2P5IA

Crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
262
Chain Sequence
PWRFLDHTSFGPTFQALQSFAYDDTLCTSIGKSQSPPTLRAWVHHNTVVLGIQDSRLPQIKAGIEALKGFQHDVIVRNSGGLAVVLDSGILNLSLVLKEEKGFSIDDGYELMYELICSMFQEQIEAREIVGSYCPGSYDLSIDGKKFAGISQRRIRGGVAVQIYLCVSGSGAERAKMIRTFYDKAVAGQPTKFVYPRIKPETMASLSELLGQPHNVSDVLLKALMTLQQHGASLLTESLSADEWLLYEQHFARISERNEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein from Bacillus halodurans: Pfam-PF03099
rcsb
source organism Bacillus halodurans c-125
molecule tags Structural genomics, unknown function
molecule keywords BH3822 protein
total genus 82
structure length 262
sequence length 265
ec nomenclature ec 2.3.1.204: Octanoyl-[GcvH]:protein N-octanoyltransferase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2p5iA00
1ATIA 1YGBA 1G5IA 3L2ZA 3REUA 2EL9A 3BFMA 2CJBA 5ELOA 1B8AA 4OP0A 4KR2A 2E64A 4XEMA 4L87A 3LC0A 2CJ9A 4YRSA 3RACA 2G4CA 2XGTA 1IL2A 3P8TA 1FYFA 3L4GB 3L4GA 4YRMA 1BBUA 4TTVA 4YRQA 4HWOA 3VQYA 2DU7A 1B70B 2XTIA 3TEHA 1YFTA 4KR3A 3NENA 3W3SA 1YFSA 1WQ7A 3CMQA 4X5OA 1SRYA 3MF2A 3A7AA 4P3OA 2PMFA 1GGMA 1BIBA 3M4PA 1BBWA 1X2HA 3R07A 2EJ9A 4H2VA 1NJ8A 2C8MA 2AKWB 3L1AA 2ZGWA 1X01A 2ZTGA 4LNSA 4P74A 3IKLA 2FYKA 4XU0A 3V8LA 1E22A 4K86A 2ZT6A 1G5HA 3HFVA 2DTHA 1WNLA 1BIAA 2Q7HA 1ASZA 2I4NA 2ZT7A 3OD1A 4BWAA 4AH6A 4YREA 4BW9A 2DTIA 4Q15A 3LSQA 2ZZFA 2EJGA 3MF1A 4TVYA 3HXZA 4XTXA 1E1TA 3PCOA 3HRKA 3A32A 3QTCA 3ICAA 2ARSA 4YRTA 4UPAA 4P72A 3UFGA 2Q7GA 4XTVA 1HC7A 1KOGA 1N9WA 1PYSA 2ZT5A 1J5WA 4H2XA 4OLFA 2CJAA 4HWRA 4YRGA 3EFRA 3RKWA 1G51A 2J3LA 1EIYA 4XTZA 4RMFA 2P5IA 3A31A 1NJ6A 4G85A 4HWTA 4P3NA 3ERRA 1JJCA 5E3IA 2ODRD 4CS3A 4YRPA 3RL6A 4DQ2A 1Z7NA 1USYA 1B70A 4P75A 1JJCB 1H4SA 2DZ9A 3NEMA 2ZNJA 1WQWA 4RQFA 1HXDA 3KFUA 3A5YA 4HWPA 4UP9A 1L0WA 4XU2A 4YRCA 4TQDA 4YCWA 4YPFA 4P74C 1EVKA 3V7RA 3IALA 2DTOA 2I4OA 2E3CA 4H2XB 1WYDA 3RGLA 3QNEA 4H2YA 1E1OA 4K87A 11ASA 2IY5B 4P71C 3E9HA 4J15A 2ARUA 3HXWA 4WJ4A 1KMNA 4H2TA 1NNHA 3HTZA 2RHSA 4XTYA 4H02A 2RHQA 2ZT8A 3IKMB 3A7RA 1NYRA 2ZZGA 1QF6A 3HY0A 4TVAA 3P8VA 2ZINA 1EOVA 1LYLA 3FJPA 4P75C 3A7UA 3UH0A 4YRIA 2HNIA 1E24A 1RIQA 2DJZA 3HXUA 3RIRA 4ZTUB 4EX5A 4ZTZB 1WU7A 3HFZB 3I7FA 5ELNA 1EIYB 4TWAA 1NJ1A 3RF1A 4RDXA 2I4MA 2RHSB 1PYSB 3MEYA 2IY5A 4H2WA 3PZCA 3RUXA 2PMEA 3RKXA 1X55A 2DXTA 4UP7A 3V7CA 4WJ3M 4HVCA 4G84A 4PHCA 4YRNA 1QE0A 1EVLA 3VQVA 1YB3A 3QO5A 4XEOA 5F5WA 2ZCEA 2DU5A 5KNNA 4YP0A 4K88A 3HFZA 2ZXFA 4ZIBA 2QHUA 2DEQA 2ZNIA 1EQRA 3NETA 4DPGA 3HXXA 3REXA 4CH3A 4EO4A 3EFSA 1X2GA 2ZZEA 3HY1A 2Q5HA 4CS2A 2AMCB 2EJFA 2QHSA 2E1HA 2ZR2A 2CIMA 1H4VB 4E51A 2J3MA 5K1XA 4YCVA 2ALYB 1NJ5A 2E41A 2EAYA 3IG2A 3PCOB 3UGTA 