2P5IA

Crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
262
Chain Sequence
PWRFLDHTSFGPTFQALQSFAYDDTLCTSIGKSQSPPTLRAWVHHNTVVLGIQDSRLPQIKAGIEALKGFQHDVIVRNSGGLAVVLDSGILNLSLVLKEEKGFSIDDGYELMYELICSMFQEQIEAREIVGSYCPGSYDLSIDGKKFAGISQRRIRGGVAVQIYLCVSGSGAERAKMIRTFYDKAVAGQPTKFVYPRIKPETMASLSELLGQPHNVSDVLLKALMTLQQHGASLLTESLSADEWLLYEQHFARISERNEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein from Bacillus halodurans: Pfam-PF03099
rcsb
source organism Bacillus halodurans c-125
molecule tags Structural genomics, unknown function
molecule keywords BH3822 protein
total genus 82
structure length 262
sequence length 265
ec nomenclature ec 2.3.1.204: Octanoyl-[GcvH]:protein N-octanoyltransferase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2p5iA00
4CS2A 3HXWA 3NENA 1H4QA 4YRQA 4YRLA 2ZT7A 1WPYA 2HNIA 1SERA 3NEMA 3HFZA 4P3OA 2E5AA 3VQYA 3A7AA 2E3CA 2DQ0A 2AKWB 2DJZA 1EQRA 2CJAA 3HRKA 2I4OA 2FYKA 1QE0A 2DKGA 4P72A 3RF1A 2DTIA 2ZXFA 4XEOA 1HC7A 1WU7A 4H2WA 1YB3A 1PYSB 3VBBA 3WQZA 3RL6A 4G84A 3V7RA 1X54A 4RMFA 2AMCB 3W3SA 1YGBA 4YCUA 1USYC 2DXTA 4TVAA 2CIMA 2G4CA 4XTWA 4YRKA 1ASZA 3HXZA 3G1ZA 4WF2A 4AH6A 4P71C 1HXDA 3A32A 3TEHB 1ATIA 4KQEA 1NJ5A 4YCVA 4WJ4A 3L4GB 3QTCA 3V7SA 4Q6GA 4DPGA 4XEMA 4BWAA 3HXUA 1KOGA 1N9WA 2EJGA 4UP8A 3QO7A 2ZCEA 4UP9A 3RGLA 4K86A 1EIYA 3CMQA 2DTHA 3M4PA 3TEGA 2Q7GA 2ZR2A 4TVYA 1X2GA 2CGHA 3FJPA 4EX5A 1E1TA 2IY5B 2RHQB 2DTOA 3M4QA 1H4TA 4H2XA 1NJ6A 3LC0A 3RIRA 3UH0A 1H4SA 2CJBA 2Q7HA 3QO8A 1Z7MA 2Q7EA 1IL2A 1B76A 2PMFA 1X01A 2ZR3A 1BBUA 4H2VA 4XU1A 1G51A 3A7RA 3TUPA 2E64A 2QHVA 4YRRA 3HTZA 4KR2A 3V8LA 4H2XB 4CH3A 2E10A 1KMNA 4K88A 4P73C 4XTZA 3OD1A 2CJ9A 1E22A 2ZT6A 1WQWA 3MF1A 4HA8A 4YDQA 2P0LA 3RKYA 2ARUA 2QHSA 3PCOA 2ODRC 1WLEA 4NCXA 5C53B 1L0WA 1EVKA 4UP7A 1B70B 1NJ8A 2EAYA 2ZZGA 3QO5A 2ZIMA 4YRPA 2ZGWA 2AMCA 3RUXA 3REXA 2EJFA 4G85A 2DQ3A 3RKXA 3LSSA 2ARSA 4YP0A 1EVLA 4YREA 1X55A 4WI1A 1WYDA 5C51B 3HY0A 1HTTA 3KFUA 5HGQA 1EFWA 2ARTA 4CH6A 2EJ9A 2ZZFA 1SETA 4P3PA 3IKLA 1SESA 2DU7A 1NYQA 2J3MA 4YPFA 2ALYA 3A74A 2ZINA 3L2ZA 1ADYA 2RHQA 4K87A 1YFTA 3UGQA 1B8AA 2EWNA 3BJUA 3EFSA 3EFRA 4RQEA 3A31A 1B7YA 1NJ2A 2ZT5A 4HVCA 1E1OA 3ICAA 3PCOB 3V8JA 3P8VA 1B7YB 4ZIBA 4TWAA 4PG3A 1PYSA 1USYA 1G5HA 1GGMA 1NYRA 4TVAB 4P71A 4H2UA 1ASYA 4Q15A 4RQFA 2DDZA 3V7CA 1X56A 4ZTZB 4WJ3M 2RHSA 4HWSA 5E3IA 2DZ9A 2QHUA 4XU2A 1YFRA 4O2DA 4BW9A 4XU3A 3L1AA 4LNSA 1BBWA 5F5WA 2IY5A 2I4LA 1YFSA 4PHCA 4YRTA 3VQWA 1NJ1A 4YRIA 2P5IA 3BFMA 4XU0A 4J15A 4CS3A 3HFZB 2ZZEA 4EO4A 4YROA 5C52B 4HWTA 2ZIOA 2Q5IA 4XTYA 1JJCA 3IKMB 2E41A 4CH5A 4YRJA 4P75A 1Z7NA 3A5YA 2EL9A 4OLFA 4XTXA 1QF6A 3UFGA 3VQXA 4E51A 