1X01A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with atp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2005-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1x01A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1x01A01
3SWNC 2E65A 4M7AE 2P5IA 4A53A 4X9CA 2ZZGA 5K1XA 3NETA 1WLEA 2VC8A 5LJ3g 5LJ3j 5F5WA 4M75A 1U1SA 2YLCA 4C92G 3G1ZA 4L87A 1USYC 4XU0A 4XTWA 3V8KA 4YCWA 5GAN5 3REUA 4YRPA 4RDXA 4JRKA 3JB9D 1PYSA 1WU7A 2FB7A 1HXDA 4C8QE 4P71C 1B8AA 3LC0A 5LJ5d 4XU3A 1NJ1A 3AHUA 1SESA 3RKWA 2HNIA 1H4SA 4P3OA 4PJOA 4JLIA 2CJBA 3LSQA 1ADJA 3HRKA 1YFSA 4YRGA 4XU2A 4M78A 2ZTGA 4P73A 3VQWA 2XTIA 1B7YA 1VQZA 4M7AA 3HSBA 2RHQB 3UGQA 4NCXA 2VXFA 1KQ2A 4P72A 4C92D 4M7DA 1E1TA 2ZT8A 4G85A 4YCVA 2EL9A 3PZCA 3IALA 1WQ7A 3VQXA 4BWAA 3QSUA 4KR2A 3M4QA 4PJOD 1N9SA 2ARTA 4P72C 2P0LA 4CH4A 4PJOC 4M7AC 3TEHA 4P74A 4M78C 4YRCA 4C92C 5I21A 2DEQA 4RCBA 3JCMV 2ZT7A 2EWNA 4M75F 4P3PA 3RF1A 4CH3A 1YFTA 3HRIA 1H641 3HFZB 4RMFA 2Y90A 4YRMA 4M75G 2QHTA 4HT8A 2CJAA 4UP9A 2DXUA 2ZR3A 4H2WA 5GMKe 5GANe 1D3BA 2ZIMA 2QHVA 4M75E 4P71A 4HWSA 4M7DE 2DXTA 2ALYA 1EVKA 4YRQA 3W3SA 4YRIA 1L0WA 4EMHA 3JCMd 4OP0A 1JBMA 1KQ1A 1WPYA 3A5ZA 5GMKl 3L4GA 4M75C 4F7UF 5K1PA 2ALYB 4Q6GA 1NJ8A 2DU5A 3BY7A 1YGBA 5GAN2 4CS3A 3JB9F 2I4LA 1MGQA 2AMCA 3TUPA 1N9WA 4P75A 3NENA 3VQYA 2DKGA 3VQVA 3EFRA 4C8QC 1KMNA 3QNEA 1HK9A 2DU7A 5E3IA 2ZZEA 1I5LA 2DJZA 3QO8A 1I8FA 1X54A 4HWPA 4BW9A 3PCOB 4C92B 1TH7A 5GAOl 1IL2A 3BW1A 1ASZA 4YROA 1QE0A 1YB3A 4YRJA 3REXA 4YPFA 4TVYA 2Q7GA 3PGGA 1B7YB 3ERRA 2I2LA 1RIQA 3P8TA 4C8QF 3HXVA 3WQZA 3RERA 1NYQA 1I4K1 5LJ5e 4XTVA 1Y96B 3HXXA 2Q5HA 5GAN3 3JB9J 4YRLA 3HFOA 2XGTA 4J5YA 1M8VA 4XTUA 1E24A 2E5AA 2Q7HA 2RA2A 4XU1A 4HWRA 1H4QA 2DZCA 1ATIA 2G4CA 1ASYA 2EAYA 1G51A 2QTXA 2ARSA 4M7DF 3JCMf 5LJ3e 3R07A 4YREA 2ARUA 4TVWA 3RACA 3RESA 2CIMA 3QHSA 4YCUA 2Q7EA 3TEHB 2ZNJA 4N0AC 1C0AA 1USYA 5GAMd 3HFNA 4RCCA 2ZXFA 3JCMX 4UPAA 1H4TA 2ZZFA 4F7UG 4JRIA 4C92A 4M7DD 5LJ5h 4P75C 4WF2A 4EMKB 3HTZA 2YHTA 2RHQA 4H2TA 5GANd 2E10A 3NELA 4YRNA 4HWTA 4M77A 3E9HA 4M7DB 4PNOA 3JCMW 4H2SA 1LJOA 3IKLA 5GAMf 3RGLA 3QO3A 3BDUA 1D3BB 3JB9H 1E22A 4YDQA 2DZ9A 3CMQA 1YFRA 1LOJA 4QVDA 5GAOp 1G5HA 4EO4A 1BIAA 1EIYA 3DSQA 5LJ3d 4C8QD 1EVLA 4K87A 1Y96A 3P8YA 4M7AG 4ZIBA 4J6YA 3M4PA 4UP8A 4TTVA 2E1HA 4YRRA 3SB2A 2CJ9A 4CS4A 3RIRA 3RUXA 1HTTA 3QUIA 3A7RA 4C8QG 1NYRA 1Z7NA 4MMKA 1GGMA 1BBUA 1NJ2A 3JB9G 1QF6A 2AKWB 2ZT6A 4LNSA 3JB9I 4K86A 4PHCA 3HXWA 4XEOA 1EOVA 5CAIA 4YRTA 4PJOB 3KFUA 4ZTZB 1B76A 4RQEA 5LJ5j 3L2ZA 2ZR2A 5GAN6 3HFZA 4H2UA 3M4GA 1U1TA 3BJUA 4YRKA 2EJ9A 4A54A 4J6WA 4HA8A 3FJPA 2FYKA 1WNLA 4HT9A 2E41A 4F7UA 5GMKh 3LSSA 5C52B 4F7UE 4P73C 1BIBA 3V8LA 5LJ3f 4OLFA 3GIBA 4P3NA 4EMKC 4J6XA 12ASA 2RHSA 4XTXA 1N9RA 3A74A 4C92E 2ZIOA 3UFGA 3RKXA 11ASA 2E3CA 2ZINA 3I7FA 2PMFA 1I81A 3JCMJ 1EFWA 4KQEA 3A7UA 2IY5B 1SRYA 4C8QB 1J5WA 1W66A 3V8JA 2EJGA 4M7DG 4H2XB 4K88A 3VU3C 5GMKj 5GAMh 1PYSB 5GAMj 2J3LA 4XEMA 2DTIA 5GAMg 1LNXA 4PJOF 1NNHA 4H2XA 3V7CA 2DQ3A 4KR3A 2CGHA 3SWNA 4M7AF 2C8MA 1WYDA 5GAMe 3L4GB 1B34B 3RL6A 5LJ5f 4M78F 1SERA 2DTHA 2QHUA 5GAN8 4NOYA 4CH5A 4C92F 4M78B 3FIFA 3JCMg 4M78G 5HGQA 2AMCB 1B34A 5GAOq 4M7AB 3V7RA 4TVAB 1G5IA 4UP7A 4CS2A 1E1OA 3SWNB 2DTOA 2E64A 5GAOm 2VXEA 3HFVA 4NL2A 3BFMA 5GAN4 2ODRC 3IG2A 4G84A 2DQ0A 3TEGA 4M78D 4M77E 1WQWA 4E51A 2ZNIA 4M7AD 3L1AA 2DDZA 4AH6A 2JN0A 2QHSA 4HVCA 5C51B 2RB6A 2IY5A 3HY0A 4WJ4A 4ZTUB 3E9IA 1BBWA 1NJ6A 2RM4A 3ICAA 1X01A 2RD1A 5GANh 1KMMA 3OD1A 1LYLA 3JCMQ 4H2VA 1ADYA 2ZGWA 4HWOA 5GANg 1B70B 4YRSA 4YYEA 1M5Q1 4M77G 5GANf 4V2SA 1H4VB 4TQDA 4N0AA 5C53B 4TWAA 1FYFA 2I4OA 1B70A 3QO5A 4YP0A 1SETA 2ODRD 4H02A 4TVAA 2ZCEA 1KOGA 3FB9A 5LJ3h 3HY1A 4Q15A 2I4NA 1JJCB 4M75D 5GAN7 4J15A 3A5YA 3VBBA 5GMKi 3MF2A 3P8VA 5ELOA 4DQ2A 2C7IA 2RHSB 4YRFA 1EQRA 3JCMh 4F7UB 4O2DA 4XTZA 2DVEA 2YLBA 4M75B 1X2HA 2EJFA 2ZT5A 1X55A 3JCMc 4XTYA 5ELNA 2PMEA 3PCOA 3HXUA 1X56A 3A7AA 1EIYB 4JUVA 4WJ3M 2I4MA 4PJOG 4TQFA 3MF1A 3NEMA 4M77D 3INZA 4M78E 5DY9A 1JRIA 4EMGA 1NJ5A 5GAOr 3QO7A 4PJOE 4M77F 1X2GA 1HC7A 3IKMB 3JCMe 4M77B 1YCYA 3MEYA 4DPGA 4P74C 2K57A 4NL3A 4WI1A 4EX5A 4XQ3A 5GAOn 4H2YA 3A32A 3HXYA 2AKWA 4C8QA 4X5OA 4Y91A 2Q5IA 3EFSA 4M7DC 5LJ5g 2J3MA 4CH6A 5KNNA 4QVCA 4PG3A 3UGTA 4X9DA 3V7SA 3QTCA 3UH0A 5GANj 3HXZA 3A31A 4EMKA 3RKYA 1Z7MA 5GMKm 3JCMb 4MMLA 4RQFA 3JCMP 1JJCA 4M77C
chains in the Genus database with same CATH superfamily
1M2VA 3SWNC 4FCYA 1ZLMA 1VA7A 5IHIA 2ZZGA 1U5SA 3CC4T 1IGUA 2G3RA 3PFSA 1WLEA 2RMOA 1IO6A 1G3YA 4M75A 1U1SA 4PJJA 2J7IA 2YLCA 3G1ZA 4YCWA 5GAN5 2QQAA 3CCSA 3KBGA 3TQ7P 4YRPA 2KAFA 2F5TX 2CS7A 4DEYA 2FPDA 4Y28E 1HXDA 4OMPA 4P71C 4OB1B 2X3XD 1B8AA 4XU3A 4FT4A 3AHUA 1SESA 3RKWA 1QVGP 4A4GA 2O01E 4OMLA 2OTLA 2KMTA 3LSQA 4J9EA 3CBOA 1M3CA 1OPKA 1ARKA 1QW1A 2QQBA 2RJCA 3A5ZB 3I56A 1A0NB 4NCXA 2OJ2A 5KYNA 4J9CA 4BE1A 4M7DA 3CCMT 1VQMA 1WQ7A 4LE9A 2LVMA 2YUNA 1RI9A 1ACMB 3EHQA 1BI0A 1WGSA 1X69A 2ARTA 3EFOA 1NJIU 5C6SA 4CH4A 4PJOC 1NJIR 3NHNA 1NPRA 4C5HA 1X27A 4YRCA 5IH2A 1S72A 1YFTA 3NFCA 1WIEA 1YHQQ 4YRMA 4C0FA 4FSXA 3G7ZA 2CP6A 2HD0A 1O75A 2LJ0A 1AZEA 3CCRT 5GANe 2ZIMA 2QHVA 2KRNA 4M75E 2LP5A 3UA7A 4P71A 4M7DE 3OYFA 4YRQA 1L0WA 3TREA 2JVVA 4AT1B 1N5ZA 2P0QA 2PNIA 1QLYA 1GL5A 1BCOA 2MWPA 2DA9A 1G3TA 4M75C 3UDCA 1G8XA 4Q6GA 3X28B 3JB9F 4E7HA 4VUBA 1K0SA 1T0JA 1N9WA 1X75C 3S6WA 2DKGA 2Z0WA 3EFRA 4C0GA 1UUEA 5E3IA 2ZZEA 1LCKA 2V8IA 3LGLA 1TWBA 2JM8A 3PCOB 3C12A 4B9WA 3CPWS 1KQSA 2QEXA 1N8RR 3ZL7C 2DM1A 2GCXA 2HZYA 1X6GA 1WHHA 1ASZA 3PIOA 4YROA 1AVZC 3PNWC 1HSQA 2MYSA 2RNAA 3CCEQ 3S3NA 1B3QA 2Q7GA 3PGGA 3M56A 3ERRA 2K5LA 1SRLA 3EG2A 4C8QF 3P8TA 3CD6Q 1W4SA 1W1FA 1NBEB 3RERA 1JJ2P 4LD9K 4C0DC 4HVUA 4Z88A 1I4K1 1C6VX 2QYZA 2YWWA 2ZAEA 3EGDA 3HFOA 4YRLA 4BI4A 2XGTA 2CZ1B 3OSVA 5J26A 1VQ5Q 4XTUA 1OULA 1W6XA 2BUDA 2RF0A 2CZ6B 2DZCA 2BZ8A 3D7SB 2RHIA 2EAYA 4TVRA 4ME7A 3QPHA 2LNHB 3R07A 2ZZDA 4JDSA 1R77A 2J05A 4E2FB 2RI3A 2L3RA 3RESA 1WFWA 1WHGA 3CMAT 2DL4A 5KYXA 1C0AA 1X6BA 3HFNA 3CC4Q 1M1KC 3OYAA 3QDRB 3JCMX 2LQ8A 3QXEB 2SRCA 1MMDA 2F2XA 3A8MB 4LDXA 2M16A 2RI2A 1OI1A 2YHTA 5GANd 2BTTA 2E10A 3NELA 2MPXC 1AHJB 4HWTA 4M77A 4C5IA 1LVKA 1EIFA 3JCMW 3VS3A 5D6WA 5GAMf 1VQMT 2A8EA 3RGLA 2QQRA 2EPDA 1UG1A 4BACA 4KUDK 5CKFA 2NUPA 3HPWA 4LUEA 4N4HA 2WACA 2BIVA 2VB6A 1LOJA 1TUGB 4EO4A 3R6NA 1EIYA 5LJ3d 3WVEB 4C8QD 1YIJQ 1Y96A 1IREB 1MMAA 4J6YA 1VIEA 4TTVA 3QWYA 3LW5E 4JJBA 3RIRA 1Y57A 3QUIA 2DFUA 2EQIA 4BD3A 3JRZA 3JB9G 3EFOB 1QF6A 4LDVA 2E3IA 2EYQA 2KRMA 1EOVA 5CAIA 2EFIA 3M4YA 1CKAA 3I9QA 4RQEA 1Q82C 5LJ5j 1YI2T 4IUQA 1S72Q 3ZBDA 4ANJA 2ZR2A 1M1FA 3HTRA 2NUTA 5GAN6 2KY9A 3M4GA 2YRCA 1W2BA 3BJUA 4YRKA 3HHTB 4LVMA 4J6WA 3FJPA 2EKOA 4LVLA 2FYKA 1NZ9A 4MZTA 5ECAA 3OYMA 4HT9A 2E41A 2HMAA 4KULA 1K9MC 5C52B 1V29B 2R5MA 1E6HA 4F7UE 4P73C 3V8LA 4J7FA 3SEMA 2DETA 1U3OA 3HL8A 3MCAB 4EMKC 4J6XA 1QQJA 3CPWP 2KXCA 2FG0A 1W70A 3M58A 12ASA 3A8GB 1QCOA 2XDPA 4PKCC 2ZIOA 4Q5WA 1VQ7A 3RKXA 1UB4A 3EGUA 2E3CA 3UFGA 3CXCA 3META 4ZGEB 3A7UA 1SRYA 2VUBA 1W66A 2E5KA 3O8VA 4H2XB 3X24B 4RG8A 5GMKj 3EGXA 5GAMj 5GAMg 5D6YA 3O5ZA 2C8MA 3RL6A 1B34B 5LJ5f 4M78F 4QW2A 1G83A 4L6V5 5KE3A 3QJYA 3JCMg 4N4GA 1VQNQ 4AG1C 1MNDA 9ATCB 3SWNB 2VXEA 2K5IA 1E6GA 3NTHA 2OTJA 4JZ4A 2DQ0A 4E51A 4XAXB 4M7AD 2JN0A 5C51B 3CCMQ 4KH0B 3CCRA 2KROA 2DLPA 3HY0A 4AG2C 1JEGA 2CDTA 3E9IA 2XDBA 2HQXA 1Q82U 2RM4A 2AT1B 5GANh 4OB2B 1I5OB 3OYLA 4HWOA 2X4JA 5GANg 2X3WD 4YYEA 2KI7A 2LX7A 1NJIC 1H3HA 5GANf 4TQDA 4E7LA 4N0AA 5C53B 1D1BA 4TWAA 4PJNA 5CKEA 2XG8D 3VRZA 3TCJA 5LJ3h 1OV3A 2I4NA 4LN2A 1JJCB 3CC2Q 5GAN7 1YJWT 3VBBA 4BY6C 5FWCA 2QA4T 1XQHA 4FL6A 4JJNK 1SSFA 3LWIA 3PMTA 1YJNT 4BI8B 1TU0B 1AWJA 2K3XA 3CCLT 3CCUQ 4O2DA 2LJ3A 3CQTA 2EJFA 4XTYA 5ELNA 3UATA 2OTLT 3PCOA 2IPOB 1YBYA 2PTKA 1NEGA 3INZA 4RKUE 2KYMA 1UTIA 1S1NA 1X2GA 2X51A 2HSEB 3JCMe 2DL7A 4AMCA 3RNJA 2AK5A 3J80E 4NL3A 4AFSC 1RUWA 4Y91A 2OX7A 3EFSA 1MMNA 2DXBA 2RJFA 1JB0E 3FC3A 4F04B 2J3MA 2RHUA 2IVWA 4X9DA 3V7SA 4E47A 3ZFJA 1AOJA 3RKYA 3OBYA 5GMKm 4RQFA 2K9GA 2QXFA 3SHWA 4M77C 3BE3A 5L8RE 1YJ9A 1TTHB 2O31A 1RAEB 4PL6A 2P5IA 4JLGA 2HCKA 1QKWA 2QI2A 4X9CA 1PRLC 2VC8A 5IHNA 1QVFA 3VS5A 4IUTA 1KFZA 3V8KA 5A0GA 1VQ4Q 2BE9B 4JRKA 1NLPC 1YJNA 1WI7A 5KYYA 2CSIA 1M90U 1NJ1A 3HRUA 2DPPB 2FPFA 3A8OB 3OB9A 1RLQC 4R0KA 1OX9A 1ADJA 1YFSA 4Z8AA 1UE9A 3CCUA 4XU2A 4M78A 4JS4A 3VQWA 1VQZA 1WHJA 1Q95G 2RHQB 2VXFA 4QQDA 2DL5A 1M27C 3CCEA 3GPLA 2ZT8A 4JRPA 3PZCA 3OYYA 3M9QA 1VQ9Q 3CD6A 5J3BA 3SDZA 4PJOD 1VQNA 3E9GA 4JS5A 4OB0B 4P72C 1KD1U 1SHGA 2XIDA 1GRIA 2ZPFB 4HVVA 2K2MA 5CIUA 4M7AC 3TEHA 1WA7A 3G4SA 5I21A 1ZSZB 2DEQA 2EWNA 5KYWA 4P3PA 4GLMA 2YRVA 3HRIA 1D0YA 4IIOA 4M75G 2CJAA 1WXUA 3MEVA 3CPWA 1D3BA 2LQWA 2HQHA 3VUBA 3OY9A 2LT1A 1OYXA 3M5AA 2MCNA 3CC4A 2FZCB 4PLIA 1N8RC 3W3SA 4PLLA 4EMHA 1GXIE 1WPYA 5GMKl 2P4RA 1JXMA 4PJLA 2DU5A 1YGBA 1BKBA 2AMCA 