2ODRC

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
679
structure length
468
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPSILNEIYVYDGNVIGIPEKIDDIALKQIMSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
total genus 117
structure length 468
sequence length 679
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrC01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrC02
2XTIA 4TQFA 3WQZA 2I4LA 3NETA 1USYC 2DTOA 2Q7EA 3M4PA 4HWRA 1BBWA 3BFMA 2DTHA 1GGMA 4CH5A 4X5OA 1G5HA 4OLFA 3HXWA 2DXTA 1N9WA 3HTZA 3E9HA 4YRQA 1Z7MA 4HWTA 4CH4A 2P5IA 4YRJA 2IY5A 4RQFA 1NJ1A 3TEHA 4YDQA 1YB3A 4P74A 1FYFA 3HXYA 2ZCEA 4H2SA 3TUPA 1QF6A 5E3IA 3ICAA 3L4GA 2FYKA 4HVCA 3REUA 1X2HA 1NJ2A 1PYSB 2QHUA 2ALYA 4YREA 1G51A 4P3OA 3A5ZA 1ATIA 12ASA 1NJ6A 3M4QA 3QO8A 3MF2A 4YRGA 3DSQA 4H2XA 1E1OA 4G84A 4H2UA 2ZT7A 1NNHA 4YRNA 4PHCA 3LC0A 1JJCA 2DXUA 4P73A 4BWAA 2C8MA 2RHSA 3HFZB 4K88A 2QHTA 3PCOB 2E41A 3EFRA 2AKWB 3RKYA 1H4TA 4TVAA 1H4VB 2ZZGA 2EJ9A 2DEQA 3A32A 2EWNA 1H4SA 4XEMA 2ZNIA 3FJPA 4NCXA 1B7YA 11ASA 4O2DA 3IG2A 2P0LA 3W3SA 4P72A 3OD1A 1EVLA 1SETA 2ZINA 1B70B 3HXXA 3MEYA 4YRKA 4XTVA 4H2WA 3LSSA 4H2VA 2CGHA 4TTVA 4TVWA 2PMEA 1Z7NA 2ZR3A 4UP7A 1J5WA 2PMFA 2ZGWA 1KOGA 2I4OA 3A74A 2Q5IA 2QHVA 1B7YB 4UP8A 2ZZFA 1HC7A 3P8VA 3QNEA 4P74C 4P71C 2Q5HA 1VQZA 2DZ9A 4WJ4A 4CS4A 2ARSA 3HXZA 4P75A 2ZR2A 3IALA 2DQ3A 4ZTUB 2ZXFA 2ZNJA 4TQDA 3RGLA 2HNIA 1WYDA 1PYSA 4YRIA 1WNLA 2DZCA 3P8TA 2C7IA 3VBBA 2E64A 3V7SA 1E1TA 4EO4A 2E3CA 4HWPA 3UGQA 3VQVA 3V8KA 4P73C 1ASYA 1WQ7A 4L87A 4E51A 2DJZA 2E65A 4UPAA 3RKWA 3HFZA 5ELNA 3UGTA 2DU5A 1SERA 3PCOA 2CJBA 3UH0A 2AKWA 4YYEA 1H4QA 2AMCB 5C51B 1QE0A 3V8JA 2ARTA 4K87A 1B70A 4LNSA 3MF1A 4XTZA 2Q7GA 3HY0A 1ADJA 1NYQA 1ASZA 3A7AA 4HWOA 3A5YA 4TVYA 4HA8A 2QHSA 2EJFA 2ODRC 2DQ0A 2G4CA 3QO5A 4YRFA 1YFTA 1ADYA 2DVEA 2ZTGA 3EFSA 4KR3A 3RF1A 1G5IA 4P3NA 4P75C 2XGTA 4YRRA 1BIAA 1HTTA 1C0AA 1KMMA 1EIYB 4EX5A 4K86A 4OP0A 4Q6GA 3L2ZA 1WU7A 3HY1A 2ZIMA 1BBUA 1W66A 4XU2A 3A31A 2CJAA 3HXUA 3A7RA 1X01A 4G85A 1YFSA 4CH6A 3IKLA 4H2YA 4XTUA 2ARUA 3RACA 2Q7HA 2ODRD 4YRCA 1X56A 2E5AA 3RKXA 3A7UA 4DPGA 4XTYA 1HXDA 1WPYA 4Q15A 3PZCA 4CS2A 5F5WA 2ZT5A 1EVKA 3HRKA 2AMCA 4XTXA 5C52B 4YRPA 2DU7A 4YROA 4J15A 2J3LA 3RL6A 3UFGA 1BIBA 2EL9A 4BW9A 4WF2A 3TEGA 2DDZA 2J3MA 2ZIOA 1X55A 2RHQA 4WJ3M 4AH6A 1L0WA 5K1PA 4YPFA 3V7CA 2I4NA 3QO7A 5KNNA 3NELA 4P71A 4H02A 4PG3A 5HGQA 3REXA 4P72C 4RQEA 1USYA 1E22A 4KQEA 2ZT6A 5C53B 4YRTA 4RMFA 2I4MA 1RIQA 1NYRA 3BJUA 1EIYA 2RHQB 4ZIBA 3VQXA 2E10A 4YCUA 1YGBA 2IY5B 4CH3A 3TEHB 4WI1A 2DKGA 4TWAA 3VQYA 3V8LA 4YCWA 4XU3A 3L4GB 2EJGA 3LSQA 3R07A 1E24A 4RDXA 4P3PA 2ZZEA 4HWSA 2CJ9A 3E9IA 1SRYA 1IL2A 3NEMA 4XU1A 4UP9A 4YCVA 3RUXA 4H2TA 2ALYB 1EQRA 1B8AA 1KMNA 3QTCA 1WQWA 1EFWA 3HFVA 3V7RA 3CMQA 4XTWA 4XU0A 4KR2A 1WLEA 4DQ2A 4H2XB 1NJ5A 1SESA 2EAYA 3RIRA 3HRIA 4CS3A 3ERRA 3P8YA 5ELOA 3L1AA 3KFUA 1JJCB 5K1XA 4XEOA 3I7FA 2ZT8A 2RHSB 1B76A 4ZTZB 1LYLA 3G1ZA 4YRMA 3IKMB 4YRSA 4TVAB 3VQWA 2E1HA 1NJ8A 4YP0A 4YRLA 1X54A 3NENA 1EOVA 2DTIA 2CIMA 1X2GA 1YFRA 3HXVA
chains in the Genus database with same CATH superfamily
1PJQA 4IS1C 5KL3A 2XTIA 1XMOE 4DV4E 4TQFA 3WQZA 5KL5A 2I4LA 3NETA 1USYC 2LMZA 2DTOA 2Q7EA 3QG5C 1SFEA 1FKAE 3M4PA 4HWRA 1BBWA 4F54A 4DV5E 4P7DA 4WPYA 4G85A 2YRMA 3IWCA 3BFMA 2DTHA 5LMNE 1GGMA 4DR7E 2MKNA 4X5OA 4CH5A 2WBTA 1MEYC 2GHFA 1G5HA 4N4RB 4M9VC 1XNQE 4DR5E 4DR4E 4OLFA 3HXWA 2EJ4A 2DXTA 5IT9C 1X6HA 1IQOA 2ZM6E 2LV2A 1N9WA 3HTZA 4MLQA 1N3GA 4WSPA 1YYOA 1A1IA 3E9HA 1Z7MA 4HWTA 4YRQA 2YU8A 4NXNE 4CH4A 2JR1A 1JK1A 5TSEA 2P5IA 2J7JA 4YRJA 2EPAA 4RQFA 2IY5A 2WBSA 2JPAA 1NJ1A 5KL4A 4KZSA 2MDGA 3TEHA 4YDQA 2EN3A 2NUGA 2ADRA 1YB3A 4P74A 1X48A 2EN2A 2EPNA 1FYFA 3HXYA 2ZCEA 4H2SA 3TUPA 1QF6A 5E3IA 2EL4A 2L2KB 2Q8UA 4F2JC 1G2DC 2DGCA 3ICAA 3MHSC 1TN9A 4ZYEA 1ZAAC 3L4GA 4LVKA 1YZ9A 3MQZA 2FYKA 2EOFA 2EPRA 4HTGA 4HVCA 1GTKA 1IBLE 4DV6E 2DB2A 4DMIA 3TQMA 3REUA 4R2QA 1NEIA 3C4TA 4WYQB 4LTYA 2D9HA 2V87A 3EPJA 1X2HA 3ZOQB 5A6BA 1NJ2A 2EM3A 2M9AA 1PYSB 2EPPA 2QHUA 3M99B 2ALYA 2LRSA 4LF6E 1KJKA 2L33A 3J7AG 1G51A 4YREA 1FJGE 4P3OA 3A5ZA 2EM6A 2JY9A 2YT4A 2B7VA 1ATIA 5KL6A 12ASA 1NJ6A 3M4QA 3RMPA 3QO8A 2YSOA 1PDAA 2MC5A 2LCEA 3MF2A 4YRGA 3DSQA 3F6GA 4H2XA 2EMZA 1E1OA 1GQEA 2EM2A 4G84A 2LO3A 4H2UA 2EOSA 2ZT7A 1NNHA 2YRKA 4R2EA 1YPNA 2V8QB 