3RUXA

Crystal structure of biotin-protein ligase bira from mycobacterium tuberculosis in complex with an acylsulfamide bisubstrate inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Bisubstrate Adenylation Inhibitors of Biotin Protein Ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ruxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ruxA01
4H2XA 4X5OA 4A53A 2CJ9A 3P8VA 1M5Q1 4P3OA 3E9IA 1Y96B 4XU1A 4M7AB 2ZR2A 2Y90A 4HT9A 4YPFA 5LJ3e 4YCUA 4E51A 2I2LA 4YP0A 1KOGA 1NJ2A 4PHCA 1BIBA 1X01A 4P75C 4HWSA 4M7DB 4C8QG 3JB9F 2Q5HA 4M77D 1EVLA 2ALYB 1YCYA 1PYSA 1Z7MA 5C52B 2JN0A 1KMMA 4BW9A 4JLIA 3EFRA 3INZA 4YCVA 4HWRA 4H2WA 1KQ2A 3RACA 4XU2A 4YRKA 1N9SA 5GAN5 3UGQA 4YDQA 1E24A 4WI1A 3V8LA 3M4QA 3QO3A 1N9WA 3JCMh 3SWNB 4RCBA 1SERA 2E64A 3A74A 1YFTA 4C8QC 3R07A 1E1TA 5LJ3g 4N0AA 2RA2A 1SRYA 3ICAA 5LJ3d 4M77B 3REUA 1WU7A 3L1AA 3JCMe 4C8QF 2E10A 2QTXA 3JCMV 1U1TA 4LNSA 4A54A 1WNLA 3HXVA 4H2VA 4XTVA 5GAN3 3HY0A 4EO4A 3HXUA 3EFSA 1JJCB 4P74C 2FYKA 2I4OA 5GMKj 3PGGA 2AKWB 5GMKl 1JRIA 1IL2A 2ARSA 3VU3C 4C8QD 1HC7A 3QUIA 2DZ9A 1EOVA 2P0LA 2QHTA 5LJ5g 4ZIBA 2I4LA 5LJ3f 4HT8A 4EX5A 3QHSA 4PJOA 4F7UE 4JRIA 2AMCA 4KQEA 4PJOE 3JCMd 3QO7A 2YHTA 4YROA 2E1HA 3JCMP 4K88A 4NL3A 5GANg 4C92E 3FJPA 4M75A 4M7DC 1G5IA 4M75E 2DTOA 3JCMQ 2E65A 2VC8A 3RERA 2VXEA 3IALA 4M78G 1W66A 4M77A 5GAMj 3VQVA 12ASA 4C8QB 3REXA 1YFSA 4M77E 3RKWA 3HFVA 4F7UG 3BDUA 1KQ1A 3UFGA 3V8JA 4YRGA 2E41A 3I7FA 4C92G 3TUPA 4X9CA 5I21A 4XQ3A 1J5WA 1JJCA 1LNXA 3SWNC 2DZCA 3HFOA 2P5IA 2EJFA 4J6YA 3HFZB 3JCMf 3LSQA 2DU7A 4EMKC 4MMLA 3HY1A 4M7DD 4P75A 2J3MA 3P8TA 4M78C 4Q15A 2DXUA 2Q7EA 2RHQA 1X56A 3HTZA 4RMFA 3VQWA 2ZGWA 4G85A 1G51A 2XGTA 3ERRA 3VQYA 4F7UF 3HXYA 3MF1A 4EMHA 2I4NA 4P73C 4PJOF 1I81A 3LSSA 2ARTA 4HWOA 4C92F 5GMKm 1X54A 4TVAB 5GAMd 3A7RA 4M75F 2ZNIA 3E9HA 1HXDA 5K1XA 4H2YA 5ELOA 4M78D 1X55A 2ZNJA 1NJ6A 1I8FA 1YB3A 1EIYA 4TVYA 4XTUA 2DVEA 5GMKi 4YRLA 1ADJA 2CIMA 3JCMJ 1NJ8A 5DY9A 5GAOq 3NENA 4OLFA 2QHVA 4XEOA 1QF6A 4QVCA 3JB9H 1NYRA 3HFZA 4P74A 3RUXA 4HWTA 4RQEA 1H4SA 2ZT8A 3JB9D 2DDZA 4H2UA 2DXTA 1U1SA 5GAN8 1E22A 4X9DA 4EMKB 3RESA 3UH0A 1H4QA 4M78B 3MF2A 2YLCA 3BJUA 3UGTA 3M4GA 5ELNA 1WYDA 2E3CA 1YGBA 3GIBA 2ODRC 4UPAA 1E1OA 1L0WA 5LJ5j 11ASA 1Y96A 3WQZA 2ZIMA 4M7AA 4P72C 4YRPA 5K1PA 4V2SA 5GMKh 4M7AE 1USYC 3TEHB 3RGLA 4CS2A 4HVCA 1Z7NA 2ZIOA 2IY5B 3RF1A 1N9RA 5GAN6 3BY7A 4M7DA 4UP9A 4XTWA 5GANj 1VQZA 4M7DE 2ALYA 4YRMA 2CJAA 1SETA 3A7AA 1JBMA 2ARUA 3DSQA 4YRFA 3QO5A 5GMKe 4YRJA 3NETA 2RHSB 1WQ7A 2ODRD 3JCMg 4J5YA 1NNHA 3RIRA 4XTXA 2C8MA 3SWNA 3A5ZA 4OP0A 4P71A 3SB2A 2XTIA 4YRTA 4N0AC 4HWPA 4PNOA 4KR3A 4MMKA 5GAMh 5F5WA 4RDXA 4XTZA 3JCMc 3QTCA 1H4TA 2RM4A 1B70B 2I4MA 1B34B 4XU3A 4PJOG 3QNEA 4XU0A 4RQFA 4H2XB 3TEGA 2EAYA 2DQ0A 4YRCA 5GAMe 1QE0A 4P73A 4TQFA 3TEHA 2IY5A 3QSUA 1B7YB 4M75G 3JB9J 4M7AF 4Y91A 2AKWA 1NJ1A 2QHUA 3IG2A 1BBWA 2G4CA 2K57A 1HTTA 4M77G 4CS4A 4K87A 1PYSB 1NJ5A 3BFMA 3OD1A 1B76A 3HXXA 1H4VB 2Q7HA 2ZINA 2RHSA 4PJOC 1TH7A 4BWAA 1H641 4C92C 4DQ2A 3A5YA 4TVWA 1LOJA 2DEQA 4M75C 1EVKA 3NELA 4KR2A 3HFNA 5GAMg 4YREA 2C7IA 1ADYA 1B8AA 3BW1A 1WPYA 1X2GA 3W3SA 3A7UA 4TQDA 1HK9A 4C8QA 4C8QE 1ASYA 1BIAA 2EWNA 4M77F 3V7CA 2ZTGA 5LJ3j 1FYFA 2RB6A 4PJOD 3FB9A 4QVDA 2ZT5A 5GAN7 1B7YA 4C92D 4P72A 2YLBA 4CH6A 1KMNA 1USYA 4M75D 2DTHA 4H02A 2J3LA 3PZCA 4NOYA 4UP7A 3LC0A 5GAMf 1BBUA 3RL6A 4YRQA 4J6XA 2VXFA 4ZTUB 4F7UB 4YRSA 5GAOp 3JCMW 1LYLA 5LJ5h 4PJOB 2AMCB 4NCXA 5GAN2 4CH4A 3NEMA 4J6WA 4C92B 5GAOn 3L2ZA 3HXWA 3L4GB 4TVAA 4M75B 5GANh 5LJ5e 3AHUA 3HRIA 1I5LA 2PMFA 5GAOr 2EJ9A 3CMQA 3IKMB 5KNNA 3HXZA 4CH5A 2CGHA 5GAN4 2Q5IA 4XTYA 2ZZFA 4G84A 4NL2A 2ZXFA 2DQ3A 5GANe 2QHSA 2ZCEA 3P8YA 3PCOB 3VQXA 4M7AG 1X2HA 5C51B 2EJGA 3G1ZA 1ATIA 4H2TA 2HNIA 3VBBA 4P3NA 1D3BB 4YRRA 2CJBA 5HGQA 4RCCA 3HRKA 4YRIA 1M8VA 1LJOA 3RKYA 4M7DG 5E3IA 2FB7A 4UP8A 4YCWA 4EMKA 5GAOm 3QO8A 1C0AA 4M78A 4PG3A 2RHQB 4M78E 3KFUA 4EMGA 4HA8A 3V8KA 4F7UA 3M4PA 5LJ5d 5C53B 4J15A 2PMEA 1I4K1 4M7AC 3MEYA 1MGQA 4WF2A 1YFRA 1EFWA 4C92A 3FIFA 2E5AA 4H2SA 3L4GA 2RD1A 4K86A 3A31A 4CS3A 5GANd 1SESA 2ZZGA 4WJ3M 2DJZA 5CAIA 4YYEA 4DPGA 4YRNA 4M7DF 2EL9A 4P3PA 3JCMX 1WQWA 4AH6A 1EIYB 3PCOA 3HSBA 4XEMA 4ZTZB 4JRKA 4WJ4A 3V7RA 3RKXA 1D3BA 5LJ5f 2DTIA 4M7AD 4L87A 1RIQA 1NYQA 4P71C 3JB9I 2ZT6A 1WLEA 3JB9G 3A32A 3V7SA 2ZR3A 4JUVA 4Q6GA 3IKLA 3JCMb 1G5HA 1GGMA 2DU5A 1EQRA 2Q7GA 4O2DA 4M77C 5GANf 1ASZA 2ZZEA 5GAOl 1B70A 4CH3A 2ZT7A 4TTVA 4M78F 5LJ3h 2DKGA 1B34A 4TWAA
chains in the Genus database with same CATH superfamily
4X5OA 2CJ9A 3P8VA 1SRLA 1WFWA 2ZPIB 1YFNA 4E2FB 3GNFB 2I2LA 3F70A 3PT9A 4J8OA 1JXOA 1TUGB 4BY6B 4C8QG 3JB9F 2LCLA 4A63B 2ALYB 2CREA 1PYSA 3QYGB 1Z7MA 2C0IA 2JN0A 3QDRB 2EFIA 3CCMQ 3PVQA 1QP2A 4JS5A 1UDLA 1K1ZA 1KQ2A 3RACA 4XU2A 1WHJA 3MEAA 4KGZB 4FL6A 1UFFA 4QKUA 5GAN5 3UGQA 4YDQA 3M4QA 2RHUA 3JCMh 1OU9A 4XAXB 1SERA 3PVLA 2V8KA 2E64A 2LNHB 1YFTA 2GFAA 4BD3A 4C0DC 3EAEA 3M5AA 1E1TA 4OB3B 4N0AA 2CT4A 1X6OA 3ICAA 2CSQA 4M77B 3IQLA 1N8RC 3WVEB 1VQ9Q 1WU7A 4XK8E 4C8QF 1QMCA 2E10A 1U1TA 1M2VB 2I0NA 4IUUA 4BI3A 2DIQA 4A54A 3HXVA 4E7JA 2HEQA 4KGXB 4XTVA 3EHQA 1Y71A 4P74C 4C5EA 3DB4A 2FYKA 4BDZA 2A0FB 5GMKl 4P5NA 2LDMA 2HBPA 3VU3C 2GTJA 1K73C 4C8QD 1D0ZA 2DBKA 2RHXA 4HXJA 4J9CA 2P0LA 2KMTA 3EG9B 2A7YA 2X9HA 4ZIBA 4A4HA 2J6OA 2I4LA 3X25B 2X3XD 2LZ6B 4HT8A 4KQEA 5KCHA 3QO7A 5CKBA 3EHRA 1W70A 2EGCA 4C92E 4JJBA 3FJPA 5EG2A 4R0KA 4BY6C 3J7AF 2K2VA 2VXEA 1SPKA 12ASA 3REXA 2OTLT 1OQKA 3TEEA 1YJ9A 1KQ1A 4YRGA 4IKFA 2E41A 4OMFB 1R0CB 3ER0A 1WJQA 4C92G 1YI2T 3CMET 1J5WA 1JJCA 1LNXA 4LXCA 3M58A 1VQ5A 4FT4A 1VIEA 4J6YA 1K0XA 6AT1B 4E7LA 1RAEB 4EMKC 2LJ1A 4MMLA 4J9HA 2J3MA 3M4YA 4Q15A 2DXUA 2Q7EA 2RHQA 3HTZA 1SSHA 1UGSB 3CEYA 1UEBA 3CCRA 1UG1A 4B9WA 1ZSGA 1DJ7B 2RJFA 1ZSZA 5FU6B 2EGAA 1JB0E 2XU8A 2LP5A 3E2UA 1K9MC 3LSSA 4HWOA 4C92F 1OZ3A 4TVAB 2EYQA 2PVGB 1QWEA 3REBB 2CP7A 5D6YA 3E9HA 1EX4A 2X4WA 4H2YA 5ELOA 2ZPGB 2WSFE 1QKWA 2LMJA 4FYWB 4LD9K 2F69A 1OX8A 1EIYA 3NFCA 4XTUA 4YRLA 1GCQC 1NZ9A 1ADJA 2DMOA 1KC8C 2EKHA 3OBWA 2D1XA 2AKKA 3NENA 2YT6A 2EYZA 1JEGA 2BZ8A 4RQEA 1TUDA 1QLYA 4Z8AA 4ME7A 1GFDA 4X9DA 1YNZA 4JJCA 2FZCB 4HVVA 4M78B 3MF2A 4ATOA 2KQWA 1D09B 1S72Q 1WYDA 4UPAA 3CBMA 3H41A 1L0WA 5LJ5j 1Y96A 3WQZA 4M7AA 2EQJA 3OS2A 4V2SA 3L2RA 5GMKh 4HVCA 2IY5B 1Q81C 1N9RA 4UP9A 2L0AA 3R6NA 3CCLQ 3CQTA 3OB9A 4M7DE 3SHWA 2CJAA 2KNBB 3A7AA 1H92A 2ARUA 2F2WA 3DSQA 3QO5A 5KYNA 5FU6C 2ODRD 2LC4A 2OTLA 4RTYA 5ECAA 3D7SB 3OS1A 3SWNA 1MHNA 4M4ZA 4OP0A 1AWWA 2P4TA 1YJNT 3OYLA 3CMEA 4FSSA 4N0AC 4KR3A 5GAMh 1FYNA 1YWPA 1OULA 2B86A 2DJQA 3JCMc 1H4TA 2RM4A 1B70B 1TWBA 5C6SA 4XU3A 4H2XB 3LWIA 2DQ0A 2LCSA 2HQXA 3QKJA 2RK2A 2DX1A 3TEHA 2PQWA 3UPUA 2DAQA 2RMOA 2E4HA 2QHUA 2MYSA 3LH0A 2K57A 1YJWA 2K5FA 3G71T 2J05A 3UATA 1IXDA 1WHMA 2QTVA 1NPPA 2VASA 2L8DA 2JXBA 1H4VB 1NEBA 3HXXA 4X34A 2RHSA 1IREB 4DA4A 1VQNT 4E7SA 1TH7A 1WYXA 4PFZA 3OYKA 2LT1A 2QGGA 2XI9A 3G6EQ 1R8OB 3C12A 4J9FA 1VQ6T 4II1A 1AEYA 3VYHB 3O5ZA 1VQ8T 3W3SA 3MKDA 1HK9A 5A0GA 4F17A 2LT4A 4Y92A 2C0OA 1WA7A 4ZGJB 2ZTGA 2DL8A 3KFVA 1OU8A 4Z88A 1N8RR 4FYVB 1C6VX 4QT7A 3LGFA 4QVDA 5GAN7 2FL7A 4C0ZA 1B7YA 1ARKA 3CCET 1QVFP 4J7IA 2DD5A 4H02A 1TTHB 3PZCA 4NOYA 2RO0A 4JPBW 5J26A 1B3QA 4YRQA 1K73R 2NUTB 2DPPB 3ZEHA 1PCXA 2RJCA 1UGVA 2BE9B 2AMCB 1XNIA 1NJIU 1VOMA 5GAN2 5EC7A 4C92B 1UGQB 2AKLA 3QPHA 3HXWA 3L4GB 1UJ0A 2E3IA 5KYWB 4C0GA 1ZLMA 1WIEA 3AHUA 2PVDB 2K2MA 3EFOB 4C5HA 1EFNA 1YJNA 2KRNA 1RAHB 3M53A 4XTYA 4BACA 2DQ3A 1BU1A 5GANe 3P8YA 3PCOB 3DLLA 5C51B 5CQYA 1X2HA 2EJGA 1BB9A 1G5VA 1ATIA 2HNIA 4YRRA 2CJBA 1PWTA 4D8KA 1YITT 5HGQA 1Q7YC 2R5AA 2AK5A 3CCQT 3I55T 1LJOA 5E3IA 2G6FX 4KBMB 1NLOC 3QWYA 2R57A 2K5IA 2MWOA 3KXTA 1M90U 2LQKA 5C53B 1M3BA 2PMEA 2CZ1B 4E6RA 4M7AC 3G71A 1QVFA 1MGQA 1EFWA 3EGDB 4JJDA 3E9FA 4Q5WA 4H2SA 1VQNA 1PHTA 2RD1A 3A31A 4CS3A 2FO0A 2DFUA 5GANd 2KYMA 4RMOA 4WJ3M 3H9NA 3GPLA 4YYEA 1OEBA 2JMCA 2OAWA 3FLGA 2EL9A 4PLIA 3ME9A 3VRYA 4CC4B 1VQ6A 4AH6A 5AT1B 1IB8A 3NHNA 1VQ8A 2PTKA 4LVLA 3S6WA 3X20B 3RKXA 1D3BA 2A8EA 1KC8R 3JB9I 2HKQB 4KUDK 2HQEA 2JTMA 3V7SA 1BKBA 2GBQA 2RHYA 3CC7Q 3CCEA 5GANf 4RTXA 2ZZEA 4TTVA 3OYDA 2DKGA 2CZ0B 4OVAA 1K76A 5J3BA 2YRDA 1S72T 2JM9A 2RJDA 3E9IA 3TVTA 1LVKA 4B9XA 1Q82U 4YPFA 2VGMA 3E9GA 1RLQC 1QCNA 1KOGA 1AHJB 4M7DB 2XD0A 4FCYA 1ZA2B 4EPCA 1Q81R 2Q5HA 3VKIA 4M77D 1EVLA 1YCYA 1ACMB 1X6GA 3CMAQ 5C52B 4BW9A 3EFRA 3INZA 1B7TA 4LVIA 3CD6A 2VWFA 2CP3A 4CRIA 1IGUA 4YRKA 1I07A 5FRNA 1K8AR 1SHGA 2KY9A 3H0HA 2F2VA 2GQVA 2QDLA 4LDUA 2DM1A 4Z02A 5HKCA 3R07A 2DETA 3OYMA 1TXQA 2L3RA 2LX9A 1M8MA 4C0FA 1YITA 1G2BA 1N5ZA 2DRKA 3CCQA 3I55A 3L1AA 3REUA 2J6FA 1ABOA 3QJ6A 5CCAA 4A4GA 1V76A 3NTIA 4FW2A 1WNLA 5CR2A 2ESWA 2BTTA 3HY0A 4EO4A 5KE2A 4FM4B 3PGGA 4DBRA 2AKWB 1QP3A 1JRIA 1RLPC 2ARSA 1BI1A 1HC7A 3QUIA 3VUBA 2DZ9A 1EOVA 2KRSA 1JJ2P 3QWXX 1WHLA 3PFSA 1YHQT 5LJ5g 4ELYC 2GQIA 