2ODRC

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
679
structure length
468
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPSILNEIYVYDGNVIGIPEKIDDIALKQIMSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
total genus 117
structure length 468
sequence length 679
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrC01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrC02
2PMFA 4WJ4A 4L87A 4YPFA 4YRGA 4RDXA 2QHSA 4YRIA 1SESA 4WF2A 3A7RA 1WLEA 4K87A 1B8AA 3LSQA 4YRSA 2QHTA 1B70A 4TVWA 4G85A 4H2YA 1X56A 4H2WA 4RQEA 2E65A 4AH6A 2IY5B 3L4GA 4P72C 1B7YB 4BWAA 2P5IA 3PZCA 3HXUA 1FYFA 4CH3A 2EAYA 3RACA 1E24A 3R07A 5HGQA 1EVKA 1EVLA 2ZR3A 2AKWA 3IG2A 3A7UA 2G4CA 2RHQB 3EFRA 1SETA 4HVCA 1H4SA 1HTTA 2EJFA 1C0AA 3RL6A 4YRPA 4YCWA 2ARUA 4YROA 3M4QA 2CIMA 4H2TA 3HRKA 1YFSA 1X2HA 3TEHB 3A5ZA 4YREA 4TVAB 4YCUA 2XTIA 1WYDA 1USYC 1QE0A 4P75C 2P0LA 2E3CA 3A7AA 1Z7MA 1ASZA 1ASYA 1EOVA 4UP9A 2DXUA 5C53B 3W3SA 4TVYA 3OD1A 1E22A 1NYRA 1W66A 3RKYA 1G51A 1BBWA 1L0WA 2RHSA 3PCOA 1EQRA 3EFSA 3L1AA 3REUA 4ZIBA 2I4OA 2ZINA 4XTZA 4HWOA 4CS3A 1ADJA 4WJ3M 1NJ6A 2Q7HA 3LSSA 4YRNA 4G84A 4ZTZB 3E9IA 1B70B 1N9WA 2DZ9A 4P74C 4Q6GA 3HFZA 2ZNJA 4YRCA 1BIAA 4OLFA 4O2DA 4TQDA 4P71C 1NJ8A 4XTXA 3UGTA 3A5YA 1WPYA 3RIRA 3HXVA 2XGTA 3HXWA 1EFWA 3VBBA 4KR3A 2Q5HA 4XTWA 1IL2A 1BIBA 1EIYA 4RQFA 4K86A 2Q5IA 3V8JA 3FJPA 2AKWB 3LC0A 4UP8A 1H4VB 5K1PA 11ASA 3MF2A 3HXYA 2ALYA 2E10A 4P3OA 3QO7A 2ZTGA 3L2ZA 2AMCA 4HWTA 4DPGA 2QHUA 2EWNA 3CMQA 3WQZA 1PYSA 2DU5A 3I7FA 2DTOA 3A31A 3V7CA 4H2XA 1B76A 1NJ5A 3M4PA 1NJ2A 4XU1A 5E3IA 5KNNA 2E41A 3VQYA 2DU7A 1YGBA 3TUPA 4P3PA 3V8KA 4OP0A 2ODRD 1WQWA 4YDQA 4YYEA 1KMNA 4HWSA 4YRRA 2CJ9A 4TWAA 2I4LA 4TQFA 1NYQA 2RHSB 3PCOB 4XU3A 2DKGA 4P73A 3TEGA 3BFMA 3V7SA 3NENA 4CH6A 2ODRC 5C51B 3P8YA 3RUXA 2HNIA 3KFUA 1SERA 2IY5A 1J5WA 2I4NA 3HFZB 1YFRA 1NJ1A 3QO5A 4YRKA 1X55A 3VQWA 1JJCA 4J15A 2ZIMA 4HWPA 2ZT8A 4YRMA 3HY0A 1LYLA 2ARSA 2J3LA 5F5WA 1ADYA 2DDZA 3NETA 5K1XA 3RKXA 2ZT5A 1EIYB 3UH0A 2DXTA 1X54A 4E51A 3DSQA 3RF1A 1Z7NA 4XEOA 2ARTA 4RMFA 1E1TA 1G5IA 4YCVA 1KMMA 1QF6A 2ALYB 3MEYA 4YRTA 4P3NA 1YB3A 2AMCB 1YFTA 3QO8A 3L4GB 3HXZA 1ATIA 1PYSB 1RIQA 4XEMA 2E64A 2DJZA 2EL9A 1WQ7A 4H2XB 4XTUA 3IKLA 3NELA 2DZCA 3VQXA 2ZR2A 5C52B 2DEQA 4CH5A 4HWRA 2J3MA 4H2UA 4EO4A 2ZXFA 3QTCA 3A74A 4H2SA 2Q7GA 2C7IA 2DVEA 1WNLA 1NNHA 4H2VA 3V8LA 4UPAA 1H4TA 2EJ9A 1VQZA 2ZGWA 3UGQA 4X5OA 2E5AA 4XU2A 2CJAA 2EJGA 4P72A 1JJCB 3ICAA 2E1HA 4YRFA 1GGMA 4P73C 4YRLA 2QHVA 1H4QA 2ZT7A 4XTYA 4NCXA 3P8TA 3REXA 2ZIOA 2ZT6A 4TTVA 3HXXA 4HA8A 2ZZFA 3QNEA 2CGHA 2CJBA 1G5HA 4K88A 5ELOA 1B7YA 4ZTUB 2PMEA 4UP7A 1HXDA 2DTIA 3HRIA 1BBUA 3HFVA 3ERRA 4BW9A 3IKMB 2DQ0A 2ZZEA 1WU7A 4CS2A 4WI1A 1USYA 3VQVA 2RHQA 3HTZA 4XTVA 4P75A 3A32A 4Q15A 2ZNIA 3NEMA 2Q7EA 2ZCEA 1X2GA 2DTHA 2DQ3A 3BJUA 3P8VA 4XU0A 4YRQA 3TEHA 3G1ZA 1E1OA 3RKWA 3V7RA 1HC7A 4YRJA 4PG3A 4H02A 2I4MA 4TVAA 2ZZGA 3E9HA 1X01A 3MF1A 4DQ2A 2C8MA 3HY1A 4CS4A 1SRYA 3IALA 3UFGA 4LNSA 4KQEA 4P74A 4EX5A 4CH4A 2FYKA 3RGLA 4YP0A 4PHCA 1KOGA 5ELNA 4P71A 12ASA 4KR2A
chains in the Genus database with same CATH superfamily
2PMFA 2NA2A 4LVIA 4WJ4A 2D9HA 2LUQA 4L87A 1N32E 4M2ZA 4YPFA 4YRGA 5IXMB 4NHRA 2QHSA 1BB8A 4RDXA 3VYXA 1YYKA 2EMAA 2EM6A 4YRIA 4LVJA 1SESA 4WF2A 3A7RA 2YU5A 4ZYDA 1WLEA 4K87A 4X62E 1HNZE 2EOOA 2YTFA 2DGCA 1B8AA 3LSQA 2WBTA 2LT7A 4YRSA 2QHTA 1B70A 2V8QB 2WCC3 3BF2A 4TVWA 4G85A 4DR6E 4H2YA 2EJ4A 4KZSA 1X56A 1AAYA 1XNQE 4H2WA 2EPUA 2JYAA 4RQEA 2E65A 3EQ1A 2VF1A 4MLVA 1X3CA 2EMCA 2V89A 4AH6A 3EPJA 3L4GA 1B7YB 4P72C 2IY5B 4BWAA 2P5IA 2L3CA 1UBDC 3QG5C 4WSPA 1X6HA 4I8OA 3PZCA 3HXUA 1N34E 3EPKA 4J8ZA 4Q35B 1FYFA 4AQYE 2YPNA 4CH3A 4WSGA 2EMWA 2EAYA 2L8TA 2VE7C 1E24A 3RACA 3R07A 1XMQE 2F4VE 2EM0A 1RMDA 1YZ9A 3C4BA 5HGQA 1EVKA 1EVLA 2ZR3A 2AKWA 1A1HA 3IG2A 3A7UA 2R1FA 5LL6R 2G4CA 2F8BA 2EM5A 2RHQB 3H09A 3EFRA 1SETA 2DB2A 4HVCA 4HEIA 4F54A 1H4SA 2UU9E 1HTTA 4R2AA 5IWAE 2EOJA 3KZYA 2UUAE 2EPRA 2EJFA 1C0AA 2EN2A 2EMXA 4O24A 3RL6A 4YRPA 1WXRA 2YTQA 2I13A 4YCWA 1WHQA 1YYOA 2GLIA 2ARUA 4YROA 2EN3A 3M4QA 3THNA 2CIMA 2FTXB 1O0WA 4H2TA 4BMJA 1QNTA 1YFSA 3HRKA 1X2HA 3TEHB 2YSOA 3A5ZA 4LF7E 5E3IA 4YREA 2LJHA 3THOB 1ZBTA 1KJKA 2VRDA 2EN6A 3KZZA 4JV5E 4DR1E 4TVAB 2EMLA 2HHHE 2M1SA 4YCUA 3ADGA 3HXLA 2IHR1 2H36X 2L2KB 2YTIA 2XTIA 2J7JA 3ECRA 1WYDA 