2G4CA

Crystal structure of human dna polymerase gamma accessory subunit
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
420
structure length
397
Chain Sequence
b'SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase gamma subunit 2
publication title A novel processive mechanism for DNA synthesis revealed by structure, modeling and mutagenesis of the accessory subunit of human mitochondrial DNA polymerase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 397
sequence length 420
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2g4cA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 2g4cA02
3QTCA 2ZXFA 3RGLA 4YP0A 4RMFA 3HY1A 4X5OA 2Q7GA 1EVKA 1X56A 4EX5A 2QHSA 2I4LA 3V8JA 2DZ9A 3V7SA 4YRSA 3L2ZA 3V8KA 5ELOA 1X55A 1B70B 2ZZFA 4YRPA 1X2HA 3A5YA 4P74C 2EWNA 2QHVA 2XTIA 2ARTA 3RF1A 4YPFA 2P5IA 3PCOA 1WU7A 12ASA 1WYDA 4P3PA 4ZTZB 2E65A 4P3NA 4H2WA 3DSQA 2AKWA 4CH6A 2EAYA 1X2GA 4P74A 1B8AA 5ELNA 3L1AA 4G84A 5K1PA 1YFTA 3IALA 2C7IA 1L0WA 3A74A 4DPGA 1YFSA 3HRIA 4YRKA 1Z7NA 1KMMA 1NYRA 3VQWA 1ADJA 4WJ3M 4J15A 3V7RA 2DEQA 3ICAA 3RIRA 3A7RA 3HXXA 3UH0A 4DQ2A 3UFGA 4P73C 4TQDA 4KR3A 3HY0A 4CH5A 3R07A 2IY5B 4TWAA 2AMCB 2I4MA 1NJ6A 1WPYA 1JJCB 3A7AA 1FYFA 4CH3A 4YROA 3QNEA 3L4GB 4P73A 2E10A 4YCWA 1SRYA 4YRJA 1PYSB 4YRRA 4BW9A 2RHQB 2ARUA 4BWAA 4CS4A 2CJBA 4TVYA 1WLEA 1WQ7A 2DQ0A 3NENA 2ZT8A 3A5ZA 4EO4A 1KOGA 2ZZGA 4XU1A 3MEYA 4XTXA 3HFZB 2J3LA 4L87A 1B70A 4H2VA 4HVCA 2ODRC 4RQFA 1X54A 3IKMB 4RQEA 3NEMA 2E3CA 1BBWA 4OLFA 2EJFA 1WNLA 3RL6A 3VBBA 4PHCA 4WF2A 11ASA 3VQYA 4YCUA 1B7YB 1NJ5A 3LC0A 1EIYB 1HC7A 3HXZA 2DQ3A 1NJ1A 2DTOA 1WQWA 1EFWA 2ZIOA 4K88A 2E1HA 2DU7A 4XU0A 3A7UA 3P8VA 4XEOA 2ZZEA 1NNHA 2Q5IA 2E64A 2G4CA 3M4PA 3RACA 2RHSB 4TVAA 4H02A 1BIAA 4H2XB 2AMCA 4ZIBA 4YDQA 1JJCA 4YRQA 2Q7HA 1E24A 3M4QA 1HTTA 3LSSA 2ZNJA 4YRFA 4WJ4A 4ZTUB 3L4GA 4P72C 4XTWA 1PYSA 2ODRD 1BIBA 2RHQA 4WI1A 2DTHA 2DTIA 4YYEA 4K86A 3KFUA 2FYKA 2DXTA 3REUA 4XU3A 4G85A 1QF6A 1ADYA 2DKGA 1B76A 2C8MA 2ZTGA 1QE0A 4XTZA 3HFZA 1SESA 2EJGA 4P72A 4YRTA 1ASYA 4YRGA 4UP9A 2LW7A 1J5WA 1H4VB 1H4QA 3IKLA 4P75A 4TTVA 2QHUA 2I4NA 4KQEA 2ARSA 1EOVA 3I7FA 2Q7EA 4XTUA 4Q6GA 1N9WA 1LYLA 5K1XA 1B7YA 4E51A 1EIYA 1YGBA 3V7CA 2ZT6A 2EJ9A 2ZR2A 4UP7A 4Q15A 2ZT7A 1NJ8A 4YRCA 4K87A 1HXDA 4YRNA 2EL9A 3A32A 1C0AA 1NYQA 4HWTA 3A31A 4CH4A 2DZCA 2ALYB 2ZNIA 3MF2A 3TEHB 2DJZA 1ATIA 4H2XA 4NCXA 3E9IA 3WQZA 1H4TA 1USYC 4HWSA 1G5HA 4P71C 4RDXA 4O2DA 1RIQA 3IG2A 1SERA 3HTZA 1KMNA 4YRMA 1IL2A 3UGTA 4HA8A 3HXUA 2Q5HA 2P0LA 4YRLA 2DXUA 1USYA 2ZINA 3QO7A 2HNIA 4P71A 4H2YA 4PG3A 3QO8A 4H2UA 3HXWA 2IY5A 4AH6A 2CJAA 4HWRA 3P8YA 2DU5A 4KR2A 4XU2A 4OP0A 3TUPA 1E1TA 3VQXA 4CS2A 3BJUA 1G51A 4TVWA 3RKWA 4H2TA 4XTYA 2CGHA 1YB3A 5E3IA 2ZGWA 1X01A 4P75C 1EQRA 3UGQA 3HXYA 2CJ9A 5C53B 3W3SA 1H4SA 3E9HA 2E41A 3QO5A 5C51B 3OD1A 3PCOB 3NETA 4CS3A 2CIMA 1GGMA 1E1OA 3MF1A 4HWOA 4TVAB 4HWPA 4UP8A 2AKWB 1YFRA 4H2SA 1SETA 4P3OA 2QHTA 1E22A 1EVLA 3NELA 3HFVA 1G5IA 2ZIMA 3RKYA 5C52B 2ALYA 1Z7MA 2DDZA 3RKXA 4TQFA 5F5WA 1V95A 1ASZA 3TEHA 3HRKA 2E5AA 2PMFA 3LSQA 3V8LA 3HXVA 4YCVA 2ZCEA 2ZR3A 3PZCA 1W66A 4UPAA 3VQVA 2I4OA 3P8TA 3REXA 3BFMA 1VQZA 3FJPA 4XEMA 2RHSA 5KNNA 4YRIA 4YREA 4XTVA 2DVEA 3ERRA 4LNSA 3CMQA 3EFRA 5HGQA 1NJ2A 3EFSA 2ZT5A 1BBUA 3TEGA 2XGTA 2J3MA 2PMEA 3RUXA 3G1ZA
chains in the Genus database with same CATH superfamily
2WZDA 5EJGA 4X20B 2BGIA 3SM3A 4YP0A 3SSMA 4YMUA 4Y9RA 2MSCB 2DBYA 1GRCA 4L5AA 2NUAB 4IDAA 2G5PA 3HI6A 4ZQIA 5L3SB 1MUUA 2QSYA 4YUVA 4Y6GB 5E7JA 2PRYA 1J06A 3UWKA 4PYOA 4RVSA 1DBPA 2W37A 2ZVJA 1TM7E 1MJFA 4EY4A 1DGQA 4EA6A 4RH3A 2QZ4A 3F7NA 4IGAA 1A9XA 5CB6A 3KUXA 2JGDA 3AU9A 3L1HA 2RGRA 1EVEA 5DI9A 3AEZA 3DEAA 4UTPA 1W88B 4XRGA 3I23A 4GP6A 1R15A 2P3LA 3KQMA 1IJKA 1H2FA 2ARTA 3MINB 1IWPB 3KTFA 1R5OA 3CV3A 5JD3A 3UBMA 4I19A 1V9CA 1KR5A 1Q0UA 3FTFA 4DV1B 1Z6TA 2DERA 1BTOA 4RLHA 1C0PA 1OH6A 1GGEA 3I8OA 2AZDA 2J59A 2RGGA 3WLHA 3KVNA 1NRJB 3DQZA 2VHXA 1J8FA 2POCA 3C24A 4NAHA 4ETNA 1TQHA 3OQ6A 3U17A 1JG2A 1QH8B 1RWVA 4BFSA 1JAZA 2H9AA 5C3MA 5B7PA 3M6MD 3QH4A 4OB8A 2W9XA 3OJ0A 1GHTA 2X3YA 2Z5VA 5BQOA 1XFAA 4UTOA 5KTOA 2FEKA 1DJNA 1I7LA 4B34A 1G291 2VAXA 1GT91 4XDZA 5AR1A 3LUKA 1CRLA 4JBWA 4QSHA 3T3MB 2EARA 1T13A 4JSYA 1WETA 3HMQA 4XB2A 5BN5A 2C96A 5SY6A 2QAGB 2F1HA 4XYBA 4QXAA 4HDAA 1C3LA 1XE3A 2IE0A 3GFSA 1IY0A 2P11A 4JS0A 3I1YA 1RXWA 4PYNA 3GYBA 3QSYA 3I8SA 1QHNA 2P2LA 4C4SA 3A4VA 1HEYA 3HN6A 2FR8A 2GRJA 4LYHA 2BRUC 3HKDB 3ENQA 3ZV4A 4AIRA 1D8AA 1QYXA 4E88A 4R81A 4DR2B 1CF2O 2M98A 4OD0A 3RR2A 1NMSA 3D6VA 1VIDA 3KKOA 4AJOA 3GCZA 2R66A 1G41A 3D4OA 1RLTA 3BWCA 4FGKA 3B6IA 4ZI7F 3OAAD 5EIBC 2IH2A 5F21A 3DZJA 2ICAA 1L1QA 1U1GA 5ALLA 1S01A 4GMKA 2C00A 3KKNA 3OT1A 4CF4A 2SKEA 2P2GA 2Q29A 3PGLA 2I2BA 3DB1A 1PFKA 1QYDA 5LP6B 4D9GA 5HTOA 3NIFB 1RRCA 3KEQA 1U2QA 3LX8A 5FOWA 3Q1LA 4EDHA 2ZIAA 4HNGA 1MTZA 1EFCA 1JGTA 2FW8A 2HRQA 1GUFA 2X1HA 2PZJA 1OXVA 3E0QA 4D25A 3GJ5A 3IULA 3GV0A 5AM5A 3C1AA 4KRXA 2RSLA 3OETA 4LGCA 1CEQA 1J5XA 1ISRA 1EZ4A 2CNOA 3EXIA 1ZOPA 1C9JA 2HCFA 3LKVA 1DWOA 3NX4A 3THOA 4JJAA 1EP2B 