2P5IA

Crystal structure of protein bh3822 from bacillus halodurans, a member of the biotin/lipoate a/b protein ligase family
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
262
Chain Sequence
PWRFLDHTSFGPTFQALQSFAYDDTLCTSIGKSQSPPTLRAWVHHNTVVLGIQDSRLPQIKAGIEALKGFQHDVIVRNSGGLAVVLDSGILNLSLVLKEEKGFSIDDGYELMYELICSMFQEQIEAREIVGSYCPGSYDLSIDGKKFAGISQRRIRGGVAVQIYLCVSGSGAERAKMIRTFYDKAVAGQPTKFVYPRIKPETMASLSELLGQPHNVSDVLLKALMTLQQHGASLLTESLSADEWLLYEQHFARISERNEKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords BH3822 protein
publication title Crystal structure of a hypothetical protein from Bacillus halodurans: Pfam-PF03099
rcsb
source organism Bacillus halodurans c-125
total genus 82
structure length 262
sequence length 265
ec nomenclature ec 2.3.1.204: Octanoyl-[GcvH]:protein N-octanoyltransferase.
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2p5iA00
4P75C 3QO7A 3QTCA 3KFUA 2DDZA 2AMCB 1EQRA 4PHCA 4H2XA 4P74A 5E3IA 2XTIA 1GGMA 4WI1A 1WNLA 1WQ7A 2E64A 2ZGWA 3VQVA 1YFSA 4H02A 2ZT7A 2ZINA 2XGTA 3RL6A 2EJ9A 1ADYA 4YRTA 1ASZA 4H2VA 4YCVA 2RHQB 4YRSA 3HTZA 1NJ8A 1LYLA 3HY0A 2DXUA 4RQFA 4EO4A 1EFWA 2ZIOA 4H2YA 2E5AA 3L4GB 4Q6GA 3V8LA 4UPAA 3A5YA 4TWAA 3RKYA 3HRKA 4KR3A 3UFGA 3NETA 1H4SA 3I7FA 3A7RA 1WLEA 1YFRA 1NYQA 3PCOB 3P8YA 3V7RA 4H2WA 1BBUA 1SETA 1WU7A 4P74C 4TVYA 1JJCA 2DU5A 5C52B 2CJBA 2ARTA 2CJAA 4P75A 1NJ2A 4XU0A 3V7CA 4G85A 4YRIA 2EWNA 4HWSA 4YRMA 1NYRA 3HY1A 4YRRA 2DZ9A 4NCXA 2EAYA 3R07A 2C8MA 3EFRA 2ZIMA 4P72C 1L0WA 2Q7HA 1ASYA 4P71A 1IL2A 4YPFA 4YCWA 1X2GA 2ZTGA 4YYEA 4TVAB 4O2DA 2AKWB 2DQ3A 2ZT8A 2ZR2A 1NJ5A 3PZCA 4XU1A 4TVWA 1BIAA 1C0AA 4K88A 4YP0A 1YFTA 3RUXA 4WJ4A 3HFZA 4OP0A 1KMNA 3TEGA 1B7YA 4XU3A 3IG2A 4UP8A 4WJ3M 2DKGA 1VQZA 1W66A 3L1AA 2ZZEA 4BW9A 3UGTA 4YRQA 3CMQA 3UH0A 4CH3A 4XEMA 4OLFA 3WQZA 2E1HA 1G5HA 1QE0A 3MF2A 4UP7A 4P71C 3UGQA 2AMCA 3TUPA 1H4TA 3V8JA 4P72A 1RIQA 1HXDA 4EX5A 2ZZGA 2Q5IA 2CJ9A 4HWPA 1HTTA 4TQFA 2Q5HA 4CH5A 3EFSA 4L87A 4YRGA 1USYC 4YROA 2RHSB 2J3MA 3VQWA 1WYDA 3M4PA 3QO5A 2Q7EA 2E41A 2QHVA 3A7UA 2I4MA 2RHQA 2IY5B 3HXZA 1EIYB 3G1ZA 4YCUA 2J3LA 2DZCA 3ERRA 3HFVA 4XTZA 3BJUA 4KR2A 1G5IA 3E9HA 5ELOA 3L4GA 1KMMA 3IALA 1Z7NA 3RGLA 2QHSA 1G51A 4CH4A 1B70B 3P8VA 3TEHB 1WPYA 1NJ6A 2DJZA 3RF1A 3PCOA 3RKWA 4X5OA 4HA8A 3M4QA 4XEOA 4RQEA 4YRJA 2DVEA 3BFMA 3VBBA 3HXVA 1PYSB 2E65A 2EJFA 2Q7GA 4XTWA 1X01A 3MF1A 4CH6A 4YRKA 4AH6A 1B8AA 3NEMA 2ZT5A 1QF6A 4LNSA 1WQWA 3QNEA 1EVLA 2ODRC 3P8TA 4TQDA 2PMFA 1H4VB 3A31A 1USYA 3HXYA 3A32A 3HXWA 2EL9A 2I4LA 2P0LA 1KOGA 1BIBA 1HC7A 3ICAA 5ELNA 3V8KA 5K1PA 2ZCEA 2EJGA 1X54A 1ADJA 3MEYA 1B76A 1E1TA 2I4NA 3E9IA 4TVAA 3RACA 3QO8A 2AKWA 