3NETA

Crystal structure of histidyl-trna synthetase from nostoc sp. pcc 7120
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
456
structure length
431
Chain Sequence
b'KINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQNIIYGLEPILEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGEFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVAADLAEEIKRRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidyl-tRNA synthetase
publication title Crystal structure of histidyl-tRNA synthetase from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp. pcc 7120
molecule tags Ligase
total genus 134
structure length 431
sequence length 456
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3netA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3netA02
3VBBA 3PCOB 4OLFA 3L2ZA 4KR3A 4UP7A 4H2XB 2ALYB 2Q7EA 1JJCB 4DQ2A 4UP9A 1KMMA 2E1HA 4RDXA 4P73A 3TEHB 2DJZA 3A32A 4YRJA 5C53B 2I4MA 2EWNA 3QNEA 3HFZA 4DPGA 3V7CA 2DEQA 3P8VA 2XGTA 4P73C 1E24A 1YFSA 2DKGA 3G1ZA 4YRFA 3QO7A 1B8AA 3REXA 4LNSA 3A7UA 3L4GA 2CGHA 2C7IA 2ZT6A 4BWAA 1NJ2A 4XTZA 3HY0A 3M4PA 2I4OA 1Z7MA 1B7YA 4TVAB 2AKWB 4YREA 3ERRA 2E3CA 3A31A 2DQ0A 4X5OA 3A5YA 4XTXA 1PYSA 3CMQA 1ASZA 1E1TA 4HWRA 3PCOA 2I4LA 4YRPA 2Q5IA 1YGBA 4H2XA 4H2YA 2Q7GA 3HTZA 3EFSA 4XU0A 4P72A 2EJGA 11ASA 4YRCA 1NJ5A 3IKMB 3TEHA 3QO5A 1ADJA 1LYLA 3REUA 2ZGWA 3VQVA 1BBWA 4HA8A 1BIBA 3KFUA 2CJ9A 2DTHA 2J3LA 4G84A 1WNLA 3NETA 1ASYA 2QHTA 3VQXA 4K88A 1X2GA 2ZR3A 2EJFA 3MEYA 1L0WA 2IY5A 3IG2A 4CH5A 5K1XA 4P75A 3QO8A 5K1PA 4Q6GA 1EIYA 4P3NA 5C51B 3HRKA 4TVAA 4HWSA 5KNNA 1B7YB 3UH0A 4YRGA 2E5AA 4RQFA 2DZ9A 1WYDA 2QHSA 2LW7A 1PYSB 4UPAA 3UGTA 4XTUA 2ARSA 3UGQA 3M4QA 4CS2A 2ZR2A 5ELNA 3HRIA 4P3OA 1KMNA 4WJ3M 2DVEA 3FJPA 2DTIA 4H2SA 2ZCEA 3RACA 2ZT5A 5C52B 2E65A 3V8LA 4CS3A 4K87A 1EQRA 1J5WA 3IKLA 1W66A 2ZT8A 3W3SA 3A7AA 2ZINA 4YRRA 1NJ8A 3HXXA 2IY5B 1HXDA 2P0LA 3HXVA 2DQ3A 2PMEA 3LC0A 3WQZA 4HWPA 4CS4A 3TEGA 1EIYB 4O2DA 1RIQA 3L1AA 1FYFA 5HGQA 2C8MA 2E10A 2ZZGA 4YRIA 4XU3A 3HFVA 4AH6A 4G85A 2RHQB 3LSQA 2ZNJA 2ZT7A 3RGLA 2AMCB 2DU7A 1SETA 1USYA 2Q7HA 4TTVA 1B70B 1BIAA 4Q15A 4WI1A 2FYKA 4CH3A 2DTOA 1SESA 1NYQA 3NEMA 3RKWA 2ZIMA 1QE0A 4P71A 2I4NA 1SERA 5ELOA 4P72C 1BBUA 3V8KA 4BW9A 1EOVA 1SRYA 3RUXA 3V7SA 1E1OA 3RKXA 1B76A 4CH6A 4CH4A 1ATIA 3ICAA 2CJAA 2RHSA 4HWTA 4YCWA 1V95A 3NELA 3LSSA 1YFTA 4EO4A 2EAYA 2QHVA 3HXUA 12ASA 2ZIOA 4P74A 2DXUA 4P75C 4YDQA 2RHQA 3HXZA 3P8TA 4ZTZB 2AMCA 3V8JA 4YRTA 2QHUA 4L87A 3A74A 4YROA 4YRKA 4PHCA 1B70A 2EJ9A 1ADYA 4KR2A 1WLEA 4J15A 1IL2A 4YYEA 2E41A 4YP0A 2ARUA 1WQ7A 3OD1A 3V7RA 1NNHA 1HC7A 4YPFA 4YRMA 3NENA 1WU7A 3DSQA 3QTCA 1Z7NA 4OP0A 1NJ6A 3E9IA 2CIMA 4ZTUB 4TQFA 3A7RA 4TVWA 3RKYA 3RF1A 1EVLA 4NCXA 1KOGA 4TWAA 1N9WA 1E22A 1VQZA 4XU2A 3I7FA 2DZCA 3MF2A 2RHSB 4XEOA 2XTIA 5E3IA 4H2TA 2E64A 3RIRA 4K86A 4H02A 2ZXFA 2ODRC 4XTVA 1C0AA 3P8YA 4YRNA 2J3MA 4TVYA 2ZZFA 1H4QA 1G5IA 4XTYA 2ZZEA 1EVKA 3RL6A 2ZNIA 2EL9A 4XTWA 4TQDA 4KQEA 1HTTA 1X2HA 1H4VB 1USYC 1X55A 4YCUA 4RQEA 1X01A 1YFRA 3BJUA 3R07A 1H4TA 2ALYA 4H2VA 4WF2A 4XEMA 1JJCA 2HNIA 4XU1A 3A5ZA 3HY1A 2DU5A 1G5HA 1WQWA 2DXTA 4P71C 1WPYA 2PMFA 4PG3A 1H4SA 1QF6A 2ZTGA 3HFZB 1NJ1A 1GGMA 3TUPA 2DDZA 4YRSA 1X56A 4HWOA 4H2WA 3IALA 1EFWA 2CJBA 3VQYA 3PZCA 4EX5A 4YCVA 3HXYA 1YB3A 3E9HA 4YRLA 2Q5HA 3BFMA 2G4CA 4UP8A 3L4GB 2ARTA 4P74C 3HXWA 3UFGA 4P3PA 2P5IA 4E51A 5F5WA 1NYRA 2AKWA 4HVCA 2ODRD 4YRQA 3VQWA 1X54A 4ZIBA 4H2UA 4RMFA 3EFRA 1G51A 4WJ4A 3MF1A
chains in the Genus database with same CATH superfamily
5F5NA 3CRRA 2XEXA 5IH3A 3S3TA 1MX3A 1H1DA 2PKXA 2YVUA 4J91A 1DBQA 4X63A 1KQNA 3UTCA 3H2KA 3KETA 1RM4A 3SBOA 3BCHA 2QSJA 2ZYUX 4Z6KA 4OLFA 1Z74A 2YC4C 3QV2A 4GPAA 4OA5A 4AM8A 5TMEA 5C1PA 1E1MA 5HDQA 5AW7A 2BM0A 4XGNA 3KJIA 2FFHA 4QFDA 4UP9A 4HAZA 2F59A 2W42A 1JXMA 4TWRA 1V16A 1Z4PX 4DEYA 2P9FA 4IJUA 3GRKA 3QE3A 4CV0A 2J0UB 4D3YA 2O2XA 4W9NA 2F3RA 4JCCA 1L8QA 5HE9A 3WBKA 1Z37A 5ADUS 3NH9A 1L7QA 3IQGX 2BAGA 1YI8A 3S7TA 1DAHA 4GYJA 2QTMA 2C98A 3CRZA 4JSYA 1T2FA 4LYFA 2GEUA 1YGPA 5ALQA 1O7JA 3CONA 5EE1A 3HJUA 1R8YA 4RK4A 4D9IA 2FPXA 1NVGA 3OX3A 2JFQA 3OCVA 4FU0A 5I3CA 5FBWB 4BMVA 3PLRA 3OPYI 3CLRD 1W0CA 3T5BA 2H1CA 4X7BA 3DR5A 4C6HA 5ITVA 4YRFA 1XWWA 2C5SA 3TLZA 1N1GA 1QVAA 1K9VF 4P93A 4D4IA 3A7UA 4GU5A 3DXZA 2NO5A 3QMMA 2XECA 4XM0A 1E89A 4YRDA 1JT9A 2H4JA 5EE0A 4DT1B 1DG3A 5K0CA 2DH5A 2J85A 2DR0A 4O63O 4UVIA 2BYTA 4IKEA 4K2AA 3RUDA 3FNIA 4IG4A 3L4JA 2OZPA 3HABA 3BGSA 4TMXA 1K4MA 1P4GA 4NHOA 4IJ6A 3TWOA 2WM3A 4C6TB 4EG5A 1MV8A 2XJ4A 3LLMA 5KYYA 4C3ZA 5LSAA 1MZPA 3ZIDA 5DBEX 4E03A 1ZLXA 2PLAA 4OXKA 4ECEA 1IXRC 5TXGA 5ANRB 3FUVA 4GZLA 1GRCA 3RRFA 4AXXA 2XIQA 2EYUA 2ZRAA 3MWFA 4IYJA 1R5OA 2Z08A 4UMFA 3MRSA 4LV5B 1LCIA 1YH3A 2RGXA 4CV2A 4D79A 2ZZNA 1YR1A 1GTMA 1OV6A 4R5MA 4BATA 2YV4A 1H3FA 1U81A 3AHHA 3U56A 3HR8A 2VPIA 3HXOA 3K1AB 2CCKA 4PN3A 4MA0A 5G0SA 1NW5A 2EWVA 3VTZA 3GLFA 1BS1A 3PTAA 3KZCA 4I14A 2RHJA 1SXGA 1AVTA 1IK6A 5FJIA 3BCSA 4OUKX 2WHQA 1KO1A 3WL3A 1WXDA 4A27A 2Q6VA 3S40A 2FUKA 2PZMA 3H2BA 4JT9A 2UDPA 3GG9A 4J2TA 1BVHA 2J7PA 3C4VA 1AKVA 2QWXA 1I3NA 4G4SP 