3RUXA

Crystal structure of biotin-protein ligase bira from mycobacterium tuberculosis in complex with an acylsulfamide bisubstrate inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords BirA bifunctional protein
publication title Bisubstrate Adenylation Inhibitors of Biotin Protein Ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ruxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ruxA01
2Q7GA 5ELNA 1H4TA 1PYSA 2PMEA 4K86A 3QO7A 4YRNA 2EWNA 1NNHA 4F7UF 3QO5A 4WI1A 3JB9I 1X2HA 2QHTA 5C53B 3V8JA 4X5OA 3HSBA 1J5WA 4ZTZB 3BDUA 3QO3A 5GMKh 2ZINA 5LJ3e 3LC0A 3FIFA 4M78B 4M7AB 4H2VA 3NETA 2DVEA 4DQ2A 3JCMb 1EQRA 4M7DC 4RMFA 5LJ3j 4C92G 2ARUA 2EL9A 2E41A 1EFWA 3TEHA 4P3PA 4PJOC 4XQ3A 3QTCA 4M75C 2ZZEA 3TUPA 1USYC 4M77A 4HWSA 3MF2A 1RIQA 5ELOA 3V8KA 3L2ZA 3IALA 4CS2A 1ADYA 4H02A 1W66A 4H2XB 1M5Q1 1WNLA 1EIYB 4J15A 1L0WA 3JCMQ 4P75A 1WPYA 3UGQA 2XTIA 3M4PA 1LYLA 3VU3C 4C8QG 3SWNC 1TH7A 1YFRA 3RKYA 4M7DD 1GGMA 3AHUA 3A32A 1KQ1A 2CJBA 1B8AA 2AKWA 1H4SA 2VXEA 4TQFA 5GANe 4G85A 4C8QA 4UP9A 3HFVA 1B34A 3RF1A 2IY5B 5GAMg 1PYSB 1WLEA 3LSSA 5CAIA 4C92C 5GMKm 3A74A 4P72A 1SERA 1HK9A 3E9IA 3JCMg 4M78G 5GAMd 4M7AG 3REXA 4M77E 4N0AA 1Y96A 3M4GA 4YRPA 3VQVA 2RHQA 3FB9A 4M7AA 4XTVA 3ICAA 5GAN6 4TVYA 4ZIBA 4G84A 1EOVA 3HXVA 2PMFA 1H641 3RACA 4EO4A 4C92D 5LJ5g 2HNIA 1I8FA 2QTXA 4J6XA 3TEHB 4YRIA 4P73A 4P71C 3JCMf 2ODRC 2ZXFA 2ZTGA 2ZT6A 4M77B 3HXXA 3VQXA 5LJ5d 1D3BA 3IKMB 3RESA 2Q5HA 1KMNA 4O2DA 3CMQA 2DU5A 1WQ7A 2ZT5A 1HC7A 2G4CA 3KFUA 5DY9A 3HXWA 2RM4A 3REUA 3NELA 4UP8A 4M7DF 5C51B 3QSUA 2AKWB 2Q7HA 3W3SA 3V8LA 2I2LA 1HXDA 1SESA 4QVDA 3VBBA 1FYFA 2DQ0A 4P74C 2DZCA 4C8QB 3HRIA 2YLBA 2ZT8A 3VQYA 4WF2A 4J6WA 1KMMA 1B34B 3FJPA 3PCOA 3HFOA 1N9RA 3R07A 1B7YA 1YCYA 3JCMc 4JUVA 1ASYA 4TWAA 1KOGA 1U1SA 4EMGA 3BY7A 4M78D 4M7AD 4PG3A 3UFGA 3L4GA 1SETA 1Y96B 2ARSA 2ZCEA 4K87A 1X01A 5F5WA 2ZZGA 3E9HA 5GAOm 4HWPA 3HFZA 4TVWA 2RHQB 4EMHA 3TEGA 4YRKA 5GMKe 2FYKA 1ASZA 4PJOA 2C7IA 4M75A 4YRRA 4X9CA 4M77G 5GAMh 1USYA 3V7RA 11ASA 5GAN8 1YFSA 4C92F 1YGBA 4DPGA 2K57A 3JB9J 4YRGA 1EVLA 4RCBA 5GAMe 2C8MA 5GMKj 5E3IA 4NL2A 4PHCA 2AMCA 3JCMh 4EX5A 4F7UA 1D3BB 4V2SA 1YB3A 3A31A 5GAOr 2VC8A 4HVCA 5GAMj 2VXFA 1WYDA 1H4VB 2Y90A 4XTUA 1LJOA 1NYQA 3VQWA 1NJ6A 3HY0A 4C8QF 4YRQA 5LJ5h 4P3NA 3QHSA 2DEQA 2ZR3A 3A7UA 5LJ5e 5I21A 4ZTUB 3PCOB 4PJOE 4M75E 3BJUA 4WJ3M 1X56A 3JCMW 5GMKi 1B7YB 4KQEA 1G51A 4EMKA 2ZIOA 1NJ5A 5LJ5j 2DU7A 3L1AA 5LJ3g 1QE0A 4YRLA 1U1TA 3UH0A 2RHSA 3P8VA 4P75C 1NJ8A 4M7AF 4M78F 2DTHA 2I4MA 3L4GB 4NOYA 4F7UE 4YRJA 3HY1A 4TVAA 2CGHA 3HFZB 3HXZA 4XEOA 4RQEA 2E5AA 3P8TA 3JCMd 1C0AA 1E24A 2RA2A 4P71A 4PJOB 3QO8A 4M75B 4C8QC 4M77D 2FB7A 5GAN2 3RERA 5LJ3f 2QHUA 3P8YA 4Y91A 3V7SA 2RB6A 4AH6A 4HWTA 3BW1A 4P72C 2AMCB 1NJ2A 4F7UB 2E1HA 4YRFA 2EJFA 4JRKA 4XTXA 3JB9G 3JB9F 5K1PA 1WQWA 3RGLA 1Z7MA 5HGQA 4Q6GA 2E3CA 2ZZFA 4XU3A 5KNNA 1YFTA 4C8QD 5GANg 3RKXA 4M78C 4M7AC 1KQ2A 5GAN7 2RD1A 4RQFA 1ATIA 2DTOA 2ALYA 3PGGA 3A5YA 2ZGWA 4H2WA 3HFNA 4P73C 1QF6A 4JLIA 4QVCA 4XU1A 1JRIA 5C52B 1N9SA 4XEMA 4EMKB 1B70A 4HT8A 5GANf 3I7FA 3NENA 4XTWA 2E65A 2RHSB 4J5YA 1BBUA 2I4OA 2EJ9A 4RDXA 4YCVA 2J3LA 2QHSA 4E51A 4J6YA 3IG2A 4PJOG 4TVAB 4M75G 1EVKA 2EAYA 4P3OA 4TTVA 1LOJA 2I4NA 1N9WA 4M7DA 3INZA 4K88A 3SB2A 3JB9H 4YREA 4NL3A 4YP0A 3RIRA 3HRKA 1BIAA 4WJ4A 4CH4A 4M77F 5GAOl 4CS4A 4F7UG 3RKWA 3HXUA 4CH3A 1X54A 4BWAA 3MF1A 3A7RA 4YRMA 12ASA 5LJ3h 3ERRA 3RUXA 1Z7NA 4MMKA 4LNSA 2EJGA 2CJAA 3JB9D 3IKLA 3JCMV 1MGQA 4HT9A 3SWNA 3JCMe 2ZNJA 2I4LA 2J3MA 1JJCA 3NEMA 1NJ1A 1B76A 4CH5A 3M4QA 2CJ9A 2ZR2A 1H4QA 4XU2A 4H2SA 4YRSA 3OD1A 2DXTA 2DKGA 1SRYA 2ZIMA 3WQZA 2YHTA 4A53A 2DQ3A 4UP7A 2ALYB 4CS3A 2CIMA 4M7DE 1E22A 4C92A 4YRCA 2DXUA 3A7AA 1VQZA 1G5IA 4HWRA 4YROA 4M77C 1BBWA 1B70B 2P5IA 4CH6A 4H2YA 5GAOn 3JCMX 5GANh 3JCMJ 1G5HA 4PJOD 4M75D 4Q15A 5GMKl 3EFRA 4M7DB 2JN0A 5LJ3d 5GAOp 2DDZA 2DJZA 5K1XA 1BIBA 4A54A 2YLCA 1I5LA 1ADJA 2ZT7A 3LSQA 4OLFA 3MEYA 5GANj 3HXYA 3V7CA 4H2TA 4TQDA 4KR3A 4EMKC 3QUIA 4C92E 4XTZA 3UGTA 4NCXA 5GAN4 3SWNB 5GAN5 1X55A 2XGTA 4M78A 1JJCB 5GAN3 4N0AC 5GAMf 4HWOA 4YCUA 4H2UA 1M8VA 4YCWA 4YRTA 4XTYA 1IL2A 4P74A 2DTIA 4XU0A 1NYRA 1HTTA 2E64A 1X2GA 2QHVA 3HTZA 1E1OA 3RL6A 4C8QE 1I81A 4HA8A 5GANd 4MMLA 4KR2A 4C92B 1WU7A 4YPFA 4H2XA 1EIYA 2P0LA 2ZNIA 2ARTA 5GAOq 4L87A 3JCMP 4BW9A 2Q7EA 1LNXA 5LJ5f 3QNEA 4M7DG 3GIBA 4PNOA 3BFMA 2E10A 3A5ZA 2ODRD 3DSQA 1JBMA 4PJOF 4RCCA 3EFSA 4JRIA 4M75F 3G1ZA 4OP0A 2Q5IA 4YDQA 4YYEA 4X9DA 4M78E 4M7AE 3PZCA 1I4K1 2DZ9A 4UPAA 1E1TA 2IY5A
chains in the Genus database with same CATH superfamily
2Q7GA 2BUDA 1OPKA 1UE9A 1OYXA 4F7UF 2C0TA 3JB9I 1X2HA 3MO8A 1YJ9Q 2QHTA 2LCSA 1PKTA 3OYGA 3V8JA 3CBMA 4J7IA 4X5OA 1BI2A 4ZTZB 3BDUA 5GMKh 3LC0A 3FIFA 4M7AB 2GTJA 3VS2A 3NETA 1KC8R 1NM7A 2IVWA 1EQRA 1VUBA 4C92G 4PJOC 4XQ3A 4OB1B 1X27A 1EX4A 2HAXA 1USYC 3DKMA 1KC8U 2KVQG 4IUUA 3V8KA 3L2ZA 3OYKA 1VQKT 1GBQA 4J15A 2XTIA 3M4PA 1TG0A 3REAB 3CC7A 3OYBA 2QTVA 3RKYA 5IAYA 5CKFA 4M7DD 2A8EA 2HL5C 3AHUA 3A32A 1VQLT 1KQ1A 1ARKA 2JTEA 1U3OA 4FSXA 1MHNA 1VQ5Q 2VXEA 3OMGA 4A4GA 1G3SA 2YUPA 3HP9A 1W6XA 3CPWA 3RF1A 4JS4A 1PYSB 2IG0A 3EHQA 2X4JA 4C92C 3OS1A 3A74A 1SRLA 2LC4A 3E9IA 3JCMg 5GAMd 1Q82R 3REXA 2BZXA 2YXYA 5IXFA 4YRPA 4JPBW 1OU9A 2FRYA 1K8AR 4M7AA 4XTVA 5CKEA 1PRMC 1YJNA 1NEBA 1Q82U 1H641 2KBTA 3PIPA 4RTWA 2HNIA 1R0CB 4FYWB 4J6XA 4YRIA 3TEHB 3GLXA 3JCMf 3VS7A 3GNGA 2ZTGA 1K8AU 2BZYA 3ZBDA 4LDYA 3VQXA 1SRMA 2KXCA 1CKAA 1BCOA 4IIOA 1YBYA 2EQKA 2Q5HA 1VQPT 2V8KA 3SFMA 3KFUA 2OTJA 3REUA 4OVAA 4UP8A 3CCQQ 4QVZA 3TVTA 2P0QA 2K3YA 5C51B 1S72A 5CKHA 4P5NA 2CREA 1D0XA 2DZCA 1OZ2A 1K73C 2LNHB 2IIMA 2YLBA 3E19A 2NYSA 3VQYA 5IN1A 1B34B 1QWEA 1QCNA 3OY9A 3OMCA 1N9RA 2WACA 2YUQA 3Q1JA 4KULA 3JCMc 1QKWA 1SSHA 1KOGA 2L89A 4EMGA 2EYYA 3G6ET 2DRMA 4M78D 1BBZA 3UFGA 3QYGB 3I55Q 1IHVA 1SETA 5F5WA 1X01A 2H8HA 2RHYA 1N6AA 2ESWA 5GAOm 5KYYA 3L2WA 4OB0B 1G3TA 3PE0A 5FROA 1RL2A 3G71T 4PJOA 2LJ1A 2X3XD 4M77G 4J9CA 5GAMh 1JEGA 1USYA 11ASA 2JM9A 3E2UA 4KT0E 1U8RA 4RCBA 1VQ6Q 5GAMe 2BTTA 1FWZA 2AMCA 3PVQA 4DBQA 3N5BB 1M8MA 1AZGB 3J80E 2LTOA 5GAMj 3QDRB 2LCCA 1VQ9T 1JJ2S 1WYDA 1H4VB 2MWPA 4D6WA 4N4GA 1LJOA 3OYFA 1WA7A 4J9FA 1RUWA 1AWXA 2M02A 3UATA 4GLMA 1K9AA 1M2OA 5CKBA 1JU5C 3CCMA 1TS9A 3E9GA 3CCSQ 1X56A 1KQSP 2DIGA 1W2BP 3NTIA 5LJ3g 2A7YA 1U1TA 2RHSA 3ZEHA 3L4GB 2GFUA 4PLIA 4F7UE 3FC3A 3HY1A 3CCJA 4D8DA 2QQRA 3HXZA 4RQEA 2E5AA 1X6BA 2CUBA 4BE0A 1D1AA 3H9NA 2K5LA 2QEXQ 2V8IA 4C8QC 1YJNT 5LJ3f 2QHUA 3V7SA 2RB6A 1OX8A 3CMAT 4HWTA 2QYZA 4P72C 3F70A 4A63B 4BI4A 4F7UB 2GGRA 2W10A 4XTXA 5K1PA 7AT1B 1WQWA 2DL4A 3EFOB 3RGLA 1ZA2B 4UC4A 1HD3A 3PIOA 5HGQA 4ESRA 4BDYA 3L2RA 5KNNA 3REBB 3MJXA 1IXDA 4M78C 5HCKA 1VIEA 4J9IA 1KQ2A 1UGSB 4N4HA 4RQFA 4JS5A 1YJ9A 3RDVA 2DTOA 3PGGA 3EAEA 3A5YA 4CC7A 4H2WA 4EPCA 4P73C 2KQWA 2KRSA 4C5IA 2E5KA 3CCLQ 4QVCA 1SHFA 3X24B 1JRIA 1SF9A 2A28A 1YWOA 4E7KA 1CSKA 4EMKB 3M0SA 3CCEQ 2SRCA 1WHMA 4CC3A 1YHQT 4MDXA 1M4ZA 3OS5A 2I4OA 2MYSA 3IG2A 3HRUA 4TVAB 1EVKA 4BD3A 4BY6B 2EVRA 2IPOB 2OX7A 2DJQA 2I4NA 1N9WA 4M7DA 4NL3A 4O6JA 4YP0A 2CKKA 1QVPA 4WJ4A 2HSPA 2EGEA 2RK2A 2DL3A 2QI2A 3CXCS 4BWAA 2DMOA 2MI6A 3A7RA 1Q95G 2V1RA 2DVJA 1C6VX 4LNSA 2G6FX 2EJGA 1SSFA 2ZPEB 3JCMV 1VQ5A 1BCMA 2F69A 4HT9A 1GL5A 1JJCA 4J9DA 2XI9A 3ER0A 3OB9A 3KXTA 1VQ8T 2RNAA 2YDLA 2DXTA 2B86A 1KD1R 2JUFA 5IHNA 1VA7A 4A53A 2K2VA 2DQ3A 1K9MC 4FM4B 4CS3A 1E22A 3ZFJA 1V29B 3A7AA 5D7UA 3CCMT 1SKUB 3CCUT 1IREB 4PK4A 2EKOA 4ZN3A 4HCCA 1KG1A 1B70B 2XD0A 2BZ8A 3TCJA 2DXCA 2ECZA 2EYZA 5GANh 2DIQA 2NS6A 2XMFA 4M75D 1M90R 2D8JA 4B9XA 3PMIA 1MMDA 2K9GA 2K3BA 1KHCA 2B8AA 3LSQA 1ADJA 2HMAA 2QA4Q 3MEYA 4ZTJA 4ANJA 3OYCA 5GANj 2EQUA 1M90U 3HL8A 1QCFA 1OEBA 3CCQA 4Y92A 3PTAA 3VS0A 1ZUUA 3M0UA 3S3OA 3EG9A 4XTZA 2DYBA 1YIJQ 3T9NA 3SWNB 3CCRT 2QGFB 4M78A 1AD5A 4N0AC 4JJDA 1IB8A 2ZAEA 2L3PA 1M8VA 4XTYA 3NPFA 2DPPB 4XU0A 1NYRA 1TUDA 2E64A 1X2GA 2VWFA 1TU0B 3S3NA 1ZUYA 1QCOA 1I81A 2XHCA 1K0XA 3FEOA 4KR2A 4MMLA 2JTMA 2MIOA 3I55A 4JZ4A 3JRZA 2CP3A 1VQOQ 2ZPFB 3MEWA 4L87A 5KH6A 3JCMP 3OYIA 1LNXA 5LJ5f 3QDFA 4PNOA 2GNCA 4A4EA 3A5ZA 3QPHA 4FT2A 1UTIA 2ODRD 3GNFB 1YFNA 4PJOF 1FYNA 2EGAA 2O01E 1NLPC 3H41A 8ATCB 2D0QB 3VYGA 1E1TA 1H4TA 3QO7A 4YRNA 2EWNA 1D1BA 1NNHA 3GBQA 2KT1A 2HL3A 4A4FA 4DOWA 2V1QA 4JRQA 3OYAA 3FLGA 1JQQA 4KUDK 4ZNXA 4RTXA 1J5WA 2GQIA 2M0OA 3OYHA 1VQ7Q 1W1FA 4OGCA 3CQTA 2LT1A 2DRKA 3H0IA 1CKBA 2CZ7B 1R77A 2EL9A 1EFWA 4J8OA 2GFAA 4P3PA 4E7ZA 4M75C 2MAMA 3QJ6A 5HKCA 1EFNA 5ELOA 3IALA 3H0FA 4H02A 1PSEA 1W66A 4H2XB 2F2XA 3I56A 1EIYB 2MCNA 1SPKA 2I0NA 3JCMQ 4P75A 2COWA 3VU3C 2FG0A 1YFRA 2R57A 1GGMA 2O88A 2PTKA 2AKWA 2D8HA 4C0GA 4BE2A 2KGTA 4HVVA 2DA9A 2F1LA 4QQ6A 3GOXA 4TVRA 2IY5B 1UB4A 3A8GB 2FZGB 2RF0A 1HK9A 2DAQA 2RI2A 2ED1A 4OGEA 2F2WA 3MEVA 4RTZA 4QW2A 4M7AG 5CKDA 1BYMA 1SHGA 4N0AA 1YITT 2DBKA 1Q86C 4HCBA 1HJDA 2O9SA 4E7SA 1Z9QA 1YCSB 