2CGHA

Crystal structure of biotin ligase from mycobacterium tuberculosis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
238
Chain Sequence
b'RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOTIN LIGASE
publication title Active Site Conformational Changes Upon Reaction Intermediate Biotinyl-5'-AMP Binding in Biotin Protein Ligase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 82
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cghA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2cghA01
1BBWA 3E9IA 5GANg 4YCVA 3A7RA 1LJOA 4M7DC 1YFTA 1H4VB 4H2XA 4C8QA 1JBMA 4RCCA 3RL6A 4TVWA 4G85A 4P3OA 3SWNB 4YRFA 1ADJA 2ZT8A 5LJ3d 3EFSA 4M7AD 3RIRA 3JCMg 1PYSB 3R07A 1WU7A 5GANd 4N0AC 3QO5A 2E65A 5LJ5d 3EFRA 4YRKA 2DKGA 1E24A 4WF2A 2ZR2A 4HWOA 1YCYA 4PJOE 1IL2A 2PMFA 2Y90A 1KQ1A 2E64A 1HXDA 1X56A 4WJ4A 3HSBA 1YB3A 3AHUA 1X2HA 4NL2A 3RKXA 4JUVA 3JCMd 4PJOD 4CS3A 4YRMA 2AMCB 1EFWA 5DY9A 4XTZA 4M78B 4YRRA 4TQDA 3V7RA 4TVYA 1JJCA 3JB9D 4UP7A 5GAMh 1QE0A 3JCMQ 1U1SA 2J3LA 4DQ2A 3NEMA 2IY5A 3HFZA 5I21A 1KOGA 2I4MA 4HT9A 2ZIMA 2DJZA 1I5LA 3LC0A 4C92F 2ZINA 4M78E 5GAOm 4M77G 4JRKA 4TTVA 4CH6A 3P8YA 5F5WA 3MF2A 4RQEA 4M78D 5GMKe 2DXTA 1B70B 1ASZA 2DVEA 2ZTGA 2CIMA 11ASA 2RHSA 1ADYA 3REXA 2ZZFA 4X5OA 4J6WA 2ARTA 1H641 3MF1A 3NETA 2DTHA 4P71A 2FB7A 4O2DA 4YRJA 4C8QC 1KQ2A 3VQWA 4M7AA 5C52B 5ELNA 4E51A 4H2VA 4CH4A 5C53B 4EMKC 2AKWA 4YRQA 4HWPA 5ELOA 1TH7A 4NCXA 2ZNJA 2I2LA 4F7UA 2YLBA 4M77B 4J6YA 4LNSA 4M75E 4WI1A 1NYRA 2EWNA 1KMNA 3P8VA 4A53A 1EQRA 1D3BB 1H4QA 3VQYA 1E1TA 3JCMb 4RQFA 4P74A 2E41A 1Y96B 4M75D 1NJ1A 5GAN6 2QTXA 4G84A 3QO7A 4PJOG 1E22A 1NJ5A 4XU0A 1PYSA 4C92E 5GMKm 4NOYA 4V2SA 4K87A 2DXUA 2PMEA 2RM4A 1RIQA 3A32A 3JB9G 1X55A 3I7FA 2ZT6A 1BIBA 1SERA 4YROA 2DEQA 5LJ3g 2ZNIA 1I8FA 2ODRC 3RKYA 5HGQA 1H4TA 4UPAA 3KFUA 5LJ5g 3IKMB 2AMCA 4PNOA 4M7DE 3V8JA 4PJOB 4ZIBA 3JCMX 5GAOq 4Q15A 3PCOA 4YREA 4M78G 2CJAA 2XTIA 2ALYB 4M7DD 1NJ6A 3V7SA 2DZCA 2C7IA 2EL9A 5K1PA 5KNNA 2YLCA 3NENA 3V8LA 5C51B 3UH0A 1ASYA 1WYDA 3QTCA 4KQEA 4P71C 2E1HA 5GAMg 4H2SA 4RDXA 2RHQB 4M7AC 5GAN3 1EOVA 4C8QF 4H2TA 4H2YA 1HK9A 4XTYA 1B34B 4HWRA 4K88A 1Z7MA 1M5Q1 3RF1A 1N9SA 2ZGWA 4OP0A 1ATIA 4YPFA 3M4GA 1HTTA 3RKWA 4P75A 5GAMd 4M75G 3L4GB 4TWAA 4XTWA 2Q7GA 3L1AA 3BW1A 5GMKh 3HFNA 4ZTUB 2ZZGA 3UFGA 2K57A 1NNHA 2ZT7A 5GMKi 2RD1A 1WLEA 2QHSA 1H4SA 4M77A 5LJ3e 2FYKA 4X9CA 3JCMP 2E5AA 3QUIA 3HY1A 3VQXA 4H2XB 1G51A 2I4LA 3JCMJ 4C92G 3DSQA 4JLIA 5GANe 5GAN7 5LJ5e 3QO8A 2EJFA 3UGTA 1QF6A 4EMKB 1Y96A 4HT8A 3HXWA 3VBBA 4K86A 2RB6A 4XTXA 5E3IA 1HC7A 4P72A 2P0LA 4M75B 4H2UA 1SETA 2DU5A 3GIBA 5K1XA 5GMKj 4EMGA 1X54A 3RACA 1U1TA 4M77F 2DU7A 1SRYA 4YYEA 3JCMe 2ZXFA 2E10A 4C8QE 1LYLA 3A7AA 4M7DG 4AH6A 3BJUA 1B7YB 4KR2A 2DQ0A 1W66A 5GAN2 5GAOn 4C92B 3A7UA 2VXFA 4QVCA 1G5IA 2ARUA 3IKLA 3BFMA 3ICAA 1EIYB 1JJCB 3VU3C 4CH5A 1X01A 4XQ3A 4PJOA 4M7AF 4YRNA 5GAOp 5GAOr 3SWNA 3V7CA 4RMFA 1L0WA 1NYQA 4KR3A 4X9DA 2ALYA 4EX5A 3HFVA 4F7UF 2G4CA 3IALA 4M7DB 2EJGA 2I4OA 4ZTZB 4P3PA 4P75C 3RERA 2EAYA 1BIAA 4YP0A 4C92D 3JCMf 3BDUA 4PJOF 4A54A 1NJ8A 4OLFA 1B76A 2QHUA 1GGMA 2QHVA 1N9RA 3JCMW 4EMHA 3HXXA 1B34A 4M77C 4HVCA 3FIFA 3BY7A 3JB9F 2ODRD 2DZ9A 4YRTA 4M78A 5CAIA 4YCUA 2ZT5A 2Q5HA 1J5WA 3G1ZA 3L4GA 2EJ9A 5GMKl 3HXVA 4HA8A 2AKWB 2I4NA 4PG3A 4WJ3M 3QSUA 1WQWA 4XU2A 4P72C 4YCWA 1M8VA 3L2ZA 1N9WA 4YRPA 1I4K1 4XU3A 4BW9A 4YRIA 4P73A 3PGGA 3A5ZA 3TEHB 4NL3A 3LSQA 1LOJA 4M78F 4Q6GA 2ZIOA 4M7AE 2HNIA 3A74A 3JCMV 2Q5IA 4J5YA 4C8QG 3OD1A 4EMKA 3WQZA 1MGQA 1B70A 1WQ7A 4HWTA 4F7UE 5LJ3h 2DQ3A 4M75A 3QNEA 2XGTA 4H02A 4YRSA 1I81A 4P3NA 4P74C 4TVAB 4PJOC 5GANh 5LJ5h 3MEYA 3JB9J 3FJPA 1SESA 1YGBA 3SWNC 1USYA 1YFRA 2P5IA 4HWSA 1Z7NA 4YDQA 4YRCA 1X2GA 1B7YA 4L87A 5GAN4 2E3CA 3ERRA 2ZZEA 1EVKA 1KMMA 3A5YA 1LNXA 3HRKA 3PZCA 3RESA 4C92A 4M75F 3JCMh 1EVLA 4XTVA 4C8QB 1D3BA 2JN0A 3PCOB 1EIYA 2C8MA 4YRGA 4H2WA 5GAN5 5LJ3j 3V8KA 3HTZA 3HY0A 3NELA 4Y91A 2CJBA 3IG2A 4CS2A 3RGLA 5GANj 2DDZA 1JRIA 5LJ5j 4XU1A 3W3SA 3TEGA 4J15A 2DTIA 4M78C 4M7DA 4XEOA 2ARSA 2Q7HA 4PHCA 3E9HA 3HFOA 4XEMA 1WPYA 4EO4A 2YHTA 4BWAA 1G5HA 3INZA 3JB9H 4CH3A 5GAMe 4C8QD 5GAOl 3M4PA 3QHSA 3HXZA 4P73C 3HXYA 2QHTA 3RUXA 4N0AA 5GAMj 1E1OA 5LJ3f 4M7DF 4TQFA 4QVDA 2J3MA 1VQZA 2ZR3A 4UP8A 3REUA 2Q7EA 1FYFA 5GANf 5LJ5f 2IY5B 4M7AG 1C0AA 3CMQA 3HFZB 3VQVA 3M4QA 4M75C 4MMLA 3SB2A 2ZCEA 4DPGA 4XTUA 4F7UG 2VXEA 3QO3A 1WNLA 3TEHA 1BBUA 3HXUA 3JCMc 2RHQA 3HRIA 1USYC 1YFSA 5GAN8 4RCBA 4CS4A 4YRLA 1B8AA 2CJ9A 2RHSB 3A31A 2RA2A 12ASA 1NJ2A 3LSSA 3TUPA 5GAMf 4MMKA 2CGHA 4C92C 2DTOA 4J6XA 4M77E 3FB9A 3P8TA 4M7AB 2VC8A 4JRIA 4TVAA 3UGQA 4M77D 4UP9A 3JB9I 4F7UB
chains in the Genus database with same CATH superfamily
1RL2A 2DLPA 1BBWA 4C0FA 4WTOB 5IXFA 5GANg 2PNIA 5J26A 3A7RA 2D8JA 1H4VB 3NMZC 3RL6A 4ZNXA 4X34A 5CIUA 5AYFA 1ADJA 4JRQA 5LJ3d 1M3AA 1RADB 2VGMA 3OYMA 1X43A 4RTUA 1PNJA 3EG9A 3R07A 3VS3A 1WU7A 4J9IA 4OMLA 4Z02A 2IIMA 4B9WA 3J81E 1IREB 1MHNA 2DK3A 2EYWA 1Q82C 2KROA 4C0GA 3CCLA 3TEEA 2E64A 4IKFA 4A4GA 3CCJT 4WJ4A 3MJXA 5CKBA 1WJSA 3JAME 4HCCA 4PJOD 1X2HA 5CKHA 4DBQA 5DY9A 2NUTB 3OYBA 1KC8R 2OTLQ 3A8OB 1MNEA 4QT7A 2D9TA 1VQLQ 4QQDA 1TSFA 3JB9D 2ED1A 2NUPB 5GAMh 1M2OA 1QE0A 2RQWA 3A98A 1CKBA 3M0RA 3X28B 1QVFP 3HFZA 3L2QA 1KOGA 2I4MA 4DEXA 1JB0E 1Q81U 4M78E 2KRMA 5IHNA 4PJNA 3GPLA 1AHJB 3HRUA 5F5WA 2X4XA 3MF2A 4Z88A 5GMKe 1ASZA 2W0ZA 1B70B 3MEWA 3REXA 1WHMA 1X6GA 1Y7XA 3O8VA 1H641 3MF1A 4JPBW 2FB7A 4YRJA 1ZUUA 1KQ2A 2RJFA 4M7AA 4A4HA 1BK2A 1OZ2A 4H2VA 1YJWA 2LJ3A 2ECZA 2V1QA 2MOXA 4RMOA 2AKWA 5ELOA 1Q7YC 2QEXT 2I2LA 4F7UA 4M77B 3M0SA 4LNSA 4M75E 2KVQG 1NYRA 2EWNA 6AT1B 4A53A 2YRDA 2COYA 3VQYA 1WIEA 3JCMb 3FEOA 1NJ1A 2LQKA 1AZGB 4G84A 2PU9B 3S3OA 3CPWP 4HCZA 2DILA 1E22A 1NJ5A 2SEMA 3WXMB 1MUZA 4C92E 5GMKm 1UJ0A 4K87A 4EPCA 2O4XA 3A32A 1X55A 1SHFA 3I7FA 1ZBXA 5I11A 4PJJA 1I8FA 2E3IA 3FDRA 2LQNA 4UPAA 2CUDA 4JJBA 5LJ5g 2DBMA 3E2UA 4ZGEB 2MPXC 1EX4A 3OBWA 5GAOq 1PKSA 4M7DD 4KBMB 1NJ6A 4KGZB 1Q81R 2EL9A 2VASA 1WHGA 2YWWA 3MO8A 2JNGA 3V8LA 5C51B 3UH0A 4O6JA 4KQEA 2LCSA 4QQ6A 4H2SA 4RDXA 1K8AU 2RJEA 4C8QF 4CI0C 4H2TA 1MMDA 2NS6A 3R6NA 4K88A 3OYAA 1M5Q1 1ATIA 2ZGWA 4OP0A 1M2VB 1A0NB 1M3CA 1VUBA 2RK2A 4TWAA 2DFUA 4XK8E 1ZSZA 1I5OB 5CO7A 5GMKh 3G4ST 4ZTUB 1UECA 4GY5A 5KCOA 4II1A 2FZKB 5GMKi 2DD4A 1EIFA 2QHSA 1R8OB 3VS1A 2QXFA 3CMEA 4LVMA 3H9NA 3THKA 5LJ3e 2FYKA 4HXJA 2HAXA 3QUIA 3NPFA 3VQXA 1Q82U 1F1BB 2RMOA 4H2XB 5FRMA 3JCMJ 4LDYA 5FROA 4JLIA 1GFDA 1QF6A 2EJFA 1K4US 4DBRA 2F5TX 1QCFA 2DL5A 2ZPEB 2RB6A 5E3IA 5DLOA 1HC7A 1VQOA 1YJNA 1UGSB 2DU5A 3EGUA 3GIBA 2A37A 2DD5A 3QZ5B 2DXBA 5K1XA 1OU8A 1G3YA 2RN8A 5C6SA 2LQWA 4AFZC 5C0MA 2E10A 5CQXA 4F04B 5FU7B 2DAQA 4B9XA 4KR2A 1WFWA 3CCMT 4HT4A 3L2VA 4RTYA 1VA7A 1VYVA 1X27A 2LDMA 4ZN3A 3A7UA 1K9AA 3CBOA 2O01E 1FYNA 3PVQA 1EIYB 2CP6A 3CBPA 1X01A 1UG1A 3OYKA 1UEBA 4OVAA 1B7TA 2RHZA 4YRNA 5GAOp 4K11A 4DOVA 1WZOA 1UB4A 2DETA 4Z8AA 1AWXA 1MNDA 1NYQA 4KR3A 2LX9A 4D8DA 1QKXA 5HK0A 2G4CA 1K8AR 2YUNA 1YHQA 4PKCC 1H3HA 1VQPT 4Y92A 2EGEA 1PC0A 2EAYA 1H92A 2LZ6B 4YP0A 3OS5A 3BDUA 4PJOF 1RI0A 1Q7YU 4RG2A 3MCAB 2JS0A 1PSEA 2QHVA 3UATA 2RHIA 2OTJA 4EMHA 3ZL7C 1B34A 2P0PA 4KULA 2CT4A 3BY7A 4ANJA 3JB9F 2OAWA 3SDZA 2ODRD 3QDRB 5CAIA 5I22A 2HEQA 2Q5HA 2OI3A 3E19A 1M4ZA 4PG3A 3OYGA 3IQLA 1WQWA 3CCUT 4P72C 1VQNT 4YCWA 1WGSA 1Q82R 2QK0A 4BW9A 4YRIA 2KT8A 3CC7T 3A5ZA 1RABB 5KYYA 3LSQA 4LD9K 2JS2A 2FPDA 2ZIOA 4M7AE 2HNIA 4AFUC 3JCMV 2K4YA 3VS4A 4J5YA 1VOMA 1EFNA 3MHXA 4C8QG 2F2WA 3OD1A 4NS5A 1WQ7A 4F7UE 4BI3A 1NEGA 2KDSA 5LJ3h 2J05A 1V76A 1GBRA 4YRSA 2EKHA 3LH0A 1JXMA 3CQTA 1VQPQ 4PJOC 3LH5A 1I07A 3MEYA 3EH1A 2E70A 2XHCA 2QGGA 1T0JA 4P5NA 2K79A 2RPNA 3P8DA 1Z7NA 2QQRA 1U06A 1B7YA 1NBEB 4L87A 1KQSP 2ZZEA 2M1HA 1EVKA 1KMMA 3RESA 2KNBB 1JO8A 2BIVA 2HQXA 3M57A 4R56A 5GAN5 2RI5A 1WXUA 1HSQA 4BE0A 3QIIA 1M3BA 1IXDA 3RGLA 1VQNQ 2LJ1A 3TSZA 1NYFA 3TEGA 4PHCA 4AMCA 1IZ6A 1Q7YR 3CC7Q 1XJWB 2YHTA 1ZBJA 1J3TA 3X26B 1N27A 2RF0A 1RLQC 3HXZA 3UA6A 1GXIE 3TU4K 4N0AA 4B6MA 3VV0A 4M7DF 2MK5A 1YBYA 5M9OA 1O9SA 2J3MA 2X3WD 5AT1B 4AG2C 3P8BB 3M59A 2Q7EA 2HKNA 5LJ5f 1SRLA 2MYSA 2CUBA 4BB7A 1X69A 1VQ4T 4MMLA 3SB2A 2ZCEA 3FC3A 4RUGA 3TEHA 1BBUA 2DERA 3CCET 1ZX6A 3QWXX 5D6WA 3REAB 4GLKA 1SHGA 1USYC 2M0YA 2XIDA 4ELZC 5GAN8 4RCBA 1JEGA 3A31A 2NLUA 2RA2A 2L8DA 2FZGB 1D09B 2AKKA 1UHFA 2IG0A 4J6XA 1VQ6T 1JJ2S 5CVIA 1KIKA 3H6ZA 3VS5A 4JRIA 3M5AA 3OMGA 2EYXA 2R57A 2JM8A 3L42A 4F16A 2ZCFB 3UF4A 4M7DC 5FLXE 2EIFA 1VQKQ 3TQ7P 4C8QA 4MDXA 4RCCA 4TVWA 1AT1B 2EQIA 3PFSA 4G85A 2CZ7B 3SWNB 4MDWA 3QJ6A 4OMOA 2ZT8A 1M30A 3EFSA 4E7SA 3HKSA 1G5VA 3JCMg 1PYSB 2ZPBB 2O9SA 4OMNA 1RAFB 5LJ5d 3JRZA 1VYUA 3EGDA 1C6VX 1VQ4Q 1UGRB 3CCQT 4HWOA 1OEBA 1X6OA 3R6OA 2YRVA 2PMFA 3CCEQ 5CKEA 1HYOA 2LX7A 2XU8A 1HXDA 1X56A 1VQMQ 1YB3A 1KHIA 3AHUA 4NL2A 4YRMA 2EGAA 3T9NA 2AMCB 1G3WA 1VQ7A 4M78B 3A1PA 3I35A 3HRSA 2QQSA 2K7AA 2H3JA 