 4NYMQ 5GOTA 1PSWA 4ZYWA 5ITSA 4MS1A 3RG8A 4ZYYA 5BXYA 3RVOA 3PCRB 3VA7A 4EI9A 3H8WA 3VR4A 3WK4A 2XUQA 4KMRA 4BLRA 4QQRA 4MUGA 3P2MA 3TIIA 2JGEA 2C2OA 3Q1KA 1HT0A 1HDRA 4YDRA 1ZCFA 4G1EB 2GLXA 1XZDA 2C03A 4HJXA 4Z1MA 5AVJA 1FUEA 1AMNA 1N7HA 3PC4A 2BFEB 2I6SA 3WP1B 3RYHB 8ATCA 4FCTA 2J0SA 1NYTA 2WP8J 4XUGB 4BEWA 3MJ4A 1PDOA 4LWQA 4NARA 4RHCA 3WGLA 1M2OA 4DR5B 3K16A 1DWPA 4TTQA 1J90A 1JLHA 1Z5PA 4ZA2A 2A84A 2RG1A 3QO5A 3GJYA 5FBKA 4BQIA 1M1YE 1APBA 3EN0A 4PINA 1RADA 1GKLA 2R6ZA 4D81A 5BV2P 1RAAA 4YNBA 2CHUA 5E6SA 4M7PA 4NE7A 3LAWA 1E5XA 3DBHB 5ALFA 4B75A 1QIKA 1U9IA 3QVWA 1YQWA 2O8BB 4J6EA 3UC5A 4YX9A 2C5FA 3OHSX 1R0YA 3DMTA 1I2ZA 4OQXA 1M1ZA 4RKFA 4DS3A 1E6KA 1TL7C 4DQDA 4ZI7F 5IC4A 4ZHQB 1PJSA 1GDTA 4TQFA 4ND4A 4NLLA 2IY5A 4PX2A 4OB7A 4D25A 2PSHA 1G5RA 2G1AA 3SNHA 5B7NA 2PAAA 1CDOA 1SIWA 4N6NA 5EC8A 5JPDA 5KSZA 4EARA 4ER5A 3TTYA 1Q0RA 5EUMA 1KO4A 3MB8A 3PJFA 5FWXA 4YR7A 1UH5A 1XCBA 4N01A 2EATA 4WFQA 3CB4A 2W8ZA 3P2YA 4IICA 4DZRA 3HN7A 3K20A 3FBWA 4IJMA 4A8HA 2UYOA 4HGZA 3GCXA 1GN8A 1QHYA 2OYSA 4RHYA 2ZUUA 1D5CA 2G1JA 2WNHA 2IGBA 3KZKA 1GIAA 1WU7A 1QOQB 2TMKA 1ZW6A 2IHTA 5HF9A 5JHHB 1GZ3A 4XLLA 1P60A 2VWQA 2YUTA 1Q0UA 4CRWB 3LGAA 4NCIA 2WAAA 3W2TA 1FB5A 1L7MA 2YFKA 3W78A 1QQBA 3MHTA 1GYQA 1YL7A 5FB3A 4YLGA 3RRYA 3COJA 2FK8A 5HFJA 4FGSA 3EQ9A 1I6MA 1IMJA 2QN3A 3T7EA 3RKYA 4ZYVA 2BTEA 1PX0A 1ZUWA 2X5JO 2WT9A 1T0IA 4HC4A 2QHVA 2XTIA 1KEVA 2OFOA 3DTVD 2MIIA 3ECAA 4LEIA 4PAOA 4IVPA 5EJ7A 3PTZA 1QMPA 1YR6A 2H48A 3HR4A 4JR1A 2UYCA 2JIPA 2YQZA 4KUHA 2IU3A 3QKRA 2X8BA 3ET5A 1NQAO 2A9FA 3K05A 4YWHA 1QE0A 1QO0D 5IARA 4CT4B 2UZ1B 2XGSA 3DLCA 3KFXA 4CNBA 1NNUA 2Q3CA 1VZ2A 5I8PA 4D0RA 2JZCA 3B52X 3FDIA 2ZW9A 4WI1A 3IL2A 1Y7IA 2VVTA 5CXUA 1LI4A 5FWDA 4BECA 2FDCA 3MS2A 3V9AA 4FMDF 1OBHA 2BZ1A 2FI1A 4TUYF 4XYEA 3DYVA 4WL0A 3VJLA 1LYLA 3I8SA 2ARTA 1HE4A 1QIJA 3D5TA 1IONA 1H23A 3O8BA 2RHJA 4URFA 4C5AA 3TDKA 2AMLA 4AF7A 1XZAA 5BQXA 3BIWA 4K6HA 1GAXA 3ET4A 1VPDA 2CMHA 4INZA 4W82A 421PA 1XPOA 3ZJYA 1GUAA 1EH5A 4YN3A 1QHSA 3NH9A 4RL4A 3PDHA 1UKAA 3LHSA 2FN9A 3I9NA 2A9PA 2VDRB 3H86A 3UFGA 3H6KA 4HFJA 5U1PA 3ZVRA 4BO6A 3LXMA 4LDZA 3DMPA 4PSAA 4WKOA 4TV9F 5B1HA 4UASA 3H13A 1AQYA 4LYHA 4NAVA 4J1TA 1LTKA 4DDVA 2O1XA 1PW7A 1C7RA 1RJDA 1EUDB 2REXB 2Y1LA 2FHSA 2JIDA 3FE2A 5JIBA 3JATB 1GPNA 2YHUA 2IL1A 1JEDA 1V39A 4RDXA 2GXQA 3C7KA 1JFVA 3CA8A 2QUZA 1RWKA 1LI5A 2EP5A 1DPFA 1M9NA 2PMWB 3D4LA 2OM2A 4I46A 2I33A 3TNDA 4ZIRB 4KR7A 1XFDA 3LT1A 4R7GA 4M46A 3RJZA 3GJ8A 1ZN2A 4CDMA 4W7HA 4YAWA 2LCFA 2OAQ1 5IFKA 3V8QA 4TTAA 2IF2A 1KDVA 2ADMA 4B5LA 4RGBA 3X43A 4CTKA 1XC7A 3QOFA 1DHRA 3I2YX 1B2RA 1KNQA 5HEKA 1ZMBA 3ZR4B 3BMQB 3AF0A 5K2OA 3DO6A 1CF9A 2DZ9A 4IAOA 3UTDA 2DHQA 1DZ3A 4YTEA 1K1EA 1KJYA 3O3MB 3L1UA 4ID9A 2BCGY 4UVDA 4AJPA 3K1ZA 4B71A 4L0MA 3LLMA 3T7JA 3IUYA 4ID3A 1SUWA 2EC5A 2GD6A 3HXLA 4NX2A 4RESA 3TGPA 3SEZA 2B4TO 2JBHA 1OWNA 1Z6TA 2ECQA 11ASA 2FTKE 2PMDA 4MWBA 5T41A 1KFJB 1U5BA 3K9QO 1YCDA 4MS3B 4OI2A 4LVKA 3UAWA 2ZNJA 3L7KA 4GP9A 5GVRA 2EKDA 4HEHA 4LJ9A 1DTWA 1J8QA 1YI8A 2HLDD 4C3OB 1IN5A 4LDPA 3EIUA 2XSZA 3TUPA 1FOEB 2EBWA 2GERA 2NWQA 3E5HA 5AKZA 4ZVNA 4CEIA 3G59A 5AR1A 1VFNA 2UVPB 2QOEA 4DIFA 4C7OA 1Z7BA 3BORA 1XOIA 2HIGA 5AHKA 4C88A 4R1NA 3L1IA 3L77A 4QPZA 2ZPUA 4WSOA 4B80A 4CMEA 3T5BA 3ICEA 2R86A 3HACA 3W1VA 2WPDA 1I2CA 3RHSA 1ZJ4A 1XZHA 3CMCO 2HMSA 3IT3A 4G5YA 4UUOA 4L9AA 5D1HA 3KTAA 1J23A 1A8IA 3GLSA 1SZCA 3ONWA 4RVOA 5AI9A 1LB1B 1NOKA 1ZUHA 1T9GS 2FZ4A 4AIRA 1AQ6A 4CYMA 2G1PA 4H31A 2IS2A 2ZIXB 4RVUA 4MLDA 3ICCA 3ESAA 4YBZA 3B7GA 2I54A 3NGXA 3NDPA 4HSGA 3VYSB 3NDJA 4TYWA 4TRNA 3WHPA 4FSDA 1IQRA 3DZJA 4L72A 4OAQA 5H81A 3ADDA 4JOQA 3PP8A 3SZMA 1MH1A 5C5CA 2I3AA 1K98A 2VP0A 1A9PA 3QXXA 3UEOA 3TFOA 3GG9A 1FCJA 2RAVA 3GT7A 3QY0A 2OFPA 1JALA 4YUZA 5ELOA 2AQKA 4YRTA 2HU2A 4PE5B 4WOKA 1RJEA 1CEQA 2BONA 3DEJA 4NBRA 2E65A 4LE2A 4WOPA 4X7MA 4F97A 5C8ZA 5K0EA 1LZKA 4HFNA 4ZAFA 3KXLA 1Z6YA 2D0IA 1ODKA 2PPLA 1YRYE 1QVVA 3ABSB 3PR3A 1FQOA 2AG8A 4N0QA 4BZZA 2PD3A 1JFSA 4ZYLA 1OLXA 4Z7QB 5MN6A 1HI9A 4HNSA 3ENQA 4E4TA 1L2TA 221PA 5KTNA 5AJVB 1KY3A 2C2MA 3MD9A 4ITVA 5DB4A 3TSZA 2EWNA 1PWXA 3U4GA 3L1AA 4ZTBA 1QIFA 1GKUB 4L4ZA 3T35A 3O4IA 1Z0ZA 2PY6A 1V11B 2OT3B 3GLHA 1D1SA 3NUZA 3RUIA 1JA9A 4KXXA 4UTRA 4G67A 2QUHA 1AK1A 1JJVA 3TEFA 4PZEA 1WSDA 4HWPA 1U81A 2JFZA 1BXGB 4R9NA 2YHBA 3BH7A 5JW6A 1SBQA 4Q7MB 3J81A 3N9IA 2AL7A 2R1VB 4A5SA 3OLQA 5ALWA 1KP2A 4TLMB 1RWOA 2DRIA 2GJ8A 3F7MA 1KGDA 2AN3A 3FVVA 3RVRA 3T9FA 1P0PA 1LBEA 2CXOA 2H11A 3VR2D 1BS2A 5CA0B 4RK7A 3ND5A 3WLPA 1N34B 1U9YA 3PVCA 3B1VA 4WNAA 1CFZA 2HK6A 1N9GA 1V2GA 2I4TA 3QWIA 4RFLA 4RDCA 2ZJOA 3N2YA 1SIBE 4MGEA 5EIBD 1MPTA 3MG9A 1K2WA 1NXPA 2X8AA 1VSQA 1XU4A 2CXHA 1DB3A 1X15A 3X1MA 1G3MA 2P35A 4BVEA 1NR7A 1B4DA 2XTAA 3ZWAA 1PZNA 1R7RA 2HX1A 4PNPA 1TF5A 1X7DA 1B7YA 1RPAA 1JQ5A 3R0QA 4OHZA 1IZ7A 1E1YA 1EZZA 1Y1SA 3WLSA 2OBFA 3ROFA 4XE5A 4U2EA 3AIMA 2W6QA 4G5SA 1N2JA 3K1AB 1EX9A 4WK6A 5C7IO 2ZM6B 3LLUA 5EWJA 5GGXA 4UPDA 2GA8A 4IIEA 1OXXK 1KORA 2QNBA 4BRZA 5KWIA 4TTJA 3DZGA 3NWEA 2Y4NA 3OM1A 5CFZA 2UU9B 3D4PA 4H2DA 4UOQA 3FUCA 1X1AA 2EXXA 3C8HA 3NOVA 4Z9BA 1IWBB 1E9AA 4LGMA 4ZAVA 1SQ0A 4YRNA 3DPSA 3IYLW 2RGDA 3TZ6A 2EFCB 4PG7A 4JEMA 1OILA 2AFIB 3L18A 3FDXA 3IBFA 4RM2A 5BN4B 3V2IA 1QHEA 3EF1A 1DOAA 4A0RA 4BY9E 1PKEA 4DVGA 2XGGA 1DKPA 1PEYA 3Q85A 6CHYA 1GM5A 3ENKA 4DC1A 1ZICA 3FJ1A 4MKIA 1WYDA 3U9TA 2UXCB 3FCEA 4DY4A 2IH5A 4X71A 