3CMEQ 4OMNA 3CCLA 1HYOA 2DD5A 4TVYA 4G84A 1EOVA 3HXVA 1W2BA 1ZSGA 4C92D 3ASKA 2L2PA 4HCZA 2KAFA 2ODRC 1ABQA 4BI8B 1UEBA 2VGMA 1XOVA 1B3QA 2EKHA 2A08A 4KGVB 1OPLA 5D6YA 5KE3A 3D7SB 4WTOB 2ZT5A 4HT4A 2G4CA 3NELA 3M53A 3OBWA 4RTTA 4M7DF 4AFZC 3QSUA 2Q7HA 1MMGA 2LCLA 3V8LA 4BACA 1SESA 3UPUA 1FYFA 1FMKA 1WGSA 3HRIA 4QKUA 4WF2A 1KMMA 3FJPA 2DEUA 3HFOA 3MKDA 1RAAB 4ELZC 2NWMA 4FYXB 3CCVT 4TWAA 1U1SA 2MOXA 2E4HA 3C95A 1B7TA 1YJWQ 2COZA 1KC8C 4DBHA 2G3RA 4K87A 2ZZGA 2GCXA 4RG2A 3HFZA 4TVWA 2FZCB 1EZZB 1M1KU 3TEGA 5D6XA 5FU7B 1ZSZC 1RAHB 5GMKe 2FYKA 2KRNA 1ASZA 2C7IA 4M75A 4DPGA 1YGBA 3JB9J 4PJJA 2FZKB 4YRGA 2RHIA 1VQMQ 5GMKj 2RO0A 4NL2A 3KFVA 3JCMh 3GPLA 3M56A 4EX5A 2CP6A 3EH2A 2KT8A 4V2SA 2RQUA 1UJ0A 1YB3A 3NFCA 2ZPIB 3VS5A 4HVCA 2VXFA 4HKEA 5IXBA 3I56T 3L42A 1S1NA 1NYQA 4DBRA 1NJ6A 3P8HA 4C8QF 1Y57A 2QA4A 2HDAA 2RQWA 2PUKB 2DILA 4YRQA 3TQ7P 1BI1A 2D0NA 4E7HA 4AG1C 2RHZA 4LUDA 1ZA1B 1OULA 5I21A 3LH5A 1ZUKA 2DK3A 2KROA 3EGDA 1Q82C 1YIJA 4PJOE 2GTOA 4FU6A 4WJ3M 3OQ5A 1QLYA 3A8LB 4KQEA 2O9VA 1G51A 5ECAA 2JTFA 2GF7A 2NUTA 1LCKA 3L1AA 1VQ4T 1ZQ1A 1QE0A 4JRPA 3P8VA 4ZN1A 2I4MA 4M78F 4Z88A 4NOYA 3DLLA 4YRJA 1NJIC 4A4HA 2CGHA 3G4ST 5KYYB 4XEOA 1WHKA 2L3SA 4FL6A 2J6KA 2JS2A 3P8TA 1C0AA 1C1AA 1E6GA 1VQOA 2JW4A 3VS4A 3NTHA 4PJOB 2PNIA 5CQXA 3QO8A 4M77D 3OYDA 3MPUB 3RERA 1AWOA 2RI3A 2AMCB 3NGPA 1NJ2A 1D0ZA 2E1HA 3JB9G 4JRKA 4LDXA 5KE2A 4GBQA 5KYUA 2NUZA 1YI2Q 5C0MA 4KBMB 4Q6GA 2PQWA 2R5AA 3CC2Q 4Z8AA 3QWYA 4R55A 4FYVB 1YFTA 1N5ZA 4C8QD 3SDZA 1G3YA 1PNJA 3PNWC 1G2BA 2OTLQ 2QG9B 3VUBA 4Z89A 2CYZB 1WXUA 3HKSA 2Z0WA 2DL5A 4J83A 4LDWA 3CD6Q 1H92A 2ZPHB 3UA7A 1WJQA 3S3MA 3A8MB 3MP8A 1N9SA 4LVIA 2K2MA 3M4YA 1VQ7A 2QDYB 2WSFE 3I7FA 1YP5A 2LRQA 5AT1B 2HSEB 5HY6A 3NENA 2RHSB 2E65A 1NG2A 1QVFP 4YCVA 2KK4A 4E51A 1ZSZA 4J6YA 2FHDA 1WXBA 1I1JA 2FVUA 3INZA 3QXEB 4K88A 4YREA 2EW3A 1Y07A 2ZPGB 4E7IA 4CH4A 5FRNA 4CS4A 4F7UG 4LNPA 5LL6S 3MF1A 4ZGEB 1KSWA 5LJ3h 3ERRA 1Z7NA 2DX1A 1GFCA 3IKLA 2A3LA 3TSZA 4FW2A 1K73U 1E6HA 3G7ZA 2I4LA 4LVJA 1NLOC 1NJ1A 3R6OA 4CH5A 3M4QA 4J9HA 4JLGA 4XU2A 3CC7T 3OD1A 1SRYA 4OMQA 1PCXA 2YHTA 2M9UA 1RI9A 1MNDA 4M7DE 3QZ9B 4C92A 2C06A 3SEMA 1UFFA 1M3AA 4X34A 2O4XA 5J3BA 1VQNA 1AWWA 4M77C 3CMEA 1OV3A 3VUZA 2VUBA 2P5IA 1Y71A 4CH6A 1O9SA 5GAOn 4E6RA 2BE7D 4C0DB 3HPWA 1AZEA 1U06A 2YUOA 2OJ2A 3EFRA 4ZGDB 4M7DB 2JN0A 5K1XA 2VGNA 5CQYA 3S6WA 2MPXC 1I5OB 2ZT7A 1W4SA 3AT1B 5M9OA 3HXYA 1MV3A 3I5RA 2EYWA 3MHXA 1I07A 1X75C 2F5KA 2AZSA 3OSSC 1WFWA 1VQKQ 4EMKC 3QUIA 3OYJA 4OMMA 2WSEE 4J7FA 1U5SA 3EG2A 5GAN4 5J39A 1JJCB 5GAN3 5GAMf 4HWOA 1QP3A 2LQWA 1VQLQ 4H2UA 4BY6C 5L8RE 2RJEA 4YCWA 1B07A 2OTJT 1TTHB 1H3ZA 1NEGA 4OB3B 4LN2A 3HTZA 1S72T 1E1OA 4C8QE 3RL6A 1T3SA 4HA8A 3X28B 5GANd 1YJWA 1WU7A 5KCHA 2WSCE 5L23A 1FMVA 2P0LA 2ARTA 2E3IA 3TU4K 4LVLA 1WHGA 4N4IA 3UWNA 2KSSA 3GIBA 3BFMA 2OI3A 2E10A 2ENMA 3DSQA 2K7AA 1JBMA 4JRIA 4M75F 2JNGA 4ZTFA 1VQMA 2Q5IA 4YYEA 4X9DA 4M78E 1UUEA 3J7AF 3PZCA 1I4K1 1A0NB 2NLUA 4CI0C 5KYNA 4K11A 1OQKA 2PMEA 4K86A 1D0YA 2NUPA 1QKXA 2H3EB 3QO5A 4WI1A 1UECA 1RLPC 2JMCA 2GBQA 5FU6B 2K5FA 4HXJA 5C53B 1VQPQ 1WLPB 3EG9B 5I22A 3PT9A 1NBEB 2R58A 3QO3A 1KD1C 4M78B 3X20B 3CXCA 2A36A 1EIFA 1M30A 4DQ2A 3JCMb 2CP0A 2ROTA 2E70A 2ARUA 1KFZA 3LX7A 1ACMB 2CT3A 3HRTA 1Q81C 1QMCA 3TUPA 4M77A 3EH1A 3EG1A 3MF2A 1RIQA 1ADYA 1ABOA 3BDLA 1M5Q1 1WNLA 1L0WA 1WJSA 3G6EQ 2XIDA 2PVOB 2AHJB 8AT1B 1JO8A 1VYUA 1VQNT 1LYLA 1BKBA 3UGQA 3X25B 3CMET 3SWNC 1TH7A 3L2VA 3QZ5B 3ZL7C 1M2VA 3OW2S 3H0HA 4Y28E 1RABB 3A5ZB 2P4RA 2CJBA 2PU9B 1B8AA 1H4SA 2HEQA 2JS0A 4TQFA 1BB9A 2AT1B 1FXXA 5GANe 3RNJA 2HZYA 4FT4A 4C8QA 3G71Q 4UP9A 3CCJT 1K1ZA 4ZGJB 5KYXA 4Z02A 3HFVA 4OB2B 2AKKA 1YI2A 3LSSA 5CAIA 5GMKm 4P72A 2EPDA 3CC2A 1BU1A 5DLOA 4LDUA 4AFUC 1Y96A 2OTLA 1WZOA 4PJLA 2M16A 3M4GA 1VQ9Q 3IQLA 2LZ6B 1K9MU 3VQVA 2RHQA 3FB9A 3ICAA 5GAN6 1H3HA 2P84A 3HHTB 3M5AA 4ZIBA 2HQHA 3P8BB 2PMFA 3CD6A 4DBFA 4C0ZA 2QXFA 4EO4A 2ZCFB 4HCKA 5LJ5g 4P73A 2CH4A 4P71C 3HRSA 9ATCB 3QG1A 4KH1B 1XQHA 2ZT6A 3HXXA 5EG2A 3DLMA 1YJ9T 4IUQA 1D3BA 3RESA 4O2DA 3CMQA 2CZ1B 2DU5A 2LT4A 2DF6A 2JOYA 3EGXA 2RM4A 1PKSA 4LVMA 1YN8A 1RAGB 3VS6A 2AKWB 2KEAA 4MZTA 3VBBA 2I2LA 1HXDA 1WX6A 1D1CA 3TSWA 2DQ0A 1VQ6A 3J81E 4P74C 1QVGS 4M4ZA 2FEIA 4J6WA 3PCOA 1GCQC 2KR3A 3R07A 1B7YA 1YCYA 1UJYA 3CMAQ 3LLRA 5AYFA 1KHIA 4ATOA 2EFIA 1NPRA 3BY7A 2KE9A 4M7AD 4XK8E 1JJ2P 4PG3A 1G3WA 2ARSA 2LX7A 1IGUA 3UDCA 2LJ0A 4HWPA 1AHJB 4B9WA 1VQ5T 5KYWA 4YRKA 3CBOA 4ELYC 2VB6A 4DA4A 4X9CA 1WJRA 3CCSA 4C92F 2FL7A 2K57A 5CR2A 1EVLA 2ZZDA 2C8MA 4GY5A 1QVFA 3C94A 4PHCA 2LQ8A 1X69A 4LE9A 3PFSA 4KH0B 3O5ZA 1WIEA 3VJPA 2CZ6B 5GAOr 2VC8A 2E6ZA 1YHQQ 5GJVB 5J26A 4XTUA 2AIRB 4LD9K 3VQWA 2JJ9A 2QEXA 3HY0A 2V8JA 1X6OA 3A1PA 3VYHB 1N8RC 2CSQA 3QHSA 1QQJA 1VQKA 3THKA 2DNUA 2ATCB 3META 4NS5A 4M75E 3BJUA 1M3CA 2O31A 3JCMW 1Z9ZA 4YTLA 1YI2T 1WHJA 3DB3A 2ZIOA 2RK1A 2DU7A 1VQLA 2RI5A 3CC2T 1YNZA 4YRLA 3UH0A 3U23A 2XG8D 4KGXB 4PFOA 3CCQT 1H8KA 1IRXA 5I2SA 3HFZB 1VQ8Q 5CCAA 2RQRA 2JXBA 3OYYA 3JCMd 2COYA 4B6MA 1E24A 2RA2A 4P71A 4M75B 1M9SA 1N27A 1PG5B 2FB7A 1PHTA 2E12A 4FCYA 1Y0MA 5FWBA 4RTYA 2QDLA 1M3BA 5D6WA 2VKNA 3WVDB 3P8YA 4AH6A 3E9FA 3CCEA 3OS0A 3OA6A 2LP5A 3BW1A 2YRDA 1KQSS 3EG0A 3CCUQ 1J3TA 4YRFA 3JB9F 2CZ0B 2KRMA 3I55T 4IUVA 2HQEA 2C0IA 1M1GA 4LD6A 4XU3A 2E3CA 5FW9A 2KI7A 4XAXB 1Q86R 2CUDA 4DEYA 2XDBA 4J9EA 1K0SA 2QASA 1NE8A 2CDTA 3RKXA 1T0JA 3LH0A 3ULRB 4M7AC 3OYMA 1AEYA 2XK0A 3QJYA 5IHKA 2ALYA 1GCQA 1MMAA 2CP7A 3CPFA 1VQ6T 1QF6A 5I11A 1KK7A 3EGDB 4A4KA 3CXCP 1Q86U 4IUTA 2BIVA 3OYNA 1NPPA 2EBPA 2RHXA 4XEMA 3C4SA 4OMOA 5GJWB 4BI3A 6AT1B 1VYVA 2NUTB 4O5VA 1M1KR 3A8OB 2DYIA 1Q7YR 3I35A 3QKJA 4XTWA 4J5YA 2EJ9A 2BE9B 1GFDA 2J3LA 3CCRQ 4E2FB 4PJOG 1VIFA 5A0GA 4P3OA 1LOJA 1JB0E 3JB9H 2X9HA 3M0TA 2YRCA 1Q7YU 2DE0X 3HRKA 3TREA 1G83A 2FPFA 2RHUA 1OZ3A 4M77F 2YSQA 3G6EA 2QQBA 4CH3A 3CCST 5HK3A 1X54A 1AVZC 4YRMA 4II1A 1X6GA 4JJCA 4R0KA 2CJAA 3JB9D 5KYUB 1HSQA 3EHRA 3LGLA 3JCMe 3OW2P 2RN8A 3G71A 2ZNJA 4L5GA 2ZPBB 4RG8A 2LQNA 2OAWA 3M57A 4L6V5 3RMSA 4H2SA 3KBGA 5CO7A 2QEXT 2DKGA 2A37A 1GCPA 3I5SA 4UP7A 1PC0A 4PJMA 3GP8A 4YRCA 2DXUA 1IO6A 1K4US 1RADB 1VQZA 1ZBXA 1VQ9A 2VVKA 3VV0A 1G5IA 2DLPA 1D09B 1UGRB 2MMPA 4YROA 4PFZA 4PKCC 1BBWA 3LWHA 4FW1A 2DXBA 5A2QE 2FPEA 4LDVA 4H2YA 1K8AC 3GF5A 3JCMX 3CPWS 1ZSZB 4JJNK 4OMLA 2DERA 4Q15A 2HD0A 3EG3A 5GMKl 4C5EA 5LJ3d 2XDPA 2DJZA 2H3JA 1FMWA 1BIBA 2MWOA 4A54A 2CS7A 3VS3A 2F2VA 3CCLT 2LDMA 1GRIA 2RJFA 3LYIA 3QBYA 4IIMA 1Y7XA 2ABLA 3PVLA 2MF2A 3CCET 2DBMA 4C92E 3M9QA 1LVKA 3UGTA 3MEAA 1O75A 1UGQB 5GAN5 3OS2A 1X55A 2XGTA 4RTVA 4C5HA 1QWFA 2V26A 4F16A 4YCUA 2JT4A 1NJIR 1QVGP 4YRTA 1IL2A 1JXOA 3CMAA 2EYQA 2E5QA 1TUGB 3A98A 3CBPA 1JXMA 4F04B 2QHVA 4LVKA 1VOMA 4F14A 2RH2A 4C92B 3VS1A 3UA6A 1NJIU 2O4XB 4YPFA 1RACB 1T3LA 2A0FB 5DLQE 5CK9A 2RJDA 1YITQ 2Q7EA 4M7DG 3QWXX 2EYXA 3CC4Q 2QQSA 1WDXA 4IKFA 1TWBA 3SD4A 4RCCA 3G1ZA 3LWIA 4FSSA 4QQGA 2DZ9A 4UPAA 5ELNA 1PYSA 2RQTA 1YHQA 2CH4W 1K73R 2OAUA 1SEMA 4DEXA 3MCAB 2P0PA 2CSIA 3HSBA 2QQ9A 2XKOC 2D1XA 3L2QA 2K79A 2ZINA 4OMFB 5LJ3e 4IUPA 4H2VA 3MP6A 4C0DC 2QK0A 1PD0A 2DVEA 5IH2A 1X2QA 4M7DC 4RMFA 2LJ3A 2DL8A 5LJ3j 2XDDA 1YWPA 4AFQC 2E41A 2HBPA 1P92A 2M1HA 2QA4T 1K76A 3TEHA 4CC2A 2Y4YA 4ORZA 3QTCA 2M0YA 1JJ2A 2ZZEA 3OSVA 4HWSA 2L8DA 1PM3A 4RTUA 3CCVQ 4CS2A 4EIKA 1VQ8A 1WPYA 2HQXA 1YIJT 5IT9E 1F1BB 4JDSA 4C8QG 3OBYA 4PJNA 2DD4A 4F17A 4AG2C 5CIUA 4C5GA 2QGGA 4BB7A 1IGQA 4E7JA 2YT6A 4G85A 1PSFA 3G1JA 3URGA 3FRNA 2RPNA 3CCUA 2HBWA 1B34A 3TEEA 5GAMg 1WLEA 2NUPB 1VQOT 4FYYB 1SERA 4R56A 4E7LA 2KXDA 4M78G 1X2KA 4M77E 3ME9A 3VKIA 3WVEB 3RBBB 1OOTA 1TOVA 3I56Q 1SG5A 5FLXE 2L3QA 3EGUA 3PMTA 1ZBJA 4PFPA 2AKLA 2KY9A 2L0AA 4D8KA 1I0CA 4AFSC 3RACA 1I8FA 2QTXA 3RMQA 2EQIA 2ZXFA 2Y4XA 4RUGA 2EQMA 4M77B 2CT4A 2JZ2A 1PD1A 3P8DA 1R0BG 2VASA 5LJ5d 1C0MA 3CCRA 3IKMB 1KMNA 5FU6C 1WQ7A 1VQ4Q 3JV3A 1HC7A 1OI1A 4BE1A 5DY9A 3HXWA 2K4YA 2KYMA 5C6SA 2P4TA 2E3HA 1IZ6A 2VV5A 4IURA 1VQ7T 3G4SQ 4LUEA 1M2VB 3JSCA 1MNEA 3W3SA 4QVDA 4C8QB 1NYGA 3VRZA 2ZT8A 5KYXB 1WHHA 1RI0A 2L3RA 1LPLA 2LMJA 1BI3A 1GBRA 4ME7A 1TSFA 4JUVA 1ASYA 1TXQA 4KRTA 2D9TA 4JZ3A 2X4WA 3L4GA 1Y96B 2ZCEA 1OX9A 2BKDN 2DFUA 1UGVA 3E9HA 2LNVA 2JMAA 4OF1A 4OMPA 2RHQB 2DETA 2K5IA 4EMHA 1XJWB 2L5QA 1BK2A 1V76A 2HKNA 2KDSA 4YRRA 1IHWA 3M58A 3V7RA 5GAN8 1YFSA 1WHLA 2LQKA 4MZMA 3M55A 4FIBA 2VYTA 3KUFA 5E3IA 2HCKA 2RMOA 3RR6A 4F7UA 1D3BB 4BUGA 3OYEA 2M51A 3A31A 3EFOA 3CPWP 4VUBA 1WI7A 1W70A 3CEYA 4CRIA 2EQJA 3EGXB 1M90C 2Y90A 2X35A 3QYHB 3NHNA 5HK0A 1OU8A 5LJ5h 3BE3A 2KYBA 4P3NA 1AOJA 1QP2A 2DEQA 2ZR3A 1NYFA 2J05A 2EGCA 3A7UA 5LJ5e 2KMTA 2P0KA 2D6FA 2X4XA 4ZTUB 3PCOB 3OW2A 2ED0A 1KD1U 2X51A 2YRVA 5GMKi 1Q81R 1B7YB 2R5MA 2ROLA 4EMKA 1K9MR 1NJ5A 5LJ5j 1PRLC 1M1FA 1ZLMA 1MUZA 4P75C 1NJ8A 4M7AF 2DTHA 2J7IA 1RLQC 3M0PA 4QT7A 2O2OA 2AZVA 4TVAA 1Q81U 1TUCA 3M0QA 1BI0A 1DJ7B 3M59A 5KYWB 4J9BA 