1X01A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with atp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2005-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1x01A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1x01A01
1HTTA 2VXFA 4YRGA 5GMKl 4C8QA 2ZZFA 1B70B 1VQZA 4K86A 2EJGA 1G51A 4J5YA 4YROA 4C8QF 4P3NA 1HC7A 4EMHA 1JRIA 3LSQA 4TTVA 3M4QA 3PCOB 3KFUA 3RESA 4H2YA 1TH7A 2ZINA 4XTYA 2CGHA 3JCMh 3W3SA 2AMCB 3ICAA 3JB9G 1NYRA 3JB9I 2C7IA 2YHTA 1L0WA 1EIYA 3JCMf 2RHSB 4CS2A 1EQRA 1Y96B 4YRJA 3PZCA 1EVKA 5GAMj 1I5LA 5GMKj 2ZZEA 4XU0A 5K1XA 1X54A 4M77C 5DY9A 3UGQA 4XTWA 2DZ9A 4OP0A 3A74A 4JRKA 4RQEA 3SB2A 3SWNB 1NJ2A 4M7AA 1NJ1A 4M7DE 2RD1A 3WQZA 2DVEA 3BY7A 4F7UE 4YRSA 3BFMA 3QO3A 4NL3A 4RMFA 2DXTA 2QHSA 4J15A 3REXA 3QO7A 5GAMh 5LJ3g 2I4LA 4ZIBA 5GMKh 4M7DA 2C8MA 3BJUA 4LNSA 4N0AA 5GANg 4M7DF 4J6YA 3LC0A 5GAMf 4F7UF 4KR2A 3VQYA 2EAYA 3A7UA 5LJ3d 2Q5IA 4M77G 4AH6A 4H2XA 4CS3A 5GANd 4F7UG 2QHTA 1KQ2A 4M75D 2E41A 3RL6A 1G5IA 2DXUA 2ZR3A 3EFRA 3UFGA 4C92B 3GIBA 3L4GA 2Q5HA 2K57A 3JCMV 2AKWA 1X2HA 1NJ5A 3A5YA 1I81A 1FYFA 4TVAA 3QNEA 1YGBA 4YRQA 3DSQA 4M77B 5GAOq 2QTXA 2E5AA 1KOGA 4A53A 4EO4A 2DQ3A 4J6XA 2ALYB 1KMMA 2E3CA 4EMGA 3VU3C 4V2SA 4C8QD 1B70A 4P3PA 3MEYA 1EFWA 3FB9A 1Z7MA 1B76A 3HXVA 5CAIA 2ZNJA 4HT8A 2EJFA 1PYSB 4CH6A 3TEGA 4YRMA 4EMKC 2ARTA 4HWPA 4M75C 2RHQA 4YPFA 2AMCA 4HWSA 4UP7A 4ZTUB 4JRIA 4MMKA 4KQEA 4H2UA 1SESA 5GAMg 4TVWA 3FIFA 3VQXA 3JCMX 1N9RA 4P71A 4M78C 4CH3A 1WYDA 1E22A 4XTVA 5GAOm 5C53B 2RB6A 5GAMd 4G84A 2DQ0A 3MF2A 2FYKA 4YRPA 2CIMA 3HFVA 3JB9F 3HFOA 4M7AD 5GAN2 1H4TA 3HSBA 2I4NA 1N9SA 3A7RA 1WQWA 3HY1A 4MMLA 1B7YA 1D3BB 3HRIA 3MF1A 2E10A 2E64A 3QO8A 5ELOA 2ZT6A 1SRYA 4HWOA 1WLEA 4M7DD 4M78G 4C92C 1BBUA 4NL2A 3E9HA 4WI1A 5I21A 5LJ5e 3OD1A 4YRNA 1USYC 4UP8A 3AHUA 3L2ZA 4JLIA 4EX5A 4EMKB 2ZCEA 4M75B 4PJOD 3RKXA 1BIBA 1YFSA 2EJ9A 2DU5A 1LJOA 3A32A 1EVLA 4M77E 1I4K1 1E1OA 4M7AC 4M78B 4X9CA 2EL9A 4WJ3M 4PG3A 4YCUA 4P74A 3IKLA 4M77A 2ZT5A 3BDUA 5GAN4 2Y90A 2EWNA 3NELA 4H2VA 4F7UA 1B8AA 3HFNA 4C92G 4M77F 2ZIOA 2ALYA 4TQDA 2ZT7A 1B34B 2HNIA 3E9IA 4C8QB 4JUVA 2QHUA 1X56A 4P75C 2RM4A 4K87A 4CH5A 4Q15A 4PJOC 3UH0A 2FB7A 2J3MA 3TEHA 2XTIA 1M8VA 1ATIA 1JJCB 2QHVA 4UP9A 1BBWA 3JCMg 1EIYB 4HVCA 1J5WA 3HY0A 4E51A 3HFZA 3HTZA 4H2WA 2Q7GA 3A31A 3QUIA 3VQWA 4ZTZB 1EOVA 1X01A 4XU1A 1YFRA 4HT9A 3JCMd 4Q6GA 3M4GA 1ADJA 4NCXA 4P73C 5KNNA 3JB9D 5GAOp 4YCWA 3NENA 4M7AB 5GAN5 4NOYA 3NETA 5GAOr 2IY5B 4J6WA 3PCOA 1GGMA 4P72C 1D3BA 4RCBA 4PNOA 5GMKm 2Q7HA 2I4OA 4CH4A 1IL2A 3V8KA 2RHSA 4YRFA 1JBMA 4M75E 1Y96A 3V8JA 1U1TA 1X2GA 3EFSA 5LJ3e 4HWRA 4X5OA 3RUXA 4A54A 3I7FA 5GANe 2DTIA 2ZGWA 4EMKA 3P8TA 4H2XB 4PJOB 3G1ZA 3RKYA 4M78E 2CJ9A 3INZA 5ELNA 4M75F 1E1TA 4C8QC 3SWNA 1RIQA 3L4GB 1YB3A 4CS4A 1NYQA 4M78A 5LJ3h 2AKWB 4O2DA 1QF6A 4M75G 12ASA 4M78F 5GAN8 4XTZA 4WJ4A 3ERRA 3QSUA 1WQ7A 4M77D 3RGLA 5GAN7 2ARSA 1Z7NA 5GAN3 4Y91A 1B34A 2Q7EA 5LJ5j 1C0AA 2ARUA 2YLCA 3V7SA 1LNXA 2DZCA 3V7RA 4YYEA 4RQFA 5GMKi 1BIAA 4K88A 4OLFA 1NJ6A 4H2TA 3RERA 2ZIMA 4PHCA 4C92E 4YRRA 4BWAA 3JCMP 2J3LA 1YFTA 5HGQA 2XGTA 4C8QG 1HXDA 2RHQB 1SETA 4P3OA 1JJCA 5GAOl 4X9DA 3JCMJ 3VQVA 3R07A 2DU7A 4C92A 3RF1A 1LYLA 4C92F 4HWTA 2YLBA 5LJ5h 3M4PA 2ZXFA 4QVDA 1USYA 4XTUA 3JB9H 2CJAA 4P74C 3NEMA 1NNHA 5LJ5f 4XQ3A 5GAMe 1H4VB 4M7AE 5C52B 4YREA 5GMKe 4M7DC 2ZT8A 4XU2A 3CMQA 2E1HA 3IALA 2ZTGA 4N0AC 3A5ZA 3LSSA 4H02A 3RIRA 1WNLA 1I8FA 4YP0A 3JCMW 4DPGA 4YRTA 2DDZA 4HA8A 1NJ8A 3BW1A 1PYSA 2IY5A 4M7AF 4DQ2A 1B7YB 5GAOn 3HXZA 1KQ1A 2ODRD 1G5HA 1ASYA 4TWAA 2PMEA 4M7AG 4XU3A 4YCVA 3HXUA 2DKGA 4PJOE 1SERA 1ASZA 5GAN6 1WU7A 4P75A 4RDXA 1ADYA 1M5Q1 3V7CA 11ASA 4M7DG 5E3IA 3JB9J 4PJOA 1X55A 3A7AA 1U1SA 2JN0A 3IKMB 4PJOF 3L1AA 5C51B 1QE0A 3FJPA 4WF2A 2DTOA 1LOJA 4BW9A 1KMNA 2DJZA 1H641 3P8VA 4YRIA 4M78D 4PJOG 4YRLA 2E65A 2CJBA 3QHSA 4L87A 4YRKA 2ZNIA 3JCMQ 1MGQA 4H2SA 1WPYA 1H4SA 5LJ5g 4M7DB 2ODRC 4UPAA 4YRCA 3IG2A 4F7UB 3QO5A 3TUPA 5LJ3j 2P0LA 4P73A 3JCMc 2G4CA 3V8LA 5GANj 2DEQA 4P71C 3HRKA 3QTCA 3JCMb 5F5WA 3RACA 4TQFA 5LJ5d 2PMFA 3UGTA 4P72A 3PGGA 3P8YA 4M75A 3RKWA 4TVYA 2RA2A 2I4MA 5K1PA 2ZR2A 4KR3A 1HK9A 4G85A 1W66A 3REUA 2DTHA 2VXEA 3TEHB 1E24A 4YDQA 3HXXA 2ZZGA 3SWNC 2I2LA 4C92D 4XEOA 3HXYA 1H4QA 3HXWA 1N9WA 3HFZB 3VBBA 5GANh 1YCYA 4C8QE 4TVAB 4RCCA 4QVCA 5LJ3f 2P5IA 3JCMe 4XEMA 4XTXA 5GANf 2VC8A
chains in the Genus database with same CATH superfamily
2F5KA 3CC4Q 1HTTA 2VXFA 3A1PA 3PE0A 3VS4A 3OYFA 4OGEA 1G51A 4X34A 3PTAA 4EMHA 1JRIA 5DM7R 1PCXA 3PCOB 4RG2A 3KFUA 1R0BG 4J9EA 2DPPB 2CGHA 2AMCB 3JB9G 4FW1A 4OB1B 3S3MA 2YHTA 2MF2A 1CKAA 4PFOA 4E7SA 1RUWA 2E6NA 1Y96B 4YRJA 1X69A 5FRNA 4A4KA 1SSFA 1VQ4Q 1I5LA 1M3BA 1KC8C 5K1XA 4OMFB 1X54A 1AVZC 3Q1JA 4M77C 3UWNA 3JAME 3A74A 4AFSC 2LC4A 3SB2A 1VQPQ 4KUIA 2NLUA 3A8HB 2RD1A 2DVEA 3BY7A 2GQIA 2X3WD 3QO3A 1K4US 1WX6A 1V29B 4LVMA 4M7DA 4LNSA 4J8OA 4QW2A 4AFQC 4J83A 4N0AA 3OYHA 1UUEA 4ZGJB 4BE1A 1TSFA 3A7UA 4KH0B 5LJ3d 4M77G 5C0MA 4BE0A 4H2XA 3MP8A 4DEXA 3UPUA 1QVPA 3I5SA 4CS3A 3H8ZA 1I07A 1B7TA 1KQ2A 4M75D 2JS0A 3G6EQ 3X20B 1YIJA 2X51A 1QVFA 2EYQA 2KY9A 2ED1A 1VIFA 3UFGA 1X6GA 3WVEB 4IURA 2K57A 1CKBA 5EC7A 1X2HA 1NJ5A 1KQSS 4TVAA 1QLYA 3H0IA 3QNEA 4LXCA 1YGBA 4QQGA 5C6SA 4M77B 3RR6A 1YJNA 1G3SA 1OX8A 2D9TA 2ALYB 4EMGA 4Z89A 3VU3C 2F1LA 3CCRA 3M5AA 2HQEA 1NEGA 1EFWA 4XK8E 3HXVA 4OB0B 2J06A 3OMCA 4HT8A 3CQTA 3CCLT 2ARTA 4M75C 3RNJA 2RHQA 1HSQA 3IQLA 1I1JA 1VQ6A 4OMNA 4UP7A 4KQEA 5IHIA 4II1A 1GRIA 1ZSGA 2JTMA 5GAMg 3THKA 1Q86C 2HBPA 3MP6A 1FWZA 1NZ9A 3QJ6A 4P71A 4IIMA 2KYBA 1E22A 1Y57A 3T9NA 2ESWA 1M90C 2V1RA 2DL3A 5KYUB 5KE2A 2KT1A 2CP6A 5CKFA 4FT2A 3OW2S 2E70A 3CPWA 2HL3A 1FXXA 1VQ5A 3JB9F 2DXBA 2ENMA 5FWCA 3HFOA 2KNBB 2JTFA 2I4NA 1SPKA 1IREB 4HCZA 1RAFB 1WQWA 2OX7A 2A8EA 3A7RA 4MMLA 5CVIA 2R5MA 2OTJQ 3CCUA 3H0HA 1OU9A 2X4XA 4HWOA 1WLEA 4M7DD 1FX7A 2VGNA 1WHGA 1IRXA 1BBUA 1AOJA 1UG1A 3NHNA 3QG1A 1QCFA 2PVOB 2K2MA 5D6YA 4M75B 2CZ7B 2X3XD 3RKXA 4J9IA 3OYEA 1YFSA 3CMEQ 1QP3A 3CCSQ 3I56T 3QYHB 2DU5A 1LJOA 2M0OA 4E7IA 1WA7A 2RI5A 1UGPB 5J26A 1YI2T 2W10A 4JJCA 5A0DA 4YCUA 4P74A 1Q81U 3IKLA 3H41A 2E5QA 2A08A 2ZT5A 3NELA 3S6WA 2DETA 2ZIOA 4M77F 4LVJA 1KK7A 4TQDA 4JUVA 2LJ1A 1X56A 3SHWA 3KUFA 2C0TA 2KROA 1K8AC 1ACMB 2KE9A 1SEMA 2RHYA 1YJWQ 1VQ9T 1KD1C 4Z02A 3UT1A 1NEBA 2XTIA 1ATIA 1Q82C 1VQ8T 1GCQA 4JRQA 2K3XA 1SF9A 3DLMA 3ZL7C 3HTZA 1RI9A 2Q7GA 3A31A 2L0AA 4DOVA 4LUEA 1K1ZA 4PLLA 1EOVA 2CUBA 3RDVA 1BK2A 4XU1A 3CCVA 1K73C 4Q6GA 1ADJA 4B6MA 1T0HA 4KT0E 1HYOA 5GAOp 3ZEHA 3X25B 5GAN5 4J6WA 2YUOA 2EKHA 2RJEA 4RCBA 3HL8A 4PNOA 5GMKm 2I4OA 1KQSP 1YITA 1K0SA 4CH4A 1TUDA 1BCMA 3FJ5A 3CCET 2LQKA 2EQIA 2P4TA 1EFNA 1OZ3A 1YJNQ 2AZSA 3OBWA 1M1FA 1U1TA 1ARKA 4X5OA 3OA6A 4HWRA 1VQPT 1WYXA 2LQ8A 4H2XB 3LGLA 1VQLT 2CJ9A 1ZUYA 2L3PA 2ATCB 4M75F 1MV3A 3ZBDA 2DK3A 3MJXA 4C8QC 1ZSZC 1KC8U 2DLPA 1U8RA 4OVAA 3ASKA 1VIEA 4KUDK 1C1AA 3DB4A 4HCBA 4XTZA 2E5KA 2A7YA 2QQRA 3JV3A 3NTHA 2EYZA 5GAN7 2YRVA 2X9HA 5LJ5j 3OB9A 4PJLA 2ARUA 2YLCA 4VUBA 2DZCA 4LN2A 1BIAA 1T0JA 2A37A 4YRRA 1M1GA 3GNFB 3LWIA 2ROTA 1YFTA 2EFIA 5HGQA 1X2QA 4C8QG 2RHQB 5GAOl 4X9DA 3VQVA 4C92A 2JW4A 4HWTA 3TSZA 1YFNA 2ZXFA 3OBYA 3F70A 4HT4A 3M0QA 4P74C 4M7AE 5HK0A 4N4GA 4IUPA 2ZTGA 3A5ZA 3RIRA 1WNLA 1PD0A 1T3SA 1FYNA 1M1KR 4ZN3A 3JCMW 4DPGA 4CC3A 1ZUKA 2QQSA 4MZTA 3QWXX 2IY5A 1KSWA 4IUTA 2X4WA 2DYIA 2BTTA 5CIUA 3OYBA 3CC7A 5GAOn 1KQ1A 2FPFA 2LNVA 2QYZA 1H92A 4M7AG 2CT3A 4HXJA 1R0CB 4YCVA 2DKGA 1GCQC 1SERA 4O6JA 3M58A 3NTIA 1WHLA 2YT6A 4IIOA 2P4RA 1Q86U 3PVQA 5CQXA 3S3NA 4WF2A 1KMNA 1BI3A 2YRDA 3ULRB 1AEYA 4BB7A 2ZAEA 2XK0A 4CC4B 1UGQB 2VASA 5EG2A 2CJBA 2QXFA 2DAQA 2ZNIA 3GF5A 2QAZA 1WPYA 1H4SA 3OMGA 4EDUA 4D6WA 1NPPA 3I55A 2PVGB 1JJ2S 2RJCA 2J6FA 3QO5A 4P73A 1GBRA 4F16A 3CCST 3LW5E 3CBPA 3HRKA 4TQFA 5LJ5d 3UGTA 4P72A 3OS5A 2BE7D 3PGGA 1M4ZA 3MHXA 2RA2A 3ZFJA 3REUA 2HL5C 3REAB 2RJFA 4JRPA 2ZZGA 4XEOA 2I2LA 4C92D 1YWOA 3HXYA 1H4QA 8AT1B 1WJQA 1N9WA 3G71A 1AWWA 3VBBA 3EG9B 3UA6A 2LRQA 4C5GA 1S72A 2K5LA 2FO0A 3VKIA 3JCMe 4XEMA 2BE9B 1M30A 3JSCA 1MGQA 2VC8A 5GANf 1YJWT 4YRGA 2WSFE 3SD4A 2ZZFA 1GBQA 5KCOA 4K86A 2EJGA 2M51A 4C8QF 3CCMA 1UECA 2RN8A 2EQUA 2DYBA 3HKSA 3EFOA 3CXCS 2SRCA 4H2YA 4XTYA 1ZX6A 2DRMA 2DL7A 3FDRA 1YHQA 1L0WA 3EGXB 1W1FA 2J6OA 1S1NA 2DE0X 2K6DA 1YIJT 3CCLQ 5GAMj 5GMKj 1Q82U 2VWFA 1ZBXA 3FEOA 2LT1A 1VYUA 3UF4A 2H3JA 4XTWA 4OP0A 2JS2A 2H8HA 4E7LA 1WFWA 1EIFA 4X1VA 3QDFA 1YJNT 3PIOA 4FM4B 1KIKA 3WQZA 2E4HA 4J9BA 1K73U 4HKEA 4JS5A 4NL3A 4RMFA 2DXTA 3CCRT 5DLOA 3BJUA 2LVMA 1RAHB 1VQKA 2XDPA 3VS3A 1KJWA 1TTHB 4LDYA 3VQYA 2BZXA 2CZ6B 2ZPEB 3MEVA 1VQ6T 2MWOA 3RL6A 4FCYA 2FL7A 3CEYA 4HVUA 1YWPA 2DXUA 2ZR3A 4L59A 2LP5A 4C92B 2Q5HA 1AD5A 1M2VA 1R8OB 3JCMV 2AKWA 1JO8A 2DL8A 3MPUB 3R6OA 1O75A 3M4YA 2XDBA 1FYFA 5FWBA 3QKJA 2X4JA 2GNCA 3CMAA 1PC0A 4YRQA 3BE3A 1VQ5T 1VQOA 4EO4A 1V76A 