3NETA

Crystal structure of histidyl-trna synthetase from nostoc sp. pcc 7120
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
456
structure length
431
Chain Sequence
KINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKGNQNIIYGLEPILEARALKFDQTVPLAAYIARHLNDLTFPFARYQMDVVFRGEFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIGDFVIRINNRKVLTGFFQSLNISETQIKSCISIIDNLEKIGEAKVKLELEKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRNLGVPDKRFCIDLAIARGLNYYTGTVYETTLIGHEALGSICSGGRYEELVGTFIGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNMQDELMPTYLKVSQQLRQAGLNVITNFEKRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGEQVEVAADLAEEIKRRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of histidyl-tRNA synthetase from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp. pcc 7120
molecule tags Ligase
molecule keywords Histidyl-tRNA synthetase
total genus 134
structure length 431
sequence length 456
chains with identical sequence B
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3netA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3netA02
3VQWA 4CS4A 1G51A 4P72C 4YCUA 4H2TA 4HVCA 3UGTA 4O2DA 4TWAA 3REXA 3RACA 4ZTZB 1H4VB 2ODRD 2Q7GA 5C53B 4TVAB 4H2XA 1X2HA 2ZTGA 4H2WA 4H2UA 2ARTA 4WJ4A 3WQZA 3LC0A 4H2XB 1HTTA 3DSQA 3A7UA 3HRKA 2FYKA 3RKWA 2Q5HA 2ZT8A 4HA8A 2ALYA 5F5WA 4KR2A 4RQFA 4K86A 1QF6A 2DVEA 2HNIA 4XTZA 3PCOB 3L1AA 3V8LA 1YFSA 3HXVA 2EWNA 3L4GB 3HFZA 2DDZA 3MF1A 4WF2A 4RDXA 2CJAA 3ERRA 3IG2A 1JJCB 3UH0A 1HC7A 1G5IA 2QHUA 4PG3A 1JJCA 2ALYB 3QTCA 1NNHA 3PCOA 2DEQA 4XU3A 4H2YA 2I4MA 2ZR2A 2ZZFA 5E3IA 1NJ6A 3HXUA 1B70A 4YRSA 2ARUA 1WU7A 4CS2A 4PHCA 2E3CA 2Q5IA 1ATIA 1HXDA 1YFTA 4OP0A 4YCVA 4BW9A 2LW7A 1KOGA 4OLFA 2E1HA 1NYRA 3RKXA 1WYDA 3BJUA 1V95A 3A5ZA 1USYC 4WJ3M 4EO4A 2PMFA 4XU0A 1NJ1A 4P73C 4YPFA 1SESA 3CMQA 3I7FA 1B8AA 3M4QA 1B7YB 1J5WA 2DXUA 3BFMA 4XTYA 3V7SA 1WPYA 3RUXA 2C7IA 3IKMB 4YCWA 2EJ9A 4H2SA 3VQYA 1ADYA 4H02A 4HWOA 3QO5A 2ZT5A 5C51B 2CJ9A 4UP8A 1EFWA 4UP9A 1E22A 4TQFA 4YDQA 4DQ2A 3A7RA 2DTIA 2ZR3A 4YRJA 3W3SA 3L2ZA 1C0AA 4G84A 3HXXA 3TEHB 4AH6A 2CJBA 2ZT7A 1X01A 4UP7A 2I4OA 4TVAA 3RKYA 4YRFA 1E1OA 5K1PA 2CGHA 3REUA 3TUPA 4Q15A 4RMFA 1KMNA 1FYFA 1YGBA 4XTUA 4KQEA 3VQXA 1X2GA 2DXTA 5ELOA 4X5OA 2DU5A 3IKLA 3P8TA 1YB3A 3NENA 1BIAA 1SERA 3RL6A 4CS3A 3MEYA 3UFGA 1NJ8A 1YFRA 2E10A 3VQVA 1PYSA 2AMCA 3MF2A 2E64A 1H4QA 1PYSB 2AMCB 4YRPA 4YREA 1L0WA 2ZIOA 2CIMA 3V7RA 4YRRA 2P0LA 2Q7HA 4J15A 2E65A 3IALA 3RGLA 1Z7MA 4YP0A 3UGQA 2ODRC 1B70B 1USYA 4YYEA 4XTWA 1IL2A 3OD1A 1X55A 2P5IA 2ZT6A 4LNSA 3HY0A 1EOVA 1WLEA 1EIYA 4P73A 4XU1A 2RHSA 3HRIA 3P8VA 1EIYB 4WI1A 3FJPA 4DPGA 2QHSA 2IY5A 3A31A 3A74A 2ZINA 4TQDA 4TVWA 2ZNJA 2ZNIA 4HWSA 3QO8A 3HFZB 3V7CA 2J3MA 2E5AA 1VQZA 2ZZEA 2EJGA 3HFVA 3KFUA 1KMMA 2AKWB 5ELNA 4K87A 3RIRA 1B7YA 1ADJA 1NJ2A 2DTHA 4ZTUB 2E41A 2Q7EA 2RHSB 1WQ7A 3ICAA 3HY1A 1EQRA 4EX5A 4XEMA 3VBBA 1H4SA 3P8YA 4HWPA 1QE0A 2XTIA 1NYQA 4YRMA 4TVYA 1NJ5A 3HXWA 4YRKA 2ZGWA 2EJFA 1SRYA 1X56A 3L4GA 1W66A 2RHQA 3HXZA 2ZZGA 2AKWA 3A7AA 3G1ZA 2J3LA 3QO7A 3LSQA 2I4NA 5KNNA 2RHQB 3V8KA 4H2VA 1GGMA 4L87A 4ZIBA 1ASZA 2DU7A 2DQ3A 4XTXA 4P3PA 4RQEA 1Z7NA 4Q6GA 4P3OA 1BBUA 2G4CA 1G5HA 4HWRA 1RIQA 2DZCA 2ZCEA 2ZXFA 2QHTA 4CH5A 4E51A 2DQ0A 4YRIA 3HTZA 2ZIMA 11ASA 4XEOA 1N9WA 5HGQA 2DZ9A 1EVKA 1LYLA 3PZCA 1WNLA 1ASYA 4YROA 3M4PA 4KR3A 1BBWA 1E24A 3V8JA 4CH4A 4YRQA 4YRNA 3HXYA 2DTOA 4YRLA 2DJZA 3LSSA 3NELA 4P3NA 12ASA 1SETA 2DKGA 5K1XA 3E9HA 4YRCA 4XTVA 4P71C 4P75A 2QHVA 1E1TA 1WQWA 4P74C 2XGTA 2EL9A 3RF1A 3EFRA 3A5YA 3TEHA 4YRTA 4CH6A 3EFSA 4G85A 3A32A 1X54A 4P75C 4TTVA 3R07A 4P71A 4UPAA 4CH3A 1H4TA 4P72A 2I4LA 4P74A 2EAYA 4XU2A 4BWAA 2ARSA 3E9IA 5C52B 4K88A 2IY5B 4HWTA 3NETA 4YRGA 1EVLA 2C8MA 1BIBA 2PMEA 3TEGA 1B76A 3NEMA 4NCXA 3QNEA
chains in the Genus database with same CATH superfamily
2HIMA 4K1XA 1T0IA 3VQWA 4GNKA 3QHPA 4PBRA 2GA8A 1JPVA 3RC7A 3O4FA 5IS2A 1JQLB 3TI7A 5C4MA 2N47A 2ZG6A 4NZZA 1YWGO 3K1TA 3AIOA 1EFUA 3HB5X 4MCIA 3T3EA 3U4AA 5LUBA 5BRJA 1X0XA 1H4VB 1M34E 2QR5A 3MUOA 3PGXA 1EFRA 2O3JA 4FFBA 4NBTA 4WZZA 5FNVA 1CUZA 3VYWA 1R8JA 2AQHA 1MR3F 4B76A 1F3LA 1F17A 1SXJD 3GC6A 4JC8A 3RBZA 1TKRA 4IUCS 5K01A 4UOQA 5AVOA 3UMJA 4CKCB 4H2WA 5IT5A 3ITKA 3EF0A 1FSZA 3BWXA 3M1LA 1XVIA 3FKSA 3JX9A 3P9QA 4FR5A 1ADFA 1BMDA 3P9RA 4EA9A 4PQRA 4MR9A 4MI9A 3ZOZA 1H2RS 1U90A 3BMXA 3HKDA 2R1VB 5JPCA 4MV4A 3RKWA 2ZJ2A 1Z0DA 4C7JA 2VJDA 1MO6A 4RFVA 4IWYA 5C7OO 2CD7A 1QF6A 2DVEA 4L4SA 4YB8A 5D6NA 3WZMA 4UAGA 3JAMA 2R11A 2CNBA 3W5VA 3QFTA 5I7RA 4OI2A 1GG9A 2NO4A 4HDRB 4KE6A 3KEGA 1C4KA 1SOWA 4NJMB 2DSTA 4C4XA 1NNEA 1BG6A 1IOZA 1N9ZA 4OX9B 4QTTB 4OV6B 1WAMA 3HZZA 4BMVA 3I8OA 3BS4A 2WG1A 3L4SO 4PYLA 5AM0A 1JTFA 4XX0A 2WHPA 5F2OA 1UT5A 4TLCA 4UXJA 5KTPA 3W9BA 1UJ5A 5JCZA 1AGYA 1IXSB 4M87A 3L8FA 5J5VA 1ZHHA 3OU7A 1BQEA 4QUAA 2V3WA 3EZYA 1UBEA 2YWDA 5JJLA 4QRDA 2QMUA 3WA6A 2JGLA 2A9JA 4BX8A 1BJKA 3FETA 4LYAA 4CTKA 4MGZR 5L9AA 3Q10A 2PT6A 4YC7A 5TVGA 1F8UA 5AVZA 1EWTA 1Z3CA 1GL3A 5FOXA 1SWWA 4EY3A 2X0DA 4R9VA 1EWVA 4KG7A 2BC9A 1NNHA 3I52A 4RKRA 2PN1A 4P5PA 4MDEA 3BXZA 2K2QB 1RR6A 1SELA 4U7GA 1S3GA 