2RHQB 4CS4A 4O2DA 4TVAB 2C7IA 3QO8A 4YRFA 2QHVA 1SETA 2DVEA 4UP8A 1KMMA 1EFWA 3NELA 2ALYA 4YRKA 3V8KA 3HXYA 1NYQA 4P71A 1B76A 3QO7A 3RKYA 2E10A 4WI1A 4XTUA 2Q7EA 3VQWA 5C53B 2QHTA 4YROA 1YFRA 5HGQA 3E9IA 1W66A 1X54A 4P3PA 12ASA 1SERA 4H2UA 2DQ3A 3A5ZA 2AKWA 1VQZA 3HRIA 1WPYA 3M4QA 1HTTA 2CGHA 3V8JA 1SESA 3DSQA 3LSSA 4P73A 3WQZA 3BJUA 2ARTA 2AMCA 2ZR3A 4HA8A 4CH5A 3UGQA 2Q5IA 1ASYA 2EWNA 2P0LA 3HXVA 4YRRA 4YRJA 1ADYA 4YRLA 4HWSA 4WF2A 3TEGA 3A74A 2ZIMA 2E5AA 5C52B 4XTWA 4PG3A 4XU3A 4RQEA 1ADJA 1B7YA 5C51B 1USYC 4CH6A 3G1ZA 3VBBA 4XU1A 3VQXA 1WLEA 4P73C 1NJ2A 2E65A 1C0AA 4YCUA 2DQ0A 3V7SA 4Q6GA 4TVWA 3P8YA 1B7YB 4TQFA 2ZIOA 1Z7MA 2DZCA 2DKGA 2DDZA 1H4QA 1X56A 2DXUA 2I4LA 2ODRC 4YDQA 1H4TA 4KQEA 4YYEA 3TEHB 3TUPA 4P72C 4CH4A 4NCXA 5K1PA 4H2SA
chains in the Genus database with same CATH superfamily
1ATIA 1YGBA 1G5IA 3L2ZA 3REUA 2EL9A 3BFMA 2CJBA 5ELOA 1B8AA 4OP0A 4KR2A 2E64A 4XEMA 4L87A 3LC0A 2CJ9A 2NS6A 4YRSA 3RACA 2G4CA 2XGTA 1IL2A 3P8TA 1FYFA 3L4GB 3L4GA 4YRMA 1BBUA 4TTVA 4YRQA 4HWOA 3VQYA 2DU7A 1B70B 2XTIA 3TEHA 1YFTA 4KR3A 3NENA 3W3SA 1YFSA 1WQ7A 3CMQA 4X5OA 1SRYA 3MF2A 4P3OA 3A7AA 2PMFA 1GGMA 1BIBA 3M4PA 4LVKA 1BBWA 1X2HA 3R07A 2EJ9A 4H2VA 4LVMA 1NJ8A 2C8MA 2AKWB 3L1AA 2ZGWA 1X01A 2ZTGA 4LNSA 4P74A 3IKLA 2FYKA 4XU0A 3V8LA 1E22A 4K86A 2ZT6A 1G5HA 3HFVA 2DTHA 1WNLA 1BIAA 2Q7HA 1ASZA 2I4NA 2ZT7A 3OD1A 4BWAA 4AH6A 4YREA 4BW9A 2DTIA 4Q15A 3LSQA 2ZZFA 2EJGA 3MF1A 4TVYA 3HXZA 4XTXA 1E1TA 3PCOA 3HRKA 3A32A 3QTCA 3ICAA 2ARSA 4YRTA 4UPAA 4P72A 3UFGA 2Q7GA 4XTVA 1HC7A 1KOGA 1N9WA 1PYSA 2ZT5A 1J5WA 4H2XA 4OLFA 2CJAA 4HWRA 4YRGA 3EFRA 3RKWA 1G51A 2J3LA 1EIYA 4XTZA 4RMFA 2P5IA 3A31A 1NJ6A 4G85A 4HWTA 4P3NA 3ERRA 1JJCA 5E3IA 2ODRD 4CS3A 4YRPA 3RL6A 4DQ2A 1Z7NA 1USYA 1B70A 4P75A 1JJCB 1H4SA 2DZ9A 3NEMA 2ZNJA 1WQWA 4RQFA 1HXDA 3KFUA 3A5YA 3MQZA 4HWPA 4UP9A 1L0WA 4XU2A 4YRCA 4TQDA 4YCWA 4YPFA 4P74C 1EVKA 3V7RA 3IALA 2DTOA 2I4OA 2E3CA 4H2XB 1WYDA 3RGLA 3QNEA 4H2YA 1E1OA 4K87A 11ASA 2IY5B 4P71C 3E9HA 4J15A 2ARUA 3HXWA 4WJ4A 1KMNA 4H2TA 1NNHA 3HTZA 2RHSA 4XTYA 4H02A 2RHQA 2ZT8A 3IKMB 3A7RA 1NYRA 2ZZGA 1QF6A 3HY0A 4TVAA 3P8VA 2ZINA 1EOVA 1LYLA 3FJPA 4P75C 3A7UA 3UH0A 4YRIA 2HNIA 1E24A 1RIQA 2DJZA 3HXUA 3RIRA 4ZTUB 4EX5A 4ZTZB 1WU7A 4HT4A 3HFZB 3I7FA 5ELNA 1EIYB 4TWAA 1NJ1A 3RF1A 4RDXA 2I4MA 2RHSB 1PYSB 3MEYA 2IY5A 4H2WA 3PZCA 3RUXA 4LVIA 2PMEA 3RKXA 1X55A 2DXTA 4UP7A 3V7CA 4WJ3M 4HVCA 4G84A 4PHCA 4YRNA 1QE0A 1EVLA 3VQVA 1YB3A 3QO5A 4XEOA 5F5WA 2ZCEA 2DU5A 5KNNA 4LVLA 4YP0A 4K88A 3HFZA 2ZXFA 4ZIBA 2QHUA 2DEQA 2ZNIA 1EQRA 3NETA 4DPGA 3HXXA 3REXA 4CH3A 4EO4A 3EFSA 1X2GA 2ZZEA 3HY1A 2Q5HA 4CS2A 2AMCB 2EJFA 2QHSA 