2FZCB 2DQ3A 3A5ZB 1YI2Q 2XKOC 1VOMA 3CCUT 1B70A 1VQ7A 2E12A 3H0FA 5D6XA 4N4HA 2MWPA 2M1HA 3CC2A 1QW1A 2HKNA 4LNPA 3C12A 2HAXA 3UDCA 4EMKC 4DBHA 3C4SA 4ZTUB 4OMMA 4F17A 3VS7A 5FU6C 1SESA 1IHVA 2A0FB 2PQWA 4GY5A 1JJ2P 3FIFA 4TVWA 2YUNA 4M78C 1SHGA 2PU9B 4OMLA 2FRYA 1G3WA 3NMZC 2AIRB 1VQ9Q 3RBBB 1D0YA 1VQ8Q 2RB6A 5GAMd 1M8MA 1OV3A 3P8HA 3PT9A 1Q7YC 4K11A 4JZ4A 1AT1B 2KEAA 1Y7XA 4YRPA 3HFVA 2COYA 3QIIA 1WJRA 2HZYA 5GAN2 1H4TA 4QKUA 2JJ9A 1N9SA 2L3RA 1AWJA 2KXDA 3FLGA 1HD3A 3ME9A 2E64A 1X43A 2ZT6A 5ELOA 2OTLA 5IHNA 3E9FA 1XTDA 4M78G 3AT1B 1D09B 4NL2A 3E9HA 4CC7A 5I21A 4UP8A 3AHUA 2DILA 5CR2A 4EMKB 1YBYA 2F2VA 2KT8A 2QASA 1UDLA 3CCEQ 4PJOD 3CXCP 2LQNA 5FU6B 3A32A 1GL5A 1EVLA 4M77E 1I4K1 3TREA 1E1OA 4M78B 3CCVT 1RAIB 4X9CA 1W6XA 2HBWA 2DX1A 2EL9A 3M0TA 4E47A 4WJ3M 2B86A 1VQLQ 2FZGB 1WHHA 4RG8A 4OGCA 4ZGEB 3BDUA 3OYKA 3OSVA 2E3HA 2EWNA 2PTKA 4F7UA 3HFNA 4RKUE 1YJ9A 4BDZA 2HCKA 2RMOA 2LDMA 3OYCA 1U06A 2ECZA 2WSCE 1YITT 4OB2B 1ZA2B 1PSFA 2HEQA 2KI7A 3EFOB 4PJOC 2SEMA 2J3MA 2GFAA 1JJCB 2QHVA 2XMFA 5KCHA 4UP9A 1K9MU 1BBWA 3JCMg 4HVCA 2X4YA 2O2OA 3HY0A 4E51A 4UC4A 1TUCA 4E6RA 1ZQ1A 5HKCA 3DB3A 2EYXA 4H2WA 1JXOA 4WCIA 2L2PA 4ZTZB 1PNJA 1OQKA 2CZ1B 4HT9A 4R55A 4YCWA 1Y0MA 2D8HA 1QVGS 1GGMA 1D3BA 2K7AA 3EHQA 1OI1A 3CCJA 1K9MR 1Q95G 2Z0WA 4ELZC 1IL2A 4BD3A 3O5ZA 2RHSA 3DKMA 1U3OA 1UTIA 4KGVB 4M75E 3S3OA 3VS2A 2O4XB 3RUXA 4A54A 1UGRB 2ZPIB 5CKBA 3VYGA 3I7FA 5LL6S 2A28A 5GANe 2DMOA 2AZVA 4PJOB 1W2BS 4ELYC 3CC2Q 1VQMQ 2RH2A 4B9WA 2D0QB 2DFUA 2P84A 2CKKA 4ME7A 1NYQA 4R0KA 3VS1A 2AKWB 1BI2A 4M75G 4M78F 5GAN8 3QJYA 1Z9ZA 2O9VA 2L89A 1KG1A 3VS6A 3OS0A 1C0MA 2WACA 1ABQA 3BDLA 5M9OA 1Z7NA 2BKDN 5GAN3 4Y91A 1B34A 3CC7T 2L3SA 3J80E 2AT1B 1IHWA 2FG0A 4A63B 4OLFA 4H2TA 4Y92A 4JJDA 2OI3A 2DA9A 1WI7A 4BWAA 4F14A 2HKQB 2QQAA 4BI8B 3JCMJ 2EGEA 2KR3A 2QEXA 2DU7A 1CSKA 3RF1A 2RQTA 8ATCB 2M0YA 3I35A 2NUTA 2YRCA 2YLBA 5LJ5h 4PLIA 1USYA 1OPKA 4XTUA 3SDZA 2A36A 4MZMA 2EQJA 5C52B 4M7DC 2ZT8A 3LSSA 2LT4A 4N0AC 1JJ2A 1EZZB 2OAUA 5FRMA 2ZZDA 5I22A 3QBYA 2D1XA 2DDZA 3SFMA 2JXBA 4HA8A 3EH1A 3G4SA 3I55T 2K79A 1PYSA 2VYTA 4KGXB 3E9GA 2EW3A 3MCAB 2HSPA 2ODRD 1ASYA 2D0NA 4QT7A 2JT4A 3KFVA 4XU3A 1N8RU 3HXUA 4JLGA 1ASZA 1Q81R 1WU7A 3KXTA 4P75A 4RDXA 4M7DG 1NJIC 4ANJA 3H9NA 4IUQA 1ZLMA 1WXBA 4DBRA 3JRZA 4PJOF 5I11A 5L23A 3G71T 5C51B 3FJPA 2DTOA 1S72T 1YIJQ 2E3IA 4AT1B 2E65A 1MMDA 4L87A 4BUGA 3CXCA 3OS2A 3JCMQ 1RABB 4B9XA 4H2SA 1OU8A 3CCMT 4M7DB 2ODRC 4PFZA 4UPAA 1N8RR 4F7UB 4CI0C 2P0LA 3VRZA 3V8LA 2DNUA 1E7OA 4P71C 3X26B 3CCRQ 5F5WA 3L42A 1WJSA 4OMPA 2PMFA 2VB6A 5CQYA 2QTVA 2K4YA 1QVGP 2I4MA 4KR3A 2RJDA 2VXEA 3D7SB 5HY6A 2MI6A 1VQ6Q 3HXXA 2LX9A 2QGGA 1MUZA 4L5GA 4C8QE 4TVAB 1BCOA 4RCCA 2Y4XA 5LJ3f 1JQQA 1P92A 5IH2A 2NUZA 1MNEA 3M0PA 2EIFA 4XTXA 3CBMA 4E7HA 1W2BP 1QVFS 3PFSA 3GLXA 5GMKl 2ZPHB 2RK2A 2RI3A 3M0UA 2QA4A 1BBZA 3OW2P 4P3NA 3OYJA 4QVZA 4LDUA 3LSQA 1VQ5Q 4TTVA 1AHJB 2MIOA 3M4QA 1TH7A 1G83A 2KK4A 3W3SA 3JCMh 1XQHA 1KC8R 3ICAA 3J81E 2VKNA 3CCUQ 2VGMA 2RHSB 4CS2A 4P5NA 3PZCA 3QDRB 1GXIE 3EGDA 3N5BB 4E7ZA 2RHUA 4LDXA 2DZ9A 3C95A 2HQXA 2EGCA 2YUQA 2OAWA 4J7FA 4JRKA 4RQEA 3CMAT 2DXCA 4Z88A 2ED0A 1NJ2A 1NJ1A 2V26A 1QCNA 1VQOT 2DF6A 2MYSA 4MZPA 4YRSA 4PK4A 3CCQA 2QHSA 2NS6A 2C0OA 5GAMh 2I4LA 2QDYB 2WSEE 5CK9A 1VQ7T 4ZIBA 5GMKh 2XDDA 1MV0B 2XHCA 1NM7A 5GANg 3CC2T 2P0QA 2W0ZA 4M7DF 3LC0A 7AT1B 1N5ZA 1VQMT 4F7UF 3L2VA 3CPWS 4KR2A 1VQNA 4J9HA 2Q5IA 4AH6A 1FMVA 2O9SA 2QHTA 4FSSA 2YDLA 3E19A 2XG8D 2LCLA 1MMNA 1BKBA 1GCPA 1UB4A 3U23A 1H8KA 3EFRA 1M90U 3LH5A 3L4GA 2CZ0B 3GOXA 2NUTB 4OF1A 1FMKA 1X6BA 2CSQA 4AFZC 1D1CA 1IGQA 4D8DA 4ZTFA 1TWBA 3DSQA 2PUKB 3EH2A 2E5AA 2DD4A 1KOGA 4A53A 2JZ2A 4J6XA 4RUGA 1KMMA 4LVKA 3CCVQ 4V2SA 3GNGA 2LJ0A 4RTVA 1KFZA 4P3PA 1YP5A 3FB9A 1K9AA 2OTLT 1B76A 1Q86R 3M55A 5CAIA 2ZNJA 2I0NA 1PYSB 2AKKA 3TEGA 3EG1A 4C0GA 4KRTA 1SKUB 4YPFA 3GBQA 2AMCA 1RADB 4HWSA 2KAFA 1M90R 4MMKA 2ZPGB 2IIMA 4H2UA 4RTUA 1YITQ 4M4ZA 2JM8A 4TVRA 3VQXA 1N9RA 3URGA 4CH3A 2HSEB 1D1AA 5CO7A 2L3QA 4XTVA 3CC4A 2ZCFB 4RTXA 1PM3A 3GP8A 3E2UA 5C53B 3PMIA 3RMSA 4G84A 3X24B 2MK5A 1W4SA 2DQ0A 2FYKA 4GLKA 5KYXA 4AG2C 5CCAA 4R56A 1YJ9T 2H3EB 1J3TA 3HY1A 3HRIA 1PKTA 3QO8A 5GJWB 3OYIA 4DBFA 1K8AU 4C92C 1VQ4A 3VJPA 2JMCA 1KD1U 1TS9A 4JS4A 3OD1A 4YRNA 2LMJA 2EGAA 1KQSA 2GGRA 3L2ZA 2QA4Q 3FC3A 1Y07A 4EX5A 2DBKA 4IUUA 1D1BA 1M27C 2AK5A 4MDWA 5J39A 1OZ2A 4JDSA 2RNAA 2FRWA 2DRKA 2JMAA 3NFCA 3C94A 4YTLA 4PG3A 2ROLA 5J3BA 5HCKA 4M77A 3WVDB 3OYLA 2QDLA 2Y90A 2J7IA 4H2VA 1K8AR 2DBMA 4C92G 2ALYA 3LYIA 3P8DA 1KD1R 4KGZB 1QCOA 4PJMA 3MP1A 1Q82R 3CCJT 1D0ZA 2R5AA 3G6EA 1U5SA 4K87A 4Q15A 2VVKA 1I5OB 2LCSA 4FIBA 1AWOA 3EGUA 3OYAA 3CC7Q 5A0GA 3TEHA 1UEBA 2B8AA 3OW2A 2JOYA 5DLQE 3LGFA 4WTOB 1K73R 4HVVA 2NWMA 1J5WA 3HFZA 2CSIA 3DLLA 1F1BB 1MMGA 4OMQA 4ZNXA 4C0DC 4Z8AA 4KULA 3QZ9B 1X01A 4J9GA 2RHZA 3A8MB 3JCMd 3M4GA 2KXCA 1SSHA 4NCXA 4P73C 5KNNA 3WXMB 3JB9D 4QQ6A 3GPLA 1LPLA 3NENA 1N6AA 1PRMC 3HRSA 2IY5B 1RLQC 5KE3A 4CC2A 2QQ9A 1PRLC 2MMPA 2RQUA 2KSSA 1A0NB 4P72C 3OYYA 1TXQA 1QKWA 2DD5A 1VYVA 2MPXC 4GLMA 3V8KA 1JBMA 3I55Q 3UA7A 2D8JA 3V8JA 1X2GA 3EFSA 3HP9A 5LJ3e 2QGFB 1AZEA 4LD9K 2R57A 2EQKA 3J7AF 2DTIA 2ZGWA 2FPEA 3G1ZA 2DO3A 4M78E 5ELNA 5KYNA 1LCKA 1G8XA 1YN8A 4FYVB 5IXFA 1E1TA 1X6OA 3SWNA 1LVKA 3L4GB 1OYXA 4CS4A 1C6VX 2KDSA 5I2SA 2OTJA 1QF6A 12ASA 3KBGA 1WHJA 4C0DB 4LDWA 1AZGB 3A8LB 2RK1A 3G71Q 1O9SA 3ERRA 3QSUA 4F04B 4M77D 3RGLA 3G4ST 2ARSA 4BDYA 1S72Q 4IKFA 2RQWA 2Q7EA 2DL5A 2F69A 4BE2A 3UATA 1C0AA 3LLRA 2KGTA 3V7SA 2AKLA 1LNXA 2D6FA 1RAGB 5GMKi 4FYWB 4K88A 2ZIMA 3CPFA 3TQ7P 1SG5A 3PNWC 3CCMQ 2DJQA 3CMEA 1RACB 2O88A 2EYWA 3CCSA 4FL6A 3VS5A 3CBOA 1HXDA 2XGTA 4P3OA 3OSSC 1WIEA 2CYZB 2HD0A 3R07A 1IGUA 4BI4A 3HRTA 1LYLA 3M9QA 4C92F 1YHQQ 1NYGA 2LCCA 4PL6A 3NEMA 2GF7A 4FU6A 1NNHA 5LJ5f 4MDXA 4YREA 4XU2A 3IALA 1TG0A 4H02A 1G3YA 1ZUUA 3OYGA 2LX7A 4YP0A 5KYXB 3LH0A 2JM9A 1UE9A 3BW1A 1YJWA 2CP5A 1D0XA 1OX9A 2AHJB 1G5HA 1M1KC 2PMEA 2DM1A 3EG0A 1I0CA 1IO6A 3RMQA 1VQKQ 1UHCA 4PJOE 2F5TX 2EPDA 5IT9E 3QWYA 2GQVA 1X75C 1Z9QA 3M54A 3M57A 2YXYA 4FW2A 3V7CA 11ASA 1E6HA 1Y71A 1X55A 3A7AA 2JN0A 3IKMB 3L1AA 2QG9B 5KYYA 4FSXA 2NYSA 1QWFA 3OYDA 1H641 3ER0A 2MOXA 4YRLA 4PJOG 1JEGA 4NS5A 1H3HA 3PVLA 4YRKA 2YWWA 3E1SA 4FYXB 2QA4T 4L6V5 1YNZA 1PKSA 2KRNA 4JPBW 1NE8A 3I9QA 3CMAQ 3IG2A 2RI2A 4YRCA 3TUPA 4A4EA 1BB9A 1BI0A 3JCMc 1VQOQ 2KYMA 4RTYA 5GANj 1UGSB 2DEQA 2BUDA 3LX7A 3JCMb 2Y4YA 1VQ7Q 2FEIA 3P8YA 4TVYA 1M3AA 1OULA 5K1PA 2ZR2A 1UFFA 1HK9A 5ECAA 5KYWA 2GTOA 2DTHA 3TEHB 1JXMA 1E24A 5L8RE 2RF0A 3SWNC 2IG0A 4C0FA 1M2VB 3HXWA 3HFZB 5IXBA 9ATCB 5AT1B 2KQWA 4PFPA 2FPDA 2PUOB 1WDXA 4C8QA 1ZSZA 4J7IA 3I5RA 3VUZA 3OS1A 2NUPA 3NPFA 3CCQT 1B70B 1VQZA 3QPHA 4J5YA 1WHMA 4YROA 4RTZA 3L2RA 1HC7A 4O5VA 1W70A 1BI1A 3QYGB 4AFUC 2CP7A 2K2VA 2PZ1A 3RESA 2CP3A 4D8KA 2ZINA 4J9CA 1VQNT 1OOTA 2COZA 1NYRA 3JB9I 2C7IA 2RHIA 1EIYA 3JCMf 2OTLQ 6AT1B 2X35A 1EQRA 2GCXA 2YSQA 2V8IA 1EVKA 5D7UA 1RL2A 2ZZEA 2K3BA 4XU0A 3CD6A 3X28B 3UGQA 2HQHA 5DY9A 4LVIA 1M2OA 1G5VA 2CREA 2CUDA 1WXUA 4EPCA 2J05A 1VUBA 3SWNB 4M7AA 4JJNK 4M7DE 2KRMA 2XU8A 4F7UE 3M53A 3BFMA 4C5IA 4HCKA 2LNHB 4J15A 3REXA 1XJWB 1T3LA 3QO7A 5LJ3g 3L2QA 2C8MA 4PJNA 3A8GB 1NPRA 2LQWA 4J6YA 5GAMf 4RMOA 3P8BB 3EG2A 1YJ9Q 1KHCA 4J9DA 2EAYA 2A3LA 4J9FA 2DEUA 1G2BA 2RO0A 4HVWA 5GANd 4F7UG 3MO8A 2E41A 2G6FX 3PMTA 4PJJA 2GBQA 2XD0A 2XI9A 1G5IA 4Q5WA 4LD6A 2CH4W 2VV5A 2BIVA 3CC4T 3GIBA 2KVQG 2V1QA 2CP0A 3A5YA 1Q7YU 1I81A 2DL4A 3EG9A 4N4IA 1QMCA 1QWEA 5GAOq 2QTXA 3M59A 3HTRA 2E3CA 3REBB 4C8QD 3MEYA 1X2KA 1Z7MA 4E7KA 2L5QA 2EJFA 1YHQT 4CH6A 2O01E 2P0PA 4C0ZA 1BYMA 4YRMA 3OYNA 5CKEA 2BZYA 4HWPA 1VQ4T 3M56A 1NG2A 4JRIA 4ORZA 2ABLA 4KBMB 1X27A 5AYFA 3CCJQ 1QKXA 5IHKA 1M3CA 1Q7YR 3EGXA 3JCMX 5IN1A 1UJYA 3QZ5B 5HK3A 1WYDA 2EBPA 5GAOm 5FW9A 2XICA 3NTKA 2P0KA 5KYYB 3MKDA 3MF2A 1WLPB 2CIMA 1RAEB 2O31A 2IVWA 1JU5C 1VQKT 4M7AD 2L8DA 3HSBA 5GJVB 4GBQA 1B7YA 1D3BB 3MF1A 3TEEA 2E10A 2DVJA 4LE9A 1EX4A 1SRYA 2CP2A 4A4FA 4BY6C 3G6ET 2G3RA 4FYYB 4DA4A 3CCLA 1N27A 3M0SA 3VS0A 2KRSA 3C0CA 5FROA 4WI1A 5LJ5e 3LWHA 1M1KU 1IB8A 4AMCA 1USYC 2EVRA 2M02A 3HPWA 4JLIA 2CDTA 2ZCEA 1B07A 5FLXE 1BIBA 4AG1C 2KMTA 4FT4A 3VRYA 2QQBA 5KYWB 2EJ9A 3G1JA 1E6GA 3L2WA 4M7AC 1SRLA 2QEXQ 1KHIA 2MCNA 1JB0E 2C0IA 2RPNA 3OY9A 2RQVA 1V1CA 1NBEB 5GAN4 2FVUA 4CRIA 1B8AA 3TVTA 3CD6Q 2ZT7A 2K5FA 1B34B 2FZKB 2HNIA 3E9IA 4C8QB 1ZSZB 2NUPB 2QHUA 1PSEA 5CKDA 4Y28E 3G7ZA 1RI0A 2K5IA 4ESRA 1UJ0A 4P75C 1HJDA 1XOVA 2RM4A 4CH5A 5CKHA 3G4SQ 2RQRA 3M0RA 3UH0A 3HRUA 2FB7A 5I2MA 4BY6B 1M8VA 1ZBJA 1ZHIA 1TUGB 1EIYB 2GFUA 1PWTA 2J6KA 4XAXB 4DBQA 4LUDA 1GFCA 3TSWA 4E7JA 1K0XA 3I56A 1WHKA 4C5HA 3QUIA 3VQWA 1MHNA 2CT4A 2MAMA 1YFRA 1YI2A 2YUPA 2OTJT 1VA7A 3A98A 5D6WA 1DJ7B 3HHTB 1UHFA 4M7AB 1NLOC 2HMAA 4NOYA 3NETA 5GAOr 3VV0A 3PCOA 4HCCA 2IPOB 2ZPFB 2DIGA 1IZ6A 4QQDA 3TU4K 2Q7HA 