1RIQA 2Q5HA 4CS4A 1W66A 1NNHA 4H2YA 2ZNIA 1ADJA 4TQDA 1KMMA 3IG2A 5K1PA 3L4GA 1VQZA 3UGTA 3V8KA 2I4MA 3QNEA 1BIBA 4P75C 1E24A 3HXVA 1FYFA 2QHTA 3E9HA 3REUA 4HWRA 2DXUA 1X2HA 3LSQA 5ELOA 5KNNA 2J3LA 4YRFA 2ODRD 2DEQA 3HXYA 2AKWA 3ERRA 1H4VB 4TQFA 4UPAA 1J5WA 4YRNA 3HRIA 3P8YA 3NELA 4H2TA 5K1XA 3MF2A 3E9IA 2ALYB 1G5IA 2ZT8A 4P73A 2I4NA 3NETA 1C0AA 4RDXA 4HWOA 3A7UA 1BIAA 3VQVA 1EIYB 2DVEA 4YRGA 2PMEA 1EOVA 4KR3A 4YYEA 2XGTA 4L87A 3R07A 4X5OA 1LYLA 2DU5A 2RHSB 3TEHA 2ZNJA 3MEYA 3IALA 2ZTGA 3P8TA 4H2SA 3RACA 4P72C 2C8MA 4TTVA 3PZCA 1WNLA 4P74C 4YRMA 4HWPA 2DZCA 4YRSA 3RKWA 3HXXA 2E1HA 4H02A 4XTUA 3HY1A 3I7FA 4DQ2A 3HFVA 3DSQA 4ZTUB 4P3NA 1B70A 1SRYA 4YCWA 4P74A 1JJCB 4CH4A 5ELNA 4YRCA 2E65A 3A5ZA 4OP0A 12ASA 4XTVA 2XTIA 4TVWA 2C7IA 11ASA 1WQ7A
chains in the Genus database with same CATH superfamily
4CS2A 3HXWA 3NENA 1H4QA 4YRQA 4YRLA 2ZT7A 1WPYA 2HNIA 1SERA 3NEMA 3HFZA 4P3OA 2E5AA 3VQYA 3A7AA 2E3CA 2DQ0A 2AKWB 2DJZA 1EQRA 2CJAA 3HRKA 2I4OA 2FYKA 1QE0A 2DKGA 4P72A 3RF1A 2DTIA 2ZXFA 4XEOA 1HC7A 1WU7A 4H2WA 1YB3A 1PYSB 3VBBA 3WQZA 3RL6A 4G84A 3V7RA 1X54A 4RMFA 2AMCB 3W3SA 4LVLA 1YGBA 4YCUA 1USYC 2DXTA 4TVAA 2CIMA 2G4CA 4XTWA 4YRKA 1ASZA 3HXZA 3G1ZA 4WF2A 4AH6A 4P71C 1HXDA 3A32A 3TEHB 1ATIA 4KQEA 1NJ5A 4YCVA 4WJ4A 3L4GB 3QTCA 3V7SA 4Q6GA 4DPGA 4XEMA 4BWAA 3HXUA 1KOGA 1N9WA 2EJGA 4UP8A 3QO7A 2ZCEA 4UP9A 3RGLA 4K86A 1EIYA 3CMQA 2DTHA 3M4PA 3TEGA 2Q7GA 2ZR2A 2NS6A 4TVYA 1X2GA 2CGHA 3FJPA 4EX5A 1E1TA 2IY5B 2RHQB 2DTOA 3M4QA 1H4TA 4H2XA 1NJ6A 3LC0A 3RIRA 3UH0A 1H4SA 2CJBA 2Q7HA 3QO8A 1Z7MA 3MQZA 2Q7EA 1IL2A 1B76A 2PMFA 1X01A 2ZR3A 1BBUA 4H2VA 4XU1A 1G51A 3A7RA 3TUPA 2E64A 2QHVA 4YRRA 3HTZA 4KR2A 3V8LA 4H2XB 4CH3A 2E10A 1KMNA 4K88A 4P73C 4XTZA 3OD1A 2CJ9A 1E22A 2ZT6A 1WQWA 3MF1A 4HA8A 4YDQA 2P0LA 3RKYA 2ARUA 2QHSA 3PCOA 2ODRC 1WLEA 4NCXA 5C53B 1L0WA 1EVKA 4UP7A 1B70B 1NJ8A 2EAYA 2ZZGA 3QO5A 2ZIMA 4YRPA 4LVIA 2ZGWA 2AMCA 3RUXA 3REXA 2EJFA 4G85A 2DQ3A 3RKXA 3LSSA 2ARSA 4YP0A 1EVLA 4YREA 4LVMA 1X55A 4WI1A 1WYDA 5C51B 3HY0A 1HTTA 3KFUA 5HGQA 1EFWA 2ARTA 4CH6A 2EJ9A 2ZZFA 1SETA 4P3PA 3IKLA 1SESA 2DU7A 1NYQA 2J3MA 4YPFA 2ALYA 3A74A 2ZINA 3L2ZA 1ADYA 2RHQA 4K87A 1YFTA 3UGQA 1B8AA 2EWNA 3BJUA 3EFSA 3EFRA 4RQEA 3A31A 1B7YA 1NJ2A 2ZT5A 4HVCA 1E1OA 3ICAA 3PCOB 3V8JA 3P8VA 1B7YB 4ZIBA 4TWAA 4PG3A 1PYSA 1USYA 1G5HA 1GGMA 1NYRA 4TVAB 4P71A 4H2UA 1ASYA 4Q15A 4RQFA 2DDZA 3V7CA 1X56A 4ZTZB 4WJ3M 2RHSA 4HWSA 5E3IA 2DZ9A 2QHUA 4XU2A 1YFRA 4O2DA 4BW9A 4XU3A 3L1AA 4LNSA 1BBWA 5F5WA 2IY5A 2I4LA 1YFSA 4PHCA 4YRTA 3VQWA 1NJ1A 4YRIA 2P5IA 3BFMA 4XU0A 4J15A 4CS3A 3HFZB 2ZZEA 4EO4A 4YROA 5C52B 4HWTA 2ZIOA 2Q5IA 4XTYA 1JJCA 3IKMB 