2E1HA 2ZR2A 2CIMA 1H4VB 4E51A 2J3MA 5K1XA 4YCVA 2ALYB 1NJ5A 2E41A 2EAYA 3IG2A 3PCOB 3UGTA 2RHQB 4CS4A 4O2DA 4TVAB 2C7IA 3QO8A 4YRFA 2QHVA 1SETA 2DVEA 4UP8A 1KMMA 1EFWA 3NELA 2ALYA 4YRKA 3V8KA 3HXYA 1NYQA 4P71A 1B76A 3QO7A 3RKYA 2E10A 4WI1A 4XTUA 2Q7EA 3VQWA 5C53B 2QHTA 4YROA 1YFRA 5HGQA 3E9IA 1W66A 1X54A 4P3PA 12ASA 1SERA 4H2UA 2DQ3A 3A5ZA 2AKWA 1VQZA 3HRIA 1WPYA 3M4QA 1HTTA 2CGHA 3V8JA 1SESA 3DSQA 3LSSA 4P73A 3WQZA 3BJUA 2ARTA 2AMCA 2ZR3A 4HA8A 4CH5A 3UGQA 2Q5IA 1ASYA 2EWNA 2P0LA 3HXVA 4YRRA 4YRJA 1ADYA 4YRLA 4HWSA 4WF2A 3TEGA 3A74A 2ZIMA 2E5AA 5C52B 4XTWA 4PG3A 4XU3A 4RQEA 1ADJA 1B7YA 5C51B 1USYC 2A8EA 4CH6A 3G1ZA 3VBBA 4XU1A 3VQXA 1WLEA 4P73C 1NJ2A 2E65A 1C0AA 4YCUA 2DQ0A 3V7SA 4Q6GA 4TVWA 3P8YA 1B7YB 4TQFA 2ZIOA 1Z7MA 2DZCA 2DKGA 2DDZA 1H4QA 1X56A 2DXUA 2I4LA 2ODRC 4YDQA 1H4TA 4KQEA 4YYEA 3TEHB 3TUPA 4P72C 4CH4A 4NCXA 4LVJA 5K1PA 4H2SA
chains in the Genus database with same CATH topology
1ATIA 1YGBA 1G5IA 3L2ZA 3REUA 2EL9A 3BFMA 2CJBA 5ELOA 1B8AA 4OP0A 4KR2A 2E64A 4XEMA 4L87A 3LC0A 2CJ9A 2NS6A 4YRSA 3RACA 2G4CA 2XGTA 1IL2A 3P8TA 1FYFA 3L4GB 3L4GA 4YRMA 1BBUA 4TTVA 4YRQA 4HWOA 3VQYA 2DU7A 1B70B 2XTIA 3TEHA 1YFTA 4KR3A 3NENA 3W3SA 1YFSA 1WQ7A 3CMQA 4X5OA 1SRYA 3MF2A 4P3OA 3A7AA 2PMFA 1GGMA 1BIBA 3M4PA 4LVKA 1BBWA 1X2HA 3R07A 2EJ9A 4H2VA 4LVMA 1NJ8A 2C8MA 2AKWB 3L1AA 2ZGWA 1X01A 2ZTGA 4LNSA 4P74A 3IKLA 2FYKA 4XU0A 3V8LA 1E22A 4K86A 2ZT6A 1G5HA 3HFVA 2DTHA 1WNLA 1BIAA 2Q7HA 1ASZA 2I4NA 2ZT7A 3OD1A 4BWAA 4AH6A 4YREA 4BW9A 2DTIA 4Q15A 3LSQA 2ZZFA 2EJGA 3MF1A 4TVYA 3HXZA 4XTXA 1E1TA 3PCOA 3HRKA 3A32A 3QTCA 3ICAA 2ARSA 4YRTA 4UPAA 4P72A 3UFGA 2Q7GA 4XTVA 1HC7A 1KOGA 1N9WA 1PYSA 2ZT5A 1J5WA 4H2XA 4OLFA 2CJAA 4HWRA 4YRGA 3EFRA 3RKWA 1G51A 2J3LA 1EIYA 4XTZA 4RMFA 2P5IA 3A31A 1NJ6A 4G85A 4HWTA 4P3NA 3ERRA 1JJCA 5E3IA 2ODRD 4CS3A 4YRPA 3RL6A 4DQ2A 1Z7NA 1USYA 1B70A 4P75A 1JJCB 1H4SA 2DZ9A 3NEMA 2ZNJA 1WQWA 4RQFA 1HXDA 3KFUA 3A5YA 3MQZA 4HWPA 4UP9A 1L0WA 4XU2A 4YRCA 4TQDA 4YCWA 4YPFA 4P74C 1EVKA 3V7RA 3IALA 2DTOA 2I4OA 2E3CA 4H2XB 1WYDA 3RGLA 3QNEA 4H2YA 1E1OA 4K87A 11ASA 2IY5B 4P71C 3E9HA 4J15A 2ARUA 3HXWA 4WJ4A 1KMNA 4H2TA 1NNHA 3HTZA 2RHSA 4XTYA 4H02A 2RHQA 2ZT8A 3IKMB 3A7RA 1NYRA 2ZZGA 1QF6A 3HY0A 4TVAA 3P8VA 2ZINA 1EOVA 1LYLA 3FJPA 4P75C 3A7UA 3UH0A 4YRIA 2HNIA 1E24A 1RIQA 2DJZA 3HXUA 3RIRA 4ZTUB 4EX5A 4ZTZB 1WU7A 4HT4A 3HFZB 3I7FA 5ELNA 1EIYB 4TWAA 1NJ1A 3RF1A 4RDXA 2I4MA 2RHSB 1PYSB 3MEYA 2IY5A 4H2WA 3PZCA 3RUXA 4LVIA 2PMEA 3RKXA 1X55A 2DXTA 4UP7A 3V7CA 4WJ3M 4HVCA 4G84A 4PHCA 4YRNA 1QE0A 1EVLA 3VQVA 1YB3A 3QO5A 4XEOA 5F5WA 2ZCEA 2DU5A 5KNNA 4LVLA 4YP0A 4K88A 3HFZA 2ZXFA 4ZIBA 2QHUA 2DEQA 2ZNIA 