1MNDA 3VUBA 1XNIA 2QI2A 5IAYA 4ZTJA 2VUBA 2COWA 1YCSB 4YRFA 3CMET 2DERA 1Y96A 1M9SA 5FU7C 2EKOA 1VQ9A 2RHXA 4ZGDB 2JTEA 1VQ8A 2F2WA 4EMKA 3P8TA 1K9MC 3MEWA 1QQJA 3RKYA 4C5EA 1BU1A 3INZA 1WGSA 4JZ3A 1PD1A 2DIQA 1PHTA 2PNIA 1RIQA 1YB3A 1MMAA 4M78A 5LJ3h 4O2DA 2EQMA 4WJ4A 1WQ7A 2XIDA 4IUVA 3MQZA 1QP2A 1QVFP 4PKCC 5A2QE 4YYEA 3V7RA 4RQFA 1NJ6A 2GTJA 3CCEA 3SEMA 3RERA 4DOWA 4PHCA 4C92E 3JCMP 2J3LA 1VQPA 1SETA 3H6ZA 1JJCA 2K3YA 1NYFA 4JJBA 1NJIU 5FU7B 1ZA1B 5KH6A 1VQLA 3M4PA 4QVDA 1SRMA 1WZOA 1PG5B 3NGPA 3JB9H 1QVGA 2CJAA 2M16A 3TCJA 4XQ3A 5GAMe 4KH1B 1H4VB 4LVLA 5GMKe 3CMQA 2E1HA 1B3QA 1VYTA 2JNGA 3MEAA 1WXTA 1I8FA 1SHFA 4YRTA 3R6NA 3EG3A 1NJ8A 2LJ3A 4M7AF 1OEBA 3VYHB 4DQ2A 3A8OB 2LTOA 1W2BA 1B7YB 3HXZA 3CCQQ 1NJIR 1FMWA 2PVDB 4BI3A 4TWAA 1RLPC 1AWXA 4RTTA 2E6ZA 4DEYA 1H3ZA 5GAN6 4A4GA 2O4XA 3CPWP 1ADYA 4EIKA 1M5Q1 3EGDB 1VQNQ 4A4HA 3QXEB 1GFDA 5KYUA 5E3IA 3JB9J 4PJOA 3META 3L2UA 2F2XA 1TU0B 2JVVA 1U1SA 1QE0A 1LOJA 4BW9A 1OPLA 1Q81C 2ZPBB 1TOVA 2DJZA 4RTWA 4OB3B 3P8VA 3PIPA 4YRIA 4M78D 3FRNA 1G3TA 3QHSA 5A0LA 4LDVA 4BACA 2HDAA 1K76A 5LJ5g 3I56Q 1IXDA 2V8KA 2QK0A 5LJ3j 2G4CA 2KBTA 2JUFA 2M9UA 2CH4A 2K9GA 4E2FB 2LZ6B 3QTCA 3RACA 2BZ8A 1UGVA 2EYYA 2QEXT 1R77A 4M75A 3RKWA 1VQMA 1N8RC 2V8JA 1RAAB 4ATOA 2R58A 2OJ2A 1ABOA 4OMOA 3OYMA 4G85A 1W66A 3EHRA 3O8VA 4YDQA 3CD6T 3EAEA 2C06A 3OQ5A 4ZN1A 1NLPC 5GANh 2CS7A 1YCYA 4QVCA 2P5IA 2FHDA 3MEUA
chains in the Genus database with same CATH topology
2F5KA 1HTTA 2VXFA 3OYFA 4OGEA 1G51A 4X34A 3PTAA 4EMHA 1JRIA 5DM7R 3PCOB 4RG2A 3KFUA 2DPPB 2CGHA 2AMCB 3JB9G 4OB1B 3S3MA 2YHTA 2MF2A 2E6NA 1Y96B 4YRJA 5FRNA 4A4KA 1SSFA 1I5LA 1KC8C 5K1XA 4OMFB 1X54A 4M77C 3Q1JA 3UWNA 3JAME 3A74A 2LC4A 3SB2A 4KUIA 2NLUA 3A8HB 2RD1A 2DVEA 3BY7A 3QO3A 1V29B 4LVMA 4M7DA 4LNSA 4J8OA 4QW2A 4J83A 4N0AA 3OYHA 4ZGJB 4BE1A 3A7UA 5LJ3d 4M77G 5C0MA 4BE0A 4H2XA 3MP8A 4CS3A 3UPUA 1QVPA 3H8ZA 1KQ2A 4M75D 3X20B 1YIJA 1QVFA 2EYQA 2KY9A 1VIFA 3UFGA 3WVEB 4IURA 2K57A 1X2HA 1NJ5A 1KQSS 4TVAA 3QNEA 1YGBA 4QQGA 5C6SA 4M77B 1YJNA 1G3SA 2D9TA 2ALYB 4EMGA 3VU3C 3CCRA 3M5AA 2HQEA 1EFWA 4XK8E 3HXVA 4OB0B 3OMCA 4HT8A 3CCLT 2ARTA 4M75C 2RHQA 1VQ6A 4UP7A 4KQEA 4II1A 2JTMA 5GAMg 1Q86C 2HBPA 3MP6A 1FWZA 1NZ9A 3QJ6A 4P71A 1E22A 3T9NA 1M90C 5KE2A 5CKFA 4FT2A 3OW2S 2E70A 3CPWA 1VQ5A 1FXXA 3JB9F 2DXBA 3HFOA 2JTFA 2I4NA 1IREB 4HCZA 2A8EA 1WQWA 3A7RA 4MMLA 5CVIA 2R5MA 3CCUA 2X4XA 4HWOA 1WLEA 4M7DD 1FX7A 2VGNA 1BBUA 3QG1A 2PVOB 5D6YA 4M75B 2CZ7B 3RKXA 3OYEA 1YFSA 1QP3A 3I56T 3QYHB 2DU5A 1LJOA 2M0OA 4E7IA 2RI5A 5J26A 1UGPB 1YI2T 5A0DA 4YCUA 4P74A 1Q81U 3IKLA 2E5QA 2ZT5A 3NELA 3S6WA 2ZIOA 4M77F 4LVJA 4TQDA 4JUVA 1X56A 3KUFA 1K8AC 2RHYA 1VQ9T 1KD1C 4Z02A 3UT1A 2XTIA 1ATIA 1Q82C 1VQ8T 4JRQA 2K3XA 3DLMA 3HTZA 2Q7GA 3A31A 4DOVA 4PLLA 1EOVA 4XU1A 3CCVA 1K73C 4Q6GA 1ADJA 4KT0E 5GAOp 3ZEHA 3X25B 5GAN5 4J6WA 2RJEA 4RCBA 3HL8A 4PNOA 5GMKm 2I4OA 1YITA 4CH4A 3CCET 2LQKA 2P4TA 1OZ3A 3OBWA 1M1FA 1U1TA 4X5OA 3OA6A 4HWRA 1VQPT 2LQ8A 4H2XB 3LGLA 1VQLT 2CJ9A 4M75F 3ZBDA 2DK3A 4C8QC 1KC8U 1U8RA 4OVAA 3ASKA 1VIEA 4KUDK 4HCBA 3DB4A 4XTZA 2A7YA 2QQRA 3NTHA 5GAN7 2YRVA 5LJ5j 3OB9A 2ARUA 2YLCA 4VUBA 2DZCA 1BIAA 4YRRA 1M1GA 3GNFB 3LWIA 1YFTA 5HGQA 2EFIA 4C8QG 2RHQB 5GAOl 4X9DA 3VQVA 4C92A 4HWTA 2ZXFA 3OBYA 3F70A 4HT4A 4P74C 4M7AE 5HK0A 4IUPA 4N4GA 2ZTGA 3A5ZA 3RIRA 1WNLA 4ZN3A 3JCMW 4DPGA 2QQSA 4MZTA 2IY5A 4IUTA 2X4WA 5CIUA 3OYBA 3CC7A 5GAOn 1KQ1A 2LNVA 4M7AG 4YCVA 1SERA 2DKGA 4O6JA 3M58A 3NTIA 1Q86U 5CQXA 3S3NA 4WF2A 1KMNA 1BI3A 4BB7A 2XK0A 1UGQB 5EG2A 2CJBA 2QXFA 2DAQA 2ZNIA 3GF5A 1WPYA 1H4SA 3OMGA 4EDUA 4D6WA 1NPPA 3I55A 2PVGB 1JJ2S 2RJCA 3QO5A 4P73A 3CCST 3LW5E 3CBPA 3HRKA 4TQFA 5LJ5d 3UGTA 4P72A 3OS5A 3PGGA 1M4ZA 2RA2A 3MHXA 3ZFJA 3REUA 2RJFA 4JRPA 2ZZGA 4XEOA 2I2LA 4C92D 3HXYA 1H4QA 1WJQA 1N9WA 3G71A 3VBBA 2LRQA 4C5GA 1S72A 2K5LA 3VKIA 3JCMe 4XEMA 5GANf 3JSCA 1MGQA 2VC8A 1YJWT 4YRGA 2WSFE 3SD4A 2ZZFA 5KCOA 4K86A 2EJGA 4C8QF 3CCMA 2EQUA 3HKSA 3CXCS 4H2YA 4XTYA 3FDRA 1YHQA 1L0WA 1YIJT 5GAMj 5GMKj 1Q82U 1ZBXA 3FEOA 2LT1A 2H3JA 4XTWA 4OP0A 4E7LA 1EIFA 1YJNT 3PIOA 4FM4B 3WQZA 1K73U 4HKEA 4JS5A 4NL3A 4RMFA 2DXTA 3CCRT 5DLOA 3BJUA 2LVMA 1VQKA 2XDPA 4LDYA 3VQYA 2CZ6B 2ZPEB 3MEVA 1VQ6T 2MWOA 3RL6A 2FL7A 3CEYA 2DXUA 2ZR3A 4L59A 4C92B 2Q5HA 1R8OB 3JCMV 2AKWA 3R6OA 1O75A 3M4YA 2XDBA 1FYFA 3QKJA 2X4JA 3CMAA 4YRQA 1VQ5T 1VQOA 4EO4A 2DQ3A 3A5ZB 2XKOC 1B70A 3CCUT 1VQ7A 2E12A 5D6XA 4N4HA 2MWPA 2M1HA 3CC2A 1QW1A 3C12A 2HAXA 3UDCA 4EMKC 3C4SA 4ZTUB 5FU6C 1SESA 2PQWA 4GY5A 4TVWA 3FIFA 4M78C 2PU9B 1G3WA 2RB6A 5GAMd 3P8HA 3PT9A 1Q7YC 1Y7XA 4YRPA 3HFVA 3QIIA 1WJRA 5GAN2 1H4TA 1N9SA 2L3RA 3FLGA 3ME9A 2E64A 5ELOA 2ZT6A 2OTLA 3E9FA 1XTDA 4M78G 4NL2A 3E9HA 5I21A 4UP8A 3AHUA 5CR2A 4EMKB 1YBYA 4PJOD 5FU6B 3A32A 1EVLA 4M77E 1I4K1 3TREA 1E1OA 4M78B 3CCVT 4X9CA 2EL9A 4E47A 4WJ3M 4RG8A 4OGCA 4ZGEB 3BDUA 3OYKA 3OSVA 2EWNA 4F7UA 3HFNA 4RKUE 1YJ9A 4BDZA 2LDMA 3OYCA 2WSCE 1YITT 4OB2B 1PSFA 4PJOC 2J3MA 2GFAA 1JJCB 2QHVA 5KCHA 4UP9A 1K9MU 1BBWA 3JCMg 4HVCA 2X4YA 3HY0A 4E51A 4UC4A 1ZQ1A 5HKCA 3DB3A 4H2WA 4ZTZB 2CZ1B 4HT9A 4R55A 4YCWA 1QVGS 1GGMA 1D3BA 1OI1A 3CCJA 4ELZC 1IL2A 4BD3A 2RHSA 3DKMA 4M75E 3S3OA 2O4XB 3RUXA 4A54A 1UGRB 2ZPIB 5CKBA 3VYGA 3I7FA 5LL6S 5GANe 4PJOB 1W2BS 4ELYC 2RH2A 4B9WA 2D0QB 2CKKA 4ME7A 1NYQA 2AKWB 1BI2A 4M75G 4M78F 5GAN8 3QJYA 2L89A 1KG1A 3OS0A 2WACA 3BDLA 5M9OA 1Z7NA 2BKDN 5GAN3 4Y91A 1B34A 3CC7T 3J80E 4OLFA 4H2TA 4BWAA 2QQAA 4BI8B 3JCMJ 2QEXA 2DU7A 3RF1A 2YLBA 5LJ5h 4PLIA 1USYA 4XTUA 3SDZA 4MZMA 2EQJA 5C52B 4M7DC 2ZT8A 3LSSA 2LT4A 4N0AC 1JJ2A 2OAUA 5FRMA 2ZZDA 3QBYA 2DDZA 3SFMA 4HA8A 3G4SA 3I55T 1PYSA 2VYTA 3E9GA 3MCAB 2ODRD 1ASYA 4XU3A 1N8RU 3HXUA 4JLGA 1ASZA 1WU7A 3KXTA 4P75A 4RDXA 4M7DG 1NJIC 4IUQA 3JRZA 4PJOF 3G71T 5C51B 3FJPA 2DTOA 1S72T 2E65A 4L87A 4BUGA 3CXCA 3OS2A 3JCMQ 4H2SA 4B9XA 3CCMT 2ODRC 4M7DB 4UPAA 4F7UB 4CI0C 2P0LA 3V8LA 4P71C 3X26B 5F5WA 3L42A 1WJSA 2PMFA 5CQYA 2K4YA 2I4MA 4KR3A 2RJDA 2VXEA 5HY6A 2MI6A 3HXXA 2LX9A 4L5GA 4C8QE 4TVAB 4RCCA 2Y4XA 5LJ3f 1P92A 4XTXA 2EIFA 3CBMA 4E7HA 1QVFS 3PFSA 3GLXA 5GMKl 2ZPHB 2RK2A 2RI3A 2QA4A 4P3NA 3OYJA 4QVZA 4LDUA 3LSQA 4TTVA 1AHJB 3M4QA 1TH7A 2KK4A 3W3SA 3JCMh 1XQHA 3ICAA 3J81E 2VGMA 2RHSB 4CS2A 4P5NA 3PZCA 3QDRB 1GXIE 3N5BB 2RHUA 4LDXA 2DZ9A 3C95A 2HQXA 4JRKA 4J7FA 4RQEA 3CMAT 2DXCA 1NJ2A 1NJ1A 1VQOT 4MZPA 4YRSA 3CCQA 2QHSA 2NS6A 5GAMh 2I4LA 2QDYB 2WSEE 5CK9A 1VQ7T 4ZIBA 5GMKh 2XDDA 2XHCA 5GANg 3CC2T 2P0QA 4M7DF 3LC0A 1VQMT 4F7UF 3L2VA 3CPWS 4KR2A 1VQNA 2Q5IA 4AH6A 2QHTA 3E19A 2XG8D 2LCLA 1BKBA 1UB4A 3EFRA 1M90U 3L4GA 2CZ0B 3GOXA 4OF1A 4ZTFA 3DSQA 2PUKB 2E5AA 2DD4A 1KOGA 4A53A 2JZ2A 4J6XA 1KMMA 4LVKA 4V2SA 3GNGA 4P3PA 3FB9A 2OTLT 1B76A 2ZNJA 3M55A 5CAIA 1PYSB 3TEGA 4C0GA 4YPFA 2AMCA 4HWSA 2KAFA 4MMKA 2ZPGB 4H2UA 4TVRA 3VQXA 1N9RA 3URGA 4CH3A 5CO7A 4XTVA 3CC4A 2ZCFB 3GP8A 5C53B 3PMIA 3RMSA 4G84A 3X24B 1W4SA 2DQ0A 2FYKA 4GLKA 5CCAA 4R56A 1YJ9T 3HY1A 3HRIA 3QO8A 3OYIA 1K8AU 4C92C 1VQ4A 3VJPA 1KD1U 4JS4A 3OD1A 4YRNA 1KQSA 3L2ZA 3FC3A 1Y07A 4EX5A 4IUUA 4MDWA 5J39A 1OZ2A 4JDSA 3NFCA 3C94A 4YTLA 4PG3A 5J3BA 4M77A 3OYLA 3WVDB 2Y90A 4H2VA 4C92G 2ALYA 3LYIA 3P8DA 3MP1A 3CCJT 2R5AA 3G6EA 4K87A 4Q15A 4FIBA 3OYAA 5A0GA 3TEHA 1UEBA 2B8AA 3OW2A 2JOYA 5DLQE 3LGFA 1J5WA 3HFZA 3DLLA 4C0DC 4KULA 3QZ9B 1X01A 2RHZA 3A8MB 3JCMd 3M4GA 4NCXA 4P73C 5KNNA 3WXMB 3JB9D 4QQ6A 3GPLA 3NENA 1N6AA 3HRSA 2IY5B 5KE3A 2QQ9A 2MMPA 2KSSA 4P72C 3OYYA 2DD5A 3V8KA 1JBMA 3V8JA 1X2GA 3EFSA 3HP9A 5LJ3e 4LD9K 2R57A 2EQKA 3J7AF 2DTIA 2ZGWA 3G1ZA 2DO3A 4M78E 5ELNA 1E1TA 1X6OA 3SWNA 3L4GB 1OYXA 4CS4A 2KDSA 5I2SA 2OTJA 1QF6A 12ASA 3KBGA 4C0DB 4LDWA 3A8LB 2RK1A 1O9SA 3ERRA 3QSUA 4M77D 3RGLA 3G4ST 2ARSA 4BDYA 4IKFA 2Q7EA 2F69A 4BE2A 1C0AA 3LLRA 3V7SA 1LNXA 2D6FA 5GMKi 4K88A 2ZIMA 3CPFA 3PNWC 3CMEA 3CCSA 4FL6A 2XGTA 3CBOA 1HXDA 4P3OA 3OSSC 2CYZB 2HD0A 3R07A 4BI4A 3HRTA 1LYLA 3M9QA 4C92F 2LCCA 4PL6A 3NEMA 2GF7A 4FU6A 1NNHA 5LJ5f 4MDXA 4YREA 4XU2A 3IALA 4H02A 1G3YA 3OYGA 4YP0A 3LH0A 3BW1A 1YJWA 2AHJB 1G5HA 1M1KC 2PMEA 3RMQA 4PJOE 2F5TX 5IT9E 2GQVA 1X75C 3M54A 3M57A 3V7CA 11ASA 1Y71A 1X55A 3A7AA 2JN0A 3IKMB 3L1AA 4FSXA 3OYDA 1H641 3ER0A 4YRLA 4PJOG 4NS5A 4YRKA 3E1SA 2QA4T 4L6V5 1NE8A 4YRCA 3IG2A 2RI2A 3TUPA 4A4EA 1BI0A 3JCMc 5GANj 1UGSB 2DEQA 2BUDA 3LX7A 3JCMb 2Y4YA 3P8YA 4TVYA 5K1PA 2ZR2A 1HK9A 2DTHA 3TEHB 1E24A 5L8RE 3SWNC 2IG0A 4C0FA 3HXWA 3HFZB 2KQWA 2PUOB 4C8QA 3OS1A 4J7IA 3VUZA 3CCQT 1B70B 1VQZA 3QPHA 4J5YA 4YROA 3L2RA 1HC7A 4O5VA 1BI1A 3QYGB 2K2VA 3RESA 2ZINA 1VQNT 1NYRA 3JB9I 2C7IA 2RHIA 1EIYA 3JCMf 2X35A 1EQRA 2GCXA 2V8IA 1EVKA 1RL2A 2ZZEA 4XU0A 3CD6A 3X28B 3UGQA 5DY9A 4LVIA 1G5VA 4EPCA 1VUBA 3SWNB 4M7AA 4JJNK 4M7DE 2XU8A 4F7UE 3M53A 3BFMA 4C5IA 4J15A 3REXA 3QO7A 5LJ3g 3L2QA 2C8MA 3A8GB 1NPRA 4J6YA 5GAMf 4RMOA 3P8BB 1KHCA 2EAYA 2A3LA 2RO0A 5GANd 4F7UG 3MO8A 2E41A 3PMTA 