2ODRD

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
Knots found
sequence length
663
structure length
451
Chain Sequence
b'REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPEIYVYDGNVIGIPELKIDDIALKQIMSKNKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
total genus 112
structure length 451
sequence length 663
other databases KnotProt 2.0: Artifct S +31 +31
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
D PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.120 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2odrD03
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrD01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrD02
3A7AA 2Q7GA 3FJPA 3BFMA 4WJ4A 1ADYA 1PYSA 2EWNA 1EVLA 2I4LA 1B76A 3HXZA 1YFRA 1ADJA 4UPAA 3VQXA 2RHQB 1NJ6A 3A32A 1E22A 2DXUA 3P8VA 4TVAA 3RGLA 2PMEA 4EO4A 2E10A 2CJAA 2EAYA 3RKXA 2E5AA 4X5OA 5C52B 2DTHA 1NJ2A 4XEOA 3HRKA 3UGQA 3A31A 4XU3A 2Q5HA 2ZT5A 2I4OA 3HFZB 1X55A 5E3IA 3RACA 3IALA 4HWPA 12ASA 4XTUA 2ZT7A 1EIYB 4P73C 1B7YA 4YCWA 2ARUA 3LSSA 2I4MA 1H4QA 2DQ0A 4PHCA 3QO5A 3VBBA 4ZTUB 3HXXA 4WJ3M 4ZIBA 1ASYA 1NJ1A 4CS4A 4DQ2A 1N9WA 1X01A 2G4CA 2E41A 1WQ7A 1Z7MA 3L2ZA 2J3MA 1X56A 4YCUA 1X54A 3M4PA 4P73A 5C53B 1B8AA 1WNLA 1JJCA 3TUPA 1BIBA 3TEHA 4H2XA 1E24A 11ASA 4H2TA 4P75C 3QTCA 2ALYB 4P3PA 3P8TA 5HGQA 4YDQA 3PCOB 4KR3A 3PZCA 2DJZA 2AKWB 3HXVA 1USYC 4XU0A 1QF6A 4XU1A 4YP0A 2AMCA 3DSQA 2RHSB 4WI1A 5K1XA 4YROA 4YRTA 4TWAA 3A5ZA 4P75A 4RQEA 1WQWA 3EFSA 1SERA 3UGTA 1E1TA 2ZR2A 3HXUA 3BJUA 4H2YA 4XTVA 2DVEA 3TEGA 2CJBA 2J3LA 3UH0A 4OP0A 3VQVA 4H2WA 1YB3A 1USYA 1QE0A 2DXTA 1YGBA 3HY0A 4YRGA 1NJ5A 4HWRA 1PYSB 2ARSA 2ZGWA 3MF1A 1ASZA 5KNNA 1SETA 4O2DA 3RKYA 3NENA 3OD1A 2ZR3A 3L1AA 4TVAB 2P5IA 2ARTA 4OLFA 4YRJA 2Q5IA 4H02A 2QHUA 3QO7A 1H4TA 4LNSA 4E51A 4YRKA 2DQ3A 3V7RA 3A7RA 3L4GA 3QNEA 3E9HA 1IL2A 4YREA 1EOVA 4P3NA 3HTZA 3R07A 2ZZEA 4YRLA 3RF1A 1NJ8A 3NEMA 1L0WA 1HXDA 4K86A 1B70A 3KFUA 1B7YB 2DEQA 1BBWA 2DU7A 4P74C 1SRYA 4CH4A 3HRIA 4ZTZB 1GGMA 1E1OA 3UFGA 4HVCA 3EFRA 1SESA 4K87A 2DTOA 1G5IA 3M4QA 1WYDA 3RKWA 4G84A 4YRSA 2CGHA 1EVKA 2XGTA 3VQYA 2E65A 4H2VA 1FYFA 1JJCB 3ICAA 2ZIMA 2ODRD 3IKLA 3TEHB 4J15A 3V7CA 4CH6A 2IY5A 4L87A 3W3SA 4P74A 2Q7HA 2QHSA 2EJFA 1X2GA 3NETA 4UP8A 4HA8A 2ZT6A 2E1HA 4H2SA 4TQFA 4PG3A 4YRQA 3RL6A 4XEMA 2XTIA 3V8LA 1WU7A 4P72C 1KMNA 1BBUA 3RIRA 1HTTA 4YRIA 4P3OA 2ZIOA 2AMCB 2DZCA 2I4NA 2ZNIA 4HWOA 4K88A 2ODRC 4YRRA 1YFSA 2PMFA 1ATIA 3NELA 2QHTA 3MF2A 2E64A 1LYLA 4KQEA 3RUXA 1H4SA 4KR2A 3IG2A 4P72A 2RHQA 1NYQA 4Q6GA 4AH6A 4UP7A 3E9IA 2C8MA 4XTWA 1RIQA 4DPGA 4YCVA 1BIAA 3G1ZA 4RMFA 2ZXFA 1X2HA 4YPFA 2QHVA 4H2UA 3HFZA 4TTVA 4TVWA 1W66A 2DU5A 1H4VB 2EJ9A 1EIYA 4TVYA 2ZNJA 2DZ9A 3IKMB 3L4GB 4UP9A 4G85A 2DTIA 4XTYA 1NNHA 4YRMA 4XTXA 4BWAA 4TQDA 3REUA 4CS3A 3QO8A 3ERRA 2CIMA 3A5YA 5ELOA 1B70B 4YRNA 3A74A 3LSQA 1Z7NA 2ZINA 4YRFA 4EX5A 5K1PA 3LC0A 4YRCA 3HFVA 2ZT8A 3WQZA 1G51A 3HXWA 3V8JA 2DKGA 1EQRA 3V8KA 4HWSA 3VQWA 2Q7EA 4XTZA 2ZTGA 3HY1A 1HC7A 2CJ9A 2ALYA 3A7UA 3MEYA 4H2XB 4P71C 5F5WA 4YYEA 3V7SA 4YRPA 2E3CA 1YFTA 3CMQA 3PCOA 1KOGA 4BW9A 2ZCEA 1NYRA 1VQZA 2ZZGA 4CH5A 2DDZA 4HWTA 1J5WA 5ELNA 2AKWA 2P0LA 4CH3A 2IY5B 4Q15A 4WF2A 1WPYA 3I7FA 2EJGA 4CS2A 1C0AA 2RHSA 5C51B 2C7IA 1KMMA 4RQFA 3P8YA 4NCXA 4XU2A 4RDXA 2HNIA 2ZZFA 4P71A 2EL9A 2FYKA 1G5HA 3REXA 3HXYA 1EFWA 1WLEA
chains in the Genus database with same CATH superfamily
4JYAE 5DTMA 2EOOA 2Q7GA 3BBGA 1LMB3 3QF3A 4DR2E 1RQ0A 4F9BB 2EMFA 1A1IA 4LVIA 3A9XA 3TELA 2PUBA 4NXNE 1KJKA 2M4IA 3VQXA 2RHQB 3A32A 4YG4A 4DV5E 3RGLA 1RMDA 2PMEA 4OOGC 5A69A 3A9YA 2HGHA 3VK0A 1NJ2A 3UGQA 3JXBC 4EK9A 2ZT5A 2PXPA 2EPUA 2LYSA 3RACA 4X4EA 3F6WA 5GAGi 4LF7E 1EIYB 4P73C 1NCSA 4YCWA 2ARUA 1EFAA 1S7EA 1AAYA 2EWLA 1H4QA 1LCCA 2V8QB 4M2ZA 4ZTUB 3HXXA 4ZIBA 2PE5A 4OX9E 2G4CA 1Z7MA 3L2ZA 2JOXA 2HC5A 3EUSA 2LE2A 1X56A 4F54A 3M4PA 5C53B 1ADRA 3HQ1A 2EOEA 1JJCA 3TUPA 4R2SA 4NXME 2PXDA 4DUZE 4H2TA 3QTCA 2F4VE 1QQBA 2B3TB 1NEQA 4YDQA 1R63A 2BB8A 2LTRA 2DJZA 3PE5A 1RZRD 3ECRA 2YTDA 5AE2A 2EPOA 4I6RA 1QF6A 3JAMC 2AMCA 4YP0A 1I94E 1PJTA 1G2DC 2EMIA 4YRTA 2BNOA 4TWAA 1A1JA 3MSWA 2V89A 4WYQB 4P75A 1JFTA 1WETA 1JK2A 1WQWA 2ZR2A 4O5GA 5KL6A 2AXZA 2PUGA 2DVEA 2V85A 1AH5A 1SFEA 1FKAE 4OP0A 4EKGA 2MKNA 2YTQA 1USYA 1ZZBA 4DMIA 1G2FC 2EM4A 1YGBA 4YRGA 1YYOA 1ASZA 1SETA 2M9AA 4O2DA 2EOYA 3RKYA 3NENA 3OD1A 4TVAB 2E1MA 2ARTA 2LYJA 2R76A 4DR3E 1FJGE 5A7LA 1H4TA 2ENHA 2DQ3A 2EMYA 2EN8A 3T1YE 2IVGA 3L4GA 3VHTB 2PXKA 4P3NA 5TSEA 3HTZA 2VEOA 2J7WA 3BGHA 4PU7A 1EH8A 3L1PA 2DMIA 5A6JA 2BJCA 1B7YB 3M99B 3SR4A 4CH4A 3BD1A 2VRDA 2LCEA 2AXUA 1JWLA 3QOXA 2V3CC 3S8QA 3M4QA 4G84A 2FTXB 1GZ6A 2XGTA 2MDGA 5LMNE 2E65A 4H2VA 3ICAA 4JI2E 2ZIMA 3BDNA 3IKLA 3TEHB 2IY5A 4IJDA 2KHXA 2EJFA 1X2GA 5KL5A 2D5VA 2E1HA 4IVZA 4H2SA 4PG3A 1A1FA 2NABA 1WU7A 1KMNA 4R2EA 2PUCA 5GAHi 4YRIA 3DJWA 4P3OA 2DZCA 2I4NA 4YRRA 3JXDL 3QWGA 1MGTA 2WBUA 3OMTA 2KZ8A 5LMUE 1YUIA 1OSLA 2R63A 2JP9A 2E64A 1IQSA 1H4SA 3QG5C 1J5EE 3IG2A 2RHQA 4AH6A 4I6TA 2C8MA 2EOFA 2YTIA 1RIQA 2LV2A 2GRMA 2YTFA 4DV3E 4JCXA 1X2HA 2DLKA 2LYPA 2QHVA 1X48A 3R09A 1H4VB 2EJ9A 5F3WA 3JXCL 1EIYA 1IQOA 2ENAA 2EOZA 2ZNJA 4DR7E 2JR1A 3JU0A 4ZYGA 4MCTA 4XTYA 