2ODRD

Methanococcus maripaludis phosphoseryl-trna synthetase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
Knots found
sequence length
663
structure length
451
Chain Sequence
REEIIEMANKDFEKAWIETKDLIKAKKINESYPRIKPVFGKTHPVNDTIENLRQAYLRMGFEEYINPVIVDERDIYKQFGPEAMAVLDRCFYLAGLPRFKDLTAVSSKLTLRSHMTSGWFLTVSDLMNKKPLPFKLFSIDRCFRREQKEDKSHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFTNFKFIPDEKKSKYYTPETQTEVYAYHPKLKEWLEVATFGVYSPVALSKYGIDVPVMNLGLGVERLAMISGNFADVREMVYPQFYEHKLNDRNVASMVKLDKVPEIYVYDGNVIGIPELKIDDIALKQIMSKNKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphoseryl-tRNA synthetase
publication title Toward understanding phosphoseryl-tRNACys formation: the crystal structure of Methanococcus maripaludis phosphoseryl-tRNA synthetase.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Ligase
total genus 112
structure length 451
sequence length 663
other databases KnotProt 2.0: Artifct S +31 +31
ec nomenclature ec 6.1.1.27: O-phosphoserine--tRNA ligase.
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
D PF18006 SepRS_C O-phosphoseryl-tRNA synthetase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.120 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2odrD03
3.30.160.480 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2odrD01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2odrD02
2Q7GA 4BWAA 2E3CA 1ASZA 2IY5B 1YFTA 3HXWA 3E9IA 1FYFA 1SERA 3RGLA 5C51B 1SESA 4PG3A 4H2SA 4RQEA 2DJZA 1Z7MA 4Q15A 4P73A 1IL2A 3HY0A 1G5IA 3LC0A 4TQDA 1X55A 1HC7A 2C7IA 2DVEA 4CH5A 2EJFA 4RQFA 3V8LA 4YRIA 1X01A 5KNNA 3BFMA 2ZINA 2EJ9A 4P3OA 1HXDA 2ZZEA 2ZIMA 1WNLA 1PYSA 2EAYA 2EJGA 3FJPA 3M4QA 1WQWA 2E41A 2Q5HA 3A7AA 2ZZGA 2RHSA 1YFRA 4H2UA 1H4TA 4TVYA 1EOVA 2I4OA 1NJ5A 4K87A 4TTVA 1NJ8A 3TEGA 2I4NA 3IG2A 1N9WA 3BJUA 3NENA 2Q5IA 2DXUA 2IY5A 2J3MA 4G85A 4TWAA 4CH3A 4XU1A 2E64A 4HWRA 1NJ1A 4OLFA 3ICAA 4H2YA 2DQ0A 3HXVA 3UH0A 2J3LA 1E22A 1EVLA 1USYC 2DQ3A 3IKMB 4UP9A 2CJAA 4YRFA 4YRRA 4E51A 1G5HA 5F5WA 4YDQA 2CJ9A 1NYRA 3A5YA 4XTWA 1QF6A 1VQZA 4YCVA 2E10A 3QO8A 1QE0A 4TQFA 4DPGA 4HWTA 2ZR3A 3IALA 1H4VB 3P8TA 4YPFA 5K1PA 3NETA 1C0AA 4YRPA 2C8MA 5K1XA 1USYA 4CH6A 1X2GA 3QO7A 4HWPA 1ADJA 1X56A 1J5WA 4P71A 3A5ZA 2CJBA 2E65A 1NYQA 2EL9A 3PCOA 2I4MA 3TUPA 2ZNIA 2DKGA 4WF2A 1LYLA 3HTZA 2DDZA 4YRTA 1B7YB 3E9HA 2FYKA 3P8VA 3RKXA 4Q6GA 3VQYA 4KR2A 2ARTA 3A31A 2CIMA 3W3SA 3V7RA 4P3NA 2G4CA 4TVAB 3ERRA 3MF2A 4L87A 2QHUA 3EFSA 1SETA 2ZNJA 1E24A 3HFZB 1WU7A 1WPYA 3A32A 1BIAA 3REXA 4YRJA 3VQWA 3RKWA 1H4SA 2ZT7A 4H2XA 1NNHA 4WJ4A 2I4LA 3A7RA 4XTVA 12ASA 3V8JA 3PCOB 3RKYA 5E3IA 4AH6A 4ZTZB 1EQRA 1YB3A 4XEMA 1B8AA 2Q7HA 2PMFA 3CMQA 1B70B 1GGMA 5HGQA 4ZTUB 3TEHB 1ASYA 3A7UA 2EWNA 1HTTA 2ZZFA 1YGBA 2DXTA 4EX5A 3LSQA 1WQ7A 2QHVA 3UFGA 1SRYA 2ZT8A 3RACA 1B7YA 2XTIA 2AKWB 4P72C 2RHQB 2DTIA 2DTHA 4P71C 3V7CA 1X54A 2ZTGA 4YRNA 1W66A 2DZCA 2Q7EA 3V7SA 1L0WA 3QTCA 3L4GB 3M4PA 2ZXFA 4UP7A 1RIQA 2XGTA 4RDXA 4EO4A 1WLEA 2PMEA 4TVAA 4HWOA 3NEMA 4CS4A 5C52B 4HVCA 2ALYA 3A74A 4H2XB 1ATIA 1BBWA 4NCXA 2DZ9A 4XTZA 1ADYA 4WI1A 3UGTA 3P8YA 3I7FA 2P5IA 3HFZA 1Z7NA 4P72A 3DSQA 4CS2A 2ZGWA 3UGQA 1YFSA 3HY1A 2ZR2A 2ODRC 3WQZA 4P75A 1BIBA 4XU3A 3VQXA 4K86A 4YRKA 2E1HA 3HRKA 2DTOA 3EFRA 1KOGA 4H2VA 3VQVA 4H2TA 4YYEA 4J15A 5ELOA 1B70A 2QHTA 1KMNA 1X2HA 3TEHA 3HXXA 4YRMA 4BW9A 11ASA 4ZIBA 4H2WA 3IKLA 3L2ZA 3L1AA 3RUXA 2ZCEA 4XEOA 4P74C 4YCUA 3PZCA 1H4QA 2QHSA 4KR3A 2AKWA 1E1TA 3MEYA 2RHQA 5C53B 4DQ2A 2P0LA 1E1OA 4RMFA 3OD1A 2ALYB 3HXUA 3R07A 4YRSA 2DU5A 4XTUA 4XU0A 1WYDA 2ARUA 3L4GA 3HXYA 4PHCA 4CS3A 1NJ6A 3LSSA 4TVWA 1G51A 4KQEA 4X5OA 3RL6A 2DEQA 1EIYA 3NELA 4YP0A 3RIRA 2AMCB 4H02A 2ZT6A 4HA8A 1EFWA 3G1ZA 4P74A 4XTXA 4WJ3M 4YRLA 1JJCA 3HRIA 3QO5A 3HXZA 3V8KA 1KMMA 1NJ2A 3RF1A 2ZIOA 4YCWA 1B76A 4HWSA 4YROA 3MF1A 4YREA 3VBBA 2ODRD 3QNEA 3KFUA 4UPAA 2CGHA 3REUA 2DU7A 4UP8A 4XTYA 2ZT5A 1PYSB 4P3PA 4P75C 4OP0A 4LNSA 4YRCA 2RHSB 2HNIA 1EVKA 3HFVA 1EIYB 5ELNA 4YRQA 4O2DA 4P73C 2E5AA 2ARSA 4K88A 1BBUA 4YRGA 1JJCB 4XU2A 4CH4A 2AMCA 4G84A
chains in the Genus database with same CATH superfamily
2PXKA 2Q7GA 2JXPA 1YFTA 3CECA 1SERA 4F8DA 2L3CA 4X9JA 1IC8A 3BGHA 1X55A 2DVEA 4CH5A 2EOSA 3V8LA 2EMLA 3BBGA 1X01A 2UXBE 3BFMA 5KNNA 1BDIA 1X3CA 2EPXA 4R2DA 1HXDA 2ZZEA 3ADLA 2EJGA 1DGCA 1WQWA 2LYSA 2ZZGA 2RHSA 1EOVA 3HQ1A 2V87A 2I4OA 4DR2E 2E72A 3IG2A 2H36X 4BC9A 3JXBC 1X6HA 4NDWA 3T1YE 2DXUA 4TWAA 3BS3A 1ZAYA 4ER7A 2E64A 4HWRA 4RH8A 1NJ1A 2RSIA 4X4HA 2BNOA 4OLFA 1L4SA 1RZSA 1BB8A 1NEQA 2AUWA 2YRHA 2BNMA 2PUFA 4UP9A 4YRRA 4B3RE 1WHQA 4KWYA 5F5WA 4WXCA 4YDQA 4EKGA 1NYRA 1PDAA 2EMWA 1VQZA 4YCVA 5IT9C 1WIZA 3QO8A 4LVKA 4HEIA 2ZR3A 3BIDA 3IALA 5K1PA 1ZBTA 2EQ3A 2YTEA 1PRAA 2JVAA 2PXUA 4HWPA 4R03A 1QP7A 1ADJA 1PJSA 2UUAE 2E65A 3MEJA 2YTIA 5A6BD 4J1WA 2PXTA 2ZNIA 4GZNC 4ZYEA 2LCEA 4WF2A 1QQBA 1LYLA 3DNVB 3HTZA 1T4OA 2VF1A 2EMAA 4Q6GA 3GN5B 5LL6R 1ZZ8A 4BCAA 1BBOA 1ZZ7A 2YPNA 3VWSA 2WCC3 2YSPA 4NXNE 3S8QA 1E24A 3QG5C 2NUGA 4WSGA 2DRPA 1I94E 4LFBE 4H2XA 4WJ4A 2PUBA 2EM9A 1N3GA 2K4VA 4ZTZB 1YB3A 1HNXE 2OR1L 2EL5A 2UU9E 4R2PA 1B70B 5HGQA 2EOIA 3OWQA 3TEHB 2KZ8A 3LFPA 2ZZFA 1DWKA 1FKAE 2WUSR 2V85A 4K0KE 3RACA 2LTRA 4YG4A 2XTIA 2AKWB 4YARA 2RHQB 2L2NA 2DLKA 2EN3A 4P71C 2EPMX 4GHJA 1X54A 2ZTGA 1RC7A 3M4PA 