1X01A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with atp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2005-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1x01A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1x01A01
4DPGA 1KMNA 2EJGA 4XQ3A 1SERA 2ZT5A 4HT8A 1JJCA 5DY9A 3INZA 4P73C 1EOVA 4H2YA 3JCMd 1NJ5A 3RERA 4P71A 5GMKe 4CS3A 3A7RA 4XTUA 3JB9J 3JCMh 4TVYA 4H2XB 4C8QE 1HXDA 4M7DD 3VU3C 1E1TA 4C8QF 4TVAB 4BWAA 3A74A 4YRTA 4M7DG 3V7SA 2CIMA 5LJ5f 2K57A 2DTHA 3I7FA 4UPAA 2E41A 2EJFA 4M7DC 4RDXA 4JRKA 5GANd 3RKWA 4F7UA 5LJ3j 4JUVA 4E51A 1NYRA 1GGMA 3NENA 1X54A 1KMMA 3HRKA 1I4K1 1BIBA 3QHSA 5I21A 3MF1A 4TVWA 2CJ9A 2ZCEA 4F7UE 1ATIA 4PJOB 1NJ1A 5ELOA 4J6YA 4YRNA 2ARUA 2EAYA 3LC0A 5C53B 4QVDA 4EMHA 1B7YB 4M75B 1I5LA 2AKWB 4G85A 4M7AC 2ARSA 4C92C 3JCMg 2DZCA 5GAOp 4M78A 4H02A 3VQVA 3QO3A 3PGGA 3JCMQ 3ICAA 4O2DA 1I8FA 1M5Q1 3ERRA 3VQYA 1D3BA 1SETA 3A7AA 4HWSA 4M7AA 1SESA 4C92A 4YPFA 1HTTA 4L87A 3WQZA 3V8JA 4PHCA 1LOJA 3V8KA 5F5WA 4YRIA 4PJOD 4P75A 1Z7NA 3JB9H 2AMCB 5LJ5j 4M77A 4MMLA 2RM4A 5GANg 4PJOG 4J15A 3E9IA 1E22A 3TEHA 2PMFA 4M75D 2DTIA 4QVCA 4PJOC 4P3PA 3BFMA 4UP7A 3JCMW 2DZ9A 4C8QB 2QHUA 4M77E 2DJZA 4EMKC 3JB9G 1H4TA 1YFSA 4RCCA 4CH4A 5GAMj 2EWNA 4J5YA 1X2GA 2YLCA 4PJOF 3QSUA 3QO8A 1Y96B 3P8TA 1QE0A 1U1SA 1G51A 2RHQB 3JB9I 3JCMf 4YCVA 4M75F 4P74C 5GMKi 3W3SA 4EMKA 4H2TA 4YCWA 3VQXA 1C0AA 4XEMA 5GAMe 1B70B 2ZT7A 3NETA 4G84A 4H2WA 3RKXA 1J5WA 4H2VA 4X9CA 3L4GB 4XU2A 3BW1A 1VQZA 2ZTGA 5GAN8 4C8QD 3G1ZA 1EVKA 3QUIA 3SWNB 2ZIMA 4UP9A 3MF2A 2I2LA 2RD1A 3JCMV 4C8QG 5GANf 1JRIA 2CJBA 3HXUA 4P72C 3QNEA 2RHSB 3HFOA 4A53A 4P3NA 1RIQA 4C8QC 3LSSA 4WJ3M 1N9WA 3M4PA 3RIRA 1G5IA 5K1XA 3KFUA 4TWAA 1PYSA 5GMKm 5GAN4 2XGTA 2DVEA 2QTXA 4DQ2A 2I4NA 2ZZEA 4YRCA 2E10A 4CH6A 4P73A 1B34A 1HK9A 1USYC 2FB7A 2Q7GA 5LJ3h 1X56A 3MEYA 3GIBA 12ASA 4HWOA 2PMEA 1E24A 1IL2A 2RA2A 4YRGA 3PCOA 2DU5A 1N9RA 1KOGA 4NL2A 4Y91A 2ZNIA 1EFWA 2C8MA 3SWNC 1ASZA 4YRMA 2ODRD 4AH6A 2XTIA 2I4MA 4XTVA 1NJ8A 1H4SA 1TH7A 4M7DA 4YRJA 3E9HA 1ASYA 2DQ0A 4RMFA 4F7UF 4HA8A 3V7CA 2ALYA 3L2ZA 5LJ3e 4YP0A 2ODRC 1YB3A 2EJ9A 2DXUA 4XTYA 2C7IA 4PG3A 5GANj 1X55A 3L1AA 3HTZA 4HT9A 4X9DA 2CGHA 2DEQA 3HXWA 5KNNA 4HWPA 3VQWA 3JCMX 3BDUA 3FB9A 2IY5B 1WYDA 3HFVA 2ZR3A 2ARTA 2DDZA 5CAIA 4ZTUB 4M78E 3HFZB 4H2XA 3M4GA 4M77D 5LJ5d 4M78F 1M8VA 4NCXA 5LJ5h 2QHTA 4Q6GA 4TVAA 1NJ2A 3P8VA 5C51B 4M7AE 3EFRA 1WU7A 3FIFA 4C92E 1L0WA 1NJ6A 2DTOA 2DXTA 2ZZGA 1EIYB 2ZT6A 1E1OA 4YRKA 4M75G 5GAMd 1HC7A 1JJCB 1N9SA 5GAMh 4M75C 4WF2A 3HXYA 4PNOA 4M77F 1ADYA 1WQWA 1WNLA 5LJ5e 2I4OA 4NOYA 1U1TA 4K87A 4PJOA 1WLEA 3UGTA 2QHVA 3HSBA 3REUA 4P3OA 5GAOm 2ZZFA 4OLFA 4HVCA 1X01A 3JCMJ 1B7YA 4M75A 1H4QA 3JCMb 3JCMc 3V7RA 2AKWA 2RB6A 1QF6A 2Q7HA 4XEOA 2CJAA 2Y90A 3UH0A 3AHUA 2ZT8A 2ZR2A 4KR3A 4UP8A 4F7UB 4XTWA 3TUPA 3OD1A 4YRSA 5GAN5 5GAOn 4P74A 3RESA 4K88A 5LJ5g 4YCUA 1LYLA 2I4LA 3A5YA 4ZIBA 4ZTZB 4CH5A 5GMKj 4MMKA 4KQEA 1EVLA 2AMCA 4J6WA 4RQFA 4P71C 4RCBA 3R07A 5GAMg 3TEGA 4YRPA 4TQDA 1H641 4YRLA 2Q5HA 4P72A 3IALA 4H2SA 4M78B 3QTCA 4EMGA 2Q5IA 5HGQA 2YHTA 4H2UA 3RL6A 4C8QA 4NL3A 1X2HA 3NELA 4N0AC 4KR2A 5LJ3d 1W66A 4EO4A 2J3LA 1D3BB 4F7UG 4M7AB 3P8YA 4WJ4A 4C92B 3M4QA 1B76A 1Y96A 3A5ZA 4XTZA 2RHQA 4HWRA 4CS2A 5GAOq 3PZCA 4M77B 1YFRA 3HRIA 4N0AA 3SB2A 1USYA 3RKYA 3TEHB 2Q7EA 1LJOA 3LSQA 3UFGA 5GAOl 1SRYA 3QO7A 4YROA 4CS4A 1B70A 4YDQA 1KQ2A 1FYFA 3JCMP 1BIAA 4CH3A 4RQEA 3JCMe 3L4GA 4M78D 4BW9A 5GANh 2HNIA 5GAN2 3CMQA 4M7DE 3V8LA 3SWNA 1YGBA 4M78G 1NYQA 4TQFA 2QHSA 4J6XA 4M7DF 5GAMf 2ZINA 5GAN3 2DU7A 4M7AD 5E3IA 4M78C 4C92D 2RHSA 5GAOr 4JRIA 4Q15A 3FJPA 1YFTA 4M7AG 3VBBA 4EMKB 2VXEA 4C92G 2J3MA 3BY7A 5GAN6 5GANe 5LJ3g 5GAN7 4M77G 1JBMA 3RACA 4YRFA 4XU1A 1G5HA 4P75C 5GMKl 3IKMB 4M77C 1BBUA 4M7AF 2ZXFA 4C92F 3IKLA 1KQ1A 2ZIOA 4XU0A 3HXZA 3RUXA 3DSQA 2JN0A 11ASA 5K1PA 4K86A 2VC8A 2ZGWA 3RGLA 2E64A 1WPYA 3RF1A 1PYSB 4V2SA 2FYKA 3HY1A 1MGQA 4LNSA 4WI1A 3JB9D 4JLIA 4YYEA 2ZNJA 2YLBA 2P5IA 4XU3A 4HWTA 1H4VB 3HXXA 1B34B 2G4CA 3NEMA 4TTVA 4PJOE 4YRQA 3UGQA 2EL9A 5ELNA 1WQ7A 4X5OA 1BBWA 1YCYA 2P0LA 4OP0A 5C52B 4M75E 1EQRA 4EX5A 5LJ3f 3PCOB 1ADJA 2IY5A 2E3CA 1NNHA 3EFSA 3IG2A 1B8AA 4YRRA 3A32A 3JB9F 3HY0A 4YREA 4M7DB 3HFZA 2E1HA 4A54A 5GMKh 3QO5A 1LNXA 2ALYB 2E5AA 3A7UA 3BJUA 1I81A 2E65A 2DKGA 3A31A 4XTXA 1Z7MA 2DQ3A 3REXA 3HFNA 2VXFA 3HXVA 1EIYA
chains in the Genus database with same CATH superfamily
1VQOT 7AT1B 4DPGA 1KMNA 4XQ3A 1ZBXA 1SERA 3KBGA 1QKWA 4HT8A 1JJCA 4P73C 3CPWS 4H2YA 3JCMd 1NJ5A 5GMKe 3CC2T 3X24B 1D1CA 4XTUA 4TVYA 2J6KA 2FL7A 1TUGB 2K2VA 2OI3A 3M56A 2KK4A 2ESWA 4JDSA 2QGFB 3DB3A 4TVAB 2DA9A 3IQLA 1YITT 3I7FA 2JS2A 4UPAA 1QCFA 1NJIU 1PD1A 1KSWA 4ZN3A 1IGUA 3G4SQ 1GGMA 5FU6C 4BB7A 2CP6A 2DJQA 2FZKB 2HQEA 1JJ2S 4TVWA 4EPCA 4AFZC 3MF1A 1QCOA 2P0KA 5KE2A 2JM9A 4F7UE 4PJOB 1QP2A 2KGTA 4PJJA 5ELOA 4J6YA 1K9MR 3UDCA 3X20B 1T3SA 4K11A 3OS0A 2X4XA 4AFUC 3JRZA 2RJDA 3CCSA 1G83A 1I5LA 2X3WD 3VS1A 4G85A 3RBBB 4C92C 2X9HA 2LT1A 4RTUA 1EFNA 5IAYA 4R56A 3JCMg 5FWCA 5FRNA 1WA7A 2ROLA 3CCJQ 2X4JA 3PGGA 4LNPA 3ICAA 2VUBA 2K9GA 1VQMQ 1SESA 2LJ3A 2K5IA 4C92A 3LWIA 3LYIA 3HP9A 2V8IA 2JT4A 4YRIA 2KR3A 3MHXA 4PJOD 4KGZB 2C06A 4BI3A 2K3XA 2RM4A 2GTOA 1U06A 4FYWB 1GBRA 1V76A 4QW2A 1BCOA 3CCVT 1KC8C 2P84A 4UP7A 4Y92A 1YFSA 4RCCA 4CH4A 2EWNA 4PJOF 3CXCA 2KYBA 4FSXA 3QZ9B 2HSPA 1QKXA 1OOTA 3C12A 1QE0A 1VYUA 3JB9I 4P74C 4H2TA 2CZ7B 4PFOA 2YWWA 1ABOA 1VQKA 3MEAA 1KQSS 3QJYA 3NETA 4JZ3A 4G84A 3RKXA 1J5WA 3EGDB 1E6HA 1VQ6A 2EFIA 1HYOA 4E6RA 1ZUYA 1FMWA 3QUIA 1AZGB 2ZIMA 1MNDA 3MF2A 4JS4A 4UP9A 2RD1A 2G3RA 5FW9A 2CJBA 3HXUA 4P72C 3QNEA 5KE3A 2PU9B 3HFOA 4P3NA 2BZYA 2CP2A 1N9WA 1PC0A 2LJ1A 1TXQA 1TUDA 5GMKm 2XGTA 3HRSA 1MMAA 2QTXA 5KYWA 1YJWQ 2DYBA 2K2MA 3CCRT 2L89A 2YUQA 4E7KA 2EYZA 3META 4JZ4A 4P5NA 2FB7A 1WDXA 1NBEB 1M3AA 5LJ3h 2MIOA 1N8RC 3GIBA 5HK0A 2RHIA 2PMEA 4JRQA 4OMLA 4J9BA 4YRGA 3PCOA 2DU5A 1N9RA 1WXBA 3PVLA 3LH0A 2C8MA 2MI6A 4YRMA 1R8OB 1H4SA 1M90C 4YRJA 1PHTA 4HA8A 3G6ET 2L2PA 3V7CA 2ALYA 2PVGB 5CQXA 2F5TX 2COWA 4FIBA 1YB3A 1P92A 3G1JA 2M0OA 1X55A 2F1LA 3HTZA 4Z88A 5IH2A 4HCCA 1N27A 1SKUB 3VQWA 2RH2A 4OMNA 3PFSA 3CBMA 1MMNA 2M9UA 2RK1A 4CC7A 3UPUA 2ZR3A 4D6WA 5CAIA 1TTHB 3HTRA 1BKBA 2D9TA 3HFZB 1R0CB 4M77D 4LN2A 2J6FA 1M8VA 5LJ5h 4TVAA 4M7AE 2FPEA 3CMAQ 2YUOA 3PVQA 3CC7Q 2YT6A 4L5GA 1EIYB 3OMGA 2F2XA 2F5KA 1UJYA 4E7JA 1TSFA 1G3TA 2DNUA 1ZX6A 1YHQT 1I0CA 3OMCA 5HKCA 3HXYA 1VQLQ 4M77F 1WNLA 5IHNA 3EHRA 3CC4T 4NOYA 2M51A 4K87A 4PJOA 3I5SA 5GAOm 2KYMA 4OLFA 2XI9A 2J05A 2RJCA 2DFUA 2LDMA 1BB9A 2GQVA 1K73U 2K3YA 1QW1A 2XDPA 1AHJB 3EH2A 3TREA 2O4XB 2V8KA 2RJFA 1K9AA 5GAN5 2QA4Q 3RESA 2OJ2A 1MNEA 3CCQA 2EYYA 1Q86U 2ZPFB 2IVWA 1IRXA 4HCBA 1T0HA 4C0DB 1JXOA 4MMKA 3AT1B 4RCBA 2RQVA 5AYFA 3R07A 2X3XD 4IUUA 1YJNQ 1VQ5A 4YRPA 1UG1A 1OEBA 2LC4A 2RNAA 1M1KR 3I56T 5KYYB 4BE0A 2Q5HA 2DD5A 4M78B 2QK0A 1X6OA 1WJQA 1VA7A 4X1VA 3CCMQ 5HGQA 1FYNA 4NL3A 1X2HA 1NEGA 2HMAA 5LJ3d 2XDBA 4EO4A 1WHLA 1PKTA 3E9GA 2J3LA 2XDDA 1D3BB 1UGVA 1YJ9A 5CKBA 1YI2A 2V8JA 2KRNA 5I2MA 3QKJA 2HQXA 2LMJA 3VUZA 2AIRB 4A4GA 1VQPQ 1YFRA 2LT4A 3SB2A 1AOJA 2LQKA 1TWBA 4AG2C 1M2VB 2PNIA 4YROA 4CS4A 5J26A 4YDQA 2IG0A 1K73C 4HCZA 1KQ2A 3EGDA 3JCMP 4RQEA 2ENMA 4M78D 5GANh 3M0UA 2EQIA 1IB8A 1JJ2P 4M7DE 1Q7YU 3OYMA 1K8AU 3J7AF 2X35A 4TQFA 4M7DF 4MZMA 5GAN3 2RI5A 1QVFS 4JRPA 5GAOr 2OTJT 1YFTA 3CQTA 4M7AG 4EMKB 1AVZC 4DBFA 2L3SA 3OS1A 3CCUT 1X2QA 3E9FA 1YIJQ 4IUPA 3UA6A 5KYNA 5LJ3g 5GAN7 2L8DA 4M77G 3HRUA 1JBMA 4XU1A 3IKMB 2EQUA 3ULRB 4VUBA 4M77C 1BBUA 4GLMA 1MMGA 3DB4A 3IKLA 2XMFA 2ZPIB 2ZIOA 3OSSC 3S3MA 4CC3A 1YITA 1K1ZA 3RUXA 2CYZB 3M57A 4K86A 1NM7A 3RGLA 2YUPA 1K76A 5FWBA 2HSEB 3RF1A 1JB0E 3M55A 4C5HA 4V2SA 4EIKA 1E7OA 1VQ7Q 4ZNXA 4LNSA 3JB9D 1H4VB 2L0AA 3HXXA 2G4CA 4TTVA 2KI7A 5DLOA 2JM8A 1MHNA 1OQKA 5ELNA 4FM4B 4BY6C 3KUFA 5A0GA 3NTKA 1IHVA 4M75E 2QQAA 3TQ7P 1ADJA 1C1AA 1NNHA 3EFSA 2JXBA 2NUPB 1B8AA 3G4ST 2NYSA 3JB9F 8AT1B 2AT1B 3HFZA 3CCEQ 3R6NA 1Y57A 1KQSP 3CMET 5GMKh 2E5AA 3A7UA 5FU6B 2DVJA 3NFCA 5A2QE 1CSKA 3PNWC 2KXDA 2NS6A 2QEXA 3REXA 1IREB 3HFNA 1NE8A 3HL8A 1X43A 3D7SB 1EIYA 1QQJA 2DE0X 2DM1A 2A8EA 3M0PA 3SEMA 4KGVB 1AT1B 5KYUB 2R5MA 5DY9A 3INZA 3LW5E 1NPRA 1EIFA 4PK4A 3BDLA 4ZN1A 3CCJT 3A7RA 3JB9J 3JCMh 4H2XB 4LDYA 2ZPEB 5I22A 4LD9K 2ED0A 2E3HA 3H0FA 4JPBW 2DX1A 1E1TA 1K0XA 3A74A 4BE2A 4YTLA 1OZ3A 1SG5A 2EGCA 4M7DG 1X27A 1WYXA 4HVUA 3V7SA 3OYAA 1Q81C 2E41A 4M7DC 4LVIA 4KH0B 1KHCA 2B86A 2RQUA 5GANd 2A28A 2O4XA 4E51A 1D1BA 5CVIA 5HK3A 4RTYA 2ECZA 1KMMA 3H0HA 1SSFA 5I21A 1MUZA 3DLLA 2E70A 3VS4A 3L2VA 1U8RA 4RTZA 4YRNA 2EAYA 1YFNA 4QVDA 1Z9QA 1Q82R 2CP3A 4EMHA 3EH1A 4ELYC 2PQWA 3CCSQ 4PFPA 4II1A 3QJ6A 5KYYA 4M78A 2RF0A 3X28B 2QG9B 3JCMQ 4PLIA 1I8FA 1M5Q1 3ERRA 3VQYA 2NWMA 3MEVA 1D3BA 4LVKA 3BE3A 3P8BB 3CCRA 1KD1U 1M3CA 2EKOA 2M02A 3I55T 1QVGA 5F5WA 4P75A 