2E10A 4P3NA 3REXA 4XTUA 4XTXA 4XTVA 2CIMA 4RDXA 1YGBA 3A74A 4ZTZB 1NJ1A 1N9WA 2HNIA 1SESA 4ZIBA 5C51B 2PMEA 4DQ2A 2ARSA 3VQXA 3IKLA 3RIRA 1X2HA 5HGQA 4HWTA 2DQ0A 1BBWA 4K87A 1EOVA 2ODRD 4YRPA 4CS4A 4YRCA 4YRNA 4UP9A 4TTVA 1E22A 1Z7MA 1JJCB 3NELA 4DPGA 4G84A 4ZTUB 3L2ZA 3HRIA 4P73A 4E51A 1SERA 1J5WA 4YDQA 4H2SA 3FJPA 4RMFA 2FYKA 2ARUA 4P3OA 3HXUA 4YRLA 4Q15A 4YRFA 3W3SA 2RHSA 4CS3A 4HWRA 2DTOA 3NENA 3HXXA 2DTIA 2ZR3A 1SRYA 4HVCA 2IY5A 3DSQA 4J15A 1EIYA 1X56A 3A5ZA 2ZXFA 2ZT6A 4YREA 1H4QA 1X55A 1FYFA 2DTHA 4HWOA 2G4CA 5K1XA 1E1OA 2CGHA 4KQEA 4P3PA 3VQYA 2ALYB 3REUA 4H2UA 4WF2A 2C7IA 4CS2A 5KNNA 1B70A 1NNHA 2QHTA 4H2TA 3TEHA 2I4OA 2DXTA 3LSQA 2E3CA 3HFZB 4P73C 1B7YB 1EVKA 1ATIA 2DU7A 4H2XB 1PYSA 5C53B 3A7AA 3IKMB 2DEQA 12ASA 4XTYA 3V7SA 3RKXA 4PG3A 2ALYA 3LC0A 2ZNIA 4BWAA 2ZNJA 4K86A 3LSSA 11ASA 1E24A 2QHUA 1YB3A 4XU2A 2P5IA 2ZZFA 5F5WA 3OD1A
chains in the Genus database with same CATH superfamily
4P75C 3QO7A 3QTCA 3KFUA 2DDZA 2AMCB 1EQRA 4PHCA 4H2XA 4P74A 3MQZA 5E3IA 2XTIA 1GGMA 4WI1A 1WNLA 1WQ7A 2E64A 2ZGWA 3VQVA 1YFSA 4H02A 2ZT7A 2ZINA 2XGTA 3RL6A 2EJ9A 1ADYA 4YRTA 1ASZA 4H2VA 4YCVA 2RHQB 4YRSA 3HTZA 1NJ8A 1LYLA 3HY0A 2DXUA 4RQFA 4EO4A 1EFWA 2ZIOA 4H2YA 2E5AA 3L4GB 4Q6GA 3V8LA 4UPAA 3A5YA 4TWAA 3RKYA 3HRKA 4KR3A 3UFGA 3NETA 1H4SA 3I7FA 3A7RA 1WLEA 1YFRA 1NYQA 3PCOB 3P8YA 3V7RA 4H2WA 1BBUA 1SETA 1WU7A 4P74C 4TVYA 1JJCA 2DU5A 5C52B 2CJBA 2ARTA 4LVJA 2CJAA 4P75A 1NJ2A 4XU0A 3V7CA 4G85A 4YRIA 4LVKA 2EWNA 4HWSA 4YRMA 1NYRA 3HY1A 4YRRA 2DZ9A 4NCXA 2EAYA 3R07A 2C8MA 3EFRA 2ZIMA 4P72C 1L0WA 2Q7HA 1ASYA 4P71A 1IL2A 4YPFA 4YCWA 1X2GA 2ZTGA 4YYEA 4TVAB 4O2DA 2AKWB 2DQ3A 2ZT8A 2ZR2A 1NJ5A 3PZCA 4XU1A 4TVWA 1BIAA 1C0AA 4K88A 4YP0A 1YFTA 3RUXA 4WJ4A 3HFZA 4OP0A 1KMNA 3TEGA 1B7YA 4XU3A 3IG2A 4UP8A 4WJ3M 2DKGA 1VQZA 1W66A 3L1AA 2ZZEA 4BW9A 3UGTA 4YRQA 3CMQA 3UH0A 4CH3A 4XEMA 4OLFA 3WQZA 2E1HA 1G5HA 1QE0A 3MF2A 4UP7A 4P71C 3UGQA 2AMCA 3TUPA 1H4TA 3V8JA 4P72A 1RIQA 1HXDA 4EX5A 2ZZGA 2Q5IA 2CJ9A 4HWPA 1HTTA 4TQFA 2Q5HA 4CH5A 3EFSA 4L87A 4YRGA 1USYC 4YROA 2RHSB 2J3MA 3VQWA 1WYDA 3M4PA 3QO5A 2Q7EA 2E41A 2QHVA 3A7UA 2I4MA 2RHQA 2IY5B 3HXZA 1EIYB 3G1ZA 4YCUA 2J3LA 2DZCA 3ERRA 3HFVA 4XTZA 3BJUA 4KR2A 1G5IA 4LVIA 3E9HA 5ELOA 3L4GA 1KMMA 3IALA 1Z7NA 3RGLA 2QHSA 4LVMA 1G51A 4CH4A 1B70B 3P8VA 3TEHB 1WPYA 1NJ6A 2DJZA 3RF1A 3PCOA 3RKWA 4X5OA 4HA8A 3M4QA 4XEOA 4RQEA 4YRJA 2DVEA 3BFMA 3VBBA 3HXVA 1PYSB 2E65A 2EJFA 2Q7GA 4XTWA 1X01A 3MF1A 4CH6A 4YRKA 4AH6A 1B8AA 3NEMA 2ZT5A 1QF6A 4LNSA 2NS6A 1WQWA 3QNEA 1EVLA 2ODRC 3P8TA 4TQDA 2PMFA 1H4VB 3A31A 1USYA 3HXYA 3A32A 3HXWA 2EL9A 2I4LA 2P0LA 1KOGA 1BIBA 1HC7A 3ICAA 5ELNA 3V8KA 5K1PA 2ZCEA 2EJGA 