2ODRD

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
Knots found
sequence length
663
structure length
451
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPEIYVYDGNVIGIPELKIDDIALKQIMSKNKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
molecule keywords phosphoseryl-tRNA synthetase
total genus 112
structure length 451
sequence length 663
other databases KnotProt 2.0: Artifct S +31 +31
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
D PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.120 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2odrD03
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrD01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrD02
2Q5HA 4YRQA 1PYSA 2CJBA 4XTYA 2QHVA 1BIBA 4XEOA 2DEQA 4YRKA 2EJ9A 2RHQA 4P71C 3A7AA 2FYKA 4H2XA 4YPFA 1X2GA 4TTVA 5C52B 4Q15A 1E24A 1YGBA 4ZIBA 3HY1A 2EJGA 4P74A 1E1OA 1BBWA 3PCOA 5F5WA 1YFRA 2P0LA 4WJ4A 3RACA 4CH3A 4CS4A 1X54A 1W66A 2Q7HA 1C0AA 1QF6A 1Z7MA 4K86A 1H4SA 2DTIA 4K88A 4H2YA 3OD1A 3QTCA 2E65A 3HFZA 2QHTA 1X56A 1H4QA 4P74C 2EWNA 2XTIA 2E3CA 3RGLA 4ZTZB 4UP9A 3IALA 1EVKA 1H4VB 2ZINA 2ALYB 3MF1A 4DQ2A 1SRYA 2DU7A 2ZNJA 3TEGA 4KR3A 1USYA 3TEHA 4WI1A 5C53B 3FJPA 2ALYA 3QO8A 2AMCA 3A5ZA 2DXUA 3L1AA 4TVYA 5ELNA 4UP8A 3LSSA 4XTXA 4XU1A 1WU7A 4KR2A 2RHSA 3LSQA 1ADJA 3QO7A 3M4QA 3RIRA 2DTHA 2E1HA 5K1PA 1J5WA 4RDXA 2ZZGA 2ZT8A 3PZCA 4HWRA 2AKWB 2ODRC 2J3LA 3HXWA 1ATIA 4YREA 4CS2A 2ZZEA 3RL6A 1SESA 4HWPA 4XTWA 2ARSA 4G85A 4H2XB 4ZTUB 1FYFA 1E1TA 4TQDA 1WNLA 4J15A 4EO4A 11ASA 3NENA 3HY0A 2ZT6A 2I4NA 4CS3A 4BWAA 4P73C 2AMCB 1YB3A 2ZGWA 4UPAA 3P8VA 2I4LA 4P75A 3HFZB 2CJAA 4YRCA 4RQEA 3A5YA 3P8YA 3RF1A 2Q7EA 2IY5B 1WYDA 1KMMA 2P5IA 4TWAA 2CGHA 4YYEA 4XU3A 4BW9A 2ZT5A 1N9WA 4TQFA 2DQ3A 1RIQA 4H2WA 4YRLA 3L4GB 3M4PA 3NEMA 4KQEA 2ODRD 2ARUA 1JJCB 3V8LA 1GGMA 4P73A 2ZXFA 2ZCEA 3VQYA 1BIAA 1NYRA 3IG2A 3V8KA 5KNNA 1JJCA 4CH4A 2RHSB 4WJ3M 4OP0A 3MEYA 1NJ1A 4YRTA 4XEMA 4XU0A 3PCOB 3REUA 5ELOA 4YRPA 1NJ5A 3UGQA 1NJ8A 2DJZA 2CIMA 3LC0A 3RKXA 3V7SA 4YRGA 2PMFA 3ICAA 4YRIA 2C7IA 2I4MA 3MF2A 4HVCA 3ERRA 2DVEA 3REXA 3DSQA 2DU5A 1H4TA 4L87A 1ADYA 1ASZA 3V7CA 4YRRA 12ASA 3QO5A 3QNEA 3A7UA 4YCUA 3UFGA 2DDZA 3HXYA 3UGTA 1NJ2A 1E22A 3VQVA 4E51A 2E64A 4XTUA 3CMQA 4H2VA 2EJFA 2QHSA 3WQZA 1YFSA 2E41A 1Z7NA 1USYC 4YROA 1B8AA 3EFSA 1EIYB 4P75C 4YRMA 4XTZA 3A32A 2DKGA 3RKWA 4P3NA 4EX5A 1WQWA 3TUPA 4H02A 3VQWA 1B70B 2EL9A 2G4CA 3BFMA 4P3OA 4YRJA 3HRIA 3NETA 3P8TA 1HC7A 4H2TA 1B7YB 3IKMB 3E9IA 3L2ZA 2ZTGA 4NCXA 1SERA 1YFTA 1NNHA 4H2UA 4YCVA 2J3MA 2Q7GA 3A31A 1EQRA 3BJUA 4HWTA 2ARTA 4P72A 1EOVA 4X5OA 4TVWA 2CJ9A 1KMNA 4P72C 1KOGA 1WPYA 2XGTA 1ASYA 1QE0A 5K1XA 1WLEA 1G51A 3UH0A 3KFUA 3HXZA 1WQ7A 3TEHB 2AKWA 2IY5A 3HRKA 1NJ6A 1B7YA 4TVAA 3W3SA 4CH5A 4HWSA 2ZIMA 3HXUA 3V7RA 4OLFA 3HXVA 4YCWA 4Q6GA 2I4OA 4YRSA 1EFWA 1G5HA 1G5IA 1X01A 3RUXA 5HGQA 2E10A 1X55A 2ZIOA 4WF2A 4RMFA 1SETA 1B70A 1X2HA 4DPGA 2RHQB 1IL2A 2DQ0A 2ZZFA 3IKLA 4YRFA 3RKYA 3R07A 1HTTA 1B76A 2ZR3A 2ZT7A 1BBUA 1NYQA 3HTZA 4TVAB 2PMEA 2ZR2A 2DZCA 3A7RA 4YRNA 4AH6A 1EVLA 4H2SA 4HWOA 4P71A 4CH6A 1PYSB 2QHUA 4XU2A 3EFRA 2Q5IA 4PHCA 2ZNIA 3I7FA 4G84A 4YP0A 4YDQA 3V8JA 4K87A 1EIYA 1VQZA 1HXDA 3VQXA 4LNSA 3HXXA 1L0WA 4RQFA 3VBBA 3HFVA 4XTVA 2C8MA 4PG3A 3A74A 1LYLA 5E3IA 4HA8A 3NELA 5C51B 2DXTA 3E9HA 4UP7A 4P3PA 2DTOA 2EAYA 2DZ9A 3G1ZA 2HNIA 4O2DA 2E5AA 3L4GA
chains in the Genus database with same CATH superfamily
2Q5HA 2WBSA 2ENAA 4M30A 4DUYE 2I9IA 1FJGE 2EL4A 1YUJA 4YRQA 1WHQA 1PYSA 2CJBA 4YRMA 4O24A 2LNMA 4XTYA 2M7QA 2IHR1 1JFSA 2QHVA 3QWGA 2XIUA 1JFTA 1GZ6A 3QYXA 2DMIA 2DLQA 4YRRA 3V7CA 1YUIA 1BIBA 4XEOA 5A69A 3BDNA 5AASA 2J7UA 2DEQA 4YRKA 1ZAAC 2EJ9A 1ZR9A 2PUEA 1WRJA 2HINA 2RHQA 3VYXA 4P71C 4Z5DA 2EPNA 3HPZA 3A7AA 4YBAA 2FYKA 4WXCA 1YYKA 4I6UA 5BR8E 1YSAC 2EN4A 3EPHA 1EH7A 1ASZA 2PXDA 1QQBA 4H2XA 4YPFA 1X2GA 2M9AA 1F2IG 4TTVA 2GRLA 1IC8A 2PUAA 3J80C 1IBME 5C52B 3ADLA 4Q15A 1QP0A 3ADIA 1E24A 1YGBA 4DR1E 3TFLA 3CLCA 3HY1A 2RQLA 2DB2A 2EJGA 4P74A 1E1OA 1BBWA 5JUWA 3PCOA 2EM8A 1A1LA 1YFRA 5F5WA 2P0LA 4WJ4A 3RACA 1X3CA 4CH3A 4ER3A 3R09A 2DSYA 4CS4A 2L8NA 1CQTA 1EH6A 2L92A 2LLVA 2LV2A 2LVHA 2PRTA 2IUOA 1N34E 1W66A 1IBKE 1X54A 2Q7HA 1C0AA 1DW9A 1YFHA 3TQMA 1QF6A 3KZ3A 3NDBB 3IWBA 1UBDC 2UUBE 3F51A 1Z7MA 4K86A 2DLKA 1X6HA 3NZLA 3THOB 1PJQA 1IBLE 2B9DA 4FK5C 1H4SA 1Y9QA 1RQ0A 1YYWA 3OKZA 3QFIA 5KL7A 1XNRE 2DTIA 4K88A 4P7DA 1IQSA 4X4DA 2H8RA 5IV8B 3CROL 5KL4A 2YTNA 4H2YA 2PXBA 1N36E 3AV0A 2GZUA 1NEIA 4WX9A 1MEYC 3C4TA 3OD1A 3QTCA 1T4OA 4BBYA 1X5WA 2I13A 2E65A 2LT7A 1LMB3 2EPKX 2IV1A 3OWQA 2EM0A 4R03A 5T6JA 1BB8A 1X56A 2QHTA 3HFZA 2J7WA 1O0WA 2O38A 2ZT5A 3H5TA 2YRKA 2PXKA 1H4QA 4JI8E 4KHPE 4Z59A 4P74C 2EWNA 2XTIA 4YY3E 4JYAE 2E3CA 1GTKA 2GLIA 3RGLA 3HZIB 1PERL 4ZTZB 4UP9A 3LISA 5FLXC 1QP7A 4LFCE 2AWIA 1G2FC 3IALA 2L2MA 2FGGA 1EVKA 4TUGA 2JYAA 2KEJA 1H4VB 4LF5E 4JI1E 2KEIA 4M9VC 3GZDC 2ALYB 2ZINA 1TF6A 3MF1A 4DQ2A 1A1JA 1SRYA 3CECA 3L1PA 4Q28A 2DU7A 2ZNJA 3TEGA 4KR3A 1USYA 3C4BA 4WI1A 3TEHA 1UILA 5C53B 2VQFE 1JWLA 3KZYA 2ALYA 3G7DA 2MEZA 2AMCA 3FJPA 3QO8A 2UUCE 4IJDA 1T4NA 3A5ZA 2F8BA 2EORA 4KZSA 2DXUA 3L1AA 4TVYA 5ELNA 2GRMA 4F9CB 1P47A 4UP8A 1HNWE 3ADJA 