2P5IA

Crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
262
Chain Sequence
b'PWRFLDHTSFGPTFQALQSFAYDDTLCTSIGKSQSPPTLRAWVHHNTVVLGIQDSRLPQIKAGIEALKGFQHDVIVRNSGGLAVVLDSGILNLSLVLKEEKGFSIDDGYELMYELICSMFQEQIEAREIVGSYCPGSYDLSIDGKKFAGISQRRIRGGVAVQIYLCVSGSGAERAKMIRTFYDKAVAGQPTKFVYPRIKPETMASLSELLGQPHNVSDVLLKALMTLQQHGASLLTESLSADEWLLYEQHFARISERNEKLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3822 protein
molecule tags Structural genomics, unknown function
source organism Bacillus halodurans c-125
publication title Crystal structure of a hypothetical protein from Bacillus halodurans: Pfam-PF03099
rcsb
total genus 82
structure length 262
sequence length 265
ec nomenclature ec 2.3.1.204: Octanoyl-[GcvH]:protein N-octanoyltransferase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2p5iA00
1IL2A 1YFSA 3RKXA 2DJZA 1SRYA 3TUPA 2E65A 3L4GB 4YRKA 1X56A 3EFSA 4H2XA 1WYDA 3UH0A 4YRIA 3QNEA 1USYC 2CIMA 2ZCEA 3QTCA 1RIQA 2ZIOA 3HXWA 2AKWA 2HNIA 2DU7A 2ZZGA 1H4VB 1EFWA 3HRIA 4PHCA 4EX5A 1FYFA 3L1AA 3M4QA 1NYQA 1YFTA 3L2ZA 1BBWA 4X5OA 4Q15A 4YDQA 3MF1A 4H2WA 5C53B 1NNHA 4CH3A 4L87A 2PMEA 3DSQA 1G5HA 3VQXA 5K1XA 3W3SA 1L0WA 1EVLA 1BBUA 2EL9A 2J3MA 5KNNA 4XEOA 4YRJA 2Q7EA 4AH6A 1H4QA 3BJUA 4YPFA 3QO5A 1PYSB 3HXXA 2ZT7A 4RMFA 4HVCA 5ELOA 3LSQA 4UPAA 2QHSA 3NETA 4TQDA 3UGTA 2ZTGA 4XU3A 1HC7A 1H4SA 4RDXA 2DXTA 2EJGA 4TTVA 4H2XB 4WJ3M 4CS4A 3NELA 2E1HA 2EJFA 4UP7A 2ZZFA 4YRLA 3A74A 4TVAB 3IALA 2AKWB 3HXVA 2EWNA 4H02A 4G84A 2AMCB 3OD1A 4XTUA 3V8KA 1LYLA 4HWPA 1YFRA 3CMQA 2DTOA 3V7RA 1J5WA 4CH4A 4YYEA 4YREA 4DPGA 1C0AA 1ASZA 1B7YA 3BFMA 3IKMB 2ZZEA 4ZTUB 4TQFA 2FYKA 1B76A 1WLEA 2DDZA 3RF1A 4BW9A 4TVWA 1VQZA 4CH6A 1E24A 3QO8A 2ALYA 1HXDA 1WPYA 2Q5IA 4H2TA 4P3NA 1E1OA 2CGHA 1B7YB 3ERRA 3HY1A 2ARUA 3EFRA 4TVAA 1ATIA 2I4OA 4HWRA 4HA8A 5F5WA 1WNLA 1B70B 1KMMA 4K87A 4E51A 3TEGA 3MEYA 1SESA 1E1TA 3I7FA 4YRFA 1G5IA 3RACA 2J3LA 3V8JA 12ASA 4O2DA 2ZGWA 4K86A 4YRMA 1NJ6A 2ZIMA 4P71C 2CJBA 2EAYA 1USYA 4P75A 3G1ZA 4RQEA 4YRTA 3VBBA 2DTHA 1JJCA 1NJ1A 1PYSA 3A7UA 3R07A 2ALYB 1ASYA 1SETA 3LC0A 2P5IA 4XU1A 3HRKA 1GGMA 4YRPA 4P74A 2DQ0A 2ZT8A 1WQWA 5C52B 4KR2A 2DQ3A 4XTYA 4RQFA 3E9IA 1KMNA 3TEHA 4HWSA 4YCVA 4HWOA 2DTIA 1YGBA 2DZCA 3VQWA 2I4MA 4OLFA 1X01A 1EIYB 4XU0A 3V7CA 4TVYA 2QHUA 2E5AA 2C7IA 4YRSA 4KR3A 3RL6A 2QHVA 1NJ2A 1QE0A 4YRNA 2CJ9A 1EVKA 3TEHB 4XEMA 4XTVA 3VQYA 4J15A 4EO4A 2QHTA 4CS3A 4XTXA 2ODRD 1NYRA 1W66A 1WQ7A 2Q7GA 4YRGA 2P0LA 4G85A 2IY5B 1SERA 2DU5A 4WI1A 2ZXFA 4LNSA 4XU2A 1G51A 4CS2A 3IKLA 4P72A 1QF6A 4KQEA 1NJ8A 3HXYA 2DVEA 2Q5HA 4H2UA 1X55A 4H2VA 3HXZA 3KFUA 3IG2A 2ZINA 3REXA 1Z7MA 1NJ5A 2ARSA 4P3PA 4TWAA 2RHQA 