4ZYHA 4WX9A 2EMWA 4LFAE 4YRNA 4PHCA 3LC0A 1JJCA 5AE3A 2DXUA 2FTXB 4KHPE 4P73A 4BWAA 2YTNA 2C8MA 2RHSA 1WHQA 3HFZB 3HTXA 4K88A 2QHTA 3PCOB 5F3WA 2E41A 1RMDA 2EOXA 2EPMX 2LUPB 2AKWB 3EFRA 3RKYA 1H4TA 2JXPA 4FK5C 4TVAA 1RQ0A 1H4VB 1TF3A 2ZZGA 2EJ9A 2E5LE 4R2DA 2DEQA 2EWNA 3A32A 1H4SA 4XEMA 2ZNIA 3FJPA 4NCXA 1SR9A 2LUQA 1B7YA 4M30A 11ASA 4O2DA 4JI3E 2RSMA 3HPSA 1AAYA 3IG2A 4JV5E 2P0LA 4P72A 3OD1A 3W3SA 4X62E 1EVLA 4R2RA 2YTPA 2L2MA 2UUCE 4X66E 1SETA 1I94E 2ZINA 2EL6A 2EL5A 1B70B 3HXXA 2HC5A 2UUAE 3MEYA 2G7HA 4YRKA 4XTVA 4H2WA 2EOZA 2YTEA 4O43A 3VHTB 4DR3E 1N34E 3LSSA 2CGHA 4H2VA 4TTVA 4TVWA 5AE1A 4NXME 2PMEA 1Z7NA 4LF9E 2LJUA 4O24A 3T1YE 2ZR3A 4ZYDA 2B9DA 2WBUA 4UP7A 4LFCE 1UILA 1XMQE 1J5WA 4LVJA 1EH6A 2PMFA 1BBOA 2ZGWA 1KOGA 2I4OA 4NHRA 3A74A 4TUIA 2EOQA 2Q5IA 2QHVA 4YHHE 1B7YB 5IXMB 3DF6A 4UP8A 4LF7E 1HC7A 2ZZFA 3KWRA 3P8VA 3QNEA 4P74C 4JI0E 2MKDA 4P71C 2Q5HA 2EM4A 2EPKX 2K7IA 2L8TA 1YSAC 1VQZA 2DZ9A 2EOMA 2B7TA 3J80C 2K4VA 4CS4A 2RS6A 4WJ4A 2UUBE 2ARSA 3HXZA 2V86A 5BR8E 2R1FA 4P75A 4JI2E 1P47A 2ZR2A 3IALA 2CPNA 2FV4B 2DQ3A 4RH8A 2EM7A 4ZTUB 2ZXFA 2ZNJA 1RC7A 4TQDA 3F6HA 3RGLA 1N32E 3THNA 2CTDA 1HR0E 4GKJE 2HNIA 1WYDA 1BB8A 2YTIA 1PYSA 4YRIA 2EM9A 4LVIA 3OMLA 1WNLA 2MDRA 2DZCA 2EOIA 3P8TA 2C7IA 2EQ1A 3VBBA 1PJTA 4KWYA 5A2QC 2HGHA 2E64A 2DIXA 1XNRE 3V7SA 1E1TA 1IQSA 2M4IA 4EO4A 2E3CA 2EMHA 4HWPA 3UGQA 3H09A 3VQVA 2EMAA 2ENCA 4LFBE 4MLVA 4F6NA 3V8KA 2LJHA 2JOXA 1YUJA 4P73C 1O0WA 2JYAA 2RS7A 1WQ7A 2EN1A 2FGGA 2I9IA 1ASYA 4L87A 4BS9A 4JI4E 4E51A 2DJZA 2E65A 2V89A 2VE7C 1A1LA 2M7QA 3HFZA 4UPAA 5ELNA 3RKWA 5A69A 4M0VA 3PCOA 3UGTA 4R2SA 2CJBA 2DU5A 2EQ3A 1SERA 3UH0A 2AKWA 4YYEA 2EPCA 3JAMC 2EE8A 1A1FA 3UK3C 1H4QA 4JI6E 2AMCB 2VRDA 5C51B 4DUZE 2EPOA 1QE0A 5DNYA 5A6BD 3J7Yp 5LLQA 1DI2A 4Q35B 3KZZA 3ADIA 2EN6A 3VK6A 1A1HA 3V8JA 3JTZA 5KL7A 3ECRA 1T39A 2ARTA 4K87A 2N8XA 4WSGA 2R76A 1X5WA 1B70A 1T38A 4LNSA 4F9BB 3MF1A 4XTZA 4BHBA 2EMLA 2Q7GA 2YZTA 4BHCA 3HY0A 2H36X 2CT1A 4LF4E 1ADJA 1WHNA 1NYQA 1ASZA 3C4BA 1DGCA 2HHHE 5IWAE 1YYWA 2DRPA 1A1GA 2YTJA 3A7AA 4JI5E 1IMUA 2DSYA 4F9CB 3HQ1A 4HWOA 5A6AA 5CFFE 3A5YA 4TVYA 4HA8A 2QHSA 2EJFA 2ODRC 4HEIA 2DQ0A 2G4CA 2LTRA 3QO5A 4YRFA 2IHR1 2GPIA 1YFTA 1STUA 2EMYA 1BBGA 1ADYA 3T1HE 2LTSA 2N3GA 2V85A 4DV1E 2DVEA 2ZTGA 3EFSA 4KR3A 2VQFE 3EPHA 5KL2A 3RF1A 3VYXA 1HNZE 4R8OA 2KHXA 3IWDA 1G5IA 3IWBA 4P3NA 4P75C 2L3CA 4IJDA 2XGTA 1WXRA 4AQYE 4HT4A 2UXCE 4YRRA 3ADJA 3ADLA 1BIAA 1HTTA 1KMMA 1C0AA 1EIYB 2ELZA 4ZYGA 2PRTA 4EX5A 2EN4A 4K86A 1F2IG 4DR1E 4X8WA 4OP0A 2UXDE 4Q6GA 3L2ZA 2DMIA 1WU7A 2F8BA 3HY1A 5ADZA 2ZIMA 2LBSB 3LLHA 4DV0E 2EOEA 4M2ZA 1PKPA 1J5EE 1BBUA 4TUGA 1W66A 2YPNA 4XU2A 3A31A 4JYAE 2CJAA 4LU9A 3HXUA 3THOB 2YTQA 3A7RA 2L6MA 4O5GA 1X01A 3BIDA 2EMFA 1X49A 2EN8A 1QNTA 2YWQA 3J81C 1YFSA 3IKLA 4OOGC 1UN6B 4CH6A 2JWOA 2EWLA 3AV0A 4H2YA 1DQ3A 4XTUA 2V83A 2ARUA 4OX9E 4GKKE 3RACA 1PJSA 2Q7HA 2ODRD 5A6JA 2V88A 4YRCA 3VYYA 1B69A 2RTXA 1ZR9A 1X56A 2E5AA 3RKXA 3A7UA 5T6JA 4B3SE 4XTYA 1X47A 1HXDA 1WPYA 4Q15A 1HNWE 4WXDA 4DPGA 1EKZA 4RHBB 1MGTA 2EPUA 4LVMA 4Q28A 3C6KA 4K0KE 5IV8B 4B3RE 4YY3E 1X6EA 3PZCA 4CS2A 5F5WA 2E72A 4WFTA 1EVKA 2ZT5A 2B3TB 1J26A 3HRKA 3P1XA 2AMCA 4XTXA 1UBDC 5C52B 4YRPA 4R2AA 2DU7A 4YROA 2EMXA 2MC6A 2NS6A 2EM8A 4J15A 2EZ6A 2J3LA 1TF6A 3RL6A 3UFGA 1HNXE 1A1JA 2RPCA 1BIBA 2EL9A 2NABA 4WF2A 4BW9A 4X9JA 2LE2A 2VQEE 3TEGA 2DDZA 1EH8A 2J3MA 2ZIOA 3ADGA 2EQ0A 2JOBA 4BMJA 1X55A 3MHHC 2UU9E 4GZNC 2F4VE 2RHQA 4X64E 4WJ3M 4AH6A 2ELYA 1L0WA 2EM0A 5K1PA 4BC9A 2LVHA 3MSWA 2EMIA 4YPFA 3FIGA 1YFHA 2JP9A 1JK2A 4NZVA 4JI8E 2A25A 2I4NA 2E1MA 3QO7A 3V7CA 5KNNA 3NELA 2GLIA 5LMUE 4P71A 3KZYA 1IBME 4H02A 4PG3A 5HGQA 3REXA 5AASA 4P72C 2EM5A 1UHZA 2EMKA 4RQEA 4L5NC 1USYA 3AUZA 1YUIA 4LVLA 3K6QA 2N3HA 1E22A 2ENHA 4JI1E 2KONA 4DUYE 2WCC3 4B3ME 3C6MA 1KYQA 4KQEA 2EP3A 4R2PA 4X65E 2ZT6A 5C53B 4YRTA 4RMFA 2EMGA 2VF1A 2I4MA 1RIQA 1NYRA 2CSHA 3BJUA 1EIYA 2RHQB 4ZIBA 3VQXA 2EOJA 3JU0A 2YTFA 1N36E 5A6KA 4R2CA 2E10A 1AH5A 2L3JA 4YCUA 4P78A 1YGBA 2IY5B 2EPXA 1A1KA 3LMLA 4LF5E 2RQLA 5AC4A 4L8NA 4CH3A 2EPZA 2L2NA 3TEHB 3EPLA 4WI1A 1T4LB 2HJJA 2DKGA 1IBKE 2YSPA 4TWAA 3VQYA 2YU5A 1LLMC 4YCWA 2YTDA 4XU3A 3V8LA 2EMBA 3L4GB 2NA2A 2EJGA 3LSQA 2EMCA 3EQ1A 1T4NA 2EOYA 5AE2A 1G2FC 1E24A 3R07A 4RDXA 1WJPA 2RSIA 2EOOA 5AC5A 4P3PA 2ZZEA 2DLKA 4HWSA 4BBYA 