2ODRC

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
679
structure length
468
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPSILNEIYVYDGNVIGIPEKIDDIALKQIMSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
total genus 117
structure length 468
sequence length 679
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrC01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrC02
2IY5A 1IL2A 1JJCA 3WQZA 3RKYA 1B76A 3VQYA 4BW9A 2ZT6A 5ELOA 4XU3A 2EAYA 2EJ9A 3EFSA 2ZNJA 2C8MA 3E9IA 3HFZB 4WF2A 3V7RA 4CH4A 1H4VB 1WU7A 1VQZA 3RIRA 11ASA 4YCUA 2EL9A 4RMFA 4TQDA 5F5WA 1WPYA 2DZCA 3V8LA 3NENA 1X56A 2Q7GA 4K88A 4P73A 1B70A 1G5IA 2HNIA 2ZZGA 1Z7NA 2DQ3A 1WQ7A 2RHSA 4DPGA 3RGLA 4H2UA 3DSQA 4P73C 1G51A 2I4NA 4YROA 4YPFA 1NJ6A 1B70B 3NETA 4PG3A 3EFRA 4H2TA 2RHSB 4WJ4A 1L0WA 3M4PA 4H2WA 3UH0A 3HRIA 3HY1A 4LNSA 1X2GA 4YCVA 3QO5A 3FJPA 2ZNIA 4YRTA 3BJUA 3A5ZA 2ARUA 3TUPA 2E64A 2DTHA 4OLFA 4CS3A 4H2SA 3MEYA 1QE0A 3G1ZA 3P8YA 3RUXA 2ALYA 1ASZA 4CH6A 1KOGA 2ODRD 4XTUA 2ZIOA 1FYFA 3L2ZA 3MF1A 2QHSA 2XGTA 1Z7MA 2ZZEA 4TQFA 3PCOA 4KQEA 1E24A 3LSQA 3A7UA 1BIAA 1ADYA 1B8AA 2ZT8A 1YB3A 2J3MA 4HWPA 4H2XB 3TEHA 4TVWA 1H4TA 2Q5HA 3IKMB 5C53B 1HC7A 4ZTUB 3V8KA 5K1XA 4UPAA 1G5HA 2XTIA 3VQVA 1EQRA 1ADJA 1H4SA 2IY5B 4ZIBA 1C0AA 1JJCB 2ARTA 2I4MA 2ODRC 2AKWA 4YRKA 1NJ1A 5KNNA 12ASA 1SETA 2CJBA 3RACA 3A5YA 3P8TA 3A7RA 3HXWA 4YRRA 1KMNA 3R07A 4EX5A 4YRMA 1RIQA 2EWNA 2DKGA 4XTYA 4YRCA 1SESA 1EIYA 3BFMA 4XU2A 2DZ9A 4RDXA 2DU7A 4XEOA 4O2DA 3CMQA 3REXA 2P5IA 5C52B 2FYKA 1BBWA 1H4QA 1X2HA 2E10A 4TWAA 2DEQA 1YFSA 3UFGA 2C7IA 3L4GA 1HTTA 2CGHA 1NJ8A 4BWAA 2ZIMA 2E3CA 2ZZFA 4H2YA 3HXZA 2QHTA 4X5OA 3IG2A 3L4GB 4WJ3M 4P3PA 4CS4A 4J15A 1B7YA 1BIBA 4NCXA 4YRGA 3RKXA 2ZTGA 1PYSA 4YCWA 3UGTA 4AH6A 2E1HA 1USYA 2ZINA 1KMMA 2ALYB 3L1AA 1EFWA 1X01A 2AMCA 4YRPA 1ASYA 1LYLA 1HXDA 4P3NA 4P3OA 3QTCA 1USYC 1WNLA 4YRQA 2QHVA 1N9WA 3NELA 1NJ5A 2ZXFA 4CS2A 3LC0A 3I7FA 4P74C 3VQWA 2E5AA 4K86A 3VQXA 3W3SA 4TVAA 4UP9A 4KR3A 4HWRA 3PCOB 4DQ2A 1EVLA 4YDQA 3ERRA 2EJGA 1YFTA 3LSSA 1EOVA 4Q6GA 4YRFA 3HRKA 2P0LA 2ZCEA 4HWOA 1QF6A 1BBUA 3HTZA 3HXUA 4XTWA 4G84A 3HFZA 1W66A 3HXYA 4Q15A 4YP0A 3TEHB 1GGMA 2RHQA 3NEMA 2G4CA 1WLEA 2DTOA 3M4QA 1E1OA 4UP8A 4G85A 1WYDA 1SERA 5K1PA 1NYQA 1NJ2A 4XU0A 2DVEA 2RHQB 4E51A 4XTVA 2AKWB 3HXVA 2CJAA 4XU1A 4YRIA 1EVKA 2DJZA 2Q5IA 3IALA 2J3LA 2DDZA 4H2VA 4KR2A 3PZCA 1NYRA 2DXUA 4L87A 2E41A 4HWTA 1NNHA 4HVCA 2CJ9A 3UGQA 1EIYB 2DQ0A 2ZR3A 3VBBA 2ZR2A 3V8JA 3HFVA 4UP7A 4P71A 1X55A 4ZTZB 3A74A 4YRLA 1E1TA 4H02A 3TEGA 2ARSA 4P71C 4HWSA 4TVYA 1WQWA 4P72A 4HA8A 3KFUA 4YREA 2EJFA 3V7SA 2ZGWA 1E22A 1YGBA 2Q7HA 3REUA 4P72C 1YFRA 1X54A 4TTVA 2PMFA 3RL6A 2ZT7A 3ICAA 3OD1A 2DXTA 3QO7A 2ZT5A 3QNEA 4P75A 3A7AA 1B7YB 3RKWA 1J5WA 3QO8A 4P74A 3RF1A 4OP0A 4CH5A 4YRJA 2DTIA 4P75C 4PHCA 1PYSB 4CH3A 2DU5A 3IKLA 1SRYA 2CIMA 2QHUA 5E3IA 3P8VA 2AMCB 5HGQA 3A31A 2I4OA 2E65A 2Q7EA 4YRNA 4EO4A 4RQFA 3V7CA 3A32A 3HXXA 4XEMA 4XTZA 3E9HA 4H2XA 3HY0A 4RQEA 5C51B 5ELNA 2PMEA 4YYEA 1ATIA 4YRSA 4K87A 3MF2A 2I4LA 4WI1A 4TVAB 4XTXA
chains in the Genus database with same CATH superfamily
2BBGA 2JWOA 3IWBA 3OMLA 2ADRA 2EOMA 2IY5A 4F6NA 1IL2A 4R8OA 1JJCA 1P47A 4JI1E 3WQZA 2HC5A 1B76A 3RKYA 3VQYA 4BW9A 2ZT6A 1NCSA 2DSYA 2KOUA 1UHZA 4XU3A 2EAYA 5ELOA 2EJ9A 2G7HA 3EFSA 2ZNJA 3ECRA 1PJQA 1XNRE 2C8MA 1T4LB 3E9IA 3HFZB 4ZYDA 1X49A 4WF2A 4Q35B 4F9AB 2LVHA 1QU6A 3THOB 5AE2A 3V7RA 2EN8A 4CH4A 1H4VB 1WJPA 1WU7A 1VQZA 2UUCE 3MQZA 3RIRA 2VQEE 11ASA 4YCUA 2EM5A 2EL9A 5IT9C 4RMFA 4LF7E 4L8NA 4M9VC 4TQDA 5F5WA 1WPYA 4R2DA 4TUIA 2EN1A 1T4NA 2DZCA 2EN2A 4LTYA 2EM0A 2EPMX 4BS9A 1A1IA 1HNXE 3V8LA 4DUZE 4K0KE 3NENA 1X56A 2L2NA 3DF6A 1I94E 2Q7GA 1X6HA 4K88A 4DR2E 2PRTA 2YTIA 1XMOE 2RTXA 4WYQB 1UN6B 3C6KA 2EPAA 4P73A 1B70A 1G5IA 1HR0E 2HNIA 2ZZGA 1DQ3A 4NXME 1Z7NA 1WHNA 2JVAA 2WZOA 2DQ3A 1WQ7A 2FV4B 1JK2A 2RHSA 2EMBA 2FTXB 4BMJA 4LFCE 4J8ZA 4DPGA 3RGLA 4H2UA 3DSQA 3ADJA 1DGCA 4P73C 1G51A 2I4NA 2LCEA 2YRMA 4YROA 2NUFA 2EQ1A 4YPFA 4R2CA 4X62E 1NJ6A 1B70B 3NETA 4PG3A 3EFRA 1ZAAC 4BCAA 4R2RA 1YPNA 1X47A 4H2TA 2N3HA 2RHSB 4WJ4A 4R2PA 1L0WA 2ENHA 3M4PA 1STUA 3IWDA 4F54A 4P7DA 4H2WA 3UH0A 4JI7E 2KHXA 1YYWA 3HRIA 3HY1A 4LNSA 1X2GA 4YCVA 3QO5A 2E5LE 2LJHA 1HNWE 3FJPA 4WXCA 2ZNIA 4YRTA 3BJUA 2VE7C 4BHBA 2LTRA 3A5ZA 2ARUA 3TUPA 3AUZA 1YYOA 