4UP7A 2YTNA 2EOEA 1TF3A 1RIQA 3JXCL 2YU5A 1WH6A 2MC6A 4JI4E 2VEOA 3NEMA 4ER3A 3F51A 2N3GA 2EQ0A 5C52B 3A74A 1N36E 4NCXA 3TELA 1N32E 4WYQB 3HFZA 3FMYA 1RZRA 3HPSA 1L1MA 5A6KA 2GPIA 2L49A 1UTXA 2R1FA 2EM5A 3JXDL 4F9BB 4K86A 2CSHA 2ELZA 1A1JA 2EL4A 1KOGA 3THNA 4H2TA 4YYEA 1PERL 2IVBA 2EN6A 5GAGi 4M30A 3SCGA 4BW9A 3IKLA 3MLFA 3L2ZA 2PXFA 5JUWA 1B0NA 2B9DA 4LF4E 2EN2A 1E3OC 5DRYA 3VYYA 4NXME 3LISA 3OD1A 2EN7A 3HXUA 3C4BA 2ARUA 4Q2JA 4M2ZA 2R1JL 2EPZA 4PHCA 4YG7B 2LO3A 1DQ3A 1PJQA 2DEQA 1EIYA 3NELA 3RIRA 2KEKA 4H02A 1SR9A 2ZT6A 1ZU1A 4LF9E 1EFWA 1X48A 3G1ZA 4XTXA 4WJ3M 3LQXA 2YTPA 5K98B 4MCTA 2LTSA 2LBSB 1RIOA 5GAHi 2EQ1A 3UK3C 2ZIOA 1YSAC 1G2FC 3ADGA 4YCWA 2LYKA 4ER6A 3KWRA 2JR1A 4YROA 4Z59A 1J5EE 2PE5A 2WBTA 2DSYA 2IVQA 2CGHA 2MQKA 2G7HA 1NCSA 4XTYA 4LVMA 2PXEA 3AUZA 4TUIA 2F8BA 5LMUE 2EZ6A 4X4FA 3VYXA 3G5GA 2RHSB 1EVKA 3EQ1A 2EMZA 1LMB3 1LCCA 2L3JA 4YRQA 1ZUGA 1QP4A 5DTRA 4HT4A 2HCNA 1ATIA 2JCGA 4LFCE 3OP9A 3QWGA 2YTGA 2WIUB 3DJWA 4JI5E 4F2JC 5LMNE 4RQEA 4X4BA 3F6HA 4OOGC 4Q15A 2D9HA 3VK0A 3K6QA 5A69A 3MQZA 3LC0A 1BBGA 2IV1A 3SCFA 1Y7YA 4PU8A 2XIUA 3ZOQB 3EPHA 1O0WA 4P3OA 2J7WA 3HTXA 2JOBA 2ZIMA 5DTQA 4B3ME 2RTXA 2EAYA 1U2ZA 2E41A 3OQNA 2Q5HA 2XXQA 1NW3A 4Q28A 4H2UA 2NABA 2YWQA 3JAMC 2LJUA 3EUSA 1ZZ9A 4K87A 3L1PA 3IWDA 1N9WA 1EFAA 2XI8A 2L2MA 3NENA 4FK5C 1UXDA 2ZM6E 2EPUA 2J3MA 2PUAA 4G85A 3ECRA 2IUOA 2GRLA 3VK6A 3ICAA 2EM8A 4AQYE 3HXVA 5IXMB 1YZ9A 4ER0A 3SR4A 2CJAA 5AC5A 4YRFA 4YHHE 1TF6A 1G5HA 4E51A 4DKKA 1Z1BA 1DULA 2EM7A 2CJ9A 3IWCA 1LLMC 3A5YA 4P7DA 2JVLA 2UUCE 1QF6A 1HNZE 2E10A 2DB2A 1YSEA 4DV6E 4TQFA 4HWTA 1Y9QA 2LV2A 2YSOA 1H4VB 3OMLA 3NETA 2YT4A 2ICTA 1C0AA 4YRPA 2C8MA 5K1XA 2XJ3A 4LF8E 4CH6A 1PNRA 2J7UA 3LMLA 1X2GA 3QO7A 3J7AG 2YTQA 2AXVA 1J5WA 4F9CB 5A2QC 3QYXA 4O4KA 3UFDA 2L33A 2HGHA 1NYQA 2EL9A 3TUPA 1ZZBA 3JU0A 2LLWA 1X6EA 4YRTA 4FN3A 1RQ0A 2EPOA 4O43A 3E9HA 4DV1E 3P8VA 4R2CA 4KR2A 2M4HA 4WVLA 2EN1A 3A31A 2CIMA 4L8NA 2XXAA 4P3NA 2G4CA 5KL7A 4IVZA 2FFHA 3ERRA 1ZAAC 4ER5A 2QHUA 3MHSC 2YTFA 3C4TA 4LF7E 2KHXA 3HFZB 1WU7A 4JCYA 1WPYA 1BIAA 4YRJA 3VQWA 3RKWA 2FTXB 2ZT7A 1NNHA 2EOOA 2M1SA 3V8JA 3PCOB 4X4GA 2O38A 2EMGA 2RPCA 4DV7E 1B8AA 2B7TA 2GHFA 2IVGA 1S7EA 2ICPA 2MKNA 1LCDA 2EWNA 3D1NI 3GZCA 1YGBA 2DXTA 2PXVA 2L1PA 4EX5A 1WQ7A 3UFGA 3OTOE 2EM6A 2XXPA 4P72C 2PIJA 4YRNA 1W66A 1ADRA 2EM4A 2DZCA 2EMHA 2Q7EA 1L0WA 4LTYA 2XGTA 4RDXA 4EO4A 2PMEA 4HWOA 2ALYA 1BBWA 1ADYA 4DV4E 4PU7A 2CPNA 4LU9A 2HC5A 2DGCA 2FGGA 3EPKA 2LUPB 2DMIA 1J26A 5DRTA 4P72A 3ZKCA 3DSQA 2J7JA 2OFYA 4WXDA 4Y42A 2V88A 1EH7A 2ODRC 3JTZA 4NHRA 4LVIA 2DIXA 2FV4B 2LYRA 2DTOA 3EFRA 4H2VA 4DMIA 4WSPA 3VQVA 2BBGA 5KL3A 5ELOA 3C6MA 2EPRA 3HXXA 4YRMA 3ME5A 1AH5A 2NUEA 2RS7A 3HPZA 4MLQA 3RUXA 4P74C 2EMBA 3PZCA 1JK1A 2QHSA 1BDHA 2EN8A 3MEYA 1VPWA 5C53B 2P0LA 2A6CA 3R07A 2VRDA 4XTUA 4XU0A 4EQZA 1NJ6A 1G51A 4KQEA 4JI6E 1X5WA 4X4IA 3THOB 1JWLA 4P74A 2E5LE 1JJCA 3MHHC 1QNTA 4IA8A 2MEZA 3V8KA 1T38A 1KMMA 4ZYGA 1EKZA 4X4EA 5FLXC 1XNRE 2BJCA 1B76A 5KL4A 3MF1A 2EN4A 1EH8A 3VBBA 2YTJA 1FJGE 3RMPA 2M4IA 4P3PA 4X65E 5DSXA 4LF5E 4LNSA 2LVHA 4YRCA 5ELNA 2L2KB 1JK2A 2RSMA 2PXPA 2A8EA 3J80C 4P73C 2EWTA 3ADJA 1A1HA 2AMCA 4BWAA 3H5TA 4P78A 3BDNA 3E9IA 1PJTA 4I8OA 3RGLA 2LMZA 5C51B 1SESA 1MEYC 3QOXA 2EMKA 2DJZA 1Z7MA 1LQCA 2WZOA 4P73A 3HY0A 1G5IA 3KZ3A 2ENCA 2NA2A 3ZHIA 1HC7A 4B3TE 2C7IA 1N33E 2EJFA 4RQFA 4YRIA 1ZZCA 2AXZA 2DLQA 2HJJA 1PYSA 2IU7A 2PUGA 2EPPA 2EMCA 4J8ZA 2GLIA 2PUEA 1ZPQA 3DM5A 3OMTA 3M4QA 5TSEA 3U3WA 4Z5HA 1UXCA 1YFRA 1H4TA 4TVYA 3KZYA 4JCXA 3NROA 1WH8A 2EBYA 4PU3C 1NJ8A 3TEGA 5CFFE 4IWRA 2I4NA 2FJRA 2EPLX 1G2DC 5ADZA 2Q5IA 2HFZA 2IY5A 4O24A 4Z5DA 2PXQA 2V3CC 5AE1A 4XU1A 3KXAA 2EWLA 1XMQE 4R2SA 1WHNA 3HXLA 4H2YA 4KZSA 1IBLE 2DQ0A 4BHBA 5A6BA 2J3LA 3EPJA 2I9IA 2PUCA 2F4VE 3TRBA 1X49A 4Q35B 4BBYA 3BD1A 4JI8E 2UXCE 4DR3E 3R09A 4X66E 4EKIA 2EPNA 1YYKA 1WRJA 1KYQA 3GN5A 2BNNA 1JH9A 4DPGA 3QFIA 2MC5A 2E1MA 2EPAA 4R2RA 2LYQA 2MXDA 2YU8A 2EMYA 1X6FA 1HQ1A 4I6TA 2NS6A 2N8XA 2VQFE 1DW9A 1A1GA 1R69A 1T4NA 2CSFA 3M9LA 2PRTA 2EM0A 5IV8B 2EOJA 2EOMA 2YBDA 2JYAA 2AW6A 1XNQE 2EJ4A 4LF6E 2R76A 2FYKA 3RKXA 3VQYA 1UBDC 2ARTA 2MKDA 2L92A 2MDRA 3FYMA 3QQ6A 1RPEL 3V7RA 3CROL 2HINA 2LRSA 4GEQB 3MF2A 3KZZA 4L87A 3EFSA 3QF3A 4B3SE 4X64E 2ZNJA 2V89A 3A32A 2KEIA 4GQMA 2M7QA 1H4SA 4WPYA 1ZR9A 3A7RA 1GZ6A 4XTVA 4YG1A 1QQAA 12ASA 3RKYA 1X47A 3OQOA 1EQRA 1T4LB 4Z58A 4MCXA 4DE9A 2Q7HA 2PMFA 4DV3E 2EOHA 3T1HE 4FBIA 4DR4E 4GKKE 4ZTUB 1POUA 4LVLA 5DTMA 3J7Yp 2LT7A 1ASYA 1YFHA 1HTTA 3LSQA 1UHZA 1B7YA 1SFEA 1YYWA 4DR7E 2R63A 2B7VA 2DTIA 2DTHA 2V8QB 1A1KA 2EF8A 1GTKA 3QTCA 1WLEA 2UUBE 4TVAA 2EOXA 4CS4A 4HVCA 3NZLA 4H2XB 2GZUA 1B69A 2DZ9A 4WI1A 2WBUA 3UGTA 3A9XA 2V86A 4OBMA 4ZYHA 1XMOE 4JI0E 2B3TB 2YTOA 2ZGWA 3UGQA 2CTDA 2EPCA 3HY1A 4DUZE 1IQOA 3UWPA 3WQZA 4P75A 4XU3A 2UXDE 2ENAA 4JV5E 4YRKA 1AAYA 2ENHA 4BS9A 3NXHA 4J15A 2QHTA 2YRMA 2LJHA 11ASA 3FIGA 4ZIBA 3HZIB 1NEIA 4YCUA 1H4QA 5DNYA 4KR3A 1E1TA 4DQ2A 4JQDA 2AXUA 2JPAA 4RMFA 1SQ8A 3LLHA 4YRSA 3L4GA 4CS3A 3F6GA 3LSSA 4TVWA 1RZRD 2AWIA 4X8WA 2L6MA 4X4DA 4YP0A 1WJPA 2AMCB 2H8RA 1GT0C 2ADRA 4HA8A 2LCVA 1IMUA 3QO5A 1AU7A 1NJ2A 5AC4A 3RF1A 1IBME 2IHR1 1QZXA 1HNWE 5BR8E 3H09A 2CROA 3QNEA 3KFUA 4O8BA 5AE2A 2DMYA 2DU7A 2ZT5A 1PYSB 2EMIA 2LYJA 1CJGA 3GBFA 3IVPA 4OP0A 4X62E 