2G4CA

Crystal structure of human dna polymerase gamma accessory subunit
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
420
structure length
397
Chain Sequence
SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase gamma subunit 2
publication title A novel processive mechanism for DNA synthesis revealed by structure, modeling and mutagenesis of the accessory subunit of human mitochondrial DNA polymerase
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 397
sequence length 420
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2g4cA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 2g4cA02
3MEYA 3REUA 1E24A 1FYFA 1ADJA 3P8TA 3EFRA 2ZCEA 1YFRA 3RKYA 1BIBA 5HGQA 4CS4A 3I7FA 3HY0A 4YPFA 2ZIMA 2CGHA 1KOGA 1EVKA 1SERA 4O2DA 4H02A 4RQEA 2ZNIA 4YRSA 2DTOA 4G85A 1ADYA 1N9WA 2ZZFA 4TVYA 3IKMB 3RKWA 1H4VB 4P73C 1H4SA 3NENA 4AH6A 4E51A 1GGMA 4TQDA 1NJ6A 2DDZA 4X5OA 2ZXFA 2J3LA 1B7YA 4YRNA 5ELNA 1B7YB 4KQEA 5K1PA 2QHTA 3L4GA 3R07A 1Z7MA 4K87A 4WF2A 2DXUA 3L4GB 1EIYB 3RGLA 2E65A 3P8YA 2AKWB 1NJ1A 3MF2A 1E22A 4XTUA 2DTHA 4YRPA 3RF1A 1HC7A 2C7IA 4H2SA 1WQ7A 4XU2A 4KR3A 3L2ZA 1E1TA 4YP0A 4YRGA 2ZT8A 1L0WA 4CH6A 3A7AA 3DSQA 2DZCA 3HRIA 4HWPA 4K86A 1X56A 2ZNJA 4J15A 3QNEA 1YGBA 2Q5HA 2E41A 4H2XA 2EL9A 4RDXA 3VQVA 1KMNA 12ASA 1JJCA 2ARSA 2P5IA 4H2XB 3RACA 4XTWA 1NJ2A 1NYQA 2EAYA 3HFVA 4XU0A 2QHUA 4XTVA 4EO4A 4OP0A 1VQZA 3IKLA 5E3IA 3QO7A 1PYSA 5C52B 2IY5A 1X2HA 3LC0A 4ZTUB 1SETA 1PYSB 2IY5B 1LYLA 3V8JA 3VQYA 2RHQA 3P8VA 2HNIA 4YRRA 2J3MA 2RHQB 4XU3A 3BFMA 1KMMA 2DU5A 2LW7A 3A7UA 2ZR2A 3EFSA 2ALYA 1J5WA 4P71C 4CH3A 4UP8A 1USYC 2ALYB 4YCWA 2DVEA 1G5HA 4P72C 1X55A 1WYDA 4WJ4A 1B70A 1BBWA 2PMFA 2G4CA 3HTZA 1ATIA 4XEOA 2ZGWA 1NYRA 1SESA 1B70B 4PHCA 3VQXA 1NJ8A 3V7RA 4XU1A 2DQ3A 4P74C 4KR2A 3RUXA 1C0AA 2EJGA 3HXYA 4HWTA 4YREA 2EJFA 2Q7EA 4CS2A 1EIYA 3QO5A 2AKWA 2ZR3A 2FYKA 4YRFA 2Q7GA 2I4LA 2CJAA 4YDQA 3PZCA 4YRMA 1G51A 1ASYA 3RIRA 3M4PA 3HXUA 3A5ZA 4YRKA 4P75A 4YROA 1QF6A 3UGTA 2Q5IA 2C8MA 1YFSA 4CH5A 1EQRA 4HWOA 2I4OA 3IALA 2EWNA 4DQ2A 3E9IA 3QTCA 4OLFA 2ARUA 2DJZA 3L1AA 2E5AA 1SRYA 1WQWA 2DU7A 4P3PA 3V8LA 5KNNA 4P71A 3M4QA 4LNSA 4Q15A 4BW9A 4Q6GA 3W3SA 3V7SA 1X54A 2AMCA 2ZZEA 4YYEA 4K88A 3NETA 2I4MA 4H2UA 2QHVA 4P73A 1Z7NA 4YRIA 2AMCB 3LSQA 4P3OA 4TVWA 2DTIA 2XGTA 3IG2A 4HA8A 4PG3A 4TVAB 4DPGA 3FJPA 2ZINA 4UPAA 3HXWA 2E64A 4TWAA 1YB3A 3WQZA 3UH0A 4HWSA 1BIAA 2RHSA 5C51B 1W66A 3HXVA 4HWRA 3QO8A 3V8KA 2RHSB 3LSSA 5K1XA 3ICAA 4RMFA 3REXA 4YRJA 4HVCA 11ASA 4YCUA 3MF1A 5ELOA 3HXZA 3TEGA 4WJ3M 1HTTA 4ZTZB 3PCOA 4H2WA 1WPYA 2DEQA 4TQFA 3TUPA 4YCVA 3PCOB 1NNHA 3A31A 1ASZA 4YRTA 3HXXA 3VBBA 3CMQA 4YRQA 2Q7HA 3UFGA 3A32A 3TEHA 3A74A 3OD1A 4CH4A 3A7RA 3BJUA 1RIQA 3E9HA 4UP9A 2ZT6A 3UGQA 2ZT7A 3NEMA 4YRLA 3TEHB 3A5YA 1YFTA 3ERRA 2QHSA 2P0LA 1EVLA 4BWAA 4L87A 4WI1A 2I4NA 1HXDA 2CIMA 2PMEA 5F5WA 1H4QA 2ODRC 1E1OA 3RL6A 4P3NA 1V95A 3V7CA 1G5IA 2DQ0A 3NELA 3G1ZA 1X2GA 1USYA 1BBUA 1B76A 4P72A 2EJ9A 4ZIBA 1WLEA 4G84A 4XTZA 2DXTA 3KFUA 4UP7A 2DZ9A 2ZT5A 2ODRD 1H4TA 3HFZA 1EOVA 4TVAA 4XTXA 2ZTGA 3HRKA 4RQFA 5C53B 3HFZB 1EFWA 4P74A 2ARTA 4TTVA 1B8AA 4XTYA 4YRCA 1JJCB 2DKGA 1IL2A 1NJ5A 3HY1A 2ZZGA 2XTIA 4H2VA 4CS3A 1WU7A 4P75C 2ZIOA 4H2TA 3RKXA 2E3CA 3VQWA 2CJ9A 1QE0A 1WNLA 4NCXA 2CJBA 2E1HA 4H2YA 1X01A 4XEMA 2E10A 4EX5A
chains in the Genus database with same CATH superfamily
3SQXA 3L1UA 3CRZA 1E24A 5TARA 1XGKA 1LCIA 1N25A 1QRRA 3JQGB 3GUUA 3GL9A 3PTZA 4MQLA 2O6LA 1RJ9A 4LMAA 4J7AA 3RTGA 4IIBA 1JTVA 2QROA 5CH3A 3VV2A 1M6YA 1Q22A 1TZCA 1POWA 4BQQA 3X0DA 4KSCA 3AVXA 5EEGA 2WFAA 8AT1A 1VXOA 4PLTA 2IS2A 4BJ5A 4IF6A 3OEWA 1N0HA 1ND6A 5KNBA 1L4BA 3UUFA 5BNWA 4P4TA 4QXOA 4YUAA 2G9NA 3MERA 1YASA 2WVGA 5JQGA 5LD2C 2C3PA 2Q28A 2Q1YA 1IHOA 3NS7A 2EATA 3JQ6A 1SERA 1D3AA 3GP5A 4FHCA 4HZUA 3W8DA 1ZICA 4ZEOA 2AFVA 2DTOA 5KHLB 2ZUSA 3PXEA 3ZQ6A 2HMSA 2RIPA 3O1JC 4NMWA 2D1QA 1IUNA 1C7JA 2C61A 1OFTA 2G9UA 1A8IA 4QM6A 4P73C 1LH0A 2Y1XA 2WPDD 3THYB 3JU3A 1JR2A 1POXA 1W93A 2HU8A 2XA2A 3B82A 1R9MA 3JYNA 3EXAA 3I1JA 3F6EX 3JXEA 5KMGA 1C0EA 3UOGA 1H0SA 1ST2A 4HLCA 3ADDA 2I2CA 2PD3A 1DBRA 2A9OA 2BGWA 3L8ZA 4CKXA 4QUKA 5HIJA 2NG1A 3BM5A 2QX4A 3WNBA 3O26A 3CPHA 3Q6NA 3LYHA 2BWJA 4X1OA 4XDGA 2LUOA 4YRNA 1NR1A 4BMXA 4B48A 3QMVA 4PXSA 1VL8A 3DOHA 2GM3A 3TJRA 1S1CA 3IKJA 3PWZA 3NTQA 4HRAA 4P7JA 3II6X 4QAJA 3AKZA 2ECKA 3RD5A 1MQAA 2GRUA 1OTYA 1WR8A 2AC7A 1GLNA 1EB9A 1NNLA 3OTQA 3N2GB 1OLXA 1K7XB 1WVGA 4F3NA 5ALMA 5CH8A 1FS4A 4PRKA 5DGDA 1U8YA 5AXDA 1GA1A 1V7QA 1U5CA 2JGEA 4JQOA 4YR7A 4LEIA 3TCKA 1VG1A 2I7XA 3PXUA 4OIMA 1SOUA 1ZC4A 3DB2A 1P6XA 2BMFA 1D7AA 1LF0A 4P38A 1E58A 2YV5A 1GTJ1 1OGYA 1N1DA 1ODLA 1SVSA 5E1MA 3OUUA 4R84A 2J9XB 4TLDA 3QVKA 1MF7A 1THZA 1PYDA 3P9CA 3PDWA 5GOZA 3PFCA 3LKDA 4BIMA 2PDAA 3U4QB 3O0TA 2OORA 4ZT7A 1HC7A 2YMPA 1Y9JA 1TPYA 2YZNA 3PCTA 4AWAA 4EQZA 3TOZA 4EX6A 3CT4A 1Z0KA 2EP5A 4GSYA 1UCFA 2AI1A 4AMUA 3LBYA 1UP7A 3L84A 3UJBA 4DMGA 2YWGA 1SUCA 1VE5A 1Z25A 4MWBA 1G6Q1 4PQRA 1CUFA 5K0LA 4D3SA 4F2HA 4K86A 4JP3A 5JNUA 4PLPA 3ETNA 4K9OA 1OBOA 1XN4A 1H5NA 1KMHB 4JI8B 3GCWA 