3RUXA

Crystal structure of biotin-protein ligase bira from mycobacterium tuberculosis in complex with an acylsulfamide bisubstrate inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate Adenylation Inhibitors of Biotin Protein Ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords BirA bifunctional protein
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ruxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ruxA01
2I2LA 4EMGA 3CMQA 3HXWA 4H2XB 4X5OA 4RQFA 3G1ZA 3DSQA 3L4GB 3MF2A 3MEYA 2CJBA 3LSQA 2QHTA 4HT8A 4UP9A 3BY7A 4NL2A 3RKWA 3HXUA 3TEGA 4J15A 2DJZA 4M77D 2EJFA 4M78C 4PJOB 1H641 4C8QF 2ARTA 2DXUA 4RQEA 5GMKh 2QTXA 4YRQA 2DU7A 3LSSA 4PJOE 5GAOn 5GANh 2ZNJA 5ELOA 2DVEA 2CJAA 2XGTA 1Y96A 4YRTA 2QHSA 1IL2A 4M78E 4HT9A 3HFNA 1YGBA 4P75C 2ZINA 3JB9F 4JRKA 3HRKA 4P72C 3JCMe 4XU0A 1EFWA 4YRSA 1X56A 4TVAA 4P75A 1EVKA 4TWAA 4M7DG 1FYFA 1X55A 5DY9A 5GMKi 4P3OA 1GGMA 4M75E 4M7DE 4F7UF 2I4LA 4EMKA 4EO4A 1G5HA 3QO7A 2ALYA 2DKGA 1BIBA 5F5WA 4P71C 3A7UA 3HFVA 2DTOA 4UP8A 3PGGA 2ZT7A 4DQ2A 1QE0A 4M78F 4PJOD 2ZNIA 4M75C 1JRIA 4M7DC 4YRPA 3VQVA 4M77G 1WPYA 3V8LA 3A7RA 3HFOA 3JCMg 1KMMA 2E41A 5GANd 4C92G 4ZTZB 4CS4A 2ZT5A 4RMFA 4HWOA 2PMEA 4CH6A 4F7UG 1WYDA 3HXXA 4QVCA 2FYKA 2DTHA 4P73A 3JB9H 1BBUA 5GMKl 1D3BB 3GIBA 3P8VA 5C53B 2E64A 4TQFA 4BW9A 3JCMc 1N9RA 5GAOr 1I5LA 3NENA 2XTIA 2ARUA 5LJ5h 4KQEA 5LJ3h 4C8QD 1C0AA 2RA2A 1WQ7A 2DZCA 4YCVA 3L2ZA 3QNEA 4XQ3A 4H2SA 1E22A 3RGLA 4YREA 1X2HA 4HA8A 3VQYA 4H02A 2EJGA 3JCMf 3HXYA 1X01A 3IKMB 1J5WA 2E65A 5GAOm 3E9HA 4M78A 1X54A 1YB3A 3QTCA 1WQWA 1SRYA 4PNOA 3SWNA 2AMCA 3HXVA 4C92F 4H2UA 4YRLA 4M78B 3QSUA 3RACA 1ASYA 4J5YA 4M75B 4M7AA 4M7AG 2ZGWA 4JLIA 3JB9D 1NYRA 3L4GA 3MF1A 4YRFA 1E1TA 4BWAA 3TEHA 4XTXA 3HY1A 4XU3A 3SWNB 5LJ3e 3V7RA 2ZT8A 2DQ0A 4DPGA 2RM4A 2E1HA 5LJ3j 4KR2A 2EL9A 3NETA 1WNLA 4M7DD 4X9CA 2DU5A 3RKXA 2ZTGA 4CS2A 4F7UE 3EFSA 2I4NA 5LJ5e 4YRCA 3RERA 5GANf 4Q15A 1HXDA 1ATIA 3ERRA 2J3LA 2ZZGA 4YRGA 4WF2A 5GAN7 5GAMd 3W3SA 3BFMA 3JCMJ 2PMFA 3JB9G 4YRNA 3HSBA 3ICAA 1HC7A 4CH4A 5CAIA 4RDXA 3R07A 2CGHA 4F7UA 3JB9J 3FIFA 2QHVA 4EMKB 1EVLA 2Q5IA 3RKYA 4M78G 3RL6A 5GAMf 12ASA 1H4TA 1Y96B 5LJ5g 4M7AF 4M75D 5LJ5d 1JJCA 1HK9A 4C92A 2EWNA 3QO8A 4OP0A 5GAN3 3QUIA 2IY5B 4C92E 1KQ2A 4XTYA 4XEOA 3V8JA 3JCMX 2DXTA 4KR3A 3A32A 4YP0A 2P5IA 2ODRD 4C8QA 5GAOl 2ZZFA 4H2XA 2Y90A 4HWTA 1YCYA 4J6YA 4C92B 5LJ5f 3KFUA 2IY5A 5GAN8 4C8QC 2DEQA 4M77B 3RUXA 3QO3A 1E1OA 3RESA 4CH3A 2E3CA 4RCCA 5GAMh 11ASA 5GANg 2E5AA 2EJ9A 3HFZB 4YRKA 1YFRA 2ZCEA 4XTWA 3HRIA 3M4QA 1I81A 1KOGA 4WJ4A 1B8AA 4Q6GA 3OD1A 5ELNA 1U1TA 2C8MA 3L1AA 4OLFA 4PJOC 3JCMV 5E3IA 3JCMd 2QHUA 1JJCB 4JUVA 2RHSB 2EAYA 3SWNC 4XTUA 1EIYB 4C92D 1ADYA 3A74A 5GAN4 4TVWA 5GAOp 3LC0A 4QVDA 3SB2A 4N0AC 2VC8A 1I4K1 5GMKe 2AKWB 1G5IA 2ZXFA 2Q7EA 4CS3A 1USYA 3A5YA 4ZTUB 3RF1A 3FB9A 5GAN5 4P74C 1NJ2A 4G85A 4J6WA 2YHTA 2DQ3A 2RB6A 2HNIA 3V7SA 4TVYA 3VBBA 4M77C 4MMKA 1B7YB 4K86A 4YPFA 2I4MA 3AHUA 3HTZA 2FB7A 2DDZA 5GAN6 1LNXA 1H4SA 1ADJA 2I4OA 2Q7GA 3V8KA 4NCXA 4XEMA 1B70A 3E9IA 4CH5A 1M5Q1 3JB9I 5LJ5j 4NL3A 2G4CA 5LJ3g 4TTVA 4AH6A 1NYQA 3JCMb 2E10A 3IKLA 4LNSA 1N9SA 3UFGA 4EX5A 2ODRC 3REXA 3TEHB 4HWSA 2VXFA 2JN0A 3FJPA 1BBWA 2VXEA 5LJ3f 1NJ1A 3PZCA 1EIYA 3REUA 4H2VA 4TQDA 1N9WA 3NEMA 1LYLA 1B34B 5K1PA 3I7FA 2DTIA 1KMNA 5GAOq 3P8YA 2ZR3A 4L87A 5C51B 5GMKj 1PYSA 3QO5A 3P8TA 4WJ3M 4YYEA 4C92C 2CJ9A 4A53A 1LJOA 2CIMA 3A7AA 3UH0A 4MMLA 3IG2A 1YFSA 4YRRA 4C8QB 4PJOG 4K88A 1PYSB 2C7IA 1VQZA 4YRJA 4YRIA 3WQZA 4M7DF 1E24A 2ARSA 4C8QE 1W66A 4G84A 4WI1A 3M4PA 2RHQA 1RIQA 1NJ5A 1BIAA 1B70B 3A5ZA 2AMCB 3RIRA 3BW1A 4PHCA 1QF6A 4M7AC 2RD1A 1SETA 4N0AA 2RHQB 4HWRA 3QHSA 5GAN2 5K1XA 4M77F 4X9DA 4M7AB 3JCMP 4YCUA 3EFRA 4Y91A 1G51A 2RHSA 4V2SA 4UPAA 4M7AE 4P3PA 4M77A 1YFTA 1EQRA 4XU1A 3M4GA 1B34A 1JBMA 5GAMj 4M77E 3BJUA 2ZR2A 4YROA 3UGTA 5GAMg 2K57A 5KNNA 4NOYA 1SERA 1LOJA 1NJ8A 4PG3A 4P71A 3PCOA 4XTVA 2ALYB 4XTZA 1NJ6A 1D3BA 2ZIMA 5LJ3d 1B7YA 3VQWA 4YRMA 4RCBA 4EMHA 4M7DA 1H4VB 4H2YA 3A31A 4HVCA 4M78D 4PJOF 1USYC 4A54A 2DZ9A 3NELA 5HGQA 4P74A 4M75G 4P72A 3PCOB 2ZZEA 1B76A 4O2DA 2J3MA 4XU2A 1WLEA 3IALA 4M7AD 3TUPA 4C8QG 2ZT6A 3JCMQ 3V7CA 4M7DB 1EOVA 3HXZA 4EMKC 3UGQA 4H2WA 4K87A 1U1SA 4J6XA 4P3NA 1HTTA 3VQXA 2P0LA 2Q5HA 1H4QA 4ZIBA 1NNHA 1MGQA 4M75A 3VU3C 1X2GA 5GANj 3HY0A 1TH7A 1WU7A 5GAMe 3BDUA 3JCMW 1Z7NA 2YLBA 5GANe 4M75F 1M8VA 4JRIA 5I21A 3INZA 4TVAB 4P73C 5C52B 4H2TA 2YLCA 4HWPA 1ASZA 3HFZA 3JCMh 4E51A 4F7UB 4YCWA 2Q7HA 1Z7MA 1L0WA 5GMKm 2AKWA 4YDQA 1KQ1A 2ZIOA 1I8FA 1SESA 4PJOA 4UP7A
chains in the Genus database with same CATH superfamily
4ATOA 4X5OA 3LGLA 3P8DA 5KYUA 4F16A 3OSVA 3LSQA 4UP9A 3BY7A 3HXUA 3UA7A 1SG5A 4OMMA 4M78C 4PJOB 1XNIA 1E6HA 5KYUB 2LP5A 2DXUA 2QTXA 4YRQA 2ZNJA 1AWOA 5KE2A 1F1BB 1Y96A 1IL2A 3KUFA 4HT9A 1VYTA 1YGBA 1GCQC 1K0SA 2ZINA 3JB9F 4JRKA 3OBWA 2DO3A 1BI3A 4HCBA 3CQTA 3QJ6A 3NFCA 4TVAA 4P75A 1W70A 4TWAA 4JPBW 1X55A 4P3OA 3CCSA 1YI2A 1QWFA 5IH2A 3CPFA 3VS5A 3M0UA 3RMSA 1BIBA 3OSSC 4FW1A 1H92A 8AT1B 5CVIA 2XG8D 1UECA 3PGGA 1UE9A 4M78F 4PJOD 2GFAA 4M75C 3VQVA 2HSEB 3V8LA 1N8RU 2X3XD 2E41A 4ZTZB 4CH6A 2D8JA 4F7UG 4R0KA 1WYDA 2HEQA 2E5QA 2NUPA 2DTHA 4P73A 3S3MA 5FWCA 3JB9H 2BE9B 1G5VA 3I56T 3A1PA 3OB9A 3GIBA 1C0MA 1G8XA 2LJ0A 5EG2A 3JCMc 4LVJA 5GAOr 2RO0A 1MMNA 3UT1A 1VQ7T 2E12A 3L2UA 4D6WA 4ZGDB 1WQ7A 3L2ZA 1VQ8A 4H2SA 1VYUA 4RG8A 4JS4A 2GF7A 1AHJB 3VQYA 4ZTFA 1EFNA 3MEUA 3X24B 4M78A 1YB3A 3OS1A 2QGGA 1QKWA 3HXVA 2NUZA 2CUDA 3HPWA 1IB8A 3RACA 3JSCA 2KXDA 4J5YA 3ZEHA 1C6VX 4M7AA 2L3PA 1PWTA 2AHJB 4JJNK 2QK0A 3L4GA 4YRFA 3M0PA 4XTXA 3VS6A 1R0BG 4E7HA 3SWNB 1Z9ZA 3PIOA 3QIIA 2E1HA 4KR2A 2LT4A 1YI2T 1JJ2A 2LTOA 2ZTGA 4D8KA 2VYTA 2HQHA 5GAN7 4AG1C 3BFMA 2PMFA 3EHRA 1ACMB 3URGA 3ICAA 4AFQC 2K5FA 1X43A 2O4XB 4RDXA 2PVGB 3R07A 1GCPA 2HQEA 2QDYB 2DL8A 2JNGA 1S1NA 1EVLA 4ZGEB 1ZHIA 4QQDA 5LJ5g 1VQMA 2WSEE 2D6FA 5CKHA 2EQUA 1HK9A 1JJCA 2KQWA 4OP0A 4FSSA 3SHWA 2V8KA 4XEOA 3V8JA 4AFSC 4KR3A 3AT1B 3G7ZA 2X4XA 4C8QA 1QCNA 4J6YA 1BI2A 1KD1U 2XHCA 1VQ6T 3H41A 4M77B 4RTWA 2QA4A 3H8ZA 3RESA 1E1OA 3MHXA 4CH3A 2E3CA 3OYNA 1YIJQ 2E5AA 2EJ9A 3MJXA 3QBYA 3VS2A 3M53A 1NJIR 2BIVA 1YFRA 2ZCEA 1VIFA 1WHLA 2DLPA 4RTYA 5C0MA 2K5IA 4RUGA 3M4QA 3GLXA 1KOGA 1D09B 1AWJA 2R57A 3UWNA 5ELNA 1RABB 3L1AA 3CMET 3JCMV 3ME9A 3CCVA 1QP3A 4FIBA 3JCMd 2L2PA 1R77A 3P8HA 2FHDA 2RHSB 4JZ3A 5DM7R 3VS1A 4C92D 1ADYA 1AD5A 3OYGA 5GAOp 3R6OA 1H8KA 1FMWA 1UHFA 2ECZA 2VC8A 4QT7A 2QASA 2Q7EA 4ZTUB 3FB9A 4P74C 1NJ2A 5CK9A 2HNIA 3VBBA 4PK4A 1PC0A 1X6BA 4M77C 9ATCB 4FYWB 3PMTA 4OB0B 2W0ZA 3C94A 3OS5A 2I4MA 2FB7A 1ZLMA 2GFUA 2H3JA 2DDZA 3QKJA 1N5ZA 1Y71A 4L59A 3MEVA 1WA7A 1RI9A 5CKFA 3GPLA 3JV3A 4XEMA 1YJWA 1B70A 3TU4K 2DVJA 2KRSA 3CBOA 2LQ8A 4NL3A 2JW4A 3JCMb 1WHJA 2YRCA 1GRIA 4J83A 1TUGB 2FEIA 2L8DA 4HXJA 1YJWQ 2K79A 2YSQA 3PZCA 1EIYA 3REUA 3NEMA 7AT1B 2QQBA 4DOWA 1D0XA 1B34B 3OYCA 3I7FA 5K1PA 2DTIA 1KMNA 3DLLA 3P8YA 1MUZA 3EGXB 4L87A 4B9WA 1WI7A 4LXCA 2PVOB 4E7SA 3QPHA 3PE0A 1LJOA 2CIMA 2KE9A 1RUWA 3IG2A 3WXMB 3CXCA 3WQZA 1E6GA 2ARSA 2V8JA 5KYWB 1SRMA 3VV0A 3CCQT 1N8RC 2FO0A 2FVUA 3CCUT 3A5ZA 1G3WA 3RIRA 1V1CA 3BW1A 1SETA 2MI6A 2RHQB 2JM9A 4DEXA 5GAN2 3EH2A 5K1XA 4X9DA 4HVWA 1UJ0A 2RQRA 2A7YA 3VS3A 1XQHA 1ZSZB 2EIFA 3UA6A 5A0DA 4UPAA 1MV3A 1OPLA 1JQQA 4M77A 1KK7A 5IHNA 1QW1A 1JBMA 3L2WA 2PZ1A 1ZSZA 1Y57A 2F2WA 1S72T 3OYYA 2QG9B 2C06A 2NS6A 1GFCA 1X2KA 2QEXA 2M51A 2K57A 4NOYA 4J8OA 1O75A 5I2MA 5CIUA 4CC7A 2DL3A 3EFOA 4XTVA 2YUPA 4XTZA 1Q86R 4HVCA 3QDFA 2P0QA 3A8LB 2CREA 2LNVA 1SSHA 4OMQA 2KVQG 1YJ9Q 3I56Q 4PJNA 4DBRA 4O2DA 2RQTA 3M9QA 4BE2A 2IIMA 5D6YA 3CMAQ 2O88A 1CKBA 4IURA 2OI3A 2ZT6A 3JCMQ 1YNZA 3NTKA 1VYVA 3EG3A 4K87A 2JMAA 4Q5WA 1PKTA 1TUDA 4WCIA 2RHUA 4Z88A 1KG1A 1IZ6A 4J6XA 4P3NA 3E9FA 1NJIC 1K0XA 2CP6A 3H0IA 3CXCS 4PJLA 4OB2B 1JB0E 2O9VA 4Z89A 3ZL7C 1Q81C 5KH6A 1QVFP 5GANe 5FRNA 2RJEA 2RHXA 1M8VA 3M59A 3INZA 1VQKT 3CC7T 2COZA 2P0PA 3ZBDA 1WZOA 2QQSA 3HFZA 4E51A 1ASZA 4EDUA 4C0FA 2DBMA 2AKWA 2KAFA 4YDQA 4LVKA 3EAEA 1M1FA 4PJOA 2HDAA 4EMGA 2RK2A 4H2XB 4RQFA 3MF2A 3L4GB 1KC8C 4II1A 3FDRA 2CJBA 4HKEA 1YJ9A 3UF4A 3TEGA 1M90C 2XDPA 1NE8A 2E5KA 2E70A 2X51A 3CCJA 1VQNQ 2ARTA 2K7AA 2OTJA 5GMKh 2OTLT 2DU7A 5KYXB 3LSSA 5ELOA 2XGTA 2CT3A 4M78E 4C0DC 1TS9A 3EG0A 3P8BB 2ZPEB 1EFWA 1OU8A 4YRSA 4HVVA 3SD4A 3VRZA 2XK0A 4M7DG 2E3HA 1NM7A 3ASKA 3C95A 2KNBB 4GLMA 2L0AA 4EO4A 3CCRA 3OYBA 2ALYA 3QO7A 2J06A 2NUPB 3A7UA 2DTOA 1PSFA 1S72Q 2YDLA 3I5RA 2ZT7A 3EH1A 4YRPA 3HRUA 2CSQA 3M0TA 3A7RA 1IHWA 2QI2A 2CZ7B 2ZAEA 4C92G 4LD9K 4CS4A 3M55A 4FW2A 4LDXA 1W2BA 3HXXA 1VA7A 2A0FB 3CBMA 2L3QA 2NWMA 4RTZA 1NEBA 2E4HA 1O9SA 3P8VA 5C53B 4TQFA 1I5LA 3TCJA 2EYYA 2RA2A 3MP1A 4YCVA 3QNEA 1E22A 4LUDA 2E6ZA 2DD5A 3FC3A 1QMCA 1X2HA 1VQLQ 4HA8A 4H02A 1WJQA 2VKNA 1Q95G 2EJGA 1ZBXA 2ED1A 2QQ9A 3E19A 1PNJA 1J5WA 3E9HA 1X54A 2A28A 3GF5A 1VQ5A 3OYIA 4CC2A 