2ODRC

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
679
structure length
468
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPSILNEIYVYDGNVIGIPEKIDDIALKQIMSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
molecule keywords phosphoseryl-tRNA synthetase
total genus 117
structure length 468
sequence length 679
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrC01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrC02
1YFSA 4YRKA 1NYRA 2ZIOA 4PG3A 5E3IA 3V8KA 4RMFA 3V7RA 3HFVA 11ASA 5F5WA 4YCVA 2DU7A 5C51B 1SESA 1X2GA 4H2VA 3QTCA 2CGHA 4HA8A 1BIBA 4P72C 1NJ2A 3TEHA 4P73A 2DXTA 4XTWA 2IY5A 1NJ6A 4HWSA 3RGLA 4K86A 2Q7HA 3RIRA 1WQWA 2EWNA 4DPGA 2ALYA 4ZIBA 2ODRC 1VQZA 2ZTGA 2ARUA 4P75A 3ICAA 4HWPA 4OLFA 2I4LA 3VQXA 4HWOA 4HWTA 4H2XA 4EX5A 3WQZA 2ZT6A 4CH5A 2ZZGA 4UP9A 2ALYB 2CJBA 2ARSA 3E9IA 2RHQB 2PMEA 4YRCA 5ELOA 3IG2A 3UGTA 1EQRA 4TQFA 3I7FA 2DKGA 4H2XB 4YREA 4P74A 4YRTA 1B8AA 1WYDA 2ZINA 2EJ9A 3HTZA 3A31A 1JJCA 4WJ3M 3EFSA 1B70B 2Q5HA 1USYC 2ARTA 2XGTA 4P3OA 4ZTUB 1C0AA 3TEHB 3QO8A 4TWAA 2EJFA 2ZXFA 3HRKA 2ODRD 2ZGWA 2J3LA 3A5ZA 1EFWA 3MF2A 5K1PA 2E5AA 4TTVA 1KMMA 2DU5A 1X2HA 3RUXA 4H2TA 3NETA 3RKYA 2CIMA 4G84A 1KOGA 4YRLA 2C8MA 1B76A 1EOVA 1ATIA 2I4NA 4UPAA 3HFZA 3REXA 1SETA 2E3CA 2ZR2A 4YRGA 5K1XA 3KFUA 1ASYA 1ADJA 4YP0A 2CJ9A 2ZNJA 3CMQA 2EAYA 3E9HA 4P71A 4ZTZB 1BBUA 4BWAA 1HC7A 3TEGA 4YRQA 2QHTA 1WU7A 3HXZA 4XU0A 3M4PA 3PZCA 4CH6A 4NCXA 1B70A 2HNIA 3A7RA 4RQEA 4HVCA 1Z7MA 2PMFA 1YFTA 2DVEA 2QHSA 4CS4A 4WI1A 4X5OA 3VQYA 2AMCA 3P8VA 3UH0A 4RDXA 1J5WA 4H2YA 4XTXA 3MF1A 4YCWA 3M4QA 4KQEA 3P8YA 1WNLA 1JJCB 4XEOA 2ZR3A 2AKWB 2QHVA 1YB3A 3G1ZA 1N9WA 1WLEA 1NNHA 1YGBA 5KNNA 4TQDA 2CJAA 4OP0A 2E65A 1EIYB 2Q5IA 4UP7A 4P75C 4LNSA 4KR3A 1NJ8A 3BFMA 4P74C 4BW9A 3EFRA 1G5IA 2P5IA 1NYQA 1PYSA 4YPFA 1ASZA 1G51A 4CS3A 3L4GB 4XU3A 3IKMB 3ERRA 4TVWA 2DZ9A 4YRSA 3RACA 2XTIA 4XTZA 4YRFA 3UFGA 4H02A 4YRNA 2P0LA 3V7SA 3NELA 3NENA 5C52B 3QNEA 4YDQA 2IY5B 2I4MA 2DQ0A 1B7YA 4XU2A 3LC0A 2EL9A 4WF2A 1KMNA 2ZT7A 1HTTA 2ZT8A 3HXWA 1WPYA 1H4SA 1E24A 1H4TA 3IKLA 2RHQA 4WJ4A 4XU1A 4YROA 1G5HA 2AKWA 3L1AA 5ELNA 1USYA 3P8TA 4P72A 2E1HA 4HWRA 4TVAA 1FYFA 2ZNIA 4L87A 1IL2A 4YRRA 4K88A 3A74A 3RF1A 3HXUA 1E22A 3V8LA 1W66A 2ZCEA 3HRIA 1E1OA 1EVKA 3BJUA 3RKXA 4YRIA 4XTUA 4CH3A 3HXVA 3UGQA 4XTYA 4P3PA 3PCOA 1EVLA 2Q7EA 2DTOA 3RL6A 2J3MA 1BBWA 2RHSB 3PCOB 3V7CA 1NJ5A 2ZZEA 3R07A 3RKWA 3A32A 4CH4A 1SERA 2E64A 2EJGA 3HXYA 3A7AA 5C53B 1EIYA 1NJ1A 4YRJA 2E41A 4O2DA 1GGMA 1SRYA 2G4CA 2I4OA 4TVYA 1WQ7A 3V8JA 5HGQA 4RQFA 3L4GA 4Q6GA 2AMCB 4YYEA 4E51A 3HFZB 3HY1A 2DJZA 1H4VB 1X56A 2DZCA 3REUA 1E1TA 3HY0A 4H2UA 4H2SA 4UP8A 2DDZA 4G85A 3HXXA 1L0WA 3VQVA 1QF6A 4P3NA 2DXUA 1Z7NA 3LSSA 3TUPA 3QO5A 3A5YA 3NEMA 4YRMA 3VBBA 2QHUA 3W3SA 2DQ3A 4TVAB 2ZIMA 2DTHA 1HXDA 4PHCA 4CS2A 1ADYA 4DQ2A 4K87A 1YFRA 2DTIA 1BIAA 4XEMA 4KR2A 1H4QA 12ASA 2ZT5A 2DEQA 4J15A 1PYSB 1B7YB 1X54A 3OD1A 4XTVA 1QE0A 1RIQA 1LYLA 2FYKA 2ZZFA 4EO4A 4YRPA 4P73C 3L2ZA 4Q15A 4AH6A 3FJPA 2C7IA 3VQWA 3LSQA 1X01A 3QO7A 3A7UA 2E10A 2Q7GA 3IALA 4YCUA 3DSQA 4P71C 2RHSA 1X55A 4H2WA 3MEYA
chains in the Genus database with same CATH superfamily
4KHPE 1YFSA 4YRKA 2UUAE 2KHXA 2EPKX 2LUQA 1NYRA 1WHNA 2GHFA 3HXLA 1B69A 2ZIOA 4PG3A 2EZ6A 5E3IA 1UBDC 2E5LE 2EOXA 4O24A 3V8KA 5IXMB 4LFAE 2UXCE 4RMFA 1GTKA 1X3CA 4DUZE 2MKNA 2M7QA 3V7RA 3ADJA 3HFVA 11ASA 5F5WA 4YCVA 2DU7A 3ADGA 2FV4B 2B9DA 4ZYDA 5C51B 1SESA 5F3WA 1X2GA 4H2VA 2EMLA 4RHBB 4LVMA 1MEYC 3QTCA 2MC6A 2CGHA 4HA8A 1BIBA 4P72C 1NJ2A 3TEHA 4P73A 2DXTA 2A8EA 2EOSA 4LVKA 2LBSB 4XTWA 4LU9A 4LF6E 2IY5A 2UXBE 1NJ6A 2FGGA 4HWSA 3RGLA 4K86A 2Q7HA 3RIRA 1WQWA 2EWNA 2EJ4A 2A25A 2NA2A 4DV1E 4DPGA 2EM6A 2ALYA 2LO3A 4ZIBA 4R2PA 2ODRC 4TUGA 1EKZA 1VQZA 2VE7C 1DI2A 2ARUA 2ZTGA 1QU6A 2NUEA 4P75A 1BBGA 2RS7A 3ICAA 2EOIA 5DNYA 4O4KA 4HWPA 4OLFA 2I4LA 3VQXA 2VRDA 4HWOA 2L2KB 2YRMA 4HWTA 4H2XA 2EOOA 3J7Yp 4EX5A 3WQZA 1XNRE 5AE2A 2MDRA 1N32E 2ZT6A 1SFEA 5BR8E 1IQSA 2E72A 1HNZE 5KL3A 4CH5A 2EM3A 4WXCA 4P78A 2ZZGA 1PJQA 2R1FA 1T4OA 2ALYB 4UP9A 4JI8E 2CJBA 3F6HA 2LTRA 1EH8A 2YTNA 2ARSA 3E9IA 2RHQB 2PMEA 4YRCA 5ELOA 3MSWA 3IG2A 5LMUE 3UGTA 4WXDA 1EQRA 1PJSA 4F6NA 4TQFA 4F9CB 3I7FA 2DKGA 2EOYA 2EOJA 3DF6A 1YPNA 4LF4E 1ZAAC 4H2XB 4YREA 3T1YE 4LVIA 2VQFE 4P74A 4DR4E 4JI0E 1DGCA 2LE2A 2BB8A 1B8AA 3MHHC 