2ODRC

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
679
structure length
468
Chain Sequence
b'REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPSILNEIYVYDGNVIGIPEKIDDIALKQIMSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
total genus 117
structure length 468
sequence length 679
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrC01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrC02
4HWOA 4ZTUB 1USYA 1GGMA 2E65A 3IALA 2I4NA 4XTWA 1BBUA 4P3NA 4KR3A 3IKMB 3M4PA 4H2XB 5ELNA 4TVYA 3HFZA 4UP7A 4H2VA 4DQ2A 1X54A 2ZR2A 2ARUA 4G84A 2XTIA 3RKWA 3RKXA 2J3MA 4UPAA 4YRGA 1NJ8A 4P72C 2E64A 3MF1A 3V8LA 2QHUA 4XEMA 1WQWA 1C0AA 4TVWA 3VQYA 2PMFA 4P3PA 1H4SA 1WYDA 3RKYA 2I4LA 4P74C 5K1XA 3IKLA 3REXA 1YFRA 4XTXA 4NCXA 2ZT8A 2Q5IA 4YRSA 4CH4A 1ADYA 1B76A 4YRNA 1BIAA 2ZZFA 3UGQA 4H02A 1WQ7A 3NELA 2AKWA 1EQRA 3OD1A 1EOVA 2DXUA 4HWTA 4YRKA 3V7SA 3HTZA 4HWPA 1NJ6A 4H2UA 1HXDA 2DEQA 4CH3A 3E9HA 4YCVA 1B7YA 3E9IA 1WPYA 3QO5A 4L87A 4XTYA 1LYLA 2I4MA 4HA8A 4P72A 4KQEA 4YRMA 4BWAA 3P8YA 4E51A 4YYEA 4YCWA 2AMCB 3QTCA 4XTVA 3PCOB 4TVAB 1EVLA 4XTUA 2ARTA 2Q7EA 5C52B 4P74A 1X55A 1B70A 1EIYA 2ZZGA 2DQ3A 2ARSA 3EFSA 3V7RA 3R07A 1YFTA 2ODRD 1SRYA 3A7UA 3HFVA 4H2XA 3TEHA 4ZIBA 3UH0A 4DPGA 1YB3A 3QO7A 3HY0A 4O2DA 1ASZA 3V7CA 1HTTA 2J3LA 2DU5A 2Q7HA 3VQWA 3IG2A 1NJ1A 3UGTA 4YRJA 2ZR3A 3RACA 1KOGA 3CMQA 2ZIMA 11ASA 3TEHB 3G1ZA 3UFGA 4WJ4A 5E3IA 4HWRA 4P3OA 1W66A 2G4CA 2ZNIA 3M4QA 4YREA 2P5IA 4OLFA 4Q15A 3NEMA 3W3SA 4HVCA 3L2ZA 1WNLA 2ALYB 2C8MA 3NETA 2EJGA 1NYQA 3MF2A 4CH5A 2DU7A 3A5ZA 3RL6A 3HRKA 2DTHA 4BW9A 3RUXA 1HC7A 3L4GA 4XU2A 1VQZA 1ATIA 3LC0A 2HNIA 4YDQA 1EVKA 4RMFA 2AMCA 2DTIA 1Z7MA 4Q6GA 3ICAA 4PHCA 3LSSA 3PCOA 1L0WA 4YRQA 4TVAA 2CJAA 3P8VA 1QF6A 4P73C 1E24A 2ZGWA 4YRFA 3L4GB 3V8KA 3FJPA 4XU1A 4EX5A 1Z7NA 2EJ9A 2P0LA 2I4OA 4WJ3M 2RHQA 4LNSA 2RHSB 3VBBA 4P75C 1NJ2A 4CS4A 2DJZA 2ZNJA 3RIRA 1IL2A 1WU7A 2ZIOA 4K88A 1H4VB 4XTZA 4K87A 2DDZA 2RHQB 1SERA 4G85A 4H2YA 3VQVA 3HXWA 4YP0A 3HXZA 5HGQA 5C51B 4TTVA 2EJFA 4K86A 1JJCA 4P73A 2ZTGA 3HXXA 1BBWA 2QHVA 1B8AA 12ASA 1X2GA 4YPFA 1EFWA 1SESA 3L1AA 3HRIA 4P71C 1KMNA 3A7RA 4YRRA 3A32A 1J5WA 1H4TA 3V8JA 2ALYA 4P75A 3HXYA 3KFUA 3REUA 1NJ5A 1JJCB 4CS3A 2DTOA 3TEGA 1E1TA 4YCUA 4KR2A 2IY5B 2ZT7A 3QNEA 1X2HA 4EO4A 2DZ9A 2E1HA 3I7FA 1X01A 3A7AA 4CS2A 2QHSA 4UP8A 4TQFA 2CJBA 1G51A 1E22A 1ADJA 2Q5HA 1H4QA 1YGBA 2DKGA 3A31A 2E5AA 2CGHA 4YRIA 4ZTZB 4TWAA 3HFZB 4XEOA 3RGLA 5ELOA 3HY1A 2RHSA 5K1PA 4P71A 4UP9A 3EFRA 2ZXFA 4AH6A 2QHTA 4YRCA 2E3CA 1WLEA 5C53B 3ERRA 2C7IA 2FYKA 1ASYA 4XU3A 4YRTA 1BIBA 1G5IA 3A74A 1QE0A 2CJ9A 3RF1A 1G5HA 1PYSA 3LSQA 1RIQA 4YROA 4TQDA 3TUPA 3MEYA 2CIMA 3QO8A 4J15A 2AKWB 4YRLA 1USYC 3BJUA 3NENA 3BFMA 3HXVA 2Q7GA 2EAYA 2EWNA 4OP0A 4XU0A 1PYSB 2ZINA 4RDXA 1NYRA 1B7YB 4RQFA 2ZCEA 4H2WA 3HXUA 4YRPA 4RQEA 3DSQA 3VQXA 1KMMA 2PMEA 4PG3A 1NNHA 5KNNA 3WQZA 3PZCA 1X56A 2E41A 2DQ0A 2DVEA 4HWSA 4WF2A 2DXTA 1N9WA 4H2SA 4CH6A 1SETA 2IY5A 4H2TA 1YFSA 1B70B 1EIYB 1E1OA 1FYFA 2XGTA 2ZT6A 2ZZEA 3P8TA 4WI1A 5F5WA 4X5OA 2EL9A 2ZT5A 3A5YA 2E10A 2ODRC 2DZCA
chains in the Genus database with same CATH superfamily
4HWOA 1IBLE 3IWBA 2ENHA 2VF1A 1EKZA 4ZTUB 2B9DA 2N3HA 1USYA 2UXBE 1GGMA 2LT7A 2UUAE 2E65A 3ADIA 2EMCA 4LVJA 2WCC3 3IALA 1A1GA 2I4NA 4XTWA 1BBUA 1N3GA 4P3NA 1IBME 3IKMB 4KR3A 3M4PA 1ZBTA 4H2XB 4M30A 1N32E 5ELNA 4TVYA 3HFZA 4UP7A 4H2VA 2EOSA 4DQ2A 1X54A 3HQ1A 3MHHC 2LO3A 3TQMA 2ARUA 2ZR2A 4G84A 2XTIA 2EN4A 3RKWA 1AAYA 2J3MA 3RKXA 4UPAA 4YRGA 1NJ8A 3EPLA 4P72C 1B69A 2E64A 3MF1A 2QHUA 3V8LA 2EOEA 2VQEE 4L5NC 2EN6A 5LMNE 4XEMA 1WQWA 4F9BB 1C0AA 2EM0A 2UXCE 4TVWA 2PMFA 2EM6A 1KYQA 2CSHA 4HEIA 3P1XA 4DV3E 5TSEA 1YZ9A 1WYDA 4P3PA 4LVMA 3LLHA 3HPSA 3RKYA 2R76A 4J8ZA 3C6KA 2YTNA 1YYOA 4JI5E 2I4LA 4P74C 2BB8A 3UK3C 5K1XA 4F6MA 3IKLA 3REXA 2EM2A 1YFRA 4XTXA 1HR0E 1EH7A 4NCXA 1MGTA 1N34E 2ZT8A 3M99B 5IXMB 5T6JA 2H36X 2Q5IA 4YRSA 4CH4A 1ADYA 1B76A 4YRNA 2RS7A 2JY9A 1BIAA 2ZZFA 3UGQA 4R03A 4H02A 1X3CA 4Q28A 1RC7A 2WBUA 1IMUA 3J81C 1WQ7A 3NELA 2AKWA 1EQRA 1X6FA 4MLVA 4KHPE 2M1SA 3OD1A 1EOVA 2DXUA 4HWTA 2YU8A 1SR9A 4YRKA 2WBTA 2RTXA 4P7DA 2LE2A 1WJPA 3J7Yp 3HTZA 4HWPA 3V7SA 1NJ6A 2LUPB 1P47A 1HXDA 2DEQA 2RSMA 4H2UA 4X8WA 2JPAA 4CH3A 3E9HA 4YCVA 1B7YA 4N4RB 2WZOA 1GTKA 3E9IA 1SFEA 2V85A 2EE8A 1WPYA 2EPOA 3L00A 3QO5A 2EPMX 