2ODRD

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
Knots found
sequence length
663
structure length
451
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPEIYVYDGNVIGIPELKIDDIALKQIMSKNKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
total genus 112
structure length 451
sequence length 663
other databases KnotProt 2.0: Artifct S +31 +31
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
D PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.120 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2odrD03
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrD01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrD02
1J5WA 4H2XB 1WPYA 1WQWA 3BJUA 3CMQA 4YRGA 4HWRA 4TQDA 3G1ZA 3TEHA 3HXXA 1USYC 3IG2A 4OP0A 3IKMB 2QHUA 1Z7MA 3P8TA 1H4QA 2ZT8A 4P73C 1YB3A 4YRFA 1FYFA 1YFSA 2RHSA 2ZZFA 4WI1A 4P75C 3L4GA 1X2GA 4PHCA 5F5WA 2I4LA 1NYQA 3VQXA 2DXUA 4E51A 5ELNA 3R07A 12ASA 1ASZA 3REXA 1W66A 4NCXA 3A7RA 3A32A 2P0LA 2ZT7A 3HXWA 3UGTA 2E1HA 1WLEA 1NNHA 1GGMA 3HRIA 2P5IA 4XU1A 2DU5A 1N9WA 3NETA 4KR3A 1SERA 3V7RA 4CS2A 3PCOB 1VQZA 4DPGA 4XU2A 1PYSA 2DTIA 3NEMA 3QO5A 4EO4A 2E64A 1B7YB 2IY5B 3LSQA 5E3IA 4YCWA 4EX5A 4ZIBA 4CH5A 3V8KA 2E10A 2ZR3A 4P3PA 3HXVA 4YRIA 2AMCA 4H2XA 4P72A 4YRQA 3RUXA 4XTYA 1KOGA 11ASA 2ZCEA 4ZTZB 1WNLA 3RL6A 5K1PA 2PMEA 4K86A 1NJ5A 1NJ8A 4XTWA 4YCUA 2ODRC 3HTZA 2EL9A 4XTUA 4YRJA 2EJ9A 4YRMA 2ZR2A 2AKWB 4H2SA 4RQEA 3A31A 4TQFA 3RF1A 2E5AA 4YP0A 4P3OA 1BBUA 2ZTGA 2Q7HA 3EFSA 2C8MA 4YDQA 1H4TA 2E3CA 1L0WA 3HRKA 2ZXFA 1X56A 4TVYA 4TTVA 3HFZB 3TEGA 2XTIA 4YRRA 1EQRA 3UFGA 3IALA 4YROA 2Q7EA 1Z7NA 5K1XA 3HXZA 1SRYA 3DSQA 3MF2A 4YRTA 1B8AA 1EIYB 1BIBA 4WJ4A 4XEMA 4P75A 1ATIA 1HC7A 3VQWA 4OLFA 1ADJA 3PCOA 3V7SA 3IKLA 3A7AA 2ALYA 4HWSA 4LNSA 2QHTA 4RDXA 1ADYA 3I7FA 4UP8A 2IY5A 4HVCA 2ODRD 4HWOA 1ASYA 3RKXA 4K88A 2Q5IA 4XTZA 1LYLA 2ZINA 4RMFA 1KMMA 3A5ZA 2ZT5A 4P74A 3W3SA 4P71A 3L2ZA 4XTVA 4XEOA 2E65A 1EFWA 3KFUA 4J15A 3EFRA 3E9HA 1JJCA 1X2HA 4WF2A 2DZCA 2EJGA 2DTHA 4HA8A 2EWNA 3REUA 2E41A 4HWPA 3VBBA 2ARTA 5C51B 2AKWA 1B70B 1E22A 2DU7A 2ZZGA 4H2VA 4YRLA 4XU3A 1HXDA 2CIMA 2ARSA 2C7IA 3ICAA 3P8VA 2DXTA 1BIAA 3QO7A 1E24A 3FJPA 4YRKA 4CH4A 3HFZA 1YFRA 3HXUA 3HY0A 2ZIMA 4TVAB 3E9IA 3OD1A 1HTTA 2CGHA 2DDZA 1E1OA 1SETA 1NYRA 4UP7A 4YCVA 3RIRA 4YRSA 2DQ0A 5C53B 1EIYA 2RHQB 4BWAA 2J3LA 2ZT6A 3PZCA 1G5HA 2DKGA 5HGQA 1USYA 1E1TA 1NJ6A 3VQVA 4TWAA 2AMCB 2EJFA 1QE0A 1H4SA 1X54A 2CJAA 2XGTA 3RKYA 4K87A 4P73A 3V8JA 3MF1A 4YRNA 2HNIA 4H2WA 2EAYA 2DQ3A 1RIQA 1YFTA 4KR2A 2I4MA 4X5OA 4WJ3M 3ERRA 3MEYA 1EVLA 3QO8A 4CS3A 2DVEA 3LC0A 4CS4A 1WU7A 3QNEA 3V8LA 4YRPA 1X01A 2DZ9A 3A5YA 3M4QA 1B76A 1BBWA 4UPAA 4CH3A 4PG3A 1B7YA 3A74A 4G84A 1X55A 3TEHB 3UH0A 4XU0A 3TUPA 4HWTA 3LSSA 2ZZEA 1B70A 3V7CA 3HFVA 4YPFA 1EVKA 2ZNJA 1QF6A 2FYKA 2QHVA 4UP9A 4YREA 2I4OA 3A7UA 3NENA 3UGQA 2RHSB 3WQZA 3HXYA 3L1AA 1WYDA 1C0AA 3RKWA 2CJBA 2ZNIA 3HY1A 2I4NA 5C52B 3L4GB 4TVAA 4KQEA 2J3MA 4CH6A 4P74C 4G85A 4P71C 4DQ2A 2CJ9A 2ZIOA 4Q15A 4YRCA 4ZTUB 2DEQA 1IL2A 4H2TA 3RGLA 1G5IA 2ALYB 1NJ2A 2DJZA 2RHQA 4H02A 1WQ7A 5ELOA 2Q7GA 2G4CA 4YYEA 2Q5HA 4P72C 2ARUA 2DTOA 4TVWA 5KNNA 1KMNA 3BFMA 3QTCA 4XTXA 4H2UA 1SESA 3RACA 1H4VB 2QHSA 4RQFA 4AH6A 4H2YA 1PYSB 3VQYA 1YGBA 3NELA 1EOVA 4O2DA 1JJCB 1NJ1A 2ZGWA 4Q6GA 3M4PA 3P8YA 2PMFA 4L87A 1G51A 4BW9A 4P3NA
chains in the Genus database with same CATH superfamily
3A9YA 1WPYA 2FFHA 4YRGA 2LTSA 1QU6A 4Z58A 4TUIA 1TF3A 1DWKA 2IVQA 2EPMX 3EPHA 5A6KA 3R1FA 4KZSA 1H4QA 1BDIA 4P73C 5A6AA 1YB3A 2L33A 2ICTA 3L1PA 4WI1A 2EWLA 4JI7E 4OB4A 4R2EA 2RTXA 3FYAA 5CFFE 3QFIA 2AUWA 3LMLA 5AE1A 3SR4A 3DF6A 1XWRA 1WLEA 2YTDA 1NNHA 2UXBE 4WPYA 4XU1A 1QNTA 3NETA 2CSFA 3C4BA 2V85A 2EL4A 1YPNA 2PXBA 2LYQA 4WYQB 1SFEA 2DB2A 2LRSA 2L6MA 1PYSA 2DTIA 2F8BA 2M7QA 3NEMA 3IVPA 3FMYA 4ER0A 1B7YB 2JR1A 2KONA 3LSQA 2DLKA 2PXPA 4NZVA 4YCWA 2YU8A 4CH5A 2ZR3A 2GRMA 1WETA 4YRIA 4O43A 4X4IA 1L1MA 3RUXA 1Z1BA 2EL5A 4ZTZB 3M99B 1B0NA 1CJGA 4WVLA 2PE5A 3VK6A 2PMEA 4B3TE 4LF8E 4YG7B 4RH8A 1A1HA 4PU8A 4XTUA 2EMAA 4YRJA 4IWRA 2ZR2A 1IMUA 2LYSA 1X6FA 2ZTGA 2JY9A 4DV6E 3VK0A 3OQMA 2H36X 1NERA 3HRKA 3HFZB 1EQRA 3UFGA 1WHQA 5IV8B 2EMCA 4R2PA 3SX0A 2LYLA 4YROA 3TELA 2EMWA 4Q2JA 4ZYEA 2YTNA 1Z7NA 2KEJA 3HXZA 1FJGE 1SRYA 3DSQA 3MF2A 2FJRA 5KL4A 2H8RA 2L3JA 2YZTA 2JVAA 1HNXE 3V7SA 3IKLA 2ENCA 2AWIA 4I6RA 1A1JA 4HWSA 4LNSA 2EZ6A 1WXRA 2B9DA 5GAGi 3RKXA 2HCSA 4J1WA 4XTZA 1LYLA 2DMYA 4JCXA 2EM0A 1PJQA 4NHRA 2ZT5A 1MFQC 3W3SA 4P71A 4XEOA 4M0VA 5AE3A 5AC4A 4BC9A 3E9HA 4YBAA 2PUFA 2L3CA 2DZCA 2EWNA 4F6NA 2K4VA 2AKWA 1LMB3 3DNVB 1ZU1A 2DU7A 2EN3A 4JYAE 3KZ3A 2CIMA 2ARSA 2EOQA 2DXTA 2M1SA 4KWYA 1P47A 1PRUA 2D5VA 3ZOQB 3FJPA 4CH4A 1KJKA 2EPKX 2HJJA 3U3WA 2ZIMA 4TVAB 3KWRA 2CROA 2N3HA 2LBSB 3QF3A 4YRSA 2RHQB 3A9ZA 1N34E 2EOEA 2UXDE 2MXDA 4MCTA 1ZS4A 1YUIA 1MEYC 3F6GA 2DKGA 1USYA 1E1TA 1X47A 1A1FA 1DULA 3RKYA 1WHNA 4K87A 3BS3A 2V8QB 2L2KB 4OOGC 2HNIA 3EPJA 1EKZA 1RIQA 1X6EA 4L5NC 2EM9A 3OMTA 4EZIA 2I4MA 3IWDA 2E72A 2GPIA 4EKGA 3ADIA 5LL6R 2EP3A 3V8LA 1ZZ8A 1YYWA 3LISA 1ZVVA 2L49A 1XNRE 2LUQA 3VHTB 4XU0A 3TUPA 4HWTA 1RZRD 2JCGA 4WX9A 5IT9C 4DV5E 4LFCE 2XXPA 2EPUA 3AUZA 3GZDA 2FYKA 3L00A 2JWOA 1YUJA 4HTGA 