2ODRD

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
Knots found
sequence length
663
structure length
451
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPEIYVYDGNVIGIPELKIDDIALKQIMSKNKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
molecule keywords phosphoseryl-tRNA synthetase
total genus 112
structure length 451
sequence length 663
other databases KnotProt 2.0: Artifct S +31 +31
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
D PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.120 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2odrD03
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrD01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrD02
2FYKA 3A7AA 2E65A 1GGMA 3IKMB 11ASA 3OD1A 4E51A 3ICAA 2CGHA 4YRNA 3DSQA 1QE0A 2ARUA 3P8VA 3TEGA 4P72C 2Q7EA 1KMMA 1WQ7A 3RKXA 3E9IA 1NJ5A 2XTIA 2Q7GA 1X2GA 3BJUA 2J3LA 2ZT6A 1G51A 3QO8A 1L0WA 3QTCA 4CS4A 2PMFA 2ZTGA 4H2XA 4LNSA 1ADYA 2EJGA 3A32A 4PG3A 4WF2A 3PCOA 3W3SA 3QO5A 3TEHA 4YRPA 2DU7A 3HY0A 4HWSA 4ZIBA 4YCUA 2ZR2A 1H4VB 3UGQA 4YRRA 4UPAA 1WPYA 4CH3A 5ELNA 4H2TA 1X55A 4PHCA 2ZZEA 2I4OA 2ZZFA 3HFZA 4BW9A 4BWAA 5K1XA 1H4TA 3LSQA 2ZZGA 4P73C 2EL9A 3KFUA 5C53B 2C8MA 2EJ9A 4O2DA 1N9WA 3L2ZA 2ZIOA 4P3PA 1WNLA 1Z7NA 4K87A 4HWOA 1PYSA 4TVWA 4YRTA 3P8TA 4WJ3M 4XTZA 5C51B 4ZTUB 2ODRD 5KNNA 3FJPA 3HXUA 1W66A 3LC0A 4KQEA 3V7CA 3R07A 3V8JA 2I4MA 1IL2A 4OLFA 3VQXA 2ZT7A 3VQVA 2ZCEA 2DXTA 2CJ9A 1B7YB 4AH6A 3NENA 2ZNIA 2G4CA 4P73A 3HY1A 2Q7HA 1NYRA 5ELOA 3EFSA 4CH6A 2DTHA 1WU7A 1B70B 4YRJA 4TWAA 2J3MA 3ERRA 4WJ4A 1RIQA 4H2UA 4TQDA 4XTXA 2DZCA 4K88A 1EIYB 3I7FA 4XTUA 3QO7A 1BBUA 1B7YA 4YRFA 2CJAA 3PCOB 3V7RA 4K86A 4DPGA 2ARTA 2P5IA 4XEOA 4XTYA 1KMNA 3V8LA 2ZGWA 3RF1A 3TUPA 4EX5A 3M4QA 3NEMA 4P75C 4P74A 4UP9A 1C0AA 4RDXA 3NELA 4TTVA 1E22A 3UFGA 1X01A 4UP7A 2DTIA 1EOVA 3MEYA 3NETA 2ZNJA 4ZTZB 1HC7A 4XU3A 1PYSB 4CH5A 3A74A 1SETA 3IALA 4XTWA 2QHVA 1H4SA 4YRCA 1ASYA 2ZT5A 2P0LA 4RMFA 2AMCA 2QHSA 4CS2A 1FYFA 5K1PA 3HXXA 1YGBA 1E1TA 4YYEA 3G1ZA 4Q6GA 3UGTA 2I4NA 1ADJA 4L87A 3MF2A 2DEQA 3P8YA 2Q5IA 1NJ8A 1YFSA 1X54A 1NYQA 3HRIA 4YREA 1EVKA 4XU1A 1B70A 1WLEA 1LYLA 3L4GA 2DJZA 4HWPA 1X56A 2RHQB 1E24A 1USYC 4H2VA 2E3CA 4X5OA 1SRYA 1HTTA 4XU2A 2DVEA 3RKYA 3WQZA 2XGTA 4H02A 1X2HA 2ZINA 4RQEA 3MF1A 4YP0A 1JJCB 2QHTA 1SESA 4YRQA 2IY5B 5F5WA 4NCXA 4YRMA 3HXZA 4XU0A 4XEMA 3QNEA 3CMQA 2AMCB 1KOGA 3RKWA 3L1AA 2PMEA 1EIYA 4HWRA 2ARSA 1WYDA 3E9HA 3LSSA 3A31A 4KR2A 4P74C 4P75A 2DZ9A 2AKWA 1H4QA 2ALYB 2C7IA 4J15A 1ATIA 4YROA 3HFVA 1YFTA 4UP8A 2RHSA 1BIBA 3IG2A 1BIAA 2ZIMA 3HXYA 5E3IA 4YDQA 2E10A 4H2WA 1ASZA 4TVAB 3EFRA 4YRSA 4HWTA 2AKWB 4P71C 4G84A 3A7RA 2EAYA 3L4GB 3RACA 2IY5A 3HXWA 2CJBA 2E1HA 3V7SA 4P72A 3RL6A 1E1OA 1NJ2A 4KR3A 1WQWA 4YCVA 4H2XB 4YCWA 2E5AA 1EFWA 1NJ6A 4YRLA 4YRIA 3VQWA 3HTZA 1YB3A 1JJCA 2DTOA 3RUXA 4DQ2A 3A5ZA 4HVCA 4P71A 2I4LA 4CS3A 2DQ0A 4RQFA 3HFZB 2RHQA 2E64A 4P3OA 1HXDA 4YRGA 4TVYA 1EQRA 1B76A 4YRKA 1USYA 2EJFA 3HXVA 12ASA 3VBBA 1VQZA 1NJ1A 4OP0A 3VQYA 1BBWA 2DQ3A 3TEHB 2CIMA 2EWNA 2ZR3A 4EO4A 3UH0A 4TQFA 2DXUA 4WI1A 4H2SA 1J5WA 4Q15A 1Z7MA 2DKGA 3V8KA 3RGLA 3M4PA 3A7UA 3REUA 3IKLA 3REXA 4HA8A 2ZXFA 4H2YA 1NNHA 1SERA 2ODRC 4P3NA 3A5YA 1G5IA 1B8AA 2ZT8A 2E41A 2QHUA 3PZCA 5C52B 2Q5HA 3HRKA 2ALYA 4XTVA 3RIRA 1QF6A 2RHSB 4CH4A 1G5HA 4YPFA 1YFRA 5HGQA 2DU5A 1EVLA 4TVAA 3BFMA 2HNIA 4G85A 2DDZA
chains in the Genus database with same CATH superfamily
2FYKA 4IWRA 2LYKA 2GRMA 2YTOA 3EPLA 4O8BA 2LYJA 2JOBA 2E65A 3A7AA 1GGMA 3GZDA 5DTRA 2PXPA 3IKMB 2E10A 2IHR1 3OD1A 4E51A 11ASA 4LVJA 3F6WA 2L3JA 4B3ME 3ICAA 2YTNA 1ZUGA 2CGHA 3JXBC 3KZYA 2I13A 3DSQA 4YRNA 1QE0A 3IWCA 2ARUA 4DMIA 3L00A 4P7DA 3P8VA 4FN3A 2V87A 3MHHC 1EKZA 2KOUA 3TEGA 3KL4A 4P72C 3J7Yp 1CQTA 2Q7EA 1KMMA 1IBME 3F6HA 1WQ7A 3RKXA 3E9IA 3A9ZA 3GN5B 1NJ5A 4H2WA 2LLVA 2XTIA 2UU9E 2Q7GA 1X2GA 3JXDL 3JU0A 1LQCA 2J3LA 2ZT6A 2PUEA 1G51A 3BJUA 1O0WA 3QO8A 2N3GA 1L0WA 3QTCA 2JPAA 1L1MA 2JY9A 2V88A 4CS4A 1HQ1A 2PMFA 5LMNE 2ZTGA 4H2XA 2EBYA 1N3GA 2RS6A 2RSMA 3CROL 4KWYA 3J80C 4YY3E 4LNSA 1ADYA 2PE5A 4M2ZA 1NCSA 2EJGA 3A32A 3ZPXA 4PG3A 1UXDA 2BJCA 1PKPA 3VWSA 1JFSA 4DR1E 2LO3A 2WIUB 1FJGE 1XNRE 5DT2A 4B3TE 3PCOA 3QO5A 2PUGA 2EM5A 5LLQA 3TEHA 3W3SA 4XTUA 2LYPA 4YRPA 1RPEL 1X5WA 1IBLE 2PXKA 1T4NA 2ICTA 3LFPA 2EMYA 2JR1A 2E5LE 2DU7A 3HY0A 3C4BA 3MQZA 2EPOA 2EN1A 3GZDC 2OR1L 2HGHA 1WETA 1E3OC 2ZR2A 4YCUA 1H4VB 2EPMX 3UGQA 4HT4A 2EM9A 3VYYA 2HHHE 3M9LA 4YRRA 4UPAA 4J1XA 3ADJA 4Z58A 4O4KA 3QF3A 1HNWE 2PXDA 1WPYA 2DMIA 4CH3A 2PXFA 1N34E 2EPXA 4ZIBA 4WSGA 5FLXC 1X57A 1X55A 4H2TA 2MKNA 5CFFE 2PUDA 4PHCA 2EQ1A 4DV2E 2ZZEA 2I4OA 2ZZFA 3HFZA 4BW9A 3EPJA 4BWAA 5K1XA 2LVHA 2L49A 1JK1A 1H4TA 3LSQA 1WHNA 4Z5CA 2ZZGA 4P73C 2K4VA 3HZIB 1NERA 1GQEA 1A1FA 2EL9A 1ZZ7A 4JI8E 5A6BA 1WH8A 3KFUA 5C53B 3TQMA 1QP0A 3B7HA 3TEPA 4BMJA 2C8MA 2EJ9A 4B3SE 4O2DA 1N9WA 3L2ZA 3OQOA 4F54A 2ZIOA 2LCEA 3C6MA 2UUBE 1PRUA 1PJSA 3KZZA 4JI4E 4DV1E 1Z1BA 5DSXA 4HRAA 3MHSC 3T1HE 4RH8A 1WNLA 1Z7NA 1PYSA 4KZSA 4HWOA 3P8TA 4K87A 4TVWA 2KONA 4XTZA 4BHBA 4YRTA 5C51B 2EM6A 1UILA 1WRJA 2ODRD 4YG4A 2GPIA 3FJPA 3HXUA 3VBBA 5KNNA 2YT4A 4JI7E 3FYAA 3VK0A 1W66A 3G5GA 1ZS4A 2IV1A 3HPZA 2XJ3A 2CSHA 