2ODRC

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
679
structure length
468
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPSILNEIYVYDGNVIGIPEKIDDIALKQIMSKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
molecule keywords phosphoseryl-tRNA synthetase
total genus 117
structure length 468
sequence length 679
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
C PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrC01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrC02
4J15A 4HWSA 1ASZA 4CH6A 2RHSA 2ALYA 3EFSA 3E9HA 4TWAA 2DXUA 3REXA 2G4CA 4HWOA 2ZT8A 5K1PA 2I4OA 1QE0A 4YROA 1L0WA 3VQVA 3G1ZA 3LSQA 1H4VB 1SERA 1X2HA 2C7IA 1IL2A 4H02A 1NJ1A 4XU2A 2AMCA 1B7YB 4G84A 1NYQA 2QHSA 4P3NA 4WF2A 3L2ZA 3EFRA 3HXXA 1BIAA 1ATIA 3IALA 3VQYA 2DZ9A 3ERRA 3ICAA 1BBWA 3FJPA 1N9WA 1B76A 3A32A 4YRCA 4OP0A 1EOVA 4XTZA 4HWTA 2ZTGA 1ADYA 4CH3A 1H4TA 1JJCB 4P73C 1YB3A 4BWAA 4RDXA 2ZT6A 2P5IA 2Q7EA 4NCXA 1Z7MA 4RQEA 1B70A 2CIMA 5K1XA 4H2YA 4TQDA 2ZT7A 2QHUA 1NJ6A 1X01A 3RACA 1EIYA 1X55A 2ZGWA 4O2DA 2EAYA 1B7YA 4Q6GA 3MF2A 4KR3A 2DXTA 3L1AA 4XTWA 4YRPA 4BW9A 2CGHA 1ADJA 5HGQA 1E24A 2ARSA 3V8LA 1G5IA 1W66A 1NJ8A 3RKYA 2Q7GA 4XTXA 4TVAB 3HTZA 2CJ9A 12ASA 4P3OA 4XTYA 1SRYA 2ZZEA 4TQFA 4HVCA 3MF1A 3RUXA 4YRNA 3PCOA 4ZTZB 2DU5A 4TTVA 2EWNA 1HTTA 2DVEA 2E10A 1BIBA 4HWPA 3HFZB 3TEHB 3V7SA 3HRKA 3V8KA 3QO5A 3QO8A 4YRQA 2I4MA 4YRIA 2EL9A 3V7RA 4RQFA 4YRLA 3HXYA 1HC7A 3DSQA 3I7FA 1SETA 2EJGA 2E65A 3TEGA 4WJ4A 3P8TA 2ZINA 3NETA 4P75A 1NJ5A 3QTCA 3QNEA 4YCUA 4YP0A 2DJZA 4TVYA 4YRJA 3HXZA 4HWRA 2IY5B 1EQRA 3UH0A 3HFZA 3TEHA 4XU1A 3A7RA 4EO4A 2E64A 5F5WA 1H4SA 3RKWA 3RF1A 4E51A 4H2UA 4AH6A 1G5HA 1J5WA 1G51A 2ZXFA 2I4LA 3UGTA 4YRRA 1RIQA 4CS3A 3P8VA 3A7AA 1H4QA 4P73A 4KQEA 4K86A 1LYLA 2C8MA 1SESA 1VQZA 2E41A 4XTVA 4CH4A 1E1OA 1NNHA 4P74A 3IKMB 3M4PA 2PMFA 3QO7A 2ZIOA 1WU7A 1EIYB 3HY0A 4P74C 3PCOB 3VBBA 2I4NA 2RHQB 1EVKA 3IKLA 2Q5HA 2XGTA 2ZZFA 4YRTA 1NJ2A 1USYA 3HY1A 3LC0A 2E1HA 2RHSB 4YRSA 2ZIMA 1YGBA 1WYDA 5C53B 3OD1A 3REUA 3RGLA 3A5YA 4X5OA 3LSSA 2DEQA 4DQ2A 2P0LA 2DQ3A 2DQ0A 2ZCEA 2ZZGA 4XTUA 4G85A 1WLEA 4H2XB 4P75C 4YRMA 1KMMA 3RIRA 3HXWA 4UP9A 2ZR2A 4WJ3M 2E5AA 1ASYA 2PMEA 3HXUA 4UPAA 3HFVA 4YYEA 2Q5IA 3NENA 4H2VA 1C0AA 5E3IA 3BJUA 4PHCA 1E22A 3L4GB 2QHVA 4XEMA 3KFUA 1EVLA 3TUPA 4P71A 4YRFA 2ARUA 1Z7NA 1WPYA 2RHQA 4P72A 4RMFA 2DTIA 4TVWA 1JJCA 4XU0A 4CS2A 3RL6A 2ZR3A 1HXDA 3MEYA 3UFGA 2ARTA 1X2GA 1X54A 3WQZA 2DKGA 3A7UA 4H2XA 2CJAA 2ODRD 1B8AA 2EJFA 4OLFA 4Q15A 4UP8A 5KNNA 1PYSB 3V7CA 1USYC 5C52B 1YFRA 4H2SA 4CS4A 2AMCB 4YRKA 1YFSA 4TVAA 11ASA 4P3PA 4XU3A 3R07A 4P72C 1YFTA 4PG3A 2ZT5A 4UP7A 4ZIBA 2ZNIA 4H2TA 4LNSA 3HXVA 4P71C 4CH5A 3HRIA 2ALYB 4HA8A 3BFMA 3VQXA 3RKXA 1GGMA 2CJBA 4WI1A 4YDQA 2ZNJA 2J3LA 3E9IA 4YCVA 5ELNA 3CMQA 4XEOA 4H2WA 4K87A 5ELOA 2DTOA 3M4QA 4ZTUB 2AKWB 1WNLA 1FYFA 2IY5A 5C51B 1WQ7A 3L4GA 2XTIA 2DU7A 3VQWA 3A74A 3P8YA 4YRGA 1QF6A 3W3SA 2HNIA 1KMNA 3IG2A 3NELA 1B70B 3A31A 1EFWA 2J3MA 1WQWA 4YPFA 2EJ9A 3UGQA 2QHTA 2AKWA 4KR2A 3A5ZA 2ODRC 2DDZA 2DZCA 4L87A 4YREA 1NYRA 1KOGA 1PYSA 2FYKA 4K88A 1BBUA 1X56A 4DPGA 3PZCA 2E3CA 3V8JA 2Q7HA 4YCWA 4EX5A 2DTHA 3NEMA 1E1TA
chains in the Genus database with same CATH superfamily
2VQEE 4J15A 4HWSA 1ASZA 4CH6A 1DGCA 2RHSA 2ALYA 1TF6A 3EFSA 1MGTA 1AH5A 3E9HA 4TWAA 2EPUA 2DXUA 3REXA 3HQ1A 1WHNA 4TUGA 2G4CA 2LUPB 1TN9A 1UILA 4HWOA 3KZYA 2ZT8A 2EN8A 2I4OA 5K1PA 1QE0A 4YROA 1L0WA 3VQVA 2KONA 3G1ZA 3LSQA 1BB8A 1H4VB 1SERA 1X2HA 2EQ0A 4KWYA 3ADLA 4L5NC 2C7IA 1IL2A 4H02A 2EPOA 1TF3A 2LMZA 2M4IA 1GQEA 2EOFA 1NJ1A 4XU2A 2JWOA 2AMCA 4BS9A 2F4VE 1B7YB 1XMOE 4JI8E 4G84A 2V8QB 4HEIA 2YTJA 1NYQA 3RMPA 2F8BA 2QHSA 2CTDA 4P3NA 4WF2A 4DR1E 3L2ZA 1N36E 3EFRA 4J8ZA 3HXXA 1BIAA 2J7JA 3HPZA 1ATIA 3F6HA 3IALA 3VQYA 2DZ9A 3ERRA 3ICAA 4LFBE 1BBWA 3FJPA 2UUAE 2ELZA 2NUEA 1B76A 1N9WA 4JI7E 1QNTA 4LVLA 3A32A 3H09A 2YRKA 4LF9E 3BGHA 4OP0A 4YRCA 1EOVA 2B9DA 3FIGA 3VYXA 3J80C 2MDRA 4XTZA 1B69A 4HWTA 2YU8A 4DV5E 2ZTGA 1A1KA 1ADYA 4X65E 4CH3A 2EOYA 2NABA 2VRDA 4RHBB 1H4TA 3MHHC 4BC7A 2JOBA 2L3JA 4DV0E 1JJCB 4P73C 1T39A 1ZAAC 2Q8UA 5KL7A 1F2IG 2EMBA 2LE2A 1YB3A 4DMIA 4BWAA 4RDXA 2ZT6A 2P5IA 2BBGA 3DJWA 1X3CA 2Q7EA 4NCXA 4LVMA 1Z7MA 3ADGA 1HR0E 4DV1E 4BHCA 1YFHA 4RQEA 2YTFA 1B70A 2CIMA 4LU9A 5K1XA 4H2YA 2RS6A 4TQDA 4BHBA 2IHR1 4LF8E 4DR5E 