2YTDA 1X6FA 5AE2A 2RPCA 4IJDA 1T4NA 1USYC 3J80C 4WYQB 1AH5A 4LVLA 5ADZA 2RTXA 1JK2A 4OX9E 3VYYA 1QE0A 2P0LA 2E3CA 3A7AA 4JI1E 4P75C 1Z7MA 1ASZA 2LMZA 1ASYA 2MDRA 4DR3E 2ADRA 1EOVA 2JR1A 4KHPE 4UP9A 3LMLA 2DXUA 5AC4A 5C53B 1YSAC 3W3SA 2EM2A 4BHBA 4TVYA 1WHNA 2UUBE 5AASA 1E22A 3OD1A 2DMIA 1P47A 1NYRA 1W66A 3RKYA 1BBOA 1G51A 4DR5E 1T4OA 2L92A 1BBWA 1L0WA 1X47A 4R2CA 2RHSA 3PCOA 1EQRA 3EFSA 3L1AA 3REUA 4ZIBA 1ZAAC 2JP9A 2I4OA 2ZINA 4O4KA 5BR8E 1J5EE 2M9AA 4XTZA 4HWOA 2UXBE 4CS3A 3ZOQB 3BGHA 1ADJA 4WJ3M 2EM3A 4WX9A 1NJ6A 2Q7HA 2CPNA 2EM9A 1ZU1A 2EMGA 3LSSA 3AUZA 1PJTA 5KL5A 3T1YE 3HTXA 4G84A 4YRNA 1ZBQA 3C4TA 4F9CB 2JOBA 3E9IA 4ZTZB 1B70B 1N9WA 2EM8A 2DZ9A 4P74C 4DV7E 4JI5E 1WRJA 2EOFA 1X5WA 4Q6GA 3BBGA 3HFZA 4F9AB 2EM4A 2ZNJA 1HNWE 3ADJA 4YRCA 3ADIA 1GTKA 2PRTA 3EPHA 1BIAA 4DV4E 4L5NC 3RMPA 4OLFA 4JYAE 3HPZA 4O2DA 2EPOA 4WPYA 5KL2A 4NXME 4TQDA 4P71C 1NJ8A 4X9JA 4XTXA 3UGTA 4RHBB 1WPYA 5KL7A 2NUGA 3T1HE 3A5YA 3RIRA 3HXVA 2EOEA 2ELYA 4BS9A 4X64E 2XGTA 3HXWA 1EFWA 4DV5E 3VBBA 3UK3C 4KR3A 4LTYA 2JXPA 2Q5HA 1A1IA 4XTWA 3IWBA 4B3RE 3J7Yp 2VQFE 2EOYA 4ZYEA 1BIBA 4RQFA 4K86A 2VQEE 1EIYA 2UUCE 1IL2A 2Q5IA 2YRHA 3V8JA 5LLQA 1PDAA 3FJPA 2RQLA 2AKWB 2LTSA 3LC0A 5A6BA 4JI3E 2EQ3A 2A8EA 4UP8A 2K4VA 4JI7E 1H4VB 2EPLX 1A1LA 1IBLE 5K1PA 11ASA 3MF2A 1BBGA 3HXYA 1UILA 2MKNA 2ALYA 2JWOA 2MC5A 3F6HA 3EPLA 2B3TB 4WXCA 2E10A 3QO7A 4P3OA 2YTJA 2ZTGA 3L2ZA 2AMCA 4HWTA 4DPGA 4F9BB 2QHUA 2EWNA 2LBSB 1JK1A 3CMQA 2EPKX 3WQZA 1PYSA 3HQ1A 2HJJA 2EOQA 2DU5A 3I7FA 2LCEA 4M30A 2DTOA 2M4IA 2BB8A 3A31A 2FGGA 3V7CA 2UXCE 2EMKA 1B76A 1X6EA 1NJ2A 1UN6B 1NJ5A 3M4PA 4H2XA 4XU1A 2EOMA 2YWQA 2EPZA 3C6MA 4BHCA 2ZM6E 4F6NA 1T39A 1IQOA 5KNNA 1IBME 2E41A 3BIDA 1XNRE 3VQYA 1MGTA 5LMUE 2ENCA 2DU7A 1YGBA 3TUPA 2LTRA 5A2QC 2G7HA 4P3PA 3L00A 2CT1A 3V8KA 4DKKA 4M0VA 4OP0A 2ODRD 1WQWA 1DQ3A 1HNXE 2RSMA 1EKZA 4YDQA 3IWDA 4LF8E 4R2RA 4YYEA 2DMYA 1KMNA 4HWSA 2CSHA 4YRRA 2CJ9A 2N3HA 4TWAA 2EN4A 4F2JC 2HGHA 1IQSA 2I4LA 4TQFA 1NYQA 2B7TA 2RHSB 3PCOB 4XU3A 4R2PA 2DKGA 4DR2E 3M99B 4ZYHA 4P73A 3TEGA 4YHHE 3BFMA 2HC5A 4NZVA 3V7SA 3NENA 1KYQA 4DUZE 2LV2A 1X49A 4B3SE 2EQ1A 4CH6A 2ODRC 5C51B 4KR2A 3P8YA 3RUXA 2HNIA 2KONA 1SERA 3KFUA 2IY5A 2EPXA 1N36E 1J5WA 3VK6A 2EN7A 2I4NA 3HFZB 1YFRA 1NJ1A 2ENHA 4TUIA 3MQZA 3QO5A 4YRKA 1X55A 3VQWA 1JJCA 4J15A 3OMLA 2ZIMA 4HWPA 4HTGA 4O5GA 4DV0E 2ZT8A 4YRMA 3HY0A 2YTOA 3J81C 2EL4A 4WXDA 2E5LE 4DR4E 2ENAA 2RSIA 3MSWA 5T6JA 4DUYE 1LYLA 2ARSA 2J3LA 5F5WA 1ADYA 2DDZA 2L33A 1TF3A 3NETA 5K1XA 2L2NA 3RKXA 2ZT5A 2EOSA 2YRMA 4JI8E 1EIYB 4MLQA 1GZ6A 2E1MA 4R8OA 2I9IA 3JU0A 1N33E 2DXTA 3UH0A 1X54A 4E51A 3DSQA 4X66E 1STUA 2EOXA 4DV3E 1G2FC 1Z7NA 4XEOA 3RF1A 1SR9A 4P78A 1N3GA 2ARTA 3MHHC 1E1TA 1G5IA 4RMFA 4YCVA 5A6BD 5TSEA 1KMMA 4LU9A 1QF6A 2ALYB 1QU6A 5A6KA 3MEYA 4YRTA 1YUJA 1DGCA 4P3NA 2LRSA 1YB3A 4KWYA 2AMCB 4DV1E 1YFTA 3QO8A 4YY3E 3L4GB 2R76A 3HXZA 1PKPA 2KOUA 1ATIA 1PYSB 1RIQA 4XEMA 2E64A 3VHTB 2MDGA 2DJZA 1EH8A 2EMHA 4LFCE 1WQ7A 5IT9C 2EL9A 4JI4E 4H2XB 4X65E 4XTUA 2EMYA 3IKLA 3NELA 1T38A 2JY9A 2DZCA 2DIXA 3AV0A 3VQXA 2EPPA 3OTOE 2ZR2A 4BC9A 5F3WA 5C52B 2CTDA 4BCAA 4B3ME 2EZ6A 2DEQA 3JTZA 1EH7A 4GEQB 4CH5A 4HWRA 1TF6A 2YZTA 2EWLA 2B7VA 2EPAA 5LMNE 1WJPA 2J3MA 5CFFE 2EE8A 2NABA 4H2UA 4EO4A 2ZXFA 1B69A 4LF5E 1FJGE 2EORA 1J26A 2EPCA 1A1JA 1A1FA 3QTCA 4IS1C 1RQ0A 1SFEA 5FLXC 3A74A 2FV4B 4H2SA 1PJSA 2LE2A 2YTNA 2RS7A 1Z1BA 2C7IA 2DVEA 1WNLA 2Q7GA 1NNHA 4H2VA 3V8LA 5IV8B 4O43A 3TQMA 4R2SA 1GQEA 2DLKA 4UPAA 1H4TA 2YU8A 4JI2E 2DSYA 5AE3A 2WZOA 2EJ9A 2NS6A 1MEYC 4R2QA 4TUGA 1VQZA 4DR7E 2ZGWA 4GZNC 2L6MA 2YRKA 3UGQA 4X5OA 2EN1A 1TN9A 2E5AA 4XU2A 4LNSA 2EMFA 2CJAA 1A1GA 1X48A 3JAMC 3MHSC 2EJGA 3KWRA 4P72A 4JI0E 1JJCB 3ICAA 2YT4A 2E1HA 4DMIA 4RH8A 2V87A 5A69A 4YRFA 1GGMA 5AC5A 4P73C 4YRLA 3K6QA 4L8NA 4WFTA 2EMZA 2QHVA 1H4QA 2ZT7A 4XTYA 4NCXA 2L3JA 3P8TA 2YSPA 2ZIOA 3REXA 2ZT6A 4TTVA 1UHZA 4R2DA 2NUFA 3HXXA 2JPAA 4HA8A 2ZZFA 2EOZA 3QNEA 2EPNA 2BBGA 4K0KE 2M7QA 1RC7A 5KL6A 1XMOE 4N4RB 2RS6A 2JVAA 2B9DA 3IWCA 2EQ0A 2JOXA 2CGHA 2NUEA 1EH6A 2Q8UA 2EOHA 2CJBA 2EN8A 2EL6A 2GPIA 1F2IG 2YTPA 2YTGA 1G5HA 4K88A 5ELOA 2K7IA 1B7YA 4ZTUB 2N8XA 2LJUA 2V86A 2YTEA 2EPMX 3P1XA 1YUIA 2N3GA 2PMEA 2LUPB 5DNYA 3F6GA 4UP7A 1HXDA 1YFHA 2DTIA 2LO3A 3HRIA 1BBUA 3HFVA 3DF6A 1A1KA 3ERRA 4X8WA 3IKMB 5AE1A 4BW9A 2DQ0A 5KL4A 