2XD0A 2XI9A 1G5IA 4Q5WA 4LD6A 2VV5A 2BIVA 3CC4T 3GIBA 2KVQG 3A5YA 1Q7YU 1I81A 4N4IA 5GAOq 2QTXA 3M59A 2E3CA 4C8QD 3MEYA 1Z7MA 4E7KA 2L5QA 2EJFA 1YHQT 4CH6A 2O01E 2P0PA 4C0ZA 1BYMA 4YRMA 3OYNA 5CKEA 4HWPA 1VQ4T 3M56A 4JRIA 4KBMB 5AYFA 3JCMX 5IN1A 3QZ5B 5HK3A 1WYDA 5GAOm 2XICA 3NTKA 2P0KA 3MF2A 2CIMA 2IVWA 1VQKT 4M7AD 2L8DA 3HSBA 1B7YA 1D3BB 3MF1A 3TEEA 2E10A 1SRYA 4A4FA 4BY6C 3G6ET 2G3RA 4DA4A 3CCLA 1N27A 5FROA 4WI1A 5LJ5e 3LWHA 1M1KU 1USYC 3HPWA 4JLIA 2ZCEA 5FLXE 1BIBA 2KMTA 4FT4A 2QQBA 2EJ9A 3L2WA 4M7AC 1KHIA 1JB0E 3OY9A 5GAN4 2FVUA 4CRIA 1B8AA 2ZT7A 2K5FA 1B34B 2HNIA 3E9IA 4C8QB 2QHUA 1PSEA 5CKDA 4Y28E 3G7ZA 1RI0A 2K5IA 4P75C 1XOVA 2RM4A 4CH5A 5CKHA 3UH0A 3HRUA 2FB7A 5I2MA 4BY6B 1M8VA 1ZHIA 1EIYB 2GFUA 4XAXB 4E7JA 3I56A 4C5HA 3QUIA 3VQWA 1MHNA 2MAMA 1YFRA 1YI2A 2OTJT 5D6WA 1DJ7B 3HHTB 4M7AB 4NOYA 3NETA 5GAOr 3VV0A 3PCOA 4HCCA 2ZPFB 2DIGA 1IZ6A 4QQDA 3TU4K 2Q7HA 3VUBA 1XNIA 2QI2A 5IAYA 4ZTJA 2VUBA 4YRFA 3CMET 1Y96A 1M9SA 5FU7C 2EKOA 1VQ9A 2RHXA 4ZGDB 1VQ8A 4EMKA 3P8TA 1K9MC 3MEWA 3RKYA 4C5EA 3INZA 1WGSA 2DIQA 1RIQA 1YB3A 4M78A 5LJ3h 4O2DA 2EQMA 4WJ4A 1WQ7A 2XIDA 4IUVA 3MQZA 1QP2A 4PKCC 5A2QE 4YYEA 3V7RA 4RQFA 1NJ6A 3CCEA 3RERA 4DOWA 4PHCA 4C92E 3JCMP 2J3LA 1VQPA 1SETA 3H6ZA 1JJCA 2K3YA 1NJIU 5FU7B 5KH6A 1VQLA 3M4PA 4QVDA 3JB9H 1QVGA 2CJAA 2M16A 3TCJA 4XQ3A 5GAMe 1H4VB 4LVLA 5GMKe 3CMQA 2E1HA 2JNGA 3MEAA 1I8FA 4YRTA 1NJ8A 4M7AF 3VYHB 4DQ2A 3A8OB 2LTOA 1W2BA 1B7YB 3HXZA 2PVDB 4BI3A 4TWAA 2E6ZA 1H3ZA 5GAN6 4A4GA 2O4XA 1ADYA 1M5Q1 4A4HA 3QXEB 5E3IA 3JB9J 4PJOA 3META 3L2UA 2JVVA 1U1SA 1QE0A 1LOJA 4BW9A 1Q81C 2ZPBB 2DJZA 4OB3B 3P8VA 3PIPA 4YRIA 4M78D 3FRNA 1G3TA 3QHSA 5A0LA 4LDVA 4BACA 5LJ5g 2V8KA 5LJ3j 2G4CA 2JUFA 2M9UA 3QTCA 3RACA 2QEXT 4M75A 3RKWA 1VQMA 1N8RC 2V8JA 4ATOA 2R58A 3OYMA 4G85A 1W66A 3O8VA 4YDQA 3CD6T 3EAEA 2C06A 3OQ5A 4ZN1A 5GANh 2CS7A 1YCYA 4QVCA 2P5IA 2FHDA 3MEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTT A;  2VXF A;  4YRG A;  5GMK l;  4C8Q A;  2ZZF A;  1B70 B;  1VQZ A;  4K86 A;  2EJG A;  1G51 A;  4J5Y A;  4YRO A;  4C8Q F;  4P3N A;  1HC7 A;  4EMH A;  1JRI A;  3LSQ A;  4TTV A;  3M4Q A;  3PCO B;  3KFU A;  3RES A;  4H2Y A;  1TH7 A;  2ZIN A;  4XTY A;  2CGH A;  3JCM h;  3W3S A;  2AMC B;  3ICA A;  3JB9 G;  1NYR A;  3JB9 I;  2C7I A;  2YHT A;  1L0W A;  1EIY A;  3JCM f;  2RHS B;  4CS2 A;  1EQR A;  1Y96 B;  4YRJ A;  3PZC A;  1EVK A;  5GAM j;  1I5L A;  5GMK j;  2ZZE A;  4XU0 A;  5K1X A;  1X54 A;  4M77 C;  5DY9 A;  3UGQ A;  4XTW A;  2DZ9 A;  4OP0 A;  3A74 A;  4JRK A;  4RQE A;  3SB2 A;  3SWN B;  1NJ2 A;  4M7A A;  1NJ1 A;  4M7D E;  2RD1 A;  3WQZ A;  2DVE A;  3BY7 A;  4F7U E;  4YRS A;  3BFM A;  3QO3 A;  4NL3 A;  4RMF A;  2DXT A;  2QHS A;  4J15 A;  3REX A;  3QO7 A;  5GAM h;  5LJ3 g;  2I4L A;  4ZIB A;  5GMK h;  4M7D A;  2C8M A;  3BJU A;  4LNS A;  4N0A A;  5GAN g;  4M7D F;  4J6Y A;  3LC0 A;  5GAM f;  4F7U F;  4KR2 A;  3VQY A;  2EAY A;  3A7U A;  5LJ3 d;  2Q5I A;  4M77 G;  4AH6 A;  4H2X A;  4CS3 A;  5GAN d;  4F7U G;  2QHT A;  1KQ2 A;  4M75 D;  2E41 A;  3RL6 A;  1G5I A;  2DXU A;  2ZR3 A;  3EFR A;  3UFG A;  4C92 B;  3GIB A;  3L4G A;  2Q5H A;  2K57 A;  3JCM V;  2AKW A;  1X2H A;  1NJ5 A;  3A5Y A;  1I81 A;  1FYF A;  4TVA A;  3QNE A;  1YGB A;  4YRQ A;  3DSQ A;  4M77 B;  5GAO q;  2QTX A;  2E5A A;  1KOG A;  4A53 A;  4EO4 A;  2DQ3 A;  4J6X A;  2ALY B;  1KMM A;  2E3C A;  4EMG A;  3VU3 C;  4V2S A;  4C8Q D;  1B70 A;  4P3P A;  3MEY A;  1EFW A;  3FB9 A;  1Z7M A;  1B76 A;  3HXV A;  5CAI A;  2ZNJ A;  4HT8 A;  2EJF A;  1PYS B;  4CH6 A;  3TEG A;  4YRM A;  4EMK C;  2ART A;  4HWP A;  4M75 C;  2RHQ A;  4YPF A;  2AMC A;  4HWS A;  4UP7 A;  4ZTU B;  4JRI A;  4MMK A;  4KQE A;  4H2U A;  1SES A;  5GAM g;  4TVW A;  3FIF A;  3VQX A;  3JCM X;  1N9R A;  4P71 A;  4M78 C;  4CH3 A;  1WYD A;  1E22 A;  4XTV A;  5GAO m;  5C53 B;  2RB6 A;  5GAM d;  4G84 A;  2DQ0 A;  3MF2 A;  2FYK A;  4YRP A;  2CIM A;  3HFV A;  3JB9 F;  3HFO A;  4M7A D;  5GAN 2;  1H4T A;  3HSB A;  2I4N A;  1N9S A;  3A7R A;  1WQW A;  3HY1 A;  4MML A;  1B7Y A;  1D3B B;  3HRI A;  3MF1 A;  2E10 A;  2E64 A;  3QO8 A;  5ELO A;  2ZT6 A;  1SRY A;  4HWO A;  1WLE A;  4M7D D;  4M78 G;  4C92 C;  1BBU A;  4NL2 A;  3E9H A;  4WI1 A;  5I21 A;  5LJ5 e;  3OD1 A;  4YRN A;  1USY C;  4UP8 A;  3AHU A;  3L2Z A;  4JLI A;  4EX5 A;  4EMK B;  2ZCE A;  4M75 B;  4PJO D;  3RKX A;  1BIB A;  1YFS A;  2EJ9 A;  2DU5 A;  1LJO A;  3A32 A;  1EVL A;  4M77 E;  1I4K 1;  1E1O A;  4M7A C;  4M78 B;  4X9C A;  2EL9 A;  4WJ3 M;  4PG3 A;  4YCU A;  4P74 A;  3IKL A;  4M77 A;  2ZT5 A;  3BDU A;  5GAN 4;  2Y90 A;  2EWN A;  3NEL A;  4H2V A;  4F7U A;  1B8A A;  3HFN A;  4C92 G;  4M77 F;  2ZIO A;  2ALY A;  4TQD A;  2ZT7 A;  1B34 B;  2HNI A;  3E9I A;  4C8Q B;  4JUV A;  2QHU A;  1X56 A;  4P75 C;  2RM4 A;  4K87 A;  4CH5 A;  4Q15 A;  4PJO C;  3UH0 A;  2FB7 A;  2J3M A;  3TEH A;  2XTI A;  1M8V A;  1ATI A;  1JJC B;  2QHV A;  4UP9 A;  1BBW A;  3JCM g;  1EIY B;  4HVC A;  1J5W A;  3HY0 A;  4E51 A;  3HFZ A;  3HTZ A;  4H2W A;  2Q7G A;  3A31 A;  3QUI A;  3VQW A;  4ZTZ B;  1EOV A;  1X01 A;  4XU1 A;  1YFR A;  4HT9 A;  3JCM d;  4Q6G A;  3M4G A;  1ADJ A;  4NCX A;  4P73 C;  5KNN A;  3JB9 D;  5GAO p;  4YCW A;  3NEN A;  4M7A B;  5GAN 5;  4NOY A;  3NET A;  5GAO r;  2IY5 B;  4J6W A;  3PCO A;  1GGM A;  4P72 C;  1D3B A;  4RCB A;  4PNO A;  5GMK m;  2Q7H A;  2I4O A;  4CH4 A;  1IL2 A;  3V8K A;  2RHS A;  4YRF A;  1JBM A;  4M75 E;  1Y96 A;  3V8J A;  1U1T A;  1X2G A;  3EFS A;  5LJ3 e;  4HWR A;  4X5O A;  3RUX A;  4A54 A;  3I7F A;  5GAN e;  2DTI A;  2ZGW A;  4EMK A;  3P8T A;  4H2X B;  4PJO B;  3G1Z A;  3RKY A;  4M78 E;  2CJ9 A;  3INZ A;  5ELN A;  4M75 F;  1E1T A;  4C8Q C;  3SWN A;  1RIQ A;  3L4G B;  1YB3 A;  4CS4 A;  1NYQ A;  4M78 A;  5LJ3 h;  2AKW B;  4O2D A;  1QF6 A;  4M75 G;  12AS A;  4M78 F;  5GAN 8;  4XTZ A;  4WJ4 A;  3ERR A;  3QSU A;  1WQ7 A;  4M77 D;  3RGL A;  5GAN 7;  2ARS A;  1Z7N A;  5GAN 3;  4Y91 A;  1B34 A;  2Q7E A;  5LJ5 j;  1C0A A;  2ARU A;  2YLC A;  3V7S A;  1LNX A;  2DZC A;  3V7R A;  4YYE A;  4RQF A;  5GMK i;  1BIA A;  4K88 A;  4OLF A;  1NJ6 A;  4H2T A;  3RER A;  2ZIM A;  4PHC A;  4C92 E;  4YRR A;  4BWA A;  3JCM P;  2J3L A;  1YFT A;  5HGQ A;  2XGT A;  4C8Q G;  1HXD A;  2RHQ B;  1SET A;  4P3O A;  1JJC A;  5GAO l;  4X9D A;  3JCM J;  3VQV A;  3R07 A;  2DU7 A;  4C92 A;  3RF1 A;  1LYL A;  4C92 F;  4HWT A;  2YLB A;  5LJ5 h;  3M4P A;  2ZXF A;  4QVD A;  1USY A;  4XTU A;  3JB9 H;  2CJA A;  4P74 C;  3NEM A;  1NNH A;  5LJ5 f;  4XQ3 A;  5GAM e;  1H4V B;  4M7A E;  5C52 B;  4YRE A;  5GMK e;  4M7D C;  2ZT8 A;  4XU2 A;  3CMQ A;  2E1H A;  3IAL A;  2ZTG A;  4N0A C;  3A5Z A;  3LSS A;  4H02 A;  3RIR A;  1WNL A;  1I8F A;  4YP0 A;  3JCM W;  4DPG A;  4YRT A;  2DDZ A;  4HA8 A;  1NJ8 A;  3BW1 A;  1PYS A;  2IY5 A;  4M7A F;  4DQ2 A;  1B7Y B;  5GAO n;  3HXZ A;  1KQ1 A;  2ODR D;  1G5H A;  1ASY A;  4TWA A;  2PME A;  4M7A G;  4XU3 A;  4YCV A;  3HXU A;  2DKG A;  4PJO E;  1SER A;  1ASZ A;  5GAN 6;  1WU7 A;  4P75 A;  4RDX A;  1ADY A;  1M5Q 1;  3V7C A;  11AS A;  4M7D G;  5E3I A;  3JB9 J;  4PJO A;  1X55 A;  3A7A A;  1U1S A;  2JN0 A;  3IKM B;  4PJO F;  3L1A A;  5C51 B;  1QE0 A;  3FJP A;  4WF2 A;  2DTO A;  1LOJ A;  4BW9 A;  1KMN A;  2DJZ A;  1H64 1;  3P8V A;  4YRI A;  4M78 D;  4PJO G;  4YRL A;  2E65 A;  2CJB A;  3QHS A;  4L87 A;  4YRK A;  2ZNI A;  3JCM Q;  1MGQ A;  4H2S A;  1WPY A;  1H4S A;  5LJ5 g;  4M7D B;  2ODR C;  4UPA A;  4YRC A;  3IG2 A;  4F7U B;  3QO5 A;  3TUP A;  5LJ3 j;  2P0L A;  4P73 A;  3JCM c;  2G4C A;  3V8L A;  5GAN j;  2DEQ A;  4P71 C;  3HRK A;  3QTC A;  3JCM b;  5F5W A;  3RAC A;  4TQF A;  5LJ5 d;  2PMF A;  3UGT A;  4P72 A;  3PGG A;  3P8Y A;  4M75 A;  3RKW A;  4TVY A;  2RA2 A;  2I4M A;  5K1P A;  2ZR2 A;  4KR3 A;  1HK9 A;  4G85 A;  1W66 A;  3REU A;  2DTH A;  2VXE A;  3TEH B;  1E24 A;  4YDQ A;  3HXX A;  2ZZG A;  3SWN C;  2I2L A;  4C92 D;  4XEO A;  3HXY A;  1H4Q A;  3HXW A;  1N9W A;  3HFZ B;  3VBB A;  5GAN h;  1YCY A;  4C8Q E;  4TVA B;  4RCC A;  4QVC A;  5LJ3 f;  2P5I A;  3JCM e;  4XEM A;  4XTX A;  5GAN f;  2VC8 A; 
#chains in the Genus database with same CATH topology