2ROLA 3ASKA 3QHSA 4PJOA 4F7UE 2BZXA 1GBRA 4K11A 4LNPA 4YROA 2E1HA 1MMAA 3JCMP 2KEAA 4M75A 4CC3A 4M7DC 2P0PA 3RERA 3IALA 4M78G 4M77A 2YUNA 2HZYA 3OW2S 1JXMA 2GGRA 1XJWB 2NWMA 3BDUA 4F7UG 3HHTB 5KYUB 1D1BA 3DKMA 2QA4T 3TUPA 1N27A 2OI3A 4X9CA 2DZCA 3L2UA 1IO6A 2O88A 2O4XA 2OTJT 1CKAA 4D6WA 3HY1A 4P75A 3E19A 4O5VA 3EG9A 2V26A 2X4YA 4D8DA 2LQNA 2ZGWA 4PJNA 1VQOT 1YIJQ 4AFSC 1G51A 2EQMA 4G85A 2XGTA 2DL4A 2JTFA 1ZUYA 3ERRA 4FT2A 3CCVQ 2QYZA 4F7UF 4P73C 2AZSA 1I0CA 2PVOB 2BE7D 1PNJA 4QQ6A 2QGFB 5GMKm 1X54A 5GAMd 1TUCA 2ABLA 3C94A 1FMVA 2LJ3A 4MZPA 2ZNIA 1JJ2A 2AIRB 4M78D 3CC4T 2ZNJA 1NJ6A 5KYXB 3LYIA 1I8FA 1QCOA 2CP6A 4FIBA 2MIOA 3MP6A 4BE2A 2KI7A 3MJXA 1M3CA 3QZ5B 5IXBA 3JSCA 2JM8A 2PUKB 1GRIA 1QF6A 4QVCA 1E6GA 4UC4A 1VIFA 3RUXA 3L42A 4HWTA 1MMGA 2ZT8A 3JB9D 3M57A 2BIVA 1TU0B 1Q7YR 3A8MB 3M0UA 1E22A 4EMKB 1WHKA 3RESA 1BCMA 3PE0A 3VUZA 3BJUA 2Z0WA 2XMFA 3OMCA 3ZFJA 1VQMQ 1BI0A 2E3CA 5HCKA 1YP5A 1PD1A 2VGNA 3G4SQ 4OMQA 4P72C 1YHQA 2L3PA 4M7AE 1USYC 4CS2A 2SEMA 2ZIOA 1RUWA 2KVQG 3S3MA 3RF1A 3N5BB 1ZHIA 5GANj 1VQZA 1GBQA 3OYHA 1O9SA 2CT3A 2CDTA 2JZ2A 3CXCP 3VV0A 3PIOA 4DOVA 4YRJA 2QASA 1OOTA 3A8OB 1T3SA 1WQ7A 4DBHA 2DRMA 4J5YA 1NNHA 4E7KA 1XTDA 3FDRA 3GF5A 1IGQA 1KD1U 1VQLQ 4P71A 1WJSA 3GP8A 1WXBA 2EQIA 2JTEA 2QA4A 5IN1A 4YRTA 3HP9A 1ZBXA 1T3LA 1WXTA 1FX7A 4PNOA 1KQSP 5F5WA 4E47A 1OZ2A 1VQ4Q 2ED1A 3QTCA 4LDWA 1PD0A 2OTJA 1RAIB 2E12A 1B34B 1G3TA 1OI1A 3QNEA 3TEGA 2EAYA 3I56T 4YRCA 1X69A 1Q86U 4TQFA 1AWJA 1VQOA 2IY5A 4M7AF 1AWOA 2K3YA 4R56A 2XDDA 1Y7XA 1ZUKA 3OSSC 5I2MA 4CS4A 2EW3A 3P8BB 1PYSB 1M1FA 2RQWA 2DF6A 3OD1A 2KGTA 1B76A 4LVJA 2QQSA 4PJOC 1OPLA 4QW2A 4F04B 3M9QA 3CC4A 2RQRA 4L6V5 4DQ2A 3CCJQ 3OMGA 3A5YA 1LOJA 4M75C 1EVKA 4KR2A 3CC2T 1AVZC 1KHCA 1V1CA 3BW1A 1GCPA 1UHCA 1P92A 3CXCA 1VQPT 4TQDA 4C8QA 2CYZB 5FU7C 3PIPA 1BIAA 2X4JA 2RNAA 1UECA 2COWA 4DBFA 2X51A 1HYOA 1YWOA 2A36A 2RB6A 2O9VA 2QEXT 5CKDA 4KH0B 4PFOA 4F16A 4C92D 5HK3A 1X75C 1OV3A 5IT9E 4FSXA 1ZBJA 2DTHA 2XIDA 4IUVA 1KQSA 2C06A 2P84A 2J3LA 1IRXA 1I1JA 3VS7A 1ZX6A 5DLQE 2GCXA 2RPNA 2VXFA 4A4KA 2IVWA 3CCSQ 4JRQA 4A4FA 4F7UB 5GAOp 1U3OA 2K9GA 2KK4A 1M9SA 5LJ5h 3OYBA 1VQKT 4NCXA 5KYYA 5CK9A 3H0IA 1KHIA 2LJ0A 4EDUA 4BI4A 1G3SA 4GY5A 2AT1B 2VKNA 1S1NA 5GAN4 2Q5IA 3T9NA 1K8AC 1M4ZA 1K9MU 1X27A 1VA7A 2W0ZA 2DL7A 3VBBA 3H8ZA 2QQAA 4M7DG 2GNCA 3I56A 2DVJA 1YI2A 2FB7A 4YCWA 5IHKA 3QO8A 1C0AA 5GJVB 1VQ7T 2DL5A 3EG3A 1D0XA 2RHQB 2NUTA 4EMGA 2KYBA 3LLRA 2PUOB 4ZN1A 2DERA 2B8AA 1G8XA 4BI8B 1YIJT 3DLMA 2NUPA 1I4K1 3I9QA 3PTAA 3M0TA 4WF2A 1RACB 4C92A 3FIFA 2O01E 3L4GA 4EIKA 4CC2A 2WSCE 3MO8A 3RNJA 1NLPC 2DJZA 2L3SA 4PKCC 2CP0A 2BZYA 3MP8A 4L5GA 4YRNA 3X24B 4M7DF 5LL6S 3CC2A 1SKUB 2K3XA 4HCCA 4FYYB 3JCMX 2LQWA 2M51A 2J7IA 1EIYB 3PCOA 3HSBA 2IG0A 1VQPA 3CCMT 3O8VA 3V7RA 2A28A 4P71C 2ZT6A 2DK3A 3A32A 1YN8A 3RBBB 2HDAA 2ZR3A 2CSIA 2NYSA 2QEXA 4Q6GA 2V1RA 4ZGDB 1G5HA 1GGMA 2DU5A 1Q95G 2RN8A 3NPFA 4CH3A 3MEWA 1T0JA 4DOWA 2DA9A 1VQ9T 2XKOC 1X43A 4A53A 4AG1C 4P3OA 1Y96B 4XU1A 4M7AB 3UDCA 2ZR2A 2EKOA 2Y90A 1W1FA 4HCKA 4E51A 1UGPB 3TSZA 5LJ3e 1TSFA 4YCUA 4HWSA 3A1PA 1VQKA 1NM7A 3JAME 3I5SA 1E6HA 4JLIA 4JZ4A 4YCVA 4HWRA 1PSFA 4H2WA 2EQKA 1H3ZA 1PM3A 3EG1A 1ZSZC 2QAZA 1N9SA 2R5MA 3C4SA 4AFQC 4JLGA 3TSWA 1E24A 1YBYA 2COZA 3V8LA 1YJ9Q 4OMMA 3SWNB 1KSWA 4HCZA 2O9SA 2YRCA 2RI5A 4ANJA 1W2BS 3A74A 5CKFA 1D1AA 4LVMA 4AMCA 2ZPHB 4C8QC 1M30A 5LJ3g 2RA2A 1SRYA 3VS4A 5LJ3d 1VQ5Q 4PL6A 1VQ4T 3JCMe 4KULA 4WCIA 3JCMV 2F5KA 4LNSA 1VQ7A 4LDVA 2L5QA 2HBWA 1Y07A 3CBOA 2O2OA 2EYXA 3HXUA 2M9UA 1JJ2S 2I4OA 1IZ6A 2PZ1A 3CCRQ 1YIJA 3JRZA 3M56A 1ABQA 5CO7A 2KT8A 1BI2A 1RAGB 1UTIA 2DXBA 4QQGA 1EIFA 2C0TA 2RI2A 2DD4A 1QVGP 1M27C 5LJ3f 1VYUA 4DBQA 4PJOE 3JCMd 3H0FA 2MOXA 5A2QE 2YHTA 4K88A 4NL3A 5GANg 1K0SA 3NGPA 3CCMA 1G5IA 1C0MA 3NMZC 4E7HA 4M75E 2DTOA 2KE9A 2VC8A 3MEUA 4IIOA 1Q82C 3L2WA 1W66A 2YSQA 1YFSA 4M77E 3VYGA 3RKWA 3HFVA 3DB3A 3UFGA 3V8JA 3G1JA 5FWCA 3J80E 2YUQA 4BDYA 3ZL7C 2KR3A 5A0LA 1QQJA 3L2QA 2L89A 4LUDA 4XQ3A 5I21A 3SWNC 2V1QA 3HFOA 2M02A 2EJFA 1VQ9A 3HFZB 3S3NA 1M2OA 2WSEE 3JCMf 1SHFA 2VB6A 3SD4A 2CUBA 2DU7A 2JOYA 1Y0MA 1V29B 1AZEA 3CBPA 2E5KA 5C0MA 5L23A 1X56A 3E1SA 4RMFA 3VQWA 3OYGA 2F5TX 3M54A 3CCST 2QQRA 3HXYA 4OMPA 3MF1A 4EMHA 1PC0A 3QBYA 4PJOF 2RQVA 4E7IA 3MEVA 4IUTA 5DM7R 3A7RA 1CSKA 2P4RA 1WJRA 2E6ZA 4GLKA 4M75F 4OB2B 4HVWA 2OTLQ 1MNEA 4LE9A 1QVGA 3QJYA 3RDVA 5K1XA 4PK4A 1NYGA 1X55A 3CCLT 2MAMA 4FW1A 1YB3A 2J6KA 1SF9A 3CMEQ 2XDBA 4B6MA 1FMKA 1A0NB 2CIMA 2XK0A 1JU5C 5DY9A 5IHNA 5GAOq 1MMDA 3HTRA 3JB9H 1C1AA 4P74A 1T0HA 2CZ6B 1H4SA 2ROTA 3A5ZB 3MCAB 2FRYA 4QVZA 1G3YA 2DXTA 1HJDA 4H2UA 1U1SA 2J06A 2O31A 1MNDA 2DNUA 4HT4A 3PMIA 3M59A 3VJPA 5GAN8 3UH0A 4RKUE 3OYCA 2YLCA 3VS6A 3UGTA 1PKSA 1JO8A 3M4GA 1VYTA 5ELNA 2SRCA 3P8HA 1N6AA 3TCJA 3HRSA 1YJWQ 3GIBA 2ODRC 3OYYA 4OB0B 4A4EA 3REAB 2QQBA 1BCOA 4YRPA 1BI3A 2FVUA 4LDYA 4JRPA 3EH1A 1GL5A 1UB4A 1XOVA 4KT0E 4LVKA 2ALYA 3A8HB 5KYXA 3HPWA 1JBMA 2MPXC 5GMKe 1WHHA 1X2QA 1QW1A 3M0RA 1KQSS 5I22A 4HCBA 1SSFA 4MZMA 3PMTA 1MMNA 1EZZB 2EBPA 3RMSA 4AG2C 5KCOA 2OAUA 3SB2A 4N4HA 3G6ET 4BB7A 4DEXA 1WXUA 2EYYA 4MMKA 4RDXA 1AT1B 1NJIR 4RTZA 1CKBA 3CCUQ 2FPDA 3C0CA 2Y4XA 1M2VA 4PJLA 4RQFA 1JQQA 2P0QA 3U23A 5GAMe 2DLPA 3FJ5A 4ESRA 1IHVA 2A37A 2K79A 1NJ1A 1M1KU 3IG2A 1S72A 2G4CA 2HSPA 1HTTA 2A08A 4AFZC 2HQHA 1HD3A 1RAAB 1NJ5A 4YTLA 2Q7HA 1MV3A 2ZINA 2LCCA 1GCQA 4BWAA 1X2KA 1AD5A 1H641 1AZGB 4KGVB 3SDZA 3CCLA 5D7UA 2AHJB 2FEIA 1YJNQ 2YDLA 3NELA 3HFNA 5GAMg 1PKTA 1BBZA 1M90R 1ADYA 1OYXA 2LX7A 1U8RA 1B8AA 1X2GA 1RABB 3EGXB 4C8QE 2EWNA 2DILA 4JS4A 5LJ3j 2XICA 1RADB 4HKEA 1PRLC 1FYFA 3META 5HK0A 1AWXA 2L2PA 1QVPA 2ZT5A 1MUZA 1UUEA 2E3HA 2YLBA 2ECZA 2D0QB 1KMNA 3OYFA 2RHIA 1KD1C 2FPFA 2QQ9A 3CCRT 1G3WA 3G71Q 1SRMA 2KSSA 3MP1A 4JJNK 1KFZA 4IUPA 4RG2A 5GAMf 1VQNQ 4E7ZA 1BBUA 4NS5A 3RL6A 1QKXA 2BKDN 4OB1B 4ZTUB 2QG9B 4YRSA 1LYLA 4OGEA 5CKHA 4PJOB 1ZQ1A 2ZPEB 2EYWA 5FW9A 2X4XA 2IIMA 2K7AA 4R55A 4FYXB 1VQ6Q 4J6WA 1J3TA 4TVAA 1Q86C 2HL5C 1VQ8Q 4M75B 5GANh 4C5GA 1XQHA 4PFPA 1I5LA 2PMFA 1D0YA 5GAOr 1Q82R 3CMQA 3G6EA 3CPWP 5FU7B 3HXZA 5KNNA 2CGHA 2ZZFA 2RH2A 5GJWB 4NL2A 2Y4YA 3NTKA 3CCEQ 2RQUA 4M7AG 4H2TA 2HMAA 5I11A 2HKNA 4RCCA 1M8VA 1U5SA 2CUDA 2FG0A 5FWBA 2O4XB 2H3EB 2M0YA 2JJ9A 2V8JA 3GLXA 4M78A 4OMNA 2YWWA 3CC7T 2KDSA 4HA8A 3UWNA 2NUZA 4F7UA 3C95A 3QZ9B 5CIUA 4CC7A 2RJEA 4J15A 2DE0X 1ZA1B 4OMLA 1WHGA 4AFUC 3MEYA 2LNVA 2RI3A 1KG1A 1NBEB 3CD6Q 1K9AA 4IURA 3OS0A 2DBMA 3A8LB 4Z89A 1N8RU 1UE9A 4LUEA 3X26B 2HAXA 2HL3A 2JS0A 4DEYA 2E5QA 2MF2A 1Z9ZA 3CMAT 2JVVA 3A8GB 4XEMA 1FWZA 4ZTZB 1YITQ 3OW2P 2L3QA 4M7AD 3CCQQ 3I55Q 2D6FA 1G83A 4AT1B 3M0QA 2ED0A 1WX6A 1K73U 1R0BG 4VUBA 1FXXA 3VRZA 3IKLA 3JCMb 2R58A 1EQRA 4M77C 4C5IA 4BE1A 2K5LA 4ZTJA 3TU4K 3CPWA 1B70A 2ZT7A 5CKEA 1QVFS 3HKSA 4H2XA 3OYNA 3MHXA 1M5Q1 1YJWT 4J9IA 2FZKB 2RHZA 5KH6A 3FRNA 4HT9A 3LWHA 2BUDA 2ZAEA 4YP0A 2LRQA 1NJ2A 4PHCA 1BIBA 1X01A 4P75C 2JW4A 3LX7A 1UGRB 3EH2A 4PJJA 3NTHA 3P8DA 2WACA 2JS2A 2MMPA 3UT1A 1M1KR 1KMMA 2D8HA 1NYFA 3OBYA 3GOXA 2DYBA 3URGA 3J81E 2NS6A 2PNIA 2OX7A 1UJYA 2OJ2A 1KJWA 2ZCFB 4WI1A 1NE8A 3QO3A 1N9WA 2ENMA 3OYEA 4RCBA 1PG5B 4BE0A 4J9DA 3M0PA 2ZPBB 4RG8A 1W4SA 2JNGA 1WDXA 2QTXA 1KK7A 3OYIA 3CCUT 3OW2A 2QXFA 3CC7A 4H2VA 5GAN3 3EFSA 2E6NA 1JJCB 2GF7A 1W6XA 1QVGS 5GMKj 4FU6A 4QQDA 1IL2A 2RF0A 1KIKA 2EIFA 3BDLA 3HRUA 3X28B 4MZTA 1KC8U 2QHTA 2HSEB 2LVMA 4GBQA 2YRVA 3MPUB 4L59A 2COYA 4EX5A 2K4YA 2D9TA 4JRIA 2AMCA 4RTUA 3RR6A 2YXYA 1ZSZB 2F1LA 3CCVT 2HCKA 3EG0A 4J7FA 3CMAA 2K6DA 4O6JA 2FRWA 5KYWA 3JCMQ 2E65A 2GTOA 5GAMj 3VQVA 3EFOA 4C8QB 4J83A 4KH1B 3Q1JA 3I35A 3I7FA 2VV5A 2DL3A 3THKA 4OMOA 1Q81U 3QXEB 3OY9A 2P5IA 5M9OA 2KXDA 1H8KA 2CS7A 3LSQA 1NJIC 4M7DD 3UA7A 5D6WA 3OA6A 3P8TA 4WTOB 4M78C 1YHQQ 3LW5E 1KD1R 4MDXA 3ZBDA 1K8AU 1VYVA 1SG5A 4PLLA 2EPDA 4TVRA 2DXCA 3VQYA 1VQMT 2I4NA 1I81A 3EGDA 3G4ST 1BYMA 5KYYB 2QDYB 3LH5A 2ARTA 2FHDA 3AT1B 3HRTA 3ULRB 1Q86R 1HXDA 1H3HA 2D8JA 5HY6A 1K4US 4LD6A 2QA4Q 1Y57A 4TVYA 5GMKi 2DVEA 3SFMA 3JCMJ 4J9BA 1YCSB 4X1VA 1NJ8A 2KBTA 3S3OA 4OLFA 4RTWA 2QHVA 4XEOA 2QK0A 3VS1A 1M90C 1NYRA 3HFZA 2OTJQ 3CCUA 2MI6A 2LTOA 5KE3A 2DDZA 3GNGA 2A3LA 3OQ5A 1VQLT 2D0NA 2KXCA 4GLMA 1NEGA 4ELZC 1VQOQ 2DEUA 1H4QA 2KT1A 5I2SA 1YGBA 1AOJA 4N4GA 1E1OA 3HL8A 3KUFA 2NUPB 11ASA 4LN2A 2JUFA 4RTVA 3OYAA 2ZIMA 2MWPA 1TG0A 1LPLA 1RAFB 5K1PA 1M1GA 1PRMC 3TEHB 3RGLA 1Z7NA 2CZ7B 5GAN6 3CD6T 3BY7A 3EG2A 4M7DA 3CC4Q 5FRMA 4XTWA 3CCVA 5CVIA 4YRMA 3R6OA 1SETA 4ZGEB 4YRFA 5DLOA 3M55A 3NETA 2KAFA 2RHSB 1TOVA 3JCMg 4BUGA 3RIRA 4XTXA 2C8MA 3G7ZA 3A5ZA 3CCJT 2XTIA 4N4IA 3UF4A 2DIGA 1SEMA 4HWPA 4XTZA 2XDPA 2W10A 2I4MA 4PJOG 4XU0A 4F14A 2M16A 4Y28E 1R77A 1ZUUA 1QE0A 4P73A 1WLPB 1RL2A 3QYHB 3QSUA 1B7YB 4M75G 9ATCB 3JB9J 2RQTA 4J9EA 4Y91A 4JDSA 1OPKA 2AKWA 3VS2A 1VQMA 4MDWA 1K9MR 1BBWA 1HSQA 4M77G 1IHWA 4J9GA 3G4SA 4JZ3A 3MQZA 2MCNA 8ATCB 