4X4HA 1X3CA 2EPNA 4YRMA 4XTXA 4BWAA 4LVJA 2CIMA 3MHHC 1B70B 3LSQA 3A74A 2ZINA 2LUPB 4Y42A 3QQ6A 3HZIB 1Z1BA 2LYLA 3EQ1A 2EPMX 2ZT8A 2BNNA 3G7DA 1G51A 2A8EA 3V8JA 5KL3A 2PPXA 4Q2JA 4DR6E 2XXQA 2I9IA 1KYQA 2R1JL 3A7UA 4GHJA 4YRPA 4B3ME 2E5LE 3ZHIA 1VQZA 3KL4A 2YTGA 4HWTA 5ELNA 4CH3A 2PXEA 4P7DA 4R2QA 3LFPA 3IWBA 2EJGA 5C51B 2C7IA 3P8YA 1WH6A 4XU2A 4LFCE 4FK5C 1QP0A 2YTNA 3OP9A 2LUQA 3FMYA 3BF2A 4F9CB 2ZZFA 2YTJA 3OQMA 2PXQA 1BDHA 4WFTA 2EL9A 3F52A 1JFSA 3LLHA 3OKZA 4F2JC 2EN1A 1LLMC 2LLWA 3BFMA 2EWNA 2K7IA 2KEIA 1A1LA 4JI0E 4RH8A 2WBSA 2EMCA 1B76A 3HXZA 5IXMB 3F51A 1YFRA 1NJ6A 1E22A 2DXUA 4TVAA 2AWIA 5A6BA 4EO4A 3UWPA 1WXRA 1MEYC 2E10A 2EAYA 3ADGA 2L92A 3VYXA 4X5OA 1DWKA 2DTHA 3K6QA 4XEOA 3HRKA 4O8BA 3SCHA 4ZYEA 1WJPA 3A31A 2YZTA 3HFZB 2LLVA 5A6KA 1X55A 5E3IA 4HWPA 1BBGA 12ASA 1YPNA 3G0TA 1B7YA 1PJSA 3MLFA 2WUSR 5ADZA 4R8OA 4R2DA 2EMAA 2YWQA 4EKIA 4BHBA 2M1SA 3QO5A 2YRKA 1ASYA 2EPCA 2DIXA 2XCJA 1NJ1A 4CS4A 4DQ2A 1N9WA 3J7Yp 1X01A 3DM5A 4WSPA 2J3MA 4LF5E 5A2QC 1X54A 2UUBE 2JQEA 3TEHA 2M4HA 1T4NA 4RHBB 5LL6R 2O38A 4P3PA 3F6HA 2LT7A 3P8TA 5AC4A 2JY9A 1QP4A 4PU4C 2ICTA 1T4LB 2EMHA 3PCOB 2PXUA 2GZUA 2IUOA 2OFYA 4XU0A 3OMLA 2RSIA 3DSQA 4WI1A 5DSXA 4R2PA 2EMKA 3EPHA 1PJQA 3CLCA 1QQAA 2ZM6E 4RQEA 4JQDA 4X4DA 3UGTA 3HXUA 4XTVA 2B7VA 2IV1A 2OR1L 2RQLA 3QFIA 4H2WA 1GQEA 2EQ3A 1PRVA 2PXBA 2DXTA 4ER6A 2EM6A 2LYQA 2EM5A 2MDRA 3KZZA 4IA8A 1HQ1A 2EM8A 3NDBB 3R1FA 2N3HA 1E3OC 2RSMA 3L1AA 3A9ZA 4DV7E 4H02A 2QHUA 2PXVA 4LNSA 4YRKA 3V7RA 2XXPA 1X47A 2M7QA 1N32E 1CQTA 3E9HA 3R07A 2ZZEA 1OCTC 5AE3A 3RF1A 2DGCA 1N33E 3G5GA 1B70A 1X2LA 2DU7A 4P74C 3GN5B 2FFHA 5LLQA 4ZTZB 3OQNA 3KXAA 1CJGA 2PRTA 1NEIA 2HFZA 2N8XA 2EORA 3GUUA 2EMZA 3F6GA 1PKPA 5BR8E 3GZDC 4J15A 4YBAA 3W3SA 2YSOA 4UP8A 2F8BA 1A1GA 4LFAE 3RL6A 1QNTA 3HPZA 3V8LA 4P72C 2LO3A 1BBUA 2CPNA 3C4BA 2ZNIA 2FV4B 4HWOA 4LVLA 2LTSA 3ADJA 5DTRA 1XNQE 1WRJA 4KZSA 2CSHA 1ATIA 4LU9A 3BS3A 2QHTA 2ICPA 3MQZA 2XSDC 1EH6A 2EM0A 4X4FA 2MQKA 4JI7E 5DRYA 1MFQC 4KR2A 4BCAA 1NYQA 4ER5A 3E9IA 2WIUB 4XTWA 4JI5E 4DPGA 4YCVA 1BIAA 2PUDA 4WXCA 3L00A 4WXDA 4X64E 2E72A 2H36X 1ZPQA 4YPFA 3HFZA 1QB2A 5AE1A 4TVWA 3ME5A 2JOBA 1EKZA 3IKMB 2L3CA 4G85A 2CSFA 2EMGA 2V87A 4J8ZA 1UILA 5IT9C 1NNHA 2L2MA 4L8NA 1QU6A 2PIJA 3ERRA 3C6KA 1ZBQA 4YRFA 4MLVA 1PNRA 4LF9E 3LC0A 1WH8A 1O4XA 4BS9A 3HFVA 4DR4E 3VYYA 3HXWA 4YG7B 2DKGA 1UXCA 2A6CA 1YZ9A 2B5AA 2Q7EA 1ZS4A 1IC8A 2CJ9A 2L49A 5DNYA 1HNXE 4NHRA 2EN7A 3PCOA 5T6JA 2ZCEA 1NYRA 2ZZGA 1A1HA 1J5WA 1X49A 4HRAA 3AV0A 2L6MA 3FYMA 3I7FA 1C0AA 3NXHA 2BBGA 4RQFA 2EQ0A 1X57A 2HNIA 2GLIA 1YYWA 4P71A 2JWOA 1RZSA 1WLEA 3SCGA 2XIUA 2DLQA 2YU8A 1NW3A 4F9AB 5AC5A 1T4OA 1ADYA 4YG1A 2XJ3A 4B3RE 2I4LA 1ADJA 2EF8A 2LYKA 2IU7A 5KL7A 4KWYA 1HNWE 4Q35B 4DV6E 4DKKA 2CJAA 2KOUA 3RKXA 2L2KB 5C52B 2LCVA 3THOB 2LJUA 2Q5HA 1LCDA 2I4OA 3SCFA 1PRAA 2YRHA 3IALA 4X4IA 2O49A 2EL6A 4HTGA 4XTUA 2ZT7A 4BHCA 2LMZA 3LSSA 2BNMA 2I4MA 3GN5A 2JVAA 5DT2A 2DQ0A 4Q28A 2G7HA 2L8NA 5IWAE 2EOXA 4R2AA 2EM2A 1N3GA 2YTEA 4EQZA 4DE8A 2E41A 3FIGA 1TF3A 3OTOE 3C6MA 2XXAA 2ELYA 3IWDA 4X8WA 4DUYE 4P73A 1YUJA 1BIBA 3T1HE 1IMUA 4H2XA 11ASA 4P75C 4LF4E 2EPRA 5HGQA 4Z5DA 2WBTA 3PZCA 5DTQA 3VWSA 2AKWB 4JI3E 1USYC 5K1XA 2HINA 4YROA 3A5ZA 4ER7A 3HPSA 3EFSA 1SERA 4BC7A 2V88A 1WHQA 3HXLA 3BJUA 4H2YA 3LISA 4WSGA 3TEGA 2CJBA 2J3LA 2KPJA 1QP7A 3UH0A 1ZUGA 1NERA 2B7TA 1YB3A 2PUAA 4BMJA 1QE0A 3J81C 2EBYA 3KZ3A 2EPZA 4HWRA 2HCSA 1PYSB 3HTXA 3QYXA 2JYAA 5KL4A 1DGCA 1SR9A 4YRJA 3QO7A 2EN4A 5DRTA 2WZOA 1JK1A 4E51A 2L1PA 3BIDA 1LLIA 3A7RA 1RZRA 3QNEA 4YREA 1EOVA 3LMLA 2Q8UA 2EPLX 1NJ8A 2YU5A 1L0WA 1HXDA 2ADRA 1F2IG 2YSPA 4R2CA 2DEQA 4PU8A 4IS1C 2V86A 1B69A 2JCGA 2XI8A 1GGMA 3UFGA 4HVCA 3TQMA 1RPEL 4HEIA 4BC9A 4LFBE 3EFRA 1SESA 1HR0E 2AXVA 1IBLE 4DV4E 2EP3A 5FLXC 1WYDA 3RKWA 4YY3E 2B9DA 1EVKA 3J7AG 3VQYA 3ADLA 1FYFA 3TEPA 1Y9QA 2ODRD 1X6FA 4CH6A 3V7CA 3RMPA 4YHHE 4L87A 1DQ3A 3DNVB 2QHSA 4JCYA 3NETA 4F6MA 2UU9E 1GT0C 2ZT6A 4TQFA 1STUA 4DV0E 1XNRE 3RIRA 4K0KE 4TUIA 1HTTA 2ZIOA 1T39A 2EPXA 2EZ6A 2JXPA 4Z5CA 2ODRC 2NA2A 3OWQA 3TFLA 3NELA 2AW6A 3MF2A 4FBIA 3QOWA 2HJJA 3ZPXA 2A25A 4UP7A 5JUWA 4O24A 3GZCA 3FYAA 1R69A 1WHNA 3ADIA 5CFFE 4RMFA 3KJXA 4I8TA 4GKKE 2H8RA 1N34E 4LF8E 2RS7A 2EOMA 2PUFA 4H2UA 2EN2A 2HSGA 2DU5A 1BDIA 3ZOQB 3VK6A 2N3GA 2KONA 1X6HA 1ZAAC 2EJ4A 3NROA 1ZR9A 1UN6B 3REUA 1ZZ7A 4P78A 3QO8A 3A5YA 1UTXA 5ELOA 1B0NA 4YRNA 1ZZ8A 5K1PA 4EX5A 2YT4A 4NZVA 4YRCA 3WQZA 4KHPE 4DV2E 4LF6E 2EOHA 3IVPA 4PU3C 1XMQE 1YYKA 1EQRA 1GTKA 3V8KA 2CROA 3ZKCA 2EM9A 4XTZA 3H5TA 2ZTGA 3MEYA 3THNA 4H2XB 1IBME 5F5WA 3V7SA 5A6BD 4FN3A 1X6EA 3CMQA 1J26A 1L1MA 2YRMA 4CH5A 2DDZA 2AKWA 3UK3C 4LVMA 2O4AA 4Q15A 4WF2A 2EPPA 1PDAA 2HCNA 2EMXA 4NCXA 2YTPA 4GEQB 4RDXA 2VF1A 4R03A 4DE9A 2NUFA 1T38A 2EOIA 4R2RA 3REXA 3HXYA 2JPAA 2EOQA 2YTOA 5KL2A 5AASA 3A7AA 4JI1E 2EMBA 3FJPA 4WJ4A 1PYSA 3P1XA 1EVLA 4Z59A 2EM7A 1ZU1A 4UPAA 3P8VA 1JH9A 2E5AA 2EN3A 4XU3A 2LNMA 1BB8A 4B3SE 2WCC3 3OQOA 3SX0A 1PERL 1RC7A 3GBFA 4OBMA 3EPKA 1TN9A 1ZAYA 2PXTA 4PHCA 1PRUA 3VBBA 4WJ3M 2L2NA 4JI4E 1POUA 2MXDA 2YBDA 1P47A 2MEZA 1WQ7A 1AU7A 5A6AA 4YCUA 4LTYA 4ZYHA 2RTXA 2EL5A 1B8AA 1WNLA 1E24A 4DR1E 2ALYB 2UXCE 4KR3A 2R1FA 1UHZA 2NUGA 4ZYDA 1HNZE 