2QHUA 2ZT7A 2EOQA 1NJ6A 2EN2A 2LTSA 1RMDA 2HJJA 2YT4A 1X01A 3RACA 1EIYA 2WBSA 2EL4A 2LTRA 1X55A 1UBDC 4R2PA 2EPAA 2ZGWA 4O2DA 3P1XA 2EAYA 4LF6E 2YSPA 4JI6E 2E1MA 1N32E 1B7YA 3L00A 3AV0A 4ZYDA 4LTYA 4NHRA 2KHXA 1NEIA 4WPYA 4Q6GA 1KJKA 3MF2A 4KR3A 2UUCE 2DXTA 2ENHA 3L1AA 1YPNA 4XTWA 4YRPA 4BW9A 2CGHA 1ADJA 5HGQA 1E24A 4ZYEA 2ARSA 3V8LA 1G5IA 3M99B 1W66A 4LF5E 2JY9A 1NJ8A 1HNXE 2ADRA 4O4KA 4WFTA 4BBYA 2Q7GA 4XTXA 3RKYA 4JI0E 2LVHA 2EPPA 4TVAB 3BF2A 3ZOQB 4DKKA 3HTZA 4O24A 2CJ9A 12ASA 4IS1C 4P3OA 4XTYA 2I13A 1ZR9A 3KWRA 3IWCA 1SRYA 1YUIA 2ZZEA 4TQFA 5IWAE 2VQFE 3VHTB 3HTXA 4HVCA 4RH8A 3MF1A 4JV5E 3RUXA 4YRNA 3PCOA 4ZTZB 2DU5A 2EPMX 4WXDA 2EWNA 4TTVA 1HTTA 4YY3E 1PDAA 4M9VC 2DVEA 1N34E 2E10A 1BIBA 1T4NA 2UXDE 5A6JA 3LLHA 4JI3E 4LFAE 4HWPA 3EPKA 1T38A 1IBLE 4OX9E 3HFZB 2HGHA 3TEHB 3V7SA 3HRKA 3VK6A 3V8KA 1WHQA 3C6KA 2L92A 3QO5A 1X6FA 3QO8A 4YRQA 4GEQB 3JU0A 2I4MA 4YRIA 2LBSB 2LO3A 2EL9A 3MHSC 3V7RA 2L2KB 4YRLA 4RQFA 3HXYA 2DB2A 2L33A 1G2FC 5AE1A 1HC7A 3DSQA 1IQOA 3QG5C 3I7FA 1SETA 2EJGA 1IQSA 2E65A 3TEGA 5A6BD 4WJ4A 2EM8A 1ZBQA 2EJ4A 2ZINA 3P8TA 3NETA 4P75A 2CSHA 4LVIA 4B3TE 2WCC3 1NJ5A 3T1HE 2EP3A 3QTCA 4F9BB 2EM6A 3QNEA 4YCUA 1X49A 5TSEA 2DJZA 4TVYA 4YP0A 4YRJA 3HXZA 4HWRA 1T4LB 2IY5B 1SFEA 1N33E 1EQRA 3UH0A 1A1GA 2NUGA 2EMZA 3HFZA 5IT9C 4XU1A 3A7RA 4GKJE 3TEHA 4GZNC 2EOMA 2E64A 5F5WA 4EO4A 5LMNE 1H4SA 2H36X 3RF1A 3RKWA 3AUZA 4LF7E 1PKPA 4WYQB 4E51A 2LUQA 1QU6A 4H2UA 2EM2A 2YTGA 1X47A 2YRMA 4AH6A 1G5HA 5KL3A 2EPCA 1J5WA 1G51A 2ZXFA 2JR1A 2I4LA 4Q28A 4O5GA 3UGTA 2KOUA 4YRRA 2RSMA 1LLMC 3J7Yp 1RIQA 4X62E 3A7AA 3P8VA 4CS3A 1H4QA 4R2RA 3EPLA 5ADZA 4KQEA 4P73A 2YU5A 4K86A 1HNWE 1LYLA 2C8MA 4K0KE 1SESA 1VQZA 5IXMB 4NZVA 2WZOA 2E41A 5KL5A 1ZU1A 4XTVA 4DR6E 4F6NA 2EQ3A 4DV2E 2R1FA 5KL2A 1E1OA 4CH4A 1NNHA 3TQMA 1WXRA 2B7VA 1X5WA 2EM7A 4P74A 3IKMB 3M4PA 4L8NA 1RC7A 2PMFA 2V86A 3QO7A 2ZIOA 1EKZA 1WU7A 1DI2A 1EIYB 3HY0A 4P74C 3PCOB 5FLXC 3VBBA 2EM4A 2EOIA 1T4OA 2I4NA 5A6BA 2YWQA 4DUYE 4R2SA 2JYAA 2RHQB 2DRPA 1EVKA 3IKLA 2EQ1A 3HXLA 2MKDA 5AC5A 2Q5HA 4JI4E 2XGTA 2EN7A 2L8TA 2ZZFA 1FKAE 1NJ2A 4YRTA 5A69A 1HNZE 1USYA 3HY1A 3LC0A 1YZ9A 2E1HA 2RHSB 2JP9A 2ZIMA 2E72A 2EN6A 4JI2E 4YRSA 2EMIA 4I8OA 1YGBA 1PJTA 2G7HA 4R2AA 1WYDA 2EL5A 5C53B 2V87A 4F2JC 3OD1A 2V88A 4R8OA 3REUA 3RGLA 2EOOA 1A1HA 2VE7C 3A5YA 4LVJA 1X48A 4X5OA 5KL4A 3LSSA 1JK2A 2YTOA 3OTOE 2DEQA 2YTEA 4DQ2A 3K6QA 4KZSA 2P0LA 4X9JA 2DQ3A 4F9CB 5AE2A 1EH6A 2LRSA 2UUBE 1BBGA 2EOEA 4DR3E 4DUZE 2CT1A 3C4BA 2YTNA 2DQ0A 2EOXA 2JXPA 4DV7E 2JPAA 2ZCEA 3C4TA 2K7IA 2ZZGA 4XTUA 4G85A 2EPKX 1KYQA 1WLEA 4H2XB 4P75C 4YRMA 2MKNA 1KMMA 2ELYA 2EMKA 2MDGA 1L4SA 3RIRA 3HXWA 4UP9A 4Q35B 4B3SE 4R2DA 1GTKA 2ZR2A 4WJ3M 2E5AA 2EOSA 3UK3C 1ASYA 2DLQA 2PMEA 1YSAC 3HXUA 2DMYA 4F9AB 3HPSA 2ENAA 4UPAA 3HFVA 4YYEA 2EPRA 4WSGA 3IWBA 2Q5IA 4R2CA 3NENA 4H2VA 2NS6A 3BJUA 4PHCA 5E3IA 1EH8A 1C0AA 4O43A 1AAYA 5IV8B 1E22A 4R2EA 3L4GB 2QHVA 4XEMA 3KFUA 1G2DC 2EMAA 1PJSA 5F3WA 2M7QA 2YZTA 4F6MA 4OOGC 2HHHE 1EVLA 3TUPA 4P71A 3JAMC 2YTPA 4X66E 4YRFA 2YRHA 4P78A 1GZ6A 2ARUA 5BR8E 1Z7NA 3T1YE 4MLQA 1WPYA 2EOJA 2RHQA 4P72A 4RMFA 2YTDA 2EPNA 3ECRA 2ZM6E 2DTIA 2LV2A 4R03A 4TVWA 4MLVA 1JJCA 5LLQA 4XU0A 2EORA 2EPXA 1XMQE 4LFCE 4CS2A 5AC4A 1IBKE 2E5LE 3RL6A 1A1IA 2ZR3A 1HXDA 3MEYA 2EM3A 3ADJA 3UFGA 2ARTA 1X2GA 1WRJA 1X54A 3JTZA 5DNYA 4LF4E 1J5EE 3VYYA 3IWDA 4R2QA 2LT7A 4DR7E 1IBME 1UHZA 4DR2E 3WQZA 2DKGA 2FV4B 2MC6A 4B3ME 2RSIA 2DLKA 2EOZA 1A1FA 3A7UA 4H2XA 4P7DA 1ZBTA 1O0WA 2CJAA 2GPIA 4BMJA 2ODRD 4YHHE 1B8AA 3OMLA 2EJFA 2A25A 4F54A 1UN6B 4OLFA 4Q15A 4UP8A 1PYSB 3V7CA 1USYC 5KNNA 2EMCA 5C52B 2YTQA 3EPJA 1YFRA 2EMLA 2JVAA 1Z1BA 5AE3A 4X8WA 2AMCB 1DQ3A 4H2SA 4CS4A 4TUIA 2NA2A 2L2NA 4YRKA 4JYAE 3J7AG 1YFSA 2FGGA 2EE8A 2EMYA 4TVAA 2RS7A 2EN3A 11ASA 1P47A 4P3PA 2GLIA 3F6GA 2K4VA 2EM5A 4XU3A 2DIXA 3R07A 4HT4A 4P72C 4DV4E 1YFTA 4PG3A 2M9AA 2ZT5A 2L2MA 2EM0A 4UP7A 2BB8A 4ZIBA 5AASA 2ZNIA 4H2TA 4LNSA 4WSPA 3HXVA 4P71C 4CH5A 2EMGA 3ADIA 3HRIA 2LJHA 2ALYB 1PJQA 4HA8A 4ZYHA 2EZ6A 1NCSA 2YTIA 2PRTA 2YPNA 3DF6A 3BFMA 3EPHA 4KHPE 3VQXA 4WXCA 2EMWA 2RTXA 2V89A 3RKXA 2N8XA 1GGMA 2CJBA 4WI1A 2EWLA 2ENCA 4YDQA 2EL6A 1STUA 1WJPA 2A8EA 3BBGA 2ZNJA 2J3LA 1A1LA 3E9IA 5A6KA 4YCVA 2LCEA 5CFFE 5ELNA 3CMQA 1RQ0A 1YUJA 4XEOA 2EPZA 4H2WA 4K87A 2L6MA 5ELOA 2DTOA 4DR4E 3M4QA 4ZTUB 3THNA 2N3HA 1IMUA 