4K87A 4OGCA 3TQ7P 2M1HA 3BFMA 1WZOA 2KROA 1NPRA 2H8HA 2P0KA 1NG2A 3PNWC 1Q7YU 2X35A 2V8IA 4C92C 3I5RA 3SEMA 2E70A 2CH4W 4TVWA 2DEQA 4OF1A 5IHIA 3VS3A 3JV3A 2NLUA 4YREA 2C7IA 4HVUA 2K3BA 3A98A 1WPYA 4LDXA 1PSEA 3A7UA 2XG8D 2YUPA 3GBQA 4ZN3A 3VS0A 8AT1B 1ASYA 3UA6A 5IAYA 4M77F 3V7CA 1VQLA 3I56Q 5KYUA 1YI2Q 4PJOD 2EQUA 3FB9A 5FROA 1X6BA 2GFUA 2CP5A 1VQ4A 4P72A 1UHFA 4CH6A 3EGUA 1USYA 4M75D 2VYTA 5L8RE 4UP7A 5CQXA 3LC0A 2RK1A 3TREA 1F1BB 2EVRA 1D1CA 2JT4A 2DO3A 4J6XA 3L2VA 1GFCA 2FPEA 3JCMW 1QCFA 3CC2Q 1WGSA 2ZPFB 4CH4A 3QG1A 3NEMA 3RMQA 5GAOn 2FZGB 3L2ZA 3LGLA 3CXCS 1TS9A 1Z9QA 5IH2A 3CPWS 1VQPQ 3QIIA 1WI7A 5LJ5e 3BE3A 3EGXA 1M1KC 3OSVA 3HRIA 2MK5A 2KRMA 3CCJA 3OYJA 2EJ9A 1BK2A 3IKMB 4CI0C 1W2BP 4CH5A 2LQ8A 1O75A 1OX9A 2QEXQ 4IIMA 4G84A 2XHCA 2X3WD 5FLXE 2ZXFA 2QHSA 2ZCEA 3VQXA 3G1ZA 4P3NA 1D3BB 2M0OA 4IUQA 2HD0A 3HRKA 4YRIA 1LCKA 3RKYA 3WXMB 2ATCB 2F2XA 1MV0B 3CPFA 3QDFA 1VUBA 4UP8A 4EMKA 5GAOm 3FC3A 5AYFA 2QI2A 1M3AA 4PG3A 4M78E 3KFUA 2VVKA 3V8KA 3M4PA 5LJ5d 2G3RA 1VQKQ 2CP2A 1FMWA 3KBGA 1YFRA 3M0SA 3VS5A 3OS5A 2E5AA 2YUOA 4K86A 4KUIA 1SESA 3CCSA 1QWFA 2ZZGA 1RI9A 5CAIA 4RTTA 4DPGA 3WVDB 4C0DB 5IXFA 5A0DA 3H6ZA 5J39A 2EGEA 4P3PA 1WQWA 1RI0A 2DYIA 4PJMA 1U06A 4JRKA 4WJ4A 5D6XA 5LJ5f 2DTIA 4L87A 1RIQA 1NYQA 1WLEA 2CH4A 2JMAA 3JB9G 2ZZDA 4ZTFA 2CKKA 2IPOB 1YJ9T 1VQ7Q 4JUVA 2Q7GA 4O2DA 4RUGA 2H3JA 3FEOA 1ASZA 7AT1B 1W2BA 2PU9B 5GAOl 2VUBA 4KRTA 1GXIE 1I5OB 1B07A 4ZNXA 2AZVA 4M78F 5LJ3h 1B34A 1E7OA 4TWAA 1VQ5T 4ORZA
chains in the Genus database with same CATH topology
4X5OA 2CJ9A 3P8VA 2ZPIB 3GNFB 2I2LA 3F70A 3PT9A 4J8OA 4BY6B 4C8QG 3JB9F 2LCLA 2ALYB 1PYSA 3QYGB 1Z7MA 2JN0A 3QDRB 2EFIA 1QP2A 4JS5A 1KQ2A 3RACA 4XU2A 3MEAA 4FL6A 5GAN5 3UGQA 4YDQA 3M4QA 2RHUA 3JCMh 4XAXB 1SERA 2V8KA 2E64A 1YFTA 2GFAA 4BD3A 4C0DC 3EAEA 3M5AA 1E1TA 4OB3B 4N0AA 1X6OA 3ICAA 4M77B 1N8RC 3WVEB 1WU7A 4XK8E 4C8QF 2E10A 1U1TA 4IUUA 4BI3A 2DIQA 4A54A 3HXVA 4E7JA 4XTVA 1Y71A 4P74C 4C5EA 3DB4A 2FYKA 4BDZA 5GMKl 4P5NA 2LDMA 2HBPA 3VU3C 1K73C 4C8QD 2RHXA 2P0LA 2KMTA 2A7YA 4ZIBA 4A4HA 2I4LA 3X25B 4HT8A 4KQEA 5KCHA 3QO7A 5CKBA 4C92E 3FJPA 5EG2A 4BY6C 3J7AF 2K2VA 2VXEA 12ASA 3REXA 2OTLT 3TEEA 1YJ9A 1KQ1A 4YRGA 4IKFA 2E41A 4OMFB 3ER0A 1WJQA 4C92G 1YI2T 3CMET 1J5WA 1JJCA 1LNXA 3M58A 1VQ5A 4FT4A 1VIEA 4J6YA 4E7LA 4EMKC 4MMLA 2J3MA 3M4YA 4Q15A 2DXUA 2Q7EA 2RHQA 3HTZA 1UGSB 3CEYA 1UEBA 3CCRA 4B9WA 1DJ7B 2RJFA 5FU6B 1JB0E 2XU8A 1K9MC 3LSSA 4HWOA 4C92F 1OZ3A 4TVAB 2EYQA 2PVGB 5D6YA 3E9HA 2X4WA 4H2YA 5ELOA 2ZPGB 2WSFE 4LD9K 2F69A 1EIYA 3NFCA 4XTUA 4YRLA 1NZ9A 1ADJA 1KC8C 3OBWA 3NENA 4RQEA 4ME7A 4X9DA 4M78B 3MF2A 4ATOA 2KQWA 1WYDA 4UPAA 3CBMA 1L0WA 5LJ5j 1Y96A 3WQZA 4M7AA 2EQJA 3OS2A 4V2SA 3L2RA 5GMKh 4HVCA 2IY5B 1Q81C 1N9RA 4UP9A 3OB9A 4M7DE 2CJAA 3A7AA 2ARUA 3DSQA 3QO5A 5FU6C 2ODRD 2LC4A 2OTLA 3OS1A 3SWNA 1MHNA 4OP0A 2P4TA 1YJNT 3OYLA 3CMEA 4N0AC 4KR3A 5GAMh 3JCMc 1H4TA 2RM4A 1B70B 5C6SA 4XU3A 4H2XB 3LWIA 2DQ0A 2HQXA 3QKJA 2RK2A 3TEHA 2PQWA 3UPUA 2DAQA 2QHUA 3LH0A 2K57A 1YJWA 2K5FA 3G71T 1NPPA 3HXXA 2L8DA 1H4VB 4X34A 2RHSA 1IREB 4DA4A 1VQNT 1TH7A 3OYKA 2LT1A 2XI9A 1R8OB 3C12A 1VQ6T 4II1A 3VYHB 1VQ8T 3W3SA 1HK9A 5A0GA 2LT4A 4ZGJB 2ZTGA 3LGFA 4QVDA 5GAN7 2FL7A 4C0ZA 1B7YA 3CCET 4J7IA 2DD5A 4H02A 3PZCA 4NOYA 2RO0A 5J26A 4YRQA 2DPPB 3ZEHA 2RJCA 2AMCB 1XNIA 1NJIU 5GAN2 4C92B 1UGQB 3QPHA 3HXWA 3L4GB 4C0GA 3AHUA 2PVDB 4C5HA 1YJNA 3M53A 4XTYA 4BACA 2DQ3A 5GANe 3P8YA 3PCOB 3DLLA 5C51B 5CQYA 1X2HA 2EJGA 1G5VA 1ATIA 2HNIA 4YRRA 2CJBA 5HGQA 1YITT 1Q7YC 2R5AA 3CCQT 3I55T 1LJOA 5E3IA 4KBMB 2R57A 2K5IA 2MWOA 3KXTA 1M90U 2LQKA 5C53B 2PMEA 2CZ1B 4M7AC 3G71A 1QVFA 1MGQA 1EFWA 3E9FA 4Q5WA 4H2SA 1VQNA 2RD1A 3A31A 4CS3A 5GANd 4RMOA 4WJ3M 3GPLA 4YYEA 3FLGA 2EL9A 4PLIA 3ME9A 1VQ6A 4AH6A 1VQ8A 4LVLA 3S6WA 3X20B 3RKXA 1D3BA 2A8EA 3JB9I 4KUDK 2HQEA 2JTMA 3V7SA 1BKBA 2RHYA 3CCEA 5GANf 2ZZEA 4TTVA 3OYDA 2DKGA 2CZ0B 4OVAA 5J3BA 1S72T 2RJDA 3E9IA 4B9XA 1Q82U 4YPFA 2VGMA 3E9GA 1KOGA 1AHJB 4M7DB 2XD0A 4EPCA 2Q5HA 3VKIA 4M77D 1EVLA 1YCYA 5C52B 4BW9A 3EFRA 3INZA 4LVIA 3CD6A 4CRIA 4YRKA 5FRNA 2KY9A 2GQVA 4LDUA 4Z02A 5HKCA 3R07A 3OYMA 2L3RA 2LX9A 4C0FA 1YITA 3CCQA 3I55A 3L1AA 3REUA 3QJ6A 5CCAA 4A4GA 3NTIA 1WNLA 5CR2A 3HY0A 4EO4A 5KE2A 4FM4B 3PGGA 2AKWB 1QP3A 1JRIA 2ARSA 1BI1A 1HC7A 3QUIA 3VUBA 2DZ9A 1EOVA 3PFSA 1YHQT 5LJ5g 4ELYC 3ASKA 3QHSA 4PJOA 4F7UE 4YROA 2E1HA 3JCMP 4M75A 4M7DC 2P0PA 3RERA 3IALA 4M78G 4M77A 3OW2S 4F7UG 3BDUA 3HHTB 3DKMA 2QA4T 3TUPA 1N27A 4X9CA 2DZCA 3L2UA 2O4XA 2OTJT 4D6WA 3HY1A 4P75A 3E19A 4O5VA 2X4YA 2ZGWA 4G85A 1VQOT 1G51A 2EQMA 2XGTA 2JTFA 3ERRA 4FT2A 4F7UF 4P73C 2PVOB 4QQ6A 5GMKm 1X54A 5GAMd 3C94A 4MZPA 2ZNIA 1JJ2A 4M78D 3CC4T 2ZNJA 1NJ6A 3LYIA 1I8FA 4FIBA 3MP6A 4BE2A 3QZ5B 3JSCA 2PUKB 1QF6A 4QVCA 4UC4A 1VIFA 3RUXA 3L42A 4HWTA 2ZT8A 3JB9D 3M57A 2BIVA 3A8MB 1E22A 4EMKB 3RESA 3VUZA 3BJUA 3OMCA 3ZFJA 1BI0A 2E3CA 2VGNA 4P72C 1YHQA 4M7AE 1USYC 4CS2A 2ZIOA 2KVQG 3S3MA 3RF1A 3N5BB 1ZHIA 5GANj 1VQZA 3OYHA 1O9SA 2JZ2A 3VV0A 3PIOA 4DOVA 4YRJA 3A8OB 1WQ7A 4J5YA 1NNHA 4E7KA 1XTDA 3FDRA 3GF5A 1KD1U 4P71A 1WJSA 3GP8A 2QA4A 5IN1A 4YRTA 3HP9A 1ZBXA 1FX7A 4PNOA 5F5WA 4E47A 1OZ2A 3QTCA 4LDWA 2OTJA 2E12A 1B34B 1G3TA 1OI1A 3QNEA 3TEGA 2EAYA 3I56T 4YRCA 1Q86U 4TQFA 1VQOA 2IY5A 4M7AF 2K3YA 4R56A 2XDDA 1Y7XA 3OSSC 5I2MA 4CS4A 3P8BB 1PYSB 1M1FA 3OD1A 1B76A 4LVJA 2QQSA 4PJOC 4QW2A 3M9QA 3CC4A 4L6V5 4DQ2A 3OMGA 3A5YA 1LOJA 4M75C 1EVKA 4KR2A 3CC2T 1KHCA 3BW1A 1P92A 3CXCA 1VQPT 4TQDA 4C8QA 2CYZB 5FU7C 3PIPA 1BIAA 2X4JA 2RB6A 2QEXT 5CKDA 4C92D 5HK3A 1X75C 5IT9E 4FSXA 2DTHA 2XIDA 4IUVA 1KQSA 2C06A 2J3LA 5DLQE 2GCXA 2VXFA 4A4KA 2IVWA 4JRQA 4A4FA 4F7UB 5GAOp 2KK4A 1M9SA 5LJ5h 3OYBA 1VQKT 4NCXA 5CK9A 1KHIA 4EDUA 4BI4A 1G3SA 4GY5A 5GAN4 2Q5IA 3T9NA 1K8AC 1M4ZA 1K9MU 3VBBA 3H8ZA 2QQAA 4M7DG 3I56A 1YI2A 2FB7A 4YCWA 3QO8A 1C0AA 1VQ7T 2RHQB 4EMGA 4ZN1A 3LLRA 2PUOB 2B8AA 4BI8B 1YIJT 3DLMA 1I4K1 3PTAA 4WF2A 4C92A 3FIFA 2O01E 3L4GA 2WSCE 3MO8A 2DJZA 4PKCC 3MP8A 4L5GA 4YRNA 3X24B 4M7DF 5LL6S 3CC2A 2K3XA 4HCCA 3JCMX 1EIYB 3PCOA 3HSBA 2IG0A 1VQPA 3CCMT 3O8VA 3V7RA 4P71C 2ZT6A 2DK3A 3A32A 2ZR3A 2QEXA 4Q6GA 4ZGDB 1G5HA 1GGMA 2DU5A 4CH3A 3MEWA 4DOWA 1VQ9T 2XKOC 4A53A 4P3OA 1Y96B 4XU1A 4M7AB 3UDCA 2ZR2A 2EKOA 2Y90A 4E51A 1UGPB 5LJ3e 4YCUA 4HWSA 1VQKA 3JAME 4JLIA 4YCVA 4HWRA 1PSFA 4H2WA 2EQKA 1H3ZA 2R5MA 3C4SA 1N9SA 4JLGA 1E24A 1YBYA 3V8LA 3SWNB 4HCZA 2RI5A 1W2BS 3A74A 5CKFA 4LVMA 2ZPHB 4C8QC 5LJ3g 2RA2A 1SRYA 5LJ3d 4PL6A 1VQ4T 3JCMe 4KULA 3JCMV 2F5KA 4LNSA 1VQ7A 4LDVA 2L5QA 1Y07A 3CBOA 3HXUA 2M9UA 1JJ2S 2I4OA 1IZ6A 1YIJA 3JRZA 3M56A 5CO7A 1BI2A 2DXBA 4QQGA 1EIFA 2RI2A 2DD4A 5LJ3f 4PJOE 3JCMd 5A2QE 2YHTA 4K88A 4NL3A 5GANg 3CCMA 1G5IA 4E7HA 4M75E 2DTOA 2VC8A 3MEUA 1Q82C 3L2WA 1W66A 1YFSA 4M77E 3VYGA 3RKWA 3HFVA 3DB3A 3UFGA 3V8JA 3J80E 4BDYA 5A0LA 3L2QA 2L89A 5I21A 4XQ3A 3SWNC 3HFOA 2EJFA 1VQ9A 3HFZB 3S3NA 2WSEE 3JCMf 3SD4A 2DU7A 2JOYA 1V29B 3CBPA 5C0MA 1X56A 3E1SA 4RMFA 3VQWA 3OYGA 2F5TX 3M54A 3CCST 2QQRA 3HXYA 3MF1A 4EMHA 3QBYA 4PJOF 4E7IA 3MEVA 4IUTA 5DM7R 3A7RA 1WJRA 2E6ZA 4GLKA 4M75F 4OB2B 1QVGA 3QJYA 5K1XA 1X55A 3CCLT 2MAMA 1YB3A 2XDBA 2CIMA 2XK0A 5DY9A 5GAOq 3JB9H 4P74A 2CZ6B 1H4SA 3A5ZB 3MCAB 4QVZA 4H2UA 1G3YA 2DXTA 1U1SA 4HT4A 3PMIA 3M59A 3VJPA 5GAN8 3UH0A 4RKUE 3OYCA 2YLCA 3UGTA 3M4GA 5ELNA 3P8HA 1N6AA 3TCJA 3HRSA 3GIBA 2ODRC 3OYYA 4OB0B 4A4EA 2QQBA 4YRPA 1BI3A 2FVUA 4LDYA 4JRPA 1UB4A 1XOVA 4KT0E 4LVKA 2ALYA 3A8HB 3HPWA 1JBMA 5GMKe 1QW1A 1KQSS 4HCBA 1SSFA 4MZMA 3PMTA 3RMSA 5KCOA 2OAUA 3SB2A 4N4HA 3G6ET 4BB7A 4MMKA 4RDXA 2Y4XA 4RQFA 2P0QA 5GAMe 1NJ1A 1M1KU 3IG2A 1S72A 2G4CA 1HTTA 1NJ5A 4YTLA 2Q7HA 2ZINA 2LCCA 4BWAA 1H641 3SDZA 3CCLA 2AHJB 3NELA 3HFNA 5GAMg 1ADYA 1OYXA 1U8RA 1B8AA 1X2GA 4C8QE 2EWNA 4JS4A 5LJ3j 2XICA 4HKEA 1FYFA 3META 5HK0A 1QVPA 2ZT5A 2YLBA 2D0QB 1KMNA 3OYFA 2RHIA 1KD1C 2QQ9A 3CCRT 1G3WA 2KSSA 3MP1A 4JJNK 4IUPA 4RG2A 5GAMf 1BBUA 4NS5A 3RL6A 4OB1B 4ZTUB 4YRSA 1LYLA 4OGEA 5CKHA 4PJOB 1ZQ1A 2ZPEB 2X4XA 4R55A 4J6WA 4TVAA 1Q86C 4M75B 5GANh 4C5GA 1XQHA 1I5LA 2PMFA 5GAOr 3CMQA 3G6EA 5KNNA 5FU7B 3HXZA 2CGHA 2ZZFA 2RH2A 4NL2A 2Y4YA 3NTKA 4M7AG 4H2TA 4RCCA 1M8VA 2O4XB 2V8JA 3GLXA 4M78A 3CC7T 2KDSA 4HA8A 3UWNA 4F7UA 3C95A 3QZ9B 5CIUA 2RJEA 4J15A 3MEYA 2LNVA 2RI3A 1KG1A 4IURA 3OS0A 3A8LB 1N8RU 3X26B 2HAXA 2E5QA 2MF2A 3CMAT 2JVVA 3A8GB 4XEMA 1FWZA 4ZTZB 4M7AD 2D6FA 1K73U 4VUBA 1FXXA 3IKLA 3JCMb 2R58A 1EQRA 4M77C 4C5IA 4BE1A 2K5LA 4ZTJA 3TU4K 3CPWA 1B70A 2ZT7A 5CKEA 1QVFS 3HKSA 4H2XA 3OYNA 3MHXA 1M5Q1 1YJWT 2RHZA 5KH6A 3FRNA 4HT9A 3LWHA 2BUDA 4YP0A 2LRQA 1NJ2A 4PHCA 1BIBA 1X01A 4P75C 3LX7A 1UGRB 3NTHA 3P8DA 2WACA 2MMPA 3UT1A 1KMMA 3OBYA 3GOXA 3URGA 3J81E 2NS6A 2ZCFB 4WI1A 1NE8A 3QO3A 1N9WA 3OYEA 4RCBA 4BE0A 2ZPBB 4RG8A 1W4SA 2JNGA 2QTXA 3CCUT 3OYIA 3OW2A 2QXFA 3CC7A 4H2VA 5GAN3 3EFSA 2E6NA 1JJCB 2GF7A 1QVGS 5GMKj 4FU6A 4QQDA 1IL2A 