3EUSA 1EFAA 1PERL 4DV7E 3LC0A 4KQEA 1JWLA 4I8OA 3V7CA 4EKGA 3IWBA 3R07A 4YHHE 1T4OA 3BIDA 1OSLA 2KEKA 2I4MA 3HPSA 3V8JA 1IL2A 3KJXA 1GTKA 4OLFA 3VQXA 2ZT7A 3RZZA 3VQVA 3UK3C 2ZCEA 4WX9A 2VE7C 1BDIA 3TFLA 3IWDA 1X49A 4ZYEA 2XCJA 4Z5DA 2DXTA 2CJ9A 2WUSR 4MCTA 2JYAA 1B7YB 4AH6A 4I6TA 2B7TA 3KXAA 2PUBA 4NZVA 3BGHA 5AE1A 2EM7A 2LTRA 4OX9E 2G4CA 2Q7HA 1RZSA 3HY1A 1NYRA 4P73A 2DIXA 4LVLA 5DRTA 3T1YE 4X4FA 4PU3C 2EMLA 1AH5A 2UXBE 4R2SA 4M9VC 4F9BB 2IU7A 3FYMA 3H5TA 5ELOA 3C6KA 1IBKE 1MFQC 3EFSA 3NROA 4R2RA 4CH6A 4WF2A 4DE9A 2DTHA 2EN7A 5A7LA 2RSIA 1WU7A 2IVGA 1B70B 4YRJA 4TWAA 1RC7A 2J3MA 3ERRA 2G7HA 2YTDA 5IV8B 2YTIA 1R63A 3GZCA 1IQSA 1RIQA 4WJ4A 1ZZ6A 1N32E 4DR2E 2LUQA 3HQ1A 4H2UA 4TQDA 4XTXA 3SCFA 2DZCA 1BBOA 2B9DA 4J1WA 4K88A 4MCXA 2EN4A 4YROA 3QG5C 5ELNA 2LYSA 1EIYB 3I7FA 1EH6A 3ME5A 3TRBA 2L1PA 2YPNA 5AE3A 4DR5E 4ZYHA 1XMOE 4LF7E 2GRLA 4R2EA 1B7YA 2EL6A 4YRFA 2CJAA 2EMCA 3PCOB 3HXLA 5DTMA 2EM8A 2GHFA 3M4PA 2MDGA 3V7RA 1WXRA 2YTQA 1ZPQA 2NA2A 4K86A 1NW3A 2I9IA 1Y9QA 2LJHA 2R1FA 4DPGA 3JTZA 3NZLA 2ARTA 2P5IA 4XEOA 4XTYA 1KMNA 1ZBTA 3V8LA 2ZGWA 1J5EE 1QPZA 4JYAE 3OQMA 4R2AA 3RF1A 2WBTA 4PU4C 3TUPA 1ZU1A 4LF6E 4EX5A 1TF3A 4LF4E 3M4QA 2M4HA 4JI2E 3NEMA 2L2KB 3REXA 4P75C 1J26A 4EKIA 4P74A 3J81C 4UP9A 4Q35B 1C0AA 3UFDA 1RZRA 1OCTC 4JI0E 2EPCA 4HWSA 1A1KA 2IVQA 2EM0A 2A25A 2FJRA 2A6CA 2EPPA 3ADLA 2IVBA 4M0VA 3OMTA 2V89A 4RDXA 3ZHIA 3GN5A 2EMZA 4BCAA 2V3CC 4O5GA 1WHQA 2M4IA 4R03A 3NXHA 2M7QA 3NENA 3NELA 2VQEE 3HXVA 2HFZA 1E22A 4TTVA 2AXZA 3UFGA 4OB4A 3QYXA 1N36E 1X01A 3TELA 2RQLA 2E1MA 2NUFA 1NEQA 2R1JL 3LLHA 5IT9C 2EN6A 2JXPA 1QP4A 4BS9A 1ZAAC 1XWRA 2E72A 2MEZA 1ZVVA 1X6HA 3L1PA 2DTIA 1EOVA 3MEYA 3NETA 1BB8A 3A9YA 1X2LA 2ZNJA 1HC7A 4ZTZB 1T38A 1YYWA 4XU3A 1PYSB 2PXBA 2MXDA 4CH5A 2YRKA 2LMZA 1IC8A 3OQNA 1X3CA 2EPNA 5GAGi 4NXME 3A74A 3ZKCA 4F9CB 2PIJA 2UXCE 3CLCA 2EMWA 1SETA 2J7UA 4HTGA 3IALA 4LU9A 4XTWA 1UN6B 2QHVA 1H4SA 4YRCA 1ASYA 1BDHA 2EJ4A 4EQZA 1RZRD 2L6MA 2ZT5A 2L8TA 2P0LA 4RMFA 3R09A 1QQAA 3BFMA 2AMCA 4ER3A 2QHSA 4CS2A 3DF6A 1FYFA 5K1PA 2VF1A 1ZZCA 4ZTUB 2HINA 2KZ8A 2PXTA 3G0TA 1UHZA 2HCNA 4WFTA 1E1TA 4X64E 2O38A 3HXXA 2PRTA 2WBSA 4JI5E 4YYEA 2CT1A 4X4EA 1DQ3A 2EMGA 3G1ZA 4Q6GA 1YUJA 2UUAE 1X6EA 1FKAE 1SR9A 4WSPA 3UGTA 2I4NA 1ADJA 4L87A 2EZ6A 4LVIA 3MF2A 2DEQA 2H8RA 3P8YA 2Q5IA 4MLVA 2LBSB 2WCC3 1QU6A 1NJ8A 2ENCA 1T4LB 4DR7E 4DV4E 4Q2JA 4GKKE 1SFEA 1X54A 1YFSA 5BR8E 1NYQA 1QNTA 5A69A 2EE8A 1HNXE 3HRIA 2BBGA 2EORA 4YREA 2GZUA 1RMDA 4X62E 2FGGA 1POUA 3A9XA 1PRVA 4Y42A 1ADRA 2JCGA 1YFHA 1B70A 1EVKA 1WLEA 2R63A 2XI8A 5DRYA 1WJPA 1LYLA 1L4SA 2NS6A 4X4CA 1BBGA 2YWQA 1CJGA 1RQ0A 4GKJE 5DTQA 1ZZ9A 2PXVA 2EOEA 3L4GA 2DJZA 4HWPA 4X4GA 1ATIA 1X56A 4ER7A 2EM3A 3KWRA 2L33A 2RHQB 1S7EA 1F2IG 3MEJA 5A6KA 1A1JA 4WVLA 1E24A 1USYC 1STUA 2DB2A 4BC7A 2E3CA 2KEIA 2EN8A 1SRYA 2MDRA 2JP9A 1HTTA 4X5OA 4M30A 1Y7YA 1JH9A 4XU2A 2DVEA 2BNNA 3RKYA 2LRSA 5LL6R 3WQZA 4JI1E 2XGTA 4H02A 1QP7A 1X2HA 2EQ3A 2YRMA 3S8QA 2EQ0A 2XSDC 3PXPA 3LISA 2BB8A 4DKKA 1GT0C 2PUCA 5AC5A 5IXMB 3LMLA 4IA8A 2WBUA 2ZINA 4X4DA 3MF1A 2EPAA 4JI3E 2L8NA 3SCHA 4RQEA 4DV5E 4YBAA 1DW9A 4IS1C 4G85A 4YP0A 1HF0A 4LVKA 4GZNC 1JJCB 2QHTA 1SESA 3OP9A 4YRQA 4YRMA 2ICPA 2IY5B 5F5WA 3OTOE 4JCXA 2XXQA 2AW6A 2EPLX 4O43A 1YYOA 2RS7A 3HXZA 2PUAA 2EF8A 3LQXA 4N4RB 4XEMA 3QNEA 4XU0A 2VQFE 1ZR9A 3CMQA 2EM2A 2AMCB 3F52A 1EH7A 3RKWA 1KOGA 4GHJA 3QFIA 2YSOA 3L1AA 4FBIA 1JFTA 2LE2A 1A1LA 4JI6E 3VYXA 2PMEA 2XXPA 1EIYA 4EO4A 2DMYA 3F51A 4HWRA 3ZOQB 2ARSA 2EOXA 2N8XA 3FMYA 2EOOA 2EOQA 2PXEA 4DR3E 1WYDA 3E9HA 5A6BD 3LSSA 5AASA 3BD1A 2H36X 4X65E 2IUOA 2EN2A 1YSEA 2HJJA 3K6QA 2DLQA 4YG7B 3A31A 2A8EA 3HTXA 4KR2A 2FV4B 4P74C 4P75A 3ADGA 2DZ9A 2AKWA 1U2ZA 1SQ8A 3G7DA 1YUIA 3U3WA 2RTXA 2NUGA 2LUPB 5GAHi 2WZOA 1H4QA 1DULA 2HCSA 2NUEA 2ALYB 4YG1A 2MC5A 3IVPA 2C7IA 4J15A 2AXUA 1LLIA 2D5VA 1QB2A 2MKDA 3AUZA 4NHRA 1LLMC 1G2DC 2DRPA 2L92A 2L3CA 3HFVA 1YFTA 2EMXA 2ENHA 4ER5A 4LTYA 4UP8A 2RHSA 5IWAE 1BIBA 1KYQA 2AXVA 3H09A 4HEIA 4BBYA 3IG2A 4OOGC 1BIAA 3EPHA 2ZIMA 3HXYA 2KHXA 2DLKA 2F8BA 3NDBB 2V86A 5E3IA 4YDQA 1ZAYA 2AWIA 2D9HA 2LCVA 4GEQB 4WXCA 2EMIA 2AUWA 2M1SA 1YPNA 3VHTB 2UXDE 4F6NA 1ASZA 3QOWA 2CPNA 4DV0E 4F6MA 3RMPA 2GLIA 2JWOA 2F4VE 4TVAB 4I6RA 3EFRA 2L2NA 4YRSA 4HWTA 4J8ZA 3SX0A 2DGCA 2AKWB 4Z5HA 3ZHMA 2MQKA 2PPXA 2YSPA 2LLWA 2J7WA 2LV2A 4F9AB 3GBFA 4LFBE 2PXUA 5ADZA 5KL5A 4P71C 4G84A 1PRAA 3DNVB 4FK5C 4NXNE 3A7RA 2V85A 1ZBQA 2EAYA 3L4GB 4IVZA 4X4BA 1PJTA 5KL6A 2YU5A 4NCXA 4DUYE 2CSFA 4ZYDA 3RACA 2JVLA 1YZ9A 2DSYA 2IY5A 2O4AA 2ADRA 1X48A 3HXWA 2EOFA 2EOZA 4WPYA 2CJBA 2E1HA 4YARA 1TF6A 4EK9A 1EH8A 3V7SA 1ZZ8A 1GZ6A 2V83A 2EPRA 1E1OA 4P72A 4OBMA 3RL6A 1PDAA 1NJ2A 2EOSA 4KR3A 3D1NI 4RHBB 3GUUA 4X8WA 5T6JA 4BHCA 4TUIA 1WQWA 5KL7A 3SR4A 3ECRA 4H2XB 1X47A 2EM4A 4YCWA 2E5AA 4PU7A 2R76A 2ENAA 3F6GA 3MSWA 1EFWA 2ZNIA 4WJ3M 5LMUE 1DI2A 1NJ6A 4YRLA 1VPWA 4YRIA 3VQWA 3OWQA 3JAMC 4DV3E 5A6JA 2Q8UA 4B3RE 3HTZA 3PE5A 1YB3A 1JJCA 2DTOA 1P47A 3RUXA 3AV0A 1AAYA 4LF5E 3EPKA 3J7AG 3A5ZA 4DQ2A 4WXDA 4LVMA 1O4XA 4R8OA 3UWPA 2YTEA 3KZ3A 4ZYGA 2O49A 2EL5A 4UP7A 4JQDA 4HVCA 4P71A 2I4LA 3QWGA 2JOXA 2EWLA 5DNYA 3REUA 1HR0E 4KHPE 4DE8A 1YYKA 5JUWA 4CS3A 1XMQE 2DQ0A 4Z59A 