2SEMA 1VYTA 4MDWA 2MK5A 5A0DA 1E7OA 3CC7Q 1RAFB 2PZ1A 5GAN2 3E1SA 3UF4A 4Y91A 4EDUA 1YITA 3M54A 4HVUA 3MEUA 3CC4A 1MMNA 2DM1A 3HTRA 3QIIA 4HVWA 2EJFA 1YJWT 5EC7A 1Z7MA 3C0CA 2K3XA 2ZZFA 2X4YA 3H8ZA 2EIFA 3SHWA 5GANg 3MQZA 3VRYA 2KNBB 3M0RA 5GAN7 2RD1A 1ATIA 2J6OA 5A0LA 2ZGWA 2XICA 3HFNA 1VQMT 2HKQB 4JLIA 1YJNQ 3NMZC 4XU1A 1UGPB 5C52B 2DL7A 3C12A 1B70A 3R6NA 3LGFA 5GANf 4HT8A 1QVGA 4JJBA 2J6FA 1M27C 1G8XA 1BBUA 4RDXA 1QW1A 1V1CA 2QHSA 4AT1B 2DO3A 4M75G 2PVDB 2EAYA 4TTVA 3FJ5A 1RAIB 3SB2A 2OTJQ 3RIRA 2QAZA 1BIAA 3X26B 5FRMA 3CCVA 5GAOl 3RKWA 1S72Q 3HXUA 5IHIA 12ASA 2J06A 1R8OB 3RUXA 4MMKA 3DB4A 5FWCA 4QQDA 1GXIE 3H6ZA 1WYXA 2X3WD 1MGQA 3SWNA 2W0ZA 1QVFS 2FO0A 4KGZB 2J3MA 3NEMA 1UG1A 4Q5WA 2C0OA 2PVGB 3WXMB 1B76A 1KIKA 4LXCA 2LX9A 2CJ9A 2ZR2A 1H4QA 3JAME 4YRSA 2FRWA 2XU8A 1X43A 2ZIMA 3WQZA 1WXTA 2ALYB 2LVMA 2CIMA 3NTKA 3FDRA 3I9QA 2JM8A 4HWRA 4PL6A 2FPDA 1UDLA 3JCMJ 1G5HA 4L59A 1PWTA 4J9GA 4PJOD 2K6DA 2OTLT 5GAOp 2DDZA 5KCOA 4CC4B 4DOVA 2YLCA 1I5LA 4OLFA 1N8RR 1VQ4A 3V7CA 2RQVA 3CD6T 4H2TA 1AT1B 2GQVA 4TQDA 4KR3A 1UHCA 3CCMQ 3G4SA 1W2BS 4X1VA 1N8RU 4NCXA 3CC4T 1VQNQ 3MP1A 1ZX6A 2RJCA 1XTDA 5CVIA 1KQSA 3OYLA 1XNIA 4P74A 2DTIA 1NZ9A 4AMCA 5FU7C 1HTTA 4RKUE 3CCJQ 2YUNA 2JVVA 1G5VA 1KJWA 1M1KC 2CP2A 4RMOA 1T0HA 1AWJA 1Q7YC 1FX7A 4BDZA 1VQPA 5DM7R 2YWWA 1ZHIA 1RAEB 2PUOB 4H2XA 1EIYA 2ZNIA 2F5TX 5GAOq 5I2MA 3O8VA 4BW9A 2E6NA 4C0FA 3UT1A 3QNEA 3A8HB 1UHFA 2CP5A 4MZPA 4PLLA 1MV0B 3EFSA 4GLKA 4OP0A 4YDQA 2AK5A 2QQAA 4M7AE 4E47A 3L2UA 4WCIA 4KUIA 3LW5E 2IY5A
chains in the Genus database with same CATH topology
2Q7GA 2BUDA 1OYXA 4F7UF 3JB9I 1X2HA 3MO8A 2QHTA 3OYGA 3V8JA 3CBMA 4J7IA 4X5OA 1BI2A 4ZTZB 3BDUA 5GMKh 3LC0A 3FIFA 4M7AB 3NETA 2IVWA 1EQRA 1VUBA 4C92G 4PJOC 4XQ3A 4OB1B 2HAXA 1USYC 3DKMA 1KC8U 2KVQG 4IUUA 3V8KA 3L2ZA 3OYKA 1VQKT 4J15A 2XTIA 3M4PA 3CC7A 3OYBA 3RKYA 5IAYA 4M7DD 5CKFA 2A8EA 3AHUA 3A32A 1VQLT 1KQ1A 4FSXA 1MHNA 2VXEA 3OMGA 4A4GA 1G3SA 3HP9A 3CPWA 3RF1A 4JS4A 1PYSB 2IG0A 4C92C 2X4JA 3OS1A 3A74A 2LC4A 3E9IA 3JCMg 5GAMd 3REXA 4YRPA 4M7AA 4XTVA 5CKEA 1YJNA 1Q82U 1H641 3PIPA 2HNIA 4J6XA 4YRIA 3TEHB 3GLXA 3JCMf 3GNGA 2ZTGA 1K8AU 3ZBDA 4LDYA 3VQXA 2EQKA 1YBYA 2Q5HA 1VQPT 2V8KA 3SFMA 3KFUA 2OTJA 3REUA 4OVAA 4UP8A 4QVZA 2P0QA 2K3YA 5C51B 1S72A 5CKHA 4P5NA 2DZCA 1OZ2A 1K73C 2YLBA 3E19A 3VQYA 5IN1A 1B34B 3OY9A 1N9RA 3OMCA 2WACA 3Q1JA 4KULA 3JCMc 1KOGA 2L89A 4EMGA 3G6ET 4M78D 3UFGA 3QYGB 1SETA 5F5WA 1X01A 2RHYA 1N6AA 5GAOm 3L2WA 4OB0B 1G3TA 5FROA 1RL2A 3G71T 4PJOA 4M77G 5GAMh 1USYA 11ASA 1U8RA 4KT0E 4RCBA 5GAMe 1FWZA 2AMCA 3N5BB 3J80E 2LTOA 5GAMj 3QDRB 2LCCA 1VQ9T 1JJ2S 1WYDA 1H4VB 2MWPA 4D6WA 4N4GA 1LJOA 3OYFA 5CKBA 3CCMA 3E9GA 1X56A 2DIGA 3NTIA 5LJ3g 2A7YA 1U1TA 2RHSA 3ZEHA 3L4GB 2GFUA 4PLIA 4F7UE 3FC3A 3HY1A 3CCJA 2QQRA 3HXZA 4RQEA 2E5AA 4BE0A 2K5LA 2V8IA 4C8QC 1YJNT 5LJ3f 2QHUA 3V7SA 2RB6A 3CMAT 4HWTA 4P72C 3F70A 4BI4A 4F7UB 4XTXA 5K1PA 1WQWA 3RGLA 4UC4A 3PIOA 5HGQA 4BDYA 3L2RA 5KNNA 4M78C 1VIEA 1KQ2A 1UGSB 4N4HA 4RQFA 4JS5A 1YJ9A 2DTOA 3PGGA 3EAEA 3A5YA 4H2WA 4EPCA 4P73C 2KQWA 4C5IA 4QVCA 3X24B 1JRIA 4E7KA 4EMKB 1YHQT 4MDXA 1M4ZA 3OS5A 2I4OA 3IG2A 3HRUA 4TVAB 1EVKA 4BD3A 4BY6B 2I4NA 1N9WA 4M7DA 4NL3A 4O6JA 4YP0A 2CKKA 1QVPA 4WJ4A 2RK2A 2QI2A 3CXCS 4BWAA 2MI6A 3A7RA 4LNSA 2EJGA 1SSFA 2ZPEB 3JCMV 1VQ5A 2F69A 4HT9A 1JJCA 2XI9A 3ER0A 3OB9A 3KXTA 1VQ8T 2DXTA 2JUFA 4A53A 2K2VA 2DQ3A 1K9MC 4FM4B 4CS3A 1E22A 3ZFJA 1V29B 3A7AA 3CCMT 3CCUT 1IREB 4ZN3A 2EKOA 4HCCA 1B70B 1KG1A 2XD0A 3TCJA 2DXCA 5GANh 2DIQA 2NS6A 4M75D 4B9XA 3PMIA 1KHCA 2B8AA 3LSQA 1ADJA 3MEYA 4ZTJA 3OYCA 5GANj 2EQUA 1M90U 3HL8A 3CCQA 3PTAA 3S3OA 4XTZA 3T9NA 3SWNB 3CCRT 4M78A 4N0AC 1M8VA 4XTYA 2DPPB 4XU0A 1NYRA 2E64A 1X2GA 3S3NA 1I81A 2XHCA 3FEOA 4KR2A 4MMLA 2JTMA 3I55A 3JRZA 2ZPFB 3MEWA 4L87A 5KH6A 3JCMP 3OYIA 1LNXA 5LJ5f 4PNOA 4A4EA 3A5ZA 3QPHA 4FT2A 2ODRD 3GNFB 4PJOF 2O01E 2D0QB 3VYGA 1E1TA 1H4TA 3QO7A 4YRNA 2EWNA 1NNHA 4A4FA 4DOWA 4JRQA 3OYAA 3FLGA 4KUDK 1J5WA 2M0OA 3OYHA 4OGCA 2LT1A 2CZ7B 2EL9A 1EFWA 4J8OA 2GFAA 4P3PA 4M75C 2MAMA 3QJ6A 5HKCA 5ELOA 3IALA 4H02A 1PSEA 1W66A 4H2XB 3I56A 1EIYB 3JCMQ 4P75A 3VU3C 1YFRA 2R57A 1GGMA 2AKWA 4C0GA 4BE2A 4QQ6A 3GOXA 4TVRA 2IY5B 1UB4A 3A8GB 1HK9A 2DAQA 2RI2A 4OGEA 3MEVA 4QW2A 4M7AG 5CKDA 1BYMA 4N0AA 1YITT 4HCBA 1Q86C 3CCLA 2DD5A 4TVYA 4G84A 1EOVA 3HXVA 1W2BA 4C92D 3ASKA 4HCZA 2KAFA 2ODRC 4BI8B 1UEBA 2VGMA 1XOVA 5D6YA 5KE3A 2ZT5A 4HT4A 2G4CA 3NELA 3M53A 3OBWA 4M7DF 3QSUA 2Q7HA 2LCLA 3V8LA 4BACA 1SESA 3UPUA 1FYFA 1WGSA 3HRIA 4WF2A 1KMMA 3FJPA 3HFOA 4ELZC 3CCVT 4TWAA 1U1SA 3C95A 1KC8C 4K87A 2G3RA 2ZZGA 2GCXA 4RG2A 3HFZA 4TVWA 1M1KU 3TEGA 5D6XA 5FU7B 5GMKe 2FYKA 1ASZA 2C7IA 4M75A 4DPGA 1YGBA 3JB9J 4YRGA 2RHIA 5GMKj 2RO0A 4NL2A 3JCMh 3GPLA 3M56A 4EX5A 4V2SA 1YB3A 3NFCA 2ZPIB 4HVCA 2VXFA 4HKEA 3I56T 3L42A 1NYQA 1NJ6A 3P8HA 4C8QF 2QA4A 2PUKB 4YRQA 1BI1A 4E7HA 2RHZA 5I21A 2DK3A 1Q82C 1YIJA 4PJOE 4FU6A 4WJ3M 3OQ5A 3A8LB 4KQEA 1G51A 2JTFA 2GF7A 3L1AA 1VQ4T 1ZQ1A 1QE0A 4JRPA 3P8VA 4ZN1A 2I4MA 4M78F 4NOYA 3DLLA 4YRJA 1NJIC 4A4HA 2CGHA 3G4ST 4XEOA 4FL6A 3P8TA 1C0AA 1VQOA 3NTHA 4PJOB 5CQXA 3QO8A 4M77D 3OYDA 3RERA 2RI3A 2AMCB 1NJ2A 2E1HA 3JB9G 4JRKA 4LDXA 5KE2A 5C0MA 4KBMB 4Q6GA 2PQWA 2R5AA 4R55A 1YFTA 4C8QD 3SDZA 1G3YA 3PNWC 3VUBA 2CYZB 3HKSA 4J83A 4LDWA 2ZPHB 3S3MA 1WJQA 3A8MB 3MP8A 1N9SA 4LVIA 3M4YA 1VQ7A 2QDYB 2WSFE 3I7FA 2LRQA 5HY6A 3NENA 2RHSB 2E65A 4YCVA 2KK4A 4E51A 4J6YA 2FHDA 2FVUA 3INZA 3QXEB 4K88A 4YREA 1Y07A 2ZPGB 4E7IA 4CH4A 5FRNA 4CS4A 4F7UG 5LL6S 3MF1A 4ZGEB 5LJ3h 3ERRA 1Z7NA 3IKLA 2A3LA 1K73U 3G7ZA 2I4LA 4LVJA 1NJ1A 3R6OA 4CH5A 3M4QA 4JLGA 4XU2A 3CC7T 3OD1A 1SRYA 2YHTA 2M9UA 4M7DE 3QZ9B 4C92A 2C06A 1VQNA 4X34A 2O4XA 5J3BA 4M77C 3CMEA 3VUZA 2P5IA 2VUBA 1Y71A 4CH6A 1O9SA 5GAOn 4C0DB 3HPWA 3EFRA 4ZGDB 4M7DB 2JN0A 5K1XA 2VGNA 5CQYA 3S6WA 2ZT7A 1W4SA 5M9OA 3HXYA 3MHXA 1X75C 2F5KA 3OSSC 4EMKC 3QUIA 3OYJA 2WSEE 4J7FA 5GAN4 5J39A 1JJCB 5GAN3 5GAMf 4HWOA 1QP3A 4H2UA 4BY6C 5L8RE 2RJEA 4YCWA 2OTJT 1H3ZA 4OB3B 3HTZA 1S72T 1E1OA 4C8QE 3RL6A 1YJWA 3X28B 4HA8A 5GANd 1WU7A 5KCHA 2WSCE 2P0LA 2ARTA 3TU4K 4LVLA 4N4IA 3UWNA 2KSSA 3GIBA 3BFMA 2E10A 3DSQA 1JBMA 4JRIA 4M75F 2JNGA 4ZTFA 1VQMA 2Q5IA 4YYEA 4X9DA 4M78E 3J7AF 3PZCA 1I4K1 2NLUA 4CI0C 2PMEA 4K86A 3QO5A 4WI1A 5FU6B 2K5FA 5C53B 3PT9A 2R58A 3QO3A 1KD1C 4M78B 3X20B 3CXCA 1EIFA 4DQ2A 3JCMb 2E70A 2ARUA 3LX7A 3HRTA 1Q81C 3TUPA 4M77A 3MF2A 1RIQA 1ADYA 3BDLA 1M5Q1 1WNLA 1L0WA 1WJSA 2XIDA 2PVOB 2AHJB 1VQNT 3UGQA 1LYLA 1BKBA 3X25B 3CMET 3SWNC 1TH7A 3L2VA 3QZ5B 3OW2S 4Y28E 3A5ZB 2CJBA 2PU9B 1B8AA 1H4SA 4TQFA 1FXXA 5GANe 4FT4A 4C8QA 4UP9A 3CCJT 4ZGJB 4Z02A 3HFVA 4OB2B 1YI2A 3LSSA 5CAIA 5GMKm 4P72A 3CC2A 5DLOA 4LDUA 1Y96A 2OTLA 2M16A 3M4GA 1K9MU 3VQVA 2RHQA 3FB9A 3ICAA 5GAN6 3HHTB 3M5AA 4ZIBA 3P8BB 2PMFA 3CD6A 4C0ZA 2QXFA 4EO4A 2ZCFB 5LJ5g 4P73A 4P71C 3HRSA 3QG1A 1XQHA 2ZT6A 3HXXA 5EG2A 3DLMA 1YJ9T 4IUQA 1D3BA 3RESA 4O2DA 3CMQA 2CZ1B 2DU5A 2LT4A 2JOYA 2RM4A 4LVMA 2AKWB 4MZTA 3VBBA 2I2LA 1HXDA 2DQ0A 1VQ6A 3J81E 4P74C 1QVGS 4J6WA 3PCOA 3R07A 1B7YA 1YCYA 3LLRA 5AYFA 1KHIA 4ATOA 2EFIA 1NPRA 3BY7A 4M7AD 4XK8E 4PG3A 1G3WA 2ARSA 3UDCA 4HWPA 1AHJB 4B9WA 1VQ5T 4YRKA 3CBOA 4ELYC 4DA4A 4X9CA 1WJRA 3CCSA 4C92F 2FL7A 2K57A 5CR2A 1EVLA 2ZZDA 2C8MA 4GY5A 1QVFA 3C94A 4PHCA 2LQ8A 3PFSA 3VJPA 2CZ6B 5GAOr 2VC8A 2E6ZA 5J26A 4XTUA 4LD9K 3VQWA 2QEXA 3HY0A 2V8JA 1X6OA 3VYHB 1N8RC 3QHSA 1VQKA 3META 4NS5A 4M75E 3BJUA 3JCMW 4YTLA 1YI2T 3DB3A 2ZIOA 2RK1A 2DU7A 1VQLA 2RI5A 3CC2T 4YRLA 3UH0A 2XG8D 3CCQT 5I2SA 3HFZB 5CCAA 3OYYA 3JCMd 1E24A 2RA2A 4P71A 4M75B 1M9SA 1N27A 2FB7A 2E12A 5D6WA 3WVDB 3P8YA 4AH6A 3E9FA 3CCEA 3OS0A 3OA6A 3BW1A 1KQSS 4YRFA 3JB9F 2CZ0B 3I55T 4IUVA 2HQEA 1M1GA 4LD6A 4XU3A 2E3CA 4XAXB 2XDBA 1NE8A 3RKXA 4M7AC 3LH0A 3OYMA 2XK0A 3QJYA 2ALYA 3CPFA 1VQ6T 1QF6A 1Q86U 4A4KA 4IUTA 2BIVA 3OYNA 1NPPA 2RHXA 4XEMA 3C4SA 4BI3A 4O5VA 3A8OB 3QKJA 4XTWA 4J5YA 2EJ9A 2J3LA 4PJOG 1VIFA 5A0GA 4P3OA 1LOJA 1JB0E 3JB9H 1Q7YU 3HRKA 3TREA 2RHUA 1OZ3A 4M77F 3G6EA 2QQBA 4CH3A 3CCST 5HK3A 1X54A 4YRMA 4II1A 2CJAA 3JB9D 3LGLA 3JCMe 2ZNJA 3G71A 4L5GA 2ZPBB 4RG8A 3M57A 4L6V5 3RMSA 4H2SA 3KBGA 5CO7A 2QEXT 2DKGA 4UP7A 3GP8A 4YRCA 2DXUA 1VQZA 1ZBXA 1VQ9A 3VV0A 1G5IA 1UGRB 2MMPA 4YROA 4PKCC 1BBWA 3LWHA 2DXBA 5A2QE 4LDVA 4H2YA 1K8AC 3GF5A 3JCMX 3CPWS 4JJNK 4Q15A 2HD0A 5GMKl 4C5EA 5LJ3d 2XDPA 2DJZA 2H3JA 1BIBA 2MWOA 4A54A 2CS7A 3CCLT 2LDMA 2RJFA 3LYIA 3QBYA 1Y7XA 2MF2A 3CCET 4C92E 3M9QA 3UGTA 3MEAA 1O75A 1UGQB 5GAN5 3OS2A 1X55A 2XGTA 4C5HA 4YCUA 4YRTA 1IL2A 3CMAA 2EYQA 2E5QA 3CBPA 2QHVA 4LVKA 2RH2A 4C92B 1NJIU 2O4XB 4YPFA 5DLQE 5CK9A 2RJDA 2Q7EA 4M7DG 2QQSA 4IKFA 3SD4A 4RCCA 3G1ZA 3LWIA 4QQGA 2DZ9A 4UPAA 5ELNA 1PYSA 1YHQA 2OAUA 3MCAB 2P0PA 3HSBA 2QQ9A 2XKOC 3L2QA 2ZINA 4OMFB 5LJ3e 4IUPA 4H2VA 3MP6A 4C0DC 2DVEA 4M7DC 4RMFA 2XDDA 5LJ3j 2E41A 2HBPA 1P92A 2M1HA 2QA4T 3TEHA 