1SRYA 2EKOA 1JO8A 2AMCA 4JRPA 4C92F 2QQRA 1X69A 3QWXX 4GY5A 4ZNXA 2J05A 2HBWA 1OX9A 2MPXC 2CS7A 1PG5B 4ZGJB 2M1HA 1K8AU 4M7AG 2ZGWA 2K5LA 4JLIA 3OYLA 1Q86C 1E1TA 4BWAA 5J39A 4HT4A 4BI3A 4BB7A 2DYBA 2JT4A 3M0QA 4ORZA 1UDLA 5AT1B 4DBHA 4DPGA 3LH5A 1JJ2S 3I9QA 1WNLA 2DYIA 1TXQA 2JTFA 1JXOA 2DU5A 4IUUA 5I11A 3RKXA 4LVMA 4CS2A 4F7UE 3EFSA 1NYGA 1TG0A 1VQ9Q 4KULA 1QVGA 3EG2A 3L42A 4WF2A 2DNUA 1K9MU 3CC7Q 5GAMd 1B3QA 3CCUQ 3W3SA 1VQPQ 1ZX6A 4YRNA 2F2VA 2R58A 4EIKA 3EG9B 2XDDA 1SHGA 4OMOA 3X26B 1UHCA 4F7UA 3FIFA 5KYYB 2Q5IA 5I22A 2RI5A 3RL6A 1T3SA 1OX8A 12ASA 3A8GB 5CO7A 4M75D 5LJ5d 1JEGA 1YJNT 4C92A 2EWNA 2HZYA 2DL4A 5J3BA 3CEYA 4KUIA 4M4ZA 1KQ2A 1A0NB 1WGSA 4YP0A 1K8AR 2OTJT 1FX7A 4C5HA 2ODRD 5GAOl 2DMOA 2MF2A 4DEYA 1YCYA 4C92B 4GLKA 4F17A 5LJ5f 4E6RA 4BE1A 1D1AA 5GAN8 4C8QC 2DL7A 4R55A 2X4WA 3BE3A 11ASA 1KJWA 3H9NA 2AKLA 2E6NA 2EYZA 3GNGA 2NLUA 3M0RA 4RG2A 2EKHA 5ECAA 4YRKA 2MK5A 1HSQA 2EW3A 3DB3A 3VS0A 1NEGA 1MMDA 4HVUA 2FPDA 3OMCA 4A4KA 2ATCB 2K9GA 4OLFA 1VQ6Q 3MQZA 3NTHA 1M3AA 3MP6A 2KYMA 1JJCB 5FU6B 1NJIU 2CP7A 4XTUA 1EIYB 5A2QE 1BCOA 2JXBA 2JJ9A 2WACA 3EGDA 4QVDA 3SB2A 4N0AC 5IAYA 1K73R 4OB3B 1Q7YU 4CI0C 2AKWB 2ZPGB 1B07A 1YP5A 4QVZA 4CS3A 1G2BA 5KCOA 3OYEA 4OMFB 2OTLA 1USYA 3RF1A 2CUBA 4G85A 2M0YA 4J6WA 1R8OB 3M5AA 5GJWB 2YHTA 1VQKA 3M0SA 3V7SA 4E7IA 1B7TA 4TVYA 1OEBA 2O01E 2O2OA 1B7YB 4YPFA 1QQJA 3HTZA 3CPWA 3CC4T 1ADJA 2I4OA 2RHIA 3V8KA 2Q7GA 3MP8A 3PT9A 3PFSA 1K8AC 3E9IA 5LJ5j 2HKQB 5LJ3g 3CMEA 1NYQA 3NGPA 3NMZC 1N9SA 2P4TA 3PIPA 4LDYA 4HWSA 2JTMA 3OBYA 1BBWA 2VXEA 4LD6A 2DPPB 3RBBB 5FLXE 1WX6A 4H2VA 3LX7A 4TQDA 1VQPT 5CKEA 2B86A 4HCKA 3LGFA 4KGVB 3VUBA 3G6ET 2PQWA 4BDZA 2PNIA 5FU7B 4ZN3A 1QVFA 3OYMA 2OJ2A 3OYKA 3QYHB 2KYBA 3UH0A 2VB6A 1N8RR 4AMCA 1IXDA 5AYFA 3EFOB 2JOYA 1AVZC 2C7IA 3CCUA 4DA4A 4M7DF 2LQWA 4YRIA 1AEYA 2LQKA 4C8QE 1QVPA 1G3TA 5IXFA 2YUOA 1QVGP 1LCKA 1ARKA 1M4ZA 2DERA 5A0GA 2RHQA 4WI1A 4ZN1A 3A8HB 2LJ3A 3G1JA 2AKKA 3CBPA 3I55T 4M7AC 3OYHA 4N0AA 1VQ5T 1OOTA 3G4ST 5KYXA 3A8MB 4N4IA 3EG9A 3JCMP 2CP5A 4YCUA 3QYGB 3CPWP 5KE3A 1FYNA 4OVAA 1YI2Q 1M3BA 4OB1B 3L2QA 1M3CA 4BY6C 4E7KA 1YFTA 3MO8A 3H6ZA 3SFMA 4M77E 3MPUB 1M1GA 4JRQA 2ZR2A 4YROA 1SRLA 2RQWA 2HL5C 3CMEQ 4J7IA 3I35A 1HYOA 1NJ8A 4P71A 1RLQC 1RAEB 3PCOA 1NLPC 3RR6A 4E2FB 1D3BA 5LJ3d 1B7YA 3VQWA 4RCBA 4M7DA 1LPLA 1QVGS 3A31A 3G4SQ 4M78D 4PJOF 4KBMB 4A54A 1X75C 4AT1B 2LJ1A 4BI8B 4FYVB 3SEMA 4P74A 3EGXA 3PCOB 4PFZA 2ZZEA 2VVKA 2JUFA 1KIKA 2ZPBB 1B76A 2X9HA 2D1XA 2J3MA 4XU2A 4Z8AA 2AT1B 1WLEA 3X28B 1KC8U 2OTLQ 4M7AD 1PD0A 4M7DB 1EOVA 2KXCA 2QAZA 2RMOA 4BDYA 4A63B 4ELZC 1U1SA 1HTTA 4MDWA 1H4QA 2DXCA 2CKKA 3QWYA 4MDXA 1MGQA 1NNHA 2CZ6B 1X2GA 3HY0A 1TH7A 3H0HA 3JCMW 2YLBA 3OYFA 2XICA 4E7LA 2PVDB 5IN1A 3OA6A 4M75F 3OW2A 5I21A 2FRWA 4J9CA 1PM3A 1SHFA 5D6WA 1YHQA 2RHZA 3REAB 2F5TX 3TSZA 4A4FA 4PL6A 2AZVA 1I1JA 4HWPA 4YCWA 2Q7HA 1Z7MA 3CXCP 1L0WA 3OMGA 4CC4B 1EX4A 4QW2A 2HCKA 1BU1A 3LWIA 3CD6Q 1UTIA 3VYGA 2X3WD 3CCMA 4UP7A 2I2LA 5HY6A 2DE0X 4E47A 2FG0A 3HXWA 3G1ZA 1QP2A 3DSQA 1KD1C 3MEYA 4BUGA 2F5KA 2R5AA 3HRTA 2KT8A 1G3SA 2QHTA 4HT8A 5FU6C 1OULA 2X35A 2I0NA 4FYXB 4CRIA 4J15A 1W2BS 2DJZA 2EJFA 1NPPA 4F14A 1AWXA 3M54A 1H641 8ATCB 2OTJQ 1Q82R 2BE7D 4RQEA 4FT2A 2GBQA 5GANh 3CCQQ 2DVEA 2CJAA 2LMJA 1VQ8Q 4LNPA 2QHSA 2C0TA 3HFNA 2P84A 4LUEA 3ER0A 2J7IA 3META 2ABLA 4JS5A 2ZPIB 5KYWA 3OYDA 2GTJA 1VQ7A 3PVQA 5FROA 4OF1A 2OAWA 4FM4B 4KRTA 4MZTA 3CPWS 2LCLA 3A5ZB 1FYFA 5DY9A 1WHGA 2OX7A 1GGMA 3CC7A 3ULRB 4M7DE 2CH4W 2CZ1B 3RMQA 3I5SA 5HK3A 1BCMA 3M56A 2LVMA 1RAAB 3HFVA 2DAQA 4DQ2A 2ZNIA 1NLOC 4XAXB 1AT1B 1YWOA 2XU8A 4M77G 1WPYA 3DLMA 2WSFE 1ZA2B 3HFOA 1XJWB 1BI1A 4FCYA 1KMMA 5GANd 1P92A 2D0QB 4JJDA 4J9DA 1WFWA 4RMFA 4HWOA 2PMEA 5IHKA 4FT4A 4QVCA 2FYKA 4YTLA 5CR2A 2XD0A 1PKSA 1NZ9A 2A3LA 1BBUA 1D1BA 5GMKl 1NYFA 4Z02A 3REBB 2E64A 1SEMA 1YFNA 1M8MA 3CMAT 2XTIA 2ARUA 2ED0A 4C8QD 5HK0A 1C0AA 3QZ5B 1IO6A 2DZCA 2FZGB 1W2BP 3RGLA 1BK2A 1Q81R 2LX7A 3HXYA 2SRCA 1X01A 1K76A 1KQSS 3QTCA 1G83A 2O9SA 3SWNA 3GNFB 1WIEA 2BZXA 1Q81U 1GBQA 2CP2A 4X1VA 4M78B 3QSUA 3NHNA 4M75B 4Y92A 2K3BA 2BKDN 4RTTA 2VASA 1UUEA 2DA9A 3MF1A 1BYMA 4K11A 3TEHA 5CQYA 3CC2Q 1ZBJA 2MCNA 3HY1A 1ZSGA 2Y4YA 1KQSP 4J7FA 3TSWA 2VGMA 3V7RA 2ZT8A 2DQ0A 1JJ2P 4RMOA 1EZZB 1T0JA 2W10A 1WXUA 2D8HA 2ZPFB 2EL9A 4L6V5 3NETA 3H0FA 4B6MA 1ZUUA 4X9CA 3J80E 1TU0B 3QZ9B 3CCLA 2I4NA 5LJ5e 4LDVA 3RERA 1UGPB 5GANf 4Q15A 2RJDA 5D7UA 1ATIA 2ZZGA 2DRKA 2HQXA 1JU5C 2X4YA 3EGUA 3JCMJ 1U06A 3JB9G 3U23A 1UGRB 1Y0MA 3HSBA 3OS2A 3CC2T 2LRQA 1VQ4T 4CH4A 1C1AA 5CAIA 3CD6T 2MMPA 3JB9J 2QHVA 5GAMf 2DK3A 1M1KR 4M7AF 3QO8A 2RI2A 2IY5B 4C92E 2AIRB 4XTYA 3A32A 2P5IA 4NS5A 3JAME 1UG1A 1KSWA 4HWTA 2JS2A 2Y90A 4OMPA 4H2XA 4ME7A 1WJRA 2LQNA 3G6EQ 2DEQA 3RUXA 1HD3A 3CCMQ 4BI4A 3QO3A 5IT9E 1J3TA 2LNHB 4C5EA 2LZ6B 2LDMA 2E3IA 2M16A 3M4YA 2BTTA 4OGEA 3HFZB 4XTWA 1YHQQ 1B8AA 2AZSA 4IIOA 3G71A 2MYSA 3VS7A 1VQKQ 3OD1A 3LYIA 3CCEA 3MEAA 1U1TA 1W1FA 1BI0A 4O5VA 2HMAA 1I07A 3CCMT 2QHUA 2MWOA 1YITA 1VQ4Q 1YBYA 2ZCFB 1UFFA 2Y4XA 3A74A 2RJCA 4TVWA 2QYZA 2QEXT 3ZFJA 2QXFA 3E2UA 5GMKe 3CCVQ 3WVEB 2JM8A 1SF9A 2K2MA 1VQ6A 2JMCA 2ZXFA 2FRYA 1EIFA 1SPKA 1FMKA 5HCKA 4IUQA 2LT1A 4IUTA 2DQ3A 2RB6A 3MEWA 2DL5A 1FWZA 2QGFB 3X20B 1RI0A 3DKMA 2RQVA 4MMKA 4K86A 1PHTA 5GAN6 4LE9A 4PLIA 4LVIA 1H4SA 2MWPA 4NCXA 4CH5A 3VS4A 1YIJT 1Z9QA 4RTXA 4EX5A 2K4YA 2ODRC 2YUNA 4DOVA 2DETA 3Q1JA 2RNAA 2CH4A 1VQNT 5LJ3f 2NYSA 3L2VA 3QXEB 4HCZA 4O6JA 1NBEB 2RN8A 1N9WA 2KY9A 4R56A 1WXTA 3OS0A 1KC8R 5GAOq 3LW5E 1W4SA 3OW2P 1VUBA 5I2SA 3DB4A 2EGCA 5GMKj 1WHMA 3QO5A 3P8TA 3O8VA 4WJ3M 4YYEA 4C92C 3QJYA 2CJ9A 2JZ2A 2ENMA 1MHNA 4PFOA 1YFSA 4YRRA 4C8QB 4PJOG 4K88A 1E7OA 3EHQA 5FRMA 4YRJA 2XDBA 1WJSA 1MMGA 2GQVA 1W66A 4G84A 1VQ4A 3M4PA 2FZKB 1RIQA 1BIAA 3GP8A 3O5ZA 2X4JA 4PHCA 4PJJA 2PUOB 3VRYA 3CC4Q 4HWRA 2C0IA 2A37A 2K3YA 3QHSA 1UGQB 4MZPA 1UJYA 4M77F 2DF6A 2P0KA 2DBKA 2H3EB 1G51A 4A4GA 4N4HA 4J9EA 4M7AE 4P3PA 3CCVT 3TQ7P 4CC3A 3KXTA 1RAIB 1BKBA 2CT4A 2XI9A 4XU1A 1NPRA 2YT6A 3M4GA 1B34A 2YWWA 1MNEA 4BE0A 2BZYA 1VQ7Q 3J81E 1GL5A 1IREB 4PJMA 1M2OA 1IRXA 1BBZA 3E1SA 2CZ0B 1LOJA 4PG3A 1VQ5Q 4VUBA 2KI7A 2RJFA 2ZIMA 4EMHA 4H2YA 3KFVA 3HP9A 3A98A 1MMAA 1Q86U 1VQLA 1USYC 2F69A 1WYXA 4DBQA 3CCLT 3NELA 1Y07A 4P72A 4IUPA 2KROA 4RKUE 6AT1B 2ZZDA 2L89A 4ELYC 1D0ZA 2PU9B 1ABOA 1XTDA 4PFPA 5L8RE 1K9MR 3HHTB 3V7CA 3S3OA 4ANJA 3HXZA 4EMKC 2JVVA 4AG2C 3OY9A 2CDTA 1T3LA 2Q5HA 5C6SA 3JRZA 4AFZC 3C0CA 5KYNA 3VU3C 2YUQA 1YJNA 1UB4A 5GANj 3VYHB 2QA4T 3X25B 4RTUA 1QKXA 3BDUA 2CP3A 2DIQA 1Z7NA 2CYZB 4GBQA 2BZ8A 5IHIA 2QDLA 1VQ9T 3NTIA 2FZCB 1U5SA 3HKSA 1S72A 4JRIA 4D8DA 5J26A 3CCST 2COYA 4H2TA 2AK5A 2YLCA 3JCMh 4F7UB 2ROTA 4PLLA 4OMLA 1VQ8T 1TTHB 4Y28E 5GMKm 1M30A 3THKA 2ESWA 1GBRA 1I8FA 4RTVA 2QTVA 1SESA 5D6XA 1RL2A 5CQXA 1QVFS 3CMQA 4IKFA 1YWPA 1M9SA 2KBTA 3T9NA 3TEEA 2KGTA 4NL2A 3RKWA 5L23A 1OPKA 1IGUA 1M2VB 2MIOA 4M77D 2G3RA 5LL6S 2YRDA 4C8QF 3G4SA 1VQNA 4C0DB 1H3ZA 4PJOE 5GAOn 3M57A 1YITT 1VQMQ 5A0LA 4YRTA 3WVDB 2RHYA 2DIGA 4P75C 3HRKA 4P72C 3JCMe 2GGRA 4XU0A 1X56A 1MV0B 4FU6A 1WHKA 2O31A 5CCAA 3A8OB 4KH1B 1K1ZA 1EVKA 4C0GA 2KRNA 5GMKi 2RI3A 4E7JA 2HSPA 1K9MC 1YHQT 2EQKA 2DXBA 4J9FA 4M75E 4HCCA 4F7UF 2I4LA 4EMKA 1G5HA 2DKGA 3SDZA 2EGAA 5F5WA 3I55A 4P71C 1LVKA 3FEOA 4UP8A 3CC4A 2V1RA 1QE0A 4LVLA 1JRIA 5FWBA 2L5QA 4M7DC 2COWA 3BDLA 3GOXA 3I55Q 1I5OB 3LLRA 3JCMg 5KCHA 1N27A 2SEMA 1M1KU 1VQOQ 2ZT5A 2C0OA 2KMTA 1VIEA 1G3YA 1ZA1B 2PTKA 2EVRA 2KK4A 1U3OA 1D3BB 2K2VA 2VUBA 1TUCA 1ZUKA 4BW9A 1ZUYA 1N9RA 3RDVA 2Z0WA 1X6OA 3NENA 2XIDA 4KQEA 5LJ5h 5LJ3h 5FU7C 3I56A 1RAGB 2KRMA 3PMIA 1YN8A 4XQ3A 3CCQA 2RQUA 4YREA 1OQKA 4ESRA 3JCMf 1PSEA 2MOXA 3IKMB 2E65A 5GAOm 2CSIA 4QKUA 2EYQA 2VGNA 1WQWA 2M9UA 4PNOA 1NG2A 2M0OA 2RK1A 3FLGA 2V1QA 5EC7A 4H2UA 1X2QA 1AZGB 4YRLA 4X34A 4QQGA 1TOVA 1K4US 1ASYA 2KEAA 2NUTA 1IGQA 1QCFA 3S3NA 3JB9D 1VQMT 1NYRA 1OZ3A 4TVRA 2G6FX 5HKCA 2KSSA 2J6KA 1Q7YR 4XU3A 5LJ3e 4J9BA 2MAMA 2OAUA 1UGSB 2RM4A 5LJ3j 3UATA 2IVWA 3PNWC 4M7DD 1DJ7B 3OYAA 1I0CA 2D9TA 1YJNQ 4YRCA 2EQJA 1KD1R 1YJWT 1OZ2A 1K73C 1HXDA 3ERRA 2J3LA 4YRGA 3TVTA 1YCSB 3E9GA 3CCSQ 1ABQA 2D0NA 4LDWA 4FYYB 1HC7A 1K9AA 2EQIA 4KGZB 2L3SA 1FXXA 2FPEA 4QQ6A 1X6GA 1M27C 2CGHA 2J6OA 4N4GA 3CCRT 3CCEQ 3VKIA 2V26A 2GCXA 4EMKB 3RKYA 4M78G 3G71Q 2HD0A 1VQOT 1H4TA 1Y96B 1XOVA 4XK8E 4ZTJA 2EBPA 5GAN3 3QUIA 3CCJQ 2LCSA 2XKOC 4KT0E 3JCMX 4J9GA 2DXTA 4J9HA 2ZZFA 4C5GA 1Q82U 3KBGA 2HL3A 3KFUA 1MNDA 2IY5A 3FRNA 2A08A 4L5GA 3QDRB 4DBFA 2FL7A 1CKAA 1Q82C 4JJCA 1WLPB 4RCCA 5GAMh 3UDCA 2A8EA 4OMNA 2EPDA 5GANg 2KT1A 2B8AA 1ZQ1A 3G71T 2LC4A 1UGVA 2EFIA 2FPFA 3HRIA 2DRMA 1I81A 2RF0A 4Q6GA 4WJ4A 4EPCA 3UPUA 3HTRA 4F04B 4KUDK 2C8MA 4PJOC 4AFUC 5E3IA 1ZSZC 1SKUB 1V29B 1M2VA 1TSFA 4JUVA 1UEBA 1VOMA 2A36A 2EGEA 2P4RA 4BY6B 3GBQA 1VQPA 2EAYA 1OYXA 3SWNC 2K6DA 5GAN4 2VV5A 4P5NA 2DEUA 2GTOA 1K73U 3F70A 2YRVA 2DJQA 