1MGTA 3M99B 4RQFA 3HFZB 2RHQA 2YTPA 2BNMA 2XXAA 2PXQA 4O24A 3V8KA 4X4HA 1QQBA 2EPUA 5K98B 2LJUA 2E64A 1G2FC 2B5AA 1PJQA 2EMBA 2EMAA 2YRHA 2EMFA 4MLQA 4DR4E 1HXDA 4P3OA 1IMUA 4YRGA 4GQMA 2EOIA 2ZM6E 1LCCA 2PXLA 4TVYA 2DDZA 1WIZA 2MC6A 4DUZE 3QOXA 1EQRA 1X6FA 1B76A 1UTXA 2J7JA 1NEIA 2YU8A 2EPZA 3P1XA 1B69A 4H2VA 3SCGA 3THNA 4YRKA 2M9AA 4JV5E 3BS3A 2LYRA 2XIUA 2YTGA 2VEOA 1USYA 5AE2A 2EJFA 4PU8A 4LF8E 12ASA 1RIOA 5F3WA 2B3TB 2EN3A 3OKZA 2L2MA 1NJ1A 1VQZA 4OP0A 3THOB 4LFCE 2ELYA 1BBWA 3VQYA 1DGCA 1KJKA 1YSAC 2DQ3A 3TEHB 3BDNA 1UXCA 1JK2A 2CIMA 4AQYE 2LT7A 5A6AA 2EWNA 2ZR3A 3UH0A 3BBGA 1A1HA 1BBUA 4TQFA 2FFHA 4L8NA 2EOMA 4ER6A 3VK6A 2DXUA 1B0NA 4WI1A 2RPCA 1TN9A 4H2SA 1ZZBA 2YTFA 2BNOA 3O9XA 4R2DA 1DWKA 2B7VA 2YTJA 2LNMA 1J5WA 1Z7MA 2DKGA 4Q15A 2HSGA 1AU7A 4X4IA 3RGLA 4I8TA 5KL3A 4LF9E 3A7UA 1HNZE 1LMB3 4R2CA 4R2QA 3IKLA 2NABA 4BC9A 4Q28A 4WYQB 2LYLA 2JVAA 1A1IA 4P3PA 4L5NC 3EQ1A 3FIGA 1IQOA 2ZXFA 4HA8A 4DR6E 4XU1A 4F2JC 2V8QB 4H2YA 3CECA 1XNQE 1NNHA 1SERA 2YBDA 4DV6E 2VRDA 5AC4A 2HC5A 4P78A 2EOHA 3ADIA 1A1GA 4IJDA 2ODRC 4P3NA 2UUCE 3QQ6A 3A5YA 1T39A 2ELZA 1PNRA 3DJWA 2EWTA 1N33E 1G5IA 1B8AA 2K7IA 2ZT8A 2KPJA 3MLFA 5KL2A 4TUGA 2PUFA 5TSEA 2E41A 2JQEA 4R2PA 2YZTA 2OFYA 2QHUA 3PZCA 5C52B 2CTDA 1LCDA 2Q5HA 3C4TA 3HRKA 2LYQA 4EZIA 2EMHA 2EPKX 2ALYA 4XTVA 2EOYA 1I94E 3RIRA 3BF2A 2EL4A 1QF6A 3JXCL 4K0KE 3R1FA 2N3HA 1R69A 2RHSB 3QO7A 4NDWA 2KEJA 5A2QC 1UBDC 4CH4A 2CROA 2EOJA 2EP3A 5KL4A 4X9JA 4LFAE 1G5HA 4ER0A 4YPFA 1YFRA 2LTSA 4F8DA 1WH6A 2EMKA 1MEYC 5HGQA 2DU5A 4YCVA 1EVLA 2FTXB 3OMLA 4X66E 4TVAA 4I6UA 3DM5A 1QZXA 2HNIA 1YGBA 4JCYA
chains in the Genus database with same CATH topology
2FYKA 3A7AA 2E65A 2JOBA 1GGMA 3GZDA 5DTRA 3IKMB 4LVJA 2IHR1 3OD1A 4E51A 11ASA 2L3JA 4B3ME 3ICAA 2CGHA 4YRNA 3DSQA 1QE0A 3IWCA 2ARUA 4DMIA 4P7DA 3P8VA 2V87A 1EKZA 2KOUA 3TEGA 4P72C 3J7Yp 2Q7EA 1KMMA 1IBME 3F6HA 1WQ7A 3RKXA 3E9IA 3A9ZA 1NJ5A 2LLVA 2XTIA 2UU9E 2Q7GA 1X2GA 3JU0A 3BJUA 2J3LA 2ZT6A 1G51A 3QO8A 1O0WA 2N3GA 1L0WA 3QTCA 2JY9A 2V88A 4CS4A 2PMFA 5LMNE 2ZTGA 4H2XA 3J80C 2RS6A 2RSMA 4LNSA 4YY3E 1ADYA 2EJGA 4M2ZA 3A32A 4PG3A 3ZPXA 1PKPA 4WF2A 3VWSA 4DR1E 1XNRE 3PCOA 1FJGE 4LVIA 3W3SA 5DT2A 4B3TE 3QO5A 3TEHA 4YRPA 1IBLE 2DU7A 1T4NA 2JR1A 3HY0A 2E5LE 4HWSA 4ZIBA 3C4BA 3MQZA 4YCUA 3GZDC 4HT4A 2ZR2A 1H4VB 3UGQA 3VYYA 2HHHE 3M9LA 4YRRA 4UPAA 3ADJA 1HNWE 1WPYA 4CH3A 1N34E 5FLXC 4H2TA 1X55A 4PHCA 5ELNA 5CFFE 4DV2E 2ZZEA 2I4OA 2ZZFA 3HFZA 4BW9A 4BWAA 5K1XA 1H4TA 3LSQA 1WHNA 2ZZGA 4P73C 2K4VA 2EL9A 1GQEA 4JI8E 3KFUA 5C53B 3TEPA 4BMJA 2C8MA 2EJ9A 4B3SE 4O2DA 1N9WA 3L2ZA 4F54A 2ZIOA 2UUBE 4JI4E 4DV1E 5DSXA 4HRAA 3T1HE 1WNLA 1Z7NA 4K87A 4HWOA 1PYSA 4KZSA 4P3PA 3P8TA 4TVWA 4YRTA 2KONA 4XTZA 5C51B 4WJ3M 1UILA 4ZTUB 2ODRD 5KNNA 3FJPA 3HXUA 2YT4A 4JI7E 1W66A 3HPZA 3LC0A 4DV7E 4KQEA 3V7CA 4I8OA 4EKGA 3IWBA 3R07A 4YHHE 1T4OA 3V8JA 2I4MA 1IL2A 3HPSA 4OLFA 3VQXA 2ZT7A 3VQVA 2ZCEA 2VE7C 3TFLA 3IWDA 1X49A 2DXTA 2CJ9A 1B7YB 4AH6A 2B7TA 3NENA 4OX9E 2G4CA 2ZNIA 5AE1A 4P73A 2LTRA 3HY1A 2Q7HA 1NYRA 4LVLA 2DIXA 5DRTA 3T1YE 2UXBE 4F9BB 5ELOA 1IBKE 3EFSA 3NROA 4CH6A 4DE9A 2DTHA 1WU7A 1B70B 4YRJA 4TWAA 1RC7A 2J3MA 3ERRA 2G7HA 3GZCA 4WJ4A 1RIQA 1N32E 4DR2E 2LUQA 3HQ1A 4H2UA 4TQDA 4XTXA 2DZCA 4K88A 2B9DA 1EIYB 3I7FA 4XTUA 3ME5A 5AE3A 2L1PA 1XMOE 4DR5E 4LF7E 1B7YA 1BBUA 3QO7A 4YRFA 2CJAA 3PCOB 3HXLA 5DTMA 3V7RA 1WXRA 2NA2A 4K86A 1NW3A 4DPGA 2LJHA 3JTZA 3NZLA 2ARTA 2P5IA 4XEOA 4XTYA 1KMNA 1ZBTA 3V8LA 2ZGWA 1J5EE 4JYAE 3RF1A 3TUPA 4LF6E 4EX5A 4LF4E 3M4QA 2M4HA 4JI2E 3NEMA 2L2KB 4P75C 1J26A 4EKIA 4P74A 3J81C 4UP9A 1C0AA 4JI0E 3ADLA 4M0VA 2V89A 4RDXA 4BCAA 1WHQA 2M4IA 4R03A 3NXHA 2M7QA 3NELA 2VQEE 2HFZA 1E22A 4TTVA 3UFGA 1N36E 1X01A 3TELA 2E1MA 2NUFA 3LLHA 4UP7A 5IT9C 4BS9A 2DTIA 1EOVA 3MEYA 3NETA 3A9YA 2ZNJA 4ZTZB 1HC7A 1YYWA 4XU3A 1PYSB 2MXDA 4CH5A 2LMZA 4NXME 3A74A 4F9CB 2UXCE 1SETA 2J7UA 3IALA 4LU9A 4XTWA 2QHVA 1H4SA 4YRCA 1ASYA 2ZT5A 4EQZA 2L6MA 2L8TA 2P0LA 4RMFA 3R09A 3BFMA 2AMCA 4ER3A 2QHSA 4CS2A 3DF6A 1FYFA 5K1PA 2VF1A 3HXXA 1UHZA 3G0TA 2HCNA 4WFTA 1E1TA 4X64E 4JI5E 4YYEA 1DQ3A 3G1ZA 4Q6GA 2UUAE 1FKAE 1SR9A 4WSPA 3UGTA 2I4NA 1ADJA 4L87A 2EZ6A 3MF2A 2DEQA 3P8YA 2Q5IA 2LBSB 1QU6A 1NJ8A 1T4LB 4DR7E 4DV4E 4Q2JA 4GKKE 1YFSA 1X54A 5BR8E 1NYQA 1HNXE 3HRIA 4YREA 4X62E 2FGGA 1EVKA 3A9XA 4XU1A 1B70A 1WLEA 5DRYA 1LYLA 2NS6A 1RQ0A 4GKJE 5DTQA 3L4GA 2DJZA 4HWPA 1X56A 4ER7A 3KWRA 2L33A 2RHQB 3MEJA 4WVLA 1E24A 1USYC 1STUA 2DB2A 4BC7A 2E3CA 4H2VA 1SRYA 4X5OA 2MDRA 1HTTA 4M30A 4XU2A 2DVEA 3RKYA 2LRSA 5LL6R 3WQZA 4JI1E 2XGTA 4H02A 1X2HA 4TUGA 2ZINA 4DKKA 3LMLA 4RQEA 3MF1A 4JI3E 4DV5E 4G85A 4YP0A 4LVKA 1JJCB 2QHTA 1SESA 4YRQA 2IY5B 5F5WA 3OTOE 4NCXA 2XXQA 4YRMA 3HXZA 1YYOA 2RS7A 4XU0A 4XEMA 3QNEA 3CMQA 2AMCB 1KOGA 3RKWA 3QFIA 3L1AA 2LE2A 4JI6E 3VYXA 2PMEA 2XXPA 1EIYA 2DMYA 4HWRA 3ZOQB 2ARSA 4DR3E 1WYDA 3E9HA 3LSSA 5AASA 2H36X 4X65E 3K6QA 3A31A 2A8EA 3HTXA 4KR2A 2FV4B 4P74C 4P75A 3ADGA 2DZ9A 2AKWA 1U2ZA 2RTXA 2NUGA 2LUPB 2WZOA 1H4QA 2HCSA 2NUEA 2ALYB 2MC5A 2C7IA 4J15A 1ATIA 4YROA 3AUZA 3HFVA 2L92A 2L3CA 1YFTA 4ER5A 4LTYA 4UP8A 2RHSA 5IWAE 1BIBA 3H09A 3IG2A 4BBYA 4OOGC 1BIAA 2ZIMA 3HXYA 2KHXA 2F8BA 2V86A 5E3IA 4YDQA 2E10A 4GEQB 4H2WA 