1X01A

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with atp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 66
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2005-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1x01A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1x01A01
2RHSB 3JCMe 3VQWA 5GAOm 2E41A 4YCUA 4M7AE 3HXXA 1D3BB 2FYKA 5GAMe 4WI1A 4UP9A 5ELOA 4M7DA 2ZT7A 5KNNA 1KMNA 1J5WA 4N0AA 1C0AA 2DXUA 1SETA 2AKWA 1USYC 3RKWA 4PJOA 4CH3A 3L4GA 2CJAA 4YRKA 4M77D 2YLCA 2DEQA 2QHTA 4TQDA 2EJ9A 5GMKh 4YCWA 4M7DF 4YCVA 1I81A 5LJ3j 4PJOF 1KQ1A 2DJZA 4XU2A 4X9DA 4M7AC 4M7DE 4F7UB 3PZCA 1I4K1 2P0LA 4ZTUB 1HXDA 3RERA 3E9IA 4PJOE 5GANf 4HA8A 5LJ3g 2DQ0A 3RUXA 4CH5A 1VQZA 2ALYB 3HFZB 4P3NA 3GIBA 4C92A 4TTVA 5F5WA 3RACA 5GAN8 2E1HA 2Q5HA 5LJ5d 4H02A 3P8TA 3M4QA 1QF6A 2CGHA 4WJ3M 3V7SA 3AHUA 4M78E 4E51A 2E10A 3MEYA 5GAN5 4C92F 4F7UG 4AH6A 4M7DC 4C8QA 3NELA 3VBBA 4N0AC 4TVWA 1H4SA 3V8JA 1ADJA 1B76A 3HSBA 4A53A 4PJOC 2G4CA 4MMKA 3HFOA 3W3SA 4M7AD 1SRYA 4C92E 1NJ2A 2ZIOA 4H2XB 4J6XA 2RHSA 3NENA 1YFRA 1M5Q1 2DDZA 1D3BA 2QHVA 4RMFA 4QVDA 3BY7A 3JB9G 1BIBA 1E24A 1H4TA 3HXUA 2DZ9A 1KOGA 4XTVA 3JCMh 4Q15A 1L0WA 3VQVA 4M7AG 1W66A 2RHQA 4LNSA 1Z7NA 4P3OA 5GAMh 1LOJA 4M7DD 4C92C 2Y90A 2ZGWA 2CJ9A 1SESA 3QO7A 1WNLA 3REXA 4XTYA 4PJOD 4YRPA 3LSSA 3UFGA 2DU7A 3TEHA 2DQ3A 2C7IA 1Z7MA 2ZTGA 1WPYA 2YHTA 1ATIA 4C8QC 4EMKB 4RDXA 4M7DG 4K88A 4EMGA 2DTHA 4M78D 4PJOG 3HRIA 4TQFA 1HTTA 2C8MA 3INZA 12ASA 4CS2A 3HFVA 5GANd 4C92D 2EJGA 4F7UE 1QE0A 4P3PA 3RL6A 2PMFA 4RCCA 3WQZA 5LJ3e 3FIFA 4HWPA 5LJ3f 4C8QB 1YB3A 5HGQA 3JCMJ 4H2XA 1B7YA 3HTZA 3LC0A 1NNHA 3P8VA 2ZT8A 4HWSA 2DXTA 5GAN7 3VU3C 3MF1A 2I2LA 4C92G 2QHSA 3IKLA 1U1SA 4XTWA 3JCMf 4HWTA 3VQXA 4NL3A 1X56A 3JCMW 3ICAA 4XEOA 4JUVA 5GAMf 5GMKj 4G84A 4PG3A 4WJ4A 2VC8A 1GGMA 1X54A 4C8QG 1WYDA 2RHQB 3IKMB 4UP8A 1BBWA 1YFTA 3HXVA 4YRTA 1HC7A 4P74A 4YREA 1E22A 2ARUA 3JCMX 5LJ5j 3QHSA 1KQ2A 3TEHB 3V7RA 4H2WA 3RKXA 5GMKl 4EMKA 2E65A 3BDUA 4YRFA 5GAN2 2Q7EA 5LJ5g 4EMHA 4H2SA 4YRNA 3CMQA 1I5LA 1NYRA 3A32A 2QTXA 4YRSA 3P8YA 4H2YA 2P5IA 3L2ZA 4ZIBA 3A7AA 1X2GA 4M75A 4BW9A 1EQRA 1U1TA 3A5YA 4K86A 4P71A 3ERRA 2RB6A 3QSUA 5CAIA 3JB9D 3JCMQ 2RD1A 3R07A 3FB9A 4J6YA 4JRKA 1X01A 4EO4A 4RQEA 4XU1A 5LJ3h 1B7YB 5DY9A 4C8QF 4P74C 1WQ7A 1X55A 3TEGA 5ELNA 2ZZGA 3JCMb 5GAOq 4P75A 2DU5A 4EMKC 4C8QE 2EWNA 3SB2A 3E9HA 4HT8A 3JCMd 5GMKm 2CIMA 1EFWA 5GAMd 1EVLA 1EVKA 5GMKi 5K1PA 2K57A 2DKGA 1LYLA 3V8KA 2JN0A 5GANj 3JB9H 4M75C 3HXZA 1I8FA 3EFRA 5C53B 4P71C 4HVCA 3FJPA 4RQFA 2J3LA 2I4OA 4M77A 1E1OA 1H641 4WF2A 5GANg 3HXWA 2PMEA 4UPAA 5GMKe 4JRIA 3SWNB 3JCMV 5GAOp 4RCBA 3BFMA 3A31A 3RGLA 3HY0A 3PGGA 3VQYA 1FYFA 2ZR2A 1N9SA 2E64A 4Y91A 1WU7A 1NJ1A 2ARSA 4P75C 1WLEA 4M75B 1KMMA 4YDQA 4OLFA 2XGTA 4QVCA 5LJ5e 3QUIA 1NYQA 2YLBA 4K87A 4C8QD 2VXFA 1JRIA 1M8VA 3UGQA 3HXYA 4XEMA 2ZT6A 2VXEA 4M75G 4OP0A 1SERA 4P73A 4M77C 2I4NA 2ZXFA 1YCYA 2EL9A 4V2SA 4ZTZB 4YYEA 4TWAA 2EJFA 1JBMA 1PYSA 2CJBA 4CH6A 1TH7A 4J6WA 4Q6GA 3BJUA 3IG2A 1H4VB 4G85A 3A5ZA 2IY5B 1B34B 3QNEA 4XTUA 1WQWA 3MF2A 4M77B 3SWNA 3A7UA 2DTOA 3UH0A 3M4GA 1YFSA 5GAN6 3A7RA 2RM4A 4UP7A 3IALA 4L87A 2ZIMA 4CH4A 3I7FA 2EAYA 4YRQA 4YRCA 3RF1A 1ASYA 1EOVA 3TUPA 3M4PA 3UGTA 4M78A 1B70A 3L1AA 3PCOB 4XQ3A 5GANe 4HT9A 1G51A 2J3MA 3NEMA 4P73C 5E3IA 2ZINA 3QO5A 3OD1A 4M77G 2AMCB 4YRJA 4CS3A 4M75F 3RIRA 5LJ5h 1EIYB 2Q5IA 3DSQA 4TVAB 4M78F 5LJ3d 5GAMj 2ARTA 4NCXA 4YRLA 4M75E 3JCMg 4PHCA 4P72A 5GAN3 1IL2A 3V7CA 3JB9I 1HK9A 4XTZA 5GAMg 4J5YA 4JLIA 4KR2A 3G1ZA 4M7AB 1G5IA 5GAOr 2RA2A 1LJOA 2ZT5A 3JCMP 3SWNC 2ZNJA 1E1TA 1Y96B 4A54A 4J15A 2I4MA 4X9CA 1LNXA 3HFNA 3JCMc 1NJ8A 1H4QA 3V8LA 4YRRA 4YPFA 2ODRC 1JJCB 1MGQA 4YROA 2E3CA 2HNIA 4H2TA 3JB9J 4CS4A 3EFSA 4DQ2A 3QO3A 1ADYA 4BWAA 1PYSB 2Q7HA 4M78C 2IY5A 1B34A 2DVEA 2ZCEA 4M7DB 1X2HA 11ASA 4KQEA 4HWRA 1G5HA 2AKWB 4PJOB 3L4GB 4O2DA 2FB7A 5GAN4 5GAOl 3QO8A 4YRIA 1N9RA 2ZZEA 2I4LA 5GAOn 2Q7GA 1BBUA 1NJ6A 4P72C 4M77F 4F7UA 4NL2A 4XU3A 2E5AA 2ODRD 3A74A 1RIQA 3PCOA 4EX5A 4YRGA 5C51B 4M77E 4M78B 3QTCA 1B70B 4M75D 2ALYA 5LJ5f 1USYA 2AMCA 5C52B 3HFZA 4YP0A 3NETA 2XTIA 3RKYA 2ZZFA 4XTXA 1EIYA 5GANh 4DPGA 4TVAA 3BW1A 3LSQA 4F7UF 4C92B 4KR3A 3RESA 4TVYA 1YGBA 4H2UA 1BIAA 1N9WA 2DZCA 3HY1A 4M7AA 5K1XA 4YRMA 2DTIA 4MMLA 1B8AA 5I21A 4M78G 1NJ5A 2ZR3A 4X5OA 3REUA 4HWOA 1Y96A 2QHUA 4PNOA 1ASZA 2ZNIA 3JB9F 3HRKA 3KFUA 4H2VA 1JJCA 4M7AF 4NOYA 4XU0A
chains in the Genus database with same CATH superfamily
2PQWA 1QMCA 1W2BA 1N6AA 2XG8D 1BB9A 5GAOm 4YCUA 2KY9A 2X4YA 4IUPA 1QCNA 1W6XA 4UP9A 1QCFA 2C0TA 2ZT7A 3CMET 4J9BA 1WA7A 2DXUA 1ZUKA 2O01E 5KYXA 1UTIA 3WVDB 3L4GA 4CH3A 2QASA 2SRCA 1C6VX 3CPWA 1UUEA 1NEGA 1VQNA 3I35A 2KBTA 2QHTA 1RAFB 3LW5E 4TQDA 2COZA 4M7DF 4YCVA 2VB6A 4KH0B 4BE1A 2O88A 4PJOF 3EGUA 2DJZA 2VGMA 4F04B 1JXMA 2HZYA 4M7AC 3PZCA 1I4K1 2P0LA 4ZTUB 1QVGA 2NS6A 1UE9A 2KT8A 1N8RR 2ALYB 3RNJA 3OBWA 3M59A 5F5WA 2AIRB 2WSEE 4ZGDB 5CKEA 2QA4A 4M4ZA 5KYYA 2D9TA 2E5QA 1QF6A 1W2BS 3V7SA 4BI3A 5L23A 4WJ3M 3HL8A 3CCSA 5CQXA 3ZFJA 4JDSA 4C92F 4AH6A 4M7DC 3VBBA 4N0AC 4TVWA 1H4SA 3M58A 3V8JA 1ADJA 2QQSA 2A37A 4A53A 4PJOC 2MYSA 3HFOA 4MMKA 5CKDA 2J6OA 2DM1A 3OS0A 3L2QA 2PZ1A 2RHSA 3CCEA 1NJIU 3A8GB 4LVMA 1M5Q1 3CCSQ 4QVDA 3BY7A 1BIBA 2EKOA 3CCLQ 3REBB 2EQIA 1KOGA 4XTVA 2ABLA 4Q15A 1L0WA 3VQVA 4J9FA 1W66A 2PU9B 2RHQA 1QVGS 4P3OA 1LCKA 2LP5A 4LN2A 4C92C 2EYQA 2NLUA 1OI1A 2RO0A 4YRPA 1C0MA 2L3RA 2HL3A 4N4IA 2FPEA 5EG2A 2JM8A 1E6GA 1NPPA 1ATIA 4C8QC 4RDXA 1K73U 1X2KA 4F14A 2OAWA 2DTHA 5A2QE 5IHIA 3A98A 1SRLA 2XMFA 1SSFA 1IXDA 2VYTA 12ASA 1VQ6T 3HFVA 5GANd 4HT4A 1AWXA 1CKBA 2EJGA 1YI2T 1QE0A 4P3PA 2QI2A 3OYMA 2RQWA 4J7FA 2RK1A 3WQZA 1K0XA 1WLPB 1ZA2B 4Q5WA 4HWPA 3Q1JA 2D6FA 1KHCA 2LRQA 2XICA 4H2XA 5LL6S 3EFOB 3LC0A 2XKOC 4DBFA 3OYLA 2ZT8A 2DXTA 4LUEA 1YP5A 5GAN7 3FC3A 3N5BB 1V29B 5I2SA 4NL3A 4FYVB 4J9IA 2HQHA 1WZOA 2J6FA 3H41A 1N8RC 4PG3A 4WJ4A 1Y0MA 1VA7A 4PLLA 4CC3A 2H3JA 3KXTA 4LVLA 2ATCB 2JUFA 2GTJA 2R57A 3G71Q 2RQUA 1UECA 4RUGA 1KQ2A 3TEHB 2IVWA 2EQUA 1M2VA 1NEBA 2E65A 1VYTA 2JZ2A 1ZUYA 3BDUA 2H8HA 1KC8C 2Q7EA 4KUIA 2Y4YA 1OX9A 2F2XA 3VS0A 4FIBA 2A7YA 1W1FA 3CXCA 3CCUT 1NYRA 3M53A 1YIJA 3CCVQ 1K1ZA 4H2YA 1RADB 1Y71A 1RUWA 1M1KU 4BI4A 4FM4B 4M75A 4BW9A 3F70A 3QSUA 2NUTB 2RPNA 1VQMA 2AZVA 4AFUC 4OVAA 1RI0A 3QZ5B 2RD1A 4PLIA 2PVGB 1OU9A 4EO4A 4E7SA 2K9GA 4RQEA 2NUPA 3DKMA 3VYGA 2X4WA 1BK2A 5DY9A 4LNPA 4P74C 2ZZGA 1UGPB 2DU5A 4EMKC 4PJLA 4C8QE 1MV0B 2ZPGB 4L5GA 2FRYA 3E9HA 3EHRA 3JCMd 2FZKB 3CC4Q 2CIMA 3LGLA 2HSEB 4E7KA 1EFWA 4F16A 2CSIA 5GAMd 2YUNA 3CXCS 5K1PA 1TOVA 2LNHB 1LYLA 1I0CA 4J9DA 4PFPA 1X2QA 3HXZA 3CCJA 3FRNA 2R5AA 1VQ5T 5D6YA 4RQFA 1K9MU 5GANg 1D1BA 3CD6A 1HSQA 1VQ4A 4JRIA 1QP2A 2LQWA 1ZSGA 3UATA 3A31A 3RGLA 3HY0A 2BZYA 1S72A 3VQYA 1H8KA 3CCJQ 4FYYB 4OLFA 2LCCA 2LZ6B 5LJ5e 2HAXA 1Z9ZA 1JEGA 2YLBA 3OYHA 3TU4K 4C8QD 2VXFA 3UA7A 1S72Q 1FMKA 1JJ2S 4KGXB 4OMLA 1RL2A 4P5NA 4M75G 4Z02A 2OJ2A 2LJ0A 3UDCA 5IT9E 1TWBA 3CCRT 4ZTZB 2EJFA 3LYIA 4OGCA 4CH6A 4Q6GA 3IG2A 2IY5B 1B34B 3ZEHA 1VQ7T 2ZZDA 4XTUA 3O8VA 4M77B 4C0DC 2DTOA 3UH0A 3M4GA 3A7RA 2RM4A 3MP1A 2ED0A 1IHWA 4UP7A 2JXBA 3C95A 2ZIMA 2KEAA 3I7FA 3QZ9B 2MAMA 1ASYA 1EOVA 3QPHA 3M4PA 4XAXB 1KFZA 2KE9A 3L1AA 4LVKA 3PCOB 4XQ3A 4HT9A 2J3MA 1GCQC 3UA6A 3OD1A 2K3YA 1O75A 5FU6C 4YRJA 2V26A 3G6EA 4M75F 1EIYB 3TREA 2Q5IA 4OMFB 4M78F 4HXJA 4OF1A 2RJCA 5LJ3d 2M0YA 4A4KA 3M0RA 2QTVA 3JCMg 1IL2A 2M16A 2CS7A 1VQ9T 2HBPA 2RHYA 5GAMg 3G1ZA 2AT1B 4IUUA 1LJOA 3BE3A 5M9OA 4ME7A 3JCMP 3SWNC 1K73C 2FHDA 3G6EQ 3CC2Q 1LNXA 1NJ8A 3PE0A 3V8LA 1AWOA 1ZLMA 2ODRC 1ZSZC 4Z8AA 2EW3A 1NBEB 5FRNA 3RBBB 4IIOA 2Q7HA 3CPFA 4M78C 2ZCEA 2DD5A 4QVZA 1X2HA 2ED1A 2KYMA 4IUTA 3L4GB 2JNGA 1Z9QA 4O2DA 2LTOA 2RF0A 3CEYA 3OMGA 3ZL7C 3PIPA 2GF7A 2I4LA 1VQOA 1ZBXA 1VQ8A 1MNDA 4NL2A 4EX5A 4YRGA 4ANJA 4J9HA 2KRMA 2QXFA 2XK0A 2AMCA 3HFZA 2XTIA 1TUCA 2DNUA 2DX1A 2KAFA 5GANh 2BE7D 4TVAA 4KR3A 1VQOQ 2HEQA 1VQ8Q 4IUVA 4H2UA 1BIAA 3I9QA 3EGXB 1N9WA 2DZCA 5KYYB 3OB9A 4M7AA 4YRMA 3R6OA 2DTIA 4MMLA 1FMVA 4R0KA 4DBHA 2ZR3A 4X5OA 3DLMA 4AFZC 2RQRA 2X51A 2JMAA 5CK9A 1MHNA 2GNCA 2ZPFB 4H2VA 4XU0A 2RHSB 3VQWA 1NE8A 1M27C 2E41A 4D8DA 3HXXA 3OS5A 2HQXA 2YXYA 1RLQC 4M7DA 5KNNA 4N0AA 5FWBA 2AKWA 1USYC 3RKWA 4PJOA 4LDUA 2QEXA 2C0OA 2LJ1A 4L6V5 4YRKA 1YCSB 3PMIA 2HMAA 3ULRB 1UDLA 3GF5A 2DLPA 1HYOA 3ER0A 2KRSA 3NTKA 1MMNA 5FU7B 4X9DA 3VS3A 4CC7A 4F7UB 3A8LB 3RERA 3E9IA 1AT1B 5LJ3g 2DQ0A 2RHUA 2FO0A 1VQZA 1SSHA 3GIBA 4C92A 4TTVA 4QQ6A 5EC7A 1AZEA 1UGQB 5GAN8 2LVMA 3E1SA 4BB7A 1UGRB 1O9SA 3OYJA 1W2BP 1KQSA 4RTZA 1X69A 5FROA 5KH6A 3M4QA 4AFSC 3AHUA 4M78E 4E51A 2FPDA 4FL6A 1OX8A 4PKCC 4C8QA 1HD3A 3HKSA 2XHCA 2KSSA 2OTJA 3CPWP 3BDLA 2DA9A 3CCQT 5IHNA 1NJ2A 3PIOA 1B07A 2ZIOA 1QVFS 4H2XB 2PNIA 3EH2A 2OTLT 2EBPA 1WXUA 4ZGJB 1YFRA 1OULA 2JS2A 3LH0A 2DDZA 2QHVA 2B8AA 4JRQA 3OSSC 1H4TA 2XIDA 