2G4CA

Crystal structure of human dna polymerase gamma accessory subunit
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
420
structure length
397
Chain Sequence
SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase gamma subunit 2
publication title A novel processive mechanism for DNA synthesis revealed by structure, modeling and mutagenesis of the accessory subunit of human mitochondrial DNA polymerase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 397
sequence length 420
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2g4cA01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 2g4cA02
4YRQA 1SRYA 4XTYA 2ARSA 3A74A 3IALA 2ZZFA 2AKWA 3MF1A 3VQYA 1ADYA 2DXTA 1X01A 5C51B 1NJ5A 3HY0A 3TEHA 3M4QA 1NYQA 2HNIA 2QHVA 1YB3A 4OLFA 4BWAA 1NJ1A 5K1PA 2E65A 2Q5HA 1H4QA 2ALYB 3LSSA 4YRGA 2E3CA 1E22A 1EVKA 2E5AA 4TQDA 3P8VA 3A5ZA 1PYSB 4TVAA 5K1XA 1EOVA 3A31A 1HC7A 3L1AA 2G4CA 2RHQB 3RF1A 1C0AA 2IY5A 3HY1A 2ZZEA 4PHCA 3EFRA 3V7CA 3UH0A 4P72A 3UFGA 2QHUA 2LW7A 4H02A 1WNLA 3CMQA 4YYEA 4XU0A 2DQ3A 4UP7A 1B7YA 4HWTA 1G5IA 3IKMB 1YGBA 2ZIOA 3L2ZA 4YP0A 4XTXA 3MEYA 3VBBA 3DSQA 2DQ0A 1B70B 2Q7EA 4L87A 2ZZGA 4G84A 2I4LA 4EX5A 4K88A 1Z7MA 4E51A 2ZIMA 4DPGA 1NYRA 3RGLA 2XGTA 1E24A 2PMFA 3V8KA 4OP0A 2Q5IA 4H2XA 4HA8A 1H4VB 5C53B 2ZNJA 3V8JA 3L4GB 1KMNA 5KNNA 4H2SA 3E9HA 2ARUA 3G1ZA 1BBUA 2I4NA 4YRCA 3RKYA 1YFRA 3ICAA 4P71A 3HXWA 1EVLA 4YRLA 2AMCA 2FYKA 2I4OA 3HFZB 4TTVA 2QHTA 1RIQA 4UP9A 2ZGWA 1VQZA 3RL6A 2ZR2A 4YCUA 1ASYA 2Q7HA 1ATIA 3IKLA 1NNHA 12ASA 4HVCA 1NJ8A 4XEMA 3HRIA 5ELOA 2XTIA 1BIAA 1JJCA 3P8TA 4YDQA 1H4TA 1B8AA 4YRNA 3PZCA 1EIYA 1X56A 3VQXA 1N9WA 1WQ7A 2ARTA 1BIBA 2ZT8A 1SESA 1H4SA 3P8YA 2DJZA 2RHSB 2EJFA 4CH4A 1B70A 2C7IA 3EFSA 4NCXA 2EJGA 4CS2A 3I7FA 1KMMA 3M4PA 4H2TA 4P3OA 2DTIA 3RKXA 1GGMA 4P71C 1G5HA 1X2HA 3NEMA 3HXZA 2AKWB 3NETA 4CS4A 4XTWA 4TWAA 4H2WA 3NELA 2E41A 3TEHB 2DDZA 11ASA 2ZT7A 3L4GA 1WU7A 4H2UA 1WYDA 3BFMA 3TEGA 3A5YA 3RIRA 1J5WA 1Z7NA 3V7SA 3PCOB 4DQ2A 4XTVA 2CIMA 1YFTA 1NJ2A 4P74A 4TVAB 2Q7GA 4HWSA 2DEQA 4H2VA 1SETA 4WI1A 2ODRC 4KQEA 3A7AA 4KR2A 3QNEA 2EWNA 2DTOA 2E10A 4H2YA 3LSQA 2P5IA 1W66A 3HXXA 3HRKA 4O2DA 1E1OA 2J3LA 3RACA 2P0LA 2DKGA 2E1HA 4XU3A 1B7YB 4YRKA 1HTTA 2ALYA 3BJUA 3UGTA 4P3PA 3MF2A 1PYSA 1QF6A 1E1TA 4ZIBA 3HXVA 4YREA 1EQRA 2ZCEA 2RHQA 2CJBA 4P75A 4HWRA 4UPAA 1KOGA 1BBWA 3RKWA 4WJ3M 4P3NA 4YCVA 3E9IA 5ELNA 4P74C 4CH3A 4CH6A 4WF2A 2EAYA 4XTZA 4WJ4A 2J3MA 4HWPA 1EFWA 2ZR3A 4PG3A 5F5WA 2DU7A 4K86A 2DXUA 1WQWA 4EO4A 4CH5A 4K87A 2QHSA 1IL2A 4P73A 4H2XB 1V95A 2DU5A 4YROA 3HFVA 2EJ9A 3REUA 2DZ9A 1B76A 1X54A 3PCOA 3A7RA 2C8MA 4Q15A 4YRSA 3IG2A 3HXUA 3QO8A 1X2GA 2AMCB 2EL9A 3RUXA 1ASZA 4KR3A 5HGQA 3V8LA 4XTUA 4YRMA 1G51A 2PMEA 4P75C 4TQFA 4RQFA 1QE0A 3TUPA 2ZNIA 1USYA 4Q6GA 3OD1A 2ZXFA 4G85A 1JJCB 4YRFA 1ADJA 1NJ6A 1SERA 1WPYA 3KFUA 2CGHA 1EIYB 1HXDA 3R07A 4RDXA 1X55A 2ZT5A 2I4MA 4P73C 4XU2A 2ZT6A 4YCWA 3A7UA 4X5OA 4XU1A 5C52B 3HFZA 4HWOA 3UGQA 4XEOA 4YPFA 5E3IA 4YRTA 4YRRA 3ERRA 3LC0A 4LNSA 4BW9A 3W3SA 1YFSA 3VQWA 2IY5B 4YRIA 3QO5A 4RQEA 4UP8A 2ODRD 1WLEA 3HTZA 3WQZA 4TVYA 3HXYA 4YRJA 3FJPA 4TVWA 3VQVA 1USYC 2DTHA 3V7RA 4AH6A 3NENA 4P72C 3QO7A 3QTCA 2RHSA 3REXA 4ZTUB 1LYLA 4J15A 4RMFA 4YRPA 1L0WA 2ZINA 4CS3A 2E64A 1FYFA 2ZTGA 2CJ9A 2DZCA 3A32A 4ZTZB 2CJAA 2DVEA
chains in the Genus database with same CATH superfamily
4I4TA 1ZSVA 3ECCA 3OKFA 1IY9A 5JXJA 1TMYA 1AQLA 1G4UR 1RPJA 1YCDA 2A88A 3IALA 2ZP1A 2IFTA 3H8VA 3IDOA 3IKVA 4LZWA 3WB0A 3U7FB 1Q14A 2EHJA 4NCAA 4UZSA 4UTPA 2VUSA 3LOPA 3P0EA 2IOYA 2Q27A 5A6SB 3WWCA 3FAKA 4ARSA 1SK8A 2C9OA 2OSVA 5AIBA 1X7ZB 4NSNA 2FQ1A 3Q41A 1IOWA 1J25A 3NG1A 5T8KC 1AQUA 1GKIA 2BFMA 1W29A 4XX0A 2POQX 4U00A 2PGAA 2O0HA 4I4LA 4Q9KA 1ZH6A 3VNRA 2MU1A 2IDZA 3DZFA 3HR4A 3Q7TA 1F2VA 2QDXA 3B8EA 1PRYA 2Z4SA 1PSZA 2VHYA 3DCJA 3IEUA 1UZNA 2X5KO 1F2UB 4J1SA 1HE4A 3OFKA 4TMKA 3TPCA 5LP6C 2Q3LA 2DR2A 2B0CA 3VTAA 4O4JB 4PU0A 3HCEA 2ALYB 1RE0A 1C3OB 2PS0A 4QBIA 5F5XA 3EZYA 1ZGCA 3G7SA 1VJCA 1RM0A 2PJUA 4XIFA 4BB5A 4FILA 3MJEA 4X1IB 1DIBA 1NOJA 1FUUA 3MT0A 3ZK8A 3OX2A 3L7NA 2R97A 3IR5A 1C1XB 4NQZA 2XR1A 3IILA 3ILHA 3ESRA 5A5GA 3AUSA 3DYIA 1QLJA 2O2CA 1T9ZA 2RHOA 1K98A 4IY1A 5ECGC 3RU3A 3KKNA 4AG3A 3PFIA 4EUKA 2WUVA 1CETA 4TL6A 2OOSA 4EHIA 1XCMA 2I80A 5IABA 2FPIB 2C54A 1H3FA 3LUKA 3WX0A 1O8CA 2ODQA 1C50A 2Z2YA 4GI5A 4JVNA 3T9FA 1XAGA 5GMOA 4HNQA 3TLGA 3BB1A 4FXOA 1WX1A 1J1IA 1E7SA 2HFJA 4LQLA 3N6XA 3PXEA 4D3YA 3TSWA 1EE1A 1DDGA 1WZIA 4WY2A 1QZXA 1E0DA 4IUDS 5IHXA 2LD4A 1R4AA 2GESA 3MCTA 3E3OA 4YYEA 1TPYA 2EV9A 3IOCA 4GVLA 4XXHA 2C5GA 2VJYA 2WNHA 3BRCA 3IT0A 4XDYA 1YZKA 5LOVA 2BFCA 1A82A 1T2FA 1VL1A 4GZMA 3LW7A 3IAXA 3N2LA 2AEJA 2I29A 1OCEA 3OE4A 4R71A 5FAKA 7AT1A 2MINB 1IZ0A 1X8JA 2B0JA 2JIDA 2IK8A 3K5HA 4KPGA 4TT3D 5MDHA 3DB2A 3VU9B 2WM2A 4GYYA 3L2ZA 1QHHA 4YP0A 3GN2A 1UBFA 4MV9A 5J4VA 5KSPA 1RYFA 1LSOA 2VYNA 3SMQA 4YR9A 2D8MA 3EOAI 2RHMA 3VBBA 1QIJA 4FIZA 1TK9A 4LY0A 2PRIA 2DYKA 2IYQA 3NC1C 4P4TA 4GZ5A 4PPNA 1DJOA 1KVTA 1L8QA 1DT3A 2WZDA 1MNQA 4HNAA 2JKYA 2IHUA 4DZZA 5B6JA 1HURA 4D9CA 