4YRTA 4IS1C 2YTEA 1WYDA 2ZINA 1L4SA 2EJ9A 2JPAA 4NXME 3HTZA 1X48A 2EPNA 2DIXA 4R2EA 4GZNC 3A31A 4DV3E 2IHR1 1JJCA 4WJ3M 3EFSA 1PJTA 1B70B 2Q5HA 1G2DC 1USYC 2ARTA 4DV0E 2XGTA 4P3OA 3C4BA 4FK5C 4DV5E 4JI3E 4ZTUB 1C0AA 3TEHB 3QO8A 4F54A 4TWAA 2EJFA 2V85A 1UILA 2ZM6E 2ZXFA 2UXDE 2ODRD 4ZYHA 3HRKA 4P7DA 2ZGWA 2EQ3A 4KWYA 2J3LA 4HEIA 2LTSA 4LTYA 2JR1A 3A5ZA 3KZYA 4KZSA 1EFWA 3MF2A 3VK6A 2JVAA 5K1PA 4LF8E 2WBSA 4WSPA 2E5AA 4TTVA 1AH5A 1KMMA 3AUZA 2K7IA 1X2HA 3RUXA 2DU5A 4F2JC 4H2TA 5A69A 1RC7A 3NETA 3RKYA 1IBLE 2LJUA 2YTJA 1YZ9A 2CIMA 4G84A 3OMLA 1KOGA 1YYWA 4YRLA 2G7HA 2YSOA 2VQEE 3THOB 2C8MA 1ZU1A 1B76A 1EOVA 1I94E 2HC5A 1ATIA 2I4NA 3HFZA 4UPAA 3REXA 1SETA 2JYAA 2BBGA 3JTZA 2E3CA 2EORA 2EL5A 2ZR2A 4YRGA 5K1XA 3F6GA 4R2RA 3KFUA 3BF2A 4IJDA 1ASYA 3BBGA 1ADJA 2UUCE 1F2IG 5A6BD 4YP0A 2L92A 2CJ9A 1FKAE 5A6BA 2ELZA 1A1GA 1T39A 2ZNJA 3CMQA 2JY9A 4BC9A 2JP9A 2EAYA 2YPNA 4OOGC 3E9HA 2CPNA 4P71A 4ZTZB 2DRPA 1PDAA 1BBUA 4BWAA 5KL6A 3LLHA 1HC7A 3J81C 3TQMA 3T1HE 3TEGA 4YRQA 1YYOA 1RQ0A 4F9AB 2QHTA 1A1LA 1T38A 2Q8UA 4X8WA 4JI7E 3EPJA 5AE1A 2KONA 4F9BB 5A2QC 2V83A 1WU7A 2LMZA 2ELYA 4DR2E 1EH6A 3HXZA 3K6QA 4XU0A 1FJGE 3M4PA 4B3RE 2EPCA 3PZCA 1N3GA 2D9HA 2DB2A 4CH6A 4NCXA 1B70A 2HNIA 3A7RA 4RQEA 5AASA 2M9AA 5FLXC 4JI5E 2EMAA 4HVCA 1Z7MA 2PMFA 1GQEA 4WF2A 4DV6E 1YFTA 1SR9A 2L2NA 2JOBA 2EN3A 4R8OA 2LJHA 2DVEA 2EPRA 2B7VA 2PRTA 2QHSA 4CS4A 3ZOQB 4WI1A 2RPCA 4X5OA 4LVLA 4F6MA 4R2DA 5A6JA 3VQYA 3HPSA 4RH8A 2AMCA 3P8VA 2YTDA 3UH0A 1A1IA 1YYKA 4RDXA 1ZR9A 1J5WA 2NUGA 4H2YA 1J5EE 5LMNE 1X6FA 3C6MA 5ADZA 2B7TA 4XTXA 3J80C 5AC5A 3MF1A 4YCWA 2EM5A 2EMIA 1T4NA 1X5WA 3M4QA 1YFHA 5AE3A 4KQEA 2EM8A 4R2QA 3P8YA 3THNA 2NUFA 1WNLA 2YTFA 4B3ME 1MGTA 1JJCB 1WHQA 2RS6A 4XEOA 2YU8A 2ZR3A 2AKWB 2QHVA 3HTXA 2EMYA 4X62E 5LL6R 4WPYA 1YB3A 2MC5A 1N9WA 3G1ZA 4DR6E 1WLEA 3MHSC 5LLQA 4JI2E 4BHCA 2I9IA 1NNHA 2YTIA 1YGBA 5KNNA 2EMXA 2YU5A 4TQDA 1NEIA 2LT7A 1YUIA 2EMBA 5KL5A 3BIDA 2CJAA 2CT1A 4OP0A 2E65A 1EIYB 2Q5IA 4R2AA 2JXPA 4UP7A 2YRKA 4M9VC 2EOHA 5IWAE 5CFFE 1A1FA 3BGHA 2YTGA 4JV5E 4LNSA 1ZBTA 4P75C 1NJ8A 4KR3A 3BFMA 4P74C 4BW9A 3EFRA 2EMZA 1X6EA 2GPIA 4I8OA 4WYQB 1G5IA 1JK2A 4NHRA 4JYAE 2EMHA 1NYQA 1PYSA 2P5IA 4YPFA 1ASZA 1DQ3A 2YRHA 4DV4E 1G51A 4CS3A 2EOMA 2LVHA 4X66E 3L4GB 4XU3A 2R76A 1STUA 3IKMB 4NZVA 2N3HA 3ERRA 4TVWA 1EH7A 2DZ9A 4YRSA 4X65E 3RACA 2DGCA 2XTIA 2EMFA 2EMGA 2RQLA 4DMIA 2EN7A 4R03A 1XMQE 2GLIA 4XTZA 1X49A 4BS9A 5A6KA 4YRFA 3UFGA 2EQ0A 4H02A 4YRNA 2HJJA 4R2CA 2P0LA 4B3SE 1Z1BA 3V7SA 1A1KA 3NELA 3C6KA 1YUJA 3NENA 3RMPA 5C52B 3QNEA 5A6AA 1N33E 4B3TE 4YDQA 2IY5B 2I4MA 4BCAA 2DQ0A 2EL6A 1B7YA 4ZYEA 4M0VA 2EL9A 3JU0A 3HQ1A 3LC0A 4LFBE 1KMNA 4LF7E 2DMYA 1HTTA 2V87A 2YSPA 2ZT7A 2ZT8A 1WPYA 3HXWA 4J8ZA 1E24A 1H4SA 1H4TA 3IKLA 1IMUA 2RHQA 4WJ4A 4XU1A 1T4LB 3VHTB 4DR3E 2L8TA 2EPOA 2EMWA 2M4IA 1WJPA 3VYXA 1G5HA 2AKWA 4YROA 3L1AA 5ELNA 2JWOA 4HT4A 2WBUA 1HR0E 3VYYA 1USYA 3P8TA 4P72A 1WRJA 2E1HA 4HWRA 2L6MA 4TVAA 2YTOA 1FYFA 4LFCE 4YY3E 2DLKA 2ZNIA 3ECRA 1BBOA 4L87A 2RSMA 2CSHA 1IL2A 4YRRA 2EPAA 4K88A 3L00A 1IBME 3A74A 2YTPA 3RF1A 2N8XA 2EPMX 2CTDA 1A1HA 3HXUA 4GKKE 1E22A 3V8LA 1PKPA 1W66A 2FTXB 2ZCEA 1ZBQA 2J7JA 2EP3A 3HRIA 3P1XA 1O0WA 4K0KE 4JI1E 2ADRA 1HNXE 1E1OA 1EVKA 3BJUA 2EPXA 3FIGA 1N36E 2EN4A 3H09A 3RKXA 1KYQA 3AV0A 4HTGA 2EM4A 1TF3A 4YRIA 2KOUA 2UUBE 4XTUA 4WSGA 3ADIA 4O43A 2EN1A 4DV2E 2ENHA 4CH3A 3HXVA 1RMDA 3UGQA 4XTYA 4P3PA 4L8NA 3PCOA 3IWBA 1EVLA 4YHHE 2Q7EA 2EN6A 2LRSA 2MDGA 2DTOA 2LUPB 1GZ6A 2V88A 2J3MA 3RL6A 1BBWA 2RHSB 2L3CA 3PCOB 3V7CA 3QG5C 1NJ5A 1QNTA 2YZTA 2ZZEA 4DR1E 4BC7A 3R07A 3A32A 3RKWA 4CH4A 1SERA 3KWRA 4MLQA 2DSYA 2E64A 4L5NC 2DLQA 2MKDA 1IQOA 2EJGA 4M30A 2EE8A 2VF1A 5KL7A 1WXRA 3JAMC 3HXYA 3A7AA 5C53B 1EIYA 1NJ1A 4LF9E 2V8QB 2E41A 4YRJA 4O2DA 2YTQA 4XU2A 2L33A 1GGMA 1SRYA 2EN8A 2G4CA 2I4OA 4TVYA 1WQ7A 3V8JA 5HGQA 1P47A 2EPLX 4ZYGA 3L4GA 4Q6GA 4RQFA 4DR5E 1UHZA 4Q28A 4DUYE 2AMCB 3M99B 2UU9E 4YYEA 4E51A 1TF6A 1TN9A 2LCEA 3HFZB 2DJZA 3HY1A 1H4VB 1X56A 2DZCA 2K4VA 2DMIA 2EM2A 4GEQB 2EPZA 2B3TB 3HPZA 3EPHA 1E1TA 3REUA 2EL4A 3EQ1A 4JI4E 1X47A 3HY0A 1A1JA 4N4RB 1X6HA 3IWDA 2EQ1A 3EPKA 4BMJA 4AQYE 4H2SA 2DDZA 4H2UA 4UP8A 4WX9A 4G85A 3HXXA 1L0WA 2EN2A 3VQVA 2RSIA 1QF6A 2YWQA 1IBKE 3DJWA 2NABA 4M2ZA 2I13A 1BB8A 4P3NA 2DXUA 2EMKA 2HGHA 3ADLA 1Z7NA 2L3JA 3LSSA 3TUPA 