3SDSA 4UHDA 4D0NA 3OTOB 4LX8A 1ZA2A 2O3RA 2QUKA 2D06A 3GG2A 4P9NA 3TVTA 1NDUA 1R5NA 2VQ3A 4YASA 3ZKAA 4CQLB 1I4OA 2H52A 2QVCA 2V6FA 3VTKA 1OPRA 4UAGA 2VDRB 4KK3A 4TKUA 4HBZA 4XDHA 3PFCA 2QN2A 4LXIA 2E82A 3AM1A 4HAUA 3W8DA 2H1HA 3H1GA 5DYYA 4P75A 4L73A 4LK2A 5ULLA 2PR7A 5DNYB 4KDFA 3BWYA 3BJIC 1I6WA 3EBLA 3EVEA 1KY2A 1IYZA 2DPYA 3PFGA 2Y4OA 2NTVA 1F5NA 1PFGA 4Q6GA 1ST3A 1EIYA 2WMYA 2Q9AA 1VPEA 3E1GA 4J4TA 2AW3A 1QAMA 2YS6A 5FOWA 1BQ4A 5TNXA 4BVKA 5ICSA 3VA7A 3TD9A 1FX0A 1X8JA 1JE1A 2HWUA 4XOUA 4EMUA 1CFJA 4IICA 3O8CA 2XDAA 3D54D 1MCZA 3KYCA 3RS7A 1HT0A 4B4KA 4P33A 4XJXA 2G25A 1XMIA 4OBXA 3V1MA 5JAPA 3JQAA 1Y1TA 2DSNA 2P3OA 5C4GB 3D8RA 3VU1A 1QZTA 4BO6A 4D9BA 4MW6A 1XN4A 4F38A 5HPYB 1R4NB 1MTZA 4ZVQA 3V46A 2YIMA 3ZJTA 3DDZX 2JLZA 1XHEA 1PYSB 2O1EA 3ZXIA 2RGEA 1S8NA 1WZUA 4OQDA 2LPMA 5KSZA 1NKTA 1QGDA 3JZFA 4DM7A 2VNHA 3KWJA 4U00A 1FK8A 1VYTA 3U5ZB 3O8QB 4GQBA 4ZA2A 2GVZC 8ATCA 3WYBA 4ZKDA 2D3WA 3EF1A 3A6JA 2EVWX 4P98A 1D2RA 4ODIA 2DVEA 2C31A 2FQ1A 1Z6AA 3HDYA 4UZSA 1KEEB 2P41A 3VR6A 3A6HA 1QS0B 2CMHA 2ORIA 1H2RS 3GZTB 4ZAXA 1BC5A 3U7QA 4ER6A 2DOKA 3I04A 4E5VA 1QGUA 2WTAA 2DQ4A 2J0SA 4BNDA 1E7WA 1BN7A 4AJOA 5EJ5A 2R60A 3WFJA 1GZ4A 1ADCA 3NNNA 1QOQB 2FOIA 5HF5A 1IHYA 4C0WA 3JATA 1VMAA 3CF0A 4ZYXA 2A0FA 1RCFA 2H65A 5BMVF 4GE3A 5ICGA 1U02A 2OLKA 4BNUA 4KUHA 1LJLA 4PYJA 3TQTA 1PGJA 1KS9A 4LRSB 3SSOA 1ORTA 4ZI5A 2I3BA 1TMOA 2VZ9A 5EY5B 4A92A 1XN1A 1VPVA 3LC0A 1GSIA 1A8QA 3L0DA 3LFUA 3PHHA 5JAOA 5TIIA 3FY4A 4EY7A 5IABA 2O1XA 3I9LA 2HDOA 3ZOKA 1OAOC 3GIWA 3R3WA 1LNQA 1U2GC 2ZIEA 5FHRA 4EKYA 2B4RO 4MV7A 3KSZO 2DWQA 1CQIB 5HGQA 2GPAA 2C8MA 2E10A 1BRMA 1RADA 4NG5A 5LN1A 5TRTA 7REQB 5KB3A 1IVSA 1CF9A 2P35A 4MDFA 4G85A 2OECA 5LPNA 1JXOA 2OO5C 4HMPA 3NB0A 2FMTA 3WQRA 4XQGA 2GYWA 1DPGA 2WJ4A 3DP7A 1P2GA 3H6HA 5EZYB 1U63A 3QVUA 4JUDX 4COOA 3PR1A 3TUZC 3CX3A 4DQLA 4C7KA 4E1BA 2IUUA 4LJ7A 3DLAA 1GPJA 1OSNA 2JGRA 2PUWA 3OIVA 4EEKA 1WXGA 3AUTA 2OAP1 3HADA 3AKZA 1B70B 2OCKA 1VKRA 1YB7A 1KHTA 1HE3A 2J32A 4ZOEA 5LYJF 3A10A 4KITB 2PMDA 4B46A 1KNXA 2WFMA 1Z4QA 4WOPA 3AU8A 3BH0A 3T06B 3QUBA 4G6ZA 5JHHB 1JTVA 5FH9A 4I08A 2DRIA 1DC3A 1NYQA 2FEAA 5H02A 5H70A 4YPOA 3D8UA 4I66A 3AP3A 4E4TA 1I4DD 4IH1A 1O6FA 2YZKA 3AVUA 4XIFA 3SIRA 1OWPA 2CEKA 4EBFA 4B3DA 4B79A 2R85A 4W63A 2F55A 4TT8A 3EXHA 1F9AA 3O92A 4EMBA 3LDGA 4KR0A 1KFJB 4JI3B 2BTEA 1MD9A 1FXUA 1XXHB 1OLOA 4Q1EA 3AL3A 4MJLA 3U2QA 2OXRA 3A70A 1RIIA 2XB4A 1PJ2A 3B7PA 3INTA 3EGWA 5CYFA 4B3XA 4BFVA 1DL5A 3H4MA 3UMVA 5KI6A 1QYWA 2EW2A 1A9SA 4CH6A 1WM1A 1XZMA 1SMKA 4RGVA 3RSGA 1XTUA 3TR6A 1M6WA 1LLUA 2J3KA 2ODWA 3ENZA 4AN0A 4KZPA 3G7UA 3WGUA 4AS3A 4MPRA 4HEA6 1YDWA 4QWWA 1PT9A 2EV9A 3TLGA 1F8XA 1WV0A 3K0CC 4AK9A 1CS0B 2OQRA 3B3AA 2IYUA 4QA9A 4CMBA 1JIKA 1P77A 3H5AA 1SCBA 3I2YX 3U40A 1PQPA 3TLAA 1CNEA 4LY3A 3W6OA 3TQHA 1J22A 3SXUB 2RC6A 3IB6A 2HIAA 1DTWA 1P3Y1 4KWEA 3C6ZA 5ENDA 5FOUA 4CQMD 2DBYA 4G0UA 3RF7A 5IBPA 5C5EA 1SEVA 2OFOA 3WKAA 4PG4A 1ESDA 3V8JA 1GCIA 4LQLA 4RGBA 4RVSA 1MW8X 1JA0A 2ZRJA 3KU1A 4RKYA 4O2BF 4CCYB 2DHCA 4PVDA 1W4ZA 4HFJA 2OLEA 5DF1A 1U11A 5FL7D 3WGGA 1M83A 3INGA 3NJRA 3X43A 5F2OA 1Y5MA 4U7DA 1ZGGA 2EL7A 3AG6A 4HB0A 4MUFA 5EZSA 2WG0A 1MEJA 3GFRA 1T5OA 2BW0A 1XTQA 1SQGA 3I9KA 3L0YA 3MJVA 4G81A 4IUYA 3RVOA 1AKQA 2COUA 3WI7A 4FCTA 5CFZA 4C0AC 2Y4NA 2Y0EA 2CD9A 4RYDA 4LBWA 2M32A 1MB0A 3I8OA 3L7CA 2QN1A 3PV0A 4QOJA 3KKNA 1MRSA 2JGKA 5ALWA 2E4ZA 3WGOA 5G4KA 1K27A 1PW5A 4GBGA 4LS3A 1ZR2A 1Z7NA 1M6YA 5KSYA 3F46A 3DVQX 2NGRA 4NR0A 5DGIA 1S2NA 4E7PA 1BCSA 1NMSA 5IJXA 1KAOA 4F4IA 1OWLA 1B26A 2IYVA 2W6JD 3SYLA 4BB9A 3ZPXA 2ID8A 721PA 1W5SA 2Y1CA 4G4SO 4J8PA 3G17A 5CG1A 2HA6A 2WYUA 3LUJA 4GXRA 2EJUA 3P9NA 4MCAA 1QRDA 1T24A 2XSZA 2IYFA 2IELA 2XAUA 3BF7A 4FMCF 5FTKA 4RNDB 1IXZA 1NSYA 1SUWA 3R44A 3LWBA 3MAGA 4K6CA 1MR3F 2SCUB 1KS2A 4G0MA 3UANA 2XTIA 1P2TA 4HDNB 3PQ8A 2RB4A 1SVUA 1ICEA 1DTSA 4MQ4A 5DOVA 1G2OA 4WA7A 1SQ0A 4OHPA 3W7BA 2P9CA 5JSZA 5TARA 3VBCA 3BWBA 4U7FA 4RJLA 1V71A 2RHHA 1QHEA 1M6VB 3FFTA 4H02A 1AXEA 3C8HA 4CIXA 1U8XX 2G36A 3SVTA 2A5GA 3LLSA 1EJBA 2WRZA 3SDZA 2IP2A 2X9VA 5TPZD 2P11A 4YUZA 3KXIA 1RXYA 1QHYA 2EW1A 1CQJB 1FTWA 2OORA 3MJSA 4FYXA 3TGWA 4YV7A 2B5VA 2FR1A 3HG7A 2GBFA 2V98A 1U1GA 3DKIA 5JECA 4FWTA 3PC4A 4P5DA 1Z68A 4RL4A 4BNHA 4KREA 1EG7A 3V32A 3JQGA 3CNQS 1HE2A 4FR2A 3GFVA 4LXQA 4XTWA 4F6RA 3LOPA 4HFNA 5IFKA 1M1XB 1R5BA 2HJRA 1WCV1 3U17A 4UBJA 5JOQA 1V48A 5CH8A 1QDEA 5LC1A 1M8JA 3G6WA 1HRDA 4KO8A 2A0UA 5FOSA 4RQEA 2J30A 1U2QA 2MYUA 3DWEX 4FYKA 4YT4A 3R3YA 1A7AA 1M2WA 2OMEA 3SMQA 5I5EA 4KK4A 1O9HA 3WL7A 3DEJA 1EFHA 4G5HA 3D0QA 1GAEO 2P30A 4LDPA 5CNMA 2ALYA 1I2CA 1IFXA 1H0KA 2XMRA 3E8MA 1IBRA 1SHLA 4QDUA 3RAGA 3SHTA 2HNIA 3DOJA 3FM9A 3SN6A 1OB2A 4G9EA 4MA4A 3L46A 2QMHA 3QX3A 3GUCA 4J94A 1NM5A 4PSVA 5LA6F 3IVMA 3JD4A 3LY7A 3KFXA 3FMVA 3IAHA 3PPVA 1F0NA 1O57A 1TVMA 5EIHA 4YXWA 4A8HA 4P71C 3G8AA 3LKDA 2Q0QA 3GDHA 4GT1A 3LC1O 4OGFA 1ENYA 3H9JA 2O14A 1EWRA 2VAXA 1E5VA 3FHLA 3ENKA 4L1KA 4NF2A 2V4ZA 1H2ZA 1Z5UA 4O0LA 4PG3A 1H4SA 3N8NA 2XYGA 4O3FA 2JGEA 1BE6A 2NSHA 4CTNA 1VG1A 2HLPA 3WP0A 3ZXUB 3MBKA 3ZC3A 2GX6A 4NICA 