2C2OA 4Q4HA 4RNDB 3N53A 1N6HA 2DQ0A 2EZ9A 2REOA 3P2JA 4LDNA 5DFAA 4RTKA 3VR2D 3GT0A 4C76A 5JS6A 4J7XA 2I4TA 2LUOA 2RGAA 3D4PA 3MGBA 2A94A 3MS2A 3HO8A 3Q3CA 5HF9A 3VBCA 3DMTC 2QS9A 1ZAYA 1VIVA 5AOVA 1FYXA 4ZVLA 3V42A 4RK1A 1ZW1A 3RVLA 5LQNA 4DLBA 4DIFA 3WZMA 1VIYA 4R9VA 3Q8LA 1LK0A 4LYFA 3NTQA 3FF1A 1Z74A 2D7JA 5AKHA 1OPXA 4G9BA 5LP6F 2FDRA 3FWNA 4W8HA 2HD4A 3KPWA 3V8VA 4KLZA 4Q6WA 3UK1A 1Z7MA 1EUCA 2IYAA 3R9KA 2JGJA 3LBFA 1SBQA 2OHHA 2ZIZA 5JPIA 1KC1A 1U31A 1SQFA 3V6MA 3FHLA 3QU2A 1E9FA 2P5TB 3NW9A 1TC1A 3LOQA 5A03A 3OX3A 4S24A 5CLJA 5SZHB 5A9RA 3DD5A 3DWFA 1UZAA 5AK6A 5CEFA 1FNNA 1CBUA 4HA8A 4F38A 2WFZA 4OXYA 3AW9A 4J0EA 3FLMA 5EL0A 5HOQA 3KPUA 2M1ZA 1XXHE 4Q9DA 1EP3B 3EUFA 4I9FA 2PGLA 4A6XA 5AK3A 3PJFA 5TXGA 1KSFX 2FPPB 2I6TA 4KODA 1DRUA 4Y1RB 5BVHB 1Q50A 3H6GA 2HW8A 2HEIA 1FVXA 1BBUA 3FLBA 4FMDB 1MRSA 2JZOA 5I3ZA 2J7PA 3TPZA 2IYUA 2IYYA 3OQIB 2MMCA 5CIWA 4EHDA 1VKZA 4FKMA 2NVOA 3DXXA 1A8HA 2AR0A 2FLVA 4D9JA 2WMNB 2GZHA 1YE3A 3NKVA 3SHWA 3LA6A 4MUFA 3SYRA 3UJAA 4DY4A 2IYFA 2WU0A 3O75A 4XB6B 4ZOLA 4GKBA 3VPAA 1ITZA 2OMKA 1LLUA 3CH7A 3WL6A 1VHWA 3QOXA 1VPDA 4Z9YA 1RJFA 2NV0A 5FPQA 4P7JA 4TSFA 5ES3A 4HGPA 2QPLA 1UBLS 1JHVA 5FDFA 3FSEA 4D0SA 5D5HA 1XALA 2IEDA 3D4NA 1Z8NA 3HRIA 3R0IA 4UEWA 4XPZA 5IF9A 3KQPA 4RCYA 3VR5D 1IY1A 1DMSA 1ONOA 1QVRA 2Q9CA 2NSLA 1G8KA 1MFPA 1PYGA 2YJ5A 5TPWA 4L76A 3ACDA 2XYPA 2O54A 1FVOA 4RGBA 2P6UA 4YRNA 1HDYA 4XTRA 9LDBA 2VWHA 4N9WA 4KIGA 1RRPA 1IU9A 4RK6A 4BDSA 1GLVA 3T52A 3CPSA 4WGFA 5BV8A 5HRUA 2WKQA 4BNDA 3GGJA 4EY4A 1MAUA 5FPYA 1DLIA 3LBAA 3W7BA 1YBVA 1OFUX 2FWRA 2XCTB 4QTUB 3RRFA 3VHLB 2IC5A 1MX1A 4IOLA 1HDIA 3OTOB 3FYCA 4GX2A 3MBIA 4QFBA 4YRZA 1E4VA 5KDLA 3ZQJA 2G71A 4K1XA 7REQA 1B70A 4DSAA 1JG7A 3C8DA 3ZS8A 3I2JA 3KZNA 2ZBPA 3AL3A 3ML1A 3QOFA 3JS5A 2PUEA 4OAQA 3WA7A 4WESA 4H1WA 3FPLA 1YC5A 3N8DA 6REQA 2NP7A 4L50A 1Z3CA 4XLLA 5JNVA 4KPUB 5KOJB 1UDRA 2XYGA 4KFCA 2AX3A 4YJHA 3RKXA 1QQTA 4N5MA 5BYAA 4TLLB 4YYZA 2CFIA 2I71A 1TCUA 2KB0A 4I4TB 4QSMA 4NAVA 4BTEA 2JJ2A 3BWYA 2AOWA 3L07A 4RJIA 4QM6A 3B53X 4X8HA 1CX9B 1I36A 5KJFA 2HU7A 5DW3A 2YXLA 3EZLA 2PWPA 4BO2A 1VG1A 3NETA 4I14A 4CG2A 2VBCA 2V5VA 3OLXA 4P92A 1EP9A 1H5QA 2PY6A 4GWLA 4FFWA 5TV2A 4LY3A 4CIDA 1UP4A 2Q5OA 3BIFA 1XZQA 4F2PA 1BMDA 3DWIA 4GUAA 3TEMA 3V1UA 1ENOA 1ANKA 1NNEA 2PLWA 2Q5JA 2WZQA 3KDPA 3QW2A 3NP7A 4MV0A 1PR2A 3ODGA 4NBUA 4XX0B 2H1SA 1X3SA 4G1CA 3SZMA 4Q1DA 3HXQA 3SBEA 5DPMA 3CR7A 3FCCA 3NXSA 4QBKA 3WSWA 1JB1A 3PHCA 2Y4NA 1XR3A 4BFTA 1SA0A 4EB8A 3K5WA 4ZJZA 2AFVA 2VBGA 2XYRA 3GZJA 3MT7A 4JVSB 5DASA 2EFDB 1GOTA 4QRIA 3E9QA 3Q9LA 1RBYA 1TU4A 3CX7A 1XF9A 5J58A 5JFTA 1V1RB 4HB2A 2O3JA 5JYBA 3H4TA 1SVNA 2C4KA 4X1YA 4YA6A 5SY6A 5TPZD 5ICGA 1EIWA 3OX4A 4HN2A 1KL7A 2FZVA 3HMKA 3FOZA 4YMSA 3E0QA 2QGNA 5DULA 4EYKA 1HYBA 5GPBA 1GT6A 2COKA 2H54A 2KE5A 3A2MA 3H11A 4R68A 3CZAA 4XGRA 4NBLA 5CJPA 1R4NA 5G4LA 5CDFA 4KQEA 4FHFA 4ITVA 4FS8A 1FA9A 2RDMA 2XIQA 3OQJA 3GLFE 5LD2C 1O9BA 1EI9A 2WWYA 1YASA 1YCGA 3P9IA 3ZHZA 2GKOA 3B48A 4L5YA 3TLGB 1PNVA 2GK6A 3GFTA 4CDGA 4L28A 3L1IA 1G3RA 1UPAA 4JC8A 4QJ4A 4RY8A 2D0DA 1EFDN 3AUAA 1E2KA 1XMVA 3OM1A 4BL5A 1F3LA 4HWKA 4LOIA 5DJ5A 2GAAA 5KDOA 4Q34A 4F4CA 4EKYA 2P2ZA 1K6EA 3H1GA 4O33A 3IR6A 5P8WA 4ZAGA 5LOVB 1DX9A 2NTEA 4GPEA 4IIBA 4KL8S 3TRHA 4QLBA 1TFUA 4EK9A 2ID7A 3MRXA 3EOBI 3ILVA 1JEOA 4OQDA 4NARA 2ZAIA 4XUCA 1AS2A 2H6EA 7YASA 3MTIA 1KJIA 1SBCA 1QHHB 2E82A 2GEDA 3B6JA 5F35A 4EYEA 4EJ2A 1S8OA 4KLAA 1QPBA 5FOVA 2R8ZA 4YTEA 4I19A 1XMPA 5HR5A 1RRFA 1YQXA 2WD9A 3NHJA 4MOWA 4OXXA 2E5LB 1EK6A 2AMFA 2AQHA 3FTNA 1C8KA 3THYA 1U2PA 4HNAB 1REQA 2X86A 4MWOA 1AKEA 1KO4A 4MWSA 3H65A 4Q4HB 5BYJA 5TVKA 1Q7BA 1SXGA 2EZUA 4J49A 4BWYA 1LJLA 2PL1A 2QSZA 4IEFB 1P6XA 3BA6A 1EVJA 2G1KA 4G5XA 4IXDA 4JOBA 4WAUA 5KPJA 4D9IA 5AMXA 2EBUA 3IODA 4FJ0A 3O74A 4B3HA 1HNZB 5CYOA 2VAXA 3RC1A 2JDIA 4ZOCA 3RGWS 3AFGA 1IBMB 1F0NA 4RACA 2IVZA 4NXNB 4QUBA 2NO9A 5C4MA 3TINA 4KX5A 1L1FA 4BJHB 1CJKC 4B3FX 2HLNA 3Q2IA 2XF2A 1A9OA 5ALOA 3BCUA 4ZYLA 1DEHA 2JH9A 5DRTA 3QXSA 1EUCB 1GGHA 1X7WA 4QVKA 5LKAA 1F2DA 3GXOA 4RV4A 4KFRA 3TB6A 4HTFA 3UWPA 2DSTA 4KDCA 2FXIA 4PC7A 4B8YA 3JQFC 4I8IA 4PO1A 2I9PA 5JQWA 2DBQA 5H16A 1IL2A 3JQPA 5JFOA 1NVVQ 4GM0A 1T9HA 3MWDA 4QJ5A 1H6DA 2XQKA 3PXBA 2XYVA 2O2GA 4HK4A 5JD3A 2JIRA 3V4SA 3TPFA 1JSXA 1QXSA 4LYGA 2DR3A 4O2BB 3LX6A 4P54A 1X0VA 3LBYA 2PQ0A 1V39A 4QOEA 5ECYA 5A02A 3JAMA 2G5GX 1T0BA 2FGJA 2R85A 2K87A 3OZVA 1E1QD 1K8XB 4RGYA 3O9MA 5IMSA 2B6HA 1JG1A 5IDXA 1FDUA 2JB9A 4DV2B 2Z9DA 4B47A 3GVIA 1T6BY 1UFOA 2K2QB 3NBXX 4E94A 5FPTA 5IM5A 5BQ5A 1BMQA 1L5WA 4RD3A 2PR7A 3DJFA 1YTUA 4FOTA 5LXTF 4QGFA 3ABOB 5BUSA 4NYJQ 4R0NA 4IQ8A 4AKGA 1R27A 1JPNA 3PLRA 5AW7A 1FDVA 2H2IA 1TZKA 4N3NA 4KMSA 3GVHA 2Q99A 1WY5A 1CF2O 2XADA 3C5EA 4H1TA 5HGQA 3PL5A 5CLQA 1O89A 1I0IA 1Q1QA 2PGXA 4Z0PA 1L4MA 3ITDA 4UPVA 3QTBA 1M3SA 1MPXA 2Q4DA 3UIEA 3ZNNA 2X4DA 4MB6A 1USIA 1Q7TA 3D8SA 1L5FA 2JLWA 1U1EA 1UOPA 1D4ZA 3CLHA 4U5XA 1F5SA 5LA6A 3I01A 3F2IA 4GMKA 2FW9A 1N5MA 2OECA 4CGYA 1DIRA 4B2LA 1O4VA 5TPWB 1A69A 1UODA 4V3CA 2H2HA 1SVLA 3LQ1A 3URMA 2PKQO 1SERA 