2ODRD

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
Knots found
sequence length
663
structure length
451
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPEIYVYDGNVIGIPELKIDDIALKQIMSKNKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
total genus 112
structure length 451
sequence length 663
other databases KnotProt 2.0: Artifct S +31 +31
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
D PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.120 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2odrD03
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrD01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrD02
3M4PA 4TQDA 3A74A 1E1TA 5E3IA 4ZIBA 2IY5A 2ZR3A 1SRYA 1Z7MA 3QO8A 4G84A 2ODRC 1YB3A 4YRSA 2ZT6A 1BIAA 3TEHB 3HTZA 1WQ7A 2P0LA 3RKXA 1B70A 1NNHA 3VQWA 3P8TA 3L4GB 1H4SA 4XTUA 4XU1A 4YRIA 4P74A 2EAYA 4TWAA 2Q7EA 2C8MA 1PYSB 4YRFA 2FYKA 4CS2A 4Q6GA 1HC7A 3HXZA 1SESA 3VQXA 2EJ9A 4KR2A 2CIMA 2J3MA 5KNNA 3L4GA 2ODRD 2CJ9A 4WJ3M 2DXTA 2PMEA 1PYSA 3A7RA 2DTHA 2DKGA 4L87A 3A5ZA 4P3PA 4K88A 2ZIMA 3E9IA 1X56A 4P71A 2DU5A 3MF2A 1GGMA 2ZT7A 3VQYA 3L2ZA 3UFGA 1KMNA 1RIQA 3VBBA 4TVAB 2AMCB 4P72A 2QHUA 4TVWA 4ZTZB 1QF6A 4YRKA 3G1ZA 5F5WA 2Q7HA 2AKWA 1WYDA 3RF1A 3R07A 4P3NA 1G5HA 4XU0A 3HY1A 2AMCA 3RKWA 4OP0A 3V7CA 4J15A 4BWAA 3KFUA 2Q7GA 2I4MA 3NELA 3V7SA 1NJ6A 3REXA 3EFRA 2QHTA 3LSSA 3QO7A 11ASA 4K87A 3A5YA 4XTYA 1ADJA 2E5AA 3NEMA 4YRLA 4TTVA 4RQEA 3UGQA 2E41A 3DSQA 3RGLA 4UP8A 4P75A 2RHQB 3QO5A 4HWTA 1HTTA 2DXUA 3P8YA 4YRRA 3RUXA 2CJAA 2DQ3A 3HFVA 3HFZB 2C7IA 3HRKA 2RHQA 2ZGWA 1IL2A 2DDZA 2G4CA 1H4VB 1E24A 2PMFA 4YCVA 1X01A 1EVKA 4YRNA 3VQVA 3PZCA 4RMFA 1WPYA 2ZNJA 3HXWA 3RACA 4RQFA 4KR3A 2ZR2A 2E10A 1E1OA 4H02A 1BIBA 3V8KA 3HY0A 5HGQA 5ELNA 2Q5IA 3PCOB 4YRPA 12ASA 4YRJA 4CH4A 5K1PA 4WI1A 3TEHA 2ZXFA 3PCOA 1YFSA 4HWPA 3IKLA 3A32A 1WNLA 1BBWA 4YCWA 4OLFA 3A31A 2ZT5A 1B7YB 4HWRA 4TVYA 4YPFA 4E51A 4H2XB 1SERA 2ARTA 4YRQA 2RHSB 1ASZA 1NJ8A 4P3OA 2ALYB 4HVCA 1WLEA 4YP0A 4Q15A 4H2XA 4XTZA 2E65A 1JJCB 4UP9A 2ALYA 4NCXA 2DTOA 4TVAA 3CMQA 3HXVA 1H4TA 1JJCA 1Z7NA 3NENA 1QE0A 4YYEA 1YGBA 1G51A 2EJGA 2ZIOA 2DU7A 4UP7A 3HXUA 2E1HA 3QNEA 1EVLA 4P73C 3E9HA 2DVEA 3HRIA 1LYLA 4K86A 5C51B 2ZINA 2ZT8A 3LSQA 1FYFA 4PG3A 1NJ1A 2ZZGA 2E3CA 1EIYB 4AH6A 4O2DA 1X55A 1NJ2A 4ZTUB 3MEYA 2CGHA 4H2UA 3HXXA 2DJZA 3UH0A 2HNIA 1EIYA 1NYRA 2EL9A 4KQEA 2DZ9A 1EQRA 4HA8A 3REUA 3HFZA 3UGTA 5C53B 3BFMA 3TEGA 2DEQA 1USYC 2QHSA 3A7UA 1KOGA 2XGTA 3I7FA 4DQ2A 1B8AA 3ERRA 2CJBA 2ZZEA 3L1AA 4CS3A 4YCUA 1G5IA 1B76A 1WQWA 3IKMB 4YDQA 1B70B 3TUPA 4XU3A 4H2WA 3V7RA 3M4QA 2I4OA 2ZTGA 1N9WA 4LNSA 3RL6A 1BBUA 3V8JA 4X5OA 1W66A 4CH5A 3P8VA 4HWOA 2J3LA 1ADYA 2EJFA 4CH6A 3NETA 1YFTA 4YRGA 3IALA 3EFSA 2EWNA 4XEMA 3BJUA 1B7YA 2P5IA 1E22A 1C0AA 4UPAA 2RHSA 3QTCA 4P74C 1X2HA 3LC0A 2Q5HA 1YFRA 2I4LA 1HXDA 2ARSA 4XTXA 1NYQA 3MF1A 4P73A 2ZZFA 4WJ4A 2AKWB 2ZNIA 2XTIA 5K1XA 4TQFA 4H2YA 3WQZA 2E64A 4PHCA 4RDXA 2DTIA 1EFWA 4YRMA 1WU7A 3RIRA 4P71C 1KMMA 1H4QA 1J5WA 5C52B 1L0WA 4WF2A 3RKYA 3OD1A 2I4NA 3ICAA 1ATIA 4P72C 3W3SA 2DQ0A 4YREA 4H2TA 3FJPA 4H2VA 4EX5A 4BW9A 3V8LA 1USYA 4YRTA 1SETA 3A7AA 2ARUA 4XEOA 1X2GA 4XTVA 4G85A 1VQZA 4XU2A 4HWSA 4EO4A 4CS4A 3HXYA 4XTWA 2QHVA 4YROA 4CH3A 1NJ5A 5ELOA 4DPGA 2DZCA 1EOVA 4H2SA 1ASYA 4YRCA 1X54A 3IG2A 2IY5B 2ZCEA 4P75C
chains in the Genus database with same CATH superfamily
4R8OA 2EF8A 3MHSC 4DV0E 3BD1A 2UUBE 2PUEA 4JI8E 2YRKA 3TEHB 2UXDE 2PXVA 4X4IA 2P0LA 3IVPA 1NNHA 3B7HA 3KZZA 3P8TA 1H4SA 4YRIA 1KYQA 1PYSB 4F54A 2YTNA 2FYKA 1HC7A 1SESA 1IQOA 3VQXA 1NEIA 4KR2A 1OSLA 1UTXA 4HEIA 2GZUA 4BMJA 2PRTA 2DSYA 2PXTA 4Z5DA 4P3PA 3A5ZA 4K88A 5KL7A 4L8NA 2EMFA 4TVAB 2LYRA 1X49A 2QHUA 4TVWA 1A1FA 2A25A 2IVBA 4LVMA 2EZ6A 4DV2E 2A8EA 4Z5CA 2EPNA 2VE7C 4XU0A 2XXPA 1Y9QA 3KFUA 1NJ6A 4O4KA 3QO7A 1QQBA 2HCNA 4YRLA 1B0NA 2MQKA 3MSWA 2LBSB 3KZ3A 3FYAA 4DMIA 1ZZCA 3F6WA 4WX9A 1Y7YA 4BBYA 4M0VA 2DDZA 1PKPA 5A7LA 4RMFA 4O8BA 2WBTA 3HXWA 2V8QB 4KR3A 1Z1BA 4I8TA 4MLQA 2PUGA 5ELNA 4TUIA 2Q5IA 1T38A 1ZR9A 1X5WA 2O49A 3L1PA 2R1JL 2ZXFA 2IUOA 1WNLA 1BDHA 2EM8A 4NHRA 3SCHA 4OLFA 1LLMC 5KL6A 2ZT5A 4HWRA 2EQ1A 4E51A 4AQYE 3M99B 4P3OA 2ALYB 2DRPA 4TUGA 3G0TA 1CQTA 4H2XA 4XTZA 4OOGC 4PU8A 3VYYA 3GN5A 3PXPA 2DTOA 2RTXA 2IVQA 1IMUA 1H4TA 3LISA 5IV8B 2UXCE 1Z7NA 4IWRA 3PE5A 4YYEA 2NA2A 2CTDA 1ZBTA 2EJGA 2CT1A 4P73C 2HSGA 4B3TE 2V85A 2VQFE 4YBAA 1FYFA 5IT9C 2E3CA 4AH6A 4O2DA 2G7HA 1NJ2A 4O5GA 3OTOE 2O4AA 2LE2A 3MEYA 1QQAA 4LU9A 3VWSA 2PXKA 1HR0E 1X47A 2HNIA 2EL9A 3F52A 2EOJA 4DR1E 1EQRA 1QB2A 4DV4E 2BNOA 3REUA 2L49A 1QP7A 3GZDA 1T4LB 3H09A 5C53B 3BFMA 3TEGA 1N33E 4R2DA 4DV3E 2HFZA 4EK9A 1RZRA 3QYXA 4KWYA 3JXCL 1RMDA 4JI4E 1WQWA 2PE5A 1PNRA 2RS6A 4R2PA 4IS1C 3L00A 2NS6A 3TUPA 1TF6A 2AXVA 3V7RA 1HNZE 2ZTGA 4LTYA 1N9WA 1NW3A 4F8DA 1IC8A 4LNSA 1BBUA 3V8JA 1W66A 2I9IA 4GZNC 2J3LA 1ADYA 4CH6A 3NETA 4YRGA 3IALA 4X62E 1HNWE 2PUAA 2PXLA 5ADZA 2YTGA 2YT4A 2EM5A 3ADLA 2RHSA 3VYXA 2MKDA 2I4LA 2ARSA 4LF8E 2EOZA 3VK6A 2ICTA 1WHNA 5K98B 3MEJA 1N36E 4P73A 1QP0A 4O43A 4RHBB 2EL4A 2EN3A 2E64A 4RDXA 1JFSA 2DGCA 1EFWA 5DTMA 2J7UA 4YRMA 1WHQA 2V86A 1O4XA 3CECA 4DV7E 1JFTA 5C52B 4WF2A 4ER5A 3ICAA 1BB8A 2KPJA 