 2F5K A;  3CC4 Q;  1HTT A;  2VXF A;  3A1P A;  3PE0 A;  3VS4 A;  3OYF A;  4OGE A;  1G51 A;  4X34 A;  3PTA A;  4EMH A;  1JRI A;  5DM7 R;  1PCX A;  3PCO B;  4RG2 A;  3KFU A;  1R0B G;  4J9E A;  2DPP B;  2CGH A;  2AMC B;  3JB9 G;  4FW1 A;  4OB1 B;  3S3M A;  2YHT A;  2MF2 A;  1CKA A;  4PFO A;  4E7S A;  1RUW A;  2E6N A;  1Y96 B;  4YRJ A;  1X69 A;  5FRN A;  4A4K A;  1SSF A;  1VQ4 Q;  1I5L A;  1M3B A;  1KC8 C;  5K1X A;  4OMF B;  1X54 A;  1AVZ C;  3Q1J A;  4M77 C;  3UWN A;  3JAM E;  3A74 A;  4AFS C;  2LC4 A;  3SB2 A;  1VQP Q;  4KUI A;  2NLU A;  3A8H B;  2RD1 A;  2DVE A;  3BY7 A;  2GQI A;  2X3W D;  3QO3 A;  1K4U S;  1WX6 A;  1V29 B;  4LVM A;  4M7D A;  4LNS A;  4J8O A;  4QW2 A;  4AFQ C;  4J83 A;  4N0A A;  3OYH A;  1UUE A;  4ZGJ B;  4BE1 A;  1TSF A;  3A7U A;  4KH0 B;  5LJ3 d;  4M77 G;  5C0M A;  4BE0 A;  4H2X A;  3MP8 A;  4DEX A;  3UPU A;  1QVP A;  3I5S A;  4CS3 A;  3H8Z A;  1I07 A;  1B7T A;  1KQ2 A;  4M75 D;  2JS0 A;  3G6E Q;  3X20 B;  1YIJ A;  2X51 A;  1QVF A;  2EYQ A;  2KY9 A;  2ED1 A;  1VIF A;  3UFG A;  1X6G A;  3WVE B;  4IUR A;  2K57 A;  1CKB A;  5EC7 A;  1X2H A;  1NJ5 A;  1KQS S;  4TVA A;  1QLY A;  3H0I A;  3QNE A;  4LXC A;  1YGB A;  4QQG A;  5C6S A;  4M77 B;  3RR6 A;  1YJN A;  1G3S A;  1OX8 A;  2D9T A;  2ALY B;  4EMG A;  4Z89 A;  3VU3 C;  2F1L A;  3CCR A;  3M5A A;  2HQE A;  1NEG A;  1EFW A;  4XK8 E;  3HXV A;  4OB0 B;  2J06 A;  3OMC A;  4HT8 A;  3CQT A;  3CCL T;  2ART A;  4M75 C;  3RNJ A;  2RHQ A;  1HSQ A;  3IQL A;  1I1J A;  1VQ6 A;  4OMN A;  4UP7 A;  4KQE A;  5IHI A;  4II1 A;  1GRI A;  1ZSG A;  2JTM A;  5GAM g;  3THK A;  1Q86 C;  2HBP A;  3MP6 A;  1FWZ A;  1NZ9 A;  3QJ6 A;  4P71 A;  4IIM A;  2KYB A;  1E22 A;  1Y57 A;  3T9N A;  2ESW A;  1M90 C;  2V1R A;  2DL3 A;  5KYU B;  5KE2 A;  2KT1 A;  2CP6 A;  5CKF A;  4FT2 A;  3OW2 S;  2E70 A;  3CPW A;  2HL3 A;  1FXX A;  1VQ5 A;  3JB9 F;  2DXB A;  2ENM A;  5FWC A;  3HFO A;  2KNB B;  2JTF A;  2I4N A;  1SPK A;  1IRE B;  4HCZ A;  1RAF B;  1WQW A;  2OX7 A;  2A8E A;  3A7R A;  4MML A;  5CVI A;  2R5M A;  2OTJ Q;  3CCU A;  3H0H A;  1OU9 A;  2X4X A;  4HWO A;  1WLE A;  4M7D D;  1FX7 A;  2VGN A;  1WHG A;  1IRX A;  1BBU A;  1AOJ A;  1UG1 A;  3NHN A;  3QG1 A;  1QCF A;  2PVO B;  2K2M A;  5D6Y A;  4M75 B;  2CZ7 B;  2X3X D;  3RKX A;  4J9I A;  3OYE A;  1YFS A;  3CME Q;  1QP3 A;  3CCS Q;  3I56 T;  3QYH B;  2DU5 A;  1LJO A;  2M0O A;  4E7I A;  1WA7 A;  2RI5 A;  1UGP B;  5J26 A;  1YI2 T;  2W10 A;  4JJC A;  5A0D A;  4YCU A;  4P74 A;  1Q81 U;  3IKL A;  3H41 A;  2E5Q A;  2A08 A;  2ZT5 A;  3NEL A;  3S6W A;  2DET A;  2ZIO A;  4M77 F;  4LVJ A;  1KK7 A;  4TQD A;  4JUV A;  2LJ1 A;  1X56 A;  3SHW A;  3KUF A;  2C0T A;  2KRO A;  1K8A C;  1ACM B;  2KE9 A;  1SEM A;  2RHY A;  1YJW Q;  1VQ9 T;  1KD1 C;  4Z02 A;  3UT1 A;  1NEB A;  2XTI A;  1ATI A;  1Q82 C;  1VQ8 T;  1GCQ A;  4JRQ A;  2K3X A;  1SF9 A;  3DLM A;  3ZL7 C;  3HTZ A;  1RI9 A;  2Q7G A;  3A31 A;  2L0A A;  4DOV A;  4LUE A;  1K1Z A;  4PLL A;  1EOV A;  2CUB A;  3RDV A;  1BK2 A;  4XU1 A;  3CCV A;  1K73 C;  4Q6G A;  1ADJ A;  4B6M A;  1T0H A;  4KT0 E;  1HYO A;  5GAO p;  3ZEH A;  3X25 B;  5GAN 5;  4J6W A;  2YUO A;  2EKH A;  2RJE A;  4RCB A;  3HL8 A;  4PNO A;  5GMK m;  2I4O A;  1KQS P;  1YIT A;  1K0S A;  4CH4 A;  1TUD A;  1BCM A;  3FJ5 A;  3CCE T;  2LQK A;  2EQI A;  2P4T A;  1EFN A;  1OZ3 A;  1YJN Q;  2AZS A;  3OBW A;  1M1F A;  1U1T A;  1ARK A;  4X5O A;  3OA6 A;  4HWR A;  1VQP T;  1WYX A;  2LQ8 A;  4H2X B;  3LGL A;  1VQL T;  2CJ9 A;  1ZUY A;  2L3P A;  2ATC B;  4M75 F;  1MV3 A;  3ZBD A;  2DK3 A;  3MJX A;  4C8Q C;  1ZSZ C;  1KC8 U;  2DLP A;  1U8R A;  4OVA A;  3ASK A;  1VIE A;  4KUD K;  1C1A A;  3DB4 A;  4HCB A;  4XTZ A;  2E5K A;  2A7Y A;  2QQR A;  3JV3 A;  3NTH A;  2EYZ A;  5GAN 7;  2YRV A;  2X9H A;  5LJ5 j;  3OB9 A;  4PJL A;  2ARU A;  2YLC A;  4VUB A;  2DZC A;  4LN2 A;  1BIA A;  1T0J A;  2A37 A;  4YRR A;  1M1G A;  3GNF B;  3LWI A;  2ROT A;  1YFT A;  2EFI A;  5HGQ A;  1X2Q A;  4C8Q G;  2RHQ B;  5GAO l;  4X9D A;  3VQV A;  4C92 A;  2JW4 A;  4HWT A;  3TSZ A;  1YFN A;  2ZXF A;  3OBY A;  3F70 A;  4HT4 A;  3M0Q A;  4P74 C;  4M7A E;  5HK0 A;  4N4G A;  4IUP A;  2ZTG A;  3A5Z A;  3RIR A;  1WNL A;  1PD0 A;  1T3S A;  1FYN A;  1M1K R;  4ZN3 A;  3JCM W;  4DPG A;  4CC3 A;  1ZUK A;  2QQS A;  4MZT A;  3QWX X;  2IY5 A;  1KSW A;  4IUT A;  2X4W A;  2DYI A;  2BTT A;  5CIU A;  3OYB A;  3CC7 A;  5GAO n;  1KQ1 A;  2FPF A;  2LNV A;  2QYZ A;  1H92 A;  4M7A G;  2CT3 A;  4HXJ A;  1R0C B;  4YCV A;  2DKG A;  1GCQ C;  1SER A;  4O6J A;  3M58 A;  3NTI A;  1WHL A;  2YT6 A;  4IIO A;  2P4R A;  1Q86 U;  3PVQ A;  5CQX A;  3S3N A;  4WF2 A;  1KMN A;  1BI3 A;  2YRD A;  3ULR B;  1AEY A;  4BB7 A;  2ZAE A;  2XK0 A;  4CC4 B;  1UGQ B;  2VAS A;  5EG2 A;  2CJB A;  2QXF A;  2DAQ A;  2ZNI A;  3GF5 A;  2QAZ A;  1WPY A;  1H4S A;  3OMG A;  4EDU A;  4D6W A;  1NPP A;  3I55 A;  2PVG B;  1JJ2 S;  2RJC A;  2J6F A;  3QO5 A;  4P73 A;  1GBR A;  4F16 A;  3CCS T;  3LW5 E;  3CBP A;  3HRK A;  4TQF A;  5LJ5 d;  3UGT A;  4P72 A;  3OS5 A;  2BE7 D;  3PGG A;  1M4Z A;  3MHX A;  2RA2 A;  3ZFJ A;  3REU A;  2HL5 C;  3REA B;  2RJF A;  4JRP A;  2ZZG A;  4XEO A;  2I2L A;  4C92 D;  1YWO A;  3HXY A;  1H4Q A;  8AT1 B;  1WJQ A;  1N9W A;  3G71 A;  1AWW A;  3VBB A;  3EG9 B;  3UA6 A;  2LRQ A;  4C5G A;  1S72 A;  2K5L A;  2FO0 A;  3VKI A;  3JCM e;  4XEM A;  2BE9 B;  1M30 A;  3JSC A;  1MGQ A;  2VC8 A;  5GAN f;  1YJW T;  4YRG A;  2WSF E;  3SD4 A;  2ZZF A;  1GBQ A;  5KCO A;  4K86 A;  2EJG A;  2M51 A;  4C8Q F;  3CCM A;  1UEC A;  2RN8 A;  2EQU A;  2DYB A;  3HKS A;  3EFO A;  3CXC S;  2SRC A;  4H2Y A;  4XTY A;  1ZX6 A;  2DRM A;  2DL7 A;  3FDR A;  1YHQ A;  1L0W A;  3EGX B;  1W1F A;  2J6O A;  1S1N A;  2DE0 X;  2K6D A;  1YIJ T;  3CCL Q;  5GAM j;  5GMK j;  1Q82 U;  2VWF A;  1ZBX A;  3FEO A;  2LT1 A;  1VYU A;  3UF4 A;  2H3J A;  4XTW A;  4OP0 A;  2JS2 A;  2H8H A;  4E7L A;  1WFW A;  1EIF A;  4X1V A;  3QDF A;  1YJN T;  3PIO A;  4FM4 B;  1KIK A;  3WQZ A;  2E4H A;  4J9B A;  1K73 U;  4HKE A;  4JS5 A;  4NL3 A;  4RMF A;  2DXT A;  3CCR T;  5DLO A;  3BJU A;  2LVM A;  1RAH B;  1VQK A;  2XDP A;  3VS3 A;  1KJW A;  1TTH B;  4LDY A;  3VQY A;  2BZX A;  2CZ6 B;  2ZPE B;  3MEV A;  1VQ6 T;  2MWO A;  3RL6 A;  4FCY A;  2FL7 A;  3CEY A;  4HVU A;  1YWP A;  2DXU A;  2ZR3 A;  4L59 A;  2LP5 A;  4C92 B;  2Q5H A;  1AD5 A;  1M2V A;  1R8O B;  3JCM V;  2AKW A;  1JO8 A;  2DL8 A;  3MPU B;  3R6O A;  1O75 A;  3M4Y A;  2XDB A;  1FYF A;  5FWB A;  3QKJ A;  2X4J A;  2GNC A;  3CMA A;  1PC0 A;  4YRQ A;  3BE3 A;  1VQ5 T;  1VQO A;  4EO4 A;  1V76 A;  2FZC B;  2DQ3 A;  3A5Z B;  1YI2 Q;  2XKO C;  1VOM A;  3CCU T;  1B70 A;  1VQ7 A;  2E12 A;  3H0F A;  5D6X A;  4N4H A;  2MWP A;  2M1H A;  3CC2 A;  1QW1 A;  2HKN A;  4LNP A;  3C12 A;  2HAX A;  3UDC A;  4EMK C;  4DBH A;  3C4S A;  4ZTU B;  4OMM A;  4F17 A;  3VS7 A;  5FU6 C;  1SES A;  1IHV A;  2A0F B;  2PQW A;  4GY5 A;  1JJ2 P;  3FIF A;  4TVW A;  2YUN A;  4M78 C;  1SHG A;  2PU9 B;  4OML A;  2FRY A;  1G3W A;  3NMZ C;  2AIR B;  1VQ9 Q;  3RBB B;  1D0Y A;  1VQ8 Q;  2RB6 A;  5GAM d;  1M8M A;  1OV3 A;  3P8H A;  3PT9 A;  1Q7Y C;  4K11 A;  4JZ4 A;  1AT1 B;  2KEA A;  1Y7X A;  4YRP A;  3HFV A;  2COY A;  3QII A;  1WJR A;  2HZY A;  5GAN 2;  1H4T A;  4QKU A;  2JJ9 A;  1N9S A;  2L3R A;  1AWJ A;  2KXD A;  3FLG A;  1HD3 A;  3ME9 A;  2E64 A;  1X43 A;  2ZT6 A;  5ELO A;  2OTL A;  5IHN A;  3E9F A;  1XTD A;  4M78 G;  3AT1 B;  1D09 B;  4NL2 A;  3E9H A;  4CC7 A;  5I21 A;  4UP8 A;  3AHU A;  2DIL A;  5CR2 A;  4EMK B;  1YBY A;  2F2V A;  2KT8 A;  2QAS A;  1UDL A;  3CCE Q;  4PJO D;  3CXC P;  2LQN A;  5FU6 B;  3A32 A;  1GL5 A;  1EVL A;  4M77 E;  1I4K 1;  3TRE A;  1E1O A;  4M78 B;  3CCV T;  1RAI B;  4X9C A;  1W6X A;  2HBW A;  2DX1 A;  2EL9 A;  3M0T A;  4E47 A;  4WJ3 M;  2B86 A;  1VQL Q;  2FZG B;  1WHH A;  4RG8 A;  4OGC A;  4ZGE B;  3BDU A;  3OYK A;  3OSV A;  2E3H A;  2EWN A;  2PTK A;  4F7U A;  3HFN A;  4RKU E;  1YJ9 A;  4BDZ A;  2HCK A;  2RMO A;  2LDM A;  3OYC A;  1U06 A;  2ECZ A;  2WSC E;  1YIT T;  4OB2 B;  1ZA2 B;  1PSF A;  2HEQ A;  2KI7 A;  3EFO B;  4PJO C;  2SEM A;  2J3M A;  2GFA A;  1JJC B;  2QHV A;  2XMF A;  5KCH A;  4UP9 A;  1K9M U;  1BBW A;  3JCM g;  4HVC A;  2X4Y A;  2O2O A;  3HY0 A;  4E51 A;  4UC4 A;  1TUC A;  4E6R A;  1ZQ1 A;  5HKC A;  3DB3 A;  2EYX A;  4H2W A;  1JXO A;  4WCI A;  2L2P A;  4ZTZ B;  1PNJ A;  1OQK A;  2CZ1 B;  4HT9 A;  4R55 A;  4YCW A;  1Y0M A;  2D8H A;  1QVG S;  1GGM A;  1D3B A;  2K7A A;  3EHQ A;  1OI1 A;  3CCJ A;  1K9M R;  1Q95 G;  2Z0W A;  4ELZ C;  1IL2 A;  4BD3 A;  3O5Z A;  2RHS A;  3DKM A;  1U3O A;  1UTI A;  4KGV B;  4M75 E;  3S3O A;  3VS2 A;  2O4X B;  3RUX A;  4A54 A;  1UGR B;  2ZPI B;  5CKB A;  3VYG A;  3I7F A;  5LL6 S;  2A28 A;  5GAN e;  2DMO A;  2AZV A;  4PJO B;  1W2B S;  4ELY C;  3CC2 Q;  1VQM Q;  2RH2 A;  4B9W A;  2D0Q B;  2DFU A;  2P84 A;  2CKK A;  4ME7 A;  1NYQ A;  4R0K A;  3VS1 A;  2AKW B;  1BI2 A;  4M75 G;  4M78 F;  5GAN 8;  3QJY A;  1Z9Z A;  2O9V A;  2L89 A;  1KG1 A;  3VS6 A;  3OS0 A;  1C0M A;  2WAC A;  1ABQ A;  3BDL A;  5M9O A;  1Z7N A;  2BKD N;  5GAN 3;  4Y91 A;  1B34 A;  3CC7 T;  2L3S A;  3J80 E;  2AT1 B;  1IHW A;  2FG0 A;  4A63 B;  4OLF A;  4H2T A;  4Y92 A;  4JJD A;  2OI3 A;  2DA9 A;  1WI7 A;  4BWA A;  4F14 A;  2HKQ B;  2QQA A;  4BI8 B;  3JCM J;  2EGE A;  2KR3 A;  2QEX A;  2DU7 A;  1CSK A;  3RF1 A;  2RQT A;  8ATC B;  2M0Y A;  3I35 A;  2NUT A;  2YRC A;  2YLB A;  5LJ5 h;  4PLI