3RUXA

Crystal structure of biotin-protein ligase bira from mycobacterium tuberculosis in complex with an acylsulfamide bisubstrate inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate Adenylation Inhibitors of Biotin Protein Ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords BirA bifunctional protein
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ruxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ruxA01
4M7DF 5F5WA 3A31A 2XTIA 5GAN5 3NENA 4K86A 4YRJA 11ASA 4H2XB 4RMFA 2QHVA 4EX5A 4YRSA 4YROA 2ZZFA 5GANj 3UGTA 4PHCA 5GANe 3FB9A 2AMCA 3ICAA 2P0LA 1QE0A 2E64A 4CH6A 4EMKB 1GGMA 5C53B 1N9WA 5K1XA 2ZIOA 5GMKi 4JUVA 5GAN8 2VC8A 4JLIA 4NL3A 4F7UG 4EO4A 4P3PA 4EMHA 3I7FA 3HXZA 1H641 3JCMQ 1B34A 4XU2A 1KOGA 5C51B 3JCMe 4YCUA 3MF2A 4XTWA 4PJOA 5GMKe 1ASZA 3BDUA 3RACA 3PZCA 4XTUA 1NJ2A 4M7DG 2I4LA 4H2XA 4P73C 3V8LA 3EFSA 4M77B 2ZCEA 4P72A 1PYSA 5GAMd 1IL2A 4M75E 4EMKA 2AKWB 5LJ5g 5ELOA 3AHUA 2IY5B 4C92A 3LC0A 1JJCA 5GMKm 5GAN6 3VQVA 2DKGA 4C8QF 4YRFA 4F7UA 4N0AC 2K57A 1I4K1 2DXTA 1Y96A 1B7YA 2ZT5A 4LNSA 4TQFA 4H2UA 3QO7A 4X9DA 2DU7A 4YRIA 4QVDA 1NNHA 2ZTGA 5LJ3h 1E1TA 2CJBA 2DTHA 2DZ9A 4M75A 1NYQA 4YRRA 4C8QC 3UFGA 1W66A 1H4SA 3E9IA 4G85A 4C8QE 3JCMh 4C92C 1ATIA 1NJ1A 4JRIA 1HC7A 12ASA 3HFZB 4Y91A 5LJ3j 4XU1A 1EVKA 1WPYA 4YRGA 5GAOm 3RGLA 3RKYA 1EIYA 3HTZA 3HXVA 4M7DE 5LJ5h 1WU7A 3V8JA 3REXA 4PJOE 2ARTA 1G5HA 4HWRA 5KNNA 4ZIBA 2DU5A 3HFNA 4UP8A 3RIRA 2Q7EA 4NOYA 4QVCA 2ALYB 3A5YA 4RQEA 4RCBA 2ZNJA 4OLFA 1E22A 5LJ5f 4C8QA 4J6YA 1D3BA 3L1AA 3A7AA 5GAN4 2I4OA 1NJ6A 5CAIA 3HY0A 2ODRC 2Q5HA 5GAOp 1EQRA 3RKXA 3HXWA 2DTOA 4H2SA 5LJ3g 1J5WA 3VQWA 3R07A 4M77A 3WQZA 1MGQA 4TQDA 1LNXA 4PJOF 3RESA 3JB9G 4PG3A 1G51A 3JCMg 3SB2A 3BW1A 4PJOB 2DZCA 1D3BB 4G84A 4X5OA 4TVAB 4TVWA 4M7AD 3TEGA 4CS2A 2EJGA 1BIBA 5GAOq 4J5YA 2EL9A 1H4VB 1M5Q1 3IKMB 3G1ZA 2DQ3A 3TEHA 4C8QB 4P71C 4YRPA 5GANf 1N9SA 2EJFA 4TTVA 3UH0A 3SWNC 4RQFA 4BW9A 4M7AA 4KR2A 3M4GA 3HFZA 3RL6A 4M78B 4RCCA 2QHUA 2ZR2A 4M75D 2HNIA 1B76A 4P74C 1SRYA 2ZINA 1I8FA 4MMLA 1H4TA 3PGGA 5GMKh 2CIMA 3KFUA 2FB7A 3QHSA 4XU0A 3RERA 4CS3A 2E65A 1YCYA 4MMKA 4CH4A 2EWNA 5GAN3 1YB3A 2ZT8A 3QUIA 1EFWA 3JCMV 4KQEA 4F7UF 2ZR3A 4M75B 3HXUA 1Z7MA 4WJ4A 4C8QD 4F7UB 4Q6GA 4M77E 3VQXA 3MF1A 5GANd 1X54A 5GAMj 5GAMe 2QHTA 2DVEA 3BJUA 1WNLA 1ASYA 5GAN7 4P75A 4PJOD 1KMNA 4M7DB 3DSQA 5E3IA 4M7AB 2J3LA 2Q7HA 3OD1A 4YRMA 5ELNA 1YFTA 1QF6A 3JCMJ 1X2HA 3A32A 3NEMA 2RB6A 4K88A 4HVCA 2VXFA 1I81A 2G4CA 3TEHB 2ARUA 1KMMA 3BY7A 4M78D 4A53A 1E1OA 4P74A 1VQZA 1WYDA 4TVYA 4C92E 4YCWA 2I4NA 1I5LA 3INZA 3JB9H 3HY1A 1B7YB 4J15A 1B8AA 4C92D 1FYFA 2EJ9A 3HFVA 1LOJA 4P75C 3SWNA 4M77G 1BBUA 1NYRA 4E51A 3EFRA 1ADJA 2IY5A 4M7AE 3LSSA 4CS4A 2DEQA 2ZT6A 4UP9A 1JRIA 3LSQA 5GAOr 4KR3A 3A74A 3V7CA 4M7DA 2AMCB 3IALA 4M7AF 3QSUA 3PCOB 2CJ9A 1KQ2A 2J3MA 3P8VA 5HGQA 1B34B 4O2DA 3RF1A 1Z7NA 1ADYA 2PMEA 4YCVA 1USYC 1HK9A 2QTXA 3JCMc 2CJAA 3A7RA 3A7UA 4C92B 3HXXA 4H2TA 2YLCA 4BWAA 4HA8A 1X01A 2YHTA 4PNOA 4XQ3A 5GAOl 4TWAA 4P72C 5LJ5j 4ZTZB 3FJPA 4NL2A 4YYEA 1USYA 1YGBA 3CMQA 3HXYA 4M75C 3A5ZA 4M78F 4HT8A 2RHQA 1U1TA 4UP7A 3UGQA 3QNEA 3JCMf 4YRCA 1X56A 4HWSA 1RIQA 1HTTA 4YP0A 3JCMW 1H4QA 3V7RA 3NELA 2ZGWA 2RA2A 3E9HA 4YRNA 4RDXA 1G5IA 4WI1A 4M78C 4XEOA 5LJ5d 4N0AA 4K87A 2EAYA 4YRTA 2FYKA 1BBWA 3IG2A 5GAN2 2ZIMA 3TUPA 5GAMh 2ZNIA 5GANg 4P3NA 3L2ZA 1SETA 4A54A 1SESA 3BFMA 2Y90A 1N9RA 1X55A 4WF2A 5LJ3e 4CH5A 1U1SA 2DXUA 4PJOC 4HWPA 4L87A 4M7DC 2DDZA 2VXEA 4M78E 5K1PA 3IKLA 2E5AA 4M78G 1KQ1A 4X9CA 5I21A 2AKWA 4TVAA 4XTZA 4CH3A 1L0WA 4J6XA 3RUXA 5GAOn 5GMKl 5LJ3d 1BIAA 4EMKC 2P5IA 3L4GB 3V8KA 2ZXFA 3REUA 3MEYA 3M4QA 1Y96B 4P3OA 2E41A 2RHSB 2E10A 4DQ2A 3JCMd 4P71A 3W3SA 1JBMA 1C0AA 3NETA 5C52B 1WQ7A 4M78A 4C92F 1X2GA 1YFRA 2I2LA 3V7SA 3VQYA 3JB9J 5GAMg 3JCMX 2RD1A 2RHQB 5LJ5e 3QTCA 4H2YA 2QHSA 5GAMf 3QO3A 1WQWA 3JB9D 4Q15A 4C8QG 4UPAA 4EMGA 5LJ3f 2CGHA 4JRKA 2RHSA 3VU3C 4XTXA 2C7IA 4YRLA 4F7UE 3VBBA 1SERA 4YDQA 1M8VA 4AH6A 4XTYA 2Q5IA 3JCMP 4M7AC 2DQ0A 2I4MA 1B70A 3P8TA 3QO8A 2YLBA 2E1HA 3P8YA 1YFSA 4H2WA 3QO5A 5DY9A 4M75G 1NJ8A 1NJ5A 4M77F 2ARSA 3RKWA 4YRKA 2E3CA 4XEMA 3HFOA 2ODRD 4M77D 2PMFA 4H2VA 4YPFA 4OP0A 2ALYA 4C92G 1PYSB 3GIBA 4HWTA 4M7AG 4WJ3M 1LYLA 4M77C 1TH7A 1JJCB 5GMKj 1EOVA 3PCOA 1B70B 2XGTA 3FIFA 3JB9I 2C8MA 3HRKA 1E24A 3HSBA 3HRIA 2JN0A 4YREA 3SWNB 1HXDA 4V2SA 4HWOA 3JCMb 2ZZEA 1EIYB 4H02A 4DPGA 2DTIA 4PJOG 2ZZGA 3JB9F 2Q7GA 4NCXA 4XU3A 1WLEA 4M75F 1LJOA 2RM4A 3L4GA 3ERRA 5GANh 2DJZA 4HT9A 1EVLA 4ZTUB 4XTVA 2ZT7A 4M7DD 4J6WA 4P73A 4YRQA 3M4PA
chains in the Genus database with same CATH superfamily
2K5LA 3A31A 4LNPA 4OMLA 2XI9A 5GAN5 2XTIA 5FU7B 2CP7A 11ASA 4H2XB 2BZXA 1XTDA 2HBPA 2QQAA 1KC8U 4BY6B 2QHVA 4JZ4A 4C0DC 4E7ZA 3G71A 2Y4YA 2O4XA 1VQ7T 1PHTA 4LD9K 5GANj 4PHCA 3QXEB 2JT4A 3O5ZA 2E64A 1M1KC 4CC7A 1IHWA 4R55A 2HQHA 3JAME 1TSFA 1ZBJA 3QJ6A 1Y71A 3A8HB 1C1AA 2VC8A 3TCJA 3CMAQ 4JLIA 3G71Q 2CZ1B 3PIOA 4F7UG 1YITA 2V8IA 5FLXE 1VQMT 5A0LA 1JJ2S 4RG8A 3PFSA 3CCJA 2HKQB 1KOGA 2RI3A 4PJOA 1O75A 1RAGB 1W6XA 4M7DG 4PFOA 2F69A 2E6NA 3GP8A 1IHVA 1TWBA 4ZGJB 2ZCEA 4P72A 2A28A 1NJIC 3C95A 5ELOA 2IY5B 4C0GA 4QW2A 2D9TA 2D0QB 3HRTA 4ZGDB 3L42A 2QA4A 1KJWA 1RABB 2K57A 4AFUC 4A63B 1SSFA 1M2VA 3G6ET 1RL2A 4MDXA 1VOMA 1BK2A 4X1VA 1R77A 2DU7A 4YRIA 3OS2A 3REAB 2ZTGA 5FWBA 1VYTA 2MMPA 5LJ3h 2CJBA 2DZ9A 4M75A 4YRRA 4C8QC 1H4SA 2ABLA 4C92C 1UDLA 1NJ1A 1HC7A 5GJWB 2DIGA 4XU1A 2ZPGB 2KXCA 1I5OB 4LUDA 5GAOm 2KVQG 3RGLA 2AKKA 3GOXA 2LQ8A 2ROTA 4LDYA 2FRYA 2JXBA 4M7DE 3LWHA 3REXA 3CCLT 2ARTA 3EGXB 3VUZA 2DU5A 1NJIR 4P5NA 4QVCA 2RJFA 5FRMA 1E22A 1AWOA 2FZKB 4J6YA 1D3BA 2XIDA 2Q5HA 3CC7T 1UEBA 1VQ9T 1ZSZA 5LJ3g 1UTIA 3CXCA 4QKUA 2K3XA 3CMEQ 2MCNA 3OYYA 3VQWA 3WQZA 1JU5C 1GRIA 1MGQA 2X3WD 2XK0A 4F16A 1LNXA 4PJOF 1VQ4A 2LT4A 2LRQA 2YUQA 1NEGA 4X5OA 1VQMA 4TVAB 4RTYA 4M7AD 4CS2A 3MEVA 1NLOC 2M0OA 4J5YA 2EL9A 1H4VB 1M5Q1 2KSSA 3IKMB 3G1ZA 3FRNA 2KYBA 3CMET 4ELYC 2M02A 1N9SA 1TU0B 1UB4A 3SWNC 3HFZA 4L59A 4M75D 1ARKA 1YN8A 2HNIA 1B76A 1WHJA 3LH5A 2QYZA 2ZINA 3RERA 4CS3A 2KI7A 3NFCA 5EC7A 4ORZA 2ZT8A 1V76A 4E7JA 1LVKA 4IUVA 4EIKA 4WJ4A 1Q81R 3M0SA 2CZ0B 4RTVA 4C8QD 1QVFA 4Q6GA 1T0HA 4M77E 3MF1A 5GANd 3OBWA 3MEUA 1JQQA 2X4WA 1QVGS 1B7TA 1ZX6A 2LT1A 3I56Q 2OJ2A 2QAZA 5CQXA 4BUGA 1ASYA 4PJOD 2OX7A 5C0MA 1YFTA 3J7AF 5A0GA 2QQ9A 4FIBA 2FPEA 2HD0A 2BE7D 2RB6A 3QG1A 4JJNK 3TEHB 1Q95G 1QW1A 2PZ1A 2LQKA 2K7AA 2RK1A 8ATCB 1KIKA 3L2RA 2RQWA 4TVYA 4C92E 2I4NA 1FMWA 2J6OA 3JSCA 3JB9H 4OB1B 4C92D 1N27A 1EZZB 2A36A 2CT3A 3HFVA 1LOJA 2CZ7B 3SWNA 4KUDK 2X4YA 1ADJA 1AWWA 2IY5A 1TG0A 3LSSA 3LGLA 2ENMA 2K3YA 1QVGA 2ZT6A 5EG2A 2AKLA 5CKFA 4UP9A 3CCQA 4FW1A 4E7LA 3N5BB 5CR2A 4M7DA 3IALA 1VQ7A 5HGQA 1KD1C 4KGVB 1K73R 1B3QA 1X6GA 4D8DA 2XDDA 2NUPB 2KGTA 1I0CA 2PMEA 1HK9A 2CJAA 3FEOA 3A7UA 3HXXA 5HK0A 3VS1A 1X01A 2E12A 5GAOl 1R8OB 3OW2A 2DERA 4P72C 2LC4A 4NL2A 2VYTA 4YYEA 1USYA 3R6OA 4FYXB 2YUOA 2H3JA 4BE1A 4N4HA 1YGBA 4JDSA 5CKHA 2FPDA 3HXYA 4M75C 1YP5A 1JJ2A 1XQHA 2RHQA 1YITQ 1LPLA 5HK3A 1M1FA 1KC8R 1D0YA 3CCJT 4HWSA 1RIQA 3V7RA 1SRLA 2DE0X 2DJQA 1W2BS 2F1LA 3E9HA 4RTXA 4E2FB 2HCKA 2KQWA 4M78C 2AIRB 2ED1A 4N4IA 3BE3A 2H3EB 1ZSZB 3M55A 3HHTB 1YITT 2FYKA 3EGDB 2ZIMA 1RLPC 2LJ3A 3CBOA 2KYMA 3L2ZA 3NGPA 2A7YA 2DK3A 1PSEA 1QCFA 2MWPA 3QYHB 2EYZA 5FRNA 2VXEA 1UUEA 5IHIA 2R58A 4X9CA 2AKWA 4C5HA 2KY9A 2DD4A 2WSCE 1QKXA 1VQNT 2R57A 5GMKl 5LJ3d 2V8KA 3M56A 1YJWA 3V8KA 3L4GB 1SPKA 3A8OB 3REUA 3QWYA 2NS6A 3S3MA 2DA9A 2E41A 2RHSB 3I56A 1YJNA 2DF6A 3OYBA 4BE2A 2XICA 1Y7XA 1OYXA 1WQ7A 1VA7A 1BI2A 2HL3A 1K8AR 3FJ5A 4LDWA 3TVTA 1K8AU 2L8DA 2QHSA 3QO3A 4WTOB 3H0FA 2KK4A 3JB9D 2ESWA 2HL5C 3MQZA 3SHWA 2VV5A 4XTXA 2C7IA 3L2WA 1OU9A 2PQWA 1VQ5T 2KDSA 2Q5IA 1ZHIA 2VGMA 4LN2A 3OYMA 3VRYA 2DBMA 1B70A 4B9WA 2YLBA 1GCQC 3C0CA 3P8YA 4PJJA 1YFSA 2KRSA 4FT2A 3CPWA 4ZTFA 3QO5A 2DRKA 1QVPA 1XNIA 1NJ8A 3MPUB 4XEMA 1W4SA 3RR6A 4JS4A 3J80E 2ODRD 1OI1A 3M9QA 5KYXA 1S1NA 2D8HA 2DPPB 4FYWB 2PMFA 3GIBA 4WJ3M 1GL5A 1LYLA 1GCPA 2J6KA 1E7OA 2CREA 1N8RU 3RDVA 2XGTA 3FIFA 2NUTB 1SG5A 1RAAB 3HRIA 2Z0WA 3THKA 4YREA 4AFZC 2VVKA 3S3OA 3RBBB 3S6WA 2XD0A 1HXDA 3H41A 4HWOA 1VQ6T 2EVRA 2ZZGA 5FROA 3E2UA 4NCXA 4XU3A 1WLEA 4M75F 2BTTA 4JJCA 2OTLQ 1TTHB 3TEEA 2IIMA 2LX9A 4KT0E 1X43A 2DJZA 4ZTUB 4XTVA 4A4HA 4J6WA 1YWPA 1C0AA 4M7DF 1NBEB 5KYYB 4RUGA 2DLPA 1FYNA 1YI2A 3NENA 2XG8D 2MAMA 4RMFA 4EX5A 3C4SA 3CCVA 3QKJA 2ZZFA 2QK0A 1ZUKA 3FB9A 3ICAA 3H6ZA 3CCJQ 1MMNA 2EQUA 1Q82R 3MP8A 2CUDA 2QEXQ 3X26B 4LD6A 1N9WA 1BBZA 2QA4T 3TSZA 2X4XA 1VQOQ 1G3WA 3CCUQ 3X28B 3FLGA 3VJPA 4EMHA 3HXZA 1H641 4CI0C 2FHDA 3JCMQ 3VS6A 4QT7A 1BI1A 3IQLA 5C51B 3JCMe 1VQ8T 1I07A 2KRMA 3MF2A 2LDMA 2GBQA 4MZMA 4XTWA 4J7IA 1MMGA 2CYZB 3RACA 3HL8A 1T3LA 1UGRB 1VIFA 3CBPA 4KULA 3CCMQ 2OTJT 1NJ2A 4H2XA 4P73C 3V8LA 1HD3A 3EFSA 1ABQA 3CCSA 2V26A 2LCSA 4MDWA 1KK7A 4M75E 4EMKA 1M2OA 2AKWB 