1ATIA 4P72C 4JI7E 5A6KA 4BC9A 4B3RE 1SETA 3JAMC 4R2SA 4XEOA 1X2GA 2YTDA 3ME5A 4G85A 2JPAA 3J7Yp 4X65E 2PUDA 4MCTA 3ZOQB 3R09A 3KXAA 2EOIA 2JVAA 4BS9A 5LL6R 2KEJA 3OWQA 3HXYA 2FJRA 2KEIA 1EOVA 2XI8A 4H2SA 4X4EA 3OKZA 1ASYA 1XWRA 2L8NA 2NUFA 3FMYA 2Q8UA 2LYKA 2EMZA 3A74A 1E1TA 1RIOA 4EKIA 2EM7A 2LUPB 3ADIA 4R03A 1ZAYA 1UILA 2ODRC 1YB3A 3SR4A 1ZS4A 1QP4A 1B70A 3VQWA 3L4GB 4PU4C 4TWAA 3UFDA 2C8MA 4YRFA 3JTZA 2XXQA 3HXZA 3KZYA 5KNNA 2CJ9A 2EPRA 1WIZA 3J7AG 1X56A 2DU5A 1EH8A 1QU6A 3GN5B 2ZT7A 3VQYA 3L2ZA 1KMNA 2EORA 3FIGA 5AE1A 3VBBA 3U3WA 1JK1A 2CPNA 2AMCB 4P72A 3ECRA 4ZTZB 1QF6A 4JCXA 2AKWA 1XMOE 4DV5E 3R07A 3G5GA 3OQMA 3HY1A 3RKWA 4OP0A 3V7CA 5BR8E 3OMLA 3QOXA 5A2QC 2YTFA 3REXA 3MHHC 2M9AA 1YYKA 2J7WA 1U2ZA 2LYPA 2VF1A 4DR4E 4XTYA 1MFQC 1N34E 1ADJA 2BNMA 1X6FA 4RQEA 1EFAA 4DR7E 4JI6E 3UGQA 3QWGA 3DSQA 3RGLA 3HXLA 2RHQB 3QO5A 1LQCA 3P8YA 4YRRA 4ER0A 3RUXA 2CJAA 3HFVA 4F9AB 1T39A 3IWCA 4FBIA 2LLVA 4NZVA 2EN8A 2ZGWA 1DULA 2LTSA 2E1MA 2G4CA 2EN4A 2YSOA 2WBSA 4YCVA 4YRNA 3VQVA 3PZCA 1WPYA 2GRLA 1X2LA 2ZNJA 1G2FC 2ZR2A 1YUJA 2EMKA 3QQ6A 1FKAE 3HY0A 2LT7A 3PCOB 12ASA 4P78A 1X48A 4FN3A 4R2QA 1XNRE 2L33A 1TN9A 2ELYA 5A6BA 1DI2A 2PUCA 2KEKA 2JVLA 2PXQA 5LMUE 3LMLA 2IVGA 2YBDA 4X9JA 4TVYA 4R2RA 2NUEA 2ADRA 2EWLA 1SERA 4YRQA 2RHSB 1ASZA 3JU0A 4DR6E 3QG5C 2DLQA 4HVCA 1WLEA 3MLFA 4MLVA 4Q15A 4Q35B 5FLXC 1JJCB 2N3HA 5LLQA 3EUSA 2R76A 4GEQB 3OQOA 1UN6B 2PXFA 3QF3A 2EOQA 1GT0C 1R63A 2ZIOA 2V89A 1S7EA 2BNNA 3QNEA 2EOSA 2V83A 2L3JA 3P1XA 3VK0A 3E9HA 3TFLA 1OCTC 2DVEA 2PIJA 2RQLA 3LSQA 4MCXA 2YTQA 1HF0A 1QNTA 1X55A 1SR9A 3DNVB 1YPNA 3HXXA 3KWRA 3THNA 1N3GA 1EIYA 5DRYA 2DEQA 2HJJA 3LQXA 4X4HA 1P47A 2EMCA 2XGTA 2YU5A 4DQ2A 1STUA 2LNMA 2LCEA 1PRVA 3R1FA 3L1AA 3HTXA 4YCUA 1SFEA 3A9ZA 2AWIA 2B3TB 1G5IA 1B76A 2N3GA 4YDQA 3GZDC 1A1KA 1B70B 2UUAE 4ZYEA 1PJTA 4X5OA 4LF6E 2EM6A 2LYSA 2EJFA 4YHHE 3IWBA 4GKJE 4NXME 2JCGA 2LUQA 1JH9A 4XEMA 4R2CA 1NERA 1UBDC 2PUFA 1UHZA 2EBYA 4UPAA 4J1WA 4P74C 1X2HA 3LC0A 4DV1E 2N8XA 2LLWA 1NYQA 3A9YA 2ZZFA 4WJ4A 2AKWB 3J80C 2ZNIA 2FFHA 1WH8A 4H2YA 3WQZA 3NXHA 1HNXE 2I13A 2DTIA 3GZCA 3SCFA 4P71C 1G2DC 1KMMA 1X6HA 3RKYA 2I4NA 1ZUGA 2EE8A 4BHCA 2PXPA 3AUZA 2PXDA 2NABA 3W3SA 2EM9A 2DQ0A 4EX5A 3FJPA 2L2NA 2EPAA 1X6EA 2GHFA 1ZU1A 3V8LA 2ARUA 2EMHA 2VQEE 3ZHMA 2PXBA 2B9DA 1VQZA 2KZ8A 5AE3A 4XTWA 3IWDA 4LVJA 2JOBA 4DPGA 2DZCA 4BHBA 5JUWA 2CROA 4YRCA 4OB4A 4BC7A 4PU7A 4IJDA 3M4PA 1LMB3 3MQZA 2IY5A 2V87A 4WPYA 2ZR3A 1EH7A 1SRYA 1Z7MA 3QO8A 2EM3A 2ZT6A 4LF7E 3HTZA 2D5VA 1XMQE 3RKXA 4ER3A 2EMIA 5DTQA 1F2IG 2A6CA 4P74A 4I6RA 2Q7EA 1ZZ7A 4ER7A 2LYQA 4J1XA 4Q6GA 2EMBA 2HCSA 4K0KE 2EOXA 1HQ1A 2ODRD 4HRAA 2EOEA 3C4BA 1AAYA 1EKZA 1L1MA 1PYSA 3A7RA 2EPLX 4ZYHA 4Z5HA 1YZ9A 2JQEA 2JOXA 1ADRA 4L87A 2ZIMA 4P71A 3MF2A 2HGHA 3S8QA 5T6JA 2V3CC 4DUZE 3K6QA 1ZZ6A 2AXUA 1IBLE 3G1ZA 2R1FA 2XXAA 2EMGA 2Q7HA 1QZXA 1PDAA 2EL6A 3LLHA 4FK5C 2ENCA 1G5HA 4DUYE 1WJPA 4GKKE 1L4SA 5A6BD 2LJHA 3BIDA 4R2AA 4N4RB 2GPIA 3V7SA 1YSEA 4F9CB 3EFRA 2QHTA 3LSSA 3A5YA 2XIUA 3NEMA 1EH6A 5TSEA 2AW6A 1RQ0A 2E41A 4IA8A 2EN1A 2EPCA 2EJ4A 4HWTA 3DM5A 3O9XA 1IBKE 1UXCA 2MDRA 4OBMA 4LVIA 3HRKA 3EPLA 1X01A 1EVKA 3RACA 4LFBE 5HGQA 1QPZA 2H36X 2RSIA 2KOUA 3GBFA 1PRAA 4CH4A 5DT2A 2DMYA 2D9HA 4X8WA 2L2MA 1YFSA 4HWPA 4YCWA 1ZVVA 2FTXB 2EPPA 2YZTA 5KL3A 1WXRA 4H2XB 4LF5E 3OMTA 2EMXA 1YUIA 4YP0A 4LFCE 5DTRA 2EOYA 1A1HA 2DB2A 2E65A 3HPSA 4UP9A 2EPZA 2B7TA 2ALYA 3CROL 2EM0A 1BBGA 1RC7A 4WSGA 2BBGA 3THOB 4KZSA 1J5EE 2XCJA 3NENA 1YGBA 2PUBA 2E1HA 2EPMX 3NDBB 3F6GA 5AASA 2MEZA 1YYOA 3QOWA 2M1SA 4X4GA 1MGTA 4K86A 3TELA 1NEQA 5C51B 3EPKA 3ZPXA 1E3OC 1NJ1A 1LCDA 4LVKA 2LCVA 4WFTA 1NCSA 4P7DA 2K4VA 1MEYC 2PXUA 4ZTUB 2EOOA 4X4CA 2CGHA 2B5AA 4H2UA 4WYQB 3OP9A 2EQ3A 4EQZA 2VRDA 2DJZA 2CSHA 2LV2A 3UH0A 1NYRA 3HFZA 3JXBC 1USYC 2QHSA 3A7UA 2O38A 1A1GA 1J26A 2ZZEA 1DGCA 1ZZBA 4CS3A 1BDIA 2EPXA 2KHXA 2YSPA 3BBGA 4F6MA 4X4DA 1KJKA 2DIXA 4XU3A 2EN6A 2MDGA 4H2WA 5A6JA 3M4QA 2I4OA 4JI0E 4GHJA 2EOHA 3C4TA 2MC6A 1IBME 4DR2E 4HWOA 2E5LE 1WH6A 4ER6A 3T1HE 1YFTA 2OFYA 3ZHIA 2B7VA 4KHPE 4JI5E 4R2EA 3BJUA 1DQ3A 5A69A 1B7YA 2P5IA 4EKGA 4X64E 1E22A 1RZRD 1C0AA 2RS7A 3BGHA 3QTCA 3OQNA 3CLCA 4XTXA 4DV6E 1A1JA 1X3CA 4GQMA 2F4VE 4JCYA 5K1XA 4TQFA 3F51A 2PXEA 4PHCA 4Z59A 4DR3E 3DJWA 2RSMA 4JI3E 2CSFA 3LFPA 1AU7A 1H4QA 2WCC3 4F6NA 1J5WA 4OX9E 2EMYA 2WUSR 3J81C 3NROA 2IU7A 4JI1E 4H2TA 3AV0A 2NUGA 1USYA 4YRTA 2GRMA 3A7AA 2EMAA 2EL5A 2LJUA 3QFIA 2F8BA 4WSPA 3TRBA 3EPHA 4XU2A 5IXMB 4JYAE 2EM4A 2QHVA 4I6UA 2KONA 3ADJA 4YROA 4CH3A 3EQ1A 1CJGA 2HC5A 3IG2A 2LYLA 3T1YE 5LMNE 4P75C 1IQSA 5AC4A 3JXDL 4TQDA 2LYJA 2L8TA 4B3ME 5E3IA 3BS3A 4ZIBA 5KL4A 3VHTB 2L6MA 1TF3A 4G84A 4LFAE 4YRSA 2V88A 2WBUA 1BIAA 3HZIB 1WQ7A 2E72A 4XTUA 4XU1A 2EAYA 2BJCA 5F3WA 4CS2A 4Y42A 3TQMA 2JR1A 2EJ9A 2CIMA 2J3MA 2MXDA 3L4GA 2LO3A 4WJ3M 2BB8A 2EOFA 5KL2A 2DXTA 1JWLA 2PMEA 2EPUA 2DTHA 4M9VC 2DKGA 3HPZA 3E9IA 2YPNA 1R69A 1GGMA 3UFGA 2YWQA 4YARA 1RIQA 3HQ1A 4YG4A 4YRKA 2JWOA 5F5WA 5AE2A 4YY3E 2JYAA 1WYDA 3RF1A 1DWKA 4LF9E 4P3NA 2DMIA 1B69A 3EPJA 2AMCA 4F9BB 4J15A 1WETA 4BWAA 2Q7GA 2I4MA 2R63A 3NELA 4LVLA 11ASA 2EN2A 4K87A 2ENAA 1AH5A 2IV1A 2UXBE 2E5AA 3ADGA 4TTVA 1UXDA 4DE8A 2JXPA 4O24A 