2E41A 4CH5A 4YRJA 4P75A 1Z7NA 3A5YA 2EL9A 4OLFA 4LVJA 4XTXA 1QF6A 3UFGA 3VQXA 4E51A 1RIQA 2Q5HA 4CS4A 1W66A 1NNHA 4H2YA 2ZNIA 1ADJA 4TQDA 1KMMA 3IG2A 5K1PA 3L4GA 1VQZA 3UGTA 3V8KA 2I4MA 3QNEA 1BIBA 4P75C 1E24A 3HXVA 1FYFA 2QHTA 3E9HA 3REUA 4HWRA 2DXUA 1X2HA 3LSQA 5ELOA 5KNNA 2J3LA 4YRFA 2ODRD 2DEQA 3HXYA 4LVKA 2AKWA 3ERRA 1H4VB 4TQFA 4UPAA 1J5WA 4YRNA 3HRIA 3P8YA 3NELA 4H2TA 5K1XA 3MF2A 3E9IA 2ALYB 1G5IA 2ZT8A 4P73A 2I4NA 3NETA 1C0AA 4RDXA 4HWOA 3A7UA 1BIAA 3VQVA 1EIYB 2DVEA 4YRGA 2PMEA 1EOVA 4KR3A 4HT4A 4YYEA 2XGTA 4L87A 3R07A 4X5OA 1LYLA 2DU5A 2RHSB 3TEHA 2ZNJA 3MEYA 3IALA 2ZTGA 3P8TA 4H2SA 3RACA 4P72C 2C8MA 4TTVA 3PZCA 1WNLA 4P74C 4YRMA 4HWPA 2DZCA 4YRSA 3RKWA 3HXXA 2E1HA 4H02A 4XTUA 3HY1A 3I7FA 4DQ2A 3HFVA 3DSQA 4ZTUB 4P3NA 1B70A 1SRYA 4YCWA 4P74A 1JJCB 4CH4A 5ELNA 4YRCA 2E65A 3A5ZA 4OP0A 2A8EA 12ASA 4XTVA 2XTIA 4TVWA 2C7IA 11ASA 1WQ7A
chains in the Genus database with same CATH topology
4CS2A 3HXWA 3NENA 1H4QA 4YRQA 4YRLA 2ZT7A 1WPYA 2HNIA 1SERA 3NEMA 3HFZA 4P3OA 2E5AA 3VQYA 3A7AA 2E3CA 2DQ0A 2AKWB 2DJZA 1EQRA 2CJAA 3HRKA 2I4OA 2FYKA 1QE0A 2DKGA 4P72A 3RF1A 2DTIA 2ZXFA 4XEOA 1HC7A 1WU7A 4H2WA 1YB3A 1PYSB 3VBBA 3WQZA 3RL6A 4G84A 3V7RA 1X54A 4RMFA 2AMCB 3W3SA 4LVLA 1YGBA 4YCUA 1USYC 2DXTA 4TVAA 2CIMA 2G4CA 4XTWA 4YRKA 1ASZA 3HXZA 3G1ZA 4WF2A 4AH6A 4P71C 1HXDA 3A32A 3TEHB 1ATIA 4KQEA 1NJ5A 4YCVA 4WJ4A 3L4GB 3QTCA 3V7SA 4Q6GA 4DPGA 4XEMA 4BWAA 3HXUA 1KOGA 1N9WA 2EJGA 4UP8A 3QO7A 2ZCEA 4UP9A 3RGLA 4K86A 1EIYA 3CMQA 2DTHA 3M4PA 3TEGA 2Q7GA 2ZR2A 2NS6A 4TVYA 1X2GA 2CGHA 3FJPA 4EX5A 1E1TA 2IY5B 2RHQB 2DTOA 3M4QA 1H4TA 4H2XA 1NJ6A 3LC0A 3RIRA 3UH0A 1H4SA 2CJBA 2Q7HA 3QO8A 1Z7MA 3MQZA 2Q7EA 1IL2A 1B76A 2PMFA 1X01A 2ZR3A 1BBUA 4H2VA 4XU1A 1G51A 3A7RA 3TUPA 2E64A 2QHVA 4YRRA 3HTZA 4KR2A 3V8LA 4H2XB 4CH3A 2E10A 1KMNA 4K88A 4P73C 4XTZA 3OD1A 2CJ9A 1E22A 2ZT6A 1WQWA 3MF1A 4HA8A 4YDQA 2P0LA 3RKYA 2ARUA 2QHSA 3PCOA 2ODRC 1WLEA 4NCXA 5C53B 1L0WA 1EVKA 4UP7A 1B70B 1NJ8A 2EAYA 2ZZGA 3QO5A 2ZIMA 4YRPA 4LVIA 2ZGWA 2AMCA 3RUXA 3REXA 2EJFA 4G85A 2DQ3A 3RKXA 3LSSA 2ARSA 4YP0A 1EVLA 4YREA 4LVMA 1X55A 4WI1A 1WYDA 5C51B 3HY0A 1HTTA 3KFUA 5HGQA 1EFWA 2ARTA 4CH6A 2EJ9A 2ZZFA 1SETA 4P3PA 3IKLA 1SESA 2DU7A 1NYQA 2J3MA 4YPFA 2ALYA 3A74A 2ZINA 3L2ZA 1ADYA 2RHQA 4K87A 1YFTA 3UGQA 1B8AA 2EWNA 3BJUA 3EFSA 3EFRA 4RQEA 3A31A 1B7YA 1NJ2A 2ZT5A 4HVCA 1E1OA 3ICAA 3PCOB 3V8JA 3P8VA 1B7YB 4ZIBA 4TWAA 4PG3A 1PYSA 1USYA 1G5HA 1GGMA 1NYRA 4TVAB 4P71A 4H2UA 1ASYA 4Q15A 4RQFA 2DDZA 3V7CA 1X56A 4ZTZB 4WJ3M 2RHSA 4HWSA 5E3IA 2DZ9A 2QHUA 4XU2A 1YFRA 4O2DA 4BW9A 4XU3A 3L1AA 4LNSA 1BBWA 5F5WA 2IY5A 2I4LA 1YFSA 4PHCA 4YRTA 3VQWA 1NJ1A 4YRIA 