2FHDA 2DM1A 4TVYA 1JJCA 3CCVA 3I56T 3U23A 5LL6S 1LCKA 2BZ8A 2J3LA 4J7IA 3PE0A 4DBFA 3S3MA 2WSFE 1IHWA 1VIFA 3C4SA 4PJLA 3LC0A 3QDFA 2L2PA 4J9DA 1Q95G 3TVTA 4E7KA 4M77G 1LPLA 4TTVA 3P8YA 2EGCA 3G71T 4M78D 2NWMA 11ASA 2GTJA 3OSSC 2RHSA 3JV3A 3HHTB 3QPHA 2ZZFA 4X5OA 2XG8D 3NETA 2DTHA 4JJDA 2L3SA 5C52B 2YUOA 1VQ5T 5ELNA 4BY6B 3FLGA 5L8RE 4E7ZA 1YI2T 4YRQA 3OW2P 1S1NA 4HVVA 2QA4Q 4J6YA 4WI1A 1YCSB 1KMNA 1OQKA 1BYMA 2X35A 3CD6Q 2BZXA 4M75D 1WHHA 5FU7C 4KUIA 2HZYA 4BDZA 1KSWA 2RJDA 4OB1B 3HTRA 3I56Q 1M9SA 2SRCA 3I55T 3GF5A 4V2SA 4NOYA 1VQ8A 4HCBA 2KT1A 2DXUA 1QVFS 2HDAA 1U5SA 4AFQC 1BIBA 1N8RR 1VQLA 1D1AA 2ODRC 3A8MB 3PTAA 4FT4A 1H4TA 4IUPA 3KFUA 3LW5E 2CP3A 2LNHB 1IHVA 3GBQA 3V8JA 3CC2T 2JTFA 2NUTA 4PJOB 2YUQA 2QI2A 1RAGB 2PVGB 1B07A 1NPRA 3PCOA 2CZ6B 1CSKA 3RDVA 3ER0A 1PSFA 2NUPA 2C7IA 3CCRQ 1YI2Q 4LVKA 2YLCA 1BI3A 2EBPA 2AHJB 1ASYA 1SEMA 3GNFB 3OYYA 3QTCA 1QVGA 2F2VA 2X4JA 3LX7A 2FPFA 3PNWC 4P71C 3CBMA 5GAMg 4C5EA 5HK3A 2RK1A 3H0FA 1OX8A 3C12A 4CC3A 1ZUKA 2OX7A 1QP3A 2ABLA 2JTMA 2P0QA 3VS7A 5EC7A 2ATCB 3A8HB 1Z7MA 2W10A 4FT2A 1CKAA 1TU0B 3I55Q 3CPWS 1TS9A 4E7IA 3RKWA 1S72A 4P75A 3BDLA 3ZEHA 2CYZB 3M0QA 2PQWA 3BW1A 1K0XA 4A63B 2RHYA 2CZ0B 5KYUA 1YIJA 3DKMA 2A28A 2K5FA 1YITA 4M77A 2E5AA 3HY1A 2RQRA 2KYMA 3EGXB 1G51A 2I4LA 2COZA 2JM9A 2HMAA 2JZ2A 5LJ5e 1R0CB 2L3RA 4EMKB 2K3YA 2P0LA 3CXCA 2K3XA 5ECAA 4H2UA 1SETA 4HVUA 3EG9B 2J6FA 4CC2A 4EMGA 5GMKj 1AWJA 3VS2A 2BZYA 3RACA 2DU7A 2ZXFA 4C8QE 4R0KA 4WCIA 3A7AA 3CEYA 3J80E 4MZMA 1AOJA 2DYBA 3OY9A 2DQ0A 3OYEA 2A8EA 3CCJQ 1WHLA 1UUEA 1G5IA 2ARUA 1W2BA 3PIPA 3VU3C 1B3QA 2DXCA 5CQYA 3V7CA 4RMFA 4DA4A 4X9DA 1PG5B 2HL5C 4EX5A 3EH2A 3HFVA 3IALA 2CH4W 4M7DB 4ZTZB 2E12A 4P3PA 4RTWA 3G7ZA 3EFOB 1X75C 1MV3A 1BIAA 2V26A 4QKUA 2DRKA 3HP9A 3RMQA 3JCMf 1SKUB 4OLFA 3EAEA 1QQJA 3EG3A 2QHUA 4FL6A 1N9RA 4LD6A 1YJ9T 2LCLA 4A4EA 3FIFA 2J7IA 3WVEB 3UDCA 4YCUA 2ZT5A 2L5QA 2XICA 5DM7R 3HXVA 2AKWB 4PFOA 4WJ3M 3QSUA 4BE2A 3L2ZA 2FL7A 2QEXQ 4P73A 1ZUYA 3PGGA 4N4HA 3OYJA 1LOJA 2QAZA 4M78F 3SD4A 1UE9A 2Q5IA 1EZZB 1QVPA 2KE9A 1MGQA 4HKEA 3VYGA 2D6FA 1WHJA 3QNEA 3S3NA 3BE3A 4N4IA 2O4XB 4P74C 3I5RA 5LJ5h 1YGBA 3SWNC 1YFRA 2P5IA 4HWSA 2JVVA 4YRCA 1X2GA 2M9UA 3ERRA 1LNXA 4ZTJA 1YJ9Q 1M90C 4M75F 4A4KA 3OYNA 2DRMA 4F14A 2ROLA 4F17A 3OYHA 1P92A 1D3BA 2JN0A 1EIYA 2XDBA 2QTVA 4YRGA 2DL3A 4VUBA 2EQUA 5LJ3j 3CMET 1OULA 1BU1A 5FRNA 4N4GA 2CJBA 3IG2A 1MMGA 3VYHB 5IN1A 2A7YA 2DDZA 3W3SA 3GNGA 4LXCA 4M78C 4XEOA 1U8RA 4XEMA 1FMWA 4EO4A 1XOVA 4BWAA 4DBHA 4J9BA 2M0OA 1R0BG 2KRNA 1VQOT 2QG9B 3OBYA 2R58A 5A0LA 3H41A 1PKTA 3M4PA 1H8KA 3G6EA 4LUEA 1TUCA 1Y07A 1ZHIA 5DLQE 3LWIA 4BDYA 2X3XD 2C06A 2FZCB 2DL7A 5GANf 3G4SQ 2IY5B 1NEBA 1C0AA 3CMQA 2ENMA 4JS5A 3M4QA 1AWOA 5FU6C 4M75C 4HCKA 1BBZA 4DPGA 3QO3A 2F69A 1BI2A 2HL3A 3HXUA 3JCMc 2RHQA 4IIOA 1KQSS 1OU9A 2EPDA 4BY6C 4YRLA 3X24B 1OPKA 1WI7A 3CMEQ 4BI8B 1YHQT 2D0NA 2FEIA 5GAMf 4C92C 2VVKA 4M77E 2MWOA 3FB9A 2L89A 4J7FA 5CK9A 1I0CA 2E5QA 4O5VA 3UPUA 2BUDA 4E7JA 4MZPA 1RAEB 2OTJT 1JXOA 4UP9A 3JB9I 2ZPGB 3MKDA 4AT1B 3CCMQ 3E9IA 2MWPA 4E7HA 2CSQA 5J3BA 3RMSA 4JLGA 1UFFA 2NYSA 1VQNA 3QYHB 2FRWA 1G3TA 4JZ3A 1JBMA 4P3OA 3CC7A 1G83A 2EQJA 4OF1A 3OMCA 3RIRA 5KYWA 3OQ5A 4RKUE 2AZVA 5GANd 3QO5A 2V8IA 1YN8A 2E6ZA 4J9FA 1E24A 3VS0A 1YCYA 2DX1A 1AEYA 4FW2A 1NLOC 1TXQA 1Z9ZA 2FG0A 3E9GA 2Y90A 2DE0X 2P0KA 2DEUA 2XK0A 4LN2A 4CS3A 4XTZA 5CR2A 1UDLA 2O31A 2EFIA 1M1GA 4PLIA 2DBKA 4YRRA 3OSVA 3V7RA 4KGVB 5FWCA 4DQ2A 3CCUQ 5I21A 2DMOA 5FWBA 4HT9A 2DJZA 1I5LA 2J06A 3VJPA 1VQ9T 2K5LA 4LE9A 4RQEA 4JJNK 3DLMA 4GBQA 2JUFA 2ZTGA 2DL4A 1WXTA 1M90U 1ADYA 2PVOB 3JSCA 2DIQA 4J6WA 2GTOA 2EVRA 4FU6A 4L6V5 4O2DA 4M4ZA 1QVGP 3MEAA 2G3RA 4LUDA 1VQKA 2P4TA 1K0SA 2VUBA 3KUFA 4EMKC 2ZZDA 4CC4B 2VWFA 4HWPA 1ABQA 3EG2A 1TH7A 2H3EB 3OYLA 2ZNJA 1GCPA 2YLBA 1OOTA 3M58A 2X51A 2XMFA 1ZQ1A 2LT1A 5CKDA 1E1TA 4RQFA 4P74A 1KD1C 1OZ3A 1Y96B 2KY9A 1IB8A 5GAN6 1M8MA 2RJCA 4PJOG 1ACMB 3CPFA 4RTZA 4XU0A 1VQMA 1PYSA 3OYDA 1PHTA 5IT9E 2IVWA 2Z0WA 1VIEA 2V8JA 2K5IA 2PMEA 1RIQA 3L2WA 3NGPA 2DL8A 3JB9G 4ZN1A 2QQAA 1VQ9Q 2ZT6A 2VV5A 2P84A 5CKFA 1W6XA 4FW1A 1SRMA 4YROA 3RKYA 3CCST 2GBQA 3DB3A 3NTKA 1OX9A 4ORZA 3IKMB 2AMCA 3CXCP 4QW2A 2DA9A 3ME9A 2CZ1B 2QGFB 2LC4A 1WDXA 3JCMX 4Q15A 2CJAA 2ALYB 2C0TA 3V7SA 1MMNA 2DZCA 1NYGA 3GP8A 2L0AA 1G2BA 3CC4T 4EIKA 1KK7A 5KNNA 4FYXB 2KEAA 3M9QA 5CCAA 4RTTA 3QG1A 1WYDA 1UTIA 2CDTA 3OW2S 1BI0A 3Q1JA 4M7AC 5GAN3 2K6DA 1EOVA 1RAAB 3QXEB 1M90R 5KYXA 4H2YA 1HK9A 1NZ9A 3CMAA 2H8HA 4XTYA 1Q86C 3M4YA 2AK5A 3X20B 1N9SA 4YPFA 3RR6A 2A0FB 2QA4A 3M4GA 3AT1B 1VQ6Q 4PK4A 1SG5A 5A0GA 4PFZA 5GJVB 3L4GB 2RO0A 3HFNA 3OA6A 3PT9A 3CD6A 2ZZGA 3PMTA 3UFGA 2K57A 3VUBA 1VQ7T 1OPLA 2RD1A 5I2MA 3ZBDA 1WLEA 3CCSQ 2LNVA 4GLMA 2GQIA 3A8GB 5FW9A 1WHKA 4DEYA 3M54A 2VYTA 4X9CA 3JCMP 2X9HA 2HBWA 4E6RA 2OJ2A 2RHUA 1D0XA 1YFNA 5GANe 4KUDK 2O9VA 4C0DB 3UGTA 4HT8A 3HXWA 3VBBA 5FU6B 4XTXA 4P72A 4EDUA 2AT1B 4M75B 4RTVA 4IUTA 5D7UA 4PJMA 3CC4Q 2RI3A 4QQGA 1V1CA 2JMCA 4IIMA 1U1TA 1SRYA 4C5GA 2BE9B 9ATCB 1QP2A 2JW4A 3CCQQ 4M7DG 1UGQB 4LDVA 4OMMA 1K76A 1MMAA 1W66A 2DJQA 2A3LA 2DIGA 5GAN2 4C92B 2J6KA 2QDYB 3CCRA 3C0CA 1YI2A 4QVCA 2DVJA 3IKLA 3BFMA 3META 3MPUB 1JJCB 4OGCA 4QVZA 4XQ3A 4PJOA 1BB9A 4Q5WA 2E5KA 2GNCA 2PUKB 1TUGB 3UA7A 4LVJA 1NE8A 1WYXA 5A2QE 2I4OA 2EJGA 2RQUA 3S6WA 3PIOA 3C94A 3C95A 3RERA 2EKOA 2KXDA 2OTLA 4ESRA 1ZSZC 4C92D 3LWHA 4A54A 2KAFA 2FO0A 3KFVA 3G71Q 1VQ8T 1NM7A 4JJCA 4ATOA 1GGMA 3JCMW 1XQHA 5I2SA 2FPEA 2DZ9A 3MQZA 1KD1U 3FJ5A 1J5WA 2QASA 3H0IA 1VQ5Q 3H0HA 3M0TA 2RNAA 4XU2A 1M8VA 4YRPA 1N9WA 1X2KA 1I4K1 4XU3A 5IAYA 4J9CA 3PMIA 2CT3A 4FYWB 5L23A 2G6FX 4KRTA 4ELYC 4JRPA 3EGXA 2ED0A 3A74A 1W70A 1K9MC 4J9EA 4EMKA 3WQZA 1B70A 4HWTA 4OB0B 1YP5A 4FCYA 1N6AA 3CCJA 1WLPB 3REBB 5A0DA 4OB3B 2VKNA 3CCLT 1T3SA 4ZGDB 4TVAB 1X2QA 2YDLA 3SEMA 5GANh 3JB9J 3FJPA 2DYIA 1USYA 2EYQA 3X25B 2PTKA 5GAN4 3M53A 1RAIB 2EQMA 1S72T 1VQ8Q 3A5YA 3MP6A 4TVRA 4MZTA 3EG0A 2B86A 4FIBA 4J83A 4PLLA 1YWPA 4XTVA 3CC2Q 3PCOB 4Z89A 1OYXA 2C8MA 2AKLA 4H2WA 1YIJT 4C0ZA 1Q86U 3NELA 4OMFB 4Y91A 1YITT 1M1KC 3VUZA 1G8XA 5LJ5j 4OMPA 4XU1A 4JS4A 1RI9A 4J15A 4M7DA 2QQ9A 3HFOA 1WPYA 4DOWA 3EFOA 1RLPC 2KYBA 3JB9H 3F70A 1KD1R 2E4HA 1SPKA 2RH2A 1PM3A 2QEXA 1YJWT 4J9HA 2WSEE 4TQFA 5KE2A 1WXBA 4QVDA 4C5IA 3CCLQ 2KK4A 1K73C 1VQZA 4UP8A 1QMCA 3NFCA 4X1VA 1FYFA 2FVUA 2JT4A 5KYUB 3HFZB 3VQVA 2HD0A 3VRYA 2DO3A 4OB2B 1QWEA 4ZGJB 1S72Q 1TTHB 1C0MA 3KBGA 2LTOA 2VXEA 1NLPC 2KXCA 2CKKA 3M0PA 3PVLA 3HRIA 2P4RA 2XI9A 4BACA 1KFZA 4IUUA 1B8AA 1WJQA 1YIJQ 2XD0A 4KH0B 1NJ2A 3LSSA 1YITQ 1QKWA 2CGHA 2CREA 2DTOA 2A36A 3P8TA 2GGRA 1M2VA 2XDDA 4M7AB 1YJ9A 5D6YA 2HCKA 1IRXA 2VC8A 1K1ZA 1JJ2A 2LP5A 4E2FB 3O5ZA 4M77D 3L2RA 2MI6A 4F7UB 3KXTA 2L3QA 1NJIC 4YCVA 1FX7A 1LJOA 1TUDA 4LDXA 1ZA2B 3ZFJA 1YFTA 1YJWQ 1Q86R 4H2XA 2YSQA 3LGFA 5IHKA 2ZAEA 3LYIA 4YRFA 3RNJA 4E47A 2ESWA 4JZ4A 4M7AD 4KH1B 4J9GA 2KI7A 4LDWA 1YNZA 4N0AC 2E65A 1D0YA 3EFRA 4YRKA 2DKGA 2K3BA 3MP1A 4AFSC 4WF2A 2ZR2A 3L2UA 3EG1A 4IUQA 4PJOE 1IL2A 3OW2A 4RTXA 3QJYA 1KQ1A 3HSBA 3GOXA 1O75A 3RKXA 4JUVA 3JCMd 3G4SA 1EFWA 5KH6A 8AT1B 1IGQA 1QWFA 1QW1A 2QYZA 1ZA1B 2ZPIB 4TQDA 1GBQA 1C1AA 1PWTA 2LCCA 1K9MU 2JJ9A 2K2VA 1KHCA 5D6XA 4UP7A 4PFPA 4FSXA 2HSPA 3JCMQ 1U1SA 2HQEA 3NEMA 2IY5A 2E3HA 3E1SA 2ZIMA 2HQHA 2MCNA 4C92F 2ZINA 2I0NA 2O2OA 3H8ZA 1XNIA 5GAOm 2EYZA 4JRKA 2WACA 3VRZA 1YJNT 2VB6A 4OGEA 4CH6A 1N5ZA 3OYCA 2DXTA 2KQWA 2DVEA 2CIMA 1DJ7B 4XAXB 2Y4XA 1R77A 2JMAA 3CCMA 2ARTA 1M27C 2K2MA 4LVIA 4P71A 1GCQC 2QQBA 1QCNA 4C8QC 1ZSZB 3VQWA 3I9QA 4E51A 1ZSGA 1HJDA 4CH4A 5C53B 3G6ET 4C0DC 1M1KU 3OS2A 2MIOA 2CS7A 2F2XA 4YTLA 5HY6A 2JOYA 1V29B 2R5AA 4NCXA 1WX6A 1GFCA 2LT4A 2KSSA 3P8VA 1EQRA 1D3BB 1H4QA 4CC7A 4ME7A 2E41A 1X6BA 1VQPA 2QTXA 4FYYB 3VS6A 3QO7A 2YUPA 2J6OA 2C0OA 1E7OA 1E6HA 3E9FA 3URGA 1UJYA 2CH4A 2GCXA 1K73U 1AVZC 2RM4A 2K9GA 1SSFA 2CP5A 2ZPFB 1QVFA 1SERA 1BCOA 2D1XA 2DEQA 2EYYA 5LJ3g 1AZEA 2F5KA 2PVDB 2ZNIA 1Y57A 5IHIA 4HVWA 4D8KA 1YJNQ 1VQOQ 2LMJA 5HGQA 2MAMA 4A4FA 2RI2A 3CCUA 1K9MR 4PNOA 4M7DE 1G3SA 5KE3A 1AD5A 4ZIBA 1TG0A 2LJ0A 3UT1A 4YREA 4M78G 2XTIA 1LVKA 3G6EQ 2C0IA 1QVGS 2X4YA 2XDPA 3QZ9B 5HKCA 3NENA 5K1PA 1SF9A 2CP2A 2HBPA 1N8RC 2GFAA 4BUGA 5IXBA 2E1HA 2RHQB 2FRYA 4KGXB 1PD1A 4Y28E 2L3PA 5KCHA 1NPPA 1NJIU 1B34B 4HWRA 1YHQQ 1D1CA 3N5BB 3RF1A 1HTTA 1M1KR 2F1LA 4M75G 5GAMd 2M16A 4XTWA 3EHQA 1GL5A 2Q7GA 3CPWA 3L1AA 5HCKA 2OTJQ 1Y71A 3OS1A 1NNHA 2ZT7A 4C5HA 1D1BA 3A5ZB 4LVLA 5KYYB 2PZ1A 1H4SA 4LNPA 2DF6A 2JTEA 2KGTA 2Y4YA 4C92G 3DSQA 5GAN7 3QO8A 3CXCS 1Y96A 1U3OA 3OYIA 1KC8C 1VQ9A 4K86A 5KYWB 2DPPB 1K73R 1PCXA 4BD3A 3NTHA 2ROTA 3LGLA 1X54A 4E7LA 4M77F 1JQQA 4YYEA 3JCMe 2D0QB 1IO6A 1LYLA 4RG8A 4AH6A 3WVDB 3BJUA 2BTTA 2IPOB 4UC4A 1B7YB 1UHCA 2AIRB 8ATCB 1NG2A 2M51A 1M1FA 3NTIA 5GAOn 1W2BS 2VXFA 2ZPHB 3VKIA 3P8HA 1VQKT 1BI1A 3ICAA 4CH5A 2XKOC 1VQ4A 1Z9QA 4M7AF 5EG2A 5GAOr 3SWNA 1L0WA 1TWBA 