1EQRA 3NETA 4DPGA 3HXXA 3REXA 4CH3A 4EO4A 3EFSA 1X2GA 2ZZEA 3HY1A 2Q5HA 4CS2A 2AMCB 2EJFA 2QHSA 2E1HA 2ZR2A 2CIMA 1H4VB 4E51A 2J3MA 5K1XA 4YCVA 2ALYB 1NJ5A 2E41A 2EAYA 3IG2A 3PCOB 3UGTA 2RHQB 4CS4A 4O2DA 4TVAB 2C7IA 3QO8A 4YRFA 2QHVA 1SETA 2DVEA 4UP8A 1KMMA 1EFWA 3NELA 2ALYA 4YRKA 3V8KA 3HXYA 1NYQA 4P71A 1B76A 3QO7A 3RKYA 2E10A 4WI1A 4XTUA 2Q7EA 3VQWA 5C53B 2QHTA 4YROA 1YFRA 5HGQA 3E9IA 1W66A 1X54A 4P3PA 12ASA 1SERA 4H2UA 2DQ3A 3A5ZA 2AKWA 1VQZA 3HRIA 1WPYA 3M4QA 1HTTA 2CGHA 3V8JA 1SESA 3DSQA 3LSSA 4P73A 3WQZA 3BJUA 2ARTA 2AMCA 2ZR3A 4HA8A 4CH5A 3UGQA 2Q5IA 1ASYA 2EWNA 2P0LA 3HXVA 4YRRA 4YRJA 1ADYA 4YRLA 4HWSA 4WF2A 3TEGA 3A74A 2ZIMA 2E5AA 5C52B 4XTWA 4PG3A 4XU3A 4RQEA 1ADJA 1B7YA 5C51B 1USYC 2A8EA 4CH6A 3G1ZA 3VBBA 4XU1A 3VQXA 1WLEA 4P73C 1NJ2A 2E65A 1C0AA 4YCUA 2DQ0A 3V7SA 4Q6GA 4TVWA 3P8YA 1B7YB 4TQFA 2ZIOA 1Z7MA 2DZCA 2DKGA 2DDZA 1H4QA 1X56A 2DXUA 2I4LA 2ODRC 4YDQA 1H4TA 4KQEA 4YYEA 3TEHB 3TUPA 4P72C 4CH4A 4NCXA 4LVJA 5K1PA 4H2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATI A;  1YGB A;  1G5I A;  3L2Z A;  3REU A;  2EL9 A;  3BFM A;  2CJB A;  5ELO A;  1B8A A;  4OP0 A;  4KR2 A;  2E64 A;  4XEM A;  4L87 A;  3LC0 A;  2CJ9 A;  4YRS A;  3RAC A;  2G4C A;  2XGT A;  1IL2 A;  3P8T A;  1FYF A;  3L4G B;  3L4G A;  4YRM A;  1BBU A;  4TTV A;  4YRQ A;  4HWO A;  3VQY A;  2DU7 A;  1B70 B;  2XTI A;  3TEH A;  1YFT A;  4KR3 A;  3NEN A;  3W3S A;  1YFS A;  1WQ7 A;  3CMQ A;  4X5O A;  1SRY A;  3MF2 A;  3A7A A;  4P3O A;  2PMF A;  1GGM A;  1BIB A;  3M4P A;  1BBW A;  1X2H A;  3R07 A;  2EJ9 A;  4H2V A;  1NJ8 A;  2C8M A;  2AKW B;  3L1A A;  2ZGW A;  1X01 A;  2ZTG A;  4LNS A;  4P74 A;  3IKL A;  2FYK A;  4XU0 A;  3V8L A;  1E22 A;  4K86 A;  2ZT6 A;  1G5H A;  3HFV A;  2DTH A;  1WNL A;  1BIA A;  2Q7H A;  1ASZ A;  2I4N A;  2ZT7 A;  3OD1 A;  4BWA A;  4AH6 A;  4YRE A;  4BW9 A;  2DTI A;  4Q15 A;  3LSQ A;  2ZZF A;  2EJG A;  3MF1 A;  4TVY A;  3HXZ A;  4XTX A;  1E1T A;  3PCO A;  3HRK A;  3A32 A;  3QTC A;  3ICA A;  2ARS A;  4YRT A;  4UPA A;  4P72 A;  3UFG A;  2Q7G A;  4XTV A;  1HC7 A;  1KOG A;  1N9W A;  1PYS A;  2ZT5 A;  1J5W A;  4H2X A;  4OLF A;  2CJA A;  4HWR A;  4YRG A;  3EFR A;  3RKW A;  1G51 A;  2J3L A;  1EIY A;  4XTZ A;  4RMF A;  2P5I A;  3A31 A;  1NJ6 A;  4G85 A;  4HWT A;  4P3N A;  3ERR A;  1JJC A;  5E3I A;  2ODR D;  4CS3 A;  4YRP A;  3RL6 A;  4DQ2 A;  1Z7N A;  1USY A;  1B70 A;  4P75 A;  1JJC B;  1H4S A;  2DZ9 A;  3NEM A;  2ZNJ A;  1WQW A;  4RQF A;  1HXD A;  3KFU A;  3A5Y A;  4HWP A;  4UP9 A;  1L0W A;  4XU2 A;  4YRC A;  4TQD A;  4YCW A;  4YPF A;  4P74 C;  1EVK A;  3V7R A;  3IAL A;  2DTO A;  2I4O A;  2E3C A;  4H2X B;  1WYD