2NUGA 3LSSA 2NABA 2LYLA 1WIZA 3VK0A 4XTXA 4XU1A 2EPXA 2XXPA 4YG4A 1GQEA 2JOBA 4JI5E 4GKKE 4JI3E 1WU7A 2RHSA 4Z5HA 3LSQA 5F3WA 4KR2A 4X4CA 2FV4B 1ADJA 3QO7A 3M4QA 1A1HA 2M4HA 3RIRA 2DTHA 2E1HA 5K1PA 3TEPA 2BJCA 4DV3E 2JPAA 4O4KA 4Y42A 1J5WA 4RDXA 2ZZGA 3SR4A 2R76A 4F9BB 5DNYA 1J26A 2VEOA 2ZT8A 3PE5A 3ZHMA 2LYJA 1NEQA 5DTRA 2EP3A 1RZRD 2PUDA 4WPYA 4DV4E 3HTXA 2AKWB 1KJKA 4M0VA 1ZUGA 2MQKA 2PXEA 3GZDA 2ODRC 2J3LA 3HXWA 3QG5C 1UTXA 1ZPQA 2PUBA 1SFEA 2EM5A 5A6KA 2IU7A 2EM7A 1ATIA 4WSGA 4I6RA 5IWAE 2HGHA 4YREA 3JXBC 1BBOA 4CS2A 1S7EA 4I6TA 4PU3C 1KYQA 3KJXA 1Z1BA 1J5EE 2ZZEA 2UXCE 2L1PA 2K7IA 3RL6A 1SESA 4HWPA 2L8TA 2YTOA 3SCFA 2XXAA 2YU8A 3MHSC 2ARSA 2JXPA 4XTWA 2DRPA 4G85A 4NXNE 2JOXA 5A6AA 2H36X 3P8VA 2EM2A 4H2XB 4ZTUB 4TUIA 1FYFA 2LYKA 5DT2A 3MLFA 2FTXB 4JQDA 1HNZE 4ER7A 1E1TA 2LBSB 2LUQA 4TQDA 1WNLA 1A1GA 1ZVVA 2F4VE 4J15A 4M2ZA 4EO4A 1N3GA 3NENA 11ASA 4GEQB 5LLQA 2LYSA 3A9ZA 1NCSA 2VE7C 1UHZA 2KONA 2CTDA 2YTDA 1XMQE 3HY0A 2ZT6A 2I4NA 4YHHE 4CS3A 1DWKA 2EMZA 2YTFA 4HT4A 4DR3E 2CT1A 4P73C 4DR4E 4BWAA 2PE5A 5CFFE 4LF8E 1YB3A 3GUUA 2AMCB 2ZGWA 4UPAA 4F9AB 1X6EA 3S8QA 3THNA 4R2RA 2M4IA 4JI2E 1PDAA 1OCTC 2EPOA 3F6HA 1A1KA 3EQ1A 5KL6A 2I4LA 2AUWA 2V8QB 4DR2E 2NS6A 4P75A 3TRBA 3HFZB 1N32E 4NXME 3R1FA 1OSLA 1PRUA 5A6JA 2CJAA 4YRCA 3M9LA 4NDWA 5DRTA 2EJ4A 2YTIA 2JP9A 4RQEA 2L3JA 1ZZ7A 2YTGA 3KL4A 1BBGA 3A5YA 3P8YA 1Y7YA 2L2NA 3FMYA 3RF1A 4F2JC 2LRSA 2Q7EA 3F6GA 2LTRA 1A1IA 2IY5B 5GAHi 2LUPB 1WYDA 1KMMA 2JY9A 3LFPA 2B7VA 2P5IA 2EL5A 4TWAA 2CSHA 2CGHA 2UXDE 2ELYA 2EMYA 2UU9E 3IWDA 2FJRA 2PUFA 4YYEA 4XU3A 4BW9A 2ZM6E 1MFQC 4LF4E 1RZRA 3IWCA 3KWRA 1N9WA 2RS6A 3OMTA 2PXFA 2BNMA 3K6QA 4RH8A 1QQAA 1RC7A 2XJ3A 1RIQA 4H2WA 4YRLA 3L4GB 3M4PA 1YSEA 3NEMA 4KQEA 2ODRD 3LQXA 4X4GA 4I8OA 3J81C 2ARUA 3EUSA 1JJCB 1UN6B 4LVMA 3V8LA 4R2EA 2EF8A 2LJHA 1GGMA 2ZCEA 2ZXFA 4P73A 2CSFA 4BS9A 3VQYA 1BIAA 1NYRA 2HCNA 2EM3A 4GQMA 2N8XA 4OB4A 3IG2A 3V8KA 2EPCA 5KNNA 1L1MA 1JJCA 2LJUA 3JTZA 2RHSB 4CH4A 4WJ3M 1HF0A 3OTOE 1WETA 2E1MA 2EM6A 4HWRA 4DV1E 4OP0A 4LVIA 4X4EA 3MEYA 1NJ1A 1EKZA 3GZCA 4XEMA 4YRTA 2EOOA 1BDIA 2YWQA 4P78A 4XU0A 2O49A 2EBYA 2BNOA 1EH8A 1YPNA 2MDRA 2V85A 3L00A 2EOIA 1HR0E 3PCOB 4DKKA 2EN3A 3REUA 1X57A 5KL5A 5ELOA 1R63A 4YRPA 2GPIA 4ER0A 1NJ5A 4X4HA 3B7HA 3BD1A 1PJTA 3UGQA 2EOZA 3BGHA 2MC6A 2YBDA 2G7HA 1YYOA 1NJ8A 4TQFA 1ZZ6A 4WF2A 2DJZA 4X9JA 4WFTA 2CIMA 2MKDA 3LC0A 3RKXA 1QNTA 2EPUA 3AUZA 3OQOA 4DR7E 2EOFA 3V7SA 5DSXA 4YRGA 2VQEE 3OQNA 5LMUE 2A8EA 4YARA 3QQ6A 2PMFA 1POUA 2PXTA 3ICAA 4YRIA 2R1JL 1O4XA 4IA8A 2MDGA 4N4RB 4F6MA 4LFBE 2C7IA 3BF2A 2EWLA 3ZKCA 4JI0E 2I4MA 1QPZA 3ERRA 2DVEA 3REXA 2EOHA 2VF1A 2PUGA 3DSQA 2DU5A 2KEKA 4Z5CA 4F8DA 2EMBA 3EPJA 1ADYA 1H4TA 4L87A 5AC4A 2V83A 4R2PA 12ASA 3QO5A 3QNEA 3KXAA 3VWSA 3A7UA 4YCUA 3UFGA 4GKJE 2EN2A 2DDZA 3HXYA 5DTQA 4X4IA 2XCJA 2K4VA 4YG1A 4DV0E 1NJ2A 1E3OC 3UGTA 4LVJA 5A6BA 2LMZA 1E22A 3VQVA 4E51A 2E64A 1NW3A 2IVBA 3DF6A 4BC7A 4XTUA 3CMQA 2HJJA 5AE3A 5AC5A 4H2VA 1B0NA 4DR5E 2XSDC 2EJFA 3KZZA 4R2AA 2QHSA 1QU6A 4DMIA 2WZOA 4IS1C 2RPCA 3WQZA 1BDHA 4KWYA 1X6FA 1YFSA 2E41A 1Z7NA 1USYC 3JXCL 4R2DA 4YROA 1B8AA 3EFSA 1EIYB 2A25A 2PXQA 2HCSA 2N3GA 2DGCA 2EN7A 2KHXA 2YRMA 2EMGA 1ZZ8A 1SQ8A 2YTPA 3JU0A 5TSEA 4R2SA 2E72A 1T39A 2EE8A 2ENCA 4LF9E 2DKGA 3A32A 1X2LA 3RKWA 1LCCA 4P3NA 1GT0C 4EX5A 3J7AG 1WQWA 5IT9C 1TF3A 2EOXA 2LCEA 4ZYDA 3T1YE 2HHHE 4H02A 3TUPA 3ZHIA 2L3CA 3VQWA 1B70B 3UWPA 4R2QA 3BS3A 2UXBE 3VHTB 2EL9A 2G4CA 2YZTA 3M99B 4DV2E 1XNQE 3BFMA 4P3OA 4YRJA 3HRIA 3NETA 3P8TA 1PNRA 5DRYA 2LO3A 1XMOE 3RZZA 1YZ9A 1HC7A 4H2TA 2B3TB 4MLQA 2L2KB 3H09A 2B7TA 2EM4A 2EPMX 2EMWA 1B7YB 5GAGi 3OP9A 3IKMB 1AU7A 1QP4A 3E9IA 3L2ZA 2RSMA 4EKIA 2CPNA 2N3HA 2ZTGA 2RS7A 3GN5A 3D1NI 3HQ1A 5AE2A 1YFTA 4ZIBA 1SERA 4FN3A 2EPRA 4DV7E 1NNHA 4H2UA 2NA2A 2E5AA 4YCVA 2JCGA 2J3MA 3MF2A 4DE8A 2Q7GA 4B3ME 2EZ6A 3BIDA 2HC5A 3A31A 2L33A 4ZYEA 4OX9E 1EQRA 3BJUA 1ZU1A 1X49A 2FFHA 4HWTA 2ARTA 4P72A 4JCXA 2IVQA 2JVLA 3QF3A 2EN6A 4BHCA 1EOVA 4TVWA 4JCYA 4X5OA 2CJ9A 4HVCA 4P75C 1L4SA 2EMCA 1LCDA 4GZNC 1KMNA 1R69A 2OR1L 1CJGA 3KFUA 1UXCA 1ZS4A 2EOSA 4L5NC 4IWRA 2EL6A 2BB8A 4P72C 2DMYA 1KOGA 2WIUB 3MEJA 3UK3C 3VK6A 1T4LB 1WPYA 2XGTA 4X4FA 3FIGA 4BMJA 1X47A 4LVKA 1ASYA 1QE0A 2YTQA 1JK2A 5K1XA 4DV6E 2EM9A 2MC5A 1WLEA 4F6NA 1RIOA 1WJPA 1G51A 3UH0A 2JVAA 2LLWA 2PXUA 4LF7E 2WBUA 2WBTA 2EPPA 4DUZE 2ICPA 3FYAA 4MCXA 4Q2JA 3OQMA 1XWRA 2L6MA 4Z58A 3DJWA 2RSIA 3MHHC 2WUSR 2RTXA 4J1WA 2EOJA 1G2DC 4DR6E 1WQ7A 2YTJA 2M1SA 4X66E 3TEHB 2YSPA 4JI6E 1LQCA 2AXUA 2PXPA 1PRVA 4X64E 2AKWA 3HRKA 2IY5A 2D9HA 4JV5E 2KZ8A 1NJ6A 1AH5A 4YG7B 1B7YA 4TVAA 1WXRA 3W3SA 1RPEL 1QZXA 4NZVA 4Q35B 5ADZA 4CH5A 4HWSA 1ADRA 1JH9A 2ZIMA 4BHBA 2A6CA 4R8OA 2NUEA 2V88A 1RMDA 3C6MA 3HXUA 2EMAA 1NERA 3ME5A 3EPKA 3RMPA 2CROA 1ZBTA 4OLFA 3V7RA 3A9YA 2EWTA 4I8TA 3HXVA 1ZZBA 2J7JA 4X65E 4HRAA 2LCVA 1ZAYA 4YCWA 1WH6A 4O43A 4WXDA 5LL6R 3GN5B 2Q8UA 3ZOQB 4Q6GA 3ECRA 2I4OA 1B69A 3PZCA 4ER6A 3MQZA 4YRSA 1T38A 2EN8A 1EFWA 1G5HA 3P1XA 3TELA 2V3CC 1ZBQA 2IVGA 2KOUA 4EK9A 1LLIA 4BCAA 1G5IA 2OFYA 3SX0A 1TN9A 2AW6A 3IVPA 2JQEA 1X01A 2YT4A 3JAMC 4O5GA 4NCXA 3RUXA 2EMHA 5KL2A 4B3TE 5HGQA 4NHRA 2EPZA 2E10A 2AXVA 4X8WA 5AE1A 1X55A 2ZIOA 