3RUXA

Crystal structure of biotin-protein ligase bira from mycobacterium tuberculosis in complex with an acylsulfamide bisubstrate inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
b'TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Bisubstrate Adenylation Inhibitors of Biotin Protein Ligase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 96
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ruxA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ruxA01
4ZTUB 4XTVA 5LJ5h 2DTIA 3EFSA 1SRYA 3ICAA 4CS3A 2C8MA 2CIMA 1B7YA 4F7UB 2DKGA 1YGBA 3UH0A 3BJUA 2I4NA 2C7IA 4YCVA 2QHVA 4TVWA 5LJ3h 2EAYA 3PZCA 3RERA 1NNHA 3NENA 3JCMb 2DZ9A 1SESA 4H2YA 2ZZEA 5C51B 2ZT7A 2P5IA 4V2SA 2ODRC 1Y96A 3A7RA 3JCMc 4H02A 1LYLA 1WLEA 4ZIBA 1HC7A 3IG2A 3JCMh 1L0WA 2ZIOA 5GAN4 1E1OA 2ZNIA 2DJZA 2AKWA 5ELOA 4G85A 5GANd 2CGHA 4M77C 5GANf 4HT8A 1KMNA 4YDQA 3SWNC 2RHQB 3OD1A 4HWPA 2RM4A 4P71A 3RF1A 1WPYA 5HGQA 1SETA 2ZGWA 2ZT8A 4H2WA 4H2SA 4XQ3A 4XEMA 4F7UA 3IALA 2PMEA 1X01A 3JB9I 5LJ3f 1G51A 1D3BB 4H2UA 3NETA 1ASYA 3A5YA 1YFTA 5C52B 1C0AA 4E51A 3VQYA 4PJOG 3A5ZA 2QHSA 2FYKA 3JCMe 4M7AC 4BWAA 4YRRA 4JRKA 2ZNJA 1H4VB 3MEYA 2DTHA 3M4GA 2RHSA 1LJOA 1NYQA 4EMHA 1HTTA 1LOJA 2E5AA 5K1XA 3QO8A 3P8YA 3MF1A 4YRNA 4YRJA 4PJOF 1X56A 3PGGA 4N0AC 1YFSA 4JUVA 4M78G 2JN0A 4XTXA 3MF2A 2I4MA 2Q7EA 4C92C 4O2DA 3HRIA 1B7YB 3RIRA 4C8QA 3L2ZA 3AHUA 3A31A 3E9HA 3VQVA 1USYA 2ZR3A 2ZIMA 3QHSA 5GAOp 5KNNA 3RGLA 2RA2A 3RL6A 4YRGA 1B34B 4M78F 4P3OA 1N9SA 1E22A 1EVKA 3HRKA 4NOYA 1Z7NA 4F7UG 3V8KA 3RKWA 4EMKC 4YP0A 2IY5A 4UP7A 2ZT5A 1Y96B 4J6XA 4M7DC 4OLFA 4K87A 4TQFA 1U1SA 4Q6GA 3SB2A 4A54A 2CJBA 5GMKj 1SERA 4LNSA 3JCMJ 1X2GA 2DQ3A 4F7UF 5GAMg 1X55A 4F7UE 1TH7A 2AKWB 3UGTA 3IKMB 2VXFA 4P74C 3VQXA 4Q15A 4L87A 4TQDA 3HFZB 4X5OA 1KQ2A 5GAN8 3FB9A 5GANh 2Q5HA 3QTCA 1KQ1A 3REUA 5LJ5j 4CH6A 4RDXA 1NJ2A 4YRLA 5GAOr 2EJ9A 4HWTA 5GMKe 2ZTGA 1B34A 4M77A 4TWAA 3VU3C 3SWNA 4HWRA 2DTOA 3REXA 1NJ8A 3PCOB 4A53A 4P72C 4K88A 4BW9A 5LJ3j 1IL2A 1HXDA 4P3NA 1M8VA 4CH3A 4CH4A 3TEHA 3QO3A 4C8QE 3JCMX 2RHSB 5ELNA 5GAMh 1YCYA 4MMLA 3M4QA 4OP0A 1N9WA 3TUPA 4EMGA 3KFUA 3EFRA 4X9CA 4C8QD 5I21A 3V7SA 4M75B 1G5IA 5LJ5e 1H641 3HY0A 2Q7GA 4M7AA 5GANe 3HXYA 4C8QB 3BY7A 3HFZA 2ARTA 2P0LA 1YB3A 1H4QA 4YRFA 3M4PA 3E9IA 3JCMQ 4TVAA 4CS4A 2DU7A 1WQ7A 5LJ3e 4N0AA 3V7CA 2E1HA 2ZR2A 1EIYA 4C92A 2IY5B 3A74A 4MMKA 2E3CA 1NJ6A 1JBMA 1GGMA 1NJ5A 3HSBA 1J5WA 1EQRA 3QO7A 3PCOA 4PJOC 4P73C 4H2XA 3V8JA 5GAMd 2EL9A 1QF6A 4HT9A 3A7AA 5GAMf 2ODRD 4DQ2A 2J3MA 2ALYA 2CJ9A 4EO4A 3BDUA 1NJ1A 4EMKA 4RMFA 4M7DA 4NL3A 1I5LA 2ZXFA 4M77E 4KQEA 1I8FA 4M78C 4M75A 4RCCA 4YRIA 5K1PA 2DDZA 3RESA 4NL2A 5GMKi 2ARUA 2ZT6A 1ADYA 5GMKm 4YRMA 3P8TA 4M77D 1BIBA 2ZZFA 5F5WA 3BW1A 1B8AA 4K86A 4P74A 4M77B 2ZCEA 3SWNB 1VQZA 2VC8A 3L4GA 2AMCA 3HY1A 4KR3A 3INZA 2EJFA 2I2LA 4M7AE 3HTZA 3TEHB 1KOGA 3VBBA 4UP8A 4M7AD 4YRQA 2E64A 2PMFA 3HXUA 1X54A 4P75C 4XU2A 3NELA 5GAOq 2E65A 4J15A 4P72A 4M7AB 3RKYA 4C92E 4RCBA 4P3PA 2E41A 3UGQA 4YRKA 4J6YA 4HWOA 5GMKl 3HXXA 1MGQA 1B70A 4M75G 4C92D 4TVAB 4YPFA 4RQFA 2QHUA 4XU1A 2ZZGA 4PNOA 1BBUA 4EX5A 4YCUA 5GANj 4C8QG 4HWSA 1ASZA 1FYFA 1EIYB 4C92B 1USYC 3HXZA 2ARSA 2DU5A 2J3LA 5GAN7 4M7DF 12ASA 1EFWA 4M75F 4M7DE 1WNLA 2YHTA 4H2XB 4M75E 3W3SA 4C8QF 4M7DD 3GIBA 2ALYB 2HNIA 1WYDA 4M75D 5CAIA 3V8LA 3A7UA 4EMKB 2I4OA 2I4LA 4XU0A 11ASA 5GAN2 4Y91A 4M7DB 3QO5A 5GAMj 1PYSA 1E1TA 4WI1A 4P73A 4PJOA 1NYRA 3LSQA 4RQEA 2XTIA 1U1TA 1I4K1 4H2TA 3TEGA 1JRIA 2YLCA 3DSQA 3HXWA 4YYEA 5GAOm 1JJCB 4QVCA 3JCMP 4AH6A 1N9RA 2EWNA 5GAN5 3JB9H 2AMCB 3L4GB 1YFRA 2EJGA 4M78A 3HFNA 1Z7MA 4TVYA 2Y90A 3RACA 4WF2A 3RUXA 5LJ5d 1EVLA 2DXUA 2DZCA 1ADJA 3P8VA 3I7FA 5E3IA 3QSUA 5LJ5f 4YRTA 2ZINA 4M77G 4DPGA 4XTUA 5GAMe 3HFOA 4PG3A 2K57A 3JCMW 2RD1A 3JB9G 4CS2A 1B76A 3UFGA 4ZTZB 2CJAA 3QUIA 4YRSA 3FJPA 2DQ0A 4HVCA 5LJ3d 4UPAA 2DVEA 4M77F 2Q7HA 4YROA 4QVDA 1KMMA 4XU3A 3VQWA 3JB9F 5C53B 1B70B 1E24A 5GAOl 4M7AG 3JCMd 3JB9J 3L1AA 4P75A 3JCMf 3ERRA 4YRPA 4WJ4A 1JJCA 4P71C 3JB9D 3WQZA 4XTYA 4PHCA 4TTVA 2E10A 1WU7A 1QE0A 1BIAA 3HXVA 3R07A 4JLIA 4KR2A 3IKLA 4XEOA 4H2VA 4HA8A 2FB7A 4M7AF 1I81A 1W66A 4PJOE 3RKXA 4J6WA 4C92G 3NEMA 2QHTA 2YLBA 3FIFA 5GAN6 3CMQA 5LJ5g 4CH5A 2RHQA 4PJOD 5GAOn 5GANg 4YRCA 1M5Q1 3A32A 5GAN3 1ATIA 1RIQA 2XGTA 1PYSB 1LNXA 1G5HA 4PJOB 3BFMA 4C92F 4M78E 3V7RA 1H4TA 1D3BA 3QNEA 4YCWA 2DEQA 5GMKh 5LJ3g 3LC0A 1BBWA 2Q5IA 1H4SA 4M7DG 4M78D 3HFVA 4UP9A 4G84A 3JCMV 4XTWA 1X2HA 4M75C 3LSSA 2QTXA 2DXTA 4YREA 5DY9A 1EOVA 1WQWA 4XTZA 4C8QC 4M78B 1HK9A 4WJ3M 4NCXA 2VXEA 3JCMg 3G1ZA 2RB6A 4JRIA 4J5YA 2G4CA 4X9DA
chains in the Genus database with same CATH superfamily
4XTVA 1SRYA 1P92A 4JRPA 1X43A 2RMOA 4OMPA 4J83A 1B7YA 4HVWA 5FW9A 1Q7YR 4D8KA 4KGZB 2JS0A 1VOMA 4YCVA 2I0NA 2QHVA 1WA7A 5CKDA 2LZ6B 1OOTA 5LJ3h 3RERA 1NNHA 1SESA 1UHCA 4H2YA 4FL6A 3CCQT 1KJWA 2LJ1A 2ZT7A 3OY9A 4BI4A 2A3LA 3L2UA 2QQBA 4LNPA 3H0HA 4ZNXA 3D7SB 3EH1A 2P0KA 1KD1C 2VVKA 4E2FB 5IN1A 1PSEA 3LYIA 1IHVA 5D6XA 3OYCA 1WX6A 1M90C 2D9TA 3MEWA 4DBRA 2ZNIA 5FU7B 2FL7A 2B86A 1YITQ 1QKWA 3UPUA 3EH2A 1G8XA 5GANd 3JRZA 2ED1A 5GANf 2EGEA 5KYYA 1K9MR 1WPYA 1UDLA 2JS2A 3EG9B 1BI2A 2AKLA 2ZT8A 2RPNA 4H2WA 4H2SA 4XEMA 3OA6A 2F1LA 3FDRA 3MEVA 3CQTA 8AT1B 1RLPC 2FZGB 1FMWA 3E2UA 1Q86C 4H2UA 2G3RA 2LT4A 3LW5E 4AG1C 3E19A 2G6FX 5KYUB 1Q82C 1RUWA 5C52B 3CCRQ 4E51A 2Y4XA 3OYLA 4DEYA 2FYKA 4M7AC 1QVGP 5FWCA 1BCOA 1WJQA 1H4VB 2DTHA 1SHFA 2PQWA 1I5OB 1X6OA 3E1SA 2CUDA 2YSQA 2E5AA 3P8YA 3A8LB 2OTJT 1AVZC 1YFSA 4XTXA 3CC4A 3WVEB 2I4MA 4C92C 4IIMA 2JTEA 1YWOA 2E3IA 2OI3A 2L3PA 2J6FA 3L2ZA 3PMIA 3E9HA 4ZTFA 1USYA 2ZR3A 4J9BA 2RQUA 5GAOp 1D1CA 3GBQA 1JJ2A 3RGLA 1G3SA 4DBHA 4FW1A 1E22A 3I55A 3VS5A 2JTFA 1YJWT 4YP0A 4ZN1A 4UP7A 4J6XA 4Q5WA 1VQLT 4TQFA 1VQ7A 3SB2A 3A98A 1Q95G 2D6FA 4LNSA 5IH2A 2P4TA 3OYJA 3CMAQ 4F7UE 4BDZA 3OYFA 1PG5B 3UGTA 4TQDA 3HFZB 4KGVB 1KC8R 2Y4YA 4IUVA 5GANh 4GLMA 2FEIA 2Q5HA 1NM7A 1PRLC 2FPDA 1KQ1A 3REUA 3LLRA 1V29B 5LJ5j 1G83A 2EJ9A 1M1KU 2ZTGA 4AFZC 1QP3A 3C95A 1K8AR 3PCOB 4A53A 4K88A 1U06A 1IL2A 4P3NA 1MNDA 4CH4A 2K3YA 1SPKA 2VGMA 1VQ5Q 5ELNA 1X69A 2F2WA 1VQ6Q 4FYWB 2V26A 3DKMA 4L59A 3REAB 4C8QD 1D09B 3GNGA 5I21A 1CSKA 2HEQA 4N4HA 1NEBA 2W10A 5LJ5e 1H641 3HY0A 3QXEB 2YUOA 3N5BB 4C8QB 1K0SA 2FPFA 3BY7A 2QG9B 2RJCA 1NJIC 2P0LA 2LC4A 5IT9E 1M1GA 1BI3A 3QZ9B 1KD1R 3E9IA 3M4PA 1S1NA 1H92A 1YJNQ 3IQLA 2DU7A 1I1JA 3A8MB 2K3XA 3V7CA 1K4US 1VQ4T 5D6WA 4R56A 2IY5B 3A74A 1VYVA 2KMTA 1NYGA 2M16A 4MMKA 1VUBA 4C0DC 4RTTA 3THKA 1JBMA 3OS1A 1NJ5A 2DL8A 4DOVA 2GQIA 1JQQA 4PJOC 4H2XA 2KDSA 3V8JA 5GAMd 1XTDA 2EL9A 2DA9A 5GAMf 4RTZA 4D8DA 1VQOQ 1M9SA 2K2VA 3RR6A 2CJ9A 5HK3A 2XDPA 3NTHA 4EMKA 1MMGA 1TXQA 2ATCB 2VASA 3CBPA 1Q86R 1VQMQ 2PVGB 1I5LA 5D6YA 1MMNA 1I8FA 4PJJA 2DJQA 1EFNA 1Q82R 4YRMA 5CVIA 1BIBA 2GGRA 3CCET 2C0TA 2QA4A 1B8AA 3VUZA 1ZSZC 3EGXA 3L4GA 1QLYA 4KR3A 3KBGA 3G6ET 2EJFA 1ZLMA 1RAHB 1Q7YU 3MJXA 4JJDA 1KOGA 2RK1A 2DO3A 4M7AD 4YRQA 5J26A 1QP2A 1KQSP 3SDZA 3HPWA 1X54A 3PVLA 2ZPIB 2V1QA 1VQNT 1RI9A 2RI3A 5GAOq 4E6RA 4M7AB 5AT1B 4E7ZA 2QXFA 1YHQA 5IXBA 3LH0A 3RMQA 1MGQA 4LDWA 4C92D 4RQFA 4XU1A 3GP8A 1BBUA 2DE0X 3OYEA 2ZZDA 4YCUA 4EX5A 1N27A 4GLKA 3EFOA 1EX4A 4IUPA 4J9HA 4AFUC 2LJ0A 1ASZA 3MKDA 4C92B 1QCNA 1USYC 2ARSA 2DU5A 2J3LA 4JJNK 1ZUUA 1K9MU 1YWPA 2YHTA 4M75E 2LQWA 2QEXT 3X24B 1VQPQ 3FLGA 3OBWA 1Z9QA 2ALYB 3A8GB 2E6NA 3DB4A 5J3BA 5CAIA 3OYIA 2K4YA 4XU0A 2F5KA 2NS6A 2X35A 1UJYA 2DXCA 3QO5A 3TEEA 2XDBA 1HYOA 4P73A 3L42A 2FO0A 3VRZA 1N6AA 4RTUA 2DYBA 2PUOB 1ZSGA 2FG0A 3NHNA 4EPCA 1RLQC 2LCSA 4QVCA 1OPLA 2EWNA 5GAN5 1YITA 2E3HA 1VYUA 3HFNA 2HQXA 2XG8D 2Y90A 1W2BP 2DXUA 2RQVA 2JZ2A 3M59A 4KUDK 3O8VA 2EQUA 2A8EA 3X26B 4XTUA 3VYHB 1NJIR 3HFOA 3I56T 5FWBA 5LL6S 1IRXA 2V8KA 2RK2A 5C0MA 1B76A 4ZTZB 2CJAA 3C0CA 1RI0A 2LDMA 4HVCA 1GCQA 3VS0A 4JRQA 1AEYA 4RUGA 3CCRA 2X4YA 4BD3A 2V8JA 3QZ5B 2CYZB 1BK2A 1B70B 5KYXB 1AZGB 5AYFA 3JCMd 1W70A 1BB9A 2YDLA 3L1AA 1PKSA 3JCMf 3CCVT 4P71C 4OMFB 4XTYA 3HXVA 1QE0A 3ULRB 3R07A 2V8IA 2NUPA 3VS1A 1JJ2P 1QVPA 1W66A 1BBZA 1WZOA 1PD1A 2GTOA 2OTLT 4DBFA 2ZAEA 4KT0E 3EHRA 2DL4A 3HHTB 4CH5A 2RHQA 4PJOD 4LDUA 1WHKA 1N8RU 4C0DB 2EPDA 5CKFA 2VGNA 4PJOB 4M78E 2AZSA 2KYMA 2LTOA 3GNFB 4C0GA 1D3BA 3CXCA 1WHJA 5GMKh 3E9GA 3EHQA 5J39A 4C5HA 4G84A 4X34A 2O4XA 1YNZA 3H9NA 3CD6T 2E5KA 3WVDB 3BDLA 1WYXA 2QTXA 3CMAA 4YREA 1EOVA 4A4KA 1HK9A 1PD0A 1K76A 2VXEA 5CKBA 3JCMg 5IXFA 2XD0A 1OV3A 2DD4A 2FZKB 4J5YA 4ZTUB 1QW1A 2PUKB 1G5VA 2K2MA 4ME7A 3ICAA 1ZQ1A 2LP5A 2C8MA 1ZSZB 1M90U 1VQ8T 3M0PA 5DM7R 3UH0A 2EBPA 2ZPHB 1RAGB 1BU1A 2P0QA 3CCUQ 4PJMA 2DZ9A 4XK8E 1VQ5A 2ZZEA 4BE1A 3CCMT 1U5SA 1K9AA 2HSPA 2P5IA 1VQ6A 3JCMc 4WTOB 4CC4B 4ZIBA 1NZ9A 2E6ZA 4E7KA 3IG2A 3JCMh 3QG1A 1Q86U 2ZIOA 3RBBB 5C6SA 4BE2A 2RQTA 1Q82U 1E1OA 2AKWA 4G85A 3OSSC 1M1KR 4FSXA 4M77C 4E47A 4HT8A 4YDQA 2A08A 2O88A 3RF1A 1YJNA 3VYGA 3OQ5A 2ZGWA 