1X01A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with atp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2005-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1x01A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1x01A01
2DTIA 2RHQB 4YREA 4C8QD 4C92A 4M7DC 4M7DB 4EO4A 4CH4A 1E1OA 2ZCEA 4TVAA 4H2TA 2DZCA 1I81A 3HFZA 1YFTA 4J5YA 1JJCB 4BW9A 1WPYA 1WU7A 5LJ3f 2ZZEA 4H2VA 4RCBA 2HNIA 2ODRC 4L87A 4P73C 4YRSA 4YRIA 5GAN4 4TQFA 4HA8A 1WNLA 1I8FA 3FIFA 2E65A 4X9DA 4C8QG 2PMFA 1ASZA 3QO5A 3SWNC 1TH7A 3SWNB 4A53A 2QHUA 1KMNA 3DSQA 1USYC 1YFSA 1JBMA 2DQ0A 2ZR3A 4TQDA 3A7UA 3PCOA 4PJOA 2CIMA 4YRMA 2ZT8A 1Y96A 3QNEA 4F7UE 3A31A 5DY9A 5GANh 5LJ5g 4HWRA 4YRFA 2EJGA 2J3LA 3RKXA 1KQ2A 4RMFA 1PYSB 2ZNIA 3UFGA 3TUPA 4M77A 4M75C 4M75B 2PMEA 3INZA 1B70A 3HFOA 5LJ5e 4YRQA 5LJ3j 4XEMA 5GAN8 3A5ZA 3IKLA 4NOYA 2J3MA 4O2DA 2IY5A 1U1SA 4YCUA 3RESA 4NL3A 4XU0A 4M7AC 5GAMg 4P72A 5GANd 4M7AB 2ZXFA 4EX5A 1LJOA 3MEYA 4P75A 4KR2A 4YDQA 1B34B 4CH3A 3EFSA 2CJBA 5K1PA 4C8QF 2ZT7A 1D3BB 3RACA 5GAMe 4M78A 4WJ4A 5GMKj 2VXFA 3JCMg 3NEMA 4ZIBA 5GAN7 2ZIOA 4XTZA 2I4NA 4WJ3M 5C53B 3OD1A 3HXZA 3PZCA 5K1XA 4EMHA 3HSBA 3BW1A 4CS3A 1KMMA 3LC0A 3V8JA 2ARTA 5GAOl 3JCMe 2DZ9A 4P74A 4OLFA 1YB3A 1ASYA 1H4SA 3QTCA 3JB9I 4YCWA 4K86A 2EJ9A 1NNHA 3NELA 4H2SA 2Y90A 4K88A 5GAOp 4K87A 2AMCB 4C8QE 3M4PA 3REXA 4CH6A 1EOVA 5C51B 1LNXA 2Q7HA 5LJ5h 4YRCA 3BFMA 4RQFA 4RCCA 2DEQA 5GAOq 2CJ9A 4YRJA 4JRKA 2ZT6A 4M75G 5GAN2 4PNOA 5GANj 3QSUA 4XU2A 1HK9A 4NL2A 4M7DF 2RHSB 4QVCA 2C7IA 2G4CA 3MF2A 4LNSA 3HXUA 4YRGA 3RKWA 3IKMB 3VQXA 2DTHA 2AKWA 3M4GA 3KFUA 4X9CA 4H2YA 4N0AA 1I5LA 4M7AG 5GAMh 2Q5HA 5LJ5d 1X2GA 3ICAA 3QHSA 1B8AA 3UH0A 2VXEA 4RDXA 1U1TA 4F7UB 1GGMA 2E3CA 3WQZA 1WLEA 2ZZGA 3JCMJ 2ALYB 3HXYA 3RUXA 5GAOn 4C92C 4C92B 3P8TA 4P71A 4XTVA 3JCMh 4TTVA 3JB9F 4TVAB 3M4QA 5LJ3g 2EWNA 3HXWA 3HFZB 3E9IA 2DKGA 5GAMd 1EQRA 1EVLA 2DVEA 4XQ3A 3V7RA 2CJAA 1HTTA 2VC8A 3NETA 2I2LA 3JB9H 3V7CA 4H02A 3L4GA 4TWAA 3BY7A 4Q15A 3TEGA 1EIYA 4YP0A 5LJ3e 4M75F 4ZTZB 4H2XA 3JCMb 4EMKA 4Q6GA 1Z7NA 4M7DD 3HRKA 3R07A 4YPFA 2FYKA 4YRNA 3JCMQ 2E64A 4JRIA 3JCMd 2QHVA 2E5AA 4C8QA 3BDUA 4HWOA 4PJOC 2EAYA 3PCOB 1C0AA 4PJOB 4M7AF 1Y96B 3ERRA 4XU1A 1RIQA 1LOJA 2ODRD 1E1TA 4XTWA 3VU3C 3HFVA 2RM4A 2YLBA 1QE0A 5GMKe 2ZNJA 3RIRA 2RA2A 4M7DG 2CGHA 1NJ1A 4BWAA 4DQ2A 4M77C 3RL6A 3A7AA 4M77B 12ASA 3QO8A 3HY1A 1B70B 2DXUA 5GANf 1BBUA 2P5IA 4JLIA 4M75E 3A7RA 4HT8A 1HC7A 1B7YA 4V2SA 3JCMX 3JB9D 3V7SA 2IY5B 2JN0A 2ZGWA 2DTOA 1FYFA 4P72C 2DU5A 4YCVA 4CH5A 5HGQA 4P75C 1H4QA 5KNNA 3P8VA 4M7AE 3TEHA 2K57A 1X56A 4KR3A 3NENA 4M75D 1KOGA 1LYLA 3FB9A 4AH6A 2ALYA 1NJ6A 4C92G 1ADYA 1X54A 3P8YA 4M78C 5GANg 4M78B 4YRTA 3JB9G 5GMKl 4HWPA 4TVWA 1WQ7A 5LJ3h 2RHQA 3JB9J 1YCYA 4M7DA 4H2WA 5GAOm 3IG2A 4M7AD 2Q7EA 3A74A 4PJOD 1X55A 1X2HA 5GAN6 3RGLA 1JJCA 4DPGA 4XTYA 2C8MA 4ZTUB 4G85A 4UPAA 4X5OA 1QF6A 4TVYA 4P74C 2XTIA 4UP9A 1M5Q1 4XTXA 5GMKm 4P73A 2I4LA 4M77D 4OP0A 4WI1A 2ZT5A 4UP7A 3VQWA 5E3IA 5LJ3d 4J6YA 3SWNA 4PJOG 5ELOA 1E22A 1H641 3LSQA 3GIBA 1WYDA 1USYA 3RF1A 1SESA 3QO3A 1MGQA 4WF2A 4YYEA 2I4OA 3A32A 3HRIA 4EMGA 4F7UF 4HWSA 1NJ8A 3I7FA 1I4K1 2ARSA 4M77G 1NJ2A 2P0LA 4HWTA 3JCMc 4C92F 3JCMP 3FJPA 4Y91A 3LSSA 4P3OA 1N9SA 5LJ5f 1PYSA 4M7DE 2DXTA 4M78D 3HTZA 4PG3A 5F5WA 3JCMV 4M75A 11ASA 4QVDA 2AKWB 3L1AA 4H2UA 4N0AC 3VQYA 4PHCA 2DDZA 3VBBA 3RKYA 2QHTA 2E10A 1SRYA 5I21A 4XEOA 4CS4A 1SETA 1HXDA 4YRLA 4YRRA 4M7AA 4YRKA 4MMKA 4MMLA 4M78G 2I4MA 3W3SA 1B34A 5GAMf 2RD1A 1EVKA 3MF1A 5GMKi 2DU7A 1N9WA 5CAIA 4A54A 5GAOr 1N9RA 4P71C 1D3BA 3AHUA 4C92E 4PJOF 2ZIMA 3CMQA 1H4VB 2DJZA 3V8KA 1X01A 4P3PA 2FB7A 1NYQA 2DQ3A 4YRPA 1ATIA 2RB6A 2Q7GA 1NJ5A 5LJ5j 3L4GB 3JCMf 1H4TA 4J15A 1EIYB 3UGTA 2XGTA 5GAN5 3EFRA 4M77F 1JRIA 2ZZFA 2QTXA 4EMKC 4H2XB 4EMKB 3SB2A 4UP8A 4C92D 3REUA 4J6XA 3E9HA 2ZR2A 4NCXA 1G5HA 4C8QC 1G51A 4C8QB 3BJUA 3JCMW 3QO7A 3HFNA 2AMCA 2Q5IA 2E41A 4F7UG 4YROA 1W66A 3UGQA 4PJOE 2QHSA 5GAMj 1M8VA 3HY0A 2EJFA 2ZINA 3L2ZA 5ELNA 5GAN3 4HT9A 3HXXA 4XU3A 1ADJA 3VQVA 1BIAA 4J6WA 1EFWA 4G84A 4M78F 2ZTGA 3PGGA 1IL2A 4KQEA 1WQWA 3IALA 4M77E 4RQEA 1Z7MA 4E51A 1BBWA 1VQZA 3RERA 2RHSA 3HXVA 1B7YB 5GANe 4XTUA 1E24A 2ARUA 1L0WA 3QUIA 4P3NA 1B76A 2EL9A 3TEHB 1J5WA 1NYRA 2E1HA 4CS2A 1KQ1A 4HVCA 3A5YA 3G1ZA 1G5IA 4JUVA 1SERA 1YFRA 2YLCA 4F7UA 5GMKh 2YHTA 1YGBA 1BIBA 5C52B 3V8LA 4M78E
chains in the Genus database with same CATH superfamily
2DTIA 2DL7A 3KXTA 3RBBB 4M7DB 4EO4A 1E1OA 1N8RU 4LNPA 2XI9A 4XAXB 4H2TA 2DZCA 1OX8A 2GF7A 5L8RE 1KFZA 3EGDA 2OAUA 1PRLC 4RCBA 2K3YA 2C0OA 2ODRC 3X20B 3WVEB 3GNFB 1BB9A 5FU6B 2RH2A 5GAN4 4TQFA 2FO0A 1I8FA 4KH1B 4HA8A 4C8QG 1A0NB 1TH7A 3H0FA 1B07A 3SWNB 2XDDA 1VQLQ 4A53A 1KK7A 2X3XD 2J6OA 1AZGB 1YFSA 1JBMA 4JJDA 5L23A 4B6MA 3HTRA 5IHNA 1M1KR 4PJOA 4YRMA 2C0TA 3CPFA 2MK5A 4F7UE 2LX9A 5C6SA 2OTJA 3M0PA 2KRNA 3EG1A 4BI3A 2ABLA 1K8AU 3REAB 3SFMA 4ELYC 3UFGA 3GOXA 2LMJA 2KT1A 2PMEA 3INZA 1I1JA 1B7TA 1W6XA 5LJ5e 4AG2C 3OB9A 4XEMA 1M27C 3QDRB 4BB7A 2AZSA 4J9EA 1O9SA 2J3MA 3HPWA 2DYBA 1VUBA 4M7AC 4EX5A 1LJOA 3VKIA 3QZ9B 1YN8A 2CUDA 4P75A 7AT1B 3OSVA 2RI5A 1B34B 1UE9A 3EFSA 4ZNXA 4ZTFA 3WXMB 3LWIA 2ZT7A 4E7IA 2JS0A 2VYTA 4F04B 1NEBA 4P5NA 4M78A 3OBWA 4WJ4A 2ZPIB 1G3YA 1IHVA 3T9NA 4A4HA 4MZTA 2VB6A 2GFAA 1F1BB 4WJ3M 1RABB 1MMDA 1JJ2P 1RI0A 4EMHA 2CT4A 3V8JA 2ARTA 3JCMe 1KQSP 4J83A 1VQKQ 4P74A 1H4SA 1IGQA 2RK1A 3S3NA 2ED0A 2E4HA 2RHXA 2AMCB 4MZMA 1PM3A 4QW2A 1PNJA 4CH6A 1YWOA 1NG2A 3ZL7C 1MMAA 3VYHB 3D7SB 4LD6A 2Q7HA 1NLPC 4DBHA 1JJ2A 1GCPA 2ZCFB 2ZPGB 4EDUA 4C0DC 3BDLA 1KQSA 2W10A 1RLPC 2CUBA 1M3BA 1HK9A 3VV0A 2LJ1A 4QVCA 3CCSA 2QA4T 2EBPA 1M3AA 4BACA 2RI2A 1Q86U 3KUFA 3OYFA 2DTHA 4GLMA 2XICA 3M4GA 2CSIA 4X9CA 4N0AA 4R56A 4CC7A 2JVVA 1E6GA 4FYYB 4DBRA 5CR2A 3EHRA 3OYYA 1I5LA 2P0KA 2E3IA 2EKHA 3EHQA 5GAMh 3CCVQ 2E5KA 2QEXT 2RHIA 1FMVA 3E1SA 5FROA 2EQMA 2VXEA 2KYBA 2QXFA 2D6FA 4D8DA 1GGMA 3I5SA 2HBPA 3J7AF 2ZPBB 1SHGA 4J9IA 3CCMT 3SD4A 4RMOA 2AK5A 5GAOn 4C92C 2M1HA 1VQ6T 3BE3A 3JB9F 2EWNA 5KE2A 2LTOA 1YP5A 1X2KA 2XK0A 3CBPA 4N4IA 1EQRA 3NTKA 1VQ9Q 1EVLA 3CBMA 3CC7Q 1HTTA 2A3LA 4J9HA 2I2LA 3GBQA 1VQMA 4TWAA 3BY7A 4Q15A 3TEGA 4PFPA 2E70A 5LJ3e 1K73C 4M75F 4J8OA 2D0QB 2JZ2A 1YI2Q 4H2XA 1TWBA 1RAFB 4Q6GA 1U5SA 2WSCE 2DEUA 3HRKA 4YPFA 2KRSA 3G6EA 3OS1A 2QHVA 4D6WA 4OB0B 2CZ7B 2KNBB 2PVOB 2JTEA 2EAYA 1X69A 3M9QA 3PCOB 3H6ZA 3R6NA 2O9SA 3ZEHA 1RL2A 5CK9A 1LOJA 2GBQA 2CZ0B 2XKOC 4GY5A 2ZNJA 1K9AA 3RIRA 1YITA 1T3SA 5D6YA 2CGHA 3OBYA 3J80E 4M77B 12ASA 2DD4A 2DF6A 3LYIA 1KJWA 4LDXA 3N5BB 1BBUA 2OJ2A 2C0IA 4DEXA 1BI0A 1MUZA 3A5ZB 1HC7A 2DK3A 3JCMX 3V7SA 2FG0A 1TS9A 2HQEA 2ZGWA 1KG1A 2DU5A 4CH5A 1OOTA 5KNNA 2QYZA 2DM1A 1KOGA 1LYLA 1K73R 4K11A 2OTJT 2HQHA 2QGFB 1ADYA 1W2BS 1UUEA 2QQBA 1WQ7A 1VYUA 4Q5WA 3L2VA 3JB9J 4IUVA 1YCYA 4OB1B 1XQHA 3IQLA 4PJOD 2SEMA 4E7HA 1X2HA 2DRKA 5HK3A 1QW1A 3ZFJA 1M2OA 1VA7A 4OMLA 4UPAA 3PTAA 2ZAEA 4PKCC 3CCEQ 1MV3A 3VYGA 2I4LA 4UC4A 5D6XA 2CZ1B 4OVAA 1EX4A 2NUZA 2NLUA 3NHNA 2QTVA 2GFUA 3LLRA 1H641 1ZA2B 5ELOA 3GIBA 1WYDA 1OV3A 1QP2A 1OU9A 2FZKB 4IKFA 2QASA 1MGQA 4YYEA 2I4OA 2KYMA 3PVLA 2EYZA 1WHMA 2DBMA 4OB2B 4FU6A 1K76A 3L2RA 4M77G 2FPFA 5KCOA 1YFNA 4C0ZA 2P0LA 4PJJA 1QVFS 5ECAA 4Y91A 3VS1A 4P3OA 2H8HA 2MMPA 1PYSA 4M7DE 2DXTA 4M78D 5F5WA 3JCMV 11ASA 3HRUA 3L1AA 4H2UA 3O8VA 3OS0A 2RF0A 1UGRB 4PK4A 4PHCA 2JUFA 4BY6C 2CP0A 2ESWA 2YRCA 4RTWA 1SETA 2EW3A 1G83A 4M7AA 1HD3A 2I4MA 4C0FA 1M1FA 2RD1A 2L2PA 2K3XA 4A54A 2DXBA 4P71C 1ZLMA 3UA7A 2LT4A 3C0CA 3CMEQ 1PG5B 2BE7D 4PJOF 1H4VB 3THKA 1VQOA 2EVRA 1C0MA 4LVKA 1UG1A 4FSSA 2FB7A 3CCST 1NYQA 1NEGA 2KVQG 2RB6A 1H8KA 4JZ4A 4QKUA 2GTJA 2QA4Q 2L3PA 2XGTA 5GAN5 3EFRA 1K73U 1RADB 5EC7A 1G5VA 3REUA 1ABQA 4J6XA 3EGXA 3RDVA 4C8QC 2QEXQ 3ME9A 3JCMW 3QO7A 1Z9QA 3HFNA 2F2XA 1KC8U 2GTOA 1GXIE 1M9SA 4F7UG 2RHZA 2KXCA 3CCMQ 1M8VA 2EYQA 2ZINA 1VQ8Q 3E9FA 3L2ZA 1SPKA 1VQ6Q 2MCNA 2O9VA 5LL6S 4G84A 4M78F 4KQEA 2XIDA 4KRTA 3SHWA 2F69A 1ZX6A 1N5ZA 1VQMT 2RHSA 2CT3A 2QG9B 5GANe 4OMNA 5FW9A 2DL8A 2ARUA 1CKBA 1L0WA 1NZ9A 2WACA 3G6ET 4P3NA 3CCLA 2A37A 2JTFA 3M0RA 3CCEA 1J5WA 3CQTA 4FT4A 2DX1A 1G5IA 2FRYA 1YFRA 4F7UA 1EFNA 5KYXA 4OMQA 2WSFE 1BIBA 3M59A 2X51A 4A4EA 1YITT 1CSKA 2RHQB 3I56A 4C92A 4M7DC 4E7JA 4QT7A 1YJ9A 4CH4A 1QVGS 4TVAA 1XOVA 1I81A 3HFZA 1YFTA 1JJCB 2ZPHB 1WPYA 1I5OB 3VS4A 3MJXA 5FU6C 2AHJB 4YRIA 2LNHB 1ZSGA 2E65A 4X9DA 3SDZA 3SWNC 2QHUA 2EFIA 2KQWA 3M4YA 1H3ZA 2DQ0A 4HCCA 2ZR3A 1ZBJA 2OAWA 3QJYA 4OMFB 2OTJQ 2DILA 3VUBA 2CIMA 2ZT8A 1Y96A 2XDPA 1K0XA 4RG8A 1ZSZA 5IXBA 3JAME 3A31A 2LJ0A 3PE0A 4TVRA 2RQVA 3LWHA 2J3LA 2E12A 4JLGA 2KAFA 1G3WA 2ZNIA 2E3HA 2L0AA 3CMEA 4IIOA 4FM4B 1B70A 3MEWA 4L6V5 4HCKA 4JS5A 4YRQA 3QZ5B 3OYNA 4OGCA 5C0MA 1OZ3A 3OMCA 1MNEA 1VQPA 2HKNA 3CMAQ 4XU0A 4E47A 5GAMg 4PJNA 3MEYA 2HEQA 4Z02A 1MMGA 5M9OA 4KR2A 2FRWA 4CH3A 1UTIA 2A36A 5K1PA 2KGTA 2RK2A 1WHJA 