3E2MA 1M7GA 1WQ7A 2DQ0A 1HE1C 4PPNA 3OJOA 4E21A 3TIXB 5K8VA 1DG1G 2HZBA 2XKBA 3PE4A 3ILVA 1QQ7A 3QVXA 1DG3A 3L1JA 3LPNA 3ETJA 1V43A 4LWPA 4BIMA 2F1KA 3HV0A 5BP7A 1HG0A 2VK2A 3A4MA 3WKBA 4BX2A 4Z7QB 1GDHA 2UXDB 4DYVA 1JZQA 1D07A 2ORIA 1IQPA 1NBME 3E23A 4J7AA 4Y2UA 1OXXK 2F3TA 1FXWA 3EVAA 1B70A 1ZMRA 3D7RA 2X9GA 2ODRC 3P27A 5BYJA 4L6AA 5IKPA 5B4TA 4K9NA 3WYAA 4XFDA 3BJIC 1QVRA 2HDOA 3R75A 4TKMA 3IKMB 3D2AA 6ADHA 3BQMB 2E49A 3M1IA 1HQYE 5DXAA 3HH8A 1KK0A 3K5WA 1PLJA 4FFNA 4M9XA 2IW1A 4DPKA 1QGZA 2EF0A 2IP2A 3EXG2 4H7FA 1MO6A 1WB6A 1XJQA 5DGCA 3K8QA 2JATA 3FHCB 1JFRA 2FMFA 1QFXA 3IT3A 2FG5A 3DEYX 3MAGA 7ADHA 3THXA 2NSJA 2XQKA 5I4IA 3PUYA 4RIEA 5HQTA 2QAGC 5FBVB 2B98A 4WBNA 2YWXA 3C1TA 3AERB 4QASA 3OQMA 3OSUA 3E5RA 2PUJA 1QGAA 2QMQA 2QTAA 4MKXA 4XB1A 5H80A 3CT4A 4EJSA 4LK2A 3RJ5A 5B1EA 3Q2OA 1DSSG 2KLHA 4EABA 4OI1A 1UP6A 4L16A 1F0PA 4BNMA 3UXEA 4E46A 4DRXA 1CUVA 2CMDA 3KQKA 2OZEA 3A9UA 2HADA 3GZTB 1KI3A 4J3NA 3RNOA 3UFXB 1ENOA 3Q7EA 5C4MA 1JIKA 4NYIR 2P2DA 4M1TA 2WF9A 3DL0A 4DJJA 3FG9A 4DWJA 5BORA 4FB4A 1NU6A 2W4QA 3EMDA 2Q07A 2ZZEA 4L9RA 5CA1B 2HHAA 5BYKA 1TYBE 5CUQA 4JJIA 4PONA 5EZQA 5H02A 4EHBA 5AVVA 4L5CA 1SXQA 5LP6C 3MMSA 4E1BA 2BF4A 3CRQA 1T3HA 1U65A 1W46A 2IZOA 2YOHA 1U6IA 4G1UC 1KDRA 1GUBA 5T3YA 4ZYLA 4W5RA 4RHTA 2G06A 3KQOA 4G2NA 4K6OA 4GC5A 4RF4A 2BONA 3JPWA 5BQ3A 5C2JB 2MU1A 3PGXA 4W9MC 1JKXA 1HE2A 1MAAA 1OI2A 3K1TA 4GOJA 3V4OA 4DCGA 1S96A 1Y1QA 4AJLA 1Y1SA 5ALOA 1RBMA 4JODA 2OBLA 3OCUA 3GGCA 1YUMA 2AJBA 2XCIA 3JQ9A 1T25A 5IVKA 3E35A 3A58B 1IN1A 3EZYA 1UWLA 4AJ9A 4MQFA 1Y89A 4PGFA 2OO7A 1R5BA 2QW1A 3MFQA 4S3MA 1ZD2P 4WZ6A 3SJZA 4XX0B 4ZT6A 1OIXA 1YDHA 3WFZA 3RIEA 3ML1A 5DNEA 2EKBA 4YECA 2XJ4A 4KGDA 1FVFA 4JEHA 3ZHCA 5KX5A 3KQWA 4TQGA 3C14C 3OA2A 4F4FA 4EEZA 3FAZA 2VJDA 2ZRMA 4A6PA 1P2DA 1JB9A 1T8TA 3GRUA 4J9UE 3QF7A 2A0FA 1SKAA 5FA5A 2HPHA 3AF2A 2DXTA 1QTIA 3NBZC 3L8DA 4BO9A 2IZ0A 5LDDC 1P45A 3NBUA 4MV9A 5SYNA 1X1AA 4BNUA 5AW2A 4OHFA 2BSXA 2BWJA 1DO8A 3HO1A 1T2FA 2Y0EA 3HXPA 5BN1A 2ZTGA 1NQOA 2PL5A 4I81A 1FFWA 1TF5A 3NIDB 1E0DA 1YQQA 2EP7A 1VBKA 2AC4A 1A9TA 1N5JA 3GP5A 4HDNB 3WYBA 2OGTA 4A0RA 4TUYB 2ZJZA 1E3MA 3PI7A 1HFEL 2BF7A 4EJFA 1ZLYA 5K3DA 1KU6A 1P1BA 2AZ4A 1PHRA 1H4QA 1SC1A 1O58A 2JLSA 3DKPA 3OQBA 4FBMA 4UMVA 4ZCRA 2EC5A 3SR3A 4P75A 4IF6A 1POXA 2JANA 1VRCA 1Z2NX 1U6KA 4TV8B 1Z0AA 2ZB2A 3B3GA 3PPWA 2R60A 4RX1A 5CX4A 3OKAA 3U60B 3QRWA 3FMOB 3Q3VA 3IA7A 2IU0A 1RPTA 2ZI6A 2IS6A 3T5TA 2ECPA 3V2GA 3E1GA 5F98A 3H17A 4K9SA 2Q4TA 2J3IA 4R9RA 1QB8A 4CCYA 1CQZA 3ILSA 4XPIB 1HDXA 3RJZA 3ZTWA 4B0PA 1NVXQ 3BTUA 3RRXA 3OT5A 5I01A 3PEFA 4IOMA 4E1VA 3E5HA 3RYHB 2OFOA 2Q6KA 1UM9B 4EIWA 2BH2A 3FYSA 4WDRA 2ZR2A 5E8RA 3CRRA 5M7EA 5F1YA 1E1MA 4K6KA 2DT5A 4Q4HB 4BKQA 2FWAA 4AFNA 1UDBA 1HDEA 4KLAA 4KQ2A 1JW9B 1RT9A 5JQGB 4K87A 3B51X 4JHXA 2PZ8A 3QU2A 4N65A 4BB0A 5CLQA 4CTKA 2FLVA 2HRCA 5L9AA 3CF4A 1T9GR 1N2OA 1M74A 2P2CA 5J47A 1SWVA 2FPIB 4S2EA 3V8EA 2P4SA 3FYHA 4RS3A 1V37A 4BFCA 1YIDA 3K09C 4WOPA 4ITRC 4PC7A 1M1YE 2YVUA 3B12A 5CVVA 3L4JA 1LNZA 5IARA 1SBHA 4RA6B 4ZU1X 4CDMA 1NMXA 4ZXFA 2GNAA 3AUXA 1YXMA 3FMPB 5AKYA 1HLDA 1RKXA 3AQIA 5BWCA 3B2QA 4J75A 3G68A 3HKBA 5KMGB 3ELYA 4PWYA 2RAFA 1OVGA 3OCJA 2QN9A 5CVEA 1NVUQ 3KEGA 1DBQA 3O1HB 3RTAA 2FEWB 1USYC 2WM9B 3PD0A 5HF6A 4EX6A 1EGVB 3IR6A 4Y1EA 3E18A 2ZTVA 3HY4A 3ZY4A 3DUFA 2RK4A 4F9TA 4Z1MD 1ZH6A 3TB4A 1IN4A 4M0PA 3WL3A 3IG2A 4HDMB 2WA1A 4HMPA 4S24A 1DOHA 4YJ2F 2AOTB 3CVWA 4UASA 3SG0A 4TZ0A 3A2LA 3MUNA 4P80A 3RTCA 4B0OA 2NXEA 3TLAA 3VRHA 1YDFA 1Q7BA 3N0TA 2B4TO 3ACDA 4KSYA 2ZIWB 3ILXA 5KKAA 5DLPA 2FPGA 3GEEA 4RHXA 3VHXA 1UKBA 1XC7A 1COWA 3HE3A 3OOYA 1VLJA 5EJ9A 4FMDF 5DZSA 1LQUA 4GRIA 4AMYA 1UMCA 3KHSA 2IXEA 2WMNB 3M33A 3KELA 4D0RA 4EY3A 3FZGA 5JXJA 1PR5A 2HV9A 4LHWA 3T52A 1U4SA 3UATA 4LDPA 2V0NA 4B71A 3RVKA 1J4AA 2XQIA 4BMDA 3W5JA 2IXFA 4EY8A 5EI5A 1ODKA 3OLCX 4HNSA 4MGEA 4I50B 4MUMA 3L0ZA 2OOKA 4I4TF 4N3AA 1KQOA 2OLJA 1E2QA 4OFXA 5TARA 4LE2A 2MYPA 2P2ZA 3FOZA 1XPRA 1TOAA 5A2GA 4BGIA 1ZIXA 3JY6A 3CRNA 1FRQA 5IEJA 3N8DA 1XCOA 5A0TA 3U1VA 1QF9A 2W6OA 3A1NA 3U39A 3RS5A 1FYVA 4NFYA 4AP6A 1Z62A 6LDHA 1O03A 4IYRA 1Z8HA 5TB5A 1LTHR 1ZRNA 2JGAA 3DBOB 1ZVQA 3D4BA 3LZCA 2I7CA 1WXIA 1XTTA 3W5VA 1RW4A 2ISSD 5DI3B 1CB0A 3IBSA 4U3JA 3JSAA 3NRBA 3VI4B 3WA6A 4JASB 2YR0A 1Z7EA 2FJ0A 2ZGWA 2ZS8A 4CBVA 3RUPA 1L5YA 4Q4DA 1XKTA 1IY8A 3IEUA 3BSWA 4JLKA 1A8IA 4NMHA 1QGED 4G81A 2QGNA 3HXYA 1IWOA 1DUIA 3QX8A 2IY7A 3PR2B 3QUTA 3MTAA 5D2CA 2CJ9A 3EBPA 3TNJA 5I4CA 3BERA 5JECA 5LVAA 1QLJA 3KXIA 1DDIA 2FZ5A 4NU8X 2IY9A 1Y1KE 1EIWA 1G8KA 3IOYA 3BA6A 4IIJF 4MUJA 3RHTA 2HNKA 2FSFA 2D3WA 1XTRA 3OJCA 3JQAD 1GCAA 1HMYA 2C7VA 3OZEA 4FT2A 4IIYA 1UXHA 4IMJB 3RUAA 3RUEA 3ZHQA 4DCNA 5K8TA 3EA5A 2W6CX 3VVLA 4YJHB 4QYWA 3RVQA 2YJ4A 3MT9A 1KEWA 1TCBA 4GPD1 1E3JA 1VPEA 3W5AA 2P69A 1RP1A 5COBA 3Q3CA 3ZU6A 4DR5B 1KHTA 2NO9A 1XYYA 3LPDA 1ZKDA 1ORTA 3G2HA 4P3OA 3EDRA 3IBTA 3QLUA 2FPLA 3B38A 5KAMA 5G4LA 3SZLA 1P0QA 5CA1F 1UDWA 3HFVA 1N6KA 3OQJA 4EQ6B 1JWLA 4A8JB 1YB2A 1DT3A 1W0JA 2YN0A 4TGLA 1IRXA 2E82A 3P9YA 5SV2A 4Q1CA 2VAVA 3RKXA 3KOOA 