1BCMA 2DD5A 2XDDA 4F7UA 5M9OA 2PMEA 2DXBA 2M51A 5I11A 1RABB 2DMOA 3M5AA 3NTIA 5LJ3f 3S6WA 4ZGJB 1C6VX 1WJSA 5KYNA 3EG1A 2A36A 2RHXA 2DBKA 1UB4A 3A5ZA 2QHSA 1VQOA 3C12A 2JXBA 5FLXE 2L3QA 1VQMA 4EMHA 4KRTA 1VQ9Q 1HTTA 5K1XA 3OYAA 4YRNA 4YRJA 3OMGA 1X56A 3PGGA 4F16A 4N0AC 4JUVA 4M78G 2K9GA 3MF2A 2Q7EA 1YJWQ 2SRCA 1TWBA 5D7UA 2P4RA 2KRSA 3A31A 3VQVA 4KUIA 3S3OA 1MV0B 2ZCFB 2ZIMA 3QHSA 2DLPA 2L3RA 3QYGB 1IB8A 4M78F 1TUCA 2JM9A 2X9HA 3HRSA 4FIBA 2KXCA 1NYFA 2RHZA 1VIEA 2LX7A 2AZVA 3Q1JA 1S72Q 3MP1A 2DRKA 1Y96B 4M7DC 3CC4T 1U1SA 2F2XA 4A54A 2XI9A 3CCJQ 4LXCA 2CJBA 3TREA 4C5EA 1GCPA 2RHIA 2HBWA 1BI0A 3OYYA 1N8RC 2QGGA 1GBRA 4AT1B 2EW3A 4P74C 4OB2B 3I55T 3F70A 2JT4A 1UECA 4X5OA 5CO7A 3FB9A 1UTIA 3MEAA 1VQ7T 1ZHIA 2JMAA 4YRLA 5GAOr 3OYNA 2SEMA 3OS2A 1B34A 3SWNA 5A0DA 4R55A 1VQPA 4ZN3A 3ME9A 1NJIU 2DTOA 3LGLA 2QQ9A 4P72C 4J9GA 1M8VA 4CH3A 5FROA 1T3LA 3CCLQ 3TEHA 4C8QE 1NPRA 2RHSB 2A37A 1KK7A 1RACB 3M4QA 2HD0A 1GFDA 1N9WA 3AT1B 2M0YA 3TUPA 3EFRA 4X9CA 1QVFP 4A4HA 4VUBA 2EYWA 2AIRB 5GANe 4EDUA 1MHNA 4PLIA 2RH2A 5GJVB 2ARTA 3L2WA 3MP6A 1YB3A 2YUPA 1H4QA 3T9NA 3JCMQ 4TVAA 3S3NA 4D6WA 2QDYB 2R58A 1OYXA 5EG2A 3CC2A 1EIYA 5A0LA 1MV3A 3PTAA 4F17A 1OI1A 2PU9B 3VS3A 4LVIA 1FMKA 2K6DA 5DLOA 2BZYA 1J5WA 1EQRA 2QYZA 1X2KA 3VV0A 2WSFE 1JXMA 1QF6A 1ZBJA 4OMOA 3A7AA 1FWZA 2FVUA 1UG1A 1ZBXA 2J3MA 1YIJQ 4EO4A 1WHHA 2JTMA 3BDUA 1NJ1A 1ZA1B 4MZMA 4KH1B 4NL3A 2IG0A 5CK9A 3R6OA 2ZXFA 4M75A 4QT7A 3CC7Q 1IO6A 2DDZA 4Z88A 3RESA 5GMKi 2ZT6A 2BE7D 2WSEE 2KYBA 2PVOB 4M77D 1WXBA 2EQJA 2OAWA 3P8BB 1U8RA 2ZZFA 2F69A 3BW1A 2P0PA 3M0TA 2E12A 2KQWA 1OU9A 4M77B 1PKTA 2VC8A 2AMCA 3RDVA 2DERA 2CP2A 4JZ4A 1C1AA 2RF0A 2LQ8A 3ER0A 2ABLA 3C4SA 2ESWA 4M7AE 3HTZA 2E70A 3VRYA 3VBBA 2CT3A 3S3MA 5CKHA 5KH6A 1BI1A 2QA4T 1GXIE 3LWIA 1WIEA 1XOVA 3GF5A 4C0FA 2HQHA 4C92E 2CREA 1ABQA 4BDYA 1VQKA 5GMKl 5KCHA 4ORZA 2DIQA 2ZZGA 1M2VA 2D8HA 4C8QG 3MHXA 2DVJA 4HWSA 1FYFA 2YXYA 2JNGA 3HXZA 4OMNA 1N8RR 2R57A 4M7DF 2XMFA 4QVZA 12ASA 1H3ZA 1EFWA 1YP5A 4ATOA 2ZPFB 4ESRA 1YHQT 2DIGA 4C8QF 2CZ0B 4M7DD 2KNBB 3QJYA 2CP7A 3V8LA 3FRNA 2K3BA 4GBQA 2KT8A 1G2BA 5KYWA 2I4LA 3CCUA 5L8RE 4PKCC 4MZPA 1B07A 4M7DB 3CBMA 3KXTA 2OAUA 5GAMj 1PYSA 1SG5A 1NYRA 4RQEA 2ZPGB 3HRUA 2EFIA 2XTIA 1JRIA 2YLCA 3HXWA 4O5VA 4FYVB 3I56Q 4BUGA 4M4ZA 1VYTA 4OVAA 2DF6A 2NUPB 3L2RA 3OW2S 1M90R 4M78A 1Z7MA 2MAMA 3PFSA 1MNEA 4TVYA 1WHMA 5LJ5d 3CPFA 2DZCA 3P8VA 5E3IA 3QSUA 5LJ5f 2XK0A 3UDCA 2XICA 5HK0A 5GAMe 1UEBA 2DETA 4P5NA 2HDAA 2VYTA 4RTVA 3UFGA 1M2OA 3CCVQ 1TS9A 3QUIA 4OF1A 4YRSA 1B7TA 3FJPA 1Y07A 4PK4A 4UPAA 1SF9A 2GBQA 1YITT 4JS4A 1YN8A 2V1RA 1K73C 2VKNA 1OU8A 2PNIA 4XU3A 2BE9B 5C53B 3CMEA 1M3AA 2IIMA 2O01E 3DB3A 4M7AG 3TVTA 3OYMA 4P75A 4LVJA 1VQ9A 2MOXA 2DRMA 4J9IA 4E7IA 3H0IA 3WQZA 2J05A 4PHCA 2E10A 2KVQG 5I2MA 1YJWA 4H2VA 5EC7A 2L5QA 2O31A 3M55A 4M7AF 1RADB 1YFNA 3CCSQ 1I81A 1SRMA 3CCRT 4PJOE 3RKXA 4C92G 1AZEA 1PCXA 5LJ5g 3SFMA 2XHCA 1KIKA 1GFCA 1M5Q1 3EG9A 3A32A 1RIQA 4LUEA 2GNCA 3TU4K 1S72A 2EYXA 4FSSA 4C92F 2EYQA 2PTKA 3QBYA 3CCJA 1I0CA 2JMCA 3SD4A 4YCWA 1QKXA 3LC0A 2IPOB 1BBWA 1H4SA 1EIFA 5KYUA 3MO8A 3JCMV 1XNIA 4M75C 4J9FA 3QWYA 5DY9A 2NUZA 3DLLA 4LN2A 2RI5A 1W1FA 3NMZC 1XJWB 3GLXA 3G1ZA 4LD6A 2X4JA 2G4CA 2ED0A 5LJ5h 3EFSA 3PE0A 4RG8A 4F7UB 2YRDA 3CPWS 1YGBA 5IHIA 2LNHB 3CMAT 2H8HA 1D1AA 4E7LA 1O75A 4Z8AA 2C7IA 1JO8A 4OB3B 4IURA 3QYHB 1JU5C 1QQJA 2HBPA 4A63B 3EGDB 1DJ7B 2XU8A 3JCMb 1PC0A 4JLGA 5A0GA 3CCLA 5CQXA 1OX9A 2ECZA 1LYLA 4AFSC 3M53A 2HCKA 1XQHA 2RN8A 3JV3A 1L0WA 3OMCA 2MWOA 3QWXX 4GY5A 3A8HB 4KH0B 1SHGA 2KAFA 2DJZA 4JPBW 2BKDN 2J7IA 4LVLA 4NS5A 4HCZA 2CGHA 3KFVA 3OD1A 4HWPA 1PWTA 1FMVA 2YUQA 1VQ5T 4BY6C 1SETA 2O2OA 5HCKA 4QQDA 2LX9A 2R5MA 1VQ6T 3MPUB 3UWNA 3IALA 5FRMA 2NUTB 2X4WA 3JB9I 3TSWA 1G51A 2DL7A 2LVMA 1ABOA 3OSVA 3NETA 1ASYA 1SRLA 3VQYA 2LMJA 4PJOG 1YIJA 3JCMe 3TSZA 1FXXA 4YRRA 1YJNT 2ZNJA 3MEYA 2MMPA 1NYQA 1UGQB 1UGSB 4FM4B 3G71Q 3CC7A 1WDXA 3QO8A 1IGQA 4PJOF 3G4ST 1K73R 1IXDA 2EIFA 3CEYA 1QVGS 1B7YB 3RIRA 1QWFA 2QDLA 4C8QA 2CUBA 3AHUA 1VQOT 3X20B 2RI2A 2MIOA 1WXUA 2DM1A 2RA2A 3RL6A 1B34B 4P3OA 1N9SA 3TQ7P 1PM3A 1VQMT 3HRKA 3HRTA 3RKWA 4EMKC 2IY5A 2A28A 3OS0A 1YI2Q 1YJ9Q 3M9QA 4K87A 4Q6GA 2CP0A 3I5RA 3ZBDA 1SERA 3JAME 2DQ3A 4HVUA 3OB9A 1R0BG 1X55A 1HSQA 9ATCB 3J7AF 4OMQA 2YT6A 1NG2A 3ZL7C 3H41A 3IKMB 2VXFA 2KXDA 1TSFA 5KYYB 1KQ2A 5GAN8 3CCQQ 3NGPA 1QCOA 3QTCA 3H0FA 1C0MA 3OYDA 1G3TA 4B9WA 2QQRA 1AHJB 4RDXA 3QJ6A 2WACA 3MQZA 4HWTA 2MCNA 1ARKA 4TWAA 3VU3C 4FW2A 4J8OA 2EYYA 1NJ8A 5ECAA 1Y7XA 2CKKA 1SSHA 4J9DA 1Y71A 4RKUE 4RTWA 5LJ3j 2D0QB 1HXDA 2KBTA 1Y57A 2CDTA 1RL2A 1NLOC 3I35A 3J80E 1FYNA 4KULA 4MMLA 1UFFA 3OYGA 4OP0A 3KFUA 2KRNA 2JUFA 2X51A 1UE9A 3V7SA 4M75B 4ZGEB 1E6HA 4M7AA 2Q7GA 4LVKA 2C0OA 1V1CA 1VQPT 3HXYA 2H3EB 2XKOC 2A7YA 1V76A 2J6OA 4N4GA 4YRFA 4CS4A 1WQ7A 3PIOA 5LJ3e 3ZEHA 2QTVA 4A4FA 2X4XA 2K79A 4C92A 2EVRA 1YBYA 5I22A 1ZA2B 1WLPB 1NJ6A 2OTJQ 1GGMA 3HSBA 4P73C 2RQWA 2KEAA 1GL5A 4DBQA 2GCXA 2ALYA 2B8AA 3OYBA 1CKAA 2M9UA 4LD9K 4OB1B 3CC2T 4M77E 4AG2C 4HCKA 4RCCA 4LDVA 2JJ9A 4NL2A 2L8DA 5GMKm 1VQLQ 1X75C 5GJWB 3PT9A 3UT1A 4Y28E 1W4SA 1GRIA 3CCSA 1ZX6A 1VQZA 4OMMA 5A2QE 2FRYA 3INZA 4BY6B 5HKCA 1GCQC 3U23A 3WXMB 4J7FA 1BYMA 1VA7A 1EZZB 1TOVA 1UJ0A 3GPLA 4XU2A 1U3OA 3L2QA 1MUZA 2ROLA 2D8JA 4RCBA 4P3PA 2E41A 3UGQA 4YRKA 2VB6A 4J6YA 1R77A 1WI7A 4HWOA 1KC8C 2HL5C 3HXXA 1B70A 5KYXA 2QHUA 1KQSS 4PNOA 1OPKA 5GANj 1IGUA 4HVVA 4RTXA 1KFZA 1RAFB 2P84A 1K8AC 4M7DE 1WNLA 4H2XB 2DBMA 1T0JA 4FU6A 2X3XD 1VQKT 2MWPA 2MK5A 3HTRA 2HNIA 3EG0A 1MMDA 2J6KA 2K5IA 3A7UA 2VUBA 4EMKB 5IAYA 2I4OA 4JZ3A 3REBB 3DLMA 2C0IA 3QIIA 1RAEB 1E1TA 1JEGA 4MDWA 4WI1A 1X27A 1OEBA 1VQ4Q 4PJOA 1N5ZA 3QDFA 1U1TA 2EKHA 1I4K1 3TEGA 4FT2A 3DSQA 4YYEA 2O9SA 3JCMP 2KR3A 4RMOA 1N9RA 1K73U 3EGXB 3L4GB 5DLQE 3UA6A 1E7OA 4LE9A 2EJGA 1YFRA 2YRVA 1NBEB 2KI7A 3CCUT 2KK4A 4HCCA 2EKOA 1EVLA 4FYXB 1ADJA 3O5ZA 2XIDA 2HKQB 2ZINA 4M77G 4DPGA 2JW4A 3EAEA 4PG3A 1G3WA 4N4IA 4DEXA 3JCMW 2RD1A 2LT1A 1ZSZA 3CCEQ 2LCCA 1K0XA 1Q81U 3MP8A 1W2BA 2DQ0A 1W2BS 3CBOA 2DVEA 2VWFA 4M77F 2Q7HA 4QVDA 2CZ7B 4MZTA 2GFAA 3G6EQ 3I5SA 2AKKA 5GAOl 3JB9J 1M3CA 1UGPB 3EFOB 4HXJA 4WJ4A 2BZ8A 3G71A 1JJCA 2DNUA 2CZ1B 1WU7A 1BIAA 1M1FA 4IUQA 4Y92A 2NWMA 4JLIA 4KR2A 1VQNQ 4HA8A 2FB7A 1B3QA 1D0ZA 1HD3A 1Y0MA 2CT4A 5FRNA 2YLBA 3FIFA 3CXCP 3CMET 3CMQA 3SHWA 5GANg 1D1BA 4A4EA 2PZ1A 4YRCA 2EGCA 4BACA 5GAN3 1VQ9T 2XGTA 4WCIA 1LNXA 1JJ2S 1M3BA 3BFMA 3PVQA 1YI2A 1YJ9A 3V7RA 1IZ6A 2COWA 3QNEA 3EG2A 2DEQA 1WHLA 2Q5IA 4M7DG 1AWXA 4XTWA 2QEXQ 1X2HA 2R5AA 3FEOA 1LPLA 3QKJA 2DXTA 3VS7A 1WQWA 4UC4A 1HJDA 4DA4A 1BKBA 4WJ3M 4NCXA 4A4GA 4J9EA 2FPEA 2EQKA 3G7ZA 2RB6A 2D0NA 3CCQA 1S72T 4J9CA 4JRIA 2HAXA 4X9DA 4HKEA 2CH4A 4E7HA 3CCJT 2GQVA 2KT1A 2DTIA 4CS3A 2CIMA 3M0QA 3VKIA 2DKGA 1IHWA 4CRIA 1TU0B 3OYHA 1KG1A 1YCSB 2KE9A 1TG0A 4CC3A 2QASA 3VS4A 3BJUA 2YWWA 2I4NA 3H8ZA 3M0RA 4ANJA 2EGAA 3A1PA 4TVWA 2EQIA 3M57A 2BTTA 4F14A 2EAYA 3PZCA 3NENA 4JJCA 4E7SA 4RG2A 5C51B 2RJDA 3VJPA 3TCJA 4V2SA 2ODRC 1Y96A 5IHNA 3A7RA 3M56A 4H02A 1SSFA 1WLEA 4BI8B 2RHUA 1HC7A 2JVVA 3OW2A 1D0YA 2JOYA 1NEGA 5KE3A 5GAN4 2CP5A 2DL3A 2L89A 5ELOA 3R6NA 4DOWA 1RAAB 4O6JA 1KMNA 1SKUB 3SWNC 2RHQB 3CCLT 2RM4A 4P71A 1Z9ZA 5HGQA 1JB0E 3VS6A 4XQ3A 1M4ZA 3GOXA 2EYZA 1X01A 2M1HA 2K5FA 1D3BB 2OTJA 1H8KA 4FCYA 2WSCE 4J7IA 3G4SQ 3A5YA 1OULA 2O4XB 1YFTA 1C0AA 2HQEA 3SEMA 2DK3A 2OTLQ 1CKBA 4PJNA 3ASKA 1IREB 4BWAA 4JRKA 4QQ6A 3M4GA 4PFPA 1LVKA 4II1A 2M02A 2RHSA 1LJOA 6AT1B 1ZUKA 1LOJA 3HP9A 3MEUA 3OS5A 3MF1A 1Q81C 1VQLA 8ATCB 4C5IA 2JN0A 5CIUA 4O2DA 3HRIA 1M8MA 4JJBA 4AMCA 3PIPA 2PVDB 1TUDA 3CD6Q 1YIJT 4PFZA 5KNNA 3M4YA 4YRGA 5HY6A 1EVKA 4NOYA 1Z7NA 4F7UG 3JSCA 3V8KA 5IHKA 3CC7T 3EG3A 3QPHA 2ZT5A 1QWEA 4PLLA 4OLFA 5GMKj 3JCMJ 2H3JA 1VQ8Q 1X2GA 2OJ2A 4F7UF 2BIVA 5GAMg 4Z02A 1TH7A 2ZPEB 2AKWB 2CS7A 4JDSA 1R8OB 5CCAA 2QI2A 4HCBA 2JM8A 3VQXA 1VIFA 4Q15A 4L87A 1I07A 2LNVA 3P8HA 2BUDA 4IKFA 1WGSA 5FU6C 2AK5A 4PFOA 1UUEA 3CCMQ 3P8DA 3CPWA 3G1JA 4CH6A 1NPPA 1UGRB 1NJ2A 4MDXA 2D1XA 2K7AA 3H6ZA 3KUFA 1QMCA 5GMKe 4M77A 2GFUA 4HWRA 3PNWC 1M30A 3REXA 3A5ZB 3C94A 3J81E 2BZXA 4BW9A 3META 3QO3A 3JCMX 2OX7A 2QK0A 5GAMh 1YCYA 2DPPB 3M0SA 1AWWA 4LVMA 2HL3A 1VQ4A 4EMGA 3HL8A 1KHIA 1H3HA 1G5IA 2RNAA 3OYKA 3M54A 1M1KC 1W6XA 1X2QA 3HFZA 3LGFA 1D0XA 4OGCA 2M0OA 2HKNA 3EGUA 1QVFA 3UF4A 1QVFS 2CP3A 4IIOA 2COZA 4N0AA 2E1HA 1OQKA 2ZR2A 5KE2A 1WJRA 2FZCB 3LH5A 1X6BA 2L2PA 2E3CA 1WHGA 2QQSA 3CC2Q 2LRQA 2C06A 3QO7A 3PCOA 2W0ZA 2Z0WA 3CCEA 3RNJA 3X25B 3M58A 4HT9A 2FHDA 2KSSA 2ODRD 4TVRA 4DQ2A 2AHJB 4BB7A 3I9QA 1AOJA 3ZFJA 2DYIA 2LQNA 4RMFA 3G6EA 4M7DA 1E6GA 4OGEA 3UATA 4KQEA 4M78C 4YRIA 1NLPC 5K1PA 1QVGA 1X6GA 2ARUA 1M27C 4FT4A 1ADYA 3P8TA 2DAQA 3CC4Q 1AWJA 5F5WA 1VQNA 4K86A 4P74A 2DFUA 2ZCEA 3SWNB 3HKSA 3HY1A 2VV5A 1KC8U 2RHYA 1Q81R 4C5GA 4AFQC 2I2LA 2CZ6B 3I55Q 5CKEA 1UGVA 3TEHB 2K5LA 1WXTA 2E4HA 2LJ3A 