1D3BB 1PSFA 4LDVA 5GMKj 2VXFA 3HRSA 1VQ8A 4F16A 1VIFA 4PLLA 5C53B 1M2VA 3NFCA 3MPUB 5FWCA 4CS3A 3LC0A 2KE9A 2NUPA 2LNVA 2JJ9A 2DZ9A 1JXOA 1Y71A 3X24B 2G3RA 1FMWA 3QTCA 2H3JA 5KYWB 2FVUA 2Y90A 5GAOp 1H3HA 1B3QA 3LH0A 1EOVA 3NTHA 5C51B 2D0NA 4ZTJA 5EG2A 3PMTA 1LNXA 1ZA1B 3TU4K 1VQOT 1VQ7A 2HDAA 1QLYA 2DEQA 3CC2A 1QVPA 5DLOA 2EQJA 1BYMA 2CP2A 5GANj 2B86A 3CCSQ 3CCQA 3M5AA 3HXUA 1UGQB 1VYTA 1WXBA 3A8MB 4F17A 2AKWA 5FRMA 5KYYA 1UEBA 1UDLA 4H2YA 2VGMA 3J81E 5LJ5d 3QHSA 3UH0A 4CI0C 4RDXA 3VJPA 4E6RA 5FU7B 3WQZA 1EZZB 2ZZGA 3JCMJ 2ALYB 3HXYA 1Q86R 3CD6A 2LCLA 1X27A 3G7ZA 3P8TA 4P71A 1AHJB 4BD3A 3M4QA 4CC4B 4JJBA 3HXWA 4C5IA 3E9IA 2DKGA 2FL7A 2BKDN 3UA6A 3OA6A 2F2WA 2DVEA 2MI6A 4GLKA 2VGNA 2O4XB 4PFOA 4XQ3A 5KH6A 2BE9B 5HKCA 1VQMQ 1VQ4A 2CJAA 2F5TX 2XD0A 3V7CA 3TREA 2KT8A 4JRQA 4YP0A 1EIYA 2QAZA 3QPHA 2V8KA 3CCLT 1BI1A 3CEYA 3JCMb 3CCET 3VS0A 3G6EQ 1Z7NA 3OS5A 1EIFA 2FYKA 4YRNA 3JCMQ 2V1RA 3JCMd 1PD0A 4C8QA 1NJIC 3TVTA 1U06A 1OX9A 3CMAA 4M7AF 2AT1B 3AT1B 3MP8A 3I56T 3EFOA 1M30A 3CXCS 1YJ9T 2J7IA 1YITQ 5FRNA 4M7DG 2VWFA 4DQ2A 4M77C 1YJWA 1BCOA 2DE0X 3EG9A 1PHTA 2M9UA 3DB3A 1WHHA 4M75E 2DFUA 3A1PA 2VKNA 3OQ5A 4HT8A 3OYKA 3JB9D 4AT1B 2A0FB 4FSXA 1M1GA 2IY5B 4ZN3A 2K7AA 1K4US 4P72C 2D9TA 1J3TA 4YCVA 2GGRA 1FYNA 1VOMA 1IB8A 4ZGDB 3ER0A 1X56A 4KR3A 2VV5A 2I0NA 4M75D 2YUPA 2HL3A 4AH6A 3LX7A 3FEOA 4YRTA 5GMKl 3S3MA 4HWPA 4N4HA 3EG2A 1JO8A 4B9XA 3CMET 4M7DA 4B9WA 5GAOm 3S6WA 3IG2A 1X6GA 2Q7EA 1RACB 1X55A 3EG0A 1VQNA 4XTYA 2C8MA 4ZTUB 2KR3A 1ZQ1A 4UP9A 1M5Q1 1VQPT 1ZBXA 5IAYA 2L3QA 1X6OA 3PIPA 4OP0A 2PTKA 4WI1A 5LJ3d 3SWNA 4L59A 1BCMA 1AD5A 4Z89A 2MOXA 1W1FA 1SESA 3M57A 3QO3A 4MZPA 3LH5A 3KFVA 3A32A 3HRIA 2DO3A 4EMGA 4F7UF 3QKJA 1I4K1 4FT2A 1G2BA 2LQWA 1VQ8T 2PQWA 3CC4A 4C92F 3JCMP 1M3CA 5LJ5f 3OYLA 4OGEA 4FW2A 3HTZA 4QVDA 3C4SA 4PL6A 2RHUA 3QIIA 2DDZA 2J05A 3RKYA 2QHTA 1WJQA 1SRYA 3LGFA 1PKSA 1TUGB 3H9NA 4KH0B 2FZGB 1CKAA 3NMZC 3X28B 4MMLA 1AVZC 1B34A 1VQ7T 2DBKA 4BE0A 1N9WA 5GAOr 1KC8C 3CC2T 2L89A 1OZ2A 2QK0A 1P92A 1VQOQ 2QQ9A 3DB4A 1X01A 3CCQT 2ZPEB 4PLIA 3VS7A 1ATIA 4AG1C 1OPLA 1NPPA 2X4XA 2XU8A 5LJ5j 3JCMf 3L4GB 1H4TA 1PSEA 3TCJA 1KSWA 1NE8A 1AWXA 1AWJA 3FLGA 1QWEA 2COYA 2RJEA 4EPCA 2ZZFA 2QTXA 2LP5A 4EMKB 4UP8A 4RTVA 4LVIA 3E9HA 3CCUA 5KYUB 1MHNA 2RI3A 4AMCA 2YT6A 1NJIU 1N27A 2AIRB 3TEEA 4J9DA 2LCSA 1D09B 2AMCA 2Q5IA 1GL5A 4YROA 3CD6T 1W66A 4PJOE 2MF2A 2QHSA 1BU1A 4KUDK 1KHCA 3A8HB 3R6OA 4E7KA 3L42A 3HXXA 3HL8A 3OSSC 3PGGA 1WQWA 1VQ4T 1ZUYA 2G6FX 4QQ6A 1IZ6A 1BBWA 1VQZA 2VUBA 1KC8R 1B7YB 1H92A 1VIEA 2XG8D 3I55A 1GRIA 1E24A 3CCLQ 1XJWB 2F2VA 4J9FA 3TEHB 2J6KA 3OYJA 1NYRA 2E1HA 3CMAT 3A5YA 3G1ZA 1NYGA 1YBYA 2NUTB 2YLCA 1N6AA 2F1LA 2EKOA 1YGBA 4QQGA 4M78E 3I56Q 4HXJA 1RI9A 3MEVA 2C06A 4QVZA 1D1BA 4YTLA 4C8QD 1YJ9Q 1YJWT 2OX7A 1WHKA 5IHKA 1RUWA 4KUIA 2ZCEA 2JM9A 2EGEA 4RTTA 5LJ3f 3UF4A 1V1CA 2L8DA 4H2VA 1M8MA 4C5EA 2HNIA 2M0OA 4LD9K 4JZ3A 3CPWS 2CH4A 2LX7A 5HCKA 1QCFA 1WNLA 2MIOA 3FIFA 1R77A 5CKHA 3QO5A 5CIUA 1ASZA 1YJNA 1FXXA 2HKQB 1KMNA 1IREB 3DSQA 4DA4A 4TQDA 1W4SA 3MEUA 3PCOA 4RTYA 1RAEB 3MO8A 1Z9ZA 2IG0A 3CBOA 4HWRA 1WXTA 3RKXA 1TUDA 2KI7A 4BDYA 1VQNT 4M77A 1D0XA 4E7SA 4M75B 3O5ZA 2CP3A 4FCYA 1JB0E 3HFOA 1T0JA 5LJ3j 2LCCA 4ANJA 1WI7A 3A5ZA 1RAGB 1R0CB 3IKLA 1W2BP 2ECZA 4NOYA 1VQPQ 5IH2A 4O2DA 1PWTA 3MEAA 1U1SA 3MP1A 4YCUA 3RESA 4VUBA 4P72A 2O88A 5GANd 2ZXFA 2DRMA 2RJDA 1SEMA 3ULRB 4YDQA 3VS2A 1OPKA 3NPFA 4JDSA 4C8QF 1NBEB 2LDMA 2DPPB 3RACA 5GAMe 1V76A 4X1VA 3CC4T 4AFQC 2CP5A 1R0BG 4ZIBA 2RQWA 5GAN7 3C94A 1W2BA 2ZIOA 4BI4A 2I4NA 3OD1A 3QXEB 3PZCA 1IRXA 3HP9A 3UPUA 5K1XA 2LQKA 3OW2S 1YWPA 3BW1A 4IIMA 1KMMA 2PVDB 5D7UA 1UGVA 5GAOl 3URGA 1WDXA 2X3WD 2J06A 4ORZA 4YCWA 2CS7A 4K86A 2CSQA 3M58A 2EJ9A 1NNHA 4K88A 2KMTA 4ZN1A 4KGXB 4LUEA 2RQTA 4R55A 1QVFP 1AT1B 2XMFA 2FHDA 4OMOA 3REXA 4IURA 3L2WA 2GCXA 8ATCB 1VQ7Q 5LJ5h 3CC2Q 1JEGA 1SSFA 1WHGA 4RCCA 5GAOq 1YNZA 3VS6A 3G1JA 4JRKA 2COZA 2ZT6A 3M0TA 4M75G 3C12A 4PNOA 1UGPB 3CCQQ 3QSUA 1QWFA 1WHLA 3OYEA 3EGUA 4M7DF 2C7IA 3MF2A 4WTOB 1M90U 2OTLA 4YRGA 4E7ZA 3RKWA 3IKMB 2JMAA 2NS6A 3VS3A 3VQXA 2JW4A 1QVFA 4BDZA 3KFUA 2P4TA 1M4ZA 3I9QA 3CCUT 1OYXA 2QQAA 4FYXB 1ARKA 4LXCA 2Q5HA 4OB3B 3ICAA 1Q82C 5FU7C 3QDFA 2YUQA 2HBWA 2E3CA 2V26A 1GCQC 3A8LB 2RO0A 4A4KA 1WLEA 3CD6Q 3RUXA 5CKBA 1AOJA 2KROA 1TU0B 3M55A 4N4GA 3E19A 2M16A 3JCMh 2K5FA 5HY6A 2CYZB 5J39A 1VQ4Q 2RHYA 4O6JA 3EGDB 2PNIA 2VC8A 2DA9A 1RAAB 2IPOB 4H02A 2DL3A 3DKMA 4RTZA 3I55T 2QDLA 2CH4W 3ASKA 4J9CA 5CCAA 5I22A 1YIJA 3QYGB 2CDTA 3QG1A 3QJ6A 3R07A 2PU9B 4IUUA 2E64A 2WSEE 1O75A 3OW2P 3EH2A 4DBQA 2R5AA 1C0AA 5DLQE 4PJOB 4JJNK 2KDSA 4XU1A 2DL5A 1E1TA 2K4YA 2ODRD 4XTWA 1QE0A 1Y7XA 1Q82R 1YJWQ 3UWNA 2LZ6B 3RMSA 3A7AA 3RL6A 3QO8A 4KULA 2VASA 1AWWA 3GP8A 2DXUA 1C6VX 5GANf 2P5IA 5J3BA 3A7RA 2MWPA 1V29B 3L2UA 4V2SA 2P0PA 3H0HA 2D1XA 1IHWA 2JN0A 1YJNT 2K3BA 1ACMB 1U3OA 4DOWA 5HGQA 2R5MA 1QVGP 4M7AE 2K57A 1IXDA 4LDWA 3FB9A 1X54A 4LDUA 3PIOA 5GANg 4M78B 4BE1A 1KIKA 1GBQA 3QBYA 3M0QA 5LJ3h 2XDBA 2COWA 2RHQA 4WCIA 1XTDA 2ROTA 4H2WA 1X6BA 4M7AD 2V1QA 2DD5A 5IT9E 3A74A 1SHFA 1VQNQ 4LDYA 5GAN6 1JJCA 4DPGA 4G85A 4X5OA 4TVYA 1QVGA 2KK4A 3EG3A 2XTIA 4XTXA 2LQ8A 1GFCA 1AEYA 5IN1A 4M77D 1TG0A 3M53A 2ZT5A 4J6YA 4KBMB 4ESRA 1PC0A 1TOVA 4PJOG 1JJ2S 2IVWA 2O31A 3M0UA 4AFUC 1Y07A 4HCBA 1E22A 3LSQA 3CCJA 4OMMA 2KBTA 3RF1A 8AT1B 2E6NA 1BI2A 3VRYA 1KQSS 4HT4A 2RNAA 2K2MA 3H41A 4R0KA 1NJ8A 2BZXA 4IUQA 3PNWC 3EH1A 5KCHA 3OYAA 2GNCA 2ARSA 3CC4Q 4HWTA 5CQYA 3JCMc 3FJPA 4J9GA 2E5QA 2D8HA 4QQDA 1TXQA 2BZYA 3HKSA 1SG5A 2H3EB 4CRIA 5I11A 2RQUA 1TTHB 1BBZA 3DLMA 4KGVB 2BUDA 2LVMA 1UB4A 2K5LA 2JXBA 3I5RA 5CKEA 1WIEA 4CS4A 5FWBA 1Q82U 3QYHB 3FDRA 4Z8AA 4YRLA 4YRRA 2KY9A 2FEIA 3OYHA 1VQ5A 1OI1A 4MMKA 1OULA 5KYNA 4M78G 3W3SA 2JNGA 1MNDA 3MF1A 4HKEA 4JJCA 3CCRA 1N9RA 1R8OB 1D3BA 4A4GA 4C92E 2ZIMA 1TSFA 2DJZA 2K2VA 2YDLA 3E9GA 2YSQA 4P3PA 2OTLT 2HSPA 4XK8E 1NJ5A 4IUPA 1NYFA 4J15A 3G4SA 3UGTA 4M77F 1JRIA 4ZGEB 1S1NA 3S3OA 4EMKC 4H2XB 2BZ8A 3SB2A 2W0ZA 4C92D 4MDWA 3CCUQ 4JRPA 6AT1B 2M02A 1G51A 2KXDA 2YUNA 5KYWA 3JSCA 3BJUA 1YHQA 2AKLA 3NTIA 2E41A 2LRQA 2BTTA 1NM7A 3UGQA 1WLPB 3HY0A 2Z0WA 2HMAA 2FPEA 2MYSA 4PJLA 3MHXA 4ME7A 4HT9A 1ADJA 4J6WA 4ZGJB 1XNIA 2X35A 1RAIB 2L3RA 4RG2A 4X34A 1WX6A 1IL2A 2QI2A 5GJVB 4RQEA 3GF5A 3A8OB 4E51A 1NJIR 5A0GA 2RQRA 3RERA 2NYSA 3HXVA 1YIJT 3RNJA 3I55Q 4LVLA 2RMOA 4AFSC 3QUIA 3H8ZA 3G71A 2NWMA 2K79A 1B76A 2MWOA 1I07A 4ATOA 3NGPA 2EL9A 4CS2A 1LCKA 3OS2A 2GQIA 1IO6A 1UJ0A 4JUVA 1SERA 1S72Q 5GMKh 2M51A 1BI3A 2EIFA 2YHTA 3OYBA 2Y4YA 1GCQA 2M0YA 2KRMA 5C52B 3V8LA 2ALYA 1QKWA 2MAMA 2O2OA 4YREA 1Q81C 2ZPFB 2EYWA 2EQIA 4J5YA 2GQVA 4LE9A 4BW9A 3WVDB 1M1KU 1WU7A 3VRZA 1HJDA 2IIMA 3F70A 2ZZEA 2O4XA 3UATA 1QCNA 4Y28E 1WA7A 4L87A 4P73C 2LQNA 3JV3A 1LVKA 3L2QA 4YRSA 1SRMA 3CXCP 1YJNQ 2X4WA 2PMFA 1SSHA 2EYYA 4CC2A 1WYXA 2J6FA 4FW1A 3OY9A 1VQLA 1USYC 5FLXE 3A7UA 3HRTA 5A0DA 2FZCB 2F5KA 3QNEA 3VS5A 2FPDA 2YXYA 5CO7A 1W70A 5DY9A 2YUOA 5GANh 1BKBA 2PZ1A 5LJ5g 4L5GA 1OQKA 4YRFA 2EJGA 4FIBA 1T3LA 1KQ2A 4RMFA 2JM8A 1PYSB 3M0SA 4RKUE 3TUPA 4RTUA 1T0HA 4M75C 3CXCA 1C1AA 3TSZA 3A98A 3SEMA 1ZHIA 1U8RA 1Q81R 5GAN8 3X25B 5DM7R 2A8EA 2DYIA 2Y4XA 1UHFA 2IY5A 3MQZA 4NL3A 1Y0MA 4M7AB 1D0ZA 2A28A 3CCJT 1ZSZC 1Q7YC 2LT1A 2E6ZA 2CJBA 3X26B 1K1ZA 3VUZA 2EYXA 4EIKA 3LGLA 1K9MC 4MDXA 1ZUUA 5KE3A 2MPXC 4FYVB 1WFWA 5CVIA 3JCMg 3NEMA 4LN2A 4Y92A 3JRZA 1E7OA 4XTZA 3MKDA 1BK2A 1HSQA 3HXZA 2CREA 1QMCA 4DBFA 3RMQA 5AT1B 3HSBA 1QQJA 3FC3A 5GJWB 4OLFA 2XHCA 3EGXB 1YB3A 1M90C 1ASYA 3JB9I 1VQKA 3GLXA 4H2SA 3NELA 3U23A 4K87A 4JS4A 1VQ5T 4C0GA 4C8QE 3M4PA 1D1AA 4F14A 4BE2A 3CCRT 2O01E 2HZYA 2RPNA 1PCXA 2B8AA 1G3SA 3LW5E 2HQXA 4PJMA 4YRCA 3BFMA 2DNUA 3I35A 2A7YA 5IHIA 1S72A 4RQFA 2CJ9A 2LJ3A 2X4YA 2DERA 1Q7YR 4YRJA 4C0DB 4HVVA 5GAN2 3TQ7P 2QQSA 2OTLQ 3OYMA 3G4ST 2X9HA 4NL2A 4XU2A 2RHSB 4LNSA 2G4CA 1KHIA 4C5HA 1K9MR 3M56A 4A63B 2VVKA 1Q95G 5A2QE 5I2SA 2A08A 2JTMA 2PUOB 4M7AG 1VYVA 5IXFA 1YHQT 3P8BB 1X2GA 2DL4A 3CCVA 2AZVA 1B8AA 4E7LA 2R57A 1U1TA 4F7UB 2SRCA 5A0LA 2JOYA 5KYXB 3H0IA 2CKKA 1M90R 1E6HA 4C92B 1SRLA 4J7IA 1Q81U 3E2UA 2K9GA 4XTVA 4TTVA 2DETA 3GNGA 4TVAB 1PKTA 5LJ3g 2P0QA 1AZEA 2KEAA 3TSWA 3HFZB 9ATCB 5GAMd 1UECA 3V7RA 1TUCA 2DIQA 1VQ9A 2V8IA 3NETA 1JXMA 3JB9H 1FWZA 3CC7A 1X2QA 3L4GA 2K6DA 4KGZB 1YIJQ 1X43A 3G71T 4M4ZA 5CQXA 4NS5A 1K0SA 4ZTZB 4EMKA 1YI2A 4M7DD 5KYUA 4JRIA 2E5AA 5J26A 4LVJA 2V8JA 3BDUA 2DXCA 1WGSA 4HWOA 4PJOC 1Y96B 3ERRA 1ZSZB 1RIQA 4HVUA 3Q1JA 2L5QA 3QWYA 3VU3C 3HFVA 2RM4A 2YLBA 5GMKe 2PUKB 3C95A 2RA2A 3OYIA 1NJ1A 4ELZC 4BWAA 2HAXA 2EQKA 4LUDA 3HY1A 3P8HA 1B70B 4JLIA 4GBQA 1MMNA 3GPLA 1B7YA 3OYDA 1LPLA 2DMOA 2JS2A 2ATCB 3KBGA 4FYWB 2DTOA 1FYFA 1QCOA 2RN8A 1VQLT 1H4QA 1SF9A 4P75C 2PVGB 3P8VA 2HL5C 1Q7YU 3TEHA 2JMCA 1UFFA 2YRDA 3PVQA 3NENA 1MV0B 3P8DA 2QGGA 3PMIA 4AFZC 4BI8B 1D1CA 1KD1C 