2CGHA

Crystal structure of biotin ligase from mycobacterium tuberculosis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
238
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Conformational Changes Upon Reaction Intermediate Biotinyl-5'-AMP Binding in Biotin Protein Ligase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords BIOTIN LIGASE
total genus 82
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cghA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2cghA01
3JCMQ 3QTCA 4M75B 4XQ3A 3PGGA 4EMKA 4H2WA 2RHQB 4P75A 2ZIOA 3JB9J 4N0AA 4XU3A 4M75G 4PJOC 1SETA 2CGHA 1I5LA 5E3IA 2PMFA 4PJOA 1YB3A 4YRJA 1X2GA 3I7FA 4C92G 4YRIA 2ZT8A 4UP7A 4P71A 3JB9F 4Q6GA 1I8FA 4CS2A 3HXWA 4H2XB 2I4OA 2ZXFA 2E41A 4M78D 3A74A 2DEQA 3VU3C 4XTWA 4YRQA 5GAN4 1BIAA 1H4QA 3IG2A 1LOJA 5GMKh 4RDXA 2ZNJA 3L4GB 2I2LA 1G51A 1Y96B 2AKWB 4TQDA 1IL2A 4M77F 5LJ3e 5GANh 5C51B 4M75F 3WQZA 1USYC 4XTUA 4PHCA 4M7AB 3HRIA 4PJOB 1KMNA 3VQWA 4P72A 2ZCEA 1QE0A 4YPFA 4M7DG 4PG3A 3SWNA 4M7AE 5ELNA 4F7UA 3ICAA 2CIMA 3HXUA 4M7DA 4RCBA 3RERA 3DSQA 4TVYA 3JCMg 4XTYA 5K1PA 3JCMW 1I81A 2DXTA 5LJ3j 4YRGA 4UPAA 1JBMA 2CJ9A 4P3NA 1C0AA 4HWRA 2Y90A 1E24A 1ADYA 1WNLA 3INZA 1LJOA 2RHSB 3A32A 4M77E 3IKLA 4P75C 2E5AA 3PCOB 2ALYA 3JCMf 3L1AA 3VQVA 4EX5A 1B70B 1JJCB 2E3CA 1EIYA 1G5HA 5GANg 4P72C 4XU0A 1H4SA 4MMKA 3JB9H 3TEHB 3BY7A 4YRKA 4QVDA 4M78C 4YRMA 2VXFA 2PMEA 5GAOq 4C8QG 5GAN6 3HFNA 4K86A 5LJ5e 4BWAA 3RKYA 1N9SA 1U1TA 4M77G 3SWNB 2ZZEA 1ADJA 5GANe 4C8QB 3RUXA 5C52B 2DZ9A 1KMMA 2ZIMA 4M7DD 4C92B 2P0LA 2IY5B 4UP9A 1U1SA 2DTIA 1W66A 3QO8A 4M78E 4RQFA 2DQ3A 4A54A 3PCOA 2EWNA 4M7DF 2VC8A 1SESA 1X01A 3A7AA 3HXXA 2E10A 3FB9A 4WJ3M 4P74C 3HFOA 5GMKe 5LJ3g 2Q5HA 4TQFA 4YYEA 2EJFA 3JCMh 3V7RA 1B7YB 4DQ2A 4YRPA 4KR3A 1FYFA 1NJ2A 2J3MA 3HFZB 1HXDA 3QHSA 4WJ4A 3BJUA 3SWNC 2K57A 3UGTA 1B76A 1J5WA 4M78G 1H641 3TEGA 1EVKA 3FIFA 2ODRC 2EJGA 1KQ2A 5GMKj 2YLCA 2Q7HA 4RQEA 3RL6A 3SB2A 4EMGA 3A31A 4YCUA 1NJ1A 4YRTA 2EAYA 3EFRA 3V7SA 1X56A 1Z7NA 4DPGA 4E51A 5I21A 4P74A 4BW9A 4XTVA 1NJ6A 4L87A 4O2DA 4J15A 4LNSA 3REXA 4Y91A 1QF6A 1E1OA 3JCMJ 3ERRA 3HY0A 5KNNA 1PYSB 5GAOp 4X9DA 2VXEA 1B34B 1NJ8A 2AMCB 3HXVA 2RB6A 5GMKm 4YRFA 1WQWA 3BFMA 1B7YA 5LJ3h 1D3BA 3G1ZA 5LJ5g 4JLIA 1E1TA 3QNEA 4EMHA 4M7DC 1EVLA 3IALA 2ALYB 4F7UF 3JCMd 1EIYB 1JRIA 1B8AA 3RIRA 2P5IA 5GAOm 2Q5IA 2CJAA 1EQRA 4H2XA 4M77C 4HWOA 4EMKC 3KFUA 5GANd 4N0AC 4C8QC 5GAN5 1B34A 4M75E 1PYSA 3QUIA 2AMCA 4K87A 4ZTUB 1ATIA 3JB9I 2XGTA 2YHTA 4CS4A 5GANf 1VQZA 3RESA 5CAIA 2DVEA 3R07A 1WU7A 4XTXA 1NJ5A 3UGQA 4C92C 2QTXA 2Q7GA 3MF1A 5C53B 1GGMA 3VQXA 3UH0A 1M8VA 4P73A 1E22A 4M78B 4WF2A 4H2VA 2ARTA 4OP0A 3RKWA 1RIQA 4TTVA 4J6XA 1YCYA 3LSSA 4YP0A 4OLFA 1SRYA 3REUA 1G5IA 1X54A 2QHUA 5GAMf 3M4PA 2QHTA 3V7CA 2ZTGA 3P8TA 4F7UB 3M4GA 4HVCA 2I4MA 2G4CA 4P3OA 11ASA 5DY9A 2DU5A 3NETA 4H2TA 5GAN3 4YROA 3QSUA 4NOYA 3LSQA 3V8KA 4X9CA 3JCMb 4YRSA 3AHUA 2HNIA 4PJOG 4P73C 4UP8A 2RHSA 2FB7A 4M77D 4C8QF 4TVAA 2ZR2A 4QVCA 1X55A 4HA8A 3JCMX 3MF2A 2RHQA 4M7AF 2EJ9A 1H4VB 3HSBA 4J5YA 3MEYA 5LJ5j 3A7RA 1WLEA 1YGBA 2CJBA 4XEOA 4H2UA 2DJZA 3OD1A 4K88A 2ZINA 3RGLA 5HGQA 1EOVA 2C8MA 4YDQA 3HY1A 2Q7EA 4JRIA 1USYA 4M75D 3VBBA 4PJOE 1Y96A 3A7UA 2E64A 4RMFA 3RACA 2ODRD 3JCMV 4C8QE 2DTHA 4C92A 1X2HA 4YRRA 4F7UE 2IY5A 4YRNA 1BBWA 4M7DE 2JN0A 3HXZA 4P71C 2DZCA 4M78F 1EFWA 3TUPA 4M7AG 5GAMe 2C7IA 4H02A 2DTOA 3L4GA 1ASYA 1HK9A 5GMKi 4CH4A 4M7AD 3A5ZA 4HWPA 3LC0A 1I4K1 12ASA 3UFGA 4H2SA 2DU7A 3E9IA 3JB9D 4YRLA 5GAN2 2J3LA 2RA2A 4M7DB 2QHSA 3HFZA 3HTZA 2ZR3A 1HC7A 3HRKA 1WYDA 4J6WA 5LJ5h 4NCXA 2EL9A 4F7UG 4CH3A 4M77B 5GAMg 4YRCA 1L0WA 3V8JA 4PNOA 1MGQA 2RD1A 2DQ0A 4PJOF 3RKXA 4YCVA 1LNXA 4HT8A 4AH6A 3HXYA 4JRKA 4M75C 4XU2A 3P8VA 2ARSA 4M75A 1BIBA 4NL3A 1NYRA 4NL2A 3QO7A 4CS3A 3RF1A 5LJ3f 2DKGA 3BW1A 4C92D 3IKMB 2I4NA 1WQ7A 3VQYA 5GAN8 5GAMh 1B70A 1JJCA 5F5WA 1TH7A 1SERA 4G84A 4YCWA 4M77A 2FYKA 2ZT7A 3FJPA 5LJ5f 3JCMe 2AKWA 1HTTA 2E1HA 4C8QA 1D3BB 3QO3A 4ZIBA 4KQEA 5GAMd 2E65A 2ZT6A 2ZT5A 4WI1A 4M7AA 2QHVA 4TVAB 4JUVA 5GANj 2I4LA 4M7AC 2ZZFA 5GAOl 2RM4A 4CH6A 4TVWA 4X5OA 1ASZA 1WPYA 4PJOD 4XTZA 5ELOA 4YREA 3CMQA 4Q15A 1YFTA 2ARUA 3NELA 5GAN7 4C8QD 1LYLA 1YFSA 4RCCA 2DDZA 5LJ5d 4CH5A 5GMKl 3P8YA 3JCMc 3QO5A 3L2ZA 1NYQA 4MMLA 1NNHA 1N9RA 4XU1A 2YLBA 4KR2A 1YFRA 3NENA 3HFVA 3GIBA 1N9WA 5K1XA 4HT9A 3V8LA 4P3PA 5LJ3d 1KOGA 1BBUA 4HWTA 4EMKB 4V2SA 4EO4A 3PZCA 3E9HA 1Z7MA 1M5Q1 4M78A 2XTIA 4H2YA 3TEHA 4G85A 4A53A 3EFSA 1KQ1A 4C92F 4ZTZB 3A5YA 3JB9G 3NEMA 3BDUA 2ZZGA 3W3SA 1H4TA 4J6YA 2ZNIA 4XEMA 3M4QA 4HWSA 4TWAA 2ZGWA 4C92E 3JCMP 2DXUA 5GAOn 5GAOr 5GAMj
chains in the Genus database with same CATH superfamily
2KEAA 1FMKA 2JZ2A 2KK4A 3JCMQ 4M75B 3PGGA 4HCBA 4H2WA 3UPUA 4O6JA 3OS0A 1VQLQ 4N0AA 1VQ5A 2ROTA 1VQPT 2AK5A 2PNIA 4C5GA 1ABOA 3EAEA 2LDMA 4UP7A 1K8AU 4Q6GA 3OS1A 4JS4A 2YT6A 4CS2A 3FC3A 2ZXFA 2OTJQ 2KVQG 4M78D 2IPOB 3MEUA 2DEQA 2FRYA 4LDYA 2H8HA 1BIAA 1KQSS 1NG2A 3MP6A 3IG2A 4LVJA 3EH1A 4C0GA 3M59A 2QQRA 3L4GB 1QKWA 3L42A 1YWOA 1HSQA 2I2LA 2YXYA 2COYA 2KMTA 1Y96B 2QYZA 4LVMA 3EHQA 2D1XA 2QEXA 1UUEA 2C0TA 4J9HA 2NWMA 2IVWA 3HRIA 4P72A 4M7DG 4PG3A 4A4KA 3SWNA 4PFPA 4M7AE 5ELNA 2XDBA 2F2VA 3ICAA 1VQOQ 1ZSGA 3CMEA 3RERA 4LDXA 2KE9A 4UPAA 1SEMA 2CJ9A 2DM1A 2Y4XA 4HWRA 3NGPA 3S3OA 4Q5WA 1WNLA 3INZA 3IKLA 1M1KC 3L1AA 3VQVA 4EX5A 1JJCB 3CBOA 2G6FX 3G4ST 3BE3A 3G1JA 1XJWB 1WZOA 3JB9H 3H8ZA 4FCYA 3TEHB 3BY7A 2ENMA 3EH2A 5AT1B 1IRXA 1N5ZA 1WI7A 2FZCB 4TVRA 1M8MA 1KD1C 4K86A 5LJ5e 5DM7R 3VUBA 1YJ9A 4OMMA 4BWAA 4MDXA 2O88A 3I56A 4C8QB 3RUXA 5C52B 2J7IA 4UP9A 1U1SA 1W66A 2EYXA 3ME9A 1PCXA 2EWNA 3M55A 4FW2A 2VC8A 2DBKA 3R6OA 4F17A 3WXMB 4WJ3M 5GMKe 1X2KA 2RI2A 3PIOA 1D0XA 4R55A 2DXCA 1C6VX 2DL7A 5KE3A 2DERA 1HXDA 3EG2A 5IXFA 1WLPB 3SWNC 3CBMA 4QQGA 4D8KA 4ZNXA 4MZPA 3TEGA 4L5GA 3X28B 3LWIA 3G4SQ 2DIGA 2A37A 3NTKA 1UJYA 3RMSA 1QLYA 4JS5A 5GMKj 2YLCA 4WCIA 2LQWA 2V8IA 3OSVA 4EMGA 1VQ9A 4LUEA 3DLMA 4QKUA 1Z7NA 4DPGA 2F2WA 3O8VA 3VUZA 4XTVA 2KYMA 1JO8A 3ERRA 3HY0A 2VGMA 5CCAA 2JUFA 1OPLA 5KYYB 1PYSB 2VB6A 3CC7A 2W0ZA 1VQ8Q 1UFFA 2RB6A 4JLIA 1E1TA 3QNEA 5IAYA 2E4HA 2ALYB 4F7UF 1KD1U 3CCUQ 1AHJB 3REAB 3JCMd 1EIYB 3CCEA 1C1AA 1J3TA 5GAOm 4JZ3A 1ZBJA 1NPPA 5FROA 1ZA2B 2DETA 2EIFA 2WACA 3THKA 4HWOA 1UJ0A 3KFUA 5GANd 2QDLA 6AT1B 2JTFA 2AMCA 2DL8A 2EYWA 3LH0A 2YHTA 4CS4A 4C5IA 2CKKA 3KFVA 2DVEA 3HHTB 4AT1B 1M90U 3UGQA 1YHQT 3G6EA 2H3EB 1M2VA 2QTXA 1UGSB 2J6OA 3I35A 3MF1A 3HL8A 1VQLT 4BI8B 2L3PA 4IUUA 4Z02A 3CCJQ 1GGMA 2AZVA 4BI4A 4P73A 4GLMA 4WF2A 4J6XA 2BE7D 2BUDA 4FM4B 3PMIA 3EGDA 5KCOA 1WDXA 3REUA 5KYWB 2CP0A 2RHUA 4WTOB 5DLOA 1N8RR 2QHTA 3WVEB 4PK4A 1TU0B 3VRZA 3MP8A 3OYEA 4D6WA 2MIOA 1VQNQ 2K6DA 4HVCA 4FW1A 1UHFA 3M0RA 3QSUA 4NOYA 4NS5A 1NEBA 3ZEHA 2HNIA 2E3IA 1OX8A 2HL5C 2PU9B 2PUKB 2BZ8A 2ZR2A 4QVCA 2IG0A 3MF2A 2LQNA 3CCMT 2COZA 2RHQA 3LGFA 1H4VB 1OPKA 2BE9B 4QQDA 1VIEA 3CC2T 3MEYA 1WX6A 1WLEA 1YGBA 2V1QA 2LC4A 2FPDA 3CCQA 4K88A 2KXCA 