2EIFA 3BDLA 3HRUA 3X28B 4MZTA 1KC8U 2QHTA 2LVMA 2YRVA 4L59A 4EX5A 2K4YA 2D9TA 4JRIA 2AMCA 3CCVT 4J7FA 3CMAA 4O6JA 3JCMQ 2E65A 5GAMj 3VQVA 4C8QB 4J83A 3Q1JA 3I7FA 2VV5A 1Q81U 3QXEB 3OY9A 2P5IA 5M9OA 2CS7A 3LSQA 1NJIC 4M7DD 5D6WA 3OA6A 3P8TA 4M78C 3LW5E 4MDXA 3ZBDA 1K8AU 4PLLA 4TVRA 2DXCA 3VQYA 1VQMT 2I4NA 1I81A 3G4ST 1BYMA 2QDYB 2ARTA 2FHDA 3HRTA 1HXDA 5HY6A 4LD6A 4TVYA 5GMKi 2DVEA 3SFMA 3JCMJ 1NJ8A 3S3OA 4OLFA 2QHVA 4XEOA 1M90C 1NYRA 3HFZA 3CCUA 2MI6A 2LTOA 5KE3A 2DDZA 2A3LA 3GNGA 3OQ5A 1VQLT 4ELZC 1H4QA 5I2SA 1YGBA 4N4GA 1E1OA 3HL8A 3KUFA 11ASA 2JUFA 3OYAA 2ZIMA 2MWPA 5K1PA 1M1GA 3TEHB 3RGLA 1Z7NA 2CZ7B 5GAN6 3CD6T 3BY7A 4M7DA 5FRMA 4XTWA 3CCVA 5CVIA 4YRMA 3R6OA 1SETA 4ZGEB 4YRFA 5DLOA 3M55A 3NETA 2KAFA 2RHSB 3JCMg 4BUGA 3RIRA 4XTXA 2C8MA 3G7ZA 3A5ZA 3CCJT 2XTIA 4N4IA 2DIGA 4HWPA 4XTZA 2XDPA 2I4MA 4PJOG 4XU0A 2M16A 4Y28E 1QE0A 4P73A 1RL2A 3QYHB 3QSUA 1B7YB 4M75G 3JB9J 4Y91A 4JDSA 2AKWA 1VQMA 4MDWA 1BBWA 4M77G 3G4SA 3MQZA 4K87A 4OGCA 2M1HA 3BFMA 1NPRA 2P0KA 3PNWC 1Q7YU 2X35A 2V8IA 4C92C 2E70A 4TVWA 2DEQA 4OF1A 2NLUA 4YREA 2C7IA 1WPYA 4LDXA 1PSEA 3A7UA 2XG8D 4ZN3A 1ASYA 5IAYA 4M77F 3V7CA 1VQLA 4PJOD 2EQUA 3FB9A 5FROA 2GFUA 1VQ4A 4P72A 4CH6A 1USYA 4M75D 2VYTA 5L8RE 4UP7A 5CQXA 3LC0A 2RK1A 3TREA 2DO3A 4J6XA 3L2VA 3JCMW 1WGSA 2ZPFB 4CH4A 3QG1A 3NEMA 3RMQA 5GAOn 3LGLA 3L2ZA 3CXCS 3CPWS 3QIIA 5LJ5e 3HRIA 1M1KC 3OSVA 3CCJA 3OYJA 2EJ9A 3IKMB 4CI0C 4CH5A 2LQ8A 1O75A 4G84A 2XHCA 5FLXE 2ZXFA 2QHSA 2ZCEA 3VQXA 3G1ZA 4P3NA 1D3BB 2M0OA 4IUQA 2HD0A 3HRKA 4YRIA 3RKYA 3WXMB 3CPFA 1VUBA 4UP8A 4EMKA 5GAOm 3FC3A 5AYFA 2QI2A 4PG3A 4M78E 3KFUA 3V8KA 3M4PA 5LJ5d 2G3RA 3KBGA 1YFRA 3OS5A 2E5AA 4K86A 4KUIA 1SESA 3CCSA 2ZZGA 5CAIA 4DPGA 3WVDB 4C0DB 5A0DA 3H6ZA 5J39A 4P3PA 1WQWA 1RI0A 4JRKA 4WJ4A 5D6XA 5LJ5f 2DTIA 4L87A 1RIQA 1NYQA 1WLEA 3JB9G 2ZZDA 4ZTFA 2CKKA 1YJ9T 4JUVA 2Q7GA 4O2DA 2H3JA 3FEOA 1ASZA 1W2BA 2PU9B 5GAOl 2VUBA 1GXIE 4M78F 5LJ3h 1B34A 4TWAA 1VQ5T 2BKDN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2X A;  4X5O A;  4A53 A;  2CJ9 A;  3P8V A;  1M5Q 1;  4P3O A;  3E9I A;  1Y96 B;  4XU1 A;  4M7A B;  2ZR2 A;  2Y90 A;  4HT9 A;  4YPF A;  5LJ3 e;  4YCU A;  4E51 A;  2I2L A;  4YP0 A;  1KOG A;  1NJ2 A;  4PHC A;  1BIB A;  1X01 A;  4P75 C;  4HWS A;  4M7D B;  4C8Q G;  3JB9 F;  2Q5H A;  4M77 D;  1EVL A;  2ALY B;  1YCY A;  1PYS A;  1Z7M A;  5C52 B;  2JN0 A;  1KMM A;  4BW9 A;  4JLI A;  3EFR A;  3INZ A;  4YCV A;  4HWR A;  4H2W A;  1KQ2 A;  3RAC A;  4XU2 A;  4YRK A;  1N9S A;  5GAN 5;  3UGQ A;  4YDQ A;  1E24 A;  4WI1 A;  3V8L A;  3M4Q A;  3QO3 A;  1N9W A;  3JCM h;  3SWN B;  4RCB A;  1SER A;  2E64 A;  3A74 A;  1YFT A;  4C8Q C;  3R07 A;  1E1T A;  5LJ3 g;  4N0A A;  2RA2 A;  1SRY A;  3ICA A;  5LJ3 d;  4M77 B;  3REU A;  1WU7 A;  3L1A A;  3JCM e;  4C8Q F;  2E10 A;  2QTX A;  3JCM V;  1U1T A;  4LNS A;  4A54 A;  1WNL A;  3HXV A;  4H2V A;  4XTV A;  5GAN 3;  3HY0 A;  4EO4 A;  3HXU A;  3EFS A;  1JJC B;  4P74 C;  2FYK A;  2I4O A;  5GMK j;  3PGG A;  2AKW B;  5GMK l;  1JRI A;  1IL2 A;  2ARS A;  3VU3 C;  4C8Q D;  1HC7 A;  3QUI A;  2DZ9 A;  1EOV A;  2P0L A;  2QHT A;  5LJ5 g;  4ZIB A;  2I4L A;  5LJ3 f;  4HT8 A;  4EX5 A;  3QHS A;  4PJO A;  4F7U E;  4JRI A;  2AMC A;  4KQE A;  4PJO E;  3JCM d;  3QO7 A;  2YHT A;  4YRO A;  2E1H A;  3JCM P;  4K88 A;  4NL3 A;  5GAN g;  4C92 E;  3FJP A;  4M75 A;  4M7D C;  1G5I A;  4M75 E;  2DTO A;  3JCM Q;  2E65 A;  2VC8 A;  3RER A;  2VXE A;  3IAL A;  4M78 G;  1W66 A;  4M77 A;  5GAM j;  3VQV A;  12AS A;  4C8Q B;  3REX A;  1YFS A;  4M77 E;  3RKW A;  3HFV A;  4F7U G;  3BDU A;  1KQ1 A;  3UFG A;  3V8J A;  4YRG A;  2E41 A;  3I7F A;  4C92 G;  3TUP A;  4X9C A;  5I21 A;  4XQ3 A;  1J5W A;  1JJC A;  1LNX A;  3SWN C;  2DZC A;  3HFO A;  2P5I A;  2EJF A;  4J6Y A;  3HFZ B;  3JCM f;  3LSQ A;  2DU7 A;  4EMK C;  4MML A;  3HY1 A;  4M7D D;  4P75 A;  2J3M A;  3P8T A;  4M78 C;  4Q15 A;  2DXU A;  2Q7E A;  2RHQ A;  1X56 A;  3HTZ A;  4RMF A;  3VQW A;  2ZGW A;  4G85 A;  1G51 A;  2XGT A;  3ERR A;  3VQY A;  4F7U F;  3HXY A;  3MF1 A;  4EMH A;  2I4N A;  4P73 C;  4PJO F;  1I81 A;  3LSS A;  2ART A;  4HWO A;  4C92 F;  5GMK m;  1X54 A;  4TVA B;  5GAM d;  3A7R A;  4M75 F;  2ZNI A;  3E9H A;  1HXD A;  5K1X A;  4H2Y A;  5ELO A;  4M78 D;  1X55 A;  2ZNJ A;  1NJ6 A;  1I8F A;  1YB3 A;  1EIY A;  4TVY A;  4XTU A;  2DVE A;  5GMK i;  4YRL A;  1ADJ A;  2CIM A;  3JCM J;  1NJ8 A;  5DY9 A;  5GAO q;  3NEN A;  4OLF A;  2QHV A;  4XEO A;  1QF6 A;  4QVC A;  3JB9 H;  1NYR A;  3HFZ A;  4P74 A;  3RUX A;  4HWT A;  4RQE A;  1H4S A;  2ZT8 A;  3JB9 D;  2DDZ A;  4H2U A;  2DXT A;  1U1S A;  5GAN 8;  1E22 A;  4X9D A;  4EMK B;  3RES A;  3UH0 A;  1H4Q A;  4M78 B;  3MF2 A;  2YLC A;  3BJU A;  3UGT A;  3M4G A;  5ELN A;  1WYD A;  2E3C A;  1YGB A;  3GIB A;  2ODR C;  4UPA A;  1E1O A;  1L0W A;  5LJ5 j;  11AS A;  1Y96 A;  3WQZ A;  2ZIM A;  4M7A A;  4P72 C;  4YRP A;  5K1P A;  4V2S A;  5GMK h;  4M7A E;  1USY C;  3TEH B;  3RGL A;  4CS2 A;  4HVC A;  1Z7N A;  2ZIO A;  2IY5 B;  3RF1 A;  1N9R A;  5GAN 6;  3BY7 A;  4M7D A;  4UP9 A;  4XTW A;  5GAN j;  1VQZ A;  4M7D E;  2ALY A;  4YRM A;  2CJA A;  1SET A;  3A7A A;  1JBM A;  2ARU A;  3DSQ A;  4YRF A;  3QO5 A;  5GMK e;  4YRJ A;  3NET A;  2RHS B;  1WQ7 A;  2ODR D;  3JCM g;  4J5Y A;  1NNH A;  3RIR A;  4XTX A;  2C8M A;  3SWN A;  3A5Z A;  4OP0 A;  4P71 A;  3SB2 A;  2XTI A;  4YRT A;  4N0A C;  4HWP A;  4PNO A;  4KR3 A;  4MMK A;  5GAM h;  5F5W A;  4RDX A;  4XTZ A;  3JCM c;  3QTC A;  1H4T A;  2RM4 A;  1B70 B;  2I4M A;  1B34 B;  4XU3 A;  4PJO G;  3QNE A;  4XU0 A;  4RQF A;  4H2X B;  3TEG A;  2EAY A;  2DQ0 A;  4YRC A;  5GAM e;  1QE0 A;  4P73 A;  4TQF A;  3TEH A;  2IY5 A;  3QSU A;  1B7Y B;  4M75 G;  3JB9 J;  4M7A F;  4Y91 A;  2AKW A;  1NJ1 A;  2QHU A;  3IG2 A;  1BBW A;  2G4C A;  2K57 A;  1HTT A;  4M77 G;  4CS4 A;  4K87 A;  1PYS B;  1NJ5 A;  3BFM A;  3OD1 A;  1B76 A;  3HXX A;  1H4V B;  2Q7H A;  2ZIN A;  2RHS A;  4PJO C;  1TH7 A;  4BWA A;  1H64 1;  4C92 C;  4DQ2 A;  3A5Y A;  4TVW A;  1LOJ A;  2DEQ A;  4M75 C;  1EVK A;  3NEL A;  4KR2 A;  3HFN A;  5GAM g;  4YRE A;  2C7I A;  1ADY A;  1B8A A;  3BW1 A;  1WPY A;  1X2G A;  3W3S A;  3A7U A;  4TQD A;  1HK9 A;  4C8Q A;  4C8Q E;  1ASY A;  1BIA A;  2EWN A;  4M77 F;  3V7C A;  2ZTG A;  5LJ3 j;  1FYF A;  2RB6 A;  4PJO D;  3FB9 A;  4QVD A;  2ZT5 A;  5GAN 7;  1B7Y A;  4C92 D;  4P72 A;  2YLB A;  4CH6 A;  1KMN A;  1USY A;  4M75 D;  2DTH A;  4H02 A;  2J3L A;  3PZC A;  4NOY A;  4UP7 A;  3LC0 A;  5GAM f;  1BBU A;  3RL6 A;  4YRQ A;  4J6X A;  2VXF A;  4ZTU B;  4F7U B;  4YRS A;  5GAO p;  3JCM W;  1LYL A;  5LJ5 h;  4PJO B;  2AMC B;  4NCX A;  5GAN 2;  4CH4 A;  3NEM A;  4J6W A;  4C92 B;  5GAO n;  3L2Z A;  3HXW A;  3L4G B;  4TVA A;  4M75 B;  5GAN h;  5LJ5 e;  3AHU A;  3HRI A;  1I5L A;  2PMF A;  5GAO r;  2EJ9 A;  3CMQ A;  3IKM B;  5KNN A;  3HXZ A;  4CH5 A;  2CGH A;  5GAN 4;  2Q5I A;  4XTY A;  2ZZF A;  4G84 A;  4NL2 A;  2ZXF A;  2DQ3 A;  5GAN e;  2QHS A;  2ZCE A;  3P8Y A;  3PCO B;  3VQX A;  4M7A G;  1X2H A;  5C51 B;  2EJG A;  3G1Z A;  1ATI A;  4H2T A;  2HNI A;  3VBB A;  4P3N A;  1D3B B;  4YRR A;  2CJB A;  5HGQ A;  4RCC A;  3HRK A;  4YRI A;  1M8V A;  1LJO A;  3RKY A;  4M7D G;  5E3I A;  2FB7 A;  4UP8 A;  4YCW A;  4EMK A;  5GAO m;  3QO8 A;  1C0A A;  4M78 A;  4PG3 A;  2RHQ B;  4M78 E;  3KFU A;  4EMG A;  4HA8 A;  3V8K A;  4F7U A;  3M4P A;  5LJ5 d;  5C53 B;  4J15 A;  2PME A;  1I4K 1;  4M7A C;  3MEY A;  1MGQ A;  4WF2 A;  1YFR A;  1EFW A;  4C92 A;  3FIF A;  2E5A A;  4H2S A;  3L4G A;  2RD1 A;  4K86 A;  3A31 A;  4CS3 A;  5GAN d;  1SES A;  2ZZG A;  4WJ3 M;  2DJZ A;  5CAI A;  4YYE A;  4DPG A;  4YRN A;  4M7D F;  2EL9 A;  4P3P A;  3JCM X;  1WQW A;  4AH6 A;  1EIY B;  3PCO A;  3HSB A;  4XEM A;  4ZTZ B;  4JRK A;  4WJ4 A;  3V7R A;  3RKX A;  1D3B A;  5LJ5 f;  2DTI A;  4M7A D;  4L87 A;  1RIQ A;  1NYQ A;  4P71 C;  3JB9 I;  2ZT6 A;  1WLE A;  3JB9 G;  3A32 A;  3V7S A;  2ZR3 A;  4JUV A;  4Q6G A;  3IKL A;  3JCM b;  1G5H A;  1GGM A;  2DU5 A;  1EQR A;  2Q7G A;  4O2D A;  4M77 C;  5GAN f;  1ASZ A;  2ZZE A;  5GAO l;  1B70 A;  4CH3 A;  2ZT7 A;  4TTV A;  4M78 F;  5LJ3 h;  2DKG A;  1B34 A;  4TWA A; 
#chains in the Genus database with same CATH topology