2CJ9A 3E9IA 2WZOA 4F6MA 1SRYA 1IL2A 4DV2E 3NEMA 4XU1A 4UP9A 2UXBE 4YCVA 2I13A 3RUXA 2ENAA 4H2TA 4F9AB 4R03A 1N33E 1NCSA 2ALYB 4LF8E 1ZU1A 2L92A 1ZBQA 1EQRA 4DKKA 2LT7A 1B8AA 4O4KA 1KMNA 3L00A 1WQWA 3QTCA 1EFWA 2YTGA 3HFVA 3V7RA 3DJWA 3CMQA 4XTWA 4XU0A 1QU6A 4KR2A 1WLEA 4DQ2A 1X3CA 5LL6R 4H2XB 1EH7A 1NJ5A 1SESA 4DV3E 2EAYA 3RIRA 1GZ6A 3BF2A 3EPKA 1L4SA 2YRHA 3HRIA 4CS3A 3ERRA 3P8YA 5ELOA 3L1AA 2EN7A 3KFUA 1JJCB 2M1SA 3BGHA 4BC7A 5K1XA 4XEOA 5FLXC 2ZT8A 3I7FA 2RHSB 1X6FA 2EORA 4JI7E 1B76A 4I8OA 1T4OA 4ZTZB 2DMYA 1LYLA 2DLQA 4DR6E 2A8EA 3G1ZA 4YRMA 1YYKA 2NUEA 3HXLA 2BB8A 3BBGA 3IKMB 4YRSA 2NUFA 4TVAB 3VQWA 1Z1BA 1ZBTA 2E1HA 2YTOA 4J8ZA 1NJ8A 1WRJA 4YP0A 4YRLA 3OTOE 2JVAA 4DR2E 1X54A 2KOUA 3NENA 2BBGA 4DV7E 4B3TE 4BCAA 1EOVA 2EOHA 2EPLX 2DTIA 3HPZA 2CIMA 4WXCA 1X2GA 1YFRA 4GEQB 3HXVA
chains in the Genus database with same CATH topology
2XTIA 1XMOE 4DV4E 4TQFA 3WQZA 2I4LA 3NETA 1USYC 2LMZA 2DTOA 2Q7EA 1FKAE 3M4PA 4HWRA 1BBWA 4F54A 4DV5E 4P7DA 4WPYA 3IWCA 3BFMA 2DTHA 5LMNE 1GGMA 4DR7E 4CH5A 4X5OA 1G5HA 1XNQE 4DR5E 4DR4E 4OLFA 3HXWA 2DXTA 5IT9C 2ZM6E 1N9WA 3HTZA 4WSPA 3E9HA 1YYOA 4YRQA 1Z7MA 4HWTA 4NXNE 4CH4A 2JR1A 2P5IA 4YRJA 2IY5A 4RQFA 1NJ1A 4KZSA 3TEHA 4YDQA 2NUGA 1YB3A 4P74A 1X48A 1FYFA 3HXYA 2ZCEA 4H2SA 3TUPA 1QF6A 5E3IA 2L2KB 3ICAA 3L4GA 4LVKA 1YZ9A 3MQZA 2FYKA 4HVCA 1IBLE 4DV6E 2DB2A 4DMIA 3REUA 3C4TA 4WYQB 4LTYA 2V87A 1X2HA 3ZOQB 1NJ2A 1PYSB 2QHUA 2ALYA 2LRSA 4LF6E 2L33A 3J7AG 1G51A 4YREA 1FJGE 4P3OA 3A5ZA 2YT4A 2JY9A 1ATIA 2B7VA 12ASA 1NJ6A 3M4QA 3RMPA 3QO8A 3MF2A 2MC5A 4YRGA 3DSQA 3F6GA 4H2XA 1E1OA 1GQEA 4G84A 4H2UA 2ZT7A 1NNHA 2V8QB 4LFAE 4YRNA 4PHCA 3LC0A 1JJCA 5AE3A 2DXUA 2FTXB 4KHPE 4P73A 4BWAA 2C8MA 2RHSA 1WHQA 3HFZB 3HTXA 4K88A 2QHTA 3PCOB 5F3WA 2E41A 2LUPB 2AKWB 3EFRA 3RKYA 1H4TA 4TVAA 1RQ0A 1H4VB 2ZZGA 2EJ9A 2E5LE 2DEQA 3A32A 2EWNA 1H4SA 4XEMA 2ZNIA 3FJPA 4NCXA 1SR9A 2LUQA 1B7YA 4M30A 11ASA 4O2DA 4JI3E 2RSMA 3HPSA 3IG2A 4JV5E 2P0LA 4P72A 3OD1A 3W3SA 4X62E 1EVLA 2UUCE 2L2MA 4X66E 1SETA 1I94E 2ZINA 1B70B 3HXXA 2UUAE 3MEYA 2G7HA 4YRKA 4XTVA 4H2WA 3LSSA 4DR3E 1N34E 4H2VA 2CGHA 4TTVA 4TVWA 5AE1A 4NXME 2PMEA 1Z7NA 4LF9E 3T1YE 2ZR3A 2B9DA 4UP7A 4LFCE 1UILA 1XMQE 1J5WA 4LVJA 2PMFA 2ZGWA 1KOGA 2I4OA 3A74A 4TUIA 2Q5IA 2QHVA 4YHHE 1B7YB 3DF6A 4UP8A 4LF7E 1HC7A 2ZZFA 3KWRA 3P8VA 3QNEA 4P74C 4JI0E 4P71C 2Q5HA 2L8TA 1VQZA 2DZ9A 2B7TA 3J80C 2K4VA 4CS4A 2RS6A 4WJ4A 2UUBE 2ARSA 3HXZA 2V86A 5BR8E 4P75A 4JI2E 2ZR2A 3IALA 2CPNA 2FV4B 2DQ3A 4ZTUB 2ZXFA 2ZNJA 1RC7A 4TQDA 3F6HA 3RGLA 1N32E 1HR0E 4GKJE 2HNIA 1WYDA 1PYSA 4YRIA 4LVIA 3OMLA 1WNLA 2MDRA 2DZCA 3P8TA 2C7IA 3VBBA 5A2QC 2E64A 2DIXA 1XNRE 3V7SA 1E1TA 4EO4A 2M4IA 2E3CA 4HWPA 3UGQA 3H09A 3VQVA 4LFBE 3V8KA 2LJHA 2JOXA 4P73C 1O0WA 2RS7A 1ASYA 1WQ7A 2FGGA 4L87A 4BS9A 4JI4E 4E51A 2DJZA 2E65A 2V89A 2VE7C 4UPAA 2M7QA 3HFZA 5ELNA 3RKWA 3UGTA 2DU5A 4M0VA 3PCOA 1SERA 2CJBA 3UH0A 2AKWA 4YYEA 3JAMC 1H4QA 4JI6E 2AMCB 5C51B 4DUZE 1QE0A 5DNYA 3J7Yp 1DI2A 3ADIA 3VK6A 3V8JA 3JTZA 2ARTA 4K87A 1B70A 4LNSA 4F9BB 3MF1A 4XTZA 2Q7GA 2YZTA 3HY0A 1ADJA 4LF4E 2H36X 1WHNA 1NYQA 1ASZA 3C4BA 2HHHE 5IWAE 1YYWA 3A7AA 4JI5E 2DSYA 4F9CB 3HQ1A 4HWOA 5CFFE 3A5YA 4TVYA 4HA8A 2QHSA 2EJFA 2ODRC 2DQ0A 2G4CA 2LTRA 3QO5A 4YRFA 2IHR1 1YFTA 1STUA 1ADYA 3T1HE 2LTSA 2N3GA 2V85A 4DV1E 2DVEA 2ZTGA 3EFSA 4KR3A 2VQFE 3RF1A 3VYXA 1HNZE 4R8OA 2KHXA 3IWDA 1G5IA 3IWBA 4P3NA 4P75C 2L3CA 2XGTA 4HT4A 1WXRA 4AQYE 2UXCE 4YRRA 3ADJA 3ADLA 1BIAA 1HTTA 1KMMA 1C0AA 1EIYB 4EX5A 4K86A 4DR1E 4X8WA 4OP0A 2UXDE 4Q6GA 3L2ZA 1WU7A 2F8BA 3HY1A 5ADZA 2ZIMA 2LBSB 3LLHA 4DV0E 4M2ZA 1PKPA 1J5EE 1BBUA 4TUGA 1W66A 4XU2A 3A31A 4JYAE 2CJAA 4LU9A 3HXUA 3A7RA 2L6MA 1X01A 4G85A 1X49A 3J81C 1YFSA 4CH6A 3IKLA 4OOGC 2JWOA 2EWLA 3AV0A 4H2YA 1DQ3A 4XTUA 2V83A 2ARUA 4OX9E 4GKKE 3RACA 2Q7HA 2ODRD 4YRCA 2V88A 3VYYA 2RTXA 1X56A 2E5AA 3RKXA 3A7UA 5T6JA 4B3SE 4XTYA 1X47A 1HXDA 1WPYA 4Q15A 1HNWE 4DPGA 1EKZA 4LVMA 4Q28A 4K0KE 4B3RE 4YY3E 3PZCA 4CS2A 5F5WA 4WFTA 2ZT5A 1EVKA 2B3TB 1J26A 3HRKA 3P1XA 2AMCA 4XTXA 5C52B 4YRPA 2DU7A 4YROA 2MC6A 2NS6A 4J15A 2EZ6A 2J3LA 3RL6A 3UFGA 1HNXE 1BIBA 2EL9A 4BW9A 4WF2A 2LE2A 2VQEE 3TEGA 2DDZA 2J3MA 2ZIOA 3ADGA 2JOBA 4BMJA 1X55A 2UU9E 2F4VE 2RHQA 4X64E 4WJ3M 4AH6A 1L0WA 5K1PA 4BC9A 3MSWA 4YPFA 3FIGA 4JI8E 3V7CA 2I4NA 2E1MA 3QO7A 5KNNA 3NELA 5LMUE 4P71A 