2AKWB 5LMUE 1WNLA 4BC9A 2B3TB 2L3CA 1YYOA 4NXNE 2B7TA 1FYFA 2EPLX 2IY5A 4IJDA 5C51B 4M2ZA 1WQ7A 2UXCE 2DMIA 5A6AA 3L4GA 2EMFA 2EM9A 5A2QC 4JI5E 2RQLA 1MEYC 2LJUA 2XTIA 2DU7A 3VQWA 3A74A 4M0VA 3P8YA 2GHFA 2I9IA 3KZZA 4LVKA 4YRGA 2DGCA 2V83A 1XNQE 3W3SA 1QF6A 5T6JA 2HNIA 1KMNA 3IG2A 2VF1A 3NELA 2N3GA 3MSWA 1B70B 1N3GA 1XNRE 1X6HA 1JK1A 4DV6E 4FK5C 3A31A 2DSYA 1EFWA 2J3MA 2YSOA 3J81C 1WQWA 4YPFA 2EMXA 3MQZA 4GKKE 3EQ1A 2EJ9A 2WBUA 2R76A 4N4RB 2WBTA 4WX9A 1SR9A 4ZYGA 2V85A 2EN4A 4B3RE 2MC5A 2UU9E 3UGQA 2D9HA 1EH7A 4AQYE 2AKWA 4JI1E 2QHTA 4KR2A 2FTXB 2HC5A 3A5ZA 2ODRC 1A1JA 4M30A 3THOB 1X6EA 4HTGA 2M1SA 1FJGE 2EOHA 2UXBE 2DDZA 4X64E 2EN1A 4DV3E 5LL6R 2DZCA 4L87A 4YREA 4NXME 1NYRA 1KOGA 1PYSA 5KL6A 1J26A 1I94E 2FYKA 4K88A 2JOXA 1YYWA 1BBOA 1BBUA 1X56A 2NUFA 4DPGA 3LMLA 4BCAA 1YYKA 2CPNA 2RPCA 3PZCA 2E3CA 3V8JA 2Q7HA 4YCWA 4EX5A 2DTHA 3NEMA 3C6MA 3BIDA 2EMHA 1E1TA
chains in the Genus database with same CATH topology
2VQEE 4J15A 4HWSA 1ASZA 4CH6A 2RHSA 2ALYA 3EFSA 3E9HA 4TWAA 2DXUA 3REXA 3HQ1A 1WHNA 4TUGA 2G4CA 2LUPB 1UILA 4HWOA 2ZT8A 5K1PA 2I4OA 1QE0A 4YROA 1L0WA 3VQVA 2KONA 3G1ZA 3LSQA 1H4VB 1SERA 1X2HA 3ADLA 4L5NC 2C7IA 1IL2A 4H02A 1NJ1A 2LMZA 2M4IA 1GQEA 4XU2A 2JWOA 2AMCA 4BS9A 2F4VE 1B7YB 1XMOE 4JI8E 4G84A 2V8QB 1NYQA 3RMPA 2F8BA 2QHSA 4P3NA 4WF2A 4DR1E 3L2ZA 1N36E 3EFRA 4J8ZA 3HXXA 1BIAA 3HPZA 1ATIA 3F6HA 3IALA 3VQYA 2DZ9A 3ERRA 3ICAA 4LFBE 1BBWA 3FJPA 2UUAE 2NUEA 1N9WA 1B76A 4JI7E 4LVLA 3A32A 3H09A 4OP0A 4LF9E 4YRCA 1EOVA 2B9DA 3FIGA 3VYXA 3J80C 2MDRA 4XTZA 4HWTA 4DV5E 2ZTGA 1ADYA 4X65E 4CH3A 1H4TA 4BC7A 2JOBA 2L3JA 4DV0E 1JJCB 4P73C 2LE2A 1YB3A 4DMIA 4BWAA 4RDXA 2ZT6A 2P5IA 3DJWA 2Q7EA 4NCXA 4LVMA 1Z7MA 3ADGA 1HR0E 4DV1E 4RQEA 1B70A 2CIMA 4LU9A 5K1XA 4H2YA 2RS6A 4TQDA 2IHR1 4LF8E 4DR5E 2QHUA 2ZT7A 1NJ6A 2LTSA 2YT4A 1X01A 3RACA 1EIYA 2LTRA 1X55A 2ZGWA 4O2DA 3P1XA 2EAYA 4LF6E 4JI6E 2E1MA 1N32E 1B7YA 3AV0A 4LTYA 2KHXA 4WPYA 4Q6GA 3MF2A 4KR3A 2UUCE 2DXTA 3L1AA 4XTWA 4YRPA 4BW9A 2CGHA 1ADJA 5HGQA 1E24A 2ARSA 3V8LA 1G5IA 1W66A 4LF5E 2JY9A 1NJ8A 1HNXE 3RKYA 4WFTA 4BBYA 2Q7GA 4XTXA 4JI0E 4TVAB 3ZOQB 4DKKA 3HTZA 2CJ9A 12ASA 4P3OA 4XTYA 3KWRA 3IWCA 1SRYA 2ZZEA 4TQFA 5IWAE 2VQFE 3HTXA 4HVCA 3MF1A 4JV5E 3RUXA 4YRNA 3PCOA 4ZTZB 2DU5A 4TTVA 2EWNA 1HTTA 4YY3E 2DVEA 1N34E 2E10A 1BIBA 1T4NA 2UXDE 3LLHA 4JI3E 4LFAE 4HWPA 1IBLE 4OX9E 3HFZB 3TEHB 3V7SA 3HRKA 3VK6A 3V8KA 1WHQA 2L92A 3QO5A 3QO8A 4YRQA 4GEQB 3JU0A 2I4MA 4YRIA 2LBSB 2EL9A 3V7RA 2L2KB 4YRLA 4RQFA 3HXYA 2DB2A 2L33A 5AE1A 1HC7A 3DSQA 3I7FA 1SETA 2EJGA 2E65A 3TEGA 4WJ4A 1ZBQA 3P8TA 2ZINA 3NETA 4P75A 4LVIA 4B3TE 1NJ5A 3T1HE 3QTCA 4F9BB 3QNEA 4YCUA 1X49A 2DJZA 4TVYA 4YP0A 4YRJA 3HXZA 4HWRA 1T4LB 2IY5B 1N33E 1EQRA 3UH0A 2NUGA 3HFZA 5IT9C 4XU1A 3A7RA 4GKJE 3TEHA 4EO4A 2E64A 5F5WA 1H4SA 5LMNE 2H36X 3RF1A 3RKWA 3AUZA 4LF7E 1PKPA 4WYQB 4E51A 2LUQA 1QU6A 4H2UA 1X47A 4AH6A 1G5HA 1J5WA 1G51A 2ZXFA 2JR1A 2I4LA 4Q28A 3UGTA 2KOUA 4YRRA 2RSMA 1RIQA 3J7Yp 4CS3A 4X62E 3A7AA 3P8VA 1H4QA 5ADZA 4KQEA 4P73A 4K86A 1HNWE 1LYLA 2C8MA 4K0KE 1SESA 1VQZA 2WZOA 2E41A 4XTVA 4DR6E 4CH4A 4DV2E 1E1OA 1NNHA 1WXRA 2B7VA 4P74A 3IKMB 3M4PA 4L8NA 1RC7A 2PMFA 2V86A 3QO7A 2ZIOA 1EKZA 1WU7A 1DI2A 1EIYB 3HY0A 4P74C 3PCOB 5FLXC 3VBBA 1T4OA 2I4NA 4DUYE 2RHQB 1EVKA 3IKLA 3HXLA 2Q5HA 4JI4E 2XGTA 2ZZFA 2L8TA 1FKAE 1NJ2A 4YRTA 1HNZE 1USYA 3HY1A 3LC0A 1YZ9A 2E1HA 2RHSB 4YRSA 2ZIMA 4JI2E 4I8OA 1YGBA 2G7HA 1WYDA 5C53B 2V87A 3OD1A 2V88A 4R8OA 3REUA 3RGLA 2VE7C 3A5YA 4LVJA 1X48A 4X5OA 3LSSA 3OTOE 2DEQA 4DQ2A 3K6QA 4KZSA 2P0LA 2DQ3A 4F9CB 5AE2A 2LRSA 2UUBE 4DR3E 4DUZE 3C4BA 2DQ0A 4DV7E 2ZCEA 2ZZGA 3C4TA 4XTUA 4G85A 1WLEA 4H2XB 4P75C 4YRMA 1KMMA 3RIRA 3HXWA 4UP9A 4B3SE 2ZR2A 4WJ3M 2E5AA 1ASYA 2PMEA 3HXUA 2DMYA 4F9AB 3HPSA 4UPAA 3HFVA 4YYEA 3IWBA 2Q5IA 3NENA 4H2VA 1C0AA 2NS6A 3BJUA 4PHCA 5E3IA 1E22A 3L4GB 2QHVA 4XEMA 3KFUA 5F3WA 1EVLA 2M7QA 2YZTA 2HHHE 4OOGC 3TUPA 4P71A 3JAMC 4X66E 4YRFA 4P78A 1GZ6A 2ARUA 5BR8E 1Z7NA 3T1YE 1WPYA 2RHQA 4P72A 4RMFA 2ZM6E 2DTIA 4R03A 4TVWA 1JJCA 4XU0A 4LFCE 1XMQE 4CS2A 1IBKE 2E5LE 3RL6A 2ZR3A 1HXDA 3MEYA 3ADJA 3UFGA 2ARTA 1X2GA 1X54A 3JTZA 5DNYA 4LF4E 1J5EE 3VYYA 3IWDA 4DR7E 1IBME 1UHZA 4DR2E 3WQZA 2DKGA 2FV4B 2MC6A 4B3ME 3A7UA 4H2XA 4P7DA 1ZBTA 1O0WA 2CJAA 4BMJA 2ODRD 4YHHE 1B8AA 3OMLA 2EJFA 4F54A 4OLFA 4Q15A 4UP8A 5KNNA 1PYSB 3V7CA 