3BIDA 4L87A 3EQ1A 4XTYA 2EM8A 1LYLA 2I4MA 4HA8A 2EL5A 1PKPA 2D9HA 4P72A 4KQEA 4YRMA 4NHRA 4BWAA 3P8YA 4E51A 1XNQE 4YYEA 2RQLA 4YCWA 2A25A 2AMCB 1A1IA 3LMLA 3EPJA 5FLXC 3QTCA 1UILA 4BCAA 2R1FA 4ZYGA 3PCOB 2UU9E 4TVAB 4XTVA 1EVLA 2ARTA 4XTUA 2Q7EA 5C52B 1PJTA 2EQ0A 4P74A 2Q8UA 5F3WA 1B70A 1X55A 4R2AA 4LVLA 1EIYA 4X62E 4DV1E 4B3ME 2ZZGA 2DQ3A 2ARSA 1Z1BA 4DKKA 1YUIA 2V89A 3EFSA 3MQZA 2DGCA 2YTPA 3C6MA 2LTRA 1H4SA 3AUZA 3V7RA 2EPLX 2M4IA 1N33E 2UUCE 3R07A 1YFTA 4KZSA 1LLMC 2NA2A 4LFBE 4WSPA 2EL4A 4ZYEA 4DR4E 2ENAA 4NXME 2LTSA 2ODRD 1SRYA 2K4VA 3A7UA 5KL5A 2A8EA 3HFVA 4X65E 4R2QA 1BBOA 1HNZE 2LUQA 4TUIA 3BF2A 4H2XA 4WX9A 2V8QB 3BGHA 3OMLA 2LVHA 4I8OA 5AE3A 4AQYE 2L8TA 2L6MA 3TEHA 4IJDA 2L33A 2JP9A 4ZIBA 3UH0A 2DSYA 4DPGA 4BHBA 1YB3A 1TF3A 2YU5A 3VQYA 2G7HA 2LCEA 4BHCA 4DR2E 3QO7A 2HC5A 3HY0A 4O2DA 2B3TB 1ASZA 3V7CA 2EWLA 4DV0E 1HTTA 4O4KA 2EMYA 2J3LA 2DU5A 1DGCA 2Q7HA 5AE2A 4LF7E 3OTOE 4YY3E 1ZR9A 3VQWA 4DMIA 2EOZA 1RQ0A 3IG2A 1NJ1A 4LF6E 4YRJA 3UGTA 2ZR3A 3RACA 2B7VA 5ADZA 4LFCE 1KOGA 3CMQA 4ZYHA 2ZIMA 1YYWA 11ASA 3TEHB 2DB2A 2GPIA 1HNWE 3G1ZA 2JOXA 1A1FA 4HTGA 3UFGA 2YTGA 3AV0A 1PJSA 4WJ4A 1F2IG 2KHXA 5E3IA 4GZNC 4HWRA 4P3OA 2FGGA 3H09A 1W66A 2UUBE 2EMZA 3VHTB 4BMJA 3THOB 2G4CA 2ZNIA 2YZTA 3KWRA 5IWAE 3M4QA 4YREA 2P5IA 1X6EA 4TUGA 4BBYA 4OLFA 4Q15A 3NEMA 3W3SA 4HVCA 4JV5E 1WNLA 3L2ZA 2EMWA 1WHNA 2EM3A 2ALYB 2C8MA 3NETA 2EJGA 1NYQA 4RHBB 3MF2A 2EM7A 2EN2A 4LFAE 4CH5A 2DU7A 2YTJA 3J80C 3A5ZA 2M9AA 4R8OA 1QU6A 2I9IA 2V87A 5A6KA 5BR8E 3RL6A 4GKKE 1X48A 2YTQA 4JYAE 2EL6A 3HRKA 2DTHA 4BW9A 4LU9A 3RUXA 1WRJA 2EOQA 2EQ1A 2DIXA 1HC7A 1I94E 1EH8A 1AH5A 3L4GA 4XU2A 1DQ3A 1VQZA 4JI3E 4DV6E 4DV2E 4DV5E 1ATIA 3DF6A 4O5GA 3LC0A 2HNIA 4YDQA 1EVKA 2AMCA 4RMFA 3IWCA 2DTIA 1Z7MA 2VE7C 4P78A 5IV8B 5A6JA 3ICAA 4Q6GA 4PHCA 3ADJA 2LJHA 3LSSA 2EZ6A 5LL6R 5AASA 3PCOA 4TVAA 4YRQA 1L0WA 2CJAA 3P8VA 3EPKA 4JI2E 4F9CB 1QF6A 4P73C 1E24A 2ZGWA 5IT9C 4BC9A 2E1MA 1IBKE 2EN8A 1TF6A 4YRFA 2JYAA 2EMXA 1O0WA 2LV2A 1ZBQA 3ECRA 2EOMA 3L4GB 2EMGA 2EORA 3V8KA 2MC6A 2EPZA 3FJPA 1WXRA 2DLQA 1FKAE 4XU1A 1Z7NA 4EX5A 2EJ9A 1PDAA 2P0LA 2RPCA 2I4OA 4M0VA 4WJ3M 2DLKA 3JU0A 2LMZA 2RHQA 4R2CA 1N36E 1ZAAC 4M2ZA 4DUZE 2RHSB 4LNSA 2N8XA 3EPHA 3VBBA 4P75C 1NJ2A 1UN6B 4CS4A 2DJZA 5A6BA 2YRHA 2NABA 2ZNJA 4WXCA 4R2RA 3THNA 5DNYA 4DUYE 3RIRA 1IL2A 1WU7A 2EPUA 2JVAA 2UXDE 4DV7E 2ZIOA 4O43A 4F6NA 1H4VB 4K88A 2EPPA 2EPCA 4R2PA 2MKDA 4ZYDA 3C4BA 4XTZA 1TN9A 4IS1C 1EH6A 2EMFA 1NEIA 4K87A 2YT4A 2M7QA 4GEQB 4X66E 4JI0E 4WPYA 2DMYA 2DDZA 1GZ6A 1WHQA 2RHQB 2VRDA 1SERA 2L2NA 2RS6A 1G2DC 4G85A 4H2YA 3VQVA 2CTDA 1PJQA 2EOIA 2DRPA 2JXPA 2YRMA 4LF5E 3HXWA 4YP0A 2EOOA 3MSWA 4O24A 1XMOE 3HXZA 4Q35B 2EPKX 2NUFA 5HGQA 5C51B 4TTVA 2L3CA 1YFHA 2HJJA 2YTDA 2BBGA 2EMBA 2EJFA 2V86A 4K86A 1JJCA 4P73A 2LBSB 2ZTGA 3HXXA 4DR5E 2JWOA 1BBWA 2YTOA 2QHVA 2WBSA 4LF9E 4DR6E 2EOJA 3F6HA 1B8AA 4LVKA 4L8NA 4JI7E 12ASA 1X2GA 4YPFA 1EFWA 1SESA 3L1AA 3HRIA 4DR1E 1J26A 4P71C 1KMNA 3A7RA 1T39A 3A32A 4YRRA 1J5WA 1H4TA 3V8JA 2ALYA 1A1KA 1JK2A 4JI4E 2CT1A 4R2SA 3VYXA 1KJKA 3HXYA 4P75A 3KFUA 2MC5A 3REUA 1YPNA 1NJ5A 5KL7A 2NS6A 2CPNA 1X6HA 1JJCB 4CS3A 3JAMC 2F8BA 5A6BD 2DTOA 3TEGA 2EOYA 1YYKA 1E1TA 4YCUA 1L4SA 2EM4A 2YTIA 4KR2A 2IY5B 2RSIA 2ADRA 1UBDC 2ZT7A 3QNEA 1X2HA 4EO4A 5KL6A 2LJUA 2DZ9A 2E1HA 1T4LB 1X5WA 4F2JC 2E5LE 1X01A 3I7FA 3A7AA 3MHSC 1FJGE 1DI2A 4CS2A 2QHSA 2EQ3A 2VQFE 4JI1E 4UP8A 1X47A 4TQFA 2I13A 2CJBA 1A1HA 4R2DA 2YRKA 4K0KE 2L3JA 2N3GA 1G51A 3ZOQB 2EN1A 1JK1A 1E22A 2NUGA 2EN3A 1UHZA 1ADJA 2Q5HA 2F4VE 1H4QA 1YGBA 2EPRA 3FIGA 2EOFA 4GKJE 1RMDA 2EM5A 2DKGA 3A31A 2E5AA 2GHFA 2CGHA 4YRIA 4ZTZB 2PRTA 1YSAC 1J5EE 4B3TE 2NUEA 4TWAA 2IHR1 4M9VC 4RH8A 3HFZB 5KL4A 2EMHA 4XEOA 3KZZA 3RGLA 5ELOA 3HY1A 4NZVA 2RHSA 1X49A 3T1HE 1XMQE 3ADGA 4X64E 4P71A 5K1PA 4UP9A 3T1YE 2YSPA 2ZXFA 3EFRA 1G2FC 4AH6A 4LF8E 2QHTA 4YRCA 4WXDA 2FV4B 2E3CA 1ZU1A 4R2EA 2DMIA 1WLEA 5C53B 2KOUA 5KL2A 1A1LA 5KL3A 2MDRA 3J7AG 2C7IA 2FYKA 3ERRA 1ASYA 4XU3A 4YRTA 1BIBA 2L92A 2ELYA 2YTFA 2EPNA 2ELZA 3ADLA 2JOBA 2V83A 1G5IA 1QE0A 2CJ9A 3A74A 2EP3A 4BC7A 3BBGA 3RF1A 1T4OA 1G5HA 3KZYA 1PYSA 3LSQA 4DR3E 1RIQA 4YROA 1STUA 2EM9A 2MDGA 2YPNA 2GLIA 4LF4E 4TQDA 3TUPA 3MEYA 1YUJA 2EOHA 2CIMA 1GQEA 2J7JA 3HXLA 4DV4E 3QO8A 4J15A 2AKWB 2EOXA 4YRLA 1USYC 3C4TA 4WFTA 3DJWA 3BJUA 3NENA 5A6AA 2LRSA 