1SETA 4RMFA 4X62E 3SCGA 1PKPA 1B70A 1UXDA 2O4AA 1X2HA 3A9XA 4DPGA 2VRDA 5K98B 1N33E 2RHQB 4RHBB 1IL2A 2DQ0A 2ZZFA 2EPAA 2JR1A 4EQZA 3DNVB 2E5LE 1JK1A 3BBGA 3IKLA 4ER5A 1WH8A 1X48A 4YRFA 3RKYA 3PXPA 2V89A 3NXHA 4F54A 3R07A 3NROA 4IVZA 4R2CA 1HTTA 4YRNA 1B76A 2EOMA 2V86A 4HTGA 2ZR3A 3FYMA 3MSWA 3HPSA 2NUFA 4K0KE 2PXVA 1AAYA 5A7LA 4X4BA 2ZT7A 1BBUA 2ENHA 1NYQA 3A7RA 3OMLA 4B3RE 3HTZA 2EOYA 3LMLA 2ZR2A 4TVAB 2PMEA 1IMUA 1PJSA 1STUA 2DZCA 2HSGA 3QOXA 4WVLA 1DGCA 3ZPXA 3SCHA 2L49A 1I94E 2XXQA 3U3WA 4DE9A 3ADGA 1EVLA 2EQ3A 4H2SA 4HWOA 4AH6A 4LF6E 4P71A 4CH6A 2LYQA 2WCC3 1DI2A 2DQ3A 3F52A 2EQ1A 1MGTA 4LVLA 2PXLA 3LLHA 4LFAE 2D5VA 2ELZA 2LTSA 2KPJA 1PYSB 2QHUA 2XI8A 4EKGA 1U2ZA 4WYQB 4XU2A 3O9XA 1WHNA 4AQYE 3EFRA 1DULA 3T1HE 1VPWA 4LU9A 2Q5IA 4L8NA 4GHJA 4PHCA 2ZNIA 2DIXA 2JWOA 2BBGA 3GBFA 3VYYA 5DTMA 2LE2A 2PPXA 4OBMA 4DV5E 3G5GA 3I7FA 4G84A 4YP0A 2AXZA 2EOEA 2YTEA 2BNNA 4WSPA 1A1FA 5KL3A 3V8JA 3DM5A 1PRAA 4K87A 4YDQA 2PIJA 2EQ0A 2B5AA 4LTYA 4MCTA 1VQZA 1EIYA 1HXDA 3VQXA 4LNSA 2ICTA 4FBIA 2UUAE 3HXXA 1L0WA 3UFDA 4XTZA 4RQFA 3QOWA 2YPNA 3VBBA 1FKAE 3HFVA 1RZSA 1EFAA 4PU7A 4EZIA 4PU4C 1IQOA 4JI4E 4XTVA 2R63A 3EPLA 2HFZA 2ADRA 2R1FA 3C6KA 4ZYHA 2YRHA 5LMNE 1HNXE 2EMXA 2C8MA 4PG3A 3A74A 3G0TA 2PUCA 1LYLA 4O8BA 4J8ZA 4HA8A 3NELA 5E3IA 5C51B 3JXDL 5IXMB 2DXTA 2GHFA 5A2QC 2EMIA 2EMKA 2EPLX 4MLVA 5A6BD 4PU8A 3E9HA 4OOGC 4B3SE 3HXZA 2EMFA 4UP7A 1SR9A 2V87A 2MKNA 4P3PA 1ZZ9A 3J7Yp 4JI7E 4HEIA 2DTOA 3F6WA 1ZZCA 1LLMC 2EAYA 4J1XA 2DZ9A 2LYPA 1DQ3A 1HQ1A 2EN1A 4BC9A 3G1ZA 3HXLA 2EMLA 4ZYGA 2HNIA 2YU5A 4O2DA 2MXDA 2YSOA 1QB2A 2LYRA 3L4GA 2EOQA
chains in the Genus database with same CATH topology
2Q5HA 4M30A 1FJGE 4DUYE 4YRQA 1WHQA 1PYSA 2CJBA 2LNMA 4XTYA 2M7QA 2IHR1 2QHVA 1GZ6A 1BIBA 4XEOA 5AASA 2J7UA 2DEQA 4YRKA 2EJ9A 2RHQA 4P71C 3VYXA 3A7AA 3HPZA 2FYKA 1YYKA 5BR8E 4H2XA 4YPFA 1X2GA 4TTVA 3J80C 1IBME 5C52B 3ADLA 4Q15A 3ADIA 1E24A 1YGBA 4ZIBA 4DR1E 3TFLA 3HY1A 2DB2A 2EJGA 4P74A 1E1OA 1BBWA 5JUWA 3PCOA 5F5WA 1YFRA 2P0LA 4WJ4A 3RACA 4CH3A 4ER3A 3R09A 2DSYA 4CS4A 1N34E 2L92A 1X54A 2LLVA 1W66A 2Q7HA 1IBKE 1C0AA 1QF6A 2UUBE 3IWBA 1Z7MA 4K86A 3NZLA 1IBLE 2B9DA 1H4SA 1RQ0A 1YYWA 3OKZA 1XNRE 3QFIA 2DTIA 4K88A 4P7DA 4H2YA 1N36E 3AV0A 3C4TA 3OD1A 3QTCA 1T4OA 4BBYA 2E65A 3HFZA 4R03A 3OWQA 5T6JA 2QHTA 1X56A 1H4QA 2J7WA 1O0WA 4JI8E 4KHPE 4P74C 2EWNA 2XTIA 4YY3E 4JYAE 2E3CA 3RGLA 4ZTZB 4UP9A 3IALA 5FLXC 4LFCE 2L2MA 2FGGA 1EVKA 4TUGA 1H4VB 4LF5E 4JI1E 2ZINA 3GZDC 2ALYB 3MF1A 4DQ2A 1SRYA 4Q28A 2DU7A 2ZNJA 3TEGA 4KR3A 1USYA 3C4BA 4WI1A 3TEHA 1UILA 5C53B 2VQFE 3FJPA 2ALYA 3QO8A 2AMCA 2UUCE 1T4NA 3A5ZA 2F8BA 4KZSA 2DXUA 3L1AA 4TVYA 5ELNA 4F9CB 4UP8A 1HNWE 3ADJA 2NUGA 3LSSA 4XTXA 4XU1A 2JOBA 2XXPA 4JI5E 1GQEA 4GKKE 1WU7A 4JI3E 2RHSA 3LSQA 4KR2A 5F3WA 2FV4B 1ADJA 3QO7A 3M4QA 2M4HA 3RIRA 2DTHA 2E1HA 5K1PA 3TEPA 4DV3E 1J5WA 4RDXA 2ZZGA 3SR4A 1J26A 4F9BB 5DNYA 2ZT8A 2VEOA 3PE5A 4WPYA 3PZCA 4HWRA 5DTRA 3HTXA 4DV4E 2AKWB 2ODRC 3GZDA 2J3LA 3HXWA 1ATIA 5IWAE 4YREA 4CS2A 1J5EE 2ZZEA 2UXCE 2L1PA 3RL6A 1SESA 4HWPA 2L8TA 4XTWA 2ARSA 4G85A 4NXNE 2JOXA 4H2XB 2H36X 4ZTUB 4TUIA 1FYFA 5DT2A 2FTXB 1HNZE 4ER7A 1E1TA 2LBSB 2LUQA 4TQDA 1WNLA 2F4VE 4J15A 4EO4A 4M2ZA 11ASA 3NENA 4GEQB 2VE7C 3A9ZA 1UHZA 2KONA 3HY0A 1XMQE 2ZT6A 2I4NA 4YHHE 4CS3A 4HT4A 4DR3E 4P73C 4BWAA 4DR4E 5CFFE 4LF8E 1YB3A 2AMCB 3GUUA 2ZGWA 4UPAA 4F9AB 4JI2E 2M4IA 3F6HA 2I4LA 2NS6A 3P8VA 2V8QB 4DR2E 4P75A 3HFZB 1N32E 4NXME 2CJAA 4YRCA 3M9LA 5DRTA 4RQEA 2L3JA 3A5YA 3P8YA 2L2NA 3RF1A 2Q7EA 2LRSA 3F6GA 2LTRA 2IY5B 2LUPB 1WYDA 1KMMA 2JY9A 2B7VA 2P5IA 4TWAA 2CGHA 2UXDE 2UU9E 3IWDA 4YYEA 4XU3A 4BW9A 2ZM6E 4LF4E 1N9WA 3IWCA 3KWRA 2DQ3A 2ZT5A 1RC7A 2RS6A 3K6QA 4TQFA 1RIQA 4H2WA 4YRLA 3L4GB 3M4PA 3NEMA 4KQEA 2ODRD 3J81C 4I8OA 2ARUA 1JJCB 4LVMA 3V8LA 1GGMA 2LJHA 4P73A 2ZXFA 2ZCEA 4BS9A 3VQYA 1BIAA 1NYRA 2HCNA 3IG2A 3V8KA 5KNNA 1JJCA 4CH4A 3JTZA 2RHSB 4WJ3M 3OTOE 2E1MA 4LVIA 4DV1E 4OP0A 3MEYA 1NJ1A 1EKZA 3GZCA 4XEMA 4YRTA 4P78A 4XU0A 2MDRA 2V85A 3PCOB 1HR0E 4DKKA 3REUA 5ELOA 4YRPA 4ER0A 1NJ5A 3UGQA 2MC6A 2YBDA 2G7HA 1YYOA 1NJ8A 2DJZA 2CIMA 4WFTA 3LC0A 3RKXA 3AUZA 4DR7E 3V7SA 5DSXA 4YRGA 2VQEE 5LMUE 2A8EA 2PMFA 3ICAA 4YRIA 4LFBE 2C7IA 2I4MA 3MF2A 2EWLA 4JI0E 3ERRA 4HVCA 2DVEA 3REXA 2VF1A 3DSQA 2DU5A 1H4TA 1ADYA 4L87A 1ASZA 3V7CA 4YRRA 12ASA 2V83A 3QO5A 3QNEA 3VWSA 3A7UA 4YCUA 3UFGA 4GKJE 2DDZA 3HXYA 5DTQA 2K4VA 4DV0E 3UGTA 1NJ2A 4LVJA 1E22A 2LMZA 3VQVA 4E51A 2E64A 1NW3A 3DF6A 4XTUA 4BC7A 3CMQA 5AE3A 4H2VA 4DR5E 2EJFA 2QHSA 1QU6A 4DMIA 2WZOA 3WQZA 1YFSA 2E41A 1Z7NA 1USYC 4YROA 1B8AA 3EFSA 1EIYB 2HCSA 2N3GA 2KHXA 3JU0A 4P75C 4YRMA 4XTZA 4LF9E 3A32A 2DKGA 3RKWA 4P3NA 4EX5A 3J7AG 1WQWA 5IT9C 3TUPA 3T1YE 2HHHE 4H02A 2L3CA 3VQWA 1B70B 3UWPA 2UXBE 2EL9A 2G4CA 2YZTA 4DV2E 3BFMA 1XNQE 4P3OA 4YRJA 3HRIA 3NETA 3P8TA 5DRYA 1XMOE 1YZ9A 1HC7A 4H2TA 2B3TB 2L2KB 3H09A 2B7TA 1B7YB 3IKMB 3E9IA 3L2ZA 2RSMA 4EKIA 2CPNA 2N3HA 2ZTGA 5AE2A 2RS7A 3HQ1A 4NCXA 1SERA 1YFTA 4DV7E 1NNHA 4H2UA 4YCVA 2NA2A 2J3MA 4DE8A 2Q7GA 4B3ME 2EZ6A 3A31A 2L33A 4OX9E 1EQRA 3BJUA 1X49A 4HWTA 2ARTA 4P72A 1EOVA 4X5OA 4TVWA 2CJ9A 1KMNA 4L5NC 4P72C 2DMYA 1KOGA 3MEJA 3VK6A 1T4LB 1WPYA 2XGTA 3FIGA 4BMJA 1X47A 4LVKA 