2P5IA 3BFMA 4XU0A 4J15A 4CS3A 3HFZB 2ZZEA 4EO4A 4YROA 5C52B 4HWTA 2ZIOA 2Q5IA 4XTYA 1JJCA 3IKMB 2E41A 4CH5A 4YRJA 4P75A 1Z7NA 3A5YA 2EL9A 4OLFA 4LVJA 4XTXA 1QF6A 3UFGA 3VQXA 4E51A 1RIQA 2Q5HA 4CS4A 1W66A 1NNHA 4H2YA 2ZNIA 1ADJA 4TQDA 1KMMA 3IG2A 5K1PA 3L4GA 1VQZA 3UGTA 3V8KA 2I4MA 3QNEA 1BIBA 4P75C 1E24A 3HXVA 1FYFA 2QHTA 3E9HA 3REUA 4HWRA 2DXUA 1X2HA 3LSQA 5ELOA 5KNNA 2J3LA 4YRFA 2ODRD 2DEQA 3HXYA 4LVKA 2AKWA 3ERRA 1H4VB 4TQFA 4UPAA 1J5WA 4YRNA 3HRIA 3P8YA 3NELA 4H2TA 5K1XA 3MF2A 3E9IA 2ALYB 1G5IA 2ZT8A 4P73A 2I4NA 3NETA 1C0AA 4RDXA 4HWOA 3A7UA 1BIAA 3VQVA 1EIYB 2DVEA 4YRGA 2PMEA 1EOVA 4KR3A 4HT4A 4YYEA 2XGTA 4L87A 3R07A 4X5OA 1LYLA 2DU5A 2RHSB 3TEHA 2ZNJA 3MEYA 3IALA 2ZTGA 3P8TA 4H2SA 3RACA 4P72C 2C8MA 4TTVA 3PZCA 1WNLA 4P74C 4YRMA 4HWPA 2DZCA 4YRSA 3RKWA 3HXXA 2E1HA 4H02A 4XTUA 3HY1A 3I7FA 4DQ2A 3HFVA 3DSQA 4ZTUB 4P3NA 1B70A 1SRYA 4YCWA 4P74A 1JJCB 4CH4A 5ELNA 4YRCA 2E65A 3A5ZA 4OP0A 2A8EA 12ASA 4XTVA 2XTIA 4TVWA 2C7IA 11ASA 1WQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS2 A;  3HXW A;  3NEN A;  1H4Q A;  4YRQ A;  4YRL A;  2ZT7 A;  1WPY A;  2HNI A;  1SER A;  3NEM A;  3HFZ A;  4P3O A;  2E5A A;  3VQY A;  3A7A A;  2E3C A;  2DQ0 A;  2AKW B;  2DJZ A;  1EQR A;  2CJA A;  3HRK A;  2I4O A;  2FYK A;  1QE0 A;  2DKG A;  4P72 A;  3RF1 A;  2DTI A;  2ZXF A;  4XEO A;  1HC7 A;  1WU7 A;  4H2W A;  1YB3 A;  1PYS B;  3VBB A;  3WQZ A;  3RL6 A;  4G84 A;  3V7R A;  1X54 A;  4RMF A;  2AMC B;  3W3S A;  1YGB A;  4YCU A;  1USY C;  2DXT A;  4TVA A;  2CIM A;  2G4C A;  4XTW A;  4YRK A;  1ASZ A;  3HXZ A;  3G1Z A;  4WF2 A;  4AH6 A;  4P71 C;  1HXD A;  3A32 A;  3TEH B;  1ATI A;  4KQE A;  1NJ5 A;  4YCV A;  4WJ4 A;  3L4G B;  3QTC A;  3V7S A;  4Q6G A;  4DPG A;  4XEM A;  4BWA A;  3HXU A;  1KOG A;  1N9W A;  2EJG A;  4UP8 A;  3QO7 A;  2ZCE A;  4UP9 A;  3RGL A;  4K86 A;  1EIY A;  3CMQ A;  2DTH A;  3M4P A;  3TEG A;  2Q7G A;  2ZR2 A;  4TVY A;  1X2G A;  2CGH A;  3FJP A;  4EX5 A;  1E1T A;  2IY5 B;  2RHQ B;  2DTO A;  3M4Q A;  1H4T A;  4H2X A;  1NJ6 A;  3LC0 A;  3RIR A;  3UH0 A;  1H4S A;  2CJB A;  2Q7H A;  3QO8 A;  1Z7M A;  2Q7E A;  1IL2 A;  1B76 A;  2PMF A;  1X01 A;  2ZR3 A;  1BBU A;  4H2V A;  4XU1 A;  1G51 A;  3A7R A;  3TUP A;  2E64 A;  2QHV A;  4YRR A;  3HTZ A;  4KR2 A;  3V8L A;  4H2X B;  4CH3 A;  2E10 A;  1KMN A;  4K88 A;  4P73 C;  4XTZ A;  3OD1 A;  2CJ9 A;  1E22 A;  2ZT6 A;  1WQW A;  3MF1 A;  4HA8 A;  4YDQ A;  2P0L A;  3RKY A;  2ARU A;  2QHS A;  3PCO A;  2ODR C;  1WLE A;  4NCX A;  5C53 B;  1L0W A;  1EVK A;  4UP7 A;  1B70 B;  1NJ8 A;  2EAY A;  2ZZG A;  3QO5 A;  2ZIM A;  4YRP A;  2ZGW A;  2AMC A;  3RUX A;  3REX A;  2EJF A;  4G85 