2ZZEA 1WU7A 1L4SA 2DRPA 4CS2A 4GKKE 4GKJE 4WI1A 1USYA 3VQVA 2RHQA 3HTZA 4R2EA 4P75A 4XTVA 3A32A 4Q15A 2ZNIA 3NEMA 2Q7EA 2KHXA 2L2MA 4M9VC 4LF4E 2ZCEA 2WBSA 2MC6A 4JI6E 2WBUA 1X2GA 4FK5C 4OOGC 2DTHA 2DQ3A 5A6AA 3BJUA 3P8VA 4XU0A 4YRQA 2UXDE 1NEIA 1LLMC 3G1ZA 3TEHA 1E1OA 4DV2E 4DV6E 3RKWA 3V7RA 5A6JA 1IBKE 1HC7A 1FKAE 4YRJA 4PG3A 2EMBA 4H02A 2I4MA 4TVAA 4ZYGA 2E72A 1HR0E 2LVHA 1IMUA 2V88A 2ZZGA 4NXNE 1T4LB 4Q28A 3E9HA 4BBYA 1G2DC 1DI2A 2MKDA 4P7DA 1X01A 3MF1A 3FIGA 1YPNA 4BC7A 4DQ2A 4R03A 4LF6E 3ADLA 2C8MA 4F6MA 3HY1A 2ELZA 2EM7A 4CS4A 1SRYA 3IALA 5KL3A 4LVKA 1YYWA 4HT4A 3J7AG 3UFGA 1ZR9A 2EOIA 3C6KA 2A25A 3LLHA 2V85A 4LFAE 2GHFA 2V83A 4KQEA 4P74A 4LF9E 2EMIA 4EX5A 4LFBE 1NCSA 2EL5A 2DLQA 4CH4A 2FYKA 3RGLA 2EP3A 4YP0A 4PHCA 1KOGA 5ELNA 4LVMA 3DJWA 4P71A 1I94E 12ASA 1PJQA 4B3TE 3HPSA
chains in the Genus database with same CATH topology
2PMFA 2NA2A 4LVIA 4WJ4A 2LUQA 4L87A 1N32E 4M2ZA 4YPFA 4YRGA 4RDXA 2QHSA 4LVJA 3VYXA 1YYKA 4YRIA 1SESA 4WF2A 3A7RA 1WLEA 4K87A 4X62E 1HNZE 1B8AA 3LSQA 4YRSA 2QHTA 1B70A 2V8QB 4TVWA 4G85A 4DR6E 4H2YA 4KZSA 1X56A 1XNQE 4H2WA 4RQEA 2E65A 2VF1A 4AH6A 2IY5B 2V89A 3L4GA 4P72C 1B7YB 4BWAA 2P5IA 2L3CA 4WSPA 3PZCA 4I8OA 3HXUA 1N34E 4J8ZA 1FYFA 4AQYE 4CH3A 2EAYA 2L8TA 2VE7C 1E24A 3RACA 3R07A 1XMQE 2F4VE 1YZ9A 3C4BA 5HGQA 1EVKA 1EVLA 2ZR3A 2AKWA 3IG2A 3A7UA 5LL6R 2G4CA 2F8BA 2RHQB 3H09A 3EFRA 1SETA 2DB2A 4HVCA 4F54A 1H4SA 2UU9E 1HTTA 5IWAE 2UUAE 2EJFA 1C0AA 3RL6A 4YRPA 1WXRA 4YCWA 1WHQA 1YYOA 2ARUA 4YROA 3M4QA 2CIMA 2FTXB 1O0WA 4H2TA 4BMJA 3HRKA 1YFSA 1X2HA 3TEHB 3A5ZA 4LF7E 4YREA 2LJHA 1ZBTA 4JV5E 4DR1E 4TVAB 2HHHE 2M1SA 4YCUA 3ADGA 3HXLA 2IHR1 2H36X 2L2KB 2XTIA 1WYDA 5AE2A 1T4NA 1USYC 3J80C 4WYQB 4LVLA 5ADZA 2RTXA 4OX9E 1QE0A 3VYYA 4P75C 2P0LA 2E3CA 3A7AA 4JI1E 1Z7MA 1ASZA 2LMZA 1ASYA 2MDRA 4DR3E 1EOVA 2JR1A 4KHPE 4UP9A 3LMLA 2DXUA 5C53B 3W3SA 4TVYA 1WHNA 2UUBE 5AASA 1E22A 3OD1A 1NYRA 1W66A 3RKYA 1G51A 4DR5E 1T4OA 2L92A 1BBWA 1L0WA 1X47A 2RHSA 3PCOA 1EQRA 3EFSA 3L1AA 3REUA 4ZIBA 2I4OA 2ZINA 5BR8E 1J5EE 4XTZA 4HWOA 2UXBE 4CS3A 3ZOQB 1ADJA 4WJ3M 1NJ6A 2Q7HA 2CPNA 3LSSA 3AUZA 4YRNA 3T1YE 3HTXA 4G84A 1ZBQA 3C4TA 4F9CB 2JOBA 3E9IA 4ZTZB 1B70B 1N9WA 2DZ9A 4P74C 4DV7E 4JI5E 4Q6GA 3HFZA 4F9AB 2ZNJA 1HNWE 3ADJA 4YRCA 3ADIA 1BIAA 4DV4E 4L5NC 3RMPA 4OLFA 4JYAE 3HPZA 4O2DA 4WPYA 4NXME 4TQDA 4P71C 1NJ8A 4XTXA 3UGTA 3A5YA 1WPYA 2NUGA 3RIRA 3T1HE 3HXVA 2XGTA 4BS9A 4X64E 3HXWA 1EFWA 4DV5E 3VBBA 4KR3A 4LTYA 2Q5HA 4XTWA 3IWBA 4B3RE 3J7Yp 2VQFE 1IL2A 1BIBA 1EIYA 4RQFA 4K86A 2VQEE 2UUCE 2Q5IA 3V8JA 3FJPA 2AKWB 2LTSA 3LC0A 4JI3E 2A8EA 4UP8A 2K4VA 4JI7E 1H4VB 5K1PA 1IBLE 11ASA 3MF2A 3HXYA 1UILA 2ALYA 2JWOA 2MC5A 3F6HA 2E10A 2B3TB 4P3OA 3QO7A 2ZTGA 3L2ZA 2AMCA 4HWTA 4DPGA 4F9BB 2QHUA 2EWNA 2LBSB 3CMQA 3WQZA 1PYSA 3HQ1A 2DU5A 3I7FA 4M30A 2DTOA 2M4IA 3A31A 2FGGA 3V7CA 2UXCE 1B76A 1NJ5A 3M4PA 1NJ2A 4H2XA 4XU1A 5E3IA 2ZM6E 5KNNA 1IBME 2E41A 1XNRE 3VQYA 5LMUE 2DU7A 1YGBA 3TUPA 2LTRA 5A2QC 2G7HA 4P3PA 3V8KA 4DKKA 4M0VA 4OP0A 2ODRD 1WQWA 1DQ3A 1HNXE 2RSMA 1EKZA 4YDQA 3IWDA 4LF8E 4YYEA 2DMYA 1KMNA 4HWSA 4YRRA 2CJ9A 2N3HA 4TWAA 2I4LA 4TQFA 1NYQA 2B7TA 2RHSB 3PCOB 4XU3A 2DKGA 4DR2E 4P73A 3TEGA 4YHHE 3BFMA 3V7SA 3NENA 4DUZE 1X49A 4B3SE 4CH6A 2ODRC 5C51B 4KR2A 3P8YA 3RUXA 2HNIA 2KONA 1SERA 3KFUA 2IY5A 1N36E 1J5WA 3VK6A 2I4NA 3HFZB 1YFRA 1NJ1A 4TUIA 3MQZA 3QO5A 4YRKA 1X55A 3VQWA 1JJCA 4J15A 3OMLA 2ZIMA 4HWPA 4DV0E 2ZT8A 4YRMA 3HY0A 3J81C 2E5LE 4DR4E 5T6JA 3MSWA 4DUYE 1LYLA 2ARSA 2J3LA 5F5WA 1ADYA 2DDZA 2L33A 3NETA 5K1XA 2L2NA 3RKXA 2ZT5A 4JI8E 1EIYB 3UH0A 1GZ6A 2E1MA 4R8OA 3JU0A 1N33E 2DXTA 1X54A 4E51A 3DSQA 4X66E 1STUA 4DV3E 3RF1A 1Z7NA 4XEOA 1SR9A 4P78A 2ARTA 4RMFA 1E1TA 1G5IA 4YCVA 1KMMA 4LU9A 1QF6A 2ALYB 1QU6A 3MEYA 4YRTA 4P3NA 2LRSA 1YB3A 2AMCB 4DV1E 1YFTA 3QO8A 4YY3E 3L4GB 3HXZA 1PKPA 2KOUA 1ATIA 1PYSB 1RIQA 4XEMA 2E64A 2DJZA 4LFCE 1WQ7A 2EL9A 4H2XB 5IT9C 4JI4E 4X65E 4XTUA 3IKLA 3NELA 2JY9A 2DZCA 2DIXA 3AV0A 3VQXA 3OTOE 2ZR2A 4BC9A 5F3WA 5C52B 4BCAA 4B3ME 2EZ6A 2DEQA 3JTZA 4GEQB 4CH5A 4HWRA 2YZTA 2EWLA 2B7VA 5LMNE 2J3MA 5CFFE 4H2UA 4EO4A 2ZXFA 1FJGE 4LF5E 1J26A 3QTCA 1RQ0A 5FLXC 3A74A 2FV4B 4H2SA 2LE2A 2Q7GA 2RS7A 2C7IA 2DVEA 1WNLA 1NNHA 4H2VA 3V8LA 1GQEA 4UPAA 1H4TA 4JI2E 2DSYA 5AE3A 2WZOA 2EJ9A 2NS6A 4TUGA 1VQZA 4DR7E 2ZGWA 2L6MA 3UGQA 4X5OA 2E5AA 