1IBME 4H02A 4PG3A 5HGQA 3REXA 5AASA 4P72C 1UHZA 4RQEA 4L5NC 1USYA 3AUZA 4LVLA 3K6QA 2N3HA 1E22A 4JI1E 2KONA 4DUYE 4KQEA 4B3ME 4X65E 2ZT6A 5C53B 4YRTA 4RMFA 2VF1A 2I4MA 1RIQA 1NYRA 3BJUA 1EIYA 2RHQB 4ZIBA 3VQXA 3JU0A 1N36E 2E10A 2L3JA 4YCUA 4P78A 1YGBA 2IY5B 3LMLA 4LF5E 4CH3A 4L8NA 2L2NA 3TEHB 4WI1A 1T4LB 2DKGA 1IBKE 4TWAA 3VQYA 3V8LA 4YCWA 4XU3A 3L4GB 2NA2A 2EJGA 3LSQA 1T4NA 5AE2A 1E24A 3R07A 4RDXA 4P3PA 2ZZEA 4HWSA 4BBYA 2CJ9A 3E9IA 2WZOA 1SRYA 1IL2A 4DV2E 3NEMA 4XU1A 4UP9A 2UXBE 4YCVA 3RUXA 4H2TA 4F9AB 4R03A 1N33E 2ALYB 4LF8E 2L92A 1ZBQA 1EQRA 4DKKA 1B8AA 1KMNA 3QTCA 1WQWA 1EFWA 3HFVA 3V7RA 3DJWA 3CMQA 4XTWA 4XU0A 1QU6A 4KR2A 1WLEA 4DQ2A 5LL6R 4H2XB 1NJ5A 1SESA 4DV3E 2EAYA 3RIRA 1GZ6A 3HRIA 4CS3A 3ERRA 3P8YA 5ELOA 3L1AA 3KFUA 1JJCB 2M1SA 5K1XA 4BC7A 4XEOA 5FLXC 2ZT8A 3I7FA 2RHSB 4JI7E 1B76A 4ZTZB 4I8OA 1T4OA 2DMYA 1LYLA 4DR6E 2A8EA 3G1ZA 4YRMA 1YYKA 2NUEA 3HXLA 3IKMB 4YRSA 2NUFA 4TVAB 3VQWA 1ZBTA 2E1HA 4J8ZA 1NJ8A 4YP0A 4YRLA 3OTOE 2JVAA 4DR2E 1X54A 2KOUA 3NENA 4DV7E 4B3TE 4BCAA 1EOVA 2DTIA 3HPZA 2CIMA 1X2GA 1YFRA 4GEQB 3HXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTI A;  4TQF A;  3WQZ A;  2I4L A;  3NET A;  1USY C;  2DTO A;  2Q7E A;  3M4P A;  4HWR A;  1BBW A;  3BFM A;  2DTH A;  1GGM A;  4CH5 A;  4X5O A;  1G5H A;  4OLF A;  3HXW A;  2DXT A;  1N9W A;  3HTZ A;  3E9H A;  4YRQ A;  1Z7M A;  4HWT A;  4CH4 A;  2P5I A;  4YRJ A;  2IY5 A;  4RQF A;  1NJ1 A;  3TEH A;  4YDQ A;  1YB3 A;  4P74 A;  1FYF A;  3HXY A;  2ZCE A;  4H2S A;  3TUP A;  1QF6 A;  5E3I A;  3ICA A;  3L4G A;  2FYK A;  4HVC A;  3REU A;  1X2H A;  1NJ2 A;  1PYS B;  2QHU A;  2ALY A;  4YRE A;  1G51 A;  4P3O A;  3A5Z A;  1ATI A;  12AS A;  1NJ6 A;  3M4Q A;  3QO8 A;  3MF2 A;  4YRG A;  3DSQ A;  4H2X A;  1E1O A;  4G84 A;  4H2U A;  2ZT7 A;  1NNH A;  4YRN A;  4PHC A;  3LC0 A;  1JJC A;  2DXU A;  4P73 A;  4BWA A;  2C8M A;  2RHS A;  3HFZ B;  4K88 A;  2QHT A;  3PCO B;  2E41 A;  3EFR A;  2AKW B;  3RKY A;  1H4T A;  4TVA A;  1H4V B;  2ZZG A;  2EJ9 A;  2DEQ A;  3A32 A;  2EWN A;  1H4S A;  4XEM A;  2ZNI A;  3FJP A;  4NCX A;  1B7Y A;  11AS A;  4O2D A;  3IG2 A;  2P0L A;  3W3S A;  4P72 A;  3OD1 A;  1EVL A;  1SET A;  2ZIN A;  1B70 B;  3HXX A;  3MEY A;  4YRK A;  4XTV A;  4H2W A;  3LSS A;  4H2V A;  2CGH A;  4TTV A;  4TVW A;  2PME A;  1Z7N A;  2ZR3 A;  4UP7 A;  1J5W A;  2PMF A;  2ZGW A;  1KOG A;  2I4O A;  3A74 A;  2Q5I A;  2QHV A;  1B7Y B;  4UP8 A;  2ZZF A;  1HC7 A;  3P8V A;  3QNE A;  4P74 C;  4P71 C;  2Q5H A;  1VQZ A;  2DZ9 A;  4WJ4 A;  4CS4 A;  2ARS A;  3HXZ A;  4P75 A;  2ZR2 A;  3IAL A;  2DQ3 A;  4ZTU B;  2ZXF A;  2ZNJ A;  4TQD A;  3RGL A;  2HNI A;  1WYD A;  1PYS A;  4YRI A;  1WNL A;  2DZC A;  3P8T A;  2C7I A;  3VBB A;  2E64 A;  3V7S A;  1E1T A;  4EO4 A;  2E3C A;  4HWP A;  3UGQ A;  3VQV A;  3V8K A;  4P73 C;  1ASY A;  1WQ7 A;  4L87 A;  4E51 A;  2DJZ A;  2E65 A;  4UPA A;  3RKW A;  3HFZ A;  5ELN A;  3UGT A;  2DU5 A;  1SER A;  3PCO A;  2CJB A;  3UH0 A;  2AKW A;  4YYE A;  1H4Q A;  2AMC B;  5C51 B;  1QE0 A;  3V8J A;  2ART A;  4K87 A;  1B70 A;  4LNS A;  3MF1 A;  4XTZ A;  2Q7G A;  3HY0 A;  1ADJ A;  1NYQ A;  1ASZ A;  3A7A A;  4HWO A;  3A5Y A;  4TVY A;  4HA8 A;  2QHS A;  2EJF A;  2ODR C;  2DQ0 A;  2G4C A;  3QO5 A;  4YRF A;  1YFT A;  1ADY A;  2DVE A;  2ZTG A;  3EFS A;  4KR3 A;  3RF1 A;  1G5I A;  4P3N A;  4P75 C;  2XGT A;  4YRR A;  1BIA A;  1HTT A;  1C0A A;  1KMM A;  1EIY B;  4EX5 A;  4K86 A;  4OP0 A;  4Q6G A;  3L2Z A;  1WU7 A;  3HY1 A;  2ZIM A;  1BBU A;  1W66 A;  4XU2 A;  3A31 A;  2CJA A;  3HXU A;  3A7R A;  1X01 A;  4G85 A;  1YFS A;  4CH6 A;  3IKL A;  4H2Y A;  4XTU A;  2ARU A;  3RAC A;  2Q7H A;  2ODR D;  4YRC A;  1X56 A;  2E5A A;  3RKX A;  3A7U A;  4DPG A;  4XTY A;  1HXD A;  1WPY A;  4Q15 A;  3PZC A;  4CS2 A;  5F5W A;  2ZT5 A;  1EVK A;  3HRK A;  2AMC A;  4XTX A;  5C52 B;  4YRP A;  2DU7 A;  4YRO A;  4J15 A;  2J3L A;  3RL6 A;  3UFG A;  1BIB A;  2EL9 A;  4BW9 A;  4WF2 A;  3TEG A;  2DDZ A;  2J3M A;  2ZIO A;  1X55 A;  2RHQ A;  4WJ3 M;  4AH6 A;  1L0W A;  5K1P A;  4YPF A;  3V7C A;  2I4N A;  3QO7 A;  5KNN A;  3NEL A;  4P71 A;  4H02 A;  4PG3 A;  5HGQ A;  3REX A;  4P72 C;  4RQE A;  1USY A;  1E22 A;  4KQE A;  2ZT6 A;  5C53 B;  4YRT A;  4RMF A;  2I4M A;  1RIQ A;  1NYR A;  3BJU A;  1EIY A;  2RHQ B;  4ZIB A;  3VQX A;  2E10 A;  