2HNIA 3HFVA 1EIYB 1JFTA 1HR0E 4O2DA 2LYPA 1WETA 4K88A 1BBUA 2K7IA 4XU2A 4MLVA 4R2QA 4JI3E 2BB8A 4LFAE 2E3CA 4DR1E 1ASZA 4RHBB 2IY5B 3HXWA 4TUGA 1FYFA 4PG3A 4H2SA 4F9AB 4WX9A 2EPKX 1IL2A 2EOZA 3L00A 1DI2A 1UILA 4TQDA 1IQSA 2VE7C 3IWBA 3FYAA 2ZINA 2EJ9A 5LLQA 1WNLA 1A1IA 3FJPA 1KJKA 3A7AA 2YTDA 4GKJE 1WXRA 1NJ5A 4TTVA 2PXDA 2HCSA 3F6WA 3BJUA 4I6RA 3ZHMA 3TEPA 2EOYA 1NERA 4I8TA 2XSDC 4N4RB 4CH3A 3AV0A 4ZYDA 2JOXA 1QP0A 1CQTA 4J1XA 2I13A 1YUJA 3UH0A 4JI7E 1E22A 2EP3A 1EVLA 2D5VA 1USYC 2DQ3A 3IKMB 4YY3E 2JQEA 2PXBA 2Q8UA 3CLCA 4EK9A 1TN9A 4XTWA 3DF6A 2KOUA 2EORA 1QE0A 2PUDA 5A7LA 3VHTB 4R2AA 3P8TA 4YPFA 2LYLA 3MSWA 1ZZ6A 5T6JA 1USYA 4R8OA 4F6MA 1YUIA 3M99B 4DR6E 1F2IG 1X56A 1QB2A 5DT2A 2KONA 2YZTA 4P71A 1EH6A 3A5ZA 4DE8A 2CJBA 3OQMA 2KEJA 2PXLA 3GZDC 4DV2E 3PCOA 2I4MA 1PRUA 3TFLA 2DKGA 1XWRA 2LNMA 3R1FA 2DDZA 1B7YB 2YRKA 4YBAA 2NUFA 4OB4A 3F52A 4OX9E 1OSLA 1MGTA 3W3SA 3GZDA 4TVAB 3C6KA 3PE5A 4BHCA 4M0VA 4PU4C 2VQEE 1SETA 1ZVVA 3REXA 1ZS4A 1MFQC 2I4LA 4DV5E 2O4AA 3ADIA 1YYOA 3PXPA 5E3IA 4LVJA 4AH6A 2EM3A 2JP9A 4JI1E 3QOWA 4XEMA 2M9AA 4KHPE 4I6UA 1O4XA 1A1FA 1R63A 3CMQA 1GGMA 1RMDA 2N3HA 4L5NC 2O49A 3A7UA 2EOFA 3SCHA 4F6NA 3KJXA 3B7HA 3OKZA 1N34E 2QHVA 1SRYA 2ZT8A 2EOQA 1YPNA 2HSGA 1PKPA 1UN6B 2PPXA 3V7CA 2EM2A 4DR5E 1GQEA 4JI2E 3V7SA 4Z5CA 2A25A 2LUQA 3L4GB 2ZXFA 2LLVA 1A1LA 3KL4A 4IS1C 4XTZA 5F3WA 2JY9A 3P8YA 5KL2A 2B5AA 3I7FA 2P5IA 1Z7NA 4CS2A 3RZZA 2WBSA 1YFSA 1PRVA 4M9VC 2ZR2A 3A9ZA 2EMXA 2ELYA 1BIBA 3VQXA 4BC7A 2E1HA 3HRKA 2EMFA 1X57A 2HHHE 1T39A 1B70A 1KMNA 1ZBQA 1X2HA 4WFTA 3TEHA 4BMJA 2XCJA 4H2WA 3L1AA 2ZCEA 4XEOA 3EPLA 3SX0A 1QPZA 5AASA 3G7DA 2AKWA 2RHQA 3A9YA 3ZPXA 4HRAA 1E1OA 1OCTC 2ALYB 2L8TA 4DUYE 2DU5A 1WYDA 5KL5A 3HXYA 2KPJA 2V83A 4O5GA 3NDBB 4X5OA 3RL6A 4EZIA 2RS6A 5AE3A 1QU6A 2GRMA 1P47A 4NZVA 4YRLA 1HF0A 3O9XA 3G0TA 3HRIA 3HXZA 4DV0E 2EE8A 4HWSA 4R2EA 4YREA 3GUUA 1LLIA 2ODRD 2JWOA 4UPAA 3REUA 5A6JA 2CT1A 4UP8A 4HTGA 3TQMA 5KL6A 4P75C 1JFSA 2EL6A 1X2LA 3BF2A 1IBKE 4JYAE 2RQLA 3P1XA 4F54A 2L8NA 4IJDA 4X4CA 1STUA 5IWAE 2E5AA 2ARSA 4YRGA 1JJCB 5A6AA 3J81C 4CH4A 2MDGA 2LE2A 4G84A
chains in the Genus database with same CATH topology
4LFCE 4JI3E 2Q7GA 4BWAA 4LFAE 2E3CA 4DR1E 1ASZA 2IY5B 4P78A 1YFTA 3HXWA 3E9IA 4TUGA 1FYFA 1SERA 3DJWA 4I8OA 4JI5E 2LMZA 3RGLA 5C51B 1SESA 4PG3A 4H2SA 5LMNE 4RQEA 3QOXA 2L3CA 2DJZA 3F6HA 1Z7MA 4OOGC 4Q15A 4F9AB 2WZOA 4P73A 3K6QA 1IL2A 3HY0A 1G5IA 3MQZA 3LC0A 1DI2A 1UILA 2NA2A 4TQDA 1X55A 1HC7A 4B3TE 2C7IA 2DVEA 1N33E 2EJFA 4CH5A 4RQFA 3V8LA 4YRIA 2VE7C 3IWBA 1X01A 2UXBE 3BFMA 5KNNA 3ZOQB 2ZINA 1O0WA 2EJ9A 4P3OA 2J7WA 1HXDA 3HTXA 2JOBA 2ZZEA 2ZIMA 1WNLA 3ADLA 1PYSA 5DTQA 4B3ME 2RTXA 4J8ZA 2EAYA 2EJGA 3FJPA 4G84A 3M4QA 1WQWA 1U2ZA 2E41A 2Q5HA 3A7AA 2ZZGA 2RHSA 2XXQA 1NW3A 1YFRA 4Q28A 4H2UA 1H4TA 4GKJE 4TVYA 1EOVA 3JAMC 1WXRA 3HQ1A 3NROA 2V87A 2I4OA 1NJ5A 4K87A 4TTVA 1NJ8A 3TEGA 5CFFE 4DR2E 2I4NA 3IWDA 3IG2A 2H36X 4BC9A 1N9WA 2HCSA 2L2MA 3BJUA 5ADZA 3NENA 2Q5IA 2HFZA 2ZM6E 3TEPA 3T1YE 2DXUA 2IY5A 2J3MA 4G85A 4TWAA 5AE1A 4CH3A 4XU1A 4ER7A 2EWLA 2E64A 4HWRA 1XMQE 1NJ1A 3AV0A 2JOXA 4OLFA 3VK6A 3ICAA 1WHNA 3HXLA 4H2YA 4KZSA 1IBLE 2DQ0A 4AQYE 3HXVA 1YZ9A 3UH0A 4JI7E 1E22A 2J3LA 4ER0A 2F4VE 1EVLA 3SR4A 1X49A 4BBYA 1USYC 2DQ3A 3IKMB 4UP9A 4JI8E 2CJAA 2UXCE 4YRFA 4YY3E 4YHHE 4DR3E 4YRRA 1G5HA 4E51A 4B3RE 1WHQA 4DKKA 5F5WA 4YDQA 4EKGA 2CJ9A 3R09A 4X66E 1NYRA 3IWCA 3A5YA 4EK9A 4P7DA 4XTWA 4EKIA 2UUCE 1QF6A 1YYKA 1HNZE 1VQZA 2E10A 2DB2A 3DF6A 5IT9C 4YCVA 2KOUA 3QO8A 4DV6E 4LVKA 1QE0A 4TQFA 4DPGA 4HWTA 2ZR3A 3QFIA 2MC5A 3IALA 1H4VB 3OMLA 3P8TA 4YPFA 5K1PA 2E1MA 1ZBTA 2YT4A 3NETA 3MSWA 1C0AA 4YRPA 2C8MA 5T6JA 2JVAA 5K1XA 1USYA 4LF8E 4CH6A 4R8OA 2J7UA 3LMLA 2MXDA 1X2GA 3QO7A 4HWPA 3J7AG 4R03A 4DR6E 2NS6A 1ADJA 1X56A 5DT2A 1J5WA 2KONA 2VQFE 4F9CB 2YZTA 4P71A 5A2QC 3A5ZA 4DE8A 2CJBA 2UUAE 1T4NA 2E65A 3M9LA 2L33A 3MEJA 1NYQA 2EL9A 3GZDC 4DV2E 3PCOA 2I4MA 3TUPA 2ZNIA 3TFLA 3JU0A 2DKGA 2LLWA 4WF2A 1LYLA 2LNMA 3HTZA 2DDZA 2YBDA 1B7YB 4YRTA 1XNQE 1T4OA 2VF1A 4LF6E 1RQ0A 3E9HA 2FYKA 4DV1E 3P8VA 3RKXA 4Q6GA 3VQYA 4KR2A 5LL6R 2NUFA 2M4HA 2ARTA 4WVLA 2L92A 4OX9E 4BCAA 2MDRA 3A31A 2CIMA 3W3SA 4L8NA 3V7RA 3GZDA 4P3NA 2LRSA 2G4CA 4TVAB 3PE5A 3VWSA 4GEQB 3ERRA 3MF2A 4ER5A 4L87A 4M0VA 2QHUA 3EFSA 4NXNE 2VQEE 3C4TA 4LF7E 1SETA 4B3SE 2KHXA 4X64E 1E24A 2ZNJA 3HFZB 1WU7A 1WPYA 2NUGA 2V89A 3A32A 1BIAA 3REXA 4YRJA 3VQWA 3RKWA 2M7QA 1I94E 4WPYA 4LFBE 2FTXB 1H4SA 2ZT7A 4H2XA 1NNHA 4WJ4A 2I4LA 4DV5E 3A7RA 1GZ6A 4XTVA 2M1SA 12ASA 3V8JA 3PCOB 3ADIA 3RKYA 1X47A 2K4VA 1YYOA 5E3IA 4LVJA 4AH6A 4ZTZB 1EQRA 1T4LB 4JI1E 3QOWA 1YB3A 4XEMA 4DV7E 1HNXE 1B8AA 4KHPE 2B7TA 4DE9A 2UU9E 2Q7HA 2PMFA 3CMQA 4DV3E 3T1HE 4DR4E 4GKKE 1B70B 1GGMA 5HGQA 4ZTUB 2N3HA 4LVLA 5DTMA 3J7Yp 4L5NC 3TEHB 3OWQA 3A7UA 1ASYA 2EWNA 1HTTA 2ZZFA 3GZCA 1YGBA 2DXTA 2L1PA 4EX5A 1FKAE 3OKZA 1N34E 1WQ7A 2QHVA 2V85A 3LSQA 1SRYA 3UFGA 2ZT8A 3OTOE 4K0KE 3RACA 1UHZA 1B7YA 2LTRA 1PKPA 2XTIA 2XXPA 2AKWB 1YYWA 4P72C 2RHQB 4DR7E 2L2NA 2B7VA 2DTIA 2DTHA 4P71C 3V7CA 2V8QB 4DR5E 1X54A 2ZTGA 1W66A 1GQEA 4YRNA 4JI2E 2DZCA 2Q7EA 3V7SA 1L0WA 2LUQA 4LTYA 1RC7A 3L4GB 2ZXFA 3M4PA 3QTCA 4UP7A 2LLVA 1RIQA 2XGTA 4RDXA 4EO4A 1WLEA 2MC6A 2UUBE 2PMEA 4TVAA 4HWOA 4JI4E 2VEOA 3NEMA 4CS4A 4ER3A 2N3GA 4HVCA 