2G4CA

Crystal structure of human dna polymerase gamma accessory subunit
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
420
structure length
397
Chain Sequence
SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel processive mechanism for DNA synthesis revealed by structure, modeling and mutagenesis of the accessory subunit of human mitochondrial DNA polymerase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DNA polymerase gamma subunit 2
total genus 100
structure length 397
sequence length 420
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2g4cA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 2g4cA02
3V7CA 1BBWA 1ADYA 4EX5A 1H4QA 2ARSA 3E9IA 2I4NA 3P8TA 1H4SA 2ZR3A 4CS3A 3QNEA 2E5AA 4RQEA 2DJZA 4XTVA 4UP9A 3RIRA 2G4CA 2E1HA 1YFTA 3VQYA 2ZT6A 4XTUA 4UP8A 4HWPA 3HXYA 5KNNA 3HXWA 1QE0A 3V7RA 2ZZFA 4P72C 4RMFA 4CH6A 1B7YA 4NCXA 1JJCA 1W66A 4H2UA 2Q7GA 5E3IA 2E41A 2E10A 2CJAA 4P73C 1E24A 3L4GA 2ARUA 4H2WA 3QTCA 5F5WA 1PYSA 3IKLA 1SRYA 12ASA 2CIMA 1Z7MA 4OP0A 4CH3A 4KR2A 3VQVA 1HTTA 1G5IA 2QHTA 1E1OA 2RHSB 1Z7NA 2ZXFA 2ZT5A 3FJPA 2CGHA 2DTIA 1H4TA 1WQWA 2ZTGA 3EFSA 3LSQA 3NETA 1NJ8A 4H2XB 3REUA 3VQXA 4YREA 4EO4A 4YROA 3HXVA 2E64A 3REXA 3QO5A 2I4OA 1WU7A 2EJ9A 2ARTA 3IKMB 1ASYA 4L87A 1X2GA 1HXDA 1WYDA 1X01A 4J15A 3HY1A 4PHCA 4TVAA 4K88A 1USYA 4HWTA 5ELNA 1NYQA 4Q6GA 1NJ1A 1B7YB 2DDZA 4YCWA 11ASA 4CH4A 3V8LA 1EVLA 4HWSA 4XEMA 2DKGA 1X54A 3A7RA 1WLEA 3A7UA 4DQ2A 3UH0A 2ZGWA 5C51B 2E3CA 2Q7HA 3PZCA 3TEGA 2DQ0A 4CH5A 2ZIMA 4TQDA 2QHVA 3EFRA 4TTVA 2ODRC 3KFUA 2ALYA 5HGQA 4YRMA 1HC7A 3A7AA 2FYKA 3V8KA 1EIYB 4X5OA 4XU3A 3G1ZA 4K87A 3TEHB 1ADJA 4G85A 4YRRA 4TWAA 4YRIA 1ASZA 4P74C 3RUXA 4BW9A 4RQFA 3P8YA 3HFZA 3BJUA 3ERRA 2LW7A 3L1AA 2DZ9A 4YRJA 4H2YA 4XTXA 1G51A 2EWNA 4H2VA 3NENA 2DXUA 2EJFA 2ZNIA 2Q5IA 1YGBA 4KQEA 4YRPA 1B76A 3CMQA 2IY5B 2CJ9A 2DTHA 3HTZA 4P75C 2PMEA 2ALYB 2HNIA 4YRFA 3RKXA 4YYEA 1KMMA 4YRKA 3V8JA 1E22A 1C0AA 3TEHA 2J3MA 1EIYA 1J5WA 1KMNA 1WQ7A 3A31A 1WNLA 2RHQB 3RKYA 1B70A 3UFGA 4YRLA 4YDQA 4XU0A 4ZTUB 1BIBA 3E9HA 1NJ6A 4XEOA 4P75A 3LC0A 4P74A 4AH6A 2E65A 4XTZA 3HRKA 2I4MA 4YCVA 2DEQA 2AKWA 4WJ3M 1V95A 2Q5HA 2CJBA 2P0LA 4H2TA 3RF1A 1BBUA 3A5ZA 3HXUA 2XTIA 2P5IA 2AMCB 2ZT7A 1EFWA 4XTWA 4UPAA 2RHQA 2C8MA 1B8AA 3BFMA 1NJ2A 5K1XA 1YFSA 1ATIA 2DU7A 4XU1A 2DU5A 2XGTA 3HRIA 4HVCA 2IY5A 2QHUA 3OD1A 1NNHA 4ZIBA 3HFZB 4XTYA 4TVYA 4CS2A 4H2XA 4BWAA 3QO8A 1QF6A 3V7SA 1KOGA 3DSQA 2EL9A 4PG3A 3VBBA 3RKWA 5ELOA 1E1TA 2EJGA 1SETA 4WI1A 3UGTA 2RHSA 4TQFA 4P3PA 1N9WA 4H02A 3HFVA 3R07A 3W3SA 4P3NA 2DVEA 3NEMA 4YRQA 2DZCA 2Q7EA 1PYSB 1BIAA 2QHSA 4YCUA 3A74A 1G5HA 2DXTA 4HWOA 3TUPA 4XU2A 4O2DA 3VQWA 1SERA 3A5YA 3QO7A 4HWRA 1X2HA 1USYC 1L0WA 3HXZA 3UGQA 4YRCA 3IG2A 2PMFA 1IL2A 1WPYA 1VQZA 3P8VA 3M4PA 1EQRA 4WF2A 2ZIOA 4P71A 2EAYA 4G84A 4P72A 4DPGA 3M4QA 1B70B 4YPFA 3WQZA 1NYRA 2DQ3A 3RGLA 1NJ5A 4YP0A 3LSSA 3PCOB 1EVKA 3IALA 4KR3A 2ZT8A 4P3OA 4YRGA 2J3LA 2ZNJA 4TVAB 4OLFA 5C52B 4YRNA 4HA8A 1H4VB 1X56A 3ICAA 3A32A 4CS4A 2DTOA 5K1PA 4P71C 5C53B 4H2SA 3I7FA 1LYLA 3MF2A 4E51A 3NELA 1SESA 4TVWA 4WJ4A 2ODRD 4LNSA 1YFRA 4P73A 3RL6A 2AMCA 4Q15A 4ZTZB 1YB3A 2ZCEA 3L2ZA 3MF1A 2ZINA 2ZZEA 3HY0A 3MEYA 4YRTA 3RACA 1JJCB 3HXXA 2AKWB 4UP7A 4K86A 3PCOA 2ZR2A 4RDXA 1FYFA 1EOVA 3L4GB 1X55A 2I4LA 2ZZGA 4YRSA 2C7IA 1GGMA 1RIQA
chains in the Genus database with same CATH superfamily
2LP4Y 2AOXA 3KHUA 3L41A 4FLEA 2QP9X 5I7SA 2HT1A 2RG7A 1CLUA 3NGMA 3BTSA 3GLHB 3OJFA 3E9IA 1XZIA 4O8CA 1APBA 2VVTA 1TOAA 4BO4A 4CHTA 2ARKA 4HUQB 1AUVA 2BEVA 4EX6A 2FKAA 3P8TA 2J0UB 2OE2A 2BF7A 3P71T 2NMVA 3SR0A 4X65B 5KVAA 3TD9A 1YFJA 3EXEA 3IL2A 4ARUA 2HA3A 1SH7A 4D4JA 2Z43A 3PPWA 1RWPA 3OJEA 3OIGA 4LRSB 4MQMA 2ZUBA 3EHDA 1D2MA 3LX8A 3ZV7A 5C1DA 2DJIA 3TFOA 4NENB 2A78A 4D2IA 2GPYA 2H4XA 2PANA 2QL7A 4K9RA 5JDIC 1EVIA 1OYVA 1UJ6A 3GCGA 4HWPA 3GVPA 4GE3A 1PR3A 2FSPA 4WMLA 3SBEA 4UOZA 3ZW7A 2H5IA 3OQ1A 2RB4A 2IYWA 1N2ZA 1GVNB 3P9CA 5H5JA 3PL5A 4L9AA 4RIIA 3KC2A 4CF6A 1OXUA 3EUAA 3H5OA 4U9IS 5H0IA 2WNSA 2D2IA 2AB0A 3I4LA 3DEYX 3MOGA 5DBIA 3VSAA 3AONB 3E53A 2X40A 5M3BA 1K7XB 5C8XA 1Y6GA 2CHVA 4QWMA 2V96A 3EARA 2X0NA 5FA5A 5KX5A 4DDVA 2FPOA 1EPUA 2A59A 3WICA 4A82A 4CDGA 1X9GA 2P35A 1TM1E 1X7WA 1OR8A 2OBBA 4QQKA 1D09A 1Z0AA 3V8EA 5CBKA 1GDTA 4LDZA 3GEBA 1OXSC 1MQAA 1XZGA 3KEQA 4IOJA 4L3WA 5MFPA 1P73A 3COWA 1SVWA 2E4XA 2BR5A 5ALNA 4WX2B 4Y6LA 1XYVA 2CD7A 3RQIA 1E1CB 3WK5A 2PKYX 3AFMA 1GV1A 2J3IA 4A1FA 4Z53A 3HXOA 3H9BA 2QHTA 3QHQA 4N18A 4Y6GB 2EFHB 1YB4A 2XQFA 4JLOA 4FHZA 3OFKA 4JJGA 4ZREA 4RJTA 4K6MA 2QM3A 1QCYA 1ZI6A 5KQPA 1CSEE 4HN2A 3GRUA 4Z4GA 3VNSA 4ZALA 2CGHA 3LF2A 3NPMA 2Z4TA 2Z9DA 4JAVC 4P4NA 4X1YA 1GVHA 2PU5A 3L84A 1IL0A 1HLDA 4FNGA 4MV7A 4Q4CA 1YO6A 3DO8A 4NE9A 3DXFA 5LUBA 2Q9AA 3IAS1 1EZZA 4UOQA 1XDZA 2A6PA 5JZBA 3OX4A 2IP1A 3ER8A 4BNHA 4XB6B 5GGXA 3JD2A 2O7QA 4G1BA 4L3VA 2AQKA 2CKDA 3U09A 3WMXA 2WNHA 3ZIDA 1YIOA 3L7IA 1VE5A 2AV6A 2GSWA 2NT4A 4RE5A 2IYVA 3GLVA 1TZJA 4EVSA 2XTAA 2CLMB 2ZRDA 4TRRA 1RADA 3OETA 4TV9A 5EA2A 4LGCA 2DPYA 1AC5A 1G7CA 1MXHA 2GK3A 1D2NA 2XKAA 