1X54A 1ADJA 3MEYA 1B76A 1E1TA 2I4NA 3E9IA 4TVAA 2A8EA 3RACA 3QO8A 2AKWA 4LVLA 2E10A 4P3NA 3REXA 4XTUA 4XTXA 4XTVA 2CIMA 4RDXA 1YGBA 3A74A 4ZTZB 1NJ1A 1N9WA 2HNIA 1SESA 4ZIBA 5C51B 2PMEA 4DQ2A 2ARSA 3VQXA 3IKLA 3RIRA 1X2HA 5HGQA 4HWTA 2DQ0A 1BBWA 4K87A 1EOVA 2ODRD 4YRPA 4CS4A 4YRCA 4YRNA 4UP9A 4TTVA 1E22A 1Z7MA 1JJCB 3NELA 4DPGA 4G84A 4ZTUB 3L2ZA 3HRIA 4P73A 4E51A 1SERA 1J5WA 4YDQA 4H2SA 3FJPA 4RMFA 2FYKA 2ARUA 4P3OA 3HXUA 4YRLA 4Q15A 4YRFA 3W3SA 2RHSA 4CS3A 4HWRA 2DTOA 4HT4A 3NENA 3HXXA 2DTIA 2ZR3A 1SRYA 4HVCA 2IY5A 3DSQA 4J15A 1EIYA 1X56A 3A5ZA 2ZXFA 2ZT6A 4YREA 1H4QA 1X55A 1FYFA 2DTHA 4HWOA 2G4CA 5K1XA 1E1OA 2CGHA 4KQEA 4P3PA 3VQYA 2ALYB 3REUA 4H2UA 4WF2A 2C7IA 4CS2A 5KNNA 1B70A 1NNHA 2QHTA 4H2TA 3TEHA 2I4OA 2DXTA 3LSQA 2E3CA 3HFZB 4P73C 1B7YB 1EVKA 1ATIA 2DU7A 4H2XB 1PYSA 5C53B 3A7AA 3IKMB 2DEQA 12ASA 4XTYA 3V7SA 3RKXA 4PG3A 2ALYA 3LC0A 2ZNIA 4BWAA 2ZNJA 4K86A 3LSSA 11ASA 1E24A 2QHUA 1YB3A 4XU2A 2P5IA 2ZZFA 5F5WA 3OD1A
chains in the Genus database with same CATH topology
4P75C 3QO7A 3QTCA 3KFUA 2DDZA 2AMCB 1EQRA 4PHCA 4H2XA 4P74A 3MQZA 5E3IA 2XTIA 1GGMA 4WI1A 1WNLA 1WQ7A 2E64A 2ZGWA 3VQVA 1YFSA 4H02A 2ZT7A 2ZINA 2XGTA 3RL6A 2EJ9A 1ADYA 4YRTA 1ASZA 4H2VA 4YCVA 2RHQB 4YRSA 3HTZA 1NJ8A 1LYLA 3HY0A 2DXUA 4RQFA 4EO4A 1EFWA 2ZIOA 4H2YA 2E5AA 3L4GB 4Q6GA 3V8LA 4UPAA 3A5YA 4TWAA 3RKYA 3HRKA 4KR3A 3UFGA 3NETA 1H4SA 3I7FA 3A7RA 1WLEA 1YFRA 1NYQA 3PCOB 3P8YA 3V7RA 4H2WA 1BBUA 1SETA 1WU7A 4P74C 4TVYA 1JJCA 2DU5A 5C52B 2CJBA 2ARTA 4LVJA 2CJAA 4P75A 1NJ2A 4XU0A 3V7CA 4G85A 4YRIA 4LVKA 2EWNA 4HWSA 4YRMA 1NYRA 3HY1A 4YRRA 2DZ9A 4NCXA 2EAYA 3R07A 2C8MA 3EFRA 2ZIMA 4P72C 1L0WA 2Q7HA 1ASYA 4P71A 1IL2A 4YPFA 4YCWA 1X2GA 2ZTGA 4YYEA 4TVAB 4O2DA 2AKWB 2DQ3A 2ZT8A 2ZR2A 1NJ5A 3PZCA 4XU1A 4TVWA 1BIAA 1C0AA 4K88A 4YP0A 1YFTA 3RUXA 4WJ4A 3HFZA 4OP0A 1KMNA 3TEGA 1B7YA 4XU3A 3IG2A 4UP8A 4WJ3M 2DKGA 1VQZA 1W66A 3L1AA 2ZZEA 4BW9A 3UGTA 4YRQA 3CMQA 3UH0A 4CH3A 4XEMA 4OLFA 3WQZA 2E1HA 1G5HA 1QE0A 3MF2A 4UP7A 4P71C 3UGQA 2AMCA 3TUPA 1H4TA 3V8JA 4P72A 1RIQA 1HXDA 4EX5A 2ZZGA 2Q5IA 2CJ9A 4HWPA 1HTTA 4TQFA 2Q5HA 4CH5A 3EFSA 4L87A 4YRGA 1USYC 4YROA 2RHSB 2J3MA 3VQWA 1WYDA 3M4PA 3QO5A 2Q7EA 2E41A 2QHVA 3A7UA 2I4MA 2RHQA 2IY5B 3HXZA 1EIYB 3G1ZA 4YCUA 2J3LA 2DZCA 3ERRA 3HFVA 4XTZA 3BJUA 4KR2A 1G5IA 4LVIA 3E9HA 5ELOA 3L4GA 1KMMA 3IALA 1Z7NA 3RGLA 2QHSA 4LVMA 1G51A 4CH4A 1B70B 3P8VA 3TEHB 1WPYA 1NJ6A 2DJZA 3RF1A 3PCOA 3RKWA 4X5OA 4HA8A 3M4QA 4XEOA 4RQEA 4YRJA 2DVEA 3BFMA 3VBBA 3HXVA 1PYSB 2E65A 2EJFA 2Q7GA 4XTWA 1X01A 3MF1A 4CH6A 4YRKA 4AH6A 1B8AA 3NEMA 2ZT5A 1QF6A 4LNSA 2NS6A 1WQWA 3QNEA 1EVLA 2ODRC 3P8TA 4TQDA 2PMFA 1H4VB 3A31A 1USYA 3HXYA 3A32A 