5C52B 3NZLA 2ALYA 3A74A 4H2XB 1BBWA 1N36E 4NCXA 3TELA 2DZ9A 4XTZA 1ADYA 4DV4E 5F3WA 1N32E 2JY9A 2CPNA 4LU9A 3A9XA 3P8YA 4WI1A 3UGTA 2FGGA 4WYQB 2LUPB 3I7FA 1J26A 2P5IA 2V86A 4OBMA 3HFZA 1XMOE 1Z7NA 5DRTA 4P72A 4JI0E 3DSQA 4CS2A 2B3TB 3HPSA 2ZGWA 3UGQA 1YFSA 2V88A 3HY1A 2ZR2A 4DUZE 3UWPA 3A9ZA 2ODRC 3JTZA 3WQZA 4F9BB 4P75A 1BIBA 4XU3A 3VQXA 4BC7A 2UXDE 4JV5E 4K86A 4YRKA 2E1HA 2DIXA 2FV4B 4LVIA 3HRKA 2DTOA 3EFRA 1KOGA 4H2VA 4BS9A 4DMIA 2HHHE 4WSPA 4H2TA 3VQVA 4YYEA 3NXHA 4J15A 5ELOA 1B70A 2QHTA 1KMNA 1ZBQA 1X2HA 4WFTA 4M30A 3TEHA 3HXXA 4YRMA 3ME5A 2LJHA 4BW9A 11ASA 2NUEA 3FIGA 4ZIBA 2RS7A 4BMJA 3HPZA 4H2WA 3IKLA 3L2ZA 3L1AA 3RUXA 2ZCEA 4XEOA 4P74C 5JUWA 4YCUA 3PZCA 3SX0A 2B9DA 5AASA 2QHSA 5DNYA 4LF4E 1H4QA 2AKWA 1E1TA 3MEYA 4KR3A 2RHQA 5C53B 3A9YA 5DRYA 4HRAA 3ZPXA 2P0LA 4DQ2A 3VYYA 4NXME 1E1OA 4RMFA 3OD1A 2ALYB 3LLHA 3HXUA 3R07A 4YRSA 2L8TA 4DUYE 2DU5A 4XTUA 3C4BA 4EQZA 1WYDA 2ARUA 4XU0A 3L4GA 4Q2JA 3HXYA 4M2ZA 4PHCA 3F6GA 4CS3A 2V83A 1NJ6A 3LSSA 4TVWA 1G51A 4KQEA 4JI6E 4X5OA 3RL6A 1DQ3A 2DEQA 4X8WA 2L6MA 4EZIA 2RS6A 1EIYA 3NELA 4YP0A 3RIRA 5AE3A 2AMCB 4H02A 1SR9A 2ZT6A 4HA8A 4LF9E 1EFWA 1QU6A 1X48A 3G1ZA 4P74A 4XTXA 4WJ3M 2E5LE 4YRLA 1JJCA 2LTSA 3G0TA 2LBSB 3HRIA 3QO5A 3HXZA 3V8KA 1KMMA 1NJ2A 3RF1A 2ZIOA 1EKZA 1IBME 2IHR1 3ADGA 4DV0E 4YCWA 5FLXC 1XNRE 1B76A 4ER6A 3KWRA 4HWSA 2JR1A 4YROA 3MF1A 4YREA 1J5EE 3GUUA 2DSYA 1HNWE 5BR8E 3H09A 3VBBA 2ODRD 3QNEA 3KFUA 2JWOA 4UPAA 5AE2A 2CGHA 3REUA 2DMYA 1FJGE 2G7HA 3RMPA 2DU7A 4UP8A 4XTYA 2M4IA 2ZT5A 4LVMA 1PYSB 4P3PA 4X65E 3AUZA 5DSXA 4TUIA 4LF5E 2F8BA 5LMUE 2EZ6A 4P75C 4OP0A 4LNSA 4X62E 3VYXA 4YRCA 2RHSB 2HNIA 1EVKA 1IBKE 3HFVA 4JYAE 1EIYB 5ELNA 2L3JA 2L2KB 3P1XA 2RSMA 1HR0E 2A8EA 4YRQA 4F54A 4O2DA 3J80C 4P73C 1STUA 5DTRA 4HT4A 5IWAE 2E5AA 2ARSA 4K88A 1BBUA 4YRGA 1JJCB 2HCNA 3ADJA 4XU2A 3J81C 4CH4A 2AMCA 2LE2A 1ATIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7G A;  4BWA A;  2E3C A;  1ASZ A;  2IY5 B;  1YFT A;  3HXW A;  3E9I A;  1FYF A;  1SER A;  3RGL A;  5C51 B;  1SES A;  4PG3 A;  4H2S A;  4RQE A;  2DJZ A;  1Z7M A;  4Q15 A;  4P73 A;  1IL2 A;  3HY0 A;  1G5I A;  3LC0 A;  4TQD A;  1X55 A;  1HC7 A;  2C7I A;  2DVE A;  4CH5 A;  2EJF A;  4RQF A;  3V8L A;  4YRI A;  1X01 A;  5KNN A;  3BFM A;  2ZIN A;  2EJ9 A;  4P3O A;  1HXD A;  2ZZE A;  2ZIM A;  1WNL A;  1PYS A;  2EAY A;  2EJG A;  3FJP A;  3M4Q A;  1WQW A;  2E41 A;  2Q5H A;  3A7A A;  2ZZG A;  2RHS A;  1YFR A;  4H2U A;  1H4T A;  4TVY A;  1EOV A;  2I4O A;  1NJ5 A;  4K87 A;  4TTV A;  1NJ8 A;  3TEG A;  2I4N A;  3IG2 A;  1N9W A;  3BJU A;  3NEN A;  2Q5I A;  2DXU A;  2IY5 A;  2J3M A;  4G85 A;  4TWA A;  4CH3 A;  4XU1 A;  2E64 A;  4HWR A;  1NJ1 A;  4OLF A;  3ICA A;  4H2Y A;  2DQ0 A;  3HXV A;  3UH0 A;  2J3L A;  1E22 A;  1EVL A;  1USY C;  2DQ3 A;  3IKM B;  4UP9 A;  2CJA A;  4YRF A;  4YRR A;  4E51 A;  1G5H A;  5F5W A;  4YDQ A;  2CJ9 A;  1NYR A;  3A5Y A;  4XTW A;  1QF6 A;  1VQZ A;  4YCV A;  2E10 A;  3QO8 A;  1QE0 A;  4TQF A;  4DPG A;  4HWT A;  2ZR3 A;  3IAL A;  1H4V B;  3P8T A;  4YPF A;  5K1P A;  3NET A;  1C0A A;  4YRP A;  2C8M A;  5K1X A;  1USY A;  4CH6 A;  1X2G A;  3QO7 A;  4HWP A;  1ADJ A;  1X56 A;  1J5W A;  4P71 A;  3A5Z A;  2CJB A;  2E65 A;  1NYQ A;  2EL9 A;  3PCO A;  2I4M A;  3TUP A;  2ZNI A;  2DKG A;  4WF2 A;  1LYL A;  3HTZ A;  2DDZ A;  4YRT A;  1B7Y B;  3E9H A;  2FYK A;  3P8V A;  3RKX A;  4Q6G A;  3VQY A;  4KR2 A;  2ART A;  3A31 A;  2CIM A;  3W3S A;  3V7R A;  4P3N A;  2G4C A;  4TVA B;  3ERR A;  3MF2 A;  4L87 A;  2QHU A;  3EFS A;  1SET A;  2ZNJ A;  1E24 A;  3HFZ B;  1WU7 A;  1WPY A;  3A32 A;  1BIA A;  3REX A;  4YRJ A;  3VQW A;  3RKW A;  1H4S A;  2ZT7 A;  4H2X A;  1NNH A;  4WJ4 A;  2I4L A;  3A7R A;  4XTV A;  12AS A;  3V8J A;  3PCO B;  3RKY A;  5E3I A;  4AH6 A;  4ZTZ B;  1EQR A;  1YB3 A;  4XEM A;  1B8A A;  2Q7H A;  2PMF A;  3CMQ A;  1B70 B;  1GGM A;  5HGQ A;  4ZTU B;  3TEH B;  1ASY A;  3A7U A;  2EWN A;  1HTT A;  2ZZF A;  1YGB A;  2DXT A;  4EX5 A;  3LSQ A;  1WQ7 A;  2QHV A;  3UFG A;  1SRY A;  2ZT8 A;  3RAC A;  1B7Y A;  2XTI A;  2AKW B;  4P72 C;  2RHQ B;  2DTI A;  2DTH A;  4P71 C;  3V7C A;  1X54 A;  2ZTG A;  4YRN A;  1W66 A;  2DZC A;  2Q7E A;  3V7S A;  1L0W A;  3QTC A;  3L4G B;  3M4P A;  2ZXF A;  4UP7 A;  1RIQ A;  2XGT A;  4RDX A;  4EO4 A;  1WLE A;  2PME A;  4TVA A;  4HWO A;  3NEM A;  4CS4 A;  5C52 B;  4HVC A;  2ALY A;  3A74 A;  4H2X B;  1ATI A;  1BBW A;  4NCX A;  2DZ9 A;  4XTZ A;  1ADY A;  4WI1 A;  3UGT A;  3P8Y A;  3I7F A;  2P5I A;  3HFZ A;  1Z7N A;  4P72 A;  3DSQ A;  4CS2 A;  2ZGW A;  3UGQ A;  1YFS A;  3HY1 A;  2ZR2 A;  2ODR C;  3WQZ A;  4P75 A;  1BIB A;  4XU3 A;  3VQX A;  4K86 A;  4YRK A;  2E1H A;  3HRK A;  2DTO A;  3EFR A;  1KOG A;  4H2V A;  3VQV A;  4H2T A;  4YYE A;  4J15 A;  5ELO A;  1B70 A;  2QHT A;  1KMN A;  1X2H A;  3TEH A;  3HXX A;  4YRM A;  4BW9 A;  11AS A;  4ZIB A;  4H2W A;  3IKL A;  3L2Z A;  3L1A A;  3RUX A;  2ZCE A;  4XEO A;  4P74 C;  4YCU A;  3PZC A;  1H4Q A;  2QHS A;  4KR3 A;  2AKW A;  1E1T A;  3MEY A;  2RHQ A;  5C53 B;  4DQ2 A;  2P0L A;  1E1O A;  4RMF A;  3OD1 A;  2ALY B;  3HXU A;  3R07 A;  4YRS A;  2DU5 A;  4XTU A;  4XU0 A;  1WYD A;  2ARU A;  3L4G A;  3HXY A;  4PHC A;  4CS3 A;  1NJ6 A;  3LSS A;  4TVW A;  1G51 A;  4KQE A;  4X5O A;  3RL6 A;  2DEQ A;  1EIY A;  3NEL A;  4YP0 A;  3RIR A;  2AMC B;  4H02 A;  2ZT6 A;  4HA8 A;  1EFW A;  3G1Z A;  4P74 A;  4XTX A;  4WJ3 M;  4YRL A;  1JJC A;  3HRI A;  3QO5 A;  3HXZ A;  3V8K A;  1KMM A;  1NJ2 A;  3RF1 A;  2ZIO A;  4YCW A;  1B76 A;  4HWS A;  4YRO A;  3MF1 A;  4YRE A;  3VBB A;  2ODR D;  3QNE A;  3KFU A;  4UPA A;  2CGH A;  3REU A;  2DU7 A;  4UP8 A;  4XTY A;  2ZT5 A;  1PYS B;  4P3P A;  4P75 C;  4OP0 A;  4LNS A;  4YRC A;  2RHS B;  2HNI A;  1EVK A;  3HFV A;  1EIY B;  5ELN A;  4YRQ A;  4O2D A;  4P73 C;  2E5A A;  2ARS A;  4K88 A;  1BBU A;  4YRG A;  1JJC B;  4XU2 A;  4CH4 A;  2AMC A;  4G84 A; 