1HYOA 5HK3A 4A63B 4R55A 3VQYA 2BZXA 3VQVA 2O4XB 1WLPB 1BI1A 2DU7A 1I5LA 1KQSP 3CCVT 5M9OA 1K9MR 4AFUC 2JS0A 1WZOA 4BDZA 1AT1B 2HL3A 4C92B 2K6DA 1NG2A 1TH7A 5GAOl 4PFZA 4A4HA 3E19A 1WXBA 1MV3A 1QE0A 2L3SA 2XMFA 3REXA 4ZGDB 1OZ2A 1C1AA 1Q7YC 1VQ8A 2A3LA 2EQMA 2GFAA 3HXVA 1X43A 2EQJA 1M2OA 2YUQA 4XTVA 3H6ZA 3CCJT 2CP2A 3CCMA 3JB9J 3NTIA 2QEXT 1K73R 4RG2A 2BKDN 2XI9A 3ZEHA 3UWNA 1M8VA 1E24A 2E5AA 2Q7HA 4HWRA 2RA2A 4XU1A 1KD1R 1K73C 1BK2A 3OYIA 1VQKT 4IUVA 3C0CA 1G2BA 1ASYA 1OEBA 2JW4A 1QVFS 1M30A 1SRMA 4IKFA 2QTXA 2GNCA 2A7YA 2MAMA 2RHYA 2D1XA 1YJ9Q 3C95A 2JMAA 3VJPA 3JCMf 2DMOA 5LJ3e 2W10A 1VQPA 1Q7YR 4YREA 1NE8A 4TVWA 3EAEA 2EYXA 3CC7A 4O5VA 2CIMA 2FHDA 2JNGA 3TEHB 1KJWA 4QVZA 1T3SA 2PVDB 1IHWA 4RTYA 3M54A 1H4TA 4R56A 2ZZFA 3G6EQ 4M7DD 1Z9QA 2RK1A 2JTEA 4Z02A 3CCLQ 3CCUT 8ATCB 5FW9A 1YWPA 5KCHA 3H0IA 1PHTA 4H2TA 4DOWA 3OS0A 2D9TA 3E9HA 2X4XA 3OW2A 4H2SA 1Y0MA 2ENMA 2DD4A 3JB9H 1E22A 2K3YA 2Y4YA 3CMQA 1M3BA 1YFRA 4QVDA 1G5HA 1W2BS 3DSQA 1EVLA 4K87A 3P8YA 4BY6B 3CCSQ 5FRMA 4WTOB 2LQNA 4ZIBA 4OMNA 2JTFA 2LMJA 4MDWA 2E1HA 3RUXA 4CC4B 1HTTA 1GGMA 3N5BB 2D8JA 2KK4A 2RQUA 2E3HA 2ZT6A 2RN8A 4PHCA 1UGSB 3SFMA 4PJOB 3CCST 5KYXB 2COYA 3A98A 3MP1A 4KH1B 5HK0A 1VUBA 3KUFA 3GF5A 1U1TA 4CC3A 1M90C 1WNLA 1MHNA 2DX1A 5I2MA 3X25B 5GMKh 1YITQ 2G6FX 2NUZA 5L23A 4RTWA 5HY6A 5LJ3f 1X2QA 2MMPA 2AIRB 3GIBA 3FRNA 4P3NA 3JSCA 1OU8A 4ESRA 3EG0A 1Q7YU 1RAFB 4C5EA 1ZQ1A 4KGVB 1Q86U 1XNIA 3QYHB 4QQ6A 3CXCP 3A74A 4C92E 2VWFA 2P0KA 11ASA 2ZPEB 4F14A 3QKJA 1XTDA 4FSSA 2DBKA 1EFWA 4KQEA 1YI2Q 1M90R 1ABOA 4E7IA 4C8QB 1GCQC 2O2OA 4GY5A 3CMEA 1D09B 3JV3A 2J3LA 4H2XA 2KXDA 3V7CA 2DQ3A 4KR3A 2CGHA 4LVKA 3C94A 1WYDA 2DXCA 1RAIB 3DLLA 2EGCA 1PKSA 2QHUA 5GAN8 2L5QA 2MOXA 4M78B 5FRNA 2AMCB 1B34A 2KRSA 2V1RA 4UP7A 1E1OA 2E64A 5GAOm 1EX4A 3BFMA 1KSWA 1S72T 5KYUB 4AFQC 2NLUA 3TEGA 1WQWA 1UFFA 2ZPHB 4AH6A 4J9BA 2QHSA 2QQSA 3EHRA 4ZTUB 2OTJT 1FX7A 4D8KA 4FYWB 3URGA 2P4TA 3EH2A 1LPLA 3L42A 2C0IA 2KDSA 1ZBJA 1ADYA 4J9FA 3OMGA 1K8AR 1M5Q1 4V2SA 1K8AU 1H4VB 2GQVA 3PT9A 1YFNA 3EG9A 1K8AC 3QO5A 1AWXA 3G71A 2ZCEA 1M2VB 1O9SA 3H41A 3OW2P 2PVGB 1ZUUA 2EW3A 2M51A 4DOVA 4B9XA 2DNUA 3CBPA 3L2QA 3KXTA 3A5YA 3CBMA 1JU5C 3MF2A 3OYCA 5KYUA 2QQ9A 4ZTJA 3HRSA 2QDLA 2V8JA 2MWOA 1X2KA 2FZGB 2FVUA 2RHSB 3ASKA 3I56T 2JM9A 5J39A 2DVEA 1D0XA 2YLBA 2ZT5A 1RADB 2K3BA 1X55A 2DVJA 4HCKA 1ZA1B 3HXUA 3A7AA 1EIYB 4JUVA 2DAQA 4LXCA 3LX7A 1N8RU 1UJYA 3OQ5A 2LC4A 3MP8A 3MF1A 3CD6T 2DRMA 4OGEA 1JRIA 2ED0A 1AWOA 2QGGA 2P84A 2RH2A 3E9FA 2CUDA 3QO7A 4PJOE 4LVJA 1IRXA 5A0DA 2EIFA 3DB4A 4M77B 1TG0A 1QP3A 5DLOA 1TOVA 2VVKA 4EX5A 4CRIA 1VQ5T 1KC8C 4M7DC 3MEWA 4QVCA 2XK0A 3I35A 3UH0A 1K4US 4OMMA 3CCQA 4EMKA 3MHXA 3L2VA 2ED1A 2FRWA 2LTOA 2XHCA 3A8HB 3M0QA 4M7AE 1SF9A 2E12A 3CC7Q 5HKCA 1FMKA 1FMVA 3MJXA 3UA6A 2LDMA 2EGEA 2EKHA 1QP2A 1KK7A 5IAYA 3NETA 4LVIA 5LJ3g 1PRMC 5F5WA 1QWFA 4C0ZA 4E7KA 3UF4A 2ATCB 1OX8A 1USYC 4XU0A 5HCKA 1D1AA 2OTJQ 4RDXA 4P5NA 4HKEA 1PYSA 5KCOA 2FB7A 2KBTA 3MEUA 4C8QE 1P92A 4FIBA 3LC0A 5LJ5d 3FEOA 2R57A 4J8OA 4RTZA 1YHQT 1YJNQ 2A37A 4P3OA 2ZCFB 4WCIA 2CJBA 3DB3A 1VQ8T 2HQEA 3HRKA 1AEYA 2NUPB 3VS0A 4YRGA 1M8MA 4P73A 1E7OA 4PFPA 2XTIA 1Y07A 3HSBA 4M7AA 1GCPA 3M0RA 3UGQA 2RQTA 4LDWA 2FO0A 4P72A 2XU8A 3I5SA 3QZ9B 4C92D 4G85A 1PM3A 1UGVA 2E5QA 3OS5A 5IHKA 2COZA 3QSUA 5C0MA 4HVWA 1TUDA 4OMFB 3OA6A 2DO3A 2P0LA 2W0ZA 4DBRA 1WJSA 1OQKA 5KYWB 1X6OA 4P74A 4A4FA 4M78C 4ELZC 3A1PA 3P8HA 1GCQA 3JCMV 2ZT7A 2GGRA 2QA4A 1H641 3HFZB 2OTLQ 4RMFA 1UGRB 4JRQA 1KHCA 2GQIA 1ZUKA 2B86A 4UP9A 4J9HA 2X4YA 1IZ6A 1T0HA 1EVKA 3EGXB 3GOXA 1B07A 1UECA 2Y4XA 2RO0A 1RAHB 3JCMd 1TXQA 5CKHA 4QQGA 3G71Q 2DF6A 1VIFA 2A28A 3X20B 3L4GA 2K7AA 1R0CB 2F2VA 3G6ET 5GJVB 5GAN2 4CS3A 2I4LA 1Q86R 2CH4A 4MZMA 2EYWA 4OVAA 2XDDA 5FU7C 3NENA 3E1SA 1Z9ZA 3OBWA 4A4KA 3QNEA 4ZN1A 4BDYA 1PSFA 1MV0B 4HWPA 4BW9A 1YJ9T 1PKTA 2A36A 3TU4K 1BU1A 3BW1A 4J9DA 8AT1B 4AFZC 2ROLA 2CREA 1OOTA 1ZSZA 1YB3A 4YRJA 2QDYB 1EZZB 2VV5A 4EDUA 3RBBB 1OU9A 1B7YB 3NTKA 5CKDA 3WQZA 4HCZA 2RJEA 5IXFA 1B7TA 2A0FB 1M1GA 4GLKA 4IURA 1M3AA 2NWMA 1Y96B 2D6FA 3HXXA 2O9SA 1KD1C 4HXJA 4J83A 4RUGA 1CSKA 3ULRB 2PZ1A 1VQPT 2L3PA 3S3MA 4KBMB 3OYHA 3H9NA 1G51A 1Q82R 1QKXA 3UPUA 3VKIA 2DJQA 2ARUA 3RACA 2CUBA 1JXOA 3VV0A 4YCUA 1AWWA 3ME9A 2Q7EA 2ZNJA 2RHZA 4N0AC 2DIQA 5GAMd 1UDLA 4RCCA 2ZXFA 4UPAA 4F16A 1QVGA 5LJ5h 2CP3A 2DYBA 2D8HA 2F69A 1VQOT 1VQ6T 3HTZA 3FJ5A 2DK3A 2NS6A 2RHQA 1MMGA 3RDVA 1FYNA 2CP5A 3MPUB 1KQSS 2CYZB 1LJOA 4L59A 4DA4A 2CP7A 3IKLA 3KFVA 1D3BB 3OYDA 3CCJA 3GP8A 3CMAA 4X34A 1WHLA 3Q1JA 4ZNXA 4KGZB 1BIAA 2L3QA 5FU6B 3M0SA 1K9MU 1WHMA 4M7AG 5CKBA 2AKKA 3M4PA 1MNEA 3I5RA 2CJ9A 2LJ1A 2B8AA 5D7UA 4LUDA 1YP5A 1I1JA 2AKWB 4LNSA 3HXWA 4XEOA 2GTJA 3IQLA 3T9NA 2QTVA 3KFUA 1VQLQ 1B76A 2K2VA 1WDXA 5FROA 2MIOA 2J6KA 4XK8E 2KR3A 3HFZA 1I0CA 4OB3B 2QG9B 3R6OA 1PWTA 2EJ9A 1BYMA 1VYTA 4HA8A 1VQMQ 3NGPA 5FU7B 3OYBA 5EC7A 3LSSA 4C0DB 1BIBA 2ZPIB 4EPCA 2LCCA 1KC8R 4FYYB 1EFNA 4J9GA 3F70A 2RHSA 1VYVA 2GF7A 1N6AA 5CO7A 2HDAA 1N9RA 2RHXA 2LZ6B 1I07A 2ZINA 2PMFA 3PMIA 1F1BB 3NMZC 3CCET 2XICA 4J7IA 2IY5B 2KSSA 1M1KU 1JJ2S 4K88A 3VU3C 1W2BP 4F17A 3PIPA 1WJQA 2LRQA 4XEMA 1LNXA 4PJOF 1RL2A 1YITA 3SWNA 3M0PA 1BB9A 2FEIA 2DIGA 4DBHA 3L4GB 3QDFA 1SERA 4CH5A 4C92F 2LQKA 3QIIA 4M78G 5I22A 1VQOQ 1VQ6Q 5GAOq 1NM7A 4M7AB 1G5IA 4CS2A 1V76A 4D6WA 3HFVA 4Z89A 4CC7A 1ABQA 2ODRC 2M1HA 1GBRA 1OZ3A 2HBWA 3CCQQ 1UEBA 3OYKA 2DDZA 3L1AA 1BI3A 5A2QE 4HVCA 2QEXQ 1CKBA 4LD6A 3CPFA 1ZX6A 2JT4A 3MQZA 2M9UA 1SG5A 1VQ4T 1BBWA 5KH6A 1FWZA 3ICAA 4BE2A 2DEUA 1X01A 1ZSGA 4D8DA 1Y7XA 4MZPA 3OD1A 3QJ6A 3JCMQ 4H2VA 2OAWA 1VQ8Q 2ZGWA 3LGFA 1B70B 2PUOB 4KUIA 4YRSA 2DERA 1WXTA 4HCCA 4PFOA 2I4OA 1SETA 2ODRD 4TVAA 1U8RA 3J81E 3FB9A 2ROTA 1SHFA 3CXCS 3EG9B 4M75D 3H8ZA 4BUGA 2HL5C 5GMKi 4RTXA 5ELOA 2WSCE 5CCAA 3MP6A 2C0OA 3VS2A 1YJWA 4IUPA 2VGNA 4M75B 3ER0A 1WYXA 3JCMc 1IB8A 2YUPA 4DBQA 4RTUA 3WXMB 1X56A 3SD4A 5IXBA 1WHKA 2I4MA 4PJOG 1NLOC 3NEMA 4GBQA 1R0BG 4DEXA 5DY9A 1M1KR 3EG1A 5GAOr 2ZPBB 3C4SA 4HT4A 1HC7A 2DRKA 1NEBA 1YCYA 2FL7A 2K57A 3EH1A 2JS2A 3LH0A 4WI1A 5GAOn 3HXYA 2AKWA 1R8OB 1NYFA 2PUKB 4X5OA 2M0YA 4FYXB 4MDXA 5CQYA 4FW2A 4CH6A 3TEEA 4PG3A 3QTCA 4RMOA 5GANj 3CC2T 2QK0A 4O6JA 1FMWA 1K73U 4FT2A 1YNZA 3A31A 4E7SA 3VYGA 1AZGB 5CQXA 2L0AA 3VS6A 3PVLA 1SSHA 2E65A 4A53A 2O4XA 2K5FA 5K1XA 5FU6C 2CT4A 1Q86C 3E2UA 5LJ3j 2KEAA 2EYYA 2YDLA 4C92G 4L87A 3REBB 4XTWA 1Q81R 3OYGA 5DM7R 4NS5A 3WVDB 3REUA 3OW2S 3JB9D 1WU7A 1IHVA 6AT1B 2QAZA 3G4SQ 2VGMA 3QYGB 1VQ7T 2HNIA 5AT1B 1H4SA 3REAB 4FU6A 3GLXA 5AYFA 1JO8A 2C0TA 4PJOA 4JLIA 3CCJQ 1YCSB 2IIMA 1PSEA 3M0UA 4ELYC 1JQQA 2ZTGA 5IN1A 1B7YA 3CMEQ 1G3SA 1KQ2A 2M0OA 2KNBB 1K76A 4K11A 1HD3A 1E1TA 4B6MA 2EL9A 3IALA 3VQXA 4BWAA 1VQPQ 2DE0X 2DILA 2KQWA 3M4QA 4HCBA 4KR2A 2JTMA 1N9SA 4OMOA 2EBPA 1RACB 2YT6A 2PU9B 1PCXA 1KG1A 4C92C 2DD5A 4RCBA 2PVOB 4M75F 3RF1A 4CH3A 2ESWA 1VQ7Q 1YN8A 2DL3A 2Y90A 5I2SA 3CC7T 3EG3A 3G4ST 3RMQA 1VQKQ 2HBPA 2DBMA 2WSFE 2QHTA 2SEMA 4HT8A 2DXUA 2OI3A 2ZR3A 4UC4A 4H2WA 3OMCA 3QBYA 4ZGJB 5GMKe 2J6OA 4HWSA 2PQWA 3RMSA 2CH4W 2L89A 2DXTA 2ALYA 1XOVA 4YRIA 1VQ9A 3QZ5B 2JUFA 4OP0A 1JBMA 4LDUA 1KQ1A 3A5ZA 2HSPA 4F7UF 5K1PA 1UGQB 2ALYB 1NJ8A 3BY7A 2VYTA 1KC8U 1MGQA 4CI0C 1BBZA 2CSQA 3TUPA 2D0NA 1K1ZA 1Q81U 3G71T 4E7ZA 4P75A 1K9AA 4E7JA 4DBFA 3OSSC 2GFUA 4C8QC 3TSZA 2BZYA 1HK9A 1KMNA 3PTAA 3OYEA 1XJWB 4KT0E 2QA4Q 2DJZA 3QO8A 1I8FA 2A08A 3CEYA 3M0TA 1YJWQ 1X54A 1N27A 3G1JA 2CP0A 1ZHIA 2LX9A 2V1QA 7AT1B 5I11A 2I0NA 1IL2A 5EG2A 1SEMA 2KYBA 2HEQA 2MF2A 4OGCA 2EGAA 2QASA 3I56Q 3LH5A 1D1CA 1PD1A 4ZN3A 1VQ9T 1J3TA 4YPFA 1BI2A 3DLMA 4PJMA 4TVYA 3I55T 1ZUYA 4JJDA 2JZ2A 2VASA 2I2LA 1RIQA 2AZVA 2R58A 3HP9A 2VKNA 5CVIA 3I55A 1QMCA 1NYQA 1UGPB 3CCLA 5LJ5e 4C5GA 3A8LB 4KRTA 3L2UA 2X35A 1QVPA 2Q5HA 5GAN3 3RR6A 2MK5A 3MEAA 4JPBW 2YXYA 4J5YA 2H3JA 5D6XA 3OS1A 3DKMA 1H4QA 1ATIA 3VS4A 4E6RA 2G4CA 4BI3A 4RTTA 3HRTA 1TUCA 2X4WA 4EIKA 2ARSA 4M7DF 2L2PA 3CMAQ 3M57A 4II1A 4A4EA 2EYZA 2MI6A 2JMCA 2KGTA 2XKOC 3QHSA 1FXXA 1ZA2B 1USYA 2XD0A 2EVRA 3VS1A 4FM4B 4F7UG 3LYIA 4JRIA 1GFDA 4C92A 2K4YA 4WF2A 4P75C 4EMKB 1RAAB 4KGXB 1QCFA 2E4HA 2FRYA 2HKNA 5IT9E 1PNJA 1GBQA 1VYUA 3EGDB 5KYYB 4YRNA 4M7DB 4PNOA 3QG1A 3JAME 3QO3A 2KT8A 3M53A 2LCSA 3BDUA 2GTOA 4YDQA 3CCRQ 2BE7D 4PK4A 2DZ9A 1IGQA 5GAOp 1U06A 2E6ZA 3GNFB 4YCVA 2AKLA 3L2WA 4ZTFA 2O88A 3MKDA 4UP8A 1VQOA 1VQ6A 3H0FA 4YRRA 1PD0A 3SB2A 4CS4A 2DYIA 2RQRA 4FW1A 3A7RA 4C8QG 2HAXA 1NYRA 1Z7NA 4MMKA 2RI5A 1RI0A 2M02A 3U23A 1BBUA 1NJ2A 2E6NA 2EQKA 4OMQA 1PG5B 3JB9I 4K86A 1PC0A 1H3ZA 4YRTA 1NYGA 1KHIA 3FLGA 1YWOA 2F1LA 3CCQT 1UHFA 4ZTZB 4LDYA 3CC2A 2D0QB 3L2ZA 1YITT 4J9IA 3S3OA 1VQKA 4H2UA 4RTVA 1VQ5A 1YHQA 4A54A 1C0MA 2V26A 1K0XA 2NYSA 1G5VA 3PE0A 4F7UA 3CCVQ 5LL6S 1H8KA 2E70A 2AZSA 4QKUA 2V8KA 1UHCA 2P0PA 4OLFA 1Y71A 1YIJT 3H0HA 2DL8A 2O9VA 2RQWA 3GNGA 2R5AA 1IXDA 