3QWYA 3EGXB 1YWPA 3OW2A 3OSVA 3JB9H 5KCHA 4MMLA 5GANg 3OA6A 1UB4A 3WVEB 1M2VA 2QXFA 2DTIA 4J7IA 1UE9A 1WJRA 1EX4A 2HL5C 3JV3A 3JCMW 3OYJA 1YN8A 4EMKC 2P0QA 3OYCA 1AD5A 3JB9G 1H4TA 2LNHB 1YJWT 3I35A 2XICA 2XU8A 1K4US 4J5YA 4XAXB 1X2GA 4Z8AA 3EG0A 2E12A 2K5LA 4GBQA 1WGSA 2P4TA 3A5ZB 1ACMB 1PG5B 4EDUA 1WJSA 2E5KA 1KJWA 3JCMf 1W6XA 3A98A 2JMAA 4EMKA 3L2QA 2F69A 3VQXA 1YNZA 2JW4A 1C0AA 1VQKQ 2M16A 2QQSA 5GAMe 1CKBA 1RAGB 4PKCC 1VQ6Q 3CCLA 4XU2A 1NLPC 1VQZA 4E2FB 4OMMA 2KT8A 4A4HA 4E7SA 2RHSB 2I0NA 4QQDA 4L6V5 4WJ3M 2QQBA 1NEBA 1N6AA 1K9MU 2BUDA 3KFUA 2DVEA 2O01E 2CS7A 2J7IA 4ME7A 4KUDK 1R77A 4CC2A 2I4NA 2ZZEA 2E10A 1TG0A 2EQJA 4CH6A 4P73A 3CPFA 1D1AA 1HK9A 1NG2A 3M53A 3L42A 3I9QA 2Q7GA 2E6ZA 2YXYA 3MEYA 1T0JA 2HCKA 1UUEA 3CC7T 5CKFA 1X75C 1QCNA 1IL2A 2RA2A 2HQHA 4KBMB 1DJ7B 1X6BA 2WACA 4CI0C 4NL2A 4Y91A 2NUPA 1EFWA 3A1PA 3SWNC 3MQZA 2R5AA 1H92A 4BI4A 4XTVA 1NJ8A 2DL8A 3QXEB 3E9HA 1ASYA 2XIDA 3VS5A 4F7UF 5KCOA 2ODRC 3FJ5A 1ZSGA 1W70A 4MDXA 2RJEA 2FZCB 2KQWA 1X69A 2WSEE 2CZ1B 4HT9A 3CPWA 4X9DA 2CGHA 3KFVA 2MMPA 1QVFP 5KNNA 2DO3A 5I11A 3JCMX 4HWPA 1YBYA 5KYUA 2XD0A 2RHZA 1WYDA 2DL4A 2EYQA 3I56A 3JSCA 1SHFA 4ZTUB 1UECA 3EG3A 2KEAA 2QA4T 2VVKA 4H2XA 1M30A 2EYXA 3S6WA 1GL5A 4NCXA 2OAWA 1G3SA 1NJ2A 2A37A 1KC8R 3FIFA 3VS0A 1L0WA 1N5ZA 2DTOA 1AWXA 1NJIC 2KDSA 3MKDA 1AWJA 3MEUA 2CP7A 3MJXA 1PWTA 1LVKA 3VJPA 3VKIA 4PNOA 2FG0A 3RDVA 1ADYA 2X51A 1M1GA 1U1TA 3KXTA 4GLKA 3LLRA 2MF2A 1ZUKA 1VQ4T 3REUA 5CKHA 4LE9A 4C0FA 2ZZFA 2B8AA 1GCQC 4OMOA 1FMKA 1WHHA 3JCMc 3S3NA 1H4QA 2Q7HA 2M1HA 5IHKA 4IUQA 2MCNA 4XEOA 3UH0A 3AHUA 3OYLA 2LCLA 2O9SA 3TUPA 5FRMA 2DXBA 4YRSA 1OX8A 4P74A 4D8DA 1SF9A 4YCUA 3CCQQ 2FPDA 2NUZA 1LYLA 4ZIBA 3A5YA 3CBOA 1S72Q 2EQKA 3EGXA 1SPKA 4KQEA 4UC4A 2MWPA 4P71C 4PFZA 4DEXA 5CKEA 4LVMA 3TEGA 3SD4A 2AZVA 1VQ5Q 1H641 4QVZA 4XK8E 4P72A 3IALA 4H2SA 2E6NA 3QTCA 5EC7A 4EMGA 2O2OA 4H2UA 5A0LA 3X25B 1YIJT 1LCKA 1W66A 1N8RR 2QYZA 4F7UG 4KT0E 4M7AB 1YJ9Q 3P8YA 2EKHA 2AKLA 1B76A 1YI2Q 3A5ZA 4XTZA 4A4EA 4C5GA 2X4YA 4OB0B 1M90R 2CH4W 4M77B 1VQ9A 3LSQA 3UFGA 5GAOl 1SRYA 2GFAA 1A0NB 3QG1A 2IIMA 3UATA 1VQ7T 1VQ8Q 2MWOA 1WIEA 5GAN2 1G2BA 1H3HA 4RUGA 2DERA 1YGBA 1NYQA 1U3OA 3CMEA 3MP6A 3OYBA 2DU7A 4M7AD 5E3IA 4HCKA 2RHSA 1AWOA 1JEGA 4AFQC 4B6MA 3VBBA 3VS3A 2DL3A 1PCXA 3VYGA 2J3MA 1Z9ZA 1UFFA 5GAN6 2P0PA 2RQTA 4BY6B 2SRCA 2M0YA 5D6WA 3CCET 4FT2A 4J83A 2PZ1A 1G8XA 4M7AF 2KSSA 1KQ1A 2YUNA 4XU0A 3OBYA 1YITQ 1UGRB 2D0NA 1U5SA 4PL6A 2VC8A 2ZGWA 1ZA1B 2E64A 1PYSB 2JTFA 2Y4XA 2FYKA 2K79A 1F1BB 4JLIA 3OYNA 3TSZA 4XU3A 1M1KU 3CEYA 5D6YA 3NEMA 1BBZA 2EQMA 3VUBA 4YRQA 3RMSA 5CO7A 1BI2A 3T9NA 2L5QA 1WQ7A 2JTEA 1M8MA 2P0LA 1H3ZA 4ORZA 3GBQA 3QYHB 3I5RA 4HXJA 5LJ3f 3H6ZA 2XKOC 2BE7D 3IG2A 4YRRA 5GJWB 3A8MB 4M7DB 4HT4A 2FEIA 2WSFE 2DAQA 2KAFA 4J9FA 1PKSA 2OTLA 1I81A 4RMOA 3A8GB 5L8RE 4LDWA 4CRIA 3PMIA 1BYMA 3G7ZA 1Z7MA 2DQ3A 2OAUA 3I55A 2ZPHB 2QEXQ 2HBWA 4DBRA 4OB2B 2L3RA 3ZEHA 5C6SA 2DRKA 3OYKA 2AK5A 3CCST 5IXFA 5IHIA 1ZSZC 2DBMA 3L2UA 1EOVA 3MCAB 1XQHA 3RERA 1RI9A 4IKFA 4CS3A 3REAB 4PJMA 2COYA 4BI8B 4E47A 2CZ6B 4J7FA 4C8QE 3G71A 1GFDA 2JVVA 4M7DD 3VU3C 2KE9A 4C8QF 3P8HA 1FX7A 4PJNA 2V1QA 4RG8A 1K73R 3CD6A 2G6FX 5LJ5f 2DTHA 1VYTA 1TUCA 5DLQE 4RDXA 3RKWA 4JUVA 1B07A 2A36A 2JZ2A 1NYRA 1D09B 3NENA 4TVRA 1X54A 3HRKA 2VGNA 1BIBA 3QHSA 1MMDA 2F2VA 2CJ9A 3QYGB 2E4HA 4E7LA 1Q86C 1VQNA 2ARUA 1KHIA 5C53B 1NYGA 1VQOA 3QPHA 3L2RA 1B7YB 4LDVA 4M75B 2E3IA 4M7AC 1GCPA 2DK3A 2JMCA 1GRIA 2ARSA 3M0QA 2CP5A 3C0CA 4Y28E 2EPDA 3CBPA 3OS2A 2DZCA 2HAXA 5GAOp 4IIOA 1BCMA 3CC2A 4H02A 3VQVA 2JNGA 1VQKT 4QT7A 4JJBA 3VS6A 3MO8A 3CXCP 1Y7XA 3E19A 1HJDA 2RO0A 1VQ6T 4O6JA 1SETA 3A7AA 4M7AA 3CCRQ 4YPFA 4RG2A 2HBPA 1HTTA 4L87A 3V8JA 3P8DA 4JJNK 2CSIA 1Z7NA 1MV3A 4M77A 1J3TA 4J15A 1UEBA 3OS5A 4M75D 3GP8A 4Z89A 4JS5A 5HY6A 4P3PA 5J39A 1RAHB 2DZ9A 4ZTFA 2QHUA 2DJZA 5GAMj 2L3QA 1Q7YC 1K8AC 3H8ZA 1Y96B 4M4ZA 3A8LB 2GGRA 1G51A 2RHQB 4AFSC 3PMTA 2GF7A 2EBPA 4M75F 5GMKi 1WZOA 3W3SA 2HZYA 4BE1A 4MDWA 3OBWA 4DEYA 3M54A 4OF1A 1B70B 2LQNA 4H2WA 1T3LA 1HSQA 1R0BG 1OYXA 8ATCB 1AZEA 3L4GB 5AT1B 3CCLQ 2ZTGA 1C0MA 5GAN8 3SWNB 4J9IA 1KFZA 5DM7R 2Z0WA 4C8QG 1NPPA 2J06A 5GANf 3MEWA 1VUBA 1O75A 4FT4A 2ABLA 5LL6S 4C8QC 3A8OB 2QQRA 2V1RA 3OYFA 3CCVA 2DPPB 4F17A 3NPFA 1W1FA 1JQQA 1PYSA 1Q82U 1VQMT 2C0TA 2RHYA 2LRQA 4QKUA 4F04B 2D8JA 4YRCA 1Q81R 1NZ9A 5J3BA 1USYC 4DBHA 4AG1C 1VQ4A 1X56A 4ESRA 1PSFA 12ASA 4HWOA 4RTTA 1W2BA 1KOGA 2ZNIA 3E2UA 2EGAA 2ODRD 4AH6A 1RUWA 2ZPBB 4M7DA 4RMFA 4KH1B 2GCXA 4IUVA 1ZBJA 2EJ9A 1EZZB 2DXUA 4FU6A 4BDYA 3E1SA 2C7IA 1OZ2A 2LZ6B 4FW2A 3L1AA 2DEQA 3HXWA 3TCJA 2ZCFB 3BDUA 4PJLA 1RL2A 3FB9A 1QWEA 2IY5B 5EG2A 2ARTA 3ER0A 3M4GA 2EYWA 2KY9A 3PE0A 1IHWA 3OYYA 3CCQT 3FC3A 2QHTA 4KGXB 2CZ0B 5C51B 3EFRA 3EG9B 4MZPA 1CKAA 1B7TA 4C92E 1S72T 1NJ6A 2DXTA 1VYVA 1UHCA 2GFUA 3TSWA 2KMTA 2R58A 1E1OA 2LCCA 4M75G 3GOXA 5GAMd 1FMVA 1ZHIA 2D0QB 1HC7A 4JLGA 4M75C 4WF2A 4ZGJB 2LX7A 3G6EA 2CUBA 2EIFA 3ZL7C 1JO8A 1WLEA 2QHVA 3HSBA 1XJWB 1YJ9T 4P3OA 4KUIA 3URGA 1X01A 3JCMJ 1YI2T 1B7YA 2CUDA 4M75A 3V7RA 3J81E 2RB6A 1QF6A 2Y90A 3DKMA 2YRDA 2ZR2A 4KR3A 3EHQA 4UP8A 4F7UB 4XTWA 3OD1A 5GAOn 4K88A 1B3QA 3L2WA 3NTHA 1RAFB 1VQ8T 1KD1C 5CKDA 2I4LA 4C5EA 4ZTZB 3WVDB 3M4YA 4CH5A 1XOVA 2OX7A 2QDLA 1S1NA 1EVLA 4L59A 4DOWA 2KXCA 4J6WA 4RQFA 1I1JA 5GAMg 2DBKA 3C94A 1SHGA 1YHQA 4TQDA 4IURA 1JU5C 1D0YA 2VB6A 4J9GA 1D0XA 2YHTA 3NELA 1IZ6A 4N0AC 3CC4A 5I2SA 4C0ZA 1PRLC 3LGLA 2VWFA 3CMAT 3M4QA 4WJ4A 1MV0B 1Y96A 2RN8A 3VYHB 3SFMA 2RHQA 2KT1A 3PZCA 2FHDA 3THKA 3HRIA 4N0AA 1VQ9Q 2KRMA 3RKYA 3TEHB 4QQGA 1VQLT 3HPWA 2KVQG 2Q7EA 3UWNA 3QO7A 2QAZA 1KC8U 2FO0A 2PUOB 2A0FB 1B70A 2EGEA 3H41A 2SEMA 4N4IA 1FYFA 3UF4A 3H0IA 3FEOA 2PVDB 1WHGA 4ATOA 2D8HA 3VRYA 3JCMe 3L4GA 2RQRA 2HNIA 3CMQA 3SWNA 2XK0A 4LVLA 3CMEQ 4J6XA 1ZUUA 2O9VA 3OYIA 2JUFA 2LTOA 3O8VA 4JRIA 3OY9A 4Q15A 4J8OA 3CXCS 2DL5A 2VXEA 4C92G 4GY5A 1K9MC 2GQIA 3BY7A 2O88A 2VASA 1WXTA 4YRFA 4E7HA 4N4HA 4X34A 5GMKl 1NJIR 2DD4A 1D0ZA 5FU7C 3M0TA 3M0SA 2ZXFA 6AT1B 4OB3B 2CP0A 3NGPA 2CT4A 2LNVA 5CQYA 4BDZA 1JJ2A 1XTDA 1YJNT 2QEXT 3HXZA 2CT3A 5FROA 4F16A 3DSQA 2JN0A 3CCMT 4FW1A 3HY1A 1OU9A 2HKNA 2K5FA 1MGQA 2COZA 2YDLA 1ZSZB 2VYTA 3DLMA 1RACB 3OYGA 5CK9A 5D7UA 2XHCA 2P5IA 4QQ6A 1B34B 1M3BA 3PT9A 1VQPT 4PJOE 4OGCA 3UGQA 2OTJA 1BBWA 1N8RU 5C52B 2MAMA 1UGSB 2RHUA 1EQRA 3CCUA 4EX5A 1GCQA 2IY5A 4KULA 3N5BB 3NHNA 3HHTB 3GF5A 2QDYB 3VRZA 1M90U 2W10A 2E1HA 4A54A 1XNIA 3A8HB 2OTLQ 4ZTJA 4FYXB 3WXMB 1RADB 2DKGA 2KRSA 3A31A 3EG9A 2ZAEA 4JJDA 2D6FA 2NLUA 3I55Q 1GFCA 1TU0B 3VS7A 3HXVA 1ZLMA 3F70A 2DIQA 2KBTA 2EJGA 3C95A 3H9NA 2ZT5A 1W2BP 2YRVA 1E6GA 1KG1A 4P71A 2CSQA 2AZSA 4LUDA 2QGGA 1WHJA 1W4SA 1ZQ1A 1HXDA 3FRNA 3HRTA 3G71Q 3OYHA 1BK2A 1KQSA 4BWAA 2FZGB 4YRTA 4R55A 9ATCB 3CD6Q 2CIMA 2K57A 1PD0A 4R0KA 2EJFA 2IPOB 4JRKA 4F7UA 5LJ3j 3G4SA 2LQWA 2X4WA 2BZXA 1RAAB 1V29B 1I4K1 1QVGP 2A7YA 2GBQA 2PVOB 1G3YA 1M2OA 2ZCEA 1ATIA 1NJ1A 1Y71A 3OW2P 1X2KA 4A4FA 1VQNQ 2FPFA 3LC0A 2LJ0A 1VQOQ 2AKWB 4J9DA 4RTXA 3O5ZA 2Y4YA 3CCJA 1VIFA 3CC2Q 3QO3A 5KYXB 1G3WA 4O2DA 4DA4A 4FL6A 1VQMA 2P4RA 4ZGEB 4ELZC 4HWSA 3CCLT 2QI2A 2FRYA 5HCKA 4FSSA 2DILA 3EG2A 3WQZA 4PHCA 1LOJA 3V8KA 4IUTA 2AMCB 4F14A 5LJ5j 2K6DA 2XG8D 1Q95G 5FLXE 4PJOG 3E9IA 1E22A 3TEHA 1JXMA 2LP5A 1WHMA 2PTKA 3REBB 2PMFA 4J9CA 3ZFJA 3QDRB 4QVCA 4PJOC 3UT1A 3BFMA 4C5IA 4C8QB 4M77E 2YSQA 1ABQA 1PSEA 1SRMA 3M58A 4A63B 4O5VA 3M9QA 2YLCA 1VIEA 4Z02A 3QSUA 3QO8A 3P8TA 1YP5A 2MYSA 4JJCA 3PIOA 4J9EA 1U1SA 1V1CA 1QWFA 1IO6A 4YCVA 2L3PA 2RQWA 5IXBA 1WI7A 1BU1A 4YCWA 1WHKA 1AWWA 4XEMA 1WX6A 2ZT7A 2DIGA 4WTOB 4H2VA 1VOMA 4X9CA 1FWZA 2PUKB 3VV0A 3BW1A 4C8QD 3G1ZA 1EVKA 1RLPC 2O31A 1BI3A 3MP1A 2I2LA 3JCMV 1YCSB 1JRIA 2DMOA 2FRWA 4BACA 4A53A 2BZ8A 4C0GA 1RIQA 1X6GA 1HD3A 1S72A 3LSSA 1RAIB 1GXIE 1UHFA 3RIRA 3M4PA 1NYFA 3OYDA 3CCVQ 1G5IA 3EFOB 4E7ZA 5K1XA 5C0MA 4CC4B 2CH4A 4TWAA 5GAN4 4D8KA 2CDTA 4IIMA 2DRMA 4DQ2A 1YJWA 4AT1B 2K4YA 1ZSZA 1RI0A 4DBQA 1RABB 2BTTA 4FCYA 1M1KC 2EVRA 1BI1A 1AEYA 1B34A 3CPWP 3TVTA 1VQ4Q 3GNFB 1BI0A 3NMZC 1Y0MA 4E7IA 2CREA 2KROA 1E24A 1UGPB 5KH6A 3ZBDA 2NUTB 3M59A 1Q86R 2DLPA 1WXUA 4FYVB 2RHXA 1ASZA 2A08A 2XTIA 2I4MA 2WSCE 1TH7A 2QASA 1I07A 2DQ0A 3TEEA 3L2ZA 5LJ3e 4YP0A 1M9SA 1OX9A 1VQ8A 4XTYA 1IXDA 4PG3A 5GANj 2VGMA 3GNGA 3FDRA 2A3LA 3TU4K 1KIKA 2JJ9A 3X26B 3RR6A 1YWOA 1TOVA 1SSHA 3SDZA 2BE9B 3HFVA 5ECAA 2ZPGB 2DDZA 2HEQA 4M78E 3PIPA 2J6OA 2BKDN 2D1XA 3ME9A 5LJ5d 5IN1A 1OI1A 2QQ9A 4M78F 1QVPA 1OU8A 4Q6GA 3P8VA 1WU7A 3CMAA 4A4KA 2DEUA 1M4ZA 1UJ0A 1OPKA 3CC7A 2ZZGA 1OV3A 2ZT6A 4LXCA 4YRKA 2QTVA 4LUEA 1Q7YR 2RK2A 2JTMA 1K8AR 3QZ5B 3JAME 3PTAA 1JJCB 1N9SA 1IGQA 5GAMh 1VQLA 2AKKA 1QVFA 2HKQB 1M27C 1WQWA 3OQ5A 3QBYA 1M1FA 2R57A 5LJ5e 3G6EQ 2DF6A 2W0ZA 2I4OA 2CKKA 3R6OA 3UGTA 4HVVA 4OVAA 3QIIA 5CR2A 4HVCA 3VS2A 1PRMC 2C0IA 2ED1A 2LQ8A 1C6VX 3JCMb 2YRCA 2AKWA 