3RADC 1PN3A 5K6TA 2YRXA 3HY6A 2X5XA 5H81A 2WJ3A 4JP2A 2GF2A 4NE7A 2B69A 1FP4B 4TS4A 1NR5A 4CRWB 3OM8A 1VYTA 2V8BA 5BSVA 3OOWA 2GD0A 3GT3A 4L87A 2E2WA 3ITEA 4ZPJA 1T6NA 3KRTA 1M74A 4FBLA 5C37A 2UYHA 3M3HA 3Q3GE 2QORA 1WP4A 4HDRA 1CNMA 5CLJA 5KC8A 3CISA 2XAUA 2JLZA 4G0VA 5H4GA 1E5XA 4NY1A 2DH5A 3GUZA 4TVAA 5L8VA 2E37A 2ZETA 2VXBA 3QUAA 4PX3A 1RAFA 2AR7A 2NVOA 1AQIA 1YJAA 3MB8A 1NUTA 3PKZA 3H05A 5HJEA 4WCFB 3AVVA 3AVUA 2JFYA 5AHRA 2XB8A 1A2QA 3DMDA 3U3ZA 1GG2A 2C2MA 1RBZA 3N8NA 3VPCA 3WIOA 1K3UB 2GB4A 3H1FA 2AI1A 3ZWVA 4AM8A 5K9ZA 2P2CA 1FQJA 1IK4A 1WX1A 1M1XB 4G56A 3UUEA 4CNQA 1JWLA 2Q49A 5LXTF 1ZM7A 4CUKA 4FONA 4JJZA 3A7RA 5TQJA 1WLEA 4RMJA 1JEQB 2OG2A 1K08A 4AZVA 4POOA 5GZ6A 3H9JA 1R3UA 1E1RD 3TLZA 1QK5A 1Y1LA 1YOVB 2WW8A 2GZDA 4OPMA 1QFZA 2BIFA 3WC4A 4MA5A 3HYTA 4XOIA 4Y2XA 4AJLA 2OXCA 2ZTVA 3QV2A 5LKRA 1MNAA 3FZGA 3TZ6A 1XNQB 5L3QA 4UU1A 1SM4A 2QD3A 4LECA 5LQRA 1ECBA 2QMUA 2V3VA 3P20A 1THGA 1UPAA 3KDAA 3L0PA 1GU0A 2IDKA 4O4IB 4OYLA 2ILVA 5KTNA 4AKIA 3ZHQA 4Q82A 1MTZA 4E5VA 2FMUA 2WOOA 4E11A 4UMEA 4UCXA 5KKAA 2IPMA 1GUAA 2JHCA 3DT9A 4FFVA 4OXYA 3SQMA 3U81A 4AZTA 3F78A 1EIYB 2AG1A 5FPQA 3U7IA 1TE2A 5EESA 5BQPA 4WHMA 1RIFA 1T34A 5FL3A 5JQGA 1VL1A 5TPZA 2H52A 3P9NA 1Z0JA 1JQ3A 1IUOA 2X9GA 4AUMA 3U6KA 1PBTA 1GGKA 2P69A 3A36A 4HQLA 2HKIA 5BVGB 1J24A 4MQ4A 2EVWX 4MV9A 3R9XB 1JKJA 5E3JA 5AVWA 2VNSA 2OMEA 2PGOA 2XWJI 3RYHA 5LFAA 3JQ9A 1UKEA 2I4RA 2ZTLA 3DNFA 2D59A 5DHSA 4RWEA 2AN9A 4HUTA 7ABPA 2JHAA 4QGHA 1AQ6A 4R1LA 5IASA 1QF9A 3HPQA 2G9ZA 1M67A 3FLMA 2JKYA 1KGDA 2I7DA 1XSEA 3QI7A 2PUBA 4LQLA 1ZOPA 5EGSA 1NW8A 1ZVJA 2JLBA 4NJEB 1IN4A 5F98A 2XNDA 1AA9A 3JWGA 3LZDA 2OBNA 4MQEA 4KXMA 1IWBB 1P2TA 3EF0A 4IDQA 4D0GA 4JBXA 2WPDD 3LHIA 3KAQA 4I3FA 1MVOA 4JLVA 2FU5C 2GS9A 2IEIA 1G0OA 3D7NA 1ANKA 5D6OA 3UWMA 1ZR4A 1RE1A 4GI7A 1RIIA 2L2QA 3IB6A 3LPLA 4TYQA 4DMLA 2WAAA 2O52A 1YB6A 2W6OA 4QTZA 5JI3E 4CMBA 3DBHB 4G5RA 1XQVA 1R50A 3CG4A 5DLQC 3L6BA 1ZONA 3ZKAA 5JJ5A 2YMQA 2OC9A 4Q7KA 3L8FA 1IYZA 4D46A 1XTQA 2GPBA 1UBGA 3ELUA 4LOJA 5ALIA 3IE0A 4MHTA 4WNYA 3I4CA 1KSJA 2AZDA 3Q7SA 4KQGA 1FY2A 2J4DA 1YBAA 3DCYA 4CLXA 5BWLA 4YRLA 4LA4A 1U2SA 2OLKA 1N2BA 3ESZA 3EQ6A 4JT2A 2XCUA 2R6GA 4W9RA 1XHEA 3IHWA 3VDXA 5I51A 1J5XA 1SKYE 1E7SA 1Q0QA 2OBLA 4ZYXA 3BN3A 2QY6A 1BDIA 3C4QA 1ZK3A 3RFXA 1QCCA 4UEQA 2PN1A 3U9TA 1NVAA 1NYTA 1DEOA 3EVFA 5ICFA 3RBZA 3ROFA 1NVXQ 4DEYA 4M7WA 1I3MA 3SMQA 4XIYA 2Z2XA 1PZNA 3HUDA 3NDRA 4OJMX 1R15A 1KFEB 1NSFA 3G13A 3R3VA 4BMSA 1IWPB 4AZ3B 1DBRA 1QV6A 1C0IA 1HTBA 2CLKB 2HMSA 3N1UA 3VX4A 3WJ1A 4YCVA 1A9XB 4CIDA 4Z1MD 5A4MS 1QE3A 2JCGA 1S8NA 5ENZA 2GT1A 2DEQA 4ZT4A 4C4AA 1FXSA 1U2QA 1ZG3A 5JAIA 1G20B 2C77A 3EXHA 3GDFA 1T9DA 4LGYA 1KVSA 3PRJA 4FHCA 7MDHA 4YAEA 1VSQA 3QJYA 1R8SA 4G86A 2XJ9A 1LQTA 3LQQA 2DBQA 2CNDA 1RTKA 4B46A 4C7BA 5CFRA 5EJ9A 4YMLA 2DUWA 4UE3S 4EVRA 3EVAA 1YS9A 1T4DA 1X2EA 5K05A 1ZUIA 1JSXA 1X86B 2IUSA 3BVPA 4X92A 1NNLA 3EYAA 4AJIA 5KOYA 4QM7A 4CG3A 3DW3X 4QOSA 4CEHB 2HA6A 3KJZA 5GGYA 2IOFA 4DCJA 4C21A 4DIMA 4KX3A 4YP9A 2OGSA 3AQ4A 1NW9B 1E9FA 5FX2A 2G1AA 4MVYA 4MYUA 5IVHA 4JK3A 3ZGLA 2UXDB 5LQJA 3GYGA 3I1JA 2YYZA 4PZCA 5K3FA 1LLFA 1YFSA 2L17A 3X3HA 2QM8A 1ZA2A 4N0EA 5JCPA 1W5AA 3DL2A 3PNOA 4YJ3B 2PUWA 4FGWA 1BTOA 1Z68A 5FO0A 5GONA 1T4CA 1P7CA 3JQBA 2B20A 5LM3A 1GTRA 4OLAA 4OHMA 2J9ZB 4L4SA 4C04A 4ZIBA 1KAHA 3OPMA 3N3AC 3L04A 4LHXA 2VYFA 2ECOA 4YLGA 2IU0A 4ZIRB 3GDGA 1G98A 3N59A 4HB0A 4IOLA 4GX0A 3ML1A 3A1FA 4LJ6A 4O3FA 2VWHA 3DZHA 1H65A 4DSZA 1IAVA 4YBZA 4NCHA 1KQPA 2VJDA 2HLNA 1B2LA 1RKXA 3A05A 1YS4A 3SHWA 5EJIA 1OX4B 3HJNA 3AV3A 4LXXA 1XXHE 2X41A 5KKCA 4KLCA 2I67A 5K4AA 5GP1A 2PUCA 1FJGB 4UUNA 2O8EB 3VZBA 4RH0A 1GKKA 1J07A 1THMA 2PRZA 3ESCA 1CF2O 2WYOA 3MJEA 5C4GB 2QUAA 3JALB 2XNHA 1YQTA 1C3OA 3CRZA 2P7HA 3K0EA 4LEIA 3T5MA 821PA 1CJKC 3E9RA 1ZKMA 4H17A 2VT2A 5JH7F 3QFRA 4J0FA 1CB7A 5DOZA 3VU9A 1QHNA 5DHFA 2WYIA 2O8EA 4XRGA 3DFKA 3C85A 2WMDA 1CE8A 5HVNA 3DC2A 3EZGA 1QIEA 3I61A 1MOQA 5UKDA 2VP2A 3JQFC 4QTTB 4BFYA 4KPEC 1SVLA 2YXNA 3QUQA 4MVJF 1YQXA 5JS2A 4QXMA 1JR2A 1SVMA 2BFWA 2O06A 3BWCA 4KLZA 3CH5A 4MRPA 4R84A 5E9AA 3O8LA 2HRRA 5GMOA 1D2EA 1SO8A 2A14A 3C14C 2BFCA 5GQSA 5DYIA 2QVZX 4X6UA 5KWVA 1GZHB 4BVEA 3S81A 4PNPA 3Q8LA 2A9PA 1ZGGA 3PSAA 4PFSA 4PFKA 4CM5A 2ZJ2A 3K70D 2WM2A 4KSYA 3WK8A 4EY6A 1UMBA 3GLUA 4XYMA 3EMKA 3KFVA 1Z6PA 3MCAA 1I2ZA 1E3QA 1ZK1A 3S68A 3HEMA 2XWPA 4XU2A 2QPOA 4WVLA 2IS2A 4M7PA 2GFIA 3RRZA 5FRDA 4CFZA 1NOIA 3P0JA 2ZKIA 2H85A 3C5HA 2Q21A 2X5NA 1FX0B 3FZNA 4D9JA 4EG7A 5BSHA 4W1RA 3AHJA 3QNMA 4TWRA 4DUYB 1FNSA 1C9KA 1OW3B 3PGKA 1DB3A 3WB9A 1Z5NA 2K6GA 4A4DA 4YO7A 3U40A 2PSSA 5EIOA 2VAPA 3GF4A 3CW2A 5WRFA 3KXLA 1JR3E 5AW3A 4RPJA 4CGYA 3F9IA 2PNJA 2YXBA 4MA4A 1XPJA 3H75A 3GRAA 4BNIA 2BCEA 2QGNA 3AQIA 4NAVA 5EIFA 2XV1A 3PQFA 5AVJA 1GARA 1ZR2A 2BF4A 4GF5A 3NYRA 1F0NA 2VK1A 1B6GA 2XNDD 3HCBA 3R7NA 3WBJA 1PCXA 1NR1A 2PWBA 2V7UA 1J33A 3GLFE 1QM5A 4P1ZA 2VTBA 1GZ4A 1RQLA 3BEOA 3NZEA 1LPMA 1WKCA 4B8YA 2ZRAA 3SQXA 1VIAA 4J03A 3TSWA 2BGMA 4WKBA 2O3JA 3O75A 1DHRA 1BJTA 3PUJA 4R69A 2ZAYA 5CNJA 3X2FA 3WQZA 4JLMA 4KQFA 