1PRVA 1ZAAC 3L1AA 3WQZA 3SCGA 1N33E 4AQYE 2CJBA 3HY1A 1G2DC 2YRHA 1NEQA 3L4GB 1CQTA 4KQEA 2HCNA 4JI3E 4G85A 2EMGA 4DR1E 2ZIOA 4ZTUB 2XIUA 1AH5A 4H2TA 3RGLA 2ALYB 1UILA 2EMKA 4TUGA 1WH6A 2ADRA 1WQ7A 5ELOA 3QG5C 2UUBE 5IXMB 1ZR9A 2BNOA 2Q5HA 4JI1E 4P72C 2ARUA 3J80C 4F9CB 5KNNA 2YTPA 3T1HE 2XSDC 1WRJA 3BFMA 4DKKA 2PXLA 4H2UA 4JI8E 4AH6A 1JK1A 4H2YA 3O9XA 3VQYA 1S7EA 1I94E 2HINA 3HQ1A 2ZGWA 4Q6GA 5KL7A 4GKJE 2LCVA 1ZPQA 3HPSA 2KZ8A 1RQ0A 2EM4A 3OWQA 2V88A 4BHBA 1WQWA 3BJUA 3CMQA 4HWRA 2KEKA 1T4NA 3G1ZA 3TEHA 2MC6A 1Y7YA 2DGCA 3IKMB 2ICPA 2B7TA 4DV2E 1GZ6A 5A2QC 2ZT8A 4LVJA 3KZZA 4BCAA 1FYFA 2GZUA 4P75C 2PXVA 1X2GA 3EQ1A 1HNZE 4WXCA 2I4LA 3VQXA 2DXUA 2PXEA 4NCXA 4P7DA 5KL3A 4IVZA 2E1HA 1GGMA 3HRIA 3HZIB 2DU5A 2CSHA 1N9WA 1IBKE 2DMIA 3NROA 4KR3A 1SERA 3V7RA 4CS2A 3PCOB 5KL5A 2RSMA 1VQZA 2EN7A 1UHZA 4LFAE 5FLXC 3CLCA 3V8KA 4FN3A 2GHFA 3HXVA 1R63A 2AMCA 2EBYA 2YPNA 4YRQA 4XTYA 1KOGA 4O24A 11ASA 2VQFE 1T39A 2BNNA 3B7HA 3VYYA 2LUPB 3HTZA 2EJ9A 4YG4A 4YRMA 2ZM6E 2J7WA 2EPAA 4YP0A 4P3OA 3C4TA 1X2LA 3HPZA 4R2RA 1KYQA 2C8MA 1H4TA 3ZKCA 5DTQA 3G7DA 1EFAA 4JI4E 1DI2A 1X56A 4TTVA 4HRAA 2FGGA 3TEGA 2XTIA 4YRRA 3GUUA 4I6UA 2NUEA 2VEOA 2PUGA 2R1FA 2NABA 2R63A 5LMUE 4FK5C 1DQ3A 4YRTA 3AV0A 2DLQA 1B8AA 5AC5A 4OLFA 2IV1A 2EQ3A 1YYOA 1XMOE 4RDXA 3BGHA 2V87A 1ZZ9A 3OTOE 1ASYA 2ODRD 1DW9A 4K88A 4F54A 1RMDA 2Q5IA 4RMFA 2JPAA 3A5ZA 1O4XA 4P74A 3RMPA 2EOYA 3MSWA 1ZUGA 2E65A 1EFWA 2LTRA 3DM5A 1IC8A 1JK2A 2YWQA 4WF2A 2EJGA 2LT7A 4HWPA 2AXUA 2EPPA 3VBBA 2ARTA 4F8DA 1E22A 4DUYE 1PDAA 4NXNE 1YSEA 2XXQA 4LVKA 4Z5HA 1T38A 2C7IA 3ICAA 3P8VA 3QO7A 2EJ4A 2WBUA 3HFZA 1X49A 3DJWA 2EPRA 4X65E 5A69A 1YFRA 3HY0A 4WSPA 1SETA 3M9LA 3TEPA 2EQ0A 1X3CA 2YU5A 5AE2A 1ZZCA 4GZNC 2EORA 1LLIA 3RIRA 2IVBA 2HC5A 4X4CA 2YTQA 3NXHA 2IHR1 3PZCA 5HGQA 2F4VE 5A6BD 4X62E 2AW6A 2RS6A 4R2DA 2NS6A 4X4BA 1QPZA 2CJAA 2XGTA 3CROL 4HEIA 1A1LA 2R76A 3V8JA 4B3RE 1QZXA 4IJDA 4H2WA 2EAYA 4Z5DA 3FYMA 1FKAE 4F6MA 4Q28A 2IUOA 2EPCA 2L8TA 1EVLA 4CS3A 2CT1A 4ER5A 2ELYA 1WU7A 4O4KA 2ENHA 1UN6B 2WIUB 2UXCE 4UPAA 4PG3A 4N4RB 2BNMA 3UH0A 2ZZEA 1HF0A 3BDNA 1A1IA 4YPFA 3ZPXA 1EVKA 3NDBB 1PNRA 2WBTA 2LVHA 1JFSA 2QHVA 3JU0A 5A6JA 3MQZA 2I4OA 3UGQA 2RHSB 3HXYA 1WYDA 4BHCA 2ZNIA 1B69A 4LF6E 2IVGA 5C52B 4TVAA 4DR2E 4CH6A 4P71C 4DQ2A 1A1KA 2DRPA 2CJ9A 3VYXA 4YRCA 3FIGA 3F6WA 2DEQA 4M30A 3OQOA 1NJ2A 3J7AG 2DJZA 2RHQA 1QB2A 2Q8UA 2YRKA 3EPLA 3JXBC 4JQDA 2RPCA 4LF4E 1STUA 2A8EA 1YYKA 2EOSA 1KMNA 2LNMA 3QTCA 2MDGA 4DR4E 1SESA 3RACA 4RQFA 4BMJA 1EOVA 4O2DA 2PXTA 2LO3A 3M4PA 5GAHi 3P8YA 2PMFA 3UWPA 4LF7E 2M4IA 4Z59A 4BW9A 1J5WA 3JXCL 4H2XB 5A7LA 5DSXA 3KL4A 4JCYA 2I13A 4EK9A 4TQDA 3P1XA 3LQXA 3HXXA 1USYC 3IG2A 1NW3A 4OP0A 2LYRA 4DE8A 2QHUA 2L1PA 3P8TA 3TRBA 2KEIA 3BD1A 2G7HA 3PXPA 3TQMA 2JOBA 1YFHA 3GZCA 1YFSA 2WZOA 1ZZBA 1SR9A 1ZBQA 3L4GA 4PHCA 4NXME 1NYQA 2EN1A 5ELNA 4X64E 1Y9QA 4X4GA 4LFBE 1N36E 1TN9A 1ASZA 3A32A 3HXWA 3UGTA 4JI5E 4GKKE 1GTKA 2P5IA 2A25A 1SQ8A 3H5TA 2RS7A 4BBYA 4I6TA 2MDRA 3LFPA 4DPGA 1RZSA 1UBDC 4XU2A 3QO5A 1BBOA 1QQBA 1IQOA 2IY5B 5E3IA 4EX5A 2D9HA 2E10A 4ZYGA 2XCJA 2EPXA 2BJCA 1BBGA 4P72A 1T4LB 2EOMA 3MHHC 2O4AA 5TSEA 1E3OC 2M9AA 2EMBA 4I8OA 2ODRC 2EL9A 1WH8A 4JI0E 4I8TA 5AASA 4B3ME 4H2SA 2VQEE 3A31A 4TQFA 3RF1A 2E5AA 4EKIA 1BBUA 4GEQB 2Q7HA 3EFSA 4YDQA 2E3CA 2PUBA 1AAYA 4TVYA 3G5GA 3IALA 3F52A 2PXKA 2YTIA 2Q7EA 1T4OA 2DIXA 4LU9A 2E1MA 1YSAC 4X9JA 2NUGA 4DV0E 1EIYB 2EE8A 4XEMA 4P75A 2EMYA 1HC7A 1AU7A 3GN5B 3PCOA 3A7AA 1ZAYA 1J5EE 2ELZA 2HHHE 3QQ6A 1A1GA 4HVCA 4LF9E 1BDHA 2L2NA 4JV5E 2KPJA 2J7UA 3L2ZA 4DV3E 4XTVA 4MCXA 1QQAA 4J15A 2EM3A 4Q35B 2UU9E 1LCCA 4DE9A 2EMIA 1JJCA 5K98B 2JP9A 2PUEA 2LV2A 1ADRA 4HA8A 1IQSA 1B70B 2ZZGA 2GRLA 2EMFA 1HXDA 3K6QA 2CPNA 1BIAA 4X4DA 4YRKA 4PU3C 3OP9A 2EN8A 3BF2A 3OD1A 1HTTA 2EQ1A 2DDZA 1E1OA 5DRTA 3TFLA 1X48A 2KOUA 4JI2E 3EUSA 4YCVA 4LF5E 3KJXA 2WCC3 1L4SA 2MEZA 3IWCA 2DQ0A 5C53B 2EM6A 4R03A 2YTGA 2J3LA 4ER7A 4R2AA 1F2IG 3SCHA 4DUZE 2AMCB 2EJFA 4J1XA 1H4SA 2MKDA 2BB8A 1N32E 4P73A 3MF1A 4YRNA 2DQ3A 2YTOA 2EN6A 4F9BB 4X5OA 3JXDL 2YRMA 3T1YE 1PERL 3QO8A 4GQMA 2YT4A 5BR8E 2DVEA 3LC0A 4CS4A 4Y42A 1UXCA 3QNEA 4YARA 5F3WA 4YRPA 2DZ9A 3M4QA 1TF6A 1UTXA 4CH3A 2HGHA 1QP0A 4YHHE 1B7YA 4G84A 2KHXA 2LLVA 3OKZA 3LSSA 3IWBA 2B5AA 3MEJA 1PKPA 3V7CA 2EM7A 1VPWA 1NCSA 3HFVA 1EH8A 2ZNJA 1JFTA 2EMZA 3QOXA 2YTFA 3F6HA 4UP9A 1QP4A 4YREA 2NUFA 5KL6A 3J81C 3RKWA 2I4NA 2WUSR 4FBIA 2J3MA 4F2JC 4P74C 1G5IA 2ENAA 3HTXA 2Q7GA 2EWTA 2EOIA 3EPKA 2YTEA 2VF1A 3BBGA 4ZYDA 1LQCA 4EQZA 4TVWA 2PUAA 1PJSA 1GT0C 1RZRA 4BS9A 2HFZA 2LE2A 5DNYA 2QHSA 1LLMC 1PYSB 2EOHA 3NELA 2EPZA 2EN2A 4LVIA 4L87A 3S8QA 1NEIA 1G51A 2NA2A 1UXDA 4OBMA 4GHJA 3GBFA 4YY3E 4LVLA 2FV4B 1IBLE 4X8WA 1G2FC 2RQLA 2J7JA 1HR0E 3A9XA 2EOOA 3BIDA 1Z7MA 2B7VA 4YRFA 2LYJA 1RC7A 2O38A 2RHSA 2ZZFA 2LLWA 2EPNA 2AXZA 3D1NI 4WSGA 5F5WA 5KL2A 1N3GA 3JAMC 2OR1L 2A6CA 1X6HA 4E51A 2V83A 2N3GA 3R07A 2EOZA 12ASA 5T6JA 3CECA 5DTMA 3REXA 1W66A 4OX9E 3A7RA 2P0LA 2ZT7A 3UK3C 2EOFA 2EOJA 1ZZ7A 4PU7A 4DV4E 4M9VC 4DV7E 4WXDA 4IA8A 5DT2A 2EM8A 4M2ZA 2AXVA 2XXAA 1XMQE 4EO4A 3F51A 2E64A 2JOXA 1OSLA 2O49A 2IU7A 4ZIBA 4P3PA 1HNWE 2JXPA 4H2XA 4DR5E 1WJPA 1RIOA 2PIJA 3SCFA 1DGCA 2UUCE 