1Q81U 2CJAA 2ZT8A 1VQ9T 1WFWA 2RI3A 4OGEA 4Q5WA 2V26A 3M0RA 2DL7A 3EGUA 2QA4A 5KYXA 5L23A 2HD0A 3MP8A 5LJ5g 2RPNA 1QLYA 1WLPB 4OMQA 1PM3A 2MOXA 4RKUE 1W2BS 5CCAA 5GMKj 1ZA2B 2AMCA 1GBQA 2F2WA 2DETA 2DXCA 1YJNA 3U23A 2VV5A 1YHQQ 2GTJA 2BIVA 4YRLA 2MK5A 3C4SA 2Q5IA 3CCMA 1QP3A 3RNJA 2E5QA 3RL6A 4C8QA 2DYIA 1KK7A 3CC4Q 4KR2A 3M5AA 2LCSA 3LWHA 1FXXA 3J80E 4C92B 4LDUA 2H8HA 1VQPA 1ARKA 4HWRA 5GAOq 4CS2A 5FU7B 1QVGS 3OB9A 1USYA 1UTIA 1LJOA 3MPUB 3GLXA 2KNBB 4PLLA 2ATCB 1OULA 2HL3A 2K3BA 3OW2S 4BD3A 4C0DC 5GJVB 1BIAA 4CH3A 1RLQC 3ASKA 4RTWA 5CIUA 4BW9A 4B9XA 3V8LA 1I5OB 4M78G 1NLOC 3HKSA 2QHSA 3RMQA 5GAMf 2ZINA 5A0DA 5IT9E 4M78C 2LX9A 2RI2A 2K7AA 4FYYB 2ROTA 4B9WA 4C92D 3FJPA 2JS0A 2EW3A 3I56Q 4BUGA 3EFOA 1UGQB 1SEMA 2FVUA 5GANe 1YIJA 1Q82C 4J9HA 3QWXX 1SRLA 3RACA 3EAEA 1G5HA 4P75C 2AHJB 3LH5A 4NS5A 3GPLA 2OTLT 4ANJA 4C92F 2ZZDA 4HVWA 2VKNA 3OYEA 1UDLA 5M9OA 1VQ5T 3Q1JA 1QMCA 2HDAA 4WCIA 2NUTA 11ASA 5K1PA 2H3JA 1WPYA 4OMFB 1VQ7A 5KYWB 3EG1A 4WI1A 4LVJA 4RTVA 4KRTA 4LD6A 4YYEA 2ZNJA 2YLBA 5D6XA 4HWTA 3G71T 1LPLA 1G5VA 4AMCA 2OTJQ 1RAEB 2EL9A 3NTIA 4X5OA 3CD6T 1YCYA 4OP0A 4MZTA 3SHWA 2RMOA 1OPLA 2C0OA 4DOVA 3CCUQ 2LVMA 3FLGA 1KD1R 4OB1B 3PCOB 2MPXC 4ZGDB 3S3OA 1K0SA 1H8KA 1TS9A 2E3CA 2JOYA 4OMPA 3A32A 3LX7A 4N4GA 3HY0A 4LDXA 1Y07A 3CCEA 4YREA 1PNJA 1O9SA 3QDFA 2H3EB 3QO5A 1LNXA 2ALYB 3BJUA 2E65A 3LGFA 4XTXA 3UA7A 1VQNT 2VXFA 2GNCA 4HKEA
chains in the Genus database with same CATH topology
1VQOT 4DPGA 1KMNA 4XQ3A 1ZBXA 1SERA 3KBGA 4HT8A 1JJCA 4P73C 3CPWS 4H2YA 3JCMd 1NJ5A 5GMKe 3CC2T 3X24B 4XTUA 4TVYA 2FL7A 2K2VA 3M56A 2KK4A 4JDSA 3DB3A 4TVAB 1YITT 3I7FA 4UPAA 1NJIU 4ZN3A 1GGMA 5FU6C 4BB7A 2HQEA 1JJ2S 4TVWA 4EPCA 3MF1A 2P0KA 5KE2A 4F7UE 4PJOB 1QP2A 5ELOA 4J6YA 3UDCA 3X20B 3OS0A 2X4XA 3JRZA 2RJDA 3CCSA 1I5LA 4G85A 4C92C 2LT1A 5IAYA 4R56A 3JCMg 5FRNA 2X4JA 3PGGA 3ICAA 2VUBA 1SESA 2K5IA 4C92A 3LWIA 3LYIA 3HP9A 2V8IA 4YRIA 4PJOD 3MHXA 2C06A 4BI3A 2K3XA 2RM4A 4QW2A 1KC8C 3CCVT 4UP7A 1YFSA 4RCCA 4CH4A 2EWNA 4PJOF 3CXCA 4FSXA 3QZ9B 3C12A 1QE0A 3JB9I 4P74C 4H2TA 2CZ7B 1VQKA 3MEAA 1KQSS 3QJYA 3NETA 4G84A 3RKXA 1J5WA 1VQ6A 2EFIA 3QUIA 2ZIMA 4UP9A 3MF2A 4JS4A 2RD1A 2G3RA 2CJBA 3HXUA 4P72C 3QNEA 5KE3A 2PU9B 3HFOA 4P3NA 1N9WA 5GMKm 2XGTA 3HRSA 2QTXA 3CCRT 2L89A 4E7KA 3META 4P5NA 2FB7A 5LJ3h 1N8RC 3GIBA 5HK0A 2RHIA 2PMEA 4JRQA 4YRGA 3PCOA 2DU5A 1N9RA 3LH0A 2C8MA 2MI6A 4YRMA 1R8OB 1H4SA 1M90C 4YRJA 4HA8A 3G6ET 3V7CA 2ALYA 2PVGB 5CQXA 2F5TX 4FIBA 1YB3A 1P92A 2M0OA 1X55A 3HTZA 4HCCA 1N27A 3VQWA 2RH2A 3PFSA 3CBMA 2ZR3A 2M9UA 2RK1A 3UPUA 4D6WA 5CAIA 1BKBA 2D9TA 3HFZB 4M77D 1M8VA 5LJ5h 4TVAA 4M7AE 4L5GA 1EIYB 3OMGA 2F5KA 4E7JA 1G3TA 1YHQT 3OMCA 5HKCA 3HXYA 4M77F 1WNLA 3CC4T 4NOYA 4K87A 4PJOA 5GAOm 4OLFA 2XI9A 2RJCA 2LDMA 2GQVA 1K73U 2K3YA 1QW1A 2XDPA 1AHJB 3TREA 2O4XB 2V8KA 2RJFA 5GAN5 3RESA 3CCQA 1Q86U 2ZPFB 2IVWA 4HCBA 4C0DB 4MMKA 4RCBA 5AYFA 3R07A 4IUUA 1VQ5A 4YRPA 2LC4A 3I56T 4BE0A 2Q5HA 2DD5A 4M78B 1X6OA 1WJQA 5HGQA 4NL3A 1X2HA 5LJ3d 2XDBA 4EO4A 3E9GA 2J3LA 2XDDA 1D3BB 1YJ9A 5CKBA 1YI2A 2V8JA 5I2MA 3QKJA 2HQXA 3VUZA 4A4GA 1YFRA 2LT4A 3SB2A 2LQKA 4YROA 4CS4A 5J26A 4YDQA 2IG0A 1K73C 4HCZA 1KQ2A 3JCMP 4RQEA 4M78D 5GANh 4M7DE 1Q7YU 3OYMA 1K8AU 3J7AF 2X35A 4TQFA 4M7DF 4MZMA 5GAN3 2RI5A 1QVFS 4JRPA 5GAOr 2OTJT 1YFTA 4M7AG 4EMKB 3OS1A 3CCUT 3E9FA 4IUPA 5LJ3g 5GAN7 2L8DA 4M77G 3HRUA 1JBMA 4XU1A 3IKMB 2EQUA 4VUBA 4M77C 1BBUA 3DB4A 3IKLA 2ZPIB 2ZIOA 3OSSC 3S3MA 1YITA 3RUXA 2CYZB 3M57A 4K86A 3RGLA 3RF1A 1JB0E 3M55A 4C5HA 4V2SA 4LNSA 3JB9D 1H4VB 3HXXA 2G4CA 4TTVA 5DLOA 1MHNA 5ELNA 4FM4B 4BY6C 3KUFA 5A0GA 3NTKA 4M75E 2QQAA 1ADJA 1NNHA 3EFSA 1B8AA 3G4ST 3JB9F 3HFZA 3CMET 5GMKh 2E5AA 3A7UA 5FU6B 3NFCA 5A2QE 3PNWC 2NS6A 2QEXA 3REXA 1IREB 3HFNA 1NE8A 3HL8A 1EIYA 2A8EA 2R5MA 5DY9A 3INZA 3LW5E 1NPRA 1EIFA 3BDLA 4ZN1A 3CCJT 3A7RA 3JB9J 3JCMh 4H2XB 4LDYA 2ZPEB 4LD9K 1E1TA 3A74A 4BE2A 4YTLA 1OZ3A 4M7DG 3V7SA 3OYAA 1Q81C 2E41A 4M7DC 4LVIA 1KHCA 5GANd 2O4XA 4E51A 5CVIA 5HK3A 1KMMA 1SSFA 5I21A 3DLLA 2E70A 3L2VA 1U8RA 4YRNA 2EAYA 4QVDA 4EMHA 4ELYC 2PQWA 4II1A 3QJ6A 4M78A 3X28B 3JCMQ 4PLIA 1I8FA 1M5Q1 3ERRA 3VQYA 3MEVA 1D3BA 4LVKA 3P8BB 3CCRA 1KD1U 2EKOA 3I55T 1QVGA 5F5WA 4P75A 3OW2A 3OSVA 3JB9H 5KCHA 4MMLA 5GANg 3OA6A 1UB4A 3WVEB 2QXFA 2DTIA 4J7IA 1WJRA 3JCMW 3OYJA 4EMKC 3OYCA 2P0QA 3JB9G 1H4TA 1YJWT 2XICA 2XU8A 4J5YA 4XAXB 1X2GA 2E12A 2K5LA 1WGSA 2P4TA 3A5ZB 4EDUA 1WJSA 3JCMf 4EMKA 3L2QA 2F69A 3VQXA 1C0AA 2M16A 2QQSA 5GAMe 4PKCC 3CCLA 4XU2A 1VQZA 4A4HA 2RHSB 4QQDA 4L6V5 4WJ3M 2QQBA 1N6AA 1K9MU 2BUDA 3KFUA 2DVEA 2O01E 2CS7A 4ME7A 4KUDK 2I4NA 2ZZEA 2E10A 2EQJA 4CH6A 4P73A 3CPFA 1HK9A 3M53A 3L42A 2Q7GA 2E6ZA 3MEYA 3CC7T 5CKFA 1X75C 1IL2A 2RA2A 4KBMB 1DJ7B 2WACA 4CI0C 4NL2A 4Y91A 1EFWA 3SWNC 3MQZA 2R5AA 4BI4A 4XTVA 1NJ8A 3QXEB 3E9HA 1ASYA 2XIDA 4F7UF 5KCOA 2ODRC 4MDXA 2RJEA 2KQWA 2WSEE 2CZ1B 4HT9A 3CPWA 4X9DA 2CGHA 2MMPA 5KNNA 2DO3A 4HWPA 3JCMX 1YBYA 2XD0A 2RHZA 1WYDA 2EYQA 3I56A 3JSCA 4ZTUB 2QA4T 4H2XA 3S6WA 4NCXA 1G3SA 1NJ2A 3FIFA 1L0WA 2DTOA 1NJIC 2KDSA 3MEUA 3VJPA 3VKIA 4PNOA 1ADYA 1M1GA 1U1TA 3KXTA 4GLKA 3LLRA 2MF2A 1VQ4T 3REUA 5CKHA 4C0FA 2ZZFA 2B8AA 1H4QA 3JCMc 3S3NA 2Q7HA 2M1HA 4XEOA 4IUQA 3UH0A 3AHUA 3OYLA 2LCLA 3TUPA 5FRMA 2DXBA 4YRSA 4P74A 4YCUA 1LYLA 4ZIBA 3A5YA 3CBOA 2EQKA 4KQEA 4UC4A 2MWPA 4P71C 4LVMA 5CKEA 3TEGA 3SD4A 1H641 4QVZA 4XK8E 4P72A 3IALA 4H2SA 2E6NA 3QTCA 4EMGA 4H2UA 5A0LA 3X25B 1YIJT 1W66A 4F7UG 4KT0E 4M7AB 3P8YA 1B76A 3A5ZA 4XTZA 4A4EA 4C5GA 2X4YA 4OB0B 4M77B 1VQ9A 3LSQA 3UFGA 5GAOl 1SRYA 2GFAA 3QG1A 1VQ7T 2MWOA 5GAN2 1YGBA 1NYQA 3CMEA 3MP6A 3OYBA 2DU7A 4M7AD 5E3IA 2RHSA 3VBBA 3VYGA 2J3MA 5GAN6 2P0PA 4BY6B 5D6WA 3CCET 4FT2A 4J83A 4M7AF 2KSSA 1KQ1A 4XU0A 3OBYA 1UGRB 4PL6A 2VC8A 2ZGWA 2E64A 1PYSB 2JTFA 2Y4XA 2FYKA 4JLIA 3OYNA 4XU3A 1M1KU 3CEYA 5D6YA 3NEMA 2EQMA 3VUBA 4YRQA 3RMSA 5CO7A 1BI2A 3T9NA 2L5QA 1WQ7A 2P0LA 1H3ZA 3QYHB 5LJ3f 3H6ZA 2XKOC 3IG2A 4YRRA 3A8MB 4M7DB 4HT4A 2WSFE 2DAQA 2KAFA 2OTLA 1I81A 4RMOA 3A8GB 5L8RE 4LDWA 4CRIA 3PMIA 1BYMA 3G7ZA 1Z7MA 2DQ3A 2OAUA 3I55A 2ZPHB 5C6SA 4OB2B 2L3RA 3ZEHA 3OYKA 3CCST 3L2UA 1EOVA 3MCAB 1XQHA 3RERA 4IKFA 4CS3A 4BI8B 4E47A 2CZ6B 4J7FA 4C8QE 3G71A 2JVVA 4M7DD 3VU3C 4C8QF 3P8HA 1FX7A 4RG8A 3CD6A 5LJ5f 2DTHA 5DLQE 4RDXA 3RKWA 4JUVA 2JZ2A 1NYRA 3NENA 4TVRA 1X54A 3HRKA 2VGNA 1BIBA 3QHSA 2CJ9A 3QYGB 4E7LA 1Q86C 1VQNA 2ARUA 1KHIA 5C53B 1VQOA 3QPHA 3L2RA 1B7YB 4LDVA 4M75B 4M7AC 2DK3A 2ARSA 4Y28E 3CBPA 3OS2A 2DZCA 2HAXA 5GAOp 4H02A 3VQVA 3CC2A 2JNGA 1VQKT 3MO8A 1Y7XA 3E19A 2RO0A 1VQ6T 4O6JA 1SETA 3A7AA 4M7AA 4YPFA 4RG2A 2HBPA 1HTTA 4L87A 3V8JA 3P8DA 4JJNK 1Z7NA 4M77A 4J15A 1UEBA 3OS5A 4M75D 3GP8A 4JS5A 5HY6A 4P3PA 5J39A 2DZ9A 4ZTFA 2QHUA 2DJZA 5GAMj 1Q7YC 1K8AC 3H8ZA 1Y96B 3A8LB 1G51A 2RHQB 3PMTA 2GF7A 4M75F 5GMKi 3W3SA 4BE1A 4MDWA 3OBWA 3M54A 4OF1A 1B70B 4H2WA 1OYXA 3L4GB 2ZTGA 5GAN8 3SWNB 5DM7R 4C8QG 1NPPA 5GANf 3MEWA 1VUBA 1O75A 4FT4A 5LL6S 4C8QC 3A8OB 2QQRA 3OYFA 3CCVA 2DPPB 1PYSA 1Q82U 1VQMT 2RHYA 2LRQA 4YRCA 1NZ9A 5J3BA 1USYC 1VQ4A 1X56A 1PSFA 12ASA 4HWOA 1W2BA 1KOGA 2ZNIA 2ODRD 4AH6A 2ZPBB 4M7DA 4RMFA 2GCXA 4IUVA 2EJ9A 4FU6A 2DXUA 4BDYA 3E1SA 2C7IA 1OZ2A 3L1AA 2DEQA 3HXWA 3TCJA 2ZCFB 3BDUA 1RL2A 3FB9A 2IY5B 5EG2A 2ARTA 3ER0A 3M4GA 2KY9A 3OYYA 3CCQT 3FC3A 2QHTA 2CZ0B 5C51B 3EFRA 4MZPA 4C92E 1S72T 1NJ6A 2DXTA 2GFUA 2KMTA 2R58A 1E1OA 2LCCA 4M75G 3GOXA 5GAMd 1ZHIA 1HC7A 2D0QB 4JLGA 4M75C 4WF2A 4ZGJB 3G6EA 2EIFA 1WLEA 2QHVA 3HSBA 1YJ9T 4P3OA 4KUIA 3URGA 1X01A 3JCMJ 1YI2T 1B7YA 4M75A 3V7RA 3J81E 2RB6A 1QF6A 2Y90A 3DKMA 2ZR2A 4KR3A 4UP8A 4F7UB 4XTWA 3OD1A 5GAOn 4K88A 3L2WA 3NTHA 1VQ8T 1KD1C 5CKDA 2I4LA 4C5EA 4ZTZB 3WVDB 3M4YA 4CH5A 1XOVA 1EVLA 4L59A 4DOWA 4J6WA 4RQFA 5GAMg 3C94A 1YHQA 4TQDA 4IURA 2YHTA 3NELA 1IZ6A 4N0AC 3CC4A 5I2SA 4C0ZA 3LGLA 4WJ4A 3CMAT 3M4QA 1Y96A 3VYHB 3SFMA 2RHQA 3PZCA 2FHDA 3HRIA 4N0AA 3RKYA 3TEHB 4QQGA 1VQLT 3HPWA 2KVQG 2Q7EA 3UWNA 3QO7A 1KC8U 2PUOB 1B70A 4N4IA 1FYFA 3FEOA 2PVDB 4ATOA 3JCMe 3L4GA 2HNIA 3CMQA 3SWNA 2XK0A 4LVLA 4J6XA 3OYIA 2JUFA 2LTOA 3O8VA 4JRIA 3OY9A 4Q15A 4J8OA 3CXCS 2VXEA 4C92G 4GY5A 1K9MC 3BY7A 4YRFA 4E7HA 4N4HA 4X34A 5GMKl 2DD4A 5FU7C 2ZXFA 4OB3B 2LNVA 5CQYA 4BDZA 1JJ2A 1XTDA 1YJNT 2QEXT 3HXZA 5FROA 3DSQA 2JN0A 3CCMT 3HY1A 2K5FA 1MGQA 2VYTA 3DLMA 3OYGA 5CK9A 2XHCA 2P5IA 4QQ6A 1B34B 3PT9A 1VQPT 4PJOE 4OGCA 3UGQA 2OTJA 1BBWA 1N8RU 5C52B 2MAMA 1UGSB 2RHUA 1EQRA 3CCUA 4EX5A 2IY5A 4KULA 3N5BB 3HHTB 3GF5A 2QDYB 1M90U 2E1HA 4A54A 1XNIA 3A8HB 4ZTJA 3WXMB 2DKGA 3A31A 2D6FA 2NLUA 3HXVA 3F70A 2DIQA 2EJGA 3C95A 2ZT5A 2YRVA 1KG1A 4P71A 1W4SA 1ZQ1A 1HXDA 3FRNA 3HRTA 3OYHA 1KQSA 4BWAA 4YRTA 4R55A 2CIMA 2K57A 2EJFA 4JRKA 4F7UA 5LJ3j 3G4SA 2X4WA 1V29B 1I4K1 2A7YA 2PVOB 1G3YA 2ZCEA 1ATIA 1NJ1A 1Y71A 4A4FA 3LC0A 2AKWB 2Y4YA 3CCJA 1VIFA 3QO3A 1G3WA 4O2DA 4DA4A 4FL6A 1VQMA 4ZGEB 4HWSA 