4DRXB 4OQQA 4XTWA 3B5EA 4WUVA 2XE8A 3KHUA 4PM4A 3DAPA 4X44A 3SJAA 4RFSA 3RT7A 2XGOA 1QIDA 4I55B 2CJWB 4J3JA 5H0IA 4KOEC 2H1OA 1Z4IA 1CERA 2DQKA 1UBGA 3ULKA 5MFZA 2R6HA 3EDMA 3AF2A 3K8YA 3OZCA 5YASA 5L9AA 5F9FA 1J8YF 1ZX1A 1NBIA 2QYOA 3O0DA 1E5QA 5IEJA 2XA9A 2OTCA 1KS2A 3AJEA 1QUEA 2JGLA 2GHIA 3HN6A 1AA6A 4FDAA 1EFRA 4TKMA 3PGLA 3LY9A 1JKJB 1QKIA 3A9CA 3GNSA 1DAIA 2HRZA 2P75A 5DN9A 2Q1TA 1QK5A 2NU8B 4YT2A 3ZDXB 4IXMA 4O4HF 2Q1SA 1TO2E 1NMEA 1YRBA 1UC5B 3I9JA 3IIEA 2P7HA 5KOJA 1X7YA 3EDQA 3TVTA 4B8YA 2MYNA 2Q1XA 2F1OA 3PNMA 5DNEA 1H94A 3D8TA 4H77A 1QTIA 2AR9A 3BHIA 3N87A 1AKRA 1PJTA 2E4UA 1SURA 4P3XA 3OQVA 5F51A 2WJPA 2H0QA 2J67A 2CK3D 3E3LA 4MVJA 1KAQA 1Z08A 1E1MA 2XRMA 3SJ7A 2AIRA 1E77A 4ZOBA 4RXTA 1MCZA 4QQ8A 2VO1A 2QTVB 4R2KA 5EUCA 3UWOA 4REQA 1U0FA 1I7DA 2QVXX 4ALMA 2F64A 2I4MA 4YECA 4HAWA 1J8DA 2CCGA 3IERA 1SUDA 4BKPA 1RXVA 3CW2A 3UY4A 3K09C 3HJRA 3P0EA 4NY1A 5LOVA 2YV1A 3LPAA 1K63A 4P2BA 4XH9B 3UANA 4DMKA 2AYYA 2Y0DA 3F9RA 3WIUA 1XHFA 3NEJA 3FPEA 2DU7A 1L5YA 3RVNA 1SBTA 1E64A 3NJRA 2W4QA 3AR4A 4IHJF 4UMFA 4PCAA 1U0BB 1UAGA 6REQA 3JWPA 3PFFA 3X1JA 5DP1A 2QF7A 2FP3A 4OYHA 2OV8A 3BK2A 1QWOA 3PXAA 4ES6A 2FZVA 1KE2A 2VDWA 3BXZA 1DAGA 2A0UA 1B6SA 1OASA 1GD1O 3HCEA 2QRQA 3KT8A 4MAFA 2W2KB 3N8DA 1DTSA 5GIOE 3GLGA 4Q1EA 4MWDA 1L9KA 2QORA 2C4WA 2J9GA 3PI7A 1XL0A 2R1UA 4H4CA 1DAPA 4ISBA 2D8MA 1TZCA 3ESYA 2P0AA 4S1PA 5EJIA 3DC7A 1TCUA 2EHJA 2KE5A 1JDJA 2KLHA 3SPXA 1ODTC 4JP5A 2WB4A 5K0CA 2QKYA 3R6LA 4D45A 2PX8A 3C1OA 3VO2A 1XLUA 2GBLA 2VCYA 3D8RA 2WHPA 5JEEA 1Y82A 1VBMA 3S40A 5TS3A 2WEKA 2TSYB 3A8TA 4JT2A 1CUFA 2ZTUA 2YY7A 3D2LA 3HDTA 4OB6A 4QD3A 3C0KA 1MOSA 3IUMA 2O2IA 1FEZA 3L1VA 2ROQA 1L4EA 1OYOA 1G6HA 2Q28A 2A3RA 5EJ9A 3EF0A 4AKEA 1T8UA 2ZP1A 3D7SA 2PXCA 4PQGA 4TLEA 3MFYA 4GLJA 1ESEA 1KYXA 1E79D 3A1EA 4DDWA 1XK7A 1KHHA 1E2EA 3HEMA 4PC2A 4UEWA 4X54A 4YJHA 3UENA 4TVSA 3TTWA 3KYDB 2HO4A 4H4DA 1KEKA 1GA6A 3BMCA 1B7YB 1P5HA 4K86A 1J00A 3BXXA 4GICA 4H7KA 4F5DA 2CV0A 4DB2A 2JHFA 2NYAA 3T12A 4BV2A 4BLWA 4CL2A 1LLUA 2GN9A 3I12A 1YVEI 4YXFA 4RHTA 3EXG2 3RUHA 1V37A 5CURA 1SHJA 2WZDA 2RCNA 3GBSA 1BXGA 1SOWA 2VUIB 2Q29A 2H65A 3VNVA 3WZMA 1P7YA 5DM4A 4F86A 4F4CA 3F6SA 1CY0A 4C5BA 2X4IA 1S2NA 1U3DA 1EFKA 3OJCA 5JAIA 1A4IA 5FPKA 1SUIA 5CJ2A 3STWA 5EIEA 4XM1A 4AJLA 4CM6A 2GF2A 1D09A 3NRCA 1MIHA 2OZKA 3DEZA 3IP5A 4JITA 4IRXA 3F4LA 5FIUA 1WZNA 4IZHA 1YSCA 3NELA 2ZSUA 3CN9A 3FNGA 4HB3A 4J1QA 5MGNA 4ECEA 3FLMA 3S4YA 2Z8YM 4MEBA 2HBYA 2HLNA 5CLLA 2GN4A 5C1DA 4QE3A 3KTOA 2P4HX 2A8YA 3D7NA 1CUCA 4NS1A 3FH0A 2ZNIA 4PO9A 5TGDA 3ZHCA 3PXUA 3MTEA 4G8CA 3K1YA 4KL8S 3OCCA 4E6EA 1FYVA 1FFSA 1JU9A 3H97A 2RIPA 1LS1A 4JUCA 4XLZA 1P5ZB 1P4HA 4TKVB 1ACJA 5EPUA 