3BFMA 5AC5A 1BB8A 3HXVA 2HHHE 2EPXA 2Q7GA 2EAYA 2EMAA 2L2KB 2EWNA 2YSOA 4OP0A 2ZM6E 4XU0A 4YHHE 1MEYC 3JTZA 1NCSA 2EMIA 2V88A 2EN7A 2K7IA 2EMKA 3VK6A 1PYSB 2ZINA 4RDXA 4BS9A 1NYRA 1B7YB 4RQFA 3QG5C 2EMLA 2ENCA 5LLQA 2JR1A 2YWQA 1A1JA 2ZCEA 4H2WA 3HXUA 1BBGA 3VYYA 4NXNE 4YRPA 4KWYA 3DSQA 4RQEA 1IQOA 2EPAA 3VQXA 5LMUE 2KONA 5A2QC 1KMMA 5A69A 1NNHA 4PG3A 2PMEA 2B7TA 5KNNA 3PZCA 4F9AB 1X56A 3WQZA 2E41A 2DQ0A 2DVEA 5AC4A 4HWSA 4WF2A 4B3RE 4HT4A 1T4NA 4LTYA 2DXTA 4FK5C 1N9WA 4H2SA 4OOGC 4F54A 4CH6A 1SETA 2IY5A 5AE1A 4H2TA 3HTXA 1YFSA 1QNTA 2L2MA 4MLQA 3IWDA 2HGHA 4JI6E 2MKNA 1XNRE 4DR7E 4WSGA 1B70B 2FTXB 1EIYB 4WYQB 1IQSA 4OX9E 2E72A 1E1OA 5CFFE 1T38A 1FYFA 2XGTA 3HPZA 2ZT6A 2ZZEA 3P8TA 4WI1A 5F5WA 4LVIA 4X5OA 3RMPA 4JI8E 2YTEA 3K6QA 2EL9A 2ZT5A 2EJ4A 3A5YA 4X9JA 2E10A 2ODRC 4B3SE 3F6GA 2DZCA 1HNXE
chains in the Genus database with same CATH topology
4HWOA 1IBLE 3IWBA 2VF1A 1EKZA 4ZTUB 2B9DA 2N3HA 1USYA 2UXBE 1GGMA 2UUAE 2E65A 4LVJA 3ADIA 3IALA 2I4NA 4XTWA 1BBUA 4P3NA 4KR3A 1IBME 3IKMB 3M4PA 1ZBTA 4H2XB 4M30A 1N32E 5ELNA 4TVYA 3HFZA 4UP7A 4H2VA 4DQ2A 1X54A 3HQ1A 2ZR2A 2ARUA 4G84A 2XTIA 3RKWA 3RKXA 2J3MA 4UPAA 4YRGA 1NJ8A 4P72C 2E64A 3MF1A 3V8LA 2QHUA 2VQEE 4L5NC 5LMNE 4XEMA 1WQWA 4F9BB 1C0AA 2UXCE 4TVWA 2PMFA 4P3PA 3VQYA 1H4SA 4DV3E 3P1XA 1YZ9A 1WYDA 4LVMA 3LLHA 3HPSA 3RKYA 4J8ZA 1YYOA 4JI5E 2I4LA 4P74C 5K1XA 3IKLA 3REXA 1YFRA 4XTXA 1HR0E 4NCXA 1N34E 2ZT8A 5T6JA 2H36X 2Q5IA 4YRSA 4CH4A 1ADYA 1B76A 4YRNA 2RS7A 2JY9A 1BIAA 2ZZFA 3UGQA 4R03A 4H02A 4Q28A 1RC7A 1WQ7A 3NELA 3J81C 2AKWA 1EQRA 4KHPE 2M1SA 3OD1A 1EOVA 2DXUA 4HWTA 1SR9A 4YRKA 2RTXA 4P7DA 2LE2A 3V7SA 3J7Yp 3HTZA 4HWPA 1NJ6A 2LUPB 1HXDA 2DEQA 4H2UA 2RSMA 4X8WA 4CH3A 3E9HA 4YCVA 1B7YA 2WZOA 3E9IA 2V85A 1WPYA 3QO5A 4L87A 4XTYA 1LYLA 2I4MA 4HA8A 1PKPA 4P72A 4KQEA 4YRMA 4BWAA 3P8YA 4E51A 1XNQE 4YYEA 4YCWA 2AMCB 3LMLA 5FLXC 3QTCA 1UILA 4BCAA 3PCOB 4XTVA 2UU9E 4TVAB 1EVLA 2ARTA 4XTUA 2Q7EA 5C52B 4P74A 5F3WA 1B70A 1X55A 4LVLA 1EIYA 4X62E 4DV1E 4B3ME 2ZZGA 2DQ3A 2ARSA 4DKKA 2V89A 3EFSA 3MQZA 2LTRA 3AUZA 3V7RA 2M4IA 1N33E 2UUCE 3R07A 1YFTA 4KZSA 2NA2A 4LFBE 4WSPA 4DR4E 4NXME 2LTSA 2ODRD 1SRYA 2K4VA 3A7UA 3HFVA 2A8EA 4X65E 1HNZE 2LUQA 4TUIA 4H2XA 2V8QB 3OMLA 5AE3A 4I8OA 4AQYE 2L8TA 2L6MA 3TEHA 2L33A 4ZIBA 3UH0A 2DSYA 4DPGA 1YB3A 2G7HA 4DR2E 3QO7A 3HY0A 4O2DA 2B3TB 1ASZA 3V7CA 2EWLA 4DV0E 1HTTA 2J3LA 2DU5A 2Q7HA 5AE2A 4LF7E 3OTOE 4YY3E 3VQWA 4DMIA 1RQ0A 3IG2A 1NJ1A 4LF6E 4YRJA 3UGTA 2ZR3A 3RACA 2B7VA 5ADZA 4LFCE 1KOGA 3CMQA 2ZIMA 1YYWA 11ASA 3TEHB 2DB2A 1HNWE 3G1ZA 2JOXA 3UFGA 3AV0A 4WJ4A 2KHXA 5E3IA 4HWRA 4P3OA 2FGGA 3H09A 1W66A 2UUBE 2G4CA 4BMJA 2ZNIA 2YZTA 3KWRA 5IWAE 3M4QA 4YREA 2P5IA 4TUGA 4BBYA 4OLFA 4Q15A 3NEMA 3W3SA 4HVCA 4JV5E 1WNLA 3L2ZA 1WHNA 2ALYB 2C8MA 3NETA 2EJGA 1NYQA 3MF2A 4LFAE 4CH5A 2DU7A 3A5ZA 3J80C 4R8OA 1QU6A 2V87A 5BR8E 3RL6A 4GKKE 1X48A 4JYAE 3HRKA 2DTHA 4BW9A 4LU9A 3RUXA 2DIXA 1HC7A 1I94E 3L4GA 4XU2A 1DQ3A 1VQZA 4JI3E 4DV6E 4DV2E 4DV5E 1ATIA 3DF6A 3LC0A 2HNIA 4YDQA 1EVKA 2AMCA 4RMFA 3IWCA 2DTIA 1Z7MA 2VE7C 4P78A 4Q6GA 3ICAA 4PHCA 3ADJA 2LJHA 3LSSA 2EZ6A 5LL6R 5AASA 3PCOA 4TVAA 4YRQA 1L0WA 2CJAA 3P8VA 4JI2E 4F9CB 1QF6A 4P73C 1E24A 2ZGWA 5IT9C 4BC9A 2E1MA 1IBKE 4YRFA 1O0WA 1ZBQA 3L4GB 3V8KA 2MC6A 3FJPA 1WXRA 1FKAE 4XU1A 4EX5A 1Z7NA 2EJ9A 2P0LA 2I4OA 4M0VA 4WJ3M 3JU0A 2LMZA 2RHQA 1N36E 2RHSB 4LNSA 4M2ZA 4DUZE 3VBBA 4P75C 1NJ2A 4CS4A 2DJZA 2ZNJA 5DNYA 4DUYE 3RIRA 1IL2A 1WU7A 2JVAA 2UXDE 4DV7E 2ZIOA 4K88A 1H4VB 3C4BA 4XTZA 4K87A 2YT4A 2M7QA 4GEQB 4X66E 4JI0E 4WPYA 2DMYA 2DDZA 1GZ6A 1WHQA 2RHQB 1SERA 2L2NA 2RS6A 4G85A 4H2YA 3VQVA 4LF5E 3HXWA 4YP0A 3MSWA 1XMOE 3HXZA 2NUFA 5HGQA 5C51B 4TTVA 2L3CA 2EJFA 2V86A 4K86A 1JJCA 4P73A 2LBSB 2ZTGA 3HXXA 4DR5E 2JWOA 1BBWA 2QHVA 4LF9E 4DR6E 3F6HA 1B8AA 4LVKA 4L8NA 4JI7E 12ASA 1X2GA 4YPFA 1EFWA 1SESA 3L1AA 3HRIA 4DR1E 1J26A 4P71C 1KMNA 3A7RA 4YRRA 3A32A 1J5WA 1H4TA 3V8JA 2ALYA 4JI4E 4P75A 3HXYA 3VYXA 3KFUA 2MC5A 3REUA 1NJ5A 2NS6A 2CPNA 1JJCB 4CS3A 3JAMC 2F8BA 2DTOA 3TEGA 1YYKA 1E1TA 4YCUA 4KR2A 2IY5B 2ZT7A 3QNEA 1X2HA 4EO4A 2DZ9A 2E1HA 1T4LB 2E5LE 1X01A 3I7FA 3A7AA 1FJGE 4CS2A 1DI2A 2QHSA 2VQFE 4JI1E 4UP8A 1X47A 4TQFA 2CJBA 4K0KE 2L3JA 2N3GA 1G51A 3ZOQB 1E22A 2NUGA 1UHZA 1ADJA 2Q5HA 2F4VE 1H4QA 1YGBA 3FIGA 4GKJE 2DKGA 3A31A 2E5AA 2CGHA 4YRIA 4ZTZB 