4ELZC 3CCLT 2QI2A 3WQZA 4PHCA 1LOJA 3V8KA 4IUTA 2AMCB 5LJ5j 2XG8D 5FLXE 4PJOG 3E9IA 1E22A 3TEHA 2PMFA 3ZFJA 3QDRB 4QVCA 4PJOC 3UT1A 3BFMA 4C5IA 4C8QB 4M77E 1PSEA 3M58A 4O5VA 3M9QA 2YLCA 1VIEA 4Z02A 3QSUA 3QO8A 3P8TA 3PIOA 1U1SA 4YCVA 4YCWA 4XEMA 2ZT7A 2DIGA 4H2VA 4X9CA 1FWZA 2PUKB 3VV0A 3BW1A 4C8QD 3G1ZA 1EVKA 1BI3A 3MP1A 2I2LA 3JCMV 1JRIA 4BACA 4A53A 4C0GA 1RIQA 1S72A 3LSSA 1GXIE 3M4PA 3RIRA 1G5IA 3OYDA 5K1XA 5C0MA 4TWAA 5GAN4 4DQ2A 1YJWA 2K4YA 1RI0A 1M1KC 1BI1A 1B34A 3GNFB 1BI0A 4E7IA 1E24A 1UGPB 5KH6A 3ZBDA 3M59A 2RHXA 1ASZA 2XTIA 2I4MA 2WSCE 1TH7A 2DQ0A 3TEEA 3L2ZA 5LJ3e 4YP0A 1M9SA 1VQ8A 4XTYA 4PG3A 5GANj 2VGMA 3GNGA 3FDRA 2A3LA 3TU4K 3X26B 3SDZA 3HFVA 2ZPGB 2DDZA 4M78E 3PIPA 2BKDN 3ME9A 5LJ5d 5IN1A 1OI1A 2QQ9A 4M78F 1QVPA 4Q6GA 3P8VA 1WU7A 3CMAA 4A4KA 1M4ZA 3CC7A 2ZZGA 2ZT6A 4YRKA 2RK2A 2JTMA 3QZ5B 1JJCB 3JAME 3PTAA 1N9SA 5GAMh 1VQLA 1QVFA 1WQWA 3OQ5A 3QBYA 1M1FA 2R57A 5LJ5e 2I4OA 2CKKA 3R6OA 3UGTA 4OVAA 3QIIA 5CR2A 4HVCA 2LQ8A 3JCMb 2AKWA 1Q81U 2CJAA 2ZT8A 1VQ9T 2RI3A 4OGEA 4Q5WA 2QA4A 2HD0A 3MP8A 5LJ5g 4RKUE 1W2BS 5CCAA 5GMKj 2AMCA 2DXCA 1YJNA 2VV5A 2BIVA 4YRLA 3C4SA 2Q5IA 3CCMA 1QP3A 2E5QA 3RL6A 4C8QA 4KR2A 3M5AA 3LWHA 1FXXA 3J80E 4C92B 4LDUA 1VQPA 4HWRA 4CS2A 5GAOq 5FU7B 1QVGS 3OB9A 1USYA 1LJOA 3GLXA 4PLLA 3OW2S 4BD3A 4C0DC 1BIAA 4CH3A 3ASKA 5CIUA 4BW9A 4B9XA 3V8LA 4M78G 3HKSA 2QHSA 3RMQA 5GAMf 2ZINA 5A0DA 5IT9E 4M78C 2LX9A 2RI2A 4C92D 4B9WA 3FJPA 4BUGA 1UGQB 2FVUA 5GANe 1YIJA 1Q82C 3RACA 3EAEA 1G5HA 4P75C 2AHJB 4NS5A 3GPLA 2OTLT 4C92F 2ZZDA 3OYEA 5M9OA 1VQ5T 3Q1JA 11ASA 5K1PA 2H3JA 1WPYA 4OMFB 1VQ7A 4WI1A 4LVJA 4LD6A 4YYEA 2ZNJA 2YLBA 5D6XA 4HWTA 3G71T 1G5VA 2EL9A 3NTIA 4X5OA 3CD6T 1YCYA 4OP0A 4MZTA 4DOVA 2LVMA 3FLGA 3PCOB 4OB1B 4ZGDB 3S3OA 2E3CA 2JOYA 3A32A 3LX7A 4N4GA 3HY0A 4LDXA 1Y07A 3CCEA 4YREA 1O9SA 3QO5A 1LNXA 2ALYB 3BJUA 2E65A 3LGFA 4XTXA 1VQNT 2VXFA 4HKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPG A;  1KMN A;  2EJG A;  4XQ3 A;  1SER A;  2ZT5 A;  4HT8 A;  1JJC A;  5DY9 A;  3INZ A;  4P73 C;  1EOV A;  4H2Y A;  3JCM d;  1NJ5 A;  3RER A;  4P71 A;  5GMK e;  4CS3 A;  3A7R A;  4XTU A;  3JB9 J;  3JCM h;  4TVY A;  4H2X B;  4C8Q E;  1HXD A;  4M7D D;  3VU3 C;  1E1T A;  4C8Q F;  4TVA B;  4BWA A;  3A74 A;  4YRT A;  4M7D G;  3V7S A;  2CIM A;  5LJ5 f;  2K57 A;  2DTH A;  3I7F A;  4UPA A;  2E41 A;  2EJF A;  4M7D C;  4RDX A;  4JRK A;  5GAN d;  3RKW A;  4F7U A;  5LJ3 j;  4JUV A;  4E51 A;  1NYR A;  1GGM A;  3NEN A;  1X54 A;  1KMM A;  3HRK A;  1I4K 1;  1BIB A;  3QHS A;  5I21 A;  3MF1 A;  4TVW A;  2CJ9 A;  2ZCE A;  4F7U E;  1ATI A;  4PJO B;  1NJ1 A;  5ELO A;  4J6Y A;  4YRN A;  2ARU A;  2EAY A;  3LC0 A;  5C53 B;  4QVD A;  4EMH A;  1B7Y B;  4M75 B;  1I5L A;  2AKW B;  4G85 A;  4M7A C;  2ARS A;  4C92 C;  3JCM g;  2DZC A;  5GAO p;  4M78 A;  4H02 A;  3VQV A;  3QO3 A;  3PGG A;  3JCM Q;  3ICA A;  4O2D A;  1I8F A;  1M5Q 1;  3ERR A;  3VQY A;  1D3B A;  1SET A;  3A7A A;  4HWS A;  4M7A A;  1SES A;  4C92 A;  4YPF A;  1HTT A;  4L87 A;  3WQZ A;  3V8J A;  4PHC A;  1LOJ A;  3V8K A;  5F5W A;  4YRI A;  4PJO D;  4P75 A;  1Z7N A;  3JB9 H;  2AMC B;  5LJ5 j;  4M77 A;  4MML A;  2RM4 A;  5GAN g;  4PJO G;  4J15 A;  3E9I A;  1E22 A;  3TEH A;  2PMF A;  4M75 D;  2DTI A;  4QVC A;  4PJO C;  4P3P A;  3BFM A;  4UP7 A;  3JCM W;  2DZ9 A;  4C8Q B;  2QHU A;  4M77 E;  2DJZ A;  4EMK C;  3JB9 G;  1H4T A;  1YFS A;  4RCC A;  4CH4 A;  5GAM j;  2EWN A;  4J5Y A;  1X2G A;  2YLC A;  4PJO F;  3QSU A;  3QO8 A;  1Y96 B;  3P8T A;  1QE0 A;  1U1S A;  1G51 A;  2RHQ B;  3JB9 I;  3JCM f;  4YCV A;  4M75 F;  4P74 C;  5GMK i;  3W3S A;  4EMK A;  4H2T A;  4YCW A;  3VQX A;  1C0A A;  4XEM A;  5GAM e;  1B70 B;  2ZT7 A;  3NET A;  4G84 A;  4H2W A;  3RKX A;  1J5W A;  4H2V A;  4X9C A;  3L4G B;  4XU2 A;  3BW1 A;  1VQZ A;  2ZTG A;  5GAN 8;  4C8Q D;  3G1Z A;  1EVK A;  3QUI A;  3SWN B;  2ZIM A;  4UP9 A;  3MF2 A;  2I2L A;  2RD1 A;  3JCM V;  4C8Q G;  5GAN f;  1JRI A;  2CJB A;  3HXU A;  4P72 C;  3QNE A;  2RHS B;  3HFO A;  4A53 A;  4P3N A;  1RIQ A;  4C8Q C;  3LSS A;  4WJ3 M;  1N9W A;  3M4P A;  3RIR A;  1G5I A;  5K1X A;  3KFU A;  4TWA A;  1PYS A;  5GMK m;  5GAN 4;  2XGT A;  2DVE A;  2QTX A;  4DQ2 A;  2I4N A;  2ZZE A;  4YRC A;  2E10 A;  4CH6 A;  4P73 A;  1B34 A;  1HK9 A;  1USY C;  2FB7 A;  2Q7G A;  5LJ3 h;  1X56 A;  3MEY A;  3GIB A;  12AS A;  4HWO A;  2PME A;  1E24 A;  1IL2 A;  2RA2 A;  4YRG A;  3PCO A;  2DU5 A;  1N9R A;  1KOG A;  4NL2 A;  4Y91 A;  2ZNI A;  1EFW A;  2C8M A;  3SWN C;  1ASZ A;  4YRM A;  2ODR D;  4AH6 A;  2XTI A;  2I4M A;  4XTV A;  1NJ8 A;  1H4S A;  1TH7 A;  4M7D A;  4YRJ A;  3E9H A;  1ASY A;  2DQ0 A;  4RMF A;  4F7U F;  4HA8 A;  3V7C A;  2ALY A;  3L2Z A;  5LJ3 e;  4YP0 A;  2ODR C;  1YB3 A;  2EJ9 A;  2DXU A;  4XTY A;  2C7I A;  4PG3 A;  5GAN j;  1X55 A;  3L1A A;  3HTZ A;  4HT9 A;  4X9D A;  2CGH A;  2DEQ A;  3HXW A;  5KNN A;  4HWP A;  3VQW A;  3JCM X;  3BDU A;  3FB9 A;  2IY5 B;  1WYD A;  3HFV A;  2ZR3 A;  2ART A;  2DDZ A;  5CAI A;  4ZTU B;  4M78 E;  3HFZ B;  4H2X A;  3M4G A;  4M77 D;  5LJ5 d;  4M78 F;  1M8V A;  4NCX A;  5LJ5 h;  2QHT A;  4Q6G A;  4TVA A;  1NJ2 A;  3P8V A;  5C51 B;  4M7A E;  3EFR A;  1WU7 A;  3FIF A;  4C92 E;  1L0W A;  1NJ6 A;  2DTO A;  2DXT A;  2ZZG A;  1EIY B;  2ZT6 A;  1E1O A;  4YRK A;  4M75 G;  5GAM d;  1HC7 A;  1JJC B;  1N9S A;  5GAM h;  4M75 C;  4WF2 A;  3HXY A;  4PNO A;  4M77 F;  1ADY A;  1WQW A;  1WNL A;  5LJ5 e;  2I4O A;  4NOY A;  1U1T A;  4K87 A;  4PJO A;  1WLE A;  3UGT A;  2QHV A;  3HSB A;  3REU A;  4P3O A;  5GAO m;  2ZZF A;  4OLF A;  4HVC A;  1X01 A;  3JCM J;  1B7Y A;  4M75 A;  1H4Q A;  3JCM b;  3JCM c;  3V7R A;  2AKW A;  2RB6 A;  1QF6 A;  2Q7H A;  4XEO A;  2CJA A;  2Y90 A;  3UH0 A;  3AHU A;  2ZT8 A;  2ZR2 A;  4KR3 A;  4UP8 A;  4F7U B;  4XTW A;  3TUP A;  3OD1 A;  4YRS A;  5GAN 5;  5GAO n;  4P74 A;  3RES A;  4K88 A;  5LJ5 g;  4YCU A;  1LYL A;  2I4L A;  3A5Y A;  4ZIB A;  4ZTZ B;  4CH5 A;  5GMK j;  4MMK A;  4KQE A;  1EVL A;  2AMC A;  4J6W A;  4RQF A;  4P71 C;  4RCB A;  3R07 A;  5GAM g;  3TEG A;  4YRP A;  4TQD A;  1H64 1;  4YRL A;  2Q5H A;  4P72 A;  3IAL A;  4H2S A;  4M78 B;  3QTC A;  4EMG A;  2Q5I A;  5HGQ A;  2YHT A;  4H2U A;  3RL6 A;  4C8Q A;  4NL3 A;  1X2H A;  3NEL A;  4N0A C;  4KR2 A;  5LJ3 d;  1W66 A;  4EO4 A;  2J3L A;  1D3B B;  4F7U G;  4M7A B;  3P8Y A;  4WJ4 A;  4C92 B;  3M4Q A;  1B76 A;  1Y96 A;  3A5Z A;  4XTZ A;  2RHQ A;  4HWR A;  4CS2 A;  5GAO q;  3PZC A;  4M77 B;  1YFR A;  3HRI A;  4N0A A;  3SB2 A;  1USY A;  3RKY A;  3TEH B;  2Q7E A;  1LJO A;  3LSQ A;  3UFG A;  5GAO l;  1SRY A;  3QO7 A;  4YRO A;  4CS4 A;  1B70 A;  4YDQ A;  1KQ2 A;  1FYF A;  3JCM P;  1BIA A;  4CH3 A;  4RQE A;  3JCM e;  3L4G A;  4M78 D;  4BW9 A;  5GAN h;  2HNI A;  5GAN 2;  3CMQ A;  4M7D E;  3V8L A;  3SWN A;  1YGB A;  4M78 G;  1NYQ A;  4TQF A;  2QHS A;  4J6X A;  4M7D F;  5GAM f;  2ZIN A;  5GAN 3;  2DU7 A;  4M7A D;  5E3I A;  4M78 C;  4C92 D;  2RHS A;  5GAO r;  4JRI A;  4Q15 A;  3FJP A;  1YFT A;  4M7A G;  3VBB A;  4EMK B;  2VXE A;  4C92 G;  2J3M A;  3BY7 A;  5GAN 6;  5GAN e;  5LJ3 g;  5GAN 7;  4M77 G;  1JBM A;  3RAC A;  4YRF A;  4XU1 A;  1G5H A;  4P75 C;  5GMK l;  3IKM B;  4M77 C;  1BBU A;  4M7A F;  2ZXF A;  4C92 F;  3IKL A;  1KQ1 A;  2ZIO A;  4XU0 A;  3HXZ A;  3RUX A;  3DSQ A;  2JN0 A;  11AS A;  5K1P A;  4K86 A;  2VC8 A;  2ZGW A;  3RGL A;  2E64 A;  1WPY A;  3RF1 A;  1PYS B;  4V2S A;  2FYK A;  3HY1 A;  1MGQ A;  4LNS A;  4WI1 A;  3JB9 D;  4JLI A;  4YYE A;  2ZNJ A;  2YLB A;  2P5I A;  4XU3 A;  4HWT A;  1H4V B;  3HXX A;  1B34 B;  2G4C A;  3NEM A;  4TTV A;  4PJO E;  4YRQ A;  3UGQ A;  2EL9 A;  5ELN A;  1WQ7 A;  4X5O A;  1BBW A;  1YCY A;  2P0L A;  4OP0 A;  5C52 B;  4M75 E;  1EQR A;  4EX5 A;  5LJ3 f;  3PCO B;  1ADJ A;  2IY5 A;  2E3C A;  1NNH A;  3EFS A;  3IG2 A;  1B8A A;  4YRR A;  3A32 A;  3JB9 F;  3HY0 A;  4YRE A;  4M7D B;  3HFZ A;  2E1H A;  4A54 A;  5GMK h;  3QO5 A;  1LNX A;  2ALY B;  2E5A A;  3A7U A;  3BJU A;  1I81 A;  2E65 A;  2DKG A;  3A31 A;  4XTX A;  1Z7M A;  2DQ3 A;  3REX A;  3HFN A;  2VXF A;  3HXV A;  1EIY A; 
#chains in the Genus database with same CATH topology