1LPNA 3L8ZA 2DQ3A 2PS1A 3VVBA 2E89A 3JD0A 4BYGA 1SU6A 1GM5A 2HGZA 2VEDA 3CX8A 4U5QA 3FCAA 4F46A 4P3XA 4A5OA 6ADHA 4NCAA 2ECQA 2WEKA 1EVKA 3IUNA 4HS9A 4MMXB 1MRNA 1WZNA 2F9LA 2QUBA 2FK8A 2FKNA 3AX6A 2EW8A 3B12A 4UNNA 3UXHA 4L0CA 2MOKA 4UNRA 1DELA 1TCVA 4CZ2A 3PK0A 5AUQA 5CBPA 4K5QA 1U0RA 2NZYA 4UE2A 3INRA 2C7PA 1T4CB 2XGOA 3D5EA 4J1TA 1MO5A 2XNKA 3UIEA 4HMPA 1PFVA 1L5YA 1SIWA 3LQKA 3ER6A 2CUTA 4I8XA 3VOAA 4B43A 3IRVA 2GPAA 1XNJA 3ONEA 3WL6A 3C3YA 3ZOZA 5GONF 3MT0A 4Q9KA 3UBTA 5FHQA 2R1TB 4UHFA 1DJNA 2WTBA 1YAHA 2VT7A 2XYGA 4EIWA 2DERA 5TQ0B 2FTKE 4NJOA 4L07A 4GVXA 1LWNA 3AUJB 4LYJA 4DV0B 4B6PA 2BFDB 1JXOA 4FNOA 1OUMA 3PPXA 3P2OA 4UBNA 2IYFA 5EWLB 3L2ZA 5T4FA 5A6SA 3PQ4A 3R0QA 1D4ZA 1FS5A 3LQ1A 1HEIA 3RACA 2OCDA 3R3YA 4XUEA 5HF8A 3T7SA 4AYXA 1U0LA 2JGDA 1T26A 1XTVA 4RHFA 2XMGA 4QJIA 4E70A 1NQUA 3PNPA 4BJ6A 3WZLA 4AG6A 1MH9A 1OHHD 3GUUA 4YHBA 3AUFA 1R0RE 1YQUA 2X0KA 4IJ6A 4YJKA 5K7SA 4L9WA 1TCAA 1ESMA 2JCXA 3R1IA 2XB2A 3AC0A 2FRDC 3DM5A 4MWGA 1E6LA 2J5KA 3V1NA 1CY7A 1OA1A 2QN6A 3I58A 1MG5A 1BYIA 3OSUA 1BDJA 1ECGA 4KG7A 2ZRLA 3E4CA 2C9BA 2XUQA 4E5UA 1M2OA 5CDYA 5DYTA 5AVVA 1GYPA 3COSA 1KR2A 1ADYA 1CS0B 1DEXA 3ET4A 1FRQA 4R1SA 3CTPA 4YPOA 4U6NA 5CXSA 1JTFA 5FTLA 4KV9A 4IZ6A 2BFEA 5HA5A 3A2KA 4QHYA 3H0EA 3E9NA 3VU3A 2P11A 3AO0B 4FX2A 5THXA 1HT2E 5JJCA 4CMAA 3G0OA 1GTJ1 4LZOA 2IEYA 4UM8B 4UP9A 3W0LB 2EAUA 3E2PA 4E88A 4G89A 4X97A 2ZM5A 4Z7QB 4HGOA 5KREA 1PNVA 1QGDA 3AM5A 3HXYA 4EMUA 5I5EA 5SZHB 3C5CA 1S6YA 1DTWA 1JXAA 4LHVA 2RCNA 2EZ8A 1B7YA 3CU5A 3TRDA 2FGKA 3KQLA 1VZ2A 1GLVA 2C9YA 3IP9A 1VSVA 4OFBA 1EWYA 3D0QA 3TBFA 1QBKC 3NHKA 3TG2A 2JI9A 3AJRA 2CJAA 1QVWA 3UG7A 2BFCB 1XG5A 2OVBA 3X1XA 3O2SB 3CNLA 4CTMA 1JFSA 1FNCA 2ASVA 3GJ5A 3ZDCA 1V16A 3GB9A 2DC1A 3IQIX 4AWAA 4WD3A 3ZZTA 1JQBA 2CK3A 2L19A 1J21A 2VDNB 2VF5X 2J3EA 12ASA 4MOWA 5TSDA 2CE2X 4A91A 2AI3A 5TV2A 2C95A 1QCZA 4EECA 3PUIA 4ENSA 5ED0A 1G8AA 3VXKA 4HDQB 1DMRA 3KYDA 1CEXA 2RHBA 2YS6A 1LBHA 1HSOA 1Q7RA 5TPWA 1E1OA 2BCGY 3QYJA 4C6RA 2PBZA 2HI0A 4P4SB 4CM9A 1PJSA 3NTUA 4HDMA 1O77A 2A9RA 1T8RA 2XVAA 1WPGA 1NQAO 1ZL2A 4UAGA 2ZXFA 4LK3A 3ICQB 3VNUA 2G09A 3D81A 2NSDA 3VJRA 3BK7A 2VZ9A 5EG5A 1KH3A 2IYNA 3OIUA 4F6RB 1IBMB 1OFGA 5TT1A 4NZ9A 1URPA 1W88B 4A27A 1XU7A 2HYDA 1H2RS 2D7CA 3KJIA 2N0SA 2DY1A 3QVGA 3LT0A 3A1CA 2H0RA 4JI3B 1N3YA 2PUDA 1QMPA 5DIZA 3MIZA 3OF2A 1T0HB 3HFSA 2NTJA 3I76A 3ZW9A 1JDZA 1P2GA 3MLEA 1R5JA 3DR3A 4N01A 1XDDA 4MRRA 4OP1A 3ECAA 1IMOA 1EM6A 2QPTA 2X15A 3Q9UA 4WZAE 3UJ8A 2P4HX 5AICA 4TKVA 4DSOA 4TZTA 1JG6A 1XIVA 2IOHA 3CB4A 4ZV7A 3VR5H 5K6RA 1YF3A 3NBXX 2D2VA 4KN6A 3BT7A 3VPGA 2C4NA 2HRCA 4MP8A 4X00A 4D9HA 1R0YA 4J0EA 2P1DA 1DXOA 2XKJE 1XDSA 1A88A 3N0VA 1SZJG 4MP3A 3UKJA 2ABWA 2XGGA 2ZXEA 3COZA 3RVJA 2FPGA 4EY7A 1DBPA 4P32A 4R2WA 4EY3A 2R0QC 2W6MA 3IAEA 3BTVA 5E95A 3TCNA 1XBTA 4E2YA 5JY1A 2QD2A 1HXDA 4MUFA 2UDPA 1P9OA 3Q4GA 3B7GA 1PLLA 1XAGA 1VGVA 1W94A 3CV3A 3D4PA 3LX5A 3ASVA 2G06A 4Q12A 4QPNA 4WK6A 5EPEA 4K88A 3C48A 1UZAA 3FCCA 1G5PA 2K5UA 2EBFX 1ZK0A 1KZ6A 1BJRE 2X14A 5F52A 3D8BA 3U3JA 2XKBA 2YXLA 5G4LA 1QP4A 5FUWA 3OCXA 5F4ZA 3MWKA 1E2GA 3TFWA 1YOVA 2C5LA 4EG5A 4YMVA 3QEMB 1XDWA 3RU7A 3UCEA 3VNVA 2JNWA 4D3XA 5KNBD 2G67A 5BV0A 4Q7EA 4WESA 4HK4A 3V8LA 3EEOA 1YQGA 4LDRA 1PD1A 3EVCA 3FPHA 2G17A 2DKGA 2W2TA 3NBZC 4PG4A 3PSHA 4U2KA 3O4IA 4TLBA 1YE3A 3G0DA 4QC2A 4YIKA 5J4KA 5A1TA 1NUHA 3CJQA 2F9FA 2IEGA 1W47A 1C9DB 3CLTC 1NZDA 1POXA 5DE3A 3AF2A 4CE6A 4KQKA 4OQZA 2BDEA 3VYWA 1XAIA 4W1PA 2WU8A 3TG8A 4J4BA 1N36B 3UV3A 2E4UA 3ERCA 4S2UA 2IU6A 2GN0A 3HJGA 5GVSA 4CFYA 1YFKA 2BR4A 2B4RO 3RIMA 2SHKA 4OXIA 2WP0A 4LFBB 1N3BA 2C5FA 2WUFA 5AP9A 4OLJA 2F55A 3EGXA 1KDRA 1JAHA 1XCPA 2XEDA 4RIHA 4PZEA 4B6SA 1VPVA 2X58A 1V7PC 4ZPXA 4OJQA 1XCMA 3CT6A 4ZVOA 3RD5A 3PNKA 4IS3A 3MFYA 2HHLA 1RPAA 5E38A 4JC4A 1MC8A 4ON9A 1P0IA 2B4TO 4ZU3A 3VOBA 1DIBA 3LCMA 5FBKA 3S6JA 1KR5A 1FQOA 2ZDGA 4QOEA 3TMAA 5DYGA 3ZWOA 5DASA 4OREX 1T8PA 5A5EA 4ZC8A 2V9CA 3F4BA 1CUIA 5KJEA 1F38A 4C03A 1G8PA 3CKKA 4ZCTA 1Q0RA 4FWTA 4RGQA 3HFZA 1BS2A 1XTIA 1ZCZA 5TC4A 3LD9A 4LJ8A 4U2FA 4FR5A 3V4ZA 5FNVB 1KTIA 2IBMA 1VLQA 3PICA 1SVOA 2Q3JA 3FB4A 4MQEB 1FUKA 3RE1A 4D8XA 5BYAA 5ADVA 5K8LA 1OY1A 1J0BA 1M8JA 1R0SA 5F21A 1NOKA 1RM3A 2AVNA 3IJPA 3QBVA 4UQOA 1AMNA 3NM6B 1SA0A 3E22B 5DNCA 1GLGA 4MVJA 4INAA 5AW7A 3AUUA 5IDYA 1ZO8A 1A9XA 1NUPA 3DL7A 3HUTA 3RANA 5KS2A 2YWFA 1S2LA 1H2ZA 2R87A 2WVHA 2K7ZA 2W71A 1V11B 1PGOA 1X7YB 4KI0A 4LOLA 2ALYB 2H2AA 2P6RA 3EW7A 4BLSA 2C9CA 3K0BA 1YC2A 3AHCA 1DRJA 1OILA 4U4AA 3U4HA 5BYJA 5M7EA 3C8HA 3CLSD 1I4EB 1Q50A 2EZ9A 2HMTA 4HSEA 1Z4LA 4LNHA 1KXJA 4LY0A 4Y1RA 2Y4OA 5AVTA 5HM8A 3KQPA 1WMDA 2V7BA 2JAOA 3D8NA 1KMNA 1W8IA 3L0DA 1Z74A 2OBMA 2FRXA 1B8PA 4LMRA 5DK4A 5JALA 2OCGA 5J1TB 4B40A 4GI1A 4YQZA 5BUCA 3CNNA 3TUZC 3UFGA 2E18A 3EIHA 2O6HA 1Z35A 4LBVA 4EFKA 3CGGA 4HVLA 3JZMA 2FFBA 2GZSA 1ZH0A 1YZVA 2OHJA 4Q1EA 4D42A 3KFXA 3K70C 1OF1A 1KAQA 1M1YB 1WEKA 2O1WA 4OI1A 4BVAA 1K66A 2MSKA 5EWJB 1OYOA 2B8EA 1G6KA 1LPOA 1UANA 5AKXA 5KAMA 1NJ6A 4AXXA 4JT4A 3L40A 3ZLUA 3LC0A 4LF5B 5F3WB 4IRUB 3UK2A 1VIDA 4EJFA 4K2HA 