2Y4YA 3QTCA 1JJ2A 2ZZEA 3OSVA 4HWSA 2L8DA 4CS2A 1VQ8A 1WPYA 2HQXA 1YIJT 5IT9E 4JDSA 4C8QG 3OBYA 2DD4A 5CIUA 4C5GA 4BB7A 4E7JA 4G85A 1PSFA 3URGA 3FRNA 3CCUA 1B34A 3TEEA 5GAMg 1WLEA 1VQOT 1SERA 4R56A 4E7LA 4M78G 4M77E 3ME9A 3VKIA 3WVEB 5FLXE 3PMTA 2KY9A 3RACA 1I8FA 2QTXA 3RMQA 2ZXFA 2Y4XA 2EQMA 4M77B 2JZ2A 3P8DA 5LJ5d 3CCRA 3IKMB 1KMNA 5FU6C 1WQ7A 1HC7A 1OI1A 4BE1A 5DY9A 3HXWA 2K4YA 5C6SA 2P4TA 2VV5A 1IZ6A 4IURA 1VQ7T 3JSCA 3W3SA 4QVDA 4C8QB 2ZT8A 1RI0A 2L3RA 1BI3A 4ME7A 4JUVA 1ASYA 2D9TA 3L4GA 2X4WA 1Y96B 2ZCEA 2BKDN 3E9HA 2LNVA 4OF1A 2RHQB 2K5IA 4EMHA 2L5QA 2KDSA 4YRRA 3M58A 3V7RA 5GAN8 1YFSA 2LQKA 4MZMA 3M55A 4FIBA 2VYTA 3KUFA 5E3IA 4F7UA 1D3BB 4BUGA 3OYEA 3A31A 4VUBA 3CEYA 4CRIA 2EQJA 1M90C 2Y90A 2X35A 3QYHB 5HK0A 5LJ5h 4P3NA 1QP2A 2DEQA 2ZR3A 3A7UA 5LJ5e 2KMTA 2P0KA 2D6FA 2X4XA 4ZTUB 3PCOB 3OW2A 1KD1U 2YRVA 5GMKi 1B7YB 2R5MA 4EMKA 1NJ5A 5LJ5j 1M1FA 4P75C 1NJ8A 4M7AF 2DTHA 4TVAA 1Q81U 1BI0A 1DJ7B 3M59A 4MDWA 5A0DA 5GAN2 3E1SA 4Y91A 4EDUA 1YITA 3M54A 3MEUA 3CC4A 3QIIA 2EJFA 1YJWT 1Z7MA 2K3XA 2ZZFA 2X4YA 3H8ZA 2EIFA 5GANg 3MQZA 5GAN7 2RD1A 1ATIA 5A0LA 2ZGWA 2XICA 3HFNA 1VQMT 4JLIA 4XU1A 1UGPB 5C52B 3C12A 1B70A 4HT8A 3LGFA 5GANf 1QVGA 1BBUA 4RDXA 1QW1A 2QHSA 2DO3A 4M75G 2PVDB 2EAYA 4TTVA 3SB2A 3RIRA 1BIAA 3X26B 5FRMA 3CCVA 5GAOl 3RKWA 3HXUA 12ASA 1GXIE 1R8OB 3RUXA 4MMKA 3DB4A 4QQDA 3H6ZA 1MGQA 3SWNA 1QVFS 2J3MA 3NEMA 4Q5WA 2PVGB 3WXMB 1B76A 2LX9A 2CJ9A 2ZR2A 1H4QA 3JAME 4YRSA 2XU8A 2ZIMA 3WQZA 2ALYB 2LVMA 2CIMA 3NTKA 3FDRA 4HWRA 4PL6A 3JCMJ 1G5HA 4L59A 4PJOD 2OTLT 5GAOp 2DDZA 5KCOA 4DOVA 2YLCA 1I5LA 4OLFA 1VQ4A 3V7CA 3CD6T 4H2TA 2GQVA 4TQDA 4KR3A 3G4SA 1W2BS 1N8RU 4NCXA 3CC4T 3MP1A 2RJCA 1XTDA 5CVIA 1KQSA 3OYLA 1XNIA 4P74A 2DTIA 1NZ9A 5FU7C 1HTTA 4RKUE 2JVVA 1G5VA 1M1KC 4RMOA 1Q7YC 1FX7A 4BDZA 1VQPA 5DM7R 1ZHIA 2PUOB 4H2XA 1EIYA 2ZNIA 2F5TX 5GAOq 5I2MA 3O8VA 4BW9A 2E6NA 4C0FA 3UT1A 3QNEA 3A8HB 4MZPA 4PLLA 3EFSA 4GLKA 4OP0A 4YDQA 2QQAA 4M7AE 4E47A 3L2UA 4KUIA 3LW5E 2IY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7G A;  5ELN A;  1H4T A;  1PYS A;  2PME A;  4K86 A;  3QO7 A;  4YRN A;  2EWN A;  1NNH A;  4F7U F;  3QO5 A;  4WI1 A;  3JB9 I;  1X2H A;  2QHT A;  5C53 B;  3V8J A;  4X5O A;  3HSB A;  1J5W A;  4ZTZ B;  3BDU A;  3QO3 A;  5GMK h;  2ZIN A;  5LJ3 e;  3LC0 A;  3FIF A;  4M78 B;  4M7A B;  4H2V A;  3NET A;  2DVE A;  4DQ2 A;  3JCM b;  1EQR A;  4M7D C;  4RMF A;  5LJ3 j;  4C92 G;  2ARU A;  2EL9 A;  2E41 A;  1EFW A;  3TEH A;  4P3P A;  4PJO C;  4XQ3 A;  3QTC A;  4M75 C;  2ZZE A;  3TUP A;  1USY C;  4M77 A;  4HWS A;  3MF2 A;  1RIQ A;  5ELO A;  3V8K A;  3L2Z A;  3IAL A;  4CS2 A;  1ADY A;  4H02 A;  1W66 A;  4H2X B;  1M5Q 1;  1WNL A;  1EIY B;  4J15 A;  1L0W A;  3JCM Q;  4P75 A;  1WPY A;  3UGQ A;  2XTI A;  3M4P A;  1LYL A;  3VU3 C;  4C8Q G;  3SWN C;  1TH7 A;  1YFR A;  3RKY A;  4M7D D;  1GGM A;  3AHU A;  3A32 A;  1KQ1 A;  2CJB A;  1B8A A;  2AKW A;  1H4S A;  2VXE A;  4TQF A;  5GAN e;  4G85 A;  4C8Q A;  4UP9 A;  3HFV A;  1B34 A;  3RF1 A;  2IY5 B;  5GAM g;  1PYS B;  1WLE A;  3LSS A;  5CAI A;  4C92 C;  5GMK m;  3A74 A;  4P72 A;  1SER A;  1HK9 A;  3E9I A;  3JCM g;  4M78 G;  5GAM d;  4M7A G;  3REX A;  4M77 E;  4N0A A;  1Y96 A;  3M4G A;  4YRP A;  3VQV A;  2RHQ A;  3FB9 A;  4M7A A;  4XTV A;  3ICA A;  5GAN 6;  4TVY A;  4ZIB A;  4G84 A;  1EOV A;  3HXV A;  2PMF A;  1H64 1;  3RAC A;  4EO4 A;  4C92 D;  5LJ5 g;  2HNI A;  1I8F A;  2QTX A;  4J6X A;  3TEH B;  4YRI A;  4P73 A;  4P71 C;  3JCM f;  2ODR C;  2ZXF A;  2ZTG A;  2ZT6 A;  4M77 B;  3HXX A;  3VQX A;  5LJ5 d;  1D3B A;  3IKM B;  3RES A;  2Q5H A;  1KMN A;  4O2D A;  3CMQ A;  2DU5 A;  1WQ7 A;  2ZT5 A;  1HC7 A;  2G4C A;  3KFU A;  5DY9 A;  3HXW A;  2RM4 A;  3REU A;  3NEL A;  4UP8 A;  4M7D F;  5C51 B;  3QSU A;  2AKW B;  2Q7H A;  3W3S A;  3V8L A;  2I2L A;  1HXD A;  1SES A;  4QVD A;  3VBB A;  1FYF A;  2DQ0 A;  4P74 C;  2DZC A;  4C8Q B;  3HRI A;  2YLB A;  2ZT8 A;  3VQY A;  4WF2 A;  4J6W A;  1KMM A;  1B34 B;  3FJP A;  3PCO A;  3HFO A;  1N9R A;  3R07 A;  1B7Y A;  1YCY A;  3JCM c;  4JUV A;  1ASY A;  4TWA A;  1KOG A;  1U1S A;  4EMG A;  3BY7 A;  4M78 D;  4M7A D;  4PG3 A;  3UFG A;  3L4G A;  1SET A;  1Y96 B;  2ARS A;  2ZCE A;  4K87 A;  1X01 A;  5F5W A;  2ZZG A;  3E9H A;  5GAO m;  4HWP A;  3HFZ A;  4TVW A;  2RHQ B;  4EMH A;  3TEG A;  4YRK A;  5GMK e;  2FYK A;  1ASZ A;  4PJO A;  2C7I A;  4M75 A;  4YRR A;  4X9C A;  4M77 G;  5GAM h;  1USY A;  3V7R A;  11AS A;  5GAN 8;  1YFS A;  4C92 F;  1YGB A;  4DPG A;  2K57 A;  3JB9 J;  4YRG A;  1EVL A;  4RCB A;  5GAM e;  2C8M A;  5GMK j;  5E3I A;  4NL2 A;  4PHC A;  2AMC A;  3JCM h;  4EX5 A;  4F7U A;  1D3B B;  4V2S A;  1YB3 A;  3A31 A;  5GAO r;  2VC8 A;  4HVC A;  5GAM j;  2VXF A;  1WYD A;  1H4V B;  2Y90 A;  4XTU A;  1LJO A;  1NYQ A;  3VQW A;  1NJ6 A;  3HY0 A;  4C8Q F;  4YRQ A;  5LJ5 h;  4P3N A;  3QHS A;  2DEQ A;  2ZR3 A;  3A7U A;  5LJ5 e;  5I21 A;  4ZTU B;  3PCO B;  4PJO E;  4M75 E;  3BJU A;  4WJ3 M;  1X56 A;  3JCM W;  5GMK i;  1B7Y B;  4KQE A;  1G51 A;  4EMK A;  2ZIO A;  1NJ5 A;  5LJ5 j;  2DU7 A;  3L1A A;  5LJ3 g;  1QE0 A;  4YRL A;  1U1T A;  3UH0 A;  2RHS A;  3P8V A;  4P75 C;  1NJ8 A;  4M7A F;  4M78 F;  2DTH A;  2I4M A;  3L4G B;  4NOY A;  4F7U E;  4YRJ A;  3HY1 A;  4TVA A;  2CGH A;  3HFZ B;  3HXZ A;  4XEO A;  4RQE A;  2E5A A;  3P8T A;  3JCM d;  1C0A A;  1E24 A;  2RA2 A;  4P71 A;  4PJO B;  3QO8 A;  4M75 B;  4C8Q C;  4M77 D;  2FB7 A;  5GAN 2;  3RER A;  5LJ3 f;  2QHU A;  3P8Y A;  4Y91 A;  3V7S A;  2RB6 A;  4AH6 A;  4HWT A;  3BW1 A;  4P72 C;  2AMC B;  1NJ2 A;  4F7U B;  2E1H A;  4YRF A;  2EJF A;  4JRK A;  4XTX A;  3JB9 G;  3JB9 F;  5K1P A;  1WQW A;  3RGL A;  1Z7M A;  5HGQ A;  4Q6G A;  2E3C A;  2ZZF A;  4XU3 A;  5KNN A;  1YFT A;  4C8Q D;  5GAN g;  3RKX A;  4M78 C;  4M7A C;  1KQ2 A;  5GAN 7;  2RD1 A;  4RQF A;  1ATI A;  2DTO A;  2ALY A;  3PGG A;  3A5Y A;  2ZGW A;  4H2W A;  3HFN A;  4P73 C;  1QF6 A;  4JLI A;  4QVC A;  4XU1 A;  1JRI A;  5C52 B;  1N9S A;  4XEM A;  4EMK B;  1B70 A;  4HT8 A;  5GAN f;  3I7F A;  3NEN A;  4XTW A;  2E65 A;  2RHS B;  4J5Y A;  1BBU A;  2I4O A;  2EJ9 A;  4RDX A;  4YCV A;  2J3L A;  2QHS A;  4E51 A;  4J6Y A;  3IG2 A;  4PJO G;  4TVA B;  4M75 G;  1EVK A;  2EAY A;  4P3O A;  4TTV A;  1LOJ A;  2I4N A;  1N9W A;  4M7D A;  3INZ A;  4K88 A;  3SB2 A;  3JB9 H;  4YRE A;  4NL3 A;  4YP0 A;  3RIR A;  3HRK A;  1BIA A;  4WJ4 A;  4CH4 A;  4M77 F;  5GAO l;  4CS4 A;  4F7U G;  3RKW A;  3HXU A;  4CH3 A;  1X54 A;  4BWA A;  3MF1 A;  3A7R A;  4YRM A;  12AS A;  5LJ3 h;  3ERR A;  3RUX A;  1Z7N A;  4MMK A;  4LNS A;  2EJG A;  2CJA A;  3JB9 D;  3IKL A;  3JCM V;  1MGQ A;  4HT9 A;  3SWN A;  3JCM e;  2ZNJ A;  2I4L A;  2J3M A;  1JJC A;  3NEM A;  1NJ1 A;  1B76 A;  4CH5 A;  3M4Q A;  2CJ9 A;  2ZR2 A;  1H4Q A;  4XU2 A;  4H2S A;  4YRS A;  3OD1 A;  2DXT A;  2DKG A;  1SRY A;  2ZIM A;  3WQZ A;  2YHT A;  4A53 A;  2DQ3 A;  4UP7 A;  2ALY B;  4CS3 A;  2CIM A;  4M7D E;  1E22 A;  4C92 A;  4YRC A;  2DXU A;  3A7A A;  1VQZ A;  1G5I A;  4HWR A;  4YRO A;  4M77 C;  1BBW A;  1B70 B;  2P5I A;  4CH6 A;  4H2Y A;  5GAO n;  3JCM X;  5GAN h;  3JCM J;  1G5H A;  4PJO D;  4M75 D;  4Q15 A;  5GMK l;  3EFR A;  4M7D B;  2JN0 A;  5LJ3 d;  5GAO p;  2DDZ A;  2DJZ A;  5K1X A;  1BIB A;  4A54 A;  2YLC A;  1I5L A;  1ADJ A;  2ZT7 A;  3LSQ A;  4OLF A;  3MEY A;  5GAN j;  3HXY A;  3V7C A;  4H2T A;  4TQD A;  4KR3 A;  4EMK C;  3QUI A;  4C92 E;  4XTZ A;  3UGT A;  4NCX A;  5GAN 4;  3SWN B;  5GAN 5;  1X55 A;  2XGT A;  4M78 A;  1JJC B;  5GAN 3;  4N0A C;  5GAM f;  4HWO A;  4YCU A;  4H2U A;  1M8V A;  4YCW A;  4YRT A;  4XTY A;  1IL2 A;  4P74 A;  2DTI A;  4XU0 A;  1NYR A;  1HTT A;  2E64 A;  1X2G A;  2QHV A;  3HTZ A;  1E1O A;  3RL6 A;  4C8Q E;  1I81 A;  4HA8 A;  5GAN d;  4MML A;  4KR2 A;  4C92 B;  1WU7 A;  4YPF A;  4H2X A;  1EIY A;  2P0L A;  2ZNI A;  2ART A;  5GAO q;  4L87 A;  3JCM P;  4BW9 A;  2Q7E A;  1LNX A;  5LJ5 f;  3QNE A;  4M7D G;  3GIB A;  4PNO A;  3BFM A;  2E10 A;  3A5Z A;  2ODR D;  3DSQ A;  1JBM A;  4PJO F;  4RCC A;  3EFS A;  4JRI A;  4M75 F;  3G1Z A;  4OP0 A;  2Q5I A;  4YDQ A;  4YYE A;  4X9D A;  4M78 E;  4M7A E;  3PZC A;  1I4K 1;  2DZ9 A;  4UPA A;  1E1T A;  2IY5 A; 
#chains in the Genus database with same CATH topology