1ABQA 2DZ9A 3JCMh 1QVGP 3QWYA 2JT4A 1QVPA 2RJEA 4M7AG 1PRMC 4LNSA 1T0JA 1XNIA 2GGRA 2RK2A 4RTXA 5GAMh 4BE2A 2DD4A 2COWA 1G3SA 1I1JA 1T3LA 1WNLA 3REXA 4XTYA 3LSSA 2LC4A 1UJ0A 1V1CA 2RHZA 2RI2A 4MDXA 3OYCA 2DU7A 4C0FA 1YJWT 1RAAB 1KQSS 1BCOA 2ZTGA 2DL8A 2EGEA 4CRIA 2YHTA 1M2VB 2FVUA 2EVRA 1WIEA 4ELZC 2DEUA 5IN1A 4M7DG 2ZAEA 4K88A 1NLOC 4M78D 3MHXA 2PUOB 4PJOG 3HRIA 3NPFA 1VIFA 1HTTA 1KSWA 1YJNA 2GFAA 3EH1A 2PTKA 3MEAA 3OA6A 3HRTA 3L2UA 3D7SB 2CT4A 4HCKA 3CC7T 1WJQA 4CC4B 3FIFA 1MNEA 5LJ3f 2RI5A 2XDDA 5HGQA 1U06A 2EYYA 1H3HA 4LDWA 1B7YA 1WXTA 1NNHA 2D8JA 1SHFA 2A3LA 1YJNQ 3CMAA 3MF1A 2I2LA 4C92G 2QHSA 3IKLA 1AEYA 4XTWA 8AT1B 2I0NA 2OX7A 2O2OA 4HWTA 1KG1A 2HCKA 4FT2A 3JCMW 2KYBA 1G5VA 4XEOA 1YHQT 5GMKj 4G84A 3CCMT 1YBYA 2VC8A 4BY6B 3OYFA 4C8QG 1M3AA 1AD5A 2X4JA 3CMAQ 1YITA 1E7OA 4UP8A 4JJNK 3X25B 3CCUQ 4IUQA 1BBWA 3VS2A 1WDXA 4P74A 2A36A 4YREA 3I56T 3JCMX 4H2WA 3VJPA 2V8KA 5GMKl 4EMKA 1EFNA 1JQQA 2HL5C 3M55A 4YRFA 5I22A 1OEBA 5GAN2 1K8AR 1YITQ 4LDYA 2RNAA 4YRNA 2X9HA 3CMQA 2V8IA 1I5LA 3A32A 3HRUA 3PVLA 2QTXA 3HP9A 2CREA 1PD0A 2P5IA 1SHGA 3L2ZA 4ZIBA 2V1QA 3FJ5A 3A7AA 5CIUA 1YN8A 1U1TA 3OYNA 3ERRA 3NFCA 2GTOA 3VS7A 3CCLA 2K5FA 1H3ZA 1R77A 4J6YA 1E6HA 4JRKA 2XDPA 1BKBA 2DBMA 3GPLA 4C5IA 2WSFE 4K11A 2HBWA 5LJ3h 3X24B 1WI7A 2QDLA 1GFDA 2DBKA 4C8QF 1OZ2A 1WQ7A 2KNBB 1X55A 2LQKA 1IGQA 2BZXA 2DETA 2ZCFB 1YJ9T 2VUBA 2KRNA 4LUDA 3H0IA 1VQKT 3P8BB 3TQ7P 4RG2A 2EWNA 2F1LA 1PRLC 2EIFA 2EQMA 3CXCP 3SFMA 1EVKA 2IIMA 5GMKi 2K57A 2DKGA 1M3CA 5IH2A 3V8KA 3OYGA 2JN0A 3A8OB 1Y7XA 4QKUA 5GANj 4J9CA 1I8FA 3EFRA 1I07A 2RHXA 3VUBA 2E6ZA 3FJPA 1UJYA 1WJRA 1E1OA 1H641 5KCHA 5IXBA 3HXWA 3JCMV 2CP0A 3G4SA 5DLOA 4RCBA 5DLQE 1EZZB 5A0GA 3BFMA 1Q7YU 3RMSA 4AG1C 4BI8B 4Y91A 2E5KA 5C6SA 3H0HA 1NJ1A 4P75C 1K4US 2M02A 1MMAA 4YDQA 4N4HA 3QUIA 1UB4A 3G4SQ 4K87A 2F5TX 3CCRQ 4CI0C 4RG8A 3QWXX 1M8VA 3UGQA 1U8RA 2BE9B 2DL4A 3G71A 4DA4A 2CZ6B 3AT1B 1AOJA 2EQKA 3LWIA 1VQLT 2VXEA 3JRZA 4M77C 2I4NA 1GCQA 4II1A 2V1RA 2YUOA 1K9AA 3GLXA 2EL9A 1VQ7Q 1KIKA 4V2SA 4E7IA 4YYEA 4A63B 1WHKA 4TWAA 4OB2B 3CCVA 2OAUA 1PYSA 1T3SA 4FYXB 2CJBA 1K76A 1PSFA 1XQHA 3VS4A 2FZCB 2CP3A 3EGDB 4G85A 3A5ZA 1BI3A 1Q95G 2ZPIB 2W10A 3ZBDA 1RABB 3SWNA 2CT3A 2RQVA 1C1AA 1YFSA 1TUGB 3JV3A 3M54A 1ZSZA 2EAYA 3RF1A 2R58A 3TUPA 3CBMA 4M78A 5GJWB 1B70A 2E3IA 2MMPA 1VQ9Q 1G51A 3WXMB 2L5QA 1W70A 2AMCB 3CC4A 4CS3A 4ZN1A 2JW4A 4TVAB 5A0LA 1T0HA 5GAMj 4NCXA 4YRLA 5J26A 4MZPA 2F2VA 3U23A 3JB9I 1VYVA 4JLIA 1FXXA 3X20B 1ZUUA 4M7AB 1VQNT 5GAOr 2RA2A 4JRPA 2JJ9A 1Q81R 2COYA 3M0TA 3ME9A 1E1TA 3MCAB 4MZTA 1EX4A 5KYNA 2MI6A 1JJ2A 2CP7A 1FYNA 2I4MA 1AHJB 1WHGA 3QXEB 2K2VA 4BACA 1RI9A 1NG2A 2HKQB 3NGPA 4C5GA 3EFSA 1PG5B 3QYGB 4Y28E 4Y92A 1OOTA 3OYEA 2DVEA 4QQGA 4BD3A 4M7DB 2P84A 1AWJA 2AKWB 4PJOB 2QA4T 2X35A 3NHNA 3QO8A 4PL6A 1N9RA 1TTHB 3CCST 4XK8E 2GBQA 5CCAA 1BBUA 1NJ6A 2WACA 2L3SA 1Q7YR 3EG9A 1IRXA 3A74A 5C51B 3MEVA 1RIQA 4M77E 5J3BA 2YRDA 2ALYA 4EDUA 1Q86R 1USYA 2K4YA 3O5ZA 3QBYA 3CCET 3NETA 2BIVA 2AK5A 1VQPA 4DPGA 3PFSA 4F7UF 4C92B 4IKFA 3LSQA 4FW1A 3RESA 4TVYA 1YGBA 1ZBJA 1SF9A 2J05A 3HY1A 2LX9A 1GRIA 4ORZA 5I21A 2LMJA 4BUGA 4M78G 3REUA 2ROLA 1VUBA 2DAQA 1VQPQ 3JB9F 2BTTA 1M90R 4B9WA 1UHFA 3CBPA 3OS1A 2CH4W 2JTMA 3FEOA 2NUZA 3MEWA 4RTUA 3P8HA 3THKA 2DYBA 3A8HB 3REAB 2FYKA 4WI1A 1UEBA 1OYXA 1C0AA 1KMNA 1PCXA 1SETA 1RAIB 5HCKA 1IHVA 4A4FA 4L59A 2O4XB 1TXQA 3I55A 2J7IA 2J06A 3S3NA 2KVQG 4M77D 2YLCA 2DEQA 2HKNA 1X6BA 5GMKh 4YCWA 2FL7A 5LJ3j 2FEIA 2QQAA 4XU2A 4FYWB 1Q81C 1RACB 2KQWA 2ZPBB 5GANf 3I55Q 3NTHA 3VKIA 5CQYA 1FWZA 1SKUB 4AFQC 3VRZA 4A4EA 3CC2A 2HDAA 3RACA 2A28A 2E1HA 2Q5HA 2PVOB 5LJ5d 2OTLQ 1Y07A 4PFOA 2MCNA 4OB1B 2QQ9A 3OSVA 1P92A 5IHKA 3HSBA 4PJNA 3W3SA 2VKNA 3KFVA 2PVDB 4GBQA 1MUZA 2CDTA 1QW1A 1OQKA 4KGZB 2P4RA 1YFNA 2X3XD 4FCYA 3GBQA 1Y57A 1Q7YC 4O5VA 1D3BA 1E24A 3SEMA 3HXUA 1Q86C 1MMGA 1PKSA 4RTWA 1YIJT 1ZHIA 2NWMA 2ZPHB 1ZX6A 2DK3A 5HK0A 5KYXB 1S1NA 5KYUA 2Y90A 2ZGWA 2CJ9A 3QO7A 4AT1B 1TS9A 5KE3A 3OYDA 3M9QA 1KQSP 1VQMT 3TEHA 2AKKA 2C7IA 1Z7MA 1JXOA 4EMKB 3CC7Q 1KK7A 2E4HA 2K6DA 4DEYA 4AG2C 1M90C 1GL5A 1A0NB 1D09B 3A1PA 2KXCA 3CMEA 4TQFA 1WX6A 2C8MA 4VUBA 5C0MA 4F7UE 1AZGB 4B9XA 2NUTA 1NLPC 1QKWA 4Z88A 4BY6C 3X26B 2CYZB 2CZ7B 1MV3A 1YHQQ 2A08A 3JCMJ 3CQTA 3CMEQ 3CCMQ 2BUDA 2ESWA 4HVWA 3P8VA 2LT4A 3A8MB 3VU3C 1KHIA 2HD0A 3CCJT 1WHJA 1U1SA 2ZPEB 2KMTA 4JJCA 5FLXE 1J3TA 4PFZA 3VS5A 3JCMf 3VQXA 2YUPA 3CD6T 1QP3A 2YWWA 2LCLA 5FRMA 3UT1A 1VQ4T 3UWNA 3DLLA 5GAMf 1ZA1B 1GGMA 2MPXC 4HCBA 1QVFA 1UHCA 2LQNA 1WYDA 2JTFA 1NYFA 3GNGA 2RHQB 1S72T 3RDVA 2KGTA 3HXVA 1IREB 4YRTA 1HC7A 4LDVA 2ARUA 2G3RA 2DO3A 1K8AU 3QHSA 1IZ6A 2DJQA 3V7RA 5KYWA 3NMZC 5HKCA 3URGA 2QQRA 5LJ5g 2P0QA 4EMHA 1BI2A 1BU1A 1ABOA 1TG0A 3MPUB 2BZ8A 1X2GA 3E9GA 2QYZA 3DB4A 1EQRA 3A5YA 3MJXA 3JB9D 4FSXA 3EG1A 3JCMQ 6AT1B 2M0OA 1VQKQ 3R07A 1GBQA 4C0DB 1QKXA 2NYSA 2QG9B 4J7IA 2DILA 2F69A 3HRSA 1TU0B 3JCMb 2GQVA 1VQ6A 4P75A 2Z0WA 3OQ5A 3UPUA 1YI2A 3SB2A 1Q82U 3X28B 5GMKm 3G7ZA 2KT1A 5AT1B 4E6RA 5FU6B 4E7LA 2QQBA 3LH5A 1NZ9A 1VQ6Q 3JB9H 5CKHA 3EHQA 4P71C 3QDFA 1YI2Q 4HVCA 2J3LA 2I4OA 3G6ET 4M77A 2CKKA 3CBOA 2DRKA 4J9GA 4KT0E 2PMEA 4WCIA 5GMKe 3MP6A 1SPKA 3SWNB 5GJVB 3NTIA 1D1CA 2DF6A 1WXBA 3H0FA 4QW2A 3G1JA 3PGGA 4C0GA 1PD1A 1FYFA 5KE2A 3M56A 1N9SA 1WU7A 3JSCA 5HY6A 2CUDA 1WLEA 4M75B 2XDBA 2XGTA 2CZ0B 3QKJA 5J39A 3C12A 1VQLQ 2PUKB 4OMQA 3FDRA 4GLKA 3SHWA 1JRIA 2NUPB 2DIQA 2GCXA 3CCUA 3HXYA 3PT9A 5IAYA 3OW2A 1IO6A 2ZT6A 3DB3A 1M3BA 1ZQ1A 1PNJA 1R0CB 1FX7A 2ZXFA 1N27A 3GOXA 1VQOT 1VQ8T 2FPFA 2DIGA 1DJ7B 3L2RA 1YWPA 1JBMA 1M4ZA 4FU6A 4OB3B 2EKHA 2JS0A 4OMPA 1TH7A 4J6WA 2EYXA 2O31A 2BKDN 1H4VB 2K3BA 1UGSB 3TCJA 3QNEA 3MF2A 1WQWA 1OPLA 1QCOA 4ATOA 5GAN6 2YDLA 1SG5A 4L87A 4CH4A 4YRCA 4ZTFA 1WJSA 4DBQA 2ECZA 2LJ3A 3PMTA 2X4XA 3EG9B 3OW2S 2KXDA 2J6KA 3I5SA 1UGVA 4PJJA 2QK0A 5GANe 3NEMA 4P73C 5E3IA 1BI0A 3J7AF 1VQNQ 2DL7A 4M77G 1VQ5A 2DFUA 3RIRA 1XJWB 4ZNXA 5LJ5h 4BE0A 2EYWA 3DSQA 1LVKA 3EGXA 2ARTA 3TSZA 4PHCA 2CP2A 1YNZA 5GAN3 1Q81U 1GCPA 3LLRA 2QEXT 4PK4A 4J5YA 4KR2A 1G5IA 2AKLA 1VQ5Q 2ZT5A 2KROA 4B6MA 1KC8R 4A54A 4J15A 4TVRA 3H6ZA 4X9CA 2VASA 3HFNA 4D8KA 3CPWS 1Q82R 2FZGB 1H4QA 2QA4Q 3JAME 4YPFA 1F1BB 1MGQA 4JJBA 4H2TA 3JB9J 3QO3A 2XI9A 1ADYA 1U5SA 2WSCE 2ROTA 3S3MA 5L8RE 1NM7A 2EGAA 4LXCA 1WGSA 1G5HA 1LPLA 2JMCA 2FB7A 5GAN4 2D0NA 4E2FB 1WHHA 3CCEQ 5GAOl 3C94A 2F2WA 2M1HA 2QAZA 3CCRA 1G3TA 5GAOn 2Q7GA 2P4TA 4P72C 1OZ3A 4M77F 4KRTA 2OTJT 1Q86U 4F7UA 1PSEA 5D6XA 2RJFA 4ELYC 3QTCA 4FT4A 5C52B 5IXFA 4A4GA 3T9NA 3RKYA 4ZGEB 2ZZFA 1JJ2P 4XTXA 4DEXA 1VQ7A 4BDYA 1D0XA 3VS6A 3WVEB 1UG1A 2RH2A 4A4HA 1BYMA 1X75C 4OB0B 1K8AC 1CKAA 1B8AA 1JB0E 3LWHA 1M90U 3VUZA 1Y96A 4PNOA 2ZNIA 3HRKA 2RHIA 4J83A 3FLGA 4J8OA 1JJCA 2GQIA 1M2OA 1X6OA 4LDXA 4NOYA 2K5LA 5AYFA 4YROA 2ENMA 4RTYA 3JCMe 3MKDA 2F5KA 4M7AE 1D3BB 1D1AA 5GAMe 5ELOA 1GBRA 2H3EB 3J81E 1EIFA 1J5WA 3S6WA 2FRWA 1X43A 1VQ9A 4MZMA 1YJNT 2YUQA 1R8OB 4O6JA 2CJAA 1XOVA 4JZ3A 3LX7A 3MP8A 2R5MA 5A0DA 3SD4A 5KYUB 4RMOA 4WTOB 1HJDA 2L8DA 4KULA 2EJ9A 1QWEA 2JOYA 4LE9A 1I81A 3H9NA 1KQ1A 5CR2A 2CH4A 2DE0X 2XD0A 5CO7A 2IPOB 4M7DE 1HXDA 4PJOE 3CMAT 4HA8A 1OU8A 3RUXA 4CH5A 2DXBA 2DL3A 1Q82C 3HFZB 4E7HA 4P3NA 4KGVB 2AHJB 3M0UA 4C0ZA 2D0QB 4H02A 3P8TA 1H92A 1XTDA 2CP6A 2CGHA 2E10A 3MEYA 5GAN5 4F7UG 1YITT 3NELA 1G83A 3L2VA 1M1FA 1PKTA 2VV5A 1B76A 1RAGB 2G4CA 3KBGA 4M7AD 1SRYA 4C92E 1YIJQ 2KK4A 4KBMB 4J6XA 3QDRB 3NENA 4JJDA 4C5HA 4ESRA 4IIMA 4RMFA 3JB9G 1VQMQ 1NJIR 1GFCA 1BCMA 2GFUA 4EIKA 3PNWC 4JS5A 3VYHB 3LGFA 2C0IA 2KR3A 2B86A 2RJDA 1Z7NA 3TSWA 1LOJA 1WFWA 2W0ZA 4M7DD 1SESA 5FW9A 4PJOD 2P0PA 2Y4XA 3UFGA 2DQ3A 3CCLT 2CSQA 2DMOA 3EG3A 1WPYA 5KYWB 2AZSA 4RTTA 2MK5A 3OMCA 2M9UA 1MMDA 4EMGA 3QJ6A 2DERA 4N4GA 1K73R 3INZA 2X3WD 4CS2A 4C92D 5CKBA 2EPDA 1KD1U 1UFFA 1BBZA 4Z89A 3RL6A 1N5ZA 3HPWA 2PMFA 4RCCA 3CD6Q 5LJ3e 2OI3A 4C8QB 1VQ4Q 1SRMA 1YB3A 4HVVA 3HTZA 4HWSA 4DOWA 1BI1A 3VS1A 3VRYA 4AMCA 2A0FB 1ARKA 2LX7A 3MQZA 1X27A 4CC2A 5FU7C 5CVIA 2C06A 4E7ZA 1X56A 1RAHB 3ICAA 3QYHB 4JUVA 3J80E 1JO8A 2DRMA 2L3QA 5DM7R 3G4ST 2JTEA 7AT1B 4GLMA 1X54A 2MWPA 3IKMB 2L0AA 4UC4A 1RLPC 1YFTA 3CCQA 1E22A 1PC0A 2CP5A 5LJ5j 2OTLA 3QIIA 2EFIA 2M51A 3RKXA 3UF4A 4R56A 3OYIA 2VWFA 3OY9A 4GY5A 4H2SA 2VVKA 2DPPB 3G71T 1G3WA 4YRSA 3P8YA 3CCQQ 3QG1A 3META 2YRCA 1NJIC 1RAEB 2MIOA 3TVTA 4K86A 4P71A 1QQJA 2RB6A 5CAIA 1AWWA 1M1KR 1R0BG 1VOMA 1PWTA 1YJWA 1QVFP 4JPBW 2LDMA 3EFOA 4DOVA 3FB9A 3VV0A 2EGCA 3CCVT 3OYBA 1X01A 4XU1A 3HHTB 1B7YB 4ZN3A 3QJYA 4RKUE 1G2BA 2RQTA 4IURA 2K2MA 3OYAA 3IQLA 4OMOA 3TEGA 5ELNA 3PTAA 2L89A 5GAOq 2FG0A 1YJWQ 4EPCA 4HT8A 3CC7A 2MOXA 2K5IA 3ASKA 2K79A 4MDWA 2L3PA 1V76A 2A8EA 1EVLA 1WHMA 5HK3A 2MF2A 1IB8A 1X6GA 1OV3A 2LT1A 1VIEA 4M75C 3EGDA 3MO8A 5ECAA 5C53B 1AVZC 3CC4T 3EAEA 1PHTA 9ATCB 4QQDA 4WF2A 1WHLA 1QWFA 4YTLA 4UPAA 4HCZA 1YHQA 4D6WA 1K9MR 3CCMA 