3KOYA 3OJLA 3TSZA 2PZEA 3DYVA 1GZ7A 2CHFA 3I83A 4UM7A 5IYZF 4AZWA 2F8MA 3HUFA 3S1SA 1U7DA 2AQHA 1DWUA 3DW1X 1XFAA 2G28A 2ZUTA 4NMHA 1Y6ZA 1U2GA 4GPAA 1VYVA 4QQRA 2XAAA 1PHRA 2HN9A 4IIJB 3PFGA 4KPUB 3RPEA 5EI5A 4MPRA 1S89A 1S4QA 4MUAA 4TLLB 3WRYA 1R0XA 5TMEA 1R6VA 5JAHA 1O9HA 3HR7A 1I14A 3G2LA 1BEUB 1ZYUA 2EF0A 3AIIA 2VP3A 1XE3A 4H1HA 4NCIA 2VOEA 4IIHA 4X1YB 3QU7A 3BULA 1XQYA 1G8MA 1YVUA 2P5IA 1FFWA 2DFLA 3CSSA 4MDFA 4JEUA 1QDUA 1DAHA 4UPAA 4AJNA 3LOPA 4DZRA 4FX5A 5CDUA 2J67A 2YV4A 1Z6TA 3C1AA 4B9AA 4KCGA 4IDDA 4C6HA 1PSZA 1WIWA 3QKSB 1D7AA 1VYUA 3H5RA 4BLUA 1JQEA 2E3JA 3GH1A 4FTWA 3NBUA 3N07A 2Q3BA 2J8ZA 3X1MA 1A69A 2BWJA 1UFOA 2VZ0A 2TECE 1ATIA 5KDOA 4RV5A 1FVHA 4BMPB 5ALYA 2AWOA 1C8KA 1B43A 3IUBA 3OA2A 1PTJA 1NONA 3OPXA 4H7DA 3UCXA 1HFWA 4HYEA 2IY5A 4ND4A 3SFTA 4LKOA 2BDUA 4O4LA 1KEVA 1WHSB 4WEOA 4WZAA 3HFZB 2A57A 4QGSA 4B3XA 4EGFA 2WTMA 1DAPA 4BWAA 10MHA 3FKSD 4M76B 3Q8XB 1L4EA 4L5AA 1ZVKA 3JV7A 4QICA 1I10A 1P17A 4MV0A 3WKCA 4KP7A 4I7EA 4MUEA 3PFCA 3IAUA 4G5HA 4AMGA 3G02A 2OWDA 4PBSA 3RKWA 4V2IA 5C1IA 2CNWA 3B2NA 2ZRHA 5B1IA 5TRTA 3RS4A 2M6SA 2PL3A 4EGSA 2EKZA 5AQEA 1E3SA 3GDOA 1KS2A 3WGVA 4OB6A 3NOQA 3VYSB 5T3YA 5TE9A 3QEOA 4PHTA 3AF5A 3KLMX 1Q20A 1JG1A 1EP2B 2DYKA 3AVOA 3SE0A 3UA4A 3WKDA 3FLBA 4HHEA 2YWXA 1EGQA 4Q1FA 2B8TA 2DPMA 4OEHA 4P3PA 4ETWA 3NO4A 4IV0A 1B3BA 3RHFA 4TZ6A 4CIXA 4V0SA 1GQSA 1Y1RA 3V7NA 3W3SA 4Q93A 5J59A 3HYSA 1K4MA 3VI3B 3HKCA 4F38A 2RJOA 2JI6A 5HIJA 3ZYCA 2ZZMA 4Y18A 3PJDA 3QKRB 3QIAA 3ZNQA 4D9KA 8AT1A 2AYZA 1ZCBA 2OCXA 2YWJA 4RC9A 2I66A 5AW1A 2GM5A 2C20A 2XT6A 2CGEA 1DV2A 1E7YA 1JYSA 1SCUA 1TTHA 2AG5A 3OZEA 3WNZA 4E22A 3H99A 3PX7A 4Y6SA 3ZHVA 3WAKA 4O0MA 3L6CA 2A5LA 1ZW1A 2JLWA 3G7NA 4L22A 3QXSA 1RD4A 4IDEA 2V5VA 3GBVA 1T1RA 4TROA 2JCSA 4CMEC 4WLNA 2H7YA 5MFZA 3H9QA 1E0KA 4JVOA 4BE7B 1U8UA 1I2CA 4OSEA 1A9ZA 4PNZA 4URVR 4BZZA 4C6TB 3CWZA 2WAMA 2MR5A 4CMJA 1NL3A 3ZD7A 1GZVA 3IAHA 1C29B 2PGNA 4GBJA 3RUEA 4QXQA 4OA8A 3ED1A 5JAUA 4TUYA 1USYC 4KNWA 2O4CA 3AJEA 1QE5A 3CNOA 4DT1A 2JDID 4E09A 1T24A 2FQWA 3AR9A 4OJYA 1A8SA 3QVTA 1EP1B 2G9VA 4PZDA 2FPGB 2Z3WA 2WIGA 3DFMA 3MT7A 3T61A 3M6FA 1XTKA 1XMJA 3DQPA 4MIOA 1T3TA 4GD3Q 3BQNB 4RMNA 3U80A 4M37A 2HF7A 3UFXA 1ISIA 2FOXA 2B6HA 4HRVA 3RK0A 9LDBA 3WWOA 4K9MA 3OIWA 4K9SA 4QJ4A 4Z4HA 4I5IA 3EQZA 1EXVA 4L8GA 1B70B 1VA5A 1W4LA 2CMFA 4MR7B 4L16A 2OCPA 3TTYA 1QRTA 5LYJB 2Z58A 5IMBA 3PGMA 4YASA 2NU8B 4OKIA 1QVVA 4M83A 1QIDA 1UXGA 4W8OA 2C9OA 2ZDQA 3PHIA 5C8ZA 3W5BA 2GXAA 1XR3A 4PQYA 1IOLA 1ZUD1 2WKWA 3GAFA 3SI7A 4CL0A 4V1CB 4UEJA 4JITA 1CKEA 1UM8A 3JWPA 1GL3A 3K4PA 5EJMA 1LJUA 2Q2OA 4PNHA 5FI3A 4EZIA 5DM2A 4XQ0A 3B1KA 3ZU6A 1P7PA 2UZAA 4DCCA 1RYBA 4IJWA 5KYWA 2XDQB 5DNYB 2JLVA 2NGRA 4CJXA 1KJZA 1XRMA 1H4VB 1UINA 3EN0A 5KTPA 3E81A 3RSFA 1G3MA 2W6CX 5F51A 1L7RA 2WQZA 1GDDA 3ET5A 5C53B 4ZOAA 3KZKA 3RYIB 4EZBA 2PT5A 2G3YA 2WI8A 3RBVA 2C61A 3KVVA 3UJ9A 4U0KA 1E0JA 4OYHA 3REFA 4L95C 3OLCX 2HIGA 3HDHA 4QT0A 2Z9BA 4R8SA 1XAJA 1CTQA 4R4JA 5CGZA 4WERA 3KD3A 2YNMA 1JJIA 2J9GA 2ZSKA 3DDNA 4KIUA 4DN6A 4FFBA 1LUAA 2ATVA 4NG4A 4ADSG 1AO3A 3VH3A 1RLTA 1FUEA 2GM9A 2OCBA 2R7KA 3CEJA 3QPAA 4EHKA 5KQGA 2XZOA 5EZ6B 1EAMA 1OROA 3R8XA 1Z18A 3BXXA 5ALQA 3F1LA 4N7RA 1XQ6A 4QRHA 3FRHA 1HFJA 1C1YA 2FSVA 2PKXA 5CHYA 2CDCA 4EKYA 4W5TA 2MJLA 1WQ3A 1LLQA 1SIBE 2DWPA 4H7EA 3BRQA 5DBHX 5EHGA 3TLEA 2PU7A 1EOVA 2Q6TA 4PR0A 4B3BA 3NIFB 1KI3A 1A7AA 2EX1A 3DVAA 4CLEA 4F4HA 1M5RA 1DRUA 3RTBA 3QKWA 2H07A 3QWHA 3T5GA 5LMZA 4HQ6A 4R6WA 2VJPA 4HLCA 4ZVPA 1GGMA 3UJHA 4OJTA 4DAEA 3BSFA 1WXXA 1MOZA 5BORA 2V3WA 4BNWA 4DDKA 1R5NA 4RA6A 2WSSD 4EX5A 3WRYC 5LJLA 3FOEC 5B36A 1EJ6A 3PX2A 3T06B 4BMNA 2P5TB 5HIAA 1WM1A 4BLRA 3WA6A 1SVUA 1PZXA 5JCOA 1EE9A 4B1FA 1C8VB 1QZ3A 1E6KA 4JP5A 4XARA 1T5LA 2QTZA 3N3BC 3OT1A 4IIJF 1EH5A 1EUYA 3W8EA 1ID8A 3AZOA 4WN3A 1HURA 1OXVA 2ZI4A 2NZ2A 2QROA 3DL0A 3TQSA 4EI2A 4LHEA 3SC2B 3BZBA 2Q3HA 1GUFA 2QUIA 3EDOA 3GDWA 3NWOA 3GPBA 4X20B 3Q7RA 3LU1A 3E03A 3OZSA 4XTUA 4KO8A 1QYVA 3C98A 2O2SA 3FKSA 4FMBB 3A25A 1M2VB 3KLBA 4QFBA 4RL4A 1Q3KA 4A0RA 2YIMA 2GI4A 2ACEA 5KPJA 3M8KA 4R41A 3K1AB 1C2TA 3MWFA 1QGZA 1PV4A 3WL3A 2OCAA 3V97A 1K7FB 1U7ZA 4MW2A 2CNWD 1GFWA 4TL8A 2X4LA 4O08A 3UXYA 5AKHA 2YJ6A 3RFUA 4UMVA 3WKEA 1Z3CA 2D3WA 3O1JC 3UJ7A 2EWWA 4FYHA 1GTG1 2VNHA 4KDEA 4DRZA 5JMWA 1HPLA 1PYSA 3CUEF 5ECGC 3EOAI 3TLJA 3I52A 5BQ5A 2QVBA 1ZBQA 3SDBA 3ZCXA 2A33A 2BCJQ 2ZSFA 4U9HS 2XGSA 2MDTA 3ENQA 3K35A 3PYLA 1H2FA 4Q5IA 2BUBA 1SR8A 2PUJA 4LHSA 3WK4A 1B23P 3NS7A 4DB4A 3L2OB 3WS7A 5GZ3A 2YYSA 1T6ZA 1RZVA 4WSOA 1CZNA 2VP0A 1BN7A 4HGPA 4DYDA 4ER5A 1KP3A 2AUNA 4HDAA 3U1VA 5FWYA 1P1KA 2A5JA 3GG9A 3HCFA 5I9IA 1T8UA 3A6LA 3AR3A 4FCTA 4N5IX 1YI0A 5E1MA 3RVBA 2PD4A 1ENYA 4BP1A 3LBIA 1IVSA 1K27A 1YRQA 2A0XA 2FW1A 1J70A 2Y05A 4OQXA 1LGYA 5M29A 3CEHA 4LJ7A 3RS7A 1R27A 2M1XA 1WB5A 2QT0A 1ZJ6A 3BIOA 5J5AA 4ZV4A 1HETA 1XHFA 4J1QA 3QY9A 3DOHA 3KQUA 2O14A 1GEEA 3CINA 1A27A 1UF9A 2PZFA 3FYUA 3QOFA 3QVMA 4HWKA 4Y98A 3RQSA 2AGVA 2ZITA 3RYIA 4C78A 4NS4A 2QL6A 1PF7E 2IQIA 4H2XB 1JIVA 2PO5A 5EHQA 4YONB 4AT1A 1RQGA 1FE8A 3A4MA 4AJ9A 2WMYA 