 4X5O A;  2CJ9 A;  3P8V A;  1SRL A;  1WFW A;  2ZPI B;  1YFN A;  4E2F B;  3GNF B;  2I2L A;  3F70 A;  3PT9 A;  4J8O A;  1JXO A;  1TUG B;  4BY6 B;  4C8Q G;  3JB9 F;  2LCL A;  4A63 B;  2ALY B;  2CRE A;  1PYS A;  3QYG B;  1Z7M A;  2C0I A;  2JN0 A;  3QDR B;  2EFI A;  3CCM Q;  3PVQ A;  1QP2 A;  4JS5 A;  1UDL A;  1K1Z A;  1KQ2 A;  3RAC A;  4XU2 A;  1WHJ A;  3MEA A;  4KGZ B;  4FL6 A;  1UFF A;  4QKU A;  5GAN 5;  3UGQ A;  4YDQ A;  3M4Q A;  2RHU A;  3JCM h;  1OU9 A;  4XAX B;  1SER A;  3PVL A;  2V8K A;  2E64 A;  2LNH B;  1YFT A;  2GFA A;  4BD3 A;  4C0D C;  3EAE A;  3M5A A;  1E1T A;  4OB3 B;  4N0A A;  2CT4 A;  1X6O A;  3ICA A;  2CSQ A;  4M77 B;  3IQL A;  1N8R C;  3WVE B;  1VQ9 Q;  1WU7 A;  4XK8 E;  4C8Q F;  1QMC A;  2E10 A;  1U1T A;  1M2V B;  2I0N A;  4IUU A;  4BI3 A;  2DIQ A;  4A54 A;  3HXV A;  4E7J A;  2HEQ A;  4KGX B;  4XTV A;  3EHQ A;  1Y71 A;  4P74 C;  4C5E A;  3DB4 A;  2FYK A;  4BDZ A;  2A0F B;  5GMK l;  4P5N A;  2LDM A;  2HBP A;  3VU3 C;  2GTJ A;  1K73 C;  4C8Q D;  1D0Z A;  2DBK A;  2RHX A;  4HXJ A;  4J9C A;  2P0L A;  2KMT A;  3EG9 B;  2A7Y A;  2X9H A;  4ZIB A;  4A4H A;  2J6O A;  2I4L A;  3X25 B;  2X3X D;  2LZ6 B;  4HT8 A;  4KQE A;  5KCH A;  3QO7 A;  5CKB A;  3EHR A;  1W70 A;  2EGC A;  4C92 E;  4JJB A;  3FJP A;  5EG2 A;  4R0K A;  4BY6 C;  3J7A F;  2K2V A;  2VXE A;  1SPK A;  12AS A;  3REX A;  2OTL T;  1OQK A;  3TEE A;  1YJ9 A;  1KQ1 A;  4YRG A;  4IKF A;  2E41 A;  4OMF B;  1R0C B;  3ER0 A;  1WJQ A;  4C92 G;  1YI2 T;  3CME T;  1J5W A;  1JJC A;  1LNX A;  4LXC A;  3M58 A;  1VQ5 A;  4FT4 A;  1VIE A;  4J6Y A;  1K0X A;  6AT1 B;  4E7L A;  1RAE B;  4EMK C;  2LJ1 A;  4MML A;  4J9H A;  2J3M A;  3M4Y A;  4Q15 A;  2DXU A;  2Q7E A;  2RHQ A;  3HTZ A;  1SSH A;  1UGS B;  3CEY A;  1UEB A;  3CCR A;  1UG1 A;  4B9W A;  1ZSG A;  1DJ7 B;  2RJF A;  1ZSZ A;  5FU6 B;  2EGA A;  1JB0 E;  2XU8 A;  2LP5 A;  3E2U A;  1K9M C;  3LSS A;  4HWO A;  4C92 F;  1OZ3 A;  4TVA B;  2EYQ A;  2PVG B;  1QWE A;  3REB B;  2CP7 A;  5D6Y A;  3E9H A;  1EX4 A;  2X4W A;  4H2Y A;  5ELO A;  2ZPG B;  2WSF E;  1QKW A;  2LMJ A;  4FYW B;  4LD9 K;  2F69 A;  1OX8 A;  1EIY A;  3NFC A;  4XTU A;  4YRL A;  1GCQ C;  1NZ9 A;  1ADJ A;  2DMO A;  1KC8 C;  2EKH A;  3OBW A;  2D1X A;  2AKK A;  3NEN A;  2YT6 A;  2EYZ A;  1JEG A;  2BZ8 A;  4RQE A;  1TUD A;  1QLY A;  4Z8A A;  4ME7 A;  1GFD A;  4X9D A;  1YNZ A;  4JJC A;  2FZC B;  4HVV A;  4M78 B;  3MF2 A;  4ATO A;  2KQW A;  1D09 B;  1S72 Q;  1WYD A;  4UPA A;  3CBM A;  3H41 A;  1L0W A;  5LJ5 j;  1Y96 A;  3WQZ A;  4M7A A;  2EQJ A;  3OS2 A;  4V2S A;  3L2R A;  5GMK h;  4HVC A;  2IY5 B;  1Q81 C;  1N9R A;  4UP9 A;  2L0A A;  3R6N A;  3CCL Q;  3CQT A;  3OB9 A;  4M7D E;  3SHW A;  2CJA A;  2KNB B;  3A7A A;  1H92 A;  2ARU A;  2F2W A;  3DSQ A;  3QO5 A;  5KYN A;  5FU6 C;  2ODR D;  2LC4 A;  2OTL A;  4RTY A;  5ECA A;  3D7S B;  3OS1 A;  3SWN A;  1MHN A;  4M4Z A;  4OP0 A;  1AWW A;  2P4T A;  1YJN T;  3OYL A;  3CME A;  4FSS A;  4N0A C;  4KR3 A;  5GAM h;  1FYN A;  1YWP A;  1OUL A;  2B86 A;  2DJQ A;  3JCM c;  1H4T A;  2RM4 A;  1B70 B;  1TWB A;  5C6S A;  4XU3 A;  4H2X B;  3LWI A;  2DQ0 A;  2LCS A;  2HQX A;  3QKJ A;  2RK2 A;  2DX1 A;  3TEH A;  2PQW A;  3UPU A;  2DAQ A;  2RMO A;  2E4H A;  2QHU A;  2MYS A;  3LH0 A;  2K57 A;  1YJW A;  2K5F A;  3G71 T;  2J05 A;  3UAT A;  1IXD A;  1WHM A;  2QTV A;  1NPP A;  2VAS A;  2L8D A;  2JXB A;  1H4V B;  1NEB A;  3HXX A;  4X34 A;  2RHS A;  1IRE B;  4DA4 A;  1VQN T;  4E7S A;  1TH7 A;  1WYX A;  4PFZ A;  3OYK A;  2LT1 A;  2QGG A;  2XI9 A;  3G6E Q;  1R8O B;  3C12 A;  4J9F A;  1VQ6 T;  4II1 A;  1AEY A;  3VYH B;  3O5Z A;  1VQ8 T;  3W3S A;  3MKD A;  1HK9 A;  5A0G A;  4F17 A;  2LT4 A;  4Y92 A;  2C0O A;  1WA7 A;  4ZGJ B;  2ZTG A;  2DL8 A;  3KFV A;  1OU8 A;  4Z88 A;  1N8R R;  4FYV B;  1C6V X;  4QT7 A;  3LGF A;  4QVD A;  5GAN 7;  2FL7 A;  4C0Z A;  1B7Y A;  1ARK A;  3CCE T;  1QVF P;  4J7I A;  2DD5 A;  4H02 A;  1TTH B;  3PZC A;  4NOY A;  2RO0 A;  4JPB W;  5J26 A;  1B3Q A;  4YRQ A;  1K73 R;  2NUT B;  2DPP B;  3ZEH A;  1PCX A;  2RJC A;  1UGV A;  2BE9 B;  2AMC B;  1XNI A;  1NJI U;  1VOM A;  5GAN 2;  5EC7 A;  4C92 B;  1UGQ B;  2AKL A;  3QPH A;  3HXW A;  3L4G B;  1UJ0 A;  2E3I A;  5KYW B;  4C0G A;  1ZLM A;  1WIE A;  3AHU A;  2PVD B;  2K2M A;  3EFO B;  4C5H A;  1EFN A;  1YJN A;  2KRN A;  1RAH B;  3M53 A;  4XTY A;  4BAC A;  2DQ3 A;  1BU1 A;  5GAN e;  3P8Y A;  3PCO B;  3DLL A;  5C51 B;  5CQY A;  1X2H A;  2EJG A;  1BB9 A;  1G5V A;  1ATI A;  2HNI A;  4YRR A;  2CJB A;  1PWT A;  4D8K A;  1YIT T;  5HGQ A;  1Q7Y C;  2R5A A;  2AK5 A;  3CCQ T;  3I55 T;  1LJO A;  5E3I A;  2G6F X;  4KBM B;  1NLO C;  3QWY A;  2R57 A;  2K5I A;  2MWO A;  3KXT A;  1M90 U;  2LQK A;  5C53 B;  1M3B A;  2PME A;  2CZ1 B;  4E6R A;  4M7A C;  3G71 A;  1QVF A;  1MGQ A;  1EFW A;  3EGD B;  4JJD A;  3E9F A;  4Q5W A;  4H2S A;  1VQN A;  1PHT A;  2RD1 A;  3A31 A;  4CS3 A;  2FO0 A;  2DFU A;  5GAN d;  2KYM A;  4RMO A;  4WJ3 M;  3H9N A;  3GPL A;  4YYE A;  1OEB A;  2JMC A;  2OAW A;  3FLG A;  2EL9 A;  4PLI A;  3ME9 A;  3VRY A;  4CC4 B;  1VQ6 A;  4AH6 A;  5AT1 B;  1IB8 A;  3NHN A;  1VQ8 A;  2PTK A;  4LVL A;  3S6W A;  3X20 B;  3RKX A;  1D3B A;  2A8E A;  1KC8 R;  3JB9 I;  2HKQ B;  4KUD K;  2HQE A;  2JTM A;  3V7S A;  1BKB A;  2GBQ A;  2RHY A;  3CC7 Q;  3CCE A;  5GAN f;  4RTX A;  2ZZE A;  4TTV A;  3OYD A;  2DKG A;  2CZ0 B;  4OVA A;  1K76 A;  5J3B A;  2YRD A;  1S72 T;  2JM9 A;  2RJD A;  3E9I A;  3TVT A;  1LVK A;  4B9X A;  1Q82 U;  4YPF A;  2VGM A;  3E9G A;  1RLQ C;  1QCN A;  1KOG A;  1AHJ B;  4M7D B;  2XD0 A;  4FCY A;  1ZA2 B;  4EPC A;  1Q81 R;  2Q5H A;  3VKI A;  4M77 D;  1EVL A;  1YCY A;  1ACM B;  1X6G A;  3CMA Q;  5C52 B;  4BW9 A;  3EFR A;  3INZ A;  1B7T A;  4LVI A;  3CD6 A;  2VWF A;  2CP3 A;  4CRI A;  1IGU A;  4YRK A;  1I07 A;  5FRN A;  1K8A R;  1SHG A;  2KY9 A;  3H0H A;  2F2V A;  2GQV A;  2QDL A;  4LDU A;  2DM1 A;  4Z02 A;  5HKC A;  3R07 A;  2DET A;  3OYM A;  1TXQ A;  2L3R A;  2LX9 A;  1M8M A;  4C0F A;  1YIT A;  1G2B A;  1N5Z A;  2DRK A;  3CCQ A;  3I55 A;  3L1A A;  3REU A;  2J6F A;  1ABO A;  3QJ6 A;  5CCA A;  4A4G A;  1V76 A;  3NTI A;  4FW2 A;  1WNL A;  5CR2 A;  2ESW A;  2BTT A;  3HY0 A;  4EO4 A;  5KE2 A;  4FM4 B;  3PGG A;  4DBR A;  2AKW B;  1QP3 A;  1JRI A;  1RLP C;  2ARS A;  1BI1 A;  1HC7 A;  3QUI A;  3VUB A;  2DZ9 A;  1EOV A;  2KRS A;  1JJ2 P;  3QWX X;  1WHL A;  3PFS A;  1YHQ T;  5LJ5 g;  4ELY C;  2GQI A;  2ROL A;  3ASK A;  3QHS A;  4PJO A;  4F7U E;  2BZX A;  1GBR A;  4K11 A;  4LNP A;  4YRO A;  2E1H A;  1MMA A;  3JCM P;  2KEA A;  4M75 A;  4CC3 A;  4M7D C;  2P0P A;  3RER A;  3IAL A;  4M78 G;  4M77 A;  2YUN A;  2HZY A;  3OW2 S;  1JXM A;  2GGR A;  1XJW B;  2NWM A;  3BDU A;  4F7U G;  3HHT B;  5KYU B;  1D1B A;  3DKM A;  2QA4 T;  3TUP A;  1N27 A;  2OI3 A;  4X9C A;  2DZC A;  3L2U A;  1IO6 A;  2O88 A;  2O4X A;  2OTJ T;  1CKA A;  4D6W A;  3HY1 A;  4P75 A;  3E19 A;  4O5V A;  3EG9 A;  2V26 A;  2X4Y A;  4D8D A;  2LQN A;  2ZGW A;  4PJN A;  1VQO T;  1YIJ Q;  4AFS C;  1G51 A;  2EQM A;  4G85 A;  2XGT A;  2DL4 A;  2JTF A;  1ZUY A;  3ERR A;  4FT2 A;  3CCV Q;  2QYZ A;  4F7U F;  4P73 C;  2AZS A;  1I0C A;  2PVO B;  2BE7 D;  1PNJ A;  4QQ6 A;  2QGF B;  5GMK m;  1X54 A;  5GAM d;  1TUC A;  2ABL A;  3C94 A;  1FMV A;  2LJ3 A;  4MZP A;  2ZNI A;  1JJ2 A;  2AIR B;  4M78 D;  3CC4 T;  2ZNJ A;  1NJ6 A;  5KYX B;  3LYI A;  1I8F A;  1QCO A;  2CP6 A;  4FIB A;  2MIO A;  3MP6 A;  4BE2 A;  2KI7 A;  3MJX A;  1M3C A;  3QZ5 B;  5IXB A;  3JSC A;  2JM8 A;  2PUK B;  1GRI A;  1QF6 A;  4QVC A;  1E6G A;  4UC4 A;  1VIF A;  3RUX A;  3L42 A;  4HWT A;  1MMG A;  2ZT8 A;  3JB9 D;  3M57 A;  2BIV A;  1TU0 B;  1Q7Y R;  3A8M B;  3M0U A;  1E22 A;  4EMK B;  1WHK A;  3RES A;  1BCM A;  3PE0 A;  3VUZ A;  3BJU A;  2Z0W A;  2XMF A;  3OMC A;  3ZFJ A;  1VQM Q;  1BI0 A;  2E3C A;  5HCK A;  1YP5 A;  1PD1 A;  2VGN A;  3G4S Q;  4OMQ A;  4P72 C;  1YHQ A;  2L3P A;  4M7A E;  1USY C;  4CS2 A;  2SEM A;  2ZIO A;  1RUW A;  2KVQ G;  3S3M A;  3RF1 A;  3N5B B;  1ZHI A;  5GAN j;  1VQZ A;  1GBQ A;  3OYH A;  1O9S A;  2CT3 A;  2CDT A;  2JZ2 A;  3CXC P;  3VV0 A;  3PIO A;  4DOV A;  4YRJ A;  2QAS A;  1OOT A;  3A8O B;  1T3S A;  1WQ7 A;  4DBH A;  2DRM A;  4J5Y A;  1NNH A;  4E7K A;  1XTD A;  3FDR A;  3GF5 A;  1IGQ A;  1KD1 U;  1VQL Q;  4P71 A;  1WJS A;  3GP8 A;  1WXB A;  2EQI A;  2JTE A;  2QA4 A;  5IN1 A;  4YRT A;  3HP9 A;  1ZBX A;  1T3L A;  1WXT A;  1FX7 A;  4PNO A;  1KQS P;  5F5W A;  4E47 A;  1OZ2 A;  1VQ4 Q;  2ED1 A;  3QTC A;  4LDW A;  1PD0 A;  2OTJ A;  1RAI B;  2E12 A;  1B34 B;  1G3T A;  1OI1 A;  3QNE A;  3TEG A;  2EAY A;  3I56 T;  4YRC A;  1X69 A;  1Q86 U;  4TQF A;  1AWJ A;  1VQO A;  2IY5 A;  4M7A F;  1AWO A;  2K3Y A;  4R56 A;  2XDD A;  1Y7X A;  1ZUK A;  3OSS C;  5I2M A;  4CS4 A;  2EW3 A;  3P8B B;  1PYS B;  1M1F A;  2RQW A;  2DF6 A;  3OD1 A;  2KGT A;  1B76 A;  4LVJ A;  2QQS A;  4PJO C;  1OPL A;  4QW2 A;  4F04 B;  3M9Q A;  3CC4 A;  2RQR A;  4L6V 5;  4DQ2 A;  3CCJ Q;  3OMG A;  3A5Y A;  1LOJ A;  4M75 C;  1EVK A;  4KR2 A;  3CC2 T;  1AVZ C;  1KHC A;  1V1C A;  3BW1 A;  1GCP A;  1UHC A;  1P92 A;  3CXC A;  1VQP T;  4TQD A;  4C8Q A;  2CYZ B;  5FU7 C;  3PIP A;  1BIA A;  2X4J A;  2RNA A;  1UEC A;  2COW A;  4DBF A;  2X51 A;  1HYO A;  1YWO A;  2A36 A;  2RB6 A;  2O9V A;  2QEX T;  5CKD A;  4KH0 B;  4PFO A;  4F16 A;  4C92 D;  5HK3 A;  1X75 C;  1OV3 A;  5IT9 E;  4FSX A;  1ZBJ A;  2DTH A;  