5GAOp 3M57A 1D0ZA 2CZ1B 1VYUA 2ZR2A 1JU5C 2E64A 2ARSA 1B3QA 1KMMA 4OGEA 3I56A 4QVCA 1NYQA 1KD1R 1U3OA 2E3HA 4OMNA 2LCSA 4KH1B 2RMOA 3OS2A 3L2WA 4R55A 2KI7A 3MEUA 4XEMA 3RR6A 2XU8A 4LD9K 3I56Q 4OP0A 1M30A 3HTRA 4C5EA 2EYZA 1SERA 4P73A 2V8JA 2E12A 1NYGA 1YCYA 2JM9A 2E6NA 2L2PA 4RTVA 1TUDA 2QGGA 3P8DA 4X1VA 2LNVA 1M9SA 2QDYB 3E9FA 2LQ8A 2K7AA 1M1GA 4BDZA 3I5RA 2O9VA 1D0YA 2CUBA 1K0SA 2MWOA 2YSQA 1M1KC 2O9SA 5I11A 3BJUA 2DVJA 1VQPT 1WYXA 1YJ9A 2KDSA 8ATCB 3A7UA 1VQKA 2YT6A 3R6NA 3IALA 4FSSA 1QLYA 2G6FX 2RN8A 5FWCA 4YRQA 3OBYA 3OW2P 1N8RU 4JLGA 3UGTA 1M8MA 2P0KA 3M0QA 1YJ9Q 2QEXQ 3KUFA 2E70A 2ZINA 3QO5A 4ZTJA 3H8ZA 1ACMB 4LVIA 2IG0A 3OYKA 3RMQA 4M75E 4P72A 4E7JA 3V7CA 4JS4A 1HK9A 4XTZA 2D1XA 5D7UA 2YRVA 5I2MA 1KC8U 1TSFA 3I55T 4FW2A 5KCOA 2QGFB 3EG2A 1GXIE 4LVJA 3C4SA 1K9MC 2DYIA 2ZNJA 3S3OA 1Y96B 1KJWA 4HVUA 4HCCA 3JCMc 1CSKA 4YRRA 1JJCB 4JZ4A 2EQJA 2HNIA 2VGNA 2E3CA 4CS4A 4DQ2A 4BWAA 4QT7A 1PYSB 3OYYA 3GP8A 1KD1C 2IY5A 1SEMA 1B34A 2OTJQ 3M0SA 4KUDK 3CC2T 3A5ZB 2O4XA 11ASA 4KQEA 4HWRA 1VQLA 1FMWA 4PJMA 3EG0A 4OMMA 4YRIA 4HKEA 1YWOA 2ZZEA 1PM3A 1G3YA 4E47A 1ZSZB 2SEMA 1B7TA 4XU3A 2ODRD 2E5AA 3PCOA 3M4YA 4DBRA 1G8XA 4M78B 1B70B 3PVQA 4M75D 1I5OB 2HQEA 5LJ5f 1IGUA 5CKFA 4YP0A 5D6WA 2RI3A 2JVVA 3C0CA 1EIYA 4LD6A 3BW1A 3E2UA 4X34A 2DL5A 1W4SA 4NS5A 4F17A 2HSPA 3GNFB 5K1XA 3M5AA 3E19A 1NJ5A 2D8HA 4HWOA 2QHUA 2K3XA 3TEEA 1ASZA 4J9EA 3SDZA 3L42A 3M0PA 3KFUA 2DXCA 1NPRA 1OPKA 4M7AF
chains in the Genus database with same CATH topology
2PQWA 1W2BA 1N6AA 2XG8D 5GAOm 4YCUA 2KY9A 2X4YA 4IUPA 4UP9A 2ZT7A 3CMET 2DXUA 2O01E 4CH3A 3WVDB 3L4GA 3CPWA 1VQNA 2QHTA 3LW5E 4TQDA 4M7DF 4YCVA 4BE1A 4PJOF 2DJZA 2VGMA 4M7AC 3PZCA 1I4K1 2P0LA 4ZTUB 1QVGA 2NS6A 2ALYB 3OBWA 3M59A 5F5WA 2WSEE 4ZGDB 5CKEA 2QA4A 2D9TA 2E5QA 1QF6A 1W2BS 3V7SA 4BI3A 4WJ3M 3HL8A 3CCSA 5CQXA 3ZFJA 4JDSA 4C92F 4AH6A 4M7DC 3VBBA 4N0AC 4TVWA 1H4SA 3M58A 3V8JA 1ADJA 2QQSA 4A53A 4PJOC 4MMKA 3HFOA 5CKDA 3OS0A 3L2QA 2RHSA 3CCEA 1NJIU 3A8GB 4LVMA 1M5Q1 4QVDA 3BY7A 1BIBA 2EKOA 1KOGA 4XTVA 4Q15A 1L0WA 3VQVA 1W66A 2RHQA 2PU9B 1QVGS 4P3OA 4C92C 2EYQA 2NLUA 1OI1A 2RO0A 4YRPA 2L3RA 4N4IA 5EG2A 1NPPA 1ATIA 4C8QC 4RDXA 1K73U 2DTHA 5A2QE 1SSFA 2VYTA 12ASA 1VQ6T 3HFVA 5GANd 4HT4A 2EJGA 1YI2T 1QE0A 4P3PA 2QI2A 3OYMA 4J7FA 2RK1A 3WQZA 4Q5WA 4HWPA 3Q1JA 2D6FA 1KHCA 2LRQA 2XICA 4H2XA 5LL6S 3LC0A 2XKOC 3OYLA 2ZT8A 2DXTA 5GAN7 3FC3A 3N5BB 1V29B 5I2SA 4NL3A 1N8RC 4PG3A 4WJ4A 4PLLA 2H3JA 3KXTA 4LVLA 2JUFA 2R57A 1KQ2A 3TEHB 2IVWA 2EQUA 2E65A 2JZ2A 3BDUA 1KC8C 2Q7EA 4KUIA 2Y4YA 4FIBA 2A7YA 3CCUT 3CXCA 1NYRA 3M53A 1YIJA 4H2YA 1Y71A 1M1KU 4BI4A 4FM4B 4M75A 4BW9A 3F70A 3QSUA 1VQMA 4OVAA 1RI0A 3QZ5B 2RD1A 4PLIA 2PVGB 4EO4A 4RQEA 3DKMA 3VYGA 2X4WA 5DY9A 4P74C 2ZZGA 1UGPB 2DU5A 4EMKC 4C8QE 2ZPGB 4L5GA 3E9HA 3JCMd 2CIMA 3LGLA 4E7KA 1EFWA 5GAMd 3CXCS 5K1PA 1LYLA 3HXZA 3CCJA 3FRNA 2R5AA 1VQ5T 5D6YA 4RQFA 1K9MU 5GANg 3CD6A 1VQ4A 4JRIA 1QP2A 3A31A 3RGLA 3HY0A 1S72A 3VQYA 4OLFA 2LCCA 5LJ5e 2HAXA 2YLBA 3OYHA 3TU4K 4C8QD 2VXFA 1JJ2S 1RL2A 4P5NA 4M75G 4Z02A 3UDCA 5IT9E 3CCRT 4ZTZB 2EJFA 3LYIA 4OGCA 4CH6A 4Q6GA 3IG2A 2IY5B 1B34B 3ZEHA 1VQ7T 2ZZDA 4XTUA 3O8VA 4M77B 4C0DC 2DTOA 3UH0A 3M4GA 3A7RA 2RM4A 3MP1A 4UP7A 3C95A 2ZIMA 3I7FA 3QZ9B 2MAMA 1ASYA 1EOVA 3QPHA 3M4PA 4XAXB 3L1AA 4LVKA 3PCOB 4XQ3A 4HT9A 2J3MA 3OD1A 2K3YA 1O75A 5FU6C 4YRJA 3G6EA 4M75F 1EIYB 3TREA 2Q5IA 4OMFB 4M78F 4OF1A 2RJCA 5LJ3d 4A4KA 3JCMg 1IL2A 2M16A 2CS7A 1VQ9T 2HBPA 2RHYA 5GAMg 3G1ZA 4IUUA 1LJOA 5M9OA 4ME7A 3JCMP 3SWNC 1K73C 2FHDA 1LNXA 1NJ8A 3V8LA 2ODRC 5FRNA 2Q7HA 3CPFA 4M78C 2ZCEA 2DD5A 4QVZA 1X2HA 4IUTA 3L4GB 2JNGA 4O2DA 2LTOA 3CEYA 3OMGA 3PIPA 2GF7A 2I4LA 1VQOA 1ZBXA 1VQ8A 4NL2A 4EX5A 4YRGA 2QXFA 2XK0A 2AMCA 3HFZA 2XTIA 2KAFA 5GANh 4TVAA 4KR3A 4IUVA 4H2UA 1BIAA 1N9WA 2DZCA 3OB9A 4M7AA 4YRMA 3R6OA 2DTIA 4MMLA 2ZR3A 4X5OA 3DLMA 5CK9A 1MHNA 2ZPFB 4H2VA 4XU0A 2RHSB 3VQWA 1NE8A 2E41A 3HXXA 3OS5A 2HQXA 4M7DA 5KNNA 4N0AA 2AKWA 1USYC 3RKWA 4PJOA 4LDUA 2QEXA 4L6V5 4YRKA 3PMIA 3GF5A 3ER0A 3NTKA 5FU7B 4X9DA 4F7UB 3A8LB 3RERA 3E9IA 5LJ3g 2DQ0A 2RHUA 1VQZA 3GIBA 4C92A 4TTVA 4QQ6A 1UGQB 5GAN8 2LVMA 3E1SA 4BB7A 1UGRB 1O9SA 3OYJA 1KQSA 5FROA 5KH6A 3M4QA 3AHUA 4M78E 4E51A 4FL6A 4PKCC 4C8QA 3HKSA 2XHCA 2KSSA 2OTJA 3BDLA 3CCQT 1NJ2A 3PIOA 2ZIOA 1QVFS 4H2XB 2OTLT 4ZGJB 1YFRA 3LH0A 2DDZA 2QHVA 2B8AA 4JRQA 3OSSC 1H4TA 2XIDA 2DZ9A 3JCMh 1QVPA 2RJEA 4M7AG 4LNSA 1XNIA 5GAMh 2RK2A 4BE2A 2DD4A 1G3SA 1WNLA 3REXA 4XTYA 3LSSA 2LC4A 2RHZA 2RI2A 4MDXA 3OYCA 2DU7A 4C0FA 1YJWT 1KQSS 2ZTGA 4CRIA 2YHTA 2FVUA 4ELZC 5IN1A 4M7DG 4K88A 4M78D 3MHXA 2PUOB 4PJOG 3HRIA 1VIFA 1HTTA 1YJNA 2GFAA 3MEAA 3OA6A 3HRTA 3L2UA 3CC7T 1WJQA 3FIFA 5LJ3f 2RI5A 2XDDA 5HGQA 4LDWA 1B7YA 1NNHA 2A3LA 3CMAA 3MF1A 2I2LA 4C92G 2QHSA 3IKLA 4XTWA 4HWTA 1KG1A 4FT2A 3JCMW 1G5VA 4XEOA 1YHQT 5GMKj 4G84A 3CCMT 1YBYA 2VC8A 4BY6B 3OYFA 4C8QG 2X4JA 1YITA 4UP8A 4JJNK 3X25B 4IUQA 1BBWA 4P74A 4YREA 3I56T 3JCMX 4H2WA 3VJPA 2V8KA 5GMKl 4EMKA 3M55A 4YRFA 5GAN2 4LDYA 4YRNA 3CMQA 2V8IA 1I5LA 3A32A 3HRUA 2QTXA 3HP9A 2P5IA 3L2ZA 4ZIBA 3A7AA 5CIUA 1U1TA 3OYNA 3ERRA 3NFCA 3CCLA 2K5FA 1H3ZA 4J6YA 4JRKA 2XDPA 1BKBA 3GPLA 4C5IA 2WSFE 5LJ3h 3X24B 4C8QF 1OZ2A 1WQ7A 1X55A 2LQKA 2ZCFB 1YJ9T 2VUBA 1VQKT 3P8BB 4RG2A 2EWNA 2EIFA 2EQMA 3SFMA 1EVKA 5GMKi 2K57A 2DKGA 3V8KA 3OYGA 2JN0A 3A8OB 1Y7XA 5GANj 1I8FA 3EFRA 2RHXA 3VUBA 2E6ZA 3FJPA 1WJRA 1E1OA 1H641 5KCHA 3HXWA 3JCMV 3G4SA 5DLOA 4RCBA 5DLQE 5A0GA 3BFMA 1Q7YU 3RMSA 4BI8B 4Y91A 5C6SA 1NJ1A 4P75C 4YDQA 4N4HA 3QUIA 1UB4A 4K87A 2F5TX 4CI0C 4RG8A 1M8VA 3UGQA 1U8RA 3G71A 4DA4A 2CZ6B 2EQKA 3LWIA 1VQLT 2VXEA 3JRZA 4M77C 2I4NA 4II1A 3GLXA 2EL9A 4V2SA 4E7IA 4YYEA 4TWAA 4OB2B 3CCVA 2OAUA 1PYSA 2CJBA 1PSFA 1XQHA 4G85A 3A5ZA 1BI3A 2ZPIB 3ZBDA 3SWNA 1YFSA 3M54A 2EAYA 3RF1A 2R58A 3TUPA 3CBMA 4M78A 1B70A 2MMPA 1G51A 3WXMB 2L5QA 2AMCB 3CC4A 4CS3A 4ZN1A 4TVAB 5A0LA 5GAMj 4NCXA 4YRLA 5J26A 4MZPA 3JB9I 4JLIA 1FXXA 3X20B 4M7AB 1VQNT 5GAOr 2RA2A 4JRPA 3ME9A 1E1TA 3MCAB 4MZTA 1JJ2A 2MI6A 2I4MA 1AHJB 3QXEB 2K2VA 4BACA 4C5GA 3EFSA 3QYGB 4Y28E 3OYEA 2DVEA 4QQGA 4BD3A 4M7DB 2AKWB 4PJOB 2QA4T 2X35A 3QO8A 4PL6A 1N9RA 3CCST 4XK8E 5CCAA 1BBUA 1NJ6A 2WACA 5C51B 3A74A 3MEVA 1RIQA 4M77E 5J3BA 2ALYA 4EDUA 1USYA 2K4YA 3QBYA 3CCET 3NETA 2BIVA 1VQPA 4DPGA 3PFSA 4F7UF 4C92B 4IKFA 3LSQA 3RESA 4TVYA 1YGBA 3HY1A 2LX9A 5I21A 4BUGA 4M78G 3REUA 1VUBA 2DAQA 3JB9F 4B9WA 3CBPA 3OS1A 2JTMA 3FEOA 3MEWA 3P8HA 3A8HB 2FYKA 4WI1A 1UEBA 1OYXA 1C0AA 1KMNA 1SETA 4A4FA 4L59A 2O4XB 3I55A 3S3NA 2KVQG 4M77D 2YLCA 2DEQA 5GMKh 4YCWA 2FL7A 5LJ3j 2QQAA 4XU2A 1Q81C 2KQWA 2ZPBB 5GANf 3NTHA 3VKIA 5CQYA 1FWZA 4A4EA 3CC2A 3RACA 2E1HA 2Q5HA 2PVOB 5LJ5d 1Y07A 4OB1B 2QQ9A 3OSVA 1P92A 3HSBA 3W3SA 2PVDB 1QW1A 1Q7YC 4O5VA 1D3BA 1E24A 3HXUA 1Q86C 1YIJT 1ZHIA 2ZPHB 2DK3A 5HK0A 2Y90A 2ZGWA 2CJ9A 3QO7A 5KE3A 3OYDA 3M9QA 1VQMT 3TEHA 2C7IA 1Z7MA 4EMKB 1M90C 3CMEA 4TQFA 2C8MA 4VUBA 5C0MA 4F7UE 4B9XA 4BY6C 3X26B 2CYZB 2CZ7B 3JCMJ 2BUDA 3P8VA 2LT4A 3A8MB 3VU3C 1KHIA 2HD0A 3CCJT 1U1SA 2ZPEB 2KMTA 5FLXE 3JCMf 3VQXA 3CD6T 1QP3A 2LCLA 5FRMA 3UT1A 1VQ4T 3UWNA 3DLLA 5GAMf 1GGMA 4HCBA 1QVFA 1WYDA 2JTFA 3GNGA 2RHQB 1S72T 3HXVA 1IREB 4YRTA 1HC7A 4LDVA 2ARUA 2G3RA 2DO3A 1K8AU 3QHSA 1IZ6A 3V7RA 5HKCA 3URGA 2QQRA 5LJ5g 2P0QA 4EMHA 1BI2A 1X2GA 3E9GA 3DB4A 1EQRA 3A5YA 3JB9D 4FSXA 3JCMQ 2M0OA 3R07A 4C0DB 4J7IA 2F69A 3HRSA 3JCMb 2GQVA 1VQ6A 4P75A 3OQ5A 3UPUA 1YI2A 3SB2A 1Q82U 3X28B 5GMKm 3G7ZA 5FU6B 4E7LA 2QQBA 1NZ9A 3JB9H 5CKHA 4P71C 4HVCA 2J3LA 2I4OA 3G6ET 4M77A 2CKKA 3CBOA 4KT0E 2PMEA 5GMKe 3MP6A 3SWNB 3NTIA 4QW2A 3PGGA 4C0GA 1FYFA 5KE2A 3M56A 1N9SA 1WU7A 3JSCA 5HY6A 1WLEA 4M75B 2XDBA 2XGTA 2CZ0B 3QKJA 5J39A 3C12A 2PUKB 3FDRA 4GLKA 1JRIA 2DIQA 2GCXA 3CCUA 3HXYA 3PT9A 5IAYA 3OW2A 2ZT6A 3DB3A 1ZQ1A 1FX7A 2ZXFA 1N27A 3GOXA 1VQOT 1VQ8T 2DIGA 1DJ7B 3L2RA 1JBMA 1M4ZA 4FU6A 4OB3B 1TH7A 4J6WA 2BKDN 1H4VB 1UGSB 3TCJA 3QNEA 3MF2A 1WQWA 4ATOA 5GAN6 4L87A 4CH4A 4YRCA 4ZTFA 1WJSA 3PMTA 2X4XA 3OW2S 5GANe 5E3IA 3NEMA 4P73C 1BI0A 3J7AF 4M77G 1VQ5A 3RIRA 5LJ5h 4BE0A 3DSQA 2ARTA 4PHCA 5GAN3 1Q81U 3LLRA 2QEXT 4J5YA 4KR2A 1G5IA 2ZT5A 4A54A 4J15A 4TVRA 3H6ZA 4X9CA 3HFNA 3CPWS 1H4QA 3JAME 4YPFA 1MGQA 4H2TA 3JB9J 3QO3A 2XI9A 1ADYA 2WSCE 3S3MA 5L8RE 1WGSA 1G5HA 2FB7A 5GAN4 5GAOl 3C94A 2M1HA 3CCRA 1G3TA 5GAOn 2Q7GA 2P4TA 4P72C 1OZ3A 4M77F 2OTJT 1Q86U 4F7UA 1PSEA 5D6XA 2RJFA 4ELYC 3QTCA 4FT4A 5C52B 4A4GA 3T9NA 3RKYA 4ZGEB 2ZZFA 4XTXA 1VQ7A 4BDYA 3WVEB 2RH2A 4A4HA 1BYMA 1X75C 4OB0B 1K8AC 1B8AA 1JB0E 3LWHA 1M90U 3VUZA 1Y96A 4PNOA 2ZNIA 3HRKA 2RHIA 4J83A 3FLGA 4J8OA 1JJCA 1X6OA 4LDXA 4NOYA 2K5LA 5AYFA 4YROA 3JCMe 2F5KA 4M7AE 1D3BB 5GAMe 5ELOA 3J81E 1EIFA 1J5WA 3S6WA 1VQ9A 4MZMA 1YJNT 1R8OB 4O6JA 2CJAA 1XOVA 3LX7A 3MP8A 2R5MA 5A0DA 3SD4A 4RMOA 2L8DA 4KULA 2EJ9A 2JOYA 1I81A 1KQ1A 5CR2A 2XD0A 5CO7A 4M7DE 1HXDA 4PJOE 3CMAT 4HA8A 