5I9BA 3OOJA 2ZVQX 4L07A 4CQLA 3ITNA 1P7VA 1G8MA 4XU0A 2EIHA 1XLVA 4BLUA 1U98A 2BLLA 3UYKA 1XJQA 5C8DA 5JWRA 2CDAA 3GJSA 4NCBA 2YV3A 3SVLA 1LNZA 2CSUA 1LVUA 1AZTA 2OR3A 1OOEA 4CMBA 4TRJA 2VS1A 4J7UA 3TYXA 4EL5A 5A4MS 4MVJE 4TMZA 3LC0A 1C1HA 3PNBA 4G0WA 5KJEA 2Q6VA 3BB3A 1FF9A 3UCXA 5KOJB 4NIMA 1ZCJA 1Z7WA 2E1PA 4KREA 4AZ3B 3OZGA 2GK6A 1I0IA 2AZTA 3L6RA 4C0BA 2ID7A 3K2QA 1T0JB 3A7UA 3NTXA 4URXR 4I6JA 1PSDA 3VH3A 1UBRS 3LBHA 4WLEA 3OJLA 5EZYB 1WB9A 4TVKA 2FFAA 3OCZA 3VHQA 2C57A 1QHFA 3RSGA 1SPBS 4C87A 3O38A 4R9SA 1I3CA 1LH0A 2FUNB 3ILHA 4R1UA 4YHHB 2B2CA 3ACDA 3AJRA 3O9MA 4Q9JA 1KEEB 4NYMR 3OMXA 1YRHA 3OFNA 1KQFA 4O59O 3IDFA 3TE6A 3O90A 4AO8A 2HT1A 4D1YA 2VQ6A 4BO1A 4JDPA 2IY8A 3TH5A 1U28A 5DTIA 1YR2A 3KTFA 5DNUA 4RULA 3VU9A 3ROKA 3GVIA 3QIVA 1X01A 3DZBA 2Q0HA 1UDCA 3GAAA 1EE1A 4JROA 5TPWA 3DE7X 3M1YA 5DHUA 1RWPA 4ZQHA 5B3AA 4CMIA 3I6QA 2FN8A 3T1OA 4NFLA 4D9IA 1G3QA 3T34A 5KI6A 2R8BA 1KC1A 4F7DA 3W79A 2EF0A 3GAMA 4CM8B 4EW6A 4D4JA 2CKMA 3ZCTA 1WO8A 2C92A 3UFXA 3HXWA 3GFSA 4OA5A 3G0IA 2PKEA 4LSMA 4A5OA 3KCQA 2WIDA 4L16A 2B7BA 1GA4A 4UARA 4U2GA 3U26A 5AM3A 4YT4A 4CEJB 5ARDA 3K70C 1UEIA 3AKDA 3ETJA 4O2BA 1CQZA 3HHPA 3KG2A 4UBLA 4W1QA 1GNPA 1TD9A 5AK6A 5JNWA 2HXYA 3AVYA 2PZ8A 3IELA 4GX2A 4N12A 5EJ6A 4BNYA 4FM9A 2JL1A 3M7IA 1GPH1 3O3NB 4HAOA 1RYMA 3PJDA 4JJ6A 4F0JA 4KFCA 4LPSA 2IEBA 3UMJA 3DFUA 5F64A 1T9HA 3QLVC 3ZDZB 2POQX 1OGYA 2V7GA 1IUOA 1G41A 4B35A 1XXHE 4NAHA 4L75A 2QLTA 4JVLA 4FLMA 4PHGA 1M1NB 5D6NA 4B7AA 3JX9A 3AT1A 4Y3UA 4HV4A 1W7AA 3ZGLA 4HR7A 1E96A 3OX4A 3IUPA 4CV3A 1YMQA 3D9QX 1GR1A 5IASA 3GLIE 5I7UA 2HU5A 3OQHA 3B3AA 3JVVA 2GR9A 4MQ4A 1N5LA 1UXKA 1AU9A 3F8SA 3Q7RA 2AZMA 3ZOKA 1THZA 1ULSA 3OFVA 2RMKA 3Q2OA 1KU6A 3EGCA 3AHEA 4XRRA 2Z6VA 4EX7A 3QGMA 3THWA 4O3MA 4HYTA 2B1JA 5L3QA 1L8OA 3IUBA 3QP9A 4EJFA 3RF7A 3ZGZA 3LT0A 3EHDA 3AV0B 4QGBA 2H3HA 1YI1A 2IIBA 3LG2A 3LO8A 2RGWA 3O74A 2W2XA 4RTJA 4PG4A 1R8JA 2PYDA 1DXQA 3BZWA 3DHYA 4MI3A 3L2ZA 1QYVA 4TZTA 3EK2A 4GC5A 3QX9A 1UBHS 4UTZA 1USIA 1YB3A 2FMTA 1YGPA 3G0BA 4HRYA 5DYGA 1PI3A 3CR8A 1BN7A 2BFDA 4JNKA 3DT9A 3G23A 3H5LA 3TZHA 1JQLB 1NPYA 2EFHB 1O6BA 3JSXA 4DLVA 2JHCA 3NIDB 4LYYA 3HFJA 3P97A 1C3XA 1PT9A 2DWPA 2F3UA 1JHZA 2H63A 3INNA 3MUOA 3HG7A 4FDUA 4PYOA 1E66A 4ZU6X 2YYZA 3TW0A 4DJEC 5C4IA 4B6FA 2QN2A 3PSHA 3E53A 4JODA 7ABPA 1NXXA 1R12A 2BHNA 1UOEA 2A9QA 2O06A 3QBTA 1WXEA 1H8HA 3MQ4A 2HL6A 2R6JA 2OUIA 1Z9BA 1PR3A 5SY6A 4CFSA 1IVSA 4HP8A 3B38A 1ZLXA 5D1NA 2J9YB 4FWBA 4M0LA 4EY3A 1VMKA 1B14A 2W6IA 1U7ZA 1P0QA 1TCCA 5F33A 4CN9A 2X8WA 3P26A 3IP7A 1LJ8A 3T7TA 1GP2A 1EFVB 4OHPA 2NADA 3Q41A 1NLZA 1FFGA 4JLJA 5TPZD 4JI6B 4GT1A 1JAZA 1IL0A 3ESBA 1JJCA 2AG0A 2DLNA 3QYAA 1G8AA 1NJ8A 