5HGQA 1W4SA 1VQ7Q 1OULA 1T0JA 1XNIA 2Q7EA 5ECAA 2QQBA 3C12A 4JRIA 4PJLA 2CP3A 2CUBA 4RMFA 3RACA 2ODRD 3TREA 1JEGA 3HRUA 4C8QE 2IY5A 4F7UE 2MOXA 4M7DE 4P71C 3OYDA 4JJBA 2RF0A 1RUWA 2K9GA 3TUPA 4JPBW 1S1NA 4BI3A 2L8DA 1VYVA 1TXQA 3L4GA 3QDFA 5GMKi 1TSFA 2JM9A 3TEEA 3A5ZA 4HWPA 3UFGA 4O5VA 2DU7A 3OSSC 4J7IA 5GAN2 2J3LA 4N4IA 1NZ9A 2ZR3A 5LJ5h 4NCXA 2EL9A 4F7UG 4OB0B 4LD6A 2EQJA 2FRWA 3CCMQ 3NTHA 1MGQA 3PT9A 3RKXA 1OZ3A 1VOMA 2BKDN 9ATCB 3OY9A 4AH6A 5KYXB 3HXYA 3SD4A 1HD3A 2EKOA 4OGEA 4J9FA 1Q86U 3P8VA 4M75A 4J7FA 3EGXB 1NYRA 4NL2A 3QO7A 4CS3A 5EG2A 1YJWQ 2RO0A 1RAFB 5F5WA 1TWBA 2JMAA 2EVRA 1RADB 4GY5A 4YCWA 2MWPA 2HQXA 1M1FA 3QZ5B 2L3QA 1IO6A 2LJ1A 1O9SA 3QO3A 2LTOA 1OI1A 4KQEA 4E47A 4OB2B 1M1KU 3CCMA 4WI1A 1YNZA 1AZEA 3DLLA 5GANj 1K0SA 4M7AC 3EG9A 2ZZFA 5GAOl 2PTKA 5FRNA 1GFDA 4LUDA 4PJOD 1YCSB 4YREA 3CMQA 1YFTA 2JW4A 2ROLA 4RTVA 5D7UA 2PQWA 4QVZA 1LYLA 1N8RC 4AFZC 2VWFA 3QJ6A 1YITQ 2QAZA 2GGRA 1PHTA 1BK2A 3L2ZA 4MMLA 3I9QA 5IN1A 4C5EA 4XU1A 2KQWA 4HKEA 1K9MR 2VKNA 3QWXX 5HK0A 1N9WA 4C0FA 4PKCC 1VQKT 4FYXB 2KSSA 3EG3A 1S72A 3CCLQ 2V8JA 2RQRA 4P3PA 1KOGA 2KGTA 1BBUA 3E19A 4HWTA 2QTVA 2DYBA 2EFIA 2HBPA 3M0SA 3E9HA 2SEMA 2XTIA 4H2YA 3OYJA 2CZ1B 4G85A 3EFSA 4XK8E 2VUBA 1NBEB 2K4YA 3I56T 1X43A 3W3SA 4ELYC 4J6YA 2ZNIA 1YI2T 2RJDA 3HRSA 1ZUUA 2LNHB 2ZGWA 4C92E 1YHQQ 3KUFA 2DXUA 2KT8A 1DJ7B 5GAOn 1AEYA 1VQ5Q 1PSEA 2XG8D 3OYAA 1AWOA 3QTCA 4EDUA 2OX7A 5FU6C 3T9NA 2EQUA 1JXMA 2RHQB 3UWNA 4UC4A 4PJOC 2CGHA 4PJOA 3G4SA 5I11A 1X2GA 3I7FA 3SDZA 4C92G 3CD6A 2FG0A 4KUIA 3JB9F 2RQVA 1I8FA 1VQMA 2DIQA 2K5IA 4H2XB 2QXFA 1PD1A 3VU3C 4XTWA 3PVQA 1H4QA 1AT1B 2NS6A 3QIIA 3OBYA 5GMKh 1RACB 2WSEE 2AKWB 1C0MA 1IZ6A 4M77F 5LJ3e 1TOVA 4ZGJB 4PJOB 2DL5A 2ZCEA 1ZLMA 3ZL7C 3ZBDA 5A0GA 1K1ZA 4F7UA 4ZTJA 2CIMA 3HXUA 4M7DA 4RCBA 4TVYA 4XTYA 5K1PA 1TUDA 3JCMW 1Q7YU 2DXTA 5LJ3j 1GCPA 3CCJA 1JBMA 5KYWA 1NE8A 1C0AA 3L2QA 4DOVA 1V76A 2XU8A 3FRNA 4BE1A 4BE2A 2ZPGB 4CI0C 3URGA 5CKBA 2ATCB 3MEVA 3CCUT 1KHIA 3A32A 2LJ0A 4M77E 4P75C 3JCMf 4AFUC 2JOYA 1B70B 2E3CA 2JVVA 3L2VA 2F69A 1UHCA 5L8RE 1KJWA 1AWJA 4XU0A 3G6ET 1X6OA 2PZ1A 3I55Q 1YJ9T 1MMGA 4II1A 2B8AA 4BY6C 3FEOA 2VXFA 3CCLT 1Y0MA 4J8OA 4C8QG 2LRQA 5GAN6 3FJ5A 3RKYA 1N9SA 1B07A 1WJQA 3PIPA 3CMAQ 2ZIMA 4C92B 3QO8A 1YIJA 4M78E 1I07A 2DQ3A 3E9FA 3CPWS 3CD6T 1YJNT 2DX1A 3A7AA 4CC2A 3OYIA 5CKDA 1Q86C 3FB9A 2Q5HA 2M02A 4TQFA 2EJFA 3JCMh 1SG5A 3V7RA 1B7YB 2JMCA 4YRPA 1FYFA 3HFZB 3H0IA 3M53A 3QPHA 1I5OB 4LVIA 1QVFS 4WJ4A 3BJUA 2GCXA 2K57A 4FSXA 3L2UA 3UGTA 1B76A 3J7AF 2RHZA 1H641 2ODRC 4RG8A 3N5BB 2EJGA 4P5NA 2IIMA 4BY6B 1ACMB 1M90C 4RQEA 3SB2A 1NJ1A 1D1CA 2EAYA 3V7SA 1PWTA 1PD0A 1PNJA 2MYSA 3CBPA 3MPUB 5I21A 1G2BA 3VS0A 1KQSP 1NJ6A 4L87A 4O2DA 4J15A 3UA7A 3J80E 2KYBA 2RI5A 3LWHA 2LT4A 5KNNA 1OU9A 3LX7A 3MP1A 2VXEA 3CC2Q 1AZGB 2C06A 2D6FA 1NJ8A 2HQEA 5J26A 4C0ZA 5GMKm 3UDCA 3BFMA 2FL7A 3CCUA 1H3ZA 2XICA 5I22A 3CCET 3EG1A 5LJ5g 2KR3A 2BIVA 3IALA 4ZN3A 3OYMA 1XOVA 3GBQA 2BZYA 3TCJA 1B8AA 1IGQA 1G3WA 4HVVA 2J6FA 2CDTA 3A8HB 3MEAA 2GTOA 4MZMA 3CXCP 4C8QC 1PYSA 4ZTUB 3QBYA 2O9SA 4KGVB 2DAQA 5CAIA 2I0NA 2V26A 4XTXA 1Y71A 2E70A 3OMGA 1BB9A 3C94A 2K3XA 2Q7GA 3GF5A 1X75C 3GOXA 4DBHA 1EZZB 1I0CA 2MWOA 1YIJQ 1VQPQ 4OP0A 3RKWA 3I56Q 4BDZA 1RIQA 4TTVA 1X2QA 2YSQA 3CPWA 1ZUKA 1WHHA 2D9TA 2HSPA 3LGLA 1YJWT 2QHUA 4RTUA 3V7CA 3P8TA 2SRCA 1M4ZA 4F7UB 2XDDA 3MKDA 4E7JA 4IUVA 1SHFA 2DVJA 5DY9A 2DU5A 3NETA 2HBWA 5GAN3 1OYXA 3V8KA 4X9CA 1PRMC 2O31A 3OMCA 1G3SA 4PJOG 4P73C 2RHSA 4ME7A 2X4XA 4FIBA 4TVAA 2AHJB 2VV5A 3SHWA 1X55A 3JAME 2M0YA 1T3LA 4E7LA 1UGPB 2A0FB 2HDAA 4M7AF 3OS5A 2CJBA 1R77A 2EGEA 4JLGA 2ZINA 1AD5A 3LH5A 8ATCB 1EOVA 4Z8AA 1YI2Q 3M57A 3KBGA 1USYA 3A7UA 4YRRA 2AT1B 3MO8A 2JN0A 1HJDA 5A0LA 2LCCA 3QKJA 1P92A 2E6ZA 1Y07A 2C7IA 4H02A 8AT1B 3SEMA 3CC4Q 4CH4A 4M7AD 2NUPB 3LC0A 2C0OA 4ZTFA 4H2SA 2MPXC 3R6NA 3HRKA 4OMOA 4J6WA 2M1HA 3PVLA 5IXBA 4DBFA 4YRCA 3CXCS 1L0WA 2DQ0A 3GLXA 4PNOA 2RMOA 1WHJA 3L2WA 4YCVA 2YRCA 1LNXA 4HT8A 2HMAA 4A4FA 3VS4A 2OJ2A 4JRKA 1UECA 1VQMQ 1BYMA 2ARSA 2CZ6B 2XHCA 2M0OA 2EYYA 2LX7A 2VYTA 2X35A 3RF1A 2P4RA 2ZPIB 1M3AA 2HKQB 1UDLA 4KUDK 3C4SA 2QA4Q 4IURA 4DOWA 2WSFE 2XI9A 3CMEQ 5GAMh 1B70A 2E6NA 5CKFA 1QWEA 3UF4A 1SERA 4JDSA 4G84A 1EX4A 2Z0WA 2FYKA 2ZT7A 1WXBA 1Z9QA 1X6GA 2ZZDA 3JCMe 1RAAB 2E1HA 4ZIBA 5KYUA 3OYFA 2ZT6A 2HL3A 4J9BA 2DL4A 2I4LA 1GFCA 3DB3A 1M3BA 2P0PA 1PRLC 1ASZA 4BUGA 5CK9A 1MMDA 5ELOA 1G8XA 2PUOB 4ANJA 3NELA 1R8OB 3H41A 5GAN7 4C8QD 3TQ7P 2MAMA 4LE9A 2JT4A 4RCCA 1JXOA 2DDZA 1VQMT 5EC7A 2DA9A 3JCMc 1VQNT 1RAGB 1NNHA 1RI0A 1UTIA 2YLBA 1YFRA 1VIFA 3MCAB 3NENA 2DBMA 1KG1A 5J3BA 2GFAA 3E1SA 4JZ4A 3FDRA 1QCNA 3TSZA 1JJ2S 1YWPA 2NUTB 1UGRB 4OMNA 1VQ7A 2K7AA 4BDYA 4EO4A 3PZCA 4FYVB 1Q82R 1Z7MA 2W10A 5CKEA 1MV3A 1NJIU 4A53A 4C92F 2J06A 1BI2A 4IUPA 1OX9A 1Y57A 3JB9G 2RN8A 1Q7YC 4AFSC 2AZSA 2XIDA 4XEMA 3M4QA 4HWSA 1VQLA 2M51A 3JCMP 2CH4W 3HPWA 4J9DA 3CCRT 3UATA 5GAOr 5GAMj 1VQ4Q 4JRPA 1FMWA 1FX7A 1XTDA 4XQ3A 4P75A 2ZIOA 3JB9J 4Z88A 1BI0A 4CC4B 4XU3A 3CCJT 1SETA 2DPPB 1PG5B 1I5LA 2PMFA 2RNAA 4YRJA 3VKIA 2EQIA 2P0KA 1PC0A 1WHMA 2QG9B 4ZGDB 2BZXA 2ZT8A 2O4XB 4P71A 1WFWA 3VS7A 2DXBA 4B6MA 2P84A 3HXWA 1K4US 2I4OA 2H3JA 2E41A 3A74A 4YRQA 1ZSZC 4A4EA 1LOJA 2ESWA 4RDXA 3VJPA 1JU5C 1JJ2P 3CCEQ 1G51A 1ZA1B 2OI3A 4TQDA 4DA4A 1IL2A 2DNUA 5C51B 4M75F 3WQZA 3CC2A 5FWBA 4XTUA 4M7AB 5D6WA 2KRNA 2ZAEA 3CCQT 1QE0A 2CSIA 1K9MU 4MDWA 1R0BG 4AG2C 1O75A 2YRDA 2L3SA 2ED1A 3DSQA 3JCMg 1KK7A 2O2OA 1K73U 2M16A 1NM7A 1K73R 4ELZC 1MV0B 2LQKA 1NYFA 2Y90A 1KC8U 2QDYB 3I5SA 5KYXA 1V1CA 2RHSB 2E5AA 3PNWC 1EIYA 2HAXA 1G3YA 2GNCA 1TUCA 3CCLA 4P72C 3RR6A 1CSKA 3M0UA 3L2RA 1AVZC 2D0NA 1XQHA 3S6WA 3OW2A 4QVDA 4M78C 4YRMA 3DKMA 5LL6S 3ULRB 1FXXA 5GAOq 1NEGA 2L0AA 3HFNA 2L89A 3M4YA 1YITA 1U1TA 2EGCA 5IHKA 2DZ9A 4DEYA 2MCNA 5KYUB 5KE2A 5CO7A 5FU7B 5IHNA 3S3NA 4M7DD 4KH0B 2P0LA 2DTIA 4RQFA 2BTTA 1WHKA 5A0DA 2D8JA 4A54A 3PCOA 1Q82C 4M7DF 2QGFB 3ER0A 1X01A 1LPLA 2KDSA 1RLQC 3M56A 2E10A 1QP2A 3CXCA 1ZUYA 3VV0A 5LJ3g 4RMOA 3MQZA 2LX9A 4DQ2A 3S3MA 4F04B 5FU7C 2MMPA 3EG0A 2E5KA 2HKNA 3OW2P 4IUTA 1VYUA 4CC7A 1EVKA 3FIFA 1VQ6A 2XMFA 1N6AA 1KQ2A 2LQ8A 4IUQA 2DF6A 2FPFA 2CREA 4JJDA 2FEIA 2V8KA 3VS5A 3SFMA 4YCUA 1MNEA 2X9HA 2XD0A 4YRTA 3EFRA 1UB4A 1SF9A 1T0HA 4A63B 1RABB 4B9XA 4RKUE 4E51A 4IKFA 4BACA 2K3BA 4P74A 1QVGA 4Y91A 1QF6A 1E1OA 3JCMJ 1JQQA 3Q1JA 3VRYA 1FYNA 1YJWA 3GP8A 1X27A 5GAOp 4X9DA 1SRLA 1B34B 2HZYA 1QVFP 2AMCB 2CP2A 3HXVA 3QYHB 2CUDA 2OAUA 4MZTA 2OTJA 2FPEA 1UE9A 1B7YA 3X26B 1QVFA 1D3BA 3G1ZA 5CQYA 2KXDA 1SKUB 2K5FA 2VGNA 1BCMA 3CCSQ 1EVLA 3QJYA 2YUNA 2V1RA 1Y7XA 1Z9ZA 2P5IA 2Q5IA 2E12A 3CCVA 4KGXB 2CJAA 1EQRA 1QVGS 4H2XA 4E7ZA 2JS0A 2CS7A 1NJIC 2FZKB 3G71A 2LP5A 3LW5E 2DJQA 4ORZA 5GAN5 4M75E 3EG9B 3M0TA 4K87A 2AKKA 1I1JA 1WA7A 2KRSA 3JB9I 2XGTA 5GANf 3RESA 1CKBA 3A8GB 3R07A 2OTLQ 1WU7A 3TU4K 4C92C 4J9CA 2JTEA 1K73C 3QYGB 1MUZA 3OYGA 1ZSZB 2RQTA 4YTLA 3UT1A 1D0ZA 2LMJA 4J9EA 1E6GA 4LVLA 1E22A 