2P5IA

Crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
262
Chain Sequence
PWRFLDHTSFGPTFQALQSFAYDDTLCTSIGKSQSPPTLRAWVHHNTVVLGIQDSRLPQIKAGIEALKGFQHDVIVRNSGGLAVVLDSGILNLSLVLKEEKGFSIDDGYELMYELICSMFQEQIEAREIVGSYCPGSYDLSIDGKKFAGISQRRIRGGVAVQIYLCVSGSGAERAKMIRTFYDKAVAGQPTKFVYPRIKPETMASLSELLGQPHNVSDVLLKALMTLQQHGASLLTESLSADEWLLYEQHFARISERNEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3822 protein
publication title Crystal structure of a hypothetical protein from Bacillus halodurans: Pfam-PF03099
rcsb
source organism Bacillus halodurans c-125
molecule tags Structural genomics, unknown function
total genus 82
structure length 262
sequence length 265
ec nomenclature ec 2.3.1.204: Octanoyl-[GcvH]:protein N-octanoyltransferase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2p5iA00
1BBWA 2P0LA 1NYQA 4CS4A 2DXUA 2E65A 3V8KA 2ZXFA 4DQ2A 2DQ0A 1VQZA 4RQFA 4YRQA 2CJ9A 4YP0A 2DDZA 3BFMA 4BWAA 2RHQA 2Q7EA 1G51A 3V8LA 4YCWA 4P3NA 3VQXA 1ASYA 3NELA 4G84A 4YRKA 4H2XA 3NETA 4L87A 3RUXA 4BW9A 4TWAA 1E1TA 1H4QA 3CMQA 3L2ZA 3BJUA 1B70B 3QNEA 2ALYA 5C53B 2ZT8A 3E9HA 2DTHA 2ZNJA 4HWOA 11ASA 5HGQA 1ADJA 1JJCA 5C51B 1YB3A 3HXVA 4ZTUB 3L1AA 4XU3A 2DZ9A 1H4VB 1PYSB 2E5AA 4YRJA 4EO4A 2DTOA 3HFZA 3REUA 3A7RA 3P8YA 4XEOA 4XU0A 3A7UA 4PHCA 1X56A 4P73C 2AMCA 2RHQB 2Q7HA 4P71A 4O2DA 4TQFA 3HXWA 1H4TA 4K86A 1KMNA 4H2UA 3UGTA 3RGLA 4XTUA 4YRRA 4XTXA 2AKWA 1USYA 1WU7A 3HXZA 2E10A 3DSQA 4YCUA 4CS2A 3RF1A 4KQEA 4Q6GA 4ZTZB 4P74C 2ZT7A 4YRIA 2E1HA 4XU2A 3HTZA 3A7AA 3LSQA 2RHSB 1KOGA 2ALYB 3TEHB 1SERA 1USYC 1ADYA 1E24A 2ZIOA 3PCOA 1W66A 2CIMA 2Q5HA 3LC0A 2XTIA 1Z7NA 3RL6A 4CS3A 1B8AA 1WYDA 3HRIA 1G5IA 4P3OA 4WJ4A 1B7YB 1ASZA 3E9IA 4WI1A 3LSSA 4K87A 2I4OA 4YCVA 2FYKA 3M4QA 2DKGA 4YRLA 1GGMA 3KFUA 4E51A 4YRMA 1X2GA 1WPYA 4XTYA 1BBUA 1NJ8A 2DQ3A 1EVLA 1BIBA 1NYRA 3VBBA 4CH3A 3HY0A 1YGBA 1NJ5A 4EX5A 2ZR3A 3IG2A 3RKYA 4TTVA 3L4GB 4LNSA 1J5WA 4KR2A 4G85A 5K1PA 1G5HA 4YRGA 4TVAA 2DU7A 2ARSA 4XTZA 3ERRA 2EAYA 1NNHA 4CH6A 4DPGA 2E64A 4KR3A 2E3CA 2EWNA 4ZIBA 1SETA 4H2SA 4P73A 3NENA 3TUPA 4NCXA 1QF6A 1EVKA 2J3LA 5ELNA 2CJAA 3HY1A 1E22A 1X55A 1YFSA 5F5WA 4YPFA 3A5ZA 4P74A 3MEYA 4H2YA 3IKLA 1SESA 4HWSA 1FYFA 1EIYA 1HC7A 3P8TA 1ATIA 2PMEA 4UP9A 1EOVA 3A5YA 4YREA 3V7SA 4TVYA 4H2XB 4CH4A 4XTVA 2ZR2A 3QO7A 2ZINA 2I4LA 3EFSA 4YDQA 1N9WA 3RIRA 2ARTA 2C7IA 4TQDA 4TVWA 3VQYA 1C0AA 1KMMA 3HXUA 1JJCB 4P75C 2ZTGA 4UP8A 4WJ3M 4HWPA 3W3SA 2EJFA 2CJBA 2Q5IA 4XTWA 1WQ7A 2QHTA 3VQVA 2ZZGA 4YRFA 3HFZB 5ELOA 3A74A 3UH0A 2ZZEA 3WQZA 4RMFA 4YRCA 1B70A 1Z7MA 4H2TA 3I7FA 4XEMA 2CGHA 2AMCB 3UFGA 3HXYA 3EFRA 4H02A 2EL9A 1E1OA 1EIYB 4YRSA 4YRTA 4OLFA 1PYSA 