5EKUA 4UTNA 2ZI7A 1OWLA 1PBNA 2II6A 3DT6A 2QM3A 2Q4RA 1GVHA 1ZNWA 3OZIA 4YBRA 3RS9A 4MKXA 5DASA 3UG6A 2AHOA 2WTUA 4LK3A 2YTZA 3KK0A 3PE4A 3ZHBA 1AQLA 3L7KA 2J33A 4HLNA 2JGMA 4P92A 2J5XA 5JG7A 2P5IA 1AA6A 1HO3A 3EDQA 3BUSA 3EVGA 2EZ4A 2L18A 2H4XA 1Z0UA 1VDZA 3QX9A 1NQ5A 2EAYA 5I7UA 5KJFA 1SXQA 3W90A 1M6NA 1VHTA 5FKJA 4Z8XA 3Q88A 1T8WA 1V11A 2WA1A 1L4LA 2BC9A 3OIVA 1URPA 2C2YA 4LW8A 1BDJA 3DQQA 2FZKA 4PV7A 4YJFA 5CA1F 2J0SA 1FFCA 5FB3A 1XZKA 1IZZA 3QVGA 4LCBA 1SXGA 1TI7A 4W5HA 1P7WA 5JU6A 1VA5A 2YL2A 4NCAA 1U0BB 3SR4A 1X2HA 2VPQA 3LVBA 2WHPA 1JA0A 3ENQA 3WZLA 2IY5B 2GBLA 1Y1TA 3I4FA 1B3RA 1Z75A 3GPDG 3TE7A 1K3TA 1X80A 3L9XA 2XDAA 5LKRA 1GRNA 1OLOA 1TQ4A 3C3BA 3OQIB 3PJFA 3F6RA 4X1KB 3N2IA 2R6FA 2ID9A 4ZT3A 4HUJA 5DK6A 4CL0A 1LRKA 3IOCA 1M76A 2IU3A 2ZBRA 3KKLA 5DHSA 2YWEA 2IPMA 3HUTA 3VPFA 5G3YA 1FPMA 4BLWA 1VBMA 4MO2A 1R9NA 1M72A 5FI5A 3A7UA 1ID1A 2AN4A 2P6MA 3GVHA 3EFSA 1SB9A 4NKRA 3TTWA 4IP0A 3WLAA 1VPWA 1A71A 4Q82A 1J2EA 4P71C 4JLDA 2EF0A 2C8LA 1BXZA 3W9SA 3OECA 2D2IA 2DVEA 1G5HA 5G2OA 4F3YA 3E9CA 1MJGM 2OO5C 3AW8A 4O4JF 2MSEB 2EFCB 3SSNA 1LPAB 4ZI5A 3EGIA 4RWZA 3FG9A 1CXZA 1V9SA 3FKSA 3C8HA 3KL2A 1P1RA 4MUXA 2GZHA 1A04A 2G4CA 2P1ZA 1KZ9A 2ZTUA 1V8OA 2ECQA 2EZ8A 3ROKA 4ER0A 5EP2A 2PM8A 1QJCA 2XCTB 4QOJA 4KVZA 3KEQA 5JBNA 3VJRA 4MCJA 1BX1A 4XWKA 3GRUA 1XZEA 1Y3HA 2FXVA 3NONA 4GECA 1UM9B 3L7CA 1F2DA 3CZ5A 1KYTA 5EPEA 3NPMA 4P74C 4NFLA 3K9WA 2H9AA 1ZD2P 1P5JA 4BO2A 4IJ5A 1W4CA 3EQ6A 2CUTA 3OIYA 2NVUA 4L6CA 4GYWA 3CBGA 5B2ZA 4RL6A 3V1UA 5EWLB 3VDNB 3ZQJA 2H00A 1AM4D 3JR7A 2BHTA 2ZAOA 1YCFA 2QAGC 1QJ4A 5CX1B 3PNBA 2ESRA 2R5FA 1JH8A 1KZ7B 2EYQA 3KRTA 3PF9A 4IV5A 2EU8A 1A3CA 2A0YA 3AG6A 3BWEA 3UWMA 3ZCUA 2YNMC 1XDBA 1Q17A 2HDNB 1ABFA 1M1XB 3DBLB 3JATA 5EHXA 1B23P 4BN5A 5L8VA 3DFKA 1SC4A 2G4VA 2PMBA 2FYKA 2Z56A 3C41J 3JPWA 4K9SA 3KHKA 2EP8A 3G2IA 3IKVA 4E5MA 1E2FA 4I3GA 1HK7A 5HBGA 5IJ0A 2EJVA 1SOWA 3ESYA 5L7YA 2LWIA 4CLDA 4UU7A 4L5JA 3RWBA 2B2XA 4L7QA 2CLHB 3IIMA 4KN8A 4B4KA 5BSVA 1H9BA 1WB6A 2QTWB 3CVJA 1DV2A 3EVDA 1J1ZA 3JVVA 1YZQA 3AUSA 3D3QA 3BIJA 2I8AA 1L5KA 3W5CA 4HN9A 1T4DA 3K1AB 5TJ9A 3IAS1 2GYUA 2I3BA 3H4MA 3C3PA 2D1SA 1W9MA 1C9EA 1B6GA 5TQ2B 4BNIA 5K4HA 1JXAA 1CUXA 3ITNA 1HLFA 1JAXA 1OHHA 1ODFA 3ICCA 3WB2A 3P19A 3DMGA 4Q66C 4BIIA 3DLHA 2XWPA 1LSUA 4GKJB 1RAFA 1Z2EA 3B3FA 3DBRB 4XGKA 3OEHD 1F5SA 3PVSA 2W71A 4EW1A 4YLEA 1FSPA 1M5UA 4R9SA 4XFJA 3RC3A 2X14A 1UXKA 2AN5A 4DGSA 4KV7A 1MB2A 1E3SA 1XFAA 4YP6A 1ZK0A 1L7MA 3H9QA 4OSOA 4CM7A 4ETIA 4L9SA 4TSRA 1DBIA 2W6ID 2ZQ5A 1WQ1R 2OECA 1T43A 5TEVA 3KB1A 3IERA 4KXUA 3S2IA 2VDOB 1Y5MA 1KIAA 4POOA 4D8YA 2XCOA 4CWAA 1Q1ZA 2ZDHA 4O3FA 4Q24A 1NPDA 4LKRA 4RC9A 1DELA 3QVTA 2UDPA 1Q0SA 1VMIA 3K7EA 1U2GA 3QE4A 4C6TA 3Q10A 5MF6A 1YQGA 1U6IA 4AWXA 4YJ2A 4G0VA 3ZQ4A 4BX9A 2NUPB 3ES9A 1J09A 1ZN7A 2VHVA 4IDHA 2P9HA 4H2UA 2XMZA 3PQ7A 2ETXA 3VZPA 2JIRA 3GT3A 4LQDA 1EP9A 4IDNA 4TVKA 2VCHA 4P3OA 4RFLA 4R1PA 2V8BA 1LJUA 3DHWC 1II9A 1FBTA 1ADBA 1ST3A 2ZSEA 1E63A 2JVJA 3BMNB 5ELMA 1KQ3A 1Z6ZA 2I6TA 3QPCA 5D7BA 3GRCA 2D5CA 1UOQA 4BWGA 1T6YA 2ZATA 4ICIA 5FL7D 1RNLA 2VCEA 3TLGB 1ZU5A 2CXOA 4Q1BA 4BEWA 3S2ZA 2XTJA 3CZMA 2ZINA 1QKIA 2FLKA 1FFGA 1NQXA 3FI0A 3UK0A 4GR5A 4O2BB 1BD3A 1DKMA 1GZ6A 3EBOA 4XKJA 2YJZA 2CLCX 4P54A 2IEYA 3SS7X 2GR9A 4UBLA 1FW6A 4ZZIA 1FSZA 5HXAA 2NU7A 1Z8FA 2AV6A 4AYWA 1JQ3A 4NH4A 5EGNA 2BI8A 1NQTA 3OIWA 4L95C 2H11A 3KZCA 3Q3CA 3OJOA 4OK6A 5IZ4A 1T4MA 4EELA 2WMYA 2YS6A 3RAGA 4PZZA 2Q62A 3IO5A 5AW0A 2IEGA 3H2YA 4LWQA 3MJ4A 5B58T 3TB6A 1JYFA 1UH5A 1NTRA 3LP5A 5EKDA 4RJTA 1E9EA 1REQA 2VP9A 4BX3A 2DTDA 3K9CA 11ASA 2EERA 4YCAA 3ZHCA 2NTVA 4V2IA 4CKWB 2XA9A 4KQMA 1QQTA 3O8CA 3BULA 4ODIA 1OYVA 1OWPA 2G5PA 4IV0A 1TDJA 1JQ5A 3FOCA 3QUSA 3VU0A 4XUEA 2PU5A 5K8JB 2HQOA 4KAXA 1NT4A 1U2DC 1ZI9A 1CERA 3ROQA 2SKEA 1CY7A 3WLPA 1UP6A 5FOSA 1DFGA 2I3AA 2UXCB 4INAA 3S5JA 2AUTA 5E4JA 3ZCXA 2C2BA 2XCQA 2QD3A 4QODA 4UM5A 4RH1A 2VRWA 3RWMB 1XZHA 1MNAA 3ABOB 3E81A 3HUDA 3N58A 3OFND 2P2CA 4RNDB 3U60B 3Q6IA 4RPKA 6ADHA 4MW0A 4C1NA 4M38A 2NV0A 2BFCB 2JGRA 4QFCA 1Q11A 2CWDA 4DV4B 1GCAA 1U3VA 5HUQA 1DX6A 5A05A 1RWQA 3V1NA 3EF1A 3KT8A 2BM1A 3V8QA 4U0JA 3W7BA 1E1RA 3LQKA 3ZE1B 3KCQA 1WXGA 3QG1A 2G17A 1E8DA 4OSEA 4Q7LA 2E89A 1PZXA 3IEMA 4W9RA 1E2QA 2C07A 4GL4A 1TM1E 4Z9XA 5BR7A 2VXOA 3KB2A 3KTFA 2XNCA 4B3FX 2OG1A 3GBSA 4JBIA 3CKMA 2HLDA 1WSAA 1P4SA 3TEHB 4ZYXA 1TCAA 1PR3A 1ZLYA 2J0UA 2PJZA 2ONCA 2WM9B 3B3QA 4MV1A 4Y6SA 4CHTA 4DREA 3NX4A 1EVYA 1QIEA 2XECA 2OHIA 4Q7JB 4JQYA 5CNKA 4B5KA 1RMYA 1WHTA 4GVLA 1FYXA 4ONEA 4FFMA 3WBFA 4BNUA 2YVQA 4GSKA 3ZK7A 5CA0F 3UC5A 1IATA 3UT5A 1NVGA 1M8GA 1G8PA 3PFHA 3QYFA 4XDYA 2OCBA 4B6PA 4U7GA 2OAQ1 4D8UA 1E4EB 2ZRGA 4GNRA 3FNEA 1E3JA 1S01A 5D2CA 3OOWA 5BYKA 2QMYA 2H0RA 1JEDA 2WHYA 3UJCA 1ZR2A 1AT1A 3ETCA 3JRXA 4LBVA 1Q6YA 4ZYVA 3FBWA 4WBXC 1MO2A 1IXZA 4Y18A 3ABSB 3WLRA 1EWQA 2VH5R 2BLNA 3V7CA 3SLKA 4KE7A 1FXWA 4G01B 4LF9B 2W6JA 2XSZA 5DTEA 3U7QB 4S1TA 1NUUA 4M87A 3A70A 4MRMA 1QUFA 4MP8A 2R8EA 2VK8A 4FDVA 2QDXA 4M49A 5ALWA 3HM9A 3GPCA 1CVLA 5KTTA 2W0SA 1KAQA 3BWCA 3NDJA 3TIVA 3GVXA 2GD0A 