4NOKA 5G4KB 3O3NB 4HFRA 3SJ7A 3UOWA 3IVRA 3REGA 5B6PA 2A9VA 4N0EA 4I1YA 4CKBB 1PVDA 3DS8A 3SDBA 4HTFB 1AKQA 1UAGA 2VJAA 1N36B 4M55A 2O8EA 5FB3A 1L1FA 3ZGVA 2PUGA 4PZYA 5KDLA 1D2AA 3SSAA 4RPHA 4W5OA 2XCSB 3C3WA 4XR4A 4PHCA 2CZQA 4E5MA 3VAZA 5B30A 4OAOA 2OCLA 4EHBA 1ATIA 1DE0A 2QR2A 4XVQA 1SHLA 4Z2AA 1E32A 4F5WA 2FSVC 1FYEA 4JP8A 5H68A 3H99A 3DL2A 4H6PA 2QLLA 8ABPA 5MN4A 1XZQA 3N5KA 4PCUA 2F1JA 1Z62A 3HA2A 2Y67A 1FEZA 1WYDA 1B74A 1X0VA 3U44A 3KK0A 2ALJA 3BYZA 5J40A 5JBIA 2Z8ZA 5B55A 4CVNA 4Z0PA 5FBVB 1QTRA 1EVEA 1R4MA 2IY9A 1AQYA 3KSMA 3LYUA 4FU0A 3I9KA 5DCYA 1QCDA 2WJVA 3R1IA 5JJIA 5J5AA 1ZIYA 2WUVA 5AW9A 4MQFA 4FONA 5TQ2B 4BCBA 5DSXA 1EM8B 4KXUA 5LXTA 2X5JO 3FSGA 4DPKA 1JR3D 5CVDA 1TDJA 4HYTA 3IP3A 2JEOA 3TOCA 5K9ZA 1VRVA 4G56A 2UZ4A 2IPXA 4U2KA 1N6RA 3ZY2A 1G9TA 4C2BA 1V43A 3MLBA 4QD3A 4NG4A 1DHTA 5KQSA 3IUYA 5M34A 1JZSA 3H3JA 2VRNA 1Z6PA 5B1HA 3LKDA 5FT9A 1WKCA 4Z86A 4BXOB 2QPOA 1IN4A 4HDSB 1MTZA 2GEDA 1FOEB 1FQJA 1L7AA 2HGZA 2O2GA 2RBEA 5D7NA 3DOJA 1A8UA 5HIIA 4QQNA 2CD9A 1DC4A 3B53X 2QPTA 3HL0A 3O9MA 4PFJA 2ZJAA 5E4TA 1VJ1A 1X2BA 1Y4DE 2IE8A 3EC7A 4RKEA 4D44A 4H15A 3DJFA 5CFZA 1FFYA 4IO1A 5ICFA 3IAAA 4OUDA 2F8SA 1E1RD 3BFPA 1ZCAA 2O8NA 4TQFA 4P0PB 1BVHA 2NQTA 5IH3A 2XRYA 1D04A 1T1EA 3DMTC 2ZR3A 3VPXA 1XZAA 5B6IA 5IM4A 1I2BA 1LDGA 3CZAA 4KN8A 3ZCRA 4ZCPA 3VJRA 2BKXA 3Q5EA 1TQ6A 3H19A 4ZVKA 3NFRA 2VSNA 3A10A 5JH7A 5BN5A 5HG0A 1H2YA 3M2TA 3T41A 3RC1A 3T4UA 4TSFD 1PYDA 3E23A 1Z2CA 2BH9A 1PZMA 1XTIA 2GSDA 1SNYA 2AZ4A 3KIPA 3JQ8A 5DEOA 1CUYA 3DWEX 2LZ0A 3B38A 3GOQA 3AVPA 4DGSA 4J1QA 4Z7OB 4Y9DA 3QU2A 1T9HA 4K3VA 1MXHA 2IUTA 3IV9A 3S5UA 1O5IA 2F3QA 1TQHA 1H0HA 1O5OA 3LLMA 3TNYA 4KRFA 2I33A 2O7VA 3NEYA 1ZK1A 2HBQA 4IOLA 3QPDA 2Q7OE 1PR1A 2X7JA 3LXRA 4C7OA 2QRMA 2B98A 3MN1A 1R64A 2I2WA 3W9SA 4N5HX 5EKXA 1TEVA 2LD4A 2CBZA 2PD4A 3HU5A 2D0IA 2XAAA 4UHJA 3UJ8A 3KOWA 1QH8A 3Q8WA 3V4RA 4PONA 4RK4A 3PNKA 3LUGA 1GZ5A 1CJSA 4MHOA 4KITB 3JQDA 2NVUA 3TUPA 4BNFA 1VKJA 2E3JA 3OQIA 3SIWA 1C7ZA 4WFIA 3X2SA 2VJCA 3JAWB 4O2BA 5K0NA 1U2DC 3OOJA 1LRKA 3EGXA 3MGCA 2LKCA 3TQCA 3N1UA 3S1LA 3LXXA 4FUQA 4ZN6A 1MC5A 4BVEA 3HYCA 3ZGZA 1HSZA 4BTLA 1MB0A 3SFVA 1Y1PA 1UC8A 1XWWA 4TOIA 5JAOA 4MIKA 5LWHA 4J91A 1YI0A 2L0XA 5ALKA 1SBYA 3NHPA 1X2EA 1KGSA 3DL7A 3MELA 2DCUA 5SZKB 4IHQA 1UBGA 4MI6A 3B7PA 3IE0A 2ABWA 1K6XA 1EG2A 4WE3A 3CH4B 2IHVA 1ZK4A 3F8WA 2FSPA 4ZXFA 5JI3E 1I7QB 4A10A 2JIMA 2KSQA 4B75A 3VHXA 5AQ1A 5I7EA 4TMVA 821PA 3SVTA 1SC3A 1X8KA 3L8GA 3B3GA 3ITNA 4FE3A 2Y3IA 3B9PA 4G8CA 3AEUA 2VT6A 3PL1A 3RYTC 4ARAA 3I5XA 2ACEA 3EZFA 1DARA 1OYOA 4IHAA 4MUFA 4JLMA 5TEWA 3OQIB 2FFHA 3WQRA 5H5JA 1TM1E 3VR6H 3OQPA 4A27A 1O2DA 4BFCA 4LXXA 1RACA 4FGKA 4U9UA 4FCTA 4V0LA 4D9NA 4ZIRB 5ARBA 3VDNB 1EUYA 4N8EA 3ULKA 3KOXA 4OHRA 3UXEA 2Q7HA 4LMBA 1BA2A 3SR4A 4LXTA 4J15A 5K0GA 2J9YB 2R6ZA 3IALA 2C3PA 3IMFA 1MAUA 1CRLA 4DSUA 4F92B 3AIMA 5KYWA 4DA4A 1PJTA 2AWNA 4B6QA 1PFUA 1ZL0A 1YZGA 3L0YA 3N8IA 3WDLA 5IJ9B 2G9UA 3PFCA 4CTJA 4EEXA 2AYZA 2N1BA 4FMPA 4EKNB 3KZMA 4GHWA 2VXYA 2PSEA 2E21A 1V5FA 3BE5A 1VMEA 1K4YA 1NLYA 1XWFA 2X0EA 3TNLA 1HZJA 4P4NA 3VU3A 4I4NA 2O48X 2VF7A 3L8HA 1Y0BA 2HZBA 1OR8A 1T5BA 1NE7A 2IYEA 4R2WA 1YA6A 1K4KA 2GN6A 1KPHA 3DOEA 3AERA 3AINA 1V8PA 3I9LA 5C8YF 2WAAA 5KU7A 4ARZB 4UREA 3M3PA 2EJCA 1LWOA 3D6FA 1YVUA 3H3XA 4EMBA 5JXJA 2VJBA 3KOZA 5AHXA 1P80A 4H6VA 5CJ2A 1KDVA 1R4NB 3F6CA 5DCUA 1EFHA 2J30A 3ICOA 3ZWXA 1UBMS 3GFVA 5KJFA 1YAHA 1G8FA 1J06A 4K2HA 2QLBA 1QYDA 3MT0A 3SLRA 4ZDWA 3RYIA 4HGNA 1USWA 3OJXA 5FBWB 1T10A 1ZLXA 4EVIA 5DHAA 4F45A 4WBNF 4ZPJA 4MP6A 4Z0HO 5IJ9A 4B4WA 2WINI 5B12A 1A95A 2KB0A 4WL0A 3D2LA 2X8BA 4JBYA 4DPMA 5ELNA 5BR1A 2WM3A 3PIIA 1JHQA 3ZVKA 1E62A 1G17A 3EGOA 1NNUA 1RQNA 1HA3A 3GPDG 4L5JA 1ZCJA 5FBRB 3UJNA 5BPHA 3O8NA 5IAKA 2I9KA 4W5JA 3A6FA 1GZSA 4B6RA 1RKQA 4NOMA 5FUYA 2ZP1A 4NKRA 5U4QA 1P60A 3JW8A 3IMKA 2K7ZA 3O8OA 4BMDA 1YU9A 2GSWA 1OAOA 1U2TA 3EWNA 3O1IC 3G9XA 1EQRA 2GJSA 5CLFA 1A9TA 5IRCD 5JSZA 5I48A 4L28A 3DPUA 1BO6A 3P20A 4F3RA 1FQWA 4QEZA 2CEAA 4BP9A 5KYUA 1N7GA 4O3FA 3JZFA 3OQ1A 4BU0A 2ODTX 1BVUA 3F6SA 4YIHA 2WICA 5FPPA 4CQLA 2LCIA 1OBCA 1XJCA 3ZZMA 1OIWA 2V97A 5BW6B 1JJBA 3LHKA 4ERNA 5E7QA 1FFCA 3PVSA 3KJZA 3LZCA 2BYTA 4QQKA 3QO7A 1IMOA 4FHDA 2I2DA 2BFCA 4KRYA 2CXRA 1M6VA 4LXHA 2YV1A 4V2IA 3FPKA 2NAPA 4DR6B 5CDSA 1Q2XA 3OOYA 4CYMA 2V7QA 1M8GA 3RSSA 5TNXA 3UEOA 1AIPA 2PSJA 4BMCA 4EG4A 2A5YB 3PKIA 3CR3C 3IT2A 2AT1A 3O8OB 1PS0A 2UUBB 3SDZA 5FOQA 2R87A 2WV9A 2X0IA 4ZVVA 3DD5A 1V2GA 4MS4A 1R27A 1T4CA 1L4HA 2MHCA 2V45A 2FN9A 4WNYA 5ANRB 3GLGA 1O0CA 1KAEA 1W4RA 1RIQA 5H8WA 2X2PA 1GU7A 3T12A 3ZS9A 1QP7A 3RKUA 2ZXFA 3O73A 4CLHA 4J1TC 3D0OA 1W96A 3JQRA 1UJCA 1C0LA 1GA1A 4XVRA 2I4TA 5IJAA 2REXB 4CNQA 1NZFA 2DQ0A 4YRIA 2Q2OA 4LHEA 2EL7A 2O6HA 4FGUA 3HU1A 5FIUA 3GD7A 3OM8A 1UINA 1TRHA 3N6VA 3EC2A 2ECOA 3BUSA 3GROA 3V7FA 3IAUA 4L85A 1D6SA 2W6PA 4ZYYA 1W35A 4Z4EA 3C45A 2GXAA 1CP3A 1SD2A 4JUDX 3LX5A 4TQAA 2H9AA 4FNAA 3SC4A 3CZ5A 2F9MA 5LCXA 6NULA 3DKIA 1EMDA 4MHTA 3E27A 2ZBDA 4FHEA 5BQOA 3N8GA 1F5SA 1UBTS 1VP9A 4OGLA 2BI4A 4URYR 4DG5A 4ZMRA 1Y3DE 3KOYA 4IIVA 4REMA 4B0OA 1QC5B 2H4JA 4IKPA 4JVNA 4JIGA 4L73A 