4J1QA 4GOND 3I9OA 1HDOA 4F4CA 4BXOA 2HCJB 5E7QA 1F4PA 1V1RB 1F2DA 1ESZA 4LJ6A 3U9SA 1PJ4A 4A0RA 5JNVA 3QU4A 3T41A 2Y1KA 2ANCA 3EC2A 2H4YA 5EN4A 2O20A 1Y6JA 5C5DA 1T9KA 1RJDA 2WV7A 3LZ6A 1JKXA 3QWIA 3PI7A 4I6EA 5LDGA 4YIHA 4Z5XA 4S0ZA 4UQOA 4RWEA 3WO0A 1LD3A 1SC1A 3NOVA 4IILA 5AJHA 1JEQB 2FUG6 2KHZA 3H17A 3TOZA 5JW6A 4Q6BA 5FPHA 1PJCA 1NIPA 3BGOS 3HB9A 4QYIA 2QUIA 1YIAA 1L4MA 2UZIR 4M1KA 2CJXA 4YV1A 4CLEA 3UFGA 3AC0A 3H5NA 5T67A 4ER0A 4S12A 3EUFA 4HTFB 4O4JA 5DSZA 1YK1A 3W3AA 4KR7A 3T7SA 5KJCA 1A9TA 1RYHA 4BV9A 4CCSA 4RA9A 4YCAA 1JIXA 2W2XA 3IESA 4LOHA 4E4RA 5HQTA 5HTKA 3TVDA 1GZSA 3COYA 3UA3A 3JARB 4P31A 3L9WA 4O2AB 3U62A 4PPNA 3AM4A 3A1UA 4KAXA 1L7NA 4JP3A 2WAAA 2XY4A 4OQYA 3SF8B 1RE1A 3W78A 3WA6A 4W5RA 1SUBA 4Y6OA 1S2LA 1H8HA 4U7PB 1GGVA 1CXZA 3WLAA 3LDUA 4DEXA 3FPHA 1YVPA 3ZNPA 1S1CA 2PGNA 3R2JA 1JHQA 2O7NA 3ETGA 3FVRA 4QO7A 5HRUA 3STVA 1C80A 2GTHA 3T99A 4L07A 2WPNA 1OW3B 3IDFA 1PEKE 1PD0A 1SXHA 3U3JA 2X40A 5HUJA 1A7UA 1U90A 2VSXA 1OX6A 3EVNA 1FZTA 2W00A 1QC5B 2XLCA 1JJCB 3FETA 4R6XA 3OJCA 2IDJA 1WG8A 3DE7X 2J4DA 4R0MA 2PUGA 3L82B 5AXAA 1XEXA 1EXWA 3HCNA 3BMOA 5JNRA 1GQSA 4PC2A 2PEYA 4PHHA 2EWNA 3EH1A 4BMPB 3GC6A 2IZ1A 3CH7A 1EWTA 1TA0A 2AKAB 2I55A 2OK7A 5DLPA 3RQIA 3ZCTA 3DP9A 1UEJA 3KT8A 4G97A 4D0LB 3R9WA 221PA 4JJAA 2W48A 4P4TA 3RCBA 1T4DA 4G23A 2O3QA 1E3EA 5I4KA 1LPSA 4KPUA 1E18A 1KTIA 4XIYA 2YOHA 4XM1A 3M6IA 5E7MA 5AM2A 2VWQA 1E2JA 4ZODA 1F8GA 2JIZA 4QU8A 1K6JA 1PL8A 2P1DA 3LSTA 1G8FA 4WN9B 1EBUA 1YR3A 4GI7A 4JP2A 4ID9A 1UKVY 4YACA 4G5GA 1RWBA 5AK3A 1AC5A 4EJMA 5BMOA 2D5IA 4IAOA 3QMVA 1AA9A 1KPIA 1YB5A 5LUBA 2ZYSA 4HXEB 3RHZA 3RU7A 3CZ9A 3VJLA 5H4GA 1CF4A 5DNEA 3ANTA 2WA1A 4EG7A 1AK9A 1MLDA 3AIKA 4KSBA 4CL0A 5JZBA 3FMIA 1RYMA 1M6NA 3RIHA 1IM5A 2YHSA 1YL5A 1NT4A 3BMNA 1FDUA 1Y7IA 4UVDA 5EQJB 5TVGA 2QSYA 4M9RA 3E1SA 2C5LA 4Y1RA 3PDWA 5P21A 1Z8DA 3EN0A 1OYOA 3L3BA 3RSZA 3T4PA 3EAQA 4US0R 4YJDA 3S99A 3GVHA 5ERYA 4KQMA 1H93A 5D5QA 2PZLA 3W2GA 3WKBA 3F90A 4Y9SA 4OAPA 3NVDA 4U8HA 4V38A 3CYFA 1V41E 1CP3A 4C30A 1PWXA 1GG5A 4LTMA 5IULC 4RK1A 2P6MA 5EVJA 3R77A 4TYQA 4CMJA 2AXNA 4KDEA 3KTAB 3NVKI 1A72A 1GXSA 4B2YA 2BJVA 2R68A 4RELA 5LR6A 4UTZA 3IEVA 1HY3A 3DO8A 4J0FA 1ZVVA 1F0YA 3ZGYA 3F97A 1T6BY 2JJQA 1GKIA 2IQIA 5HGJA 1CQWA 1T1SA 4DR7B 1S9HA 3CW8X 4GGOA 5BN1A 1JFVA 2WYHA 5PNTA 2XF8A 3AF2A 2ZSFA 1KYZA 5J2UF 1F7VA 1NQAO 1VCHA 2HSJA 3WDSA 4MJXA 5DWVA 4C0SA 3TLXA 3IDAA 1NQOA 3BJEA 3E84A 2V8BA 2PRYA 5C8XA 3DHVA 4ESHA 4DPLA 4PYIA 3IOCA 4Q9IA 1NZDA 3PEYA 2XMDA 4PLYA 1KGDA 1B3RA 3CPJB 4Q3CA 1RWMA 3ISVA 1JKMA 4X1IB 4XDZA 1F51E 3HL4A 3A4YA 3PFIA 4Y67A 3SLKA 4NYIR 3W06A 4UTRA 1X2GA 2ZR3A 1MFPA 5H9WA 5ICMA 1E2BA 3U4QB 4V0ME 5E9JA 1CD5A 3KOOA 2A9QA 4KO3S 2B0JA 3H2ZA 5JBNA 2EEZA 2GPJA 1AKEA 2XNDA 1NIJA 4HPXB 3K73O 5IJAA 1KEVA 1T1RA 2A5DA 2NVUB 1TZ2A 4W5NA 1FDTA 5F21A 2WWWA 1Z34A 5BYJA 5EESA 2HH9A 1P4SA 2NUAB 4DQXA 5B7PA 1KRWA 1CKEA 5CD9A 1ODLA 2JCVA 3ANNA 2YFQA 3F8TA 3QLEA 4GWLA 4OHBA 2GK6A 3DV0A 3FPEA 3PS9A 5E4JA 4G86A 4R2WA 1AIPA 2J5XA 2QF7A 3JQ8B 4RHCA 3NXSA 4EPTA 1MVOA 1DDIA 3Q15C 1K98A 4EW6A 1Q7RA 1OFUA 2PL9A 2FMKA 1PX0A 3IP6A 3G0GA 4HT4A 4M54A 2BLNA 5CRIA 3V1UA 2CWDA 3FZEA 2HQSA 3WL5A 1QTQA 4E1AA 4H3KB 2GD6A 3PC8A 4TTPA 2OT3B 1DX6A 1KI7A 4AYXA 3M70A 1KBQA 4PQGA 5BSFA 4Z1OA 3ANMA 1B8UA 3BT7A 1P9WA 3AF3A 3KR9A 4KLRA 3BB4A 1J20A 1GCAA 3HU5A 4RXTA 4GX5A 2JGJA 3KC2A 2NQTA 3UGTA 5JNSA 4WOBA 2DJ5A 4TLMB 1AOXA 3UK7A 3FUWA 4FLFA 3GLFE 2F8SA 1L5OA 4I50F 2ARSA 1O6BA 4FOOA 5HM8A 1MEEA 1VA4A 2IPXA 2Z3WA 3A4VA 4TKZA 4UBLA 5KWVA 3W5HA 5KTTA 3UMSA 1SOMA 3T15A 1FXSA 4J1SA 2VT2A 4M9ZA 5SYMA 1HKHA 1CJCA 3LDFA 3REQB 3AKDA 2I78A 1EDOA 1PD1A 3FJPA 1BTOA 3BUSA 1GGKA 3HDVA 1C1HA 1XAGA 4G5OA 4KI0A 4P92A 4Q7KA 3DE2X 4UC0A 4M0MA 5DHFA 5AOVA 4CDNA 4WW0A 1WD7A 3SXJA 3USCS 1X7ZB 3KX2A 4G1UC 2O2EA 4JYCA 1T0HB 4OP2A 1G9XA 4ROSA 5A7GA 1MRNA 4U7HA 1OHHD 1YJBA 4DMCA 1C9YA 2XT9A 2VXOA 2OY0A 3EJ6A 2WE8A 4X84A 3U80A 1ORHA 4FEGA 3AZQA 2CLFB 2E7ZA 4RU1A 4XD7D 3OIFA 4TS1A 4KQGA 2W2LD 5C8DA 4PIMA 4K6KA 3FDZA 2EARA 4OSEA 4KWCA 1KL7A 4R2LA 3R9KA 1JU3A 1R6AA 1V4NA 4H7PA 4RX1A 1W6RA 3JASA 3S1SA 1NNSA 4OHWA 1NBEA 4GUDA 2VHCA 5KOIA 2PUHA 3DE5X 3FWYA 1TZCA 3WQQA 4RF4A 2XA1A 3PICA 3QQPA 3B3GA 4O2DA 4C7MA 3Q7RA 2M1ZA 3OVMA 2YIVX 3ZV4A 1SHUX 1V26A 4A8TA 2PT5A 2GZSA 4ZDKA 5AKYA 2IPNA 1OXXK 1GG2A 3TTVA 1Y9JA 1ODTC 3ZLVA 4ENWA 2BHSA 4W8GA 4WXRA 1XALA 2CF6A 4FKZA 4S0XA 4XJTA 3MXTA 4YAIA 4NZZA 4N49A 3VR4A 4A5SA 3UW1A 2WWIA 3ZU4A 2BI8A 1PGQA 1W94A 3A6ZA 1A88A 3QNUA 3JPYA 1UP7A 3AY6A 4OQQA 2YIDA 3L01A 5AP9A 2HQOA 1ENPA 1Q17A 2V7VA 1YZYA 1JTFA 4ARSA 3KKEA 5A9SB 2QAGC 2GJSA 4GW3A 5IZ4A 2H2HA 3GLHE 4FBMA 4IJMA 2JI9A 4KXQA 1N36B 4Q15A 3OOHA 1GTJ1 3D7SA 5D8DA 3FPLA 3A9WA 2BCEA 1D0VA 4A26A 4CFZA 1E1NA 1NX6A 1GM5A 1DUIA 1HTBA 1QH9A 1DXOA 4CF4A 1KMHB 3HDHA 4HGPA 4UQLA 5L3SB 1CT9A 1IL0A 4ESOA 1QH0A 1CZNA 1PU2A 5CT6A 3EGXB 1ST2A 2FQQA 4OHKA 1SCKA 4WN3A 1D2AA 2CY0A 2ZUVA 4J1TA 3UICA 1BOOA 3BORA 1Z0DA 2DYKA 4BP3A 4I5DA 3OU2A 4KQ9A 3BILA 1KPHA 4TTJA 1T4BA 4M9CA 1WY7A 5BSGA 5REQB 5DYIA 1MJHA 5CFRA 5I45A 1U9ZA 4JLNA 2P9QA 2TRSB 