A;  2DQ3 A;  3RKX A;  3LSS A;  2ARS A;  4YP0 A;  1EVL A;  4YRE A;  1X55 A;  4WI1 A;  1WYD A;  5C51 B;  3HY0 A;  1HTT A;  3KFU A;  5HGQ A;  1EFW A;  2ART A;  4CH6 A;  2EJ9 A;  2ZZF A;  1SET A;  4P3P A;  3IKL A;  1SES A;  2DU7 A;  1NYQ A;  2J3M A;  4YPF A;  2ALY A;  3A74 A;  2ZIN A;  3L2Z A;  1ADY A;  2RHQ A;  4K87 A;  1YFT A;  3UGQ A;  1B8A A;  2EWN A;  3BJU A;  3EFS A;  3EFR A;  4RQE A;  3A31 A;  1B7Y A;  1NJ2 A;  2ZT5 A;  4HVC A;  1E1O A;  3ICA A;  3PCO B;  3V8J A;  3P8V A;  1B7Y B;  4ZIB A;  4TWA A;  4PG3 A;  1PYS A;  1USY A;  1G5H A;  1GGM A;  1NYR A;  4TVA B;  4P71 A;  4H2U A;  1ASY A;  4Q15 A;  4RQF A;  2DDZ A;  3V7C A;  1X56 A;  4ZTZ B;  4WJ3 M;  2RHS A;  4HWS A;  5E3I A;  2DZ9 A;  2QHU A;  4XU2 A;  1YFR A;  4O2D A;  4BW9 A;  4XU3 A;  3L1A A;  4LNS A;  1BBW A;  5F5W A;  2IY5 A;  2I4L A;  1YFS A;  4PHC A;  4YRT A;  3VQW A;  1NJ1 A;  4YRI A;  2P5I A;  3BFM A;  4XU0 A;  4J15 A;  4CS3 A;  3HFZ B;  2ZZE A;  4EO4 A;  4YRO A;  5C52 B;  4HWT A;  2ZIO A;  2Q5I A;  4XTY A;  1JJC A;  3IKM B;  2E41 A;  4CH5 A;  4YRJ A;  4P75 A;  1Z7N A;  3A5Y A;  2EL9 A;  4OLF A;  4XTX A;  1QF6 A;  3UFG A;  3VQX A;  4E51 A;  1RIQ A;  2Q5H A;  4CS4 A;  1W66 A;  1NNH A;  4H2Y A;  2ZNI A;  1ADJ A;  4TQD A;  1KMM A;  3IG2 A;  5K1P A;  3L4G A;  1VQZ A;  3UGT A;  3V8K A;  2I4M A;  3QNE A;  1BIB A;  4P75 C;  1E24 A;  3HXV A;  1FYF A;  2QHT A;  3E9H A;  3REU A;  4HWR A;  2DXU A;  1X2H A;  3LSQ A;  5ELO A;  5KNN A;  2J3L A;  4YRF A;  2ODR D;  2DEQ A;  3HXY A;  2AKW A;  3ERR A;  1H4V B;  4TQF A;  4UPA A;  1J5W A;  4YRN A;  3HRI A;  3P8Y A;  3NEL A;  4H2T A;  5K1X A;  3MF2 A;  3E9I A;  2ALY B;  1G5I A;  2ZT8 A;  4P73 A;  2I4N A;  3NET A;  1C0A A;  4RDX A;  4HWO A;  3A7U A;  1BIA A;  3VQV A;  1EIY B;  2DVE A;  4YRG A;  2PME A;  1EOV A;  4KR3 A;  4YYE A;  2XGT A;  4L87 A;  3R07 A;  4X5O A;  1LYL A;  2DU5 A;  2RHS B;  3TEH A;  2ZNJ A;  3MEY A;  3IAL A;  2ZTG A;  3P8T A;  4H2S A;  3RAC A;  4P72 C;  2C8M A;  4TTV A;  3PZC A;  1WNL A;  4P74 C;  4YRM A;  4HWP A;  2DZC A;  4YRS A;  3RKW A;  3HXX A;  2E1H A;  4H02 A;  4XTU A;  3HY1 A;  3I7F A;  4DQ2 A;  3HFV A;  3DSQ A;  4ZTU B;  4P3N A;  1B70 A;  1SRY A;  4YCW A;  4P74 A;  1JJC B;  4CH4 A;  5ELN A;  4YRC A;  2E65 A;  3A5Z A;  4OP0 A;  12AS A;  4XTV A;  2XTI A;  4TVW A;  2C7I A;  11AS A;  1WQ7 A; 
#chains in the Genus database with same CATH topology