2MC6A 3HXVA 4WPYA 2VQEE 1ZBTA 4XU1A 2RHSB 1Y7YA 1UXDA 3ZHMA 4LVKA 1VPWA 4N4RB 2EE8A 1L4SA 1U2ZA 2J7UA 1E1TA 3J80C 1ZZCA 1EH7A 5K98B 2EPKX 2KEJA 2EPAA 4WVLA 4I8OA 3CECA 3VQVA 2EM3A 2LJHA 4JV5E 2LBSB 2V83A 3HY0A 3KZYA 3AUZA 1N36E 1YSEA 2NUEA 1NJ5A 2ARSA 3NZLA 2ZGWA 2VQFE 3MF1A 5KNNA 2L8TA 1QPZA 4Z5HA 2GRLA 1ZZ6A 2LRSA 1BBOA 1UBDC 2ZR3A 2P5IA 2EN6A 4OLFA 2Q5IA 2UUCE 5IV8B 3DF6A 2PXFA 1O0WA 1IL2A 2DB2A 3EPJA 2IHR1 4YRLA 2MKDA 1YSAC 2VE7C 3TRBA 3NEMA 3MHSC 4K86A 4X65E 3KFUA 2IVBA 2RS6A 2KEKA 2UXDE 1BBWA 1SRYA 4OB4A 3HRIA 1E1OA 3UFDA 1SQ8A 4X66E 4GZNC 4B3TE 1HF0A 2LYRA 2ELZA 4K87A 2DTOA 1G5IA 4YRSA 2EMLA 2CGHA 1RIOA 3EPLA 2CT1A 2GPIA 4M0VA 2I13A 1JJCB 4M9VC 4YARA 2EL4A 4P74A 2Q7HA 2HHHE 4J1XA 4HA8A 4MCXA 2UXBE 4GQMA 3M9LA 1DULA 4AQYE 3U3WA 4YRQA 4XEMA 2XTIA 4BBYA 4F6NA 3LQXA 2RPCA 1A1KA 4X9JA 4I6UA 2DRPA 2AMCB 4J1WA 2EQ1A 4X4BA 4K88A 1YFSA 2UUAE 3GZDA 2PMFA 2FGGA 2K4VA 2MC5A 3B7HA 4L5NC 1LYLA 4KQEA 3RUXA 4ER3A 4P72A 1ZVVA 4Q6GA 2L3JA 1XMOE 4HT4A 3RZZA 2LVHA 1TF6A 2D9HA 3G1ZA 2ZXFA 4DR5E 2EOJA 2FJRA 1YFHA 2PUEA 4TTVA 3KWRA 1W66A 4TUGA 4M30A 4GKJE 4TVYA 2DZ9A 3L4GB 4UP9A 4JI8E 2DTIA 1X5WA 4X62E 3D1NI 4TQDA 4CS3A 2YPNA 1Z7NA 4NDWA 4X4GA 2AUWA 1WIZA 4JI6E 2NS6A 1DI2A 3O9XA 2EWTA 2IVQA 4WX9A 4F8DA 3PXPA 4HWSA 4O43A 3VQWA 3IWCA 3HY1A 4ER0A 4O4KA 2JVLA 2GHFA 3MEJA 1HC7A 2ALYA 1XWRA 4P71C 3C4TA 4YYEA 2E3CA 1YFTA 1KOGA 4BW9A 2PXLA 2P0LA 2J7JA 2IY5B 1WPYA 2EMWA 4X4CA 4CS2A 2RHSA 1ZZ9A 4Z58A 1KMMA 1DW9A 4EZIA 2DSYA 3CROL 2CTDA 2EOSA 2DMYA 1IBKE 3JTZA 2FYKA 1G5HA 2ENCA 1LQCA 2L33A 4IWRA 3H09A 4MLQA 4DV1E 1EFWA 1QZXA
chains in the Genus database with same CATH topology
4JYAE 5AASA 3A7AA 5DTMA 4JI1E 2Q7GA 1NW3A 4F9AB 3FJPA 1T4OA 2LLWA 3BFMA 4WJ4A 1ADYA 1PYSA 3P1XA 1EVLA 2EWNA 4DR2E 4B3RE 4JI0E 1RQ0A 4F9BB 2I4LA 4LVIA 3A9XA 3TELA 4NXNE 1B76A 3HXZA 1YFRA 1ADJA 2M4IA 4UPAA 3VQXA 2RHQB 1NJ6A 3A32A 1E22A 2DXUA 3P8VA 4DV5E 4TVAA 3RGLA 2PMEA 4EO4A 1HNWE 3UWPA 1WXRA 4DV6E 4DKKA 4OOGC 2E10A 2CJAA 2KOUA 2EAYA 3RKXA 3ADGA 2L92A 3VYXA 2L2KB 2E5AA 3A9YA 4X5OA 5C52B 2DTHA 1NJ2A 3K6QA 4XEOA 3HRKA 3UGQA 3A31A 4XU3A 2Q5HA 2LNMA 4EK9A 2ZT5A 2YZTA 2I4OA 2LLVA 3HFZB 1X55A 5E3IA 3RACA 3IALA 4B3SE 4HWPA 12ASA 4LF7E 4XTUA 2ZT7A 1EIYB 4P73C 3G0TA 1B7YA 4YCWA 3SX0A 2LMZA 2ARUA 3LSSA 2I4MA 1RC7A 5ADZA 2EWLA 4R8OA 2JVAA 1H4QA 4OBMA 5DT2A 2DQ0A 2V8QB 4Q28A 4PHCA 4EKIA 2G7HA 2M1SA 4M2ZA 5IWAE 3QO5A 3VBBA 4ZTUB 3HXXA 4WJ3M 4ZIBA 2L2NA 4JI4E 1ASYA 4EQZA 2DIXA 1NJ1A 4CS4A 4DQ2A 4DE8A 1N9WA 3J7Yp 2MXDA 1X01A 4OX9E 2YBDA 2E41A 2G4CA 1WQ7A 3FIGA 1Z7MA 3L2ZA 3OTOE 2JOXA 4WSPA 2J3MA 4LF5E 2LE2A 5A2QC 1X56A 4YCUA 4LTYA 4F54A 3IWDA 4X8WA 2RTXA 4DUYE 1X54A 3HQ1A 1B8AA 1WNLA 1JJCA 2UUBE 3M4PA 4P73A 5C53B 3TUPA 4NXME 1BIBA 3T1HE 3TEHA 2M4HA 4H2XA 4DUZE 1T4NA 1E24A 11ASA 5LL6R 4H2TA 4P75C 4DR1E 3QTCA 2F4VE 2ALYB 4P3PA 2B3TB 3F6HA 2UXCE 3P8TA 4LF4E 5HGQA 2JY9A 4YDQA 1T4LB 3PCOB 4KR3A 3PZCA 1UHZA 2NUGA 2LTRA 5DTQA 1HNZE 3VWSA 2MC6A 2DJZA 2AKWB 3HXVA 4JI3E 4WPYA 3PE5A 1USYC 5AE2A 2VQEE 1ZBTA 4XU0A 1QF6A 4XU1A 3JAMC 3OMLA 2AMCA 4YP0A 1I94E 3DSQA 2RHSB 4WI1A 5DSXA 5K1XA 4YROA 4YRTA 4TWAA 3MSWA 2V89A 4WYQB 4LVKA 3A5ZA 4ER7A 4P75A 3HPSA 2ZM6E 4RQEA 1WQWA 3EFSA 1SERA 1U2ZA 2J7UA 4BC7A 3UGTA 1E1TA 2ZR2A 3HXUA 3J80C 2V88A 1WHQA 3HXLA 3BJUA 4H2YA 4XTVA 2DVEA 3TEGA 2V85A 2CJBA 2B7VA 1FKAE 2J3LA 4WVLA 4I8OA 3UH0A 4OP0A 3VQVA 3QFIA 4EKGA 2B7TA 4H2WA 1GQEA 1YB3A 2LJHA 1USYA 4BMJA 1QE0A 4JV5E 4DMIA 2LBSB 2V83A 2DXTA 4ER6A 1YGBA 3J81C 1N36E 3AUZA 3HY0A 4YRGA 2NUEA 1NJ5A 4HWRA 2HCSA 1YYOA 1PYSB 3NZLA 2ARSA 2VQFE 3HTXA 2ZGWA 3MF1A 1ASZA 5KNNA 1SETA 2L8TA 2MDRA 4O2DA 3RKYA 3NENA 2LRSA 2N3HA 3OD1A 2ZR3A 2RSMA 3L1AA 4TVAB 2E1MA 1SR9A 2P5IA 3A9ZA 2ARTA 4OLFA 4YRJA 4DV7E 2Q5IA 4H02A 2UUCE 4DR3E 2QHUA 1FJGE 3QO7A 1H4TA 5DRTA 2WZOA 3DF6A 4LNSA 4E51A 4YRKA 2L1PA 2DQ3A 3V7RA 3A7RA 2XXPA 3T1YE 1X47A 2M7QA 3L4GA 3QNEA 1O0WA 1N32E 3E9HA 1IL2A 4YREA 2DB2A 1EOVA 4P3NA 3HTZA 2VEOA 3R07A 2IHR1 2J7WA 2ZZEA 3LMLA 4YRLA 5AE3A 3RF1A 2VE7C 1NJ8A 3NEMA 1N33E 1L0WA 1HXDA 4K86A 1B70A 4X65E 3KFUA 1B7YB 2RS6A 2UXDE 1BBWA 2DEQA 3SR4A 2DU7A 4P74C 1SRYA 4CH4A 2V86A 3HRIA 4ZTZB 1GGMA 1E1OA 3UFGA 4HVCA 4X66E 4BC9A 4LFBE 3EFRA 1SESA 3QOXA 1HR0E 4B3TE 1IBLE 4DV4E 4K87A 2DTOA 5FLXC 1G5IA 3M4QA 1WYDA 3RKWA 4G84A 4YRSA 2HFZA 2FTXB 1GZ6A 4YY3E 2CGHA 2B9DA 1EVKA 3J7AG 4M0VA 5LMNE 2XGTA 3GUUA 3F6GA 3VQYA 2E65A 1PKPA 3ADLA 1FYFA 4H2VA 5BR8E 3TEPA 1JJCB 3ICAA 4JI2E 3GZDC 2ZIMA 2ODRD 3IKLA 3TEHB 4J15A 3V7CA 3RMPA 4CH6A 2IY5A 4YHHE 2KHXA 4L87A 1DQ3A 3W3SA 4P74A 2Q7HA 2HHHE 2QHSA 2EJFA 1X2GA 3NETA 4UP8A 2F8BA 4HA8A 2UU9E 2UXBE 2ZT6A 2E1HA 3M9LA 4AQYE 4H2SA 4TQFA 4LFAE 4PG3A 4YRQA 3RL6A 1STUA 4XEMA 2XTIA 3HPZA 3V8LA 4DV0E 4BBYA 1WU7A 4P72C 1KMNA 1XNRE 1BBUA 3RIRA 4K0KE 4TUIA 1HTTA 4YRIA 3DJWA 4P3OA 2CPNA 2ZIOA 2AMCB 2DZCA 3C4BA 2I4NA 2ZNIA 2FV4B 4HWOA 2EZ6A 4K88A 4LVLA 2ODRC 4YRRA 2LTSA 1YFSA 2NA2A 3ADJA 5DTRA 2UUAE 3GZDA 2PMFA 2FGGA 1XNQE 2K4VA 4KZSA 1ATIA 4LU9A 3OWQA 3TFLA 5LMUE 2MC5A 3NELA 2QHTA 3MQZA 4L5NC 3MF2A 2E64A 1LYLA 4KQEA 3RUXA 1H4SA 4ER3A 3QOWA 4JI7E 5DRYA 3ZPXA 1J5EE 3IG2A 4P72A 4KR2A 4BCAA 2RHQA 1NYQA 4Q6GA 4AH6A 4ER5A 2L3JA 3E9IA 4UP7A 5JUWA 2C8MA 1XMOE 3GZCA 