4R5MA 4X64B 1T5OA 1YS9A 2J6CA 3TEHA 1HYBA 3CX6A 1B43A 3FIJA 5GZ6A 5F12A 1L4YA 3USCS 2E5FA 2PVSA 3PXUA 2II6A 4UVGA 4DWVA 3U3KA 5B53A 1Q74A 2NUBA 1W5EA 4J9VA 2VKTA 1W6RA 1JDNA 4LPKA 4FTWA 4D0NA 4YPVA 3I2HA 1QO9A 1CIVA 5EVCA 3TDMA 1HYEA 2WAXA 4GVPA 2ANCA 3VDQA 1YUBA 3A6KA 2H07A 1ZN7A 4JLPA 2PKXA 2ZCUA 5AUQA 3SSAA 4BMVA 2IWRA 2I4OA 2VZ8A 2B9VA 3TZEA 1XNRB 4BQQA 3MJHA 4YJFB 5EWJA 4IFTA 3LQ2A 3OIVA 4QPCA 5CTJA 3OTHA 2KW5A 3DTNA 1NW4A 1QAOA 2ASEA 1MGOA 1JU9A 1NRWA 2ZXEA 4GOLD 3KT6A 1E4VA 1G7RA 4HEHA 2C94A 5KNNA 2H1IA 2IYZA 4OREX 3K05A 5ALRA 5IUNC 3OQNA 1ORVA 3I2FA 3ELBA 3REQB 1WDWB 3UQYS 4UPEA 3RFFA 1Z7BA 2FEPA 1Z4JA 2CEKA 3PPIA 1J9EA 2E18A 4XUCA 4BC1A 4CN9A 3UK2A 1GNRA 4GQIA 1PQPA 2X1VA 4Y7CA 3GNQA 4M83A 5BQPA 4R5HA 1U3GA 3PR1A 3UMYA 4LDNA 3WKAA 4G9GA 3IHKA 1IG0A 2QRJA 3IUSA 1JLLA 4YBZA 2VNSA 3BGWA 1Z12A 5AK0A 2F48A 4KAJA 1LRJA 1V25A 2P9GA 3OIYA 2GD0A 1QF7A 4LRSB 4FYXA 3HYNA 3QTCA 2ZXFA 3TTSA 3H8VA 5I9IA 4M1MA 4RMFA 3I05A 4V02A 4BO6A 1LC3A 1ZK3A 2M6SA 3HXTA 5DWVA 1K5DA 3PC2A 2VJQA 4M7OA 2I4LA 1DFHA 4CM8B 4J07A 1C1XA 4ID3A 1TEXA 1ONNA 5ECYA 3S7ZA 4RTSA 3L2ZA 1OX6A 2EFGA 3FLAA 3NUQA 3RV4A 2ZUSA 5BNIA 3L6UA 1ZVVA 1TRHA 1G21E 1ZVKA 4FILA 1D7OA 1OAAA 4OSOA 1ML3A 3BJRA 1LJLA 1YCHA 2VNAA 3NG1A 3R41A 5GONB 3QWHA 1PV2A 3O2NA 4RVHA 1X2HA 1AV7A 1G8FA 3TDNA 3HUUA 4J76A 3EGDA 4UREA 2R4QA 3BXZA 1EG2A 5DNUA 1D6JA 2PTGA 2QVXX 1FRNA 1KK3A 2B1RA 5CJJA 4YVFA 4CU2A 4FHGA 1HNNA 2PYZA 4U6NA 2H16A 3RF1A 3A1WA 2E2WA 3I09A 4O59O 4Y6SA 4GX1A 2OM6A 3TZ6A 4RIGA 1YR1A 3SK0A 4CIXA 4FS8A 1G63A 1FJ2A 1DPGA 1I32A 3OFVA 1JMYA 4G1BA 2VL7A 5E3HA 2CLHB 3DGFC 1F5NA 2W4MA 1TT7A 5HHTA 3A6EA 4IDNA 2W8ZA 4HUTA 1VP3A 5A5VA 3KR1A 4UJ3A 3ACCA 2F1JA 2PFGA 3FPAA 4CL3A 3DDZX 5J4KA 1CR4A 2OHFA 2EGGA 4M9ZA 1WXDA 5LZ5A 3KWFA 2YHAA 3HCCA 1FBTA 2G1UA 2ID7A 5FFMA 4EPXA 3AHFA 1M0EA 3V4ZA 5B6PA 4Q47A 5F33A 1XPUA 1BEUB 5KVSA 2X0NA 4JCOA 2W0MA 1O0SA 3LDGA 2IODA 4H7HA 3VR5D 5LOVB 5K0JA 2ZREA 2IIVA 2GK7A 3HRIA 2SKDA 3TWOA 2Y93A 1IY2A 4OKIA 1CKEA 1YAJA 2BKEA 4RDHA 4XQCA 5TF4A 1O95D 2R3SA 2C2YA 3LY8A 4N3CA 1GUZA 4UUOA 1EU1A 1IXZA 2ZKIA 5AICA 3RIGA 1GQSA 1U5BB 4HFNA 2VSXA 3BRWD 1J5EB 4WLNA 2XAAA 4QUKA 3SOPA 3C6YA 1UMDA 2WYOA 1R1DA 4HXEB 3NT5A 1VIMA 4QU0A 1GUYA 3WSVA 4ND5A 1N2XA 2BDEA 3NH9A 2ZW9A 1APBA 4LFAB 1RM4A 1ODLA 3B78A 1X1TA 2OAQ1 3TIVA 1UXIA 1P3Y1 2D2VA 2RKWA 3L5OA 2TMDA 4OKNA 4CUKA 1QIKA 2YY6A 4GPAA 4K46A 4M0UA 2BFNA 5AHRA 1GQQA 3JQ8A 1I33A 3C5EA 4IG4A 4TMVA 4Z3DA 4B79A 4AY3A 2POQX 1ODFA 1XSEA 4BCBA 4BX3A 3HVUA 4TTJA 2OGUA 1BHO1 3PKZA 4CH3A 3FMIA 2ANBA 1WLYA 3BJZA 5J40A 4DY6A 1LLFA 1YS1X 4GR5A 3STTA 1IN8A 1P72A 1VMEA 2BRUA 3VM6A 2WSIA 2V8OA 3AEXA 1PS0A 1X86B 3M9XA 4POAA 3C3BA 1G6Q1 1GA6A 5H4HA 3ADOA 4MWOA 2AR7A 2C83A 3BWMA 4MW2A 4KI0A 1J33A 3K92A 2A0UA 2J4FA 3OEED 1KIAA 3R6WA 4JBNA 2X58A 4N5LA 3ETCA 4BQEA 4WCFC 3FDJA 3UHPA 5AVOA 1ZWKA 2FMUA 3DV0A 3CUKA 4LCEA 3VZQA 4PXYA 1NX9A 4X20A 2CV1A 4PIPA 3VHRA 4M0EA 1JUDA 1IU9A 2NUAA 4PC1A 3DMFA 2WMDA 2H59A 2Z98A 2EERA 5CURA 2WKWA 1AZSC 3EIOA 5I45A 3T3IA 5C34B 2CWWA 3JYQA 5CXSA 4UFOA 1BXKA 5TNXA 2GXUA 4HMOA 1OI7A 3EEYA 4QULA 5BT9A 4GNRA 4MGZR 1SRRA 1EVZA 2QI9F 4H2VA 2ZJ6A 4AY2A 1KJWA 2YX1A 2ZBUA 1JDPA 4Y2VA 5CX1B 5DX1A 4NENB 2BBWA 2UZIR 2MJLA 1W88A 4NG4A 3ZY3A 3A6FA 3FMGA 2JCVA 3KYCB 1GV1A 4WBXC 2IDJA 3O4JA 4U2GA 3M3HA 3RVMA 3U5TA 4B3BA 2X76A 1Z0SA 1LSJA 3CA8A 2E3CA 3MINA 4E03A 4YLYA 3NC4A 1Y6FA 2ORYA 3TLKA 1NOKA 2I66A 1IVNA 1GNTA 1KS2A 2I22A 2ZBFA 4ERNA 4PHCA 1P1HA 2Q5LA 3H42B 2TRSB 4Q4LA 1PFQA 1L5SA 1GV0A 2YQ4A 3OFKA 1PUJA 3NHUA 1AMUA 4HP8A 3MD0A 3ZQKA 5L4LA 4LHYA 1NJ5A 4GQAA 3KIPA 1WMSA 1FX0A 4UNIA 2AFHB 1SCJA 4URFA 2IF0A 4M53A 5B64A 2JFHA 1OKKA 4W7IA 2KM1A 1QH8A 3GEIA 4LUCA 5EIAA 1E3EA 3H1PA 5H81A 3GDOA 4EVQA 1WQWA 1NXSA 3LT1A 3IDOA 1Y8RB 4MWSA 1HSZA 3V1MA 2ZSAA 3T3GA 5C7IO 3VC7A 1F3OA 2WVGA 2Z6VA 2DFPA 3I42A 2VDJA 1FPQA 4JIGA 4LMAA 3VU8A 1E0AA 2Z2JA 4FFBB 4G07A 3PNLA 4EF6A 5IT9A 2QAGA 2HLNA 2YJ5A 3I2GA 3O8NA 1PJAA 4H7EA 4HDOB 4HZIA 3GCXA 2DR0A 4GOOD 1JWBB 2OZKA 3GJ7A 3HKDA 5DP2A 5I47A 5A0VA 3FPLA 2RHSB 3ZD8A 3C5VA 3EPJA 4Y2PA 4JXXA 5IKOA 4LHXA 3ZJVA 4A0GA 3KPWA 4H02A 3BCRA 5JCZA 1SUEA 1QV9A 1R0ZA 4IEEA 3TYXA 3ZHYA 2NO6A 1L5HA 5CA0B 1GVHA 2CVFA 1ID1A 1GL6A 4ZN6A 4GMDA 3GEDA 4HAYA 2GTIA 2W0SA 4C3ZA 3KQUA 3V9PA 4MA0A 1GU1A 1IHDA 3PQ4A 1JSRA 3LYHA 2VRNA 4YRQA 3RVBA 4O8ZA 2WFLB 3HZOA 2P7IA 1TW3A 4TRMA 5JHHB 1KJIA 4Y1FA 1X92A 5LP6A 3NNNA 1GPNA 4H60A 4L0CA 4RL4A 1WUYA 1I01A 1TCAA 2I6UA 3M6AA 3QENA 1GQOA 1ORIA 4MHTA 1ZK0A 1QS0B 3IILA 1RCTE 3GFFA 1Q1ZA 3B70A 2BZSA 2XWPA 3KVOA 4MPRA 3PI6A 2ZUDA 2FZWA 3WOVA 2ZJAA 4EFNA 1AN9A 2D1SA 1W4RA 4GH5A 5B6IA 5EQJB 2CNKA 3EDYA 4PYLA 1JI0A 4IILA 3B52X 4U0JA 3QOYA 3ID6C 1WP9A 2QMHA 1A1VA 2WSBA 2Q45A 4EJMA 4F5EA 5GM1A 4B84A 3WGHA 2PWPA 2X3FA 4MUFA 4JT9A 1ACJA 1B76A 1IBCA 2F6RA 2RHGB 3NYWA 5A5DA 4JBGA 1RKVA 2PKQP 1PKEA 5AOCA 1QCYA 1PNOA 2ZRLA 3MT7A 2PPLA 2I9PA 3SSOA 1GEGA 2H31A 1IM8A 2HC9A 2IPLA 5HUHA 3HXOA 4IDOA 2BYTA 2NT4A 1QORA 2B99A 1W34A 3TXYA 4BNFA 3SGLA 5FOXA 3L7BA 3PKIA 2HBZA 3ROQA 4IVNA 3ZIDA 1XF9A 3OE5A 4PLZA 4KQFA 