3RUXA 4CH5A 2DXBA 1Q82C 3HFZB 4E7HA 4P3NA 2AHJB 4C0ZA 2D0QB 4H02A 3P8TA 1XTDA 2CGHA 2E10A 3MEYA 5GAN5 4F7UG 1YITT 3NELA 3L2VA 1M1FA 2VV5A 1B76A 2G4CA 3KBGA 4M7AD 1SRYA 4C92E 2KK4A 4KBMB 4J6XA 3QDRB 3NENA 4C5HA 4RMFA 3JB9G 2GFUA 3PNWC 4JS5A 3VYHB 3LGFA 2RJDA 1Z7NA 1LOJA 4M7DD 1SESA 4PJOD 2P0PA 2Y4XA 3UFGA 2DQ3A 3CCLT 1WPYA 3OMCA 2M9UA 4EMGA 3QJ6A 4N4GA 3INZA 4CS2A 4C92D 5CKBA 1KD1U 3RL6A 3HPWA 2PMFA 4RCCA 5LJ3e 4C8QB 1YB3A 3HTZA 4HWSA 4DOWA 1BI1A 3MQZA 5FU7C 5CVIA 2C06A 1X56A 3ICAA 3QYHB 4JUVA 3J80E 5DM7R 3G4ST 1X54A 2MWPA 3IKMB 4UC4A 1YFTA 3CCQA 1E22A 5LJ5j 2OTLA 3QIIA 2EFIA 3RKXA 4R56A 3OYIA 3OY9A 4GY5A 4H2SA 2DPPB 3G71T 1G3WA 4YRSA 3P8YA 3QG1A 3META 1NJIC 4K86A 4P71A 2RB6A 5CAIA 1YJWA 2LDMA 4DOVA 3FB9A 3VV0A 3CCVT 3OYBA 1X01A 4XU1A 3HHTB 1B7YB 4ZN3A 3QJYA 4RKUE 4IURA 3OYAA 3TEGA 5ELNA 3PTAA 2L89A 5GAOq 4EPCA 4HT8A 3CC7A 3ASKA 2K5IA 4MDWA 2A8EA 1EVLA 5HK3A 2MF2A 2LT1A 1VIEA 4M75C 3MO8A 5C53B 3CC4T 3EAEA 4QQDA 4WF2A 4YTLA 4UPAA 4HCZA 1YHQA 4D6WA 3CCMA 5GAOp 3M57A 2CZ1B 2ZR2A 2E64A 2ARSA 1KMMA 4OGEA 3I56A 4QVCA 1NYQA 3OS2A 3L2WA 4R55A 3MEUA 4XEMA 2XU8A 4LD9K 4OP0A 4C5EA 1SERA 4P73A 2V8JA 2E12A 1YCYA 2E6NA 3P8DA 2LNVA 1M9SA 2QDYB 3E9FA 2LQ8A 1M1GA 4BDZA 2MWOA 1M1KC 3BJUA 1VQPT 1YJ9A 2KDSA 3A7UA 1VQKA 3IALA 4YRQA 3OBYA 1N8RU 4JLGA 3UGTA 2P0KA 3KUFA 2E70A 2ZINA 3QO5A 4ZTJA 3H8ZA 4LVIA 2IG0A 3OYKA 3RMQA 4M75E 4P72A 4E7JA 3V7CA 4JS4A 1HK9A 4XTZA 2YRVA 5I2MA 1KC8U 3I55T 5KCOA 1GXIE 4LVJA 3C4SA 1K9MC 2ZNJA 3S3OA 1Y96B 4HCCA 3JCMc 4YRRA 1JJCB 2EQJA 2HNIA 2VGNA 2E3CA 4CS4A 4DQ2A 4BWAA 1PYSB 3OYYA 3GP8A 1KD1C 2IY5A 1B34A 4KUDK 3CC2T 3A5ZB 2O4XA 11ASA 4KQEA 4HWRA 1VQLA 4YRIA 4HKEA 2ZZEA 1G3YA 4E47A 4XU3A 2ODRD 2E5AA 3PCOA 3M4YA 4M78B 1B70B 4M75D 2HQEA 5LJ5f 5CKFA 4YP0A 5D6WA 2RI3A 2JVVA 1EIYA 4LD6A 3BW1A 4X34A 1W4SA 4NS5A 3GNFB 5K1XA 3M5AA 3E19A 1NJ5A 4HWOA 2QHUA 2K3XA 3TEEA 1ASZA 3SDZA 3L42A 3KFUA 2DXCA 1NPRA 4M7AF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHS B;  3JCM e;  3VQW A;  5GAO m;  2E41 A;  4YCU A;  4M7A E;  3HXX A;  1D3B B;  2FYK A;  5GAM e;  4WI1 A;  4UP9 A;  5ELO A;  4M7D A;  2ZT7 A;  5KNN A;  1KMN A;  1J5W A;  4N0A A;  1C0A A;  2DXU A;  1SET A;  2AKW A;  1USY C;  3RKW A;  4PJO A;  4CH3 A;  3L4G A;  2CJA A;  4YRK A;  4M77 D;  2YLC A;  2DEQ A;  2QHT A;  4TQD A;  2EJ9 A;  5GMK h;  4YCW A;  4M7D F;  4YCV A;  1I81 A;  5LJ3 j;  4PJO F;  1KQ1 A;  2DJZ A;  4XU2 A;  4X9D A;  4M7A C;  4M7D E;  4F7U B;  3PZC A;  1I4K 1;  2P0L A;  4ZTU B;  1HXD A;  3RER A;  3E9I A;  4PJO E;  5GAN f;  4HA8 A;  5LJ3 g;  2DQ0 A;  3RUX A;  4CH5 A;  1VQZ A;  2ALY B;  3HFZ B;  4P3N A;  3GIB A;  4C92 A;  4TTV A;  5F5W A;  3RAC A;  5GAN 8;  2E1H A;  2Q5H A;  5LJ5 d;  4H02 A;  3P8T A;  3M4Q A;  1QF6 A;  2CGH A;  4WJ3 M;  3V7S A;  3AHU A;  4M78 E;  4E51 A;  2E10 A;  3MEY A;  5GAN 5;  4C92 F;  4F7U G;  4AH6 A;  4M7D C;  4C8Q A;  3NEL A;  3VBB A;  4N0A C;  4TVW A;  1H4S A;  3V8J A;  1ADJ A;  1B76 A;  3HSB A;  4A53 A;  4PJO C;  2G4C A;  4MMK A;  3HFO A;  3W3S A;  4M7A D;  1SRY A;  4C92 E;  1NJ2 A;  2ZIO A;  4H2X B;  4J6X A;  2RHS A;  3NEN A;  1YFR A;  1M5Q 1;  2DDZ A;  1D3B A;  2QHV A;  4RMF A;  4QVD A;  3BY7 A;  3JB9 G;  1BIB A;  1E24 A;  1H4T A;  3HXU A;  2DZ9 A;  1KOG A;  4XTV A;  3JCM h;  4Q15 A;  1L0W A;  3VQV A;  4M7A G;  1W66 A;  2RHQ A;  4LNS A;  1Z7N A;  4P3O A;  5GAM h;  1LOJ A;  4M7D D;  4C92 C;  2Y90 A;  2ZGW A;  2CJ9 A;  1SES A;  3QO7 A;  1WNL A;  3REX A;  4XTY A;  4PJO D;  4YRP A;  3LSS A;  3UFG A;  2DU7 A;  3TEH A;  2DQ3 A;  2C7I A;  1Z7M A;  2ZTG A;  1WPY A;  2YHT A;  1ATI A;  4C8Q C;  4EMK B;  4RDX A;  4M7D G;  4K88 A;  4EMG A;  2DTH A;  4M78 D;  4PJO G;  3HRI A;  4TQF A;  1HTT A;  2C8M A;  3INZ A;  12AS A;  4CS2 A;  3HFV A;  5GAN d;  4C92 D;  2EJG A;  4F7U E;  1QE0 A;  4P3P A;  3RL6 A;  2PMF A;  4RCC A;  3WQZ A;  5LJ3 e;  3FIF A;  4HWP A;  5LJ3 f;  4C8Q B;  1YB3 A;  5HGQ A;  3JCM J;  4H2X A;  1B7Y A;  3HTZ A;  3LC0 A;  1NNH A;  3P8V A;  2ZT8 A;  4HWS A;  2DXT A;  5GAN 7;  3VU3 C;  3MF1 A;  2I2L A;  4C92 G;  2QHS A;  3IKL A;  1U1S A;  4XTW A;  3JCM f;  4HWT A;  3VQX A;  4NL3 A;  1X56 A;  3JCM W;  3ICA A;  4XEO A;  4JUV A;  5GAM f;  5GMK j;  4G84 A;  4PG3 A;  4WJ4 A;  2VC8 A;  1GGM A;  1X54 A;  4C8Q G;  1WYD A;  2RHQ B;  3IKM B;  4UP8 A;  1BBW A;  1YFT A;  3HXV A;  4YRT A;  1HC7 A;  4P74 A;  4YRE A;  1E22 A;  2ARU A;  3JCM X;  5LJ5 j;  3QHS A;  1KQ2 A;  3TEH B;  3V7R A;  4H2W A;  3RKX A;  5GMK l;  4EMK A;  2E65 A;  3BDU A;  4YRF A;  5GAN 2;  2Q7E A;  5LJ5 g;  4EMH A;  4H2S A;  4YRN A;  3CMQ A;  1I5L A;  1NYR A;  3A32 A;  2QTX A;  4YRS A;  3P8Y A;  4H2Y A;  2P5I A;  3L2Z A;  4ZIB A;  3A7A A;  1X2G A;  4M75 A;  4BW9 A;  1EQR A;  1U1T A;  3A5Y A;  4K86 A;  4P71 A;  3ERR A;  2RB6 A;  3QSU A;  5CAI A;  3JB9 D;  3JCM Q;  2RD1 A;  3R07 A;  3FB9 A;  4J6Y A;  4JRK A;  1X01 A;  4EO4 A;  4RQE A;  4XU1 A;  5LJ3 h;  1B7Y B;  5DY9 A;  4C8Q F;  4P74 C;  1WQ7 A;  1X55 A;  3TEG A;  5ELN A;  2ZZG A;  3JCM b;  5GAO q;  4P75 A;  2DU5 A;  4EMK C;  4C8Q E;  2EWN A;  3SB2 A;  3E9H A;  4HT8 A;  3JCM d;  5GMK m;  2CIM A;  1EFW A;  5GAM d;  1EVL A;  1EVK A;  5GMK i;  5K1P A;  2K57 A;  2DKG A;  1LYL A;  3V8K A;  2JN0 A;  5GAN j;  3JB9 H;  4M75 C;  3HXZ A;  1I8F A;  3EFR A;  5C53 B;  4P71 C;  4HVC A;  3FJP A;  4RQF A;  2J3L A;  2I4O A;  4M77 A;  1E1O A;  1H64 1;  4WF2 A;  5GAN g;  3HXW A;  2PME A;  4UPA A;  5GMK e;  4JRI A;  3SWN B;  3JCM V;  5GAO p;  4RCB A;  3BFM A;  3A31 A;  3RGL A;  3HY0 A;  3PGG A;  3VQY A;  1FYF A;  2ZR2 A;  1N9S A;  2E64 A;  4Y91 A;  1WU7 A;  1NJ1 A;  2ARS A;  4P75 C;  1WLE A;  4M75 B;  1KMM A;  4YDQ A;  4OLF A;  2XGT A;  4QVC A;  5LJ5 e;  3QUI A;  1NYQ A;  2YLB A;  4K87 A;  4C8Q D;  2VXF A;  1JRI A;  1M8V A;  3UGQ A;  3HXY A;  4XEM A;  2ZT6 A;  2VXE A;  4M75 G;  4OP0 A;  1SER A;  4P73 A;  4M77 C;  2I4N A;  2ZXF A;  1YCY A;  2EL9 A;  4V2S A;  4ZTZ B;  4YYE A;  4TWA A;  2EJF A;  1JBM A;  1PYS A;  2CJB A;  4CH6 A;  1TH7 A;  4J6W A;  4Q6G A;  3BJU A;  3IG2 A;  1H4V B;  4G85 A;  3A5Z A;  2IY5 B;  1B34 B;  3QNE A;  4XTU A;  1WQW A;  3MF2 A;  4M77 B;  3SWN A;  3A7U A;  2DTO A;  3UH0 A;  3M4G A;  1YFS A;  5GAN 6;  3A7R A;  2RM4 A;  4UP7 A;  3IAL A;  4L87 A;  2ZIM A;  4CH4 A;  3I7F A;  2EAY A;  4YRQ A;  4YRC A;  3RF1 A;  1ASY A;  1EOV A;  3TUP A;  3M4P A;  3UGT A;  4M78 A;  1B70 A;  3L1A A;  3PCO B;  4XQ3 A;  5GAN e;  4HT9 A;  1G51 A;  2J3M A;  3NEM A;  4P73 C;  5E3I A;  2ZIN A;  3QO5 A;  3OD1 A;  4M77 G;  2AMC B;  4YRJ A;  4CS3 A;  4M75 F;  3RIR A;  5LJ5 h;  1EIY B;  2Q5I A;  3DSQ A;  4TVA B;  4M78 F;  5LJ3 d;  5GAM j;  2ART A;  4NCX A;  4YRL A;  4M75 E;  3JCM g;  4PHC A;  4P72 A;  5GAN 3;  1IL2 A;  3V7C A;  3JB9 I;  1HK9 A;  4XTZ A;  5GAM g;  4J5Y A;  4JLI A;  4KR2 A;  3G1Z A;  4M7A B;  1G5I A;  5GAO r;  2RA2 A;  1LJO A;  2ZT5 A;  3JCM P;  3SWN C;  2ZNJ A;  1E1T A;  1Y96 B;  4A54 A;  4J15 A;  2I4M A;  4X9C A;  1LNX A;  3HFN A;  3JCM c;  1NJ8 A;  1H4Q A;  3V8L A;  4YRR A;  4YPF A;  2ODR C;  1JJC B;  1MGQ A;  4YRO A;  2E3C A;  2HNI A;  4H2T A;  3JB9 J;  4CS4 A;  3EFS A;  4DQ2 A;  3QO3 A;  1ADY A;  4BWA A;  1PYS B;  2Q7H A;  4M78 C;  2IY5 A;  1B34 A;  2DVE A;  2ZCE A;  4M7D B;  1X2H A;  11AS A;  4KQE A;  4HWR A;  1G5H A;  2AKW B;  4PJO B;  3L4G B;  4O2D A;  2FB7 A;  5GAN 4;  5GAO l;  3QO8 A;  4YRI A;  1N9R A;  2ZZE A;  2I4L A;  5GAO n;  2Q7G A;  1BBU A;  1NJ6 A;  4P72 C;  4M77 F;  4F7U A;  4NL2 A;  4XU3 A;  2E5A A;  2ODR D;  3A74 A;  1RIQ A;  3PCO A;  4EX5 A;  4YRG A;  5C51 B;  4M77 E;  4M78 B;  3QTC A;  1B70 B;  4M75 D;  2ALY A;  5LJ5 f;  1USY A;  2AMC A;  5C52 B;  3HFZ A;  4YP0 A;  3NET A;  2XTI A;  3RKY A;  2ZZF A;  4XTX A;  1EIY A;  5GAN h;  4DPG A;  4TVA A;  3BW1 A;  3LSQ A;  4F7U F;  4C92 B;  4KR3 A;  3RES A;  4TVY A;  1YGB A;  4H2U A;  1BIA A;  1N9W A;  2DZC A;  3HY1 A;  4M7A A;  5K1X A;  4YRM A;  2DTI A;  4MML A;  1B8A A;  5I21 A;  4M78 G;  1NJ5 A;  2ZR3 A;  4X5O A;  3REU A;  4HWO A;  1Y96 A;  2QHU A;  4PNO A;  1ASZ A;  2ZNI A;  3JB9 F;  3HRK A;  3KFU A;  4H2V A;  1JJC A;  4M7A F;  4NOY A;  4XU0 A; 
#chains in the Genus database with same CATH topology