3CCEA 2ALYA 2EQKA 1ABOA 3OS0A 1KG1A 4F7UF 3ULRB 3EHRA 2RQVA 2RHXA 2KRSA 2RQTA 3M0UA 4P75C 2GF7A 2O88A 2NUZA 3MP8A 1VQ6A 4L59A 1NJIR 1NJ8A 3A8LB 1VQMT 1B76A 1T0HA 4BE1A 1BKBA 1OI1A 3HXXA 4M77C 4HVCA 3CCSA 3TREA 1QCOA 3OYFA 4R55A 4YRTA 4M78A 3M56A 4IUVA 2D8HA 2DNUA 2YRCA 2BE7D 2HSEB 1W4SA 3G1ZA 2KBTA 3L4GA 2EJ9A 5GMKl 2LVMA 4HA8A 2I4NA 2CSIA 2B8AA 1RACB 1Y0MA 3TEHB 4FSSA 2AZSA 1WJRA 4NL3A 3CC4A 2QDLA 3J7AF 1ARKA 4Q6GA 1GCQA 1W2BP 2COWA 2A08A 1RAHB 3UWNA 3CCQA 2OAUA 2EW3A 1VYTA 2M02A 2DQ3A 4M75A 2PUOB 1I1JA 1FWZA 5GJWB 2XGTA 4H02A 1I81A 4P3NA 1Q81C 3CMAT 1SESA 1PRMC 4YDQA 1IGUA 3NHNA 4FM4B 2QA4T 2E3CA 1N8RU 3HPWA 2E6NA 3I56A 3HRKA 1E6GA 3CCVT 3PZCA 4C92A 1PRLC 3JCMh 7AT1B 1EVLA 2V8KA 4C8QB 3FRNA 3CD6T 3MEVA 2KR3A 3ASKA 3MEUA 2X4WA 3HL8A 2CP0A 3HTZA 3V8KA 4KT0E 3HY0A 1JJ2P 1W1FA 2HKQB 4CS2A 1JU5C 2CP7A 3OB9A 5GANj 3G71A 1JRIA 4IURA 3EGDB 3QBYA 3TCJA 2LQ8A 2GFUA 2WSCE 2DTIA 2LRQA 2ARSA 2Q7HA 1HD3A 3SHWA 3E9HA 2V1RA 3I5SA 4LDUA 1D0ZA 1G5HA 5KYXB 4BI4A 1FMVA 4J8OA 3HRTA 3INZA 3G1JA 4CH3A 5GAMe 4C8QD 4L5GA 5GAOl 1VQ5A 3QHSA 3D7SB 1ZLMA 1UGVA 4P73C 3HXYA 2QHTA 3SFMA 1RUWA 3RUXA 2MMPA 5GAMj 1E1OA 5LJ3f 4JDSA 2BKDN 1KC8U 1TOVA 2ZR3A 3DLLA 1FMKA 3REUA 3M55A 3CMAQ 3DB4A 4M7AG 3CCRT 3QKJA 4AG1C 1VQ7Q 4CRIA 1WA7A 3GLXA 1MV0B 4PL6A 4ZTFA 2VGNA 1UGPB 3CCVQ 3LLRA 4XTUA 4F7UG 3I55A 1T3LA 1WNLA 1SSHA 5KYNA 1PD0A 1YFSA 4OMQA 3RBBB 1OV3A 4CS4A 2CJ9A 1AWWA 2JXBA 2RHSB 1YWOA 4D6WA 1KQSA 1QLYA 1BCMA 2YT6A 12ASA 3TUPA 3TSWA 5IH2A 2OTLT 4MMKA 2MF2A 1XTDA 1VQLT 2KMTA 2GQVA 2YXYA 5J39A 3QWYA 1H3ZA 4FYVB 4TVAA 3UGQA 3QYGB 1K8AC 3CC2A 1FXXA 1KJWA 2R5MA 1GRIA
chains in the Genus database with same CATH topology
1RL2A 1BBWA 4C0FA 5GANg 5J26A 3A7RA 1H4VB 3RL6A 4X34A 5CIUA 5AYFA 1ADJA 4JRQA 5LJ3d 2VGMA 3OYMA 3R07A 1WU7A 4Z02A 4B9WA 3J81E 1IREB 1MHNA 2DK3A 1Q82C 4C0GA 3CCLA 3TEEA 2E64A 4IKFA 4A4GA 3CCJT 4WJ4A 5CKBA 1WJSA 1X2HA 3JAME 4HCCA 4PJOD 5CKHA 5DY9A 3OYBA 3A8OB 2D9TA 4QQDA 3JB9D 5GAMh 1QE0A 3X28B 3HFZA 3L2QA 1KOGA 2I4MA 1JB0E 1Q81U 4M78E 3GPLA 1AHJB 3HRUA 5F5WA 2X4XA 3MF2A 5GMKe 1ASZA 1B70B 3MEWA 3REXA 1Y7XA 3O8VA 1H641 3MF1A 2FB7A 4YRJA 1KQ2A 2RJFA 4M7AA 4A4HA 1OZ2A 4H2VA 1YJWA 4RMOA 2AKWA 5ELOA 1Q7YC 2QEXT 2I2LA 4F7UA 4M77B 4LNSA 4M75E 2KVQG 1NYRA 2EWNA 4A53A 3VQYA 3JCMb 3FEOA 1NJ1A 2LQKA 4G84A 2PU9B 3S3OA 4HCZA 1E22A 1NJ5A 3WXMB 4C92E 5GMKm 4K87A 4EPCA 2O4XA 3A32A 1X55A 3I7FA 1ZBXA 1I8FA 3FDRA 4UPAA 5LJ5g 4ZGEB 3OBWA 5GAOq 4M7DD 4KBMB 1NJ6A 2EL9A 3MO8A 2JNGA 3V8LA 5C51B 3UH0A 4O6JA 4KQEA 4QQ6A 4H2SA 4RDXA 1K8AU 2RJEA 4C8QF 4CI0C 4H2TA 2NS6A 4K88A 3OYAA 1M5Q1 1ATIA 2ZGWA 4OP0A 1VUBA 2RK2A 4TWAA 4XK8E 5CO7A 5GMKh 3G4ST 4ZTUB 4GY5A 5KCOA 4II1A 5GMKi 2DD4A 1EIFA 2QHSA 1R8OB 2QXFA 3CMEA 4LVMA 5LJ3e 2FYKA 2HAXA 3QUIA 3VQXA 1Q82U 4H2XB 5FRMA 3JCMJ 4LDYA 5FROA 4JLIA 1QF6A 2EJFA 2F5TX 2ZPEB 2RB6A 5E3IA 5DLOA 1HC7A 1VQOA 1YJNA 1UGSB 2DU5A 3GIBA 2DD5A 3QZ5B 2DXBA 5K1XA 1G3YA 5C6SA 5C0MA 2E10A 5CQXA 5FU7B 2DAQA 4B9XA 4KR2A 3CCMT 4HT4A 3L2VA 2LDMA 4ZN3A 3A7UA 3CBOA 2O01E 1EIYB 3CBPA 1X01A 3OYKA 1UEBA 4OVAA 2RHZA 4YRNA 5GAOp 4DOVA 1UB4A 1NYQA 4KR3A 2LX9A 5HK0A 2G4CA 1YHQA 4PKCC 1VQPT 2EAYA 4YP0A 3OS5A 3BDUA 4PJOF 1RI0A 1Q7YU 4RG2A 3MCAB 1PSEA 2QHVA 2RHIA 2OTJA 4EMHA 1B34A 2P0PA 4KULA 3BY7A 3JB9F 3SDZA 2ODRD 3QDRB 5CAIA 2Q5HA 3E19A 1M4ZA 4PG3A 3OYGA 1WQWA 3CCUT 4P72C 1VQNT 4YCWA 1WGSA 4BW9A 4YRIA 3CC7T 3A5ZA 3LSQA 4LD9K 2ZIOA 4M7AE 2HNIA 3JCMV 2K4YA 4J5YA 3MHXA 4C8QG 3OD1A 4NS5A 1WQ7A 4F7UE 4BI3A 2KDSA 5LJ3h 4YRSA 3LH0A 4PJOC 3MEYA 2E70A 2XHCA 4P5NA 1Z7NA 3P8DA 2QQRA 1B7YA 4L87A 2ZZEA 2M1HA 1KMMA 1EVKA 3RESA 2BIVA 2HQXA 3M57A 4R56A 5GAN5 2RI5A 4BE0A 3QIIA 3RGLA 3TEGA 4PHCA 1IZ6A 2YHTA 3X26B 1N27A 3HXZA 1GXIE 3TU4K 4N0AA 3VV0A 4M7DF 1YBYA 5M9OA 1O9SA 2J3MA 3P8BB 3M59A 2Q7EA 5LJ5f 4BB7A 1VQ4T 4MMLA 3SB2A 2ZCEA 3FC3A 3TEHA 1BBUA 3CCET 5D6WA 4GLKA 1USYC 2XIDA 4ELZC 5GAN8 4RCBA 3A31A 2NLUA 2RA2A 2L8DA 2IG0A 4J6XA 1VQ6T 1JJ2S 5CVIA 3H6ZA 4JRIA 3M5AA 3OMGA 2R57A 3L42A 2ZCFB 4M7DC 5FLXE 2EIFA 4MDXA 4C8QA 4RCCA 4TVWA 3PFSA 4G85A 2CZ7B 3SWNB 4MDWA 3QJ6A 2ZT8A 3EFSA 3HKSA 1G5VA 3JCMg 1PYSB 2ZPBB 5LJ5d 3JRZA 1UGRB 3CCQT 4HWOA 1X6OA 3R6OA 2YRVA 2PMFA 5CKEA 2XU8A 1HXDA 1X56A 1YB3A 1KHIA 3AHUA 4NL2A 4YRMA 3T9NA 2AMCB 1G3WA 1VQ7A 4M78B 3HRSA 2QQSA 2H3JA 2FHDA 4TVYA 1JJCA 3CCVA 3I56T 5LL6S 2J3LA 4J7IA 3S3MA 2WSFE 1VIFA 3C4SA 3LC0A 4E7KA 4M77G 4TTVA 3P8YA 3G71T 4M78D 11ASA 3OSSC 2RHSA 3HHTB 3QPHA 2ZZFA 4X5OA 2XG8D 3NETA 2DTHA 5C52B 1VQ5T 5ELNA 4BY6B 3FLGA 5L8RE 1YI2T 4YRQA 4J6YA 4WI1A 1KMNA 1BYMA 2X35A 4M75D 5FU7C 4KUIA 4BDZA 2RJDA 4OB1B 1M9SA 3I55T 3GF5A 4V2SA 4NOYA 1VQ8A 4HCBA 2DXUA 1QVFS 1BIBA 1VQLA 2ODRC 3A8MB 3PTAA 4FT4A 1H4TA 4IUPA 3KFUA 3LW5E 3V8JA 3CC2T 2JTFA 4PJOB 2QI2A 2PVGB 1NPRA 3PCOA 2CZ6B 3ER0A 1PSFA 2C7IA 4LVKA 2YLCA 1BI3A 2AHJB 1ASYA 3GNFB 3OYYA 3QTCA 1QVGA 2X4JA 3LX7A 3PNWC 4P71C 3CBMA 5GAMg 4C5EA 5HK3A 2RK1A 3C12A 1QP3A 2JTMA 2P0QA 3A8HB 1Z7MA 4FT2A 3CPWS 4E7IA 3RKWA 1S72A 4P75A 3BDLA 3ZEHA 2CYZB 2PQWA 3BW1A 2RHYA 2CZ0B 1YIJA 3DKMA 2K5FA 1YITA 4M77A 2E5AA 3HY1A 1G51A 2I4LA 2JZ2A 5LJ5e 2L3RA 4EMKB 2K3YA 2P0LA 3CXCA 2K3XA 4H2UA 1SETA 5GMKj 4EMGA 3RACA 2DU7A 2ZXFA 4C8QE 3A7AA 3CEYA 3J80E 4MZMA 3OY9A 2DQ0A 3OYEA 2A8EA 1G5IA 2ARUA 1W2BA 3PIPA 3VU3C 2DXCA 5CQYA 3V7CA 4RMFA 4DA4A 4X9DA 4EX5A 3HFVA 3IALA 4M7DB 4ZTZB 2E12A 4P3PA 3G7ZA 1X75C 1BIAA 3HP9A 3RMQA 3JCMf 4OLFA 3EAEA 2QHUA 4FL6A 1N9RA 4LD6A 1YJ9T 2LCLA 4A4EA 3FIFA 3WVEB 3UDCA 4YCUA 2ZT5A 2L5QA 2XICA 5DM7R 3HXVA 2AKWB 4WJ3M 3QSUA 4BE2A 3L2ZA 2FL7A 4P73A 3PGGA 4N4HA 3OYJA 1LOJA 4M78F 3SD4A 2Q5IA 1QVPA 1MGQA 4HKEA 3VYGA 2D6FA 3QNEA 3S3NA 4N4IA 2O4XB 4P74C 5LJ5h 1YGBA 3SWNC 1YFRA 2P5IA 4HWSA 2JVVA 4YRCA 1X2GA 2M9UA 3ERRA 1LNXA 4ZTJA 1M90C 4M75F 4A4KA 3OYNA 3OYHA 1P92A 1D3BA 2JN0A 1EIYA 2XDBA 4YRGA 4VUBA 2EQUA 5LJ3j 3CMET 5FRNA 4N4GA 2CJBA 3IG2A 3VYHB 5IN1A 2A7YA 2DDZA 3W3SA 3GNGA 4M78C 4XEOA 1U8RA 4XEMA 4EO4A 1XOVA 4BWAA 2M0OA 1VQOT 3OBYA 2R58A 5A0LA 3M4PA 3G6EA 1Y07A 1ZHIA 5DLQE 3LWIA 4BDYA 2C06A 5GANf 2IY5B 1C0AA 3CMQA 4JS5A 3M4QA 5FU6C 4M75C 4DPGA 3QO3A 2F69A 1BI2A 3HXUA 3JCMc 2RHQA 1KQSS 4BY6C 4YRLA 3X24B 4BI8B 1YHQT 5GAMf 4C92C 4M77E 2MWOA 3FB9A 2L89A 4J7FA 5CK9A 2E5QA 4O5VA 3UPUA 2BUDA 4E7JA 4MZPA 2OTJT 4UP9A 3JB9I 2ZPGB 3E9IA 2MWPA 4E7HA 5J3BA 3RMSA 4JLGA 1VQNA 3QYHB 1G3TA 1JBMA 4P3OA 3CC7A 2EQJA 4OF1A 3OMCA 3RIRA 3OQ5A 4RKUE 5GANd 3QO5A 2V8IA 2E6ZA 1E24A 1YCYA 3E9GA 2Y90A 2P0KA 2XK0A 4CS3A 4XTZA 5CR2A 2EFIA 1M1GA 4PLIA 4YRRA 3OSVA 3V7RA 4DQ2A 5I21A 4HT9A 2DJZA 1I5LA 3VJPA 1VQ9T 2K5LA 4RQEA 4JJNK 3DLMA 2JUFA 2ZTGA 1M90U 1ADYA 2PVOB 3JSCA 2DIQA 4J6WA 4FU6A 4L6V5 4O2DA 3MEAA 2G3RA 1VQKA 2P4TA 2VUBA 3KUFA 4EMKC 2ZZDA 4HWPA 1TH7A 3OYLA 2ZNJA 2YLBA 3M58A 1ZQ1A 2LT1A 5CKDA 1E1TA 4RQFA 4P74A 1KD1C 1OZ3A 1Y96B 2KY9A 5GAN6 2RJCA 4PJOG 3CPFA 4XU0A 1VQMA 1PYSA 3OYDA 5IT9E 2IVWA 1VIEA 2V8JA 2K5IA 2PMEA 1RIQA 3L2WA 3JB9G 4ZN1A 2QQAA 2ZT6A 2VV5A 5CKFA 4YROA 3RKYA 3CCST 3DB3A 3NTKA 3IKMB 2AMCA 4QW2A 3ME9A 2CZ1B 2LC4A 3JCMX 4Q15A 2CJAA 2ALYB 3V7SA 2DZCA 3GP8A 3CC4T 5KNNA 3M9QA 5CCAA 3QG1A 1WYDA 3OW2S 1BI0A 3Q1JA 4M7AC 5GAN3 1EOVA 3QXEB 4H2YA 1HK9A 1NZ9A 3CMAA 4XTYA 1Q86C 3M4YA 3X20B 1N9SA 4YPFA 2QA4A 3M4GA 5A0GA 3L4GB 2RO0A 3HFNA 3OA6A 3PT9A 3CD6A 2ZZGA 3PMTA 3UFGA 2K57A 3VUBA 1VQ7T 2RD1A 5I2MA 3ZBDA 1WLEA 2LNVA 3A8GB 3M54A 2VYTA 4X9CA 3JCMP 2RHUA 5GANe 4KUDK 4C0DB 3UGTA 4HT8A 3HXWA 3VBBA 5FU6B 4XTXA 4P72A 4EDUA 4M75B 4IUTA 2RI3A 4QQGA 1U1TA 1SRYA 4C5GA 1QP2A 4M7DG 1UGQB 4LDVA 1W66A 2A3LA 2DIGA 5GAN2 4C92B 2QDYB 3CCRA 1YI2A 4QVCA 3IKLA 3BFMA 3META 1JJCB 4OGCA 4QVZA 4XQ3A 4PJOA 4Q5WA 2PUKB 4LVJA 1NE8A 5A2QE 2I4OA 2EJGA 3S6WA 3PIOA 3C94A 3C95A 3RERA 2EKOA 2OTLA 4C92D 3LWHA 4A54A 2KAFA 1VQ8T 1GGMA 4ATOA 3JCMW 1XQHA 5I2SA 2DZ9A 3MQZA 1KD1U 1J5WA 4XU2A 1M8VA 4YRPA 1N9WA 1I4K1 4XU3A 5IAYA 3PMIA 4ELYC 4JRPA 3A74A 1K9MC 4EMKA 3WQZA 1B70A 4HWTA 4OB0B 1N6AA 3CCJA 5A0DA 4OB3B 3CCLT 4ZGDB 4TVAB 5GANh 3JB9J 3FJPA 1USYA 2EYQA 3X25B 5GAN4 3M53A 2EQMA 1S72T 3A5YA 3MP6A 4TVRA 4MZTA 4FIBA 4J83A 4PLLA 4XTVA 3PCOB 1OYXA 2C8MA 4H2WA 1YIJT 4C0ZA 1Q86U 3NELA 4OMFB 4Y91A 1YITT 1M1KC 3VUZA 5LJ5j 4XU1A 4JS4A 4J15A 4M7DA 2QQ9A 3HFOA 1WPYA 4DOWA 3JB9H 3F70A 2RH2A 2QEXA 1YJWT 2WSEE 4TQFA 5KE2A 4QVDA 4C5IA 2KK4A 1K73C 1VQZA 4UP8A 3NFCA 1FYFA 2FVUA 3HFZB 3VQVA 2HD0A 2DO3A 4OB2B 4ZGJB 3KBGA 2LTOA 2VXEA 2CKKA 3HRIA 2XI9A 4BACA 4IUUA 1B8AA 1WJQA 2XD0A 1NJ2A 3LSSA 2CGHA 2DTOA 3P8TA 2XDDA 4M7AB 1YJ9A 5D6YA 2VC8A 1JJ2A 4M77D 3L2RA 2MI6A 4F7UB 3KXTA 1NJIC 4YCVA 1FX7A 1LJOA 4LDXA 3ZFJA 1YFTA 4H2XA 3LGFA 3LYIA 4YRFA 4E47A 4M7AD 4LDWA 4N0AC 2E65A 3EFRA 4YRKA 2DKGA 3MP1A 4WF2A 2ZR2A 3L2UA 4IUQA 4PJOE 1IL2A 3OW2A 3QJYA 1KQ1A 3HSBA 3GOXA 1O75A 3RKXA 4JUVA 3JCMd 3G4SA 1EFWA 5KH6A 1QW1A 2ZPIB 4TQDA 2LCCA 1K9MU 2K2VA 1KHCA 5D6XA 4UP7A 4FSXA 3JCMQ 1U1SA 2HQEA 3NEMA 2IY5A 3E1SA 2ZIMA 4C92F 2ZINA 3H8ZA 