4XU2A 2CJAA 1X48A 3JAMC 2EJGA 3KWRA 4P72A 4JI0E 1JJCB 3ICAA 2YT4A 2E1HA 4DMIA 2V87A 4YRFA 1GGMA 4P73C 4YRLA 3K6QA 4L8NA 4WFTA 2QHVA 1H4QA 2ZT7A 4XTYA 4NCXA 2L3JA 3P8TA 3REXA 2ZIOA 2ZT6A 4TTVA 1UHZA 2NUFA 3HXXA 4HA8A 2ZZFA 3QNEA 4K0KE 2M7QA 1RC7A 1XMOE 2RS6A 2JVAA 2B9DA 3IWCA 2JOXA 2CGHA 2NUEA 2CJBA 1G5HA 4K88A 5ELOA 1B7YA 4ZTUB 2V86A 3P1XA 2N3GA 2PMEA 2LUPB 5DNYA 3F6GA 4UP7A 1HXDA 2DTIA 3HRIA 1BBUA 3HFVA 3DF6A 3ERRA 4X8WA 3IKMB 5AE1A 4BW9A 2DQ0A 2ZZEA 1WU7A 4CS2A 4GKKE 4GKJE 4WI1A 1USYA 3VQVA 2RHQA 3HTZA 4XTVA 4P75A 3A32A 4Q15A 2ZNIA 3NEMA 2Q7EA 2KHXA 2L2MA 4LF4E 2ZCEA 2MC6A 4JI6E 1X2GA 2DTHA 4OOGC 2DQ3A 3BJUA 3P8VA 4XU0A 4YRQA 2UXDE 3TEHA 3G1ZA 1E1OA 4DV2E 4DV6E 3RKWA 3V7RA 1IBKE 1HC7A 1FKAE 4YRJA 4PG3A 4H02A 2I4MA 4TVAA 1HR0E 2V88A 2ZZGA 4NXNE 1T4LB 4Q28A 3E9HA 4BBYA 1DI2A 4P7DA 1X01A 3MF1A 3FIGA 4BC7A 4DQ2A 4R03A 4LF6E 3ADLA 2C8MA 3HY1A 4CS4A 1SRYA 3IALA 4LVKA 1YYWA 4HT4A 3J7AG 3UFGA 3LLHA 4LNSA 4KQEA 4P74A 2V85A 4LFAE 2V83A 4LF9E 4EX5A 4LFBE 4CH4A 2FYKA 3RGLA 4YP0A 4PHCA 1KOGA 5ELNA 4LVMA 3DJWA 4P71A 1I94E 12ASA 4B3TE 3HPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMF A;  4WJ4 A;  4L87 A;  4YPF A;  4YRG A;  4RDX A;  2QHS A;  4YRI A;  1SES A;  4WF2 A;  3A7R A;  1WLE A;  4K87 A;  1B8A A;  3LSQ A;  4YRS A;  2QHT A;  1B70 A;  4TVW A;  4G85 A;  4H2Y A;  1X56 A;  4H2W A;  4RQE A;  2E65 A;  4AH6 A;  2IY5 B;  3L4G A;  4P72 C;  1B7Y B;  4BWA A;  2P5I A;  3PZC A;  3HXU A;  1FYF A;  4CH3 A;  2EAY A;  3RAC A;  1E24 A;  3R07 A;  5HGQ A;  1EVK A;  1EVL A;  2ZR3 A;  2AKW A;  3IG2 A;  3A7U A;  2G4C A;  2RHQ B;  3EFR A;  1SET A;  4HVC A;  1H4S A;  1HTT A;  2EJF A;  1C0A A;  3RL6 A;  4YRP A;  4YCW A;  2ARU A;  4YRO A;  3M4Q A;  2CIM A;  4H2T A;  3HRK A;  1YFS A;  1X2H A;  3TEH B;  3A5Z A;  4YRE A;  4TVA B;  4YCU A;  2XTI A;  1WYD A;  1USY C;  1QE0 A;  4P75 C;  2P0L A;  2E3C A;  3A7A A;  1Z7M A;  1ASZ A;  1ASY A;  1EOV A;  4UP9 A;  2DXU A;  5C53 B;  3W3S A;  4TVY A;  3OD1 A;  1E22 A;  1NYR A;  1W66 A;  3RKY A;  1G51 A;  1BBW A;  1L0W A;  2RHS A;  3PCO A;  1EQR A;  3EFS A;  3L1A A;  3REU A;  4ZIB A;  2I4O A;  2ZIN A;  4XTZ A;  4HWO A;  4CS3 A;  1ADJ A;  4WJ3 M;  1NJ6 A;  2Q7H A;  3LSS A;  4YRN A;  4G84 A;  4ZTZ B;  3E9I A;  1B70 B;  1N9W A;  2DZ9 A;  4P74 C;  4Q6G A;  3HFZ A;  2ZNJ A;  4YRC A;  1BIA A;  4OLF A;  4O2D A;  4TQD A;  4P71 C;  1NJ8 A;  4XTX A;  3UGT A;  3A5Y A;  1WPY A;  3RIR A;  3HXV A;  2XGT A;  3HXW A;  1EFW A;  3VBB A;  4KR3 A;  2Q5H A;  4XTW A;  1IL2 A;  1BIB A;  1EIY A;  4RQF A;  4K86 A;  2Q5I A;  3V8J A;  3FJP A;  2AKW B;  3LC0 A;  4UP8 A;  1H4V B;  5K1P A;  11AS A;  3MF2 A;  3HXY A;  2ALY A;  2E10 A;  4P3O A;  3QO7 A;  2ZTG A;  3L2Z A;  2AMC A;  4HWT A;  4DPG A;  2QHU A;  2EWN A;  3CMQ A;  3WQZ A;  1PYS A;  2DU5 A;  3I7F A;  2DTO A;  3A31 A;  3V7C A;  4H2X A;  1B76 A;  1NJ5 A;  3M4P A;  1NJ2 A;  4XU1 A;  5E3I A;  5KNN A;  2E41 A;  3VQY A;  2DU7 A;  1YGB A;  3TUP A;  4P3P A;  3V8K A;  4OP0 A;  2ODR D;  1WQW A;  4YDQ A;  4YYE A;  1KMN A;  4HWS A;  4YRR A;  2CJ9 A;  4TWA A;  2I4L A;  4TQF A;  1NYQ A;  2RHS B;  3PCO B;  4XU3 A;  2DKG A;  4P73 A;  3TEG A;  3BFM A;  3V7S A;  3NEN A;  4CH6 A;  2ODR C;  5C51 B;  3P8Y A;  3RUX A;  2HNI A;  3KFU A;  1SER A;  2IY5 A;  1J5W A;  2I4N A;  3HFZ B;  1YFR A;  1NJ1 A;  3QO5 A;  4YRK A;  1X55 A;  3VQW A;  1JJC A;  4J15 A;  2ZIM A;  4HWP A;  2ZT8 A;  4YRM A;  3HY0 A;  1LYL A;  2ARS A;  2J3L A;  5F5W A;  1ADY A;  2DDZ A;  3NET A;  5K1X A;  3RKX A;  2ZT5 A;  1EIY B;  3UH0 A;  2DXT A;  1X54 A;  4E51 A;  3DSQ A;  3RF1 A;  1Z7N A;  4XEO A;  2ART A;  4RMF A;  1E1T A;  1G5I A;  4YCV A;  1KMM A;  1QF6 A;  2ALY B;  3MEY A;  4YRT A;  4P3N A;  1YB3 A;  2AMC B;  1YFT A;  3QO8 A;  3L4G B;  3HXZ A;  1ATI A;  1PYS B;  1RIQ A;  4XEM A;  2E64 A;  2DJZ A;  2EL9 A;  1WQ7 A;  4H2X B;  4XTU A;  3IKL A;  3NEL A;  2DZC A;  3VQX A;  2ZR2 A;  5C52 B;  2DEQ A;  4CH5 A;  4HWR A;  2J3M A;  4H2U A;  4EO4 A;  2ZXF A;  3QTC A;  3A74 A;  4H2S A;  2Q7G A;  2C7I A;  2DVE A;  1WNL A;  1NNH A;  4H2V A;  3V8L A;  4UPA A;  1H4T A;  2EJ9 A;  1VQZ A;  2ZGW A;  3UGQ A;  4X5O A;  2E5A A;  4XU2 A;  2CJA A;  2EJG A;  4P72 A;  1JJC B;  3ICA A;  2E1H A;  4YRF A;  1GGM A;  4P73 C;  4YRL A;  2QHV A;  1H4Q A;  2ZT7 A;  4XTY A;  4NCX A;  3P8T A;  