2IG0A 2YUOA 3VRYA 4XTXA 4ORZA 1TS9A 3VUZA 3PVQA 2GBQA 3M59A 2F2WA 3I7FA 1M9SA 2YRDA 5DLQE 1I81A 3JCMJ 2CZ7B 2L8DA 3GBQA 5FLXE 2CZ0B 4X1VA 1J5WA 3V8JA 2EJGA 4M7DG 2CT3A 1SPKA 1QCNA 2C06A 5GAMh 1PYSB 5CR2A 1Q81C 2DTIA 2HKQB 1NNHA 4Y92A 1OPLA 2CKKA 1DJ7B 4M7AF 3P8BB 3P8DA 1QVGS 1TSFA 5GAMe 1YIJA 2DTHA 3G6EA 4NOYA 1WX6A 2QGFB 2FPEA 3FIFA 5HGQA 3V7RA 1QVFP 4TVAB 3OYJA 4ATOA 2DTOA 2ZPGB 5A0LA 1AD5A 4NL2A 3I55Q 2LNVA 5GAN4 3IG2A 5KE2A 2KVQG 1VQ4A 4G84A 1ZSZC 3NPFA 4M78D 4M77E 3THKA 4FYVB 4M4ZA 3VYHB 2ZNIA 2X9HA 4JJCA 1RAGB 2RB6A 5FWBA 1ZBXA 2IY5A 1YI2A 4WJ4A 4LNPA 2RPNA 2KE9A 2RK2A 1NJ6A 2WSEE 3FDRA 3HKSA 2RD1A 1NPPA 1KMMA 1GFCA 1LYLA 5CK9A 3LWHA 2ECZA 3MO8A 1VQLT 4M77G 3CCVA 4BB7A 1T3LA 1FYFA 3X26B 1B70A 4YP0A 4H02A 1M4ZA 1VQNT 1KOGA 3CMET 1G3WA 3L2RA 3HY1A 4IUUA 4Q15A 2K79A 4J15A 3UT1A 5GJWB 2LCLA 3P8VA 2J6FA 4DQ2A 2C7IA 2H8HA 1HJDA 4QT7A 2KT1A 4YRFA 1EQRA 1UJ0A 1D0ZA 2ABLA 3JCMh 4F7UB 4XTZA 1X2HA 3AT1B 3VS7A 2JJ9A 2PMEA 4CC2A 1SKUB 1H92A 2YSQA 1QWEA 3LLRA 3TSWA 4WJ3M 4L5GA 4N4IA 4TQFA 4M77D 4M78E 4EMGA 1NJ5A 2COWA 1MUZA 2LT4A 1VOMA 1RLPC 4M77F 3QWXX 3M55A 3IKMB 1BCMA 2F5KA 1RABB 2NUTB 3MEYA 4YTLA 4DPGA 2RJDA 4P74C 2RQVA 4JZ3A 4XQ3A 4H2YA 3A32A 1KIKA 4OF1A 4C8QA 2JXBA 2Q5IA 2JOYA 2H3EB 2FZKB 3TVTA 3OS2A 1VQLA 5LJ5g 1V1CA 2J06A 5KNNA 2OAUA 2EQUA 3UGTA 1JJ2A 1WJRA 3OYNA 3HXZA 2AHJB 4IIMA 3J7AF 1Z7MA 3JCMb 4MMLA 4BE0A 3JCMP 3BDLA 1JJCA
chains in the Genus database with same CATH topology
3SWNC 2ZZGA 3CC4T 2G3RA 3PFSA 1WLEA 1G3YA 4M75A 1U1SA 2YLCA 3G1ZA 4YCWA 5GAN5 2QQAA 3CCSA 3KBGA 4YRPA 2KAFA 2F5TX 2CS7A 4Y28E 1HXDA 4P71C 4OB1B 1B8AA 4XU3A 4FT4A 3AHUA 1SESA 3RKWA 4A4GA 2O01E 2OTLA 2KMTA 3LSQA 3CBOA 1QW1A 2QQBA 2RJCA 3A5ZB 3I56A 4NCXA 4BE1A 4M7DA 3CCMT 1VQMA 1WQ7A 2LVMA 1BI0A 1WGSA 2ARTA 1NJIU 5C6SA 4CH4A 4PJOC 1NPRA 4C5HA 4YRCA 1S72A 1YFTA 3NFCA 4YRMA 4C0FA 4FSXA 3G7ZA 2HD0A 1O75A 3CCRT 5GANe 2ZIMA 2QHVA 4M75E 4P71A 4M7DE 3OYFA 4YRQA 1L0WA 3TREA 2JVVA 2P0QA 2MWPA 4M75C 1G3TA 3UDCA 4Q6GA 3X28B 3JB9F 4E7HA 4VUBA 1N9WA 1X75C 3S6WA 2DKGA 3EFRA 4C0GA 5E3IA 2ZZEA 2V8IA 3LGLA 3PCOB 3C12A 4B9WA 3CPWS 1KQSA 2QEXA 2GCXA 1ASZA 3PIOA 4YROA 3PNWC 3S3NA 2Q7GA 3PGGA 3M56A 3ERRA 2K5LA 3P8TA 4C8QF 1W4SA 3RERA 4LD9K 4C0DC 1I4K1 4YRLA 3HFOA 4BI4A 2XGTA 2CZ1B 3OSVA 5J26A 4XTUA 2BUDA 2CZ6B 2DZCA 2RHIA 2EAYA 4TVRA 4ME7A 3QPHA 3R07A 2ZZDA 4JDSA 2RI3A 2L3RA 3RESA 3CMAT 1C0AA 3HFNA 1M1KC 3OYAA 3QDRB 3JCMX 2LQ8A 3QXEB 3A8MB 4LDXA 2M16A 2RI2A 1OI1A 2YHTA 5GANd 2E10A 3NELA 1AHJB 4HWTA 4M77A 4C5IA 1EIFA 3JCMW 5D6WA 5GAMf 1VQMT 2A8EA 3RGLA 2QQRA 4BACA 4KUDK 5CKFA 3HPWA 4N4HA 2WACA 2BIVA 1LOJA 4EO4A 1EIYA 5LJ3d 3WVEB 4C8QD 1Y96A 1IREB 4J6YA 1VIEA 4TTVA 3LW5E 3RIRA 3QUIA 4BD3A 3JRZA 3JB9G 1QF6A 4LDVA 2EYQA 1EOVA 5CAIA 2EFIA 3M4YA 4RQEA 1Q82C 5LJ5j 1YI2T 4IUQA 3ZBDA 2ZR2A 1M1FA 5GAN6 2KY9A 3M4GA 1W2BA 3BJUA 4YRKA 3HHTB 4LVMA 4J6WA 3FJPA 2EKOA 4LVLA 2FYKA 1NZ9A 4MZTA 3OYMA 4HT9A 2E41A 4KULA 1K9MC 5C52B 1V29B 2R5MA 4F7UE 4P73C 3V8LA 4J7FA 3HL8A 3MCAB 4EMKC 4J6XA 3M58A 12ASA 3A8GB 2XDPA 4PKCC 2ZIOA 4Q5WA 1VQ7A 3RKXA 1UB4A 2E3CA 3UFGA 3CXCA 3META 4ZGEB 3A7UA 1SRYA 2VUBA 1W66A 3O8VA 4H2XB 3X24B 4RG8A 5GMKj 5GAMj 5GAMg 5D6YA 2C8MA 3RL6A 1B34B 5LJ5f 4M78F 4QW2A 4L6V5 5KE3A 3QJYA 4N4GA 3JCMg 3SWNB 2VXEA 2K5IA 3NTHA 2OTJA 2DQ0A 4E51A 4XAXB 4M7AD 2JN0A 5C51B 3CCRA 3HY0A 3E9IA 2XDBA 2HQXA 1Q82U 2RM4A 5GANh 4OB2B 3OYLA 4HWOA 2X4JA 5GANg 4YYEA 1NJIC 5GANf 4TQDA 4E7LA 4N0AA 5C53B 4TWAA 5CKEA 2XG8D 3TCJA 5LJ3h 2I4NA 1JJCB 5GAN7 1YJWT 3VBBA 4BY6C 2QA4T 1XQHA 4FL6A 4JJNK 1SSFA 3LWIA 3PMTA 1YJNT 4BI8B 2K3XA 3CCLT 4O2DA 2EJFA 4XTYA 5ELNA 2OTLT 3PCOA 1YBYA 3INZA 4RKUE 1X2GA 3JCMe 3J80E 4NL3A 4Y91A 3EFSA 2DXBA 2RJFA 1JB0E 3FC3A 2J3MA 2RHUA 2IVWA 4X9DA 3V7SA 4E47A 3ZFJA 3RKYA 3OBYA 5GMKm 4RQFA 2QXFA 4M77C 5L8RE 1YJ9A 4PL6A 2P5IA 4JLGA 2QI2A 4X9CA 2VC8A 1QVFA 4IUTA 3V8KA 5A0GA 4JRKA 1YJNA 1M90U 1NJ1A 3HRUA 2DPPB 3A8OB 3OB9A 1ADJA 1YFSA 3CCUA 4XU2A 4M78A 4JS4A 3VQWA 1VQZA 2RHQB 2VXFA 4QQDA 3CCEA 3GPLA 2ZT8A 4JRPA 3PZCA 3OYYA 3M9QA 3CD6A 5J3BA 3SDZA 4PJOD 1VQNA 3E9GA 4JS5A 4OB0B 4P72C 1KD1U 2ZPFB 2XIDA 5CIUA 4M7AC 3TEHA 3G4SA 5I21A 2DEQA 2EWNA 4P3PA 2YRVA 3HRIA 4M75G 2CJAA 3MEVA 3CPWA 1D3BA 3VUBA 3OY9A 2LT1A 1OYXA 3M5AA 3CC4A 4PLIA 1N8RC 3W3SA 4PLLA 4EMHA 1GXIE 1WPYA 5GMKl 2DU5A 1YGBA 1BKBA 2AMCA 5HK3A 4R55A 3VQYA 3VQVA 2O4XB 1BI1A 2DU7A 1I5LA 3CCVT 5M9OA 4BDZA 4C92B 1TH7A 5GAOl 4A4HA 3E19A 1QE0A 3REXA 4ZGDB 1OZ2A 1Q7YC 1VQ8A 2A3LA 2EQMA 2GFAA 3HXVA 2EQJA 4XTVA 3H6ZA 3CCJT 3CCMA 3JB9J 3NTIA 2QEXT 4RG2A 2BKDN 2XI9A 3ZEHA 3UWNA 1M8VA 1E24A 2E5AA 2Q7HA 4HWRA 2RA2A 4XU1A 1K73C 3OYIA 1VQKT 4IUVA 1ASYA 1QVFS 4IKFA 2QTXA 2MAMA 2A7YA 2RHYA 3C95A 3VJPA 3JCMf 5LJ3e 4YREA 1VQPA 1NE8A 4TVWA 3EAEA 3CC7A 4O5VA 2CIMA 2FHDA 2JNGA 3TEHB 4QVZA 2PVDB 3M54A 1H4TA 4R56A 2ZZFA 4M7DD 2RK1A 4Z02A 3CCUT 5KCHA 4H2TA 4DOWA 3OS0A 2D9TA 3E9HA 2X4XA 3OW2A 4H2SA 2DD4A 3JB9H 1E22A 2K3YA 2Y4YA 3CMQA 1YFRA 4QVDA 1G5HA 1W2BS 3DSQA 1EVLA 4K87A 3P8YA 4BY6B 5FRMA 4ZIBA 2JTFA 4MDWA 2E1HA 3RUXA 1HTTA 1GGMA 3N5BB 2KK4A 2ZT6A 4PHCA 1UGSB 3SFMA 4PJOB 3CCST 3MP1A 5HK0A 1VUBA 3KUFA 3GF5A 1U1TA 1M90C 1WNLA 1MHNA 5I2MA 5GMKh 3X25B 5HY6A 5LJ3f 2MMPA 3GIBA 4P3NA 3FRNA 3JSCA 1Q7YU 4C5EA 1ZQ1A 1Q86U 1XNIA 3QYHB 4QQ6A 3A74A 4C92E 2P0KA 11ASA 2ZPEB 3QKJA 1XTDA 1EFWA 4KQEA 4E7IA 4C8QB 4GY5A 3CMEA 2J3LA 4H2XA 3V7CA 2DQ3A 4KR3A 2CGHA 4LVKA 3C94A 1WYDA 2DXCA 3DLLA 2QHUA 5GAN8 2L5QA 4M78B 5FRNA 2AMCB 1B34A 4UP7A 1E1OA 2E64A 5GAOm 3BFMA 1S72T 2NLUA 3TEGA 1WQWA 2ZPHB 4AH6A 2QHSA 2QQSA 4ZTUB 2OTJT 1FX7A 3URGA 2P4TA 3L42A 2KDSA 1ADYA 3OMGA 1M5Q1 4V2SA 1K8AU 1H4VB 2GQVA 3PT9A 1K8AC 3QO5A 3G71A 2ZCEA 1O9SA 2PVGB 4DOVA 4B9XA 3CBPA 3L2QA 3KXTA 3A5YA 3CBMA 3MF2A 3OYCA 2QQ9A 4ZTJA 3HRSA 2V8JA 2MWOA 2FVUA 2RHSB 3ASKA 3I56T 5J39A 2DVEA 2YLBA 2ZT5A 1X55A 3HXUA 3A7AA 1EIYB 4JUVA 2DAQA 3LX7A 1N8RU 3OQ5A 2LC4A 3MP8A 3MF1A 3CD6T 4OGEA 1JRIA 3E9FA 2RH2A 3QO7A 4PJOE 4LVJA 5A0DA 2EIFA 3DB4A 4M77B 1QP3A 5DLOA 4EX5A 4CRIA 1VQ5T 1KC8C 4M7DC 3MEWA 4QVCA 2XK0A 3UH0A 3CCQA 4EMKA 3MHXA 3L2VA 2LTOA 2XHCA 3A8HB 4M7AE 2E12A 5HKCA 2LDMA 1QP2A 3NETA 5IAYA 4LVIA 5LJ3g 5F5WA 4C0ZA 4E7KA 1USYC 4XU0A 4RDXA 4P5NA 4HKEA 1PYSA 5KCOA 2FB7A 3MEUA 4C8QE 1P92A 4FIBA 3LC0A 5LJ5d 3FEOA 2R57A 4J8OA 1YHQT 4P3OA 2ZCFB 2CJBA 3DB3A 1VQ8T 2HQEA 3HRKA 4YRGA 4P73A 2XTIA 1Y07A 3HSBA 4M7AA 3UGQA 4LDWA 4P72A 4YCVA 2XU8A 4C92D 3QZ9B 4G85A 3OS5A 2E5QA 3QSUA 5C0MA 4OMFB 3OA6A 2DO3A 2P0LA 1WJSA 1X6OA 4P74A 4A4FA 4M78C 4ELZC 3P8HA 3JCMV 2ZT7A 2QA4A 1H641 3HFZB 4RMFA 1UGRB 4JRQA 1KHCA 4UP9A 2X4YA 1IZ6A 1EVKA 3GOXA 2Y4XA 2RO0A 3JCMd 5CKHA 4QQGA 3X20B 1VIFA 3L4GA 3G6ET 5GAN2 4CS3A 2I4LA 4MZMA 4OVAA 2XDDA 5FU7C 3NENA 3E1SA 3OBWA 4A4KA 3QNEA 4ZN1A 4BDYA 1PSFA 4HWPA 4BW9A 1YJ9T 3TU4K 3BW1A 1YB3A 4YRJA 2QDYB 2VV5A 4EDUA 1B7YB 3NTKA 5CKDA 3WQZA 4HCZA 2RJEA 1M1GA 4GLKA 4IURA 2D6FA 1Y96B 3HXXA 1KD1C 4J83A 1VQPT 3S3MA 4KBMB 3OYHA 1G51A 3UPUA 3VKIA 2ARUA 3RACA 3VV0A 4YCUA 3ME9A 2Q7EA 2ZNJA 2RHZA 4N0AC 2DIQA 5GAMd 4RCCA 2ZXFA 4UPAA 1QVGA 5LJ5h 1VQOT 2F69A 1VQ6T 3HTZA 2DK3A 2NS6A 2RHQA 1KQSS 2CYZB 1LJOA 4L59A 4DA4A 3IKLA 1D3BB 3OYDA 3CCJA 3GP8A 3CMAA 4X34A 3Q1JA 1BIAA 5FU6B 1K9MU 4M7AG 5CKBA 3M4PA 2CJ9A 2B8AA 2AKWB 4LNSA 3HXWA 4XEOA 3T9NA 3KFUA 1B76A 2K2VA 5FROA 4XK8E 3HFZA 4OB3B 3R6OA 2EJ9A 1BYMA 4HA8A 5FU7B 3OYBA 3LSSA 4C0DB 1BIBA 2ZPIB 4EPCA 2LCCA 3F70A 2RHSA 2GF7A 1N6AA 5CO7A 1N9RA 2RHXA 2ZINA 2PMFA 3PMIA 3CCET 2XICA 4J7IA 2IY5B 2KSSA 1M1KU 1JJ2S 4K88A 3VU3C 3PIPA 1WJQA 2LRQA 4XEMA 1LNXA 4PJOF 1RL2A 1YITA 3SWNA 2DIGA 3L4GB 1SERA 4CH5A 4C92F 2LQKA 3QIIA 4M78G 5GAOq 4M7AB 1G5IA 4CS2A 4D6WA 3HFVA 2ODRC 2M1HA 1OZ3A 1UEBA 3OYKA 2DDZA 3L1AA 1BI3A 5A2QE 4HVCA 4LD6A 3CPFA 3MQZA 2M9UA 1VQ4T 1BBWA 5KH6A 1FWZA 3ICAA 4BE2A 1X01A 1Y7XA 4MZPA 3OD1A 3QJ6A 3JCMQ 4H2VA 2ZGWA 3LGFA 1B70B 2PUOB 4KUIA 4YRSA 4HCCA 2I4OA 1SETA 4TVAA 2ODRD 1U8RA 3J81E 3FB9A 3CXCS 4M75D 3H8ZA 4BUGA 5GMKi 5ELOA 2WSCE 5CCAA 3MP6A 1YJWA 4IUPA 2VGNA 4M75B 3ER0A 3JCMc 3WXMB 1X56A 3SD4A 2I4MA 4PJOG 3NEMA 5DY9A 5GAOr 2ZPBB 3C4SA 4HT4A 1HC7A 1YCYA 2FL7A 2K57A 4WI1A 3LH0A 5GAOn 3HXYA 2AKWA 1R8OB 2PUKB 4X5OA 4MDXA 5CQYA 4CH6A 3TEEA 4PG3A 3QTCA 4RMOA 5GANj 3CC2T 4O6JA 1K73U 3A31A 4FT2A 3VYGA 5CQXA 2E65A 4A53A 2O4XA 2K5FA 5K1XA 5FU6C 1Q86C 5LJ3j 4C92G 4L87A 4XTWA 3OYGA 5DM7R 4NS5A 3WVDB 3REUA 3OW2S 3JB9D 1WU7A 2VGMA 3QYGB 1VQ7T 2HNIA 1H4SA 4FU6A 3GLXA 5AYFA 4PJOA 4JLIA 1PSEA 4ELYC 2ZTGA 5IN1A 1B7YA 1G3SA 1KQ2A 2M0OA 1E1TA 2EL9A 3IALA 3VQXA 4BWAA 2KQWA 4KR2A 3M4QA 4HCBA 2JTMA 1N9SA 2PU9B 1KG1A 4C92C 2DD5A 4RCBA 2PVOB 4M75F 3RF1A 4CH3A 2Y90A 5I2SA 3CC7T 3G4ST 3RMQA 2HBPA 2WSFE 2QHTA 4HT8A 2DXUA 2ZR3A 4H2WA 4UC4A 3OMCA 3QBYA 4ZGJB 5GMKe 4HWSA 2PQWA 3RMSA 2L89A 2DXTA 2ALYA 1XOVA 4YRIA 1VQ9A 3QZ5B 2JUFA 4OP0A 1JBMA 4LDUA 1KQ1A 3A5ZA 4F7UF 5K1PA 1UGQB 2ALYB 1NJ8A 