4Q15A 2C8MA 2AKWB 4K88A 2J3MA 4OP0A 5KNNA 1QE0A 2IY5A 1NJ6A 1BIAA 4PG3A 1HXDA 3A32A 1RIQA 2E41A 1EFWA 1H4SA 2EJGA 4WF2A 3V8JA 2G4CA 2I4MA 3P8VA 3PCOB 2DTIA 2P5IA 3QTCA 4YROA 3MF1A 4HWRA 2ZGWA 4P72A 4RDXA 3R07A 3V7RA 2DU5A 2RHSA 1X2HA 1WQWA 2HNIA 3UGQA 3TEHA 1SRYA 2ODRD 4HA8A 4J15A 4P72C 4H2VA 2ZIMA 4RQEA 3HXXA 2QHUA 1LYLA 3HRKA 2EJ9A 3RKXA 4UP7A 3NEMA 1B7YA 4YRPA 3M4PA 2DZCA 2DVEA 12ASA 2XGTA 4XU1A 1YFTA 2IY5B 1NJ2A 4P75A 2DXTA 1IL2A 4CH5A 1B76A 1X01A 2ZT5A 3V7CA 3TEGA 2DEQA 1WLEA 4HVCA 2ODRC 3G1ZA 2QHSA 4TVAB 1WNLA 3VQWA 4AH6A 5C52B 2ZT6A 3MF2A 4UPAA 3FJPA 3QO5A 3OD1A 3RACA 1L0WA 2ZCEA 4X5OA 4P71C 1X54A 3L4GA 4HWTA 4P3PA 2ZZFA 4YYEA 3QO8A 4YRNA 1EQRA 4H2WA 2I4NA 2ZNIA 5K1XA 3IKMB 3IALA 3HFVA 3REXA 2Q7GA 3RKWA 1NJ1A 1YFRA 1HTTA 3ICAA 2QHVA 3A31A 2DJZA 3PZCA 2PMFA 5E3IA 2ARUA
chains in the Genus database with same CATH superfamily
1BBWA 2P0LA 1NYQA 4CS4A 2DXUA 2E65A 3V8KA 2ZXFA 4DQ2A 2DQ0A 1VQZA 4RQFA 4YRQA 2CJ9A 4YP0A 2DDZA 3BFMA 4BWAA 2RHQA 2Q7EA 1G51A 3V8LA 4YCWA 4P3NA 3VQXA 1ASYA 3NELA 4G84A 4YRKA 4H2XA 3NETA 4L87A 3RUXA 4BW9A 4TWAA 1E1TA 1H4QA 3CMQA 3L2ZA 3BJUA 1B70B 3QNEA 2ALYA 5C53B 2ZT8A 3E9HA 2DTHA 2ZNJA 4HWOA 11ASA 5HGQA 1ADJA 1JJCA 5C51B 4LVKA 1YB3A 3HXVA 4ZTUB 3L1AA 4XU3A 2DZ9A 1H4VB 1PYSB 2E5AA 4YRJA 4EO4A 4LVLA 2DTOA 3HFZA 3REUA 3A7RA 3P8YA 4XEOA 3A7UA 4XU0A 4PHCA 1X56A 4P73C 2AMCA 2RHQB 2Q7HA 4P71A 4O2DA 4TQFA 3HXWA 1H4TA 4K86A 1KMNA 4H2UA 3UGTA 3RGLA 4XTUA 4YRRA 4XTXA 2AKWA 1USYA 1WU7A 3HXZA 2E10A 3DSQA 4YCUA 4CS2A 3RF1A 4KQEA 4Q6GA 4ZTZB 4P74C 2ZT7A 4YRIA 2NS6A 2E1HA 4XU2A 3HTZA 3A7AA 3LSQA 2RHSB 1KOGA 2ALYB 3TEHB 1SERA 1USYC 1ADYA 1E24A 2ZIOA 3PCOA 1W66A 2CIMA 2Q5HA 3LC0A 2XTIA 1Z7NA 3RL6A 4CS3A 1B8AA 1WYDA 3HRIA 1G5IA 4P3OA 4WJ4A 1B7YB 1ASZA 3E9IA 4WI1A 3LSSA 4K87A 2I4OA 4YCVA 2FYKA 3M4QA 2DKGA 4YRLA 1GGMA 3KFUA 4E51A 4YRMA 1X2GA 1WPYA 4XTYA 1BBUA 1NJ8A 2DQ3A 1EVLA 1BIBA 1NYRA 3VBBA 4CH3A 3HY0A 1YGBA 1NJ5A 4EX5A 2ZR3A 3IG2A 3RKYA 4TTVA 3L4GB 4HT4A 4LNSA 1J5WA 4KR2A 4G85A 5K1PA 1G5HA 4YRGA 4TVAA 2DU7A 2ARSA 3ERRA 4XTZA 2EAYA 1NNHA 4CH6A 4DPGA 2E64A 4KR3A 2E3CA 2EWNA 4ZIBA 1SETA 4H2SA 4P73A 3NENA 3TUPA 4NCXA 1QF6A 1EVKA 2J3LA 5ELNA 2CJAA 3HY1A 1E22A 1X55A 1YFSA 5F5WA 4YPFA 3A5ZA 4P74A 3MEYA 4H2YA 3IKLA 1SESA 4HWSA 1FYFA 1EIYA 1HC7A 3P8TA 1ATIA 2PMEA 4UP9A 1EOVA 3A5YA 4YREA 3V7SA 4TVYA 4H2XB 4CH4A 4XTVA 2ZR2A 3QO7A 2ZINA 2I4LA 3EFSA 4YDQA 1N9WA 3RIRA 2ARTA 2C7IA 4TQDA 4TVWA 3VQYA 1C0AA 1KMMA 3HXUA 1JJCB 4P75C 2ZTGA 4UP8A 4WJ3M 4HWPA 3W3SA 2EJFA 2CJBA 2Q5IA 4XTWA 1WQ7A 2QHTA 3VQVA 2ZZGA 4YRFA 3HFZB 5ELOA 3A74A 3UH0A 2ZZEA 3WQZA 4RMFA 4YRCA 1B70A 1Z7MA 4H2TA 3I7FA 4XEMA 2CGHA 2AMCB 4LVMA 