3O4GA 5H59A 3VDQA 2I7VA 4CQMA 5B57C 2C84A 5MFZA 2DSNA 4FSDA 1Q74A 4LTDA 2SCUA 2Y3IA 1DFHA 1FYDA 3OCZA 2AOXA 4HB3A 2FJUA 3SY8A 1JH9A 1EJ2A 3T3IA 2WKSA 3OHSX 5FBRB 1EDBA 4JYZA 1G42A 3MD0A 5AUQA 4UXJA 2E1RA 4CCWA 1B42A 2CBZA 3R0JA 2QM0A 4JA2A 4PLZA 1G3UA 2C5SA 2CD7A 5A3SA 1U94A 3EZYA 2C98A 4R7GA 1R6XA 4GOOD 2PU7A 4OU4A 2VZ9A 3HYLA 2RBKA 3IDQA 1ZQ1A 5FYQA 5KQMA 1L7EA 1W76A 5EJFA 3Q9NA 3S29A 3BKXA 3PHLA 3G68A 7MDHA 4GP6A 1J06A 1XDSA 3IDOA 2SECE 4O4LA 3KJXA 1XMOB 2ZPAA 4HADA 2VJMB 2XB9A 5E1BA 3USCS 4NG5A 2G1AA 1R0ZA 3D7KA 1E3WB 2ADMA 2Y27A 3O8LA 3GLQA 1Q0HA 3TLXA 4M1KA 3JYHA 4QU9A 3I09A 5KJEA 3L0IB 2M6SA 1QLJA 1B74A 2AZ4A 2H08A 2YDYA 3GAMA 4H2TA 5BSUA 4PLYA 3UHJA 5CXUA 3IYLW 4YHHB 3SEQA 1IZ0A 4DV6B 4HS4A 1N8NA 1N3YA 3QU5A 3TI9A 4B85A 2P6OA 1E1DA 2QGNA 4R1MA 1Q21A 2EXXA 2GJSA 4YGYA 4YVFA 2HSJA 4RK5A 3RVJA 1X01A 5DI9A 2H4JA 3L43A 3O95A 3ZWYA 4D1YA 1IVSA 4DIBA 5AW8A 1YDGA 1IDOA 2IOQA 2XOKD 1R15A 3AR3A 3L07A 5JS7A 4RPHA 3JWGA 4QNRA 4IRMA 3PGXA 3OO1A 4GUAA 1C1HA 2A1TS 3CY6A 3LL4A 3PQ6A 3SC2B 1NFQA 4PHHA 2W93A 3MQZA 2P27A 2LBPA 2V7WA 3JZMA 3BMCA 2EF1A 3V1MA 3W5SA 2PR7A 3JVIA 1QHXA 1V5IA 1PV4A 3JRNA 1P1HA 1W4ZA 1ZUHA 3MSXA 3IBGA 4KIWA 3H7AA 2JLRA 4PYRA 1JR3E 4Q3EA 3K35A 1JDBB 2JIOA 4PGHA 1P0CA 1R6TA 2AYYA 2Q49A 3MCTA 4OUDA 4W7HA 2C97A 3F90A 3KLPX 5IJWA 1H5UA 1W2HA 3C5EA 5JS8A 4I4TB 4W6QA 1WCIB 4D56A 5AKIA 4C0LA 1D5WA 2FN3A 4ZAVA 3ABQB 2EV9A 2NU9A 3GVCA 1MJGA 5DGIA 5BR1A 2V03A 3GLHE 3QOWA 3P94A 4M21A 4Q47A 1F0KA 3AY6A 5I7RA 4G63A 2HHAA 2VYVA 2NXNA 2V6GA 3VM6A 4JSTA 4U2DA 3G13A 4K46A 4RIEA 3ZV3A 4UNIA 2E4YA 2DXIA 1XE3A 2FEXA 6ABPA 1THMA 2MSNA 1HFEL 3OZ7A 2GNAA 2BEVA 3ZDEA 1GQFA 4JJKA 3U13A 4U7TB 2F8SA 3DHVA 3UWDA 1LDYA 2BBOA 1G8KA 3VR6H 2E37A 4ZFNA 2AKAB 4RW0A 4UHJA 2GS9A 5DYIA 3GAFA 3PITA 2OZLA 3JQAB 5LLTA 4CV1A 5ELLA 3OF3A 1JJIA 4OO3A 2VO1A 2NZYA 1ZN8A 3N39C 5LQJA 1NN3A 3R40A 1JIJA 2JCGA 4RVCA 1NZDA 3V8VA 4NNJA 1U8ZA 3E15A 3W2IA 4DBZA 1Y1QA 3LCVB 1VPEA 2V0CA 2XYPA 4FYXA 4UM9D 5JVDA 3VKGA 2CCJA 4F92B 1E4YA 3PEFA 1Z7BA 1XRNA 2W43A 3GHHA 4QTYA 3CBQA 3HEBA 5BXQC 2AKWB 1MVLA 2WSYB 1EFAA 3ZS8A 1EJBA 2IELA 2O50A 4U8GA 1XEFA 4TMZA 1W5BA 2LV8A 3DCIA 1CG6A 3RRXA 1MIOA 2CD9A 3PBKA 1GHTA 4F5ZA 1COWA 3SOPA 4X54A 4EUEA 5HKAA 3F98A 4XH9B 5BVHB 2HRZA 2EL7A 3KUUA 3YASA 1VB3A 2Q21A 1CRQA 5FAKA 2D8AA 1ZJ5A 4P4GA 1M1YB 1DRKA 2JZCA 3FTPA 4HJRA 5HZGA 1J23A 2WFZA 4Y67A 5CVUA 5ALYA 4PEVA 5DSTA 1S2GA 4JKOA 3UB4A 3FAKA 3R3SA 4JASB 4FC7A 4MOWA 4G86A 3R7AA 1MTZA 4HWPA 4TTRA 1J42A 3WGGA 3K16A 4Q02A 2F3SA 3REQB 1IHXA 1KI6A 2JHGA 4J15A 2QZ4A 4PAMA 4DIMA 2CDNA 2GXSA 3ITEA 1L5GB 1F38A 3JZDA 1QK4A 3T7AA 1CQJA 3RBAA 4F46A 4MS3B 4KVGA 5ALIA 3VU9A 2GXQA 3VQVA 1MX5A 1EUCB 3DMPA 4N8EA 1RM4A 3B85A 5JXJA 3K0EA 4M1MA 3WLEA 2CCKA 2NO5A 2W8BB 1YUMA 1UMCB 2ACKA 4IY1A 4RA6B 2R0QC 2YJ5A 2L0XA 4IV8A 3HWWA 4XTWA 1NNI1 2JD2A 3TNYA 1CUBA 1ADCA 3OSZA 3RT9A 1GN8A 2MINA 5AHRA 1BMTA 5HJEA 4JD5A 4IGAA 3U3ZA 2E1PA 2W11A 1PQYA 2W2LA 4FLMA 4X71A 5GOTA 1X7ZA 2NO9A 2ZKIA 1AMNA 1DLJA 1PI3A 2GN1A 3CUEF 5I47A 3EZ2A 1QXSA 2R87A 1WMEA 1EBBA 1T3LA 4X7RA 1I5RA 1FTNA 1AU9A 3UJHA 2F48A 4I55B 1XA0A 1X8XA 4KNWA 1YDEA 3BRWD 1FNNA 3DE6X 1UQTA 1V45E 2VDQB 2WD8A 4M6WA 3TZ6A 3W8FA 4BNHA 4XDHA 3RJ5A 4RZXA 1CHDA 3WYNA 4BKOA 4PAGA 2ZTLA 1I9CA 1TF7A 4PM4A 2DJIA 4BWYA 1Y82A 5IWCA 3DV2A 2B8TA 2YY6A 3LI2A 4ESOA 4NCIA 4RWEA 3SEFA 2HNIA 3CCCA 4WNAA 1EK0A 2PXCA 2QL6A 2QUIA 3QLEA 4CL3A 4BE7B 1EU1A 3KHUA 5E1DA 3TUJC 5FD8A 2ZULA 4MVJP 1TGYA 2HRQA 3AMVA 4HBZA 4WW0A 1RYMA 4JJ8A 1N5JA 4TMXA 2RGRA 3HK2A 1SB8A 1KP3A 3KQQA 4H2DA 4IIJF 1J5WA 2OM6A 4HDNA 2VRNA 2Q8NA 5EWMA 5AJTA 2R62A 4A8JB 1H2HA 3TOXA 2PQMA 2W6QA 5HKKD 1JTFA 1GRRA 4GWGA 3SHFA 821PA 3PIRA 3CONA 3O2JA 1NVDA 1W5EA 5DM2A 5E8JA 2IH5A 4LE2A 2C8JA 3LECA 1KK2A 1FNMA 4H1UA 5KYWB 2VWHA 1QG2A 1KQNA 2PO7A 4WJ4A 1Z22A 2DWQA 3BK2A 3K96A 4HTAA 4H1HA 2K2QB 5DM4A 1GZHB 5TPWA 4NCKA 4ZVOA 2JJ2D 3NP7A 2G04A 3S6JA 1T24A 4URHA 1WB5A 1PK8A 1XD2B 4UHBA 4E30A 4NEGA 3WVNA 4P3XA 1BRTA 4WLFA 1E1LA 1GZ7A 4C0AC 4PS0A 2NYRA 5JC8A 3MRTA 5C3UA 1BCRB 4LRUA 3F3KA 2JBAA 1TTPB 5THQA 2FW0A 4XOUA 2R60A 1MEEA 3JQ9C 4ZT4A 4IJUA 4JL6A 3U7JA 3EX7C 2BFDA 4WE3A 3GRAA 2VYCA 1FJ2A 3CR3C 1RYHA 1XZ8A 4FYJA 3EGDA 1IJEA 2PKXA 4MTCA 4RF5A 2ZOSA 4POAA 1KJ9A 1RWPA 4KDRA 1R0YA 2O8CA 4K9QA 2PMCA 1KZ1A 4BDTA 3C3MA 2CHEA 1USGA 1CK4A 5EHIA 2ZXEA 3L6CA 2YJTD 4L4SA 1TMKA 1I3CA 4UNQA 3QV2A 2BSAA 2D0IA 3L4EA 3K70C 3H1EA 4LNUB 5LWQA 5DH9A 1O5OA 3E7PA 3UPTA 2PH7A 1V7PC 2FWPA 5KS2A 4AURA 4WESA 5JNTA 2HHJA 3H5VA 4HGQA 4EBBA 5KNCH 4MQEA 1Q3TA 1MLDA 2DWOA 2F9MA 1FP7A 1P75A 1UWCA 1G21A 3HHEA 3L7OA 4Y2VA 2M6LA 1GAQA 4V0ME 2GT1A 1J22A 4PX5A 4F4CA 1QZZA 3CJTA 3B5JA 4LJAA 4MHSA 3QRWA 4KZPA 2N1BA 3DCYA 2J5KA 3HLKA 2Q5IA 1XLTC 2ES4A 1CQWA 2C8MA 1M8JA 5AFSA 2P1RA 4GZ3A 4CH5A 1FUEA 1NW8A 1LDEA 5TT1A 1L9KA 4M0LA 3FR7A 2GCEA 1MAVA 2Y9MB 3HCOA 4LDNA 3S1SA 2RKWA 3H3FA 3HHPA 1QV6A 2B4RO 1TJYA 2COUA 2QLLA 3HP7A 4FCCA 4QELA 5I7AA 4F04A 4QTXA 4FGSA 4BFSA 3TBKA 2VRCD 2FLVA 1PLJA 2GPWA 1DO0A 1V1RB 2NWQA 4MV5A 4UDXX 3SM3A 5DGHA 3UB2A 2GUWA 3DEAA 2YV1A 3ETLA 3MK31 