1GBRA 4J7FA 1NJ6A 1WJRA 2NUTA 4C92G 3P8YA 3OMGA 1PRMC 4M78C 3A8GB 3HHTB 1K9MU 3JB9G 3PT9A 4FL6A 4TVWA 3CPWP 3META 2EQUA 1N8RC 1AWOA 1M2VB 1UGSB 4A4FA 3RGLA 4DOVA 5AYFA 1NPRA 2NUPB 1QF6A 4P74C 3FRNA 1Y57A 2P84A 4OMPA 1G3TA 4RUGA 3REBB 5HK0A 5GMKm 4P73A 3DLLA 2DJQA 2DLPA 2QQRA 2RJFA 1RLQC 2CP7A 5D6WA 3RR6A 4UP7A 3VQWA 5E3IA 4E2FB 1G8XA 3CPWA 3CCJQ 1GFDA 1USYA 4C5GA 2QDYB 2AKKA 3OYCA 4WF2A 1PD1A 4DEYA 4HWSA 3MP6A 1WZOA 4BUGA 3I7FA 1NJ2A 2HD0A 2L3SA 2ENMA 4J9BA 2DIGA 1KD1R 1K8AC 3LSSA 1N9SA 2KSSA 4RTXA 4PG3A 4M75A 4O5VA 2AKWB 5KYYB 4N0AC 3VQYA 1VQKT 3VBBA 4BY6B 1N8RR 3MCAB 2R58A 2E10A 2ZZDA 5I21A 4XEOA 1HXDA 1QP3A 2BIVA 1VQ5Q 4YRKA 2DVJA 4HVWA 1IGUA 5GAMf 3CCRQ 1EVKA 5GMKi 2P4RA 2DU7A 5CAIA 1S72T 5CKFA 3PFSA 3AHUA 2CP6A 2DAQA 3CMQA 1UJYA 4KT0E 1FMKA 1FX7A 3V8KA 4D8KA 2EPDA 1YCSB 3FJ5A 4CC3A 2DQ3A 4YRPA 4JPBW 2Q7GA 1JQQA 2JT4A 3ZBDA 3G4SQ 1JU5C 1DJ7B 4LVMA 1EIYB 2QA4A 2YWWA 2X4JA 2RJCA 3CCVT 3QWXX 1K8AR 2ZR2A 4II1A 3OW2A 1YHQQ 4NCXA 1G5HA 1X75C 1UHCA 3UT1A 4C8QB 1WXUA 2QEXA 2EGAA 3OYGA 1HYOA 1I0CA 2ED1A 3EAEA 3EFOB 2HCKA 5GAMj 2EJFA 5ELNA 1NLOC 3CCMA 1QKXA 5GAN3 4XU3A 2HSEB 3VQVA 1BIAA 1D0YA 3M54A 3UDCA 1EFWA 1ZUKA 1VQ6A 2ZTGA 3EG9B 4IUTA 1VQ9T 3IALA 4HCZA 4M77E 1Z7MA 4OF1A 3CC7T 2YRVA 2ROLA 1ABOA 1RAHB 1Q86C 4XTUA 3G71Q 1YI2T 1M1KC 5I2MA 1SKUB 2CZ6B 2EGCA 5CKDA 2LC4A 1KQ1A 4Z88A 1OU8A 4HVCA 2OI3A 1KD1U 2K5IA 4PFZA 1WJSA 2D8JA 1OEBA
chains in the Genus database with same CATH topology
2DTIA 3KXTA 4M7DB 4EO4A 1E1OA 1N8RU 2XI9A 4XAXB 4H2TA 2DZCA 2GF7A 5L8RE 2OAUA 4RCBA 2K3YA 2ODRC 3X20B 3WVEB 3GNFB 5FU6B 2RH2A 5GAN4 4TQFA 4HA8A 1I8FA 4C8QG 1TH7A 3SWNB 2XDDA 4A53A 1YFSA 1JBMA 4PJOA 4YRMA 3CPFA 4F7UE 5C6SA 2LX9A 2OTJA 4BI3A 1K8AU 3SFMA 4ELYC 3UFGA 3GOXA 2PMEA 3INZA 5LJ5e 3OB9A 4XEMA 3QDRB 4BB7A 1O9SA 2J3MA 3HPWA 1VUBA 4M7AC 4EX5A 1LJOA 3VKIA 3QZ9B 4P75A 3OSVA 2RI5A 1B34B 3EFSA 4ZTFA 3WXMB 3LWIA 2ZT7A 4E7IA 2VYTA 4P5NA 4M78A 3OBWA 4WJ4A 2ZPIB 1G3YA 3T9NA 4A4HA 4MZTA 2GFAA 4WJ3M 1RI0A 4EMHA 3V8JA 2ARTA 3JCMe 4J83A 4P74A 1H4SA 2RK1A 3S3NA 2RHXA 2AMCB 4MZMA 4QW2A 4CH6A 3VYHB 4LD6A 2Q7HA 1JJ2A 2ZCFB 2ZPGB 4EDUA 4C0DC 3BDLA 1KQSA 1HK9A 3VV0A 4QVCA 3CCSA 2QA4T 4BACA 2RI2A 1Q86U 3KUFA 3OYFA 2DTHA 2XICA 3M4GA 4X9CA 4N0AA 4R56A 2JVVA 1I5LA 5CR2A 3OYYA 2P0KA 5GAMh 2QEXT 2RHIA 3E1SA 5FROA 2EQMA 2VXEA 2QXFA 2D6FA 1GGMA 2HBPA 3J7AF 2ZPBB 3CCMT 3SD4A 4RMOA 5GAOn 4C92C 2M1HA 1VQ6T 3JB9F 2EWNA 5KE2A 2LTOA 2XK0A 3CBPA 4N4IA 1EQRA 3NTKA 1EVLA 3CBMA 1HTTA 2A3LA 2I2LA 1VQMA 4TWAA 3BY7A 4Q15A 3TEGA 2E70A 5LJ3e 1K73C 4M75F 4J8OA 2D0QB 2JZ2A 4H2XA 4Q6GA 2WSCE 3HRKA 4YPFA 3G6EA 3OS1A 2QHVA 4D6WA 4OB0B 2CZ7B 2PVOB 2EAYA 3M9QA 3PCOB 3H6ZA 3ZEHA 1RL2A 5CK9A 1LOJA 2CZ0B 2XKOC 4GY5A 2ZNJA 1YITA 3RIRA 5D6YA 2CGHA 3OBYA 3J80E 4M77B 12ASA 2DD4A 3LYIA 4LDXA 3N5BB 1BBUA 1BI0A 3A5ZB 1HC7A 2DK3A 3JCMX 3V7SA 2HQEA 2ZGWA 1KG1A 2DU5A 4CH5A 5KNNA 1KOGA 1LYLA 2OTJT 1ADYA 1W2BS 2QQBA 1WQ7A 4Q5WA 3L2VA 3JB9J 4IUVA 1YCYA 4OB1B 1XQHA 4PJOD 4E7HA 1X2HA 5HK3A 1QW1A 3ZFJA 4UPAA 3PTAA 4PKCC 3VYGA 2I4LA 4UC4A 5D6XA 2CZ1B 4OVAA 2NLUA 2GFUA 3LLRA 1H641 5ELOA 3GIBA 1WYDA 1QP2A 4IKFA 1MGQA 4YYEA 2I4OA 4OB2B 4FU6A 3L2RA 4M77G 5KCOA 4C0ZA 2P0LA 1QVFS 4Y91A 4P3OA 2MMPA 1PYSA 4M7DE 2DXTA 4M78D 5F5WA 3JCMV 11ASA 3HRUA 3L1AA 4H2UA 3O8VA 3OS0A 1UGRB 4PHCA 2JUFA 4BY6C 1SETA 4M7AA 2I4MA 4C0FA 1M1FA 2RD1A 2K3XA 4A54A 2DXBA 4P71C 2LT4A 4PJOF 1H4VB 1VQOA 4LVKA 2FB7A 3CCST 1NYQA 2KVQG 2RB6A 2XGTA 5GAN5 3EFRA 1K73U 1G5VA 3REUA 4J6XA 4C8QC 3ME9A 3JCMW 3QO7A 3HFNA 1KC8U 1GXIE 1M9SA 4F7UG 2RHZA 1M8VA 2EYQA 2ZINA 3E9FA 3L2ZA 5LL6S 4G84A 4M78F 4KQEA 2XIDA 2F69A 1VQMT 2RHSA 5GANe 2ARUA 1L0WA 1NZ9A 2WACA 3G6ET 4P3NA 3CCLA 2JTFA 3CCEA 1J5WA 4FT4A 1G5IA 1YFRA 4F7UA 2WSFE 1BIBA 3M59A 4A4EA 1YITT 2RHQB 3I56A 4C92A 4M7DC 4E7JA 1YJ9A 4CH4A 1QVGS 4TVAA 1XOVA 1I81A 3HFZA 1YFTA 1JJCB 2ZPHB 1WPYA 5FU6C 2AHJB 4YRIA 2E65A 4X9DA 3SDZA 3SWNC 2QHUA 2EFIA 2KQWA 3M4YA 1H3ZA 2DQ0A 4HCCA 2ZR3A 3QJYA 4OMFB 2CIMA 3VUBA 2ZT8A 1Y96A 2XDPA 4RG8A 3JAME 3A31A 4TVRA 2J3LA 3LWHA 2E12A 4JLGA 2KAFA 1G3WA 2ZNIA 3CMEA 4FM4B 1B70A 3MEWA 4L6V5 4JS5A 4YRQA 3QZ5B 3OYNA 4OGCA 5C0MA 1OZ3A 3OMCA 1VQPA 4XU0A 4E47A 5GAMg 3MEYA 4Z02A 5M9OA 4KR2A 4CH3A 5K1PA 2RK2A 1D3BB 1PSFA 4LDVA 5GMKj 2VXFA 3HRSA 1VQ8A 1VIFA 4PLLA 5C53B 3NFCA 4CS3A 3LC0A 2LNVA 2DZ9A 1Y71A 3X24B 2G3RA 3QTCA 2H3JA 2FVUA 2Y90A 5GAOp 3LH0A 1EOVA 3NTHA 5C51B 4ZTJA 5EG2A 3PMTA 1LNXA 3TU4K 1VQOT 1VQ7A 2DEQA 3CC2A 1QVPA 5DLOA 2EQJA 1BYMA 5GANj 3CCQA 3M5AA 3HXUA 1UGQB 3A8MB 2AKWA 5FRMA 1UEBA 4H2YA 2VGMA 3J81E 5LJ5d 3QHSA 3UH0A 4CI0C 4RDXA 3VJPA 5FU7B 3WQZA 2ZZGA 3JCMJ 2ALYB 3HXYA 3CD6A 2LCLA 3G7ZA 3P8TA 4P71A 1AHJB 4BD3A 3M4QA 3HXWA 4C5IA 3E9IA 2DKGA 2FL7A 2BKDN 3OA6A 2DVEA 2MI6A 4GLKA 2VGNA 2O4XB 4XQ3A 5KH6A 5HKCA 1VQ4A 2CJAA 2F5TX 2XD0A 3V7CA 3TREA 4JRQA 1EIYA 4YP0A 3CCLT 3QPHA 2V8KA 1BI1A 3CEYA 3JCMb 3CCET 1Z7NA 3OS5A 1EIFA 2FYKA 4YRNA 3JCMQ 3JCMd 4C8QA 1NJIC 3CMAA 4M7AF 3MP8A 3I56T 3CXCS 1YJ9T 5FRNA 4M7DG 4DQ2A 4M77C 1YJWA 2M9UA 3DB3A 4M75E 3OQ5A 4HT8A 3OYKA 3JB9D 2IY5B 1M1GA 4FSXA 4ZN3A 4P72C 2D9TA 4YCVA 4ZGDB 3ER0A 1X56A 4KR3A 2VV5A 4M75D 4AH6A 3LX7A 3FEOA 4YRTA 5GMKl 3S3MA 4HWPA 4N4HA 4B9XA 4M7DA 3CMET 4B9WA 5GAOm 3S6WA 3IG2A 2Q7EA 1X55A 1VQNA 4XTYA 2C8MA 4ZTUB 1ZQ1A 4UP9A 1M5Q1 1VQPT 1ZBXA 5IAYA 1X6OA 3PIPA 4OP0A 4WI1A 5LJ3d 3SWNA 4L59A 1SESA 3M57A 3QO3A 4MZPA 3A32A 3HRIA 2DO3A 4EMGA 4F7UF 3QKJA 1I4K1 4FT2A 1VQ8T 2PQWA 3CC4A 4C92F 3JCMP 5LJ5f 3OYLA 4OGEA 3HTZA 4QVDA 3C4SA 4PL6A 2RHUA 3QIIA 2DDZA 3RKYA 2QHTA 1WJQA 1SRYA 3LGFA 3X28B 4MMLA 1B34A 1VQ7T 4BE0A 1N9WA 5GAOr 1KC8C 3CC2T 2L89A 1OZ2A 1P92A 2QQ9A 3DB4A 1X01A 3CCQT 2ZPEB 4PLIA 1ATIA 1NPPA 2X4XA 2XU8A 5LJ5j 3JCMf 3L4GB 1H4TA 1PSEA 3TCJA 3FLGA 1NE8A 2RJEA 4EPCA 2ZZFA 2QTXA 4EMKB 4UP8A 4LVIA 3E9HA 3CCUA 1MHNA 2RI3A 1NJIU 1N27A 3TEEA 2AMCA 2Q5IA 4YROA 3CD6T 1W66A 4PJOE 2MF2A 2QHSA 4KUDK 1KHCA 3A8HB 3R6OA 4E7KA 3L42A 3HXXA 3HL8A 3OSSC 3PGGA 1WQWA 1VQ4T 4QQ6A 1IZ6A 1BBWA 1VQZA 2VUBA 1B7YB 1VIEA 2XG8D 3I55A 1E24A 3TEHB 3OYJA 1NYRA 2E1HA 3CMAT 3A5YA 3G1ZA 1YBYA 2YLCA 1N6AA 2EKOA 1YGBA 4QQGA 4M78E 3MEVA 2C06A 4QVZA 4YTLA 4C8QD 1YJWT 4KUIA 2ZCEA 5LJ3f 2L8DA 4H2VA 4C5EA 2HNIA 2M0OA 4LD9K 3CPWS 1WNLA 3FIFA 1ASZA 5CKHA 3QO5A 5CIUA 1YJNA 1FXXA 1KMNA 1IREB 3DSQA 4DA4A 4TQDA 1W4SA 3MEUA 3PCOA 3MO8A 2IG0A 3CBOA 4HWRA 3RKXA 4BDYA 1VQNT 4M77A 4M75B 1JB0E 3HFOA 5LJ3j 2LCCA 3A5ZA 3IKLA 4NOYA 4O2DA 3MEAA 1U1SA 3MP1A 4YCUA 3RESA 4VUBA 4P72A 5GANd 2ZXFA 2RJDA 4YDQA 4JDSA 4C8QF 2LDMA 2DPPB 3RACA 5GAMe 3CC4T 4ZIBA 5GAN7 3C94A 1W2BA 2ZIOA 4BI4A 2I4NA 3OD1A 3QXEB 3PZCA 3HP9A 3UPUA 5K1XA 2LQKA 3OW2S 3BW1A 1KMMA 2PVDB 5GAOl 3URGA 4YCWA 2CS7A 4K86A 3M58A 2EJ9A 1NNHA 4K88A 2KMTA 4ZN1A 4R55A 2FHDA 3REXA 4IURA 3L2WA 2GCXA 5LJ5h 1SSFA 4RCCA 5GAOq 4JRKA 2ZT6A 4M75G 3C12A 4PNOA 1UGPB 3QSUA 3OYEA 4M7DF 2C7IA 3MF2A 1M90U 2OTLA 4YRGA 3RKWA 3IKMB 2NS6A 3VQXA 1QVFA 4BDZA 3KFUA 2P4TA 1M4ZA 3CCUT 1OYXA 2QQAA 2Q5HA 4OB3B 3ICAA 1Q82C 5FU7C 2E3CA 3A8LB 2RO0A 4A4KA 1WLEA 3RUXA 5CKBA 3M55A 4N4GA 3E19A 2M16A 3JCMh 2K5FA 5HY6A 2CYZB 5J39A 2RHYA 4O6JA 2VC8A 4H02A 3I55T 3DKMA 3ASKA 5CCAA 1YIJA 3QYGB 3QG1A 3QJ6A 3R07A 2PU9B 4IUUA 2E64A 2WSEE 1O75A 2R5AA 1C0AA 5DLQE 4PJOB 4JJNK 2KDSA 4XU1A 2ODRD 1E1TA 2K4YA 4XTWA 1QE0A 1Y7XA 3UWNA 3RMSA 3A7AA 3RL6A 3QO8A 4KULA 3GP8A 2DXUA 5GANf 2P5IA 5J3BA 3A7RA 2MWPA 1V29B 3L2UA 4V2SA 2P0PA 2JN0A 1YJNT 4DOWA 5HGQA 2R5MA 4M7AE 2K57A 4LDWA 3FB9A 1X54A 4LDUA 3PIOA 5GANg 4M78B 4BE1A 3QBYA 2XDBA 5LJ3h 2RHQA 1XTDA 4H2WA 4M7AD 2DD5A 5IT9E 3A74A 4LDYA 5GAN6 1JJCA 4DPGA 4G85A 4X5OA 4TVYA 1QVGA 2KK4A 2XTIA 4XTXA 2LQ8A 5IN1A 4M77D 3M53A 2ZT5A 4J6YA 4KBMB 4PJOG 1JJ2S 2IVWA 4HCBA 1E22A 3LSQA 1Y07A 3CCJA 3RF1A 2E6NA 1BI2A 1KQSS 4HT4A 1NJ8A 4IUQA 3PNWC 5KCHA 3OYAA 2ARSA 4HWTA 5CQYA 3JCMc 3FJPA 2E5QA 4QQDA 3HKSA 4CRIA 3DLMA 2BUDA 2LVMA 1UB4A 2K5LA 5CKEA 4CS4A 1Q82U 3QYHB 3FDRA 4YRLA 4YRRA 2KY9A 3OYHA 1VQ5A 1OI1A 4MMKA 4M78G 3W3SA 2JNGA 3MF1A 4HKEA 3CCRA 1N9RA 1R8OB 1D3BA 4A4GA 4C92E 2ZIMA 2DJZA 2K2VA 3E9GA 4P3PA 2OTLT 4XK8E 1NJ5A 4IUPA 4J15A 3G4SA 3UGTA 4M77F 1JRIA 4ZGEB 3S3OA 4EMKC 4H2XB 3SB2A 4C92D 4MDWA 4JRPA 1G51A 3JSCA 3BJUA 1YHQA 3NTIA 2E41A 2LRQA 3UGQA 3HY0A 3MHXA 4ME7A 4HT9A 1ADJA 4J6WA 4ZGJB 1XNIA 2X35A 2L3RA 4RG2A 4X34A 1IL2A 2QI2A 4RQEA 3GF5A 3A8OB 4E51A 5A0GA 3RERA 3HXVA 1YIJT 4LVLA 3QUIA 3H8ZA 3G71A 1B76A 2MWOA 4ATOA 2EL9A 4CS2A 3OS2A 4JUVA 1SERA 5GMKh 1BI3A 2EIFA 2YHTA 3OYBA 2Y4YA 5C52B 3V8LA 2ALYA 2MAMA 4YREA 1Q81C 2ZPFB 4J5YA 2GQVA 4BW9A 3WVDB 1M1KU 1WU7A 2ZZEA 3F70A 2O4XA 4Y28E 4L87A 4P73C 4YRSA 3L2QA 2X4WA 2PMFA 3OY9A 1VQLA 1USYC 5FLXE 3A7UA 3HRTA 5A0DA 2F5KA 3QNEA 5CO7A 5DY9A 5GANh 1BKBA 5LJ5g 4L5GA 4YRFA 2EJGA 4FIBA 1KQ2A 4RMFA 1PYSB 4RKUE 3TUPA 4M75C 3CXCA 1ZHIA 1U8RA 5GAN8 3X25B 5DM7R 2A8EA 2Y4XA 2IY5A 3MQZA 4NL3A 4M7AB 3CCJT 1Q7YC 