4XTWA 1RIQA 4JI5E 4DPGA 4HT4A 4YCVA 1BIAA 1WHNA 3ADIA 3G1ZA 5CFFE 4RMFA 4X64E 4DR5E 2ZXFA 4DV3E 2H36X 4GKKE 1X2HA 1N34E 4YPFA 4LF8E 2RS7A 2QHVA 4H2UA 3HFZA 5AE1A 4TTVA 4TVWA 3ME5A 3KWRA 1W66A 1X48A 2DU5A 3R09A 4TUGA 3ZOQB 1H4VB 4M30A 2EJ9A 2JOBA 5F3WA 1EIYA 4GKJE 3VK6A 4TVYA 1EKZA 2ZNJA 2N3GA 2DZ9A 2KONA 3IKMB 3L4GB 2L3CA 4DR7E 4UP9A 2JR1A 3JU0A 4G85A 3NROA 4JI8E 2DTIA 2V87A 4J8ZA 4XTYA 1UILA 5IT9C 1NNHA 4XTXA 4YRMA 4BWAA 2L2MA 4L8NA 4X62E 1QU6A 4TQDA 3REUA 4CS3A 4P78A 3QO8A 3ERRA 2CIMA 4LVJA 3A5YA 5ELOA 1B70B 4YRNA 1ZBQA 3A74A 1Z7NA 2LUPB 2ZINA 3LSQA 2YT4A 4YRFA 4EX5A 5K1PA 4LF9E 3LC0A 4YRCA 4BS9A 3HFVA 2ZT8A 3WQZA 4DR4E 4KHPE 4DV2E 4LF6E 4JI6E 1G51A 3VYYA 2A8EA 3HXWA 3V8JA 2NS6A 2DKGA 1XMQE 1DI2A 1YYKA 1EQRA 4Q2JA 1YZ9A 4DR6E 3V8KA 2XXQA 4HWSA 3VQWA 2Q7EA 4XTZA 3IWCA 2ZTGA 4ER0A 3HY1A 3MEJA 1HC7A 2CJ9A 2ALYA 3A7UA 3MEYA 5DNYA 1HNXE 4H2XB 4P71C 3C4TA 1IBME 5F5WA 4YYEA 3V7SA 4YRPA 4B3ME 2E3CA 1YFTA 3CMQA 3PCOA 1KOGA 2E5LE 1J26A 5T6JA 4BW9A 2ZCEA 1NYRA 1VQZA 2ZZGA 4CH5A 2DDZA 4HWTA 1J5WA 5ELNA 2AKWA 2P0LA 1X49A 4CH3A 4LVMA 4P7DA 2IY5B 4HRAA 4Q15A 3AV0A 4WF2A 2L6MA 1WPYA 3IWBA 3I7FA 2EJGA 4CS2A 1C0AA 2RHSA 3NXHA 5C51B 2C7IA 1KMMA 4RQFA 2HCNA 3P8YA 4NCXA 4XU2A 4EZIA 4LFCE 2DSYA 4GEQB 2LUQA 4RDXA 2HNIA 4F9CB 2ZZFA 2VF1A 2DMYA 4R03A 1YYWA 4WFTA 1IBKE 2JWOA 2EL9A 4DE9A 2NUFA 4P71A 3JTZA 2FYKA 1G5HA 2L33A 3H09A 3LLHA 3REXA 4DV1E 3OKZA 3HXYA 1EFWA 1WLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7A A;  2Q7G A;  3FJP A;  3BFM A;  4WJ4 A;  1ADY A;  1PYS A;  2EWN A;  1EVL A;  2I4L A;  1B76 A;  3HXZ A;  1YFR A;  1ADJ A;  4UPA A;  3VQX A;  2RHQ B;  1NJ6 A;  3A32 A;  1E22 A;  2DXU A;  3P8V A;  4TVA A;  3RGL A;  2PME A;  4EO4 A;  2E10 A;  2CJA A;  2EAY A;  3RKX A;  2E5A A;  4X5O A;  5C52 B;  2DTH A;  1NJ2 A;  4XEO A;  3HRK A;  3UGQ A;  3A31 A;  4XU3 A;  2Q5H A;  2ZT5 A;  2I4O A;  3HFZ B;  1X55 A;  5E3I A;  3RAC A;  3IAL A;  4HWP A;  12AS A;  4XTU A;  2ZT7 A;  1EIY B;  4P73 C;  1B7Y A;  4YCW A;  2ARU A;  3LSS A;  2I4M A;  1H4Q A;  2DQ0 A;  4PHC A;  3QO5 A;  3VBB A;  4ZTU B;  3HXX A;  4WJ3 M;  4ZIB A;  1ASY A;  1NJ1 A;  4CS4 A;  4DQ2 A;  1N9W A;  1X01 A;  2G4C A;  2E41 A;  1WQ7 A;  1Z7M A;  3L2Z A;  2J3M A;  1X56 A;  4YCU A;  1X54 A;  3M4P A;  4P73 A;  5C53 B;  1B8A A;  1WNL A;  1JJC A;  3TUP A;  1BIB A;  3TEH A;  4H2X A;  1E24 A;  11AS A;  4H2T A;  4P75 C;  3QTC A;  2ALY B;  4P3P A;  3P8T A;  5HGQ A;  4YDQ A;  3PCO B;  4KR3 A;  3PZC A;  2DJZ A;  2AKW B;  3HXV A;  1USY C;  4XU0 A;  1QF6 A;  4XU1 A;  4YP0 A;  2AMC A;  3DSQ A;  2RHS B;  4WI1 A;  5K1X A;  4YRO A;  4YRT A;  4TWA A;  3A5Z A;  4P75 A;  4RQE A;  1WQW A;  3EFS A;  1SER A;  3UGT A;  1E1T A;  2ZR2 A;  3HXU A;  3BJU A;  4H2Y A;  4XTV A;  2DVE A;  3TEG A;  2CJB A;  2J3L A;  3UH0 A;  4OP0 A;  3VQV A;  4H2W A;  1YB3 A;  1USY A;  1QE0 A;  2DXT A;  1YGB A;  3HY0 A;  4YRG A;  1NJ5 A;  4HWR A;  1PYS B;  2ARS A;  2ZGW A;  3MF1 A;  1ASZ A;  5KNN A;  1SET A;  4O2D A;  3RKY A;  3NEN A;  3OD1 A;  2ZR3 A;  3L1A A;  4TVA B;  2P5I A;  2ART A;  4OLF A;  4YRJ A;  2Q5I A;  4H02 A;  2QHU A;  3QO7 A;  1H4T A;  4LNS A;  4E51 A;  4YRK A;  2DQ3 A;  3V7R A;  3A7R A;  3L4G A;  3QNE A;  3E9H A;  1IL2 A;  4YRE A;  1EOV A;  4P3N A;  3HTZ A;  3R07 A;  2ZZE A;  4YRL A;  3RF1 A;  1NJ8 A;  3NEM A;  1L0W A;  1HXD A;  4K86 A;  1B70 A;  3KFU A;  1B7Y B;  2DEQ A;  1BBW A;  2DU7 A;  4P74 C;  1SRY A;  4CH4 A;  3HRI A;  4ZTZ B;  1GGM A;  1E1O A;  3UFG A;  4HVC A;  3EFR A;  1SES A;  4K87 A;  2DTO A;  1G5I A;  3M4Q A;  1WYD A;  3RKW A;  4G84 A;  4YRS A;  2CGH A;  1EVK A;  2XGT A;  3VQY A;  2E65 A;  4H2V A;  1FYF A;  1JJC B;  3ICA A;  2ZIM A;  2ODR D;  3IKL A;  3TEH B;  4J15 A;  3V7C A;  4CH6 A;  2IY5 A;  4L87 A;  3W3S A;  4P74 A;  2Q7H A;  2QHS A;  2EJF A;  1X2G A;  3NET A;  4UP8 A;  4HA8 A;  2ZT6 A;  2E1H A;  4H2S A;  4TQF A;  4PG3 A;  4YRQ A;  3RL6 A;  4XEM A;  2XTI A;  3V8L A;  1WU7 A;  4P72 C;  1KMN A;  1BBU A;  3RIR A;  1HTT A;  4YRI A;  4P3O A;  2ZIO A;  2AMC B;  2DZC A;  2I4N A;  2ZNI A;  4HWO A;  4K88 A;  2ODR C;  4YRR A;  1YFS A;  2PMF A;  1ATI A;  3NEL A;  2QHT A;  3MF2 A;  2E64 A;  1LYL A;  4KQE A;  3RUX A;  1H4S A;  4KR2 A;  3IG2 A;  4P72 A;  2RHQ A;  1NYQ A;  4Q6G A;  4AH6 A;  4UP7 A;  3E9I A;  2C8M A;  4XTW A;  1RIQ A;  4DPG A;  4YCV A;  1BIA A;  3G1Z A;  4RMF A;  2ZXF A;  1X2H A;  4YPF A;  2QHV A;  4H2U A;  3HFZ A;  4TTV A;  4TVW A;  1W66 A;  2DU5 A;  1H4V B;  2EJ9 A;  1EIY A;  4TVY A;  2ZNJ A;  2DZ9 A;  3IKM B;  3L4G B;  4UP9 A;  4G85 A;  2DTI A;  4XTY A;  1NNH A;  4YRM A;  4XTX A;  4BWA A;  4TQD A;  3REU A;  4CS3 A;  3QO8 A;  3ERR A;  2CIM A;  3A5Y A;  5ELO A;  1B70 B;  4YRN A;  3A74 A;  3LSQ A;  1Z7N A;  2ZIN A;  4YRF A;  4EX5 A;  5K1P A;  3LC0 A;  4YRC A;  3HFV A;  2ZT8 A;  3WQZ A;  1G51 A;  3HXW A;  3V8J A;  2DKG A;  1EQR A;  3V8K A;  4HWS A;  3VQW A;  2Q7E A;  4XTZ A;  2ZTG A;  3HY1 A;  1HC7 A;  2CJ9 A;  2ALY A;  3A7U A;  3MEY A;  4H2X B;  4P71 C;  5F5W A;  4YYE A;  3V7S A;  4YRP A;  2E3C A;  1YFT A;  3CMQ A;  3PCO A;  1KOG A;  4BW9 A;  2ZCE A;  1NYR A;  1VQZ A;  2ZZG A;  4CH5 A;  2DDZ A;  4HWT A;  1J5W A;  5ELN A;  2AKW A;  2P0L A;  4CH3 A;  2IY5 B;  4Q15 A;  4WF2 A;  1WPY A;  3I7F A;  2EJG A;  4CS2 A;  1C0A A;  2RHS A;  5C51 B;  2C7I A;  1KMM A;  4RQF A;  3P8Y A;  4NCX A;  4XU2 A;  4RDX A;  2HNI A;  2ZZF A;  4P71 A;  2EL9 A;  2FYK A;  1G5H A;  3REX A;  3HXY A;  1EFW A;  1WLE A; 