3REX A;  2ZIO A;  2ZT6 A;  4TTV A;  3HXX A;  4HA8 A;  2ZZF A;  3QNE A;  2CGH A;  2CJB A;  1G5H A;  4K88 A;  5ELO A;  1B7Y A;  4ZTU B;  2PME A;  4UP7 A;  1HXD A;  2DTI A;  3HRI A;  1BBU A;  3HFV A;  3ERR A;  4BW9 A;  3IKM B;  2DQ0 A;  2ZZE A;  1WU7 A;  4CS2 A;  4WI1 A;  1USY A;  3VQV A;  2RHQ A;  3HTZ A;  4XTV A;  4P75 A;  3A32 A;  4Q15 A;  2ZNI A;  3NEM A;  2Q7E A;  2ZCE A;  1X2G A;  2DTH A;  2DQ3 A;  3BJU A;  3P8V A;  4XU0 A;  4YRQ A;  3TEH A;  3G1Z A;  1E1O A;  3RKW A;  3V7R A;  1HC7 A;  4YRJ A;  4PG3 A;  4H02 A;  2I4M A;  4TVA A;  2ZZG A;  3E9H A;  1X01 A;  3MF1 A;  4DQ2 A;  2C8M A;  3HY1 A;  4CS4 A;  1SRY A;  3IAL A;  3UFG A;  4LNS A;  4KQE A;  4P74 A;  4EX5 A;  4CH4 A;  2FYK A;  3RGL A;  4YP0 A;  4PHC A;  1KOG A;  5ELN A;  4P71 A;  12AS A;  4KR2 A; 
#chains in the Genus database with same CATH topology
 2PMF A;  2NA2 A;  4LVI A;  4WJ4 A;  2D9H A;  2LUQ A;  4L87 A;  1N32 E;  4M2Z A;  4YPF A;  4YRG A;  5IXM B;  4NHR A;  2QHS A;  1BB8 A;  4RDX A;  3VYX A;  1YYK A;  2EMA A;  2EM6 A;  4YRI A;  4LVJ A;  1SES A;  4WF2 A;  3A7R A;  2YU5 A;  4ZYD A;  1WLE A;  4K87 A;  4X62 E;  1HNZ E;  2EOO A;  2YTF A;  2DGC A;  1B8A A;  3LSQ A;  2WBT A;  2LT7 A;  4YRS A;  2QHT A;  1B70 A;  2V8Q B;  2WCC 3;  3BF2 A;  4TVW A;  4G85 A;  4DR6 E;  4H2Y A;  2EJ4 A;  4KZS A;  1X56 A;  1AAY A;  1XNQ E;  4H2W A;  2EPU A;  2JYA A;  4RQE A;  2E65 A;  3EQ1 A;  2VF1 A;  4MLV A;  1X3C A;  2EMC A;  2V89 A;  4AH6 A;  3EPJ A;  3L4G A;  1B7Y B;  4P72 C;  2IY5 B;  4BWA A;  2P5I A;  2L3C A;  1UBD C;  3QG5 C;  4WSP A;  1X6H A;  4I8O A;  3PZC A;  3HXU A;  1N34 E;  3EPK A;  4J8Z A;  4Q35 B;  1FYF A;  4AQY E;  2YPN A;  4CH3 A;  4WSG A;  2EMW A;  2EAY A;  2L8T A;  2VE7 C;  1E24 A;  3RAC A;  3R07 A;  1XMQ E;  2F4V E;  2EM0 A;  1RMD A;  1YZ9 A;  3C4B A;  5HGQ A;  1EVK A;  1EVL A;  2ZR3 A;  2AKW A;  1A1H A;  3IG2 A;  3A7U A;  2R1F A;  5LL6 R;  2G4C A;  2F8B A;  2EM5 A;  2RHQ B;  3H09 A;  3EFR A;  1SET A;  2DB2 A;  4HVC A;  4HEI A;  4F54 A;  1H4S A;  2UU9 E;  1HTT A;  4R2A A;  5IWA E;  2EOJ A;  3KZY A;  2UUA E;  2EPR A;  2EJF A;  1C0A A;  2EN2 A;  2EMX A;  4O24 A;  3RL6 A;  4YRP A;  1WXR A;  2YTQ A;  2I13 A;  4YCW A;  1WHQ A;  1YYO A;  2GLI A;  2ARU A;  4YRO A;  2EN3 A;  3M4Q A;  3THN A;  2CIM A;  2FTX B;  1O0W A;  4H2T A;  4BMJ A;  1QNT A;  1YFS A;  3HRK A;  1X2H A;  3TEH B;  2YSO A;  3A5Z A;  4LF7 E;  5E3I A;  4YRE A;  2LJH A;  3THO B;  1ZBT A;  1KJK A;  2VRD A;  2EN6 A;  3KZZ A;  4JV5 E;  4DR1 E;  4TVA B;  2EML A;  2HHH E;  2M1S A;  4YCU A;  3ADG A;  3HXL A;  2IHR 1;  2H36 X;  2L2K B;  2YTI A;  2XTI A;  2J7J A;  3ECR A;  1WYD A;  2YTD A;  1X6F A;  5AE2 A;  2RPC A;  4IJD A;  1T4N A;  1USY C;  3J80 C;  4WYQ B;  1AH5 A;  4LVL A;  5ADZ A;  2RTX A;  1JK2 A;  4OX9 E;  3VYY A;  1QE0 A;  2P0L A;  2E3C A;  3A7A A;  4JI1 E;  4P75 C;  1Z7M A;  1ASZ A;  2LMZ A;  1ASY A;  2MDR A;  4DR3 E;  2ADR A;  1EOV A;  2JR1 A;  4KHP E;  4UP9 A;  3LML A;  2DXU A;  5AC4 A;  5C53 B;  1YSA C;  3W3S A;  2EM2 A;  4BHB A;  4TVY A;  1WHN A;  2UUB E;  5AAS A;  1E22 A;  3OD1 A;  2DMI A;  1P47 A;  1NYR A;  1W66 A;  3RKY A;  1BBO A;  1G51 A;  4DR5 E;  1T4O A;  2L92 A;  1BBW A;  1L0W A;  1X47 A;  4R2C A;  2RHS A;  3PCO A;  1EQR A;  3EFS A;  3L1A A;  3REU A;  4ZIB A;  1ZAA C;  2JP9 A;  2I4O A;  2ZIN A;  4O4K A;  5BR8 E;  1J5E E;  2M9A A;  4XTZ A;  4HWO A;  2UXB E;  4CS3 A;  3ZOQ B;  3BGH A;  1ADJ A;  4WJ3 M;  2EM3 A;  4WX9 A;  1NJ6 A;  2Q7H A;  2CPN A;  2EM9 A;  1ZU1 A;  2EMG A;  3LSS A;  3AUZ A;  1PJT A;  5KL5 A;  3T1Y E;  3HTX A;  4G84 A;  4YRN A;  1ZBQ A;  3C4T A;  4F9C B;  2JOB A;  3E9I A;  4ZTZ B;  1B70 B;  1N9W A;  2EM8 A;  2DZ9 A;  4P74 C;  4DV7 E;  4JI5 E;  1WRJ A;  2EOF A;  1X5W A;  4Q6G A;  3BBG A;  3HFZ A;  4F9A B;  2EM4 A;  2ZNJ A;  1HNW E;  3ADJ A;  4YRC A;  3ADI A;  1GTK A;  2PRT A;  3EPH A;  1BIA A;  4DV4 E;  4L5N C;  3RMP A;  4OLF A;  4JYA E;  3HPZ A;  4O2D A;  2EPO A;  4WPY A;  5KL2 A;  4NXM E;  4TQD A;  4P71 C;  1NJ8 A;  4X9J A;  4XTX A;  3UGT A;  4RHB B;  1WPY A;  5KL7 A;  2NUG A;  3T1H E;  3A5Y A;  3RIR A;  3HXV A;  2EOE A;  2ELY A;  4BS9 A;  4X64 E;  2XGT A;  3HXW A;  1EFW A;  4DV5 E;  3VBB A;  3UK3 C;  4KR3 A;  4LTY A;  2JXP A;  2Q5H A;  1A1I A;  4XTW A;  3IWB A;  4B3R E;  3J7Y p;  2VQF E;  2EOY A;  4ZYE