4YP0A 4P74C 2ZT5A 4XTZA 3HFVA 3P8VA 4P72C 4PG3A 2DZ9A 1YB3A 3FJPA 4HWTA 4WF2A 3QO7A 1Z7NA 1EIYA 3REUA 2Q7HA 1KOGA 3HY0A 2RHSB 3A5ZA 1HTTA 5E3IA 4UP9A 4BWAA 3V7SA 2CJAA 2DEQA 2ZNIA 5C51B 2E10A 3NEMA 2RHSA 2PMFA 4Q6GA 1JJCB 1WU7A 1ADYA 3UGQA 2E3CA 4ZTZB 3M4PA 3P8TA 3RUXA 4YCWA 3VQVA 2DXUA 4WJ4A 3HFZA 2ODRC 3A7AA 3HTZA 4K88A 3L4GA 1ADJA 3RKYA 2E41A 3A32A 1BIBA 4CH5A 1H4TA 3E9HA 4H2SA 1B70A 1X2GA 2IY5A 3PCOB 4YRQA 1B8AA 4OP0A 1N9WA 2XTIA 4YRRA 4DQ2A 3RIRA 2ZT6A 3PCOA 4XTWA 3HXUA 4P73C 2ZR3A 5ELNA 1E22A 1BIAA 4P75C 1EQRA 3UFGA 3PZCA 2DKGA 3P8YA 3LSSA 1X2HA 4UP8A 3A31A 3V8LA 1EOVA 4NCXA 11ASA 3A5YA 2ARTA 2C8MA 2EJ9A 5HGQA 2G4CA 4P71A 3HFZB 4YROA 2RHQB 2I4NA 2ZNJA 2I4LA 4P73A 3RKWA 5K1PA 3A7RA 4H2YA 1X54A 2AMCA 3MF2A 2ZR2A 3WQZA 2E64A 3NENA 2XGTA 3ICAA 4P3OA 3RGLA 4YCUA 4YRCA 4ZIBA
chains in the Genus database with same CATH superfamily
1IL2A 1YFSA 3RKXA 2DJZA 1SRYA 3TUPA 2E65A 3L4GB 4YRKA 1X56A 3EFSA 4H2XA 1WYDA 3UH0A 4YRIA 3QNEA 4LVKA 1USYC 2CIMA 2ZCEA 3QTCA 1RIQA 2ZIOA 3HXWA 2AKWA 2HNIA 2DU7A 2ZZGA 1H4VB 1EFWA 3HRIA 4PHCA 4EX5A 1FYFA 3L1AA 3M4QA 1NYQA 1YFTA 3L2ZA 1BBWA 4X5OA 4Q15A 4YDQA 3MF1A 4H2WA 5C53B 1NNHA 4HT4A 4CH3A 4L87A 2PMEA 3DSQA 1G5HA 3VQXA 5K1XA 3W3SA 1L0WA 1EVLA 1BBUA 2EL9A 2J3MA 5KNNA 4XEOA 4YRJA 2Q7EA 4AH6A 1H4QA 3BJUA 4YPFA 3QO5A 1PYSB 3HXXA 2ZT7A 4RMFA 4HVCA 5ELOA 3LSQA 4UPAA 2QHSA 3NETA 4TQDA 3UGTA 2ZTGA 4XU3A 1HC7A 1H4SA 4RDXA 2DXTA 2EJGA 4TTVA 4H2XB 3MQZA 4WJ3M 4CS4A 3NELA 2E1HA 2EJFA 4UP7A 2ZZFA 4YRLA 3A74A 4TVAB 3IALA 2AKWB 3HXVA 2EWNA 4H02A 4G84A 2AMCB 3OD1A 4XTUA 3V8KA 1LYLA 4HWPA 1YFRA 3CMQA 4LVIA 2DTOA 3V7RA 1J5WA 4CH4A 4YYEA 4YREA 4DPGA 1C0AA 1ASZA 1B7YA 3BFMA 3IKMB 2ZZEA 4ZTUB 4TQFA 2FYKA 1B76A 1WLEA 2DDZA 3RF1A 4BW9A 2NS6A 4TVWA 1VQZA 4CH6A 1E24A 3QO8A 2ALYA 1HXDA 1WPYA 2Q5IA 4H2TA 4P3NA 1E1OA 2CGHA 1B7YB 3ERRA 3HY1A 2ARUA 3EFRA 4TVAA 1ATIA 2I4OA 4HWRA 4HA8A 5F5WA 1WNLA 1B70B 1KMMA 4K87A 4E51A 3TEGA 3MEYA 1SESA 1E1TA 3I7FA 4YRFA 1G5IA 3RACA 2J3LA 3V8JA 12ASA 4O2DA 2ZGWA 4K86A 4YRMA 1NJ6A 2ZIMA 4P71C 2CJBA 2EAYA 1USYA 4P75A 3G1ZA 4RQEA 4YRTA 3VBBA 2DTHA 1JJCA 1NJ1A 1PYSA 3A7UA 3R07A 2ALYB 1ASYA 1SETA 3LC0A 2P5IA 4XU1A 3HRKA 1GGMA 4YRPA 4P74A 2DQ0A 4LVLA 2ZT8A 1WQWA 5C52B 4KR2A 2DQ3A 4XTYA 4RQFA 3E9IA 1KMNA 3TEHA 4HWSA 4YCVA 4HWOA 2DTIA 1YGBA 2DZCA 3VQWA 2I4MA 4OLFA 1X01A 1EIYB 4XU0A 3V7CA 4TVYA 2QHUA 2E5AA 2C7IA 4YRSA 4KR3A 3RL6A 2QHVA 1NJ2A 1QE0A 4YRNA 2CJ9A 1EVKA 3TEHB 2A8EA 4XEMA 4XTVA 3VQYA 4J15A 4EO4A 2QHTA 4CS3A 4XTXA 2ODRD 1NYRA 1W66A 1WQ7A 2Q7GA 4YRGA 2P0LA 4G85A 2IY5B 1SERA 2DU5A 4WI1A 2ZXFA 4LNSA 4XU2A 1G51A 4CS2A 3IKLA 4P72A 1QF6A 4KQEA 1NJ8A 3HXYA 2DVEA 2Q5HA 