4YCU A;  1YGB A;  2IY5 B;  4CH3 A;  3TEH B;  4WI1 A;  2DKG A;  4TWA A;  3VQY A;  3V8L A;  4YCW A;  4XU3 A;  3L4G B;  2EJG A;  3LSQ A;  3R07 A;  1E24 A;  4RDX A;  4P3P A;  2ZZE A;  4HWS A;  2CJ9 A;  3E9I A;  1SRY A;  1IL2 A;  3NEM A;  4XU1 A;  4UP9 A;  4YCV A;  3RUX A;  4H2T A;  2ALY B;  1EQR A;  1B8A A;  1KMN A;  3QTC A;  1WQW A;  1EFW A;  3HFV A;  3V7R A;  3CMQ A;  4XTW A;  4XU0 A;  4KR2 A;  1WLE A;  4DQ2 A;  4H2X B;  1NJ5 A;  1SES A;  2EAY A;  3RIR A;  3HRI A;  4CS3 A;  3ERR A;  3P8Y A;  5ELO A;  3L1A A;  3KFU A;  1JJC B;  5K1X A;  4XEO A;  3I7F A;  2ZT8 A;  2RHS B;  1B76 A;  4ZTZ B;  1LYL A;  3G1Z A;  4YRM A;  3IKM B;  4YRS A;  4TVA B;  3VQW A;  2E1H A;  1NJ8 A;  4YP0 A;  4YRL A;  1X54 A;  3NEN A;  1EOV A;  2DTI A;  2CIM A;  1X2G A;  1YFR A;  3HXV A; 
#chains in the Genus database with same CATH topology
 1PJQ A;  4IS1 C;  5KL3 A;  2XTI A;  1XMO E;  4DV4 E;  4TQF A;  3WQZ A;  5KL5 A;  2I4L A;  3NET A;  1USY C;  2LMZ A;  2DTO A;  2Q7E A;  3QG5 C;  1SFE A;  1FKA E;  3M4P A;  4HWR A;  1BBW A;  4F54 A;  4DV5 E;  4P7D A;  4WPY A;  4G85 A;  2YRM A;  3IWC A;  3BFM A;  2DTH A;  5LMN E;  1GGM A;  4DR7 E;  2MKN A;  4X5O A;  4CH5 A;  2WBT A;  1MEY C;  2GHF A;  1G5H A;  4N4R B;  4M9V C;  1XNQ E;  4DR5 E;  4DR4 E;  4OLF A;  3HXW A;  2EJ4 A;  2DXT A;  5IT9 C;  1X6H A;  1IQO A;  2ZM6 E;  2LV2 A;  1N9W A;  3HTZ A;  4MLQ A;  1N3G A;  4WSP A;  1YYO A;  1A1I A;  3E9H A;  1Z7M A;  4HWT A;  4YRQ A;  2YU8 A;  4NXN E;  4CH4 A;  2JR1 A;  1JK1 A;  5TSE A;  2P5I A;  2J7J A;  4YRJ A;  2EPA A;  4RQF A;  2IY5 A;  2WBS A;  2JPA A;  1NJ1 A;  5KL4 A;  4KZS A;  2MDG A;  3TEH A;  4YDQ A;  2EN3 A;  2NUG A;  2ADR A;  1YB3 A;  4P74 A;  1X48 A;  2EN2 A;  2EPN A;  1FYF A;  3HXY A;  2ZCE A;  4H2S A;  3TUP A;  1QF6 A;  5E3I A;  2EL4 A;  2L2K B;  2Q8U A;  4F2J C;  1G2D C;  2DGC A;  3ICA A;  3MHS C;  1TN9 A;  4ZYE A;  1ZAA C;  3L4G A;  4LVK A;  1YZ9 A;  3MQZ A;  2FYK A;  2EOF A;  2EPR A;  4HTG A;  4HVC A;  1GTK A;  1IBL E;  4DV6 E;  2DB2 A;  4DMI A;  3TQM A;  3REU A;  4R2Q A;  1NEI A;  3C4T A;  4WYQ B;  4LTY A;  2D9H A;  2V87 A;  3EPJ A;  1X2H A;  3ZOQ B;  5A6B A;  1NJ2 A;  2EM3 A;  2M9A A;  1PYS B;  2EPP A;  2QHU A;  3M99 B;  2ALY A;  2LRS A;  4LF6 E;  1KJK A;  2L33 A;  3J7A G;  1G51 A;  4YRE A;  1FJG E;  4P3O A;  3A5Z A;  2EM6 A;  2JY9 A;  2YT4 A;  2B7V A;  1ATI A;  5KL6 A;  12AS A;  1NJ6 A;  3M4Q A;  3RMP A;  3QO8 A;  2YSO A;  1PDA A;  2MC5 A;  2LCE A;  3MF2 A;  4YRG A;  3DSQ A;  3F6G A;  4H2X A;  2EMZ A;  1E1O A;  1GQE A;  2EM2 A;  4G84 A;  2LO3 A;  4H2U A;  2EOS A;  2ZT7 A;  1NNH A;  2YRK A;  4R2E A;  1YPN A;  2V8Q B;  4ZYH A;  4WX9 A;  2EMW A;  4LFA E;  4YRN A;  4PHC A;  3LC0 A;  1JJC A;  5AE3 A;  2DXU A;  2FTX B;  4KHP E;  4P73 A;  4BWA A;  2YTN A;  2C8M A;  2RHS A;  1WHQ A;  3HFZ B;  3HTX A;  4K88 A;  2QHT A;  3PCO B;  5F3W A;  2E41 A;  1RMD A;  2EOX A;  2EPM X;  2LUP B;  2AKW B;  3EFR A;  3RKY A;  1H4T A;  2JXP A;  4FK5 C;  4TVA A;  1RQ0 A;  1H4V B;  1TF3 A;  2ZZG A;  2EJ9 A;  2E5L E;  4R2D A;  2DEQ A;  2EWN A;  3A32 A;  1H4S A;  4XEM A;  2ZNI A;  3FJP A;  4NCX A;  1SR9 A;  2LUQ A;  1B7Y A;  4M30 A;  11AS A;  4O2D A;  4JI3 E;  2RSM A;  3HPS A;  1AAY A;  3IG2 A;  4JV5 E;  2P0L A;  4P72 A;  3OD1 A;  3W3S A;  4X62 E;  1EVL A;  4R2R A;  2YTP A;  2L2M A;  2UUC E;  4X66 E;  1SET A;  1I94 E;  2ZIN A;  2EL6 A;  2EL5 A;  1B70 B;  3HXX A;  2HC5 A;  2UUA E;  3MEY A;  2G7H A;  4YRK A;  4XTV A;  4H2W A;  2EOZ A;  2YTE A;  4O43 A;  3VHT B;  4DR3 E;  1N34 E;  3LSS A;  2CGH A;  4H2V A;  4TTV A;  4TVW A;  5AE1 A;  4NXM E;  2PME A;  1Z7N A;  4LF9 E;  2LJU A;  4O24 A;  3T1Y E;  2ZR3 A;  4ZYD A;  2B9D A;  2WBU A;  4UP7 A;  4LFC E;  1UIL A;  1XMQ E;  1J5W A;  4LVJ A;  1EH6 A;  2PMF A;  1BBO A;  2ZGW A;  1KOG A;  2I4O A;  4NHR A;  3A74 A;  4TUI A;  2EOQ A;  2Q5I A;  2QHV A;  4YHH E;  1B7Y B;  5IXM B;  3DF6 A;  4UP8 A;  4LF7 E;  1HC7 A;  2ZZF A;  3KWR A;  3P8V A;  3QNE A;  4P74 C;  4JI0 E;  2MKD A;  4P71 C;  2Q5H A;  2EM4 A;  2EPK X;  2K7I A;  2L8T A;  1YSA C;  1VQZ A;  2DZ9 A;  2EOM A;  2B7T A;  3J80 C;  2K4V A;  4CS4 A;  2RS6 A;  4WJ4 A;  2UUB E;  2ARS A;  3HXZ A;  2V86 A;  5BR8 E;  2R1F A;  4P75 A;  4JI2 E;  1P47 A;  2ZR2 A;  3IAL A;  2CPN A;  2FV4 B;  2DQ3 A;  4RH8 A;  2EM7 A;  4ZTU B;  2ZXF