A;  1BIB A;  4RQF A;  4K86 A;  2VQE E;  1EIY A;  2UUC E;  1IL2 A;  2Q5I A;  2YRH A;  3V8J A;  5LLQ A;  1PDA A;  3FJP A;  2RQL A;  2AKW B;  2LTS A;  3LC0 A;  5A6B A;  4JI3 E;  2EQ3 A;  2A8E A;  4UP8 A;  2K4V A;  4JI7 E;  1H4V B;  2EPL X;  1A1L A;  1IBL E;  5K1P A;  11AS A;  3MF2 A;  1BBG A;  3HXY A;  1UIL A;  2MKN A;  2ALY A;  2JWO A;  2MC5 A;  3F6H A;  3EPL A;  2B3T B;  4WXC A;  2E10 A;  3QO7 A;  4P3O A;  2YTJ A;  2ZTG A;  3L2Z A;  2AMC A;  4HWT A;  4DPG A;  4F9B B;  2QHU A;  2EWN A;  2LBS B;  1JK1 A;  3CMQ A;  2EPK X;  3WQZ A;  1PYS A;  3HQ1 A;  2HJJ A;  2EOQ A;  2DU5 A;  3I7F A;  2LCE A;  4M30 A;  2DTO A;  2M4I A;  2BB8 A;  3A31 A;  2FGG A;  3V7C A;  2UXC E;  2EMK A;  1B76 A;  1X6E A;  1NJ2 A;  1UN6 B;  1NJ5 A;  3M4P A;  4H2X A;  4XU1 A;  2EOM A;  2YWQ A;  2EPZ A;  3C6M A;  4BHC A;  2ZM6 E;  4F6N A;  1T39 A;  1IQO A;  5KNN A;  1IBM E;  2E41 A;  3BID A;  1XNR E;  3VQY A;  1MGT A;  5LMU E;  2ENC A;  2DU7 A;  1YGB A;  3TUP A;  2LTR A;  5A2Q C;  2G7H A;  4P3P A;  3L00 A;  2CT1 A;  3V8K A;  4DKK A;  4M0V A;  4OP0 A;  2ODR D;  1WQW A;  1DQ3 A;  1HNX E;  2RSM A;  1EKZ A;  4YDQ A;  3IWD A;  4LF8 E;  4R2R A;  4YYE A;  2DMY A;  1KMN A;  4HWS A;  2CSH A;  4YRR A;  2CJ9 A;  2N3H A;  4TWA A;  2EN4 A;  4F2J C;  2HGH A;  1IQS A;  2I4L A;  4TQF A;  1NYQ A;  2B7T A;  2RHS B;  3PCO B;  4XU3 A;  4R2P A;  2DKG A;  4DR2 E;  3M99 B;  4ZYH A;  4P73 A;  3TEG A;  4YHH E;  3BFM A;  2HC5 A;  4NZV A;  3V7S A;  3NEN A;  1KYQ A;  4DUZ E;  2LV2 A;  1X49 A;  4B3S E;  2EQ1 A;  4CH6 A;  2ODR C;  5C51 B;  4KR2 A;  3P8Y A;  3RUX A;  2HNI A;  2KON A;  1SER A;  3KFU A;  2IY5 A;  2EPX A;  1N36 E;  1J5W A;  3VK6 A;  2EN7 A;  2I4N A;  3HFZ B;  1YFR A;  1NJ1 A;  2ENH A;  4TUI A;  3MQZ A;  3QO5 A;  4YRK A;  1X55 A;  3VQW A;  1JJC A;  4J15 A;  3OML A;  2ZIM A;  4HWP A;  4HTG A;  4O5G A;  4DV0 E;  2ZT8 A;  4YRM A;  3HY0 A;  2YTO A;  3J81 C;  2EL4 A;  4WXD A;  2E5L E;  4DR4 E;  2ENA A;  2RSI A;  3MSW A;  5T6J A;  4DUY E;  1LYL A;  2ARS A;  2J3L A;  5F5W A;  1ADY A;  2DDZ A;  2L33 A;  1TF3 A;  3NET A;  5K1X A;  2L2N A;  3RKX A;  2ZT5 A;  2EOS A;  2YRM A;  4JI8 E;  1EIY B;  4MLQ A;  1GZ6 A;  2E1M A;  4R8O A;  2I9I A;  3JU0 A;  1N33 E;  2DXT A;  3UH0 A;  1X54 A;  4E51 A;  3DSQ A;  4X66 E;  1STU A;  2EOX A;  4DV3 E;  1G2F C;  1Z7N A;  4XEO A;  3RF1 A;  1SR9 A;  4P78 A;  1N3G A;  2ART A;  3MHH C;  1E1T A;  1G5I A;  4RMF A;  4YCV A;  5A6B D;  5TSE A;  1KMM A;  4LU9 A;  1QF6 A;  2ALY B;  1QU6 A;  5A6K A;  3MEY A;  4YRT A;  1YUJ A;  1DGC A;  4P3N A;  2LRS A;  1YB3 A;  4KWY A;  2AMC B;  4DV1 E;  1YFT A;  3QO8 A;  4YY3 E;  3L4G B;  2R76 A;  3HXZ A;  1PKP A;  2KOU A;  1ATI A;  1PYS B;  1RIQ A;  4XEM A;  2E64 A;  3VHT B;  2MDG A;  2DJZ A;  1EH8 A;  2EMH A;  4LFC E;  1WQ7 A;  5IT9 C;  2EL9 A;  4JI4 E;  4H2X B;  4X65 E;  4XTU A;  2EMY A;  3IKL A;  3NEL A;  1T38 A;  2JY9 A;  2DZC A;  2DIX A;  3AV0 A;  3VQX A;  2EPP A;  3OTO E;  2ZR2 A;  4BC9 A;  5F3W A;  5C52 B;  2CTD A;  4BCA A;  4B3M E;  2EZ6 A;  2DEQ A;  3JTZ A;  1EH7 A;  4GEQ B;  4CH5 A;  4HWR A;  1TF6 A;  2YZT A;  2EWL A;  2B7V A;  2EPA A;  5LMN E;  1WJP A;  2J3M A;  5CFF E;  2EE8 A;  2NAB A;  4H2U A;  4EO4 A;  2ZXF A;  1B69 A;  4LF5 E;  1FJG E;  2EOR A;  1J26 A;  2EPC A;  1A1J A;  1A1F A;  3QTC A;  4IS1 C;  1RQ0 A;  1SFE A;  5FLX C;  3A74 A;  2FV4 B;  4H2S A;  1PJS A;  2LE2 A;  2YTN A;  2RS7 A;  1Z1B A;  2C7I A;  2DVE A;  1WNL A;  2Q7G A;  1NNH A;  4H2V A;  3V8L A;  5IV8 B;  4O43 A;  3TQM A;  4R2S A;  1GQE A;  2DLK A;  4UPA A;  1H4T A;  2YU8 A;  4JI2 E;  2DSY A;  5AE3 A;  2WZO A;  2EJ9 A;  2NS6 A;  1MEY C;  4R2Q A;  4TUG A;  1VQZ A;  4DR7 E;  2ZGW A;  4GZN C;  2L6M A;  2YRK A;  3UGQ A;  4X5O A;  2EN1 A;  1TN9 A;  2E5A A;  4XU2 A;  4LNS A;  2EMF A;  2CJA A;  1A1G A;  1X48 A;  3JAM C;  3MHS C;  2EJG A;  3KWR A;  4P72 A;  4JI0 E;  1JJC B;  3ICA A;  2YT4 A;  2E1H A;  4DMI A;  4RH8 A;  2V87 A;  5A69 A;  4YRF A;  1GGM A;  5AC5 A;  4P73 C;  4YRL A;  3K6Q A;  4L8N A;  4WFT A;  2EMZ A;  2QHV A;  1H4Q A;  2ZT7 A;  4XTY A;  4NCX A;  2L3J A;  3P8T A;  2YSP A;  2ZIO A;  3REX A;  2ZT6 A;  4TTV A;  1UHZ A;  4R2D A;  2NUF A;  3HXX A;  2JPA A;  4HA8 A;  2ZZF A;  2EOZ A;  3QNE A;  2EPN A;  2BBG A;  4K0K E;  2M7Q A;  1RC7 A;  5KL6 A;  1XMO E;  4N4R B;  2RS6 A;  