2E64A 2DTHA 4DV5E 2DIXA 4DUYE 4OLFA 4CS3A 2EL5A 2LMZA 1MGTA 4ZYGA 2E72A 2LE2A 4H2SA 1T38A 3MEYA 2NUEA 1QE0A 3G1ZA 3P8YA 3RUXA 4F6MA 3JAMC 1RQ0A 2ALYA 2B7TA 2DLQA 4GEQB 2NUGA 1ASZA 4JI8E 4F2JC 4NZVA 4F9CB 2JPAA 2JXPA 3KZYA 1WRJA 2WBTA 2LV2A 3ZOQB 3H09A 2JYAA 1A1JA 1ZBQA 5A6BA 1GZ6A 2YU5A 1X6EA 4CH6A 1KOGA 2EOYA 1B69A 2ODRD 4LF8E 2ZIOA 4XTUA 3J7Yp 1FYFA 3L2ZA 3MF1A 4DV1E 3T1YE 2QHSA 4DR5E 2EOJA 2UUBE 2V86A 4DR4E 2XGTA 1Z7MA 2A25A 2LRSA 4MLVA 4DR3E 2LUPB 2ZZEA 2EN3A 2GHFA 4YHHE 4TQFA 1XMQE 3PCOA 4I8OA 4KQEA 2YT4A 1E24A 1PDAA 2E1MA 3LSQA 3A7UA 2L33A 1BIAA 5KL3A 1ADYA 1B8AA 2ZT8A 2JY9A 4R2SA 1YZ9A 4LVJA 4LVMA 1YB3A 1WHQA 2M7QA 2J3MA 4HWPA 4RH8A 3KZZA 5DNYA 4H2XB 3TEHA 4LF9E 4DMIA 3BBGA 2GLIA 4TVWA 2R76A 1H4TA 2Q5HA 3IKMB 5C53B 2EL4A 2NA2A 4DV7E 1HC7A 4KWYA 4ZTUB 2FGGA 2Q8UA 3V8KA 5AC5A 5K1XA 4O4KA 1G5HA 2XTIA 4UPAA 3VQVA 1EQRA 1ADJA 1H4SA 2K7IA 5A2QC 1RC7A 2IY5B 4WPYA 4ZIBA 1C0AA 1JJCB 4GZNC 2ARTA 2I4MA 1TN9A 2YTQA 2JOXA 2L92A 2ODRC 1IBME 2EMCA 2EM9A 2AKWA 4YRKA 1NJ1A 5IXMB 5KNNA 2EPPA 12ASA 1SETA 2RS7A 1TF6A 2H36X 2MDRA 4IS1C 2V83A 1N32E 2CJBA 1EH8A 3RACA 3A5YA 5KL2A 3P8TA 2EMXA 3A7RA 1PJTA 2EORA 3HXWA 3ADGA 1N34E 4YRRA 5IV8B 1KMNA 3R07A 4EX5A 3THNA 1XNQE 4YRMA 1ZR9A 3EQ1A 1RIQA 2YRHA 2EWNA 4MLQA 2DKGA 4M30A 2EMZA 4L5NC 4XTYA 4YRCA 3J80C 4HT4A 2DMYA 1SESA 1EIYA 3BFMA 4XU2A 2DGCA 2DZ9A 4RDXA 2YTFA 2DU7A 4XEOA 4HTGA 4O2DA 1BBGA 2EM8A 5F3WA 4JI0E 3HPSA 3LMLA 3CMQA 3REXA 2P5IA 2RPCA 5C52B 1UILA 2J7JA 2ELYA 2V85A 2FYKA 4XTXA 1N33E 1BBWA 1H4QA 1X2HA 3T1HE 3VYYA 4LF5E 2E10A 2M4IA 1YUJA 4TWAA 4WSPA 2DEQA 3J7AG 1J26A 3P1XA 2JP9A 1YFSA 3UFGA 2C7IA 2EPXA 3L4GA 1HTTA 1X3CA 5KL6A 4JI5E 4X64E 2CGHA 3MHSC 4YY3E 1NJ8A 1NEIA 4BWAA 2ZIMA 4X8WA 5KL5A 4JI3E 2E3CA 2ZZFA 4IJDA 2ENCA 2MKNA 2VRDA 4H2YA 5LMUE 3UK3C 3HXZA 4DR1E 4Q28A 1L4SA 4BC7A 2QHTA 4X5OA 3EPHA 1ZU1A 2EPLX 2DB2A 3HQ1A 2MKDA 3IG2A 3L4GB 4WJ3M 2D9HA 1X48A 4P3PA 4CS4A 2HHHE 3MHHC 1X6FA 2EMKA 1UBDC 4JV5E 4J15A 1B7YA 2YPNA 1BIBA 4NCXA 4BBYA 2VQFE 4BC9A 4YRGA 3MSWA 1YYKA 3RKXA 2UXCE 2ZTGA 3C4TA 1PYSA 4DV4E 5AE1A 4YCWA 3K6QA 3UGTA 4AH6A 2E1HA 2R1FA 3J81C 1T4OA 1USYA 2ZINA 1KMMA 2M1SA 2ALYB 4OX9E 2MDGA 3L1AA 1EFWA 2EOQA 1X01A 2AMCA 4YRPA 1ASYA 5T6JA 1LYLA 1HXDA 4R2QA 3ADLA 4P3NA 4P3OA 3QTCA 1USYC 1WNLA 2LT7A 3C4BA 2EOHA 4YRQA 4FK5C 2QHVA 2EOXA 1N9WA 3NELA 1GQEA 1NJ5A 2ZXFA 2EM6A 2YTNA 4CS2A 2MC6A 3LC0A 5LL6R 4HEIA 5A6KA 1YSAC 2UXDE 2ELZA 3FIGA 3I7FA 4P74C 3BGHA 5CFFE 1HNZE 3VQWA 1X5WA 1EH7A 4DKKA 2E5AA 2RSIA 2V88A 2HGHA 2YRKA 2JR1A 2ENAA 4K86A 3VQXA 1RMDA 2EP3A 5BR8E 2RSMA 2EWLA 2EN7A 2L3JA 3W3SA 4LU9A 4TVAA 1YUIA 4UP9A 1A1HA 2N3GA 3EPLA 3QG5C 4DV6E 3PCOB 4HWRA 4KR3A 4DQ2A 1TF3A 2EM3A 1EVLA 2KONA 4YDQA 3ERRA 2EQ0A 4LF4E 2EM4A 4X9JA 2EJGA 1YFTA 1IMUA 2YZTA 2UXBE 3LSSA 1EOVA 1T39A 2B9DA 4Q6GA 3JTZA 2VF1A 3HRKA 1KYQA 2CTDA 2P0LA 4YRFA 2MC5A 2ZCEA 4B3TE 4HWOA 4KZSA 1QF6A 1BBUA 3HTZA 3HXUA 4XTWA 4G84A 3HFZA 1W66A 4M2ZA 3HXYA 4Q15A 4YP0A 3TEHB 1GGMA 2RHQA 3NEMA 2V87A 2YSOA 3RMPA 4DR7E 2G4CA 5KL4A 4JYAE 1WLEA 2CPNA 2EOEA 2LTSA 4KHPE 1E1OA 2DTOA 3M4QA 2EM7A 4G85A 4UP8A 4LVLA 1WYDA 1SERA 3VYXA 5AC4A 5K1PA 5AASA 1FKAE 4JI4E 4LF6E 1NJ2A 2B7VA 1NYQA 2EQ3A 4XU0A 5A69A 4TUGA 4LVIA 4WXDA 2DVEA 2WBSA 4WX9A 3HPZA 4ZYEA 2RHQB 1A1GA 3IWCA 2EPUA 4E51A 3KWRA 4XTVA 2L2MA 4P78A 2AKWB 5LLQA 3HXVA 2CT1A 2YWQA 1WXRA 4WSGA 2CJAA 4XU1A 2LBSB 3M99B 1IBKE 4YRIA 4RHBB 4WFTA 4NXNE 1EVKA 2EMFA 2DJZA 2Q5IA 2N8XA 1O0WA 3IALA 4OOGC 2V89A 2DMIA 3F6GA 2J3LA 2EOZA 2CSHA 2DDZA 4H2VA 2EPOA 5AE3A 2YTJA 5A6AA 4KR2A 5TSEA 3PZCA 1NYRA 2EMGA 2EN6A 4DV3E 1YFHA 1JK1A 1A1LA 3DJWA 2B3TB 2DXUA 5ADZA 4L87A 2E41A 2EPCA 4B3ME 4HWTA 1NNHA 1BB8A 4HVCA 2EPKX 2CJ9A 2WCC3 3BIDA 3REUA 2YTOA 3UGQA 1EIYB 4DV2E 3AV0A 2DQ0A 3OTOE 2ZR3A 3LLHA 1MEYC 3VBBA 2ZR2A 2EPRA 1G2DC 4R2EA 3V8JA 3HXLA 4JI6E 4GKKE 2YTDA 2BB8A 1G2FC 4LFBE 1QNTA 3HFVA 1ZBTA 2YU8A 4UP7A 4P71A 1PKPA 1X55A 1LLMC 5A6BD 2GPIA 4ZTZB 2WBUA 5FLXC 3HTXA 2EL6A 3A74A 1AH5A 4YRLA 1EKZA 1AAYA 2UUAE 1E1TA 2F8BA 4H02A 4DV0E 3TEGA 4LFAE 4DR6E 2ARSA 3L00A 4P71C 4AQYE 4HWSA 2K4VA 2EN4A 5IWAE 1KJKA 4TVYA 2RS6A 2RQLA 1WQWA 4P72A 1N3GA 4HA8A 3KFUA 3JU0A 4M0VA 4X66E 4YREA 4R03A 2EJFA 2I9IA 3V7SA 2YTPA 2ZGWA 2LO3A 3C6MA 2DRPA 1E22A 1YGBA 2Q7HA 2EMYA 2EOIA 2LJUA 2M9AA 3F6HA 4BHCA 1A1FA 1DI2A 1X54A 1YFRA 4P72C 4TTVA 1F2IG 1IQSA 