3KCQA 3IKLA 1H9BA 4TTVA 3R6TA 5BW6B 3LOPA 5DJ5A 2QHUA 4AG3A 1G4HA 5AJTA 2BFWA 2SHKA 5JBNA 5GVRA 5GADl 1VPWA 2PLRA 2DJ5A 2ARSA 2B4AA 5FPKA 3FSJX 4KMSA 4M8NE 5AKKA 5KEIA 1GUAA 2GRUA 4IIHA 1L5LA 1UKZA 1MC1A 1SVIA 4AKIA 1XEWX 4XTUA 4AP5A 1AQ6A 1II9A 4NL4H 1N9WA 4NCIA 1LYLA 4QBFA 2GD2A 2ODWA 3VSDA 3IDFA 2G76A 4RQUA 4NCJA 5G02A 5H68A 3VV2A 4OXRA 5TR9A 2WV7A 2J9FB 3AERA 2REBA 4Z7OB 1BFUA 4E5UA 3UXMA 2IYTA 4AD8A 4OHUA 4EZEA 4F85A 5K99A 1UPBA 5YASA 3NWOA 2QU8A 3FHJA 5CFNA 3Q0IA 4BO1A 3DJYA 3R7SA 2WJGA 2PIDA 1D2NA 3WRXC 3O4VA 4ER7A 1JLKA 2NO5A 3FKSA 1WXWA 3BRQA 4NTZA 1MH9A 1VG1A 1NBOA 3R3SA 4QRHA 4RE5A 1M5RA 2HSWA 4XJVA 3CLUD 4PYQA 1EM6A 3DBRB 3DO8A 3UFXA 1NYQA 4ZV4A 1FDVA 4RVCA 1EX6A 2AOVA 2HV8A 3K15A 1XKLA 2KBFA 4GXRA 4R1NA 5C7LO 3MTBA 4PSAA 4PLFA 4PX5A 2QUZA 3JYOA 1Y3FE 4OL0A 2IP1A 4KU4A 2F7SA 2GQ0A 3IUPA 3RS3A 3HFGA 1YKSA 1FL9A 1P1RA 3TOCA 4AIIA 3L2OB 3I2JA 4DLLA 4KO4S 5LYJF 3IDAA 5COAA 4IEIA 3HB9A 3AYXB 4FFMA 1LZLA 1G42A 5EUQB 3WGVA 1UJ5A 3U49A 3VZCA 3HBLA 3MJFA 4BAZA 4E2WA 1RAIA 5KVAA 4P71C 1XD2B 1WDLA 1DJOA 1KJ9A 3UXHA 2IDZA 3F7TA 3ETLA 3O74A 1B0UA 1KSFX 2GFHA 1SCAA 1IATA 1OUMA 2PLAA 3CZQA 2R1TA 3IOMA 3K09A 5EJ4A 1OT5A 3RUIA 2PCLA 1KYZA 1DEAA 1OHHD 3IBYA 1RPNA 3GT7A 4NH4A 2HA2A 3G0DA 3IJRA 4XX0A 3CLTD 4MV7A 3RGWS 5BV0A 2XR1A 4S0ZA 5DHRA 1IIBA 3FUWA 1CCWA 4G24A 3UGTA 2EFEB 1YS2X 5LM3A 3E9EA 2IE8A 1ORHA 3B1WA 2FB9A 4TWJA 4GLBA 5E6UB 3KVYA 1O8CA 4C1BA 1USYA 2ZAYA 2EOAA 1SC3A 4Z2YA 2XMPA 1LK5A 1UDRA 3IX7A 1M2EA 3WIDA 5HCIA 3OX2A 1EE2A 1J8YF 1L5RA 5F64A 3UAGA 1JAIA 5EERA 3F46A 2IY5A 2HGSA 4QLAA 1UJCA 4O1MA 3S1LA 2NO0A 1X87A 4DVJA 1MAUA 3DMTC 1P2FA 2AMLA 4HDNA 4MTLA 1NVVR 3EBOA 4ZXPA 2IYAA 1A76A 3LP8A 2VYVD 3OEHA 4AJEA 1D09A 2J5XA 5IBCA 1TJNA 3JARB 4I1OA 3ZJTA 1AS2A 1PLKA 4ED9A 4OXIA 1Q5PA 3UMSA 3RC3A 4TSKA 1EFAA 4E1AA 4UHHA 4X65B 1XZGA 2D4AA 3DJFA 3U3MA 2PA3A 1ORRA 2EGHA 4X91A 5A3SA 4EW2A 4H2TA 1N2IA 4ZT5A 4ES6A 1E2BA 3JVIA 4EHLA 4XKJA 1DLIA 3KL2A 4G3XA 1RQGA 1S2DA 3MWDA 5JYEA 4OGKA 3GVCA 3ZI7A 1E9BA 3EAGA 3DAFA 5EINA 2BEWB 2YZ2A 4PVCA 4ZRMA 5A71A 4QFCA 1N2HA 3DHEA 2DUUA 2DWCA 3IO5A 3L0IB 1O9BA 3DLCA 2O2CA 3GELA 4XPIA 3RO7A 2C78A 3K8ZA 4XWWA 1ZAYA 3VAZA 2FWPA 4BJ5A 5CDTA 1UM9A 2JG3A 1BHQ1 4U7PB 4PYMA 4MDEA 3I34X 1IY9A 1FFAA 5F2KA 3OD1A 1SUAA 3G9TA 1F4VA 2LKCA 2YVQA 3EY9A 4Q4HA 4X6YA 1Y8AA 3W4KA 1MAWA 3W8DA 4DBZA 5IAAA 2C9MA 5IMSA 5JQGA 4JLNA 4CTJA 3UN1A 1M0WA 3H5TA 1F8FA 4GO1A 4AG5A 4K0KB 2AFIE 1ID8A 2W2KB 2RI1A 4GF5A 3FPBA 1KEPA 2WK1A 3FWKA 2GM4A 2H0QA 1KF0A 4H2SA 1ZP6A 2C07A 7GPBA 3DC2A 2EBFX 3RF7A 3K0CC 1SC6A 1QIGA 4RA6A 4ZCTA 1K88A 2BCGY 2V7WA 2VWPA 1JDZA 1RIFA 3GLHE 4LGVA 1SIWA 2FJUA 2WVAA 1UEJA 4LZPA 1RC8A 2DDZA 4Q4AB 5KMGA 4PLYA 5C18A 3N7TA 4W1QA 4BVFA 1MAVA 2YJGA 3MWEB 4J0JA 2Q5QA 4C0HA 2QRMA 4CIAA 4B7CA 2HF7A 1RLJA 4JENA 1RXSA 3R5JA 1QHXA 1UPFA 3VDNB 5I9NA 1YI1A 4ENTA 1Q12A 3VSBA 4HDMA 4Z1OA 5B58C 3DOOA 2AOTA 5JFGA 1MPXA 3KSMA 1ZIYA 1P8AA 3VYVA 5E8JA 4AKHA 4N48A 4BNTA 3T9BA 3AJEA 2CVPA 4BWFB 1HH4A 2BFMA 3C7TA 4RWEA 1O7JA 2GKGA 4CT5A 2Q4BA 2VNIA 4R9VA 3D7MA 3EPLA 2E3JA 3IKJA 3UIEA 4EDFA 3GJZA 3RIMA 1YMVA 4HGOA 4W4TA 3N58A 2JFBA 2FSHA 4QBKA 1YH3A 3SVZA 4JI2B 2B25A 1L5VA 1YIAA 4U7FA 3ZE7A 2O8VA 3A3KA 2NXWA 2VZEA 4QRDA 2FG7C 2DVEA 3T35A 1W4ZA 4PQRA 2MR6A 1X0VA 2HXGA 4I50A 3ICVA 1NUUA 3PV0A 4WOCA 2ZAGA 4RVFA 2CBGA 3F90A 2BFDB 3KD3A 4F6RB 1EGHA 1JDVA 3C1OA 5THQA 2KI5A 4BRZA 2XGTA 2J3MA 3U4DA 1NUPA 3X1XA 3T41A 4CU5A 1F38A 2CFIA 2FEAA 5D5HA 1QBGA 2E9SA 4UDOA 3WLIA 4HK4A 4KIFA 4S1NA 3L4KA 1X56A 1FFXB 2BGMA 1YE5A 5DM0A 2AC2A 2BBTA 5DI3A 5DTMA 2BCJQ 4KPYA 4PC3A 4P82A 3OCZA 4MYCA 2ZGVA 3IAEA 1VHQA 3D7NA 3NWJA 4LHVA 3TFOA 3V8RA 3FOBA 3O90A 5KTYA 5ELOA 1BVUA 1RHQA 2QEQA 1ESMA 1QGYA 1VL5A 4LYJA 4N0QA 5EKUA 2GXAA 1LSSA 1T43A 1JLSA 1V8FA 4BUZA 3F71A 1VJ0A 2VC2B 3CM0A 4FHEA 2YICA 3DL7A 3ZCSA 3P9PA 2CSXA 2A5LA 4NZNA 1CF4A 3JZDA 2FQYA 2F3UA 3P0IA 3RPEA 1GSAA 2OV3A 4N0PA 3UHAA 1WU7A 3LCJA 2RK6A 3Q9NA 1E2MA 3M89A 1VG9B 3QWIA 4QBIA 4R7GA 3AR3A 1HE8B 3DAGA 1YJXA 2JI4A 2ZROA 2GEVA 4BB5A 2J46A 3EODA 1HT1E 4YJHA 4N5NA 1UJNA 1JP7A 4MUEA 1GNQA 1X2GA 1T0UA 5KU1A 1VPLA 2IRWA 2ZANA 2B8WA 4BQPA 1SU4A 1NFFA 4RMGA 4AJKA 4EQ6A 1MJGA 4G0WA 1K08A 1GGNA 4RNCA 2YY5A 3T0GA 3A26A 2RHMA 3G8DA 3QX9A 4IIDA 4DBVO 1X6VA 3AVQA 3PGKA 3GPLA 1J97A 1GQRA 3OZFA 3EX7C 1MC8A 4UE3S 4XUDA 5LIRA 1ZM3A 1W5SA 1V2HE 3BGVA 2WWVD 3UWOA 1F7VA 3K6SB 1WO8A 4KQJA 2QX4A 3JQRA 4MUXA 5MGBA 1C0EA 3SXUB 1MC4A 3B3JA 4LSZA 1KVUA 2VJKA 3WX0A 1ZX1A 1NBHA 2H4WA 4ALMA 2W83A 5DU2A 3EXHB 1M2FA 4LYGA 1YRAA 1PP4A 3O2JA 1NPTO 2ARKA 3OC6A 1JDTA 1SD5A 3EOZA 1UBOS 5E2IA 4KL8S 1M1NB 4G9BA 4QOGA 5L51A 4D0GA 1NQWA 3PPXA 1UBLS 3CX3A 1SBQA 3SC2B 1PG2A 3V8MA 1HEUA 1WPYA 2P1DA 4PHGA 3OUZA 1T24A 1UXKA 3I0ZA 5CGQB 4BCDA 3REQA 1M34E 2OK7A 2ZYAA 3IUJA 4P7BA 4PFSA 2O0HA 1HQDA 1NMYA 3OY7A 2EGUA 3T4UA 1UKAA 2V0CA 5IJ9B 1FTSA 1F1JA 3A1FA 1J56A 4EB3A 3QELB 2M1XA 1J2JA 3IP3A 1U2TA 3DOEA 2QW8A 5JXGA 3ESZA 4RUKA 2DUNA 4GKKB 2E6UX 4L3VA 3F6EX 4JYAB 2G1AA 1JH9A 1CUHA 2HUPA 3WQBA 3MS7A 2F4VB 1KA9H 1OY1A 3NENA 1K89A 2AD5A 3PUVA 3JVUA 