3AHUA 3LC0A 4IUUA 5GMKm 1Q82C 1KG1A 2HDAA 1YHQQ 4YRFA 1I4K1 4PKCC 2ZT5A 4LNSA 3HKSA 3VUBA 1C0MA 2K2MA 4BDYA 3CC4A 3RMSA 3CCRQ 2M9UA 2RHZA 3LX7A 1NYQA 1V29B 4LVMA 1K8AC 3E9IA 3L2QA 4G85A 3G1JA 3VYGA 1RI9A 4A4GA 2LMJA 4A4EA 1EVKA 1WPYA 4YRGA 1V1CA 1PCXA 3CC4Q 2EGCA 3HXVA 3VS3A 4J9IA 2A0FB 2GFUA 3ZEHA 4LVLA 3V8JA 4KH0B 3MJXA 1UJ0A 2LZ6B 3DB4A 2PVGB 2I0NA 4Q5WA 2Q7EA 4NOYA 3VS4A 3A8MB 5IH2A 4OLFA 3CCVT 4LDUA 1WHGA 3L1AA 5GAN4 1BYMA 5CAIA 2ODRC 5GAOp 5CKEA 4HCKA 2LP5A 4HVVA 1D1AA 2SEMA 2K6DA 4M77A 3NPFA 5IAYA 2XDBA 2GGRA 3E19A 3MCAB 4FT4A 2RHUA 1M1GA 4J8OA 1UG1A 3FC3A 4PJOB 2A8EA 1VQPA 2DX1A 2KE9A 2YXYA 3E1SA 4OMQA 4ME7A 3J81E 3URGA 5GJVB 1IZ6A 2RHXA 1YWOA 5KCOA 4C8QB 4P71C 1ZUYA 2OTJA 5GANf 2EJFA 2BUDA 4BW9A 4KR2A 1VQ5A 3QBYA 2QHUA 2ZR2A 1Q7YR 2PTKA 4J9HA 3MHXA 3X20B 1VQ9Q 4E6RA 2NUTA 2QGFB 1YJNT 2CP5A 2P0QA 4C5IA 4P74C 3NTHA 1O9SA 1VQ4T 3CCEQ 1H4TA 5GMKh 2FB7A 2F2XA 1UGVA 3VS2A 2ZAEA 1YIJA 4JLGA 5KYUA 4CH4A 1QVFP 3QUIA 1EFWA 4HCCA 4F7UF 2ZR3A 3HXUA 2B8AA 4F7UB 1M90C 1X54A 2EYXA 5GAMe 2DETA 4R56A 1TXQA 3CCMA 3GNFB 3BJUA 2V1QA 4LXCA 2IG0A 2C0OA 1WNLA 5GAN7 1H3HA 1WJQA 1YBYA 4J9FA 3DSQA 3X24B 3OD1A 2M16A 4DA4A 1H92A 1QF6A 2GQIA 1X2HA 3A32A 1AVZC 3PIPA 1ZA2B 1KMMA 3CC7Q 3BY7A 4PJLA 4M78D 2JMCA 1WXBA 4P74A 4GLKA 1VQZA 1K0XA 3CCRA 1I5LA 2K79A 3HY1A 1Q86U 1MNDA 1B8AA 2MK5A 2EJ9A 3M4YA 4P75C 3MKDA 3CCLQ 4M77G 1NYRA 2O9VA 2D6FA 5FU7C 3EFRA 3OS0A 4Y92A 1D1BA 1KFZA 4M7AE 1J3TA 2RJDA 2DEQA 2CP6A 1OOTA 4OB0B 1JRIA 2EYYA 3LSQA 1M3AA 1WXUA 1Y0MA 2BKDN 3E9GA 3QIIA 1K9MU 2AMCB 3QSUA 3P8VA 1YJ9A 4IKFA 2WACA 1KD1R 1OX8A 3JCMc 2M1HA 2GFAA 4H2TA 4BWAA 3NMZC 2L3RA 2YHTA 4PNOA 3I5SA 4TWAA 4ZTZB 5LJ5j 3FJPA 1UFFA 2COYA 3TQ7P 4RTWA 1VQOA 1K0SA 2HSPA 5J26A 3UGQA 2K4YA 3QNEA 3JCMf 1X56A 3NHNA 1H4QA 1WLPB 2DAQA 4BD3A 2DFUA 2RA2A 2KT8A 3EG2A 3CCST 2VB6A 3CC7A 4N0AA 4MZTA 2JJ9A 4K87A 2CP3A 3VKIA 4DEYA 4YRTA 4KGXB 1X27A 3ME9A 4M4ZA 2ZZDA 3TUPA 2PUOB 1M8MA 1JXMA 1OX9A 2X35A 4P3NA 3LLRA 1FWZA 2RQVA 2DL7A 2DXBA 3HRSA 2Y90A 2ZPHB 2EYQA 4HWPA 3MEWA 4L87A 4M7DC 4JS5A 2DDZA 2QQSA 2YUPA 4FYYB 1RUWA 4CH3A 1WDXA 1L0WA 3M57A 4J6XA 4J9CA 1BIAA 2NUZA 2P5IA 3REBB 1RACB 2HKNA 2ZXFA 1WHLA 1M4ZA 4HT4A 4BE0A 4P71A 5CVIA 4PJMA 4M78A 5A0DA 4C92F 1X2GA 4LVIA 2DL3A 2O31A 3QDRB 3MO8A 3DLMA 1D0ZA 3QTCA 5GAMf 1WQWA 3TU4K 1K73U 2L2PA 4UPAA 5LJ3f 4ATOA 2CGHA 2RPNA 4JRKA 3QJYA 2GF7A 3VU3C 2DEUA 4F7UE 1WHHA 3VBBA 1SERA 3OYJA 1VQNA 1M8VA 3LGFA 4Z88A 4M7AC 2I4MA 1SF9A 4Z8AA 4QQ6A 3AT1B 4AFQC 3I56T 1BI3A 1VQPT 1NEBA 4E47A 5IN1A 3UWNA 2X51A 1AD5A 1W2BA 4M77F 3RKWA 3M54A 1KHCA 3SD4A 4K11A 3HFOA 2EYWA 3CBMA 2F5TX 2QDLA 2CKKA 3OYAA 2J05A 3A8LB 3A5ZB 1AWXA 3JV3A 4YPFA 2LQNA 4OP0A 2JNGA 1D1CA 4HWTA 4M7AG 4ANJA 4MZPA 2BE9B 3I55T 5GMKj 2LJ0A 1NYFA 4HXJA 3LWIA 2EFIA 2OTLA 4BB7A 3QYGB 3HSBA 2DL5A 2LQWA 2LCLA 2X9HA 3SEMA 1OQKA 2EGEA 3CCQT 5D6YA 1OZ2A 3DB3A 4V2SA 4JJDA 1EX4A 4H02A 5HY6A 1K76A 4PJOG 1HJDA 2P4RA 2ED0A 3JB9F 2Q7GA 1S72T 4FL6A 4HCBA 2EW3A 3O8VA 4CRIA 3CCMT 3SDZA 4FYVB 1DJ7B 2NLUA 2WSFE 1VQPQ 4LVKA 2DYIA 1N6AA 5GANh 2OAUA 4HT9A 2OI3A 5CCAA 3EG9A 3T9NA 4YRQA 3I5RA 1CSKA 5F5WA 1KQSP 4RKUE 1F1BB 4F17A 4YRJA 2DL8A 2BZ8A 3TSWA 2FL7A 4C0DB 4BY6C 2LX7A 2LCCA 1BI0A 4YRSA 4YROA 1Y57A 4E7HA 2B86A 1NZ9A 2EQKA 2K9GA 4C0ZA 3HRUA 3UGTA 2NYSA 2SRCA 4OB3B 3CCRT 1SKUB 4CH6A 4DEXA 4EMKB 1GGMA 3I9QA 3OYCA 5K1XA 1ZUUA 4OB2B 2ZIOA 1QWFA 4JUVA 5GMKi 2KR3A 5GAN8 3OYEA 5L23A 3CCSQ 4NL3A 4LDVA 1KQSS 5IXBA 3H0IA 2RNAA 2PVDB 1N8RR 4P3PA 2KEAA 2YRCA 3GBQA 3I7FA 3OSSC 5IHNA 1B34A 4XU2A 4QQGA 4YCUA 2QEXA 3GPLA 1U5SA 4DBHA 1ASZA 3BDUA 3PZCA 4XTUA 3CMEA 1AEYA 2QI2A 2O9SA 3P8HA 4M77B 2BZYA 3QWXX 5GAMd 1IL2A 2DYBA 3NTKA 1T3SA 1YJWT 2K2VA 1JJCA 3VQVA 4KUIA 4C8QF 4F7UA 2OAWA 4N0AC 4AFSC 2DXTA 1VQOT 5DM7R 4DBRA 1PD1A 4II1A 3QO7A 5ECAA 1QP3A 3KFVA 4QVDA 2P0PA 1NNHA 2L3SA 1WIEA 2COWA 2CUBA 4CC3A 2DTHA 4RG2A 1QWEA 1VQ5Q 1K73C 1BB9A 1W66A 3L2VA 1K4US 4ELZC 2ZPIB 2PVOB 4GY5A 3M0PA 1G3SA 4ESRA 1UHCA 4JRIA 3HFZB 4Y91A 5LJ3j 1WJSA 3RKYA 1EIYA 5KYUB 2CT4A 5LJ5h 1WU7A 1IRXA 2XDPA 3CCQQ 1AHJB 4Z89A 1G5HA 4HWRA 4KH1B 1MV3A 2KNBB 2JZ2A 3RIRA 1Q81U 2ZNJA 5LJ5f 1OU8A 2HBWA 1XOVA 4C8QA 3A7AA 2I4OA 1X2QA 1NJ6A 3HY0A 1EQRA 3RKXA 3HXWA 2HZYA 2PU9B 2EGAA 1R0BG 1G2BA 1GBQA 4DOWA 1J5WA 3LW5E 1H3ZA 2AZSA 2DO3A 3JB9G 4PG3A 3JCMg 3SB2A 1ZSGA 1D3BB 2DZCA 2PUKB 1KD1U 2DL4A 3TEGA 2EJGA 1BIBA 4OF1A 3OA6A 1YI2Q 3PMTA 3CD6Q 2DQ3A 1NPRA 2QEXT 3TEHA 1R0CB 2MIOA 4J9DA 1QCOA 1EFNA 2VUBA 1G5VA 2A08A 4TTVA 4RQFA 4XAXB 4M7AA 4N4GA 2FRWA 1XJWB 4RCCA 2CSIA 4E7IA 2C06A 4B9XA 3OY9A 3OW2S 5DLOA 5A2QE 1VQNQ 3OS5A 1SRYA 2ZPFB 3OYNA 4E7KA 1I8FA 4MMLA 3PGGA 2CIMA 3KFUA 4Z02A 3G4SA 1YCYA 2ZPBB 4MMKA 1OEBA 2E5QA 1VQ6A 4LVJA 3EG3A 2YRVA 3LYIA 3CXCS 2KBTA 5GAMj 3OYDA 1W70A 4BI3A 1YFNA 4GLMA 2EBPA 3QZ5B 3RMQA 3MP6A 3OW2P 4TVRA 2RHIA 1PSFA 2RMOA 2DD5A 4AT1B 1NYGA 5I11A 3I35A 2CDTA 1X75C 4OMNA 3I55A 1SRMA 3BDLA 5E3IA 4VUBA 2G3RA 3SFMA 3C94A 2J3LA 2Q7HA 4AG1C 3CPWS 5ELNA 4YRMA 3CCLA 1TUCA 3JCMJ 3NEMA 1VQKA 4K88A 4ZTJA 1M1KR 2VXFA 2JTMA 1VQ4Q 1I81A 2GCXA 1Q86C 1WFWA 2YRDA 4A53A 2RN8A 1E1OA 5D6XA 2VGNA 1ZBXA 8AT1B 3INZA 2D1XA 2MF2A 2HQXA 3CD6A 2DVJA 5IXFA 1IB8A 1U3OA 5HKCA 2RF0A 1BBUA 2X3XD 1M90U 4E51A 1NG2A 3CC2A 5CIUA 4QVZA 2VASA 2X4JA 3EFOA 1VUBA 3VRZA 4B6MA 2E3HA 4AG2C 5GAOr 1WHKA 4M7AF 3PCOB 4ZN3A 1VYVA 2DM1A 4YTLA 2CJ9A 2J3MA 1RAHB 4O2DA 3RF1A 1Z7NA 4FSXA 3HP9A 1ADYA 1X2KA 2HQEA 1Z9ZA 4PFPA 3OYKA 4YCVA 1YHQT 4CC4B 1NM7A 3A7RA 4HA8A 1NPPA 1D0XA 1WYXA 4DBQA 3EG1A 3UF4A 3CMQA 5DLQE 3A5ZA 2DIQA 2FPFA 3CCUA 4M78F 1U1TA 2PNIA 3CQTA 3GNGA 3G71T 2J06A 4UP7A 1Q7YC 2K5IA 2KAFA 3JRZA 3M5AA 3OBYA 2FEIA 3NELA 1WI7A 3UATA 4YRNA 2JM8A 2QG9B 5J3BA 4WI1A 1P92A 4XEOA 3EG0A 5LJ5d 5D6WA 4JRPA 3LH0A 2EAYA 1WZOA 4OMOA 5KYWB 3EHRA 4Y28E 1G8XA 1BBWA 2DNUA 5GAN2 2JS0A 5GAMh 4OGEA 1Q82U 2QA4Q 1GBRA 5GANg 1Q7YU 1BCMA 5FU6C 5IHKA 1OPKA 4A54A 1VQKT 4OVAA 1X55A 1IGUA 1SEMA 1UGSB 5LJ3e 4CH5A 5AT1B 4PJOC 1I1JA 2JVVA 4M78E 2NUPA 5K1PA 3IKLA 4DOVA 4M78G 1KQ1A 5I21A 3UPUA 4TVAA 1SHGA 1ZLMA 5GAOn 1Z9QA 1VQLQ 3DKMA 1NJIU 3WVEB 3A98A 1AWJA 3E9FA 3PT9A 3MEYA 1YCSB 1Y96B 1A0NB 1TS9A 1KSWA 2E10A 2DRMA 3EG9B 3JCMd 7AT1B 4J9EA 3W3SA 4OMFB 3H9NA 3I55Q 5C52B 3UA7A 1YFRA 2EQMA 1UHFA 3V7SA 3JB9J 3VQYA 1TUGB 5LJ5e 4H2YA 3G6EQ 1BKBA 2HMAA 4HCZA 5J39A 2RQTA 2LVMA 4Q15A 3VS5A 5AYFA 4EMGA 1K9AA 2RHSA 3R6NA 4YRLA 3META 1VQ9A 4YDQA 1PD0A 2KRNA 2RQUA 2DQ0A 2JMAA 1PKTA 2VKNA 1Q86R 3QO8A 1G3TA 1UGPB 3G4SQ 2R5MA 4R0KA 3PE0A 4H2WA 1ZSZC 2ZCFB 1YIJT 4BI4A 1VQ8A 1MNEA 2ARSA 1X6OA 5CKBA 4YRKA 2AHJB 2E3CA 4LDXA 4M77D 1WXTA 3KXTA 2LNVA 1YJ9Q 1HSQA 1W1FA 1IREB 4H2VA 2ALYA 4X34A 1M90R 5I2SA 1BCOA 1QMCA 1JJCB 2IVWA 3PCOA 2RJCA 1VQLA 1AZEA 1N8RC 2P4TA 1JJ2P 3HRKA 1OULA 3F70A 1E24A 1KQSA 2JN0A 3EFOB 2FG0A 4KRTA 3SWNB 2O2OA 4BI8B 3P8DA 3CPFA 2L0AA 5L8RE 1IGQA 3JCMb 2ZZEA 1AT1B 1EIYB 5KYYA 5LL6S 3CXCP 1LJOA 1M3BA 2RM4A 3OYGA 3TREA 1BU1A 1RAFB 4A4FA 1EVLA 2JUFA 2AT1B 4M7DD 3M4PA 2C0IA 4K86A 2JTEA 1E6GA 2VWFA 2MWOA 3H8ZA 2YSQA 1GXIE 4PLIA 2E4HA 1U06A 3OS1A 1YJ9T 2RI2A 2ROLA 3EGXA 4J9BA 2CP0A 5GANe 2AMCA 2P0LA 5KH6A 4C0FA 1QE0A 1M9SA 5C53B 1M2VB 2HEQA 1T0JA 4D8KA 2HAXA 3VYHB 2D8JA 3PVLA 5CKDA 4EO4A 1HYOA 3UT1A 2EIFA 1OPLA 2FZGB 1PG5B 2E3IA 1UJYA 2BIVA 2P0KA 4HVWA 5GMKe 1ZQ1A 2C0TA 2I4LA 5FW9A 2RHYA 2P84A 1RI0A 2RJEA 4IUQA 1PYSA 3EGUA 4HVUA 5LJ5g 1UE9A 4C92A 5GAN6 2DKGA 4J83A 1IO6A 2K5FA 4O6JA 4GBQA 2DXCA 3M0QA 1Y96A 1B7YA 4TQFA 2EQJA 2R5AA 4H2UA 1WGSA 4X9DA 1W2BP 2A3LA 1E1TA 5CQYA 1X69A 2K3BA 4ZNXA 3UFGA 5KCHA 5I2MA 4IIOA 1YHQA 2JOYA 4A4KA 2F5KA 2DMOA 4C8QE 2J7IA 3JCMh 1ATIA 1CKAA 12ASA 4LE9A 3M53A 4HKEA 6AT1B 3UDCA 3Q1JA 2JTFA 2XHCA 5FWCA 3HTZA 3UA6A 4BDZA 2MPXC 5D7UA 4PJOE 1E6HA 5KNNA 2E70A 2LNHB 3CMAA 4ZIBA 3HFNA 3KUFA 1EIFA 4UP8A 2ALYB 2V1RA 3A5YA 2QASA 4PFZA 4RQEA 4RCBA 4FSSA 4RTZA 1UGQB 2HSEB 3FDRA 3L2UA 1NLPC 2CH4W 4FU6A 2DTOA 4H2SA 1JEGA 5I22A 1M1KU 3WVDB 2XKOC 3R07A 4JZ3A 4FW2A 2LJ1A 4TQDA 2FO0A 3RESA 1G51A 1N5ZA 1MV0B 3BW1A 2KT1A 4G84A 3S3NA 5CK9A 1QVFS 1G83A 4TVWA 2QXFA 3EAEA 5GAOq 5FU6B 3ZFJA 3CCEA 2GTJA 4YRPA 2M0YA 3PNWC 2W0ZA 3ULRB 4ZN1A 3UH0A 3OYLA 3M4GA 3RL6A 4M78B 4NS5A 2LTOA 1KC8C 2F2VA 3M0TA 5C6SA 2CSQA 2IPOB 2RI5A 3QZ9B 1JB0E 3QHSA 4XU0A 3A8GB 2E65A 3ASKA 2QQBA 5KE3A 2EWNA 5GAN3 1YB3A 3OYFA 3JCMV 2KROA 4KQEA 3M59A 4M75B 1K9MR 1Z7MA 2GTOA 1S72A 3VQXA 3CD6T 1WA7A 3OSVA 1QQJA 3OQ5A 2QHTA 2DVEA 1SHFA 1PC0A 1MUZA 1MHNA 3MP1A 1G3YA 3OYHA 4P75A 1PRMC 1FXXA 3CC2T 1KMNA 3C12A 3PVQA 3VS0A 4M7DB 1X6BA 4M7AB 4OGCA 1TOVA 1VYUA 2DILA 3QPHA 4C5GA 2EKHA 4XK8E 4JPBW 4HVCA 2CS7A 1WJRA 2G4CA 2H8HA 4JRQA 2ARUA 2EPDA 2YWWA 3U23A 4J7FA 2MOXA 4CC2A 1WYDA 4YCWA 1PWTA 4BACA 1GCQA 3PMIA 1B7YB 4J15A 1FYFA 4J9GA 2NWMA 3M0RA 1PM3A 2FVUA 2M51A 3X25B 2J6FA 2JS2A 1ACMB 5IT9E 1B07A 1VQ8Q 4CS4A 4IUPA 4EDUA 3PTAA 5HCKA 1K1ZA 1TUDA 4KR3A 1M27C 3A74A 3V7CA 3ZBDA 2W10A 1KQ2A 4LUEA 