2EMWA 2EPNA 1BBOA 2PMFA 2I13A 2ZT7A 3ICAA 3OD1A 3RL6A 2IHR1 2DXTA 3QO7A 4O43A 3VK6A 2DLKA 2EM2A 2L2KB 2ZT5A 3ADIA 3QNEA 4P75A 4ZYHA 1IBLE 3EPKA 2EOOA 5LMNE 3A7AA 1FJGE 2L8TA 1B7YB 3BF2A 3RKWA 1J5WA 3QO8A 2ZM6E 4P74A 3RF1A 4O24A 4OP0A 4CH5A 1GTKA 4YRJA 2DTIA 4P75C 4PHCA 1PYSB 1A1KA 4B3SE 4CH3A 2DU5A 1EH6A 2F4VE 3IKLA 1SRYA 2CIMA 2QHUA 2EPZA 2JOBA 5E3IA 3P8VA 2AMCB 5HGQA 3A31A 2UU9E 4JI2E 1PJSA 2V8QB 1N36E 2A8EA 2I4OA 4F9BB 2E65A 2Q7EA 4R2AA 1SFEA 1IQOA 2EE8A 4YRNA 4NHRA 4O5GA 2EJ4A 2L3CA 4B3RE 3EPJA 2L6MA 4EO4A 4RQFA 3V7CA 2NABA 3A32A 4LVKA 2EMAA 4X65E 2LUQA 2EMIA 3HXXA 2EOFA 3TQMA 1J5EE 4XEMA 4XTZA 3E9HA 2EZ6A 4H2XA 3HY0A 4RQEA 5C51B 2YTGA 1Z1BA 2NS6A 5ELNA 2PMEA 1ATIA 4GKJE 4YYEA 1SR9A 2YSPA 4YRSA 4K87A 2YTEA 5KL7A 2HJJA 3MF2A 2I4LA 3VHTB 2EOSA 5A6JA 2EMLA 4WI1A 4TVAB 2EMHA 4N4RB
chains in the Genus database with same CATH topology
2JWOA 3IWBA 3OMLA 2IY5A 1IL2A 4R8OA 1JJCA 4JI1E 3WQZA 3RKYA 1B76A 3VQYA 4BW9A 2ZT6A 5ELOA 2DSYA 2KOUA 1UHZA 4XU3A 2EAYA 2EJ9A 2G7HA 3EFSA 2ZNJA 1XNRE 2C8MA 1T4LB 3E9IA 3HFZB 1X49A 4WF2A 4F9AB 3V7RA 1QU6A 5AE2A 4CH4A 1H4VB 1WU7A 1VQZA 2UUCE 3MQZA 3RIRA 2VQEE 11ASA 4YCUA 2EL9A 5IT9C 4RMFA 4LF7E 4L8NA 4TQDA 5F5WA 1WPYA 4TUIA 1T4NA 2DZCA 4LTYA 3V8LA 4BS9A 1HNXE 4DUZE 4K0KE 3NENA 1X56A 2L2NA 3DF6A 1I94E 2Q7GA 4K88A 4DR2E 1XMOE 2RTXA 4WYQB 4P73A 1B70A 1G5IA 1HR0E 2HNIA 2ZZGA 1DQ3A 4NXME 1Z7NA 1WHNA 2JVAA 2WZOA 2DQ3A 1WQ7A 2FV4B 2RHSA 2FTXB 4BMJA 4LFCE 4DPGA 4J8ZA 3RGLA 4H2UA 3DSQA 3ADJA 4P73C 1G51A 2I4NA 4YROA 2NUFA 4YPFA 4X62E 1NJ6A 1B70B 3NETA 4PG3A 3EFRA 4BCAA 1X47A 4H2TA 2N3HA 2RHSB 4WJ4A 1L0WA 3M4PA 1STUA 3IWDA 4F54A 4P7DA 4H2WA 3UH0A 4JI7E 2KHXA 1YYWA 3HRIA 3HY1A 4LNSA 1X2GA 4YCVA 3QO5A 2E5LE 2LJHA 1HNWE 3FJPA 2ZNIA 4YRTA 3BJUA 2VE7C 2LTRA 3A5ZA 2ARUA 3TUPA 3AUZA 1YYOA 2E64A 2DTHA 4DV5E 2DIXA 4DUYE 4OLFA 4CS3A 2LMZA 4H2SA 2LE2A 3MEYA 2NUEA 1QE0A 3G1ZA 3P8YA 3RUXA 3JAMC 1RQ0A 2ALYA 2B7TA 4GEQB 2NUGA 1ASZA 4JI8E 4F9CB 3ZOQB 3H09A 1ZBQA 1GZ6A 4CH6A 1KOGA 2ODRD 4LF8E 2ZIOA 4XTUA 3J7Yp 1FYFA 3L2ZA 3MF1A 4DV1E 3T1YE 2QHSA 4DR5E 2UUBE 2V86A 4DR4E 2XGTA 1Z7MA 2LRSA 4DR3E 2LUPB 2ZZEA 4YHHE 4TQFA 1XMQE 3PCOA 4I8OA 4KQEA 2YT4A 1E24A 2E1MA 3LSQA 3A7UA 2L33A 1BIAA 1ADYA 1B8AA 2ZT8A 2JY9A 1YZ9A 4LVJA 4LVMA 1YB3A 1WHQA 2M7QA 2J3MA 4HWPA 5DNYA 4H2XB 3TEHA 4LF9E 4DMIA 4TVWA 1H4TA 2Q5HA 3IKMB 5C53B 2NA2A 4DV7E 1HC7A 4ZTUB 2FGGA 3V8KA 5K1XA 4UPAA 1G5HA 2XTIA 3VQVA 1EQRA 1ADJA 1H4SA 5A2QC 1RC7A 2IY5B 4WPYA 4ZIBA 1C0AA 1JJCB 2ARTA 2I4MA 2L92A 2ODRC 2JOXA 1IBME 2AKWA 4YRKA 1NJ1A 5KNNA 12ASA 1SETA 2RS7A 2H36X 2MDRA 2V83A 1N32E 2CJBA 3RACA 3A5YA 3P8TA 3A7RA 3HXWA 3ADGA 1N34E 4YRRA 1KMNA 3R07A 4EX5A 4YRMA 1XNQE 1RIQA 2EWNA 2DKGA 4M30A 4L5NC 4XTYA 4YRCA 3J80C 4HT4A 2DMYA 1SESA 1EIYA 3BFMA 4XU2A 2DZ9A 4RDXA 2DU7A 4XEOA 4O2DA 5F3WA 4JI0E 3HPSA 3LMLA 3CMQA 3REXA 2P5IA 5C52B 1UILA 2V85A 2FYKA 1N33E 1BBWA 1H4QA 1X2HA 3T1HE 3VYYA 4LF5E 2E10A 2M4IA 4TWAA 4WSPA 2DEQA 3J7AG 1J26A 3P1XA 1YFSA 3UFGA 2C7IA 3L4GA 1HTTA 4JI5E 4X64E 2CGHA 4YY3E 1NJ8A 4BWAA 2ZIMA 4X8WA 4JI3E 2E3CA 2ZZFA 4H2YA 5LMUE 3HXZA 4DR1E 4Q28A 4BC7A 2QHTA 4X5OA 2DB2A 3HQ1A 3IG2A 3L4GB 4WJ3M 1X48A 4P3PA 4CS4A 2HHHE 4JV5E 4J15A 1B7YA 1BIBA 4NCXA 4BBYA 2VQFE 4BC9A 4YRGA 3MSWA 1YYKA 3RKXA 2UXCE 2ZTGA 3C4TA 1PYSA 4DV4E 5AE1A 4YCWA 3K6QA 3UGTA 4AH6A 2E1HA 3J81C 1T4OA 1USYA 2ZINA 1KMMA 2M1SA 2ALYB 4OX9E 3L1AA 1EFWA 1X01A 2AMCA 4YRPA 1ASYA 5T6JA 1LYLA 1HXDA 3ADLA 4P3NA 4P3OA 3QTCA 1USYC 1WNLA 3C4BA 4YRQA 2QHVA 1N9WA 3NELA 1GQEA 1NJ5A 2ZXFA 4CS2A 2MC6A 3LC0A 5LL6R 2UXDE 3FIGA 3I7FA 4P74C 5CFFE 1HNZE 3VQWA 4DKKA 2E5AA 2V88A 2JR1A 4K86A 3VQXA 5BR8E 2RSMA 2EWLA 2L3JA 3W3SA 4LU9A 4TVAA 4UP9A 2N3GA 4DV6E 4KR3A 4HWRA 3PCOB 4DQ2A 1EVLA 2KONA 4YDQA 3ERRA 4LF4E 2EJGA 1YFTA 2YZTA 2UXBE 3LSSA 1EOVA 2B9DA 4Q6GA 3JTZA 2VF1A 3HRKA 2P0LA 4YRFA 2MC5A 2ZCEA 4B3TE 4HWOA 4KZSA 1QF6A 1BBUA 3HTZA 3HXUA 4XTWA 4G84A 3HFZA 1W66A 4M2ZA 3HXYA 4Q15A 4YP0A 3TEHB 1GGMA 2RHQA 3NEMA 2V87A 3RMPA 4DR7E 2G4CA 4JYAE 1WLEA 2CPNA 2DTOA 2LTSA 4KHPE 1E1OA 3M4QA 4UP8A 4G85A 4LVLA 1WYDA 1SERA 3VYXA 5K1PA 5AASA 1FKAE 4JI4E 4LF6E 1NJ2A 2B7VA 1NYQA 4XU0A 4TUGA 4LVIA 2DVEA 3HPZA 2RHQB 3IWCA 4E51A 3KWRA 4XTVA 2L2MA 4P78A 2AKWB 3HXVA 1WXRA 2CJAA 4XU1A 2LBSB 1IBKE 4YRIA 4WFTA 4NXNE 1EVKA 2DJZA 2Q5IA 1O0WA 3IALA 4OOGC 2V89A 3F6GA 2J3LA 