1ASYA 1QE0A 5K1XA 4DV6E 1WLEA 2MC5A 1G51A 3UH0A 2JVAA 2LLWA 4LF7E 4DUZE 3KFUA 4Q2JA 4M0VA 3HXZA 2L6MA 3DJWA 2RTXA 4DR6E 1WQ7A 2M1SA 4X66E 3TEHB 4JI6E 4X64E 2AKWA 2IY5A 3HRKA 4JV5E 1NJ6A 1B7YA 4TVAA 1WXRA 3W3SA 5ADZA 4CH5A 4HWSA 2ZIMA 4R8OA 2NUEA 2V88A 3HXUA 3RMPA 3ME5A 3V7RA 4OLFA 1ZBTA 3A9YA 3HXVA 4X65E 4HRAA 4YCWA 3ZOQB 4Q6GA 5LL6R 2I4OA 4YRSA 4ER6A 3MQZA 1EFWA 1G5HA 3P1XA 3TELA 4BCAA 1ZBQA 2KOUA 1G5IA 4EK9A 3SX0A 1X01A 2YT4A 3JAMC 3RUXA 4B3TE 5HGQA 2E10A 4X8WA 1X55A 5AE1A 2ZIOA 4RMFA 1SETA 4WF2A 4X62E 1B70A 1PKPA 1X2HA 4DPGA 3A9XA 1N33E 2RHQB 1IL2A 2DQ0A 2ZZFA 2JR1A 4EQZA 2E5LE 3IKLA 4ER5A 1X48A 4YRFA 3RKYA 2V89A 3R07A 3NXHA 4F54A 3NROA 1HTTA 1B76A 2V86A 2ZR3A 3MSWA 2NUFA 3HPSA 4K0KE 2ZT7A 1BBUA 1NYQA 3HTZA 3OMLA 4B3RE 4TVAB 3LMLA 2PMEA 2ZR2A 1STUA 2DZCA 3A7RA 3QOXA 4WVLA 3ZPXA 1I94E 4YRNA 2XXQA 3ADGA 4DE9A 1EVLA 4AH6A 4H2SA 4HWOA 4LF6E 4P71A 4CH6A 1DI2A 4LVLA 3LLHA 4LFAE 1PYSB 2LTSA 2QHUA 4EKGA 1U2ZA 4WYQB 4XU2A 1WHNA 4AQYE 3EFRA 3T1HE 4LU9A 2Q5IA 4L8NA 4PHCA 2ZNIA 2DIXA 2JWOA 3VYYA 5DTMA 2LE2A 4OBMA 4DV5E 3I7FA 4G84A 4YP0A 4WSPA 4YDQA 3V8JA 4K87A 4LTYA 1EIYA 1VQZA 1HXDA 3VQXA 4LNSA 2UUAE 3HXXA 1L0WA 4RQFA 3QOWA 3VBBA 1FKAE 3HFVA 4EZIA 4JI4E 4XTVA 2HFZA 5LMNE 1HNXE 2C8MA 4PG3A 3A74A 3G0TA 1LYLA 5E3IA 4J8ZA 4HA8A 3NELA 5C51B 2DXTA 5A2QC 3E9HA 4OOGC 4B3SE 4UP7A 1SR9A 2V87A 4P3PA 3J7Yp 4JI7E 2DTOA 2EAYA 2DZ9A 1DQ3A 4BC9A 3G1ZA 3HXLA 2HNIA 4O2DA 2MXDA 2E5AA 3L4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5H A;  4YRQ A;  1PYS A;  2CJB A;  4XTY A;  2QHV A;  1BIB A;  4XEO A;  2DEQ A;  4YRK A;  2EJ9 A;  2RHQ A;  4P71 C;  3A7A A;  2FYK A;  4H2X A;  4YPF A;  1X2G A;  4TTV A;  5C52 B;  4Q15 A;  1E24 A;  1YGB A;  4ZIB A;  3HY1 A;  2EJG A;  4P74 A;  1E1O A;  1BBW A;  3PCO A;  5F5W A;  1YFR A;  2P0L A;  4WJ4 A;  3RAC A;  4CH3 A;  4CS4 A;  1X54 A;  1W66 A;  2Q7H A;  1C0A A;  1QF6 A;  1Z7M A;  4K86 A;  1H4S A;  2DTI A;  4K88 A;  4H2Y A;  3OD1 A;  3QTC A;  2E65 A;  3HFZ A;  2QHT A;  1X56 A;  1H4Q A;  4P74 C;  2EWN A;  2XTI A;  2E3C A;  3RGL A;  4ZTZ B;  4UP9 A;  3IAL A;  1EVK A;  1H4V B;  2ZIN A;  2ALY B;  3MF1 A;  4DQ2 A;  1SRY A;  2DU7 A;  2ZNJ A;  3TEG A;  4KR3 A;  1USY A;  3TEH A;  4WI1 A;  5C53 B;  3FJP A;  2ALY A;  3QO8 A;  2AMC A;  3A5Z A;  2DXU A;  3L1A A;  4TVY A;  5ELN A;  4UP8 A;  3LSS A;  4XTX A;  4XU1 A;  1WU7 A;  4KR2 A;  2RHS A;  3LSQ A;  1ADJ A;  3QO7 A;  3M4Q A;  3RIR A;  2DTH A;  2E1H A;  5K1P A;  1J5W A;  4RDX A;  2ZZG A;  2ZT8 A;  3PZC A;  4HWR A;  2AKW B;  2ODR C;  2J3L A;  3HXW A;  1ATI A;  4YRE A;  4CS2 A;  2ZZE A;  3RL6 A;  1SES A;  4HWP A;  4XTW A;  2ARS A;  4G85 A;  4H2X B;  4ZTU B;  1FYF A;  1E1T A;  4TQD A;  1WNL A;  4J15 A;  4EO4 A;  11AS A;  3NEN A;  3HY0 A;  2ZT6 A;  2I4N A;  4CS3 A;  4BWA A;  4P73 C;  2AMC B;  1YB3 A;  2ZGW A;  4UPA A;  3P8V A;  2I4L A;  4P75 A;  3HFZ B;  2CJA A;  4YRC A;  4RQE A;  3A5Y A;  3P8Y A;  3RF1 A;  2Q7E A;  2IY5 B;  1WYD A;  1KMM A;  2P5I A;  4TWA A;  2CGH A;  4YYE A;  4XU3 A;  4BW9 A;  2ZT5 A;  1N9W A;  4TQF A;  2DQ3 A;  1RIQ A;  4H2W A;  4YRL A;  3L4G B;  3M4P A;  3NEM A;  4KQE A;  2ODR D;  2ARU A;  1JJC B;  3V8L A;  1GGM A;  4P73 A;  2ZXF A;  2ZCE A;  3VQY A;  1BIA A;  1NYR A;  3IG2 A;  3V8K A;  5KNN A;  1JJC A;  4CH4 A;  2RHS B;  4WJ3 M;  4OP0 A;  3MEY A;  1NJ1 A;  4YRT A;  4XEM A;  4XU0 A;  3PCO B;  3REU A;  5ELO A;  4YRP A;  1NJ5 A;  3UGQ A;  1NJ8 A;  2DJZ A;  2CIM A;  3LC0 A;  3RKX A;  3V7S A;  4YRG A;  2PMF A;  3ICA A;  4YRI A;  2C7I A;  2I4M A;  3MF2 A;  4HVC A;  3ERR A;  2DVE A;  3REX A;  3DSQ A;  2DU5 A;  1H4T A;  4L87 A;  1ADY A;  1ASZ A;  3V7C A;  4YRR A;  12AS A;  3QO5 A;  3QNE A;  3A7U A;  4YCU A;  3UFG A;  2DDZ A;  3HXY A;  3UGT A;  1NJ2 A;  1E22 A;  3VQV A;  4E51 A;  2E64 A;  4XTU A;  3CMQ A;  4H2V A;  2EJF A;  2QHS A;  3WQZ A;  1YFS A;  2E41 A;  1Z7N A;  1USY C;  4YRO A;  1B8A A;  3EFS A;  1EIY B;  4P75 C;  4YRM A;  4XTZ A;  3A32 A;  2DKG A;  3RKW A;  4P3N A;  4EX5 A;  1WQW A;  3TUP A;  4H02 A;  3VQW A;  1B70 B;  2EL9 A;  2G4C A;  3BFM A;  4P3O A;  4YRJ A;  3HRI A;  3NET A;  3P8T A;  1HC7 A;  4H2T A;  1B7Y B;  3IKM B;  3E9I A;  3L2Z A;  2ZTG A;  4NCX A;  1SER A;  1YFT A;  1NNH A;  4H2U A;  4YCV A;  2J3M A;  2Q7G A;  3A31 A;  1EQR A;  3BJU A;  4HWT A;  2ART A;  4P72 A;  1EOV A;  4X5O A;  4TVW A;  2CJ9 A;  1KMN A;  4P72 C;  1KOG A;  1WPY A;  2XGT A;  1ASY A;  1QE0 A;  5K1X A;  1WLE A;  1G51 A;  3UH0 A;  3KFU A;  3HXZ A;  1WQ7 A;  3TEH B;  2AKW A;  2IY5 A;  3HRK A;  1NJ6 A;  1B7Y A;  4TVA A;  3W3S A;  4CH5 A;  4HWS A;  2ZIM A;  3HXU A;  3V7R A;  4OLF A;  3HXV A;  4YCW A;  4Q6G A;  2I4O A;  4YRS A;  1EFW A;  1G5H A;  1G5I A;  1X01 A;  3RUX A;  5HGQ A;  2E10 A;  1X55 A;  2ZIO A;  4WF2 A;  4RMF A;  1SET A;  1B70 A;  1X2H A;  4DPG A;  2RHQ B;  1IL2 A;  2DQ0 A;  2ZZF A;  3IKL A;  4YRF A;  3RKY A;  3R07 A;  1HTT A;  1B76 A;  2ZR3 A;  2ZT7 A;  1BBU A;  1NYQ A;  3HTZ A;  4TVA B;  2PME A;  2ZR2 A;  2DZC A;  3A7R A;  4YRN A;  4AH6 A;  1EVL A;  4H2S A;  4HWO A;  4P71 A;  4CH6 A;  1PYS B;  2QHU A;  4XU2 A;  3EFR A;  2Q5I A;  4PHC A;  2ZNI A;  3I7F A;  4G84 A;  4YP0 A;  4YDQ A;  3V8J A;  4K87 A;  1EIY A;  1VQZ A;  1HXD A;  3VQX A;  4LNS A;  3HXX A;  1L0W A;  4RQF A;  3VBB A;  3HFV A;  4XTV A;  2C8M A;  4PG3 A;  3A74 A;  1LYL A;  5E3I A;  4HA8 A;  3NEL A;  5C51 B;  2DXT A;  3E9H A;  4UP7 A;  4P3P A;  2DTO A;  2EAY A;  2DZ9 A;  3G1Z A;  2HNI A;  4O2D A;  2E5A A;  3L4G A; 