3HLYA 1GFIA 3IPLA 4PBSA 2GCEA 5KI6A 4C22A 4ZYXA 4TKVB 1PD0A 5ALRA 2RBKA 3LSSA 4XJXA 5F9MA 4MXDA 5GGXA 3NVKI 1HZZA 3C8DA 621PA 3HDQA 1S1MA 3U7QA 3EULA 2ZU0C 5FWXB 5B36A 1NKTA 4LC1A 4RMNA 5IF3A 4OKNA 1PFKA 2QE6A 4GMXA 4HS4A 3T3OA 1XLVA 4GI7A 4PBTA 5DPMA 1GD1O 1KGDA 1FB5A 2QVYX 1OBOA 1Z83A 1NXSA 3OMWA 5FNVF 3SSOA 5HR5A 2BMEA 3JATA 2C1ZA 5AHWA 3WTBA 4TLMB 2O2XA 2V1UA 2HK9A 2CF6A 4TTJA 4CFZA 1SKBA 4KI7A 1E3LA 1DKMA 2H5LA 3NOVA 1ECCA 3HUEA 5I7WA 4CH6A 5K3EA 1D6NA 3OG9A 2NN3C 4I08A 1XTZA 4QM6A 4CMEC 5ICSA 5BR7A 1XKQA 2VK1A 3AI3A 5LZ4A 1W1WA 4L51A 5E4FA 4HJRA 3R07A 3U4IA 1B43A 2XYHA 3TTSA 3NDJA 4KGVA 1W0JD 4PSAA 3L79A 4U5XA 5GOTA 1PLKA 1X7XA 2W6ZA 4TM8A 4K6HA 3NV7A 4ZGWA 4DAOA 1NLMA 3FY4A 3N59A 4A0HA 4KXLA 3DE5X 4TN5A 4DMCA 4FUTA 4JQYA 4XPIA 4NDNE 1L6RA 1CUEA 2OHXA 3O4GA 1T8RA 4R2IA 4FILA 1NVFA 3HBFA 2HEGA 2RHDA 2ZYGA 2C3OA 1CUWA 1V3TA 2IGBA 1SBQA 3E7XA 3GB9A 2I34A 3AW8A 3IR7A 4V0KA 3WLLA 3F5DA 3VZCA 3GUCA 2BBTA 5H70A 3LFTA 3R5HA 1JIJA 4N65A 3TQSA 2FA9A 1MMFB 4IQ0A 1SC6A 1A4RA 4GR5A 1RWNA 3EASA 2I2XB 4YCBA 3VVLA 3IHWA 1B76A 2BFBB 3HSKA 4WK2B 1C1HA 1TVKB 2VPZA 1YT5A 3Q5DA 5AWFC 4HXEB 4HV4A 4PSDA 4OMDA 1IVNA 3UWSA 3GRUA 1EGVB 1G3UA 1R0RE 1XZMA 1Z73A 2OZPA 1B0PA 3ODGA 1XKLA 3Q3HA 5EVCA 3H5WA 4EEKA 3W5CA 1GIAA 1W76A 3NBMA 1IUKA 5ENVA 5ICGA 1EFLA 4E15A 1DQZA 3DTTA 2UXBB 3T5PA 4TTAA 5AKYA 1KE1A 3EZ7A 3AFOA 3FCUB 3RS2A 5AVUA 4EY4A 1E94E 1YCFA 5GM1A 1UBLS 3Q2KA 1LA2A 13PKA 3JZDA 2B25A 4MPPA 4ZRNA 4H2XB 1KK1A 4A16A 4AXBA 1IBLB 1HUQA 1Q1NA 4D9IA 1LLUA 3AB3A 2G09A 2WQZA 1KH3A 5JMTA 2HTEA 1J2UA 3I76A 4TMYA 4BPRA 3JASA 2PANA 4N49A 1NVTA 4CI0B 5KYUB 1X7HA 1POXA 3INYA 5ECDA 3JALB 3LZ6A 1XEAA 2WM9B 3EGEA 1AM4D 4ZHQA 2GH1A 3HFRA 3L6EA 3QUAA 4GP6A 4XE5A 1MPTA 3GA0A 5E1MA 1TO6A 3CX8A 2YWEA 4MQ4A 3ROGA 2PUJA 4X1IA 2EFEB 1KRWA 2VLBA 3KWLA 4ZCTA 1AUPA 1RC1A 2X6QA 5TJHA 1NXXA 4TL9A 4G41A 1SUDA 1UZAA 2PLRA 5F77A 2DTDA 3VPSA 4WLNA 2JFGA 4RDXA 1IRXA 1FU7A 3HXQA 4YLEA 1OXBB 3RR2A 3P7MA 1U0TA 4AJNA 2HL6A 2QUJA 3H11B 1BFUA 1TM7E 3PQ2A 1UZUA 4DREA 3IRUA 4LJKA 1TQ2A 3JASB 2RBGA 2QX6A 4J0FA 4M1TA 5AUOB 5JQWA 2EARA 1JR3A 1YIDA 4D4MA 2GZSA 3O31A 3U3OA 4ZYUA 3L41A 4F9GA 3H9CA 4ZQBA 5EWMB 2PXAA 2JDIA 2JLCA 2Q2NA 4GPTA 2WSBA 3JQGB 1Z4JA 3RVQA 3TUJC 4COKA 2PX5A 4QZVA 5F23A 1XCPA 3NC1C 3OEYA 2SKEA 4FWTA 3CH5A 2CBXA 4FWBA 5JFOA 3CW9A 3KJGA 2EGUA 4WN9A 1AZSC 1ZC3A 1QMGA 1BWQA 2EBUA 3T7SA 4U9IS 5EGSA 2E3CA 1L4YA 2FPUA 2IZ7A 2PKEA 1P1JA 4GM4A 3P5SA 4JB0A 1NRIA 4NNOA 4OHXA 2Z5LA 3KTAA 4QDZA 4AJIA 3QTLA 4ZQIA 1XRPA 4WXEA 4RF4A 2LW7A 1E3QA 4EKGA 2BMJA 3NLLA 4JHXA 1QZ3A 1OVMA 1XYVA 4MS3B 5FCDA 2R7LA 2WUWE 2EDAA 3AL2A 3EVBA 1EVIA 3O3CA 3OO1A 4KBFA 2XT9A 3CM0A 3SXJA 3T9FA 5JNVA 2HA5A 5J1TB 1USYC 1DTWB 2IUEA 1YBHA 3IQDB 1KH2A 1YNSA 2VZEA 4O4IB 4C21A 4YMUA 4WJ3M 5FTMA 4GOOD 4PLCA 4US2R 3I01A 4OIFA 1QVWA 4R9RA 2ONZA 3QE4A 4M7RA 4E5PA 4BO1A 4BE4A 1V0JA 2V3VA 2HSDA 3HEMA 3MUEA 4HI0E 5EQJB 4DQKA 2RC6A 4YPFA 3BX1A 2NLOA 4FEEA 3MAAC 4E5NA 2O2CA 3BXHA 3C4JA 2Q3DA 5JDCC 3RM3A 3VO8A 5HX7A 4IIJF 1UK6A 4H18A 4Z4HA 1GPKA 4CEJA 1E2DA 4RFSB 1E9DA 3NNSA 1NR5A 3AF1A 4LMAA 4QXAA 3PTZA 3ENKA 2AVNA 4X7MA 5E7MA 2EAUA 3FPCA 4KK3A 2E6KA 5IARA 3TEFA 1ID1A 1MA3A 1QO0A 2HSGA 3E18A 3NBQA 3BIFA 3QYPA 5KHOC 3WKAA 2IZZA 5D1HA 3PQCA 3PWTA 1WWKA 2V7VA 3FMVA 1CVIA 1JHPA 2GN4A 4LJAA 4ZP1A 1ABFA 4D6XA 4H2SA 2WWWA 1NC1A 2BTQA 2XSZA 4JUFA 1IRIA 4KLAA 1OLOA 2GJAA 1KSHA 1ZRNA 4NH4A 2JVJA 4BZPA 1V71A 4GWGA 1U1FA 2WSLA 3NXKA 3QVUA 5D5PA 3F7OA 3OIDA 1S8OA 4MYSA 5B3KA 1HQDA 3VYRB 3V32A 3AB8A 2FP3A 3HVRA 4L15A 3HCAA 2LWIA 1A7JA 1F0KA 5DNUA 5AI9A 4JSTA 4Q4JA 4LYEA 3ILVA 1CF2O 5ALDA 1CZNA 5HKBA 4WCFB 4V24A 3I30X 4FCVA 1KP2A 3RT1A 4IOKA 1IM8A 1V11A 3FMIA 1WG8A 4FLEA 4RABA 3OQVA 3VZSA 3K32A 1HX7A 4UVIA 2AV6A 3V8RA 4F4DA 1OWNA 2GK7A 4NARA 3NWEA 4A92A 4Z7JA 4RA9B 1I14A 2QTBA 2J09A 4I4TB 4Y1EA 1HFWA 1Y1SA 3K96A 5AW5A 3BH7A 3Q3VA 5IVHA 2HYIC 3B2EA 2GK6A 2VP3A 4LNUA 5I9LA 2ZIXA 1CYDA 3F5MA 3CRNA 1KO5A 3ZCSA 3JAKB 1FSFA 4Z3DA 4G84A 1ZITA 3HXXA 1XAGA 2FNAA 3PCTA 2X1HA 1J1IA 1AMUA 4MV5A 1BS2A 5I9BA 5FPTA 2GKGA 4EDHA 1N34B 2CWDA 2MSEB 3B8EA 3W2FA 2G07A 1RAGA 1A7KA 2I4RA 4B43A 3K09A 3VDQA 2I29A 1ZZGA 3NQ41 5HM6A 3EJ6A 4CKEA 1OD6A 1UJ2A 2R4UA 4EJSA 2XTMA 1Q3TA 2BZ0A 1GCGA 1QO0D 4C0SA 1DKOA 1OUMA 1JG4A 3BXGA 3NIDB 4CCSA 4IIBA 3ZTTA 3CZRA 3NALA 1L5LA 1C0PA 1FYFA 2I3DA 3R6TA 3WL5A 4DRXB 1O9HA 4A6EA 3UFXA 2O06A 3PHIA 4X5OA 2VEOA 5IC6A 3QOYA 4PLWA 1YB7A 1UWVA 4ZEOA 4TWZA 3C7CB 1ZD3A 5AKJA 4YT8A 1I8TA 3DLAA 5JMWA 3QBDA 4HGQA 4YJHB 1S6YA 4Y2RA 3G2IA 4AP6A 5HSGA 1BIAA 2C0QA 5JQGB 1RJGA 1YSCA 3FWNA 5K51A 4CS3A 3DZKA 4F3KA 1W19A 1UKVY 4QATA 4F21A 4OXKA 5G41A 2AJTA 5J5CA 4FJ1A 4W4TA 2G5PA 1M6YA 1XU7A 4ZEVA 1PZGA 4O2AB 5JXHA 1MRNA 1YRLA 1FTGA 4PRYA 1ZMRA 3KJEA 2OXIA 3Q0TA 3GNLA 2HQ1A 3F6EX 5ALTA 2J6HA 1O6BA 4CBVA 1UADA 6Q21A 3J7AC 3TVYA 1SU6A 4D80A 2Y1GA 4UDXX 5D5QA 5CFOA 2LCFA 1VXOA 4TMWA 2ZQ5A 3DZCA 4BMOB 3BSYA 1ODIA 3K5HA 4S0ZA 1P1KA 2V7XA 4BN0A 4U63A 2W6JD 3PD0A 2DE0X 3MCZA 4WBXC 1AQ6A 5DM0A 3ZR4B 1Q83A 2CV0A 1G7SA 1HT1E 1A5AB 4YDHB 1ZIOA 4PO8A 2WAYA 3UJHA 5IBQA 2HDHA 3N2NA 3PQFA 3ZH9B 3L4EA 5DM60 4Q66C 5CM8B 