4JI4B 5IBQA 3GLFA 2RJ3A 3DE6X 3NASA 1U1DA 2IUTA 5H1YA 4X85A 2BJVA 2OCIA 2V5UA 1N0IA 2JJ1A 2G1UA 3U44B 5E9JA 1B14A 3BERA 2BUAA 2HK7A 3CE6A 3NRBA 4I50A 3K31A 4ZVKA 1Q84A 3CRQA 1KU0A 4MCHA 1RHMA 4MV4A 3REXA 4R9RA 1N5JA 4ZAZA 4RTJA 2RHJA 1PL7A 1K3FA 1S2OA 4NBNA 4CCYB 4UTRA 3PUZA 5EJ4A 3BH0A 5JSQA 4PEVA 3H1PA 1LXCA 1UWVA 4IJMA 2ZJ0A 4LVMA 1XQ1A 4B5KA 1HX7A 1T2VA 3AUXA 3S7ZA 4ARIA 3DKVA 4QPJC 1NWCA 3AUAA 4GI5A 4RM2A 1BMQA 2P7IA 4EEKA 4P58A 4R8KA 5FI1B 2YFQA 1V48A 2JD1A 3MUOA 1JSRA 3F6PA 1NX9A 1K86A 2J0SA 5JSHA 3PDUA 5DBFA 3I6QA 5AQ1A 1XA3A 2I87A 2CT8A 2X1VA 4XPIB 5I3ZA 4JOQA 1L7MA 1YHYA 2UVPA 3R23A 4GWLA 5GJCA 4RA6B 1GUBA 1KMHB 2QRPA 1DMSA 1P0PA 4PX2A 3VZQA 1MPTA 2R48A 4ABTA 1RM0A 3IAM6 4ZCSA 4Z2AA 5AOVA 2C1ZA 5JYDA 2Z6AA 3CKMA 4XEMA 1KF0A 2RHTA 1JF8A 3HI4A 2IRWA 1TMOA 2SCUB 1BWQA 4LC9A 5KSYA 4PRZA 2YICA 4K9PA 3EWSA 3W8NA 4CKBB 1EUQA 1MORA 5GVRA 5H68A 3H87A 4NV3A 4EQZA 3MTDA 4UBKA 1K7YA 3V4RA 2H1SA 4EFLA 4YR9A 4BUZA 2P90A 3DQZA 1YB7A 1ULUA 3E7PA 1S7CA 1XOIA 3RUCA 4Y6OA 4IHQA 3UAXA 3IDAA 1JG2A 1G2PA 3BCHA 3I8SA 3TXAA 4XDZA 4YJ3F 4DOMA 4UHBA 4MUMA 5CEEA 1QQ6A 3VR4A 1W36C 1EJBA 2WJWA 3BH6A 1QTRA 2IYLD 4V0OA 1D2CA 2I22A 4KQCA 1QK3A 1ZNZA 3NBAA 1U9YA 5ENDA 4YRMA 3CZPA 3T52A 3TTXA 1AMUA 1RXWA 1VBMA 4X64B 3W5JA 2J5XA 4TXMA 1G6OA 3WBBA 1X39A 2QTFA 2RBKA 3OP1A 1ADCA 1REQA 4RJJA 3IBSA 2DU8A 2RHWA 4QX6A 3VC3A 3I5YA 1BHO1 2OORC 2D0DA 5BR8B 1H1DA 1NW6A 3LUKA 3ABIA 4MUGA 4BVBA 3NM5A 3LQYA 4YAIA 4FEGA 3VM6A 5LIRA 5F9HA 4ZYVA 1ARZA 2Z5VA 4BFXA 4G8BA 4MVJH 4LZNA 4C01A 1GNPA 5A0VA 1MGOA 1QRSA 5DBOA 3ABOB 3BJIC 1J39A 3HJBA 1RYHA 2JJ2A 1W30A 3T3MB 2X7JA 3R0VA 4TZ0A 3PUKA 2BMVA 3N2LA 3FKJA 2Z0MA 3BJRA 4G1UC 5AVQA 4ZODA 1V5EA 4LHZA 2MYUA 4BFTA 1XUOA 2A5FA 2G4VA 2YN0A 4F86A 2V7XA 2FMIA 4H1VA 3QBJA 4RUKA 4Z7NB 3NRJA 3WTBA 1LD3A 1R4NA 3HU1A 3O6VA 3ND9A 4IJUA 2ZS8A 4ZT6A 3TECE 1OTHA 4D98A 2VUTA 2A58A 2Q6KA 3DFIA 1H3NA 2HWWA 3KZXA 1FYVA 3AM1A 2IH2A 2HEGA 2ZJ6A 4AVYA 4BN4A 2CJ9A 1XD2A 1YUNA 3GZNB 4HPJB 3WXBA 2O8CA 2O7SA 3HTZA 2V7PA 4QOGA 1TO6A 1AGRA 1UAGA 3RF6A 1L7QA 4O2LA 4CMKA 3H8VA 4BFCA 4EUFA 1Q3TA 4F2WA 2IOFK 3WKAA 2ZIUB 4EH1A 4HT3B 1ZVVA 1PV1A 1JYFA 3LY7A 3L7NA 3B2QA 3HKEB 3VO9A 4MP6A 1DIOB 1YAJA 3W79A 3M9WA 2I8AA 3NMUF 3I09A 3O2NA 4ZK6A 4UUOA 3RC9A 1T9KA 1L4KA 1Y7TA 3DZKA 4HH1A 4RAOA 3FUCA 2VSFA 3H5AA 5E7MA 2II6A 2DLCX 5DCWA 5JE8A 2VRCD 4HDCA 4BXOB 4JLAA 4RHXA 2PYIA 3U1TA 3WYCA 3UGKA 3N28A 2R3SA 2BBTA 1KI6B 3I01M 4YMWA 4YDSA 2WT4A 3TFQA 4CF4A 1C1XB 2EW2A 1E2JA 3RSZA 5B55A 1XMOB 5IJ0B 4C0BA 1T3SA 3NANA 3SDSA 3JCZA 1IK6A 1ZMTA 2OENG 2OBXA 3RFFA 2W6ID 4B71A 4EG1A 3KKMA 2QTLA 4P75A 1LNSA 5HDQA 4XFDA 4GZLA 2ODEA 3A9SA 5DMHA 3S55A 4GOLD 5AMXA 1HKHA 2XUIA 3EHEA 5J2TF 4MDEA 1TJNA 2ZREA 3QXJA 5F64A 4QL3A 3K5PA 4RORA 4O3MA 4B3JA 4EYGA 3GCZA 2GAOA 2YASA 3CLSC 4JUIA 4YBRA 3T9BA 5CFLA 2UYQA 4CM4B 4IV5A 4LYYA 2JIZA 3A11A 4OFXA 1WG8A 5H9VA 2ZR7A 2I7XA 3N2KB 4MQFA 2ANBA 2E6KA 4JU9A 4L0DA 3IUEA 1R00A 1QTNA 4D4LA 5B1EA 2PEYA 1IN7A 2OGTA 4LK2A 2P2GA 3W1EA 4AKSA 3PFWO 1VE7A 2PGAA 1T0PA 4JP1A 1R0WA 4ARCA 1M54A 2BI7A 3TL2A 3HXUA 1QORA 5TQVA 2JZOA 1O5IA 1T1JA 3OMWA 2NACA 4I4TF 4B6RA 5JD4A 1PDWA 4US2R 1DXYA 2FPSA 1YONA 1CR1A 1O96A 3WGYA 5KHLB 1L5OA 2Q0QA 3CF2A 3OTGA 1K3TA 4MLCA 1SCAA 3TGWA 3V2IA 4QBHA 4B3CA 3VNBA 4DLRA 1E77A 2C8MA 4CCAA 4UVEA 1Q44A 4LRQA 4YCAA 2HCFA 2QDKA 3R5JA 5ICCA 5JRZA 3I42A 5IMSA 4KR7A 5DEOA 3IEVA 5EMNA 4PC1A 5K1XA 2AX4A 1LW6E 3OIFA 2NVUA 3SEZA 3TTTA 3V32A 3KE8A 5IS2A 2Q2NA 5BRNA 5BPHA 3AB7A 4JX8A 4P4LA 4Y2GA 3LVRE 3RIHA 3MW8A 3IELA 8ADHA 1RYZA 5I7VA 2BJHA 4HDOB 1HRKA 2QT1A 3ZTTA 4HY3A 2GVZC 4B73A 3T3EA 3WQQA 1E3JA 1TI7A 2HIHA 1YWGO 2G71A 3IDQA 3NNSA 4YUWA 4WK4B 2Z83A 5JADA 3HM9A 4ZWNA 3E8SA 4FCVA 3H0KA 3H4TA 3KZVA 5BO5A 1FFGA 1GXSA 1OU0A 1H6AA 2GNPA 4UHEA 3GV0A 2P9QA 1O3YA 1SOUA 1UT8A 1XRRA 3OEWA 5IT5A 4U6QA 4EOGA 2QTWB 3OJ0A 1S3SA 1JEYB 1P4AA 3F46A 3DAYA 3QVGB 4ZO8A 2XVYA 5DISB 1KZHA 2QT9A 3R0JA 3F5FA 4FYMA 1SQGA 1L5WA 2IYPA 4G07A 4Q39A 1XLVA 1BZYA 1GXSB 1H94A 1Z12A 1DO0A 2X1MA 3E8XA 5ERYA 3ACCA 1L4BA 3VU0A 3R75A 4FEYA 4GDMA 1L0BA 3DEHA 2E5FA 3K15A 4GP7A 5A4FS 5H7XA 4CMCA 3JYOA 4KMRA 4DDHA 3GLIA 4LMBA 3C43A 4D97A 3IGFA 4YJGB 5CITA 1Y3IA 1JFLA 2QTVA 3FPKA 2O20A 2XYRA 1KP9A 4M1OA 3ANLA 4Y9UA 3QF4B 4HX9A 3TLBA 1KVRA 1L5LA 3AIMA 5HM6A 2DX7A 2GWHA 3ZIUA 4J4TA 3NCTA 2JPDA 1S9DA 3VGJA 4BZQA 2J7KA 5M04A 1VYHA 2QVXX 4D9NA 2O9JA 3KG2A 2GN9A 2XUDA 1GSAA 1CQJB 1Y7PA 3P96A 3N0TA 1R18A 2OLJA 2P9YA 3E8MA 4FDMA 3DJFA 1NNSA 4TYYA 2JATA 2FX5A 4M8IA 1IPFA 1O95C 4CEIB 4EG6A 2HPVA 1U3CA 3QNWA 1P0QA 2V6GA 3AESB 2Q8PA 1UBCA 1JHQA 2JGIA 5LXTA 2CCKA 2ENUA 2Q2VA 1NFQA 2JI4A 1JA1A 1TCBA 1FDSA 3K3PA 3M6UA 2IXBA 4BU1A 1SCQA 1NULA 2R44A 3IDOA 5EWJA 1UXJA 3BS4A 1JEQA 3VQWA 3ZVKA 3O26A 1UBLS 4MI9A 1IPHA 2QX6A 3BC1A 2AKEA 3WIBA 1P19A 3A1DA 4PPYA 3TR5A 3H7IA 4ITVA 3K7EA 5J4HA 2I3GA 2FK7A 3NQ41 4KE6A 4B31A 5AOBA 4CM8A 3PJEA 2ZB3A 2YXPX 1ZRNA 2ZUUA 2AE2A 4NZPA 2FUKA 4PGMA 1DAIA 1HQDA 2R6DA 4NYJQ 4BO7A 4DIDA 5JARA 3P8VA 4FFRA 2PKCA 4I9NA 3RU3A 3WNQA 3PXUA 3M4PA 2RSLA 3OT5A 3WLNA 1NN1A 3QEAZ 3LXMA 