2LT1A 2E6ZA 2CJBA 3X26B 3VUZA 3LGLA 1K9MC 4MDXA 5KE3A 5CVIA 3JCMg 3NEMA 3JRZA 4XTZA 3HXZA 3RMQA 3HSBA 3FC3A 4OLFA 2XHCA 1YB3A 1M90C 1ASYA 3JB9I 1VQKA 3GLXA 4H2SA 3NELA 4K87A 4JS4A 1VQ5T 4C0GA 4C8QE 3M4PA 4BE2A 3CCRT 2O01E 3LW5E 2B8AA 1G3SA 2HQXA 4YRCA 3BFMA 4RQFA 2A7YA 1S72A 2CJ9A 2X4YA 4YRJA 4C0DB 5GAN2 2QQSA 3OYMA 3G4ST 4XU2A 4NL2A 2RHSB 4LNSA 2G4CA 1KHIA 4C5HA 3M56A 5A2QE 5I2SA 2JTMA 2PUOB 4M7AG 1YHQT 3P8BB 1X2GA 3CCVA 1B8AA 4E7LA 2R57A 1U1TA 4F7UB 5A0LA 2JOYA 2CKKA 4C92B 4J7IA 1Q81U 4XTVA 4TTVA 3GNGA 4TVAB 5LJ3g 2P0QA 3HFZB 5GAMd 3V7RA 1VQ9A 2DIQA 2V8IA 3NETA 3JB9H 1FWZA 3CC7A 3L4GA 3G71T 5CQXA 4NS5A 4ZTZB 4EMKA 1YI2A 4M7DD 4JRIA 2E5AA 5J26A 4LVJA 2V8JA 3BDUA 2DXCA 1WGSA 4HWOA 4PJOC 1Y96B 3ERRA 1RIQA 3Q1JA 2L5QA 3VU3C 3HFVA 2RM4A 2YLBA 5GMKe 2PUKB 3C95A 2RA2A 3OYIA 1NJ1A 4ELZC 4BWAA 2HAXA 2EQKA 3HY1A 3P8HA 1B70B 4JLIA 3GPLA 1B7YA 3OYDA 3KBGA 2DTOA 1FYFA 1VQLT 1H4QA 4P75C 2PVGB 3P8VA 1Q7YU 3TEHA 3NENA 3P8DA 3PMIA 4BI8B 1KD1C 4J7FA 1NJ6A 1WJRA 4C92G 3P8YA 3OMGA 4M78C 3A8GB 3HHTB 1K9MU 3JB9G 3PT9A 4FL6A 4TVWA 3META 2EQUA 1N8RC 1UGSB 4A4FA 3RGLA 4DOVA 5AYFA 1NPRA 1QF6A 4P74C 3FRNA 1G3TA 5HK0A 5GMKm 4P73A 3DLLA 2QQRA 2RJFA 5D6WA 4UP7A 3VQWA 5E3IA 3CPWA 1USYA 4C5GA 2QDYB 3OYCA 4WF2A 4HWSA 3MP6A 4BUGA 3I7FA 1NJ2A 2HD0A 2DIGA 1K8AC 3LSSA 1N9SA 2KSSA 4PG3A 4M75A 4O5VA 2AKWB 4N0AC 3VQYA 1VQKT 3VBBA 4BY6B 3MCAB 2R58A 2E10A 2ZZDA 5I21A 4XEOA 1HXDA 1QP3A 2BIVA 4YRKA 5GAMf 1EVKA 5GMKi 2DU7A 5CAIA 1S72T 5CKFA 3PFSA 3AHUA 2DAQA 3CMQA 4KT0E 1FX7A 3V8KA 2DQ3A 4YRPA 2Q7GA 3ZBDA 1DJ7B 4LVMA 1EIYB 2QA4A 2X4JA 2RJCA 3CCVT 2ZR2A 4II1A 3OW2A 4NCXA 1G5HA 1X75C 3UT1A 4C8QB 2QEXA 3OYGA 3EAEA 5GAMj 2EJFA 5ELNA 3CCMA 5GAN3 4XU3A 3VQVA 1BIAA 3M54A 3UDCA 1EFWA 1VQ6A 2ZTGA 4IUTA 1VQ9T 3IALA 4HCZA 4M77E 1Z7MA 4OF1A 3CC7T 2YRVA 1Q86C 4XTUA 1YI2T 1M1KC 5I2MA 2CZ6B 5CKDA 2LC4A 1KQ1A 4HVCA 1KD1U 2K5IA 1WJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTI A;  2RHQ B;  4YRE A;  4C8Q D;  4C92 A;  4M7D C;  4M7D B;  4EO4 A;  4CH4 A;  1E1O A;  2ZCE A;  4TVA A;  4H2T A;  2DZC A;  1I81 A;  3HFZ A;  1YFT A;  4J5Y A;  1JJC B;  4BW9 A;  1WPY A;  1WU7 A;  5LJ3 f;  2ZZE A;  4H2V A;  4RCB A;  2HNI A;  2ODR C;  4L87 A;  4P73 C;  4YRS A;  4YRI A;  5GAN 4;  4TQF A;  4HA8 A;  1WNL A;  1I8F A;  3FIF A;  2E65 A;  4X9D A;  4C8Q G;  2PMF A;  1ASZ A;  3QO5 A;  3SWN C;  1TH7 A;  3SWN B;  4A53 A;  2QHU A;  1KMN A;  3DSQ A;  1USY C;  1YFS A;  1JBM A;  2DQ0 A;  2ZR3 A;  4TQD A;  3A7U A;  3PCO A;  4PJO A;  2CIM A;  4YRM A;  2ZT8 A;  1Y96 A;  3QNE A;  4F7U E;  3A31 A;  5DY9 A;  5GAN h;  5LJ5 g;  4HWR A;  4YRF A;  2EJG A;  2J3L A;  3RKX A;  1KQ2 A;  4RMF A;  1PYS B;  2ZNI A;  3UFG A;  3TUP A;  4M77 A;  4M75 C;  4M75 B;  2PME A;  3INZ A;  1B70 A;  3HFO A;  5LJ5 e;  4YRQ A;  5LJ3 j;  4XEM A;  5GAN 8;  3A5Z A;  3IKL A;  4NOY A;  2J3M A;  4O2D A;  2IY5 A;  1U1S A;  4YCU A;  3RES A;  4NL3 A;  4XU0 A;  4M7A C;  5GAM g;  4P72 A;  5GAN d;  4M7A B;  2ZXF A;  4EX5 A;  1LJO A;  3MEY A;  4P75 A;  4KR2 A;  4YDQ A;  1B34 B;  4CH3 A;  3EFS A;  2CJB A;  5K1P A;  4C8Q F;  2ZT7 A;  1D3B B;  3RAC A;  5GAM e;  4M78 A;  4WJ4 A;  5GMK j;  2VXF A;  3JCM g;  3NEM A;  4ZIB A;  5GAN 7;  2ZIO A;  4XTZ A;  2I4N A;  4WJ3 M;  5C53 B;  3OD1 A;  3HXZ A;  3PZC A;  5K1X A;  4EMH A;  3HSB A;  3BW1 A;  4CS3 A;  1KMM A;  3LC0 A;  3V8J A;  2ART A;  5GAO l;  3JCM e;  2DZ9 A;  4P74 A;  4OLF A;  1YB3 A;  1ASY A;  1H4S A;  3QTC A;  3JB9 I;  4YCW A;  4K86 A;  2EJ9 A;  1NNH A;  3NEL A;  4H2S A;  2Y90 A;  4K88 A;  5GAO p;  4K87 A;  2AMC B;  4C8Q E;  3M4P A;  3REX A;  4CH6 A;  1EOV A;  5C51 B;  1LNX A;  2Q7H A;  5LJ5 h;  4YRC A;  3BFM A;  4RQF A;  4RCC A;  2DEQ A;  5GAO q;  2CJ9 A;  4YRJ A;  4JRK A;  2ZT6 A;  4M75 G;  5GAN 2;  4PNO A;  5GAN j;  3QSU A;  4XU2 A;  1HK9 A;  4NL2 A;  4M7D F;  2RHS B;  4QVC A;  2C7I A;  2G4C A;  3MF2 A;  4LNS A;  3HXU A;  4YRG A;  3RKW A;  3IKM B;  3VQX A;  2DTH A;  2AKW A;  3M4G A;  3KFU A;  4X9C A;  4H2Y A;  4N0A A;  1I5L A;  4M7A G;  5GAM h;  2Q5H A;  5LJ5 d;  1X2G A;  3ICA A;  3QHS A;  1B8A A;  3UH0 A;  2VXE A;  4RDX A;  1U1T A;  4F7U B;  1GGM A;  2E3C A;  3WQZ A;  1WLE A;  2ZZG A;  3JCM J;  2ALY B;  3HXY A;  3RUX A;  5GAO n;  4C92 C;  4C92 B;  3P8T A;  4P71 A;  4XTV A;  3JCM h;  4TTV A;  3JB9 F;  4TVA B;  3M4Q A;  5LJ3 g;  2EWN A;  3HXW A;  3HFZ B;  3E9I A;  2DKG A;  5GAM d;  1EQR A;  1EVL A;  2DVE A;  4XQ3 A;  3V7R A;  2CJA A;  1HTT A;  2VC8 A;  3NET A;  2I2L A;  3JB9 H;  3V7C A;  4H02 A;  3L4G A;  4TWA A;  3BY7 A;  4Q15 A;  3TEG A;  1EIY A;  4YP0 A;  5LJ3 e;  4M75 F;  4ZTZ B;  4H2X A;  3JCM b;  4EMK A;  4Q6G A;  1Z7N A;  4M7D D;  3HRK A;  3R07 A;  4YPF A;  2FYK A;  4YRN A;  3JCM Q;  2E64 A;  4JRI A;  3JCM d;  2QHV A;  2E5A A;  4C8Q A;  3BDU A;  4HWO A;  4PJO C;  2EAY A;  3PCO B;  1C0A A;  4PJO B;  4M7A F;  1Y96 B;  3ERR A;  4XU1 A;  1RIQ A;  1LOJ A;  2ODR D;  1E1T A;  4XTW A;  3VU3 C;  3HFV A;  2RM4 A;  2YLB A;  1QE0 A;  5GMK e;  2ZNJ A;  3RIR A;  2RA2 A;  4M7D G;  2CGH A;  1NJ1 A;  4BWA A;  4DQ2 A;  4M77 C;  3RL6 A;  3A7A A;  4M77 B;  12AS A;  3QO8 A;  3HY1 A;  1B70 B;  2DXU A;  5GAN f;  1BBU A;  2P5I A;  4JLI A;  4M75 E;  3A7R A;  4HT8 A;  1HC7 A;  1B7Y A;  4V2S A;  3JCM X;  3JB9 D;  3V7S A;  2IY5 B;  2JN0 A;  2ZGW A;  2DTO A;  1FYF A;  4P72 C;  2DU5 A;  4YCV A;  4CH5 A;  5HGQ A;  4P75 C;  1H4Q A;  5KNN A;  3P8V A;  4M7A E;  3TEH A;  2K57 A;  1X56 A;  4KR3 A;  3NEN A;  4M75 D;  1KOG A;  1LYL A;  3FB9 A;  4AH6 A;  2ALY A;  1NJ6 A;  4C92 G;  1ADY A;  1X54 A;  3P8Y A;  4M78 C;  5GAN g;  4M78 B;  4YRT A;  3JB9 G;  5GMK l;  4HWP A;  4TVW A;  1WQ7 A;  5LJ3 h;  2RHQ A;  3JB9 J;  1YCY A;  4M7D A;  4H2W A;  5GAO m;  3IG2 A;  4M7A D;  2Q7E A;  3A74 A;  4PJO D;  1X55 A;  1X2H A;  5GAN 6;  3RGL A;  1JJC A;  4DPG A;  4XTY A;  2C8M A;  4ZTU B;  4G85 A;  4UPA A;  4X5O A;  1QF6 A;  4TVY A;  4P74 C;  2XTI A;  4UP9 A;  1M5Q 1;  4XTX A;  5GMK m;  4P73 A;  2I4L A;  4M77 D;  4OP0 A;  4WI1 A;  2ZT5 A;  4UP7 A;  3VQW A;  5E3I A;  5LJ3 d;  4J6Y A;  3SWN A;  4PJO G;  5ELO A;  1E22 A;  1H64 1;  3LSQ A;  3GIB A;  1WYD A;  1USY A;  3RF1 A;  1SES A;  3QO3 A;  1MGQ A;  4WF2 A;  4YYE A;  2I4O A;  3A32 A;  3HRI A;  4EMG A;  4F7U F;  4HWS A;  1NJ8 A;  3I7F A;  1I4K 1;  2ARS A;  4M77 G;  1NJ2 A;  2P0L A;  4HWT A;  3JCM c;  4C92 F;  3JCM P;  3FJP A;  4Y91 A;  3LSS A;  4P3O A;  1N9S A;  5LJ5 f;  1PYS A;  4M7D E;  2DXT A;  4M78 D;  3HTZ A;  4PG3 A;  5F5W A;  3JCM V;  4M75 A;  11AS A;  4QVD A;  2AKW B;  3L1A A;  4H2U A;  4N0A C;  3VQY A;  4PHC A;  2DDZ A;  3VBB A;  3RKY A;  2QHT A;  2E10 A;  1SRY A;  5I21 A;  4XEO A;  4CS4 A;  1SET A;  1HXD A;  4YRL A;  4YRR A;  4M7A A;  4YRK A;  4MMK A;  4MML A;  4M78 G;  2I4M A;  3W3S A;  1B34 A;  5GAM f;  2RD1 A;  1EVK A;  3MF1 A;  5GMK i;  2DU7 A;  1N9W A;  5CAI A;  4A54 A;  5GAO r;  1N9R A;  4P71 C;  1D3B A;  3AHU A;  4C92 E;  4PJO F;  2ZIM A;  3CMQ A;  1H4V B;  2DJZ A;  3V8K A;  1X01 A;  4P3P A;  2FB7 A;  1NYQ A;  2DQ3 A;  4YRP A;  1ATI A;  2RB6 A;  2Q7G A;  1NJ5 A;  5LJ5 j;  3L4G B;  3JCM f;  1H4T A;  4J15 A;  1EIY B;  3UGT A;  2XGT A;  5GAN 5;  3EFR A;  4M77 F;  1JRI A;  2ZZF A;  2QTX A;  4EMK C;  4H2X B;  4EMK B;  3SB2 A;  4UP8 A;  4C92 D;  3REU A;  4J6X A;  3E9H A;  2ZR2 A;  4NCX A;  1G5H A;  4C8Q C;  1G51 A;  4C8Q B;  3BJU A;  3JCM W;  3QO7 A;  3HFN A;  2AMC A;  2Q5I A;  2E41 A;  4F7U G;  4YRO A;  1W66 A;  3UGQ A;  4PJO E;  2QHS A;  5GAM j;  1M8V A;  3HY0 A;  2EJF A;  2ZIN A;  3L2Z A;  5ELN A;  5GAN 3;  4HT9 A;  3HXX A;  4XU3 A;  1ADJ A;  3VQV A;  1BIA A;  4J6W A;  1EFW A;  4G84 A;  4M78 F;  2ZTG A;  3PGG A;  1IL2 A;  4KQE A;  1WQW A;  3IAL A;  4M77 E;  4RQE A;  1Z7M A;  4E51 A;  1BBW A;  1VQZ A;  3RER A;  2RHS A;  3HXV A;  1B7Y B;  5GAN e;  4XTU A;  1E24 A;  2ARU A;  1L0W A;  3QUI A;  4P3N A;  1B76 A;  2EL9 A;  3TEH B;  1J5W A;  1NYR A;  2E1H A;  4CS2 A;  1KQ1 A;  4HVC A;  3A5Y A;  3G1Z A;  1G5I A;  4JUV A;  1SER A;  1YFR A;  2YLC A;  4F7U A;  5GMK h;  2YHT A;  1YGB A;  1BIB A;  5C52 B;  3V8L A;  4M78 E; 
#chains in the Genus database with same CATH topology