3UFGA 3HXYA 3EFRA 4H02A 2EL9A 1E1OA 1EIYB 4YRSA 4YRTA 2A8EA 4OLFA 1PYSA 4Q15A 2C8MA 2AKWB 4K88A 2J3MA 4OP0A 5KNNA 1QE0A 2IY5A 1NJ6A 1BIAA 4PG3A 1HXDA 3A32A 1RIQA 2E41A 1EFWA 1H4SA 2EJGA 4WF2A 3V8JA 2G4CA 2I4MA 3P8VA 3PCOB 2DTIA 2P5IA 3QTCA 4YROA 3MF1A 4HWRA 2ZGWA 4P72A 4RDXA 3R07A 3V7RA 2DU5A 2RHSA 1X2HA 1WQWA 2HNIA 3UGQA 3TEHA 1SRYA 2ODRD 4HA8A 4J15A 4P72C 4H2VA 4LVJA 2ZIMA 4RQEA 3HXXA 2QHUA 1LYLA 3HRKA 2EJ9A 3RKXA 4UP7A 3NEMA 1B7YA 4YRPA 3M4PA 2DZCA 2DVEA 12ASA 2XGTA 4XU1A 1YFTA 2IY5B 1NJ2A 4P75A 2DXTA 1IL2A 4CH5A 1B76A 1X01A 2ZT5A 3V7CA 3TEGA 2DEQA 1WLEA 4HVCA 2ODRC 3G1ZA 2QHSA 4TVAB 1WNLA 3VQWA 3MQZA 4AH6A 5C52B 2ZT6A 3MF2A 4UPAA 3FJPA 3QO5A 3OD1A 3RACA 4LVIA 1L0WA 4X5OA 2ZCEA 4P71C 1X54A 3L4GA 4HWTA 4P3PA 2ZZFA 4YYEA 3QO8A 4YRNA 1EQRA 4H2WA 2I4NA 2ZNIA 5K1XA 3IKMB 3IALA 3HFVA 3REXA 2Q7GA 3RKWA 1NJ1A 1YFRA 1HTTA 3ICAA 2QHVA 3A31A 2DJZA 3PZCA 2PMFA 5E3IA 2ARUA
chains in the Genus database with same CATH topology
1BBWA 2P0LA 1NYQA 4CS4A 2DXUA 2E65A 3V8KA 2ZXFA 4DQ2A 2DQ0A 1VQZA 4RQFA 4YRQA 2CJ9A 4YP0A 2DDZA 3BFMA 4BWAA 2RHQA 2Q7EA 1G51A 3V8LA 4YCWA 4P3NA 3VQXA 1ASYA 3NELA 4G84A 4YRKA 4H2XA 3NETA 4L87A 3RUXA 4BW9A 4TWAA 1E1TA 1H4QA 3CMQA 3L2ZA 3BJUA 1B70B 3QNEA 2ALYA 5C53B 2ZT8A 3E9HA 2DTHA 2ZNJA 4HWOA 11ASA 5HGQA 1ADJA 1JJCA 5C51B 4LVKA 1YB3A 3HXVA 4ZTUB 3L1AA 4XU3A 2DZ9A 1H4VB 1PYSB 2E5AA 4YRJA 4EO4A 4LVLA 2DTOA 3HFZA 3REUA 3A7RA 3P8YA 4XEOA 3A7UA 4XU0A 4PHCA 1X56A 4P73C 2AMCA 2RHQB 2Q7HA 4P71A 4O2DA 4TQFA 3HXWA 1H4TA 4K86A 1KMNA 4H2UA 3UGTA 3RGLA 4XTUA 4YRRA 4XTXA 2AKWA 1USYA 1WU7A 3HXZA 2E10A 3DSQA 4YCUA 4CS2A 3RF1A 4KQEA 4Q6GA 4ZTZB 4P74C 2ZT7A 4YRIA 2NS6A 2E1HA 4XU2A 3HTZA 3A7AA 3LSQA 2RHSB 1KOGA 2ALYB 3TEHB 1SERA 1USYC 1ADYA 1E24A 2ZIOA 3PCOA 1W66A 2CIMA 2Q5HA 3LC0A 2XTIA 1Z7NA 3RL6A 4CS3A 1B8AA 1WYDA 3HRIA 1G5IA 4P3OA 4WJ4A 1B7YB 1ASZA 3E9IA 4WI1A 3LSSA 4K87A 2I4OA 4YCVA 2FYKA 3M4QA 2DKGA 4YRLA 1GGMA 3KFUA 4E51A 4YRMA 1X2GA 1WPYA 4XTYA 1BBUA 1NJ8A 2DQ3A 1EVLA 1BIBA 1NYRA 3VBBA 4CH3A 3HY0A 1YGBA 1NJ5A 4EX5A 2ZR3A 3IG2A 3RKYA 4TTVA 3L4GB 4HT4A 4LNSA 1J5WA 4KR2A 4G85A 5K1PA 1G5HA 4YRGA 4TVAA 2DU7A 2ARSA 3ERRA 4XTZA 2EAYA 1NNHA 4CH6A 4DPGA 2E64A 4KR3A 2E3CA 2EWNA 4ZIBA 1SETA 4H2SA 4P73A 3NENA 3TUPA 4NCXA 1QF6A 1EVKA 2J3LA 5ELNA 2CJAA 3HY1A 1E22A 1X55A 1YFSA 5F5WA 4YPFA 3A5ZA 4P74A 3MEYA 4H2YA 3IKLA 1SESA 4HWSA 1FYFA 1EIYA 1HC7A 3P8TA 1ATIA 2PMEA 4UP9A 1EOVA 3A5YA 4YREA 3V7SA 4TVYA 4H2XB 4CH4A 4XTVA 2ZR2A 3QO7A 2ZINA 2I4LA 3EFSA 4YDQA 1N9WA 3RIRA 2ARTA 2C7IA 4TQDA 4TVWA 3VQYA 1C0AA 1KMMA 3HXUA 1JJCB 4P75C 2ZTGA 4UP8A 4WJ3M 4HWPA 3W3SA 2EJFA 2CJBA 2Q5IA 4XTWA 1WQ7A 2QHTA 3VQVA 2ZZGA 4YRFA 