3LC0A 1I4K1 1KHCA 1G5IA 4FSXA 1PRMC 1GFDA 3CMAA 3A5YA 4C0ZA 5GAN5 5DLOA 3MKDA 3R6NA 4IIMA 1PRLC 1RLPC 1WXBA 2HBPA 3CC2A 2HKNA 3MCAB 3AHUA 1WDXA 4JZ4A 1R0CB 2KDSA 3VUZA 1LNXA 2IG0A 1WHHA 1OU9A 3C4SA 3OYJA 1M5Q1 2EYWA 3JB9I 2QA4Q 2G4CA 4TTVA 4AH6A 2E10A 3IKLA 2QEXQ 4LNSA 1T0HA 1CSKA 3UFGA 5KYYA 3REXA 3TEHB 1Q7YC 2GQIA 3HRSA 4E7ZA 2VXFA 2JN0A 3FJPA 3OQ5A 4BACA 1NJ1A 4IUVA 4MZMA 4UC4A 2LCCA 2V8IA 4KGXB 2DM1A 4JJBA 4A4EA 1LYLA 3HL8A 2ZR3A 5C51B 1PYSA 1HJDA 3OW2S 3L2RA 2PUKB 4A53A 3A7AA 3EG1A 5CKDA 4MMLA 2DX1A 1PYSB 1VQZA 1E24A 1X27A 1M1KC 1QWEA 1IHVA 1YITQ 3QG1A 1NJ5A 1B70B 3EGDB 2AMCB 2ZPHB 3C12A 3IQLA 1QF6A 2RPNA 2RD1A 4J9IA 1OI1A 4JLGA 3LH0A 4C5IA 2BUDA 4M7AB 5DLQE 3LWHA 3CCRQ 3CCET 2CP0A 3N5BB 3EFRA 2DILA 4JDSA 2YXYA 4Y91A 2HAXA 4V2SA 2RHSA 5CKBA 1YJ9T 4LN2A 5M9OA 2R5MA 2M02A 1EQRA 3VJPA 1FMVA 1OV3A 1PCXA 2RH2A 5GAMj 3CCJT 1H3HA 3BJUA 2H8HA 1RAHB 1AOJA 2JS0A 4BD3A 2QQAA 3UGTA 1RAFB 5GAMg 3G6EA 1N6AA 3PTAA 1JXMA 2EYXA 5KNNA 1SERA 1SSFA 2F1LA 1M90R 1VQLT 2J6FA 2IPOB 3RNJA 2ALYB 1NJ6A 4YRMA 1TWBA 1H4VB 1QCOA 3PVLA 1GCQA 2DZ9A 2F2XA 5HGQA 2XMFA 3TREA 4M75G 2JTEA 2NUTB 4PKCC 1M90U 1V76A 2GNCA 4A4HA 3IALA 1KHIA 1RADB 3TUPA 4C8QG 4OGCA 1AZEA 2L3RA 3S6WA 1BB9A 3CD6A 4WTOB 4FL6A 3UGQA 4H2WA 2ROLA 4B9XA 5GJVB 3VQXA 1AWWA 1D0YA 2P0LA 1VQOA 4ZIBA 1D1CA 1RACB 4M75A 1VQ9A 3CCLQ 4KH0B 1GXIE 1WU7A 4LDUA 1PD1A 5GAMe 1QLYA 2O4XA 1U8RA 2VWFA 3J7AF 2K3XA 3NPFA 2LX9A 1KQSA 4TVAB 1KFZA 4P73C 2EQMA 5FW9A 3D7SB 5C52B 3M58A 2DFUA 2KR3A 1YIJA 1W6XA 1Y7XA 2DD4A 5IXBA 1KQ1A 3FJ5A 2ZIOA 2WSCE
chains in the Genus database with same CATH topology
4ATOA 4X5OA 3LGLA 3P8DA 3LSQA 3OSVA 4UP9A 3BY7A 3HXUA 4M78C 4PJOB 1XNIA 2DXUA 2QTXA 4YRQA 2ZNJA 5KE2A 1Y96A 1IL2A 3KUFA 4HT9A 1YGBA 2ZINA 3JB9F 4JRKA 3OBWA 2DO3A 1BI3A 4HCBA 3QJ6A 3NFCA 4TVAA 4P75A 4TWAA 1X55A 4P3OA 3CCSA 1YI2A 3CPFA 3RMSA 1BIBA 3OSSC 5CVIA 2XG8D 3PGGA 4M78F 4PJOD 2GFAA 4M75C 3VQVA 3V8LA 1N8RU 2E41A 4ZTZB 4CH6A 4F7UG 1WYDA 2E5QA 2DTHA 4P73A 3S3MA 3JB9H 1G5VA 3I56T 3OB9A 3GIBA 5EG2A 3JCMc 4LVJA 5GAOr 2RO0A 3UT1A 1VQ7T 2E12A 3L2UA 4D6WA 4ZGDB 1WQ7A 3L2ZA 1VQ8A 4H2SA 4RG8A 4JS4A 2GF7A 1AHJB 3VQYA 4ZTFA 3MEUA 3X24B 4M78A 1YB3A 3OS1A 3HXVA 3HPWA 3RACA 3JSCA 4J5YA 3ZEHA 4M7AA 2AHJB 4JJNK 3L4GA 4YRFA 4XTXA 4E7HA 3SWNB 3PIOA 3QIIA 2E1HA 4KR2A 2LT4A 1YI2T 1JJ2A 2LTOA 2ZTGA 2VYTA 5GAN7 3BFMA 2PMFA 3URGA 3ICAA 2K5FA 2O4XB 4RDXA 2PVGB 3R07A 2HQEA 2QDYB 2JNGA 1EVLA 4ZGEB 1ZHIA 4QQDA 5LJ5g 1VQMA 2WSEE 2D6FA 5CKHA 2EQUA 1HK9A 1JJCA 2KQWA 4OP0A 2V8KA 4XEOA 3V8JA 4KR3A 3G7ZA 2X4XA 4C8QA 4J6YA 1BI2A 1KD1U 2XHCA 1VQ6T 4M77B 2QA4A 3H8ZA 3RESA 1E1OA 3MHXA 4CH3A 2E3CA 3OYNA 2E5AA 2EJ9A 3QBYA 3M53A 2BIVA 1YFRA 2ZCEA 1VIFA 5C0MA 2K5IA 3M4QA 3GLXA 1KOGA 2R57A 3UWNA 5ELNA 3L1AA 3CMET 3JCMV 3ME9A 3CCVA 1QP3A 4FIBA 3JCMd 3P8HA 2FHDA 2RHSB 5DM7R 4C92D 1ADYA 3OYGA 5GAOp 3R6OA 2VC8A 2Q7EA 4ZTUB 3FB9A 4P74C 1NJ2A 5CK9A 2HNIA 3VBBA 4M77C 4OB0B 3PMTA 3OS5A 3C94A 2I4MA 2FB7A 2GFUA 2H3JA 2DDZA 3QKJA 1Y71A 4L59A 3MEVA 5CKFA 3GPLA 4XEMA 1YJWA 1B70A 3TU4K 3CBOA 2LQ8A 4NL3A 3JCMb 4J83A 2L8DA 3PZCA 1EIYA 3REUA 3NEMA 2QQBA 4DOWA 1B34B 3OYCA 3I7FA 5K1PA 2DTIA 1KMNA 3DLLA 3P8YA 4L87A 4B9WA 2PVOB 3QPHA 1LJOA 2CIMA 3IG2A 3WXMB 3CXCA 3WQZA 2ARSA 2V8JA 3VV0A 3CCQT 1N8RC 2FVUA 3CCUT 3A5ZA 1G3WA 3RIRA 3BW1A 1SETA 2MI6A 2RHQB 5GAN2 5K1XA 4X9DA 2A7YA 5A0DA 1XQHA 2EIFA 4UPAA 4M77A 1QW1A 1JBMA 3L2WA 1S72T 3OYYA 2NS6A 2C06A 2QEXA 2K57A 4NOYA 4J8OA 1O75A 5I2MA 5CIUA 4XTVA 4XTZA 4HVCA 2P0QA 3A8LB 2LNVA 2KVQG 4O2DA 3M9QA 4BE2A 5D6YA 4IURA 2ZT6A 3JCMQ 3NTKA 4K87A 4Q5WA 1KG1A 2RHUA 1IZ6A 4P3NA 4J6XA 3E9FA 1NJIC 3CXCS 4OB2B 1JB0E 1Q81C 5KH6A 5FRNA 5GANe 2RJEA 2RHXA 1M8VA 3M59A 3INZA 1VQKT 3CC7T 2P0PA 3ZBDA 2QQSA 3HFZA 4E51A 1ASZA 4EDUA 4C0FA 2AKWA 2KAFA 4YDQA 4LVKA 3EAEA 1M1FA 4PJOA 4EMGA 4H2XB 2RK2A 4RQFA 3MF2A 3L4GB 1KC8C 4II1A 3FDRA 2CJBA 4HKEA 1YJ9A 3TEGA 1M90C 2XDPA 1NE8A 2E70A 3CCJA 2ARTA 2OTJA 5GMKh 2OTLT 2DU7A 3LSSA 5ELOA 2XGTA 4M78E 4C0DC 3P8BB 2ZPEB 1EFWA 4YRSA 3SD4A 2XK0A 4M7DG 3ASKA 3C95A 4EO4A 3CCRA 3OYBA 2ALYA 3QO7A 3A7UA 2DTOA 1PSFA 2ZT7A 4YRPA 3HRUA 3A7RA 2QI2A 2CZ7B 4C92G 4LD9K 4CS4A 3M55A 4LDXA 1W2BA 3HXXA 3CBMA 1O9SA 3P8VA 5C53B 4TQFA 1I5LA 3TCJA 2RA2A 3MP1A 4YCVA 3QNEA 1E22A 2E6ZA 2DD5A 3FC3A 1X2HA 4HA8A 4H02A 1WJQA 2EJGA 1ZBXA 2QQ9A 3E19A 1J5WA 3E9HA 1X54A 3GF5A 1VQ5A 3OYIA 1SRYA 2EKOA 2AMCA 4JRPA 4C92F 2QQRA 4GY5A 2CS7A 4ZGJB 2M1HA 1K8AU 4M7AG 2ZGWA 2K5LA 4JLIA 3OYLA 1Q86C 1E1TA 4BWAA 5J39A 4HT4A 4BI3A 4BB7A 4DPGA 1JJ2S 1WNLA 2JTFA 2DU5A 4IUUA 3RKXA 4LVMA 4CS2A 4F7UE 3EFSA 4KULA 1QVGA 3L42A 4WF2A 1K9MU 5GAMd 3W3SA 4YRNA 2R58A 2XDDA 3X26B 4F7UA 3FIFA 2Q5IA 2RI5A 3RL6A 12ASA 3A8GB 5CO7A 4M75D 5LJ5d 1YJNT 4C92A 2EWNA 5J3BA 3CEYA 4KUIA 1KQ2A 1WGSA 4YP0A 2OTJT 1FX7A 4C5HA 2ODRD 5GAOl 2MF2A 1YCYA 4C92B 4GLKA 5LJ5f 4BE1A 5GAN8 4C8QC 4R55A 2X4WA 11ASA 2E6NA 3GNGA 2NLUA 4RG2A 4YRKA 3DB3A 3OMCA 4A4KA 4OLFA 3MQZA 3NTHA 3MP6A 1JJCB 5FU6B 1NJIU 4XTUA 1EIYB 5A2QE 2WACA 4QVDA 3SB2A 4N0AC 5IAYA 4OB3B 1Q7YU 4CI0C 2AKWB 2ZPGB 4QVZA 4CS3A 2OTLA 5KCOA 3OYEA 4OMFB 1USYA 3RF1A 4G85A 4J6WA 1R8OB 3M5AA 1VQKA 2YHTA 3V7SA 4E7IA 4TVYA 2O01E 1B7YB 4YPFA 3HTZA 3CPWA 3CC4T 1ADJA 2I4OA 2RHIA 3V8KA 2Q7GA 3MP8A 3PT9A 3PFSA 1K8AC 3E9IA 5LJ5j 5LJ3g 3CMEA 1NYQA 1N9SA 2P4TA 3PIPA 4LDYA 4HWSA 2JTMA 3OBYA 1BBWA 2VXEA 4LD6A 2DPPB 5FLXE 4H2VA 3LX7A 4TQDA 1VQPT 5CKEA 3LGFA 3VUBA 3G6ET 2PQWA 4BDZA 5FU7B 4ZN3A 1QVFA 3OYMA 3OYKA 3QYHB 3UH0A 5AYFA 2JOYA 2C7IA 3CCUA 4DA4A 4M7DF 4YRIA 2LQKA 4C8QE 1QVPA 1G3TA 4WI1A 1M4ZA 5A0GA 2RHQA 4ZN1A 3A8HB 3CBPA 3I55T 4M7AC 3OYHA 4N0AA 1VQ5T 3G4ST 3A8MB 4N4IA 3JCMP 4YCUA 3QYGB 5KE3A 4OVAA 4OB1B 3L2QA 4BY6C 4E7KA 1YFTA 3MO8A 3H6ZA 4M77E 3SFMA 1M1GA 4JRQA 2ZR2A 4YROA 4J7IA 1NJ8A 4P71A 3PCOA 1D3BA 5LJ3d 1B7YA 3VQWA 4RCBA 4M7DA 1QVGS 3A31A 4M78D 4PJOF 4KBMB 4A54A 1X75C 4BI8B 4P74A 3PCOB 2ZZEA 2JUFA 1B76A 2ZPBB 2J3MA 4XU2A 1WLEA 3X28B 1KC8U 4M7AD 4M7DB 1EOVA 4BDYA 4ELZC 1U1SA 1HTTA 4MDWA 1H4QA 2DXCA 2CKKA 4MDXA 1MGQA 1NNHA 2CZ6B 1X2GA 3HY0A 1TH7A 3JCMW 2YLBA 3OYFA 2XICA 4E7LA 2PVDB 5IN1A 3OA6A 4M75F 3OW2A 5I21A 5D6WA 1YHQA 2RHZA 4A4FA 2F5TX 4PL6A 4HWPA 4YCWA 2Q7HA 1Z7MA 1L0WA 3OMGA 4QW2A 3LWIA 3VYGA 3CCMA 4UP7A 2I2LA 5HY6A 4E47A 3HXWA 3G1ZA 1QP2A 3DSQA 1KD1C 3MEYA 4BUGA 2F5KA 2R5AA 3HRTA 1G3SA 2QHTA 4HT8A 5FU6C 2X35A 4CRIA 4J15A 1W2BS 2DJZA 2EJFA 1NPPA 3M54A 1H641 4RQEA 4FT2A 5GANh 2DVEA 2CJAA 2QHSA 3HFNA 3ER0A 3META 4JS5A 2ZPIB 3OYDA 1VQ7A 5FROA 4OF1A 4FM4B 4MZTA 3CPWS 2LCLA 3A5ZB 1FYFA 5DY9A 1GGMA 3CC7A 4M7DE 2CZ1B 3RMQA 5HK3A 3M56A 2LVMA 3HFVA 2DAQA 4DQ2A 2ZNIA 4XAXB 2XU8A 4M77G 1WPYA 3DLMA 2WSFE 3HFOA 1BI1A 1KMMA 5GANd 1P92A 2D0QB 4RMFA 4HWOA 2PMEA 4FT4A 4QVCA 2FYKA 4YTLA 2XD0A 5CR2A 1NZ9A 2A3LA 1BBUA 5GMKl 4Z02A 2E64A 2XTIA 3CMAT 2ARUA 4C8QD 5HK0A 1C0AA 3QZ5B 2DZCA 3RGLA 3HXYA 1X01A 1KQSS 3QTCA 3SWNA 3GNFB 1Q81U 4M78B 3QSUA 4M75B 2BKDN 3MF1A 1BYMA 3TEHA 5CQYA 3HY1A 2Y4YA 4J7FA 2VGMA 3V7RA 2ZT8A 2DQ0A 4RMOA 2ZPFB 2EL9A 4L6V5 3NETA 4X9CA 3J80E 3QZ9B 3CCLA 2I4NA 5LJ5e 4LDVA 3RERA 1UGPB 5GANf 4Q15A 2RJDA 1ATIA 2ZZGA 2HQXA 2X4YA 3JCMJ 3JB9G 1UGRB 3HSBA 3OS2A 3CC2T 2LRQA 1VQ4T 4CH4A 5CAIA 3CD6T 2MMPA 3JB9J 2QHVA 5GAMf 2DK3A 4M7AF 3QO8A 2RI2A 2IY5B 4C92E 4XTYA 3A32A 2P5IA 4NS5A 3JAME 4HWTA 4H2XA 2Y90A 4ME7A 1WJRA 2DEQA 3RUXA 4BI4A 3QO3A 5IT9E 4C5EA 2LDMA 2M16A 3M4YA 4OGEA 3HFZB 4XTWA 1B8AA 3G71A 3OD1A 3LYIA 3CCEA 3MEAA 1U1TA 1BI0A 4O5VA 3CCMT 2QHUA 2MWOA 1YITA 1YBYA 2ZCFB 2Y4XA 3A74A 2RJCA 4TVWA 2QEXT 3ZFJA 2QXFA 5GMKe 3WVEB 1VQ6A 2ZXFA 1EIFA 4IUQA 2LT1A 4IUTA 2DQ3A 2RB6A 3MEWA 1FWZA 3X20B 1RI0A 3DKMA 4MMKA 4K86A 5GAN6 4PLIA 4LVIA 1H4SA 2MWPA 4NCXA 4CH5A 1YIJT 4EX5A 2K4YA 2ODRC 4DOVA 3Q1JA 1VQNT 5LJ3f 3L2VA 3QXEB 4HCZA 4O6JA 1N9WA 2KY9A 4R56A 3OS0A 5GAOq 3LW5E 1W4SA 1VUBA 5I2SA 3DB4A 5GMKj 3QO5A 3P8TA 3O8VA 4WJ3M 4YYEA 4C92C 3QJYA 2CJ9A 2JZ2A 1MHNA 1YFSA 4YRRA 4C8QB 4PJOG 4K88A 4YRJA 5FRMA 2XDBA 1WJSA 2GQVA 1W66A 4G84A 1VQ4A 3M4PA 1RIQA 1BIAA 3GP8A 2X4JA 4PHCA 2PUOB 4HWRA 2K3YA 3QHSA 1UGQB 4MZPA 4M77F 2P0KA 1G51A 4A4GA 4N4HA 4M7AE 4P3PA 3CCVT 3KXTA 1BKBA 2XI9A 4XU1A 1NPRA 3M4GA 1B34A 4BE0A 3J81E 1IREB 3E1SA 2CZ0B 1LOJA 4PG3A 4VUBA 2RJFA 2ZIMA 4EMHA 4H2YA 3HP9A 1VQLA 1Q86U 1USYC 2F69A 3CCLT 3NELA 1Y07A 4P72A 4IUPA 4RKUE 2ZZDA 2L89A 4ELYC 2PU9B 1XTDA 5L8RE 3HHTB 3V7CA 3S3OA 3HXZA 4EMKC 2JVVA 3OY9A 2Q5HA 5C6SA 3JRZA 3VU3C 1YJNA 1UB4A 5GANj 3VYHB 2QA4T 3X25B 3BDUA 2DIQA 1Z7NA 2CYZB 1VQ9T 3NTIA 3HKSA 1S72A 4JRIA 5J26A 3CCST 4H2TA 2YLCA 3JCMh 4F7UB 4PLLA 1VQ8T 4Y28E 5GMKm 1I8FA 1SESA 5D6XA 1RL2A 5CQXA 1QVFS 3CMQA 4IKFA 1M9SA 3T9NA 3TEEA 4NL2A 3RKWA 4M77D 2G3RA 5LL6S 4C8QF 3G4SA 1VQNA 4C0DB 1H3ZA 4PJOE 5GAOn 3M57A 1YITT 5A0LA 4YRTA 3WVDB 2RHYA 2DIGA 4P75C 3HRKA 4P72C 3JCMe 4XU0A 1X56A 4FU6A 5CCAA 3A8OB 1EVKA 4C0GA 5GMKi 2RI3A 4E7JA 1K9MC 1YHQT 2EQKA 2DXBA 4M75E 4HCCA 4F7UF 