2DDZA 4H2VA 5AE3A 4KR2A 3PZCA 1NYRA 4DV3E 2DXUA 3DJWA 2B3TB 4L87A 5ADZA 2E41A 4B3ME 4HWTA 1NNHA 4HVCA 2CJ9A 3UGQA 1EIYB 4DV2E 3AV0A 2DQ0A 3OTOE 2ZR3A 3LLHA 3VBBA 2ZR2A 3V8JA 3HXLA 4JI6E 4GKKE 4LFBE 3HFVA 1ZBTA 4UP7A 4P71A 1PKPA 1X55A 4ZTZB 5FLXC 3HTXA 3A74A 4YRLA 1EKZA 1E1TA 2UUAE 2F8BA 4H02A 4DV0E 3TEGA 4LFAE 4DR6E 2ARSA 4P71C 4AQYE 4HWSA 2K4VA 5IWAE 4TVYA 2RS6A 1WQWA 4P72A 4HA8A 3KFUA 3JU0A 4M0VA 4X66E 4YREA 4R03A 2EJFA 3V7SA 2ZGWA 1E22A 1YGBA 2Q7HA 3REUA 3F6HA 1DI2A 1X54A 1YFRA 4P72C 4TTVA 2PMFA 3RL6A 2ZT7A 3ICAA 3OD1A 2IHR1 2DXTA 3QO7A 3VK6A 2L2KB 2ZT5A 3ADIA 3QNEA 4P75A 1IBLE 5LMNE 3A7AA 1FJGE 2L8TA 1B7YB 3RKWA 1J5WA 3QO8A 2ZM6E 4P74A 3RF1A 4OP0A 4CH5A 4YRJA 2DTIA 4P75C 4PHCA 1PYSB 4B3SE 4CH3A 2DU5A 2F4VE 3IKLA 1SRYA 2CIMA 2QHUA 2JOBA 5E3IA 3P8VA 2AMCB 5HGQA 3A31A 2UU9E 4JI2E 2V8QB 1N36E 2I4OA 2A8EA 4F9BB 2E65A 2Q7EA 4YRNA 2L3CA 4B3RE 2L6MA 4EO4A 4RQFA 3V7CA 3A32A 4LVKA 4X65E 2LUQA 3HXXA 4XEMA 1J5EE 4XTZA 3E9HA 2EZ6A 4H2XA 3HY0A 4RQEA 5C51B 2NS6A 5ELNA 2PMEA 4YYEA 1ATIA 4GKJE 4YRSA 1SR9A 4K87A 3MF2A 2I4LA 4WI1A 4TVAB 4XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY5 A;  1IL2 A;  1JJC A;  3WQZ A;  3RKY A;  1B76 A;  3VQY A;  4BW9 A;  2ZT6 A;  5ELO A;  4XU3 A;  2EAY A;  2EJ9 A;  3EFS A;  2ZNJ A;  2C8M A;  3E9I A;  3HFZ B;  4WF2 A;  3V7R A;  4CH4 A;  1H4V B;  1WU7 A;  1VQZ A;  3RIR A;  11AS A;  4YCU A;  2EL9 A;  4RMF A;  4TQD A;  5F5W A;  1WPY A;  2DZC A;  3V8L A;  3NEN A;  1X56 A;  2Q7G A;  4K88 A;  4P73 A;  1B70 A;  1G5I A;  2HNI A;  2ZZG A;  1Z7N A;  2DQ3 A;  1WQ7 A;  2RHS A;  4DPG A;  3RGL A;  4H2U A;  3DSQ A;  4P73 C;  1G51 A;  2I4N A;  4YRO A;  4YPF A;  1NJ6 A;  1B70 B;  3NET A;  4PG3 A;  3EFR A;  4H2T A;  2RHS B;  4WJ4 A;  1L0W A;  3M4P A;  4H2W A;  3UH0 A;  3HRI A;  3HY1 A;  4LNS A;  1X2G A;  4YCV A;  3QO5 A;  3FJP A;  2ZNI A;  4YRT A;  3BJU A;  3A5Z A;  2ARU A;  3TUP A;  2E64 A;  2DTH A;  4OLF A;  4CS3 A;  4H2S A;  3MEY A;  1QE0 A;  3G1Z A;  3P8Y A;  3RUX A;  2ALY A;  1ASZ A;  4CH6 A;  1KOG A;  2ODR D;  4XTU A;  2ZIO A;  1FYF A;  3L2Z A;  3MF1 A;  2QHS A;  2XGT A;  1Z7M A;  2ZZE A;  4TQF A;  3PCO A;  4KQE A;  1E24 A;  3LSQ A;  3A7U A;  1BIA A;  1ADY A;  1B8A A;  2ZT8 A;  1YB3 A;  2J3M A;  4HWP A;  4H2X B;  3TEH A;  4TVW A;  1H4T A;  2Q5H A;  3IKM B;  5C53 B;  1HC7 A;  4ZTU B;  3V8K A;  5K1X A;  4UPA A;  1G5H A;  2XTI A;  3VQV A;  1EQR A;  1ADJ A;  1H4S A;  2IY5 B;  4ZIB A;  1C0A A;  1JJC B;  2ART A;  2I4M A;  2ODR C;  2AKW A;  4YRK A;  1NJ1 A;  5KNN A;  12AS A;  1SET A;  2CJB A;  3RAC A;  3A5Y A;  3P8T A;  3A7R A;  3HXW A;  4YRR A;  1KMN A;  3R07 A;  4EX5 A;  4YRM A;  1RIQ A;  2EWN A;  2DKG A;  4XTY A;  4YRC A;  1SES A;  1EIY A;  3BFM A;  4XU2 A;  2DZ9 A;  4RDX A;  2DU7 A;  4XEO A;  4O2D A;  3CMQ A;  3REX A;  2P5I A;  5C52 B;  2FYK A;  1BBW A;  1H4Q A;  1X2H A;  2E10 A;  4TWA A;  2DEQ A;  1YFS A;  3UFG A;  2C7I A;  3L4G A;  1HTT A;  2CGH A;  1NJ8 A;  4BWA A;  2ZIM A;  2E3C A;  2ZZF A;  4H2Y A;  3HXZ A;  2QHT A;  4X5O A;  3IG2 A;  3L4G B;  4WJ3 M;  4P3P A;  4CS4 A;  4J15 A;  1B7Y A;  1BIB A;  4NCX A;  4YRG A;  3RKX A;  2ZTG A;  1PYS A;  4YCW A;  3UGT A;  4AH6 A;  2E1H A;  1USY A;  2ZIN A;  1KMM A;  2ALY B;  3L1A A;  1EFW A;  1X01 A;  2AMC A;  4YRP A;  1ASY A;  1LYL A;  1HXD A;  4P3N A;  4P3O A;  3QTC A;  1USY C;  1WNL A;  4YRQ A;  2QHV A;  1N9W A;  3NEL A;  1NJ5 A;  2ZXF A;  4CS2 A;  3LC0 A;  3I7F A;  4P74 C;  3VQW A;  2E5A A;  4K86 A;  3VQX A;  3W3S A;  4TVA A;  4UP9 A;  4KR3 A;  4HWR A;  3PCO B;  4DQ2 A;  1EVL A;  4YDQ A;  3ERR A;  2EJG A;  1YFT A;  3LSS A;  1EOV A;  4Q6G A;  4YRF A;  3HRK A;  2P0L A;  2ZCE A;  4HWO A;  1QF6 A;  1BBU A;  3HTZ A;  3HXU A;  4XTW A;  4G84 A;  3HFZ A;  1W66 A;  3HXY A;  4Q15 A;  4YP0 A;  3TEH B;  1GGM A;  2RHQ A;  3NEM A;  2G4C A;  1WLE A;  2DTO A;  3M4Q A;  1E1O A;  4UP8 A;  4G85 A;  1WYD A;  1SER A;  5K1P A;  1NYQ A;  1NJ2 A;  4XU0 A;  2DVE A;  2RHQ B;  4E51 A;  4XTV A;  2AKW B;  3HXV A;  2CJA A;  4XU1 A;  4YRI A;  1EVK A;  2DJZ A;  2Q5I A;  3IAL A;  2J3L A;  2DDZ A;  4H2V A;  4KR2 A;  3PZC A;  1NYR A;  2DXU A;  4L87 A;  2E41 A;  4HWT A;  1NNH A;  4HVC A;  2CJ9 A;  3UGQ A;  1EIY B;  2DQ0 A;  2ZR3 A;  3VBB A;  2ZR2 A;  3V8J A;  3HFV A;  4UP7 A;  4P71 A;  1X55 A;  4ZTZ B;  3A74 A;  4YRL A;  