3IMFA 2AI3A 1BVYF 1GADO 1OAKA 2W2LA 3EUEA 4WFKA 1LA2A 4TMZA 1PFUA 4C9BA 3U4IA 4NCAA 5DV9A 4FYYA 5EKSA 4CM8A 2IYUA 4AJJA 1EXMA 3ONDA 3FXAA 10MHA 1TZBA 2JK0A 4PX9A 5H3HA 1AMNA 4HSGA 2HKIA 1UC9A 4CG2A 3H2KA 4W99A 5ADHA 2F4NA 5GONA 3MMZA 1P6QA 3QNMA 1AK1A 5JDIC 1DXQA 1KVSA 3Q8WA 2FMXA 5FADA 4CMGA 3EOBI 4MVWA 1UOEA 1QZUA 2NTYC 1DX6A 2AEFA 5CIQA 1LEHA 5E0OA 1PV1A 1WW8A 2ODEA 3ECCA 3K94A 2W42A 1W29A 5JO9A 1DFGA 2YFKA 3DEFA 5HMLA 2FFHA 4C5CA 3S4YA 3GMDA 3VBBA 3HYCA 3CHYA 3T7TA 4C1NA 4BLPA 1KMIY 5DYIA 4DUGA 1H3NA 3GDWA 4FVTA 2RJOA 4EUKA 3T7RA 1L9XA 1YU6A 5KJ6A 1N3LA 1EIYB 2C4HA 2YHIB 4YAKA 4R2JA 1PUXA 3DDWA 4NZMA 2NO1A 1YU9A 3M2TA 2VNJA 1AGXA 1MB3A 1DP4A 1UJ4A 2O52A 2RI0A 3BXPA 2DWOA 1Q19A 3LT4A 1KWKA 2QLLA 4GKBA 1AHHA 3K16A 3LG2A 3LK7A 2HCRA 4KQHA 4RPIA 3WLKX 5LJLA 2FDRA 1Z82A 2Z9BA 2PRIA 3COZA 2X6TA 4I08A 5EHIA 1TYEB 2GNOA 5FPYA 4EMUA 2D4HA 1OXBB 5LOVA 1GFIA 2GK6A 2QTTA 3PFFA 4JN6B 4QJ5A 2XNDA 4L9SA 2BFPA 3P97A 3PPYA 4PSUA 1KIFA 4XVUA 4D4LA 1P7CA 3VJRA 3WR5A 4ND6A 2X5KO 2RH9B 3MPOA 3HKEB 3V4PB 1CZLA 4C0AC 1U3CA 3LXXA 3SP1A 1YVUA 1MIHA 1MAHA 3IAS6 1IZ7A 1Q57A 1F6DA 2Q5IA 4MV1A 1LBIA 3R7AA 3W8RA 5DNCA 4IH1A 5TY0A 1CETA 5I48A 2JGFA 4KYVA 2GH1A 5EJEA 1ZJ6A 4ZGBA 2ZPAA 5D6OA 4E6PA 1TZKA 1RYZA 2E5WA 4U9IS 3LA8A 2JCBA 1LS6A 2FN8A 4R3WA 2V4UA 3RJMA 1JHYA 2YVLA 1K4KA 4TKUB 1O6CA 3OH8A 5CVUA 3RUDA 3WSWA 1RLOA 1JKFA 3ECAA 5A5GA 1JG3A 3USES 5JCJA 4M8IA 4G1CA 2HBYA 4UXJA 2AYZA 1V45E 2O8BB 1JKMA 2ZATA 4X3PA 4C14A 3GMTA 2BSQA 4HAXA 4Q93A 1HTTA 3UWMA 2ZNJA 3KU4A 4UMEA 3ZGVA 4EMTA 4WE3A 1VCHA 2BFFB 5AW3A 3PT5A 2QLJA 2F8LA 3KDPA 4XTWA 2VO1A 3LKDA 3M0EA 1ZGJA 3IIMA 3BL6A 5KVQA 1X8JA 4KR9A 1JEEA 2VTVA 3DVSX 2CVHA 1A98A 1YJAA 4MGKR 4NR0A 4OJMX 5ILOA 4QGGA 2XCTB 4UHBA 4DSNA 2WG2A 4YTEA 4KR7A 4JUCA 3BD7A 3G9ZA 3Q3HA 1QE3A 5FTKA 4OX9B 4GI1A 3AOGA 5EE0A 3M5WA 2I29A 1ZD4A 5A4FS 3BRSA 3FFWA 2JKYA 3SQLA 1XMXA 3QPAA 3NT2A 3OE7D 1SXGA 3TUJC 1YRQA 3LM8A 2OEPA 2XCLA 4H6WA 4RD4A 4G01B 3EY4A 1FFCA 2OFXA 3JX9A 2OV8A 1TVCA 4B7UA 1P7YA 2W48A 4W5OA 2X9LA 2QVBA 4XWOA 1Y7PA 3KX2A 3FNGA 5C37A 1VMIA 5FV7A 1VG0B 3BULA 2ZK7A 3ZQ4A 1X7YB 5CX1A 1ZEJA 4LN1A 1MJHA 1D2HA 4FNOA 1Q17A 4NENA 4DNXA 3LKZA 4HQ0A 1JPUA 1C4WA 1ECLA 2WV9A 3KYCA 3OPMA 3AJ8A 5A4AA 3KAPA 3G0GA 2IYNA 3R4CA 4TLAA 4NBTA 1O6BA 3C8UA 3PUJA 1OILA 4KAXA 4LI3X 1KIMA 7ABPA 4GXTA 1CY8A 3RF6A 1CRQA 1ZC3A 2UAGA 1CHNA 1E3IA 4AY5A 4N40A 3BHIA 1ODCA 4MJLA 1OGJA 1ABFA 2E89A 1JV2B 3DPUA 2WHEA 3IERA 3V34A 3VPXA 3KTAB 5KDLA 4D4HA 3IEMA 2CDNA 2AYXA 2AS0A 4RXUA 2IYEA 3N8GA 5LP1A 3BYZA 2WJAA 1Z2DA 2AFHA 1I6WA 3ZBPA 4NG5A 1PDVA 2XMGA 4FYIA 3IQDB 4I4LA 4OTZA 1XG5A 2XADA 3L0CA 2VH1A 2CNNA 4GI7A 4BUCA 1SCUB 2XQVA 5E6RB 4MSUA 3S1AB 4NYMQ 4JNCA 2ZT7A 5GJVC 4A4DA 5HZGA 1Y8RA 2EYQA 1FQWA 3BGOS 1V41E 1N5KA 5EIEA 3P2IA 1FFDA 1C29B 4LC9A 4CYMA 1YQWA 2JFWA 1DAGA 4LJ7A 3QIVA 2A5DA 3CNOA 3TCXB 1XWWA 4IIXA 1KI2A 1VLHA 4HZUB 1BHJA 2NM0A 2XUKA 4M21A 4AP9A 4DC1A 4FFBA 1PTJA 2DX7A 3T5MA 1NLFA 2E4UA 2QL6A 3LHKA 4JDUA 1Q7GA 3CLSD 3ZJ5A 1WU8A 4YAOA 5KYXB 4IS2A 2A0KA 3Q9UA 1T4CB 3FUXA 4HF7A 4R1PA 5K8UA 3WWCA 5H16A 3QFFA 1ZR2A 4WXRA 3RV3A 3B6ZA 3T9DA 3V1KA 5P8WA 3PEUA 4QGHA 4YLEA 1Q1EA 2ZJYA 3CEHA 2M32A 4BN5A 1Q83A 1S8OA 1XHFA 3C6MA 2QOEA 5CA0A 3K9HA 5IT5A 5L8VA 1ZIPA 2PCJA 2QY6A 2CLMB 1SVWA 3HU5A 2UYQA 4B6JA 1ICIA 1NZFA 1EK0A 1RAHA 2IHKA 2XE8A 3UK6A 4BO3A 2K4MA 4NFLA 1J7KA 3UAVA 5KSZA 4EHNA 2JIRA 1KI7A 1O0BA 721PA 1HNZB 5BWOA 2HT1A 2WFLA 2I76A 2L82A 4CT4B 1GILA 4GM0A 4OO3A 1WZ2A 4LTDA 1EDOA 4X90A 4U9HS 1S1CA 2OHOA 1M10A 1QS0A 2WFMA 2YV4A 1E2PA 1BHSA 2A9PA 1YGPA 1BMTA 1W52X 2VJNA 2XQGA 3PF8A 4COOA 1YK0A 2YWEA 3CS3A 1UBCA 4OYYA 2XKJE 3EFEA 3F4BA 4LE1A 4B80A 2CXTA 4MVJP 4P71A 1G6OA 1U0RA 2QVZX 4N5IX 4BGDA 5IYZF 1CUSA 1TFRA 2F1RA 3A36A 4TMFA 1BVRA 5MN5A 3Q7QA 3FLBA 5B1YA 2R44A 4Q48A 2QMOA 5IXJA 4AH6A 3GC6A 5FTWA 4HWRA 2VQSA 5A05A 1VLMA 3WDLA 5MN6A 3H4IA 2GEBA 4ZCQA 3O8LA 1QFMA 3A4NA 1K6EA 3NP9A 1O5OA 1LI4A 4PQYA 5HJEA 3QVOA 4L8YA 3AVWA 1Z47A 4AZVA 1L3BA 3M6IA 2OBYA 3PWTA 4MP3A 2HK8A 1OIVA 2QHXA 1M8JA 3D59A 1Q95A 1LBHA 4ZVTA 3N75A 4GR4A 3KPJA 4ZO6A 4GFDA 5AJUA 4ZAFA 3A1CA 3RRFA 3IOEA 2VHUA 2CWDA 1C0KA 1E5VA 5KNBA 4FC6A 3N8IA 4N5DA 3O91A 1VZ2A 3F1LA 5G0WA 5HMMA 4YQFA 1YKFA 2GXQA 1K98A 13PKA 1PGQA 1Q91A 4QVIA 2YRWA 3QBJA 4TVOA 4UU1A 2HW8A 3DMTA 1CG6A 1EX7A 1HGXA 2QRKA 3PCTA 4ZOLF 4ENUA 4HYQA 1B74A 1KJZA 1AUPA 3LCMA 1NVDA 1RQNA 2A8YA 3WMFA 2FR0A 4YXWD 4HATA 1XR3A 3FZNA 3USZA 1CV2A 4HRAA 2VUSA 4TSRA 3TTTA 1E61A 1WMBA 3AUTA 2J9FA 4B1FA 2VHEA 4HHEA 4LYDA 5KVCA 3I9V6 4Q4CA 2E41A 1L2TA 2QJRA 4KQGA 1L5NA 4B3FX 2C2BA 3LDUA 4RFLA 1KAOA 3NLLA 4PCAA 3UOGA 2KB0A 2PFSA 3BRCA 3NW9A 4MB6A 2CIMA 5JXWA 4MRPA 3P0EA 5I5GA 4LPSA 2I6XA 2GN4A 3RVOA 3DBRA 4F86A 1CUZA 3BHJA 4XE5A 1EX1A 1Z18A 3ND7A 4Q6WA 3QE2A 1EYZA 3QU7A 1E2EA 1JAHA 3RUCA 3TQSA 3FKQA 3PUXA 2AFIB 3D3KA 2J9XB 3DOFA 2PGLA 2L69A 3ZHRA 2FOXA 1JTEA 1JXMA 3LOQA 3SXPA 1G5IA 2C9BA 3DF9A 3M9LA 3STUA 4DIFA 5C52B 2WD7B 2FY8A 2REQB 4WGFA 3A3PA 1X1RA 2R6HA 2G80A 2YXLA 5L95A 1PK9A 2X9VA 4P5EA 2VVTA 4I99A 5AW7A 4I3FA 1GLVA 1OF1A 4LVOA 4X7MA 