1XNIA 5GAOm 4JRKA 2WACA 1YJNT 4OGEA 4CH6A 3OYCA 2DXTA 2KQWA 2DVEA 2CIMA 1DJ7B 4XAXB 2Y4XA 2ARTA 3CCMA 4LVIA 4P71A 2QQBA 4C8QC 3VQWA 4E51A 4CH4A 5C53B 3G6ET 4C0DC 1M1KU 3OS2A 2CS7A 4YTLA 5HY6A 2JOYA 1V29B 2R5AA 4NCXA 2LT4A 2KSSA 3P8VA 1EQRA 1D3BB 1H4QA 4ME7A 2E41A 1VQPA 2QTXA 3QO7A 3E9FA 3URGA 2GCXA 1K73U 2RM4A 1SSFA 2ZPFB 1QVFA 1SERA 2ZNIA 2DEQA 5LJ3g 2F5KA 2PVDB 5HGQA 2MAMA 4A4FA 2RI2A 3CCUA 4PNOA 4M7DE 1G3SA 5KE3A 4ZIBA 3UT1A 4YREA 4M78G 2XTIA 1QVGS 2X4YA 2XDPA 3QZ9B 5HKCA 3NENA 5K1PA 2HBPA 1N8RC 2GFAA 4BUGA 2E1HA 2RHQB 4Y28E 5KCHA 1NPPA 1NJIU 1B34B 4HWRA 3N5BB 3RF1A 1HTTA 5GAMd 4M75G 2M16A 4XTWA 2Q7GA 3CPWA 3L1AA 1Y71A 3OS1A 1NNHA 2ZT7A 4C5HA 3A5ZB 4LVLA 1H4SA 2Y4YA 4C92G 3DSQA 5GAN7 3QO8A 3CXCS 1Y96A 3OYIA 1VQ9A 1KC8C 4K86A 2DPPB 4BD3A 3NTHA 3LGLA 1X54A 4E7LA 4M77F 4YYEA 3JCMe 2D0QB 1LYLA 4RG8A 4AH6A 3WVDB 3BJUA 4UC4A 1B7YB 1M1FA 3NTIA 5GAOn 1W2BS 2VXFA 2ZPHB 3VKIA 3P8HA 1VQKT 1BI1A 3ICAA 4CH5A 2XKOC 1VQ4A 4M7AF 5EG2A 5GAOr 3SWNA 1L0WA 3CCEA 2ALYA 2EQKA 3OS0A 1KG1A 4F7UF 2RHXA 4P75C 2GF7A 3MP8A 1VQ6A 4L59A 1NJ8A 3A8LB 1VQMT 1B76A 4BE1A 1BKBA 1OI1A 3HXXA 4M77C 4HVCA 3CCSA 3TREA 3OYFA 4R55A 4YRTA 4M78A 3M56A 4IUVA 1W4SA 3G1ZA 3L4GA 2EJ9A 5GMKl 2LVMA 4HA8A 2I4NA 2B8AA 3TEHB 4NL3A 1WJRA 3CC4A 3J7AF 4Q6GA 3UWNA 3CCQA 2OAUA 2DQ3A 4M75A 2PUOB 1FWZA 2XGTA 4H02A 1I81A 4P3NA 1Q81C 3CMAT 1SESA 4YDQA 4FM4B 2QA4T 2E3CA 1N8RU 3HPWA 2E6NA 3I56A 3HRKA 3PZCA 3CCVT 4C92A 3JCMh 1EVLA 2V8KA 4C8QB 3FRNA 3CD6T 3MEVA 3ASKA 3MEUA 2X4WA 3HL8A 3HTZA 3V8KA 4KT0E 3HY0A 4CS2A 3OB9A 5GANj 3G71A 1JRIA 4IURA 3QBYA 3TCJA 2LQ8A 2GFUA 2WSCE 2DTIA 2LRQA 2ARSA 2Q7HA 3E9HA 4LDUA 1G5HA 4BI4A 4J8OA 3HRTA 3INZA 4CH3A 5GAMe 4C8QD 4L5GA 5GAOl 1VQ5A 3QHSA 4P73C 3HXYA 2QHTA 3SFMA 3RUXA 2MMPA 5GAMj 1E1OA 5LJ3f 4JDSA 2BKDN 1KC8U 2ZR3A 3DLLA 3REUA 3M55A 3DB4A 4M7AG 3CCRT 3QKJA 4CRIA 3GLXA 4PL6A 4ZTFA 2VGNA 1UGPB 3LLRA 4XTUA 4F7UG 3I55A 1WNLA 1YFSA 4CS4A 2CJ9A 2RHSB 4D6WA 1KQSA 12ASA 3TUPA 2OTLT 4MMKA 2MF2A 1XTDA 1VQLT 2KMTA 2GQVA 5J39A 1H3ZA 4TVAA 3UGQA 3QYGB 1K8AC 3CC2A 1FXXA 2R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBW A;  3E9I A;  5GAN g;  4YCV A;  3A7R A;  1LJO A;  4M7D C;  1YFT A;  1H4V B;  4H2X A;  4C8Q A;  1JBM A;  4RCC A;  3RL6 A;  4TVW A;  4G85 A;  4P3O A;  3SWN B;  4YRF A;  1ADJ A;  2ZT8 A;  5LJ3 d;  3EFS A;  4M7A D;  3RIR A;  3JCM g;  1PYS B;  3R07 A;  1WU7 A;  5GAN d;  4N0A C;  3QO5 A;  2E65 A;  5LJ5 d;  3EFR A;  4YRK A;  2DKG A;  1E24 A;  4WF2 A;  2ZR2 A;  4HWO A;  1YCY A;  4PJO E;  1IL2 A;  2PMF A;  2Y90 A;  1KQ1 A;  2E64 A;  1HXD A;  1X56 A;  4WJ4 A;  3HSB A;  1YB3 A;  3AHU A;  1X2H A;  4NL2 A;  3RKX A;  4JUV A;  3JCM d;  4PJO D;  4CS3 A;  4YRM A;  2AMC B;  1EFW A;  5DY9 A;  4XTZ A;  4M78 B;  4YRR A;  4TQD A;  3V7R A;  4TVY A;  1JJC A;  3JB9 D;  4UP7 A;  5GAM h;  1QE0 A;  3JCM Q;  1U1S A;  2J3L A;  4DQ2 A;  3NEM A;  2IY5 A;  3HFZ A;  5I21 A;  1KOG A;  2I4M A;  4HT9 A;  2ZIM A;  2DJZ A;  1I5L A;  3LC0 A;  4C92 F;  2ZIN A;  4M78 E;  5GAO m;  4M77 G;  4JRK A;  4TTV A;  4CH6 A;  3P8Y A;  5F5W A;  3MF2 A;  4RQE A;  4M78 D;  5GMK e;  2DXT A;  1B70 B;  1ASZ A;  2DVE A;  2ZTG A;  2CIM A;  11AS A;  2RHS A;  1ADY A;  3REX A;  2ZZF A;  4X5O A;  4J6W A;  2ART A;  1H64 1;  3MF1 A;  3NET A;  2DTH A;  4P71 A;  2FB7 A;  4O2D A;  4YRJ A;  4C8Q C;  1KQ2 A;  3VQW A;  4M7A A;  5C52 B;  5ELN A;  4E51 A;  4H2V A;  4CH4 A;  5C53 B;  4EMK C;  2AKW A;  4YRQ A;  4HWP A;  5ELO A;  1TH7 A;  4NCX A;  2ZNJ A;  2I2L A;  4F7U A;  2YLB A;  4M77 B;  4J6Y A;  4LNS A;  4M75 E;  4WI1 A;  1NYR A;  2EWN A;  1KMN A;  3P8V A;  4A53 A;  1EQR A;  1D3B B;  1H4Q A;  3VQY A;  1E1T A;  3JCM b;  4RQF A;  4P74 A;  2E41 A;  1Y96 B;  4M75 D;  1NJ1 A;  5GAN 6;  2QTX A;  4G84 A;  3QO7 A;  4PJO G;  1E22 A;  1NJ5 A;  4XU0 A;  1PYS A;  4C92 E;  5GMK m;  4NOY A;  4V2S A;  4K87 A;  2DXU A;  2PME A;  2RM4 A;  1RIQ A;  3A32 A;  3JB9 G;  1X55 A;  3I7F A;  2ZT6 A;  1BIB A;  1SER A;  4YRO A;  2DEQ A;  5LJ3 g;  2ZNI A;  1I8F A;  2ODR C;  3RKY A;  5HGQ A;  1H4T A;  4UPA A;  3KFU A;  5LJ5 g;  3IKM B;  2AMC A;  4PNO A;  4M7D E;  3V8J A;  4PJO B;  4ZIB A;  3JCM X;  5GAO q;  4Q15 A;  3PCO A;  4YRE A;  4M78 G;  2CJA A;  2XTI A;  2ALY B;  4M7D D;  1NJ6 A;  3V7S A;  2DZC A;  2C7I A;  2EL9 A;  5K1P A;  5KNN A;  2YLC A;  3NEN A;  3V8L A;  5C51 B;  3UH0 A;  1ASY A;  1WYD A;  3QTC A;  4KQE A;  4P71 C;  2E1H A;  5GAM g;  4H2S A;  4RDX A;  2RHQ B;  4M7A C;  5GAN 3;  1EOV A;  4C8Q F;  4H2T A;  4H2Y A;  1HK9 A;  4XTY A;  1B34 B;  4HWR A;  4K88 A;  1Z7M A;  1M5Q 1;  3RF1 A;  1N9S A;  2ZGW A;  4OP0 A;  1ATI A;  4YPF A;  3M4G A;  1HTT A;  3RKW A;  4P75 A;  5GAM d;  4M75 G;  3L4G B;  4TWA A;  4XTW A;  2Q7G A;  3L1A A;  3BW1 A;  5GMK h;  3HFN A;  4ZTU B;  2ZZG A;  3UFG A;  2K57 A;  1NNH A;  2ZT7 A;  5GMK i;  2RD1 A;  1WLE A;  2QHS A;  1H4S A;  4M77 A;  5LJ3 e;  2FYK A;  4X9C A;  3JCM P;  2E5A A;  3QUI A;  3HY1 A;  3VQX A;  4H2X B;  1G51 A;  2I4L A;  3JCM J;  4C92 G;  3DSQ A;  4JLI A;  5GAN e;  5GAN 7;  5LJ5 e;  3QO8 A;  2EJF A;  3UGT A;  1QF6 A;  4EMK B;  1Y96 A;  4HT8 A;  3HXW A;  3VBB A;  4K86 A;  2RB6 A;  4XTX A;  5E3I A;  1HC7 A;  4P72 A;  2P0L A;  4M75 B;  4H2U A;  1SET A;  2DU5 A;  3GIB A;  5K1X A;  5GMK j;  4EMG A;  1X54 A;  3RAC A;  1U1T A;  4M77 F;  2DU7 A;  1SRY A;  4YYE A;  3JCM e;  2ZXF A;  2E10 A;  4C8Q E;  1LYL A;  3A7A A;  4M7D G;  4AH6 A;  3BJU A;  1B7Y B;  4KR2 A;  2DQ0 A;  1W66 A;  5GAN 2;  5GAO n;  4C92 B;  3A7U A;  2VXF A;  4QVC A;  1G5I A;  2ARU A;  3IKL A;  3BFM A;  3ICA A;  1EIY B;  1JJC B;  3VU3 C;  4CH5 A;  1X01 A;  4XQ3 A;  4PJO A;  4M7A F;  4YRN A;  5GAO p;  5GAO r;  3SWN A;  3V7C A;  4RMF A;  1L0W A;  1NYQ A;  4KR3 A;  4X9D A;  2ALY A;  4EX5 A;  3HFV A;  4F7U F;  2G4C A;  3IAL A;  4M7D B;  2EJG A;  2I4O A;  4ZTZ B;  4P3P A;  4P75 C;  3RER A;  2EAY A;  1BIA A;  4YP0 A;  4C92 D;  3JCM f;  3BDU A;  4PJO F;  4A54 A;  1NJ8 A;  4OLF A;  1B76 A;  2QHU A;  1GGM A;  2QHV A;  1N9R A;  3JCM W;  4EMH A;  3HXX A;  1B34 A;  4M77 C;  4HVC A;  3FIF A;  3BY7 A;  3JB9 F;  2ODR D;  2DZ9 A;  4YRT A;  4M78 A;  5CAI A;  4YCU A;  2ZT5 A;  2Q5H A;  1J5W A;  3G1Z A;  3L4G A;  2EJ9 A;  5GMK l;  3HXV A;  4HA8 A;  2AKW B;  2I4N A;  4PG3 A;  4WJ3 M;  3QSU A;  1WQW A;  4XU2 A;  4P72 C;  4YCW A;  1M8V A;  3L2Z A;  1N9W A;  4YRP A;  1I4K 1;  4XU3 A;  4BW9 A;  4YRI A;  4P73 A;  3PGG A;  3A5Z A;  3TEH B;  4NL3 A;  3LSQ A;  1LOJ A;  4M78 F;  4Q6G A;  2ZIO A;  4M7A E;  2HNI A;  3A74 A;  3JCM V;  2Q5I A;  4J5Y A;  4C8Q G;  3OD1 A;  4EMK A;  3WQZ A;  1MGQ A;  1B70 A;  1WQ7 A;  4HWT A;  4F7U E;  5LJ3 h;  2DQ3 A;  4M75 A;  3QNE A;  2XGT A;  4H02 A;  4YRS A;  1I81 A;  4P3N A;  4P74 C;  4TVA B;  4PJO C;  5GAN h;  5LJ5 h;  3MEY A;  3JB9 J;  3FJP A;  1SES A;  1YGB A;  3SWN C;  1USY A;  1YFR A;  2P5I A;  4HWS A;  1Z7N A;  4YDQ A;  4YRC A;  1X2G A;  1B7Y A;  4L87 A;  5GAN 4;  2E3C A;  3ERR A;  2ZZE A;  1EVK A;  1KMM A;  3A5Y A;  1LNX A;  3HRK A;  3PZC A;  3RES A;  4C92 A;  4M75 F;  3JCM h;  1EVL A;  4XTV A;  4C8Q B;  1D3B A;  2JN0 A;  3PCO B;  1EIY A;  2C8M A;  4YRG A;  4H2W A;  5GAN 5;  5LJ3 j;  3V8K A;  3HTZ A;  3HY0 A;  3NEL A;  4Y91 A;  2CJB A;  3IG2 A;  4CS2 A;  3RGL A;  5GAN j;  2DDZ A;  1JRI A;  5LJ5 j;  4XU1 A;  3W3S A;  3TEG A;  4J15 A;  2DTI A;  4M78 C;  4M7D A;  4XEO A;  2ARS A;  2Q7H A;  4PHC A;  3E9H A;  3HFO A;  4XEM A;  1WPY A;  4EO4 A;  2YHT A;  4BWA A;  1G5H A;  3INZ A;  3JB9 H;  4CH3 A;  5GAM e;  4C8Q D;  5GAO l;  3M4P A;  3QHS A;  3HXZ A;  4P73 C;  3HXY A;  2QHT A;  3RUX A;  4N0A A;  5GAM j;  1E1O A;  5LJ3 f;  4M7D F;  4TQF A;  4QVD A;  2J3M A;  1VQZ A;  2ZR3 A;  4UP8 A;  3REU A;  2Q7E A;  1FYF A;  5GAN f;  5LJ5 f;  2IY5 B;  4M7A G;  1C0A A;  3CMQ A;  3HFZ B;  3VQV A;  3M4Q A;  4M75 C;  4MML A;  3SB2 A;  2ZCE A;  4DPG A;  4XTU A;  4F7U G;  2VXE A;  3QO3 A;  1WNL A;  3TEH A;  1BBU A;  3HXU A;  3JCM c;  2RHQ A;  3HRI A;  1USY C;  1YFS A;  5GAN 8;  4RCB A;  4CS4 A;  4YRL A;  1B8A A;  2CJ9 A;  2RHS B;  3A31 A;  2RA2 A;  12AS A;  1NJ2 A;  3LSS A;  3TUP A;  5GAM f;  4MMK A;  2CGH A;  4C92 C;  2DTO A;  4J6X A;  4M77 E;  3FB9 A;  3P8T A;  4M7A B;  2VC8 A;  4JRI A;  4TVA A;  3UGQ A;  4M77 D;  4UP9 A;  3JB9 I;  4F7U B; 
#chains in the Genus database with same CATH topology