3QO5A 2EOEA 1JK1A 4BHBA 3A5YA 3NEMA 2EM0A 4DKKA 1YSAC 4WFTA 4YRMA 1UN6B 1J26A 2EWLA 2YT4A 3VBBA 3J7AG 2F4VE 2QHUA 4JI6E 3W3SA 2DQ3A 5IT9C 4Q35B 1LLMC 4TVAB 1G2FC 2F8BA 1XNQE 2ZIMA 3UK3C 2DTHA 2M1SA 1HXDA 4PHCA 4X64E 1ADYA 4CS2A 4DQ2A 4O5GA 2WBTA 4K87A 5T6JA 4DV7E 5TSEA 2RTXA 2EOQA 2EOFA 1XMOE 1YFRA 2DTIA 5KL4A 1BIAA 2EM7A 4XEMA 2EPUA 2HHHE 4BBYA 1N34E 4KR2A 2WCC3 3C4TA 4TUIA 12ASA 1H4QA 2ZT5A 2DEQA 4GKJE 2JOXA 4NXNE 2E1MA 1AAYA 4J15A 4LVJA 2NS6A 1NCSA 1PYSB 2L2MA 2V89A 1B7YB 5AC4A 1X54A 3OD1A 1QE0A 5KL2A 1LYLA 1RIQA 4XTVA 2FYKA 2ZZFA 2EM9A 4EO4A 4YRPA 4P73C 3EPLA 3L2ZA 4Q15A 4AH6A 3FJPA 2N3GA 4MLVA 2C7IA 1KJKA 3VQWA 3MQZA 2LV2A 3LSQA 4X9JA 2ENAA 1X01A 2EMCA 3QO7A 3LMLA 3A7UA 4OX9E 2WZOA 2E10A 2Q7GA 3IALA 4YCUA 1HNWE 3IWCA 3DSQA 2EOZA 4P71C 2V86A 4LF5E 4DR7E 2H36X 5IV8B 2RHSA 1X55A 2ENCA 2EPPA 4H2WA 4R2SA 3OTOE 3MEYA 3KZZA
chains in the Genus database with same CATH topology
4KHPE 1YFSA 4YRKA 2UUAE 2KHXA 2LUQA 1NYRA 1WHNA 3HXLA 2ZIOA 4PG3A 2EZ6A 5E3IA 2E5LE 3V8KA 4LFAE 2UXCE 4RMFA 4DUZE 2M7QA 3V7RA 3ADJA 3HFVA 11ASA 5F5WA 4YCVA 2DU7A 3ADGA 2FV4B 2B9DA 5C51B 1SESA 5F3WA 1X2GA 4H2VA 4LVMA 3QTCA 2MC6A 2CGHA 4HA8A 1BIBA 4P72C 1NJ2A 3TEHA 4P73A 2DXTA 2A8EA 4LVKA 2LBSB 4XTWA 4LU9A 4LF6E 2IY5A 2UXBE 1NJ6A 2FGGA 4HWSA 3RGLA 4K86A 2Q7HA 3RIRA 1WQWA 2EWNA 2NA2A 4DV1E 4DPGA 2ALYA 4ZIBA 1EKZA 2ODRC 4TUGA 1VQZA 2ZTGA 2VE7C 1DI2A 2ARUA 1QU6A 2NUEA 4P75A 2RS7A 3ICAA 5DNYA 4HWPA 4OLFA 2I4LA 3VQXA 4HWOA 2L2KB 4HWTA 4H2XA 3J7Yp 4EX5A 3WQZA 1XNRE 5AE2A 2MDRA 1N32E 2ZT6A 5BR8E 1HNZE 4CH5A 4P78A 2ZZGA 1T4OA 2ALYB 4UP9A 4JI8E 2CJBA 3F6HA 2LTRA 2ARSA 3E9IA 2RHQB 2PMEA 4YRCA 5ELOA 3MSWA 3IG2A 5LMUE 3UGTA 1EQRA 4TQFA 4F9CB 3I7FA 2DKGA 4LF4E 4LVIA 3DF6A 4H2XB 4YREA 3T1YE 2VQFE 4P74A 4DR4E 4JI0E 2LE2A 4YRTA 1B8AA 1WYDA 2ZINA 2EJ9A 4NXME 3HTZA 1X48A 2DIXA 3A31A 4DV3E 2IHR1 1JJCA 4WJ3M 3EFSA 1B70B 2Q5HA 1USYC 2ARTA 4DV0E 2XGTA 4P3OA 3C4BA 4DV5E 4JI3E 4ZTUB 1C0AA 3TEHB 3QO8A 4F54A 4TWAA 2EJFA 2V85A 1UILA 2ZM6E 2ZXFA 2UXDE 2ODRD 3HRKA 4P7DA 2ZGWA 2J3LA 2LTSA 2JR1A 4LTYA 3A5ZA 4KZSA 1EFWA 3MF2A 3VK6A 2JVAA 5K1PA 4LF8E 4WSPA 2E5AA 4TTVA 1KMMA 3AUZA 1X2HA 3RUXA 2DU5A 4H2TA 1RC7A 3NETA 3RKYA 1IBLE 1YZ9A 2CIMA 4G84A 3OMLA 1KOGA 1YYWA 4YRLA 2G7HA 2VQEE 2C8MA 1B76A 1EOVA 1I94E 1ATIA 2I4NA 4UPAA 3HFZA 3REXA 1SETA 3JTZA 2E3CA 2ZR2A 4YRGA 5K1XA 3F6GA 3KFUA 1ASYA 1ADJA 2UUCE 4YP0A 2L92A 2CJ9A 1FKAE 2ZNJA 3CMQA 2JY9A 4BC9A 2EAYA 4OOGC 3E9HA 2CPNA 4P71A 4ZTZB 1BBUA 4BWAA 3LLHA 1HC7A 3J81C 3T1HE 3TEGA 4YRQA 1YYOA 1RQ0A 4F9AB 2QHTA 4X8WA 4JI7E 5AE1A 2KONA 4F9BB 5A2QC 2V83A 1WU7A 2LMZA 4DR2E 3HXZA 4XU0A 3K6QA 1FJGE 3M4PA 4B3RE 3PZCA 4CH6A 2DB2A 4NCXA 1B70A 2HNIA 3A7RA 4RQEA 5AASA 4JI5E 5FLXC 4HVCA 1Z7MA 2PMFA 1GQEA 4DV6E 1YFTA 1SR9A 2L2NA 2JOBA 4R8OA 2LJHA 2DVEA 2QHSA 2B7VA 4CS4A 3ZOQB 4WI1A 4X5OA 4LVLA 3VQYA 3HPSA 2AMCA 3P8VA 3UH0A 1YYKA 4RDXA 1J5WA 2NUGA 4H2YA 1J5EE 5LMNE 5ADZA 4XTXA 2B7TA 3J80C 3MF1A 4YCWA 1T4NA 3M4QA 5AE3A 4KQEA 3P8YA 2NUFA 1WNLA 4B3ME 1JJCB 1WHQA 2RS6A 4XEOA 2ZR3A 2AKWB 2QHVA 3HTXA 4X62E 5LL6R 4WPYA 1YB3A 2MC5A 1N9WA 3G1ZA 4DR6E 1WLEA 4JI2E 1NNHA 1YGBA 5KNNA 4TQDA 2CJAA 4OP0A 2E65A 1EIYB 2Q5IA 4UP7A 5IWAE 5CFFE 4JV5E 4LNSA 4P75C 1ZBTA 4KR3A 1NJ8A 3BFMA 4P74C 4BW9A 3EFRA 4I8OA 4WYQB 1G5IA 4JYAE 2P5IA 1NYQA 1PYSA 4YPFA 1ASZA 1DQ3A 4DV4E 1G51A 4CS3A 4X66E 3L4GB 4XU3A 1STUA 3IKMB 2N3HA 3ERRA 4TVWA 2DZ9A 4YRSA 4X65E 3RACA 2XTIA 4DMIA 4R03A 1XMQE 4XTZA 4YRFA 1X49A 4BS9A 3UFGA 4H02A 4YRNA 2P0LA 4B3SE 3V7SA 3NELA 3NENA 3RMPA 5C52B 3QNEA 1N33E 4B3TE 4YDQA 2IY5B 2I4MA 4BCAA 2DQ0A 1B7YA 4XU2A 3LC0A 4M0VA 2EL9A 3JU0A 3HQ1A 4WF2A 1KMNA 4LFBE 4LF7E 2DMYA 1HTTA 2V87A 2ZT7A 2ZT8A 3HXWA 1WPYA 4J8ZA 1E24A 1H4SA 1H4TA 3IKLA 2RHQA 4WJ4A 4XU1A 1T4LB 4DR3E 2L8TA 4YROA 2M4IA 3VYXA 1G5HA 2AKWA 3L1AA 5ELNA 2JWOA 4HT4A 1HR0E 3VYYA 1USYA 3P8TA 4P72A 2E1HA 4HWRA 2L6MA 4TVAA 1FYFA 4LFCE 4YY3E 2ZNIA 4L87A 2RSMA 1IL2A 4YRRA 4K88A 1IBME 3A74A 3RF1A 3HXUA 1E22A 4GKKE 3V8LA 1PKPA 1W66A 2FTXB 2ZCEA 1ZBQA 3HRIA 3P1XA 1O0WA 4K0KE 4JI1E 1E1OA 1HNXE 1EVKA 3BJUA 3FIGA 1N36E 3H09A 3RKXA 3AV0A 4YRIA 2KOUA 2UUBE 4XTUA 3ADIA 4DV2E 4CH3A 3HXVA 3UGQA 4XTYA 4P3PA 4L8NA 3PCOA 3IWBA 1EVLA 4YHHE 2Q7EA 2LRSA 2DTOA 2LUPB 1GZ6A 2V88A 2J3MA 3RL6A 1BBWA 2RHSB 2L3CA 3PCOB 3V7CA 1NJ5A 2YZTA 2ZZEA 4DR1E 4BC7A 3R07A 3A32A 3RKWA 