2P5IA

Crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
262
Chain Sequence
PWRFLDHTSFGPTFQALQSFAYDDTLCTSIGKSQSPPTLRAWVHHNTVVLGIQDSRLPQIKAGIEALKGFQHDVIVRNSGGLAVVLDSGILNLSLVLKEEKGFSIDDGYELMYELICSMFQEQIEAREIVGSYCPGSYDLSIDGKKFAGISQRRIRGGVAVQIYLCVSGSGAERAKMIRTFYDKAVAGQPTKFVYPRIKPETMASLSELLGQPHNVSDVLLKALMTLQQHGASLLTESLSADEWLLYEQHFARISERNEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3822 protein
publication title Crystal structure of a hypothetical protein from Bacillus halodurans: Pfam-PF03099
rcsb
source organism Bacillus halodurans c-125
molecule tags Structural genomics, unknown function
total genus 82
structure length 262
sequence length 265
ec nomenclature ec 2.3.1.204: Octanoyl-[GcvH]:protein N-octanoyltransferase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2p5iA00
3V8KA 4KR3A 1KMMA 2ZTGA 4BW9A 1KOGA 2ZT6A 1B7YB 2ALYA 3UFGA 2Q7HA 4AH6A 1E22A 2ZGWA 2G4CA 4G85A 4CH3A 1B70A 2DQ3A 3A74A 2EWNA 3REXA 1E1TA 1YGBA 4YPFA 4UP9A 2RHQA 4H2YA 4NCXA 4XU0A 3LSSA 2ZT8A 3HXYA 3VQYA 1G5IA 1EIYA 1X54A 3ERRA 4LNSA 3TEHB 3EFSA 5F5WA 3BFMA 3IALA 3V7CA 4G84A 4YP0A 4RQEA 1ADYA 4UP8A 4XU1A 1NJ2A 4TWAA 4XTZA 2EJ9A 1HTTA 4TVAB 2ODRC 4ZIBA 1ASZA 1ATIA 3RKYA 2ZR3A 1BBWA 3OD1A 4ZTZB 2AMCB 2DZ9A 4YRJA 3A7UA 3RKWA 3HRIA 3UGQA 2DJZA 4YRKA 2ZINA 4YRCA 3HFZB 3P8VA 4P72A 3V8JA 2DVEA 4YYEA 2DTIA 4DPGA 2DXUA 3NEMA 2DTHA 1WNLA 4H2WA 3IKMB 4J15A 2ARTA 3HXZA 3RF1A 4WI1A 1KMNA 2C8MA 4RQFA 1GGMA 3L4GA 4H2TA 3RGLA 3TEHA 1NJ1A 1SRYA 1X2GA 2E5AA 3M4PA 1X01A 3EFRA 2ZCEA 4WJ4A 4YCUA 3HXUA 4KQEA 3MF1A 4P75A 4YRGA 1PYSB 2EL9A 1L0WA 4BWAA 4H2SA 3VQVA 1H4VB 2ZNJA 1C0AA 4PHCA 3A5YA 3I7FA 3MEYA 1W66A 3A32A 3HXVA 3UGTA 2AMCA 2ZIOA 1IL2A 2ZNIA 3LSQA 4KR2A 1YFTA 3HY0A 4XTYA 3HFZA 2AKWB 3NETA 2HNIA 1LYLA 1YB3A 1BIBA 2CGHA 4ZTUB 3HY1A 5K1XA 1FYFA 1NJ6A 2QHTA 1USYA 3L2ZA 3QO7A 4X5OA 3HTZA 4CS2A 1E24A 2I4LA 4YRFA 4HA8A 4K88A 4TQFA 1NYRA 4O2DA 4H2VA 2CJAA 3TUPA 4K86A 4XTXA 1WU7A 1Z7NA 3RUXA 3UH0A 4EO4A 2DKGA 3CMQA 3E9IA 2P5IA 2ARUA 1H4TA 2ZIMA 4P73A 1WQ7A 4YRTA 4TVWA 2IY5B 4EX5A 3A5ZA 2ZT5A 1B7YA 3NELA 2I4MA 2RHSB 3E9HA 4YRLA 4TVYA 3R07A 3HXXA 2QHVA 3VQWA 3ICAA 1E1OA 1X56A 1BBUA 4UPAA 4YRRA 3QTCA 4HWPA 2EJFA 2XGTA 2E3CA 2Q7GA 2ALYB 3VBBA 4XTUA 2I4NA 2DDZA 3TEGA 4TTVA 1B70B 4TVAA 1H4QA 5K1PA 5ELNA 1NNHA 2ZXFA 3M4QA 3WQZA 1QF6A 1EIYB 2FYKA 4YRQA 2IY5A 4XEMA 2ZT7A 2ZZGA 4P73C 1B8AA 2DZCA 2E64A 2I4OA 3P8YA 5C51B 2ODRD 4YRNA 3P8TA 3FJPA 3BJUA 1HXDA 3QO8A 5HGQA 5C52B 3QNEA 1EFWA 5KNNA 3G1ZA 4RDXA 1ASYA 1QE0A 1NJ8A 4PG3A 4HVCA 4P72C 4E51A 1BIAA 3A7AA 2QHSA 4P3NA 1WLEA 1JJCB 4YRIA 4YRSA 2ZZEA 3QO5A 3PCOB 2XTIA 1EVKA 4OP0A 3A31A 3RKXA 3IG2A 