4H2UA 1X55A 4H2VA 3HXZA 3KFUA 3IG2A 2ZINA 3REXA 1Z7MA 1NJ5A 2ARSA 4P3PA 4TWAA 4LVMA 2RHQA 4YP0A 4P74C 2ZT5A 4XTZA 3HFVA 3P8VA 4P72C 4PG3A 2DZ9A 1YB3A 3FJPA 4HWTA 4WF2A 3QO7A 1Z7NA 1EIYA 3REUA 2Q7HA 1KOGA 3HY0A 2RHSB 3A5ZA 1HTTA 5E3IA 4UP9A 4BWAA 3V7SA 2CJAA 2DEQA 2ZNIA 5C51B 2E10A 3NEMA 2RHSA 2PMFA 4Q6GA 1JJCB 1WU7A 1ADYA 3UGQA 2E3CA 4ZTZB 3M4PA 3P8TA 3RUXA 4YCWA 3VQVA 2DXUA 4WJ4A 3HFZA 2ODRC 3A7AA 3HTZA 4K88A 3L4GA 1ADJA 3RKYA 2E41A 3A32A 1BIBA 4CH5A 1H4TA 3E9HA 4H2SA 1B70A 1X2GA 2IY5A 3PCOB 4YRQA 1B8AA 4OP0A 1N9WA 2XTIA 4YRRA 4DQ2A 3RIRA 2ZT6A 3PCOA 4XTWA 3HXUA 4P73C 2ZR3A 5ELNA 1E22A 1BIAA 4P75C 1EQRA 3UFGA 3PZCA 2DKGA 3P8YA 3LSSA 1X2HA 4UP8A 3A31A 3V8LA 1EOVA 4NCXA 11ASA 3A5YA 2ARTA 2C8MA 2EJ9A 5HGQA 2G4CA 4P71A 3HFZB 4YROA 2RHQB 2I4NA 2ZNJA 4LVJA 2I4LA 4P73A 3RKWA 5K1PA 3A7RA 4H2YA 1X54A 2AMCA 3MF2A 2ZR2A 3WQZA 2E64A 3NENA 2XGTA 3ICAA 4P3OA 3RGLA 4YCUA 4YRCA 4ZIBA
chains in the Genus database with same CATH topology
1IL2A 1YFSA 3RKXA 2DJZA 1SRYA 3TUPA 2E65A 3L4GB 4YRKA 1X56A 3EFSA 4H2XA 1WYDA 3UH0A 4YRIA 3QNEA 4LVKA 1USYC 2CIMA 2ZCEA 3QTCA 1RIQA 2ZIOA 3HXWA 2AKWA 2HNIA 2DU7A 2ZZGA 1H4VB 1EFWA 3HRIA 4PHCA 4EX5A 1FYFA 3L1AA 3M4QA 1NYQA 1YFTA 3L2ZA 1BBWA 4X5OA 4Q15A 4YDQA 3MF1A 4H2WA 5C53B 1NNHA 4HT4A 4CH3A 4L87A 2PMEA 3DSQA 1G5HA 3VQXA 5K1XA 3W3SA 1L0WA 1EVLA 1BBUA 2EL9A 2J3MA 5KNNA 4XEOA 4YRJA 2Q7EA 4AH6A 1H4QA 3BJUA 4YPFA 3QO5A 1PYSB 3HXXA 2ZT7A 4RMFA 4HVCA 5ELOA 3LSQA 4UPAA 2QHSA 3NETA 4TQDA 3UGTA 2ZTGA 4XU3A 1HC7A 1H4SA 4RDXA 2DXTA 2EJGA 4TTVA 4H2XB 3MQZA 4WJ3M 4CS4A 3NELA 2E1HA 2EJFA 4UP7A 2ZZFA 4YRLA 3A74A 4TVAB 3IALA 2AKWB 3HXVA 2EWNA 4H02A 4G84A 2AMCB 3OD1A 4XTUA 3V8KA 1LYLA 4HWPA 1YFRA 3CMQA 4LVIA 2DTOA 3V7RA 1J5WA 4CH4A 4YYEA 4YREA 4DPGA 1C0AA 1ASZA 1B7YA 3BFMA 3IKMB 2ZZEA 4ZTUB 4TQFA 2FYKA 1B76A 1WLEA 2DDZA 3RF1A 4BW9A 2NS6A 4TVWA 1VQZA 4CH6A 1E24A 3QO8A 2ALYA 1HXDA 1WPYA 2Q5IA 4H2TA 4P3NA 1E1OA 2CGHA 1B7YB 3ERRA 3HY1A 2ARUA 3EFRA 4TVAA 1ATIA 2I4OA 4HWRA 4HA8A 5F5WA 1WNLA 1B70B 1KMMA 4K87A 4E51A 3TEGA 3MEYA 1SESA 1E1TA 3I7FA 4YRFA 1G5IA 3RACA 2J3LA 3V8JA 12ASA 4O2DA 2ZGWA 4K86A 4YRMA 1NJ6A 2ZIMA 4P71C 2CJBA 2EAYA 1USYA 4P75A 3G1ZA 4RQEA 4YRTA 3VBBA 2DTHA 1JJCA 1NJ1A 1PYSA 3A7UA 3R07A 2ALYB 1ASYA 1SETA 3LC0A 2P5IA 4XU1A 3HRKA 1GGMA 4YRPA 4P74A 2DQ0A 4LVLA 2ZT8A 1WQWA 5C52B 4KR2A 2DQ3A 4XTYA 4RQFA 3E9IA 1KMNA 3TEHA 4HWSA 4YCVA 4HWOA 2DTIA 1YGBA 2DZCA 3VQWA 2I4MA 4OLFA 1X01A 1EIYB 4XU0A 3V7CA 4TVYA 2QHUA 2E5AA 2C7IA 4YRSA 4KR3A 3RL6A 2QHVA 1NJ2A 1QE0A 4YRNA 2CJ9A 1EVKA 3TEHB 2A8EA 4XEMA 4XTVA 3VQYA 4J15A 4EO4A 2QHTA 4CS3A 4XTXA 2ODRD 1NYRA 1W66A 1WQ7A 2Q7GA 4YRGA 2P0LA 4G85A 2IY5B 1SERA 