2XID A;  4IUV A;  1KQS A;  2C06 A;  2P84 A;  2J3L A;  1IRX A;  1I1J A;  3VS7 A;  1ZX6 A;  5DLQ E;  2GCX A;  2RPN A;  2VXF A;  4A4K A;  2IVW A;  3CCS Q;  4JRQ A;  4A4F A;  4F7U B;  5GAO p;  1U3O A;  2K9G A;  2KK4 A;  1M9S A;  5LJ5 h;  3OYB A;  1VQK T;  4NCX A;  5KYY A;  5CK9 A;  3H0I A;  1KHI A;  2LJ0 A;  4EDU A;  4BI4 A;  1G3S A;  4GY5 A;  2AT1 B;  2VKN A;  1S1N A;  5GAN 4;  2Q5I A;  3T9N A;  1K8A C;  1M4Z A;  1K9M U;  1X27 A;  1VA7 A;  2W0Z A;  2DL7 A;  3VBB A;  3H8Z A;  2QQA A;  4M7D G;  2GNC A;  3I56 A;  2DVJ A;  1YI2 A;  2FB7 A;  4YCW A;  5IHK A;  3QO8 A;  1C0A A;  5GJV B;  1VQ7 T;  2DL5 A;  3EG3 A;  1D0X A;  2RHQ B;  2NUT A;  4EMG A;  2KYB A;  3LLR A;  2PUO B;  4ZN1 A;  2DER A;  2B8A A;  1G8X A;  4BI8 B;  1YIJ T;  3DLM A;  2NUP A;  1I4K 1;  3I9Q A;  3PTA A;  3M0T A;  4WF2 A;  1RAC B;  4C92 A;  3FIF A;  2O01 E;  3L4G A;  4EIK A;  4CC2 A;  2WSC E;  3MO8 A;  3RNJ A;  1NLP C;  2DJZ A;  2L3S A;  4PKC C;  2CP0 A;  2BZY A;  3MP8 A;  4L5G A;  4YRN A;  3X24 B;  4M7D F;  5LL6 S;  3CC2 A;  1SKU B;  2K3X A;  4HCC A;  4FYY B;  3JCM X;  2LQW A;  2M51 A;  2J7I A;  1EIY B;  3PCO A;  3HSB A;  2IG0 A;  1VQP A;  3CCM T;  3O8V A;  3V7R A;  2A28 A;  4P71 C;  2ZT6 A;  2DK3 A;  3A32 A;  1YN8 A;  3RBB B;  2HDA A;  2ZR3 A;  2CSI A;  2NYS A;  2QEX A;  4Q6G A;  2V1R A;  4ZGD B;  1G5H A;  1GGM A;  2DU5 A;  1Q95 G;  2RN8 A;  3NPF A;  4CH3 A;  3MEW A;  1T0J A;  4DOW A;  2DA9 A;  1VQ9 T;  2XKO C;  1X43 A;  4A53 A;  4AG1 C;  4P3O A;  1Y96 B;  4XU1 A;  4M7A B;  3UDC A;  2ZR2 A;  2EKO A;  2Y90 A;  1W1F A;  4HCK A;  4E51 A;  1UGP B;  3TSZ A;  5LJ3 e;  1TSF A;  4YCU A;  4HWS A;  3A1P A;  1VQK A;  1NM7 A;  3JAM E;  3I5S A;  1E6H A;  4JLI A;  4JZ4 A;  4YCV A;  4HWR A;  1PSF A;  4H2W A;  2EQK A;  1H3Z A;  1PM3 A;  3EG1 A;  1ZSZ C;  2QAZ A;  1N9S A;  2R5M A;  3C4S A;  4AFQ C;  4JLG A;  3TSW A;  1E24 A;  1YBY A;  2COZ A;  3V8L A;  1YJ9 Q;  4OMM A;  3SWN B;  1KSW A;  4HCZ A;  2O9S A;  2YRC A;  2RI5 A;  4ANJ A;  1W2B S;  3A74 A;  5CKF A;  1D1A A;  4LVM A;  4AMC A;  2ZPH B;  4C8Q C;  1M30 A;  5LJ3 g;  2RA2 A;  1SRY A;  3VS4 A;  5LJ3 d;  1VQ5 Q;  4PL6 A;  1VQ4 T;  3JCM e;  4KUL A;  4WCI A;  3JCM V;  2F5K A;  4LNS A;  1VQ7 A;  4LDV A;  2L5Q A;  2HBW A;  1Y07 A;  3CBO A;  2O2O A;  2EYX A;  3HXU A;  2M9U A;  1JJ2 S;  2I4O A;  1IZ6 A;  2PZ1 A;  3CCR Q;  1YIJ A;  3JRZ A;  3M56 A;  1ABQ A;  5CO7 A;  2KT8 A;  1BI2 A;  1RAG B;  1UTI A;  2DXB A;  4QQG A;  1EIF A;  2C0T A;  2RI2 A;  2DD4 A;  1QVG P;  1M27 C;  5LJ3 f;  1VYU A;  4DBQ A;  4PJO E;  3JCM d;  3H0F A;  2MOX A;  5A2Q E;  2YHT A;  4K88 A;  4NL3 A;  5GAN g;  1K0S A;  3NGP A;  3CCM A;  1G5I A;  1C0M A;  3NMZ C;  4E7H A;  4M75 E;  2DTO A;  2KE9 A;  2VC8 A;  3MEU A;  4IIO A;  1Q82 C;  3L2W A;  1W66 A;  2YSQ A;  1YFS A;  4M77 E;  3VYG A;  3RKW A;  3HFV A;  3DB3 A;  3UFG A;  3V8J A;  3G1J A;  5FWC A;  3J80 E;  2YUQ A;  4BDY A;  3ZL7 C;  2KR3 A;  5A0L A;  1QQJ A;  3L2Q A;  2L89 A;  4LUD A;  4XQ3 A;  5I21 A;  3SWN C;  2V1Q A;  3HFO A;  2M02 A;  2EJF A;  1VQ9 A;  3HFZ B;  3S3N A;  1M2O A;  2WSE E;  3JCM f;  1SHF A;  2VB6 A;  3SD4 A;  2CUB A;  2DU7 A;  2JOY A;  1Y0M A;  1V29 B;  1AZE A;  3CBP A;  2E5K A;  5C0M A;  5L23 A;  1X56 A;  3E1S A;  4RMF A;  3VQW A;  3OYG A;  2F5T X;  3M54 A;  3CCS T;  2QQR A;  3HXY A;  4OMP A;  3MF1 A;  4EMH A;  1PC0 A;  3QBY A;  4PJO F;  2RQV A;  4E7I A;  3MEV A;  4IUT A;  5DM7 R;  3A7R A;  1CSK A;  2P4R A;  1WJR A;  2E6Z A;  4GLK A;  4M75 F;  4OB2 B;  4HVW A;  2OTL Q;  1MNE A;  4LE9 A;  1QVG A;  3QJY A;  3RDV A;  5K1X A;  4PK4 A;  1NYG A;  1X55 A;  3CCL T;  2MAM A;  4FW1 A;  1YB3 A;  2J6K A;  1SF9 A;  3CME Q;  2XDB A;  4B6M A;  1FMK A;  1A0N B;  2CIM A;  2XK0 A;  1JU5 C;  5DY9 A;  5IHN A;  5GAO q;  1MMD A;  3HTR A;  3JB9 H;  1C1A A;  4P74 A;  1T0H A;  2CZ6 B;  1H4S A;  2ROT A;  3A5Z B;  3MCA B;  2FRY A;  4QVZ A;  1G3Y A;  2DXT A;  1HJD A;  4H2U A;  1U1S A;  2J06 A;  2O31 A;  1MND A;  2DNU A;  4HT4 A;  3PMI A;  3M59 A;  3VJP A;  5GAN 8;  3UH0 A;  4RKU E;  3OYC A;  2YLC A;  3VS6 A;  3UGT A;  1PKS A;  1JO8 A;  3M4G A;  1VYT A;  5ELN A;  2SRC A;  3P8H A;  1N6A A;  3TCJ A;  3HRS A;  1YJW Q;  3GIB A;  2ODR C;  3OYY A;  4OB0 B;  4A4E A;  3REA B;  2QQB A;  1BCO A;  4YRP A;  1BI3 A;  2FVU A;  4LDY A;  4JRP A;  3EH1 A;  1GL5 A;  1UB4 A;  1XOV A;  4KT0 E;  4LVK A;  2ALY A;  3A8H B;  5KYX A;  3HPW A;  1JBM A;  2MPX C;  5GMK e;  1WHH A;  1X2Q A;  1QW1 A;  3M0R A;  1KQS S;  5I22 A;  4HCB A;  1SSF A;  4MZM A;  3PMT A;  1MMN A;  1EZZ B;  2EBP A;  3RMS A;  4AG2 C;  5KCO A;  2OAU A;  3SB2 A;  4N4H A;  3G6E T;  4BB7 A;  4DEX A;  1WXU A;  2EYY A;  4MMK A;  4RDX A;  1AT1 B;  1NJI R;  4RTZ A;  1CKB A;  3CCU Q;  2FPD A;  3C0C A;  2Y4X A;  1M2V A;  4PJL A;  4RQF A;  1JQQ A;  2P0Q A;  3U23 A;  5GAM e;  2DLP A;  3FJ5 A;  4ESR A;  1IHV A;  2A37 A;  2K79 A;  1NJ1 A;  1M1K U;  3IG2 A;  1S72 A;  2G4C A;  2HSP A;  1HTT A;  2A08 A;  4AFZ C;  2HQH A;  1HD3 A;  1RAA B;  1NJ5 A;  4YTL A;  2Q7H A;  1MV3 A;  2ZIN A;  2LCC A;  1GCQ A;  4BWA A;  1X2K A;  1AD5 A;  1H64 1;  1AZG B;  4KGV B;  3SDZ A;  3CCL A;  5D7U A;  2AHJ B;  2FEI A;  1YJN Q;  2YDL A;  3NEL A;  3HFN A;  5GAM g;  1PKT A;  1BBZ A;  1M90 R;  1ADY A;  1OYX A;  2LX7 A;  1U8R A;  1B8A A;  1X2G A;  1RAB B;  3EGX B;  4C8Q E;  2EWN A;  2DIL A;  4JS4 A;  5LJ3 j;  2XIC A;  1RAD B;  4HKE A;  1PRL C;  1FYF A;  3MET A;  5HK0 A;  1AWX A;  2L2P A;  1QVP A;  2ZT5 A;  1MUZ A;  1UUE A;  2E3H A;  2YLB A;  2ECZ A;  2D0Q B;  1KMN A;  3OYF A;  2RHI A;  1KD1 C;  2FPF A;  2QQ9 A;  3CCR T;  1G3W A;  3G71 Q;  1SRM A;  2KSS A;  3MP1 A;  4JJN K;  1KFZ A;  4IUP A;  4RG2 A;  5GAM f;  1VQN Q;  4E7Z A;  1BBU A;  4NS5 A;  3RL6 A;  1QKX A;  2BKD N;  4OB1 B;  4ZTU B;  2QG9 B;  4YRS A;  1LYL A;  4OGE A;  5CKH A;  4PJO B;  1ZQ1 A;  2ZPE B;  2EYW A;  5FW9 A;  2X4X A;  2IIM A;  2K7A A;  4R55 A;  4FYX B;  1VQ6 Q;  4J6W A;  1J3T A;  4TVA A;  1Q86 C;  2HL5 C;  1VQ8 Q;  4M75 B;  5GAN h;  4C5G A;  1XQH A;  4PFP A;  1I5L A;  2PMF A;  1D0Y A;  5GAO r;  1Q82 R;  3CMQ A;  3G6E A;  3CPW P;  5FU7 B;  3HXZ A;  5KNN A;  2CGH A;  2ZZF A;  2RH2 A;  5GJW B;  4NL2 A;  2Y4Y A;  3NTK A;  3CCE Q;  2RQU A;  4M7A G;  4H2T A;  2HMA A;  5I11 A;  2HKN A;  4RCC A;  1M8V A;  1U5S A;  2CUD A;  2FG0 A;  5FWB A;  2O4X B;  2H3E B;  2M0Y A;  2JJ9 A;  2V8J A;  3GLX A;  4M78 A;  4OMN A;  2YWW A;  3CC7 T;  2KDS A;  4HA8 A;  3UWN A;  2NUZ A;  4F7U A;  3C95 A;  3QZ9 B;  5CIU A;  4CC7 A;  2RJE A;  4J15 A;  2DE0 X;  1ZA1 B;  4OML A;  1WHG A;  4AFU C;  3MEY A;  2LNV A;  2RI3 A;  1KG1 A;  1NBE B;  3CD6 Q;  1K9A A;  4IUR A;  3OS0 A;  2DBM A;  3A8L B;  4Z89 A;  1N8R U;  1UE9 A;  4LUE A;  3X26 B;  2HAX A;  2HL3 A;  2JS0 A;  4DEY A;  2E5Q A;  2MF2 A;  1Z9Z A;  3CMA T;  2JVV A;  3A8G B;  4XEM A;  1FWZ A;  4ZTZ B;  1YIT Q;  3OW2 P;  2L3Q A;  4M7A D;  3CCQ Q;  3I55 Q;  2D6F A;  1G83 A;  4AT1 B;  3M0Q A;  2ED0 A;  1WX6 A;  1K73 U;  1R0B G;  4VUB A;  1FXX A;  3VRZ A;  3IKL A;  3JCM b;  2R58 A;  1EQR A;  4M77 C;  4C5I A;  4BE1 A;  2K5L A;  4ZTJ A;  3TU4 K;  3CPW A;  1B70 A;  2ZT7 A;  5CKE A;  1QVF S;  3HKS A;  4H2X A;  3OYN A;  3MHX A;  1M5Q 1;  1YJW T;  4J9I A;  2FZK B;  2RHZ A;  5KH6 A;  3FRN A;  4HT9 A;  3LWH A;  2BUD A;  2ZAE A;  4YP0 A;  2LRQ A;  1NJ2 A;  4PHC A;  1BIB A;  1X01 A;  4P75 C;  2JW4 A;  3LX7 A;  1UGR B;  3EH2 A;  4PJJ A;  3NTH A;  3P8D A;  2WAC A;  2JS2 A;  2MMP A;  3UT1 A;  1M1K R;  1KMM A;  2D8H A;  1NYF A;  3OBY A;  3GOX A;  2DYB A;  3URG A;  3J81 E;  2NS6 A;  2PNI A;  2OX7 A;  1UJY A;  2OJ2 A;  1KJW A;  2ZCF B;  4WI1 A;  1NE8 A;  3QO3 A;  1N9W A;  2ENM A;  3OYE A;  4RCB A;  1PG5 B;  4BE0 A;  4J9D A;  3M0P A;  2ZPB B;  4RG8 A;  1W4S A;  2JNG A;  1WDX A;  2QTX A;  1KK7 A;  3OYI A;  3CCU T;  3OW2 A;  2QXF A;  3CC7 A;  4H2V A;  5GAN 3;  3EFS A;  2E6N A;  1JJC B;  2GF7 A;  1W6X A;  1QVG S;  5GMK j;  4FU6 A;  4QQD A;  1IL2 A;  2RF0 A;  1KIK A;  2EIF A;  3BDL A;  3HRU A;  3X28 B;  4MZT A;  1KC8 U;  2QHT A;  2HSE B;  2LVM A;  4GBQ A;  2YRV A;  3MPU B;  4L59 A;  2COY A;  4EX5 A;  2K4Y A;  2D9T A;  4JRI A;  2AMC A;  4RTU A;  3RR6 A;  2YXY A;  1ZSZ B;  2F1L A;  3CCV T;  2HCK A;  3EG0 A;  4J7F A;  3CMA A;  2K6D A;  4O6J A;  2FRW A;  5KYW A;  3JCM Q;  2E65 A;  2GTO A;  5GAM j;  3VQV A;  3EFO A;  4C8Q B;  4J83 A;  4KH1 B;  3Q1J A;  3I35 A;  3I7F A;  2VV5 A;  2DL3 A;  3THK A;  4OMO A;  1Q81 U;  3QXE B;  3OY9 A;  2P5I A;  5M9O A;  2KXD A;  1H8K A;  2CS7 A;  3LSQ A;  1NJI C;  4M7D D;  3UA7 A;  5D6W A;  3OA6 A;  3P8T A;  4WTO B;  4M78 C;  1YHQ Q;  3LW5 E;  1KD1 R;  4MDX A;  3ZBD A;  1K8A U;  1VYV A;  1SG5 A;  4PLL A;  2EPD A;  4TVR A;  2DXC A;  3VQY A;  1VQM T;  2I4N A;  1I81 A;  3EGD A;  3G4S T;  1BYM A;  5KYY B;  2QDY B;  3LH5 A;  2ART A;  2FHD A;  3AT1 B;  3HRT