4PGMA 3U5ZB 1HE1C 3U3MA 3CLSC 3OFVA 5A4IS 2DU7A 1BXKA 4HUTA 3H1TA 3RANA 3HCDA 3TPFA 1NE7A 4KYIB 3NC1C 3C3KA 3NRCA 4MCAA 1C9DB 1CHNA 3KQKA 3EY4A 5F21A 4HDRB 4K6MA 1U7UA 2X0KA 4NLLA 4QVIA 2WWXA 4BU1A 2ZG6A 4Q6GA 1QAMA 3KPWA 4QD3A 3V1YA 2ZRHA 3EMVA 4KR9A 4ATNA 1YKGA 1XIVA 3AUFA 1KZ4A 4GX0A 4QUAA 4D97A 1FX0B 3UMYA 3DKKA 3UK2A 1PJZA 2OYCA 5HNKA 3K71B 4UD6A 3WADA 4CM4B 4ZT5A 3BHMA 3KQPA 1UPAA 2OE2A 3ENKA 3NHKA 1U2TA 3OKPA 3RJ9A 4U7JA 1ESZA 1K66A 5SY9A 1AGPA 4ALIA 2F1KA 1OPXA 4X64B 3DQZA 1X94A 4YCNA 1JHUA 4GMGA 4LJ8A 2X4IA 2GDJA 4N54A 4XEHA 3TAXA 5GJBA 1CUGA 2BEWB 2XQVA 4V1CB 2O2EA 3USES 3RV4A 2R7NA 4MDEA 5DK4A 2XQGA 3HYCA 3M6XA 1G55A 2Q4TA 3F97A 1A97A 1DAFA 3H6GA 3KLOA 4QYXA 1JKIA 4WOKA 1WF3A 3JTEA 2NO7A 3JTMA 2N0SA 4Y1FA 3F6CA 3M83A 4O4HF 4RVDA 3VFDA 1XRMA 2OCLA 4RCVA 5DHPA 4ZVTA 1C1DA 3WHPA 3ZYZA 5JXHA 1XD8A 5IAKA 2A9QA 1PZFA 1GL6A 1LBIA 5BWBA 1IB0A 4JI7B 5AESA 1I5OA 4D98A 2WU3A 2AYXA 3UHFA 3TEJA 5B1EA 4U02A 4IJWA 1XTVA 5KYUA 1S2MA 4MWTA 2O14A 2VJKA 3T7IA 4D41A 3DGFC 3JD2A 2CV2A 3M9XA 4FT2A 4EHAA 2H9IA 2VJNA 4WVFA 4AX4A 3LW8A 1C7EA 1J5PA 1MR3F 1IU9A 2BGLA 4MS1A 4PNEA 5IAGA 3M3DA 2Q7DA 3CF4A 1BE8A 4TLAA 4NJMA 1UMBA 1O5IA 4JLJA 2IZ6A 1U1EA 2WHEA 3KOZA 4YH1A 2X9NA 5AVQA 3E27A 1NG1A 1HSZA 3BMQB 3DCJA 4J76A 1W36B 3ID6C 4B4UA 1KXZA 3H9UA 3S7TA 1LLFA 3LGXA 3NIBA 2LGJA 4OQDA 1QHYA 2Z08A 3U7EB 4OTZA 1ZJYA 4D8TA 1Q1GA 3BGSA 1IQRA 1BS9A 2QORA 4MPRA 1R64A 2NUTA 1MJNA 1STOA 3A1SA 4KTTE 1AZLA 2CFRA 4NHOA 3ZH2A 4CCYB 2GGSA 5JCPA 3RYCA 3SFVA 1UWVA 4BUCA 3UCXA 2KS6A 2IHNA 3ROTA 2F3TA 3PC2A 4HAIA 5HF6A 1G6OA 1WKCA 1QBKC 2XR1A 4X84A 4R51A 3TRKA 3OC0A 4O4IF 4QYIA 3Q87B 4CDMA 4IJ6A 1ZMXA 3KYDA 1JR3D 2Q0HA 1N57A 3EWNA 5GONA 3W5VA 1L7OA 4B1FA 4Z4EA 1DVRA 3VH2A 3KXIA 2B83A 2EX4A 4OK3A 2NYVA 4QGGA 1JZSA 1XTPA 1DC4A 3K2QA 4BVJA 3A6ZA 4DDMA 3REFA 2YHIB 1B14A 3KV3O 1CP3A 3WA7A 3VPDA 5B1HA 4TQ9A 6NULA 3PSHA 5ALTA 2PA3A 2KPOA 2HGSA 2OLEA 3DEHA 1SEPA 4NFYA 1TF2A 3H0KA 3DJYA 3KLBA 3PA6A 2AFIE 3TFWA 4R1UA 3H7IA 3WA6A 1DJQA 4DTCA 3DG9A 3UUEA 2WQ6A 1R3DA 4U5QA 2VS1A 1ZNXA 3AJ8A 3PWSA 2Y0DA 5I9BA 5BUCA 3F71A 4N9QA 1Y34E 4M53A 4NF2A 1RQNA 1P1CA 1O89A 2JANA 3FVWA 3QXHA 4LJRA 4LYDA 5EI5A 3P9QA 2HNKA 2CLLB 5EWJA 4JT4A 4JHLA 4RV9A 5CTAA 1XEWY 4XIYA 1MW9X 2PY6A 2AVNA 2R1TA 4CR6A 4D3YA 5EVCA 2B25A 2C4HA 1T91A 3OM8A 5FORA 3DOEA 2XLCA 5CK5A 1U3WA 3IR5A 3CX3A 2QTRA 5SY4A 1WZEA 5EJ5A 3WQSB 1E3TA 1ZK4A 2WF6A 5K5EA 4N5HX 1PR5A 2XHEA 5HJ5A 3FUXA 1IRXA 3PX3A 4JLSA 3IHLA 3BXEA 4EUHA 2I8LA 3PUHA 1RRKA 2QBYB 4Y9TA 2ZB2A 3IGFA 5T3UA 4HUQA 1GQOA 1ZOPA 1RWBA 4JR1A 4R4JA 3RGGA 4WBNF 2R6CA 1G66A 3I6ZA 4YP1A 3H8VA 4P72A 3WWEA 5ITVA 4DR3B 4G84A 1VDMA 3GCDA 3TM4A 3UXHA 4ARBA 3ZI4A 4NBSA 4QLOA 4D3XA 1EVZA 4NSNA 3D7NA 4Y2PA 3DAFA 3SZOA 5IVKA 1Q7TA 1QG4A 4FCTA 4QECA 1CE8B 4EHNA 1A5TA 4HDOB 2EWMA 1LBSA 1K6XA 1UBCA 4J1TA 4J7XA 1SA0A 1GTVA 1VE1A 2ZANA 3HU2A 3QF4A 2GAJA 2VBCA 3DBIA 1KSFX 3A28A 1BGWA 1JBKA 1FDUA 1JI0A 2PXHA 3C6MA 1R12A 3GGCA 1ZMOA 2PK3A 4LZJA 2HRDA 1FDOA 5DCWA 2UZ4A 4MLCA 3BJRA 5IJ9B 2QRKA 3FWYA 5DJ5A 3PPWA 1OX6A 2OXTA 1QR2A 3LDUA 1QSGA 3IPXA 3ER9A 2NSLA 4RELA 2OMEA 3IV9A 3TTSA 3KDPA 4PHGA 4RM3A 2HBZA 3OU6A 2W70A 3K0FB 1ESCA 1JHQA 5GAJA 2GN9A 1DG9A 5LJLA 1U28A 1I7PA 2FG5A 2PG3A 3WL7A 1T4BA 5ALKA 2AMFA 1NULA 3EAGA 3GJQA 3QFTA 4ZEWA 4D9GA 4M9ZA 3NBUA 3ZE0B 3D6JA 2ATEA 5AM4A 4ZMBA 2CJ9A 1WNLA 2CL6X 4PFKA 5IKMA 2Y1WA 3H13A 5A06A 2DR2A 2HT1A 1SUFA 3ZDAA 3DYVA 4ND7A 5KWVA 1IBRA 5HP4A 1XI2A 4QRDA 3ROMA 2IW1A 1TVCA 3MEYA 4NBRA 1K89A 3DR3A 4YMTA 5JE8A 3EFRA 4RDIA 1T5HX 4V39A 4YYZA 3EH1A 5JI3E 3SE0A 4U39A 5ESRA 5KTSA 3SX0A 3ZD9A 5SZJA 3AY0A 4DM4A 2Z6AA 2C31A 5K6TA 1BIBA 1AKEA 3AUJB 1YFZA 5B4TA 4TMWA 3UA4A 3TLEA 1U0RA 2PAFA 5H3HA 2DC1A 2RKOA 2WICA 1AF4A 4MXDA 1HEYA 3KJHA 2OHHA 1ULTA 3WYEA 3CF6R 4DNXA 3T12A 4D6XA 4UJ3A 1BFKA 2CNDA 1YS2X 3O94A 4TTSA 4P33A 4OLHA 1RJEA 1QC5B 2ZZFA 4RSMA 4RXMA 1VC2A 3A14A 3NGXA 2V6IA 4D9IA 3OE7A 4G2NA 3A04A 4M9CA 5T57A 1H4SA 1U8AA 1SOAA 4EG0A 4E51A 4S1PA 5D01A 1IG3A 3OOJA 5ERGB 4GOJA 2B4KA 2VYNA 5JMOA 4D4IA 2NXJA 2YQ4A 3DXYA 1N6LA 4OBWA 4U3JA 3P32A 2IYXA 4YASA 1KH2A 4EEKA 2D7JA 2YQ5A 3ASVA 1LC3A 4DG8A 5MN4A 3PWTA 4NZZA 3WGYA 4KIGA 3OJXA 3THXA 1ICIA 2E5WA 4PLFA 3H8JA 1SCAA 2JLXA 3QVVA 1PR2A 5CCBA 5HQ3A 2XGJA 1Q7CA 3AFMA 1I01A 3I72A 4BU0A 1TKAA 4PSAA 1PEDA 5D84A 1ZEJA 4AS1A 4V0KA 3EGEA 4TQUS 2NTEA 1QIMA 4XD7A 5DV9A 5E3HA 13PKA 1TYCA 1C7ZA 2H2IA 3OZFA 3U4GA 1MENA 5J5VA 3U3DA 3B2EA 2PRSA 4WADA 3QWBA 2GN6A 4BFLA 2WRZA 1JHPA 3PHCA 4H15A 3SQMA 3EXG1 2GJAA 5JZOA 2E0IA 4CU2A 2G83A 2OB1A 4WOCA 4HY3A 5FADA 2EKPA 4KMOA 5FFFA 1XVAA 2E6KA 4K2HA 4YA6A 1J8VA 2NP7A 5T7BA 1Y1LA 2JFOA 5BW6B 1N2CA 2QJOA 5DCUA 4FQ5A 5GIOE 4EHFA 3STXA 1FL9A 2HBQA 4QKQA 5KPJA 2QSUA 4QWWA 1M1ZA 1KY2A 5FR1A 1MZVA 1W85A 4YJ3F 5JS6A 4RYDA 4BFTA 1ZSYA 3DCNA 4KMSA 3LYLA 4UOZA 3I6MA 1UJ4A 5JSUA 1WMBA 2IUFA 3DDCA 4ECAA 2ZT8A 3GLSA 3NT2A 5C7LO 2A3RA 2YWXA 4MV4A 4WUVA 2DZCA 1Z16A 2D1FA 1N92A 3HRIA 2DM6A 3DZJA 4NV0A 3WGVA 5BYAA 3HBJA 3P2YA 1NVEA 2XNKA 2Z8ZA 4CLHA 3KWJA 5EMMA 1U9CA 4RU1A 4XDZA 1AHHA 4BGDA 2QVBA 1PJAA 