#chains in the Genus database with same CATH topology
 2Q5H A;  2WBS A;  2ENA A;  4M30 A;  4DUY E;  2I9I A;  1FJG E;  2EL4 A;  1YUJ A;  4YRQ A;  1WHQ A;  1PYS A;  2CJB A;  4YRM A;  4O24 A;  2LNM A;  4XTY A;  2M7Q A;  2IHR 1;  1JFS A;  2QHV A;  3QWG A;  2XIU A;  1JFT A;  1GZ6 A;  3QYX A;  2DMI A;  2DLQ A;  4YRR A;  3V7C A;  1YUI A;  1BIB A;  4XEO A;  5A69 A;  3BDN A;  5AAS A;  2J7U A;  2DEQ A;  4YRK A;  1ZAA C;  2EJ9 A;  1ZR9 A;  2PUE A;  1WRJ A;  2HIN A;  2RHQ A;  3VYX A;  4P71 C;  4Z5D A;  2EPN A;  3HPZ A;  3A7A A;  4YBA A;  2FYK A;  4WXC A;  1YYK A;  4I6U A;  5BR8 E;  1YSA C;  2EN4 A;  3EPH A;  1EH7 A;  1ASZ A;  2PXD A;  1QQB A;  4H2X A;  4YPF A;  1X2G A;  2M9A A;  1F2I G;  4TTV A;  2GRL A;  1IC8 A;  2PUA A;  3J80 C;  1IBM E;  5C52 B;  3ADL A;  4Q15 A;  1QP0 A;  3ADI A;  1E24 A;  1YGB A;  4DR1 E;  3TFL A;  3CLC A;  3HY1 A;  2RQL A;  2DB2 A;  2EJG A;  4P74 A;  1E1O A;  1BBW A;  5JUW A;  3PCO A;  2EM8 A;  1A1L A;  1YFR A;  5F5W A;  2P0L A;  4WJ4 A;  3RAC A;  1X3C A;  4CH3 A;  4ER3 A;  3R09 A;  2DSY A;  4CS4 A;  2L8N A;  1CQT A;  1EH6 A;  2L92 A;  2LLV A;  2LV2 A;  2LVH A;  2PRT A;  2IUO A;  1N34 E;  1W66 A;  1IBK E;  1X54 A;  2Q7H A;  1C0A A;  1DW9 A;  1YFH A;  3TQM A;  1QF6 A;  3KZ3 A;  3NDB B;  3IWB A;  1UBD C;  2UUB E;  3F51 A;  1Z7M A;  4K86 A;  2DLK A;  1X6H A;  3NZL A;  3THO B;  1PJQ A;  1IBL E;  2B9D A;  4FK5 C;  1H4S A;  1Y9Q A;  1RQ0 A;  1YYW A;  3OKZ A;  3QFI A;  5KL7 A;  1XNR E;  2DTI A;  4K88 A;  4P7D A;  1IQS A;  4X4D A;  2H8R A;  5IV8 B;  3CRO L;  5KL4 A;  2YTN A;  4H2Y A;  2PXB A;  1N36 E;  3AV0 A;  2GZU A;  1NEI A;  4WX9 A;  1MEY C;  3C4T A;  3OD1 A;  3QTC A;  1T4O A;  4BBY A;  1X5W A;  2I13 A;  2E65 A;  2LT7 A;  1LMB 3;  2EPK X;  2IV1 A;  3OWQ A;  2EM0 A;  4R03 A;  5T6J A;  1BB8 A;  1X56 A;  2QHT A;  3HFZ A;  2J7W A;  1O0W A;  2O38 A;  2ZT5 A;  3H5T A;  2YRK A;  2PXK A;  1H4Q A;  4JI8 E;  4KHP E;  4Z59 A;  4P74 C;  2EWN A;  2XTI A;  4YY3 E;  4JYA E;  2E3C A;  1GTK A;  2GLI A;  3RGL A;  3HZI B;  1PER L;  4ZTZ B;  4UP9 A;  3LIS A;  5FLX C;  1QP7 A;  4LFC E;  2AWI A;  1G2F C;  3IAL A;  2L2M A;  2FGG A;  1EVK A;  4TUG A;  2JYA A;  2KEJ A;  1H4V B;  4LF5 E;  4JI1 E;  2KEI A;  4M9V C;  3GZD C;  2ALY B;  2ZIN A;  1TF6 A;  3MF1 A;  4DQ2 A;  1A1J A;  1SRY A;  3CEC A;  3L1P A;  4Q28 A;  2DU7 A;  2ZNJ A;  3TEG A;  4KR3 A;  1USY A;  3C4B A;  4WI1 A;  3TEH A;  1UIL A;  5C53 B;  2VQF E;  1JWL A;  3KZY A;  2ALY A;  3G7D A;  2MEZ A;  2AMC A;  3FJP A;  3QO8 A;  2UUC E;  4IJD A;  1T4N A;  3A5Z A;  2F8B A;  2EOR A;  4KZS A;  2DXU A;  3L1A A;  4TVY A;  5ELN A;  2GRM A;  4F9C B;  1P47 A;  4UP8 A;  1HNW E;  3ADJ A;  2NUG A;  3LSS A;  2NAB A;  2LYL A;  1WIZ A;  3VK0 A;  4XTX A;  4XU1 A;  2EPX A;  2XXP A;  4YG4 A;  1GQE A;  2JOB A;  4JI5 E;  4GKK E;  4JI3 E;  1WU7 A;  2RHS A;  4Z5H A;  3LSQ A;  5F3W A;  4KR2 A;  4X4C A;  2FV4 B;  1ADJ A;  3QO7 A;  3M4Q A;  1A1H A;  2M4H A;  3RIR A;  2DTH A;  2E1H A;  5K1P A;  3TEP A;  2BJC A;  4DV3 E;  2JPA A;  4O4K A;  4Y42 A;  1J5W A;  4RDX A;  2ZZG A;  3SR4 A;  2R76 A;  4F9B B;  5DNY A;  1J26 A;  2VEO A;  2ZT8 A;  3PE5 A;  3ZHM A;  2LYJ A;  1NEQ A;  5DTR A;  2EP3 A;  1RZR D;  2PUD A;  4WPY A;  4DV4 E;  3HTX A;  2AKW B;  1KJK A;  4M0V A;  1ZUG A;  2MQK A;  2PXE A;  3GZD A;  2ODR C;  2J3L A;  3HXW A;  3QG5 C;  1UTX A;  1ZPQ A;  2PUB A;  1SFE A;  2EM5 A;  5A6K A;  2IU7 A;  2EM7 A;  1ATI A;  4WSG A;  4I6R A;  5IWA E;  2HGH A;  4YRE A;  3JXB C;  1BBO A;  4CS2 A;  1S7E A;  4I6T A;  4PU3 C;  1KYQ A;  3KJX A;  1Z1B A;  1J5E E;  2ZZE A;  2UXC E;  2L1P A;  2K7I A;  3RL6 A;  1SES A;  4HWP A;  2L8T A;  2YTO A;  3SCF A;  2XXA A;  2YU8 A;  3MHS C;  2ARS A;  2JXP A;  4XTW A;  2DRP A;  4G85 A;  4NXN E;  2JOX A;  5A6A A;  2H36 X;  3P8V A;  2EM2 A;  4H2X B;  4ZTU B;  4TUI A;  1FYF A;  2LYK A;  5DT2 A;  3MLF A;  2FTX B;  4JQD A;  1HNZ E;  4ER7 A;  1E1T A;  2LBS B;  2LUQ A;  4TQD A;  1WNL A;  1A1G A;  1ZVV A;  2F4V E;  4J15 A;  4M2Z A;  4EO4 A;  1N3G A;  3NEN A;  11AS A;  4GEQ B;  5LLQ A;  2LYS A;  3A9Z A;  1NCS A;  2VE7 C;  1UHZ A;  2KON A;  2CTD A;  2YTD A;  1XMQ E;  3HY0 A;  2ZT6 A;  2I4N A;  4YHH E;  4CS3 A;  1DWK A;  2EMZ A;  2YTF A;  4HT4 A;  4DR3 E;  2CT1 A;  4P73 C;  4DR4 E;  4BWA A;  2PE5 A;  5CFF E;  4LF8 E;  1YB3 A;  3GUU A;  2AMC B;  2ZGW A;  4UPA A;  4F9A B;  1X6E A;  3S8Q A;  3THN A;  4R2R A;  2M4I A;  4JI2 E;  1PDA A;  1OCT C;  2EPO A;  3F6H A;  1A1K A;  3EQ1 A;  5KL6 A;  2I4L A;  2AUW A;  2V8Q B;  4DR2 E;  2NS6 A;  4P75 A;  3TRB A;  3HFZ B;  1N32 E;  4NXM E;  3R1F A;  1OSL A;  1PRU A;  5A6J A;  2CJA A;  4YRC A;  3M9L A;  4NDW A;  5DRT A;  2EJ4 A;  2YTI A;  2JP9 A;  4RQE A;  2L3J A;  1ZZ7 A;  2YTG A;  3KL4 A;  1BBG A;  3A5Y A;  3P8Y A;  1Y7Y A;  2L2N A;  3FMY A;  3RF1 A;  4F2J C;  2LRS A;  2Q7E A;  3F6G A;  2LTR A;  1A1I A;  2IY5 B;  5GAH i;  2LUP B;  