2I4LA 4EMKA 1G5HA 2DKGA 3SDZA 5F5WA 3I55A 4P71C 3FEOA 4UP8A 3CC4A 1QE0A 4LVLA 1JRIA 4M7DC 2L5QA 3BDLA 3GOXA 3LLRA 3JCMg 5KCHA 1N27A 1M1KU 2ZT5A 2KMTA 1VIEA 1G3YA 2KK4A 1D3BB 2K2VA 2VUBA 4BW9A 1N9RA 1X6OA 3NENA 2XIDA 4KQEA 5LJ5h 5LJ3h 5FU7C 3I56A 3PMIA 4XQ3A 3CCQA 4YREA 3JCMf 1PSEA 3IKMB 2E65A 5GAOm 2EYQA 2VGNA 1WQWA 2M9UA 4PNOA 2M0OA 2RK1A 3FLGA 4H2UA 4YRLA 4X34A 4QQGA 1ASYA 3S3NA 3JB9D 1VQMT 1NYRA 1OZ3A 4TVRA 5HKCA 2KSSA 4XU3A 5LJ3e 2MAMA 2OAUA 1UGSB 2RM4A 5LJ3j 2IVWA 3PNWC 4M7DD 1DJ7B 3OYAA 2D9TA 4YRCA 2EQJA 1YJWT 1OZ2A 1K73C 1HXDA 3ERRA 2J3LA 4YRGA 3E9GA 4LDWA 1HC7A 1FXXA 4QQ6A 2CGHA 4N4GA 3CCRT 3VKIA 2GCXA 4EMKB 3RKYA 4M78G 2HD0A 1VQOT 1H4TA 1Y96B 1XOVA 4XK8E 4ZTJA 5GAN3 3QUIA 2XKOC 4KT0E 3JCMX 2DXTA 2ZZFA 4C5GA 1Q82U 3KBGA 3KFUA 2IY5A 3FRNA 4L5GA 3QDRB 2FL7A 1Q82C 4RCCA 5GAMh 3UDCA 2A8EA 5GANg 2B8AA 1ZQ1A 3G71T 2LC4A 2EFIA 3HRIA 1I81A 4WJ4A 4Q6GA 4EPCA 3UPUA 4KUDK 2C8MA 4PJOC 5E3IA 1V29B 4JUVA 1UEBA 1VQPA 4BY6B 2EAYA 1OYXA 3SWNC 5GAN4 2VV5A 4P5NA 1K73U 3F70A 2YRVA 3LC0A 1I4K1 1KHCA 1G5IA 4FSXA 3CMAA 3A5YA 4C0ZA 5GAN5 5DLOA 2HBPA 3CC2A 3MCAB 3AHUA 2KDSA 3VUZA 1LNXA 2IG0A 3C4SA 3OYJA 1M5Q1 3JB9I 2G4CA 4TTVA 4AH6A 2E10A 3IKLA 4LNSA 3UFGA 3REXA 3TEHB 1Q7YC 3HRSA 2VXFA 2JN0A 3FJPA 3OQ5A 4BACA 1NJ1A 4IUVA 4MZMA 4UC4A 2LCCA 2V8IA 4A4EA 1LYLA 3HL8A 2ZR3A 5C51B 1PYSA 3OW2S 3L2RA 2PUKB 4A53A 3A7AA 5CKDA 4MMLA 1PYSB 1VQZA 1E24A 1M1KC 3QG1A 1NJ5A 1B70B 2AMCB 2ZPHB 3C12A 1QF6A 2RD1A 1OI1A 4JLGA 3LH0A 4C5IA 2BUDA 5DLQE 4M7AB 3LWHA 3CCET 3N5BB 3EFRA 2RHSA 4JDSA 4Y91A 2HAXA 4V2SA 5CKBA 1YJ9T 5M9OA 2R5MA 1EQRA 3VJPA 2RH2A 5GAMj 3CCJT 3BJUA 4BD3A 2QQAA 3UGTA 3G6EA 5GAMg 1N6AA 3PTAA 5KNNA 1SERA 1SSFA 1VQLT 2ALYB 1NJ6A 4YRMA 1H4VB 2DZ9A 5HGQA 3TREA 4M75G 4PKCC 1M90U 4A4HA 3IALA 1KHIA 3TUPA 4C8QG 4OGCA 2L3RA 3S6WA 3CD6A 4FL6A 3UGQA 4H2WA 4B9XA 3VQXA 2P0LA 1VQOA 4ZIBA 4M75A 1VQ9A 1GXIE 1WU7A 4LDUA 5GAMe 2O4XA 1U8RA 3J7AF 2K3XA 2LX9A 1KQSA 4TVAB 4P73C 2EQMA 5C52B 3M58A 1YIJA 1Y7XA 2DD4A 1KQ1A 2ZIOA 2WSCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2L A;  4EMG A;  3CMQ A;  3HXW A;  4H2X B;  4X5O A;  4RQF A;  3G1Z A;  3DSQ A;  3L4G B;  3MF2 A;  3MEY A;  2CJB A;  3LSQ A;  2QHT A;  4HT8 A;  4UP9 A;  3BY7 A;  4NL2 A;  3RKW A;  3HXU A;  3TEG A;  4J15 A;  2DJZ A;  4M77 D;  2EJF A;  4M78 C;  4PJO B;  1H64 1;  4C8Q F;  2ART A;  2DXU A;  4RQE A;  5GMK h;  2QTX A;  4YRQ A;  2DU7 A;  3LSS A;  4PJO E;  5GAO n;  5GAN h;  2ZNJ A;  5ELO A;  2DVE A;  2CJA A;  2XGT A;  1Y96 A;  4YRT A;  2QHS A;  1IL2 A;  4M78 E;  4HT9 A;  3HFN A;  1YGB A;  4P75 C;  2ZIN A;  3JB9 F;  4JRK A;  3HRK A;  4P72 C;  3JCM e;  4XU0 A;  1EFW A;  4YRS A;  1X56 A;  4TVA A;  4P75 A;  1EVK A;  4TWA A;  4M7D G;  1FYF A;  1X55 A;  5DY9 A;  5GMK i;  4P3O A;  1GGM A;  4M75 E;  4M7D E;  4F7U F;  2I4L A;  4EMK A;  4EO4 A;  1G5H A;  3QO7 A;  2ALY A;  2DKG A;  1BIB A;  5F5W A;  4P71 C;  3A7U A;  3HFV A;  2DTO A;  4UP8 A;  3PGG A;  2ZT7 A;  4DQ2 A;  1QE0 A;  4M78 F;  4PJO D;  2ZNI A;  4M75 C;  1JRI A;  4M7D C;  4YRP A;  3VQV A;  4M77 G;  1WPY A;  3V8L A;  3A7R A;  3HFO A;  3JCM g;  1KMM A;  2E41 A;  5GAN d;  4C92 G;  4ZTZ B;  4CS4 A;  2ZT5 A;  4RMF A;  4HWO A;  2PME A;  4CH6 A;  4F7U G;  1WYD A;  3HXX A;  4QVC A;  2FYK A;  2DTH A;  4P73 A;  3JB9 H;  1BBU A;  5GMK l;  1D3B B;  3GIB A;  3P8V A;  5C53 B;  2E64 A;  4TQF A;  4BW9 A;  3JCM c;  1N9R A;  5GAO r;  1I5L A;  3NEN A;  2XTI A;  2ARU A;  5LJ5 h;  4KQE A;  5LJ3 h;  4C8Q D;  1C0A A;  2RA2 A;  1WQ7 A;  2DZC A;  4YCV A;  3L2Z A;  3QNE A;  4XQ3 A;  4H2S A;  1E22 A;  3RGL A;  4YRE A;  1X2H A;  4HA8 A;  3VQY A;  4H02 A;  2EJG A;  3JCM f;  3HXY A;  1X01 A;  3IKM B;  1J5W A;  2E65 A;  5GAO m;  3E9H A;  4M78 A;  1X54 A;  1YB3 A;  3QTC A;  1WQW A;  1SRY A;  4PNO A;  3SWN A;  2AMC A;  3HXV A;  4C92 F;  4H2U A;  4YRL A;  4M78 B;  3QSU A;  3RAC A;  1ASY A;  4J5Y A;  4M75 B;  4M7A A;  4M7A G;  2ZGW A;  4JLI A;  3JB9 D;  1NYR A;  3L4G A;  3MF1 A;  4YRF A;  1E1T A;  4BWA A;  3TEH A;  4XTX A;  3HY1 A;  4XU3 A;  3SWN B;  5LJ3 e;  3V7R A;  2ZT8 A;  2DQ0 A;  4DPG A;  2RM4 A;  2E1H A;  5LJ3 j;  4KR2 A;  2EL9 A;  3NET A;  1WNL A;  4M7D D;  4X9C A;  2DU5 A;  3RKX A;  2ZTG A;  4CS2 A;  4F7U E;  3EFS A;  2I4N A;  5LJ5 e;  4YRC A;  3RER A;  5GAN f;  4Q15 A;  1HXD A;  1ATI A;  3ERR A;  2J3L A;  2ZZG A;  4YRG A;  4WF2 A;  5GAN 7;  5GAM d;  3W3S A;  3BFM A;  3JCM J;  2PMF A;  3JB9 G;  4YRN A;  3HSB A;  3ICA A;  1HC7 A;  4CH4 A;  5CAI A;  4RDX A;  3R07 A;  2CGH A;  4F7U A;  3JB9 J;  3FIF A;  2QHV A;  4EMK B;  1EVL A;  2Q5I A;  3RKY A;  4M78 G;  3RL6 A;  5GAM f;  12AS A;  1H4T A;  1Y96 B;  5LJ5 g;  4M7A F;  4M75 D;  5LJ5 d;  1JJC A;  1HK9 A;  4C92 A;  2EWN A;  3QO8 A;  4OP0 A;  5GAN 3;  3QUI A;  2IY5 B;  4C92 E;  1KQ2 A;  4XTY A;  4XEO A;  3V8J A;  3JCM X;  2DXT A;  4KR3 A;  3A32 A;  4YP0 A;  2P5I A;  2ODR D;  4C8Q A;  5GAO l;  2ZZF A;  4H2X A;  2Y90 A;  4HWT A;  1YCY A;  4J6Y A;  4C92 B;  5LJ5 f;  3KFU A;  2IY5 A;  5GAN 8;  4C8Q C;  2DEQ A;  4M77 B;  3RUX A;  3QO3 A;  1E1O A;  3RES A;  4CH3 A;  2E3C A;  4RCC A;  5GAM h;  11AS A;  5GAN g;  2E5A A;  2EJ9 A;  3HFZ B;  4YRK A;  1YFR A;  2ZCE A;  4XTW A;  3HRI A;  3M4Q A;  1I81 A;  1KOG A;  4WJ4 A;  1B8A A;  4Q6G A;  3OD1 A;  5ELN A;  1U1T A;  2C8M A;  3L1A A;  4OLF A;  4PJO C;  3JCM V;  5E3I A;  3JCM d;  2QHU A;  1JJC B;  4JUV A;  2RHS B;  2EAY A;  3SWN C;  4XTU A;  1EIY B;  4C92 D;  1ADY A;  3A74 A;  5GAN 4;  4TVW A;  5GAO p;  3LC0 A;  4QVD A;  3SB2 A;  4N0A C;  2VC8 A;  1I4K 1;  5GMK e;  2AKW B;  1G5I A;  2ZXF A;  2Q7E A;  4CS3 A;  1USY A;  3A5Y A;  4ZTU B;  3RF1 A;  3FB9 A;  5GAN 5;  4P74 C;  1NJ2 A;  4G85 A;  4J6W A;  2YHT A;  2DQ3 A;  2RB6 A;  2HNI A;  3V7S A;  4TVY A;  3VBB A;  4M77 C;  4MMK A;  1B7Y B;  4K86 A;  4YPF A;  2I4M A;  3AHU A;  3HTZ A;  2FB7 A;  2DDZ A;  5GAN 6;  1LNX A;  1H4S A;  1ADJ A;  2I4O A;  2Q7G A;  3V8K A;  4NCX A;  4XEM A;  1B70 A;  3E9I A;  4CH5 A;  1M5Q 1;  3JB9 I;  5LJ5 j;  4NL3 A;  2G4C A;  5LJ3 g;  4TTV A;  4AH6 A;  1NYQ A;  3JCM b;  2E10 A;  3IKL A;  4LNS A;  1N9S A;  3UFG A;  4EX5 A;  2ODR C;  3REX A;  3TEH B;  4HWS A;  2VXF A;  2JN0 A;  3FJP A;  1BBW A;  2VXE A;  5LJ3 f;  1NJ1 A;  3PZC A;  1EIY A;  3REU A;  4H2V A;  4TQD A;  1N9W A;  3NEM A;  1LYL A;  1B34 B;  5K1P A;  3I7F A;  2DTI A;  1KMN A;  5GAO q;  3P8Y A;  2ZR3 A;  4L87 A;  5C51 B;  5GMK j;  1PYS A;  3QO5 A;  3P8T A;  4WJ3 M;  4YYE A;  4C92 C;  2CJ9 A;  4A53 A;  1LJO A;  2CIM A;  3A7A A;  3UH0 A;  4MML A;  3IG2 A;  1YFS A;  4YRR A;  4C8Q B;  4PJO G;  4K88 A;  1PYS B;  2C7I A;  1VQZ A;  4YRJ A;  4YRI A;  3WQZ A;  4M7D F;  1E24 A;  2ARS A;  4C8Q E;  1W66 A;  4G84 A;  4WI1 A;  3M4P A;  2RHQ A;  1RIQ A;  1NJ5 A;  1BIA A;  1B70 B;  3A5Z A;  2AMC B;  3RIR A;  3BW1 A;  4PHC A;  1QF6 A;  4M7A C;  2RD1 A;  1SET A;  4N0A A;  2RHQ B;  4HWR A;  3QHS A;  5GAN 2;  5K1X A;  4M77 F;  4X9D A;  4M7A B;  3JCM P;  4YCU A;  3EFR A;  4Y91 A;  1G51 A;  2RHS A;  4V2S A;  4UPA A;  4M7A E;  4P3P A;  4M77 A;  1YFT A;  1EQR A;  4XU1 A;  3M4G A;  1B34 A;  1JBM A;  5GAM j;  4M77 E;  3BJU A;  2ZR2 A;  4YRO A;  3UGT A;  5GAM g;  2K57 A;  5KNN A;  4NOY A;  1SER A;  1LOJ A;  1NJ8 A;  4PG3 A;  4P71 A;  3PCO A;  4XTV A;  2ALY B;  4XTZ A;  1NJ6 A;  1D3B A;  2ZIM A;  5LJ3 d;  1B7Y A;  3VQW A;  4YRM A;  4RCB A;  4EMH A;  4M7D A;  1H4V B;  4H2Y A;  3A31 A;  4HVC A;  4M78 D;  4PJO F;  1USY C;  4A54 A;  2DZ9 A;  3NEL A;  5HGQ A;  4P74 A;  4M75 G;  4P72 A;  3PCO B;  2ZZE A;  1B76 A;  4O2D A;  2J3M A;  4XU2 A;  1WLE A;  3IAL A;  4M7A D;  3TUP A;  4C8Q G;  2ZT6 A;  3JCM Q;  3V7C A;  4M7D B;  1EOV A;  3HXZ A;  4EMK C;  3UGQ A;  4H2W A;  4K87 A;  1U1S A;  4J6X A;  4P3N A;  1HTT A;  3VQX A;  2P0L A;  2Q5H A;  1H4Q A;  4ZIB A;  1NNH A;  1MGQ A;  4M75 A;  3VU3 C;  1X2G A;  5GAN j;  3HY0 A;  1TH7 A;  1WU7 A;  5GAM e;  3BDU A;  3JCM W;  1Z7N A;  2YLB A;  5GAN e;  4M75 F;  1M8V A;  4JRI A;  5I21 A;  3INZ A;  4TVA B;  4P73 C;  5C52 B;  4H2T A;  2YLC A;  4HWP A;  1ASZ A;  3HFZ A;  3JCM h;  4E51 A;  4F7U B;  4YCW A;  2Q7H A;  1Z7M A;  1L0W A;  5GMK m;  2AKW A;  4YDQ A;  1KQ1 A;  2ZIO A;  1I8F A;  1SES A;  4PJO A;  4UP7 A; 
#chains in the Genus database with same CATH topology