#chains in the Genus database with same CATH topology
 4JYA E;  5DTM A;  2EOO A;  2Q7G A;  3BBG A;  1LMB 3;  3QF3 A;  4DR2 E;  1RQ0 A;  4F9B B;  2EMF A;  1A1I A;  4LVI A;  3A9X A;  3TEL A;  2PUB A;  4NXN E;  1KJK A;  2M4I A;  3VQX A;  2RHQ B;  3A32 A;  4YG4 A;  4DV5 E;  3RGL A;  1RMD A;  2PME A;  4OOG C;  5A69 A;  3A9Y A;  2HGH A;  3VK0 A;  1NJ2 A;  3UGQ A;  3JXB C;  4EK9 A;  2ZT5 A;  2PXP A;  2EPU A;  2LYS A;  3RAC A;  4X4E A;  3F6W A;  5GAG i;  4LF7 E;  1EIY B;  4P73 C;  1NCS A;  4YCW A;  2ARU A;  1EFA A;  1S7E A;  1AAY A;  2EWL A;  1H4Q A;  1LCC A;  2V8Q B;  4M2Z A;  4ZTU B;  3HXX A;  4ZIB A;  2PE5 A;  4OX9 E;  2G4C A;  1Z7M A;  3L2Z A;  2JOX A;  2HC5 A;  3EUS A;  2LE2 A;  1X56 A;  4F54 A;  3M4P A;  5C53 B;  1ADR A;  3HQ1 A;  2EOE A;  1JJC A;  3TUP A;  4R2S A;  4NXM E;  2PXD A;  4DUZ E;  4H2T A;  3QTC A;  2F4V E;  1QQB A;  2B3T B;  1NEQ A;  4YDQ A;  1R63 A;  2BB8 A;  2LTR A;  2DJZ A;  3PE5 A;  1RZR D;  3ECR A;  2YTD A;  5AE2 A;  2EPO A;  4I6R A;  1QF6 A;  3JAM C;  2AMC A;  4YP0 A;  1I94 E;  1PJT A;  1G2D C;  2EMI A;  4YRT A;  2BNO A;  4TWA A;  1A1J A;  3MSW A;  2V89 A;  4WYQ B;  4P75 A;  1JFT A;  1WET A;  1JK2 A;  1WQW A;  2ZR2 A;  4O5G A;  5KL6 A;  2AXZ A;  2PUG A;  2DVE A;  2V85 A;  1AH5 A;  1SFE A;  1FKA E;  4OP0 A;  4EKG A;  2MKN A;  2YTQ A;  1USY A;  1ZZB A;  4DMI A;  1G2F C;  2EM4 A;  1YGB A;  4YRG A;  1YYO A;  1ASZ A;  1SET A;  2M9A A;  4O2D A;  2EOY A;  3RKY A;  3NEN A;  3OD1 A;  4TVA B;  2E1M A;  2ART A;  2LYJ A;  2R76 A;  4DR3 E;  1FJG E;  5A7L A;  1H4T A;  2ENH A;  2DQ3 A;  2EMY A;  2EN8 A;  3T1Y E;  2IVG A;  3L4G A;  3VHT B;  2PXK A;  4P3N A;  5TSE A;  3HTZ A;  2VEO A;  2J7W A;  3BGH A;  4PU7 A;  1EH8 A;  3L1P A;  2DMI A;  5A6J A;  2BJC A;  1B7Y B;  3M99 B;  3SR4 A;  4CH4 A;  3BD1 A;  2VRD A;  2LCE A;  2AXU A;  1JWL A;  3QOX A;  2V3C C;  3S8Q A;  3M4Q A;  4G84 A;  2FTX B;  1GZ6 A;  2XGT A;  2MDG A;  5LMN E;  2E65 A;  4H2V A;  3ICA A;  4JI2 E;  2ZIM A;  3BDN A;  3IKL A;  3TEH B;  2IY5 A;  4IJD A;  2KHX A;  2EJF A;  1X2G A;  5KL5 A;  2D5V A;  2E1H A;  4IVZ A;  4H2S A;  4PG3 A;  1A1F A;  2NAB A;  1WU7 A;  1KMN A;  4R2E A;  2PUC A;  5GAH i;  4YRI A;  3DJW A;  4P3O A;  2DZC A;  2I4N A;  4YRR A;  3JXD L;  3QWG A;  1MGT A;  2WBU A;  3OMT A;  2KZ8 A;  5LMU E;  1YUI A;  1OSL A;  2R63 A;  2JP9 A;  2E64 A;  1IQS A;  1H4S A;  3QG5 C;  1J5E E;  3IG2 A;  2RHQ A;  4AH6 A;  4I6T A;  2C8M A;  2EOF A;  2YTI A;  1RIQ A;  2LV2 A;  2GRM A;  2YTF A;  4DV3 E;  4JCX A;  1X2H A;  2DLK A;  2LYP A;  2QHV A;  1X48 A;  3R09 A;  1H4V B;  2EJ9 A;  5F3W A;  3JXC L;  1EIY A;  1IQO A;  2ENA A;  2EOZ A;  2ZNJ A;  4DR7 E;  2JR1 A;  3JU0 A;  4ZYG A;  4MCT A;  4XTY A;  4X4H A;  1X3C A;  2EPN A;  4YRM A;  4XTX A;  4BWA A;  4LVJ A;  2CIM A;  3MHH C;  1B70 B;  3LSQ A;  3A74 A;  2ZIN A;  2LUP B;  4Y42 A;  3QQ6 A;  3HZI B;  1Z1B A;  2LYL A;  3EQ1 A;  2EPM X;  2ZT8 A;  2BNN A;  3G7D A;  1G51 A;  2A8E A;  3V8J A;  5KL3 A;  2PPX A;  4Q2J A;  4DR6 E;  2XXQ A;  2I9I A;  1KYQ A;  2R1J L;  3A7U A;  4GHJ A;  4YRP A;  4B3M E;  2E5L E;  3ZHI A;  1VQZ A;  3KL4 A;  2YTG A;  4HWT A;  5ELN A;  4CH3 A;  2PXE A;  4P7D A;  4R2Q A;  3LFP A;  3IWB A;  2EJG A;  5C51 B;  2C7I A;  3P8Y A;  1WH6 A;  4XU2 A;  4LFC E;  4FK5 C;  1QP0 A;  2YTN A;  3OP9 A;  2LUQ A;  3FMY A;  3BF2 A;  4F9C B;  2ZZF A;  2YTJ A;  3OQM A;  2PXQ A;  1BDH A;  4WFT A;  2EL9 A;  3F52 A;  1JFS A;  3LLH A;  3OKZ A;  4F2J C;  2EN1 A;  1LLM C;  2LLW A;  3BFM A;  2EWN A;  2K7I A;  2KEI A;  1A1L A;  4JI0 E;  4RH8 A;  2WBS A;  2EMC A;  1B76 A;  3HXZ A;  5IXM B;  3F51 A;  1YFR A;  1NJ6 A;  1E22 A;  2DXU A;  4TVA A;  2AWI A;  5A6B A;  4EO4 A;  3UWP A;  1WXR A;  1MEY C;  2E10 A;  2EAY A;  3ADG A;  2L92 A;  3VYX A;  4X5O A;  1DWK A;  2DTH A;  3K6Q A;  4XEO A;  3HRK A;  4O8B A;  3SCH A;  4ZYE A;  1WJP A;  3A31 A;  2YZT A;  3HFZ B;  2LLV A;  5A6K A;  1X55 A;  5E3I A;  4HWP A;  1BBG A;  12AS A;  1YPN A;  3G0T A;  1B7Y A;  1PJS A;  3MLF A;  2WUS R;  5ADZ A;  4R8O A;  4R2D A;  2EMA A;  2YWQ A;  4EKI A;  4BHB A;  2M1S A;  3QO5 A;  2YRK A;  1ASY A;  2EPC A;  2DIX A;  2XCJ A;  1NJ1 A;  4CS4 A;  4DQ2 A;  1N9W A;  3J7Y p;  1X01 A;  3DM5 A;  4WSP A;  2J3M A;  4LF5 E;  5A2Q C;  1X54 A;  2UUB E;  2JQE A;  3TEH A;  2M4H A;  1T4N A;  4RHB B;  5LL6 R;  2O38 A;  4P3P A;  3F6H A;  2LT7 A;  3P8T A;  5AC4 A;  2JY9 A;  1QP4 A;  4PU4 C;  2ICT A;  1T4L B;  2EMH A;  3PCO B;  2PXU A;  2GZU A;  2IUO A;  2OFY A;  4XU0 A;  3OML A;  2RSI A;  3DSQ A;  4WI1 A;  5DSX A;  4R2P A;  2EMK A;  3EPH A;  1PJQ A;  3CLC A;  1QQA A;  2ZM6 E;  4RQE A;  4JQD A;  4X4D A;  3UGT A;  3HXU A;  4XTV A;  2B7V A;  2IV1 A;  2OR1 L;  2RQL A;  3QFI A;  4H2W A;  1GQE A;  2EQ3 A;  1PRV A;  2PXB A;  2DXT A;  4ER6 A;  2EM6 A;  2LYQ A;  2EM5 A;  2MDR A;  3KZZ A;  4IA8 A;  1HQ1 A;  2EM8 A;  3NDB B;  3R1F A;  2N3H A;  1E3O C;  2RSM A;  3L1A