1J5EE 4B3TE 2NUEA 4TWAA 2IHR1 3HFZB 4XEOA 3RGLA 5ELOA 3HY1A 2RHSA 1X49A 3T1HE 1XMQE 3ADGA 4X64E 4P71A 5K1PA 4UP9A 3T1YE 3EFRA 2ZXFA 4AH6A 4LF8E 2QHTA 4YRCA 2FV4B 2E3CA 1WLEA 5C53B 2KOUA 3ERRA 3J7AG 2MDRA 2C7IA 2FYKA 1ASYA 4XU3A 4YRTA 1BIBA 2L92A 3ADLA 2JOBA 2V83A 1G5IA 1QE0A 2CJ9A 3A74A 4BC7A 3RF1A 1T4OA 1G5HA 1PYSA 3LSQA 4DR3E 1RIQA 4YROA 1STUA 4LF4E 4TQDA 3TUPA 3MEYA 2CIMA 1GQEA 3HXLA 4DV4E 3QO8A 4J15A 2AKWB 4YRLA 1USYC 3C4TA 4WFTA 3DJWA 3BJUA 3NENA 2LRSA 3BFMA 3HXVA 2HHHE 2Q7GA 2EAYA 2L2KB 2EWNA 4OP0A 4XU0A 2ZM6E 4YHHE 3JTZA 1PYSB 2ZINA 2V88A 3VK6A 4RDXA 4BS9A 1NYRA 1B7YB 4RQFA 2JR1A 2ZCEA 4H2WA 3HXUA 3VYYA 4NXNE 4YRPA 4RQEA 3DSQA 3VQXA 5LMUE 2KONA 5A2QC 1KMMA 1NNHA 4PG3A 2PMEA 5KNNA 2B7TA 3WQZA 3PZCA 4F9AB 1X56A 2E41A 2DQ0A 2DVEA 4HWSA 4WF2A 4B3RE 4HT4A 1T4NA 4LTYA 2DXTA 1N9WA 4H2SA 4OOGC 4F54A 4CH6A 1SETA 2IY5A 5AE1A 4H2TA 3HTXA 1YFSA 2L2MA 3IWDA 4JI6E 1XNRE 4DR7E 1B70B 2FTXB 1EIYB 4WYQB 1E1OA 4OX9E 5CFFE 1FYFA 2XGTA 3HPZA 2ZT6A 2ZZEA 3P8TA 4WI1A 5F5WA 4LVIA 4X5OA 3RMPA 4JI8E 2EL9A 3K6QA 2ZT5A 3A5YA 2E10A 2ODRC 4B3SE 3F6GA 2DZCA 1HNXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWO A;  4ZTU B;  1USY A;  1GGM A;  2E65 A;  3IAL A;  2I4N A;  4XTW A;  1BBU A;  4P3N A;  4KR3 A;  3IKM B;  3M4P A;  4H2X B;  5ELN A;  4TVY A;  3HFZ A;  4UP7 A;  4H2V A;  4DQ2 A;  1X54 A;  2ZR2 A;  2ARU A;  4G84 A;  2XTI A;  3RKW A;  3RKX A;  2J3M A;  4UPA A;  4YRG A;  1NJ8 A;  4P72 C;  2E64 A;  3MF1 A;  3V8L A;  2QHU A;  4XEM A;  1WQW A;  1C0A A;  4TVW A;  3VQY A;  2PMF A;  4P3P A;  1H4S A;  1WYD A;  3RKY A;  2I4L A;  4P74 C;  5K1X A;  3IKL A;  3REX A;  1YFR A;  4XTX A;  4NCX A;  2ZT8 A;  2Q5I A;  4YRS A;  4CH4 A;  1ADY A;  1B76 A;  4YRN A;  1BIA A;  2ZZF A;  3UGQ A;  4H02 A;  1WQ7 A;  3NEL A;  2AKW A;  1EQR A;  3OD1 A;  1EOV A;  2DXU A;  4HWT A;  4YRK A;  3V7S A;  3HTZ A;  4HWP A;  1NJ6 A;  4H2U A;  1HXD A;  2DEQ A;  4CH3 A;  3E9H A;  4YCV A;  1B7Y A;  3E9I A;  1WPY A;  3QO5 A;  4L87 A;  4XTY A;  1LYL A;  2I4M A;  4HA8 A;  4P72 A;  4KQE A;  4YRM A;  4BWA A;  3P8Y A;  4E51 A;  4YYE A;  4YCW A;  2AMC B;  3QTC A;  4XTV A;  3PCO B;  4TVA B;  1EVL A;  4XTU A;  2ART A;  2Q7E A;  5C52 B;  4P74 A;  1X55 A;  1B70 A;  1EIY A;  2ZZG A;  2DQ3 A;  2ARS A;  3EFS A;  3V7R A;  3R07 A;  1YFT A;  2ODR D;  1SRY A;  3A7U A;  3HFV A;  4H2X A;  3TEH A;  4ZIB A;  3UH0 A;  4DPG A;  1YB3 A;  3QO7 A;  3HY0 A;  4O2D A;  1ASZ A;  3V7C A;  1HTT A;  2J3L A;  2DU5 A;  2Q7H A;  3VQW A;  3IG2 A;  1NJ1 A;  3UGT A;  4YRJ A;  2ZR3 A;  3RAC A;  1KOG A;  3CMQ A;  2ZIM A;  11AS A;  3TEH B;  3G1Z A;  3UFG A;  4WJ4 A;  5E3I A;  4HWR A;  4P3O A;  1W66 A;  2G4C A;  2ZNI A;  3M4Q A;  4YRE A;  2P5I A;  4OLF A;  4Q15 A;  3NEM A;  3W3S A;  4HVC A;  3L2Z A;  1WNL A;  2ALY B;  2C8M A;  3NET A;  2EJG A;  1NYQ A;  3MF2 A;  4CH5 A;  2DU7 A;  3A5Z A;  3RL6 A;  3HRK A;  2DTH A;  4BW9 A;  3RUX A;  1HC7 A;  3L4G A;  4XU2 A;  1VQZ A;  1ATI A;  3LC0 A;  2HNI A;  4YDQ A;  1EVK A;  4RMF A;  2AMC A;  2DTI A;  1Z7M A;  4Q6G A;  3ICA A;  4PHC A;  3LSS A;  3PCO A;  1L0W A;  4YRQ A;  4TVA A;  2CJA A;  3P8V A;  1QF6 A;  4P73 C;  1E24 A;  2ZGW A;  4YRF A;  3L4G B;  3V8K A;  3FJP A;  4XU1 A;  4EX5 A;  1Z7N A;  2EJ9 A;  2P0L A;  2I4O A;  4WJ3 M;  2RHQ A;  4LNS A;  2RHS B;  3VBB A;  4P75 C;  1NJ2 A;  4CS4 A;  2DJZ A;  2ZNJ A;  3RIR A;  1IL2 A;  1WU7 A;  2ZIO A;  4K88 A;  1H4V B;  4XTZ A;  4K87 A;  2DDZ A;  2RHQ B;  1SER A;  4G85 A;  4H2Y A;  3VQV A;  3HXW A;  4YP0 A;  3HXZ A;  5HGQ A;  5C51 B;  4TTV A;  2EJF A;  4K86 A;  1JJC A;  4P73 A;  2ZTG A;  3HXX A;  1BBW A;  2QHV A;  1B8A A;  12AS A;  1X2G A;  4YPF A;  1EFW A;  1SES A;  3L1A A;  3HRI A;  4P71 C;  1KMN A;  3A7R A;  4YRR A;  3A32 A;  1J5W A;  1H4T A;  3V8J A;  2ALY A;  4P75 A;  3HXY A;  3KFU A;  3REU A;  1NJ5 A;  1JJC B;  4CS3 A;  2DTO A;  3TEG A;  1E1T A;  4YCU A;  4KR2 A;  2IY5 B;  2ZT7 A;  3QNE A;  1X2H A;  4EO4 A;  2DZ9 A;  2E1H A;  3I7F A;  1X01 A;  3A7A A;  4CS2 A;  2QHS A;  4UP8 A;  4TQF A;  2CJB A;  1G51 A;  1E22 A;  1ADJ A;  2Q5H A;  1H4Q A;  1YGB A;  2DKG A;  3A31 A;  2E5A A;  2CGH A;  4YRI A;  4ZTZ B;  4TWA A;  3HFZ B;  4XEO A;  3RGL A;  5ELO A;  3HY1 A;  2RHS A;  5K1P A;  4P71 A;  4UP9 A;  3EFR A;  2ZXF A;  4AH6 A;  2QHT A;  4YRC A;  2E3C A;  1WLE A;  5C53 B;  