3HFZB 5ELOA 3A74A 3UH0A 2ZZEA 3WQZA 4RMFA 4YRCA 1B70A 1Z7MA 4H2TA 3I7FA 4XEMA 2CGHA 2AMCB 4LVMA 3UFGA 3HXYA 3EFRA 4H02A 2EL9A 1E1OA 1EIYB 4YRSA 4YRTA 2A8EA 4OLFA 1PYSA 4Q15A 2C8MA 2AKWB 4K88A 2J3MA 4OP0A 5KNNA 1QE0A 2IY5A 1NJ6A 1BIAA 4PG3A 1HXDA 3A32A 1RIQA 2E41A 1EFWA 1H4SA 2EJGA 4WF2A 3V8JA 2G4CA 2I4MA 3P8VA 3PCOB 2DTIA 2P5IA 3QTCA 4YROA 3MF1A 4HWRA 2ZGWA 4P72A 4RDXA 3R07A 3V7RA 2DU5A 2RHSA 1X2HA 1WQWA 2HNIA 3UGQA 3TEHA 1SRYA 2ODRD 4HA8A 4J15A 4P72C 4H2VA 4LVJA 2ZIMA 4RQEA 3HXXA 2QHUA 1LYLA 3HRKA 2EJ9A 3RKXA 4UP7A 3NEMA 1B7YA 4YRPA 3M4PA 2DZCA 2DVEA 12ASA 2XGTA 4XU1A 1YFTA 2IY5B 1NJ2A 4P75A 2DXTA 1IL2A 4CH5A 1B76A 1X01A 2ZT5A 3V7CA 3TEGA 2DEQA 1WLEA 4HVCA 2ODRC 3G1ZA 2QHSA 4TVAB 1WNLA 3VQWA 3MQZA 4AH6A 5C52B 2ZT6A 3MF2A 4UPAA 3FJPA 3QO5A 3OD1A 3RACA 4LVIA 1L0WA 4X5OA 2ZCEA 4P71C 1X54A 3L4GA 4HWTA 4P3PA 2ZZFA 4YYEA 3QO8A 4YRNA 1EQRA 4H2WA 2I4NA 2ZNIA 5K1XA 3IKMB 3IALA 3HFVA 3REXA 2Q7GA 3RKWA 1NJ1A 1YFRA 1HTTA 3ICAA 2QHVA 3A31A 2DJZA 3PZCA 2PMFA 5E3IA 2ARUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBW A;  2P0L A;  1NYQ A;  4CS4 A;  2DXU A;  2E65 A;  3V8K A;  2ZXF A;  4DQ2 A;  2DQ0 A;  1VQZ A;  4RQF A;  4YRQ A;  2CJ9 A;  4YP0 A;  2DDZ A;  3BFM A;  4BWA A;  2RHQ A;  2Q7E A;  1G51 A;  3V8L A;  4YCW A;  4P3N A;  3VQX A;  1ASY A;  3NEL A;  4G84 A;  4YRK A;  4H2X A;  3NET A;  4L87 A;  3RUX A;  4BW9 A;  4TWA A;  1E1T A;  1H4Q A;  3CMQ A;  3L2Z A;  3BJU A;  1B70 B;  3QNE A;  2ALY A;  5C53 B;  2ZT8 A;  3E9H A;  2DTH A;  2ZNJ A;  4HWO A;  11AS A;  5HGQ A;  1ADJ A;  1JJC A;  5C51 B;  1YB3 A;  3HXV A;  4ZTU B;  3L1A A;  4XU3 A;  2DZ9 A;  1H4V B;  1PYS B;  2E5A A;  4YRJ A;  4EO4 A;  2DTO A;  3HFZ A;  3REU A;  3A7R A;  3P8Y A;  4XEO A;  4XU0 A;  3A7U A;  4PHC A;  1X56 A;  4P73 C;  2AMC A;  2RHQ B;  2Q7H A;  4P71 A;  4O2D A;  4TQF A;  3HXW A;  1H4T A;  4K86 A;  1KMN A;  4H2U A;  3UGT A;  3RGL A;  4XTU A;  4YRR A;  4XTX A;  2AKW A;  1USY A;  1WU7 A;  3HXZ A;  2E10 A;  3DSQ A;  4YCU A;  4CS2 A;  3RF1 A;  4KQE A;  4Q6G A;  4ZTZ B;  4P74 C;  2ZT7 A;  4YRI A;  2E1H A;  4XU2 A;  3HTZ A;  3A7A A;  3LSQ A;  2RHS B;  1KOG A;  2ALY B;  3TEH B;  1SER A;  1USY C;  1ADY A;  1E24 A;  2ZIO A;  3PCO A;  1W66 A;  2CIM A;  2Q5H A;  3LC0 A;  2XTI A;  1Z7N A;  3RL6 A;  4CS3 A;  1B8A A;  1WYD A;  3HRI A;  1G5I A;  4P3O A;  4WJ4 A;  1B7Y B;  1ASZ A;  3E9I A;  4WI1 A;  3LSS A;  4K87 A;  2I4O A;  4YCV A;  2FYK A;  3M4Q A;  2DKG A;  4YRL A;  1GGM A;  3KFU A;  4E51 A;  4YRM A;  1X2G A;  1WPY A;  4XTY A;  1BBU A;  1NJ8 A;  2DQ3 A;  1EVL A;  1BIB A;  1NYR A;  3VBB A;  4CH3 A;  3HY0 A;  1YGB A;  1NJ5 A;  4EX5 A;  2ZR3 A;  3IG2 A;  