3FCSB 2GQ0A 1ABEA 1PYGA 2Q3MA 4LF4B 4P71A 1QFYA 1JE0A 2Y71A 3MCVA 4M4SA 1G20E 1SKYB 3TDMA 1E5QA 3ZQUA 1E32A 4L4ZA 3H19A 1RAGA 2REOA 1A9YA 1FFAA 1Z0SA 1QPBA 3LGSA 5I7RA 1XCJA 3DD1A 5DM4A 1USUA 1RKBA 1ZA1A 2XWBF 3NBYC 3QW4B 4F72A 2RG1A 3DMRA 4R31A 4B75A 4RPCA 5BXYA 4IJKA 1Z5VA 1M5TA 4Q4DA 3EY4A 4X7MA 4RULA 1SU7A 2R8XA 1FIUA 5A06A 2BKUA 3NIBA 4N9QA 1GZSA 1LVUA 2XMSA 3O9VA 1MBZA 1FW8A 4S35A 5C0OE 1G7RA 1GRVA 2WU0A 4E94A 3HBFA 4PQRA 2BEUB 5IBCA 4E5YA 2FDCA 3K73O 3E5NA 3ZCSA 1J97A 3DV2A 4X84A 4BC0A 2I2XB 4LMAA 1G5QA 4DARA 4R6XA 5I4CA 1L2TA 5KIAA 3MRVA 4LDJA 1XDGA 2AYXA 4UUMA 3UATA 1KKLA 2ZCVA 2ZI7A 3GA5A 3PTZA 2W42A 2GGSA 1YZHA 3GAZA 4KWTA 1JUDA 4OVKA 1OT3A 1MZVA 4I55B 2DTEA 5CD9A 2JFOA 3ZD9A 1YK1A 1YFRA 2BKAA 4LCBA 2ORVA 2MMGA 5KUTA 1POWA 3KAJA 1WLSA 3KSMA 4HYQA 2ZRKA 2IEAA 1Y3DE 4OQNA 3ZWQA 2Q9UA 2BM9A 3MS7A 4N3BA 4J3FA 4O8ZA 1PDOA 1VE1A 3QXCA 4LISA 2JGNA 5YASA 3EA4A 5DLEA 2G76A 4CEJB 2C9DA 3K92A 3PFIA 4NK5A 4CKEB 3KQKA 2H4FA 1FK8A 2YY5A 4A15A 1LEHA 3MQFA 4H60A 3KX2A 5D1NA 1SPXA 4UTVA 3L5KA 2I4LA 1NXSA 3DTNA 4GXTA 5TEWA 2ZZGA 5ADUS 1GPDG 3R5XA 2JIBA 2QTAA 1YKGA 3BKXA 2EP8A 5BSUA 4H6WA 3ILYA 1U1GA 4UHDA 5GWXA 5FTJA 3E84A 4XPIA 4CQMA 3ZDRA 2PD3A 1WY7A 3PT9A 3CFYA 4GI3A 1BBWA 1CBUA 1KYWA 2WPNA 5TF4A 2BH9A 1P9NA 5ALUA 5JEEA 1U5AA 3AVWA 2Y77A 3AOEC 5SY9A 2QRVA 3TOVA 1XMXA 4G67A 3AESA 2EBUA 4GICA 1X38A 4YAOA 3T5BA 3MB5A 4KFTA 5C3UA 3EF1A 3NDPA 2OFXA 1QBGA 3UAWA 5I3CA 3WDMA 3F4LA 3SN6A 4IQ8A 3RTCA 2G7MC 3A1SA 2J9YB 4EY4A 2X6QA 4RTRA 1Q0UA 3MJ4A 4TZKA 4L2IA 3ZI4A 2AJLI 2NUPA 2LPMA 5MGBA 1SZDA 1A7JA 4JGGA 5EVJA 1M6VB 1WKBA 4M0MA 4Q24A 3MAGA 2PH5A 4PZPA 2IOYA 2EJCA 3KKLA 3DBVO 1JPVA 3LKDA 4GP6A 4OG2A 4BNUA 4BTEA 2A3NA 2C31A 3TOXA 3JX9A 1G2IA 4D57A 4DLSA 5A3JA 4CKWB 3ZVRA 3KR0A 5SYMA 5EP3A 3WO0A 2QB5A 2ZI6A 1KJNA 4JVSB 2B7LA 2C4HA 2HM7A 4A0HA 4B2YA 2ZM6B 4ZDKA 3L4GA 2YZGA 1PZHA 1E7RA 4UW9A 3EK2A 2DUNA 3E0XA 4QEZA 3DYBA 3L8GA 4U5XA 1DAOA 1K6JA 4F5DA 3FYCA 4ZOLB 1PEDA 3AR4A 4KGDA 3SYRA 2FSVC 4Q47A 1THTA 2JS7A 4L3OA 2EFDB 3OCVA 2WMOB 1QJ4A 2M6KA 4CM6A 2PX6A 2GPSA 3HV0A 4A73A 3KB1A 2FE4A 4B8WA 3G3EA 2AS0A 4HNAA 3L0OA 3WWCA 2FV8A 4GUAA 3LH5A 2RAUA 1RCTE 4UZSA 4QT4A 1XWWA 1UM9B 1MT0A 3K8QA 2OM2A 4LIPD 4GT1A 4GG1A 4Q4JA 5AKLA 3UPUA 4JXZA 1DKMA 1KSHA 3A7EA 2Z2YA 3HKBA 1GTMA 3EUEA 2DTIA 3PITA 4MKGA 1EWKA 2YL2A 5TY0A 1HH4A 2ZPAA 2IPNA 4IDNA 3W6UA 1A5ZA 1I2BA 3X1JA 1OYYA 3GLFB 2IH4A 4BRUA 4WJZA 1ABBA 3ISJA 3EVEA 3KJQA 4B3FX 5BSKA 1IBLB 1CJMA 2JGDB 2WZDA 3E3LA 1XO1A 2YQ5A 5AHKA 5AM1A 3ZDQA 2BGGA 3REUA 4HB4A 1MIOA 3R5KA 5L4SA 2VT3A 1R5OA 2BPOA 2Y1WA 4BDTA 1DLIA 4R5MA 1YNSA 1DBVO 2WU4A 3AXSA 2B2XA 2NXJA 5ESRA 5I8ZA 5EE1A 1EXDA 4FDTA 1J0AA 3LVFO 2ZYVX 4ZVMA 3ZJ5A 2B9EA 1RKVA 3H9EO 4FIDA 5IYZB 4DJTA 3L7CA 1O95A 5DKFA 5CJPA 2W2LD 1O87A 3B3GA 3G1UA 2WWVD 4J90A 2BHNA 1MO6A 1X1QA 1V5IA 2WE7A 4ZRMA 1BKDR 1UDRA 4EI8A 3CNQS 3LC1O 1DJLA 1HMYA 2Q3DA 1HZJA 1O2DA 4UFPA 2I4OA 4BATA 4QAQA 4RDIA 1AT1A 3FROA 3UJPA 1BKYA 2IDMA 3EFBA 1QU3A 1P4HA 2R00A 2FEWB 3IS3A 2FEAA 1EDEA 2RGCA 1AS2A 1PEYA 1IQUA 1TO1E 4UTZA 1PWXA 1BYUA 2JH8A 3AY6A 1Y6QA 1UR5A 1V3UA 2V7GA 4IEIA 4KZKA 3QX3A 4ZO4A 3A6PC 2Q6VA 4HWTA 3KUUA 3TJZA 4DA6A 3EGIA 2O8BA 1D1PA 2R751 1NYQA 1V5WA 2GN2A 1GZDA 3JD4A 5E1OA 5DYYA 4YUYA 4RTNA 1J8QA 2XTZA 4ZQGA 3H86A 1ZD5A 4CI0B 2C97A 3GT7A 4MKRA 4ZU6X 3G5UA 2WF7A 4ZGGA 4OGGA 3CWCA 3IIEA 2WFZA 3L7MA 1T1IA 1XB2A 3OZ7A 1XLTC 1CULC 3WGZA 1G20A 2BZ0A 2W5UA 2X0DA 4XDHA 1I2MA 3VTFA 3KLNA 1UBMS 3T0GA 3SBDA 2EP7A 1SHZA 1ADFA 4X62B 1NVVR 4G5XA 4NRDA 4A8JA 3RT1A 5IAKA 2QN9A 2E3CA 3BGDA 3M0EA 1FP1D 1P0CA 1PGPA 3RSQA 2VJBA 4OF4A 4V0ME 5T64A 4QJ3A 3NEPX 3U44A 4UNIA 3IV6A 3Q7TA 4MVJM 1P29A 4F3KA 2ZK7A 4DCVA 4FB5A 5EXDA 2ZP1A 4H7HA 3TUJC 2J85A 1ZCFA 2HCJB 1Y8RB 3U3XA 8OHMA 1Y1TA 2QX8A 2Y0EA 1H1TA 3GFFA 3IKVA 5AT1A 3WY9A 2IS1A 2FYKA 1NRXA 2R1TA 1TC2A 4IIDA 4NCNA 5D51S 2NLOA 6ABPA 1SEVA 2IV2X 3F6BX 3KYJB 4JJFA 1Y4SA 2CHGA 2ENWA 4IBOA 4M36A 1BRTA 2AEMA 4G85A 2BELA 3FAKA 1U7PA 3DMTC 3EIEA 3Q6NA 1P7VA 4OYRA 4Z0HO 4BZPA 1BQEA 5EE3A 4GXNA 1ZAYA 1ZZEA 4TSRA 4YJHA 3OIYA 2ZROA 3KVNA 4OBWA 1QQ7A 4JFAA 3TOSA 5KYWB 5CBPB 1KDPA 1L1FA 2ZBFA 3EGOA 4IGKA 5C8VA 1PZGA 4GX1A 2WIFA 1EGVB 5FFFA 5E3HA 3D43A 1Y9ZA 3E9MA 1PW5A 4G1VA 1KYXA 5AVYA 1TF7A 1P1HA 1VJRA 4GGOA 1NATA 2EERA 2XDAA 2EJFA 3SS8A 1VA4A 1J49A 1TIKA 1ZESA 4D25A 1E2BA 1NLMA 1E2KA 1WUHS 5KTTA 1YGBA 1RJDA 1Y7IA 1Z2NX 3K09C 3NI2A 1N3IA 4LBWA 3IPRA 2EWVA 3MQ2A 5D2CA 3VKVA 1U0BB 4X41A 3EY9A 2Q6LA 3UAGA 4IDFA 1B76A 3BUSA 4JQCA 4F5YA 1NT2A 2H29A 1BFDA 3BCSA 4OHZA 2PMEA 3X0DA 5DTEA 4CETA 1N2CA 2RKBA 3L79A 2UYCA 3NVDA 2G9QA 5HMLA 1J2TA 1DAFA 4KWIA 5THKA 1GUDA 3BFKA 1XZLA 2W4IA 4M99A 1E22A 3K8YA 4BO6A 1Q7GA 5L6MB 4ABYA 5JPCA 4C1BA 3OURA 3HU2A 3QV1A 5MHTA 2OV4A 2Z5LA 4X20A 2W2XA 3T5PA 4J3NA 1SXQA 2HIAA 1FUIA 4MITA 1NXTA 1I51A 1DADA 5IWCA 3BCRA 5ERXA 5BQFA 1CR2A 1XTUA 2PQ0A 4BGDA 3L7OA 1WJGA 3R09A 3KTAA 3RG2A 4JEMA 4BPRA 1VMAA 1XMIA 1XVUA 3ETCA 1AD2A 3HS3A 5ALTA 3PIRA 5C8YA 1WQ4A 2D5LA 2JVIA 4Q3DA 4HXYA 2OO5C 1G8HA 3EAFA 2AHRA 4YUZA 2XXAB 3DLCA 2Q46A 3OG9A 4DIEA 2NM0A 