3ERR A;  2C7I A;  2FYK A;  1ASY A;  4XU3 A;  4YRT A;  1BIB A;  1G5I A;  3A74 A;  1QE0 A;  2CJ9 A;  3RF1 A;  1G5H A;  1PYS A;  3LSQ A;  1RIQ A;  4YRO A;  4TQD A;  3TUP A;  3MEY A;  2CIM A;  3QO8 A;  4J15 A;  2AKW B;  4YRL A;  1USY C;  3BJU A;  3NEN A;  3BFM A;  3HXV A;  2Q7G A;  2EAY A;  2EWN A;  4OP0 A;  4XU0 A;  1PYS B;  2ZIN A;  4RDX A;  1NYR A;  1B7Y B;  4RQF A;  2ZCE A;  4H2W A;  3HXU A;  4YRP A;  4RQE A;  3DSQ A;  3VQX A;  1KMM A;  2PME A;  4PG3 A;  1NNH A;  5KNN A;  3WQZ A;  3PZC A;  1X56 A;  2E41 A;  2DQ0 A;  2DVE A;  4HWS A;  4WF2 A;  2DXT A;  1N9W A;  4H2S A;  4CH6 A;  1SET A;  2IY5 A;  4H2T A;  1YFS A;  1B70 B;  1EIY B;  1E1O A;  1FYF A;  2XGT A;  2ZT6 A;  2ZZE A;  3P8T A;  4WI1 A;  5F5W A;  4X5O A;  2EL9 A;  2ZT5 A;  3A5Y A;  2E10 A;  2ODR C;  2DZC A; 
#chains in the Genus database with same CATH topology
 4HWO A;  1IBL E;  3IWB A;  2ENH A;  2VF1 A;  1EKZ A;  4ZTU B;  2B9D A;  2N3H A;  1USY A;  2UXB E;  1GGM A;  2LT7 A;  2UUA E;  2E65 A;  3ADI A;  2EMC A;  4LVJ A;  2WCC 3;  3IAL A;  1A1G A;  2I4N A;  4XTW A;  1BBU A;  1N3G A;  4P3N A;  1IBM E;  3IKM B;  4KR3 A;  3M4P A;  1ZBT A;  4H2X B;  4M30 A;  1N32 E;  5ELN A;  4TVY A;  3HFZ A;  4UP7 A;  4H2V A;  2EOS A;  4DQ2 A;  1X54 A;  3HQ1 A;  3MHH C;  2LO3 A;  3TQM A;  2ARU A;  2ZR2 A;  4G84 A;  2XTI A;  2EN4 A;  3RKW A;  1AAY A;  2J3M A;  3RKX A;  4UPA A;  4YRG A;  1NJ8 A;  3EPL A;  4P72 C;  1B69 A;  2E64 A;  3MF1 A;  2QHU A;  3V8L A;  2EOE A;  2VQE E;  4L5N C;  2EN6 A;  5LMN E;  4XEM A;  1WQW A;  4F9B B;  1C0A A;  2EM0 A;  2UXC E;  4TVW A;  2PMF A;  2EM6 A;  1KYQ A;  2CSH A;  4HEI A;  3P1X A;  4DV3 E;  5TSE A;  1YZ9 A;  1WYD A;  4P3P A;  4LVM A;  3LLH A;  3HPS A;  3RKY A;  2R76 A;  4J8Z A;  3C6K A;  2YTN A;  1YYO A;  4JI5 E;  2I4L A;  4P74 C;  2BB8 A;  3UK3 C;  5K1X A;  4F6M A;  3IKL A;  3REX A;  2EM2 A;  1YFR A;  4XTX A;  1HR0 E;  1EH7 A;  4NCX A;  1MGT A;  1N34 E;  2ZT8 A;  3M99 B;  5IXM B;  5T6J A;  2H36 X;  2Q5I A;  4YRS A;  4CH4 A;  1ADY A;  1B76 A;  4YRN A;  2RS7 A;  2JY9 A;  1BIA A;  2ZZF A;  3UGQ A;  4R03 A;  4H02 A;  1X3C A;  4Q28 A;  1RC7 A;  2WBU A;  1IMU A;  3J81 C;  1WQ7 A;  3NEL A;  2AKW A;  1EQR A;  1X6F A;  4MLV A;  4KHP E;  2M1S A;  3OD1 A;  1EOV A;  2DXU A;  4HWT A;  2YU8 A;  1SR9 A;  4YRK A;  2WBT A;  2RTX A;  4P7D A;  2LE2 A;  1WJP A;  3J7Y p;  3HTZ A;  4HWP A;  3V7S A;  1NJ6 A;  2LUP B;  1P47 A;  1HXD A;  2DEQ A;  2RSM A;  4H2U A;  4X8W A;  2JPA A;  4CH3 A;  3E9H A;  4YCV A;  1B7Y A;  4N4R B;  2WZO A;  1GTK A;  3E9I A;  1SFE A;  2V85 A;  2EE8 A;  1WPY A;  2EPO A;  3L00 A;  3QO5 A;  2EPM X;  3BID A;  4L87 A;  3EQ1 A;  4XTY A;  2EM8 A;  1LYL A;  2I4M A;  4HA8 A;  2EL5 A;  1PKP A;  2D9H A;  4P72 A;  4KQE A;  4YRM A;  4NHR A;  4BWA A;  3P8Y A;  4E51 A;  1XNQ E;  4YYE A;  2RQL A;  4YCW A;  2A25 A;  2AMC B;  1A1I A;  3LML A;  3EPJ A;  5FLX C;  3QTC A;  1UIL A;  4BCA A;  2R1F A;  4ZYG A;  3PCO B;  2UU9 E;  4TVA B;  4XTV A;  1EVL A;  2ART A;  4XTU A;  2Q7E A;  5C52 B;  1PJT A;  2EQ0 A;  4P74 A;  2Q8U A;  5F3W A;  1B70 A;  1X55 A;  4R2A A;  4LVL A;  1EIY A;  4X62 E;  4DV1 E;  4B3M E;  2ZZG A;  2DQ3 A;  2ARS A;  1Z1B A;  4DKK A;  1YUI A;  2V89 A;  3EFS A;  3MQZ A;  2DGC A;  2YTP A;  3C6M A;  2LTR A;  1H4S A;  3AUZ A;  3V7R A;  2EPL X;  2M4I A;  1N33 E;  2UUC E;  3R07 A;  1YFT A;  4KZS A;  1LLM C;  2NA2 A;  4LFB E;  4WSP A;  2EL4 A;  4ZYE A;  4DR4 E;  2ENA A;  4NXM E;  2LTS A;  2ODR D;  1SRY A;  2K4V A;  3A7U A;  5KL5 A;  2A8E A;  3HFV A;  4X65 E;  4R2Q A;  1BBO A;  1HNZ E;  2LUQ A;  4TUI A;  3BF2 A;  4H2X A;  4WX9 A;  2V8Q B;  3BGH A;  3OML A;  2LVH A;  4I8O A;  5AE3 A;  4AQY E;  2L8T A;  2L6M A;  3TEH A;  4IJD A;  2L33 A;  2JP9 A;  4ZIB A;  3UH0 A;  2DSY A;  4DPG A;  4BHB A;  1YB3 A;  1TF3 A;  2YU5 A;  3VQY A;  2G7H A;  2LCE A;  4BHC A;  4DR2 E;  3QO7 A;  2HC5 A;  3HY0 A;  4O2D A;  2B3T B;  1ASZ A;  3V7C A;  2EWL A;  4DV0 E;  1HTT A;  4O4K A;  2EMY A;  2J3L A;  2DU5 A;  1DGC A;  2Q7H A;  5AE2 A;  4LF7 E;  3OTO E;  4YY3 E;  1ZR9 A;  3VQW A;  4DMI A;  2EOZ A;  1RQ0 A;  3IG2 A;  1NJ1 A;  4LF6 E;  4YRJ A;  3UGT A;  2ZR3 A;  3RAC A;  2B7V A;  5ADZ A;  4LFC E;  1KOG A;  3CMQ A;  4ZYH A;  2ZIM A;  1YYW A;  11AS A;  3TEH B;  2DB2 A;  2GPI A;  1HNW E;  3G1Z A;  2JOX A;  1A1F A;  4HTG