2NNWB 4F56A 5K1ZA 5EMNA 3CFYA 3EAGA 1ISGA 2G04A 3AHCA 4NV3A 3RTBA 2PGIA 4RPIA 2AFHA 1K0UA 1XZJA 2PWAA 4L15A 4RPJA 4RF2A 4W8OA 4XLLA 3SJAA 5EMHA 4OJKA 2HKIA 2GEFA 2DULA 3PDIA 4ZXFA 3RSSA 3W8RA 3I83A 2FU5C 1WO8A 2FV8A 3TL2A 1JJ7A 1YFTA 1T2EA 3SEFA 2Q49A 4WJZA 3KV1A 5EERA 1DTEA 3EXFB 2GCOB 5JJ5A 3MT9A 2P9YA 3HVJA 3MMPA 1XJ5A 4FWIB 3LY9A 5SZHB 3IT2A 3KCQA 1ZUWA 1VKNA 5FWYA 3NRBA 2QYHA 1MO4A 2AOXA 4ZCIA 3HPRA 1TA9A 3C8MA 3VR5A 4G0WA 5COAA 5U4QA 2BSAA 2ETVA 3HXZA 1FRNA 3WYDA 3SD7A 3DWGA 3T9CA 3IQIX 5IMSA 3RLIA 1E9VA 2AMCA 4KWTA 5C7OO 1CFZA 1Q50A 4MS4A 3LQYA 2GNOA 3S0JA 2AB0A 3R9XB 4FD2A 2C7GA 3DDUA 3A1FA 5H3LA 3OE7A 2JLAA 1M34A 5IX8A 1W29A 3AI1A 2ZIUB 1PNQA 4HT3B 4CT5A 1YS4A 1WF6A 3BREA 3K0HA 2Q29A 2CXSA 3AILA 1VBKA 4FEYA 2PEZA 4N1AA 3N5CA 1QAOA 3NBXX 1N6HA 4JWKA 4QQKA 2ARUA 5DPMA 4FC7A 1V3UA 2FPIB 1XD2A 3OURA 1T9ZA 4EFDA 1IQPA 2EG5A 2RH9B 1W4LA 3SC2B 3S2FA 3TZLA 2OV8A 1XZHA 2BF4A 5AT1A 3ZY5A 4AZ0B 3G0HA 1US8A 4BDSA 2J3DA 3PFHA 2DFKB 3OUUA 1O6GA 4ZOLB 3TEJA 4YJGA 3ZJ5A 4ZV4A 2GCPA 1PV2A 4NEHB 1W85A 1E1LA 3AINA 5IEBA 2O8CB 3M49A 2Z4RA 5K09A 1HLDA 3IULA 5BNFA 1G9SA 3RKYA 5KO2A 4F4HA 3X0DA 2ZYVX 2OCDA 3RE1A 1E5TA 1HE5A 2H17A 3LBAA 4QDKA 5JHGB 4UULA 2EWWA 3HJNA 5AKKA 2AE2A 3GW8A 3HKEB 5J47A 3DDCA 3DT8A 4KVFA 4QGFA 5IU6A 1C9KA 3ZIAD 2HF8A 3I3SR 3ZD8A 4YX9A 1AUQA 4N01A 1MAUA 3ZYCA 1C50A 2RHSB 3ZGOA 3BMQB 4OHRA 1OT3A 4YK7A 1OYVA 3FPJA 4CFYA 3DTVB 1GNVA 2ZSKA 3CIFA 3LE8A 3VXKA 4LYDA 3WLHA 1VMIA 2QL5A 4EQZA 2AC4A 2B34A 3FVTA 3K8QA 4F21A 1CUCA 2JRCA 3BXXA 4U02A 5FEMA 4UCQA 1JG4A 3L7LA 3Q8KA 2APJA 4PBTA 2N3ZA 1EDBA 1G66A 5K4GA 1OKKD 4EFKA 1RKQA 3FZQA 3GEDA 2GTPA 3NEAA 4LV6A 1Z18A 3VRHA 3ZLTA 3LP6A 4C9BA 3KUKA 2ZE6A 3I32A 1G17A 4HV4A 1MABA 1AF4A 2YJTD 1E2GA 1ENZA 2D8MA 3ELYA 2C3UA 3M5CA 4N0EA 1TC2A 3SQMA 1XMJA 1MAWA 1UCFA 1EZ4A 1PCXA 3FSEA 4E5KA 2SNIE 2XGSA 1G5IA 1A2BA 2ZBDA 4Y2XA 4YQYA 5CJPA 4WL0A 1ZVQA 3N2EA 3TDKA 3KQYA 4YBZA 2JFBA 1CK4A 2VPZA 3ASZA 4TV8A 4A2PA 5ILOA 3BJMA 4ZYVA 1XZIA 2BI4A 1BH2A 1YBFA 1KWKA 1YNSA 2CJWA 5C8YB 4MIYA 3ETJA 4EY3A 1NUPA 1QBGA 1PJQA 2VWGA 2OHVA 2QPOA 3ZQUA 2EIHA 3OKFA 4YN3A 3DDSA 2GA9A 1NYTA 3KQUA 2XZPA 4G07A 1MOZA 4TMYA 4NH0A 1Q2UA 1NYLA 1LWOA 4QSMA 5BSTA 1OZ0A 1SUDA 1OXTA 2D2VA 1SQ6A 1A5TA 3KG2A 3O84A 4CCAA 2XZLA 3AVVA 1Q1EA 5LZ5A 3UQZA 1Z6XA 1EGMB 4U2BA 1IU9A 1EK5A 3W2FA 3W04A 4IX9A 5FI3A 3SFZA 4AF6A 4BLOA 3ROZA 4PNHA 3D3EA 1WQWA 1BD3A 2RBEA 3FYSA 1N2HA 1E62A 2PUTA 3S1AB 3ZXXA 2A30A 3KRTA 4ZIRA 1W36B 1ZMOA 1UT8A 3O21A 5MF6A 2M6SA 5JAHA 1QRUA 4RYLA 1WX1A 2O59A 1UAGA 3HJAA 3JX9A 4AF8A 4HNTA 2WC1A 2I87A 2F6RA 3E27A 2XUQA 3IEPA 4MYDA 2RJNA 4MO2A 5KX5F 4BV3A 1TOAA 3NBQA 3H13A 3UMMA 4BWFB 3FF1A 3R4CA 5DTRA 3KEOA 3NYWA 2JCBA 3NHPA 3FLMA 2C9CA 3FDXA 2G08A 3AEXA 1BMTA 4B81A 2ZEJA 4C0KA 4HH3C 3FKSD 4I1YA 4U3JB 2AH5A 1OLXB 1TT5B 1IG3A 2A5JA 3SSMA 2UXCB 3CN7A 2VA8A 3HXYA 3BE6A 3EIUA 4N6OA 5C80A 1Y6QA 1ND5A 1GSOA 2VCHA 3L5OA 4EELA 4ZZ0A 1IQRA 1W1UA 4UP8A 2FUG1 1UBNA 1C0LA 3AUXA 1C4XA 4XYBA 5FOVA 3FROA 3TI9A 1QR2A 1XX6A 1CDOA 1KO4A 2PAFA 3BSWA 1ZC4A 4O4LF 1NDHA 4HUJA 4JVMA 1H22A 1GA1A 3EA4A 3H42B 4WZBB 3FI9A 1MIOB 4WERA 1JLSA 1ULAA 5B4VA 3PUKA 4FN5A 2QUBA 4PY2A 3ZEIA 1KSGA 3NEPX 5JCJA 1XYVA 1Z7GA 1CS4C 3FYUC 3SJBA 3BRCA 4FK8A 3TK1A 4GIBA 3OX1A 2P2ZA 3GT0A 3K9NA 4X41A 3TDNA 3AVOA 3NHMA 3N2KB 1CDDA 4Y2RA 2R6JA 4BYGA 6CHYA 3LLUA 2D1QA 2HF2A 1TZKA 2QN6A 3ABRB 3K92A 4EI9A 4ETWA 2VPTA 3B20A 4XQ0A 2WWVD 1FMTA 1GZ7A 5K20A 3H6GA 4F2HA 5DT9A 2ID7A 1J24A 1RI4A 2QR5A 1KVUA 3OPYB 4ND5A 3H5OA 2JKVA 5IXJA 3FOCA 3OQBA 2X8BA 2P3LA 1GAWA 4KFCA 1XJWA 3VPHA 4TS4A 5JSFA 3IEIA 3T1TA 3VVBA 5MN5A 2XPCA 3ESRA 1YZNA 2FUCA 3A1DA 3HUDA 2DEQA 3OQIA 4QAJA 2HNKA 1O95A 3PHBE 1CZRA 1DKOA 5C8VA 8LDHA 2RG1A 2WPDD 2HHLA 1A9QA 3Q0IA 4QUJA 2GKOA 2PK3A 3MT7A 4ZDIA 3TSAA 4Q19A 1BMFA 1KFEB 1IHOA 1NP3A 2DG2A 2RKOA 3A3OA 1DGQA 3JQBA 1YFSA 4B3MB 2BFEB 2EHJA 3N2GA 2VDWB 1EUDB 1LBIA 2XT0A 5DHPA 3LPDA 4JOCA 2W37A 2FTKE 1H94A 3QOXA 1WD5A 3V4SA 1JSCA 5JS2A 1X19A 3TLBA 2CLLB 3L4GA 1MMFB 4QODA 1RFGE 2KM1A 3Q4GA 3OLCX 3UENA 4KYVA 1PJBA 2BKEA 2QBYB 4JXZA 4W5HA 2OD9A 4QD3A 4Y9RA 2H7CA 2R7NA 2VHTA 3PRHA 3GZNB 1NMXA 1ARZA 2CFOA 4L8YA 4XRRA 3HLKA 3E5NA 3LUFA 3OJEA 4ISBA 4UHFA 5AHXA 4ZTBA 5ADVA 5JRJA 5L51A 1B7YA 3DKVA 1IG0A 5KWEA 3N6XA 3P9KA 2P2YA 2OFFA 1Z9BA 2YZ2A 4H3HB 1JDBB 1MU0A 3IHLA 1PIWA 4CHGA 2XNCA 4FT2A 1K4KA 3PT5A 3STUA 1EU1A 3B8EA 5DCLA 2KMLA 2R1UA 3WTCA 4P4NA 4WLOA 4PFQA 1WHTA 1DCMA 2EP7A 3ZKWA 4LJKA 4RVUA 5CVJA 1CU1A 1JLLA 5JO0A 3RIYA 3ONVA 3CMQA 2P75A 3M6FA 2XB6A 3NCHA 4N3BA 2GEJA 5IMBA 4PXAA 2J31A 3IFSA 1TECE 2Q5IA 1W2WB 2FSPA 3BD9A 3EPPA 4EQ6B 5HW0A 5KVAA 1D09A 2XZOA 4TRNA 4UPVA 4INPA 1L6RA 4O4IB 1L5HB 5DYNA 3THRA 4CKWA 5HIKA 2ZROA 2ZJFA 1AUOA 3AEQA 4G1BA 4YGYA 3IVGA 2LCQA 3VZSA 3QU5A 4MZDA 5JXJA 4B85A 2XQFA 5IVKA 1EH5A 3VBEA 3W5UA 5FP0A 3T5GA 3HQ4O 1JZTA 4LVLA 2Y68A 3RD5A 1NC3A 3KELA 5B30A 2ZI5A 4NVRA 4CWAA 5EFZA 2ADFA 1RRFA 3VNQA 4AJKA 5AW8A 1TRHA 2OCGA 5P8WA 5KYNA 3CVJA 1SC9A 3ZHZA 3FUCA 3EMBA 3PD1A 3RSHA 3VQXA 2H07A 3RGGA 3DCJA 2WJHA 4W5JA 1HL3A 5ALVA 2PMCA 4UZFA 4AQYB 2QNRA 2H0RA 1DU4A 