A;  3RGL A;  3QNE A;  4H2Y A;  1E1O A;  4K87 A;  11AS A;  2IY5 B;  4P71 C;  3E9H A;  4J15 A;  2ARU A;  3HXW A;  4WJ4 A;  1KMN A;  4H2T A;  1NNH A;  3HTZ A;  2RHS A;  4XTY A;  4H02 A;  2RHQ A;  2ZT8 A;  3IKM B;  3A7R A;  1NYR A;  2ZZG A;  1QF6 A;  3HY0 A;  4TVA A;  3P8V A;  2ZIN A;  1EOV A;  1LYL A;  3FJP A;  4P75 C;  3A7U A;  3UH0 A;  4YRI A;  2HNI A;  1E24 A;  1RIQ A;  2DJZ A;  3HXU A;  3RIR A;  4ZTU B;  4EX5 A;  4ZTZ B;  1WU7 A;  3HFZ B;  3I7F A;  5ELN A;  1EIY B;  4TWA A;  1NJ1 A;  3RF1 A;  4RDX A;  2I4M A;  2RHS B;  1PYS B;  3MEY A;  2IY5 A;  4H2W A;  3PZC A;  3RUX A;  2PME A;  3RKX A;  1X55 A;  2DXT A;  4UP7 A;  3V7C A;  4WJ3 M;  4HVC A;  4G84 A;  4PHC A;  4YRN A;  1QE0 A;  1EVL A;  3VQV A;  1YB3 A;  3QO5 A;  4XEO A;  5F5W A;  2ZCE A;  2DU5 A;  5KNN A;  4YP0 A;  4K88 A;  3HFZ A;  2ZXF A;  4ZIB A;  2QHU A;  2DEQ A;  2ZNI A;  1EQR A;  3NET A;  4DPG A;  3HXX A;  3REX A;  4CH3 A;  4EO4 A;  3EFS A;  1X2G A;  2ZZE A;  3HY1 A;  2Q5H A;  4CS2 A;  2AMC B;  2EJF A;  2QHS A;  2E1H A;  2ZR2 A;  2CIM A;  1H4V B;  4E51 A;  2J3M A;  5K1X A;  4YCV A;  2ALY B;  1NJ5 A;  2E41 A;  2EAY A;  3IG2 A;  3PCO B;  3UGT A;  2RHQ B;  4CS4 A;  4O2D A;  4TVA B;  2C7I A;  3QO8 A;  4YRF A;  2QHV A;  1SET A;  2DVE A;  4UP8 A;  1KMM A;  1EFW A;  3NEL A;  2ALY A;  4YRK A;  3V8K A;  3HXY A;  1NYQ A;  4P71 A;  1B76 A;  3QO7 A;  3RKY A;  2E10 A;  4WI1 A;  4XTU A;  2Q7E A;  3VQW A;  5C53 B;  2QHT A;  4YRO A;  1YFR A;  5HGQ A;  3E9I A;  1W66 A;  1X54 A;  4P3P A;  12AS A;  1SER A;  4H2U A;  2DQ3 A;  3A5Z A;  2AKW A;  1VQZ A;  3HRI A;  1WPY A;  3M4Q A;  1HTT A;  2CGH A;  3V8J A;  1SES A;  3DSQ A;  3LSS A;  4P73 A;  3WQZ A;  3BJU A;  2ART A;  2AMC A;  2ZR3 A;  4HA8 A;  4CH5 A;  3UGQ A;  2Q5I A;  1ASY A;  2EWN A;  2P0L A;  3HXV A;  4YRR A;  4YRJ A;  1ADY A;  4YRL A;  4HWS A;  4WF2 A;  3TEG A;  3A74 A;  2ZIM A;  2E5A A;  5C52 B;  4XTW A;  4PG3 A;  4XU3 A;  4RQE A;  1ADJ A;  1B7Y A;  5C51 B;  1USY C;  4CH6 A;  3G1Z A;  3VBB A;  4XU1 A;  3VQX A;  1WLE A;  4P73 C;  1NJ2 A;  2E65 A;  1C0A A;  4YCU A;  2DQ0 A;  3V7S A;  4Q6G A;  4TVW A;  3P8Y A;  1B7Y B;  4TQF A;  2ZIO A;  1Z7M A;  2DZC A;  2DKG A;  2DDZ A;  1H4Q A;  1X56 A;  2DXU A;  2I4L A;  2ODR C;  4YDQ A;  1H4T A;  4KQE A;  4YYE A;  3TEH B;  3TUP A;  4P72 C;  4CH4 A;  4NCX A;  5K1P A;  4H2S A; 
#chains in the Genus database with same CATH topology