4EZIA 4UP8A 4P75A 2ICPA 1HTTA 2DXUA 2YTJA 1PJSA 2DQ3A 3HFZB 2C7IA 2M4IA 1SQ8A 3H5TA 4B3SE 3BDNA 2YRMA 2RHQA 3KJXA 1IL2A 3TEPA 1YFHA 1H4VB 2L92A 4HTGA 1E24A 2EQ0A 5GAHi 2PMFA 2WZOA 3M9LA 3F6HA 1XNQE 4RQFA 2ELZA 2E10A 4I6TA 1LLIA 1BIBA 1E1OA 4H02A 3V8KA 3A9XA 2LMZA 2EPKX 2FGGA 4YRPA 5GAGi 4NDWA 2YTIA 4YRJA 2YTPA 5K1PA 1VPWA 4LF4E 1ZZ8A 4WI1A 2LVHA 3TEHA 4JI2E 3PCOA 1YSAC 3IKLA 3A32A 2VEOA 1BBWA 3KL4A 3A31A 3BF2A 1B7YB 5AC5A 2UUCE 4YPFA 2K7IA 2LRSA 2ARTA 2EM2A 2YTOA 4J8ZA 1NJ8A 3UWPA 4F2JC 4I8OA 3FYMA 3C6MA 4WVLA 4PU3C 4NCXA 4JV5E 2EMLA 4TVAA 2EWTA 3CMQA 1GZ6A 3HXVA 2EOMA 1T4OA 4DE9A 1JJCA 2FV4B 4Q28A 1QE0A 1G51A 2DU7A 4UP7A 3HXUA 1GTKA 4RH8A 4L5NC 3SCGA 1EVLA 2XSDC 5IWAE 2HINA 4BCAA 4X4FA 5DSXA 1I94E 2AUWA 3HRIA 5KL5A 2L1PA 1LYLA 2UU9E 2L3CA 4Z58A 2ZINA 2ZT8A 2M4HA 4PG3A 2ZZGA 1EIYB 5DNYA 4ZYDA 3D1NI 4Q2JA 4M2ZA 2MKNA 2YU8A 4KQEA 2DZ9A 2J7JA 3G7DA 2EP3A 1A1LA 4HA8A 1GQEA 3UGTA 1A1IA 4WXDA 1PERL 3SX0A 1KOGA 1PJQA 3I7FA 1B8AA 3DF6A 3ERRA 2CJBA 1POUA 1PRUA 4ZYGA 1N32E 2AXZA 3IKMB 1RPEL 2HHHE 1T4NA 2ZM6E 3UK3C 3ZKCA 3RMPA 2XJ3A 4JQDA 2YTEA 2EPOA 3RL6A 1X57A 5CFFE 2IHR1 4CH5A 3P8VA 1WRJA 4DKKA 5A6AA 2RPCA 4IVZA 3NZLA 3EFSA 1LCCA 1O0WA 1BBOA 2EWNA 2JP9A 2H8RA 1ZBQA 4NXNE 4WXCA 4YG7B 2MC5A 2JY9A 2GLIA 2Q5HA 1YFRA 1HXDA 3MF1A 4DR5E 1JK2A 2XTIA 1FJGE 2ENHA 1WU7A 3RIRA 1L0WA 3OD1A 4X66E 2M7QA 1ZPQA 2WIUB 1YYWA 4YG1A 2EMWA 1DW9A 4YREA 1ZZ9A 2L2KB 4H2VA 4BW9A 5DRTA 2DLKA 2YRHA 4X4BA 4XTVA 4M30A 3C6KA 4HWSA 4EO4A 2EN7A 4CS4A 3GUUA 2OR1L 4HT4A 1NJ5A 1ZAAC 5ELOA 2PPXA 1X54A 2IY5B 3RZZA 2ZCEA 2LTRA 1RZSA
chains in the Genus database with same CATH topology
3M4PA 4TQDA 4R8OA 3MQZA 3A74A 1E1TA 2L8TA 4B3ME 4EKIA 4DV0E 5E3IA 4ZIBA 2IY5A 2V87A 4WPYA 2UUBE 2ZR3A 2L6MA 2LUPB 1SRYA 1Z7MA 3QO8A 3ADIA 4R03A 4G84A 1UILA 2ODRC 4LFAE 1YB3A 4JI8E 4YRSA 2ZT6A 2V88A 4LF7E 3SR4A 1BIAA 3HTZA 3TEHB 2UXDE 1XMQE 1WQ7A 2P0LA 3RKXA 1B70A 4ER3A 1NNHA 3VQWA 5DTQA 3P8TA 3L4GB 1H4SA 4XTUA 4XU1A 4YRIA 4P74A 2EAYA 4TWAA 5F3WA 2Q7EA 2C8MA 1PYSB 4F54A 4YRFA 4ER7A 2FYKA 4CS2A 3JTZA 4Q6GA 2XXQA 1HC7A 3HXZA 1SESA 2HCSA 3VQXA 4K0KE 2JR1A 2EJ9A 4KR2A 2CIMA 2J3MA 5KNNA 2MXDA 3L4GA 2ODRD 4HRAA 2CJ9A 4WJ3M 3C4BA 1EKZA 2DXTA 2PMEA 1PYSA 3A7RA 3J7AG 4BMJA 2DTHA 2DSYA 2DKGA 1YZ9A 2JOXA 4L87A 3A5ZA 4P3PA 4K88A 3HPZA 2ZIMA 3E9IA 1X56A 4P71A 2DU5A 1QU6A 1GGMA 3MF2A 2ZT7A 3VQYA 3L2ZA 3UFGA 1KMNA 5T6JA 3FIGA 4L8NA 5AE1A 4DUZE 3K6QA 1RIQA 3VBBA 4TVAB 3HQ1A 2CPNA 2AMCB 1X49A 4P72A 2QHUA 4TVWA 1IBLE 4ZTZB 1QF6A 4YRKA 2JWOA 3G1ZA 5F5WA 4LVMA 2EZ6A 5AE2A 2Q7HA 4YY3E 4DV2E 2AKWA 1WYDA 3RF1A 1XMOE 4DV5E 2A8EA 3R07A 4LF9E 2VE7C 3LLHA 4P3NA 1G5HA 4XU0A 2XXPA 3HY1A 4DUYE 4GKKE 2AMCA 2LJHA 3RKWA 4F9BB 4OP0A 3V7CA 4J15A 5BR8E 4BWAA 3OMLA 3KFUA 3QOXA 2Q7GA 2I4MA 3NELA 4LVLA 5A2QC 3V7SA 1NJ6A 3REXA 4F9CB 3EFRA 2QHTA 3LSSA 3QO7A 11ASA 1YYKA 2J7WA 4K87A 1U2ZA 3A5YA 2VF1A 4DR4E 4XTYA 1N34E 2HCNA 1ADJA 2UXBE 2E5AA 3NEMA 4YRLA 3ADGA 4TTVA 4RQEA 3MSWA 2LBSB 4DE8A 4DR7E 4JI6E 4EZIA 3UGQA 1RQ0A 4DMIA 2E41A 3DSQA 3RGLA 4UP8A 3HXLA 4P75A 2RHQB 3QO5A 4HWTA 1HTTA 2DXUA 3P8YA 4YRRA 4ER0A 1IBKE 3RUXA 2CJAA 2DQ3A 4F9AB 3HFVA 2C7IA 2M4IA 3HFZB 2MDRA 4BBYA 4OBMA 3IWCA 4LVIA 4B3SE 3HRKA 2LLVA 2RHQA 2ZGWA 2LTSA 2E1MA 4M0VA 1IL2A 2DDZA 3TEPA 1PKPA 2G4CA 1H4VB 2L92A 1E24A 2PMFA 4YCVA 2WZOA 1X01A 1EVKA 4YRNA 3VQVA 3PZCA 4RMFA 1WPYA 3M9LA 3F6HA 2ZNJA 1XNQE 2V8QB 3HXWA 3RACA 4RQFA 4KR3A 2ZR2A 2E10A 1E1OA 4H02A 1BIBA 1FKAE 3V8KA 4LFBE 3HY0A 5HGQA 3A9XA 5ELNA 4TUIA 2LMZA 2Q5IA 2FGGA 2H36X 3PCOB 4YRPA 2KOUA 12ASA 4P78A 1X48A 4YRJA 4CH4A 5DT2A 2DMYA 5K1PA 4LF4E 1XNRE 2L33A 4WI1A 3TEHA 2ZXFA 4JI2E 4X8WA 1DI2A 3PCOA 2L2MA 1YFSA 4HWPA 5LMUE 3IKLA 3A32A 1WNLA 2VEOA 1BBWA 4YCWA 3LMLA 4OLFA 3A31A 2YBDA 2FTXB 1B7YB 2ZT5A 2YZTA 4HWRA 2UUCE 4TVYA 2LRSA 4YPFA 4E51A 2NUEA 1WXRA 2EWLA 4H2XB 1SERA 4AQYE 2ARTA 4YRQA 2RHSB 1ASZA 4J8ZA 3JU0A 4DR6E 4LF5E 1NJ8A 3UWPA 4P3OA 2ALYB 4HVCA 1WLEA 4I8OA 4TUGA 3G0TA 4YP0A 4LFCE 5DTRA 4Q15A 4H2XA 2DB2A 5FLXC 4WVLA 4XTZA 4OOGC 2E65A 1JJCB 3HPSA 3VYYA 2N3HA 4UP9A 2B7TA 2ALYA 4NCXA 4JV5E 2DTOA 2RTXA 4TVAA 3CMQA 1GZ6A 4GEQB 3HXVA 1RC7A 1H4TA 1T4OA 4DE9A 1JJCA 4KZSA 2FV4B 1J5EE 2UXCE 1Z7NA 4Q28A 3PE5A 3NENA 1QE0A 4YYEA 1YGBA 2NA2A 1G51A 1ZBTA 2V89A 2EJGA 2ZIOA 2DU7A 4UP7A 3HXUA 2E1HA 3QNEA 4L5NC 3F6GA 1EVLA 5AASA 4P73C 4B3TE 2V85A 2V83A 5IWAE 2VQFE 2L3JA 1YYOA 3P1XA 3E9HA 3QOWA 2M1SA 3TFLA 5DSXA 4BCAA 1I94E 2DVEA 3HRIA 2L1PA 1LYLA 4K86A 2UU9E 2L3CA 3TELA 5C51B 2ZINA 2ZT8A 2M4HA 3ZPXA 3LSQA 1FYFA 4PG3A 5IT9C 1NJ1A 2ZZGA 4LVKA 2E3CA 1EIYB 4AH6A 4WFTA 4O2DA 2G7HA 1X55A 4P7DA 2K4VA 1SR9A 1NJ2A 3OTOE 5DNYA 4ZTUB 2LE2A 3MEYA 2CGHA 4H2UA 4WYQB 3HXXA 4Q2JA 3KWRA 4EQZA 4LU9A 1HR0E 3VWSA 4M2ZA 2DJZA 1X47A 2HNIA 3UH0A 1EIYA 1NYRA 2EL9A 4KQEA 4DR1E 2DZ9A 1EQRA 4DV4E 4HA8A 3REUA 5DRYA 3HFZA 3GZDA 1GQEA 3UGTA 1T4LB 3H09A 5C53B 3BFMA 3TEGA 2DEQA 3SX0A 1USYC 2QHSA 3A7UA 1KOGA 2XGTA 3I7FA 4DQ2A 1STUA 1B8AA 1N33E 2LNMA 1J26A 4DV3E 3DF6A 3ERRA 2HFZA 4EK9A 2CJBA 2ZZEA 3L1AA 4CS3A 3HTXA 4YCUA 2KHXA 3A9ZA 1N32E 2B3TB 1G5IA 1B76A 4JI4E 2N3GA 1WQWA 3IKMB 4YDQA 3GZDC 2HHHE 2RS6A 1B70B 1T4NA 2UUAE 2ZM6E 2NS6A 2DIXA 4XU3A 3TUPA 3RMPA 4H2WA 3V7RA 3M4QA 2I4OA 1HNZE 