2JZNA 2OC4A 2V6IA 3EVBA 5EKXA 1OXBB 3U13A 4BRZA 3DLPX 4HNTA 1H9CA 3WI7A 3QY9A 1CUCA 2OXFA 5H3HA 2RG1A 5ALUA 1M1NA 4RK5A 5DBGA 4XR4A 5DMXA 5TQ0A 4DR2B 1MO5A 4ER0A 3KQHA 1MAHA 2X0IA 2LTAA 4MW5A 3SHOA 4DMGA 3KXPA 4DUYB 4QYIA 2GRAA 4JH0A 3IAUA 2GJAA 1J2RA 5L40A 1RRVA 5T7BA 3COSA 2EIHA 1OA0A 1T8RA 4G4SO 2P91A 1Q84A 3SC3A 7REQB 1XLTA 4LNSA 3CA8A 1DLJA 1QVVA 3UV7A 4JA2A 2XODA 3ENKA 3PWTA 1NVTA 4UBIA 1QHEA 3QTTA 2WIAA 1RSZA 4WESB 2FUG1 2RGEA 3VQWA 4NCNA 3TK1A 3WWOA 3N8GA 4DEXA 6REQB 1J70A 4ZOEA 3DO5A 1P31A 3O31A 1SIUA 3MNFA 5DP1A 2XMBA 2J6CA 2GSDA 4P2BA 4YJHB 3JSAA 1GG2A 3G59A 3GPBA 3AHCA 2JJ1D 1O08A 3DNFA 2BLNA 4XPIA 6ABPA 3UMSA 2PGNA 1DS6A 2J5QA 2ZRBA 1XTKA 4M86A 1PLLA 4TQUS 5DHTA 1TUBB 2OP1A 2OQ2A 1RXWA 1YR2A 1Q19A 3LGAA 2WZBA 4BY9E 4DSNA 4O1MA 2MSEB 1QOPB 1VHLA 1Z6XA 2WHEA 1GTG1 4HR7A 4AX4A 2BGJA 4N3AA 1JXMA 1FUIA 1MIHA 2ZITA 4MGEA 1Y0BA 5EJEA 3C3DA 3VPHA 3V7RA 5JAMA 2G76A 3I76A 4NZPA 1G9TA 4NNJA 1JJIA 2E49A 4ZPXA 2I66A 3EWAA 4PY2A 3QGMA 4TYYA 1YR6A 4JI6B 2JFVA 3SBDA 1NVBA 4BMYA 1Y1RA 2P1DA 5IM4F 1YB1A 1GNVA 1SA0B 2WKPA 3IVMA 1JYFA 4KQ6A 1NBAA 4RLSA 1VYVA 3SE0A 2XCRB 2VNHA 3KCQA 2ZW9A 3A11A 2RJNA 1MHPA 3NTXA 1XA3A 2HYDA 2Y77A 2DLCX 5LDDC 1AKNA 1GQFA 3BDIA 4BFLA 3AIOA 2ZTGA 2IUEA 4YR7A 2Q4BA 4KXLA 1F1JA 1KVSA 1EFCA 2DQ4A 2QRNA 3C4JA 5GM1A 1DC3A 1Z88A 3WRXC 2GF9A 4DXDA 5KWEA 5F1KA 3OY2A 1GTL1 4O4LF 5TGDA 3W6NA 2XUIA 2DUMA 1KQGA 1TE2A 2NTNA 3ZBTA 4DKXA 4PN3A 1H66A 1R4NB 1DI0A 2QR2A 2W11A 4F84A 3GLGA 1YOVA 3A1FA 2XQFA 2X1LA 4QYXA 2QQEA 1YWGO 4YP5A 3VQYA 2RCYA 4LK2A 2VZLA 1LDBA 3NIBA 1X7YA 2CSUA 2EBFX 4GSYA 2Z6UA 4RFSB 4J91A 3WK5A 4KO3S 5ELMA 2CLMB 4OI4A 4PXAA 3WWYA 4IDAA 4XB1A 3HKEB 2C8JA 4LZJA 3ADOA 1GU7A 4WJZA 4MRRA 4NK4A 1Q83A 4OCZA 4ZU1X 1DRJA 5LIPA 4OOEA 1DO8A 3IP9A 1YTLA 5ARDA 1NBMD 1CY8A 2ANCA 2QMEA 1L9XA 3IUMA 4JI1B 1CUAA 1HMYA 1XWWA 3H9JA 4LTMA 4NAHA 3AI3A 1ESMA 1NVAA 4KXVA 3CBQA 1KI6A 1TQ8A 2OWDA 3EODA 5G1OA 3KU4A 4PAQA 4D82A 3V8PA 4BNGA 2WWVD 1PL6A 2DWUA 4Y2VA 5BO5A 2IDMA 3UMYA 1ENPA 3WGGA 5C7YA 1AKTA 2AEFA 3D7LA 1E3LA 1Q3HA 1QWOA 1RVV1 2CF5A 3AIMA 3PWKA 4RF3A 1REQB 3THYB 1AN0A 1FF9A 1M0EA 4ZCLA 5B2FA 3FMIA 1PGJA 1FFGA 1VLVA 1YS2X 3D7NA 4RKYA 4RW0A 4ZEWA 2G4CA 2ZYIA 3DL7A 3Q5GA 4PYIA 4DDWA 1EVQA 1NR1A 4GIBA 1Y8QB 2QE7A 4YV0A 1E3MA 2V98A 5F9FA 2ZS7A 1CUYA 1A97A 2JK0A 3PL1A 2DBZA 1B4DA 4TTIA 1P75A 3TX2A 1RPAA 4NY1A 1J7KA 1NOIA 4R05A 3FXAA 2QHUA 2QRUA 1ZIXA 1NU6A 3CMQA 3EVEA 6GPBA 1DTWA 1PFWA 3ED1A 4MR8A 2K6GA 4Z0NA 4RVHA 3T41A 4CUKA 2V4MA 1X7WB 2Q8QA 1A5ZA 3OF5A 3M1LA 1ISPA 1I3OA 4HTFB 3PWSA 3PQ7A 3QFFA 5IVPA 1YD7A 2GSWA 3CKKA 3O26A 2I99A 1VMAA 4TTSA 5LJLA 4B31A 3H5OA 6ADHA 1GUBA 3D7KA 1Z25A 3BZWA 2PLFA 3CLRC 1U0FA 1XVVA 3N05A 4HEQA 4QUJA 5CUQA 2I7VA 4LRSB 3UMVA 5I01A 4ZI2A 4GGOA 3TB4A 4KVZA 2Z1DA 1TCCA 1GUDA 3MWDB 2VPQA 2OXCA 2WDZA 3OZAA 1BFKA 3RKRA 2P6RA 4AY2A 1U65A 3EMDA 1JQAA 3CM0A 4OHOA 3WQRA 1RR6A 1PJAA 1IJFA 4E6PA 1TXGA 2DSNA 3G0OA 5ICMA 3O2QB 4KMRA 1KDVA 1IONA 2XMSA 4GLFA 5CW2A 3BERA 3HJBA 1Z83A 4YIHA 3B60A 4W7HA 4H6XA 1YFJA 2R3SA 3QWFA 4G5HA 4URFA 3FUVA 4EQ6A 1G64A 2C9DA 3ZGVA 4JWKA 1G60A 3GOQA 4WCFA 3T9AA 2D6FA 1DCMA 1OTXA 1HFKA 2CY0A 1YQDA 2OD2A 2HQBA 1J0BA 2WEKA 3OMWA 2BM1A 3PQ5A 3LT1A 5LP6A 5HMMA 1RQ7A 1SOAA 2CBZA 3FR7A 3WS7A 3STWA 2VI5A 5HCIA 1WPXA 2JBWA 2VPTA 4Q93A 1G66A 2IPAB 1BDMA 3O94A 3V7NA 4IIGA 1YI0A 3C6YA 4MUNA 1RZVA 1Z16A 3CEAA 1SHUX 2H1FA 2YWEA 5LA6B 3WDLA 3OQPA 3HZOA 4YT5A 2Z0MA 1QRDA 2EFYA 3GLIB 3OJWA 5JZSA 2R2GA 2IU3A 1R0BA 1RWQA 1FU7A 1TUGA 2D5LA 1KIFA 1M1NB 1XEXA 2XVZA 5TQ0B 1JSRA 2AW3A 4FD2A 4Z8YA 3UUEA 4BS9A 2G88A 4FFLA 2DH5A 3AEQA 1RYMA 1W2HA 4NECA 4Z0TA 3EBPA 5T57A 3L0ZA 3WYFA 4P71A 1HO3A 3FY4A 3JVDA 3PI7A 2EFGA 5JY1A 5IRCD 4HSGA 1L7PA 3KXDA 2XQVA 4PZDA 2G5CA 2XMGA 1IB0A 4GE0A 3TLYA 3M6LA 2VQFB 3FIJA 1PT8A 3R9WA 1JQEA 2AL7A 5CVEA 4UD6A 1UPTA 5ITSA 4OP3A 4MPTA 3KG2A 4B9AA 1KQOA 2PRZA 3KUXA 1WQ3A 2HLPA 2AN3A 1RWWA 4JI5B 2HR1A 3DF9A 3IJPA 3IPYA 2PZJA 2VOJA 4D25A 2GT1A 3M4JA 1XRSB 2LR0A 2PH7A 2D1SA 1RE1A 3P94A 2E4ZA 5HZMA 5JE8A 1ZUD1 4PSUA 4BPRA 3HCAA 1CDEA 2OO5C 4KIJA 4M8IA 4BRUA 2N9UA 3OPVA 2QTTA 1B8AA 5L7YA 3ANYB 3BGWA 4TL8A 1XMIA 1D9ZA 1L1EA 2F90A 3IOEA 4QHYA 2QMZA 2P4QA 3RRYA 4NYMR 4YCJA 1PX0A 4MKHA 2BTQA 3OLQA 4BB6A 2VFAA 1O97D 2C9BA 4DQ0A 2IBMA 2BHRA 1XMSA 1IMOA 4YV2A 1L8LA 2BM8A 3IIIA 3KJZA 3KFVA 3RARA 5TQ2A 2OMEA 2Y9MB 1DX4A 2QMQA 2EP7A 1QFMA 2C2ZA 3GMIA 4AY5A 5L8VA 2DJZA 4WZZA 2FMTA 3WP0A 2EJFA 1R8JA 3ZW8A 4Y7DA 3QU9A 2Y2UA 3VH4A 3IO3A 4EGCB 2Q2VA 2ISSD 4F4FA 3R8FA 1I2BA 5GAJA 2QNIA 3HDHA 2F1KA 4X94A 1AO3A 1D7AA 4TXLA 1KMMA 3WYNA 2K7FA 1OTYA 4ODIA 1S4QA 1UT5A 4YJFA 3DDUA 2FEWB 1S1CA 4QLOA 3MIIA 4QEDA 2I62A 4CM3A 2BTEA 2IS1A 2ZXEA 2YKGA 1G38A 5K45A 1ZO8A 1N6KA 5C1OA 2WOJA 3UH1A 2HA5A 4RCVA 2QV7A 3P0RA 1VCMA 1DFGA 2IPOA 5H1YA 4OLBA 5CB8A 3NH9A 2CLHB 3AUTA 1ABBA 2PS1A 4EY6A 2P69A 1JDPA 5KHAA 2J45A 1G19A 1X7YB 5AW8A 4Q24A 3P2OA 3TI7A 2R6JA 4L0QA 3THSA 2E4YA 1LD3A 3VHXA 3W8RA 4C3OB 1QS0A 4GQIA 2RHDA 1UPFA 2IUYA 1V7CA 4I3GA 1U0LA 1CPYA 1DVRA 1V9LA 3FSGA 4K9NA 1SKMA 5EWLA 3RIRA 2XDWA 3NC4A 5CJ2A 1H2BA 