 2DTI A;  2DL7 A;  3KXT A;  3RBB B;  4M7D B;  4EO4 A;  1E1O A;  1N8R U;  4LNP A;  2XI9 A;  4XAX B;  4H2T A;  2DZC A;  1OX8 A;  2GF7 A;  5L8R E;  1KFZ A;  3EGD A;  2OAU A;  1PRL C;  4RCB A;  2K3Y A;  2C0O A;  2ODR C;  3X20 B;  3WVE B;  3GNF B;  1BB9 A;  5FU6 B;  2RH2 A;  5GAN 4;  4TQF A;  2FO0 A;  1I8F A;  4KH1 B;  4HA8 A;  4C8Q G;  1A0N B;  1TH7 A;  3H0F A;  1B07 A;  3SWN B;  2XDD A;  1VQL Q;  4A53 A;  1KK7 A;  2X3X D;  2J6O A;  1AZG B;  1YFS A;  1JBM A;  4JJD A;  5L23 A;  4B6M A;  3HTR A;  5IHN A;  1M1K R;  4PJO A;  4YRM A;  2C0T A;  3CPF A;  2MK5 A;  4F7U E;  2LX9 A;  5C6S A;  2OTJ A;  3M0P A;  2KRN A;  3EG1 A;  4BI3 A;  2ABL A;  1K8A U;  3REA B;  3SFM A;  4ELY C;  3UFG A;  3GOX A;  2LMJ A;  2KT1 A;  2PME A;  3INZ A;  1I1J A;  1B7T A;  1W6X A;  5LJ5 e;  4AG2 C;  3OB9 A;  4XEM A;  1M27 C;  3QDR B;  4BB7 A;  2AZS A;  4J9E A;  1O9S A;  2J3M A;  3HPW A;  2DYB A;  1VUB A;  4M7A C;  4EX5 A;  1LJO A;  3VKI A;  3QZ9 B;  1YN8 A;  2CUD A;  4P75 A;  7AT1 B;  3OSV A;  2RI5 A;  1B34 B;  1UE9 A;  3EFS A;  4ZNX A;  4ZTF A;  3WXM B;  3LWI A;  2ZT7 A;  4E7I A;  2JS0 A;  2VYT A;  4F04 B;  1NEB A;  4P5N A;  4M78 A;  3OBW A;  4WJ4 A;  2ZPI B;  1G3Y A;  1IHV A;  3T9N A;  4A4H A;  4MZT A;  2VB6 A;  2GFA A;  1F1B B;  4WJ3 M;  1RAB B;  1MMD A;  1JJ2 P;  1RI0 A;  4EMH A;  2CT4 A;  3V8J A;  2ART A;  3JCM e;  1KQS P;  4J83 A;  1VQK Q;  4P74 A;  1H4S A;  1IGQ A;  2RK1 A;  3S3N A;  2ED0 A;  2E4H A;  2RHX A;  2AMC B;  4MZM A;  1PM3 A;  4QW2 A;  1PNJ A;  4CH6 A;  1YWO A;  1NG2 A;  3ZL7 C;  1MMA A;  3VYH B;  3D7S B;  4LD6 A;  2Q7H A;  1NLP C;  4DBH A;  1JJ2 A;  1GCP A;  2ZCF B;  2ZPG B;  4EDU A;  4C0D C;  3BDL A;  1KQS A;  2W10 A;  1RLP C;  2CUB A;  1M3B A;  1HK9 A;  3VV0 A;  2LJ1 A;  4QVC A;  3CCS A;  2QA4 T;  2EBP A;  1M3A A;  4BAC A;  2RI2 A;  1Q86 U;  3KUF A;  3OYF A;  2DTH A;  4GLM A;  2XIC A;  3M4G A;  2CSI A;  4X9C A;  4N0A A;  4R56 A;  4CC7 A;  2JVV A;  1E6G A;  4FYY B;  4DBR A;  5CR2 A;  3EHR A;  3OYY A;  1I5L A;  2P0K A;  2E3I A;  2EKH A;  3EHQ A;  5GAM h;  3CCV Q;  2E5K A;  2QEX T;  2RHI A;  1FMV A;  3E1S A;  5FRO A;  2EQM A;  2VXE A;  2KYB A;  2QXF A;  2D6F A;  4D8D A;  1GGM A;  3I5S A;  2HBP A;  3J7A F;  2ZPB B;  1SHG A;  4J9I A;  3CCM T;  3SD4 A;  4RMO A;  2AK5 A;  5GAO n;  4C92 C;  2M1H A;  1VQ6 T;  3BE3 A;  3JB9 F;  2EWN A;  5KE2 A;  2LTO A;  1YP5 A;  1X2K A;  2XK0 A;  3CBP A;  4N4I A;  1EQR A;  3NTK A;  1VQ9 Q;  1EVL A;  3CBM A;  3CC7 Q;  1HTT A;  2A3L A;  4J9H A;  2I2L A;  3GBQ A;  1VQM A;  4TWA A;  3BY7 A;  4Q15 A;  3TEG A;  4PFP A;  2E70 A;  5LJ3 e;  1K73 C;  4M75 F;  4J8O A;  2D0Q B;  2JZ2 A;  1YI2 Q;  4H2X A;  1TWB A;  1RAF B;  4Q6G A;  1U5S A;  2WSC E;  2DEU A;  3HRK A;  4YPF A;  2KRS A;  3G6E A;  3OS1 A;  2QHV A;  4D6W A;  4OB0 B;  2CZ7 B;  2KNB B;  2PVO B;  2JTE A;  2EAY A;  1X69 A;  3M9Q A;  3PCO B;  3H6Z A;  3R6N A;  2O9S A;  3ZEH A;  1RL2 A;  5CK9 A;  1LOJ A;  2GBQ A;  2CZ0 B;  2XKO C;  4GY5 A;  2ZNJ A;  1K9A A;  3RIR A;  1YIT A;  1T3S A;  5D6Y A;  2CGH A;  3OBY A;  3J80 E;  4M77 B;  12AS A;  2DD4 A;  2DF6 A;  3LYI A;  1KJW A;  4LDX A;  3N5B B;  1BBU A;  2OJ2 A;  2C0I A;  4DEX A;  1BI0 A;  1MUZ A;  3A5Z B;  1HC7 A;  2DK3 A;  3JCM X;  3V7S A;  2FG0 A;  1TS9 A;  2HQE A;  2ZGW A;  1KG1 A;  2DU5 A;  4CH5 A;  1OOT A;  5KNN A;  2QYZ A;  2DM1 A;  1KOG A;  1LYL A;  1K73 R;  4K11 A;  2OTJ T;  2HQH A;  2QGF B;  1ADY A;  1W2B S;  1UUE A;  2QQB A;  1WQ7 A;  1VYU A;  4Q5W A;  3L2V A;  3JB9 J;  4IUV A;  1YCY A;  4OB1 B;  1XQH A;  3IQL A;  4PJO D;  2SEM A;  4E7H A;  1X2H A;  2DRK A;  5HK3 A;  1QW1 A;  3ZFJ A;  1M2O A;  1VA7 A;  4OML A;  4UPA A;  3PTA A;  2ZAE A;  4PKC C;  3CCE Q;  1MV3 A;  3VYG A;  2I4L A;  4UC4 A;  5D6X A;  2CZ1 B;  4OVA A;  1EX4 A;  2NUZ A;  2NLU A;  3NHN A;  2QTV A;  2GFU A;  3LLR A;  1H64 1;  1ZA2 B;  5ELO A;  3GIB A;  1WYD A;  1OV3 A;  1QP2 A;  1OU9 A;  2FZK B;  4IKF A;  2QAS A;  1MGQ A;  4YYE A;  2I4O A;  2KYM A;  3PVL A;  2EYZ A;  1WHM A;  2DBM A;  4OB2 B;  4FU6 A;  1K76 A;  3L2R A;  4M77 G;  2FPF A;  5KCO A;  1YFN A;  4C0Z A;  2P0L A;  4PJJ A;  1QVF S;  5ECA A;  4Y91 A;  3VS1 A;  4P3O A;  2H8H A;  2MMP A;  1PYS A;  4M7D E;  2DXT A;  4M78 D;  5F5W A;  3JCM V;  11AS A;  3HRU A;  3L1A A;  4H2U A;  3O8V A;  3OS0 A;  2RF0 A;  1UGR B;  4PK4 A;  4PHC A;  2JUF A;  4BY6 C;  2CP0 A;  2ESW A;  2YRC A;  4RTW A;  1SET A;  2EW3 A;  1G83 A;  4M7A A;  1HD3 A;  2I4M A;  4C0F A;  1M1F A;  2RD1 A;  2L2P A;  2K3X A;  4A54 A;  2DXB A;  4P71 C;  1ZLM A;  3UA7 A;  2LT4 A;  3C0C A;  3CME Q;  1PG5 B;  2BE7 D;  4PJO F;  1H4V B;  3THK A;  1VQO A;  2EVR A;  1C0M A;  4LVK A;  1UG1 A;  4FSS A;  2FB7 A;  3CCS T;  1NYQ A;  1NEG A;  2KVQ G;  2RB6 A;  1H8K A;  4JZ4 A;  4QKU A;  2GTJ A;  2QA4 Q;  2L3P A;  2XGT A;  5GAN 5;  3EFR A;  1K73 U;  1RAD B;  5EC7 A;  1G5V A;  3REU A;  1ABQ A;  4J6X A;  3EGX A;  3RDV A;  4C8Q C;  2QEX Q;  3ME9 A;  3JCM W;  3QO7 A;  1Z9Q A;  3HFN A;  2F2X A;  1KC8 U;  2GTO A;  1GXI E;  1M9S A;  4F7U G;  2RHZ A;  2KXC A;  3CCM Q;  1M8V A;  2EYQ A;  2ZIN A;  1VQ8 Q;  3E9F A;  3L2Z A;  1SPK A;  1VQ6 Q;  2MCN A;  2O9V A;  5LL6 S;  4G84 A;  4M78 F;  4KQE A;  2XID A;  4KRT A;  3SHW A;  2F69 A;  1ZX6 A;  1N5Z A;  1VQM T;  2RHS A;  2CT3 A;  2QG9 B;  5GAN e;  4OMN A;  5FW9 A;  2DL8 A;  2ARU A;  1CKB A;  1L0W A;  1NZ9 A;  2WAC A;  3G6E T;  4P3N A;  3CCL A;  2A37 A;  2JTF A;  3M0R A;  3CCE A;  1J5W A;  3CQT A;  4FT4 A;  2DX1 A;  1G5I A;  2FRY A;  1YFR A;  4F7U A;  1EFN A;  5KYX A;  4OMQ A;  2WSF E;  1BIB A;  3M59 A;  2X51 A;  4A4E A;  1YIT T;  1CSK A;  2RHQ B;  3I56 A;  4C92 A;  4M7D C;  4E7J A;  4QT7 A;  1YJ9 A;  4CH4 A;  1QVG S;  4TVA A;  1XOV A;  1I81 A;  3HFZ A;  1YFT A;  1JJC B;  2ZPH B;  1WPY A;  1I5O B;  3VS4 A;  3MJX A;  5FU6 C;  2AHJ B;  4YRI A;  2LNH B;  1ZSG A;  2E65 A;  4X9D A;  3SDZ A;  3SWN C;  2QHU A;  2EFI A;  2KQW A;  3M4Y A;  1H3Z A;  2DQ0 A;  4HCC A;  2ZR3 A;  1ZBJ A;  2OAW A;  3QJY A;  4OMF B;  2OTJ Q;  2DIL A;  3VUB A;  2CIM A;  2ZT8 A;  1Y96 A;  2XDP A;  1K0X A;  4RG8 A;  1ZSZ A;  5IXB A;  3JAM E;  3A31 A;  2LJ0 A;  3PE0 A;  4TVR A;  2RQV A;  3LWH A;  2J3L A;  2E12 A;  4JLG A;  2KAF A;  1G3W A;  2ZNI A;  2E3H A;  2L0A A;  3CME A;  4IIO A;  4FM4 B;  1B70 A;  3MEW A;  4L6V 5;  4HCK A;  4JS5 A;  4YRQ A;  3QZ5 B;  3OYN A;  4OGC A;  5C0M A;  1OZ3 A;  3OMC A;  1MNE A;  1VQP A;  2HKN A;  3CMA Q;  4XU0 A;  4E47 A;  5GAM g;  4PJN A;  3MEY A;  2HEQ A;  4Z02 A;  1MMG A;  5M9O A;  4KR2 A;  2FRW A;  4CH3 A;  1UTI A;  2A36 A;  5K1P A;  2KGT A;  2RK2 A;  1WHJ A;  1D3B B;  1PSF A;  4LDV A;  5GMK j;  2VXF A;  3HRS A;  1VQ8 A;  4F16 A;  1VIF A;  4PLL A;  5C53 B;  1M2V A;  3NFC A;  3MPU B;  5FWC A;  4CS3 A;  3LC0 A;  2KE9 A;  2NUP A;  2LNV A;  2JJ9 A;  2DZ9 A;  1JXO A;  1Y71 A;  3X24 B;  2G3R A;  1FMW A;  3QTC A;  2H3J A;  5KYW B;  2FVU A;  2Y90 A;  5GAO p;  1H3H A;  1B3Q A;  3LH0 A;  1EOV A;  3NTH A;  5C51 B;  2D0N A;  4ZTJ A;  5EG2 A;  3PMT A;  1LNX A;  1ZA1 B;  3TU4 K;  1VQO T;  1VQ7 A;  2HDA A;  1QLY A;  2DEQ A;  3CC2 A;  1QVP A;  5DLO A;  2EQJ A;  1BYM A;  2CP2 A;  5GAN j;  2B86 A;  3CCS Q;  3CCQ A;  3M5A A;  3HXU A;  1UGQ B;  1VYT A;  1WXB A;  3A8M B;  4F17 A;  2AKW A;  5FRM A;  5KYY A;  1UEB A;  1UDL A;  4H2Y A;  2VGM A;  3J81 E;  5LJ5 d;  3QHS A;  3UH0 A;  4CI0 C;  4RDX A;  3VJP A;  4E6R A;  5FU7 B;  3WQZ A;  1EZZ B;  2ZZG A;  3JCM J;  2ALY B;  3HXY A;  1Q86 R;  3CD6 A;  2LCL A;  1X27 A;  3G7Z A;  3P8T A;  4P71 A;  1AHJ B;  4BD3 A;  3M4Q A;  4CC4 B;  4JJB A;  3HXW A;  4C5I A;  3E9I A;  2DKG A;  2FL7 A;  2BKD N;  3UA6 A;  3OA6 A;  2F2W A;  2DVE A;  2MI6 A;  4GLK A;  2VGN A;  2O4X B;  4PFO A;  4XQ3 A;  5KH6 A;  2BE9 B;  5HKC A;  1VQM Q;  1VQ4 A;  2CJA A;  2F5T X;  2XD0 A;  3V7C A;  3TRE A;  2KT8 A;  4JRQ A;  4YP0 A;  1EIY A;  2QAZ A;  3QPH A;  2V8K A;  3CCL T;  1BI1 A;  3CEY A;  3JCM b;  3CCE T;  3VS0 A;  3G6E Q;  1Z7N A;  3OS5 A;  1EIF A;  2FYK A;  4YRN A;  3JCM Q;  2V1R A;  3JCM d;  1PD0 A;  4C8Q A;  1NJI C;  3TVT A;  1U06 A;  1OX9 A;  3CMA A;  4M7A F;  2AT1 B;  3AT1 B;  3MP8 A;  3I56 T;  3EFO A;  1M30 A;  3CXC S;  1YJ9 T;  2J7I A;  1YIT Q;  5FRN A;  4M7D G;  2VWF A;  4DQ2 A;  4M77 C;  1YJW A;  1BCO A;  2DE0 X;  3EG9 A;  1PHT A;  2M9U A;  3DB3 A;  1WHH A;  4M75 E;  2DFU A;  3A1P A;  2VKN A;  3OQ5 A;  4HT8 A;  3OYK A;  3JB9 D;  4AT1 B;  2A0F B;  4FSX A;  1M1G A;  2IY5 B;  4ZN3 A;  2K7A A;  1K4U S;  4P72 C;  2D9T A;  1J3T A;  4YCV A;  2GGR A;  1FYN A;  1VOM A;  1IB8 A;  4ZGD B;  3ER0 A;  1X56 A;  4KR3 A;  2VV5 A;  2I0N A;  4M75 D;  2YUP A;  2HL3 A;  4AH6 A;  3LX7 A;  3FEO A;  4YRT A;  5GMK l;  3S3M A;  4HWP A;  4N4H A;  3EG2 A;  1JO8 A;  4B9X A;  3CME T;  4M7D A;  4B9W A;  5GAO m;  3S6W A;  3IG2 A;  1X6G A;  2Q7E A;  1RAC B;  1X55 A;  3EG0 A;  1VQN A;  4XTY A;  2C8M A;  4ZTU B;  2KR3 A;  1ZQ1 A;  4UP9 A;  1M5Q 1;  1VQP T;  1ZBX A;  5IAY A;  2L3Q A;  1X6O A;  3PIP A;  4OP0 A;  2PTK A;  4WI1 A;  5LJ3 d;  3SWN A;  4L59 A;  1BCM A;  1AD5 A;  4Z89 A;  2MOX A;  1W1F A;  1SES A;  3M57 A;  3QO3 A;  4MZP A;  3LH5 A;  3KFV A;  3A32 A;  3HRI A;  2DO3 A;  4EMG A;  4F7U F;  3QKJ A;  1I4K 1;  4FT2 A;  1G2B A;  2LQW A;  1VQ8 T;  2PQW A;  3CC4 A;  4C92 F;  3JCM P;  1M3C A;  5LJ5 f;  3OYL A;  4OGE A;  4FW2 A;  3HTZ A;  4QVD A;  3C4S A;  4PL6 A;  2RHU A;  3QII A;  2DDZ A;  2J05 A;  3RKY A;  2QHT A;  1WJQ A;  1SRY A;  3LGF A;  1PKS A;  1TUG B;  3H9N A;  4KH0 