#chains in the Genus database with same CATH topology
 2PXK A;  2Q7G A;  2JXP A;  1YFT A;  3CEC A;  1SER A;  4F8D A;  2L3C A;  4X9J A;  1IC8 A;  3BGH A;  1X55 A;  2DVE A;  4CH5 A;  2EOS A;  3V8L A;  2EML A;  3BBG A;  1X01 A;  2UXB E;  3BFM A;  5KNN A;  1BDI A;  1X3C A;  2EPX A;  4R2D A;  1HXD A;  2ZZE A;  3ADL A;  2EJG A;  1DGC A;  1WQW A;  2LYS A;  2ZZG A;  2RHS A;  1EOV A;  3HQ1 A;  2V87 A;  2I4O A;  4DR2 E;  2E72 A;  3IG2 A;  2H36 X;  4BC9 A;  3JXB C;  1X6H A;  4NDW A;  3T1Y E;  2DXU A;  4TWA A;  3BS3 A;  1ZAY A;  4ER7 A;  2E64 A;  4HWR A;  4RH8 A;  1NJ1 A;  2RSI A;  4X4H A;  2BNO A;  4OLF A;  1L4S A;  1RZS A;  1BB8 A;  1NEQ A;  2AUW A;  2YRH A;  2BNM A;  2PUF A;  4UP9 A;  4YRR A;  4B3R E;  1WHQ A;  4KWY A;  5F5W A;  4WXC A;  4YDQ A;  4EKG A;  1NYR A;  1PDA A;  2EMW A;  1VQZ A;  4YCV A;  5IT9 C;  1WIZ A;  3QO8 A;  4LVK A;  4HEI A;  2ZR3 A;  3BID A;  3IAL A;  5K1P A;  1ZBT A;  2EQ3 A;  2YTE A;  1PRA A;  2JVA A;  2PXU A;  4HWP A;  4R03 A;  1QP7 A;  1ADJ A;  1PJS A;  2UUA E;  2E65 A;  3MEJ A;  2YTI A;  5A6B D;  4J1W A;  2PXT A;  2ZNI A;  4GZN C;  4ZYE A;  2LCE A;  4WF2 A;  1QQB A;  1LYL A;  3DNV B;  3HTZ A;  1T4O A;  2VF1 A;  2EMA A;  4Q6G A;  3GN5 B;  5LL6 R;  1ZZ8 A;  4BCA A;  1BBO A;  1ZZ7 A;  2YPN A;  3VWS A;  2WCC 3;  2YSP A;  4NXN E;  3S8Q A;  1E24 A;  3QG5 C;  2NUG A;  4WSG A;  2DRP A;  1I94 E;  4LFB E;  4H2X A;  4WJ4 A;  2PUB A;  2EM9 A;  1N3G A;  2K4V A;  4ZTZ B;  1YB3 A;  1HNX E;  2OR1 L;  2EL5 A;  2UU9 E;  4R2P A;  1B70 B;  5HGQ A;  2EOI A;  3OWQ A;  3TEH B;  2KZ8 A;  3LFP A;  2ZZF A;  1DWK A;  1FKA E;  2WUS R;  2V85 A;  4K0K E;  3RAC A;  2LTR A;  4YG4 A;  2XTI A;  2AKW B;  4YAR A;  2RHQ B;  2L2N A;  2DLK A;  2EN3 A;  4P71 C;  2EPM X;  4GHJ A;  1X54 A;  2ZTG A;  1RC7 A;  3M4P A;  4UP7 A;  2YTN A;  2EOE A;  1TF3 A;  1RIQ A;  3JXC L;  2YU5 A;  1WH6 A;  2MC6 A;  4JI4 E;  2VEO A;  3NEM A;  4ER3 A;  3F51 A;  2N3G A;  2EQ0 A;  5C52 B;  3A74 A;  1N36 E;  4NCX A;  3TEL A;  1N32 E;  4WYQ B;  3HFZ A;  3FMY A;  1RZR A;  3HPS A;  1L1M A;  5A6K A;  2GPI A;  2L49 A;  1UTX A;  2R1F A;  2EM5 A;  3JXD L;  4F9B B;  4K86 A;  2CSH A;  2ELZ A;  1A1J A;  2EL4 A;  1KOG A;  3THN A;  4H2T A;  4YYE A;  1PER L;  2IVB A;  2EN6 A;  5GAG i;  4M30 A;  3SCG A;  4BW9 A;  3IKL A;  3MLF A;  3L2Z A;  2PXF A;  5JUW A;  1B0N A;  2B9D A;  4LF4 E;  2EN2 A;  1E3O C;  5DRY A;  3VYY A;  4NXM E;  3LIS A;  3OD1 A;  2EN7 A;  3HXU A;  3C4B A;  2ARU A;  4Q2J A;  4M2Z A;  2R1J L;  2EPZ A;  4PHC A;  4YG7 B;  2LO3 A;  1DQ3 A;  1PJQ A;  2DEQ A;  1EIY A;  3NEL A;  3RIR A;  2KEK A;  4H02 A;  1SR9 A;  2ZT6 A;  1ZU1 A;  4LF9 E;  1EFW A;  1X48 A;  3G1Z A;  4XTX A;  4WJ3 M;  3LQX A;  2YTP A;  5K98 B;  4MCT A;  2LTS A;  2LBS B;  1RIO A;  5GAH i;  2EQ1 A;  3UK3 C;  2ZIO A;  1YSA C;  1G2F C;  3ADG A;  4YCW A;  2LYK A;  4ER6 A;  3KWR A;  2JR1 A;  4YRO A;  4Z59 A;  1J5E E;  2PE5 A;  2WBT A;  2DSY A;  2IVQ A;  2CGH A;  2MQK A;  2G7H A;  1NCS A;  4XTY A;  4LVM A;  2PXE A;  3AUZ A;  4TUI A;  2F8B A;  5LMU E;  2EZ6 A;  4X4F A;  3VYX A;  3G5G A;  2RHS B;  1EVK A;  3EQ1 A;  2EMZ A;  1LMB 3;  1LCC A;  2L3J A;  4YRQ A;  1ZUG A;  1QP4 A;  5DTR A;  4HT4 A;  2HCN A;  1ATI A;  2JCG A;  4LFC E;  3OP9 A;  3QWG A;  2YTG A;  2WIU B;  3DJW A;  4JI5 E;  4F2J C;  5LMN E;  4RQE A;  4X4B A;  3F6H A;  4OOG C;  4Q15 A;  2D9H A;  3VK0 A;  3K6Q A;  5A69 A;  3MQZ A;  3LC0 A;  1BBG A;  2IV1 A;  3SCF A;  1Y7Y A;  4PU8 A;  2XIU A;  3ZOQ B;  3EPH A;  1O0W A;  4P3O A;  2J7W A;  3HTX A;  2JOB A;  2ZIM A;  5DTQ A;  4B3M E;  2RTX A;  2EAY A;  1U2Z A;  2E41 A;  3OQN A;  2Q5H A;  2XXQ A;  1NW3 A;  4Q28 A;  4H2U A;  2NAB A;  2YWQ A;  3JAM C;  2LJU A;  3EUS A;  1ZZ9 A;  4K87 A;  3L1P A;  3IWD A;  1N9W A;  1EFA A;  2XI8 A;  2L2M A;  3NEN A;  4FK5 C;  1UXD A;  2ZM6 E;  2EPU A;  2J3M A;  2PUA A;  4G85 A;  3ECR A;  2IUO A;  2GRL A;  3VK6 A;  3ICA A;  2EM8 A;  4AQY E;  3HXV A;  5IXM B;  1YZ9 A;  4ER0 A;  3SR4 A;  2CJA A;  5AC5 A;  4YRF A;  4YHH E;  1TF6 A;  1G5H A;  4E51 A;  4DKK A;  1Z1B A;  1DUL A;  2EM7 A;  2CJ9 A;  3IWC A;  1LLM C;  3A5Y A;  4P7D A;  2JVL A;  2UUC E;  1QF6 A;  1HNZ E;  2E10 A;  2DB2 A;  1YSE A;  4DV6 E;  4TQF A;  4HWT A;  1Y9Q A;  2LV2 A;  2YSO A;  1H4V B;  3OML A;  3NET A;  2YT4 A;  2ICT A;  1C0A A;  4YRP A;  2C8M A;  5K1X A;  2XJ3 A;  4LF8 E;  4CH6 A;  1PNR A;  2J7U A;  3LML A;  1X2G A;  3QO7 A;  3J7A G;  2YTQ A;  2AXV A;  1J5W A;  4F9C B;  5A2Q C;  3QYX A;  4O4K A;  3UFD A;  2L33 A;  2HGH A;  1NYQ A;  2EL9 A;  3TUP A;  1ZZB A;  3JU0 A;  2LLW A;  1X6E A;  4YRT A;  4FN3 A;  1RQ0 A;  2EPO A;  4O43 A;  3E9H A;  4DV1 