4YTLA 3L2VA 4UP8A 1PSFA 2E64A 1VQ7Q 2PMFA 2X3WD 3HXUA 1LCKA 2F2VA 2MF2A 4P75C 1K8AU 3NELA 2E65A 2MPXC 2CSQA 1AWOA 4J15A 4P72A 3RKYA 2DL5A 3CCST 2QEXA 2ROTA 4F04B 2NLUA 3CXCS 4QQGA 1AT1B 2NYSA 3FC3A 3X28B 5FU7C 4CC2A 4M75G 4ZTJA 4TVAB 2CSIA 4ZGDB 1Q7YC 4YPFA 1VQKQ 4CC7A 4LDYA 4ELZC 1WFWA 1EIYB 1T3SA 2HSEB 5GAN7 5CQYA 3NTKA 4M75F 4IUTA 3LWHA 3W3SA 4BI3A 1KD1U 2CH4W 4OMLA 2GTJA 4Z89A 3GIBA 1WYDA 4M75D 1K1ZA 2DEUA 11ASA 5L23A 5GAN2 4Y91A 3E9FA 1O9SA 4JS5A 2YUNA 3URGA 3OW2P 3UA7A 4LUDA 3LSQA 4R0KA 1J3TA 2E5QA 4H2TA 2IVWA 2RQRA 3NPFA 3I56A 1K9MC 2O9VA 4L6V5 4E7JA 1T0HA 5GAOm 1JJCB 2ENMA 2KROA 4AH6A 1JXOA 1MMAA 2YRCA 1AD5A 1A0NB 3JB9H 3QDRB 3VS2A 2AMCB 4KBMB 4RTYA 5FU6B 3RMSA 3MCAB 1OZ2A 1G3YA 4WF2A 3RUXA 3RACA 2QGFB 1QCFA 3I7FA 2HZYA 1NE8A 1OZ3A 4YRTA 4L5GA 1FX7A 4QW2A 3CCVA 4IUUA 2K57A 1PHTA 2HMAA 2ZPBB 3OBYA 2LCLA 3JB9G 4CS2A 3A8OB 2L3SA 2MI6A 2QQAA 1ZUYA 5LJ3d 2L0AA 2KGTA 2GF7A 4OB0B 1R0CB 3G4SA 1SEMA 2RJEA 5KCOA 5I2SA 4YROA 2OTLA 2AT1B 2F5TX 1KMMA 1KHCA 3VQWA 3JB9F 1TTHB 3EGDA 1E24A 2DILA 2J06A 2KY9A 1M2VB 3CMEQ 7AT1B 3ERRA 4YRPA 3JB9D 4TTVA 4FYYB 3LX7A 4X1VA 3VUBA 4PL6A 4K11A 2QA4Q 3FJ5A 2COYA 3IKLA 4XEOA 4ELYC 4BE0A 4CI0C 4J6WA 3CD6A 2DX1A 2A0FB 4XAXB 3NEMA 2QAZA 2QHTA 4LDXA 1F1BB 3PMTA 4EIKA 5GAN6 1RAIB 5GAOn 5KYWB 1TUGB 2MYSA 1ATIA 2RO0A 3M0UA 1ACMB 3G71T 1PYSB 3NFCA 1G5HA 1PRMC 5CR2A 2NUTA 1H4TA 2FRWA 5LJ3g 3HFVA 4M78D 1PNJA 4UP9A 1VQ8A 4PJLA 3BE3A 1YHQQ 1KQSA 3LSSA 1UHFA 4XTZA 4B9XA 4C8QC 4M78B 2EQMA 4QKUA 4KGXB 3CPWP 1OX8A 4C0ZA 4HT4A 1GBQA 4B6MA 2LQKA 1YI2T 2KRMA 3CCMA 1YJ9T 2RJFA 2CP6A 1KSWA
chains in the Genus database with same CATH topology
4XTVA 1SRYA 1P92A 4JRPA 4J83A 1B7YA 4YCVA 2QHVA 5CKDA 5LJ3h 3RERA 1NNHA 1SESA 4H2YA 4FL6A 3CCQT 2ZT7A 3OY9A 4BI4A 2A3LA 3L2UA 2QQBA 2P0KA 1KD1C 5IN1A 1PSEA 3LYIA 5D6XA 3OYCA 1M90C 2D9TA 3MEWA 2ZNIA 5FU7B 2FL7A 3UPUA 5GANd 3JRZA 5GANf 1WPYA 1BI2A 2ZT8A 4H2WA 4H2SA 4XEMA 3OA6A 3FDRA 3MEVA 1Q86C 4H2UA 2G3RA 2LT4A 3LW5E 3E19A 1Q82C 5C52B 4E51A 2Y4XA 3OYLA 2FYKA 4M7AC 1WJQA 1H4VB 2DTHA 2PQWA 1X6OA 3E1SA 2E5AA 3P8YA 3A8LB 2OTJT 1YFSA 4XTXA 3CC4A 3WVEB 2I4MA 4C92C 3L2ZA 3PMIA 3E9HA 4ZTFA 1USYA 2ZR3A 5GAOp 1JJ2A 3RGLA 1G3SA 1E22A 3I55A 2JTFA 1YJWT 4YP0A 4ZN1A 4UP7A 4J6XA 4Q5WA 1VQLT 4TQFA 1VQ7A 3SB2A 4LNSA 2D6FA 2P4TA 3OYJA 4F7UE 4BDZA 3OYFA 3UGTA 4TQDA 3HFZB 2Y4YA 4IUVA 5GANh 2Q5HA 1KQ1A 3REUA 3LLRA 1V29B 5LJ5j 2EJ9A 1M1KU 2ZTGA 1QP3A 3C95A 3PCOB 4A53A 4K88A 1IL2A 4P3NA 4CH4A 2K3YA 2VGMA 5ELNA 3DKMA 4L59A 4C8QD 3GNGA 5I21A 4N4HA 5LJ5e 1H641 3HY0A 3QXEB 3N5BB 4C8QB 3BY7A 2RJCA 1NJIC 2P0LA 2LC4A 5IT9E 1M1GA 1BI3A 3QZ9B 3M4PA 3E9IA 2DU7A 3A8MB 2K3XA 3V7CA 1VQ4T 5D6WA 4R56A 2IY5B 3A74A 2KMTA 2M16A 4MMKA 1VUBA 4C0DC 3OS1A 1JBMA 1NJ5A 4DOVA 4PJOC 4H2XA 2KDSA 3V8JA 5GAMd 1XTDA 2EL9A 5GAMf 1M9SA 2K2VA 2CJ9A 5HK3A 2XDPA 3NTHA 4EMKA 3CBPA 1I5LA 2PVGB 5D6YA 1I8FA 4YRMA 5CVIA 1BIBA 3CCET 2QA4A 1B8AA 3VUZA 3L4GA 4KR3A 3KBGA 3G6ET 2EJFA 1Q7YU 1KOGA 2RK1A 2DO3A 4M7AD 4YRQA 5J26A 1QP2A 3SDZA 3HPWA 1X54A 2ZPIB 1VQNT 5GAOq 2RI3A 4M7AB 2QXFA 1YHQA 3LH0A 3RMQA 1MGQA 4LDWA 4C92D 4RQFA 4XU1A 3GP8A 1BBUA 3OYEA 4EX5A 2ZZDA 4YCUA 1N27A 4GLKA 4IUPA 1ASZA 4C92B 1USYC 2ARSA 2DU5A 2J3LA 4JJNK 1K9MU 2YHTA 4M75E 2QEXT 3X24B 3FLGA 3OBWA 2ALYB 3A8GB 2E6NA 3DB4A 5J3BA 5CAIA 3OYIA 2K4YA 4XU0A 2F5KA 2NS6A 2X35A 2DXCA 3QO5A 3TEEA 2XDBA 4P73A 3L42A 1N6AA 2PUOB 4EPCA 4QVCA 2EWNA 5GAN5 1YITA 3HFNA 2HQXA 2XG8D 2Y90A 2DXUA 2JZ2A 3M59A 4KUDK 3O8VA 2EQUA 2A8EA 3X26B 4XTUA 3VYHB 3HFOA 3I56T 5LL6S 2V8KA 2RK2A 5C0MA 1B76A 4ZTZB 2CJAA 1RI0A 2LDMA 4HVCA 4JRQA 3CCRA 2X4YA 4BD3A 2V8JA 3QZ5B 2CYZB 1B70B 5AYFA 3JCMd 3L1AA 3JCMf 3CCVT 4P71C 4OMFB 4XTYA 3HXVA 1QE0A 3R07A 2V8IA 1QVPA 1W66A 2OTLT 4KT0E 3HHTB 4CH5A 2RHQA 4PJOD 4LDUA 1N8RU 4C0DB 5CKFA 2VGNA 4PJOB 4M78E 2LTOA 3GNFB 4C0GA 1D3BA 3CXCA 5GMKh 3E9GA 5J39A 4C5HA 4G84A 4X34A 2O4XA 3CD6T 3WVDB 3BDLA 2QTXA 3CMAA 4YREA 1EOVA 4A4KA 1HK9A 2VXEA 5CKBA 3JCMg 2XD0A 2DD4A 4J5YA 4ZTUB 1QW1A 2PUKB 1G5VA 4ME7A 3ICAA 1ZQ1A 2C8MA 1M90U 1VQ8T 5DM7R 3UH0A 2ZPHB 2P0QA 2DZ9A 4XK8E 1VQ5A 2ZZEA 4BE1A 3CCMT 2P5IA 1VQ6A 3JCMc 4ZIBA 1NZ9A 2E6ZA 4E7KA 3IG2A 3JCMh 3QG1A 1Q86U 2ZIOA 5C6SA 4BE2A 1Q82U 1E1OA 2AKWA 4G85A 3OSSC 4FSXA 4M77C 4E47A 4HT8A 4YDQA 3RF1A 1YJNA 3VYGA 3OQ5A 2ZGWA 2DD5A 2XDDA 4F7UA 5M9OA 2PMEA 2DXBA 3M5AA 3NTIA 5LJ3f 3S6WA 4ZGJB 1WJSA 2RHXA 1UB4A 3A5ZA 2QHSA 1VQOA 3C12A 5FLXE 1VQMA 4EMHA 1HTTA 5K1XA 3OYAA 4YRNA 4YRJA 3OMGA 1X56A 3PGGA 4N0AC 4JUVA 4M78G 3MF2A 2Q7EA 3A31A 3VQVA 4KUIA 3S3OA 2ZCFB 2ZIMA 3QHSA 2L3RA 3QYGB 4M78F 3HRSA 4FIBA 2RHZA 1VIEA 3Q1JA 3MP1A 1Y96B 4M7DC 3CC4T 1U1SA 4A54A 2XI9A 2CJBA 3TREA 4C5EA 2RHIA 1BI0A 3OYYA 1N8RC 4P74C 4OB2B 3I55T 3F70A 4X5OA 5CO7A 3FB9A 3MEAA 1VQ7T 1ZHIA 4YRLA 5GAOr 3OYNA 3OS2A 1B34A 3SWNA 5A0DA 4R55A 1VQPA 4ZN3A 3ME9A 1NJIU 2DTOA 3LGLA 2QQ9A 4P72C 1M8VA 4CH3A 5FROA 3TEHA 4C8QE 1NPRA 2RHSB 3M4QA 2HD0A 1N9WA 3TUPA 3EFRA 4X9CA 4A4HA 4VUBA 5GANe 4EDUA 1MHNA 4PLIA 2RH2A 2ARTA 3L2WA 3MP6A 1YB3A 1H4QA 3T9NA 3JCMQ 4TVAA 3S3NA 4D6WA 2QDYB 2R58A 1OYXA 5EG2A 3CC2A 1EIYA 5A0LA 3PTAA 1OI1A 2PU9B 4LVIA 5DLOA 1J5WA 1EQRA 3VV0A 2WSFE 1QF6A 3A7AA 1FWZA 2FVUA 1ZBXA 2J3MA 4EO4A 2JTMA 3BDUA 1NJ1A 4MZMA 4NL3A 2IG0A 5CK9A 3R6OA 2ZXFA 4M75A 2DDZA 3RESA 5GMKi 2ZT6A 2WSEE 2PVOB 4M77D 2EQJA 3P8BB 1U8RA 2ZZFA 2F69A 3BW1A 2P0PA 2E12A 2KQWA 4M77B 2VC8A 2AMCA 2LQ8A 3ER0A 3C4SA 4M7AE 3HTZA 2E70A 3VBBA 3S3MA 5CKHA 5KH6A 1BI1A 2QA4T 1GXIE 3LWIA 1XOVA 3GF5A 4C0FA 4C92E 4BDYA 1VQKA 5GMKl 5KCHA 2DIQA 2ZZGA 4C8QG 3MHXA 4HWSA 1FYFA 2JNGA 3HXZA 2R57A 4M7DF 4QVZA 12ASA 1H3ZA 1EFWA 4ATOA 2ZPFB 1YHQT 2DIGA 4C8QF 2CZ0B 4M7DD 3QJYA 3V8LA 3FRNA 2I4LA 3CCUA 5L8RE 4PKCC 4MZPA 4M7DB 3CBMA 3KXTA 2OAUA 5GAMj 1PYSA 1NYRA 4RQEA 2ZPGB 3HRUA 2EFIA 2XTIA 1JRIA 2YLCA 3HXWA 4O5VA 4BUGA 4OVAA 3L2RA 3OW2S 4M78A 1Z7MA 2MAMA 3PFSA 4TVYA 5LJ5d 3CPFA 2DZCA 3P8VA 5E3IA 3QSUA 5LJ5f 2XK0A 3UDCA 2XICA 5HK0A 5GAMe 1UEBA 4P5NA 2VYTA 3UFGA 3QUIA 4OF1A 4YRSA 3FJPA 1Y07A 4UPAA 1YITT 4JS4A 1K73C 4XU3A 5C53B 3CMEA 2O01E 3DB3A 4M7AG 3OYMA 4P75A 4LVJA 1VQ9A 4E7IA 3WQZA 4PHCA 2E10A 2KVQG 5I2MA 1YJWA 4H2VA 2L5QA 3M55A 4M7AF 1I81A 3CCRT 4PJOE 3RKXA 4C92G 5LJ5g 3SFMA 2XHCA 1M5Q1 3A32A 1RIQA 3TU4K 1S72A 4C92F 2EYQA 3QBYA 3CCJA 4YCWA 3SD4A 3LC0A 1BBWA 1H4SA 1EIFA 3MO8A 3JCMV 1XNIA 4M75C 5DY9A 3DLLA 2RI5A 3GLXA 3G1ZA 4LD6A 2X4JA 2G4CA 5LJ5h 3EFSA 4RG8A 4F7UB 3CPWS 1YGBA 3CMAT 4E7LA 1O75A 2C7IA 4OB3B 4IURA 3QYHB 2HBPA 1DJ7B 2XU8A 3JCMb 4JLGA 5A0GA 3CCLA 5CQXA 1LYLA 3M53A 1XQHA 1L0WA 3OMCA 2MWOA 4GY5A 3A8HB 2KAFA 2DJZA 2BKDN 4LVLA 4NS5A 4HCZA 2CGHA 3OD1A 4HWPA 1VQ5T 4BY6C 1SETA 4QQDA 2LX9A 2R5MA 1VQ6T 3UWNA 3IALA 5FRMA 2X4WA 3JB9I 1G51A 2LVMA 3OSVA 3NETA 1ASYA 3VQYA 4PJOG 1YIJA 3JCMe 1FXXA 4YRRA 1YJNT 2ZNJA 3MEYA 2MMPA 1NYQA 1UGQB 1UGSB 4FM4B 3CC7A 3QO8A 4PJOF 3G4ST 2EIFA 3CEYA 1QVGS 1B7YB 3RIRA 4C8QA 3AHUA 1VQOT 3X20B 2RI2A 2RA2A 3RL6A 1B34B 4P3OA 1N9SA 1VQMT 3HRKA 3HRTA 3RKWA 4EMKC 2IY5A 3OS0A 3M9QA 4K87A 4Q6GA 3ZBDA 1SERA 3JAME 2DQ3A 3OB9A 1X55A 3J7AF 3IKMB 2VXFA 1KQ2A 5GAN8 3QTCA 3OYDA 1G3TA 4B9WA 2QQRA 1AHJB 4RDXA 3QJ6A 2WACA 3MQZA 4HWTA 4TWAA 3VU3C 4J8OA 1NJ8A 1Y7XA 2CKKA 4RKUE 1Y71A 5LJ3j 2D0QB 1HXDA 1RL2A 3J80E 4KULA 4MMLA 3OYGA 4OP0A 3KFUA 2JUFA 3V7SA 4M75B 4ZGEB 2Q7GA 4M7AA 4LVKA 1VQPT 3HXYA 2XKOC 2A7YA 4N4GA 4YRFA 4CS4A 1WQ7A 3PIOA 5LJ3e 3ZEHA 4A4FA 2X4XA 4C92A 1YBYA 1NJ6A 1GGMA 3HSBA 4P73C 2GCXA 2ALYA 2B8AA 3OYBA 2M9UA 4LD9K 4OB1B 3CC2T 4M77E 4RCCA 4LDVA 4NL2A 2L8DA 5GMKm 1X75C 3PT9A 3UT1A 4Y28E 1W4SA 3CCSA 1VQZA 5A2QE 3INZA 4BY6B 5HKCA 3WXMB 4J7FA 1BYMA 3GPLA 4XU2A 3L2QA 4RCBA 4P3PA 2E41A 3UGQA 4YRKA 4J6YA 4HWOA 1KC8C 3HXXA 1B70A 2QHUA 1KQSS 4PNOA 5GANj 1K8AC 4M7DE 1WNLA 4H2XB 4FU6A 1VQKT 2MWPA 2HNIA 2K5IA 3A7UA 2VUBA 4EMKB 5IAYA 2I4OA 3DLMA 3QIIA 1E1TA 4MDWA 4WI1A 4PJOA 1U1TA 1I4K1 3TEGA 4FT2A 3DSQA 4YYEA 3JCMP 4RMOA 1N9RA 1K73U 3L4GB 5DLQE 1YFRA 2EJGA 2YRVA 3CCUT 2KK4A 4HCCA 2EKOA 1EVLA 1ADJA 2XIDA 2ZINA 4M77G 4DPGA 3EAEA 4PG3A 1G3WA 4N4IA 3JCMW 2RD1A 2LT1A 2LCCA 1Q81U 3MP8A 1W2BA 2DQ0A 1W2BS 3CBOA 2DVEA 4M77F 2Q7HA 4QVDA 2CZ7B 4MZTA 2GFAA 5GAOl 3JB9J 1UGPB 4WJ4A 3G71A 1JJCA 2CZ1B 1WU7A 1M1FA 1BIAA 4IUQA 4JLIA 4KR2A 4HA8A 2FB7A 5FRNA 2YLBA 3FIFA 3CMET 3CMQA 5GANg 4YRCA 4A4EA 4BACA 5GAN3 1VQ9T 2XGTA 1LNXA 1JJ2S 3BFMA 1YI2A 1YJ9A 3V7RA 1IZ6A 3QNEA 2DEQA 2Q5IA 4M7DG 4XTWA 1X2HA 2R5AA 3FEOA 3QKJA 2DXTA 1WQWA 4UC4A 4DA4A 1BKBA 4WJ3M 4NCXA 4A4GA 2EQKA 3G7ZA 2RB6A 3CCQA 1S72T 4JRIA 2HAXA 4X9DA 4HKEA 4E7HA 3CCJT 2GQVA 2DTIA 4CS3A 2CIMA 3VKIA 2DKGA 4CRIA 3OYHA 1KG1A 3BJUA 2I4NA 3H8ZA 4TVWA 3M57A 2EAYA 3PZCA 3NENA 4RG2A 5C51B 2RJDA 3VJPA 3TCJA 4V2SA 2ODRC 1Y96A 3A7RA 3M56A 4H02A 1SSFA 1WLEA 4BI8B 2RHUA 1HC7A 2JVVA 3OW2A 2JOYA 5KE3A 5GAN4 2L89A 5ELOA 4DOWA 4O6JA 1KMNA 3SWNC 2RHQB 3CCLT 2RM4A 4P71A 5HGQA 1JB0E 4XQ3A 1M4ZA 3GOXA 1X01A 2M1HA 2K5FA 1D3BB 