2ZCEA 1WNLA 3RL6A 4R2SA 5K1PA 3H09A 4K86A 2PUDA 1NJ5A 2RSIA 1NJ8A 1PRAA 4XTWA 4X4HA 4YCUA 2OFYA 1QP7A 2R1JL 3C6MA 2LJUA 2JYAA 2AKWB 4RQEA 1O0WA 4ER3A 5DTRA 2PXUA 2M4HA 1L0WA 2XJ3A 2N8XA 2ZXFA 4J8ZA 2YSPA 4HT4A 1ZBTA 2V89A 3ADLA 2EMLA 1J26A 5K1XA 3MLFA 2GLIA 1BIBA 1JH9A 4WJ4A 1GQEA 1ATIA 2MKNA 4R2CA 2PXDA 3VQWA 1ADJA 1JWLA 2ALYA 4KHPE 3MHSC 2QHTA 4LTYA 1ADYA 3I7FA 2L92A 4UP8A 2IY5A 2EOXA 4HWOA 5LLQA 3VWSA 2YBDA 1BB8A 2YTJA 2ZINA 1KMMA 3GZDC 2HSGA 4Z5CA 2E5LE 4O8BA 3KFUA 4O5GA 5IWAE 3EFRA 5JUWA 2MQKA 5ADZA 4DR3E 1X2HA 5DRYA 2DTHA 3REUA 2E41A 5C51B 1X5WA 4H2VA 4YRLA 1HQ1A 2EMXA 4XU3A 3J7Yp 1YZ9A 3KZYA 1E24A 1ZZ6A 3ADJA 1LCDA 3THOB 3G0TA 4MLQA 4L8NA 3HXUA 3E9IA 2EL6A 2CGHA 2LYKA 1RPEL 1NYRA 3KXAA 2PPXA 4UP7A 1EIYA 2EM5A 3HXLA 3LLHA 3ECRA 4BWAA 4K0KE 2ZT6A 3GN5A 2K7IA 2EM2A 1G5HA 2LJHA 1NJ6A 3VQVA 4TWAA 3ZHMA 3ZHIA 1QE0A 1X57A 1X54A 1XNQE 1WIZA 2I9IA 1IBME 2XI8A 2L8NA 3ME5A 1EH6A 2EF8A 4X4EA 2BBGA 1YFTA 4KR2A 4WJ3M 3ERRA 4LVMA 3MEYA 2LCEA 2FTXB 1X01A 4PU4C 3A5YA 2VE7C 1B76A 3JTZA 1BBWA 4JI6E 2EMHA 3A74A 2UUAE 1X55A 2DSYA 3TEHB 1EH7A 3QOWA 3NZLA 1B70A 4DR6E 4BC7A 2JQEA 3OMLA 4P78A 4DR7E 1MGTA 4WFTA 1QF6A 2EPLX 5A6BA 2L2MA 3QYXA 3OQNA 2YSOA 4ZYHA 3A7UA 3NENA 1C0AA 1PJTA 2PXFA 4X4FA 4B3SE 4Q15A 2LMZA 4R8OA 5LMNE 1IL2A 2PXQA 2LYPA 2B3TB 4RHBB 3THNA 2MC5A 4DMIA 4R2QA 1U2ZA 4IS1C 4MLVA 4H02A 4YG1A 1R69A 3C6KA 3QWGA 3UFDA 4ER6A 2G4CA 4X66E 4YYEA 1OCTC 1POUA 2DTOA 3R09A 3ADGA 2V86A 4DV1E 2PUCA 3PE5A 4XTXA 2EPOA 3RZZA 4F9AB 1H4VB 2EN4A 1YGBA 2PRTA 1JJCB 2VRDA 1NJ1A 4NDWA 2V3CC 2JVLA 2CTDA 4P3NA 2WBSA
chains in the Genus database with same CATH topology
1J5WA 3A9YA 1RQ0A 4H2XB 1WPYA 3OWQA 2V88A 5DSXA 1WQWA 3BJUA 3CMQA 4YRGA 4YY3E 2LTSA 4LVLA 4EK9A 1QU6A 4HWRA 1T4NA 2FV4B 3G1ZA 1IBLE 4X8WA 4TQDA 4TUIA 3TEHA 2MC6A 3P1XA 3HXXA 1USYC 3IG2A 1NW3A 4OP0A 4DE8A 3IKMB 2B7TA 4DV2E 1GZ6A 1HR0E 3A9XA 2QHUA 4KZSA 5A2QC 2L1PA 1Z7MA 3P8TA 1H4QA 2ZT8A 4LVJA 2B7VA 4P73C 2G7HA 1YB3A 4YRFA 4BCAA 2L33A 1RC7A 2JOBA 1FYFA 1YFSA 3GZCA 2RHSA 2LLWA 2ZZFA 4WI1A 2WZOA 1SR9A 2EWLA 4P75C 1ZBQA 3L4GA 4JI7E 1X2GA 4PHCA 1HNZE 5F5WA 4NXME 3JAMC 2I4LA 2RTXA 1NYQA 3VQXA 2DXUA 4E51A 2V83A 3QFIA 5CFFE 5ELNA 2N3GA 4X64E 3R07A 4LFBE 1N36E 3LMLA 12ASA 5T6JA 5AE1A 1ASZA 5DTMA 3REXA 1W66A 4OX9E 3SR4A 4NCXA 3A7RA 3A32A 3DF6A 4P7DA 2P0LA 2ZT7A 3HXWA 3UGTA 4JI5E 2E1HA 1WLEA 4DV4E 4GKKE 1NNHA 2UXBE 1GGMA 3HRIA 4WPYA 2P5IA 4XU1A 2DU5A 2RS7A 1N9WA 1IBKE 4BBYA 4DV7E 3NETA 3NROA 4KR3A 1SERA 3V7RA 4CS2A 2MDRA 3C4BA 3PCOB 2V85A 2RSMA 1VQZA 5DT2A 4M2ZA 4WYQB 4DPGA 2DB2A 2LRSA 2L6MA 4XU2A 1PYSA 2DTIA 2F8BA 2M7QA 1XMQE 3NEMA 3QO5A 1UHZA 4EO4A 4LFAE 4ER0A 2E64A 1B7YB 2JOXA 2JR1A 2IY5B 2KONA 3LSQA 5FLXC 5E3IA 4YCWA 4EX5A 4ZIBA 4CH5A 3V8KA 2E10A 2ZR3A 4P3PA 3HXVA 4YRIA 2AMCA 1HNWE 4H2XA 4DR5E 4P72A 4YRQA 3RUXA 1T4LB 2UUCE 4XTYA 1KOGA 11ASA 2ZCEA 4ZTZB 2VQFE 1WNLA 3RL6A 5K1PA 4WVLA 3H09A 3VK6A 2PMEA 3VYYA 4B3TE 4LF8E 4K86A 1NJ5A 1NJ8A 4XTWA 4YCUA 4I8OA 2ODRC 2LUPB 3HTZA 2EL9A 4XTUA 4YRJA 4JI0E 2EJ9A 4YRMA 2ZM6E 2ZR2A 5AASA 2J7WA 4B3ME 2AKWB 4H2SA 2VQEE 3A31A 4TQFA 1O0WA 3RF1A 4RQEA 4ER3A 2E5AA 5DTRA 4EKIA 4YP0A 4P3OA 3C4TA 1BBUA 3HPZA 2ZTGA 4GEQB 2M4HA 2Q7HA 3EFSA 2C8MA 2JY9A 4DV6E 4YDQA 1H4TA 2E3CA 1L0WA 5DTQA 2H36X 3HRKA 2ZXFA 4JI4E 1DI2A 1X56A 4TVYA 4J8ZA 4TTVA 4HRAA 3HFZB 4HT4A 2FGGA 1ZBTA 3TEGA 2XTIA 4YRRA 1EQRA 2V89A 3GUUA 2NUEA 3UFGA 3IALA 2VEOA 1WHQA 3SX0A 4YROA 3ADLA 2Q7EA 3TELA 4Q2JA 1T4OA 1J26A 1Z7NA 5K1XA 2DIXA 4LU9A 5LMUE 3HXZA 2E1MA 1FJGE 2NUGA 1DQ3A 1SRYA 3DSQA 3MF2A 3AV0A 4YRTA 4DV0E 1B8AA 1EIYB 1BIBA 2L3JA 4WJ4A 4XEMA 4P75A 1GQEA 2YZTA 1ATIA 2JVAA 1HC7A 1HNXE 3VQWA 4OLFA 1ADJA 3PCOA 3V7SA 3IKLA 3A7AA 2ALYA 1YYOA 4KHPE 1XMOE 1J5EE 4HWSA 4LNSA 2QHTA 4RDXA 4LTYA 2EZ6A 1ADYA 1WXRA 2HHHE 2V87A 3I7FA 2B9DA 2L92A 4UP8A 2IY5A 3OTOE 4HVCA 2ODRD 4HWOA 1ASYA 3RKXA 2HCSA 4K88A 4F54A 3VWSA 2Q5IA 4LF9E 2YBDA 4XTZA 1LYLA 2L2NA 2DMYA 4JV5E 2ZINA 4RMFA 1KMMA 3A5ZA 3GZDC 2ZT5A 4P74A 3W3SA 2J7UA 3L2ZA 4P71A 4DV3E 4XTVA 4XEOA 3RMPA 2E5LE 4M0VA 3MSWA 5AE3A 2E65A 1EFWA 5IWAE 3KFUA 2LTRA 4J15A 3EFRA 5JUWA 5ADZA 4DR3E 4BC9A 3E9HA 2UU9E 1JJCA 4DE9A 1X2HA 4WF2A 5DRYA 2L3CA 2DZCA 2EJGA 2DTHA 4HA8A 2EWNA 3REUA 2E41A 4HWPA 3VBBA 2ARTA 5C51B 2AKWA 2K4VA 1B70B 1E22A 2DU7A 2ZZGA 4DUYE 4NXNE 4JYAE 4H2VA 4YRLA 2XXQA 4LVKA 4XU3A 1HXDA 2CIMA 3K6QA 3J7Yp 2ARSA 2C7IA 1YZ9A 3ICAA 2CPNA 3P8VA 2DXTA 1BIAA 2M1SA 3QO7A 1E24A 3ZOQB 3FJPA 3ADJA 4YRKA 3G0TA 4CH4A 3HFZA 1X49A 3DJWA 4L8NA 4X65E 1YFRA 3HXUA 3HY0A 2ZIMA 4TVAB 3E9IA 3OD1A 3KWRA 1HTTA 2CGHA 2DDZA 4WSPA 1E1OA 5DRTA 2N3HA 2LBSB 1SETA 3M9LA 3TFLA 3TEPA 1X48A 1NYRA 2KOUA 5AE2A 4UP7A 4JI2E 4YCVA 4LF5E 3RIRA 3IWCA 4YRSA 2DQ0A 5C53B 1EIYA 2RHQB 3HXLA 3LLHA 3A9ZA 4R03A 4BWAA 1N34E 2J3LA 4K0KE 2UXDE 2MXDA 2ZT6A 4ER7A 3NXHA 2IHR1 3PZCA 3F6GA 1G5HA 2DKGA 5HGQA 1USYA 2LJHA 1E1TA 4DUZE 1NJ6A 2F4VE 3VQVA 4X62E 4TWAA 1X47A 2RS6A 2AMCB 2EJFA 2NS6A 1QE0A 1H4SA 1X54A 2CJAA 2XGTA 3RKYA 1WHNA 1N32E 4K87A 4P73A 1XNQE 3V8JA 3MF1A 4YRNA 2V8QB 2L2KB 4OOGC 1IBME 4B3RE 2HNIA 4H2WA 3ME5A 2EAYA 2DQ3A 1EKZA 1RIQA 1YFTA 4L5NC 4KR2A 4F9BB 4EZIA 1FKAE 2I4MA 4X5OA 4WJ3M 4Q28A 3ERRA 3T1YE 4LVMA 2L8TA 3MEYA 3IWDA 1EVLA 3QO8A 