2JVA A;  2B9D A;  3IWC A;  2EQ0 A;  2JOX A;  2CGH A;  2NUE A;  1EH6 A;  2Q8U A;  2EOH A;  2CJB A;  2EN8 A;  2EL6 A;  2GPI A;  1F2I G;  2YTP A;  2YTG A;  1G5H A;  4K88 A;  5ELO A;  2K7I A;  1B7Y A;  4ZTU B;  2N8X A;  2LJU A;  2V86 A;  2YTE A;  2EPM X;  3P1X A;  1YUI A;  2N3G A;  2PME A;  2LUP B;  5DNY A;  3F6G A;  4UP7 A;  1HXD A;  1YFH A;  2DTI A;  2LO3 A;  3HRI A;  1BBU A;  3HFV A;  3DF6 A;  1A1K A;  3ERR A;  4X8W A;  3IKM B;  5AE1 A;  4BW9 A;  2DQ0 A;  5KL4 A;  2ZZE A;  1WU7 A;  1L4S A;  2DRP A;  4CS2 A;  4GKK E;  4GKJ E;  4WI1 A;  1USY A;  3VQV A;  2RHQ A;  3HTZ A;  4R2E A;  4P75 A;  4XTV A;  3A32 A;  4Q15 A;  2ZNI A;  3NEM A;  2Q7E A;  2KHX A;  2L2M A;  4M9V C;  4LF4 E;  2ZCE A;  2WBS A;  2MC6 A;  4JI6 E;  2WBU A;  1X2G A;  4FK5 C;  4OOG C;  2DTH A;  2DQ3 A;  5A6A A;  3BJU A;  3P8V A;  4XU0 A;  4YRQ A;  2UXD E;  1NEI A;  1LLM C;  3G1Z A;  3TEH A;  1E1O A;  4DV2 E;  4DV6 E;  3RKW A;  3V7R A;  5A6J A;  1IBK E;  1HC7 A;  1FKA E;  4YRJ A;  4PG3 A;  2EMB A;  4H02 A;  2I4M A;  4TVA A;  4ZYG A;  2E72 A;  1HR0 E;  2LVH A;  1IMU A;  2V88 A;  2ZZG A;  4NXN E;  1T4L B;  4Q28 A;  3E9H A;  4BBY A;  1G2D C;  1DI2 A;  2MKD A;  4P7D A;  1X01 A;  3MF1 A;  3FIG A;  1YPN A;  4BC7 A;  4DQ2 A;  4R03 A;  4LF6 E;  3ADL A;  2C8M A;  4F6M A;  3HY1 A;  2ELZ A;  2EM7 A;  4CS4 A;  1SRY A;  3IAL A;  5KL3 A;  4LVK A;  1YYW A;  4HT4 A;  3J7A G;  3UFG A;  1ZR9 A;  2EOI A;  3C6K A;  2A25 A;  3LLH A;  2V85 A;  4LFA E;  2GHF A;  2V83 A;  4KQE A;  4P74 A;  4LF9 E;  2EMI A;  4EX5 A;  4LFB E;  1NCS A;  2EL5 A;  2DLQ A;  4CH4 A;  2FYK A;  3RGL A;  2EP3 A;  4YP0 A;  4PHC A;  1KOG A;  5ELN A;  4LVM A;  3DJW A;  4P71 A;  1I94 E;  12AS A;  1PJQ A;  4B3T E;  3HPS A; 
#chains in the Genus database with same CATH homology
 2PMF A;  2NA2 A;  4LVI A;  4WJ4 A;  2LUQ A;  4L87 A;  1N32 E;  4M2Z A;  4YPF A;  4YRG A;  4RDX A;  2QHS A;  4LVJ A;  3VYX A;  1YYK A;  4YRI A;  1SES A;  4WF2 A;  3A7R A;  1WLE A;  4K87 A;  4X62 E;  1HNZ E;  1B8A A;  3LSQ A;  4YRS A;  2QHT A;  1B70 A;  2V8Q B;  4TVW A;  4G85 A;  4DR6 E;  4H2Y A;  4KZS A;  1X56 A;  1XNQ E;  4H2W A;  4RQE A;  2E65 A;  2VF1 A;  4AH6 A;  2IY5 B;  2V89 A;  3L4G A;  4P72 C;  1B7Y B;  4BWA A;  2P5I A;  2L3C A;  4WSP A;  3PZC A;  4I8O A;  3HXU A;  1N34 E;  4J8Z A;  1FYF A;  4AQY E;  4CH3 A;  2EAY A;  2L8T A;  2VE7 C;  1E24 A;  3RAC A;  3R07 A;  1XMQ E;  2F4V E;  1YZ9 A;  3C4B A;  5HGQ A;  1EVK A;  1EVL A;  2ZR3 A;  2AKW A;  3IG2 A;  3A7U A;  5LL6 R;  2G4C A;  2F8B A;  2RHQ B;  3H09 A;  3EFR A;  1SET A;  2DB2 A;  4HVC A;  4F54 A;  1H4S A;  2UU9 E;  1HTT A;  5IWA E;  2UUA E;  2EJF A;  1C0A A;  3RL6 A;  4YRP A;  1WXR A;  4YCW A;  1WHQ A;  1YYO A;  2ARU A;  4YRO A;  3M4Q A;  2CIM A;  2FTX B;  1O0W A;  4H2T A;  4BMJ A;  3HRK A;  1YFS A;  1X2H A;  3TEH B;  3A5Z A;  4LF7 E;  4YRE A;  2LJH A;  1ZBT A;  4JV5 E;  4DR1 E;  4TVA B;  2HHH E;  2M1S A;  4YCU A;  3ADG A;  3HXL A;  2IHR 1;  2H36 X;  2L2K B;  2XTI A;  1WYD A;  5AE2 A;  1T4N A;  1USY C;  3J80 C;  4WYQ B;  4LVL A;  5ADZ A;  2RTX A;  4OX9 E;  1QE0 A;  3VYY A;  4P75 C;  2P0L A;  2E3C A;  3A7A A;  4JI1 E;  1Z7M A;  1ASZ A;  2LMZ A;  1ASY A;  2MDR A;  4DR3 E;  1EOV A;  2JR1 A;  4KHP E;  4UP9 A;  3LML A;  2DXU A;  5C53 B;  3W3S A;  4TVY A;  1WHN A;  2UUB E;  5AAS A;  1E22 A;  3OD1 A;  1NYR A;  1W66 A;  3RKY A;  1G51 A;  4DR5 E;  1T4O A;  2L92 A;  1BBW A;  1L0W A;  1X47 A;  2RHS A;  3PCO A;  1EQR A;  3EFS A;  3L1A A;  3REU A;  4ZIB A;  2I4O A;  2ZIN A;  5BR8 E;  1J5E E;  4XTZ A;  4HWO A;  2UXB E;  4CS3 A;  3ZOQ B;  1ADJ A;  4WJ3 M;  1NJ6 A;  2Q7H A;  2CPN A;  3LSS A;  3AUZ A;  4YRN A;  3T1Y E;  3HTX A;  4G84 A;  1ZBQ A;  3C4T A;  4F9C B;  2JOB A;  3E9I A;  4ZTZ B;  1B70 B;  1N9W A;  2DZ9 A;  4P74 C;  4DV7 E;  4JI5 E;  4Q6G A;  3HFZ A;  4F9A B;  2ZNJ A;  1HNW E;  3ADJ A;  4YRC A;  3ADI A;  1BIA A;  4DV4 E;  4L5N C;  3RMP A;  4OLF A;  4JYA E;  3HPZ A;  4O2D A;  4WPY A;  4NXM E;  4TQD A;  4P71 C;  1NJ8 A;  4XTX A;  3UGT A;  3A5Y A;  1WPY A;  2NUG A;  3RIR A;  3T1H E;  3HXV A;  2XGT A;  4BS9 A;  4X64 E;  3HXW A;  1EFW A;  4DV5 E;  3VBB A;  4KR3 A;  4LTY A;  2Q5H A;  4XTW A;  3IWB A;  4B3R E;  3J7Y p;  2VQF E;  1IL2 A;  1BIB A;  1EIY A;  4RQF A;  4K86 A;  2VQE E;  2UUC E;  2Q5I A;  3V8J A;  3FJP A;  