1KI6B 4MKGA 5AVUA 2PWAA 3GGGA 2YMLA 2AN5A 1G3UA 4B6FA 3S29A 4BB9A 1ND5A 4EBBA 2HSWA 3SBOA 4AIIA 2OXEA 3ISVA 2L82A 4L5CA 1V47A 4RYDA 2VJMA 4XYEA 2XE6A 3OU6A 4Z49A 2BGMA 4HWSA 5JMWA 1U2GA 2NUPA 2HF7A 3DHWC 3S2ZA 2JAQA 1P18A 2WSSA 2OR3A 3I0ZA 3OZUA 3E7DA 3AU8A 3N3BC 4YAEA 3KLBA 1I5EA 4IEIA 4UUOA 5DVZA 5GJWC 4ZCPA 5B58T 2XD4A 3HEMA 4LX0A 3RUCA 1PEYA 2HSGA 2YY6A 5KNCD 3OQBA 1AO0A 4ZVOA 4DV1B 1N6RA 1TM1E 5IVDA 1DCKA 1VA4A 3HXXA 2ZZNA 3PGA1 4HRXA 1U94A 3EEOA 4GGMX 3M1YA 1ETHA 4QUGA 4LKOA 1L8AA 3WBBA 3GRRA 1E89A 4RTMA 1EK5A 3LX5A 3A26A 1DTWB 1FP2A 1HZZA 4MR8B 4CM1A 2RH8A 3GJ3A 2DQKA 4YRKA 2J3QA 1CUEA 3EQ9A 1A4UA 3IBCA 2WUWE 3ILSA 4ALLA 1NVDA 3G0IA 4PQGA 3L4BA 1YZLA 1TQ2A 1ELOA 1I3LA 2QD3A 2L2QA 1QORA 1NUSA 1RZ3A 5AW5A 4DCGA 4HC4A 4MARA 1LK7A 4RHTA 3WRWA 1KJYA 4ND8A 1JIJA 2ZJ2A 2H5IA 3G9ZA 2W2QA 3C1TA 4HNUA 4JU9A 4F5DA 4XDHA 4I3HA 1JHOA 2QL9A 3DBHA 1J5XA 3PF8A 4YP7A 4EG5A 4YP1A 4HWRA 1U9YA 1T29A 4TKUA 1PUJA 2Q3HA 5DGXA 2C3OA 5CTAA 1XTTA 4V3BA 4UTNA 3ZHRA 5HW0A 3AFIA 2FZ5A 4TRNA 4EQ6B 2B99A 3IBGA 4MZDA 4P74C 1P1KA 1D1SA 4ER3A 2UZ3A 4PG7A 4FGSA 4PPQA 3ZE7A 4M8KA 1FBTA 3G0BA 1DEXA 1XTSA 5HE8A 4MIYA 4U7PB 2GZDA 3P97A 1F06A 2BFAA 1U8ZA 1U9IC 2WIFA 3D6FA 3EZ6A 3EZFA 5LP6B 2AE2A 5I8PA 2Q5CA 3UAOA 2O8FA 1WQWA 3K8QA 4N03A 3PYMA 4RS4A 3RK1A 4GG1A 4JBYA 2HRBA 4Q01A 4B6RA 2CDBA 4AXXA 1L7EA 4B3SB 5JS1A 1R37A 4UZEA 1WVGA 3EUEA 5FTWA 4WERA 3TLEA 1WTCA 4ZK2A 4H60A 4LJ6A 3ASYA 1VE6A 4HRAA 4DA6A 2DU8A 1V95A 1DV1A 1JDZA 1LX7A 4KN6A 1C9DB 4E1AA 2QTRA 1BMFD 5DGTA 3SDZA 5HYVA 4KPEC 1RYYA 1CEQA 2QN7A 3UICA 4NK5A 3DWGA 1C3EA 3RSQA 1LC0A 1XEXB 1I7QB 4QECA 3LPNA 2YOHA 4Y6LA 5C7LO 3NOOA 3OUZA 4E33A 4JJZA 4UBLA 1M8GA 3AEQB 5AQEA 3EQ8A 3U17A 1GDHA 4BNUA 5JV5A 5K20A 2KWIA 1FRFS 4M37A 3QO8A 1JIVA 3L8GA 1L5HA 3I4CA 4ZZIA 1YS7A 2O5CA 3MWYW 2AJDA 1H94A 3M33A 5JXWA 3D0QA 1SUPA 4DUGD 2F67A 4NTZA 1SVWA 1T6YA 3PPXA 2OCPA 4YUXA 4GFDA 1RAFA 4P1ZA 3MUFA 5BUCA 2FX3A 1PUIA 1XU9A 4RGQA 3PQDA 4RE6A 5EHXA 3S2EA 5JDIA 1G16A 3AM3A 1Q3KA 5CYFA 1PGQA 4K9QA 4QQNA 5I9TA 3VPCA 3B1ZA 2I8CA 2JCBA 2X6RA 4FEYA 4KTTE 1YB4A 3RUIA 4AT1A 1W0KD 4D02A 3U44B 3GR6A 2MSNA 2WMDA 3DDZX 3Q4GA 4NJMA 3SR0A 4A26A 1LX6A 4D4IA 2CUTA 2RH4A 2DPXA 4I66A 4TYQA 4QEKA 5HFNA 3A7EA 3KHSA 4D74A 4IZIA 5JWOA 2QJOA 1WLSA 3CWCA 3OCZA 2PRKA 4PGGA 3NDRA 5HDQA 2ZTSA 5DM4A 3I6QA 2A67A 3PWZA 3RH0A 2BTQB 4OQZA 3G9TA 4KXUA 3JRNA 3LKVA 1CNMA 3M0EA 4KQ1A 4OHKA 4R51A 5TEWA 3VM6A 1L4BA 3UJDA 4BQNA 5HZKA 3BQMB 4IGKA 1RZUA 1PQWA 3RYIA 1GCUA 2JAWA 5TQ2B 4C4RA 5AVWA 1GM5A 1CUDA 1SD2A 3VAZA 1XU7A 5K3EA 2GN1A 2ALJA 3JYOA 5IT0A 2ECPA 3H1AA 3OETA 1ZG3A 1XPJA 2JJ8A 4L1KA 1W1WA 1RWPA 1P8AA 2Q8PA 1ZJZA 2ONZA 2R6R1 2YV5A 4F5WA 2E4UA 2R00A 2ZI9A 5C81A 3WL4A 1N2CA 3RSOA 3NAMA 3IHTA 3K31A 4X24A 3UJ3X 4ZMSA 1M34E 2VDNB 3HC7A 4M54A 3RV3A 2C83A 2GPNA 1SQ0A 4QXRA 4YJFB 3N87A 5B2ZA 5JD6A 3AGQA 3NT4A 1GGNA 3C6QA 3PI6A 5CFZA 1DGQA 3FRJA 4C2AA 1B6GA 3OCJA 1O5IA 4WEQA 4AO6A 1E6WA 1WJGA 2WJJA 4FJ2A 4BBZA 2VJCA 1RQNA 2AVDA 3NATA 4R8LA 4US0R 2WU3A 3NHAA 1FMCA 3FM9A 4LOKA 4OHRA 3K5IA 1L5NA 2IH5A 1N2IA 1A9RA 1R6XA 1I2CA 2YJNA 3B9RA 5E6UA 1TYDE 2J0QA 4REMA 4OJQA 1OMOA 1Z75A 1VXRA 2HHCA 4RFLA 4B3CA 1AQYA 4D42A 5KOIA 5JD4A 1U0NA 1NOKA 3U3ZA 4BEVA 2JFQA 2Z08A 3GX1A 4ZVSA 3I9JA 1P80A 2H9YA 2O2HA 3VHXB 2WIDA 3FYTA 2LCIA 1V37A 4JI0B 1QS0B 3DVAB 4P3YA 1RM3A 2DPHA 3QJYA 4ZU6X 1P4RA 2ERXA 1CQIA 1DO2A 1IEXA 3W05A 5EWLB 4XRRA 2NLOA 4PTLA 1ZBQA 2GTIA 3OHMA 1BOOA 3SM3A 1E1LA 1OBOA 2QTMA 4CS3A 4S0ZA 2PH5A 3HYLA 4WOJA 4Y2SA 1FYFA 2YXBA 3ETJA 3IAM6 2Q8NA 4ZRDA 2IV7A 5EJ8A 4DV7B 2ZRGA 3QX3A 3DTVA 1HYHA 1L7DA 2OCAA 3W2GA 2VJMB 1TYZA 1QANA 3F8SA 3PR2B 5BV2P 1UIRA 2NUPB 2FZLA 3X1ZA 5KNBH 2ZRIA 2A92A 3AI7A 4OSEA 3K70C 4AJHA 5IX8A 2PUDA 1XGKA 2X3YA 3AIIA 1SB8A 3UXYA 2J9GA 1QYXA 2ZSIA 4M87A 4BMPB 3OQMA 1RJ9A 4TV8F 2Z8YM 1NJ5A 1JQBA 4LCJA 1J2JA 4JCCA 4BNXA 1PJ2A 2ZJYA 3C0KA 5GJBA 5FB3A 3UA4A 2G5PA 3V46A 1WVMA 4HAXA 1O97C 5AWFC 1C8VB 4KQ9A 5IN4A 1RKXA 4LV5B 4ZEOA 3X0DA 1S4MA 2JCYA 2P67A 4OLFA 1YB3A 4FMPA 1ZSYA 1BXRA 4A23A 1BKSB 1FXWA 1SCQA 1P45A 4KV9A 1KYYA 1WP9A 1Z8DA 1U8XX 4X91A 3TECE 1RC8A 2QM0A 2GJKA 4D0NA 3VKHA 1Q2UA 1JIQA 2HBYA 3A25A 5A5DA 1RU3A 2NUAA 4DRZA 4FFPA 1OD6A 4NKRA 5JROA 1X2EA 2OILA 4HYYA 4IICA 5F1PA 2E5AA 4V1CI 4PVDA 1GO2A 4I4CA 4BP8A 5K1XA 1IWPB 1URPA 2FFQA 2ZJ1A 4N4AA 1NX9A 4ND8B 4V0OA 5LC1A 1MOQA 4EGFA 3WLAA 1JH8A 2HK7A 2ZU0C 4BP3A 5AUPB 4DMKA 4C6SA 1TMKA 2Y0EA 1NI4A 3FWZA 3IV7A 4ZVMA 3KKZA 5JXIA 3DBHB 4IVNA 3VKFA 3IP6A 3EHEA 3X2EA 4BQFA 1K7FB 3NEAA 1UT8A 4EHJA 4TKUB 4K3UA 3Q98A 2V7GA 3SZLA 4E15A 4X44A 4HH4A 5U1PA 1DWPA 5ICFA 2O19A 3I37X 4QDOA 1JIXA 2P9EA 3PRKE 4B46A 3H0KA 3VYTB 1R8XA 4JLVA 4H02A 2VHUA 1ZWLA 2IEYA 2YJ4A 2YYYA 1EFUA 3AR2A 2Q3FA 2KX7A 4UHBA 2HWWA 4X63A 4QQRA 3PX2A 4L8LA 1WD7A 1TQ4A 3H1BA 4HNVA 4AQDA 1MH9A 1WRBA 4UDOA 3SLKA 2CCGA 4MB2A 3Q12A 4TLBA 1JLKA 2DWQA 2FJPA 3V00A 2ZJ7A 2O8FB 1H1LB 1KAOA 2X22A 3LWZA 4DA8A 5B37A 3CYFA 1XJCA 2GNPA 3VR4A 1HWYA 2WI8A 2WP8J 4NZMA 1G9SA 3E23A 1OJ7A 3GJYA 4Z99A 3R7LA 4E46A 3ON5A 4EUSA 2GZSA 3H5LA 3FA2A 4QTYA 5J4KA 3KIPA 