1USYC 5C52B 1YFRA 2JVAA 4H2SA 5AE3A 4X8WA 2AMCB 1DQ3A 4CS4A 4TUIA 2NA2A 2L2NA 4YRKA 4JYAE 3J7AG 1YFSA 2FGGA 4TVAA 2RS7A 11ASA 4P3PA 3F6GA 2K4VA 4XU3A 2DIXA 3R07A 4HT4A 4P72C 4DV4E 1YFTA 4PG3A 2ZT5A 2L2MA 4UP7A 4ZIBA 5AASA 2ZNIA 4H2TA 4LNSA 4WSPA 3HXVA 4P71C 4CH5A 3ADIA 3HRIA 2LJHA 2ALYB 4HA8A 2EZ6A 3DF6A 3BFMA 4KHPE 3VQXA 2RTXA 2V89A 3RKXA 1GGMA 2CJBA 4WI1A 2EWLA 4YDQA 1STUA 2A8EA 2ZNJA 2J3LA 3E9IA 4YCVA 5CFFE 5ELNA 3CMQA 1RQ0A 4XEOA 4H2WA 4K87A 2L6MA 5ELOA 2DTOA 4DR4E 3M4QA 4ZTUB 2N3HA 2AKWB 5LMUE 1WNLA 4BC9A 2B3TB 2L3CA 1YYOA 4NXNE 2B7TA 1FYFA 2IY5A 5C51B 4M2ZA 1WQ7A 2UXCE 3L4GA 5A2QC 4JI5E 2XTIA 2DU7A 3VQWA 3A74A 4M0VA 3P8YA 4LVKA 4YRGA 2V83A 1XNQE 3W3SA 1QF6A 5T6JA 2HNIA 1KMNA 3IG2A 2VF1A 3NELA 2N3GA 3MSWA 1B70B 1XNRE 4DV6E 3A31A 2DSYA 1EFWA 2J3MA 3J81C 1WQWA 4YPFA 3MQZA 4GKKE 2EJ9A 1SR9A 2V85A 4B3RE 2MC5A 2UU9E 3UGQA 4AQYE 2AKWA 2QHTA 4KR2A 4JI1E 2FTXB 3A5ZA 2ODRC 4M30A 1FJGE 2M1SA 2UXBE 2DDZA 4X64E 4DV3E 5LL6R 2DZCA 4L87A 4YREA 4NXME 1NYRA 1KOGA 1PYSA 1J26A 1I94E 2FYKA 4K88A 2JOXA 1YYWA 1BBUA 1X56A 2NUFA 4DPGA 3LMLA 4BCAA 1YYKA 2CPNA 3PZCA 2E3CA 3V8JA 2Q7HA 4YCWA 4EX5A 2DTHA 3NEMA 1E1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J15 A;  4HWS A;  1ASZ A;  4CH6 A;  2RHS A;  2ALY A;  3EFS A;  3E9H A;  4TWA A;  2DXU A;  3REX A;  2G4C A;  4HWO A;  2ZT8 A;  5K1P A;  2I4O A;  1QE0 A;  4YRO A;  1L0W A;  3VQV A;  3G1Z A;  3LSQ A;  1H4V B;  1SER A;  1X2H A;  2C7I A;  1IL2 A;  4H02 A;  1NJ1 A;  4XU2 A;  2AMC A;  1B7Y B;  4G84 A;  1NYQ A;  2QHS A;  4P3N A;  4WF2 A;  3L2Z A;  3EFR A;  3HXX A;  1BIA A;  1ATI A;  3IAL A;  3VQY A;  2DZ9 A;  3ERR A;  3ICA A;  1BBW A;  3FJP A;  1N9W A;  1B76 A;  3A32 A;  4YRC A;  4OP0 A;  1EOV A;  4XTZ A;  4HWT A;  2ZTG A;  1ADY A;  4CH3 A;  1H4T A;  1JJC B;  4P73 C;  1YB3 A;  4BWA A;  4RDX A;  2ZT6 A;  2P5I A;  2Q7E A;  4NCX A;  1Z7M A;  4RQE A;  1B70 A;  2CIM A;  5K1X A;  4H2Y A;  4TQD A;  2ZT7 A;  2QHU A;  1NJ6 A;  1X01 A;  3RAC A;  1EIY A;  1X55 A;  2ZGW A;  4O2D A;  2EAY A;  1B7Y A;  4Q6G A;  3MF2 A;  4KR3 A;  2DXT A;  3L1A A;  4XTW A;  4YRP A;  4BW9 A;  2CGH A;  1ADJ A;  5HGQ A;  1E24 A;  2ARS A;  3V8L A;  1G5I A;  1W66 A;  1NJ8 A;  3RKY A;  2Q7G A;  4XTX A;  4TVA B;  3HTZ A;  2CJ9 A;  12AS A;  4P3O A;  4XTY A;  1SRY A;  2ZZE A;  4TQF A;  4HVC A;  3MF1 A;  3RUX A;  4YRN A;  3PCO A;  4ZTZ B;  2DU5 A;  4TTV A;  2EWN A;  1HTT A;  2DVE A;  2E10 A;  1BIB A;  4HWP A;  3HFZ B;  3TEH B;  3V7S A;  3HRK A;  3V8K A;  3QO5 A;  3QO8 A;  4YRQ A;  2I4M A;  4YRI A;  2EL9 A;  3V7R A;  4RQF A;  4YRL A;  3HXY A;  1HC7 A;  3DSQ A;  3I7F A;  1SET A;  2EJG A;  2E65 A;  3TEG A;  4WJ4 A;  3P8T A;  2ZIN A;  3NET A;  4P75 A;  1NJ5 A;  3QTC A;  3QNE A;  4YCU A;  4YP0 A;  2DJZ A;  4TVY A;  4YRJ A;  3HXZ A;  4HWR A;  2IY5 B;  1EQR A;  3UH0 A;  3HFZ A;  3TEH A;  4XU1 A;  3A7R A;  4EO4 A;  2E64 A;  5F5W A;  1H4S A;  3RKW A;  3RF1 A;  4E51 A;  4H2U A;  4AH6 A;  1G5H A;  1J5W A;  1G51 A;  2ZXF A;  2I4L A;  3UGT A;  4YRR A;  1RIQ A;  4CS3 A;  3P8V A;  3A7A A;  1H4Q A;  4P73 A;  4KQE A;  4K86 A;  1LYL A;  2C8M A;  1SES A;  1VQZ A;  2E41 A;  4XTV A;  4CH4 A;  1E1O A;  1NNH A;  4P74 A;  3IKM B;  3M4P A;  2PMF A;  3QO7 A;  2ZIO A;  1WU7 A;  1EIY B;  3HY0 A;  4P74 C;  3PCO B;  3VBB A;  2I4N A;  2RHQ B;  1EVK A;  3IKL A;  2Q5H A;  2XGT A;  2ZZF A;  4YRT A;  1NJ2 A;  1USY A;  3HY1 A;  3LC0 A;  2E1H A;  2RHS B;  4YRS A;  2ZIM A;  1YGB A;  1WYD A;  5C53 B;  3OD1 A;  3REU A;  3RGL A;  3A5Y A;  4X5O A;  3LSS A;  2DEQ A;  4DQ2 A;  2P0L A;  2DQ3 A;  2DQ0 A;  2ZCE A;  2ZZG A;  4XTU A;  4G85 A;  1WLE A;  4H2X B;  4P75 C;  4YRM A;  1KMM A;  3RIR A;  3HXW A;  4UP9 A;  2ZR2 A;  4WJ3 M;  2E5A A;  1ASY A;  2PME A;  3HXU A;  4UPA A;  3HFV A;  4YYE A;  2Q5I A;  3NEN A;  4H2V A;  1C0A A;  5E3I A;  3BJU A;  4PHC A;  1E22 A;  3L4G B;  2QHV A;  4XEM A;  3KFU A;  1EVL A;  3TUP A;  4P71 A;  4YRF A;  2ARU A;  1Z7N A;  1WPY A;  2RHQ A;  4P72 A;  4RMF A;  2DTI A;  4TVW A;  1JJC A;  4XU0 A;  4CS2 A;  3RL6 A;  2ZR3 A;  1HXD A;  3MEY A;  3UFG A;  2ART A;  1X2G A;  1X54 A;  3WQZ A;  2DKG A;  3A7U A;  4H2X A;  2CJA A;  2ODR D;  1B8A A;  2EJF A;  4OLF A;  4Q15 A;  4UP8 A;  5KNN A;  1PYS B;  3V7C A;  1USY C;  5C52 B;  1YFR A;  4H2S A;  4CS4 A;  2AMC B;  4YRK A;  1YFS A;  4TVA A;  11AS A;  