 2Q7G A;  2BUD A;  1OPK A;  1UE9 A;  1OYX A;  4F7U F;  2C0T A;  3JB9 I;  1X2H A;  3MO8 A;  1YJ9 Q;  2QHT A;  2LCS A;  1PKT A;  3OYG A;  3V8J A;  3CBM A;  4J7I A;  4X5O A;  1BI2 A;  4ZTZ B;  3BDU A;  5GMK h;  3LC0 A;  3FIF A;  4M7A B;  2GTJ A;  3VS2 A;  3NET A;  1KC8 R;  1NM7 A;  2IVW A;  1EQR A;  1VUB A;  4C92 G;  4PJO C;  4XQ3 A;  4OB1 B;  1X27 A;  1EX4 A;  2HAX A;  1USY C;  3DKM A;  1KC8 U;  2KVQ G;  4IUU A;  3V8K A;  3L2Z A;  3OYK A;  1VQK T;  1GBQ A;  4J15 A;  2XTI A;  3M4P A;  1TG0 A;  3REA B;  3CC7 A;  3OYB A;  2QTV A;  3RKY A;  5IAY A;  5CKF A;  4M7D D;  2A8E A;  2HL5 C;  3AHU A;  3A32 A;  1VQL T;  1KQ1 A;  1ARK A;  2JTE A;  1U3O A;  4FSX A;  1MHN A;  1VQ5 Q;  2VXE A;  3OMG A;  4A4G A;  1G3S A;  2YUP A;  3HP9 A;  1W6X A;  3CPW A;  3RF1 A;  4JS4 A;  1PYS B;  2IG0 A;  3EHQ A;  2X4J A;  4C92 C;  3OS1 A;  3A74 A;  1SRL A;  2LC4 A;  3E9I A;  3JCM g;  5GAM d;  1Q82 R;  3REX A;  2BZX A;  2YXY A;  5IXF A;  4YRP A;  4JPB W;  1OU9 A;  2FRY A;  1K8A R;  4M7A A;  4XTV A;  5CKE A;  1PRM C;  1YJN A;  1NEB A;  1Q82 U;  1H64 1;  2KBT A;  3PIP A;  4RTW A;  2HNI A;  1R0C B;  4FYW B;  4J6X A;  4YRI A;  3TEH B;  3GLX A;  3JCM f;  3VS7 A;  3GNG A;  2ZTG A;  1K8A U;  2BZY A;  3ZBD A;  4LDY A;  3VQX A;  1SRM A;  2KXC A;  1CKA A;  1BCO A;  4IIO A;  1YBY A;  2EQK A;  2Q5H A;  1VQP T;  2V8K A;  3SFM A;  3KFU A;  2OTJ A;  3REU A;  4OVA A;  4UP8 A;  3CCQ Q;  4QVZ A;  3TVT A;  2P0Q A;  2K3Y A;  5C51 B;  1S72 A;  5CKH A;  4P5N A;  2CRE A;  1D0X A;  2DZC A;  1OZ2 A;  1K73 C;  2LNH B;  2IIM A;  2YLB A;  3E19 A;  2NYS A;  3VQY A;  5IN1 A;  1B34 B;  1QWE A;  1QCN A;  3OY9 A;  3OMC A;  1N9R A;  2WAC A;  2YUQ A;  3Q1J A;  4KUL A;  3JCM c;  1QKW A;  1SSH A;  1KOG A;  2L89 A;  4EMG A;  2EYY A;  3G6E T;  2DRM A;  4M78 D;  1BBZ A;  3UFG A;  3QYG B;  3I55 Q;  1IHV A;  1SET A;  5F5W A;  1X01 A;  2H8H A;  2RHY A;  1N6A A;  2ESW A;  5GAO m;  5KYY A;  3L2W A;  4OB0 B;  1G3T A;  3PE0 A;  5FRO A;  1RL2 A;  3G71 T;  4PJO A;  2LJ1 A;  2X3X D;  4M77 G;  4J9C A;  5GAM h;  1JEG A;  1USY A;  11AS A;  2JM9 A;  3E2U A;  4KT0 E;  1U8R A;  4RCB A;  1VQ6 Q;  5GAM e;  2BTT A;  1FWZ A;  2AMC A;  3PVQ A;  4DBQ A;  3N5B B;  1M8M A;  1AZG B;  3J80 E;  2LTO A;  5GAM j;  3QDR B;  2LCC A;  1VQ9 T;  1JJ2 S;  1WYD A;  1H4V B;  2MWP A;  4D6W A;  4N4G A;  1LJO A;  3OYF A;  1WA7 A;  4J9F A;  1RUW A;  1AWX A;  2M02 A;  3UAT A;  4GLM A;  1K9A A;  1M2O A;  5CKB A;  1JU5 C;  3CCM A;  1TS9 A;  3E9G A;  3CCS Q;  1X56 A;  1KQS P;  2DIG A;  1W2B P;  3NTI A;  5LJ3 g;  2A7Y A;  1U1T A;  2RHS A;  3ZEH A;  3L4G B;  2GFU A;  4PLI A;  4F7U E;  3FC3 A;  3HY1 A;  3CCJ A;  4D8D A;  2QQR A;  3HXZ A;  4RQE A;  2E5A A;  1X6B A;  2CUB A;  4BE0 A;  1D1A A;  3H9N A;  2K5L A;  2QEX Q;  2V8I A;  4C8Q C;  1YJN T;  5LJ3 f;  2QHU A;  3V7S A;  2RB6 A;  1OX8 A;  3CMA T;  4HWT A;  2QYZ A;  4P72 C;  3F70 A;  4A63 B;  4BI4 A;  4F7U B;  2GGR A;  2W10 A;  4XTX A;  5K1P A;  7AT1 B;  1WQW A;  2DL4 A;  3EFO B;  3RGL A;  1ZA2 B;  4UC4 A;  1HD3 A;  3PIO A;  5HGQ A;  4ESR A;  4BDY A;  3L2R A;  5KNN A;  3REB B;  3MJX A;  1IXD A;  4M78 C;  5HCK A;  1VIE A;  4J9I A;  1KQ2 A;  1UGS B;  4N4H A;  4RQF A;  4JS5 A;  1YJ9 A;  3RDV A;  2DTO A;  3PGG A;  3EAE A;  3A5Y A;  4CC7 A;  4H2W A;  4EPC A;  4P73 C;  2KQW A;  2KRS A;  4C5I A;  2E5K A;  3CCL Q;  4QVC A;  1SHF A;  3X24 B;  1JRI A;  1SF9 A;  2A28 A;  1YWO A;  4E7K A;  1CSK A;  4EMK B;  3M0S A;  3CCE Q;  2SRC A;  1WHM A;  4CC3 A;  1YHQ T;  4MDX A;  1M4Z A;  3OS5 A;  2I4O A;  2MYS A;  3IG2 A;  3HRU A;  4TVA B;  1EVK A;  4BD3 A;  4BY6 B;  2EVR A;  2IPO B;  2OX7 A;  2DJQ A;  2I4N A;  1N9W A;  4M7D A;  4NL3 A;  4O6J A;  4YP0 A;  2CKK A;  1QVP A;  4WJ4 A;  2HSP A;  2EGE A;  2RK2 A;  2DL3 A;  2QI2 A;  3CXC S;  4BWA A;  2DMO A;  2MI6 A;  3A7R A;  1Q95 G;  2V1R A;  2DVJ A;  1C6V X;  4LNS A;  2G6F X;  2EJG A;  1SSF A;  2ZPE B;  3JCM V;  1VQ5 A;  1BCM A;  2F69 A;  4HT9 A;  1GL5 A;  1JJC A;  4J9D A;  2XI9 A;  3ER0 A;  3OB9 A;  3KXT A;  1VQ8 T;  2RNA A;  2YDL A;  2DXT A;  2B86 A;  1KD1 R;  2JUF A;  5IHN A;  1VA7 A;  4A53 A;  2K2V A;  2DQ3 A;  1K9M C;  4FM4 B;  4CS3 A;  1E22 A;  3ZFJ A;  1V29 B;  3A7A A;  5D7U A;  3CCM T;  1SKU B;  3CCU T;  1IRE B;  4PK4 A;  2EKO A;  4ZN3 A;  4HCC A;  1KG1 A;  1B70 B;  2XD0 A;  2BZ8 A;  3TCJ A;  2DXC A;  2ECZ A;  2EYZ A;  5GAN h;  2DIQ A;  2NS6 A;  2XMF A;  4M75 D;  1M90 R;  2D8J A;  4B9X A;  3PMI A;  1MMD A;  2K9G A;  2K3B A;  1KHC A;  2B8A A;  3LSQ A;  1ADJ A;  2HMA A;  2QA4 Q;  3MEY A;  4ZTJ A;  4ANJ A;  3OYC A;  5GAN j;  2EQU A;  1M90 U;  3HL8 A;  1QCF A;  1OEB A;  3CCQ A;  4Y92 A;  3PTA A;  3VS0 A;  1ZUU A;  3M0U A;  3S3O A;  3EG9 A;  4XTZ A;  2DYB A;  1YIJ Q;  3T9N A;  3SWN B;  3CCR T;  2QGF B;  4M78 A;  1AD5 A;  4N0A C;  4JJD A;  1IB8 A;  2ZAE A;  2L3P A;  1M8V A;  4XTY A;  3NPF A;  2DPP B;  4XU0 A;  1NYR A;  1TUD A;  2E64 A;  1X2G A;  2VWF A;  1TU0 B;  3S3N A;  1ZUY A;  1QCO A;  1I81 A;  2XHC A;  1K0X A;  3FEO A;  4KR2 A;  4MML A;  2JTM A;  2MIO A;  3I55 A;  4JZ4 A;  3JRZ A;  2CP3 A;  1VQO Q;  2ZPF B;  3MEW A;  4L87 A;  5KH6 A;  3JCM P;  3OYI A;  1LNX A;  5LJ5 f;  3QDF A;  4PNO A;  2GNC A;  4A4E A;  3A5Z A;  3QPH A;  4FT2 A;  1UTI A;  2ODR D;  3GNF B;  1YFN A;  4PJO F;  1FYN A;  2EGA A;  2O01 E;  1NLP C;  3H41 A;  8ATC B;  2D0Q B;  3VYG A;  1E1T A;  1H4T A;  3QO7 A;  4YRN A;  2EWN A;  1D1B A;  1NNH A;  3GBQ A;  2KT1 A;  2HL3 A;  4A4F A;  4DOW A;  2V1Q A;  4JRQ A;  3OYA A;  3FLG A;  1JQQ A;  4KUD K;  4ZNX A;  4RTX A;  1J5W A;  2GQI A;  2M0O A;  3OYH A;  1VQ7 Q;  1W1F A;  4OGC A;  3CQT A;  2LT1 A;  2DRK A;  3H0I A;  1CKB A;  2CZ7 B;  1R77 A;  2EL9 A;  1EFW A;  4J8O A;  2GFA A;  4P3P A;  4E7Z A;  4M75 C;  2MAM A;  3QJ6 A;  5HKC A;  1EFN A;  5ELO A;  3IAL A;  3H0F A;  4H02 A;  1PSE A;  1W66 A;  4H2X B;  2F2X A;  3I56 A;  1EIY B;  2MCN A;  1SPK A;  2I0N A;  3JCM Q;  4P75 A;  2COW A;  3VU3 C;  2FG0 A;  1YFR A;  2R57 A;  1GGM A;  2O88 A;  2PTK A;  2AKW A;  2D8H A;  4C0G A;  4BE2 A;  2KGT A;  4HVV A;  2DA9 A;  2F1L A;  4QQ6 A;  3GOX A;  4TVR A;  2IY5 B;  1UB4 A;  3A8G B;  2FZG B;  2RF0 A;  1HK9 A;  2DAQ A;  2RI2 A;  2ED1 A;  4OGE A;  2F2W A;  3MEV A;  4RTZ A;  4QW2 A;  4M7A G;  5CKD A;  1BYM A;  1SHG A;  4N0A A;  1YIT T;  2DBK A;  1Q86 C;  4HCB A;  1HJD A;  2O9S A;  4E7S A;  1Z9Q A;  1YCS B;  3CME Q;  4OMN A;  3CCL A;  1HYO A;  2DD5 A;  4TVY A;  4G84 A;  1EOV A;  3HXV A;  1W2B A;  1ZSG A;  4C92 D;  3ASK A;  2L2P A;  4HCZ A;  2KAF A;  2ODR C;  1ABQ A;  4BI8 B;  1UEB A;  2VGM A;  1XOV A;  1B3Q A;  2EKH A;  2A08 A;  4KGV B;  1OPL A;  5D6Y A;  5KE3 A;  3D7S B;  4WTO B;  2ZT5 A;  4HT4 A;  2G4C A;  3NEL A;  3M53 A;  3OBW A;  4RTT A;  4M7D F;  4AFZ C;  3QSU A;  2Q7H A;  1MMG A;  2LCL A;  3V8L A;  4BAC A;  1SES A;  3UPU A;  1FYF A;  1FMK A;  1WGS A;  3HRI A;  4QKU A;  4WF2 A;  1KMM A;  3FJP A;  2DEU A;  3HFO A;  3MKD A;  1RAA B;  4ELZ C;  2NWM A;  4FYX B;  3CCV T;  4TWA A;  1U1S A;  2MOX A;  2E4H A;  3C95 A;  1B7T A;  1YJW Q;  2COZ A;  1KC8 C;  4DBH A;  2G3R A;  4K87 A;  2ZZG A;  2GCX A;  4RG2 A;  3HFZ A;  4TVW A;  2FZC B;  1EZZ B;  1M1K U;  3TEG A;  5D6X A;  5FU7 B;  1ZSZ C;  1RAH B;  5GMK e;  2FYK A;  2KRN A;  1ASZ A;  2C7I A;  4M75 A;  4DPG A;  1YGB A;  3JB9 J;  4PJJ A;  2FZK B;  4YRG A;  2RHI A;  1VQM Q;  5GMK j;  2RO0 A;  4NL2 A;  3KFV A;  3JCM h;  3GPL A;  3M56 A;  4EX5 A;  2CP6 A;  3EH2 A;  2KT8 A;  4V2S A;  2RQU A;  1UJ0 A;  1YB3 A;  3NFC A;  2ZPI B;  3VS5 A;  4HVC A;  2VXF A;  4HKE A;  5IXB A;  3I56 T;  3L42 A;  1S1N A;  1NYQ A;  4DBR A;  1NJ6 A;  3P8H A;  4C8Q F;  1Y57 A;  2QA4 A;  2HDA A;  2RQW A;  2PUK B;  2DIL A;  4YRQ A;  3TQ7 P;  1BI1 A;  2D0N A;  4E7H A;  4AG1 C;  2RHZ A;  4LUD A;  1ZA1 B;  1OUL A;  5I21 A;  3LH5 A;  1ZUK A;  2DK3 A;  2KRO A;  3EGD A;  1Q82 C;  1YIJ A;  4PJO E;  2GTO A;  4FU6 A;  4WJ3 M;  3OQ5 A;  1QLY A;  3A8L B;  4KQE A;  2O9V A;  1G51 A;  5ECA A;  2JTF A;  2GF7 A;  2NUT A;  1LCK A;  3L1A A;  1VQ4 T;  1ZQ1 A;  1QE0 A;  4JRP A;  3P8V A;  4ZN1 A;  2I4M A;  4M78 F;  4Z88 A;  4NOY A;  3DLL A;  4YRJ A;  1NJI C;  4A4H A;  2CGH A;  3G4S T;  5KYY B;  4XEO A;  1WHK A;  2L3S A;  4FL6 A;  2J6K A;  2JS2 A;  3P8T A;  1C0A A;  1C1A A;  1E6G A;  1VQO A;  2JW4 A;  3VS4 A;  3NTH A;  4PJO B;  2PNI A;  5CQX A;  3QO8 A;  4M77 D;  3OYD A;  3MPU B;  3RER A;  1AWO A;  2RI3 A;  2AMC B;  3NGP A;  1NJ2 A;  1D0Z A;  2E1H A;  3JB9 G;  4JRK A;  4LDX A;  5KE2 A;  4GBQ A;  5KYU A;  2NUZ A;  1YI2 Q;  5C0M A;  4KBM B;  4Q6G A;  2PQW A;  2R5A A;  3CC2 Q;  4Z8A A;  3QWY A;  4R55 A;  4FYV B;  1YFT A;  1N5Z A;  4C8Q D;  3SDZ A;  1G3Y A;  1PNJ A;  3PNW C;  1G2B A;  2OTL Q;  2QG9 B;  3VUB A;  4Z89 A;  2CYZ B;  1WXU A;  3HKS A;  2Z0W A;  2DL5 A;  4J83 A;  4LDW A;  3CD6 Q;  1H92 A;  2ZPH B;  3UA7 A;  1WJQ A;  3S3M A;  3A8M B;  3MP8 A;  1N9S A;  4LVI A;  2K2M A;  3M4Y A;  1VQ7 A;  2QDY B;  2WSF E;  3I7F A;  1YP5 A;  2LRQ A;  5AT1 B;  2HSE B;  5HY6 A;  3NEN A;  2RHS B;  2E65 A;  1NG2 A;  1QVF P;  4YCV A;  2KK4 A;  4E51 A;  1ZSZ A;  4J6Y A;  2FHD A;  1WXB A;  1I1J A;  2FVU A;  3INZ A;  3QXE B;  4K88 A;  4YRE A;  2EW3 A;  1Y07 A;  2ZPG B;  4E7I A;  4CH4 A;  5FRN A;  4CS4 A;  4F7U G;  4LNP A;  5LL6 S;  3MF1 A;  4ZGE B;  1KSW A;  5LJ3 h;  3ERR A;  1Z7N A;  2DX1 A;  1GFC A;  3IKL A;  2A3L A;  3TSZ A;  4FW2 A;  1K73 U;  1E6H A;  3G7Z A;  