 1VQO T;  7AT1 B;  4DPG A;  1KMN A;  4XQ3 A;  1ZBX A;  1SER A;  3KBG A;  1QKW A;  4HT8 A;  1JJC A;  4P73 C;  3CPW S;  4H2Y A;  3JCM d;  1NJ5 A;  5GMK e;  3CC2 T;  3X24 B;  1D1C A;  4XTU A;  4TVY A;  2J6K A;  2FL7 A;  1TUG B;  2K2V A;  2OI3 A;  3M56 A;  2KK4 A;  2ESW A;  4JDS A;  2QGF B;  3DB3 A;  4TVA B;  2DA9 A;  3IQL A;  1YIT T;  3I7F A;  2JS2 A;  4UPA A;  1QCF A;  1NJI U;  1PD1 A;  1KSW A;  4ZN3 A;  1IGU A;  3G4S Q;  1GGM A;  5FU6 C;  4BB7 A;  2CP6 A;  2DJQ A;  2FZK B;  2HQE A;  1JJ2 S;  4TVW A;  4EPC A;  4AFZ C;  3MF1 A;  1QCO A;  2P0K A;  5KE2 A;  2JM9 A;  4F7U E;  4PJO B;  1QP2 A;  2KGT A;  4PJJ A;  5ELO A;  4J6Y A;  1K9M R;  3UDC A;  3X20 B;  1T3S A;  4K11 A;  3OS0 A;  2X4X A;  4AFU C;  3JRZ A;  2RJD A;  3CCS A;  1G83 A;  1I5L A;  2X3W D;  3VS1 A;  4G85 A;  3RBB B;  4C92 C;  2X9H A;  2LT1 A;  4RTU A;  1EFN A;  5IAY A;  4R56 A;  3JCM g;  5FWC A;  5FRN A;  1WA7 A;  2ROL A;  3CCJ Q;  2X4J A;  3PGG A;  4LNP A;  3ICA A;  2VUB A;  2K9G A;  1VQM Q;  1SES A;  2LJ3 A;  2K5I A;  4C92 A;  3LWI A;  3LYI A;  3HP9 A;  2V8I A;  2JT4 A;  4YRI A;  2KR3 A;  3MHX A;  4PJO D;  4KGZ B;  2C06 A;  4BI3 A;  2K3X A;  2RM4 A;  2GTO A;  1U06 A;  4FYW B;  1GBR A;  1V76 A;  4QW2 A;  1BCO A;  3CCV T;  1KC8 C;  2P84 A;  4UP7 A;  4Y92 A;  1YFS A;  4RCC A;  4CH4 A;  2EWN A;  4PJO F;  3CXC A;  2KYB A;  4FSX A;  3QZ9 B;  2HSP A;  1QKX A;  1OOT A;  3C12 A;  1QE0 A;  1VYU A;  3JB9 I;  4P74 C;  4H2T A;  2CZ7 B;  4PFO A;  2YWW A;  1ABO A;  1VQK A;  3MEA A;  1KQS S;  3QJY A;  3NET A;  4JZ3 A;  4G84 A;  3RKX A;  1J5W A;  3EGD B;  1E6H A;  1VQ6 A;  2EFI A;  1HYO A;  4E6R A;  1ZUY A;  1FMW A;  3QUI A;  1AZG B;  2ZIM A;  1MND A;  3MF2 A;  4JS4 A;  4UP9 A;  2RD1 A;  2G3R A;  5FW9 A;  2CJB A;  3HXU A;  4P72 C;  3QNE A;  5KE3 A;  2PU9 B;  3HFO A;  4P3N A;  2BZY A;  2CP2 A;  1N9W A;  1PC0 A;  2LJ1 A;  1TXQ A;  1TUD A;  5GMK m;  2XGT A;  3HRS A;  1MMA A;  2QTX A;  5KYW A;  1YJW Q;  2DYB A;  2K2M A;  3CCR T;  2L89 A;  2YUQ A;  4E7K A;  2EYZ A;  3MET A;  4JZ4 A;  4P5N A;  2FB7 A;  1WDX A;  1NBE B;  1M3A A;  5LJ3 h;  2MIO A;  1N8R C;  3GIB A;  5HK0 A;  2RHI A;  2PME A;  4JRQ A;  4OML A;  4J9B A;  4YRG A;  3PCO A;  2DU5 A;  1N9R A;  1WXB A;  3PVL A;  3LH0 A;  2C8M A;  2MI6 A;  4YRM A;  1R8O B;  1H4S A;  1M90 C;  4YRJ A;  1PHT A;  4HA8 A;  3G6E T;  2L2P A;  3V7C A;  2ALY A;  2PVG B;  5CQX A;  2F5T X;  2COW A;  4FIB A;  1YB3 A;  1P92 A;  3G1J A;  2M0O A;  1X55 A;  2F1L A;  3HTZ A;  4Z88 A;  5IH2 A;  4HCC A;  1N27 A;  1SKU B;  3VQW A;  2RH2 A;  4OMN A;  3PFS A;  3CBM A;  1MMN A;  2M9U A;  2RK1 A;  4CC7 A;  3UPU A;  2ZR3 A;  4D6W A;  5CAI A;  1TTH B;  3HTR A;  1BKB A;  2D9T A;  3HFZ B;  1R0C B;  4M77 D;  4LN2 A;  2J6F A;  1M8V A;  5LJ5 h;  4TVA A;  4M7A E;  2FPE A;  3CMA Q;  2YUO A;  3PVQ A;  3CC7 Q;  2YT6 A;  4L5G A;  1EIY B;  3OMG A;  2F2X A;  2F5K A;  1UJY A;  4E7J A;  1TSF A;  1G3T A;  2DNU A;  1ZX6 A;  1YHQ T;  1I0C A;  3OMC A;  5HKC A;  3HXY A;  1VQL Q;  4M77 F;  1WNL A;  5IHN A;  3EHR A;  3CC4 T;  4NOY A;  2M51 A;  4K87 A;  4PJO A;  3I5S A;  5GAO m;  2KYM A;  4OLF A;  2XI9 A;  2J05 A;  2RJC A;  2DFU A;  2LDM A;  1BB9 A;  2GQV A;  1K73 U;  2K3Y A;  1QW1 A;  2XDP A;  1AHJ B;  3EH2 A;  3TRE A;  2O4X B;  2V8K A;  2RJF A;  1K9A A;  5GAN 5;  2QA4 Q;  3RES A;  2OJ2 A;  1MNE A;  3CCQ A;  2EYY A;  1Q86 U;  2ZPF B;  2IVW A;  1IRX A;  4HCB A;  1T0H A;  4C0D B;  1JXO A;  4MMK A;  3AT1 B;  4RCB A;  2RQV A;  5AYF A;  3R07 A;  2X3X D;  4IUU A;  1YJN Q;  1VQ5 A;  4YRP A;  1UG1 A;  1OEB A;  2LC4 A;  2RNA A;  1M1K R;  3I56 T;  5KYY B;  4BE0 A;  2Q5H A;  2DD5 A;  4M78 B;  2QK0 A;  1X6O A;  1WJQ A;  1VA7 A;  4X1V A;  3CCM Q;  5HGQ A;  1FYN A;  4NL3 A;  1X2H A;  1NEG A;  2HMA A;  5LJ3 d;  2XDB A;  4EO4 A;  1WHL A;  1PKT A;  3E9G A;  2J3L A;  2XDD A;  1D3B B;  1UGV A;  1YJ9 A;  5CKB A;  1YI2 A;  2V8J A;  2KRN A;  5I2M A;  3QKJ A;  2HQX A;  2LMJ A;  3VUZ A;  2AIR B;  4A4G A;  1VQP Q;  1YFR A;  2LT4 A;  3SB2 A;  1AOJ A;  2LQK A;  1TWB A;  4AG2 C;  1M2V B;  2PNI A;  4YRO A;  4CS4 A;  5J26 A;  4YDQ A;  2IG0 A;  1K73 C;  4HCZ A;  1KQ2 A;  3EGD A;  3JCM P;  4RQE A;  2ENM A;  4M78 D;  5GAN h;  3M0U A;  2EQI A;  1IB8 A;  1JJ2 P;  4M7D E;  1Q7Y U;  3OYM A;  1K8A U;  3J7A F;  2X35 A;  4TQF A;  4M7D F;  4MZM A;  5GAN 3;  2RI5 A;  1QVF S;  4JRP A;  5GAO r;  2OTJ T;  1YFT A;  3CQT A;  4M7A G;  4EMK B;  1AVZ C;  4DBF A;  2L3S A;  3OS1 A;  3CCU T;  1X2Q A;  3E9F A;  1YIJ Q;  4IUP A;  3UA6 A;  5KYN A;  5LJ3 g;  5GAN 7;  2L8D A;  4M77 G;  3HRU A;  1JBM A;  4XU1 A;  3IKM B;  2EQU A;  3ULR B;  4VUB A;  4M77 C;  1BBU A;  4GLM A;  1MMG A;  3DB4 A;  3IKL A;  2XMF A;  2ZPI B;  2ZIO A;  3OSS C;  3S3M A;  4CC3 A;  1YIT A;  1K1Z A;  3RUX A;  2CYZ B;  3M57 A;  4K86 A;  1NM7 A;  3RGL A;  2YUP A;  1K76 A;  5FWB A;  2HSE B;  3RF1 A;  1JB0 E;  3M55 A;  4C5H A;  4V2S A;  4EIK A;  1E7O A;  1VQ7 Q;  4ZNX A;  4LNS A;  3JB9 D;  1H4V B;  2L0A A;  3HXX A;  2G4C A;  4TTV A;  2KI7 A;  5DLO A;  2JM8 A;  1MHN A;  1OQK A;  5ELN A;  4FM4 B;  4BY6 C;  3KUF A;  5A0G A;  3NTK A;  1IHV A;  4M75 E;  2QQA A;  3TQ7 P;  1ADJ A;  1C1A A;  1NNH A;  3EFS A;  2JXB A;  2NUP B;  1B8A A;  3G4S T;  2NYS A;  3JB9 F;  8AT1 B;  2AT1 B;  3HFZ A;  3CCE Q;  3R6N A;  1Y57 A;  1KQS P;  3CME T;  5GMK h;  2E5A A;  3A7U A;  5FU6 B;  2DVJ A;  3NFC A;  5A2Q E;  1CSK A;  3PNW C;  2KXD A;  2NS6 A;  2QEX A;  3REX A;  1IRE B;  3HFN A;  1NE8 A;  3HL8 A;  1X43 A;  3D7S B;  1EIY A;  1QQJ A;  2DE0 X;  2DM1 A;  2A8E A;  3M0P A;  3SEM A;  4KGV B;  1AT1 B;  5KYU B;  2R5M A;  5DY9 A;  3INZ A;  3LW5 E;  1NPR A;  1EIF A;  4PK4 A;  3BDL A;  4ZN1 A;  3CCJ T;  3A7R A;  3JB9 J;  3JCM h;  4H2X B;  4LDY A;  2ZPE B;  5I22 A;  4LD9 K;  2ED0 A;  2E3H A;  3H0F A;  4JPB W;  2DX1 A;  1E1T A;  1K0X A;  3A74 A;  4BE2 A;  4YTL A;  1OZ3 A;  1SG5 A;  2EGC A;  4M7D G;  1X27 A;  1WYX A;  4HVU A;  3V7S A;  3OYA A;  1Q81 C;  2E41 A;  4M7D C;  4LVI A;  4KH0 B;  1KHC A;  2B86 A;  2RQU A;  5GAN d;  2A28 A;  2O4X A;  4E51 A;  1D1B A;  5CVI A;  5HK3 A;  4RTY A;  2ECZ A;  1KMM A;  3H0H A;  1SSF A;  5I21 A;  1MUZ A;  3DLL A;  2E70 A;  3VS4 A;  3L2V A;  1U8R A;  4RTZ A;  4YRN A;  2EAY A;  1YFN A;  4QVD A;  1Z9Q A;  1Q82 R;  2CP3 A;  4EMH A;  3EH1 A;  4ELY C;  2PQW A;  3CCS Q;  4PFP A;  4II1 A;  3QJ6 A;  5KYY A;  4M78 A;  2RF0 A;  3X28 B;  2QG9 B;  3JCM Q;  4PLI A;  1I8F A;  1M5Q 1;  3ERR A;  3VQY A;  2NWM A;  3MEV A;  1D3B A;  4LVK A;  3BE3 A;  3P8B B;  3CCR A;  1KD1 U;  1M3C A;  2EKO A;  2M02 A;  3I55 T;  1QVG A;  5F5W A;  4P75 A;  3QWY A;  3EGX B;  1YWP A;  3OW2 A;  3OSV A;  3JB9 H;  5KCH A;  4MML A;  5GAN g;  3OA6 A;  1UB4 A;  3WVE B;  1M2V A;  2QXF A;  2DTI A;  4J7I A;  1UE9 A;  1WJR A;  1EX4 A;  2HL5 C;  3JV3 A;  3JCM W;  3OYJ A;  1YN8 A;  4EMK C;  2P0Q A;  3OYC A;  1AD5 A;  3JB9 G;  1H4T A;  2LNH B;  1YJW T;  3I35 A;  2XIC A;  2XU8 A;  1K4U S;  4J5Y A;  4XAX B;  1X2G A;  4Z8A A;  3EG0 A;  2E12 A;  2K5L A;  4GBQ A;  1WGS A;  2P4T A;  3A5Z B;  1ACM B;  1PG5 B;  4EDU A;  1WJS A;  2E5K A;  1KJW A;  3JCM f;  1W6X A;  3A98 A;  2JMA A;  4EMK A;  3L2Q A;  2F69 A;  3VQX A;  1YNZ A;  2JW4 A;  1C0A A;  1VQK Q;  2M16 A;  2QQS A;  5GAM e;  1CKB A;  1RAG B;  4PKC C;  1VQ6 Q;  3CCL A;  4XU2 A;  1NLP C;  1VQZ A;  4E2F B;  4OMM A;  2KT8 A;  4A4H A;  4E7S A;  2RHS B;  2I0N A;  4QQD A;  4L6V 5;  4WJ3 M;  2QQB A;  1NEB A;  1N6A A;  1K9M U;  2BUD A;  3KFU A;  2DVE A;  2O01 E;  2CS7 A;  2J7I A;  4ME7 A;  4KUD K;  1R77 A;  4CC2 A;  2I4N A;  2ZZE A;  2E10 A;  1TG0 A;  2EQJ A;  4CH6 A;  4P73 A;  3CPF A;  1D1A A;  1HK9 A;  1NG2 A;  3M53 A;  3L42 A;  3I9Q A;  2Q7G A;  2E6Z A;  2YXY A;  3MEY A;  1T0J A;  2HCK A;  1UUE A;  3CC7 T;  5CKF A;  1X75 C;  1QCN A;  1IL2 A;  2RA2 A;  2HQH A;  4KBM B;  1DJ7 B;  1X6B A;  2WAC A;  4CI0 C;  4NL2 A;  4Y91 A;  2NUP A;  1EFW A;  3A1P A;  3SWN C;  3MQZ A;  2R5A A;  1H92 A;  4BI4 A;  4XTV A;  1NJ8 A;  2DL8 A;  3QXE B;  3E9H A;  1ASY A;  2XID A;  3VS5 A;  4F7U F;  5KCO A;  2ODR C;  3FJ5 A;  1ZSG A;  1W70 A;  4MDX A;  2RJE A;  2FZC B;  2KQW A;  1X69 A;  2WSE E;  2CZ1 B;  4HT9 A;  3CPW A;  4X9D A;  2CGH A;  3KFV A;  2MMP A;  1QVF P;  5KNN A;  2DO3 A;  5I11 A;  3JCM X;  4HWP A;  1YBY A;  5KYU A;  2XD0 A;  2RHZ A;  1WYD A;  2DL4 A;  2EYQ A;  3I56 A;  3JSC A;  1SHF A;  4ZTU B;  1UEC A;  3EG3 A;  2KEA A;  2QA4 T;  2VVK A;  4H2X A;  1M30 A;  2EYX A;  3S6W A;  1GL5 A;  4NCX A;  2OAW A;  1G3S A;  1NJ2 A;  2A37 A;  1KC8 R;  3FIF A;  3VS0 A;  1L0W A;  1N5Z A;  2DTO A;  1AWX A;  1NJI C;  2KDS A;  3MKD A;  1AWJ A;  3MEU A;  2CP7 A;  3MJX A;  1PWT A;  1LVK A;  3VJP A;  3VKI A;  4PNO A;  2FG0 A;  3RDV A;  1ADY A;  2X51 A;  1M1G A;  1U1T A;  3KXT A;  4GLK A;  3LLR A;  2MF2 A;  1ZUK A;  1VQ4 T;  3REU A;  5CKH A;  4LE9 A;  4C0F A;  2ZZF A;  2B8A A;  1GCQ C;  4OMO A;  1FMK A;  1WHH A;  3JCM c;  3S3N A;  1H4Q A;  2Q7H A;  2M1H A;  5IHK A;  4IUQ A;  2MCN A;  4XEO A;  3UH0 A;  3AHU A;  3OYL A;  2LCL A;  2O9S A;  3TUP A;  5FRM A;  2DXB A;  4YRS A;  1OX8 A;  4P74 A;  4D8D A;  1SF9 A;  4YCU A;  3CCQ Q;  2FPD A;  2NUZ A;  1LYL A;  4ZIB A;  3A5Y A;  3CBO A;  1S72 Q;  2EQK A;  3EGX A;  1SPK A;  4KQE A;  4UC4 A;  2MWP A;  4P71 C;  4PFZ A;  4DEX A;  5CKE A;  4LVM A;  3TEG A;  3SD4 A;  2AZV A;  1VQ5 Q;  1H64 1;  4QVZ A;  4XK8 E;  4P72 A;  3IAL A;  4H2S A;  2E6N A;  3QTC A;  5EC7 A;  4EMG A;  2O2O A;  4H2U A;  5A0L A;  3X25 B;  1YIJ T;  1LCK A;  1W66 A;  1N8R R;  2QYZ A;  4F7U G;  4KT0 E;  4M7A B;  1YJ9 Q;  3P8Y A;  2EKH A;  2AKL A;  1B76 A;  1YI2 Q;  3A5Z A;  4XTZ A;  4A4E A;  4C5G A;  2X4Y A;  4OB0 B;  1M90 R;  2CH4 W;  4M77 B;  1VQ9 A;  3LSQ A;  3UFG A;  5GAO l;  1SRY A;  2GFA A;  1A0N B;  3QG1 A;  2IIM A;  3UAT A;  1VQ7 T;  1VQ8 Q;  2MWO A;  1WIE A;  5GAN 2;  1G2B A;  1H3H A;  4RUG A;  2DER A;  1YGB A;  1NYQ A;  1U3O A;  3CME A;  3MP6 A;  3OYB A;  2DU7 A;  4M7A D;  5E3I A;  4HCK A;  2RHS A;  1AWO A;  1JEG A;  4AFQ C;  4B6M A;  3VBB A;  3VS3 A;  2DL3 A;  1PCX A;  3VYG A;  2J3M A;  1Z9Z A;  1UFF A;  5GAN 6;  2P0P A;  2RQT A;  4BY6 B;  2SRC A;  2M0Y A;  5D6W A;  3CCE T;  4FT2 A;  4J83 A;  2PZ1 A;  1G8X A;  4M7A F;  2KSS A;  1KQ1 A;  2YUN A;  4XU0 A;  3OBY A;  1YIT Q;  1UGR B;  2D0N A;  1U5S A;  4PL6 A;  2VC8 A;  2ZGW A;  1ZA1 B;  2E64 A;  1PYS B;  2JTF A;  2Y4X A;  2FYK A;  2K79 A;  1F1B B;  4JLI A;  3OYN A;  3TSZ A;  4XU3 A;  1M1K U;  3CEY A;  5D6Y A;  3NEM A;  1BBZ A;  2EQM A;  3VUB A;  4YRQ A;  3RMS A;  5CO7 A;  1BI2 A;  3T9N A;  2L5Q A;  1WQ7 A;  2JTE A;  1M8M A;  2P0L A;  1H3Z A;  4ORZ A;  3GBQ A;  3QYH B;  3I5R A;  4HXJ A;  5LJ3 f;  3H6Z A;  2XKO C;  2BE7 D;  3IG2 A;  4YRR A;  5GJW B;  3A8M B;  4M7D B;  4HT4 A;  2FEI A;  2WSF E;  2DAQ A;  2KAF A;  4J9F A;  1PKS A;  2OTL A;  1I81 A;  4RMO A;  3A8G B;  5L8R E;  4LDW A;  4CRI A;  3PMI A;  1BYM A;  3G7Z A;  1Z7M A;  2DQ3 A;  2OAU A;  3I55 A;  2ZPH B;  2QEX Q;  2HBW A;  4DBR A;  4OB2 B;  2L3R A;  3ZEH A;  5C6S A;  2DRK A;  3OYK A;  2AK5 A;  3CCS T;  5IXF A;  5IHI A;  1ZSZ C;  2DBM A;  3L2U A;  1EOV A;  3MCA B;  1XQH A;  3RER A;  1RI9 A;  4IKF A;  4CS3 A;  3REA B;  4PJM A;  2COY A;  4BI8 B;  4E47 A;  2CZ6 B;  4J7F A;  4C8Q E;  3G71 A;  1GFD A;  2JVV A;  4M7D D;  3VU3 C;  2KE9 A;  4C8Q F;  3P8H A;  1FX7 A;  4PJN A;  2V1Q A;  4RG8 A;  1K73 R;  3CD6 A;  2G6F X;  5LJ5 f;  2DTH A;  1VYT A;  1TUC A;  5DLQ E;  4RDX A;  3RKW A;  4JUV A;  1B07 A;  2A36 A;  2JZ2 A;  1NYR A;  1D09 B;  3NEN A;  4TVR A;  1X54 A;  3HRK A;  2VGN A;  1BIB A;  3QHS A;  1MMD A;  2F2V A;  2CJ9 A;  3QYG B;  2E4H A;  4E7L A;  1Q86 C;  1VQN A;  2ARU A;  1KHI A;  5C53 B;  1NYG A;  1VQO A;  3QPH A;  3L2R A;  1B7Y B;  4LDV A;  4M75 B;  2E3I A;  4M7A C;  1GCP A;  2DK3 A;  2JMC A;  1GRI A;  2ARS A;  3M0Q A;  2CP5 A;  3C0C A;  4Y28 E;  2EPD A;  3CBP A;  3OS2 A;  2DZC A;  2HAX A;  5GAO p;  4IIO A;  1BCM A;  3CC2 A;  4H02 A;  3VQV A;  2JNG A;  1VQK T;  4QT7 A;  4JJB A;  3VS6 A;  3MO8 A;  3CXC P;  1Y7X A;  3E19 A;  1HJD A;  2RO0 A;  1VQ6 T;  4O6J A;  1SET A;  3A7A A;  4M7A A;  3CCR Q;  4YPF A;  4RG2 A;  2HBP A;  1HTT A;  4L87 A;  3V8J A;  3P8D A;  4JJN K;  2CSI A;  1Z7N A;  1MV3 A;  4M77 A;  1J3T A;  4J15 A;  1UEB A;  3OS5 A;  4M75 D;  3GP8 A;  4Z89 A;  4JS5 A;  5HY6 A;  4P3P A;  5J39 A;  1RAH B;  2DZ9 A;  4ZTF A;  2QHU A;  2DJZ A;  5GAM j;  2L3Q A;  1Q7Y C;  1K8A C;  3H8Z A;  1Y96 B;  4M4Z A;  3A8L B;  2GGR A;  1G51 A;  2RHQ B;  4AFS C;  3PMT A;  2GF7 A;  2EBP A;  4M75 F;  5GMK i;  1WZO A;  3W3S A;  2HZY A;  4BE1 A;  4MDW A;  3OBW A;  4DEY A;  3M54 A;  4OF1 A;  1B70 B;  2LQN A;  4H2W A;  1T3L A;  1HSQ A;  1R0B G;  1OYX A;  8ATC B;  1AZE A;  3L4G B;  5AT1 B;  3CCL Q;  2ZTG A;  1C0M A;  5GAN 8;  3SWN B;  4J9I A;  1KFZ A;  5DM7 R;  2Z0W A;  4C8Q G;  1NPP A;  2J06 A;  5GAN f;  3MEW A;  1VUB A;  1O75 A;  4FT4 A;  2ABL A;  5LL6 S;  4C8Q C;  3A8O B;  2QQR A;  2V1R A;  3OYF A;  3CCV A;  2DPP B;  4F17 A;  3NPF A;  1W1F A;  1JQQ A;  1PYS A;  1Q82 U;  1VQM T;  2C0T A;  2RHY A;  2LRQ A;  4QKU A;  4F04 B;  2D8J A;  4YRC A;  1Q81 R;  1NZ9 A;  5J3B A;  1USY C;  4DBH A;  4AG1 C;  1VQ4 A;  1X56 A;  4ESR A;  1PSF A;  12AS A;  4HWO A;  4RTT A;  1W2B A;  1KOG A;  2ZNI A;  3E2U A;  2EGA A;  2ODR D;  4AH6 A;  1RUW A;  2ZPB B;  4M7D A;  4RMF A;  4KH1 B;  2GCX A;  4IUV A;  1ZBJ A;  2EJ9 A;  1EZZ B;  2DXU A;  4FU6 A;  4BDY A;  3E1S A;  2C7I A;  1OZ2 A;  2LZ6 B;  4FW2 A;  3L1A A;  2DEQ A;  3HXW A;  3TCJ A;  2ZCF B;  3BDU A;  4PJL A;  1RL2 A;  3FB9 A;  1QWE A;  2IY5 B;  5EG2 A;  2ART A;  3ER0 A;  3M4G A;  2EYW A;  2KY9 A;  3PE0 A;  1IHW A;  3OYY A;  3CCQ T;  3FC3 A;  2QHT A;  4KGX B;  2CZ0 B;  5C51 B;  3EFR A;  3EG9 B;  4MZP A;  1CKA A;  1B7T A;  4C92 E;  1S72 T;  1NJ6 A;  2DXT A;  1VYV A;  1UHC A;  2GFU A;  3TSW A;  2KMT A;  2R58 A;  1E1O A;  2LCC A;  4M75 G;  3GOX A;  5GAM d;  1FMV A;  1ZHI A;  2D0Q B;  1HC7 A;  4JLG A;  4M75 C;  4WF2 A;  4ZGJ B;  2LX7 A;  3G6E A;  2CUB A;  2EIF A;  3ZL7 C;  1JO8 A;  1WLE A;  2QHV A;  3HSB A;  1XJW B;  1YJ9 T;  4P3O A;  4KUI A;  3URG A;  1X01 A;  3JCM J;  1YI2 T;  1B7Y A;  2CUD A;  4M75 A;  3V7R A;  3J81 E;  2RB6 A;  1QF6 A;  2Y90 A;  3DKM A;  2YRD A;  2ZR2 A;  4KR3 A;  3EHQ A;  4UP8 A;  4F7U B;  4XTW A;  3OD1 A;  5GAO n;  4K88 A;  1B3Q A;  3L2W A;  3NTH A;  1RAF B;  1VQ8 T;  1KD1 C;  5CKD A;  2I4L A;  4C5E A;  4ZTZ B;  3WVD B;  3M4Y A;  4CH5 A;  1XOV A;  2OX7 A;  2QDL A;  1S1N A;  1EVL A;  4L59 A;  4DOW A;  2KXC A;  4J6W A;  4RQF A;  1I1J A;  5GAM g;  2DBK A;  3C94 A;  1SHG A;  1YHQ A;  4TQD A;  4IUR A;  1JU5 C;  1D0Y A;  2VB6 A;  4J9G A;  1D0X A;  2YHT A;  3NEL A;  1IZ6 A;  4N0A C;  3CC4 A;  5I2S A;  4C0Z A;  1PRL C;  3LGL A;  2VWF A;  3CMA T;  3M4Q A;  4WJ4 A;  1MV0 B;  1Y96 A;  2RN8 A;  3VYH B;  3SFM A;  2RHQ A;  2KT1 A;  3PZC A;  2FHD A;  3THK A;  3HRI A;  4N0A A;  1VQ9 Q;  2KRM A;  3RKY A;  3TEH B;  4QQG A;  1VQL T;  3HPW A;  2KVQ G;  2Q7E A;  3UWN A;  3QO7 A;  2QAZ A;  1KC8 U;  2FO0 A;  2PUO B;  2A0F B;  1B70 A;  2EGE A;  3H41 A;  2SEM A;  4N4I A;  1FYF A;  3UF4 A;  3H0I A;  3FEO A;  2PVD B;  1WHG A;  4ATO A;  2D8H A;  3VRY A;  3JCM e;  3L4G A;  2RQR A;  2HNI A;  3CMQ A;  3SWN A;  2XK0 A;  4LVL A;  3CME Q;  4J6X A;  1ZUU A;  2O9V A;  3OYI A;  2JUF A;  2LTO A;  3O8V A;  4JRI A;  3OY9 A;  4Q15 A;  4J8O A;  3CXC S;  2DL5 A;  2VXE A;  4C92 G;  4GY5 A;  1K9M C;  2GQI A;  3BY7 A;  2O88 A;  2VAS A;  1WXT A;  4YRF A;  4E7H A;  4N4H A;  4X34 A;  5GMK l;  1NJI R;  2DD4 A;  1D0Z A;  5FU7 C;  3M0T A;  3M0S A;  2ZXF A;  6AT1 B;  4OB3 B;  2CP0 A;  3NGP A;  2CT4 A;  2LNV A;  5CQY A;  4BDZ A;  1JJ2 A;  1XTD A;  1YJN T;  2QEX T;  3HXZ A;  2CT3 A;  5FRO A;  4F16 A;  3DSQ A;  2JN0 A;  3CCM T;  4FW1 A;  3HY1 A;  1OU9 A;  2HKN A;  2K5F A;  1MGQ A;  2COZ A;  2YDL A;  1ZSZ B;  2VYT A;  3DLM A;  1RAC B;  3OYG A;  5CK9 A;  5D7U A;  2XHC A;  2P5I A;  4QQ6 A;  1B34 B;  1M3B A;  3PT9 A;  1VQP T;  4PJO E;  4OGC A;  3UGQ A;  2OTJ A;  1BBW A;  1N8R U;  5C52 B;  2MAM A;  1UGS B;  2RHU A;  1EQR A;  3CCU A;  4EX5 A;  1GCQ A;  2IY5 A;  4KUL A;  3N5B B;  3NHN A;  3HHT B;  3GF5 A;  2QDY B;  3VRZ A;  1M90 U;  2W10 A;  2E1H A;  4A54 A;  1XNI A;  3A8H B;  2OTL Q;  4ZTJ A;  4FYX B;  3WXM B;  1RAD B;  2DKG A;  2KRS A;  3A31 A;  3EG9 A;  2ZAE A;  4JJD A;  2D6F A;  2NLU A;  3I55 Q;  1GFC A;  1TU0 B;  3VS7 A;  3HXV A;  1ZLM A;  3F70 A;  2DIQ A;  2KBT A;  2EJG A;  3C95 A;  3H9N A;  2ZT5 A;  1W2B P;  2YRV A;  1E6G A;  1KG1 A;  4P71 A;  2CSQ A;  2AZS A;  4LUD A;  2QGG A;  1WHJ A;  1W4S A;  1ZQ1 A;  1HXD A;  3FRN A;  3HRT A;  3G71 Q;  3OYH A;  1BK2 A;  1KQS A;  4BWA A;  2FZG B;  4YRT A;  4R55 A;  9ATC B;  3CD6 Q;  2CIM A;  2K57 A;  1PD0 A;  4R0K A;  2EJF A;  2IPO B;  4JRK A;  4F7U A;  5LJ3 j;  3G4S A;  2LQW A;  2X4W A;  2BZX A;  1RAA B;  1V29 B;  1I4K 1;  1QVG P;  2A7Y A;  2GBQ A;  2PVO B;  1G3Y A;  1M2O A;  2ZCE A;  1ATI A;  1NJ1 A;  1Y71 A;  3OW2 P;  1X2K A;  4A4F A;  1VQN Q;  2FPF A;  3LC0 A;  2LJ0 A;  1VQO Q;  2AKW B;  4J9D A;  4RTX A;  3O5Z A;  2Y4Y A;  3CCJ A;  1VIF A;  3CC2 Q;  3QO3 A;  5KYX B;  1G3W A;  4O2D A;  4DA4 A;  4FL6 A;  1VQM A;  2P4R A;  4ZGE B;  4ELZ C;  4HWS A;  3CCL T;  2QI2 A;  2FRY A;  5HCK A;  4FSS A;  2DIL A;  3EG2 A;  3WQZ A;  4PHC A;  1LOJ A;  3V8K A;  4IUT A;  2AMC B;  4F14 A;  5LJ5 j;  2K6D A;  2XG8 D;  1Q95 G;  5FLX E;  4PJO G;  3E9I A;  1E22 A;  3TEH A;  1JXM A;  2LP5 A;  1WHM A;  2PTK A;  3REB B;  2PMF A;  4J9C A;  3ZFJ A;  3QDR B;  4QVC A;  4PJO C;  3UT1 A;  3BFM A;  4C5I A;  4C8Q B;  4M77 E;  2YSQ A;  1ABQ A;  1PSE A;  1SRM A;  3M58 A;  4A63 B;  4O5V A;  3M9Q A;  2YLC A;  1VIE A;  4Z02 A;  3QSU A;  3QO8 A;  3P8T A;  1YP5 A;  2MYS A;  4JJC A;  3PIO A;  4J9E A;  1U1S A;  1V1C A;  1QWF A;  1IO6 A;  4YCV A;  2L3P A;  2RQW A;  5IXB A;  1WI7 A;  1BU1 A;  4YCW A;  1WHK A;  1AWW A;  4XEM A;  1WX6 A;  2ZT7 A;  2DIG A;  4WTO B;  4H2V A;  1VOM A;  4X9C A;  1FWZ A;  2PUK B;  3VV0 A;  3BW1 A;  4C8Q D;  3G1Z A;  1EVK A;  1RLP C;  2O31 A;  1BI3 A;  3MP1 A;  2I2L A;  3JCM V;  1YCS B;  1JRI A;  2DMO A;  2FRW A;  4BAC A;  4A53 A;  2BZ8 A;  4C0G A;  1RIQ A;  1X6G A;  1HD3 A;  1S72 A;  3LSS A;  1RAI B;  1GXI E;  1UHF A;  3RIR A;  3M4P A;  1NYF A;  3OYD A;  