E;  3P8V A;  4R2C A;  4KR2 A;  2M4H A;  4WVL A;  2EN1 A;  3A31 A;  2CIM A;  4L8N A;  2XXA A;  4P3N A;  2G4C A;  5KL7 A;  4IVZ A;  2FFH A;  3ERR A;  1ZAA C;  4ER5 A;  2QHU A;  3MHS C;  2YTF A;  3C4T A;  4LF7 E;  2KHX A;  3HFZ B;  1WU7 A;  4JCY A;  1WPY A;  1BIA A;  4YRJ A;  3VQW A;  3RKW A;  2FTX B;  2ZT7 A;  1NNH A;  2EOO A;  2M1S A;  3V8J A;  3PCO B;  4X4G A;  2O38 A;  2EMG A;  2RPC A;  4DV7 E;  1B8A A;  2B7T A;  2GHF A;  2IVG A;  1S7E A;  2ICP A;  2MKN A;  1LCD A;  2EWN A;  3D1N I;  3GZC A;  1YGB A;  2DXT A;  2PXV A;  2L1P A;  4EX5 A;  1WQ7 A;  3UFG A;  3OTO E;  2EM6 A;  2XXP A;  4P72 C;  2PIJ A;  4YRN A;  1W66 A;  1ADR A;  2EM4 A;  2DZC A;  2EMH A;  2Q7E A;  1L0W A;  4LTY A;  2XGT A;  4RDX A;  4EO4 A;  2PME A;  4HWO A;  2ALY A;  1BBW A;  1ADY A;  4DV4 E;  4PU7 A;  2CPN A;  4LU9 A;  2HC5 A;  2DGC A;  2FGG A;  3EPK A;  2LUP B;  2DMI A;  1J26 A;  5DRT A;  4P72 A;  3ZKC A;  3DSQ A;  2J7J A;  2OFY A;  4WXD A;  4Y42 A;  2V88 A;  1EH7 A;  2ODR C;  3JTZ A;  4NHR A;  4LVI A;  2DIX A;  2FV4 B;  2LYR A;  2DTO A;  3EFR A;  4H2V A;  4DMI A;  4WSP A;  3VQV A;  2BBG A;  5KL3 A;  5ELO A;  3C6M A;  2EPR A;  3HXX A;  4YRM A;  3ME5 A;  1AH5 A;  2NUE A;  2RS7 A;  3HPZ A;  4MLQ A;  3RUX A;  4P74 C;  2EMB A;  3PZC A;  1JK1 A;  2QHS A;  1BDH A;  2EN8 A;  3MEY A;  1VPW A;  5C53 B;  2P0L A;  2A6C A;  3R07 A;  2VRD A;  4XTU A;  4XU0 A;  4EQZ A;  1NJ6 A;  1G51 A;  4KQE A;  4JI6 E;  1X5W A;  4X4I A;  3THO B;  1JWL A;  4P74 A;  2E5L E;  1JJC A;  3MHH C;  1QNT A;  4IA8 A;  2MEZ A;  3V8K A;  1T38 A;  1KMM A;  4ZYG A;  1EKZ A;  4X4E A;  5FLX C;  1XNR E;  2BJC A;  1B76 A;  5KL4 A;  3MF1 A;  2EN4 A;  1EH8 A;  3VBB A;  2YTJ A;  1FJG E;  3RMP A;  2M4I A;  4P3P A;  4X65 E;  5DSX A;  4LF5 E;  4LNS A;  2LVH A;  4YRC A;  5ELN A;  2L2K B;  1JK2 A;  2RSM A;  2PXP A;  2A8E A;  3J80 C;  4P73 C;  2EWT A;  3ADJ A;  1A1H A;  2AMC A;  4BWA A;  3H5T A;  4P78 A;  3BDN A;  3E9I A;  1PJT A;  4I8O A;  3RGL A;  2LMZ A;  5C51 B;  1SES A;  1MEY C;  3QOX A;  2EMK A;  2DJZ A;  1Z7M A;  1LQC A;  2WZO A;  4P73 A;  3HY0 A;  1G5I A;  3KZ3 A;  2ENC A;  2NA2 A;  3ZHI A;  1HC7 A;  4B3T E;  2C7I A;  1N33 E;  2EJF A;  4RQF A;  4YRI A;  1ZZC A;  2AXZ A;  2DLQ A;  2HJJ A;  1PYS A;  2IU7 A;  2PUG A;  2EPP A;  2EMC A;  4J8Z A;  2GLI A;  2PUE A;  1ZPQ A;  3DM5 A;  3OMT A;  3M4Q A;  5TSE A;  3U3W A;  4Z5H A;  1UXC A;  1YFR A;  1H4T A;  4TVY A;  3KZY A;  4JCX A;  3NRO A;  1WH8 A;  2EBY A;  4PU3 C;  1NJ8 A;  3TEG A;  5CFF E;  4IWR A;  2I4N A;  2FJR A;  2EPL X;  1G2D C;  5ADZ A;  2Q5I A;  2HFZ A;  2IY5 A;  4O24 A;  4Z5D A;  2PXQ A;  2V3C C;  5AE1 A;  4XU1 A;  3KXA A;  2EWL A;  1XMQ E;  4R2S A;  1WHN A;  3HXL A;  4H2Y A;  4KZS A;  1IBL E;  2DQ0 A;  4BHB A;  5A6B A;  2J3L A;  3EPJ A;  2I9I A;  2PUC A;  2F4V E;  3TRB A;  1X49 A;  4Q35 B;  4BBY A;  3BD1 A;  4JI8 E;  2UXC E;  4DR3 E;  3R09 A;  4X66 E;  4EKI A;  2EPN A;  1YYK A;  1WRJ A;  1KYQ A;  3GN5 A;  2BNN A;  1JH9 A;  4DPG A;  3QFI A;  2MC5 A;  2E1M A;  2EPA A;  4R2R A;  2LYQ A;  2MXD A;  2YU8 A;  2EMY A;  1X6F A;  1HQ1 A;  4I6T A;  2NS6 A;  2N8X A;  2VQF E;  1DW9 A;  1A1G A;  1R69 A;  1T4N A;  2CSF A;  3M9L A;  2PRT A;  2EM0 A;  5IV8 B;  2EOJ A;  2EOM A;  2YBD A;  2JYA A;  2AW6 A;  1XNQ E;  2EJ4 A;  4LF6 E;  2R76 A;  2FYK A;  3RKX A;  3VQY A;  1UBD C;  2ART A;  2MKD A;  2L92 A;  2MDR A;  3FYM A;  3QQ6 A;  1RPE L;  3V7R A;  3CRO L;  2HIN A;  2LRS A;  4GEQ B;  3MF2 A;  3KZZ A;  4L87 A;  3EFS A;  3QF3 A;  4B3S E;  4X64 E;  2ZNJ A;  2V89 A;  3A32 A;  2KEI A;  4GQM A;  2M7Q A;  1H4S A;  4WPY A;  1ZR9 A;  3A7R A;  1GZ6 A;  4XTV A;  4YG1 A;  1QQA A;  12AS A;  3RKY A;  1X47 A;  3OQO A;  1EQR A;  1T4L B;  4Z58 A;  4MCX A;  4DE9 A;  2Q7H A;  2PMF A;  4DV3 E;  2EOH A;  3T1H E;  4FBI A;  4DR4 E;  4GKK E;  4ZTU B;  1POU A;  4LVL A;  5DTM A;  3J7Y p;  2LT7 A;  1ASY A;  1YFH A;  1HTT A;  3LSQ A;  1UHZ A;  1B7Y A;  1SFE A;  1YYW A;  4DR7 E;  2R63 A;  2B7V A;  2DTI A;  2DTH A;  2V8Q B;  1A1K A;  2EF8 A;  1GTK A;  3QTC A;  1WLE A;  2UUB E;  4TVA A;  2EOX A;  4CS4 A;  4HVC A;  3NZL A;  4H2X B;  2GZU A;  1B69 A;  2DZ9 A;  4WI1 A;  2WBU A;  3UGT A;  3A9X A;  2V86 A;  4OBM A;  4ZYH A;  1XMO E;  4JI0 E;  2B3T B;  2YTO A;  2ZGW A;  3UGQ A;  2CTD A;  2EPC A;  3HY1 A;  4DUZ E;  1IQO A;  3UWP A;  3WQZ A;  4P75 A;  4XU3 A;  2UXD E;  2ENA A;  4JV5 E;  4YRK A;  1AAY A;  2ENH A;  4BS9 A;  3NXH A;  4J15 A;  2QHT A;  2YRM A;  2LJH A;  11AS A;  3FIG A;  4ZIB A;  3HZI B;  1NEI A;  4YCU A;  1H4Q A;  5DNY A;  4KR3 A;  1E1T A;  4DQ2 A;  4JQD A;  2AXU A;  2JPA A;  4RMF A;  1SQ8 A;  3LLH A;  4YRS A;  3L4G A;  4CS3 A;  3F6G A;  3LSS A;  4TVW A;  1RZR D;  2AWI A;  4X8W A;  2L6M A;  4X4D A;  4YP0 A;  1WJP A;  2AMC B;  2H8R A;  1GT0 C;  2ADR A;  4HA8 A;  2LCV A;  1IMU A;  3QO5 A;  1AU7 A;  1NJ2 A;  5AC4 A;  3RF1 A;  1IBM E;  2IHR 1;  1QZX A;  1HNW E;  5BR8 E;  3H09 A;  2CRO A;  3QNE A;  3KFU A;  4O8B A;  5AE2 A;  2DMY A;  2DU7 A;  2ZT5 A;  1PYS B;  2EMI A;  2LYJ A;  1CJG A;  3GBF A;  3IVP A;  4OP0 A;  4X62 E;  2HNI A;  3HFV A;  1EIY B;  1JFT A;  1HR0 E;  4O2D A;  2LYP A;  1WET A;  4K88 A;  1BBU A;  2K7I A;  4XU2 A;  4MLV A;  4R2Q A;  4JI3 E;  2BB8 A;  4LFA E;  2E3C A;  4DR1 E;  1ASZ A;  4RHB B;  