2I4L A;  4LVJ A;  1NLO C;  1NJ1 A;  3R6O A;  4CH5 A;  3M4Q A;  4J9H A;  4JLG A;  4XU2 A;  3CC7 T;  3OD1 A;  1SRY A;  4OMQ A;  1PCX A;  2YHT A;  2M9U A;  1RI9 A;  1MND A;  4M7D E;  3QZ9 B;  4C92 A;  2C06 A;  3SEM A;  1UFF A;  1M3A A;  4X34 A;  2O4X A;  5J3B A;  1VQN A;  1AWW A;  4M77 C;  3CME A;  1OV3 A;  3VUZ A;  2VUB A;  2P5I A;  1Y71 A;  4CH6 A;  1O9S A;  5GAO n;  4E6R A;  2BE7 D;  4C0D B;  3HPW A;  1AZE A;  1U06 A;  2YUO A;  2OJ2 A;  3EFR A;  4ZGD B;  4M7D B;  2JN0 A;  5K1X A;  2VGN A;  5CQY A;  3S6W A;  2MPX C;  1I5O B;  2ZT7 A;  1W4S A;  3AT1 B;  5M9O A;  3HXY A;  1MV3 A;  3I5R A;  2EYW A;  3MHX A;  1I07 A;  1X75 C;  2F5K A;  2AZS A;  3OSS C;  1WFW A;  1VQK Q;  4EMK C;  3QUI A;  3OYJ A;  4OMM A;  2WSE E;  4J7F A;  1U5S A;  3EG2 A;  5GAN 4;  5J39 A;  1JJC B;  5GAN 3;  5GAM f;  4HWO A;  1QP3 A;  2LQW A;  1VQL Q;  4H2U A;  4BY6 C;  5L8R E;  2RJE A;  4YCW A;  1B07 A;  2OTJ T;  1TTH B;  1H3Z A;  1NEG A;  4OB3 B;  4LN2 A;  3HTZ A;  1S72 T;  1E1O A;  4C8Q E;  3RL6 A;  1T3S A;  4HA8 A;  3X28 B;  5GAN d;  1YJW A;  1WU7 A;  5KCH A;  2WSC E;  5L23 A;  1FMV A;  2P0L A;  2ART A;  2E3I A;  3TU4 K;  4LVL A;  1WHG A;  4N4I A;  3UWN A;  2KSS A;  3GIB A;  3BFM A;  2OI3 A;  2E10 A;  2ENM A;  3DSQ A;  2K7A A;  1JBM A;  4JRI A;  4M75 F;  2JNG A;  4ZTF A;  1VQM A;  2Q5I A;  4YYE A;  4X9D A;  4M78 E;  1UUE A;  3J7A F;  3PZC A;  1I4K 1;  1A0N B;  2NLU A;  4CI0 C;  5KYN A;  4K11 A;  1OQK A;  2PME A;  4K86 A;  1D0Y A;  2NUP A;  1QKX A;  2H3E B;  3QO5 A;  4WI1 A;  1UEC A;  1RLP C;  2JMC A;  2GBQ A;  5FU6 B;  2K5F A;  4HXJ A;  5C53 B;  1VQP Q;  1WLP B;  3EG9 B;  5I22 A;  3PT9 A;  1NBE B;  2R58 A;  3QO3 A;  1KD1 C;  4M78 B;  3X20 B;  3CXC A;  2A36 A;  1EIF A;  1M30 A;  4DQ2 A;  3JCM b;  2CP0 A;  2ROT A;  2E70 A;  2ARU A;  1KFZ A;  3LX7 A;  1ACM B;  2CT3 A;  3HRT A;  1Q81 C;  1QMC A;  3TUP A;  4M77 A;  3EH1 A;  3EG1 A;  3MF2 A;  1RIQ A;  1ADY A;  1ABO A;  3BDL A;  1M5Q 1;  1WNL A;  1L0W A;  1WJS A;  3G6E Q;  2XID A;  2PVO B;  2AHJ B;  8AT1 B;  1JO8 A;  1VYU A;  1VQN T;  1LYL A;  1BKB A;  3UGQ A;  3X25 B;  3CME T;  3SWN C;  1TH7 A;  3L2V A;  3QZ5 B;  3ZL7 C;  1M2V A;  3OW2 S;  3H0H A;  4Y28 E;  1RAB B;  3A5Z B;  2P4R A;  2CJB A;  2PU9 B;  1B8A A;  1H4S A;  2HEQ A;  2JS0 A;  4TQF A;  1BB9 A;  2AT1 B;  1FXX A;  5GAN e;  3RNJ A;  2HZY A;  4FT4 A;  4C8Q A;  3G71 Q;  4UP9 A;  3CCJ T;  1K1Z A;  4ZGJ B;  5KYX A;  4Z02 A;  3HFV A;  4OB2 B;  2AKK A;  1YI2 A;  3LSS A;  5CAI A;  5GMK m;  4P72 A;  2EPD A;  3CC2 A;  1BU1 A;  5DLO A;  4LDU A;  4AFU C;  1Y96 A;  2OTL A;  1WZO A;  4PJL A;  2M16 A;  3M4G A;  1VQ9 Q;  3IQL A;  2LZ6 B;  1K9M U;  3VQV A;  2RHQ A;  3FB9 A;  3ICA A;  5GAN 6;  1H3H A;  2P84 A;  3HHT B;  3M5A A;  4ZIB A;  2HQH A;  3P8B B;  2PMF A;  3CD6 A;  4DBF A;  4C0Z A;  2QXF A;  4EO4 A;  2ZCF B;  4HCK A;  5LJ5 g;  4P73 A;  2CH4 A;  4P71 C;  3HRS A;  9ATC B;  3QG1 A;  4KH1 B;  1XQH A;  2ZT6 A;  3HXX A;  5EG2 A;  3DLM A;  1YJ9 T;  4IUQ A;  1D3B A;  3RES A;  4O2D A;  3CMQ A;  2CZ1 B;  2DU5 A;  2LT4 A;  2DF6 A;  2JOY A;  3EGX A;  2RM4 A;  1PKS A;  4LVM A;  1YN8 A;  1RAG B;  3VS6 A;  2AKW B;  2KEA A;  4MZT A;  3VBB A;  2I2L A;  1HXD A;  1WX6 A;  1D1C A;  3TSW A;  2DQ0 A;  1VQ6 A;  3J81 E;  4P74 C;  1QVG S;  4M4Z A;  2FEI A;  4J6W A;  3PCO A;  1GCQ C;  2KR3 A;  3R07 A;  1B7Y A;  1YCY A;  1UJY A;  3CMA Q;  3LLR A;  5AYF A;  1KHI A;  4ATO A;  2EFI A;  1NPR A;  3BY7 A;  2KE9 A;  4M7A D;  4XK8 E;  1JJ2 P;  4PG3 A;  1G3W A;  2ARS A;  2LX7 A;  1IGU A;  3UDC A;  2LJ0 A;  4HWP A;  1AHJ B;  4B9W A;  1VQ5 T;  5KYW A;  4YRK A;  3CBO A;  4ELY C;  2VB6 A;  4DA4 A;  4X9C A;  1WJR A;  3CCS A;  4C92 F;  2FL7 A;  2K57 A;  5CR2 A;  1EVL A;  2ZZD A;  2C8M A;  4GY5 A;  1QVF A;  3C94 A;  4PHC A;  2LQ8 A;  1X69 A;  4LE9 A;  3PFS A;  4KH0 B;  3O5Z A;  1WIE A;  3VJP A;  2CZ6 B;  5GAO r;  2VC8 A;  2E6Z A;  1YHQ Q;  5GJV B;  5J26 A;  4XTU A;  2AIR B;  4LD9 K;  3VQW A;  2JJ9 A;  2QEX A;  3HY0 A;  2V8J A;  1X6O A;  3A1P A;  3VYH B;  1N8R C;  2CSQ A;  3QHS A;  1QQJ A;  1VQK A;  3THK A;  2DNU A;  2ATC B;  3MET A;  4NS5 A;  4M75 E;  3BJU A;  1M3C A;  2O31 A;  3JCM W;  1Z9Z A;  4YTL A;  1YI2 T;  1WHJ A;  3DB3 A;  2ZIO A;  2RK1 A;  2DU7 A;  1VQL A;  2RI5 A;  3CC2 T;  1YNZ A;  4YRL A;  3UH0 A;  3U23 A;  2XG8 D;  4KGX B;  4PFO A;  3CCQ T;  1H8K A;  1IRX A;  5I2S A;  3HFZ B;  1VQ8 Q;  5CCA A;  2RQR A;  2JXB A;  3OYY A;  3JCM d;  2COY A;  4B6M A;  1E24 A;  2RA2 A;  4P71 A;  4M75 B;  1M9S A;  1N27 A;  1PG5 B;  2FB7 A;  1PHT A;  2E12 A;  4FCY A;  1Y0M A;  5FWB A;  4RTY A;  2QDL A;  1M3B A;  5D6W A;  2VKN A;  3WVD B;  3P8Y A;  4AH6 A;  3E9F A;  3CCE A;  3OS0 A;  3OA6 A;  2LP5 A;  3BW1 A;  2YRD A;  1KQS S;  3EG0 A;  3CCU Q;  1J3T A;  4YRF A;  3JB9 F;  2CZ0 B;  2KRM A;  3I55 T;  4IUV A;  2HQE A;  2C0I A;  1M1G A;  4LD6 A;  4XU3 A;  2E3C A;  5FW9 A;  2KI7 A;  4XAX B;  1Q86 R;  2CUD A;  4DEY A;  2XDB A;  4J9E A;  1K0S A;  2QAS A;  1NE8 A;  2CDT A;  3RKX A;  1T0J A;  3LH0 A;  3ULR B;  4M7A C;  3OYM A;  1AEY A;  2XK0 A;  3QJY A;  5IHK A;  2ALY A;  1GCQ A;  1MMA A;  2CP7 A;  3CPF A;  1VQ6 T;  1QF6 A;  5I11 A;  1KK7 A;  3EGD B;  4A4K A;  3CXC P;  1Q86 U;  4IUT A;  2BIV A;  3OYN A;  1NPP A;  2EBP A;  2RHX A;  4XEM A;  3C4S A;  4OMO A;  5GJW B;  4BI3 A;  6AT1 B;  1VYV A;  2NUT B;  4O5V A;  1M1K R;  3A8O B;  2DYI A;  1Q7Y R;  3I35 A;  3QKJ A;  4XTW A;  4J5Y A;  2EJ9 A;  2BE9 B;  1GFD A;  2J3L A;  3CCR Q;  4E2F B;  4PJO G;  1VIF A;  5A0G A;  4P3O A;  1LOJ A;  1JB0 E;  3JB9 H;  2X9H A;  3M0T A;  2YRC A;  1Q7Y U;  2DE0 X;  3HRK A;  3TRE A;  1G83 A;  2FPF A;  2RHU A;  1OZ3 A;  4M77 F;  2YSQ A;  3G6E A;  2QQB A;  4CH3 A;  3CCS T;  5HK3 A;  1X54 A;  1AVZ C;  4YRM A;  4II1 A;  1X6G A;  4JJC A;  4R0K A;  2CJA A;  3JB9 D;  5KYU B;  1HSQ A;  3EHR A;  3LGL A;  3JCM e;  3OW2 P;  2RN8 A;  3G71 A;  2ZNJ A;  4L5G A;  2ZPB B;  4RG8 A;  2LQN A;  2OAW A;  3M57 A;  4L6V 5;  3RMS A;  4H2S A;  3KBG A;  5CO7 A;  2QEX T;  2DKG A;  2A37 A;  1GCP A;  3I5S A;  4UP7 A;  1PC0 A;  4PJM A;  3GP8 A;  4YRC A;  2DXU A;  1IO6 A;  1K4U S;  1RAD B;  1VQZ A;  1ZBX A;  1VQ9 A;  2VVK A;  3VV0 A;  1G5I A;  2DLP A;  1D09 B;  1UGR B;  2MMP A;  4YRO A;  4PFZ A;  4PKC C;  1BBW A;  3LWH A;  4FW1 A;  2DXB A;  5A2Q E;  2FPE A;  4LDV A;  4H2Y A;  1K8A C;  3GF5 A;  3JCM X;  3CPW S;  1ZSZ B;  4JJN K;  4OML A;  2DER A;  4Q15 A;  2HD0 A;  3EG3 A;  5GMK l;  4C5E A;  5LJ3 d;  2XDP A;  2DJZ A;  2H3J A;  1FMW A;  1BIB A;  2MWO A;  4A54 A;  2CS7 A;  3VS3 A;  2F2V A;  3CCL T;  2LDM A;  1GRI A;  2RJF A;  3LYI A;  3QBY A;  4IIM A;  1Y7X A;  2ABL A;  3PVL A;  2MF2 A;  3CCE T;  2DBM A;  4C92 E;  3M9Q A;  1LVK A;  3UGT A;  3MEA A;  1O75 A;  1UGQ B;  5GAN 5;  3OS2 A;  1X55 A;  2XGT A;  4RTV A;  4C5H A;  1QWF A;  2V26 A;  4F16 A;  4YCU A;  2JT4 A;  1NJI R;  1QVG P;  4YRT A;  1IL2 A;  1JXO A;  3CMA A;  2EYQ A;  2E5Q A;  1TUG B;  3A98 A;  3CBP A;  1JXM A;  4F04 B;  2QHV A;  4LVK A;  1VOM A;  4F14 A;  2RH2 A;  4C92 B;  3VS1 A;  3UA6 A;  1NJI U;  2O4X B;  4YPF A;  1RAC B;  1T3L A;  2A0F B;  5DLQ E;  5CK9 A;  2RJD A;  1YIT Q;  2Q7E A;  4M7D G;  3QWX X;  2EYX A;  3CC4 Q;  2QQS A;  1WDX A;  4IKF A;  1TWB A;  3SD4 A;  4RCC A;  3G1Z A;  3LWI A;  4FSS A;  4QQG A;  2DZ9 A;  4UPA A;  5ELN A;  1PYS A;  2RQT A;  1YHQ A;  2CH4 W;  1K73 R;  2OAU A;  1SEM A;  4DEX A;  3MCA B;  2P0P A;  2CSI A;  3HSB A;  2QQ9 A;  2XKO C;  2D1X A;  3L2Q A;  2K79 A;  2ZIN A;  4OMF B;  5LJ3 e;  4IUP A;  4H2V A;  3MP6 A;  4C0D C;  2QK0 A;  1PD0 A;  2DVE A;  5IH2 A;  1X2Q A;  4M7D C;  4RMF A;  2LJ3 A;  2DL8 A;  5LJ3 j;  2XDD A;  1YWP A;  4AFQ C;  2E41 A;  2HBP A;  1P92 A;  2M1H A;  2QA4 T;  1K76 A;  3TEH A;  4CC2 A;  2Y4Y A;  4ORZ A;  3QTC A;  2M0Y A;  1JJ2 A;  2ZZE A;  3OSV A;  4HWS A;  2L8D A;  1PM3 A;  4RTU A;  3CCV Q;  4CS2 A;  4EIK A;  1VQ8 A;  1WPY A;  2HQX A;  1YIJ T;  5IT9 E;  1F1B B;  4JDS A;  4C8Q G;  3OBY A;  4PJN A;  2DD4 A;  4F17 A;  4AG2 C;  5CIU A;  4C5G A;  2QGG A;  4BB7 A;  1IGQ A;  4E7J A;  2YT6 A;  4G85 A;  1PSF A;  3G1J A;  3URG A;  3FRN A;  2RPN A;  3CCU A;  2HBW A;  1B34 A;  3TEE A;  5GAM g;  1WLE A;  2NUP B;  1VQO T;  4FYY B;  1SER A;  4R56 A;  4E7L A;  2KXD A;  4M78 G;  1X2K A;  4M77 E;  3ME9 A;  3VKI A;  3WVE B;  3RBB B;  1OOT A;  1TOV A;  3I56 Q;  1SG5 A;  5FLX E;  2L3Q A;  3EGU A;  3PMT A;  1ZBJ A;  4PFP A;  2AKL A;  2KY9 A;  2L0A A;  4D8K A;  1I0C A;  4AFS C;  3RAC A;  1I8F A;  2QTX A;  3RMQ A;  2EQI A;  2ZXF A;  2Y4X A;  4RUG A;  2EQM A;  4M77 B;  2CT4 A;  2JZ2 A;  1PD1 A;  3P8D A;  1R0B G;  2VAS A;  5LJ5 d;  1C0M A;  3CCR A;  3IKM B;  1KMN A;  5FU6 C;  1WQ7 A;  1VQ4 Q;  3JV3 A;  1HC7 A;  1OI1 A;  4BE1 A;  5DY9 A;  3HXW A;  2K4Y A;  2KYM A;  5C6S A;  2P4T A;  2E3H A;  1IZ6 A;  2VV5 A;  4IUR