2OTJA 2WSCE 4J7IA 3A5YA 2O4XB 1YFTA 1C0AA 2HQEA 2DK3A 3ASKA 1IREB 4BWAA 4JRKA 4QQ6A 3M4GA 4II1A 2RHSA 1LJOA 1LOJA 3HP9A 3MEUA 3OS5A 3MF1A 1Q81C 1VQLA 4C5IA 2JN0A 5CIUA 4O2DA 3HRIA 3PIPA 2PVDB 1YIJT 5KNNA 3M4YA 4YRGA 5HY6A 1EVKA 4NOYA 1Z7NA 4F7UG 3JSCA 3V8KA 3CC7T 3QPHA 2ZT5A 4PLLA 4OLFA 5GMKj 3JCMJ 2H3JA 1X2GA 4F7UF 2BIVA 5GAMg 4Z02A 1TH7A 2ZPEB 2AKWB 2CS7A 4JDSA 1R8OB 5CCAA 2QI2A 4HCBA 3VQXA 1VIFA 4Q15A 4L87A 2LNVA 3P8HA 2BUDA 4IKFA 1WGSA 5FU6C 3P8DA 3CPWA 4CH6A 1NPPA 1UGRB 1NJ2A 4MDXA 3H6ZA 3KUFA 5GMKe 4M77A 2GFUA 4HWRA 3PNWC 3REXA 3A5ZB 3C94A 3J81E 4BW9A 3META 3QO3A 3JCMX 5GAMh 1YCYA 2DPPB 4LVMA 1VQ4A 4EMGA 3HL8A 1KHIA 1G5IA 3OYKA 3M54A 1M1KC 3HFZA 3LGFA 4OGCA 2M0OA 1QVFA 1QVFS 4N0AA 2E1HA 2ZR2A 5KE2A 1WJRA 2E3CA 2QQSA 2LRQA 2C06A 3QO7A 3PCOA 3CCEA 3X25B 3M58A 4HT9A 2FHDA 2KSSA 2ODRD 4TVRA 4DQ2A 2AHJB 4BB7A 3ZFJA 4RMFA 3G6EA 4M7DA 4OGEA 4KQEA 4M78C 4YRIA 5K1PA 1QVGA 2ARUA 4FT4A 1ADYA 3P8TA 2DAQA 5F5WA 1VQNA 4K86A 4P74A 2ZCEA 3SWNB 3HKSA 3HY1A 2VV5A 1KC8U 2RHYA 4C5GA 2I2LA 2CZ6B 5CKEA 3TEHB 2K5LA 4YTLA 3L2VA 4UP8A 1PSFA 2E64A 2PMFA 3HXUA 2MF2A 4P75C 1K8AU 3NELA 2E65A 4J15A 4P72A 3RKYA 3CCST 2QEXA 2NLUA 3CXCS 4QQGA 3FC3A 3X28B 5FU7C 4M75G 4ZTJA 4TVAB 4ZGDB 1Q7YC 4YPFA 4LDYA 4ELZC 1EIYB 5GAN7 5CQYA 3NTKA 4M75F 4IUTA 3LWHA 3W3SA 4BI3A 1KD1U 3GIBA 1WYDA 4M75D 11ASA 5GAN2 4Y91A 3E9FA 1O9SA 4JS5A 3URGA 3LSQA 2E5QA 4H2TA 2IVWA 3I56A 1K9MC 4L6V5 4E7JA 5GAOm 1JJCB 4AH6A 3JB9H 3QDRB 2AMCB 4KBMB 5FU6B 3RMSA 3MCAB 1OZ2A 1G3YA 4WF2A 3RUXA 3RACA 3I7FA 1NE8A 1OZ3A 4YRTA 4L5GA 1FX7A 4QW2A 3CCVA 4IUUA 2K57A 2ZPBB 3OBYA 2LCLA 3JB9G 4CS2A 3A8OB 2MI6A 2QQAA 5LJ3d 2GF7A 4OB0B 3G4SA 2RJEA 5KCOA 5I2SA 4YROA 2OTLA 2F5TX 1KMMA 1KHCA 3VQWA 3JB9F 1E24A 2KY9A 3ERRA 4YRPA 3JB9D 4TTVA 3LX7A 3VUBA 4PL6A 3IKLA 4XEOA 4ELYC 4BE0A 4CI0C 4J6WA 3CD6A 4XAXB 3NEMA 2QHTA 4LDXA 3PMTA 5GAN6 5GAOn 1ATIA 2RO0A 3G71T 1PYSB 3NFCA 1G5HA 5CR2A 1H4TA 5LJ3g 3HFVA 4M78D 4UP9A 1VQ8A 1KQSA 3LSSA 4XTZA 4B9XA 4C8QC 4M78B 2EQMA 4C0ZA 4HT4A 2LQKA 1YI2T 1YJ9T 3CCMA 2RJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTU B;  4XTV A;  5LJ5 h;  2DTI A;  3EFS A;  1SRY A;  3ICA A;  4CS3 A;  2C8M A;  2CIM A;  1B7Y A;  4F7U B;  2DKG A;  1YGB A;  3UH0 A;  3BJU A;  2I4N A;  2C7I A;  4YCV A;  2QHV A;  4TVW A;  5LJ3 h;  2EAY A;  3PZC A;  3RER A;  1NNH A;  3NEN A;  3JCM b;  2DZ9 A;  1SES A;  4H2Y A;  2ZZE A;  5C51 B;  2ZT7 A;  2P5I A;  4V2S A;  2ODR C;  1Y96 A;  3A7R A;  3JCM c;  4H02 A;  1LYL A;  1WLE A;  4ZIB A;  1HC7 A;  3IG2 A;  3JCM h;  1L0W A;  2ZIO A;  5GAN 4;  1E1O A;  2ZNI A;  2DJZ A;  2AKW A;  5ELO A;  4G85 A;  5GAN d;  2CGH A;  4M77 C;  5GAN f;  4HT8 A;  1KMN A;  4YDQ A;  3SWN C;  2RHQ B;  3OD1 A;  4HWP A;  2RM4 A;  4P71 A;  3RF1 A;  1WPY A;  5HGQ A;  1SET A;  2ZGW A;  2ZT8 A;  4H2W A;  4H2S A;  4XQ3 A;  4XEM A;  4F7U A;  3IAL A;  2PME A;  1X01 A;  3JB9 I;  5LJ3 f;  1G51 A;  1D3B B;  4H2U A;  3NET A;  1ASY A;  3A5Y A;  1YFT A;  5C52 B;  1C0A A;  4E51 A;  3VQY A;  4PJO G;  3A5Z A;  2QHS A;  2FYK A;  3JCM e;  4M7A C;  4BWA A;  4YRR A;  4JRK A;  2ZNJ A;  1H4V B;  3MEY A;  2DTH A;  3M4G A;  2RHS A;  1LJO A;  1NYQ A;  4EMH A;  1HTT A;  1LOJ A;  2E5A A;  5K1X A;  3QO8 A;  3P8Y A;  3MF1 A;  4YRN A;  4YRJ A;  4PJO F;  1X56 A;  3PGG A;  4N0A C;  1YFS A;  4JUV A;  4M78 G;  2JN0 A;  4XTX A;  3MF2 A;  2I4M A;  2Q7E A;  4C92 C;  4O2D A;  3HRI A;  1B7Y B;  3RIR A;  4C8Q A;  3L2Z A;  3AHU A;  3A31 A;  3E9H A;  3VQV A;  1USY A;  2ZR3 A;  2ZIM A;  3QHS A;  5GAO p;  5KNN A;  3RGL A;  2RA2 A;  3RL6 A;  4YRG A;  1B34 B;  4M78 F;  4P3O A;  1N9S A;  1E22 A;  1EVK A;  3HRK A;  4NOY A;  1Z7N A;  4F7U G;  3V8K A;  3RKW A;  4EMK C;  4YP0 A;  2IY5 A;  4UP7 A;  2ZT5 A;  1Y96 B;  4J6X A;  4M7D C;  4OLF A;  4K87 A;  4TQF A;  1U1S A;  4Q6G A;  3SB2 A;  4A54 A;  2CJB A;  5GMK j;  1SER A;  4LNS A;  3JCM J;  1X2G A;  2DQ3 A;  4F7U F;  5GAM g;  1X55 A;  4F7U E;  1TH7 A;  2AKW B;  3UGT A;  3IKM B;  2VXF A;  4P74 C;  3VQX A;  4Q15 A;  4L87 A;  4TQD A;  3HFZ B;  4X5O A;  1KQ2 A;  5GAN 8;  3FB9 A;  5GAN h;  2Q5H A;  3QTC A;  1KQ1 A;  3REU A;  5LJ5 j;  4CH6 A;  4RDX A;  1NJ2 A;  4YRL A;  5GAO r;  2EJ9 A;  4HWT A;  5GMK e;  2ZTG A;  1B34 A;  4M77 A;  4TWA A;  3VU3 C;  3SWN A;  4HWR A;  2DTO A;  3REX A;  1NJ8 A;  3PCO B;  4A53 A;  4P72 C;  4K88 A;  4BW9 A;  5LJ3 j;  1IL2 A;  1HXD A;  4P3N A;  1M8V A;  4CH3 A;  4CH4 A;  3TEH A;  3QO3 A;  4C8Q E;  3JCM X;  2RHS B;  5ELN A;  5GAM h;  1YCY A;  4MML A;  3M4Q A;  4OP0 A;  1N9W A;  3TUP A;  4EMG A;  3KFU A;  3EFR A;  4X9C A;  4C8Q D;  5I21 A;  3V7S A;  4M75 B;  1G5I A;  5LJ5 e;  1H64 1;  3HY0 A;  2Q7G A;  4M7A A;  5GAN e;  3HXY A;  4C8Q B;  3BY7 A;  3HFZ A;  2ART A;  2P0L A;  1YB3 A;  1H4Q A;  4YRF A;  3M4P A;  3E9I A;  3JCM Q;  4TVA A;  4CS4 A;  2DU7 A;  1WQ7 A;  5LJ3 e;  4N0A A;  3V7C A;  2E1H A;  2ZR2 A;  1EIY A;  4C92 A;  2IY5 B;  3A74 A;  4MMK A;  2E3C A;  1NJ6 A;  1JBM A;  1GGM A;  1NJ5 A;  3HSB A;  1J5W A;  1EQR A;  3QO7 A;  3PCO A;  4PJO C;  4P73 C;  4H2X A;  3V8J A;  5GAM d;  2EL9 A;  1QF6 A;  4HT9 A;  3A7A A;  5GAM f;  2ODR D;  4DQ2 A;  2J3M A;  2ALY A;  2CJ9 A;  4EO4 A;  3BDU A;  1NJ1 A;  4EMK A;  4RMF A;  4M7D A;  4NL3 A;  1I5L A;  2ZXF A;  4M77 E;  4KQE A;  1I8F A;  4M78 C;  4M75 A;  4RCC A;  4YRI A;  5K1P A;  2DDZ A;  3RES A;  4NL2 A;  5GMK i;  2ARU A;  2ZT6 A;  1ADY A;  5GMK m;  4YRM A;  3P8T A;  4M77 D;  1BIB A;  2ZZF A;  5F5W A;  3BW1 A;  1B8A A;  4K86 A;  4P74 A;  4M77 B;  2ZCE A;  3SWN B;  1VQZ A;  2VC8 A;  3L4G A;  2AMC A;  3HY1 A;  4KR3 A;  3INZ A;  2EJF A;  2I2L A;  4M7A E;  3HTZ A;  3TEH B;  1KOG A;  3VBB A;  4UP8 A;  4M7A D;  4YRQ A;  2E64 A;  2PMF A;  3HXU A;  1X54 A;  4P75 C;  4XU2 A;  3NEL A;  5GAO q;  2E65 A;  4J15 A;  4P72 A;  4M7A B;  3RKY A;  4C92 E;  4RCB A;  4P3P A;  2E41 A;  3UGQ A;  4YRK A;  4J6Y A;  4HWO A;  5GMK l;  3HXX A;  1MGQ A;  1B70 A;  4M75 G;  4C92 D;  4TVA B;  4YPF A;  4RQF A;  2QHU A;  4XU1 A;  2ZZG A;  4PNO A;  1BBU A;  4EX5 A;  4YCU A;  5GAN j;  4C8Q G;  4HWS A;  1ASZ A;  1FYF A;  1EIY B;  4C92 B;  1USY C;  3HXZ A;  2ARS A;  2DU5 A;  2J3L A;  5GAN 7;  4M7D F;  12AS A;  1EFW A;  4M75 F;  4M7D E;  1WNL A;  2YHT A;  4H2X B;  4M75 E;  3W3S A;  4C8Q F;  4M7D D;  3GIB A;  2ALY B;  2HNI A;  1WYD A;  4M75 D;  5CAI A;  3V8L A;  3A7U A;  4EMK B;  2I4O A;  2I4L A;  4XU0 A;  11AS A;  5GAN 2;  4Y91 A;  4M7D B;  3QO5 A;  5GAM j;  1PYS A;  1E1T A;  4WI1 A;  4P73 A;  4PJO A;  1NYR A;  3LSQ A;  4RQE A;  2XTI A;  1U1T A;  1I4K 1;  4H2T A;  3TEG A;  1JRI A;  2YLC A;  3DSQ A;  3HXW A;  4YYE A;  5GAO m;  1JJC B;  4QVC A;  3JCM P;  4AH6 A;  1N9R A;  2EWN A;  5GAN 5;  3JB9 H;  2AMC B;  3L4G B;  1YFR A;  2EJG A;  4M78 A;  3HFN A;  1Z7M A;  4TVY A;  2Y90 A;  3RAC A;  4WF2 A;  3RUX A;  5LJ5 d;  1EVL A;  2DXU A;  2DZC A;  1ADJ A;  3P8V A;  3I7F A;  5E3I A;  3QSU A;  5LJ5 f;  4YRT A;  2ZIN A;  4M77 G;  4DPG A;  4XTU A;  5GAM e;  3HFO A;  4PG3 A;  2K57 A;  3JCM W;  2RD1 A;  3JB9 G;  4CS2 A;  1B76 A;  3UFG A;  4ZTZ B;  2CJA A;  3QUI A;  4YRS A;  3FJP A;  2DQ0 A;  4HVC A;  5LJ3 d;  4UPA A;  2DVE A;  4M77 F;  2Q7H A;  4YRO A;  4QVD A;  1KMM A;  4XU3 A;  3VQW A;  3JB9 F;  5C53 B;  1B70 B;  1E24 A;  5GAO l;  4M7A G;  3JCM d;  3JB9 J;  3L1A A;  4P75 A;  3JCM f;  3ERR A;  4YRP A;  4WJ4 A;  1JJC A;  4P71 C;  3JB9 D;  3WQZ A;  4XTY A;  4PHC A;  4TTV A;  2E10 A;  1WU7 A;  1QE0 A;  1BIA A;  3HXV A;  3R07 A;  4JLI A;  4KR2 A;  3IKL A;  4XEO A;  4H2V A;  4HA8 A;  2FB7 A;  4M7A F;  1I81 A;  1W66 A;  4PJO E;  3RKX A;  4J6W A;  4C92 G;  3NEM A;  2QHT A;  2YLB A;  3FIF A;  5GAN 6;  3CMQ A;  5LJ5 g;  4CH5 A;  2RHQ A;  4PJO D;  5GAO n;  5GAN g;  4YRC A;  1M5Q 1;  3A32 A;  5GAN 3;  1ATI A;  1RIQ A;  2XGT A;  1PYS B;  1LNX A;  1G5H A;  4PJO B;  3BFM A;  4C92 F;  4M78 E;  3V7R A;  1H4T A;  1D3B A;  3QNE A;  4YCW A;  2DEQ A;  5GMK h;  5LJ3 g;  3LC0 A;  1BBW A;  2Q5I A;  1H4S A;  4M7D G;  4M78 D;  3HFV A;  4UP9 A;  4G84 A;  3JCM V;  4XTW A;  1X2H A;  4M75 C;  3LSS A;  2QTX A;  2DXT A;  4YRE A;  5DY9 A;  1EOV A;  1WQW A;  4XTZ A;  4C8Q C;  4M78 B;  1HK9 A;  4WJ3 M;  4NCX A;  2VXE A;  3JCM g;  3G1Z A;  2RB6 A;  4JRI A;  4J5Y A;  2G4C A;  4X9D A; 
#chains in the Genus database with same CATH topology