3CCV Q;  1G5I A;  3EFO B;  4E7Z A;  5K1X A;  5C0M A;  4CC4 B;  2CH4 A;  4TWA A;  5GAN 4;  4D8K A;  2CDT A;  4IIM A;  2DRM A;  4DQ2 A;  1YJW A;  4AT1 B;  2K4Y A;  1ZSZ A;  1RI0 A;  4DBQ A;  1RAB B;  2BTT A;  4FCY A;  1M1K C;  2EVR A;  1BI1 A;  1AEY A;  1B34 A;  3CPW P;  3TVT A;  1VQ4 Q;  3GNF B;  1BI0 A;  3NMZ C;  1Y0M A;  4E7I A;  2CRE A;  2KRO A;  1E24 A;  1UGP B;  5KH6 A;  3ZBD A;  2NUT B;  3M59 A;  1Q86 R;  2DLP A;  1WXU A;  4FYV B;  2RHX A;  1ASZ A;  2A08 A;  2XTI A;  2I4M A;  2WSC E;  1TH7 A;  2QAS A;  1I07 A;  2DQ0 A;  3TEE A;  3L2Z A;  5LJ3 e;  4YP0 A;  1M9S A;  1OX9 A;  1VQ8 A;  4XTY A;  1IXD A;  4PG3 A;  5GAN j;  2VGM A;  3GNG A;  3FDR A;  2A3L A;  3TU4 K;  1KIK A;  2JJ9 A;  3X26 B;  3RR6 A;  1YWO A;  1TOV A;  1SSH A;  3SDZ A;  2BE9 B;  3HFV A;  5ECA A;  2ZPG B;  2DDZ A;  2HEQ A;  4M78 E;  3PIP A;  2J6O A;  2BKD N;  2D1X A;  3ME9 A;  5LJ5 d;  5IN1 A;  1OI1 A;  2QQ9 A;  4M78 F;  1QVP A;  1OU8 A;  4Q6G A;  3P8V A;  1WU7 A;  3CMA A;  4A4K A;  2DEU A;  1M4Z A;  1UJ0 A;  1OPK A;  3CC7 A;  2ZZG A;  1OV3 A;  2ZT6 A;  4LXC A;  4YRK A;  2QTV A;  4LUE A;  1Q7Y R;  2RK2 A;  2JTM A;  1K8A R;  3QZ5 B;  3JAM E;  3PTA A;  1JJC B;  1N9S A;  1IGQ A;  5GAM h;  1VQL A;  2AKK A;  1QVF A;  2HKQ B;  1M27 C;  1WQW A;  3OQ5 A;  3QBY A;  1M1F A;  2R57 A;  5LJ5 e;  3G6E Q;  2DF6 A;  2W0Z A;  2I4O A;  2CKK A;  3R6O A;  3UGT A;  4HVV A;  4OVA A;  3QII A;  5CR2 A;  4HVC A;  3VS2 A;  1PRM C;  2C0I A;  2ED1 A;  2LQ8 A;  1C6V X;  3JCM b;  2YRC A;  2AKW A;  1Q81 U;  2CJA A;  2ZT8 A;  1VQ9 T;  1WFW A;  2RI3 A;  4OGE A;  4Q5W A;  2V26 A;  3M0R A;  2DL7 A;  3EGU A;  2QA4 A;  5KYX A;  5L23 A;  2HD0 A;  3MP8 A;  5LJ5 g;  2RPN A;  1QLY A;  1WLP B;  4OMQ A;  1PM3 A;  2MOX A;  4RKU E;  1W2B S;  5CCA A;  5GMK j;  1ZA2 B;  2AMC A;  1GBQ A;  2F2W A;  2DET A;  2DXC A;  1YJN A;  3U23 A;  2VV5 A;  1YHQ Q;  2GTJ A;  2BIV A;  4YRL A;  2MK5 A;  3C4S A;  2Q5I A;  3CCM A;  1QP3 A;  3RNJ A;  2E5Q A;  3RL6 A;  4C8Q A;  2DYI A;  1KK7 A;  3CC4 Q;  4KR2 A;  3M5A A;  2LCS A;  3LWH A;  1FXX A;  3J80 E;  4C92 B;  4LDU A;  2H8H A;  1VQP A;  1ARK A;  4HWR A;  5GAO q;  4CS2 A;  5FU7 B;  1QVG S;  3OB9 A;  1USY A;  1UTI A;  1LJO A;  3MPU B;  3GLX A;  2KNB B;  4PLL A;  2ATC B;  1OUL A;  2HL3 A;  2K3B A;  3OW2 S;  4BD3 A;  4C0D C;  5GJV B;  1BIA A;  4CH3 A;  1RLQ C;  3ASK A;  4RTW A;  5CIU A;  4BW9 A;  4B9X A;  3V8L A;  1I5O B;  4M78 G;  1NLO C;  3HKS A;  2QHS A;  3RMQ A;  5GAM f;  2ZIN A;  5A0D A;  5IT9 E;  4M78 C;  2LX9 A;  2RI2 A;  2K7A A;  4FYY B;  2ROT A;  4B9W A;  4C92 D;  3FJP A;  2JS0 A;  2EW3 A;  3I56 Q;  4BUG A;  3EFO A;  1UGQ B;  1SEM A;  2FVU A;  5GAN e;  1YIJ A;  1Q82 C;  4J9H A;  3QWX X;  1SRL A;  3RAC A;  3EAE A;  1G5H A;  4P75 C;  2AHJ B;  3LH5 A;  4NS5 A;  3GPL A;  2OTL T;  4ANJ A;  4C92 F;  2ZZD A;  4HVW A;  2VKN A;  3OYE A;  1UDL A;  5M9O A;  1VQ5 T;  3Q1J A;  1QMC A;  2HDA A;  4WCI A;  2NUT A;  11AS A;  5K1P A;  2H3J A;  1WPY A;  4OMF B;  1VQ7 A;  5KYW B;  3EG1 A;  4WI1 A;  4LVJ A;  4RTV A;  4KRT A;  4LD6 A;  4YYE A;  2ZNJ A;  2YLB A;  5D6X A;  4HWT A;  3G71 T;  1LPL A;  1G5V A;  4AMC A;  2OTJ Q;  1RAE B;  2EL9 A;  3NTI A;  4X5O A;  3CD6 T;  1YCY A;  4OP0 A;  4MZT A;  3SHW A;  2RMO A;  1OPL A;  2C0O A;  4DOV A;  3CCU Q;  2LVM A;  3FLG A;  1KD1 R;  4OB1 B;  3PCO B;  2MPX C;  4ZGD B;  3S3O A;  1K0S A;  1H8K A;  1TS9 A;  2E3C A;  2JOY A;  4OMP A;  3A32 A;  3LX7 A;  4N4G A;  3HY0 A;  4LDX A;  1Y07 A;  3CCE A;  4YRE A;  1PNJ A;  1O9S A;  3QDF A;  2H3E B;  3QO5 A;  1LNX A;  2ALY B;  3BJU A;  2E65 A;  3LGF A;  4XTX A;  3UA7 A;  1VQN T;  2VXF A;  2GNC A;  4HKE A; 
#chains in the Genus database with same CATH homology
 1VQO T;  4DPG A;  1KMN A;  4XQ3 A;  1ZBX A;  1SER A;  3KBG A;  4HT8 A;  1JJC A;  4P73 C;  3CPW S;  4H2Y A;  3JCM d;  1NJ5 A;  5GMK e;  3CC2 T;  3X24 B;  4XTU A;  4TVY A;  2FL7 A;  2K2V A;  3M56 A;  2KK4 A;  4JDS A;  3DB3 A;  4TVA B;  1YIT T;  3I7F A;  4UPA A;  1NJI U;  4ZN3 A;  1GGM A;  5FU6 C;  4BB7 A;  2HQE A;  1JJ2 S;  4TVW A;  4EPC A;  3MF1 A;  2P0K A;  5KE2 A;  4F7U E;  4PJO B;  1QP2 A;  5ELO A;  4J6Y A;  3UDC A;  3X20 B;  3OS0 A;  2X4X A;  3JRZ A;  2RJD A;  3CCS A;  1I5L A;  4G85 A;  4C92 C;  2LT1 A;  5IAY A;  4R56 A;  3JCM g;  5FRN A;  2X4J A;  3PGG A;  3ICA A;  2VUB A;  1SES A;  2K5I A;  4C92 A;  3LWI A;  3LYI A;  3HP9 A;  2V8I A;  4YRI A;  4PJO D;  3MHX A;  2C06 A;  4BI3 A;  2K3X A;  2RM4 A;  4QW2 A;  1KC8 C;  3CCV T;  4UP7 A;  1YFS A;  4RCC A;  4CH4 A;  2EWN A;  4PJO F;  3CXC A;  4FSX A;  3QZ9 B;  3C12 A;  1QE0 A;  3JB9 I;  4P74 C;  4H2T A;  2CZ7 B;  1VQK A;  3MEA A;  1KQS S;  3QJY A;  3NET A;  4G84 A;  3RKX A;  1J5W A;  1VQ6 A;  2EFI A;  3QUI A;  2ZIM A;  4UP9 A;  3MF2 A;  4JS4 A;  2RD1 A;  2G3R A;  2CJB A;  3HXU A;  4P72 C;  3QNE A;  5KE3 A;  2PU9 B;  3HFO A;  4P3N A;  1N9W A;  5GMK m;  2XGT A;  3HRS A;  2QTX A;  3CCR T;  2L89 A;  4E7K A;  3MET A;  4P5N A;  2FB7 A;  5LJ3 h;  1N8R C;  3GIB A;  5HK0 A;  2RHI A;  2PME A;  4JRQ A;  4YRG A;  3PCO A;  2DU5 A;  1N9R A;  3LH0 A;  2C8M A;  2MI6 A;  4YRM A;  1R8O B;  1H4S A;  1M90 C;  4YRJ A;  4HA8 A;  3G6E T;  3V7C A;  2ALY A;  2PVG B;  5CQX A;  2F5T X;  4FIB A;  1YB3 A;  1P92 A;  2M0O A;  1X55 A;  3HTZ A;  4HCC A;  1N27 A;  3VQW A;  2RH2 A;  3PFS A;  3CBM A;  2ZR3 A;  2M9U A;  2RK1 A;  3UPU A;  4D6W A;  5CAI A;  1BKB A;  2D9T A;  3HFZ B;  4M77 D;  1M8V A;  5LJ5 h;  4TVA A;  4M7A E;  4L5G A;  1EIY B;  3OMG A;  2F5K A;  4E7J A;  1G3T A;  1YHQ T;  3OMC A;  5HKC A;  3HXY A;  4M77 F;  1WNL A;  3CC4 T;  4NOY A;  4K87 A;  4PJO A;  5GAO m;  4OLF A;  2XI9 A;  2RJC A;  2LDM A;  2GQV A;  1K73 U;  2K3Y A;  1QW1 A;  2XDP A;  1AHJ B;  3TRE A;  2O4X B;  2V8K A;  2RJF A;  5GAN 5;  3RES A;  3CCQ A;  1Q86 U;  2ZPF B;  2IVW A;  4HCB A;  4C0D B;  4MMK A;  4RCB A;  5AYF A;  3R07 A;  4IUU A;  1VQ5 A;  4YRP A;  2LC4 A;  3I56 T;  4BE0 A;  2Q5H A;  2DD5 A;  4M78 B;  1X6O A;  1WJQ A;  5HGQ A;  4NL3 A;  1X2H A;  5LJ3 d;  2XDB A;  4EO4 A;  3E9G A;  2J3L A;  2XDD A;  1D3B B;  1YJ9 A;  5CKB A;  1YI2 A;  2V8J A;  5I2M A;  3QKJ A;  2HQX A;  3VUZ A;  4A4G A;  1YFR A;  2LT4 A;  3SB2 A;  2LQK A;  4YRO A;  4CS4 A;  5J26 A;  4YDQ A;  2IG0 A;  1K73 C;  4HCZ A;  1KQ2 A;  3JCM P;  4RQE A;  4M78 D;  5GAN h;  4M7D E;  1Q7Y U;  3OYM A;  1K8A U;  3J7A F;  2X35 A;  4TQF A;  4M7D F;  4MZM A;  5GAN 3;  2RI5 A;  1QVF S;  4JRP A;  5GAO r;  2OTJ T;  1YFT A;  4M7A G;  4EMK B;  3OS1 A;  3CCU T;  3E9F A;  4IUP A;  5LJ3 g;  5GAN 7;  2L8D A;  4M77 G;  3HRU A;  1JBM A;  4XU1 A;  3IKM B;  2EQU A;  4VUB A;  4M77 C;  1BBU A;  3DB4 A;  3IKL A;  2ZPI B;  2ZIO A;  3OSS C;  3S3M A;  1YIT A;  3RUX A;  2CYZ B;  3M57 A;  4K86 A;  3RGL A;  3RF1 A;  1JB0 E;  3M55 A;  4C5H A;  4V2S A;  4LNS A;  3JB9 D;  1H4V B;  3HXX A;  2G4C A;  4TTV A;  5DLO A;  1MHN A;  5ELN A;  4FM4 B;  4BY6 C;  3KUF A;  5A0G A;  3NTK A;  4M75 E;  2QQA A;  1ADJ A;  1NNH A;  3EFS A;  1B8A A;  3G4S T;  3JB9 F;  3HFZ A;  3CME T;  5GMK h;  2E5A A;  3A7U A;  5FU6 B;  3NFC A;  5A2Q E;  3PNW C;  2NS6 A;  2QEX A;  3REX A;  1IRE B;  3HFN A;  1NE8 A;  3HL8 A;  1EIY A;  2A8E A;  2R5M A;  5DY9 A;  3INZ A;  3LW5 E;  1NPR A;  1EIF A;  3BDL A;  4ZN1 A;  3CCJ T;  3A7R A;  3JB9 J;  3JCM h;  4H2X B;  4LDY A;  2ZPE B;  4LD9 K;  1E1T A;  3A74 A;  4BE2 A;  4YTL A;  1OZ3 A;  4M7D G;  3V7S A;  3OYA A;  1Q81 C;  2E41 A;  4M7D C;  4LVI A;  1KHC A;  5GAN d;  2O4X A;  4E51 A;  5CVI A;  5HK3 A;  1KMM A;  1SSF A;  5I21 A;  3DLL A;  2E70 A;  3L2V A;  1U8R A;  4YRN A;  2EAY A;  4QVD A;  4EMH A;  4ELY C;  2PQW A;  4II1 A;  3QJ6 A;  4M78 A;  3X28 B;  3JCM Q;  4PLI A;  1I8F A;  1M5Q 1;  3ERR A;  3VQY A;  3MEV A;  1D3B A;  4LVK A;  3P8B B;  3CCR A;  1KD1 U;  2EKO A;  3I55 T;  1QVG A;  5F5W A;  4P75 A;  3OW2 A;  3OSV A;  3JB9 H;  5KCH A;  4MML A;  5GAN g;  3OA6 A;  1UB4 A;  3WVE B;  2QXF A;  2DTI A;  4J7I A;  1WJR A;  3JCM W;  3OYJ A;  4EMK C;  3OYC A;  2P0Q A;  3JB9 G;  1H4T A;  1YJW T;  2XIC A;  2XU8 A;  4J5Y A;  4XAX B;  1X2G A;  2E12 A;  2K5L A;  1WGS A;  2P4T A;  3A5Z B;  4EDU A;  1WJS A;  3JCM f;  4EMK A;  3L2Q A;  2F69 A;  3VQX A;  1C0A A;  2M16 A;  2QQS A;  5GAM e;  4PKC C;  3CCL A;  4XU2 A;  1VQZ A;  4A4H A;  2RHS B;  4QQD A;  4L6V 5;  4WJ3 M;  2QQB A;  1N6A A;  1K9M U;  2BUD A;  3KFU A;  2DVE A;  2O01 E;  2CS7 A;  4ME7 A;  4KUD K;  2I4N A;  2ZZE A;  2E10 A;  2EQJ A;  4CH6 A;  4P73 A;  3CPF A;  1HK9 A;  3M53 A;  3L42 A;  2Q7G A;  2E6Z A;  3MEY A;  3CC7 T;  5CKF A;  1X75 C;  1IL2 A;  2RA2 A;  4KBM B;  1DJ7 B;  2WAC A;  4CI0 C;  4NL2 A;  4Y91 A;  1EFW A;  3SWN C;  3MQZ A;  2R5A A;  4BI4 A;  4XTV A;  1NJ8 A;  3QXE B;  3E9H A;  1ASY A;  2XID A;  4F7U F;  5KCO A;  2ODR C;  4MDX A;  2RJE A;  2KQW A;  2WSE E;  2CZ1 B;  4HT9 A;  