1WYD A;  1KMM A;  2JY9 A;  3LFP A;  2B7V A;  2P5I A;  2EL5 A;  4TWA A;  2CSH A;  2CGH A;  2UXD E;  2ELY A;  2EMY A;  2UU9 E;  3IWD A;  2FJR A;  2PUF A;  4YYE A;  4XU3 A;  4BW9 A;  2ZM6 E;  1MFQ C;  4LF4 E;  1RZR A;  3IWC A;  3KWR A;  1N9W A;  2RS6 A;  3OMT A;  2PXF A;  2BNM A;  3K6Q A;  4RH8 A;  1QQA A;  1RC7 A;  2XJ3 A;  1RIQ A;  4H2W A;  4YRL A;  3L4G B;  3M4P A;  1YSE A;  3NEM A;  4KQE A;  2ODR D;  3LQX A;  4X4G A;  4I8O A;  3J81 C;  2ARU A;  3EUS A;  1JJC B;  1UN6 B;  4LVM A;  3V8L A;  4R2E A;  2EF8 A;  2LJH A;  1GGM A;  2ZCE A;  2ZXF A;  4P73 A;  2CSF A;  4BS9 A;  3VQY A;  1BIA A;  1NYR A;  2HCN A;  2EM3 A;  4GQM A;  2N8X A;  4OB4 A;  3IG2 A;  3V8K A;  2EPC A;  5KNN A;  1L1M A;  1JJC A;  2LJU A;  3JTZ A;  2RHS B;  4CH4 A;  4WJ3 M;  1HF0 A;  3OTO E;  1WET A;  2E1M A;  2EM6 A;  4HWR A;  4DV1 E;  4OP0 A;  4LVI A;  4X4E A;  3MEY A;  1NJ1 A;  1EKZ A;  3GZC A;  4XEM A;  4YRT A;  2EOO A;  1BDI A;  2YWQ A;  4P78 A;  4XU0 A;  2O49 A;  2EBY A;  2BNO A;  1EH8 A;  1YPN A;  2MDR A;  2V85 A;  3L00 A;  2EOI A;  1HR0 E;  3PCO B;  4DKK A;  2EN3 A;  3REU A;  1X57 A;  5KL5 A;  5ELO A;  1R63 A;  4YRP A;  2GPI A;  4ER0 A;  1NJ5 A;  4X4H A;  3B7H A;  3BD1 A;  1PJT A;  3UGQ A;  2EOZ A;  3BGH A;  2MC6 A;  2YBD A;  2G7H A;  1YYO A;  1NJ8 A;  4TQF A;  1ZZ6 A;  4WF2 A;  2DJZ A;  4X9J A;  4WFT A;  2CIM A;  2MKD A;  3LC0 A;  3RKX A;  1QNT A;  2EPU A;  3AUZ A;  3OQO A;  4DR7 E;  2EOF A;  3V7S A;  5DSX A;  4YRG A;  2VQE E;  3OQN A;  5LMU E;  2A8E A;  4YAR A;  3QQ6 A;  2PMF A;  1POU A;  2PXT A;  3ICA A;  4YRI A;  2R1J L;  1O4X A;  4IA8 A;  2MDG A;  4N4R B;  4F6M A;  4LFB E;  2C7I A;  3BF2 A;  2EWL A;  3ZKC A;  4JI0 E;  2I4M A;  1QPZ A;  3ERR A;  2DVE A;  3REX A;  2EOH A;  2VF1 A;  2PUG A;  3DSQ A;  2DU5 A;  2KEK A;  4Z5C A;  4F8D A;  2EMB A;  3EPJ A;  1ADY A;  1H4T A;  4L87 A;  5AC4 A;  2V83 A;  4R2P A;  12AS A;  3QO5 A;  3QNE A;  3KXA A;  3VWS A;  3A7U A;  4YCU A;  3UFG A;  4GKJ E;  2EN2 A;  2DDZ A;  3HXY A;  5DTQ A;  4X4I A;  2XCJ A;  2K4V A;  4YG1 A;  4DV0 E;  1NJ2 A;  1E3O C;  3UGT A;  4LVJ A;  5A6B A;  2LMZ A;  1E22 A;  3VQV A;  4E51 A;  2E64 A;  1NW3 A;  2IVB A;  3DF6 A;  4BC7 A;  4XTU A;  3CMQ A;  2HJJ A;  5AE3 A;  5AC5 A;  4H2V A;  1B0N A;  4DR5 E;  2XSD C;  2EJF A;  3KZZ A;  4R2A A;  2QHS A;  1QU6 A;  4DMI A;  2WZO A;  4IS1 C;  2RPC A;  3WQZ A;  1BDH A;  4KWY A;  1X6F A;  1YFS A;  2E41 A;  1Z7N A;  1USY C;  3JXC L;  4R2D A;  4YRO A;  1B8A A;  3EFS A;  1EIY B;  2A25 A;  2PXQ A;  2HCS A;  2N3G A;  2DGC A;  2EN7 A;  2KHX A;  2YRM A;  2EMG A;  1ZZ8 A;  1SQ8 A;  2YTP A;  3JU0 A;  5TSE A;  4R2S A;  2E72 A;  1T39 A;  2EE8 A;  2ENC A;  4LF9 E;  2DKG A;  3A32 A;  1X2L A;  3RKW A;  1LCC A;  4P3N A;  1GT0 C;  4EX5 A;  3J7A G;  1WQW A;  5IT9 C;  1TF3 A;  2EOX A;  2LCE A;  4ZYD A;  3T1Y E;  2HHH E;  4H02 A;  3TUP A;  3ZHI A;  2L3C A;  3VQW A;  1B70 B;  3UWP A;  4R2Q A;  3BS3 A;  2UXB E;  3VHT B;  2EL9 A;  2G4C A;  2YZT A;  3M99 B;  4DV2 E;  1XNQ E;  3BFM A;  4P3O A;  4YRJ A;  3HRI A;  3NET A;  3P8T A;  1PNR A;  5DRY A;  2LO3 A;  1XMO E;  3RZZ A;  1YZ9 A;  1HC7 A;  4H2T A;  2B3T B;  4MLQ A;  2L2K B;  3H09 A;  2B7T A;  2EM4 A;  2EPM X;  2EMW A;  1B7Y B;  5GAG i;  3OP9 A;  3IKM B;  1AU7 A;  1QP4 A;  3E9I A;  3L2Z A;  2RSM A;  4EKI A;  2CPN A;  2N3H A;  2ZTG A;  2RS7 A;  3GN5 A;  3D1N I;  3HQ1 A;  5AE2 A;  1YFT A;  4ZIB A;  1SER A;  4FN3 A;  2EPR A;  4DV7 E;  1NNH A;  4H2U A;  2NA2 A;  2E5A A;  4YCV A;  2JCG A;  2J3M A;  3MF2 A;  4DE8 A;  2Q7G A;  4B3M E;  2EZ6 A;  3BID A;  2HC5 A;  3A31 A;  2L33 A;  4ZYE A;  4OX9 E;  1EQR A;  3BJU A;  1ZU1 A;  1X49 A;  2FFH A;  4HWT A;  2ART A;  4P72 A;  4JCX A;  2IVQ A;  2JVL A;  3QF3 A;  2EN6 A;  4BHC A;  1EOV A;  4TVW A;  4JCY A;  4X5O A;  2CJ9 A;  4HVC A;  4P75 C;  1L4S A;  2EMC A;  1LCD A;  4GZN C;  1KMN A;  1R69 A;  2OR1 L;  1CJG A;  3KFU A;  1UXC A;  1ZS4 A;  2EOS A;  4L5N C;  4IWR A;  2EL6 A;  2BB8 A;  4P72 C;  2DMY A;  1KOG A;  2WIU B;  3MEJ A;  3UK3 C;  3VK6 A;  1T4L B;  1WPY A;  2XGT A;  4X4F A;  3FIG A;  4BMJ A;  1X47 A;  4LVK A;  1ASY A;  1QE0 A;  2YTQ A;  1JK2 A;  5K1X A;  4DV6 E;  2EM9 A;  2MC5 A;  1WLE A;  4F6N A;  1RIO A;  1WJP A;  1G51 A;  3UH0 A;  2JVA A;  2LLW A;  2PXU A;  4LF7 E;  2WBU A;  2WBT A;  2EPP A;  4DUZ E;  2ICP A;  3FYA A;  4MCX A;  4Q2J A;  3OQM A;  1XWR A;  2L6M A;  4Z58 A;  3DJW A;  2RSI A;  3MHH C;  2WUS R;  2RTX A;  4J1W A;  2EOJ A;  1G2D C;  4DR6 E;  1WQ7 A;  2YTJ A;  2M1S A;  4X66 E;  3TEH B;  2YSP A;  4JI6 E;  1LQC A;  2AXU A;  2PXP A;  1PRV A;  4X64 E;  2AKW A;  3HRK A;  2IY5 A;  2D9H A;  4JV5 E;  2KZ8 A;  1NJ6 A;  1AH5 A;  4YG7 B;  1B7Y A;  4TVA A;  1WXR A;  3W3S A;  1RPE L;  1QZX A;  4NZV A;  4Q35 B;  5ADZ A;  4CH5 A;  4HWS A;  1ADR A;  1JH9 A;  2ZIM A;  4BHB A;  2A6C A;  4R8O A;  2NUE A;  2V88 A;  1RMD A;  3C6M A;  3HXU A;  2EMA A;  1NER A;  3ME5 A;  3EPK A;  3RMP A;  2CRO A;  1ZBT A;  4OLF A;  3V7R A;  3A9Y A;  2EWT A;  4I8T A;  3HXV A;  1ZZB A;  2J7J A;  4X65 E;  4HRA A;  2LCV A;  1ZAY A;  4YCW A;  1WH6 A;  4O43 A;  4WXD A;  5LL6 R;  3GN5 B;  2Q8U A;  3ZOQ B;  4Q6G A;  3ECR A;  2I4O A;  1B69 A;  3PZC A;  4ER6 