A;  3ULR B;  1Q86 R;  1HXD A;  1H3H A;  2D8J A;  5HY6 A;  1K4U S;  4LD6 A;  2QA4 Q;  1Y57 A;  4TVY A;  5GMK i;  2DVE A;  3SFM A;  3JCM J;  4J9B A;  1YCS B;  4X1V A;  1NJ8 A;  2KBT A;  3S3O A;  4OLF A;  4RTW A;  2QHV A;  4XEO A;  2QK0 A;  3VS1 A;  1M90 C;  1NYR A;  3HFZ A;  2OTJ Q;  3CCU A;  2MI6 A;  2LTO A;  5KE3 A;  2DDZ A;  3GNG A;  2A3L A;  3OQ5 A;  1VQL T;  2D0N A;  2KXC A;  4GLM A;  1NEG A;  4ELZ C;  1VQO Q;  2DEU A;  1H4Q A;  2KT1 A;  5I2S A;  1YGB A;  1AOJ A;  4N4G A;  1E1O A;  3HL8 A;  3KUF A;  2NUP B;  11AS A;  4LN2 A;  2JUF A;  4RTV A;  3OYA A;  2ZIM A;  2MWP A;  1TG0 A;  1LPL A;  1RAF B;  5K1P A;  1M1G A;  1PRM C;  3TEH B;  3RGL A;  1Z7N A;  2CZ7 B;  5GAN 6;  3CD6 T;  3BY7 A;  3EG2 A;  4M7D A;  3CC4 Q;  5FRM A;  4XTW A;  3CCV A;  5CVI A;  4YRM A;  3R6O A;  1SET A;  4ZGE B;  4YRF A;  5DLO A;  3M55 A;  3NET A;  2KAF A;  2RHS B;  1TOV A;  3JCM g;  4BUG A;  3RIR A;  4XTX A;  2C8M A;  3G7Z A;  3A5Z A;  3CCJ T;  2XTI A;  4N4I A;  3UF4 A;  2DIG A;  1SEM A;  4HWP A;  4XTZ A;  2XDP A;  2W10 A;  2I4M A;  4PJO G;  4XU0 A;  4F14 A;  2M16 A;  4Y28 E;  1R77 A;  1ZUU A;  1QE0 A;  4P73 A;  1WLP B;  1RL2 A;  3QYH B;  3QSU A;  1B7Y B;  4M75 G;  9ATC B;  3JB9 J;  2RQT A;  4J9E A;  4Y91 A;  4JDS A;  1OPK A;  2AKW A;  3VS2 A;  1VQM A;  4MDW A;  1K9M R;  1BBW A;  1HSQ A;  4M77 G;  1IHW A;  4J9G A;  3G4S A;  4JZ3 A;  3MQZ A;  2MCN A;  8ATC B;  4K87 A;  4OGC A;  3TQ7 P;  2M1H A;  3BFM A;  1WZO A;  2KRO A;  1NPR A;  2H8H A;  2P0K A;  1NG2 A;  3PNW C;  1Q7Y U;  2X35 A;  2V8I A;  4C92 C;  3I5R A;  3SEM A;  2E70 A;  2CH4 W;  4TVW A;  2DEQ A;  4OF1 A;  5IHI A;  3VS3 A;  3JV3 A;  2NLU A;  4YRE A;  2C7I A;  4HVU A;  2K3B A;  3A98 A;  1WPY A;  4LDX A;  1PSE A;  3A7U A;  2XG8 D;  2YUP A;  3GBQ A;  4ZN3 A;  3VS0 A;  8AT1 B;  1ASY A;  3UA6 A;  5IAY A;  4M77 F;  3V7C A;  1VQL A;  3I56 Q;  5KYU A;  1YI2 Q;  4PJO D;  2EQU A;  3FB9 A;  5FRO A;  1X6B A;  2GFU A;  2CP5 A;  1VQ4 A;  4P72 A;  1UHF A;  4CH6 A;  3EGU A;  1USY A;  4M75 D;  2VYT A;  5L8R E;  4UP7 A;  5CQX A;  3LC0 A;  2RK1 A;  3TRE A;  1F1B B;  2EVR A;  1D1C A;  2JT4 A;  2DO3 A;  4J6X A;  3L2V A;  1GFC A;  2FPE A;  3JCM W;  1QCF A;  3CC2 Q;  1WGS A;  2ZPF B;  4CH4 A;  3QG1 A;  3NEM A;  3RMQ A;  5GAO n;  2FZG B;  3L2Z A;  3LGL A;  3CXC S;  1TS9 A;  1Z9Q A;  5IH2 A;  3CPW S;  1VQP Q;  3QII A;  1WI7 A;  5LJ5 e;  3BE3 A;  3EGX A;  1M1K C;  3OSV A;  3HRI A;  2MK5 A;  2KRM A;  3CCJ A;  3OYJ A;  2EJ9 A;  1BK2 A;  3IKM B;  4CI0 C;  1W2B P;  4CH5 A;  2LQ8 A;  1O75 A;  1OX9 A;  2QEX Q;  4IIM A;  4G84 A;  2XHC A;  2X3W D;  5FLX E;  2ZXF A;  2QHS A;  2ZCE A;  3VQX A;  3G1Z A;  4P3N A;  1D3B B;  2M0O A;  4IUQ A;  2HD0 A;  3HRK A;  4YRI A;  1LCK A;  3RKY A;  3WXM B;  2ATC B;  2F2X A;  1MV0 B;  3CPF A;  3QDF A;  1VUB A;  4UP8 A;  4EMK A;  5GAO m;  3FC3 A;  5AYF A;  2QI2 A;  1M3A A;  4PG3 A;  4M78 E;  3KFU A;  2VVK A;  3V8K A;  3M4P A;  5LJ5 d;  2G3R A;  1VQK Q;  2CP2 A;  1FMW A;  3KBG A;  1YFR A;  3M0S A;  3VS5 A;  3OS5 A;  2E5A A;  2YUO A;  4K86 A;  4KUI A;  1SES A;  3CCS A;  1QWF A;  2ZZG A;  1RI9 A;  5CAI A;  4RTT A;  4DPG A;  3WVD B;  4C0D B;  5IXF A;  5A0D A;  3H6Z A;  5J39 A;  2EGE A;  4P3P A;  1WQW A;  1RI0 A;  2DYI A;  4PJM A;  1U06 A;  4JRK A;  4WJ4 A;  5D6X A;  5LJ5 f;  2DTI A;  4L87 A;  1RIQ A;  1NYQ A;  1WLE A;  2CH4 A;  2JMA A;  3JB9 G;  2ZZD A;  4ZTF A;  2CKK A;  2IPO B;  1YJ9 T;  1VQ7 Q;  4JUV A;  2Q7G A;  4O2D A;  4RUG A;  2H3J A;  3FEO A;  1ASZ A;  7AT1 B;  1W2B A;  2PU9 B;  5GAO l;  2VUB A;  4KRT A;  1GXI E;  1I5O B;  1B07 A;  4ZNX A;  2AZV A;  4M78 F;  5LJ3 h;  1B34 A;  1E7O A;  4TWA A;  1VQ5 T;  4ORZ A; 
#chains in the Genus database with same CATH homology
 4X5O A;  2CJ9 A;  3P8V A;  2ZPI B;  3GNF B;  2I2L A;  3F70 A;  3PT9 A;  4J8O A;  4BY6 B;  4C8Q G;  3JB9 F;  2LCL A;  2ALY B;  1PYS A;  3QYG B;  1Z7M A;  2JN0 A;  3QDR B;  2EFI A;  1QP2 A;  4JS5 A;  1KQ2 A;  3RAC A;  4XU2 A;  3MEA A;  4FL6 A;  5GAN 5;  3UGQ A;  4YDQ A;  3M4Q A;  2RHU A;  3JCM h;  4XAX B;  1SER A;  2V8K A;  2E64 A;  1YFT A;  2GFA A;  4BD3 A;  4C0D C;  3EAE A;  3M5A A;  1E1T A;  4OB3 B;  4N0A A;  1X6O A;  3ICA A;  4M77 B;  1N8R C;  3WVE B;  1WU7 A;  4XK8 E;  4C8Q F;  2E10 A;  1U1T A;  4IUU A;  4BI3 A;  2DIQ A;  4A54 A;  3HXV A;  4E7J A;  4XTV A;  1Y71 A;  4P74 C;  4C5E A;  3DB4 A;  2FYK A;  4BDZ A;  5GMK l;  4P5N A;  2LDM A;  2HBP A;  3VU3 C;  1K73 C;  4C8Q D;  2RHX A;  2P0L A;  2KMT A;  2A7Y A;  4ZIB A;  4A4H A;  2I4L A;  3X25 B;  4HT8 A;  4KQE A;  5KCH A;  3QO7 A;  5CKB A;  4C92 E;  3FJP A;  5EG2 A;  4BY6 C;  3J7A F;  2K2V A;  2VXE A;  12AS A;  3REX A;  2OTL T;  3TEE A;  1YJ9 A;  1KQ1 A;  4YRG A;  4IKF A;  2E41 A;  4OMF B;  3ER0 A;  1WJQ A;  4C92 G;  1YI2 T;  3CME T;  1J5W A;  1JJC A;  1LNX A;  3M58 A;  1VQ5 A;  4FT4 A;  1VIE A;  4J6Y A;  4E7L A;  4EMK C;  4MML A;  2J3M A;  3M4Y A;  4Q15 A;  2DXU A;  2Q7E A;  2RHQ A;  3HTZ A;  1UGS B;  3CEY A;  1UEB A;  3CCR A;  4B9W A;  1DJ7 B;  2RJF A;  5FU6 B;  1JB0 E;  2XU8 A;  1K9M C;  3LSS A;  4HWO A;  4C92 F;  1OZ3 A;  4TVA B;  2EYQ A;  2PVG B;  5D6Y A;  3E9H A;  2X4W A;  4H2Y A;  5ELO A;  2ZPG B;  2WSF E;  4LD9 K;  2F69 A;  1EIY A;  3NFC A;  4XTU A;  4YRL A;  1NZ9 A;  1ADJ A;  1KC8 C;  3OBW A;  3NEN A;  4RQE A;  4ME7 A;  4X9D A;  4M78 B;  3MF2 A;  4ATO A;  2KQW A;  1WYD A;  4UPA A;  3CBM A;  1L0W A;  5LJ5 j;  1Y96 A;  3WQZ A;  4M7A A;  2EQJ A;  3OS2 A;  4V2S A;  3L2R A;  5GMK h;  4HVC A;  2IY5 B;  1Q81 C;  1N9R A;  4UP9 A;  3OB9 A;  4M7D E;  2CJA A;  3A7A A;  2ARU A;  3DSQ A;  3QO5 A;  5FU6 C;  2ODR D;  2LC4 A;  2OTL A;  3OS1 A;  3SWN A;  1MHN A;  4OP0 A;  2P4T A;  1YJN T;  3OYL A;  3CME A;  4N0A C;  4KR3 A;  5GAM h;  3JCM c;  1H4T A;  2RM4 A;  1B70 B;  5C6S A;  4XU3 A;  4H2X B;  3LWI A;  2DQ0 A;  2HQX A;  3QKJ A;  2RK2 A;  3TEH A;  2PQW A;  3UPU A;  2DAQ A;  2QHU A;  3LH0 A;  2K57 A;  1YJW A;  2K5F A;  3G71 T;  1NPP A;  3HXX A;  2L8D A;  1H4V B;  4X34 A;  2RHS A;  1IRE B;  4DA4 A;  1VQN T;  1TH7 A;  3OYK A;  2LT1 A;  2XI9 A;  1R8O B;  3C12 A;  1VQ6 T;  4II1 A;  3VYH B;  1VQ8 T;  3W3S A;  1HK9 A;  5A0G A;  2LT4 A;  4ZGJ B;  2ZTG A;  3LGF A;  4QVD A;  5GAN 7;  2FL7 A;  4C0Z A;  1B7Y A;  3CCE T;  4J7I A;  2DD5 A;  4H02 A;  3PZC A;  4NOY A;  2RO0 A;  5J26 A;  4YRQ A;  2DPP B;  3ZEH A;  2RJC A;  2AMC B;  1XNI A;  1NJI U;  5GAN 2;  4C92 B;  1UGQ B;  3QPH A;  3HXW A;  3L4G B;  4C0G A;  3AHU A;  2PVD B;  4C5H A;  1YJN A;  3M53 A;  4XTY A;  4BAC A;  2DQ3 A;  5GAN e;  3P8Y A;  3PCO B;  3DLL A;  5C51 B;  5CQY A;  1X2H A;  2EJG A;  1G5V A;  1ATI A;  2HNI A;  4YRR A;  2CJB A;  5HGQ A;  1YIT T;  1Q7Y C;  2R5A A;  3CCQ T;  3I55 T;  1LJO A;  5E3I A;  4KBM B;  2R57 A;  2K5I A;  2MWO A;  3KXT A;  1M90 U;  2LQK A;  5C53 B;  2PME A;  2CZ1 B;  4M7A C;  3G71 A;  1QVF A;  1MGQ A;  1EFW A;  3E9F A;  4Q5W A;  4H2S A;  1VQN A;  2RD1 A;  3A31 A;  4CS3 A;  5GAN d;  4RMO A;  4WJ3 M;  3GPL A;  4YYE A;  3FLG A;  2EL9 A;  4PLI A;  3ME9 A;  1VQ6 A;  4AH6 A;  1VQ8 A;  4LVL A;  3S6W A;  3X20 B;  3RKX A;  1D3B A;  2A8E A;  3JB9 I;  4KUD K;  2HQE A;  2JTM A;  3V7S A;  1BKB A;  2RHY A;  3CCE A;  5GAN f;  2ZZE A;  4TTV A;  3OYD A;  2DKG A;  2CZ0 B;  4OVA A;  5J3B A;  1S72 T;  2RJD A;  3E9I A;  4B9X A;  1Q82 U;  4YPF A;  2VGM A;  3E9G A;  1KOG A;  1AHJ B;  4M7D B;  2XD0 A;  4EPC A;  2Q5H A;  3VKI A;  4M77 D;  1EVL A;  1YCY A;  5C52 B;  4BW9 A;  3EFR A;  3INZ A;  4LVI A;  3CD6 A;  4CRI A;  4YRK A;  5FRN A;  2KY9 A;  2GQV A;  4LDU A;  4Z02 A;  5HKC A;  3R07 A;  3OYM A;  2L3R A;  2LX9 A;  4C0F A;  1YIT A;  3CCQ A;  3I55 A;  3L1A A;  3REU A;  3QJ6 A;  5CCA A;  4A4G A;  3NTI A;  1WNL A;  5CR2 A;  3HY0 A;  4EO4 A;  5KE2 A;  4FM4 B;  3PGG A;  2AKW B;  1QP3 A;  1JRI A;  2ARS A;  1BI1 A;  1HC7 A;  3QUI A;  3VUB A;  2DZ9 A;  1EOV A;  3PFS A;  1YHQ T;  5LJ5 g;  4ELY C;  3ASK A;  3QHS A;  4PJO A;  4F7U E;  4YRO A;  2E1H A;  3JCM P;  4M75 A;  4M7D C;  2P0P A;  3RER A;  3IAL A;  4M78 G;  4M77 A;  3OW2 S;  4F7U G;  3BDU A;  3HHT B;  3DKM A;  2QA4 T;  3TUP A;  1N27 A;  4X9C A;  2DZC A;  3L2U A;  2O4X A;  2OTJ T;  4D6W A;  3HY1 A;  4P75 A;  3E19 A;  4O5V A;  2X4Y A;  2ZGW A;  4G85 A;  1VQO T;  1G51 A;  2EQM A;  2XGT A;  2JTF A;  3ERR A;  4FT2 A;  4F7U F;  4P73 C;  2PVO B;  4QQ6 A;  5GMK m;  1X54 A;  5GAM d;  3C94 A;  4MZP A;  2ZNI A;  1JJ2 A;  4M78 D;  3CC4 T;  2ZNJ A;  1NJ6 A;  3LYI A;  1I8F A;  4FIB A;  3MP6 A;  4BE2 A;  3QZ5 B;  3JSC A;  2PUK B;  1QF6 A;  4QVC A;  4UC4 A;  1VIF A;  3RUX A;  3L42 A;  4HWT A;  2ZT8 A;  3JB9 D;  3M57 A;  2BIV A;  3A8M B;  1E22 A;  4EMK B;  3RES A;  3VUZ A;  3BJU A;  3OMC A;  3ZFJ A;  1BI0 A;  2E3C A;  2VGN A;  4P72 C;  1YHQ A;  4M7A E;  1USY C;  4CS2 A;  2ZIO A;  2KVQ G;  3S3M A;  3RF1 A;  3N5B B;  1ZHI