2Q7EA 4CH5A 2P0LA 1PYSA 4H2XB 1EOVA 1YFSA 2E1HA 2EAYA 1NJ5A 3W3SA 3LC0A 1WPYA 1B76A 4TQDA 4H02A 4P75C 5ELOA 3L4GB 4XU3A 4CS3A 12ASA 4HWRA 1HC7A 4OLFA 4P74A 4HWOA 2J3LA 2ZZFA 4P71A 4XEOA 3MF2A 4UP7A 4YROA 2AKWA 4HWSA 1WQWA 2DXTA 2DTOA 4YREA 2E41A 3V7SA 3L1AA 5C53B 3VQXA 4WJ3M 4YDQA 4L87A 4RMFA 3A7RA 4YRPA 1JJCA 4YCVA 1X55A 3PCOA 1USYC 4CH4A 1ADJA 2J3MA 4HWTA 3RL6A 4CS4A 4YCWA 1G5HA 2DQ0A 1Z7MA 1SESA 2DEQA 1SETA 4YRMA 5E3IA 1J5WA 3HXWA 1H4SA 4XTWA 4H2UA 4H2XA 3HRKA 1G51A 2E10A 1WYDA 2ZR2A 3V8LA 3REUA 3DSQA 1VQZA 2RHQB 2CJBA 1EVLA 3HFVA 4Q6GA 4XTVA 3RACA 3RIRA 4P3PA 4Q15A 1X2HA 2PMEA 2ARSA 1N9WA 2C7IA 2PMFA 3NENA 2DU5A 1NYQA 11ASA 3KFUA 2CJ9A 2Q5HA 1RIQA 4CH6A 4P74C 4XU2A 2E65A 2Q5IA 2DU7A 2QHUA 4P71C 2RHSA 4WF2A 4DQ2A 4P3OA 3V7RA 4K87A 3IKLA 1EQRA 2CIMA 1YFRA 1SERA 3PZCA 2EJGA
chains in the Genus database with same CATH superfamily
3V8KA 4KR3A 1KMMA 2ZTGA 4BW9A 1KOGA 2ZT6A 1B7YB 2ALYA 3UFGA 2Q7HA 4AH6A 1E22A 2ZGWA 2G4CA 4G85A 4CH3A 1B70A 2DQ3A 3A74A 2EWNA 3REXA 1E1TA 4LVJA 4HT4A 1YGBA 4YPFA 4LVKA 4UP9A 2RHQA 4H2YA 4NCXA 4XU0A 3LSSA 2ZT8A 3HXYA 3VQYA 1G5IA 1EIYA 1X54A 3ERRA 4LNSA 3TEHB 3EFSA 5F5WA 3BFMA 3IALA 3V7CA 4G84A 4YP0A 4RQEA 1ADYA 4UP8A 4XU1A 1NJ2A 4TWAA 4XTZA 2EJ9A 1HTTA 4TVAB 2ODRC 4ZIBA 1ASZA 1ATIA 3RKYA 2ZR3A 1BBWA 3OD1A 4ZTZB 2AMCB 2DZ9A 4YRJA 3A7UA 3RKWA 3HRIA 3UGQA 2DJZA 4YRKA 2ZINA 4YRCA 3HFZB 3P8VA 4P72A 3V8JA 2DVEA 4YYEA 2DTIA 4DPGA 2DXUA 3NEMA 2DTHA 1WNLA 4H2WA 3IKMB 4J15A 2ARTA 3HXZA 3RF1A 4WI1A 1KMNA 2C8MA 4RQFA 1GGMA 3L4GA 4H2TA 3RGLA 3TEHA 1NJ1A 1SRYA 1X2GA 2E5AA 3M4PA 1X01A 3EFRA 2ZCEA 4WJ4A 4YCUA 3HXUA 4KQEA 3MF1A 2NS6A 4P75A 4YRGA 1PYSB 2EL9A 1L0WA 4BWAA 4H2SA 3VQVA 1H4VB 2ZNJA 1C0AA 4PHCA 3A5YA 3I7FA 3MEYA 1W66A 3A32A 3HXVA 3UGTA 2AMCA 2ZIOA 1IL2A 2ZNIA 3LSQA 4KR2A 1YFTA 3HY0A 4LVIA 4XTYA 3HFZA 2AKWB 3NETA 2HNIA 1LYLA 1YB3A 1BIBA 2CGHA 4ZTUB 3HY1A 5K1XA 1FYFA 1NJ6A 2QHTA 1USYA 3L2ZA 3QO7A 4X5OA 3HTZA 4CS2A 1E24A 2I4LA 4YRFA 4HA8A 4K88A 4TQFA 1NYRA 4O2DA 4H2VA 2CJAA 3TUPA 4K86A 4XTXA 1WU7A 1Z7NA 3RUXA 3UH0A 4EO4A 2DKGA 3CMQA 3E9IA 2P5IA 2ARUA 1H4TA 2ZIMA 4P73A 1WQ7A 4YRTA 4TVWA 2IY5B 4EX5A 3A5ZA 2ZT5A 1B7YA 3NELA 2I4MA 2RHSB 3E9HA 4YRLA 4TVYA 3R07A 3HXXA 2QHVA 3VQWA 3ICAA 1E1OA 1X56A 4LVMA 1BBUA 4UPAA 4YRRA 3QTCA 4HWPA 2EJFA 2XGTA 2E3CA 2Q7GA 2ALYB 3VBBA 4XTUA 2I4NA 2DDZA 3TEGA 4TTVA 1B70B 4TVAA 1H4QA 5K1PA 5ELNA 1NNHA 2ZXFA 3M4QA 3WQZA 1QF6A 1EIYB 2FYKA 4YRQA 2IY5A 4XEMA 2ZT7A 2ZZGA 4P73C 1B8AA 2DZCA 2E64A 2I4OA 3P8YA 5C51B 2ODRD 4YRNA 3P8TA 3FJPA 3BJUA 1HXDA 3QO8A 5HGQA 5C52B 3QNEA 1EFWA 5KNNA 3G1ZA 4RDXA 1ASYA 1QE0A 1NJ8A 4PG3A 4HVCA 4P72C 4E51A 1BIAA 3A7AA 2QHSA 4P3NA 1WLEA 