A;  3MQZ A;  4YRS A;  1T38 A;  2EN8 A;  1EFW A;  1G5H A;  3P1X A;  3TEL A;  2V3C C;  1ZBQ A;  2IVG A;  2KOU A;  4EK9 A;  1LLI A;  4BCA A;  1G5I A;  2OFY A;  3SX0 A;  1TN9 A;  2AW6 A;  3IVP A;  2JQE A;  1X01 A;  2YT4 A;  3JAM C;  4O5G A;  4NCX A;  3RUX A;  2EMH A;  5KL2 A;  4B3T E;  5HGQ A;  4NHR A;  2EPZ A;  2E10 A;  2AXV A;  4X8W A;  5AE1 A;  1X55 A;  2ZIO A;  1SET A;  4RMF A;  4X62 E;  3SCG A;  1PKP A;  1B70 A;  1UXD A;  2O4A A;  1X2H A;  3A9X A;  4DPG A;  2VRD A;  5K98 B;  1N33 E;  2RHQ B;  4RHB B;  1IL2 A;  2DQ0 A;  2ZZF A;  2EPA A;  2JR1 A;  4EQZ A;  3DNV B;  2E5L E;  1JK1 A;  3BBG A;  3IKL A;  4ER5 A;  1WH8 A;  1X48 A;  4YRF A;  3RKY A;  3PXP A;  2V89 A;  3NXH A;  4F54 A;  3R07 A;  3NRO A;  4IVZ A;  4R2C A;  1HTT A;  4YRN A;  1B76 A;  2EOM A;  2V86 A;  4HTG A;  2ZR3 A;  3FYM A;  3MSW A;  3HPS A;  2NUF A;  4K0K E;  2PXV A;  1AAY A;  5A7L A;  4X4B A;  2ZT7 A;  1BBU A;  2ENH A;  1NYQ A;  3A7R A;  3OML A;  4B3R E;  3HTZ A;  2EOY A;  3LML A;  2ZR2 A;  4TVA B;  2PME A;  1IMU A;  1PJS A;  1STU A;  2DZC A;  2HSG A;  3QOX A;  4WVL A;  1DGC A;  3ZPX A;  3SCH A;  2L49 A;  1I94 E;  2XXQ A;  3U3W A;  4DE9 A;  3ADG A;  1EVL A;  2EQ3 A;  4H2S A;  4HWO A;  4AH6 A;  4LF6 E;  4P71 A;  4CH6 A;  2LYQ A;  2WCC 3;  1DI2 A;  2DQ3 A;  3F52 A;  2EQ1 A;  1MGT A;  4LVL A;  2PXL A;  3LLH A;  4LFA E;  2D5V A;  2ELZ A;  2LTS A;  2KPJ A;  1PYS B;  2QHU A;  2XI8 A;  4EKG A;  1U2Z A;  4WYQ B;  4XU2 A;  3O9X A;  1WHN A;  4AQY E;  3EFR A;  1DUL A;  3T1H E;  1VPW A;  4LU9 A;  2Q5I A;  4L8N A;  4GHJ A;  4PHC A;  2ZNI A;  2DIX A;  2JWO A;  2BBG A;  3GBF A;  3VYY A;  5DTM A;  2LE2 A;  2PPX A;  4OBM A;  4DV5 E;  3G5G A;  3I7F A;  4G84 A;  4YP0 A;  2AXZ A;  2EOE A;  2YTE A;  2BNN A;  4WSP A;  1A1F A;  5KL3 A;  3V8J A;  3DM5 A;  1PRA A;  4K87 A;  4YDQ A;  2PIJ A;  2EQ0 A;  2B5A A;  4LTY A;  4MCT A;  1VQZ A;  1EIY A;  1HXD A;  3VQX A;  4LNS A;  2ICT A;  4FBI A;  2UUA E;  3HXX A;  1L0W A;  3UFD A;  4XTZ A;  4RQF A;  3QOW A;  2YPN A;  3VBB A;  1FKA E;  3HFV A;  1RZS A;  1EFA A;  4PU7 A;  4EZI A;  4PU4 C;  1IQO A;  4JI4 E;  4XTV A;  2R63 A;  3EPL A;  2HFZ A;  2ADR A;  2R1F A;  3C6K A;  4ZYH A;  2YRH A;  5LMN E;  1HNX E;  2EMX A;  2C8M A;  4PG3 A;  3A74 A;  3G0T A;  2PUC A;  1LYL A;  4O8B A;  4J8Z A;  4HA8 A;  3NEL A;  5E3I A;  5C51 B;  3JXD L;  5IXM B;  2DXT A;  2GHF A;  5A2Q C;  2EMI A;  2EMK A;  2EPL X;  4MLV A;  5A6B D;  4PU8 A;  3E9H A;  4OOG C;  4B3S E;  3HXZ A;  2EMF A;  4UP7 A;  1SR9 A;  2V87 A;  2MKN A;  4P3P A;  1ZZ9 A;  3J7Y p;  4JI7 E;  4HEI A;  2DTO A;  3F6W A;  1ZZC A;  1LLM C;  2EAY A;  4J1X A;  2DZ9 A;  2LYP A;  1DQ3 A;  1HQ1 A;  2EN1 A;  4BC9 A;  3G1Z A;  3HXL A;  2EML A;  4ZYG A;  2HNI A;  2YU5 A;  4O2D A;  2MXD A;  2YSO A;  1QB2 A;  2LYR A;  3L4G A;  2EOQ A; 
#chains in the Genus database with same CATH homology
 2Q5H A;  4M30 A;  1FJG E;  4DUY E;  4YRQ A;  1WHQ A;  1PYS A;  2CJB A;  2LNM A;  4XTY A;  2M7Q A;  2IHR 1;  2QHV A;  1GZ6 A;  1BIB A;  4XEO A;  5AAS A;  2J7U A;  2DEQ A;  4YRK A;  2EJ9 A;  2RHQ A;  4P71 C;  3VYX A;  3A7A A;  3HPZ A;  2FYK A;  1YYK A;  5BR8 E;  4H2X A;  4YPF A;  1X2G A;  4TTV A;  3J80 C;  1IBM E;  5C52 B;  3ADL A;  4Q15 A;  3ADI A;  1E24 A;  1YGB A;  4ZIB A;  4DR1 E;  3TFL A;  3HY1 A;  2DB2 A;  2EJG A;  4P74 A;  1E1O A;  1BBW A;  5JUW A;  3PCO A;  5F5W A;  1YFR A;  2P0L A;  4WJ4 A;  3RAC A;  4CH3 A;  4ER3 A;  3R09 A;  2DSY A;  4CS4 A;  1N34 E;  2L92 A;  1X54 A;  2LLV A;  1W66 A;  2Q7H A;  1IBK E;  1C0A A;  1QF6 A;  2UUB E;  3IWB A;  1Z7M A;  4K86 A;  3NZL A;  1IBL E;  2B9D A;  1H4S A;  1RQ0 A;  1YYW A;  3OKZ A;  1XNR E;  3QFI A;  2DTI A;  4K88 A;  4P7D A;  4H2Y A;  1N36 E;  3AV0 A;  3C4T A;  3OD1 A;  3QTC A;  1T4O A;  4BBY A;  2E65 A;  3HFZ A;  4R03 A;  3OWQ A;  5T6J A;  2QHT A;  1X56 A;  1H4Q A;  2J7W A;  1O0W A;  4JI8 E;  4KHP E;  4P74 C;  2EWN A;  2XTI A;  4YY3 E;  4JYA E;  2E3C A;  3RGL A;  4ZTZ B;  4UP9 A;  3IAL A;  5FLX C;  4LFC E;  2L2M A;  2FGG A;  1EVK A;  4TUG A;  1H4V B;  4LF5 E;  4JI1 E;  2ZIN A;  3GZD C;  2ALY B;  3MF1 A;  4DQ2 A;  1SRY A;  4Q28 A;  2DU7 A;  2ZNJ A;  3TEG A;  4KR3 A;  1USY A;  3C4B A;  4WI1 A;  3TEH A;  1UIL A;  5C53 B;  2VQF E;  3FJP A;  2ALY A;  3QO8 A;  2AMC A;  2UUC E;  1T4N A;  3A5Z A;  2F8B A;  4KZS A;  2DXU A;  3L1A A;  4TVY A;  5ELN A;  4F9C B;  4UP8 A;  1HNW E;  3ADJ A;  2NUG A;  3LSS A;  4XTX A;  4XU1 A;  2JOB A;  2XXP A;  4JI5 E;  1GQE A;  4GKK E;  1WU7 A;  4JI3 E;  2RHS A;  3LSQ A;  4KR2 A;  5F3W A;  2FV4 B;  1ADJ A;  3QO7 A;  3M4Q A;  2M4H A;  3RIR A;  2DTH A;  2E1H A;  5K1P A;  3TEP A;  4DV3 E;  1J5W A;  4RDX A;  2ZZG A;  3SR4 A;  1J26 A;  4F9B B;  5DNY A;  2ZT8 A;  2VEO A;  3PE5 A;  4WPY A;  3PZC A;  4HWR A;  5DTR A;  3HTX A;  4DV4 E;  2AKW B;  2ODR C;  3GZD A;  2J3L A;  3HXW A;  1ATI A;  5IWA E;  4YRE A;  4CS2 A;  1J5E E;  2ZZE A;  2UXC E;  2L1P A;  3RL6 A;  1SES A;  4HWP A;  2L8T A;  4XTW A;  2ARS A;  4G85 A;  4NXN E;  2JOX A;  4H2X B;  2H36 X;  4ZTU B;  4TUI A;  1FYF A;  5DT2 A;  2FTX B;  1HNZ E;  4ER7 A;  1E1T A;  2LBS B;  2LUQ A;  4TQD A;  1WNL A;  2F4V E;  4J15 A;  4EO4 A;  4M2Z A;  11AS A;  3NEN A;  