1B34B 2ATCB 1YNZA 2JM9A 1Q81C 3GLXA 1USYC 2QTXA 1H8KA 4JJBA 2L3QA 4C92B 2YUNA 2YLCA 4KGZB 2JW4A 1RLQC 1FMKA 4XQ3A 2A37A 1C6VX 3ER0A 4PLLA 3EH1A 1M30A 1YI2T 1JO8A 3G6EA 2ECZA 4HT8A 1RAIB 4C5EA 4YRCA 2L89A 2GNCA 1HTTA 4YP0A 3JCMW 1LCKA 1PRLC 4F04B 2ZGWA 1D09B 2MI6A 4EPCA 2L3PA 2CZ6B 4RDXA 1JXOA 1G5IA 2YT6A 1IXDA 4OMPA 3DLLA 2YDLA 1FMVA 2O4XB 2GQVA 1QKWA 5KE2A 2KMTA 5KYXB 1CKBA 3IG2A 3NTIA 2ZPEB 2OTLT 1QCNA 2ZNIA 1QP2A 2D0NA 3VV0A 1YJWQ 3CCVQ 1GFDA 3CCUT 1U8RA 5CO7A 1SETA 3RNJA 1SESA 3BFMA 1AZGB 2O01E 1N9RA 3H0HA 4WF2A 1U1SA 4F14A 2DXUA 1OZ3A 1OV3A 1YIJQ 2EQIA 3WXMB 3ZL7C 2E5AA 4QQDA 4PL6A 4XTZA 4UC4A 4ZGEB 3RUXA 4OMMA 4EMKC 1QVGP 2E6ZA 3OB9A 9ATCB 3OMCA 3M4QA 4P3OA 1ABOA 4DQ2A 3CEYA 1K9MC 2V8JA 1JBMA 1MMAA 1SSHA 2CH4A 3NETA 1PKSA 5M9OA 2QQRA 3CC4T 2CP2A 4PK4A 2I2LA 2QGGA 4D6WA 3G4ST 5GAMg 3JCMX 2RD1A 2RHQB 4FM4B 2Y4XA 3G7ZA 4C8QG 3M58A 1UECA 2RO0A 2RK2A 3M0UA 1YJNQ 1Y07A 1NE8A 2XU8A 4AH6A 4DBFA 1FX7A 4XTYA 3JCMP 3A1PA 4KBMB 3VS7A 3D7SB 2RH2A 1VQLT 2DBKA 1RADB 3P8TA 2E1HA 1RAEB 1WHMA 4PJNA 2RQRA 3CMAT 5DY9A 1AOJA 4M75G 2O88A 3CC2Q 1PNJA 1VIEA 2COZA 1NJ5A 3OYIA 3P8BB 3KBGA 1VQ6Q 1VQMQ 4L6V5 1S72Q 1QLYA 2G6FX 4IIMA 2FZCB 1WX6A 3HTRA 4E7SA 1MMDA 5KYWA 2QDYB 1VQ7Q 4RTUA 1GFCA 2OTJQ 4C92G 1PYSB 2E5KA 3HPWA 4M77C 1TH7A 2EKOA 3EGDA 1EOVA 2XMFA 4O5VA 1B70B 3JB9I 4WCIA 5KYNA 1VQKQ 2C8MA 2AZVA 1ZA1B 4FCYA 4IURA 3CPWP 2L5QA 2AK5A 3CCET 2KXDA 3MEAA 1KHIA 3OMGA 2MYSA 3EHQA 3QDFA 2QTVA 1M3CA 4DPGA 2DTIA 4IUTA 3GF5A 2F2WA 2WSEE 3EH2A 3L4GA 4RTTA 3ERRA 4AMCA 4L5GA 4RMOA 2ZT7A 4P73A
chains in the Genus database with same CATH topology
2K5LA 3A31A 2XI9A 5GAN5 2XTIA 5FU7B 11ASA 4H2XB 1XTDA 2HBPA 2QQAA 1KC8U 4BY6B 2QHVA 4C0DC 3G71A 2Y4YA 2O4XA 1VQ7T 4LD9K 5GANj 4PHCA 3QXEB 2E64A 1M1KC 4R55A 3JAME 3QJ6A 1Y71A 3A8HB 2VC8A 3TCJA 4JLIA 2CZ1B 3PIOA 4F7UG 1YITA 2V8IA 5FLXE 1VQMT 5A0LA 1JJ2S 4RG8A 3PFSA 3CCJA 1KOGA 2RI3A 4PJOA 1O75A 4M7DG 2F69A 2E6NA 3GP8A 4ZGJB 2ZCEA 4P72A 1NJIC 3C95A 5ELOA 2IY5B 4C0GA 4QW2A 2D9TA 2D0QB 3HRTA 4ZGDB 3L42A 2QA4A 2K57A 1SSFA 3G6ET 1RL2A 4MDXA 2DU7A 4YRIA 3OS2A 2ZTGA 2MMPA 5LJ3h 2CJBA 2DZ9A 4M75A 4YRRA 4C8QC 1H4SA 4C92C 1NJ1A 1HC7A 2DIGA 4XU1A 2ZPGB 5GAOm 2KVQG 3RGLA 3GOXA 2LQ8A 4LDYA 4M7DE 3LWHA 3REXA 3CCLT 2ARTA 3VUZA 2DU5A 4P5NA 4QVCA 2RJFA 5FRMA 1E22A 4J6YA 1D3BA 2XIDA 2Q5HA 3CC7T 1UEBA 1VQ9T 5LJ3g 3CXCA 3VQWA 2K3XA 3OYYA 3WQZA 1MGQA 2XK0A 1LNXA 4PJOF 1VQ4A 2LT4A 2LRQA 4X5OA 1VQMA 4TVAB 4M7AD 4CS2A 3MEVA 2M0OA 4J5YA 2EL9A 1H4VB 1M5Q1 3IKMB 2KSSA 3G1ZA 3FRNA 3CMET 4ELYC 1N9SA 1UB4A 3SWNC 3HFZA 4L59A 4M75D 2HNIA 1B76A 2ZINA 3RERA 4CS3A 3NFCA 2ZT8A 4E7JA 4IUVA 4WJ4A 2CZ0B 4C8QD 1QVFA 4Q6GA 4M77E 3MF1A 5GANd 3OBWA 3MEUA 2X4WA 1QVGS 2LT1A 5CQXA 4BUGA 1ASYA 4PJOD 5C0MA 1YFTA 3J7AF 5A0GA 2QQ9A 4FIBA 2HD0A 2RB6A 3QG1A 4JJNK 3TEHB 1QW1A 2LQKA 2RK1A 3L2RA 4TVYA 4C92E 2I4NA 3JSCA 3JB9H 4OB1B 4C92D 1N27A 3HFVA 1LOJA 2CZ7B 3SWNA 4KUDK 2X4YA 1ADJA 2IY5A 3LSSA 3LGLA 2K3YA 1QVGA 2ZT6A 5EG2A 5CKFA 4UP9A 3CCQA 3IALA 3N5BB 5CR2A 4E7LA 4M7DA 1VQ7A 5HGQA 1KD1C 2XDDA 2PMEA 1HK9A 2CJAA 3FEOA 3A7UA 3HXXA 5HK0A 1X01A 2E12A 5GAOl 1R8OB 3OW2A 4P72C 2LC4A 2VYTA 4NL2A 4YYEA 1USYA 3R6OA 2H3JA 4BE1A 4N4HA 1YGBA 4JDSA 5CKHA 3HXYA 4M75C 1JJ2A 1XQHA 2RHQA 5HK3A 1M1FA 3CCJT 4HWSA 1RIQA 3V7RA 1W2BS 3E9HA 2KQWA 4M78C 4N4IA 3M55A 3HHTB 1YITT 2FYKA 2ZIMA 3CBOA 3L2ZA 2A7YA 2DK3A 1PSEA 3QYHB 2MWPA 5FRNA 2VXEA 2R58A 4X9CA 2AKWA 4C5HA 2KY9A 2DD4A 2WSCE 1VQNT 2R57A 5GMKl 5LJ3d 2V8KA 3M56A 1YJWA 3V8KA 3L4GB 3A8OB 3REUA 2NS6A 3S3MA 2E41A 2RHSB 3I56A 1YJNA 3OYBA 4BE2A 2XICA 1Y7XA 1OYXA 1WQ7A 1BI2A 4LDWA 1K8AU 2L8DA 2QHSA 3QO3A 2KK4A 3JB9D 3MQZA 2VV5A 4XTXA 2C7IA 3L2WA 2PQWA 1VQ5T 2KDSA 2Q5IA 1ZHIA 2VGMA 3OYMA 1B70A 4B9WA 2YLBA 3P8YA 1YFSA 4FT2A 3CPWA 4ZTFA 3QO5A 1QVPA 1XNIA 1NJ8A 4XEMA 1W4SA 4JS4A 3J80E 2ODRD 1OI1A 3M9QA 2DPPB 2PMFA 3GIBA 4WJ3M 1LYLA 1N8RU 2XGTA 3FIFA 3HRIA 4YREA 3S3OA 3S6WA 2XD0A 1HXDA 4HWOA 1VQ6T 2ZZGA 5FROA 4NCXA 4XU3A 1WLEA 4M75F 3TEEA 2LX9A 4KT0E 2DJZA 4ZTUB 4XTVA 4A4HA 4J6WA 1C0AA 4M7DF 1YI2A 3NENA 2XG8D 2MAMA 4RMFA 4EX5A 3C4SA 3CCVA 3QKJA 2ZZFA 3FB9A 3ICAA 3H6ZA 2EQUA 3MP8A 3X26B 4LD6A 1N9WA 2QA4T 2X4XA 1G3WA 3X28B 3FLGA 3VJPA 4EMHA 3HXZA 1H641 4CI0C 2FHDA 3JCMQ 1BI1A 5C51B 3JCMe 1VQ8T 3MF2A 2LDMA 4MZMA 4XTWA 4J7IA 2CYZB 3RACA 3HL8A 1VIFA 1UGRB 1NJ2A 3CBPA 4KULA 2OTJT 4H2XA 4P73C 3V8LA 3EFSA 3CCSA 4MDWA 4M75E 4EMKA 2AKWB 3AHUA 3LC0A 4IUUA 5GMKm 1Q82C 1KG1A 4YRFA 1I4K1 4PKCC 2ZT5A 4LNSA 3HKSA 3VUBA 4BDYA 3CC4A 3RMSA 2M9UA 2RHZA 3LX7A 1NYQA 1V29B 4LVMA 1K8AC 3E9IA 3L2QA 4G85A 3VYGA 4A4GA 4A4EA 1EVKA 1WPYA 4YRGA 3HXVA 2GFUA 4LVLA 3ZEHA 3V8JA 3DB4A 2PVGB 4Q5WA 2Q7EA 4NOYA 3A8MB 4OLFA 3CCVT 4LDUA 3L1AA 5GAN4 1BYMA 5CAIA 2ODRC 5GAOp 5CKEA 4M77A 5IAYA 2XDBA 3E19A 3MCAB 4FT4A 2RHUA 1M1GA 4J8OA 3FC3A 4PJOB 2A8EA 1VQPA 3E1SA 4ME7A 3J81E 3URGA 1IZ6A 2RHXA 5KCOA 4C8QB 4P71C 2OTJA 5GANf 2EJFA 2BUDA 4BW9A 4KR2A 1VQ5A 3QBYA 2QHUA 2ZR2A 3MHXA 3X20B 1YJNT 2P0QA 4P74C 4C5IA 3NTHA 1O9SA 1VQ4T 1H4TA 5GMKh 2FB7A 1YIJA 4JLGA 4CH4A 3QUIA 1EFWA 4HCCA 4F7UF 2ZR3A 3HXUA 2B8AA 4F7UB 1M90C 1X54A 5GAMe 4R56A 3CCMA 3GNFB 3BJUA 2IG0A 1WNLA 5GAN7 1WJQA 1YBYA 3DSQA 3X24B 3OD1A 2M16A 4DA4A 1QF6A 1X2HA 3A32A 3PIPA 1KMMA 3BY7A 4M78D 4P74A 4GLKA 1VQZA 3CCRA 1I5LA 3HY1A 1Q86U 1B8AA 2EJ9A 3M4YA 4P75C 4M77G 1NYRA 2D6FA 5FU7C 3EFRA 3OS0A 4M7AE 2RJDA 2DEQA 4OB0B 1JRIA 3LSQA 2BKDN 3E9GA 3QIIA 1K9MU 2AMCB 3QSUA 3P8VA 1YJ9A 4IKFA 2WACA 3JCMc 2M1HA 2GFAA 4H2TA 4BWAA 2L3RA 2YHTA 4PNOA 4TWAA 4ZTZB 5LJ5j 3FJPA 1VQOA 5J26A 3UGQA 2K4YA 3QNEA 3JCMf 1X56A 1H4QA 2DAQA 4BD3A 2RA2A 3CCST 3CC7A 4N0AA 4MZTA 4K87A 3VKIA 4YRTA 3ME9A 2ZZDA 3TUPA 2PUOB 2X35A 4P3NA 3LLRA 1FWZA 2DXBA 3HRSA 2Y90A 2ZPHB 2EYQA 4HWPA 3MEWA 4L87A 4M7DC 4JS5A 2DDZA 2QQSA 4CH3A 1L0WA 3M57A 4J6XA 1BIAA 2P5IA 2ZXFA 1M4ZA 4HT4A 4BE0A 4P71A 5CVIA 4M78A 5A0DA 4C92F 1X2GA 4LVIA 3QDRB 3MO8A 3DLMA 3QTCA 5GAMf 1WQWA 3TU4K 1K73U 4UPAA 5LJ3f 4ATOA 2CGHA 4JRKA 3QJYA 2GF7A 3VU3C 4F7UE 3VBBA 1SERA 3OYJA 1VQNA 1M8VA 3LGFA 4M7AC 2I4MA 4QQ6A 3I56T 1BI3A 1VQPT 4E47A 5IN1A 3UWNA 1W2BA 4M77F 3RKWA 3M54A 1KHCA 3SD4A 3HFOA 3CBMA 2F5TX 2CKKA 3OYAA 3A8LB 3A5ZB 4YPFA 4OP0A 2JNGA 4HWTA 4M7AG 4MZPA 3I55T 5GMKj 3LWIA 2EFIA 2OTLA 4BB7A 3QYGB 3HSBA 2LCLA 3CCQT 5D6YA 1OZ2A 3DB3A 4V2SA 4H02A 5HY6A 4PJOG 3JB9F 2Q7GA 1S72T 4FL6A 4HCBA 3O8VA 4CRIA 3CCMT 3SDZA 1DJ7B 2NLUA 2WSFE 4LVKA 1N6AA 5GANh 2OAUA 4HT9A 5CCAA 3T9NA 4YRQA 5F5WA 4RKUE 4YRJA 2FL7A 4C0DB 4BY6C 2LCCA 1BI0A 4YRSA 4YROA 4E7HA 1NZ9A 2EQKA 4C0ZA 3HRUA 3UGTA 4OB3B 3CCRT 4CH6A 4EMKB 1GGMA 3OYCA 5K1XA 4OB2B 2ZIOA 5GMKi 4JUVA 3OYEA 5GAN8 4NL3A 4LDVA 1KQSS 2PVDB 4P3PA 3I7FA 3OSSC 1B34A 4XU2A 4QQGA 4YCUA 2QEXA 3GPLA 1ASZA 3BDUA 3PZCA 4XTUA 3CMEA 2QI2A 3P8HA 4M77B 5GAMd 1IL2A 3NTKA 1YJWT 2K2VA 1JJCA 3VQVA 4KUIA 4C8QF 4F7UA 4N0AC 2DXTA 1VQOT 5DM7R 3QO7A 4II1A 1QP3A 4QVDA 2P0PA 1NNHA 2DTHA 4RG2A 1K73C 1W66A 3L2VA 4ELZC 2ZPIB 2PVOB 4GY5A 1G3SA 4JRIA 3HFZB 4Y91A 5LJ3j 1WJSA 3RKYA 1EIYA 5LJ5h 1WU7A 2XDPA 1AHJB 1G5HA 4HWRA 2JZ2A 3RIRA 1Q81U 2ZNJA 5LJ5f 1XOVA 4C8QA 3A7AA 2I4OA 1NJ6A 3HY0A 1EQRA 3RKXA 3HXWA 2PU9B 4DOWA 1J5WA 3LW5E 1H3ZA 2DO3A 3JB9G 4PG3A 3JCMg 3SB2A 1D3BB 2DZCA 2PUKB 1KD1U 3TEGA 2EJGA 1BIBA 4OF1A 3OA6A 3PMTA 2DQ3A 1NPRA 2QEXT 3TEHA 2VUBA 1G5VA 4TTVA 4RQFA 4XAXB 4M7AA 4N4GA 4RCCA 4E7IA 2C06A 4B9XA 3OY9A 3OW2S 5DLOA 5A2QE 3OS5A 1SRYA 2ZPFB 3OYNA 4E7KA 1I8FA 4MMLA 3PGGA 2CIMA 3KFUA 4Z02A 3G4SA 1YCYA 2ZPBB 4MMKA 2E5QA 1VQ6A 4LVJA 2YRVA 3LYIA 3CXCS 5GAMj 3OYDA 4BI3A 3QZ5B 3RMQA 3MP6A 4TVRA 2RHIA 1PSFA 2DD5A 1X75C 3I55A 3BDLA 5E3IA 4VUBA 2G3RA 3SFMA 3C94A 2J3LA 2Q7HA 3CPWS 4YRMA 5ELNA 3CCLA 3JCMJ 3NEMA 1VQKA 4K88A 4ZTJA 2VXFA 2JTMA 1I81A 2GCXA 1Q86C 4A53A 1E1OA 5D6XA 2VGNA 1ZBXA 3INZA 2MF2A 2HQXA 3CD6A 5HKCA 1BBUA 1M90U 4E51A 3CC2A 5CIUA 4QVZA 2X4JA 1VUBA 5GAOr 4M7AF 3PCOB 4ZN3A 2CJ9A 4YTLA 2J3MA 4O2DA 3RF1A 1Z7NA 4FSXA 3HP9A 1ADYA 2HQEA 3OYKA 4YCVA 1YHQT 3A7RA 4HA8A 1NPPA 3CMQA 5DLQE 3A5ZA 2DIQA 3CCUA 4M78F 1U1TA 3GNGA 3G71T 4UP7A 1Q7YC 2K5IA 2KAFA 3JRZA 3M5AA 3OBYA 3NELA 4YRNA 5J3BA 4WI1A 1P92A 4XEOA 5LJ5d 5D6WA 4JRPA 3LH0A 2EAYA 4Y28E 1BBWA 5GAN2 5GAMh 4OGEA 1Q82U 5GANg 1Q7YU 5FU6C 4A54A 1VQKT 4OVAA 1X55A 1UGSB 5LJ3e 4CH5A 4PJOC 2JVVA 4M78E 5K1PA 3IKLA 4DOVA 4M78G 1KQ1A 5I21A 3UPUA 4TVAA 5GAOn 3DKMA 1NJIU 3WVEB 3E9FA 3PT9A 3MEYA 1Y96B 2E10A 3JCMd 3W3SA 4OMFB 5C52B 1YFRA 2EQMA 3V7SA 3VQYA 3JB9J 5LJ5e 4H2YA 1BKBA 4HCZA 5J39A 2LVMA 4Q15A 5AYFA 4EMGA 2RHSA 4YRLA 3META 1VQ9A 4YDQA 2DQ0A 3QO8A 1G3TA 1UGPB 2R5MA 4H2WA 2ZCFB 1YIJT 4BI4A 1VQ8A 2ARSA 1X6OA 5CKBA 4YRKA 2AHJB 2E3CA 4LDXA 4M77D 3KXTA 2LNVA 1IREB 4H2VA 2ALYA 4X34A 5I2SA 1JJCB 2IVWA 3PCOA 2RJCA 1VQLA 1N8RC 2P4TA 3HRKA 3F70A 1E24A 1KQSA 2JN0A 3SWNB 4BI8B 3P8DA 3CPFA 5L8RE 3JCMb 2ZZEA 1EIYB 5LL6S 1LJOA 2RM4A 3OYGA 3TREA 4A4FA 1EVLA 2JUFA 4M7DD 3M4PA 4K86A 2MWOA 3H8ZA 