 1ATI A;  1YGB A;  1G5I A;  3L2Z A;  3REU A;  2EL9 A;  3BFM A;  2CJB A;  5ELO A;  1B8A A;  4OP0 A;  4KR2 A;  2E64 A;  4XEM A;  4L87 A;  3LC0 A;  2CJ9 A;  2NS6 A;  4YRS A;  3RAC A;  2G4C A;  2XGT A;  1IL2 A;  3P8T A;  1FYF A;  3L4G B;  3L4G A;  4YRM A;  1BBU A;  4TTV A;  4YRQ A;  4HWO A;  3VQY A;  2DU7 A;  1B70 B;  2XTI A;  3TEH A;  1YFT A;  4KR3 A;  3NEN A;  3W3S A;  1YFS A;  1WQ7 A;  3CMQ A;  4X5O A;  1SRY A;  3MF2 A;  4P3O A;  3A7A A;  2PMF A;  1GGM A;  1BIB A;  3M4P A;  4LVK A;  1BBW A;  1X2H A;  3R07 A;  2EJ9 A;  4H2V A;  4LVM A;  1NJ8 A;  2C8M A;  2AKW B;  3L1A A;  2ZGW A;  1X01 A;  2ZTG A;  4LNS A;  4P74 A;  3IKL A;  2FYK A;  4XU0 A;  3V8L A;  1E22 A;  4K86 A;  2ZT6 A;  1G5H A;  3HFV A;  2DTH A;  1WNL A;  1BIA A;  2Q7H A;  1ASZ A;  2I4N A;  2ZT7 A;  3OD1 A;  4BWA A;  4AH6 A;  4YRE A;  4BW9 A;  2DTI A;  4Q15 A;  3LSQ A;  2ZZF A;  2EJG A;  3MF1 A;  4TVY A;  3HXZ A;  4XTX A;  1E1T A;  3PCO A;  3HRK A;  3A32 A;  3QTC A;  3ICA A;  2ARS A;  4YRT A;  4UPA A;  4P72 A;  3UFG A;  2Q7G A;  4XTV A;  1HC7 A;  1KOG A;  1N9W A;  1PYS A;  2ZT5 A;  1J5W A;  4H2X A;  4OLF A;  2CJA A;  4HWR A;  4YRG A;  3EFR A;  3RKW A;  1G51 A;  2J3L A;  1EIY A;  4XTZ A;  4RMF A;  2P5I A;  3A31 A;  1NJ6 A;  4G85 A;  4HWT A;  4P3N A;  3ERR A;  1JJC A;  5E3I A;  2ODR D;  4CS3 A;  4YRP A;  3RL6 A;  4DQ2 A;  1Z7N A;  1USY A;  1B70 A;  4P75 A;  1JJC B;  1H4S A;  2DZ9 A;  3NEM A;  2ZNJ A;  1WQW A;  4RQF A;  1HXD A;  3KFU A;  3A5Y A;  3MQZ A;  4HWP A;  4UP9 A;  1L0W A;  4XU2 A;  4YRC A;  4TQD A;  4YCW A;  4YPF A;  4P74 C;  1EVK A;  3V7R A;  3IAL A;  2DTO A;  2I4O A;  2E3C A;  4H2X B;  1WYD A;  3RGL A;  3QNE A;  4H2Y A;  1E1O A;  4K87 A;  11AS A;  2IY5 B;  4P71 C;  3E9H A;  4J15 A;  2ARU A;  3HXW A;  4WJ4 A;  1KMN A;  4H2T A;  1NNH A;  3HTZ A;  2RHS A;  4XTY A;  4H02 A;  2RHQ A;  2ZT8 A;  3IKM B;  3A7R A;  1NYR A;  2ZZG A;  1QF6 A;  3HY0 A;  4TVA A;  3P8V A;  2ZIN A;  1EOV A;  1LYL A;  3FJP A;  4P75 C;  3A7U A;  3UH0 A;  4YRI A;  2HNI A;  1E24 A;  1RIQ A;  2DJZ A;  3HXU A;  3RIR A;  4ZTU B;  4EX5 A;  4ZTZ B;  1WU7 A;  4HT4 A;  3HFZ B;  3I7F A;  5ELN A;  1EIY B;  4TWA A;  1NJ1 A;  3RF1 A;  4RDX A;  2I4M A;  2RHS B;  1PYS B;  3MEY A;  2IY5 A;  4H2W A;  3PZC A;  3RUX A;  4LVI A;  2PME A;  3RKX A;  1X55 A;  2DXT A;  4UP7 A;  3V7C A;  4WJ3 M;  4HVC A;  4G84 A;  4PHC A;  4YRN A;  1QE0 A;  1EVL A;  3VQV A;  1YB3 A;  3QO5 A;  4XEO A;  5F5W A;  2ZCE A;  2DU5 A;  5KNN A;  4LVL A;  4YP0 A;  4K88 A;  3HFZ A;  2ZXF A;  4ZIB A;  2QHU A;  2DEQ A;  2ZNI A;  1EQR A;  3NET A;  4DPG A;  3HXX A;  3REX A;  4CH3 A;  4EO4 A;  3EFS A;  1X2G A;  2ZZE A;  3HY1 A;  2Q5H A;  4CS2 A;  2AMC B;  2EJF A;  2QHS A;  2E1H A;  2ZR2 A;  2CIM A;  1H4V B;  4E51 A;  2J3M A;  5K1X A;  4YCV A;  2ALY B;  1NJ5 A;  2E41 A;  2EAY A;  3IG2 A;  3PCO B;  3UGT A;  2RHQ B;  4CS4 A;  4O2D A;  4TVA B;  2C7I A;  