1E1T A;  4H02 A;  3TEG A;  2ARS A;  4P71 C;  4HWS A;  4TVY A;  1WQW A;  4P72 A;  4HA8 A;  3KFU A;  4YRE A;  2EJF A;  3V7S A;  2ZGW A;  1E22 A;  1YGB A;  2Q7H A;  3REU A;  4P72 C;  1YFR A;  1X54 A;  4TTV A;  2PMF A;  3RL6 A;  2ZT7 A;  3ICA A;  3OD1 A;  2DXT A;  3QO7 A;  2ZT5 A;  3QNE A;  4P75 A;  3A7A A;  1B7Y B;  3RKW A;  1J5W A;  3QO8 A;  4P74 A;  3RF1 A;  4OP0 A;  4CH5 A;  4YRJ A;  2DTI A;  4P75 C;  4PHC A;  1PYS B;  4CH3 A;  2DU5 A;  3IKL A;  1SRY A;  2CIM A;  2QHU A;  5E3I A;  3P8V A;  2AMC B;  5HGQ A;  3A31 A;  2I4O A;  2E65 A;  2Q7E A;  4YRN A;  4EO4 A;  4RQF A;  3V7C A;  3A32 A;  3HXX A;  4XEM A;  4XTZ A;  3E9H A;  4H2X A;  3HY0 A;  4RQE A;  5C51 B;  5ELN A;  2PME A;  4YYE A;  1ATI A;  4YRS A;  4K87 A;  3MF2 A;  2I4L A;  4WI1 A;  4TVA B;  4XTX A; 
#chains in the Genus database with same CATH topology
 2BBG A;  2JWO A;  3IWB A;  3OML A;  2ADR A;  2EOM A;  2IY5 A;  4F6N A;  1IL2 A;  4R8O A;  1JJC A;  1P47 A;  4JI1 E;  3WQZ A;  2HC5 A;  1B76 A;  3RKY A;  3VQY A;  4BW9 A;  2ZT6 A;  1NCS A;  2DSY A;  2KOU A;  1UHZ A;  4XU3 A;  2EAY A;  5ELO A;  2EJ9 A;  2G7H A;  3EFS A;  2ZNJ A;  3ECR A;  1PJQ A;  1XNR E;  2C8M A;  1T4L B;  3E9I A;  3HFZ B;  4ZYD A;  1X49 A;  4WF2 A;  4Q35 B;  4F9A B;  2LVH A;  1QU6 A;  3THO B;  5AE2 A;  3V7R A;  2EN8 A;  4CH4 A;  1H4V B;  1WJP A;  1WU7 A;  1VQZ A;  2UUC E;  3MQZ A;  3RIR A;  2VQE E;  11AS A;  4YCU A;  2EM5 A;  2EL9 A;  5IT9 C;  4RMF A;  4LF7 E;  4L8N A;  4M9V C;  4TQD A;  5F5W A;  1WPY A;  4R2D A;  4TUI A;  2EN1 A;  1T4N A;  2DZC A;  2EN2 A;  4LTY A;  2EM0 A;  2EPM X;  4BS9 A;  1A1I A;  1HNX E;  3V8L A;  4DUZ E;  4K0K E;  3NEN A;  1X56 A;  2L2N A;  3DF6 A;  1I94 E;  2Q7G A;  1X6H A;  4K88 A;  4DR2 E;  2PRT A;  2YTI A;  1XMO E;  2RTX A;  4WYQ B;  1UN6 B;  3C6K A;  2EPA A;  4P73 A;  1B70 A;  1G5I A;  1HR0 E;  2HNI A;  2ZZG A;  1DQ3 A;  4NXM E;  1Z7N A;  1WHN A;  2JVA A;  2WZO A;  2DQ3 A;  1WQ7 A;  2FV4 B;  1JK2 A;  2RHS A;  2EMB A;  2FTX B;  4BMJ A;  4LFC E;  4J8Z A;  4DPG A;  3RGL A;  4H2U A;  3DSQ A;  3ADJ A;  1DGC A;  4P73 C;  1G51 A;  2I4N A;  2LCE A;  2YRM A;  4YRO A;  2NUF A;  2EQ1 A;  4YPF A;  4R2C A;  4X62 E;  1NJ6 A;  1B70 B;  3NET A;  4PG3 A;  3EFR A;  1ZAA C;  4BCA A;  4R2R A;  1YPN A;  1X47 A;  4H2T A;  2N3H A;  2RHS B;  4WJ4 A;  4R2P A;  1L0W A;  2ENH A;  3M4P A;  1STU A;  3IWD A;  4F54 A;  4P7D A;  4H2W A;  3UH0 A;  4JI7 E;  2KHX A;  1YYW A;  3HRI A;  3HY1 A;  4LNS A;  1X2G A;  4YCV A;  3QO5 A;  2E5L E;  2LJH A;  1HNW E;  3FJP A;  4WXC A;  2ZNI A;  4YRT A;  3BJU A;  2VE7 C;  4BHB A;  2LTR A;  3A5Z A;  2ARU A;  3TUP A;  3AUZ A;  1YYO A;  2E64 A;  2DTH A;  4DV5 E;  2DIX A;  4DUY E;  4OLF A;  4CS3 A;  2EL5 A;  2LMZ A;  1MGT A;  4ZYG A;  2E72 A;  2LE2 A;  4H2S A;  1T38 A;  3MEY A;  2NUE A;  1QE0 A;  3G1Z A;  3P8Y A;  3RUX A;  4F6M A;  3JAM C;  1RQ0 A;  2ALY A;  2B7T A;  2DLQ A;  4GEQ B;  2NUG A;  1ASZ A;  4JI8 E;  4F2J C;  4NZV A;  4F9C B;  2JPA A;  2JXP A;  3KZY A;  1WRJ A;  2WBT A;  2LV2 A;  3ZOQ B;  3H09 A;  2JYA A;  1A1J A;  1ZBQ A;  5A6B A;  1GZ6 A;  2YU5 A;  1X6E A;  4CH6 A;  1KOG A;  2EOY A;  1B69 A;  2ODR D;  4LF8 E;  2ZIO A;  4XTU A;  3J7Y p;  1FYF A;  3L2Z A;  3MF1 A;  4DV1 E;  3T1Y E;  2QHS A;  4DR5 E;  2EOJ A;  2UUB E;  2V86 A;  4DR4 E;  2XGT A;  1Z7M A;  2A25 A;  2LRS A;  4MLV A;  4DR3 E;  2LUP B;  2ZZE A;  2EN3 A;  2GHF A;  4YHH E;  4TQF A;  1XMQ E;  3PCO A;  4I8O A;  4KQE A;  2YT4 A;  1E24 A;  1PDA A;  2E1M A;  3LSQ A;  3A7U A;  2L33 A;  1BIA A;  5KL3 A;  1ADY A;  1B8A A;  2ZT8 A;  2JY9 A;  4R2S A;  1YZ9 A;  4LVJ A;  4LVM A;  1YB3 A;  1WHQ A;  2M7Q A;  2J3M A;  4HWP A;  4RH8 A;  3KZZ A;  5DNY A;  4H2X B;  3TEH A;  4LF9 E;  4DMI A;  3BBG A;  2GLI A;  4TVW A;  2R76 A;  1H4T A;  2Q5H A;  3IKM B;  5C53 B;  2EL4 A;  2NA2 A;  4DV7 E;  1HC7 A;  4KWY A;  4ZTU B;  2FGG A;  2Q8U A;  3V8K A;  5AC5 A;  5K1X A;  4O4K A;  1G5H A;  2XTI A;  4UPA A;  3VQV A;  1EQR A;  1ADJ A;  1H4S A;  2K7I A;  5A2Q C;  1RC7 A;  2IY5 B;  4WPY A;  4ZIB A;  1C0A A;  1JJC B;  4GZN C;  2ART A;  2I4M A;  1TN9 A;  2YTQ A;  2JOX A;  2L92 A;  2ODR C;  1IBM E;  2EMC A;  2EM9 A;  2AKW A;  4YRK A;  1NJ1 A;  5IXM B;  5KNN A;  2EPP A;  12AS A;  1SET A;  2RS7 A;  1TF6 A;  2H36 X;  2MDR A;  4IS1 C;  2V83 A;  1N32 E;  2CJB A;  1EH8 