A;  2ZNJ A;  1RC7 A;  4TQD A;  3F6H A;  3RGL A;  1N32 E;  3THN A;  2CTD A;  1HR0 E;  4GKJ E;  2HNI A;  1WYD A;  1BB8 A;  2YTI A;  1PYS A;  4YRI A;  2EM9 A;  4LVI A;  3OML A;  1WNL A;  2MDR A;  2DZC A;  2EOI A;  3P8T A;  2C7I A;  2EQ1 A;  3VBB A;  1PJT A;  4KWY A;  5A2Q C;  2HGH A;  2E64 A;  2DIX A;  1XNR E;  3V7S A;  1E1T A;  1IQS A;  2M4I A;  4EO4 A;  2E3C A;  2EMH A;  4HWP A;  3UGQ A;  3H09 A;  3VQV A;  2EMA A;  2ENC A;  4LFB E;  4MLV A;  4F6N A;  3V8K A;  2LJH A;  2JOX A;  1YUJ A;  4P73 C;  1O0W A;  2JYA A;  2RS7 A;  1WQ7 A;  2EN1 A;  2FGG A;  2I9I A;  1ASY A;  4L87 A;  4BS9 A;  4JI4 E;  4E51 A;  2DJZ A;  2E65 A;  2V89 A;  2VE7 C;  1A1L A;  2M7Q A;  3HFZ A;  4UPA A;  5ELN A;  3RKW A;  5A69 A;  4M0V A;  3PCO A;  3UGT A;  4R2S A;  2CJB A;  2DU5 A;  2EQ3 A;  1SER A;  3UH0 A;  2AKW A;  4YYE A;  2EPC A;  3JAM C;  2EE8 A;  1A1F A;  3UK3 C;  1H4Q A;  4JI6 E;  2AMC B;  2VRD A;  5C51 B;  4DUZ E;  2EPO A;  1QE0 A;  5DNY A;  5A6B D;  3J7Y p;  5LLQ A;  1DI2 A;  4Q35 B;  3KZZ A;  3ADI A;  2EN6 A;  3VK6 A;  1A1H A;  3V8J A;  3JTZ A;  5KL7 A;  3ECR A;  1T39 A;  2ART A;  4K87 A;  2N8X A;  4WSG A;  2R76 A;  1X5W A;  1B70 A;  1T38 A;  4LNS A;  4F9B B;  3MF1 A;  4XTZ A;  4BHB A;  2EML A;  2Q7G A;  2YZT A;  4BHC A;  3HY0 A;  2H36 X;  2CT1 A;  4LF4 E;  1ADJ A;  1WHN A;  1NYQ A;  1ASZ A;  3C4B A;  1DGC A;  2HHH E;  5IWA E;  1YYW A;  2DRP A;  1A1G A;  2YTJ A;  3A7A A;  4JI5 E;  1IMU A;  2DSY A;  4F9C B;  3HQ1 A;  4HWO A;  5A6A A;  5CFF E;  3A5Y A;  4TVY A;  4HA8 A;  2QHS A;  2EJF A;  2ODR C;  4HEI A;  2DQ0 A;  2G4C A;  2LTR A;  3QO5 A;  4YRF A;  2IHR 1;  2GPI A;  1YFT A;  1STU A;  2EMY A;  1BBG A;  1ADY A;  3T1H E;  2LTS A;  2N3G A;  2V85 A;  4DV1 E;  2DVE A;  2ZTG A;  3EFS A;  4KR3 A;  2VQF E;  3EPH A;  5KL2 A;  3RF1 A;  3VYX A;  1HNZ E;  4R8O A;  2KHX A;  3IWD A;  1G5I A;  3IWB A;  4P3N A;  4P75 C;  2L3C A;  4IJD A;  2XGT A;  1WXR A;  4AQY E;  4HT4 A;  2UXC E;  4YRR A;  3ADJ A;  3ADL A;  1BIA A;  1HTT A;  1KMM A;  1C0A A;  1EIY B;  2ELZ A;  4ZYG A;  2PRT A;  4EX5 A;  2EN4 A;  4K86 A;  1F2I G;  4DR1 E;  4X8W A;  4OP0 A;  2UXD E;  4Q6G A;  3L2Z A;  2DMI A;  1WU7 A;  2F8B A;  3HY1 A;  5ADZ A;  2ZIM A;  2LBS B;  3LLH A;  4DV0 E;  2EOE A;  4M2Z A;  1PKP A;  1J5E E;  1BBU A;  4TUG A;  1W66 A;  2YPN A;  4XU2 A;  3A31 A;  4JYA E;  2CJA A;  4LU9 A;  3HXU A;  3THO B;  2YTQ A;  3A7R A;  2L6M A;  4O5G A;  1X01 A;  3BID A;  2EMF A;  1X49 A;  2EN8 A;  1QNT A;  2YWQ A;  3J81 C;  1YFS A;  3IKL A;  4OOG C;  1UN6 B;  4CH6 A;  2JWO A;  2EWL A;  3AV0 A;  4H2Y A;  1DQ3 A;  4XTU A;  2V83 A;  2ARU A;  4OX9 E;  4GKK E;  3RAC A;  1PJS A;  2Q7H A;  2ODR D;  5A6J A;  2V88 A;  4YRC A;  3VYY A;  1B69 A;  2RTX A;  1ZR9 A;  1X56 A;  2E5A A;  3RKX A;  3A7U A;  5T6J A;  4B3S E;  4XTY A;  1X47 A;  1HXD A;  1WPY A;  4Q15 A;  1HNW E;  4WXD A;  4DPG A;  1EKZ A;  4RHB B;  1MGT A;  2EPU A;  4LVM A;  4Q28 A;  3C6K A;  4K0K E;  5IV8 B;  4B3R E;  4YY3 E;  1X6E A;  3PZC A;  4CS2 A;  5F5W A;  2E72 A;  4WFT A;  1EVK A;  2ZT5 A;  2B3T B;  1J26 A;  3HRK A;  3P1X A;  2AMC A;  4XTX A;  1UBD C;  5C52 B;  4YRP A;  4R2A A;  2DU7 A;  4YRO A;  2EMX A;  2MC6 A;  2NS6 A;  2EM8 A;  4J15 A;  2EZ6 A;  2J3L A;  1TF6 A;  3RL6 A;  3UFG A;  1HNX E;  1A1J A;  2RPC A;  1BIB A;  2EL9 A;  2NAB A;  4WF2 A;  4BW9 A;  4X9J A;  2LE2 A;  2VQE E;  3TEG A;  2DDZ A;  1EH8 A;  2J3M A;  2ZIO A;  3ADG A;  2EQ0 A;  2JOB A;  4BMJ A;  1X55 A;  3MHH C;  2UU9 E;  4GZN C;  2F4V E;  2RHQ A;  4X64 E;  4WJ3 M;  4AH6 A;  2ELY A;  1L0W A;  2EM0 A;  5K1P A;  4BC9 A;  2LVH A;  3MSW A;  2EMI A;  4YPF A;  3FIG A;  1YFH A;  2JP9 A;  1JK2 A;  4NZV A;  4JI8 E;  2A25 A;  2I4N A;  2E1M A;  3QO7 A;  3V7C A;  5KNN A;  3NEL A;  2GLI A;  5LMU E;  4P71 A;  3KZY A;  1IBM E;  4H02 A;  4PG3 A;  5HGQ A;  3REX A;  5AAS A;  4P72 C;  2EM5 A;  1UHZ A;  2EMK A;  4RQE A;  4L5N C;  1USY A;  3AUZ A;  1YUI A;  4LVL A;  3K6Q A;  2N3H A;  1E22 A;  2ENH A;  4JI1 E;  2KON A;  4DUY E;  2WCC 3;  4B3M E;  3C6M A;  1KYQ A;  4KQE A;  2EP3 A;  4R2P A;  4X65 E;  2ZT6 A;  5C53 B;  4YRT A;  4RMF A;  2EMG A;  2VF1 A;  2I4M A;  1RIQ A;  1NYR A;  2CSH A;  3BJU A;  1EIY A;  2RHQ B;  4ZIB A;  3VQX A;  2EOJ A;  3JU0 A;  2YTF A;  1N36 E;  5A6K A;  4R2C A;  2E10 A;  1AH5 A;  2L3J A;  4YCU A;  