2DU5A 4WI1A 2ZXFA 4LNSA 4XU2A 1G51A 4CS2A 3IKLA 4P72A 1QF6A 4KQEA 1NJ8A 3HXYA 2DVEA 2Q5HA 4H2UA 1X55A 4H2VA 3HXZA 3KFUA 3IG2A 2ZINA 3REXA 1Z7MA 1NJ5A 2ARSA 4P3PA 4TWAA 4LVMA 2RHQA 4YP0A 4P74C 2ZT5A 4XTZA 3HFVA 3P8VA 4P72C 4PG3A 2DZ9A 1YB3A 3FJPA 4HWTA 4WF2A 3QO7A 1Z7NA 1EIYA 3REUA 2Q7HA 1KOGA 3HY0A 2RHSB 3A5ZA 1HTTA 5E3IA 4UP9A 4BWAA 3V7SA 2CJAA 2DEQA 2ZNIA 5C51B 2E10A 3NEMA 2RHSA 2PMFA 4Q6GA 1JJCB 1WU7A 1ADYA 3UGQA 2E3CA 4ZTZB 3M4PA 3P8TA 3RUXA 4YCWA 3VQVA 2DXUA 4WJ4A 3HFZA 2ODRC 3A7AA 3HTZA 4K88A 3L4GA 1ADJA 3RKYA 2E41A 3A32A 1BIBA 4CH5A 1H4TA 3E9HA 4H2SA 1B70A 1X2GA 2IY5A 3PCOB 4YRQA 1B8AA 4OP0A 1N9WA 2XTIA 4YRRA 4DQ2A 3RIRA 2ZT6A 3PCOA 4XTWA 3HXUA 4P73C 2ZR3A 5ELNA 1E22A 1BIAA 4P75C 1EQRA 3UFGA 3PZCA 2DKGA 3P8YA 3LSSA 1X2HA 4UP8A 3A31A 3V8LA 1EOVA 4NCXA 11ASA 3A5YA 2ARTA 2C8MA 2EJ9A 5HGQA 2G4CA 4P71A 3HFZB 4YROA 2RHQB 2I4NA 2ZNJA 4LVJA 2I4LA 4P73A 3RKWA 5K1PA 3A7RA 4H2YA 1X54A 2AMCA 3MF2A 2ZR2A 3WQZA 2E64A 3NENA 2XGTA 3ICAA 4P3OA 3RGLA 4YCUA 4YRCA 4ZIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL2 A;  1YFS A;  3RKX A;  2DJZ A;  1SRY A;  3TUP A;  2E65 A;  3L4G B;  4YRK A;  1X56 A;  3EFS A;  4H2X A;  1WYD A;  3UH0 A;  4YRI A;  3QNE A;  1USY C;  2CIM A;  2ZCE A;  3QTC A;  1RIQ A;  2ZIO A;  3HXW A;  2AKW A;  2HNI A;  2DU7 A;  2ZZG A;  1H4V B;  1EFW A;  3HRI A;  4PHC A;  4EX5 A;  1FYF A;  3L1A A;  3M4Q A;  1NYQ A;  1YFT A;  3L2Z A;  1BBW A;  4X5O A;  4Q15 A;  4YDQ A;  3MF1 A;  4H2W A;  5C53 B;  1NNH A;  4CH3 A;  4L87 A;  2PME A;  3DSQ A;  1G5H A;  3VQX A;  5K1X A;  3W3S A;  1L0W A;  1EVL A;  1BBU A;  2EL9 A;  2J3M A;  5KNN A;  4XEO A;  4YRJ A;  2Q7E A;  4AH6 A;  1H4Q A;  3BJU A;  4YPF A;  3QO5 A;  1PYS B;  3HXX A;  2ZT7 A;  4RMF A;  4HVC A;  5ELO A;  3LSQ A;  4UPA A;  2QHS A;  3NET A;  4TQD A;  3UGT A;  2ZTG A;  4XU3 A;  1HC7 A;  1H4S A;  4RDX A;  2DXT A;  2EJG A;  4TTV A;  4H2X B;  4WJ3 M;  4CS4 A;  3NEL A;  2E1H A;  2EJF A;  4UP7 A;  2ZZF A;  4YRL A;  3A74 A;  4TVA B;  3IAL A;  2AKW B;  3HXV A;  2EWN A;  4H02 A;  4G84 A;  2AMC B;  3OD1 A;  4XTU A;  3V8K A;  1LYL A;  4HWP A;  1YFR A;  3CMQ A;  2DTO A;  3V7R A;  1J5W A;  4CH4 A;  4YYE A;  4YRE A;  4DPG A;  1C0A A;  1ASZ A;  1B7Y A;  3BFM A;  3IKM B;  2ZZE A;  4ZTU B;  4TQF A;  2FYK A;  1B76 A;  1WLE A;  2DDZ A;  3RF1 A;  4BW9 A;  4TVW A;  1VQZ A;  4CH6 A;  1E24 A;  3QO8 A;  2ALY A;  1HXD A;  1WPY A;  2Q5I A;  4H2T A;  4P3N A;  1E1O A;  2CGH A;  1B7Y B;  3ERR A;  3HY1 A;  2ARU A;  3EFR A;  4TVA A;  1ATI A;  2I4O A;  4HWR A;  4HA8 A;  5F5W A;  1WNL A;  1B70 B;  1KMM A;  4K87 A;  4E51 A;  3TEG A;  3MEY A;  1SES A;  1E1T A;  3I7F A;  4YRF A;  