1O6ZA 4RLQA 1T5IA 4X8LA 1NMYA 2BFPA 2ZR8A 3L05A 3B1YA 1OLSA 3AKYA 1Z36A 1RI2A 1QFJA 2QSYA 3T9AA 1C9MA 4BZPA 1S3FA 2A88A 4KQGA 4REQA 4E6PA 3ZLUA 4AZ3A 4EHBA 1LPSA 4LGYA 5CB4F 2Q4OA 2VSNA 1Z73A 4WNCA 4UAGA 5C0OE 3UK1A 3LCJA 1VKJA 3O73A 4HH3C 1DZ3A 4YCLA 2NVWA 4MUJA 1EIWA 3GWGA 5HDQA 2ZI4A 3GG9A 5TMDA 2AVDA 3OIGA 4B6JA 4EO4A 1V4NA 3IRVA 4MYTA 3RFUA 1GFSA 3MWJA 5C80A 3G9QA 2PFGA 3JQEA 1Y8ZA 2A9JA 3PD0A 5L3SB 3CIFA 4I5DA 3ESCA 3IE0A 4FLFA 2IBTA 2QZJA 2XUQA 1Y4UA 5ALXA 4EPYA 1EWKA 2IHTA 4FFNA 1WO8A 1C4KA 1PJSA 4NXMB 4FFPA 3L6UA 2QN6A 4I3HA 2XGMA 1FVHA 4P81A 4YIKA 1HDRA 4XE5A 3V8JA 5HKLA 1JVNA 2W2TA 2WJWA 3FLAA 4GEKA 1SZCA 3PA8A 1HTBA 4DCPA 2O7RA 3WWCA 4CGZA 3UAYA 3IUEA 1JQDA 4XSHA 1T1GA 2GETA 2J3MA 1QHHB 4COOA 1SU6A 4G9EA 2RHQB 4Q1VA 3GFQA 3BFMA 3N0RA 4M8IA 2GESA 1E1NA 4EA9A 3R8CA 1NUHA 1RVDA 4CI0B 3CLRD 1FTQA 5IABA 2D6FA 1QYRA 4RMGA 4K9PA 3HPRA 4PG5A 3NP9A 3OFJA 4QYMA 4KQKA 3V3TA 3PFWO 2Y4OA 4A1FA 1N9ZA 2IIVA 4TV8F 5A7FA 1N7IA 1EBFA 2BN4A 4ALJA 2LIVA 1DKRA 4EARA 1K6EA 1GRCA 3MB5A 1OLUB 1QV9A 2FA9A 3JAKA 4RPLA 3ZGZA 1IY8A 1KO1A 1TT7A 1KY4A 4NBWA 3IOMA 4AG3A 2DMRA 3G23A 3C6KA 5AI9A 2Y99A 4ZXPA 5EZYB 3LBFA 3KU1A 1OR8A 5GINE 1V5EA 4DV2B 3BILA 1EMDA 1YU9A 5IW8A 2GDZA 5JDCC 2VTBB 3GF4A 4F85A 4WOJA 4BB9A 2P3LA 1RJWA 2AHRA 1L5QA 4XU1A 1F8GA 1VYUA 2HF2A 3H9BA 2FMUA 3O21A 3MJDA 1ZVJA 1UJ5A 1E77A 4XAQA 3GZJA 2DKNA 2WSLA 1EB8A 3HU1A 3QUQA 4J0DA 2RHDA 4P7GA 4Q6BA 4WLOA 4DA4A 4JFRA 1XRRA 5FBHA 3FWNA 4B7ZA 1BDMA 2HLNA 2XD4A 4K1XA 1TAQA 5SYNA 3TEFA 3K5WA 5IG2A 1U0OC 1E2LA 3ZWQA 2X6TA 5H82A 1CZOA 1H2RS 3AVVA 3SBXA 3HUEA 1T8PA 3UNXA 3T7KA 2OR3A 5L3ZA 2X8JB 3E8XA 2NOAA 4UE2A 2FN4A 3K0AB 4H77A 3T5DA 3PRHA 3PXAA 1TCUA 5CITA 1NI4A 1QRDA 2W00A 4Y6PA 1GG5A 4FFOA 1W46A 4NFHA 4Y3UA 3KBBA 1H2XA 1NMQA 1BMFA 3ZWVA 2WM3A 1P61B 4ND8A 4YROA 3T1OA 5LP1A 3QV1A 1JQEA 1W4BA 3JVUA 1G8AA 3L93A 2ZRAA 3NDBB 3U4CA 1RLJA 3X2EA 3MSCA 2YNMD 1NJGA 1F1JA 2ZYIA 3AL2A 4RVFA 1EQRA 1V9CA 1G3QA 3G82C 3S28A 3ZDXB 4AD8A 1XCOA 1MQSA 4FZ3A 2C03A 5FTMA 2P9GA 2G71A 3CF2A 4C6RA 3IALA 3AERA 3U19A 4YRBA 2OP0A 1AKRA 1P9OA 2NZUG 3S68A 4YMHA 1ZW6A 4YC7A 4Q9AA 4X00A 2K7ZA 4B84A 3VYVA 1WBJB 1R00A 4FFVA 3HNRA 1N9KA 3WK9A 4F6CA 2B9VA 3ZV7A 1XMXA 5JY6A 2YWCA 3BCRA 5E6SB 1A1SA 1VZ3A 3PHIA 4KOEC 2UUOA 3VU1A 2VI5A 4WCFC 1ABBA 1N77A 1I2BA 1M7BA 3M0EA 2TMGA 4FOPA 3MUFA 5TC4A 2VHYA 3A9UA 4M60A 1YZUA 3LPLA 2ZRLA 3DP9A 1N5RA 2AT1A 2BDEA 4II7A 3GFOA 3W3SA 3DE4X 2C9BA 1D03A 4HDQB 3R74A 4ZJUA 3ZDCA 2ZZEA 1O96A 3BA6A 2WT4A 4Z3OA 2JNWA 3IT3A 4KC0A 5AOAA 2FR1A 2PX6A 4AN4A 1Q7RA 1V16B 1RYEA 2QJRA 4FVTA 1ZNQO 2XUKA 5IN5A 3VR4A 3SOZA 3VZRA 4DLAA 3BMOA 4CKBA 1RU3A 4OXXA 4B6FA 4YCJA 3DVSX 5SICE 2EFDB 3FUCA 5F9FA 5F7ZA 4O4JB 4TT3D 3UG7A 4QEZA 4EY5A 2GD6A 3PDUA 1X7YA 1XG5A 2HX1A 2ZJ2A 3HJUA 2WSSA 1LK0A 1T4GA 1UJBA 1XKXA 3FZGA 3G1UA 1VQ1A 3IXLA 3TSYA 3WL5A 2VUSA 2D5IA 3TF5A 5KQRA 4DPGA 1L5FA 1I7LA 3KAQA 2J3JA 3DLIA 4TV9A 3MCVA 1IEWA 1GCOA 2D8MA 1E7RA 3BYZA 2JFQA 3FF1A 3KQVA 4HEQA 2OA0A 3TTVA 1DEHA 1IH8A 3E5NA 5G02A 3HXWA 4JT8A 1AN9A 4WMLA 1DCMA 2YVLA 2P0YA 5EIWA 1G41A 1E3DA 2V7UA 4ES6A 3B1JA 5DOVA 5B5SA 2EIXA 4BO4A 4HWSA 1EE2A 1KZHA 4DNPA 3PT5A 4H4DA 4YLYA 1MB0A 3HXVA 1TKBA 3KAJA 4IEFB 3R7NA 4Z4CA 2BL4A 2VUHB 3QY9A 1C9YA 4LXYA 3VQTA 4L76A 3JARB 5ARDA 4DV5B 4AMBA 4C88A 4DV1B 3EVAA 3V8KA 2IY7A 4DMKA 1RI3A 3LNTA 1XZIA 1OH6A 3DOFA 3F5QA 2CJPA 2OUIA 1LQ2A 2DPHA 2P9BA 3F4BA 5IDYA 1JLLA 4TUYB 1MV8A 3DF7A 4GLJA 1BKSB 1I4TD 2GHTA 2Q9BA 3HKEB 3L82B 4XASA 5EHGA 5I9TA 2VUUA 3PENA 1IUPA 3JD4A 1EWVA 3PUVA 1ZMBA 4LQ4A 2V3VA 4PF1A 2OD7A 3AR4A 2X5NA 3EYWA 4I0WB 4RMIA 4DJAA 2AQIA 2JK1A 4GD3Q 4QPJC 3IOYA 4OXNA 4WJ3M 3FMVA 2IV7A 3PWKA 3F2IA 4GPAA 2P5SA 2ODAA 2RH5A 3KO8A 4GMKA 4HDKB 4IYRA 5IRCD 4KJZA 3GJTA 1R5BA 1Y8AA 4MB6A 2G28A 3ZXSA 1ESDA 5LR6A 4NCJA 1U7HA 2FRVA 5AKJA 4HC4A 4RD0A 4ZHQF 5B2EA 1TM2A 5B7QA 2Y68A 3D7RA 3OH8A 2ZQZA 3Q5GA 3PCOB 2VQDA 5BVGB 4H7KA 4JI3B 1OI7A 1JEYA 2AZDA 4IZ6A 3FWZA 1W0JA 4U6QA 3AETB 1K0FA 1HZZA 5EXTA 5ICEA 4G0NA 2VPPA 2ASEA 4OAPA 1E62A 4RSGA 2DRIA 4B8YA 1ETHA 4QE3A 3PXCX 1XTQA 5LKAA 3OTIA 2I2WA 1UK8A 3KJFA 1AZTA 4H6PA 3NEMA 1PR4A 4LXXA 3TG8A 3A5YA 3OKCA 1XPRA 2IBSA 3GLFE 1ODCA 5L3RA 3TKLA 4LF4B 3U1BA 2GRAA 4OGGA 3FJYA 3D3EA 1PGNA 2QRPA 4OREX 2YIJA 3TW8B 3HB1A 3E7DA 4B6QA 4Y2HA 4QJIA 3B8HA 4HRYA 4YUZA 1H6AA 3HYRA 3K6RA 3MWEA 5KOJB 1X8KA 1YRWA 4WLVA 1E4VA 5IYZF 4TKUB 1ZISA 2A5GA 5JJ5A 2CIMA 3DV9A 4GOMD 4XB2A 4D9BA 1GAWA 4X1YA 4PFJA 4KNYA 3VNUA 3DMRA 1NSTA 3CEHA 4NOJA 1BVHA 2EFHB 1OB5A 2WE8A 1E1OA 1UDRA 4P3NA 1XQ6A 2AW5A 3JASA 4WZAE 1DXOA 2XTMA 4GC9A 3JWEA 2DQ0A 1UBFA 3EK2A 3FE2A 3UV7A 1Z6AA 5L4LA 4NYJQ 3T4UA 4N5DA 1PFVA 3TEMA 1IM2A 3VDXA 5KSYA 3EEOA 2IX9A 4CG1A 1JVSA 3H18A 2MR6A 2R4TA 2QSZA 3RV3A 3OMLA 4DJDC 2PE5A 3H5NA 3HCEA 1R4NB 5I4KA 3U61B 4OOFA 5H7XA 3AEKA 3Q3EA 4KXYA 1QYCA 4Q37A 2DJ5A 4XSVA 2DZ9A 1W1UA 2I2BA 3L18A 1DX9A 2R7KA 3M70A 4DY6A 4MWGA 5C5IA 1XYGA 1WW3A 4I46A 3TX6A 3TGLA 5LL6P 5BN3B 4F21A 4ZCTA 3FHLA 2J4CA 5HGJA 2CXHA 4Y9DA 5EY5B 3UWKA 4HXEB 3D31A 3VPAA 1JV2B 4G09A 3AUYA 4P84A 1WMFA 4Q18A 1UFKA 5TT0A 4CKCA 