1GXIE 4PLIA 3OS1A 1YJ9T 2RI2A 5GANe 2AMCA 2P0LA 5KH6A 4C0FA 1QE0A 1M9SA 5C53B 2HAXA 3VYHB 5CKDA 4EO4A 3UT1A 2EIFA 2P0KA 2BIVA 5GMKe 1ZQ1A 2I4LA 2RHYA 2RJEA 1RI0A 4IUQA 1PYSA 5LJ5g 4C92A 5GAN6 2DKGA 4J83A 2K5FA 4O6JA 2DXCA 1Y96A 1B7YA 4TQFA 2EQJA 2R5AA 4H2UA 1WGSA 4X9DA 2A3LA 1E1TA 5CQYA 3UFGA 5KCHA 5I2MA 1YHQA 2JOYA 4A4KA 2F5KA 4C8QE 3JCMh 1ATIA 12ASA 3M53A 4HKEA 3UDCA 3Q1JA 2JTFA 2XHCA 3HTZA 4BDZA 4PJOE 5KNNA 2E70A 4ZIBA 3CMAA 3HFNA 3KUFA 1EIFA 4UP8A 2ALYB 3A5YA 4RQEA 4RCBA 1UGQB 3FDRA 3L2UA 4FU6A 2DTOA 4H2SA 1M1KU 3WVDB 2XKOC 3R07A 4TQDA 3RESA 1G51A 3BW1A 4G84A 3S3NA 5CK9A 1QVFS 4TVWA 2QXFA 3EAEA 5GAOq 5FU6B 3ZFJA 3CCEA 4YRPA 3PNWC 4ZN1A 3UH0A 3OYLA 3M4GA 3RL6A 4M78B 4NS5A 2LTOA 1KC8C 5C6SA 2RI5A 3QZ9B 1JB0E 3QHSA 4XU0A 3A8GB 2E65A 3ASKA 2QQBA 5KE3A 2EWNA 5GAN3 1YB3A 3OYFA 3JCMV 4KQEA 3M59A 4M75B 1Z7MA 1S72A 3VQXA 3CD6T 3OSVA 3OQ5A 2QHTA 2DVEA 1MHNA 3MP1A 1G3YA 3OYHA 4P75A 3CC2T 1FXXA 1KMNA 3C12A 4M7DB 4M7AB 4OGCA 3QPHA 4C5GA 4XK8E 4HVCA 2CS7A 1WJRA 2G4CA 4JRQA 2ARUA 4J7FA 1WYDA 4YCWA 4BACA 3PMIA 1B7YB 4J15A 1FYFA 2FVUA 3X25B 5IT9E 4CS4A 4IUPA 4EDUA 3PTAA 4KR3A 3A74A 3V7CA 3ZBDA 1KQ2A 1B34B 1Q81C 3GLXA 1USYC 2QTXA 4C92B 2YLCA 4XQ3A 3ER0A 4PLLA 1YI2T 3G6EA 4HT8A 4C5EA 4YRCA 2L89A 1HTTA 4YP0A 3JCMW 2ZGWA 2MI6A 4EPCA 4RDXA 2CZ6B 1G5IA 3DLLA 2O4XB 2GQVA 5KE2A 2KMTA 3IG2A 3NTIA 2ZPEB 2OTLT 2ZNIA 1QP2A 3VV0A 3CCUT 1U8RA 5CO7A 1SETA 1SESA 3BFMA 2O01E 1N9RA 4WF2A 1U1SA 2DXUA 1OZ3A 3WXMB 2E5AA 4QQDA 4PL6A 4XTZA 4UC4A 4ZGEB 3RUXA 4EMKC 2E6ZA 3OB9A 3M4QA 3OMCA 4P3OA 4DQ2A 3CEYA 1K9MC 2V8JA 1JBMA 3NETA 5M9OA 2QQRA 3CC4T 3G4ST 2I2LA 4D6WA 5GAMg 3JCMX 2RD1A 2RHQB 4FM4B 2Y4XA 3G7ZA 4C8QG 3M58A 2RO0A 2RK2A 1Y07A 1NE8A 2XU8A 4AH6A 1FX7A 4XTYA 3JCMP 4KBMB 2RH2A 1VQLT 3P8TA 2E1HA 3CMAT 5DY9A 4M75G 1VIEA 1NJ5A 3OYIA 3P8BB 3KBGA 4L6V5 2QDYB 4C92G 1PYSB 3HPWA 4M77C 1TH7A 2EKOA 1EOVA 4O5VA 1B70B 3JB9I 2C8MA 4IURA 2L5QA 3CCET 3MEAA 1KHIA 3OMGA 4DPGA 2DTIA 4IUTA 3GF5A 2WSEE 3L4GA 3ERRA 4L5GA 4RMOA 2ZT7A 4P73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D F;  5F5W A;  3A31 A;  2XTI A;  5GAN 5;  3NEN A;  4K86 A;  4YRJ A;  11AS A;  4H2X B;  4RMF A;  2QHV A;  4EX5 A;  4YRS A;  4YRO A;  2ZZF A;  5GAN j;  3UGT A;  4PHC A;  5GAN e;  3FB9 A;  2AMC A;  3ICA A;  2P0L A;  1QE0 A;  2E64 A;  4CH6 A;  4EMK B;  1GGM A;  5C53 B;  1N9W A;  5K1X A;  2ZIO A;  5GMK i;  4JUV A;  5GAN 8;  2VC8 A;  4JLI A;  4NL3 A;  4F7U G;  4EO4 A;  4P3P A;  4EMH A;  3I7F A;  3HXZ A;  1H64 1;  3JCM Q;  1B34 A;  4XU2 A;  1KOG A;  5C51 B;  3JCM e;  4YCU A;  3MF2 A;  4XTW A;  4PJO A;  5GMK e;  1ASZ A;  3BDU A;  3RAC A;  3PZC A;  4XTU A;  1NJ2 A;  4M7D G;  2I4L A;  4H2X A;  4P73 C;  3V8L A;  3EFS A;  4M77 B;  2ZCE A;  4P72 A;  1PYS A;  5GAM d;  1IL2 A;  4M75 E;  4EMK A;  2AKW B;  5LJ5 g;  5ELO A;  3AHU A;  2IY5 B;  4C92 A;  3LC0 A;  1JJC A;  5GMK m;  5GAN 6;  3VQV A;  2DKG A;  4C8Q F;  4YRF A;  4F7U A;  4N0A C;  2K57 A;  1I4K 1;  2DXT A;  1Y96 A;  1B7Y A;  2ZT5 A;  4LNS A;  4TQF A;  4H2U A;  3QO7 A;  4X9D A;  2DU7 A;  4YRI A;  4QVD A;  1NNH A;  2ZTG A;  5LJ3 h;  1E1T A;  2CJB A;  2DTH A;  2DZ9 A;  4M75 A;  1NYQ A;  4YRR A;  4C8Q C;  3UFG A;  1W66 A;  1H4S A;  3E9I A;  4G85 A;  4C8Q E;  3JCM h;  4C92 C;  1ATI A;  1NJ1 A;  4JRI A;  1HC7 A;  12AS A;  3HFZ B;  4Y91 A;  5LJ3 j;  4XU1 A;  1EVK A;  1WPY A;  4YRG A;  5GAO m;  3RGL A;  3RKY A;  1EIY A;  3HTZ A;  3HXV A;  4M7D E;  5LJ5 h;  1WU7 A;  3V8J A;  3REX A;  4PJO E;  2ART A;  1G5H A;  4HWR A;  5KNN A;  4ZIB A;  2DU5 A;  3HFN A;  4UP8 A;  3RIR A;  2Q7E A;  4NOY A;  4QVC A;  2ALY B;  3A5Y A;  4RQE A;  4RCB A;  2ZNJ A;  4OLF A;  1E22 A;  5LJ5 f;  4C8Q A;  4J6Y A;  1D3B A;  3L1A A;  3A7A A;  5GAN 4;  2I4O A;  1NJ6 A;  5CAI A;  3HY0 A;  2ODR C;  2Q5H A;  5GAO p;  1EQR A;  3RKX A;  3HXW A;  2DTO A;  4H2S A;  5LJ3 g;  1J5W A;  3VQW A;  3R07 A;  4M77 A;  3WQZ A;  1MGQ A;  4TQD A;  1LNX A;  4PJO F;  3RES A;  3JB9 G;  4PG3 A;  1G51 A;  3JCM g;  3SB2 A;  3BW1 A;  4PJO B;  2DZC A;  1D3B B;  4G84 A;  4X5O A;  4TVA B;  4TVW A;  4M7A D;  3TEG A;  4CS2 A;  2EJG A;  1BIB A;  5GAO q;  4J5Y A;  2EL9 A;  1H4V B;  1M5Q 1;  3IKM B;  3G1Z A;  2DQ3 A;  3TEH A;  4C8Q B;  4P71 C;  4YRP A;  5GAN f;  1N9S A;  2EJF A;  4TTV A;  3UH0 A;  3SWN C;  4RQF A;  4BW9 A;  4M7A A;  4KR2 A;  3M4G A;  3HFZ A;  3RL6 A;  4M78 B;  4RCC A;  2QHU A;  2ZR2 A;  4M75 D;  2HNI A;  1B76 A;  4P74 C;  1SRY A;  2ZIN A;  1I8F A;  4MML A;  1H4T A;  3PGG A;  5GMK h;  2CIM A;  3KFU A;  2FB7 A;  3QHS A;  4XU0 A;  3RER A;  4CS3 A;  2E65 A;  1YCY A;  4MMK A;  4CH4 A;  2EWN A;  5GAN 3;  1YB3 A;  2ZT8 A;  3QUI A;  1EFW A;  3JCM V;  4KQE A;  4F7U F;  2ZR3 A;  4M75 B;  3HXU A;  1Z7M A;  4WJ4 A;  4C8Q D;  4F7U B;  4Q6G A;  4M77 E;  3VQX A;  3MF1 A;  5GAN d;  1X54 A;  5GAM j;  5GAM e;  2QHT A;  2DVE A;  3BJU A;  1WNL A;  1ASY A;  5GAN 7;  4P75 A;  4PJO D;  1KMN A;  4M7D B;  3DSQ A;  5E3I A;  4M7A B;  2J3L A;  2Q7H A;  3OD1 A;  4YRM A;  5ELN A;  1YFT A;  1QF6 A;  3JCM J;  1X2H A;  3A32 A;  3NEM A;  2RB6 A;  4K88 A;  4HVC A;  2VXF A;  1I81 A;  2G4C A;  3TEH B;  2ARU A;  1KMM A;  3BY7 A;  4M78 D;  4A53 A;  1E1O A;  4P74 A;  1VQZ A;  1WYD A;  4TVY A;  4C92 E;  4YCW A;  2I4N A;  1I5L A;  3INZ A;  3JB9 H;  3HY1 A;  1B7Y B;  4J15 A;  1B8A A;  4C92 D;  1FYF A;  2EJ9 A;  3HFV A;  1LOJ A;  4P75 C;  3SWN A;  4M77 G;  1BBU A;  1NYR A;  4E51 A;  3EFR A;  1ADJ A;  2IY5 A;  4M7A E;  3LSS A;  4CS4 A;  2DEQ A;  2ZT6 A;  4UP9 A;  1JRI A;  3LSQ A;  5GAO r;  4KR3 A;  3A74 A;  3V7C A;  4M7D A;  2AMC B;  3IAL A;  4M7A F;  3QSU A;  3PCO B;  2CJ9 A;  1KQ2 A;  2J3M A;  3P8V A;  5HGQ A;  1B34 B;  4O2D A;  3RF1 A;  1Z7N A;  1ADY A;  2PME A;  4YCV A;  1USY C;  1HK9 A;  2QTX A;  3JCM c;  2CJA A;  3A7R A;  3A7U A;  4C92 B;  3HXX A;  4H2T A;  2YLC A;  4BWA A;  4HA8 A;  1X01 A;  2YHT A;  4PNO A;  4XQ3 A;  5GAO l;  4TWA A;  4P72 C;  5LJ5 j;  4ZTZ B;  3FJP A;  4NL2 A;  4YYE A;  1USY A;  1YGB A;  3CMQ A;  3HXY A;  4M75 C;  3A5Z A;  4M78 F;  4HT8 A;  2RHQ A;  1U1T A;  4UP7 A;  3UGQ A;  3QNE A;  3JCM f;  4YRC A;  1X56 A;  4HWS A;  1RIQ A;  1HTT A;  4YP0 A;  3JCM W;  1H4Q A;  3V7R A;  3NEL A;  2ZGW A;  2RA2 A;  3E9H A;  4YRN A;  4RDX A;  1G5I A;  4WI1 A;  4M78 C;  4XEO A;  5LJ5 d;  4N0A A;  4K87 A;  2EAY A;  4YRT A;  2FYK A;  1BBW A;  3IG2 A;  5GAN 2;  2ZIM A;  3TUP A;  5GAM h;  2ZNI A;  5GAN g;  4P3N A;  3L2Z A;  1SET A;  4A54 A;  1SES A;  3BFM A;  2Y90 A;  1N9R A;  1X55 A;  4WF2 A;  5LJ3 e;  4CH5 A;  1U1S A;  2DXU A;  4PJO C;  4HWP A;  4L87 A;  4M7D C;  2DDZ A;  2VXE A;  4M78 E;  5K1P A;  3IKL A;  2E5A A;  4M78 G;  1KQ1 A;  4X9C A;  5I21 A;  2AKW A;  4TVA A;  4XTZ A;  4CH3 A;  1L0W A;  4J6X A;  3RUX A;  5GAO n;  5GMK l;  5LJ3 d;  1BIA A;  4EMK C;  2P5I A;  3L4G B;  3V8K A;  2ZXF A;  3REU A;  3MEY A;  3M4Q A;  1Y96 B;  4P3O A;  2E41 A;  2RHS B;  2E10 A;  4DQ2 A;  3JCM d;  4P71 A;  3W3S A;  1JBM A;  1C0A A;  3NET A;  5C52 B;  1WQ7 A;  4M78 A;  4C92 F;  1X2G A;  1YFR A;  2I2L A;  3V7S A;  3VQY A;  3JB9 J;  5GAM g;  3JCM X;  2RD1 A;  2RHQ B;  5LJ5 e;  3QTC A;  4H2Y A;  2QHS A;  5GAM f;  3QO3 A;  1WQW A;  3JB9 D;  4Q15 A;  4C8Q G;  4UPA A;  4EMG A;  5LJ3 f;  2CGH A;  4JRK A;  2RHS A;  3VU3 C;  4XTX A;  2C7I A;  4YRL A;  4F7U E;  3VBB A;  1SER A;  4YDQ A;  1M8V A;  4AH6 A;  4XTY A;  2Q5I A;  3JCM P;  4M7A C;  2DQ0 A;  2I4M A;  1B70 A;  3P8T A;  3QO8 A;  2YLB A;  2E1H A;  3P8Y A;  1YFS A;  4H2W A;  3QO5 A;  5DY9 A;  4M75 G;  1NJ8 A;  1NJ5 A;  4M77 F;  2ARS A;  3RKW A;  4YRK A;  2E3C A;  4XEM A;  3HFO A;  2ODR D;  4M77 D;  2PMF A;  4H2V A;  4YPF A;  4OP0 A;  2ALY A;  4C92 G;  1PYS B;  3GIB A;  4HWT A;  4M7A G;  4WJ3 M;  1LYL A;  4M77 C;  1TH7 A;  1JJC B;  5GMK j;  1EOV A;  3PCO A;  1B70 B;  2XGT A;  3FIF A;  3JB9 I;  2C8M A;  3HRK A;  1E24 A;  3HSB A;  3HRI A;  2JN0 A;  4YRE A;  3SWN B;  1HXD A;  4V2S A;  4HWO A;  3JCM b;  2ZZE A;  1EIY B;  4H02 A;  4DPG A;  2DTI A;  4PJO G;  2ZZG A;  3JB9 F;  2Q7G A;  4NCX A;  4XU3 A;  1WLE A;  4M75 F;  1LJO A;  2RM4 A;  3L4G A;  3ERR A;  5GAN h;  2DJZ A;  4HT9 A;  1EVL A;  4ZTU B;  4XTV A;  2ZT7 A;  4M7D D;  4J6W A;  4P73 A;  4YRQ A;  3M4P A; 
#chains in the Genus database with same CATH topology