 1RL2 A;  2DLP A;  1BBW A;  4C0F A;  4WTO B;  5IXF A;  5GAN g;  2PNI A;  5J26 A;  3A7R A;  2D8J A;  1H4V B;  3NMZ C;  3RL6 A;  4ZNX A;  4X34 A;  5CIU A;  5AYF A;  1ADJ A;  4JRQ A;  5LJ3 d;  1M3A A;  1RAD B;  2VGM A;  3OYM A;  1X43 A;  4RTU A;  1PNJ A;  3EG9 A;  3R07 A;  3VS3 A;  1WU7 A;  4J9I A;  4OML A;  4Z02 A;  2IIM A;  4B9W A;  3J81 E;  1IRE B;  1MHN A;  2DK3 A;  2EYW A;  1Q82 C;  2KRO A;  4C0G A;  3CCL A;  3TEE A;  2E64 A;  4IKF A;  4A4G A;  3CCJ T;  4WJ4 A;  3MJX A;  5CKB A;  1WJS A;  3JAM E;  4HCC A;  4PJO D;  1X2H A;  5CKH A;  4DBQ A;  5DY9 A;  2NUT B;  3OYB A;  1KC8 R;  2OTL Q;  3A8O B;  1MNE A;  4QT7 A;  2D9T A;  1VQL Q;  4QQD A;  1TSF A;  3JB9 D;  2ED1 A;  2NUP B;  5GAM h;  1M2O A;  1QE0 A;  2RQW A;  3A98 A;  1CKB A;  3M0R A;  3X28 B;  1QVF P;  3HFZ A;  3L2Q A;  1KOG A;  2I4M A;  4DEX A;  1JB0 E;  1Q81 U;  4M78 E;  2KRM A;  5IHN A;  4PJN A;  3GPL A;  1AHJ B;  3HRU A;  5F5W A;  2X4X A;  3MF2 A;  4Z88 A;  5GMK e;  1ASZ A;  2W0Z A;  1B70 B;  3MEW A;  3REX A;  1WHM A;  1X6G A;  1Y7X A;  3O8V A;  1H64 1;  3MF1 A;  4JPB W;  2FB7 A;  4YRJ A;  1ZUU A;  1KQ2 A;  2RJF A;  4M7A A;  4A4H A;  1BK2 A;  1OZ2 A;  4H2V A;  1YJW A;  2LJ3 A;  2ECZ A;  2V1Q A;  2MOX A;  4RMO A;  2AKW A;  5ELO A;  1Q7Y C;  2QEX T;  2I2L A;  4F7U A;  4M77 B;  3M0S A;  4LNS A;  4M75 E;  2KVQ G;  1NYR A;  2EWN A;  6AT1 B;  4A53 A;  2YRD A;  2COY A;  3VQY A;  1WIE A;  3JCM b;  3FEO A;  1NJ1 A;  2LQK A;  1AZG B;  4G84 A;  2PU9 B;  3S3O A;  3CPW P;  4HCZ A;  2DIL A;  1E22 A;  1NJ5 A;  2SEM A;  3WXM B;  1MUZ A;  4C92 E;  5GMK m;  1UJ0 A;  4K87 A;  4EPC A;  2O4X A;  3A32 A;  1X55 A;  1SHF A;  3I7F A;  1ZBX A;  5I11 A;  4PJJ A;  1I8F A;  2E3I A;  3FDR A;  2LQN A;  4UPA A;  2CUD A;  4JJB A;  5LJ5 g;  2DBM A;  3E2U A;  4ZGE B;  2MPX C;  1EX4 A;  3OBW A;  5GAO q;  1PKS A;  4M7D D;  4KBM B;  1NJ6 A;  4KGZ B;  1Q81 R;  2EL9 A;  2VAS A;  1WHG A;  2YWW A;  3MO8 A;  2JNG A;  3V8L A;  5C51 B;  3UH0 A;  4O6J A;  4KQE A;  2LCS A;  4QQ6 A;  4H2S A;  4RDX A;  1K8A U;  2RJE A;  4C8Q F;  4CI0 C;  4H2T A;  1MMD A;  2NS6 A;  3R6N A;  4K88 A;  3OYA A;  1M5Q 1;  1ATI A;  2ZGW A;  4OP0 A;  1M2V B;  1A0N B;  1M3C A;  1VUB A;  2RK2 A;  4TWA A;  2DFU A;  4XK8 E;  1ZSZ A;  1I5O B;  5CO7 A;  5GMK h;  3G4S T;  4ZTU B;  1UEC A;  4GY5 A;  5KCO A;  4II1 A;  2FZK B;  5GMK i;  2DD4 A;  1EIF A;  2QHS A;  1R8O B;  3VS1 A;  2QXF A;  3CME A;  4LVM A;  3H9N A;  3THK A;  5LJ3 e;  2FYK A;  4HXJ A;  2HAX A;  3QUI A;  3NPF A;  3VQX A;  1Q82 U;  1F1B B;  2RMO A;  4H2X B;  5FRM A;  3JCM J;  4LDY A;  5FRO A;  4JLI A;  1GFD A;  1QF6 A;  2EJF A;  1K4U S;  4DBR A;  2F5T X;  1QCF A;  2DL5 A;  2ZPE B;  2RB6 A;  5E3I A;  5DLO A;  1HC7 A;  1VQO A;  1YJN A;  1UGS B;  2DU5 A;  3EGU A;  3GIB A;  2A37 A;  2DD5 A;  3QZ5 B;  2DXB A;  5K1X A;  1OU8 A;  1G3Y A;  2RN8 A;  5C6S A;  2LQW A;  4AFZ C;  5C0M A;  2E10 A;  5CQX A;  4F04 B;  5FU7 B;  2DAQ A;  4B9X A;  4KR2 A;  1WFW A;  3CCM T;  4HT4 A;  3L2V A;  4RTY A;  1VA7 A;  1VYV A;  1X27 A;  2LDM A;  4ZN3 A;  3A7U A;  1K9A A;  3CBO A;  2O01 E;  1FYN A;  3PVQ A;  1EIY B;  2CP6 A;  3CBP A;  1X01 A;  1UG1 A;  3OYK A;  1UEB A;  4OVA A;  1B7T A;  2RHZ A;  4YRN A;  5GAO p;  4K11 A;  4DOV A;  1WZO A;  1UB4 A;  2DET A;  4Z8A A;  1AWX A;  1MND A;  1NYQ A;  4KR3 A;  2LX9 A;  4D8D A;  1QKX A;  5HK0 A;  2G4C A;  1K8A R;  2YUN A;  1YHQ A;  4PKC C;  1H3H A;  1VQP T;  4Y92 A;  2EGE A;  1PC0 A;  2EAY A;  1H92 A;  2LZ6 B;  4YP0 A;  3OS5 A;  3BDU A;  4PJO F;  1RI0 A;  1Q7Y U;  4RG2 A;  3MCA B;  2JS0 A;  1PSE A;  2QHV A;  3UAT A;  2RHI A;  2OTJ A;  4EMH A;  3ZL7 C;  1B34 A;  2P0P A;  4KUL A;  2CT4 A;  3BY7 A;  4ANJ A;  3JB9 F;  2OAW A;  3SDZ A;  2ODR D;  3QDR B;  5CAI A;  5I22 A;  2HEQ A;  2Q5H A;  2OI3 A;  3E19 A;  1M4Z A;  4PG3 A;  3OYG A;  3IQL A;  1WQW A;  3CCU T;  4P72 C;  1VQN T;  4YCW A;  1WGS A;  1Q82 R;  2QK0 A;  4BW9 A;  4YRI A;  2KT8 A;  3CC7 T;  3A5Z A;  1RAB B;  5KYY A;  3LSQ A;  4LD9 K;  2JS2 A;  2FPD A;  2ZIO A;  4M7A E;  2HNI A;  4AFU C;  3JCM V;  2K4Y A;  3VS4 A;  4J5Y A;  1VOM A;  1EFN A;  3MHX A;  4C8Q G;  2F2W A;  3OD1 A;  4NS5 A;  1WQ7 A;  4F7U E;  4BI3 A;  1NEG A;  2KDS A;  5LJ3 h;  2J05 A;  1V76 A;  1GBR A;  4YRS A;  2EKH A;  3LH0 A;  1JXM A;  3CQT A;  1VQP Q;  4PJO C;  3LH5 A;  1I07 A;  3MEY A;  3EH1 A;  2E70 A;  2XHC A;  2QGG A;  1T0J A;  4P5N A;  2K79 A;  2RPN A;  3P8D A;  1Z7N A;  2QQR A;  1U06 A;  1B7Y A;  1NBE B;  4L87 A;  1KQS P;  2ZZE A;  2M1H A;  1EVK A;  1KMM A;  3RES A;  2KNB B;  1JO8 A;  2BIV A;  2HQX A;  3M57 A;  4R56 A;  5GAN 5;  2RI5 A;  1WXU A;  1HSQ A;  4BE0 A;  3QII A;  1M3B A;  1IXD A;  3RGL A;  1VQN Q;  2LJ1 A;  3TSZ A;  1NYF A;  3TEG A;  4PHC A;  4AMC A;  1IZ6 A;  1Q7Y R;  3CC7 Q;  1XJW B;  2YHT A;  1ZBJ A;  1J3T A;  3X26 B;  1N27 A;  2RF0 A;  1RLQ C;  3HXZ A;  3UA6 A;  1GXI E;  3TU4 K;  4N0A A;  4B6M A;  3VV0 A;  4M7D F;  2MK5 A;  1YBY A;  5M9O A;  1O9S A;  2J3M A;  2X3W D;  5AT1 B;  4AG2 C;  3P8B B;  3M59 A;  2Q7E A;  2HKN A;  5LJ5 f;  1SRL A;  2MYS A;  2CUB A;  4BB7 A;  1X69 A;  1VQ4 T;  4MML A;  3SB2 A;  2ZCE A;  3FC3 A;  4RUG A;  3TEH A;  1BBU A;  2DER A;  3CCE T;  1ZX6 A;  3QWX X;  5D6W A;  3REA B;  4GLK A;  1SHG A;  1USY C;  2M0Y A;  2XID A;  4ELZ C;  5GAN 8;  4RCB A;  1JEG A;  3A31 A;  2NLU A;  2RA2 A;  2L8D A;  2FZG B;  1D09 B;  2AKK A;  1UHF A;  2IG0 A;  4J6X A;  1VQ6 T;  1JJ2 S;  5CVI A;  1KIK A;  3H6Z A;  3VS5 A;  4JRI A;  3M5A A;  3OMG A;  2EYX A;  2R57 A;  2JM8 A;  3L42 A;  4F16 A;  2ZCF B;  3UF4 A;  4M7D C;  5FLX E;  2EIF A;  1VQK Q;  3TQ7 P;  4C8Q A;  4MDX A;  4RCC A;  4TVW A;  1AT1 B;  2EQI A;  3PFS A;  4G85 A;  2CZ7 B;  3SWN B;  4MDW A;  3QJ6 A;  4OMO A;  2ZT8 A;  1M30 A;  3EFS A;  4E7S A;  3HKS A;  1G5V A;  3JCM g;  1PYS B;  2ZPB B;  2O9S A;  4OMN A;  1RAF B;  5LJ5 d;  3JRZ A;  1VYU A;  3EGD A;  1C6V X;  1VQ4 Q;  1UGR B;  3CCQ T;  4HWO A;  1OEB A;  1X6O A;  3R6O A;  2YRV A;  2PMF A;  3CCE Q;  5CKE A;  1HYO A;  2LX7 A;  2XU8 A;  1HXD A;  1X56 A;  1VQM Q;  1YB3 A;  1KHI A;  3AHU A;  4NL2 A;  4YRM A;  2EGA A;  3T9N A;  2AMC B;  1G3W A;  1VQ7 A;  4M78 B;  3A1P A;  3I35 A;  3HRS A;  2QQS A;  2K7A A;  2H3J A;  2FHD A;  2DM1 A;  4TVY A;  1JJC A;  3CCV A;  3I56 T;  3U23 A;  5LL6 S;  1LCK A;  2BZ8 A;  2J3L A;  4J7I A;  3PE0 A;  4DBF A;  3S3M A;  2WSF E;  1IHW A;  1VIF A;  3C4S A;  4PJL A;  3LC0 A;  3QDF A;  2L2P A;  4J9D A;  1Q95 G;  3TVT A;  4E7K A;  4M77 G;  1LPL A;  4TTV A;  3P8Y A;  2EGC A;  3G71 T;  4M78 D;  2NWM A;  11AS A;  2GTJ A;  3OSS C;  2RHS A;  3JV3 A;  3HHT B;  3QPH A;  2ZZF A;  4X5O A;  2XG8 D;  3NET A;  2DTH A;  4JJD A;  2L3S A;  5C52 B;  2YUO A;  1VQ5 T;  5ELN A;  4BY6 B;  3FLG A;  5L8R E;  4E7Z A;  1YI2 T;  4YRQ A;  3OW2 P;  1S1N A;  4HVV A;  2QA4 Q;  4J6Y A;  4WI1 A;  1YCS B;  1KMN A;  1OQK A;  1BYM A;  2X35 A;  3CD6 Q;  2BZX A;  4M75 D;  1WHH A;  5FU7 C;  4KUI A;  2HZY A;  4BDZ A;  1KSW A;  2RJD A;  4OB1 B;  3HTR A;  3I56 Q;  1M9S A;  2SRC A;  3I55 T;  3GF5 A;  4V2S A;  4NOY A;  1VQ8 A;  4HCB A;  2KT1 A;  2DXU A;  1QVF S;  2HDA A;  1U5S A;  4AFQ C;  1BIB A;  1N8R R;  1VQL A;  1D1A A;  2ODR C;  3A8M B;  3PTA A;  4FT4 A;  1H4T A;  4IUP A;  3KFU A;  3LW5 E;  2CP3 A;  2LNH B;  1IHV A;  3GBQ A;  3V8J A;  3CC2 T;  2JTF A;  2NUT A;  4PJO B;  2YUQ A;  2QI2 A;  1RAG B;  2PVG B;  1B07 A;  1NPR A;  3PCO A;  2CZ6 B;  1CSK A;  3RDV A;  3ER0 A;  1PSF A;  2NUP A;  2C7I A;  3CCR Q;  1YI2 Q;  4LVK A;  2YLC A;  1BI3 A;  2EBP A;  2AHJ B;  1ASY A;  1SEM A;  3GNF B;  3OYY A;  3QTC A;  1QVG A;  2F2V A;  2X4J A;  3LX7 A;  2FPF A;  3PNW C;  4P71 C;  3CBM A;  5GAM g;  4C5E A;  5HK3 A;  2RK1 A;  3H0F A;  1OX8 A;  3C12 A;  4CC3 A;  1ZUK A;  2OX7 A;  1QP3 A;  2ABL A;  2JTM A;  2P0Q A;  3VS7 A;  5EC7 A;  2ATC B;  3A8H B;  1Z7M A;  2W10 A;  4FT2 A;  1CKA A;  1TU0 B;  3I55 Q;  3CPW S;  1TS9 A;  4E7I A;  3RKW A;  1S72 A;  4P75 A;  3BDL A;  3ZEH A;  2CYZ B;  3M0Q A;  2PQW A;  3BW1 A;  1K0X A;  4A63 B;  2RHY A;  2CZ0 B;  5KYU A;  1YIJ A;  3DKM A;  2A28 A;  2K5F A;  1YIT A;  4M77 A;  2E5A A;  3HY1 A;  2RQR A;  2KYM A;  3EGX B;  1G51 A;  2I4L A;  2COZ A;  2JM9 A;  2HMA A;  2JZ2 A;  5LJ5 e;  1R0C B;  2L3R A;  4EMK B;  2K3Y A;  2P0L A;  3CXC A;  2K3X A;  5ECA A;  4H2U A;  1SET A;  4HVU A;  3EG9 B;  2J6F A;  4CC2 A;  4EMG A;  5GMK j;  1AWJ A;  3VS2 A;  2BZY A;  3RAC A;  2DU7 A;  2ZXF A;  4C8Q E;  4R0K A;  4WCI A;  3A7A A;  3CEY A;  3J80 E;  4MZM A;  1AOJ A;  2DYB A;  3OY9 A;  2DQ0 A;  3OYE A;  2A8E A;  3CCJ Q;  1WHL A;  1UUE A;  1G5I A;  2ARU A;  1W2B A;  3PIP A;  3VU3 C;  1B3Q A;  2DXC A;  5CQY A;  3V7C A;  4RMF A;  4DA4 A;  4X9D A;  1PG5 B;  2HL5 C;  4EX5 A;  3EH2 A;  3HFV A;  3IAL A;  2CH4 W;  4M7D B;  4ZTZ B;  2E12 A;  4P3P A;  4RTW A;  3G7Z A;  3EFO B;  1X75 C;  1MV3 A;  1BIA A;  2V26 A;  4QKU A;  2DRK A;  3HP9 A;  3RMQ A;  3JCM f;  1SKU B;  4OLF A;  3EAE A;  1QQJ A;  3EG3 A;  2QHU A;  4FL6 A;  1N9R A;  4LD6 A;  1YJ9 T;  2LCL A;  4A4E A;  3FIF A;  2J7I A;  3WVE B;  3UDC A;  4YCU A;  2ZT5 A;  2L5Q A;  2XIC A;  5DM7 R;  3HXV A;  2AKW B;  4PFO A;  4WJ3 M;  3QSU A;  4BE2 A;  3L2Z A;  2FL7 A;  2QEX Q;  4P73 A;  1ZUY A;  3PGG A;  4N4H A;  3OYJ A;  1LOJ A;  2QAZ A;  4M78 F;  3SD4 A;  1UE9 A;  2Q5I A;  1EZZ B;  1QVP A;  2KE9 A;  1MGQ A;  4HKE A;  3VYG A;  2D6F A;  