3HXWA 2EL9A 2I4LA 2P0LA 1KOGA 1BIBA 1HC7A 3ICAA 5ELNA 3V8KA 5K1PA 2ZCEA 2EJGA 1X54A 1ADJA 3MEYA 1B76A 1E1TA 2I4NA 3E9IA 4TVAA 2A8EA 3RACA 3QO8A 2AKWA 4LVLA 2E10A 4P3NA 3REXA 4XTUA 4XTXA 4XTVA 2CIMA 4RDXA 1YGBA 3A74A 4ZTZB 1NJ1A 1N9WA 2HNIA 1SESA 4ZIBA 5C51B 2PMEA 4DQ2A 2ARSA 3VQXA 3IKLA 3RIRA 1X2HA 5HGQA 4HWTA 2DQ0A 1BBWA 4K87A 1EOVA 2ODRD 4YRPA 4CS4A 4YRCA 4YRNA 4UP9A 4TTVA 1E22A 1Z7MA 1JJCB 3NELA 4DPGA 4G84A 4ZTUB 3L2ZA 3HRIA 4P73A 4E51A 1SERA 1J5WA 4YDQA 4H2SA 3FJPA 4RMFA 2FYKA 2ARUA 4P3OA 3HXUA 4YRLA 4Q15A 4YRFA 3W3SA 2RHSA 4CS3A 4HWRA 2DTOA 4HT4A 3NENA 3HXXA 2DTIA 2ZR3A 1SRYA 4HVCA 2IY5A 3DSQA 4J15A 1EIYA 1X56A 3A5ZA 2ZXFA 2ZT6A 4YREA 1H4QA 1X55A 1FYFA 2DTHA 4HWOA 2G4CA 5K1XA 1E1OA 2CGHA 4KQEA 4P3PA 3VQYA 2ALYB 3REUA 4H2UA 4WF2A 2C7IA 4CS2A 5KNNA 1B70A 1NNHA 2QHTA 4H2TA 3TEHA 2I4OA 2DXTA 3LSQA 2E3CA 3HFZB 4P73C 1B7YB 1EVKA 1ATIA 2DU7A 4H2XB 1PYSA 5C53B 3A7AA 3IKMB 2DEQA 12ASA 4XTYA 3V7SA 3RKXA 4PG3A 2ALYA 3LC0A 2ZNIA 4BWAA 2ZNJA 4K86A 3LSSA 11ASA 1E24A 2QHUA 1YB3A 4XU2A 2P5IA 2ZZFA 5F5WA 3OD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P75 C;  3QO7 A;  3QTC A;  3KFU A;  2DDZ A;  2AMC B;  1EQR A;  4PHC A;  4H2X A;  4P74 A;  5E3I A;  2XTI A;  1GGM A;  4WI1 A;  1WNL A;  1WQ7 A;  2E64 A;  2ZGW A;  3VQV A;  1YFS A;  4H02 A;  2ZT7 A;  2ZIN A;  2XGT A;  3RL6 A;  2EJ9 A;  1ADY A;  4YRT A;  1ASZ A;  4H2V A;  4YCV A;  2RHQ B;  4YRS A;  3HTZ A;  1NJ8 A;  1LYL A;  3HY0 A;  2DXU A;  4RQF A;  4EO4 A;  1EFW A;  2ZIO A;  4H2Y A;  2E5A A;  3L4G B;  4Q6G A;  3V8L A;  4UPA A;  3A5Y A;  4TWA A;  3RKY A;  3HRK A;  4KR3 A;  3UFG A;  3NET A;  1H4S A;  3I7F A;  3A7R A;  1WLE A;  1YFR A;  1NYQ A;  3PCO B;  3P8Y A;  3V7R A;  4H2W A;  1BBU A;  1SET A;  1WU7 A;  4P74 C;  4TVY A;  1JJC A;  2DU5 A;  5C52 B;  2CJB A;  2ART A;  2CJA A;  4P75 A;  1NJ2 A;  4XU0 A;  3V7C A;  4G85 A;  4YRI A;  2EWN A;  4HWS A;  4YRM A;  1NYR A;  3HY1 A;  4YRR A;  2DZ9 A;  4NCX A;  2EAY A;  3R07 A;  2C8M A;  3EFR A;  2ZIM A;  4P72 C;  1L0W A;  2Q7H A;  1ASY A;  4P71 A;  1IL2 A;  4YPF A;  4YCW A;  1X2G A;  2ZTG A;  4YYE A;  4TVA B;  4O2D A;  2AKW B;  2DQ3 A;  2ZT8 A;  2ZR2 A;  1NJ5 A;  3PZC A;  4XU1 A;  4TVW A;  1BIA A;  1C0A A;  4K88 A;  4YP0 A;  1YFT A;  3RUX A;  4WJ4 A;  3HFZ A;  4OP0 A;  1KMN A;  3TEG A;  1B7Y A;  4XU3 A;  3IG2 A;  4UP8 A;  4WJ3 M;  2DKG A;  1VQZ A;  1W66 A;  3L1A A;  2ZZE A;  4BW9 A;  3UGT A;  4YRQ A;  3CMQ A;  3UH0 A;  4CH3 A;  4XEM A;  4OLF A;  3WQZ A;  2E1H A;  1G5H A;  1QE0 A;  3MF2 A;  4UP7 A;  4P71 C;  3UGQ A;  2AMC A;  3TUP A;  1H4T A;  3V8J A;  4P72 A;  1RIQ A;  1HXD A;  4EX5 A;  2ZZG A;  2Q5I A;  2CJ9 A;  4HWP A;  