1G5I A;  3RAC A;  2J3L A;  3V8J A;  12AS A;  4O2D A;  2ZGW A;  4K86 A;  4YRM A;  1NJ6 A;  2ZIM A;  4P71 C;  2CJB A;  2EAY A;  1USY A;  4P75 A;  3G1Z A;  4RQE A;  4YRT A;  3VBB A;  2DTH A;  1JJC A;  1NJ1 A;  1PYS A;  3A7U A;  3R07 A;  2ALY B;  1ASY A;  1SET A;  3LC0 A;  2P5I A;  4XU1 A;  3HRK A;  1GGM A;  4YRP A;  4P74 A;  2DQ0 A;  2ZT8 A;  1WQW A;  5C52 B;  4KR2 A;  2DQ3 A;  4XTY A;  4RQF A;  3E9I A;  1KMN A;  3TEH A;  4HWS A;  4YCV A;  4HWO A;  2DTI A;  1YGB A;  2DZC A;  3VQW A;  2I4M A;  4OLF A;  1X01 A;  1EIY B;  4XU0 A;  3V7C A;  4TVY A;  2QHU A;  2E5A A;  2C7I A;  4YRS A;  4KR3 A;  3RL6 A;  2QHV A;  1NJ2 A;  1QE0 A;  4YRN A;  2CJ9 A;  1EVK A;  3TEH B;  4XEM A;  4XTV A;  3VQY A;  4J15 A;  4EO4 A;  2QHT A;  4CS3 A;  4XTX A;  2ODR D;  1NYR A;  1W66 A;  1WQ7 A;  2Q7G A;  4YRG A;  2P0L A;  4G85 A;  2IY5 B;  1SER A;  2DU5 A;  4WI1 A;  2ZXF A;  4LNS A;  4XU2 A;  1G51 A;  4CS2 A;  3IKL A;  4P72 A;  1QF6 A;  4KQE A;  1NJ8 A;  3HXY A;  2DVE A;  2Q5H A;  4H2U A;  1X55 A;  4H2V A;  3HXZ A;  3KFU A;  3IG2 A;  2ZIN A;  3REX A;  1Z7M A;  1NJ5 A;  2ARS A;  4P3P A;  4TWA A;  2RHQ A;  4YP0 A;  4P74 C;  2ZT5 A;  4XTZ A;  3HFV A;  3P8V A;  4P72 C;  4PG3 A;  2DZ9 A;  1YB3 A;  3FJP A;  4HWT A;  4WF2 A;  3QO7 A;  1Z7N A;  1EIY A;  3REU A;  2Q7H A;  1KOG A;  3HY0 A;  2RHS B;  3A5Z A;  1HTT A;  5E3I A;  4UP9 A;  4BWA A;  3V7S A;  2CJA A;  2DEQ A;  2ZNI A;  5C51 B;  2E10 A;  3NEM A;  2RHS A;  2PMF A;  4Q6G A;  1JJC B;  1WU7 A;  1ADY A;  3UGQ A;  2E3C A;  4ZTZ B;  3M4P A;  3P8T A;  3RUX A;  4YCW A;  3VQV A;  2DXU A;  4WJ4 A;  3HFZ A;  2ODR C;  3A7A A;  3HTZ A;  4K88 A;  3L4G A;  1ADJ A;  3RKY A;  2E41 A;  3A32 A;  1BIB A;  4CH5 A;  1H4T A;  3E9H A;  4H2S A;  1B70 A;  1X2G A;  2IY5 A;  3PCO B;  4YRQ A;  1B8A A;  4OP0 A;  1N9W A;  2XTI A;  4YRR A;  4DQ2 A;  3RIR A;  2ZT6 A;  3PCO A;  4XTW A;  3HXU A;  4P73 C;  2ZR3 A;  5ELN A;  1E22 A;  1BIA A;  4P75 C;  1EQR A;  3UFG A;  3PZC A;  2DKG A;  3P8Y A;  3LSS A;  1X2H A;  4UP8 A;  3A31 A;  3V8L A;  1EOV A;  4NCX A;  11AS A;  3A5Y A;  2ART A;  2C8M A;  2EJ9 A;  5HGQ A;  2G4C A;  4P71 A;  3HFZ B;  4YRO A;  2RHQ B;  2I4N A;  2ZNJ A;  2I4L A;  4P73 A;  3RKW A;  5K1P A;  3A7R A;  4H2Y A;  1X54 A;  2AMC A;  3MF2 A;  2ZR2 A;  3WQZ A;  2E64 A;  3NEN A;  2XGT A;  3ICA A;  4P3O A;  3RGL A;  4YCU A;  4YRC A;  4ZIB A; 
#chains in the Genus database with same CATH topology