1WHJ A;  3QNE A;  3S3N A;  3BE3 A;  4N4I A;  2O4X B;  4P74 C;  3I5R A;  5LJ5 h;  1YGB A;  3SWN C;  1YFR A;  2P5I A;  4HWS A;  2JVV A;  4YRC A;  1X2G A;  2M9U A;  3ERR A;  1LNX A;  4ZTJ A;  1YJ9 Q;  1M90 C;  4M75 F;  4A4K A;  3OYN A;  2DRM A;  4F14 A;  2ROL A;  4F17 A;  3OYH A;  1P92 A;  1D3B A;  2JN0 A;  1EIY A;  2XDB A;  2QTV A;  4YRG A;  2DL3 A;  4VUB A;  2EQU A;  5LJ3 j;  3CME T;  1OUL A;  1BU1 A;  5FRN A;  4N4G A;  2CJB A;  3IG2 A;  1MMG A;  3VYH B;  5IN1 A;  2A7Y A;  2DDZ A;  3W3S A;  3GNG A;  4LXC A;  4M78 C;  4XEO A;  1U8R A;  4XEM A;  1FMW A;  4EO4 A;  1XOV A;  4BWA A;  4DBH A;  4J9B A;  2M0O A;  1R0B G;  2KRN A;  1VQO T;  2QG9 B;  3OBY A;  2R58 A;  5A0L A;  3H41 A;  1PKT A;  3M4P A;  1H8K A;  3G6E A;  4LUE A;  1TUC A;  1Y07 A;  1ZHI A;  5DLQ E;  3LWI A;  4BDY A;  2X3X D;  2C06 A;  2FZC B;  2DL7 A;  5GAN f;  3G4S Q;  2IY5 B;  1NEB A;  1C0A A;  3CMQ A;  2ENM A;  4JS5 A;  3M4Q A;  1AWO A;  5FU6 C;  4M75 C;  4HCK A;  1BBZ A;  4DPG A;  3QO3 A;  2F69 A;  1BI2 A;  2HL3 A;  3HXU A;  3JCM c;  2RHQ A;  4IIO A;  1KQS S;  1OU9 A;  2EPD A;  4BY6 C;  4YRL A;  3X24 B;  1OPK A;  1WI7 A;  3CME Q;  4BI8 B;  1YHQ T;  2D0N A;  2FEI A;  5GAM f;  4C92 C;  2VVK A;  4M77 E;  2MWO A;  3FB9 A;  2L89 A;  4J7F A;  5CK9 A;  1I0C A;  2E5Q A;  4O5V A;  3UPU A;  2BUD A;  4E7J A;  4MZP A;  1RAE B;  2OTJ T;  1JXO A;  4UP9 A;  3JB9 I;  2ZPG B;  3MKD A;  4AT1 B;  3CCM Q;  3E9I A;  2MWP A;  4E7H A;  2CSQ A;  5J3B A;  3RMS A;  4JLG A;  1UFF A;  2NYS A;  1VQN A;  3QYH B;  2FRW A;  1G3T A;  4JZ3 A;  1JBM A;  4P3O A;  3CC7 A;  1G83 A;  2EQJ A;  4OF1 A;  3OMC A;  3RIR A;  5KYW A;  3OQ5 A;  4RKU E;  2AZV A;  5GAN d;  3QO5 A;  2V8I A;  1YN8 A;  2E6Z A;  4J9F A;  1E24 A;  3VS0 A;  1YCY A;  2DX1 A;  1AEY A;  4FW2 A;  1NLO C;  1TXQ A;  1Z9Z A;  2FG0 A;  3E9G A;  2Y90 A;  2DE0 X;  2P0K A;  2DEU A;  2XK0 A;  4LN2 A;  4CS3 A;  4XTZ A;  5CR2 A;  1UDL A;  2O31 A;  2EFI A;  1M1G A;  4PLI A;  2DBK A;  4YRR A;  3OSV A;  3V7R A;  4KGV B;  5FWC A;  4DQ2 A;  3CCU Q;  5I21 A;  2DMO A;  5FWB A;  4HT9 A;  2DJZ A;  1I5L A;  2J06 A;  3VJP A;  1VQ9 T;  2K5L A;  4LE9 A;  4RQE A;  4JJN K;  3DLM A;  4GBQ A;  2JUF A;  2ZTG A;  2DL4 A;  1WXT A;  1M90 U;  1ADY A;  2PVO B;  3JSC A;  2DIQ A;  4J6W A;  2GTO A;  2EVR A;  4FU6 A;  4L6V 5;  4O2D A;  4M4Z A;  1QVG P;  3MEA A;  2G3R A;  4LUD A;  1VQK A;  2P4T A;  1K0S A;  2VUB A;  3KUF A;  4EMK C;  2ZZD A;  4CC4 B;  2VWF A;  4HWP A;  1ABQ A;  3EG2 A;  1TH7 A;  2H3E B;  3OYL A;  2ZNJ A;  1GCP A;  2YLB A;  1OOT A;  3M58 A;  2X51 A;  2XMF A;  1ZQ1 A;  2LT1 A;  5CKD A;  1E1T A;  4RQF A;  4P74 A;  1KD1 C;  1OZ3 A;  1Y96 B;  2KY9 A;  1IB8 A;  5GAN 6;  1M8M A;  2RJC A;  4PJO G;  1ACM B;  3CPF A;  4RTZ A;  4XU0 A;  1VQM A;  1PYS A;  3OYD A;  1PHT A;  5IT9 E;  2IVW A;  2Z0W A;  1VIE A;  2V8J A;  2K5I A;  2PME A;  1RIQ A;  3L2W A;  3NGP A;  2DL8 A;  3JB9 G;  4ZN1 A;  2QQA A;  1VQ9 Q;  2ZT6 A;  2VV5 A;  2P84 A;  5CKF A;  1W6X A;  4FW1 A;  1SRM A;  4YRO A;  3RKY A;  3CCS T;  2GBQ A;  3DB3 A;  3NTK A;  1OX9 A;  4ORZ A;  3IKM B;  2AMC A;  3CXC P;  4QW2 A;  2DA9 A;  3ME9 A;  2CZ1 B;  2QGF B;  2LC4 A;  1WDX A;  3JCM X;  4Q15 A;  2CJA A;  2ALY B;  2C0T A;  3V7S A;  1MMN A;  2DZC A;  1NYG A;  3GP8 A;  2L0A A;  1G2B A;  3CC4 T;  4EIK A;  1KK7 A;  5KNN A;  4FYX B;  2KEA A;  3M9Q A;  5CCA A;  4RTT A;  3QG1 A;  1WYD A;  1UTI A;  2CDT A;  3OW2 S;  1BI0 A;  3Q1J A;  4M7A C;  5GAN 3;  2K6D A;  1EOV A;  1RAA B;  3QXE B;  1M90 R;  5KYX A;  4H2Y A;  1HK9 A;  1NZ9 A;  3CMA A;  2H8H A;  4XTY A;  1Q86 C;  3M4Y A;  2AK5 A;  3X20 B;  1N9S A;  4YPF A;  3RR6 A;  2A0F B;  2QA4 A;  3M4G A;  3AT1 B;  1VQ6 Q;  4PK4 A;  1SG5 A;  5A0G A;  4PFZ A;  5GJV B;  3L4G B;  2RO0 A;  3HFN A;  3OA6 A;  3PT9 A;  3CD6 A;  2ZZG A;  3PMT A;  3UFG A;  2K57 A;  3VUB A;  1VQ7 T;  1OPL A;  2RD1 A;  5I2M A;  3ZBD A;  1WLE A;  3CCS Q;  2LNV A;  4GLM A;  2GQI A;  3A8G B;  5FW9 A;  1WHK A;  4DEY A;  3M54 A;  2VYT A;  4X9C A;  3JCM P;  2X9H A;  2HBW A;  4E6R A;  2OJ2 A;  2RHU A;  1D0X A;  1YFN A;  5GAN e;  4KUD K;  2O9V A;  4C0D B;  3UGT A;  4HT8 A;  3HXW A;  3VBB A;  5FU6 B;  4XTX A;  4P72 A;  4EDU A;  2AT1 B;  4M75 B;  4RTV A;  4IUT A;  5D7U A;  4PJM A;  3CC4 Q;  2RI3 A;  4QQG A;  1V1C A;  2JMC A;  4IIM A;  1U1T A;  1SRY A;  4C5G A;  2BE9 B;  9ATC B;  1QP2 A;  2JW4 A;  3CCQ Q;  4M7D G;  1UGQ B;  4LDV A;  4OMM A;  1K76 A;  1MMA A;  1W66 A;  2DJQ A;  2A3L A;  2DIG A;  5GAN 2;  4C92 B;  2J6K A;  2QDY B;  3CCR A;  3C0C A;  1YI2 A;  4QVC A;  2DVJ A;  3IKL A;  3BFM A;  3MET A;  3MPU B;  1JJC B;  4OGC A;  4QVZ A;  4XQ3 A;  4PJO A;  1BB9 A;  4Q5W A;  2E5K A;  2GNC A;  2PUK B;  1TUG B;  3UA7 A;  4LVJ A;  1NE8 A;  1WYX A;  5A2Q E;  2I4O A;  2EJG A;  2RQU A;  3S6W A;  3PIO A;  3C94 A;  3C95 A;  3RER A;  2EKO A;  2KXD A;  2OTL A;  4ESR A;  1ZSZ C;  4C92 D;  3LWH A;  4A54 A;  2KAF A;  2FO0 A;  3KFV A;  3G71 Q;  1VQ8 T;  1NM7 A;  4JJC A;  4ATO A;  1GGM A;  3JCM W;  1XQH A;  5I2S A;  2FPE A;  2DZ9 A;  3MQZ A;  1KD1 U;  3FJ5 A;  1J5W A;  2QAS A;  3H0I A;  1VQ5 Q;  3H0H A;  3M0T A;  2RNA A;  4XU2 A;  1M8V A;  4YRP A;  1N9W A;  1X2K A;  1I4K 1;  4XU3 A;  5IAY A;  4J9C A;  3PMI A;  2CT3 A;  4FYW B;  5L23 A;  2G6F X;  4KRT A;  4ELY C;  4JRP A;  3EGX A;  2ED0 A;  3A74 A;  1W70 A;  1K9M C;  4J9E A;  4EMK A;  3WQZ A;  1B70 A;  4HWT A;  4OB0 B;  1YP5 A;  4FCY A;  1N6A A;  3CCJ A;  1WLP B;  3REB B;  5A0D A;  4OB3 B;  2VKN A;  3CCL T;  1T3S A;  4ZGD B;  4TVA B;  1X2Q A;  2YDL A;  3SEM A;  5GAN h;  3JB9 J;  3FJP A;  2DYI A;  1USY A;  2EYQ A;  3X25 B;  2PTK A;  5GAN 4;  3M53 A;  1RAI B;  2EQM A;  1S72 T;  1VQ8 Q;  3A5Y A;  3MP6 A;  4TVR A;  4MZT A;  3EG0 A;  2B86 A;  4FIB A;  4J83 A;  4PLL A;  1YWP A;  4XTV A;  3CC2 Q;  3PCO B;  4Z89 A;  1OYX A;  2C8M A;  2AKL A;  4H2W A;  1YIJ T;  4C0Z A;  1Q86 U;  3NEL A;  4OMF B;  4Y91 A;  1YIT T;  1M1K C;  3VUZ A;  1G8X A;  5LJ5 j;  4OMP A;  4XU1 A;  4JS4 A;  1RI9 A;  4J15 A;  4M7D A;  2QQ9 A;  3HFO A;  1WPY A;  4DOW A;  3EFO A;  1RLP C;  2KYB A;  3JB9 H;  3F70 A;  1KD1 R;  2E4H A;  1SPK A;  2RH2 A;  1PM3 A;  2QEX A;  1YJW T;  4J9H A;  2WSE E;  4TQF A;  5KE2 A;  1WXB A;  4QVD A;  4C5I A;  3CCL Q;  2KK4 A;  1K73 C;  1VQZ A;  4UP8 A;  1QMC A;  3NFC A;  4X1V A;  1FYF A;  2FVU A;  2JT4 A;  5KYU B;  3HFZ B;  3VQV A;  2HD0 A;  3VRY A;  2DO3 A;  4OB2 B;  1QWE A;  4ZGJ B;  1S72 Q;  1TTH B;  1C0M A;  3KBG A;  2LTO A;  2VXE A;  1NLP C;  2KXC A;  2CKK A;  3M0P A;  3PVL A;  3HRI A;  2P4R A;  2XI9 A;  4BAC A;  1KFZ A;  4IUU A;  1B8A A;  1WJQ A;  1YIJ Q;  2XD0 A;  4KH0 B;  1NJ2 A;  3LSS A;  1YIT Q;  1QKW A;  2CGH A;  2CRE A;  2DTO A;  2A36 A;  3P8T A;  2GGR A;  1M2V A;  2XDD A;  4M7A B;  1YJ9 A;  5D6Y A;  2HCK A;  1IRX A;  2VC8 A;  1K1Z A;  1JJ2 A;  2LP5 A;  4E2F B;  3O5Z A;  4M77 D;  3L2R A;  2MI6 A;  4F7U B;  3KXT A;  2L3Q A;  1NJI C;  4YCV A;  1FX7 A;  1LJO A;  1TUD A;  4LDX A;  1ZA2 B;  3ZFJ A;  1YFT A;  1YJW Q;  1Q86 R;  4H2X A;  2YSQ A;  3LGF A;  5IHK A;  2ZAE A;  3LYI A;  4YRF A;  3RNJ A;  4E47 A;  2ESW A;  4JZ4 A;  4M7A D;  4KH1 B;  4J9G A;  2KI7 A;  4LDW A;  1YNZ A;  4N0A C;  2E65 A;  1D0Y A;  3EFR A;  4YRK A;  2DKG A;  2K3B A;  3MP1 A;  4AFS C;  4WF2 A;  2ZR2 A;  3L2U A;  3EG1 A;  4IUQ A;  4PJO E;  1IL2 A;  3OW2 A;  4RTX A;  3QJY A;  1KQ1 A;  3HSB A;  3GOX A;  1O75 A;  3RKX A;  4JUV A;  3JCM d;  3G4S A;  1EFW A;  5KH6 A;  8AT1 B;  1IGQ A;  1QWF A;  1QW1 A;  2QYZ A;  1ZA1 B;  2ZPI B;  4TQD A;  1GBQ A;  1C1A A;  1PWT A;  2LCC A;  1K9M U;  2JJ9 A;  2K2V A;  1KHC A;  5D6X A;  4UP7 A;  4PFP A;  4FSX A;  2HSP A;  3JCM Q;  1U1S A;  2HQE A;  3NEM A;  2IY5 A;  2E3H A;  3E1S A;  2ZIM A;  2HQH A;  2MCN A;  4C92 F;  2ZIN A;  2I0N A;  2O2O A;  3H8Z A;  1XNI A;  5GAO m;  2EYZ A;  4JRK A;  2WAC A;  3VRZ A;  1YJN T;  2VB6 A;  4OGE A;  4CH6 A;  1N5Z A;  3OYC A;  2DXT A;  2KQW A;  2DVE A;  2CIM A;  1DJ7 B;  4XAX B;  2Y4X A;  1R77 A;  2JMA A;  3CCM A;  2ART A;  1M27 C;  2K2M A;  4LVI A;  4P71 A;  1GCQ C;  2QQB A;  1QCN A;  4C8Q C;  1ZSZ B;  3VQW A;  3I9Q A;  4E51 A;  1ZSG A;  1HJD A;  4CH4 A;  5C53 B;  3G6E T;  4C0D C;  1M1K U;  3OS2 A;  2MIO A;  2CS7 A;  2F2X A;  4YTL A;  5HY6 A;  2JOY A;  1V29 B;  2R5A A;  4NCX A;  1WX6 A;  1GFC A;  2LT4 A;  2KSS A;  3P8V A;  1EQR A;  1D3B B;  1H4Q A;  4CC7 A;  4ME7 A;  2E41 A;  1X6B A;  1VQP A;  2QTX A;  4FYY B;  3VS6 A;  3QO7 A;  2YUP A;  2J6O A;  2C0O A;  1E7O A;  1E6H A;  3E9F A;  3URG A;  1UJY A;  2CH4 A;  2GCX A;  1K73 U;  1AVZ C;  2RM4 A;  2K9G A;  1SSF A;  2CP5 A;  2ZPF B;  1QVF A;  1SER A;  1BCO A;  2D1X A;  2DEQ A;  2EYY A;  5LJ3 g;  1AZE A;  2F5K A;  2PVD B;  2ZNI A;  1Y57 A;  5IHI A;  4HVW A;  4D8K A;  1YJN Q;  1VQO Q;  2LMJ A;  5HGQ A;  2MAM A;  4A4F A;  2RI2 A;  3CCU A;  1K9M R;  4PNO A;  4M7D