2IY5 B;  3HXW A;  4TUG A;  1FYF A;  4PG3 A;  4H2S A;  4F9A B;  4WX9 A;  2EPK X;  1IL2 A;  2EOZ A;  3L00 A;  1DI2 A;  1UIL A;  4TQD A;  1IQS A;  2VE7 C;  3IWB A;  3FYA A;  2ZIN A;  2EJ9 A;  5LLQ A;  1WNL A;  1A1I A;  3FJP A;  1KJK A;  3A7A A;  2YTD A;  4GKJ E;  1WXR A;  1NJ5 A;  4TTV A;  2PXD A;  2HCS A;  3F6W A;  3BJU A;  4I6R A;  3ZHM A;  3TEP A;  2EOY A;  1NER A;  4I8T A;  2XSD C;  4N4R B;  4CH3 A;  3AV0 A;  4ZYD A;  2JOX A;  1QP0 A;  1CQT A;  4J1X A;  2I13 A;  1YUJ A;  3UH0 A;  4JI7 E;  1E22 A;  2EP3 A;  1EVL A;  2D5V A;  1USY C;  2DQ3 A;  3IKM B;  4YY3 E;  2JQE A;  2PXB A;  2Q8U A;  3CLC A;  4EK9 A;  1TN9 A;  4XTW A;  3DF6 A;  2KOU A;  2EOR A;  1QE0 A;  2PUD A;  5A7L A;  3VHT B;  4R2A A;  3P8T A;  4YPF A;  2LYL A;  3MSW A;  1ZZ6 A;  5T6J A;  1USY A;  4R8O A;  4F6M A;  1YUI A;  3M99 B;  4DR6 E;  1F2I G;  1X56 A;  1QB2 A;  5DT2 A;  2KON A;  2YZT A;  4P71 A;  1EH6 A;  3A5Z A;  4DE8 A;  2CJB A;  3OQM A;  2KEJ A;  2PXL A;  3GZD C;  4DV2 E;  3PCO A;  2I4M A;  1PRU A;  3TFL A;  2DKG A;  1XWR A;  2LNM A;  3R1F A;  2DDZ A;  1B7Y B;  2YRK A;  4YBA A;  2NUF A;  4OB4 A;  3F52 A;  4OX9 E;  1OSL A;  1MGT A;  3W3S A;  3GZD A;  4TVA B;  3C6K A;  3PE5 A;  4BHC A;  4M0V A;  4PU4 C;  2VQE E;  1SET A;  1ZVV A;  3REX A;  1ZS4 A;  1MFQ C;  2I4L A;  4DV5 E;  2O4A A;  3ADI A;  1YYO A;  3PXP A;  5E3I A;  4LVJ A;  4AH6 A;  2EM3 A;  2JP9 A;  4JI1 E;  3QOW A;  4XEM A;  2M9A A;  4KHP E;  4I6U A;  1O4X A;  1A1F A;  1R63 A;  3CMQ A;  1GGM A;  1RMD A;  2N3H A;  4L5N C;  2O49 A;  3A7U A;  2EOF A;  3SCH A;  4F6N A;  3KJX A;  3B7H A;  3OKZ A;  1N34 E;  2QHV A;  1SRY A;  2ZT8 A;  2EOQ A;  1YPN A;  2HSG A;  1PKP A;  1UN6 B;  2PPX A;  3V7C A;  2EM2 A;  4DR5 E;  1GQE A;  4JI2 E;  3V7S A;  4Z5C A;  2A25 A;  2LUQ A;  3L4G B;  2ZXF A;  2LLV A;  1A1L A;  3KL4 A;  4IS1 C;  4XTZ A;  5F3W A;  2JY9 A;  3P8Y A;  5KL2 A;  2B5A A;  3I7F A;  2P5I A;  1Z7N A;  4CS2 A;  3RZZ A;  2WBS A;  1YFS A;  1PRV A;  4M9V C;  2ZR2 A;  3A9Z A;  2EMX A;  2ELY A;  1BIB A;  3VQX A;  4BC7 A;  2E1H A;  3HRK A;  2EMF A;  1X57 A;  2HHH E;  1T39 A;  1B70 A;  1KMN A;  1ZBQ A;  1X2H A;  4WFT A;  3TEH A;  4BMJ A;  2XCJ A;  4H2W A;  3L1A A;  2ZCE A;  4XEO A;  3EPL A;  3SX0 A;  1QPZ A;  5AAS A;  3G7D A;  2AKW A;  2RHQ A;  3A9Y A;  3ZPX A;  4HRA A;  1E1O A;  1OCT C;  2ALY B;  2L8T A;  4DUY E;  2DU5 A;  1WYD A;  5KL5 A;  3HXY A;  2KPJ A;  2V83 A;  4O5G A;  3NDB B;  4X5O A;  3RL6 A;  4EZI A;  2RS6 A;  5AE3 A;  1QU6 A;  2GRM A;  1P47 A;  4NZV A;  4YRL A;  1HF0 A;  3O9X A;  3G0T A;  3HRI A;  3HXZ A;  4DV0 E;  2EE8 A;  4HWS A;  4R2E A;  4YRE A;  3GUU A;  1LLI A;  2ODR D;  2JWO A;  4UPA A;  3REU A;  5A6J A;  2CT1 A;  4UP8 A;  4HTG A;  3TQM A;  5KL6 A;  4P75 C;  1JFS A;  2EL6 A;  1X2L A;  3BF2 A;  1IBK E;  4JYA E;  2RQL A;  3P1X A;  4F54 A;  2L8N A;  4IJD A;  4X4C A;  1STU A;  5IWA E;  2E5A A;  2ARS A;  4YRG A;  1JJC B;  5A6A A;  3J81 C;  4CH4 A;  2MDG A;  2LE2 A;  4G84 A; 
#chains in the Genus database with same CATH homology
 4LFC E;  4JI3 E;  2Q7G A;  4BWA A;  4LFA E;  2E3C A;  4DR1 E;  1ASZ A;  2IY5 B;  4P78 A;  1YFT A;  3HXW A;  3E9I A;  4TUG A;  1FYF A;  1SER A;  3DJW A;  4I8O A;  4JI5 E;  2LMZ A;  3RGL A;  5C51 B;  1SES A;  4PG3 A;  4H2S A;  5LMN E;  4RQE A;  3QOX A;  2L3C A;  2DJZ A;  3F6H A;  1Z7M A;  4OOG C;  4Q15 A;  4F9A B;  2WZO A;  4P73 A;  3K6Q A;  1IL2 A;  3HY0 A;  1G5I A;  3MQZ A;  3LC0 A;  1DI2 A;  1UIL A;  2NA2 A;  4TQD A;  1X55 A;  1HC7 A;  4B3T E;  2C7I A;  2DVE A;  1N33 E;  2EJF A;  4CH5 A;  4RQF A;  3V8L A;  4YRI A;  2VE7 C;  3IWB A;  1X01 A;  2UXB E;  3BFM A;  5KNN A;  3ZOQ B;  2ZIN A;  1O0W A;  2EJ9 A;  4P3O A;  2J7W A;  1HXD A;  3HTX A;  2JOB A;  2ZZE A;  2ZIM A;  1WNL A;  3ADL A;  1PYS A;  5DTQ A;  4B3M E;  2RTX A;  4J8Z A;  2EAY A;  2EJG A;  3FJP A;  4G84 A;  3M4Q A;  1WQW A;  1U2Z A;  2E41 A;  2Q5H A;  3A7A A;  2ZZG A;  2RHS A;  2XXQ A;  1NW3 A;  1YFR A;  4Q28 A;  4H2U A;  1H4T A;  4GKJ E;  4TVY A;  1EOV A;  3JAM C;  1WXR A;  3HQ1 A;  3NRO A;  2V87 A;  2I4O A;  1NJ5 A;  4K87 A;  4TTV A;  1NJ8 A;  3TEG A;  5CFF E;  4DR2 E;  2I4N A;  3IWD A;  3IG2 A;  2H36 X;  4BC9 A;  1N9W A;  2HCS A;  2L2M A;  3BJU A;  5ADZ A;  3NEN A;  2Q5I A;  2HFZ A;  2ZM6 E;  3TEP A;  3T1Y E;  2DXU A;  2IY5 A;  2J3M A;  4G85 A;  4TWA A;  5AE1 A;  4CH3 A;  4XU1 A;  4ER7 A;  2EWL A;  2E64 A;  4HWR A;  1XMQ E;  1NJ1 A;  3AV0 A;  2JOX A;  4OLF A;  3VK6 A;  3ICA A;  1WHN A;  3HXL A;  4H2Y A;  4KZS A;  1IBL E;  2DQ0 A;  4AQY E;  3HXV A;  1YZ9 A;  3UH0 A;  4JI7 E;  1E22 A;  2J3L A;  4ER0 A;  2F4V E;  1EVL A;  3SR4 A;  1X49 A;  4BBY A;  1USY C;  2DQ3 A;  3IKM B;  4UP9 A;  4JI8 E;  2CJA A;  2UXC E;  4YRF A;  4YY3 E;  4YHH E;  4DR3 E;  4YRR A;  1G5H A;  4E51 A;  4B3R E;  1WHQ A;  4DKK A;  5F5W A;  4YDQ A;  4EKG A;  2CJ9 A;  3R09 A;  4X66 E;  1NYR A;  3IWC A;  3A5Y A;  4EK9 A;  4P7D A;  4XTW A;  4EKI A;  2UUC E;  1QF6 A;  1YYK A;  1HNZ E;  1VQZ A;  2E10 A;  2DB2 A;  3DF6 A;  5IT9 C;  4YCV A;  2KOU A;  3QO8 A;  4DV6 E;  4LVK A;  1QE0 A;  4TQF A;  4DPG A;  4HWT A;  2ZR3 A;  3QFI A;  2MC5 A;  3IAL A;  1H4V B;  3OML A;  3P8T A;  4YPF A;  5K1P A;  2E1M A;  1ZBT A;  2YT4 A;  3NET A;  3MSW A;  1C0A A;  4YRP A;  2C8M A;  5T6J A;  2JVA