A;  1USY A;  1OPK A;  4XTU A;  3SDZ A;  2A36 A;  4MZM A;  2EQJ A;  5C52 B;  4M7D C;  2ZT8 A;  3LSS A;  2LT4 A;  4N0A C;  1JJ2 A;  1EZZ B;  2OAU A;  5FRM A;  2ZZD A;  5I22 A;  3QBY A;  2D1X A;  2DDZ A;  3SFM A;  2JXB A;  4HA8 A;  3EH1 A;  3G4S A;  3I55 T;  2K79 A;  1PYS A;  2VYT A;  4KGX B;  3E9G A;  2EW3 A;  3MCA B;  2HSP A;  2ODR D;  1ASY A;  2D0N A;  4QT7 A;  2JT4 A;  3KFV A;  4XU3 A;  1N8R U;  3HXU A;  4JLG A;  1ASZ A;  1Q81 R;  1WU7 A;  3KXT A;  4P75 A;  4RDX A;  4M7D G;  1NJI C;  4ANJ A;  3H9N A;  4IUQ A;  1ZLM A;  1WXB A;  4DBR A;  3JRZ A;  4PJO F;  5I11 A;  5L23 A;  3G71 T;  5C51 B;  3FJP A;  2DTO A;  1S72 T;  1YIJ Q;  2E3I A;  4AT1 B;  2E65 A;  1MMD A;  4L87 A;  4BUG A;  3CXC A;  3OS2 A;  3JCM Q;  1RAB B;  4B9X A;  4H2S A;  1OU8 A;  3CCM T;  4M7D B;  2ODR C;  4PFZ A;  4UPA A;  1N8R R;  4F7U B;  4CI0 C;  2P0L A;  3VRZ A;  3V8L A;  2DNU A;  1E7O A;  4P71 C;  3X26 B;  3CCR Q;  5F5W A;  3L42 A;  1WJS A;  4OMP A;  2PMF A;  2VB6 A;  5CQY A;  2QTV A;  2K4Y A;  1QVG P;  2I4M A;  4KR3 A;  2RJD A;  2VXE A;  3D7S B;  5HY6 A;  2MI6 A;  1VQ6 Q;  3HXX A;  2LX9 A;  2QGG A;  1MUZ A;  4L5G A;  4C8Q E;  4TVA B;  1BCO A;  4RCC A;  2Y4X A;  5LJ3 f;  1JQQ A;  1P92 A;  5IH2 A;  2NUZ A;  1MNE A;  3M0P A;  2EIF A;  4XTX A;  3CBM A;  4E7H A;  1W2B P;  1QVF S;  3PFS A;  3GLX A;  5GMK l;  2ZPH B;  2RK2 A;  2RI3 A;  3M0U A;  2QA4 A;  1BBZ A;  3OW2 P;  4P3N A;  3OYJ A;  4QVZ A;  4LDU A;  3LSQ A;  1VQ5 Q;  4TTV A;  1AHJ B;  2MIO A;  3M4Q A;  1TH7 A;  1G83 A;  2KK4 A;  3W3S A;  3JCM h;  1XQH A;  1KC8 R;  3ICA A;  3J81 E;  2VKN A;  3CCU Q;  2VGM A;  2RHS B;  4CS2 A;  4P5N A;  3PZC A;  3QDR B;  1GXI E;  3EGD A;  3N5B B;  4E7Z A;  2RHU A;  4LDX A;  2DZ9 A;  3C95 A;  2HQX A;  2EGC A;  2YUQ A;  2OAW A;  4J7F A;  4JRK A;  4RQE A;  3CMA T;  2DXC A;  4Z88 A;  2ED0 A;  1NJ2 A;  1NJ1 A;  2V26 A;  1QCN A;  1VQO T;  2DF6 A;  2MYS A;  4MZP A;  4YRS A;  4PK4 A;  3CCQ A;  2QHS A;  2NS6 A;  2C0O A;  5GAM h;  2I4L A;  2QDY B;  2WSE E;  5CK9 A;  1VQ7 T;  4ZIB A;  5GMK h;  2XDD A;  1MV0 B;  2XHC A;  1NM7 A;  5GAN g;  3CC2 T;  2P0Q A;  2W0Z A;  4M7D F;  3LC0 A;  7AT1 B;  1N5Z A;  1VQM T;  4F7U F;  3L2V A;  3CPW S;  4KR2 A;  1VQN A;  4J9H A;  2Q5I A;  4AH6 A;  1FMV A;  2O9S A;  2QHT A;  4FSS A;  2YDL A;  3E19 A;  2XG8 D;  2LCL A;  1MMN A;  1BKB A;  1GCP A;  1UB4 A;  3U23 A;  1H8K A;  3EFR A;  1M90 U;  3LH5 A;  3L4G A;  2CZ0 B;  3GOX A;  2NUT B;  4OF1 A;  1FMK A;  1X6B A;  2CSQ A;  4AFZ C;  1D1C A;  1IGQ A;  4D8D A;  4ZTF A;  1TWB A;  3DSQ A;  2PUK B;  3EH2 A;  2E5A A;  2DD4 A;  1KOG A;  4A53 A;  2JZ2 A;  4J6X A;  4RUG A;  1KMM A;  4LVK A;  3CCV Q;  4V2S A;  3GNG A;  2LJ0 A;  4RTV A;  1KFZ A;  4P3P A;  1YP5 A;  3FB9 A;  1K9A A;  2OTL T;  1B76 A;  1Q86 R;  3M55 A;  5CAI A;  2ZNJ A;  2I0N A;  1PYS B;  2AKK A;  3TEG A;  3EG1 A;  4C0G A;  4KRT A;  1SKU B;  4YPF A;  3GBQ A;  2AMC A;  1RAD B;  4HWS A;  2KAF A;  1M90 R;  4MMK A;  2ZPG B;  2IIM A;  4H2U A;  4RTU A;  1YIT Q;  4M4Z A;  2JM8 A;  4TVR A;  3VQX A;  1N9R A;  3URG A;  4CH3 A;  2HSE B;  1D1A A;  5CO7 A;  2L3Q A;  4XTV A;  3CC4 A;  2ZCF B;  4RTX A;  1PM3 A;  3GP8 A;  3E2U A;  5C53 B;  3PMI A;  3RMS A;  4G84 A;  3X24 B;  2MK5 A;  1W4S A;  2DQ0 A;  2FYK A;  4GLK A;  5KYX A;  4AG2 C;  5CCA A;  4R56 A;  1YJ9 T;  2H3E B;  1J3T A;  3HY1 A;  3HRI A;  1PKT A;  3QO8 A;  5GJW B;  3OYI A;  4DBF A;  1K8A U;  4C92 C;  1VQ4 A;  3VJP A;  2JMC A;  1KD1 U;  1TS9 A;  4JS4 A;  3OD1 A;  4YRN A;  2LMJ A;  2EGA A;  1KQS A;  2GGR A;  3L2Z A;  2QA4 Q;  3FC3 A;  1Y07 A;  4EX5 A;  2DBK A;  4IUU A;  1D1B A;  1M27 C;  2AK5 A;  4MDW A;  5J39 A;  1OZ2 A;  4JDS A;  2RNA A;  2FRW A;  2DRK A;  2JMA A;  3NFC A;  3C94 A;  4YTL A;  4PG3 A;  2ROL A;  5J3B A;  5HCK A;  4M77 A;  3WVD B;  3OYL A;  2QDL A;  2Y90 A;  2J7I A;  4H2V A;  1K8A R;  2DBM A;  4C92 G;  2ALY A;  3LYI A;  3P8D A;  1KD1 R;  4KGZ B;  1QCO A;  4PJM A;  3MP1 A;  1Q82 R;  3CCJ T;  1D0Z A;  2R5A A;  3G6E A;  1U5S A;  4K87 A;  4Q15 A;  2VVK A;  1I5O B;  2LCS A;  4FIB A;  1AWO A;  3EGU A;  3OYA A;  3CC7 Q;  5A0G A;  3TEH A;  1UEB A;  2B8A A;  3OW2 A;  2JOY A;  5DLQ E;  3LGF A;  4WTO B;  1K73 R;  4HVV A;  2NWM A;  1J5W A;  3HFZ A;  2CSI A;  3DLL A;  1F1B B;  1MMG A;  4OMQ A;  4ZNX A;  4C0D C;  4Z8A A;  4KUL A;  3QZ9 B;  1X01 A;  4J9G A;  2RHZ A;  3A8M B;  3JCM d;  3M4G A;  2KXC A;  1SSH A;  4NCX A;  4P73 C;  5KNN A;  3WXM B;  3JB9 D;  4QQ6 A;  3GPL A;  1LPL A;  3NEN A;  1N6A A;  1PRM C;  3HRS A;  2IY5 B;  1RLQ C;  5KE3 A;  4CC2 A;  2QQ9 A;  1PRL C;  2MMP A;  2RQU A;  2KSS A;  1A0N B;  4P72 C;  3OYY A;  1TXQ A;  1QKW A;  2DD5 A;  1VYV A;  2MPX C;  4GLM A;  3V8K A;  1JBM A;  3I55 Q;  3UA7 A;  2D8J A;  3V8J A;  1X2G A;  3EFS A;  3HP9 A;  5LJ3 e;  2QGF B;  1AZE A;  4LD9 K;  2R57 A;  2EQK A;  3J7A F;  2DTI A;  2ZGW A;  2FPE A;  3G1Z A;  2DO3 A;  4M78 E;  5ELN A;  5KYN A;  1LCK A;  1G8X A;  1YN8 A;  4FYV B;  5IXF A;  1E1T A;  1X6O A;  3SWN A;  1LVK A;  3L4G B;  1OYX A;  4CS4 A;  1C6V X;  2KDS A;  5I2S A;  2OTJ A;  1QF6 A;  12AS A;  3KBG A;  1WHJ A;  4C0D B;  4LDW A;  1AZG B;  3A8L B;  2RK1 A;  3G71 Q;  1O9S A;  3ERR A;  3QSU A;  4F04 B;  4M77 D;  3RGL A;  3G4S T;  2ARS A;  4BDY A;  1S72 Q;  4IKF A;  2RQW A;  2Q7E A;  2DL5 A;  2F69 A;  4BE2 A;  3UAT A;  1C0A A;  3LLR A;  2KGT A;  3V7S A;  2AKL A;  1LNX A;  2D6F A;  1RAG B;  5GMK i;  4FYW B;  4K88 A;  2ZIM A;  3CPF A;  3TQ7 P;  1SG5 A;  3PNW C;  3CCM Q;  2DJQ A;  3CME A;  1RAC B;  2O88 A;  2EYW A;  3CCS A;  4FL6 A;  3VS5 A;  3CBO A;  1HXD A;  2XGT A;  4P3O A;  3OSS C;  1WIE A;  2CYZ B;  2HD0 A;  3R07 A;  1IGU A;  4BI4 A;  3HRT A;  1LYL A;  3M9Q A;  4C92 F;  1YHQ Q;  1NYG A;  2LCC A;  4PL6 A;  3NEM A;  2GF7 A;  4FU6 A;  1NNH A;  5LJ5 f;  4MDX A;  4YRE A;  4XU2 A;  3IAL A;  1TG0 A;  4H02 A;  1G3Y A;  1ZUU A;  3OYG A;  2LX7 A;  4YP0 A;  5KYX B;  3LH0 A;  2JM9 A;  1UE9 A;  3BW1 A;  1YJW A;  2CP5 A;  1D0X A;  1OX9 A;  2AHJ B;  1G5H A;  1M1K C;  2PME A;  2DM1 A;  3EG0 A;  1I0C A;  1IO6 A;  3RMQ A;  1VQK Q;  1UHC A;  4PJO E;  2F5T X;  2EPD A;  5IT9 E;  3QWY A;  2GQV A;  1X75 C;  1Z9Q A;  3M54 A;  3M57 A;  2YXY A;  4FW2 A;  3V7C A;  11AS A;  1E6H A;  1Y71 A;  1X55 A;  3A7A A;  2JN0 A;  3IKM B;  3L1A A;  2QG9 B;  5KYY A;  4FSX A;  2NYS A;  1QWF A;  3OYD A;  1H64 1;  3ER0 A;  2MOX A;  4YRL A;  4PJO G;  1JEG A;  4NS5 A;  1H3H A;  3PVL A;  4YRK A;  2YWW A;  3E1S A;  4FYX B;  2QA4 T;  4L6V 5;  1YNZ A;  1PKS A;  2KRN A;  4JPB W;  1NE8 A;  3I9Q A;  3CMA Q;  3IG2 A;  2RI2 A;  4YRC A;  3TUP A;  4A4E A;  1BB9 A;  1BI0 A;  3JCM c;  1VQO Q;  2KYM A;  4RTY A;  5GAN j;  1UGS B;  2DEQ A;  2BUD A;  3LX7 A;  3JCM b;  2Y4Y A;  1VQ7 Q;  2FEI A;  3P8Y A;  4TVY A;  1M3A A;  1OUL A;  5K1P A;  2ZR2 A;  1UFF A;  1HK9 A;  5ECA A;  5KYW A;  2GTO A;  2DTH A;  3TEH B;  1JXM A;  1E24 A;  5L8R E;  2RF0 A;  3SWN C;  2IG0 A;  4C0F A;  1M2V B;  3HXW A;  3HFZ B;  5IXB A;  9ATC B;  5AT1 B;  2KQW A;  4PFP A;  2FPD A;  2PUO B;  1WDX A;  4C8Q A;  1ZSZ A;  4J7I A;  3I5R A;  3VUZ A;  3OS1 A;  2NUP A;  3NPF A;  3CCQ T;  1B70 B;  1VQZ A;  3QPH A;  4J5Y A;  1WHM A;  4YRO A;  4RTZ A;  3L2R A;  1HC7 A;  4O5V A;  1W70 A;  1BI1 A;  3QYG B;  4AFU C;  2CP7 A;  2K2V A;  2PZ1 A;  3RES A;  2CP3 A;  4D8K A;  2ZIN A;  4J9C A;  1VQN T;  1OOT A;  2COZ A;  1NYR A;  3JB9 I;  2C7I A;  2RHI A;  1EIY A;  3JCM f;  2OTL Q;  6AT1 B;  2X35 A;  1EQR A;  2GCX A;  2YSQ A;  2V8I A;  1EVK A;  5D7U A;  1RL2 A;  2ZZE A;  2K3B A;  4XU0 A;  3CD6 A;  3X28 B;  3UGQ A;  2HQH A;  5DY9 A;  4LVI A;  1M2O A;  1G5V A;  2CRE A;  2CUD A;  1WXU A;  4EPC A;  2J05 A;  1VUB A;  3SWN B;  4M7A A;  4JJN K;  4M7D E;  2KRM A;  2XU8 A;  4F7U E;  3M53 A;  3BFM A;  4C5I A;  4HCK A;  2LNH B;  4J15 A;  3REX A;  1XJW B;  1T3L A;  3QO7 A;  5LJ3 g;  3L2Q A;  2C8M A;  4PJN A;  3A8G B;  1NPR A;  2LQW A;  4J6Y A;  5GAM f;  4RMO A;  3P8B B;  3EG2 A;  1YJ9 Q;  1KHC A;  4J9D A;  2EAY A;  2A3L A;  4J9F A;  2DEU A;  1G2B A;  2RO0 A;  4HVW A;  5GAN d;  4F7U G;  3MO8 A;  2E41 A;  2G6F X;  3PMT A;  4PJJ A;  2GBQ A;  2XD0 A;  2XI9 A;  1G5I A;  4Q5W A;  4LD6 A;  2CH4 W;  2VV5 A;  2BIV A;  3CC4 T;  3GIB A;  2KVQ G;  2V1Q A;  2CP0 A;  3A5Y A;  1Q7Y U;  1I81 A;  2DL4 A;  3EG9 A;  4N4I A;  1QMC A;  1QWE A;  5GAO q;  2QTX A;  3M59 A;  3HTR A;  2E3C A;  3REB B;  4C8Q D;  3MEY A;  1X2K A;  1Z7M A;  4E7K A;  2L5Q A;  2EJF A;  1YHQ T;  4CH6 A;  2O01 E;  2P0P A;  4C0Z A;  1BYM A;  4YRM A;  3OYN A;  5CKE A;  2BZY A;  4HWP A;  1VQ4 T;  3M56 A;  1NG2 A;  4JRI A;  4ORZ A;  2ABL A;  4KBM B;  1X27 A;  5AYF A;  3CCJ Q;  1QKX A;  5IHK A;  1M3C A;  1Q7Y R;  3EGX A;  3JCM X;  5IN1 A;  1UJY A;  3QZ5 B;  5HK3 A;  1WYD A;  2EBP A;  5GAO m;  5FW9 A;  2XIC A;  3NTK A;  2P0K A;  5KYY B;  