4M78B 4RTWA 1BI3A 5KCHA 2ARTA 3JSCA 4RUGA 1IHWA 1QCFA 1UG1A 2NUTA 2JM8A 4YP0A 1KIKA 4OLFA 5FRMA 2LJ3A 1UEBA 4Y28E 5GAMf 1W1FA 2PVOB 3CCRQ 2CT3A 4LDWA 2KROA 5C0MA 2I4MA 1M2VB 4P3OA 4H2TA 1U3OA 2QGGA 4YRSA 3AHUA 2HSEB 1ZBXA 4C8QF 1SRMA 5KYYA 2E5QA 3AT1B 1BKBA 4HA8A 1W2BA 3JCMX 2YUOA 3KXTA 2EJ9A 3A8LB 3NPFA 4J5YA 1Q81U 5LJ5j 1W70A 1VYTA 1HYOA 4XEOA 2JXBA 4J9GA 3A8OB 4H2UA 2DD4A 2DJZA 1VQ4A 3OD1A 1LVKA 4YDQA 3VBBA 2E3HA 3NFCA 3NTIA 2YWWA 1Y96A 1Q81C 2E64A 2KNBB 3E9GA 1OOTA 2A36A 4C92A 4YRNA 1BBWA 4ATOA 2DZCA 2EYZA 2JS2A 4M78F 1EFWA 3M54A 4M7AG 1CKAA 5GAMe 1VQ5T 2DTOA 4HCZA 1ASYA 1K8AC 2DK3A 1TTHB 1IXDA 1E7OA 2ZPBB 1IB8A 1MHNA 2ED0A 3CPFA 1JB0E 1A0NB 1SSHA 1NLOC 3E9IA 4YRLA 2QHSA 3E2UA 1EFNA 3OYKA 1WYDA 3GNFB 1KSWA 1KQSA 2GFUA 4L59A 4CH3A 5I2SA 1KD1R 3RMQA 4EPCA 4GLKA 1WJRA 5GAMg 1TG0A 3P8HA 3V8JA 1KC8C 3QZ9B 4PFZA 2A08A 2RJFA 4DBQA 3RNJA 3CMAT 2HQHA 2L3RA 1Q86R 2J05A 4QT7A 1QCOA 4M75C 2QEXT 4FYYB 5I2MA 1VQ7T 5M9OA 3CD6Q 4QW2A 3EGDB 2X4JA 3A8MB 4NL3A 2NUPA 2OAWA 5DLQE 5LJ3f 1YN8A 1M1GA 2FO0A 2ZCFB 3X24B 4KH1B 2I4NA 1WQ7A 1YFNA 2DD5A 2DLPA 2F2XA 5KYNA 4KBMB 5GAN8 3OYCA 1JJCA 1M90R 2XKOC 3META 2CP6A 1TH7A 4LDVA 1T3SA 3J81E 5CKHA 1Q95G 1WHLA 3FJPA 4IIOA 2CT4A 5LJ5f 1SPKA 2JJ9A 3CCSA 4C8QA 1D3BB 1QP3A 2E65A 3ASKA 2D0QB 5HKCA 2PVGB 2QHVA 1RL2A 4RTZA 3EFOA 4TVAB 1KFZA 1YIJT 2QA4T 2X4WA 4TVWA 4X5OA 4GBQA 1WPYA 2LCLA 4XTZA 5C6SA 1VQ4T 2AKLA 4HVWA 2ARUA 1N8RU 3I55A 4CRIA 2EYQA 3JRZA 5D6YA 3U23A 5LJ5d 3QO5A 1ZSZA 2A28A 1NYQA 3MEWA 1QW1A 2ZPHB 2EKHA 4J83A 4ZN1A 1D1BA 2P0QA 3G6EQ 3HFVA 2ZPEB 5GJVB 1RAEB 4FT4A 1M27C 2F5TX 5LJ3d 2Y4YA 2DO3A 2ZPFB 1SHGA 4M78A 1UGVA 4FT2A 1K76A 2DILA 4ZTZB 3NEMA 2NLUA 3H0HA 2QASA 3BDUA 2ZZGA 1VQ6Q 4JJCA 4BD3A 2O4XA 2NUZA 3IQLA 3CCRA 3H6ZA 2L5QA 3CMAA 4ZGEB 4DEXA 2C0IA 2DL3A 5FU6B 2RQWA 2RHXA 1WIEA 2KT1A 5CQXA 4A4HA 2EGAA 4E7KA 4EMKA 2JNGA 2CH4A 1VQ9T 4M75G 1YHQA 4X1VA 2L2PA 5E3IA 2R57A 1Q82U 3PMTA 1YB3A 4HVUA 2EQKA 3FLGA 1NJIR 2KI7A 2J6KA 4YRIA 1VUBA 4F16A 4LXCA 3QXEB 1TS9A 2RHIA 3CC7T 4OB1B 5GAN4 1R0CB 3EGUA 4LD9K 2ZNJA 2QK0A 2DFUA 1GBQA 1KC8R 5FWCA 2RK2A 2EQMA 2VVKA 1QVPA 5GANh 1VA7A 4VUBA 4EIKA 2O01E 1USYC 4PHCA 2OTJT 1KMNA 3C0CA 1BI1A 3VQWA 2AIRB 2K5LA 4YPFA 2M9UA 4HXJA 2X3WD 5CVIA 5HK3A 2DEUA 3X25B 1W6XA 1QKXA 1Q7YR 3GPLA 3CCVQ 1I81A 3H9NA 4YRGA 5A2QE 5CR2A 2RPNA 2KY9A 4P3NA 4AG1C 1PSFA 1E24A 1TUGB 1ADYA 1ZQ1A 4JRQA 1LJOA 2QQ9A 3PCOB 4KULA 1U8RA 2ALYA 1VQPA 1G5HA 1M9SA 5GANg 3EGXA 1UGQB 1H4SA 4MMKA 1ZHIA 1VQNA 4YRKA 3CQTA 2PMEA 1H8KA 2LT1A 4OMLA 3GNGA 4KT0E 3P8BB 4PJMA 1X69A 2DRMA 4M77G 3SWNB 1OZ2A 4JJNK 1ADJA 2ZZEA 1OV3A 1G5VA 1M3CA 4XAXB 1BBZA 5GANe 1WXUA 4LDUA 5L23A 3HRTA 1KMMA 2D8HA 2IY5B 1F1BB 3BDLA 3O5ZA 3M0QA 1MMAA 3M58A 3X20B 1K8AR 1NLPC 4OVAA 1SESA 3CCVT 3HXXA 1OQKA 3VS1A 4P74C 3HFOA 1WXTA 2CYZB 1IREB 4YYEA 1K9MC 5IHIA 2DE0X 1FMVA 4FYWB 2DYIA 4KR3A 1NJ2A 2J3MA 1AWXA 4Z89A 2X4YA 4OGCA 3QHSA 2RHYA 3M0PA 3CMET 1J5WA 3H0FA 4M78G 2KRMA 2VASA 2EPDA 2FHDA 2R5MA 1QWFA 3OYLA 2RI3A 2RK1A 2ABLA 3M5AA 4R0KA 2Q7HA 3RL6A 4RTTA 4QQ6A 5HY6A 3A31A 3OYNA 1X56A 1BCOA 1SSFA 2X3XD 4D8DA 2K2VA 3G7ZA 4DBRA 3VYHB 2ECZA 3CCQQ 4BW9A 4HT4A 2B86A 4LNSA 3REXA 3TSWA 2GF7A 3CC7Q 1GRIA 5KH6A 4PL6A 1YJNQ 1JJ2A 1YI2A 4OMQA 3UA6A 3QG1A 3OW2S 1WYXA 4YRFA 1WQWA 2K2MA 2COWA 5LJ3h 4E7IA 1M2OA 4AMCA 1VQKQ 4EMHA 4M7DC 1GBRA 1IGUA 1VQ8A 4PLIA 4B9WA 2LNVA 2HEQA 1G83A 1KHCA 1MNDA 1JRIA 2KAFA 5FW9A 3JV3A 3RIRA 1PM3A 5J39A 3VS6A 2EBPA 3G71T 1PKSA 3QDRB 3EHRA 1VQKA 4N4GA 2QEXQ 4M77C 4EMKC 2YRVA 1RAHB 1K9AA 1ARKA 3CEYA 4N0AC 4KGZB 1B34A 3QUIA 2LCSA 1H92A 1K0XA 1ATIA 4FU6A 3VYGA 1VQZA 4PLLA 3MHXA 5FLXE 1NJ5A 2CP5A 1D1AA 5HCKA 3D7SB 3M9QA 1ABQA 1AOJA 1B3QA 3WVDB 2OTLA 5C53B 2F1LA 1U06A 3LYIA 1D09B 3VQXA 3UH0A 1M8VA 1M30A 1LCKA 4H2VA 2HD0A 3OYBA 1YCYA 3LSSA 4OF1A 1Q81R 3MJXA 1SRYA 4KRTA 1G5IA 1X54A 1X6BA 2RJCA 4BB7A 1EIFA 3M4PA 4R56A 2ZTGA 1ZX6A 3M4GA 1RAIB 4CC3A 1YITT 1WGSA 3HKSA 3VS2A 1U5SA 7AT1B 3OBWA 1MMNA 1QQJA 2P4TA 2G4CA 11ASA 3OYYA 1OU8A 1WJSA 3CC4T 4YROA 2GQVA 3LSQA 4C0DC 4LNPA 3RBBB 3JCMb 1QVGP 4LVKA 2X51A 4UP8A 2FB7A 4M77D 1M1KR 3OA6A 5AYFA 2RQUA 3HSBA 3CPWP 3A7RA 1S72Q 3A98A 2HCKA 1VQ8T 1G3TA 3RDVA 1RLPC 3NMZC 3ZFJA 2A3LA 2RH2A 3RGLA 1VQOT 4FSSA 3NHNA 4Y92A 2C8MA 3HY1A 3CCST 4M75D 4X34A 4PJOE 1B7TA 2EW3A 3JCMV 2DTHA 1X2HA 4PFOA 1NYGA 2FZGB 3HXZA 3OYHA 1RI9A 4E7HA 3LLRA 4J9IA 1VQ9Q 1HK9A 2A7YA 4RTXA 2MI6A 3I55T 1I4K1 12ASA 2LZ6B 2LVMA 4F14A 1GCQA 4FL6A 3JB9D 1FWZA 2RA2A 3PE0A 4M7DB 3HFZA 3HTZA 1AWWA 1HC7A 2OTLT 2GTJA 4M77B 3G71Q 1BU1A 2RD1A 4PJOF 3OS2A 2MK5A 2DRKA 2K3YA 4OB3B 2PVDB 4XU2A 2QQAA 4AFQC 4N4HA 3C95A 3PFSA 3EFOB 2QI2A 1BIBA 1OEBA 4OMFB 2DMOA 1NPRA 3A5ZB 1GXIE 2GQIA 1D0YA 2K79A 2DKGA 3BW1A 3I5RA 4LN2A 4C92D 1GL5A 3IKMB 1PKTA 1YJNA 3REBB 2MF2A 3VQYA 4OMPA 4RG2A 3CC4A 4A4GA 3QWYA 2R5AA 1WHGA 2CP7A 4M77A 1YP5A 2CZ7B 3A1PA 2AKWA 1HTTA 1H3HA 2QA4A 5GAMd 2XDPA 3F70A 3OB9A 2ZT5A 5CIUA 4M7AA 1IHVA 3HTRA 4JUVA 4C5HA 2RM4A 3HP9A 4CH6A 2QQSA 4Q15A 1VQOA 2O9VA 5D6XA 4E7SA 2YUPA 2G3RA 4ESRA 1YFSA 4M4ZA 5IH2A 2RJEA 3OQ5A 3P8DA 3TVTA 4BE0A 5GJWB 4CH5A 4IIMA 2CSQA 5GMKl 3P8YA 1V29B 2JTMA 4RTYA 1GCQC 1YJ9Q 1N9RA 1W2BS 4KR2A 3VS3A 3GIBA 5IT9E 1VQ6T 5K1XA 4HT9A 1N27A 3V8LA 2XK0A 4PJJA 4L6V5 4K11A 4C0DB 2FVUA 3PTAA 4EMKB 4V2SA 1YBYA 1S72T 2NYSA 1M5Q1 2YDLA 2CZ0B 2GBQA 4PJNA 4HCCA 3TEHA 2WSCE 4E6RA 1KQ1A 2R58A 3A5YA 1E6HA 1H4TA 2F5KA 3DB4A 2KBTA 4E2FB 4TWAA 1W2BP 4HCKA 2YUQA 2A8EA 1QMCA
chains in the Genus database with same CATH topology
2JZ2A 2KK4A 3JCMQ 4M75B 3PGGA 4H2WA 4HCBA 3UPUA 4O6JA 3OS0A 4N0AA 1VQ5A 1VQPT 4C5GA 3EAEA 2LDMA 4UP7A 1K8AU 4Q6GA 3OS1A 4JS4A 4CS2A 3FC3A 2ZXFA 2KVQG 4M78D 3MEUA 2DEQA 4LDYA 1BIAA 1KQSS 3MP6A 3IG2A 4LVJA 4C0GA 3M59A 2QQRA 3L4GB 3L42A 2I2LA 2KMTA 1Y96B 4LVMA 2QEXA 2IVWA 3HRIA 4P72A 4M7DG 4PG3A 4A4KA 3SWNA 4M7AE 5ELNA 2XDBA 3ICAA 3CMEA 3RERA 4LDXA 4UPAA 2CJ9A 2Y4XA 4HWRA 3S3OA 4Q5WA 1WNLA 3INZA 3IKLA 1M1KC 3L1AA 3VQVA 4EX5A 1JJCB 3CBOA 3G4ST 3JB9H 3H8ZA 3TEHB 3BY7A 4TVRA 1KD1C 4K86A 5LJ5e 5DM7R 3VUBA 1YJ9A 4BWAA 4MDXA 3I56A 4C8QB 3RUXA 5C52B 4UP9A 1U1SA 1W66A 3ME9A 2EWNA 3M55A 2VC8A 3R6OA 3WXMB 4WJ3M 5GMKe 2RI2A 3PIOA 4R55A 2DXCA 5KE3A 1HXDA 3SWNC 3CBMA 4QQGA 4MZPA 3TEGA 4L5GA 3X28B 3LWIA 2DIGA 3NTKA 3RMSA 4JS5A 5GMKj 2YLCA 2V8IA 3OSVA 4EMGA 1VQ9A 3DLMA 1Z7NA 4DPGA 3O8VA 3VUZA 4XTVA 3ERRA 3HY0A 2VGMA 5CCAA 2JUFA 1PYSB 3CC7A 2RB6A 4JLIA 3QNEA 1E1TA 5IAYA 2ALYB 4F7UF 1KD1U 1AHJB 3JCMd 1EIYB 3CCEA 5GAOm 1NPPA 5FROA 2EIFA 2WACA 4HWOA 3KFUA 5GANd 2JTFA 2AMCA 3LH0A 2YHTA 4CS4A 4C5IA 2CKKA 2DVEA 3HHTB 1M90U 3UGQA 1YHQT 3G6EA 2QTXA 1UGSB 3MF1A 3HL8A 1VQLT 4BI8B 4IUUA 4Z02A 1GGMA 4BI4A 4P73A 4WF2A 4J6XA 2BUDA 4FM4B 3PMIA 5KCOA 3REUA 2RHUA 5DLOA 2QHTA 3WVEB 3MP8A 3OYEA 4D6WA 4HVCA 3QSUA 4NOYA 4NS5A 3ZEHA 2HNIA 2PU9B 2PUKB 2ZR2A 4QVCA 2IG0A 3MF2A 3CCMT 2RHQA 3LGFA 1H4VB 4QQDA 3CC2T 1VIEA 3MEYA 1WLEA 1YGBA 2LC4A 3CCQA 4K88A 5HGQA 1W4SA 1XNIA 2Q7EA 2QQBA 3C12A 4JRIA 