1ISGA 3PZBA 3TSWA 2A57A 4MQFA 3QUCA 2OXEA 3FWYA 3MIIA 2CVQA 1KJIA 4D8UA 3Q7TA 4PRZA 1CEXA 1VLJA 2HWWA 3VM6A 3HXOA 3H19A 4BQNA 1T6BY 2EOAA 2V5UA 1NR1A 3UT5B 2B4AA 4BE9A 4C04A 3B6MA 1UPBA 2CKDA 5EZSA 5LSAA 4L27A 5FBVB 2MSDB 3ZQUA 4GEGA 4DA0A 3WGJA 4BLTA 2WFLA 3SHQA 1UBNA 4HDRA 3VX4A 3R6WA 3M0EA 3FKSD 3ER8A 5IVPA 1JE0A 2WG0A 3ZGXA 4B3GA 2W8BB 3TEJA 3LCVB 3QNWA 1ADFA 5K4AA 3WK5A 1U7XA 4C5CA 3ADCA 3ACBA 3K32A 1FFBA 1HNNA 2PX5A 2VYVD 3QTLA 2VT7A 3QW4B 3W5UA 4E32A 5BT8A 2GN8A 4JBHA 1VB5A 3NP7A 5CB8A 5LP6F 1P1KA 1Z47A 1MB3A 1YS9A 4OSOA 5HNKA 1Y8RA 2DM6A 1T2NA 2PX4A 5D85A 5E6UA 1NXQA 4C03A 4ESHA 2Q0QA 1DFHA 4S1VA 1U99A 4TXMA 2Y1WA 3FOBA 4KI0A 1Z82A 1NVUQ 1PHRA 4B4WA 1BWSA 4N41A 5B64A 4PYLA 1K5PA 1PU2A 3CRVA 3MQ2A 3TO5A 4FMCB 2PZBA 4C06A 2LP4Y 4MUNA 1U2QA 2QTWB 1B76A 1FTWA 1A71A 4B44A 4GDMA 1WY7A 5JDIA 4EJMA 5K09A 5BSHA 4BP3A 2J9FB 5AMXA 3A6FA 5AKXA 3WA7A 1JT9A 2ONZA 2E1RA 3KPWA 2HF2A 1FDTA 1DMRA 3IAFA 2MYTA 4TTPA 4EPXA 3WIDA 1T5IA 1W30A 1YHYA 2FSSA 5J4HA 1QB7A 3DDSA 1ZRHA 1UP4A 3FGNA 2F3SA 2N1MA 1JG2A 4FE7A 4Y7DA 2AOUB 4JJGA 5DLEA 4ZKEA 1IBKB 2P3OA 4FFBB 3TW6A 4TUYA 2LUOA 2PRYA 3FROA 3SR0A 1KIFA 3QEBZ 1GTRA 2WWFA 1E1NA 5I45A 4K26A 1W19A 1EUCA 2H2IA 3SFTA 5KTPA 2XGMA 4RKEA 2Z56A 1QC5A 3V4ZA 1DVRA 2G5TA 4Q3OA 5IM5A 3V32A 8ABPA 3HGMA 4L15A 1NVVQ 2Q6IA 3F2VA 4MIEA 5EXEA 1KE1A 4NABA 1UCFA 3L4BC 1JLSA 1WP9A 2X0KA 2PLWA 4HQFA 5DM2A 1DAKA 1E3TA 2FKNA 2AYXA 3P20A 1XP5A 2HCBA 5D6OA 1N7GA 4CT5A 2JEOA 2VLIA 3ZGNA 4EA9A 1KL7A 4XEUA 4MVYA 2GPAA 4KNYA 1SCJA 1RPTA 5PGMA 4R2IA 3EEFA 2KYRA 1RHUA 3KD3A 5F3RA 1QF9A 2J6HA 3A6LA 3OP4A 2Q3MA 5TLSA 3X1WA 1A9RA 5E38A 1L5NA 3QA3E 1EYZA 1XEWX 5GONA 1WNLA 3I6IA 3UK6A 2KMLA 5KYWA 5LM3A 3IOBA 4QUIA 3SEQA 3T1YB 1AHIA 2GT1A 1C7JA 4FMBB 4U6NA 4YXWD 1U1GA 1WDLA 4IILA 3KSMA 3B3FA 4F5YA 2H18A 1WAMA 3EMVA 5HRUA 1X55A 2TECE 5G0WA 1NE2A 1U1FA 2HHLA 2YZKA 3PLNA 1IEWA 2RGRA 5FTNA 2Z8YA 1DQRA 5CFNA 4HNVA 2ZYVX 5GZ6A 4YA6A 1T5OA 4D6PA 1UJBA 4MRMA 3Q3GE 1A5AB 1I32A 2GNAA 3DAFA 4WJ3M 2ZBDA 4XTCS 4YAGA 4EZBA 3UKJA 3B89A 3LU1A 4KYTA 1H1TA 2HJRA 3F90A 1RACA 3TIVA 4N5IX 5AYVA 2CXXA 4KKXB 5F1KA 1SVUA 3U0VA 4MCAA 4RYLA 3HSYA 1EGVB 2QTAA 1M6WA 1PJ8A 4XSHA 2P77A 4IGAA 3VQVA 3ZE6A 3DE6X 1NMQA 2I1VB 2E4VA 1HXHA 5DLPA 2P78A 4KTTE 4JSTA 1N5KA 2AOTA 2WF7A 3ABQB 4YREA 1X38A 1F3OA 2HBQA 1HMPA 1KK2A 4QBFA 3SJBA 2Q9BA 1ZUIA 3ZY2A 4DUGA 5AK3A 3Q8LA 2G83A 4D43A 2VT2A 2ZE8A 2XOKA 1RYBA 5GZ1A 1VE5A 2I76A 1GPKA 3V3KA 1SXHA 3RABA 4KTVE 3CIOA 4N7RA 4YR9A 4GM0A 1F6BA 3W5SA 1ODLA 1YKSA 3A4MA 3UNXA 4YJ2A 4KXYA 5JJBA 2V97A 4D4HA 4ZQIA 4YUWA 1JZSA 2XRZA 2HQSA 3BT7A 5FHQA 1SZPA 2RI0A 3GT4A 3OJ0A 5LKRA 3KQNA 1RYYA 2OPBA 1JJ7A 1H66A 2WOJA 2P91A 3NHYA 4YJKA 