A;  5K1X A;  1USY A;  4LF8 E;  4CH6 A;  4R8O A;  2J7U A;  3LML A;  2MXD A;  1X2G A;  3QO7 A;  4HWP A;  3J7A G;  4R03 A;  4DR6 E;  2NS6 A;  1ADJ A;  1X56 A;  5DT2 A;  1J5W A;  2KON A;  2VQF E;  4F9C B;  2YZT A;  4P71 A;  5A2Q C;  3A5Z A;  4DE8 A;  2CJB A;  2UUA E;  1T4N A;  2E65 A;  3M9L A;  2L33 A;  3MEJ A;  1NYQ A;  2EL9 A;  3GZD C;  4DV2 E;  3PCO A;  2I4M A;  3TUP A;  2ZNI A;  3TFL A;  3JU0 A;  2DKG A;  2LLW A;  4WF2 A;  1LYL A;  2LNM A;  3HTZ A;  2DDZ A;  2YBD A;  1B7Y B;  4YRT A;  1XNQ E;  1T4O A;  2VF1 A;  4LF6 E;  1RQ0 A;  3E9H A;  2FYK A;  4DV1 E;  3P8V A;  3RKX A;  4Q6G A;  3VQY A;  4KR2 A;  5LL6 R;  2NUF A;  2M4H A;  2ART A;  4WVL A;  2L92 A;  4OX9 E;  4BCA A;  2MDR A;  3A31 A;  2CIM A;  3W3S A;  4L8N A;  3V7R A;  3GZD A;  4P3N A;  2LRS A;  2G4C A;  4TVA B;  3PE5 A;  3VWS A;  4GEQ B;  3ERR A;  3MF2 A;  4ER5 A;  4L87 A;  4M0V A;  2QHU A;  3EFS A;  4NXN E;  2VQE E;  3C4T A;  4LF7 E;  1SET A;  4B3S E;  2KHX A;  4X64 E;  1E24 A;  2ZNJ A;  3HFZ B;  1WU7 A;  1WPY A;  2NUG A;  2V89 A;  3A32 A;  1BIA A;  3REX A;  4YRJ A;  3VQW A;  3RKW A;  2M7Q A;  1I94 E;  4WPY A;  4LFB E;  2FTX B;  1H4S A;  2ZT7 A;  4H2X A;  1NNH A;  4WJ4 A;  2I4L A;  4DV5 E;  3A7R A;  1GZ6 A;  4XTV A;  2M1S A;  12AS A;  3V8J A;  3PCO B;  3ADI A;  3RKY A;  1X47 A;  2K4V A;  1YYO A;  5E3I A;  4LVJ A;  4AH6 A;  4ZTZ B;  1EQR A;  1T4L B;  4JI1 E;  3QOW A;  1YB3 A;  4XEM A;  4DV7 E;  1HNX E;  1B8A A;  4KHP E;  2B7T A;  4DE9 A;  2UU9 E;  2Q7H A;  2PMF A;  3CMQ A;  4DV3 E;  3T1H E;  4DR4 E;  4GKK E;  1B70 B;  1GGM A;  5HGQ A;  4ZTU B;  2N3H A;  4LVL A;  5DTM A;  3J7Y p;  4L5N C;  3TEH B;  3OWQ A;  3A7U A;  1ASY A;  2EWN A;  1HTT A;  2ZZF A;  3GZC A;  1YGB A;  2DXT A;  2L1P A;  4EX5 A;  1FKA E;  3OKZ A;  1N34 E;  1WQ7 A;  2QHV A;  2V85 A;  3LSQ A;  1SRY A;  3UFG A;  2ZT8 A;  3OTO E;  4K0K E;  3RAC A;  1UHZ A;  1B7Y A;  2LTR A;  1PKP A;  2XTI A;  2XXP A;  2AKW B;  1YYW A;  4P72 C;  2RHQ B;  4DR7 E;  2L2N A;  2B7V A;  2DTI A;  2DTH A;  4P71 C;  3V7C A;  2V8Q B;  4DR5 E;  1X54 A;  2ZTG A;  1W66 A;  1GQE A;  4YRN A;  4JI2 E;  2DZC A;  2Q7E A;  3V7S A;  1L0W A;  2LUQ A;  4LTY A;  1RC7 A;  3L4G B;  2ZXF A;  3M4P A;  3QTC A;  4UP7 A;  2LLV A;  1RIQ A;  2XGT A;  4RDX A;  4EO4 A;  1WLE A;  2MC6 A;  2UUB E;  2PME A;  4TVA A;  4HWO A;  4JI4 E;  2VEO A;  3NEM A;  4CS4 A;  4ER3 A;  2N3G A;  4HVC A;  5C52 B;  3NZL A;  2ALY A;  3A74 A;  4H2X B;  1BBW A;  1N36 E;  4NCX A;  3TEL A;  2DZ9 A;  4XTZ A;  1ADY A;  4DV4 E;  5F3W A;  1N32 E;  2JY9 A;  2CPN A;  4LU9 A;  3A9X A;  3P8Y A;  4WI1 A;  3UGT A;  2FGG A;  4WYQ B;  2LUP B;  3I7F A;  1J26 A;  2P5I A;  2V86 A;  4OBM A;  3HFZ A;  1XMO E;  1Z7N A;  5DRT A;  4P72 A;  4JI0 E;  3DSQ A;  4CS2 A;  2B3T B;  3HPS A;  2ZGW A;  3UGQ A;  1YFS A;  2V88 A;  3HY1 A;  2ZR2 A;  4DUZ E;  3UWP A;  3A9Z A;  2ODR C;  3JTZ A;  3WQZ A;  4F9B B;  4P75 A;  1BIB A;  4XU3 A;  3VQX A;  4BC7 A;  2UXD E;  4JV5 E;  4K86 A;  4YRK A;  2E1H A;  2DIX A;  2FV4 B;  4LVI A;  3HRK A;  2DTO A;  3EFR A;  1KOG A;  4H2V A;  4BS9 A;  4DMI A;  2HHH E;  4WSP A;  4H2T A;  3VQV A;  4YYE A;  3NXH A;  4J15 A;  5ELO A;  1B70 A;  2QHT A;  1KMN A;  1ZBQ A;  1X2H A;  4WFT A;  4M30 A;  3TEH A;  3HXX A;  4YRM A;  3ME5 A;  2LJH A;  4BW9 A;  11AS A;  2NUE A;  3FIG A;  4ZIB A;  2RS7 A;  4BMJ A;  3HPZ A;  4H2W A;  3IKL A;  3L2Z A;  3L1A A;  3RUX A;  2ZCE A;  4XEO A;  4P74 C;  5JUW A;  4YCU A;  3PZC A;  3SX0 A;  2B9D A;  5AAS A;  2QHS A;  5DNY A;  4LF4 E;  1H4Q A;  2AKW A;  1E1T A;  3MEY A;  4KR3 A;  2RHQ A;  5C53 B;  3A9Y A;  5DRY A;  4HRA A;  3ZPX A;  2P0L A;  4DQ2 A;  3VYY A;  4NXM E;  1E1O A;  4RMF A;  3OD1 A;  2ALY B;  3LLH A;  3HXU A;  3R07 A;  4YRS A;  2L8T A;  4DUY E;  2DU5 A;  4XTU A;  3C4B A;  4EQZ A;  1WYD A;  2ARU A;  4XU0 A;  3L4G A;  4Q2J A;  3HXY A;  4M2Z A;  4PHC A;  3F6G A;  4CS3 A;  2V83 A;  1NJ6 A;  3LSS A;  4TVW A;  1G51 A;  4KQE A;  4JI6 E;  4X5O A;  3RL6 A;  1DQ3 A;  2DEQ A;  4X8W A;  2L6M A;  4EZI A;  2RS6 A;  1EIY A;  3NEL A;  4YP0 A;  3RIR A;  5AE3 A;  2AMC B;  4H02 A;  1SR9 A;  2ZT6 A;  4HA8 A;  4LF9 E;  1EFW A;  1QU6 A;  1X48 A;  3G1Z A;  4P74 A;  4XTX A;  4WJ3 M;  2E5L E;  4YRL A;  1JJC A;  2LTS A;  3G0T A;  2LBS B;  3HRI A;  3QO5 A;  3HXZ A;  3V8K A;  1KMM A;  1NJ2 A;  3RF1 A;  2ZIO A;  1EKZ A;  1IBM E;  2IHR 1;  3ADG A;  4DV0 E;  4YCW A;  5FLX C;  1XNR E;  1B76 A;  4ER6 A;  3KWR A;  4HWS A;  2JR1 A;  4YRO A;  3MF1 A;  4YRE A;  1J5E E;  3GUU A;  2DSY A;  1HNW E;  5BR8 E;  3H09 A;  3VBB A;  2ODR D;  3QNE A;  3KFU A;  2JWO A;  4UPA A;  5AE2 A;  2CGH A;  3REU A;  2DMY A;  1FJG E;  2G7H A;  3RMP A;  2DU7 A;  4UP8 A;  4XTY A;  2M4I A;  2ZT5 A;  4LVM A;  1PYS B;  4P3P A;  4X65 E;  3AUZ A;  5DSX A;  4TUI A;  4LF5 E;  2F8B A;  5LMU E;  2EZ6 A;  4P75 C;  4OP0 A;  4LNS A;  4X62 E;  3VYX A;  4YRC A;  2RHS B;  2HNI A;  1EVK A;  1IBK E;  3HFV A;  4JYA E;  1EIY B;  5ELN A;  2L3J A;  2L2K B;  3P1X A;  2RSM A;  1HR0 E;  2A8E A;  4YRQ A;  4F54 A;  4O2D A;  3J80 C;  4P73 C;  1STU A;  5DTR A;  4HT4 A;  5IWA E;  2E5A A;  2ARS A;  4K88 A;  1BBU A;  4YRG A;  1JJC B;  2HCN A;  3ADJ A;  4XU2 A;  3J81 C;  4CH4 A;  2AMC A;  2LE2 A;  1ATI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...