3RKY A;  4TTV A;  3L4G B;  4LNS A;  1J5W A;  4KR2 A;  4G85 A;  5K1P A;  1G5H A;  4YRG A;  4TVA A;  2DU7 A;  2ARS A;  4XTZ A;  3ERR A;  2EAY A;  1NNH A;  4CH6 A;  4DPG A;  2E64 A;  4KR3 A;  2E3C A;  2EWN A;  4ZIB A;  1SET A;  4H2S A;  4P73 A;  3NEN A;  3TUP A;  4NCX A;  1QF6 A;  1EVK A;  2J3L A;  5ELN A;  2CJA A;  3HY1 A;  1E22 A;  1X55 A;  1YFS A;  5F5W A;  4YPF A;  3A5Z A;  4P74 A;  3MEY A;  4H2Y A;  3IKL A;  1SES A;  4HWS A;  1FYF A;  1EIY A;  1HC7 A;  3P8T A;  1ATI A;  2PME A;  4UP9 A;  1EOV A;  3A5Y A;  4YRE A;  3V7S A;  4TVY A;  4H2X B;  4CH4 A;  4XTV A;  2ZR2 A;  3QO7 A;  2ZIN A;  2I4L A;  3EFS A;  4YDQ A;  1N9W A;  3RIR A;  2ART A;  2C7I A;  4TQD A;  4TVW A;  3VQY A;  1C0A A;  1KMM A;  3HXU A;  1JJC B;  4P75 C;  2ZTG A;  4UP8 A;  4WJ3 M;  4HWP A;  3W3S A;  2EJF A;  2CJB A;  2Q5I A;  4XTW A;  1WQ7 A;  2QHT A;  3VQV A;  2ZZG A;  4YRF A;  3HFZ B;  5ELO A;  3A74 A;  3UH0 A;  2ZZE A;  3WQZ A;  4RMF A;  4YRC A;  1B70 A;  1Z7M A;  4H2T A;  3I7F A;  4XEM A;  2CGH A;  2AMC B;  3UFG A;  3HXY A;  3EFR A;  4H02 A;  2EL9 A;  1E1O A;  1EIY B;  4YRS A;  4YRT A;  4OLF A;  1PYS A;  4Q15 A;  2C8M A;  2AKW B;  4K88 A;  2J3M A;  4OP0 A;  5KNN A;  1QE0 A;  2IY5 A;  1NJ6 A;  1BIA A;  4PG3 A;  1HXD A;  3A32 A;  1RIQ A;  2E41 A;  1EFW A;  1H4S A;  2EJG A;  4WF2 A;  3V8J A;  2G4C A;  2I4M A;  3P8V A;  3PCO B;  2DTI A;  2P5I A;  3QTC A;  4YRO A;  3MF1 A;  4HWR A;  2ZGW A;  4P72 A;  4RDX A;  3R07 A;  3V7R A;  2DU5 A;  2RHS A;  1X2H A;  1WQW A;  2HNI A;  3UGQ A;  3TEH A;  1SRY A;  2ODR D;  4HA8 A;  4J15 A;  4P72 C;  4H2V A;  2ZIM A;  4RQE A;  3HXX A;  2QHU A;  1LYL A;  3HRK A;  2EJ9 A;  3RKX A;  4UP7 A;  3NEM A;  1B7Y A;  4YRP A;  3M4P A;  2DZC A;  2DVE A;  12AS A;  2XGT A;  4XU1 A;  1YFT A;  2IY5 B;  1NJ2 A;  4P75 A;  2DXT A;  1IL2 A;  4CH5 A;  1B76 A;  1X01 A;  2ZT5 A;  3V7C A;  3TEG A;  2DEQ A;  1WLE A;  4HVC A;  2ODR C;  3G1Z A;  2QHS A;  4TVA B;  1WNL A;  3VQW A;  4AH6 A;  5C52 B;  2ZT6 A;  3MF2 A;  4UPA A;  3FJP A;  3QO5 A;  3OD1 A;  3RAC A;  1L0W A;  2ZCE A;  4X5O A;  4P71 C;  1X54 A;  3L4G A;  4HWT A;  4P3P A;  2ZZF A;  4YYE A;  3QO8 A;  4YRN A;  1EQR A;  4H2W A;  2I4N A;  2ZNI A;  5K1X A;  3IKM B;  3IAL A;  3HFV A;  3REX A;  2Q7G A;  3RKW A;  1NJ1 A;  1YFR A;  1HTT A;  3ICA A;  2QHV A;  3A31 A;  2DJZ A;  3PZC A;  2PMF A;  5E3I A;  2ARU A; 
#chains in the Genus database with same CATH topology