4P78 A;  1YGB A;  2IY5 B;  2EPX A;  1A1K A;  3LML A;  4LF5 E;  2RQL A;  5AC4 A;  4L8N A;  4CH3 A;  2EPZ A;  2L2N A;  3TEH B;  3EPL A;  4WI1 A;  1T4L B;  2HJJ A;  2DKG A;  1IBK E;  2YSP A;  4TWA A;  3VQY A;  2YU5 A;  1LLM C;  4YCW A;  2YTD A;  4XU3 A;  3V8L A;  2EMB A;  3L4G B;  2NA2 A;  2EJG A;  3LSQ A;  2EMC A;  3EQ1 A;  1T4N A;  2EOY A;  5AE2 A;  1G2F C;  1E24 A;  3R07 A;  4RDX A;  1WJP A;  2RSI A;  2EOO A;  5AC5 A;  4P3P A;  2ZZE A;  2DLK A;  4HWS A;  4BBY A;  2CJ9 A;  3E9I A;  2WZO A;  4F6M A;  1SRY A;  1IL2 A;  4DV2 E;  3NEM A;  4XU1 A;  4UP9 A;  2UXB E;  4YCV A;  2I13 A;  3RUX A;  2ENA A;  4H2T A;  4F9A B;  4R03 A;  1N33 E;  1NCS A;  2ALY B;  4LF8 E;  1ZU1 A;  2L92 A;  1ZBQ A;  1EQR A;  4DKK A;  2LT7 A;  1B8A A;  4O4K A;  1KMN A;  3L00 A;  1WQW A;  3QTC A;  1EFW A;  2YTG A;  3HFV A;  3V7R A;  3DJW A;  3CMQ A;  4XTW A;  4XU0 A;  1QU6 A;  4KR2 A;  1WLE A;  4DQ2 A;  1X3C A;  5LL6 R;  4H2X B;  1EH7 A;  1NJ5 A;  1SES A;  4DV3 E;  2EAY A;  3RIR A;  1GZ6 A;  3BF2 A;  3EPK A;  1L4S A;  2YRH A;  3HRI A;  4CS3 A;  3ERR A;  3P8Y A;  5ELO A;  3L1A A;  2EN7 A;  3KFU A;  1JJC B;  2M1S A;  3BGH A;  4BC7 A;  5K1X A;  4XEO A;  5FLX C;  2ZT8 A;  3I7F A;  2RHS B;  1X6F A;  2EOR A;  4JI7 E;  1B76 A;  4I8O A;  1T4O A;  4ZTZ B;  2DMY A;  1LYL A;  2DLQ A;  4DR6 E;  2A8E A;  3G1Z A;  4YRM A;  1YYK A;  2NUE A;  3HXL A;  2BB8 A;  3BBG A;  3IKM B;  4YRS A;  2NUF A;  4TVA B;  3VQW A;  1Z1B A;  1ZBT A;  2E1H A;  2YTO A;  4J8Z A;  1NJ8 A;  1WRJ A;  4YP0 A;  4YRL A;  3OTO E;  2JVA A;  4DR2 E;  1X54 A;  2KOU A;  3NEN A;  2BBG A;  4DV7 E;  4B3T E;  4BCA A;  1EOV A;  2EOH A;  2EPL X;  2DTI A;  3HPZ A;  2CIM A;  4WXC A;  1X2G A;  1YFR A;  4GEQ B;  3HXV A; 
#chains in the Genus database with same CATH homology
 2XTI A;  1XMO E;  4DV4 E;  4TQF A;  3WQZ A;  2I4L A;  3NET A;  1USY C;  2LMZ A;  2DTO A;  2Q7E A;  1FKA E;  3M4P A;  4HWR A;  1BBW A;  4F54 A;  4DV5 E;  4P7D A;  4WPY A;  3IWC A;  3BFM A;  2DTH A;  5LMN E;  1GGM A;  4DR7 E;  4CH5 A;  4X5O A;  1G5H A;  1XNQ E;  4DR5 E;  4DR4 E;  4OLF A;  3HXW A;  2DXT A;  5IT9 C;  2ZM6 E;  1N9W A;  3HTZ A;  4WSP A;  3E9H A;  1YYO A;  4YRQ A;  1Z7M A;  4HWT A;  4NXN E;  4CH4 A;  2JR1 A;  2P5I A;  4YRJ A;  2IY5 A;  4RQF A;  1NJ1 A;  4KZS A;  3TEH A;  4YDQ A;  2NUG A;  1YB3 A;  4P74 A;  1X48 A;  1FYF A;  3HXY A;  2ZCE A;  4H2S A;  3TUP A;  1QF6 A;  5E3I A;  2L2K B;  3ICA A;  3L4G A;  4LVK A;  1YZ9 A;  3MQZ A;  2FYK A;  4HVC A;  1IBL E;  4DV6 E;  2DB2 A;  4DMI A;  3REU A;  3C4T A;  4WYQ B;  4LTY A;  2V87 A;  1X2H A;  3ZOQ B;  1NJ2 A;  1PYS B;  2QHU A;  2ALY A;  2LRS A;  4LF6 E;  2L33 A;  3J7A G;  1G51 A;  4YRE A;  1FJG E;  4P3O A;  3A5Z A;  2YT4 A;  2JY9 A;  1ATI A;  2B7V A;  12AS A;  1NJ6 A;  3M4Q A;  3RMP A;  3QO8 A;  3MF2 A;  2MC5 A;  4YRG A;  3DSQ A;  3F6G A;  4H2X A;  1E1O A;  1GQE A;  4G84 A;  4H2U A;  2ZT7 A;  1NNH A;  2V8Q B;  4LFA E;  4YRN A;  4PHC A;  3LC0 A;  1JJC A;  5AE3 A;  2DXU A;  2FTX B;  4KHP E;  4P73 A;  4BWA A;  2C8M A;  2RHS A;  1WHQ A;  3HFZ B;  3HTX A;  4K88 A;  2QHT A;  3PCO B;  5F3W A;  2E41 A;  2LUP B;  2AKW B;  3EFR A;  3RKY A;  1H4T A;  4TVA A;  1RQ0 A;  1H4V B;  2ZZG A;  2EJ9 A;  2E5L E;  2DEQ A;  3A32 A;  2EWN A;  1H4S A;  4XEM A;  2ZNI A;  3FJP A;  4NCX A;  1SR9 A;  2LUQ A;  1B7Y A;  4M30 A;  11AS A;  4O2D A;  4JI3 E;  2RSM A;  3HPS A;  3IG2 A;  4JV5 E;  2P0L A;  4P72 A;  3OD1 A;  3W3S A;  4X62 E;  1EVL A;  2UUC E;  2L2M A;  4X66 E;  1SET A;  1I94 E;  2ZIN A;  1B70 B;  3HXX A;  2UUA E;  3MEY A;  2G7H A;  4YRK A;  4XTV A;  4H2W A;  3LSS A;  4DR3 E;  1N34 E;  4H2V A;  2CGH A;  4TTV A;  4TVW A;  5AE1 A;  4NXM E;  2PME A;  1Z7N A;  4LF9 E;  3T1Y E;  2ZR3 A;  2B9D A;  4UP7 A;  4LFC E;  1UIL A;  1XMQ E;  1J5W A;  4LVJ A;  2PMF A;  2ZGW A;  1KOG A;  2I4O A;  3A74 A;  4TUI A;  2Q5I A;  2QHV A;  4YHH E;  1B7Y B;  3DF6 A;  4UP8 A;  4LF7 E;  1HC7 A;  2ZZF A;  3KWR A;  3P8V A;  3QNE A;  4P74 C;  4JI0 E;  4P71 C;  2Q5H A;  2L8T A;  1VQZ A;  2DZ9 A;  2B7T A;  3J80 C;  2K4V A;  4CS4 A;  2RS6 A;  4WJ4 A;  2UUB E;  2ARS A;  3HXZ A;  2V86 A;  5BR8 E;  4P75 A;  4JI2 E;  2ZR2 A;  3IAL A;  2CPN A;  2FV4 B;  2DQ3 A;  4ZTU B;  2ZXF A;  2ZNJ A;  1RC7 A;  4TQD A;  3F6H A;  3RGL A;  1N32 E;  1HR0 E;  4GKJ E;  2HNI A;  1WYD A;  