5EPEA 3ZXSA 2Y77A 3ED5A 4AAYA 4KQ1A 1I6KA 3F5DA 1SC3A 4B74A 1MRSA 1J0AA 1WUTA 2J4CA 4DF3A 4KAJA 1IM5A 1J5PA 4BBJA 4A0HA 1WPQA 2FH5B 2NW6A 4IJQA 5G1OA 4HTFA 4IUYA 3LZ6A 1S3IA 1QYDA 4WZBE 4QKQA 2EKQA 3K7EA 5ADHA 3LNCA 3BTOA 1XZIA 1NN1A 2CJPA 1XALA 3L6OO 1CQIB 4HGPA 3ICPA 4IIJB 1CHNA 4G0MA 5BYAA 3G2JA 4V0QA 1NJSA 4D8XA 1O6GA 3PGVA 1R4MA 1HC7A 1GTL1 2P2CA 2IXFA 5LOVF 3GLGE 3N3AC 1XVLA 1NLUA 4WN9A 2BF7A 2YHAA 4IH9A 4JU8A 5T6BA 4A73A 1OE0A 4Z0NA 4DCOA 5KYNA 2O0MA 1UMKA 4BX2A 2WTXA 3LHDA 4P5EA 2XB8A 4K81B 4B9AA 1HK7A 2A14A 4ZEVA 1XDWA 1XNGA 3QEAZ 1GGMA 1S8FA 1NF3A 4X65B 2VH1A 4XQ0A 1HF3A 4G1BA 4EYSA 4F8JA 2ZIZA 2ZULA 1V6AA 4P0QB 1ECBA 4OEHA 1XDUA 2M6SA 2YZ7A 1UJ5A 4B79A 1KRXA 3GA5A 4I9UA 1QLHA 2HSZA 4HN4B 4OP3A 4OQEA 3L0CA 1GRCA 4HUQA 1XQXA 2B1GA 4NOJA 4W99A 4Y6OA 4G5RA 1PZEA 1G8KA 2GAFA 3PNLA 1U94A 2YX1A 4QDJA 4QYSA 1Z17A 3SWWA 1QZZA 1U3VA 3TPZA 3VRHA 3B2EA 2ZAYA 4FIDA 5EYPB 5IJ9A 3O8CA 4RFSB 4RQFA 1B8PA 3ONFA 3EGDA 3WYGA 4P35A 3NVDA 5KQGA 1RXWA 1LU9A 1T34A 4BMOB 5IZCC 4M1SA 1XTVA 1MA3A 2AJ8A 3DG9A 4JNCA 2XUGA 3CX8A 4TSFD 5CP8A 3OF2A 4L8WB 2JKVA 4NCAA 3GB9A 3RSCA 1Q2UA 3FTEA 3C3PA 3OZ7A 1PGNA 3FYUC 5AOAA 3TWOA 1S0UA 4L0DA 1HOXA 2LXNA 2O8EA 2IIQA 2PVCA 2QTCA 4NJMB 5FD8A 3SX4A 4B76A 1UQRA 3ABIA 1VLQA 5CB4A 1UJNA 1RM3A 1VECA 5E9AA 3ONNA 4JYMA 2BEJA 4JC5A 2ZSAA 4TVOA 4RH1A 4IX1A 4AO7A 3AU8A 2Z4SA 1VRCA 1MN6A 3K0CA 3SY8A 3E18A 3MCTA 4RH0A 1WCXA 1UM9A 3I4LA 4FX5A 2VHUA 5FL7D 5E9WA 3HNPA 4IY1A 4AX8A 5K3CA 2UYGA 1YBVA 4MDFA 2PS1A 3OQPA 4DIUA 3V1KA 3ROMA 1DAEA 1T0UA 3AC0A 2I29A 2FSGA 4JDUA 4WGFA 5AIAA 5AXAA 3NYIA 1F2UA 3QK7A 3TVYA 3AIKA 3B7WA 5G40A 2BZ0A 1G3RA 4PLFA 1NF2A 1LEHA 3L4GA 2MYUA 4I5IA 3Q4GA 2D2IA 3W2EA 4B0PA 5AW2A 3FWPA 3JZDA 3RYTC 3AR2A 4J4TA 2F43A 2NUAA 3ZZ0A 2VA8A 2ZI6A 4EKDA 2CC2A 1BJKA 1DIHA 4M0KA 3UMGA 4YRQA 2IBSA 1K6IA 4MRVA 1TYBE 3L4EA 4J75A 2B20A 5EQDA 4ZXFA 4QFCA 3REQA 8OHMA 3MF2A 1FDWA 4BB6A 4L87A 1EFTA 1HG0A 1OZHA 2WWXA 3BQMB 4JI4B 1E0KA 2BUAA 2VYCA 4QDXA 1GTZA 4H6VA 5AJXA 5FOWA 1IHUA 5K6AC 1Y9ZA 3BMNA 4CIWA 1Q44A 3BRWD 3FX2A 4DV4B 1JDZA 2WLSA 3LQ4A 4JB8A 2BKLA 4A7PA 1JG3A 3ZE9A 2A4MA 5FTWA 2ZZMA 5ECWA 5B37A 3DVRX 4FMDB 3RGGA 4BFSA 4D99A 5C1OA 2QX8A 2D5LA 1NRJB 5JYDA 3STHA 5K05A 5C53B 2DUWA 5DTMA 1EDDA 1WDMA 1XTSA 3PZCA 3M9XA 2ZAMA 1KOFA 1OTYA 2CYAA 3QV1A 3T06B 1DBIA 4Q34A 3WJAA 2HHJA 5JDCA 5HZGA 1KMNA 1HZZC 1V8OA 4Q9KA 2Q7EA 5M5BA 2AQ8A 1WUKS 3HZZA 4BV8A 3GPIA 1JHDA 5F35A 3LCUA 1UUFA 2XWBF 1CUGA 4WOJA 2PJRA 2FPWA 1Y3BE 2ZYUX 3C1AA 3SAJA 4WNYA 2CHEA 3NWPA 1JTFA 3HKCA 4Q01A 1HEIA 4TQAA 3GJ0A 2C7BA 3P27A 4QRIA 2ZR7A 3QWBA 1TVCA 1THTA 1E6EA 4HEQA 4CTOA 4BRSA 4B4UA 1DC6A 2D8AA 1KK3A 4LFCB 3UQZA 1ORVA 1GR0A 4MQ5A 