4JI0E 2ZTGA 4LTYA 1N9WA 1NW3A 4LNSA 3RL6A 1BBUA 3V8JA 4X5OA 5CFFE 2IHR1 4LF6E 3C4TA 2MC6A 1IBME 1W66A 4CH5A 4DR2E 3P8VA 4HWOA 2J3LA 4DKKA 1ADYA 2EJFA 2E5LE 4ER6A 4YHHE 4CH6A 3NETA 3T1HE 3IWBA 1YFTA 4YRGA 3NZLA 4GKJE 3IALA 4NXME 2B7VA 3EFSA 4KHPE 1O0WA 2LUQA 4JI5E 4X62E 1HNWE 2EWNA 4XEMA 3BJUA 1DQ3A 1ZBQA 4NXNE 1B7YA 2P5IA 5ADZA 4EKGA 4X64E 1E22A 2YT4A 2MC5A 1UHZA 1C0AA 4UPAA 2JY9A 2RS7A 3ADLA 2RHSA 3QTCA 4P74C 1X2HA 3LC0A 4DV1E 3VYXA 2Q5HA 1YFRA 2I4LA 1HXDA 2ARSA 2LLWA 4LF8E 4XTXA 4DV6E 1NYQA 3A9YA 3VK6A 3MF1A 1WHNA 4DR5E 3MEJA 1N36E 4P73A 2ZZFA 4WJ4A 2AKWB 3J80C 2F4VE 2ZNIA 2XTIA 5K1XA 4TQFA 4H2YA 3WQZA 3NXHA 1HNXE 1FJGE 2E64A 4PHCA 4RDXA 2DTIA 4DR3E 3GZCA 5DTMA 3DJWA 1EFWA 2RSMA 2J7UA 4YRMA 4JI3E 1WU7A 3RIRA 4P71C 1WHQA 1KMMA 2V86A 1H4QA 4DV7E 1J5WA 5C52B 1L0WA 4OX9E 4WF2A 3RKYA 3OD1A 4ER5A 2I4NA 3ICAA 4X66E 1ATIA 4P72C 2M7QA 4JI7E 1YYWA 3J81C 3NROA 3AUZA 3W3SA 2DQ0A 4YREA 2L2KB 4JI1E 2L2NA 3FJPA 4H2VA 4H2TA 3AV0A 4BC9A 4BW9A 4EX5A 4B3RE 3V8LA 2NUGA 1USYA 4YRTA 1SETA 3JAMC 5DRTA 3A7AA 2ARUA 2VQEE 4XEOA 1X2GA 4XTVA 3ME5A 3QFIA 4G85A 2F8BA 4M30A 4WSPA 2B9DA 3J7Yp 4X65E 1VQZA 4XU2A 4HWSA 4EO4A 3ZOQB 3R09A 4BS9A 5AE3A 2JVAA 4CS4A 5LL6R 4JYAE 3GUUA 3OWQA 3HXYA 4XTWA 3IWDA 2QHVA 4HT4A 2KONA 3ADJA 4YROA 4LVJA 4CH3A 2JOBA 1NJ5A 5ELOA 4DPGA 2DZCA 1EOVA 4H2SA 5JUWA 3OKZA 1ASYA 2NUFA 4YRCA 1X54A 3IG2A 2IY5B 4BC7A 2ZCEA 2LTRA 3T1YE 5LMNE 4P75C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4P A;  4TQD A;  3A74 A;  1E1T A;  5E3I A;  4ZIB A;  2IY5 A;  2ZR3 A;  1SRY A;  1Z7M A;  3QO8 A;  4G84 A;  2ODR C;  1YB3 A;  4YRS A;  2ZT6 A;  1BIA A;  3TEH B;  3HTZ A;  1WQ7 A;  2P0L A;  3RKX A;  1B70 A;  1NNH A;  3VQW A;  3P8T A;  3L4G B;  1H4S A;  4XTU A;  4XU1 A;  4YRI A;  4P74 A;  2EAY A;  4TWA A;  2Q7E A;  2C8M A;  1PYS B;  4YRF A;  2FYK A;  4CS2 A;  4Q6G A;  1HC7 A;  3HXZ A;  1SES A;  3VQX A;  2EJ9 A;  4KR2 A;  2CIM A;  2J3M A;  5KNN A;  3L4G A;  2ODR D;  2CJ9 A;  4WJ3 M;  2DXT A;  2PME A;  1PYS A;  3A7R A;  2DTH A;  2DKG A;  4L87 A;  3A5Z A;  4P3P A;  4K88 A;  2ZIM A;  3E9I A;  1X56 A;  4P71 A;  2DU5 A;  3MF2 A;  1GGM A;  2ZT7 A;  3VQY A;  3L2Z A;  3UFG A;  1KMN A;  1RIQ A;  3VBB A;  4TVA B;  2AMC B;  4P72 A;  2QHU A;  4TVW A;  4ZTZ B;  1QF6 A;  4YRK A;  3G1Z A;  5F5W A;  2Q7H A;  2AKW A;  1WYD A;  3RF1 A;  3R07 A;  4P3N A;  1G5H A;  4XU0 A;  3HY1 A;  2AMC A;  3RKW A;  4OP0 A;  3V7C A;  4J15 A;  4BWA A;  3KFU A;  2Q7G A;  2I4M A;  3NEL A;  3V7S A;  1NJ6 A;  3REX A;  3EFR A;  2QHT A;  3LSS A;  3QO7 A;  11AS A;  4K87 A;  3A5Y A;  4XTY A;  1ADJ A;  2E5A A;  3NEM A;  4YRL A;  4TTV A;  4RQE A;  3UGQ A;  2E41 A;  3DSQ A;  3RGL A;  4UP8 A;  4P75 A;  2RHQ B;  3QO5 A;  4HWT A;  1HTT A;  2DXU A;  3P8Y A;  4YRR A;  3RUX A;  2CJA A;  2DQ3 A;  3HFV A;  3HFZ B;  2C7I A;  3HRK A;  2RHQ A;  2ZGW A;  1IL2 A;  2DDZ A;  2G4C A;  1H4V B;  1E24 A;  2PMF A;  4YCV A;  1X01 A;  1EVK A;  4YRN A;  3VQV A;  3PZC A;  4RMF A;  1WPY A;  2ZNJ A;  3HXW A;  3RAC A;  4RQF A;  4KR3 A;  2ZR2 A;  2E10 A;  1E1O A;  4H02 A;  1BIB A;  3V8K A;  3HY0 A;  5HGQ A;  5ELN A;  2Q5I A;  3PCO B;  4YRP A;  12AS A;  4YRJ A;  4CH4 A;  5K1P A;  4WI1 A;  3TEH A;  2ZXF A;  3PCO A;  1YFS A;  4HWP A;  3IKL A;  3A32 A;  1WNL A;  1BBW A;  4YCW A;  4OLF A;  3A31 A;  2ZT5 A;  1B7Y B;  4HWR A;  4TVY A;  4YPF A;  4E51 A;  4H2X B;  1SER A;  2ART A;  4YRQ A;  2RHS B;  1ASZ A;  1NJ8 A;  4P3O A;  2ALY B;  4HVC A;  1WLE A;  4YP0 A;  4Q15 A;  4H2X A;  4XTZ A;  2E65 A;  1JJC B;  4UP9 A;  2ALY A;  4NCX A;  2DTO A;  4TVA A;  3CMQ A;  3HXV A;  1H4T A;  1JJC A;  1Z7N A;  3NEN A;  1QE0 A;  4YYE A;  1YGB A;  1G51 A;  2EJG A;  2ZIO A;  2DU7 A;  4UP7 A;  3HXU A;  2E1H A;  3QNE A;  1EVL A;  4P73 C;  3E9H A;  2DVE A;  3HRI A;  1LYL A;  4K86 A;  5C51 B;  2ZIN A;  2ZT8 A;  3LSQ A;  1FYF A;  4PG3 A;  1NJ1 A;  2ZZG A;  2E3C A;  1EIY B;  4AH6 A;  4O2D A;  1X55 A;  1NJ2 A;  4ZTU B;  3MEY A;  2CGH A;  4H2U A;  3HXX A;  2DJZ A;  3UH0 A;  2HNI A;  1EIY A;  1NYR A;  2EL9 A;  4KQE A;  2DZ9 A;  1EQR A;  4HA8 A;  3REU A;  3HFZ A;  3UGT A;  5C53 B;  3BFM A;  3TEG A;  2DEQ A;  1USY C;  2QHS A;  3A7U A;  1KOG A;  2XGT A;  3I7F A;  4DQ2 A;  1B8A A;  3ERR A;  2CJB A;  2ZZE A;  3L1A A;  4CS3 A;  4YCU A;  1G5I A;  1B76 A;  1WQW A;  3IKM B;  4YDQ A;  1B70 B;  3TUP A;  4XU3 A;  4H2W A;  3V7R A;  3M4Q A;  2I4O A;  2ZTG A;  1N9W A;  4LNS A;  3RL6 A;  1BBU A;  3V8J A;  4X5O A;  1W66 A;  4CH5 A;  3P8V A;  4HWO A;  2J3L A;  1ADY A;  2EJF A;  4CH6 A;  3NET A;  1YFT A;  4YRG A;  3IAL A;  3EFS A;  2EWN A;  4XEM A;  3BJU A;  1B7Y A;  2P5I A;  1E22 A;  1C0A A;  4UPA A;  2RHS A;  3QTC A;  4P74 C;  1X2H A;  3LC0 A;  2Q5H A;  1YFR A;  2I4L A;  1HXD A;  2ARS A;  4XTX A;  1NYQ A;  3MF1 A;  4P73 A;  2ZZF A;  4WJ4 A;  2AKW B;  2ZNI A;  2XTI A;  5K1X A;  4TQF A;  4H2Y A;  3WQZ A;  2E64 A;  4PHC A;  4RDX A;  2DTI A;  1EFW A;  4YRM A;  1WU7 A;  3RIR A;  4P71 C;  1KMM A;  1H4Q A;  1J5W A;  5C52 B;  1L0W A;  4WF2 A;  3RKY A;  3OD1 A;  2I4N A;  3ICA A;  1ATI A;  4P72 C;  3W3S A;  2DQ0 A;  4YRE A;  4H2T A;  3FJP A;  4H2V A;  4EX5 A;  4BW9 A;  3V8L A;  1USY A;  4YRT A;  1SET A;  3A7A A;  2ARU A;  4XEO A;  1X2G A;  4XTV A;  4G85 A;  1VQZ A;  4XU2 A;  4HWS A;  4EO4 A;  4CS4 A;  3HXY A;  4XTW A;  2QHV A;  4YRO A;  4CH3 A;  1NJ5 A;  5ELO A;  4DPG A;  2DZC A;  1EOV A;  4H2S A;  1ASY A;  4YRC A;  1X54 A;  3IG2 A;  2IY5 B;  2ZCE A;  4P75 C; 