1U4OA 3O4FA 4GU5A 1HQKA 3IAUA 5H1YA 2QSZA 3R7BA 4P2BA 4EMSA 1Y6QA 1VKRA 2H06A 2JAOA 4ALKA 1XD2A 2NPOA 4U7DA 1L4HA 2NX2A 5LMCA 3UPUA 3GLFE 2JFQA 2PLWA 2GN8A 3WGYA 4JI3B 1H3EA 2YHSA 4TS9A 1IEVA 2B83A 2IK8A 1II0A 3BZWA 4XIJA 2O2DA 2UZ0A 3K0CA 5DN6A 3U4GA 4JAVC 2Z0MA 3B6MA 6GPBA 2VP5A 1F9AA 2ZZKA 3BXHA 4I7EA 4EW6A 9LDBA 4DMFA 2XGGA 4Q02A 3OJEA 2XRYA 5DM60 1YQXA 2GD6A 5A4IS 1G0OA 4P5DA 3D3EA 4JJEA 3WWEA 4E7PA 2ZTLA 3G6KA 3WYDA 3AH8A 4PHTA 5E6UA 2QTCA 5IX8A 3IOBA 2CL6X 4JYBA 1OYWA 1CZOA 4K9MA 3P1JA 5JD6A 1AQLA 3D4LA 4WZZA 3WLEA 2QY9A 3R9WA 4WL0A 1U11A 2QD5A 2PQMA 4MMYB 5CDHA 3QE3A 4G65A 4MJXA 4XGQA 3RTEA 2EF1A 2O5CA 2NT3A 1T3ZA 2PBLA 2GF9A 4FD2A 3BL5A 4JKOA 4DR3B 4MGIR 1M5UA 3GJQA 4KDCA 4UHJA 3KB2A 1GNSA 3JARA 4INZA 2Z1MA 4NICA 4BS9A 1BBUA 2XI4A 3ASUA 3CXUA 1QFJA 4ZGWA 3VNBA 3JQEA 2WABA 5AVQA 4BEVA 2PO7A 3T7AA 1LBSA 1KORA 4CT0A 3EXAA 1JRLA 1D2GA 2NZJA 4CLXA 2HR1A 2O05A 4J7XA 2OP0A 3LBNA 5JXIA 4IX1A 1TUEA 3R3ZA 2PUFA 3BFPA 1Y8QB 3GFOA 3MXTA 4KLZA 1ZJYA 1JYEA 1B8UA 1LBQA 3PLRA 4V0KA 4YMTA 3BQNB 5JAOA 3QNWA 2P6RA 3E58A 2BEWA 1YZHA 4J4BA 3R9KA 1JIJA 4OA8A 1C9MA 3R5KA 1P62B 5H8WA 3KE9A 2OFFA 1RLIA 4MULA 4G0ZA 2P9YA 3G0IA 2J87A 1B6GA 2F8SA 3V48A 1Z5UA 3UWPA 1YS4A 4I1VA 4D46A 2QHVA 1QUFA 2IUTA 4F3YA 2QVGA 2F00A 1VRVA 2CNWA 2WAMA 5GMOA 2R79A 2RHCA 1RZRA 1MB4A 1JJIA 3DONA 1X7HA 1MBZA 4QARA 1P7ZA 3EJ6A 3MQ4A 4WNAB 4CZ2A 2DSNA 3COSA 3D7LA 4F04A 3KLOA 4C3OB 3T4XA 1C8LA 4PYJA 3DXYA 4P3PA 4L8FA 4WEQA 1YQUA 4CM4B 2QPAA 5FI5A 5IEBA 3HABA 4WLUA 4JJGA 3EGEA 2W2KA 3M9WA 1VYVA 2BZ1A 2WD8A 4LBWA 3LFUA 4RADA 4Z9FA 2QS9A 2O4UX 2KHZA 2OZLB 3ENWA 5CGZA 1KRHA 3NANA 2D0DA 2GMWA 3UCFA 5DFAA 5L3QB 3DMPA 1XI2A 5IWAB 1PZMA 4F84A 4JL5A 3OJWA 2O19A 3G13A 3KCNA 4H35A 4HAVA 5FBQB 3DR3A 1RAGA 2Q4OA 2Q4RA 4MVJG 5KKNB 1JBQA 3DBLB 4Q4AA 4RGBA 1V3UA 2I1QA 2LPMA 3A05A 1BE8A 2PX6A 2C2WA 3D64A 3GRVA 4H6VA 5JAIA 3I5YA 4NF2A 1GLGA 4HN9A 3CNLA 1XRRA 1A8UA 2RARA 1XDBA 3BCHA 1ADBA 2AKYA 2OORA 3AOEC 5ALIA 1TPYA 3TGWA 4EG7A 3R5FA 1HR0B 4RZUA 3REFA 4IQ4A 1SCQA 1XNHA 2JJMA 1R5JA 1QRUA 4GX5A 4WJKB 1ZNZA 4ZRDA 1XKQA 3D4NA 5FPSA 4O63O 3EZFA 4JUDX 4L78A 5I7WA 4EJ6A 3FSRA 4M3NA 3B1JA 4DLUA 3HL0A 3PF9A 4KBYA 4YP1A 3ADCA 1Q0SA 3GWGA 3FFBA 1GR1A 1H2EA 3UWDA 3PNMA 5JAQA 4F5YA 2I2FA 1RE1A 3I58A 1J0XO 1SUIA 1WX1A 1Q92A 4AU1A 4DIOA 4AQ7A 1L8OA 1V3QE 2PLFA 2R7KA 2CXNA 4G0OA 1SPBS 4GL4A 4XIYA 3PD1A 5ALWA 3NHWA 5T6BA 4UD2A 4KDFA 2Q0SA 3W2FA 5F7JA 4D0LB 4TMWA 5G0UA 5CT6A 3ZWMA 1XQ9A 1H5QA 2C1XA 2KWIA 4YMLA 3AKZA 3SC3A 1FFGA 4YCWA 1YS6A 4C3VA 2J85A 3QJGA 4DLVA 4DQUA 2WJHA 2BFDA 2H2WA 2YXNA 2JLBA 1Y6JA 4IRMA 4F6RA 4JI0B 1MZPA 1QKJA 2PPVA 4UCQA 1C1HA 2NSDA 3QVKA 3U09A 1CLEA 1RYHA 2HSEA 2VTBB 3BAZA 4MTCA 1BWSA 2A0XA 3W78A 2ZIXB 4FMCB 5DB4A 3GGPA 2ZRDA 4OQNA 1CQWA 5DTEA 1FFXA 1WBBA 5K0CA 2ZYIA 3TLBA 1U7XA 4XU1A 1IUKA 1L4KA 2VOEA 2FQ1A 3MQFA 1M7BA 1T0IA 4KUHA 1CQXA 1KERA 4LG1A 4WQMA 1E8MA 1TTQB 5BQ5A 5BNFA 3GDHA 2W6PA 3Q2KA 4RVOA 5F5NA 2GPYA 1BJKA 5HP4A 3AVTA 4G4IA 4AXXA 3R5SA 3B1YA 4QIHA 2XB2A 1PL0A 2ZYDA 3DBHB 5ER9A 1H2AS 3O95A 1ZSNA 3UAXA 4P34A 2H5LA 3NJRA 3Q0EA 1WCIB 4OJYA 1LFDB 5B1DA 2IPNA 2G28A 1DOAA 5KB3A 2XYRA 3LBYA 2A59A 1ZFNA 1FFHA 2AQIA 3ZK8A 3PFNA 2PXHA 3C5WP 2NTVA 1NJGA 4GOXA 1ZM4A 2WUGA 3A6PC 7MHTA 1L5ZA 3M6XA 1E7SA 1IZZA 2ZBPA 4M1EA 3VR2A 1HDIA 1IY1A 4HNAB 4LS3A 3K0KA 4OUDB 4IDPA 1LPBB 1I4DD 2SICE 2ZI3A 4MJ3A 3RC9A 1AOXA 2OGZA 1X7GA 3K4HA 3HUDA 4DJEC 3DQQA 3ET5A 3JVVA 1D0IA 4IDDA 3U3JA 4WNCA 5JDIA 1R9MA 2ZI5A 3QQ5A 4FXPA 1FTQA 2VQEB 4JOSA 2WEKA 2I8LA 4LBVA 2VQFB 1W49A 1L7XA 1FCJA 1U1DA 3Q8MA 1NHGA 2DF8A 4E2XA 4OQMA 4OAQA 1FOEB 5U4QA 1QIHA 3I4FA 2GZMA 4IRXA 1MABB 4MWTA 1I3CA 3STYA 2PT6A 1LDNA 3D7KA 1NXTA 2WYWA 3GFQA 4E3ZA 5SY9A 3K6SA 1XZMA 1NXOA 4MPDA 2J5BA 5K8CA 1E2KA 1FU8A 4YY3B 3KUKA 3SXUA 4WX2B 1SA0B 1TM3E 3IDQA 3B2NA 4H7KA 4YJ3F 4PAQA 5ESXA 3EZGA 1PQ4A 2K6GA 4JX8A 3RT7A 5JJBA 4JXZA 5F9FA 5F76A 5JSHA 3L7IA 5KYYB 3JR7A 4I1PA 3EXHA 4TVAA 2XMZA 4RANA 1JG1A 1GP2A 1RKQA 2WHYA 3RKUA 4UFPA 4NDZA 4XVRA 1FVHA 3NATA 1ELOA 2E4XA 2WWXA 4H2XB 1M1NA 1IMOA 3SC2A 1GIAA 1TIBA 3E0XA 2YJNA 1H22A 2FSVC 3TLMA 1ZN9A 1SQFA 2YS6A 1NC3A 4XZ3A 4RPJA 4BJ3A 1FMCA 2COKA 4D4JA 1MNQA 4OHXA 1DRVA 3NRCA 4XW2A 3M4QA 5KU7A 1YR9A 2YDXA 3HA7A 2LR0A 4H6PA 4O4JB 1S2MA 1RPZA 1FLAA 2GA9A 2DUMA 5IJ9A 4KI7A 4P72C 1BOOA 4UEWA 3SLGA 4DV0B 5LN1A 2XBMA 1NXWA 4RK6A 3JRXA 4MPJA 3EQ7A 3MOSA 2QENA 4YASA 4DLKA 1P5HA 4MUIA 3ENZA 1T1SA 2ZITA 3SDBA 3I76A 4MOWA 4O33A 3UICA 5AW4A 1DC8A 4IINA 3KB1A 1BYIA 4TUYF 2WKSA 1KOFA 4FJ1A 1LDYA 3RSSA 4DDMA 2BV3A 2CF6A 3CLRD 4XQGA 3TLCA 1ZH0A 1TU4A 3LRTA 4QICA 4LRQA 4PFJA 2X9QA 2O06A 4HB4A 1PEAA 4KHZA 4TV8F 4ETIA 4F3KA 1YMUA 1D5CA 1LQ2A 3EEFA 4J16C 1VM6A 4QDXA 3KUDA 1FDOA 2VBFA 2GCIA 1L7NA 1PR2A 1ULBA 5AOVA 2X14A 5TPZA 1BIFA 1R4ZA 3FPHA 1PWXA 2JS7A 2PUTA 2QXYA 4I8XA 4RFVA 3GCGA 3T9AA 1ZS9A 3GK3A 3QX3A 2A5FA 1SXJB 3DO6A 3JQCA 3EIXA 3JYPA 1KVQA 4QT4A 3RASA 4CMEC 1WKBA 4JUFA 3UJ7A 1FIUA 4DG8A 2K7ZA 2IS1A 5DRYA 4FN5A 4LKRA 5EZSA 3FRJA 3MSXA 2I33A 4JT2A 4QG3A 1A27A 1MENA 1U2GA 2FXVA 3LW8A 1XZEA 3M4JA 2BY4A 5G3ZA 1MFZA 