4OUDA 2GRJA 1QR6A 1F20A 3C7KA 3SC6A 2GZAA 4X41A 2A9VA 4F7DA 3JCZA 3M9LA 4L0MA 1T34A 2WSMA 3M4XA 4IILA 2ZAMA 1ECCA 1VGRA 2B1GA 3F6RA 3AVTA 1U7TA 2HWUA 3ZGOA 1CEXA 4OGLA 5SYAA 1JHQA 1LDMA 2YVLA 4MYTA 4XI9A 4UEQA 1SRQA 2EJCA 2G25A 2HHLA 4WXEA 4RENA 5K09A 1IN4A 3OPXA 5JJKA 4EW2A 1SVOA 1E1KA 2XAUA 5GM2A 1L5HB 2P5SA 3AR5A 5CLHA 4LPSA 2FPXA 4F5EA 3ZH2A 3DCNA 1ZK0A 1X7XA 3DFKA 3TXYA 1QK5A 4E51A 1P61B 3HUUA 4RELA 4KE6A 4BGVA 5L3SA 1N8TA 2L17A 1T1GA 2GBGA 3C3BA 1V3TA 3EY9A 3Q0EA 4OYRA 3VJMA 5CG1A 4LOJA 3U9LA 1OA1A 4Y30A 2H8GA 4PICA 2A9QA 1PQUA 4OP0A 1UEJA 3I3SR 1P8JA 5I7AA 1B93A 3PT9A 4OPMA 4LBYA 3A6FA 4WOCA 3VC3A 4YCAA 3ZN2A 2QLMA 2HYIC 2YXDA 3W5HA 1KMCA 4C87A 4NJMB 3WV4A 4P0TA 1XZHA 1MAAA 4E2WA 5FL7D 1KMNA 2YFHA 4RF2A 4ER5A 4J9UE 3WQQA 4D6XA 4MRSA 1AUXA 2VDQB 4L02A 3U9SA 5B4VA 3OQHA 1G63A 4YACA 2HX1A 4ENQA 3D0RA 4IIXA 2PZGA 3M2PA 5I4BA 3ZCUA 1NJFA 3ZK7A 2ZBRA 1P4HA 2F9LA 2I4NA 2NSDA 3TDNA 4IO0A 7MHTA 2OCYC 2VDRB 1OSNA 2Y6VA 4BFUA 1ID1A 5CXSA 2LBPA 3GCXA 3U7JA 3RS5A 4BU1A 5IC5A 4YRLA 2AMCA 1C7ZA 3KSUA 3RYIB 5JJCA 3N70A 1SOWA 3PICA 3KL2A 1LLQA 3PPYA 4E5DA 2W2MA 3E3MA 4RA9A 3OZGA 4CF4A 1ASYA 1VHJA 4PQRA 2Q7HA 3GWGA 2W8BA 1NNHA 3CZ9A 4ZEVA 1N2CB 2Q5EA 5HG0A 2IHNA 4HAZA 1LBEA 3SI7A 4ZVRA 3D4BA 2BGNA 2ZSEA 4LHWA 4JR1A 1AMOA 2C9CA 2ATCA 3EPJA 4CCWA 4UOEA 3K2QA 4B74A 2AZXA 2H2FA 5SV2A 3P8TA 3EULA 3DF7A 4RJJA 1HM5A 2VCYA 1A3CA 1KZYC 3A1VA 4AS1A 3LRTA 4AZTA 4GDFA 3EXG1 1E3EA 3DV0B 3A9RA 3P26A 1X56A 4MEAA 2IZ6A 2BD0A 4RK4A 1IXKA 4O63O 3DW1X 4HY3A 2Z98A 4PLYA 3ULKA 3WRYA 2QWXA 1E6KA 1YRBA 5E6UB 5FLYA 3T38A 1JAYA 1RQXA 3W7AA 1KVUA 3ZHUA 1GKLA 1YUBA 3BZBA 2QP4A 3C39A 3MJ4A 3MIZA 1QJCA 4ZGBA 1FFBA 2JFOA 1XOIA 5A0VA 3UPUA 1PS9A 1Q0SA 2GBPA 1XEAA 4TLMB 1CZRA 1K5DA 4TV9F 4CBVA 3GN1A 4DSTA 1E18A 1L5LA 3STYA 4CH4A 2J59A 1X0XA 2WE8A 2GZ1A 4M21A 2G63A 3E9EA 1HDRA 2PIAA 4HUQA 1CQIB 3PKIA 3ONEA 3OWOA 2RHRA 1HE3A 4PQYA 2DLDA 3INNA 3EZXA 4H2TA 3ASZA 3RABA 2P0EA 2PX2A 2GHQA 3LUHA 1DRWA 1ODTC 4IPTA 1F7UA 4HFMA 2IXEA 2PGDA 2XVAA 4RLHA 3NEMA 2VF4X 1E3TA 4P93A 2WJVA 4LJ4A 4LXGA 4XSGA 5EMJA 4PYNA 1G20A 4HGYA 1OZHA 4N49A 2HK6A 4EZEA 1AGXA 4OQFA 3FZYA 4M4SA 2JVJA 5FYQA 4B7CA 1EUQA 1RJ9B 4NU6A 1EFVA 2O50A 3ABSB 3GAAA 1BWRA 3SN6A 1M75A 1YB5A 4Z2YA 2NSYA 1JJAA 3SQOA 3IEXA 1TJNA 4D4LA 1DQYA 11ASA 2WF5A 1DEAA 2NP6A 2R8BA 3RAEC 1NLFA 3DMNA 3MMNA 4MR7A 4EMBA 3VPBA 4RC9A 5BWBA 1OFIA 1UEXC 1BXRB 2VZ9A 3K0FA 4KXMA 1YBHA 4LHEA 3DE5X 4G0OA 3RVNA 2BVNA 2CD7A 1ACLA 3KZKA 2B30A 2XXAA 4CMJA 3NXKA 2JHAA 2VHTA 5LCXA 3W4JA 1COWD 2O8BA 3PCOB 3INYA 4HLQB 2GPSA 1ADBA 2WE7A 2NUAB 4G89A 3ONWA 4IHQA 3HKBB 1EP1B 1T3HA 2ZYHA 3PFWO 1EDDA 2NACA 2J30A 3RADC 4K9RA 2OO5A 4L07A 1Z34A 1PIWA 3KTFA 3T7TA 3F0TA 3WYDA 3RBZA 5BNIA 5T5QA 3BUSA 3KVYA 1NI4B 1R12A 1MJ5A 4HH0A 4L5AA 5ALNA 3SLRA 2HAEA 3LP8A 4UBKA 4YMVA 1UKAA 3EA4A 4WCVA 4PYJA 1W9MA 2E10A 1GG9A 2FLKA 1OHHD 2I4RA 3FHJA 2AQKA 3AC0A 3H87A 3X44A 3OQOA 2V7QA 5G3ZA 5LYJA 1B74A 5BSWA 1U2EA 2N75A 3U19A 1VBFA 1IY2A 4XJXA 1QFXA 4BMVA 3D6TB 3F98A 2V3CC 3CXUA 5BQPA 2ZYWX 2Z8ZA 4JX9A 2GHRA 3NBYC 3RYTC 1TB4A 4QYTA 3DP7A 4F86A 1KPHA 4BX0A 2C04A 2ZRMA 3PXUA 4IXWA 4C4AA 2JJYA 2MTBA 3GLKA 2B4KA 3GH3A 3UOGA 3OT5A 4E4TA 2QM8A 3HCFA 4OJMX 4PSKA 2UUAB 1H2YA 5LQDA 5JC1A 3MT8A 1R0YA 3MINA 3N6VA 3BTVA 1QM5A 5FQNA 3ZGZA 3I0MA 5THKA 2UZAA 3L8DA 2QL7A 2BKXA 2FPUA 1EP2B 4HAWA 4HYEA 2VA8A 5B36A 3W5IA 3FDXA 2ZCEA 1HQDA 3ETLA 4AICA 2O0KA 3EZGA 3PVCA 2C4TA 4LOLA 2BBWA 3ISJA 4CF3A 1PCXA 3HBLA 4F4IA 4NC9A 2OYRA 1HYEA 3PC2A 1GNPA 4BNJA 1QHIA 2FQQA 4J0JA 1DWOA 1RC0A 2AC7A 2Q0HA 1OXXK 2V0CA 3IAS1 3MSXA 2Y1LA 4Q82A 5ALFA 3IUYA 1Q0PA 4ACAA 5DH9A 5GINE 4NVRA 3GJQA 4P7FA 4JVOA 2NPIA 4WMLA 3FI0A 4F3RA 3N2KA 2ZR3A 5F5WA 4K86A 1GAXA 2PCLA 3DS8A 4RJLA 3QWIA 2DXUA 3ZWQA 4JSRA 5H4HA 2RSLA 1N4AA 5L3SB 5EQDA 1CJTC 1ZOIA 5A2GA 4EO4A 3GF4A 3PUHA 1FSZA 3KX2A 3PHLA 4PZYA 2FSVA 4UCWA 3RIYA 2QKYA 4EB6A 1N1MA 4R8VA 1QRUA 1CTQA 2DHQA 1CULC 2P65A 3CWZA 1KJJA 2ARKA 2E1PA 5TMDA 1H0HA 4NWIA 2I2WA 5FA8A 4KX3A 5BSFA 2IS4A 5GVSA 3ESDA 1ESNA 3CPEA 5DYYA 2P9BA 1FX0A 3AV3A 1IJEA 4OP1A 1R0SA 1V45E 2XCQA 3FI9A 5J5AA 3ZLVA 1KAQA 4Q4CA 5BN4A 4K46A 2IU6A 1OX6A 1T1RA 4S1OA 4EPYA 3LCCA 3MLAA 2OUIA 4IV5A 4JELA 3VO9A 4WLVA 1U8CB 2O07A 3ZVRA 1FL9A 1HE1C 1J8YF 1YBAA 1E1RA 1BH2A 2AZMA 3T9CA 1J4AA 2ST1A 1YZVA 4EJ6A 3G17A 1CQWA 2E4AA 4ETIA 1VE7A 4HB4A 1L4YA 4UFNA 1OH8A 2B8JA 2AMCB 2F8MA 4X00A 4YQYA 1C3LA 4RMNA 2XVXA 5HBGA 1N3IA 4HDSA 1CUGA 3E35A 4L7QA 3RTBA 4XM1A 2JI9A 2B7BA 1EFPA 4RA9B 1H5NA 1M2VA 4MUIA 3COZA 3EDOA 2D5BA 1N92A 2W8BB 3HVKA 1ZHOA 4OB8A 3H5AA 5AYVA 4U63A 2ORWA 4HDCA 1U1IA 3I9V1 1FSGA 4WLOA 2ILTA 2D2IA 3SF0A 3T7EA 1HDCA 4L8WB 1RLIA 1GPKA 3MCAA 4DLKA 2P3QA 1HQCA 3FAZA 4O4HF 1FQKA 1TA4A 2P9ZA 4DQUA 3OWXA 1PZGA 3OI7A 3VZBA 1EE2A 3F5DA 5K3CA 4X1KA 2DT5A 1B42A 4RPIA 5HK8A 2PLNA 1HH4A 3AUFA 3IBTA 1NY6A 1WPQA 4UHDA 3CXRA 4BLOA 4FDAA 1X9IA 1LLCA 3UWDA 1ZVJA 3DPIA 4BGUA 1DJQA 2Q07A 4DSOA 2GKGA 1O96A 3P0HA 2HF9A 1A7JA 2EX1A 4X5OA 1VSVA 5J5VA 1NQ5A 2WNIA 2ZSJA 1HE8B 3NB0A 1RWXA 1VRWA 5E3IA 2A5FA 3NJ4A 4LF9B 3ROQA 1YR3A 2ECFA 4X6YA 