 4ATO A;  4X5O A;  3LGL A;  3P8D A;  5KYU A;  4F16 A;  3OSV A;  3LSQ A;  4UP9 A;  3BY7 A;  3HXU A;  3UA7 A;  1SG5 A;  4OMM A;  4M78 C;  4PJO B;  1XNI A;  1E6H A;  5KYU B;  2LP5 A;  2DXU A;  2QTX A;  4YRQ A;  2ZNJ A;  1AWO A;  5KE2 A;  1F1B B;  1Y96 A;  1IL2 A;  3KUF A;  4HT9 A;  1VYT A;  1YGB A;  1GCQ C;  1K0S A;  2ZIN A;  3JB9 F;  4JRK A;  3OBW A;  2DO3 A;  1BI3 A;  4HCB A;  3CQT A;  3QJ6 A;  3NFC A;  4TVA A;  4P75 A;  1W70 A;  4TWA A;  4JPB W;  1X55 A;  4P3O A;  3CCS A;  1YI2 A;  1QWF A;  5IH2 A;  3CPF A;  3VS5 A;  3M0U A;  3RMS A;  1BIB A;  3OSS C;  4FW1 A;  1H92 A;  8AT1 B;  5CVI A;  2XG8 D;  1UEC A;  3PGG A;  1UE9 A;  4M78 F;  4PJO D;  2GFA A;  4M75 C;  3VQV A;  2HSE B;  3V8L A;  1N8R U;  2X3X D;  2E41 A;  4ZTZ B;  4CH6 A;  2D8J A;  4F7U G;  4R0K A;  1WYD A;  2HEQ A;  2E5Q A;  2NUP A;  2DTH A;  4P73 A;  3S3M A;  5FWC A;  3JB9 H;  2BE9 B;  1G5V A;  3I56 T;  3A1P A;  3OB9 A;  3GIB A;  1C0M A;  1G8X A;  2LJ0 A;  5EG2 A;  3JCM c;  4LVJ A;  5GAO r;  2RO0 A;  1MMN A;  3UT1 A;  1VQ7 T;  2E12 A;  3L2U A;  4D6W A;  4ZGD B;  1WQ7 A;  3L2Z A;  1VQ8 A;  4H2S A;  1VYU A;  4RG8 A;  4JS4 A;  2GF7 A;  1AHJ B;  3VQY A;  4ZTF A;  1EFN A;  3MEU A;  3X24 B;  4M78 A;  1YB3 A;  3OS1 A;  2QGG A;  1QKW A;  3HXV A;  2NUZ A;  2CUD A;  3HPW A;  1IB8 A;  3RAC A;  3JSC A;  2KXD A;  4J5Y A;  3ZEH A;  1C6V X;  4M7A A;  2L3P A;  1PWT A;  2AHJ B;  4JJN K;  2QK0 A;  3L4G A;  4YRF A;  3M0P A;  4XTX A;  3VS6 A;  1R0B G;  4E7H A;  3SWN B;  1Z9Z A;  3PIO A;  3QII A;  2E1H A;  4KR2 A;  2LT4 A;  1YI2 T;  1JJ2 A;  2LTO A;  2ZTG A;  4D8K A;  2VYT A;  2HQH A;  5GAN 7;  4AG1 C;  3BFM A;  2PMF A;  3EHR A;  1ACM B;  3URG A;  3ICA A;  4AFQ C;  2K5F A;  1X43 A;  2O4X B;  4RDX A;  2PVG B;  3R07 A;  1GCP A;  2HQE A;  2QDY B;  2DL8 A;  2JNG A;  1S1N A;  1EVL A;  4ZGE B;  1ZHI A;  4QQD A;  5LJ5 g;  1VQM A;  2WSE E;  2D6F A;  5CKH A;  2EQU A;  1HK9 A;  1JJC A;  2KQW A;  4OP0 A;  4FSS A;  3SHW A;  2V8K A;  4XEO A;  3V8J A;  4AFS C;  4KR3 A;  3AT1 B;  3G7Z A;  2X4X A;  4C8Q A;  1QCN A;  4J6Y A;  1BI2 A;  1KD1 U;  2XHC A;  1VQ6 T;  3H41 A;  4M77 B;  4RTW A;  2QA4 A;  3H8Z A;  3RES A;  1E1O A;  3MHX A;  4CH3 A;  2E3C A;  3OYN A;  1YIJ Q;  2E5A A;  2EJ9 A;  3MJX A;  3QBY A;  3VS2 A;  3M53 A;  1NJI R;  2BIV A;  1YFR A;  2ZCE A;  1VIF A;  1WHL A;  2DLP A;  4RTY A;  5C0M A;  2K5I A;  4RUG A;  3M4Q A;  3GLX A;  1KOG A;  1D09 B;  1AWJ A;  2R57 A;  3UWN A;  5ELN A;  1RAB B;  3L1A A;  3CME T;  3JCM V;  3ME9 A;  3CCV A;  1QP3 A;  4FIB A;  3JCM d;  2L2P A;  1R77 A;  3P8H A;  2FHD A;  2RHS B;  4JZ3 A;  5DM7 R;  3VS1 A;  4C92 D;  1ADY A;  1AD5 A;  3OYG A;  5GAO p;  3R6O A;  1H8K A;  1FMW A;  1UHF A;  2ECZ A;  2VC8 A;  4QT7 A;  2QAS A;  2Q7E A;  4ZTU B;  3FB9 A;  4P74 C;  1NJ2 A;  5CK9 A;  2HNI A;  3VBB A;  4PK4 A;  1PC0 A;  1X6B A;  4M77 C;  9ATC B;  4FYW B;  3PMT A;  4OB0 B;  2W0Z A;  3C94 A;  3OS5 A;  2I4M A;  2FB7 A;  1ZLM A;  2GFU A;  2H3J A;  2DDZ A;  3QKJ A;  1N5Z A;  1Y71 A;  4L59 A;  3MEV A;  1WA7 A;  1RI9 A;  5CKF A;  3GPL A;  3JV3 A;  4XEM A;  1YJW A;  1B70 A;  3TU4 K;  2DVJ A;  2KRS A;  3CBO A;  2LQ8 A;  4NL3 A;  2JW4 A;  3JCM b;  1WHJ A;  2YRC A;  1GRI A;  4J83 A;  1TUG B;  2FEI A;  2L8D A;  4HXJ A;  1YJW Q;  2K79 A;  2YSQ A;  3PZC A;  1EIY A;  3REU A;  3NEM A;  7AT1 B;  2QQB A;  4DOW A;  1D0X A;  1B34 B;  3OYC A;  3I7F A;  5K1P A;  2DTI A;  1KMN A;  3DLL A;  3P8Y A;  1MUZ A;  3EGX B;  4L87 A;  4B9W A;  1WI7 A;  4LXC A;  2PVO B;  4E7S A;  3QPH A;  3PE0 A;  1LJO A;  2CIM A;  2KE9 A;  1RUW A;  3IG2 A;  3WXM B;  3CXC A;  3WQZ A;  1E6G A;  2ARS A;  2V8J A;  5KYW B;  1SRM A;  3VV0 A;  3CCQ T;  1N8R C;  2FO0 A;  2FVU A;  3CCU T;  3A5Z A;  1G3W A;  3RIR A;  1V1C A;  3BW1 A;  1SET A;  2MI6 A;  2RHQ B;  2JM9 A;  4DEX A;  5GAN 2;  3EH2 A;  5K1X A;  4X9D A;  4HVW A;  1UJ0 A;  2RQR A;  2A7Y A;  3VS3 A;  1XQH A;  1ZSZ B;  2EIF A;  3UA6 A;  5A0D A;  4UPA A;  1MV3 A;  1OPL A;  1JQQ A;  4M77 A;  1KK7 A;  5IHN A;  1QW1 A;  1JBM A;  3L2W A;  2PZ1 A;  1ZSZ A;  1Y57 A;  2F2W A;  1S72 T;  3OYY A;  2QG9 B;  2C06 A;  2NS6 A;  1GFC A;  1X2K A;  2QEX A;  2M51 A;  2K57 A;  4NOY A;  4J8O A;  1O75 A;  5I2M A;  5CIU A;  4CC7 A;  2DL3 A;  3EFO A;  4XTV A;  2YUP A;  4XTZ A;  1Q86 R;  4HVC A;  3QDF A;  2P0Q A;  3A8L B;  2CRE A;  2LNV A;  1SSH A;  4OMQ A;  2KVQ G;  1YJ9 Q;  3I56 Q;  4PJN A;  4DBR A;  4O2D A;  2RQT A;  3M9Q A;  4BE2 A;  2IIM A;  5D6Y A;  3CMA Q;  2O88 A;  1CKB A;  4IUR A;  2OI3 A;  2ZT6 A;  3JCM Q;  1YNZ A;  3NTK A;  1VYV A;  3EG3 A;  4K87 A;  2JMA A;  4Q5W A;  1PKT A;  1TUD A;  4WCI A;  2RHU A;  4Z88 A;  1KG1 A;  1IZ6 A;  4J6X A;  4P3N A;  3E9F A;  1NJI C;  1K0X A;  2CP6 A;  3H0I A;  3CXC S;  4PJL A;  4OB2 B;  1JB0 E;  2O9V A;  4Z89 A;  3ZL7 C;  1Q81 C;  5KH6 A;  1QVF P;  5GAN e;  5FRN A;  2RJE A;  2RHX A;  1M8V A;  3M59 A;  3INZ A;  1VQK T;  3CC7 T;  2COZ A;  2P0P A;  3ZBD A;  1WZO A;  2QQS A;  3HFZ A;  4E51 A;  1ASZ A;  4EDU A;  4C0F A;  2DBM A;  2AKW A;  2KAF A;  4YDQ A;  4LVK A;  3EAE A;  1M1F A;  4PJO A;  2HDA A;  4EMG A;  2RK2 A;  4H2X B;  4RQF A;  3MF2 A;  3L4G B;  1KC8 C;  4II1 A;  3FDR A;  2CJB A;  4HKE A;  1YJ9 A;  3UF4 A;  3TEG A;  1M90 C;  2XDP A;  1NE8 A;  2E5K A;  2E70 A;  2X51 A;  3CCJ A;  1VQN Q;  2ART A;  2K7A A;  2OTJ A;  5GMK h;  2OTL T;  2DU7 A;  5KYX B;  3LSS A;  5ELO A;  2XGT A;  2CT3 A;  4M78 E;  4C0D C;  1TS9 A;  3EG0 A;  3P8B B;  2ZPE B;  1EFW A;  1OU8 A;  4YRS A;  4HVV A;  3SD4 A;  3VRZ A;  2XK0 A;  4M7D G;  2E3H A;  1NM7 A;  3ASK A;  3C95 A;  2KNB B;  4GLM A;  2L0A A;  4EO4 A;  3CCR A;  3OYB A;  2ALY A;  3QO7 A;  2J06 A;  2NUP B;  3A7U A;  2DTO A;  1PSF A;  1S72 Q;  2YDL A;  3I5R A;  2ZT7 A;  3EH1 A;  4YRP A;  3HRU A;  2CSQ A;  3M0T A;  3A7R A;  1IHW A;  2QI2 A;  2CZ7 B;  2ZAE A;  4C92 G;  4LD9 K;  4CS4 A;  3M55 A;  4FW2 A;  4LDX A;  1W2B A;  3HXX A;  1VA7 A;  2A0F B;  3CBM A;  2L3Q A;  2NWM A;  4RTZ A;  1NEB A;  2E4H A;  1O9S A;  3P8V A;  5C53 B;  4TQF A;  1I5L A;  3TCJ A;  2EYY A;  2RA2 A;  3MP1 A;  4YCV A;  3QNE A;  1E22 A;  4LUD A;  2E6Z A;  2DD5 A;  3FC3 A;  1QMC A;  1X2H A;  1VQL Q;  4HA8 A;  4H02 A;  1WJQ A;  2VKN A;  1Q95 G;  2EJG A;  1ZBX A;  2ED1 A;  2QQ9 A;  3E19 A;  1PNJ A;  1J5W A;  3E9H A;  1X54 A;  2A28 A;  3GF5 A;  1VQ5 A;  3OYI A;  4CC2 A;  1SRY A;  2EKO A;  1JO8 A;  2AMC A;  4JRP A;  4C92 F;  2QQR A;  1X69 A;  3QWX X;  4GY5 A;  4ZNX A;  2J05 A;  2HBW A;  1OX9 A;  2MPX C;  2CS7 A;  1PG5 B;  4ZGJ B;  2M1H A;  1K8A U;  4M7A G;  2ZGW A;  2K5L A;  4JLI A;  3OYL A;  1Q86 C;  1E1T A;  4BWA A;  5J39 A;  4HT4 A;  4BI3 A;  4BB7 A;  2DYB A;  2JT4 A;  3M0Q A;  4ORZ A;  1UDL A;  5AT1 B;  4DBH A;  4DPG A;  3LH5 A;  1JJ2 S;  3I9Q A;  1WNL A;  2DYI A;  1TXQ A;  2JTF A;  1JXO A;  2DU5 A;  4IUU A;  5I11 A;  3RKX A;  4LVM A;  4CS2 A;  4F7U E;  3EFS A;  1NYG A;  1TG0 A;  1VQ9 Q;  4KUL A;  1QVG A;  3EG2 A;  3L42 A;  4WF2 A;  2DNU A;  1K9M U;  3CC7 Q;  5GAM d;  1B3Q A;  3CCU Q;  3W3S A;  1VQP Q;  1ZX6 A;  4YRN A;  2F2V A;  2R58 A;  4EIK A;  3EG9 B;  2XDD A;  1SHG A;  4OMO A;  3X26 B;  1UHC A;  4F7U A;  3FIF A;  5KYY B;  2Q5I A;  5I22 A;  2RI5 A;  3RL6 A;  1T3S A;  1OX8 A;  12AS A;  3A8G B;  5CO7 A;  4M75 D;  5LJ5 d;  1JEG A;  1YJN T;  4C92 A;  2EWN A;  2HZY A;  2DL4 A;  5J3B A;  3CEY A;  4KUI A;  4M4Z A;  1KQ2 A;  1A0N B;  1WGS A;  4YP0 A;  1K8A R;  2OTJ T;  1FX7 A;  4C5H A;  2ODR D;  5GAO l;  2DMO A;  2MF2 A;  4DEY A;  1YCY A;  4C92 B;  4GLK A;  4F17 A;  5LJ5 f;  4E6R A;  4BE1 A;  1D1A A;  5GAN 8;  4C8Q C;  2DL7 A;  4R55 A;  2X4W A;  3BE3 A;  11AS A;  1KJW A;  3H9N A;  2AKL A;  2E6N A;  2EYZ A;  3GNG A;  2NLU A;  3M0R A;  4RG2 A;  2EKH A;  5ECA A;  4YRK A;  2MK5 A;  1HSQ A;  2EW3 A;  3DB3 A;  3VS0 A;  1NEG A;  1MMD A;  4HVU A;  2FPD A;  3OMC A;  4A4K A;  2ATC B;  2K9G A;  4OLF A;  1VQ6 Q;  3MQZ A;  3NTH A;  1M3A A;  3MP6 A;  2KYM A;  1JJC B;  5FU6 B;  1NJI U;  2CP7 A;  4XTU A;  1EIY B;  5A2Q E;  1BCO A;  2JXB A;  2JJ9 A;  2WAC A;  3EGD A;  4QVD A;  3SB2 A;  4N0A C;  5IAY A;  1K73 R;  4OB3 B;  1Q7Y U;  4CI0 C;  2AKW B;  2ZPG B;  1B07 A;  1YP5 A;  4QVZ A;  4CS3 A;  1G2B A;  5KCO A;  3OYE A;  4OMF B;  2OTL A;  1USY A;  3RF1 A;  2CUB A;  4G85 A;  2M0Y A;  4J6W A;  1R8O B;  3M5A A;  5GJW B;  2YHT A;  1VQK A;  3M0S A;  3V7S A;  4E7I A;  1B7T A;  4TVY A;  1OEB A;  2O01 E;  2O2O A;  1B7Y B;  4YPF A;  1QQJ A;  3HTZ A;  3CPW A;  3CC4 T;  1ADJ A;  2I4O A;  2RHI A;  3V8K A;  2Q7G A;  3MP8 A;  3PT9 A;  3PFS A;  1K8A C;  3E9I A;  5LJ5 j;  2HKQ B;  5LJ3 g;  3CME A;  1NYQ A;  3NGP A;  3NMZ C;  1N9S A;  2P4T A;  3PIP A;  4LDY A;  4HWS A;  2JTM A;  3OBY A;  1BBW A;  2VXE A;  4LD6 A;  2DPP B;  3RBB B;  5FLX E;  1WX6 A;  4H2V A;  3LX7 A;  4TQD A;  1VQP T;  5CKE A;  2B86 A;  4HCK A;  3LGF A;  4KGV B;  3VUB A;  3G6E T;  2PQW A;  4BDZ A;  2PNI A;  5FU7 B;  4ZN3 A;  1QVF A;  3OYM A;  2OJ2 A;  3OYK A;  3QYH B;  2KYB A;  3UH0 A;  2VB6 A;  1N8R R;  4AMC A;  1IXD A;  5AYF A;  3EFO B;  2JOY A;  1AVZ C;  2C7I A;  3CCU A;  4DA4 A;  4M7D F;  2LQW A;  4YRI A;  1AEY A;  2LQK A;  4C8Q E;  1QVP A;  1G3T A;  5IXF A;  2YUO A;  1QVG P;  1LCK A;  1ARK A;  1M4Z A;  2DER A;  5A0G A;  2RHQ A;  4WI1 A;  4ZN1 A;  3A8H B;  2LJ3 A;  3G1J A;  2AKK A;  3CBP A;  3I55 T;  4M7A C;  3OYH A;  4N0A A;  1VQ5 T;  1OOT A;  3G4S T;  5KYX A;  3A8M B;  4N4I A;  3EG9 