4P3P A;  4XU3 A;  3R07 A;  4P72 C;  1YFT A;  4PG3 A;  2ZT5 A;  4UP7 A;  4ZIB A;  2ZNI A;  4H2T A;  4LNS A;  3HXV A;  4P71 C;  4CH5 A;  3HRI A;  2ALY B;  4HA8 A;  3BFM A;  3VQX A;  3RKX A;  1GGM A;  2CJB A;  4WI1 A;  4YDQ A;  2ZNJ A;  2J3L A;  3E9I A;  4YCV A;  5ELN A;  3CMQ A;  4XEO A;  4H2W A;  4K87 A;  5ELO A;  2DTO A;  3M4Q A;  4ZTU B;  2AKW B;  1WNL A;  1FYF A;  2IY5 A;  5C51 B;  1WQ7 A;  3L4G A;  2XTI A;  2DU7 A;  3VQW A;  3A74 A;  3P8Y A;  4YRG A;  1QF6 A;  3W3S A;  2HNI A;  1KMN A;  3IG2 A;  3NEL A;  1B70 B;  3A31 A;  1EFW A;  2J3M A;  1WQW A;  4YPF A;  2EJ9 A;  3UGQ A;  2QHT A;  2AKW A;  4KR2 A;  3A5Z A;  2ODR C;  2DDZ A;  2DZC A;  4L87 A;  4YRE A;  1NYR A;  1KOG A;  1PYS A;  2FYK A;  4K88 A;  1BBU A;  1X56 A;  4DPG A;  3PZC A;  2E3C A;  3V8J A;  2Q7H A;  4YCW A;  4EX5 A;  2DTH A;  3NEM A;  1E1T A; 
#chains in the Genus database with same CATH topology
 2VQE E;  4J15 A;  4HWS A;  1ASZ A;  4CH6 A;  1DGC A;  2RHS A;  2ALY A;  1TF6 A;  3EFS A;  1MGT A;  1AH5 A;  3E9H A;  4TWA A;  2EPU A;  2DXU A;  3REX A;  3HQ1 A;  1WHN A;  4TUG A;  2G4C A;  2LUP B;  1TN9 A;  1UIL A;  4HWO A;  3KZY A;  2ZT8 A;  2EN8 A;  2I4O A;  5K1P A;  1QE0 A;  4YRO A;  1L0W A;  3VQV A;  2KON A;  3G1Z A;  3LSQ A;  1BB8 A;  1H4V B;  1SER A;  1X2H A;  2EQ0 A;  4KWY A;  3ADL A;  4L5N C;  2C7I A;  1IL2 A;  4H02 A;  2EPO A;  1TF3 A;  2LMZ A;  2M4I A;  1GQE A;  2EOF A;  1NJ1 A;  4XU2 A;  2JWO A;  2AMC A;  4BS9 A;  2F4V E;  1B7Y B;  1XMO E;  4JI8 E;  4G84 A;  2V8Q B;  4HEI A;  2YTJ A;  1NYQ A;  3RMP A;  2F8B A;  2QHS A;  2CTD A;  4P3N A;  4WF2 A;  4DR1 E;  3L2Z A;  1N36 E;  3EFR A;  4J8Z A;  3HXX A;  1BIA A;  2J7J A;  3HPZ A;  1ATI A;  3F6H A;  3IAL A;  3VQY A;  2DZ9 A;  3ERR A;  3ICA A;  4LFB E;  1BBW A;  3FJP A;  2UUA E;  2ELZ A;  2NUE A;  1B76 A;  1N9W A;  4JI7 E;  1QNT A;  4LVL A;  3A32 A;  3H09 A;  2YRK A;  4LF9 E;  3BGH A;  4OP0 A;  4YRC A;  1EOV A;  2B9D A;  3FIG A;  3VYX A;  3J80 C;  2MDR A;  4XTZ A;  1B69 A;  4HWT A;  2YU8 A;  4DV5 E;  2ZTG A;  1A1K A;  1ADY A;  4X65 E;  4CH3 A;  2EOY A;  2NAB A;  2VRD A;  4RHB B;  1H4T A;  3MHH C;  4BC7 A;  2JOB A;  2L3J A;  4DV0 E;  1JJC B;  4P73 C;  1T39 A;  1ZAA C;  2Q8U A;  5KL7 A;  1F2I G;  2EMB A;  2LE2 A;  1YB3 A;  4DMI A;  4BWA A;  4RDX A;  2ZT6 A;  2P5I A;  2BBG A;  3DJW A;  1X3C A;  2Q7E A;  4NCX A;  4LVM A;  1Z7M A;  3ADG A;  1HR0 E;  4DV1 E;  4BHC A;  1YFH A;  4RQE A;  2YTF A;  1B70 A;  2CIM A;  4LU9 A;  5K1X A;  4H2Y A;  2RS6 A;  4TQD A;  4BHB A;  2IHR 1;  4LF8 E;  4DR5 E;  2QHU A;  2ZT7 A;  2EOQ A;  1NJ6 A;  2EN2 A;  2LTS A;  1RMD A;  2HJJ A;  2YT4 A;  1X01 A;  3RAC A;  1EIY A;  2WBS A;  2EL4 A;  2LTR A;  1X55 A;  1UBD C;  4R2P A;  2EPA A;  2ZGW A;  4O2D A;  3P1X A;  2EAY A;  4LF6 E;  2YSP A;  4JI6 E;  2E1M A;  1N32 E;  1B7Y A;  3L00 A;  3AV0 A;  4ZYD A;  4LTY A;  4NHR A;  2KHX A;  1NEI A;  4WPY A;  4Q6G A;  1KJK A;  3MF2 A;  4KR3 A;  2UUC E;  2DXT A;  2ENH A;  3L1A A;  1YPN A;  4XTW A;  4YRP A;  4BW9 A;  2CGH A;  1ADJ A;  5HGQ A;  1E24 A;  4ZYE A;  2ARS A;  3V8L A;  1G5I A;  3M99 B;  1W66 A;  4LF5 E;  2JY9 A;  1NJ8 A;  1HNX E;  2ADR A;  4O4K A;  4WFT A;  4BBY A;  2Q7G A;  4XTX A;  3RKY A;  4JI0 E;  2LVH A;  2EPP A;  4TVA B;  3BF2 A;  3ZOQ B;  4DKK A;  3HTZ A;  4O24 A;  2CJ9 A;  12AS A;  4IS1 C;  4P3O A;  4XTY A;  2I13 A;  1ZR9 A;  3KWR A;  3IWC A;  1SRY A;  1YUI A;  2ZZE A;  4TQF A;  5IWA E;  2VQF E;  3VHT B;  3HTX A;  4HVC A;  4RH8 A;  3MF1 A;  4JV5 E;  3RUX A;  4YRN A;  3PCO A;  4ZTZ B;  2DU5 A;  2EPM X;  4WXD A;  2EWN A;  4TTV A;  1HTT A;  4YY3 E;  1PDA A;  4M9V C;  2DVE A;  1N34 E;  2E10 A;  1BIB A;  1T4N A;  2UXD E;  5A6J A;  3LLH A;  4JI3 E;  4LFA E;  4HWP A;  3EPK A;  1T38 A;  1IBL E;  4OX9 E;  3HFZ B;  2HGH A;  3TEH B;  3V7S A;  3HRK A;  3VK6 A;  3V8K A;  1WHQ A;  3C6K A;  2L92 A;  3QO5 A;  1X6F A;  3QO8 A;  4YRQ A;  4GEQ B;  3JU0 A;  2I4M A;  4YRI A;  2LBS B;  2LO3 A;  2EL9 A;  3MHS C;  3V7R A;  2L2K B;  4YRL A;  4RQF A;  3HXY A;  2DB2 A;  2L33 A;  1G2F C;  5AE1 A;  1HC7 A;  3DSQ A;  1IQO A;  3QG5 C;  3I7F A;  1SET A;  2EJG A;  1IQS A;  2E65 A;  3TEG A;  5A6B D;  4WJ4 A;  2EM8 A;  1ZBQ A;  2EJ4 A;  2ZIN A;  3P8T A;  3NET A;  4P75 A;  2CSH A;  4LVI A;  4B3T E;  2WCC 3;  1NJ5 A;  3T1H E;  2EP3 A;  3QTC A;  4F9B B;  2EM6 A;  