 1IL2 A;  1YFS A;  3RKX A;  2DJZ A;  1SRY A;  3TUP A;  2E65 A;  3L4G B;  4YRK A;  1X56 A;  3EFS A;  4H2X A;  1WYD A;  3UH0 A;  4YRI A;  3QNE A;  4LVK A;  1USY C;  2CIM A;  2ZCE A;  3QTC A;  1RIQ A;  2ZIO A;  3HXW A;  2AKW A;  2HNI A;  2DU7 A;  2ZZG A;  1H4V B;  1EFW A;  3HRI A;  4PHC A;  4EX5 A;  1FYF A;  3L1A A;  3M4Q A;  1NYQ A;  1YFT A;  3L2Z A;  1BBW A;  4X5O A;  4Q15 A;  4YDQ A;  3MF1 A;  4H2W A;  5C53 B;  1NNH A;  4HT4 A;  4CH3 A;  4L87 A;  2PME A;  3DSQ A;  1G5H A;  3VQX A;  5K1X A;  3W3S A;  1L0W A;  1EVL A;  1BBU A;  2EL9 A;  2J3M A;  5KNN A;  4XEO A;  4YRJ A;  2Q7E A;  4AH6 A;  1H4Q A;  3BJU A;  4YPF A;  3QO5 A;  1PYS B;  3HXX A;  2ZT7 A;  4RMF A;  4HVC A;  5ELO A;  3LSQ A;  4UPA A;  2QHS A;  3NET A;  4TQD A;  3UGT A;  2ZTG A;  4XU3 A;  1HC7 A;  1H4S A;  4RDX A;  2DXT A;  2EJG A;  4TTV A;  4H2X B;  3MQZ A;  4WJ3 M;  4CS4 A;  3NEL A;  2E1H A;  2EJF A;  4UP7 A;  2ZZF A;  4YRL A;  3A74 A;  4TVA B;  3IAL A;  2AKW B;  3HXV A;  2EWN A;  4H02 A;  4G84 A;  2AMC B;  3OD1 A;  4XTU A;  3V8K A;  1LYL A;  4HWP A;  1YFR A;  3CMQ A;  4LVI A;  2DTO A;  3V7R A;  1J5W A;  4CH4 A;  4YYE A;  4YRE A;  4DPG A;  1C0A A;  1ASZ A;  1B7Y A;  3BFM A;  3IKM B;  2ZZE A;  4ZTU B;  4TQF A;  2FYK A;  1B76 A;  1WLE A;  2DDZ A;  3RF1 A;  4BW9 A;  2NS6 A;  4TVW A;  1VQZ A;  4CH6 A;  1E24 A;  3QO8 A;  2ALY A;  1HXD A;  1WPY A;  2Q5I A;  4H2T A;  4P3N A;  1E1O A;  2CGH A;  1B7Y B;  3ERR A;  3HY1 A;  2ARU A;  3EFR A;  4TVA A;  1ATI A;  2I4O A;  4HWR A;  4HA8 A;  5F5W A;  1WNL A;  1B70 B;  1KMM A;  4K87 A;  4E51 A;  3TEG A;  3MEY A;  1SES A;  1E1T A;  3I7F A;  4YRF A;  1G5I A;  3RAC A;  2J3L A;  3V8J A;  12AS A;  4O2D A;  2ZGW A;  4K86 A;  4YRM A;  1NJ6 A;  2ZIM A;  4P71 C;  2CJB A;  2EAY A;  1USY A;  4P75 A;  3G1Z A;  4RQE A;  4YRT A;  3VBB A;  2DTH A;  1JJC A;  1NJ1 A;  1PYS A;  3A7U A;  3R07 A;  2ALY B;  1ASY A;  1SET A;  3LC0 A;  2P5I A;  4XU1 A;  3HRK A;  1GGM A;  4YRP A;  4P74 A;  2DQ0 A;  4LVL A;  2ZT8 A;  1WQW A;  5C52 B;  4KR2 A;  2DQ3 A;  4XTY A;  4RQF A;  3E9I A;  1KMN A;  3TEH A;  4HWS A;  4YCV A;  4HWO A;  2DTI A;  1YGB A;  2DZC A;  3VQW A;  2I4M A;  4OLF A;  1X01 A;  1EIY B;  4XU0 A;  3V7C A;  4TVY A;  2QHU A;  2E5A A;  2C7I A;  4YRS A;  4KR3 A;  3RL6 A;  2QHV A;  1NJ2 A;  1QE0 A;  4YRN A;  2CJ9 A;  1EVK A;  3TEH B;  2A8E A;  4XEM A;  4XTV A;  3VQY A;  4J15 A;  4EO4 A;  2QHT A;  4CS3 A;  4XTX A;  2ODR D;  1NYR A;  1W66 A;  1WQ7 A;  2Q7G A;  4YRG A;  2P0L A;  4G85 A;  2IY5 B;  1SER A;  2DU5 A;  4WI1 A;  2ZXF A;  4LNS A;  4XU2 A;  1G51 A;  4CS2 A;  3IKL A;  4P72 A;  1QF6 A;  4KQE A;  1NJ8 A;  3HXY A;  2DVE A;  2Q5H A;  4H2U A;  1X55 A;  4H2V A;  3HXZ A;  3KFU A;  3IG2 A;  2ZIN A;  3REX A;  1Z7M A;  1NJ5 A;  2ARS A;  4P3P A;  4TWA A;  4LVM A;  2RHQ A;  4YP0 A;  4P74 C;  2ZT5 A;  4XTZ A;  3HFV A;  3P8V A;  4P72 C;  4PG3 A;  2DZ9 A;  