4CH4A 1SERA 3KWRA 2E64A 2DSYA 2EJGA 4L5NC 4M30A 2VF1A 1WXRA 3JAMC 3HXYA 3A7AA 5C53B 1EIYA 1NJ1A 4LF9E 2V8QB 2E41A 4YRJA 4O2DA 2L33A 1GGMA 1SRYA 2G4CA 2I4OA 4TVYA 1WQ7A 3V8JA 5HGQA 4RQFA 3L4GA 4Q6GA 4DR5E 1UHZA 4Q28A 4DUYE 2AMCB 2UU9E 4YYEA 4E51A 3HFZB 3HY1A 2DJZA 1H4VB 1X56A 2DZCA 2K4VA 4GEQB 2B3TB 3HPZA 3REUA 1E1TA 4JI4E 1X47A 3HY0A 3IWDA 4AQYE 4H2UA 4BMJA 4H2SA 4UP8A 2DDZA 4G85A 3HXXA 1L0WA 3VQVA 1QF6A 1IBKE 3DJWA 4M2ZA 4P3NA 2DXUA 3ADLA 1Z7NA 2L3JA 3LSSA 3TUPA 3QO5A 3A5YA 3NEMA 4DKKA 4WFTA 4YRMA 1J26A 2EWLA 2YT4A 3VBBA 3J7AG 2F4VE 2QHUA 4JI6E 3W3SA 2DQ3A 5IT9C 4TVAB 2F8BA 1XNQE 2ZIMA 2DTHA 2M1SA 1HXDA 4PHCA 4X64E 1ADYA 4CS2A 4DQ2A 4K87A 5T6JA 4DV7E 2RTXA 1XMOE 1YFRA 2DTIA 1BIAA 4XEMA 2HHHE 4BBYA 1N34E 4KR2A 3C4TA 4TUIA 12ASA 1H4QA 2ZT5A 2DEQA 4GKJE 2JOXA 4NXNE 2E1MA 4J15A 4LVJA 2NS6A 1PYSB 2L2MA 2V89A 1B7YB 1X54A 3OD1A 4XTVA 1QE0A 1RIQA 1LYLA 2FYKA 2ZZFA 4EO4A 4YRPA 4P73C 3L2ZA 4Q15A 4AH6A 3FJPA 2N3GA 2C7IA 3VQWA 3MQZA 3LSQA 1X01A 3QO7A 3LMLA 3A7UA 4OX9E 2WZOA 2E10A 2Q7GA 3IALA 4YCUA 1HNWE 3IWCA 3DSQA 4P71C 2V86A 4LF5E 4DR7E 2H36X 2RHSA 1X55A 4H2WA 3OTOE 3MEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFS A;  4YRK A;  1NYR A;  2ZIO A;  4PG3 A;  5E3I A;  3V8K A;  4RMF A;  3V7R A;  3HFV A;  11AS A;  5F5W A;  4YCV A;  2DU7 A;  5C51 B;  1SES A;  1X2G A;  4H2V A;  3QTC A;  2CGH A;  4HA8 A;  1BIB A;  4P72 C;  1NJ2 A;  3TEH A;  4P73 A;  2DXT A;  4XTW A;  2IY5 A;  1NJ6 A;  4HWS A;  3RGL A;  4K86 A;  2Q7H A;  3RIR A;  1WQW A;  2EWN A;  4DPG A;  2ALY A;  4ZIB A;  2ODR C;  1VQZ A;  2ZTG A;  2ARU A;  4P75 A;  3ICA A;  4HWP A;  4OLF A;  2I4L A;  3VQX A;  4HWO A;  4HWT A;  4H2X A;  4EX5 A;  3WQZ A;  2ZT6 A;  4CH5 A;  2ZZG A;  4UP9 A;  2ALY B;  2CJB A;  2ARS A;  3E9I A;  2RHQ B;  2PME A;  4YRC A;  5ELO A;  3IG2 A;  3UGT A;  1EQR A;  4TQF A;  3I7F A;  2DKG A;  4H2X B;  4YRE A;  4P74 A;  4YRT A;  1B8A A;  1WYD A;  2ZIN A;  2EJ9 A;  3HTZ A;  3A31 A;  1JJC A;  4WJ3 M;  3EFS A;  1B70 B;  2Q5H A;  1USY C;  2ART A;  2XGT A;  4P3O A;  4ZTU B;  1C0A A;  3TEH B;  3QO8 A;  4TWA A;  2EJF A;  2ZXF A;  3HRK A;  2ODR D;  2ZGW A;  2J3L A;  3A5Z A;  1EFW A;  3MF2 A;  5K1P A;  2E5A A;  4TTV A;  1KMM A;  2DU5 A;  1X2H A;  3RUX A;  4H2T A;  3NET A;  3RKY A;  2CIM A;  4G84 A;  1KOG A;  4YRL A;  2C8M A;  1B76 A;  1EOV A;  1ATI A;  2I4N A;  4UPA A;  3HFZ A;  3REX A;  1SET A;  2E3C A;  2ZR2 A;  4YRG A;  5K1X A;  3KFU A;  1ASY A;  1ADJ A;  4YP0 A;  2CJ9 A;  2ZNJ A;  3CMQ A;  2EAY A;  3E9H A;  4P71 A;  4ZTZ B;  1BBU A;  4BWA A;  1HC7 A;  3TEG A;  4YRQ A;  2QHT A;  1WU7 A;  3HXZ A;  4XU0 A;  3M4P A;  3PZC A;  4CH6 A;  4NCX A;  1B70 A;  2HNI A;  3A7R A;  4RQE A;  4HVC A;  1Z7M A;  2PMF A;  1YFT A;  2DVE A;  2QHS A;  4CS4 A;  4WI1 A;  4X5O A;  3VQY A;  2AMC A;  3P8V A;  3UH0 A;  4RDX A;  1J5W A;  4H2Y A;  4XTX A;  3MF1 A;  4YCW A;  3M4Q A;  4KQE A;  3P8Y A;  1WNL A;  1JJC B;  4XEO A;  2ZR3 A;  2AKW B;  2QHV A;  1YB3 A;  3G1Z A;  1N9W A;  1WLE A;  1NNH A;  1YGB A;  5KNN A;  4TQD A;  2CJA A;  4OP0 A;  2E65 A;  1EIY B;  2Q5I A;  4UP7 A;  4P75 C;  4LNS A;  4KR3 A;  1NJ8 A;  3BFM A;  4P74 C;  4BW9 A;  3EFR A;  1G5I A;  2P5I A;  1NYQ A;  1PYS A;  4YPF A;  1ASZ A;  1G51 A;  4CS3 A;  3L4G B;  4XU3 A;  3IKM B;  3ERR A;  4TVW A;  2DZ9 A;  4YRS A;  3RAC A;  2XTI A;  4XTZ A;  4YRF A;  3UFG A;  4H02 A;  4YRN A;  2P0L A;  3V7S A;  3NEL A;  3NEN A;  5C52 B;  3QNE A;  4YDQ A;  2IY5 B;  2I4M A;  2DQ0 A;  1B7Y A;  4XU2 A;  3LC0 A;  2EL9 A;  4WF2 A;  1KMN A;  2ZT7 A;  1HTT A;  2ZT8 A;  3HXW A;  1WPY A;  1H4S A;  1E24 A;  1H4T A;  3IKL A;  2RHQ A;  4WJ4 A;  4XU1 A;  4YRO A;  1G5H A;  2AKW A;  3L1A A;  5ELN A;  1USY A;  3P8T A;  4P72 A;  2E1H A;  4HWR A;  4TVA A;  1FYF A;  2ZNI A;  4L87 A;  1IL2 A;  4YRR A;  4K88 A;  3A74 A;  3RF1 A;  3HXU A;  1E22 A;  3V8L A;  1W66 A;  2ZCE A;  3HRI A;  1E1O A;  1EVK A;  3BJU A;  3RKX A;  4YRI A;  4XTU A;  4CH3 A;  3HXV A;  3UGQ A;  4XTY A;  4P3P A;  3PCO A;  1EVL A;  2Q7E A;  2DTO A;  3RL6 A;  2J3M A;  1BBW A;  2RHS B;  3PCO B;  3V7C A;  1NJ5 A;  2ZZE A;  3R07 A;  3RKW A;  3A32 A;  4CH4 A;  1SER A;  2E64 A;  2EJG A;  3HXY A;  3A7A A;  5C53 B;  1EIY A;  1NJ1 A;  4YRJ A;  2E41 A;  4O2D A;  1GGM A;  1SRY A;  2G4C A;  2I4O A;  4TVY A;  1WQ7 A;  3V8J A;  5HGQ A;  4RQF A;  