2FRXA 3O84A 3DTVA 3MB5A 4GSLA 2Z6UA 3DNMA 5BW4A 2FWAA 3C14C 1TUGA 2EIXA 3JD4A 1I30A 3W04A 1BFDA 2Y6VA 1KRHA 2GA9A 1W2WB 4YCAA 5HZHA 3IAM6 3IR6A 3L7LA 1X9HA 2MSWA 3RODA 3ZWKA 3LKVA 3C6BA 3GK3A 1YAJA 3FSEA 4OJYA 4QXAA 5FO0A 2YKGA 4RPJA 1KO1A 1QNLA 2PUGA 3TDNA 4BP8A 5H9WA 3QTTA 4ESEA 2JJYA 3QUBA 1OXUA 2ZAOA 5IC5A 4B45A 4MXDA 1ZMRA 3TEMA 1VKZA 1ISSA 5BOSA 4B46A 2R8OA 3WYAA 3BJRA 3KFVA 4CS3A 4GL4A 5DWVA 4GQIA 1T9BA 5TXGA 3RUDA 3NIBA 1KMMA 4EJSB 2RK3A 4P4LA 4PO3X 4XSVA 2ZKIA 5DYTA 1RZUA 3FOZA 1K3FA 3N2GB 3IMFA 5E6SB 1YZUA 3AFOA 5I8WA 1AKNA 1N5MA 1HT3A 2Q62A 3AP3A 5ESWA 1RHKA 2FPPB 3I1JA 3USCS 1RJGA 3F7NA 3LK7A 3WMXA 2YCBA 3NW9A 4G9BA 3RARA 2OV3A 3QOWA 2VJDA 2ZTSA 4BMNA 4PHFA 3VPHA 3GBPA 1XIVA 3BCSA 3L8CA 3IOCA 4D3SA 2VNJA 3HNOA 3AZQA 1GZUA 2BBOA 2DWOA 4GXQA 5ITZA 4AH6A 1Z5WA 3B2QA 4LXXA 2LD4A 4S2EA 3W6ZA 2FR8C 5HKAA 1YF3A 3WK6A 2PIDA 4OX9B 1E2HA 3QU9A 3B82A 1ZJ6A 3HJGA 3L8MA 1T8TA 3ZV6A 4MCJA 1WU8A 2VUHB 3PE4A 2P2LA 4PZ9A 4PTZA 1VMAA 1E2GA 1KMQA 4RE5A 1JDSA 2QT0A 3C5CA 2CL6X 3K4QA 2IYUA 1NXWA 1NL3A 2JLCA 1Q17A 3D3WB 3OUUA 4QJIA 1YWGO 4RF4A 1D2AA 2C31A 3BWBA 1P9NA 2CVPA 3JQPA 3KUUA 1ZKMA 4HVAA 2ZVDA 4QBKA 3L0PA 3EBLA 1CJBA 3U3OA 1X39A 2I6FA 2O2ZA 2Q5LA 3UHAA 1G51A 2IW1A 3ZWCA 1OT3A 2VSOA 1Q0SA 4QQNA 4AJNA 1QG6A 2VHYA 1AN0A 3ZZNA 2LCQA 3LGXA 4M7WA 5DSZA 2OQVA 1A0OA 5KHLB 2QG4A 1M34E 2YWEA 4F5WA 2NVOA 3KQHA 3F73A 4X62B 4GX0A 3BXHA 3O4VA 5CX4A 3KSZO 4WZAA 3E7FA 3BD9A 5E0KB 5DOZA 2Q4TA 3THRA 1IIRA 4OATA 3T3HA 4BUCA 1QRSA 5BRJA 1S2GA 2CF6A 4GWKA 4L1KA 1VYHA 4QG7A 4BYMA 1IU9A 2QIOA 2FHPA 3CU5A 3Q98A 1H3NA 1DRJA 4YRCA 2DJ5A 3OO1A 1VHTA 2DMRA 3P52A 4KQ9A 3RROA 4UMDA 3RWMB 4C4TA 4WLOA 4DXDA 5KVVA 4Y67A 1YQQA 2WWRA 2Y66A 3IESA 1I80A 1OAOC 4PC3A 1CZLA 1DEXA 1FTNA 1KFBB 3AJ9A 3ES9A 3HMKA 4HDMB 4M0MA 3T0IA 4HNTA 1U8XX 4BZXA 1V1RA 2VYFA 3W2HA 3IDZA 3P9ZA 1VMDA 2OHJA 1BROA 1PJAA 4QLOA 3EZGA 4J0FA 5KNLA 4RKRA 5AW3A 3O8LA 1JSLA 2IVFA 3AQIA 3JQGB 4BUJA 4D92A 1G17A 5LIRA 2EJVA 2X6TA 3A4IA 3IQHX 4KWCA 4DRXA 1VDMA 3HVHA 4B2PA 2HTEA 1I10A 5BORA 3P9KA 3FFAA 3R3SA 1D7AA 4I14A 3IVXA 4QFDA 1PTJA 1HETA 3LY7A 1SKYE 1RJ9A 1U3TA 3B1WA 3LUFA 3DHEA 2VPWA 3UICA 4EJ2A 3B6IA 3KYCA 4UUQA 3SS9X 1ZXBA 5A3RA 3HC7A 5HHTA 1Y6FA 1NMSA 3VTZA 2CMGA 3L01A 1KZHA 1GADO 5F2EA 4JBIA 3TCKA 1YBMA 1JR4A 2FZWA 4URYR 3FCSB 4R81A 1KXJA 4ZCSA 3KL4A 1DG9A 3SKVA 1CULC 2C95A 2KI5A 2D6FA 1G5TA 5CITA 3AB8A 1IH8A 4MYSA 3ZU5A 3ZLUA 5AIBA 3KAKA 4LZLA 2J5XA 3ZS8A 4K05A 3HPQA 1Q91A 3UPDA 1JQBA 3BVPA 3BXGA 3VR3A 3IPCA 4NU6A 1QGDA 4FMPA 2L42A 4PLVA 2Q3JA 1Z26A 3PPXA 4U4AA 4MV1A 3FDJA 4WBNB 2DSTA 4L8FA 4P4NA 1AGNA 3WNCA 3L6UA 4N3AA 4Y2JA 3BBLA 1F5SA 1ZCAA 5HR5A 1MHTA 2JG3A 4FGUA 1ZISA 1I51A 2VRCA 