3CY6A 3H1BA 5CT8A 5THKA 3G0DA 3FN4A 3QUTA 5EJ7A 4E33A 1N8SA 3NV9A 3FWKA 3HEMA 3PBKA 1T6XA 2LIPA 4WJKB 4YBRA 2XD4A 5IAGA 3EG9B 2G1KA 2GR9A 4GPIB 4KC0A 2GBPA 2WJ6A 3LWNA 3RJTA 2OD2A 3R3UA 2ZP1A 2Q0XA 2GK4A 2E4WA 3A37A 3AERB 3I05A 3LT5A 4FQ7A 2B1GA 2Q8NA 4G24A 4PICA 2BFDB 2E4XA 4RD4A 4A8JA 5JBQA 4R0VA 2X42A 4OHOA 4Z4IA 2AUNA 2E89A 5A7FA 4EVQA 1QHGA 4TX1A 3UPUA 2BHLA 2C1EA 1G21A 1UP4A 4MUAA 2LR0A 4YCMA 1S0UA 2HLDD 3LS2A 1XTKA 4OIMA 4KQ1A 4A0HA 3HI4A 1TYAE 2IPMA 2CDAA 2Q5FA 1IB6A 3BRWD 5FI1B 1RC0A 3DJFA 3MBIA 5TX7A 4C4OA 4H3SA 1CIJA 2PKQO 3HU1A 4XWTA 2JLVA 2J1LA 1FMCA 4YRGA 2ATIA 2ZBPA 1X1DA 1QJCA 5CA0A 2ZCJA 5LU8A 2WU1A 5TEVA 4G8CA 1Y48E 2FWPA 2QN7A 4B4WA 1MP0A 4MV8A 4B17A 4LXXA 4JXJA 3L0ZA 1TX4B 2BTOA 1DC4A 4HS9A 2J08A 4DE5A 4DLSA 3ZLJA 3BRQA 3FSRA 3JYPA 3MCAA 2W22A 5DGCA 4GR5A 2BBOA 3DLBA 3LIPA 1G8YA 1PQ4A 4I55B 1KERA 5H4HA 3PQ4A 5AW5A 4B40A 1Y1LA 3QI7A 4KVZA 3CVUA 3T12A 4K3VA 1T9CA 1PG2A 4NU5A 4RPCA 3B5EA 2IS1A 2F1OA 4ARZB 1KR5A 1E0DA 1CQZA 2K2WA 1QO0D 2RIPA 3CWCA 4JJEA 4HFRA 4MVXA 3T6KA 1NLYA 2P6OA 4GI2A 4D6PA 1FDOA 4M7WA 4M55A 1ZNQO 2IKSA 3SC3A 4FOPA 1YDHA 2HWXA 1CZHA 3VPAA 3A3NA 4TMKA 4TLDA 2ZT8A 2NSJA 3FXAA 3GJYA 1A2OA 1FSSA 2EWMA 4HSEA 2CFTA 4NTZA 4ZHSA 2OILA 3M3DA 1U0OC 2BRUA 4PLPA 2JBAB 1XQVA 4M1YA 1DRVA 4TXMA 1XCMA 2GESA 3GVXA 4DCVA 4N65A 3W5DA 5HKLA 1JR3E 3ED1A 2BGMA 4YYZA 5G0UA 3ETNA 1T2CA 3V4OA 1WXIA 2GNPA 1MJNA 4RVHA 3HXVA 1F2UA 2D1FA 3V3KA 3OT4A 3RFTA 2H2GA 3W5SA 3FZYA 2WHXA 4M22A 4CS4A 4WFQA 5BYKA 3WTBA 1GG8A 1GNPA 1E96A 4YXWD 2FMIA 5KOYA 2OE2A 3U7EB 2CBXA 5I7AA 1CE8B 4QX6A 1FYDA 1NU8A 1P3JA 4NFHA 1T36A 1EAMA 2OGWA 1Y0BA 3TZEA 2C7PA 4I81A 1I4WA 3CUWA 1KVQA 3TQQA 4AO8A 1OTYA 4FE3A 1J21A 3C3XA 3PC2A 4ZZ3A 4I1UA 1J2EA 2H4HA 3N8HA 3V6MA 5HZGA 4MPDA 1QPBA 3F3YA 4HLDA 3DGEC 3VHXA 1FRVA 1E2FA 1I2AA 5ELMA 3IUJA 4J0QA 3WIUA 4MRMA 1HR0B 2GFQA 3VR1A 1T6ZA 3SKVA 2AI3A 4FR0A 4KQ2A 3IL2A 1NOIA 2AIRA 5C35A 1YU6A 4OL9A 4WSOA 3WHPA 1P1BA 2DWPA 1JN0A 4RTOA 2WTBA 3PHJA 3P2YA 3PNQA 4MITA 1VJRA 4RD3A 5GV8A 5HA5A 1Y3CE 1HDCA 2C4MA 2ZYDA 1DO2A 1EX6A 1XFDA 3LYLA 3PFFA 4U8GA 4PX9A 2PPLA 2FP4B 4NLLA 4XSHA 2PX0A 1JHXA 2P8SA 5ALYA 4F8JA 3CXUA 1M8GA 4QGSA 3TXYA 1Q0RA 1QQ6A 5KHLB 4X1KA 5K7SA 2JFYA 4E30A 2PKCA 4LTDA 3TBKA 2JIOA 1JQ5A 1ZWLA 2Z43A 1LBHA 1K7YA 2ZIGA 1TUGA 4KH0A 5KYUA 4HLCA 4YJHA 3QPAA 1LA2A 3GGOA 2R6DA 3G5LA 3PSAA 3GLSA 4F97A 1K8QA 1Z0UA 1BBUA 3OFNA 2PS3A 3K70C 2WVHA 1G20A 2JDID 3ZXYA 1SRYA 2BGGA 4NJEB 3FX2A 1YJQA 4GI5A 3UY4A 2VLIA 4YTEA 5TJ9A 4FBGA 1X1BA 4CH4A 1TZJA 2N1MA 2VDPB 4HDRB 3EY9A 1XRLA 2NUPB 4YI5A 3U3RA 3X2EA 3B6ZA 4AZSA 4DF3A 2AL7A 5HFJA 4Z4HA 1IE3A 3D5QA 3HMQA 1DELA 2QXUA 5FPPA 2YJZA 1IZ8A 1QHFA 1GCUA 2RSLA 3FAKA 1ZUHA 4X92A 5LJLA 2XCLA 2NVBA 2XHZA 2Y0DA 3EISA 3QKTA 4DMUB 7MDHA 5DI9A 2Z6QA 4QUAA 1C7QA 1LC3A 5JXHA 2D1RA 4MUIA 2QA5A 4BS9A 4MGIR 3LUCA 2DT5A 2B5OA 4EKDA 4QVGA 5JCOC 3QKUA 4N7MA 4P74A 1W4RA 1EM6A 2AG1A 2ZYGA 3AOEC 2F1IA 2QAGB 1MQAA 4PZUA 4V02A 521PA 2X0IA 2UZAA 2NP6A 4R9SA 3RRMA 1BXRB 4OUDA 2VHQA 1F0PA 1JHOA 1UPTA 1O54A 2QUHA 3D0KA 1YFZA 2ZU0C 3F2VA 3FPFA 1VRVA 4H1HA 4K1XA 4PLWA 5EVCA 4P54A 4AURA 2A4KA 2RH4A 4L5JA 1QVVA 3Q1LA 2O2JA 4DR1B 1UBMS 5K0NA 4PHCA 1E1CB 2G28A 3FWZA 5T5QA 4GFDA 1WL8A 3QHPA 2PZAA 2NV6A 2PVCA 4AZTA 4URVR 2C00A 9LDTA 5FA6A 4FM9A 1ZJ4A 2X4DA 3DLTA 3OA0A 4V39A 1UXGA 3ZY3A 4KG7A 2OB2A 3R6GA 3HH8A 3OHMA 5E4YA 3DR3A 4DVGA 3RUIA 4R8MA 4RZIA 4Y2PA 1H2AS 1J07A 3H2YA 3H75A 2POCA 3K5WA 3KYJB 4A82A 2A4MA 4OQMA 4BAGA 5LMZA 1UZAA 3IPCA 1QCCA 2H8KA 1N7IA 3KOMA 2GM9A 3PFKA 3QE0A 2OUKA 1EFLA 3D7NA 3L8ZA 3DBIA 1OX5A 3A1CA 4IRXA 5G1NA 3SBEA 3ADCA 4QJ3A 5B1IA 3GBSA 5F9HA 4Q66C 2X0FA 1C0IA 4EHJA 5DISB 2XW6A 1R10A 2LP4Y 4KCGA 3SOPA 2WYIA 4BCCA 3CEAA 4D46A 4KO1S 3Q3JB 5K0BA 5MFPA 1KY3A 4TVWA 1L4LA 1F7UA 1NXWA 3U3XA 1APBA 3ENWA 5DTQA 3TS1A 3RF1A 4BX8A 4QPJC 1TU3A 1EEHA 3ILHA 3MNFA 4UHKA 1C1DA 4URHA 3MAAC 1N9WA 4XH9B 3HFJA 1DFGA 1YD7A 1XA3A 2ECKA 1XEWY 3AHEA 3FFAA 4WGFA 3NTUA 2VTBA 3JAKA 4UNQA 5I47A 4RV4A 4EH1A 2D5CA 1GPKA 3BSFA 1X2BA 1T3TA 3E7DA 3EGVA 1QGOA 3OMLA 1XQXA 3L4BC 3OZTA 1YT5A 1GKLA 1EPUA 3KR0A 1OUMA 3ZG6A 1UBRS 2Q6IA 3KKZA 4NS1A 1WNFA 2BEJA 2BGNA 1NF8A 5C9ZA 5IHXA 4K86A 2RGWA 3L0SA 1CY7A 2ZXFA 4HL6A 4M3NA 4X8OA 4DM3A 1SUPA 2XUDA 3UEOA 4DC9A 4FB5A 3CNHA 2BGJA 2WUFA 1D2CA 3Q1KA 4CT4B 3GJSA 1PLLA 2RI0A 4X45A 2B7CA 4RD1A 1O89A 2J3MA 2HLNA 4PXYA 2CLEB 3CF6R 5BQ3A 3ZY2A 5K4AA 1CUBA 1WCYA 1X7HA 3AFIA 4MKGA 1CUFA 3WNZA 3KQSA 4KE7A 4LSGA 1XCOA 4TL6A 4WMLA 1JR3D 5FNVA 5AYVA 1NP6A 4Q4JB 3MWDA 1B2RA 3BK1A 3HWX1 4KSYA 1L8LA 2BKUA 2JHPA 4DZZA 1DG1G 1JSLA 5CFPA 2ZJOA 2JCGA 4QUIA 4PG5A 1P6QA 4KYTA 3NALA 1MB4A 4C87A 1X01A 4BNTA 1KSFX 1O4VA 1UFVA 1JBQA 4K9LA 4RHTA 1NOKA 4EWLA 2WQ7A 2FSVA 2YUIA 2UYCA 4L2IA 3W2HA 4TYYA 3HP4A 4FMDB 3FSGD 4NBVA 3HNRA 2QY6A 2K7FA 3TIXB 1I3MA 2IEAA 4RWZA 1E2UA 3FW1A 2DFLA 1VM6A 1IB0A 3ECSA 3V4ZA 2Q9CA 2QM0A 2X0KA 4XWAA 5EQDA 4BTLA 4DBLC 1FNDA 5K9ZA 3G68A 3DO6A 1ECGA 4KE6A 3BWVA 3CLRC 4X00A 5JWRA 2QTHA 4Q0MA 3AR6A 1RKXA 1Y34E 4NNOA 3IIIA 5EJGA 3E5HA 1Y8RA 1E92A 3BFVA 1K8XB 4PX2A 2E85A 4H3VA 3ZBUA 5EIAA 1V7PC 4B6EA 