 2PQW A;  1QMC A;  1W2B A;  1N6A A;  2XG8 D;  1BB9 A;  5GAO m;  4YCU A;  2KY9 A;  2X4Y A;  4IUP A;  1QCN A;  1W6X A;  4UP9 A;  1QCF A;  2C0T A;  2ZT7 A;  3CME T;  4J9B A;  1WA7 A;  2DXU A;  1ZUK A;  2O01 E;  5KYX A;  1UTI A;  3WVD B;  3L4G A;  4CH3 A;  2QAS A;  2SRC A;  1C6V X;  3CPW A;  1UUE A;  1NEG A;  1VQN A;  3I35 A;  2KBT A;  2QHT A;  1RAF B;  3LW5 E;  4TQD A;  2COZ A;  4M7D F;  4YCV A;  2VB6 A;  4KH0 B;  4BE1 A;  2O88 A;  4PJO F;  3EGU A;  2DJZ A;  2VGM A;  4F04 B;  1JXM A;  2HZY A;  4M7A C;  3PZC A;  1I4K 1;  2P0L A;  4ZTU B;  1QVG A;  2NS6 A;  1UE9 A;  2KT8 A;  1N8R R;  2ALY B;  3RNJ A;  3OBW A;  3M59 A;  5F5W A;  2AIR B;  2WSE E;  4ZGD B;  5CKE A;  2QA4 A;  4M4Z A;  5KYY A;  2D9T A;  2E5Q A;  1QF6 A;  1W2B S;  3V7S A;  4BI3 A;  5L23 A;  4WJ3 M;  3HL8 A;  3CCS A;  5CQX A;  3ZFJ A;  4JDS A;  4C92 F;  4AH6 A;  4M7D C;  3VBB A;  4N0A C;  4TVW A;  1H4S A;  3M58 A;  3V8J A;  1ADJ A;  2QQS A;  2A37 A;  4A53 A;  4PJO C;  2MYS A;  3HFO A;  4MMK A;  5CKD A;  2J6O A;  2DM1 A;  3OS0 A;  3L2Q A;  2PZ1 A;  2RHS A;  3CCE A;  1NJI U;  3A8G B;  4LVM A;  1M5Q 1;  3CCS Q;  4QVD A;  3BY7 A;  1BIB A;  2EKO A;  3CCL Q;  3REB B;  2EQI A;  1KOG A;  4XTV A;  2ABL A;  4Q15 A;  1L0W A;  3VQV A;  4J9F A;  1W66 A;  2PU9 B;  2RHQ A;  1QVG S;  4P3O A;  1LCK A;  2LP5 A;  4LN2 A;  4C92 C;  2EYQ A;  2NLU A;  1OI1 A;  2RO0 A;  4YRP A;  1C0M A;  2L3R A;  2HL3 A;  4N4I A;  2FPE A;  5EG2 A;  2JM8 A;  1E6G A;  1NPP A;  1ATI A;  4C8Q C;  4RDX A;  1K73 U;  1X2K A;  4F14 A;  2OAW A;  2DTH A;  5A2Q E;  5IHI A;  3A98 A;  1SRL A;  2XMF A;  1SSF A;  1IXD A;  2VYT A;  12AS A;  1VQ6 T;  3HFV A;  5GAN d;  4HT4 A;  1AWX A;  1CKB A;  2EJG A;  1YI2 T;  1QE0 A;  4P3P A;  2QI2 A;  3OYM A;  2RQW A;  4J7F A;  2RK1 A;  3WQZ A;  1K0X A;  1WLP B;  1ZA2 B;  4Q5W A;  4HWP A;  3Q1J A;  2D6F A;  1KHC A;  2LRQ A;  2XIC A;  4H2X A;  5LL6 S;  3EFO B;  3LC0 A;  2XKO C;  4DBF A;  3OYL A;  2ZT8 A;  2DXT A;  4LUE A;  1YP5 A;  5GAN 7;  3FC3 A;  3N5B B;  1V29 B;  5I2S A;  4NL3 A;  4FYV B;  4J9I A;  2HQH A;  1WZO A;  2J6F A;  3H41 A;  1N8R C;  4PG3 A;  4WJ4 A;  1Y0M A;  1VA7 A;  4PLL A;  4CC3 A;  2H3J A;  3KXT A;  4LVL A;  2ATC B;  2JUF A;  2GTJ A;  2R57 A;  3G71 Q;  2RQU A;  1UEC A;  4RUG A;  1KQ2 A;  3TEH B;  2IVW A;  2EQU A;  1M2V A;  1NEB A;  2E65 A;  1VYT A;  2JZ2 A;  1ZUY A;  3BDU A;  2H8H A;  1KC8 C;  2Q7E A;  4KUI A;  2Y4Y A;  1OX9 A;  2F2X A;  3VS0 A;  4FIB A;  2A7Y A;  1W1F A;  3CXC A;  3CCU T;  1NYR A;  3M53 A;  1YIJ A;  3CCV Q;  1K1Z A;  4H2Y A;  1RAD B;  1Y71 A;  1RUW A;  1M1K U;  4BI4 A;  4FM4 B;  4M75 A;  4BW9 A;  3F70 A;  3QSU A;  2NUT B;  2RPN A;  1VQM A;  2AZV A;  4AFU C;  4OVA A;  1RI0 A;  3QZ5 B;  2RD1 A;  4PLI A;  2PVG B;  1OU9 A;  4EO4 A;  4E7S A;  2K9G A;  4RQE A;  2NUP A;  3DKM A;  3VYG A;  2X4W A;  1BK2 A;  5DY9 A;  4LNP A;  4P74 C;  2ZZG A;  1UGP B;  2DU5 A;  4EMK C;  4PJL A;  4C8Q E;  1MV0 B;  2ZPG B;  4L5G A;  2FRY A;  3E9H A;  3EHR A;  3JCM d;  2FZK B;  3CC4 Q;  2CIM A;  3LGL A;  2HSE B;  4E7K A;  1EFW A;  4F16 A;  2CSI A;  5GAM d;  2YUN A;  3CXC S;  5K1P A;  1TOV A;  2LNH B;  1LYL A;  1I0C A;  4J9D A;  4PFP A;  1X2Q A;  3HXZ A;  3CCJ A;  3FRN A;  2R5A A;  1VQ5 T;  5D6Y A;  4RQF A;  1K9M U;  5GAN g;  1D1B A;  3CD6 A;  1HSQ A;  1VQ4 A;  4JRI A;  1QP2 A;  2LQW A;  1ZSG A;  3UAT A;  3A31 A;  3RGL A;  3HY0 A;  2BZY A;  1S72 A;  3VQY A;  1H8K A;  3CCJ Q;  4FYY B;  4OLF A;  2LCC A;  2LZ6 B;  5LJ5 e;  2HAX A;  1Z9Z A;  1JEG A;  2YLB A;  3OYH A;  3TU4 K;  4C8Q D;  2VXF A;  3UA7 A;  1S72 Q;  1FMK A;  1JJ2 S;  4KGX B;  4OML A;  1RL2 A;  4P5N A;  4M75 G;  4Z02 A;  2OJ2 A;  2LJ0 A;  3UDC A;  5IT9 E;  1TWB A;  3CCR T;  4ZTZ B;  2EJF A;  3LYI A;  4OGC A;  4CH6 A;  4Q6G A;  3IG2 A;  2IY5 B;  1B34 B;  3ZEH A;  1VQ7 T;  2ZZD A;  4XTU A;  3O8V A;  4M77 B;  4C0D C;  2DTO A;  3UH0 A;  3M4G A;  3A7R A;  2RM4 A;  3MP1 A;  2ED0 A;  1IHW A;  4UP7 A;  2JXB A;  3C95 A;  2ZIM A;  2KEA A;  3I7F A;  3QZ9 B;  2MAM A;  1ASY A;  1EOV A;  3QPH A;  3M4P A;  4XAX B;  1KFZ A;  2KE9 A;  3L1A A;  4LVK A;  3PCO B;  4XQ3 A;  4HT9 A;  2J3M A;  1GCQ C;  3UA6 A;  3OD1 A;  2K3Y A;  1O75 A;  5FU6 C;  4YRJ A;  2V26 A;  3G6E A;  4M75 F;  1EIY B;  3TRE A;  2Q5I A;  4OMF B;  4M78 F;  4HXJ A;  4OF1 A;  2RJC A;  5LJ3 d;  2M0Y A;  4A4K A;  3M0R A;  2QTV A;  3JCM g;  1IL2 A;  2M16 A;  2CS7 A;  1VQ9 T;  2HBP A;  2RHY A;  5GAM g;  3G1Z A;  2AT1 B;  4IUU A;  1LJO A;  3BE3 A;  5M9O A;  4ME7 A;  3JCM P;  3SWN C;  1K73 C;  2FHD A;  3G6E Q;  3CC2 Q;  1LNX A;  1NJ8 A;  3PE0 A;  3V8L A;  1AWO A;  1ZLM A;  2ODR C;  1ZSZ C;  4Z8A A;  2EW3 A;  1NBE B;  5FRN A;  3RBB B;  4IIO A;  2Q7H A;  3CPF A;  4M78 C;  2ZCE A;  2DD5 A;  4QVZ A;  1X2H A;  2ED1 A;  2KYM A;  4IUT A;  3L4G B;  2JNG A;  1Z9Q A;  4O2D A;  2LTO A;  2RF0 A;  3CEY A;  3OMG A;  3ZL7 C;  3PIP A;  2GF7 A;  2I4L A;  1VQO A;  1ZBX A;  1VQ8 A;  1MND A;  4NL2 A;  4EX5 A;  4YRG A;  4ANJ A;  4J9H A;  2KRM A;  2QXF A;  2XK0 A;  2AMC A;  3HFZ A;  2XTI A;  1TUC A;  2DNU A;  2DX1 A;  2KAF A;  5GAN h;  2BE7 D;  4TVA A;  4KR3 A;  1VQO Q;  2HEQ A;  1VQ8 Q;  4IUV A;  4H2U A;  1BIA A;  3I9Q A;  3EGX B;  1N9W A;  2DZC A;  5KYY B;  3OB9 A;  4M7A A;  4YRM A;  3R6O A;  2DTI A;  4MML A;  1FMV A;  4R0K A;  4DBH A;  2ZR3 A;  4X5O A;  3DLM A;  4AFZ C;  2RQR A;  2X51 A;  2JMA A;  5CK9 A;  1MHN A;  2GNC A;  2ZPF B;  4H2V A;  4XU0 A;  2RHS B;  3VQW A;  1NE8 A;  1M27 C;  2E41 A;  4D8D A;  3HXX A;  3OS5 A;  2HQX A;  2YXY A;  1RLQ C;  4M7D A;  5KNN A;  4N0A A;  5FWB A;  2AKW A;  1USY C;  3RKW A;  4PJO A;  4LDU A;  2QEX A;  2C0O A;  2LJ1 A;  4L6V 5;  4YRK A;  1YCS B;  3PMI A;  2HMA A;  3ULR B;  1UDL A;  3GF5 A;  2DLP A;  1HYO A;  3ER0 A;  2KRS A;  3NTK A;  1MMN A;  5FU7 B;  4X9D A;  3VS3 A;  4CC7 A;  4F7U B;  3A8L B;  3RER A;  3E9I A;  1AT1 B;  5LJ3 g;  2DQ0 A;  2RHU A;  2FO0 A;  1VQZ A;  1SSH A;  3GIB A;  4C92 A;  4TTV A;  4QQ6 A;  5EC7 A;  1AZE A;  1UGQ B;  5GAN 8;  2LVM A;  3E1S A;  4BB7 A;  1UGR B;  1O9S A;  3OYJ A;  1W2B P;  1KQS A;  4RTZ A;  1X69 A;  5FRO A;  5KH6 A;  3M4Q A;  4AFS C;  3AHU A;  4M78 E;  4E51 A;  2FPD A;  4FL6 A;  1OX8 A;  4PKC C;  4C8Q A;  1HD3 A;  3HKS A;  2XHC A;  2KSS A;  2OTJ A;  3CPW P;  3BDL A;  2DA9 A;  3CCQ T;  5IHN A;  1NJ2 A;  3PIO A;  1B07 A;  2ZIO A;  1QVF S;  4H2X B;  2PNI A;  3EH2 A;  2OTL T;  2EBP A;  1WXU A;  4ZGJ B;  1YFR A;  1OUL A;  2JS2 A;  3LH0 A;  2DDZ A;  2QHV A;  2B8A A;  4JRQ A;  3OSS C;  1H4T A;  2XID A;  1ABQ A;  2DZ9 A;  3JCM h;  1QVG P;  3QWY A;  2JT4 A;  1QVP A;  2RJE A;  4M7A G;  1PRM C;  4LNS A;  1T0J A;  1XNI A;  2GGR A;  2RK2 A;  4RTX A;  5GAM h;  4BE2 A;  2DD4 A;  2COW A;  1G3S A;  1I1J A;  1T3L A;  1WNL A;  3REX A;  4XTY A;  3LSS A;  2LC4 A;  1UJ0 A;  1V1C A;  2RHZ A;  2RI2 A;  4MDX A;  3OYC A;  2DU7 A;  4C0F A;  1YJW T;  1RAA B;  1KQS S;  1BCO A;  2ZTG A;  2DL8 A;  2EGE A;  4CRI A;  2YHT A;  1M2V B;  2FVU A;  2EVR A;  1WIE A;  4ELZ C;  2DEU A;  5IN1 A;  4M7D G;  2ZAE A;  4K88 A;  1NLO C;  4M78 D;  3MHX A;  2PUO B;  4PJO G;  3HRI A;  3NPF A;  1VIF A;  1HTT A;  1KSW A;  1YJN A;  2GFA A;  3EH1 A;  2PTK A;  3MEA A;  3OA6 A;  3HRT A;  3L2U A;  3D7S B;  2CT4 A;  4HCK A;  3CC7 T;  1WJQ A;  4CC4 B;  3FIF A;  1MNE A;  5LJ3 f;  2RI5 A;  2XDD A;  5HGQ A;  1U06 A;  2EYY A;  1H3H A;  4LDW A;  1B7Y A;  1WXT A;  1NNH A;  2D8J A;  1SHF A;  2A3L A;  1YJN Q;  3CMA A;  3MF1 A;  2I2L A;  4C92 G;  2QHS A;  3IKL A;  1AEY A;  4XTW A;  8AT1 B;  2I0N A;  2OX7 A;  2O2O A;  4HWT A;  1KG1 A;  2HCK A;  4FT2 A;  3JCM W;  2KYB A;  1G5V A;  4XEO A;  1YHQ T;  5GMK j;  4G84 A;  3CCM T;  1YBY A;  2VC8 A;  4BY6 B;  3OYF A;  4C8Q G;  1M3A A;  1AD5 A;  2X4J A;  3CMA Q;  1YIT A;  1E7O A;  4UP8 A;  4JJN K;  3X25 B;  3CCU Q;  4IUQ A;  1BBW A;  3VS2 A;  1WDX A;  4P74 A;  2A36 A;  4YRE A;  3I56 T;  3JCM X;  4H2W A;  3VJP A;  2V8K A;  5GMK l;  4EMK A;  1EFN A;  1JQQ A;  2HL5 C;  3M55 A;  4YRF A;  5I22 A;  1OEB A;  5GAN 2;  1K8A R;  1YIT Q;  4LDY A;  2RNA A;  4YRN A;  2X9H A;  3CMQ A;  2V8I A;  1I5L A;  3A32 A;  3HRU A;  3PVL A;  2QTX A;  3HP9 A;  2CRE A;  1PD0 A;  2P5I A;  1SHG A;  3L2Z A;  4ZIB A;  2V1Q A;  3FJ5 A;  3A7A A;  5CIU A;  1YN8 A;  1U1T A;  3OYN A;  3ERR A;  3NFC A;  2GTO A;  3VS7 A;  3CCL A;  2K5F A;  1H3Z A;  1R77 A;  4J6Y A;  1E6H A;  4JRK A;  2XDP A;  1BKB A;  2DBM A;  3GPL A;  4C5I A;  2WSF E;  4K11 A;  2HBW A;  5LJ3 h;  3X24 B;  1WI7 A;  2QDL A;  1GFD A;  2DBK A;  4C8Q F;  1OZ2 A;  1WQ7 A;  2KNB B;  1X55 A;  2LQK A;  1IGQ A;  2BZX A;  2DET A;  2ZCF B;  1YJ9 T;  2VUB A;  2KRN A;  4LUD A;  3H0I A;  1VQK T;  3P8B B;  3TQ7 P;  4RG2 A;  2EWN A;  2F1L A;  1PRL C;  2EIF A;  2EQM A;  3CXC P;  3SFM A;  1EVK A;  2IIM A;  5GMK i;  2K57 A;  2DKG A;  1M3C A;  5IH2 A;  3V8K A;  3OYG A;  2JN0 A;  3A8O B;  1Y7X A;  4QKU A;  5GAN j;  4J9C A;  1I8F A;  3EFR A;  1I07 A;  2RHX A;  3VUB A;  2E6Z A;  3FJP A;  1UJY A;  1WJR A;  1E1O A;  1H64 1;  5KCH A;  5IXB A;  3HXW A;  3JCM V;  2CP0 A;  3G4S A;  5DLO A;  4RCB A;  5DLQ E;  1EZZ B;  5A0G A;  3BFM A;  1Q7Y U;  3RMS A;  4AG1 C;  4BI8 B;  4Y91 A;  2E5K A;  5C6S A;  3H0H A;  1NJ1 A;  4P75 C;  1K4U S;  2M02 A;  1MMA A;  4YDQ A;  4N4H A;  3QUI A;  1UB4 A;  3G4S Q;  4K87 A;  2F5T X;  3CCR Q;  4CI0 C;  4RG8 A;  3QWX X;  1M8V A;  3UGQ A;  1U8R A;  2BE9 B;  2DL4 A;  3G71 A;  4DA4 A;  2CZ6 B;  3AT1 B;  1AOJ A;  2EQK A;  3LWI A;  