2YT4A 4CS3A 5BR8E 4EKGA 3ADIA 2DVEA 4ER5A 2FTXB 5LL6R 3LC0A 4CS4A 1WU7A 3QNEA 3V8LA 1YYWA 5F3WA 4YRPA 1X01A 2DZ9A 3A5YA 2VE7C 3M4QA 2UXCE 1XNRE 1B76A 3JTZA 2LUQA 1BBWA 4PG3A 4UPAA 4CH3A 4JI6E 4YHHE 1B7YA 3A74A 2KHXA 2UUAE 1X55A 4G84A 2LLVA 2DSYA 3TEHB 3UH0A 4XU0A 3OKZA 3TUPA 4HWTA 3LSSA 2ZZEA 3QOWA 3IWBA 3NZLA 3MEJA 1B70A 1PKPA 4DR6E 4BC7A 3V7CA 3HFVA 4YPFA 3OMLA 3ZPXA 4P78A 1EVKA 5IT9C 2ZNJA 4DR7E 4DV5E 4LFCE 4WFTA 2XXPA 3AUZA 3GZDA 1QF6A 3QOXA 2FYKA 2JWOA 2QHVA 3JU0A 3F6HA 3MQZA 4UP9A 4YREA 2I4OA 2L2MA 2NUFA 3A7UA 3NENA 2RHSB 3UGQA 3WQZA 3HXYA 3L1AA 3J81C 1WYDA 1N33E 1C0AA 3RKWA 4AQYE 2CJBA 2ZNIA 3HY1A 4LF6E 2I4NA 5C52B 3L4GB 4TVAA 4KQEA 2J3MA 4DR2E 4CH6A 4P74C 2HCNA 4JI3E 4G85A 4P71C 4B3SE 4DR1E 4DQ2A 2CJ9A 2ZIOA 4Q15A 2LMZA 3VYXA 4R8OA 3FIGA 5LMNE 4YRCA 4ZTUB 2DEQA 1IL2A 4H2TA 4M30A 3RGLA 1G5IA 2ALYB 1NJ2A 3J7AG 2B3TB 4DMIA 1UILA 2MC5A 2DJZA 1U2ZA 3HTXA 4TUGA 2RHQA 4H02A 1WQ7A 5ELOA 2Q7GA 4ER6A 2G4CA 4X66E 2UUBE 2VF1A 4YYEA 4LF4E 1STUA 2Q5HA 4JI1E 2A8EA 1YYKA 4P72C 2ARUA 2DTOA 4EQZA 4TVWA 3J80C 3R09A 3ADGA 4F9CB 5KNNA 3T1HE 1KMNA 2LNMA 2V86A 4DV1E 3BFMA 3PE5A 3QTCA 4BS9A 4DKKA 2HFZA 4XTXA 2LE2A 5DNYA 4DR4E 1SESA 4H2UA 4JI8E 4F9AB 3RACA 1H4VB 2QHSA 4RQFA 4AH6A 4H2YA 1PYSB 3VQYA 1YGBA 3NELA 4BMJA 1EOVA 1I94E 1JJCB 4O2DA 1NJ1A 3HQ1A 2ZGWA 4Q6GA 3M4PA 3P8YA 4LVIA 2PMFA 4GKJE 3UWPA 4L87A 4LF7E 1G51A 2NA2A 2M4IA 4BW9A 3HPSA 4P3NA 4OBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5W A;  4H2X B;  1WPY A;  1WQW A;  3BJU A;  3CMQ A;  4YRG A;  4HWR A;  4TQD A;  3G1Z A;  3TEH A;  3HXX A;  1USY C;  3IG2 A;  4OP0 A;  3IKM B;  2QHU A;  1Z7M A;  3P8T A;  1H4Q A;  2ZT8 A;  4P73 C;  1YB3 A;  4YRF A;  1FYF A;  1YFS A;  2RHS A;  2ZZF A;  4WI1 A;  4P75 C;  3L4G A;  1X2G A;  4PHC A;  5F5W A;  2I4L A;  1NYQ A;  3VQX A;  2DXU A;  4E51 A;  5ELN A;  3R07 A;  12AS A;  1ASZ A;  3REX A;  1W66 A;  4NCX A;  3A7R A;  3A32 A;  2P0L A;  2ZT7 A;  3HXW A;  3UGT A;  2E1H A;  1WLE A;  1NNH A;  1GGM A;  3HRI A;  2P5I A;  4XU1 A;  2DU5 A;  1N9W A;  3NET A;  4KR3 A;  1SER A;  3V7R A;  4CS2 A;  3PCO B;  1VQZ A;  4DPG A;  4XU2 A;  1PYS A;  2DTI A;  3NEM A;  3QO5 A;  4EO4 A;  2E64 A;  1B7Y B;  2IY5 B;  3LSQ A;  5E3I A;  4YCW A;  4EX5 A;  4ZIB A;  4CH5 A;  3V8K A;  2E10 A;  2ZR3 A;  4P3P A;  3HXV A;  4YRI A;  2AMC A;  4H2X A;  4P72 A;  4YRQ A;  3RUX A;  4XTY A;  1KOG A;  11AS A;  2ZCE A;  4ZTZ B;  1WNL A;  3RL6 A;  5K1P A;  2PME A;  4K86 A;  1NJ5 A;  1NJ8 A;  4XTW A;  4YCU A;  2ODR C;  3HTZ A;  2EL9 A;  4XTU A;  4YRJ A;  2EJ9 A;  4YRM A;  2ZR2 A;  2AKW B;  4H2S A;  4RQE A;  3A31 A;  4TQF A;  3RF1 A;  2E5A A;  4YP0 A;  4P3O A;  1BBU A;  2ZTG A;  2Q7H A;  3EFS A;  2C8M A;  4YDQ A;  1H4T A;  2E3C A;  1L0W A;  3HRK A;  2ZXF A;  1X56 A;  4TVY A;  4TTV A;  3HFZ B;  3TEG A;  2XTI A;  4YRR A;  1EQR A;  3UFG A;  3IAL A;  4YRO A;  2Q7E A;  1Z7N A;  5K1X A;  3HXZ A;  1SRY A;  3DSQ A;  3MF2 A;  4YRT A;  1B8A A;  1EIY B;  1BIB A;  4WJ4 A;  4XEM A;  4P75 A;  1ATI A;  1HC7 A;  3VQW A;  4OLF A;  1ADJ A;  3PCO A;  3V7S A;  3IKL A;  3A7A A;  2ALY A;  4HWS A;  4LNS A;  2QHT A;  4RDX A;  1ADY A;  3I7F A;  4UP8 A;  2IY5 A;  4HVC A;  2ODR D;  4HWO A;  1ASY A;  3RKX A;  4K88 A;  2Q5I A;  4XTZ A;  1LYL A;  2ZIN A;  4RMF A;  1KMM A;  3A5Z A;  2ZT5 A;  4P74 A;  3W3S A;  4P71 A;  3L2Z A;  4XTV A;  4XEO A;  2E65 A;  1EFW A;  3KFU A;  4J15 A;  3EFR A;  3E9H A;  1JJC A;  1X2H A;  4WF2 A;  2DZC A;  2EJG A;  2DTH A;  4HA8 A;  2EWN A;  3REU A;  2E41 A;  4HWP A;  3VBB A;  2ART A;  5C51 B;  2AKW A;  1B70 B;  1E22 A;  2DU7 A;  2ZZG A;  4H2V A;  4YRL A;  4XU3 A;  1HXD A;  2CIM A;  2ARS A;  2C7I A;  3ICA A;  3P8V A;  2DXT A;  1BIA A;  3QO7 A;  1E24 A;  3FJP A;  4YRK A;  4CH4 A;  3HFZ A;  1YFR A;  3HXU A;  3HY0 A;  2ZIM A;  4TVA B;  3E9I A;  3OD1 A;  1HTT A;  2CGH A;  2DDZ A;  1E1O A;  1SET A;  1NYR A;  4UP7 A;  4YCV A;  3RIR A;  4YRS A;  2DQ0 A;  5C53 B;  1EIY A;  2RHQ B;  4BWA A;  2J3L A;  2ZT6 A;  3PZC A;  1G5H A;  2DKG A;  5HGQ A;  1USY A;  1E1T A;  1NJ6 A;  3VQV A;  4TWA A;  2AMC B;  2EJF A;  1QE0 A;  1H4S A;  1X54 A;  2CJA A;  2XGT A;  3RKY A;  4K87 A;  4P73 A;  3V8J A;  3MF1 A;  4YRN A;  2HNI A;  4H2W A;  2EAY A;  2DQ3 A;  1RIQ A;  1YFT A;  4KR2 A;  2I4M A;  4X5O A;  4WJ3 M;  3ERR A;  3MEY A;  1EVL A;  3QO8 A;  4CS3 A;  2DVE A;  3LC0 A;  4CS4 A;  1WU7 A;  3QNE A;  3V8L A;  4YRP A;  1X01 A;  2DZ9 A;  3A5Y A;  3M4Q A;  1B76 A;  1BBW A;  4UPA A;  4CH3 A;  4PG3 A;  1B7Y A;  3A74 A;  4G84 A;  1X55 A;  3TEH B;  3UH0 A;  4XU0 A;  3TUP A;  4HWT A;  3LSS A;  2ZZE A;  1B70 A;  3V7C A;  3HFV A;  4YPF A;  1EVK A;  2ZNJ A;  1QF6 A;  2FYK A;  2QHV A;  4UP9 A;  4YRE A;  2I4O A;  3A7U A;  3NEN A;  3UGQ A;  2RHS B;  3WQZ A;  3HXY A;  3L1A A;  1WYD A;  1C0A A;  3RKW A;  2CJB A;  2ZNI A;  3HY1 A;  2I4N A;  5C52 B;  3L4G B;  4TVA A;  4KQE A;  2J3M A;  4CH6 A;  4P74 C;  4G85 A;  4P71 C;  4DQ2 A;  2CJ9 A;  2ZIO A;  4Q15 A;  4YRC A;  4ZTU B;  2DEQ A;  1IL2 A;  4H2T A;  3RGL A;  1G5I A;  2ALY B;  1NJ2 A;  2DJZ A;  2RHQ A;  4H02 A;  1WQ7 A;  5ELO A;  2Q7G A;  2G4C A;  4YYE A;  2Q5H A;  4P72 C;  2ARU A;  2DTO A;  4TVW A;  5KNN A;  1KMN A;  3BFM A;  3QTC A;  4XTX A;  4H2U A;  1SES A;  3RAC A;  1H4V B;  2QHS A;  4RQF A;  4AH6 A;  4H2Y A;  1PYS B;  3VQY A;  1YGB A;  3NEL A;  1EOV A;  4O2D A;  1JJC B;  1NJ1 A;  2ZGW A;  4Q6G A;  3M4P A;  3P8Y A;  2PMF A;  4L87 A;  1G51 A;  4BW9 A;  4P3N A; 
#chains in the Genus database with same CATH topology
 3A9Y A;  1WPY A;  2FFH A;  4YRG A;  2LTS A;  1QU6 A;  4Z58 A;  4TUI A;  1TF3 A;  1DWK A;  2IVQ A;  2EPM X;  3EPH A;  5A6K A;  3R1F A;  4KZS A;  1H4Q A;  1BDI A;  4P73 C;  5A6A A;  1YB3 A;  2L33 A;  2ICT A;  3L1P A;  4WI1 A;  2EWL A;  4JI7 E;  4OB4 A;  4R2E A;  2RTX A;  3FYA A;  5CFF E;  3QFI A;  2AUW A;  3LML A;  5AE1 A;  3SR4 A;  3DF6 A;  1XWR A;  1WLE A;  2YTD A;  1NNH A;  2UXB E;  4WPY A;  4XU1 A;  1QNT A;  3NET A;  2CSF A;  3C4B A;  2V85 A;  2EL4 A;  1YPN A;  2PXB A;  2LYQ A;  4WYQ B;  1SFE A;  2DB2 A;  2LRS A;  2L6M A;  1PYS A;  2DTI A;  2F8B A;  2M7Q A;  3NEM A;  3IVP A;  3FMY A;  4ER0 A;  1B7Y B;  2JR1 A;  2KON A;  3LSQ A;  2DLK A;  2PXP A;  4NZV A;  4YCW A;  2YU8 A;  4CH5 A;  2ZR3 A;  2GRM A;  1WET A;  4YRI A;  4O43 A;  4X4I A;  1L1M A;  3RUX A;  1Z1B A;  2EL5 A;  4ZTZ B;  3M99 B;  1B0N A;  1CJG A;  4WVL A;  2PE5 A;  3VK6 A;  2PME A;  4B3T E;  4LF8 E;  4YG7 B;  4RH8 A;  1A1H A;  4PU8 A;  4XTU A;  2EMA A;  4YRJ A;  4IWR A;  2ZR2 A;  1IMU A;  2LYS A;  1X6F A;  2ZTG A;  2JY9 A;  4DV6 E;  3VK0 A;  3OQM A;  2H36 X;  1NER A;  3HRK A;  3HFZ B;  1EQR A;  3UFG A;  1WHQ A;  5IV8 B;  2EMC A;  4R2P A;  3SX0 A;  2LYL A;  4YRO A;  3TEL A;  2EMW A;  4Q2J A;  4ZYE A;  2YTN A;  1Z7N A;  2KEJ A;  3HXZ A;  1FJG E;  1SRY A;  3DSQ A;  3MF2 A;  2FJR A;  5KL4 A;  2H8R A;  2L3J A;  2YZT A;  2JVA A;  1HNX E;  3V7S A;  3IKL A;  2ENC A;  2AWI A;  4I6R A;  1A1J A;  4HWS A;  4LNS A;  2EZ6 A;  1WXR A;  2B9D A;  5GAG i;  3RKX A;  2HCS A;  4J1W A;  4XTZ A;  1LYL A;  2DMY A;  4JCX A;  2EM0 A;  1PJQ A;  4NHR A;  2ZT5 A;  1MFQ C;  3W3S A;  4P71 A;  4XEO A;  4M0V A;  5AE3 A;  5AC4 A;  4BC9 A;  3E9H A;  4YBA A;  2PUF A;  2L3C A;  2DZC A;  2EWN A;  4F6N A;  2K4V A;  2AKW A;  1LMB 3;  3DNV B;  1ZU1 A;  2DU7 A;  2EN3 A;  4JYA E;  3KZ3 A;  2CIM A;  2ARS A;  2EOQ A;  2DXT A;  2M1S A;  4KWY A;  1P47 A;  1PRU A;  2D5V A;  3ZOQ B;  3FJP A;  4CH4 A;  1KJK A;  2EPK X;  2HJJ A;  3U3W A;  2ZIM A;  4TVA B;  3KWR A;  2CRO A;  2N3H A;  2LBS B;  3QF3 A;  4YRS A;  2RHQ B;  3A9Z A;  1N34 E;  2EOE A;  2UXD E;  2MXD A;  4MCT A;  1ZS4 A;  1YUI A;  1MEY C;  3F6G A;  2DKG A;  1USY A;  1E1T A;  1X47 A;  1A1F A;  1DUL A;  3RKY A;  1WHN A;  4K87 A;  3BS3 A;  2V8Q B;  2L2K B;  4OOG C;  2HNI A;  3EPJ A;  1EKZ A;  1RIQ A;  1X6E A;  4L5N C;  2EM9 A;  3OMT A;  4EZI A;  2I4M A;  3IWD A;  2E72 A;  2GPI A;  4EKG A;  3ADI A;  5LL6 R;  2EP3 A;  3V8L A;  1ZZ8 A;  1YYW A;  3LIS A;  1ZVV A;  2L49 A;  1XNR E;  2LUQ A;  3VHT B;  4XU0 A;  3TUP A;  4HWT A;  1RZR D;  2JCG A;  4WX9 A;  5IT9 C;  4DV5 E;  4LFC E;  2XXP A;  2EPU A;  3AUZ A;  3GZD A;  2FYK A;  3L00 A;  2JWO A;  1YUJ A;  4HTG A;  1PRV A;  1ZAA C;  3L1A A;  3WQZ A;  3SCG A;  1N33 E;  4AQY E;  2CJB A;  3HY1 A;  1G2D C;  2YRH A;  1NEQ A;  3L4G B;  1CQT A;  4KQE A;  2HCN A;  4JI3 E;  4G85 A;  2EMG A;  4DR1 E;  2ZIO A;  4ZTU B;  2XIU A;  1AH5 A;  4H2T A;  3RGL A;  2ALY B;  1UIL A;  2EMK A;  4TUG A;  1WH6 A;  2ADR A;  1WQ7 A;  5ELO A;  3QG5 C;  2UUB E;  5IXM B;  1ZR9 A;  2BNO A;  2Q5H A;  4JI1 E;  4P72 C;  2ARU A;  3J80 C;  4F9C B;  5KNN A;  2YTP A;  3T1H E;  2XSD C;  1WRJ A;  3BFM A;  4DKK A;  2PXL A;  4H2U A;  4JI8 E;  4AH6 A;  1JK1 A;  4H2Y A;  3O9X A;  3VQY A;  1S7E A;  1I94 E;  2HIN A;  3HQ1 A;  2ZGW A;  4Q6G A;  5KL7 A;  4GKJ E;  2LCV A;  1ZPQ A;  3HPS A;  2KZ8 A;  1RQ0 A;  2EM4 A;  3OWQ A;  2V88 A;  4BHB A;  1WQW A;  3BJU A;  3CMQ A;  4HWR A;  2KEK A;  1T4N A;  3G1Z A;  3TEH A;  2MC6 A;  1Y7Y A;  2DGC A;  3IKM B;  2ICP A;  2B7T A;  4DV2 E;  1GZ6 A;  5A2Q C;  2ZT8 A;  4LVJ A;  3KZZ A;  4BCA A;  1FYF A;  2GZU A;  4P75 C;  2PXV A;  1X2G A;  3EQ1 A;  1HNZ E;  4WXC A;  2I4L A;  3VQX A;  2DXU A;  2PXE A;  4NCX A;  4P7D A;  5KL3 A;  4IVZ A;  2E1H A;  1GGM A;  3HRI A;  3HZI B;  2DU5 A;  2CSH A;  1N9W A;  1IBK E;  2DMI A;  3NRO A;  4KR3 A;  1SER A;  3V7R A;  4CS2 A;  3PCO B;  5KL5 A;  2RSM A;  1VQZ A;  2EN7 A;  1UHZ A;  4LFA E;  5FLX C;  3CLC A;  3V8K A;  4FN3 A;  2GHF A;  3HXV A;  1R63 A;  2AMC A;  2EBY A;  2YPN A;  4YRQ A;  4XTY A;  1KOG A;  4O24 A;  11AS A;  2VQF E;  1T39 A;  2BNN A;  3B7H A;  3VYY A;  2LUP B;  3HTZ A;  2EJ9 A;  4YG4 A;  4YRM A;  2ZM6 E;  2J7W A;  2EPA A;  4YP0 A;  4P3O A;  3C4T A;  1X2L A;  3HPZ A;  4R2R A;  1KYQ A;  2C8M A;  1H4T A;  3ZKC A;  5DTQ A;  3G7D A;  1EFA A;  4JI4 E;  1DI2 A;  1X56 A;  4TTV A;  4HRA A;  2FGG A;  3TEG A;  2XTI A;  4YRR A;  3GUU A;  4I6U A;  2NUE A;  2VEO A;  2PUG A;  2R1F A;  2NAB A;  2R63 A;  5LMU E;  4FK5 C;  1DQ3 A;  4YRT A;  3AV0 A;  2DLQ A;  1B8A A;  5AC5 A;  4OLF A;  2IV1 A;  2EQ3 A;  1YYO A;  1XMO E;  4RDX A;  3BGH A;  2V87 A;  1ZZ9 A;  3OTO E;  1ASY A;  2ODR D;  1DW9 A;  4K88 A;  4F54 A;  1RMD A;  2Q5I A;  4RMF A;  2JPA A;  3A5Z A;  1O4X A;  4P74 A;  3RMP A;  2EOY A;  3MSW A;  1ZUG A;  2E65 A;  1EFW A;  