A;  1VQ7 T;  3G4S Q;  4LUE A;  1M2V B;  3JSC A;  1MNE A;  3W3S A;  4QVD A;  4C8Q B;  1NYG A;  3VRZ A;  2ZT8 A;  5KYX B;  1WHH A;  1RI0 A;  2L3R A;  1LPL A;  2LMJ A;  1BI3 A;  1GBR A;  4ME7 A;  1TSF A;  4JUV A;  1ASY A;  1TXQ A;  4KRT A;  2D9T A;  4JZ3 A;  2X4W A;  3L4G A;  1Y96 B;  2ZCE A;  1OX9 A;  2BKD N;  2DFU A;  1UGV A;  3E9H A;  2LNV A;  2JMA A;  4OF1 A;  4OMP A;  2RHQ B;  2DET A;  2K5I A;  4EMH A;  1XJW B;  2L5Q A;  1BK2 A;  1V76 A;  2HKN A;  2KDS A;  4YRR A;  1IHW A;  3M58 A;  3V7R A;  5GAN 8;  1YFS A;  1WHL A;  2LQK A;  4MZM A;  3M55 A;  4FIB A;  2VYT A;  3KUF A;  5E3I A;  2HCK A;  2RMO A;  3RR6 A;  4F7U A;  1D3B B;  4BUG A;  3OYE A;  2M51 A;  3A31 A;  3EFO A;  3CPW P;  4VUB A;  1WI7 A;  1W70 A;  3CEY A;  4CRI A;  2EQJ A;  3EGX B;  1M90 C;  2Y90 A;  2X35 A;  3QYH B;  3NHN A;  5HK0 A;  1OU8 A;  5LJ5 h;  3BE3 A;  2KYB A;  4P3N A;  1AOJ A;  1QP2 A;  2DEQ A;  2ZR3 A;  1NYF A;  2J05 A;  2EGC A;  3A7U A;  5LJ5 e;  2KMT A;  2P0K A;  2D6F A;  2X4X A;  4ZTU B;  3PCO B;  3OW2 A;  2ED0 A;  1KD1 U;  2X51 A;  2YRV A;  5GMK i;  1Q81 R;  1B7Y B;  2R5M A;  2ROL A;  4EMK A;  1K9M R;  1NJ5 A;  5LJ5 j;  1PRL C;  1M1F A;  1ZLM A;  1MUZ A;  4P75 C;  1NJ8 A;  4M7A F;  2DTH A;  2J7I A;  1RLQ C;  3M0P A;  4QT7 A;  2O2O A;  2AZV A;  4TVA A;  1Q81 U;  1TUC A;  3M0Q A;  1BI0 A;  1DJ7 B;  3M59 A;  5KYW B;  4J9B A;  2SEM A;  1VYT A;  4MDW A;  2MK5 A;  5A0D A;  1E7O A;  3CC7 Q;  1RAF B;  2PZ1 A;  5GAN 2;  3E1S A;  3UF4 A;  4Y91 A;  4EDU A;  1YIT A;  3M54 A;  4HVU A;  3MEU A;  3CC4 A;  1MMN A;  2DM1 A;  3HTR A;  3QII A;  4HVW A;  2EJF A;  1YJW T;  5EC7 A;  1Z7M A;  3C0C A;  2K3X A;  2ZZF A;  2X4Y A;  3H8Z A;  2EIF A;  3SHW A;  5GAN g;  3MQZ A;  3VRY A;  2KNB B;  3M0R A;  5GAN 7;  2RD1 A;  1ATI A;  2J6O A;  5A0L A;  2ZGW A;  2XIC A;  3HFN A;  1VQM T;  2HKQ B;  4JLI A;  1YJN Q;  3NMZ C;  4XU1 A;  1UGP B;  5C52 B;  2DL7 A;  3C12 A;  1B70 A;  3R6N A;  3LGF A;  5GAN f;  4HT8 A;  1QVG A;  4JJB A;  2J6F A;  1M27 C;  1G8X A;  1BBU A;  4RDX A;  1QW1 A;  1V1C A;  2QHS A;  4AT1 B;  2DO3 A;  4M75 G;  2PVD B;  2EAY A;  4TTV A;  3FJ5 A;  1RAI B;  3SB2 A;  2OTJ Q;  3RIR A;  2QAZ A;  1BIA A;  3X26 B;  5FRM A;  3CCV A;  5GAO l;  3RKW A;  1S72 Q;  3HXU A;  5IHI A;  12AS A;  2J06 A;  1R8O B;  3RUX A;  4MMK A;  3DB4 A;  5FWC A;  4QQD A;  1GXI E;  3H6Z A;  1WYX A;  2X3W D;  1MGQ A;  3SWN A;  2W0Z A;  1QVF S;  2FO0 A;  4KGZ B;  2J3M A;  3NEM A;  1UG1 A;  4Q5W A;  2C0O A;  2PVG B;  3WXM B;  1B76 A;  1KIK A;  4LXC A;  2LX9 A;  2CJ9 A;  2ZR2 A;  1H4Q A;  3JAM E;  4YRS A;  2FRW A;  2XU8 A;  1X43 A;  2ZIM A;  3WQZ A;  1WXT A;  2ALY B;  2LVM A;  2CIM A;  3NTK A;  3FDR A;  3I9Q A;  2JM8 A;  4HWR A;  4PL6 A;  2FPD A;  1UDL A;  3JCM J;  1G5H A;  4L59 A;  1PWT A;  4J9G A;  4PJO D;  2K6D A;  2OTL T;  5GAO p;  2DDZ A;  5KCO A;  4CC4 B;  4DOV A;  2YLC A;  1I5L A;  4OLF A;  1N8R R;  1VQ4 A;  3V7C A;  2RQV A;  3CD6 T;  4H2T A;  1AT1 B;  2GQV A;  4TQD A;  4KR3 A;  1UHC A;  3CCM Q;  3G4S A;  1W2B S;  4X1V A;  1N8R U;  4NCX A;  3CC4 T;  1VQN Q;  3MP1 A;  1ZX6 A;  2RJC A;  1XTD A;  5CVI A;  1KQS A;  3OYL A;  1XNI A;  4P74 A;  2DTI A;  1NZ9 A;  4AMC A;  5FU7 C;  1HTT A;  4RKU E;  3CCJ Q;  2YUN A;  2JVV A;  1G5V A;  1KJW A;  1M1K C;  2CP2 A;  4RMO A;  1T0H A;  1AWJ A;  1Q7Y C;  1FX7 A;  4BDZ A;  1VQP A;  5DM7 R;  2YWW A;  1ZHI A;  1RAE B;  2PUO B;  4H2X A;  1EIY A;  2ZNI A;  2F5T X;  5GAO q;  5I2M A;  3O8V A;  4BW9 A;  2E6N A;  4C0F A;  3UT1 A;  3QNE A;  3A8H B;  1UHF A;  2CP5 A;  4MZP A;  4PLL A;  1MV0 B;  3EFS A;  4GLK A;  4OP0 A;  4YDQ A;  2AK5 A;  2QQA A;  4M7A E;  4E47 A;  3L2U A;  4WCI A;  4KUI A;  3LW5 E;  2IY5 A; 
#chains in the Genus database with same CATH homology
 2Q7G A;  2BUD A;  1OYX A;  4F7U F;  3JB9 I;  1X2H A;  3MO8 A;  2QHT A;  3OYG A;  3V8J A;  3CBM A;  4J7I A;  4X5O A;  1BI2 A;  4ZTZ B;  3BDU A;  5GMK h;  3LC0 A;  3FIF A;  4M7A B;  3NET A;  2IVW A;  1EQR A;  1VUB A;  4C92 G;  4PJO C;  4XQ3 A;  4OB1 B;  2HAX A;  1USY C;  3DKM A;  1KC8 U;  2KVQ G;  4IUU A;  3V8K A;  3L2Z A;  3OYK A;  1VQK T;  4J15 A;  2XTI A;  3M4P A;  3CC7 A;  3OYB A;  3RKY A;  5IAY A;  4M7D D;  5CKF A;  2A8E A;  3AHU A;  3A32 A;  1VQL T;  1KQ1 A;  4FSX A;  1MHN A;  2VXE A;  3OMG A;  4A4G A;  1G3S A;  3HP9 A;  3CPW A;  3RF1 A;  4JS4 A;  1PYS B;  2IG0 A;  4C92 C;  2X4J A;  3OS1 A;  3A74 A;  2LC4 A;  3E9I A;  3JCM g;  5GAM d;  3REX A;  4YRP A;  4M7A A;  4XTV A;  5CKE A;  1YJN A;  1Q82 U;  1H64 1;  3PIP A;  2HNI A;  4J6X A;  4YRI A;  3TEH B;  3GLX A;  3JCM f;  3GNG A;  2ZTG A;  1K8A U;  3ZBD A;  4LDY A;  3VQX A;  2EQK A;  1YBY A;  2Q5H A;  1VQP T;  2V8K A;  3SFM A;  3KFU A;  2OTJ A;  3REU A;  4OVA A;  4UP8 A;  4QVZ A;  2P0Q A;  2K3Y A;  5C51 B;  1S72 A;  5CKH A;  4P5N A;  2DZC A;  1OZ2 A;  1K73 C;  2YLB A;  3E19 A;  3VQY A;  5IN1 A;  1B34 B;  3OY9 A;  1N9R A;  3OMC A;  2WAC A;  3Q1J A;  4KUL A;  3JCM c;  1KOG A;  2L89 A;  4EMG A;  3G6E T;  4M78 D;  3UFG A;  3QYG B;  1SET A;  5F5W A;  1X01 A;  2RHY A;  1N6A A;  5GAO m;  3L2W A;  4OB0 B;  1G3T A;  5FRO A;  1RL2 A;  3G71 T;  4PJO A;  4M77 G;  5GAM h;  1USY A;  11AS A;  1U8R A;  4KT0 E;  4RCB A;  5GAM e;  1FWZ A;  2AMC A;  3N5B B;  3J80 E;  2LTO A;  5GAM j;  3QDR B;  2LCC A;  1VQ9 T;  1JJ2 S;  1WYD A;  1H4V B;  2MWP A;  4D6W A;  4N4G A;  1LJO A;  3OYF A;  5CKB A;  3CCM A;  3E9G A;  1X56 A;  2DIG A;  3NTI A;  5LJ3 g;  2A7Y A;  1U1T A;  2RHS A;  3ZEH A;  3L4G B;  2GFU A;  4PLI A;  4F7U E;  3FC3 A;  3HY1 A;  3CCJ A;  2QQR A;  3HXZ A;  4RQE A;  2E5A A;  4BE0 A;  2K5L A;  2V8I A;  4C8Q C;  1YJN T;  5LJ3 f;  2QHU A;  3V7S A;  2RB6 A;  3CMA T;  4HWT A;  4P72 C;  3F70 A;  4BI4 A;  4F7U B;  4XTX A;  5K1P A;  1WQW A;  3RGL A;  4UC4 A;  3PIO A;  5HGQ A;  4BDY A;  3L2R A;  5KNN A;  4M78 C;  1VIE A;  1KQ2 A;  1UGS B;  4N4H A;  4RQF A;  4JS5 A;  1YJ9 A;  2DTO A;  3PGG A;  3EAE A;  3A5Y A;  4H2W A;  4EPC A;  4P73 C;  2KQW A;  4C5I A;  4QVC A;  3X24 B;  1JRI A;  4E7K A;  4EMK B;  1YHQ T;  4MDX A;  1M4Z A;  3OS5 A;  2I4O A;  3IG2 A;  3HRU A;  4TVA B;  1EVK A;  4BD3 A;  4BY6 B;  2I4N A;  1N9W A;  4M7D A;  4NL3 A;  4O6J A;  4YP0 A;  2CKK A;  1QVP A;  4WJ4 A;  2RK2 A;  2QI2 A;  3CXC S;  4BWA A;  2MI6 A;  3A7R A;  4LNS A;  2EJG A;  1SSF A;  2ZPE B;  3JCM V;  1VQ5 A;  2F69 A;  4HT9 A;  1JJC A;  2XI9 A;  3ER0 A;  3OB9 A;  3KXT A;  1VQ8 T;  2DXT A;  2JUF A;  4A53 A;  2K2V A;  2DQ3 A;  1K9M C;  4FM4 B;  4CS3 A;  1E22 A;  3ZFJ A;  1V29 B;  3A7A A;  3CCM T;  3CCU T;  1IRE B;  4ZN3 A;  2EKO A;  4HCC A;  1B70 B;  1KG1 A;  2XD0 A;  3TCJ A;  2DXC A;  5GAN h;  2DIQ A;  2NS6 A;  4M75 D;  4B9X A;  3PMI A;  1KHC A;  2B8A A;  3LSQ A;  1ADJ A;  3MEY A;  4ZTJ A;  3OYC A;  5GAN j;  2EQU A;  1M90 U;  3HL8 A;  3CCQ A;  3PTA A;  3S3O A;  4XTZ A;  3T9N A;  3SWN B;  3CCR T;  4M78 A;  4N0A C;  1M8V A;  4XTY A;  2DPP B;  4XU0 A;  1NYR A;  2E64 A;  1X2G A;  3S3N A;  1I81 A;  2XHC A;  3FEO A;  4KR2 A;  4MML A;  2JTM A;  3I55 A;  3JRZ A;  2ZPF B;  3MEW A;  4L87 A;  5KH6 A;  3JCM P;  3OYI A;  1LNX A;  5LJ5 f;  4PNO A;  4A4E A;  3A5Z A;  3QPH A;  4FT2 A;  2ODR D;  3GNF B;  4PJO F;  2O01 E;  2D0Q B;  3VYG A;  1E1T A;  1H4T A;  3QO7 A;  4YRN A;  2EWN A;  1NNH A;  4A4F A;  4DOW A;  4JRQ A;  3OYA A;  3FLG A;  4KUD K;  1J5W A;  2M0O A;  3OYH A;  4OGC A;  2LT1 A;  2CZ7 B;  2EL9 A;  1EFW A;  4J8O A;  2GFA A;  4P3P A;  4M75 C;  2MAM A;  3QJ6 A;  5HKC A;  5ELO A;  3IAL A;  4H02 A;  1PSE A;  1W66 A;  4H2X B;  3I56 A;  1EIY B;  3JCM Q;  4P75 A;  3VU3 C;  1YFR A;  2R57 A;  1GGM A;  2AKW A;  4C0G A;  4BE2 A;  4QQ6 A;  3GOX A;  4TVR A;  2IY5 B;  1UB4 A;  3A8G B;  1HK9 A;  2DAQ A;  2RI2 A;  4OGE A;  3MEV A;  4QW2 A;  4M7A G;  5CKD A;  1BYM A;  4N0A A;  1YIT T;  4HCB A;  1Q86 C;  3CCL A;  2DD5 A;  4TVY A;  4G84 A;  1EOV A;  3HXV A;  1W2B A;  4C92 D;  3ASK A;  4HCZ A;  2KAF A;  2ODR C;  4BI8 B;  1UEB A;  2VGM A;  1XOV A;  5D6Y A;  5KE3 A;  2ZT5 A;  4HT4 A;  2G4C A;  3NEL A;  3M53 A;  3OBW A;  4M7D F;  3QSU A;  2Q7H A;  2LCL A;  3V8L A;  4BAC A;  1SES A;  3UPU A;  1FYF A;  1WGS A;  3HRI A;  4WF2 A;  1KMM A;  3FJP A;  3HFO A;  4ELZ C;  3CCV T;  4TWA A;  1U1S A;  3C95 A;  1KC8 C;  4K87 A;  2G3R A;  2ZZG A;  2GCX A;  4RG2 A;  3HFZ A;  4TVW A;  1M1K U;  3TEG A;  5D6X A;  5FU7 B;  5GMK e;  2FYK A;  1ASZ A;  2C7I A;  4M75 A;  4DPG A;  1YGB A;  3JB9 J;  4YRG A;  2RHI A;  5GMK j;  2RO0 A;  4NL2 A;  3JCM h;  3GPL A;  3M56 A;  4EX5 A;  4V2S A;  1YB3 A;  3NFC A;  2ZPI B;  4HVC A;  2VXF A;  4HKE A;  3I56 T;  3L42 A;  1NYQ A;  1NJ6 A;  3P8H A;  4C8Q F;  2QA4 A;  2PUK B;  4YRQ A;  1BI1 A;  4E7H A;  2RHZ A;  5I21 A;  2DK3 A;  1Q82 C;  1YIJ A;  4PJO E;  4FU6 A;  4WJ3 M;  3OQ5 A;  3A8L B;  4KQE A;  1G51 A;  2JTF A;  2GF7 A;  3L1A A;  1VQ4 T;  1ZQ1 A;  1QE0 