4RMFA 3RACA 2ODRD 3TREA 3HRUA 4C8QE 2IY5A 4F7UE 4M7DE 4P71C 3OYDA 3TUPA 4BI3A 2L8DA 3L4GA 5GMKi 3TEEA 3A5ZA 4HWPA 3UFGA 4O5VA 2DU7A 3OSSC 4J7IA 5GAN2 2J3LA 4N4IA 1NZ9A 2ZR3A 5LJ5h 4NCXA 2EL9A 4F7UG 4OB0B 4LD6A 2EQJA 3NTHA 1MGQA 3PT9A 3RKXA 1OZ3A 2BKDN 3OY9A 4AH6A 3HXYA 3SD4A 2EKOA 4OGEA 3P8VA 1Q86U 4M75A 4J7FA 1NYRA 3QO7A 4NL2A 4CS3A 5EG2A 2RO0A 5F5WA 4GY5A 4YCWA 2MWPA 2HQXA 1M1FA 3QZ5B 1O9SA 3QO3A 2LTOA 1OI1A 4KQEA 4E47A 4OB2B 1M1KU 3CCMA 4WI1A 3DLLA 5GANj 4M7AC 2ZZFA 5GAOl 5FRNA 4PJOD 4YREA 3CMQA 1YFTA 2PQWA 4QVZA 1LYLA 1N8RC 3QJ6A 3L2ZA 4MMLA 5IN1A 4C5EA 4XU1A 2KQWA 4HKEA 5HK0A 1N9WA 4C0FA 4PKCC 1VQKT 2KSSA 1S72A 2V8JA 4P3PA 1KOGA 1BBUA 3E19A 4HWTA 2EFIA 2HBPA 3E9HA 2XTIA 4H2YA 3OYJA 2CZ1B 4G85A 3EFSA 4XK8E 2VUBA 2K4YA 3I56T 3W3SA 4ELYC 4J6YA 2ZNIA 1YI2T 2RJDA 3HRSA 2ZGWA 4C92E 3KUFA 2DXUA 5GAOn 1DJ7B 1PSEA 2XG8D 3OYAA 3QTCA 4EDUA 5FU6C 3T9NA 2EQUA 2RHQB 3UWNA 4UC4A 4PJOC 2CGHA 4PJOA 3G4SA 1X2GA 3I7FA 3SDZA 4C92G 3CD6A 4KUIA 3JB9F 1I8FA 1VQMA 2DIQA 2K5IA 4H2XB 2QXFA 3VU3C 4XTWA 1H4QA 2NS6A 3QIIA 3OBYA 5GMKh 2WSEE 2AKWB 1IZ6A 4M77F 5LJ3e 4ZGJB 4PJOB 2ZCEA 3ZBDA 5A0GA 4F7UA 4ZTJA 2CIMA 3HXUA 4M7DA 4RCBA 4TVYA 4XTYA 5K1PA 3JCMW 1Q7YU 2DXTA 5LJ3j 3CCJA 1JBMA 1NE8A 1C0AA 3L2QA 4DOVA 2XU8A 3FRNA 4BE1A 4BE2A 2ZPGB 4CI0C 3URGA 5CKBA 3MEVA 3CCUT 1KHIA 3A32A 4M77E 4P75C 3JCMf 2JOYA 1B70B 2E3CA 2JVVA 3L2VA 2F69A 5L8RE 4XU0A 3G6ET 1X6OA 1YJ9T 4II1A 2B8AA 4BY6C 3FEOA 2VXFA 3CCLT 4J8OA 4C8QG 2LRQA 5GAN6 3RKYA 1N9SA 1WJQA 3PIPA 2ZIMA 4C92B 3QO8A 1YIJA 4M78E 2DQ3A 3E9FA 3CPWS 3CD6T 1YJNT 3A7AA 3OYIA 5CKDA 1Q86C 3FB9A 2Q5HA 4TQFA 2EJFA 3JCMh 3V7RA 1B7YB 4YRPA 1FYFA 3HFZB 3M53A 3QPHA 4LVIA 1QVFS 4WJ4A 3BJUA 2GCXA 2K57A 4FSXA 3L2UA 3UGTA 1B76A 3J7AF 2RHZA 1H641 2ODRC 4RG8A 3N5BB 2EJGA 4P5NA 4BY6B 1M90C 4RQEA 3SB2A 1NJ1A 2EAYA 3V7SA 3CBPA 5I21A 1NJ6A 4L87A 4O2DA 4J15A 3J80E 2RI5A 3LWHA 2LT4A 5KNNA 3LX7A 3MP1A 2VXEA 2C06A 2D6FA 1NJ8A 2HQEA 5J26A 4C0ZA 5GMKm 3UDCA 3BFMA 2FL7A 3CCUA 1H3ZA 2XICA 3CCET 5LJ5g 2BIVA 3IALA 4ZN3A 3OYMA 1XOVA 3TCJA 1B8AA 1G3WA 3A8HB 3MEAA 4MZMA 4C8QC 1PYSA 4ZTUB 3QBYA 2DAQA 5CAIA 4XTXA 1Y71A 2E70A 3OMGA 3C94A 2K3XA 2Q7GA 3GF5A 1X75C 3GOXA 2MWOA 4OP0A 3RKWA 4BDZA 1RIQA 4TTVA 3CPWA 2D9TA 3LGLA 1YJWT 2QHUA 3V7CA 3P8TA 1M4ZA 4F7UB 2XDDA 4E7JA 4IUVA 5DY9A 2DU5A 3NETA 5GAN3 1OYXA 3V8KA 4X9CA 3OMCA 1G3SA 4PJOG 4P73C 2RHSA 4ME7A 2X4XA 4FIBA 4TVAA 2AHJB 2VV5A 1X55A 3JAME 4E7LA 1UGPB 4M7AF 3OS5A 2CJBA 4JLGA 2ZINA 1EOVA 3M57A 3KBGA 1USYA 3A7UA 4YRRA 3MO8A 2JN0A 5A0LA 2LCCA 3QKJA 1P92A 2E6ZA 1Y07A 2C7IA 4H02A 4CH4A 4M7AD 3LC0A 4H2SA 4ZTFA 3HRKA 4J6WA 2M1HA 4YRCA 3CXCS 1L0WA 2DQ0A 3GLXA 4PNOA 3L2WA 4YCVA 1LNXA 4HT8A 4A4FA 4JRKA 1BYMA 2ARSA 2CZ6B 2XHCA 2M0OA 2VYTA 2X35A 3RF1A 2ZPIB 4KUDK 3C4SA 4IURA 4DOWA 2WSFE 2XI9A 5GAMh 1B70A 2E6NA 5CKFA 1SERA 4JDSA 4G84A 2FYKA 2ZT7A 2ZZDA 3JCMe 2E1HA 4ZIBA 3OYFA 2ZT6A 2I4LA 3DB3A 2P0PA 1ASZA 4BUGA 5CK9A 5ELOA 2PUOB 3NELA 1R8OB 5GAN7 4C8QD 2MAMA 4RCCA 2DDZA 1VQMT 3JCMc 1VQNT 1NNHA 1RI0A 2YLBA 1YFRA 1VIFA 3MCAB 3NENA 1KG1A 5J3BA 2GFAA 3E1SA 3FDRA 1JJ2S 1UGRB 1VQ7A 4BDYA 4EO4A 3PZCA 1Z7MA 5CKEA 1NJIU 4A53A 4C92F 1BI2A 4IUPA 3JB9G 1Q7YC 2XIDA 4XEMA 3M4QA 4HWSA 1VQLA 3JCMP 3HPWA 3CCRT 5GAOr 5GAMj 4JRPA 1FX7A 1XTDA 4XQ3A 4P75A 2ZIOA 3JB9J 1BI0A 4XU3A 3CCJT 1SETA 2DPPB 1I5LA 2PMFA 4YRJA 3VKIA 2P0KA 4ZGDB 2ZT8A 2O4XB 4P71A 2DXBA 3HXWA 2I4OA 2H3JA 2E41A 3A74A 4YRQA 4A4EA 1LOJA 4RDXA 3VJPA 1G51A 4TQDA 4DA4A 1IL2A 5C51B 4M75F 3WQZA 3CC2A 4XTUA 4M7AB 5D6WA 3CCQT 1QE0A 1K9MU 4MDWA 1O75A 3DSQA 3JCMg 1K73U 2M16A 4ELZC 2LQKA 2Y90A 1KC8U 2QDYB 2RHSB 2E5AA 3PNWC 1EIYA 2HAXA 1G3YA 4P72C 3CCLA 3L2RA 1XQHA 3S6WA 3OW2A 4QVDA 4M78C 4YRMA 3DKMA 5LL6S 1FXXA 5GAOq 3HFNA 2L89A 3M4YA 1YITA 1U1TA 2DZ9A 5KE2A 5CO7A 5FU7B 3S3NA 4M7DD 2P0LA 2DTIA 4RQFA 5A0DA 4A54A 3PCOA 1Q82C 4M7DF 3ER0A 1X01A 2KDSA 3M56A 2E10A 1QP2A 3CXCA 3VV0A 5LJ3g 4RMOA 3MQZA 2LX9A 4DQ2A 3S3MA 5FU7C 2MMPA 4IUTA 1EVKA 3FIFA 1VQ6A 1N6AA 1KQ2A 2LQ8A 4IUQA 2V8KA 3SFMA 4YCUA 2XD0A 4YRTA 3EFRA 1UB4A 4B9XA 4RKUE 4E51A 4IKFA 4BACA 4P74A 1QVGA 4Y91A 1QF6A 1E1OA 3JCMJ 3Q1JA 1YJWA 3GP8A 5GAOp 4X9DA 1B34B 2AMCB 3HXVA 3QYHB 4MZTA 2OAUA 2OTJA 1B7YA 3X26B 1QVFA 1D3BA 3G1ZA 5CQYA 2VGNA 2K5FA 1EVLA 3QJYA 1Y7XA 2P5IA 2Q5IA 2E12A 3CCVA 2CJAA 1EQRA 1QVGS 4H2XA 2CS7A 1NJIC 3G71A 3LW5E 5GAN5 4M75E 4K87A 3JB9I 2XGTA 5GANf 3RESA 3A8GB 3R07A 1WU7A 3TU4K 4C92C 1K73C 3QYGB 3OYGA 4YTLA 3UT1A 4LVLA 1E22A 4M78B 1BI3A 5KCHA 2ARTA 3JSCA 4YP0A 4OLFA 5FRMA 5GAMf 1UEBA 4Y28E 2PVOB 4LDWA 5C0MA 2I4MA 4P3OA 4H2TA 4YRSA 3AHUA 1ZBXA 4C8QF 2E5QA 1BKBA 4HA8A 1W2BA 3JCMX 3KXTA 2EJ9A 3A8LB 4J5YA 1Q81U 5LJ5j 4XEOA 3A8OB 4H2UA 2DD4A 2DJZA 1VQ4A 3OD1A 4YDQA 3VBBA 3NFCA 3NTIA 1Q81C 1Y96A 2E64A 3E9GA 4C92A 4YRNA 1BBWA 4ATOA 2DZCA 4M78F 1EFWA 3M54A 4M7AG 5GAMe 1VQ5T 2DTOA 4HCZA 1ASYA 1K8AC 2DK3A 2ZPBB 1MHNA 3CPFA 1JB0E 4YRLA 3E9IA 2QHSA 3OYKA 1WYDA 3GNFB 1KQSA 2GFUA 4L59A 4CH3A 5I2SA 3RMQA 4EPCA 4GLKA 1WJRA 5GAMg 3P8HA 1KC8C 3V8JA 3QZ9B 2RJFA 3CMAT 2L3RA 4M75C 2QEXT 5I2MA 1VQ7T 5M9OA 4QW2A 2X4JA 3A8MB 4NL3A 5DLQE 5LJ3f 1M1GA 2ZCFB 3X24B 2I4NA 1WQ7A 2DD5A 4KBMB 5GAN8 1JJCA 3OYCA 2XKOC 3META 1TH7A 4LDVA 3J81E 5CKHA 3FJPA 5LJ5f 3CCSA 4C8QA 1D3BB 1QP3A 2E65A 3ASKA 2D0QB 5HKCA 2PVGB 2QHVA 1RL2A 4TVAB 1YIJT 2QA4T 2X4WA 4TVWA 4X5OA 1WPYA 2LCLA 4XTZA 5C6SA 1VQ4T 2ARUA 1N8RU 3I55A 4CRIA 2EYQA 3JRZA 5D6YA 5LJ5d 3QO5A 1NYQA 3MEWA 1QW1A 2ZPHB 4J83A 4ZN1A 2P0QA 3HFVA 2ZPEB 4FT4A 2F5TX 5LJ3d 2Y4YA 2DO3A 2ZPFB 4M78A 4FT2A 4ZTZB 3NEMA 2NLUA 3BDUA 2ZZGA 4BD3A 3CCRA 2O4XA 3H6ZA 2L5QA 3CMAA 4ZGEB 5FU6B 2RHXA 5CQXA 4A4HA 4E7KA 4EMKA 2JNGA 1VQ9T 4M75G 1YHQA 5E3IA 2R57A 1Q82U 3PMTA 1YB3A 2EQKA 3FLGA 4YRIA 1VUBA 3QXEB 2RHIA 3CC7T 4OB1B 5GAN4 4LD9K 2ZNJA 2RK2A 2EQMA 1QVPA 5GANh 4VUBA 2O01E 1USYC 4PHCA 2OTJT 1KMNA 3VQWA 1BI1A 2K5LA 4YPFA 2M9UA 5CVIA 5HK3A 3X25B 3GPLA 1I81A 4YRGA 5A2QE 5CR2A 2KY9A 4P3NA 1PSFA 1E24A 1ADYA 1ZQ1A 4JRQA 1LJOA 2QQ9A 3PCOB 4KULA 1U8RA 2ALYA 1VQPA 1G5HA 1M9SA 5GANg 1UGQB 1H4SA 4MMKA 1ZHIA 1VQNA 4YRKA 2PMEA 2LT1A 3GNGA 4KT0E 3P8BB 4M77G 3SWNB 1OZ2A 4JJNK 1ADJA 2ZZEA 1G5VA 4XAXB 5GANe 4LDUA 3HRTA 1KMMA 2IY5B 3BDLA 3M58A 3X20B 1SESA 4OVAA 3CCVT 3HXXA 4P74C 3HFOA 2CYZB 1IREB 4YYEA 1K9MC 4KR3A 1NJ2A 2J3MA 2X4YA 4OGCA 3QHSA 2RHYA 3CMET 1J5WA 4M78G 2FHDA 2R5MA 3OYLA 2RI3A 2RK1A 3M5AA 2Q7HA 3RL6A 4QQ6A 5HY6A 3A31A 3OYNA 1X56A 1SSFA 2K2VA 3G7ZA 3VYHB 4BW9A 4HT4A 4LNSA 3REXA 2GF7A 5KH6A 4PL6A 1JJ2A 1YI2A 3QG1A 3OW2S 4YRFA 1WQWA 5LJ3h 4E7IA 4EMHA 4M7DC 1VQ8A 4PLIA 4B9WA 2LNVA 1KHCA 1JRIA 2KAFA 3RIRA 5J39A 3G71T 3QDRB 1VQKA 4N4GA 4M77C 4EMKC 2YRVA 3CEYA 4N0AC 1B34A 3QUIA 1ATIA 4FU6A 3VYGA 1VQZA 4PLLA 3MHXA 5FLXE 1NJ5A 3M9QA 3WVDB 2OTLA 5C53B 3LYIA 3VQXA 3UH0A 1M8VA 4H2VA 2HD0A 3OYBA 1YCYA 3LSSA 4OF1A 1SRYA 1G5IA 1X54A 2RJCA 4BB7A 1EIFA 3M4PA 4R56A 2ZTGA 3M4GA 1YITT 1WGSA 3HKSA 3OBWA 2P4TA 2G4CA 11ASA 3OYYA 1WJSA 3CC4T 4YROA 2GQVA 3LSQA 4C0DC 3JCMb 4LVKA 4UP8A 