2LTR A;  3DM5 A;  1IC8 A;  1JK2 A;  2YWQ A;  4WF2 A;  2EJG A;  2LT7 A;  4HWP A;  2AXU A;  2EPP A;  3VBB A;  2ART A;  4F8D A;  1E22 A;  4DUY E;  1PDA A;  4NXN E;  1YSE A;  2XXQ A;  4LVK A;  4Z5H A;  1T38 A;  2C7I A;  3ICA A;  3P8V A;  3QO7 A;  2EJ4 A;  2WBU A;  3HFZ A;  1X49 A;  3DJW A;  2EPR A;  4X65 E;  5A69 A;  1YFR A;  3HY0 A;  4WSP A;  1SET A;  3M9L A;  3TEP A;  2EQ0 A;  1X3C A;  2YU5 A;  5AE2 A;  1ZZC A;  4GZN C;  2EOR A;  1LLI A;  3RIR A;  2IVB A;  2HC5 A;  4X4C A;  2YTQ A;  3NXH A;  2IHR 1;  3PZC A;  5HGQ A;  2F4V E;  5A6B D;  4X62 E;  2AW6 A;  2RS6 A;  4R2D A;  2NS6 A;  4X4B A;  1QPZ A;  2CJA A;  2XGT A;  3CRO L;  4HEI A;  1A1L A;  2R76 A;  3V8J A;  4B3R E;  1QZX A;  4IJD A;  4H2W A;  2EAY A;  4Z5D A;  3FYM A;  1FKA E;  4F6M A;  4Q28 A;  2IUO A;  2EPC A;  2L8T A;  1EVL A;  4CS3 A;  2CT1 A;  4ER5 A;  2ELY A;  1WU7 A;  4O4K A;  2ENH A;  1UN6 B;  2WIU B;  2UXC E;  4UPA A;  4PG3 A;  4N4R B;  2BNM A;  3UH0 A;  2ZZE A;  1HF0 A;  3BDN A;  1A1I A;  4YPF A;  3ZPX A;  1EVK A;  3NDB B;  1PNR A;  2WBT A;  2LVH A;  1JFS A;  2QHV A;  3JU0 A;  5A6J A;  3MQZ A;  2I4O A;  3UGQ A;  2RHS B;  3HXY A;  1WYD A;  4BHC A;  2ZNI A;  1B69 A;  4LF6 E;  2IVG A;  5C52 B;  4TVA A;  4DR2 E;  4CH6 A;  4P71 C;  4DQ2 A;  1A1K A;  2DRP A;  2CJ9 A;  3VYX A;  4YRC A;  3FIG A;  3F6W A;  2DEQ A;  4M30 A;  3OQO A;  1NJ2 A;  3J7A G;  2DJZ A;  2RHQ A;  1QB2 A;  2Q8U A;  2YRK A;  3EPL A;  3JXB C;  4JQD A;  2RPC A;  4LF4 E;  1STU A;  2A8E A;  1YYK A;  2EOS A;  1KMN A;  2LNM A;  3QTC A;  2MDG A;  4DR4 E;  1SES A;  3RAC A;  4RQF A;  4BMJ A;  1EOV A;  4O2D A;  2PXT A;  2LO3 A;  3M4P A;  5GAH i;  3P8Y A;  2PMF A;  3UWP A;  4LF7 E;  2M4I A;  4Z59 A;  4BW9 A;  1J5W A;  3JXC L;  4H2X B;  5A7L A;  5DSX A;  3KL4 A;  4JCY A;  2I13 A;  4EK9 A;  4TQD A;  3P1X A;  3LQX A;  3HXX A;  1USY C;  3IG2 A;  1NW3 A;  4OP0 A;  2LYR A;  4DE8 A;  2QHU A;  2L1P A;  3P8T A;  3TRB A;  2KEI A;  3BD1 A;  2G7H A;  3PXP A;  3TQM A;  2JOB A;  1YFH A;  3GZC A;  1YFS A;  2WZO A;  1ZZB A;  1SR9 A;  1ZBQ A;  3L4G A;  4PHC A;  4NXM E;  1NYQ A;  2EN1 A;  5ELN A;  4X64 E;  1Y9Q A;  4X4G A;  4LFB E;  1N36 E;  1TN9 A;  1ASZ A;  3A32 A;  3HXW A;  3UGT A;  4JI5 E;  4GKK E;  1GTK A;  2P5I A;  2A25 A;  1SQ8 A;  3H5T A;  2RS7 A;  4BBY A;  4I6T A;  2MDR A;  3LFP A;  4DPG A;  1RZS A;  1UBD C;  4XU2 A;  3QO5 A;  1BBO A;  1QQB A;  1IQO A;  2IY5 B;  5E3I A;  4EX5 A;  2D9H A;  2E10 A;  4ZYG A;  2XCJ A;  2EPX A;  2BJC A;  1BBG A;  4P72 A;  1T4L B;  2EOM A;  3MHH C;  2O4A A;  5TSE A;  1E3O C;  2M9A A;  2EMB A;  4I8O A;  2ODR C;  2EL9 A;  1WH8 A;  4JI0 E;  4I8T A;  5AAS A;  4B3M E;  4H2S A;  2VQE E;  3A31 A;  4TQF A;  3RF1 A;  2E5A A;  4EKI A;  1BBU A;  4GEQ B;  2Q7H A;  3EFS A;  4YDQ A;  2E3C A;  2PUB A;  1AAY A;  4TVY A;  3G5G A;  3IAL A;  3F52 A;  2PXK A;  2YTI A;  2Q7E A;  1T4O A;  2DIX A;  4LU9 A;  2E1M A;  1YSA C;  4X9J A;  2NUG A;  4DV0 E;  1EIY B;  2EE8 A;  4XEM A;  4P75 A;  2EMY A;  1HC7 A;  1AU7 A;  3GN5 B;  3PCO A;  3A7A A;  1ZAY A;  1J5E E;  2ELZ A;  2HHH E;  3QQ6 A;  1A1G A;  4HVC A;  4LF9 E;  1BDH A;  2L2N A;  4JV5 E;  2KPJ A;  2J7U A;  3L2Z A;  4DV3 E;  4XTV A;  4MCX A;  1QQA A;  4J15 A;  2EM3 A;  4Q35 B;  2UU9 E;  1LCC A;  4DE9 A;  2EMI A;  1JJC A;  5K98 B;  2JP9 A;  2PUE A;  2LV2 A;  1ADR A;  4HA8 A;  1IQS A;  1B70 B;  2ZZG A;  2GRL A;  2EMF A;  1HXD A;  3K6Q A;  2CPN A;  1BIA A;  4X4D A;  4YRK A;  4PU3 C;  3OP9 A;  2EN8 A;  3BF2 A;  3OD1 A;  1HTT A;  2EQ1 A;  2DDZ A;  1E1O A;  5DRT A;  3TFL A;  1X48 A;  2KOU A;  4JI2 E;  3EUS A;  4YCV A;  4LF5 E;  3KJX A;  2WCC 3;  1L4S A;  2MEZ A;  3IWC A;  2DQ0 A;  5C53 B;  2EM6 A;  4R03 A;  2YTG A;  2J3L A;  4ER7 A;  4R2A A;  1F2I G;  3SCH A;  4DUZ E;  2AMC B;  2EJF A;  4J1X A;  1H4S A;  2MKD A;  2BB8 A;  1N32 E;  4P73 A;  3MF1 A;  4YRN A;  2DQ3 A;  2YTO A;  2EN6 A;  4F9B B;  4X5O A;  3JXD L;  2YRM A;  3T1Y E;  1PER L;  3QO8 A;  4GQM A;  2YT4 A;  5BR8 E;  2DVE A;  3LC0 A;  4CS4 A;  4Y42 A;  1UXC A;  3QNE A;  4YAR A;  5F3W A;  4YRP A;  2DZ9 A;  3M4Q A;  1TF6 A;  1UTX A;  4CH3 A;  2HGH A;  1QP0 A;  4YHH E;  1B7Y A;  4G84 A;  2KHX A;  2LLV A;  3OKZ A;  3LSS A;  3IWB A;  2B5A A;  3MEJ A;  1PKP A;  3V7C A;  2EM7 A;  1VPW A;  1NCS A;  3HFV A;  1EH8 A;  2ZNJ A;  1JFT A;  2EMZ A;  3QOX A;  2YTF A;  3F6H A;  4UP9 A;  1QP4 A;  4YRE A;  2NUF A;  5KL6 A;  3J81 C;  3RKW A;  2I4N A;  2WUS R;  4FBI A;  2J3M A;  4F2J C;  4P74 C;  1G5I A;  2ENA A;  3HTX A;  2Q7G A;  2EWT A;  2EOI A;  3EPK A;  2YTE A;  2VF1 A;  3BBG A;  4ZYD A;  1LQC A;  4EQZ A;  4TVW A;  2PUA A;  1PJS A;  1GT0 C;  1RZR A;  4BS9 A;  2HFZ A;  2LE2 A;  5DNY A;  2QHS A;  1LLM C;  1PYS B;  2EOH A;  3NEL A;  2EPZ A;  2EN2 A;  4LVI A;  4L87 A;  3S8Q A;  1NEI A;  1G51 A;  2NA2 A;  1UXD A;  4OBM A;  4GHJ A;  3GBF A;  4YY3 E;  4LVL A;  2FV4 B;  1IBL E;  4X8W A;  1G2F C;  2RQL A;  2J7J A;  1HR0 E;  3A9X A;  2EOO A;  3BID A;  1Z7M A;  2B7V A;  4YRF A;  2LYJ A;  1RC7 A;  2O38 A;  2RHS A;  2ZZF A;  2LLW A;  2EPN A;  2AXZ A;  3D1N I;  4WSG A;  5F5W A;  5KL2 A;  1N3G A;  3JAM C;  2OR1 L;  2A6C A;  1X6H A;  4E51 A;  2V83 A;  2N3G A;  3R07 A;  2EOZ A;  