A;  3UFG A;  2YTG A;  3AV0 A;  1PJS A;  4WJ4 A;  1F2I G;  2KHX A;  5E3I A;  4GZN C;  4HWR A;  4P3O A;  2FGG A;  3H09 A;  1W66 A;  2UUB E;  2EMZ A;  3VHT B;  4BMJ A;  3THO B;  2G4C A;  2ZNI A;  2YZT A;  3KWR A;  5IWA E;  3M4Q A;  4YRE A;  2P5I A;  1X6E A;  4TUG A;  4BBY A;  4OLF A;  4Q15 A;  3NEM A;  3W3S A;  4HVC A;  4JV5 E;  1WNL A;  3L2Z A;  2EMW A;  1WHN A;  2EM3 A;  2ALY B;  2C8M A;  3NET A;  2EJG A;  1NYQ A;  4RHB B;  3MF2 A;  2EM7 A;  2EN2 A;  4LFA E;  4CH5 A;  2DU7 A;  2YTJ A;  3J80 C;  3A5Z A;  2M9A A;  4R8O A;  1QU6 A;  2I9I A;  2V87 A;  5A6K A;  5BR8 E;  3RL6 A;  4GKK E;  1X48 A;  2YTQ A;  4JYA E;  2EL6 A;  3HRK A;  2DTH A;  4BW9 A;  4LU9 A;  3RUX A;  1WRJ A;  2EOQ A;  2EQ1 A;  2DIX A;  1HC7 A;  1I94 E;  1EH8 A;  1AH5 A;  3L4G A;  4XU2 A;  1DQ3 A;  1VQZ A;  4JI3 E;  4DV6 E;  4DV2 E;  4DV5 E;  1ATI A;  3DF6 A;  4O5G A;  3LC0 A;  2HNI A;  4YDQ A;  1EVK A;  2AMC A;  4RMF A;  3IWC A;  2DTI A;  1Z7M A;  2VE7 C;  4P78 A;  5IV8 B;  5A6J A;  3ICA A;  4Q6G A;  4PHC A;  3ADJ A;  2LJH A;  3LSS A;  2EZ6 A;  5LL6 R;  5AAS A;  3PCO A;  4TVA A;  4YRQ A;  1L0W A;  2CJA A;  3P8V A;  3EPK A;  4JI2 E;  4F9C B;  1QF6 A;  4P73 C;  1E24 A;  2ZGW A;  5IT9 C;  4BC9 A;  2E1M A;  1IBK E;  2EN8 A;  1TF6 A;  4YRF A;  2JYA A;  2EMX A;  1O0W A;  2LV2 A;  1ZBQ A;  3ECR A;  2EOM A;  3L4G B;  2EMG A;  2EOR A;  3V8K A;  2MC6 A;  2EPZ A;  3FJP A;  1WXR A;  2DLQ A;  1FKA E;  4XU1 A;  1Z7N A;  4EX5 A;  2EJ9 A;  1PDA A;  2P0L A;  2RPC A;  2I4O A;  4M0V A;  4WJ3 M;  2DLK A;  3JU0 A;  2LMZ A;  2RHQ A;  4R2C A;  1N36 E;  1ZAA C;  4M2Z A;  4DUZ E;  2RHS B;  4LNS A;  2N8X A;  3EPH A;  3VBB A;  4P75 C;  1NJ2 A;  1UN6 B;  4CS4 A;  2DJZ A;  5A6B A;  2YRH A;  2NAB A;  2ZNJ A;  4WXC A;  4R2R A;  3THN A;  5DNY A;  4DUY E;  3RIR A;  1IL2 A;  1WU7 A;  2EPU A;  2JVA A;  2UXD E;  4DV7 E;  2ZIO A;  4O43 A;  4F6N A;  1H4V B;  4K88 A;  2EPP A;  2EPC A;  4R2P A;  2MKD A;  4ZYD A;  3C4B A;  4XTZ A;  1TN9 A;  4IS1 C;  1EH6 A;  2EMF A;  1NEI A;  4K87 A;  2YT4 A;  2M7Q A;  4GEQ B;  4X66 E;  4JI0 E;  4WPY A;  2DMY A;  2DDZ A;  1GZ6 A;  1WHQ A;  2RHQ B;  2VRD A;  1SER A;  2L2N A;  2RS6 A;  1G2D C;  4G85 A;  4H2Y A;  3VQV A;  2CTD A;  1PJQ A;  2EOI A;  2DRP A;  2JXP A;  2YRM A;  4LF5 E;  3HXW A;  4YP0 A;  2EOO A;  3MSW A;  4O24 A;  1XMO E;  3HXZ A;  4Q35 B;  2EPK X;  2NUF A;  5HGQ A;  5C51 B;  4TTV A;  2L3C A;  1YFH A;  2HJJ A;  2YTD A;  2BBG A;  2EMB A;  2EJF A;  2V86 A;  4K86 A;  1JJC A;  4P73 A;  2LBS B;  2ZTG A;  3HXX A;  4DR5 E;  2JWO A;  1BBW A;  2YTO A;  2QHV A;  2WBS A;  4LF9 E;  4DR6 E;  2EOJ A;  3F6H A;  1B8A A;  4LVK A;  4L8N A;  4JI7 E;  12AS A;  1X2G A;  4YPF A;  1EFW A;  1SES A;  3L1A A;  3HRI A;  4DR1 E;  1J26 A;  4P71 C;  1KMN A;  3A7R A;  1T39 A;  3A32 A;  4YRR A;  1J5W A;  1H4T A;  3V8J A;  2ALY A;  1A1K A;  1JK2 A;  4JI4 E;  2CT1 A;  4R2S A;  3VYX A;  1KJK A;  3HXY A;  4P75 A;  3KFU A;  2MC5 A;  3REU A;  1YPN A;  1NJ5 A;  5KL7 A;  2NS6 A;  2CPN A;  1X6H A;  1JJC B;  4CS3 A;  3JAM C;  2F8B A;  5A6B D;  2DTO A;  3TEG A;  2EOY A;  1YYK A;  1E1T A;  4YCU A;  1L4S A;  2EM4 A;  2YTI A;  4KR2 A;  2IY5 B;  2RSI A;  2ADR A;  1UBD C;  2ZT7 A;  3QNE A;  1X2H A;  4EO4 A;  5KL6 A;  2LJU A;  2DZ9 A;  2E1H A;  1T4L B;  1X5W A;  4F2J C;  2E5L E;  1X01 A;  3I7F A;  3A7A A;  3MHS C;  1FJG E;  1DI2 A;  4CS2 A;  2QHS A;  2EQ3 A;  2VQF E;  4JI1 E;  4UP8 A;  1X47 A;  4TQF A;  2I13 A;  2CJB A;  1A1H A;  4R2D A;  2YRK A;  4K0K E;  2L3J A;  2N3G A;  1G51 A;  3ZOQ B;  2EN1 A;  1JK1 A;  1E22 A;  2NUG A;  2EN3 A;  1UHZ A;  1ADJ A;  2Q5H A;  2F4V E;  1H4Q A;  1YGB A;  2EPR A;  3FIG A;  2EOF A;  4GKJ E;  1RMD A;  2EM5 A;  2DKG A;  3A31 A;  2E5A A;  2GHF A;  2CGH A;  4YRI A;  4ZTZ B;  2PRT A;  1YSA C;  1J5E E;  4B3T E;  2NUE A;  4TWA A;  2IHR 1;  4M9V C;  4RH8 A;  3HFZ B;  5KL4 A;  2EMH A;  4XEO A;  3KZZ A;  3RGL A;  5ELO A;  3HY1 A;  4NZV A;  2RHS A;  1X49 A;  3T1H E;  1XMQ E;  3ADG A;  4X64 E;  4P71 A;  5K1P A;  4UP9 A;  3T1Y E;  2YSP A;  2ZXF A;  3EFR A;  1G2F C;  4AH6 A;  4LF8 E;  2QHT A;  4YRC A;  4WXD A;  2FV4 B;  2E3C A;  1ZU1 A;  4R2E A;  2DMI A;  1WLE A;  5C53 B;  2KOU A;  5KL2 A;  1A1L A;  5KL3 A;  2MDR A;  3J7A G;  2C7I A;  2FYK A;  3ERR A;  1ASY A;  4XU3 A;  4YRT A;  1BIB A;  2L92 A;  2ELY A;  2YTF