B;  2FZG B;  1CKA A;  3NMZ C;  3X28 B;  4MML A;  1AVZ C;  1B34 A;  1VQ7 T;  2DBK A;  4BE0 A;  1N9W A;  5GAO r;  1KC8 C;  3CC2 T;  2L89 A;  1OZ2 A;  2QK0 A;  1P92 A;  1VQO Q;  2QQ9 A;  3DB4 A;  1X01 A;  3CCQ T;  2ZPE B;  4PLI A;  3VS7 A;  1ATI A;  4AG1 C;  1OPL A;  1NPP A;  2X4X A;  2XU8 A;  5LJ5 j;  3JCM f;  3L4G B;  1H4T A;  1PSE A;  3TCJ A;  1KSW A;  1NE8 A;  1AWX A;  1AWJ A;  3FLG A;  1QWE A;  2COY A;  2RJE A;  4EPC A;  2ZZF A;  2QTX A;  2LP5 A;  4EMK B;  4UP8 A;  4RTV A;  4LVI A;  3E9H A;  3CCU A;  5KYU B;  1MHN A;  2RI3 A;  4AMC A;  2YT6 A;  1NJI U;  1N27 A;  2AIR B;  3TEE A;  4J9D A;  2LCS A;  1D09 B;  2AMC A;  2Q5I A;  1GL5 A;  4YRO A;  3CD6 T;  1W66 A;  4PJO E;  2MF2 A;  2QHS A;  1BU1 A;  4KUD K;  1KHC A;  3A8H B;  3R6O A;  4E7K A;  3L42 A;  3HXX A;  3HL8 A;  3OSS C;  3PGG A;  1WQW A;  1VQ4 T;  1ZUY A;  2G6F X;  4QQ6 A;  1IZ6 A;  1BBW A;  1VQZ A;  2VUB A;  1KC8 R;  1B7Y B;  1H92 A;  1VIE A;  2XG8 D;  3I55 A;  1GRI A;  1E24 A;  3CCL Q;  1XJW B;  2F2V A;  4J9F A;  3TEH B;  2J6K A;  3OYJ A;  1NYR A;  2E1H A;  3CMA T;  3A5Y A;  3G1Z A;  1NYG A;  1YBY A;  2NUT B;  2YLC A;  1N6A A;  2F1L A;  2EKO A;  1YGB A;  4QQG A;  4M78 E;  3I56 Q;  4HXJ A;  1RI9 A;  3MEV A;  2C06 A;  4QVZ A;  1D1B A;  4YTL A;  4C8Q D;  1YJ9 Q;  1YJW T;  2OX7 A;  1WHK A;  5IHK A;  1RUW A;  4KUI A;  2ZCE A;  2JM9 A;  2EGE A;  4RTT A;  5LJ3 f;  3UF4 A;  1V1C A;  2L8D A;  4H2V A;  1M8M A;  4C5E A;  2HNI A;  2M0O A;  4LD9 K;  4JZ3 A;  3CPW S;  2CH4 A;  2LX7 A;  5HCK A;  1QCF A;  1WNL A;  2MIO A;  3FIF A;  1R77 A;  5CKH A;  3QO5 A;  5CIU A;  1ASZ A;  1YJN A;  1FXX A;  2HKQ B;  1KMN A;  1IRE B;  3DSQ A;  4DA4 A;  4TQD A;  1W4S A;  3MEU A;  3PCO A;  4RTY A;  1RAE B;  3MO8 A;  1Z9Z A;  2IG0 A;  3CBO A;  4HWR A;  1WXT A;  3RKX A;  1TUD A;  2KI7 A;  4BDY A;  1VQN T;  4M77 A;  1D0X A;  4E7S A;  4M75 B;  3O5Z A;  2CP3 A;  4FCY A;  1JB0 E;  3HFO A;  1T0J A;  5LJ3 j;  2LCC A;  4ANJ A;  1WI7 A;  3A5Z A;  1RAG B;  1R0C B;  3IKL A;  1W2B P;  2ECZ A;  4NOY A;  1VQP Q;  5IH2 A;  4O2D A;  1PWT A;  3MEA A;  1U1S A;  3MP1 A;  4YCU A;  3RES A;  4VUB A;  4P72 A;  2O88 A;  5GAN d;  2ZXF A;  2DRM A;  2RJD A;  1SEM A;  3ULR B;  4YDQ A;  3VS2 A;  1OPK A;  3NPF A;  4JDS A;  4C8Q F;  1NBE B;  2LDM A;  2DPP B;  3RAC A;  5GAM e;  1V76 A;  4X1V A;  3CC4 T;  4AFQ C;  2CP5 A;  1R0B G;  4ZIB A;  2RQW A;  5GAN 7;  3C94 A;  1W2B A;  2ZIO A;  4BI4 A;  2I4N A;  3OD1 A;  3QXE B;  3PZC A;  1IRX A;  3HP9 A;  3UPU A;  5K1X A;  2LQK A;  3OW2 S;  1YWP A;  3BW1 A;  4IIM A;  1KMM A;  2PVD B;  5D7U A;  1UGV A;  5GAO l;  3URG A;  1WDX A;  2X3W D;  2J06 A;  4ORZ A;  4YCW A;  2CS7 A;  4K86 A;  2CSQ A;  3M58 A;  2EJ9 A;  1NNH A;  4K88 A;  2KMT A;  4ZN1 A;  4KGX B;  4LUE A;  2RQT A;  4R55 A;  1QVF P;  1AT1 B;  2XMF A;  2FHD A;  4OMO A;  3REX A;  4IUR A;  3L2W A;  2GCX A;  8ATC B;  1VQ7 Q;  5LJ5 h;  3CC2 Q;  1JEG A;  1SSF A;  1WHG A;  4RCC A;  5GAO q;  1YNZ A;  3VS6 A;  3G1J A;  4JRK A;  2COZ A;  2ZT6 A;  3M0T A;  4M75 G;  3C12 A;  4PNO A;  1UGP B;  3CCQ Q;  3QSU A;  1QWF A;  1WHL A;  3OYE A;  3EGU A;  4M7D F;  2C7I A;  3MF2 A;  4WTO B;  1M90 U;  2OTL A;  4YRG A;  4E7Z A;  3RKW A;  3IKM B;  2JMA A;  2NS6 A;  3VS3 A;  3VQX A;  2JW4 A;  1QVF A;  4BDZ A;  3KFU A;  2P4T A;  1M4Z A;  3I9Q A;  3CCU T;  1OYX A;  2QQA A;  4FYX B;  1ARK A;  4LXC A;  2Q5H A;  4OB3 B;  3ICA A;  1Q82 C;  5FU7 C;  3QDF A;  2YUQ A;  2HBW A;  2E3C A;  2V26 A;  1GCQ C;  3A8L B;  2RO0 A;  4A4K A;  1WLE A;  3CD6 Q;  3RUX A;  5CKB A;  1AOJ A;  2KRO A;  1TU0 B;  3M55 A;  4N4G A;  3E19 A;  2M16 A;  3JCM h;  2K5F A;  5HY6 A;  2CYZ B;  5J39 A;  1VQ4 Q;  2RHY A;  4O6J A;  3EGD B;  2PNI A;  2VC8 A;  2DA9 A;  1RAA B;  2IPO B;  4H02 A;  2DL3 A;  3DKM A;  4RTZ A;  3I55 T;  2QDL A;  2CH4 W;  3ASK A;  4J9C A;  5CCA A;  5I22 A;  1YIJ A;  3QYG B;  2CDT A;  3QG1 A;  3QJ6 A;  3R07 A;  2PU9 B;  4IUU A;  2E64 A;  2WSE E;  1O75 A;  3OW2 P;  3EH2 A;  4DBQ A;  2R5A A;  1C0A A;  5DLQ E;  4PJO B;  4JJN K;  2KDS A;  4XU1 A;  2DL5 A;  1E1T A;  2K4Y A;  2ODR D;  4XTW A;  1QE0 A;  1Y7X A;  1Q82 R;  1YJW Q;  3UWN A;  2LZ6 B;  3RMS A;  3A7A A;  3RL6 A;  3QO8 A;  4KUL A;  2VAS A;  1AWW A;  3GP8 A;  2DXU A;  1C6V X;  5GAN f;  2P5I A;  5J3B A;  3A7R A;  2MWP A;  1V29 B;  3L2U A;  4V2S A;  2P0P A;  3H0H A;  2D1X A;  1IHW A;  2JN0 A;  1YJN T;  2K3B A;  1ACM B;  1U3O A;  4DOW A;  5HGQ A;  2R5M A;  1QVG P;  4M7A E;  2K57 A;  1IXD A;  4LDW A;  3FB9 A;  1X54 A;  4LDU A;  3PIO A;  5GAN g;  4M78 B;  4BE1 A;  1KIK A;  1GBQ A;  3QBY A;  3M0Q A;  5LJ3 h;  2XDB A;  2COW A;  2RHQ A;  4WCI A;  1XTD A;  2ROT A;  4H2W A;  1X6B A;  4M7A D;  2V1Q A;  2DD5 A;  5IT9 E;  3A74 A;  1SHF A;  1VQN Q;  4LDY A;  5GAN 6;  1JJC A;  4DPG A;  4G85 A;  4X5O A;  4TVY A;  1QVG A;  2KK4 A;  3EG3 A;  2XTI A;  4XTX A;  2LQ8 A;  1GFC A;  1AEY A;  5IN1 A;  4M77 D;  1TG0 A;  3M53 A;  2ZT5 A;  4J6Y A;  4KBM B;  4ESR A;  1PC0 A;  1TOV A;  4PJO G;  1JJ2 S;  2IVW A;  2O31 A;  3M0U A;  4AFU C;  1Y07 A;  4HCB A;  1E22 A;  3LSQ A;  3CCJ A;  4OMM A;  2KBT A;  3RF1 A;  8AT1 B;  2E6N A;  1BI2 A;  3VRY A;  1KQS S;  4HT4 A;  2RNA A;  2K2M A;  3H41 A;  4R0K A;  1NJ8 A;  2BZX A;  4IUQ A;  3PNW C;  3EH1 A;  5KCH A;  3OYA A;  2GNC A;  2ARS A;  3CC4 Q;  4HWT A;  5CQY A;  3JCM c;  3FJP A;  4J9G A;  2E5Q A;  2D8H A;  4QQD A;  1TXQ A;  2BZY A;  3HKS A;  1SG5 A;  2H3E B;  4CRI A;  5I11 A;  2RQU A;  1TTH B;  1BBZ A;  3DLM A;  4KGV B;  2BUD A;  2LVM A;  1UB4 A;  2K5L A;  2JXB A;  3I5R A;  5CKE A;  1WIE A;  4CS4 A;  5FWB A;  1Q82 U;  3QYH B;  3FDR A;  4Z8A A;  4YRL A;  4YRR A;  2KY9 A;  2FEI A;  3OYH A;  1VQ5 A;  1OI1 A;  4MMK A;  1OUL A;  5KYN A;  4M78 G;  3W3S A;  2JNG A;  1MND A;  3MF1 A;  4HKE A;  4JJC A;  3CCR A;  1N9R A;  1R8O B;  1D3B A;  4A4G A;  4C92 E;  2ZIM A;  1TSF A;  2DJZ A;  2K2V A;  2YDL A;  3E9G A;  2YSQ A;  4P3P A;  2OTL T;  2HSP A;  4XK8 E;  1NJ5 A;  4IUP A;  1NYF A;  4J15 A;  3G4S A;  3UGT A;  4M77 F;  1JRI A;  4ZGE B;  1S1N A;  3S3O A;  4EMK C;  4H2X B;  2BZ8 A;  3SB2 A;  2W0Z A;  4C92 D;  4MDW A;  3CCU Q;  4JRP A;  6AT1 B;  2M02 A;  1G51 A;  2KXD A;  2YUN A;  5KYW A;  3JSC A;  3BJU A;  1YHQ A;  2AKL A;  3NTI A;  2E41 A;  2LRQ A;  2BTT A;  1NM7 A;  3UGQ A;  1WLP B;  3HY0 A;  2Z0W A;  2HMA A;  2FPE A;  2MYS A;  4PJL A;  3MHX A;  4ME7 A;  4HT9 A;  1ADJ A;  4J6W A;  4ZGJ B;  1XNI A;  2X35 A;  1RAI B;  2L3R A;  4RG2 A;  4X34 A;  1WX6 A;  1IL2 A;  2QI2 A;  5GJV B;  4RQE A;  3GF5 A;  3A8O B;  4E51 A;  1NJI R;  5A0G A;  2RQR A;  3RER A;  2NYS A;  3HXV A;  1YIJ T;  3RNJ A;  3I55 Q;  4LVL A;  2RMO A;  4AFS C;  3QUI A;  3H8Z A;  3G71 A;  2NWM A;  2K79 A;  1B76 A;  2MWO A;  1I07 A;  4ATO A;  3NGP A;  2EL9 A;  4CS2 A;  1LCK A;  3OS2 A;  2GQI A;  1IO6 A;  1UJ0 A;  4JUV A;  1SER A;  1S72 Q;  5GMK h;  2M51 A;  1BI3 A;  2EIF A;  2YHT A;  3OYB A;  2Y4Y A;  1GCQ A;  2M0Y A;  2KRM A;  5C52 B;  3V8L A;  2ALY A;  1QKW A;  2MAM A;  2O2O A;  4YRE A;  1Q81 C;  2ZPF B;  2EYW A;  2EQI A;  4J5Y A;  2GQV A;  4LE9 A;  4BW9 A;  3WVD B;  1M1K U;  1WU7 A;  3VRZ A;  1HJD A;  2IIM A;  3F70 A;  2ZZE A;  2O4X A;  3UAT A;  1QCN A;  4Y28 E;  1WA7 A;  4L87 A;  4P73 C;  2LQN A;  3JV3 A;  1LVK A;  3L2Q A;  4YRS A;  1SRM A;  3CXC P;  1YJN Q;  2X4W A;  2PMF A;  1SSH A;  2EYY A;  4CC2 A;  1WYX A;  2J6F A;  4FW1 A;  3OY9 A;  1VQL A;  1USY C;  5FLX E;  3A7U A;  3HRT A;  5A0D A;  2FZC B;  2F5K A;  3QNE A;  3VS5 A;  2FPD A;  2YXY A;  5CO7 A;  1W70 A;  5DY9 A;  2YUO A;  5GAN h;  1BKB A;  2PZ1 A;  5LJ5 g;  4L5G A;  1OQK A;  4YRF A;  2EJG A;  4FIB A;  1T3L A;  1KQ2 A;  4RMF A;  2JM8 A;  1PYS B;  3M0S A;  4RKU E;  3TUP A;  4RTU A;  1T0H A;  4M75 C;  3CXC A;  1C1A A;  3TSZ A;  3A98 A;  3SEM A;  1ZHI A;  1U8R A;  1Q81 R;  5GAN 8;  3X25 B;  5DM7 R;  2A8E A;  2DYI A;  2Y4X A;  1UHF A;  2IY5 A;  3MQZ A;  4NL3 A;  1Y0M A;  4M7A B;  1D0Z A;  2A28 A;  3CCJ T;  1ZSZ C;  1Q7Y C;  2LT1 A;  2E6Z A;  2CJB A;  3X26 B;  1K1Z A;  3VUZ A;  2EYX A;  4EIK A;  3LGL A;  1K9M C;  4MDX A;  1ZUU A;  5KE3 A;  2MPX C;  4FYV B;  1WFW A;  5CVI A;  3JCM g;  3NEM A;  4LN2 A;  4Y92 A;  3JRZ A;  1E7O A;  4XTZ A;  3MKD A;  1BK2 A;  1HSQ A;  3HXZ A;  2CRE A;  1QMC A;  4DBF A;  3RMQ A;  5AT1 B;  3HSB A;  1QQJ A;  3FC3 A;  5GJW B;  4OLF A;  2XHC A;  3EGX B;  1YB3 A;  1M90 C;  1ASY A;  3JB9 I;  1VQK A;  3GLX A;  4H2S A;  3NEL A;  3U23 A;  4K87 A;  4JS4 A;  1VQ5 T;  4C0G A;  4C8Q E;  3M4P A;  1D1A A;  4F14 A;  4BE2 A;  3CCR T;  2O01 E;  2HZY A;  2RPN A;  1PCX A;  2B8A A;  1G3S A;  3LW5 E;  2HQX A;  4PJM A;  4YRC A;  3BFM A;  2DNU A;  3I35 A;  2A7Y A;  5IHI A;  1S72 A;  4RQF A;  2CJ9 A;  2LJ3 A;  2X4Y A;  2DER A;  1Q7Y R;  4YRJ A;  4C0D B;  4HVV A;  5GAN 2;  3TQ7 P;  2QQS A;  2OTL Q;  3OYM A;  