 4CS2 A;  3HXW A;  3NEN A;  1H4Q A;  4YRQ A;  4YRL A;  2ZT7 A;  1WPY A;  2HNI A;  1SER A;  3NEM A;  3HFZ A;  4P3O A;  2E5A A;  3VQY A;  3A7A A;  2E3C A;  2DQ0 A;  2AKW B;  2DJZ A;  1EQR A;  2CJA A;  3HRK A;  2I4O A;  2FYK A;  1QE0 A;  2DKG A;  4P72 A;  3RF1 A;  2DTI A;  2ZXF A;  4XEO A;  1HC7 A;  1WU7 A;  4H2W A;  1YB3 A;  1PYS B;  3VBB A;  3WQZ A;  3RL6 A;  4G84 A;  3V7R A;  1X54 A;  4RMF A;  2AMC B;  3W3S A;  4LVL A;  1YGB A;  4YCU A;  1USY C;  2DXT A;  4TVA A;  2CIM A;  2G4C A;  4XTW A;  4YRK A;  1ASZ A;  3HXZ A;  3G1Z A;  4WF2 A;  4AH6 A;  4P71 C;  1HXD A;  3A32 A;  3TEH B;  1ATI A;  4KQE A;  1NJ5 A;  4YCV A;  4WJ4 A;  3L4G B;  3QTC A;  3V7S A;  4Q6G A;  4DPG A;  4XEM A;  4BWA A;  3HXU A;  1KOG A;  1N9W A;  2EJG A;  4UP8 A;  3QO7 A;  2ZCE A;  4UP9 A;  3RGL A;  4K86 A;  1EIY A;  3CMQ A;  2DTH A;  3M4P A;  3TEG A;  2Q7G A;  2ZR2 A;  2NS6 A;  4TVY A;  1X2G A;  2CGH A;  3FJP A;  4EX5 A;  1E1T A;  2IY5 B;  2RHQ B;  2DTO A;  3M4Q A;  1H4T A;  4H2X A;  1NJ6 A;  3LC0 A;  3RIR A;  3UH0 A;  1H4S A;  2CJB A;  2Q7H A;  3QO8 A;  1Z7M A;  3MQZ A;  2Q7E A;  1IL2 A;  1B76 A;  2PMF A;  1X01 A;  2ZR3 A;  1BBU A;  4H2V A;  4XU1 A;  1G51 A;  3A7R A;  3TUP A;  2E64 A;  2QHV A;  4YRR A;  3HTZ A;  4KR2 A;  3V8L A;  4H2X B;  4CH3 A;  2E10 A;  1KMN A;  4K88 A;  4P73 C;  4XTZ A;  3OD1 A;  2CJ9 A;  1E22 A;  2ZT6 A;  1WQW A;  3MF1 A;  4HA8 A;  4YDQ A;  2P0L A;  3RKY A;  2ARU A;  2QHS A;  3PCO A;  2ODR C;  1WLE A;  4NCX A;  5C53 B;  1L0W A;  1EVK A;  4UP7 A;  1B70 B;  1NJ8 A;  2EAY A;  2ZZG A;  3QO5 A;  2ZIM A;  4YRP A;  4LVI A;  2ZGW A;  2AMC A;  3RUX A;  3REX A;  2EJF A;  4G85 A;  2DQ3 A;  3RKX A;  3LSS A;  2ARS A;  4YP0 A;  1EVL A;  4YRE A;  4LVM A;  1X55 A;  4WI1 A;  1WYD A;  5C51 B;  3HY0 A;  1HTT A;  3KFU A;  5HGQ A;  1EFW A;  2ART A;  4CH6 A;  2EJ9 A;  2ZZF A;  1SET A;  4P3P A;  3IKL A;  1SES A;  2DU7 A;  1NYQ A;  2J3M A;  4YPF A;  2ALY A;  3A74 A;  2ZIN A;  3L2Z A;  1ADY A;  2RHQ A;  4K87 A;  1YFT A;  3UGQ A;  1B8A A;  2EWN A;  3BJU A;  3EFS A;  3EFR A;  4RQE A;  3A31 A;  1B7Y A;  1NJ2 A;  2ZT5 A;  4HVC A;  1E1O A;  3ICA A;  3PCO B;  3V8J A;  3P8V A;  1B7Y B;  4ZIB A;  4TWA A;  4PG3 A;  1PYS A;  1USY A;  1G5H A;  1GGM A;  1NYR A;  4TVA B;  4P71 A;  4H2U A;  1ASY A;  4Q15 A;  4RQF A;  2DDZ A;  3V7C A;  1X56 A;  4ZTZ B;  4WJ3 M;  2RHS A;  4HWS A;  5E3I A;  2DZ9 A;  2QHU A;  4XU2 A;  1YFR A;  4O2D A;  4BW9 A;  4XU3 A;  3L1A A;  4LNS A;  1BBW A;  5F5W A;  2IY5 A;  2I4L A;  1YFS A;  4PHC A;  4YRT A;  3VQW A;  1NJ1 A;  4YRI A;  2P5I A;  3BFM A;  4XU0 A;  4J15 A;  4CS3 A;  3HFZ B;  2ZZE A;  4EO4 A;  4YRO A;  5C52 B;  4HWT A;  2ZIO A;  2Q5I A;  4XTY A;  1JJC A;  3IKM B;  2E41 A;  4CH5 A;  4YRJ A;  4P75 A;  1Z7N A;  3A5Y A;  2EL9 A;  4OLF A;  4LVJ A;  4XTX A;  1QF6 A;  3UFG A;  3VQX A;  4E51 A;  1RIQ A;  2Q5H A;  4CS4 A;  1W66 A;  1NNH A;  4H2Y A;  