A;  3A9Z A;  4DV7 E;  4H02 A;  2QHU A;  2PXV A;  4LNS A;  4YRK A;  3V7R A;  2XXP A;  1X47 A;  2M7Q A;  1N32 E;  1CQT A;  3E9H A;  3R07 A;  2ZZE A;  1OCT C;  5AE3 A;  3RF1 A;  2DGC A;  1N33 E;  3G5G A;  1B70 A;  1X2L A;  2DU7 A;  4P74 C;  3GN5 B;  2FFH A;  5LLQ A;  4ZTZ B;  3OQN A;  3KXA A;  1CJG A;  2PRT A;  1NEI A;  2HFZ A;  2N8X A;  2EOR A;  3GUU A;  2EMZ A;  3F6G A;  1PKP A;  5BR8 E;  3GZD C;  4J15 A;  4YBA A;  3W3S A;  2YSO A;  4UP8 A;  2F8B A;  1A1G A;  4LFA E;  3RL6 A;  1QNT A;  3HPZ A;  3V8L A;  4P72 C;  2LO3 A;  1BBU A;  2CPN A;  3C4B A;  2ZNI A;  2FV4 B;  4HWO A;  4LVL A;  2LTS A;  3ADJ A;  5DTR A;  1XNQ E;  1WRJ A;  4KZS A;  2CSH A;  1ATI A;  4LU9 A;  3BS3 A;  2QHT A;  2ICP A;  3MQZ A;  2XSD C;  1EH6 A;  2EM0 A;  4X4F A;  2MQK A;  4JI7 E;  5DRY A;  1MFQ C;  4KR2 A;  4BCA A;  1NYQ A;  4ER5 A;  3E9I A;  2WIU B;  4XTW A;  4JI5 E;  4DPG A;  4YCV A;  1BIA A;  2PUD A;  4WXC A;  3L00 A;  4WXD A;  4X64 E;  2E72 A;  2H36 X;  1ZPQ A;  4YPF A;  3HFZ A;  1QB2 A;  5AE1 A;  4TVW A;  3ME5 A;  2JOB A;  1EKZ A;  3IKM B;  2L3C A;  4G85 A;  2CSF A;  2EMG A;  2V87 A;  4J8Z A;  1UIL A;  5IT9 C;  1NNH A;  2L2M A;  4L8N A;  1QU6 A;  2PIJ A;  3ERR A;  3C6K A;  1ZBQ A;  4YRF A;  4MLV A;  1PNR A;  4LF9 E;  3LC0 A;  1WH8 A;  1O4X A;  4BS9 A;  3HFV A;  4DR4 E;  3VYY A;  3HXW A;  4YG7 B;  2DKG A;  1UXC A;  2A6C A;  1YZ9 A;  2B5A A;  2Q7E A;  1ZS4 A;  1IC8 A;  2CJ9 A;  2L49 A;  5DNY A;  1HNX E;  4NHR A;  2EN7 A;  3PCO A;  5T6J A;  2ZCE A;  1NYR A;  2ZZG A;  1A1H A;  1J5W A;  1X49 A;  4HRA A;  3AV0 A;  2L6M A;  3FYM A;  3I7F A;  1C0A A;  3NXH A;  2BBG A;  4RQF A;  2EQ0 A;  1X57 A;  2HNI A;  2GLI A;  1YYW A;  4P71 A;  2JWO A;  1RZS A;  1WLE A;  3SCG A;  2XIU A;  2DLQ A;  2YU8 A;  1NW3 A;  4F9A B;  5AC5 A;  1T4O A;  1ADY A;  4YG1 A;  2XJ3 A;  4B3R E;  2I4L A;  1ADJ A;  2EF8 A;  2LYK A;  2IU7 A;  5KL7 A;  4KWY A;  1HNW E;  4Q35 B;  4DV6 E;  4DKK A;  2CJA A;  2KOU A;  3RKX A;  2L2K B;  5C52 B;  2LCV A;  3THO B;  2LJU A;  2Q5H A;  1LCD A;  2I4O A;  3SCF A;  1PRA A;  2YRH A;  3IAL A;  4X4I A;  2O49 A;  2EL6 A;  4HTG A;  4XTU A;  2ZT7 A;  4BHC A;  2LMZ A;  3LSS A;  2BNM A;  2I4M A;  3GN5 A;  2JVA A;  5DT2 A;  2DQ0 A;  4Q28 A;  2G7H A;  2L8N A;  5IWA E;  2EOX A;  4R2A A;  2EM2 A;  1N3G A;  2YTE A;  4EQZ A;  4DE8 A;  2E41 A;  3FIG A;  1TF3 A;  3OTO E;  3C6M A;  2XXA A;  2ELY A;  3IWD A;  4X8W A;  4DUY E;  4P73 A;  1YUJ A;  1BIB A;  3T1H E;  1IMU A;  4H2X A;  11AS A;  4P75 C;  4LF4 E;  2EPR A;  5HGQ A;  4Z5D A;  2WBT A;  3PZC A;  5DTQ A;  3VWS A;  2AKW B;  4JI3 E;  1USY C;  5K1X A;  2HIN A;  4YRO A;  3A5Z A;  4ER7 A;  3HPS A;  3EFS A;  1SER A;  4BC7 A;  2V88 A;  1WHQ A;  3HXL A;  3BJU A;  4H2Y A;  3LIS A;  4WSG A;  3TEG A;  2CJB A;  2J3L A;  2KPJ A;  1QP7 A;  3UH0 A;  1ZUG A;  1NER A;  2B7T A;  1YB3 A;  2PUA A;  4BMJ A;  1QE0 A;  3J81 C;  2EBY A;  3KZ3 A;  2EPZ A;  4HWR A;  2HCS A;  1PYS B;  3HTX A;  3QYX A;  2JYA A;  5KL4 A;  1DGC A;  1SR9 A;  4YRJ A;  3QO7 A;  2EN4 A;  5DRT A;  2WZO A;  1JK1 A;  4E51 A;  2L1P A;  3BID A;  1LLI A;  3A7R A;  1RZR A;  3QNE A;  4YRE A;  1EOV A;  3LML A;  2Q8U A;  2EPL X;  1NJ8 A;  2YU5 A;  1L0W A;  1HXD A;  2ADR A;  1F2I G;  2YSP A;  4R2C A;  2DEQ A;  4PU8 A;  4IS1 C;  2V86 A;  1B69 A;  2JCG A;  2XI8 A;  1GGM A;  3UFG A;  4HVC A;  3TQM A;  1RPE L;  4HEI A;  4BC9 A;  4LFB E;  3EFR A;  1SES A;  1HR0 E;  2AXV A;  1IBL E;  4DV4 E;  2EP3 A;  5FLX C;  1WYD A;  3RKW A;  4YY3 E;  2B9D A;  1EVK A;  3J7A G;  3VQY A;  3ADL A;  1FYF A;  3TEP A;  1Y9Q A;  2ODR D;  1X6F A;  4CH6 A;  3V7C A;  3RMP A;  4YHH E;  4L87 A;  1DQ3 A;  3DNV B;  2QHS A;  4JCY A;  3NET A;  4F6M A;  2UU9 E;  1GT0 C;  2ZT6 A;  4TQF A;  1STU A;  4DV0 E;  1XNR E;  3RIR A;  4K0K E;  4TUI A;  1HTT A;  2ZIO A;  1T39 A;  2EPX A;  2EZ6 A;  2JXP A;  4Z5C A;  2ODR C;  2NA2 A;  3OWQ A;  3TFL A;  3NEL A;  2AW6 A;  3MF2 A;  4FBI A;  3QOW A;  2HJJ A;  3ZPX A;  2A25 A;  4UP7 A;  5JUW A;  4O24 A;  3GZC A;  3FYA A;  1R69 A;  1WHN A;  3ADI A;  5CFF E;  4RMF A;  3KJX A;  4I8T A;  4GKK E;  2H8R A;  1N34 E;  4LF8 E;  2RS7 A;  2EOM A;  2PUF A;  4H2U A;  2EN2 A;  2HSG A;  2DU5 A;  1BDI A;  3ZOQ B;  3VK6 A;  2N3G A;  2KON A;  1X6H A;  1ZAA C;  2EJ4 A;  3NRO A;  1ZR9 A;  1UN6 B;  3REU A;  1ZZ7 A;  4P78 A;  3QO8 A;  3A5Y A;  1UTX A;  5ELO A;  1B0N A;  4YRN A;  1ZZ8 A;  5K1P A;  4EX5 A;  2YT4 A;  4NZV A;  4YRC A;  3WQZ A;  4KHP E;  4DV2 E;  4LF6 E;  2EOH A;  3IVP A;  4PU3 C;  1XMQ E;  1YYK A;  1EQR A;  1GTK A;  3V8K A;  2CRO A;  3ZKC A;  2EM9 A;  4XTZ A;  3H5T A;  2ZTG A;  3MEY A;  3THN A;  4H2X B;  1IBM E;  5F5W A;  3V7S A;  5A6B D;  4FN3 A;  1X6E A;  3CMQ A;  1J26 A;  1L1M A;  2YRM A;  4CH5 A;  2DDZ A;  2AKW A;  3UK3 C;  4LVM A;  2O4A A;  4Q15 A;  4WF2 A;  2EPP A;  1PDA A;  2HCN A;  2EMX A;  4NCX A;  2YTP A;  4GEQ B;  4RDX A;  2VF1 A;  4R03 A;  4DE9 A;  2NUF A;  1T38 A;  2EOI A;  4R2R A;  3REX A;  3HXY A;  2JPA A;  2EOQ A;  2YTO A;  5KL2 A;  5AAS A;  3A7A A;  4JI1 E;  2EMB A;  3FJP A;  4WJ4 A;  1PYS A;  3P1X A;  1EVL A;  4Z59 A;  2EM7 A;  1ZU1 A;  4UPA A;  3P8V A;  1JH9 A;  2E5A A;  2EN3 A;  4XU3 A;  2LNM A;  1BB8 