A;  3RAC A;  3A5Y A;  5KL2 A;  3P8T A;  2EMX A;  3A7R A;  1PJT A;  2EOR A;  3HXW A;  3ADG A;  1N34 E;  4YRR A;  5IV8 B;  1KMN A;  3R07 A;  4EX5 A;  3THN A;  1XNQ E;  4YRM A;  1ZR9 A;  3EQ1 A;  1RIQ A;  2YRH A;  2EWN A;  4MLQ A;  2DKG A;  4M30 A;  2EMZ A;  4L5N C;  4XTY A;  4YRC A;  3J80 C;  4HT4 A;  2DMY A;  1SES A;  1EIY A;  3BFM A;  4XU2 A;  2DGC A;  2DZ9 A;  4RDX A;  2YTF A;  2DU7 A;  4XEO A;  4HTG A;  4O2D A;  1BBG A;  2EM8 A;  5F3W A;  4JI0 E;  3HPS A;  3LML A;  3CMQ A;  3REX A;  2P5I A;  2RPC A;  5C52 B;  1UIL A;  2J7J A;  2ELY A;  2V85 A;  2FYK A;  4XTX A;  1N33 E;  1BBW A;  1H4Q A;  1X2H A;  3T1H E;  3VYY A;  4LF5 E;  2E10 A;  2M4I A;  1YUJ A;  4TWA A;  4WSP A;  2DEQ A;  3J7A G;  1J26 A;  3P1X A;  2JP9 A;  1YFS A;  3UFG A;  2C7I A;  2EPX A;  3L4G A;  1HTT A;  1X3C A;  5KL6 A;  4JI5 E;  4X64 E;  2CGH A;  3MHS C;  4YY3 E;  1NJ8 A;  1NEI A;  4BWA A;  2ZIM A;  4X8W A;  5KL5 A;  4JI3 E;  2E3C A;  2ZZF A;  4IJD A;  2ENC A;  2MKN A;  2VRD A;  4H2Y A;  5LMU E;  3UK3 C;  3HXZ A;  4DR1 E;  4Q28 A;  1L4S A;  4BC7 A;  2QHT A;  4X5O A;  3EPH A;  1ZU1 A;  2EPL X;  2DB2 A;  3HQ1 A;  2MKD A;  3IG2 A;  3L4G B;  4WJ3 M;  2D9H A;  1X48 A;  4P3P A;  4CS4 A;  2HHH E;  3MHH C;  1X6F A;  2EMK A;  1UBD C;  4JV5 E;  4J15 A;  1B7Y A;  2YPN A;  1BIB A;  4NCX A;  4BBY A;  2VQF E;  4BC9 A;  4YRG A;  3MSW A;  1YYK A;  3RKX A;  2UXC E;  2ZTG A;  3C4T A;  1PYS A;  4DV4 E;  5AE1 A;  4YCW A;  3K6Q A;  3UGT A;  4AH6 A;  2E1H A;  2R1F A;  3J81 C;  1T4O A;  1USY A;  2ZIN A;  1KMM A;  2M1S A;  2ALY B;  4OX9 E;  2MDG A;  3L1A A;  1EFW A;  2EOQ A;  1X01 A;  2AMC A;  4YRP A;  1ASY A;  5T6J A;  1LYL A;  1HXD A;  4R2Q A;  3ADL A;  4P3N A;  4P3O A;  3QTC A;  1USY C;  1WNL A;  2LT7 A;  3C4B A;  2EOH A;  4YRQ A;  4FK5 C;  2QHV A;  2EOX A;  1N9W A;  3NEL A;  1GQE A;  1NJ5 A;  2ZXF A;  2EM6 A;  2YTN A;  4CS2 A;  2MC6 A;  3LC0 A;  5LL6 R;  4HEI A;  5A6K A;  1YSA C;  2UXD E;  2ELZ A;  3FIG A;  3I7F A;  4P74 C;  3BGH A;  5CFF E;  1HNZ E;  3VQW A;  1X5W A;  1EH7 A;  4DKK A;  2E5A A;  2RSI A;  2V88 A;  2HGH A;  2YRK A;  2JR1 A;  2ENA A;  4K86 A;  3VQX A;  1RMD A;  2EP3 A;  5BR8 E;  2RSM A;  2EWL A;  2EN7 A;  2L3J A;  3W3S A;  4LU9 A;  4TVA A;  1YUI A;  4UP9 A;  1A1H A;  2N3G A;  3EPL A;  3QG5 C;  4DV6 E;  3PCO B;  4HWR A;  4KR3 A;  4DQ2 A;  1TF3 A;  2EM3 A;  1EVL A;  2KON A;  4YDQ A;  3ERR A;  2EQ0 A;  4LF4 E;  2EM4 A;  4X9J A;  2EJG A;  1YFT A;  1IMU A;  2YZT A;  2UXB E;  3LSS A;  1EOV A;  1T39 A;  2B9D A;  4Q6G A;  3JTZ A;  2VF1 A;  3HRK A;  1KYQ A;  2CTD A;  2P0L A;  4YRF A;  2MC5 A;  2ZCE A;  4B3T E;  4HWO A;  4KZS A;  1QF6 A;  1BBU A;  3HTZ A;  3HXU A;  4XTW A;  4G84 A;  3HFZ A;  1W66 A;  4M2Z A;  3HXY A;  4Q15 A;  4YP0 A;  3TEH B;  1GGM A;  2RHQ A;  3NEM A;  2V87 A;  2YSO A;  3RMP A;  4DR7 E;  2G4C A;  5KL4 A;  4JYA E;  1WLE A;  2CPN A;  2EOE A;  2LTS A;  4KHP E;  1E1O A;  2DTO A;  3M4Q A;  2EM7 A;  4G85 A;  4UP8 A;  4LVL A;  1WYD A;  1SER A;  3VYX A;  5AC4 A;  5K1P A;  5AAS A;  1FKA E;  4JI4 E;  4LF6 E;  1NJ2 A;  2B7V A;  1NYQ A;  2EQ3 A;  4XU0 A;  5A69 A;  4TUG A;  4LVI A;  4WXD A;  2DVE A;  2WBS A;  4WX9 A;  3HPZ A;  4ZYE A;  2RHQ B;  1A1G A;  3IWC A;  2EPU A;  4E51 A;  3KWR A;  4XTV A;  2L2M A;  4P78 A;  2AKW B;  5LLQ A;  3HXV A;  2CT1 A;  2YWQ A;  1WXR A;  4WSG A;  2CJA A;  4XU1 A;  2LBS B;  3M99 B;  1IBK E;  4YRI A;  4RHB B;  4WFT A;  4NXN E;  1EVK A;  2EMF A;  2DJZ A;  2Q5I A;  2N8X A;  1O0W A;  3IAL A;  4OOG C;  2V89 A;  2DMI A;  3F6G A;  2J3L A;  2EOZ A;  2CSH A;  2DDZ A;  4H2V A;  2EPO A;  5AE3 A;  2YTJ A;  5A6A A;  4KR2 A;  5TSE A;  3PZC A;  1NYR A;  2EMG A;  2EN6 A;  4DV3 E;  1YFH A;  1JK1 A;  1A1L A;  3DJW A;  2B3T B;  2DXU A;  5ADZ A;  4L87 A;  2E41 A;  2EPC A;  4B3M E;  4HWT A;  1NNH A;  1BB8 A;  4HVC A;  2EPK X;  2CJ9 A;  2WCC 3;  3BID A;  3REU A;  2YTO A;  3UGQ A;  1EIY B;  4DV2 E;  3AV0 A;  2DQ0 A;  3OTO E;  2ZR3 A;  3LLH A;  1MEY C;  3VBB A;  2ZR2 A;  2EPR A;  1G2D C;  4R2E A;  3V8J A;  3HXL A;  4JI6 E;  4GKK E;  2YTD A;  2BB8 A;  1G2F C;  4LFB E;  1QNT A;  3HFV A;  1ZBT A;  2YU8 A;  4UP7 A;  4P71 A;  1PKP A;  1X55 A;  1LLM C;  5A6B D;  2GPI A;  4ZTZ B;  2WBU A;  5FLX C;  3HTX A;  2EL6 A;  3A74 A;  1AH5 A;  4YRL A;  1EKZ A;  1AAY A;  2UUA E;  1E1T A;  2F8B A;  