1U9IA 5F2OA 3CKMA 5K4AA 1NUQA 2NIPA 3VKUA 1C3XA 1KFBB 1MX3A 3OC0A 4HUQB 5GONA 1DC5A 4YGYA 5HKLA 5DSZA 4DLTA 4KI0A 4JI4B 3OHPA 2BSXA 4UOQA 4CMEA 5LKRA 3JQ9A 1F8YA 1DXYA 3HCCA 2GK4A 2ZWMA 1CU1A 1NRJB 3HB1A 1R88A 3SY8A 4B6GA 3DQQA 4QU5A 2WW8A 2PFGA 4DIMA 2IZZA 2ODRD 4PO8A 3N0RA 5CFQA 1DBSA 1YHYA 1KMQA 3QU7A 1W0CA 2WKWA 3FFAA 1PYOA 5HF8A 5ADHA 5MFPA 4X0EA 3O0DA 1ZUIA 1G20B 1MABA 4QPCA 1XNGA 3LZ6A 4DA0A 1P7WA 1F0YA 4FMCB 1PJLA 3OQNA 4M36A 3AUXA 4UD2A 3ZXYA 1KYIA 5J1SB 5KMGA 1UFKA 4F97A 1N2XA 1EFVB 1VJDA 1ZMXA 3IV6A 1YMUA 4JS0A 2HA4A 3DM9B 4FONA 3HA2A 5EJGA 1USYC 4QJ3A 1LK5A 1YZ3A 1MOZA 2I8AA 1BEUB 1JS1X 2OA0A 4B48A 4DEYA 1NJSA 2AEEA 1JPVA 3D8TA 3GHHA 4LGYA 5JSZA 4QUDA 3RHSA 3MERA 1ESDA 1LUAA 1SC6A 2AFHE 1I30A 3COWA 4QYMA 2J5XA 1U02A 1Y5LA 5CA0F 3K0FB 4L2IA 4UPEA 3TRDA 5C5CA 4PLCA 5C3MA 4OSOA 5CGZA 4YMHA 3NP9A 4WWHA 4YC7A 4GL2A 5AM4A 3U4MA 3W3AA 3RI3A 1O0SA 3EXIB 4P08A 4JU8A 2O8BB 3MUNA 2Y4OA 2AXPA 2B69A 3FTPA 3PFFA 4W5JA 5FUBA 3A32A 1WZCA 1AA6A 4NZYA 4FDUA 5EI5A 1J90A 1R9NA 3G1WA 1FTWA 2I2FA 4F5YA 4ABTA 3GY0A 2WWWA 3PNVA 3VJLA 2RKBA 2ARSA 2E21A 4WFIA 4IDBA 3U3RA 3UTCA 2CZCA 1N1EA 3OEWA 1KY4A 2WF9A 3U44A 5LZ8A 3PE4A 4YDHB 4KN9S 2W6JD 1MT3A 1X1EA 4TL7A 4K6CA 1IOVA 1VJRA 4Q48A 2OCGA 5LXTB 1G21E 4CGZA 4IDEA 1PR9A 1PKXA 1VI6A 3LK6A 3UHJA 3OLZA 4BX9A 2Q49A 3RV4A 4S1TA 5B3AA 3LHDA 4P5DA 4S1VA 3IP5A 2YJZA 1NYQA 5LYJB 3AJAA 3Q11A 3SQXA 2XB6A 4KPFC 1V8DA 4AK9A 3E9RA 1T5TA 4HS9A 5IDVA 2JLXA 2VH2A 3P96A 1J8MF 4OJNA 3UXHA 2FJ0A 3HFJA 4WD3A 8MHTA 4PCUA 1BC5A 4CCYA 5MN6A 3OEHD 4B2YA 3OZRA 4Q16A 3LPMA 2JAXA 2H06A 3BFKA 1I5RA 4BECA 1PK8A 3ZU2A 4G5FA 4ARIA 2BDTA 1ECJA 4RKEA 3UCEA 1X80A 1J49A 5GOZA 4S04A 1YJXA 1P0FA 1TECE 2FFHA 2JK1A 3IFSA 4FYWA 4MW9A 3RYFA 4A8JC 4ETMA 4GPZA 2BAGA 4UM5A 4CIVA 3MINB 3NONA 3Q8KA 4PW0A 3GNTA 5FCDA 5KX5F 4FZRA 3KYDA 4HJRA 3IUBA 2HCFA 2PNFA 3DHEA 3PA8A 3TZCA 3EX7C 2O2DA 3L8FA 4QATA 5BYBA 4BNHA 4BASA 3GNSA 1HFEL 4G65A 1DJLA 1S1MA 1M6EX 1PGNA 3FTFA 6NULA 2HCRA 2ZQZA 5L53A 4LVIA 2VZ8A 4KNVA 4MVJE 4DDVA 5TEVA 5KS2A 1WV0A 3QNWA 2BLLA 4TYWA 3U39A 3EFRA 2GGSA 2WLTA 3C7AA 2VF2A 3E7XA 4MUGA 3UG7A 2A58A 4JVLA 3GG9A 4P36A 2O3SA 3CRNA 2XOXA 4AL4A 2OD7A 5CCXA 1RLTA 3N2KB 2IKQA 2I3ZA 4P4GA 1STOA 1VKOA 3HN7A 1OR8A 4WASA 2PJDA 3PNLA 3S40A 1U3UA 4E13A 1YGBA 5A62A 4PYKA 1ZKMA 1ZU5A 3MBOA 1TAHA 3L0PA 3T5MA 4EB6B 1WXXA 4TWIA 5CNMA 2VATA 2ZI7A 1QX4A 3CX3A 5I48A 2BEJA 2WWFA 5A4JA 1EFRD 1TU0A 1JALA 2R6HA 2RHBA 3AERA 3TOVA 1FX1A 1G8GA 4F71A 4BP9A 1SCAA 2GYVA 4ESEA 4M9SA 5AKIA 5EGSA 4JSTA 5BN4B 4L87A 1YNSA 4RDCA 3G0DA 5SYNA 2YMMA 4LQCA 5LP1A 1CUJA 4ND4A 4CM9D 3DD1A 2WPDA 1YB7A 5IU6A 5JPCA 5DRYA 2YV4A 1NN0A 2EX0A 4YXFA 3P9CA 5K0FA 5CFOA 4FWTA 1R0RE 1R74A 1BCSA 5A5VA 1XT6A 4WACA 3KSAC 2H3EA 3S2YA 2WYHA 4MYDA 4QFCA 1TL7C 1FUYB 4FDTA 4J43A 4WN3A 4ISBA 3RVDA 4HDSB 4EPVA 1QIIA 1XZIA 2Z5GA 3NTLA 1OILA 1N6OA 4Y2PA 3QE4A 1CK4A 4BNIA 3R7SA 1Q95A 1EFPB 1P1BA 5A3JA 1KZ1A 1SN7A 3KOWA 1M2VB 3KQWA 2NZWA 5DI3A 4IQGA 2XH8A 5F4BA 3HJFA 1YJQA 3Q3VA 5JIBA 2R1UA 3EAGA 4FU0A 3CG4A 4QNMA 4RZSA 1DKQA 1E0AA 4OYHA 3IDSA 2VT2A 3C74A 3OSZA 4FWBA 3UN1A 3WLQA 2YZGA 4ZAXA 4AKSA 3L4GB 1G41A 3QK7A 1YUNA 2BEUA 3DA8A 1QE3A 4F46A 1PW7A 5KNNA 4Z4FA 3VH2A 3VZQA 1JKFA 4X1KB 2QD4A 3W1VA 3BBPA 4KQKA 1TTQB 4MWEA 3NEYA 1KQNA 1R15A 4QU8A 3UNXA 1XDGA 1E2PA 3CHYA 1UKCA 4FUQA 2RIRA 3KJXA 2EBHX 5CDUA 1O96B 5IKEA 4X3OA 2WUDA 4PGAA 5C7OO 4F8EA 4YRCA 3V2UA 1VXOA 3SR4A 2FW1A 1GJRA 2LZ0A 1CQXA 2PMBA 3NALA 2F9FA 3A6EA 4R81A 2FK8A 4MUAA 1WZUA 3HI4A 5A4KA 2DCUA 4IIHA 1D03A 4TZKA 5LQAA 1USVA 1XZGA 2OQRA 4RLFA 3OZFA 5CK5A 1KDOA 5JH7F 3VNUA 4FOSA 4A2QA 1TVKA 1D2MA 2PFKA 2FFRA 3F4KA 5EPOA 4UULA 3O6VA 3L01A 5K3DA 1V71A 3WLMA 3R1IA 4TKVA 1QUFA 2X19A 2OFWA 4NDAA 4QHSA 2FMFA 1Z5OA 2JA1A 1GNTA 1KZ9A 3KOMA 1FLAA 1JDBB 2YXPX 5LBTA 3L92A 1V6AA 2FRDC 3A28A 1Y9DA 3DOUA 3ANNA 1R8QA 2G67A 3M1AA 3PE6A 3DMFA 5SZJA 2ZRDA 2GD1O 4FEEA 1DG3A 3U4GA 4W9NC 3UJPA 3VQXA 1MABB 4LE2A 1VE9A 3O8LA 4EJSC 3UGJA 2ZZMA 1R8YA 1MDFA 2N42A 2NM0A 4MMYB 2J9RA 3CUVA 5CT6A 1SR8A 5KMGB 3ENWA 2PKCA 3ZG6A 1M33A 4C0BA 1IEVA 4A0FA 1IDOA 3RT1A 3CUKA 1TF5A 2FWJA 4GD3Q 1DG9A 1GLGA 2APJA 5JSYA 2B9VA 3NBZC 4KR9A 4D8WA 5CYGA 1AKRA 1S2OA 2VSXA 3TAHA 4CHTA 2ZDHA 2CLEB 1P7ZA 5FWDA 4YEDA 2C2HA 2OYSA 2VYQA 1JLSA 3CZRA 1JDNA 4L2IB 4B76A 1Z5VA 5JZMA 4G0PA 5AICA 5HIAA 5IAJA 2FSGA 2J7KA 5J59A 4U2BA 1E61A 1PN3A 1C8LA 3H2BA 4GOND 2DT8A 4JD5A 2QRQA 2DTIA 3ZE1B 2HU5A 4X62B 1ISMA 2XGJA 1FCJA 2C4WA 1JEAA 1OYYA 2C59A 3F6PA 2PRJA 2HO5A 4ZJPA 4AKTA 4G0VA 3FTDA 3C3CA 4GX5A 2GN9A 1VL6A 3DJYA 5CRIA 3RNOA 5AM1A 1TYAE 1VQ1A 2VHCA 3D1LA 4JSYA 3URKA 1T6ZA 3Q0IA 4RD1A 4FOLA 5ALQA 5GTDA 5L6MB 2ZYAA 1DJPA 2XDAA 3AY7A 3RF7A 1G42A 1SBNE 5KSZA 2J09A 4IVRA 3VKWA 1KQPA 4EMTA 1EFKA 3JVIA 4AU1A 2EBWA 2CKDA 3KRTA 3QX8A 2BJWA 1UC8A 5EQJB 1M7BA 1AT1A 2B2XA 3DL0A 4PONA 2JPDA 2VJBA 1OIWA 4G41A 4N8DA 5IJZA 2VDWA 3AOGA 4FZ5A 3IB6A 1S2NA 3E18A 1AK1A 4IQ4A 4HRYA 1NW9B 2G8LA 1H2EA 3FNFA 4G1UC 4DJEC 3G1TA 1RPTA 1HKUA 3DT9A 4MYUA 1NURA 3RUHA 4MW7A 4QODA 4CCSA 4DHEA 2YRWA 2Y0PA 4CCYB 2QI9F 2YV3A 5IKOA 2QRGA 