3QNE A;  4YCU A;  1X49 A;  5TSE A;  2DJZ A;  4TVY A;  4YP0 A;  4YRJ A;  3HXZ A;  4HWR A;  1T4L B;  2IY5 B;  1SFE A;  1N33 E;  1EQR A;  3UH0 A;  1A1G A;  2NUG A;  2EMZ A;  3HFZ A;  5IT9 C;  4XU1 A;  3A7R A;  4GKJ E;  3TEH A;  4GZN C;  2EOM A;  2E64 A;  5F5W A;  4EO4 A;  5LMN E;  1H4S A;  2H36 X;  3RF1 A;  3RKW A;  3AUZ A;  4LF7 E;  1PKP A;  4WYQ B;  4E51 A;  2LUQ A;  1QU6 A;  4H2U A;  2EM2 A;  2YTG A;  1X47 A;  2YRM A;  4AH6 A;  1G5H A;  5KL3 A;  2EPC A;  1J5W A;  1G51 A;  2ZXF A;  2JR1 A;  2I4L A;  4Q28 A;  4O5G A;  3UGT A;  2KOU A;  4YRR A;  2RSM A;  1LLM C;  3J7Y p;  1RIQ A;  4X62 E;  3A7A A;  3P8V A;  4CS3 A;  1H4Q A;  4R2R A;  3EPL A;  5ADZ A;  4KQE A;  4P73 A;  2YU5 A;  4K86 A;  1HNW E;  1LYL A;  2C8M A;  4K0K E;  1SES A;  1VQZ A;  5IXM B;  4NZV A;  2WZO A;  2E41 A;  5KL5 A;  1ZU1 A;  4XTV A;  4DR6 E;  4F6N A;  2EQ3 A;  4DV2 E;  2R1F A;  5KL2 A;  1E1O A;  4CH4 A;  1NNH A;  3TQM A;  1WXR A;  2B7V A;  1X5W A;  2EM7 A;  4P74 A;  3IKM B;  3M4P A;  4L8N A;  1RC7 A;  2PMF A;  2V86 A;  3QO7 A;  2ZIO A;  1EKZ A;  1WU7 A;  1DI2 A;  1EIY B;  3HY0 A;  4P74 C;  3PCO B;  5FLX C;  3VBB A;  2EM4 A;  2EOI A;  1T4O A;  2I4N A;  5A6B A;  2YWQ A;  4DUY E;  4R2S A;  2JYA A;  2RHQ B;  2DRP A;  1EVK A;  3IKL A;  2EQ1 A;  3HXL A;  2MKD A;  5AC5 A;  2Q5H A;  4JI4 E;  2XGT A;  2EN7 A;  2L8T A;  2ZZF A;  1FKA E;  1NJ2 A;  4YRT A;  5A69 A;  1HNZ E;  1USY A;  3HY1 A;  3LC0 A;  1YZ9 A;  2E1H A;  2RHS B;  2JP9 A;  2ZIM A;  2E72 A;  2EN6 A;  4JI2 E;  4YRS A;  2EMI A;  4I8O A;  1YGB A;  1PJT A;  2G7H A;  4R2A A;  1WYD A;  2EL5 A;  5C53 B;  2V87 A;  4F2J C;  3OD1 A;  2V88 A;  4R8O A;  3REU A;  3RGL A;  2EOO A;  1A1H A;  2VE7 C;  3A5Y A;  4LVJ A;  1X48 A;  4X5O A;  5KL4 A;  3LSS A;  1JK2 A;  2YTO A;  3OTO E;  2DEQ A;  2YTE A;  4DQ2 A;  3K6Q A;  4KZS A;  2P0L A;  4X9J A;  2DQ3 A;  4F9C B;  5AE2 A;  1EH6 A;  2LRS A;  2UUB E;  1BBG A;  2EOE A;  4DR3 E;  4DUZ E;  2CT1 A;  3C4B A;  2YTN A;  2DQ0 A;  2EOX A;  2JXP A;  4DV7 E;  2JPA A;  2ZCE A;  3C4T A;  2K7I A;  2ZZG A;  4XTU A;  4G85 A;  2EPK X;  1KYQ A;  1WLE A;  4H2X B;  4P75 C;  4YRM A;  2MKN A;  1KMM A;  2ELY A;  2EMK A;  2MDG A;  1L4S A;  3RIR A;  3HXW A;  4UP9 A;  4Q35 B;  4B3S E;  4R2D A;  1GTK A;  2ZR2 A;  4WJ3 M;  2E5A A;  2EOS A;  3UK3 C;  1ASY A;  2DLQ A;  2PME A;  1YSA C;  3HXU A;  2DMY A;  4F9A B;  3HPS A;  2ENA A;  4UPA A;  3HFV A;  4YYE A;  2EPR A;  4WSG A;  3IWB A;  2Q5I A;  4R2C A;  3NEN A;  4H2V A;  2NS6 A;  3BJU A;  4PHC A;  5E3I A;  1EH8 A;  1C0A A;  4O43 A;  1AAY A;  5IV8 B;  1E22 A;  4R2E A;  3L4G B;  2QHV A;  4XEM A;  3KFU A;  1G2D C;  2EMA A;  1PJS A;  5F3W A;  2M7Q A;  2YZT A;  4F6M A;  4OOG C;  2HHH E;  1EVL A;  3TUP A;  4P71 A;  3JAM C;  2YTP A;  4X66 E;  4YRF A;  2YRH A;  4P78 A;  1GZ6 A;  2ARU A;  5BR8 E;  1Z7N A;  3T1Y E;  4MLQ A;  1WPY A;  2EOJ A;  2RHQ A;  4P72 A;  4RMF A;  2YTD A;  2EPN A;  3ECR A;  2ZM6 E;  2DTI A;  2LV2 A;  4R03 A;  4TVW A;  4MLV A;  1JJC A;  5LLQ A;  4XU0 A;  2EOR A;  2EPX A;  1XMQ E;  4LFC E;  4CS2 A;  5AC4 A;  1IBK E;  2E5L E;  3RL6 A;  1A1I A;  2ZR3 A;  1HXD A;  3MEY A;  2EM3 A;  3ADJ A;  3UFG A;  2ART A;  1X2G A;  1WRJ A;  1X54 A;  3JTZ A;  5DNY A;  4LF4 E;  1J5E E;  3VYY A;  3IWD A;  4R2Q A;  2LT7 A;  4DR7 E;  1IBM E;  1UHZ A;  4DR2 E;  3WQZ A;  2DKG A;  2FV4 B;  2MC6 A;  4B3M E;  2RSI A;  2DLK A;  2EOZ A;  1A1F A;  3A7U A;  4H2X A;  4P7D A;  1ZBT A;  1O0W A;  2CJA A;  2GPI A;  4BMJ A;  2ODR D;  4YHH E;  1B8A A;  3OML A;  2EJF A;  2A25 A;  4F54 A;  1UN6 B;  4OLF A;  4Q15 A;  4UP8 A;  1PYS B;  3V7C A;  1USY C;  5KNN A;  2EMC A;  5C52 B;  2YTQ A;  3EPJ A;  1YFR A;  2EML A;  2JVA A;  1Z1B A;  5AE3 A;  4X8W A;  2AMC B;  1DQ3 A;  4H2S A;  4CS4 A;  4TUI A;  2NA2 A;  2L2N A;  4YRK A;  4JYA E;  3J7A G;  1YFS A;  2FGG A;  2EE8 A;  2EMY A;  4TVA A;  2RS7 A;  2EN3 A;  11AS A;  1P47 A;  4P3P A;  2GLI A;  3F6G A;  2K4V A;  2EM5 A;  4XU3 A;  2DIX A;  3R07 A;  4HT4 A;  4P72 C;  4DV4 E;  1YFT A;  4PG3 A;  2M9A A;  2ZT5 A;  2L2M A;  2EM0 A;  4UP7 A;  2BB8 A;  4ZIB A;  5AAS A;  2ZNI A;  4H2T A;  4LNS A;  4WSP A;  3HXV A;  4P71 C;  4CH5 A;  2EMG A;  3ADI A;  3HRI A;  2LJH A;  2ALY B;  1PJQ A;  4HA8 A;  4ZYH A;  2EZ6 A;  1NCS A;  2YTI A;  2PRT A;  2YPN A;  3DF6 A;  3BFM A;  3EPH A;  4KHP E;  3VQX A;  