4H02 A;  4DV0 E;  3TEG A;  4LFA E;  4DR6 E;  2ARS A;  3L00 A;  4P71 C;  4AQY E;  4HWS A;  2K4V A;  2EN4 A;  5IWA E;  1KJK A;  4TVY A;  2RS6 A;  2RQL A;  1WQW A;  4P72 A;  1N3G A;  4HA8 A;  3KFU A;  3JU0 A;  4M0V A;  4X66 E;  4YRE A;  4R03 A;  2EJF A;  2I9I A;  3V7S A;  2YTP A;  2ZGW A;  2LO3 A;  3C6M A;  2DRP A;  1E22 A;  1YGB A;  2Q7H A;  2EMY A;  2EOI A;  2LJU A;  2M9A A;  3F6H A;  4BHC A;  1A1F A;  1DI2 A;  1X54 A;  1YFR A;  4P72 C;  4TTV A;  1F2I G;  1IQS A;  2EMW A;  2EPN A;  1BBO A;  2PMF A;  2I13 A;  2ZT7 A;  3ICA A;  3OD1 A;  3RL6 A;  2IHR 1;  2DXT A;  3QO7 A;  4O43 A;  3VK6 A;  2DLK A;  2EM2 A;  2L2K B;  2ZT5 A;  3ADI A;  3QNE A;  4P75 A;  4ZYH A;  1IBL E;  3EPK A;  2EOO A;  5LMN E;  3A7A A;  1FJG E;  2L8T A;  1B7Y B;  3BF2 A;  3RKW A;  1J5W A;  3QO8 A;  2ZM6 E;  4P74 A;  3RF1 A;  4O24 A;  4OP0 A;  4CH5 A;  1GTK A;  4YRJ A;  2DTI A;  4P75 C;  4PHC A;  1PYS B;  1A1K A;  4B3S E;  4CH3 A;  2DU5 A;  1EH6 A;  2F4V E;  3IKL A;  1SRY A;  2CIM A;  2QHU A;  2EPZ A;  2JOB A;  5E3I A;  3P8V A;  2AMC B;  5HGQ A;  3A31 A;  2UU9 E;  4JI2 E;  1PJS A;  2V8Q B;  1N36 E;  2A8E A;  2I4O A;  4F9B B;  2E65 A;  2Q7E A;  4R2A A;  1SFE A;  1IQO A;  2EE8 A;  4YRN A;  4NHR A;  4O5G A;  2EJ4 A;  2L3C A;  4B3R E;  3EPJ A;  2L6M A;  4EO4 A;  4RQF A;  3V7C A;  2NAB A;  3A32 A;  4LVK A;  2EMA A;  4X65 E;  2LUQ A;  2EMI A;  3HXX A;  2EOF A;  3TQM A;  1J5E E;  4XEM A;  4XTZ A;  3E9H A;  2EZ6 A;  4H2X A;  3HY0 A;  4RQE A;  5C51 B;  2YTG A;  1Z1B A;  2NS6 A;  5ELN A;  2PME A;  1ATI A;  4GKJ E;  4YYE A;  1SR9 A;  2YSP A;  4YRS A;  4K87 A;  2YTE A;  5KL7 A;  2HJJ A;  3MF2 A;  2I4L A;  3VHT B;  2EOS A;  5A6J A;  2EML A;  4WI1 A;  4TVA B;  2EMH A;  4N4R B; 
#chains in the Genus database with same CATH homology
 2JWO A;  3IWB A;  3OML A;  2IY5 A;  1IL2 A;  4R8O A;  1JJC A;  4JI1 E;  3WQZ A;  3RKY A;  1B76 A;  3VQY A;  4BW9 A;  2ZT6 A;  5ELO A;  2DSY A;  2KOU A;  1UHZ A;  4XU3 A;  2EAY A;  2EJ9 A;  2G7H A;  3EFS A;  2ZNJ A;  1XNR E;  2C8M A;  1T4L B;  3E9I A;  3HFZ B;  1X49 A;  4WF2 A;  4F9A B;  3V7R A;  1QU6 A;  5AE2 A;  4CH4 A;  1H4V B;  1WU7 A;  1VQZ A;  2UUC E;  3MQZ A;  3RIR A;  2VQE E;  11AS A;  4YCU A;  2EL9 A;  5IT9 C;  4RMF A;  4LF7 E;  4L8N A;  4TQD A;  5F5W A;  1WPY A;  4TUI A;  1T4N A;  2DZC A;  4LTY A;  3V8L A;  4BS9 A;  1HNX E;  4DUZ E;  4K0K E;  3NEN A;  1X56 A;  2L2N A;  3DF6 A;  1I94 E;  2Q7G A;  4K88 A;  4DR2 E;  1XMO E;  2RTX A;  4WYQ B;  4P73 A;  1B70 A;  1G5I A;  1HR0 E;  2HNI A;  2ZZG A;  1DQ3 A;  4NXM E;  1Z7N A;  1WHN A;  2JVA A;  2WZO A;  2DQ3 A;  1WQ7 A;  2FV4 B;  2RHS A;  2FTX B;  4BMJ A;  4LFC E;  4DPG A;  4J8Z A;  3RGL A;  4H2U A;  3DSQ A;  3ADJ A;  4P73 C;  1G51 A;  2I4N A;  4YRO A;  2NUF A;  4YPF A;  4X62 E;  1NJ6 A;  1B70 B;  3NET A;  4PG3 A;  3EFR A;  4BCA A;  1X47 A;  4H2T A;  2N3H A;  2RHS B;  4WJ4 A;  1L0W A;  3M4P A;  1STU A;  3IWD A;  4F54 A;  4P7D A;  4H2W A;  3UH0 A;  4JI7 E;  2KHX A;  1YYW A;  3HRI A;  3HY1 A;  4LNS A;  1X2G A;  4YCV A;  3QO5 A;  2E5L E;  2LJH A;  1HNW E;  3FJP A;  2ZNI A;  4YRT A;  3BJU A;  2VE7 C;  2LTR A;  3A5Z A;  2ARU A;  3TUP A;  3AUZ A;  1YYO A;  2E64 A;  2DTH A;  4DV5 E;  2DIX A;  4DUY E;  4OLF A;  4CS3 A;  2LMZ A;  4H2S A;  2LE2 A;  3MEY A;  2NUE A;  1QE0 A;  3G1Z A;  3P8Y A;  3RUX A;  3JAM C;  1RQ0 A;  2ALY A;  2B7T A;  4GEQ B;  2NUG A;  1ASZ A;  4JI8 E;  4F9C B;  3ZOQ B;  3H09 A;  1ZBQ A;  1GZ6 A;  4CH6 A;  1KOG A;  2ODR D;  4LF8 E;  2ZIO A;  4XTU A;  3J7Y p;  1FYF A;  3L2Z A;  3MF1 A;  4DV1 E;  3T1Y E;  2QHS A;  4DR5 E;  2UUB E;  2V86 A;  4DR4 E;  2XGT A;  1Z7M A;  2LRS A;  4DR3 E;  2LUP B;  2ZZE A;  4YHH E;  4TQF A;  1XMQ E;  3PCO A;  4I8O A;  4KQE A;  2YT4 A;  1E24 A;  2E1M A;  3LSQ A;  3A7U A;  2L33 A;  1BIA A;  1ADY A;  1B8A A;  2ZT8 A;  2JY9 A;  1YZ9 A;  4LVJ A;  4LVM A;  1YB3 A;  1WHQ A;  2M7Q A;  2J3M A;  4HWP A;  5DNY A;  4H2X B;  3TEH A;  4LF9 E;  4DMI A;  4TVW A;  1H4T A;  2Q5H A;  3IKM B;  5C53 B;  2NA2 A;  4DV7 E;  1HC7 A;  4ZTU B;  2FGG A;  3V8K A;  5K1X A;  4UPA A;  1G5H A;  2XTI A;  3VQV A;  1EQR A;  1ADJ A;  1H4S A;  5A2Q C;  1RC7 A;  2IY5 B;  4WPY A;  4ZIB A;  1C0A A;  1JJC B;  2ART A;  2I4M A;  2L92 A;  2ODR C;  2JOX A;  1IBM E;  2AKW A;  4YRK A;  1NJ1 A;  5KNN A;  12AS A;  1SET A;  