3BY7A 2VYTA 1KC8U 1MGQA 4CI0C 3TUPA 1Q81U 3G71T 4P75A 4E7JA 3OSSC 2GFUA 4C8QC 1KMNA 1HK9A 3PTAA 3OYEA 4KT0E 2DJZA 3QO8A 1I8FA 3CEYA 1X54A 1N27A 1ZHIA 2LX9A 1IL2A 5EG2A 2MF2A 4OGCA 1VQ9T 4ZN3A 4YPFA 1BI2A 3DLMA 4TVYA 3I55T 2JZ2A 2I2LA 1RIQA 2R58A 3HP9A 5CVIA 3I55A 1NYQA 1UGPB 3CCLA 5LJ5e 4C5GA 3A8LB 3L2UA 2X35A 1QVPA 2Q5HA 5GAN3 3MEAA 4J5YA 2H3JA 5D6XA 3OS1A 3DKMA 1H4QA 1ATIA 2G4CA 4BI3A 3HRTA 2X4WA 2ARSA 4M7DF 3M57A 4II1A 4A4EA 2MI6A 2XKOC 3QHSA 1FXXA 1USYA 2XD0A 4FM4B 4F7UG 3LYIA 4JRIA 4C92A 2K4YA 4WF2A 4P75C 4EMKB 5IT9E 4YRNA 4M7DB 4PNOA 3QG1A 3JAME 3QO3A 3M53A 3BDUA 4YDQA 2DZ9A 5GAOp 2E6ZA 3GNFB 3L2WA 4ZTFA 4UP8A 1VQOA 1VQ6A 4YRRA 3SB2A 4CS4A 3A7RA 4C8QG 2HAXA 1NYRA 1Z7NA 4MMKA 2RI5A 1RI0A 1BBUA 1NJ2A 2E6NA 2EQKA 3JB9I 4K86A 1H3ZA 4YRTA 1KHIA 3FLGA 3CCQT 4ZTZB 4LDYA 3CC2A 2D0QB 3L2ZA 1YITT 3S3OA 1VQKA 4H2UA 1VQ5A 1YHQA 4A54A 1G5VA 4F7UA 5LL6S 2E70A 2V8KA 2P0PA 4OLFA 1Y71A 1YIJT 3GNGA 2R5AA 2IG0A 4XTXA 3VUZA 3M59A 3I7FA 1M9SA 5DLQE 1I81A 3JCMJ 2CZ7B 2L8DA 5FLXE 2CZ0B 1J5WA 3V8JA 2EJGA 4M7DG 2C06A 5GAMh 1PYSB 5CR2A 1Q81C 2DTIA 1NNHA 2CKKA 1DJ7B 4M7AF 3P8BB 3P8DA 1QVGS 5GAMe 1YIJA 2DTHA 3G6EA 4NOYA 3FIFA 5HGQA 3V7RA 4TVAB 3OYJA 4ATOA 2DTOA 2ZPGB 5A0LA 4NL2A 2LNVA 5GAN4 3IG2A 4G84A 2KVQG 5KE2A 1VQ4A 4M78D 4M77E 3VYHB 2ZNIA 2RB6A 1ZBXA 2IY5A 1YI2A 4WJ4A 2RK2A 1NJ6A 2WSEE 3FDRA 3HKSA 2RD1A 1NPPA 1KMMA 1LYLA 5CK9A 3LWHA 3MO8A 1VQLT 4M77G 3CCVA 4BB7A 1FYFA 3X26B 1B70A 4YP0A 4H02A 1M4ZA 1VQNT 1KOGA 3CMET 1G3WA 3L2RA 3HY1A 4IUUA 4Q15A 4J15A 3UT1A 2LCLA 3P8VA 4DQ2A 2C7IA 4YRFA 1EQRA 3JCMh 4F7UB 4XTZA 1X2HA 2PMEA 3LLRA 4WJ3M 4L5GA 4N4IA 4TQFA 4M77D 4M78E 4EMGA 1NJ5A 2LT4A 4M77F 3M55A 3IKMB 2F5KA 3MEYA 4DPGA 4YTLA 2RJDA 4P74C 4XQ3A 4H2YA 3A32A 4OF1A 4C8QA 2Q5IA 2JOYA 3OS2A 1VQLA 5LJ5g 5KNNA 2OAUA 2EQUA 3UGTA 1JJ2A 3HXZA 1WJRA 3OYNA 2AHJB 3J7AF 1Z7MA 3JCMb 4MMLA 4BE0A 3JCMP 3BDLA 1JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWN C;  2E65 A;  4M7A E;  2P5I A;  4A53 A;  4X9C A;  2ZZG A;  5K1X A;  3NET A;  1WLE A;  2VC8 A;  5LJ3 g;  5LJ3 j;  5F5W A;  4M75 A;  1U1S A;  2YLC A;  4C92 G;  3G1Z A;  4L87 A;  1USY C;  4XU0 A;  4XTW A;  3V8K A;  4YCW A;  5GAN 5;  3REU A;  4YRP A;  4RDX A;  4JRK A;  3JB9 D;  1PYS A;  1WU7 A;  2FB7 A;  1HXD A;  4C8Q E;  4P71 C;  1B8A A;  3LC0 A;  5LJ5 d;  4XU3 A;  1NJ1 A;  3AHU A;  1SES A;  3RKW A;  2HNI A;  1H4S A;  4P3O A;  4PJO A;  4JLI A;  2CJB A;  3LSQ A;  1ADJ A;  3HRK A;  1YFS A;  4YRG A;  4XU2 A;  4M78 A;  2ZTG A;  4P73 A;  3VQW A;  2XTI A;  1B7Y A;  1VQZ A;  4M7A A;  3HSB A;  2RHQ B;  3UGQ A;  4NCX A;  2VXF A;  1KQ2 A;  4P72 A;  4C92 D;  4M7D A;  1E1T A;  2ZT8 A;  4G85 A;  4YCV A;  2EL9 A;  3PZC A;  3IAL A;  1WQ7 A;  3VQX A;  4BWA A;  3QSU A;  4KR2 A;  3M4Q A;  4PJO D;  1N9S A;  2ART A;  4P72 C;  2P0L A;  4CH4 A;  4PJO C;  4M7A C;  3TEH A;  4P74 A;  4M78 C;  4YRC A;  4C92 C;  5I21 A;  2DEQ A;  4RCB A;  3JCM V;  2ZT7 A;  2EWN A;  4M75 F;  4P3P A;  3RF1 A;  4CH3 A;  1YFT A;  3HRI A;  1H64 1;  3HFZ B;  4RMF A;  2Y90 A;  4YRM A;  4M75 G;  2QHT A;  4HT8 A;  2CJA A;  4UP9 A;  2DXU A;  2ZR3 A;  4H2W A;  5GMK e;  5GAN e;  1D3B A;  2ZIM A;  2QHV A;  4M75 E;  4P71 A;  4HWS A;  4M7D E;  2DXT A;  2ALY A;  1EVK A;  4YRQ A;  3W3S A;  4YRI A;  1L0W A;  4EMH A;  3JCM d;  4OP0 A;  1JBM A;  1KQ1 A;  1WPY A;  3A5Z A;  5GMK l;  3L4G A;  4M75 C;  4F7U F;  5K1P A;  2ALY B;  4Q6G A;  1NJ8 A;  2DU5 A;  3BY7 A;  1YGB A;  5GAN 2;  4CS3 A;  3JB9 F;  2I4L A;  1MGQ A;  2AMC A;  3TUP A;  1N9W A;  4P75 A;  3NEN A;  3VQY A;  2DKG A;  3VQV A;  3EFR A;  4C8Q C;  1KMN A;  3QNE A;  1HK9 A;  2DU7 A;  5E3I A;  2ZZE A;  1I5L A;  2DJZ A;  3QO8 A;  1I8F A;  1X54 A;  4HWP A;  4BW9 A;  3PCO B;  4C92 B;  1TH7 A;  5GAO l;  1IL2 A;  3BW1 A;  1ASZ A;  4YRO A;  1QE0 A;  1YB3 A;  4YRJ A;  3REX A;  4YPF A;  4TVY A;  2Q7G A;  3PGG A;  1B7Y B;  3ERR A;  2I2L A;  1RIQ A;  3P8T A;  4C8Q F;  3HXV A;  3WQZ A;  3RER A;  1NYQ A;  1I4K 1;  5LJ5 e;  4XTV A;  1Y96 B;  3HXX A;  2Q5H A;  5GAN 3;  3JB9 J;  4YRL A;  3HFO A;  2XGT A;  4J5Y A;  1M8V A;  4XTU A;  1E24 A;  2E5A A;  2Q7H A;  2RA2 A;  4XU1 A;  4HWR A;  1H4Q A;  2DZC A;  1ATI A;  2G4C A;  1ASY A;  2EAY A;  1G51 A;  2QTX A;  2ARS A;  4M7D F;  3JCM f;  5LJ3 e;  3R07 A;  4YRE A;  2ARU A;  4TVW A;  3RAC A;  3RES A;  2CIM A;  3QHS A;  4YCU A;  2Q7E A;  3TEH B;  2ZNJ A;  4N0A C;  1C0A A;  1USY A;  5GAM d;  3HFN A;  4RCC A;  2ZXF A;  3JCM X;  4UPA A;  1H4T A;  2ZZF A;  4F7U G;  4JRI A;  4C92 A;  4M7D D;  5LJ5 h;  4P75 C;  4WF2 A;  4EMK B;  3HTZ A;  2YHT A;  2RHQ A;  4H2T A;  5GAN d;  2E10 A;  3NEL A;  4YRN A;  4HWT A;  4M77 A;  3E9H A;  4M7D B;  4PNO A;  3JCM W;  4H2S A;  1LJO A;  3IKL A;  5GAM f;  3RGL A;  3QO3 A;  3BDU A;  1D3B B;  3JB9 H;  1E22 A;  4YDQ A;  2DZ9 A;  3CMQ A;  1YFR A;  1LOJ A;  4QVD A;  5GAO p;  1G5H A;  4EO4 A;  1BIA A;  1EIY A;  3DSQ A;  5LJ3 d;  4C8Q D;  1EVL A;  4K87 A;  1Y96 A;  3P8Y A;  4M7A G;  4ZIB A;  4J6Y A;  3M4P A;  4UP8 A;  4TTV A;  2E1H A;  4YRR A;  3SB2 A;  2CJ9 A;  4CS4 A;  3RIR A;  3RUX A;  1HTT A;  3QUI A;  3A7R A;  4C8Q G;  1NYR A;  1Z7N A;  4MMK A;  1GGM A;  1BBU A;  1NJ2 A;  3JB9 G;  1QF6 A;  2AKW B;  2ZT6 A;  4LNS A;  3JB9 I;  4K86 A;  4PHC A;  3HXW A;  4XEO A;  1EOV A;  5CAI A;  4YRT A;  4PJO B;  3KFU A;  4ZTZ B;  1B76 A;  4RQE A;  5LJ5 j;  3L2Z A;  2ZR2 A;  5GAN 6;  3HFZ A;  4H2U A;  3M4G A;  1U1T A;  3BJU A;  4YRK A;  2EJ9 A;  4A54 A;  4J6W A;  4HA8 A;  3FJP A;  2FYK A;  1WNL A;  4HT9 A;  2E41 A;  4F7U A;  5GMK h;  3LSS A;  5C52 B;  4F7U E;  4P73 C;  1BIB A;  3V8L A;  5LJ3 f;  4OLF A;  3GIB A;  4P3N A;  4EMK C;  4J6X A;  12AS A;  2RHS A;  4XTX A;  1N9R A;  3A74 A;  4C92 E;  2ZIO A;  3UFG A;  3RKX A;  11AS A;  2E3C A;  2ZIN A;  3I7F A;  2PMF A;  1I81 A;  3JCM J;  1EFW A;  4KQE A;  3A7U A;  2IY5 B;  1SRY A;  4C8Q B;  1J5W A;  1W66 A;  3V8J A;  2EJG A;  4M7D G;  4H2X B;  4K88 A;  3VU3 C;  5GMK j;  5GAM h;  1PYS B;  5GAM j;  2J3L A;  4XEM A;  2DTI A;  5GAM g;  1LNX A;  4PJO F;  1NNH A;  4H2X A;  3V7C A;  2DQ3 A;  4KR3 A;  2CGH A;  3SWN A;  4M7A F;  2C8M A;  1WYD A;  5GAM e;  3L4G B;  1B34 B;  3RL6 A;  5LJ5 f;  4M78 F;  1SER A;  2DTH A;  2QHU A;  5GAN 8;  4NOY A;  4CH5 A;  4C92 F;  4M78 B;  3FIF A;  3JCM g;  4M78 G;  5HGQ A;  2AMC B;  1B34 A;  5GAO q;  4M7A B;  3V7R A;  4TVA B;  1G5I A;  4UP7 A;  4CS2 A;  1E1O A;  3SWN B;  2DTO A;  2E64 A;  5GAO m;  2VXE A;  3HFV A;  4NL2 A;  3BFM A;  5GAN 4;  2ODR C;  3IG2 A;  4G84 A;  2DQ0 A;  3TEG A;  4M78 D;  4M77 E;  1WQW A;  4E51 A;  2ZNI A;  4M7A D;  3L1A A;  2DDZ A;  4AH6 A;  2JN0 A;  2QHS A;  4HVC A;  5C51 B;  2RB6 A;  2IY5 A;  3HY0 A;  4WJ4 A;  4ZTU B;  3E9I A;  1BBW A;  1NJ6 A;  2RM4 A;  3ICA A;  1X01 A;  2RD1 A;  5GAN h;  1KMM A;  3OD1 A;  1LYL A;  3JCM Q;  4H2V A;  1ADY A;  2ZGW A;  4HWO A;  5GAN g;  1B70 B;  4YRS A;  4YYE A;  1M5Q 1;  4M77 G;  5GAN f;  4V2S A;  1H4V B;  4TQD A;  4N0A A;  5C53 B;  4TWA A;  1FYF A;  2I4O A;  1B70 A;  3QO5 A;  4YP0 A;  1SET A;  2ODR D;  4H02 A;  4TVA A;  2ZCE A;  1KOG A;  3FB9 A;  5LJ3 h;  3HY1 A;  4Q15 A;  2I4N A;  1JJC B;  4M75 D;  5GAN 7;  4J15 A;  3A5Y A;  3VBB A;  5GMK i;  3MF2 A;  3P8V A;  5ELO A;  4DQ2 A;  2C7I A;  2RHS B;  4YRF A;  1EQR A;  3JCM h;  4F7U B;  4O2D A;  4XTZ A;  2DVE A;  2YLB A;  4M75 B;  1X2H A;  2EJF A;  2ZT5 A;  1X55 A;  3JCM c;  4XTY A;  5ELN A;  2PME A;  3PCO A;  3HXU A;  1X56 A;  3A7A A;  1EIY B;  4JUV A;  4WJ3 M;  2I4M A;  4PJO G;  4TQF A;  3MF1 A;  3NEM A;  4M77 D;  3INZ A;  4M78 E;  5DY9 A;  1JRI A;  4EMG A;  1NJ5 A;  5GAO r;  3QO7 A;  4PJO E;  4M77 F;  1X2G A;  1HC7 A;  3IKM B;  3JCM e;  4M77 B;  1YCY A;  3MEY A;  4DPG A;  4P74 C;  2K57 A;  4NL3 A;  4WI1 A;  4EX5 A;  4XQ3 A;  5GAO n;  4H2Y A;  3A32 A;  3HXY A;  2AKW A;  4C8Q A;  4X5O A;  4Y91 A;  2Q5I A;  3EFS A;  4M7D C;  5LJ5 g;  2J3M A;  4CH6 A;  5KNN A;  4QVC A;  4PG3 A;  3UGT A;  4X9D A;  3V7S A;  3QTC A;  3UH0 A;  5GAN j;  3HXZ A;  3A31 A;  4EMK A;  3RKY A;  1Z7M A;  5GMK m;  3JCM b;  4MML A;  4RQF A;  3JCM P;  1JJC A;  4M77 C; 
#chains in the Genus database with same CATH topology