 4XTV A;  1SRY A;  1P92 A;  4JRP A;  1X43 A;  2RMO A;  4OMP A;  4J83 A;  1B7Y A;  4HVW A;  5FW9 A;  1Q7Y R;  4D8K A;  4KGZ B;  2JS0 A;  1VOM A;  4YCV A;  2I0N A;  2QHV A;  1WA7 A;  5CKD A;  2LZ6 B;  1OOT A;  5LJ3 h;  3RER A;  1NNH A;  1SES A;  1UHC A;  4H2Y A;  4FL6 A;  3CCQ T;  1KJW A;  2LJ1 A;  2ZT7 A;  3OY9 A;  4BI4 A;  2A3L A;  3L2U A;  2QQB A;  4LNP A;  3H0H A;  4ZNX A;  3D7S B;  3EH1 A;  2P0K A;  1KD1 C;  2VVK A;  4E2F B;  5IN1 A;  1PSE A;  3LYI A;  1IHV A;  5D6X A;  3OYC A;  1WX6 A;  1M90 C;  2D9T A;  3MEW A;  4DBR A;  2ZNI A;  5FU7 B;  2FL7 A;  2B86 A;  1YIT Q;  1QKW A;  3UPU A;  3EH2 A;  1G8X A;  5GAN d;  3JRZ A;  2ED1 A;  5GAN f;  2EGE A;  5KYY A;  1K9M R;  1WPY A;  1UDL A;  2JS2 A;  3EG9 B;  1BI2 A;  2AKL A;  2ZT8 A;  2RPN A;  4H2W A;  4H2S A;  4XEM A;  3OA6 A;  2F1L A;  3FDR A;  3MEV A;  3CQT A;  8AT1 B;  1RLP C;  2FZG B;  1FMW A;  3E2U A;  1Q86 C;  4H2U A;  2G3R A;  2LT4 A;  3LW5 E;  4AG1 C;  3E19 A;  2G6F X;  5KYU B;  1Q82 C;  1RUW A;  5C52 B;  3CCR Q;  4E51 A;  2Y4X A;  3OYL A;  4DEY A;  2FYK A;  4M7A C;  1QVG P;  5FWC A;  1BCO A;  1WJQ A;  1H4V B;  2DTH A;  1SHF A;  2PQW A;  1I5O B;  1X6O A;  3E1S A;  2CUD A;  2YSQ A;  2E5A A;  3P8Y A;  3A8L B;  2OTJ T;  1AVZ C;  1YFS A;  4XTX A;  3CC4 A;  3WVE B;  2I4M A;  4C92 C;  4IIM A;  2JTE A;  1YWO A;  2E3I A;  2OI3 A;  2L3P A;  2J6F A;  3L2Z A;  3PMI A;  3E9H A;  4ZTF A;  1USY A;  2ZR3 A;  4J9B A;  2RQU A;  5GAO p;  1D1C A;  3GBQ A;  1JJ2 A;  3RGL A;  1G3S A;  4DBH A;  4FW1 A;  1E22 A;  3I55 A;  3VS5 A;  2JTF A;  1YJW T;  4YP0 A;  4ZN1 A;  4UP7 A;  4J6X A;  4Q5W A;  1VQL T;  4TQF A;  1VQ7 A;  3SB2 A;  3A98 A;  1Q95 G;  2D6F A;  4LNS A;  5IH2 A;  2P4T A;  3OYJ A;  3CMA Q;  4F7U E;  4BDZ A;  3OYF A;  1PG5 B;  3UGT A;  4TQD A;  3HFZ B;  4KGV B;  1KC8 R;  2Y4Y A;  4IUV A;  5GAN h;  4GLM A;  2FEI A;  2Q5H A;  1NM7 A;  1PRL C;  2FPD A;  1KQ1 A;  3REU A;  3LLR A;  1V29 B;  5LJ5 j;  1G83 A;  2EJ9 A;  1M1K U;  2ZTG A;  4AFZ C;  1QP3 A;  3C95 A;  1K8A R;  3PCO B;  4A53 A;  4K88 A;  1U06 A;  1IL2 A;  4P3N A;  1MND A;  4CH4 A;  2K3Y A;  1SPK A;  2VGM A;  1VQ5 Q;  5ELN A;  1X69 A;  2F2W A;  1VQ6 Q;  4FYW B;  2V26 A;  3DKM A;  4L59 A;  3REA B;  4C8Q D;  1D09 B;  3GNG A;  5I21 A;  1CSK A;  2HEQ A;  4N4H A;  1NEB A;  2W10 A;  5LJ5 e;  1H64 1;  3HY0 A;  3QXE B;  2YUO A;  3N5B B;  4C8Q B;  1K0S A;  2FPF A;  3BY7 A;  2QG9 B;  2RJC A;  1NJI C;  2P0L A;  2LC4 A;  5IT9 E;  1M1G A;  1BI3 A;  3QZ9 B;  1KD1 R;  3E9I A;  3M4P A;  1S1N A;  1H92 A;  1YJN Q;  3IQL A;  2DU7 A;  1I1J A;  3A8M B;  2K3X A;  3V7C A;  1K4U S;  1VQ4 T;  5D6W A;  4R56 A;  2IY5 B;  3A74 A;  1VYV A;  2KMT A;  1NYG A;  2M16 A;  4MMK A;  1VUB A;  4C0D C;  4RTT A;  3THK A;  1JBM A;  3OS1 A;  1NJ5 A;  2DL8 A;  4DOV A;  2GQI A;  1JQQ A;  4PJO C;  4H2X A;  2KDS A;  3V8J A;  5GAM d;  1XTD A;  2EL9 A;  2DA9 A;  5GAM f;  4RTZ A;  4D8D A;  1VQO Q;  1M9S A;  2K2V A;  3RR6 A;  2CJ9 A;  5HK3 A;  2XDP A;  3NTH A;  4EMK A;  1MMG A;  1TXQ A;  2ATC B;  2VAS A;  3CBP A;  1Q86 R;  1VQM Q;  2PVG B;  1I5L A;  5D6Y A;  1MMN A;  1I8F A;  4PJJ A;  2DJQ A;  1EFN A;  1Q82 R;  4YRM A;  5CVI A;  1BIB A;  2GGR A;  3CCE T;  2C0T A;  2QA4 A;  1B8A A;  3VUZ A;  1ZSZ C;  3EGX A;  3L4G A;  1QLY A;  4KR3 A;  3KBG A;  3G6E T;  2EJF A;  1ZLM A;  1RAH B;  1Q7Y U;  3MJX A;  4JJD A;  1KOG A;  2RK1 A;  2DO3 A;  4M7A D;  4YRQ A;  5J26 A;  1QP2 A;  1KQS P;  3SDZ A;  3HPW A;  1X54 A;  3PVL A;  2ZPI B;  2V1Q A;  1VQN T;  1RI9 A;  2RI3 A;  5GAO q;  4E6R A;  4M7A B;  5AT1 B;  4E7Z A;  2QXF A;  1YHQ A;  5IXB A;  3LH0 A;  3RMQ A;  1MGQ A;  4LDW A;  4C92 D;  4RQF A;  4XU1 A;  3GP8 A;  1BBU A;  2DE0 X;  3OYE A;  2ZZD A;  4YCU A;  4EX5 A;  1N27 A;  4GLK A;  3EFO A;  1EX4 A;  4IUP A;  4J9H A;  4AFU C;  2LJ0 A;  1ASZ A;  3MKD A;  4C92 B;  1QCN A;  1USY C;  2ARS A;  2DU5 A;  2J3L A;  4JJN K;  1ZUU A;  1K9M U;  1YWP A;  2YHT A;  4M75 E;  2LQW A;  2QEX T;  3X24 B;  1VQP Q;  3FLG A;  3OBW A;  1Z9Q A;  2ALY B;  3A8G B;  2E6N A;  3DB4 A;  5J3B A;  5CAI A;  3OYI A;  2K4Y A;  4XU0 A;  2F5K A;  2NS6 A;  2X35 A;  1UJY A;  2DXC A;  3QO5 A;  3TEE A;  2XDB A;  1HYO A;  4P73 A;  3L42 A;  2FO0 A;  3VRZ A;  1N6A A;  4RTU A;  2DYB A;  2PUO B;  1ZSG A;  2FG0 A;  3NHN A;  4EPC A;  1RLQ C;  2LCS A;  4QVC A;  1OPL A;  2EWN A;  5GAN 5;  1YIT A;  2E3H A;  1VYU A;  3HFN A;  2HQX A;  2XG8 D;  2Y90 A;  1W2B P;  2DXU A;  2RQV A;  2JZ2 A;  3M59 A;  4KUD K;  3O8V A;  2EQU A;  2A8E A;  3X26 B;  4XTU A;  3VYH B;  1NJI R;  3HFO A;  3I56 T;  5FWB A;  5LL6 S;  1IRX A;  2V8K A;  2RK2 A;  5C0M A;  1B76 A;  4ZTZ B;  2CJA A;  3C0C A;  1RI0 A;  2LDM A;  4HVC A;  1GCQ A;  3VS0 A;  4JRQ A;  1AEY A;  4RUG A;  3CCR A;  2X4Y A;  4BD3 A;  2V8J A;  3QZ5 B;  2CYZ B;  1BK2 A;  1B70 B;  5KYX B;  1AZG B;  5AYF A;  3JCM d;  1W70 A;  1BB9 A;  2YDL A;  3L1A A;  1PKS A;  3JCM f;  3CCV T;  4P71 C;  4OMF B;  4XTY A;  3HXV A;  1QE0 A;  3ULR B;  3R07 A;  2V8I A;  2NUP A;  3VS1 A;  1JJ2 P;  1QVP A;  1W66 A;  1BBZ A;  1WZO A;  1PD1 A;  2GTO A;  2OTL T;  4DBF A;  2ZAE A;  4KT0 E;  3EHR A;  2DL4 A;  3HHT B;  4CH5 A;  2RHQ A;  4PJO D;  4LDU A;  1WHK A;  1N8R U;  4C0D B;  2EPD A;  5CKF A;  2VGN A;  4PJO B;  4M78 E;  2AZS A;  2KYM A;  2LTO A;  3GNF B;  4C0G A;  1D3B A;  3CXC A;  1WHJ A;  5GMK h;  3E9G A;  3EHQ A;  5J39 A;  4C5H A;  4G84 A;  4X34 A;  2O4X A;  1YNZ A;  3H9N A;  3CD6 T;  2E5K A;  3WVD B;  3BDL A;  1WYX A;  2QTX A;  3CMA A;  4YRE A;  1EOV A;  4A4K A;  1HK9 A;  1PD0 A;  1K76 A;  2VXE A;  5CKB A;  3JCM g;  5IXF A;  2XD0 A;  1OV3 A;  2DD4 A;  2FZK B;  4J5Y A;  4ZTU B;  1QW1 A;  2PUK B;  1G5V A;  2K2M A;  4ME7 A;  3ICA A;  1ZQ1 A;  2LP5 A;  2C8M A;  1ZSZ B;  1M90 U;  1VQ8 T;  3M0P A;  5DM7 R;  3UH0 A;  2EBP A;  2ZPH B;  1RAG B;  1BU1 A;  2P0Q A;  3CCU Q;  4PJM A;  2DZ9 A;  4XK8 E;  1VQ5 A;  2ZZE A;  4BE1 A;  3CCM T;  1U5S A;  1K9A A;  2HSP A;  2P5I A;  1VQ6 A;  3JCM c;  4WTO B;  4CC4 B;  4ZIB A;  1NZ9 A;  2E6Z A;  4E7K A;  3IG2 A;  3JCM h;  3QG1 A;  1Q86 U;  2ZIO A;  3RBB B;  5C6S A;  4BE2 A;  2RQT A;  1Q82 U;  1E1O A;  2AKW A;  4G85 A;  3OSS C;  1M1K R;  4FSX A;  4M77 C;  4E47 A;  4HT8 A;  4YDQ A;  2A08 A;  2O88 A;  3RF1 A;  1YJN A;  3VYG A;  3OQ5 A;  2ZGW A;  1BCM A;  2DD5 A;  2XDD A;  4F7U A;  5M9O A;  2PME A;  2DXB A;  2M51 A;  5I11 A;  1RAB B;  2DMO A;  3M5A A;  3NTI A;  5LJ3 f;  3S6W A;  4ZGJ B;  1C6V X;  1WJS A;  5KYN A;  3EG1 A;  2A36 A;  2RHX A;  2DBK A;  1UB4 A;  3A5Z A;  2QHS A;  1VQO A;  3C12 A;  2JXB A;  5FLX E;  2L3Q A;  1VQM A;  4EMH A;  4KRT A;  1VQ9 Q;  1HTT A;  5K1X A;  3OYA A;  4YRN A;  4YRJ A;  3OMG A;  1X56 A;  3PGG A;  4F16 A;  4N0A C;  4JUV A;  4M78 G;  2K9G A;  3MF2 A;  2Q7E A;  1YJW Q;  2SRC A;  1TWB A;  5D7U A;  2P4R A;  2KRS A;  3A31 A;  3VQV A;  4KUI A;  3S3O A;  1MV0 B;  2ZCF B;  2ZIM A;  3QHS A;  2DLP A;  2L3R A;  3QYG B;  1IB8 A;  4M78 F;  1TUC A;  2JM9 A;  2X9H A;  3HRS A;  4FIB A;  2KXC A;  1NYF A;  2RHZ A;  1VIE A;  2LX7 A;  2AZV A;  3Q1J A;  1S72 Q;  3MP1 A;  2DRK A;  1Y96 B;  4M7D C;  3CC4 T;  1U1S A;  2F2X A;  4A54 A;  2XI9 A;  3CCJ Q;  4LXC A;  2CJB A;  3TRE A;  4C5E A;  1GCP A;  2RHI A;  2HBW A;  1BI0 A;  3OYY A;  1N8R C;  2QGG A;  1GBR A;  4AT1 B;  2EW3 A;  4P74 C;  4OB2 B;  3I55 T;  3F70 A;  2JT4 A;  1UEC A;  4X5O A;  5CO7 A;  3FB9 A;  1UTI A;  3MEA A;  1VQ7 T;  1ZHI A;  2JMA A;  4YRL A;  5GAO r;  3OYN A;  2SEM A;  3OS2 A;  1B34 A;  3SWN A;  5A0D A;  4R55 A;  1VQP A;  4ZN3 A;  3ME9 A;  1NJI U;  2DTO A;  3LGL A;  2QQ9 A;  4P72 C;  4J9G A;  1M8V A;  4CH3 A;  5FRO A;  1T3L A;  3CCL Q;  3TEH A;  4C8Q E;  1NPR A;  2RHS B;  2A37 A;  1KK7 A;  1RAC B;  3M4Q A;  2HD0 A;  1GFD A;  1N9W A;  3AT1 B;  2M0Y A;  3TUP A;  3EFR A;  4X9C A;  1QVF P;  4A4H A;  4VUB A;  2EYW A;  2AIR B;  5GAN e;  4EDU A;  1MHN A;  4PLI A;  2RH2 A;  5GJV B;  2ART A;  3L2W A;  3MP6 A;  1YB3 A;  2YUP A;  1H4Q A;  3T9N A;  3JCM Q;  4TVA A;  3S3N A;  4D6W A;  2QDY B;  2R58 A;  1OYX A;  5EG2 A;  3CC2 A;  1EIY A;  5A0L A;  1MV3 A;  3PTA A;  4F17 A;  1OI1 A;  2PU9 B;  3VS3 A;  4LVI A;  1FMK A;  2K6D A;  5DLO A;  2BZY A;  1J5W A;  1EQR A;  2QYZ A;  1X2K A;  3VV0 A;  2WSF E;  1JXM A;  1QF6 A;  1ZBJ A;  4OMO A;  3A7A A;  1FWZ A;  2FVU A;  1UG1 A;  1ZBX A;  2J3M A;  1YIJ Q;  4EO4 A;  1WHH A;  2JTM A;  3BDU A;  1NJ1 A;  1ZA1 B;  4MZM A;  4KH1 B;  4NL3 A;  2IG0 A;  5CK9 A;  3R6O A;  2ZXF A;  4M75 A;  4QT7 A;  3CC7 Q;  1IO6 A;  2DDZ A;  4Z88 A;  3RES A;  5GMK i;  2ZT6 A;  2BE7 D;  2WSE E;  2KYB A;  2PVO B;  4M77 D;  1WXB A;  2EQJ A;  2OAW A;  3P8B B;  1U8R A;  2ZZF A;  2F69 A;  3BW1 A;  2P0P A;  3M0T A;  2E12 A;  2KQW A;  1OU9 A;  4M77 B;  1PKT A;  2VC8 A;  2AMC A;  3RDV A;  2DER A;  2CP2 A;  4JZ4 A;  1C1A A;  2RF0 A;  2LQ8 A;  3ER0 A;  2ABL A;  3C4S A;  2ESW A;  4M7A E;  3HTZ A;  2E70 A;  3VRY A;  3VBB A;  2CT3 A;  3S3M A;  5CKH A;  5KH6 A;  1BI1 A;  2QA4 T;  1GXI E;  3LWI A;  1WIE A;  1XOV A;  3GF5 A;  4C0F A;  2HQH A;  4C92 E;  2CRE A;  1ABQ A;  4BDY A;  1VQK A;  5GMK l;  5KCH A;  4ORZ A;  2DIQ A;  2ZZG A;  1M2V A;  2D8H A;  4C8Q G;  3MHX A;  2DVJ A;  4HWS A;  1FYF A;  2YXY A;  2JNG A;  3HXZ A;  4OMN A;  1N8R R;  2R57 A;  4M7D F;  2XMF A;  4QVZ A;  12AS A;  1H3Z A;  1EFW A;  1YP5 A;  4ATO A;  2ZPF B;  4ESR A;  1YHQ T;  2DIG A;  4C8Q F;  2CZ0 B;  4M7D D;  2KNB B;  