3G4S T;  2X9H A;  4NL2 A;  4XU2 A;  2RHS B;  4LNS A;  2G4C A;  1KHI A;  4C5H A;  1K9M R;  3M56 A;  4A63 B;  2VVK A;  1Q95 G;  5A2Q E;  5I2S A;  2A08 A;  2JTM A;  2PUO B;  4M7A G;  1VYV A;  5IXF A;  1YHQ T;  3P8B B;  1X2G A;  2DL4 A;  3CCV A;  2AZV A;  1B8A A;  4E7L A;  2R57 A;  1U1T A;  4F7U B;  2SRC A;  5A0L A;  2JOY A;  5KYX B;  3H0I A;  2CKK A;  1M90 R;  1E6H A;  4C92 B;  1SRL A;  4J7I A;  1Q81 U;  3E2U A;  2K9G A;  4XTV A;  4TTV A;  2DET A;  3GNG A;  4TVA B;  1PKT A;  5LJ3 g;  2P0Q A;  1AZE A;  2KEA A;  3TSW A;  3HFZ B;  9ATC B;  5GAM d;  1UEC A;  3V7R A;  1TUC A;  2DIQ A;  1VQ9 A;  2V8I A;  3NET A;  1JXM A;  3JB9 H;  1FWZ A;  3CC7 A;  1X2Q A;  3L4G A;  2K6D A;  4KGZ B;  1YIJ Q;  1X43 A;  3G71 T;  4M4Z A;  5CQX A;  4NS5 A;  1K0S A;  4ZTZ B;  4EMK A;  1YI2 A;  4M7D D;  5KYU A;  4JRI A;  2E5A A;  5J26 A;  4LVJ A;  2V8J A;  3BDU A;  2DXC A;  1WGS A;  4HWO A;  4PJO C;  1Y96 B;  3ERR A;  1ZSZ B;  1RIQ A;  4HVU A;  3Q1J A;  2L5Q A;  3QWY A;  3VU3 C;  3HFV A;  2RM4 A;  2YLB A;  5GMK e;  2PUK B;  3C95 A;  2RA2 A;  3OYI A;  1NJ1 A;  4ELZ C;  4BWA A;  2HAX A;  2EQK A;  4LUD A;  3HY1 A;  3P8H A;  1B70 B;  4JLI A;  4GBQ A;  1MMN A;  3GPL A;  1B7Y A;  3OYD A;  1LPL A;  2DMO A;  2JS2 A;  2ATC B;  3KBG A;  4FYW B;  2DTO A;  1FYF A;  1QCO A;  2RN8 A;  1VQL T;  1H4Q A;  1SF9 A;  4P75 C;  2PVG B;  3P8V A;  2HL5 C;  1Q7Y U;  3TEH A;  2JMC A;  1UFF A;  2YRD A;  3PVQ A;  3NEN A;  1MV0 B;  3P8D A;  2QGG A;  3PMI A;  4AFZ C;  4BI8 B;  1D1C A;  1KD1 C;  1GBR A;  4J7F A;  1NJ6 A;  1WJR A;  2NUT A;  4C92 G;  3P8Y A;  3OMG A;  1PRM C;  4M78 C;  3A8G B;  3HHT B;  1K9M U;  3JB9 G;  3PT9 A;  4FL6 A;  4TVW A;  3CPW P;  3MET A;  2EQU A;  1N8R C;  1AWO A;  1M2V B;  1UGS B;  4A4F A;  3RGL A;  4DOV A;  5AYF A;  1NPR A;  2NUP B;  1QF6 A;  4P74 C;  3FRN A;  1Y57 A;  2P84 A;  4OMP A;  1G3T A;  4RUG A;  3REB B;  5HK0 A;  5GMK m;  4P73 A;  3DLL A;  2DJQ A;  2DLP A;  2QQR A;  2RJF A;  1RLQ C;  2CP7 A;  5D6W A;  3RR6 A;  4UP7 A;  3VQW A;  5E3I A;  4E2F B;  1G8X A;  3CPW A;  3CCJ Q;  1GFD A;  1USY A;  4C5G A;  2QDY B;  2AKK A;  3OYC A;  4WF2 A;  1PD1 A;  4DEY A;  4HWS A;  3MP6 A;  1WZO A;  4BUG A;  3I7F A;  1NJ2 A;  2HD0 A;  2L3S A;  2ENM A;  4J9B A;  2DIG A;  1KD1 R;  1K8A C;  3LSS A;  1N9S A;  2KSS A;  4RTX A;  4PG3 A;  4M75 A;  4O5V A;  2AKW B;  5KYY B;  4N0A C;  3VQY A;  1VQK T;  3VBB A;  4BY6 B;  1N8R R;  3MCA B;  2R58 A;  2E10 A;  2ZZD A;  5I21 A;  4XEO A;  1HXD A;  1QP3 A;  2BIV A;  1VQ5 Q;  4YRK A;  2DVJ A;  4HVW A;  1IGU A;  5GAM f;  3CCR Q;  1EVK A;  5GMK i;  2P4R A;  2DU7 A;  5CAI A;  1S72 T;  5CKF A;  3PFS A;  3AHU A;  2CP6 A;  2DAQ A;  3CMQ A;  1UJY A;  4KT0 E;  1FMK A;  1FX7 A;  3V8K A;  4D8K A;  2EPD A;  1YCS B;  3FJ5 A;  4CC3 A;  2DQ3 A;  4YRP A;  4JPB W;  2Q7G A;  1JQQ A;  2JT4 A;  3ZBD A;  3G4S Q;  1JU5 C;  1DJ7 B;  4LVM A;  1EIY B;  2QA4 A;  2YWW A;  2X4J A;  2RJC A;  3CCV T;  3QWX X;  1K8A R;  2ZR2 A;  4II1 A;  3OW2 A;  1YHQ Q;  4NCX A;  1G5H A;  1X75 C;  1UHC A;  3UT1 A;  4C8Q B;  1WXU A;  2QEX A;  2EGA A;  3OYG A;  1HYO A;  1I0C A;  2ED1 A;  3EAE A;  3EFO B;  2HCK A;  5GAM j;  2EJF A;  5ELN A;  1NLO C;  3CCM A;  1QKX A;  5GAN 3;  4XU3 A;  2HSE B;  3VQV A;  1BIA A;  1D0Y A;  3M54 A;  3UDC A;  1EFW A;  1ZUK A;  1VQ6 A;  2ZTG A;  3EG9 B;  4IUT A;  1VQ9 T;  3IAL A;  4HCZ A;  4M77 E;  1Z7M A;  4OF1 A;  3CC7 T;  2YRV A;  2ROL A;  1ABO A;  1RAH B;  1Q86 C;  4XTU A;  3G71 Q;  1YI2 T;  1M1K C;  5I2M A;  1SKU B;  2CZ6 B;  2EGC A;  5CKD A;  2LC4 A;  1KQ1 A;  4Z88 A;  1OU8 A;  4HVC A;  2OI3 A;  1KD1 U;  2K5I A;  4PFZ A;  1WJS A;  2D8J A;  1OEB A; 
#chains in the Genus database with same CATH homology
 2DTI A;  3KXT A;  4M7D B;  4EO4 A;  1E1O A;  1N8R U;  2XI9 A;  4XAX B;  4H2T A;  2DZC A;  2GF7 A;  5L8R E;  2OAU A;  4RCB A;  2K3Y A;  2ODR C;  3X20 B;  3WVE B;  3GNF B;  5FU6 B;  2RH2 A;  5GAN 4;  4TQF A;  4HA8 A;  1I8F A;  4C8Q G;  1TH7 A;  3SWN B;  2XDD A;  4A53 A;  1YFS A;  1JBM A;  4PJO A;  4YRM A;  3CPF A;  4F7U E;  5C6S A;  2LX9 A;  2OTJ A;  4BI3 A;  1K8A U;  3SFM A;  4ELY C;  3UFG A;  3GOX A;  2PME A;  3INZ A;  5LJ5 e;  3OB9 A;  4XEM A;  3QDR B;  4BB7 A;  1O9S A;  2J3M A;  3HPW A;  1VUB A;  4M7A C;  4EX5 A;  1LJO A;  3VKI A;  3QZ9 B;  4P75 A;  3OSV A;  2RI5 A;  1B34 B;  3EFS A;  4ZTF A;  3WXM B;  3LWI A;  2ZT7 A;  4E7I A;  2VYT A;  4P5N A;  4M78 A;  3OBW A;  4WJ4 A;  2ZPI B;  1G3Y A;  3T9N A;  4A4H A;  4MZT A;  2GFA A;  4WJ3 M;  1RI0 A;  4EMH A;  3V8J A;  2ART A;  3JCM e;  4J83 A;  4P74 A;  1H4S A;  2RK1 A;  3S3N A;  2RHX A;  2AMC B;  4MZM A;  4QW2 A;  4CH6 A;  3VYH B;  4LD6 A;  2Q7H A;  1JJ2 A;  2ZCF B;  2ZPG B;  4EDU A;  4C0D C;  3BDL A;  1KQS A;  1HK9 A;  3VV0 A;  4QVC A;  3CCS A;  2QA4 T;  4BAC A;  2RI2 A;  1Q86 U;  3KUF A;  3OYF A;  2DTH A;  2XIC A;  3M4G A;  4X9C A;  4N0A A;  4R56 A;  2JVV A;  1I5L A;  5CR2 A;  3OYY A;  2P0K A;  5GAM h;  2QEX T;  2RHI A;  3E1S A;  5FRO A;  2EQM A;  2VXE A;  2QXF A;  2D6F A;  1GGM A;  2HBP A;  3J7A F;  2ZPB B;  3CCM T;  3SD4 A;  4RMO A;  5GAO n;  4C92 C;  2M1H A;  1VQ6 T;  3JB9 F;  2EWN A;  5KE2 A;  2LTO A;  2XK0 A;  3CBP A;  4N4I A;  1EQR A;  3NTK A;  1EVL A;  3CBM A;  1HTT A;  2A3L A;  2I2L A;  1VQM A;  4TWA A;  3BY7 A;  4Q15 A;  3TEG A;  2E70 A;  5LJ3 e;  1K73 C;  4M75 F;  4J8O A;  2D0Q B;  2JZ2 A;  4H2X A;  4Q6G A;  2WSC E;  3HRK A;  4YPF A;  3G6E A;  3OS1 A;  2QHV A;  4D6W A;  4OB0 B;  2CZ7 B;  2PVO B;  2EAY A;  3M9Q A;  3PCO B;  3H6Z A;  3ZEH A;  1RL2 A;  5CK9 A;  1LOJ A;  2CZ0 B;  2XKO C;  4GY5 A;  2ZNJ A;  1YIT A;  3RIR A;  5D6Y A;  2CGH A;  3OBY A;  3J80 E;  4M77 B;  12AS A;  2DD4 A;  3LYI A;  4LDX A;  3N5B B;  1BBU A;  1BI0 A;  3A5Z B;  1HC7 A;  2DK3 A;  3JCM X;  3V7S A;  2HQE A;  2ZGW A;  1KG1 A;  2DU5 A;  4CH5 A;  5KNN A;  1KOG A;  1LYL A;  2OTJ T;  1ADY A;  1W2B S;  2QQB A;  1WQ7 A;  4Q5W A;  3L2V A;  3JB9 J;  4IUV A;  1YCY A;  4OB1 B;  1XQH A;  4PJO D;  4E7H A;  1X2H A;  5HK3 A;  1QW1 A;  3ZFJ A;  4UPA A;  3PTA A;  4PKC C;  3VYG A;  2I4L A;  4UC4 A;  5D6X A;  2CZ1 B;  4OVA A;  2NLU A;  2GFU A;  3LLR A;  1H64 1;  5ELO A;  3GIB A;  1WYD A;  1QP2 A;  4IKF A;  1MGQ A;  4YYE A;  2I4O A;  4OB2 B;  4FU6 A;  3L2R A;  4M77 G;  5KCO A;  4C0Z A;  2P0L A;  1QVF S;  4Y91 A;  4P3O A;  2MMP A;  1PYS A;  4M7D E;  2DXT A;  4M78 D;  5F5W A;  3JCM V;  11AS A;  3HRU A;  3L1A A;  4H2U A;  3O8V A;  3OS0 A;  1UGR B;  4PHC A;  2JUF A;  4BY6 C;  1SET A;  4M7A A;  2I4M A;  4C0F A;  1M1F A;  2RD1 A;  2K3X A;  4A54 A;  2DXB A;  4P71 C;  2LT4 A;  4PJO F;  1H4V B;  1VQO A;  4LVK A;  2FB7 A;  3CCS T;  1NYQ A;  2KVQ G;  2RB6 A;  2XGT A;  5GAN 5;  3EFR A;  1K73 U;  1G5V A;  3REU A;  4J6X A;  4C8Q C;  3ME9 A;  3JCM W;  3QO7 A;  3HFN A;  1KC8 U;  1GXI E;  1M9S A;  4F7U G;  2RHZ A;  1M8V A;  2EYQ A;  2ZIN A;  3E9F A;  3L2Z A;  5LL6 S;  4G84 A;  4M78 F;  4KQE A;  2XID A;  2F69 A;  1VQM T;  2RHS A;  5GAN e;  2ARU A;  1L0W A;  1NZ9 A;  2WAC A;  3G6E T;  4P3N A;  3CCL A;  2JTF A;  3CCE A;  1J5W A;  4FT4 A;  1G5I A;  1YFR A;  4F7U A;  2WSF E;  1BIB A;  3M59 A;  4A4E A;  1YIT T;  2RHQ B;  3I56 A;  4C92 A;  4M7D C;  4E7J A;  1YJ9 A;  4CH4 A;  1QVG S;  4TVA A;  1XOV A;  1I81 A;  3HFZ A;  1YFT A;  1JJC B;  2ZPH B;  1WPY A;  5FU6 C;  2AHJ B;  4YRI A;  2E65 A;  4X9D A;  3SDZ A;  3SWN C;  2QHU A;  2EFI A;  2KQW A;  3M4Y A;  1H3Z A;  2DQ0 A;  4HCC A;  2ZR3 A;  3QJY A;  4OMF B;  2CIM A;  3VUB A;  2ZT8 A;  1Y96 A;  2XDP A;  4RG8 A;  3JAM E;  3A31 A;  4TVR A;  2J3L A;  3LWH A;  2E12 A;  4JLG A;  2KAF A;  1G3W A;  2ZNI A;  3CME A;  4FM4 B;  1B70 A;  3MEW A;  4L6V 5;  4JS5 A;  4YRQ A;  3QZ5 B;  3OYN A;  4OGC A;  5C0M A;  1OZ3 A;  3OMC A;  1VQP A;  4XU0 A;  4E47 A;  5GAM g;  3MEY A;  4Z02 A;  5M9O A;  4KR2 A;  4CH3 A;  5K1P A;  2RK2 A;  1D3B B;  1PSF A;  4LDV A;  5GMK j;  2VXF A;  3HRS A;  1VQ8 A;  1VIF A;  4PLL A;  5C53 B;  3NFC A;  4CS3 A;  3LC0 A;  2LNV A;  2DZ9 A;  1Y71 A;  3X24 B;  2G3R A;  3QTC A;  2H3J A;  2FVU A;  2Y90 A;  5GAO p;  3LH0 A;  1EOV A;  3NTH A;  5C51 B;  4ZTJ A;  5EG2 A;  3PMT A;  1LNX A;  3TU4 K;  1VQO T;  1VQ7 A;  2DEQ A;  3CC2 A;  1QVP A;  5DLO A;  2EQJ A;  1BYM A;  5GAN j;  3CCQ A;  3M5A A;  3HXU A;  1UGQ B;  3A8M B;  2AKW A;  5FRM A;  1UEB A;  4H2Y A;  2VGM A;  3J81 E;  5LJ5 d;  3QHS A;  3UH0 A;  4CI0 C;  4RDX A;  3VJP A;  5FU7 B;  3WQZ A;  2ZZG A;  3JCM J;  2ALY B;  3HXY A;  3CD6 A;  2LCL A;  3G7Z A;  3P8T A;  4P71 A;  1AHJ B;  4BD3 A;  3M4Q A;  3HXW A;  4C5I A;  3E9I A;  2DKG A;  2FL7 A;  2BKD N;  3OA6 A;  2DVE A;  2MI6 A;  4GLK A;  2VGN A;  2O4X B;  4XQ3 A;  5KH6 A;  5HKC A;  1VQ4 A;  2CJA A;  2F5T X;  2XD0 A;  3V7C A;  3TRE A;  4JRQ A;  1EIY A;  4YP0 A;  3CCL T;  3QPH A;  2V8K A;  1BI1 A;  3CEY A;  3JCM b;  3CCE T;  