 1BBW A;  2P0L A;  1NYQ A;  4CS4 A;  2DXU A;  2E65 A;  3V8K A;  2ZXF A;  4DQ2 A;  2DQ0 A;  1VQZ A;  4RQF A;  4YRQ A;  2CJ9 A;  4YP0 A;  2DDZ A;  3BFM A;  4BWA A;  2RHQ A;  2Q7E A;  1G51 A;  3V8L A;  4YCW A;  4P3N A;  3VQX A;  1ASY A;  3NEL A;  4G84 A;  4YRK A;  4H2X A;  3NET A;  4L87 A;  3RUX A;  4BW9 A;  4TWA A;  1E1T A;  1H4Q A;  3CMQ A;  3L2Z A;  3BJU A;  1B70 B;  3QNE A;  2ALY A;  5C53 B;  2ZT8 A;  3E9H A;  2DTH A;  2ZNJ A;  4HWO A;  11AS A;  5HGQ A;  1ADJ A;  1JJC A;  5C51 B;  4LVK A;  1YB3 A;  3HXV A;  4ZTU B;  3L1A A;  4XU3 A;  2DZ9 A;  1H4V B;  1PYS B;  2E5A A;  4YRJ A;  4EO4 A;  4LVL A;  2DTO A;  3HFZ A;  3REU A;  3A7R A;  3P8Y A;  4XEO A;  3A7U A;  4XU0 A;  4PHC A;  1X56 A;  4P73 C;  2AMC A;  2RHQ B;  2Q7H A;  4P71 A;  4O2D A;  4TQF A;  3HXW A;  1H4T A;  4K86 A;  1KMN A;  4H2U A;  3UGT A;  3RGL A;  4XTU A;  4YRR A;  4XTX A;  2AKW A;  1USY A;  1WU7 A;  3HXZ A;  2E10 A;  3DSQ A;  4YCU A;  4CS2 A;  3RF1 A;  4KQE A;  4Q6G A;  4ZTZ B;  4P74 C;  2ZT7 A;  4YRI A;  2NS6 A;  2E1H A;  4XU2 A;  3HTZ A;  3A7A A;  3LSQ A;  2RHS B;  1KOG A;  2ALY B;  3TEH B;  1SER A;  1USY C;  1ADY A;  1E24 A;  2ZIO A;  3PCO A;  1W66 A;  2CIM A;  2Q5H A;  3LC0 A;  2XTI A;  1Z7N A;  3RL6 A;  4CS3 A;  1B8A A;  1WYD A;  3HRI A;  1G5I A;  4P3O A;  4WJ4 A;  1B7Y B;  1ASZ A;  3E9I A;  4WI1 A;  3LSS A;  4K87 A;  2I4O A;  4YCV A;  2FYK A;  3M4Q A;  2DKG A;  4YRL A;  1GGM A;  3KFU A;  4E51 A;  4YRM A;  1X2G A;  1WPY A;  4XTY A;  1BBU A;  1NJ8 A;  2DQ3 A;  1EVL A;  1BIB A;  1NYR A;  3VBB A;  4CH3 A;  3HY0 A;  1YGB A;  1NJ5 A;  4EX5 A;  2ZR3 A;  3IG2 A;  3RKY A;  4TTV A;  3L4G B;  4HT4 A;  4LNS A;  1J5W A;  4KR2 A;  4G85 A;  5K1P A;  1G5H A;  4YRG A;  4TVA A;  2DU7 A;  2ARS A;  3ERR A;  4XTZ A;  2EAY A;  1NNH A;  4CH6 A;  4DPG A;  2E64 A;  4KR3 A;  2E3C A;  2EWN A;  4ZIB A;  1SET A;  4H2S A;  4P73 A;  3NEN A;  3TUP A;  4NCX A;  1QF6 A;  1EVK A;  2J3L A;  5ELN A;  2CJA A;  3HY1 A;  1E22 A;  1X55 A;  1YFS A;  5F5W A;  4YPF A;  3A5Z A;  4P74 A;  3MEY A;  4H2Y A;  3IKL A;  1SES A;  4HWS A;  1FYF A;  1EIY A;  1HC7 A;  3P8T A;  1ATI A;  2PME A;  4UP9 A;  1EOV A;  3A5Y A;  4YRE A;  3V7S A;  4TVY A;  4H2X B;  4CH4 A;  4XTV A;  2ZR2 A;  3QO7 A;  2ZIN A;  2I4L A;  3EFS A;  4YDQ A;  1N9W A;  3RIR A;  2ART A;  2C7I A;  4TQD A;  4TVW A;  3VQY A;  1C0A A;  1KMM A;  3HXU A;  1JJC B;  4P75 C;  2ZTG A;  4UP8 A;  4WJ3 M;  4HWP A;  3W3S A;  2EJF A;  2CJB A;  2Q5I A;  4XTW A;  1WQ7 A;  2QHT A;  3VQV A;  2ZZG A;  4YRF A;  3HFZ B;  5ELO A;  3A74 A;  3UH0 A;  2ZZE A;  3WQZ A;  4RMF A;  4YRC A;  1B70 A;  1Z7M A;  4H2T A;  3I7F A;  4XEM A;  2CGH A;  2AMC B;  4LVM A;  3UFG A;  3HXY A;  3EFR A;  4H02 A;  2EL9 A;  1E1O A;  1EIY B;  4YRS A;  4YRT A;  2A8E A;  4OLF A;  1PYS A;  4Q15 A;  2C8M A;  2AKW B;  4K88 A;  2J3M A;  4OP0 A;  5KNN A;  1QE0 A;  2IY5 A;  1NJ6 A;  1BIA A;  