1VQL T;  2VXE A;  3JRZ A;  4M77 C;  2I4N A;  1GCQ A;  4II1 A;  2V1R A;  2YUO A;  1K9A A;  3GLX A;  2EL9 A;  1VQ7 Q;  1KIK A;  4V2S A;  4E7I A;  4YYE A;  4A63 B;  1WHK A;  4TWA A;  4OB2 B;  3CCV A;  2OAU A;  1PYS A;  1T3S A;  4FYX B;  2CJB A;  1K76 A;  1PSF A;  1XQH A;  3VS4 A;  2FZC B;  2CP3 A;  3EGD B;  4G85 A;  3A5Z A;  1BI3 A;  1Q95 G;  2ZPI B;  2W10 A;  3ZBD A;  1RAB B;  3SWN A;  2CT3 A;  2RQV A;  1C1A A;  1YFS A;  1TUG B;  3JV3 A;  3M54 A;  1ZSZ A;  2EAY A;  3RF1 A;  2R58 A;  3TUP A;  3CBM A;  4M78 A;  5GJW B;  1B70 A;  2E3I A;  2MMP A;  1VQ9 Q;  1G51 A;  3WXM B;  2L5Q A;  1W70 A;  2AMC B;  3CC4 A;  4CS3 A;  4ZN1 A;  2JW4 A;  4TVA B;  5A0L A;  1T0H A;  5GAM j;  4NCX A;  4YRL A;  5J26 A;  4MZP A;  2F2V A;  3U23 A;  3JB9 I;  1VYV A;  4JLI A;  1FXX A;  3X20 B;  1ZUU A;  4M7A B;  1VQN T;  5GAO r;  2RA2 A;  4JRP A;  2JJ9 A;  1Q81 R;  2COY A;  3M0T A;  3ME9 A;  1E1T A;  3MCA B;  4MZT A;  1EX4 A;  5KYN A;  2MI6 A;  1JJ2 A;  2CP7 A;  1FYN A;  2I4M A;  1AHJ B;  1WHG A;  3QXE B;  2K2V A;  4BAC A;  1RI9 A;  1NG2 A;  2HKQ B;  3NGP A;  4C5G A;  3EFS A;  1PG5 B;  3QYG B;  4Y28 E;  4Y92 A;  1OOT A;  3OYE A;  2DVE A;  4QQG A;  4BD3 A;  4M7D B;  2P84 A;  1AWJ A;  2AKW B;  4PJO B;  2QA4 T;  2X35 A;  3NHN A;  3QO8 A;  4PL6 A;  1N9R A;  1TTH B;  3CCS T;  4XK8 E;  2GBQ A;  5CCA A;  1BBU A;  1NJ6 A;  2WAC A;  2L3S A;  1Q7Y R;  3EG9 A;  1IRX A;  3A74 A;  5C51 B;  3MEV A;  1RIQ A;  4M77 E;  5J3B A;  2YRD A;  2ALY A;  4EDU A;  1Q86 R;  1USY A;  2K4Y A;  3O5Z A;  3QBY A;  3CCE T;  3NET A;  2BIV A;  2AK5 A;  1VQP A;  4DPG A;  3PFS A;  4F7U F;  4C92 B;  4IKF A;  3LSQ A;  4FW1 A;  3RES A;  4TVY A;  1YGB A;  1ZBJ A;  1SF9 A;  2J05 A;  3HY1 A;  2LX9 A;  1GRI A;  4ORZ A;  5I21 A;  2LMJ A;  4BUG A;  4M78 G;  3REU A;  2ROL A;  1VUB A;  2DAQ A;  1VQP Q;  3JB9 F;  2BTT A;  1M90 R;  4B9W A;  1UHF A;  3CBP A;  3OS1 A;  2CH4 W;  2JTM A;  3FEO A;  2NUZ A;  3MEW A;  4RTU A;  3P8H A;  3THK A;  2DYB A;  3A8H B;  3REA B;  2FYK A;  4WI1 A;  1UEB A;  1OYX A;  1C0A A;  1KMN A;  1PCX A;  1SET A;  1RAI B;  5HCK A;  1IHV A;  4A4F A;  4L59 A;  2O4X B;  1TXQ A;  3I55 A;  2J7I A;  2J06 A;  3S3N A;  2KVQ G;  4M77 D;  2YLC A;  2DEQ A;  2HKN A;  1X6B A;  5GMK h;  4YCW A;  2FL7 A;  5LJ3 j;  2FEI A;  2QQA A;  4XU2 A;  4FYW B;  1Q81 C;  1RAC B;  2KQW A;  2ZPB B;  5GAN f;  3I55 Q;  3NTH A;  3VKI A;  5CQY A;  1FWZ A;  1SKU B;  4AFQ C;  3VRZ A;  4A4E A;  3CC2 A;  2HDA A;  3RAC A;  2A28 A;  2E1H A;  2Q5H A;  2PVO B;  5LJ5 d;  2OTL Q;  1Y07 A;  4PFO A;  2MCN A;  4OB1 B;  2QQ9 A;  3OSV A;  1P92 A;  5IHK A;  3HSB A;  4PJN A;  3W3S A;  2VKN A;  3KFV A;  2PVD B;  4GBQ A;  1MUZ A;  2CDT A;  1QW1 A;  1OQK A;  4KGZ B;  2P4R A;  1YFN A;  2X3X D;  4FCY A;  3GBQ A;  1Y57 A;  1Q7Y C;  4O5V A;  1D3B A;  1E24 A;  3SEM A;  3HXU A;  1Q86 C;  1MMG A;  1PKS A;  4RTW A;  1YIJ T;  1ZHI A;  2NWM A;  2ZPH B;  1ZX6 A;  2DK3 A;  5HK0 A;  5KYX B;  1S1N A;  5KYU A;  2Y90 A;  2ZGW A;  2CJ9 A;  3QO7 A;  4AT1 B;  1TS9 A;  5KE3 A;  3OYD A;  3M9Q A;  1KQS P;  1VQM T;  3TEH A;  2AKK A;  2C7I A;  1Z7M A;  1JXO A;  4EMK B;  3CC7 Q;  1KK7 A;  2E4H A;  2K6D A;  4DEY A;  4AG2 C;  1M90 C;  1GL5 A;  1A0N B;  1D09 B;  3A1P A;  2KXC A;  3CME A;  4TQF A;  1WX6 A;  2C8M A;  4VUB A;  5C0M A;  4F7U E;  1AZG B;  4B9X A;  2NUT A;  1NLP C;  1QKW A;  4Z88 A;  4BY6 C;  3X26 B;  2CYZ B;  2CZ7 B;  1MV3 A;  1YHQ Q;  2A08 A;  3JCM J;  3CQT A;  3CME Q;  3CCM Q;  2BUD A;  2ESW A;  4HVW A;  3P8V A;  2LT4 A;  3A8M B;  3VU3 C;  1KHI A;  2HD0 A;  3CCJ T;  1WHJ A;  1U1S A;  2ZPE B;  2KMT A;  4JJC A;  5FLX E;  1J3T A;  4PFZ A;  3VS5 A;  3JCM f;  3VQX A;  2YUP A;  3CD6 T;  1QP3 A;  2YWW A;  2LCL A;  5FRM A;  3UT1 A;  1VQ4 T;  3UWN A;  3DLL A;  5GAM f;  1ZA1 B;  1GGM A;  2MPX C;  4HCB A;  1QVF A;  1UHC A;  2LQN A;  1WYD A;  2JTF A;  1NYF A;  3GNG A;  2RHQ B;  1S72 T;  3RDV A;  2KGT A;  3HXV A;  1IRE B;  4YRT A;  1HC7 A;  4LDV A;  2ARU A;  2G3R A;  2DO3 A;  1K8A U;  3QHS A;  1IZ6 A;  2DJQ A;  3V7R A;  5KYW A;  3NMZ C;  5HKC A;  3URG A;  2QQR A;  5LJ5 g;  2P0Q A;  4EMH A;  1BI2 A;  1BU1 A;  1ABO A;  1TG0 A;  3MPU B;  2BZ8 A;  1X2G A;  3E9G A;  2QYZ A;  3DB4 A;  1EQR A;  3A5Y A;  3MJX A;  3JB9 D;  4FSX A;  3EG1 A;  3JCM Q;  6AT1 B;  2M0O A;  1VQK Q;  3R07 A;  1GBQ A;  4C0D B;  1QKX A;  2NYS A;  2QG9 B;  4J7I A;  2DIL A;  2F69 A;  3HRS A;  1TU0 B;  3JCM b;  2GQV A;  1VQ6 A;  4P75 A;  2Z0W A;  3OQ5 A;  3UPU A;  1YI2 A;  3SB2 A;  1Q82 U;  3X28 B;  5GMK m;  3G7Z A;  2KT1 A;  5AT1 B;  4E6R A;  5FU6 B;  4E7L A;  2QQB A;  3LH5 A;  1NZ9 A;  1VQ6 Q;  3JB9 H;  5CKH A;  3EHQ A;  4P71 C;  3QDF A;  1YI2 Q;  4HVC A;  2J3L A;  2I4O A;  3G6E T;  4M77 A;  2CKK A;  3CBO A;  2DRK A;  4J9G A;  4KT0 E;  2PME A;  4WCI A;  5GMK e;  3MP6 A;  1SPK A;  3SWN B;  5GJV B;  3NTI A;  1D1C A;  2DF6 A;  1WXB A;  3H0F A;  4QW2 A;  3G1J A;  3PGG A;  4C0G A;  1PD1 A;  1FYF A;  5KE2 A;  3M56 A;  1N9S A;  1WU7 A;  3JSC A;  5HY6 A;  2CUD A;  1WLE A;  4M75 B;  2XDB A;  2XGT A;  2CZ0 B;  3QKJ A;  5J39 A;  3C12 A;  1VQL Q;  2PUK B;  4OMQ A;  3FDR A;  4GLK A;  3SHW A;  1JRI A;  2NUP B;  2DIQ A;  2GCX A;  3CCU A;  3HXY A;  3PT9 A;  5IAY A;  3OW2 A;  1IO6 A;  2ZT6 A;  3DB3 A;  1M3B A;  1ZQ1 A;  1PNJ A;  1R0C B;  1FX7 A;  2ZXF A;  1N27 A;  3GOX A;  1VQO T;  1VQ8 T;  2FPF A;  2DIG A;  1DJ7 B;  3L2R A;  1YWP A;  1JBM A;  1M4Z A;  4FU6 A;  4OB3 B;  2EKH A;  2JS0 A;  4OMP A;  1TH7 A;  4J6W A;  2EYX A;  2O31 A;  2BKD N;  1H4V B;  2K3B A;  1UGS B;  3TCJ A;  3QNE A;  3MF2 A;  1WQW A;  1OPL A;  1QCO A;  4ATO A;  5GAN 6;  2YDL A;  1SG5 A;  4L87 A;  4CH4 A;  4YRC A;  4ZTF A;  1WJS A;  4DBQ A;  2ECZ A;  2LJ3 A;  3PMT A;  2X4X A;  3EG9 B;  3OW2 S;  2KXD A;  2J6K A;  3I5S A;  1UGV A;  4PJJ A;  2QK0 A;  5GAN e;  3NEM A;  4P73 C;  5E3I A;  1BI0 A;  3J7A F;  1VQN Q;  2DL7 A;  4M77 G;  1VQ5 A;  2DFU A;  3RIR A;  1XJW B;  4ZNX A;  5LJ5 h;  4BE0 A;  2EYW A;  3DSQ A;  1LVK A;  3EGX A;  2ART A;  3TSZ A;  4PHC A;  2CP2 A;  1YNZ A;  5GAN 3;  1Q81 U;  1GCP A;  3LLR A;  2QEX T;  4PK4 A;  4J5Y A;  4KR2 A;  1G5I A;  2AKL A;  1VQ5 Q;  2ZT5 A;  2KRO A;  4B6M A;  1KC8 R;  4A54 A;  4J15 A;  4TVR A;  3H6Z A;  4X9C A;  2VAS A;  3HFN A;  4D8K A;  3CPW S;  1Q82 R;  2FZG B;  1H4Q A;  2QA4 Q;  3JAM E;  4YPF A;  1F1B B;  1MGQ A;  4JJB A;  4H2T A;  3JB9 J;  3QO3 A;  2XI9 A;  1ADY A;  1U5S A;  2WSC E;  2ROT A;  3S3M A;  5L8R E;  1NM7 A;  2EGA A;  4LXC A;  1WGS A;  1G5H A;  1LPL A;  2JMC A;  2FB7 A;  5GAN 4;  2D0N A;  4E2F B;  1WHH A;  3CCE Q;  5GAO l;  3C94 A;  2F2W A;  2M1H A;  2QAZ A;  3CCR A;  1G3T A;  5GAO n;  2Q7G A;  2P4T A;  4P72 C;  1OZ3 A;  4M77 F;  4KRT A;  2OTJ T;  1Q86 U;  4F7U A;  1PSE A;  5D6X A;  2RJF A;  4ELY C;  3QTC A;  4FT4 A;  5C52 B;  5IXF A;  4A4G A;  3T9N A;  3RKY A;  4ZGE B;  2ZZF A;  1JJ2 P;  4XTX A;  4DEX A;  1VQ7 A;  4BDY A;  1D0X A;  3VS6 A;  3WVE B;  1UG1 A;  2RH2 A;  4A4H A;  1BYM A;  1X75 C;  4OB0 B;  1K8A C;  1CKA A;  1B8A A;  1JB0 E;  3LWH A;  1M90 U;  3VUZ A;  1Y96 A;  4PNO A;  2ZNI A;  3HRK A;  2RHI A;  4J83 A;  3FLG A;  4J8O A;  1JJC A;  2GQI A;  1M2O A;  1X6O A;  4LDX A;  4NOY A;  2K5L A;  5AYF A;  4YRO A;  2ENM A;  4RTY A;  3JCM e;  3MKD A;  2F5K A;  4M7A E;  1D3B B;  1D1A A;  5GAM e;  5ELO A;  1GBR A;  2H3E B;  3J81 E;  1EIF A;  1J5W A;  3S6W A;  2FRW A;  1X43 A;  1VQ9 A;  4MZM A;  1YJN T;  2YUQ A;  1R8O B;  4O6J A;  2CJA A;  1XOV A;  4JZ3 A;  3LX7 A;  3MP8 A;  2R5M A;  5A0D A;  3SD4 A;  5KYU B;  4RMO A;  4WTO B;  1HJD A;  2L8D A;  4KUL A;  2EJ9 A;  1QWE A;  2JOY A;  4LE9 A;  1I81 A;  3H9N A;  1KQ1 A;  5CR2 A;  2CH4 A;  2DE0 X;  2XD0 A;  5CO7 A;  2IPO B;  4M7D E;  1HXD A;  4PJO E;  3CMA T;  4HA8 A;  1OU8 A;  3RUX A;  4CH5 A;  2DXB A;  2DL3 A;  1Q82 C;  3HFZ B;  4E7H A;  4P3N A;  4KGV B;  2AHJ B;  3M0U A;  4C0Z A;  2D0Q B;  4H02 A;  3P8T A;  1H92 A;  1XTD A;  2CP6 A;  2CGH A;  2E10 A;  3MEY A;  5GAN 5;  4F7U G;  1YIT T;  3NEL A;  1G83 A;  3L2V A;  1M1F A;  1PKT A;  2VV5 A;  1B76 A;  1RAG B;  2G4C A;  3KBG A;  4M7A D;  1SRY A;  4C92 E;  1YIJ Q;  2KK4 A;  4KBM B;  4J6X A;  3QDR B;  3NEN A;  4JJD A;  4C5H A;  4ESR A;  4IIM A;  4RMF A;  3JB9 G;  1VQM Q;  1NJI R;  1GFC A;  1BCM A;  2GFU A;  4EIK A;  3PNW C;  4JS5 A;  3VYH B;  3LGF A;  2C0I A;  2KR3 A;  2B86 A;  2RJD A;  1Z7N A;  3TSW A;  1LOJ A;  1WFW A;  2W0Z A;  4M7D D;  1SES A;  5FW9 A;  4PJO D;  2P0P A;  2Y4X A;  3UFG A;  2DQ3 A;  3CCL T;  2CSQ A;  2DMO A;  3EG3 A;  1WPY A;  5KYW B;  2AZS A;  4RTT A;  2MK5 A;  3OMC A;  2M9U A;  1MMD A;  4EMG A;  3QJ6 A;  2DER A;  4N4G A;  1K73 R;  3INZ A;  2X3W D;  4CS2 A;  4C92 D;  5CKB A;  2EPD A;  1KD1 U;  1UFF A;  1BBZ A;  4Z89 A;  3RL6 A;  1N5Z A;  3HPW A;  2PMF A;  4RCC A;  3CD6 Q;  5LJ3 e;  2OI3 A;  4C8Q B;  