1JJCB 4YRIA 4YRSA 2ZZEA 3QO5A 3PCOB 2XTIA 1EVKA 4OP0A 3A31A 3RKXA 3IG2A 2Q7EA 4CH5A 2P0LA 1PYSA 4H2XB 1EOVA 1YFSA 2E1HA 2EAYA 1NJ5A 3W3SA 3LC0A 1WPYA 1B76A 4TQDA 4H02A 4P75C 5ELOA 3L4GB 4XU3A 4CS3A 12ASA 4HWRA 1HC7A 4OLFA 4P74A 4HWOA 2J3LA 2ZZFA 4P71A 4XEOA 3MF2A 4UP7A 4YROA 2AKWA 4HWSA 1WQWA 2DXTA 2DTOA 4YREA 2E41A 3V7SA 3L1AA 5C53B 3VQXA 4WJ3M 4YDQA 4L87A 4RMFA 3A7RA 4YRPA 1JJCA 4YCVA 1X55A 3PCOA 1USYC 4CH4A 1ADJA 2J3MA 4HWTA 3RL6A 4CS4A 4YCWA 1G5HA 2DQ0A 1Z7MA 1SESA 2DEQA 1SETA 4YRMA 5E3IA 1J5WA 3HXWA 1H4SA 4XTWA 4H2UA 4H2XA 3HRKA 1G51A 2E10A 1WYDA 2ZR2A 3V8LA 3REUA 3DSQA 1VQZA 2RHQB 2CJBA 1EVLA 3HFVA 4Q6GA 4XTVA 3RACA 3RIRA 4P3PA 4Q15A 1X2HA 2PMEA 2ARSA 1N9WA 4LVLA 2C7IA 2PMFA 3NENA 2DU5A 1NYQA 11ASA 3KFUA 2CJ9A 2Q5HA 1RIQA 4CH6A 4P74C 4XU2A 2E65A 2Q5IA 2DU7A 3MQZA 2QHUA 4P71C 2RHSA 4WF2A 4DQ2A 4P3OA 3V7RA 4K87A 3IKLA 1EQRA 2A8EA 2CIMA 1YFRA 1SERA 3PZCA 2EJGA
chains in the Genus database with same CATH topology
3V8KA 4KR3A 1KMMA 2ZTGA 4BW9A 1KOGA 2ZT6A 1B7YB 2ALYA 3UFGA 2Q7HA 4AH6A 1E22A 2ZGWA 2G4CA 4G85A 4CH3A 1B70A 2DQ3A 3A74A 2EWNA 3REXA 1E1TA 4LVJA 4HT4A 1YGBA 4YPFA 4LVKA 4UP9A 2RHQA 4H2YA 4NCXA 4XU0A 3LSSA 2ZT8A 3HXYA 3VQYA 1G5IA 1EIYA 1X54A 3ERRA 4LNSA 3TEHB 3EFSA 5F5WA 3BFMA 3IALA 3V7CA 4G84A 4YP0A 4RQEA 1ADYA 4UP8A 4XU1A 1NJ2A 4TWAA 4XTZA 2EJ9A 1HTTA 4TVAB 2ODRC 4ZIBA 1ASZA 1ATIA 3RKYA 2ZR3A 1BBWA 3OD1A 4ZTZB 2AMCB 2DZ9A 4YRJA 3A7UA 3RKWA 3HRIA 3UGQA 2DJZA 4YRKA 2ZINA 4YRCA 3HFZB 3P8VA 4P72A 3V8JA 2DVEA 4YYEA 2DTIA 4DPGA 2DXUA 3NEMA 2DTHA 1WNLA 4H2WA 3IKMB 4J15A 2ARTA 3HXZA 3RF1A 4WI1A 1KMNA 2C8MA 4RQFA 1GGMA 3L4GA 4H2TA 3RGLA 3TEHA 1NJ1A 1SRYA 1X2GA 2E5AA 3M4PA 1X01A 3EFRA 2ZCEA 4WJ4A 4YCUA 3HXUA 4KQEA 3MF1A 2NS6A 4P75A 4YRGA 1PYSB 2EL9A 1L0WA 4BWAA 4H2SA 3VQVA 1H4VB 2ZNJA 1C0AA 4PHCA 3A5YA 3I7FA 3MEYA 1W66A 3A32A 3HXVA 3UGTA 2AMCA 2ZIOA 1IL2A 2ZNIA 3LSQA 4KR2A 1YFTA 3HY0A 4LVIA 4XTYA 3HFZA 2AKWB 3NETA 2HNIA 1LYLA 1YB3A 1BIBA 2CGHA 4ZTUB 3HY1A 5K1XA 1FYFA 1NJ6A 2QHTA 1USYA 3L2ZA 3QO7A 4X5OA 3HTZA 4CS2A 1E24A 2I4LA 4YRFA 4HA8A 4K88A 4TQFA 1NYRA 4O2DA 4H2VA 2CJAA 3TUPA 4K86A 4XTXA 1WU7A 1Z7NA 3RUXA 3UH0A 4EO4A 2DKGA 3CMQA 3E9IA 2P5IA 2ARUA 1H4TA 2ZIMA 4P73A 1WQ7A 4YRTA 4TVWA 2IY5B 4EX5A 3A5ZA 2ZT5A 1B7YA 3NELA 2I4MA 2RHSB 3E9HA 4YRLA 4TVYA 3R07A 3HXXA 2QHVA 3VQWA 3ICAA 1E1OA 1X56A 4LVMA 1BBUA 4UPAA 4YRRA 3QTCA 4HWPA 2EJFA 2XGTA 2E3CA 2Q7GA 2ALYB 3VBBA 4XTUA 2I4NA 2DDZA 3TEGA 4TTVA 1B70B 4TVAA 1H4QA 5K1PA 5ELNA 1NNHA 2ZXFA 3M4QA 3WQZA 1QF6A 1EIYB 2FYKA 4YRQA 2IY5A 4XEMA 2ZT7A 2ZZGA 4P73C 1B8AA 2DZCA 2E64A 2I4OA 3P8YA 5C51B 2ODRD 4YRNA 3P8TA 3FJPA 3BJUA 1HXDA 3QO8A 5HGQA 5C52B 3QNEA 