4GEQ B;  2VE7 C;  3A9Z A;  1UHZ A;  2KON A;  3HY0 A;  1XMQ E;  2ZT6 A;  2I4N A;  4YHH E;  4CS3 A;  4HT4 A;  4DR3 E;  4P73 C;  4BWA A;  4DR4 E;  5CFF E;  4LF8 E;  1YB3 A;  2AMC B;  3GUU A;  2ZGW A;  4UPA A;  4F9A B;  4JI2 E;  2M4I A;  3F6H A;  2I4L A;  2NS6 A;  3P8V A;  2V8Q B;  4DR2 E;  4P75 A;  3HFZ B;  1N32 E;  4NXM E;  2CJA A;  4YRC A;  3M9L A;  5DRT A;  4RQE A;  2L3J A;  3A5Y A;  3P8Y A;  2L2N A;  3RF1 A;  2Q7E A;  2LRS A;  3F6G A;  2LTR A;  2IY5 B;  2LUP B;  1WYD A;  1KMM A;  2JY9 A;  2B7V A;  2P5I A;  4TWA A;  2CGH A;  2UXD E;  2UU9 E;  3IWD A;  4YYE A;  4XU3 A;  4BW9 A;  2ZM6 E;  4LF4 E;  1N9W A;  3IWC A;  3KWR A;  2DQ3 A;  2ZT5 A;  1RC7 A;  2RS6 A;  3K6Q A;  4TQF A;  1RIQ A;  4H2W A;  4YRL A;  3L4G B;  3M4P A;  3NEM A;  4KQE A;  2ODR D;  3J81 C;  4I8O A;  2ARU A;  1JJC B;  4LVM A;  3V8L A;  1GGM A;  2LJH A;  4P73 A;  2ZXF A;  2ZCE A;  4BS9 A;  3VQY A;  1BIA A;  1NYR A;  2HCN A;  3IG2 A;  3V8K A;  5KNN A;  1JJC A;  4CH4 A;  3JTZ A;  2RHS B;  4WJ3 M;  3OTO E;  2E1M A;  4LVI A;  4DV1 E;  4OP0 A;  3MEY A;  1NJ1 A;  1EKZ A;  3GZC A;  4XEM A;  4YRT A;  4P78 A;  4XU0 A;  2MDR A;  2V85 A;  3PCO B;  1HR0 E;  4DKK A;  3REU A;  5ELO A;  4YRP A;  4ER0 A;  1NJ5 A;  3UGQ A;  2MC6 A;  2YBD A;  2G7H A;  1YYO A;  1NJ8 A;  2DJZ A;  2CIM A;  4WFT A;  3LC0 A;  3RKX A;  3AUZ A;  4DR7 E;  3V7S A;  5DSX A;  4YRG A;  2VQE E;  5LMU E;  2A8E A;  2PMF A;  3ICA A;  4YRI A;  4LFB E;  2C7I A;  2I4M A;  3MF2 A;  2EWL A;  4JI0 E;  3ERR A;  4HVC A;  2DVE A;  3REX A;  2VF1 A;  3DSQ A;  2DU5 A;  1H4T A;  1ADY A;  4L87 A;  1ASZ A;  3V7C A;  4YRR A;  12AS A;  2V83 A;  3QO5 A;  3QNE A;  3VWS A;  3A7U A;  4YCU A;  3UFG A;  4GKJ E;  2DDZ A;  3HXY A;  5DTQ A;  2K4V A;  4DV0 E;  3UGT A;  1NJ2 A;  4LVJ A;  1E22 A;  2LMZ A;  3VQV A;  4E51 A;  2E64 A;  1NW3 A;  3DF6 A;  4XTU A;  4BC7 A;  3CMQ A;  5AE3 A;  4H2V A;  4DR5 E;  2EJF A;  2QHS A;  1QU6 A;  4DMI A;  2WZO A;  3WQZ A;  1YFS A;  2E41 A;  1Z7N A;  1USY C;  4YRO A;  1B8A A;  3EFS A;  1EIY B;  2HCS A;  2N3G A;  2KHX A;  3JU0 A;  4P75 C;  4YRM A;  4XTZ A;  4LF9 E;  3A32 A;  2DKG A;  3RKW A;  4P3N A;  4EX5 A;  3J7A G;  1WQW A;  5IT9 C;  3TUP A;  3T1Y E;  2HHH E;  4H02 A;  2L3C A;  3VQW A;  1B70 B;  3UWP A;  2UXB E;  2EL9 A;  2G4C A;  2YZT A;  4DV2 E;  3BFM A;  1XNQ E;  4P3O A;  4YRJ A;  3HRI A;  3NET A;  3P8T A;  5DRY A;  1XMO E;  1YZ9 A;  1HC7 A;  4H2T A;  2B3T B;  2L2K B;  3H09 A;  2B7T A;  1B7Y B;  3IKM B;  3E9I A;  3L2Z A;  2RSM A;  4EKI A;  2CPN A;  2N3H A;  2ZTG A;  5AE2 A;  2RS7 A;  3HQ1 A;  4NCX A;  1SER A;  1YFT A;  4DV7 E;  1NNH A;  4H2U A;  4YCV A;  2NA2 A;  2J3M A;  4DE8 A;  2Q7G A;  4B3M E;  2EZ6 A;  3A31 A;  2L33 A;  4OX9 E;  1EQR A;  3BJU A;  1X49 A;  4HWT A;  2ART A;  4P72 A;  1EOV A;  4X5O A;  4TVW A;  2CJ9 A;  1KMN A;  4L5N C;  4P72 C;  2DMY A;  1KOG A;  3MEJ A;  3VK6 A;  1T4L B;  1WPY A;  2XGT A;  3FIG A;  4BMJ A;  1X47 A;  4LVK A;  1ASY A;  1QE0 A;  5K1X A;  4DV6 E;  1WLE A;  2MC5 A;  1G51 A;  3UH0 A;  2JVA A;  2LLW A;  4LF7 E;  4DUZ E;  3KFU A;  4Q2J A;  4M0V A;  3HXZ A;  2L6M A;  3DJW A;  2RTX A;  4DR6 E;  1WQ7 A;  2M1S A;  4X66 E;  3TEH B;  4JI6 E;  4X64 E;  2AKW A;  2IY5 A;  3HRK A;  4JV5 E;  1NJ6 A;  1B7Y A;  4TVA A;  1WXR A;  3W3S A;  5ADZ A;  4CH5 A;  4HWS A;  2ZIM A;  4R8O A;  2NUE A;  2V88 A;  3HXU A;  3RMP A;  3ME5 A;  3V7R A;  4OLF A;  1ZBT A;  3A9Y A;  3HXV A;  4X65 E;  4HRA A;  4YCW A;  3ZOQ B;  4Q6G A;  5LL6 R;  2I4O A;  4YRS A;  4ER6 A;  3MQZ A;  1EFW A;  1G5H A;  3P1X A;  3TEL A;  4BCA A;  1ZBQ A;  2KOU A;  1G5I A;  4EK9 A;  3SX0 A;  1X01 A;  2YT4 A;  3JAM C;  3RUX A;  4B3T E;  5HGQ A;  2E10 A;  4X8W A;  1X55 A;  5AE1 A;  2ZIO A;  4RMF A;  1SET A;  4WF2 A;  4X62 E;  1B70 A;  1PKP A;  1X2H A;  4DPG A;  3A9X A;  1N33 E;  2RHQ B;  1IL2 A;  2DQ0 A;  2ZZF A;  2JR1 A;  4EQZ A;  2E5L E;  3IKL A;  4ER5 A;  1X48 A;  4YRF A;  3RKY A;  2V89 A;  3R07 A;  3NXH A;  4F54 A;  3NRO A;  1HTT A;  1B76 A;  2V86 A;  2ZR3 A;  3MSW A;  2NUF A;  3HPS A;  4K0K E;  2ZT7 A;  1BBU A;  1NYQ A;  3HTZ A;  3OML A;  4B3R E;  4TVA B;  3LML A;  2PME A;  2ZR2 A;  1STU A;  2DZC A;  3A7R A;  3QOX A;  4WVL A;  3ZPX A;  1I94 E;  4YRN A;  2XXQ A;  3ADG A;  4DE9 A;  1EVL A;  4AH6 A;  4H2S A;  4HWO A;  4LF6 E;  4P71 A;  4CH6 A;  1DI2 A;  4LVL A;  3LLH A;  4LFA E;  1PYS B;  2LTS A;  2QHU A;  4EKG A;  1U2Z A;  4WYQ B;  4XU2 A;  1WHN A;  4AQY E;  3EFR A;  3T1H E;  4LU9 A;  2Q5I A;  4L8N A;  4PHC A;  2ZNI A;  2DIX A;  2JWO A;  3VYY A;  5DTM A;  2LE2 A;  4OBM A;  4DV5 E;  3I7F A;  4G84 A;  4YP0 A;  4WSP A;  4YDQ A;  3V8J A;  4K87 A;  4LTY A;  1EIY A;  1VQZ A;  1HXD A;  3VQX A;  4LNS A;  2UUA E;  3HXX A;  1L0W A;  4RQF A;  3QOW A;  3VBB A;  1FKA E;  3HFV A;  4EZI A;  4JI4 E;  4XTV A;  2HFZ A;  5LMN E;  1HNX E;  2C8M A;  4PG3 A;  3A74 A;  3G0T A;  1LYL A;  5E3I A;  4J8Z A;  4HA8 A;  3NEL A;  5C51 B;  2DXT A;  5A2Q C;  3E9H A;  4OOG C;  4B3S E;  4UP7 A;  1SR9 A;  2V87 A;  4P3P A;  3J7Y p;  4JI7 E;  2DTO A;  2EAY A;  2DZ9 A;  1DQ3 A;  4BC9 A;  3G1Z A;  3HXL A;  2HNI A;  4O2D A;  2MXD A;  2E5A A;  3L4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...