#chains in the Genus database with same CATH topology
 4R8O A;  2EF8 A;  3MHS C;  4DV0 E;  3BD1 A;  2UUB E;  2PUE A;  4JI8 E;  2YRK A;  3TEH B;  2UXD E;  2PXV A;  4X4I A;  2P0L A;  3IVP A;  1NNH A;  3B7H A;  3KZZ A;  3P8T A;  1H4S A;  4YRI A;  1KYQ A;  1PYS B;  4F54 A;  2YTN A;  2FYK A;  1HC7 A;  1SES A;  1IQO A;  3VQX A;  1NEI A;  4KR2 A;  1OSL A;  1UTX A;  4HEI A;  2GZU A;  4BMJ A;  2PRT A;  2DSY A;  2PXT A;  4Z5D A;  4P3P A;  3A5Z A;  4K88 A;  5KL7 A;  4L8N A;  2EMF A;  4TVA B;  2LYR A;  1X49 A;  2QHU A;  4TVW A;  1A1F A;  2A25 A;  2IVB A;  4LVM A;  2EZ6 A;  4DV2 E;  2A8E A;  4Z5C A;  2EPN A;  2VE7 C;  4XU0 A;  2XXP A;  1Y9Q A;  3KFU A;  1NJ6 A;  4O4K A;  3QO7 A;  1QQB A;  2HCN A;  4YRL A;  1B0N A;  2MQK A;  3MSW A;  2LBS B;  3KZ3 A;  3FYA A;  4DMI A;  1ZZC A;  3F6W A;  4WX9 A;  1Y7Y A;  4BBY A;  4M0V A;  2DDZ A;  1PKP A;  5A7L A;  4RMF A;  4O8B A;  2WBT A;  3HXW A;  2V8Q B;  4KR3 A;  1Z1B A;  4I8T A;  4MLQ A;  2PUG A;  5ELN A;  4TUI A;  2Q5I A;  1T38 A;  1ZR9 A;  1X5W A;  2O49 A;  3L1P A;  2R1J L;  2ZXF A;  2IUO A;  1WNL A;  1BDH A;  2EM8 A;  4NHR A;  3SCH A;  4OLF A;  1LLM C;  5KL6 A;  2ZT5 A;  4HWR A;  2EQ1 A;  4E51 A;  4AQY E;  3M99 B;  4P3O A;  2ALY B;  2DRP A;  4TUG A;  3G0T A;  1CQT A;  4H2X A;  4XTZ A;  4OOG C;  4PU8 A;  3VYY A;  3GN5 A;  3PXP A;  2DTO A;  2RTX A;  2IVQ A;  1IMU A;  1H4T A;  3LIS A;  5IV8 B;  2UXC E;  1Z7N A;  4IWR A;  3PE5 A;  4YYE A;  2NA2 A;  2CTD A;  1ZBT A;  2EJG A;  2CT1 A;  4P73 C;  2HSG A;  4B3T E;  2V85 A;  2VQF E;  4YBA A;  1FYF A;  5IT9 C;  2E3C A;  4AH6 A;  4O2D A;  2G7H A;  1NJ2 A;  4O5G A;  3OTO E;  2O4A A;  2LE2 A;  3MEY A;  1QQA A;  4LU9 A;  3VWS A;  2PXK A;  1HR0 E;  1X47 A;  2HNI A;  2EL9 A;  3F52 A;  2EOJ A;  4DR1 E;  1EQR A;  1QB2 A;  4DV4 E;  2BNO A;  3REU A;  2L49 A;  1QP7 A;  3GZD A;  1T4L B;  3H09 A;  5C53 B;  3BFM A;  3TEG A;  1N33 E;  4R2D A;  4DV3 E;  2HFZ A;  4EK9 A;  1RZR A;  3QYX A;  4KWY A;  3JXC L;  1RMD A;  4JI4 E;  1WQW A;  2PE5 A;  1PNR A;  2RS6 A;  4R2P A;  4IS1 C;  3L00 A;  2NS6 A;  3TUP A;  1TF6 A;  2AXV A;  3V7R A;  1HNZ E;  2ZTG A;  4LTY A;  1N9W A;  1NW3 A;  4F8D A;  1IC8 A;  4LNS A;  1BBU A;  3V8J A;  1W66 A;  2I9I A;  4GZN C;  2J3L A;  1ADY A;  4CH6 A;  3NET A;  4YRG A;  3IAL A;  4X62 E;  1HNW E;  2PUA A;  2PXL A;  5ADZ A;  2YTG A;  2YT4 A;  2EM5 A;  3ADL A;  2RHS A;  3VYX A;  2MKD A;  2I4L A;  2ARS A;  4LF8 E;  2EOZ A;  3VK6 A;  2ICT A;  1WHN A;  5K98 B;  3MEJ A;  1N36 E;  4P73 A;  1QP0 A;  4O43 A;  4RHB B;  2EL4 A;  2EN3 A;  2E64 A;  4RDX A;  1JFS A;  2DGC A;  1EFW A;  5DTM A;  2J7U A;  4YRM A;  1WHQ A;  2V86 A;  1O4X A;  3CEC A;  4DV7 E;  1JFT A;  5C52 B;  4WF2 A;  4ER5 A;  3ICA A;  1BB8 A;  2KPJ A;  1ATI A;  4P72 C;  4JI7 E;  5A6K A;  4BC9 A;  4B3R E;  1SET A;  3JAM C;  4R2S A;  4XEO A;  1X2G A;  2YTD A;  3ME5 A;  4G85 A;  2JPA A;  3J7Y p;  4X65 E;  2PUD A;  4MCT A;  3ZOQ B;  3R09 A;  3KXA A;  2EOI A;  2JVA A;  4BS9 A;  5LL6 R;  2KEJ A;  3OWQ A;  3HXY A;  2FJR A;  2KEI A;  1EOV A;  2XI8 A;  4H2S A;  4X4E A;  3OKZ A;  1ASY A;  1XWR A;  2L8N A;  2NUF A;  3FMY A;  2Q8U A;  2LYK A;  2EMZ A;  3A74 A;  1E1T A;  1RIO A;  4EKI A;  2EM7 A;  2LUP B;  3ADI A;  4R03 A;  1ZAY A;  1UIL A;  2ODR C;  1YB3 A;  3SR4 A;  1ZS4 A;  1QP4 A;  1B70 A;  3VQW A;  3L4G B;  4PU4 C;  4TWA A;  3UFD A;  2C8M A;  4YRF A;  3JTZ A;  2XXQ A;  3HXZ A;  3KZY A;  5KNN A;  2CJ9 A;  2EPR A;  1WIZ A;  3J7A G;  1X56 A;  2DU5 A;  1EH8 A;  1QU6 A;  3GN5 B;  2ZT7 A;  3VQY A;  3L2Z A;  1KMN A;  2EOR A;  3FIG A;  5AE1 A;  3VBB A;  3U3W A;  1JK1 A;  2CPN A;  2AMC B;  4P72 A;  3ECR A;  4ZTZ B;  1QF6 A;  4JCX A;  2AKW A;  1XMO E;  4DV5 E;  3R07 A;  3G5G A;  3OQM A;  3HY1 A;  3RKW A;  4OP0 A;  3V7C A;  5BR8 E;  3OML A;  3QOX A;  5A2Q C;  2YTF A;  3REX A;  3MHH C;  2M9A A;  1YYK A;  2J7W A;  1U2Z A;  2LYP A;  2VF1 A;  4DR4 E;  4XTY A;  1MFQ C;  1N34 E;  1ADJ A;  2BNM A;  1X6F A;  4RQE A;  1EFA A;  4DR7 E;  4JI6 E;  3UGQ A;  3QWG A;  3DSQ A;  3RGL A;  3HXL A;  2RHQ B;  3QO5 A;  1LQC A;  3P8Y A;  4YRR A;  4ER0 A;  3RUX A;  2CJA A;  3HFV A;  4F9A B;  1T39 A;  3IWC A;  4FBI A;  2LLV A;  4NZV A;  2EN8 A;  2ZGW A;  1DUL A;  2LTS A;  2E1M A;  2G4C A;  2EN4 A;  2YSO A;  2WBS A;  4YCV A;  4YRN A;  3VQV A;  3PZC A;  1WPY A;  2GRL A;  1X2L A;  2ZNJ A;  1G2F C;  2ZR2 A;  1YUJ A;  2EMK A;  3QQ6 A;  1FKA E;  3HY0 A;  2LT7 A;  3PCO B;  12AS A;  4P78 A;  1X48 A;  4FN3 A;  4R2Q A;  1XNR E;  2L33 A;  1TN9 A;  2ELY A;  5A6B A;  1DI2 A;  2PUC A;  2KEK A;  2JVL A;  2PXQ A;  5LMU E;  3LML A;  2IVG A;  2YBD A;  4X9J A;  4TVY A;  4R2R A;  2NUE A;  2ADR A;  2EWL A;  1SER A;  4YRQ A;  2RHS B;  1ASZ A;  3JU0 A;  4DR6 E;  3QG5 C;  2DLQ A;  4HVC A;  1WLE A;  3MLF A;  4MLV A;  4Q15 A;  4Q35 B;  5FLX C;  1JJC B;  2N3H A;  5LLQ A;  3EUS A;  2R76 A;  4GEQ B;  3OQO A;  1UN6 B;  2PXF A;  3QF3 A;  2EOQ A;  