1EFWA 5KNNA 3G1ZA 4RDXA 1ASYA 1QE0A 1NJ8A 4PG3A 4HVCA 4P72C 4E51A 1BIAA 3A7AA 2QHSA 4P3NA 1WLEA 1JJCB 4YRIA 4YRSA 2ZZEA 3QO5A 3PCOB 2XTIA 1EVKA 4OP0A 3A31A 3RKXA 3IG2A 2Q7EA 4CH5A 2P0LA 1PYSA 4H2XB 1EOVA 1YFSA 2E1HA 2EAYA 1NJ5A 3W3SA 3LC0A 1WPYA 1B76A 4TQDA 4H02A 4P75C 5ELOA 3L4GB 4XU3A 4CS3A 12ASA 4HWRA 1HC7A 4OLFA 4P74A 4HWOA 2J3LA 2ZZFA 4P71A 4XEOA 3MF2A 4UP7A 4YROA 2AKWA 4HWSA 1WQWA 2DXTA 2DTOA 4YREA 2E41A 3V7SA 3L1AA 5C53B 3VQXA 4WJ3M 4YDQA 4L87A 4RMFA 3A7RA 4YRPA 1JJCA 4YCVA 1X55A 3PCOA 1USYC 4CH4A 1ADJA 2J3MA 4HWTA 3RL6A 4CS4A 4YCWA 1G5HA 2DQ0A 1Z7MA 1SESA 2DEQA 1SETA 4YRMA 5E3IA 1J5WA 3HXWA 1H4SA 4XTWA 4H2UA 4H2XA 3HRKA 1G51A 2E10A 1WYDA 2ZR2A 3V8LA 3REUA 3DSQA 1VQZA 2RHQB 2CJBA 1EVLA 3HFVA 4Q6GA 4XTVA 3RACA 3RIRA 4P3PA 4Q15A 1X2HA 2PMEA 2ARSA 1N9WA 4LVLA 2C7IA 2PMFA 3NENA 2DU5A 1NYQA 11ASA 3KFUA 2CJ9A 2Q5HA 1RIQA 4CH6A 4P74C 4XU2A 2E65A 2Q5IA 2DU7A 3MQZA 2QHUA 4P71C 2RHSA 4WF2A 4DQ2A 4P3OA 3V7RA 4K87A 3IKLA 1EQRA 2A8EA 2CIMA 1YFRA 1SERA 3PZCA 2EJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8K A;  4KR3 A;  1KMM A;  2ZTG A;  4BW9 A;  1KOG A;  2ZT6 A;  1B7Y B;  2ALY A;  3UFG A;  2Q7H A;  4AH6 A;  1E22 A;  2ZGW A;  2G4C A;  4G85 A;  4CH3 A;  1B70 A;  2DQ3 A;  3A74 A;  2EWN A;  3REX A;  1E1T A;  1YGB A;  4YPF A;  4UP9 A;  2RHQ A;  4H2Y A;  4NCX A;  4XU0 A;  3LSS A;  2ZT8 A;  3HXY A;  3VQY A;  1G5I A;  1EIY A;  1X54 A;  3ERR A;  4LNS A;  3TEH B;  3EFS A;  5F5W A;  3BFM A;  3IAL A;  3V7C A;  4G84 A;  4YP0 A;  4RQE A;  1ADY A;  4UP8 A;  4XU1 A;  1NJ2 A;  4TWA A;  4XTZ A;  2EJ9 A;  1HTT A;  4TVA B;  2ODR C;  4ZIB A;  1ASZ A;  1ATI A;  3RKY A;  2ZR3 A;  1BBW A;  3OD1 A;  4ZTZ B;  2AMC B;  2DZ9 A;  4YRJ A;  3A7U A;  3RKW A;  3HRI A;  3UGQ A;  2DJZ A;  4YRK A;  2ZIN A;  4YRC A;  3HFZ B;  3P8V A;  4P72 A;  3V8J A;  2DVE A;  4YYE A;  2DTI A;  4DPG A;  2DXU A;  3NEM A;  2DTH A;  1WNL A;  4H2W A;  3IKM B;  4J15 A;  2ART A;  3HXZ A;  3RF1 A;  4WI1 A;  1KMN A;  2C8M A;  4RQF A;  1GGM A;  3L4G A;  4H2T A;  3RGL A;  3TEH A;  1NJ1 A;  1SRY A;  1X2G A;  2E5A A;  3M4P A;  1X01 A;  3EFR A;  2ZCE A;  4WJ4 A;  4YCU A;  3HXU A;  4KQE A;  3MF1 A;  4P75 A;  4YRG A;  1PYS B;  2EL9 A;  1L0W A;  4BWA A;  4H2S A;  3VQV A;  1H4V B;  2ZNJ A;  1C0A A;  4PHC A;  3A5Y A;  3I7F A;  3MEY A;  1W66 A;  3A32 A;  3HXV A;  3UGT A;  2AMC A;  2ZIO A;  1IL2 A;  2ZNI A;  3LSQ A;  4KR2 A;  1YFT A;  3HY0 A;  4XTY A;  3HFZ A;  2AKW B;  3NET A;  2HNI A;  1LYL A;  1YB3 A;  1BIB A;  2CGH A;  4ZTU B;  3HY1 A;  5K1X A;  1FYF A;  1NJ6 A;  2QHT A;  1USY A;  3L2Z A;  3QO7 A;  4X5O A;  3HTZ A;  4CS2 A;  1E24 A;  2I4L A;  4YRF A;  4HA8 A;  