2AJLI 2FZLA 2WTXA 4JB2A 3O8OB 5KNDD 4ZDWA 3WKAA 4YRCA 4RORA 4LVOA 1P4GA 2OG2A 2VPZA 1W0CA 3GJ8A 3IB6A 1KO7A 2G1KA 3O91A 1G6HA 1BSVA 3N6VA 4DJTA 3HY1A 1H2EA 1GEGA 1P6QA 1MOQA 3G0BA 5KNCA 4H4CA 4G67A 1E3LA 2I2AA 3DOCA 2C7GA 2V7VA 4Q4JB 5EERA 4EG8A 2AW3A 3OLWA 5CLHA 1WW2A 2DB3A 1GPJA 1RZVA 3VH1A 2IUUA 2HEGA 4CDGA 3MGKA 3NTVA 4GBED 2O1SA 3SIXA 3PXBA 3E6AA 4PWYA 5CT6A 3FZNA 4EPWA 4DADA 1N1MA 2EHJA 3JQGA 3V33A 1OH7A 1IHDA 2OV4A 3GD7A 1Y6RA 4KZKA 4B44A 5BRJA 2EBFX 3Q12A 3B2QA 3MHTA 3O3CA 4RJ2A 2X5OA 3UAOA 5KOYA 1HE8B 4W1RA 4L8GA 5FLXA 5GV8A 2GVNA 3W9YA 2HO4A 3WP0A 4FWTA 2ZCEA 4K9KA 3T3OA 2QX6A 2OBLA 3PNYA 1P1IA 4B80A 4ZCRA 3LQFA 3WRVA 2JLSA 1NRWA 3IP7A 2YJ4A 3VBEA 3L4BC 1AUXA 5JSYA 1OT5A 3UJ3X 5AK6A 2PX4A 4KRFA 2ZIMA 3SC3A 4CIAA 2CE2X 2O3JA 5LUBA 1TYDE 3TLZA 4C08A 1VL6A 1FS6A 5TX7A 1TUIA 1YI8A 3Q1LA 2ZNIA 1D1PA 3Q5DA 1L7PA 1U6KA 2QHXA 3CNOA 3GROA 4GPIB 4UQOA 4PZPA 3AB3A 1J5XA 1ZK2A 5WRFA 4BVKA 4BB5A 5LWHA 5JZBA 3CEMA 4L5CA 1W9HA 2PKCA 1Z4JA 2ZJOA 3E0QA 4RIIA 2DTXA 1NMXA 2XMBA 3QEJA 3AW9A 3L1KA 4JJ4A 1QYWA 2XTZA 2HGZA 2HEIA 5KKAA 1Z68A 2PRYA 1SXIA 4RD3A 1GGMA 2R68A 4FGUA 2PSDA 3I3OA 5CU7A 1SUIA 3BJEA 1GNPA 2N46A 2WKRA 3GMDA 1M0TA 3OZRA 3L49A 2WJ4A 1GFZA 5CVDA 4QLBA 4ABTA 2DFLA 3HB9A 3WIBA 4OBBA 1YNOA 3TXYA 1IDN1 3NDIA 3WNDA 1Y1RA 2MMCA 2Q1SA 3MRVA 4KFTA 4LXGA 2RHCA 3SKYA 3N2GA 3MWKA 1TEHA 2X23A 2BMEA 1B7YB 4MW2A 3KDAA 5FNVF 4KQEA 1PR6A 1WKVA 4V0QA 4YUVA 2WUWE 3QSYA 3ET5A 1YUBA 4KMMA 3ZS9A 1PL6A 5CBKA 1NMEA 4QYSA 1Z7MA 2C88A 4HAXA 1MRNA 1C41A 3VDMA 3BB1A 5KTRA 4Q21A 4QGBA 1LZLA 4XB6B 4M8NE 1DQNA 1N2EA 2B2CA 3B9RA 4MUFA 5EQTA 5JCJA 1T2VA 3FWKA 1RXWA 1NJFA 2WIKA 3PF8A 3A2LA 2IW3A 3O7MA 4ZGBA 5B1SA 1NJ1A 1DL5A 3MNFA 3NHYA 4OBXA 3U4QA 3HJTA 3CM0A 1U8EA 3PZBA 3DC7A 5D8DA 1IOLA 5CLIA 3TQTA 1Z2NX 3E4CA 1N2SA 1ULUA 4WY8A 4RGQA 4ARZB 1R7RA 4PYJA 1KZ6A 4X24A 4N3AA 5BUZA 1HDEA 3BSFA 5EJ2A 2B6HA 3WQHA 4TZ6A 3GVPA 4D26A 2QT1A 2IDZA 3ADOA 4N0DA 4OJYA 2JH3A 1OYWA 5DF1A 4HQKA 2XUHA 1ULSA 1G7CA 1V5GA 1YE3A 1KF0A 3HJBA 3L9WA 4NE9A 3PEYA 4G5RA 3CRMA 3PJEA 4JOBA 5K99A 1KMHA 4HI0E 3GU3A 1AK9A 1PN3A 3FUUA 1Y6JA 1WDMA 2NPFA 2BFEB 2HSGA 4B2LA 3DGEC 1XHLA 3QUTA 3DF9A 1FFBA 3CC8A 4Q01A 4Y2JA 1SBQA 4EFKA 3AY7A 4LZAA 3I76A 5AM0A 4RIFA 5HIKA 1EM8B 4UNNA 5KQGA 3EG9B 3SBEA 1YVRA 3I28A 2PEYA 3KZ1E 4PN7A 3GGJA 2FH5B 1MGPA 1Y63A 3CSUA 3AOEA 2WIFA 1TAUA 3A4NA 2IXTA 5KYVA 3DDWA 5NULA 4KPFC 1NJ2A 3N7AA 3BHNA 4R31A 1QGUA 4HMQA 4OQMA 4PPFA 3FPKA 1QVRA 3AEQA 4PNPA 4DOMA 5JEDA 1IY9A 4OEHA 4HB0A 3HR7A 1GIAA 1Q1QA 1OYOA 4M7PA 4OMFG 4Q9KA 5JISA 3PEWA 4RZSA 3QJ5A 3QO7A 1XVIA 4UASA 2IY5A 4XPZA 3U40A 5JSFA 1KOJA 3HS3A 3QLTA 4J07A 4XPIB 2H0AA 2JD1A 4EHHA 4HNAB 1SAYA 3OQIA 4UEKA 2GJKA 4X1KA 1TGVA 4HDSB 1HE4A 4QO7A 2HSZA 4QDZA 4X91A 4DGQA 1E2PA 5C8YB 1PS9A 5ECGC 2FMXA 2O3SA 4ALLA 1BE1A 1JEOA 3DFUA 3DO8A 3TD9A 1GL3A 1SY7A 5ILQA 1HURA 2J6CA 3CWQA 3NI2A 3OQJA 1LJLA 3VPBA 4IDDA 2ZIEA 5IFKA 4F0JA 3ZGOA 1ZI6A 4B73A 4HFNA 3K0SA 1GCIA 3LKBA 1PWHA 4JBHA 2FPXA 1RAGA 1E5XA 4BY9E 2PLFA 3LFUA 3EVTA 1W4LA 4O08A 3LNCA 3EPPA 4BO0A 3VNSA 1Z7GA 3DYIA 5AKHA 4FHZA 2PZEA 1TMOA 4QHSA 1VXRA 3I0MA 2KSQA 1EWYA 5LB2A 2VR1A 5DTQA 1JWAB 3I6BA 5IUNC 4LRWA 3V4VB 4A16A 4MITA 3RVRA 2COEA 4DIKA 2B0CA 2RHGB 2GCPA 3BJMA 3NHZA 5JDIA 3UVEA 1QQAA 1B00A 3GLIB 1P18A 4OIFA 2NTYC 4IJVA 1NVKA 2EJBA 1KJNA 4UEJA 2VYQA 3SMVA 1Y6FA 2LCFA 5DO9A 1Z7EA 4YAWA 2OCYC 4ZVNA 5TS3A 1MBZA 1UM9A 1XXHE 3RABA 3S55A 2MSKA 5FI0B 1JMVA 2LXNA 3A37A 2DQZA 4LJ9A 1R6DA 4MVJI 1CZHA 3VQXA 4XCXA 3ZVLA 2YWFA 2ZE5A 3A6DA 1KOFA 4D3FA 1RVV1 5LA6A 4BO9A 1PFUA 4IMRA 5CX1A 2VHQA 3U7GA 1SXJD 3R0VA 3W4KA 5I5EA 1XMJA 2UVQA 1D2MA 3P4XA 3IDAA 3HXYA 3HCWA 4NZYA 3DBLA 4E5SA 1P80A 5CLFA 3NRBA 2EFEB 2ZCUA 1BWSA 2AXEA 3QBEA 1KK0A 2L42A 1X7WB 3PFGA 1D1TA 5HK8A 3T7TA 4YIHA 4N12A 4PZCA 4AJKA 5FFMA 1M5RA 4IPTA 2Q07A 2YMMA 3SYTA 1CDDA 2B82A 4E12A 3G5MA 4KOAA 1TD1A 5GV7A 1M5TA 2BZ0A 2REQB 2Z5VA 1B8NA 3P0IA 3PR3A 3UAZA 1PD0A 5DBHX 4DQDA 5KWIA 5CHYA 1FNBA 3NR2A 5BQPA 3AR8A 2PUGA 1KC1A 4ZQGA 5LC1A 1VRVA 2OXRA 3I2GA 4FMCF 3B20A 2JLVA 1IYZA 4AKHA 2BUAA 3K9QO 2F43B 3M4PA 2WDZA 1ETUA 3HXUA 1UAGA 2EEZA 3K1AA 4RENA 5J2UB 1L8AA 1WEHA 3H4IA 4GKVA 3HCRA 3LU1A 5ICSA 4YDHB 1V96A 1GTMA 1EE1A 1E5LA 2E4ZA 4KO3S 4Q03A 1UJ6A 3DBRA 3KXKA 2XNDD 3D0QA 3U0BA 1YU6A 3DTVB 5IBRA 1UC9A 2B9EA 1FFXB 1ZS9A 3M1IA 4IW3B 1U2PA 4XM2A 2CGEA 4WA8A 5F5NA 4MQ5A 5EJMA 2ZUFA 3KTAB 4EVSA 4PR0A 3KQOA 4FGLA 5J4HA 2P7HA 1TFUA 2QV7A 2Q1UA 1BWQA 3D8TA 4KGDA 1BDIA 4FFWA 3CEJA 3S44A 4WCVA 4FWBA 1J8FA 2BR4A 3LZ6A 4G97A 4LY6A 1AO3A 3GFTA 4LVMA 1JILA 1M2VB 1MRZA 1RFLA 3HO8A 4FONA 4O5OA 1A9TA 3WHIA 1JLRA 5AVUA 3WL4A 2GJ8A 4LY0A 4TS9A 1DCFA 1WU8A 3FTCA 2NUPA 5JXIA 1J49A 5DIFA 2JFVA 2FZWA 2HV8A 2ZU0C 3LPMA 1TKCA 3TNLA 1TOAA 3V7SA 3H5TA 4QYTA 4F4IA 1U63A 3P2IA 3ZU4A 5K6AC 5KWJA 3BMNA 3AV3A 3D1JA 3IAFA 1AA9A 4B31A 4WXMA 2ZB8A 1Z7NA 4JR0A 3SHVA 4X6LA 3KC2A 2QTAA 4FOLA 2AC4A 4MV7A 4R5HA 3I12A 1F60A 4WKNA 3FYTA 3EXFA 1TQHA 4BNNA 5AW4A 2QTGA 1IZ8A 1YNSA 2NV2B 4R9UC 3PPYA 4IG4A 4G65A 4C03A 5K8UA 2ZUDA 1SIBE 4OLJA 4I66A 3I6YA 1LUAA 1N2JA 4PG3A 