 2K5L A;  3A31 A;  4LNP A;  4OML A;  2XI9 A;  5GAN 5;  2XTI A;  5FU7 B;  2CP7 A;  11AS A;  4H2X B;  2BZX A;  1XTD A;  2HBP A;  2QQA A;  1KC8 U;  4BY6 B;  2QHV A;  4JZ4 A;  4C0D C;  4E7Z A;  3G71 A;  2Y4Y A;  2O4X A;  1VQ7 T;  1PHT A;  4LD9 K;  5GAN j;  4PHC A;  3QXE B;  2JT4 A;  3O5Z A;  2E64 A;  1M1K C;  4CC7 A;  1IHW A;  4R55 A;  2HQH A;  3JAM E;  1TSF A;  1ZBJ A;  3QJ6 A;  1Y71 A;  3A8H B;  1C1A A;  2VC8 A;  3TCJ A;  3CMA Q;  4JLI A;  3G71 Q;  2CZ1 B;  3PIO A;  4F7U G;  1YIT A;  2V8I A;  5FLX E;  1VQM T;  5A0L A;  1JJ2 S;  4RG8 A;  3PFS A;  3CCJ A;  2HKQ B;  1KOG A;  2RI3 A;  4PJO A;  1O75 A;  1RAG B;  1W6X A;  4M7D G;  4PFO A;  2F69 A;  2E6N A;  3GP8 A;  1IHV A;  1TWB A;  4ZGJ B;  2ZCE A;  4P72 A;  2A28 A;  1NJI C;  3C95 A;  5ELO A;  2IY5 B;  4C0G A;  4QW2 A;  2D9T A;  2D0Q B;  3HRT A;  4ZGD B;  3L42 A;  2QA4 A;  1KJW A;  1RAB B;  2K57 A;  4AFU C;  4A63 B;  1SSF A;  1M2V A;  3G6E T;  1RL2 A;  4MDX A;  1VOM A;  1BK2 A;  4X1V A;  1R77 A;  2DU7 A;  4YRI A;  3OS2 A;  3REA B;  2ZTG A;  5FWB A;  1VYT A;  2MMP A;  5LJ3 h;  2CJB A;  2DZ9 A;  4M75 A;  4YRR A;  4C8Q C;  1H4S A;  2ABL A;  4C92 C;  1UDL A;  1NJ1 A;  1HC7 A;  5GJW B;  2DIG A;  4XU1 A;  2ZPG B;  2KXC A;  1I5O B;  4LUD A;  5GAO m;  2KVQ G;  3RGL A;  2AKK A;  3GOX A;  2LQ8 A;  2ROT A;  4LDY A;  2FRY A;  2JXB A;  4M7D E;  3LWH A;  3REX A;  3CCL T;  2ART A;  3EGX B;  3VUZ A;  2DU5 A;  1NJI R;  4P5N A;  4QVC A;  2RJF A;  5FRM A;  1E22 A;  1AWO A;  2FZK B;  4J6Y A;  1D3B A;  2XID A;  2Q5H A;  3CC7 T;  1UEB A;  1VQ9 T;  1ZSZ A;  5LJ3 g;  1UTI A;  3CXC A;  4QKU A;  2K3X A;  3CME Q;  2MCN A;  3OYY A;  3VQW A;  3WQZ A;  1JU5 C;  1GRI A;  1MGQ A;  2X3W D;  2XK0 A;  4F16 A;  1LNX A;  4PJO F;  1VQ4 A;  2LT4 A;  2LRQ A;  2YUQ A;  1NEG A;  4X5O A;  1VQM A;  4TVA B;  4RTY A;  4M7A D;  4CS2 A;  3MEV A;  1NLO C;  2M0O A;  4J5Y A;  2EL9 A;  1H4V B;  1M5Q 1;  2KSS A;  3IKM B;  3G1Z A;  3FRN A;  2KYB A;  3CME T;  4ELY C;  2M02 A;  1N9S A;  1TU0 B;  1UB4 A;  3SWN C;  3HFZ A;  4L59 A;  4M75 D;  1ARK A;  1YN8 A;  2HNI A;  1B76 A;  1WHJ A;  3LH5 A;  2QYZ A;  2ZIN A;  3RER A;  4CS3 A;  2KI7 A;  3NFC A;  5EC7 A;  4ORZ A;  2ZT8 A;  1V76 A;  4E7J A;  1LVK A;  4IUV A;  4EIK A;  4WJ4 A;  1Q81 R;  3M0S A;  2CZ0 B;  4RTV A;  4C8Q D;  1QVF A;  4Q6G A;  1T0H A;  4M77 E;  3MF1 A;  5GAN d;  3OBW A;  3MEU A;  1JQQ A;  2X4W A;  1QVG S;  1B7T A;  1ZX6 A;  2LT1 A;  3I56 Q;  2OJ2 A;  2QAZ A;  5CQX A;  4BUG A;  1ASY A;  4PJO D;  2OX7 A;  5C0M A;  1YFT A;  3J7A F;  5A0G A;  2QQ9 A;  4FIB A;  2FPE A;  2HD0 A;  2BE7 D;  2RB6 A;  3QG1 A;  4JJN K;  3TEH B;  1Q95 G;  1QW1 A;  2PZ1 A;  2LQK A;  2K7A A;  2RK1 A;  8ATC B;  1KIK A;  3L2R A;  2RQW A;  4TVY A;  4C92 E;  2I4N A;  1FMW A;  2J6O A;  3JSC A;  3JB9 H;  4OB1 B;  4C92 D;  1N27 A;  1EZZ B;  2A36 A;  2CT3 A;  3HFV A;  1LOJ A;  2CZ7 B;  3SWN A;  4KUD K;  2X4Y A;  1ADJ A;  1AWW A;  2IY5 A;  1TG0 A;  3LSS A;  3LGL A;  2ENM A;  2K3Y A;  1QVG A;  2ZT6 A;  5EG2 A;  2AKL A;  5CKF A;  4UP9 A;  3CCQ A;  4FW1 A;  4E7L A;  3N5B B;  5CR2 A;  4M7D A;  3IAL A;  1VQ7 A;  5HGQ A;  1KD1 C;  4KGV B;  1K73 R;  1B3Q A;  1X6G A;  4D8D A;  2XDD A;  2NUP B;  2KGT A;  1I0C A;  2PME A;  1HK9 A;  2CJA A;  3FEO A;  3A7U A;  3HXX A;  5HK0 A;  3VS1 A;  1X01 A;  2E12 A;  5GAO l;  1R8O B;  3OW2 A;  2DER A;  4P72 C;  2LC4 A;  4NL2 A;  2VYT A;  4YYE A;  1USY A;  3R6O A;  4FYX B;  2YUO A;  2H3J A;  4BE1 A;  4N4H A;  1YGB A;  4JDS A;  5CKH A;  2FPD A;  3HXY A;  4M75 C;  1YP5 A;  1JJ2 A;  1XQH A;  2RHQ A;  1YIT Q;  1LPL A;  5HK3 A;  1M1F A;  1KC8 R;  1D0Y A;  3CCJ T;  4HWS A;  1RIQ A;  3V7R A;  1SRL A;  2DE0 X;  2DJQ A;  1W2B S;  2F1L A;  3E9H A;  4RTX A;  4E2F B;  2HCK A;  2KQW A;  4M78 C;  2AIR B;  2ED1 A;  4N4I A;  3BE3 A;  2H3E B;  1ZSZ B;  3M55 A;  3HHT B;  1YIT T;  2FYK A;  3EGD B;  2ZIM A;  1RLP C;  2LJ3 A;  3CBO A;  2KYM A;  3L2Z A;  3NGP A;  2A7Y A;  2DK3 A;  1PSE A;  1QCF A;  2MWP A;  3QYH B;  2EYZ A;  5FRN A;  2VXE A;  1UUE A;  5IHI A;  2R58 A;  4X9C A;  2AKW A;  4C5H A;  2KY9 A;  2DD4 A;  2WSC E;  1QKX A;  1VQN T;  2R57 A;  5GMK l;  5LJ3 d;  2V8K A;  3M56 A;  1YJW A;  3V8K A;  3L4G B;  1SPK A;  3A8O B;  3REU A;  3QWY A;  2NS6 A;  3S3M A;  2DA9 A;  2E41 A;  2RHS B;  3I56 A;  1YJN A;  2DF6 A;  3OYB A;  4BE2 A;  2XIC A;  1Y7X A;  1OYX A;  1WQ7 A;  1VA7 A;  1BI2 A;  2HL3 A;  1K8A R;  3FJ5 A;  4LDW A;  3TVT A;  1K8A U;  2L8D A;  2QHS A;  3QO3 A;  4WTO B;  3H0F A;  2KK4 A;  3JB9 D;  2ESW A;  2HL5 C;  3MQZ A;  3SHW A;  2VV5 A;  4XTX A;  2C7I A;  3L2W A;  1OU9 A;  2PQW A;  1VQ5 T;  2KDS A;  2Q5I A;  1ZHI A;  2VGM A;  4LN2 A;  3OYM A;  3VRY A;  2DBM A;  1B70 A;  4B9W A;  2YLB A;  1GCQ C;  3C0C A;  3P8Y A;  4PJJ A;  1YFS A;  2KRS A;  4FT2 A;  3CPW A;  4ZTF A;  3QO5 A;  2DRK A;  1QVP A;  1XNI A;  1NJ8 A;  3MPU B;  4XEM A;  1W4S A;  3RR6 A;  4JS4 A;  3J80 E;  2ODR D;  1OI1 A;  3M9Q A;  5KYX A;  1S1N A;  2D8H A;  2DPP B;  4FYW B;  2PMF A;  3GIB A;  4WJ3 M;  1GL5 A;  1LYL A;  1GCP A;  2J6K A;  1E7O A;  2CRE A;  1N8R U;  3RDV A;  2XGT A;  3FIF A;  2NUT B;  1SG5 A;  1RAA B;  3HRI A;  2Z0W A;  3THK A;  4YRE A;  4AFZ C;  2VVK A;  3S3O A;  3RBB B;  3S6W A;  2XD0 A;  1HXD A;  3H41 A;  4HWO A;  1VQ6 T;  2EVR A;  2ZZG A;  5FRO A;  3E2U A;  4NCX A;  4XU3 A;  1WLE A;  4M75 F;  2BTT A;  4JJC A;  2OTL Q;  1TTH B;  3TEE A;  2IIM A;  2LX9 A;  4KT0 E;  1X43 A;  2DJZ A;  4ZTU B;  4XTV A;  4A4H A;  4J6W A;  1YWP A;  1C0A A;  4M7D F;  1NBE B;  5KYY B;  4RUG A;  2DLP A;  1FYN A;  1YI2 A;  3NEN A;  2XG8 D;  2MAM A;  4RMF A;  4EX5 A;  3C4S A;  3CCV A;  3QKJ A;  2ZZF A;  2QK0 A;  1ZUK A;  3FB9 A;  3ICA A;  3H6Z A;  3CCJ Q;  1MMN A;  2EQU A;  1Q82 R;  3MP8 A;  2CUD A;  2QEX Q;  3X26 B;  4LD6 A;  1N9W A;  1BBZ A;  2QA4 T;  3TSZ A;  2X4X A;  1VQO Q;  1G3W A;  3CCU Q;  3X28 B;  3FLG A;  3VJP A;  4EMH A;  3HXZ A;  1H64 1;  4CI0 C;  2FHD A;  3JCM Q;  3VS6 A;  4QT7 A;  1BI1 A;  3IQL A;  5C51 B;  3JCM e;  1VQ8 T;  1I07 A;  2KRM A;  3MF2 A;  2LDM A;  2GBQ A;  4MZM A;  4XTW A;  4J7I A;  1MMG A;  2CYZ B;  3RAC A;  3HL8 A;  1T3L A;  1UGR B;  1VIF A;  3CBP A;  4KUL A;  3CCM Q;  2OTJ T;  1NJ2 A;  4H2X A;  4P73 C;  3V8L A;  1HD3 A;  3EFS A;  1ABQ A;  3CCS A;  2V26 A;  2LCS A;  4MDW A;  1KK7 A;  4M75 E;  4EMK A;  1M2O A;  2AKW B;  3AHU A;  3LC0 A;  4IUU A;  5GMK m;  1Q82 C;  1KG1 A;  2HDA A;  1YHQ Q;  4YRF A;  1I4K 1;  4PKC C;  2ZT5 A;  4LNS A;  3HKS A;  3VUB A;  1C0M A;  2K2M A;  4BDY A;  3CC4 A;  3RMS A;  3CCR Q;  2M9U A;  2RHZ A;  3LX7 A;  1NYQ A;  1V29 B;  4LVM A;  1K8A C;  3E9I A;  3L2Q A;  4G85 A;  3G1J A;  3VYG A;  1RI9 A;  4A4G A;  2LMJ A;  4A4E A;  1EVK A;  1WPY A;  4YRG A;  1V1C A;  1PCX A;  3CC4 Q;  2EGC A;  3HXV A;  3VS3 A;  4J9I A;  2A0F B;  2GFU A;  3ZEH A;  4LVL A;  3V8J A;  4KH0 B;  3MJX A;  1UJ0 A;  2LZ6 B;  3DB4 A;  2PVG B;  2I0N A;  4Q5W A;  2Q7E A;  4NOY A;  3VS4 A;  3A8M B;  5IH2 A;  4OLF A;  3CCV T;  4LDU A;  1WHG A;  3L1A A;  5GAN 4;  1BYM A;  5CAI A;  2ODR C;  5GAO p;  5CKE A;  4HCK A;  2LP5 A;  4HVV A;  1D1A A;  2SEM A;  2K6D A;  4M77 A;  3NPF A;  5IAY A;  2XDB A;  2GGR A;  3E19 A;  3MCA B;  4FT4 A;  2RHU A;  1M1G A;  4J8O A;  1UG1 A;  3FC3 A;  4PJO B;  2A8E A;  1VQP A;  2DX1 A;  2KE9 A;  2YXY A;  3E1S A;  4OMQ A;  4ME7 A;  3J81 E;  3URG A;  5GJV B;  1IZ6 A;  2RHX A;  1YWO A;  5KCO A;  4C8Q B;  4P71 C;  1ZUY A;  2OTJ A;  5GAN f;  2EJF A;  2BUD A;  4BW9 A;  4KR2 A;  1VQ5 A;  3QBY A;  2QHU A;  2ZR2 A;  1Q7Y R;  2PTK A;  4J9H A;  3MHX A;  3X20 B;  1VQ9 Q;  4E6R A;  2NUT A;  2QGF B;  1YJN T;  2CP5 A;  2P0Q A;  4C5I A;  4P74 C;  3NTH A;  1O9S A;  1VQ4 T;  3CCE Q;  1H4T A;  5GMK h;  2FB7 A;  2F2X A;  1UGV A;  3VS2 A;  2ZAE A;  1YIJ A;  4JLG A;  5KYU A;  4CH4 A;  1QVF P;  3QUI A;  1EFW A;  4HCC A;  4F7U F;  2ZR3 A;  3HXU A;  2B8A A;  4F7U B;  1M90 C;  1X54 A;  2EYX A;  5GAM e;  2DET A;  4R56 A;  1TXQ A;  3CCM A;  3GNF B;  3BJU A;  2V1Q A;  4LXC A;  2IG0 A;  2C0O A;  1WNL A;  5GAN 7;  1H3H A;  1WJQ A;  1YBY A;  4J9F A;  3DSQ A;  3X24 B;  3OD1 A;  2M16 A;  4DA4 A;  1H92 A;  1QF6 A;  2GQI A;  1X2H A;  3A32 A;  1AVZ C;  3PIP A;  1ZA2 B;  1KMM A;  3CC7 Q;  3BY7 A;  4PJL A;  4M78 D;  2JMC A;  1WXB A;  4P74 A;  4GLK A;  1VQZ A;  1K0X A;  3CCR A;  1I5L A;  2K79 A;  3HY1 A;  1Q86 U;  1MND A;  1B8A A;  2MK5 A;  2EJ9 A;  3M4Y A;  4P75 C;  3MKD A;  3CCL Q;  4M77 G;  1NYR A;  2O9V A;  2D6F A;  5FU7 C;  3EFR A;  3OS0 A;  4Y92 A;  1D1B A;  1KFZ A;  4M7A E;  1J3T A;  2RJD A;  2DEQ A;  2CP6 A;  1OOT A;  4OB0 B;  1JRI A;  2EYY A;  3LSQ A;  1M3A A;  1WXU A;  1Y0M A;  2BKD N;  3E9G A;  3QII A;  1K9M U;  2AMC B;  3QSU A;  3P8V A;  1YJ9 A;  4IKF A;  2WAC A;  1KD1 R;  1OX8 A;  3JCM c;  2M1H A;  2GFA A;  4H2T A;  4BWA A;  3NMZ C;  2L3R A;  2YHT A;  4PNO A;  3I5S A;  4TWA A;  4ZTZ B;  5LJ5 j;  3FJP A;  1UFF A;  2COY A;  3TQ7 P;  4RTW A;  1VQO A;  1K0S A;  2HSP A;  5J26 A;  3UGQ A;  2K4Y A;  3QNE A;  3JCM f;  1X56 A;  3NHN A;  1H4Q A;  1WLP B;  2DAQ A;  4BD3 A;  2DFU A;  2RA2 A;  2KT8 A;  3EG2 A;  3CCS T;  2VB6 A;  3CC7 A;  4N0A A;  4MZT A;  2JJ9 A;  4K87 A;  2CP3 A;  3VKI A;  4DEY A;  4YRT A;  4KGX B;  1X27 A;  3ME9 A;  4M4Z A;  2ZZD A;  3TUP A;  2PUO B;  1M8M A;  1JXM A;  1OX9 A;  2X35 A;  4P3N A;  3LLR A;  1FWZ A;  2RQV A;  2DL7 A;  2DXB A;  3HRS A;  2Y90 A;  2ZPH B;  2EYQ A;  4HWP