4K88 A;  4TQF A;  1NYR A;  4O2D A;  4H2V A;  2CJA A;  3TUP A;  4K86 A;  4XTX A;  1WU7 A;  1Z7N A;  3RUX A;  3UH0 A;  4EO4 A;  2DKG A;  3CMQ A;  3E9I A;  2P5I A;  2ARU A;  1H4T A;  2ZIM A;  4P73 A;  1WQ7 A;  4YRT A;  4TVW A;  2IY5 B;  4EX5 A;  3A5Z A;  2ZT5 A;  1B7Y A;  3NEL A;  2I4M A;  2RHS B;  3E9H A;  4YRL A;  4TVY A;  3R07 A;  3HXX A;  2QHV A;  3VQW A;  3ICA A;  1E1O A;  1X56 A;  1BBU A;  4UPA A;  4YRR A;  3QTC A;  4HWP A;  2EJF A;  2XGT A;  2E3C A;  2Q7G A;  2ALY B;  3VBB A;  4XTU A;  2I4N A;  2DDZ A;  3TEG A;  4TTV A;  1B70 B;  4TVA A;  1H4Q A;  5K1P A;  5ELN A;  1NNH A;  2ZXF A;  3M4Q A;  3WQZ A;  1QF6 A;  1EIY B;  2FYK A;  4YRQ A;  2IY5 A;  4XEM A;  2ZT7 A;  2ZZG A;  4P73 C;  1B8A A;  2DZC A;  2E64 A;  2I4O A;  3P8Y A;  5C51 B;  2ODR D;  4YRN A;  3P8T A;  3FJP A;  3BJU A;  1HXD A;  3QO8 A;  5HGQ A;  5C52 B;  3QNE A;  1EFW A;  5KNN A;  3G1Z A;  4RDX A;  1ASY A;  1QE0 A;  1NJ8 A;  4PG3 A;  4HVC A;  4P72 C;  4E51 A;  1BIA A;  3A7A A;  2QHS A;  4P3N A;  1WLE A;  1JJC B;  4YRI A;  4YRS A;  2ZZE A;  3QO5 A;  3PCO B;  2XTI A;  1EVK A;  4OP0 A;  3A31 A;  3RKX A;  3IG2 A;  2Q7E A;  4CH5 A;  2P0L A;  1PYS A;  4H2X B;  1EOV A;  1YFS A;  2E1H A;  2EAY A;  1NJ5 A;  3W3S A;  3LC0 A;  1WPY A;  1B76 A;  4TQD A;  4H02 A;  4P75 C;  5ELO A;  3L4G B;  4XU3 A;  4CS3 A;  12AS A;  4HWR A;  1HC7 A;  4OLF A;  4P74 A;  4HWO A;  2J3L A;  2ZZF A;  4P71 A;  4XEO A;  3MF2 A;  4UP7 A;  4YRO A;  2AKW A;  4HWS A;  1WQW A;  2DXT A;  2DTO A;  4YRE A;  2E41 A;  3V7S A;  3L1A A;  5C53 B;  3VQX A;  4WJ3 M;  4YDQ A;  4L87 A;  4RMF A;  3A7R A;  4YRP A;  1JJC A;  4YCV A;  1X55 A;  3PCO A;  1USY C;  4CH4 A;  1ADJ A;  2J3M A;  4HWT A;  3RL6 A;  4CS4 A;  4YCW A;  1G5H A;  2DQ0 A;  1Z7M A;  1SES A;  2DEQ A;  1SET A;  4YRM A;  5E3I A;  1J5W A;  3HXW A;  1H4S A;  4XTW A;  4H2U A;  4H2X A;  3HRK A;  1G51 A;  2E10 A;  1WYD A;  2ZR2 A;  3V8L A;  3REU A;  3DSQ A;  1VQZ A;  2RHQ B;  2CJB A;  1EVL A;  3HFV A;  4Q6G A;  4XTV A;  3RAC A;  3RIR A;  4P3P A;  4Q15 A;  1X2H A;  2PME A;  2ARS A;  1N9W A;  2C7I A;  2PMF A;  3NEN A;  2DU5 A;  1NYQ A;  11AS A;  3KFU A;  2CJ9 A;  2Q5H A;  1RIQ A;  4CH6 A;  4P74 C;  4XU2 A;  2E65 A;  2Q5I A;  2DU7 A;  2QHU A;  4P71 C;  2RHS A;  4WF2 A;  4DQ2 A;  4P3O A;  3V7R A;  4K87 A;  3IKL A;  1EQR A;  2CIM A;  1YFR A;  1SER A;  3PZC A;  2EJG A; 
#chains in the Genus database with same CATH topology