1HTT A;  4TQF A;  2Q5H A;  4CH5 A;  3EFS A;  4L87 A;  4YRG A;  1USY C;  4YRO A;  2RHS B;  2J3M A;  3VQW A;  1WYD A;  3M4P A;  3QO5 A;  2Q7E A;  2E41 A;  2QHV A;  3A7U A;  2I4M A;  2RHQ A;  2IY5 B;  3HXZ A;  1EIY B;  3G1Z A;  4YCU A;  2J3L A;  2DZC A;  3ERR A;  3HFV A;  4XTZ A;  3BJU A;  4KR2 A;  1G5I A;  3E9H A;  5ELO A;  3L4G A;  1KMM A;  3IAL A;  1Z7N A;  3RGL A;  2QHS A;  1G51 A;  4CH4 A;  1B70 B;  3P8V A;  3TEH B;  1WPY A;  1NJ6 A;  2DJZ A;  3RF1 A;  3PCO A;  3RKW A;  4X5O A;  4HA8 A;  3M4Q A;  4XEO A;  4RQE A;  4YRJ A;  2DVE A;  3BFM A;  3VBB A;  3HXV A;  1PYS B;  2E65 A;  2EJF A;  2Q7G A;  4XTW A;  1X01 A;  3MF1 A;  4CH6 A;  4YRK A;  4AH6 A;  1B8A A;  3NEM A;  2ZT5 A;  1QF6 A;  4LNS A;  1WQW A;  3QNE A;  1EVL A;  2ODR C;  3P8T A;  4TQD A;  2PMF A;  1H4V B;  3A31 A;  1USY A;  3HXY A;  3A32 A;  3HXW A;  2EL9 A;  2I4L A;  2P0L A;  1KOG A;  1BIB A;  1HC7 A;  3ICA A;  5ELN A;  3V8K A;  5K1P A;  2ZCE A;  2EJG A;  1X54 A;  1ADJ A;  3MEY A;  1B76 A;  1E1T A;  2I4N A;  3E9I A;  4TVA A;  3RAC A;  3QO8 A;  2AKW A;  2E10 A;  4P3N A;  3REX A;  4XTU A;  4XTX A;  4XTV A;  2CIM A;  4RDX A;  1YGB A;  3A74 A;  4ZTZ B;  1NJ1 A;  1N9W A;  2HNI A;  1SES A;  4ZIB A;  5C51 B;  2PME A;  4DQ2 A;  2ARS A;  3VQX A;  3IKL A;  3RIR A;  1X2H A;  5HGQ A;  4HWT A;  2DQ0 A;  1BBW A;  4K87 A;  1EOV A;  2ODR D;  4YRP A;  4CS4 A;  4YRC A;  4YRN A;  4UP9 A;  4TTV A;  1E22 A;  1Z7M A;  1JJC B;  3NEL A;  4DPG A;  4G84 A;  4ZTU B;  3L2Z A;  3HRI A;  4P73 A;  4E51 A;  1SER A;  1J5W A;  4YDQ A;  4H2S A;  3FJP A;  4RMF A;  2FYK A;  2ARU A;  4P3O A;  3HXU A;  4YRL A;  4Q15 A;  4YRF A;  3W3S A;  2RHS A;  4CS3 A;  4HWR A;  2DTO A;  3NEN A;  3HXX A;  2DTI A;  2ZR3 A;  1SRY A;  4HVC A;  2IY5 A;  3DSQ A;  4J15 A;  1EIY A;  1X56 A;  3A5Z A;  2ZXF A;  2ZT6 A;  4YRE A;  1H4Q A;  1X55 A;  1FYF A;  2DTH A;  4HWO A;  2G4C A;  5K1X A;  1E1O A;  2CGH A;  4KQE A;  4P3P A;  3VQY A;  2ALY B;  3REU A;  4H2U A;  4WF2 A;  2C7I A;  4CS2 A;  5KNN A;  1B70 A;  1NNH A;  2QHT A;  4H2T A;  3TEH A;  2I4O A;  2DXT A;  3LSQ A;  2E3C A;  3HFZ B;  4P73 C;  1B7Y B;  1EVK A;  1ATI A;  2DU7 A;  4H2X B;  1PYS A;  5C53 B;  3A7A A;  3IKM B;  2DEQ A;  12AS A;  4XTY A;  3V7S A;  3RKX A;  4PG3 A;  2ALY A;  3LC0 A;  2ZNI A;  4BWA A;  2ZNJ A;  4K86 A;  3LSS A;  11AS A;  1E24 A;  2QHU A;  1YB3 A;  4XU2 A;  2P5I A;  2ZZF A;  5F5W A;  3OD1 A; 
#chains in the Genus database with same CATH topology