1ASZA 2M1SA 2UXDE 3QOWA 2CPNA 3RMPA 4DV0E 2JWOA 2F4VE 4TVAB 3EFRA 2L2NA 4YRSA 4HWTA 4J8ZA 3SX0A 2AKWB 2LLWA 2J7WA 4F9AB 4LFBE 5ADZA 4P71C 4G84A 4NXNE 3A7RA 2V85A 1ZBQA 2EAYA 3L4GB 4DUYE 3RACA 1YZ9A 2DSYA 2IY5A 1X48A 3HXWA 4WPYA 2CJBA 2E1HA 4EK9A 3V7SA 4P72A 1GZ6A 2V83A 3RL6A 1E1OA 4OBMA 1NJ2A 4KR3A 4X8WA 1WQWA 3GUUA 4YCVA 5T6JA 4TUIA 3SR4A 4H2XB 1X47A 4YCWA 2E5AA 3F6GA 3MSWA 1EFWA 5LMUE 1DI2A 1NJ6A 4YRLA 4YRIA 3VQWA 3OWQA 3JAMC 4DV3E 3HTZA 4B3RE 3PE5A 1YB3A 1JJCA 2DTOA 3RUXA 4DQ2A 3AV0A 4LF5E 3J7AG 3A5ZA 4LVMA 4R8OA 3UWPA 4HVCA 4P71A 2I4LA 2JOXA 2EWLA 5DNYA 1HR0E 4KHPE 4DE8A 1YYKA 5JUWA 4CS3A 1XMQE 2DQ0A 4RQFA 3HFZB 2RHQA 2E64A 4P3OA 1HXDA 4DR4E 4YRGA 2ZM6E 4TVYA 4DUZE 2MC6A 1EQRA 3QOXA 1B76A 3P1XA 4YRKA 4JV5E 1USYA 2EJFA 3HXVA 2VEOA 5AE2A 12ASA 4LF8E 5F3WA 2B3TB 3VBBA 3OKZA 2L2MA 1NJ1A 1VQZA 4OP0A 4LFCE 1BBWA 3VQYA 2DQ3A 3TEHB 2CIMA 4AQYE 2EWNA 2ZR3A 3UH0A 4EO4A 4TQFA 4L8NA 4ER6A 3VK6A 2DXUA 4WI1A 4H2SA 1J5WA 2B7VA 4Q15A 2LNMA 1Z7MA 2DKGA 3V8KA 3RGLA 3M4PA 3A7UA 4LF9E 3REUA 1HNZE 3IKLA 4BC9A 4Q28A 4WYQB 2JVAA 3REXA 4L5NC 4HA8A 3FIGA 2ZXFA 4DR6E 4H2YA 2V8QB 1XNQE 1NNHA 1SERA 2YBDA 4DV6E 4P78A 3ADIA 2ODRC 4P3NA 2UUCE 3A5YA 3DJWA 1N33E 1G5IA 1B8AA 2ZT8A 2E41A 2YZTA 2QHUA 3PZCA 5C52B 2Q5HA 3C4TA 3HRKA 4EZIA 2ALYA 4XTVA 1I94E 3RIRA 1QF6A 4K0KE 2N3HA 2RHSB 5A2QC 4CH4A 1G5HA 4LFAE 4YPFA 4ER0A 1YFRA 2LTSA 5HGQA 2DU5A 1EVLA 2FTXB 3OMLA 4X66E 4TVAA 2VQFE 2HNIA 1YGBA 2DDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYK A;  3A7A A;  2E65 A;  1GGM A;  3IKM B;  11AS A;  3OD1 A;  4E51 A;  3ICA A;  2CGH A;  4YRN A;  3DSQ A;  1QE0 A;  2ARU A;  3P8V A;  3TEG A;  4P72 C;  2Q7E A;  1KMM A;  1WQ7 A;  3RKX A;  3E9I A;  1NJ5 A;  2XTI A;  2Q7G A;  1X2G A;  3BJU A;  2J3L A;  2ZT6 A;  1G51 A;  3QO8 A;  1L0W A;  3QTC A;  4CS4 A;  2PMF A;  2ZTG A;  4H2X A;  4LNS A;  1ADY A;  2EJG A;  3A32 A;  4PG3 A;  4WF2 A;  3PCO A;  3W3S A;  3QO5 A;  3TEH A;  4YRP A;  2DU7 A;  3HY0 A;  4HWS A;  4ZIB A;  4YCU A;  2ZR2 A;  1H4V B;  3UGQ A;  4YRR A;  4UPA A;  1WPY A;  4CH3 A;  5ELN A;  4H2T A;  1X55 A;  4PHC A;  2ZZE A;  2I4O A;  2ZZF A;  3HFZ A;  4BW9 A;  4BWA A;  5K1X A;  1H4T A;  3LSQ A;  2ZZG A;  4P73 C;  2EL9 A;  3KFU A;  5C53 B;  2C8M A;  2EJ9 A;  4O2D A;  1N9W A;  3L2Z A;  2ZIO A;  4P3P A;  1WNL A;  1Z7N A;  4K87 A;  4HWO A;  1PYS A;  4TVW A;  4YRT A;  3P8T A;  4WJ3 M;  4XTZ A;  5C51 B;  4ZTU B;  2ODR D;  5KNN A;  3FJP A;  3HXU A;  1W66 A;  3LC0 A;  4KQE A;  3V7C A;  3R07 A;  3V8J A;  2I4M A;  1IL2 A;  4OLF A;  3VQX A;  2ZT7 A;  3VQV A;  2ZCE A;  2DXT A;  2CJ9 A;  1B7Y B;  4AH6 A;  3NEN A;  2ZNI A;  2G4C A;  4P73 A;  3HY1 A;  2Q7H A;  1NYR A;  5ELO A;  3EFS A;  4CH6 A;  2DTH A;  1WU7 A;  1B70 B;  4YRJ A;  4TWA A;  2J3M A;  3ERR A;  4WJ4 A;  1RIQ A;  4H2U A;  4TQD A;  4XTX A;  2DZC A;  4K88 A;  1EIY B;  3I7F A;  4XTU A;  3QO7 A;  1BBU A;  1B7Y A;  4YRF A;  2CJA A;  3PCO B;  3V7R A;  4K86 A;  4DPG A;  2ART A;  2P5I A;  4XEO A;  4XTY A;  1KMN A;  3V8L A;  2ZGW A;  3RF1 A;  3TUP A;  4EX5 A;  3M4Q A;  3NEM A;  4P75 C;  4P74 A;  4UP9 A;  1C0A A;  4RDX A;  3NEL A;  4TTV A;  1E22 A;  3UFG A;  1X01 A;  4UP7 A;  2DTI A;  1EOV A;  3MEY A;  3NET A;  2ZNJ A;  4ZTZ B;  1HC7 A;  4XU3 A;  1PYS B;  4CH5 A;  3A74 A;  1SET A;  3IAL A;  4XTW A;  2QHV A;  1H4S A;  4YRC A;  1ASY A;  2ZT5 A;  2P0L A;  4RMF A;  2AMC A;  2QHS A;  4CS2 A;  1FYF A;  5K1P A;  3HXX A;  1YGB A;  1E1T A;  4YYE A;  3G1Z A;  4Q6G A;  3UGT A;  2I4N A;  1ADJ A;  4L87 A;  3MF2 A;  2DEQ A;  3P8Y A;  2Q5I A;  1NJ8 A;  1YFS A;  1X54 A;  1NYQ A;  3HRI A;  4YRE A;  1EVK A;  4XU1 A;  1B70 A;  1WLE A;  1LYL A;  3L4G A;  2DJZ A;  4HWP A;  1X56 A;  2RHQ B;  1E24 A;  1USY C;  4H2V A;  2E3C A;  4X5O A;  1SRY A;  1HTT A;  4XU2 A;  2DVE A;  3RKY A;  3WQZ A;  2XGT A;  4H02 A;  1X2H A;  2ZIN A;  4RQE A;  3MF1 A;  4YP0 A;  1JJC B;  2QHT A;  1SES A;  4YRQ A;  2IY5 B;  5F5W A;  4NCX A;  4YRM A;  3HXZ A;  4XU0 A;  4XEM A;  3QNE A;  3CMQ A;  2AMC B;  1KOG A;  3RKW A;  3L1A A;  2PME A;  1EIY A;  4HWR A;  2ARS A;  1WYD A;  3E9H A;  3LSS A;  3A31 A;  4KR2 A;  4P74 C;  4P75 A;  2DZ9 A;  2AKW A;  1H4Q A;  2ALY B;  2C7I A;  4J15 A;  1ATI A;  4YRO A;  3HFV A;  1YFT A;  4UP8 A;  2RHS A;  1BIB A;  3IG2 A;  1BIA A;  2ZIM A;  3HXY A;  5E3I A;  4YDQ A;  2E10 A;  4H2W A;  1ASZ A;  4TVA B;  3EFR A;  4YRS A;  4HWT A;  2AKW B;  4P71 C;  4G84 A;  3A7R A;  2EAY A;  3L4G B;  3RAC A;  2IY5 A;  3HXW A;  2CJB A;  2E1H A;  3V7S A;  4P72 A;  3RL6 A;  1E1O A;  1NJ2 A;  4KR3 A;  1WQW A;  4YCV A;  4H2X B;  4YCW A;  2E5A A;  1EFW A;  1NJ6 A;  4YRL A;  4YRI A;  3VQW A;  3HTZ A;  1YB3 A;  1JJC A;  2DTO A;  3RUX A;  4DQ2 A;  3A5Z A;  4HVC A;  4P71 A;  2I4L A;  4CS3 A;  2DQ0 A;  4RQF A;  3HFZ B;  2RHQ A;  2E64 A;  4P3O A;  1HXD A;  4YRG A;  4TVY A;  1EQR A;  1B76 A;  4YRK A;  1USY A;  2EJF A;  3HXV A;  12AS A;  3VBB A;  1VQZ A;  1NJ1 A;  4OP0 A;  3VQY A;  1BBW A;  2DQ3 A;  3TEH B;  2CIM A;  2EWN A;  2ZR3 A;  4EO4 A;  3UH0 A;  4TQF A;  2DXU A;  4WI1 A;  4H2S A;  1J5W A;  4Q15 A;  1Z7M A;  2DKG A;  3V8K A;  3RGL A;  3M4P A;  3A7U A;  3REU A;  3IKL A;  3REX A;  4HA8 A;  2ZXF A;  4H2Y A;  1NNH A;  1SER A;  2ODR C;  4P3N A;  3A5Y A;  1G5I A;  1B8A A;  2ZT8 A;  2E41 A;  2QHU A;  3PZC A;  5C52 B;  2Q5H A;  3HRK A;  2ALY A;  4XTV A;  3RIR A;  1QF6 A;  2RHS B;  4CH4 A;  1G5H A;  4YPF A;  1YFR A;  5HGQ A;  2DU5 A;  1EVL A;  4TVA A;  3BFM A;  2HNI A;  4G85 A;  2DDZ A; 