3QO8 A;  4YRF A;  2QHV A;  1SET A;  2DVE A;  4UP8 A;  1KMM A;  1EFW A;  3NEL A;  2ALY A;  4YRK A;  3V8K A;  3HXY A;  1NYQ A;  4P71 A;  1B76 A;  3QO7 A;  3RKY A;  2E10 A;  4WI1 A;  4XTU A;  2Q7E A;  3VQW A;  5C53 B;  2QHT A;  4YRO A;  1YFR A;  5HGQ A;  3E9I A;  1W66 A;  1X54 A;  4P3P A;  12AS A;  1SER A;  4H2U A;  2DQ3 A;  3A5Z A;  2AKW A;  1VQZ A;  3HRI A;  1WPY A;  3M4Q A;  1HTT A;  2CGH A;  3V8J A;  1SES A;  3DSQ A;  3LSS A;  4P73 A;  3WQZ A;  3BJU A;  2ART A;  2AMC A;  2ZR3 A;  4HA8 A;  4CH5 A;  3UGQ A;  2Q5I A;  1ASY A;  2EWN A;  2P0L A;  3HXV A;  4YRR A;  4YRJ A;  1ADY A;  4YRL A;  4HWS A;  4WF2 A;  3TEG A;  3A74 A;  2ZIM A;  2E5A A;  5C52 B;  4XTW A;  4PG3 A;  4XU3 A;  4RQE A;  1ADJ A;  1B7Y A;  5C51 B;  1USY C;  2A8E A;  4CH6 A;  3G1Z A;  3VBB A;  4XU1 A;  3VQX A;  1WLE A;  4P73 C;  1NJ2 A;  2E65 A;  1C0A A;  4YCU A;  2DQ0 A;  3V7S A;  4Q6G A;  4TVW A;  3P8Y A;  1B7Y B;  4TQF A;  2ZIO A;  1Z7M A;  2DZC A;  2DKG A;  2DDZ A;  1H4Q A;  1X56 A;  2DXU A;  2I4L A;  2ODR C;  4YDQ A;  1H4T A;  4KQE A;  4YYE A;  3TEH B;  3TUP A;  4P72 C;  4CH4 A;  4NCX A;  4LVJ A;  5K1P A;  4H2S A; 
#chains in the Genus database with same CATH homology
 1ATI A;  1YGB A;  1G5I A;  3L2Z A;  3REU A;  2EL9 A;  3BFM A;  2CJB A;  5ELO A;  1B8A A;  4OP0 A;  4KR2 A;  2E64 A;  4XEM A;  4L87 A;  3LC0 A;  2CJ9 A;  2NS6 A;  4YRS A;  3RAC A;  2G4C A;  2XGT A;  1IL2 A;  3P8T A;  1FYF A;  3L4G B;  3L4G A;  4YRM A;  1BBU A;  4TTV A;  4YRQ A;  4HWO A;  3VQY A;  2DU7 A;  1B70 B;  2XTI A;  3TEH A;  1YFT A;  4KR3 A;  3NEN A;  3W3S A;  1YFS A;  1WQ7 A;  3CMQ A;  4X5O A;  1SRY A;  3MF2 A;  4P3O A;  3A7A A;  2PMF A;  1GGM A;  1BIB A;  3M4P A;  4LVK A;  1BBW A;  1X2H A;  3R07 A;  2EJ9 A;  4H2V A;  4LVM A;  1NJ8 A;  2C8M A;  2AKW B;  3L1A A;  2ZGW A;  1X01 A;  2ZTG A;  4LNS A;  4P74 A;  3IKL A;  2FYK A;  4XU0 A;  3V8L A;  1E22 A;  4K86 A;  2ZT6 A;  1G5H A;  3HFV A;  2DTH A;  1WNL A;  1BIA A;  2Q7H A;  1ASZ A;  2I4N A;  2ZT7 A;  3OD1 A;  4BWA A;  4AH6 A;  4YRE A;  4BW9 A;  2DTI A;  4Q15 A;  3LSQ A;  2ZZF A;  2EJG A;  3MF1 A;  4TVY A;  3HXZ A;  4XTX A;  1E1T A;  3PCO A;  3HRK A;  3A32 A;  3QTC A;  3ICA A;  2ARS A;  4YRT A;  4UPA A;  4P72 A;  3UFG A;  2Q7G A;  4XTV A;  1HC7 A;  1KOG A;  1N9W A;  1PYS A;  2ZT5 A;  1J5W A;  4H2X A;  4OLF A;  2CJA A;  4HWR A;  4YRG A;  3EFR A;  3RKW A;  1G51 A;  2J3L A;  1EIY A;  4XTZ A;  4RMF A;  2P5I A;  3A31 A;  1NJ6 A;  4G85 A;  4HWT A;  4P3N A;  3ERR A;  1JJC A;  5E3I A;  2ODR D;  4CS3 A;  4YRP A;  3RL6 A;  4DQ2 A;  1Z7N A;  1USY A;  1B70 A;  4P75 A;  1JJC B;  1H4S A;  2DZ9 A;  3NEM A;  2ZNJ A;  1WQW