4WXC A;  2EMW A;  2RTX A;  2V89 A;  3RKX A;  2N8X A;  1GGM A;  2CJB A;  4WI1 A;  2EWL A;  2ENC A;  4YDQ A;  2EL6 A;  1STU A;  1WJP A;  2A8E A;  3BBG A;  2ZNJ A;  2J3L A;  1A1L A;  3E9I A;  5A6K A;  4YCV A;  2LCE A;  5CFF E;  5ELN A;  3CMQ A;  1RQ0 A;  1YUJ A;  4XEO A;  2EPZ A;  4H2W A;  4K87 A;  2L6M A;  5ELO A;  2DTO A;  4DR4 E;  3M4Q A;  4ZTU B;  3THN A;  2N3H A;  1IMU A;  2AKW B;  5LMU E;  1WNL A;  4BC9 A;  2B3T B;  2L3C A;  1YYO A;  4NXN E;  2B7T A;  1FYF A;  2EPL X;  2IY5 A;  4IJD A;  5C51 B;  4M2Z A;  1WQ7 A;  2UXC E;  2DMI A;  5A6A A;  3L4G A;  2EMF A;  2EM9 A;  5A2Q C;  4JI5 E;  2RQL A;  1MEY C;  2LJU A;  2XTI A;  2DU7 A;  3VQW A;  3A74 A;  4M0V A;  3P8Y A;  2GHF A;  2I9I A;  3KZZ A;  4LVK A;  4YRG A;  2DGC A;  2V83 A;  1XNQ E;  3W3S A;  1QF6 A;  5T6J A;  2HNI A;  1KMN A;  3IG2 A;  2VF1 A;  3NEL A;  2N3G A;  3MSW A;  1B70 B;  1N3G A;  1XNR E;  1X6H A;  1JK1 A;  4DV6 E;  4FK5 C;  3A31 A;  2DSY A;  1EFW A;  2J3M A;  2YSO A;  3J81 C;  1WQW A;  4YPF A;  2EMX A;  3MQZ A;  4GKK E;  3EQ1 A;  2EJ9 A;  2WBU A;  2R76 A;  4N4R B;  2WBT A;  4WX9 A;  1SR9 A;  4ZYG A;  2V85 A;  2EN4 A;  4B3R E;  2MC5 A;  2UU9 E;  3UGQ A;  2D9H A;  1EH7 A;  4AQY E;  2AKW A;  4JI1 E;  2QHT A;  4KR2 A;  2FTX B;  2HC5 A;  3A5Z A;  2ODR C;  1A1J A;  4M30 A;  3THO B;  1X6E A;  4HTG A;  2M1S A;  1FJG E;  2EOH A;  2UXB E;  2DDZ A;  4X64 E;  2EN1 A;  4DV3 E;  5LL6 R;  2DZC A;  4L87 A;  4YRE A;  4NXM E;  1NYR A;  1KOG A;  1PYS A;  5KL6 A;  1J26 A;  1I94 E;  2FYK A;  4K88 A;  2JOX A;  1YYW A;  1BBO A;  1BBU A;  1X56 A;  2NUF A;  4DPG A;  3LML A;  4BCA A;  1YYK A;  2CPN A;  2RPC A;  3PZC A;  2E3C A;  3V8J A;  2Q7H A;  4YCW A;  4EX5 A;  2DTH A;  3NEM A;  3C6M A;  3BID A;  2EMH A;  1E1T A; 
#chains in the Genus database with same CATH homology
 2VQE E;  4J15 A;  4HWS A;  1ASZ A;  4CH6 A;  2RHS A;  2ALY A;  3EFS A;  3E9H A;  4TWA A;  2DXU A;  3REX A;  3HQ1 A;  1WHN A;  4TUG A;  2G4C A;  2LUP B;  1UIL A;  4HWO A;  2ZT8 A;  5K1P A;  2I4O A;  1QE0 A;  4YRO A;  1L0W A;  3VQV A;  2KON A;  3G1Z A;  3LSQ A;  1H4V B;  1SER A;  1X2H A;  3ADL A;  4L5N C;  2C7I A;  1IL2 A;  4H02 A;  1NJ1 A;  2LMZ A;  2M4I A;  1GQE A;  4XU2 A;  2JWO A;  2AMC A;  4BS9 A;  2F4V E;  1B7Y B;  1XMO E;  4JI8 E;  4G84 A;  2V8Q B;  1NYQ A;  3RMP A;  2F8B A;  2QHS A;  4P3N A;  4WF2 A;  4DR1 E;  3L2Z A;  1N36 E;  3EFR A;  4J8Z A;  3HXX A;  1BIA A;  3HPZ A;  1ATI A;  3F6H A;  3IAL A;  3VQY A;  2DZ9 A;  3ERR A;  3ICA A;  4LFB E;  1BBW A;  3FJP A;  2UUA E;  2NUE A;  1N9W A;  1B76 A;  4JI7 E;  4LVL A;  3A32 A;  3H09 A;  4OP0 A;  4LF9 E;  4YRC A;  1EOV A;  2B9D A;  3FIG A;  3VYX A;  3J80 C;  2MDR A;  4XTZ A;  4HWT A;  4DV5 E;  2ZTG A;  1ADY A;  4X65 E;  4CH3 A;  1H4T A;  4BC7 A;  2JOB A;  2L3J A;  4DV0 E;  1JJC B;  4P73 C;  2LE2 A;  1YB3 A;  4DMI A;  4BWA A;  4RDX A;  2ZT6 A;  2P5I A;  3DJW A;  2Q7E A;  4NCX A;  4LVM A;  1Z7M A;  3ADG A;  1HR0 E;  4DV1 E;  4RQE A;  1B70 A;  2CIM A;  4LU9 A;  5K1X A;  4H2Y A;  2RS6 A;  4TQD A;  2IHR 1;  4LF8 E;  4DR5 E;  2QHU A;  2ZT7 A;  1NJ6 A;  2LTS A;  2YT4 A;  1X01 A;  3RAC A;  1EIY A;  2LTR A;  1X55 A;  2ZGW A;  4O2D A;  3P1X A;  2EAY A;  4LF6 E;  4JI6 E;  2E1M A;  1N32 E;  1B7Y A;  3AV0 A;  4LTY A;  2KHX A;  4WPY A;  4Q6G A;  3MF2 A;  4KR3 A;  2UUC E;  2DXT A;  3L1A A;  4XTW A;  4YRP A;  4BW9 A;  2CGH A;  1ADJ A;  5HGQ A;  1E24 A;  2ARS A;  3V8L A;  1G5I A;  1W66 A;  4LF5 E;  2JY9 A;  1NJ8 A;  1HNX E;  3RKY A;  4WFT A;  4BBY A;  2Q7G A;  4XTX A;  4JI0 E;  4TVA B;  3ZOQ B;  4DKK A;  3HTZ A;  2CJ9 A;  12AS A;  4P3O A;  4XTY A;  3KWR A;  3IWC A;  1SRY A;  2ZZE A;  4TQF A;  5IWA E;  2VQF E;  3HTX A;  4HVC A;  3MF1 A;  4JV5 E;  3RUX A;  4YRN A;  3PCO A;  4ZTZ B;  2DU5 A;  4TTV A;  2EWN A;  1HTT A;  4YY3 E;  2DVE A;  1N34 E;  2E10 A;  1BIB A;  1T4N A;  2UXD E;  3LLH A;  4JI3 E;  4LFA E;  4HWP A;  1IBL E;  4OX9 E;  3HFZ B;  3TEH B;  3V7S A;  3HRK A;  3VK6 A;  3V8K A;  1WHQ A;  2L92 A;  3QO5 A;  3QO8 A;  4YRQ A;  4GEQ B;  3JU0 A;  2I4M A;  4YRI A;  2LBS B;  2EL9 A;  3V7R A;  2L2K B;  4YRL A;  4RQF A;  3HXY A;  2DB2 A;  2L33 A;  5AE1 A;  1HC7 A;  3DSQ A;  3I7F A;  1SET A;  2EJG A;  2E65 A;  3TEG A;  4WJ4 A;  1ZBQ A;  3P8T A;  2ZIN A;  3NET A;  4P75 A;  4LVI A;  4B3T E;  1NJ5 A;  3T1H E;  3QTC A;  4F9B