A;  3MEW A;  4L87 A;  4M7D C;  4JS5 A;  2DDZ A;  2QQS A;  2YUP A;  4FYY B;  1RUW A;  4CH3 A;  1WDX A;  1L0W A;  3M57 A;  4J6X A;  4J9C A;  1BIA A;  2NUZ A;  2P5I A;  3REB B;  1RAC B;  2HKN A;  2ZXF A;  1WHL A;  1M4Z A;  4HT4 A;  4BE0 A;  4P71 A;  5CVI A;  4PJM A;  4M78 A;  5A0D A;  4C92 F;  1X2G A;  4LVI A;  2DL3 A;  2O31 A;  3QDR B;  3MO8 A;  3DLM A;  1D0Z A;  3QTC A;  5GAM f;  1WQW A;  3TU4 K;  1K73 U;  2L2P A;  4UPA A;  5LJ3 f;  4ATO A;  2CGH A;  2RPN A;  4JRK A;  3QJY A;  2GF7 A;  3VU3 C;  2DEU A;  4F7U E;  1WHH A;  3VBB A;  1SER A;  3OYJ A;  1VQN A;  1M8V A;  3LGF A;  4Z88 A;  4M7A C;  2I4M A;  1SF9 A;  4Z8A A;  4QQ6 A;  3AT1 B;  4AFQ C;  3I56 T;  1BI3 A;  1VQP T;  1NEB A;  4E47 A;  5IN1 A;  3UWN A;  2X51 A;  1AD5 A;  1W2B A;  4M77 F;  3RKW A;  3M54 A;  1KHC A;  3SD4 A;  4K11 A;  3HFO A;  2EYW A;  3CBM A;  2F5T X;  2QDL A;  2CKK A;  3OYA A;  2J05 A;  3A8L B;  3A5Z B;  1AWX A;  3JV3 A;  4YPF A;  2LQN A;  4OP0 A;  2JNG A;  1D1C A;  4HWT A;  4M7A G;  4ANJ A;  4MZP A;  2BE9 B;  3I55 T;  5GMK j;  2LJ0 A;  1NYF A;  4HXJ A;  3LWI A;  2EFI A;  2OTL A;  4BB7 A;  3QYG B;  3HSB A;  2DL5 A;  2LQW A;  2LCL A;  2X9H A;  3SEM A;  1OQK A;  2EGE A;  3CCQ T;  5D6Y A;  1OZ2 A;  3DB3 A;  4V2S A;  4JJD A;  1EX4 A;  4H02 A;  5HY6 A;  1K76 A;  4PJO G;  1HJD A;  2P4R A;  2ED0 A;  3JB9 F;  2Q7G A;  1S72 T;  4FL6 A;  4HCB A;  2EW3 A;  3O8V A;  4CRI A;  3CCM T;  3SDZ A;  4FYV B;  1DJ7 B;  2NLU A;  2WSF E;  1VQP Q;  4LVK A;  2DYI A;  1N6A A;  5GAN h;  2OAU A;  4HT9 A;  2OI3 A;  5CCA A;  3EG9 A;  3T9N A;  4YRQ A;  3I5R A;  1CSK A;  5F5W A;  1KQS P;  4RKU E;  1F1B B;  4F17 A;  4YRJ A;  2DL8 A;  2BZ8 A;  3TSW A;  2FL7 A;  4C0D B;  4BY6 C;  2LX7 A;  2LCC A;  1BI0 A;  4YRS A;  4YRO A;  1Y57 A;  4E7H A;  2B86 A;  1NZ9 A;  2EQK A;  2K9G A;  4C0Z A;  3HRU A;  3UGT A;  2NYS A;  2SRC A;  4OB3 B;  3CCR T;  1SKU B;  4CH6 A;  4DEX A;  4EMK B;  1GGM A;  3I9Q A;  3OYC A;  5K1X A;  1ZUU A;  4OB2 B;  2ZIO A;  1QWF A;  4JUV A;  5GMK i;  2KR3 A;  5GAN 8;  3OYE A;  5L23 A;  3CCS Q;  4NL3 A;  4LDV A;  1KQS S;  5IXB A;  3H0I A;  2RNA A;  2PVD B;  1N8R R;  4P3P A;  2KEA A;  2YRC A;  3GBQ A;  3I7F A;  3OSS C;  5IHN A;  1B34 A;  4XU2 A;  4QQG A;  4YCU A;  2QEX A;  3GPL A;  1U5S A;  4DBH A;  1ASZ A;  3BDU A;  3PZC A;  4XTU A;  3CME A;  1AEY A;  2QI2 A;  2O9S A;  3P8H A;  4M77 B;  2BZY A;  3QWX X;  5GAM d;  1IL2 A;  2DYB A;  3NTK A;  1T3S A;  1YJW T;  2K2V A;  1JJC A;  3VQV A;  4KUI A;  4C8Q F;  4F7U A;  2OAW A;  4N0A C;  4AFS C;  2DXT A;  1VQO T;  5DM7 R;  4DBR A;  1PD1 A;  4II1 A;  3QO7 A;  5ECA A;  1QP3 A;  3KFV A;  4QVD A;  2P0P A;  1NNH A;  2L3S A;  1WIE A;  2COW A;  2CUB A;  4CC3 A;  2DTH A;  4RG2 A;  1QWE A;  1VQ5 Q;  1K73 C;  1BB9 A;  1W66 A;  3L2V A;  1K4U S;  4ELZ C;  2ZPI B;  2PVO B;  4GY5 A;  3M0P A;  1G3S A;  4ESR A;  1UHC A;  4JRI A;  3HFZ B;  4Y91 A;  5LJ3 j;  1WJS A;  3RKY A;  1EIY A;  5KYU B;  2CT4 A;  5LJ5 h;  1WU7 A;  1IRX A;  2XDP A;  3CCQ Q;  1AHJ B;  4Z89 A;  1G5H A;  4HWR A;  4KH1 B;  1MV3 A;  2KNB B;  2JZ2 A;  3RIR A;  1Q81 U;  2ZNJ A;  5LJ5 f;  1OU8 A;  2HBW A;  1XOV A;  4C8Q A;  3A7A A;  2I4O A;  1X2Q A;  1NJ6 A;  3HY0 A;  1EQR A;  3RKX A;  3HXW A;  2HZY A;  2PU9 B;  2EGA A;  1R0B G;  1G2B A;  1GBQ A;  4DOW A;  1J5W A;  3LW5 E;  1H3Z A;  2AZS A;  2DO3 A;  3JB9 G;  4PG3 A;  3JCM g;  3SB2 A;  1ZSG A;  1D3B B;  2DZC A;  2PUK B;  1KD1 U;  2DL4 A;  3TEG A;  2EJG A;  1BIB A;  4OF1 A;  3OA6 A;  1YI2 Q;  3PMT A;  3CD6 Q;  2DQ3 A;  1NPR A;  2QEX T;  3TEH A;  1R0C B;  2MIO A;  4J9D A;  1QCO A;  1EFN A;  2VUB A;  1G5V A;  2A08 A;  4TTV A;  4RQF A;  4XAX B;  4M7A A;  4N4G A;  2FRW A;  1XJW B;  4RCC A;  2CSI A;  4E7I A;  2C06 A;  4B9X A;  3OY9 A;  3OW2 S;  5DLO A;  5A2Q E;  1VQN Q;  3OS5 A;  1SRY A;  2ZPF B;  3OYN A;  4E7K A;  1I8F A;  4MML A;  3PGG A;  2CIM A;  3KFU A;  4Z02 A;  3G4S A;  1YCY A;  2ZPB B;  4MMK A;  1OEB A;  2E5Q A;  1VQ6 A;  4LVJ A;  3EG3 A;  2YRV A;  3LYI A;  3CXC S;  2KBT A;  5GAM j;  3OYD A;  1W70 A;  4BI3 A;  1YFN A;  4GLM A;  2EBP A;  3QZ5 B;  3RMQ A;  3MP6 A;  3OW2 P;  4TVR A;  2RHI A;  1PSF A;  2RMO A;  2DD5 A;  4AT1 B;  1NYG A;  5I11 A;  3I35 A;  2CDT A;  1X75 C;  4OMN A;  3I55 A;  1SRM A;  3BDL A;  5E3I A;  4VUB A;  2G3R A;  3SFM A;  3C94 A;  2J3L A;  2Q7H A;  4AG1 C;  3CPW S;  5ELN A;  4YRM A;  3CCL A;  1TUC A;  3JCM J;  3NEM A;  1VQK A;  4K88 A;  4ZTJ A;  1M1K R;  2VXF A;  2JTM A;  1VQ4 Q;  1I81 A;  2GCX A;  1Q86 C;  1WFW A;  2YRD A;  4A53 A;  2RN8 A;  1E1O A;  5D6X A;  2VGN A;  1ZBX A;  8AT1 B;  3INZ A;  2D1X A;  2MF2 A;  2HQX A;  3CD6 A;  2DVJ A;  5IXF A;  1IB8 A;  1U3O A;  5HKC A;  2RF0 A;  1BBU A;  2X3X D;  1M90 U;  4E51 A;  1NG2 A;  3CC2 A;  5CIU A;  4QVZ A;  2VAS A;  2X4J A;  3EFO A;  1VUB A;  3VRZ A;  4B6M A;  2E3H A;  4AG2 C;  5GAO r;  1WHK A;  4M7A F;  3PCO B;  4ZN3 A;  1VYV A;  2DM1 A;  4YTL A;  2CJ9 A;  2J3M A;  1RAH B;  4O2D A;  3RF1 A;  1Z7N A;  4FSX A;  3HP9 A;  1ADY A;  1X2K A;  2HQE A;  1Z9Z A;  4PFP A;  3OYK A;  4YCV A;  1YHQ T;  4CC4 B;  1NM7 A;  3A7R A;  4HA8 A;  1NPP A;  1D0X A;  1WYX A;  4DBQ A;  3EG1 A;  3UF4 A;  3CMQ A;  5DLQ E;  3A5Z A;  2DIQ A;  2FPF A;  3CCU A;  4M78 F;  1U1T A;  2PNI A;  3CQT A;  3GNG A;  3G71 T;  2J06 A;  4UP7 A;  1Q7Y C;  2K5I A;  2KAF A;  3JRZ A;  3M5A A;  3OBY A;  2FEI A;  3NEL A;  1WI7 A;  3UAT A;  4YRN A;  2JM8 A;  2QG9 B;  5J3B A;  4WI1 A;  1P92 A;  4XEO A;  3EG0 A;  5LJ5 d;  5D6W A;  4JRP A;  3LH0 A;  2EAY A;  1WZO A;  4OMO A;  5KYW B;  3EHR A;  4Y28 E;  1G8X A;  1BBW A;  2DNU A;  5GAN 2;  2JS0 A;  5GAM h;  4OGE A;  1Q82 U;  2QA4 Q;  1GBR A;  5GAN g;  1Q7Y U;  1BCM A;  5FU6 C;  5IHK A;  1OPK A;  4A54 A;  1VQK T;  4OVA A;  1X55 A;  1IGU A;  1SEM A;  1UGS B;  5LJ3 e;  4CH5 A;  5AT1 B;  4PJO C;  1I1J A;  2JVV A;  4M78 E;  2NUP A;  5K1P A;  3IKL A;  4DOV A;  4M78 G;  1KQ1 A;  5I21 A;  3UPU A;  4TVA A;  1SHG A;  1ZLM A;  5GAO n;  1Z9Q A;  1VQL Q;  3DKM A;  1NJI U;  3WVE B;  3A98 A;  1AWJ A;  3E9F A;  3PT9 A;  3MEY A;  1YCS B;  1Y96 B;  1A0N B;  1TS9 A;  1KSW A;  2E10 A;  2DRM A;  3EG9 B;  3JCM d;  7AT1 B;  4J9E A;  3W3S A;  4OMF B;  3H9N A;  3I55 Q;  5C52 B;  3UA7 A;  1YFR A;  2EQM A;  1UHF A;  3V7S A;  3JB9 J;  3VQY A;  1TUG B;  5LJ5 e;  4H2Y A;  3G6E Q;  1BKB A;  2HMA A;  4HCZ A;  5J39 A;  2RQT A;  2LVM A;  4Q15 A;  3VS5 A;  5AYF A;  4EMG A;  1K9A A;  2RHS A;  3R6N A;  4YRL A;  3MET A;  1VQ9 A;  4YDQ A;  1PD0 A;  2KRN A;  2RQU A;  2DQ0 A;  2JMA A;  1PKT A;  2VKN A;  1Q86 R;  3QO8 A;  1G3T A;  1UGP B;  3G4S Q;  2R5M A;  4R0K A;  3PE0 A;  4H2W A;  1ZSZ C;  2ZCF B;  1YIJ T;  4BI4 A;  1VQ8 A;  1MNE A;  2ARS A;  1X6O A;  5CKB A;  4YRK A;  2AHJ B;  2E3C A;  4LDX A;  4M77 D;  1WXT A;  3KXT A;  2LNV A;  1YJ9 Q;  1HSQ A;  1W1F A;  1IRE B;  4H2V A;  2ALY A;  4X34 A;  1M90 R;  5I2S A;  1BCO A;  1QMC A;  1JJC B;  2IVW A;  3PCO A;  2RJC A;  1VQL A;  1AZE A;  1N8R C;  2P4T A;  1JJ2 P;  3HRK A;  1OUL A;  3F70 A;  1E24 A;  1KQS A;  2JN0 A;  3EFO B;  2FG0 A;  4KRT A;  3SWN B;  2O2O A;  4BI8 B;  3P8D A;  3CPF A;  2L0A A;  5L8R E;  1IGQ A;  3JCM b;  2ZZE A;  1AT1 B;  1EIY B;  5KYY A;  5LL6 S;  3CXC P;  1LJO A;  1M3B A;  2RM4 A;  3OYG A;  3TRE A;  1BU1 A;  1RAF B;  4A4F A;  1EVL A;  2JUF A;  2AT1 B;  4M7D D;  3M4P A;  2C0I A;  4K86 A;  2JTE A;  1E6G A;  2VWF A;  2MWO A;  3H8Z A;  2YSQ A;  1GXI E;  4PLI A;  2E4H A;  1U06 A;  3OS1 A;  1YJ9 T;  2RI2 A;  2ROL A;  3EGX A;  4J9B A;  2CP0 A;  5GAN e;  2AMC A;  2P0L A;  5KH6 A;  4C0F A;  1QE0 A;  1M9S A;  5C53 B;  1M2V B;  2HEQ A;  1T0J A;  4D8K A;  2HAX A;  3VYH B;  2D8J A;  3PVL A;  5CKD A;  4EO4 A;  1HYO A;  3UT1 A;  2EIF A;  1OPL A;  2FZG B;  1PG5 B;  2E3I A;  1UJY A;  2BIV A;  2P0K A;  4HVW A;  5GMK e;  1ZQ1 A;  2C0T A;  2I4L A;  5FW9 A;  2RHY A;  2P84 A;  1RI0 A;  2RJE A;  4IUQ A;  1PYS A;  3EGU A;  4HVU A;  5LJ5 g;  1UE9 A;  4C92 A;  5GAN 6;  2DKG A;  4J83 A;  1IO6 A;  2K5F A;  4O6J A;  4GBQ A;  2DXC A;  3M0Q A;  1Y96 A;  1B7Y A;  4TQF A;  2EQJ A;  2R5A A;  4H2U A;  1WGS A;  4X9D A;  1W2B P;  2A3L A;  1E1T A;  5CQY A;  1X69 A;  2K3B A;  4ZNX A;  3UFG A;  5KCH A;  5I2M A;  4IIO A;  1YHQ A;  2JOY A;  4A4K A;  2F5K A;  2DMO A;  4C8Q E;  2J7I A;  3JCM h;  1ATI A;  1CKA A;  12AS A;  4LE9 A;  3M53 A;  4HKE A;  6AT1 B;  3UDC A;  3Q1J A;  2JTF A;  2XHC A;  5FWC A;  3HTZ A;  3UA6 A;  4BDZ A;  2MPX C;  5D7U A;  4PJO E;  1E6H A;  5KNN A;  2E70 A;  2LNH B;  3CMA A;  4ZIB A;  3HFN A;  3KUF A;  1EIF A;  4UP8 A;  2ALY B;  2V1R A;  3A5Y A;  2QAS A;  4PFZ A;  4RQE A;  4RCB A;  4FSS A;  4RTZ A;  1UGQ B;  2HSE B;  3FDR A;  3L2U A;  1NLP C;  2CH4 W;  4FU6 A;  2DTO A;  4H2S A;  1JEG A;  5I22 A;  1M1K U;  3WVD B;  2XKO C;  3R07 A;  4JZ3 A;  4FW2 A;  2LJ1 A;  4TQD A;  2FO0 A;  3RES A;  1G51 A;  