1GT0 C;  1R63 A;  2ZIO A;  2V89 A;  1S7E A;  2BNN A;  3QNE A;  2EOS A;  2V83 A;  2L3J A;  3P1X A;  3VK0 A;  3E9H A;  3TFL A;  1OCT C;  2DVE A;  2PIJ A;  2RQL A;  3LSQ A;  4MCX A;  2YTQ A;  1HF0 A;  1QNT A;  1X55 A;  1SR9 A;  3DNV B;  1YPN A;  3HXX A;  3KWR A;  3THN A;  1N3G A;  1EIY A;  5DRY A;  2DEQ A;  2HJJ A;  3LQX A;  4X4H A;  1P47 A;  2EMC A;  2XGT A;  2YU5 A;  4DQ2 A;  1STU A;  2LNM A;  2LCE A;  1PRV A;  3R1F A;  3L1A A;  3HTX A;  4YCU A;  1SFE A;  3A9Z A;  2AWI A;  2B3T B;  1G5I A;  1B76 A;  2N3G A;  4YDQ A;  3GZD C;  1A1K A;  1B70 B;  2UUA E;  4ZYE A;  1PJT A;  4X5O A;  4LF6 E;  2EM6 A;  2LYS A;  2EJF A;  4YHH E;  3IWB A;  4GKJ E;  4NXM E;  2JCG A;  2LUQ A;  1JH9 A;  4XEM A;  4R2C A;  1NER A;  1UBD C;  2PUF A;  1UHZ A;  2EBY A;  4UPA A;  4J1W A;  4P74 C;  1X2H A;  3LC0 A;  4DV1 E;  2N8X A;  2LLW A;  1NYQ A;  3A9Y A;  2ZZF A;  4WJ4 A;  2AKW B;  3J80 C;  2ZNI A;  2FFH A;  1WH8 A;  4H2Y A;  3WQZ A;  3NXH A;  1HNX E;  2I13 A;  2DTI A;  3GZC A;  3SCF A;  4P71 C;  1G2D C;  1KMM A;  1X6H A;  3RKY A;  2I4N A;  1ZUG A;  2EE8 A;  4BHC A;  2PXP A;  3AUZ A;  2PXD A;  2NAB A;  3W3S A;  2EM9 A;  2DQ0 A;  4EX5 A;  3FJP A;  2L2N A;  2EPA A;  1X6E A;  2GHF A;  1ZU1 A;  3V8L A;  2ARU A;  2EMH A;  2VQE E;  3ZHM A;  2PXB A;  2B9D A;  1VQZ A;  2KZ8 A;  5AE3 A;  4XTW A;  3IWD A;  4LVJ A;  2JOB A;  4DPG A;  2DZC A;  4BHB A;  5JUW A;  2CRO A;  4YRC A;  4OB4 A;  4BC7 A;  4PU7 A;  4IJD A;  3M4P A;  1LMB 3;  3MQZ A;  2IY5 A;  2V87 A;  4WPY A;  2ZR3 A;  1EH7 A;  1SRY A;  1Z7M A;  3QO8 A;  2EM3 A;  2ZT6 A;  4LF7 E;  3HTZ A;  2D5V A;  1XMQ E;  3RKX A;  4ER3 A;  2EMI A;  5DTQ A;  1F2I G;  2A6C A;  4P74 A;  4I6R A;  2Q7E A;  1ZZ7 A;  4ER7 A;  2LYQ A;  4J1X A;  4Q6G A;  2EMB A;  2HCS A;  4K0K E;  2EOX A;  1HQ1 A;  2ODR D;  4HRA A;  2EOE A;  3C4B A;  1AAY A;  1EKZ A;  1L1M A;  1PYS A;  3A7R A;  2EPL X;  4ZYH A;  4Z5H A;  1YZ9 A;  2JQE A;  2JOX A;  1ADR A;  4L87 A;  2ZIM A;  4P71 A;  3MF2 A;  2HGH A;  3S8Q A;  5T6J A;  2V3C C;  4DUZ E;  3K6Q A;  1ZZ6 A;  2AXU A;  1IBL E;  3G1Z A;  2R1F A;  2XXA A;  2EMG A;  2Q7H A;  1QZX A;  1PDA A;  2EL6 A;  3LLH A;  4FK5 C;  2ENC A;  1G5H A;  4DUY E;  1WJP A;  4GKK E;  1L4S A;  5A6B D;  2LJH A;  3BID A;  4R2A A;  4N4R B;  2GPI A;  3V7S A;  1YSE A;  4F9C B;  3EFR A;  2QHT A;  3LSS A;  3A5Y A;  2XIU A;  3NEM A;  1EH6 A;  5TSE A;  2AW6 A;  1RQ0 A;  2E41 A;  4IA8 A;  2EN1 A;  2EPC A;  2EJ4 A;  4HWT A;  3DM5 A;  3O9X A;  1IBK E;  1UXC A;  2MDR A;  4OBM A;  4LVI A;  3HRK A;  3EPL A;  1X01 A;  1EVK A;  3RAC A;  4LFB E;  5HGQ A;  1QPZ A;  2H36 X;  2RSI A;  2KOU A;  3GBF A;  1PRA A;  4CH4 A;  5DT2 A;  2DMY A;  2D9H A;  4X8W A;  2L2M A;  1YFS A;  4HWP A;  4YCW A;  1ZVV A;  2FTX B;  2EPP A;  2YZT A;  5KL3 A;  1WXR A;  4H2X B;  4LF5 E;  3OMT A;  2EMX A;  1YUI A;  4YP0 A;  4LFC E;  5DTR A;  2EOY A;  1A1H A;  2DB2 A;  2E65 A;  3HPS A;  4UP9 A;  2EPZ A;  2B7T A;  2ALY A;  3CRO L;  2EM0 A;  1BBG A;  1RC7 A;  4WSG A;  2BBG A;  3THO B;  4KZS A;  1J5E E;  2XCJ A;  3NEN A;  1YGB A;  2PUB A;  2E1H A;  2EPM X;  3NDB B;  3F6G A;  5AAS A;  2MEZ A;  1YYO A;  3QOW A;  2M1S A;  4X4G A;  1MGT A;  4K86 A;  3TEL A;  1NEQ A;  5C51 B;  3EPK A;  3ZPX A;  1E3O C;  1NJ1 A;  1LCD A;  4LVK A;  2LCV A;  4WFT A;  1NCS A;  4P7D A;  2K4V A;  1MEY C;  2PXU A;  4ZTU B;  2EOO A;  4X4C A;  2CGH A;  2B5A A;  4H2U A;  4WYQ B;  3OP9 A;  2EQ3 A;  4EQZ A;  2VRD A;  2DJZ A;  2CSH A;  2LV2 A;  3UH0 A;  1NYR A;  3HFZ A;  3JXB C;  1USY C;  2QHS A;  3A7U A;  2O38 A;  1A1G A;  1J26 A;  2ZZE A;  1DGC A;  1ZZB A;  4CS3 A;  1BDI A;  2EPX A;  2KHX A;  2YSP A;  3BBG A;  4F6M A;  4X4D A;  1KJK A;  2DIX A;  4XU3 A;  2EN6 A;  2MDG A;  4H2W A;  5A6J A;  3M4Q A;  2I4O A;  4JI0 E;  4GHJ A;  2EOH A;  3C4T A;  2MC6 A;  1IBM E;  4DR2 E;  4HWO A;  2E5L E;  1WH6 A;  4ER6 A;  3T1H E;  1YFT A;  2OFY A;  3ZHI A;  2B7V A;  4KHP E;  4JI5 E;  4R2E A;  3BJU A;  1DQ3 A;  5A69 A;  1B7Y A;  2P5I A;  4EKG A;  4X64 E;  1E22 A;  1RZR D;  1C0A A;  2RS7 A;  3BGH A;  3QTC A;  3OQN A;  3CLC A;  4XTX A;  4DV6 E;  1A1J A;  1X3C A;  4GQM A;  2F4V E;  4JCY A;  5K1X A;  4TQF A;  3F51 A;  2PXE A;  4PHC A;  4Z59 A;  4DR3 E;  3DJW A;  2RSM A;  4JI3 E;  2CSF A;  3LFP A;  1AU7 A;  1H4Q A;  2WCC 3;  4F6N A;  1J5W A;  4OX9 E;  2EMY A;  2WUS R;  3J81 C;  3NRO A;  2IU7 A;  4JI1 E;  4H2T A;  3AV0 A;  2NUG A;  1USY A;  4YRT A;  2GRM A;  3A7A A;  2EMA A;  2EL5 A;  2LJU A;  3QFI A;  2F8B A;  4WSP A;  3TRB A;  3EPH A;  4XU2 A;  5IXM B;  4JYA E;  2EM4 A;  2QHV A;  4I6U A;  2KON A;  3ADJ A;  4YRO A;  4CH3 A;  3EQ1 A;  1CJG A;  2HC5 A;  3IG2 A;  2LYL A;  3T1Y E;  5LMN E;  4P75 C;  1IQS A;  5AC4 A;  3JXD L;  4TQD A;  2LYJ A;  2L8T A;  4B3M E;  5E3I A;  3BS3 A;  4ZIB A;  5KL4 A;  3VHT B;  2L6M A;  1TF3 A;  4G84 A;  4LFA E;  4YRS A;  2V88 A;  2WBU A;  1BIA A;  3HZI B;  1WQ7 A;  2E72 A;  4XTU A;  4XU1 A;  2EAY A;  2BJC A;  5F3W A;  4CS2 A;  4Y42 A;  3TQM A;  2JR1 A;  2EJ9 A;  2CIM A;  2J3M A;  2MXD A;  3L4G A;  2LO3 A;  4WJ3 M;  2BB8 A;  2EOF A;  5KL2 A;  2DXT A;  1JWL A;  2PME A;  2EPU A;  2DTH A;  4M9V C;  2DKG A;  3HPZ A;  3E9I A;  2YPN A;  1R69 A;  