A;  3JCM P;  2CP5 A;  4YCU A;  3QYG B;  3CPW P;  5KE3 A;  1FYN A;  4OVA A;  1YI2 Q;  1M3B A;  4OB1 B;  3L2Q A;  1M3C A;  4BY6 C;  4E7K A;  1YFT A;  3MO8 A;  3H6Z A;  3SFM A;  4M77 E;  3MPU B;  1M1G A;  4JRQ A;  2ZR2 A;  4YRO A;  1SRL A;  2RQW A;  2HL5 C;  3CME Q;  4J7I A;  3I35 A;  1HYO A;  1NJ8 A;  4P71 A;  1RLQ C;  1RAE B;  3PCO A;  1NLP C;  3RR6 A;  4E2F B;  1D3B A;  5LJ3 d;  1B7Y A;  3VQW A;  4RCB A;  4M7D A;  1LPL A;  1QVG S;  3A31 A;  3G4S Q;  4M78 D;  4PJO F;  4KBM B;  4A54 A;  1X75 C;  4AT1 B;  2LJ1 A;  4BI8 B;  4FYV B;  3SEM A;  4P74 A;  3EGX A;  3PCO B;  4PFZ A;  2ZZE A;  2VVK A;  2JUF A;  1KIK A;  2ZPB B;  1B76 A;  2X9H A;  2D1X A;  2J3M A;  4XU2 A;  4Z8A A;  2AT1 B;  1WLE A;  3X28 B;  1KC8 U;  2OTL Q;  4M7A D;  1PD0 A;  4M7D B;  1EOV A;  2KXC A;  2QAZ A;  2RMO A;  4BDY A;  4A63 B;  4ELZ C;  1U1S A;  1HTT A;  4MDW A;  1H4Q A;  2DXC A;  2CKK A;  3QWY A;  4MDX A;  1MGQ A;  1NNH A;  2CZ6 B;  1X2G A;  3HY0 A;  1TH7 A;  3H0H A;  3JCM W;  2YLB A;  3OYF A;  2XIC A;  4E7L A;  2PVD B;  5IN1 A;  3OA6 A;  4M75 F;  3OW2 A;  5I21 A;  2FRW A;  4J9C A;  1PM3 A;  1SHF A;  5D6W A;  1YHQ A;  2RHZ A;  3REA B;  2F5T X;  3TSZ A;  4A4F A;  4PL6 A;  2AZV A;  1I1J A;  4HWP A;  4YCW A;  2Q7H A;  1Z7M A;  3CXC P;  1L0W A;  3OMG A;  4CC4 B;  1EX4 A;  4QW2 A;  2HCK A;  1BU1 A;  3LWI A;  3CD6 Q;  1UTI A;  3VYG A;  2X3W D;  3CCM A;  4UP7 A;  2I2L A;  5HY6 A;  2DE0 X;  4E47 A;  2FG0 A;  3HXW A;  3G1Z A;  1QP2 A;  3DSQ A;  1KD1 C;  3MEY A;  4BUG A;  2F5K A;  2R5A A;  3HRT A;  2KT8 A;  1G3S A;  2QHT A;  4HT8 A;  5FU6 C;  1OUL A;  2X35 A;  2I0N A;  4FYX B;  4CRI A;  4J15 A;  1W2B S;  2DJZ A;  2EJF A;  1NPP A;  4F14 A;  1AWX A;  3M54 A;  1H64 1;  8ATC B;  2OTJ Q;  1Q82 R;  2BE7 D;  4RQE A;  4FT2 A;  2GBQ A;  5GAN h;  3CCQ Q;  2DVE A;  2CJA A;  2LMJ A;  1VQ8 Q;  4LNP A;  2QHS A;  2C0T A;  3HFN A;  2P84 A;  4LUE A;  3ER0 A;  2J7I A;  3MET A;  2ABL A;  4JS5 A;  2ZPI B;  5KYW A;  3OYD A;  2GTJ A;  1VQ7 A;  3PVQ A;  5FRO A;  4OF1 A;  2OAW A;  4FM4 B;  4KRT A;  4MZT A;  3CPW S;  2LCL A;  3A5Z B;  1FYF A;  5DY9 A;  1WHG A;  2OX7 A;  1GGM A;  3CC7 A;  3ULR B;  4M7D E;  2CH4 W;  2CZ1 B;  3RMQ A;  3I5S A;  5HK3 A;  1BCM A;  3M56 A;  2LVM A;  1RAA B;  3HFV A;  2DAQ A;  4DQ2 A;  2ZNI A;  1NLO C;  4XAX B;  1AT1 B;  1YWO A;  2XU8 A;  4M77 G;  1WPY A;  3DLM A;  2WSF E;  1ZA2 B;  3HFO A;  1XJW B;  1BI1 A;  4FCY A;  1KMM A;  5GAN d;  1P92 A;  2D0Q B;  4JJD A;  4J9D A;  1WFW A;  4RMF A;  4HWO A;  2PME A;  5IHK A;  4FT4 A;  4QVC A;  2FYK A;  4YTL A;  5CR2 A;  2XD0 A;  1PKS A;  1NZ9 A;  2A3L A;  1BBU A;  1D1B A;  5GMK l;  1NYF A;  4Z02 A;  3REB B;  2E64 A;  1SEM A;  1YFN A;  1M8M A;  3CMA T;  2XTI A;  2ARU A;  2ED0 A;  4C8Q D;  5HK0 A;  1C0A A;  3QZ5 B;  1IO6 A;  2DZC A;  2FZG B;  1W2B P;  3RGL A;  1BK2 A;  1Q81 R;  2LX7 A;  3HXY A;  2SRC A;  1X01 A;  1K76 A;  1KQS S;  3QTC A;  1G83 A;  2O9S A;  3SWN A;  3GNF B;  1WIE A;  2BZX A;  1Q81 U;  1GBQ A;  2CP2 A;  4X1V A;  4M78 B;  3QSU A;  3NHN A;  4M75 B;  4Y92 A;  2K3B A;  2BKD N;  4RTT A;  2VAS A;  1UUE A;  2DA9 A;  3MF1 A;  1BYM A;  4K11 A;  3TEH A;  5CQY A;  3CC2 Q;  1ZBJ A;  2MCN A;  3HY1 A;  1ZSG A;  2Y4Y A;  1KQS P;  4J7F A;  3TSW A;  2VGM A;  3V7R A;  2ZT8 A;  2DQ0 A;  1JJ2 P;  4RMO A;  1EZZ B;  1T0J A;  2W10 A;  1WXU A;  2D8H A;  2ZPF B;  2EL9 A;  4L6V 5;  3NET A;  3H0F A;  4B6M A;  1ZUU A;  4X9C A;  3J80 E;  1TU0 B;  3QZ9 B;  3CCL A;  2I4N A;  5LJ5 e;  4LDV A;  3RER A;  1UGP B;  5GAN f;  4Q15 A;  2RJD A;  5D7U A;  1ATI A;  2ZZG A;  2DRK A;  2HQX A;  1JU5 C;  2X4Y A;  3EGU A;  3JCM J;  1U06 A;  3JB9 G;  3U23 A;  1UGR B;  1Y0M A;  3HSB A;  3OS2 A;  3CC2 T;  2LRQ A;  1VQ4 T;  4CH4 A;  1C1A A;  5CAI A;  3CD6 T;  2MMP A;  3JB9 J;  2QHV A;  5GAM f;  2DK3 A;  1M1K R;  4M7A F;  3QO8 A;  2RI2 A;  2IY5 B;  4C92 E;  2AIR B;  4XTY A;  3A32 A;  2P5I A;  4NS5 A;  3JAM E;  1UG1 A;  1KSW A;  4HWT A;  2JS2 A;  2Y90 A;  4OMP A;  4H2X A;  4ME7 A;  1WJR A;  2LQN A;  3G6E Q;  2DEQ A;  3RUX A;  1HD3 A;  3CCM Q;  4BI4 A;  3QO3 A;  5IT9 E;  1J3T A;  2LNH B;  4C5E A;  2LZ6 B;  2LDM A;  2E3I A;  2M16 A;  3M4Y A;  2BTT A;  4OGE A;  3HFZ B;  4XTW A;  1YHQ Q;  1B8A A;  2AZS A;  4IIO A;  3G71 A;  2MYS A;  3VS7 A;  1VQK Q;  3OD1 A;  3LYI A;  3CCE A;  3MEA A;  1U1T A;  1W1F A;  1BI0 A;  4O5V A;  2HMA A;  1I07 A;  3CCM T;  2QHU A;  2MWO A;  1YIT A;  1VQ4 Q;  1YBY A;  2ZCF B;  1UFF A;  2Y4X A;  3A74 A;  2RJC A;  4TVW A;  2QYZ A;  2QEX T;  3ZFJ A;  2QXF A;  3E2U A;  5GMK e;  3CCV Q;  3WVE B;  2JM8 A;  1SF9 A;  2K2M A;  1VQ6 A;  2JMC A;  2ZXF A;  2FRY A;  1EIF A;  1SPK A;  1FMK A;  5HCK A;  4IUQ A;  2LT1 A;  4IUT A;  2DQ3 A;  2RB6 A;  3MEW A;  2DL5 A;  1FWZ A;  2QGF B;  3X20 B;  1RI0 A;  3DKM A;  2RQV A;  4MMK A;  4K86 A;  1PHT A;  5GAN 6;  4LE9 A;  4PLI A;  4LVI A;  1H4S A;  2MWP A;  4NCX A;  4CH5 A;  3VS4 A;  1YIJ T;  1Z9Q A;  4RTX A;  4EX5 A;  2K4Y A;  2ODR C;  2YUN A;  4DOV A;  2DET A;  3Q1J A;  2RNA A;  2CH4 A;  1VQN T;  5LJ3 f;  2NYS A;  3L2V A;  3QXE B;  4HCZ A;  4O6J A;  1NBE B;  2RN8 A;  1N9W A;  2KY9 A;  4R56 A;  1WXT A;  3OS0 A;  1KC8 R;  5GAO q;  3LW5 E;  1W4S A;  3OW2 P;  1VUB A;  5I2S A;  3DB4 A;  2EGC A;  5GMK j;  1WHM A;  3QO5 A;  3P8T A;  3O8V A;  4WJ3 M;  4YYE A;  4C92 C;  3QJY A;  2CJ9 A;  2JZ2 A;  2ENM A;  1MHN A;  4PFO A;  1YFS A;  4YRR A;  4C8Q B;  4PJO G;  4K88 A;  1E7O A;  3EHQ A;  5FRM A;  4YRJ A;  2XDB A;  1WJS A;  1MMG A;  2GQV A;  1W66 A;  4G84 A;  1VQ4 A;  3M4P A;  2FZK B;  1RIQ A;  1BIA A;  3GP8 A;  3O5Z A;  2X4J A;  4PHC A;  4PJJ A;  2PUO B;  3VRY A;  3CC4 Q;  4HWR A;  2C0I A;  2A37 A;  2K3Y A;  3QHS A;  1UGQ B;  4MZP A;  1UJY A;  4M77 F;  2DF6 A;  2P0K A;  2DBK A;  2H3E B;  1G51 A;  4A4G A;  4N4H A;  4J9E A;  4M7A E;  4P3P A;  3CCV T;  3TQ7 P;  4CC3 A;  3KXT A;  1RAI B;  1BKB A;  2CT4 A;  2XI9 A;  4XU1 A;  1NPR A;  2YT6 A;  3M4G A;  1B34 A;  2YWW A;  1MNE A;  4BE0 A;  2BZY A;  1VQ7 Q;  3J81 E;  1GL5 A;  1IRE B;  4PJM A;  1M2O A;  1IRX A;  1BBZ A;  3E1S A;  2CZ0 B;  1LOJ A;  4PG3 A;  1VQ5 Q;  4VUB A;  2KI7 A;  2RJF A;  2ZIM A;  4EMH A;  4H2Y A;  3KFV A;  3HP9 A;  3A98 A;  1MMA A;  1Q86 U;  1VQL A;  1USY C;  2F69 A;  1WYX A;  4DBQ A;  3CCL T;  3NEL A;  1Y07 A;  4P72 A;  4IUP A;  2KRO A;  4RKU E;  6AT1 B;  2ZZD A;  2L89 A;  4ELY C;  1D0Z A;  2PU9 B;  1ABO A;  1XTD A;  4PFP A;  5L8R E;  1K9M R;  3HHT B;  3V7C A;  3S3O A;  4ANJ A;  3HXZ A;  4EMK C;  2JVV A;  4AG2 C;  3OY9 A;  2CDT A;  1T3L A;  2Q5H A;  5C6S A;  3JRZ A;  4AFZ C;  3C0C A;  5KYN A;  3VU3 C;  2YUQ A;  1YJN A;  1UB4 A;  5GAN j;  3VYH B;  2QA4 T;  3X25 B;  4RTU A;  1QKX A;  3BDU A;  2CP3 A;  2DIQ A;  1Z7N A;  2CYZ B;  4GBQ A;  2BZ8 A;  5IHI A;  2QDL A;  1VQ9 T;  3NTI A;  2FZC B;  1U5S A;  3HKS A;  1S72 A;  4JRI A;  4D8D A;  5J26 A;  3CCS T;  2COY A;  4H2T A;  2AK5 A;  2YLC A;  3JCM h;  4F7U B;  2ROT A;  4PLL A;  4OML A;  1VQ8 T;  1TTH B;  4Y28 E;  5GMK m;  1M30 A;  3THK A;  2ESW A;  1GBR A;  1I8F A;  4RTV A;  2QTV A;  1SES A;  5D6X A;  1RL2 A;  5CQX A;  1QVF S;  3CMQ A;  4IKF A;  1YWP A;  1M9S A;  2KBT A;  3T9N A;  3TEE A;  2KGT A;  4NL2 A;  3RKW A;  5L23 A;  1OPK A;  1IGU A;  1M2V B;  2MIO A;  4M77 D;  2G3R A;  5LL6 S;  2YRD A;  4C8Q F;  3G4S A;  1VQN A;  4C0D B;  1H3Z A;  4PJO E;  5GAO n;  3M57 A;  1YIT T;  1VQM Q;  5A0L A;  4YRT A;  3WVD B;  2RHY A;  2DIG A;  4P75 C;  3HRK A;  4P72 C;  3JCM e;  2GGR A;  4XU0 A;  1X56 A;  1MV0 B;  4FU6 A;  1WHK A;  2O31 A;  5CCA A;  3A8O B;  4KH1 B;  1K1Z A;  1EVK A;  4C0G A;  2KRN A;  5GMK i;  2RI3 A;  4E7J A;  2HSP A;  1K9M C;  1YHQ T;  2EQK A;  2DXB A;  4J9F A;  4M75 E;  4HCC A;  4F7U F;  2I4L A;  4EMK A;  1G5H A;  2DKG A;  3SDZ A;  2EGA A;  5F5W A;  3I55 A;  4P71 C;  1LVK A;  3FEO A;  4UP8 A;  3CC4 A;  2V1R A;  1QE0 A;  4LVL A;  1JRI A;  5FWB A;  2L5Q A;  4M7D C;  2COW A;  3BDL A;  3GOX A;  3I55 Q;  1I5O B;  3LLR A;  3JCM g;  5KCH A;  1N27 A;  2SEM A;  1M1K U;  1VQO Q;  2ZT5 A;  2C0O A;  2KMT A;  1VIE A;  1G3Y A;  1ZA1 B;  2PTK A;  2EVR A;  2KK4 A;  1U3O A;  1D3B B;  2K2V A;  2VUB A;  1TUC A;  1ZUK A;  4BW9 A;  1ZUY A;  1N9R A;  3RDV A;  2Z0W A;  1X6O A;  3NEN A;  2XID A;  4KQE A;  5LJ5 h;  5LJ3 h;  5FU7 C;  3I56 A;  1RAG B;  2KRM A;  3PMI A;  1YN8 A;  4XQ3 A;  3CCQ A;  2RQU A;  4YRE A;  1OQK A;  4ESR A;  3JCM f;  1PSE A;  2MOX A;  3IKM B;  2E65 A;  5GAO m;  2CSI A;  4QKU A;  2EYQ A;  2VGN A;  1WQW A;  2M9U A;  4PNO A;  1NG2 A;  2M0O A;  2RK1 A;  3FLG A;  2V1Q A;  5EC7 A;  4H2U A;  1X2Q A;  1AZG B;  4YRL A;  4X34 A;  4QQG A;  1TOV A;  1K4U S;  1ASY A;  2KEA A;  2NUT A;  1IGQ A;  1QCF A;  3S3N A;  3JB9 D;  1VQM T;  1NYR A;  1OZ3 A;  4TVR A;  2G6F X;  5HKC A;  2KSS A;  2J6K A;  1Q7Y R;  4XU3 A;  5LJ3 e;  4J9B A;  2MAM A;  2OAU A;  1UGS B;  