 4P75 C;  3QO7 A;  3QTC A;  3KFU A;  2DDZ A;  2AMC B;  1EQR A;  4PHC A;  4H2X A;  4P74 A;  3MQZ A;  5E3I A;  2XTI A;  1GGM A;  4WI1 A;  1WNL A;  1WQ7 A;  2E64 A;  2ZGW A;  3VQV A;  1YFS A;  4H02 A;  2ZT7 A;  2ZIN A;  2XGT A;  3RL6 A;  2EJ9 A;  1ADY A;  4YRT A;  1ASZ A;  4H2V A;  4YCV A;  2RHQ B;  4YRS A;  3HTZ A;  1NJ8 A;  1LYL A;  3HY0 A;  2DXU A;  4RQF A;  4EO4 A;  1EFW A;  2ZIO A;  4H2Y A;  2E5A A;  3L4G B;  4Q6G A;  3V8L A;  4UPA A;  3A5Y A;  4TWA A;  3RKY A;  3HRK A;  4KR3 A;  3UFG A;  3NET A;  1H4S A;  3I7F A;  3A7R A;  1WLE A;  1YFR A;  1NYQ A;  3PCO B;  3P8Y A;  3V7R A;  4H2W A;  1BBU A;  1SET A;  1WU7 A;  4P74 C;  4TVY A;  1JJC A;  2DU5 A;  5C52 B;  2CJB A;  2ART A;  4LVJ A;  2CJA A;  4P75 A;  1NJ2 A;  4XU0 A;  3V7C A;  4G85 A;  4YRI A;  4LVK A;  2EWN A;  4HWS A;  4YRM A;  1NYR A;  3HY1 A;  4YRR A;  2DZ9 A;  4NCX A;  2EAY A;  3R07 A;  2C8M A;  3EFR A;  2ZIM A;  4P72 C;  1L0W A;  2Q7H A;  1ASY A;  4P71 A;  1IL2 A;  4YPF A;  4YCW A;  1X2G A;  2ZTG A;  4YYE A;  4TVA B;  4O2D A;  2AKW B;  2DQ3 A;  2ZT8 A;  2ZR2 A;  1NJ5 A;  3PZC A;  4XU1 A;  4TVW A;  1BIA A;  1C0A A;  4K88 A;  4YP0 A;  1YFT A;  3RUX A;  4WJ4 A;  3HFZ A;  4OP0 A;  1KMN A;  3TEG A;  1B7Y A;  4XU3 A;  3IG2 A;  4UP8 A;  4WJ3 M;  2DKG A;  1VQZ A;  1W66 A;  3L1A A;  2ZZE A;  4BW9 A;  3UGT A;  4YRQ A;  3CMQ A;  3UH0 A;  4CH3 A;  4XEM A;  4OLF A;  3WQZ A;  2E1H A;  1G5H A;  1QE0 A;  3MF2 A;  4UP7 A;  4P71 C;  3UGQ A;  2AMC A;  3TUP A;  1H4T A;  3V8J A;  4P72 A;  1RIQ A;  1HXD A;  4EX5 A;  2ZZG A;  2Q5I A;  2CJ9 A;  4HWP A;  1HTT A;  4TQF A;  2Q5H A;  4CH5 A;  3EFS A;  4L87 A;  4YRG A;  1USY C;  4YRO A;  2RHS B;  2J3M A;  3VQW A;  1WYD A;  3M4P A;  3QO5 A;  2Q7E A;  2E41 A;  2QHV A;  3A7U A;  2I4M A;  2RHQ A;  2IY5 B;  3HXZ A;  1EIY B;  3G1Z A;  4YCU A;  2J3L A;  2DZC A;  3ERR A;  3HFV A;  4XTZ A;  3BJU A;  4KR2 A;  1G5I A;  4LVI A;  3E9H A;  5ELO A;  3L4G A;  1KMM A;  3IAL A;  1Z7N A;  3RGL A;  2QHS A;  4LVM A;  1G51 A;  4CH4 A;  1B70 B;  3P8V A;  3TEH B;  1WPY A;  1NJ6 A;  2DJZ A;  3RF1 A;  3PCO A;  3RKW A;  4X5O A;  4HA8 A;  3M4Q A;  4XEO A;  4RQE A;  4YRJ A;  2DVE A;  3BFM A;  3VBB A;  3HXV A;  1PYS B;  2E65 A;  2EJF A;  2Q7G A;  4XTW A;  1X01 A;  3MF1 A;  4CH6 A;  4YRK A;  4AH6 A;  1B8A A;  3NEM A;  2ZT5 A;  1QF6 A;  4LNS A;  2NS6 A;  1WQW A;  3QNE A;  1EVL A;  2ODR C;  3P8T A;  4TQD A;  2PMF A;  1H4V B;  3A31 A;  1USY A;  3HXY A;  3A32 A;  3HXW A;  2EL9 A;  2I4L A;  2P0L A;  1KOG A;  1BIB A;  1HC7 A;  3ICA A;  5ELN A;  3V8K A;  5K1P A;  2ZCE A;  2EJG A;  1X54 A;  1ADJ A;  3MEY A;  1B76 A;  1E1T A;  2I4N A;  3E9I A;  4TVA A;  2A8E A;  3RAC A;  3QO8 A;  2AKW A;  4LVL A;  2E10 A;  4P3N A;  3REX A;  4XTU A;  4XTX A;  4XTV A;  2CIM A;  4RDX A;  1YGB A;  3A74 A;  4ZTZ B;  1NJ1 A;  1N9W A;  2HNI A;  1SES A;  4ZIB A;  5C51 B;  2PME A;  