 1M2V A;  3SWN C;  4FCY A;  1ZLM A;  1VA7 A;  5IHI A;  2ZZG A;  1U5S A;  3CC4 T;  1IGU A;  2G3R A;  3PFS A;  1WLE A;  2RMO A;  1IO6 A;  1G3Y A;  4M75 A;  1U1S A;  4PJJ A;  2J7I A;  2YLC A;  3G1Z A;  4YCW A;  5GAN 5;  2QQA A;  3CCS A;  3KBG A;  3TQ7 P;  4YRP A;  2KAF A;  2F5T X;  2CS7 A;  4DEY A;  2FPD A;  4Y28 E;  1HXD A;  4OMP A;  4P71 C;  4OB1 B;  2X3X D;  1B8A A;  4XU3 A;  4FT4 A;  3AHU A;  1SES A;  3RKW A;  1QVG P;  4A4G A;  2O01 E;  4OML A;  2OTL A;  2KMT A;  3LSQ A;  4J9E A;  3CBO A;  1M3C A;  1OPK A;  1ARK A;  1QW1 A;  2QQB A;  2RJC A;  3A5Z B;  3I56 A;  1A0N B;  4NCX A;  2OJ2 A;  5KYN A;  4J9C A;  4BE1 A;  4M7D A;  3CCM T;  1VQM A;  1WQ7 A;  4LE9 A;  2LVM A;  2YUN A;  1RI9 A;  1ACM B;  3EHQ A;  1BI0 A;  1WGS A;  1X69 A;  2ART A;  3EFO A;  1NJI U;  5C6S A;  4CH4 A;  4PJO C;  1NJI R;  3NHN A;  1NPR A;  4C5H A;  1X27 A;  4YRC A;  5IH2 A;  1S72 A;  1YFT A;  3NFC A;  1WIE A;  1YHQ Q;  4YRM A;  4C0F A;  4FSX A;  3G7Z A;  2CP6 A;  2HD0 A;  1O75 A;  2LJ0 A;  1AZE A;  3CCR T;  5GAN e;  2ZIM A;  2QHV A;  2KRN A;  4M75 E;  2LP5 A;  3UA7 A;  4P71 A;  4M7D E;  3OYF A;  4YRQ A;  1L0W A;  3TRE A;  2JVV A;  4AT1 B;  1N5Z A;  2P0Q A;  2PNI A;  1QLY A;  1GL5 A;  1BCO A;  2MWP A;  2DA9 A;  1G3T A;  4M75 C;  3UDC A;  1G8X A;  4Q6G A;  3X28 B;  3JB9 F;  4E7H A;  4VUB A;  1K0S A;  1T0J A;  1N9W A;  1X75 C;  3S6W A;  2DKG A;  2Z0W A;  3EFR A;  4C0G A;  1UUE A;  5E3I A;  2ZZE A;  1LCK A;  2V8I A;  3LGL A;  1TWB A;  2JM8 A;  3PCO B;  3C12 A;  4B9W A;  3CPW S;  1KQS A;  2QEX A;  1N8R R;  3ZL7 C;  2DM1 A;  2GCX A;  2HZY A;  1X6G A;  1WHH A;  1ASZ A;  3PIO A;  4YRO A;  1AVZ C;  3PNW C;  1HSQ A;  2MYS A;  2RNA A;  3CCE Q;  3S3N A;  1B3Q A;  2Q7G A;  3PGG A;  3M56 A;  3ERR A;  2K5L A;  1SRL A;  3EG2 A;  4C8Q F;  3P8T A;  3CD6 Q;  1W4S A;  1W1F A;  1NBE B;  3RER A;  1JJ2 P;  4LD9 K;  4C0D C;  4HVU A;  4Z88 A;  1I4K 1;  1C6V X;  2QYZ A;  2YWW A;  2ZAE A;  3EGD A;  3HFO A;  4YRL A;  4BI4 A;  2XGT A;  2CZ1 B;  3OSV A;  5J26 A;  1VQ5 Q;  4XTU A;  1OUL A;  1W6X A;  2BUD A;  2RF0 A;  2CZ6 B;  2DZC A;  2BZ8 A;  3D7S B;  2RHI A;  2EAY A;  4TVR A;  4ME7 A;  3QPH A;  2LNH B;  3R07 A;  2ZZD A;  4JDS A;  1R77 A;  2J05 A;  4E2F B;  2RI3 A;  2L3R A;  3RES A;  1WFW A;  1WHG A;  3CMA T;  2DL4 A;  5KYX A;  1C0A A;  1X6B A;  3HFN A;  3CC4 Q;  1M1K C;  3OYA A;  3QDR B;  3JCM X;  2LQ8 A;  3QXE B;  2SRC A;  1MMD A;  2F2X A;  3A8M B;  4LDX A;  2M16 A;  2RI2 A;  1OI1 A;  2YHT A;  5GAN d;  2BTT A;  2E10 A;  3NEL A;  2MPX C;  1AHJ B;  4HWT A;  4M77 A;  4C5I A;  1LVK A;  1EIF A;  3JCM W;  3VS3 A;  5D6W A;  5GAM f;  1VQM T;  2A8E A;  3RGL A;  2QQR A;  2EPD A;  1UG1 A;  4BAC A;  4KUD K;  5CKF A;  2NUP A;  3HPW A;  4LUE A;  4N4H A;  2WAC A;  2BIV A;  2VB6 A;  1LOJ A;  1TUG B;  4EO4 A;  3R6N A;  1EIY A;  5LJ3 d;  3WVE B;  4C8Q D;  1YIJ Q;  1Y96 A;  1IRE B;  1MMA A;  4J6Y A;  1VIE A;  4TTV A;  3QWY A;  3LW5 E;  4JJB A;  3RIR A;  1Y57 A;  3QUI A;  2DFU A;  2EQI A;  4BD3 A;  3JRZ A;  3JB9 G;  3EFO B;  1QF6 A;  4LDV A;  2E3I A;  2EYQ A;  2KRM A;  1EOV A;  5CAI A;  2EFI A;  3M4Y A;  1CKA A;  3I9Q A;  4RQE A;  1Q82 C;  5LJ5 j;  1YI2 T;  4IUQ A;  1S72 Q;  3ZBD A;  4ANJ A;  2ZR2 A;  1M1F A;  3HTR A;  2NUT A;  5GAN 6;  2KY9 A;  3M4G A;  2YRC A;  1W2B A;  3BJU A;  4YRK A;  3HHT B;  4LVM A;  4J6W A;  3FJP A;  2EKO A;  4LVL A;  2FYK A;  1NZ9 A;  4MZT A;  5ECA A;  3OYM A;  4HT9 A;  2E41 A;  2HMA A;  4KUL A;  1K9M C;  5C52 B;  1V29 B;  2R5M A;  1E6H A;  4F7U E;  4P73 C;  3V8L A;  4J7F A;  3SEM A;  2DET A;  1U3O A;  3HL8 A;  3MCA B;  4EMK C;  4J6X A;  1QQJ A;  3CPW P;  2KXC A;  2FG0 A;  1W70 A;  3M58 A;  12AS A;  3A8G B;  1QCO A;  2XDP A;  4PKC C;  2ZIO A;  4Q5W A;  1VQ7 A;  3RKX A;  1UB4 A;  3EGU A;  2E3C A;  3UFG A;  3CXC A;  3MET A;  4ZGE B;  3A7U A;  1SRY A;  2VUB A;  1W66 A;  2E5K A;  3O8V A;  4H2X B;  3X24 B;  4RG8 A;  5GMK j;  3EGX A;  5GAM j;  5GAM g;  5D6Y A;  3O5Z A;  2C8M A;  3RL6 A;  1B34 B;  5LJ5 f;  4M78 F;  4QW2 A;  1G83 A;  4L6V 5;  5KE3 A;  3QJY A;  3JCM g;  4N4G A;  1VQN Q;  4AG1 C;  1MND A;  9ATC B;  3SWN B;  2VXE A;  2K5I A;  1E6G A;  3NTH A;  2OTJ A;  4JZ4 A;  2DQ0 A;  4E51 A;  4XAX B;  4M7A D;  2JN0 A;  5C51 B;  3CCM Q;  4KH0 B;  3CCR A;  2KRO A;  2DLP A;  3HY0 A;  4AG2 C;  1JEG A;  2CDT A;  3E9I A;  2XDB A;  2HQX A;  1Q82 U;  2RM4 A;  2AT1 B;  5GAN h;  4OB2 B;  1I5O B;  3OYL A;  4HWO A;  2X4J A;  5GAN g;  2X3W D;  4YYE A;  2KI7 A;  2LX7 A;  1NJI C;  1H3H A;  5GAN f;  4TQD A;  4E7L A;  4N0A A;  5C53 B;  1D1B A;  4TWA A;  4PJN A;  5CKE A;  2XG8 D;  3VRZ A;  3TCJ A;  5LJ3 h;  1OV3 A;  2I4N A;  4LN2 A;  1JJC B;  3CC2 Q;  5GAN 7;  1YJW T;  3VBB A;  4BY6 C;  5FWC A;  2QA4 T;  1XQH A;  4FL6 A;  4JJN K;  1SSF A;  3LWI A;  3PMT A;  1YJN T;  4BI8 B;  1TU0 B;  1AWJ A;  2K3X A;  3CCL T;  3CCU Q;  4O2D A;  2LJ3 A;  3CQT A;  2EJF A;  4XTY A;  5ELN A;  3UAT A;  2OTL T;  3PCO A;  2IPO B;  1YBY A;  2PTK A;  1NEG A;  3INZ A;  4RKU E;  2KYM A;  1UTI A;  1S1N A;  1X2G A;  2X51 A;  2HSE B;  3JCM e;  2DL7 A;  4AMC A;  3RNJ A;  2AK5 A;  3J80 E;  4NL3 A;  4AFS C;  1RUW A;  4Y91 A;  2OX7 A;  3EFS A;  1MMN A;  2DXB A;  2RJF A;  1JB0 E;  3FC3 A;  4F04 B;  2J3M A;  2RHU A;  2IVW A;  4X9D A;  3V7S A;  4E47 A;  3ZFJ A;  1AOJ A;  3RKY A;  3OBY A;  5GMK m;  4RQF A;  2K9G A;  2QXF A;  3SHW A;  4M77 C;  3BE3 A;  5L8R E;  1YJ9 A;  1TTH B;  2O31 A;  1RAE B;  4PL6 A;  2P5I A;  4JLG A;  2HCK A;  1QKW A;  2QI2 A;  4X9C A;  1PRL C;  2VC8 A;  5IHN A;  1QVF A;  3VS5 A;  4IUT A;  1KFZ A;  3V8K A;  5A0G A;  1VQ4 Q;  2BE9 B;  4JRK A;  1NLP C;  1YJN A;  1WI7 A;  5KYY A;  2CSI A;  1M90 U;  1NJ1 A;  3HRU A;  2DPP B;  2FPF A;  3A8O B;  3OB9 A;  1RLQ C;  4R0K A;  1OX9 A;  1ADJ A;  1YFS A;  4Z8A A;  1UE9 A;  3CCU A;  4XU2 A;  4M78 A;  4JS4 A;  3VQW A;  1VQZ A;  1WHJ A;  1Q95 G;  2RHQ B;  2VXF A;  4QQD A;  2DL5 A;  1M27 C;  3CCE A;  3GPL A;  2ZT8 A;  4JRP A;  3PZC A;  3OYY A;  3M9Q A;  1VQ9 Q;  3CD6 A;  5J3B A;  3SDZ A;  4PJO D;  1VQN A;  3E9G A;  4JS5 A;  4OB0 B;  4P72 C;  1KD1 U;  1SHG A;  2XID A;  1GRI A;  2ZPF B;  4HVV A;  2K2M A;  5CIU A;  4M7A C;  3TEH A;  1WA7 A;  3G4S A;  5I21 A;  1ZSZ B;  2DEQ A;  2EWN A;  5KYW A;  4P3P A;  4GLM A;  2YRV A;  3HRI A;  1D0Y A;  4IIO A;  4M75 G;  2CJA A;  1WXU A;  3MEV A;  3CPW A;  1D3B A;  2LQW A;  2HQH A;  3VUB A;  3OY9 A;  2LT1 A;  1OYX A;  3M5A A;  2MCN A;  3CC4 A;  2FZC B;  4PLI A;  1N8R C;  3W3S A;  4PLL A;  4EMH A;  1GXI E;  1WPY A;  5GMK l;  2P4R A;  1JXM A;  4PJL A;  2DU5 A;  1YGB A;  1BKB A;  2AMC A;  1HYO A;  5HK3 A;  4A63 B;  4R55 A;  3VQY A;  2BZX A;  3VQV A;  2O4X B;  1WLP B;  1BI1 A;  2DU7 A;  1I5L A;  1KQS P;  3CCV T;  5M9O A;  1K9M R;  4AFU C;  2JS0 A;  1WZO A;  4BDZ A;  1AT1 B;  2HL3 A;  4C92 B;  2K6D A;  1NG2 A;  1TH7 A;  5GAO l;  4PFZ A;  4A4H A;  3E19 A;  1WXB A;  1MV3 A;  1QE0 A;  2L3S A;  2XMF A;  3REX A;  4ZGD B;  1OZ2 A;  1C1A A;  1Q7Y C;  1VQ8 A;  2A3L A;  2EQM A;  2GFA A;  3HXV A;  1X43 A;  2EQJ A;  1M2O A;  2YUQ A;  4XTV A;  3H6Z A;  3CCJ T;  2CP2 A;  3CCM A;  3JB9 J;  3NTI A;  2QEX T;  1K73 R;  4RG2 A;  2BKD N;  2XI9 A;  3ZEH A;  3UWN A;  1M8V A;  1E24 A;  2E5A A;  2Q7H A;  4HWR A;  2RA2 A;  4XU1 A;  1KD1 R;  1K73 C;  1BK2 A;  3OYI A;  1VQK T;  4IUV A;  3C0C A;  1G2B A;  1ASY A;  1OEB A;  2JW4 A;  1QVF S;  1M30 A;  1SRM A;  4IKF A;  2QTX A;  2GNC A;  2A7Y A;  2MAM A;  2RHY A;  2D1X A;  1YJ9 Q;  3C95 A;  2JMA A;  3VJP A;  3JCM f;  2DMO A;  5LJ3 e;  2W10 A;  1VQP A;  1Q7Y R;  4YRE A;  1NE8 A;  4TVW A;  3EAE A;  2EYX A;  3CC7 A;  4O5V A;  2CIM A;  2FHD A;  2JNG A;  3TEH B;  1KJW A;  4QVZ A;  1T3S A;  2PVD B;  1IHW A;  4RTY A;  3M54 A;  1H4T A;  4R56 A;  2ZZF A;  3G6E Q;  4M7D D;  1Z9Q A;  2RK1 A;  2JTE A;  4Z02 A;  3CCL Q;  3CCU T;  8ATC B;  5FW9 A;  1YWP A;  5KCH A;  3H0I A;  1PHT A;  4H2T A;  4DOW A;  3OS0 A;  2D9T A;  3E9H A;  2X4X A;  3OW2 A;  4H2S A;  1Y0M A;  2ENM A;  2DD4 A;  3JB9 H;  1E22 A;  2K3Y A;  2Y4Y A;  3CMQ A;  1M3B A;  1YFR A;  4QVD A;  1G5H A;  1W2B S;  3DSQ A;  1EVL A;  4K87 A;  3P8Y A;  4BY6 B;  3CCS Q;  5FRM A;  4WTO B;  2LQN A;  4ZIB A;  4OMN A;  2JTF A;  2LMJ A;  4MDW A;  2E1H A;  3RUX A;  4CC4 B;  1HTT A;  1GGM A;  3N5B B;  2D8J A;  2KK4 A;  2RQU A;  2E3H A;  2ZT6 A;  2RN8 A;  4PHC A;  1UGS B;  3SFM A;  4PJO B;  3CCS T;  5KYX B;  2COY A;  3A98 A;  3MP1 A;  4KH1 B;  5HK0 A;  1VUB A;  3KUF A;  3GF5 A;  1U1T A;  4CC3 A;  1M90 C;  1WNL A;  1MHN A;  2DX1 A;  5I2M A;  3X25 B;  5GMK h;  1YIT Q;  2G6F X;  2NUZ A;  5L23 A;  4RTW A;  5HY6 A;  5LJ3 f;  1X2Q A;  2MMP A;  2AIR B;  3GIB A;  3FRN A;  4P3N A;  3JSC A;  1OU8 A;  4ESR A;  3EG0 A;  1Q7Y U;  1RAF B;  4C5E A;  1ZQ1 A;  4KGV B;  1Q86 U;  1XNI A;  3QYH B;  4QQ6 A;  3CXC P;  3A74 A;  4C92 E;  2VWF A;  2P0K A;  11AS A;  2ZPE B;  4F14 A;  3QKJ A;  1XTD A;  4FSS A;  2DBK A;  1EFW A;  4KQE A;  1YI2 Q;  1M90 R;  1ABO A;  4E7I A;  4C8Q B;  1GCQ C;  2O2O A;  4GY5 A;  3CME A;  1D09 B;  3JV3 A;  2J3L A;  4H2X A;  2KXD A;  3V7C A;  2DQ3 A;  4KR3 A;  2CGH A;  4LVK A;  3C94 A;  1WYD A;  2DXC A;  1RAI B;  3DLL A;  2EGC A;  1PKS A;  2QHU A;  5GAN 8;  2L5Q A;  2MOX A;  4M78 B;  5FRN A;  2AMC B;  1B34 A;  2KRS A;  2V1R A;  4UP7 A;  1E1O A;  2E64 A;  5GAO m;  1EX4 A;  3BFM A;  1KSW A;  1S72 T;  5KYU B;  4AFQ C;  2NLU A;  3TEG A;  1WQW A;  1UFF A;  2ZPH B;  4AH6 A;  4J9B A;  2QHS A;  2QQS A;  3EHR A;  4ZTU B;  2OTJ T;  1FX7 A;  4D8K A;  4FYW B;  3URG A;  2P4T A;  3EH2 A;  1LPL A;  3L42 A;  2C0I A;  2KDS A;  1ZBJ A;  1ADY A;  4J9F A;  3OMG A;  1K8A R;  1M5Q 1;  4V2S A;  1K8A U;  1H4V B;  2GQV A;  3PT9 A;  1YFN A;  3EG9 A;  1K8A C;  3QO5 A;  1AWX A;  3G71 A;  2ZCE A;  1M2V B;  1O9S A;  3H41 A;  3OW2 P;  2PVG B;  1ZUU A;  2EW3 A;  2M51 A;  4DOV A;  4B9X A;  2DNU A;  3CBP A;  3L2Q A;  3KXT A;  3A5Y A;  3CBM A;  1JU5 C;  3MF2 A;  3OYC A;  5KYU A;  2QQ9 A;  4ZTJ A;  3HRS A;  2QDL A;  2V8J A;  2MWO A;  1X2K A;  2FZG B;  2FVU A;  2RHS B;  3ASK A;  3I56 T;  2JM9 A;  5J39 A;  2DVE A;  1D0X A;  2YLB A;  2ZT5 A;  1RAD B;  2K3B A;  1X55 A;  2DVJ A;  4HCK A;  1ZA1 B;  3HXU A;  3A7A A;  1EIY B;  4JUV A;  2DAQ A;  4LXC A;  3LX7 A;  1N8R U;  1UJY A;  3OQ5 A;  2LC4 A;  3MP8 A;  3MF1 A;  3CD6 T;  2DRM A;  4OGE A;  1JRI A;  2ED0 A;  1AWO A;  2QGG A;  2P84 A;  2RH2 A;  3E9F A;  2CUD A;  3QO7 A;  4PJO E;  4LVJ A;  1IRX A;  5A0D A;  2EIF A;  3DB4 A;  4M77 B;  1TG0 A;  1QP3 A;  5DLO A;  1TOV A;  2VVK A;  4EX5 A;  4CRI A;  1VQ5 T;  1KC8 C;  4M7D C;  3MEW A;  4QVC A;  2XK0 A;  3I35 A;  3UH0 A;  1K4U S;  4OMM A;  3CCQ A;  4EMK A;  3MHX A;  3L2V A;  2ED1 A;  2FRW A;  2LTO A;  2XHC A;  3A8H B;  3M0Q A;  4M7A E;  1SF9 A;  2E12 A;  3CC7 Q;  5HKC A;  1FMK A;  1FMV A;  3MJX A;  3UA6 A;  2LDM A;  2EGE A;  2EKH A;  1QP2 A;  1KK7 A;  5IAY A;  3NET A;  4LVI A;  5LJ3 g;  1PRM C;  5F5W A;  1QWF A;  4C0Z A;  4E7K A;  3UF4 A;  2ATC B;  1OX8 A;  1USY C;  4XU0 A;  5HCK A;  1D1A A;  2OTJ Q;  4RDX A;  4P5N A;  4HKE A;  1PYS A;  5KCO A;  2FB7 A;  2KBT A;  3MEU A;  4C8Q E;  1P92 A;  4FIB A;  3LC0 A;  5LJ5 d;  3FEO A;  2R57 A;  4J8O A;  4RTZ A;  1YHQ T;  1YJN Q;  2A37 A;  4P3O A;  2ZCF B;  4WCI A;  2CJB A;  3DB3 A;  1VQ8 T;  2HQE A;  3HRK A;  1AEY A;  2NUP B;  3VS0 A;  4YRG A;  1M8M A;  4P73 A;  1E7O A;  4PFP A;  2XTI A;  1Y07 A;  3HSB A;  4M7A A;  1GCP A;  3M0R A;  3UGQ A;  2RQT A;  4LDW A;  2FO0 A;  4P72 A;  2XU8 A;  3I5S A;  3QZ9 B;  4C92 D;  4G85 A;  1PM3 A;  1UGV A;  2E5Q A;  3OS5 A;  5IHK A;  2COZ A;  3QSU A;  5C0M A;  4HVW A;  1TUD A;  4OMF B;  3OA6 A;  2DO3 A;  2P0L A;  2W0Z A;  4DBR A;  1WJS A;  1OQK A;  5KYW B;  1X6O A;  4P74 A;  4A4F A;  4M78 C;  4ELZ C;  3A1P A;  3P8H A;  1GCQ A;  3JCM V;  2ZT7 A;  2GGR A;  2QA4 A;  1H64 1;  3HFZ B;  2OTL Q;  4RMF A;  1UGR B;  4JRQ A;  1KHC A;  2GQI A;  1ZUK A;  2B86 A;  4UP9 A;  4J9H A;  2X4Y A;  1IZ6 A;  1T0H A;  1EVK A;  3EGX B;  3GOX A;  1B07 A;  1UEC A;  2Y4X A;  2RO0 A;  1RAH B;  3JCM d;  1TXQ A;  5CKH A;  4QQG A;  3G71 Q;  2DF6 A;  1VIF A;  2A28 A;  3X20 B;  3L4G A;  2K7A A;  1R0C B;  2F2V A;  3G6E T;  5GJV B;  5GAN 2;  4CS3 A;  2I4L A;  1Q86 R;  2CH4 A;  4MZM A;  2EYW A;  4OVA A;  2XDD A;  5FU7 C;  3NEN A;  3E1S A;  1Z9Z A;  3OBW A;  4A4K A;  3QNE A;  4ZN1 A;  4BDY A;  1PSF A;  1MV0 B;  4HWP A;  4BW9 A;  1YJ9 T;  1PKT A;  2A36 A;  3TU4 K;  1BU1 A;  3BW1 A;  4J9D A;  8AT1 B;  4AFZ C;  2ROL A;  2CRE A;  1OOT A;  1ZSZ A;  1YB3 A;  4YRJ A;  2QDY B;  1EZZ B;  2VV5 A;  4EDU A;  3RBB B;  1OU9 A;  1B7Y B;  3NTK A;  5CKD A;  3WQZ A;  4HCZ A;  2RJE A;  5IXF A;  1B7T A;  2A0F B;  1M1G A;  4GLK A;  4IUR A;  1M3A A;  2NWM A;  1Y96 B;  2D6F A;  3HXX A;  2O9S A;  1KD1 C;  4HXJ A;  4J83 A;  4RUG A;  1CSK A;  3ULR B;  2PZ1 A;  1VQP T;  2L3P A;  3S3M A;  4KBM B;  3OYH A;  3H9N A;  1G51 A;  1Q82 R;  1QKX A;  3UPU A;  3VKI A;  2DJQ A;  2ARU A;  3RAC A;  2CUB A;  1JXO A;  3VV0 A;  4YCU A;  1AWW A;  3ME9 A;  2Q7E A;  2ZNJ A;  2RHZ A;  4N0A C;  2DIQ A;  5GAM d;  1UDL A;  4RCC A;  2ZXF A;  4UPA A;  4F16 A;  1QVG A;  5LJ5 h;  2CP3 A;  2DYB A;  2D8H A;  2F69 A;  1VQO T;  1VQ6 T;  3HTZ A;  3FJ5 A;  2DK3 A;  2NS6 A;  2RHQ A;  1MMG A;  3RDV A;  1FYN A;  2CP5 A;  3MPU B;  1KQS S;  2CYZ B;  1LJO A;  4L59 A;  4DA4 A;  2CP7 A;  3IKL A;  3KFV A;  1D3B B;  3OYD A;  3CCJ A;  3GP8 A;  3CMA A;  4X34 A;  1WHL A;  3Q1J A;  4ZNX A;  4KGZ B;  1BIA A;  2L3Q A;  5FU6 B;  3M0S A;  1K9M U;  1WHM A;  4M7A G;  5CKB A;  2AKK A;  3M4P A;  1MNE A;  3I5R A;  2CJ9 A;  2LJ1 A;  2B8A A;  5D7U A;  4LUD A;  1YP5 A;  1I1J A;  2AKW B;  4LNS A;  3HXW A;  4XEO A;  2GTJ A;  3IQL A;  3T9N A;  2QTV A;  3KFU A;  1VQL Q;  1B76 A;  2K2V A;  1WDX A;  5FRO A;  2MIO A;  2J6K A;  4XK8 E;  2KR3 A;  3HFZ A;  1I0C A;  4OB3 B;  2QG9 B;  3R6O A;  1PWT A;  2EJ9 A;  1BYM A;  1VYT A;  4HA8 A;  1VQM Q;  3NGP A;  5FU7 B;  3OYB A;  5EC7 A;  3LSS A;  4C0D B;  1BIB A;  2ZPI B;  4EPC A;  2LCC A;  1KC8 R;  4FYY B;  1EFN A;  4J9G A;  3F70 A;  2RHS A;  1VYV A;  2GF7 A;  1N6A A;  5CO7 A;  2HDA A;  1N9R A;  2RHX A;  2LZ6 B;  1I07 A;  2ZIN A;  2PMF A;  3PMI A;  1F1B B;  3NMZ C;  3CCE T;  2XIC A;  4J7I A;  2IY5 B;  2KSS A;  1M1K U;  1JJ2 S;  4K88 A;  3VU3 C;  1W2B P;  4F17 A;  3PIP A;  1WJQ A;  2LRQ A;  4XEM A;  1LNX A;  4PJO F;  1RL2 A;  1YIT A;  3SWN A;  3M0P A;  1BB9 A;  2FEI A;  2DIG A;  4DBH A;  3L4G B;  3QDF A;  1SER A;  4CH5 A;  4C92 F;  2LQK A;  3QII A;  4M78 G;  5I22 A;  1VQO Q;  1VQ6 Q;  5GAO q;  1NM7 A;  4M7A B;  1G5I A;  4CS2 A;  1V76 A;  4D6W A;  3HFV A;  4Z89 A;  4CC7 A;  1ABQ A;  2ODR C;  2M1H A;  1GBR A;  1OZ3 A;  2HBW A;  3CCQ Q;  1UEB A;  3OYK A;  2DDZ A;  3L1A A;  1BI3 A;  5A2Q E;  4HVC A;  2QEX Q;  1CKB A;  4LD6 A;  3CPF A;  1ZX6 A;  2JT4 A;  3MQZ A;  2M9U A;  1SG5 A;  1VQ4 T;  1BBW A;  5KH6 A;  1FWZ A;  3ICA A;  4BE2 A;  2DEU A;  1X01 A;  1ZSG A;  4D8D A;  1Y7X A;  4MZP A;  3OD1 A;  3QJ6 A;  3JCM Q;  4H2V A;  2OAW A;  1VQ8 Q;  2ZGW A;  3LGF A;  1B70 B;  2PUO B;  4KUI A;  4YRS A;  2DER A;  1WXT A;  4HCC A;  4PFO A;  2I4O A;  1SET A;  2ODR D;  4TVA A;  1U8R A;  3J81 E;  3FB9 A;  2ROT A;  1SHF A;  3CXC S;  3EG9 B;  4M75 D;  3H8Z A;  4BUG A;  2HL5 C;  5GMK i;  4RTX A;  5ELO A;  2WSC E;  5CCA A;  3MP6 A;  2C0O A;  3VS2 A;  1YJW A;  4IUP A;  2VGN A;  4M75 B;  3ER0 A;  1WYX A;  3JCM c;  1IB8 A;  2YUP A;  4DBQ A;  4RTU A;  3WXM B;  1X56 A;  3SD4 A;  5IXB A;  1WHK A;  2I4M A;  4PJO G;  1NLO C;  3NEM A;  4GBQ A;  1R0B G;  4DEX A;  5DY9 A;  1M1K R;  3EG1 A;  5GAO r;  2ZPB B;  3C4S A;  4HT4 A;  1HC7 A;  2DRK A;  1NEB A;  1YCY A;  2FL7 A;  2K57 A;  3EH1 A;  2JS2 A;  3LH0 A;  4WI1 A;  5GAO n;  3HXY A;  2AKW A;  1R8O B;  1NYF A;  2PUK B;  4X5O A;  2M0Y A;  4FYX B;  4MDX A;  5CQY A;  4FW2 A;  4CH6 A;  3TEE A;  4PG3 A;  3QTC A;  4RMO A;  5GAN j;  3CC2 T;  2QK0 A;  4O6J A;  1FMW A;  1K73 U;  4FT2 A;  1YNZ A;  3A31 A;  4E7S A;  3VYG A;  1AZG B;  5CQX A;  2L0A A;  3VS6 A;  3PVL A;  1SSH A;  2E65 A;  4A53 A;  2O4X A;  2K5F A;  5K1X A;  5FU6 C;  2CT4 A;  1Q86 C;  3E2U A;  5LJ3 j;  2KEA A;  2EYY A;  2YDL A;  4C92 G;  4L87 A;  3REB B;  4XTW A;  1Q81 R;  3OYG A;  5DM7 R;  4NS5 A;  3WVD B;  3REU A;  3OW2 S;  3JB9 D;  1WU7 A;  1IHV A;  6AT1 B;  2QAZ A;  3G4S Q;  2VGM A;  3QYG B;  1VQ7 T;  2HNI A;  5AT1 B;  1H4S A;  3REA B;  4FU6 A;  3GLX A;  5AYF A;  1JO8 A;  2C0T A;  4PJO A;  4JLI A;  3CCJ Q;  1YCS B;  2IIM A;  1PSE A;  3M0U A;  4ELY C;  1JQQ A;  2ZTG A;  5IN1 A;  1B7Y A;  3CME Q;  1G3S A;  1KQ2 A;  2M0O A;  2KNB B;  1K76 A;  4K11 A;  1HD3 A;  1E1T A;  4B6M A;  2EL9 A;  3IAL A;  3VQX A;  4BWA A;  1VQP Q;  2DE0 X;  2DIL A;  2KQW A;  3M4Q A;  4HCB A;  4KR2 A;  2JTM A;  1N9S A;  4OMO A;  2EBP A;  1RAC B;  2YT6 A;  2PU9 B;  1PCX A;  1KG1 A;  4C92 C;  2DD5 A;  4RCB A;  2PVO B;  4M75 F;  3RF1 A;  4CH3 A;  2ESW A;  1VQ7 Q;  1YN8 A;  2DL3 A;  2Y90 A;  5I2S A;  3CC7 T;  3EG3 A;  3G4S T;  3RMQ A;  1VQK Q;  2HBP A;  2DBM A;  2WSF E;  2QHT A;  2SEM A;  4HT8 A;  2DXU A;  2OI3 A;  2ZR3 A;  4UC4 A;  4H2W A;  3OMC A;  3QBY A;  4ZGJ B;  5GMK e;  2J6O A;  4HWS A;  2PQW A;  3RMS A;  2CH4 W;  2L89 A;  2DXT A;  2ALY A;  1XOV A;  4YRI A;  1VQ9 A;  3QZ5 B;  2JUF A;  4OP0 A;  1JBM A;  4LDU A;  1KQ1 A;  3A5Z A;  2HSP A;  4F7U F;  5K1P A;  1UGQ B;  2ALY B;  1NJ8 A;  3BY7 A;  2VYT A;  1KC8 U;  1MGQ A;  4CI0 C;  1BBZ A;  2CSQ A;  3TUP A;  2D0N A;  1K1Z A;  1Q81 U;  3G71 T;  4E7Z A;  4P75 A;  1K9A A;  4E7J A;  4DBF A;  3OSS C;  2GFU A;  4C8Q C;  3TSZ A;  2BZY A;  1HK9 A;  1KMN A;  3PTA A;  3OYE A;  1XJW B;  4KT0 E;  2QA4 Q;  2DJZ A;  3QO8 A;  1I8F A;  2A08 A;  3CEY A;  3M0T A;  1YJW Q;  1X54 A;  1N27 A;  3G1J A;  2CP0 A;  1ZHI A;  2LX9 A;  2V1Q A;  7AT1 B;  5I11 A;  2I0N A;  1IL2 A;  5EG2 A;  1SEM A;  2KYB A;  2HEQ A;  2MF2 A;  4OGC A;  2EGA A;  2QAS A;  3I56 Q;  3LH5 A;  1D1C A;  1PD1 A;  4ZN3 A;  1VQ9 T;  1J3T A;  4YPF A;  1BI2 A;  3DLM A;  4PJM A;  4TVY A;  3I55 T;  1ZUY A;  4JJD A;  2JZ2 A;  2VAS A;  2I2L A;  1RIQ A;  2AZV A;  2R58 A;  3HP9 A;  2VKN A;  5CVI A;  3I55 A;  1QMC A;  1NYQ A;  1UGP B;  3CCL A;  5LJ5 e;  4C5G A;  3A8L B;  4KRT A;  3L2U A;  2X35 A;  1QVP A;  2Q5H A;  5GAN 3;  3RR6 A;  2MK5 A;  3MEA A;  4JPB W;  2YXY A;  4J5Y A;  