3NBKA 4RTRA 2C29D 1Z16A 1Q6YA 3ZHVA 1V7QA 1L0BA 2DDZA 2EOAA 3R76A 3V8BA 3IJPA 3V2HA 4G8JA 3THXA 1PZGA 4ZVSA 4F96A 1H3EA 1XAJA 1Z0FA 1QQBA 4YDRA 1XEWX 5JWHA 2E3JA 3DVSX 1DLIA 3ROEA 1EUZA 8ABPA 3ABZA 4LCJA 4XWOA 4YCVA 1NVFA 2R3SA 4PC6A 4RTJA 1WRBA 3SCZA 5IS2A 4RACA 2R86A 2QJRA 4MS3B 1SOWA 4NBNA 4L08A 2EKLA 1EGQA 5ARDA 4KX5A 3DMNA 1I7SB 1M8FA 2EFCB 1XLTC 1TO2E 2NO9A 2XTMA 2Q62A 3N2ZB 2ARTA 1ACMA 2C2OA 1XCPA 2GPTA 2EBWA 5JSKA 3WXBA 3GUUA 3WRXA 1PUXA 1KY4A 2H54A 5TGTA 2XXBA 1ZU5A 2R1VA 5EGSA 2P5IA 1T8RA 1OMOA 2AKWA 3HI6A 4LEIA 5T4BA 5HS4A 4F1KA 5KYYB 2ZUFA 4CKCA 1E2LA 1LY1A 3ADPA 4N7RA 2C0PA 3VU3A 5ABPA 2ZTLA 3PUYA 1I4EB 3AKYA 1OI3A 4DKJA 1K5DA 2N42A 4RQTA 3RHSA 2IEBA 4IINA 4L9AA 1HFWA 2B78A 2XE8A 4BKPA 1EIWA 4XEHA 5D5HA 2Z5FA 1ZP6A 4J0IA 3RYFB 1A8UA 3VBBA 4N9QA 3THWB 2NQ8A 3PDHA 4C4TA 3EAFA 3GJXC 1CZKA 1RXSA 2NACA 1I01A 1PI3A 4C01A 4BX9A 4DLUA 1E7RA 2FETA 3WWPA 3PP8A 1XB2A 4AL4A 4WBNA 1VQ1A 1Y8ZA 3V4RA 4HATA 4TM7A 1C41A 4PAQA 2E1HA 2Z58A 3BL5A 3V2IA 2DJZA 2I8CA 2ZPAA 3DZBA 1VSBA 1AGPA 3GJ4A 1LSJA 3MQFA 4MROA 4U2CA 3N05A 2GBLC 1CJSA 4L8FA 4O25A 1EFVA 3B9PA 4K28A 5GAJA 5K2MA 3MSCA 1QH8A 1AKWA 2YW9A 3CA8A 1RNLA 5KDLA 2BP7A 2ZYRA 2AHOA 3ZV7A 3OY7A 1K7SN 2GCEA 4GLJA 1HDIA 3MLEA 3PYXA 5HUHA 2O8BA 1Z73A 1TQ4A 2J6BA 1KAGA 1GZDA 2JAOA 2PZEA 2ZIXB 3DVLA 4PEVA 2Q1UA 2VSFA 3USES 5B57C 4IS2A 4UTXA 4B8WA 4WZ6A 4BN4A 2PZBA 4D45A 3QNMA 4UTPA 5JAQA 2DQKA 3COZA 1JLMA 621PA 1UQRA 1G1MA 5GMOA 1VDZA 3CMCO 4NARA 5ESDA 4EW2A 3KZXA 2ZBRA 4EHBA 3E0XA 3HSKA 4CIYA 4DR5B 4E2XA 1BX0A 3GRUA 4EHFA 4A10A 3W5BA 2IEIA 2O7SA 1ZUNB 3UQYS 4HVLA 4GYYA 5HJ5A 3AY3A 1H2WA 2NXCA 2RG7A 4U6NA 4S1TA 2XEDA 3BAFA 3EF3A 1DKNA 2ZYAA 5I8ZA 1ONBA 1LRLA 4BFYA 5M34A 3JQEA 2WQZA 2DF8A 1OYWA 2QGZA 1NVAA 2XXJA 3FUTA 1A3CA 2VJBA 3DHNA 3KPUA 3AVPA 5FORA 3I09A 4E1VA 2LXNA 4M8NE 4Q7JB 3TQCA 2GYYA 1R3DA 3KYCB 3Q8WA 3FTDA 3ZWAA 3AIOA 4TLAA 4R1PA 4UBMA 1V5IA 4IBOA 1BG6A 2WFZA 3JQAB 1JDNA 5CR9A 2CDRA 3MJRA 3NBAA 4MQBA 1M9NA 4GOJA 1QHSA 5TQ0A 4XTXA 5DM60 2H5JA 3OLQA 4RH3A 3UMGA 3U3OA 4EMTA 5L4SA 4P0QB 1QG4A 2BE9A 2XTZA 3Q5DA 5IUJC 2OV1A 4RA6A 3G8BA 4Q3DA 1HM5A 2HPZA 1D5CA 3INYA 1L2TA 3KQWA 4IDFA 3T54A 3ZHYA 5INTA 2RHDA 1U3TA 2X22A 5EKTA 4BRSA 4NS4A 1KORA 4JI1B 3FTEA 2OG1A 3IKMB 2UZ1A 3OE7D 4UD6A 1FQKA 2C61A 4WE3A 1NI4A 2DZDA 3B51X 4R16A 2FFBA 4REQA 4WZAE 3WVNA 3C3PA 4ZVNA 3O4FA 3DEYX 4Z3DA 1C3VA 2HRCA 2WABA 3IERA 4F84A 1ISMA 2B92A 2J6IA 3VSBA 4HA8A 4UFPA 1JFFA 5ENVA 3PC7A 3LDAA 3EW7A 3U7QB 2JI4A 4LF9B 1L4BA 3IOYA 5DLDA 5LKRA 3GDGA 3RADC 5HK9A 1XPJA 2KYRA 3BHJA 2DWOA 4E15A 4BNDB 3B6MA 2A94A 1E3MA 3IAFA 4BMZA 4XQEA 3ZS9A 3PE4A 3RC1A 2VHXA 3ICCA 3F3KA 4G8BA 3JATB 4IDOA 1NVKA 4Y6QA 4B3JA 3Q3VA 3RU3A 2W0MA 3NHZA 1L0WA 2XNJA 1D04A 1VZ3A 2XWQA 3D1LA 3P2EA 4ME6A 3A05A 3WICA 4BO9A 4GMGA 5D1NA 2R6GA 4ZMBA 1VLLA 4C89A 5HSGA 3H11B 4CH5A 1YUMA 5DMHA 3ZWYA 4IOKA 1JDTA 4LKOA 4S1VA 1LLFA 1I1OA 2BGIA 2WK1A 3W05A 4A0FA 1BKDR 2WW8A 1DRUA 3WMWA 5BOSA 2QTVB 1KYXA 4AX8A 4RJIA 2QIOA 2AEMA 1UKYA 4RZUA 3M4YA 4YJ3A 1UXIA 2GN6A 4W1PA 2NO1A 4Z8YA 4EUNA 4V2UA 1CCWA 4Q4AB 3TX6A 4IMPA 3HS3A 2B8NA 2VP5A 4DG9A 1P31A 4CKXA 2HYIC 2PBLA 3LWDA 5CIYA 3G2PA 4W99A 5I8PA 1BS2A 1X6VA 3I30X 3G9TA 2Z1DA 3AHFA 3C5CA 4GL4A 4M1OA 2DB3A 3T0IA 2VSQA 4AZ3B 3ISJA 1YZUA 3T7KA 1EINA 3OZXA 2VYVA 3T3OA 1CUGA 4JQOA 5KQSA 1FY2A 2E5AA 3A6DA 3BX1A 3O0DA 3WDKA 4UM9B 4RPGA 3F1LA 3P71T 1L7PA 3LF1A 4Z9AA 1SH7A 3AESA 4YPVA 4RORA 1TF5A 4G09A 1ZH4A 1TO1E 3VOTA 1FU4A 4IIBA 1X92A 3ESYA 4QXQA 3SE0A 4RGQA 2CUZA 1E32A 2ZRBA 3DNFA 3Q3CA 4OHUA 4Q03A 4YWJA 1V1MA 3D3NA 3Q8LA 4GKJB 3D0OA 2YN0A 3VVMA 2O54A 3AF0A 4J6EA 5JQGA 3OQVA 2B20A 4LUCA 1QCZA 3QA9A 4L72A 2O0JA 2YICA 2OBXA 3DYIA 4U2EA 1RJ9B 3UG6A 3AEUB 3G85A 2CV2A 4BE7B 1MBZA 4K87A 2ISSD 2WYWA 4ZC1A 1ND6A 4G0XA 3TSZA 4G63A 2OGZA 2Q27A 4KYUA 2EGUA 3V2GA 4LAFA 2YWJA 4Z9YA 1ZJZA 2B37A 1FFXA 1URPA 4DIKA 5EA2A 5KUTA 1UK9A 4UVHA 1G4UR 1VHTA 1ZD9A 4KIGA 3D43A 4LN1A 5EP2A 2W6ID 5DZSA 1VCIA 1I51A 2G70A 4NEQA 1EX9A 2YN2A 3R7LA 1OZGA 1L8AA 5DX0A 1XROA 2ZYWX 4HWGA 3UMRA 3CX6A 3M4ZA 3OCCA 1T4CA 4JR0A 3UT5B 4BL5A 3ME5A 1VJDA 3WQZA 2YXEA 2GAJA 4HYEA 1RIFA 2YMLA 4RZQA 1ZQ1A 3M6VA 4JEIA 5IW8A 3T94A 4BYMA 4LVJA 3M5DA 2FEWB 3HYRA 2ZIAA 3TLGB 2DEUA 4YECA 2DH6A 1QMPA 3V3TA 4MUJA 3ZD6A 1J9EA 2PUEA 3V6LA 1IZYA 2JAPA 3E9YA 3JY6A 3JWJA 2J0EA 3QVGA 2XQGA 1Z62A 1VIYA 5E1BA 2FJPA 2YCLA 3GFFA 3I2FA 2I5PO 5AXCA 2PA3A 3D31A 1J0DA 3ZU5A 3TDMA 2RHRA 3CURA 3N39C 4Y30A 3R09A 1Z2CA 4DXAA 5BWLA 3QUSA 2VQEB 2F3QA 2O3JA 3AJ8A 2X9QA 1J0AA 5I4CA 3PIRA 3KE8A 3IMKA 2PS1A 1TTQB 3LO5A 3WK5A 5IPFA 5IYZA 1RC1A 2O8FA 1HLFA 2CK3A 4OGGA 1Y7TA 2AN1A 4KFRA 1T8PA 4Q02A 3L0BA 3ORFA 3PWTA 1FP4B 2QUAA 2Q2VA 4I4TA 5A4JA 5CW1A 2H2FA 1BXGA 2CLSA 1NRJB 3RC3A 4NBWA 1ZIPA 5JJIA 4G89A 4WOKA 5CK4A 1PL7A 3N70A 2F3UA 1SCDA 3CINA 3PGXA 3IKJA 4KXNA 3RC7A 1ZQ9A 5IBCA 1FYVA 4Q1FA 3E4DA 3K09C 3VZPA 4LMRA 1CEQA 3ZCSA 1UBJS 4HLUC 5JNWA 3I1IA 5FTNA 4CHTA 4S04A 1EESA 1BCSB 4AKIA 4TV8F 2I3AA 3PF9A 3HKDB 2W11A 5LKAA 4RS3A 6ADHA 4CEHA 1BE1A 2C4KA 3F6YA 2IYWA 3GOHA 2J7KA 3UAWA 2JGMA 5J4LA 5JD4A 3ZJVA 2B1RA 5ED0A 1VCMA 