4DQ2 A;  2ARS A;  3VQX A;  3IKL A;  3RIR A;  1X2H A;  5HGQ A;  4HWT A;  2DQ0 A;  1BBW A;  4K87 A;  1EOV A;  2ODR D;  4YRP A;  4CS4 A;  4YRC A;  4YRN A;  4UP9 A;  4TTV A;  1E22 A;  1Z7M A;  1JJC B;  3NEL A;  4DPG A;  4G84 A;  4ZTU B;  3L2Z A;  3HRI A;  4P73 A;  4E51 A;  1SER A;  1J5W A;  4YDQ A;  4H2S A;  3FJP A;  4RMF A;  2FYK A;  2ARU A;  4P3O A;  3HXU A;  4YRL A;  4Q15 A;  4YRF A;  3W3S A;  2RHS A;  4CS3 A;  4HWR A;  2DTO A;  4HT4 A;  3NEN A;  3HXX A;  2DTI A;  2ZR3 A;  1SRY A;  4HVC A;  2IY5 A;  3DSQ A;  4J15 A;  1EIY A;  1X56 A;  3A5Z A;  2ZXF A;  2ZT6 A;  4YRE A;  1H4Q A;  1X55 A;  1FYF A;  2DTH A;  4HWO A;  2G4C A;  5K1X A;  1E1O A;  2CGH A;  4KQE A;  4P3P A;  3VQY A;  2ALY B;  3REU A;  4H2U A;  4WF2 A;  2C7I A;  4CS2 A;  5KNN A;  1B70 A;  1NNH A;  2QHT A;  4H2T A;  3TEH A;  2I4O A;  2DXT A;  3LSQ A;  2E3C A;  3HFZ B;  4P73 C;  1B7Y B;  1EVK A;  1ATI A;  2DU7 A;  4H2X B;  1PYS A;  5C53 B;  3A7A A;  3IKM B;  2DEQ A;  12AS A;  4XTY A;  3V7S A;  3RKX A;  4PG3 A;  2ALY A;  3LC0 A;  2ZNI A;  4BWA A;  2ZNJ A;  4K86 A;  3LSS A;  11AS A;  1E24 A;  2QHU A;  1YB3 A;  4XU2 A;  2P5I A;  2ZZF A;  5F5W A;  3OD1 A; 
#chains in the Genus database with same CATH homology
 4P75 C;  3QO7 A;  3QTC A;  3KFU A;  2DDZ A;  2AMC B;  1EQR A;  4PHC A;  4H2X A;  4P74 A;  3MQZ A;  5E3I A;  2XTI A;  1GGM A;  4WI1 A;  1WNL A;  1WQ7 A;  2E64 A;  2ZGW A;  3VQV A;  1YFS A;  4H02 A;  2ZT7 A;  2ZIN A;  2XGT A;  3RL6 A;  2EJ9 A;  1ADY A;  4YRT A;  1ASZ A;  4H2V A;  4YCV A;  2RHQ B;  4YRS A;  3HTZ A;  1NJ8 A;  1LYL A;  3HY0 A;  2DXU A;  4RQF A;  4EO4 A;  1EFW A;  2ZIO A;  4H2Y A;  2E5A A;  3L4G B;  4Q6G A;  3V8L A;  4UPA A;  3A5Y A;  4TWA A;  3RKY A;  3HRK A;  4KR3 A;  3UFG A;  3NET A;  1H4S A;  3I7F A;  3A7R A;  1WLE A;  1YFR A;  1NYQ A;  3PCO B;  3P8Y A;  3V7R A;  4H2W A;  1BBU A;  1SET A;  1WU7 A;  4P74 C;  4TVY A;  1JJC A;  2DU5 A;  5C52 B;  2CJB A;  2ART A;  4LVJ A;  2CJA A;  4P75 A;  1NJ2 A;  4XU0 A;  3V7C A;  4G85 A;  4YRI A;  4LVK A;  2EWN A;  4HWS A;  4YRM A;  1NYR A;  3HY1 A;  4YRR A;  2DZ9 A;  4NCX A;  2EAY A;  3R07 A;  2C8M A;  3EFR A;  2ZIM A;  4P72 C;  1L0W A;  2Q7H A;  1ASY A;  4P71 A;  1IL2 A;  4YPF A;  4YCW A;  1X2G A;  2ZTG A;  4YYE A;  4TVA B;  4O2D A;  2AKW B;  2DQ3 A;  2ZT8 A;  2ZR2 A;  1NJ5 A;  3PZC A;  4XU1 A;  4TVW A;  1BIA A;  1C0A A;  4K88 A;  4YP0 A;  1YFT A;  3RUX A;  4WJ4 A;  3HFZ A;  4OP0 A;  1KMN A;  3TEG A;  1B7Y A;  4XU3 A;  3IG2 A;  4UP8 A;  4WJ3 M;  2DKG A;  1VQZ A;  1W66 A;  3L1A A;  2ZZE A;  4BW9 A;  3UGT A;  4YRQ A;  3CMQ A;  3UH0 A;  4CH3 A;  4XEM A;  4OLF A;  3WQZ A;  2E1H A;  1G5H A;  1QE0 A;  