2FB7A 4M77D 3OA6A 5AYFA 3HSBA 3A7RA 1VQ8T 1G3TA 3ZFJA 2A3LA 2RH2A 3RGLA 1VQOT 2C8MA 3HY1A 3CCST 4M75D 4X34A 4PJOE 3JCMV 2DTHA 1X2HA 3HXZA 3OYHA 4E7HA 3LLRA 1HK9A 2A7YA 2MI6A 3I55T 1I4K1 12ASA 2LVMA 4FL6A 3JB9D 1FWZA 2RA2A 4M7DB 3HFZA 3HTZA 1HC7A 2OTLT 4M77B 2RD1A 4PJOF 3OS2A 2K3YA 4OB3B 2PVDB 4XU2A 2QQAA 4N4HA 3C95A 3PFSA 2QI2A 1BIBA 4OMFB 1NPRA 3A5ZB 1GXIE 2DKGA 3BW1A 4C92D 3IKMB 1YJNA 2MF2A 3VQYA 4RG2A 3CC4A 4A4GA 2R5AA 4M77A 2CZ7B 2AKWA 1HTTA 2QA4A 5GAMd 2XDPA 3F70A 3OB9A 2ZT5A 5CIUA 4M7AA 4JUVA 4C5HA 2RM4A 3HP9A 4CH6A 2QQSA 4Q15A 1VQOA 5D6XA 2G3RA 1YFSA 2RJEA 3OQ5A 3P8DA 4BE0A 4CH5A 5GMKl 3P8YA 1V29B 2JTMA 1N9RA 1W2BS 4KR2A 3GIBA 5IT9E 1VQ6T 5K1XA 4HT9A 1N27A 3V8LA 2XK0A 4L6V5 4C0DB 2FVUA 3PTAA 4EMKB 4V2SA 1YBYA 1S72T 1M5Q1 2CZ0B 4HCCA 3TEHA 2WSCE 1KQ1A 2R58A 3A5YA 1H4TA 2F5KA 3DB4A 4TWAA 2A8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM Q;  3QTC A;  4M75 B;  4XQ3 A;  3PGG A;  4EMK A;  4H2W A;  2RHQ B;  4P75 A;  2ZIO A;  3JB9 J;  4N0A A;  4XU3 A;  4M75 G;  4PJO C;  1SET A;  2CGH A;  1I5L A;  5E3I A;  2PMF A;  4PJO A;  1YB3 A;  4YRJ A;  1X2G A;  3I7F A;  4C92 G;  4YRI A;  2ZT8 A;  4UP7 A;  4P71 A;  3JB9 F;  4Q6G A;  1I8F A;  4CS2 A;  3HXW A;  4H2X B;  2I4O A;  2ZXF A;  2E41 A;  4M78 D;  3A74 A;  2DEQ A;  3VU3 C;  4XTW A;  4YRQ A;  5GAN 4;  1BIA A;  1H4Q A;  3IG2 A;  1LOJ A;  5GMK h;  4RDX A;  2ZNJ A;  3L4G B;  2I2L A;  1G51 A;  1Y96 B;  2AKW B;  4TQD A;  1IL2 A;  4M77 F;  5LJ3 e;  5GAN h;  5C51 B;  4M75 F;  3WQZ A;  1USY C;  4XTU A;  4PHC A;  4M7A B;  3HRI A;  4PJO B;  1KMN A;  3VQW A;  4P72 A;  2ZCE A;  1QE0 A;  4YPF A;  4M7D G;  4PG3 A;  3SWN A;  4M7A E;  5ELN A;  4F7U A;  3ICA A;  2CIM A;  3HXU A;  4M7D A;  4RCB A;  3RER A;  3DSQ A;  4TVY A;  3JCM g;  4XTY A;  5K1P A;  3JCM W;  1I81 A;  2DXT A;  5LJ3 j;  4YRG A;  4UPA A;  1JBM A;  2CJ9 A;  4P3N A;  1C0A A;  4HWR A;  2Y90 A;  1E24 A;  1ADY A;  1WNL A;  3INZ A;  1LJO A;  2RHS B;  3A32 A;  4M77 E;  3IKL A;  4P75 C;  2E5A A;  3PCO B;  2ALY A;  3JCM f;  3L1A A;  3VQV A;  4EX5 A;  1B70 B;  1JJC B;  2E3C A;  1EIY A;  1G5H A;  5GAN g;  4P72 C;  4XU0 A;  1H4S A;  4MMK A;  3JB9 H;  3TEH B;  3BY7 A;  4YRK A;  4QVD A;  4M78 C;  4YRM A;  2VXF A;  2PME A;  5GAO q;  4C8Q G;  5GAN 6;  3HFN A;  4K86 A;  5LJ5 e;  4BWA A;  3RKY A;  1N9S A;  1U1T A;  4M77 G;  3SWN B;  2ZZE A;  1ADJ A;  5GAN e;  4C8Q B;  3RUX A;  5C52 B;  2DZ9 A;  1KMM A;  2ZIM A;  4M7D D;  4C92 B;  2P0L A;  2IY5 B;  4UP9 A;  1U1S A;  2DTI A;  1W66 A;  3QO8 A;  4M78 E;  4RQF A;  2DQ3 A;  4A54 A;  3PCO A;  2EWN A;  4M7D F;  2VC8 A;  1SES A;  1X01 A;  3A7A A;  3HXX A;  2E10 A;  3FB9 A;  4WJ3 M;  4P74 C;  3HFO A;  5GMK e;  5LJ3 g;  2Q5H A;  4TQF A;  4YYE A;  2EJF A;  3JCM h;  3V7R A;  1B7Y B;  4DQ2 A;  4YRP A;  4KR3 A;  1FYF A;  1NJ2 A;  2J3M A;  3HFZ B;  1HXD A;  3QHS A;  4WJ4 A;  3BJU A;  3SWN C;  2K57 A;  3UGT A;  1B76 A;  1J5W A;  4M78 G;  1H64 1;  3TEG A;  1EVK A;  3FIF A;  2ODR C;  2EJG A;  1KQ2 A;  5GMK j;  2YLC A;  2Q7H A;  4RQE A;  3RL6 A;  3SB2 A;  4EMG A;  3A31 A;  4YCU A;  1NJ1 A;  4YRT A;  2EAY A;  3EFR A;  3V7S A;  1X56 A;  1Z7N A;  4DPG A;  4E51 A;  5I21 A;  4P74 A;  4BW9 A;  4XTV A;  1NJ6 A;  4L87 A;  4O2D A;  4J15 A;  4LNS A;  3REX A;  4Y91 A;  1QF6 A;  1E1O A;  3JCM J;  3ERR A;  3HY0 A;  5KNN A;  1PYS B;  5GAO p;  4X9D A;  2VXE A;  1B34 B;  1NJ8 A;  2AMC B;  3HXV A;  2RB6 A;  5GMK m;  4YRF A;  1WQW A;  3BFM A;  1B7Y A;  5LJ3 h;  1D3B A;  3G1Z A;  5LJ5 g;  4JLI A;  1E1T A;  3QNE A;  4EMH A;  4M7D C;  1EVL A;  3IAL A;  2ALY B;  4F7U F;  3JCM d;  1EIY B;  1JRI A;  1B8A A;  3RIR A;  2P5I A;  5GAO m;  2Q5I A;  2CJA A;  1EQR A;  4H2X A;  4M77 C;  4HWO A;  4EMK C;  3KFU A;  5GAN d;  4N0A C;  4C8Q C;  5GAN 5;  1B34 A;  4M75 E;  1PYS A;  3QUI A;  2AMC A;  4K87 A;  4ZTU B;  1ATI A;  3JB9 I;  2XGT A;  2YHT A;  4CS4 A;  5GAN f;  1VQZ A;  3RES A;  5CAI A;  2DVE A;  3R07 A;  1WU7 A;  4XTX A;  1NJ5 A;  3UGQ A;  4C92 C;  2QTX A;  2Q7G A;  3MF1 A;  5C53 B;  1GGM A;  3VQX A;  3UH0 A;  1M8V A;  4P73 A;  1E22 A;  4M78 B;  4WF2 A;  4H2V A;  2ART A;  4OP0 A;  3RKW A;  1RIQ A;  4TTV A;  4J6X A;  1YCY A;  3LSS A;  4YP0 A;  4OLF A;  1SRY A;  3REU A;  1G5I A;  1X54 A;  2QHU A;  5GAM f;  3M4P A;  2QHT A;  3V7C A;  2ZTG A;  3P8T A;  4F7U B;  3M4G A;  4HVC A;  2I4M A;  2G4C A;  4P3O A;  11AS A;  5DY9 A;  2DU5 A;  3NET A;  4H2T A;  5GAN 3;  4YRO A;  3QSU A;  4NOY A;  3LSQ A;  3V8K A;  4X9C A;  3JCM b;  4YRS A;  3AHU A;  2HNI A;  4PJO G;  4P73 C;  4UP8 A;  2RHS A;  2FB7 A;  4M77 D;  4C8Q F;  4TVA A;  2ZR2 A;  4QVC A;  1X55 A;  4HA8 A;  3JCM X;  3MF2 A;  2RHQ A;  4M7A F;  2EJ9 A;  1H4V B;  3HSB A;  4J5Y A;  3MEY A;  5LJ5 j;  3A7R A;  1WLE A;  1YGB A;  2CJB A;  4XEO A;  4H2U A;  2DJZ A;  3OD1 A;  4K88 A;  2ZIN A;  3RGL A;  5HGQ A;  1EOV A;  2C8M A;  4YDQ A;  3HY1 A;  2Q7E A;  4JRI A;  1USY A;  4M75 D;  3VBB A;  4PJO E;  1Y96 A;  3A7U A;  2E64 A;  4RMF A;  3RAC A;  2ODR D;  3JCM V;  4C8Q E;  2DTH A;  4C92 A;  1X2H A;  4YRR A;  4F7U E;  2IY5 A;  4YRN A;  1BBW A;  4M7D E;  2JN0 A;  3HXZ A;  4P71 C;  2DZC A;  4M78 F;  1EFW A;  3TUP A;  4M7A G;  5GAM e;  2C7I A;  4H02 A;  2DTO A;  3L4G A;  1ASY A;  1HK9 A;  5GMK i;  4CH4 A;  4M7A D;  3A5Z A;  4HWP A;  3LC0 A;  1I4K 1;  12AS A;  3UFG A;  4H2S A;  2DU7 A;  3E9I A;  3JB9 D;  4YRL A;  5GAN 2;  2J3L A;  2RA2 A;  4M7D B;  2QHS A;  3HFZ A;  3HTZ A;  2ZR3 A;  1HC7 A;  3HRK A;  1WYD A;  4J6W A;  5LJ5 h;  4NCX A;  2EL9 A;  4F7U G;  4CH3 A;  4M77 B;  5GAM g;  4YRC A;  1L0W A;  3V8J A;  4PNO A;  1MGQ A;  2RD1 A;  2DQ0 A;  4PJO F;  3RKX A;  4YCV A;  1LNX A;  4HT8 A;  4AH6 A;  3HXY A;  4JRK A;  4M75 C;  4XU2 A;  3P8V A;  2ARS A;  4M75 A;  1BIB A;  4NL3 A;  1NYR A;  4NL2 A;  3QO7 A;  4CS3 A;  3RF1 A;  5LJ3 f;  2DKG A;  3BW1 A;  4C92 D;  3IKM B;  2I4N A;  1WQ7 A;  3VQY A;  5GAN 8;  5GAM h;  1B70 A;  1JJC A;  5F5W A;  1TH7 A;  1SER A;  4G84 A;  4YCW A;  4M77 A;  2FYK A;  2ZT7 A;  3FJP A;  5LJ5 f;  3JCM e;  2AKW A;  1HTT A;  2E1H A;  4C8Q A;  1D3B B;  3QO3 A;  4ZIB A;  4KQE A;  5GAM d;  2E65 A;  2ZT6 A;  2ZT5 A;  4WI1 A;  4M7A A;  2QHV A;  4TVA B;  4JUV A;  5GAN j;  2I4L A;  4M7A C;  2ZZF A;  5GAO l;  2RM4 A;  4CH6 A;  4TVW A;  4X5O A;  1ASZ A;  1WPY A;  4PJO D;  4XTZ A;  5ELO A;  4YRE A;  3CMQ A;  4Q15 A;  1YFT A;  2ARU A;  3NEL A;  5GAN 7;  4C8Q D;  1LYL A;  1YFS A;  4RCC A;  2DDZ A;  5LJ5 d;  4CH5 A;  5GMK l;  3P8Y A;  3JCM c;  3QO5 A;  3L2Z A;  1NYQ A;  4MML A;  1NNH A;  1N9R A;  4XU1 A;  2YLB A;  4KR2 A;  1YFR A;  3NEN A;  3HFV A;  3GIB A;  1N9W A;  5K1X A;  4HT9 A;  3V8L A;  4P3P A;  5LJ3 d;  1KOG A;  1BBU A;  4HWT A;  4EMK B;  4V2S A;  4EO4 A;  3PZC A;  3E9H A;  1Z7M A;  1M5Q 1;  4M78 A;  2XTI A;  4H2Y A;  3TEH A;  4G85 A;  4A53 A;  3EFS A;  1KQ1 A;  4C92 F;  4ZTZ B;  3A5Y A;  3JB9 G;  3NEM A;  3BDU A;  2ZZG A;  3W3S A;  1H4T A;  4J6Y A;  2ZNI A;  4XEM A;  3M4Q A;  4HWS A;  4TWA A;  2ZGW A;  4C92 E;  3JCM P;  2DXU A;  5GAO n;  5GAO r;  5GAM j; 