A;  2EPN A;  2ELZ A;  3ADL A;  2JOB A;  2V83 A;  1G5I A;  1QE0 A;  2CJ9 A;  3A74 A;  2EP3 A;  4BC7 A;  3BBG A;  3RF1 A;  1T4O A;  1G5H A;  3KZY A;  1PYS A;  3LSQ A;  4DR3 E;  1RIQ A;  4YRO A;  1STU A;  2EM9 A;  2MDG A;  2YPN A;  2GLI A;  4LF4 E;  4TQD A;  3TUP A;  3MEY A;  1YUJ A;  2EOH A;  2CIM A;  1GQE A;  2J7J A;  3HXL A;  4DV4 E;  3QO8 A;  4J15 A;  2AKW B;  2EOX A;  4YRL A;  1USY C;  3C4T A;  4WFT A;  3DJW A;  3BJU A;  3NEN A;  5A6A A;  2LRS A;  3BFM A;  5AC5 A;  1BB8 A;  3HXV A;  2HHH E;  2EPX A;  2Q7G A;  2EAY A;  2EMA A;  2L2K B;  2EWN A;  2YSO A;  4OP0 A;  2ZM6 E;  4XU0 A;  4YHH E;  1MEY C;  3JTZ A;  1NCS A;  2EMI A;  2V88 A;  2EN7 A;  2K7I A;  2EMK A;  3VK6 A;  1PYS B;  2ZIN A;  4RDX A;  4BS9 A;  1NYR A;  1B7Y B;  4RQF A;  3QG5 C;  2EML A;  2ENC A;  5LLQ A;  2JR1 A;  2YWQ A;  1A1J A;  2ZCE A;  4H2W A;  3HXU A;  1BBG A;  3VYY A;  4NXN E;  4YRP A;  4KWY A;  3DSQ A;  4RQE A;  1IQO A;  2EPA A;  3VQX A;  5LMU E;  2KON A;  5A2Q C;  1KMM A;  5A69 A;  1NNH A;  4PG3 A;  2PME A;  2B7T A;  5KNN A;  3PZC A;  4F9A B;  1X56 A;  3WQZ A;  2E41 A;  2DQ0 A;  2DVE A;  5AC4 A;  4HWS A;  4WF2 A;  4B3R E;  4HT4 A;  1T4N A;  4LTY A;  2DXT A;  4FK5 C;  1N9W A;  4H2S A;  4OOG C;  4F54 A;  4CH6 A;  1SET A;  2IY5 A;  5AE1 A;  4H2T A;  3HTX A;  1YFS A;  1QNT A;  2L2M A;  4MLQ A;  3IWD A;  2HGH A;  4JI6 E;  2MKN A;  1XNR E;  4DR7 E;  4WSG A;  1B70 B;  2FTX B;  1EIY B;  4WYQ B;  1IQS A;  4OX9 E;  2E72 A;  1E1O A;  5CFF E;  1T38 A;  1FYF A;  2XGT A;  3HPZ A;  2ZT6 A;  2ZZE A;  3P8T A;  4WI1 A;  5F5W A;  4LVI A;  4X5O A;  3RMP A;  4JI8 E;  2YTE A;  3K6Q A;  2EL9 A;  2ZT5 A;  2EJ4 A;  3A5Y A;  4X9J A;  2E10 A;  2ODR C;  4B3S E;  3F6G A;  2DZC A;  1HNX E; 
#chains in the Genus database with same CATH homology
 4HWO A;  1IBL E;  3IWB A;  2VF1 A;  1EKZ A;  4ZTU B;  2B9D A;  2N3H A;  1USY A;  2UXB E;  1GGM A;  2UUA E;  2E65 A;  4LVJ A;  3ADI A;  3IAL A;  2I4N A;  4XTW A;  1BBU A;  4P3N A;  4KR3 A;  1IBM E;  3IKM B;  3M4P A;  1ZBT A;  4H2X B;  4M30 A;  1N32 E;  5ELN A;  4TVY A;  3HFZ A;  4UP7 A;  4H2V A;  4DQ2 A;  1X54 A;  3HQ1 A;  2ZR2 A;  2ARU A;  4G84 A;  2XTI A;  3RKW A;  3RKX A;  2J3M A;  4UPA A;  4YRG A;  1NJ8 A;  4P72 C;  2E64 A;  3MF1 A;  3V8L A;  2QHU A;  2VQE E;  4L5N C;  5LMN E;  4XEM A;  1WQW A;  4F9B B;  1C0A A;  2UXC E;  4TVW A;  2PMF A;  4P3P A;  3VQY A;  1H4S A;  4DV3 E;  3P1X A;  1YZ9 A;  1WYD A;  4LVM A;  3LLH A;  3HPS A;  3RKY A;  4J8Z A;  1YYO A;  4JI5 E;  2I4L A;  4P74 C;  5K1X A;  3IKL A;  3REX A;  1YFR A;  4XTX A;  1HR0 E;  4NCX A;  1N34 E;  2ZT8 A;  5T6J A;  2H36 X;  2Q5I A;  4YRS A;  4CH4 A;  1ADY A;  1B76 A;  4YRN A;  2RS7 A;  2JY9 A;  1BIA A;  2ZZF A;  3UGQ A;  4R03 A;  4H02 A;  4Q28 A;  1RC7 A;  1WQ7 A;  3NEL A;  3J81 C;  2AKW A;  1EQR A;  4KHP E;  2M1S A;  3OD1 A;  1EOV A;  2DXU A;  4HWT A;  1SR9 A;  4YRK A;  2RTX A;  4P7D A;  2LE2 A;  3V7S A;  3J7Y p;  3HTZ A;  4HWP A;  1NJ6 A;  2LUP B;  1HXD A;  2DEQ A;  4H2U A;  2RSM A;  4X8W A;  4CH3 A;  3E9H A;  4YCV A;  1B7Y A;  2WZO A;  3E9I A;  2V85 A;  1WPY A;  3QO5 A;  4L87 A;  4XTY A;  1LYL A;  2I4M A;  4HA8 A;  1PKP A;  4P72 A;  4KQE A;  4YRM A;  4BWA A;  3P8Y A;  4E51 A;  1XNQ E;  4YYE A;  4YCW A;  2AMC B;  3LML A;  5FLX C;  3QTC A;  1UIL A;  4BCA A;  3PCO B;  4XTV A;  2UU9 E;  4TVA B;  1EVL A;  2ART A;  4XTU A;  2Q7E A;  5C52 B;  4P74 A;  5F3W A;  1B70 A;  1X55 A;  4LVL A;  1EIY A;  4X62 E;  4DV1 E;  4B3M E;  2ZZG A;  2DQ3 A;  2ARS A;  4DKK A;  2V89 A;  3EFS A;  3MQZ A;  2LTR A;  3AUZ A;  3V7R A;  2M4I A;  1N33 E;  2UUC E;  3R07 A;  1YFT A;  4KZS A;  2NA2 A;  4LFB E;  4WSP A;  4DR4 E;  4NXM E;  2LTS A;  2ODR D;  1SRY A;  2K4V A;  3A7U A;  3HFV A;  2A8E A;  4X65 E;  1HNZ E;  2LUQ A;  4TUI A;  4H2X A;  2V8Q B;  3OML A;  5AE3 A;  4I8O A;  4AQY E;  2L8T A;  2L6M A;  3TEH A;  2L33 A;  4ZIB A;  3UH0 A;  2DSY A;  4DPG A;  1YB3 A;  2G7H A;  4DR2 E;  3QO7 A;  3HY0 A;  4O2D A;  2B3T B;  1ASZ A;  3V7C A;  2EWL A;  4DV0 E;  1HTT A;  2J3L A;  2DU5 A;  2Q7H A;  5AE2 A;  4LF7 E;  3OTO E;  4YY3 E;  3VQW A;  4DMI A;  1RQ0 A;  3IG2 A;  1NJ1 A;  4LF6 E;  4YRJ A;  3UGT A;  2ZR3 A;  3RAC A;  2B7V A;  5ADZ A;  4LFC E;  1KOG A;  3CMQ A;  2ZIM A;  1YYW A;  11AS A;  3TEH B;  2DB2 A;  1HNW E;  3G1Z A;  2JOX A;  3UFG A;  