 3V8K A;  4KR3 A;  1KMM A;  2ZTG A;  4BW9 A;  1KOG A;  2ZT6 A;  1B7Y B;  2ALY A;  3UFG A;  2Q7H A;  4AH6 A;  1E22 A;  2ZGW A;  2G4C A;  4G85 A;  4CH3 A;  1B70 A;  2DQ3 A;  3A74 A;  2EWN A;  3REX A;  1E1T A;  4LVJ A;  4HT4 A;  1YGB A;  4YPF A;  4LVK A;  4UP9 A;  2RHQ A;  4H2Y A;  4NCX A;  4XU0 A;  3LSS A;  2ZT8 A;  3HXY A;  3VQY A;  1G5I A;  1EIY A;  1X54 A;  3ERR A;  4LNS A;  3TEH B;  3EFS A;  5F5W A;  3BFM A;  3IAL A;  3V7C A;  4G84 A;  4YP0 A;  4RQE A;  1ADY A;  4UP8 A;  4XU1 A;  1NJ2 A;  4TWA A;  4XTZ A;  2EJ9 A;  1HTT A;  4TVA B;  2ODR C;  4ZIB A;  1ASZ A;  1ATI A;  3RKY A;  2ZR3 A;  1BBW A;  3OD1 A;  4ZTZ B;  2AMC B;  2DZ9 A;  4YRJ A;  3A7U A;  3RKW A;  3HRI A;  3UGQ A;  2DJZ A;  4YRK A;  2ZIN A;  4YRC A;  3HFZ B;  3P8V A;  4P72 A;  3V8J A;  2DVE A;  4YYE A;  2DTI A;  4DPG A;  2DXU A;  3NEM A;  2DTH A;  1WNL A;  4H2W A;  3IKM B;  4J15 A;  2ART A;  3HXZ A;  3RF1 A;  4WI1 A;  1KMN A;  2C8M A;  4RQF A;  1GGM A;  3L4G A;  4H2T A;  3RGL A;  3TEH A;  1NJ1 A;  1SRY A;  1X2G A;  2E5A A;  3M4P A;  1X01 A;  3EFR A;  2ZCE A;  4WJ4 A;  4YCU A;  3HXU A;  4KQE A;  3MF1 A;  2NS6 A;  4P75 A;  4YRG A;  1PYS B;  2EL9 A;  1L0W A;  4BWA A;  4H2S A;  3VQV A;  1H4V B;  2ZNJ A;  1C0A A;  4PHC A;  3A5Y A;  3I7F A;  3MEY A;  1W66 A;  3A32 A;  3HXV A;  3UGT A;  2AMC A;  2ZIO A;  1IL2 A;  2ZNI A;  3LSQ A;  4KR2 A;  1YFT A;  3HY0 A;  4LVI A;  4XTY A;  3HFZ A;  2AKW B;  3NET A;  2HNI A;  1LYL A;  1YB3 A;  1BIB A;  2CGH A;  4ZTU B;  3HY1 A;  5K1X A;  1FYF A;  1NJ6 A;  2QHT A;  1USY A;  3L2Z A;  3QO7 A;  4X5O A;  3HTZ A;  4CS2 A;  1E24 A;  2I4L A;  4YRF A;  4HA8 A;  4K88 A;  4TQF A;  1NYR A;  4O2D A;  4H2V A;  2CJA A;  3TUP A;  4K86 A;  4XTX A;  1WU7 A;  1Z7N A;  3RUX A;  3UH0 A;  4EO4 A;  2DKG A;  3CMQ A;  3E9I A;  2P5I A;  2ARU A;  1H4T A;  2ZIM A;  4P73 A;  1WQ7 A;  4YRT A;  4TVW A;  2IY5 B;  4EX5 A;  3A5Z A;  2ZT5 A;  1B7Y A;  3NEL A;  2I4M A;  2RHS B;  3E9H A;  4YRL A;  4TVY A;  3R07 A;  3HXX A;  2QHV A;  3VQW A;  3ICA A;  1E1O A;  1X56 A;  4LVM A;  1BBU A;  4UPA A;  4YRR A;  3QTC A;  4HWP A;  2EJF A;  2XGT A;  2E3C A;  2Q7G A;  2ALY B;  3VBB A;  4XTU A;  2I4N A;  2DDZ A;  3TEG A;  4TTV A;  1B70 B;  4TVA A;  1H4Q A;  5K1P A;  5ELN A;  1NNH A;  2ZXF A;  3M4Q A;  3WQZ A;  1QF6 A;  1EIY B;  2FYK A;  4YRQ A;  2IY5 A;  4XEM A;  2ZT7 A;  2ZZG A;  4P73 C;  1B8A A;  2DZC A;  2E64 A;  2I4O A;  3P8Y A;  5C51 B;  2ODR D;  4YRN A;  3P8T A;  3FJP A;  3BJU A;  1HXD A;  3QO8 A;  5HGQ A;  5C52 B;  3QNE A;  1EFW A;  5KNN A;  3G1Z A;  4RDX A;  1ASY A;  1QE0 A;  1NJ8 A;  4PG3 A;  4HVC A;  4P72 C;  4E51 A;  1BIA A;  3A7A A;  2QHS A;  4P3N A;  1WLE A;  1JJC B;  4YRI A;  4YRS A;  2ZZE A;  3QO5 A;  3PCO B;  2XTI A;  1EVK A;  4OP0 A;  3A31 A;  3RKX A;  3IG2 A;  2Q7E A;  4CH5 A;  2P0L A;  1PYS A;  4H2X B;  1EOV A;  1YFS A;  2E1H A;  2EAY A;  1NJ5 A;  3W3S A;  