2BJWA 3IUNA 4GUDA 1ZL0A 2B7BA 4L5BA 1EIYA 1KH2A 3EMVA 3KKPA 4PG6A 2YHIA 3V8BA 1GNVA 5KNDA 1KFCB 1RFGE 2FPUA 4GLOA 1YE3A 3B3FA 3B3AA 3CW8X 3LBIA 3M4XA 3MW8A 3N6RA 4QU5A 4XSGA 2GJ8A 3JWJA 3RQIA 3WICA 1EINA 3OTOB 3JQFC 3DAHA 1DARA 1K7CA 3UMFA 1Z8FA 1WD7A 1QQTA 2WSMA 1X70A 1VE1A 2FPOA 2HQBA 1KY2A 2D5BA 1JLHA 1GPJA 4JYCA 5T6MA 5T4FA 2I71A 1JXQA 2H5EA 1V7QA 2QTZA 3Q5DA 4L3WA 4PSKA 1ZCZA 5CRIA 5LBTA 4CF5A 1G1AA 4RL6A 3VR5H 3FA2A 1Y7HA 1G3MA 5ENDA 4BNVA 4NQZA 3KOYA 2FYTA 1UMBB 1M0TA 3GQBB 3H11B 3VPDA 3HKEA 3VBEA 4B73A 4BQRA 2AR0A 3MZ0A 1JI3A 3T0IA 2JI7A 5CDUA 1AMOA 3ZWOA 5K1ZA 2C04A 3OZBA 4JJKA 3VMMA 4YUZA 3A28A 1YQGA 1FJXA 4MQ4A 1JDJA 4F3TA 2EX0A 1G9XA 5ALQA 4YCBA 3L7CA 4BJ6A 1FP2A 1EZ1A 1LV7A 1USVA 3AG5A 3G17A 3PUHA 4JKIA 4F9GA 2V7QD 2MDTA 4X93A 1LPAB 2DJZA 2H92A 2OD7A 4HRVA 5DX8A 4ETMA 2JLYA 1AC5A 4LF4B 5FTMA 4BBJA 2ZJ1A 2VJOA 4TKUA 4U02A 2FNAA 2X0JA 3ZI4A 2OCIA 2WIGA 4IG9A 4TXHA 2NSLA 2VLBA 2ZWPA 4QU9A 1W25A 2B21A 1R0WA 1PJ3A 2I6FA 3AQ4A 4KO3S 2O8BA 4JGGA 2B78A 5J23A 4ACBA 1EXVA 1DXHA 4YHBA 2GSDA 3QKSB 5G0SA 2BFFA 1K5PA 2Y66A 3I28A 4TXMA 1EK6A 4MQUA 2AI2A 4JUBA 1VGQA 3HBNA 1N1MA 3DNFA 3GRZA 4YRLA 1SY7A 3QO7A 3PQFA 1KTVA 2HNIA 1MQ8B 2OAEA 5FYDA 3PQ3A 3W5IA 1N5DA 3WYCA 2YCBA 3GH3A 5D3ZA 4A7PA 2XEXA 3QO8A 4ZOAA 4QAQA 4U63A 3B82A 4NMMA 4BP9A 1ZGBA 1WUHS 2ZS9A 4V2IA 1Y8ZA 3F5SA 3QU5A 2DPHA 7YASA 1DKLA 2CJAA 2C2OA 3GEHA 3H97A 3P8YA 1BYUA 2X2EA 1PHPA 3T4EA 3WDKA 4ZVVA 3OF3A 1T8UA 3SX0A 4EB6B 3U19A 4I55B 3CE6A 4JNKA 1FVXA 5I6DA 3EF1A 1UXOA 1GCIA 2AXQA 1G20B 3TUPA 2P75A 4P4TA 5E0KB 4IIVA 4KUGA 2ZG6A 1EWKA 3RRZA 4OYRA 3TOSA 1X15A 3NFYA 4ZMBA 2PUHA 1EFVB 3K1AA 1TVKA 1M2HA 1X7YA 4RTOA 2ADOA 4IEFB 4WT7A 3ZDZB 3ZZ0A 4D9NA 1NKVA 3U7FB 1XAHA 1FS4A 1YI0A 4IF4A 1Q0TA 4R3UC 5GQSA 2BUBA 1NIJA 4QECA 4WLOA 5FBRB 2GCGA 5FHRA 3EGVA 1N3IA 1QQBA 3C7KA 3GARA 2IGTA 5B7GA 3AL0C 3ZE6A 4Y2YA 4PM4A 2Q3HA 1Z29A 5IJ0B 1CTQA 3IB3A 3KTAA 3UT5B 1MW9X 3IPLA 4G5SA 1VQ1A 1ZD9A 4MS3B 4XQ0A 4D8VA 2V1XA 1PEDA 3KHTA 3L7MA 3G8AA 4GX2A 2FPWA 2JIZA 1H6AA 3C43A 3KFVA 2W6ID 3RQSA 2WBLC 1SCUA 3QO5A 5E6RA 3IELA 3S1AA 3G82C 2V9PA 3I5AA 3VAYA 1QQAA 4QGAA 4RLSA 5E2AA 2B3TA 4PYRA 5KTMA 1IWBB 4R7ZA 3TQHA 2JGEA 5JOQA 2A92A 2VN8A 1C7JA 2V6BA 3QF4B 4HZUA 3B36A 2Q3CA 2AKWB 4LF5B 2ZWMA 3T5GA 2V3VA 3O9ZA 2ZVQX 5HFJA 1X2EA 4RSMA 3NB0A 1ZNXA 4ZPJA 4RW0A 3OE4A 2ZRAA 2FUEA 3FDZB 1XQ6A 4GVLA 4CIBA 1T4CA 221PA 5KYUB 3OQOA 2O2XA 1L7AA 1R6BX 3LP5A 2WF5A 3V4LA 4MVJD 4F93B 1FSZA 3HC7A 4ZAWA 4RJ2A 1YIOA 1NR5A 2GO1A 2VZ9A 4MRVA 3F73A 1E79D 3WNBA 4WDQA 1N78A 1UPUA 4M86A 2CF5A 3F6SA 2H1HA 1ORDA 1TTPB 2EZ9A 3B9QA 2OB1A 4HDKA 4MIOA 5EYPB 2E5AA 3L93A 2Y92A 2ODQA 4KR0A 2YFQA 2ZDGA 2Q6LA 5GPBA 5THKA 1S7CA 3SM9A 3OBBA 4JI4B 3H0KA 1RVV1 1R0YA 2HJHA 3UGJA 2PX5A 4J1TC 1QRAA 4PHHA 3WB0A 4C4YA 2W71A 2PWAA 2M9MA 3IESA 1FB5A 4LX8A 2ZCEA 3R0JA 1QR6A 2FCAA 4I9FA 5DWDA 1IC6A 1RPJA 3V7NA 4EI7A 1M2OB 5KHOC 3N74A 4NHOA 2UUAB 1ZQ1A 1QVZA 1TJYA 1SUCA 4GBMA 2ZKLA 4YB8A 4KOAA 4ZAZA 1H9CA 5J9FA 2H0AA 4OJQA 1DIGA 3TVDA 3OEYA 3A6DA 5FTNA 1R2QA 1MR3F 3I0MA 1LK0A 1LUAA 2O5EA 2OCXA 4KDEA 1MA3A 1QIFA 2OILA 2XMQA 3CN7A 4FC7A 3M4NA 4G36A 1QJ4A 1OI3A 2OC4A 3PSAA 5E9WA 3R3YA 1EQUA 1OYOA 2X4LA 1TYCA 2CLCX 3L6DA 2QTVB 4YA6A 4HVLA 3HI4A 2AUMA 4ZO8A 4B31A 3X2EA 2A9OA 3D31A 1M6NA 4QYSA 2EIXA 3LDFA 2W7TA 1K7FB 3TGPA 3IP6A 2DH6A 3DCIA 5IHXA 3EFSA 2BI4A 2RHLA 5GV8A 4BJ1A 4YUWA 1RWKA 5EPUA 2AL7A 1GPDG 4I0WB 4JYMA 4PXAA 4PX3A 3S0JA 2G0AA 2W6ZA 2FZ4A 3AFHA 3RGLA 2N1MA 3R6LA 4EG0A 3ABRB 3QG1A 2V0GA 3B85A 4IMIB 2FSIA 1JPVA 1A5ZA 2AG1A 2DWQA 2G7MC 3D2LA 1QRDA 1KYQA 3H2HA 3Q88A 4FFPA 1G4AE 2XUFA 1Y7IA 3PXDA 3NT4A 3WTBA 3IP8A 2WWRA 4FDMA 5TEWA 3PFBA 4RCYA 2DBRA 1NQXA 3CC8A 3DTVD 5AW0A 1JYFA 1G7TA 4J3JA 4BVEA 1VJTA 3EZ6A 2M2IA 3Q6NA 1FSSA 3WNVA 5AM0A 2WW8A 3HTXA 1R0SA 4P74C 2Y0PA 3ASVA 3CPSA 2Y0BA 3LLMA 4MI3A 5HK9A 4BCCA 1XL1A 1ZCJA 3AR4A 3UJNA 2C61A 2A9JA 3GRKA 4G0MA 4XD7D 5A6VA 3X1WA 2O5RA 5CLJA 2J33A 4TN5A 4O2BB 4AMGA 2QT0A 3FAKA 2PX8A 5HM8A 1QANA 3RT9A 4WNYA 1TK3A 1VKHA 1G17A 2VDQB 3DFMA 1DVRA 4FDLA 5FNVF 5L53A 4BAUA 3QWFA 1WYDA 4AWAA 3LUBA 4HAZA 3BILA 2CNDA 2EDCA 4V0RA 4OBWA 3OTGA 4U6QA 4YLGA 3T5AA 1UR5A 1UPCA 1CP2A 3I37X 3FTCA 5A6SB 4QEZA 1RIIA 2K5UA 4X7PA 3RG2A 4OOEA 4TTIA 1QUEA 3KJFA 3RYCB 3P2YA 2AFIA 1G3RA 2NSYA 4F2PA 3NHAA 3L1AA 3Q12A 4Q3BA 2B20A 3SS9X 1LI7A 2PL3A 5FUVA 4B5LA 3GFPA 3CPJB 1NAHA 2WD7A 2ZIVB 3EVFA 3Q6MA 4LY3A 3QI2A 3F2VA 4V1CB 3R9XB 4DPGA 4L4XA 1IJEA 2G25A 2HPVA 2PZMA 1V9LA 2WLTA 2CD7A 3CJRA 3GLHA 3IQXA 4WFIA 5FBWB 1ZU4A 3CZPA 1KMMA 2JARA 1A9OA 2NQ8A 4J94A 4OHMA 1E62A 4TM7A 2EJUA 1ZN8A 2CFOA 2XA2A 5ICEA 3V7RA 1FXSA 1U0TA 2J3EA 3O1LA 3ONVA 3OPYB 2IQ5A 4INPA 3WNDA 4PRZA 3CVJA 4D5GA 2XQFA 2VPPA 3PJFA 2AK2A 5D3MB 1OPRA 1Z7WA 2H7VA 4QVKA 4TLDA 5KI6A 4DJDC 4DQ2A 1PJSA 1Y33E 3TTYA 3DO5A 1OV4A 4DMLA 3U7IA 2C88A 3T7CA 5I7FA 3SHOA 3KYBA 3WGTA 3PVSA 4WZBB 5CNIA 1UK7A 2I4MA 1IHYA 5DYTA 5FLEX 4C0XA 4HNUA 5CMLA 3PG5A 1NJ6A 1IHXA 1ONPA 4MMXB 1A2BA 5AJXA 4Z4CA 4S12A 3AOEA 1D2AA 4C6RA 1X1QA 2GB4A 4J0GA 2IS2A 3IO3A 4WTOA 4H0NA 1XEWY 3G2PA 1AB6A 3ZWYA 