3ZYCA 4O2BA 3TFOA 3VX4A 1B41A 2XDYA 5KDOA 3IRUA 4WDQA 3RRFA 5CM8B 1PTJA 3D81A 5F23A 2W9XA 3JR3A 3TS1A 4BLPA 1CDZA 1ZUIA 1W2WB 4D43A 5KWSA 1H94A 3QXJA 4NQRA 5AUPB 4U4AA 2E64A 2AZMA 2Q45A 3D0KA 1UK7A 3RYIB 3IODA 4GL2A 1E59A 1NWCA 3IV7A 1KDTA 2QZPA 3NUGA 3W1VA 4CCSA 1QPZA 3IESA 3Q7RA 3U3OA 3RAEC 4DJ5X 2EJCA 4JLNA 5B4VA 3NEAA 1RW4A 1YRYE 3BFXA 1L5OA 2FK7A 3UH1A 5HILA 1C7QA 5CW2A 1QYXA 2XEXA 1O95C 4UHFA 1WAMA 3OEYA 3Q3VA 4G5OA 2WEKA 4LGMA 3H04A 5EP4A 1R8JA 2WJGA 2Q2WA 4FD2A 4HGNA 5EZ5A 3TNDA 4DPLA 5BYBA 5K3FB 4DABA 2F1RA 1FSFA 1II0A 1SULA 1A82A 4WINA 2CMHA 3GJ5A 2NVBA 1E69A 5LQKA 2W37A 4XVHA 4E94A 2LDBA 4L9RA 1HG1A 2EP7A 2G1JA 3E2PA 4EKNB 2Y2VA 4ZI7F 3EVZA 4NDZA 1YQXA 1RJDA 3NQ41 2VOJA 4GXQA 1A95A 1KAGA 1N3BA 1P0IA 1M74A 2OXCA 3N8GA 3P9XA 4ZQFA 4RKQA 4D92A 5AVVA 3FM9A 1EDZA 1MEOA 1TPZA 1YL7A 3BJZA 3G2KA 3PSAA 2R84A 3P0HA 3C15C 1U7WA 2QVCA 4KWHA 3IELA 4WK0B 1XZQA 2A30A 1J20A 3PC7A 4R2LA 3VR5D 2B7CA 2EKZA 3TVYA 2J3EA 2PRIA 4IDPA 5E6RB 4J90A 1K4MA 1EFKA 2IYNA 1KAEA 4KWIA 1F8FA 2PPVA 2JHCA 4Y9SA 3VC2A 3OTOB 3AU9A 2WNIA 4ZICA 1N2GA 4JY7A 2RAUA 2FHPA 3EJWA 3WGJA 4XYMA 1QDEA 4X61A 1UBUS 4EF4A 4RH3A 3CMQA 2DG2A 3C6YA 5T6MA 2Q7HA 1CWUA 1RTKA 3KHSA 3QLVA 4J7UA 2LNDA 3HUFA 1DWOA 3P5BA 4MVJA 5DXJA 4UXIA 3MFQA 2XYGA 5JAOA 3ZHTA 3TEHA 4UAVA 3BBPA 4XTRA 1RYDA 4YECA 3CX4A 5EP3A 1YL6A 4FS3A 3W3AH 1LLQA 2Z04A 2PT6A 3ITDA 4B9AA 3CNLA 5ALGA 4XWAA 3F5FA 2ZIGA 4UP9A 4HX2A 3ZG6A 3S8EA 5HCNA 3D2AA 5HW0A 5KX5B 5I45A 1M2FA 5GY7A 1WB9A 1G20B 3GT7A 2ECOA 2ZYHA 4GM1A 4GP9A 5CLLA 3KPUA 1CUWA 2IOYA 2B1IA 3N0XA 2A5YB 5EG5A 5AXCA 4WNYA 5TIIA 1PL7A 1WWKA 2C00A 2C78A 5JRZA 4EKYA 1E4EA 3AJRA 4YXWD 3KOXA 2HIMA 4G0MA 5KEIA 2NX2A 4TQAA 3RIEA 4HGOA 4FHFA 4OFXA 5AW3A 1JU3A 1SQSA 3AXTA 4QJ3A 3WMWA 1ECCA 2GPBA 4CIWA 4PLGA 4LX0A 4OD0A 2I4NA 4WXHA 1WM1A 3K72B 3VYRB 4JIMA 5EIBD 2CJWB 3JQDA 3F46A 1XU9A 2OVBA 4MAAA 1Z45A 5DOZA 4ZPXA 3IFSA 2DPLA 1SHUX 5BSKA 2F3QA 1X3LA 2OFOA 2IDJA 3P20A 4E5VA 1DRJA 3QKTA 3U7QA 3HDHA 3T95A 1U7XA 5FWAA 1NC1A 1NUAA 1XEWX 2JI9A 1GILA 3CLTC 4JXXA 3BFJA 2IBMA 3ESDA 5ALHA 2FR8C 4FEGA 3G1ZA 1K5PA 7MHTA 1A9PA 1ZXBA 4CM1A 1E2GA 2KB0A 1UJCA 1QUEA 2PSFA 3IAAA 5C7IO 5BWNA 1T6BY 5CGZA 3ZHZA 1GPMA 1PFWA 4E5NA 1A9RA 4H18A 2GHQA 5KNBD 3HG7A 4OHPA 5AO9A 5AW5A 3IP1A 3MJSA 1X1CA 1AY0A 1T25A 1I7DA 1KJWA 1PE0A 2C2KA 4PAOA 3RVKA 2RG7A 4MUBA 4BS9A 4CFZA 2XF8A 1EVIA 1P1JA 4N39A 1GFWA 4BN0A 3JD3A 4LY9A 2RHTA 4N5NA 1K97A 1DQZA 1N5MA 1QFYA 3GWZA 5A3JA 2GA8A 1RI1A 3CE9A 3H3JA 1ZRMA 1IXRC 3LYAA 3R3ZA 1M2GA 1Q3HA 4NEHB 5DFAA 3RT7A 1EJ0A 2ZTGA 1XCGB 4M86A 2XE4A 4AULA 5CIQA 1PYOA 2R8YA 3ZC3A 5JRJA 5AYVA 3FIJA 3T9EA 3ZBQA 3HMQA 4YO7A 4PIMA 3A1NA 3VZBA 2VJMA 3L0OA 4BASA 1L4HA 3KD2A 2Y6UA 1E3WA 2LCIA 3QH4A 1CF2O 2UYYA 3E0XA 3N2LA 3WB1A 3NTOA 1H3EA 5AJWA 4F1WA 4IDBA 2DBQA 3RBZA 3FVQA 4QJBA 5JS1A 1UT5A 5IYZA 1F9AA 2PBLA 1HF3A 1NW9B 2YXEA 4UHEA 1UKCA 1IN6A 4MYHA 1NXWA 1EX6A 1OPRA 2OFFA 4YJFB 4AKTA 2E3CA 2Y0PA 4RA9B 4AX8A 4OL0A 2XW6A 3H5WA 4KH0A 1YZYA 1JJAA 4DL9A 5JJKA 2DX7A 1SCQA 2P2LA 2YW9A 4G5YA 1TYEB 2XRYA 5EIOA 3CPSA 1WW8A 4G4GA 4OCZA 3QPVA 1NRXA 4MA0A 3ZWKA 1ORVA 1CEXA 5IVPA 3CR7A 4RGBA 5H83A 5IF3A 1ZGAA 4ZDKA 1F4VA 3PGLA 1PWZA 1KEPA 4JXJA 1CY1A 5LQMA 3KQNA 1E9RA 2J30A 3LFHA 4O59O 4Z53A 4B2IA 3GUYA 1O8CA 3QP9A 3C3WA 3PQ4A 5FEUA 721PA 3HY0A 4M99A 3RC1A 1NF8A 3QF7A 2RE8A 2AK2A 1J21A 5JBIA 4I4TA 5FIUA 2ZBEA 4D25A 1Y9AA 3C1AA 2NZJA 1Q1NA 3DT9A 3DE3X 3MT8A 4EEZA 2WU0A 2X2PA 3ESAA 4MI6A 3B2NA 1N6PA 1XTBA 4JN6B 4D9MA 1UANA 3W3ZB 3DEFA 4RVOA 2CZCA 2HU7A 1TO6A 2GEFA 3KLNA 1R16A 4LPKA 1P2FA 4M0DA 3DW1X 1SPBS 1UKYA 4JLVA 3VYSB 2D5LA 1P2DA 2DLNA 2UYGA 5LM3A 2FAXA 3KEMA 4GPEA 1E2BA 1E66A 1YBAA 3FGOA 2AUNA 3QYJA 1PJBA 1VLZA 1ZESA 3GB9A 2GX6A 5GQSA 4XVQA 3JQAA 2X7JA 1RAIA 2FQQA 2ATIA 2I1QA 2WZBA 3QG5A 1OASA 4XVRA 5JD3A 4WBNB 1LF5A 5DXAA 2PTGA 4NAHA 3GEIA 5AOBA 5CFMA 1KI4A 3ESZA 5K1PA 3MAAC 4RETA 1NLYA 4RLSA 1BOOA 3RCBA 1UPFA 3P9KA 3OLVA 2HZBA 2ZSIA 3SF8A 2OAEA 2CYAA 4MR8B 4KHZA 1LW7A 3ODGA 1MVOA 2FUG6 2OQ2A 4E5KA 1DOZA 2XCUA 4K0RA 2NQTA 2QP4A 4K03A 4XX0B 2PNJA 1W4RA 5EKTA 1N75A 1OW3B 4F3KA 5JQGF 3BGDA 4E5UA 3PIIA 1E2DA 1EXNA 3M1YA 3PPVA 1M8KA 2QL5A 3GDGA 4CR7A 3Q7PA 5BNIA 3ABZA 3V34A 4TXNA 5BVHA 3LIPA 4RESA 3HCNA 2Q5OA 1NYTA 3MF2A 5BW8A 2VBGA 3B6MA 1PDVA 3IP9A 4H6XA 1MAAA 4CG3A 1M1YA 3HE3A 5HRAA 1W94A 3ELUA 3QVXA 3LBIA 1U1CA 3A6EA 5DYGA 1Y4ZA 3VVBA 1GUZA 4X41A 3KDSE 4P98A 5DHAA 4LHZA 2FFQA 3ZWPA 4CM9A 1JG4A 1I3NA 2H4YA 3ONVA 3T4PA 3DFIA 4PZDA 1IBCA 1DZIA 4OLBA 2A8EA 4HJXA 4MVYA 3IQFA 1P19A 3HVIA 2YWRA 5G0WA 3QKRB 3ORQA 4MS3A 4RY9A 5C35A 2ZNJA 1SVMA 2B37A 1EUCA 4QIHA 3QNEA 2AOVA 9LDTA 4YALA 1BOFA 2HJ9A 3U5TA 1P2TA 2PNFA 1UMCA 3FKSD 4RA6A 4CNQA 2EL9A 1YK0A 4WFKA 2EG9A 1YS1X 3BCUA 4DSZA 1UBKS 3GNTA 3SYLA 3OZDA 4A10A 1I24A 2ARSA 5C8DA 4K8OA 1T9GR 1VP3A 3D59A 4JP5A 3VPGA 3QFFA 1HI9A 4ND1A 3CH6A 1E89A 2OD2A 3RB8A 5COBA 4CV0A 1JVBA 1LKZA 2X7HA 1YZGA 3AJ9A 1RPAA 1EQ2A 1IOZA 1KSGA 3SNKA 4YRZA 4I55A 5CNMA 2MYNA 4R8MA 5EAIA 4KQIA 1IXKA 2WK1A 1DKOA 1K8ZB 5C52B 2PS0A 4H3VA 1JAHA 1X9HA 2G36A 3GLHB 3L8MA 4GF5A 