2RM4 A;  5LJ3 j;  3UAT A;  2IVW A;  3PNW C;  4M7D D;  1DJ7 B;  3OYA A;  1I0C A;  2D9T A;  1YJN Q;  4YRC A;  2EQJ A;  1KD1 R;  1YJW T;  1OZ2 A;  1K73 C;  1HXD A;  3ERR A;  2J3L A;  4YRG A;  3TVT A;  1YCS B;  3E9G A;  3CCS Q;  1ABQ A;  2D0N A;  4LDW A;  4FYY B;  1HC7 A;  1K9A A;  2EQI A;  4KGZ B;  2L3S A;  1FXX A;  2FPE A;  4QQ6 A;  1X6G A;  1M27 C;  2CGH A;  2J6O A;  4N4G A;  3CCR T;  3CCE Q;  3VKI A;  2V26 A;  2GCX A;  4EMK B;  3RKY A;  4M78 G;  3G71 Q;  2HD0 A;  1VQO T;  1H4T A;  1Y96 B;  1XOV A;  4XK8 E;  4ZTJ A;  2EBP A;  5GAN 3;  3QUI A;  3CCJ Q;  2LCS A;  2XKO C;  4KT0 E;  3JCM X;  4J9G A;  2DXT A;  4J9H A;  2ZZF A;  4C5G A;  1Q82 U;  3KBG A;  2HL3 A;  3KFU A;  1MND A;  2IY5 A;  3FRN A;  2A08 A;  4L5G A;  3QDR B;  4DBF A;  2FL7 A;  1CKA A;  1Q82 C;  4JJC A;  1WLP B;  4RCC A;  5GAM h;  3UDC A;  2A8E A;  4OMN A;  2EPD A;  5GAN g;  2KT1 A;  2B8A A;  1ZQ1 A;  3G71 T;  2LC4 A;  1UGV A;  2EFI A;  2FPF A;  3HRI A;  2DRM A;  1I81 A;  2RF0 A;  4Q6G A;  4WJ4 A;  4EPC A;  3UPU A;  3HTR A;  4F04 B;  4KUD K;  2C8M A;  4PJO C;  4AFU C;  5E3I A;  1ZSZ C;  1SKU B;  1V29 B;  1M2V A;  1TSF A;  4JUV A;  1UEB A;  1VOM A;  2A36 A;  2EGE A;  2P4R A;  4BY6 B;  3GBQ A;  1VQP A;  2EAY A;  1OYX A;  3SWN C;  2K6D A;  5GAN 4;  2VV5 A;  4P5N A;  2DEU A;  2GTO A;  1K73 U;  3F70 A;  2YRV A;  2DJQ A;  3LC0 A;  1I4K 1;  1KHC A;  1G5I A;  4FSX A;  1PRM C;  1GFD A;  3CMA A;  3A5Y A;  4C0Z A;  5GAN 5;  5DLO A;  3MKD A;  3R6N A;  4IIM A;  1PRL C;  1RLP C;  1WXB A;  2HBP A;  3CC2 A;  2HKN A;  3MCA B;  3AHU A;  1WDX A;  4JZ4 A;  1R0C B;  2KDS A;  3VUZ A;  1LNX A;  2IG0 A;  1WHH A;  1OU9 A;  3C4S A;  3OYJ A;  1M5Q 1;  2EYW A;  3JB9 I;  2QA4 Q;  2G4C A;  4TTV A;  4AH6 A;  2E10 A;  3IKL A;  2QEX Q;  4LNS A;  1T0H A;  1CSK A;  3UFG A;  5KYY A;  3REX A;  3TEH B;  1Q7Y C;  2GQI A;  3HRS A;  4E7Z A;  2VXF A;  2JN0 A;  3FJP A;  3OQ5 A;  4BAC A;  1NJ1 A;  4IUV A;  4MZM A;  4UC4 A;  2LCC A;  2V8I A;  4KGX B;  2DM1 A;  4JJB A;  4A4E A;  1LYL A;  3HL8 A;  2ZR3 A;  5C51 B;  1PYS A;  1HJD A;  3OW2 S;  3L2R A;  2PUK B;  4A53 A;  3A7A A;  3EG1 A;  5CKD A;  4MML A;  2DX1 A;  1PYS B;  1VQZ A;  1E24 A;  1X27 A;  1M1K C;  1QWE A;  1IHV A;  1YIT Q;  3QG1 A;  1NJ5 A;  1B70 B;  3EGD B;  2AMC B;  2ZPH B;  3C12 A;  3IQL A;  1QF6 A;  2RPN A;  2RD1 A;  4J9I A;  1OI1 A;  4JLG A;  3LH0 A;  4C5I A;  2BUD A;  4M7A B;  5DLQ E;  3LWH A;  3CCR Q;  3CCE T;  2CP0 A;  3N5B B;  3EFR A;  2DIL A;  4JDS A;  2YXY A;  4Y91 A;  2HAX A;  4V2S A;  2RHS A;  5CKB A;  1YJ9 T;  4LN2 A;  5M9O A;  2R5M A;  2M02 A;  1EQR A;  3VJP A;  1FMV A;  1OV3 A;  1PCX A;  2RH2 A;  5GAM j;  3CCJ T;  1H3H A;  3BJU A;  2H8H A;  1RAH B;  1AOJ A;  2JS0 A;  4BD3 A;  2QQA A;  3UGT A;  1RAF B;  5GAM g;  3G6E A;  1N6A A;  3PTA A;  1JXM A;  2EYX A;  5KNN A;  1SER A;  1SSF A;  2F1L A;  1M90 R;  1VQL T;  2J6F A;  2IPO B;  3RNJ A;  2ALY B;  1NJ6 A;  4YRM A;  1TWB A;  1H4V B;  1QCO A;  3PVL A;  1GCQ A;  2DZ9 A;  2F2X A;  5HGQ A;  2XMF A;  3TRE A;  4M75 G;  2JTE A;  2NUT B;  4PKC C;  1M90 U;  1V76 A;  2GNC A;  4A4H A;  3IAL A;  1KHI A;  1RAD B;  3TUP A;  4C8Q G;  4OGC A;  1AZE A;  2L3R A;  3S6W A;  1BB9 A;  3CD6 A;  4WTO B;  4FL6 A;  3UGQ A;  4H2W A;  2ROL A;  4B9X A;  5GJV B;  3VQX A;  1AWW A;  1D0Y A;  2P0L A;  1VQO A;  4ZIB A;  1D1C A;  1RAC B;  4M75 A;  1VQ9 A;  3CCL Q;  4KH0 B;  1GXI E;  1WU7 A;  4LDU A;  1PD1 A;  5GAM e;  1QLY A;  2O4X A;  1U8R A;  2VWF A;  3J7A F;  2K3X A;  3NPF A;  2LX9 A;  1KQS A;  4TVA B;  1KFZ A;  4P73 C;  2EQM A;  5FW9 A;  3D7S B;  5C52 B;  3M58 A;  2DFU A;  2KR3 A;  1YIJ A;  1W6X A;  1Y7X A;  2DD4 A;  5IXB A;  1KQ1 A;  3FJ5 A;  2ZIO A;  2WSC E; 
#chains in the Genus database with same CATH homology
 4ATO A;  4X5O A;  3LGL A;  3P8D A;  3LSQ A;  3OSV A;  4UP9 A;  3BY7 A;  3HXU A;  4M78 C;  4PJO B;  1XNI A;  2DXU A;  2QTX A;  4YRQ A;  2ZNJ A;  5KE2 A;  1Y96 A;  1IL2 A;  3KUF A;  4HT9 A;  1YGB A;  2ZIN A;  3JB9 F;  4JRK A;  3OBW A;  2DO3 A;  1BI3 A;  4HCB A;  3QJ6 A;  3NFC A;  4TVA A;  4P75 A;  4TWA A;  1X55 A;  4P3O A;  3CCS A;  1YI2 A;  3CPF A;  3RMS A;  1BIB A;  3OSS C;  5CVI A;  2XG8 D;  3PGG A;  4M78 F;  4PJO D;  2GFA A;  4M75 C;  3VQV A;  3V8L A;  1N8R U;  2E41 A;  4ZTZ B;  4CH6 A;  4F7U G;  1WYD A;  2E5Q A;  2DTH A;  4P73 A;  3S3M A;  3JB9 H;  1G5V A;  3I56 T;  3OB9 A;  3GIB A;  5EG2 A;  3JCM c;  4LVJ A;  5GAO r;  2RO0 A;  3UT1 A;  1VQ7 T;  2E12 A;  3L2U A;  4D6W A;  4ZGD B;  1WQ7 A;  3L2Z A;  1VQ8 A;  4H2S A;  4RG8 A;  4JS4 A;  2GF7 A;  1AHJ B;  3VQY A;  4ZTF A;  3MEU A;  3X24 B;  4M78 A;  1YB3 A;  3OS1 A;  3HXV A;  3HPW A;  3RAC A;  3JSC A;  4J5Y A;  3ZEH A;  4M7A A;  2AHJ B;  4JJN K;  3L4G A;  4YRF A;  4XTX A;  4E7H A;  3SWN B;  3PIO A;  3QII A;  2E1H A;  4KR2 A;  2LT4 A;  1YI2 T;  1JJ2 A;  2LTO A;  2ZTG A;  2VYT A;  5GAN 7;  3BFM A;  2PMF A;  3URG A;  3ICA A;  2K5F A;  2O4X B;  4RDX A;  2PVG B;  3R07 A;  2HQE A;  2QDY B;  2JNG A;  1EVL A;  4ZGE B;  1ZHI A;  4QQD A;  5LJ5 g;  1VQM A;  2WSE E;  2D6F A;  5CKH A;  2EQU A;  1HK9 A;  1JJC A;  2KQW A;  4OP0 A;  2V8K A;  4XEO A;  3V8J A;  4KR3 A;  3G7Z A;  2X4X A;  4C8Q A;  4J6Y A;  1BI2 A;  1KD1 U;  2XHC A;  1VQ6 T;  4M77 B;  2QA4 A;  3H8Z A;  3RES A;  1E1O A;  3MHX A;  4CH3 A;  2E3C A;  3OYN A;  2E5A A;  2EJ9 A;  3QBY A;  3M53 A;  2BIV A;  1YFR A;  2ZCE A;  1VIF A;  5C0M A;  2K5I A;  3M4Q A;  3GLX A;  1KOG A;  2R57 A;  3UWN A;  5ELN A;  3L1A A;  3CME T;  3JCM V;  3ME9 A;  3CCV A;  1QP3 A;  4FIB A;  3JCM d;  3P8H A;  2FHD A;  2RHS B;  5DM7 R;  4C92 D;  1ADY A;  3OYG A;  5GAO p;  3R6O A;  2VC8 A;  2Q7E A;  4ZTU B;  3FB9 A;  4P74 C;  1NJ2 A;  5CK9 A;  2HNI A;  3VBB A;  4M77 C;  4OB0 B;  3PMT A;  3OS5 A;  3C94 A;  2I4M A;  2FB7 A;  2GFU A;  2H3J A;  2DDZ A;  3QKJ A;  1Y71 A;  4L59 A;  3MEV A;  5CKF A;  3GPL A;  4XEM A;  1YJW A;  1B70 A;  3TU4 K;  3CBO A;  2LQ8 A;  4NL3 A;  3JCM b;  4J83 A;  2L8D A;  3PZC A;  1EIY A;  3REU A;  3NEM A;  2QQB A;  4DOW A;  1B34 B;  3OYC A;  3I7F A;  5K1P A;  2DTI A;  1KMN A;  3DLL A;  3P8Y A;  4L87 A;  4B9W A;  2PVO B;  3QPH A;  1LJO A;  2CIM A;  3IG2 A;  3WXM B;  3CXC A;  3WQZ A;  2ARS A;  2V8J A;  3VV0 A;  3CCQ T;  1N8R C;  2FVU A;  3CCU T;  3A5Z A;  1G3W A;  3RIR A;  3BW1 A;  1SET A;  2MI6 A;  2RHQ B;  5GAN 2;  5K1X A;  4X9D A;  2A7Y A;  5A0D A;  1XQH A;  2EIF A;  4UPA A;  4M77 A;  1QW1 A;  1JBM A;  3L2W A;  1S72 T;  3OYY A;  2NS6 A;  2C06 A;  2QEX A;  2K57 A;  4NOY A;  4J8O A;  1O75 A;  5I2M A;  5CIU A;  4XTV A;  4XTZ A;  4HVC A;  2P0Q A;  3A8L B;  2LNV A;  2KVQ G;  4O2D A;  3M9Q A;  4BE2 A;  5D6Y A;  4IUR A;  2ZT6 A;  3JCM Q;  3NTK A;  4K87 A;  4Q5W A;  1KG1 A;  2RHU A;  1IZ6 A;  4P3N A;  4J6X A;  3E9F A;  1NJI C;  3CXC S;  4OB2 B;  1JB0 E;  1Q81 C;  5KH6 A;  5FRN A;  5GAN e;  2RJE A;  2RHX A;  1M8V A;  3M59 A;  3INZ A;  1VQK T;  3CC7 T;  2P0P A;  3ZBD A;  2QQS A;  3HFZ A;  4E51 A;  1ASZ A;  4EDU A;  4C0F A;  2AKW A;  2KAF A;  4YDQ A;  4LVK A;  3EAE A;  1M1F A;  4PJO A;  4EMG A;  4H2X B;  2RK2 A;  4RQF A;  3MF2 A;  3L4G B;  1KC8 C;  4II1 A;  3FDR A;  2CJB A;  4HKE A;  1YJ9 A;  3TEG A;  1M90 C;  2XDP A;  1NE8 A;  2E70 A;  3CCJ A;  2ART A;  2OTJ A;  5GMK h;  2OTL T;  2DU7 A;  3LSS A;  5ELO A;  2XGT A;  4M78 E;  4C0D C;  3P8B B;  2ZPE B;  1EFW A;  4YRS A;  3SD4 A;  2XK0 A;  4M7D G;  3ASK A;  3C95 A;  4EO4 A;  3CCR A;  3OYB A;  2ALY A;  3QO7 A;  3A7U A;  2DTO A;  1PSF A;  2ZT7 A;  4YRP A;  3HRU A;  3A7R A;  2QI2 A;  2CZ7 B;  4C92 G;  4LD9 K;  4CS4 A;  3M55 A;  4LDX A;  1W2B A;  3HXX A;  3CBM A;  1O9S A;  3P8V A;  5C53 B;  4TQF A;  1I5L A;  3TCJ A;  2RA2 A;  3MP1 A;  4YCV A;  3QNE A;  1E22 A;  2E6Z A;  2DD5 A;  3FC3 A;  1X2H A;  4HA8 A;  4H02 A;  1WJQ A;  2EJG A;  1ZBX A;  2QQ9 A;  3E19 A;  1J5W A;  3E9H A;  1X54 A;  3GF5 A;  1VQ5 A;  3OYI A;  1SRY A;  2EKO A;  2AMC A;  4JRP A;  4C92 F;  2QQR A;  4GY5 A;  2CS7 A;  4ZGJ B;  2M1H A;  1K8A U;  4M7A G;  2ZGW A;  2K5L A;  4JLI A;  3OYL A;  1Q86 C;  1E1T A;  4BWA A;  5J39 A;  4HT4 A;  4BI3 A;  4BB7 A;  4DPG A;  1JJ2 S;  1WNL A;  2JTF A;  2DU5 A;  4IUU A;  3RKX A;  4LVM A;  4CS2 A;  4F7U E;  3EFS A;  4KUL A;  1QVG A;  3L42 A;  4WF2 A;  1K9M U;  5GAM d;  3W3S A;  4YRN A;  2R58 A;  2XDD A;  3X26 B;  4F7U A;  3FIF A;  2Q5I A;  2RI5 A;  3RL6 A;  12AS A;  3A8G B;  5CO7 A;  4M75 D;  5LJ5 d;  1YJN T;  4C92 A;  2EWN A;  5J3B A;  3CEY A;  4KUI A;  1KQ2 A;  1WGS A;  4YP0 A;  2OTJ T;  1FX7 A;  4C5H A;  2ODR D;  5GAO l;  2MF2 A;  1YCY A;  4C92 B;  4GLK A;  5LJ5 f;  4BE1 A;  5GAN 8;  4C8Q C;  4R55 A;  2X4W A;  11AS A;  2E6N A;  3GNG A;  2NLU A;  4RG2 A;  4YRK A;  3DB3 A;  3OMC A;  4A4K A;  4OLF A;  3MQZ A;  3NTH A;  3MP6 A;  1JJC B;  5FU6 B;  1NJI U;  4XTU A;  1EIY B;  5A2Q E;  2WAC A;  4QVD A;  3SB2 A;  4N0A C;  5IAY