A;  4B3S E;  2WCC 3;  3OQO A;  3SX0 A;  1PER L;  1RC7 A;  3GBF A;  4OBM A;  3EPK A;  1TN9 A;  1ZAY A;  2PXT A;  4PHC A;  1PRU A;  3VBB A;  4WJ3 M;  2L2N A;  4JI4 E;  1POU A;  2MXD A;  2YBD A;  1P47 A;  2MEZ A;  1WQ7 A;  1AU7 A;  5A6A A;  4YCU A;  4LTY A;  4ZYH A;  2RTX A;  2EL5 A;  1B8A A;  1WNL A;  1E24 A;  4DR1 E;  2ALY B;  2UXC E;  4KR3 A;  2R1F A;  1UHZ A;  2NUG A;  4ZYD A;  1HNZ E;  2MC6 A;  3HXV A;  4WPY A;  2VQE E;  1ZBT A;  4XU1 A;  2RHS B;  1Y7Y A;  1UXD A;  3ZHM A;  4LVK A;  1VPW A;  4N4R B;  2EE8 A;  1L4S A;  1U2Z A;  2J7U A;  1E1T A;  3J80 C;  1ZZC A;  1EH7 A;  5K98 B;  2EPK X;  2KEJ A;  2EPA A;  4WVL A;  4I8O A;  3CEC A;  3VQV A;  2EM3 A;  2LJH A;  4JV5 E;  2LBS B;  2V83 A;  3HY0 A;  3KZY A;  3AUZ A;  1N36 E;  1YSE A;  2NUE A;  1NJ5 A;  2ARS A;  3NZL A;  2ZGW A;  2VQF E;  3MF1 A;  5KNN A;  2L8T A;  1QPZ A;  4Z5H A;  2GRL A;  1ZZ6 A;  2LRS A;  1BBO A;  1UBD C;  2ZR3 A;  2P5I A;  2EN6 A;  4OLF A;  2Q5I A;  2UUC E;  5IV8 B;  3DF6 A;  2PXF A;  1O0W A;  1IL2 A;  2DB2 A;  3EPJ A;  2IHR 1;  4YRL A;  2MKD A;  1YSA C;  2VE7 C;  3TRB A;  3NEM A;  3MHS C;  4K86 A;  4X65 E;  3KFU A;  2IVB A;  2RS6 A;  2KEK A;  2UXD E;  1BBW A;  1SRY A;  4OB4 A;  3HRI A;  1E1O A;  3UFD A;  1SQ8 A;  4X66 E;  4GZN C;  4B3T E;  1HF0 A;  2LYR A;  2ELZ A;  4K87 A;  2DTO A;  1G5I A;  4YRS A;  2EML A;  2CGH A;  1RIO A;  3EPL A;  2CT1 A;  2GPI A;  4M0V A;  2I13 A;  1JJC B;  4M9V C;  4YAR A;  2EL4 A;  4P74 A;  2Q7H A;  2HHH E;  4J1X A;  4HA8 A;  4MCX A;  2UXB E;  4GQM A;  3M9L A;  1DUL A;  4AQY E;  3U3W A;  4YRQ A;  4XEM A;  2XTI A;  4BBY A;  4F6N A;  3LQX A;  2RPC A;  1A1K A;  4X9J A;  4I6U A;  2DRP A;  2AMC B;  4J1W A;  2EQ1 A;  4X4B A;  4K88 A;  1YFS A;  2UUA E;  3GZD A;  2PMF A;  2FGG A;  2K4V A;  2MC5 A;  3B7H A;  4L5N C;  1LYL A;  4KQE A;  3RUX A;  4ER3 A;  4P72 A;  1ZVV A;  4Q6G A;  2L3J A;  1XMO E;  4HT4 A;  3RZZ A;  2LVH A;  1TF6 A;  2D9H A;  3G1Z A;  2ZXF A;  4DR5 E;  2EOJ A;  2FJR A;  1YFH A;  2PUE A;  4TTV A;  3KWR A;  1W66 A;  4TUG A;  4M30 A;  4GKJ E;  4TVY A;  2DZ9 A;  3L4G B;  4UP9 A;  4JI8 E;  2DTI A;  1X5W A;  4X62 E;  3D1N I;  4TQD A;  4CS3 A;  2YPN A;  1Z7N A;  4NDW A;  4X4G A;  2AUW A;  1WIZ A;  4JI6 E;  2NS6 A;  1DI2 A;  3O9X A;  2EWT A;  2IVQ A;  4WX9 A;  4F8D A;  3PXP A;  4HWS A;  4O43 A;  3VQW A;  3IWC A;  3HY1 A;  4ER0 A;  4O4K A;  2JVL A;  2GHF A;  3MEJ A;  1HC7 A;  2ALY A;  1XWR A;  4P71 C;  3C4T A;  4YYE A;  2E3C A;  1YFT A;  1KOG A;  4BW9 A;  2PXL A;  2P0L A;  2J7J A;  2IY5 B;  1WPY A;  2EMW A;  4X4C A;  4CS2 A;  2RHS A;  1ZZ9 A;  4Z58 A;  1KMM A;  1DW9 A;  4EZI A;  2DSY A;  3CRO L;  2CTD A;  2EOS A;  2DMY A;  1IBK E;  3JTZ A;  2FYK A;  1G5H A;  2ENC A;  1LQC A;  2L33 A;  4IWR A;  3H09 A;  4MLQ A;  4DV1 E;  1EFW A;  1QZX A; 
#chains in the Genus database with same CATH homology
 4JYA E;  5AAS A;  3A7A A;  5DTM A;  4JI1 E;  2Q7G A;  1NW3 A;  4F9A B;  3FJP A;  1T4O A;  2LLW A;  3BFM A;  4WJ4 A;  1ADY A;  1PYS A;  3P1X A;  1EVL A;  2EWN A;  4DR2 E;  4B3R E;  4JI0 E;  1RQ0 A;  4F9B B;  2I4L A;  4LVI A;  3A9X A;  3TEL A;  4NXN E;  1B76 A;  3HXZ A;  1YFR A;  1ADJ A;  2M4I A;  4UPA A;  3VQX A;  2RHQ B;  1NJ6 A;  3A32 A;  1E22 A;  2DXU A;  3P8V A;  4DV5 E;  4TVA A;  3RGL A;  2PME A;  4EO4 A;  1HNW E;  3UWP A;  1WXR A;  4DV6 E;  4DKK A;  4OOG C;  2E10 A;  2CJA A;  2KOU A;  2EAY A;  3RKX A;  3ADG A;  2L92 A;  3VYX A;  2L2K B;  2E5A A;  3A9Y A;  4X5O A;  5C52 B;  2DTH A;  1NJ2 A;  3K6Q A;  4XEO A;  3HRK A;  3UGQ A;  3A31 A;  4XU3 A;  2Q5H A;  2LNM A;  4EK9 A;  2ZT5 A;  2YZT A;  2I4O A;  2LLV A;  3HFZ B;  1X55 A;  5E3I A;  3RAC A;  3IAL A;  4B3S E;  4HWP A;  12AS A;  4LF7 E;  4XTU A;  2ZT7 A;  1EIY B;  4P73 C;  3G0T A;  1B7Y A;  4YCW A;  3SX0 A;  2LMZ A;  2ARU A;  3LSS A;  2I4M A;  1RC7 A;  5ADZ A;  2EWL A;  4R8O A;  2JVA A;  1H4Q A;  4OBM A;  5DT2 A;  2DQ0 A;  2V8Q B;  4Q28 A;  4PHC A;  4EKI A;  2G7H A;  2M1S A;  4M2Z A;  5IWA E;  3QO5 A;  3VBB A;  4ZTU B;  3HXX A;  4WJ3 M;  4ZIB A;  2L2N A;  4JI4 E;  1ASY A;  4EQZ A;  2DIX A;  1NJ1 A;  4CS4 A;  4DQ2 A;  4DE8 A;  1N9W A;  3J7Y p;  2MXD A;  1X01 A;  4OX9 E;  2YBD A;  2E41 A;  2G4C A;  1WQ7 A;  3FIG A;  1Z7M A;  3L2Z A;  3OTO E;  2JOX A;  4WSP A;  2J3M A;  4LF5 E;  2LE2 A;  5A2Q C;  1X56 A;  4YCU A;  4LTY A;  4F54 A;  3IWD A;  4X8W A;  2RTX A;  4DUY E;  1X54 A;  3HQ1 A;  1B8A A;  1WNL A;  1JJC A;  2UUB E;  3M4P A;  4P73 A;  5C53 B;  3TUP A;  4NXM E;  1BIB A;  3T1H E;  3TEH A;  2M4H A;  4H2X A;  4DUZ E;  1T4N A;  1E24 A;  11AS A;  5LL6 R;  4H2T A;  4P75 C;  4DR1 E;  3QTC A;  2F4V E;  2ALY B;  4P3P A;  2B3T B;  3F6H A;  2UXC E;  3P8T A;  4LF4 E;  5HGQ A;  2JY9 A;  4YDQ A;  1T4L B;  3PCO B;  4KR3 A;  3PZC A;  1UHZ A;  2NUG A;  2LTR A;  5DTQ A;  1HNZ E;  3VWS A;  2MC6 A;  2DJZ A;  2AKW B;  3HXV A;  4JI3 E;  4WPY A;  3PE5 A;  1USY C;  5AE2 A;  2VQE E;  1ZBT A;  4XU0 A;  1QF6 A;  4XU1 A;  3JAM C;  3OML A;  2AMC A;  4YP0 A;  1I94 E;  3DSQ A;  2RHS B;  4WI1 A;  5DSX A;  5K1X A;  4YRO A;  4YRT A;  4TWA A;  3MSW A;  2V89 A;  4WYQ B;  4LVK A;  3A5Z A;  4ER7 A;  4P75 A;  3HPS A;  2ZM6 E;  4RQE A;  1WQW A;  3EFS A;  1SER