3QJY A;  2CP7 A;  3V8L A;  3FRN A;  2K3B A;  4GBQ A;  2KT8 A;  1G2B A;  5KYW A;  2I4L A;  3CCU A;  5L8R E;  4PKC C;  4MZP A;  1B07 A;  4M7D B;  3CBM A;  3KXT A;  2OAU A;  5GAM j;  1PYS A;  1SG5 A;  1NYR A;  4RQE A;  2ZPG B;  3HRU A;  2EFI A;  2XTI A;  1JRI A;  2YLC A;  3HXW A;  4O5V A;  4FYV B;  3I56 Q;  4BUG A;  4M4Z A;  1VYT A;  4OVA A;  2DF6 A;  2NUP B;  3L2R A;  3OW2 S;  1M90 R;  4M78 A;  1Z7M A;  2MAM A;  3PFS A;  1MNE A;  4TVY A;  1WHM A;  5LJ5 d;  3CPF A;  2DZC A;  3P8V A;  5E3I A;  3QSU A;  5LJ5 f;  2XK0 A;  3UDC A;  2XIC A;  5HK0 A;  5GAM e;  1UEB A;  2DET A;  4P5N A;  2HDA A;  2VYT A;  4RTV A;  3UFG A;  1M2O A;  3CCV Q;  1TS9 A;  3QUI A;  4OF1 A;  4YRS A;  1B7T A;  3FJP A;  1Y07 A;  4PK4 A;  4UPA A;  1SF9 A;  2GBQ A;  1YIT T;  4JS4 A;  1YN8 A;  2V1R A;  1K73 C;  2VKN A;  1OU8 A;  2PNI A;  4XU3 A;  2BE9 B;  5C53 B;  3CME A;  1M3A A;  2IIM A;  2O01 E;  3DB3 A;  4M7A G;  3TVT A;  3OYM A;  4P75 A;  4LVJ A;  1VQ9 A;  2MOX A;  2DRM A;  4J9I A;  4E7I A;  3H0I A;  3WQZ A;  2J05 A;  4PHC A;  2E10 A;  2KVQ G;  5I2M A;  1YJW A;  4H2V A;  5EC7 A;  2L5Q A;  2O31 A;  3M55 A;  4M7A F;  1RAD B;  1YFN A;  3CCS Q;  1I81 A;  1SRM A;  3CCR T;  4PJO E;  3RKX A;  4C92 G;  1AZE A;  1PCX A;  5LJ5 g;  3SFM A;  2XHC A;  1KIK A;  1GFC A;  1M5Q 1;  3EG9 A;  3A32 A;  1RIQ A;  4LUE A;  2GNC A;  3TU4 K;  1S72 A;  2EYX A;  4FSS A;  4C92 F;  2EYQ A;  2PTK A;  3QBY A;  3CCJ A;  1I0C A;  2JMC A;  3SD4 A;  4YCW A;  1QKX A;  3LC0 A;  2IPO B;  1BBW A;  1H4S A;  1EIF A;  5KYU A;  3MO8 A;  3JCM V;  1XNI A;  4M75 C;  4J9F A;  3QWY A;  5DY9 A;  2NUZ A;  3DLL A;  4LN2 A;  2RI5 A;  1W1F A;  3NMZ C;  1XJW B;  3GLX A;  3G1Z A;  4LD6 A;  2X4J A;  2G4C A;  2ED0 A;  5LJ5 h;  3EFS A;  3PE0 A;  4RG8 A;  4F7U B;  2YRD A;  3CPW S;  1YGB A;  5IHI A;  2LNH B;  3CMA T;  2H8H A;  1D1A A;  4E7L A;  1O75 A;  4Z8A A;  2C7I A;  1JO8 A;  4OB3 B;  4IUR A;  3QYH B;  1JU5 C;  1QQJ A;  2HBP A;  4A63 B;  3EGD B;  1DJ7 B;  2XU8 A;  3JCM b;  1PC0 A;  4JLG A;  5A0G A;  3CCL A;  5CQX A;  1OX9 A;  2ECZ A;  1LYL A;  4AFS C;  3M53 A;  2HCK A;  1XQH A;  2RN8 A;  3JV3 A;  1L0W A;  3OMC A;  2MWO A;  3QWX X;  4GY5 A;  3A8H B;  4KH0 B;  1SHG A;  2KAF A;  2DJZ A;  4JPB W;  2BKD N;  2J7I A;  4LVL A;  4NS5 A;  4HCZ A;  2CGH A;  3KFV A;  3OD1 A;  4HWP A;  1PWT A;  1FMV A;  2YUQ A;  1VQ5 T;  4BY6 C;  1SET A;  2O2O A;  5HCK A;  4QQD A;  2LX9 A;  2R5M A;  1VQ6 T;  3MPU B;  3UWN A;  3IAL A;  5FRM A;  2NUT B;  2X4W A;  3JB9 I;  3TSW A;  1G51 A;  2DL7 A;  2LVM A;  1ABO A;  3OSV A;  3NET A;  1ASY A;  1SRL A;  3VQY A;  2LMJ A;  4PJO G;  1YIJ A;  3JCM e;  3TSZ A;  1FXX A;  4YRR A;  1YJN T;  2ZNJ A;  3MEY A;  2MMP A;  1NYQ A;  1UGQ B;  1UGS B;  4FM4 B;  3G71 Q;  3CC7 A;  1WDX A;  3QO8 A;  1IGQ A;  4PJO F;  3G4S T;  1K73 R;  1IXD A;  2EIF A;  3CEY A;  1QVG S;  1B7Y B;  3RIR A;  1QWF A;  2QDL A;  4C8Q A;  2CUB A;  3AHU A;  1VQO T;  3X20 B;  2RI2 A;  2MIO A;  1WXU A;  2DM1 A;  2RA2 A;  3RL6 A;  1B34 B;  4P3O A;  1N9S A;  3TQ7 P;  1PM3 A;  1VQM T;  3HRK A;  3HRT A;  3RKW A;  4EMK C;  2IY5 A;  2A28 A;  3OS0 A;  1YI2 Q;  1YJ9 Q;  3M9Q A;  4K87 A;  4Q6G A;  2CP0 A;  3I5R A;  3ZBD A;  1SER A;  3JAM E;  2DQ3 A;  4HVU A;  3OB9 A;  1R0B G;  1X55 A;  1HSQ A;  9ATC B;  3J7A F;  4OMQ A;  2YT6 A;  1NG2 A;  3ZL7 C;  3H41 A;  3IKM B;  2VXF A;  2KXD A;  1TSF A;  5KYY B;  1KQ2 A;  5GAN 8;  3CCQ Q;  3NGP A;  1QCO A;  3QTC A;  3H0F A;  1C0M A;  3OYD A;  1G3T A;  4B9W A;  2QQR A;  1AHJ B;  4RDX A;  3QJ6 A;  2WAC A;  3MQZ A;  4HWT A;  2MCN A;  1ARK A;  4TWA A;  3VU3 C;  4FW2 A;  4J8O A;  2EYY A;  1NJ8 A;  5ECA A;  1Y7X A;  2CKK A;  1SSH A;  4J9D A;  1Y71 A;  4RKU E;  4RTW A;  5LJ3 j;  2D0Q B;  1HXD A;  2KBT A;  1Y57 A;  2CDT A;  1RL2 A;  1NLO C;  3I35 A;  3J80 E;  1FYN A;  4KUL A;  4MML A;  1UFF A;  3OYG A;  4OP0 A;  3KFU A;  2KRN A;  2JUF A;  2X51 A;  1UE9 A;  3V7S A;  4M75 B;  4ZGE B;  1E6H A;  4M7A A;  2Q7G A;  4LVK A;  2C0O A;  1V1C A;  1VQP T;  3HXY A;  2H3E B;  2XKO C;  2A7Y A;  1V76 A;  2J6O A;  4N4G A;  4YRF A;  4CS4 A;  1WQ7 A;  3PIO A;  5LJ3 e;  3ZEH A;  2QTV A;  4A4F A;  2X4X A;  2K79 A;  4C92 A;  2EVR A;  1YBY A;  5I22 A;  1ZA2 B;  1WLP B;  1NJ6 A;  2OTJ Q;  1GGM A;  3HSB A;  4P73 C;  2RQW A;  2KEA A;  1GL5 A;  4DBQ A;  2GCX A;  2ALY A;  2B8A A;  3OYB A;  1CKA A;  2M9U A;  4LD9 K;  4OB1 B;  3CC2 T;  4M77 E;  4AG2 C;  4HCK A;  4RCC A;  4LDV A;  2JJ9 A;  4NL2 A;  2L8D A;  5GMK m;  1VQL Q;  1X75 C;  5GJW B;  3PT9 A;  3UT1 A;  4Y28 E;  1W4S A;  1GRI A;  3CCS A;  1ZX6 A;  1VQZ A;  4OMM A;  5A2Q E;  2FRY A;  3INZ A;  4BY6 B;  5HKC A;  1GCQ C;  3U23 A;  3WXM B;  4J7F A;  1BYM A;  1VA7 A;  1EZZ B;  1TOV A;  1UJ0 A;  3GPL A;  4XU2 A;  1U3O A;  3L2Q A;  1MUZ A;  2ROL A;  2D8J A;  4RCB A;  4P3P A;  2E41 A;  3UGQ A;  4YRK A;  2VB6 A;  4J6Y A;  1R77 A;  1WI7 A;  4HWO A;  1KC8 C;  2HL5 C;  3HXX A;  1B70 A;  5KYX A;  2QHU A;  1KQS S;  4PNO A;  1OPK A;  5GAN j;  1IGU A;  4HVV A;  4RTX A;  1KFZ A;  1RAF B;  2P84 A;  1K8A C;  4M7D E;  1WNL A;  4H2X B;  2DBM A;  1T0J A;  4FU6 A;  2X3X D;  1VQK T;  2MWP A;  2MK5 A;  3HTR A;  2HNI A;  3EG0 A;  1MMD A;  2J6K A;  2K5I A;  3A7U A;  2VUB A;  4EMK B;  5IAY A;  2I4O A;  4JZ3 A;  3REB B;  3DLM A;  2C0I A;  3QII A;  1RAE B;  1E1T A;  1JEG A;  4MDW A;  4WI1 A;  1X27 A;  1OEB A;  1VQ4 Q;  4PJO A;  1N5Z A;  3QDF A;  1U1T A;  2EKH A;  1I4K 1;  3TEG A;  4FT2 A;  3DSQ A;  4YYE A;  2O9S A;  3JCM P;  2KR3 A;  4RMO A;  1N9R A;  1K73 U;  3EGX B;  3L4G B;  5DLQ E;  3UA6 A;  1E7O A;  4LE9 A;  2EJG A;  1YFR A;  2YRV A;  1NBE B;  2KI7 A;  3CCU T;  2KK4 A;  4HCC A;  2EKO A;  1EVL A;  4FYX B;  1ADJ A;  3O5Z A;  2XID A;  2HKQ B;  2ZIN A;  4M77 G;  4DPG A;  2JW4 A;  3EAE A;  4PG3 A;  1G3W A;  4N4I A;  4DEX A;  3JCM W;  2RD1 A;  2LT1 A;  1ZSZ A;  3CCE Q;  2LCC A;  1K0X A;  1Q81 U;  3MP8 A;  1W2B A;  2DQ0 A;  1W2B S;  3CBO A;  2DVE A;  2VWF A;  4M77 F;  2Q7H A;  4QVD A;  2CZ7 B;  4MZT A;  2GFA A;  3G6E Q;  3I5S A;  2AKK A;  5GAO l;  3JB9 J;  1M3C A;  1UGP B;  3EFO B;  4HXJ A;  4WJ4 A;  2BZ8 A;  3G71 A;  1JJC A;  2DNU A;  2CZ1 B;  1WU7 A;  1BIA A;  1M1F A;  4IUQ A;  4Y92 A;  2NWM A;  4JLI A;  4KR2 A;  1VQN Q;  4HA8 A;  2FB7 A;  1B3Q A;  1D0Z A;  1HD3 A;  1Y0M A;  2CT4 A;  5FRN A;  2YLB A;  3FIF A;  3CXC P;  3CME T;  3CMQ A;  3SHW A;  5GAN g;  1D1B A;  4A4E A;  2PZ1 A;  4YRC A;  2EGC A;  4BAC A;  5GAN 3;  1VQ9 T;  2XGT A;  4WCI A;  1LNX A;  1JJ2 S;  1M3B A;  3BFM A;  3PVQ A;  1YI2 A;  1YJ9 A;  3V7R A;  1IZ6 A;  2COW A;  3QNE A;  3EG2 A;  2DEQ A;  1WHL A;  2Q5I A;  4M7D G;  1AWX A;  4XTW A;  2QEX Q;  1X2H A;  2R5A A;  3FEO A;  1LPL A;  3QKJ A;  2DXT A;  3VS7 A;  1WQW A;  4UC4 A;  1HJD A;  4DA4 A;  1BKB A;  4WJ3 M;  4NCX A;  4A4G A;  4J9E A;  2FPE A;  2EQK A;  3G7Z A;  2RB6 A;  2D0N A;  3CCQ A;  1S72 T;  4J9C A;  4JRI A;  2HAX A;  4X9D A;  4HKE A;  2CH4 A;  4E7H A;  3CCJ T;  2GQV A;  2KT1 A;  2DTI A;  4CS3 A;  2CIM A;  3M0Q A;  3VKI A;  2DKG A;  1IHW A;  4CRI A;  1TU0 B;  3OYH A;  1KG1 A;  1YCS B;  2KE9 A;  1TG0 A;  4CC3 A;  2QAS A;  3VS4 A;  3BJU A;  2YWW A;  2I4N A;  3H8Z A;  3M0R A;  4ANJ A;  2EGA A;  3A1P A;  4TVW A;  2EQI A;  3M57 A;  2BTT A;  4F14 A;  2EAY A;  3PZC A;  3NEN A;  4JJC A;  4E7S A;  4RG2 A;  5C51 B;  2RJD A;  3VJP A;  3TCJ A;  4V2S A;  2ODR C;  1Y96 A;  5IHN A;  3A7R A;  3M56 A;  4H02 A;  1SSF A;  1WLE A;  4BI8 B;  2RHU A;  1HC7 A;  2JVV A;  3OW2 A;  1D0Y A;  2JOY A;  1NEG A;  5KE3 A;  5GAN 4;  2CP5 A;  2DL3 A;  2L89 A;  5ELO A;  3R6N A;  4DOW A;  1RAA B;  4O6J A;  1KMN A;  1SKU B;  3SWN C;  2RHQ B;  3CCL T;  2RM4 A;  4P71 A;  1Z9Z A;  5HGQ A;  1JB0 E;  3VS6 A;  4XQ3 A;  1M4Z A;  3GOX A;  2EYZ A;  1X01 A;  2M1H A;  2K5F A;  1D3B B;  2OTJ A;  1H8K A;  4FCY A;  2WSC E;  4J7I A;  3G4S Q;  3A5Y A;  1OUL A;  2O4X B;  1YFT A;  1C0A A;  2HQE A;  3SEM A;  2DK3 A;  2OTL Q;  1CKB A;  4PJN A;  3ASK A;  1IRE B;  4BWA A;  4JRK A;  4QQ6 A;  3M4G A;  4PFP A;  1LVK A;  4II1 A;  2M02 A;  2RHS A;  1LJO A;  6AT1 B;  1ZUK A;  1LOJ A;  3HP9 A;  3MEU A;  3OS5 A;  3MF1 A;  1Q81 C;  1VQL A;  8ATC B;  4C5I A;  2JN0 A;  5CIU A;  4O2D A;  3HRI A;  1M8M A;  4JJB A;  4AMC A;  3PIP A;  2PVD B;  1TUD A;  3CD6 Q;  1YIJ T;  4PFZ A;  5KNN A;  3M4Y A;  4YRG A;  5HY6 A;  1EVK A;  4NOY A;  1Z7N A;  4F7U G;  3JSC A;  3V8K A;  5IHK A;  3CC7 T;  3EG3 A;  3QPH A;  2ZT5 A;  1QWE A;  4PLL A;  4OLF A;  5GMK j;  3JCM J;  2H3J A;  1VQ8 Q;  1X2G A;  2OJ2 A;  4F7U F;  2BIV A;  5GAM g;  4Z02 A;  1TH7 A;  2ZPE B;  2AKW B;  2CS7 A;  4JDS A;  1R8O B;  5CCA A;  2QI2 A;  4HCB A;  2JM8 A;  3VQX A;  1VIF A;  4Q15 A;  4L87 A;  1I07 A;  2LNV A;  3P8H A;  2BUD A;  4IKF A;  1WGS A;  5FU6 C;  2AK5 A;  4PFO A;  1UUE A;  3CCM Q;  3P8D A;  3CPW A;  3G1J A;  4CH6 A;  1NPP A;  1UGR