3CPW A;  4X9D A;  2CGH A;  2MMP A;  5KNN A;  2DO3 A;  4HWP A;  3JCM X;  1YBY A;  2XD0 A;  2RHZ A;  1WYD A;  2EYQ A;  3I56 A;  3JSC A;  4ZTU B;  2QA4 T;  4H2X A;  3S6W A;  4NCX A;  1G3S A;  1NJ2 A;  3FIF A;  1L0W A;  2DTO A;  1NJI C;  2KDS A;  3MEU A;  3VJP A;  3VKI A;  4PNO A;  1ADY A;  1M1G A;  1U1T A;  3KXT A;  4GLK A;  3LLR A;  2MF2 A;  1VQ4 T;  3REU A;  5CKH A;  4C0F A;  2ZZF A;  2B8A A;  1H4Q A;  3JCM c;  3S3N A;  2Q7H A;  2M1H A;  4XEO A;  4IUQ A;  3UH0 A;  3AHU A;  3OYL A;  2LCL A;  3TUP A;  5FRM A;  2DXB A;  4YRS A;  4P74 A;  4YCU A;  1LYL A;  4ZIB A;  3A5Y A;  3CBO A;  2EQK A;  4KQE A;  4UC4 A;  2MWP A;  4P71 C;  4LVM A;  5CKE A;  3TEG A;  3SD4 A;  1H64 1;  4QVZ A;  4XK8 E;  4P72 A;  3IAL A;  4H2S A;  2E6N A;  3QTC A;  4EMG A;  4H2U A;  5A0L A;  3X25 B;  1YIJ T;  1W66 A;  4F7U G;  4KT0 E;  4M7A B;  3P8Y A;  1B76 A;  3A5Z A;  4XTZ A;  4A4E A;  4C5G A;  2X4Y A;  4OB0 B;  4M77 B;  1VQ9 A;  3LSQ A;  3UFG A;  5GAO l;  1SRY A;  2GFA A;  3QG1 A;  1VQ7 T;  2MWO A;  5GAN 2;  1YGB A;  1NYQ A;  3CME A;  3MP6 A;  3OYB A;  2DU7 A;  4M7A D;  5E3I A;  2RHS A;  3VBB A;  3VYG A;  2J3M A;  5GAN 6;  2P0P A;  4BY6 B;  5D6W A;  3CCE T;  4FT2 A;  4J83 A;  4M7A F;  2KSS A;  1KQ1 A;  4XU0 A;  3OBY A;  1UGR B;  4PL6 A;  2VC8 A;  2ZGW A;  2E64 A;  1PYS B;  2JTF A;  2Y4X A;  2FYK A;  4JLI A;  3OYN A;  4XU3 A;  1M1K U;  3CEY A;  5D6Y A;  3NEM A;  2EQM A;  3VUB A;  4YRQ A;  3RMS A;  5CO7 A;  1BI2 A;  3T9N A;  2L5Q A;  1WQ7 A;  2P0L A;  1H3Z A;  3QYH B;  5LJ3 f;  3H6Z A;  2XKO C;  3IG2 A;  4YRR A;  3A8M B;  4M7D B;  4HT4 A;  2WSF E;  2DAQ A;  2KAF A;  2OTL A;  1I81 A;  4RMO A;  3A8G B;  5L8R E;  4LDW A;  4CRI A;  3PMI A;  1BYM A;  3G7Z A;  1Z7M A;  2DQ3 A;  2OAU A;  3I55 A;  2ZPH B;  5C6S A;  4OB2 B;  2L3R A;  3ZEH A;  3OYK A;  3CCS T;  3L2U A;  1EOV A;  3MCA B;  1XQH A;  3RER A;  4IKF A;  4CS3 A;  4BI8 B;  4E47 A;  2CZ6 B;  4J7F A;  4C8Q E;  3G71 A;  2JVV A;  4M7D D;  3VU3 C;  4C8Q F;  3P8H A;  1FX7 A;  4RG8 A;  3CD6 A;  5LJ5 f;  2DTH A;  5DLQ E;  4RDX A;  3RKW A;  4JUV A;  2JZ2 A;  1NYR A;  3NEN A;  4TVR A;  1X54 A;  3HRK A;  2VGN A;  1BIB A;  3QHS A;  2CJ9 A;  3QYG B;  4E7L A;  1Q86 C;  1VQN A;  2ARU A;  1KHI A;  5C53 B;  1VQO A;  3QPH A;  3L2R A;  1B7Y B;  4LDV A;  4M75 B;  4M7A C;  2DK3 A;  2ARS A;  4Y28 E;  3CBP A;  3OS2 A;  2DZC A;  2HAX A;  5GAO p;  4H02 A;  3VQV A;  3CC2 A;  2JNG A;  1VQK T;  3MO8 A;  1Y7X A;  3E19 A;  2RO0 A;  1VQ6 T;  4O6J A;  1SET A;  3A7A A;  4M7A A;  4YPF A;  4RG2 A;  2HBP A;  1HTT A;  4L87 A;  3V8J A;  3P8D A;  4JJN K;  1Z7N A;  4M77 A;  4J15 A;  1UEB A;  3OS5 A;  4M75 D;  3GP8 A;  4JS5 A;  5HY6 A;  4P3P A;  5J39 A;  2DZ9 A;  4ZTF A;  2QHU A;  2DJZ A;  5GAM j;  1Q7Y C;  1K8A C;  3H8Z A;  1Y96 B;  3A8L B;  1G51 A;  2RHQ B;  3PMT A;  2GF7 A;  4M75 F;  5GMK i;  3W3S A;  4BE1 A;  4MDW A;  3OBW A;  3M54 A;  4OF1 A;  1B70 B;  4H2W A;  1OYX A;  3L4G B;  2ZTG A;  5GAN 8;  3SWN B;  5DM7 R;  4C8Q G;  1NPP A;  5GAN f;  3MEW A;  1VUB A;  1O75 A;  4FT4 A;  5LL6 S;  4C8Q C;  3A8O B;  2QQR A;  3OYF A;  3CCV A;  2DPP B;  1PYS A;  1Q82 U;  1VQM T;  2RHY A;  2LRQ A;  4YRC A;  1NZ9 A;  5J3B A;  1USY C;  1VQ4 A;  1X56 A;  1PSF A;  12AS A;  4HWO A;  1W2B A;  1KOG A;  2ZNI A;  2ODR D;  4AH6 A;  2ZPB B;  4M7D A;  4RMF A;  2GCX A;  4IUV A;  2EJ9 A;  4FU6 A;  2DXU A;  4BDY A;  3E1S A;  2C7I A;  1OZ2 A;  3L1A A;  2DEQ A;  3HXW A;  3TCJ A;  2ZCF B;  3BDU A;  1RL2 A;  3FB9 A;  2IY5 B;  5EG2 A;  2ART A;  3ER0 A;  3M4G A;  2KY9 A;  3OYY A;  3CCQ T;  3FC3 A;  2QHT A;  2CZ0 B;  5C51 B;  3EFR A;  4MZP A;  4C92 E;  1S72 T;  1NJ6 A;  2DXT A;  2GFU A;  2KMT A;  2R58 A;  1E1O A;  2LCC A;  4M75 G;  3GOX A;  5GAM d;  1ZHI A;  1HC7 A;  2D0Q B;  4JLG A;  4M75 C;  4WF2 A;  4ZGJ B;  3G6E A;  2EIF A;  1WLE A;  2QHV A;  3HSB A;  1YJ9 T;  4P3O A;  4KUI A;  3URG A;  1X01 A;  3JCM J;  1YI2 T;  1B7Y A;  4M75 A;  3V7R A;  3J81 E;  2RB6 A;  1QF6 A;  2Y90 A;  3DKM A;  2ZR2 A;  4KR3 A;  4UP8 A;  4F7U B;  4XTW A;  3OD1 A;  5GAO n;  4K88 A;  3L2W A;  3NTH A;  1VQ8 T;  1KD1 C;  5CKD A;  2I4L A;  4C5E A;  4ZTZ B;  3WVD B;  3M4Y A;  4CH5 A;  1XOV A;  1EVL A;  4L59 A;  4DOW A;  4J6W A;  4RQF A;  5GAM g;  3C94 A;  1YHQ A;  4TQD A;  4IUR A;  2YHT A;  3NEL A;  1IZ6 A;  4N0A C;  3CC4 A;  5I2S A;  4C0Z A;  3LGL A;  4WJ4 A;  3CMA T;  3M4Q A;  1Y96 A;  3VYH B;  3SFM A;  2RHQ A;  3PZC A;  2FHD A;  3HRI A;  4N0A A;  3RKY A;  3TEH B;  4QQG A;  1VQL T;  3HPW A;  2KVQ G;  2Q7E A;  3UWN A;  3QO7 A;  1KC8 U;  2PUO B;  1B70 A;  4N4I A;  1FYF A;  3FEO A;  2PVD B;  4ATO A;  3JCM e;  3L4G A;  2HNI A;  3CMQ A;  3SWN A;  2XK0 A;  4LVL A;  4J6X A;  3OYI A;  2JUF A;  2LTO A;  3O8V A;  4JRI A;  3OY9 A;  4Q15 A;  4J8O A;  3CXC S;  2VXE A;  4C92 G;  4GY5 A;  1K9M C;  3BY7 A;  4YRF A;  4E7H A;  4N4H A;  4X34 A;  5GMK l;  2DD4 A;  5FU7 C;  2ZXF A;  4OB3 B;  2LNV A;  5CQY A;  4BDZ A;  1JJ2 A;  1XTD A;  1YJN T;  2QEX T;  3HXZ A;  5FRO A;  3DSQ A;  2JN0 A;  3CCM T;  3HY1 A;  2K5F A;  1MGQ A;  2VYT A;  3DLM A;  3OYG A;  5CK9 A;  2XHC A;  2P5I A;  4QQ6 A;  1B34 B;  3PT9 A;  1VQP T;  4PJO E;  4OGC A;  3UGQ A;  2OTJ A;  1BBW A;  1N8R U;  5C52 B;  2MAM A;  1UGS B;  2RHU A;  1EQR A;  3CCU A;  4EX5 A;  2IY5 A;  4KUL A;  3N5B B;  3HHT B;  3GF5 A;  2QDY B;  1M90 U;  2E1H A;  4A54 A;  1XNI A;  3A8H B;  4ZTJ A;  3WXM B;  2DKG A;  3A31 A;  2D6F A;  2NLU A;  3HXV A;  3F70 A;  2DIQ A;  2EJG A;  3C95 A;  2ZT5 A;  2YRV A;  1KG1 A;  4P71 A;  1W4S A;  1ZQ1 A;  1HXD A;  3FRN A;  3HRT A;  3OYH A;  1KQS A;  4BWA A;  4YRT A;  4R55 A;  2CIM A;  2K57 A;  2EJF A;  4JRK A;  4F7U A;  5LJ3 j;  3G4S A;  2X4W A;  1V29 B;  1I4K 1;  2A7Y A;  2PVO B;  1G3Y A;  2ZCE A;  1ATI A;  1NJ1 A;  1Y71 A;  4A4F A;  3LC0 A;  2AKW B;  2Y4Y A;  3CCJ A;  1VIF A;  3QO3 A;  1G3W A;  4O2D A;  4DA4 A;  4FL6 A;  1VQM A;  4ZGE B;  4HWS A;  4ELZ C;  3CCL T;  2QI2 A;  3WQZ A;  4PHC A;  1LOJ A;  3V8K A;  4IUT A;  2AMC B;  5LJ5 j;  2XG8 D;  5FLX E;  4PJO G;  3E9I A;  1E22 A;  3TEH A;  2PMF A;  3ZFJ A;  3QDR B;  4QVC A;  4PJO C;  3UT1 A;  3BFM A;  4C5I A;  4C8Q B;  4M77 E;  1PSE A;  3M58 A;  4O5V A;  3M9Q A;  2YLC A;  1VIE A;  4Z02 A;  3QSU A;  3QO8 A;  3P8T A;  3PIO A;  1U1S A;  4YCV A;  4YCW A;  4XEM A;  2ZT7 A;  2DIG A;  4H2V A;  4X9C A;  1FWZ A;  2PUK B;  3VV0 A;  3BW1 A;  4C8Q D;  3G1Z A;  1EVK A;  1BI3 A;  3MP1 A;  2I2L A;  3JCM V;  1JRI A;  4BAC A;  4A53 A;  4C0G A;  1RIQ A;  1S72 A;  3LSS A;  1GXI E;  3M4P A;  3RIR A;  1G5I A;  3OYD A;  5K1X A;  5C0M A;  4TWA A;  5GAN 4;  4DQ2 A;  1YJW A;  2K4Y A;  1RI0 A;  1M1K C;  1BI1 A;  1B34 A;  3GNF B;  1BI0 A;  4E7I A;  1E24 A;  1UGP B;  5KH6 A;  3ZBD A;  3M59 A;  2RHX A;  1ASZ A;  2XTI A;  2I4M A;  2WSC E;  1TH7 A;  2DQ0 A;  3TEE A;  3L2Z A;  5LJ3 e;  4YP0 A;  1M9S A;  1VQ8 A;  4XTY A;  4PG3 A;  5GAN j;  2VGM A;  3GNG A;  3FDR A;  2A3L A;  3TU4 K;  3X26 B;  3SDZ A;  3HFV A;  2ZPG B;  2DDZ A;  4M78 E;  3PIP A;  2BKD N;  3ME9 A;  5LJ5 d;  5IN1 A;  1OI1 A;  2QQ9 A;  4M78 F;  1QVP A;  4Q6G A;  3P8V A;  1WU7 A;  3CMA A;  4A4K A;  1M4Z A;  3CC7 A;  2ZZG A;  2ZT6 A;  4YRK A;  2RK2 A;  2JTM A;  3QZ5 B;  1JJC B;  3JAM E;  3PTA A;  1N9S A;  5GAM h;  1VQL A;  1QVF A;  1WQW A;  3OQ5 A;  3QBY A;  1M1F A;  2R57 A;  5LJ5 e;  2I4O A;  2CKK A;  3R6O A;  3UGT A;  4OVA A;  3QII A;  5CR2 A;  4HVC A;  2LQ8 A;  3JCM b;  2AKW A;  1Q81 U;  2CJA A;  2ZT8 A;  1VQ9 T;  2RI3 A;  4OGE A;  4Q5W A;  2QA4 A;  2HD0 A;  3MP8 A;  5LJ5 g;  4RKU E;  1W2B S;  5CCA A;  5GMK j;  2AMC A;  2DXC A;  1YJN A;  2VV5 A;  2BIV A;  4YRL A;  3C4S A;  2Q5I A;  3CCM A;  1QP3 A;  2E5Q A;  3RL6 A;  4C8Q A;  4KR2 A;  3M5A A;  3LWH A;  1FXX A;  3J80 E;  4C92 B;  4LDU A;  1VQP A;  4HWR A;  4CS2 A;  5GAO q;  5FU7 B;  1QVG S;  3OB9 A;  1USY A;  1LJO A;  3GLX A;  4PLL A;  3OW2 S;  4BD3 A;  4C0D C;  1BIA A;  4CH3 A;  3ASK A;  5CIU A;  4BW9 A;  4B9X A;  3V8L A;  4M78 G;  3HKS A;  2QHS A;  3RMQ A;  5GAM f;  2ZIN A;  5A0D A;  5IT9 E;  4M78 C;  2LX9 A;  2RI2 A;  4C92 D;  4B9W A;  3FJP A;  4BUG A;  1UGQ B;  2FVU A;  5GAN e;  1YIJ A;  1Q82 C;  3RAC A;  3EAE A;  1G5H A;  4P75 C;  2AHJ B;  4NS5 A;  3GPL A;  2OTL T;  4C92 F;  2ZZD A;  3OYE A;  5M9O A;  1VQ5 T;  3Q1J A;  11AS A;  5K1P A;  2H3J A;  1WPY A;  4OMF B;  1VQ7 A;  4WI1 A;  4LVJ A;  4LD6 A;  4YYE A;  2ZNJ A;  2YLB A;  5D6X A;  4HWT A;  3G71 T;  1G5V A;  2EL9 A;  3NTI A;  4X5O A;  3CD6 T;  1YCY A;  4OP0 A;  4MZT A;  4DOV A;  2LVM A;  3FLG A;  3PCO B;  4OB1 B;  4ZGD B;  3S3O A;  2E3C A;  2JOY A;  3A32 A;  3LX7 A;  4N4G A;  3HY0 A;  4LDX A;  1Y07 A;  3CCE A;  4YRE A;  1O9S A;  3QO5 A;  1LNX A;  2ALY B;  3BJU A;  2E65 A;  3LGF A;  4XTX A;  1VQN T;  2VXF A;  4HKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...