1QGUB 2WINI 4PYIA 3V9PA 4EJSC 1R7RA 3OX3A 3K05A 3HDGA 4LRTB 3WAGA 4AZSA 2WF5A 1N6RA 1PJRA 1WABA 2QL9A 4RK4A 4CMEA 1SELA 4CF7A 1KWKA 2WLSA 5B53A 3DLAA 1L7XA 1VE9A 1EHIA 3USZA 5FIUA 1GPH1 3K72B 3K2IA 5SZIA 4D99A 2DWOA 3ZPXA 2F3QA 3N5KA 3DGFC 4RIEA 2XITA 1GKLA 2J3JA 2JRLA 3HHEA 2I2BA 3INTA 3QFCA 3H83A 3K1AA 1RQPA 4YAUA 1LSOA 2VF4X 3SC3A 5KKNB 1JS1X 3R9IA 4CL2A 3VU9B 5EXSA 3LT2A 3TJRA 5IUNC 1GNRA 1QH0A 2YY6A 3JYNA 1A50B 2ATCA 3EXHB 1WXHA 2Y67A 3K0SA 5JS1A 2V7QD 2ZJ4A 1Y63A 4N5HX 1IM5A 1SUBA 4JELA 4A6XA 2G83A 4OQFA 3VOTA 5I01A 1U8XX 2C88A 2QYOA 2RHGB 4JENA 4TQUS 1LVGA 4QDKA 4WXPA 2QTCA 3R6DA 2HJWA 3UMJA 3BFMA 1ZXBA 4NARA 3B7WA 1PYDA 5IFLA 3DULA 1MXFA 1WP9A 4G23A 3RKUA 1NKTA 3PQ3A 3FVVA 1K7CA 1W1IA 3FZYA 4IXDA 1V8FA 3AJAA 5AK6A 3FPJA 4ZI7A 5DZSA 1NKVA 1SC3A 5FD8A 5DT2A 1DDGA 3KOMA 3OOYA 5DN6A 2QNBA 5CAEB 2D0PB 1I0IA 2NZUG 4K3UA 3KP1A 1Y3AA 3LCUA 2A30A 3GHHA 3M33A 3RRYA 4ETIA 2IYSA 1FSFA 2ADOA 1QU2A 4BASA 2CE7A 1X77A 2RONA 1GIAA 4R8RA 5D85A 1NP7A 2H8KA 4GMHA 3N2ZB 2JGRA 3T4EA 3CEAA 2WB4A 3F2VA 3UKDA 5K8JB 3F7NA 2Y3IA 4QBKA 3RK4A 2BGIA 2UVQA 2WG0A 4OQPA 5HRUA 3F3KA 3DMGA 2PX2A 4NBSA 2GAIA 4LXUA 3ZHBA 1NPTO 3QU2A 1PEKE 2ZU0C 4PG8A 2VO1A 3CZAA 3HVHA 3U7FB 5JC8A 2EGGA 1T5OA 4E2WA 4NBWA 1TIPA 5HUJA 5JPIA 2XHEA 3LV8A 4TQFA 4FWIB 3DOEA 1KI8A 2NYUA 2YNMC 3RFTA 4ZCIA 4JSTA 4KQ1A 1KRHA 2Q9BA 1HT1E 3R07A 1Z4NA 1DEHA 1TZCA 2PKQO 3O47A 4BMOB 4M0EA 2IGBA 4RDCA 1MRSA 5CCXA 3TSOA 3QPUA 1UODA 4DW8A 1O0CA 3S2FA 3ANXA 2GCGA 2ZI9A 3QYAA 1RLJA 4QE3A 3N6VA 3ABSB 3I6BA 1YZYA 1MCZA 4IP0A 4BLVA 2NS6A 1U28A 3SNHA 1D0IA 1OI7A 1E9DA 4BVJA 3BJMA 1OXXK 3L7LA 4KK4A 3RYHB 3USES 2KI5A 2QUZA 3TL6A 3QLUA 5LZ8A 2PJRA 1G8GA 2ZBDA 1Z2OX 1SBCA 2D5BA 1G5HA 2PO7A 1M6NA 3GRZA 1G21E 1W85B 3LUDA 3WK7A 3W4KA 3MCTA 3HWRA 3HDYA 1UKYA 3G1WA 2G40A 3I9OA 5KCMA 5TDHA 3W5HA 1JAZA 3D2LA 2PCJA 1B8NA 4QQ8A 4ZDIA 1OWNA 3VTZA 4NENA 3OEYA 2QPAA 3EZYA 2ODQA 5CK5A 1PJ8A 3OP4A 1NGSA 2X2EA 1E0AA 2GCEA 2G7ZA 1P1IA 3ECSA 5GIPE 4AY6A 3HTXA 2PHZA 4GM0A 4MHOA 1MC1A 1WB9A 2OHGA 3O9MA 5BW6B 4ZEMA 2VKQA 3W9SA 4NNPA 4DWJA 3SSNA 4XYLA 1XZNA 3E48A 1P8JA 1LLUA 1AUXA 3RU2A 3E9YA 4IIEA 1O03A 4OMUA 3DB2A 3HZHA 3S3TA 3KUDA 1XTRA 3WYEA 3P5BA 4AICA 4CF3A 5JHHB 1UKZA 5JYCA 4MQUA 3SIXA 2IE8A 2I71A 4DT1B 4LG1A 1XZAA 2VDWB 1ZS9A 2W83A 4N76A 2B61A 1HL3A 1RQ7A 4Q03A 4CCWA 4DKXA 3SQWA 1LH0A 3NHWA 5GZ1A 1VL6A 4IGEA 4PC7A 5JZOA 1PWHA 1JHZA 2O19A 2OLEA 1D6SA 4LTMA 3SF0A 4GR4A 3R7DA 2MSNA 2Q5QA 3F71A 3LGAA 5JCZA 2RGXA 3LBHA 1K6EA 1YZLA 1EK0A 3O4FA 2A8EA 4Y1RB 3QX7A 4YB8A 1PGQA 3WLKX 4DQXA 4B7AA 4E2ZA 1FXUA 4F3NA 1J8DA 2VCYA 3ZDEA 3LP5A 4WBNF 5LPNA 4TVAB 1NDQA 1VDMA 1II9A 2RC6A 1KAGA 2ZRNA 3CNEA 2HB6A 5EEGA 3V4OA 1P4JA 1XQWA 2ZIFA 4DPLA 1FZTA 4YRNA 4HA8A 1YZTA 3ZXYA 1MEJA 2GFQA 2VPWA 2YHAA 3OX2A 5I8PA 5LMNB 3KL4A 3A32A 1LDYA 2VQ3A 3AY7A 5EIAA 1CIJA 3H5LA 3NXKA 3RVNA 4DNXA 4PLWA 1Z47A 3GRPA 2R66A 4MIKA 5CNMA 3U4GA 3BMQB 2RGNC 3W4JA 1NVEA 2HQRA 3A6GA 4YT4A 5B58C 4BFSA 1BHJA 1OAAA 4Z0TA 5AHOA 3PFBA 4X7PA 2JKVA 5K8IA 3NIWA 5HQ3A 1A1VA 3JXEA 3Q98A 1ZJYA 1U3UA 1AZWA 4Y30A 2ZEJA 3QA9A 1LK7A 5JH7B 5A9TA 4GYKA 4QVIA 3WX0A 1B2RA 2GD1O 5KYXA 3K0AA 3MF1A 2B30A 4J3JA 4L5IA 4FB4A 1HOXA 1NW7A 4PS1A 1WV1A 3G2OA 4X1OA 2GAJA 1JE1A 3D3JA 1YU6A 5B7GA 1GR1A 1KY3A 1IG0A 2IITA 2AF3C 2QRGA 1SCDA 1Z39A 1GHTA 1FYFA 1S8FA 2A0WA 3MERA 4REQB 1UXKA 2CFSA 4OKSA 5HIMA 4IGFA 1GZ5A 2ZVPX 4RJLA 1RPNA 2O7RA 4S1WA 4DLWA 1FNDA 2V55B 4ZQBA 3FD8A 1UFKA 3HKDA 5JLAA 1RTTA 3F90A 4ER7A 1FPMA 4JBLA 4UTPA 3WSWA 1QLJA 1GZUA 3MWEB 4BLWA 4D56A 1CNEA 2PUHA 2G0TA 3CO5A 1EFDN 2ARSA 1VLVA 3MD9A 1WU8A 1CQIB 4BRWA 3GJYA 4AP6A 3JTEA 5L40A 3A7DA 2H5JA 5CM9C 2IIVA 1NN0A 4IIVA 1U8EA 3SS7X 3RJZA 3M9XA 1A9QA 1DFGA 2XA9A 1E3IA 3CRW1 3RUFA 5KYTA 3MELA 5BOVA 2MWMA 2B1GA 3OQVA 3RC8A 1OXBB 1QKKA 1V2GA 4CM4A 2TMYA 1XEAA 2R79A 2W0MA 3PXGA 3ORSA 3T5DA 3WLIA 1TTQB 5F33A 1U3WA 5KTMA 1BJKA 2ZULA 3CF0A 3U9SA 3HY4A 4ZCMA 3RYTC 4TRNA 2W98A 3EASA 5B2EA 3O93A 2JFPA 4KAJA 1W66A 3PD7A 1TU0A 4H2UA 3AKDA 3ZHYA 1DPFA 3GJZA 5HOQA 2K2QB 4TRJA 2UKDA 1C1XA 1DJOA 3DMPA 5K3BA 2J3KA 3GNQA 2NOAA 3NVAA 1U1IA 3KPJA 3B1YA 3VKFA 3ZGYA 3NIGB 2CD9A 1JR3D 1L7PA 3CEPB 1H22A 5CA1A 4RHTA 3UK6A 2RH5A 4W7HA 1XL0A 1N6LA 3BK1A 4P5DA 4FLMA 4WJLA 4W5QA 4K8RB 2VQFB 1L5HB 1TJ3A 2QSJA 2VT6A 3A4IA 4N7MA 4G4SO 3TVYA 3T3NA 4C22A 2A9QA 1JZSA 1BDBA 1OLSB 3L8DA 1EEXB 1M76A 1Z4KA 2C59A 3A9RA 2PE5A 1XALA 1WNTA 2R8RA 3X1DA 1DL5A 1WMBA 3LFUA 4QDZA 3JW8A 3BHNA 1SPBS 1NG1A 3C3DA 2Z1DA 3EIFA 3WBFA 2HNKA 5DCUA 1B1CA 2HADA 1XU4A 2VP9A 3KYDB 5F7OA 4LWPA 4GWGA 1FNMA 4HL6A 3EEYA 4DWOA 5ALFA 4MGKR 3IURA 1H3FA 4PE5B 4DA0A 3EFSA 2GEDA 5EYPB 2ZPTX 3U5TA 4UARA 2WR8A 2PGLA 1SK8A 1I9GA 1FF9A 2A4KA 1U9ZA 2GEBA 4DCSA 5LVAA 4DV7B 3BXEA 2VYVD 2G25A 1C30B 2IHKA 3MWDB 1BEZA 2DFNA 4R2LA 5LJIA 1T5TA 3TZEA 3PXCX 5C31A 2R6HA 3NBFA 4LUCA 3AFNA 3NHFA 3I9JA 1RRKA 1INLA 3D5TA 1OBFO 2Q5LA 1I8TA 3L8CA 1JALA 2R6JA 3I2JA 3B1XA 1UK9A 4OA5A 3JQ8B 1RCFA 1YH3A 3TLGA 4PNEA 1CJBA 4HO1X 4ZHQB 1UK7A 1X8LA 4MV8A 3HXVA 3O8RA 2DHCA 3BMCA 1U5CA 1EI9A 4LMPA 3VU8A 3QO5A 1Q1BA 1OWPA 4M6WA 3ENZA 