B;  1NJ2 A;  4MDX A;  2D1X A;  2K7A A;  3H6Z A;  3KUF A;  1QMC A;  5GMK e;  4M77 A;  2GFU A;  4HWR A;  3PNW C;  1M30 A;  3REX A;  3A5Z B;  3C94 A;  3J81 E;  2BZX A;  4BW9 A;  3MET A;  3QO3 A;  3JCM X;  2OX7 A;  2QK0 A;  5GAM h;  1YCY A;  2DPP B;  3M0S A;  1AWW A;  4LVM A;  2HL3 A;  1VQ4 A;  4EMG A;  3HL8 A;  1KHI A;  1H3H A;  1G5I A;  2RNA A;  3OYK A;  3M54 A;  1M1K C;  1W6X A;  1X2Q A;  3HFZ A;  3LGF A;  1D0X A;  4OGC A;  2M0O A;  2HKN A;  3EGU A;  1QVF A;  3UF4 A;  1QVF S;  2CP3 A;  4IIO A;  2COZ A;  4N0A A;  2E1H A;  1OQK A;  2ZR2 A;  5KE2 A;  1WJR A;  2FZC B;  3LH5 A;  1X6B A;  2L2P A;  2E3C A;  1WHG A;  2QQS A;  3CC2 Q;  2LRQ A;  2C06 A;  3QO7 A;  3PCO A;  2W0Z A;  2Z0W A;  3CCE A;  3RNJ A;  3X25 B;  3M58 A;  4HT9 A;  2FHD A;  2KSS A;  2ODR D;  4TVR A;  4DQ2 A;  2AHJ B;  4BB7 A;  3I9Q A;  1AOJ A;  3ZFJ A;  2DYI A;  2LQN A;  4RMF A;  3G6E A;  4M7D A;  1E6G A;  4OGE A;  3UAT A;  4KQE A;  4M78 C;  4YRI A;  1NLP C;  5K1P A;  1QVG A;  1X6G A;  2ARU A;  1M27 C;  4FT4 A;  1ADY A;  3P8T A;  2DAQ A;  3CC4 Q;  1AWJ A;  5F5W A;  1VQN A;  4K86 A;  4P74 A;  2DFU A;  2ZCE A;  3SWN B;  3HKS A;  3HY1 A;  2VV5 A;  1KC8 U;  2RHY A;  1Q81 R;  4C5G A;  4AFQ C;  2I2L A;  2CZ6 B;  3I55 Q;  5CKE A;  1UGV A;  3TEH B;  2K5L A;  1WXT A;  2E4H A;  2LJ3 A;  4YTL A;  3L2V A;  4UP8 A;  1PSF A;  2E64 A;  1VQ7 Q;  2PMF A;  2X3W D;  3HXU A;  1LCK A;  2F2V A;  2MF2 A;  4P75 C;  1K8A U;  3NEL A;  2E65 A;  2MPX C;  2CSQ A;  1AWO A;  4J15 A;  4P72 A;  3RKY A;  2DL5 A;  3CCS T;  2QEX A;  2ROT A;  4F04 B;  2NLU A;  3CXC S;  4QQG A;  1AT1 B;  2NYS A;  3FC3 A;  3X28 B;  5FU7 C;  4CC2 A;  4M75 G;  4ZTJ A;  4TVA B;  2CSI A;  4ZGD B;  1Q7Y C;  4YPF A;  1VQK Q;  4CC7 A;  4LDY A;  4ELZ C;  1WFW A;  1EIY B;  1T3S A;  2HSE B;  5GAN 7;  5CQY A;  3NTK A;  4M75 F;  4IUT A;  3LWH A;  3W3S A;  4BI3 A;  1KD1 U;  2CH4 W;  4OML A;  2GTJ A;  4Z89 A;  3GIB A;  1WYD A;  4M75 D;  1K1Z A;  2DEU A;  11AS A;  5L23 A;  5GAN 2;  4Y91 A;  3E9F A;  1O9S A;  4JS5 A;  2YUN A;  3URG A;  3OW2 P;  3UA7 A;  4LUD A;  3LSQ A;  4R0K A;  1J3T A;  2E5Q A;  4H2T A;  2IVW A;  2RQR A;  3NPF A;  3I56 A;  1K9M C;  2O9V A;  4L6V 5;  4E7J A;  1T0H A;  5GAO m;  1JJC B;  2ENM A;  2KRO A;  4AH6 A;  1JXO A;  1MMA A;  2YRC A;  1AD5 A;  1A0N B;  3JB9 H;  3QDR B;  3VS2 A;  2AMC B;  4KBM B;  4RTY A;  5FU6 B;  3RMS A;  3MCA B;  1OZ2 A;  1G3Y A;  4WF2 A;  3RUX A;  3RAC A;  2QGF B;  1QCF A;  3I7F A;  2HZY A;  1NE8 A;  1OZ3 A;  4YRT A;  4L5G A;  1FX7 A;  4QW2 A;  3CCV A;  4IUU A;  2K57 A;  1PHT A;  2HMA A;  2ZPB B;  3OBY A;  2LCL A;  3JB9 G;  4CS2 A;  3A8O B;  2L3S A;  2MI6 A;  2QQA A;  1ZUY A;  5LJ3 d;  2L0A A;  2KGT A;  2GF7 A;  4OB0 B;  1R0C B;  3G4S A;  1SEM A;  2RJE A;  5KCO A;  5I2S A;  4YRO A;  2OTL A;  2AT1 B;  2F5T X;  1KMM A;  1KHC A;  3VQW A;  3JB9 F;  1TTH B;  3EGD A;  1E24 A;  2DIL A;  2J06 A;  2KY9 A;  1M2V B;  3CME Q;  7AT1 B;  3ERR A;  4YRP A;  3JB9 D;  4TTV A;  4FYY B;  3LX7 A;  4X1V A;  3VUB A;  4PL6 A;  4K11 A;  2QA4 Q;  3FJ5 A;  2COY A;  3IKL A;  4XEO A;  4ELY C;  4BE0 A;  4CI0 C;  4J6W A;  3CD6 A;  2DX1 A;  2A0F B;  4XAX B;  3NEM A;  2QAZ A;  2QHT A;  4LDX A;  1F1B B;  3PMT A;  4EIK A;  5GAN 6;  1RAI B;  5GAO n;  5KYW B;  1TUG B;  2MYS A;  1ATI A;  2RO0 A;  3M0U A;  1ACM B;  3G71 T;  1PYS B;  3NFC A;  1G5H A;  1PRM C;  5CR2 A;  2NUT A;  1H4T A;  2FRW A;  5LJ3 g;  3HFV A;  4M78 D;  1PNJ A;  4UP9 A;  1VQ8 A;  4PJL A;  3BE3 A;  1YHQ Q;  1KQS A;  3LSS A;  1UHF A;  4XTZ A;  4B9X A;  4C8Q C;  4M78 B;  2EQM A;  4QKU A;  4KGX B;  3CPW P;  1OX8 A;  4C0Z A;  4HT4 A;  1GBQ A;  4B6M A;  2LQK A;  1YI2 T;  2KRM A;  3CCM A;  1YJ9 T;  2RJF A;  2CP6 A;  1KSW A; 
#chains in the Genus database with same CATH homology
 4XTV A;  1SRY A;  1P92 A;  4JRP A;  4J83 A;  1B7Y A;  4YCV A;  2QHV A;  5CKD A;  5LJ3 h;  3RER A;  1NNH A;  1SES A;  4H2Y A;  4FL6 A;  3CCQ T;  2ZT7 A;  3OY9 A;  4BI4 A;  2A3L A;  3L2U A;  2QQB A;  2P0K A;  1KD1 C;  5IN1 A;  1PSE A;  3LYI A;  5D6X A;  3OYC A;  1M90 C;  2D9T A;  3MEW A;  2ZNI A;  5FU7 B;  2FL7 A;  3UPU A;  5GAN d;  3JRZ A;  5GAN f;  1WPY A;  1BI2 A;  2ZT8 A;  4H2W A;  4H2S A;  4XEM A;  3OA6 A;  3FDR A;  3MEV A;  1Q86 C;  4H2U A;  2G3R A;  2LT4 A;  3LW5 E;  3E19 A;  1Q82 C;  5C52 B;  4E51 A;  2Y4X A;  3OYL A;  2FYK A;  4M7A C;  1WJQ A;  1H4V B;  2DTH A;  2PQW A;  1X6O A;  3E1S A;  2E5A A;  3P8Y A;  3A8L B;  2OTJ T;  1YFS A;  4XTX A;  3CC4 A;  3WVE B;  2I4M A;  4C92 C;  3L2Z A;  3PMI A;  3E9H A;  4ZTF A;  1USY A;  2ZR3 A;  5GAO p;  1JJ2 A;  3RGL A;  1G3S A;  1E22 A;  3I55 A;  2JTF A;  1YJW T;  4YP0 A;  4ZN1 A;  4UP7 A;  4J6X A;  4Q5W A;  1VQL T;  4TQF A;  1VQ7 A;  3SB2 A;  4LNS A;  2D6F A;  2P4T A;  3OYJ A;  4F7U E;  4BDZ A;  3OYF A;  3UGT A;  4TQD A;  3HFZ B;  2Y4Y A;  4IUV A;  5GAN h;  2Q5H A;  1KQ1 A;  3REU A;  3LLR A;  1V29 B;  5LJ5 j;  2EJ9 A;  1M1K U;  2ZTG A;  1QP3 A;  3C95 A;  3PCO B;  4A53 A;  4K88 A;  1IL2 A;  4P3N A;  4CH4 A;  2K3Y A;  2VGM A;  5ELN A;  3DKM A;  4L59 A;  4C8Q D;  3GNG A;  5I21 A;  4N4H A;  5LJ5 e;  1H64 1;  3HY0 A;  3QXE B;  3N5B B;  4C8Q B;  3BY7 A;  2RJC A;  1NJI C;  2P0L A;  2LC4 A;  5IT9 E;  1M1G A;  1BI3 A;  3QZ9 B;  3M4P A;  3E9I A;  2DU7 A;  3A8M B;  2K3X A;  3V7C A;  1VQ4 T;  5D6W A;  4R56 A;  2IY5 B;  3A74 A;  2KMT A;  2M16 A;  4MMK A;  1VUB A;  4C0D C;  3OS1 A;  1JBM A;  1NJ5 A;  4DOV A;  4PJO C;  4H2X A;  2KDS A;  3V8J A;  5GAM d;  1XTD A;  2EL9 A;  5GAM f;  1M9S A;  2K2V A;  2CJ9 A;  5HK3 A;  2XDP A;  3NTH A;  4EMK A;  3CBP A;  1I5L A;  2PVG B;  5D6Y A;  1I8F A;  4YRM A;  5CVI A;  1BIB A;  3CCE T;  2QA4 A;  1B8A A;  3VUZ A;  3L4G A;  4KR3 A;  3KBG A;  3G6E T;  2EJF A;  1Q7Y U;  1KOG A;  2RK1 A;  2DO3 A;  4M7A D;  4YRQ A;  5J26 A;  1QP2 A;  3SDZ A;  3HPW A;  1X54 A;  2ZPI B;  1VQN T;  5GAO q;  2RI3 A;  4M7A B;  2QXF A;  1YHQ A;  3LH0 A;  3RMQ A;  1MGQ A;  4LDW A;  4C92 D;  4RQF A;  4XU1 A;  3GP8 A;  1BBU A;  3OYE A;  4EX5 A;  2ZZD A;  4YCU A;  1N27 A;  4GLK A;  4IUP A;  1ASZ A;  4C92 B;  1USY C;  2ARS A;  2DU5 A;  2J3L A;  4JJN K;  1K9M U;  2YHT A;  4M75 E;  2QEX T;  3X24 B;  3FLG A;  3OBW A;  2ALY B;  3A8G B;  2E6N A;  3DB4 A;  5J3B A;  5CAI A;  3OYI A;  2K4Y A;  4XU0 A;  2F5K A;  2NS6 A;  2X35 A;  2DXC A;  3QO5 A;  3TEE A;  2XDB A;  4P73 A;  3L42 A;  1N6A A;  2PUO B;  4EPC A;  4QVC A;  2EWN A;  5GAN 5;  1YIT A;  3HFN A;  2HQX A;  2XG8 D;  2Y90 A;  2DXU A;  2JZ2 A;  3M59 A;  4KUD K;  3O8V A;  2EQU A;  2A8E A;  3X26 B;  4XTU A;  3VYH B;  3HFO A;  3I56 T;  5LL6 S;  2V8K A;  2RK2 A;  5C0M A;  1B76 A;  4ZTZ B;  2CJA A;  1RI0 A;  2LDM A;  4HVC A;  4JRQ A;  3CCR A;  2X4Y A;  4BD3 A;  2V8J A;  3QZ5 B;  2CYZ B;  1B70 B;  5AYF A;  3JCM d;  3L1A A;  3JCM f;  3CCV T;  4P71 C;  4OMF B;  4XTY A;  3HXV A;  1QE0 A;  3R07 A;  2V8I A;  1QVP A;  1W66 A;  2OTL T;  4KT0 E;  3HHT B;  4CH5 A;  2RHQ A;  4PJO D;  4LDU A;  1N8R U;  4C0D B;  5CKF A;  2VGN A;  4PJO B;  4M78 E;  2LTO A;  3GNF B;  4C0G A;  1D3B A;  3CXC A;  5GMK h;  3E9G A;  5J39 A;  4C5H A;  4G84 A;  4X34 A;  2O4X A;  3CD6 T;  3WVD B;  3BDL A;  2QTX A;  3CMA A;  4YRE A;  1EOV A;  4A4K A;  1HK9 A;  2VXE A;  5CKB A;  3JCM g;  2XD0 A;  2DD4 A;  4J5Y A;  4ZTU B;  1QW1 A;  2PUK B;  1G5V A;  4ME7 A;  3ICA A;  1ZQ1 A;  2C8M A;  1M90 U;  1VQ8 T;  5DM7 R;  3UH0 A;  2ZPH B;  2P0Q A;  2DZ9 A;  4XK8 E;  1VQ5 A;  2ZZE A;  4BE1 A;  3CCM T;  2P5I A;  1VQ6 A;  3JCM c;  4ZIB A;  1NZ9 A;  2E6Z A;  4E7K A;  3IG2 A;  3JCM h;  3QG1 A;  1Q86 U;  2ZIO A;  5C6S A;  4BE2 A;  1Q82 U;  1E1O A;  2AKW A;  4G85 A;  3OSS C;  4FSX A;  4M77 C;  4E47 A;  4HT8 A;  4YDQ A;  3RF1 A;  1YJN A;  3VYG A;  3OQ5 A;  2ZGW A;  2DD5 A;  2XDD A;  4F7U A;  5M9O A;  2PME A;  2DXB A;  3M5A A;  3NTI A;  5LJ3 f;  3S6W A;  4ZGJ B;  1WJS A;  2RHX A;  1UB4 A;  3A5Z A;  2QHS A;  1VQO A;  3C12 A;  5FLX E;  1VQM A;  4EMH A;  1HTT A;  5K1X A;  3OYA A;  4YRN A;  4YRJ A;  3OMG A;  1X56 A;  3PGG A;  4N0A C;  4JUV A;  4M78 G;  3MF2 A;  2Q7E A;  3A31 A;  3VQV A;  4KUI A;  3S3O A;  2ZCF B;  2ZIM A;  3QHS A;  2L3R A;  3QYG B;  4M78 F;  3HRS A;  4FIB A;  2RHZ A;  1VIE A;  3Q1J A;  3MP1 A;  1Y96 B;  4M7D C;  3CC4 T;  1U1S A;  4A54 A;  2XI9 A;  2CJB A;  3TRE A;  4C5E A;  2RHI A;  1BI0 A;  3OYY A;  1N8R C;  4P74 C;  4OB2 B;  3I55 T;  3F70 A;  4X5O A;  5CO7 A;  3FB9 A;  3MEA A;  1VQ7 T;  1ZHI A;  4YRL A;  5GAO r;  3OYN A;  3OS2 A;  1B34 A;  3SWN A;  5A0D A;  4R55 A;  1VQP A;  4ZN3 A;  3ME9 A;  1NJI U;  2DTO A;  3LGL A;  2QQ9 A;  4P72 C;  1M8V A;  4CH3 A;  5FRO A;  3TEH A;  4C8Q E;  1NPR A;  2RHS B;  3M4Q A;  2HD0 A;  1N9W A;  3TUP A;  3EFR A;  4X9C A;  4A4H A;  4VUB A;  5GAN e;  4EDU A;  1MHN A;  4PLI A;  2RH2 A;  2ART A;  3L2W A;  3MP6 A;  1YB3 A;  1H4Q A;  3T9N A;  3JCM Q;  4TVA A;  3S3N A;  4D6W