4FB5A 1ZKMA 1MVNA 2R8XA 5I9NA 5ISMA 1CZUA 2OCKA 4PAQA 1OA0A 1P1HA 3KTAB 4AG3A 2OC9A 2GZAA 1WEKA 3GWGA 3R5JA 5A0FA 2WP0A 5H81A 2P0YA 2P1DA 3ZI7A 1E58A 1E66A 4J90A 4RANA 5AK5A 4HMOA 4IRUB 3EFHA 3O83A 2A1UA 3RAPR 3FRJA 4HWGA 4NI5A 4OHPA 1SBIA 3FJPA 3QKIA 2Q8QA 4XDGA 2NP7A 2C83A 1YULA 4BY9E 2C7VA 4D9BA 4M1EA 4XYEA 3R0JA 2FUCA 4A0SA 3UYKA 1SKYB 2Q3EA 3FHCB 3QVMA 3OVMA 4G8DA 2OSVA 1PT7A 3AETB 2JI7A 2WMOB 2A9KA 1Y89A 4HT3B 4ARCA 5B7NA 3QQ5A 5HFAA 2E5AA 4B9EA 5DYGA 1QFSA 1F9AA 2YHUA 2IF0A 2YMLA 4MARA 2OXTA 4CEJB 4FN4A 4X44A 2YS6A 3TUZC 2HCRA 3II6X 4G1VA 4LXGA 1P74A 3FKJA 3KE8A 4CM1A 1USKA 3UA3A 3A6PC 3NYQA 2AOTB 2IX3A 2IW1A 2VAXA 3UC5A 3ZNOA 3AY6A 5K3BA 3OIGA 3R44A 1CDZA 3CGWA 3UMYA 1P19A 2HPZA 4I1PA 1XELA 2R8PA 3CUTA 5H83A 4LTMA 2R7MA 3WWYA 5BMVB 5ITZA 2IOFK 1E9AA 2I80A 3KKOA 3DT9A 4LFAB 3HY1A 1ZONA 1RAHA 4HDNB 3P2YA 4L74A 5K0JA 2HN9A 4FR2A 1QR6A 1RYYA 1ESMA 1PK9A 4G3XA 1VHTA 5JSZB 3KQYA 2F9LA 3HNPA 2J9FB 4QJ4A 1XD9A 3WGJA 5I5GA 2AG1A 5LMNB 3RUIA 1SRYA 3G2JA 3ZZNA 1BXRB 1A4UA 1EFPA 3HXZA 1TF7A 1ZNQO 2JASA 3GEEA 3ISJA 3CXRA 2VVTA 2J3LA 2ZYHA 5EI5A 2DT5A 5KTOA 2EZ8A 1TLLA 1OGJA 2H8GA 1OX4A 3VSAA 3HTXA 3V8KA 1XDBA 3OZEA 3PC3A 4MW9A 5JJ5A 3FFWA 3WY9A 1UPFA 4M7OA 1X42A 1DBPA 4WBSA 2P6MA 2XUKA 5THQA 4YLYA 1L8OA 3ZGXA 3G82C 4M1ZA 2GAAA 5DRTA 3MOIA 4MJXA 5MGBA 5BP7A 2ZUFA 4R8KA 3VSBA 2WWXA 4US0R 1RZUA 1ECJA 1K9SA 4JLWA 3KCQA 2J3JA 3HKEA 4NPAA 4HPXB 2D7CA 3MB5A 3IAS6 5IUNC 4JI5B 1UZNA 5GPBA 3SXPA 1FSSA 1PAUA 1T3TA 1XA3A 2HQRA 3AB7A 3EBLA 3NBFA 1YMVA 4CHGA 4ZJUA 3LWDA 2B36A 3E5HA 1D5CA 3JPWA 4JUAA 5D1NA 5CDFA 4DCMA 2IDMA 3CLRC 4AKGA 4R9UC 1EFVA 2V5UA 1DKUA 3A4TA 1ZG3A 4X63A 5JEEA 1M72A 3A3NA 3QBEA 5EIHA 3HTZA 2GWHA 1GPWB 3PD1A 4JY7A 4LXUA 1WRBA 3LUPA 1N9WA 1W4LA 2CLFB 3CWZA 3EOAI 4QHTA 1RLIA 4X3CA 2QUBA 4ND1A 3DE2X 5J58A 4IQ4A 5SV2A 1OXVA 1NPTO 2EKPA 3H1BA 2PUEA 5LOVB 2Z3VA 5JXGA 4YHHB 3IAEA 1PNRA 4PEVA 1H22A 5LIPA 2C7PA 1GNPA 4PAWA 1E0AA 4OJNA 3GBVA 2ZI3A 2GA9A 4XEUA 5E1DA 3TVTA 1SVLA 1BBWA 1Z17A 2RARA 2ZUSA 3RJMA 5AKLA 3KQTA 1YRAA 4YIKA 3K9FC 4WKCA 5J2TB 3VC2A 5CG2A 2Z95A 3A1WA 2GUGA 3IC5A 1PKXA 4LHVA 2F1OA 2GJ4A 4YRLA 2JVKA 2OO5C 4C6RA 4CF6A 4E2ZA 3MJCA 4L5YA 4LJ4A 2VRCD 3LTNC 3WWEA 1QOPB 4DSOA 3NELA 2A5GA 1KQ3A 3FN4A 3JZMA 1T8SA 4HZUB 5A0TA 1WM1A 3F5SA 5CNMA 3REQB 3T95A 1RXSA 2BKAA 4JQSA 5CA0A 4YRCA 5IKMA 5H7XA 1AXRA 5KWVA 2JGJA 5G3YA 4M7WA 3MWEA 5EP4A 3X0DA 4B3HA 4EBFA 4PFKA 1Q0RA 5A3RA 4WSOA 5LQKA 3ASYA 4HMPA 1QHIA 3AM1A 5KTKA 3Q87B 1JF8A 3D7LA 5DP2A 5HTOA 1USUA 1E7SA 4LGCA 4P74C 1DEAA 1TCCA 1BFKA 3HNRA 2EEZA 1X7YA 2NSHA 5AM4A 1GAEO 1L3BA 2P41A 4NU0A 1EFCA 1VGVA 1USIA 2SKDA 3BH6A 3F6PA 1DT5A 4Q3BA 1O97C 5GOZA 1N33B 1V7QA 4ND3A 1QS0B 4X6YA 3PXAA 1M0WA 2BM8A 4Z9FA 3TLXA 3SR0A 3B82A 4LHZA 4R2XA 4J0KA 5T57A 3L7KA 1NQVA 1X54A 1NATA 1Q0LA 2DPGA 3VGJA 5CP8A 2FHSA 1UMCA 1CCWA 1IUPA 4E7PA 4IIJA 2FSIA 2YWCA 2O8CA 1V1RA 2VN8A 1YH3A 3K0AB 1L7DA 2DUNA 1BD3A 1SUAA 2OEPA 4KBYA 3HP7A 3GRCA 4GZLA 2IPMA 1E6WA 1XXHB 2QN9A 2V6MA 1N1MA 4S35A 4S2EA 5E38A 1NTRA 2QX9A 4B82A 1VBKA 1DPFA 4EVRA 2RAPA 1KHTA 1TNDA 1NMSA 1YS7A 3DOFA 1QZZA 3G5MA 4P9NA 1TTQB 2RDMA 3EUAA 5H3HA 1MC1A 4HP8A 3UKDA 4C5CA 3F49S 2G17A 5BWLA 1ZM9A 2B6NA 4HQFA 4EM6A 2WG0A 4YJFA 3EZ9A 4HB0A 3TLKA 1M0EA 3RRXA 1JWLA 2YWJA 1YR1A 3SR3A 5DHSA 1NQOA 1J56A 2L18A 2VNJA 1XHEA 1GEGA 1J0EA 1KMQA 1VLZA 2I1WA 2Q0SA 3B2NA 1N5LA 1XQXA 1TJPB 2YN4A 3GA5A 3KT8A 1YZ3A 4IIUA 2PBZA 2VWGA 4MO9A 4EHKA 4U39A 2C1XA 4RIHA 2WUDA 3SSMA 1COWD 4B5KA 3GZTB 1KQOA 2C97A 1PR0A 3EF1A 2BFBA 3NUZA 1L0BA 2WPDD 3NT4A 5DX8A 3REOA 3VI4B 3ZEAA 5TLSA 4MP8A 5CEEA 4MHSA 2R68A 2BEKA 1Y4ZA 1I10A 2JAOA 2VC2B 2M2IA 2YXNA 4N03A 4QBKA 3P0RA 4HDMB 4UUAA 5ALFA 3USES 4G0XA 2GX6A 3PLNA 4MRRA 4TVOA 5DI3A 3K0KA 2EX1A 5JADA 3UGJA 2AOVA 3NDBB 3W2GA 1E20A 4GNRA 4TWJA 2UVPB 3RS9A 2A86A 3CXUA 1WBJB 2A2ZA 5JSHA 1H69A 2IU3A 3BIOA 1L4FA 2RJ3A 3D4BA 1NWHA 4HDNA 2F55A 3FTEA 3R7DA 5BWOA 5CK4A 4QOIA 1PHPA 2NT3A 2QHXA 3G2MA 3PFIA 1YRBA 2JFFA 1HDIA 4K86A 4QOJA 4DIMA 5IHXA 2OQIA 1F1JA 2HO5A 3P0JA 3WHIA 4N7BA 2MMGA 4XCQA 3S2EA 2LV8A 1YFSA 1E4EA 1TT5A 4QARA 1BWRA 5INTA 2FR8C 2DFKB 1JA9A 1EFPB 4KIJA 4AM8A 5CLIA 3I6QA 3ZY3A 2P90A 3HB0A 3DBVO 1BHJA 4C7VA 1FW6A 1XZDA 3N5CA 2ZWMA 1B23P 3H4TA 1NBMA 2NPIA 2YR0A 3B36A 4M0PA 5CDHA 1FDSA 1ZU4A 5FJIA 4M83A 4OA8A 1DC5A 2HK8A 4TMTA 5DGXA 4JJ4A 1XJQA 3OUUA 2A57A 3PC6A 3U3XA 4G5FA 1C9YA 1FVFA 1NP7A 1F2VA 4DG9A 1EM6A 5HILA 3OP1A 3BEDA 3E5NA 2RGYA 1G5IA 1S2MA 2BGWA 2D0OB 3AL3A 2Q5FA 3G6KA 4B3JA 4PG3A 1E7RA 2MYTA 4KPFC 1GLNA 3P2MA 1JRLA 2JZNA 3WLOA 3MQ2A 1MD9A 3SEFA 3HG7A 2GBPA 4DA8A 1SVNA 1X1EA 2ENWA 3PCOA 1ITZA 1PL6A 3L7DA 1BKYA 5CX4A 3D7RA 1EFVB 2UYHA 1E89A 3I5UA 1MUUA 4FXPA 3A2MA 5AI5A 1XX6A 2HV8A 1MV5A 4OYRA 5IAOA 1Z63A 1RAEA 3GLGE 2JA1A 2VJOA 2R7KA 2JRCA 3N0RA 4B40A 3R3SA 1MC4A 1BWPA 2OY0A 2P3SA 4MR7A 5F1PA 5KTTA 1NSTA 2WHPB 2WKSA 3EEYA 3MRXA 3K31A 4LVCA 4NCAA 5LYJB 4E22A 1SVIA 1S02A 5FX2A 2CK3D 3EXIA 3QEJA 3ITDA 2ZWVA 3IE1A 3HDTA 1YUMA 3AKYA 3BH0A 5LJLA 3KWJA 2B3DA 4NZOA 3E5RA 3UJ3X 1MG0A 3I9V6 4B3FX 1DFHA 5ALPA 3TSZA 2A9OA 1H3EA 3QIVA 3E58A 4WXMA 2CYAA 2ZSEA 2BRUC 3Q40A 1DL5A 5IN5A 2BWJA 3N2ZB 