1LBTA 1T9ZA 4HNTA 2AJDA 1NN5A 3KU4A 1GTL1 1RXSA 2Y8EA 1ASYA 3GR6A 5CLFA 3NBKA 4M1EA 5BV8A 3BBLA 1E79A 4GM1A 4RLQA 3TF5A 1D5WA 2XJ4A 3HSKA 3FWNA 3ZY3A 2AMVA 1OTYA 1YMUA 2OK7A 4KAAA 3MYRA 4RK5A 2NAPA 3BL6A 4KE9A 4KW7A 1I4DD 4Y7CA 1QTIA 4QBFA 3U2QA 3IC5A 1U31A 4TM8A 2HF9A 2QN3A 2I54A 3NAZA 4M1SA 3B1VA 1MQ8B 1Q77A 1ULTA 4HSGA 1RXYA 4YGXB 3UMFA 5JWRA 1WQ1R 3QG5A 4HADA 4NF2A 1GKIA 1BRMA 1DKPA 3OUUA 4P2BA 4N3CA 2GAFA 1VJ0A 4PPGA 2X9VA 3WDSA 3R3XA 1TCUA 2QRNA 1J0XO 4F45A 5AI8A 1TT5B 4DLBA 1EVJA 4FDAA 1G5RA 5JCXA 4KSCA 3REGA 3EC7A 4RKYA 3ILSA 3I5MA 2EG9A 1ZVQA 3LPCA 4RHEA 4WY8A 1K92A 2NO9A 2WIBA 5FI5A 3GVCA 3VYUB 4RD4A 3PE4A 1PJTA 3RDPA 3L0YA 5A0TA 2XE8A 1G8YA 3Q9LA 3EPKA 3ES9A 1M2GA 1BXZA 3QKTA 5IF3A 1OGIA 4X6LA 4WECA 1NXOA 1XV5A 3ETHA 1MH1A 2AG0A 2B5WA 2XMZA 1G5TA 3GZNA 4G0QA 2BRUA 4IG4A 5KOJB 5ELXA 3G68A 2O8CB 1DP4A 1UADA 1FVOA 3UXEA 1PS9A 4U2DA 3CB2A 2W37A 4KVGA 3OWOA 4WZBA 4X44A 1JW9B 5C18A 1LS1A 2AW5A 1UC8A 4I08A 5DLPA 4UTNA 1GPWB 1WO8A 3V46A 3WYAA 4XU3A 3V8MA 3M49A 3ZX5A 3AP3A 2Q3EA 1I7PA 4JKOA 3TIVA 2PGJA 2HLDA 3IR5A 2ZRQA 1WCIA 4NCKA 2D13A 3FTCA 4P98A 4Z99A 4DR5B 2O3QA 3FDFA 4U8HA 5F5XA 2FWMX 1TYBE 1AIPA 4EPWA 2LBPA 5K0EA 4JD5A 1P6XA 4MWZA 4YRJA 4IFBA 4P4SA 3UHJA 5BN3A 1N5IA 3DT8A 1RDFA 1V8BA 3LAWA 1SU4A 4WASA 4KOEC 3HDTA 1HE8B 1NXXA 3SXPA 1US8B 4INJA 2JIRA 2PR7A 5HNKA 2IZ6A 4IJVA 5FR2A 1B0UA 3CMCO 4LF7B 1GQQA 4UUAA 3WJ7A 3IUMA 1TKAA 2WLTA 1QIFA 1Z4PX 2C4VA 1CUHA 3I28A 3BGVA 4OQ4A 5HE8A 3THSA 2ZRMA 5J2UF 1UFVA 3RSLA 4ZVUA 2C3UA 3CMQA 1ACJA 2C84A 3QOWA 2P5SA 4FGJA 3T9FA 5MF6A 1DKNA 3HGMA 1SXJD 2HCTA 3IQWA 4KNVA 4TTAA 3PPIA 1NSTA 1PUIA 2C04A 2ID8A 5HJ5A 1X7ZA 4C0KA 2FSHA 5CLIA 1NR7A 4MRAA 3S8MA 1GL7A 1N9GB 3VR2A 2XMQA 4M1QA 4ZOLA 2H7XA 5I4BA 1Q0SA 3PQ8A 1TYCA 4PX9A 2ZQ5A 3TJMA 3ZZUA 1GRCA 3HP1A 3QF7A 3FLAA 1UFQA 3QX8A 3H9CA 3OMLA 4KX5A 4PRYA 4AG5A 4DLAA 1JPJA 4M22A 3KQOA 3BM5A 8ATCA 1ZHOA 2Q27A 3F5MA 1Q1NA 1DO8A 3E7XA 2KBFA 2UZ1A 7ADHA 5B3JC 3A04A 3SR3A 4F93B 1PG0A 2W4QA 2AMJA 4AZ0B 3K0KA 4AS3A 5IC5A 1P5ZB 3LK7A 4MJXA 1OFHA 3RCBA 4CLOB 2BFEB 2ZJ1A 1WW3A 2VH5R 4TWIA 1Q17A 5A7GA 3RO7A 5BW5A 1HYGA 1WETA 5JSYA 1QKJA 4XEOA 2AQIA 1QFXA 4XWTA 5IBPA 5IAEA 1JT2A 1LTQA 1P3JA 5K0LA 1WMFA 2J07A 4WQMA 3HRKA 5ECDA 1L9KA 2VHXA 3LW8A 3ND5A 4M1KA 1TZ2A 4OI0A 2WAOA 1IVNA 3EEIA 1NHWA 2ZBPA 2PKQP 3R7BA 2DM6A 3M1YA 4LTDA 5HCIA 1ZUHA 5ALSA 1JNYA 1FX1A 1NFFA 4BUCA 5K6AA 2DEUA 3KPVA 2CYBA 3FMGA 4LNUB 1DSSG 2FPIB 1V95A 4I1VA 2WJGA 3D7RA 1E94E 2OHXA 2PA0A 2JCVA 4D79A 2EX4A 1OH6A 5KVSA 1RXUA 3WYGA 3BWYA 2WTEA 1XFDA 2H4ZA 4IFIA 1EUZA 1DJMA 2B83A 5AWFC 2F64A 2XSZD 4ZZ0A 1SKUA 2BFDA 3BKWA 4P3KA 1QX3A 3WJAA 4DCTA 1HZZC 4TTJA 3BRCA 5LDDC 1JJFA 2CZGA 3FF1A 1JFRA 1CF4A 2OYSA 5HG0A 4JBYA 1AA6A 3I9NA 1HYQA 3MXTA 2DOKA 5L45A 3IP6A 2H1VA 4NE2A 1MV5A 3BTUA 4JR1A 1DX4A 3A3YA 4J0IA 2KE5A 3DZ8A 3OOSA 1V0JA 2CNKA 4F56A 2OXFA 5FWDA 1YC5A 4BCBA 1GJRA 4X54A 3M6WA 3LG2A 1OBVA 1KJ8A 2KBEA 2OZKA 3L9WA 4ZIRA 1EU1A 2CWWA 2B92A 2JLAA 4V03A 3UY4A 1Q11A 2HRZA 4HQRA 2GJ8A 3LE8A 3JQ6A 4YFVA 2XUGA 1M83A 2GBPA 3LDAA 1I7NA 5DTJA 1K06A 2Q1SA 4IH9A 4X63A 1M2JA 4QXOA 1BOFA 4IW3B 3I9KA 3L6EA 3VNAA 3RC1A 1JLLA 3N2IA 1Y8QB 1VGRA 1CNFA 3IILA 5LQDA 3ESAA 1QHFA 3PDJA 4HLQB 4JBWA 5KVVA 1TNDA 2QYTA 2YQ4A 5ALEA 3NYQA 2WUEA 1QV7A 4NS1A 3PNMA 1L8OA 5AJHA 3BFJA 4YPVA 1QJCA 3ESRA 3KR2A 3AHHA 3OM0A 4R16A 3V33A 3DE1X 1LX6A 2Y0PA 5A6SB 3DVLA 2BEUA 1E1TA 4NCBA 2EJGA 4CTOA 3QWFA 3DV0B 4R71A 1A8QA 2WJJA 5EZ5A 1XTBA 3RSOA 4FZ5A 1QR6A 2Q3CA 5AVZA 2QAGB 5I9LA 4BYMA 4RSGA 1SRQA 1O0BA 1W4BA 3ZVMA 3R41A 4L5BA 1E92A 4HNSA 2PL5A 1J2UA 1RRGA 3N0XA 4FOPA 2C4KA 2VF7A 1LBIA 1HE5A 4OBBA 4XM0A 4AMZA 5KAPA 3TB6A 1LV7A 1X13A 1TJYA 2TMKA 2FCRA 3S27A 3VHLB 1QTQA 1FDTA 2HEIA 3FTEA 3QITA 4GMKA 5IH7A 1QHXA 1CVLA 5IHXA 3THXA 1C7QA 3LUPA 2F3PA 4NULA 4YCCA 4GPBA 1W36B 5KOIA 5LZ2A 1T9BA 1HLGA 5CW1A 5G1OA 2BN4A 1PP4A 4FMPA 4Y2PA 5K0JA 3U4QA 1DO2A 4OHYA 3WGLA 1PYOA 16PKA 4JIGA 4WN9A 1F2UA 3S8YA 2YHBA 3DOFA 2YX1A 4KXNA 5L3VA 1Y6RA 3LA6A 4NWIA 3LCVB 4P2GA 5FI0B 2NUTA 3I4FA 4Q3KA 2O3RA 1AOXA 1MV8A 3D5QA 1UMBB 4NONA 4BX2A 4FGLA 2WIKA 3R8FA 2PLWA 2PK3A 4GFDA 3TZLA 4UDXX 4GLLA 3P19A 1U1EA 4EENA 2R5NA 1XROA 3O8OB 4ZXFA 3O0DA 2CL6X 4IDBA 5BNZA 1LC3A 3CCCA 3IOEA 2VH2A 3GJ3A 2LGJA 3KD2A 2L82A 2DFPA 4ME6A 5ES4B 1HE3A 2VJCA 1EB8A 3QLJA 1PE0A 1ZH8A 2I8LA 2KSQA 2ZVJA 4DIOA 5FDFA 4MIEA 3PENA 4JKYA 3ANNA 4B76A 5IT0A 3GRRA 4OD0A 4XYBA 2B1IA 4NR0A 1EVYA 4REOA 1V5FA 3TEJA 3DONA 2Q5CA 3PI6A 2NO7A 2RD2A 2EAYA 3A58B 3QEKA 4PLFA 4DSTA 3QOXA 2OKCA 4AS2A 3N7TA 2TMDA 1PL8A 2CXRA 3E9QA 2IODA 1T25A 4IFEA 5EUCA 5EMJA 4MAFA 5EIBC 1I2DA 2CMKA 4DEXA 1HYHA 4MQBA 1SCUB 1T0BA 1FJHA 1VC2A 2QX4A 1UPFA 4AJHA 4K9QA 2I7CA 3K5IA 3FWZA 5TXGA 3BXOA 3UV7A 4C2BA 1XTPA 4YEDA 4CKEA 2SNIE 1J99A 4UXJA 3AY0A 4ZC1A 5KB3A 3Q1LA 1RYDA 3SU8A 1XDBA 3KTFA 1DC3A 1ADBA 1TLLA 2FWNA 2A1UA 2RFLA 3VTAA 4DMFA 2ZT8A 1M8FA 5C1BA 1MD9A 1IN1A 5TGZA 2HXSA 2F4VB 3SPXA 1AF4A 2EQAA 1VHJA 2XRFA 4NIMA 4IGAA 4D26A 4N7BA 1ILWA 3R0ZA 5IJ9A 3I62A 2P6PA 2A0FA 5EZSA 4R1UA 1Q92A 2LKDA 3OFSA 1UQUA 4BDSA 1OLXA 2JFNA 2Z2ZA