3AV0 A;  4WJ4 A;  2KHX A;  5E3I A;  4HWR A;  4P3O A;  2FGG A;  3H09 A;  1W66 A;  2UUB E;  2G4C A;  4BMJ A;  2ZNI A;  2YZT A;  3KWR A;  5IWA E;  3M4Q A;  4YRE A;  2P5I A;  4TUG A;  4BBY A;  4OLF A;  4Q15 A;  3NEM A;  3W3S A;  4HVC A;  4JV5 E;  1WNL A;  3L2Z A;  1WHN A;  2ALY B;  2C8M A;  3NET A;  2EJG A;  1NYQ A;  3MF2 A;  4LFA E;  4CH5 A;  2DU7 A;  3A5Z A;  3J80 C;  4R8O A;  1QU6 A;  2V87 A;  5BR8 E;  3RL6 A;  4GKK E;  1X48 A;  4JYA E;  3HRK A;  2DTH A;  4BW9 A;  4LU9 A;  3RUX A;  2DIX A;  1HC7 A;  1I94 E;  3L4G A;  4XU2 A;  1DQ3 A;  1VQZ A;  4JI3 E;  4DV6 E;  4DV2 E;  4DV5 E;  1ATI A;  3DF6 A;  3LC0 A;  2HNI A;  4YDQ A;  1EVK A;  2AMC A;  4RMF A;  3IWC A;  2DTI A;  1Z7M A;  2VE7 C;  4P78 A;  4Q6G A;  3ICA A;  4PHC A;  3ADJ A;  2LJH A;  3LSS A;  2EZ6 A;  5LL6 R;  5AAS A;  3PCO A;  4TVA A;  4YRQ A;  1L0W A;  2CJA A;  3P8V A;  4JI2 E;  4F9C B;  1QF6 A;  4P73 C;  1E24 A;  2ZGW A;  5IT9 C;  4BC9 A;  2E1M A;  1IBK E;  4YRF A;  1O0W A;  1ZBQ A;  3L4G B;  3V8K A;  2MC6 A;  3FJP A;  1WXR A;  1FKA E;  4XU1 A;  4EX5 A;  1Z7N A;  2EJ9 A;  2P0L A;  2I4O A;  4M0V A;  4WJ3 M;  3JU0 A;  2LMZ A;  2RHQ A;  1N36 E;  2RHS B;  4LNS A;  4M2Z A;  4DUZ E;  3VBB A;  4P75 C;  1NJ2 A;  4CS4 A;  2DJZ A;  2ZNJ A;  5DNY A;  4DUY E;  3RIR A;  1IL2 A;  1WU7 A;  2JVA A;  2UXD E;  4DV7 E;  2ZIO A;  4K88 A;  1H4V B;  3C4B A;  4XTZ A;  4K87 A;  2YT4 A;  2M7Q A;  4GEQ B;  4X66 E;  4JI0 E;  4WPY A;  2DMY A;  2DDZ A;  1GZ6 A;  1WHQ A;  2RHQ B;  1SER A;  2L2N A;  2RS6 A;  4G85 A;  4H2Y A;  3VQV A;  4LF5 E;  3HXW A;  4YP0 A;  3MSW A;  1XMO E;  3HXZ A;  2NUF A;  5HGQ A;  5C51 B;  4TTV A;  2L3C A;  2EJF A;  2V86 A;  4K86 A;  1JJC A;  4P73 A;  2LBS B;  2ZTG A;  3HXX A;  4DR5 E;  2JWO A;  1BBW A;  2QHV A;  4LF9 E;  4DR6 E;  3F6H A;  1B8A A;  4LVK A;  4L8N A;  4JI7 E;  12AS A;  1X2G A;  4YPF A;  1EFW A;  1SES A;  3L1A A;  3HRI A;  4DR1 E;  1J26 A;  4P71 C;  1KMN A;  3A7R A;  4YRR A;  3A32 A;  1J5W A;  1H4T A;  3V8J A;  2ALY A;  4JI4 E;  4P75 A;  3HXY A;  3VYX A;  3KFU A;  2MC5 A;  3REU A;  1NJ5 A;  2NS6 A;  2CPN A;  1JJC B;  4CS3 A;  3JAM C;  2F8B A;  2DTO A;  3TEG A;  1YYK A;  1E1T A;  4YCU A;  4KR2 A;  2IY5 B;  2ZT7 A;  3QNE A;  1X2H A;  4EO4 A;  2DZ9 A;  2E1H A;  1T4L B;  2E5L E;  1X01 A;  3I7F A;  3A7A A;  1FJG E;  4CS2 A;  1DI2 A;  2QHS A;  2VQF E;  4JI1 E;  4UP8 A;  1X47 A;  4TQF A;  2CJB A;  4K0K E;  2L3J A;  2N3G A;  1G51 A;  3ZOQ B;  1E22 A;  2NUG A;  1UHZ A;  1ADJ A;  2Q5H A;  2F4V E;  1H4Q A;  1YGB A;  3FIG A;  4GKJ E;  2DKG A;  3A31 A;  2E5A A;  2CGH A;  4YRI A;  4ZTZ B;  1J5E E;  4B3T E;  2NUE A;  4TWA A;  2IHR 1;  3HFZ B;  4XEO A;  3RGL A;  5ELO A;  3HY1 A;  2RHS A;  1X49 A;  3T1H E;  1XMQ E;  3ADG A;  4X64 E;  4P71 A;  5K1P A;  4UP9 A;  3T1Y E;  3EFR A;  2ZXF A;  4AH6 A;  4LF8 E;  2QHT A;  4YRC A;  2FV4 B;  2E3C A;  1WLE A;  5C53 B;  2KOU A;  3ERR A;  3J7A G;  2MDR A;  2C7I A;  2FYK A;  1ASY A;  4XU3 A;  4YRT A;  1BIB A;  2L92 A;  3ADL A;  2JOB A;  2V83 A;  1G5I A;  1QE0 A;  2CJ9 A;  3A74 A;  4BC7 A;  3RF1 A;  1T4O A;  1G5H A;  1PYS A;  3LSQ A;  4DR3 E;  1RIQ A;  4YRO A;  1STU A;  4LF4 E;  4TQD A;  3TUP A;  3MEY A;  2CIM A;  1GQE A;  3HXL A;  4DV4 E;  3QO8 A;  4J15 A;  2AKW B;  4YRL A;  1USY C;  3C4T A;  4WFT A;  3DJW A;  3BJU A;  3NEN A;  2LRS A;  3BFM A;  3HXV A;  2HHH E;  2Q7G A;  2EAY A;  2L2K B;  2EWN A;  4OP0 A;  4XU0 A;  2ZM6 E;  4YHH E;  3JTZ A;  1PYS B;  2ZIN A;  2V88 A;  3VK6 A;  4RDX A;  4BS9 A;  1NYR A;  1B7Y B;  4RQF A;  2JR1 A;  2ZCE A;  4H2W A;  3HXU A;  3VYY A;  4NXN E;  4YRP A;  4RQE A;  3DSQ A;  3VQX A;  5LMU E;  2KON A;  5A2Q C;  1KMM A;  1NNH A;  4PG3 A;  2PME A;  5KNN A;  2B7T A;  3WQZ A;  3PZC A;  4F9A B;  1X56 A;  2E41 A;  2DQ0 A;  2DVE A;  4HWS A;  4WF2 A;  4B3R E;  4HT4 A;  1T4N A;  4LTY A;  2DXT A;  1N9W A;  4H2S A;  4OOG C;  4F54 A;  4CH6 A;  1SET A;  2IY5 A;  5AE1 A;  4H2T A;  3HTX A;  1YFS A;  2L2M A;  3IWD A;  4JI6 E;  1XNR E;  4DR7 E;  1B70 B;  2FTX B;  1EIY B;  4WYQ B;  1E1O A;  4OX9 E;  5CFF E;  1FYF A;  2XGT A;  3HPZ A;  2ZT6 A;  2ZZE A;  3P8T A;  4WI1 A;  5F5W A;  4LVI A;  4X5O A;  3RMP A;  4JI8 E;  2EL9 A;  3K6Q A;  2ZT5 A;  3A5Y A;  2E10 A;  2ODR C;  4B3S E;  3F6G A;  2DZC A;  1HNX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...