A;  2QDY B;  2R58 A;  1OYX A;  5EG2 A;  3CC2 A;  1EIY A;  5A0L A;  3PTA A;  1OI1 A;  2PU9 B;  4LVI A;  5DLO A;  1J5W A;  1EQR A;  3VV0 A;  2WSF E;  1QF6 A;  3A7A A;  1FWZ A;  2FVU A;  1ZBX A;  2J3M A;  4EO4 A;  2JTM A;  3BDU A;  1NJ1 A;  4MZM A;  4NL3 A;  2IG0 A;  5CK9 A;  3R6O A;  2ZXF A;  4M75 A;  2DDZ A;  3RES A;  5GMK i;  2ZT6 A;  2WSE E;  2PVO B;  4M77 D;  2EQJ A;  3P8B B;  1U8R A;  2ZZF A;  2F69 A;  3BW1 A;  2P0P A;  2E12 A;  2KQW A;  4M77 B;  2VC8 A;  2AMC A;  2LQ8 A;  3ER0 A;  3C4S A;  4M7A E;  3HTZ A;  2E70 A;  3VBB A;  3S3M A;  5CKH A;  5KH6 A;  1BI1 A;  2QA4 T;  1GXI E;  3LWI A;  1XOV A;  3GF5 A;  4C0F A;  4C92 E;  4BDY A;  1VQK A;  5GMK l;  5KCH A;  2DIQ A;  2ZZG A;  4C8Q G;  3MHX A;  4HWS A;  1FYF A;  2JNG A;  3HXZ A;  2R57 A;  4M7D F;  4QVZ A;  12AS A;  1H3Z A;  1EFW A;  4ATO A;  2ZPF B;  1YHQ T;  2DIG A;  4C8Q F;  2CZ0 B;  4M7D D;  3QJY A;  3V8L A;  3FRN A;  2I4L A;  3CCU A;  5L8R E;  4PKC C;  4MZP A;  4M7D B;  3CBM A;  3KXT A;  2OAU A;  5GAM j;  1PYS A;  1NYR A;  4RQE A;  2ZPG B;  3HRU A;  2EFI A;  2XTI A;  1JRI A;  2YLC A;  3HXW A;  4O5V A;  4BUG A;  4OVA A;  3L2R A;  3OW2 S;  4M78 A;  1Z7M A;  2MAM A;  3PFS A;  4TVY A;  5LJ5 d;  3CPF A;  2DZC A;  3P8V A;  5E3I A;  3QSU A;  5LJ5 f;  2XK0 A;  3UDC A;  2XIC A;  5HK0 A;  5GAM e;  1UEB A;  4P5N A;  2VYT A;  3UFG A;  3QUI A;  4OF1 A;  4YRS A;  3FJP A;  1Y07 A;  4UPA A;  1YIT T;  4JS4 A;  1K73 C;  4XU3 A;  5C53 B;  3CME A;  2O01 E;  3DB3 A;  4M7A G;  3OYM A;  4P75 A;  4LVJ A;  1VQ9 A;  4E7I A;  3WQZ A;  4PHC A;  2E10 A;  2KVQ G;  5I2M A;  1YJW A;  4H2V A;  2L5Q A;  3M55 A;  4M7A F;  1I81 A;  3CCR T;  4PJO E;  3RKX A;  4C92 G;  5LJ5 g;  3SFM A;  2XHC A;  1M5Q 1;  3A32 A;  1RIQ A;  3TU4 K;  1S72 A;  4C92 F;  2EYQ A;  3QBY A;  3CCJ A;  4YCW A;  3SD4 A;  3LC0 A;  1BBW A;  1H4S A;  1EIF A;  3MO8 A;  3JCM V;  1XNI A;  4M75 C;  5DY9 A;  3DLL A;  2RI5 A;  3GLX A;  3G1Z A;  4LD6 A;  2X4J A;  2G4C A;  5LJ5 h;  3EFS A;  4RG8 A;  4F7U B;  3CPW S;  1YGB A;  3CMA T;  4E7L A;  1O75 A;  2C7I A;  4OB3 B;  4IUR A;  3QYH B;  2HBP A;  1DJ7 B;  2XU8 A;  3JCM b;  4JLG A;  5A0G A;  3CCL A;  5CQX A;  1LYL A;  3M53 A;  1XQH A;  1L0W A;  3OMC A;  2MWO A;  4GY5 A;  3A8H B;  2KAF A;  2DJZ A;  2BKD N;  4LVL A;  4NS5 A;  4HCZ A;  2CGH A;  3OD1 A;  4HWP A;  1VQ5 T;  4BY6 C;  1SET A;  4QQD A;  2LX9 A;  2R5M A;  1VQ6 T;  3UWN A;  3IAL A;  5FRM A;  2X4W A;  3JB9 I;  1G51 A;  2LVM A;  3OSV A;  3NET A;  1ASY A;  3VQY A;  4PJO G;  1YIJ A;  3JCM e;  1FXX A;  4YRR A;  1YJN T;  2ZNJ A;  3MEY A;  2MMP A;  1NYQ A;  1UGQ B;  1UGS B;  4FM4 B;  3CC7 A;  3QO8 A;  4PJO F;  3G4S T;  2EIF A;  3CEY A;  1QVG S;  1B7Y B;  3RIR A;  4C8Q A;  3AHU A;  1VQO T;  3X20 B;  2RI2 A;  2RA2 A;  3RL6 A;  1B34 B;  4P3O A;  1N9S A;  1VQM T;  3HRK A;  3HRT A;  3RKW A;  4EMK C;  2IY5 A;  3OS0 A;  3M9Q A;  4K87 A;  4Q6G A;  3ZBD A;  1SER A;  3JAM E;  2DQ3 A;  3OB9 A;  1X55 A;  3J7A F;  3IKM B;  2VXF A;  1KQ2 A;  5GAN 8;  3QTC A;  3OYD A;  1G3T A;  4B9W A;  2QQR A;  1AHJ B;  4RDX A;  3QJ6 A;  2WAC A;  3MQZ A;  4HWT A;  4TWA A;  3VU3 C;  4J8O A;  1NJ8 A;  1Y7X A;  2CKK A;  4RKU E;  1Y71 A;  5LJ3 j;  2D0Q B;  1HXD A;  1RL2 A;  3J80 E;  4KUL A;  4MML A;  3OYG A;  4OP0 A;  3KFU A;  2JUF A;  3V7S A;  4M75 B;  4ZGE B;  2Q7G A;  4M7A A;  4LVK A;  1VQP T;  3HXY A;  2XKO C;  2A7Y A;  4N4G A;  4YRF A;  4CS4 A;  1WQ7 A;  3PIO A;  5LJ3 e;  3ZEH A;  4A4F A;  2X4X A;  4C92 A;  1YBY A;  1NJ6 A;  1GGM A;  3HSB A;  4P73 C;  2GCX A;  2ALY A;  2B8A A;  3OYB A;  2M9U A;  4LD9 K;  4OB1 B;  3CC2 T;  4M77 E;  4RCC A;  4LDV A;  4NL2 A;  2L8D A;  5GMK m;  1X75 C;  3PT9 A;  3UT1 A;  4Y28 E;  1W4S A;  3CCS A;  1VQZ A;  5A2Q E;  3INZ A;  4BY6 B;  5HKC A;  3WXM B;  4J7F A;  1BYM A;  3GPL A;  4XU2 A;  3L2Q A;  4RCB A;  4P3P A;  2E41 A;  3UGQ A;  4YRK A;  4J6Y A;  4HWO A;  1KC8 C;  3HXX A;  1B70 A;  2QHU A;  1KQS S;  4PNO A;  5GAN j;  1K8A C;  4M7D E;  1WNL A;  4H2X B;  4FU6 A;  1VQK T;  2MWP A;  2HNI A;  2K5I A;  3A7U A;  2VUB A;  4EMK B;  5IAY A;  2I4O A;  3DLM A;  3QII A;  1E1T A;  4MDW A;  4WI1 A;  4PJO A;  1U1T A;  1I4K 1;  3TEG A;  4FT2 A;  3DSQ A;  4YYE A;  3JCM P;  4RMO A;  1N9R A;  1K73 U;  3L4G B;  5DLQ E;  1YFR A;  2EJG A;  2YRV A;  3CCU T;  2KK4 A;  4HCC A;  2EKO A;  1EVL A;  1ADJ A;  2XID A;  2ZIN A;  4M77 G;  4DPG A;  3EAE A;  4PG3 A;  1G3W A;  4N4I A;  3JCM W;  2RD1 A;  2LT1 A;  2LCC A;  1Q81 U;  3MP8 A;  1W2B A;  2DQ0 A;  1W2B S;  3CBO A;  2DVE A;  4M77 F;  2Q7H A;  4QVD A;  2CZ7 B;  4MZT A;  2GFA A;  5GAO l;  3JB9 J;  1UGP B;  4WJ4 A;  3G71 A;  1JJC A;  2CZ1 B;  1WU7 A;  1M1F A;  1BIA A;  4IUQ A;  4JLI A;  4KR2 A;  4HA8 A;  2FB7 A;  5FRN A;  2YLB A;  3FIF A;  3CME T;  3CMQ A;  5GAN g;  4YRC A;  4A4E A;  4BAC A;  5GAN 3;  1VQ9 T;  2XGT A;  1LNX A;  1JJ2 S;  3BFM A;  1YI2 A;  1YJ9 A;  3V7R A;  1IZ6 A;  3QNE A;  2DEQ A;  2Q5I A;  4M7D G;  4XTW A;  1X2H A;  2R5A A;  3FEO A;  3QKJ A;  2DXT A;  1WQW A;  4UC4 A;  4DA4 A;  1BKB A;  4WJ3 M;  4NCX A;  4A4G A;  2EQK A;  3G7Z A;  2RB6 A;  3CCQ A;  1S72 T;  4JRI A;  2HAX A;  4X9D A;  4HKE A;  4E7H A;  3CCJ T;  2GQV A;  2DTI A;  4CS3 A;  2CIM A;  3VKI A;  2DKG A;  4CRI A;  3OYH A;  1KG1 A;  3BJU A;  2I4N A;  3H8Z A;  4TVW A;  3M57 A;  2EAY A;  3PZC A;  3NEN A;  4RG2 A;  5C51 B;  2RJD A;  3VJP A;  3TCJ A;  4V2S A;  2ODR C;  1Y96 A;  3A7R A;  3M56 A;  4H02 A;  1SSF A;  1WLE A;  4BI8 B;  2RHU A;  1HC7 A;  2JVV A;  3OW2 A;  2JOY A;  5KE3 A;  5GAN 4;  2L89 A;  5ELO A;  4DOW A;  4O6J A;  1KMN A;  3SWN C;  2RHQ B;  3CCL T;  2RM4 A;  4P71 A;  5HGQ A;  1JB0 E;  4XQ3 A;  1M4Z A;  3GOX A;  1X01 A;  2M1H A;  2K5F A;  1D3B B;  2OTJ A;  2WSC E;  4J7I A;  3A5Y A;  2O4X B;  1YFT A;  1C0A A;  2HQE A;  2DK3 A;  3ASK A;  1IRE B;  4BWA A;  4JRK A;  4QQ6 A;  3M4G A;  4II1 A;  2RHS A;  1LJO A;  1LOJ A;  3HP9 A;  3MEU A;  3OS5 A;  3MF1 A;  1Q81 C;  1VQL A;  4C5I A;  2JN0 A;  5CIU A;  4O2D A;  3HRI A;  3PIP A;  2PVD B;  1YIJ T;  5KNN A;  3M4Y A;  4YRG A;  5HY6 A;  1EVK A;  4NOY A;  1Z7N A;  4F7U G;  3JSC A;  3V8K A;  3CC7 T;  3QPH A;  2ZT5 A;  4PLL A;  4OLF A;  5GMK j;  3JCM J;  2H3J A;  1X2G A;  4F7U F;  2BIV A;  5GAM g;  4Z02 A;  1TH7 A;  2ZPE B;  2AKW B;  2CS7 A;  4JDS A;  1R8O B;  5CCA A;  2QI2 A;  4HCB A;  3VQX A;  1VIF A;  4Q15 A;  4L87 A;  2LNV A;  3P8H A;  2BUD A;  4IKF A;  1WGS A;  5FU6 C;  3P8D A;  3CPW A;  4CH6 A;  1NPP A;  1UGR B;  1NJ2 A;  4MDX A;  3H6Z A;  3KUF A;  5GMK e;  4M77 A;  2GFU A;  4HWR A;  3PNW C;  3REX A;  3A5Z B;  3C94 A;  3J81 E;  4BW9 A;  3MET A;  3QO3 A;  3JCM X;  5GAM h;  1YCY A;  2DPP B;  4LVM A;  1VQ4 A;  4EMG A;  3HL8 A;  1KHI A;  1G5I A;  3OYK A;  3M54 A;  1M1K C;  3HFZ A;  3LGF A;  4OGC A;  2M0O A;  1QVF A;  1QVF S;  4N0A A;  2E1H A;  2ZR2 A;  5KE2 A;  1WJR A;  2E3C A;  2QQS A;  2LRQ A;  2C06 A;  3QO7 A;  3PCO A;  3CCE A;  3X25 B;  3M58 A;  4HT9 A;  2FHD A;  2KSS A;  2ODR D;  4TVR A;  4DQ2 A;  2AHJ B;  4BB7 A;  3ZFJ A;  4RMF A;  3G6E A;  4M7D A;  4OGE A;  4KQE A;  4M78 C;  4YRI A;  5K1P A;  1QVG A;  2ARU A;  4FT4 A;  1ADY A;  3P8T A;  2DAQ A;  5F5W A;  1VQN A;  4K86 A;  4P74 A;  2ZCE A;  3SWN B;  3HKS A;  3HY1 A;  2VV5 A;  1KC8 U;  2RHY A;  4C5G A;  2I2L A;  2CZ6 B;  5CKE A;  3TEH B;  2K5L A;  4YTL A;  3L2V A;  4UP8 A;  1PSF A;  2E64 A;  2PMF A;  3HXU A;  2MF2 A;  4P75 C;  1K8A U;  3NEL A;  2E65 A;  4J15 A;  4P72 A;  3RKY A;  3CCS T;  2QEX A;  2NLU A;  3CXC S;  4QQG A;  3FC3 A;  3X28 B;  5FU7 C;  4M75 G;  4ZTJ A;  4TVA B;  4ZGD B;  1Q7Y C;  4YPF A;  4LDY A;  4ELZ C;  1EIY B;  5GAN 7;  5CQY A;  3NTK A;  4M75 F;  4IUT A;  3LWH A;  3W3S A;  4BI3 A;  1KD1 U;  3GIB A;  1WYD A;  4M75 D;  11AS A;  5GAN 2;  4Y91 A;  3E9F A;  1O9S A;  4JS5 A;  3URG A;  3LSQ A;  2E5Q A;  4H2T A;  2IVW A;  3I56 A;  1K9M C;  4L6V 5;  4E7J A;  5GAO m;  1JJC B;  4AH6 A;  3JB9 H;  3QDR B;  2AMC B;  4KBM B;  5FU6 B;  3RMS A;  3MCA B;  1OZ2 A;  1G3Y A;  4WF2 A;  3RUX A;  3RAC A;  3I7F A;  1NE8 A;  1OZ3 A;  4YRT A;  4L5G A;  1FX7 A;  4QW2 A;  3CCV A;  4IUU A;  2K57 A;  2ZPB B;  3OBY A;  2LCL A;  3JB9 G;  4CS2 A;  3A8O B;  2MI6 A;  2QQA A;  5LJ3 d;  2GF7 A;  4OB0 B;  3G4S A;  2RJE A;  5KCO A;  5I2S A;  4YRO A;  2OTL A;  2F5T X;  1KMM A;  1KHC A;  3VQW A;  3JB9 F;  1E24 A;  2KY9 A;  3ERR A;  4YRP A;  3JB9 D;  4TTV A;  3LX7 A;  3VUB A;  4PL6 A;  3IKL A;  4XEO A;  4ELY C;  4BE0 A;  4CI0 C;  4J6W A;  3CD6 A;  4XAX B;  3NEM A;  2QHT A;  4LDX A;  3PMT A;  5GAN 6;  5GAO n;  1ATI A;  2RO0 A;  3G71 T;  1PYS B;  3NFC A;  1G5H A;  5CR2 A;  1H4T A;  5LJ3 g;  3HFV A;  4M78 D;  4UP9 A;  1VQ8 A;  1KQS A;  3LSS A;  4XTZ A;  4B9X A;  4C8Q C;  4M78 B;  2EQM A;  4C0Z A;  4HT4 A;  2LQK A;  1YI2 T;  1YJ9 T;  3CCM A;  2RJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...