1YB3 A;  3FJP A;  4HWT A;  4WF2 A;  3QO7 A;  1Z7N A;  1EIY A;  3REU A;  2Q7H A;  1KOG A;  3HY0 A;  2RHS B;  3A5Z A;  1HTT A;  5E3I A;  4UP9 A;  4BWA A;  3V7S A;  2CJA A;  2DEQ A;  2ZNI A;  5C51 B;  2E10 A;  3NEM A;  2RHS A;  2PMF A;  4Q6G A;  1JJC B;  1WU7 A;  1ADY A;  3UGQ A;  2E3C A;  4ZTZ B;  3M4P A;  3P8T A;  3RUX A;  4YCW A;  3VQV A;  2DXU A;  4WJ4 A;  3HFZ A;  2ODR C;  3A7A A;  3HTZ A;  4K88 A;  3L4G A;  1ADJ A;  3RKY A;  2E41 A;  3A32 A;  1BIB A;  4CH5 A;  1H4T A;  3E9H A;  4H2S A;  1B70 A;  1X2G A;  2IY5 A;  3PCO B;  4YRQ A;  1B8A A;  4OP0 A;  1N9W A;  2XTI A;  4YRR A;  4DQ2 A;  3RIR A;  2ZT6 A;  3PCO A;  4XTW A;  3HXU A;  4P73 C;  2ZR3 A;  5ELN A;  1E22 A;  1BIA A;  4P75 C;  1EQR A;  3UFG A;  3PZC A;  2DKG A;  3P8Y A;  3LSS A;  1X2H A;  4UP8 A;  3A31 A;  3V8L A;  1EOV A;  4NCX A;  11AS A;  3A5Y A;  2ART A;  2C8M A;  2EJ9 A;  5HGQ A;  2G4C A;  4P71 A;  3HFZ B;  4YRO A;  2RHQ B;  2I4N A;  2ZNJ A;  4LVJ A;  2I4L A;  4P73 A;  3RKW A;  5K1P A;  3A7R A;  4H2Y A;  1X54 A;  2AMC A;  3MF2 A;  2ZR2 A;  3WQZ A;  2E64 A;  3NEN A;  2XGT A;  3ICA A;  4P3O A;  3RGL A;  4YCU A;  4YRC A;  4ZIB A; 
#chains in the Genus database with same CATH homology
 1IL2 A;  1YFS A;  3RKX A;  2DJZ A;  1SRY A;  3TUP A;  2E65 A;  3L4G B;  4YRK A;  1X56 A;  3EFS A;  4H2X A;  1WYD A;  3UH0 A;  4YRI A;  3QNE A;  4LVK A;  1USY C;  2CIM A;  2ZCE A;  3QTC A;  1RIQ A;  2ZIO A;  3HXW A;  2AKW A;  2HNI A;  2DU7 A;  2ZZG A;  1H4V B;  1EFW A;  3HRI A;  4PHC A;  4EX5 A;  1FYF A;  3L1A A;  3M4Q A;  1NYQ A;  1YFT A;  3L2Z A;  1BBW A;  4X5O A;  4Q15 A;  4YDQ A;  3MF1 A;  4H2W A;  5C53 B;  1NNH A;  4HT4 A;  4CH3 A;  4L87 A;  2PME A;  3DSQ A;  1G5H A;  3VQX A;  5K1X A;  3W3S A;  1L0W A;  1EVL A;  1BBU A;  2EL9 A;  2J3M A;  5KNN A;  4XEO A;  4YRJ A;  2Q7E A;  4AH6 A;  1H4Q A;  3BJU A;  4YPF A;  3QO5 A;  1PYS B;  3HXX A;  2ZT7 A;  4RMF A;  4HVC A;  5ELO A;  3LSQ A;  4UPA A;  2QHS A;  3NET A;  4TQD A;  3UGT A;  2ZTG A;  4XU3 A;  1HC7 A;  1H4S A;  4RDX A;  2DXT A;  2EJG A;  4TTV A;  4H2X B;  3MQZ A;  4WJ3 M;  4CS4 A;  3NEL A;  2E1H A;  2EJF A;  4UP7 A;  2ZZF A;  4YRL A;  3A74 A;  4TVA B;  3IAL A;  2AKW B;  3HXV A;  2EWN A;  4H02 A;  4G84 A;  2AMC B;  3OD1 A;  4XTU A;  3V8K A;  1LYL A;  4HWP A;  1YFR A;  3CMQ A;  4LVI A;  2DTO A;  3V7R A;  1J5W A;  4CH4 A;  4YYE A;  4YRE A;  4DPG A;  1C0A A;  1ASZ A;  1B7Y A;  3BFM A;  3IKM B;  2ZZE A;  4ZTU B;  4TQF A;  2FYK A;  1B76 A;  1WLE A;  2DDZ A;  3RF1 A;  4BW9 A;  2NS6 A;  4TVW A;  1VQZ A;  4CH6 A;  1E24 A;  3QO8 A;  2ALY A;  1HXD A;  1WPY A;  2Q5I A;  4H2T A;  4P3N A;  1E1O A;  2CGH A;  1B7Y B;  