1P5RA 4Q9DA 2E5LB 2DP4E 1AUOA 2K87A 4MUYA 5BSMA 4ZTUB 4IDCA 4LN1A 3RUHA 2WVHA 1ZXXA 2DCMA 3KT0A 3R3UA 1Z0IA 5FA6A 5DPMA 4ZZ2A 3TMYA 4BVFA 1CC1S 1WETA 2QTFA 1DBPA 1LBTA 1ZD3A 1RHMA 2IUYA 3BAFA 2R8BA 3DO6A 2BKXA 3OE1A 3QMWA 3RRNA 4EY3A 1ISGA 3PC4A 3WV4A 5AI6A 2BM0A 4MEBA 2Y05A 4DTIA 1VPDA 1A8QA 1PEAA 5F4ZA 4H7HA 1C7FA 4UCFA 2X0FA 3SZUA 2EHDA 4A8JA 2ZE6A 5E6UB 2FKNA 2B4QA 1ORHA 2H4HA 3E2MA 3KR1A 4C2BA 4W8GA 2G3YA 4BVHA 3TXXA 1KEWA 4QG7A 5KYWA 5LP6C 1AHIA 1IOVA 1NN1A 3IUNA 4JFAA 2NM0A 2XNSA 5IANA 5LQNA 1IZ7A 1GQRA 1IIRA 3FNRA 1L7VC 1USYC 4MHTA 1LX7A 1FQWA 1OHHD 1Z2PX 1S1MA 2YIVX 4X8OA 1JHRA 3BFKA 5LZ2A 2XODA 3D5TA 2ZQYA 2CXQA 1K2VN 2KLHA 2W2NA 3VRHA 3K0KA 4OJKA 5I7EA 2X58A 5JH7B 4H1WA 1MABB 3D8HA 3NV7A 3GGPA 1BCRA 1IY0A 2B1JA 3OT1A 1QX4A 4JLMA 5K0TA 1F8UA 5J58A 3FTEA 4X94A 1VI2A 1ATIA 3OZGA 5AP9A 4WERA 4JLPA 5C1DA 4ZO6A 1HYBA 1REQB 2REXB 3GJYA 2H57A 4J1QA 3ZNPA 4YP5A 1VJ5A 4DWJA 2V6FA 2FPIB 3TQQA 4OQEA 2FQWA 2JCXA 3CO0S 4DEXA 3IUJA 3RUXA 3KKOA 2O2SA 1QYIA 4KO4S 2EJGA 3OUZA 2FSPA 2ZYTX 4E22A 1ONOA 2GPNA 3HWX1 3CB4A 3I64A 4UBMA 2ZZMA 5DWDA 1YQWA 1YULA 4B3MB 4FZJA 3ZGYA 1YR2A 1HLGA 1ZMRA 4LNUA 3JQPA 3NBYC 4GPD1 1CEQA 4RXTA 3RS3A 4I99A 1YMQA 1W34A 1W6UA 3DPIA 3GQBB 3VOTA 1SO8A 4MNTA 4ZAZA 3MJCA 2WZCA 1QWOA 1GL9B 1OI2A 5BQ3A 2CNBA 4LZPA 3GH3A 2DHQA 1N8SA 3H87A 3HN6A 3I53A 5ER9A 4DMFA 1VYHA 4Q4LA 4QOIA 4IX1A 1XNJA 3RC8A 5C5DA 2G0NA 3VNQA 3KWMA 5A9RA 3T3GA 1U5AA 3NIFB 3QA3E 4P75A 1O5TA 2BP7B 2IE8A 4KV9A 3ZXYA 3UUWA 2OL4A 2IQIA 2J08A 1S2LA 4PAQA 4DM7A 4AO8A 4BNGA 7AT1A 1QOQB 1AHNA 1O94A 4GT1A 5FBKA 3UTCA 5JAQA 4MCHA 1V1RA 2J6IA 3O4RA 4KWCA 2I76A 4X8MA 3EXIB 2R7AA 2M32A 3LFTA 3VNAA 2G4LA 1DO2A 4N82A 3LQ1A 4DQ2A 3WLFA 1K9VF 1VPLA 4WWHA 4BJ3A 3QTCA 2QW1A 3WYAA 3NEJA 4AY3A 4OLFA 4I50B 1P9LA 1OXVA 3D2LA 1NV9A 4PCUA 3L1AA 3LXRA 1DGQA 3UBMA 5K0ZA 3NBQA 2MMGA 3DDZX 4N48A 5ALDA 2QTLA 4QWMA 1G2OA 1NJSA 3L7JA 4WH0A 1NLFA 3OQMA 1T1JA 2IE0A 1XTJA 3RSHA 4QULA 1J9ZA 1FX0A 4I9UA 1SQ5A 2X3YA 2HHLA 4PYOA 1RHKA 4KEAA 4TLEA 3R3HA 3V1TC 5LMUB 4CM4A 1YHYA 1B8PA 3M2PA 3SZ3A 4MGKR 3OCJA 1ZDMA 4OMUA 3ZD7A 2CHFA 2JRCA 2J7PA 4RACA 1OU0A 1NBMA 2YR0A 3IC5A 4ZVVA 3ZGXA 3IEVA 4PINA 2YVKA 1JPUA 4Q34A 4QJ4A 3LA6A 4AJOA 2NZVG 2B34A 4CQMB 5I8WA 4A6PA 2H1OA 2VSFA 3KSAC 2SCUB 4DAOA 3SVTA 2VDMB 1WL8A 3D4PA 4KFSA 2OQVA 3M6UA 2BJHA 1G8JA 2ONKA 5BSEA 5HM6A 3HL4A 2V74B 4QHTA 1LI4A 1IONA 4CMEA 1K4YA 3WLHA 5DULA 1X2BA 1E1RD 5M29A 1X7XA 3Q7TA 1UMKA 1P2GA 4DLYA 2TECE 4B33A 4UPAA 3D8UA 4N3BA 3GV0A 3IAXA 2H2HA 3ANNA 1TIPA 1DU4A 2HLDD 4JAVC 4EJSC 1XZMA 3WRXA 4BCDA 4EVQA 5AM2A 2G6BA 4JYCA 4H7FA 3R3WA 3U49A 4DT1A 4HNQA 1P4JA 2PMWB 1E0SA 4XWTA 4KKXB 4HWRA 5ECYA 2X3FA 5GJVC 4L8LA 1V8BA 1JG7A 2CL5A 1SHJA 1SFRA 3LW7A 4PYQA 4C3VA 3AV0B 1XP8A 1YHZA 3LXXA 1R27A 4YJ2F 2EKLA 3OBIA 3AZOA 3OQNA 4IGFA 3LSSA 2JEOA 3HBFA 5FO1A 4DDWA 5F33A 3P45A 4MKFA 4QEKA 2BRUA 3AR6A 3TRDA 3WKBA 1YRBA 1JFRA 4IIVA 4LV5B 3GP8A 1OTHA 2C58A 3TKAA 3BMQA 3AUKA 1U99A 3QVUA 4DQKA 1L5SA 1IPEA 5F76A 1GQSA 2VOEA 6YASA 3W2HA 2B5OA 2VDKB 1XLVA 3UFXA 1QQ7A 4R3NA 2JS7A 1NP7A 4L0MA 2W6JD 2XSZD 3K0CC 2Q3LA 4A6DA 5TMPA 3AEYA 4CCYA 4FJ0A 4WY5A 4OB8A 4OGLA 3VJMA 1OH5A 3O74A 2Q50A 3KKNA 4M98A 4MR7B 3TAHA 4H2WA 1IMOA 1WPYA 2XQFA 4KRGA 1MRSA 4OQYA 4FFSA 3EDCA 2B7LA 3L1IA 4YJGA 3UWOA 1KL7A 3VV3A 2JAOA 4C21A 2OK8A 2GERA 3P0FA 5BW4A 1OJ7A 5E7MA 2HW8A 2GHRA 4Q7EA 2OFWA 5K45A 2ZYSA 2XMSA 4KUEA 5HCUA 4Z7JA 1IHYA 5JRDS 1CJUC 4PHFA 2BVNA 2GBIA 3WJ1A 1YCDA 2P11A 2PRJA 4DCVA 3FPJA 1QGED 2ZWVA 4EJMA 2YFYA 3BAZA 2Q6IA 3T0GA 1XHEA 2DUWA 1NUSA 2YHIA 4MW5A 3KYJB 4L3WA 5HYVA 2BMJA 4OHXA 3V4PB 1SVOA 3A74A 1GZVA 4YJKA 4XUDA 5ERXA 5CFOA 2JGDA 1Q16A 2IPAB 4D9CA 1TU3A 4RFVA 2V0GA 1OWNA 1RE0A 2ZUCA 5H4HA 3KVNA 4AU1A 5AK4A 3Q2KA 4YRLA 4FMBB 4AP6A 4MW7A 4DUZB 2ZUBA 4DR2B 1O9GA 3JYQA 1L8XA 1C3LA 4Y9UA 4YT5A 5FA8A 4M46A 1D2EA 1UWLA 2ZDGA 2WW8A 3F3MA 3QNWA 1LDMA 2HKIA 1ZAYA 2I1LA 4TWBA 4YFVA 3TZCA 1H1TA 4ACBA 5JASA 1UKBA 2FPLA 4RF4A 2PT9A 1XVLA 4ZOLA 1UXHA 4ZU1X 1T9CA 5IVIA 4WI1A 5REQB 2Q9UA 2MSWA 4HQNA 5E4FA 4YN3A 3S5UA 1YAJA 2G6TA 3O90A 3N2YA 3R3JA 3RYFB 3OM1A 1D2HA 4UZEA 2BSQA 2AX3A 2I3GA 1Q2UA 1HE3A 2BHLA 2OHXA 4G0PA 2XMRA 3TX2A 3FOEC 1I7QB 4FYIA 1EGAA 2QBYA 2M98A 3LUDA 4U7FA 1JG3A 5EJ6A 5K1ZA 2CC2A 4JVLA 2ROQA 3G02A 1XKLA 4N3NA 1F6DA 4X90A 1E2HA 3BFPA 1KVUA 4F1KA 1CLUA 4L72A 4RIHA 4YT2A 3UMCA 1XJWA 4LBYA 3MN1A 2Z98A 3ZKAA 5KKCA 4C20A 2FJ0A 1CE8A 2PS1A 3TLJA 1CF4A 2ODTX 4WQMA 1P2VA 3FZEA 2FUCA 1JA9A 2AG0A 3D4OA 1EZZA 3NEPX 1GNTA 3O6VA 1QONA 4JP8A 4EYSA 4BZWA 2XJ9A 3OPMA 4RHUA 2RH8A 4JBGA 4P82A 4ZAYA 3SQLA 3ED5A 5CB0A 2B1QA 3KQLA 2PUTA 2OC4A 3U3XA 1EOVA 1S3IA 3SAJA 1XTRA 4H6WA 1WIWA 1KI6B 1GJRA 4G56A 4OYYA 1FRQA 1YIOA 3HRKA 2FR0A 1Q1BA 5IJ9A 2D0OB 5C53B 4JUFA 2GOYA 3MS4A 5EJ4A 1O6FA 3SI7A 2PGJA 4WJZA 1ZH0A 3FHOA 1BD4A 1NNUA 1CBUA 1MC4A 4TLMB 1YC5A 1BX0A 4TTVA 2VYVD 3E05A 3R44A 2C7OA 1BYUA 3BTUA 1P91A 3K0FA 4C4TA 1I94B 2NSHA 3CZQA 2GBCA 1IL2A 1L6IA 1U0TA 1XQXA 2VAWA 3R5HA 1WUYA 2FSFA 2QX9A 3HXKA 3LLCA 4IBOA 5AW9A 1WV1A 3LS2A 3KYIB 5U9CA 4CM8B 1PT9A 1AUVA 5CVCA 2Q0SA 5C5EA