2BSAA 3UWPA 3WGVA 3ORYA 1RMQA 3CKYA 1FYWA 2WA2A 1SUBA 5BNTA 4XU0A 4FYIA 1DTWA 3FWYA 3SNKA 3ONWA 1MU0A 2NVOA 3G9TA 3IFSA 5IJXA 3O90A 2XODA 4GM1A 3CT4A 2D5CA 4DJEC 4RCVA 4ENTA 2UYYA 1GLVA 2CE2X 2PBRA 3MWEB 4RGVA 2NU6B 3GFTA 4LVLA 2QVZX 5CTJA 3SOPA 3OJOA 5AJVB 4YP7A 4CZ2A 3ZGOA 3SQXA 2AJBA 4ZJYA 3G7SA 4PZZA 1YZUA 2BBWA 3DVAA 3UB3A 1HFJA 3PX3A 2Z98A 2G8NA 1IXZA 4KKXB 3DAYA 3SHVA 2ZATA 1A0OA 1LNZA 1NJGA 5ED0A 1PYGA 1CE8A 1ZH0A 1T0BA 3DULA 3Q9NA 2BUCA 1RI2A 2ATEA 2P9CA 4F38A 3HR8A 4YT4A 1GL7A 3ZHYA 1LX6A 3V7SA 4UBLA 4TV9B 9GPBA 3RUPA 1ZUD1 2FXVA 2BMFA 2PGNA 2EJ9A 1DFIA 2G36A 2Y4OA 3EHEA 4OK5A 4F7DA 1H93A 4UQLA 2JH9A 5G4LA 1BHQ1 1EA5A 1XFAA 1YQGA 1YZNA 2JCXA 3GEPA 4PLTA 4RPKA 1MEJA 1GPYA 1QQ7A 2HLDA 1V26A 4Q4AA 4RXUA 2FMUA 2EJWA 1ISMA 1X8XA 1UKZA 3DCIA 1SG9A 3FPBA 2DWQA 1JEEA 4CXMA 1ZISA 2XOXA 3NYRA 3VSDA 4QTYA 2O5CA 4PAGA 2ECFA 3S8MA 1G18A 1JXAA 2QG4A 4LV5B 4W5WA 4EHAA 5CD9A 2XDWA 4UHFA 1UWLA 5CXUA 3AEQA 4Q4JB 3ZD8A 4YXWA 3ZHZA 1EB9A 2P69A 1CR4A 1SKYE 3WK7A 2ZCUA 3MGBA 4LPKA 2PZJA 3WQBA 1CRWG 3SEAA 5FUWA 1LDBA 1R6XA 1UQRA 3L2ZA 4A36A 5A1TA 2D2EA 2H1VA 3TRHA 5LA6A 2ZI6A 1WDWB 1JT9A 1VCOA 2XMRA 4LE1A 4MVJD 1XZIA 1BEUB 3OZDA 5A4MS 3DG9A 3IEIA 2R6JA 1O6CA 1IOWA 1AXEA 3DB1A 4NCKA 3NHRA 2JFUA 2QJFA 3ZWDA 3RFUA 1DAEA 3TEHB 4D97A 4C14A 2YFHA 4BWVA 5KNCD 3QKRB 1PL7A 3FRIA 4J8PA 5F78A 5T64A 1GQ2A 1TZKA 3NHKA 4XCVA 4OPMA 3R7NA 3UUGA 1MFPA 2WYOA 1CDEA 1Z2OX 1GPAA 3U0VA 5BUCA 2YMMA 4NZYA 1BJTA 3RSGA 3VDXA 3KSZO 2Q5QA 4BFLA 6GPBA 3O3OB 5GJBA 1NVKA 2A9QA 3ME5A 3STHA 1FPQA 4KMRA 2OXRA 1ISSA 3KS9A 4S05A 2X8LA 1JH8A 3L8ZA 1H1TA 3PBKA 4YQZA 4MLCA 2MDTA 1RBZA 3TSAA 4GW3A 1FLAA 3T1QA 5M7EA 4AJHA 2W6CX 5LA6B 3INTA 5EE9A 2YOHA 2QMHA 5FBHA 4PFSA 1J0BA 1U6KA 4WHMA 2PSFA 2PD3A 4IKOA 1LTQA 3N74A 3I2JA 4U1RA 3C8MA 1ZSYA 3RARA 5A4JA 3MNFA 2HUPA 2RGEA 2Y27A 3QU5A 2RE8A 4DV7B 2CJXA 2VPWA 2BZGA 3CE9A 1RYFA 3COSA 4MKFA 5JRZA 1QFMA 4Q3AA 4X1YA 1CRZA 4BKMA 4IX1A 2UZ1B 3WMXA 1HDXA 1GYQA 2JIZA 1P0QA 3VU8A 1CZKA 3R4CA 3S8YA 2ZVJA 2VBFA 1ILEA 2HF9A 3VO9A 1JL3A 1U9JA 1BSVA 3MWDA 3C6XA 4TMZA 3SS7X 1ZL2A 3GZNB 1QH8B 4E3ZA 3OCXA 4IJKA 4XX1A 1C81A 1VHJA 1SB9A 2H65A 3IXQA 4M21A 4NE7A 4R8VA 2YRXA 2OA0A 3FJYA 5BW8A 2BFWA 3HXMA 4C7XA 4OD0A 2XA2A 4XJTA 4CKXA 3O03A 3CZPA 2FHPA 3R0QA 1TOAA 2AZDA 4QUDA 3HBMA 2JHAA 2RAUA 2UYCA 4YRRA 1KFBB 1MT3A 3GZ4A 4Q00A 1XTBA 4KE7A 4KIFA 1KAMA 4OKSA 1TUGA 4RGQA 4YMIA 2WFLB 1IAVA 1X74A 1XRRA 3NT5A 1BH6A 1V1JA 2GXUA 3ENQA 3N8DA 4ZO8A 3D3WB 4CDMA 1XNRB 2C9MA 1ORIA 3W8DA 2OLEA 5B3LA 3LO5A 1KQGA 3PWSA 4JK3A 4YP0A 5F76A 4D4HA 5BUSA 4G8BA 1H5NA 2YHAA 4M0DA 1TKBA 2RB4A 4G5OA 1EJ6A 4OHUA 5LQUA 1HRKA 4LRWA 1H8HA 4G24A 2DGDA 1QIJA 1VMKA 1XQVA 3A9TA 3C5WP 3KJXA 1U2GA 2XNDD 4PPGA 4PXYA 4YO7A 1JVSA 5B1EA 4QBGB 4CLOA 5DVZA 1E2MA 1X1TA 2P11A 1W5EA 4N3NA 4TX1A 3ZJUA 1XZ8A 3VHXB 3GEBA 1OLXA 3IAM1 2DAPA 4JIMA 4U2EA 3AEUB 4ZD6A 4ND8B 5ALJA 2I91A 4NENA 1CFJA 3JV7A 1XT6A 2ZU6A 2WMDA 4B46A 3C1UA 3K70D 4MQEB 3FHTA 1UKAA 3BHIA 1H05A 1A50B 1C1DA 4GBGA 4F56A 5LYJF 1LX7A 4XARA 4OOEA 1ZPDA 1VG8A 2ERCA 3ANSA 3FOWA 3I1FA 4IXDA 4NBVA 3R6DA 4AG5A 5IASA 3ZU2A 4HWSA 2JJ1D 5KYVA 1OWOA 4L0MA 1UBOS 5K5EA 1N75A 4MCAA 4PPQA 1Y5RA 3ZDFA 5TEVA 2H7VA 2WJ4A 4KDFA 1NUAA 2Q7XA 2PKWA 4X7BA 3IB6A 2I22A 1XDGA 3JWEA 1DWOA 1EE1A 4BNDA 5LXTB 2IH4A 3MG9A 4LHYA 4YUXA 3PRJA 1GTZA 1XKTA 4PWZA 5LDDC 4TKUA 2IVFA 4RORA 5E95A 3PJRA 2BCJQ 3MQ4A 4H08A 4GPZA 3U48A 3UOAB 2DPLA 2D1YA 5LC1A 1KSGA 1RYBA 4LZZA 4OM7A 5FYQA 5KX5F 3EVDA 2P68A 3O4JA 1P1IA 4IHJF 1Q3HA 2WOOA 3UICA 3PEEA 4NDZA 2P2CA 1EP2B 3ENZA 4GR4A 4NJOA 1RBQA 4MQ5A 4QYIA 5KS2A 4GGPA 1G2QA 4KSBA 5K8IA 3IH5A 4L08A 3U4CA 3UATA 2J45A 3KD2A 3WJ7A 1S2LA 2D1SA 4FJ2A 4EX5A 1II8B 1RMYA 1S96A 2EFHB 3IUNA 4QO7A 4QHYA 1Y34E 1E2KA 1NW3A 4XM0A 3QKSA 2PH7A 4BGVA 2WZQA 2F48A 3FVVA 1V7PC 3TTUA 1TYCA 3FTCA 2P6RA 2VWHA 3EMBA 3H42B 1XJWA 3N86A 1A2KC 5JIBA 1FFBA 1NJ5A 4HSEA 4FSXA 1XK7A 4S04A 2C03A 1MORA 5A9TA 2POQX 5DWVA 2P75A 5KMGA 3ZE7A 1OFTA 5T7BA 2NYVA 1T2EA 4EABA 3H8SA 2J7PD 1Y8ZA 1BVRA 1Q1BA 4CQJA 4B71A 5CB8A 2PL1A 2EG5A 1DCFA 4RDIA 5EZSA 3C6KA 2V9PA 3A25A 3CEMA 3SEQA 3UQYS 5JJCA 3VM6A 2ZYSA 2HFJA 4OBBA 5CVEA 1KXJA 2V6JA 3DYVA 3NS7A 5HK9A 1JI3A 2HHJA 3MRSA 4Z4GA 2ZDGA 1FBTA 5JZSA 1Q6ZA 4D9EA 4UMEA 1G5TA 2M32A 4PR0A 2C2MA 4JVOA 5HXAA 4QYIB 3ZHQA 2CXXA 4DIEA 2OVBA 3NRBA 2HJ9A 4E1AA 1NBAA 2YOFA 1KYTA 4PWYA 4EPTA 3W5DA 3S28A 2GFHA 3FM9A 2FPMA 5AH0A 1IULA 2ID9A 4OQPA 1E4VA 1NUPA 1UFQA 4ZALA 2IS6A 1GZDA 2W6IA 3PHJA 2IF2A 4PYJA 1S3IA 1YJQA 3L1JA 4OCZA 4CLEA 1W2WB 3FDZA 3RUFA 3ZWYA 1MNAA 5LZ5A 3AVOA 2PZGA 2C57A 4NV3A 5EJ7A 4MRAA 5DLQC 3IBFA 3T3PB 4UNPA 3H8VA 4DB2A 1JZTA 11ASA 1RRVA 1ULBA 2ANCA 2I6TA 1O58A 2IIVA 2IV7A 3GJ8A 1DQPA 2P4SA 4W7SA 3RVNA 3L6DA 2DZ9A 4YUWA 2OR3A 1E1RA 4J43A 5B1SA 5EE1A 3FOFC 4P4TA 2JHPA 4YP9A 4UVDA 3TIIA 4ZK2A 4MP3A 3IJRA 1FQKA 3JQAB 1EE2A 4ER6A 1Y48E 3QELB 3MC1A 1JIUA 1GUDA 1SXQA 3KKPA 4B6PA 1ASYA 4DIBA 3A1DA 4JA2A 4EHIA 3AJRA 2QS9A 2AN9A 3Q3GE 1VKZA 1P8AA 1T4CB 1A9SA 3IUJA 4FN5A 3UY4A 1JQJC 2NSYA 2VRWA 3X43A 1KKLA 3FGNA 1VBNA 3QLJA 1ZLYA 5DF1A 5IM4F 4HUQB 3AOEC 2EZ4A 4KAFA 4B4KA 1S01A 1FMTA 3QOXA 1ENYA 1U8XX 