1VQ4 Q;  1SRM A;  1YB3 A;  4HVV A;  3HTZ A;  4HWS A;  4DOW A;  1BI1 A;  3VS1 A;  3VRY A;  4AMC A;  2A0F B;  1ARK A;  2LX7 A;  3MQZ A;  1X27 A;  4CC2 A;  5FU7 C;  5CVI A;  2C06 A;  4E7Z A;  1X56 A;  1RAH B;  3ICA A;  3QYH B;  4JUV A;  3J80 E;  1JO8 A;  2DRM A;  2L3Q A;  5DM7 R;  3G4S T;  2JTE A;  7AT1 B;  4GLM A;  1X54 A;  2MWP A;  3IKM B;  2L0A A;  4UC4 A;  1RLP C;  1YFT A;  3CCQ A;  1E22 A;  1PC0 A;  2CP5 A;  5LJ5 j;  2OTL A;  3QII A;  2EFI A;  2M51 A;  3RKX A;  3UF4 A;  4R56 A;  3OYI A;  2VWF A;  3OY9 A;  4GY5 A;  4H2S A;  2VVK A;  2DPP B;  3G71 T;  1G3W A;  4YRS A;  3P8Y A;  3CCQ Q;  3QG1 A;  3MET A;  2YRC A;  1NJI C;  1RAE B;  2MIO A;  3TVT A;  4K86 A;  4P71 A;  1QQJ A;  2RB6 A;  5CAI A;  1AWW A;  1M1K R;  1R0B G;  1VOM A;  1PWT A;  1YJW A;  1QVF P;  4JPB W;  2LDM A;  3EFO A;  4DOV A;  3FB9 A;  3VV0 A;  2EGC A;  3CCV T;  3OYB A;  1X01 A;  4XU1 A;  3HHT B;  1B7Y B;  4ZN3 A;  3QJY A;  4RKU E;  1G2B A;  2RQT A;  4IUR A;  2K2M A;  3OYA A;  3IQL A;  4OMO A;  3TEG A;  5ELN A;  3PTA A;  2L89 A;  5GAO q;  2FG0 A;  1YJW Q;  4EPC A;  4HT8 A;  3CC7 A;  2MOX A;  2K5I A;  3ASK A;  2K79 A;  4MDW A;  2L3P A;  1V76 A;  2A8E A;  1EVL A;  1WHM A;  5HK3 A;  2MF2 A;  1IB8 A;  1X6G A;  1OV3 A;  2LT1 A;  1VIE A;  4M75 C;  3EGD A;  3MO8 A;  5ECA A;  5C53 B;  1AVZ C;  3CC4 T;  3EAE A;  1PHT A;  9ATC B;  4QQD A;  4WF2 A;  1WHL A;  1QWF A;  4YTL A;  4UPA A;  4HCZ A;  1YHQ A;  4D6W A;  1K9M R;  3CCM A;  5GAO p;  3M57 A;  1D0Z A;  2CZ1 B;  1VYU A;  2ZR2 A;  1JU5 C;  2E64 A;  2ARS A;  1B3Q A;  1KMM A;  4OGE A;  3I56 A;  4QVC A;  1NYQ A;  1KD1 R;  1U3O A;  2E3H A;  4OMN A;  2LCS A;  4KH1 B;  2RMO A;  3OS2 A;  3L2W A;  4R55 A;  2KI7 A;  3MEU A;  4XEM A;  3RR6 A;  2XU8 A;  4LD9 K;  3I56 Q;  4OP0 A;  1M30 A;  3HTR A;  4C5E A;  2EYZ A;  1SER A;  4P73 A;  2V8J A;  2E12 A;  1NYG A;  1YCY A;  2JM9 A;  2E6N A;  2L2P A;  4RTV A;  1TUD A;  2QGG A;  3P8D A;  4X1V A;  2LNV A;  1M9S A;  2QDY B;  3E9F A;  2LQ8 A;  2K7A A;  1M1G A;  4BDZ A;  3I5R A;  2O9V A;  1D0Y A;  2CUB A;  1K0S A;  2MWO A;  2YSQ A;  1M1K C;  2O9S A;  5I11 A;  3BJU A;  2DVJ A;  1VQP T;  1WYX A;  1YJ9 A;  2KDS A;  8ATC B;  3A7U A;  1VQK A;  2YT6 A;  3R6N A;  3IAL A;  4FSS A;  1QLY A;  2G6F X;  2RN8 A;  5FWC A;  4YRQ A;  3OBY A;  3OW2 P;  1N8R U;  4JLG A;  3UGT A;  1M8M A;  2P0K A;  3M0Q A;  1YJ9 Q;  2QEX Q;  3KUF A;  2E70 A;  2ZIN A;  3QO5 A;  4ZTJ A;  3H8Z A;  1ACM B;  4LVI A;  2IG0 A;  3OYK A;  3RMQ A;  4M75 E;  4P72 A;  4E7J A;  3V7C A;  4JS4 A;  1HK9 A;  4XTZ A;  2D1X A;  5D7U A;  2YRV A;  5I2M A;  1KC8 U;  1TSF A;  3I55 T;  4FW2 A;  5KCO A;  2QGF B;  3EG2 A;  1GXI E;  4LVJ A;  3C4S A;  1K9M C;  2DYI A;  2ZNJ A;  3S3O A;  1Y96 B;  1KJW A;  4HVU A;  4HCC A;  3JCM c;  1CSK A;  4YRR A;  1JJC B;  4JZ4 A;  2EQJ A;  2HNI A;  2VGN A;  2E3C A;  4CS4 A;  4DQ2 A;  4BWA A;  4QT7 A;  1PYS B;  3OYY A;  3GP8 A;  1KD1 C;  2IY5 A;  1SEM A;  1B34 A;  2OTJ Q;  3M0S A;  4KUD K;  3CC2 T;  3A5Z B;  2O4X A;  11AS A;  4KQE A;  4HWR A;  1VQL A;  1FMW A;  4PJM A;  3EG0 A;  4OMM A;  4YRI A;  4HKE A;  1YWO A;  2ZZE A;  1PM3 A;  1G3Y A;  4E47 A;  1ZSZ B;  2SEM A;  1B7T A;  4XU3 A;  2ODR D;  2E5A A;  3PCO A;  3M4Y A;  4DBR A;  1G8X A;  4M78 B;  1B70 B;  3PVQ A;  4M75 D;  1I5O B;  2HQE A;  5LJ5 f;  1IGU A;  5CKF A;  4YP0 A;  5D6W A;  2RI3 A;  2JVV A;  3C0C A;  1EIY A;  4LD6 A;  3BW1 A;  3E2U A;  4X34 A;  2DL5 A;  1W4S A;  4NS5 A;  4F17 A;  2HSP A;  3GNF B;  5K1X A;  3M5A A;  3E19 A;  1NJ5 A;  2D8H A;  4HWO A;  2QHU A;  2K3X A;  3TEE A;  1ASZ A;  4J9E A;  3SDZ A;  3L42 A;  3M0P A;  3KFU A;  2DXC A;  1NPR A;  1OPK A;  4M7A F; 
#chains in the Genus database with same CATH homology
 2PQW A;  1W2B A;  1N6A A;  2XG8 D;  5GAO m;  4YCU A;  2KY9 A;  2X4Y A;  4IUP A;  4UP9 A;  2ZT7 A;  3CME T;  2DXU A;  2O01 E;  4CH3 A;  3WVD B;  3L4G A;  3CPW A;  1VQN A;  2QHT A;  3LW5 E;  4TQD A;  4M7D F;  4YCV A;  4BE1 A;  4PJO F;  2DJZ A;  2VGM A;  4M7A C;  3PZC A;  1I4K 1;  2P0L A;  4ZTU B;  1QVG A;  2NS6 A;  2ALY B;  3OBW A;  3M59 A;  5F5W A;  2WSE E;  4ZGD B;  5CKE A;  2QA4 A;  2D9T A;  2E5Q A;  1QF6 A;  1W2B S;  3V7S A;  4BI3 A;  4WJ3 M;  3HL8 A;  3CCS A;  5CQX A;  3ZFJ A;  4JDS A;  4C92 F;  4AH6 A;  4M7D C;  3VBB A;  4N0A C;  4TVW A;  1H4S A;  3M58 A;  3V8J A;  1ADJ A;  2QQS A;  4A53 A;  4PJO C;  4MMK A;  3HFO A;  5CKD A;  3OS0 A;  3L2Q A;  2RHS A;  3CCE A;  1NJI U;  3A8G B;  4LVM A;  1M5Q 1;  4QVD A;  3BY7 A;  1BIB A;  2EKO A;  1KOG A;  4XTV A;  4Q15 A;  1L0W A;  3VQV A;  1W66 A;  2RHQ A;  2PU9 B;  1QVG S;  4P3O A;  4C92 C;  2EYQ A;  2NLU A;  1OI1 A;  2RO0 A;  4YRP A;  2L3R A;  4N4I A;  5EG2 A;  1NPP A;  1ATI A;  4C8Q C;  4RDX A;  1K73 U;  2DTH A;  5A2Q E;  1SSF A;  2VYT A;  12AS A;  1VQ6 T;  3HFV A;  5GAN d;  4HT4 A;  2EJG A;  1YI2 T;  1QE0 A;  4P3P A;  2QI2 A;  3OYM A;  4J7F A;  2RK1 A;  3WQZ A;  4Q5W A;  4HWP A;  3Q1J A;  2D6F A;  1KHC A;  2LRQ A;  2XIC A;  4H2X A;  5LL6 S;  3LC0 A;  2XKO C;  3OYL A;  2ZT8 A;  2DXT A;  5GAN 7;  3FC3 A;  3N5B B;  1V29 B;  5I2S A;  4NL3 A;  1N8R C;  4PG3 A;  4WJ4 A;  4PLL A;  2H3J A;  3KXT A;  4LVL A;  2JUF A;  2R57 A;  1KQ2 A;  3TEH B;  2IVW A;  2EQU A;  2E65 A;  2JZ2 A;  3BDU A;  1KC8 C;  2Q7E A;  4KUI A;  2Y4Y A;  4FIB A;  2A7Y A;  3CCU T;  3CXC A;  1NYR A;  3M53 A;  1YIJ A;  4H2Y A;  1Y71 A;  1M1K U;  4BI4 A;  4FM4 B;  4M75 A;  4BW9 A;  3F70 A;  3QSU A;  1VQM A;  4OVA A;  1RI0 A;  3QZ5 B;  2RD1 A;  4PLI A;  2PVG B;  4EO4 A;  4RQE A;  3DKM A;  3VYG A;  2X4W A;  5DY9 A;  4P74 C;  2ZZG A;  1UGP B;  2DU5 A;  4EMK C;  4C8Q E;  2ZPG B;  4L5G A;  3E9H A;  3JCM d;  2CIM A;  3LGL A;  4E7K A;  1EFW A;  5GAM d;  3CXC S;  5K1P A;  1LYL A;  3HXZ A;  3CCJ A;  3FRN A;  2R5A A;  1VQ5 T;  5D6Y A;  4RQF A;  1K9M U;  5GAN g;  3CD6 A;  1VQ4 A;  4JRI A;  1QP2 A;  3A31 A;  3RGL A;  3HY0 A;  1S72 A;  3VQY A;  4OLF A;  2LCC A;  5LJ5 e;  2HAX A;  2YLB A;  3OYH A;  3TU4 K;  4C8Q D;  2VXF A;  1JJ2 S;  1RL2 A;  4P5N A;  4M75 G;  4Z02 A;  3UDC A;  5IT9 E;  3CCR T;  4ZTZ B;  2EJF A;  3LYI A;  4OGC A;  4CH6 A;  4Q6G A;  3IG2 A;  2IY5 B;  1B34 B;  3ZEH A;  1VQ7 T;  2ZZD A;  4XTU A;  3O8V A;  4M77 B;  4C0D C;  2DTO A;  3UH0 A;  3M4G A;  3A7R A;  2RM4 A;  3MP1 A;  4UP7 A;  3C95 A;  2ZIM A;  3I7F A;  3QZ9 B;  2MAM A;  1ASY A;  1EOV A;  3QPH A;  3M4P A;  4XAX B;  3L1A A;  4LVK A;  3PCO B;  4XQ3 A;  4HT9 A;  2J3M A;  3OD1 A;  2K3Y A;  1O75 A;  5FU6 C;  4YRJ A;  3G6E A;  4M75 F;  1EIY B;  3TRE A;  2Q5I A;  4OMF B;  4M78 F;  4OF1 A;  2RJC A;  5LJ3 d;  4A4K A;  3JCM g;  1IL2 A;  2M16 A;  2CS7 A;  1VQ9 T;  2HBP A;  2RHY A;  5GAM g;  3G1Z A;  4IUU A;  1LJO A;  5M9O A;  4ME7 A;  3JCM P;  3SWN C;  1K73 C;  2FHD A;  1LNX A;  1NJ8 A;  3V8L A;  2ODR C;  5FRN A;  2Q7H A;  3CPF A;  4M78 C;  2ZCE A;  2DD5 A;  4QVZ A;  1X2H A;  4IUT A;  3L4G B;  2JNG A;  4O2D A;  2LTO A;  3CEY A;  3OMG A;  3PIP A;  2GF7 A;  2I4L A;  1VQO A;  1ZBX A;  1VQ8 A;  4NL2 A;  4EX5 A;  4YRG A;  2QXF A;  2XK0 A;  2AMC A;  3HFZ A;  2XTI A;  2KAF A;  5GAN h;  4TVA A;  4KR3 A;  4IUV A;  4H2U A;  1BIA A;  1N9W A;  2DZC A;  3OB9 A;  4M7A A;  4YRM A;  3R6O A;  2DTI A;  4MML A;  2ZR3 A;  4X5O A;  3DLM A;  5CK9 A;  1MHN A;  2ZPF B;  4H2V A;  4XU0 A;  2RHS B;  3VQW A;  1NE8 A;  2E41 A;  3HXX A;  3OS5 A;  2HQX A;  4M7D A;  5KNN A;  4N0A A;  2AKW A;  1USY C;  3RKW A;  4PJO A;  4LDU A;  2QEX A;  4L6V 5;  4YRK A;  3PMI A;  3GF5 A;  3ER0 A;  3NTK A;  5FU7 B;  4X9D A;  4F7U B;  3A8L B;  3RER A;  3E9I A;  5LJ3 g;  2DQ0 A;  2RHU A;  1VQZ A;  3GIB A;  4C92 A;  4TTV A;  4QQ6 A;  1UGQ B;  5GAN 8;  2LVM A;  3E1S A;  4BB7 A;  1UGR B;  1O9S A;  3OYJ A;  1KQS A;  5FRO A;  5KH6 A;  3M4Q A;  3AHU A;  4M78 E;  4E51 A;  4FL6 A;  4PKC C;  4C8Q A;  3HKS A;  2XHC A;  2KSS A;  2OTJ A;  3BDL A;  3CCQ T;  1NJ2 A;  3PIO A;  2ZIO A;  1QVF S;  4H2X B;  2OTL T;  4ZGJ B;  1YFR A;  3LH0 A;  2DDZ A;  2QHV A;  2B8A A;  4JRQ A;  3OSS C;  1H4T A;  2XID A;  2DZ9 A;  3JCM h;  1QVP A;  2RJE A;  4M7A G;  4LNS A;  1XNI A;  5GAM h;  2RK2 A;  4BE2 A;  2DD4 A;  1G3S A;  1WNL A;  3REX A;  4XTY A;  3LSS A;  2LC4 A;  2RHZ A;  2RI2 A;  4MDX A;  3OYC A;  2DU7 A;  4C0F A;  1YJW T;  1KQS S;  2ZTG A;  4CRI A;  2YHT A;  2FVU A;  4ELZ C;  5IN1 A;  4M7D G;  4K88 A;  4M78 D;  3MHX A;  2PUO B;  4PJO G;  3HRI A;  1VIF A;  1HTT A;  1YJN A;  2GFA A;  3MEA A;  3OA6 A;  3HRT A;  3L2U A;  3CC7 T;  1WJQ A;  3FIF A;  5LJ3 f;  2RI5 A;  2XDD A;  5HGQ A;  4LDW A;  1B7Y A;  1NNH A;  2A3L A;  3CMA A;  3MF1 A;  2I2L A;  4C92 G;  2QHS A;  3IKL A;  4XTW A;  4HWT A;  1KG1 A;  4FT2 A;  3JCM W;  1G5V A;  4XEO A;  1YHQ T;  5GMK j;  4G84 A;  3CCM T;  1YBY A;  2VC8 A;  4BY6 B;  3OYF A;  4C8Q G;  2X4J A;  1YIT A;  4UP8 A;  4JJN K;  3X25 B;  4IUQ A;  1BBW A;  4P74 