12AS A;  5T6J A;  3CEC A;  5DTM A;  3REX A;  1W66 A;  4OX9 E;  3A7R A;  2P0L A;  2ZT7 A;  3UK3 C;  2EOF A;  2EOJ A;  1ZZ7 A;  4PU7 A;  4DV4 E;  4M9V C;  4DV7 E;  4WXD A;  4IA8 A;  5DT2 A;  2EM8 A;  4M2Z A;  2AXV A;  2XXA A;  1XMQ E;  4EO4 A;  3F51 A;  2E64 A;  2JOX A;  1OSL A;  2O49 A;  2IU7 A;  4ZIB A;  4P3P A;  1HNW E;  2JXP A;  4H2X A;  4DR5 E;  1WJP A;  1RIO A;  2PIJ A;  3SCF A;  1DGC A;  2UUC E;  2ZCE A;  1WNL A;  3RL6 A;  4R2S A;  5K1P A;  3H09 A;  4K86 A;  2PUD A;  1NJ5 A;  2RSI A;  1NJ8 A;  1PRA A;  4XTW A;  4X4H A;  4YCU A;  2OFY A;  1QP7 A;  2R1J L;  3C6M A;  2LJU A;  2JYA A;  2AKW B;  4RQE A;  1O0W A;  4ER3 A;  5DTR A;  2PXU A;  2M4H A;  1L0W A;  2XJ3 A;  2N8X A;  2ZXF A;  4J8Z A;  2YSP A;  4HT4 A;  1ZBT A;  2V89 A;  3ADL A;  2EML A;  1J26 A;  5K1X A;  3MLF A;  2GLI A;  1BIB A;  1JH9 A;  4WJ4 A;  1GQE A;  1ATI A;  2MKN A;  4R2C A;  2PXD A;  3VQW A;  1ADJ A;  1JWL A;  2ALY A;  4KHP E;  3MHS C;  2QHT A;  4LTY A;  1ADY A;  3I7F A;  2L92 A;  4UP8 A;  2IY5 A;  2EOX A;  4HWO A;  5LLQ A;  3VWS A;  2YBD A;  1BB8 A;  2YTJ A;  2ZIN A;  1KMM A;  3GZD C;  2HSG A;  4Z5C A;  2E5L E;  4O8B A;  3KFU A;  4O5G A;  5IWA E;  3EFR A;  5JUW A;  2MQK A;  5ADZ A;  4DR3 E;  1X2H A;  5DRY A;  2DTH A;  3REU A;  2E41 A;  5C51 B;  1X5W A;  4H2V A;  4YRL A;  1HQ1 A;  2EMX A;  4XU3 A;  3J7Y p;  1YZ9 A;  3KZY A;  1E24 A;  1ZZ6 A;  3ADJ A;  1LCD A;  3THO B;  3G0T A;  4MLQ A;  4L8N A;  3HXU A;  3E9I A;  2EL6 A;  2CGH A;  2LYK A;  1RPE L;  1NYR A;  3KXA A;  2PPX A;  4UP7 A;  1EIY A;  2EM5 A;  3HXL A;  3LLH A;  3ECR A;  4BWA A;  4K0K E;  2ZT6 A;  3GN5 A;  2K7I A;  2EM2 A;  1G5H A;  2LJH A;  1NJ6 A;  3VQV A;  4TWA A;  3ZHM A;  3ZHI A;  1QE0 A;  1X57 A;  1X54 A;  1XNQ E;  1WIZ A;  2I9I A;  1IBM E;  2XI8 A;  2L8N A;  3ME5 A;  1EH6 A;  2EF8 A;  4X4E A;  2BBG A;  1YFT A;  4KR2 A;  4WJ3 M;  3ERR A;  4LVM A;  3MEY A;  2LCE A;  2FTX B;  1X01 A;  4PU4 C;  3A5Y A;  2VE7 C;  1B76 A;  3JTZ A;  1BBW A;  4JI6 E;  2EMH A;  3A74 A;  2UUA E;  1X55 A;  2DSY A;  3TEH B;  1EH7 A;  3QOW A;  3NZL A;  1B70 A;  4DR6 E;  4BC7 A;  2JQE A;  3OML A;  4P78 A;  4DR7 E;  1MGT A;  4WFT A;  1QF6 A;  2EPL X;  5A6B A;  2L2M A;  3QYX A;  3OQN A;  2YSO A;  4ZYH A;  3A7U A;  3NEN A;  1C0A A;  1PJT A;  2PXF A;  4X4F A;  4B3S E;  4Q15 A;  2LMZ A;  4R8O A;  5LMN E;  1IL2 A;  2PXQ A;  2LYP A;  2B3T B;  4RHB B;  3THN A;  2MC5 A;  4DMI A;  4R2Q A;  1U2Z A;  4IS1 C;  4MLV A;  4H02 A;  4YG1 A;  1R69 A;  3C6K A;  3QWG A;  3UFD A;  4ER6 A;  2G4C A;  4X66 E;  4YYE A;  1OCT C;  1POU A;  2DTO A;  3R09 A;  3ADG A;  2V86 A;  4DV1 E;  2PUC A;  3PE5 A;  4XTX A;  2EPO A;  3RZZ A;  4F9A B;  1H4V B;  2EN4 A;  1YGB A;  2PRT A;  1JJC B;  2VRD A;  1NJ1 A;  4NDW A;  2V3C C;  2JVL A;  2CTD A;  4P3N A;  2WBS A; 
#chains in the Genus database with same CATH homology
 1J5W A;  3A9Y A;  1RQ0 A;  4H2X B;  1WPY A;  3OWQ A;  2V88 A;  5DSX A;  1WQW A;  3BJU A;  3CMQ A;  4YRG A;  4YY3 E;  2LTS A;  4LVL A;  4EK9 A;  1QU6 A;  4HWR A;  1T4N A;  2FV4 B;  3G1Z A;  1IBL E;  4X8W A;  4TQD A;  4TUI A;  3TEH A;  2MC6 A;  3P1X A;  3HXX A;  1USY C;  3IG2 A;  1NW3 A;  4OP0 A;  4DE8 A;  3IKM B;  2B7T A;  4DV2 E;  1GZ6 A;  1HR0 E;  3A9X A;  2QHU A;  4KZS A;  5A2Q C;  2L1P A;  1Z7M A;  3P8T A;  1H4Q A;  2ZT8 A;  4LVJ A;  2B7V A;  4P73 C;  2G7H A;  1YB3 A;  4YRF A;  4BCA A;  2L33 A;  1RC7 A;  2JOB A;  1FYF A;  1YFS A;  3GZC A;  2RHS A;  2LLW A;  2ZZF A;  4WI1 A;  2WZO A;  1SR9 A;  2EWL A;  4P75 C;  1ZBQ A;  3L4G A;  4JI7 E;  1X2G A;  4PHC A;  1HNZ E;  5F5W A;  4NXM E;  3JAM C;  2I4L A;  2RTX A;  1NYQ A;  3VQX A;  2DXU A;  4E51 A;  2V83 A;  3QFI A;  5CFF E;  5ELN A;  2N3G A;  4X64 E;  3R07 A;  4LFB E;  1N36 E;  3LML A;  12AS A;  5T6J A;  5AE1 A;  1ASZ A;  5DTM A;  3REX A;  1W66 A;  4OX9 E;  3SR4 A;  4NCX A;  3A7R A;  3A32 A;  3DF6 A;  4P7D A;  2P0L A;  2ZT7 A;  3HXW A;  3UGT A;  4JI5 E;  2E1H A;  1WLE A;  4DV4 E;  4GKK E;  1NNH A;  2UXB E;  1GGM A;  3HRI A;  4WPY A;  2P5I A;  4XU1 A;  2DU5 A;  2RS7 A;  1N9W A;  1IBK E;  4BBY A;  4DV7 E;  3NET A;  3NRO A;  4KR3 A;  1SER A;  3V7R A;  4CS2 A;  2MDR A;  3C4B A;  3PCO B;  2V85 A;  2RSM A;  1VQZ A;  5DT2 A;  4M2Z A;  4WYQ B;  4DPG A;  2DB2 A;  2LRS A;  2L6M A;  4XU2 A;  1PYS A;  2DTI A;  2F8B A;  2M7Q A;  1XMQ E;  3NEM A;  3QO5 A;  1UHZ A;  4EO4 A;  4LFA E;  4ER0 A;  2E64 A;  1B7Y B;  2JOX A;  2JR1 A;  2IY5 B;  2KON A;  3LSQ A;  5FLX C;  5E3I A;  4YCW A;  4EX5 A;  4ZIB A;  4CH5 A;  3V8K A;  2E10 A;  2ZR3 A;  4P3P A;  3HXV A;  4YRI A;  2AMC A;  1HNW E;  4H2X A;  4DR5 E;  4P72 A;  4YRQ A;  3RUX A;  1T4L B;  2UUC E;  4XTY A;  1KOG A;  11AS A;  2ZCE A;  4ZTZ B;  2VQF E;  1WNL A;  3RL6 A;  5K1P A;  4WVL A;  3H09 A;  3VK6 A;  2PME A;  3VYY A;  4B3T E;  4LF8 E;  4K86 A;  1NJ5 A;  1NJ8 A;  4XTW A;  4YCU A;  4I8O A;  2ODR C;  2LUP B;  3HTZ A;  2EL9 A;  4XTU A;  4YRJ A;  4JI0 E;  2EJ9 A;  4YRM A;  2ZM6 E;  2ZR2 A;  5AAS A;  2J7W A;  4B3M E;  2AKW B;  4H2S A;  2VQE E;  3A31 A;  4TQF A;  1O0W A;  3RF1 A;  4RQE A;  4ER3 A;  2E5A A;  5DTR A;  4EKI A;  4YP0 A;  4P3O A;  3C4T A;  1BBU A;  3HPZ A;  2ZTG A;  4GEQ B;  2M4H A;  2Q7H A;  3EFS A;  2C8M A;  2JY9 A;  4DV6 E;  4YDQ A;  1H4T A;  2E3C A;  1L0W A;  5DTQ A;  2H36 X;  3HRK A;  2ZXF A;  4JI4 E;  1DI2 A;  1X56 A;  4TVY A;  4J8Z A;  4TTV A;  4HRA A;  3HFZ B;  4HT4 A;  2FGG A;  1ZBT A;  3TEG A;  2XTI A;  4YRR A;  1EQR A;  2V89 A;  3GUU A;  2NUE A;  3UFG A;  3IAL A;  2VEO A;  1WHQ A;  3SX0 A;  4YRO A;  3ADL A;  2Q7E A;  3TEL A;  4Q2J A;  1T4O A;  1J26 A;  1Z7N A;  5K1X A;  2DIX A;  4LU9 A;  5LMU E;  3HXZ A;  2E1M A;  1FJG E;  2NUG A;  1DQ3 A;  1SRY A;  3DSQ A;  3MF2 A;  3AV0 A;  4YRT A;  4DV0 E;  1B8A A;  1EIY B;  1BIB A;  2L3J A;  4WJ4 A;  4XEM A;  4P75 A;  1GQE A;  2YZT A;  1ATI A;  2JVA A;  1HC7 A;  1HNX E;  3VQW A;  4OLF A;  1ADJ A;  3PCO A;  3V7S A;  3IKL A;  3A7A A;  2ALY A;  1YYO A;  4KHP E;  1XMO E;  1J5E E;  4HWS A;  4LNS A;  2QHT A;  4RDX A;  4LTY A;  2EZ6 A;  1ADY A;  1WXR A;  2HHH E;  2V87 A;  3I7F A;  2B9D A;  2L92 A;  4UP8 A;  2IY5 A;  3OTO E;  4HVC A;  2ODR D;  4HWO A;  1ASY A;  3RKX A;  2HCS A;  4K88 A;  4F54 A;  3VWS A;  2Q5I A;  4LF9 E;  2YBD A;  4XTZ A;  1LYL A;  2L2N A;  2DMY A;  4JV5 E;  2ZIN A;  4RMF A;  1KMM A;  3A5Z A;  3GZD C;  2ZT5 A;  4P74 A;  3W3S A;  2J7U A;  3L2Z A;  4P71 A;  4DV3 E;  4XTV A;  4XEO A;  3RMP A;  2E5L E;  4M0V A;  3MSW A;  5AE3 A;  2E65 A;  1EFW A;  5IWA E;  3KFU A;  2LTR A;  4J15 A;  3EFR A;  5JUW A;  5ADZ A;  4DR3 E;  4BC9 A;  3E9H A;  2UU9 E;  1JJC A;  4DE9 A;  1X2H A;  4WF2 A;  5DRY A;  2L3C A;  2DZC A;  2EJG A;  2DTH A;  4HA8 A;  2EWN A;  3REU A;  2E41 A;  4HWP A;  3VBB A;  2ART A;  5C51 B;  2AKW A;  2K4V A;  1B70 B;  1E22 A;  2DU7 A;  2ZZG A;  4DUY E;  4NXN E;  4JYA E;  4H2V A;  4YRL A;  2XXQ A;  4LVK A;  4XU3 A;  1HXD A;  2CIM A;  3K6Q A;  3J7Y p;  2ARS A;  2C7I A;  1YZ9 A;  3ICA A;  2CPN A;  3P8V A;  2DXT A;  1BIA A;  2M1S A;  3QO7 A;  1E24 A;  3ZOQ B;  3FJP A;  3ADJ A;  4YRK A;  3G0T A;  4CH4 A;  3HFZ A;  1X49 A;  3DJW A;  4L8N A;  4X65 E;  1YFR A;  3HXU A;  3HY0 A;  2ZIM A;  4TVA B;  3E9I A;  3OD1 A;  3KWR A;  1HTT A;  2CGH A;  2DDZ A;  4WSP A;  1E1O A;  5DRT A;  2N3H A;  2LBS B;  1SET A;  3M9L A;  3TFL A;  3TEP A;  1X48 A;  1NYR A;  2KOU A;  5AE2 A;  4UP7 A;  4JI2 E;  4YCV A;  4LF5 E;  3RIR A;  3IWC A;  4YRS A;  2DQ0 A;  5C53 B;  1EIY A;  2RHQ B;  3HXL A;  3LLH A;  3A9Z A;  4R03 A;  4BWA A;  1N34 E;  2J3L A;  4K0K E;  2UXD E;  2MXD A;  2ZT6 A;  4ER7 A;  3NXH A;  2IHR 1;  3PZC A;  3F6G A;  1G5H A;  2DKG A;  5HGQ A;  1USY A;  2LJH A;  1E1T A;  4DUZ E;  1NJ6 A;  2F4V E;  3VQV A;  4X62 E;  4TWA A;  1X47 A;  2RS6 A;  2AMC B;  2EJF A;  2NS6 A;  1QE0 A;  1H4S A;  1X54 A;  2CJA A;  2XGT A;  3RKY A;  1WHN A;  1N32 E;  4K87 A;  4P73 A;  1XNQ E;  3V8J A;  3MF1 A;  4YRN A;  2V8Q B;  2L2K B;  4OOG C;  1IBM E;  4B3R E;  2HNI A;  4H2W A;  3ME5 A;  2EAY A;  2DQ3 A;  1EKZ A;  1RIQ A;  1YFT A;  4L5N C;  4KR2 A;  4F9B B;  4EZI A;  1FKA E;  2I4M A;  4X5O A;  4WJ3 M;  4Q28 A;  3ERR A;  3T1Y E;  4LVM A;  2L8T A;  3MEY A;  3IWD A;  1EVL A;  3QO8 A;  2YT4 A;  4CS3 A;  5BR8 E;  4EKG A;  3ADI A;  2DVE A;  4ER5 A;  2FTX B;  5LL6 R;  3LC0 A;  4CS4 A;  1WU7 A;  3QNE A;  3V8L A;  1YYW A;  5F3W A;  4YRP A;  1X01 A;  2DZ9 A;  3A5Y A;  2VE7 C;  3M4Q A;  2UXC E;  1XNR E;  1B76 A;  3JTZ A;  2LUQ A;  1BBW A;  4PG3 A;  4UPA A;  4CH3 A;  4JI6 E;  4YHH E;  1B7Y A;  3A74 A;  2KHX A;  2UUA E;  1X55 A;  4G84 A;  2LLV A;  2DSY A;  3TEH B;  3UH0 A;  4XU0 A;  3OKZ A;  3TUP A;  4HWT A;  3LSS A;  2ZZE A;  3QOW A;  3IWB A;  3NZL A;  3MEJ A;  1B70 A;  1PKP A;  4DR6 E;  4BC7 A;  3V7C A;  3HFV A;  4YPF A;  3OML A;  3ZPX A;  4P78 A;  1EVK A;  5IT9 C;  2ZNJ A;  4DR7 E;  4DV5 E;  4LFC E;  4WFT A;  2XXP A;  3AUZ A;  3GZD A;  1QF6 A;  3QOX A;  2FYK A;  2JWO A;  2QHV A;  3JU0 A;  3F6H A;  3MQZ A;  4UP9 A;  4YRE A;  2I4O A;  2L2M A;  2NUF A;  3A7U A;  3NEN A;  2RHS B;  3UGQ A;  3WQZ A;  3HXY A;  3L1A A;  3J81 C;  1WYD A;  1N33 E;  1C0A A;  3RKW A;  4AQY E;  2CJB A;  2ZNI A;  3HY1 A;  4LF6 E;  2I4N A;  5C52 B;  3L4G B;  4TVA A;  4KQE A;  2J3M A;  4DR2 E;  4CH6 A;  4P74 C;  2HCN A;  4JI3 E;  4G85 A;  4P71 C;  4B3S E;  4DR1 E;  4DQ2 A;  2CJ9 A;  2ZIO A;  4Q15 A;  2LMZ A;  3VYX A;  4R8O A;  3FIG A;  5LMN E;  4YRC A;  4ZTU B;  2DEQ A;  1IL2 A;  4H2T A;  4M30 A;  3RGL A;  1G5I A;  2ALY B;  1NJ2 A;  3J7A G;  2B3T B;  4DMI A;  1UIL A;  2MC5 A;  2DJZ A;  1U2Z A;  3HTX A;  4TUG A;  2RHQ A;  4H02 A;  1WQ7 A;  5ELO A;  2Q7G A;  4ER6 A;  2G4C A;  4X66 E;  2UUB E;  2VF1 A;  4YYE A;  4LF4 E;  1STU A;  2Q5H A;  4JI1 E;  2A8E A;  1YYK A;  4P72 C;  2ARU A;  2DTO A;  4EQZ A;  4TVW A;  3J80 C;  3R09 A;  3ADG A;  4F9C B;  5KNN A;  3T1H E;  1KMN A;  2LNM A;  2V86 A;  4DV1 E;  3BFM A;  3PE5 A;  3QTC A;  4BS9 A;  4DKK A;  2HFZ A;  4XTX A;  2LE2 A;  5DNY A;  4DR4 E;  1SES A;  4H2U A;  4JI8 E;  4F9A B;  3RAC A;  1H4V B;  2QHS A;  4RQF A;  4AH6 A;  4H2Y A;  1PYS B;  3VQY A;  1YGB A;  3NEL A;  4BMJ A;  1EOV A;  1I94 E;  1JJC B;  4O2D A;  1NJ1 A;  3HQ1 A;  2ZGW A;  4Q6G A;  3M4P A;  3P8Y A;  4LVI A;  2PMF A;  4GKJ E;  3UWP A;  4L87 A;  4LF7 E;  1G51 A;  2NA2 A;  2M4I A;  4BW9 A;  3HPS A;  4P3N A;  4OBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...