3MKD A;  3MF2 A;  1WLP B;  2CIM A;  1RAE B;  2O31 A;  2IVW A;  1JU5 C;  1VQK T;  4M7A D;  2L8D A;  3HSB A;  5GJV B;  4GBQ A;  1B7Y A;  1D3B B;  3MF1 A;  3TEE A;  2E10 A;  2DVJ A;  4LE9 A;  1EX4 A;  1SRY A;  2CP2 A;  4A4F A;  4BY6 C;  3G6E T;  2G3R A;  4FYY B;  4DA4 A;  3CCL A;  1N27 A;  3M0S A;  3VS0 A;  2KRS A;  3C0C A;  5FRO A;  4WI1 A;  5LJ5 e;  3LWH A;  1M1K U;  1IB8 A;  4AMC A;  1USY C;  2EVR A;  2M02 A;  3HPW A;  4JLI A;  2CDT A;  2ZCE A;  1B07 A;  5FLX E;  1BIB A;  4AG1 C;  2KMT A;  4FT4 A;  3VRY A;  2QQB A;  5KYW B;  2EJ9 A;  3G1J A;  1E6G A;  3L2W A;  4M7A C;  1SRL A;  2QEX Q;  1KHI A;  2MCN A;  1JB0 E;  2C0I A;  2RPN A;  3OY9 A;  2RQV A;  1V1C A;  1NBE B;  5GAN 4;  2FVU A;  4CRI A;  1B8A A;  3TVT A;  3CD6 Q;  2ZT7 A;  2K5F A;  1B34 B;  2FZK B;  2HNI A;  3E9I A;  4C8Q B;  1ZSZ B;  2NUP B;  2QHU A;  1PSE A;  5CKD A;  4Y28 E;  3G7Z A;  1RI0 A;  2K5I A;  4ESR A;  1UJ0 A;  4P75 C;  1HJD A;  1XOV A;  2RM4 A;  4CH5 A;  5CKH A;  3G4S Q;  2RQR A;  3M0R A;  3UH0 A;  3HRU A;  2FB7 A;  5I2M A;  4BY6 B;  1M8V A;  1ZBJ A;  1ZHI A;  1TUG B;  1EIY B;  2GFU A;  1PWT A;  2J6K A;  4XAX B;  4DBQ A;  4LUD A;  1GFC A;  3TSW A;  4E7J A;  1K0X A;  3I56 A;  1WHK A;  4C5H A;  3QUI A;  3VQW A;  1MHN A;  2CT4 A;  2MAM A;  1YFR A;  1YI2 A;  2YUP A;  2OTJ T;  1VA7 A;  3A98 A;  5D6W A;  1DJ7 B;  3HHT B;  1UHF A;  4M7A B;  1NLO C;  2HMA A;  4NOY A;  3NET A;  5GAO r;  3VV0 A;  3PCO A;  4HCC A;  2IPO B;  2ZPF B;  2DIG A;  1IZ6 A;  4QQD A;  3TU4 K;  2Q7H A;  1MND A;  3VUB A;  1XNI A;  2QI2 A;  5IAY A;  4ZTJ A;  2VUB A;  2COW A;  1YCS B;  4YRF A;  3CME T;  2DER A;  1Y96 A;  1M9S A;  5FU7 C;  2EKO A;  1VQ9 A;  2RHX A;  4ZGD B;  2JTE A;  1VQ8 A;  2F2W A;  4EMK A;  3P8T A;  1K9M C;  3MEW A;  1QQJ A;  3RKY A;  4C5E A;  1BU1 A;  3INZ A;  1WGS A;  4JZ3 A;  1PD1 A;  2DIQ A;  1PHT A;  2PNI A;  1RIQ A;  1YB3 A;  1MMA A;  4M78 A;  5LJ3 h;  4O2D A;  2EQM A;  4WJ4 A;  1WQ7 A;  2XID A;  4IUV A;  3MQZ A;  1QP2 A;  1QVF P;  4PKC C;  5A2Q E;  4YYE A;  3V7R A;  4RQF A;  1NJ6 A;  2GTJ A;  3CCE A;  3SEM A;  3RER A;  4DOW A;  4PHC A;  4C92 E;  3JCM P;  2J3L A;  1VQP A;  1SET A;  3H6Z A;  1JJC A;  2K3Y A;  1NYF A;  4JJB A;  1NJI U;  5FU7 B;  1ZA1 B;  5KH6 A;  1VQL A;  3M4P A;  4QVD A;  1SRM A;  1WZO A;  1PG5 B;  3NGP A;  3JB9 H;  1QVG A;  2CJA A;  2M16 A;  3TCJ A;  4XQ3 A;  5GAM e;  4KH1 B;  1H4V B;  4LVL A;  5GMK e;  3CMQ A;  2E1H A;  1B3Q A;  1VYT A;  2JNG A;  3MEA A;  1WXT A;  1I8F A;  1SHF A;  4YRT A;  3R6N A;  3EG3 A;  1NJ8 A;  2LJ3 A;  4M7A F;  1OEB A;  3VYH B;  4DQ2 A;  3A8O B;  2LTO A;  1W2B A;  1B7Y B;  3HXZ A;  3CCQ Q;  1NJI R;  1FMW A;  2PVD B;  4BI3 A;  4TWA A;  1RLP C;  1AWX A;  4RTT A;  2E6Z A;  4DEY A;  1H3Z A;  5GAN 6;  4A4G A;  2O4X A;  3CPW P;  1ADY A;  4EIK A;  1M5Q 1;  3EGD B;  1VQN Q;  4A4H A;  3QXE B;  1GFD A;  5KYU A;  5E3I A;  3JB9 J;  4PJO A;  3MET A;  3L2U A;  2F2X A;  1TU0 B;  2JVV A;  1U1S A;  1QE0 A;  1LOJ A;  4BW9 A;  1OPL A;  1Q81 C;  2ZPB B;  1TOV A;  2DJZ A;  4RTW A;  4OB3 B;  3P8V A;  3PIP A;  4YRI A;  4M78 D;  3FRN A;  1G3T A;  3QHS A;  5A0L A;  4LDV A;  4BAC A;  2HDA A;  1K76 A;  5LJ5 g;  3I56 Q;  1IXD A;  2V8K A;  2QK0 A;  5LJ3 j;  2G4C A;  2KBT A;  2JUF A;  2M9U A;  2CH4 A;  2K9G A;  4E2F B;  2LZ6 B;  3QTC A;  3RAC A;  2BZ8 A;  1UGV A;  2EYY A;  2QEX T;  1R77 A;  4M75 A;  3RKW A;  1VQM A;  1N8R C;  2V8J A;  1RAA B;  4ATO A;  2R58 A;  2OJ2 A;  1ABO A;  4OMO A;  3OYM A;  4G85 A;  1W66 A;  3EHR A;  3O8V A;  4YDQ A;  3CD6 T;  3EAE A;  2C06 A;  3OQ5 A;  4ZN1 A;  1NLP C;  5GAN h;  2CS7 A;  1YCY A;  4QVC A;  2P5I A;  2FHD A;  3MEU A; 
#chains in the Genus database with same CATH homology
 2F5K A;  1HTT A;  2VXF A;  3OYF A;  4OGE A;  1G51 A;  4X34 A;  3PTA A;  4EMH A;  1JRI A;  5DM7 R;  3PCO B;  4RG2 A;  3KFU A;  2DPP B;  2CGH A;  2AMC B;  3JB9 G;  4OB1 B;  3S3M A;  2YHT A;  2MF2 A;  2E6N A;  1Y96 B;  4YRJ A;  5FRN A;  4A4K A;  1SSF A;  1I5L A;  1KC8 C;  5K1X A;  4OMF B;  1X54 A;  4M77 C;  3Q1J A;  3UWN A;  3JAM E;  3A74 A;  2LC4 A;  3SB2 A;  4KUI A;  2NLU A;  3A8H B;  2RD1 A;  2DVE A;  3BY7 A;  3QO3 A;  1V29 B;  4LVM A;  4M7D A;  4LNS A;  4J8O A;  4QW2 A;  4J83 A;  4N0A A;  3OYH A;  4ZGJ B;  4BE1 A;  3A7U A;  5LJ3 d;  4M77 G;  5C0M A;  4BE0 A;  4H2X A;  3MP8 A;  4CS3 A;  3UPU A;  1QVP A;  3H8Z A;  1KQ2 A;  4M75 D;  3X20 B;  1YIJ A;  1QVF A;  2EYQ A;  2KY9 A;  1VIF A;  3UFG A;  3WVE B;  4IUR A;  2K57 A;  1X2H A;  1NJ5 A;  1KQS S;  4TVA A;  3QNE A;  1YGB A;  4QQG A;  5C6S A;  4M77 B;  1YJN A;  1G3S A;  2D9T A;  2ALY B;  4EMG A;  3VU3 C;  3CCR A;  3M5A A;  2HQE A;  1EFW A;  4XK8 E;  3HXV A;  4OB0 B;  3OMC A;  4HT8 A;  3CCL T;  2ART A;  4M75 C;  2RHQ A;  1VQ6 A;  4UP7 A;  4KQE A;  4II1 A;  2JTM A;  5GAM g;  1Q86 C;  2HBP A;  3MP6 A;  1FWZ A;  1NZ9 A;  3QJ6 A;  4P71 A;  1E22 A;  3T9N A;  1M90 C;  5KE2 A;  5CKF A;  4FT2 A;  3OW2 S;  2E70 A;  3CPW A;  1VQ5 A;  1FXX A;  3JB9 F;  2DXB A;  3HFO A;  2JTF A;  2I4N A;  1IRE B;  4HCZ A;  2A8E A;  1WQW A;  3A7R A;  4MML A;  5CVI A;  2R5M A;  3CCU A;  2X4X A;  4HWO A;  1WLE A;  4M7D D;  1FX7 A;  2VGN A;  1BBU A;  3QG1 A;  2PVO B;  5D6Y A;  4M75 B;  2CZ7 B;  3RKX A;  3OYE A;  1YFS A;  1QP3 A;  3I56 T;  3QYH B;  2DU5 A;  1LJO A;  2M0O A;  4E7I A;  2RI5 A;  5J26 A;  1UGP B;  1YI2 T;  5A0D A;  4YCU A;  4P74 A;  1Q81 U;  3IKL A;  2E5Q A;  2ZT5 A;  3NEL A;  3S6W A;  2ZIO A;  4M77 F;  4LVJ A;  4TQD A;  4JUV A;  1X56 A;  3KUF A;  1K8A C;  2RHY A;  1VQ9 T;  1KD1 C;  4Z02 A;  3UT1 A;  2XTI A;  1ATI A;  1Q82 C;  1VQ8 T;  4JRQ A;  2K3X A;  3DLM A;  3HTZ A;  2Q7G A;  3A31 A;  4DOV A;  4PLL A;  1EOV A;  4XU1 A;  3CCV A;  1K73 C;  4Q6G A;  1ADJ A;  4KT0 E;  5GAO p;  3ZEH A;  3X25 B;  5GAN 5;  4J6W A;  2RJE A;  4RCB A;  3HL8 A;  4PNO A;  5GMK m;  2I4O A;  1YIT A;  4CH4 A;  3CCE T;  2LQK A;  2P4T A;  1OZ3 A;  3OBW A;  1M1F A;  1U1T A;  4X5O A;  3OA6 A;  4HWR A;  1VQP T;  2LQ8 A;  4H2X B;  3LGL A;  1VQL T;  2CJ9 A;  4M75 F;  3ZBD A;  2DK3 A;  4C8Q C;  1KC8 U;  1U8R A;  4OVA A;  3ASK A;  1VIE A;  4KUD K;  4HCB A;  3DB4 A;  4XTZ A;  2A7Y A;  2QQR A;  3NTH A;  5GAN 7;  2YRV A;  5LJ5 j;  3OB9 A;  2ARU A;  2YLC A;  4VUB A;  2DZC A;  1BIA A;  4YRR A;  1M1G A;  3GNF B;  3LWI A;  1YFT A;  5HGQ A;  2EFI A;  4C8Q G;  2RHQ B;  5GAO l;  4X9D A;  3VQV A;  4C92 A;  4HWT A;  2ZXF A;  3OBY A;  3F70 A;  4HT4 A;  4P74 C;  4M7A E;  5HK0 A;  4IUP A;  4N4G A;  2ZTG A;  3A5Z A;  3RIR A;  1WNL A;  4ZN3 A;  3JCM W;  4DPG A;  2QQS A;  4MZT A;  2IY5 A;  4IUT A;  2X4W A;  5CIU A;  3OYB A;  3CC7 A;  5GAO n;  1KQ1 A;  2LNV A;  4M7A G;  4YCV A;  1SER A;  2DKG A;  4O6J A;  3M58 A;  3NTI A;  1Q86 U;  5CQX A;  3S3N A;  4WF2 A;  1KMN A;  1BI3 A;  4BB7 A;  2XK0 A;  1UGQ B;  5EG2 A;  2CJB A;  2QXF A;  2DAQ A;  2ZNI A;  3GF5 A;  1WPY A;  1H4S A;  3OMG A;  4EDU A;  4D6W A;  1NPP A;  3I55 A;  2PVG B;  1JJ2 S;  2RJC A;  3QO5 A;  4P73 A;  3CCS T;  3LW5 E;  3CBP A;  3HRK A;  4TQF A;  5LJ5 d;  3UGT A;  4P72 A;  3OS5 A;  3PGG A;  1M4Z A;  2RA2 A;  3MHX A;  3ZFJ A;  3REU A;  2RJF A;  4JRP A;  2ZZG A;  4XEO A;  2I2L A;  4C92 D;  3HXY A;  1H4Q A;  1WJQ A;  1N9W A;  3G71 A;  3VBB A;  2LRQ A;  4C5G A;  1S72 A;  2K5L A;  3VKI A;  3JCM e;  4XEM A;  5GAN f;  3JSC A;  1MGQ A;  2VC8 A;  1YJW T;  4YRG A;  2WSF E;  3SD4 A;  2ZZF A;  5KCO A;  4K86 A;  2EJG A;  4C8Q F;  3CCM A;  2EQU A;  3HKS A;  3CXC S;  4H2Y A;  4XTY A;  3FDR A;  1YHQ A;  1L0W A;  1YIJ T;  5GAM j;  5GMK j;  1Q82 U;  1ZBX A;  3FEO A;  2LT1 A;  2H3J A;  4XTW A;  4OP0 A;  4E7L A;  1EIF A;  1YJN T;  3PIO A;  4FM4 B;  3WQZ A;  1K73 U;  4HKE A;  4JS5 A;  4NL3 A;  4RMF A;  2DXT A;  3CCR T;  5DLO A;  3BJU A;  2LVM A;  1VQK A;  2XDP A;  4LDY A;  3VQY A;  2CZ6 B;  2ZPE B;  3MEV A;  1VQ6 T;  2MWO A;  3RL6 A;  2FL7 A;  3CEY A;  2DXU A;  2ZR3 A;  4L59 A;  4C92 B;  2Q5H A;  1R8O B;  3JCM V;  2AKW A;  3R6O A;  1O75 A;  3M4Y A;  2XDB A;  1FYF A;  3QKJ A;  2X4J A;  3CMA A;  4YRQ A;  1VQ5 T;  1VQO A;  4EO4 A;  2DQ3 A;  3A5Z B;  2XKO C;  1B70 A;  3CCU T;  1VQ7 A;  2E12 A;  5D6X A;  4N4H A;  2MWP A;  2M1H A;  3CC2 A;  1QW1 A;  3C12 A;  2HAX A;  3UDC A;  4EMK C;  3C4S A;  4ZTU B;  5FU6 C;  1SES A;  2PQW A;  4GY5 A;  4TVW A;  3FIF A;  4M78 C;  2PU9 B;  1G3W A;  2RB6 A;  5GAM d;  3P8H A;  3PT9 A;  1Q7Y C;  1Y7X A;  4YRP A;  3HFV A;  3QII A;  1WJR A;  5GAN 2;  1H4T A;  1N9S A;  2L3R A;  3FLG A;  3ME9 A;  2E64 A;  5ELO A;  2ZT6 A;  2OTL A;  3E9F A;  1XTD A;  4M78 G;  4NL2 A;  3E9H A;  5I21 A;  4UP8 A;  3AHU A;  5CR2 A;  4EMK B;  1YBY A;  4PJO D;  5FU6 B;  3A32 A;  1EVL A;  4M77 E;  1I4K 1;  3TRE A;  1E1O A;  4M78 B;  3CCV T;  4X9C A;  2EL9 A;  4E47 A;  4WJ3 M;  4RG8 A;  4OGC A;  4ZGE B;  3BDU A;  3OYK A;  3OSV A;  2EWN A;  4F7U A;  