A;  4JRP A;  3P8V A;  4ZN1 A;  2I4M A;  4M78 F;  4NOY A;  3DLL A;  4YRJ A;  1NJI C;  4A4H A;  2CGH A;  3G4S T;  4XEO A;  4FL6 A;  3P8T A;  1C0A A;  1VQO A;  3NTH A;  4PJO B;  5CQX A;  3QO8 A;  4M77 D;  3OYD A;  3RER A;  2RI3 A;  2AMC B;  1NJ2 A;  2E1H A;  3JB9 G;  4JRK A;  4LDX A;  5KE2 A;  5C0M A;  4KBM B;  4Q6G A;  2PQW A;  2R5A A;  4R55 A;  1YFT A;  4C8Q D;  3SDZ A;  1G3Y A;  3PNW C;  3VUB A;  2CYZ B;  3HKS A;  4J83 A;  4LDW A;  2ZPH B;  3S3M A;  1WJQ A;  3A8M B;  3MP8 A;  1N9S A;  4LVI A;  3M4Y A;  1VQ7 A;  2QDY B;  2WSF E;  3I7F A;  2LRQ A;  5HY6 A;  3NEN A;  2RHS B;  2E65 A;  4YCV A;  2KK4 A;  4E51 A;  4J6Y A;  2FHD A;  2FVU A;  3INZ A;  3QXE B;  4K88 A;  4YRE A;  1Y07 A;  2ZPG B;  4E7I A;  4CH4 A;  5FRN A;  4CS4 A;  4F7U G;  5LL6 S;  3MF1 A;  4ZGE B;  5LJ3 h;  3ERR A;  1Z7N A;  3IKL A;  2A3L A;  1K73 U;  3G7Z A;  2I4L A;  4LVJ A;  1NJ1 A;  3R6O A;  4CH5 A;  3M4Q A;  4JLG A;  4XU2 A;  3CC7 T;  3OD1 A;  1SRY A;  2YHT A;  2M9U A;  4M7D E;  3QZ9 B;  4C92 A;  2C06 A;  1VQN A;  4X34 A;  2O4X A;  5J3B A;  4M77 C;  3CME A;  3VUZ A;  2P5I A;  2VUB A;  1Y71 A;  4CH6 A;  1O9S A;  5GAO n;  4C0D B;  3HPW A;  3EFR A;  4ZGD B;  4M7D B;  2JN0 A;  5K1X A;  2VGN A;  5CQY A;  3S6W A;  2ZT7 A;  1W4S A;  5M9O A;  3HXY A;  3MHX A;  1X75 C;  2F5K A;  3OSS C;  4EMK C;  3QUI A;  3OYJ A;  2WSE E;  4J7F A;  5GAN 4;  5J39 A;  1JJC B;  5GAN 3;  5GAM f;  4HWO A;  1QP3 A;  4H2U A;  4BY6 C;  5L8R E;  2RJE A;  4YCW A;  2OTJ T;  1H3Z A;  4OB3 B;  3HTZ A;  1S72 T;  1E1O A;  4C8Q E;  3RL6 A;  1YJW A;  3X28 B;  4HA8 A;  5GAN d;  1WU7 A;  5KCH A;  2WSC E;  2P0L A;  2ART A;  3TU4 K;  4LVL A;  4N4I A;  3UWN A;  2KSS A;  3GIB A;  3BFM A;  2E10 A;  3DSQ A;  1JBM A;  4JRI A;  4M75 F;  2JNG A;  4ZTF A;  1VQM A;  2Q5I A;  4YYE A;  4X9D A;  4M78 E;  3J7A F;  3PZC A;  1I4K 1;  2NLU A;  4CI0 C;  2PME A;  4K86 A;  3QO5 A;  4WI1 A;  5FU6 B;  2K5F A;  5C53 B;  3PT9 A;  2R58 A;  3QO3 A;  1KD1 C;  4M78 B;  3X20 B;  3CXC A;  1EIF A;  4DQ2 A;  3JCM b;  2E70 A;  2ARU A;  3LX7 A;  3HRT A;  1Q81 C;  3TUP A;  4M77 A;  3MF2 A;  1RIQ A;  1ADY A;  3BDL A;  1M5Q 1;  1WNL A;  1L0W A;  1WJS A;  2XID A;  2PVO B;  2AHJ B;  1VQN T;  3UGQ A;  1LYL A;  1BKB A;  3X25 B;  3CME T;  3SWN C;  1TH7 A;  3L2V A;  3QZ5 B;  3OW2 S;  4Y28 E;  3A5Z B;  2CJB A;  2PU9 B;  1B8A A;  1H4S A;  4TQF A;  1FXX A;  5GAN e;  4FT4 A;  4C8Q A;  4UP9 A;  3CCJ T;  4ZGJ B;  4Z02 A;  3HFV A;  4OB2 B;  1YI2 A;  3LSS A;  5CAI A;  5GMK m;  4P72 A;  3CC2 A;  5DLO A;  4LDU A;  1Y96 A;  2OTL A;  2M16 A;  3M4G A;  1K9M U;  3VQV A;  2RHQ A;  3FB9 A;  3ICA A;  5GAN 6;  3HHT B;  3M5A A;  4ZIB A;  3P8B B;  2PMF A;  3CD6 A;  4C0Z A;  2QXF A;  4EO4 A;  2ZCF B;  5LJ5 g;  4P73 A;  4P71 C;  3HRS A;  3QG1 A;  1XQH A;  2ZT6 A;  3HXX A;  5EG2 A;  3DLM A;  1YJ9 T;  4IUQ A;  1D3B A;  3RES A;  4O2D A;  3CMQ A;  2CZ1 B;  2DU5 A;  2LT4 A;  2JOY A;  2RM4 A;  4LVM A;  2AKW B;  4MZT A;  3VBB A;  2I2L A;  1HXD A;  2DQ0 A;  1VQ6 A;  3J81 E;  4P74 C;  1QVG S;  4J6W A;  3PCO A;  3R07 A;  1B7Y A;  1YCY A;  3LLR A;  5AYF A;  1KHI A;  4ATO A;  2EFI A;  1NPR A;  3BY7 A;  4M7A D;  4XK8 E;  4PG3 A;  1G3W A;  2ARS A;  3UDC A;  4HWP A;  1AHJ B;  4B9W A;  1VQ5 T;  4YRK A;  3CBO A;  4ELY C;  4DA4 A;  4X9C A;  1WJR A;  3CCS A;  4C92 F;  2FL7 A;  2K57 A;  5CR2 A;  1EVL A;  2ZZD A;  2C8M A;  4GY5 A;  1QVF A;  3C94 A;  4PHC A;  2LQ8 A;  3PFS A;  3VJP A;  2CZ6 B;  5GAO r;  2VC8 A;  2E6Z A;  5J26 A;  4XTU A;  4LD9 K;  3VQW A;  2QEX A;  3HY0 A;  2V8J A;  1X6O A;  3VYH B;  1N8R C;  3QHS A;  1VQK A;  3MET A;  4NS5 A;  4M75 E;  3BJU A;  3JCM W;  4YTL A;  1YI2 T;  3DB3 A;  2ZIO A;  2RK1 A;  2DU7 A;  1VQL A;  2RI5 A;  3CC2 T;  4YRL A;  3UH0 A;  2XG8 D;  3CCQ T;  5I2S A;  3HFZ B;  5CCA A;  3OYY A;  3JCM d;  1E24 A;  2RA2 A;  4P71 A;  4M75 B;  1M9S A;  1N27 A;  2FB7 A;  2E12 A;  5D6W A;  3WVD B;  3P8Y A;  4AH6 A;  3E9F A;  3CCE A;  3OS0 A;  3OA6 A;  3BW1 A;  1KQS S;  4YRF A;  3JB9 F;  2CZ0 B;  3I55 T;  4IUV A;  2HQE A;  1M1G A;  4LD6 A;  4XU3 A;  2E3C A;  4XAX B;  2XDB A;  1NE8 A;  3RKX A;  4M7A C;  3LH0 A;  3OYM A;  2XK0 A;  3QJY A;  2ALY A;  3CPF A;  1VQ6 T;  1QF6 A;  1Q86 U;  4A4K A;  4IUT A;  2BIV A;  3OYN A;  1NPP A;  2RHX A;  4XEM A;  3C4S A;  4BI3 A;  4O5V A;  3A8O B;  3QKJ A;  4XTW A;  4J5Y A;  2EJ9 A;  2J3L A;  4PJO G;  1VIF A;  5A0G A;  4P3O A;  1LOJ A;  1JB0 E;  3JB9 H;  1Q7Y U;  3HRK A;  3TRE A;  2RHU A;  1OZ3 A;  4M77 F;  3G6E A;  2QQB A;  4CH3 A;  3CCS T;  5HK3 A;  1X54 A;  4YRM A;  4II1 A;  2CJA A;  3JB9 D;  3LGL A;  3JCM e;  2ZNJ A;  3G71 A;  4L5G A;  2ZPB B;  4RG8 A;  3M57 A;  4L6V 5;  3RMS A;  4H2S A;  3KBG A;  5CO7 A;  2QEX T;  2DKG A;  4UP7 A;  3GP8 A;  4YRC A;  2DXU A;  1VQZ A;  1ZBX A;  1VQ9 A;  3VV0 A;  1G5I A;  1UGR B;  2MMP A;  4YRO A;  4PKC C;  1BBW A;  3LWH A;  2DXB A;  5A2Q E;  4LDV A;  4H2Y A;  1K8A C;  3GF5 A;  3JCM X;  3CPW S;  4JJN K;  4Q15 A;  2HD0 A;  5GMK l;  4C5E A;  5LJ3 d;  2XDP A;  2DJZ A;  2H3J A;  1BIB A;  2MWO A;  4A54 A;  2CS7 A;  3CCL T;  2LDM A;  2RJF A;  3LYI A;  3QBY A;  1Y7X A;  2MF2 A;  3CCE T;  4C92 E;  3M9Q A;  3UGT A;  3MEA A;  1O75 A;  1UGQ B;  5GAN 5;  3OS2 A;  1X55 A;  2XGT A;  4C5H A;  4YCU A;  4YRT A;  1IL2 A;  3CMA A;  2EYQ A;  2E5Q A;  3CBP A;  2QHV A;  4LVK A;  2RH2 A;  4C92 B;  1NJI U;  2O4X B;  4YPF A;  5DLQ E;  5CK9 A;  2RJD A;  2Q7E A;  4M7D G;  2QQS A;  4IKF A;  3SD4 A;  4RCC A;  3G1Z A;  3LWI A;  4QQG A;  2DZ9 A;  4UPA A;  5ELN A;  1PYS A;  1YHQ A;  2OAU A;  3MCA B;  2P0P A;  3HSB A;  2QQ9 A;  2XKO C;  3L2Q A;  2ZIN A;  4OMF B;  5LJ3 e;  4IUP A;  4H2V A;  3MP6 A;  4C0D C;  2DVE A;  4M7D C;  4RMF A;  2XDD A;  5LJ3 j;  2E41 A;  2HBP A;  1P92 A;  2M1H A;  2QA4 T;  3TEH A;  2Y4Y A;  3QTC A;  1JJ2 A;  2ZZE A;  3OSV A;  4HWS A;  2L8D A;  4CS2 A;  1VQ8 A;  1WPY A;  2HQX A;  1YIJ T;  5IT9 E;  4JDS A;  4C8Q G;  3OBY A;  2DD4 A;  5CIU A;  4C5G A;  4BB7 A;  4E7J A;  4G85 A;  1PSF A;  3URG A;  3FRN A;  3CCU A;  1B34 A;  3TEE A;  5GAM g;  1WLE A;  1VQO T;  1SER A;  4R56 A;  4E7L A;  4M78 G;  4M77 E;  3ME9 A;  3VKI A;  3WVE B;  5FLX E;  3PMT A;  2KY9 A;  3RAC A;  1I8F A;  2QTX A;  3RMQ A;  2ZXF A;  2Y4X A;  2EQM A;  4M77 B;  2JZ2 A;  3P8D A;  5LJ5 d;  3CCR A;  3IKM B;  1KMN A;  5FU6 C;  1WQ7 A;  1HC7 A;  1OI1 A;  4BE1 A;  5DY9 A;  3HXW A;  2K4Y A;  5C6S A;  2P4T A;  2VV5 A;  1IZ6 A;  4IUR A;  1VQ7 T;  3JSC A;  3W3S A;  4QVD A;  4C8Q B;  2ZT8 A;  1RI0 A;  2L3R A;  1BI3 A;  4ME7 A;  4JUV A;  1ASY A;  2D9T A;  3L4G A;  2X4W A;  1Y96 B;  2ZCE A;  2BKD N;  3E9H A;  2LNV A;  4OF1 A;  2RHQ B;  2K5I A;  4EMH A;  2L5Q A;  2KDS A;  4YRR A;  3M58 A;  3V7R A;  5GAN 8;  1YFS A;  2LQK A;  4MZM A;  3M55 A;  4FIB A;  2VYT A;  3KUF A;  5E3I A;  4F7U A;  1D3B B;  4BUG A;  3OYE A;  3A31 A;  4VUB A;  3CEY A;  4CRI A;  2EQJ A;  1M90 C;  2Y90 A;  2X35 A;  3QYH B;  5HK0 A;  5LJ5 h;  4P3N A;  1QP2 A;  2DEQ A;  2ZR3 A;  3A7U A;  5LJ5 e;  2KMT A;  2P0K A;  2D6F A;  2X4X A;  4ZTU B;  3PCO B;  3OW2 A;  1KD1 U;  2YRV A;  5GMK i;  1B7Y B;  2R5M A;  4EMK A;  1NJ5 A;  5LJ5 j;  1M1F A;  4P75 C;  1NJ8 A;  4M7A F;  2DTH A;  4TVA A;  1Q81 U;  1BI0 A;  1DJ7 B;  3M59 A;  4MDW A;  5A0D A;  5GAN 2;  3E1S A;  4Y91 A;  4EDU A;  1YIT A;  3M54 A;  3MEU A;  3CC4 A;  3QII A;  2EJF A;  1YJW T;  1Z7M A;  2K3X A;  2ZZF A;  2X4Y A;  3H8Z A;  2EIF A;  5GAN g;  3MQZ A;  5GAN 7;  2RD1 A;  1ATI A;  5A0L A;  2ZGW A;  2XIC A;  3HFN A;  1VQM T;  4JLI A;  4XU1 A;  1UGP B;  5C52 B;  3C12 A;  1B70 A;  4HT8 A;  3LGF A;  5GAN f;  1QVG A;  1BBU A;  4RDX A;  1QW1 A;  2QHS A;  2DO3 A;  4M75 G;  2PVD B;  2EAY A;  4TTV A;  3SB2 A;  3RIR A;  1BIA A;  3X26 B;  5FRM A;  3CCV A;  5GAO l;  3RKW A;  3HXU A;  12AS A;  1GXI E;  1R8O B;  3RUX A;  4MMK A;  3DB4 A;  4QQD A;  3H6Z A;  1MGQ A;  3SWN A;  1QVF S;  2J3M A;  3NEM A;  4Q5W A;  2PVG B;  3WXM B;  1B76 A;  2LX9 A;  2CJ9 A;  2ZR2 A;  1H4Q A;  3JAM E;  4YRS A;  2XU8 A;  2ZIM A;  3WQZ A;  2ALY B;  2LVM A;  2CIM A;  3NTK A;  3FDR A;  4HWR A;  4PL6 A;  3JCM J;  1G5H A;  4L59 A;  4PJO D;  2OTL T;  5GAO p;  2DDZ A;  5KCO A;  4DOV A;  2YLC A;  1I5L A;  4OLF A;  1VQ4 A;  3V7C A;  3CD6 T;  4H2T A;  2GQV A;  4TQD A;  4KR3 A;  3G4S A;  1W2B S;  1N8R U;  4NCX A;  3CC4 T;  3MP1 A;  2RJC A;  1XTD A;  5CVI A;  1KQS A;  3OYL A;  1XNI A;  4P74 A;  2DTI A;  1NZ9 A;  5FU7 C;  1HTT A;  4RKU E;  2JVV A;  1G5V A;  1M1K C;  4RMO A;  1Q7Y C;  1FX7 A;  4BDZ A;  1VQP A;  5DM7 R;  1ZHI A;  2PUO B;  4H2X A;  1EIY A;  2ZNI A;  2F5T X;  5GAO q;  5I2M A;  3O8V A;  4BW9 A;  2E6N A;  4C0F A;  3UT1 A;  3QNE A;  3A8H B;  4MZP A;  4PLL A;  3EFS A;  4GLK A;  4OP0 A;  4YDQ A;  2QQA A;  4M7A E;  4E47 A;  3L2U A;  4KUI A;  3LW5 E;  2IY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...