#chains in the Genus database with same CATH topology
 2FYK A;  4IWR A;  2LYK A;  2GRM A;  2YTO A;  3EPL A;  4O8B A;  2LYJ A;  2JOB A;  2E65 A;  3A7A A;  1GGM A;  3GZD A;  5DTR A;  2PXP A;  3IKM B;  2E10 A;  2IHR 1;  3OD1 A;  4E51 A;  11AS A;  4LVJ A;  3F6W A;  2L3J A;  4B3M E;  3ICA A;  2YTN A;  1ZUG A;  2CGH A;  3JXB C;  3KZY A;  2I13 A;  3DSQ A;  4YRN A;  1QE0 A;  3IWC A;  2ARU A;  4DMI A;  3L00 A;  4P7D A;  3P8V A;  4FN3 A;  2V87 A;  3MHH C;  1EKZ A;  2KOU A;  3TEG A;  3KL4 A;  4P72 C;  3J7Y p;  1CQT A;  2Q7E A;  1KMM A;  1IBM E;  3F6H A;  1WQ7 A;  3RKX A;  3E9I A;  3A9Z A;  3GN5 B;  1NJ5 A;  4H2W A;  2LLV A;  2XTI A;  2UU9 E;  2Q7G A;  1X2G A;  3JXD L;  3JU0 A;  1LQC A;  2J3L A;  2ZT6 A;  2PUE A;  1G51 A;  3BJU A;  1O0W A;  3QO8 A;  2N3G A;  1L0W A;  3QTC A;  2JPA A;  1L1M A;  2JY9 A;  2V88 A;  4CS4 A;  1HQ1 A;  2PMF A;  5LMN E;  2ZTG A;  4H2X A;  2EBY A;  1N3G A;  2RS6 A;  2RSM A;  3CRO L;  4KWY A;  3J80 C;  4YY3 E;  4LNS A;  1ADY A;  2PE5 A;  4M2Z A;  1NCS A;  2EJG A;  3A32 A;  3ZPX A;  4PG3 A;  1UXD A;  2BJC A;  1PKP A;  3VWS A;  1JFS A;  4DR1 E;  2LO3 A;  2WIU B;  1FJG E;  1XNR E;  5DT2 A;  4B3T E;  3PCO A;  3QO5 A;  2PUG A;  2EM5 A;  5LLQ A;  3TEH A;  3W3S A;  4XTU A;  2LYP A;  4YRP A;  1RPE L;  1X5W A;  1IBL E;  2PXK A;  1T4N A;  2ICT A;  3LFP A;  2EMY A;  2JR1 A;  2E5L E;  2DU7 A;  3HY0 A;  3C4B A;  3MQZ A;  2EPO A;  2EN1 A;  3GZD C;  2OR1 L;  2HGH A;  1WET A;  1E3O C;  2ZR2 A;  4YCU A;  1H4V B;  2EPM X;  3UGQ A;  4HT4 A;  2EM9 A;  3VYY A;  2HHH E;  3M9L A;  4YRR A;  4UPA A;  4J1X A;  3ADJ A;  4Z58 A;  4O4K A;  3QF3 A;  1HNW E;  2PXD A;  1WPY A;  2DMI A;  4CH3 A;  2PXF A;  1N34 E;  2EPX A;  4ZIB A;  4WSG A;  5FLX C;  1X57 A;  1X55 A;  4H2T A;  2MKN A;  5CFF E;  2PUD A;  4PHC A;  2EQ1 A;  4DV2 E;  2ZZE A;  2I4O A;  2ZZF A;  3HFZ A;  4BW9 A;  3EPJ A;  4BWA A;  5K1X A;  2LVH A;  2L49 A;  1JK1 A;  1H4T A;  3LSQ A;  1WHN A;  4Z5C A;  2ZZG A;  4P73 C;  2K4V A;  3HZI B;  1NER A;  1GQE A;  1A1F A;  2EL9 A;  1ZZ7 A;  4JI8 E;  5A6B A;  1WH8 A;  3KFU A;  5C53 B;  3TQM A;  1QP0 A;  3B7H A;  3TEP A;  4BMJ A;  2C8M A;  2EJ9 A;  4B3S E;  4O2D A;  1N9W A;  3L2Z A;  3OQO A;  4F54 A;  2ZIO A;  2LCE A;  3C6M A;  2UUB E;  1PRU A;  1PJS A;  3KZZ A;  4JI4 E;  4DV1 E;  1Z1B A;  5DSX A;  4HRA A;  3MHS C;  3T1H E;  4RH8 A;  1WNL A;  1Z7N A;  1PYS A;  4KZS A;  4HWO A;  3P8T A;  4K87 A;  4TVW A;  2KON A;  4XTZ A;  4BHB A;  4YRT A;  5C51 B;  2EM6 A;  1UIL A;  1WRJ A;  2ODR D;  4YG4 A;  2GPI A;  3FJP A;  3HXU A;  3VBB A;  5KNN A;  2YT4 A;  4JI7 E;  3FYA A;  3VK0 A;  1W66 A;  3G5G A;  1ZS4 A;  2IV1 A;  3HPZ A;  2XJ3 A;  2CSH A;  3EUS A;  1EFA A;  1PER L;  4DV7 E;  3LC0 A;  4KQE A;  1JWL A;  4I8O A;  3V7C A;  4EKG A;  3IWB A;  3R07 A;  4YHH E;  1T4O A;  3BID A;  1OSL A;  2KEK A;  2I4M A;  3HPS A;  3V8J A;  1IL2 A;  3KJX A;  1GTK A;  4OLF A;  3VQX A;  2ZT7 A;  3RZZ A;  3VQV A;  3UK3 C;  2ZCE A;  4WX9 A;  2VE7 C;  1BDI A;  3TFL A;  3IWD A;  1X49 A;  4ZYE A;  2XCJ A;  4Z5D A;  2DXT A;  2CJ9 A;  2WUS R;  4MCT A;  2JYA A;  1B7Y B;  4AH6 A;  4I6T A;  2B7T A;  3KXA A;  2PUB A;  4NZV A;  3BGH A;  5AE1 A;  2EM7 A;  2LTR A;  4OX9 E;  2G4C A;  2Q7H A;  1RZS A;  3HY1 A;  1NYR A;  4P73 A;  2DIX A;  4LVL A;  5DRT A;  3T1Y E;  4X4F A;  4PU3 C;  2EML A;  1AH5 A;  2UXB E;  4R2S A;  4M9V C;  4F9B B;  2IU7 A;  3FYM A;  3H5T A;  5ELO A;  3C6K A;  1IBK E;  1MFQ C;  3EFS A;  3NRO A;  4R2R A;  4CH6 A;  4WF2 A;  4DE9 A;  2DTH A;  2EN7 A;  5A7L A;  2RSI A;  1WU7 A;  2IVG A;  1B70 B;  4YRJ A;  4TWA A;  1RC7 A;  2J3M A;  3ERR A;  2G7H A;  2YTD A;  5IV8 B;  2YTI A;  1R63 A;  3GZC A;  1IQS A;  1RIQ A;  4WJ4 A;  1ZZ6 A;  1N32 E;  4DR2 E;  2LUQ A;  3HQ1 A;  4H2U A;  4TQD A;  4XTX A;  3SCF A;  2DZC A;  1BBO A;  2B9D A;  4J1W A;  4K88 A;  4MCX A;  2EN4 A;  4YRO A;  3QG5 C;  5ELN A;  2LYS A;  1EIY B;  3I7F A;  1EH6 A;  3ME5 A;  3TRB A;  2L1P A;  2YPN A;  5AE3 A;  4DR5 E;  4ZYH A;  1XMO E;  4LF7 E;  2GRL A;  4R2E A;  1B7Y A;  2EL6 A;  4YRF A;  2CJA A;  2EMC A;  3PCO B;  3HXL A;  5DTM A;  2EM8 A;  2GHF A;  3M4P A;  2MDG A;  3V7R A;  1WXR A;  2YTQ A;  1ZPQ A;  2NA2 A;  4K86 A;  1NW3 A;  2I9I A;  1Y9Q A;  2LJH A;  2R1F A;  4DPG A;  3JTZ A;  3NZL A;  2ART A;  2P5I A;  4XEO A;  4XTY A;  1KMN A;  1ZBT A;  3V8L A;  2ZGW A;  1J5E E;  1QPZ A;  4JYA E;  3OQM A;  4R2A A;  3RF1 A;  2WBT A;  4PU4 C;  3TUP A;  1ZU1 A;  4LF6 E;  4EX5 A;  1TF3 A;  4LF4 E;  3M4Q A;  2M4H A;  4JI2 E;  3NEM A;  2L2K B;  3REX A;  4P75 C;  1J26 A;  4EKI A;  4P74 A;  3J81 C;  4UP9 A;  4Q35 B;  1C0A A;  3UFD A;  1RZR A;  1OCT C;  4JI0 E;  2EPC A;  4HWS A;  1A1K A;  2IVQ A;  2EM0 A;  2A25 A;  2FJR A;  2A6C A;  2EPP A;  3ADL A;  2IVB A;  4M0V A;  3OMT A;  2V89 A;  4RDX A;  3ZHI A;  3GN5 A;  2EMZ A;  4BCA A;  2V3C C;  4O5G A;  1WHQ A;  2M4I A;  4R03 A;  3NXH A;  2M7Q A;  