2AKW B;  2LTS A;  3LC0 A;  4JI3 E;  2A8E A;  4UP8 A;  2K4V A;  4JI7 E;  1H4V B;  5K1P A;  1IBL E;  11AS A;  3MF2 A;  3HXY A;  1UIL A;  2ALY A;  2JWO A;  2MC5 A;  3F6H A;  2E10 A;  2B3T B;  4P3O A;  3QO7 A;  2ZTG A;  3L2Z A;  2AMC A;  4HWT A;  4DPG A;  4F9B B;  2QHU A;  2EWN A;  2LBS B;  3CMQ A;  3WQZ A;  1PYS A;  3HQ1 A;  2DU5 A;  3I7F A;  4M30 A;  2DTO A;  2M4I A;  3A31 A;  2FGG A;  3V7C A;  2UXC E;  1B76 A;  1NJ5 A;  3M4P A;  1NJ2 A;  4H2X A;  4XU1 A;  5E3I A;  2ZM6 E;  5KNN A;  1IBM E;  2E41 A;  1XNR E;  3VQY A;  5LMU E;  2DU7 A;  1YGB A;  3TUP A;  2LTR A;  5A2Q C;  2G7H A;  4P3P A;  3V8K A;  4DKK A;  4M0V A;  4OP0 A;  2ODR D;  1WQW A;  1DQ3 A;  1HNX E;  2RSM A;  1EKZ A;  4YDQ A;  3IWD A;  4LF8 E;  4YYE A;  2DMY A;  1KMN A;  4HWS A;  4YRR A;  2CJ9 A;  2N3H A;  4TWA A;  2I4L A;  4TQF A;  1NYQ A;  2B7T A;  2RHS B;  3PCO B;  4XU3 A;  2DKG A;  4DR2 E;  4P73 A;  3TEG A;  4YHH E;  3BFM A;  3V7S A;  3NEN A;  4DUZ E;  1X49 A;  4B3S E;  4CH6 A;  2ODR C;  5C51 B;  4KR2 A;  3P8Y A;  3RUX A;  2HNI A;  2KON A;  1SER A;  3KFU A;  2IY5 A;  1N36 E;  1J5W A;  3VK6 A;  2I4N A;  3HFZ B;  1YFR A;  1NJ1 A;  4TUI A;  3MQZ A;  3QO5 A;  4YRK A;  1X55 A;  3VQW A;  1JJC A;  4J15 A;  3OML A;  2ZIM A;  4HWP A;  4DV0 E;  2ZT8 A;  4YRM A;  3HY0 A;  3J81 C;  2E5L E;  4DR4 E;  5T6J A;  3MSW A;  4DUY E;  1LYL A;  2ARS A;  2J3L A;  5F5W A;  1ADY A;  2DDZ A;  2L33 A;  3NET A;  5K1X A;  2L2N A;  3RKX A;  2ZT5 A;  4JI8 E;  1EIY B;  3UH0 A;  1GZ6 A;  2E1M A;  4R8O A;  3JU0 A;  1N33 E;  2DXT A;  1X54 A;  4E51 A;  3DSQ A;  4X66 E;  1STU A;  4DV3 E;  3RF1 A;  1Z7N A;  4XEO A;  1SR9 A;  4P78 A;  2ART A;  4RMF A;  1E1T A;  1G5I A;  4YCV A;  1KMM A;  4LU9 A;  1QF6 A;  2ALY B;  1QU6 A;  3MEY A;  4YRT A;  4P3N A;  2LRS A;  1YB3 A;  2AMC B;  4DV1 E;  1YFT A;  3QO8 A;  4YY3 E;  3L4G B;  3HXZ A;  1PKP A;  2KOU A;  1ATI A;  1PYS B;  1RIQ A;  4XEM A;  2E64 A;  2DJZ A;  4LFC E;  1WQ7 A;  2EL9 A;  4H2X B;  5IT9 C;  4JI4 E;  4X65 E;  4XTU A;  3IKL A;  3NEL A;  2JY9 A;  2DZC A;  2DIX A;  3AV0 A;  3VQX A;  3OTO E;  2ZR2 A;  4BC9 A;  5F3W A;  5C52 B;  4BCA A;  4B3M E;  2EZ6 A;  2DEQ A;  3JTZ A;  4GEQ B;  4CH5 A;  4HWR A;  2YZT A;  2EWL A;  2B7V A;  5LMN E;  2J3M A;  5CFF E;  4H2U A;  4EO4 A;  2ZXF A;  1FJG E;  4LF5 E;  1J26 A;  3QTC A;  1RQ0 A;  5FLX C;  3A74 A;  2FV4 B;  4H2S A;  2LE2 A;  2Q7G A;  2RS7 A;  2C7I A;  2DVE A;  1WNL A;  1NNH A;  4H2V A;  3V8L A;  1GQE A;  4UPA A;  1H4T A;  4JI2 E;  2DSY A;  5AE3 A;  2WZO A;  2EJ9 A;  2NS6 A;  4TUG A;  1VQZ A;  4DR7 E;  2ZGW A;  2L6M A;  3UGQ A;  4X5O A;  2E5A A;  4XU2 A;  2CJA A;  1X48 A;  3JAM C;  2EJG A;  3KWR A;  4P72 A;  4JI0 E;  1JJC B;  3ICA A;  2YT4 A;  2E1H A;  4DMI A;  2V87 A;  4YRF A;  1GGM A;  4P73 C;  4YRL A;  3K6Q A;  4L8N A;  4WFT A;  2QHV A;  1H4Q A;  2ZT7 A;  4XTY A;  4NCX A;  2L3J A;  3P8T A;  3REX A;  2ZIO A;  2ZT6 A;  4TTV A;  1UHZ A;  2NUF A;  3HXX A;  4HA8 A;  2ZZF A;  3QNE A;  4K0K E;  2M7Q A;  1RC7 A;  1XMO E;  2RS6 A;  2JVA A;  2B9D A;  3IWC A;  2JOX A;  2CGH A;  2NUE A;  2CJB A;  1G5H A;  4K88 A;  5ELO A;  1B7Y A;  4ZTU B;  2V86 A;  3P1X A;  2N3G A;  2PME A;  2LUP B;  5DNY A;  3F6G A;  4UP7 A;  1HXD A;  2DTI A;  3HRI A;  1BBU A;  3HFV A;  3DF6 A;  3ERR A;  4X8W A;  3IKM B;  5AE1 A;  4BW9 A;  2DQ0 A;  2ZZE A;  1WU7 A;  4CS2 A;  4GKK E;  4GKJ E;  4WI1 A;  1USY A;  3VQV A;  2RHQ A;  3HTZ A;  4XTV A;  4P75 A;  3A32 A;  4Q15 A;  2ZNI A;  3NEM A;  2Q7E A;  2KHX A;  2L2M A;  4LF4 E;  2ZCE A;  2MC6 A;  4JI6 E;  1X2G A;  2DTH A;  4OOG C;  2DQ3 A;  3BJU A;  3P8V A;  4XU0 A;  4YRQ A;  2UXD E;  3TEH A;  3G1Z A;  1E1O A;  4DV2 E;  4DV6 E;  3RKW A;  3V7R A;  1IBK E;  1HC7 A;  1FKA E;  4YRJ A;  4PG3 A;  4H02 A;  2I4M A;  4TVA A;  1HR0 E;  2V88 A;  2ZZG A;  4NXN E;  1T4L B;  4Q28 A;  3E9H A;  4BBY A;  1DI2 A;  4P7D A;  1X01 A;  3MF1 A;  3FIG A;  4BC7 A;  4DQ2 A;  4R03 A;  4LF6 E;  3ADL A;  2C8M A;  3HY1 A;  4CS4 A;  1SRY A;  3IAL A;  4LVK A;  1YYW A;  4HT4 A;  3J7A G;  3UFG A;  3LLH A;  4LNS A;  4KQE A;  4P74 A;  2V85 A;  4LFA E;  2V83 A;  4LF9 E;  4EX5 A;  4LFB E;  4CH4 A;  2FYK A;  3RGL A;  4YP0 A;  4PHC A;  1KOG A;  5ELN A;  4LVM A;  3DJW A;  4P71 A;  1I94 E;  12AS A;  4B3T E;  3HPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...