4PG3 A;  1HXD A;  3A32 A;  1RIQ A;  2E41 A;  1EFW A;  1H4S A;  2EJG A;  4WF2 A;  3V8J A;  2G4C A;  2I4M A;  3P8V A;  3PCO B;  2DTI A;  2P5I A;  3QTC A;  4YRO A;  3MF1 A;  4HWR A;  2ZGW A;  4P72 A;  4RDX A;  3R07 A;  3V7R A;  2DU5 A;  2RHS A;  1X2H A;  1WQW A;  2HNI A;  3UGQ A;  3TEH A;  1SRY A;  2ODR D;  4HA8 A;  4J15 A;  4P72 C;  4H2V A;  4LVJ A;  2ZIM A;  4RQE A;  3HXX A;  2QHU A;  1LYL A;  3HRK A;  2EJ9 A;  3RKX A;  4UP7 A;  3NEM A;  1B7Y A;  4YRP A;  3M4P A;  2DZC A;  2DVE A;  12AS A;  2XGT A;  4XU1 A;  1YFT A;  2IY5 B;  1NJ2 A;  4P75 A;  2DXT A;  1IL2 A;  4CH5 A;  1B76 A;  1X01 A;  2ZT5 A;  3V7C A;  3TEG A;  2DEQ A;  1WLE A;  4HVC A;  2ODR C;  3G1Z A;  2QHS A;  4TVA B;  1WNL A;  3VQW A;  3MQZ A;  4AH6 A;  5C52 B;  2ZT6 A;  3MF2 A;  4UPA A;  3FJP A;  3QO5 A;  3OD1 A;  3RAC A;  4LVI A;  1L0W A;  4X5O A;  2ZCE A;  4P71 C;  1X54 A;  3L4G A;  4HWT A;  4P3P A;  2ZZF A;  4YYE A;  3QO8 A;  4YRN A;  1EQR A;  4H2W A;  2I4N A;  2ZNI A;  5K1X A;  3IKM B;  3IAL A;  3HFV A;  3REX A;  2Q7G A;  3RKW A;  1NJ1 A;  1YFR A;  1HTT A;  3ICA A;  2QHV A;  3A31 A;  2DJZ A;  3PZC A;  2PMF A;  5E3I A;  2ARU A; 
#chains in the Genus database with same CATH homology
 1BBW A;  2P0L A;  1NYQ A;  4CS4 A;  2DXU A;  2E65 A;  3V8K A;  2ZXF A;  4DQ2 A;  2DQ0 A;  1VQZ A;  4RQF A;  4YRQ A;  2CJ9 A;  4YP0 A;  2DDZ A;  3BFM A;  4BWA A;  2RHQ A;  2Q7E A;  1G51 A;  3V8L A;  4YCW A;  4P3N A;  3VQX A;  1ASY A;  3NEL A;  4G84 A;  4YRK A;  4H2X A;  3NET A;  4L87 A;  3RUX A;  4BW9 A;  4TWA A;  1E1T A;  1H4Q A;  3CMQ A;  3L2Z A;  3BJU A;  1B70 B;  3QNE A;  2ALY A;  5C53 B;  2ZT8 A;  3E9H A;  2DTH A;  2ZNJ A;  4HWO A;  11AS A;  5HGQ A;  1ADJ A;  1JJC A;  5C51 B;  4LVK A;  1YB3 A;  3HXV A;  4ZTU B;  3L1A A;  4XU3 A;  2DZ9 A;  1H4V B;  1PYS B;  2E5A A;  4YRJ A;  4EO4 A;  4LVL A;  2DTO A;  3HFZ A;  3REU A;  3A7R A;  3P8Y A;  4XEO A;  3A7U A;  4XU0 A;  4PHC A;  1X56 A;  4P73 C;  2AMC A;  2RHQ B;  2Q7H A;  4P71 A;  4O2D A;  4TQF A;  3HXW A;  1H4T A;  4K86 A;  1KMN A;  4H2U A;  3UGT A;  3RGL A;  4XTU A;  4YRR A;  4XTX A;  2AKW A;  1USY A;  1WU7 A;  3HXZ A;  2E10 A;  3DSQ A;  4YCU A;  4CS2 A;  3RF1 A;  4KQE A;  4Q6G A;  4ZTZ B;  4P74 C;  2ZT7 A;  4YRI A;  2NS6 A;  2E1H A;  4XU2 A;  3HTZ A;  3A7A A;  3LSQ A;  2RHS B;  1KOG A;  2ALY B;  3TEH B;  1SER A;  1USY C;  1ADY A;  1E24 A;  2ZIO A;  3PCO A;  1W66 A;  2CIM A;  2Q5H A;  3LC0 A;  2XTI A;  1Z7N A;  3RL6 A;  4CS3 A;  1B8A A;  1WYD A;  3HRI A;  1G5I A;  4P3O A;  4WJ4 A;  1B7Y B;  1ASZ A;  3E9I A;  4WI1 A;  3LSS A;  4K87 A;  2I4O A;  4YCV A;  2FYK A;  3M4Q A;  2DKG A;  4YRL A;  1GGM A;  3KFU A;  