A;  4YRE A;  3I56 T;  3JCM X;  4H2W A;  3VJP A;  2V8K A;  5GMK l;  4EMK A;  3M55 A;  4YRF A;  5GAN 2;  4LDY A;  4YRN A;  3CMQ A;  2V8I A;  1I5L A;  3A32 A;  3HRU A;  2QTX A;  3HP9 A;  2P5I A;  3L2Z A;  4ZIB A;  3A7A A;  5CIU A;  1U1T A;  3OYN A;  3ERR A;  3NFC A;  3CCL A;  2K5F A;  1H3Z A;  4J6Y A;  4JRK A;  2XDP A;  1BKB A;  3GPL A;  4C5I A;  2WSF E;  5LJ3 h;  3X24 B;  4C8Q F;  1OZ2 A;  1WQ7 A;  1X55 A;  2LQK A;  2ZCF B;  1YJ9 T;  2VUB A;  1VQK T;  3P8B B;  4RG2 A;  2EWN A;  2EIF A;  2EQM A;  3SFM A;  1EVK A;  5GMK i;  2K57 A;  2DKG A;  3V8K A;  3OYG A;  2JN0 A;  3A8O B;  1Y7X A;  5GAN j;  1I8F A;  3EFR A;  2RHX A;  3VUB A;  2E6Z A;  3FJP A;  1WJR A;  1E1O A;  1H64 1;  5KCH A;  3HXW A;  3JCM V;  3G4S A;  5DLO A;  4RCB A;  5DLQ E;  5A0G A;  3BFM A;  1Q7Y U;  3RMS A;  4BI8 B;  4Y91 A;  5C6S A;  1NJ1 A;  4P75 C;  4YDQ A;  4N4H A;  3QUI A;  1UB4 A;  4K87 A;  2F5T X;  4CI0 C;  4RG8 A;  1M8V A;  3UGQ A;  1U8R A;  3G71 A;  4DA4 A;  2CZ6 B;  2EQK A;  3LWI A;  1VQL T;  2VXE A;  3JRZ A;  4M77 C;  2I4N A;  4II1 A;  3GLX A;  2EL9 A;  4V2S A;  4E7I A;  4YYE A;  4TWA A;  4OB2 B;  3CCV A;  2OAU A;  1PYS A;  2CJB A;  1PSF A;  1XQH A;  4G85 A;  3A5Z A;  1BI3 A;  2ZPI B;  3ZBD A;  3SWN A;  1YFS A;  3M54 A;  2EAY A;  3RF1 A;  2R58 A;  3TUP A;  3CBM A;  4M78 A;  1B70 A;  2MMP A;  1G51 A;  3WXM B;  2L5Q A;  2AMC B;  3CC4 A;  4CS3 A;  4ZN1 A;  4TVA B;  5A0L A;  5GAM j;  4NCX A;  4YRL A;  5J26 A;  4MZP A;  3JB9 I;  4JLI A;  1FXX A;  3X20 B;  4M7A B;  1VQN T;  5GAO r;  2RA2 A;  4JRP A;  3ME9 A;  1E1T A;  3MCA B;  4MZT A;  1JJ2 A;  2MI6 A;  2I4M A;  1AHJ B;  3QXE B;  2K2V A;  4BAC A;  4C5G A;  3EFS A;  3QYG B;  4Y28 E;  3OYE A;  2DVE A;  4QQG A;  4BD3 A;  4M7D B;  2AKW B;  4PJO B;  2QA4 T;  2X35 A;  3QO8 A;  4PL6 A;  1N9R A;  3CCS T;  4XK8 E;  5CCA A;  1BBU A;  1NJ6 A;  2WAC A;  5C51 B;  3A74 A;  3MEV A;  1RIQ A;  4M77 E;  5J3B A;  2ALY A;  4EDU A;  1USY A;  2K4Y A;  3QBY A;  3CCE T;  3NET A;  2BIV A;  1VQP A;  4DPG A;  3PFS A;  4F7U F;  4C92 B;  4IKF A;  3LSQ A;  3RES A;  4TVY A;  1YGB A;  3HY1 A;  2LX9 A;  5I21 A;  4BUG A;  4M78 G;  3REU A;  1VUB A;  2DAQ A;  3JB9 F;  4B9W A;  3CBP A;  3OS1 A;  2JTM A;  3FEO A;  3MEW A;  3P8H A;  3A8H B;  2FYK A;  4WI1 A;  1UEB A;  1OYX A;  1C0A A;  1KMN A;  1SET A;  4A4F A;  4L59 A;  2O4X B;  3I55 A;  3S3N A;  2KVQ G;  4M77 D;  2YLC A;  2DEQ A;  5GMK h;  4YCW A;  2FL7 A;  5LJ3 j;  2QQA A;  4XU2 A;  1Q81 C;  2KQW A;  2ZPB B;  5GAN f;  3NTH A;  3VKI A;  5CQY A;  1FWZ A;  4A4E A;  3CC2 A;  3RAC A;  2E1H A;  2Q5H A;  2PVO B;  5LJ5 d;  1Y07 A;  4OB1 B;  2QQ9 A;  3OSV A;  1P92 A;  3HSB A;  3W3S A;  2PVD B;  1QW1 A;  1Q7Y C;  4O5V A;  1D3B A;  1E24 A;  3HXU A;  1Q86 C;  1YIJ T;  1ZHI A;  2ZPH B;  2DK3 A;  5HK0 A;  2Y90 A;  2ZGW A;  2CJ9 A;  3QO7 A;  5KE3 A;  3OYD A;  3M9Q A;  1VQM T;  3TEH A;  2C7I A;  1Z7M A;  4EMK B;  1M90 C;  3CME A;  4TQF A;  2C8M A;  4VUB A;  5C0M A;  4F7U E;  4B9X A;  4BY6 C;  3X26 B;  2CYZ B;  2CZ7 B;  3JCM J;  2BUD A;  3P8V A;  2LT4 A;  3A8M B;  3VU3 C;  1KHI A;  2HD0 A;  3CCJ T;  1U1S A;  2ZPE B;  2KMT A;  5FLX E;  3JCM f;  3VQX A;  3CD6 T;  1QP3 A;  2LCL A;  5FRM A;  3UT1 A;  1VQ4 T;  3UWN A;  3DLL A;  5GAM f;  1GGM A;  4HCB A;  1QVF A;  1WYD A;  2JTF A;  3GNG A;  2RHQ B;  1S72 T;  3HXV A;  1IRE B;  4YRT A;  1HC7 A;  4LDV A;  2ARU A;  2G3R A;  2DO3 A;  1K8A U;  3QHS A;  1IZ6 A;  3V7R A;  5HKC A;  3URG A;  2QQR A;  5LJ5 g;  2P0Q A;  4EMH A;  1BI2 A;  1X2G A;  3E9G A;  3DB4 A;  1EQR A;  3A5Y A;  3JB9 D;  4FSX A;  3JCM Q;  2M0O A;  3R07 A;  4C0D B;  4J7I A;  2F69 A;  3HRS A;  3JCM b;  2GQV A;  1VQ6 A;  4P75 A;  3OQ5 A;  3UPU A;  1YI2 A;  3SB2 A;  1Q82 U;  3X28 B;  5GMK m;  3G7Z A;  5FU6 B;  4E7L A;  2QQB A;  1NZ9 A;  3JB9 H;  5CKH A;  4P71 C;  4HVC A;  2J3L A;  2I4O A;  3G6E T;  4M77 A;  2CKK A;  3CBO A;  4KT0 E;  2PME A;  5GMK e;  3MP6 A;  3SWN B;  3NTI A;  4QW2 A;  3PGG A;  4C0G A;  1FYF A;  5KE2 A;  3M56 A;  1N9S A;  1WU7 A;  3JSC A;  5HY6 A;  1WLE A;  4M75 B;  2XDB A;  2XGT A;  2CZ0 B;  3QKJ A;  5J39 A;  3C12 A;  2PUK B;  3FDR A;  4GLK A;  1JRI A;  2DIQ A;  2GCX A;  3CCU A;  3HXY A;  3PT9 A;  5IAY A;  3OW2 A;  2ZT6 A;  3DB3 A;  1ZQ1 A;  1FX7 A;  2ZXF A;  1N27 A;  3GOX A;  1VQO T;  1VQ8 T;  2DIG A;  1DJ7 B;  3L2R A;  1JBM A;  1M4Z A;  4FU6 A;  4OB3 B;  1TH7 A;  4J6W A;  2BKD N;  1H4V B;  1UGS B;  3TCJ A;  3QNE A;  3MF2 A;  1WQW A;  4ATO A;  5GAN 6;  4L87 A;  4CH4 A;  4YRC A;  4ZTF A;  1WJS A;  3PMT A;  2X4X A;  3OW2 S;  5GAN e;  5E3I A;  3NEM A;  4P73 C;  1BI0 A;  3J7A F;  4M77 G;  1VQ5 A;  3RIR A;  5LJ5 h;  4BE0 A;  3DSQ A;  2ART A;  4PHC A;  5GAN 3;  1Q81 U;  3LLR A;  2QEX T;  4J5Y A;  4KR2 A;  1G5I A;  2ZT5 A;  4A54 A;  4J15 A;  4TVR A;  3H6Z A;  4X9C A;  3HFN A;  3CPW S;  1H4Q A;  3JAM E;  4YPF A;  1MGQ A;  4H2T A;  3JB9 J;  3QO3 A;  2XI9 A;  1ADY A;  2WSC E;  3S3M A;  5L8R E;  1WGS A;  1G5H A;  2FB7 A;  5GAN 4;  5GAO l;  3C94 A;  2M1H A;  3CCR A;  1G3T A;  5GAO n;  2Q7G A;  2P4T A;  4P72 C;  1OZ3 A;  4M77 F;  2OTJ T;  1Q86 U;  4F7U A;  1PSE A;  5D6X A;  2RJF A;  4ELY C;  3QTC A;  4FT4 A;  5C52 B;  4A4G A;  3T9N A;  3RKY A;  4ZGE B;  2ZZF A;  4XTX A;  1VQ7 A;  4BDY A;  3WVE B;  2RH2 A;  4A4H A;  1BYM A;  1X75 C;  4OB0 B;  1K8A C;  1B8A A;  1JB0 E;  3LWH A;  1M90 U;  3VUZ A;  1Y96 A;  4PNO A;  2ZNI A;  3HRK A;  2RHI A;  4J83 A;  3FLG A;  4J8O A;  1JJC A;  1X6O A;  4LDX A;  4NOY A;  2K5L A;  5AYF A;  4YRO A;  3JCM e;  2F5K A;  4M7A E;  1D3B B;  5GAM e;  5ELO A;  3J81 E;  1EIF A;  1J5W A;  3S6W A;  1VQ9 A;  4MZM A;  1YJN T;  1R8O B;  4O6J A;  2CJA A;  1XOV A;  3LX7 A;  3MP8 A;  2R5M A;  5A0D A;  3SD4 A;  4RMO A;  2L8D A;  4KUL A;  2EJ9 A;  2JOY A;  1I81 A;  1KQ1 A;  5CR2 A;  2XD0 A;  5CO7 A;  4M7D E;  1HXD A;  4PJO E;  3CMA T;  4HA8 A;  3RUX A;  4CH5 A;  2DXB A;  1Q82 C;  3HFZ B;  4E7H A;  4P3N A;  2AHJ B;  4C0Z A;  2D0Q B;  4H02 A;  3P8T A;  1XTD A;  2CGH A;  2E10 A;  3MEY A;  5GAN 5;  4F7U G;  1YIT T;  3NEL A;  3L2V A;  1M1F A;  2VV5 A;  1B76 A;  2G4C A;  3KBG A;  4M7A D;  1SRY A;  4C92 E;  2KK4 A;  4KBM B;  4J6X A;  3QDR B;  3NEN A;  4C5H A;  4RMF A;  3JB9 G;  2GFU A;  3PNW C;  4JS5 A;  3VYH B;  3LGF A;  2RJD A;  1Z7N A;  1LOJ A;  4M7D D;  1SES A;  4PJO D;  2P0P A;  2Y4X A;  3UFG A;  2DQ3 A;  3CCL T;  1WPY A;  3OMC A;  2M9U A;  4EMG A;  3QJ6 A;  4N4G A;  3INZ A;  4CS2 A;  4C92 D;  5CKB A;  1KD1 U;  3RL6 A;  3HPW A;  2PMF A;  4RCC A;  5LJ3 e;  4C8Q B;  1YB3 A;  3HTZ A;  4HWS A;  4DOW A;  1BI1 A;  3MQZ A;  5FU7 C;  5CVI A;  2C06 A;  1X56 A;  3ICA A;  3QYH B;  4JUV A;  3J80 E;  5DM7 R;  3G4S T;  1X54 A;  2MWP A;  3IKM B;  4UC4 A;  1YFT A;  3CCQ A;  1E22 A;  5LJ5 j;  2OTL A;  3QII A;  2EFI A;  3RKX A;  4R56 A;  3OYI A;  3OY9 A;  4GY5 A;  4H2S A;  2DPP B;  3G71 T;  1G3W A;  4YRS A;  3P8Y A;  3QG1 A;  3MET A;  1NJI C;  4K86 A;  4P71 A;  2RB6 A;  5CAI A;  1YJW A;  2LDM A;  4DOV A;  3FB9 A;  3VV0 A;  3CCV T;  3OYB A;  1X01 A;  4XU1 A;  3HHT B;  1B7Y B;  4ZN3 A;  3QJY A;  4RKU E;  4IUR A;  3OYA A;  3TEG A;  5ELN A;  3PTA A;  2L89 A;  5GAO q;  4EPC A;  4HT8 A;  3CC7 A;  3ASK A;  2K5I A;  4MDW A;  2A8E A;  1EVL A;  5HK3 A;  2MF2 A;  2LT1 A;  1VIE A;  4M75 C;  3MO8 A;  5C53 B;  3CC4 T;  3EAE A;  4QQD A;  4WF2 A;  4YTL A;  4UPA A;  4HCZ A;  1YHQ A;  4D6W A;  3CCM A;  5GAO p;  3M57 A;  2CZ1 B;  2ZR2 A;  2E64 A;  2ARS A;  1KMM A;  4OGE A;  3I56 A;  4QVC A;  1NYQ A;  3OS2 A;  3L2W A;  4R55 A;  3MEU A;  4XEM A;  2XU8 A;  4LD9 K;  4OP0 A;  4C5E A;  1SER A;  4P73 A;  2V8J A;  2E12 A;  1YCY A;  2E6N A;  3P8D A;  2LNV A;  1M9S A;  2QDY B;  3E9F A;  2LQ8 A;  1M1G A;  4BDZ A;  2MWO A;  1M1K C;  3BJU A;  1VQP T;  1YJ9 A;  2KDS A;  3A7U A;  1VQK A;  3IAL A;  4YRQ A;  3OBY A;  1N8R U;  4JLG A;  3UGT A;  2P0K A;  3KUF A;  2E70 A;  2ZIN A;  3QO5 A;  4ZTJ A;  3H8Z A;  4LVI A;  2IG0 A;  3OYK A;  3RMQ A;  4M75 E;  4P72 A;  4E7J A;  3V7C A;  4JS4 A;  1HK9 A;  4XTZ A;  2YRV A;  5I2M A;  1KC8 U;  3I55 T;  5KCO A;  1GXI E;  4LVJ A;  3C4S A;  1K9M C;  2ZNJ A;  3S3O A;  1Y96 B;  4HCC A;  3JCM c;  4YRR A;  1JJC B;  2EQJ A;  2HNI A;  2VGN A;  2E3C A;  4CS4 A;  4DQ2 A;  4BWA A;  1PYS B;  3OYY A;  3GP8 A;  1KD1 C;  2IY5 A;  1B34 A;  4KUD K;  3CC2 T;  3A5Z B;  2O4X A;  11AS A;  4KQE A;  4HWR A;  1VQL A;  4YRI A;  4HKE A;  2ZZE A;  1G3Y A;  4E47 A;  4XU3 A;  2ODR D;  2E5A A;  3PCO A;  3M4Y A;  4M78 B;  1B70 B;  4M75 D;  2HQE A;  5LJ5 f;  5CKF A;  4YP0 A;  5D6W A;  2RI3 A;  2JVV A;  1EIY A;  4LD6 A;  3BW1 A;  4X34 A;  1W4S A;  4NS5 A;  3GNF B;  5K1X A;  3M5A A;  3E19 A;  1NJ5 A;  4HWO A;  2QHU A;  2K3X A;  3TEE A;  1ASZ A;  3SDZ A;  3L42 A;  3KFU A;  2DXC A;  1NPR A;  4M7A F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...