2FLKA 3LAWA 1ULTA 1GA4A 2WEKA 3ANTA 3I5AA 4QLBA 3LY5A 1UBFA 1NHGA 1VCIA 2YC4C 1BCSB 2VXOA 4YRBA 4GF5A 3DMYA 1DDGA 1QYXA 4QSHA 1O94D 5AESA 4RV4A 5CA0B 5ED4A 4P75A 4G5QA 1FXWF 3BJZA 1N2CE 3ADOA 3CS3A 1KYZA 2W6OA 5SYMA 3KNZA 4ZIRA 2C94A 1XSEA 2UYGA 1LVGA 4QOHA 4TXJA 1A9OA 2TRSB 2MYPA 1E1TA 4N18A 4EUEA 1P5RA 3LHIA 2C9CA 3FYUB 4ANFA 4OX9Y 3FNBA 1D8TA 3MWJA 4LJ8A 1K7SN 5EMHA 3S1AA 3ESDA 3D5TA 1IPHA 4YRTA 1KK0A 3A58B 4IJMA 4L50A 2WAMA 4X00A 4MRMA 3DC2A 2YJGA 1X77A 3KD3A 1RHRA 2FSSA 3NTVA 1KVRA 1K66A 1PQYA 2BLNA 3CCBA 4KQXA 4NWIA 1DVRA 4YPVA 2HT6A 4RD0A 4RTRA 4LWZA 1QS0A 4OBWA 3K4HA 5EXDA 3NWBA 5AHKA 4HUQA 5AIBA 1TU3A 3U19A 4RBNA 4TKVA 5JXWA 3W5UA 4UEWA 1RQPA 3IOMA 4IHJB 4DIDA 1XR3A 3K35A 3L43A 4B32A 4GOND 4UUNA 4IYJA 4ND8A 3ROXA 3N0TA 2ARSA 2H1LA 1T0JB 4LFBB 2PO7A 1LEHA 1YU6A 1Z25A 1C7EA 2IPAB 3PRHA 4HYQA 4TKMA 3KB1A 3DDZX 4BJ6A 3BREA 3K0SA 3VX4A 5CFPA 4QUHA 4RLFA 1Q1AA 4OBXA 2JIOA 4OLAA 1OFUX 2IH5A 3R8CA 4E88A 2K4MA 5CAEB 1WXEA 4IDCA 2C5HA 3I83A 3AJDA 3LMKA 3VH1A 5K0CA 4BHTA 5H9VA 1RBYA 3MGAA 4MMYB 1T1GA 3W8NA 1MHTA 1EWRA 1U7HA 5NULA 5J47A 2PWBA 2XTAA 4CS4A 1MFZA 4PV7A 3L0BA 1DRWA 4FYXA 1U31A 2IXEA 3MLEA 4I8DA 5JHGB 3S2SA 3FGPA 4AN0A 4HVCA 1LPSA 2DX7A 3E53A 5EOVA 3H3FA 3MWYW 1PJQA 5CVJA 1PJ8A 1V8OA 3JD4A 5CYGA 2Q7GA 1FLVA 2HA4A 1WVMA 4HHEA 5IDYA 3WB9A 1TGVA 3DT6A 5JJBA 3K5WA 5LOVF 1L7NA 3P0FA 5TXGA 1MO5A 2XKAA 3ORQA 3V2GA 2HQBA 2IPNA 2IODA 1P7VA 2QM3A 2ZFUA 4Z9XA 3BJEA 3V8NA 3CWCA 5KB3A 2NUTA 2V9ZA 3DCJA 4RK5A 2I66A 1JKFA 1WU8A 4F12A 1JU9A 2ZBVA 2YZMA 4QELA 4UM8B 3WL8A 5REQA 4ALMA 3ANMA 3EVCA 5C37A 2WU4A 1OILA 2WAXA 5KYWB 5FQOA 1VLVA 2XYVA 1GNRA 1OZHA 2VSYA 4HVTA 1WXXA 5IABA 1IZZA 1FS6A 3LL7A 4GYJA 3U3DA 4B4VA 3LUHA 4EGCB 3FUCA 3CVVA 1F8XA 3V6LA 3G02A 2AX4A 2CVQA 1Q7TA 2OFFA 1CUJA 4ETIA 4KAXA 5DBHX 1S9HA 2M98A 3ZGLA 3GUZA 1HE4A 1M83A 1L7PA 2IYTA 4A8PA 2I0FA 2AG5A 1YS4A 2DPYA 2BFCB 3H9GA 4EUKA 3HPQA 5EPEA 1UOQA 1JH9A 5ALOA 2DR0A 3H2ZA 2QU7A 1Z7WA 4L22A 1YBAA 1W36B 2E18A 1IAQA 2NZWA 3LVQE 1FJHA 3QLUA 4XX0B 2AI1A 3UPTA 4B33A 1TZCA 1KEWA 4Q37A 4UVEA 2F9FA 2ZYDA 3SXUA 1JHVA 3O0DA 1CY0A 1HC7A 5ALWA 3RJ9A 3UT5B 4ZCMA 4ZMBA 2HA6A 5JEDA 1KQFA 1U2GC 1DKQA 2AFHA 3AUTA 2HMWA 3BZWA 4LDPA 5CEJA 3EHDA 4Q9NA 1QP0A 2JKZA 1NVUQ 1HMYA 2AEEA 2DT8A 1L8LA 5DGDA 1GU1A 1GPNA 1VZ3A 4RK1A 2PM8A 4NONA 4K2AA 4PPFA 3FVTA 4LRTB 2OT3B 3SP1A 3VR6D 2BCEA 2PRKA 1TIPA 2QT0A 2RG1A 5LU9A 5DOZA 3JALA 1M2NA 4E32A 4XOIA 2DPMA 4ZAXA 3GT7A 2ZYAA 3FVWA 5A2GA 2JPDA 3UAYA 4TYNA 4AY6A 2ZAOA 4H2YA 4WJZA 5JJKA 3U5TA 1MP0A 1N7JA 2A0WA 2V4MA 4B3GA 2ZSDA 4TYWA 2W4MA 2PEYA 3AR9A 4LTNA 2NZ2A 4WY2A 3TKAA 4HYYA 1H3FA 1YAJA 5HYVA 5A5EA 3W34A 4ZZ0A 5A1JA 4I19A 2RAVA 2C0PA 3ZWMA 4A1OA 2AEJA 2B4YA 4Z4IA 1JAXA 4XWGA 5FOUA 2OL4A 1SFRA 4MYCA 3UXYA 1PV4A 3DKRA 4NU8X 3S99A 2QVCA 3B1ZA 3IILA 4BGDA 3G7NA 2WI8A 4C05A 5EL0A 4AROA 3QXSA 2ZS7A 4EB6B 2JJ2D 4I6EA 3RKXA 4DLRA 5EYPA 4DR4B 3I58A 1DQSA 4M60A 4B7CA 1IN6A 3R3UA 2CJFA 4UVHA 3EVZA 2VP0A 2ZSFA 1P77A 3IP6A 3O5AA 5EJIA 5HKKD 2PH1A 5LQSA 1SIOA 1PBNA 2DRIA 2B2CA 5KDDA 3U44B 2GO7A 1EINA 1SHJA 3Q7RA 3GVXA 1IK6A 3ZE8A 5H4GA 1WETA 4QDOA 5AFSA 4O5AA 1U3WA 1VE3A 3AUUA 2OAEA 4MAAA 1YV9A 1HH4A 3JQGA 1JMKC 1AUOA 4C0AC 3HA3A 4BVLA 3QE0A 2IUSA 3BDAA 4CTOA 1GR1A 3CMQA 3LO8A 1QVRA 3DZFA 1GQRA 3LSYA 1QGYA 2GZRA 1DJMA 2AX3A 3FCXA 3WRYA 1T9BA 2OSBA 1N6LA 1AKYA 3BQNB 2IGTA 3QWHA 1F2UA 1ZEJA 4XWTA 2EBFX 3DA8A 4F06A 1GKLA 4LAFA 1Z6XA 1WPYA 5HS6A 5AW1A 2HMSA 1L9XA 3W6NA 2C58A 4KQIA 1XMOB 2LBPA 1GTL1 4FYPA 1AS2A 1AN9A 3DUWA 4LVUA 1T1JA 4C5BA 2CXHA 1UXOA 4MVJF 1SUEA 4X97A 2ONYA 3AZPA 3TLAA 1JHOA 5ILOA 3NEJA 3KB2A 3AT1A 1KS9A 2Z1NA 4L8WB 4IF4A 3LYHA 4P3KA 4KREA 3RS7A 4B31A 3TD9A 5JS7A 4ZAWA 1RKVA 4J6EA 1ELOA 1GVHA 1TMOA 3H2BA 3PUVA 2VHCA 4DLAA 2VYQA 2JANA 4TLBA 1R0SA 1G7TA 1N2IA 4GX2A 4NQZA 3FAZA 1KO8A 2FR0A 2KLBA 2QJRA 2VRBA 3SM3A 4RLSA 5FQNA 5I45A 2B34A 5K4GA 1JKMA 1ZIDA 4RHUA 4F72A 2BIFA 3BKWA 1Z4LA 2G06A 3OFJA 3SDSA 3V8EA 3A7DA 5IKOA 1B6TA 2QBYA 4KV9A 3ZXSA 1OFGA 1DZ3A 3GLRA 3TCXB 2B8EA 1B0ZA 4FZVA 2RHCA 3DVLA 4NU6A 4JHLA 3EVAA 4ETWA 1B14A 1QRRA 5FUXA 3A3OA 3EFOB 1WKVA 4EX7A 5C32A 4FMCB 3AGPA 4QYMA 3THSA 2OCIA 4XQGA 1E2EA 3RODA 4HPJB 2D06A 2QM7A 4PYRA 2J9RA 3OETA 2CXNA 4N0PA 2C8KA 4CV0A 2H48A 4BO2A 1EFRD 4WNAA 3T9BA 3RRZA 5C1BA 3BQ9A 3PNOA 4HN9A 4P98A 1IWOA 4NV1A 1EU1A 2H1IA 2AC7A 3KSUA 4I3HA 1W49A 1WZEA 3KOMA 4JR1A 1JQAA 3HVUA 2FFAA 4ITRC 3W2EA 2ISQA 3P0HA 1VJ0A 3NORA 4LUCA 5IPFA 4PG6A 4RMFA 3BJRA 4GFDA 4ZODA 4HDKA 4KAJA 4D9KA 4HNAB 4XTUA 1SMKA 4J0QA 1TF5A 4FYMA 4L4XA 3I4CA 1QOQB 1X2GA 1RQXA 2M1XA 2VK4A 3N7AA 4J1SA 4P86A 1J99A 1LVUA 3LW7A 2J6CA 3D8NA 3VAYA 4K0KB 3A2NA 3VSEA 4RQTA 1P9RA 3NRJA 1J8VA 4K3UA 2L17A 1CQWA 4DPLA 1IN7A 1KJIA 4AO7A 4JA0A 3UJ7A 4M89A 3BFXA 3CF6R 1K6IA 1DCKA 2VUHB 1MJFA 2XWSA 1GG8A 2PTGA 4HQLA 1C9JA 1OKKA 2E10A 1W73A 3AJ8A 4K9LA 2HMUA 3FCCA 4KGDA 4A03A 3K73O 4UARA 5L6LB 3R6LA 3QNWA 3KO8A 2IV2X 4ESOA 4GMFA 1WXFA 4IDNA 4DIKA 2PUHA 5CBPB 2GM9A 3RU7A 3I6IA 1SJ9A 1Y8RA 3GGPA 2CSXA 3C1TA 3FVQA 4RLHA 4Y67A 4YQEA 3TGLA 2QENA 3KZNA 1P72A 1ZW6A 5G2OA 4YREA 1MXFA 1Z5PA 2A30A 1TEHA 1SCIA 1U7UA 1QH1B 2LRHA 2W5UA 4M99A 