A;  5GAN j;  1VQZ A;  3OYH A;  1O9S A;  2JZ2 A;  3VV0 A;  3PIO A;  4DOV A;  4YRJ A;  3A8O B;  1WQ7 A;  4J5Y A;  1NNH A;  4E7K A;  1XTD A;  3FDR A;  3GF5 A;  1KD1 U;  4P71 A;  1WJS A;  3GP8 A;  2QA4 A;  5IN1 A;  4YRT A;  3HP9 A;  1ZBX A;  1FX7 A;  4PNO A;  5F5W A;  4E47 A;  1OZ2 A;  3QTC A;  4LDW A;  2OTJ A;  2E12 A;  1B34 B;  1G3T A;  1OI1 A;  3QNE A;  3TEG A;  2EAY A;  3I56 T;  4YRC A;  1Q86 U;  4TQF A;  1VQO A;  2IY5 A;  4M7A F;  2K3Y A;  4R56 A;  2XDD A;  1Y7X A;  3OSS C;  5I2M A;  4CS4 A;  3P8B B;  1PYS B;  1M1F A;  3OD1 A;  1B76 A;  4LVJ A;  2QQS A;  4PJO C;  4QW2 A;  3M9Q A;  3CC4 A;  4L6V 5;  4DQ2 A;  3OMG A;  3A5Y A;  1LOJ A;  4M75 C;  1EVK A;  4KR2 A;  3CC2 T;  1KHC A;  3BW1 A;  1P92 A;  3CXC A;  1VQP T;  4TQD A;  4C8Q A;  2CYZ B;  5FU7 C;  3PIP A;  1BIA A;  2X4J A;  2RB6 A;  2QEX T;  5CKD A;  4C92 D;  5HK3 A;  1X75 C;  5IT9 E;  4FSX A;  2DTH A;  2XID A;  4IUV A;  1KQS A;  2C06 A;  2J3L A;  5DLQ E;  2GCX A;  2VXF A;  4A4K A;  2IVW A;  4JRQ A;  4A4F A;  4F7U B;  5GAO p;  2KK4 A;  1M9S A;  5LJ5 h;  3OYB A;  1VQK T;  4NCX A;  5CK9 A;  1KHI A;  4EDU A;  4BI4 A;  1G3S A;  4GY5 A;  5GAN 4;  2Q5I A;  3T9N A;  1K8A C;  1M4Z A;  1K9M U;  3VBB A;  3H8Z A;  2QQA A;  4M7D G;  3I56 A;  1YI2 A;  2FB7 A;  4YCW A;  3QO8 A;  1C0A A;  1VQ7 T;  2RHQ B;  4EMG A;  4ZN1 A;  3LLR A;  2PUO B;  2B8A A;  4BI8 B;  1YIJ T;  3DLM A;  1I4K 1;  3PTA A;  4WF2 A;  4C92 A;  3FIF A;  2O01 E;  3L4G A;  2WSC E;  3MO8 A;  2DJZ A;  4PKC C;  3MP8 A;  4L5G A;  4YRN A;  3X24 B;  4M7D F;  5LL6 S;  3CC2 A;  2K3X A;  4HCC A;  3JCM X;  1EIY B;  3PCO A;  3HSB A;  2IG0 A;  1VQP A;  3CCM T;  3O8V A;  3V7R A;  4P71 C;  2ZT6 A;  2DK3 A;  3A32 A;  2ZR3 A;  2QEX A;  4Q6G A;  4ZGD B;  1G5H A;  1GGM A;  2DU5 A;  4CH3 A;  3MEW A;  4DOW A;  1VQ9 T;  2XKO C;  4A53 A;  4P3O A;  1Y96 B;  4XU1 A;  4M7A B;  3UDC A;  2ZR2 A;  2EKO A;  2Y90 A;  4E51 A;  1UGP B;  5LJ3 e;  4YCU A;  4HWS A;  1VQK A;  3JAM E;  4JLI A;  4YCV A;  4HWR A;  1PSF A;  4H2W A;  2EQK A;  1H3Z A;  2R5M A;  3C4S A;  1N9S A;  4JLG A;  1E24 A;  1YBY A;  3V8L A;  3SWN B;  4HCZ A;  2RI5 A;  1W2B S;  3A74 A;  5CKF A;  4LVM A;  2ZPH B;  4C8Q C;  5LJ3 g;  2RA2 A;  1SRY A;  5LJ3 d;  4PL6 A;  1VQ4 T;  3JCM e;  4KUL A;  3JCM V;  2F5K A;  4LNS A;  1VQ7 A;  4LDV A;  2L5Q A;  1Y07 A;  3CBO A;  3HXU A;  2M9U A;  1JJ2 S;  2I4O A;  1IZ6 A;  1YIJ A;  3JRZ A;  3M56 A;  5CO7 A;  1BI2 A;  2DXB A;  4QQG A;  1EIF A;  2RI2 A;  2DD4 A;  5LJ3 f;  4PJO E;  3JCM d;  5A2Q E;  2YHT A;  4K88 A;  4NL3 A;  5GAN g;  3CCM A;  1G5I A;  4E7H A;  4M75 E;  2DTO A;  2VC8 A;  3MEU A;  1Q82 C;  3L2W A;  1W66 A;  1YFS A;  4M77 E;  3VYG A;  3RKW A;  3HFV A;  3DB3 A;  3UFG A;  3V8J A;  3J80 E;  4BDY A;  5A0L A;  3L2Q A;  2L89 A;  5I21 A;  4XQ3 A;  3SWN C;  3HFO A;  2EJF A;  1VQ9 A;  3HFZ B;  3S3N A;  2WSE E;  3JCM f;  3SD4 A;  2DU7 A;  2JOY A;  1V29 B;  3CBP A;  5C0M A;  1X56 A;  3E1S A;  4RMF A;  3VQW A;  3OYG A;  2F5T X;  3M54 A;  3CCS T;  2QQR A;  3HXY A;  3MF1 A;  4EMH A;  3QBY A;  4PJO F;  4E7I A;  3MEV A;  4IUT A;  5DM7 R;  3A7R A;  1WJR A;  2E6Z A;  4GLK A;  4M75 F;  4OB2 B;  1QVG A;  3QJY A;  5K1X A;  1X55 A;  3CCL T;  2MAM A;  1YB3 A;  2XDB A;  2CIM A;  2XK0 A;  5DY9 A;  5GAO q;  3JB9 H;  4P74 A;  2CZ6 B;  1H4S A;  3A5Z B;  3MCA B;  4QVZ A;  4H2U A;  1G3Y A;  2DXT A;  1U1S A;  4HT4 A;  3PMI A;  3M59 A;  3VJP A;  5GAN 8;  3UH0 A;  4RKU E;  3OYC A;  2YLC A;  3UGT A;  3M4G A;  5ELN A;  3P8H A;  1N6A A;  3TCJ A;  3HRS A;  3GIB A;  2ODR C;  3OYY A;  4OB0 B;  4A4E A;  2QQB A;  4YRP A;  1BI3 A;  2FVU A;  4LDY A;  4JRP A;  1UB4 A;  1XOV A;  4KT0 E;  4LVK A;  2ALY A;  3A8H B;  3HPW A;  1JBM A;  5GMK e;  1QW1 A;  1KQS S;  4HCB A;  1SSF A;  4MZM A;  3PMT A;  3RMS A;  5KCO A;  2OAU A;  3SB2 A;  4N4H A;  3G6E T;  4BB7 A;  4MMK A;  4RDX A;  2Y4X A;  4RQF A;  2P0Q A;  5GAM e;  1NJ1 A;  1M1K U;  3IG2 A;  1S72 A;  2G4C A;  1HTT A;  1NJ5 A;  4YTL A;  2Q7H A;  2ZIN A;  2LCC A;  4BWA A;  1H64 1;  3SDZ A;  3CCL A;  2AHJ B;  3NEL A;  3HFN A;  5GAM g;  1ADY A;  1OYX A;  1U8R A;  1B8A A;  1X2G A;  4C8Q E;  2EWN A;  4JS4 A;  5LJ3 j;  2XIC A;  4HKE A;  1FYF A;  3MET A;  5HK0 A;  1QVP A;  2ZT5 A;  2YLB A;  2D0Q B;  1KMN A;  3OYF A;  2RHI A;  1KD1 C;  2QQ9 A;  3CCR T;  1G3W A;  2KSS A;  3MP1 A;  4JJN K;  4IUP A;  4RG2 A;  5GAM f;  1BBU A;  4NS5 A;  3RL6 A;  4OB1 B;  4ZTU B;  4YRS A;  1LYL A;  4OGE A;  5CKH A;  4PJO B;  1ZQ1 A;  2ZPE B;  2X4X A;  4R55 A;  4J6W A;  4TVA A;  1Q86 C;  4M75 B;  5GAN h;  4C5G A;  1XQH A;  1I5L A;  2PMF A;  5GAO r;  3CMQ A;  3G6E A;  5KNN A;  5FU7 B;  3HXZ A;  2CGH A;  2ZZF A;  2RH2 A;  4NL2 A;  2Y4Y A;  3NTK A;  4M7A G;  4H2T A;  4RCC A;  1M8V A;  2O4X B;  2V8J A;  3GLX A;  4M78 A;  3CC7 T;  2KDS A;  4HA8 A;  3UWN A;  4F7U A;  3C95 A;  3QZ9 B;  5CIU A;  2RJE A;  4J15 A;  3MEY A;  2LNV A;  2RI3 A;  1KG1 A;  4IUR A;  3OS0 A;  3A8L B;  1N8R U;  3X26 B;  2HAX A;  2E5Q A;  2MF2 A;  3CMA T;  2JVV A;  3A8G B;  4XEM A;  1FWZ A;  4ZTZ B;  4M7A D;  2D6F A;  1K73 U;  4VUB A;  1FXX A;  3IKL A;  3JCM b;  2R58 A;  1EQR A;  4M77 C;  4C5I A;  4BE1 A;  2K5L A;  4ZTJ A;  3TU4 K;  3CPW A;  1B70 A;  2ZT7 A;  5CKE A;  1QVF S;  3HKS A;  4H2X A;  3OYN A;  3MHX A;  1M5Q 1;  1YJW T;  2RHZ A;  5KH6 A;  3FRN A;  4HT9 A;  3LWH A;  2BUD A;  4YP0 A;  2LRQ A;  1NJ2 A;  4PHC A;  1BIB A;  1X01 A;  4P75 C;  3LX7 A;  1UGR B;  3NTH A;  3P8D A;  2WAC A;  2MMP A;  3UT1 A;  1KMM A;  3OBY A;  3GOX A;  3URG A;  3J81 E;  2NS6 A;  2ZCF B;  4WI1 A;  1NE8 A;  3QO3 A;  1N9W A;  3OYE A;  4RCB A;  4BE0 A;  2ZPB B;  4RG8 A;  1W4S A;  2JNG A;  2QTX A;  3CCU T;  3OYI A;  3OW2 A;  2QXF A;  3CC7 A;  4H2V A;  5GAN 3;  3EFS A;  2E6N A;  1JJC B;  2GF7 A;  1QVG S;  5GMK j;  4FU6 A;  4QQD A;  1IL2 A;  2EIF A;  3BDL A;  3HRU A;  3X28 B;  4MZT A;  1KC8 U;  2QHT A;  2LVM A;  2YRV A;  4L59 A;  4EX5 A;  2K4Y A;  2D9T A;  4JRI A;  2AMC A;  3CCV T;  4J7F A;  3CMA A;  4O6J A;  3JCM Q;  2E65 A;  5GAM j;  3VQV A;  4C8Q B;  4J83 A;  3Q1J A;  3I7F A;  2VV5 A;  1Q81 U;  3QXE B;  3OY9 A;  2P5I A;  5M9O A;  2CS7 A;  3LSQ A;  1NJI C;  4M7D D;  5D6W A;  3OA6 A;  3P8T A;  4M78 C;  3LW5 E;  4MDX A;  3ZBD A;  1K8A U;  4PLL A;  4TVR A;  2DXC A;  3VQY A;  1VQM T;  2I4N A;  1I81 A;  3G4S T;  1BYM A;  2QDY B;  2ART A;  2FHD A;  3HRT A;  1HXD A;  5HY6 A;  4LD6 A;  4TVY A;  5GMK i;  2DVE A;  3SFM A;  3JCM J;  1NJ8 A;  3S3O A;  4OLF A;  2QHV A;  4XEO A;  1M90 C;  1NYR A;  3HFZ A;  3CCU A;  2MI6 A;  2LTO A;  5KE3 A;  2DDZ A;  2A3L A;  3GNG A;  3OQ5 A;  1VQL T;  4ELZ C;  1H4Q A;  5I2S A;  1YGB A;  4N4G A;  1E1O A;  3HL8 A;  3KUF A;  11AS A;  2JUF A;  3OYA A;  2ZIM A;  2MWP A;  5K1P A;  1M1G A;  3TEH B;  3RGL A;  1Z7N A;  2CZ7 B;  5GAN 6;  3CD6 T;  3BY7 A;  4M7D A;  5FRM A;  4XTW A;  3CCV A;  5CVI A;  4YRM A;  3R6O A;  1SET A;  4ZGE B;  4YRF A;  5DLO A;  3M55 A;  3NET A;  2KAF A;  2RHS B;  3JCM g;  4BUG A;  3RIR A;  4XTX A;  2C8M A;  3G7Z A;  3A5Z A;  3CCJ T;  2XTI A;  4N4I A;  2DIG A;  4HWP A;  4XTZ A;  2XDP A;  2I4M A;  4PJO G;  4XU0 A;  2M16 A;  4Y28 E;  1QE0 A;  4P73 A;  1RL2 A;  3QYH B;  3QSU A;  1B7Y B;  4M75 G;  3JB9 J;  4Y91 A;  4JDS A;  2AKW A;  1VQM A;  4MDW A;  1BBW A;  4M77 G;  3G4S A;  3MQZ A;  4K87 A;  4OGC A;  2M1H A;  3BFM A;  1NPR A;  2P0K A;  3PNW C;  1Q7Y U;  2X35 A;  2V8I A;  4C92 C;  2E70 A;  4TVW A;  2DEQ A;  4OF1 A;  2NLU A;  4YRE A;  2C7I A;  1WPY A;  4LDX A;  1PSE A;  3A7U A;  2XG8 D;  4ZN3 A;  1ASY A;  5IAY A;  4M77 F;  3V7C A;  1VQL A;  4PJO D;  2EQU A;  3FB9 A;  5FRO A;  2GFU A;  1VQ4 A;  4P72 A;  4CH6 A;  1USY A;  4M75 D;  2VYT A;  5L8R E;  4UP7 A;  5CQX A;  3LC0 A;  2RK1 A;  3TRE A;  2DO3 A;  4J6X A;  3L2V A;  3JCM W;  1WGS A;  2ZPF B;  4CH4 A;  3QG1 A;  3NEM A;  3RMQ A;  5GAO n;  3LGL A;  3L2Z A;  3CXC S;  3CPW S;  3QII A;  5LJ5 e;  3HRI A;  1M1K C;  3OSV A;  3CCJ A;  3OYJ A;  2EJ9 A;  3IKM B;  4CI0 C;  4CH5 A;  2LQ8 A;  1O75 A;  4G84 A;  2XHC A;  5FLX E;  2ZXF A;  2QHS A;  2ZCE A;  3VQX A;  3G1Z A;  4P3N A;  1D3B B;  2M0O A;  4IUQ A;  2HD0 A;  3HRK A;  4YRI A;  3RKY A;  3WXM B;  3CPF A;  1VUB A;  4UP8 A;  4EMK A;  5GAO m;  3FC3 A;  5AYF A;  2QI2 A;  4PG3 A;  4M78 E;  3KFU A;  3V8K A;  3M4P A;  5LJ5 d;  2G3R A;  3KBG A;  1YFR A;  3OS5 A;  2E5A A;  4K86 A;  4KUI A;  1SES A;  3CCS A;  2ZZG A;  5CAI A;  4DPG A;  3WVD B;  4C0D B;  5A0D A;  3H6Z A;  5J39 A;  4P3P A;  1WQW A;  1RI0 A;  4JRK A;  4WJ4 A;  5D6X A;  5LJ5 f;  2DTI A;  4L87 A;  1RIQ A;  1NYQ A;  1WLE A;  3JB9 G;  2ZZD A;  4ZTF A;  2CKK A;  1YJ9 T;  4JUV A;  2Q7G A;  4O2D A;  2H3J A;  3FEO A;  1ASZ A;  1W2B A;  2PU9 B;  5GAO l;  2VUB A;  1GXI E;  4M78 F;  5LJ3 h;  1B34 A;  4TWA A;  1VQ5 T;  2BKD N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...