A;  4RQF A;  1HXD A;  3KFU A;  3A5Y A;  3MQZ A;  4HWP A;  4UP9 A;  1L0W A;  4XU2 A;  4YRC A;  4TQD A;  4YCW A;  4YPF A;  4P74 C;  1EVK A;  3V7R A;  3IAL A;  2DTO A;  2I4O A;  2E3C A;  4H2X B;  1WYD A;  3RGL A;  3QNE A;  4H2Y A;  1E1O A;  4K87 A;  11AS A;  2IY5 B;  4P71 C;  3E9H A;  4J15 A;  2ARU A;  3HXW A;  4WJ4 A;  1KMN A;  4H2T A;  1NNH A;  3HTZ A;  2RHS A;  4XTY A;  4H02 A;  2RHQ A;  2ZT8 A;  3IKM B;  3A7R A;  1NYR A;  2ZZG A;  1QF6 A;  3HY0 A;  4TVA A;  3P8V A;  2ZIN A;  1EOV A;  1LYL A;  3FJP A;  4P75 C;  3A7U A;  3UH0 A;  4YRI A;  2HNI A;  1E24 A;  1RIQ A;  2DJZ A;  3HXU A;  3RIR A;  4ZTU B;  4EX5 A;  4ZTZ B;  1WU7 A;  4HT4 A;  3HFZ B;  3I7F A;  5ELN A;  1EIY B;  4TWA A;  1NJ1 A;  3RF1 A;  4RDX A;  2I4M A;  2RHS B;  1PYS B;  3MEY A;  2IY5 A;  4H2W A;  3PZC A;  3RUX A;  4LVI A;  2PME A;  3RKX A;  1X55 A;  2DXT A;  4UP7 A;  3V7C A;  4WJ3 M;  4HVC A;  4G84 A;  4PHC A;  4YRN A;  1QE0 A;  1EVL A;  3VQV A;  1YB3 A;  3QO5 A;  4XEO A;  5F5W A;  2ZCE A;  2DU5 A;  5KNN A;  4LVL A;  4YP0 A;  4K88 A;  3HFZ A;  2ZXF A;  4ZIB A;  2QHU A;  2DEQ A;  2ZNI A;  1EQR A;  3NET A;  4DPG A;  3HXX A;  3REX A;  4CH3 A;  4EO4 A;  3EFS A;  1X2G A;  2ZZE A;  3HY1 A;  2Q5H A;  4CS2 A;  2AMC B;  2EJF A;  2QHS A;  2E1H A;  2ZR2 A;  2CIM A;  1H4V B;  4E51 A;  2J3M A;  5K1X A;  4YCV A;  2ALY B;  1NJ5 A;  2E41 A;  2EAY A;  3IG2 A;  3PCO B;  3UGT A;  2RHQ B;  4CS4 A;  4O2D A;  4TVA B;  2C7I A;  3QO8 A;  4YRF A;  2QHV A;  1SET A;  2DVE A;  4UP8 A;  1KMM A;  1EFW A;  3NEL A;  2ALY A;  4YRK A;  3V8K A;  3HXY A;  1NYQ A;  4P71 A;  1B76 A;  3QO7 A;  3RKY A;  2E10 A;  4WI1 A;  4XTU A;  2Q7E A;  3VQW A;  5C53 B;  2QHT A;  4YRO A;  1YFR A;  5HGQ A;  3E9I A;  1W66 A;  1X54 A;  4P3P A;  12AS A;  1SER A;  4H2U A;  2DQ3 A;  3A5Z A;  2AKW A;  1VQZ A;  3HRI A;  1WPY A;  3M4Q A;  1HTT A;  2CGH A;  3V8J A;  1SES A;  3DSQ A;  3LSS A;  4P73 A;  3WQZ A;  3BJU A;  2ART A;  2AMC A;  2ZR3 A;  4HA8 A;  4CH5 A;  3UGQ A;  2Q5I A;  1ASY A;  2EWN A;  2P0L A;  3HXV A;  4YRR A;  4YRJ A;  1ADY A;  4YRL A;  4HWS A;  4WF2 A;  3TEG A;  3A74 A;  2ZIM A;  2E5A A;  5C52 B;  4XTW A;  4PG3 A;  4XU3 A;  4RQE A;  1ADJ A;  1B7Y A;  5C51 B;  1USY C;  2A8E A;  4CH6 A;  3G1Z A;  3VBB A;  4XU1 A;  3VQX A;  1WLE A;  4P73 C;  1NJ2 A;  2E65 A;  1C0A A;  4YCU A;  2DQ0 A;  3V7S A;  4Q6G A;  4TVW A;  3P8Y A;  1B7Y B;  4TQF A;  2ZIO A;  1Z7M A;  2DZC A;  2DKG A;  2DDZ A;  1H4Q A;  1X56 A;  2DXU A;  2I4L A;  2ODR C;  4YDQ A;  1H4T A;  4KQE A;  4YYE A;  3TEH B;  3TUP A;  4P72 C;  4CH4 A;  4NCX A;  4LVJ A;  5K1P A;  4H2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...