2ZNI A;  1ADJ A;  4TQD A;  1KMM A;  3IG2 A;  5K1P A;  3L4G A;  1VQZ A;  3UGT A;  3V8K A;  2I4M A;  3QNE A;  1BIB A;  4P75 C;  1E24 A;  3HXV A;  1FYF A;  2QHT A;  3E9H A;  3REU A;  4HWR A;  2DXU A;  1X2H A;  3LSQ A;  5ELO A;  5KNN A;  2J3L A;  4YRF A;  2ODR D;  2DEQ A;  3HXY A;  4LVK A;  2AKW A;  3ERR A;  1H4V B;  4TQF A;  4UPA A;  1J5W A;  4YRN A;  3HRI A;  3P8Y A;  3NEL A;  4H2T A;  5K1X A;  3MF2 A;  3E9I A;  2ALY B;  1G5I A;  2ZT8 A;  4P73 A;  2I4N A;  3NET A;  1C0A A;  4RDX A;  4HWO A;  3A7U A;  1BIA A;  3VQV A;  1EIY B;  2DVE A;  4YRG A;  2PME A;  1EOV A;  4KR3 A;  4HT4 A;  4YYE A;  2XGT A;  4L87 A;  3R07 A;  4X5O A;  1LYL A;  2DU5 A;  2RHS B;  3TEH A;  2ZNJ A;  3MEY A;  3IAL A;  2ZTG A;  3P8T A;  4H2S A;  3RAC A;  4P72 C;  2C8M A;  4TTV A;  3PZC A;  1WNL A;  4P74 C;  4YRM A;  4HWP A;  2DZC A;  4YRS A;  3RKW A;  3HXX A;  2E1H A;  4H02 A;  4XTU A;  3HY1 A;  3I7F A;  4DQ2 A;  3HFV A;  3DSQ A;  4ZTU B;  4P3N A;  1B70 A;  1SRY A;  4YCW A;  4P74 A;  1JJC B;  4CH4 A;  5ELN A;  4YRC A;  2E65 A;  3A5Z A;  4OP0 A;  2A8E A;  12AS A;  4XTV A;  2XTI A;  4TVW A;  2C7I A;  11AS A;  1WQ7 A; 
#chains in the Genus database with same CATH homology
 4CS2 A;  3HXW A;  3NEN A;  1H4Q A;  4YRQ A;  4YRL A;  2ZT7 A;  1WPY A;  2HNI A;  1SER A;  3NEM A;  3HFZ A;  4P3O A;  2E5A A;  3VQY A;  3A7A A;  2E3C A;  2DQ0 A;  2AKW B;  2DJZ A;  1EQR A;  2CJA A;  3HRK A;  2I4O A;  2FYK A;  1QE0 A;  2DKG A;  4P72 A;  3RF1 A;  2DTI A;  2ZXF A;  4XEO A;  1HC7 A;  1WU7 A;  4H2W A;  1YB3 A;  1PYS B;  3VBB A;  3WQZ A;  3RL6 A;  4G84 A;  3V7R A;  1X54 A;  4RMF A;  2AMC B;  3W3S A;  4LVL A;  1YGB A;  4YCU A;  1USY C;  2DXT A;  4TVA A;  2CIM A;  2G4C A;  4XTW A;  4YRK A;  1ASZ A;  3HXZ A;  3G1Z A;  4WF2 A;  4AH6 A;  4P71 C;  1HXD A;  3A32 A;  3TEH B;  1ATI A;  4KQE A;  1NJ5 A;  4YCV A;  4WJ4 A;  3L4G B;  3QTC A;  3V7S A;  4Q6G A;  4DPG A;  4XEM A;  4BWA A;  3HXU A;  1KOG A;  1N9W A;  2EJG A;  4UP8 A;  3QO7 A;  2ZCE A;  4UP9 A;  3RGL A;  4K86 A;  1EIY A;  3CMQ A;  2DTH A;  3M4P A;  3TEG A;  2Q7G A;  2ZR2 A;  2NS6 A;  4TVY A;  1X2G A;  2CGH A;  3FJP A;  4EX5 A;  1E1T A;  2IY5 B;  2RHQ B;  2DTO A;  3M4Q A;  1H4T A;  4H2X A;  1NJ6 A;  3LC0 A;  3RIR A;  3UH0 A;  1H4S A;  2CJB A;  2Q7H A;  3QO8 A;  1Z7M A;  3MQZ A;  2Q7E A;  1IL2 A;  1B76 A;  2PMF A;  1X01 A;  2ZR3 A;  1BBU A;  4H2V A;  4XU1 A;  1G51 A;  3A7R A;  3TUP A;  2E64 A;  2QHV A;  4YRR A;  3HTZ A;  4KR2 A;  3V8L A;  4H2X B;  4CH3 A;  2E10 A;  1KMN A;  4K88 A;  4P73 C;  4XTZ A;  3OD1 A;  2CJ9 A;  1E22 A;  2ZT6 A;  1WQW A;  3MF1 A;  4HA8 A;  4YDQ A;  2P0L A;  3RKY A;  2ARU A;  2QHS