E;  1G3S A;  5KE3 A;  1AD5 A;  4ZIB A;  1TG0 A;  2LJ0 A;  3UT1 A;  4YRE A;  4M78 G;  2XTI A;  1LVK A;  3G6E Q;  2C0I A;  1QVG S;  2X4Y A;  2XDP A;  3QZ9 B;  5HKC A;  3NEN A;  5K1P A;  1SF9 A;  2CP2 A;  2HBP A;  1N8R C;  2GFA A;  4BUG A;  5IXB A;  2E1H A;  2RHQ B;  2FRY A;  4KGX B;  1PD1 A;  4Y28 E;  2L3P A;  5KCH A;  1NPP A;  1NJI U;  1B34 B;  4HWR A;  1YHQ Q;  1D1C A;  3N5B B;  3RF1 A;  1HTT A;  1M1K R;  2F1L A;  4M75 G;  5GAM d;  2M16 A;  4XTW A;  3EHQ A;  1GL5 A;  2Q7G A;  3CPW A;  3L1A A;  5HCK A;  2OTJ Q;  1Y71 A;  3OS1 A;  1NNH A;  2ZT7 A;  4C5H A;  1D1B A;  3A5Z B;  4LVL A;  5KYY B;  2PZ1 A;  1H4S A;  4LNP A;  2DF6 A;  2JTE A;  2KGT A;  2Y4Y A;  4C92 G;  3DSQ A;  5GAN 7;  3QO8 A;  3CXC S;  1Y96 A;  1U3O A;  3OYI A;  1KC8 C;  1VQ9 A;  4K86 A;  5KYW B;  2DPP B;  1K73 R;  1PCX A;  4BD3 A;  3NTH A;  2ROT A;  3LGL A;  1X54 A;  4E7L A;  4M77 F;  1JQQ A;  4YYE A;  3JCM e;  2D0Q B;  1IO6 A;  1LYL A;  4RG8 A;  4AH6 A;  3WVD B;  3BJU A;  2BTT A;  2IPO B;  4UC4 A;  1B7Y B;  1UHC A;  2AIR B;  8ATC B;  1NG2 A;  2M51 A;  1M1F A;  3NTI A;  5GAO n;  1W2B S;  2VXF A;  2ZPH B;  3VKI A;  3P8H A;  1VQK T;  1BI1 A;  3ICA A;  4CH5 A;  2XKO C;  1VQ4 A;  1Z9Q A;  4M7A F;  5EG2 A;  5GAO r;  3SWN A;  1L0W A;  1TWB A;  3CCE A;  2ALY A;  2EQK A;  1ABO A;  3OS0 A;  1KG1 A;  4F7U F;  3ULR B;  3EHR A;  2RQV A;  2RHX A;  2KRS A;  2RQT A;  3M0U A;  4P75 C;  2GF7 A;  2O88 A;  2NUZ A;  3MP8 A;  1VQ6 A;  4L59 A;  1NJI R;  1NJ8 A;  3A8L B;  1VQM T;  1B76 A;  1T0H A;  4BE1 A;  1BKB A;  1OI1 A;  3HXX A;  4M77 C;  4HVC A;  3CCS A;  3TRE A;  1QCO A;  3OYF A;  4R55 A;  4YRT A;  4M78 A;  3M56 A;  4IUV A;  2D8H A;  2DNU A;  2YRC A;  2BE7 D;  2HSE B;  1W4S A;  3G1Z A;  2KBT A;  3L4G A;  2EJ9 A;  5GMK l;  2LVM A;  4HA8 A;  2I4N A;  2CSI A;  2B8A A;  1RAC B;  1Y0M A;  3TEH B;  4FSS A;  2AZS A;  1WJR A;  4NL3 A;  3CC4 A;  2QDL A;  3J7A F;  1ARK A;  4Q6G A;  1GCQ A;  1W2B P;  2COW A;  2A08 A;  1RAH B;  3UWN A;  3CCQ A;  2OAU A;  2EW3 A;  1VYT A;  2M02 A;  2DQ3 A;  4M75 A;  2PUO B;  1I1J A;  1FWZ A;  5GJW B;  2XGT A;  4H02 A;  1I81 A;  4P3N A;  1Q81 C;  3CMA T;  1SES A;  1PRM C;  4YDQ A;  1IGU A;  3NHN A;  4FM4 B;  2QA4 T;  2E3C A;  1N8R U;  3HPW A;  2E6N A;  3I56 A;  3HRK A;  1E6G A;  3CCV T;  3PZC A;  4C92 A;  1PRL C;  3JCM h;  7AT1 B;  1EVL A;  2V8K A;  4C8Q B;  3FRN A;  3CD6 T;  3MEV A;  2KR3 A;  3ASK A;  3MEU A;  2X4W A;  3HL8 A;  2CP0 A;  3HTZ A;  3V8K A;  4KT0 E;  3HY0 A;  1JJ2 P;  1W1F A;  2HKQ B;  4CS2 A;  1JU5 C;  2CP7 A;  3OB9 A;  5GAN j;  3G71 A;  1JRI A;  4IUR A;  3EGD B;  3QBY A;  3TCJ A;  2LQ8 A;  2GFU A;  2WSC E;  2DTI A;  2LRQ A;  2ARS A;  2Q7H A;  1HD3 A;  3SHW A;  3E9H A;  2V1R A;  3I5S A;  4LDU A;  1D0Z A;  1G5H A;  5KYX B;  4BI4 A;  1FMV A;  4J8O A;  3HRT A;  3INZ A;  3G1J A;  4CH3 A;  5GAM e;  4C8Q D;  4L5G A;  5GAO l;  1VQ5 A;  3QHS A;  3D7S B;  1ZLM A;  1UGV A;  4P73 C;  3HXY A;  2QHT A;  3SFM A;  1RUW A;  3RUX A;  2MMP A;  5GAM j;  1E1O A;  5LJ3 f;  4JDS A;  2BKD N;  1KC8 U;  1TOV A;  2ZR3 A;  3DLL A;  1FMK A;  3REU A;  3M55 A;  3CMA Q;  3DB4 A;  4M7A G;  3CCR T;  3QKJ A;  4AG1 C;  1VQ7 Q;  4CRI A;  1WA7 A;  3GLX A;  1MV0 B;  4PL6 A;  4ZTF A;  2VGN A;  1UGP B;  3CCV Q;  3LLR A;  4XTU A;  4F7U G;  3I55 A;  1T3L A;  1WNL A;  1SSH A;  5KYN A;  1PD0 A;  1YFS A;  4OMQ A;  3RBB B;  1OV3 A;  4CS4 A;  2CJ9 A;  1AWW A;  2JXB A;  2RHS B;  1YWO A;  4D6W A;  1KQS A;  1QLY A;  1BCM A;  2YT6 A;  12AS A;  3TUP A;  3TSW A;  5IH2 A;  2OTL T;  4MMK A;  2MF2 A;  1XTD A;  1VQL T;  2KMT A;  2GQV A;  2YXY A;  5J39 A;  3QWY A;  1H3Z A;  4FYV B;  4TVA A;  3UGQ A;  3QYG B;  1K8A C;  3CC2 A;  1FXX A;  1KJW A;  2R5M A;  1GRI A; 
#chains in the Genus database with same CATH homology
 1RL2 A;  1BBW A;  4C0F A;  5GAN g;  5J26 A;  3A7R A;  1H4V B;  3RL6 A;  4X34 A;  5CIU A;  5AYF A;  1ADJ A;  4JRQ A;  5LJ3 d;  2VGM A;  3OYM A;  3R07 A;  1WU7 A;  4Z02 A;  4B9W A;  3J81 E;  1IRE B;  1MHN A;  2DK3 A;  1Q82 C;  4C0G A;  3CCL A;  3TEE A;  2E64 A;  4IKF A;  4A4G A;  3CCJ T;  4WJ4 A;  5CKB A;  1WJS A;  1X2H A;  3JAM E;  4HCC A;  4PJO D;  5CKH A;  5DY9 A;  3OYB A;  3A8O B;  2D9T A;  4QQD A;  3JB9 D;  5GAM h;  1QE0 A;  3X28 B;  3HFZ A;  3L2Q A;  1KOG A;  2I4M A;  1JB0 E;  1Q81 U;  4M78 E;  3GPL A;  1AHJ B;  3HRU A;  5F5W A;  2X4X A;  3MF2 A;  5GMK e;  1ASZ A;  1B70 B;  3MEW A;  3REX A;  1Y7X A;  3O8V A;  1H64 1;  3MF1 A;  2FB7 A;  4YRJ A;  1KQ2 A;  2RJF A;  4M7A A;  4A4H A;  1OZ2 A;  4H2V A;  1YJW A;  4RMO A;  2AKW A;  5ELO A;  1Q7Y C;  2QEX T;  2I2L A;  4F7U A;  4M77 B;  4LNS A;  4M75 E;  2KVQ G;  1NYR A;  2EWN A;  4A53 A;  3VQY A;  3JCM b;  3FEO A;  1NJ1 A;  2LQK A;  4G84 A;  2PU9 B;  3S3O A;  4HCZ A;  1E22 A;  1NJ5 A;  3WXM B;  4C92 E;  5GMK m;  4K87 A;  4EPC A;  2O4X A;  3A32 A;  1X55 A;  3I7F A;  1ZBX A;  1I8F A;  3FDR A;  4UPA A;  5LJ5 g;  4ZGE B;  3OBW A;  5GAO q;  4M7D D;  4KBM B;  1NJ6 A;  2EL9 A;  3MO8 A;  2JNG A;  3V8L A;  5C51 B;  3UH0 A;  4O6J A;  4KQE A;  4QQ6 A;  4H2S A;  4RDX A;  1K8A U;  2RJE A;  4C8Q F;  4CI0 C;  4H2T A;  2NS6 A;  4K88 A;  3OYA A;  1M5Q 1;  1ATI A;  2ZGW A;  4OP0 A;  1VUB A;  2RK2 A;  4TWA A;  4XK8 E;  5CO7 A;  5GMK h;  3G4S T;  4ZTU B;  4GY5 A;  5KCO A;  4II1 A;  5GMK i;  2DD4 A;  1EIF A;  2QHS A;  1R8O B;  2QXF A;  3CME A;  4LVM A;  5LJ3 e;  2FYK A;  2HAX A;  3QUI A;  3VQX A;  1Q82 U;  4H2X B;  5FRM A;  3JCM J;  4LDY A;  5FRO A;  4JLI A;  1QF6 A;  2EJF A;  2F5T X;  2ZPE B;  2RB6 A;  5E3I A;  5DLO A;  1HC7 A;  1VQO A;  1YJN A;  1UGS B;  2DU5 A;  3GIB A;  2DD5 A;  3QZ5 B;  2DXB A;  5K1X A;  1G3Y A;  5C6S A;  5C0M A;  2E10 A;  5CQX A;  5FU7 B;  2DAQ A;  4B9X A;  4KR2 A;  3CCM T;  4HT4 A;  3L2V A;  2LDM A;  4ZN3 A;  3A7U A;  3CBO A;  2O01 E;  1EIY B;  3CBP A;  1X01 A;  3OYK A;  1UEB A;  4OVA A;  2RHZ A;  4YRN A;  5GAO p;  4DOV A;  1UB4 A;  1NYQ A;  4KR3 A;  2LX9 A;  5HK0 A;  2G4C A;  1YHQ A;  4PKC C;  1VQP T;  2EAY A;  4YP0 A;  3OS5 A;  3BDU A;  4PJO F;  1RI0 A;  1Q7Y U;  4RG2 A;  3MCA B;  1PSE A;  2QHV A;  2RHI A;  2OTJ A;  4EMH A;  1B34 A;  2P0P A;  4KUL A;  3BY7 A;  3JB9 F;  3SDZ A;  2ODR D;  3QDR B;  5CAI A;  2Q5H A;  3E19 A;  1M4Z A;  4PG3 A;  3OYG A;  1WQW A;  3CCU T;  4P72 C;  1VQN T;  4YCW A;  1WGS A;  4BW9 A;  4YRI A;  3CC7 T;  3A5Z A;  3LSQ A;  4LD9 K;  2ZIO A;  4M7A E;  2HNI A;  3JCM V;  2K4Y A;  4J5Y A;  3MHX A;  4C8Q G;  3OD1 A;  4NS5 A;  1WQ7 A;  4F7U E;  4BI3 A;  2KDS A;  5LJ3 h;  4YRS A;  3LH0 A;  4PJO C;  3MEY A;  2E70 A;  2XHC A;  4P5N A;  1Z7N A;  3P8D A;  2QQR A;  1B7Y A;  4L87 A;  2ZZE A;  2M1H A;  1KMM A;  1EVK A;  3RES A;  2BIV A;  2HQX A;  3M57 A;  4R56 A;  5GAN 5;  2RI5 A;  4BE0 A;  3QII A;  3RGL A;  3TEG A;  4PHC A;  1IZ6 A;  2YHT A;  3X26 B;  1N27 A;  3HXZ A;  1GXI E;  3TU4 K;  4N0A A;  3VV0 A;  4M7D F;  1YBY A;  5M9O A;  1O9S A;  2J3M A;  3P8B B;  3M59 A;  2Q7E A;  5LJ5 f;  4BB7 A;  1VQ4 T;  4MML A;  3SB2 A;  2ZCE A;  3FC3 A;  3TEH A;  1BBU A;  3CCE T;  5D6W A;  4GLK A;  1USY C;  2XID A;  4ELZ C;  5GAN 8;  4RCB A;  3A31 A;  2NLU A;  2RA2 A;  2L8D A;  2IG0 A;  4J6X A;  1VQ6 T;  1JJ2 S;  5CVI A;  3H6Z A;  4JRI A;  3M5A A;  3OMG A;  2R57 A;  3L42 A;  2ZCF B;  4M7D C;  5FLX E;  2EIF A;  4MDX A;  4C8Q A;  4RCC A;  4TVW A;  3PFS A;  4G85 A;  2CZ7 B;  3SWN B;  4MDW A;  3QJ6 A;  2ZT8 A;  3EFS A;  3HKS A;  1G5V A;  3JCM g;  1PYS B;  2ZPB B;  5LJ5 d;  3JRZ A;  1UGR B;  3CCQ T;  4HWO A;  1X6O A;  3R6O A;  2YRV A;  2PMF A;  5CKE A;  2XU8 A;  1HXD A;  1X56 A;  1YB3 A;  1KHI A;  3AHU A;  4NL2 A;  4YRM A;  3T9N A;  2AMC B;  1G3W A;  1VQ7 A;  4M78 B;  3HRS A;  2QQS A;  2H3J A;  2FHD A;  4TVY A;  1JJC A;  3CCV A;  3I56 T;  5LL6 S;  2J3L A;  4J7I A;  3S3M A;  2WSF E;  1VIF A;  3C4S A;  3LC0 A;  4E7K A;  4M77 G;  4TTV A;  3P8Y A;  3G71 T;  4M78 D;  11AS A;  3OSS C;  2RHS A;  3HHT B;  3QPH A;  2ZZF A;  4X5O A;  2XG8 D;  3NET A;  2DTH A;  5C52 B;  1VQ5 T;  5ELN A;  4BY6 B;  3FLG A;  5L8R E;  1YI2 T;  4YRQ A;  4J6Y A;  4WI1 A;  1KMN A;  1BYM A;  2X35 A;  4M75 D;  5FU7 C;  4KUI A;  4BDZ A;  2RJD A;  4OB1 B;  1M9S A;  3I55 T;  3GF5 A;  4V2S A;  4NOY A;  1VQ8 A;  4HCB A;  2DXU A;  1QVF S;  1BIB A;  1VQL A;  2ODR C;  3A8M B;  3PTA A;  4FT4 A;  1H4T A;  4IUP A;  3KFU A;  3LW5 E;  3V8J A;  3CC2 T;  2JTF A;  4PJO B;  2QI2 A;  2PVG B;  1NPR A;  3PCO A;  2CZ6 B;  3ER0 A;  1PSF A;  2C7I A;  4LVK A;  2YLC A;  1BI3 A;  2AHJ B;  1ASY A;  3GNF B;  3OYY A;  3QTC A;  1QVG A;  2X4J A;  3LX7 A;  3PNW C;  4P71 C;  3CBM A;  5GAM g;  4C5E A;  5HK3 A;  2RK1 A;  3C12 A;  1QP3 A;  2JTM A;  2P0Q A;  3A8H B;  1Z7M A;  4FT2 A;  3CPW S;  4E7I A;  3RKW A;  1S72 A;  4P75 A;  3BDL A;  3ZEH A;  2CYZ B;  2PQW A;  3BW1 A;  2RHY A;  2CZ0 B;  1YIJ A;  3DKM A;  2K5F A;  1YIT A;  4M77 A;  2E5A A;  3HY1 A;  