4L27A 3SP1A 3JQGA 3V7SA 1YJBA 2B7CA 2FOIA 2OWEA 2VP4A 4DBZA 2NVBA 1YCFA 1X80B 1XDSA 2BELA 3K0EA 5J4HA 4A03A 2F8TA 2X0NA 1QCCA 2AUMA 3RYFB 5JVDF 2QX7A 1GPAA 3D5EA 3AF0A 4FR0A 3QW4B 3NDPA 3H2HA 3B6MA 4MH0R 3QPCA 5HS6A 1ULUA 4HKTA 4LJKA 4DHWA 2DEQA 3KYDB 3NBMA 3Q3IA 2W8ZA 4CLOA 3B38A 4I8DA 2AK3A 1J2TA 1FBNA 1GL7A 2ODRC 1F9EA 3WE7A 2KMLA 3FNRA 4K5QA 1Z7BA 2DUUA 4F4HA 1SUBA 2ZKLA 4BKUA 1A0OA 2P5IA 1IRIA 3HKDA 4K40A 1E3QA 5T64A 3TSAA 3TOZA 4X95A 3HRKA 2PBFA 2Y1XA 3R3VA 2X5OA 3N8IA 4WK0B 2HA2A 4C5AA 2BKAA 2C82A 5JAIA 2H4WA 4PFJA 1WQ1R 3E27A 1MPTA 1I1QB 1UQUA 1EDZA 4I9NA 4JJ8A 5DHQA 1Y8CA 1NQTA 5KKNB 1BA2A 1C0PA 4NCKA 2ROQA 1EGAA 1Z35A 3GJRA 4LBVA 1LB1B 4AURA 2RHLA 2BOVA 2SCUB 2G1PA 1VPTA 3UFXA 2XUQA 1AXGA 3HACA 3SNKA 2NYAA 2Y05A 1I80A 1ZVMA 9ATCA 2X5XA 1HGXA 5AKLA 3RG8A 3ROKA 4GLLA 3SBXA 3IRVA 1Z6ZA 3TSCA 3Q5EA 1SUCA 2XD9A 3QWAA 4HMQA 3WMXA 3AEUA 1UK9A 1XL0A 1ENZA 2ZFUA 2H8KA 5IZCC 1YZTA 5HXAA 4GKJB 1PR1A 1SG9A 3MJTA 3AERB 1LKZA 3GJ0A 4UVEA 3JRWA 1C9MA 4MQBA 5DW0A 3K70B 2PPLA 5EQTA 1IOLA 3FW1A 4URXR 4G0WA 1OLXA 1VIDA 4OJKA 4DPLA 5I6DA 5CB4A 4OFBA 1O95D 2VKTA 5B12A 5KNBD 1ZCAA 3MJDA 5FUQA 4C21A 1BG6A 3B85A 5CDSA 4K6KA 3E9IA 4HZUA 3SQDA 2ADOA 2GERA 5CFRA 3WG9A 1CY4A 4MGHA 4GHWA 4XOIA 3J81k 2EAYA 3QOWA 3V9PA 4WJ4A 4Q7EA 4QUAA 1E92A 4ESOA 3W9UA 1Y6JA 1NONA 1WW3A 3LCRA 3QA3E 3B1XA 4JDPA 5C1PA 2BUAA 3VO1A 2H4FA 3EIOA 1Y3DE 2XECA 1FE8A 1ZNWA 5DI3B 4D92A 2JASA 4PNEA 3H5NA 1T5HX 3IVXA 1NVXQ 2AKAB 2Q2WA 3MTAA 1BHJA 2DULA 4KWCA 3DBLB 3A3PA 4TTTS 3AHJA 3BB3A 4NR0A 3AF1A 2PQ2A 1BJKA 1JEJA 1GZ4A 4JQSA 4E09A 1JVSA 1Y98A 1VBMA 1AGRA 1FQWA 4HMOA 3S8YA 2BEUB 3JZFA 4Y2JA 1R50A 3PR1A 3IA2A 4FHCA 2O0JA 5BMVA 3O5AA 3F46A 4GX0A 1B00A 1ISRA 3SXPA 2MJLA 2BPOA 2DHEA 3B3JA 3H99A 3PSAA 5K6AC 1NXXA 4FGLA 4GOKA 4NMLA 4ARVA 1QOZA 4Q15A 1CR4A 4JT9A 1JJ7A 1M1ZA 2JHCA 5AJVB 3TNLA 4AMUA 2FP3A 2B7LA 3VDNB 4V0ME 1D2NA 4D6YA 3ZD8A 4ASUA 3BMCA 2SBTA 2A8EA 5JAUA 4XTUA 3QE0A 2NT3A 4UTOA 3RFCA 3GLSA 1JEYA 4OATA 4BJ5A 1SU7A 2IOQA 5BV7A 5C8XA 1TVKB 1C7FA 2QT0A 3H8WA 2RE8A 3K5PA 2BW0A 1TVEA 2A1UA 2C5AA 2JAHA 3C8MA 1CXZA 3H42B 3INGA 4RGVA 4TKVB 2VJAA 3I09A 5CH3A 1KO5A 1NUHA 1OXVA 2ZUCA 4KE7A 3CTPA 3I2KA 3WGTA 2ET6A 1Z5WA 4PGMA 2R2AA 2ZXFA 1KIMA 2O3UA 3H19A 3CG0A 4L9WA 5T4EA 5B1EA 2XBLA 2IELA 2VHQA 1Q1EA 2NVUA 2VYCA 1EU1A 2ZATA 3MELA 4R6WA 4G5QA 4J1NA 1EBUA 4FZVA 4GXTA 3X1WA 1RLOA 1CE8A 2HDHA 3C5HA 1M0WA 3JWJA 2P9JA 4EFDA 3F9IA 1U63A 4OJYA 3HBNA 1VHQA 1YJCA 4TTAA 1VPLA 5FR1A 1U2SA 4Q3KA 2ZGVA 3T54A 4CYMA 2EFJA 3WMRA 1V2GA 3OE5A 1BCRB 4G3XA 2I4MA 1H0SA 4B6EA 1KXJA 4EG7A 4ZDJA 3HJRA 3GUHA 4BJ3A 2YCBA 1Q74A 1K6MA 3RAPR 3NOQA 4E5UA 5AVVA 3V2GA 4DN6A 2I8LA 2KQUA 4LXTA 1G9XA 1D4FA 2VAVA 5IMBA 4Q9AA 1DEOA 1GPLA 4GM4A 2V6GA 4NBWA 3WNCA 4UHKA 4ZZ2A 2B21A 4PO9A 2H2DA 3PKZA 3BXGA 4UP8A 1W1UA 4FYXA 1Z68A 3S5UA 4MPPA 2QVLA 4F4DA 5CNKA 5EKTA 3NMUF 1YV9A 3QLEA 5GZ1A 4QUEA 2OZKA 4I1OA 1LLFA 2DETA 1V48A 4TGLA 1D5CA 3W2IA 2DH6A 3F7OA 3ET4A 1X1SA 1V5IA 4MI1A 1KY5A 2PZ8A 5B7QA 1FTGA 4QSHA 1C4XA 4G24A 2Y1WA 3A9UA 2NUBA 2P9YA 4H7KA 2OG2A 3LK7A 5C5DA 3AHEA 2IV2X 2QJFA 1ABFA 3LO5A 1I32A 1Z0ZA 2H11A 4FZJA 5BWNA 2VDWB 2BGTA 2WJYA 1KNXA 3GLHA 3KLNA 2CNWD 2J32A 3FZNA 4P72C 2NXEA 1HFWA 4IUCS 4QO8A 2M6LA 3RVSA 4A36A 3RJMA 2H59A 1K4YA 3HA7A 1WABA 3DKIA 1KSGA 1T5LA 1TA0A 1L4KA 2BGRA 1CY7A 2FJUA 4PLVA 5EXSA 4ZARA 5IJAA 3SS7X 3H9UA 3W4IA 4ZTUB 4O2RA 4BNZA 3L8EA 5BN1A 3GYBA 5HUJA 5IDQA 1A98A 2FP4A 4AMGA 3R74A 3ZKAA 3SWWA 1YHZA 4UVDA 4WZAA 2IUUA 2Q7DA 3ER9A 1JFLA 4Y9DA 1J8QA 3L9WA 4JHLA 1C29B 4NU8X 3V7WA 4AIRA 1SHTX 4KQWA 2PUGA 4MIEA 5ALSA 1ODLA 1Z07A 3KQLA 2ZJAA 4WK6A 1ACMA 5ALJA 5DNCA 4O4IA 3U4QA 1Z6AA 3CSUA 5L7WA 3VDQA 4UHEA 1T1EA 4B80A 1J99A 2BDUA 3LUAA 1M2JA 4CLOB 2FN4A 1NLZA 1YJ5A 1NT4A 2AQIA 2F3UA 2XLBA 3EDRA 3EXHA 2HNKA 4HDMA 5K3AA 4O25A 5CD9A 4EYSA 4JHXA 4BVBA 2WF8A 2F7SA 1H8HD 2O1WA 2R25B 3M4ZA 4Z53A 3AKCA 4MQMA 4ZQBA 2HA7A 3IVCA 4RANA 3HKDB 3M3DA 1UBMS 2I33A 2F1HA 2VUTA 1BKDR 3OESA 3R6TA 2HOQA 4Q7LA 1Q6YA 4FE4A 2M2IA 3HXTA 3TD6A 5JALA 4JP8A 5KTPA 1AIPA 2C3YA 1YL6A 2PUWA 2IKSA 4M1OA 2JLYA 2VPWA 1DNPA 2NX2A 2XYHA 3RM3A 2P6OA 5J2UF 4KAAA 1RIIA 2ZYTX 2PMDA 4G8DA 3YASA 5B3LA 1FRVA 2XB8A 3IYLW 2E65A 1MOPA 4LJYA 3FF4A 3QXGA 4YUWA 3MMZA 2F3PA 2FWPA 3BIXA 1IBLB 1JDTA 3UFXB 1UL1X 5JJIA 5D3ZA 3KKQA 4NE9A 1ADCA 1XB2A 1KJQA 3T3MB 3TYXA 3ZWBA 3K1JA 2RFLA 1OH5A 3EN0A 4LXQA 5IW8A 2FPLA 3O83A 1TYBE 4S12A 1XZNA 1ADGA 2IXBA 4Y9RA 4ZO6A 4BAUA 3AEUB 1KFEB 1OPRA 4KFTA 4KGDA 3ADDA 1JA0A 1GVNB 1SCKA 1LCIA 3OTHA 3G2HA 4H27A 2FRVA 3GBPA 3KWMA 4JKYA 5KYVA 1Z5PA 3BH7A 4FI3F 1N3LA 1GPYA 4A0HA 2Q1UA 6LDHA 3RF1A 4EKIA 1OLXB 5CB4B 2LPMA 1FOEB 2RAPA 2VDLB 4J0KA 2ZI3A 4KQGA 4MW4A 1Y1QA 4ITUA 4RD6A 4X20A 3W9SA 3BCRA 1W8DA 3EQ6A 2XE7A 3A6DA 2JI7A 4NZZA 3E48A 3IAHA 3N8NA 3GJXC 3UH0A 4HZUB 4C6RA 2MT9A 4OD0A 4MLPA 2I0FA 3GFRA 1N78A 2BGGA 2IV3A 3ZWMA 2C5LA 2VP3A 3JYHA 2YW2A 2DXIA 2DQ3A 3L8ZA 4XAQA 4XX1A 4UP7A 5KYXA 1K8QA 4HWTA 3JYPA 4V0QA 2WM8A 1Q0RA 4HGOA 4BBAA 3ZPXA 4JY7A 5DGIA 3PUYA 1YVDA 1Q0ZA 1FDIA 2CFRA 1FP4A 1R9MA 2IIQA 3BIWA 3E58A 3EIFA 