3NEN A;  3NEL A;  2VQE E;  3HXV A;  2HFZ A;  1E22 A;  4TTV A;  2AXZ A;  3UFG A;  4OB4 A;  3QYX A;  1N36 E;  1X01 A;  3TEL A;  2RQL A;  2E1M A;  2NUF A;  1NEQ A;  2R1J L;  3LLH A;  5IT9 C;  2EN6 A;  2JXP A;  1QP4 A;  4BS9 A;  1ZAA C;  1XWR A;  2E72 A;  2MEZ A;  1ZVV A;  1X6H A;  3L1P A;  2DTI A;  1EOV A;  3MEY A;  3NET A;  1BB8 A;  3A9Y A;  1X2L A;  2ZNJ A;  1HC7 A;  4ZTZ B;  1T38 A;  1YYW A;  4XU3 A;  1PYS B;  2PXB A;  2MXD A;  4CH5 A;  2YRK A;  2LMZ A;  1IC8 A;  3OQN A;  1X3C A;  2EPN A;  5GAG i;  4NXM E;  3A74 A;  3ZKC A;  4F9C B;  2PIJ A;  2UXC E;  3CLC A;  2EMW A;  1SET A;  2J7U A;  4HTG A;  3IAL A;  4LU9 A;  4XTW A;  1UN6 B;  2QHV A;  1H4S A;  4YRC A;  1ASY A;  1BDH A;  2EJ4 A;  4EQZ A;  1RZR D;  2L6M A;  2ZT5 A;  2L8T A;  2P0L A;  4RMF A;  3R09 A;  1QQA A;  3BFM A;  2AMC A;  4ER3 A;  2QHS A;  4CS2 A;  3DF6 A;  1FYF A;  5K1P A;  2VF1 A;  1ZZC A;  4ZTU B;  2HIN A;  2KZ8 A;  2PXT A;  3G0T A;  1UHZ A;  2HCN A;  4WFT A;  1E1T A;  4X64 E;  2O38 A;  3HXX A;  2PRT A;  2WBS A;  4JI5 E;  4YYE A;  2CT1 A;  4X4E A;  1DQ3 A;  2EMG A;  3G1Z A;  4Q6G A;  1YUJ A;  2UUA E;  1X6E A;  1FKA E;  1SR9 A;  4WSP A;  3UGT A;  2I4N A;  1ADJ A;  4L87 A;  2EZ6 A;  4LVI A;  3MF2 A;  2DEQ A;  2H8R A;  3P8Y A;  2Q5I A;  4MLV A;  2LBS B;  2WCC 3;  1QU6 A;  1NJ8 A;  2ENC A;  1T4L B;  4DR7 E;  4DV4 E;  4Q2J A;  4GKK E;  1SFE A;  1X54 A;  1YFS A;  5BR8 E;  1NYQ A;  1QNT A;  5A69 A;  2EE8 A;  1HNX E;  3HRI A;  2BBG A;  2EOR A;  4YRE A;  2GZU A;  1RMD A;  4X62 E;  2FGG A;  1POU A;  3A9X A;  1PRV A;  4Y42 A;  1ADR A;  2JCG A;  1YFH A;  1B70 A;  1EVK A;  1WLE A;  2R63 A;  2XI8 A;  5DRY A;  1WJP A;  1LYL A;  1L4S A;  2NS6 A;  4X4C A;  1BBG A;  2YWQ A;  1CJG A;  1RQ0 A;  4GKJ E;  5DTQ A;  1ZZ9 A;  2PXV A;  2EOE A;  3L4G A;  2DJZ A;  4HWP A;  4X4G A;  1ATI A;  1X56 A;  4ER7 A;  2EM3 A;  3KWR A;  2L33 A;  2RHQ B;  1S7E A;  1F2I G;  3MEJ A;  5A6K A;  1A1J A;  4WVL A;  1E24 A;  1USY C;  1STU A;  2DB2 A;  4BC7 A;  2E3C A;  2KEI A;  2EN8 A;  1SRY A;  2MDR A;  2JP9 A;  1HTT A;  4X5O A;  4M30 A;  1Y7Y A;  1JH9 A;  4XU2 A;  2DVE A;  2BNN A;  3RKY A;  2LRS A;  5LL6 R;  3WQZ A;  4JI1 E;  2XGT A;  4H02 A;  1QP7 A;  1X2H A;  2EQ3 A;  2YRM A;  3S8Q A;  2EQ0 A;  2XSD C;  3PXP A;  3LIS A;  2BB8 A;  4DKK A;  1GT0 C;  2PUC A;  5AC5 A;  5IXM B;  3LML A;  4IA8 A;  2WBU A;  2ZIN A;  4X4D A;  3MF1 A;  2EPA A;  4JI3 E;  2L8N A;  3SCH A;  4RQE A;  4DV5 E;  4YBA A;  1DW9 A;  4IS1 C;  4G85 A;  4YP0 A;  1HF0 A;  4LVK A;  4GZN C;  1JJC B;  2QHT A;  1SES A;  3OP9 A;  4YRQ A;  4YRM A;  2ICP A;  2IY5 B;  5F5W A;  3OTO E;  4JCX A;  2XXQ A;  2AW6 A;  2EPL X;  4O43 A;  1YYO A;  2RS7 A;  3HXZ A;  2PUA A;  2EF8 A;  3LQX A;  4N4R B;  4XEM A;  3QNE A;  4XU0 A;  2VQF E;  1ZR9 A;  3CMQ A;  2EM2 A;  2AMC B;  3F52 A;  1EH7 A;  3RKW A;  1KOG A;  4GHJ A;  3QFI A;  2YSO A;  3L1A A;  4FBI A;  1JFT A;  2LE2 A;  1A1L A;  4JI6 E;  3VYX A;  2PME A;  2XXP A;  1EIY A;  4EO4 A;  2DMY A;  3F51 A;  4HWR A;  3ZOQ B;  2ARS A;  2EOX A;  2N8X A;  3FMY A;  2EOO A;  2EOQ A;  2PXE A;  4DR3 E;  1WYD A;  3E9H A;  5A6B D;  3LSS A;  5AAS A;  3BD1 A;  2H36 X;  4X65 E;  2IUO A;  2EN2 A;  1YSE A;  2HJJ A;  3K6Q A;  2DLQ A;  4YG7 B;  3A31 A;  2A8E A;  3HTX A;  4KR2 A;  2FV4 B;  4P74 C;  4P75 A;  3ADG A;  2DZ9 A;  2AKW A;  1U2Z A;  1SQ8 A;  3G7D A;  1YUI A;  3U3W A;  2RTX A;  2NUG A;  2LUP B;  5GAH i;  2WZO A;  1H4Q A;  1DUL A;  2HCS A;  2NUE A;  2ALY B;  4YG1 A;  2MC5 A;  3IVP A;  2C7I A;  4J15 A;  2AXU A;  1LLI A;  2D5V A;  1QB2 A;  2MKD A;  3AUZ A;  4NHR A;  1LLM C;  1G2D C;  2DRP A;  2L92 A;  2L3C A;  3HFV A;  1YFT A;  2EMX A;  2ENH A;  4ER5 A;  4LTY A;  4UP8 A;  2RHS A;  5IWA E;  1BIB A;  1KYQ A;  2AXV A;  3H09 A;  4HEI A;  4BBY A;  3IG2 A;  4OOG C;  1BIA A;  3EPH A;  2ZIM A;  3HXY A;  2KHX A;  2DLK A;  2F8B A;  3NDB B;  2V86 A;  5E3I A;  4YDQ A;  1ZAY A;  2AWI A;  2D9H A;  2LCV A;  4GEQ B;  4WXC A;  2EMI A;  2AUW A;  2M1S A;  1YPN A;  3VHT B;  2UXD E;  4F6N A;  1ASZ A;  3QOW A;  2CPN A;  4DV0 E;  4F6M A;  3RMP A;  2GLI A;  2JWO A;  2F4V E;  4TVA B;  4I6R A;  3EFR A;  2L2N A;  4YRS A;  4HWT A;  4J8Z A;  3SX0 A;  2DGC A;  2AKW B;  4Z5H A;  3ZHM A;  2MQK A;  2PPX A;  2YSP A;  2LLW A;  2J7W A;  2LV2 A;  4F9A B;  3GBF A;  4LFB E;  2PXU A;  5ADZ A;  5KL5 A;  4P71 C;  4G84 A;  1PRA A;  3DNV B;  4FK5 C;  4NXN E;  3A7R A;  2V85 A;  1ZBQ A;  2EAY A;  3L4G B;  4IVZ A;  4X4B A;  1PJT A;  5KL6 A;  2YU5 A;  4NCX A;  4DUY E;  2CSF A;  4ZYD A;  3RAC A;  2JVL A;  1YZ9 A;  2DSY A;  2IY5 A;  2O4A A;  2ADR A;  1X48 A;  3HXW A;  2EOF A;  2EOZ A;  4WPY A;  2CJB A;  2E1H A;  4YAR A;  1TF6 A;  4EK9 A;  1EH8 A;  3V7S A;  1ZZ8 A;  1GZ6 A;  2V83 A;  2EPR A;  1E1O A;  4P72 A;  4OBM A;  3RL6 A;  1PDA A;  1NJ2 A;  2EOS A;  4KR3 A;  3D1N I;  4RHB B;  3GUU A;  4X8W A;  5T6J A;  4BHC A;  4TUI A;  1WQW A;  5KL7 A;  3SR4 A;  3ECR A;  4H2X B;  1X47 A;  2EM4 A;  4YCW A;  2E5A A;  4PU7 A;  2R76 A;  2ENA A;  3F6G A;  3MSW A;  1EFW A;  2ZNI A;  4WJ3 M;  5LMU E;  1DI2 A;  1NJ6 A;  4YRL A;  1VPW A;  4YRI A;  3VQW A;  3OWQ A;  3JAM C;  4DV3 E;  5A6J A;  2Q8U A;  4B3R E;  3HTZ A;  3PE5 A;  1YB3 