1G51 A;  2I4L A;  2JZ2 A;  5LJ5 e;  2L3R A;  4EMK B;  2K3Y A;  2P0L A;  3CXC A;  2K3X A;  4H2U A;  1SET A;  5GMK j;  4EMG A;  3RAC A;  2DU7 A;  2ZXF A;  4C8Q E;  3A7A A;  3CEY A;  3J80 E;  4MZM A;  3OY9 A;  2DQ0 A;  3OYE A;  2A8E A;  1G5I A;  2ARU A;  1W2B A;  3PIP A;  3VU3 C;  2DXC A;  5CQY A;  3V7C A;  4RMF A;  4DA4 A;  4X9D A;  4EX5 A;  3HFV A;  3IAL A;  4M7D B;  4ZTZ B;  2E12 A;  4P3P A;  3G7Z A;  1X75 C;  1BIA A;  3HP9 A;  3RMQ A;  3JCM f;  4OLF A;  3EAE A;  2QHU A;  4FL6 A;  1N9R A;  4LD6 A;  1YJ9 T;  2LCL A;  4A4E A;  3FIF A;  3WVE B;  3UDC A;  4YCU A;  2ZT5 A;  2L5Q A;  2XIC A;  5DM7 R;  3HXV A;  2AKW B;  4WJ3 M;  3QSU A;  4BE2 A;  3L2Z A;  2FL7 A;  4P73 A;  3PGG A;  4N4H A;  3OYJ A;  1LOJ A;  4M78 F;  3SD4 A;  2Q5I A;  1QVP A;  1MGQ A;  4HKE A;  3VYG A;  2D6F A;  3QNE A;  3S3N A;  4N4I A;  2O4X B;  4P74 C;  5LJ5 h;  1YGB A;  3SWN C;  1YFR A;  2P5I A;  4HWS A;  2JVV A;  4YRC A;  1X2G A;  2M9U A;  3ERR A;  1LNX A;  4ZTJ A;  1M90 C;  4M75 F;  4A4K A;  3OYN A;  3OYH A;  1P92 A;  1D3B A;  2JN0 A;  1EIY A;  2XDB A;  4YRG A;  4VUB A;  2EQU A;  5LJ3 j;  3CME T;  5FRN A;  4N4G A;  2CJB A;  3IG2 A;  3VYH B;  5IN1 A;  2A7Y A;  2DDZ A;  3W3S A;  3GNG A;  4M78 C;  4XEO A;  1U8R A;  4XEM A;  4EO4 A;  1XOV A;  4BWA A;  2M0O A;  1VQO T;  3OBY A;  2R58 A;  5A0L A;  3M4P A;  3G6E A;  1Y07 A;  1ZHI A;  5DLQ E;  3LWI A;  4BDY A;  2C06 A;  5GAN f;  2IY5 B;  1C0A A;  3CMQ A;  4JS5 A;  3M4Q A;  5FU6 C;  4M75 C;  4DPG A;  3QO3 A;  2F69 A;  1BI2 A;  3HXU A;  3JCM c;  2RHQ A;  1KQS S;  4BY6 C;  4YRL A;  3X24 B;  4BI8 B;  1YHQ T;  5GAM f;  4C92 C;  4M77 E;  2MWO A;  3FB9 A;  2L89 A;  4J7F A;  5CK9 A;  2E5Q A;  4O5V A;  3UPU A;  2BUD A;  4E7J A;  4MZP A;  2OTJ T;  4UP9 A;  3JB9 I;  2ZPG B;  3E9I A;  2MWP A;  4E7H A;  5J3B A;  3RMS A;  4JLG A;  1VQN A;  3QYH B;  1G3T A;  1JBM A;  4P3O A;  3CC7 A;  2EQJ A;  4OF1 A;  3OMC A;  3RIR A;  3OQ5 A;  4RKU E;  5GAN d;  3QO5 A;  2V8I A;  2E6Z A;  1E24 A;  1YCY A;  3E9G A;  2Y90 A;  2P0K A;  2XK0 A;  4CS3 A;  4XTZ A;  5CR2 A;  2EFI A;  1M1G A;  4PLI A;  4YRR A;  3OSV A;  3V7R A;  4DQ2 A;  5I21 A;  4HT9 A;  2DJZ A;  1I5L A;  3VJP A;  1VQ9 T;  2K5L A;  4RQE A;  4JJN K;  3DLM A;  2JUF A;  2ZTG A;  1M90 U;  1ADY A;  2PVO B;  3JSC A;  2DIQ A;  4J6W A;  4FU6 A;  4L6V 5;  4O2D A;  3MEA A;  2G3R A;  1VQK A;  2P4T A;  2VUB A;  3KUF A;  4EMK C;  2ZZD A;  4HWP A;  1TH7 A;  3OYL A;  2ZNJ A;  2YLB A;  3M58 A;  1ZQ1 A;  2LT1 A;  5CKD A;  1E1T A;  4RQF A;  4P74 A;  1KD1 C;  1OZ3 A;  1Y96 B;  2KY9 A;  5GAN 6;  2RJC A;  4PJO G;  3CPF A;  4XU0 A;  1VQM A;  1PYS A;  3OYD A;  5IT9 E;  2IVW A;  1VIE A;  2V8J A;  2K5I A;  2PME A;  1RIQ A;  3L2W A;  3JB9 G;  4ZN1 A;  2QQA A;  2ZT6 A;  2VV5 A;  5CKF A;  4YRO A;  3RKY A;  3CCS T;  3DB3 A;  3NTK A;  3IKM B;  2AMC A;  4QW2 A;  3ME9 A;  2CZ1 B;  2LC4 A;  3JCM X;  4Q15 A;  2CJA A;  2ALY B;  3V7S A;  2DZC A;  3GP8 A;  3CC4 T;  5KNN A;  3M9Q A;  5CCA A;  3QG1 A;  1WYD A;  3OW2 S;  1BI0 A;  3Q1J A;  4M7A C;  5GAN 3;  1EOV A;  3QXE B;  4H2Y A;  1HK9 A;  1NZ9 A;  3CMA A;  4XTY A;  1Q86 C;  3M4Y A;  3X20 B;  1N9S A;  4YPF A;  2QA4 A;  3M4G A;  5A0G A;  3L4G B;  2RO0 A;  3HFN A;  3OA6 A;  3PT9 A;  3CD6 A;  2ZZG A;  3PMT A;  3UFG A;  2K57 A;  3VUB A;  1VQ7 T;  2RD1 A;  5I2M A;  3ZBD A;  1WLE A;  2LNV A;  3A8G B;  3M54 A;  2VYT A;  4X9C A;  3JCM P;  2RHU A;  5GAN e;  4KUD K;  4C0D B;  3UGT A;  4HT8 A;  3HXW A;  3VBB A;  5FU6 B;  4XTX A;  4P72 A;  4EDU A;  4M75 B;  4IUT A;  2RI3 A;  4QQG A;  1U1T A;  1SRY A;  4C5G A;  1QP2 A;  4M7D G;  1UGQ B;  4LDV A;  1W66 A;  2A3L A;  2DIG A;  5GAN 2;  4C92 B;  2QDY B;  3CCR A;  1YI2 A;  4QVC A;  3IKL A;  3BFM A;  3MET A;  1JJC B;  4OGC A;  4QVZ A;  4XQ3 A;  4PJO A;  4Q5W A;  2PUK B;  4LVJ A;  1NE8 A;  5A2Q E;  2I4O A;  2EJG A;  3S6W A;  3PIO A;  3C94 A;  3C95 A;  3RER A;  2EKO A;  2OTL A;  4C92 D;  3LWH A;  4A54 A;  2KAF A;  1VQ8 T;  1GGM A;  4ATO A;  3JCM W;  1XQH A;  5I2S A;  2DZ9 A;  3MQZ A;  1KD1 U;  1J5W A;  4XU2 A;  1M8V A;  4YRP A;  1N9W A;  1I4K 1;  4XU3 A;  5IAY A;  3PMI A;  4ELY C;  4JRP A;  3A74 A;  1K9M C;  4EMK A;  3WQZ A;  1B70 A;  4HWT A;  4OB0 B;  1N6A A;  3CCJ A;  5A0D A;  4OB3 B;  3CCL T;  4ZGD B;  4TVA B;  5GAN h;  3JB9 J;  3FJP A;  1USY A;  2EYQ A;  3X25 B;  5GAN 4;  3M53 A;  2EQM A;  1S72 T;  3A5Y A;  3MP6 A;  4TVR A;  4MZT A;  4FIB A;  4J83 A;  4PLL A;  4XTV A;  3PCO B;  1OYX A;  2C8M A;  4H2W A;  1YIJ T;  4C0Z A;  1Q86 U;  3NEL A;  4OMF B;  4Y91 A;  1YIT T;  1M1K C;  3VUZ A;  5LJ5 j;  4XU1 A;  4JS4 A;  4J15 A;  4M7D A;  2QQ9 A;  3HFO A;  1WPY A;  4DOW A;  3JB9 H;  3F70 A;  2RH2 A;  2QEX A;  1YJW T;  2WSE E;  4TQF A;  5KE2 A;  4QVD A;  4C5I A;  2KK4 A;  1K73 C;  1VQZ A;  4UP8 A;  3NFC A;  1FYF A;  2FVU A;  3HFZ B;  3VQV A;  2HD0 A;  2DO3 A;  4OB2 B;  4ZGJ B;  3KBG A;  2LTO A;  2VXE A;  2CKK A;  3HRI A;  2XI9 A;  4BAC A;  4IUU A;  1B8A A;  1WJQ A;  2XD0 A;  1NJ2 A;  3LSS A;  2CGH A;  2DTO A;  3P8T A;  2XDD A;  4M7A B;  1YJ9 A;  5D6Y A;  2VC8 A;  1JJ2 A;  4M77 D;  3L2R A;  2MI6 A;  4F7U B;  3KXT A;  1NJI C;  4YCV A;  1FX7 A;  1LJO A;  4LDX A;  3ZFJ A;  1YFT A;  4H2X A;  3LGF A;  3LYI A;  4YRF A;  4E47 A;  4M7A D;  4LDW A;  4N0A C;  2E65 A;  3EFR A;  4YRK A;  2DKG A;  3MP1 A;  4WF2 A;  2ZR2 A;  3L2U A;  4IUQ A;  4PJO E;  1IL2 A;  3OW2 A;  3QJY A;  1KQ1 A;  3HSB A;  3GOX A;  1O75 A;  3RKX A;  4JUV A;  3JCM d;  3G4S A;  1EFW A;  5KH6 A;  1QW1 A;  2ZPI B;  4TQD A;  2LCC A;  1K9M U;  2K2V A;  1KHC A;  5D6X A;  4UP7 A;  4FSX A;  3JCM Q;  1U1S A;  2HQE A;  3NEM A;  2IY5 A;  3E1S A;  2ZIM A;  4C92 F;  2ZIN A;  3H8Z A;  1XNI A;  5GAO m;  4JRK A;  2WAC A;  1YJN T;  4OGE A;  4CH6 A;  3OYC A;  2DXT A;  2KQW A;  2DVE A;  2CIM A;  1DJ7 B;  4XAX B;  2Y4X A;  2ART A;  3CCM A;  4LVI A;  4P71 A;  2QQB A;  4C8Q C;  3VQW A;  4E51 A;  4CH4 A;  5C53 B;  3G6E T;  4C0D C;  1M1K U;  3OS2 A;  2CS7 A;  4YTL A;  5HY6 A;  2JOY A;  1V29 B;  2R5A A;  4NCX A;  2LT4 A;  2KSS A;  3P8V A;  1EQR A;  1D3B B;  1H4Q A;  4ME7 A;  2E41 A;  1VQP A;  2QTX A;  3QO7 A;  3E9F A;  3URG A;  2GCX A;  1K73 U;  2RM4 A;  1SSF A;  2ZPF B;  1QVF A;  1SER A;  2ZNI A;  2DEQ A;  5LJ3 g;  2F5K A;  2PVD B;  5HGQ A;  2MAM A;  4A4F A;  2RI2 A;  3CCU A;  4PNO A;  4M7D E;  1G3S A;  5KE3 A;  4ZIB A;  3UT1 A;  4YRE A;  4M78 G;  2XTI A;  1QVG S;  2X4Y A;  2XDP A;  3QZ9 B;  5HKC A;  3NEN A;  5K1P A;  2HBP A;  1N8R C;  2GFA A;  4BUG A;  2E1H A;  2RHQ B;  4Y28 E;  5KCH A;  1NPP A;  1NJI U;  1B34 B;  4HWR A;  3N5B B;  3RF1 A;  1HTT A;  5GAM d;  4M75 G;  2M16 A;  4XTW A;  2Q7G A;  3CPW A;  3L1A A;  1Y71 A;  3OS1 A;  1NNH A;  2ZT7 A;  4C5H A;  3A5Z B;  4LVL A;  1H4S A;  2Y4Y A;  4C92 G;  3DSQ A;  5GAN 7;  3QO8 A;  3CXC S;  1Y96 A;  3OYI A;  1VQ9 A;  1KC8 C;  4K86 A;  2DPP B;  4BD3 A;  3NTH A;  3LGL A;  1X54 A;  4E7L A;  4M77 F;  4YYE A;  3JCM e;  2D0Q B;  1LYL A;  4RG8 A;  4AH6 A;  3WVD B;  3BJU A;  4UC4 A;  1B7Y B;  1M1F A;  3NTI A;  5GAO n;  1W2B S;  2VXF A;  2ZPH B;  3VKI A;  3P8H A;  1VQK T;  1BI1 A;  3ICA A;  4CH5 A;  2XKO C;  1VQ4 A;  4M7A F;  5EG2 A;  5GAO r;  3SWN A;  1L0W A;  3CCE A;  2ALY A;  2EQK A;  3OS0 A;  1KG1 A;  4F7U F;  2RHX A;  4P75 C;  2GF7 A;  3MP8 A;  1VQ6 A;  4L59 A;  1NJ8 A;  3A8L B;  1VQM T;  1B76 A;  4BE1 A;  1BKB A;  1OI1 A;  3HXX A;  4M77 C;  4HVC A;  3CCS A;  3TRE A;  3OYF A;  4R55 A;  4YRT A;  4M78 A;  3M56 A;  4IUV A;  1W4S A;  3G1Z A;  3L4G A;  2EJ9 A;  5GMK l;  2LVM A;  4HA8 A;  2I4N A;  2B8A A;  3TEH B;  4NL3 A;  1WJR A;  3CC4 A;  3J7A F;  4Q6G A;  3UWN A;  3CCQ A;  2OAU A;  2DQ3 A;  4M75 A;  2PUO B;  1FWZ A;  2XGT A;  4H02 A;  1I81 A;  4P3N A;  1Q81 C;  3CMA T;  1SES A;  4YDQ A;  4FM4 B;  2QA4 T;  2E3C A;  1N8R U;  3HPW A;  2E6N A;  3I56 A;  3HRK A;  3PZC A;  3CCV T;  4C92 A;  3JCM h;  1EVL A;  2V8K A;  4C8Q B;  3FRN A;  3CD6 T;  3MEV A;  3ASK A;  3MEU A;  2X4W A;  3HL8 A;  3HTZ A;  3V8K A;  4KT0 E;  3HY0 A;  4CS2 A;  3OB9 A;  5GAN j;  3G71 A;  1JRI A;  4IUR A;  3QBY A;  3TCJ A;  2LQ8 A;  2GFU A;  2WSC E;  2DTI A;  2LRQ A;  2ARS A;  2Q7H A;  3E9H A;  4LDU A;  1G5H A;  4BI4 A;  4J8O A;  3HRT A;  3INZ A;  4CH3 A;  5GAM e;  4C8Q D;  4L5G A;  5GAO l;  1VQ5 A;  3QHS A;  4P73 C;  3HXY A;  2QHT A;  3SFM A;  3RUX A;  2MMP A;  5GAM j;  1E1O A;  5LJ3 f;  4JDS A;  2BKD N;  1KC8 U;  2ZR3 A;  3DLL A;  3REU A;  3M55 A;  3DB4 A;  4M7A G;  3CCR T;  3QKJ A;  4CRI A;  3GLX A;  4PL6 A;  4ZTF A;  2VGN A;  1UGP B;  3LLR A;  4XTU A;  4F7U G;  3I55 A;  1WNL A;  1YFS A;  4CS4 A;  2CJ9 A;  2RHS B;  4D6W A;  1KQS A;  12AS A;  3TUP A;  2OTL T;  4MMK A;  2MF2 A;  1XTD A;  1VQL T;  2KMT A;  2GQV A;  5J39 A;  1H3Z A;  4TVA A;  3UGQ A;  3QYG B;  1K8A C;  3CC2 A;  1FXX A;  2R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...