3MF2 A;  4UP7 A;  4P71 C;  3UGQ A;  2AMC A;  3TUP A;  1H4T A;  3V8J A;  4P72 A;  1RIQ A;  1HXD A;  4EX5 A;  2ZZG A;  2Q5I A;  2CJ9 A;  4HWP A;  1HTT A;  4TQF A;  2Q5H A;  4CH5 A;  3EFS A;  4L87 A;  4YRG A;  1USY C;  4YRO A;  2RHS B;  2J3M A;  3VQW A;  1WYD A;  3M4P A;  3QO5 A;  2Q7E A;  2E41 A;  2QHV A;  3A7U A;  2I4M A;  2RHQ A;  2IY5 B;  3HXZ A;  1EIY B;  3G1Z A;  4YCU A;  2J3L A;  2DZC A;  3ERR A;  3HFV A;  4XTZ A;  3BJU A;  4KR2 A;  1G5I A;  4LVI A;  3E9H A;  5ELO A;  3L4G A;  1KMM A;  3IAL A;  1Z7N A;  3RGL A;  2QHS A;  4LVM A;  1G51 A;  4CH4 A;  1B70 B;  3P8V A;  3TEH B;  1WPY A;  1NJ6 A;  2DJZ A;  3RF1 A;  3PCO A;  3RKW A;  4X5O A;  4HA8 A;  3M4Q A;  4XEO A;  4RQE A;  4YRJ A;  2DVE A;  3BFM A;  3VBB A;  3HXV A;  1PYS B;  2E65 A;  2EJF A;  2Q7G A;  4XTW A;  1X01 A;  3MF1 A;  4CH6 A;  4YRK A;  4AH6 A;  1B8A A;  3NEM A;  2ZT5 A;  1QF6 A;  4LNS A;  2NS6 A;  1WQW A;  3QNE A;  1EVL A;  2ODR C;  3P8T A;  4TQD A;  2PMF A;  1H4V B;  3A31 A;  1USY A;  3HXY A;  3A32 A;  3HXW A;  2EL9 A;  2I4L A;  2P0L A;  1KOG A;  1BIB A;  1HC7 A;  3ICA A;  5ELN A;  3V8K A;  5K1P A;  2ZCE A;  2EJG A;  1X54 A;  1ADJ A;  3MEY A;  1B76 A;  1E1T A;  2I4N A;  3E9I A;  4TVA A;  2A8E A;  3RAC A;  3QO8 A;  2AKW A;  4LVL A;  2E10 A;  4P3N A;  3REX A;  4XTU A;  4XTX A;  4XTV A;  2CIM A;  4RDX A;  1YGB A;  3A74 A;  4ZTZ B;  1NJ1 A;  1N9W A;  2HNI A;  1SES A;  4ZIB A;  5C51 B;  2PME A;  4DQ2 A;  2ARS A;  3VQX A;  3IKL A;  3RIR A;  1X2H A;  5HGQ A;  4HWT A;  2DQ0 A;  1BBW A;  4K87 A;  1EOV A;  2ODR D;  4YRP A;  4CS4 A;  4YRC A;  4YRN A;  4UP9 A;  4TTV A;  1E22 A;  1Z7M A;  1JJC B;  3NEL A;  4DPG A;  4G84 A;  4ZTU B;  3L2Z A;  3HRI A;  4P73 A;  4E51 A;  1SER A;  1J5W A;  4YDQ A;  4H2S A;  3FJP A;  4RMF A;  2FYK A;  2ARU A;  4P3O A;  3HXU A;  4YRL A;  4Q15 A;  4YRF A;  3W3S A;  2RHS A;  4CS3 A;  4HWR A;  2DTO A;  4HT4 A;  3NEN A;  3HXX A;  2DTI A;  2ZR3 A;  1SRY A;  4HVC A;  2IY5 A;  3DSQ A;  4J15 A;  1EIY A;  1X56 A;  3A5Z A;  2ZXF A;  2ZT6 A;  4YRE A;  1H4Q A;  1X55 A;  1FYF A;  2DTH A;  4HWO A;  2G4C A;  5K1X A;  1E1O A;  2CGH A;  4KQE A;  4P3P A;  3VQY A;  2ALY B;  3REU A;  4H2U A;  4WF2 A;  2C7I A;  4CS2 A;  5KNN A;  1B70 A;  1NNH A;  2QHT A;  4H2T A;  3TEH A;  2I4O A;  2DXT A;  3LSQ A;  2E3C A;  3HFZ B;  4P73 C;  1B7Y B;  1EVK A;  1ATI A;  2DU7 A;  4H2X B;  1PYS A;  5C53 B;  3A7A A;  3IKM B;  2DEQ A;  12AS A;  4XTY A;  3V7S A;  3RKX A;  4PG3 A;  2ALY A;  3LC0 A;  2ZNI A;  4BWA A;  2ZNJ A;  4K86 A;  3LSS A;  11AS A;  1E24 A;  2QHU A;  1YB3 A;  4XU2 A;  2P5I A;  2ZZF A;  5F5W A;  3OD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...