4XM2A 5EJ2A 3B82A 4TS9A 1QIDA 4D3FA 3BD6A 5AQ1A 4BFXA 4IIFA 4XKJA 1KIAA 4FXPA 1BYIA 5AJUA 1TT7A 1AS0A 2J6BA 2R11A 4N54A 4RXTA 4Z9BA 1T43A 2CNOA 2ONCA 2ZWVA 4EVQA 5CA1F 4YAOA 4DOMA 1UANA 1SD5A 4UU8A 2OQVA 3HGMA 3S2GA 2R0QC 1DBPA 1NF3A 2C1EA 5HGXA 1EXDA 1UJCA 1WUJS 4L6IA 2UYYA 5CNIA 1R6DA 2AGVA 1EVIA 3VU0A 3MPUA 5BMVB 3CF6R 2XZLA 5AVTA 2CLCX 1PBTA 2LP4Y 3U0VA 2QY9A 4TV9A 3USCS 4X64B 4NG5A 4QM7A 1QYWA 1OW3B 1D5WA 1W88A 5DDIP 3BTOA 1I6LA 2JI6A 3QU4A 1NRXA 1VSQA 1Z15A 4MWBA 2QSYA 5EMHA 1N5DA 4EX5A 5H80A 3RC8A 2HQSA 4INAA 3UV3A 4K88A 1VBNA 3BKXA 3BMCB 3MT9A 1U8TA 4DQDA 4JQYA 3MW8A 4IP0A 4MR9A 1P29A 1EVEA 3ICVA 3K0CC 4EB0A 1E24A 4M8NE 4I5DA 3G1UA 2GXSA 2R6ZA 4DYHA 2PMFA 2A0KA 3FBWA 4PBSA 1JEYB 1GFIA 3I8OA 1HL7A 1W0JD 1PL7A 1W36D 1SXIA 3OJ0A 4CETA 5JPDA 1A9SA 2A1UB 2AFIE 4KGXA 2ZRNA 3PJGA 4NZ9A 4PBTA 2X0FA 4GZ3A 4DCCA 1DJMA 4H35A 5AUOB 2JAOA 1SCDA 3KZVA 5F76A 4B3IA 2AXQA 1KWKA 1T4CA 1LQUA 1ZDMA 2RGNC 3O3OB 4OHPA 4TV8B 2B1RA 4XVRA 3HFSA 4D4KA 5JNWA 3J7TA 3DZCA 2NVUB 1XAJA 5A4MS 4MGIR 2I9KA 2RBKA 1TZBA 2XWJI 4DBLE 5AM3A 1M67A 5D84A 1CE8B 1H0RA 1Y4DE 3KQKA 1CIVA 1KZ6A 3CUTA 5JW6A 1ORVA 1KQFA 5AH0A 3VQTA 1D09A 3UJ6A 2P78A 4D8TA 4QPPA 1NSTA 1O95C 2ZRJA 5CPFA 3V4OA 3HK2A 4B3RB 3ZE9A 4JGBA 4ESVA 2CFOA 5KYUA 4JT4A 4TOIA 2ZDGA 1SXJD 4E31A 4NZNA 2FYKA 2I4OA 4Q9IA 1E1CA 3WY9A 2XW6A 3KUCA 3DEJA 1BE1A 3AKEA 1KC3A 1ZI6A 1GZ3A 2ZJ3A 4BKRA 2GNAA 4J0DA 2A9KA 2R5FA 4OK3A 3RTAA 5KNDH 1CUSA 3PUJA 3PITA 3QKRA 3F4LA 4URVR 4I1VA 5JS7A 1NJ8A 1XCBA 2SKDA 1DRVA 4CKBA 1OJLA 1PS8A 5ELOA 4KHZA 1SXQA 1ZINA 4MW1A 5E9WA 3N74A 3UA3A 1IWBB 2QRZA 3WLIA 1EYZA 1M54A 4DZTA 1CP2A 1H4TA 3ENNA 1RHUA 1NXSA 1TOAA 4GAEA 3OO0A 5K0CA 5CH8A 4N48A 1NVGA 2B5VA 5AJYA 2XUFA 2CMHA 4B43A 1XTJA 1XHFA 2NU9A 3F8WA 4EW3A 2ONYA 3RB8A 3ZDCA 1C3VA 3KZ1E 3OQ1A 4BVGA 2IXFA 2Q0XA 1EG2A 1TJ5A 2W6IA 2VJOA 2Y1DA 1GUFA 3AQIA 1SESA 3T1TA 4IZ6A 1TQDA 3GLHB 5JCZA 1FEZA 3N58A 1ZN2A 2CN1A 4XYLA 3C3WA 4UAGA 4XH9B 4PR0A 3ER8A 3ZY2A 1CJBA 2AJCA 1GZ5A 2AJBA 2TYSB 1YK1A 3FZGA 1LFAA 4I9GA 4URHA 4HUTA 1MOSA 1QB8A 1JR4A 2QTWB 1FXUA 1UBRS 2FP4B 1XDBA 3ORFA 2ZYUX 2ZBGA 1H2HA 2I7TA 4KO4S 4WZAB 3VXKA 2GF2A 5BOSA 3ZHSA 3ANSA 3TIIA 1ODIA 2D2FA 2CK3A 2R7NA 1B1CA 1R8SA 4TMXA 3V8RA 2GA8A 3F47A 5KQSA 2X8JA 2LWIA 4KRGA 5FFNA 1CB7A 1OU0A 4O4IB 3U4QB 4IGIA 2EKPA 2PX3A 3GHYA 1BMTA 5HIJA 4F1JA 2HMUA 3EXHB 3B3AA 3WJAA 1VMIA 4HDMB 3ZJUA 3WKEA 4S0XA 4N1AA 1YKGA 1Y3HA 3L5OA 5F1YA 2ZB7A 2ACEA 4FHDA 5AW0A 3K9FC 3MHTA 1IN6A 2C1ZA 1W76A 3LHSA 1GGJA 4K9PA 4QXMA 4EKGA 2XUAA 1PBNA 3HNPA 5FD8A 2P8JA 1EXMA 1AGPA 5HFJA 2QT9A 3UT6A 1AMUA 1C7RA 1EJBA 2EKZA 3GPCA 3JD2A 4M1TA 4LRYA 3HCNA 5CYPA 1EIZA 3E81A 5A04A 3WWPA 2AH5A 3UAZA 1ZJ5A 4F06A 3HBAA 5FO1A 1IHYA 4Z4CA 3BFMA 3BSYA 1NUAA 3PUXA 5I3CA 3ZUPA 4TWZA 2VCEA 5DYTA 1J5WA 3T0FA 1M7GA 3FDFA 1PV4A 5DI9A 1WB4A 4TVOA 2ZWAA 4UXJA 1XRJA 3AVVA 1RM5A 1E0JA 2GWRA 4QWWA 2H1LA 4M0MA 4YBRA 3EYWA 4DIDA 4KAJA 1T6NA 3PS9A 4D8YA 3QBJA 3FUTA 2Z6AA 3OZIA 4JEMA 1WNFA 4JJEA 4E6EA 1T4MA 3DL2A 1SU6A 2FRDA 1W73A 1D9XA 1Y63A 2DCMA 3DEFA 3T3GA 2PBRA 3WMWA 3AVUA 2P3LA 4W9NA 5JYDA 1KSHA 1M83A 3VMMA 3DPSA 1I1OA 3LFUA 1OAOA 5JEEA 2NO6A 4OHFA 4RHEA 1WHSA 3GFPA 3D4OA 2JIQA 5EWMA 3T1NA 2PZLA 4X20B 3SR3A 2NO4A 5I51A 3OIVA 3L4SO 2HPAA 4OH7A 4O59O 4IXNA 2XQIA 4BGEA 2MSKA 5FR2A 5CBPA 4OBWA 3GRUA 3NHLA 1C4OA 3HCOA 3GEHA 3D81A 5LM3A 1JMVA 4IKOA 1JLHA 2JIBA 1GA1A 1UMBA 4RNCA 1CDZA 1W2GA 3FFWA 3BJEA 5BSVA 5KYXB 5EOVA 3EJ6A 3I83A 3C3EA 4EVRA 3WXBA 1KY2A 1XDUA 4FQ8A 2CV0A 4NAUA 3DP9A 4NOKA 4O2LA 1FP4B 4J0FA 4LF4B 4O4HA 1IAQA 4C20A 2YJ6A 2C7RA 4NEQA 4V39A 3LBIA 1D04A 4M3NA 2GWHA 4RXMA 4BZQA 1LBHA 4CHGA 3NU1A 1NWCA 2C7PA 1UBTS 4AJNA 3BPSA 5JCOC 1HMPA 1MJHA 2XOKD 5C5EA 3EA0A 3TUZC 1NJGA 4YREA 2FR8A 2YWGA 5T6MA 2QQ5A 1ULSA 5K9ZA 1PE0A 1SKYB 3TNYA 3PNYA 3ORSA 3MWFA 4KRYA 3A4TA 1YZUA 4AP9A 5F7JA 3QEBZ 4MAFA 2HMTA 4TV9B 4IXMA 2XNSA 4MO2A 4D80A 1IIBA 1W88B 3KV1A 4JNCA 3FGZA 5ELNA 1NSFA 2EF0A 3TEJA 4EG6A 3BE5A 1PR4A 3CLKA 4V0RA 3S5JA 1M2WA 1T24A 3TX6A 4C7KA 1BDJA 3TJRA 5JAHA 3OJFA 1WULS 2IUTA 1U6IA 1QIKA 1F4VA 4R2HA 4RVSA 2DU7A 1CLUA 2HV8A 4MR9B 1AK9A 4C0QC 2PMWB 4DDKA 3LVBA 2QMUA 2W2TA 4FFVA 5EVCA 3WADA 3S4YA 4BZPA 4EZBA 1JPJA 4TZ6A 1KOFA 1JU4A 4KLNA 2Z3ZA 4QG3A 3AK4A 5J63A 4EGJA 4E14A 4OMFG 2DKOA 1T3LA 2C03A 2NU7A 3O21A 4A8JB 4K3VA 2OENG 4FI3C 4HGQA 5AJXA 3BJRA 4EF6A 3NO4A 5D7BA 3RFUA 4OHBA 3NQ41 3LG2A 3N75A 3NT5A 4BVEA 3DMGA 3B2EA 1N34B 2EJ9A 2B1QA 3K32A 5FI5A 1YZFA 1C0LA 5FBKA 2H7XA 3MZ0A 3PFGA 1JAIA 3AY0A 1E94E 1BWPA 2G4LA 3EW9A 3PXCX 2OAEA 4DQXA 5IVKA 5DMHA 1X54A 3F5MA 2AI2A 3SXJA 3T6KA 1XLWA 1AQIA 2KJQA 1EGQA 1PZEA 5CA0A 3ZXSA 5T67A 3QXCA 4V0SA 1JHMA 2N1MA 4ZRMA 1L5VA 4MTLA 1RIFA 2GZ2A 2FWMX 3PEEA 3WIEA 5KYUB 1VYHA 2ZBEA 4GRIA 1WSDA 1E1CB 1A96A 1GWNA 3DLAA 3X1DA 2A1IA 4KJXA 4PSVA 2N0SA 2GMWA 3QEKA 5EP4A 1DB3A 1GUAA 5FKJA 5AW2A 3AEKA 3I2GA 1HXHA 5BSEA 1TM7E 3QVSA 2GUGA 5M34A 3C15C 4MQFA 3QKRB 4MUHA 3RRXA 3ZIAD 5KWSA 2YNMD 3R41A 3CEHA 4YLEA 2Z58A 1RDFA 4HDKA 4HDQB 4EG4A 4W7SA 2P3OA 1RHQA 3JD3A 4CKBB 1QCYA 1J8DA 3G8BA 4PSDA 5B7GA 5IZCA 4M1MA 3Q7QA