2B4QA 2BFEB 3DEHA 1E6KA 2H1RA 2WTXA 3SY8A 3RSQA 5JO0A 2ECFA 1S3GA 1XMJA 3HG7A 4TTPA 2SKCA 2WU1A 3HM2A 1JX6A 2OMKA 1PYSB 2JPDA 4CDNA 1N33B 2EBUA 4FFRA 2G9VA 1RI1A 1QG4A 2C1EA 5MF6A 1HWYA 1Y9EA 4QDTA 5ESWA 3S81A 3S8EA 3AB3A 1LS1A 2QTMA 4Q3CA 3MN1A 4DR7B 1Q20A 4MH0R 4U2KA 2X7HA 1RABA 2WC1A 2G63A 1P2UA 1VB3A 5B1IA 3FD8A 1EDBA 1Y8QA 3HFZB 4HB2A 1U4NA 5FT9A 3T61A 4BKOA 4NC9A 4RMNA 4FNAA 4HGYA 2IHTA 4YFVA 1XXLA 3PIRA 3VTFA 1XO1A 1L4MA 1ST2A 2XTNA 4YUYA 3OIGA 2JCGA 4HVCA 1X7ZB 4CKWB 3TPCA 4LVLA 1XTUA 3FCCA 3G9UA 4IDHA 3IQIX 1WSWA 2QYOA 2OCKA 1QH9A 1T2AA 4P4GA 2P4EA 2ZIZA 4K9PA 4R69A 4FGSA 2O0JA 4EYEA 3JQ6A 3ERCA 4WNAA 3WA7A 1O9GA 4BP3A 3VGPA 2H48A 2I2XB 4CFZA 1FDIA 2Y1WA 3WLPA 1P2VA 2O6LA 3RRJA 4CM4A 1GSIA 4GGMX 3D6MA 3ZW9A 4MV8A 4KBGA 2V7PA 4ZEOA 2IITA 4QOEA 2M6LA 1G19A 4LVCA 4BWVA 3A2MA 3CKYA 2OZLA 2DQ3A 3PL5A 4ONEA 5L3QA 1GPBA 1QKIA 1V39A 1NRXA 1ZNQO 2R7NA 4JP1A 4LZOA 5DBHX 5DH9A 5DHSA 1SVNA 1XN1A 4FFSA 1X7WB 4BKUA 4OX9Y 1EFWA 4HEA6 4F60A 2OVFA 4L4RA 2C4KA 3NWBA 2AZXA 1P7PA 1J23A 1YC2A 2QVYX 3DBLA 5GM2A 1VE9A 3VYRB 4AURA 3GZ4A 2XVAA 3FTPA 3IB6A 3RK1A 4ZCMA 1FYWA 2C57A 2YDYA 3L7JA 2MCFA 4DS3A 2ZJ2A 4OQQA 2ILTA 4UOQA 5E38A 1QVAA 3RYTC 4ZI2A 2UUBB 2FVXA 1PTKA 2BKLA 1NRIA 2OV6A 4G5QA 2VLIA 2Q28A 2Q50A 4UC0A 5ILQA 1N9ZA 1TYZA 1M8FA 4DV5B 5DNWA 4KN9S 2QR5A 2OWDA 3AVPA 4M0MA 2EW8A 3NQ41 4ZT3A 1SFRA 2Z83A 4PBSA 4FFOA 1H2ZA 4RFSB 4NOKA 1LV8A 1Q84A 2VUTA 1FP6A 4XEHA 3W90A 4BEWA 2ZJOA 3JQQA 2LCFA 4MQ6A 4NYJR 5JRZA 1ULTA 2XCSB 4KQCA 4UCXA 4Y6PA 3AW8A 4IICA 5JU6A 4HWGA 4OF4A 2Z09A 3CLUC 4C30A 1NUAA 1X1BA 3AX6A 5H5JA 2JLQA 3ELUA 3CW2A 4XARA 1KRXA 1XMVA 1UAAA 1YZGA 1U2RA 1DAMA 1GYRA 3T5BA 3BWVA 5F77A 3OY2A 4IO0A 1B1AA 2IXGA 3STXA 2FP3A 1TLLA 4AZWA 1E1RA 1M34A 2X1LA 4GYKA 3NWEA 5JZOA 2MWMA 4BHTA 4PO3X 2R5NA 2VPYA 2ZRFA 4MKGA 3JZMA 1K6JA 3KP1A 2Q6IA 3RB8A 1ISIA 2CDRA 2ZSEA 2A2ZA 3K0HA 1H2XA 2OAP1 5GAJA 3WV4A 3R8FA 2UU9B 2FSVA 4EG3A 2XE4A 1Y9ZA 2VTBA 1QWOA 3LTEA 4K9QA 4UNNA 3WQSB 4B83A 4PNEA 3QLTA 3MCWA 4MCHA 1QF6A 5E4YA 3ABZA 2QSUA 2ZIXA 1AKUA 4FIZA 4BYGA 3G1TA 3A14A 2PSDA 1F14A 2UKDA 4EZBA 2WDZA 2G9QA 1ZMOA 3SLKA 4RZ2A 3KKZA 4PR3A 1YRWA 4G41A 5GY7A 1YQTA 2AR9A 4P72A 3ME5A 3TL3A 2ZSIA 4YALA 1PI3A 3FNIA 5AVUA 2NADA 2LW7A 1MOQA 4F4UA 2XD9A 3WLNA 1CVIA 5KCMA 4FHCA 5H9VA 1ZI6A 5C8YF 4BLSA 1CY1A 1MOPA 1U8YA 2N47A 3DBHA 2GJKA 4NBLA 5CIWA 5D85A 3ZW8A 1WCIA 1O5TA 2H2DA 3ROFA 1VDZA 4HVTA 4X54A 2DQSA 5TT1A 1ZQ9A 1BD4A 1QONA 4US2R 3I83A 1QM5A 5JY6A 4J7CA 2GYWA 3DLBA 3DDHA 5AKLA 4M9CA 3HYRA 3PP8A 3VNRA 1DWUA 4J16A 3CB2A 3HY3A 2HF8A 3KPUA 4HNAA 1GITA 1H8HD 1H2RS 2QIOA 4IKEA 3RVNA 3MBKA 2W6JD 3FVVA 1RI5A 4Q7MB 1ACMA 1PT6A 1U5CA 1F48A 2J8ZA 1F51E 2ZBDA 2HWKA 3TCNA 1W19A 1Z4LA 3B53X 1OA0A 4JJ7A 4Q9DA 1IG3A 4KVZA 1U6JA 2WM2A 4D43A 4F91B 1FY2A 4Q3LA 1K5GA 2HEIA 3N7UA 3RTDA 4CMEA 2EBHX 4HLUC 4L0QA 4DMRA 1OW3B 4WVLA 2A9RA 1PCXA 3VTAA 1VP9A 1MABA 5DP1A 3GA0A 1EUDB 1BQ4A 1G38A 2LXNA 3BT7A 2HPAA 5KOIA 2I2AA 1GRQA 3RD5A 4LFCB 1M66A 1ZW1A 4NU0A 1RDFA 2RHWA 1SA0A 4JKYA 4QRIA 4V38A 5DCYA 1SMKA 5K9ZA 2DYKA 2HIMA 3HA2A 1Y80A 2Y4NA 2K2QB 4MLZA 3TSCA 4K05A 4BV8A 3JQFA 2Q0XA 2H52A 5KYYA 2ALYB 3BE6A 4CQLB 2FE1A 3HBMA 2V7VA 3UMCA 2EATA 4QT0A 1UJBA 2AI1A 2WNHA 1SHZA 4DR4B 4H2XA 1V9SA 5JJ5A 2G4VA 3K9NA 2PUGA 2X2OA 1TAGA 3PGMA 4XYMA 3WJ1A 2QMEA 4O2DA 5A3RA 1CC1S 1DBVO 1X9GA 4KXWA 5IM4A 1ISGA 2H3HA 1EEHA 1RIQA 2BE9A 5FCDA 5HZKA 4JCCA 1EK1A 3BSSA 3P9SA 3C8ZA 3WJAA 4O2RA 5K0TA 3DFKA 2Y1OA 4GOMD 1E58A 1RTTA 5B4VA 2HMVA 3B1ZA 3EZ7A 1XVIA 3M4YA 3PHIA 3Q87B 4UUNA 4ZT4A 4B2LA 1M6EX 3S8YA 5GJBA 4RKRA 2XRZA 5LL6P 3GFRA 4LOKA 2C5GA 3C16C 2D7DA 2LUOA 3UAWA 4MS1B 4A1FA 1JE0A 4I2VA 5TMBA 3I01A 3NKVA 1KTIA 1JZSA 4ZEMA 4X3OA 1JHRA 4TZTA 2R25B 4UTZA 3MJ4A 1XOIA 1S8FA 1U9IC 3EVZA 4YDHB 2IY8A 2V6IA 1PJ4A 4UU8A 3UC5A 3ULKA 1MJ5A 3R1IA 3DAPA 5ALUA 2RH5A 3OECA 3AUJB 3D6FA 3TD6A 5LU9A 1C3OA 2OCAA 5DDIP 4AY4A 5FKJA 2BAGA 1C9DB 3LVRE 5HDQA 5IBRA 4MYDA 4O29A 3F7MA 3CVXA 4DV6B 5ALKA 1NURA 5AXBA 3KJHA 3HYSA 1DC6A 2H18A 2ZRJA 2COEA 5EJAA 3UK1A 3AM3A 4KXNA 4FSHA 3OX3A 3WL5A 2AYYA 5SZKB 3T12A 2UUCB 1CDEA 3UNXA 2E87A 1VZ3A 2QUKA 1SXJA 1USWA 2OC9A 1ICEA 2PRJA 1WCXA 1XCJA 1MT3A 1YB3A 2UXBB 2QLTA 3NDBB 4X7BA 4HADA 3EVEA 3BTVA 3BKXA 1WKCA 4HB0A 4KXYA 2O3QA 1G8YA 3K1YA 4NOMA 1F60A 1WULS 3HMKA 3I9JA 5IW8A 4WZAB 4EUHA 1KRWA 1Q22A 1VE7A 3A1TA 4P86A 1AURA 4I36A 4LE0A 4MZXA 2V65A 3ONEA 1OSNA 4N8DA 4QUAA 3GFVA 5CG1A 2FPRA 1N32B 4MPPA 3W3SA 2WJYA 2NZWA 3H5LA 3IAM6 3A9SA 2IUSA 4RZQA 1KGSA 3HVHA 3JQ7B 5JT1A 1QHGA 4GICA 4BFVA 3E9HA 3NBAA 2QRPA 4QPDA 4NONA 4DZTA 1N2SA 3OHMA 2Z9DA 1L7PA 3NH6A 4H3VA 4BFWA 3J81k 4CS3A 1RM5A 1ODJA 2APJA 3ZZ1A 2C5EA 2N3ZA 4HDRB 4AJ2A 3J7AC 5AESA 3GLIE 1XQYA 3QPBA 1UMBA 2CDCA 3GQBA 1RRVA 2BEUB 3EWSA 3H11A 3LHFA 3N39C 4IV5A 3QPWA 2MTBA 1FTGA 4ZK6A 4D82A 1L7RA 3IXQA 4XX1A 4L50A 3H2BA 2EG5A 2CNLA 1P4HA 1QQ6A 3D8NA 2FFJA 3NC1C 1XTKA 1YDWA 1Q7EA 2IUYA 2W6NA 2GK4A 2BCEA 2Z57A 3LD9A 1FW8A 3Q3IA 3T5CA 4TVBA 5DEOA 1Z5GA 4QM7A 2G70A 4JLMA 5E6SA 2VP4A 3M34A 4QLOA 1QFYA 2IXBA 3AHEA 5ECWA 4AKTA 5ECGC 3WADA 2BD0A 4L73A 3CTPA