B;  3QNE A;  4YCU A;  1X49 A;  2DJZ A;  4TVY A;  4YP0 A;  4YRJ A;  3HXZ A;  4HWR A;  1T4L B;  2IY5 B;  1N33 E;  1EQR A;  3UH0 A;  2NUG A;  3HFZ A;  5IT9 C;  4XU1 A;  3A7R A;  4GKJ E;  3TEH A;  4EO4 A;  2E64 A;  5F5W A;  1H4S A;  5LMN E;  2H36 X;  3RF1 A;  3RKW A;  3AUZ A;  4LF7 E;  1PKP A;  4WYQ B;  4E51 A;  2LUQ A;  1QU6 A;  4H2U A;  1X47 A;  4AH6 A;  1G5H A;  1J5W A;  1G51 A;  2ZXF A;  2JR1 A;  2I4L A;  4Q28 A;  3UGT A;  2KOU A;  4YRR A;  2RSM A;  1RIQ A;  3J7Y p;  4CS3 A;  4X62 E;  3A7A A;  3P8V A;  1H4Q A;  5ADZ A;  4KQE A;  4P73 A;  4K86 A;  1HNW E;  1LYL A;  2C8M A;  4K0K E;  1SES A;  1VQZ A;  2WZO A;  2E41 A;  4XTV A;  4DR6 E;  4CH4 A;  4DV2 E;  1E1O A;  1NNH A;  1WXR A;  2B7V A;  4P74 A;  3IKM B;  3M4P A;  4L8N A;  1RC7 A;  2PMF A;  2V86 A;  3QO7 A;  2ZIO A;  1EKZ A;  1WU7 A;  1DI2 A;  1EIY B;  3HY0 A;  4P74 C;  3PCO B;  5FLX C;  3VBB A;  1T4O A;  2I4N A;  4DUY E;  2RHQ B;  1EVK A;  3IKL A;  3HXL A;  2Q5H A;  4JI4 E;  2XGT A;  2ZZF A;  2L8T A;  1FKA E;  1NJ2 A;  4YRT A;  1HNZ E;  1USY A;  3HY1 A;  3LC0 A;  1YZ9 A;  2E1H A;  2RHS B;  4YRS A;  2ZIM A;  4JI2 E;  4I8O A;  1YGB A;  2G7H A;  1WYD A;  5C53 B;  2V87 A;  3OD1 A;  2V88 A;  4R8O A;  3REU A;  3RGL A;  2VE7 C;  3A5Y A;  4LVJ A;  1X48 A;  4X5O A;  3LSS A;  3OTO E;  2DEQ A;  4DQ2 A;  3K6Q A;  4KZS A;  2P0L A;  2DQ3 A;  4F9C B;  5AE2 A;  2LRS A;  2UUB E;  4DR3 E;  4DUZ E;  3C4B A;  2DQ0 A;  4DV7 E;  2ZCE A;  2ZZG A;  3C4T A;  4XTU A;  4G85 A;  1WLE A;  4H2X B;  4P75 C;  4YRM A;  1KMM A;  3RIR A;  3HXW A;  4UP9 A;  4B3S E;  2ZR2 A;  4WJ3 M;  2E5A A;  1ASY A;  2PME A;  3HXU A;  2DMY A;  4F9A B;  3HPS A;  4UPA A;  3HFV A;  4YYE A;  3IWB A;  2Q5I A;  3NEN A;  4H2V A;  1C0A A;  2NS6 A;  3BJU A;  4PHC A;  5E3I A;  1E22 A;  3L4G B;  2QHV A;  4XEM A;  3KFU A;  5F3W A;  1EVL A;  2M7Q A;  2YZT A;  2HHH E;  4OOG C;  3TUP A;  4P71 A;  3JAM C;  4X66 E;  4YRF A;  4P78 A;  1GZ6 A;  2ARU A;  5BR8 E;  1Z7N A;  3T1Y E;  1WPY A;  2RHQ A;  4P72 A;  4RMF A;  2ZM6 E;  2DTI A;  4R03 A;  4TVW A;  1JJC A;  4XU0 A;  4LFC E;  1XMQ E;  4CS2 A;  1IBK E;  2E5L E;  3RL6 A;  2ZR3 A;  1HXD A;  3MEY A;  3ADJ A;  3UFG A;  2ART A;  1X2G A;  1X54 A;  3JTZ A;  5DNY A;  4LF4 E;  1J5E E;  3VYY A;  3IWD A;  4DR7 E;  1IBM E;  1UHZ A;  4DR2 E;  3WQZ A;  2DKG A;  2FV4 B;  2MC6 A;  4B3M E;  3A7U A;  4H2X A;  4P7D A;  1ZBT A;  1O0W A;  2CJA A;  4BMJ A;  2ODR D;  4YHH E;  1B8A A;  3OML A;  2EJF A;  4F54 A;  4OLF A;  4Q15 A;  4UP8 A;  5KNN A;  1PYS B;  3V7C A;  1USY C;  5C52 B;  1YFR A;  2JVA A;  4H2S A;  5AE3 A;  4X8W A;  2AMC B;  1DQ3 A;  4CS4 A;  4TUI A;  2NA2 A;  2L2N A;  4YRK A;  4JYA E;  3J7A G;  1YFS A;  2FGG A;  4TVA A;  2RS7 A;  11AS A;  4P3P A;  3F6G A;  2K4V A;  4XU3 A;  2DIX A;  3R07 A;  4HT4 A;  4P72 C;  4DV4 E;  1YFT A;  4PG3 A;  2ZT5 A;  2L2M A;  4UP7 A;  4ZIB A;  5AAS A;  2ZNI A;  4H2T A;  4LNS A;  4WSP A;  3HXV A;  4P71 C;  4CH5 A;  3ADI A;  3HRI A;  2LJH A;  2ALY B;  4HA8 A;  2EZ6 A;  3DF6 A;  3BFM A;  4KHP E;  3VQX A;  2RTX A;  2V89 A;  3RKX A;  1GGM A;  2CJB A;  4WI1 A;  2EWL A;  4YDQ A;  1STU A;  2A8E A;  2ZNJ A;  2J3L A;  3E9I A;  4YCV A;  5CFF E;  5ELN A;  3CMQ A;  1RQ0 A;  4XEO A;  4H2W A;  4K87 A;  2L6M A;  5ELO A;  2DTO A;  4DR4 E;  3M4Q A;  4ZTU B;  2N3H A;  2AKW B;  5LMU E;  1WNL A;  4BC9 A;  2B3T B;  2L3C A;  1YYO A;  4NXN E;  2B7T A;  1FYF A;  2IY5 A;  5C51 B;  4M2Z A;  1WQ7 A;  2UXC E;  3L4G A;  5A2Q C;  4JI5 E;  2XTI A;  2DU7 A;  3VQW A;  3A74 A;  4M0V A;  3P8Y A;  4LVK A;  4YRG A;  2V83 A;  1XNQ E;  3W3S A;  1QF6 A;  5T6J A;  2HNI A;  1KMN A;  3IG2 A;  2VF1 A;  3NEL A;  2N3G A;  3MSW A;  1B70 B;  1XNR E;  4DV6 E;  3A31 A;  2DSY A;  1EFW A;  2J3M A;  3J81 C;  1WQW A;  4YPF A;  3MQZ A;  4GKK E;  2EJ9 A;  1SR9 A;  2V85 A;  4B3R E;  2MC5 A;  2UU9 E;  3UGQ A;  4AQY E;  2AKW A;  2QHT A;  4KR2 A;  4JI1 E;  2FTX B;  3A5Z A;  2ODR C;  4M30 A;  1FJG E;  2M1S A;  2UXB E;  2DDZ A;  4X64 E;  4DV3 E;  5LL6 R;  2DZC A;  4L87 A;  4YRE A;  4NXM E;  1NYR A;  1KOG A;  1PYS A;  1J26 A;  1I94 E;  2FYK A;  4K88 A;  2JOX A;  1YYW A;  1BBU A;  1X56 A;  2NUF A;  4DPG A;  3LML A;  4BCA A;  1YYK A;  2CPN A;  3PZC A;  2E3C A;  3V8J A;  2Q7H A;  4YCW A;  4EX5 A;  2DTH A;  3NEM A;  1E1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...