A;  1U2Z A;  2J7U A;  4BC7 A;  3UGT A;  1E1T A;  2ZR2 A;  3HXU A;  3J80 C;  2V88 A;  1WHQ A;  3HXL A;  3BJU A;  4H2Y A;  4XTV A;  2DVE A;  3TEG A;  2V85 A;  2CJB A;  2B7V A;  1FKA E;  2J3L A;  4WVL A;  4I8O A;  3UH0 A;  4OP0 A;  3VQV A;  3QFI A;  4EKG A;  2B7T A;  4H2W A;  1GQE A;  1YB3 A;  2LJH A;  1USY A;  4BMJ A;  1QE0 A;  4JV5 E;  4DMI A;  2LBS B;  2V83 A;  2DXT A;  4ER6 A;  1YGB A;  3J81 C;  1N36 E;  3AUZ A;  3HY0 A;  4YRG A;  2NUE A;  1NJ5 A;  4HWR A;  2HCS A;  1YYO A;  1PYS B;  3NZL A;  2ARS A;  2VQF E;  3HTX A;  2ZGW A;  3MF1 A;  1ASZ A;  5KNN A;  1SET A;  2L8T A;  2MDR A;  4O2D A;  3RKY A;  3NEN A;  2LRS A;  2N3H A;  3OD1 A;  2ZR3 A;  2RSM A;  3L1A A;  4TVA B;  2E1M A;  1SR9 A;  2P5I A;  3A9Z A;  2ART A;  4OLF A;  4YRJ A;  4DV7 E;  2Q5I A;  4H02 A;  2UUC E;  4DR3 E;  2QHU A;  1FJG E;  3QO7 A;  1H4T A;  5DRT A;  2WZO A;  3DF6 A;  4LNS A;  4E51 A;  4YRK A;  2L1P A;  2DQ3 A;  3V7R A;  3A7R A;  2XXP A;  3T1Y E;  1X47 A;  2M7Q A;  3L4G A;  3QNE A;  1O0W A;  1N32 E;  3E9H A;  1IL2 A;  4YRE A;  2DB2 A;  1EOV A;  4P3N A;  3HTZ A;  2VEO A;  3R07 A;  2IHR 1;  2J7W A;  2ZZE A;  3LML A;  4YRL A;  5AE3 A;  3RF1 A;  2VE7 C;  1NJ8 A;  3NEM A;  1N33 E;  1L0W A;  1HXD A;  4K86 A;  1B70 A;  4X65 E;  3KFU A;  1B7Y B;  2RS6 A;  2UXD E;  1BBW A;  2DEQ A;  3SR4 A;  2DU7 A;  4P74 C;  1SRY A;  4CH4 A;  2V86 A;  3HRI A;  4ZTZ B;  1GGM A;  1E1O A;  3UFG A;  4HVC A;  4X66 E;  4BC9 A;  4LFB E;  3EFR A;  1SES A;  3QOX A;  1HR0 E;  4B3T E;  1IBL E;  4DV4 E;  4K87 A;  2DTO A;  5FLX C;  1G5I A;  3M4Q A;  1WYD A;  3RKW A;  4G84 A;  4YRS A;  2HFZ A;  2FTX B;  1GZ6 A;  4YY3 E;  2CGH A;  2B9D A;  1EVK A;  3J7A G;  4M0V A;  5LMN E;  2XGT A;  3GUU A;  3F6G A;  3VQY A;  2E65 A;  1PKP A;  3ADL A;  1FYF A;  4H2V A;  5BR8 E;  3TEP A;  1JJC B;  3ICA A;  4JI2 E;  3GZD C;  2ZIM A;  2ODR D;  3IKL A;  3TEH B;  4J15 A;  3V7C A;  3RMP A;  4CH6 A;  2IY5 A;  4YHH E;  2KHX A;  4L87 A;  1DQ3 A;  3W3S A;  4P74 A;  2Q7H A;  2HHH E;  2QHS A;  2EJF A;  1X2G A;  3NET A;  4UP8 A;  2F8B A;  4HA8 A;  2UU9 E;  2UXB E;  2ZT6 A;  2E1H A;  3M9L A;  4AQY E;  4H2S A;  4TQF A;  4LFA E;  4PG3 A;  4YRQ A;  3RL6 A;  1STU A;  4XEM A;  2XTI A;  3HPZ A;  3V8L A;  4DV0 E;  4BBY A;  1WU7 A;  4P72 C;  1KMN A;  1XNR E;  1BBU A;  3RIR A;  4K0K E;  4TUI A;  1HTT A;  4YRI A;  3DJW A;  4P3O A;  2CPN A;  2ZIO A;  2AMC B;  2DZC A;  3C4B A;  2I4N A;  2ZNI A;  2FV4 B;  4HWO A;  2EZ6 A;  4K88 A;  4LVL A;  2ODR C;  4YRR A;  2LTS A;  1YFS A;  2NA2 A;  3ADJ A;  5DTR A;  2UUA E;  3GZD A;  2PMF A;  2FGG A;  1XNQ E;  2K4V A;  4KZS A;  1ATI A;  4LU9 A;  3OWQ A;  3TFL A;  5LMU E;  2MC5 A;  3NEL A;  2QHT A;  3MQZ A;  4L5N C;  3MF2 A;  2E64 A;  1LYL A;  4KQE A;  3RUX A;  1H4S A;  4ER3 A;  3QOW A;  4JI7 E;  5DRY A;  3ZPX A;  1J5E E;  3IG2 A;  4P72 A;  4KR2 A;  4BCA A;  2RHQ A;  1NYQ A;  4Q6G A;  4AH6 A;  4ER5 A;  2L3J A;  3E9I A;  4UP7 A;  5JUW A;  2C8M A;  1XMO E;  3GZC A;  4XTW A;  1RIQ A;  4JI5 E;  4DPG A;  4HT4 A;  4YCV A;  1BIA A;  1WHN A;  3ADI A;  3G1Z A;  5CFF E;  4RMF A;  4X64 E;  4DR5 E;  2ZXF A;  4DV3 E;  2H36 X;  4GKK E;  1X2H A;  1N34 E;  4YPF A;  4LF8 E;  2RS7 A;  2QHV A;  4H2U A;  3HFZ A;  5AE1 A;  4TTV A;  4TVW A;  3ME5 A;  3KWR A;  1W66 A;  1X48 A;  2DU5 A;  3R09 A;  4TUG A;  3ZOQ B;  1H4V B;  4M30 A;  2EJ9 A;  2JOB A;  5F3W A;  1EIY A;  4GKJ E;  3VK6 A;  4TVY A;  1EKZ A;  2ZNJ A;  2N3G A;  2DZ9 A;  2KON A;  3IKM B;  3L4G B;  2L3C A;  4DR7 E;  4UP9 A;  2JR1 A;  3JU0 A;  4G85 A;  3NRO A;  4JI8 E;  2DTI A;  2V87 A;  4J8Z A;  4XTY A;  1UIL A;  5IT9 C;  1NNH A;  4XTX A;  4YRM A;  4BWA A;  2L2M A;  4L8N A;  4X62 E;  1QU6 A;  4TQD A;  3REU A;  4CS3 A;  4P78 A;  3QO8 A;  3ERR A;  2CIM A;  4LVJ A;  3A5Y A;  5ELO A;  1B70 B;  4YRN A;  1ZBQ A;  3A74 A;  1Z7N A;  2LUP B;  2ZIN A;  3LSQ A;  2YT4 A;  4YRF A;  4EX5 A;  5K1P A;  4LF9 E;  3LC0 A;  4YRC A;  4BS9 A;  3HFV A;  2ZT8 A;  3WQZ A;  4DR4 E;  4KHP E;  4DV2 E;  4LF6 E;  4JI6 E;  1G51 A;  3VYY A;  2A8E A;  3HXW A;  3V8J A;  2NS6 A;  2DKG A;  1XMQ E;  1DI2 A;  1YYK A;  1EQR A;  4Q2J A;  1YZ9 A;  4DR6 E;  3V8K A;  2XXQ A;  4HWS A;  3VQW A;  2Q7E A;  4XTZ A;  3IWC A;  2ZTG A;  4ER0 A;  3HY1 A;  3MEJ A;  1HC7 A;  2CJ9 A;  2ALY A;  3A7U A;  3MEY A;  5DNY A;  1HNX E;  4H2X B;  4P71 C;  3C4T A;  1IBM E;  5F5W A;  4YYE A;  3V7S A;  4YRP A;  4B3M E;  2E3C A;  1YFT A;  3CMQ A;  3PCO A;  1KOG A;  2E5L E;  1J26 A;  5T6J A;  4BW9 A;  2ZCE A;  1NYR A;  1VQZ A;  2ZZG A;  4CH5 A;  2DDZ A;  4HWT A;  1J5W A;  5ELN A;  2AKW A;  2P0L A;  1X49 A;  4CH3 A;  4LVM A;  4P7D A;  2IY5 B;  4HRA A;  4Q15 A;  3AV0 A;  4WF2 A;  2L6M A;  1WPY A;  3IWB A;  3I7F A;  2EJG A;  4CS2 A;  1C0A A;  2RHS A;  3NXH A;  5C51 B;  2C7I A;  1KMM A;  4RQF A;  2HCN A;  3P8Y A;  4NCX A;  4XU2 A;  4EZI A;  4LFC E;  2DSY A;  4GEQ B;  2LUQ A;  4RDX A;  2HNI A;  4F9C B;  2ZZF A;  2VF1 A;  2DMY A;  4R03 A;  1YYW A;  4WFT A;  1IBK E;  2JWO A;  2EL9 A;  4DE9 A;  2NUF A;  4P71 A;  3JTZ A;  2FYK A;  1G5H A;  2L33 A;  3H09 A;  3LLH A;  3REX A;  4DV1 E;  3OKZ A;  3HXY A;  1EFW A;  1WLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...