3HFN A;  4RKU E;  1YJ9 A;  4BDZ A;  2LDM A;  3OYC A;  2WSC E;  1YIT T;  4OB2 B;  1PSF A;  4PJO C;  2J3M A;  2GFA A;  1JJC B;  2QHV A;  5KCH A;  4UP9 A;  1K9M U;  1BBW A;  3JCM g;  4HVC A;  2X4Y A;  3HY0 A;  4E51 A;  4UC4 A;  1ZQ1 A;  5HKC A;  3DB3 A;  4H2W A;  4ZTZ B;  2CZ1 B;  4HT9 A;  4R55 A;  4YCW A;  1QVG S;  1GGM A;  1D3B A;  1OI1 A;  3CCJ A;  4ELZ C;  1IL2 A;  4BD3 A;  2RHS A;  3DKM A;  4M75 E;  3S3O A;  2O4X B;  3RUX A;  4A54 A;  1UGR B;  2ZPI B;  5CKB A;  3VYG A;  3I7F A;  5LL6 S;  5GAN e;  4PJO B;  1W2B S;  4ELY C;  2RH2 A;  4B9W A;  2D0Q B;  2CKK A;  4ME7 A;  1NYQ A;  2AKW B;  1BI2 A;  4M75 G;  4M78 F;  5GAN 8;  3QJY A;  2L89 A;  1KG1 A;  3OS0 A;  2WAC A;  3BDL A;  5M9O A;  1Z7N A;  2BKD N;  5GAN 3;  4Y91 A;  1B34 A;  3CC7 T;  3J80 E;  4OLF A;  4H2T A;  4BWA A;  2QQA A;  4BI8 B;  3JCM J;  2QEX A;  2DU7 A;  3RF1 A;  2YLB A;  5LJ5 h;  4PLI A;  1USY A;  4XTU A;  3SDZ A;  4MZM A;  2EQJ A;  5C52 B;  4M7D C;  2ZT8 A;  3LSS A;  2LT4 A;  4N0A C;  1JJ2 A;  2OAU A;  5FRM A;  2ZZD A;  3QBY A;  2DDZ A;  3SFM A;  4HA8 A;  3G4S A;  3I55 T;  1PYS A;  2VYT A;  3E9G A;  3MCA B;  2ODR D;  1ASY A;  4XU3 A;  1N8R U;  3HXU A;  4JLG A;  1ASZ A;  1WU7 A;  3KXT A;  4P75 A;  4RDX A;  4M7D G;  1NJI C;  4IUQ A;  3JRZ A;  4PJO F;  3G71 T;  5C51 B;  3FJP A;  2DTO A;  1S72 T;  2E65 A;  4L87 A;  4BUG A;  3CXC A;  3OS2 A;  3JCM Q;  4H2S A;  4B9X A;  3CCM T;  2ODR C;  4M7D B;  4UPA A;  4F7U B;  4CI0 C;  2P0L A;  3V8L A;  4P71 C;  3X26 B;  5F5W A;  3L42 A;  1WJS A;  2PMF A;  5CQY A;  2K4Y A;  2I4M A;  4KR3 A;  2RJD A;  2VXE A;  5HY6 A;  2MI6 A;  3HXX A;  2LX9 A;  4L5G A;  4C8Q E;  4TVA B;  4RCC A;  2Y4X A;  5LJ3 f;  1P92 A;  4XTX A;  2EIF A;  3CBM A;  4E7H A;  1QVF S;  3PFS A;  3GLX A;  5GMK l;  2ZPH B;  2RK2 A;  2RI3 A;  2QA4 A;  4P3N A;  3OYJ A;  4QVZ A;  4LDU A;  3LSQ A;  4TTV A;  1AHJ B;  3M4Q A;  1TH7 A;  2KK4 A;  3W3S A;  3JCM h;  1XQH A;  3ICA A;  3J81 E;  2VGM A;  2RHS B;  4CS2 A;  4P5N A;  3PZC A;  3QDR B;  1GXI E;  3N5B B;  2RHU A;  4LDX A;  2DZ9 A;  3C95 A;  2HQX A;  4JRK A;  4J7F A;  4RQE A;  3CMA T;  2DXC A;  1NJ2 A;  1NJ1 A;  1VQO T;  4MZP A;  4YRS A;  3CCQ A;  2QHS A;  2NS6 A;  5GAM h;  2I4L A;  2QDY B;  2WSE E;  5CK9 A;  1VQ7 T;  4ZIB A;  5GMK h;  2XDD A;  2XHC A;  5GAN g;  3CC2 T;  2P0Q A;  4M7D F;  3LC0 A;  1VQM T;  4F7U F;  3L2V A;  3CPW S;  4KR2 A;  1VQN A;  2Q5I A;  4AH6 A;  2QHT A;  3E19 A;  2XG8 D;  2LCL A;  1BKB A;  1UB4 A;  3EFR A;  1M90 U;  3L4G A;  2CZ0 B;  3GOX A;  4OF1 A;  4ZTF A;  3DSQ A;  2PUK B;  2E5A A;  2DD4 A;  1KOG A;  4A53 A;  2JZ2 A;  4J6X A;  1KMM A;  4LVK A;  4V2S A;  3GNG A;  4P3P A;  3FB9 A;  2OTL T;  1B76 A;  2ZNJ A;  3M55 A;  5CAI A;  1PYS B;  3TEG A;  4C0G A;  4YPF A;  2AMC A;  4HWS A;  2KAF A;  4MMK A;  2ZPG B;  4H2U A;  4TVR A;  3VQX A;  1N9R A;  3URG A;  4CH3 A;  5CO7 A;  4XTV A;  3CC4 A;  2ZCF B;  3GP8 A;  5C53 B;  3PMI A;  3RMS A;  4G84 A;  3X24 B;  1W4S A;  2DQ0 A;  2FYK A;  4GLK A;  5CCA A;  4R56 A;  1YJ9 T;  3HY1 A;  3HRI A;  3QO8 A;  3OYI A;  1K8A U;  4C92 C;  1VQ4 A;  3VJP A;  1KD1 U;  4JS4 A;  3OD1 A;  4YRN A;  1KQS A;  3L2Z A;  3FC3 A;  1Y07 A;  4EX5 A;  4IUU A;  4MDW A;  5J39 A;  1OZ2 A;  4JDS A;  3NFC A;  3C94 A;  4YTL A;  4PG3 A;  5J3B A;  4M77 A;  3OYL A;  3WVD B;  2Y90 A;  4H2V A;  4C92 G;  2ALY A;  3LYI A;  3P8D A;  3MP1 A;  3CCJ T;  2R5A A;  3G6E A;  4K87 A;  4Q15 A;  4FIB A;  3OYA A;  5A0G A;  3TEH A;  1UEB A;  2B8A A;  3OW2 A;  2JOY A;  5DLQ E;  3LGF A;  1J5W A;  3HFZ A;  3DLL A;  4C0D C;  4KUL A;  3QZ9 B;  1X01 A;  2RHZ A;  3A8M B;  3JCM d;  3M4G A;  4NCX A;  4P73 C;  5KNN A;  3WXM B;  3JB9 D;  4QQ6 A;  3GPL A;  3NEN A;  1N6A A;  3HRS A;  2IY5 B;  5KE3 A;  2QQ9 A;  2MMP A;  2KSS A;  4P72 C;  3OYY A;  2DD5 A;  3V8K A;  1JBM A;  3V8J A;  1X2G A;  3EFS A;  3HP9 A;  5LJ3 e;  4LD9 K;  2R57 A;  2EQK A;  3J7A F;  2DTI A;  2ZGW A;  3G1Z A;  2DO3 A;  4M78 E;  5ELN A;  1E1T A;  1X6O A;  3SWN A;  3L4G B;  1OYX A;  4CS4 A;  2KDS A;  5I2S A;  2OTJ A;  1QF6 A;  12AS A;  3KBG A;  4C0D B;  4LDW A;  3A8L B;  2RK1 A;  1O9S A;  3ERR A;  3QSU A;  4M77 D;  3RGL A;  3G4S T;  2ARS A;  4BDY A;  4IKF A;  2Q7E A;  2F69 A;  4BE2 A;  1C0A A;  3LLR A;  3V7S A;  1LNX A;  2D6F A;  5GMK i;  4K88 A;  2ZIM A;  3CPF A;  3PNW C;  3CME A;  3CCS A;  4FL6 A;  2XGT A;  3CBO A;  1HXD A;  4P3O A;  3OSS C;  2CYZ B;  2HD0 A;  3R07 A;  4BI4 A;  3HRT A;  1LYL A;  3M9Q A;  4C92 F;  2LCC A;  4PL6 A;  3NEM A;  2GF7 A;  4FU6 A;  1NNH A;  5LJ5 f;  4MDX A;  4YRE A;  4XU2 A;  3IAL A;  4H02 A;  1G3Y A;  3OYG A;  4YP0 A;  3LH0 A;  3BW1 A;  1YJW A;  2AHJ B;  1G5H A;  1M1K C;  2PME A;  3RMQ A;  4PJO E;  2F5T X;  5IT9 E;  2GQV A;  1X75 C;  3M54 A;  3M57 A;  3V7C A;  11AS A;  1Y71 A;  1X55 A;  3A7A A;  2JN0 A;  3IKM B;  3L1A A;  4FSX A;  3OYD A;  1H64 1;  3ER0 A;  4YRL A;  4PJO G;  4NS5 A;  4YRK A;  3E1S A;  2QA4 T;  4L6V 5;  1NE8 A;  4YRC A;  3IG2 A;  2RI2 A;  3TUP A;  4A4E A;  1BI0 A;  3JCM c;  5GAN j;  1UGS B;  2DEQ A;  2BUD A;  3LX7 A;  3JCM b;  2Y4Y A;  3P8Y A;  4TVY A;  5K1P A;  2ZR2 A;  1HK9 A;  2DTH A;  3TEH B;  1E24 A;  5L8R E;  3SWN C;  2IG0 A;  4C0F A;  3HXW A;  3HFZ B;  2KQW A;  2PUO B;  4C8Q A;  3OS1 A;  4J7I A;  3VUZ A;  3CCQ T;  1B70 B;  1VQZ A;  3QPH A;  4J5Y A;  4YRO A;  3L2R A;  1HC7 A;  4O5V A;  1BI1 A;  3QYG B;  2K2V A;  3RES A;  2ZIN A;  1VQN T;  1NYR A;  3JB9 I;  2C7I A;  2RHI A;  1EIY A;  3JCM f;  2X35 A;  1EQR A;  2GCX A;  2V8I A;  1EVK A;  1RL2 A;  2ZZE A;  4XU0 A;  3CD6 A;  3X28 B;  3UGQ A;  5DY9 A;  4LVI A;  1G5V A;  4EPC A;  1VUB A;  3SWN B;  4M7A A;  4JJN K;  4M7D E;  2XU8 A;  4F7U E;  3M53 A;  3BFM A;  4C5I A;  4J15 A;  3REX A;  3QO7 A;  5LJ3 g;  3L2Q A;  2C8M A;  3A8G B;  1NPR A;  4J6Y A;  5GAM f;  4RMO A;  3P8B B;  1KHC A;  2EAY A;  2A3L A;  2RO0 A;  5GAN d;  4F7U G;  3MO8 A;  2E41 A;  3PMT A;  2XD0 A;  2XI9 A;  1G5I A;  4Q5W A;  4LD6 A;  2VV5 A;  2BIV A;  3CC4 T;  3GIB A;  2KVQ G;  3A5Y A;  1Q7Y U;  1I81 A;  4N4I A;  5GAO q;  2QTX A;  3M59 A;  2E3C A;  4C8Q D;  3MEY A;  1Z7M A;  4E7K A;  2L5Q A;  2EJF A;  1YHQ T;  4CH6 A;  2O01 E;  2P0P A;  4C0Z A;  1BYM A;  4YRM A;  3OYN A;  5CKE A;  4HWP A;  1VQ4 T;  3M56 A;  4JRI A;  4KBM B;  5AYF A;  3JCM X;  5IN1 A;  3QZ5 B;  5HK3 A;  1WYD A;  5GAO m;  2XIC A;  3NTK A;  2P0K A;  3MF2 A;  2CIM A;  2IVW A;  1VQK T;  4M7A D;  2L8D A;  3HSB A;  1B7Y A;  1D3B B;  3MF1 A;  3TEE A;  2E10 A;  1SRY A;  4A4F A;  4BY6 C;  3G6E T;  2G3R A;  4DA4 A;  3CCL A;  1N27 A;  5FRO A;  4WI1 A;  5LJ5 e;  3LWH A;  1M1K U;  1USY C;  3HPW A;  4JLI A;  2ZCE A;  5FLX E;  1BIB A;  2KMT A;  4FT4 A;  2QQB A;  2EJ9 A;  3L2W A;  4M7A C;  1KHI A;  1JB0 E;  3OY9 A;  5GAN 4;  2FVU A;  4CRI A;  1B8A A;  2ZT7 A;  2K5F A;  1B34 B;  2HNI A;  3E9I A;  4C8Q B;  2QHU A;  1PSE A;  5CKD A;  4Y28 E;  3G7Z A;  1RI0 A;  2K5I A;  4P75 C;  1XOV A;  2RM4 A;  4CH5 A;  5CKH A;  3UH0 A;  3HRU A;  2FB7 A;  5I2M A;  4BY6 B;  1M8V A;  1ZHI A;  1EIY B;  2GFU A;  4XAX B;  4E7J A;  3I56 A;  4C5H A;  3QUI A;  3VQW A;  1MHN A;  2MAM A;  1YFR A;  1YI2 A;  2OTJ T;  5D6W A;  1DJ7 B;  3HHT B;  4M7A B;  4NOY A;  3NET A;  5GAO r;  3VV0 A;  3PCO A;  4HCC A;  2ZPF B;  2DIG A;  1IZ6 A;  4QQD A;  3TU4 K;  2Q7H A;  3VUB A;  1XNI A;  2QI2 A;  5IAY A;  4ZTJ A;  2VUB A;  4YRF A;  3CME T;  1Y96 A;  1M9S A;  5FU7 C;  2EKO A;  1VQ9 A;  2RHX A;  4ZGD B;  1VQ8 A;  4EMK A;  3P8T A;  1K9M C;  3MEW A;  3RKY A;  4C5E A;  3INZ A;  1WGS A;  2DIQ A;  1RIQ A;  1YB3 A;  4M78 A;  5LJ3 h;  4O2D A;  2EQM A;  4WJ4 A;  1WQ7 A;  2XID A;  4IUV A;  3MQZ A;  1QP2 A;  4PKC C;  5A2Q E;  4YYE A;  3V7R A;  4RQF A;  1NJ6 A;  3CCE A;  3RER A;  4DOW A;  4PHC A;  4C92 E;  3JCM P;  2J3L A;  1VQP A;  1SET A;  3H6Z A;  1JJC A;  2K3Y A;  1NJI U;  5FU7 B;  5KH6 A;  1VQL A;  3M4P A;  4QVD A;  3JB9 H;  1QVG A;  2CJA A;  2M16 A;  3TCJ A;  4XQ3 A;  5GAM e;  1H4V B;  4LVL A;  5GMK e;  3CMQ A;  2E1H A;  2JNG A;  3MEA A;  1I8F A;  4YRT A;  1NJ8 A;  4M7A F;  3VYH B;  4DQ2 A;  3A8O B;  2LTO A;  1W2B A;  1B7Y B;  3HXZ A;  2PVD B;  4BI3 A;  4TWA A;  2E6Z A;  1H3Z A;  5GAN 6;  4A4G A;  2O4X A;  1ADY A;  1M5Q 1;  4A4H A;  3QXE B;  5E3I A;  3JB9 J;  4PJO A;  3MET A;  3L2U A;  2JVV A;  1U1S A;  1QE0 A;  1LOJ A;  4BW9 A;  1Q81 C;  2ZPB B;  2DJZ A;  4OB3 B;  3P8V A;  3PIP A;  4YRI A;  4M78 D;  3FRN A;  1G3T A;  3QHS A;  5A0L A;  4LDV A;  4BAC A;  5LJ5 g;  2V8K A;  5LJ3 j;  2G4C A;  2JUF A;  2M9U A;  3QTC A;  3RAC A;  2QEX T;  4M75 A;  3RKW A;  1VQM A;  1N8R C;  2V8J A;  4ATO A;  2R58 A;  3OYM A;  4G85 A;  1W66 A;  3O8V A;  4YDQ A;  3CD6 T;  3EAE A;  2C06 A;  3OQ5 A;  4ZN1 A;  5GAN h;  2CS7 A;  1YCY A;  4QVC A;  2P5I A;  2FHD A;  3MEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...