A;  1JJC A;  2DTO A;  1P47 A;  3RUX A;  3AV0 A;  1AAY A;  4LF5 E;  3EPK A;  3J7A G;  3A5Z A;  4DQ2 A;  4WXD A;  4LVM A;  1O4X A;  4R8O A;  3UWP A;  2YTE A;  3KZ3 A;  4ZYG A;  2O49 A;  2EL5 A;  4UP7 A;  4JQD A;  4HVC A;  4P71 A;  2I4L A;  3QWG A;  2JOX A;  2EWL A;  5DNY A;  3REU A;  1HR0 E;  4KHP E;  4DE8 A;  1YYK A;  5JUW A;  4CS3 A;  1XMQ E;  2DQ0 A;  4Z59 A;  1MGT A;  3M99 B;  4RQF A;  3HFZ B;  2RHQ A;  2YTP A;  2BNM A;  2XXA A;  2PXQ A;  4O24 A;  3V8K A;  4X4H A;  1QQB A;  2EPU A;  5K98 B;  2LJU A;  2E64 A;  1G2F C;  2B5A A;  1PJQ A;  2EMB A;  2EMA A;  2YRH A;  2EMF A;  4MLQ A;  4DR4 E;  1HXD A;  4P3O A;  1IMU A;  4YRG A;  4GQM A;  2EOI A;  2ZM6 E;  1LCC A;  2PXL A;  4TVY A;  2DDZ A;  1WIZ A;  2MC6 A;  4DUZ E;  3QOX A;  1EQR A;  1X6F A;  1B76 A;  1UTX A;  2J7J A;  1NEI A;  2YU8 A;  2EPZ A;  3P1X A;  1B69 A;  4H2V A;  3SCG A;  3THN A;  4YRK A;  2M9A A;  4JV5 E;  3BS3 A;  2LYR A;  2XIU A;  2YTG A;  2VEO A;  1USY A;  5AE2 A;  2EJF A;  4PU8 A;  4LF8 E;  12AS A;  1RIO A;  5F3W A;  2B3T B;  2EN3 A;  3OKZ A;  2L2M A;  1NJ1 A;  1VQZ A;  4OP0 A;  3THO B;  4LFC E;  2ELY A;  1BBW A;  3VQY A;  1DGC A;  1KJK A;  1YSA C;  2DQ3 A;  3TEH B;  3BDN A;  1UXC A;  1JK2 A;  2CIM A;  4AQY E;  2LT7 A;  5A6A A;  2EWN A;  2ZR3 A;  3UH0 A;  3BBG A;  1A1H A;  1BBU A;  4TQF A;  2FFH A;  4L8N A;  2EOM A;  4ER6 A;  3VK6 A;  2DXU A;  1B0N A;  4WI1 A;  2RPC A;  1TN9 A;  4H2S A;  1ZZB A;  2YTF A;  2BNO A;  3O9X A;  4R2D A;  1DWK A;  2B7V A;  2YTJ A;  2LNM A;  1J5W A;  1Z7M A;  2DKG A;  4Q15 A;  2HSG A;  1AU7 A;  4X4I A;  3RGL A;  4I8T A;  5KL3 A;  4LF9 E;  3A7U A;  1HNZ E;  1LMB 3;  4R2C A;  4R2Q A;  3IKL A;  2NAB A;  4BC9 A;  4Q28 A;  4WYQ B;  2LYL A;  2JVA A;  1A1I A;  4P3P A;  4L5N C;  3EQ1 A;  3FIG A;  1IQO A;  2ZXF A;  4HA8 A;  4DR6 E;  4XU1 A;  4F2J C;  2V8Q B;  4H2Y A;  3CEC A;  1XNQ E;  1NNH A;  1SER A;  2YBD A;  4DV6 E;  2VRD A;  5AC4 A;  2HC5 A;  4P78 A;  2EOH A;  3ADI A;  1A1G A;  4IJD A;  2ODR C;  4P3N A;  2UUC E;  3QQ6 A;  3A5Y A;  1T39 A;  2ELZ A;  1PNR A;  3DJW A;  2EWT A;  1N33 E;  1G5I A;  1B8A A;  2K7I A;  2ZT8 A;  2KPJ A;  3MLF A;  5KL2 A;  4TUG A;  2PUF A;  5TSE A;  2E41 A;  2JQE A;  4R2P A;  2YZT A;  2OFY A;  2QHU A;  3PZC A;  5C52 B;  2CTD A;  1LCD A;  2Q5H A;  3C4T A;  3HRK A;  2LYQ A;  4EZI A;  2EMH A;  2EPK X;  2ALY A;  4XTV A;  2EOY A;  1I94 E;  3RIR A;  3BF2 A;  2EL4 A;  1QF6 A;  3JXC L;  4K0K E;  3R1F A;  2N3H A;  1R69 A;  2RHS B;  3QO7 A;  4NDW A;  2KEJ A;  5A2Q C;  1UBD C;  4CH4 A;  2CRO A;  2EOJ A;  2EP3 A;  5KL4 A;  4X9J A;  4LFA E;  1G5H A;  4ER0 A;  4YPF A;  1YFR A;  2LTS A;  4F8D A;  1WH6 A;  2EMK A;  1MEY C;  5HGQ A;  2DU5 A;  4YCV A;  1EVL A;  2FTX B;  3OML A;  4X66 E;  4TVA A;  4I6U A;  3DM5 A;  1QZX A;  2HNI A;  1YGB A;  4JCY A; 
#chains in the Genus database with same CATH homology
 2FYK A;  3A7A A;  2E65 A;  2JOB A;  1GGM A;  3GZD A;  5DTR A;  3IKM B;  4LVJ A;  2IHR 1;  3OD1 A;  4E51 A;  11AS A;  2L3J A;  4B3M E;  3ICA A;  2CGH A;  4YRN A;  3DSQ A;  1QE0 A;  3IWC A;  2ARU A;  4DMI A;  4P7D A;  3P8V A;  2V87 A;  1EKZ A;  2KOU A;  3TEG A;  4P72 C;  3J7Y p;  2Q7E A;  1KMM A;  1IBM E;  3F6H A;  1WQ7 A;  3RKX A;  3E9I A;  3A9Z A;  1NJ5 A;  2LLV A;  2XTI A;  2UU9 E;  2Q7G A;  1X2G A;  3JU0 A;  3BJU A;  2J3L A;  2ZT6 A;  1G51 A;  3QO8 A;  1O0W A;  2N3G A;  1L0W A;  3QTC A;  2JY9 A;  2V88 A;  4CS4 A;  2PMF A;  5LMN E;  2ZTG A;  4H2X A;  3J80 C;  2RS6 A;  2RSM A;  4LNS A;  4YY3 E;  1ADY A;  2EJG A;  4M2Z A;  3A32 A;  4PG3 A;  3ZPX A;  1PKP A;  4WF2 A;  3VWS A;  4DR1 E;  1XNR E;  3PCO A;  1FJG E;  4LVI A;  3W3S A;  5DT2 A;  4B3T E;  3QO5 A;  3TEH A;  4YRP A;  1IBL E;  2DU7 A;  1T4N A;  2JR1 A;  3HY0 A;  2E5L E;  4HWS A;  4ZIB A;  3C4B A;  3MQZ A;  4YCU A;  3GZD C;  4HT4 A;  2ZR2 A;  1H4V B;  3UGQ A;  3VYY A;  2HHH E;  3M9L A;  4YRR A;  4UPA A;  3ADJ A;  1HNW E;  1WPY A;  4CH3 A;  1N34 E;  5FLX C;  4H2T A;  1X55 A;  4PHC A;  5ELN A;  5CFF E;  4DV2 E;  2ZZE A;  2I4O A;  2ZZF A;  3HFZ A;  4BW9 A;  4BWA A;  5K1X A;  1H4T A;  3LSQ A;  1WHN A;  2ZZG A;  4P73 C;  2K4V A;  2EL9 A;  1GQE A;  4JI8 E;  3KFU A;  5C53 B;  3TEP A;  4BMJ A;  2C8M A;  2EJ9 A;  4B3S E;  4O2D A;  1N9W A;  3L2Z A;  4F54 A;  2ZIO A;  2UUB E;  4JI4 E;  4DV1 E;  5DSX A;  4HRA A;  3T1H E;  1WNL A;  1Z7N A;  4K87 A;  4HWO A;  1PYS A;  4KZS A;  4P3P A;  3P8T A;  4TVW A;  4YRT A;  2KON A;  4XTZ A;  5C51 B;  4WJ3 M;  1UIL A;  4ZTU B;  2ODR D;  5KNN A;  3FJP A;  3HXU A;  2YT4 A;  4JI7 E;  1W66 A;  3HPZ A;  3LC0 A;  4DV7 E;  4KQE A;  3V7C A;  4I8O A;  4EKG A;  3IWB A;  3R07 A;  4YHH E;  1T4O A;  3V8J A;  2I4M A;  1IL2 A;  3HPS A;  4OLF A;  3VQX A;  2ZT7 A;  3VQV A;  2ZCE A;  2VE7 C;  3TFL A;  3IWD A;  1X49 A;  2DXT A;  2CJ9 A;  1B7Y B;  4AH6 A;  2B7T A;  3NEN A;  4OX9 E;  2G4C A;  2ZNI A;  5AE1 A;  4P73 A;  2LTR A;  3HY1 A;  2Q7H A;  1NYR A;  4LVL A;  2DIX A;  5DRT A;  3T1Y E;  2UXB E;  4F9B B;  5ELO A;  1IBK E;  3EFS A;  3NRO A;  4CH6 A;  4DE9 A;  2DTH A;  1WU7 A;  1B70 B;  4YRJ A;  4TWA A;  1RC7 A;  2J3M A;  3ERR A;  2G7H A;  3GZC A;  4WJ4 A;  1RIQ A;  1N32 E;  4DR2 E;  2LUQ A;  3HQ1 A;  4H2U A;  