1GGM A;  3UFG A;  2YWQ A;  4YAR A;  1RIQ A;  3HQ1 A;  4YG4 A;  4YRK A;  2JWO A;  5F5W A;  5AE2 A;  4YY3 E;  2JYA A;  1WYD A;  3RF1 A;  1DWK A;  4LF9 E;  4P3N A;  2DMI A;  1B69 A;  3EPJ A;  2AMC A;  4F9B B;  4J15 A;  1WET A;  4BWA A;  2Q7G A;  2I4M A;  2R63 A;  3NEL A;  4LVL A;  11AS A;  2EN2 A;  4K87 A;  2ENA A;  1AH5 A;  2IV1 A;  2UXB E;  2E5A A;  3ADG A;  4TTV A;  1UXD A;  4DE8 A;  2JXP A;  4O24 A;  4EZI A;  4UP8 A;  4P75 A;  2ICP A;  1HTT A;  2DXU A;  2YTJ A;  1PJS A;  2DQ3 A;  3HFZ B;  2C7I A;  2M4I A;  1SQ8 A;  3H5T A;  4B3S E;  3BDN A;  2YRM A;  2RHQ A;  3KJX A;  1IL2 A;  3TEP A;  1YFH A;  1H4V B;  2L92 A;  4HTG A;  1E24 A;  2EQ0 A;  5GAH i;  2PMF A;  2WZO A;  3M9L A;  3F6H A;  1XNQ E;  4RQF A;  2ELZ A;  2E10 A;  4I6T A;  1LLI A;  1BIB A;  1E1O A;  4H02 A;  3V8K A;  3A9X A;  2LMZ A;  2EPK X;  2FGG A;  4YRP A;  5GAG i;  4NDW A;  2YTI A;  4YRJ A;  2YTP A;  5K1P A;  1VPW A;  4LF4 E;  1ZZ8 A;  4WI1 A;  2LVH A;  3TEH A;  4JI2 E;  3PCO A;  1YSA C;  3IKL A;  3A32 A;  2VEO A;  1BBW A;  3KL4 A;  3A31 A;  3BF2 A;  1B7Y B;  5AC5 A;  2UUC E;  4YPF A;  2K7I A;  2LRS A;  2ART A;  2EM2 A;  2YTO A;  4J8Z A;  1NJ8 A;  3UWP A;  4F2J C;  4I8O A;  3FYM A;  3C6M A;  4WVL A;  4PU3 C;  4NCX A;  4JV5 E;  2EML A;  4TVA A;  2EWT A;  3CMQ A;  1GZ6 A;  3HXV A;  2EOM A;  1T4O A;  4DE9 A;  1JJC A;  2FV4 B;  4Q28 A;  1QE0 A;  1G51 A;  2DU7 A;  4UP7 A;  3HXU A;  1GTK A;  4RH8 A;  4L5N C;  3SCG A;  1EVL A;  2XSD C;  5IWA E;  2HIN A;  4BCA A;  4X4F A;  5DSX A;  1I94 E;  2AUW A;  3HRI A;  5KL5 A;  2L1P A;  1LYL A;  2UU9 E;  2L3C A;  4Z58 A;  2ZIN A;  2ZT8 A;  2M4H A;  4PG3 A;  2ZZG A;  1EIY B;  5DNY A;  4ZYD A;  3D1N I;  4Q2J A;  4M2Z A;  2MKN A;  2YU8 A;  4KQE A;  2DZ9 A;  2J7J A;  3G7D A;  2EP3 A;  1A1L A;  4HA8 A;  1GQE A;  3UGT A;  1A1I A;  4WXD A;  1PER L;  3SX0 A;  1KOG A;  1PJQ A;  3I7F A;  1B8A A;  3DF6 A;  3ERR A;  2CJB A;  1POU A;  1PRU A;  4ZYG A;  1N32 E;  2AXZ A;  3IKM B;  1RPE L;  2HHH E;  1T4N A;  2ZM6 E;  3UK3 C;  3ZKC A;  3RMP A;  2XJ3 A;  4JQD A;  2YTE A;  2EPO A;  3RL6 A;  1X57 A;  5CFF E;  2IHR 1;  4CH5 A;  3P8V A;  1WRJ A;  4DKK A;  5A6A A;  2RPC A;  4IVZ A;  3NZL A;  3EFS A;  1LCC A;  1O0W A;  1BBO A;  2EWN A;  2JP9 A;  2H8R A;  1ZBQ A;  4NXN E;  4WXC A;  4YG7 B;  2MC5 A;  2JY9 A;  2GLI A;  2Q5H A;  1YFR A;  1HXD A;  3MF1 A;  4DR5 E;  1JK2 A;  2XTI A;  1FJG E;  2ENH A;  1WU7 A;  3RIR A;  1L0W A;  3OD1 A;  4X66 E;  2M7Q A;  1ZPQ A;  2WIU B;  1YYW A;  4YG1 A;  2EMW A;  1DW9 A;  4YRE A;  1ZZ9 A;  2L2K B;  4H2V A;  4BW9 A;  5DRT A;  2DLK A;  2YRH A;  4X4B A;  4XTV A;  4M30 A;  3C6K A;  4HWS A;  4EO4 A;  2EN7 A;  4CS4 A;  3GUU A;  2OR1 L;  4HT4 A;  1NJ5 A;  1ZAA C;  5ELO A;  2PPX A;  1X54 A;  2IY5 B;  3RZZ A;  2ZCE A;  2LTR A;  1RZS A; 
#chains in the Genus database with same CATH homology
 3M4P A;  4TQD A;  4R8O A;  3MQZ A;  3A74 A;  1E1T A;  2L8T A;  4B3M E;  4EKI A;  4DV0 E;  5E3I A;  4ZIB A;  2IY5 A;  2V87 A;  4WPY A;  2UUB E;  2ZR3 A;  2L6M A;  2LUP B;  1SRY A;  1Z7M A;  3QO8 A;  3ADI A;  4R03 A;  4G84 A;  1UIL A;  2ODR C;  4LFA E;  1YB3 A;  4JI8 E;  4YRS A;  2ZT6 A;  2V88 A;  4LF7 E;  3SR4 A;  1BIA A;  3HTZ A;  3TEH B;  2UXD E;  1XMQ E;  1WQ7 A;  2P0L A;  3RKX A;  1B70 A;  4ER3 A;  1NNH A;  3VQW A;  5DTQ A;  3P8T A;  3L4G B;  1H4S A;  4XTU A;  4XU1 A;  4YRI A;  4P74 A;  2EAY A;  4TWA A;  5F3W A;  2Q7E A;  2C8M A;  1PYS B;  4F54 A;  4YRF A;  4ER7 A;  2FYK A;  4CS2 A;  3JTZ A;  4Q6G A;  2XXQ A;  1HC7 A;  3HXZ A;  1SES A;  2HCS A;  3VQX A;  4K0K E;  2JR1 A;  2EJ9 A;  4KR2 A;  2CIM A;  2J3M A;  5KNN A;  2MXD A;  3L4G A;  2ODR D;  4HRA A;  2CJ9 A;  4WJ3 M;  3C4B A;  1EKZ A;  2DXT A;  2PME A;  1PYS A;  3A7R A;  3J7A G;  4BMJ A;  2DTH A;  2DSY A;  2DKG A;  1YZ9 A;  2JOX A;  4L87 A;  3A5Z A;  4P3P A;  4K88 A;  3HPZ A;  2ZIM A;  3E9I A;  1X56 A;  4P71 A;  2DU5 A;  1QU6 A;  1GGM A;  3MF2 A;  2ZT7 A;  3VQY A;  3L2Z A;  3UFG A;  1KMN A;  5T6J A;  3FIG A;  4L8N A;  5AE1 A;  4DUZ E;  3K6Q A;  1RIQ A;  3VBB A;  4TVA B;  3HQ1 A;  2CPN A;  2AMC B;  1X49 A;  4P72 A;  2QHU A;  4TVW A;  1IBL E;  4ZTZ B;  1QF6 A;  4YRK A;  2JWO A;  3G1Z A;  5F5W A;  4LVM A;  2EZ6 A;  5AE2 A;  2Q7H A;  4YY3 E;  4DV2 E;  2AKW A;  1WYD A;  3RF1 A;  1XMO E;  4DV5 E;  2A8E A;  3R07 A;  4LF9 E;  2VE7 C;  3LLH A;  4P3N A;  1G5H A;  4XU0 A;  2XXP A;  3HY1 A;  4DUY E;  4GKK E;  2AMC A;  2LJH A;  3RKW A;  4F9B B;  4OP0 A;  3V7C A;  4J15 A;  5BR8 E;  4BWA A;  3OML A;  3KFU A;  3QOX A;  2Q7G A;  2I4M A;  3NEL A;  4LVL A;  5A2Q C;  3V7S A;  1NJ6 A;  3REX A;  4F9C B;  3EFR A;  2QHT A;  3LSS A;  3QO7 A;  11AS A;  1YYK A;  2J7W A;  4K87 A;  1U2Z A;  3A5Y A;  2VF1 A;  4DR4 E;  4XTY A;  1N34 E;  2HCN A;  1ADJ A;  2UXB E;  2E5A A;  3NEM A;  4YRL A;  3ADG A;  4TTV A;  4RQE A;  3MSW A;  2LBS B;  4DE8 A;  4DR7 E;  4JI6 E;  4EZI A;  3UGQ A;  1RQ0 A;  4DMI A;  2E41 A;  3DSQ A;  3RGL A;  4UP8 A;  3HXL A;  4P75 A;  2RHQ B;  3QO5 A;  4HWT A;  1HTT A;  2DXU A;  3P8Y A;  4YRR A;  4ER0 A;  1IBK E;  3RUX A;  2CJA A;  2DQ3 A;  4F9A B;  3HFV A;  2C7I A;  2M4I A;  3HFZ B;  2MDR A;  4BBY A;  4OBM A;  3IWC A;  4LVI A;  4B3S E;  