4IF6A 1OE0A 4JC0A 2I2BA 5CVUA 5KKCA 3KWLA 2V6MA 2VXYA 4JI6B 1QIIA 1X80A 3NX4A 5T57A 4G1VA 3UWDA 4OAOA 4KN9S 3VHRA 5AW6A 2R5WA 1JHZA 1Y4UA 5JXIA 2HJ9A 1FXWA 3DOHA 4MULA 1N8NA 3WQHA 1P3DA 2JFUA 2V5AA 3T1QA 3ZE7A 1OAKA 4BIIA 4PSDA 2D8AA 2Z1NA 1N0VC 3CN9A 4ND4A 4C21A 1QDLB 5JSZB 2BFCB 4FDMA 2AFVA 4N6GA 3VU9A 1VJ0A 3T1YB 2GAOA 2IW1A 2XH8A 1O95D 1LSUA 5G02A 2HJSA 1OB5A 3T5CA 2IHYA 2VHJA 4BLWA 5LQDA 1Y3DE 4O4HF 1QV6A 1BMFD 1GCOA 2PH3A 2Z5VA 2ZAMA 1REQA 3AIMA 3PQ7A 1I5EA 3PQEA 1DAOA 1KC1A 3ITNA 5LIRA 3LKVA 2WFLB 1G8GA 5AKJA 2QHXA 3VMFA 5HX7A 3BXOA 3M5PA 1DQZA 4PO8A 2YQ4A 5BW5A 2ODQA 5AJTA 2QN8A 5ALDA 1IL2A 5HKAA 2V7QD 1SPXA 2OCXA 4IUBS 5BNWA 4M9UA 2OTCA 4F6RB 5KNCA 3GH3A 3UJ9A 1FYEA 4JGGA 1X39A 4QJ5A 3K70B 5ES3A 4K6HA 3C8DA 3A7DA 3OKAA 1F8UA 3S8MA 3ZE0B 2X5NA 3FRJA 1NBAA 2G82A 3QTCA 1TK9A 3BA1A 1BCRA 1BGVA 2GERA 4OP0A 2A14A 2BBSA 2W2MA 3LTEA 2C4VA 1RWOA 1F12A 4OOEA 3N7TA 3QVLA 4E2FA 4M0DA 2H9AA 4LGVA 3O82A 3O7WA 1FNNA 2I1WA 3O8LA 4IEEA 4LPSA 5KTKA 3VOBA 1HPLA 4GI3A 1NVMB 4CM3A 4CR6A 1DADA 1ONPA 3BMCB 4IIDA 1Z13A 1UFKA 1EFUA 5E3JA 4DXDA 5JCXA 1A82A 1LVHA 2OSVA 2ZBUA 3OJLA 1E22A 1UXHA 3ZX5A 4EUSA 2JK0A 2EFEB 2OR3A 3VR2A 1WAMA 4JUBA 3OKCA 1ZJ5A 2DGDA 4GPD1 3T35A 2EP8A 3V7UA 3ULKA 3HCWA 4A03A 3OZUA 3PB3A 1P4RA 2WEKA 1WBDA 3I12A 1AO0A 4JEUA 4D9KA 4L28A 2BEWA 2C20A 1E7MA 2O7VA 4FYYA 1HQDA 2PGAA 4H2TA 4M88A 3RS8A 3KJQA 5A1TA 4B75A 4D41A 3FWHA 2R4TA 3KALA 4A73A 4ENRA 4ZGGA 5LQSA 3K1JA 5LXTF 2X5OA 4POOA 4OO3A 2DQSA 3IV7A 2P4QA 5JH7B 3K6RA 1OWMA 1U04A 2CJYA 3R0XA 5LMUB 2OOSA 2PYIA 4BFWA 2VP2A 4EVRA 3CF2A 4MS1B 3LCJA 1GZ3A 4HOYA 3R74A 1N1MA 1PZEA 3GJTA 2H2AA 1ZC3A 1UAYA 3KAJA 4RE6A 4N76A 5GM1A 2IP4A 4ZJYA 3F8SA 5H82A 5J4YA 3B1KA 4FCVA 2IYZA 4ZD6A 5LIPA 3K72B 3ND8A 1AURA 4YMTA 5BQXA 4DCUA 1WCWA 4LX0A 4O4JB 3GNQA 1WXEA 4HVTA 4N3GA 1X15A 2JJ1A 4WXPA 4L8GA 1KZ9A 4P5PA 4RA9B 4H6WA 2QXYA 2W98A 4LSMA 1PN3A 4GAEA 1VBNA 3L6UA 5IDYA 3UPDA 4DNFA 4E07A 5KCZA 2PD3A 4FGKA 1I2BA 4KFSA 1WSDA 1YRYE 2NNLD 1J9GA 2Y76A 3E6AA 3SJZA 1U7ZA 3EZLA 1JFRA 2PE5A 1Q20A 3M81A 1LPAB 1KGSA 3GWZA 4OHFA 5KQGA 2I62A 2OBMA 4EJFA 1O9GA 1QKKA 5CITA 2QVGA 1PR1A 5EKSA 3LBFA 1E58A 2NZ8A 3PIIA 3E2PA 2H63A 3VYTB 3M0EA 2IY7A 5FHQA 2AWNA 5KOHB 1C8KA 3GJZA 4BE9A 3C7DB 4LGMA 4GL2A 4H31A 4CKBA 1G3MA 2A5YB 1SGWA 1IEVA 3LL4A 5AIAA 1GZUA 5CJ2A 2VK1A 1PZXA 4P58A 3ZU3A 2Y99A 2Z8YM 3N8IA 3U3DA 1BDBA 1AKYA 3BFJA 2DY0A 3IQZA 1YCHA 3F98A 4B4UA 4B2LA 4BQSA 4S1NA 2AG5A 2D00A 2YHAA 3EUAA 1BXKA 1EE9A 2X14A 2X1VA 2BGTA 2ODPA 4MLCA 4PPYA 1NI5A 1W5BA 3MA0A 5KSOA 3COJA 3IPYA 4AJJA 5FNZA 5JAMA 2HA0A 4CU2A 1KSJA 3K0FB 4ZU1X 4UE6A 1JNXX 2A7XA 2CVPA 2Q1WA 4OKIA 5IUNC 3U44A 1S2DA 2XUKA 3KLNA 4PZPA 4WINA 5DM0A 1PT5A 3I6MA 4G4IA 1N2OA 5IKMA 4BQEA 2JRLA 3AKEA 7REQA 2P79A 3OTWA 1NVEA 3B5IA 3RBVA 3HCDA 2GYVA 1LLDA 4GR4A 1U0BB 4XWGA 2QGFA 2Q5HA 3II6X 4LVKA 1SOAA 4GHWA 1WE2A 3S70A 2XUFA 3TQRA 4A4DA 3E81A 4F3NA 3LRPA 1R16A 4XX1A 4ALIA 4M0FA 3NH6A 3TKYA 1J56A 5ENZA 3V7NA 1QANA 5B58C 2FKNA 3A6GA 2H1SA 1C14A 5FWDA 4K9NA 4A7PA 2V0GA 2ETXA 3VQWA 2A9FA 1O87A 5ALRA 5MGNA 5BWMA 4DLAA 3C7CB 4XVUA 4BQPA 1G1AA 3LM8A 1P7WA 1QG6A 2X5KO 4PGMA 3VFDA 5A4FS 5A05A 1N0HA 5M04A 1NLFA 4KPYA 3R5HA 4JLMA 4TWZA 4GM4A 1C7ZA 3TG2A 1YVDA 1NW4A 5AQ1A 1Q19A 5LQMA 3GY0A 1JMYA 2R79A 1KJNA 2XMGA 4P3KA 1UP6A 2Z9CA 3ADBA 4YLYA 1RRVA 2OBNA 2ZJ3A 1T26A 1GSHA 3AHJA 3OI7A 2AR0A 2ENUA 2AXPA 2VDVE 2YXLA 2YZ7A 3CLTD 1JQKA 3AJ9A 1W5FA 3K1AA 5AH0A 4B7ZA 5B12A 5AVQA 3HBFA 4B71A 5ALKA 2O8DB 3RFFA 3LY8A 2WWHA 4NOMA 1KQFA 4FHGA 2VT6A 3DBVO 2V7PA 1PG5A 4DR3B 1KJZA 4DMRA 2JJYA 4J16C 1VIVA 4IGEA 2BR5A 2O52A 2PXCA 2D4AA 3HFZA 1KDTA 2O7RA 2V6BA 2WHEA 1E4YA 2B7LA 1QFYA 2VHYA 4FNGA 3WBJA 4BCDA 1II9A 1YV9A 2F90A 4S1WA 4CKEB 3HJRA 2CV0A 2VDUE 2FZLA 1AHHA 4LOAA 4CQLA 1ICIA 3RTGA 2JFHA 5FF9A 2I2FA 5IT9A 3NWOA 1SD5A 3G89A 3UWOA 2C7OA 3M9XA 4DV3B 2RIRA 3R6LA 3AUFA 2WQ6A 5SZJA 1F4LA 4NATA 4WY2A 4UHHA 1OFUX 3OFND 2IZ5A 5JZMA 4M86A 5J59A 1S4QA 3OCWA 1YZVA 2V9CA 2YYYA 2Y77A 2GCGA 4F04A 2ZWIA 3VNUA 1T1IA 4L6CA 3LSYA 3DV0B 4NSNA 1ZO8A 3T9FA 2RGNC 2VATA 2OL4A 3UJCA 3X1ZA 4CV3A 2F48A 1ZBQA 3NUQA 5EHXA 3DGFC 4XTZA 1G16A 1B8NA 3HY0A 3WLIA 1D6JA 1DFHA 1L4YA 1M2EA 2WU0A 3CKKA 1BHO1 2L42A 1Z7MA 1V37A 2JJ8A 5EJ4A 1S3IA 4NPHA 3UAZA 3KQLA 3EXG1 3OPXA 5FTMA 2FY8A 1B16A 5LD2C 3F7OA 1ZIYA 4EPYA 3WOVA 2O2IA 3W34A 4LXGA 1HWYA 3BRSA 1QGED 2CKMA 2IV7A 2GAAA 4NZYA 1Z7WA 2ZUCA 4NJOA 4UJ3A 3RARA 2IIPA 1DAIA 3ZTYA 4J0CA 1XZCA 2A92A 1PYSA 3ZCVA 1K66A 4GLFA 3Q7IA 3NIBA 1U2PA 3KJGA 3C6XA 2GF2A 2R6HA 3IE0A 3THYB 5DNWA 1GN8A 4XQ9A 3GT4A 2AF4C 3QPVA 4HRYA 1JIUA 2N1BA 1XDSA 3PFNA 4JL5A 3FCXA 2UYOA 4OCZA 3N6VA 3O8QA 3PSHA 2C4HA 4P72A 4ZQFA 2PGDA 3RUFA 3HXLA 3QV1A 3WNCA 5G41A 5F33A 2QPAA 5ILQA 2JL1A 4BFCA 1XKTA 1CSEE 4TQUS 4A0SA 1SKMA 1F06A 2WMNB 2P7IA 1TM7E 4FYIA 1PX2A 2EKDA 2ERXA 3VQVA 4L7VA 1QS0A 3BG5A 2JFNA 4R40A 4EZBA 3RC2A 2WU4A 5CK5A 3PRJA 1DX9A 1BMDA 3LCMA 2MTBA 4KXYA 2DTHA 2J3LA 1L5SA 1N7GA 3EZ2A 3UOWA 4ERNA 4C2BA 2W71A 1M1YB 4OTZA 2PQMA 3IPXA 4B8YA 3RH0A 1K9SA 1RI2A 2EJFA 4TZTA 1VYHA 4DJJA 2WVGA 3DAGA 3FNFA 3UW3A 4Z53A 1HT2E 4W7HA 