4E51 A;  4YRM A;  1X2G A;  1WPY A;  4XTY A;  1BBU A;  1NJ8 A;  2DQ3 A;  1EVL A;  1BIB A;  1NYR A;  3VBB A;  4CH3 A;  3HY0 A;  1YGB A;  1NJ5 A;  4EX5 A;  2ZR3 A;  3IG2 A;  3RKY A;  4TTV A;  3L4G B;  4HT4 A;  4LNS A;  1J5W A;  4KR2 A;  4G85 A;  5K1P A;  1G5H A;  4YRG A;  4TVA A;  2DU7 A;  2ARS A;  3ERR A;  4XTZ A;  2EAY A;  1NNH A;  4CH6 A;  4DPG A;  2E64 A;  4KR3 A;  2E3C A;  2EWN A;  4ZIB A;  1SET A;  4H2S A;  4P73 A;  3NEN A;  3TUP A;  4NCX A;  1QF6 A;  1EVK A;  2J3L A;  5ELN A;  2CJA A;  3HY1 A;  1E22 A;  1X55 A;  1YFS A;  5F5W A;  4YPF A;  3A5Z A;  4P74 A;  3MEY A;  4H2Y A;  3IKL A;  1SES A;  4HWS A;  1FYF A;  1EIY A;  1HC7 A;  3P8T A;  1ATI A;  2PME A;  4UP9 A;  1EOV A;  3A5Y A;  4YRE A;  3V7S A;  4TVY A;  4H2X B;  4CH4 A;  4XTV A;  2ZR2 A;  3QO7 A;  2ZIN A;  2I4L A;  3EFS A;  4YDQ A;  1N9W A;  3RIR A;  2ART A;  2C7I A;  4TQD A;  4TVW A;  3VQY A;  1C0A A;  1KMM A;  3HXU A;  1JJC B;  4P75 C;  2ZTG A;  4UP8 A;  4WJ3 M;  4HWP A;  3W3S A;  2EJF A;  2CJB A;  2Q5I A;  4XTW A;  1WQ7 A;  2QHT A;  3VQV A;  2ZZG A;  4YRF A;  3HFZ B;  5ELO A;  3A74 A;  3UH0 A;  2ZZE A;  3WQZ A;  4RMF A;  4YRC A;  1B70 A;  1Z7M A;  4H2T A;  3I7F A;  4XEM A;  2CGH A;  2AMC B;  4LVM A;  3UFG A;  3HXY A;  3EFR A;  4H02 A;  2EL9 A;  1E1O A;  1EIY B;  4YRS A;  4YRT A;  2A8E A;  4OLF A;  1PYS A;  4Q15 A;  2C8M A;  2AKW B;  4K88 A;  2J3M A;  4OP0 A;  5KNN A;  1QE0 A;  2IY5 A;  1NJ6 A;  1BIA A;  4PG3 A;  1HXD A;  3A32 A;  1RIQ A;  2E41 A;  1EFW A;  1H4S A;  2EJG A;  4WF2 A;  3V8J A;  2G4C A;  2I4M A;  3P8V A;  3PCO B;  2DTI A;  2P5I A;  3QTC A;  4YRO A;  3MF1 A;  4HWR A;  2ZGW A;  4P72 A;  4RDX A;  3R07 A;  3V7R A;  2DU5 A;  2RHS A;  1X2H A;  1WQW A;  2HNI A;  3UGQ A;  3TEH A;  1SRY A;  2ODR D;  4HA8 A;  4J15 A;  4P72 C;  4H2V A;  4LVJ A;  2ZIM A;  4RQE A;  3HXX A;  2QHU A;  1LYL A;  3HRK A;  2EJ9 A;  3RKX A;  4UP7 A;  3NEM A;  1B7Y A;  4YRP A;  3M4P A;  2DZC A;  2DVE A;  12AS A;  2XGT A;  4XU1 A;  1YFT A;  2IY5 B;  1NJ2 A;  4P75 A;  2DXT A;  1IL2 A;  4CH5 A;  1B76 A;  1X01 A;  2ZT5 A;  3V7C A;  3TEG A;  2DEQ A;  1WLE A;  4HVC A;  2ODR C;  3G1Z A;  2QHS A;  4TVA B;  1WNL A;  3VQW A;  3MQZ A;  4AH6 A;  5C52 B;  2ZT6 A;  3MF2 A;  4UPA A;  3FJP A;  3QO5 A;  3OD1 A;  3RAC A;  4LVI A;  1L0W A;  4X5O A;  2ZCE A;  4P71 C;  1X54 A;  3L4G A;  4HWT A;  4P3P A;  2ZZF A;  4YYE A;  3QO8 A;  4YRN A;  1EQR A;  4H2W A;  2I4N A;  2ZNI A;  5K1X A;  3IKM B;  3IAL A;  3HFV A;  3REX A;  2Q7G A;  3RKW A;  1NJ1 A;  1YFR A;  1HTT A;  3ICA A;  2QHV A;  3A31 A;  2DJZ A;  3PZC A;  2PMF A;  5E3I A;  2ARU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...