3HRK A;  2LLV A;  2RHQ A;  2ZGW A;  2LTS A;  2E1M A;  4M0V A;  1IL2 A;  2DDZ A;  3TEP A;  1PKP A;  2G4C A;  1H4V B;  2L92 A;  1E24 A;  2PMF A;  4YCV A;  2WZO A;  1X01 A;  1EVK A;  4YRN A;  3VQV A;  3PZC A;  4RMF A;  1WPY A;  3M9L A;  3F6H A;  2ZNJ A;  1XNQ E;  2V8Q B;  3HXW A;  3RAC A;  4RQF A;  4KR3 A;  2ZR2 A;  2E10 A;  1E1O A;  4H02 A;  1BIB A;  1FKA E;  3V8K A;  4LFB E;  3HY0 A;  5HGQ A;  3A9X A;  5ELN A;  4TUI A;  2LMZ A;  2Q5I A;  2FGG A;  2H36 X;  3PCO B;  4YRP A;  2KOU A;  12AS A;  4P78 A;  1X48 A;  4YRJ A;  4CH4 A;  5DT2 A;  2DMY A;  5K1P A;  4LF4 E;  1XNR E;  2L33 A;  4WI1 A;  3TEH A;  2ZXF A;  4JI2 E;  4X8W A;  1DI2 A;  3PCO A;  2L2M A;  1YFS A;  4HWP A;  5LMU E;  3IKL A;  3A32 A;  1WNL A;  2VEO A;  1BBW A;  4YCW A;  3LML A;  4OLF A;  3A31 A;  2YBD A;  2FTX B;  1B7Y B;  2ZT5 A;  2YZT A;  4HWR A;  2UUC E;  4TVY A;  2LRS A;  4YPF A;  4E51 A;  2NUE A;  1WXR A;  2EWL A;  4H2X B;  1SER A;  4AQY E;  2ART A;  4YRQ A;  2RHS B;  1ASZ A;  4J8Z A;  3JU0 A;  4DR6 E;  4LF5 E;  1NJ8 A;  3UWP A;  4P3O A;  2ALY B;  4HVC A;  1WLE A;  4I8O A;  4TUG A;  3G0T A;  4YP0 A;  4LFC E;  5DTR A;  4Q15 A;  4H2X A;  2DB2 A;  5FLX C;  4WVL A;  4XTZ A;  4OOG C;  2E65 A;  1JJC B;  3HPS A;  3VYY A;  2N3H A;  4UP9 A;  2B7T A;  2ALY A;  4NCX A;  4JV5 E;  2DTO A;  2RTX A;  4TVA A;  3CMQ A;  1GZ6 A;  4GEQ B;  3HXV A;  1RC7 A;  1H4T A;  1T4O A;  4DE9 A;  1JJC A;  4KZS A;  2FV4 B;  1J5E E;  2UXC E;  1Z7N A;  4Q28 A;  3PE5 A;  3NEN A;  1QE0 A;  4YYE A;  1YGB A;  2NA2 A;  1G51 A;  1ZBT A;  2V89 A;  2EJG A;  2ZIO A;  2DU7 A;  4UP7 A;  3HXU A;  2E1H A;  3QNE A;  4L5N C;  3F6G A;  1EVL A;  5AAS A;  4P73 C;  4B3T E;  2V85 A;  2V83 A;  5IWA E;  2VQF E;  2L3J A;  1YYO A;  3P1X A;  3E9H A;  3QOW A;  2M1S A;  3TFL A;  5DSX A;  4BCA A;  1I94 E;  2DVE A;  3HRI A;  2L1P A;  1LYL A;  4K86 A;  2UU9 E;  2L3C A;  3TEL A;  5C51 B;  2ZIN A;  2ZT8 A;  2M4H A;  3ZPX A;  3LSQ A;  1FYF A;  4PG3 A;  5IT9 C;  1NJ1 A;  2ZZG A;  4LVK A;  2E3C A;  1EIY B;  4AH6 A;  4WFT A;  4O2D A;  2G7H A;  1X55 A;  4P7D A;  2K4V A;  1SR9 A;  1NJ2 A;  3OTO E;  5DNY A;  4ZTU B;  2LE2 A;  3MEY A;  2CGH A;  4H2U A;  4WYQ B;  3HXX A;  4Q2J A;  3KWR A;  4EQZ A;  4LU9 A;  1HR0 E;  3VWS A;  4M2Z A;  2DJZ A;  1X47 A;  2HNI A;  3UH0 A;  1EIY A;  1NYR A;  2EL9 A;  4KQE A;  4DR1 E;  2DZ9 A;  1EQR A;  4DV4 E;  4HA8 A;  3REU A;  5DRY A;  3HFZ A;  3GZD A;  1GQE A;  3UGT A;  1T4L B;  3H09 A;  5C53 B;  3BFM A;  3TEG A;  2DEQ A;  3SX0 A;  1USY C;  2QHS A;  3A7U A;  1KOG A;  2XGT A;  3I7F A;  4DQ2 A;  1STU A;  1B8A A;  1N33 E;  2LNM A;  1J26 A;  4DV3 E;  3DF6 A;  3ERR A;  2HFZ A;  4EK9 A;  2CJB A;  2ZZE A;  3L1A A;  4CS3 A;  3HTX A;  4YCU A;  2KHX A;  3A9Z A;  1N32 E;  2B3T B;  1G5I A;  1B76 A;  4JI4 E;  2N3G A;  1WQW A;  3IKM B;  4YDQ A;  3GZD C;  2HHH E;  2RS6 A;  1B70 B;  1T4N A;  2UUA E;  2ZM6 E;  2NS6 A;  2DIX A;  4XU3 A;  3TUP A;  3RMP A;  4H2W A;  3V7R A;  3M4Q A;  2I4O A;  1HNZ E;  4JI0 E;  2ZTG A;  4LTY A;  1N9W A;  1NW3 A;  4LNS A;  3RL6 A;  1BBU A;  3V8J A;  4X5O A;  5CFF E;  2IHR 1;  4LF6 E;  3C4T A;  2MC6 A;  1IBM E;  1W66 A;  4CH5 A;  4DR2 E;  3P8V A;  4HWO A;  2J3L A;  4DKK A;  1ADY A;  2EJF A;  2E5L E;  4ER6 A;  4YHH E;  4CH6 A;  3NET A;  3T1H E;  3IWB A;  1YFT A;  4YRG A;  3NZL A;  4GKJ E;  3IAL A;  4NXM E;  2B7V A;  3EFS A;  4KHP E;  1O0W A;  2LUQ A;  4JI5 E;  4X62 E;  1HNW E;  2EWN A;  4XEM A;  3BJU A;  1DQ3 A;  1ZBQ A;  4NXN E;  1B7Y A;  2P5I A;  5ADZ A;  4EKG A;  4X64 E;  1E22 A;  2YT4 A;  2MC5 A;  1UHZ A;  1C0A A;  4UPA A;  2JY9 A;  2RS7 A;  3ADL A;  2RHS A;  3QTC A;  4P74 C;  1X2H A;  3LC0 A;  4DV1 E;  3VYX A;  2Q5H A;  1YFR A;  2I4L A;  1HXD A;  2ARS A;  2LLW A;  4LF8 E;  4XTX A;  4DV6 E;  1NYQ A;  3A9Y A;  3VK6 A;  3MF1 A;  1WHN A;  4DR5 E;  3MEJ A;  1N36 E;  4P73 A;  2ZZF A;  4WJ4 A;  2AKW B;  3J80 C;  2F4V E;  2ZNI A;  2XTI A;  5K1X A;  4TQF A;  4H2Y A;  3WQZ A;  3NXH A;  1HNX E;  1FJG E;  2E64 A;  4PHC A;  4RDX A;  2DTI A;  4DR3 E;  3GZC A;  5DTM A;  3DJW A;  1EFW A;  2RSM A;  2J7U A;  4YRM A;  4JI3 E;  1WU7 A;  3RIR A;  4P71 C;  1WHQ A;  1KMM A;  2V86 A;  1H4Q A;  4DV7 E;  1J5W A;  5C52 B;  1L0W A;  4OX9 E;  4WF2 A;  3RKY A;  3OD1 A;  4ER5 A;  2I4N A;  3ICA A;  4X66 E;  1ATI A;  4P72 C;  2M7Q A;  4JI7 E;  1YYW A;  3J81 C;  3NRO A;  3AUZ A;  3W3S A;  2DQ0 A;  4YRE A;  2L2K B;  4JI1 E;  2L2N A;  3FJP A;  4H2V A;  4H2T A;  3AV0 A;  4BC9 A;  4BW9 A;  4EX5 A;  4B3R E;  3V8L A;  2NUG A;  1USY A;  4YRT A;  1SET A;  3JAM C;  5DRT A;  3A7A A;  2ARU A;  2VQE E;  4XEO A;  1X2G A;  4XTV A;  3ME5 A;  3QFI A;  4G85 A;  2F8B A;  4M30 A;  4WSP A;  2B9D A;  3J7Y p;  4X65 E;  1VQZ A;  4XU2 A;  4HWS A;  4EO4 A;  3ZOQ B;  3R09 A;  4BS9 A;  5AE3 A;  2JVA A;  4CS4 A;  5LL6 R;  4JYA E;  3GUU A;  3OWQ A;  3HXY A;  4XTW A;  3IWD A;  2QHV A;  4HT4 A;  2KON A;  3ADJ A;  4YRO A;  4LVJ A;  4CH3 A;  2JOB A;  1NJ5 A;  5ELO A;  4DPG A;  2DZC A;  1EOV A;  4H2S A;  5JUW A;  3OKZ A;  1ASY A;  2NUF A;  4YRC A;  1X54 A;  3IG2 A;  2IY5 B;  4BC7 A;  2ZCE A;  2LTR A;  3T1Y E;  5LMN E;  4P75 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...