1PYS A;  4YRI A;  4LVI A;  3OML A;  1WNL A;  2MDR A;  2DZC A;  3P8T A;  2C7I A;  3VBB A;  5A2Q C;  2E64 A;  2DIX A;  1XNR E;  3V7S A;  1E1T A;  4EO4 A;  2M4I A;  2E3C A;  4HWP A;  3UGQ A;  3H09 A;  3VQV A;  4LFB E;  3V8K A;  2LJH A;  2JOX A;  4P73 C;  1O0W A;  2RS7 A;  1ASY A;  1WQ7 A;  2FGG A;  4L87 A;  4BS9 A;  4JI4 E;  4E51 A;  2DJZ A;  2E65 A;  2V89 A;  2VE7 C;  4UPA A;  2M7Q A;  3HFZ A;  5ELN A;  3RKW A;  3UGT A;  2DU5 A;  4M0V A;  3PCO A;  1SER A;  2CJB A;  3UH0 A;  2AKW A;  4YYE A;  3JAM C;  1H4Q A;  4JI6 E;  2AMC B;  5C51 B;  4DUZ E;  1QE0 A;  5DNY A;  3J7Y p;  1DI2 A;  3ADI A;  3VK6 A;  3V8J A;  3JTZ A;  2ART A;  4K87 A;  1B70 A;  4LNS A;  4F9B B;  3MF1 A;  4XTZ A;  2Q7G A;  2YZT A;  3HY0 A;  1ADJ A;  4LF4 E;  2H36 X;  1WHN A;  1NYQ A;  1ASZ A;  3C4B A;  2HHH E;  5IWA E;  1YYW A;  3A7A A;  4JI5 E;  2DSY A;  4F9C B;  3HQ1 A;  4HWO A;  5CFF E;  3A5Y A;  4TVY A;  4HA8 A;  2QHS A;  2EJF A;  2ODR C;  2DQ0 A;  2G4C A;  2LTR A;  3QO5 A;  4YRF A;  2IHR 1;  1YFT A;  1STU A;  1ADY A;  3T1H E;  2LTS A;  2N3G A;  2V85 A;  4DV1 E;  2DVE A;  2ZTG A;  3EFS A;  4KR3 A;  2VQF E;  3RF1 A;  3VYX A;  1HNZ E;  4R8O A;  2KHX A;  3IWD A;  1G5I A;  3IWB A;  4P3N A;  4P75 C;  2L3C A;  2XGT A;  4HT4 A;  1WXR A;  4AQY E;  2UXC E;  4YRR A;  3ADJ A;  3ADL A;  1BIA A;  1HTT A;  1KMM A;  1C0A A;  1EIY B;  4EX5 A;  4K86 A;  4DR1 E;  4X8W A;  4OP0 A;  2UXD E;  4Q6G A;  3L2Z A;  1WU7 A;  2F8B A;  3HY1 A;  5ADZ A;  2ZIM A;  2LBS B;  3LLH A;  4DV0 E;  4M2Z A;  1PKP A;  1J5E E;  1BBU A;  4TUG A;  1W66 A;  4XU2 A;  3A31 A;  4JYA E;  2CJA A;  4LU9 A;  3HXU A;  3A7R A;  2L6M A;  1X01 A;  4G85 A;  1X49 A;  3J81 C;  1YFS A;  4CH6 A;  3IKL A;  4OOG C;  2JWO A;  2EWL A;  3AV0 A;  4H2Y A;  1DQ3 A;  4XTU A;  2V83 A;  2ARU A;  4OX9 E;  4GKK E;  3RAC A;  2Q7H A;  2ODR D;  4YRC A;  2V88 A;  3VYY A;  2RTX A;  1X56 A;  2E5A A;  3RKX A;  3A7U A;  5T6J A;  4B3S E;  4XTY A;  1X47 A;  1HXD A;  1WPY A;  4Q15 A;  1HNW E;  4DPG A;  1EKZ A;  4LVM A;  4Q28 A;  4K0K E;  4B3R E;  4YY3 E;  3PZC A;  4CS2 A;  5F5W A;  4WFT A;  2ZT5 A;  1EVK A;  2B3T B;  1J26 A;  3HRK A;  3P1X A;  2AMC A;  4XTX A;  5C52 B;  4YRP A;  2DU7 A;  4YRO A;  2MC6 A;  2NS6 A;  4J15 A;  2EZ6 A;  2J3L A;  3RL6 A;  3UFG A;  1HNX E;  1BIB A;  2EL9 A;  4BW9 A;  4WF2 A;  2LE2 A;  2VQE E;  3TEG A;  2DDZ A;  2J3M A;  2ZIO A;  3ADG A;  2JOB A;  4BMJ A;  1X55 A;  2UU9 E;  2F4V E;  2RHQ A;  4X64 E;  4WJ3 M;  4AH6 A;  1L0W A;  5K1P A;  4BC9 A;  3MSW A;  4YPF A;  3FIG A;  4JI8 E;  3V7C A;  2I4N A;  2E1M A;  3QO7 A;  5KNN A;  3NEL A;  5LMU E;  4P71 A;  1IBM E;  4H02 A;  4PG3 A;  5HGQ A;  3REX A;  5AAS A;  4P72 C;  1UHZ A;  4RQE A;  4L5N C;  1USY A;  3AUZ A;  4LVL A;  3K6Q A;  2N3H A;  1E22 A;  4JI1 E;  2KON A;  4DUY E;  4KQE A;  4B3M E;  4X65 E;  2ZT6 A;  5C53 B;  4YRT A;  4RMF A;  2VF1 A;  2I4M A;  1RIQ A;  1NYR A;  3BJU A;  1EIY A;  2RHQ B;  4ZIB A;  3VQX A;  3JU0 A;  1N36 E;  2E10 A;  2L3J A;  4YCU A;  4P78 A;  1YGB A;  2IY5 B;  3LML A;  4LF5 E;  4CH3 A;  4L8N A;  2L2N A;  3TEH B;  4WI1 A;  1T4L B;  2DKG A;  1IBK E;  4TWA A;  3VQY A;  3V8L A;  4YCW A;  4XU3 A;  3L4G B;  2NA2 A;  2EJG A;  3LSQ A;  1T4N A;  5AE2 A;  1E24 A;  3R07 A;  4RDX A;  4P3P A;  2ZZE A;  4HWS A;  4BBY A;  2CJ9 A;  3E9I A;  2WZO A;  1SRY A;  1IL2 A;  4DV2 E;  3NEM A;  4XU1 A;  4UP9 A;  2UXB E;  4YCV A;  3RUX A;  4H2T A;  4F9A B;  4R03 A;  1N33 E;  2ALY B;  4LF8 E;  2L92 A;  1ZBQ A;  1EQR A;  4DKK A;  1B8A A;  1KMN A;  3QTC A;  1WQW A;  1EFW A;  3HFV A;  3V7R A;  3DJW A;  3CMQ A;  4XTW A;  4XU0 A;  1QU6 A;  4KR2 A;  1WLE A;  4DQ2 A;  5LL6 R;  4H2X B;  1NJ5 A;  1SES A;  4DV3 E;  2EAY A;  3RIR A;  1GZ6 A;  3HRI A;  4CS3 A;  3ERR A;  3P8Y A;  5ELO A;  3L1A A;  3KFU A;  1JJC B;  2M1S A;  5K1X A;  4BC7 A;  4XEO A;  5FLX C;  2ZT8 A;  3I7F A;  2RHS B;  4JI7 E;  1B76 A;  4ZTZ B;  4I8O A;  1T4O A;  2DMY A;  1LYL A;  4DR6 E;  2A8E A;  3G1Z A;  4YRM A;  1YYK A;  2NUE A;  3HXL A;  3IKM B;  4YRS A;  2NUF A;  4TVA B;  3VQW A;  1ZBT A;  2E1H A;  4J8Z A;  1NJ8 A;  4YP0 A;  4YRL A;  3OTO E;  2JVA A;  4DR2 E;  1X54 A;  2KOU A;  3NEN A;  4DV7 E;  4B3T E;  4BCA A;  1EOV A;  2DTI A;  3HPZ A;  2CIM A;  1X2G A;  1YFR A;  4GEQ B;  3HXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...