1N5Z A;  1MV0 B;  3BW1 A;  2KT1 A;  4G84 A;  3S3N A;  5CK9 A;  1QVF S;  1G83 A;  4TVW A;  2QXF A;  3EAE A;  5GAO q;  5FU6 B;  3ZFJ A;  3CCE A;  2GTJ A;  4YRP A;  2M0Y A;  3PNW C;  2W0Z A;  3ULR B;  4ZN1 A;  3UH0 A;  3OYL A;  3M4G A;  3RL6 A;  4M78 B;  4NS5 A;  2LTO A;  1KC8 C;  2F2V A;  3M0T A;  5C6S A;  2CSQ A;  2IPO B;  2RI5 A;  3QZ9 B;  1JB0 E;  3QHS A;  4XU0 A;  3A8G B;  2E65 A;  3ASK A;  2QQB A;  5KE3 A;  2EWN A;  5GAN 3;  1YB3 A;  3OYF A;  3JCM V;  2KRO A;  4KQE A;  3M59 A;  4M75 B;  1K9M R;  1Z7M A;  2GTO A;  1S72 A;  3VQX A;  3CD6 T;  1WA7 A;  3OSV A;  1QQJ A;  3OQ5 A;  2QHT A;  2DVE A;  1SHF A;  1PC0 A;  1MUZ A;  1MHN A;  3MP1 A;  1G3Y A;  3OYH A;  4P75 A;  1PRM C;  1FXX A;  3CC2 T;  1KMN A;  3C12 A;  3PVQ A;  3VS0 A;  4M7D B;  1X6B A;  4M7A B;  4OGC A;  1TOV A;  1VYU A;  2DIL A;  3QPH A;  4C5G A;  2EKH A;  4XK8 E;  4JPB W;  4HVC A;  2CS7 A;  1WJR A;  2G4C A;  2H8H A;  4JRQ A;  2ARU A;  2EPD A;  2YWW A;  3U23 A;  4J7F A;  2MOX A;  4CC2 A;  1WYD A;  4YCW A;  1PWT A;  4BAC A;  1GCQ A;  3PMI A;  1B7Y B;  4J15 A;  1FYF A;  4J9G A;  2NWM A;  3M0R A;  1PM3 A;  2FVU A;  2M51 A;  3X25 B;  2J6F A;  2JS2 A;  1ACM B;  5IT9 E;  1B07 A;  1VQ8 Q;  4CS4 A;  4IUP A;  4EDU A;  3PTA A;  5HCK A;  1K1Z A;  1TUD A;  4KR3 A;  1M27 C;  3A74 A;  3V7C A;  3ZBD A;  2W10 A;  1KQ2 A;  4LUE A;  1B34 B;  2ATC B;  1YNZ A;  2JM9 A;  1Q81 C;  3GLX A;  1USY C;  2QTX A;  1H8K A;  4JJB A;  2L3Q A;  4C92 B;  2YUN A;  2YLC A;  4KGZ B;  2JW4 A;  1RLQ C;  1FMK A;  4XQ3 A;  2A37 A;  1C6V X;  3ER0 A;  4PLL A;  3EH1 A;  1M30 A;  1YI2 T;  1JO8 A;  3G6E A;  2ECZ A;  4HT8 A;  1RAI B;  4C5E A;  4YRC A;  2L89 A;  2GNC A;  1HTT A;  4YP0 A;  3JCM W;  1LCK A;  1PRL C;  4F04 B;  2ZGW A;  1D09 B;  2MI6 A;  4EPC A;  2L3P A;  2CZ6 B;  4RDX A;  1JXO A;  1G5I A;  2YT6 A;  1IXD A;  4OMP A;  3DLL A;  2YDL A;  1FMV A;  2O4X B;  2GQV A;  1QKW A;  5KE2 A;  2KMT A;  5KYX B;  1CKB A;  3IG2 A;  3NTI A;  2ZPE B;  2OTL T;  1QCN A;  2ZNI A;  1QP2 A;  2D0N A;  3VV0 A;  1YJW Q;  3CCV Q;  1GFD A;  3CCU T;  1U8R A;  5CO7 A;  1SET A;  3RNJ A;  1SES A;  3BFM A;  1AZG B;  2O01 E;  1N9R A;  3H0H A;  4WF2 A;  1U1S A;  4F14 A;  2DXU A;  1OZ3 A;  1OV3 A;  1YIJ Q;  2EQI A;  3WXM B;  3ZL7 C;  2E5A A;  4QQD A;  4PL6 A;  4XTZ A;  4UC4 A;  4ZGE B;  3RUX A;  4OMM A;  4EMK C;  1QVG P;  2E6Z A;  3OB9 A;  9ATC B;  3OMC A;  3M4Q A;  4P3O A;  1ABO A;  4DQ2 A;  3CEY A;  1K9M C;  2V8J A;  1JBM A;  1MMA A;  1SSH A;  2CH4 A;  3NET A;  1PKS A;  5M9O A;  2QQR A;  3CC4 T;  2CP2 A;  4PK4 A;  2I2L A;  2QGG A;  4D6W A;  3G4S T;  5GAM g;  3JCM X;  2RD1 A;  2RHQ B;  4FM4 B;  2Y4X A;  3G7Z A;  4C8Q G;  3M58 A;  1UEC A;  2RO0 A;  2RK2 A;  3M0U A;  1YJN Q;  1Y07 A;  1NE8 A;  2XU8 A;  4AH6 A;  4DBF A;  1FX7 A;  4XTY A;  3JCM P;  3A1P A;  4KBM B;  3VS7 A;  3D7S B;  2RH2 A;  1VQL T;  2DBK A;  1RAD B;  3P8T A;  2E1H A;  1RAE B;  1WHM A;  4PJN A;  2RQR A;  3CMA T;  5DY9 A;  1AOJ A;  4M75 G;  2O88 A;  3CC2 Q;  1PNJ A;  1VIE A;  2COZ A;  1NJ5 A;  3OYI A;  3P8B B;  3KBG A;  1VQ6 Q;  1VQM Q;  4L6V 5;  1S72 Q;  1QLY A;  2G6F X;  4IIM A;  2FZC B;  1WX6 A;  3HTR A;  4E7S A;  1MMD A;  5KYW A;  2QDY B;  1VQ7 Q;  4RTU A;  1GFC A;  2OTJ Q;  4C92 G;  1PYS B;  2E5K A;  3HPW A;  4M77 C;  1TH7 A;  2EKO A;  3EGD A;  1EOV A;  2XMF A;  4O5V A;  1B70 B;  3JB9 I;  4WCI A;  5KYN A;  1VQK Q;  2C8M A;  2AZV A;  1ZA1 B;  4FCY A;  4IUR A;  3CPW P;  2L5Q A;  2AK5 A;  3CCE T;  2KXD A;  3MEA A;  1KHI A;  3OMG A;  2MYS A;  3EHQ A;  3QDF A;  2QTV A;  1M3C A;  4DPG A;  2DTI A;  4IUT A;  3GF5 A;  2F2W A;  2WSE E;  3EH2 A;  3L4G A;  4RTT A;  3ERR A;  4AMC A;  4L5G A;  4RMO A;  2ZT7 A;  4P73 A; 
#chains in the Genus database with same CATH homology
 2K5L A;  3A31 A;  2XI9 A;  5GAN 5;  2XTI A;  5FU7 B;  11AS A;  4H2X B;  1XTD A;  2HBP A;  2QQA A;  1KC8 U;  4BY6 B;  2QHV A;  4C0D C;  3G71 A;  2Y4Y A;  2O4X A;  1VQ7 T;  4LD9 K;  5GAN j;  4PHC A;  3QXE B;  2E64 A;  1M1K C;  4R55 A;  3JAM E;  3QJ6 A;  1Y71 A;  3A8H B;  2VC8 A;  3TCJ A;  4JLI A;  2CZ1 B;  3PIO A;  4F7U G;  1YIT A;  2V8I A;  5FLX E;  1VQM T;  5A0L A;  1JJ2 S;  4RG8 A;  3PFS A;  3CCJ A;  1KOG A;  2RI3 A;  4PJO A;  1O75 A;  4M7D G;  2F69 A;  2E6N A;  3GP8 A;  4ZGJ B;  2ZCE A;  4P72 A;  1NJI C;  3C95 A;  5ELO A;  2IY5 B;  4C0G A;  4QW2 A;  2D9T A;  2D0Q B;  3HRT A;  4ZGD B;  3L42 A;  2QA4 A;  2K57 A;  1SSF A;  3G6E T;  1RL2 A;  4MDX A;  2DU7 A;  4YRI A;  3OS2 A;  2ZTG A;  2MMP A;  5LJ3 h;  2CJB A;  2DZ9 A;  4M75 A;  4YRR A;  4C8Q C;  1H4S A;  4C92 C;  1NJ1 A;  1HC7 A;  2DIG A;  4XU1 A;  2ZPG B;  5GAO m;  2KVQ G;  3RGL A;  3GOX A;  2LQ8 A;  4LDY A;  4M7D E;  3LWH A;  3REX A;  3CCL T;  2ART A;  3VUZ A;  2DU5 A;  4P5N A;  4QVC A;  2RJF A;  5FRM A;  1E22 A;  4J6Y A;  1D3B A;  2XID A;  2Q5H A;  3CC7 T;  1UEB A;  1VQ9 T;  5LJ3 g;  3CXC A;  3VQW A;  2K3X A;  3OYY A;  3WQZ A;  1MGQ A;  2XK0 A;  1LNX A;  4PJO F;  1VQ4 A;  2LT4 A;  2LRQ A;  4X5O A;  1VQM A;  4TVA B;  4M7A D;  4CS2 A;  3MEV A;  2M0O A;  4J5Y A;  2EL9 A;  1H4V B;  1M5Q 1;  3IKM B;  2KSS A;  3G1Z A;  3FRN A;  3CME T;  4ELY C;  1N9S A;  1UB4 A;  3SWN C;  3HFZ A;  4L59 A;  4M75 D;  2HNI A;  1B76 A;  2ZIN A;  3RER A;  4CS3 A;  3NFC A;  2ZT8 A;  4E7J A;  4IUV A;  4WJ4 A;  2CZ0 B;  4C8Q D;  1QVF A;  4Q6G A;  4M77 E;  3MF1 A;  5GAN d;  3OBW A;  3MEU A;  2X4W A;  1QVG S;  2LT1 A;  5CQX A;  4BUG A;  1ASY A;  4PJO D;  5C0M A;  1YFT A;  3J7A F;  5A0G A;  2QQ9 A;  4FIB A;  2HD0 A;  2RB6 A;  3QG1 A;  4JJN K;  3TEH B;  1QW1 A;  2LQK A;  2RK1 A;  3L2R A;  4TVY A;  4C92 E;  2I4N A;  3JSC A;  3JB9 H;  4OB1 B;  4C92 D;  1N27 A;  3HFV A;  1LOJ A;  2CZ7 B;  3SWN A;  4KUD K;  2X4Y A;  1ADJ A;  2IY5 A;  3LSS A;  3LGL A;  2K3Y A;  1QVG A;  2ZT6 A;  5EG2 A;  5CKF A;  4UP9 A;  3CCQ A;  3IAL A;  3N5B B;  5CR2 A;  4E7L A;  4M7D A;  1VQ7 A;  5HGQ A;  1KD1 C;  2XDD A;  2PME A;  1HK9 A;  2CJA A;  3FEO A;  3A7U A;  3HXX A;  5HK0 A;  1X01 A;  2E12 A;  5GAO l;  1R8O B;  3OW2 A;  4P72 C;  2LC4 A;  2VYT A;  4NL2 A;  4YYE A;  1USY A;  3R6O A;  2H3J A;  4BE1 A;  4N4H A;  1YGB A;  4JDS A;  5CKH A;  3HXY A;  4M75 C;  1JJ2 A;  1XQH A;  2RHQ A;  5HK3 A;  1M1F A;  3CCJ T;  4HWS A;  1RIQ A;  3V7R A;  1W2B S;  3E9H A;  2KQW A;  4M78 C;  4N4I A;  3M55 A;  3HHT B;  1YIT T;  2FYK A;  2ZIM A;  3CBO A;  3L2Z A;  2A7Y A;  2DK3 A;  1PSE A;  3QYH B;  2MWP A;  5FRN A;  2VXE A;  2R58 A;  4X9C A;  2AKW A;  4C5H A;  2KY9 A;  2DD4 A;  2WSC E;  1VQN T;  2R57 A;  5GMK l;  5LJ3 d;  2V8K A;  3M56 A;  1YJW A;  3V8K A;  3L4G B;  3A8O B;  3REU A;  2NS6 A;  3S3M A;  2E41 A;  2RHS B;  3I56 A;  1YJN A;  3OYB A;  4BE2 A;  2XIC A;  1Y7X A;  1OYX A;  1WQ7 A;  1BI2 A;  4LDW A;  1K8A U;  2L8D A;  2QHS A;  3QO3 A;  2KK4 A;  3JB9 D;  3MQZ A;  2VV5 A;  4XTX A;  2C7I A;  3L2W A;  2PQW A;  1VQ5 T;  2KDS A;  2Q5I A;  1ZHI A;  2VGM A;  3OYM A;  1B70 A;  4B9W A;  2YLB A;  3P8Y A;  1YFS A;  4FT2 A;  3CPW A;  4ZTF A;  3QO5 A;  1QVP A;  1XNI A;  1NJ8 A;  4XEM A;  1W4S A;  4JS4 A;  3J80 E;  2ODR D;  1OI1 A;  3M9Q A;  2DPP B;  2PMF A;  3GIB A;  4WJ3 M;  1LYL A;  1N8R U;  2XGT A;  3FIF A;  3HRI A;  4YRE A;  3S3O A;  3S6W A;  2XD0 A;  1HXD A;  4HWO A;  1VQ6 T;  2ZZG A;  5FRO A;  4NCX A;  4XU3 A;  1WLE A;  4M75 F;  3TEE A;  2LX9 A;  4KT0 E;  2DJZ A;  4ZTU B;  4XTV A;  4A4H A;  4J6W A;  1C0A A;  4M7D F;  1YI2 A;  3NEN A;  2XG8 D;  2MAM A;  4RMF A;  4EX5 A;  3C4S A;  3CCV A;  3QKJ A;  2ZZF A;  3FB9 A;  3ICA A;  3H6Z A;  2EQU A;  3MP8 A;  3X26 B;  4LD6 A;  1N9W A;  2QA4 T;  2X4X A;  1G3W A;  3X28 B;  3FLG A;  3VJP A;  4EMH A;  3HXZ A;  1H64 1;  4CI0 C;  2FHD A;  3JCM Q;  1BI1 A;  5C51 B;  3JCM e;  1VQ8 T;  3MF2 A;  2LDM A;  4MZM A;  4XTW A;  4J7I A;  2CYZ B;  3RAC A;  3HL8 A;  1VIF A;  1UGR B;  1NJ2 A;  3CBP A;  4KUL A;  2OTJ T;  4H2X A;  4P73 C;  3V8L A;  3EFS A;  3CCS A;  4MDW A;  4M75 E;  4EMK A;  2AKW B;  3AHU A;  3LC0 A;  4IUU A;  5GMK m;  1Q82 C;  1KG1 A;  4YRF A;  1I4K 1;  4PKC C;  2ZT5 A;  4LNS A;  3HKS A;  3VUB A;  4BDY A;  3CC4 A;  3RMS A;  2M9U A;  2RHZ A;  3LX7 A;  1NYQ A;  1V29 B;  4LVM A;  1K8A C;  3E9I A;  3L2Q A;  4G85 A;  3VYG A;  4A4G A;  4A4E A;  1EVK A;  1WPY A;  4YRG A;  3HXV A;  2GFU A;  4LVL A;  3ZEH A;  3V8J A;  3DB4 A;  2PVG B;  4Q5W A;  2Q7E A;  4NOY A;  3A8M B;  4OLF A;  3CCV T;  4LDU A;  3L1A A;  5GAN 4;  1BYM A;  5CAI A;  2ODR C;  5GAO p;  5CKE A;  4M77 A;  5IAY A;  2XDB A;  3E19 A;  3MCA B;  4FT4 A;  2RHU A;  1M1G A;  4J8O A;  3FC3 A;  4PJO B;  2A8E A;  1VQP A;  3E1S A;  4ME7 A;  3J81 E;  3URG A;  1IZ6 A;  2RHX A;  5KCO A;  4C8Q B;  4P71 C;  2OTJ A;  5GAN f;  2EJF A;  2BUD A;  4BW9 A;  4KR2 A;  1VQ5 A;  3QBY A;  2QHU A;  2ZR2 A;  3MHX A;  3X20 B;  1YJN T;  2P0Q A;  4P74 C;  4C5I A;  3NTH A;  1O9S A;  1VQ4 T;  1H4T A;  5GMK