A;  3PCO A;  2ODR C;  1WLE A;  4NCX A;  5C53 B;  1L0W A;  1EVK A;  4UP7 A;  1B70 B;  1NJ8 A;  2EAY A;  2ZZG A;  3QO5 A;  2ZIM A;  4YRP A;  4LVI A;  2ZGW A;  2AMC A;  3RUX A;  3REX A;  2EJF A;  4G85 A;  2DQ3 A;  3RKX A;  3LSS A;  2ARS A;  4YP0 A;  1EVL A;  4YRE A;  4LVM A;  1X55 A;  4WI1 A;  1WYD A;  5C51 B;  3HY0 A;  1HTT A;  3KFU A;  5HGQ A;  1EFW A;  2ART A;  4CH6 A;  2EJ9 A;  2ZZF A;  1SET A;  4P3P A;  3IKL A;  1SES A;  2DU7 A;  1NYQ A;  2J3M A;  4YPF A;  2ALY A;  3A74 A;  2ZIN A;  3L2Z A;  1ADY A;  2RHQ A;  4K87 A;  1YFT A;  3UGQ A;  1B8A A;  2EWN A;  3BJU A;  3EFS A;  3EFR A;  4RQE A;  3A31 A;  1B7Y A;  1NJ2 A;  2ZT5 A;  4HVC A;  1E1O A;  3ICA A;  3PCO B;  3V8J A;  3P8V A;  1B7Y B;  4ZIB A;  4TWA A;  4PG3 A;  1PYS A;  1USY A;  1G5H A;  1GGM A;  1NYR A;  4TVA B;  4P71 A;  4H2U A;  1ASY A;  4Q15 A;  4RQF A;  2DDZ A;  3V7C A;  1X56 A;  4ZTZ B;  4WJ3 M;  2RHS A;  4HWS A;  5E3I A;  2DZ9 A;  2QHU A;  4XU2 A;  1YFR A;  4O2D A;  4BW9 A;  4XU3 A;  3L1A A;  4LNS A;  1BBW A;  5F5W A;  2IY5 A;  2I4L A;  1YFS A;  4PHC A;  4YRT A;  3VQW A;  1NJ1 A;  4YRI A;  2P5I A;  3BFM A;  4XU0 A;  4J15 A;  4CS3 A;  3HFZ B;  2ZZE A;  4EO4 A;  4YRO A;  5C52 B;  4HWT A;  2ZIO A;  2Q5I A;  4XTY A;  1JJC A;  3IKM B;  2E41 A;  4CH5 A;  4YRJ A;  4P75 A;  1Z7N A;  3A5Y A;  2EL9 A;  4OLF A;  4LVJ A;  4XTX A;  1QF6 A;  3UFG A;  3VQX A;  4E51 A;  1RIQ A;  2Q5H A;  4CS4 A;  1W66 A;  1NNH A;  4H2Y A;  2ZNI A;  1ADJ A;  4TQD A;  1KMM A;  3IG2 A;  5K1P A;  3L4G A;  1VQZ A;  3UGT A;  3V8K A;  2I4M A;  3QNE A;  1BIB A;  4P75 C;  1E24 A;  3HXV A;  1FYF A;  2QHT A;  3E9H A;  3REU A;  4HWR A;  2DXU A;  1X2H A;  3LSQ A;  5ELO A;  5KNN A;  2J3L A;  4YRF A;  2ODR D;  2DEQ A;  3HXY A;  4LVK A;  2AKW A;  3ERR A;  1H4V B;  4TQF A;  4UPA A;  1J5W A;  4YRN A;  3HRI A;  3P8Y A;  3NEL A;  4H2T A;  5K1X A;  3MF2 A;  3E9I A;  2ALY B;  1G5I A;  2ZT8 A;  4P73 A;  2I4N A;  3NET A;  1C0A A;  4RDX A;  4HWO A;  3A7U A;  1BIA A;  3VQV A;  1EIY B;  2DVE A;  4YRG A;  2PME A;  1EOV A;  4KR3 A;  4HT4 A;  4YYE A;  2XGT A;  4L87 A;  3R07 A;  4X5O A;  1LYL A;  2DU5 A;  2RHS B;  3TEH A;  2ZNJ A;  3MEY A;  3IAL A;  2ZTG A;  3P8T A;  4H2S A;  3RAC A;  4P72 C;  2C8M A;  4TTV A;  3PZC A;  1WNL A;  4P74 C;  4YRM A;  4HWP A;  2DZC A;  4YRS A;  3RKW A;  3HXX A;  2E1H A;  4H02 A;  4XTU A;  3HY1 A;  3I7F A;  4DQ2 A;  3HFV A;  3DSQ A;  4ZTU B;  4P3N A;  1B70 A;  1SRY A;  4YCW A;  4P74 A;  1JJC B;  4CH4 A;  5ELN A;  4YRC A;  2E65 A;  3A5Z A;  4OP0 A;  2A8E A;  12AS A;  4XTV A;  2XTI A;  4TVW A;  2C7I A;  11AS A;  1WQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...