2H3J A;  5D6X A;  3OS1 A;  3DKM A;  1H4Q A;  1ATI A;  3VS4 A;  4E6R A;  2G4C A;  4BI3 A;  4RTT A;  3HRT A;  1TUC A;  2X4W A;  4EIK A;  2ARS A;  4M7D F;  2L2P A;  3CMA Q;  3M57 A;  4II1 A;  4A4E A;  2EYZ A;  2MI6 A;  2JMC A;  2KGT A;  2XKO C;  3QHS A;  1FXX A;  1ZA2 B;  1USY A;  2XD0 A;  2EVR A;  3VS1 A;  4FM4 B;  4F7U G;  3LYI A;  4JRI A;  1GFD A;  4C92 A;  2K4Y A;  4WF2 A;  4P75 C;  4EMK B;  1RAA B;  4KGX B;  1QCF A;  2E4H A;  2FRY A;  2HKN A;  5IT9 E;  1PNJ A;  1GBQ A;  1VYU A;  3EGD B;  5KYY B;  4YRN A;  4M7D B;  4PNO A;  3QG1 A;  3JAM E;  3QO3 A;  2KT8 A;  3M53 A;  2LCS A;  3BDU A;  2GTO A;  4YDQ A;  3CCR Q;  2BE7 D;  4PK4 A;  2DZ9 A;  1IGQ A;  5GAO p;  1U06 A;  2E6Z A;  3GNF B;  4YCV A;  2AKL A;  3L2W A;  4ZTF A;  2O88 A;  3MKD A;  4UP8 A;  1VQO A;  1VQ6 A;  3H0F A;  4YRR A;  1PD0 A;  3SB2 A;  4CS4 A;  2DYI A;  2RQR A;  4FW1 A;  3A7R A;  4C8Q G;  2HAX A;  1NYR A;  1Z7N A;  4MMK A;  2RI5 A;  1RI0 A;  2M02 A;  3U23 A;  1BBU A;  1NJ2 A;  2E6N A;  2EQK A;  4OMQ A;  1PG5 B;  3JB9 I;  4K86 A;  1PC0 A;  1H3Z A;  4YRT A;  1NYG A;  1KHI A;  3FLG A;  1YWO A;  2F1L A;  3CCQ T;  1UHF A;  4ZTZ B;  4LDY A;  3CC2 A;  2D0Q B;  3L2Z A;  1YIT T;  4J9I A;  3S3O A;  1VQK A;  4H2U A;  4RTV A;  1VQ5 A;  1YHQ A;  4A54 A;  1C0M A;  2V26 A;  1K0X A;  2NYS A;  1G5V A;  3PE0 A;  4F7U A;  3CCV Q;  5LL6 S;  1H8K A;  2E70 A;  2AZS A;  4QKU A;  2V8K A;  1UHC A;  2P0P A;  4OLF A;  1Y71 A;  1YIJ T;  3H0H A;  2DL8 A;  2O9V A;  2RQW A;  3GNG A;  2R5A A;  1IXD A;  2IG0 A;  2YUO A;  3VRY A;  4XTX A;  4ORZ A;  1TS9 A;  3VUZ A;  3PVQ A;  2GBQ A;  3M59 A;  2F2W A;  3I7F A;  1M9S A;  2YRD A;  5DLQ E;  1I81 A;  3JCM J;  2CZ7 B;  2L8D A;  3GBQ A;  5FLX E;  2CZ0 B;  4X1V A;  1J5W A;  3V8J A;  2EJG A;  4M7D G;  2CT3 A;  1SPK A;  1QCN A;  2C06 A;  5GAM h;  1PYS B;  5CR2 A;  1Q81 C;  2DTI A;  2HKQ B;  1NNH A;  4Y92 A;  1OPL A;  2CKK A;  1DJ7 B;  4M7A F;  3P8B B;  3P8D A;  1QVG S;  1TSF A;  5GAM e;  1YIJ A;  2DTH A;  3G6E A;  4NOY A;  1WX6 A;  2QGF B;  2FPE A;  3FIF A;  5HGQ A;  3V7R A;  1QVF P;  4TVA B;  3OYJ A;  4ATO A;  2DTO A;  2ZPG B;  5A0L A;  1AD5 A;  4NL2 A;  3I55 Q;  2LNV A;  5GAN 4;  3IG2 A;  5KE2 A;  2KVQ G;  1VQ4 A;  4G84 A;  1ZSZ C;  3NPF A;  4M78 D;  4M77 E;  3THK A;  4FYV B;  4M4Z A;  3VYH B;  2ZNI A;  2X9H A;  4JJC A;  1RAG B;  2RB6 A;  5FWB A;  1ZBX A;  2IY5 A;  1YI2 A;  4WJ4 A;  4LNP A;  2RPN A;  2KE9 A;  2RK2 A;  1NJ6 A;  2WSE E;  3FDR A;  3HKS A;  2RD1 A;  1NPP A;  1KMM A;  1GFC A;  1LYL A;  5CK9 A;  3LWH A;  2ECZ A;  3MO8 A;  1VQL T;  4M77 G;  3CCV A;  4BB7 A;  1T3L A;  1FYF A;  3X26 B;  1B70 A;  4YP0 A;  4H02 A;  1M4Z A;  1VQN T;  1KOG A;  3CME T;  1G3W A;  3L2R A;  3HY1 A;  4IUU A;  4Q15 A;  2K79 A;  4J15 A;  3UT1 A;  5GJW B;  2LCL A;  3P8V A;  2J6F A;  4DQ2 A;  2C7I A;  2H8H A;  1HJD A;  4QT7 A;  2KT1 A;  4YRF A;  1EQR A;  1UJ0 A;  1D0Z A;  2ABL A;  3JCM h;  4F7U B;  4XTZ A;  1X2H A;  3AT1 B;  3VS7 A;  2JJ9 A;  2PME A;  4CC2 A;  1SKU B;  1H92 A;  2YSQ A;  1QWE A;  3LLR A;  3TSW A;  4WJ3 M;  4L5G A;  4N4I A;  4TQF A;  4M77 D;  4M78 E;  4EMG A;  1NJ5 A;  2COW A;  1MUZ A;  2LT4 A;  1VOM A;  1RLP C;  4M77 F;  3QWX X;  3M55 A;  3IKM B;  1BCM A;  2F5K A;  1RAB B;  2NUT B;  3MEY A;  4YTL A;  4DPG A;  2RJD A;  4P74 C;  2RQV A;  4JZ3 A;  4XQ3 A;  4H2Y A;  3A32 A;  1KIK A;  4OF1 A;  4C8Q A;  2JXB A;  2Q5I A;  2JOY A;  2H3E B;  2FZK B;  3TVT A;  3OS2 A;  1VQL A;  5LJ5 g;  1V1C A;  2J06 A;  5KNN A;  2OAU A;  2EQU A;  3UGT A;  1JJ2 A;  1WJR A;  3OYN A;  3HXZ A;  2AHJ B;  4IIM A;  3J7A F;  1Z7M A;  3JCM b;  4MML A;  4BE0 A;  3JCM P;  3BDL A;  1JJC A; 
#chains in the Genus database with same CATH homology
 3SWN C;  2ZZG A;  3CC4 T;  2G3R A;  3PFS A;  1WLE A;  1G3Y A;  4M75 A;  1U1S A;  2YLC A;  3G1Z A;  4YCW A;  5GAN 5;  2QQA A;  3CCS A;  3KBG A;  4YRP A;  2KAF A;  2F5T X;  2CS7 A;  4Y28 E;  1HXD A;  4P71 C;  4OB1 B;  1B8A A;  4XU3 A;  4FT4 A;  3AHU A;  1SES A;  3RKW A;  4A4G A;  2O01 E;  2OTL A;  2KMT A;  3LSQ A;  3CBO A;  1QW1 A;  2QQB A;  2RJC A;  3A5Z B;  3I56 A;  4NCX A;  4BE1 A;  4M7D A;  3CCM T;  1VQM A;  1WQ7 A;  2LVM A;  1BI0 A;  1WGS A;  2ART A;  1NJI U;  5C6S A;  4CH4 A;  4PJO C;  1NPR A;  4C5H A;  4YRC A;  1S72 A;  1YFT A;  3NFC A;  4YRM A;  4C0F A;  4FSX A;  3G7Z A;  2HD0 A;  1O75 A;  3CCR T;  5GAN e;  2ZIM A;  2QHV A;  4M75 E;  4P71 A;  4M7D E;  3OYF A;  4YRQ A;  1L0W A;  3TRE A;  2JVV A;  2P0Q A;  2MWP A;  4M75 C;  1G3T A;  3UDC A;  4Q6G A;  3X28 B;  3JB9 F;  4E7H A;  4VUB A;  1N9W A;  1X75 C;  3S6W A;  2DKG A;  3EFR A;  4C0G A;  5E3I A;  2ZZE A;  2V8I A;  3LGL A;  3PCO B;  3C12 A;  4B9W A;  3CPW S;  1KQS A;  2QEX A;  2GCX A;  1ASZ A;  3PIO A;  4YRO A;  3PNW C;  3S3N A;  2Q7G A;  3PGG A;  3M56 A;  3ERR A;  2K5L A;  3P8T A;  4C8Q F;  1W4S A;  3RER A;  4LD9 K;  4C0D C;  1I4K 1;  4YRL A;  3HFO A;  4BI4 A;  2XGT A;  2CZ1 B;  3OSV A;  5J26 A;  4XTU A;  2BUD A;  2CZ6 B;  2DZC A;  2RHI A;  2EAY A;  4TVR A;  4ME7 A;  3QPH A;  3R07 A;  2ZZD A;  4JDS A;  2RI3 A;  2L3R A;  3RES A;  3CMA T;  1C0A A;  3HFN A;  1M1K C;  3OYA A;  3QDR B;  3JCM X;  2LQ8 A;  3QXE B;  3A8M B;  4LDX A;  2M16 A;  2RI2 A;  1OI1 A;  2YHT A;  5GAN d;  2E10 A;  3NEL A;  1AHJ B;  4HWT A;  4M77 A;  4C5I A;  1EIF A;  3JCM W;  5D6W A;  5GAM f;  1VQM T;  2A8E A;  3RGL A;  2QQR A;  4BAC A;  4KUD K;  5CKF A;  3HPW A;  4N4H A;  2WAC A;  2BIV A;  1LOJ A;  4EO4 A;  1EIY A;  5LJ3 d;  3WVE B;  4C8Q D;  1Y96 A;  1IRE B;  4J6Y A;  1VIE A;  4TTV A;  3LW5 E;  3RIR A;  3QUI A;  4BD3 A;  3JRZ A;  3JB9 G;  1QF6 A;  4LDV A;  2EYQ A;  1EOV A;  5CAI A;  2EFI A;  3M4Y A;  4RQE A;  1Q82 C;  5LJ5 j;  1YI2 T;  4IUQ A;  3ZBD A;  2ZR2 A;  1M1F A;  5GAN 6;  2KY9 A;  3M4G A;  1W2B A;  3BJU A;  4YRK A;  3HHT B;  4LVM A;  4J6W A;  3FJP A;  2EKO A;  4LVL A;  2FYK A;  1NZ9 A;  4MZT A;  3OYM A;  4HT9 A;  2E41 A;  4KUL A;  1K9M C;  5C52 B;  1V29 B;  2R5M A;  4F7U E;  4P73 C;  3V8L A;  4J7F A;  3HL8 A;  3MCA B;  4EMK C;  4J6X A;  3M58 A;  12AS A;  3A8G B;  2XDP A;  4PKC C;  2ZIO A;  4Q5W A;  1VQ7 A;  3RKX A;  1UB4 A;  2E3C A;  3UFG A;  3CXC A;  3MET A;  4ZGE B;  3A7U A;  1SRY A;  2VUB A;  1W66 A;  3O8V A;  4H2X B;  3X24 B;  4RG8 A;  5GMK j;  5GAM j;  5GAM g;  5D6Y A;  2C8M A;  3RL6 A;  1B34 B;  5LJ5 f;  4M78 F;  4QW2 A;  4L6V 5;  5KE3 A;  3QJY A;  4N4G A;  3JCM g;  3SWN B;  2VXE A;  2K5I A;  3NTH A;  2OTJ A;  2DQ0 A;  4E51 A;  4XAX B;  4M7A D;  2JN0 A;  5C51 B;  3CCR A;  3HY0 A;  3E9I A;  2XDB A;  2HQX A;  1Q82 U;  2RM4 A;  5GAN h;  4OB2 B;  3OYL A;  4HWO A;  2X4J A;  5GAN g;  4YYE A;  1NJI C;  5GAN f;  4TQD A;  4E7L A;  4N0A A;  5C53 B;  4TWA A;  5CKE A;  2XG8 D;  3TCJ A;  5LJ3 h;  2I4N A;  1JJC B;  5GAN 7;  1YJW T;  3VBB A;  4BY6 C;  2QA4 T;  1XQH A;  4FL6 A;  4JJN K;  1SSF A;  3LWI A;  3PMT A;  1YJN T;  4BI8 B;  2K3X A;  3CCL T;  4O2D A;  2EJF A;  4XTY A;  5ELN A;  2OTL T;  3PCO A;  1YBY A;  3INZ A;  4RKU E;  1X2G A;  3JCM e;  3J80 E;  4NL3 A;  4Y91 A;  3EFS A;  2DXB A;  2RJF A;  1JB0 E;  3FC3 A;  2J3M A;  2RHU A;  2IVW A;  4X9D A;  3V7S A;  4E47 A;  3ZFJ A;  3RKY A;  3OBY A;  5GMK m;  4RQF A;  2QXF A;  4M77 C;  5L8R E;  1YJ9 A;  4PL6 A;  2P5I A;  4JLG A;  2QI2 A;  4X9C A;  2VC8 A;  1QVF A;  4IUT A;  3V8K A;  5A0G A;  4JRK A;  1YJN A;  1M90 U;  1NJ1 A;  3HRU A;  2DPP B;  3A8O B;  3OB9 A;  1ADJ A;  1YFS A;  3CCU A;  4XU2 A;  4M78 A;  4JS4 A;  3VQW A;  1VQZ A;  2RHQ B;  2VXF A;  4QQD A;  3CCE A;  3GPL A;  2ZT8 A;  4JRP A;  3PZC A;  3OYY A;  3M9Q A;  3CD6 A;  5J3B A;  3SDZ A;  4PJO D;  1VQN A;  3E9G A;  4JS5 A;  4OB0 B;  4P72 C;  1KD1 U;  2ZPF B;  2XID A;  5CIU A;  4M7A C;  3TEH A;  3G4S A;  5I21 A;  2DEQ A;  2EWN A;  4P3P A;  2YRV A;  3HRI A;  4M75 G;  2CJA A;  3MEV A;  3CPW A;  1D3B A;  3VUB A;  3OY9 A;  2LT1 A;  1OYX A;  3M5A A;  3CC4 A;  4PLI A;  1N8R C;  3W3S A;  4PLL A;  4EMH A;  1GXI E;  1WPY A;  5GMK l;  2DU5 A;  1YGB A;  1BKB A;  2AMC A;  5HK3 A;  4R55 A;  3VQY A;  3VQV A;  2O4X B;  1BI1 A;  2DU7 A;  1I5L A;  3CCV T;  5M9O A;  4BDZ A;  4C92 B;  1TH7 A;  5GAO l;  4A4H A;  3E19 A;  1QE0 A;  3REX A;  4ZGD B;  1OZ2 A;  1Q7Y C;  1VQ8 A;  2A3L A;  2EQM A;  2GFA A;  3HXV A;  2EQJ A;  4XTV A;  3H6Z A;  3CCJ T;  3CCM A;  3JB9 J;  3NTI A;  2QEX T;  4RG2 A;  2BKD N;  2XI9 A;  3ZEH A;  3UWN A;  1M8V A;  1E24 A;  2E5A A;  2Q7H A;  4HWR A;  2RA2 A;  4XU1 A;  1K73 C;  3OYI A;  1VQK T;  4IUV A;  1ASY A;  1QVF S;  4IKF A;  2QTX A;  2MAM A;  2A7Y A;  2RHY A;  3C95 A;  3VJP A;  3JCM f;  5LJ3 e;  4YRE A;  1VQP A;  1NE8 A;  4TVW A;  3EAE A;  3CC7 A;  4O5V A;  2CIM A;  2FHD A;  2JNG A;  3TEH B;  4QVZ A;  2PVD B;  3M54 A;  1H4T A;  4R56 A;  2ZZF A;  4M7D D;  2RK1 A;  4Z02 A;  3CCU T;  5KCH A;  4H2T A;  4DOW A;  3OS0 A;  2D9T