5CK5A 3L0PA 2VTDA 3K8OE 3TNDA 2HWYA 4F8EA 5A05A 2NV2B 1C8KA 5DNCA 3B3JA 4LOAA 3LCVB 2ZAGA 4XQEA 5EAIA 3NATA 4K9SA 5KPJA 1G21B 3QEMB 4XDHA 3WA7A 2A5DA 2B9EA 1O9GA 4KR6A 3WRXA 4MKZA 4J9UE 3EIQA 2DWUA 4LHXA 2GPNA 1C0KA 2YJ3A 4HGOA 3CLUD 4PS1A 3WGTA 4L4UA 5A5GA 3WGHA 3PCRB 1U0SY 1RYZA 1V8BA 1KI2A 4KDCA 5IANA 3HB7A 3RFVA 1TGYA 5JYEA 1XMPA 2ZVDA 4WY5A 3EPKA 1T26A 1Z82A 4N0QA 3EYAA 3GEIA 1VG1A 3MTGA 1P2SA 5CTAA 5TQVA 1WZIA 2FW8A 1HEIA 2HB6A 4DBLC 1UXIA 2QAGC 3K2QA 1VKNA 3STVA 3TPCA 5JD5A 4M8KA 1SVMA 1B0UA 2EVWX 2I7XA 1NXVA 1PGJA 4WI1A 2HI0A 5CW2A 4YAWA 4Q6BA 2QHSA 1MRSA 1VMIA 1WB5A 2DQKA 4PAOA 4X0EA 4JV5B 3EOZA 3UO8B 2ZXUA 2AMFA 2XMSA 4GKAA 3L4BA 4YJGB 3OX4A 4I66A 4H35A 4J1NA 2G80A 4MWCA 2BVNA 1FVHA 1HE1C 5ALUA 5M3BA 3TW8A 3KR9A 4IIGA 4C4TA 3ICQB 4RHTA 4QU8A 2WHQA 4XASA 4HXYA 4EI2A 3H2YA 2QAGB 2J3MA 1T9GR 1QM5A 2IZ5A 1YZFA 3R0XA 4RSGA 1U0NA 3PVCA 2EJGA 4A23A 2AKWB 3T3HA 4NZ9A 1XNQB 1G20A 2BEUA 2FWPA 5A4IS 2QQ5A 1HKUA 3FYHA 1WTAA 5GAJA 1ISJA 4HN4B 4YUZA 3NBKA 1F4VA 4ON9A 1E5QA 3M5DA 1AC5A 3K0EA 3LOUA 4QBFA 2YASA 3DCYA 3OLXA 4NAVA 4B35A 4BQIA 3ZDAA 3H84A 1WMBA 4YJDA 5HQTA 4NU5A 5JV5A 1VBMA 2J41A 2RHSB 5KX5A 1IBKB 4CDNA 4DT1A 2QROA 1UPXA 1VJGA 2G7MC 2OGUA 3QWAA 4FZ5A 4HDQB 3DGFC 4QOSA 5JU6A 1AQUA 2ZB4A 3ESQA 4GPEA 4YMLA 4ZAFA 2CVOA 5EFZA 3RNOA 3AL0C 1ZM2A 4DF3A 3PPYA 2WP8J 2CHGA 1G291 3RHZA 2KBEA 1G6Q1 4MEAA 5LIRA 2PZ8A 3Q98A 2W2NA 5CHEA 2WJPA 5AM5A 2VUIB 3AFMA 5HMLA 2EJFA 3FDXA 1HYHA 3N05A 5BOSA 2DECA 3GLHB 1W8IA 4PNHA 5K0LA 2RHQA 1KNXA 3ZTYA 4EYGA 4DV3B 4NXNB 3RC2A 4F3YA 4FI3C 2YVLA 3TKLA 2V5VA 1ZHOA 2XVAA 2QBYB 3BDVA 4F4JA 2OCDA 2QLJA 1KAQA 4HL6A 4DDMA 5EHXA 3UK6A 3AHIA 4YN3A 3MS4A 2QI9F 3IR6A 2FZWA 1QNLA 3GLKA 3I01M 4MS3A 1BNCA 4WGFA 2B78A 5CLLA 4WCFC 4L3VA 3T99A 4B73A 4DT1B 3RG2A 3DM5A 3JSXA 2B8NA 4QPJC 3H9QA 4YALA 3KV3O 4N12A 4INPA 1ZCBA 5TF4A 3S3TA 1R00A 4CIVA 3GIWA 3IUBA 4IYRA 5ALLA 3V4ZA 4BO8A 2W70A 2ZCEA 3A6KA 1LF5A 3O8LA 2REBA 4EHJA 5KHLB 4G2NA 4DCUA 1QYRA 3I23A 3F9RA 3WK6A 1FXUA 1II9A 2OFXA 2R6FA 4FQ8A 4J7CA 1XTPA 1GUFA 2B21A 2EKDA 1V35A 3BGIA 4Q4DA 5EP3A 2O50A 1JDBC 1U65A 5SY4A 1H6BA 4ALJA 4Z54A 3AJ9A 1NX9A 3GA7A 1QF9A 1FRVA 5HGQA 1O96B 3JQFC 2OCGA 4O1MA 5CVCA 1BE8A 1QQ6A 4RK7A 1XTUA 1UEIA 5ECYA 1ZSVA 2IOHA 4U00A 3QVTA 5B3JC 3UVEA 4Q02A 2WTEA 5AJYA 4BQPA 1E2PA 2XZLA 3HSYA 1D2CA 2EWVA 2X9GA 3FUTA 3MHPA 1ZI9A 3OU2A 3VVBA 5TT1A 1NC3A 5C34B 5KWEA 3BOSA 3LF2A 1UJ4A 3PC8C 1UK8A 3C6MA 2RONA 1RQLA 1RKUA 1PG0A 1NLZA 2HD4A 1YC5A 3M49A 3K1AA 3C7TA 1SPBS 2MMCA 3AKCA 3DTVD 4HQNA 1A5SB 4TSFA 5D01A 3FUWA 4W5NA 1I9CA 2CFCA 2PX3A 1KAOA 1QLJA 3HGQA 3I2FA 2B0CA 5IMSA 5DNVA 2C4UA 4IL5A 5ALHA 1H5UA 1QVAA 2HKIA 2BELA 1CY2A 3HSSA 5ARDA 4RS3A 5FWXA 4F2WA 4YAFA 1NF9A 2DSNA 4IG9A 5AUNB 2DQZA 3IERA 1ZEMA 4C89A 1N6NA 3MQZA 2ZSAA 1WQWA 5FOVA 3B9BA 3ZJYA 5EEHA 2VG8A 4Q9HA 2Q1UA 2ZDHA 1NY5A 2DCMA 1IMJA 3NV9A 4NMXB 3X1JA 3JPYA 3IBYA 4ZMSA 1EDZA 2O2EA 2WU1A 2ZKLA 3H1PA 3OTWA 4RLQA 4II3A 2VDRB 3DD1A 5FL7A 2XAUA 4P08A 3H05A 1NNI1 2COKA 5I7SA 3T5AA 1V5WA 2MWMA 3LPLA 2JJQA 2W2PA 5DTQA 5ABPA 2W83A 3BTOA 4C3OB 2F4VB 1YS9A 2VSFA 2AJCA 4LBWA 3EUEA 3QGMA 1JGTA 1ODSA 4BEBA 4EKDA 4OXNA 1EX6A 3B51X 2HK6A 1V8ZA 2EAYA 3GRVA 4G0UA 4NPCA 4XPZA 3AYXB 3I73A 1K6MA 5T5QA 1DAGA 1ZCFA 1WD7A 3NIBA 2H63A 2ZSIA 3RD5A 2ZROA 1Z6QA 1Q95A 3NM5A 4IDPA 1ZBQA 1M8KA 1PFWA 2P3OA 2NZ8A 4KMOA 4CMKA 4OB6A 3ZE9A 4UU7A 2J0EA 2KX7A 3CZQA 4IZ6A 3SJAA 3AF6A 1V5EA 4LRXA 1SCNE 1VFNA 2C95A 4ZTBA 4Q7QA 6ADHA 1WZ2A 2H0RA 4XM2A 1HNWB 4RADA 4E1VA 4FHFA 3OZUA 4EGJA 2BM9A 4AFNA 1L8QA 2NO5A 4WKOA 5EE5B 4C6HA 5T6BA 5CLJA 3BTVA 4PHFA 1OZAA 1NJSA 1E6CA 1R1DA 1T1SA 1Y3AA 3N28A 4FFPA 3HB9A 4X95A 2F17A 5AW8A 5F2NA 2H4YA 2QUKA 5KNCH 1EQAA 1JQ3A 3I1YA 1Z13A 1KRHA 5FWDA 5GV8A 4HSGA 1P2VA 5EIWA 3VUEA 4FEAA 5DXJA 3TINA 3G0IA 5ERYA 5A06A 1M8JA 5KUTA 4F5ZA 4HYEA 5F9HA 1JHUA 4L7VA 2C8JA 1QHFA 3T6KA 4D02A 2PUVA 1M0SA 3FG9A 1NULA 3DSQA 2QTMA 2PY6A 1JYSA 3O8CA 2FYKA 3HP4A 4INZA 4C30A 2YXDA 4DQXA 1YOVA 121PA 4Q16A 3ZDXB 1LSUA 1W0JA 1R8XA 2J3EA 2NNWB 4LCJA 1A7UA 1W52X 1ZRSA 1PWZA 2D62A 1QIIA 4XTZA 3OC6A 4AURA 4EKYA 1W4ZA 2OK8A 3BRQA 3JVEA 5AYVA 4UPDA 2EP7A 2W4IA 2CNKA 2YNMA 2F2TA 4PG5A 4GG1A 1BXRA 3TM4A 3HFZA 5E6SB 3FI0A 5GIPE 1QYCA 2BJVA 3FUUA 2FG7C 3TM5A 4GPAA 5DNYB 4RTQA 3V1UA 2IBMA 5JCPA 3ONFA 5A6VA 4QNMA 1OX4B 3ND7A 2VPPA 4D1YA 4WF2A 1CNEA 3A26A 1DBSA 1L8XA 4KIGA 4H7FA 2P0EA 2V7EA 3IIKA 3VJLA 1MIOA 3BSFA 4HLUC 4DRYA 2A1TR 4RHFA 2DKOA 2PMKA 2CJAA 2Q50A 3TLEA 3B7WA 3T1NA 4BVFA 1FXWA 4P36A 1SHTX 3UMGA 4CIYA 3DBIA 1OV4A 3B3FA 4TV8F 4URWR 1CZHA 2QTLA 1CP2A 1DDOA 3TE6A 3DOIA 4OSOA 2QT9A 2R751 1OVGA 4R8RA 3WBFA 3FJ1A 5FI5A 5CB6A 5ALXA 1FRFS 1SK9A 1JJCA 2MINB 3NX4A 1X7WB 4IV8A 3WC4A 4F2PA 1LXCA 1T2NA 2FRDA 3G1WA 2CMKA 1RI5A 2GNAA 3JRNA 3T52A 1W8DA 4INJA 1J70A 2V7UA 2X76A 1E9SA 1MEEA 1GQFA 2DUUA 2OBBA 1RQ2A 3M6XA 3PUYA 3CVJA 3EIXA 3PUHA 1NP6A 4Z0TA 4BMPB 3AVVA 4P7JA 4YAIA 2QTNA 5IWAB 6REQB 4BIIA 1WL8A 3EEBA 4OQNA 1E7MA 4BKOA 4L9RA 5MFZA 1FUUA 1Y81A 3T5CA 3QUSA 4DR5B 1GGHA 2OYSA 4XVCA 5L3RA 1N9GB 4BTVA 4F4HA 4REOA 1C9DB 3PGA1 1IEWA 1JKIA 1QU3A 1U7OA 3ICPA 3ZXXA 2XEXA 2H9YA 3F8SA 3CRZA 4GXNA 2O5EA 