4TQD A;  4XTX A;  2DZC A;  4K88 A;  2B9D A;  1EIY B;  3I7F A;  4XTU A;  3ME5 A;  5AE3 A;  2L1P A;  1XMO E;  4DR5 E;  4LF7 E;  1B7Y A;  1BBU A;  3QO7 A;  4YRF A;  2CJA A;  3PCO B;  3HXL A;  5DTM A;  3V7R A;  1WXR A;  2NA2 A;  4K86 A;  1NW3 A;  4DPG A;  2LJH A;  3JTZ A;  3NZL A;  2ART A;  2P5I A;  4XEO A;  4XTY A;  1KMN A;  1ZBT A;  3V8L A;  2ZGW A;  1J5E E;  4JYA E;  3RF1 A;  3TUP A;  4LF6 E;  4EX5 A;  4LF4 E;  3M4Q A;  2M4H A;  4JI2 E;  3NEM A;  2L2K B;  4P75 C;  1J26 A;  4EKI A;  4P74 A;  3J81 C;  4UP9 A;  1C0A A;  4JI0 E;  3ADL A;  4M0V A;  2V89 A;  4RDX A;  4BCA A;  1WHQ A;  2M4I A;  4R03 A;  3NXH A;  2M7Q A;  3NEL A;  2VQE E;  2HFZ A;  1E22 A;  4TTV A;  3UFG A;  1N36 E;  1X01 A;  3TEL A;  2E1M A;  2NUF A;  3LLH A;  4UP7 A;  5IT9 C;  4BS9 A;  2DTI A;  1EOV A;  3MEY A;  3NET A;  3A9Y A;  2ZNJ A;  4ZTZ B;  1HC7 A;  1YYW A;  4XU3 A;  1PYS B;  2MXD A;  4CH5 A;  2LMZ A;  4NXM E;  3A74 A;  4F9C B;  2UXC E;  1SET A;  2J7U A;  3IAL A;  4LU9 A;  4XTW A;  2QHV A;  1H4S A;  4YRC A;  1ASY A;  2ZT5 A;  4EQZ A;  2L6M A;  2L8T A;  2P0L A;  4RMF A;  3R09 A;  3BFM A;  2AMC A;  4ER3 A;  2QHS A;  4CS2 A;  3DF6 A;  1FYF A;  5K1P A;  2VF1 A;  3HXX A;  1UHZ A;  3G0T A;  2HCN A;  4WFT A;  1E1T A;  4X64 E;  4JI5 E;  4YYE A;  1DQ3 A;  3G1Z A;  4Q6G A;  2UUA E;  1FKA E;  1SR9 A;  4WSP A;  3UGT A;  2I4N A;  1ADJ A;  4L87 A;  2EZ6 A;  3MF2 A;  2DEQ A;  3P8Y A;  2Q5I A;  2LBS B;  1QU6 A;  1NJ8 A;  1T4L B;  4DR7 E;  4DV4 E;  4Q2J A;  4GKK E;  1YFS A;  1X54 A;  5BR8 E;  1NYQ A;  1HNX E;  3HRI A;  4YRE A;  4X62 E;  2FGG A;  1EVK A;  3A9X A;  4XU1 A;  1B70 A;  1WLE A;  5DRY A;  1LYL A;  2NS6 A;  1RQ0 A;  4GKJ E;  5DTQ A;  3L4G A;  2DJZ A;  4HWP A;  1X56 A;  4ER7 A;  3KWR A;  2L33 A;  2RHQ B;  3MEJ A;  4WVL A;  1E24 A;  1USY C;  1STU A;  2DB2 A;  4BC7 A;  2E3C A;  4H2V A;  1SRY A;  4X5O A;  2MDR A;  1HTT A;  4M30 A;  4XU2 A;  2DVE A;  3RKY A;  2LRS A;  5LL6 R;  3WQZ A;  4JI1 E;  2XGT A;  4H02 A;  1X2H A;  4TUG A;  2ZIN A;  4DKK A;  3LML A;  4RQE A;  3MF1 A;  4JI3 E;  4DV5 E;  4G85 A;  4YP0 A;  4LVK A;  1JJC B;  2QHT A;  1SES A;  4YRQ A;  2IY5 B;  5F5W A;  3OTO E;  4NCX A;  2XXQ A;  4YRM A;  3HXZ A;  1YYO A;  2RS7 A;  4XU0 A;  4XEM A;  3QNE A;  3CMQ A;  2AMC B;  1KOG A;  3RKW A;  3QFI A;  3L1A A;  2LE2 A;  4JI6 E;  3VYX A;  2PME A;  2XXP A;  1EIY A;  2DMY A;  4HWR A;  3ZOQ B;  2ARS A;  4DR3 E;  1WYD A;  3E9H A;  3LSS A;  5AAS A;  2H36 X;  4X65 E;  3K6Q A;  3A31 A;  2A8E A;  3HTX A;  4KR2 A;  2FV4 B;  4P74 C;  4P75 A;  3ADG A;  2DZ9 A;  2AKW A;  1U2Z A;  2RTX A;  2NUG A;  2LUP B;  2WZO A;  1H4Q A;  2HCS A;  2NUE A;  2ALY B;  2MC5 A;  2C7I A;  4J15 A;  1ATI A;  4YRO A;  3AUZ A;  3HFV A;  2L92 A;  2L3C A;  1YFT A;  4ER5 A;  4LTY A;  4UP8 A;  2RHS A;  5IWA E;  1BIB A;  3H09 A;  3IG2 A;  4BBY A;  4OOG C;  1BIA A;  2ZIM A;  3HXY A;  2KHX A;  2F8B A;  2V86 A;  5E3I A;  4YDQ A;  2E10 A;  4GEQ B;  4H2W A;  1ASZ A;  2M1S A;  2UXD E;  3QOW A;  2CPN A;  3RMP A;  4DV0 E;  2JWO A;  2F4V E;  4TVA B;  3EFR A;  2L2N A;  4YRS A;  4HWT A;  4J8Z A;  3SX0 A;  2AKW B;  2LLW A;  2J7W A;  4F9A B;  4LFB E;  5ADZ A;  4P71 C;  4G84 A;  4NXN E;  3A7R A;  2V85 A;  1ZBQ A;  2EAY A;  3L4G B;  4DUY E;  3RAC A;  1YZ9 A;  2DSY A;  2IY5 A;  1X48 A;  3HXW A;  4WPY A;  2CJB A;  2E1H A;  4EK9 A;  3V7S A;  4P72 A;  1GZ6 A;  2V83 A;  3RL6 A;  1E1O A;  4OBM A;  1NJ2 A;  4KR3 A;  4X8W A;  1WQW A;  3GUU A;  4YCV A;  5T6J A;  4TUI A;  3SR4 A;  4H2X B;  1X47 A;  4YCW A;  2E5A A;  3F6G A;  3MSW A;  1EFW A;  5LMU E;  1DI2 A;  1NJ6 A;  4YRL A;  4YRI A;  3VQW A;  3OWQ A;  3JAM C;  4DV3 E;  3HTZ A;  4B3R E;  3PE5 A;  1YB3 A;  1JJC A;  2DTO A;  3RUX A;  4DQ2 A;  3AV0 A;  4LF5 E;  3J7A G;  3A5Z A;  4LVM A;  4R8O A;  3UWP A;  4HVC A;  4P71 A;  2I4L A;  2JOX A;  2EWL A;  5DNY A;  1HR0 E;  4KHP E;  4DE8 A;  1YYK A;  5JUW A;  4CS3 A;  1XMQ E;  2DQ0 A;  4RQF A;  3HFZ B;  2RHQ A;  2E64 A;  4P3O A;  1HXD A;  4DR4 E;  4YRG A;  2ZM6 E;  4TVY A;  4DUZ E;  2MC6 A;  1EQR A;  3QOX A;  1B76 A;  3P1X A;  4YRK A;  4JV5 E;  1USY A;  2EJF A;  3HXV A;  2VEO A;  5AE2 A;  12AS A;  4LF8 E;  5F3W A;  2B3T B;  3VBB A;  3OKZ A;  2L2M A;  1NJ1 A;  1VQZ A;  4OP0 A;  4LFC E;  1BBW A;  3VQY A;  2DQ3 A;  3TEH B;  2CIM A;  4AQY E;  2EWN A;  2ZR3 A;  3UH0 A;  4EO4 A;  4TQF A;  4L8N A;  4ER6 A;  3VK6 A;  2DXU A;  4WI1 A;  4H2S A;  1J5W A;  2B7V A;  4Q15 A;  2LNM A;  1Z7M A;  2DKG A;  3V8K A;  3RGL A;  3M4P A;  3A7U A;  4LF9 E;  3REU A;  1HNZ E;  3IKL A;  4BC9 A;  4Q28 A;  4WYQ B;  2JVA A;  3REX A;  4L5N C;  4HA8 A;  3FIG A;  2ZXF A;  4DR6 E;  4H2Y A;  2V8Q B;  1XNQ E;  1NNH A;  1SER A;  2YBD A;  4DV6 E;  4P78 A;  3ADI A;  2ODR C;  4P3N A;  2UUC E;  3A5Y A;  3DJW A;  1N33 E;  1G5I A;  1B8A A;  2ZT8 A;  2E41 A;  2YZT A;  2QHU A;  3PZC A;  5C52 B;  2Q5H A;  3C4T A;  3HRK A;  4EZI A;  2ALY A;  4XTV A;  1I94 E;  3RIR A;  1QF6 A;  4K0K E;  2N3H A;  2RHS B;  5A2Q C;  4CH4 A;  1G5H A;  4LFA E;  4YPF A;  4ER0 A;  1YFR A;  2LTS A;  5HGQ A;  2DU5 A;  1EVL A;  2FTX B;  3OML A;  4X66 E;  4TVA A;  2VQF E;  2HNI A;  1YGB A;  2DDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...