2RS7 A;  2H36 X;  2MDR A;  2V83 A;  1N32 E;  2CJB A;  3RAC A;  3A5Y A;  3P8T A;  3A7R A;  3HXW A;  3ADG A;  1N34 E;  4YRR A;  1KMN A;  3R07 A;  4EX5 A;  4YRM A;  1XNQ E;  1RIQ A;  2EWN A;  2DKG A;  4M30 A;  4L5N C;  4XTY A;  4YRC A;  3J80 C;  4HT4 A;  2DMY A;  1SES A;  1EIY A;  3BFM A;  4XU2 A;  2DZ9 A;  4RDX A;  2DU7 A;  4XEO A;  4O2D A;  5F3W A;  4JI0 E;  3HPS A;  3LML A;  3CMQ A;  3REX A;  2P5I A;  5C52 B;  1UIL A;  2V85 A;  2FYK A;  1N33 E;  1BBW A;  1H4Q A;  1X2H A;  3T1H E;  3VYY A;  4LF5 E;  2E10 A;  2M4I A;  4TWA A;  4WSP A;  2DEQ A;  3J7A G;  1J26 A;  3P1X A;  1YFS A;  3UFG A;  2C7I A;  3L4G A;  1HTT A;  4JI5 E;  4X64 E;  2CGH A;  4YY3 E;  1NJ8 A;  4BWA A;  2ZIM A;  4X8W A;  4JI3 E;  2E3C A;  2ZZF A;  4H2Y A;  5LMU E;  3HXZ A;  4DR1 E;  4Q28 A;  4BC7 A;  2QHT A;  4X5O A;  2DB2 A;  3HQ1 A;  3IG2 A;  3L4G B;  4WJ3 M;  1X48 A;  4P3P A;  4CS4 A;  2HHH E;  4JV5 E;  4J15 A;  1B7Y A;  1BIB A;  4NCX A;  4BBY A;  2VQF E;  4BC9 A;  4YRG A;  3MSW A;  1YYK A;  3RKX A;  2UXC E;  2ZTG A;  3C4T A;  1PYS A;  4DV4 E;  5AE1 A;  4YCW A;  3K6Q A;  3UGT A;  4AH6 A;  2E1H A;  3J81 C;  1T4O A;  1USY A;  2ZIN A;  1KMM A;  2M1S A;  2ALY B;  4OX9 E;  3L1A A;  1EFW A;  1X01 A;  2AMC A;  4YRP A;  1ASY A;  5T6J A;  1LYL A;  1HXD A;  3ADL A;  4P3N A;  4P3O A;  3QTC A;  1USY C;  1WNL A;  3C4B A;  4YRQ A;  2QHV A;  1N9W A;  3NEL A;  1GQE A;  1NJ5 A;  2ZXF A;  4CS2 A;  2MC6 A;  3LC0 A;  5LL6 R;  2UXD E;  3FIG A;  3I7F A;  4P74 C;  5CFF E;  1HNZ E;  3VQW A;  4DKK A;  2E5A A;  2V88 A;  2JR1 A;  4K86 A;  3VQX A;  5BR8 E;  2RSM A;  2EWL A;  2L3J A;  3W3S A;  4LU9 A;  4TVA A;  4UP9 A;  2N3G A;  4DV6 E;  4KR3 A;  4HWR A;  3PCO B;  4DQ2 A;  1EVL A;  2KON A;  4YDQ A;  3ERR A;  4LF4 E;  2EJG A;  1YFT A;  2YZT A;  2UXB E;  3LSS A;  1EOV A;  2B9D A;  4Q6G A;  3JTZ A;  2VF1 A;  3HRK A;  2P0L A;  4YRF A;  2MC5 A;  2ZCE A;  4B3T E;  4HWO A;  4KZS A;  1QF6 A;  1BBU A;  3HTZ A;  3HXU A;  4XTW A;  4G84 A;  3HFZ A;  1W66 A;  4M2Z A;  3HXY A;  4Q15 A;  4YP0 A;  3TEH B;  1GGM A;  2RHQ A;  3NEM A;  2V87 A;  3RMP A;  4DR7 E;  2G4C A;  4JYA E;  1WLE A;  2CPN A;  2DTO A;  2LTS A;  4KHP E;  1E1O A;  3M4Q A;  4UP8 A;  4G85 A;  4LVL A;  1WYD A;  1SER A;  3VYX A;  5K1P A;  5AAS A;  1FKA E;  4JI4 E;  4LF6 E;  1NJ2 A;  2B7V A;  1NYQ A;  4XU0 A;  4TUG A;  4LVI A;  2DVE A;  3HPZ A;  2RHQ B;  3IWC A;  4E51 A;  3KWR A;  4XTV A;  2L2M A;  4P78 A;  2AKW B;  3HXV A;  1WXR A;  2CJA A;  4XU1 A;  2LBS B;  1IBK E;  4YRI A;  4WFT A;  4NXN E;  1EVK A;  2DJZ A;  2Q5I A;  1O0W A;  3IAL A;  4OOG C;  2V89 A;  3F6G A;  2J3L A;  2DDZ A;  4H2V A;  5AE3 A;  4KR2 A;  3PZC A;  1NYR A;  4DV3 E;  2DXU A;  3DJW A;  2B3T B;  4L87 A;  5ADZ A;  2E41 A;  4B3M E;  4HWT A;  1NNH A;  4HVC A;  2CJ9 A;  3UGQ A;  1EIY B;  4DV2 E;  3AV0 A;  2DQ0 A;  3OTO E;  2ZR3 A;  3LLH A;  3VBB A;  2ZR2 A;  3V8J A;  3HXL A;  4JI6 E;  4GKK E;  4LFB E;  3HFV A;  1ZBT A;  4UP7 A;  4P71 A;  1PKP A;  1X55 A;  4ZTZ B;  5FLX C;  3HTX A;  3A74 A;  4YRL A;  1EKZ A;  1E1T A;  2UUA E;  2F8B A;  4H02 A;  4DV0 E;  3TEG A;  4LFA E;  4DR6 E;  2ARS A;  4P71 C;  4AQY E;  4HWS A;  2K4V A;  5IWA E;  4TVY A;  2RS6 A;  1WQW A;  4P72 A;  4HA8 A;  3KFU A;  3JU0 A;  4M0V A;  4X66 E;  4YRE A;  4R03 A;  2EJF A;  3V7S A;  2ZGW A;  1E22 A;  1YGB A;  2Q7H A;  3REU A;  3F6H A;  1DI2 A;  1X54 A;  1YFR A;  4P72 C;  4TTV A;  2PMF A;  3RL6 A;  2ZT7 A;  3ICA A;  3OD1 A;  2IHR 1;  2DXT A;  3QO7 A;  3VK6 A;  2L2K B;  2ZT5 A;  3ADI A;  3QNE A;  4P75 A;  1IBL E;  5LMN E;  3A7A A;  1FJG E;  2L8T A;  1B7Y B;  3RKW A;  1J5W A;  3QO8 A;  2ZM6 E;  4P74 A;  3RF1 A;  4OP0 A;  4CH5 A;  4YRJ A;  2DTI A;  4P75 C;  4PHC A;  1PYS B;  4B3S E;  4CH3 A;  2DU5 A;  2F4V E;  3IKL A;  1SRY A;  2CIM A;  2QHU A;  2JOB A;  5E3I A;  3P8V A;  2AMC B;  5HGQ A;  3A31 A;  2UU9 E;  4JI2 E;  2V8Q B;  1N36 E;  2I4O A;  2A8E A;  4F9B B;  2E65 A;  2Q7E A;  4YRN A;  2L3C A;  4B3R E;  2L6M A;  4EO4 A;  4RQF A;  3V7C A;  3A32 A;  4LVK A;  4X65 E;  2LUQ A;  3HXX A;  4XEM A;  1J5E E;  4XTZ A;  3E9H A;  2EZ6 A;  4H2X A;  3HY0 A;  4RQE A;  5C51 B;  2NS6 A;  5ELN A;  2PME A;  4YYE A;  1ATI A;  4GKJ E;  4YRS A;  1SR9 A;  4K87 A;  3MF2 A;  2I4L A;  4WI1 A;  4TVA B;  4XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...