3ERR A;  3HY1 A;  2ARU A;  3EFR A;  4TVA A;  1ATI A;  2I4O A;  4HWR A;  4HA8 A;  5F5W A;  1WNL A;  1B70 B;  1KMM A;  4K87 A;  4E51 A;  3TEG A;  3MEY A;  1SES A;  1E1T A;  3I7F A;  4YRF A;  1G5I A;  3RAC A;  2J3L A;  3V8J A;  12AS A;  4O2D A;  2ZGW A;  4K86 A;  4YRM A;  1NJ6 A;  2ZIM A;  4P71 C;  2CJB A;  2EAY A;  1USY A;  4P75 A;  3G1Z A;  4RQE A;  4YRT A;  3VBB A;  2DTH A;  1JJC A;  1NJ1 A;  1PYS A;  3A7U A;  3R07 A;  2ALY B;  1ASY A;  1SET A;  3LC0 A;  2P5I A;  4XU1 A;  3HRK A;  1GGM A;  4YRP A;  4P74 A;  2DQ0 A;  4LVL A;  2ZT8 A;  1WQW A;  5C52 B;  4KR2 A;  2DQ3 A;  4XTY A;  4RQF A;  3E9I A;  1KMN A;  3TEH A;  4HWS A;  4YCV A;  4HWO A;  2DTI A;  1YGB A;  2DZC A;  3VQW A;  2I4M A;  4OLF A;  1X01 A;  1EIY B;  4XU0 A;  3V7C A;  4TVY A;  2QHU A;  2E5A A;  2C7I A;  4YRS A;  4KR3 A;  3RL6 A;  2QHV A;  1NJ2 A;  1QE0 A;  4YRN A;  2CJ9 A;  1EVK A;  3TEH B;  2A8E A;  4XEM A;  4XTV A;  3VQY A;  4J15 A;  4EO4 A;  2QHT A;  4CS3 A;  4XTX A;  2ODR D;  1NYR A;  1W66 A;  1WQ7 A;  2Q7G A;  4YRG A;  2P0L A;  4G85 A;  2IY5 B;  1SER A;  2DU5 A;  4WI1 A;  2ZXF A;  4LNS A;  4XU2 A;  1G51 A;  4CS2 A;  3IKL A;  4P72 A;  1QF6 A;  4KQE A;  1NJ8 A;  3HXY A;  2DVE A;  2Q5H A;  4H2U A;  1X55 A;  4H2V A;  3HXZ A;  3KFU A;  3IG2 A;  2ZIN A;  3REX A;  1Z7M A;  1NJ5 A;  2ARS A;  4P3P A;  4TWA A;  4LVM A;  2RHQ A;  4YP0 A;  4P74 C;  2ZT5 A;  4XTZ A;  3HFV A;  3P8V A;  4P72 C;  4PG3 A;  2DZ9 A;  1YB3 A;  3FJP A;  4HWT A;  4WF2 A;  3QO7 A;  1Z7N A;  1EIY A;  3REU A;  2Q7H A;  1KOG A;  3HY0 A;  2RHS B;  3A5Z A;  1HTT A;  5E3I A;  4UP9 A;  4BWA A;  3V7S A;  2CJA A;  2DEQ A;  2ZNI A;  5C51 B;  2E10 A;  3NEM A;  2RHS A;  2PMF A;  4Q6G A;  1JJC B;  1WU7 A;  1ADY A;  3UGQ A;  2E3C A;  4ZTZ B;  3M4P A;  3P8T A;  3RUX A;  4YCW A;  3VQV A;  2DXU A;  4WJ4 A;  3HFZ A;  2ODR C;  3A7A A;  3HTZ A;  4K88 A;  3L4G A;  1ADJ A;  3RKY A;  2E41 A;  3A32 A;  1BIB A;  4CH5 A;  1H4T A;  3E9H A;  4H2S A;  1B70 A;  1X2G A;  2IY5 A;  3PCO B;  4YRQ A;  1B8A A;  4OP0 A;  1N9W A;  2XTI A;  4YRR A;  4DQ2 A;  3RIR A;  2ZT6 A;  3PCO A;  4XTW A;  3HXU A;  4P73 C;  2ZR3 A;  5ELN A;  1E22 A;  1BIA A;  4P75 C;  1EQR A;  3UFG A;  3PZC A;  2DKG A;  3P8Y A;  3LSS A;  1X2H A;  4UP8 A;  3A31 A;  3V8L A;  1EOV A;  4NCX A;  11AS A;  3A5Y A;  2ART A;  2C8M A;  2EJ9 A;  5HGQ A;  2G4C A;  4P71 A;  3HFZ B;  4YRO A;  2RHQ B;  2I4N A;  2ZNJ A;  4LVJ A;  2I4L A;  4P73 A;  3RKW A;  5K1P A;  3A7R A;  4H2Y A;  1X54 A;  2AMC A;  3MF2 A;  2ZR2 A;  3WQZ A;  2E64 A;  3NEN A;  2XGT A;  3ICA A;  4P3O A;  3RGL A;  4YCU A;  4YRC A;  4ZIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...