3M6AA 4MVJD 1A8HA 3FDZB 1R9GA 3L7MA 4DLLA 5B6PA 5K1XA 2W4MA 5K8JB 1MN6A 1XTBA 4LBZA 4P8RA 3KOYA 4ZWNA 4C4PA 2OC9A 4WADA 1Z12A 3WWYA 1QAQA 1WB5A 3KE9A 4M21A 1I0LA 1NASA 2R2GA 5BT8A 4HGRA 4LF6B 1M73E 5FWNA 1TXGA 4FYJA 1E4VA 1Q22A 3CNBA 1NN5A 4MWZA 1FSPA 2P9BA 3NGMA 1CQIA 1CF2O 3V33A 5CTJA 3KQPA 4MV4A 3RJ5A 3DEZA 1HE1C 4ZI7A 1NMQA 2XYQA 1IQUA 3X1MA 1X7GA 4UUNA 1F14A 3NQ41 1JH8A 1WKVA 1QG2A 4QYSA 3ZWKA 2AHRA 4HNSA 4NYJR 5IXYA 1U8TA 3C3EA 1Z8HA 5DM1A 3SYMA 2BMAA 3AV3A 2FQWA 4DR2B 4HDCA 2VN8A 3O4HA 3QITA 1Q7CA 3I01A 3I53A 1CRWG 2LW7A 5AOBA 3NU1A 2PN1A 3WNDA 2KQUA 4YT5A 5EUBA 1V35A 5D7BA 4RE5A 3TRKA 3QEBZ 3DMDA 3UGQA 2C5EA 3WIOA 2DETA 4KQXA 4N40A 4OQFA 4JA2A 1EXDA 1R37A 2GZDA 4F45A 3LIIA 4X20B 1KMNA 1VPLA 3HXTA 3IVXA 3MRTA 1LVGA 3BZWA 3RJZA 1HDXA 3O9ZA 5DO9A 2O8EA 2M6KA 3RVSA 4C7VA 1T1EA 1NSFA 3IXMA 1G5PA 1M75A 2QE7A 4GRAA 1N5LA 1DIAA 4W5OA 1L5YA 4O59O 1JBKA 1NOJA 1GT6A 1YKGA 3P2MA 1OFGA 3MUEA 4HX5A 1GITA 3QFTA 3OZRA 4O2BB 1XXHA 1WVGA 3B8HA 4HH1A 4QTUB 4RZXA 5GIPE 3VKFA 1WW8A 1Y3HA 2R8PA 5AXBA 3FTNA 1YBHA 1Z4OA 1OXVA 1UBHS 5EQTA 3UOGA 5B3JA 1EQAA 3WGHA 1VHJA 4AKTA 2H06A 3Q5EA 3WMGA 3LUBA 4KBGA 3QWFA 4KGVA 1FRQA 3G2QA 3RKUA 1UJ6A 3JQCA 3B5JA 3QIVA 1S6YA 3W9UA 4LNHA 1QR6A 1VHLA 4MUXA 1FFWA 4YV2A 4NAHA 4P34A 5AQEA 2HSZA 2RE8A 4L78A 1KZ4A 4BJ3A 4EENA 3IBCA 3NAGA 1BOFA 2I6FA 5F23A 1XZAA 1M72A 3SXUA 4BTEA 4RH0A 4YRIA 1H8ED 2V8OA 4DUYB 2YRXA 3VYUB 3AF4A 1Q77A 4G36A 1N2JA 4R9VA 1W30A 2FPMA 3VPFA 4N39A 5BSEA 2ZB7A 3LSQA 1U31A 2XF2A 4ZVKA 3OICA 1K97A 2QLMA 3N0XA 4K2HA 2ZT7A 2F43B 1JBEA 2AMCB 4CCYA 3SZOA 2E49A 4MS4B 1NBMA 2O7QA 1I7LA 5JARA 4P86A 1XMVA 3QE4A 1GWNA 3DZJA 3GLTA 1E94E 4RSMA 2VJKA 2W6MA 3ZCXA 2B8WA 1M34B 1V47A 1ORWA 3BGIA 3OBBA 4X93A 4DCNA 3FPSA 5KNLA 4DY6A 1U99A 3SR4A 3HJFA 4ICIA 2FYKA 1DWPA 2HPVA 4H7JA 4LCBA 1AMUA 5HVNA 2QD3A 2I99A 2ES4A 2GAFA 1T3HA 2XQJA 4NESA 3KXPA 1E1RA 3OAAA 4IVPA 1FW6A 4RIIA 5IKXA 1SU8A 1FJ2A 2IBMA 1GNRA 3A58B 3B3FA 7YASA 4HADA 3TPFA 4HG2A 1GSAA 1QVWA 1UPFA 1AKNA 1O6ZA 4KJZA 5DHQA 5HQ3B 4NYIQ 1RR6A 1G6Q1 3A6FA 3IEXA 4XI9A 4Z2YA 5H16A 2GN9A 3NIDB 2IZ6A 4HD8A 2IV3A 2NTEA 4XM2A 4RTLA 4ZN6A 2XBMA 3BIWA 4TUYF 1ZDMA 4M0CA 1VE6A 4QDZA 2NYUA 2C42A 5C34B 3AF6A 3LF2A 4DSAA 2ZRHA 1C1XA 2IEZA 3NVAA 3BL8A 4IHQA 3ZHTA 4EHLA 1O94C 4HXYA 5IAAA 5KYWA 2D1SA 2ZI4A 4XGRA 3BA6A 3GZ4A 4ENTA 1RLMA 2Z0MA 5MDHA 2JK1A 2BMFA 2C8LA 4XFJA 3NBFA 4PCUA 2ZRQA 1B93A 5DP2A 3GPLA 4HDNA 1RBMA 3L1KA 1Z6YA 3RUPA 4W5TA 3AB3A 3EVBA 4BLPA 1T91A 4MKIA 4QPZA 3DVAB 1O9BA 2O2CA 3CUTA 2HAEA 2ZIOA 1B6SA 3IQWA 3MUFA 1E1YA 4F4FA 4EI2A 5E1OA 4EUFA 3PT9A 3BKXA 1I6LA 4P75C 1NLUA 2RHQA 2IXAA 2BUBA 1ZN2A 2DUJA 5T6BA 5A6SB 5LA6B 5IH7A 1Y42X 1YQTA 4WEOA 4EDFA 2BGWA 1G8HA 1RWWA 1WUTA 2O8FB 4MYUA 3VR3A 4LFCB 1E3DA 1JPNA 2HWKA 2Z6VA 5HIMA 1L4KA 1QONA 2GVDC 2GM3A 2PL5A 1Y1RA 3D6FA 4I5EA 3LECA 4PBRA 1JS1X 2HDWA 4PU0A 1PBTA 1FE8A 1ZG3A 1HYBA 2ZDGA 3HVKA 3LK7A 3WGZA 4CLOB 2KWIA 4EGJA 2HHCA 3BFXA 5AJXA 4X66B 1QM5A 2CMGA 4L9RA 4PC3A 4CODB 1I36A 2IEYA 1OREA 4YPFA 3WMFA 2ZJ8A 1JKIA 1FVXA 4H08A 2X6RA 1SB9A 2O3TA 3BGWA 2QT1A 4JZKA 5CNJA 1XK7A 3U49A 3URMA 1XTTA 2ODEA 3Q9LA 4FFLA 2XCTB 1YVEI 3AB8A 1UAAA 1WHSB 3WGJA 3E9IA 1KI9A 5JLJA 4K9OA 5BSUA 2DCUA 3EGCA 1QP8A 3GLUA 3MOSA 2NZVG 1ZJYA 3HFGA 5CDHA 3UBMA 1OWOA 1P6UA 4FFWA 3GRYA 2VC2B 3E9CA 1CEYA 1VE7A 1TCUA 4KN6A 3A0UA 3SQWA 2O5RA 1VQZA 3DE4X 2ET6A 1ABBA 4ID3A 1EHCA 3BHIA 5I6DA 1CUIA 5GM2A 5TMPA 3RUEA 4HN4B 4TL9A 4OMFG 1TYDE 3TTSA 1I24A 2NX2A 4MEJA 1B0AA 3I1YA 4NCNA 1WEKA 2R8RA 4CTMA 5JVDF 5JC8A 3PXDA 3T38A 2I76A 2IXDA 3T7RA 4NKRA 4EKEA 4HAVA 1MUUA 2WTXA 5AHOA 5KNBH 3H7AA 3QVXA 1S02A 3GCGA 2YHIB 3MMNA 4L6IA 1V1RA 6Q21A 1C4KA 4IRMA 3A4TA 3PNBA 4OMDA 2YHUA 2V97A 5BV2P 5A4MS 2P6NA 3MCTA 1QFMA 5BORA 5FUQA 2BKAA 4TL8A 5K3AA 2FR8C 2I33A 1RKVA 3VZQA 2V55B 4K8RB 4IO1A 1K5GA 4LXTA 5SY4A 1FRFS 2WINI 3EVZA 5BSWA 4TWIA 1WZ2A 1SWVA 3QY0A 1R8SA 2Q5EA 1AS3A 4HHEA 2GZ3A 2JEOA 4YNBA 4NYMR 1KR2A 2XE4A 2DFNA 5HG0A 4XUDA 1WPGA 4NZPA 1R4MB 1Q91A 3WJ2A 3ZZTA 2CB0A 5EIOA 1E0KA 1L7OA 1VG8A 1E6CA 4AICA 1I2DA 1NI3A 2ZQ5A 1M76A 2I6UA 3JARA 3PD7A 4C0QC 4NAVA 1WB9A 2NS6A 3IXQA 4KQEA 5JS1A 3BPSA 4JB0A 2CHFA 1HTTA 2ZR0A 1D5WA 1D1PA 1W49A 2F8TA 10MHA 3ILSA 2IGTA 4QOEA 5GOTA 1USVA 3WYGA 3WIVA 4Q3EA 2DHRA 1SK9A 4PYOA 5E6UB 1QIKA 2VF8A 4AUEA 1UBFA 1YFRA 4JP5A 4MJ7A 4G1FA 1PSWA 2EQBA 4ECAA 3UMCA 3D8BA 4EF6A 2C7QA 1KDOA 2V3VA 3K20A 5E6RA 2Y1DA 4PRKA 2YMMA 3U7FB 3BWDD 4L50A 1JJCA 2GPNA 1KC3A 4X54A 3RYIB 1BU8A 3KB8A 4C0HA 1DHRA 4H9GA 2BY4A 1O5TA 1RT9A 4CZ2A 4DN6A 5CLJA 5KTOA 1MFZA 2B4KA 3MUNA 3FD8A 4EHHA 2AMYA 1T5LA 1SXJA 2CJFA 3O74A 3EEBA 3PFWO 4FLEA 3IVRA 2Z8ZA 2BN4A 2ORVA 2VF2A 2ZJAA 3EXHC 3OECA 4DLBA 3UMBA 3ZY4A 2HK8A 1W7AA 2VYQA 2V7XA 2KE5A 4I4IA 4PWYA 2QZ9A 2YNMA 1W96A 3OQIB 2XUAA 2DX7A 3NBZC 5KZMB 2XODA 2W6QA 2A59A 2YBDA 2HSEA 4DOMA 2G8LA 1YAHA 2HJWA 2ZWPA 3JWHA 4W7IA 3C2QA 1GQFA 1PDOA 4TTSA 1U9IC 2G5TA 3DEFA 3FHTA 4FGJA 5EZQA 3RU9A 1L7DA 3AI3A 3VI3B 1ZM4A 3O26A 3LHFA 2Q3JA 5T8KA 4BE4A 4MDEA 3E9HA 4Y2HA 4Q93A 5F7JA 3WX0A 4Z1MD 5LWQA 1FVOA 1HZZA 4IV5A 4RLSA 3GUVA 3GFPA 5J2UB 3L4GB 4JOQA