3L4G A;  4Q6G A;  2AMC B;  4YYE A;  4E51 A;  3HFZ B;  3HY1 A;  2DJZ A;  1H4V B;  1X56 A;  2DZC A;  3REU A;  1E1T A;  3HY0 A;  4H2U A;  4H2S A;  4UP8 A;  2DDZ A;  4G85 A;  3HXX A;  1L0W A;  3VQV A;  1QF6 A;  4P3N A;  2DXU A;  1Z7N A;  3LSS A;  3TUP A;  3QO5 A;  3A5Y A;  3NEM A;  4YRM A;  3VBB A;  2QHU A;  3W3S A;  2DQ3 A;  4TVA B;  2ZIM A;  2DTH A;  1HXD A;  4PHC A;  4CS2 A;  1ADY A;  4DQ2 A;  4K87 A;  1YFR A;  2DTI A;  1BIA A;  4XEM A;  4KR2 A;  1H4Q A;  12AS A;  2ZT5 A;  2DEQ A;  4J15 A;  1PYS B;  1B7Y B;  1X54 A;  3OD1 A;  4XTV A;  1QE0 A;  1RIQ A;  1LYL A;  2FYK A;  2ZZF A;  4EO4 A;  4YRP A;  4P73 C;  3L2Z A;  4Q15 A;  4AH6 A;  3FJP A;  2C7I A;  3VQW A;  3LSQ A;  1X01 A;  3QO7 A;  3A7U A;  2E10 A;  2Q7G A;  3IAL A;  4YCU A;  3DSQ A;  4P71 C;  2RHS A;  1X55 A;  4H2W A;  3MEY A; 
#chains in the Genus database with same CATH topology
 4KHP E;  1YFS A;  4YRK A;  2UUA E;  2KHX A;  2EPK X;  2LUQ A;  1NYR A;  1WHN A;  2GHF A;  3HXL A;  1B69 A;  2ZIO A;  4PG3 A;  2EZ6 A;  5E3I A;  1UBD C;  2E5L E;  2EOX A;  4O24 A;  3V8K A;  5IXM B;  4LFA E;  2UXC E;  4RMF A;  1GTK A;  1X3C A;  4DUZ E;  2MKN A;  2M7Q A;  3V7R A;  3ADJ A;  3HFV A;  11AS A;  5F5W A;  4YCV A;  2DU7 A;  3ADG A;  2FV4 B;  2B9D A;  4ZYD A;  5C51 B;  1SES A;  5F3W A;  1X2G A;  4H2V A;  2EML A;  4RHB B;  4LVM A;  1MEY C;  3QTC A;  2MC6 A;  2CGH A;  4HA8 A;  1BIB A;  4P72 C;  1NJ2 A;  3TEH A;  4P73 A;  2DXT A;  2A8E A;  2EOS A;  4LVK A;  2LBS B;  4XTW A;  4LU9 A;  4LF6 E;  2IY5 A;  2UXB E;  1NJ6 A;  2FGG A;  4HWS A;  3RGL A;  4K86 A;  2Q7H A;  3RIR A;  1WQW A;  2EWN A;  2EJ4 A;  2A25 A;  2NA2 A;  4DV1 E;  4DPG A;  2EM6 A;  2ALY A;  2LO3 A;  4ZIB A;  4R2P A;  2ODR C;  4TUG A;  1EKZ A;  1VQZ A;  2VE7 C;  1DI2 A;  2ARU A;  2ZTG A;  1QU6 A;  2NUE A;  4P75 A;  1BBG A;  2RS7 A;  3ICA A;  2EOI A;  5DNY A;  4O4K A;  4HWP A;  4OLF A;  2I4L A;  3VQX A;  2VRD A;  4HWO A;  2L2K B;  2YRM A;  4HWT A;  4H2X A;  2EOO A;  3J7Y p;  4EX5 A;  3WQZ A;  1XNR E;  5AE2 A;  2MDR A;  1N32 E;  2ZT6 A;  1SFE A;  5BR8 E;  1IQS A;  2E72 A;  1HNZ E;  5KL3 A;  4CH5 A;  2EM3 A;  4WXC A;  4P78 A;  2ZZG A;  1PJQ A;  2R1F A;  1T4O A;  2ALY B;  4UP9 A;  4JI8 E;  2CJB A;  3F6H A;  2LTR A;  1EH8 A;  2YTN A;  2ARS A;  3E9I A;  2RHQ B;  2PME A;  4YRC A;  5ELO A;  3MSW A;  3IG2 A;  5LMU E;  3UGT A;  4WXD A;  1EQR A;  1PJS A;  4F6N A;  4TQF A;  4F9C B;  3I7F A;  2DKG A;  2EOY A;  2EOJ A;  3DF6 A;  1YPN A;  4LF4 E;  1ZAA C;  4H2X B;  4YRE A;  3T1Y E;  4LVI A;  2VQF E;  4P74 A;  4DR4 E;  4JI0 E;  1DGC A;  2LE2 A;  2BB8 A;  1B8A A;  3MHH C;  4YRT A;  4IS1 C;  2YTE A;  1WYD A;  2ZIN A;  1L4S A;  2EJ9 A;  2JPA A;  4NXM E;  3HTZ A;  1X48 A;  2EPN A;  2DIX A;  4R2E A;  4GZN C;  3A31 A;  4DV3 E;  2IHR 1;  1JJC A;  4WJ3 M;  3EFS A;  1PJT A;  1B70 B;  2Q5H A;  1G2D C;  1USY C;  2ART A;  4DV0 E;  2XGT A;  4P3O A;  3C4B A;  4FK5 C;  4DV5 E;  4JI3 E;  4ZTU B;  1C0A A;  3TEH B;  3QO8 A;  4F54 A;  4TWA A;  2EJF A;  2V85 A;  1UIL A;  2ZM6 E;  2ZXF A;  2UXD E;  2ODR D;  4ZYH A;  3HRK A;  4P7D A;  2ZGW A;  2EQ3 A;  4KWY A;  2J3L A;  4HEI A;  2LTS A;  4LTY A;  2JR1 A;  3A5Z A;  3KZY A;  4KZS A;  1EFW A;  3MF2 A;  3VK6 A;  2JVA A;  5K1P A;  4LF8 E;  2WBS A;  4WSP A;  2E5A A;  4TTV A;  1AH5 A;  1KMM A;  3AUZ A;  2K7I A;  1X2H A;  3RUX A;  2DU5 A;  4F2J C;  4H2T A;  5A69 A;  1RC7 A;  3NET A;  3RKY A;  1IBL E;  2LJU A;  2YTJ A;  1YZ9 A;  2CIM A;  4G84 A;  3OML A;  1KOG A;  1YYW A;  4YRL A;  2G7H A;  2YSO A;  2VQE E;  3THO B;  2C8M A;  1ZU1 A;  1B76 A;  1EOV A;  1I94 E;  2HC5 A;  1ATI A;  2I4N A;  3HFZ A;  4UPA A;  3REX A;  1SET A;  2JYA A;  2BBG A;  3JTZ A;  2E3C A;  2EOR A;  2EL5 A;  2ZR2 A;  4YRG A;  5K1X A;  3F6G A;  4R2R A;  3KFU A;  3BF2 A;  4IJD A;  1ASY A;  3BBG A;  1ADJ A;  2UUC E;  1F2I G;  5A6B D;  4YP0 A;  2L92 A;  2CJ9 A;  1FKA E;  5A6B A;  2ELZ A;  1A1G A;  1T39 A;  2ZNJ A;  3CMQ A;  2JY9 A;  4BC9 A;  2JP9 A;  2EAY A;  2YPN A;  4OOG C;  3E9H A;  2CPN A;  4P71 A;  4ZTZ B;  2DRP A;  1PDA A;  1BBU A;  4BWA A;  5KL6 A;  3LLH A;  1HC7 A;  3J81 C;  3TQM A;  3T1H E;  3TEG A;  4YRQ A;  1YYO A;  1RQ0 A;  4F9A B;  2QHT A;  1A1L A;  1T38 A;  2Q8U A;  4X8W A;  4JI7 E;  3EPJ A;  5AE1 A;  2KON A;  4F9B B;  5A2Q C;  2V83 A;  1WU7 A;  2LMZ A;  2ELY A;  4DR2 