3D8BA 4PYOA 3VZBA 2GFIA 1G3RA 2IC5A 4J1TA 1ODTC 4M9XA 4P4SB 4Q3NA 1E18A 3DO5A 3FPHA 1IWPB 3HCBA 3IOBA 3KL4A 3A9SA 2N75A 3D7SA 1R16A 1XXHE 4DDKA 3KLOA 3T4EA 1ZAKA 1IY1A 2M1ZA 1A72A 1O8BA 2E4WA 5ESDA 3LUCA 2CE7A 4L8VA 3SFZA 3L1KA 5AW3A 2FPXA 7MDHA 2OAP1 3S40A 1Z8HA 5F7XA 4PLYA 1E5LA 4YP5A 2HNKA 2ZJYA 4HAUA 1HSOA 2PPLA 4F11A 5EHZA 1O7JA 4LOLA 2IQIA 3PX7A 4WLVA 2BM0A 1QG6A 3MERA 4FX5A 3AG6A 3JQBC 2BE9A 3B2QA 1Z5GA 3GVCA 1C3OA 3O2JA 4JU9A 4WK4B 1M1XB 3A28A 2R7NA 3MCWA 2HY7A 2J3HA 3CKMA 3HI4A 3UAGA 5I7FA 2FQYA 2CHQA 3MOGA 5I47A 2JGMA 4QU5A 2AGVA 2IIBA 3ADDA 5JUWA 2KHZA 4LC9A 2CB0A 3EZNA 4S1VA 3U2QA 4MQBA 3SE7A 1LDNA 1T8WA 2I2AA 2DBRA 2JHFA 2NV6A 4REQA 3NRCA 2ZIUB 3ET5A 3TTYA 3A9UA 2ZB8A 1DRVA 1G6HA 2Y93A 1N5JA 3EY9A 3N8HA 4I50B 4BEVA 3ILHA 1KJWA 3ZY5A 4D6PA 2IV3A 1Z4IA 1ZJWA 2ZZNA 3DE4X 2Q4DA 5I7UA 4LXQA 2ZT5A 2ODNA 3SIXA 1Z28A 2L82A 3VH3A 3B9RA 2VTEA 1N5RA 4KBGA 2XIQA 3D6HA 3JQ6A 4MVJM 4XUEA 4OQXA 2QL9A 3LYAA 3MTQA 3VR5H 5BN4A 1DLJA 1KU0A 3OZFA 3WLAA 1LZKA 4WOBA 1LK5A 3MJHA 4GD3Q 5HRCA 2Q1TA 2RMKA 1CVLA 2D00A 2IE0A 4GOKA 3T38A 5MGNA 4WXRA 3FPJA 2Y1KA 2FN8A 1JE1A 2ZYTX 3E4CA 1DDIA 4OL0A 5YASA 3VHLB 4ZOQI 3GLFA 1M7GA 2JLSA 4DW8A 2JZCA 4AZTA 1JKXA 2FEPA 9ABPA 1GPMA 4QBIA 5IXYA 1DSSG 2NQ8A 5E0OA 4C3VA 3DZ8A 1PVVA 1UBUS 4CPDA 1KDTA 3D43A 1P44A 3FD8A 3FSGD 2MTBA 3LOQA 2HHLA 1LPBB 3P8ZA 4OQ4A 3TN7A 3AXTA 2E4XA 1OSNA 4GOLD 4KXQA 3JR3A 2UAGA 3E70C 1PIWA 3REQA 2I7DA 1VSQA 3ZJTA 3E61A 5IC5A 1SZJG 3RVOA 4NK4A 4EITA 4JLNA 5KWIA 3V7YA 3AUAA 5F5XA 3EVGA 1Y37A 2A58A 3CWQA 4CU2A 3REUA 1RAFA 4ZT3A 4ZICA 1KO4A 3O2SB 1QGOA 3VI3B 5FFFA 1Y4SA 3AUYA 4XCXA 1DO2A 3D8SA 4BNXA 4DJ5X 1YGBA 4E4RA 4KQEA 1BOOA 3Q9LA 1GKYA 5LLDA 3NP9A 3OOSA 3WIBA 3M8KA 1KWGA 3UMBA 1T6XA 4ENSA 2J46A 3OY7A 4ZEMA 2W43A 2GBGA 1D09A 4DWJA 3QUTA 2XYQA 1XMQB 4TMXA 2DU5A 2D0DA 1IUNA 3QPAA 3G8BA 3GAAA 1JJFA 1B1CA 1IEVA 2AKYA 3SF0A 2JC3A 5A9SA 3OMLA 1RP1A 1BWSA 4I8IA 5EUBA 4EJSC 4BGEA 1K9VF 2YZKA 2PBFA 4GYYA 2IXGA 3FFBA 4Q1EA 3MEYA 5EQTA 2Q6IA 4KYUA 3EPJA 4KXWA 4GBJA 1LC0A 1FDTA 3M6AA 2V55B 1K68A 4J75A 3FIJA 1MW8X 3ZLJA 3JU3A 3JD3A 4E94A 2GDJA 4PE5B 5HUQA 2E64A 3V1NA 4IDAA 4CKWB 2XOKD 3PPWA 5EUCA 1L5WA 4RD2A 4J0IA 1L5OA 2Y6VA 1DP4A 4BO0A 2YKGA 1E1CA 4TSRA 5F4ZA 1E0SA 4UTOA 4Y2TA 3OFVA 1MZPA 3LFUA 3TZEA 2WF6A 5EMMA 1W30A 3QX3A 5CM9C 2AOUA 3V7RA 3OY2A 4BNJA 4EQ6B 2QY6A 2WFMA 3DDNA 4PIMA 1OYVA 3F5QA 3GFPA 4H27A 4JB3A 1TK3A 1MJGM 1YVRA 1UEJA 1ZO8A 2B7LA 5HDBB 1J9GA 1WX1A 1PN3A 2OGWA 1L5FA 5I6DA 4UXHA 4DLZA 1PF7E 4LYGA 4XB1A 2QLMA 4B80A 4C29A 1VIAA 4F46A 1FFEA 2FSUA 4GP9A 2GPAA 3TD6A 4ZZ1A 1HGXA 2C5BA 2WD7A 3GYGA 1OAAA 1SU8A 2I62A 3MIIA 2PKCA 4CKCA 4ARIA 5AVKA 1WXWA 2RAFA 5CLHA 3ILYA 4LYDA 3ZS8A 1T8TA 2O3QA 3IL2A 1HLFA 4A6PA 3KAQA 1YR3A 1XXLA 4I50F 3LC2O 2MU1A 4QG3A 3NEPX 3DLPX 1EIYB 1OU4A 4QDJA 4LDRA 4XTCS 3UAOA 4DPGA 4UDNA 2YXBA 5C4IA 3HJAA 3AVXA 1J2JA 2Y1DA 4EGQA 5D00A 5A7GA 4B74A 4G6ZA 3M33A 5FBKA 3W5AA 1I2DA 1WIWA 1UWCA 5CFQA 2NVWA 2FGKA 3FNIA 1INLA 4RTJA 4DNXA 3OQMA 1YONA 3TB6A 1F8YA 1N1GA 2NU8A 3ZGYA 1N77A 2XY4A 1XCOA 3RIYA 4XIYA 1HR0B 4LF8B 5IN4A 2YIVX 3MPUA 3HFSA 2BN4A 2DU8A 3LM8A 4IQGA 1GFSA 2CDRA 1CQJB 2BI8A 1JI0A 3TSWA 5ADVA 3RIRA 2A4KA 1U28A 2R62A 3E3MA 3IBTA 1GNSA 4GLJA 1RCUA 3DAHA 4DNFA 5CG1A 1ADJA 3BXXA 3P27A 5C5IA 1UC5B 5IC4A 1Z2AA 3E9CA 4OKIA 3UG6A 1L4EA 3GCWA 5A6SB 1XRQA 4BAGA 5TMEA 2PCLA 4L7QA 1V4VA 1FUKA 3I8SA 2V4ZA 3LT4A 3AYZB 2GZ2A 3FLAA 4ZAGA 5CDUA 2VPTA 2G71A 4NYMR 2R8ZA 2QRVB 3ASUA 4RXTA 1AVTA 3B6JA 4PS0A 1NQTA 4JSRA 4PGMA 3W6UA 1ESCA 4E13A 2RHGB 5C80A 1VSVA 2P5TB 2VXBA 4GLBA 5TT0A 1L4BA 1P5HA 3V00A 3PUKA 4HZGA 4KWEA 2ZJ5A 3HXWA 3LGAA 3M5CA 5KOJB 2QG6A 4X64B 1YMQA 2HDWA 4GP7A 3L4GA 5TY0A 2WAOA 4BUJA 5I7OA 4ID3A 2M6LA 3MFQA 2Y76A 4NFLA 4P80A 1NI5A 3A6LA 1PS8A 2H0QA 2O1EA 5KNNA 1U2RA 2ZJ8A 3DE7X 2BR5A 3QXJA 5EHQA 4RTSA 4V02A 3WV4A 4V03A 4IOJA 3RK4A 5AW4A 2X0KA 1Z4PX 3GGCA 3PFHA 3M3DA 3DMRA 2OGTA 4ZIBA 3ZTWA 8GPBA 3F73A 1XRMA 1XEXA 1Q21A 3P2JA 3BZUA 2FSHA 1P75A 2C5FA 1HL3A 1Z16A 3ZEIA 2G4CA 4HXFB 1JPNA 1VQ1A 2BDTA 3R5SA 2NUPB 1JFSA 1A97A 1RWQA 3I6MA 3ZLTA 4NE2A 3RVBA 1Z4NA 1MOZA 1EGMB 1JAZA 3L0SA 1PV1A 4BRZA 1HDEA 2JS7A 1K2VN 4PXAA 4BLOA 3S4YA 1YK0A 1Y7TA 4J0GA 3B48A 1AU9A 3QVXA 4QAJA 3W04A 3WHPA 1U2EA 2SKCA 3U09A 4AAYA 3WBJA 4EHHA 3KSDO 3QMVA 5AJZA 4CG2A 4Y2SA 4QU9A 3CRQA 3EVEA 4L95C 4ZVSA 2MCFA 2XDQA 3PUXA 2ORED 4WQMA 2XE4A 1EK6A 4XRRA 2LIVA 2B4QA 1GKKA 5I4CA 5ETJA 3CSDA 4NV0A 4BKRA 2QSZA 3UHPA 3WK9A 4EWLA 1FF9A 5ESWA 2DQYA 5JAZA 2P7HA 4NULA 1H2AS 1E5XA 1JV2B 3E7FA 3FB4A 4WZAB 4D98A 5HIKA 4HDCA 3O8RA 2ODEA 4G65A 3RS8A 1TO1E 4ZCQA 4BNYA 2R8OA 3FHJA 1BZYA 4IGAA 3WLMA 2W8ZA 2BF7A 3K30A 4FLMA 4S1TA 1NQUA 4O02B 2VCYA 4FDUA 4TLEA 4ZEXA 2OD9A 1E24A 2O8FA 1NVVQ 5JMOA 1H0KA 4RD1A 2EF0A 3A36A 1HL7A 4D3FA 4IGKA 3DE0X 1W5FA 1CV2A 2ZSHA 3BEOA 2RHMA 3GLFE 12ASA 1SETA 3L3BA 1ST2A 3ORRA 3NYWA 5JS2A 2EKLA 2GWRA 3JVVA 4NOLA 3PLRA 1JG1A 1WP9A 1Y6QA 2VJNA 3ENVA 5JNWA 1IBRA 4L6CA 5DN6A 4HQOA 3CB4A 4BO5A 5CJPA 2CV2A 2H54A 4RKYA 1EJ0A 2P5UA 4EQ6A 4HNVA 2P2LA 1QCYA 2X4DA 3JSAA 1RYNA 1E9BA 4ZYTA 2OM6A 5HFJA 2NTVA 5DYYA 4DWVA 1DC7A 1YIOA 2X77A 3HJFA 4FBLA