3GVXA 4L4RA 3QTBA 2MMGA 3TUIC 1TT5B 3T5GA 1P72A 4GZ3A 3OIGA 4GPIB 4WY2A 4S2UA 2VPIA 4MIYA 5HX7A 1KMHB 2CB0A 4OD0A 3TRKA 4N3NA 1NASA 1BFKA 2CB9A 2IDZA 4EX5A 3O83A 5BSTA 4MW5A 2DR3A 2C9MA 5H4HA 2JC3A 5K3EA 5KVAA 3UJ9A 3E7WA 1RPJA 5ALPA 1RW4A 3QNMA 2CMFA 4MYUA 3SSNA 3B1YA 4CLOB 4YJHB 1C0LA 4QC2A 3AJAA 3ZJ5A 1JV2B 3H0EA 4JT4A 4QULA 1SBHA 3IOMA 1GGVA 1EJ6A 2HNIA 2GRUA 4P82A 3MWEB 5CVEA 4BQFA 1VMEA 2GBGA 4N76A 1JDTA 4NFSA 2HJSA 1ABEA 2QSUA 2OD2A 4B31A 1M67A 5HYVA 1OW3B 2ZRJA 4OGGA 1MX9A 2D59A 3WOHA 3I73A 2B9EA 2WWIA 1QOZA 5FNVF 2W2PA 3GZNA 2BE9A 1KSFX 4PU0A 3IXQA 1WMAA 4YMSA 4OXNA 4GPTA 1T29A 1YNOA 5EE5B 4JUIA 4RPLA 2R7KA 3RREA 1ZOOA 4X84A 4ZO6A 2DE0X 1P4AA 4ZARA 5IBPA 1SCAA 1RQXA 1RTKA 4XASA 4PLZA 4PSDA 1BMFA 2HA6A 2GDJA 1Q7RA 2B25A 1RNLA 4LBWA 1D2GA 1P7WA 3MA0A 3VPDA 4F5EA 2XZDA 5KMGA 4AY3A 1RAEA 2J5BA 3EZLA 1I3LA 1L5MA 3DE1X 3MQZA 2HA2A 4GGPA 4ICIA 3REGA 5FO1A 1YR3A 4O63O 3QPUA 4CCAA 4AF8A 1NNHA 4YCMA 1O5IA 1ST3A 3IKTA 1ODSA 2D5IA 1MZPA 2R25B 3R5JA 3RIMA 1M2EA 3CCCA 5ADUS 2JLBA 4AUKA 3FZQA 1IG3A 2ID9A 1NDUA 1MQSA 3CT4A 4OJNA 4V0NA 3SD7A 4QEZA 3TLZA 4HQRA 4OXRA 3S2GA 5CYOA 3C5WP 3HADA 1GWNA 2UYHA 1XWWA 4UHEA 1RMTA 1YBFA 2ZYRA 3O26A 4I4LA 1Z0AA 3WSTA 5K0SA 1I7PA 4CH6A 1R27A 4WZAB 2LCIA 2V03A 3DT8A 5IWAB 4P98A 4DEXA 1FP4A 1GQFA 1VHLA 4R84A 4A15A 1Z39A 4YV0A 4LRXA 1RAIA 3QX3A 3T3PB 3M4NA 1WRBA 2GPWA 1GVNB 1T9ZA 1F6WA 2ZDGA 5DHTA 3S68A 3WQQA 4LPKA 1AOXA 2E5FA 4CIAA 4MHSA 1KP9A 1CY7A 2X0DA 4D3DA 2LV8A 5BN3A 1QP8A 5EKDA 1T1SA 4ENUA 5CVCA 2WVJA 4RVSA 4AYXA 1TUBA 2C0PA 1MJNA 3BIOA 4DSTA 5J2UA 2IYOA 5FPTA 4IDCA 4J49A 3RVSA 5ALOA 1NBOA 1OX4B 3GFPA 2P2SA 2DEUA 1KO7A 1Z45A 2ECKA 3T15A 1KI1A 2B8EA 4XJVA 3STUA 1YJCA 3ZNPA 5ESRA 1NE7A 2WD7B 1M72A 3DUWA 5DI3A 3RJTA 1VSTA 4YV2A 4Q19A 1W29A 1BCRA 1JVSA 2KBFA 2XKJE 3PIIA 5JWOA 3KUKA 3QF7A 3CMQA 4TTIA 2VYQA 2Y2UA 2DQ4A 3G0OA 3R7DA 4IJVA 5A2QA 1FU7A 5TDHA 3C74A 4RY2A 4UD6A 2C98A 3TOSA 3UZUA 3TAHA 3TBFA 5C8YB 5LD2B 3EVZA 4MWZA 4V1CA 3I6MA 2G1UA 4NMLA 2BFMA 3AEQB 4ZFNA 1L5HB 3VMFA 4M0UA 2ARKA 3CEPB 2VJYA 4RW0A 2VKTA 2WPNA 3N70A 3RL6A 3OF5A 4GI5A 1H42A 4IG4A 3NATA 3KXDA 4PPNA 4HNGA 5BNFA 4DM4A 1WIWA 3MJTA 4KSYA 3OPXA 3ZDFA 3G79A 1U8TA 5CLFA 2QZSA 2WG2A 3KDSE 3MXOA 2C7PA 4N3GA 1YFLA 1IZZA 1OT5A 4D74A 4BN4A 3PL5A 4MVJI 3PI6A 1Z4KA 4J94A 4CHGA 3L7JA 2B3DA 4YMTA 4P33A 2FV8A 2J9RA 4NMXB 4UTNA 4ZJZA 2QGNA 1UANA 2PBRA 2V7QD 3D3KA 4RENA 2DZDA 1L4FA 2DJZA 2BM0A 3KQPA 4CF5A 2VHVA 4EG7A 4G4SO 2ODQA 2GVDC 2JD1A 5IBQA 2FZ5A 3E1SA 1INLA 2PLRA 5DNYB 1NVWQ 5KSWB 1UBSB 5IAEA 3H9QA 3VR1A 4UC0A 1AH2A 2JJQA 3O2SB 3EAQA 1Q21A 1ZD1A 3AW8A 3ITDA 5CEFA 3R9WA 3OOHA 3AP1A 1XMJA 4IVNA 4W5JA 1GZDA 3DMHA 1L5FA 1E9VA 4BNZA 1E1QD