1Z7N A;  3OS5 A;  1EIF A;  2FYK A;  4YRN A;  3JCM Q;  3JCM d;  4C8Q A;  1NJI C;  3CMA A;  4M7A F;  3MP8 A;  3I56 T;  3CXC S;  1YJ9 T;  5FRN A;  4M7D G;  4DQ2 A;  4M77 C;  1YJW A;  2M9U A;  3DB3 A;  4M75 E;  3OQ5 A;  4HT8 A;  3OYK A;  3JB9 D;  2IY5 B;  1M1G A;  4FSX A;  4ZN3 A;  4P72 C;  2D9T A;  4YCV A;  4ZGD B;  3ER0 A;  1X56 A;  4KR3 A;  2VV5 A;  4M75 D;  4AH6 A;  3LX7 A;  3FEO A;  4YRT A;  5GMK l;  3S3M A;  4HWP A;  4N4H A;  4B9X A;  4M7D A;  3CME T;  4B9W A;  5GAO m;  3S6W A;  3IG2 A;  2Q7E A;  1X55 A;  1VQN A;  4XTY A;  2C8M A;  4ZTU B;  1ZQ1 A;  4UP9 A;  1M5Q 1;  1VQP T;  1ZBX A;  5IAY A;  1X6O A;  3PIP A;  4OP0 A;  4WI1 A;  5LJ3 d;  3SWN A;  4L59 A;  1SES A;  3M57 A;  3QO3 A;  4MZP A;  3A32 A;  3HRI A;  2DO3 A;  4EMG A;  4F7U F;  3QKJ A;  1I4K 1;  4FT2 A;  1VQ8 T;  2PQW A;  3CC4 A;  4C92 F;  3JCM P;  5LJ5 f;  3OYL A;  4OGE A;  3HTZ A;  4QVD A;  3C4S A;  4PL6 A;  2RHU A;  3QII A;  2DDZ A;  3RKY A;  2QHT A;  1WJQ A;  1SRY A;  3LGF A;  3X28 B;  4MML A;  1B34 A;  1VQ7 T;  4BE0 A;  1N9W A;  5GAO r;  1KC8 C;  3CC2 T;  2L89 A;  1OZ2 A;  1P92 A;  2QQ9 A;  3DB4 A;  1X01 A;  3CCQ T;  2ZPE B;  4PLI A;  1ATI A;  1NPP A;  2X4X A;  2XU8 A;  5LJ5 j;  3JCM f;  3L4G B;  1H4T A;  1PSE A;  3TCJ A;  3FLG A;  1NE8 A;  2RJE A;  4EPC A;  2ZZF A;  2QTX A;  4EMK B;  4UP8 A;  4LVI A;  3E9H A;  3CCU A;  1MHN A;  2RI3 A;  1NJI U;  1N27 A;  3TEE A;  2AMC A;  2Q5I A;  4YRO A;  3CD6 T;  1W66 A;  4PJO E;  2MF2 A;  2QHS A;  4KUD K;  1KHC A;  3A8H B;  3R6O A;  4E7K A;  3L42 A;  3HXX A;  3HL8 A;  3OSS C;  3PGG A;  1WQW A;  1VQ4 T;  4QQ6 A;  1IZ6 A;  1BBW A;  1VQZ A;  2VUB A;  1B7Y B;  1VIE A;  2XG8 D;  3I55 A;  1E24 A;  3TEH B;  3OYJ A;  1NYR A;  2E1H A;  3CMA T;  3A5Y A;  3G1Z A;  1YBY A;  2YLC A;  1N6A A;  2EKO A;  1YGB A;  4QQG A;  4M78 E;  3MEV A;  2C06 A;  4QVZ A;  4YTL A;  4C8Q D;  1YJW T;  4KUI A;  2ZCE A;  5LJ3 f;  2L8D A;  4H2V A;  4C5E A;  2HNI A;  2M0O A;  4LD9 K;  3CPW S;  1WNL A;  3FIF A;  1ASZ A;  5CKH A;  3QO5 A;  5CIU A;  1YJN A;  1FXX A;  1KMN A;  1IRE B;  3DSQ A;  4DA4 A;  4TQD A;  1W4S A;  3MEU A;  3PCO A;  3MO8 A;  2IG0 A;  3CBO A;  4HWR A;  3RKX A;  4BDY A;  1VQN T;  4M77 A;  4M75 B;  1JB0 E;  3HFO A;  5LJ3 j;  2LCC A;  3A5Z A;  3IKL A;  4NOY A;  4O2D A;  3MEA A;  1U1S A;  3MP1 A;  4YCU A;  3RES A;  4VUB A;  4P72 A;  5GAN d;  2ZXF A;  2RJD A;  4YDQ A;  4JDS A;  4C8Q F;  2LDM A;  2DPP B;  3RAC A;  5GAM e;  3CC4 T;  4ZIB A;  5GAN 7;  3C94 A;  1W2B A;  2ZIO A;  4BI4 A;  2I4N A;  3OD1 A;  3QXE B;  3PZC A;  3HP9 A;  3UPU A;  5K1X A;  2LQK A;  3OW2 S;  3BW1 A;  1KMM A;  2PVD B;  5GAO l;  3URG A;  4YCW A;  2CS7 A;  4K86 A;  3M58 A;  2EJ9 A;  1NNH A;  4K88 A;  2KMT A;  4ZN1 A;  4R55 A;  2FHD A;  3REX A;  4IUR A;  3L2W A;  2GCX A;  5LJ5 h;  1SSF A;  4RCC A;  5GAO q;  4JRK A;  2ZT6 A;  4M75 G;  3C12 A;  4PNO A;  1UGP B;  3QSU A;  3OYE A;  4M7D F;  2C7I A;  3MF2 A;  1M90 U;  2OTL A;  4YRG A;  3RKW A;  3IKM B;  2NS6 A;  3VQX A;  1QVF A;  4BDZ A;  3KFU A;  2P4T A;  1M4Z A;  3CCU T;  1OYX A;  2QQA A;  2Q5H A;  4OB3 B;  3ICA A;  1Q82 C;  5FU7 C;  2E3C A;  3A8L B;  2RO0 A;  4A4K A;  1WLE A;  3RUX A;  5CKB A;  3M55 A;  4N4G A;  3E19 A;  2M16 A;  3JCM h;  2K5F A;  5HY6 A;  2CYZ B;  5J39 A;  2RHY A;  4O6J A;  2VC8 A;  4H02 A;  3I55 T;  3DKM A;  3ASK A;  5CCA A;  1YIJ A;  3QYG B;  3QG1 A;  3QJ6 A;  3R07 A;  2PU9 B;  4IUU A;  2E64 A;  2WSE E;  1O75 A;  2R5A A;  1C0A A;  5DLQ E;  4PJO B;  4JJN K;  2KDS A;  4XU1 A;  2ODR D;  1E1T A;  2K4Y A;  4XTW A;  1QE0 A;  1Y7X A;  3UWN A;  3RMS A;  3A7A A;  3RL6 A;  3QO8 A;  4KUL A;  3GP8 A;  2DXU A;  5GAN f;  2P5I A;  5J3B A;  3A7R A;  2MWP A;  1V29 B;  3L2U A;  4V2S A;  2P0P A;  2JN0 A;  1YJN T;  4DOW A;  5HGQ A;  2R5M A;  4M7A E;  2K57 A;  4LDW A;  3FB9 A;  1X54 A;  4LDU A;  3PIO A;  5GAN g;  4M78 B;  4BE1 A;  3QBY A;  2XDB A;  5LJ3 h;  2RHQ A;  1XTD A;  4H2W A;  4M7A D;  2DD5 A;  5IT9 E;  3A74 A;  4LDY A;  5GAN 6;  1JJC A;  4DPG A;  4G85 A;  4X5O A;  4TVY A;  1QVG A;  2KK4 A;  2XTI A;  4XTX A;  2LQ8 A;  5IN1 A;  4M77 D;  3M53 A;  2ZT5 A;  4J6Y A;  4KBM B;  4PJO G;  1JJ2 S;  2IVW A;  4HCB A;  1E22 A;  3LSQ A;  1Y07 A;  3CCJ A;  3RF1 A;  2E6N A;  1BI2 A;  1KQS S;  4HT4 A;  1NJ8 A;  4IUQ A;  3PNW C;  5KCH A;  3OYA A;  2ARS A;  4HWT A;  5CQY A;  3JCM c;  3FJP A;  2E5Q A;  4QQD A;  3HKS A;  4CRI A;  3DLM A;  2BUD A;  2LVM A;  1UB4 A;  2K5L A;  5CKE A;  4CS4 A;  1Q82 U;  3QYH B;  3FDR A;  4YRL A;  4YRR A;  2KY9 A;  3OYH A;  1VQ5 A;  1OI1 A;  4MMK A;  4M78 G;  3W3S A;  2JNG A;  3MF1 A;  4HKE A;  3CCR A;  1N9R A;  1R8O B;  1D3B A;  4A4G A;  4C92 E;  2ZIM A;  2DJZ A;  2K2V A;  3E9G A;  4P3P A;  2OTL T;  4XK8 E;  1NJ5 A;  4IUP A;  4J15 A;  3G4S A;  3UGT A;  4M77 F;  1JRI A;  4ZGE B;  3S3O A;  4EMK C;  4H2X B;  3SB2 A;  4C92 D;  4MDW A;  4JRP A;  1G51 A;  3JSC A;  3BJU A;  1YHQ A;  3NTI A;  2E41 A;  2LRQ A;  3UGQ A;  3HY0 A;  3MHX A;  4ME7 A;  4HT9 A;  1ADJ A;  4J6W A;  4ZGJ B;  1XNI A;  2X35 A;  2L3R A;  4RG2 A;  4X34 A;  1IL2 A;  2QI2 A;  4RQE A;  3GF5 A;  3A8O B;  4E51 A;  5A0G A;  3RER A;  3HXV A;  1YIJ T;  4LVL A;  3QUI A;  3H8Z A;  3G71 A;  1B76 A;  2MWO A;  4ATO A;  2EL9 A;  4CS2 A;  3OS2 A;  4JUV A;  1SER A;  5GMK h;  1BI3 A;  2EIF A;  2YHT A;  3OYB A;  2Y4Y A;  5C52 B;  3V8L A;  2ALY A;  2MAM A;  4YRE A;  1Q81 C;  2ZPF B;  4J5Y A;  2GQV A;  4BW9 A;  3WVD B;  1M1K U;  1WU7 A;  2ZZE A;  3F70 A;  2O4X A;  4Y28 E;  4L87 A;  4P73 C;  4YRS A;  3L2Q A;  2X4W A;  2PMF A;  3OY9 A;  1VQL A;  1USY C;  5FLX E;  3A7U A;  3HRT A;  5A0D A;  2F5K A;  3QNE A;  5CO7 A;  5DY9 A;  5GAN h;  1BKB A;  5LJ5 g;  4L5G A;  4YRF A;  2EJG A;  4FIB A;  1KQ2 A;  4RMF A;  1PYS B;  4RKU E;  3TUP A;  4M75 C;  3CXC A;  1ZHI A;  1U8R A;  5GAN 8;  3X25 B;  5DM7 R;  2A8E A;  2Y4X A;  2IY5 A;  3MQZ A;  4NL3 A;  4M7A B;  3CCJ T;  1Q7Y C;  2LT1 A;  2E6Z A;  2CJB A;  3X26 B;  3VUZ A;  3LGL A;  1K9M C;  4MDX A;  5KE3 A;  5CVI A;  3JCM g;  3NEM A;  3JRZ A;  4XTZ A;  3HXZ A;  3RMQ A;  3HSB A;  3FC3 A;  4OLF A;  2XHC A;  1YB3 A;  1M90 C;  1ASY A;  3JB9 I;  1VQK A;  3GLX A;  4H2S A;  3NEL A;  4K87 A;  4JS4 A;  1VQ5 T;  4C0G A;  4C8Q E;  3M4P A;  4BE2 A;  3CCR T;  2O01 E;  3LW5 E;  2B8A A;  1G3S A;  2HQX A;  4YRC A;  3BFM A;  4RQF A;  2A7Y A;  1S72 A;  2CJ9 A;  2X4Y A;  4YRJ A;  4C0D B;  5GAN 2;  2QQS A;  3OYM A;  3G4S T;  4XU2 A;  4NL2 A;  2RHS B;  4LNS A;  2G4C A;  1KHI A;  4C5H A;  3M56 A;  5A2Q E;  5I2S A;  2JTM A;  2PUO B;  4M7A G;  1YHQ T;  3P8B B;  1X2G A;  3CCV A;  1B8A A;  4E7L A;  2R57 A;  1U1T A;  4F7U B;  5A0L A;  2JOY A;  2CKK A;  4C92 B;  4J7I A;  1Q81 U;  4XTV A;  4TTV A;  3GNG A;  4TVA B;  5LJ3 g;  2P0Q A;  3HFZ B;  5GAM d;  3V7R A;  1VQ9 A;  2DIQ A;  2V8I A;  3NET A;  3JB9 H;  1FWZ A;  3CC7 A;  3L4G A;  3G71 T;  5CQX A;  4NS5 A;  4ZTZ B;  4EMK A;  1YI2 A;  4M7D D;  4JRI A;  2E5A A;  5J26 A;  4LVJ A;  2V8J A;  3BDU A;  2DXC A;  1WGS A;  4HWO A;  4PJO C;  1Y96 B;  3ERR A;  1RIQ A;  3Q1J A;  2L5Q A;  3VU3 C;  3HFV A;  2RM4 A;  2YLB A;  5GMK e;  2PUK B;  3C95 A;  2RA2 A;  3OYI A;  1NJ1 A;  4ELZ C;  4BWA A;  2HAX A;  2EQK A;  3HY1 A;  3P8H A;  1B70 B;  4JLI A;  3GPL A;  1B7Y A;  3OYD A;  3KBG A;  2DTO A;  1FYF A;  1VQL T;  1H4Q A;  4P75 C;  2PVG B;  3P8V A;  1Q7Y U;  3TEH A;  3NEN A;  3P8D A;  3PMI A;  4BI8 B;  1KD1 C;  4J7F A;  1NJ6 A;  1WJR A;  4C92 G;  3P8Y A;  3OMG A;  4M78 C;  3A8G B;  3HHT B;  1K9M U;  3JB9 G;  3PT9 A;  4FL6 A;  4TVW A;  3MET A;  2EQU A;  1N8R C;  1UGS B;  4A4F A;  3RGL A;  4DOV A;  5AYF A;  1NPR A;  1QF6 A;  4P74 C;  3FRN A;  1G3T A;  5HK0 A;  5GMK m;  4P73 A;  3DLL A;  2QQR A;  2RJF A;  5D6W A;  4UP7 A;  3VQW A;  5E3I A;  3CPW A;  1USY A;  4C5G A;  2QDY B;  3OYC A;  4WF2 A;  4HWS A;  3MP6 A;  4BUG A;  3I7F A;  1NJ2 A;  2HD0 A;  2DIG A;  1K8A C;  3LSS A;  1N9S A;  2KSS A;  4PG3 A;  4M75 A;  4O5V A;  2AKW B;  4N0A C;  3VQY A;  1VQK T;  3VBB A;  4BY6 B;  3MCA B;  2R58 A;  2E10 A;  2ZZD A;  5I21 A;  4XEO A;  1HXD A;  1QP3 A;  2BIV A;  4YRK A;  5GAM f;  1EVK A;  5GMK i;  2DU7 A;  5CAI A;  1S72 T;  5CKF A;  3PFS A;  3AHU A;  2DAQ A;  3CMQ A;  4KT0 E;  1FX7 A;  3V8K A;  2DQ3 A;  4YRP A;  2Q7G A;  3ZBD A;  1DJ7 B;  4LVM A;  1EIY B;  2QA4 A;  2X4J A;  2RJC A;  3CCV T;  2ZR2 A;  4II1 A;  3OW2 A;  4NCX A;  1G5H A;  1X75 C;  3UT1 A;  4C8Q B;  2QEX A;  3OYG A;  3EAE A;  5GAM j;  2EJF A;  5ELN A;  3CCM A;  5GAN 3;  4XU3 A;  3VQV A;  1BIA A;  3M54 A;  3UDC A;  1EFW A;  1VQ6 A;  2ZTG A;  4IUT A;  1VQ9 T;  3IAL A;  4HCZ A;  4M77 E;  1Z7M A;  4OF1 A;  3CC7 T;  2YRV A;  1Q86 C;  4XTU A;  1YI2 T;  1M1K C;  5I2M A;  2CZ6 B;  5CKD A;  2LC4 A;  1KQ1 A;  4HVC A;  1KD1 U;  2K5I A;  1WJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...