#chains in the Genus database with same CATH topology
 2KEA A;  1FMK A;  2JZ2 A;  2KK4 A;  3JCM Q;  4M75 B;  3PGG A;  4HCB A;  4H2W A;  3UPU A;  4O6J A;  3OS0 A;  1VQL Q;  4N0A A;  1VQ5 A;  2ROT A;  1VQP T;  2AK5 A;  2PNI A;  4C5G A;  1ABO A;  3EAE A;  2LDM A;  4UP7 A;  1K8A U;  4Q6G A;  3OS1 A;  4JS4 A;  2YT6 A;  4CS2 A;  3FC3 A;  2ZXF A;  2OTJ Q;  2KVQ G;  4M78 D;  2IPO B;  3MEU A;  2DEQ A;  2FRY A;  4LDY A;  2H8H A;  1BIA A;  1KQS S;  1NG2 A;  3MP6 A;  3IG2 A;  4LVJ A;  3EH1 A;  4C0G A;  3M59 A;  2QQR A;  3L4G B;  1QKW A;  3L42 A;  1YWO A;  1HSQ A;  2I2L A;  2YXY A;  2COY A;  2KMT A;  1Y96 B;  2QYZ A;  4LVM A;  3EHQ A;  2D1X A;  2QEX A;  1UUE A;  2C0T A;  4J9H A;  2NWM A;  2IVW A;  3HRI A;  4P72 A;  4M7D G;  4PG3 A;  4A4K A;  3SWN A;  4PFP A;  4M7A E;  5ELN A;  2XDB A;  2F2V A;  3ICA A;  1VQO Q;  1ZSG A;  3CME A;  3RER A;  4LDX A;  2KE9 A;  4UPA A;  1SEM A;  2CJ9 A;  2DM1 A;  2Y4X A;  4HWR A;  3NGP A;  3S3O A;  4Q5W A;  1WNL A;  3INZ A;  3IKL A;  1M1K C;  3L1A A;  3VQV A;  4EX5 A;  1JJC B;  3CBO A;  2G6F X;  3G4S T;  3BE3 A;  3G1J A;  1XJW B;  1WZO A;  3JB9 H;  3H8Z A;  4FCY A;  3TEH B;  3BY7 A;  2ENM A;  3EH2 A;  5AT1 B;  1IRX A;  1N5Z A;  1WI7 A;  2FZC B;  4TVR A;  1M8M A;  1KD1 C;  4K86 A;  5LJ5 e;  5DM7 R;  3VUB A;  1YJ9 A;  4OMM A;  4BWA A;  4MDX A;  2O88 A;  3I56 A;  4C8Q B;  3RUX A;  5C52 B;  2J7I A;  4UP9 A;  1U1S A;  1W66 A;  2EYX A;  3ME9 A;  1PCX A;  2EWN A;  3M55 A;  4FW2 A;  2VC8 A;  2DBK A;  3R6O A;  4F17 A;  3WXM B;  4WJ3 M;  5GMK e;  1X2K A;  2RI2 A;  3PIO A;  1D0X A;  4R55 A;  2DXC A;  1C6V X;  2DL7 A;  5KE3 A;  2DER A;  1HXD A;  3EG2 A;  5IXF A;  1WLP B;  3SWN C;  3CBM A;  4QQG A;  4D8K A;  4ZNX A;  4MZP A;  3TEG A;  4L5G A;  3X28 B;  3LWI A;  3G4S Q;  2DIG A;  2A37 A;  3NTK A;  1UJY A;  3RMS A;  1QLY A;  4JS5 A;  5GMK j;  2YLC A;  4WCI A;  2LQW A;  2V8I A;  3OSV A;  4EMG A;  1VQ9 A;  4LUE A;  3DLM A;  4QKU A;  1Z7N A;  4DPG A;  2F2W A;  3O8V A;  3VUZ A;  4XTV A;  2KYM A;  1JO8 A;  3ERR A;  3HY0 A;  2VGM A;  5CCA A;  2JUF A;  1OPL A;  5KYY B;  1PYS B;  2VB6 A;  3CC7 A;  2W0Z A;  1VQ8 Q;  1UFF A;  2RB6 A;  4JLI A;  1E1T A;  3QNE A;  5IAY A;  2E4H A;  2ALY B;  4F7U F;  1KD1 U;  3CCU Q;  1AHJ B;  3REA B;  3JCM d;  1EIY B;  3CCE A;  1C1A A;  1J3T A;  5GAO m;  4JZ3 A;  1ZBJ A;  1NPP A;  5FRO A;  1ZA2 B;  2DET A;  2EIF A;  2WAC A;  3THK A;  4HWO A;  1UJ0 A;  3KFU A;  5GAN d;  2QDL A;  6AT1 B;  2JTF A;  2AMC A;  2DL8 A;  2EYW A;  3LH0 A;  2YHT A;  4CS4 A;  4C5I A;  2CKK A;  3KFV A;  2DVE A;  3HHT B;  4AT1 B;  1M90 U;  3UGQ A;  1YHQ T;  3G6E A;  2H3E B;  1M2V A;  2QTX A;  1UGS B;  2J6O A;  3I35 A;  3MF1 A;  3HL8 A;  1VQL T;  4BI8 B;  2L3P A;  4IUU A;  4Z02 A;  3CCJ Q;  1GGM A;  2AZV A;  4BI4 A;  4P73 A;  4GLM A;  4WF2 A;  4J6X A;  2BE7 D;  2BUD A;  4FM4 B;  3PMI A;  3EGD A;  5KCO A;  1WDX A;  3REU A;  5KYW B;  2CP0 A;  2RHU A;  4WTO B;  5DLO A;  1N8R R;  2QHT A;  3WVE B;  4PK4 A;  1TU0 B;  3VRZ A;  3MP8 A;  3OYE A;  4D6W A;  2MIO A;  1VQN Q;  2K6D A;  4HVC A;  4FW1 A;  1UHF A;  3M0R A;  3QSU A;  4NOY A;  4NS5 A;  1NEB A;  3ZEH A;  2HNI A;  2E3I A;  1OX8 A;  2HL5 C;  2PU9 B;  2PUK B;  2BZ8 A;  2ZR2 A;  4QVC A;  2IG0 A;  3MF2 A;  2LQN A;  3CCM T;  2COZ A;  2RHQ A;  3LGF A;  1H4V B;  1OPK A;  2BE9 B;  4QQD A;  1VIE A;  3CC2 T;  3MEY A;  1WX6 A;  1WLE A;  1YGB A;  2V1Q A;  2LC4 A;  2FPD A;  3CCQ A;  4K88 A;  2KXC A;  5HGQ A;  1W4S A;  1VQ7 Q;  1OUL A;  1T0J A;  1XNI A;  2Q7E A;  5ECA A;  2QQB A;  3C12 A;  4JRI A;  4PJL A;  2CP3 A;  2CUB A;  4RMF A;  3RAC A;  2ODR D;  3TRE A;  1JEG A;  3HRU A;  4C8Q E;  2IY5 A;  4F7U E;  2MOX A;  4M7D E;  4P71 C;  3OYD A;  4JJB A;  2RF0 A;  1RUW A;  2K9G A;  3TUP A;  4JPB W;  1S1N A;  4BI3 A;  2L8D A;  1VYV A;  1TXQ A;  3L4G A;  3QDF A;  5GMK i;  1TSF A;  2JM9 A;  3TEE A;  3A5Z A;  4HWP A;  3UFG A;  4O5V A;  2DU7 A;  3OSS C;  4J7I A;  5GAN 2;  2J3L A;  4N4I A;  1NZ9 A;  2ZR3 A;  5LJ5 h;  4NCX A;  2EL9 A;  4F7U G;  4OB0 B;  4LD6 A;  2EQJ A;  2FRW A;  3CCM Q;  3NTH A;  1MGQ A;  3PT9 A;  3RKX A;  1OZ3 A;  1VOM A;  2BKD N;  9ATC B;  3OY9 A;  4AH6 A;  5KYX B;  3HXY A;  3SD4 A;  1HD3 A;  2EKO A;  4OGE A;  4J9F A;  1Q86 U;  3P8V A;  4M75 A;  4J7F A;  3EGX B;  1NYR A;  4NL2 A;  3QO7 A;  4CS3 A;  5EG2 A;  1YJW Q;  2RO0 A;  1RAF B;  5F5W A;  1TWB A;  2JMA A;  2EVR A;  1RAD B;  4GY5 A;  4YCW A;  2MWP A;  2HQX A;  1M1F A;  3QZ5 B;  2L3Q A;  1IO6 A;  2LJ1 A;  1O9S A;  3QO3 A;  2LTO A;  1OI1 A;  4KQE A;  4E47 A;  4OB2 B;  1M1K U;  3CCM A;  4WI1 A;  1YNZ A;  1AZE A;  3DLL A;  5GAN j;  1K0S A;  4M7A C;  3EG9 A;  2ZZF A;  5GAO l;  2PTK A;  5FRN A;  1GFD A;  4LUD A;  4PJO D;  1YCS B;  4YRE A;  3CMQ A;  1YFT A;  2JW4 A;  2ROL A;  4RTV A;  5D7U A;  2PQW A;  4QVZ A;  1LYL A;  1N8R C;  4AFZ C;  2VWF A;  3QJ6 A;  1YIT Q;  2QAZ A;  2GGR A;  1PHT A;  1BK2 A;  3L2Z A;  4MML A;  3I9Q A;  5IN1 A;  4C5E A;  4XU1 A;  2KQW A;  4HKE A;  1K9M R;  2VKN A;  3QWX X;  5HK0 A;  1N9W A;  4C0F A;  4PKC C;  1VQK T;  4FYX B;  2KSS A;  3EG3 A;  1S72 A;  3CCL Q;  2V8J A;  2RQR A;  4P3P A;  1KOG A;  2KGT A;  1BBU A;  3E19 A;  4HWT A;  2QTV A;  2DYB A;  2EFI A;  2HBP A;  3M0S A;  3E9H A;  2SEM A;  2XTI A;  4H2Y A;  3OYJ A;  2CZ1 B;  4G85 A;  3EFS A;  4XK8 E;  2VUB A;  1NBE B;  2K4Y A;  3I56 T;  1X43 A;  3W3S A;  4ELY C;  4J6Y A;  2ZNI A;  1YI2 T;  2RJD A;  3HRS A;  1ZUU A;  2LNH B;  2ZGW A;  4C92 E;  1YHQ Q;  3KUF A;  2DXU A;  2KT8 A;  1DJ7 B;  5GAO n;  1AEY A;  1VQ5 Q;  1PSE A;  2XG8 D;  3OYA A;  1AWO A;  3QTC A;  4EDU A;  2OX7 A;  5FU6 C;  3T9N A;  2EQU A;  1JXM A;  2RHQ B;  3UWN A;  4UC4 A;  4PJO C;  2CGH A;  4PJO A;  3G4S A;  5I11 A;  1X2G A;  3I7F A;  3SDZ A;  4C92 G;  3CD6 A;  2FG0 A;  4KUI A;  3JB9 F;  2RQV A;  1I8F A;  1VQM A;  2DIQ A;  2K5I A;  4H2X B;  2QXF A;  1PD1 A;  3VU3 C;  4XTW A;  3PVQ A;  1H4Q A;  1AT1 B;  2NS6 A;  3QII A;  3OBY A;  5GMK h;  1RAC B;  2WSE E;  2AKW B;  1C0M A;  1IZ6 A;  4M77 F;  5LJ3 e;  1TOV A;  4ZGJ B;  4PJO B;  2DL5 A;  2ZCE A;  1ZLM A;  3ZL7 C;  3ZBD A;  5A0G A;  1K1Z A;  4F7U A;  4ZTJ A;  2CIM A;  3HXU A;  4M7D A;  4RCB A;  4TVY A;  4XTY A;  5K1P A;  1TUD A;  3JCM W;  1Q7Y U;  2DXT A;  5LJ3 j;  1GCP A;  3CCJ A;  1JBM A;  5KYW A;  1NE8 A;  1C0A A;  3L2Q A;  4DOV A;  1V76 A;  2XU8 A;  3FRN A;  4BE1 A;  4BE2 A;  2ZPG B;  4CI0 C;  3URG A;  5CKB A;  2ATC B;  3MEV A;  3CCU T;  1KHI A;  3A32 A;  2LJ0 A;  4M77 E;  4P75 C;  3JCM f;  4AFU C;  2JOY A;  1B70 B;  2E3C A;  2JVV A;  3L2V A;  2F69 A;  1UHC A;  5L8R E;  1KJW A;  1AWJ A;  4XU0 A;  3G6E T;  1X6O A;  2PZ1 A;  3I55 Q;  1YJ9 T;  1MMG A;  4II1 A;  2B8A A;  4BY6 C;  3FEO A;  2VXF A;  3CCL T;  1Y0M A;  4J8O A;  4C8Q G;  2LRQ A;  5GAN 6;  3FJ5 A;  3RKY A;  1N9S A;  1B07 A;  1WJQ A;  3PIP