E;  1EH6 A;  3HXZ A;  3K6Q A;  4XU0 A;  1FJG E;  3M4P A;  4B3R E;  2EPC A;  3PZC A;  1N3G A;  2D9H A;  2DB2 A;  4CH6 A;  4NCX A;  1B70 A;  2HNI A;  3A7R A;  4RQE A;  5AAS A;  2M9A A;  5FLX C;  4JI5 E;  2EMA A;  4HVC A;  1Z7M A;  2PMF A;  1GQE A;  4WF2 A;  4DV6 E;  1YFT A;  1SR9 A;  2L2N A;  2JOB A;  2EN3 A;  4R8O A;  2LJH A;  2DVE A;  2EPR A;  2B7V A;  2PRT A;  2QHS A;  4CS4 A;  3ZOQ B;  4WI1 A;  2RPC A;  4X5O A;  4LVL A;  4F6M A;  4R2D A;  5A6J A;  3VQY A;  3HPS A;  4RH8 A;  2AMC A;  3P8V A;  2YTD A;  3UH0 A;  1A1I A;  1YYK A;  4RDX A;  1ZR9 A;  1J5W A;  2NUG A;  4H2Y A;  1J5E E;  5LMN E;  1X6F A;  3C6M A;  5ADZ A;  2B7T A;  4XTX A;  3J80 C;  5AC5 A;  3MF1 A;  4YCW A;  2EM5 A;  2EMI A;  1T4N A;  1X5W A;  3M4Q A;  1YFH A;  5AE3 A;  4KQE A;  2EM8 A;  4R2Q A;  3P8Y A;  3THN A;  2NUF A;  1WNL A;  2YTF A;  4B3M E;  1MGT A;  1JJC B;  1WHQ A;  2RS6 A;  4XEO A;  2YU8 A;  2ZR3 A;  2AKW B;  2QHV A;  3HTX A;  2EMY A;  4X62 E;  5LL6 R;  4WPY A;  1YB3 A;  2MC5 A;  1N9W A;  3G1Z A;  4DR6 E;  1WLE A;  3MHS C;  5LLQ A;  4JI2 E;  4BHC A;  2I9I A;  1NNH A;  2YTI A;  1YGB A;  5KNN A;  2EMX A;  2YU5 A;  4TQD A;  1NEI A;  2LT7 A;  1YUI A;  2EMB A;  5KL5 A;  3BID A;  2CJA A;  2CT1 A;  4OP0 A;  2E65 A;  1EIY B;  2Q5I A;  4R2A A;  2JXP A;  4UP7 A;  2YRK A;  4M9V C;  2EOH A;  5IWA E;  5CFF E;  1A1F A;  3BGH A;  2YTG A;  4JV5 E;  4LNS A;  1ZBT A;  4P75 C;  1NJ8 A;  4KR3 A;  3BFM A;  4P74 C;  4BW9 A;  3EFR A;  2EMZ A;  1X6E A;  2GPI A;  4I8O A;  4WYQ B;  1G5I A;  1JK2 A;  4NHR A;  4JYA E;  2EMH A;  1NYQ A;  1PYS A;  2P5I A;  4YPF A;  1ASZ A;  1DQ3 A;  2YRH A;  4DV4 E;  1G51 A;  4CS3 A;  2EOM A;  2LVH A;  4X66 E;  3L4G B;  4XU3 A;  2R76 A;  1STU A;  3IKM B;  4NZV A;  2N3H A;  3ERR A;  4TVW A;  1EH7 A;  2DZ9 A;  4YRS A;  4X65 E;  3RAC A;  2DGC A;  2XTI A;  2EMF A;  2EMG A;  2RQL A;  4DMI A;  2EN7 A;  4R03 A;  1XMQ E;  2GLI A;  4XTZ A;  1X49 A;  4BS9 A;  5A6K A;  4YRF A;  3UFG A;  2EQ0 A;  4H02 A;  4YRN A;  2HJJ A;  4R2C A;  2P0L A;  4B3S E;  1Z1B A;  3V7S A;  1A1K A;  3NEL A;  3C6K A;  1YUJ A;  3NEN A;  3RMP A;  5C52 B;  3QNE A;  5A6A A;  1N33 E;  4B3T E;  4YDQ A;  2IY5 B;  2I4M A;  4BCA A;  2DQ0 A;  2EL6 A;  1B7Y A;  4ZYE A;  4M0V A;  2EL9 A;  3JU0 A;  3HQ1 A;  3LC0 A;  4LFB E;  1KMN A;  4LF7 E;  2DMY A;  1HTT A;  2V87 A;  2YSP A;  2ZT7 A;  2ZT8 A;  1WPY A;  3HXW A;  4J8Z A;  1E24 A;  1H4S A;  1H4T A;  3IKL A;  1IMU A;  2RHQ A;  4WJ4 A;  4XU1 A;  1T4L B;  3VHT B;  4DR3 E;  2L8T A;  2EPO A;  2EMW A;  2M4I A;  1WJP A;  3VYX A;  1G5H A;  2AKW A;  4YRO A;  3L1A A;  5ELN A;  2JWO A;  4HT4 A;  2WBU A;  1HR0 E;  3VYY A;  1USY A;  3P8T A;  4P72 A;  1WRJ A;  2E1H A;  4HWR A;  2L6M A;  4TVA A;  2YTO A;  1FYF A;  4LFC E;  4YY3 E;  2DLK A;  2ZNI A;  3ECR A;  1BBO A;  4L87 A;  2RSM A;  2CSH A;  1IL2 A;  4YRR A;  2EPA A;  4K88 A;  3L00 A;  1IBM E;  3A74 A;  2YTP A;  3RF1 A;  2N8X A;  2EPM X;  2CTD A;  1A1H A;  3HXU A;  4GKK E;  1E22 A;  3V8L A;  1PKP A;  1W66 A;  2FTX B;  2ZCE A;  1ZBQ A;  2J7J A;  2EP3 A;  3HRI A;  3P1X A;  1O0W A;  4K0K E;  4JI1 E;  2ADR A;  1HNX E;  1E1O A;  1EVK A;  3BJU A;  2EPX A;  3FIG A;  1N36 E;  2EN4 A;  3H09 A;  3RKX A;  1KYQ A;  3AV0 A;  4HTG A;  2EM4 A;  1TF3 A;  4YRI A;  2KOU A;  2UUB E;  4XTU A;  4WSG A;  3ADI A;  4O43 A;  2EN1 A;  4DV2 E;  2ENH A;  4CH3 A;  3HXV A;  1RMD A;  3UGQ A;  4XTY A;  4P3P A;  4L8N A;  3PCO A;  3IWB A;  1EVL A;  4YHH E;  2Q7E A;  2EN6 A;  2LRS A;  2MDG A;  2DTO A;  2LUP B;  1GZ6 A;  2V88 A;  2J3M A;  3RL6 A;  1BBW A;  2RHS B;  2L3C A;  3PCO B;  3V7C A;  3QG5 C;  1NJ5 A;  1QNT A;  2YZT A;  2ZZE A;  4DR1 E;  4BC7 A;  3R07 A;  3A32 A;  3RKW A;  4CH4 A;  1SER A;  3KWR A;  4MLQ A;  2DSY A;  2E64 A;  4L5N C;  2DLQ A;  2MKD A;  1IQO A;  2EJG A;  4M30 A;  2EE8 A;  2VF1 A;  5KL7 A;  1WXR A;  3JAM C;  3HXY A;  3A7A A;  5C53 B;  1EIY A;  1NJ1 A;  4LF9 E;  2V8Q B;  2E41 A;  4YRJ A;  4O2D A;  2YTQ A;  4XU2 A;  2L33 A;  1GGM A;  1SRY A;  2EN8 A;  2G4C A;  2I4O A;  4TVY A;  1WQ7 A;  3V8J A;  5HGQ A;  1P47 A;  2EPL X;  4ZYG A;  3L4G A;  4Q6G A;  4RQF A;  4DR5 E;  1UHZ A;  4Q28 A;  4DUY E;  2AMC B;  3M99 B;  2UU9 E;  4YYE A;  4E51 A;  1TF6 A;  1TN9 A;  2LCE A;  3HFZ B;  2DJZ A;  3HY1 A;  1H4V B;  1X56 A;  2DZC A;  2K4V A;  2DMI A;  2EM2 A;  4GEQ B;  2EPZ A;  2B3T B;  3HPZ A;  3EPH A;  1E1T A;  3REU A;  2EL4 A;  3EQ1 A;  4JI4 E;  1X47 A;  3HY0 A;  1A1J A;  4N4R B;  1X6H A;  3IWD A;  2EQ1 A;  3EPK A;  4BMJ A;  4AQY E;  4H2S A;  2DDZ A;  4H2U A;  4UP8 A;  4WX9 A;  4G85 A;  3HXX A;  1L0W A;  2EN2 A;  3VQV A;  2RSI A;  1QF6 A;  2YWQ A;  1IBK E;  3DJW A;  2NAB A;  4M2Z A;  2I13 A;  1BB8 A;  4P3N A;  2DXU A;  2EMK A;  2HGH A;  3ADL A;  1Z7N A;  2L3J A;  3LSS A;  3TUP A;  3QO5 A;  2EOE A;  1JK1 A;  4BHB A;  3A5Y A;  3NEM A;  2EM0 A;  4DKK A;  1YSA C;  4WFT A;  4YRM A;  1UN6 B;  1J26 A;  2EWL A;  2YT4 A;  3VBB A;  3J7A G;  2F4V E;  2QHU A;  4JI6 E;  3W3S A;  2DQ3 A;  5IT9 C;  4Q35 B;  1LLM C;  4TVA B;  1G2F C;  2F8B A;  1XNQ E;  2ZIM A;  3UK3 C;  2DTH A;  2M1S A;  1HXD A;  4PHC A;  4X64 E;  1ADY A;  4CS2 A;  4DQ2 A;  4O5G A;  2WBT A;  4K87 A;  5T6J A;  4DV7 E;  5TSE A;  2RTX A;  2EOQ A;  2EOF A;  1XMO E;  1YFR A;  2DTI A;  5KL4 A;  1BIA A;  2EM7 A;  4XEM A;  2EPU A;  2HHH E;  4BBY A;  1N34 E;  4KR2 A;  2WCC 3;  3C4T A;  4TUI A;  12AS A;  1H4Q A;  2ZT5 A;  2DEQ A;  4GKJ E;  2JOX A;  4NXN E;  2E1M A;  1AAY A;  4J15 A;  4LVJ A;  2NS6 A;  1NCS A;  1PYS B;  2L2M A;  2V89 A;  1B7Y B;  5AC4 A;  1X54 A;  3OD1 A;  1QE0 A;  5KL2 A;  1LYL A;  1RIQ A;  4XTV A;  2FYK A;  2ZZF A;  2EM9 A;  4EO4 A;  4YRP A;  4P73 C;  3EPL A;  3L2Z A;  4Q15 A;  4AH6 A;  3FJP A;  2N3G A;  4MLV A;  2C7I A;  1KJK A;  3VQW A;  3MQZ A;  2LV2 A;  3LSQ A;  4X9J A;  2ENA A;  1X01 A;  2EMC A;  3QO7 A;  3LML A;  3A7U A;  4OX9 E;  2WZO A;  2E10 A;  2Q7G A;  3IAL A;  4YCU A;  1HNW E;  3IWC A;  3DSQ A;  2EOZ A;  4P71 C;  2V86 A;  4LF5 E;  4DR7 E;  2H36 X;  5IV8 B;  2RHS A;  1X55 A;  2ENC A;  2EPP A;  4H2W A;  4R2S A;  3OTO E;  3MEY A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 4KHP E;  1YFS A;  4YRK A;  2UUA E;  2KHX A;  2LUQ A;  1NYR A;  1WHN A;  3HXL A;  2ZIO A;  4PG3 A;  2EZ6 A;  5E3I A;  2E5L E;  3V8K A;  4LFA E;  2UXC E;  4RMF A;  4DUZ E;  2M7Q A;  3V7R A;  3ADJ A;  3HFV A;  11AS A;  5F5W A;  4YCV A;  2DU7 A;  3ADG A;  2FV4 B;  2B9D A;  5C51 B;  1SES A;  5F3W A;  1X2G A;  4H2V A;  4LVM A;  3QTC A;  2MC6 A;  2CGH A;  4HA8 A;  1BIB A;  4P72 C;  1NJ2 A;  3TEH A;  4P73 A;  2DXT A;  2A8E A;  4LVK A;  2LBS B;  4XTW A;  4LU9 A;  4LF6 E;  2IY5 A;  2UXB E;  1NJ6 A;  2FGG A;  4HWS A;  3RGL A;  4K86 A;  2Q7H A;  3RIR A;  1WQW A;  2EWN A;  2NA2 A;  4DV1 E;  4DPG A;  2ALY A;  4ZIB A;  1EKZ A;  2ODR C;  4TUG A;  1VQZ A;  2ZTG A;  2VE7 C;  1DI2 A;  2ARU A;  1QU6 A;  2NUE A;  4P75 A;  2RS7 A;  3ICA A;  5DNY A;  4HWP A;  4OLF A;  2I4L A;  3VQX A;  4HWO A;  2L2K B;  4HWT A;  4H2X A;  3J7Y p;  4EX5 A;  3WQZ A;  1XNR E;  5AE2 A;  2MDR A;  1N32 E;  2ZT6 A;  5BR8 E;  1HNZ E;  4CH5 A;  4P78 A;  2ZZG A;  1T4O A;  2ALY B;  4UP9 A;  4JI8 E;  2CJB A;  3F6H A;  2LTR A;  2ARS A;  3E9I A;  2RHQ B;  2PME A;  4YRC A;  5ELO A;  3MSW A;  3IG2 A;  5LMU E;  3UGT A;  1EQR A;  4TQF A;  4F9C B;  3I7F A;  2DKG A;  4LF4 E;  4LVI A;  3DF6 A;  4H2X B;  4YRE A;  3T1Y E;  2VQF E;  4P74 A;  4DR4 E;  4JI0 E;  2LE2 A;  4YRT A;  1B8A A;  1WYD A;  2ZIN A;  2EJ9 A;  4NXM E;  3HTZ A;  1X48 A;  2DIX A;  3A31 A;  4DV3 E;  2IHR 1;  1JJC A;  4WJ3 M;  3EFS A;  1B70 B;  2Q5H A;  1USY C;  2ART A;  4DV0 E;  2XGT A;  4P3O A;  3C4B A;  4DV5 E;  4JI3 E;  4ZTU B;  1C0A A;  3TEH B;  3QO8 A;  4F54 A;  4TWA A;  2EJF A;  2V85 A;  1UIL A;  2ZM6 E;  2ZXF A;  2UXD E;  2ODR D;  3HRK A;  4P7D A;  2ZGW A;  2J3L A;  2LTS A;  2JR1 A;  4LTY A;  3A5Z A;  4KZS A;  1EFW A;  3MF2 A;  3VK6 A;  2JVA A;  5K1P A;  4LF8 E;  4WSP A;  2E5A A;  4TTV A;  1KMM A;  3AUZ A;  1X2H A;  3RUX A;  2DU5 A;  4H2T A;  1RC7 A;  3NET A;  3RKY A;  1IBL E;  1YZ9 A;  2CIM A;  4G84 A;  3OML A;  1KOG A;  1YYW A;  4YRL A;  2G7H A;  2VQE E;  2C8M A;  1B76 A;  1EOV A;  1I94 E;  1ATI A;  2I4N A;  4UPA A;  3HFZ A;  3REX A;  1SET A;  3JTZ A;  2E3C A;  2ZR2 A;  4YRG A;  5K1X A;  3F6G A;  3KFU A;  1ASY A;  1ADJ A;  2UUC E;  4YP0 A;  2L92 A;  2CJ9 A;  1FKA E;  2ZNJ A;  3CMQ A;  2JY9 A;  4BC9 A;  2EAY A;  4OOG C;  3E9H A;  2CPN A;  4P71 A;  4ZTZ B;  1BBU A;  4BWA A;  3LLH A;  1HC7 A;  3J81 C;  3T1H E;  3TEG A;  4YRQ A;  1YYO A;  1RQ0 A;  4F9A B;  2QHT A;  4X8W A;  4JI7 E;  5AE1 A;  2KON A;  4F9B B;  5A2Q C;  2V83 A;  1WU7 A;  2LMZ A;  4DR2 