3LC0 A;  1WPY A;  1B76 A;  4TQD A;  4H02 A;  4P75 C;  5ELO A;  3L4G B;  4XU3 A;  4CS3 A;  12AS A;  4HWR A;  1HC7 A;  4OLF A;  4P74 A;  4HWO A;  2J3L A;  2ZZF A;  4P71 A;  4XEO A;  3MF2 A;  4UP7 A;  4YRO A;  2AKW A;  4HWS A;  1WQW A;  2DXT A;  2DTO A;  4YRE A;  2E41 A;  3V7S A;  3L1A A;  5C53 B;  3VQX A;  4WJ3 M;  4YDQ A;  4L87 A;  4RMF A;  3A7R A;  4YRP A;  1JJC A;  4YCV A;  1X55 A;  3PCO A;  1USY C;  4CH4 A;  1ADJ A;  2J3M A;  4HWT A;  3RL6 A;  4CS4 A;  4YCW A;  1G5H A;  2DQ0 A;  1Z7M A;  1SES A;  2DEQ A;  1SET A;  4YRM A;  5E3I A;  1J5W A;  3HXW A;  1H4S A;  4XTW A;  4H2U A;  4H2X A;  3HRK A;  1G51 A;  2E10 A;  1WYD A;  2ZR2 A;  3V8L A;  3REU A;  3DSQ A;  1VQZ A;  2RHQ B;  2CJB A;  1EVL A;  3HFV A;  4Q6G A;  4XTV A;  3RAC A;  3RIR A;  4P3P A;  4Q15 A;  1X2H A;  2PME A;  2ARS A;  1N9W A;  4LVL A;  2C7I A;  2PMF A;  3NEN A;  2DU5 A;  1NYQ A;  11AS A;  3KFU A;  2CJ9 A;  2Q5H A;  1RIQ A;  4CH6 A;  4P74 C;  4XU2 A;  2E65 A;  2Q5I A;  2DU7 A;  3MQZ A;  2QHU A;  4P71 C;  2RHS A;  4WF2 A;  4DQ2 A;  4P3O A;  3V7R A;  4K87 A;  3IKL A;  1EQR A;  2A8E A;  2CIM A;  1YFR A;  1SER A;  3PZC A;  2EJG A; 
#chains in the Genus database with same CATH homology
 3V8K A;  4KR3 A;  1KMM A;  2ZTG A;  4BW9 A;  1KOG A;  2ZT6 A;  1B7Y B;  2ALY A;  3UFG A;  2Q7H A;  4AH6 A;  1E22 A;  2ZGW A;  2G4C A;  4G85 A;  4CH3 A;  1B70 A;  2DQ3 A;  3A74 A;  2EWN A;  3REX A;  1E1T A;  4LVJ A;  4HT4 A;  1YGB A;  4YPF A;  4LVK A;  4UP9 A;  2RHQ A;  4H2Y A;  4NCX A;  4XU0 A;  3LSS A;  2ZT8 A;  3HXY A;  3VQY A;  1G5I A;  1EIY A;  1X54 A;  3ERR A;  4LNS A;  3TEH B;  3EFS A;  5F5W A;  3BFM A;  3IAL A;  3V7C A;  4G84 A;  4YP0 A;  4RQE A;  1ADY A;  4UP8 A;  4XU1 A;  1NJ2 A;  4TWA A;  4XTZ A;  2EJ9 A;  1HTT A;  4TVA B;  2ODR C;  4ZIB A;  1ASZ A;  1ATI A;  3RKY A;  2ZR3 A;  1BBW A;  3OD1 A;  4ZTZ B;  2AMC B;  2DZ9 A;  4YRJ A;  3A7U A;  3RKW A;  3HRI A;  3UGQ A;  2DJZ A;  4YRK A;  2ZIN A;  4YRC A;  3HFZ B;  3P8V A;  4P72 A;  3V8J A;  2DVE A;  4YYE A;  2DTI A;  4DPG A;  2DXU A;  3NEM A;  2DTH A;  1WNL A;  4H2W A;  3IKM B;  4J15 A;  2ART A;  3HXZ A;  3RF1 A;  4WI1 A;  1KMN A;  2C8M A;  4RQF A;  1GGM A;  3L4G A;  4H2T A;  3RGL A;  3TEH A;  1NJ1 A;  1SRY A;  1X2G A;  2E5A A;  3M4P A;  1X01 A;  3EFR A;  2ZCE A;  4WJ4 A;  4YCU A;  3HXU A;  4KQE A;  3MF1 A;  2NS6 A;  4P75 A;  4YRG A;  1PYS B;  2EL9 A;  1L0W A;  4BWA A;  4H2S A;  3VQV A;  1H4V B;  2ZNJ A;  1C0A A;  4PHC A;  3A5Y A;  3I7F A;  3MEY A;  1W66 A;  3A32 A;  3HXV A;  3UGT A;  2AMC A;  2ZIO A;  1IL2 A;  2ZNI A;  3LSQ A;  4KR2 A;  1YFT A;  3HY0 A;  4LVI A;  4XTY A;  3HFZ A;  2AKW B;  3NET A;  2HNI A;  1LYL A;  1YB3 A;  1BIB A;  2CGH A;  4ZTU B;  3HY1 A;  5K1X A;  1FYF A;  1NJ6 A;  2QHT A;  1USY A;  3L2Z A;  3QO7 A;  4X5O A;  3HTZ A;  4CS2 A;  1E24 A;  2I4L A;  4YRF A;  4HA8 A;  4K88 A;  4TQF A;  1NYR A;  4O2D A;  4H2V A;  2CJA A;  3TUP A;  4K86 A;  4XTX A;  1WU7 A;  1Z7N A;  3RUX A;  3UH0 A;  4EO4 A;  2DKG A;  3CMQ A;  3E9I A;  2P5I A;  2ARU A;  1H4T A;  2ZIM A;  4P73 A;  1WQ7 A;  4YRT A;  4TVW A;  2IY5 B;  4EX5 A;  3A5Z A;  2ZT5 A;  1B7Y A;  3NEL A;  2I4M A;  2RHS B;  3E9H A;  4YRL A;  4TVY A;  3R07 A;  3HXX A;  2QHV A;  3VQW A;  3ICA A;  1E1O A;  1X56 A;  4LVM A;  1BBU A;  4UPA A;  4YRR A;  3QTC A;  4HWP A;  2EJF A;  2XGT A;  2E3C A;  2Q7G A;  2ALY B;  3VBB A;  4XTU A;  2I4N A;  2DDZ A;  3TEG A;  4TTV A;  1B70 B;  4TVA A;  1H4Q A;  5K1P A;  5ELN A;  1NNH A;  2ZXF A;  3M4Q A;  3WQZ A;  1QF6 A;  1EIY B;  2FYK A;  4YRQ A;  2IY5 A;  4XEM A;  2ZT7 A;  2ZZG A;  4P73 C;  1B8A A;  2DZC A;  2E64 A;  2I4O A;  3P8Y A;  5C51 B;  2ODR D;  4YRN A;  3P8T A;  3FJP A;  3BJU A;  1HXD A;  3QO8 A;  5HGQ A;  5C52 B;  3QNE A;  1EFW A;  5KNN A;  3G1Z A;  4RDX A;  1ASY A;  1QE0 A;  1NJ8 A;  4PG3 A;  4HVC A;  4P72 C;  4E51 A;  1BIA A;  3A7A A;  2QHS A;  4P3N A;  1WLE A;  1JJC B;  4YRI A;  4YRS A;  2ZZE A;  3QO5 A;  3PCO B;  2XTI A;  1EVK A;  4OP0 A;  3A31 A;  3RKX A;  3IG2 A;  2Q7E A;  4CH5 A;  2P0L A;  1PYS A;  4H2X B;  1EOV A;  1YFS A;  2E1H A;  2EAY A;  1NJ5 A;  3W3S A;  3LC0 A;  1WPY A;  1B76 A;  4TQD A;  4H02 A;  4P75 C;  5ELO A;  3L4G B;  4XU3 A;  4CS3 A;  12AS A;  4HWR A;  1HC7 A;  4OLF A;  4P74 A;  4HWO A;  2J3L A;  2ZZF A;  4P71 A;  4XEO A;  3MF2 A;  4UP7 A;  4YRO A;  2AKW A;  4HWS A;  1WQW A;  2DXT A;  2DTO A;  4YRE A;  2E41 A;  3V7S A;  3L1A A;  5C53 B;  3VQX A;  4WJ3 M;  4YDQ A;  4L87 A;  4RMF A;  3A7R A;  4YRP A;  1JJC A;  4YCV A;  1X55 A;  3PCO A;  1USY C;  4CH4 A;  1ADJ A;  2J3M A;  4HWT A;  3RL6 A;  4CS4 A;  4YCW A;  1G5H A;  2DQ0 A;  1Z7M A;  1SES A;  2DEQ A;  1SET A;  4YRM A;  5E3I A;  1J5W A;  3HXW A;  1H4S A;  4XTW A;  4H2U A;  4H2X A;  3HRK A;  1G51 A;  2E10 A;  1WYD A;  2ZR2 A;  3V8L A;  3REU A;  3DSQ A;  1VQZ A;  2RHQ B;  2CJB A;  1EVL A;  3HFV A;  4Q6G A;  4XTV A;  3RAC A;  3RIR A;  4P3P A;  4Q15 A;  1X2H A;  2PME A;  2ARS A;  1N9W A;  4LVL A;  2C7I A;  2PMF A;  3NEN A;  2DU5 A;  1NYQ A;  11AS A;  3KFU A;  2CJ9 A;  2Q5H A;  1RIQ A;  4CH6 A;  4P74 C;  4XU2 A;  2E65 A;  2Q5I A;  2DU7 A;  3MQZ A;  2QHU A;  4P71 C;  2RHS A;  4WF2 A;  4DQ2 A;  4P3O A;  3V7R A;  4K87 A;  3IKL A;  1EQR A;  2A8E A;  2CIM A;  1YFR A;  1SER A;  3PZC A;  2EJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...