A;  4OB3 B;  1Q7Y U;  4CI0 C;  2AKW B;  2ZPG B;  4QVZ A;  4CS3 A;  2OTL A;  5KCO A;  3OYE A;  4OMF B;  1USY A;  3RF1 A;  4G85 A;  4J6W A;  1R8O B;  3M5A A;  1VQK A;  2YHT A;  3V7S A;  4E7I A;  4TVY A;  2O01 E;  1B7Y B;  4YPF A;  3HTZ A;  3CPW A;  3CC4 T;  1ADJ A;  2I4O A;  2RHI A;  3V8K A;  2Q7G A;  3MP8 A;  3PT9 A;  3PFS A;  1K8A C;  3E9I A;  5LJ5 j;  5LJ3 g;  3CME A;  1NYQ A;  1N9S A;  2P4T A;  3PIP A;  4LDY A;  4HWS A;  2JTM A;  3OBY A;  1BBW A;  2VXE A;  4LD6 A;  2DPP B;  5FLX E;  4H2V A;  3LX7 A;  4TQD A;  1VQP T;  5CKE A;  3LGF A;  3VUB A;  3G6E T;  2PQW A;  4BDZ A;  5FU7 B;  4ZN3 A;  1QVF A;  3OYM A;  3OYK A;  3QYH B;  3UH0 A;  5AYF A;  2JOY A;  2C7I A;  3CCU A;  4DA4 A;  4M7D F;  4YRI A;  2LQK A;  4C8Q E;  1QVP A;  1G3T A;  4WI1 A;  1M4Z A;  5A0G A;  2RHQ A;  4ZN1 A;  3A8H B;  3CBP A;  3I55 T;  4M7A C;  3OYH A;  4N0A A;  1VQ5 T;  3G4S T;  3A8M B;  4N4I A;  3JCM P;  4YCU A;  3QYG B;  5KE3 A;  4OVA A;  4OB1 B;  3L2Q A;  4BY6 C;  4E7K A;  1YFT A;  3MO8 A;  3H6Z A;  4M77 E;  3SFM A;  1M1G A;  4JRQ A;  2ZR2 A;  4YRO A;  4J7I A;  1NJ8 A;  4P71 A;  3PCO A;  1D3B A;  5LJ3 d;  1B7Y A;  3VQW A;  4RCB A;  4M7D A;  1QVG S;  3A31 A;  4M78 D;  4PJO F;  4KBM B;  4A54 A;  1X75 C;  4BI8 B;  4P74 A;  3PCO B;  2ZZE A;  2JUF A;  1B76 A;  2ZPB B;  2J3M A;  4XU2 A;  1WLE A;  3X28 B;  1KC8 U;  4M7A D;  4M7D B;  1EOV A;  4BDY A;  4ELZ C;  1U1S A;  1HTT A;  4MDW A;  1H4Q A;  2DXC A;  2CKK A;  4MDX A;  1MGQ A;  1NNH A;  2CZ6 B;  1X2G A;  3HY0 A;  1TH7 A;  3JCM W;  2YLB A;  3OYF A;  2XIC A;  4E7L A;  2PVD B;  5IN1 A;  3OA6 A;  4M75 F;  3OW2 A;  5I21 A;  5D6W A;  1YHQ A;  2RHZ A;  4A4F A;  2F5T X;  4PL6 A;  4HWP A;  4YCW A;  2Q7H A;  1Z7M A;  1L0W A;  3OMG A;  4QW2 A;  3LWI A;  3VYG A;  3CCM A;  4UP7 A;  2I2L A;  5HY6 A;  4E47 A;  3HXW A;  3G1Z A;  1QP2 A;  3DSQ A;  1KD1 C;  3MEY A;  4BUG A;  2F5K A;  2R5A A;  3HRT A;  1G3S A;  2QHT A;  4HT8 A;  5FU6 C;  2X35 A;  4CRI A;  4J15 A;  1W2B S;  2DJZ A;  2EJF A;  1NPP A;  3M54 A;  1H64 1;  4RQE A;  4FT2 A;  5GAN h;  2DVE A;  2CJA A;  2QHS A;  3HFN A;  3ER0 A;  3MET A;  4JS5 A;  2ZPI B;  3OYD A;  1VQ7 A;  5FRO A;  4OF1 A;  4FM4 B;  4MZT A;  3CPW S;  2LCL A;  3A5Z B;  1FYF A;  5DY9 A;  1GGM A;  3CC7 A;  4M7D E;  2CZ1 B;  3RMQ A;  5HK3 A;  3M56 A;  2LVM A;  3HFV A;  2DAQ A;  4DQ2 A;  2ZNI A;  4XAX B;  2XU8 A;  4M77 G;  1WPY A;  3DLM A;  2WSF E;  3HFO A;  1BI1 A;  1KMM A;  5GAN d;  1P92 A;  2D0Q B;  4RMF A;  4HWO A;  2PME A;  4FT4 A;  4QVC A;  2FYK A;  4YTL A;  2XD0 A;  5CR2 A;  1NZ9 A;  2A3L A;  1BBU A;  5GMK l;  4Z02 A;  2E64 A;  2XTI A;  3CMA T;  2ARU A;  4C8Q D;  5HK0 A;  1C0A A;  3QZ5 B;  2DZC A;  3RGL A;  3HXY A;  1X01 A;  1KQS S;  3QTC A;  3SWN A;  3GNF B;  1Q81 U;  4M78 B;  3QSU A;  4M75 B;  2BKD N;  3MF1 A;  1BYM A;  3TEH A;  5CQY A;  3HY1 A;  2Y4Y A;  4J7F A;  2VGM A;  3V7R A;  2ZT8 A;  2DQ0 A;  4RMO A;  2ZPF B;  2EL9 A;  4L6V 5;  3NET A;  4X9C A;  3J80 E;  3QZ9 B;  3CCL A;  2I4N A;  5LJ5 e;  4LDV A;  3RER A;  1UGP B;  5GAN f;  4Q15 A;  2RJD A;  1ATI A;  2ZZG A;  2HQX A;  2X4Y A;  3JCM J;  3JB9 G;  1UGR B;  3HSB A;  3OS2 A;  3CC2 T;  2LRQ A;  1VQ4 T;  4CH4 A;  5CAI A;  3CD6 T;  2MMP A;  3JB9 J;  2QHV A;  5GAM f;  2DK3 A;  4M7A F;  3QO8 A;  2RI2 A;  2IY5 B;  4C92 E;  4XTY A;  3A32 A;  2P5I A;  4NS5 A;  3JAM E;  4HWT A;  4H2X A;  2Y90 A;  4ME7 A;  1WJR A;  2DEQ A;  3RUX A;  4BI4 A;  3QO3 A;  5IT9 E;  4C5E A;  2LDM A;  2M16 A;  3M4Y A;  4OGE A;  3HFZ B;  4XTW A;  1B8A A;  3G71 A;  3OD1 A;  3LYI A;  3CCE A;  3MEA A;  1U1T A;  1BI0 A;  4O5V A;  3CCM T;  2QHU A;  2MWO A;  1YIT A;  1YBY A;  2ZCF B;  2Y4X A;  3A74 A;  2RJC A;  4TVW A;  2QEX T;  3ZFJ A;  2QXF A;  5GMK e;  3WVE B;  1VQ6 A;  2ZXF A;  1EIF A;  4IUQ A;  2LT1 A;  4IUT A;  2DQ3 A;  2RB6 A;  3MEW A;  1FWZ A;  3X20 B;  1RI0 A;  3DKM A;  4MMK A;  4K86 A;  5GAN 6;  4PLI A;  4LVI A;  1H4S A;  2MWP A;  4NCX A;  4CH5 A;  1YIJ T;  4EX5 A;  2K4Y A;  2ODR C;  4DOV A;  3Q1J A;  1VQN T;  5LJ3 f;  3L2V A;  3QXE B;  4HCZ A;  4O6J A;  1N9W A;  2KY9 A;  4R56 A;  3OS0 A;  5GAO q;  3LW5 E;  1W4S A;  1VUB A;  5I2S A;  3DB4 A;  5GMK j;  3QO5 A;  3P8T A;  3O8V A;  4WJ3 M;  4YYE A;  4C92 C;  3QJY A;  2CJ9 A;  2JZ2 A;  1MHN A;  1YFS A;  4YRR A;  4C8Q B;  4PJO G;  4K88 A;  4YRJ A;  5FRM A;  2XDB A;  1WJS A;  2GQV A;  1W66 A;  4G84 A;  1VQ4 A;  3M4P A;  1RIQ A;  1BIA A;  3GP8 A;  2X4J A;  4PHC A;  2PUO B;  4HWR A;  2K3Y A;  3QHS A;  1UGQ B;  4MZP A;  4M77 F;  2P0K A;  1G51 A;  4A4G A;  4N4H A;  4M7A E;  4P3P A;  3CCV T;  3KXT A;  1BKB A;  2XI9 A;  4XU1 A;  1NPR A;  3M4G A;  1B34 A;  4BE0 A;  3J81 E;  1IRE B;  3E1S A;  2CZ0 B;  1LOJ A;  4PG3 A;  4VUB A;  2RJF A;  2ZIM A;  4EMH A;  4H2Y A;  3HP9 A;  1VQL A;  1Q86 U;  1USY C;  2F69 A;  3CCL T;  3NEL A;  1Y07 A;  4P72 A;  4IUP A;  4RKU E;  2ZZD A;  2L89 A;  4ELY C;  2PU9 B;  1XTD A;  5L8R E;  3HHT B;  3V7C A;  3S3O A;  3HXZ A;  4EMK C;  2JVV A;  3OY9 A;  2Q5H A;  5C6S A;  3JRZ A;  3VU3 C;  1YJN A;  1UB4 A;  5GAN j;  3VYH B;  2QA4 T;  3X25 B;  3BDU A;  2DIQ A;  1Z7N A;  2CYZ B;  1VQ9 T;  3NTI A;  3HKS A;  1S72 A;  4JRI A;  5J26 A;  3CCS T;  4H2T A;  2YLC A;  3JCM h;  4F7U B;  4PLL A;  1VQ8 T;  4Y28 E;  5GMK m;  1I8F A;  1SES A;  5D6X A;  1RL2 A;  5CQX A;  1QVF S;  3CMQ A;  4IKF A;  1M9S A;  3T9N A;  3TEE A;  4NL2 A;  3RKW A;  4M77 D;  2G3R A;  5LL6 S;  4C8Q F;  3G4S A;  1VQN A;  4C0D B;  1H3Z A;  4PJO E;  5GAO n;  3M57 A;  1YIT T;  5A0L A;  4YRT A;  3WVD B;  2RHY A;  2DIG A;  4P75 C;  3HRK A;  4P72 C;  3JCM e;  4XU0 A;  1X56 A;  4FU6 A;  5CCA A;  3A8O B;  1EVK A;  4C0G A;  5GMK i;  2RI3 A;  4E7J A;  1K9M C;  1YHQ T;  2EQK A;  2DXB A;  4M75 E;  4HCC A;  4F7U F;  2I4L A;  4EMK A;  1G5H A;  2DKG A;  3SDZ A;  5F5W A;  3I55 A;  4P71 C;  3FEO A;  4UP8 A;  3CC4 A;  1QE0 A;  4LVL A;  1JRI A;  4M7D C;  2L5Q A;  3BDL A;  3GOX A;  3LLR A;  3JCM g;  5KCH A;  1N27 A;  1M1K U;  2ZT5 A;  2KMT A;  1VIE A;  1G3Y A;  2KK4 A;  1D3B B;  2K2V A;  2VUB A;  4BW9 A;  1N9R A;  1X6O A;  3NEN A;  2XID A;  4KQE A;  5LJ5 h;  5LJ3 h;  5FU7 C;  3I56 A;  3PMI A;  4XQ3 A;  3CCQ A;  4YRE A;  3JCM f;  1PSE A;  3IKM B;  2E65 A;  5GAO m;  2EYQ A;  2VGN A;  1WQW A;  2M9U A;  4PNO A;  2M0O A;  2RK1 A;  3FLG A;  4H2U A;  4YRL A;  4X34 A;  4QQG A;  1ASY A;  3S3N A;  3JB9 D;  1VQM T;  1NYR A;  1OZ3 A;  4TVR A;  5HKC A;  2KSS A;  4XU3 A;  5LJ3 e;  2MAM A;  2OAU A;  1UGS B;  2RM4 A;  5LJ3 j;  2IVW A;  3PNW C;  4M7D D;  1DJ7 B;  3OYA A;  2D9T A;  4YRC A;  2EQJ A;  1YJW T;  1OZ2 A;  1K73 C;  1HXD A;  3ERR A;  2J3L A;  4YRG A;  3E9G A;  4LDW A;  1HC7 A;  1FXX A;  4QQ6 A;  2CGH A;  4N4G A;  3CCR T;  3VKI A;  2GCX A;  4EMK B;  3RKY A;  4M78 G;  2HD0 A;  1VQO T;  1H4T A;  1Y96 B;  1XOV A;  4XK8 E;  4ZTJ A;  5GAN 3;  3QUI A;  2XKO C;  4KT0 E;  3JCM X;  2DXT A;  2ZZF A;  4C5G A;  1Q82 U;  3KBG A;  3KFU A;  2IY5 A;  3FRN A;  4L5G A;  3QDR B;  2FL7 A;  1Q82 C;  4RCC A;  5GAM h;  3UDC A;  2A8E A;  5GAN g;  2B8A A;  1ZQ1 A;  3G71 T;  2LC4 A;  2EFI A;  3HRI A;  1I81 A;  4WJ4 A;  4Q6G A;  4EPC A;  3UPU A;  4KUD K;  2C8M A;  4PJO C;  5E3I A;  1V29 B;  4JUV A;  1UEB A;  1VQP A;  4BY6 B;  2EAY A;  1OYX A;  3SWN C;  5GAN 4;  2VV5 A;  4P5N A;  1K73 U;  3F70 A;  2YRV A;  3LC0 A;  1I4K 1;  1KHC A;  1G5I A;  4FSX A;  3CMA A;  3A5Y A;  4C0Z A;  5GAN 5;  5DLO A;  2HBP A;  3CC2 A;  3MCA B;  3AHU A;  2KDS A;  3VUZ A;  1LNX A;  2IG0 A;  3C4S A;  3OYJ A;  1M5Q 1;  3JB9 I;  2G4C A;  4TTV A;  4AH6 A;  2E10 A;  3IKL A;  4LNS A;  3UFG A;  3REX A;  3TEH B;  1Q7Y C;  3HRS A;  2VXF A;  2JN0 A;  3FJP A;  3OQ5 A;  4BAC A;  1NJ1 A;  4IUV A;  4MZM A;  4UC4 A;  2LCC A;  2V8I A;  4A4E A;  1LYL A;  3HL8 A;  2ZR3 A;  5C51 B;  1PYS A;  3OW2 S;  3L2R A;  2PUK B;  4A53 A;  3A7A A;  5CKD A;  4MML A;  1PYS B;  1VQZ A;  1E24 A;  1M1K C;  3QG1 A;  1NJ5 A;  1B70 B;  2AMC B;  2ZPH B;  3C12 A;  1QF6 A;  2RD1 A;  1OI1 A;  4JLG A;  3LH0 A;  4C5I A;  2BUD A;  5DLQ E;  4M7A B;  3LWH A;  3CCE T;  3N5B B;  3EFR A;  2RHS A;  4JDS A;  4Y91 A;  2HAX A;  4V2S A;  5CKB A;  1YJ9 T;  5M9O A;  2R5M A;  1EQR A;  3VJP A;  2RH2 A;  5GAM j;  3CCJ T;  3BJU A;  4BD3 A;  2QQA A;  3UGT A;  3G6E A;  5GAM g;  1N6A A;  3PTA A;  5KNN A;  1SER A;  1SSF A;  1VQL T;  2ALY B;  1NJ6 A;  4YRM A;  1H4V B;  2DZ9 A;  5HGQ A;  3TRE A;  4M75 G;  4PKC C;  1M90 U;  4A4H A;  3IAL A;  1KHI A;  3TUP A;  4C8Q G;  4OGC A;  2L3R A;  3S6W A;  3CD6 A;  4FL6 A;  3UGQ A;  4H2W A;  4B9X A;  3VQX A;  2P0L A;  1VQO A;  4ZIB A;  4M75 A;  1VQ9 A;  1GXI E;  1WU7 A;  4LDU A;  5GAM e;  2O4X A;  1U8R A;  3J7A F;  2K3X A;  2LX9 A;  1KQS A;  4TVA B;  4P73 C;  2EQM A;  5C52 B;  3M58 A;  1YIJ A;  1Y7X A;  2DD4 A;  1KQ1 A;  2ZIO A;  2WSC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...