h;  2FB7 A;  1YIJ A;  4JLG A;  4CH4 A;  3QUI A;  1EFW A;  4HCC A;  4F7U F;  2ZR3 A;  3HXU A;  2B8A A;  4F7U B;  1M90 C;  1X54 A;  5GAM e;  4R56 A;  3CCM A;  3GNF B;  3BJU A;  2IG0 A;  1WNL A;  5GAN 7;  1WJQ A;  1YBY A;  3DSQ A;  3X24 B;  3OD1 A;  2M16 A;  4DA4 A;  1QF6 A;  1X2H A;  3A32 A;  3PIP A;  1KMM A;  3BY7 A;  4M78 D;  4P74 A;  4GLK A;  1VQZ A;  3CCR A;  1I5L A;  3HY1 A;  1Q86 U;  1B8A A;  2EJ9 A;  3M4Y A;  4P75 C;  4M77 G;  1NYR A;  2D6F A;  5FU7 C;  3EFR A;  3OS0 A;  4M7A E;  2RJD A;  2DEQ A;  4OB0 B;  1JRI A;  3LSQ A;  2BKD N;  3E9G A;  3QII A;  1K9M U;  2AMC B;  3QSU A;  3P8V A;  1YJ9 A;  4IKF A;  2WAC A;  3JCM c;  2M1H A;  2GFA A;  4H2T A;  4BWA A;  2L3R A;  2YHT A;  4PNO A;  4TWA A;  4ZTZ B;  5LJ5 j;  3FJP A;  1VQO A;  5J26 A;  3UGQ A;  2K4Y A;  3QNE A;  3JCM f;  1X56 A;  1H4Q A;  2DAQ A;  4BD3 A;  2RA2 A;  3CCS T;  3CC7 A;  4N0A A;  4MZT A;  4K87 A;  3VKI A;  4YRT A;  3ME9 A;  2ZZD A;  3TUP A;  2PUO B;  2X35 A;  4P3N A;  3LLR A;  1FWZ A;  2DXB A;  3HRS A;  2Y90 A;  2ZPH B;  2EYQ A;  4HWP A;  3MEW A;  4L87 A;  4M7D C;  4JS5 A;  2DDZ A;  2QQS A;  4CH3 A;  1L0W A;  3M57 A;  4J6X A;  1BIA A;  2P5I A;  2ZXF A;  1M4Z A;  4HT4 A;  4BE0 A;  4P71 A;  5CVI A;  4M78 A;  5A0D A;  4C92 F;  1X2G A;  4LVI A;  3QDR B;  3MO8 A;  3DLM A;  3QTC A;  5GAM f;  1WQW A;  3TU4 K;  1K73 U;  4UPA A;  5LJ3 f;  4ATO A;  2CGH A;  4JRK A;  3QJY A;  2GF7 A;  3VU3 C;  4F7U E;  3VBB A;  1SER A;  3OYJ A;  1VQN A;  1M8V A;  3LGF A;  4M7A C;  2I4M A;  4QQ6 A;  3I56 T;  1BI3 A;  1VQP T;  4E47 A;  5IN1 A;  3UWN A;  1W2B A;  4M77 F;  3RKW A;  3M54 A;  1KHC A;  3SD4 A;  3HFO A;  3CBM A;  2F5T X;  2CKK A;  3OYA A;  3A8L B;  3A5Z B;  4YPF A;  4OP0 A;  2JNG A;  4HWT A;  4M7A G;  4MZP A;  3I55 T;  5GMK j;  3LWI A;  2EFI A;  2OTL A;  4BB7 A;  3QYG B;  3HSB A;  2LCL A;  3CCQ T;  5D6Y A;  1OZ2 A;  3DB3 A;  4V2S A;  4H02 A;  5HY6 A;  4PJO G;  3JB9 F;  2Q7G A;  1S72 T;  4FL6 A;  4HCB A;  3O8V A;  4CRI A;  3CCM T;  3SDZ A;  1DJ7 B;  2NLU A;  2WSF E;  4LVK A;  1N6A A;  5GAN h;  2OAU A;  4HT9 A;  5CCA A;  3T9N A;  4YRQ A;  5F5W A;  4RKU E;  4YRJ A;  2FL7 A;  4C0D B;  4BY6 C;  2LCC A;  1BI0 A;  4YRS A;  4YRO A;  4E7H A;  1NZ9 A;  2EQK A;  4C0Z A;  3HRU A;  3UGT A;  4OB3 B;  3CCR T;  4CH6 A;  4EMK B;  1GGM A;  3OYC A;  5K1X A;  4OB2 B;  2ZIO A;  5GMK i;  4JUV A;  3OYE A;  5GAN 8;  4NL3 A;  4LDV A;  1KQS S;  2PVD B;  4P3P A;  3I7F A;  3OSS C;  1B34 A;  4XU2 A;  4QQG A;  4YCU A;  2QEX A;  3GPL A;  1ASZ A;  3BDU A;  3PZC A;  4XTU A;  3CME A;  2QI2 A;  3P8H A;  4M77 B;  5GAM d;  1IL2 A;  3NTK A;  1YJW T;  2K2V A;  1JJC A;  3VQV A;  4KUI A;  4C8Q F;  4F7U A;  4N0A C;  2DXT A;  1VQO T;  5DM7 R;  3QO7 A;  4II1 A;  1QP3 A;  4QVD A;  2P0P A;  1NNH A;  2DTH A;  4RG2 A;  1K73 C;  1W66 A;  3L2V A;  4ELZ C;  2ZPI B;  2PVO B;  4GY5 A;  1G3S A;  4JRI A;  3HFZ B;  4Y91 A;  5LJ3 j;  1WJS A;  3RKY A;  1EIY A;  5LJ5 h;  1WU7 A;  2XDP A;  1AHJ B;  1G5H A;  4HWR A;  2JZ2 A;  3RIR A;  1Q81 U;  2ZNJ A;  5LJ5 f;  1XOV A;  4C8Q A;  3A7A A;  2I4O A;  1NJ6 A;  3HY0 A;  1EQR A;  3RKX A;  3HXW A;  2PU9 B;  4DOW A;  1J5W A;  3LW5 E;  1H3Z A;  2DO3 A;  3JB9 G;  4PG3 A;  3JCM g;  3SB2 A;  1D3B B;  2DZC A;  2PUK B;  1KD1 U;  3TEG A;  2EJG A;  1BIB A;  4OF1 A;  3OA6 A;  3PMT A;  2DQ3 A;  1NPR A;  2QEX T;  3TEH A;  2VUB A;  1G5V A;  4TTV A;  4RQF A;  4XAX B;  4M7A A;  4N4G A;  4RCC A;  4E7I A;  2C06 A;  4B9X A;  3OY9 A;  3OW2 S;  5DLO A;  5A2Q E;  3OS5 A;  1SRY A;  2ZPF B;  3OYN A;  4E7K A;  1I8F A;  4MML A;  3PGG A;  2CIM A;  3KFU A;  4Z02 A;  3G4S A;  1YCY A;  2ZPB B;  4MMK A;  2E5Q A;  1VQ6 A;  4LVJ A;  2YRV A;  3LYI A;  3CXC S;  5GAM j;  3OYD A;  4BI3 A;  3QZ5 B;  3RMQ A;  3MP6 A;  4TVR A;  2RHI A;  1PSF A;  2DD5 A;  1X75 C;  3I55 A;  3BDL A;  5E3I A;  4VUB A;  2G3R A;  3SFM A;  3C94 A;  2J3L A;  2Q7H A;  3CPW S;  4YRM A;  5ELN A;  3CCL A;  3JCM J;  3NEM A;  1VQK A;  4K88 A;  4ZTJ A;  2VXF A;  2JTM A;  1I81 A;  2GCX A;  1Q86 C;  4A53 A;  1E1O A;  5D6X A;  2VGN A;  1ZBX A;  3INZ A;  2MF2 A;  2HQX A;  3CD6 A;  5HKC A;  1BBU A;  1M90 U;  4E51 A;  3CC2 A;  5CIU A;  4QVZ A;  2X4J A;  1VUB A;  5GAO r;  4M7A F;  3PCO B;  4ZN3 A;  2CJ9 A;  4YTL A;  2J3M A;  4O2D A;  3RF1 A;  1Z7N A;  4FSX A;  3HP9 A;  1ADY A;  2HQE A;  3OYK A;  4YCV A;  1YHQ T;  3A7R A;  4HA8 A;  1NPP A;  3CMQ A;  5DLQ E;  3A5Z A;  2DIQ A;  3CCU A;  4M78 F;  1U1T A;  3GNG A;  3G71 T;  4UP7 A;  1Q7Y C;  2K5I A;  2KAF A;  3JRZ A;  3M5A A;  3OBY A;  3NEL A;  4YRN A;  5J3B A;  4WI1 A;  1P92 A;  4XEO A;  5LJ5 d;  5D6W A;  4JRP A;  3LH0 A;  2EAY A;  4Y28 E;  1BBW A;  5GAN 2;  5GAM h;  4OGE A;  1Q82 U;  5GAN g;  1Q7Y U;  5FU6 C;  4A54 A;  1VQK T;  4OVA A;  1X55 A;  1UGS B;  5LJ3 e;  4CH5 A;  4PJO C;  2JVV A;  4M78 E;  5K1P A;  3IKL A;  4DOV A;  4M78 G;  1KQ1 A;  5I21 A;  3UPU A;  4TVA A;  5GAO n;  3DKM A;  1NJI U;  3WVE B;  3E9F A;  3PT9 A;  3MEY A;  1Y96 B;  2E10 A;  3JCM d;  3W3S A;  4OMF B;  5C52 B;  1YFR A;  2EQM A;  3V7S A;  3VQY A;  3JB9 J;  5LJ5 e;  4H2Y A;  1BKB A;  4HCZ A;  5J39 A;  2LVM A;  4Q15 A;  5AYF A;  4EMG A;  2RHS A;  4YRL A;  3MET A;  1VQ9 A;  4YDQ A;  2DQ0 A;  3QO8 A;  1G3T A;  1UGP B;  2R5M A;  4H2W A;  2ZCF B;  1YIJ T;  4BI4 A;  1VQ8 A;  2ARS A;  1X6O A;  5CKB A;  4YRK A;  2AHJ B;  2E3C A;  4LDX A;  4M77 D;  3KXT A;  2LNV A;  1IRE B;  4H2V A;  2ALY A;  4X34 A;  5I2S A;  1JJC B;  2IVW A;  3PCO A;  2RJC A;  1VQL A;  1N8R C;  2P4T A;  3HRK A;  3F70 A;  1E24 A;  1KQS A;  2JN0 A;  3SWN B;  4BI8 B;  3P8D A;  3CPF A;  5L8R E;  3JCM b;  2ZZE A;  1EIY B;  5LL6 S;  1LJO A;  2RM4 A;  3OYG A;  3TRE A;  4A4F A;  1EVL A;  2JUF A;  4M7D D;  3M4P A;  4K86 A;  2MWO A;  3H8Z A;  1GXI E;  4PLI A;  3OS1 A;  1YJ9 T;  2RI2 A;  5GAN e;  2AMC A;  2P0L A;  5KH6 A;  4C0F A;  1QE0 A;  1M9S A;  5C53 B;  2HAX A;  3VYH B;  5CKD A;  4EO4 A;  3UT1 A;  2EIF A;  2P0K A;  2BIV A;  5GMK e;  1ZQ1 A;  2I4L A;  2RHY A;  2RJE A;  1RI0 A;  4IUQ A;  1PYS A;  5LJ5 g;  4C92 A;  5GAN 6;  2DKG A;  4J83 A;  2K5F A;  4O6J A;  2DXC A;  1Y96 A;  1B7Y A;  4TQF A;  2EQJ A;  2R5A A;  4H2U A;  1WGS A;  4X9D A;  2A3L A;  1E1T A;  5CQY A;  3UFG A;  5KCH A;  5I2M A;  1YHQ A;  2JOY A;  4A4K A;  2F5K A;  4C8Q E;  3JCM h;  1ATI A;  12AS A;  3M53 A;  4HKE A;  3UDC A;  3Q1J A;  2JTF A;  2XHC A;  3HTZ A;  4BDZ A;  4PJO E;  5KNN A;  2E70 A;  4ZIB A;  3CMA A;  3HFN A;  3KUF A;  1EIF A;  4UP8 A;  2ALY B;  3A5Y A;  4RQE A;  4RCB A;  1UGQ B;  3FDR A;  3L2U A;  4FU6 A;  2DTO A;  4H2S A;  1M1K U;  3WVD B;  2XKO C;  3R07 A;  4TQD A;  3RES A;  1G51 A;  3BW1 A;  4G84 A;  3S3N A;  5CK9 A;  1QVF S;  4TVW A;  2QXF A;  3EAE A;  5GAO q;  5FU6 B;  3ZFJ A;  3CCE A;  4YRP A;  3PNW C;  4ZN1 A;  3UH0 A;  3OYL A;  3M4G A;  3RL6 A;  4M78 B;  4NS5 A;  2LTO A;  1KC8 C;  5C6S A;  2RI5 A;  3QZ9 B;  1JB0 E;  3QHS A;  4XU0 A;  3A8G B;  2E65 A;  3ASK A;  2QQB A;  5KE3 A;  2EWN A;  5GAN 3;  1YB3 A;  3OYF A;  3JCM V;  4KQE A;  3M59 A;  4M75 B;  1Z7M A;  1S72 A;  3VQX A;  3CD6 T;  3OSV A;  3OQ5 A;  2QHT A;  2DVE A;  1MHN A;  3MP1 A;  1G3Y A;  3OYH A;  4P75 A;  3CC2 T;  1FXX A;  1KMN A;  3C12 A;  4M7D B;  4M7A B;  4OGC A;  3QPH A;  4C5G A;  4XK8 E;  4HVC A;  2CS7 A;  1WJR A;  2G4C A;  4JRQ A;  2ARU A;  4J7F A;  1WYD A;  4YCW A;  4BAC A;  3PMI A;  1B7Y B;  4J15 A;  1FYF A;  2FVU A;  3X25 B;  5IT9 E;  4CS4 A;  4IUP A;  4EDU A;  3PTA A;  4KR3 A;  3A74 A;  3V7C A;  3ZBD A;  1KQ2 A;  1B34 B;  1Q81 C;  3GLX A;  1USY C;  2QTX A;  4C92 B;  2YLC A;  4XQ3 A;  3ER0 A;  4PLL A;  1YI2 T;  3G6E A;  4HT8 A;  4C5E A;  4YRC A;  2L89 A;  1HTT A;  4YP0 A;  3JCM W;  2ZGW A;  2MI6 A;  4EPC A;  4RDX A;  2CZ6 B;  1G5I A;  3DLL A;  2O4X B;  2GQV A;  5KE2 A;  2KMT A;  3IG2 A;  3NTI A;  2ZPE B;  2OTL T;  2ZNI A;  1QP2 A;  3VV0 A;  3CCU T;  1U8R A;  5CO7 A;  1SET A;  1SES A;  3BFM A;  2O01 E;  1N9R A;  4WF2 A;  1U1S A;  2DXU A;  1OZ3 A;  3WXM B;  2E5A A;  4QQD A;  4PL6 A;  4XTZ A;  4UC4 A;  4ZGE B;  3RUX A;  4EMK C;  2E6Z A;  3OB9 A;  3M4Q A;  3OMC A;  4P3O A;  4DQ2 A;  3CEY A;  1K9M C;  2V8J A;  1JBM A;  3NET A;  5M9O A;  2QQR A;  3CC4 T;  3G4S T;  2I2L A;  4D6W A;  5GAM g;  3JCM X;  2RD1 A;  2RHQ B;  4FM4 B;  2Y4X A;  3G7Z A;  4C8Q G;  3M58 A;  2RO0 A;  2RK2 A;  1Y07 A;  1NE8 A;  2XU8 A;  4AH6 A;  1FX7 A;  4XTY A;  3JCM P;  4KBM B;  2RH2 A;  1VQL T;  3P8T A;  2E1H A;  3CMA T;  5DY9 A;  4M75 G;  1VIE A;  1NJ5 A;  3OYI A;  3P8B B;  3KBG A;  4L6V 5;  2QDY B;  4C92 G;  1PYS B;  3HPW A;  4M77 C;  1TH7 A;  2EKO A;  1EOV A;  4O5V A;  1B70 B;  3JB9 I;  2C8M A;  4IUR A;  2L5Q A;  3CCE T;  3MEA A;  1KHI A;  3OMG A;  4DPG A;  2DTI A;  4IUT A;  3GF5 A;  2WSE E;  3L4G A;  3ERR A;  4L5G A;  4RMO A;  2ZT7 A;  4P73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...