E;  3HXZ A;  4XU0 A;  3K6Q A;  1FJG E;  3M4P A;  4B3R E;  3PZC A;  4CH6 A;  2DB2 A;  4NCX A;  1B70 A;  2HNI A;  3A7R A;  4RQE A;  5AAS A;  4JI5 E;  5FLX C;  4HVC A;  1Z7M A;  2PMF A;  1GQE A;  4DV6 E;  1YFT A;  1SR9 A;  2L2N A;  2JOB A;  4R8O A;  2LJH A;  2DVE A;  2QHS A;  2B7V A;  4CS4 A;  3ZOQ B;  4WI1 A;  4X5O A;  4LVL A;  3VQY A;  3HPS A;  2AMC A;  3P8V A;  3UH0 A;  1YYK A;  4RDX A;  1J5W A;  2NUG A;  4H2Y A;  1J5E E;  5LMN E;  5ADZ A;  4XTX A;  2B7T A;  3J80 C;  3MF1 A;  4YCW A;  1T4N A;  3M4Q A;  5AE3 A;  4KQE A;  3P8Y A;  2NUF A;  1WNL A;  4B3M E;  1JJC B;  1WHQ A;  2RS6 A;  4XEO A;  2ZR3 A;  2AKW B;  2QHV A;  3HTX A;  4X62 E;  5LL6 R;  4WPY A;  1YB3 A;  2MC5 A;  1N9W A;  3G1Z A;  4DR6 E;  1WLE A;  4JI2 E;  1NNH A;  1YGB A;  5KNN A;  4TQD A;  2CJA A;  4OP0 A;  2E65 A;  1EIY B;  2Q5I A;  4UP7 A;  5IWA E;  5CFF E;  4JV5 E;  4LNS A;  4P75 C;  1ZBT A;  4KR3 A;  1NJ8 A;  3BFM A;  4P74 C;  4BW9 A;  3EFR A;  4I8O A;  4WYQ B;  1G5I A;  4JYA E;  2P5I A;  1NYQ A;  1PYS A;  4YPF A;  1ASZ A;  1DQ3 A;  4DV4 E;  1G51 A;  4CS3 A;  4X66 E;  3L4G B;  4XU3 A;  1STU A;  3IKM B;  2N3H A;  3ERR A;  4TVW A;  2DZ9 A;  4YRS A;  4X65 E;  3RAC A;  2XTI A;  4DMI A;  4R03 A;  1XMQ E;  4XTZ A;  4YRF A;  1X49 A;  4BS9 A;  3UFG A;  4H02 A;  4YRN A;  2P0L A;  4B3S E;  3V7S A;  3NEL A;  3NEN A;  3RMP A;  5C52 B;  3QNE A;  1N33 E;  4B3T E;  4YDQ A;  2IY5 B;  2I4M A;  4BCA A;  2DQ0 A;  1B7Y A;  4XU2 A;  3LC0 A;  4M0V A;  2EL9 A;  3JU0 A;  3HQ1 A;  4WF2 A;  1KMN A;  4LFB E;  4LF7 E;  2DMY A;  1HTT A;  2V87 A;  2ZT7 A;  2ZT8 A;  3HXW A;  1WPY A;  4J8Z A;  1E24 A;  1H4S A;  1H4T A;  3IKL A;  2RHQ A;  4WJ4 A;  4XU1 A;  1T4L B;  4DR3 E;  2L8T A;  4YRO A;  2M4I A;  3VYX A;  1G5H A;  2AKW A;  3L1A A;  5ELN A;  2JWO A;  4HT4 A;  1HR0 E;  3VYY A;  1USY A;  3P8T A;  4P72 A;  2E1H A;  4HWR A;  2L6M A;  4TVA A;  1FYF A;  4LFC E;  4YY3 E;  2ZNI A;  4L87 A;  2RSM A;  1IL2 A;  4YRR A;  4K88 A;  1IBM E;  3A74 A;  3RF1 A;  3HXU A;  1E22 A;  4GKK E;  3V8L A;  1PKP A;  1W66 A;  2FTX B;  2ZCE A;  1ZBQ A;  3HRI A;  3P1X A;  1O0W A;  4K0K E;  4JI1 E;  1E1O A;  1HNX E;  1EVK A;  3BJU A;  3FIG A;  1N36 E;  3H09 A;  3RKX A;  3AV0 A;  4YRI A;  2KOU A;  2UUB E;  4XTU A;  3ADI A;  4DV2 E;  4CH3 A;  3HXV A;  3UGQ A;  4XTY A;  4P3P A;  4L8N A;  3PCO A;  3IWB A;  1EVL A;  4YHH E;  2Q7E A;  2LRS A;  2DTO A;  2LUP B;  1GZ6 A;  2V88 A;  2J3M A;  3RL6 A;  1BBW A;  2RHS B;  2L3C A;  3PCO B;  3V7C A;  1NJ5 A;  2YZT A;  2ZZE A;  4DR1 E;  4BC7 A;  3R07 A;  3A32 A;  3RKW A;  4CH4 A;  1SER A;  3KWR A;  2E64 A;  2DSY A;  2EJG A;  4L5N C;  4M30 A;  2VF1 A;  1WXR A;  3JAM C;  3HXY A;  3A7A A;  5C53 B;  1EIY A;  1NJ1 A;  4LF9 E;  2V8Q B;  2E41 A;  4YRJ A;  4O2D A;  2L33 A;  1GGM A;  1SRY A;  2G4C A;  2I4O A;  4TVY A;  1WQ7 A;  3V8J A;  5HGQ A;  4RQF A;  3L4G A;  4Q6G A;  4DR5 E;  1UHZ A;  4Q28 A;  4DUY E;  2AMC B;  2UU9 E;  4YYE A;  4E51 A;  3HFZ B;  3HY1 A;  2DJZ A;  1H4V B;  1X56 A;  2DZC A;  2K4V A;  4GEQ B;  2B3T B;  3HPZ A;  3REU A;  1E1T A;  4JI4 E;  1X47 A;  3HY0 A;  3IWD A;  4AQY E;  4H2U A;  4BMJ A;  4H2S A;  4UP8 A;  2DDZ A;  4G85 A;  3HXX A;  1L0W A;  3VQV A;  1QF6 A;  1IBK E;  3DJW A;  4M2Z A;  4P3N A;  2DXU A;  3ADL A;  1Z7N A;  2L3J A;  3LSS A;  3TUP A;  3QO5 A;  3A5Y A;  3NEM A;  4DKK A;  4WFT A;  4YRM A;  1J26 A;  2EWL A;  2YT4 A;  3VBB A;  3J7A G;  2F4V E;  2QHU A;  4JI6 E;  3W3S A;  2DQ3 A;  5IT9 C;  4TVA B;  2F8B A;  1XNQ E;  2ZIM A;  2DTH A;  2M1S A;  1HXD A;  4PHC A;  4X64 E;  1ADY A;  4CS2 A;  4DQ2 A;  4K87 A;  5T6J A;  4DV7 E;  2RTX A;  1XMO E;  1YFR A;  2DTI A;  1BIA A;  4XEM A;  2HHH E;  4BBY A;  1N34 E;  4KR2 A;  3C4T A;  4TUI A;  12AS A;  1H4Q A;  2ZT5 A;  2DEQ A;  4GKJ E;  2JOX A;  4NXN E;  2E1M A;  4J15 A;  4LVJ A;  2NS6 A;  1PYS B;  2L2M A;  2V89 A;  1B7Y B;  1X54 A;  3OD1 A;  4XTV A;  1QE0 A;  1RIQ A;  1LYL A;  2FYK A;  2ZZF A;  4EO4 A;  4YRP A;  4P73 C;  3L2Z A;  4Q15 A;  4AH6 A;  3FJP A;  2N3G A;  2C7I A;  3VQW A;  3MQZ A;  3LSQ A;  1X01 A;  3QO7 A;  3LML A;  3A7U A;  4OX9 E;  2WZO A;  2E10 A;  2Q7G A;  3IAL A;  4YCU A;  1HNW E;  3IWC A;  3DSQ A;  4P71 C;  2V86 A;  4LF5 E;  4DR7 E;  2H36 X;  2RHS A;  1X55 A;  4H2W A;  3OTO E;  3MEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...