A;  3E9H A;  2X4X A;  3OW2 A;  4H2S A;  2DD4 A;  3JB9 H;  1E22 A;  2K3Y A;  2Y4Y A;  3CMQ A;  1YFR A;  4QVD A;  1G5H A;  1W2B S;  3DSQ A;  1EVL A;  4K87 A;  3P8Y A;  4BY6 B;  5FRM A;  4ZIB A;  2JTF A;  4MDW A;  2E1H A;  3RUX A;  1HTT A;  1GGM A;  3N5B B;  2KK4 A;  2ZT6 A;  4PHC A;  1UGS B;  3SFM A;  4PJO B;  3CCS T;  3MP1 A;  5HK0 A;  1VUB A;  3KUF A;  3GF5 A;  1U1T A;  1M90 C;  1WNL A;  1MHN A;  5I2M A;  5GMK h;  3X25 B;  5HY6 A;  5LJ3 f;  2MMP A;  3GIB A;  4P3N A;  3FRN A;  3JSC A;  1Q7Y U;  4C5E A;  1ZQ1 A;  1Q86 U;  1XNI A;  3QYH B;  4QQ6 A;  3A74 A;  4C92 E;  2P0K A;  11AS A;  2ZPE B;  3QKJ A;  1XTD A;  1EFW A;  4KQE A;  4E7I A;  4C8Q B;  4GY5 A;  3CME A;  2J3L A;  4H2X A;  3V7C A;  2DQ3 A;  4KR3 A;  2CGH A;  4LVK A;  3C94 A;  1WYD A;  2DXC A;  3DLL A;  2QHU A;  5GAN 8;  2L5Q A;  4M78 B;  5FRN A;  2AMC B;  1B34 A;  4UP7 A;  1E1O A;  2E64 A;  5GAO m;  3BFM A;  1S72 T;  2NLU A;  3TEG A;  1WQW A;  2ZPH B;  4AH6 A;  2QHS A;  2QQS A;  4ZTU B;  2OTJ T;  1FX7 A;  3URG A;  2P4T A;  3L42 A;  2KDS A;  1ADY A;  3OMG A;  1M5Q 1;  4V2S A;  1K8A U;  1H4V B;  2GQV A;  3PT9 A;  1K8A C;  3QO5 A;  3G71 A;  2ZCE A;  1O9S A;  2PVG B;  4DOV A;  4B9X A;  3CBP A;  3L2Q A;  3KXT A;  3A5Y A;  3CBM A;  3MF2 A;  3OYC A;  2QQ9 A;  4ZTJ A;  3HRS A;  2V8J A;  2MWO A;  2FVU A;  2RHS B;  3ASK A;  3I56 T;  5J39 A;  2DVE A;  2YLB A;  2ZT5 A;  1X55 A;  3HXU A;  3A7A A;  1EIY B;  4JUV A;  2DAQ A;  3LX7 A;  1N8R U;  3OQ5 A;  2LC4 A;  3MP8 A;  3MF1 A;  3CD6 T;  4OGE A;  1JRI A;  3E9F A;  2RH2 A;  3QO7 A;  4PJO E;  4LVJ A;  5A0D A;  2EIF A;  3DB4 A;  4M77 B;  1QP3 A;  5DLO A;  4EX5 A;  4CRI A;  1VQ5 T;  1KC8 C;  4M7D C;  3MEW A;  4QVC A;  2XK0 A;  3UH0 A;  3CCQ A;  4EMK A;  3MHX A;  3L2V A;  2LTO A;  2XHC A;  3A8H B;  4M7A E;  2E12 A;  5HKC A;  2LDM A;  1QP2 A;  3NET A;  5IAY A;  4LVI A;  5LJ3 g;  5F5W A;  4C0Z A;  4E7K A;  1USY C;  4XU0 A;  4RDX A;  4P5N A;  4HKE A;  1PYS A;  5KCO A;  2FB7 A;  3MEU A;  4C8Q E;  1P92 A;  4FIB A;  3LC0 A;  5LJ5 d;  3FEO A;  2R57 A;  4J8O A;  1YHQ T;  4P3O A;  2ZCF B;  2CJB A;  3DB3 A;  1VQ8 T;  2HQE A;  3HRK A;  4YRG A;  4P73 A;  2XTI A;  1Y07 A;  3HSB A;  4M7A A;  3UGQ A;  4LDW A;  4P72 A;  4YCV A;  2XU8 A;  4C92 D;  3QZ9 B;  4G85 A;  3OS5 A;  2E5Q A;  3QSU A;  5C0M A;  4OMF B;  3OA6 A;  2DO3 A;  2P0L A;  1WJS A;  1X6O A;  4P74 A;  4A4F A;  4M78 C;  4ELZ C;  3P8H A;  3JCM V;  2ZT7 A;  2QA4 A;  1H64 1;  3HFZ B;  4RMF A;  1UGR B;  4JRQ A;  1KHC A;  4UP9 A;  2X4Y A;  1IZ6 A;  1EVK A;  3GOX A;  2Y4X A;  2RO0 A;  3JCM d;  5CKH A;  4QQG A;  3X20 B;  1VIF A;  3L4G A;  3G6E T;  5GAN 2;  4CS3 A;  2I4L A;  4MZM A;  4OVA A;  2XDD A;  5FU7 C;  3NEN A;  3E1S A;  3OBW A;  4A4K A;  3QNE A;  4ZN1 A;  4BDY A;  1PSF A;  4HWP A;  4BW9 A;  1YJ9 T;  3TU4 K;  3BW1 A;  1YB3 A;  4YRJ A;  2QDY B;  2VV5 A;  4EDU A;  1B7Y B;  3NTK A;  5CKD A;  3WQZ A;  4HCZ A;  2RJE A;  1M1G A;  4GLK A;  4IUR A;  2D6F A;  1Y96 B;  3HXX A;  1KD1 C;  4J83 A;  1VQP T;  3S3M A;  4KBM B;  3OYH A;  1G51 A;  3UPU A;  3VKI A;  2ARU A;  3RAC A;  3VV0 A;  4YCU A;  3ME9 A;  2Q7E A;  2ZNJ A;  2RHZ A;  4N0A C;  2DIQ A;  5GAM d;  4RCC A;  2ZXF A;  4UPA A;  1QVG A;  5LJ5 h;  1VQO T;  2F69 A;  1VQ6 T;  3HTZ A;  2DK3 A;  2NS6 A;  2RHQ A;  1KQS S;  2CYZ B;  1LJO A;  4L59 A;  4DA4 A;  3IKL A;  1D3B B;  3OYD A;  3CCJ A;  3GP8 A;  3CMA A;  4X34 A;  3Q1J A;  1BIA A;  5FU6 B;  1K9M U;  4M7A G;  5CKB A;  3M4P A;  2CJ9 A;  2B8A A;  2AKW B;  4LNS A;  3HXW A;  4XEO A;  3T9N A;  3KFU A;  1B76 A;  2K2V A;  5FRO A;  4XK8 E;  3HFZ A;  4OB3 B;  3R6O A;  2EJ9 A;  1BYM A;  4HA8 A;  5FU7 B;  3OYB A;  3LSS A;  4C0D B;  1BIB A;  2ZPI B;  4EPC A;  2LCC A;  3F70 A;  2RHS A;  2GF7 A;  1N6A A;  5CO7 A;  1N9R A;  2RHX A;  2ZIN A;  2PMF A;  3PMI A;  3CCE T;  2XIC A;  4J7I A;  2IY5 B;  2KSS A;  1M1K U;  1JJ2 S;  4K88 A;  3VU3 C;  3PIP A;  1WJQ A;  2LRQ A;  4XEM A;  1LNX A;  4PJO F;  1RL2 A;  1YIT A;  3SWN A;  2DIG A;  3L4G B;  1SER A;  4CH5 A;  4C92 F;  2LQK A;  3QII A;  4M78 G;  5GAO q;  4M7A B;  1G5I A;  4CS2 A;  4D6W A;  3HFV A;  2ODR C;  2M1H A;  1OZ3 A;  1UEB A;  3OYK A;  2DDZ A;  3L1A A;  1BI3 A;  5A2Q E;  4HVC A;  4LD6 A;  3CPF A;  3MQZ A;  2M9U A;  1VQ4 T;  1BBW A;  5KH6 A;  1FWZ A;  3ICA A;  4BE2 A;  1X01 A;  1Y7X A;  4MZP A;  3OD1 A;  3QJ6 A;  3JCM Q;  4H2V A;  2ZGW A;  3LGF A;  1B70 B;  2PUO B;  4KUI A;  4YRS A;  4HCC A;  2I4O A;  1SET A;  4TVA A;  2ODR D;  1U8R A;  3J81 E;  3FB9 A;  3CXC S;  4M75 D;  3H8Z A;  4BUG A;  5GMK i;  5ELO A;  2WSC E;  5CCA A;  3MP6 A;  1YJW A;  4IUP A;  2VGN A;  4M75 B;  3ER0 A;  3JCM c;  3WXM B;  1X56 A;  3SD4 A;  2I4M A;  4PJO G;  3NEM A;  5DY9 A;  5GAO r;  2ZPB B;  3C4S A;  4HT4 A;  1HC7 A;  1YCY A;  2FL7 A;  2K57 A;  4WI1 A;  3LH0 A;  5GAO n;  3HXY A;  2AKW A;  1R8O B;  2PUK B;  4X5O A;  4MDX A;  5CQY A;  4CH6 A;  3TEE A;  4PG3 A;  3QTC A;  4RMO A;  5GAN j;  3CC2 T;  4O6J A;  1K73 U;  3A31 A;  4FT2 A;  3VYG A;  5CQX A;  2E65 A;  4A53 A;  2O4X A;  2K5F A;  5K1X A;  5FU6 C;  1Q86 C;  5LJ3 j;  4C92 G;  4L87 A;  4XTW A;  3OYG A;  5DM7 R;  4NS5 A;  3WVD B;  3REU A;  3OW2 S;  3JB9 D;  1WU7 A;  2VGM A;  3QYG B;  1VQ7 T;  2HNI A;  1H4S A;  4FU6 A;  3GLX A;  5AYF A;  4PJO A;  4JLI A;  1PSE A;  4ELY C;  2ZTG A;  5IN1 A;  1B7Y A;  1G3S A;  1KQ2 A;  2M0O A;  1E1T A;  2EL9 A;  3IAL A;  3VQX A;  4BWA A;  2KQW A;  4KR2 A;  3M4Q A;  4HCB A;  2JTM A;  1N9S A;  2PU9 B;  1KG1 A;  4C92 C;  2DD5 A;  4RCB A;  2PVO B;  4M75 F;  3RF1 A;  4CH3 A;  2Y90 A;  5I2S A;  3CC7 T;  3G4S T;  3RMQ A;  2HBP A;  2WSF E;  2QHT A;  4HT8 A;  2DXU A;  2ZR3 A;  4H2W A;  4UC4 A;  3OMC A;  3QBY A;  4ZGJ B;  5GMK e;  4HWS A;  2PQW A;  3RMS A;  2L89 A;  2DXT A;  2ALY A;  1XOV A;  4YRI A;  1VQ9 A;  3QZ5 B;  2JUF A;  4OP0 A;  1JBM A;  4LDU A;  1KQ1 A;  3A5Z A;  4F7U F;  5K1P A;  1UGQ B;  2ALY B;  1NJ8 A;  3BY7 A;  2VYT A;  1KC8 U;  1MGQ A;  4CI0 C;  3TUP A;  1Q81 U;  3G71 T;  4P75 A;  4E7J A;  3OSS C;  2GFU A;  4C8Q C;  1KMN A;  1HK9 A;  3PTA A;  3OYE A;  4KT0 E;  2DJZ A;  3QO8 A;  1I8F A;  3CEY A;  1X54 A;  1N27 A;  1ZHI A;  2LX9 A;  1IL2 A;  5EG2 A;  2MF2 A;  4OGC A;  1VQ9 T;  4ZN3 A;  4YPF A;  1BI2 A;  3DLM A;  4TVY A;  3I55 T;  2JZ2 A;  2I2L A;  1RIQ A;  2R58 A;  3HP9 A;  5CVI A;  3I55 A;  1NYQ A;  1UGP B;  3CCL A;  5LJ5 e;  4C5G A;  3A8L B;  3L2U A;  2X35 A;  1QVP A;  2Q5H A;  5GAN 3;  3MEA A;  4J5Y A;  2H3J A;  5D6X A;  3OS1 A;  3DKM A;  1H4Q A;  1ATI A;  2G4C A;  4BI3 A;  3HRT A;  2X4W A;  2ARS A;  4M7D F;  3M57 A;  4II1 A;  4A4E A;  2MI6 A;  2XKO C;  3QHS A;  1FXX A;  1USY A;  2XD0 A;  4FM4 B;  4F7U G;  3LYI A;  4JRI A;  4C92 A;  2K4Y A;  4WF2 A;  4P75 C;  4EMK B;  5IT9 E;  4YRN A;  4M7D B;  4PNO A;  3QG1 A;  3JAM E;  3QO3 A;  3M53 A;  3BDU A;  4YDQ A;  2DZ9 A;  5GAO p;  2E6Z A;  3GNF B;  3L2W A;  4ZTF A;  4UP8 A;  1VQO A;  1VQ6 A;  4YRR A;  3SB2 A;  4CS4 A;  3A7R A;  4C8Q G;  2HAX A;  1NYR A;  1Z7N A;  4MMK A;  2RI5 A;  1RI0 A;  1BBU A;  1NJ2 A;  2E6N A;  2EQK A;  3JB9 I;  4K86 A;  1H3Z A;  4YRT A;  1KHI A;  3FLG A;  3CCQ T;  4ZTZ B;  4LDY A;  3CC2 A;  2D0Q B;  3L2Z A;  1YIT T;  3S3O A;  1VQK A;  4H2U A;  1VQ5 A;  1YHQ A;  4A54 A;  1G5V A;  4F7U A;  5LL6 S;  2E70 A;  2V8K A;  2P0P A;  4OLF A;  1Y71 A;  1YIJ T;  3GNG A;  2R5A A;  2IG0 A;  4XTX A;  3VUZ A;  3M59 A;  3I7F A;  1M9S A;  5DLQ E;  1I81 A;  3JCM J;  2CZ7 B;  2L8D A;  5FLX E;  2CZ0 B;  1J5W A;  3V8J A;  2EJG A;  4M7D G;  2C06 A;  5GAM h;  1PYS B;  5CR2 A;  1Q81 C;  2DTI A;  1NNH A;  2CKK A;  1DJ7 B;  4M7A F;  3P8B B;  3P8D A;  1QVG S;  5GAM e;  1YIJ A;  2DTH A;  3G6E A;  4NOY A;  3FIF A;  5HGQ A;  3V7R A;  4TVA B;  3OYJ A;  4ATO A;  2DTO A;  2ZPG B;  5A0L A;  4NL2 A;  2LNV A;  5GAN 4;  3IG2 A;  4G84 A;  2KVQ G;  5KE2 A;  1VQ4 A;  4M78 D;  4M77 E;  3VYH B;  2ZNI A;  2RB6 A;  1ZBX A;  2IY5 A;  1YI2 A;  4WJ4 A;  2RK2 A;  1NJ6 A;  2WSE E;  3FDR A;  3HKS A;  2RD1 A;  1NPP A;  1KMM A;  1LYL A;  5CK9 A;  3LWH A;  3MO8 A;  1VQL T;  4M77 G;  3CCV A;  4BB7 A;  1FYF A;  3X26 B;  1B70 A;  4YP0 A;  4H02 A;  1M4Z A;  1VQN T;  1KOG A;  3CME T;  1G3W A;  3L2R A;  3HY1 A;  4IUU A;  4Q15 A;  4J15 A;  3UT1 A;  2LCL A;  3P8V A;  4DQ2 A;  2C7I A;  4YRF A;  1EQR A;  3JCM h;  4F7U B;  4XTZ A;  1X2H A;  2PME A;  3LLR A;  4WJ3 M;  4L5G A;  4N4I A;  4TQF A;  4M77 D;  4M78 E;  4EMG A;  1NJ5 A;  2LT4 A;  4M77 F;  3M55 A;  3IKM B;  2F5K A;  3MEY A;  4DPG A;  4YTL A;  2RJD A;  4P74 C;  4XQ3 A;  4H2Y A;  3A32 A;  4OF1 A;  4C8Q A;  2Q5I A;  2JOY A;  3OS2 A;  1VQL A;  5LJ5 g;  5KNN A;  2OAU A;  2EQU A;  3UGT A;  1JJ2 A;  3HXZ A;  1WJR A;  3OYN A;  2AHJ B;  3J7A F;  1Z7M A;  3JCM b;  4MML A;  4BE0 A;  3JCM P;  3BDL A;  1JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...