A;  3CMA Q;  2ZIM A;  4C92 B;  3QO8 A;  1YIJ A;  4M78 E;  1I07 A;  2DQ3 A;  3E9F A;  3CPW S;  3CD6 T;  1YJN T;  2DX1 A;  3A7A A;  4CC2 A;  3OYI A;  5CKD A;  1Q86 C;  3FB9 A;  2Q5H A;  2M02 A;  4TQF A;  2EJF A;  3JCM h;  1SG5 A;  3V7R A;  1B7Y B;  2JMC A;  4YRP A;  1FYF A;  3HFZ B;  3H0I A;  3M53 A;  3QPH A;  1I5O B;  4LVI A;  1QVF S;  4WJ4 A;  3BJU A;  2GCX A;  2K57 A;  4FSX A;  3L2U A;  3UGT A;  1B76 A;  3J7A F;  2RHZ A;  1H64 1;  2ODR C;  4RG8 A;  3N5B B;  2EJG A;  4P5N A;  2IIM A;  4BY6 B;  1ACM B;  1M90 C;  4RQE A;  3SB2 A;  1NJ1 A;  1D1C A;  2EAY A;  3V7S A;  1PWT A;  1PD0 A;  1PNJ A;  2MYS A;  3CBP A;  3MPU B;  5I21 A;  1G2B A;  3VS0 A;  1KQS P;  1NJ6 A;  4L87 A;  4O2D A;  4J15 A;  3UA7 A;  3J80 E;  2KYB A;  2RI5 A;  3LWH A;  2LT4 A;  5KNN A;  1OU9 A;  3LX7 A;  3MP1 A;  2VXE A;  3CC2 Q;  1AZG B;  2C06 A;  2D6F A;  1NJ8 A;  2HQE A;  5J26 A;  4C0Z A;  5GMK m;  3UDC A;  3BFM A;  2FL7 A;  3CCU A;  1H3Z A;  2XIC A;  5I22 A;  3CCE T;  3EG1 A;  5LJ5 g;  2KR3 A;  2BIV A;  3IAL A;  4ZN3 A;  3OYM A;  1XOV A;  3GBQ A;  2BZY A;  3TCJ A;  1B8A A;  1IGQ A;  1G3W A;  4HVV A;  2J6F A;  2CDT A;  3A8H B;  3MEA A;  2GTO A;  4MZM A;  3CXC P;  4C8Q C;  1PYS A;  4ZTU B;  3QBY A;  2O9S A;  4KGV B;  2DAQ A;  5CAI A;  2I0N A;  2V26 A;  4XTX A;  1Y71 A;  2E70 A;  3OMG A;  1BB9 A;  3C94 A;  2K3X A;  2Q7G A;  3GF5 A;  1X75 C;  3GOX A;  4DBH A;  1EZZ B;  1I0C A;  2MWO A;  1YIJ Q;  1VQP Q;  4OP0 A;  3RKW A;  3I56 Q;  4BDZ A;  1RIQ A;  4TTV A;  1X2Q A;  2YSQ A;  3CPW A;  1ZUK A;  1WHH A;  2D9T A;  2HSP A;  3LGL A;  1YJW T;  2QHU A;  4RTU A;  3V7C A;  3P8T A;  2SRC A;  1M4Z A;  4F7U B;  2XDD A;  3MKD A;  4E7J A;  4IUV A;  1SHF A;  2DVJ A;  5DY9 A;  2DU5 A;  3NET A;  2HBW A;  5GAN 3;  1OYX A;  3V8K A;  4X9C A;  1PRM C;  2O31 A;  3OMC A;  1G3S A;  4PJO G;  4P73 C;  2RHS A;  4ME7 A;  2X4X A;  4FIB A;  4TVA A;  2AHJ B;  2VV5 A;  3SHW A;  1X55 A;  3JAM E;  2M0Y A;  1T3L A;  4E7L A;  1UGP B;  2A0F B;  2HDA A;  4M7A F;  3OS5 A;  2CJB A;  1R77 A;  2EGE A;  4JLG A;  2ZIN A;  1AD5 A;  3LH5 A;  8ATC B;  1EOV A;  4Z8A A;  1YI2 Q;  3M57 A;  3KBG A;  1USY A;  3A7U A;  4YRR A;  2AT1 B;  3MO8 A;  2JN0 A;  1HJD A;  5A0L A;  2LCC A;  3QKJ A;  1P92 A;  2E6Z A;  1Y07 A;  2C7I A;  4H02 A;  8AT1 B;  3SEM A;  3CC4 Q;  4CH4 A;  4M7A D;  2NUP B;  3LC0 A;  2C0O A;  4ZTF A;  4H2S A;  2MPX C;  3R6N A;  3HRK A;  4OMO A;  4J6W A;  2M1H A;  3PVL A;  5IXB A;  4DBF A;  4YRC A;  3CXC S;  1L0W A;  2DQ0 A;  3GLX A;  4PNO A;  2RMO A;  1WHJ A;  3L2W A;  4YCV A;  2YRC A;  1LNX A;  4HT8 A;  2HMA A;  4A4F A;  3VS4 A;  2OJ2 A;  4JRK A;  1UEC A;  1VQM Q;  1BYM A;  2ARS A;  2CZ6 B;  2XHC A;  2M0O A;  2EYY A;  2LX7 A;  2VYT A;  2X35 A;  3RF1 A;  2P4R A;  2ZPI B;  1M3A A;  2HKQ B;  1UDL A;  4KUD K;  3C4S A;  2QA4 Q;  4IUR A;  4DOW A;  2WSF E;  2XI9 A;  3CME Q;  5GAM h;  1B70 A;  2E6N A;  5CKF A;  1QWE A;  3UF4 A;  1SER A;  4JDS A;  4G84 A;  1EX4 A;  2Z0W A;  2FYK A;  2ZT7 A;  1WXB A;  1Z9Q A;  1X6G A;  2ZZD A;  3JCM e;  1RAA B;  2E1H A;  4ZIB A;  5KYU A;  3OYF A;  2ZT6 A;  2HL3 A;  4J9B A;  2DL4 A;  2I4L A;  1GFC A;  3DB3 A;  1M3B A;  2P0P A;  1PRL C;  1ASZ A;  4BUG A;  5CK9 A;  1MMD A;  5ELO A;  1G8X A;  2PUO B;  4ANJ A;  3NEL A;  1R8O B;  3H41 A;  5GAN 7;  4C8Q D;  3TQ7 P;  2MAM A;  4LE9 A;  2JT4 A;  4RCC A;  1JXO A;  2DDZ A;  1VQM T;  5EC7 A;  2DA9 A;  3JCM c;  1VQN T;  1RAG B;  1NNH A;  1RI0 A;  1UTI A;  2YLB A;  1YFR A;  1VIF A;  3MCA B;  3NEN A;  2DBM A;  1KG1 A;  5J3B A;  2GFA A;  3E1S A;  4JZ4 A;  3FDR A;  1QCN A;  3TSZ A;  1JJ2 S;  1YWP A;  2NUT B;  1UGR B;  4OMN A;  1VQ7 A;  2K7A A;  4BDY A;  4EO4 A;  3PZC A;  4FYV B;  1Q82 R;  1Z7M A;  2W10 A;  5CKE A;  1MV3 A;  1NJI U;  4A53 A;  4C92 F;  2J06 A;  1BI2 A;  4IUP A;  1OX9 A;  1Y57 A;  3JB9 G;  2RN8 A;  1Q7Y C;  4AFS C;  2AZS A;  2XID A;  4XEM A;  3M4Q A;  4HWS A;  1VQL A;  2M51 A;  3JCM P;  2CH4 W;  3HPW A;  4J9D A;  3CCR T;  3UAT A;  5GAO r;  5GAM j;  1VQ4 Q;  4JRP A;  1FMW A;  1FX7 A;  1XTD A;  4XQ3 A;  4P75 A;  2ZIO A;  3JB9 J;  4Z88 A;  1BI0 A;  4CC4 B;  4XU3 A;  3CCJ T;  1SET A;  2DPP B;  1PG5 B;  1I5L A;  2PMF A;  2RNA A;  4YRJ A;  3VKI A;  2EQI A;  2P0K A;  1PC0 A;  1WHM A;  2QG9 B;  4ZGD B;  2BZX A;  2ZT8 A;  2O4X B;  4P71 A;  1WFW A;  3VS7 A;  2DXB A;  4B6M A;  2P84 A;  3HXW A;  1K4U S;  2I4O A;  2H3J A;  2E41 A;  3A74 A;  4YRQ A;  1ZSZ C;  4A4E A;  1LOJ A;  2ESW A;  4RDX A;  3VJP A;  1JU5 C;  1JJ2 P;  3CCE Q;  1G51 A;  1ZA1 B;  2OI3 A;  4TQD A;  4DA4 A;  1IL2 A;  2DNU A;  5C51 B;  4M75 F;  3WQZ A;  3CC2 A;  5FWB A;  4XTU A;  4M7A B;  5D6W A;  2KRN A;  2ZAE A;  3CCQ T;  1QE0 A;  2CSI A;  1K9M U;  4MDW A;  1R0B G;  4AG2 C;  1O75 A;  2YRD A;  2L3S A;  2ED1 A;  3DSQ A;  3JCM g;  1KK7 A;  2O2O A;  1K73 U;  2M16 A;  1NM7 A;  1K73 R;  4ELZ C;  1MV0 B;  2LQK A;  1NYF A;  2Y90 A;  1KC8 U;  2QDY B;  3I5S A;  5KYX A;  1V1C A;  2RHS B;  2E5A A;  3PNW C;  1EIY A;  2HAX A;  1G3Y A;  2GNC A;  1TUC A;  3CCL A;  4P72 C;  3RR6 A;  1CSK A;  3M0U A;  3L2R A;  1AVZ C;  2D0N A;  1XQH A;  3S6W A;  3OW2 A;  4QVD A;  4M78 C;  4YRM A;  3DKM A;  5LL6 S;  3ULR B;  1FXX A;  5GAO q;  1NEG A;  2L0A A;  3HFN A;  2L89 A;  3M4Y A;  1YIT A;  1U1T A;  2EGC A;  5IHK A;  2DZ9 A;  4DEY A;  2MCN A;  5KYU B;  5KE2 A;  5CO7 A;  5FU7 B;  5IHN A;  3S3N A;  4M7D D;  4KH0 B;  2P0L A;  2DTI A;  4RQF A;  2BTT A;  1WHK A;  5A0D A;  2D8J A;  4A54 A;  3PCO A;  1Q82 C;  4M7D F;  2QGF B;  3ER0 A;  1X01 A;  1LPL A;  2KDS A;  1RLQ C;  3M56 A;  2E10 A;  1QP2 A;  3CXC A;  1ZUY A;  3VV0 A;  5LJ3 g;  4RMO A;  3MQZ A;  2LX9 A;  4DQ2 A;  3S3M A;  4F04 B;  5FU7 C;  2MMP A;  3EG0 A;  2E5K A;  2HKN A;  3OW2 P;  4IUT A;  1VYU A;  4CC7 A;  1EVK A;  3FIF A;  1VQ6 A;  2XMF A;  1N6A A;  1KQ2 A;  2LQ8 A;  4IUQ A;  2DF6 A;  2FPF A;  2CRE A;  4JJD A;  2FEI A;  2V8K A;  3VS5 A;  3SFM A;  4YCU A;  1MNE A;  2X9H A;  2XD0 A;  4YRT A;  3EFR A;  1UB4 A;  1SF9 A;  1T0H A;  4A63 B;  1RAB B;  4B9X A;  4RKU E;  4E51 A;  4IKF A;  4BAC A;  2K3B A;  4P74 A;  1QVG A;  4Y91 A;  1QF6 A;  1E1O A;  3JCM J;  1JQQ A;  3Q1J A;  3VRY A;  1FYN A;  1YJW A;  3GP8 A;  1X27 A;  5GAO p;  4X9D A;  1SRL A;  1B34 B;  2HZY A;  1QVF P;  2AMC B;  2CP2 A;  3HXV A;  3QYH B;  2CUD A;  2OAU A;  4MZT A;  2OTJ A;  2FPE A;  1UE9 A;  1B7Y A;  3X26 B;  1QVF A;  1D3B A;  3G1Z A;  5CQY A;  2KXD A;  1SKU B;  2K5F A;  2VGN A;  1BCM A;  3CCS Q;  1EVL A;  3QJY A;  2YUN A;  2V1R A;  1Y7X A;  1Z9Z A;  2P5I A;  2Q5I A;  2E12 A;  3CCV A;  4KGX B;  2CJA A;  1EQR A;  1QVG S;  4H2X A;  4E7Z A;  2JS0 A;  2CS7 A;  1NJI C;  2FZK B;  3G71 A;  2LP5 A;  3LW5 E;  2DJQ A;  4ORZ A;  5GAN 5;  4M75 E;  3EG9 B;  3M0T A;  4K87 A;  2AKK A;  1I1J A;  1WA7 A;  2KRS A;  3JB9 I;  2XGT A;  5GAN f;  3RES A;  1CKB A;  3A8G B;  3R07 A;  2OTL Q;  1WU7 A;  3TU4 K;  4C92 C;  4J9C A;  2JTE A;  1K73 C;  3QYG B;  1MUZ A;  3OYG A;  1ZSZ B;  2RQT A;  4YTL A;  3UT1 A;  1D0Z A;  2LMJ A;  4J9E A;  1E6G A;  4LVL A;  1E22 A;  4M78 B;  4RTW A;  1BI3 A;  5KCH A;  2ART A;  3JSC A;  4RUG A;  1IHW A;  1QCF A;  1UG1 A;  2NUT A;  2JM8 A;  4YP0 A;  1KIK A;  4OLF A;  5FRM A;  2LJ3 A;  1UEB A;  4Y28 E;  5GAM f;  1W1F A;  2PVO B;  3CCR Q;  2CT3 A;  4LDW A;  2KRO A;  5C0M A;  2I4M A;  1M2V B;  4P3O A;  4H2T A;  1U3O A;  2QGG A;  4YRS A;  3AHU A;  2HSE B;  1ZBX A;  4C8Q F;  1SRM A;  5KYY A;  2E5Q A;  3AT1 B;  1BKB A;  4HA8 A;  1W2B A;  3JCM X;  2YUO A;  3KXT A;  2EJ9 A;  3A8L B;  3NPF A;  4J5Y A;  1Q81 U;  5LJ5 j;  1W70 A;  1VYT A;  1HYO A;  4XEO A;  2JXB A;  4J9G A;  3A8O B;  4H2U A;  2DD4 A;  2DJZ A;  1VQ4 A;  3OD1 A;  1LVK A;  4YDQ A;  3VBB A;  2E3H A;  3NFC A;  3NTI A;  2YWW A;  1Y96 A;  1Q81 C;  2E64 A;  2KNB B;  3E9G A;  1OOT A;  2A36 A;  4C92 A;  4YRN A;  1BBW A;  4ATO A;  2DZC A;  2EYZ A;  2JS2 A;  4M78 F;  1EFW A;  3M54 A;  4M7A G;  1CKA A;  5GAM e;  1VQ5 T;  2DTO A;  4HCZ A;  1ASY A;  1K8A C;  2DK3 A;  1TTH B;  1IXD A;  1E7O A;  2ZPB B;  1IB8 A;  1MHN A;  2ED0 A;  3CPF A;  1JB0 E;  1A0N B;  1SSH A;  1NLO C;  3E9I A;  4YRL A;  2QHS A;  3E2U A;  1EFN A;  3OYK A;  1WYD A;  3GNF B;  1KSW A;  1KQS A;  2GFU A;  4L59 A;  4CH3 A;  5I2S A;  1KD1 R;  3RMQ A;  4EPC A;  4GLK A;  1WJR A;  5GAM g;  1TG0 A;  3P8H A;  3V8J A;  1KC8 C;  3QZ9 B;  4PFZ A;  2A08 A;  2RJF A;  4DBQ A;  3RNJ A;  3CMA T;  2HQH A;  2L3R A;  1Q86 R;  2J05 A;  4QT7 A;  1QCO A;  4M75 C;  2QEX T;  4FYY B;  5I2M A;  1VQ7 T;  5M9O A;  3CD6 Q;  4QW2 A;  3EGD B;  2X4J A;  3A8M B;  4NL3 A;  2NUP A;  2OAW A;  5DLQ E;  5LJ3 f;  1YN8 A;  1M1G A;  2FO0 A;  2ZCF B;  3X24 B;  4KH1 B;  2I4N A;  1WQ7 A;  1YFN A;  2DD5 A;  2DLP A;  2F2X A;  5KYN A;  4KBM B;  5GAN 8;  3OYC A;  1JJC A;  1M90 R;  2XKO C;  3MET A;  2CP6 A;  1TH7 A;  4LDV A;  1T3S A;  3J81 E;  5CKH A;  1Q95 G;  1WHL A;  3FJP A;  4IIO A;  2CT4 A;  5LJ5 f;  1SPK A;  2JJ9 A;  3CCS A;  4C8Q A;  1D3B B;  1QP3 A;  2E65 A;  3ASK A;  2D0Q B;  5HKC A;  2PVG B;  2QHV A;  1RL2 A;  4RTZ A;  3EFO A;  4TVA B;  1KFZ A;  1YIJ T;  2QA4 T;  2X4W A;  4TVW A;  4X5O A;  4GBQ A;  1WPY A;  2LCL A;  4XTZ A;  5C6S A;  1VQ4 T;  2AKL A;  4HVW A;  2ARU A;  1N8R U;  3I55 A;  4CRI A;  2EYQ A;  3JRZ A;  5D6Y A;  3U23 A;  5LJ5 d;  3QO5 A;  1ZSZ A;  2A28 A;  1NYQ A;  3MEW A;  1QW1 A;  2ZPH B;  2EKH A;  4J83 A;  4ZN1 A;  1D1B A;  2P0Q A;  3G6E Q;  3HFV A;  2ZPE B;  5GJV B;  1RAE B;  4FT4 A;  1M27 C;  2F5T X;  5LJ3 d;  2Y4Y A;  2DO3 A;  2ZPF B;  1SHG A;  4M78 A;  1UGV A;  4FT2 A;  1K76 A;  2DIL A;  4ZTZ B;  3NEM A;  2NLU A;  3H0H A;  2QAS A;  3BDU A;  2ZZG A;  1VQ6 Q;  4JJC A;  4BD3 A;  2O4X A;  2NUZ A;  3IQL A;  3CCR A;  3H6Z A;  2L5Q A;  3CMA A;  4ZGE B;  4DEX A;  2C0I A;  2DL3 A;  5FU6 B;  2RQW A;  2RHX A;  1WIE A;  2KT1 A;  5CQX A;  4A4H A;  2EGA A;  4E7K A;  4EMK A;  2JNG A;  2CH4 A;  1VQ9 T;  4M75 G;  1YHQ A;  4X1V A;  2L2P A;  5E3I A;  2R57 A;  1Q82 U;  3PMT A;  1YB3 A;  4HVU A;  2EQK A;  3FLG A;  1NJI R;  2KI7 A;  2J6K A;  4YRI A;  1VUB A;  4F16 A;  4LXC A;  3QXE B;  1TS9 A;  2RHI A;  3CC7 T;  4OB1 B;  5GAN 4;  1R0C B;  3EGU A;  4LD9 K;  2ZNJ A;  2QK0 A;  2DFU A;  1GBQ A;  1KC8 R;  5FWC A;  2RK2 A;  2EQM A;  2VVK A;  1QVP A;  5GAN h;  1VA7 A;  4VUB A;  4EIK A;  2O01 E;  1USY C;  4PHC A;  2OTJ T;  1KMN A;  3C0C A;  1BI1 A;  3VQW A;  2AIR B;  2K5L A;  4YPF A;  2M9U A;  4HXJ A;  2X3W D;  5CVI A;  5HK3 A;  2DEU A;  3X25 B;  1W6X A;  1QKX A;  1Q7Y R;  3GPL A;  3CCV Q;  1I81 A;  3H9N A;  4YRG A;  5A2Q E;  5CR2 A;  2RPN A;  2KY9 A;  4P3N A;  4AG1 C;  1PSF A;  1E24 A;  1TUG B;  1ADY A;  1ZQ1 A;  4JRQ A;  1LJO A;  2QQ9 A;  3PCO B;  4KUL A;  1U8R A;  2ALY A;  1VQP A;  1G5H A;  1M9S A;  5GAN g;  3EGX A;  1UGQ B;  1H4S A;  4MMK A;  1ZHI A;  1VQN A;  4YRK A;  3CQT A;  2PME A;  1H8K A;  2LT1 A;  4OML A;  3GNG A;  4KT0 E;  3P8B B;  4PJM A;  1X69 A;  2DRM A;  4M77 G;  3SWN B;  1OZ2 A;  4JJN K;  1ADJ A;  2ZZE A;  1OV3 A;  1G5V A;  1M3C A;  4XAX B;  1BBZ A;  5GAN e;  1WXU A;  4LDU A;  5L23 A;  3HRT A;  1KMM A;  2D8H A;  2IY5 B;  1F1B B;  3BDL A;  3O5Z A;  3M0Q A;  1MMA A;  3M58 A;  3X20 B;  1K8A R;  1NLP C;  4OVA A;  1SES A;  3CCV T;  3HXX A;  1OQK A;  3VS1 A;  4P74 C;  3HFO A;  1WXT A;  2CYZ B;  1IRE B;  4YYE A;  1K9M C;  5IHI A;  2DE0 X;  1FMV A;  4FYW B;  2DYI A;  4KR3 A;  1NJ2 A;  2J3M A;  1AWX A;  4Z89 A;  2X4Y A;  4OGC A;  3QHS A;  2RHY A;  3M0P A;  3CME T;  1J5W A;  3H0F A;  4M78 G;  2KRM A;  2VAS A;  2EPD A;  2FHD A;  2R5M A;  1QWF A;  3OYL A;  2RI3 A;  2RK1 A;  2ABL A;  3M5A A;  4R0K A;  2Q7H A;  3RL6 A;  4RTT A;  4QQ6 A;  5HY6 A;  3A31 A;  3OYN A;  1X56 A;  1BCO A;  1SSF A;  2X3X D;  4D8D A;  2K2V A;  3G7Z A;  4DBR A;  3VYH B;  2ECZ A;  3CCQ Q;  4BW9 A;  4HT4 A;  2B86 A;  4LNS A;  3REX A;  3TSW A;  2GF7 A;  3CC7 Q;  1GRI A;  5KH6 A;  4PL6 A;  1YJN Q;  1JJ2 A;  1YI2 A;  4OMQ A;  3UA6 A;  3QG1 A;  3OW2 S;  1WYX A;  4YRF A;  1WQW A;  2K2M A;  2COW A;  5LJ3 h;  4E7I A;  1M2O A;  4AMC A;  1VQK Q;  4EMH A;  4M7D C;  1GBR A;  1IGU A;  1VQ8 A;  4PLI A;  4B9W A;  2LNV A;  2HEQ A;  1G83 A;  1KHC A;  1MND A;  1JRI A;  2KAF A;  5FW9 A;  3JV3 A;  3RIR A;  1PM3 A;  5J39 A;  3VS6 A;  2EBP A;  3G71 T;  1PKS A;  3QDR B;  3EHR A;  1VQK A;  4N4G A;  2QEX Q;  4M77 C;  4EMK C;  2YRV A;  1RAH B;  1K9A A;  1ARK A;  3CEY A;  4N0A C;  4KGZ B;  1B34 A;  3QUI A;  2LCS A;  1H92 A;  1K0X A;  1ATI A;  4FU6 A;  3VYG A;  1VQZ A;  4PLL A;  3MHX A;  5FLX E;  1NJ5 A;  2CP5 A;  1D1A A;  5HCK A;  3D7S B;  3M9Q A;  1ABQ A;  1AOJ A;  1B3Q A;  3WVD B;  2OTL A;  5C53 B;  2F1L A;  1U06 A;  3LYI A;  1D09 B;  3VQX A;  3UH0 A;  1M8V A;  1M30 A;  1LCK A;  4H2V A;  2HD0 A;  3OYB A;  1YCY A;  3LSS A;  4OF1 A;  1Q81 R;  3MJX A;  1SRY A;  4KRT A;  1G5I A;  1X54 A;  1X6B A;  2RJC A;  4BB7 A;  1EIF A;  3M4P A;  4R56 A;  2ZTG A;  1ZX6 A;  3M4G A;  1RAI B;  4CC3 A;  1YIT T;  1WGS A;  3HKS A;  3VS2 A;  1U5S A;  7AT1 B;  3OBW A;  1MMN A;  1QQJ A;  2P4T A;  2G4C A;  11AS A;  3OYY A;  1OU8 A;  1WJS A;  3CC4 T;  4YRO A;  2GQV A;  3LSQ A;  4C0D C;  4LNP A;  3RBB B;  3JCM b;  1QVG P;  4LVK A;  2X51 A;  4UP8 A;  2FB7 A;  4M77 D;  1M1K R;  3OA6 A;  5AYF A;  2RQU A;  3HSB A;  3CPW P;  3A7R A;  1S72 Q;  3A98 A;  2HCK A;  1VQ8 T;  1G3T A;  3RDV A;  1RLP C;  3NMZ C;  3ZFJ A;  2A3L A;  2RH2 A;  3RGL A;  1VQO T;  4FSS A;  3NHN A;  4Y92 A;  2C8M A;  3HY1 A;  3CCS T;  4M75 D;  4X34 A;  4PJO E;  1B7T A;  2EW3 A;  3JCM V;  2DTH A;  1X2H A;  4PFO A;  1NYG A;  2FZG B;  3HXZ A;  3OYH A;  1RI9 A;  4E7H A;  3LLR A;  4J9I A;  1VQ9 Q;  1HK9 A;  2A7Y A;  4RTX A;  2MI6 A;  3I55 T;  1I4K 1;  12AS A;  2LZ6 B;  2LVM A;  4F14 A;  1GCQ A;  4FL6 A;  3JB9 D;  1FWZ A;  2RA2 A;  3PE0 A;  4M7D B;  3HFZ A;  3HTZ A;  1AWW A;  1HC7 A;  2OTL T;  2GTJ A;  4M77 B;  3G71 Q;  1BU1 A;  2RD1 A;  4PJO F;  3OS2 A;  2MK5 A;  2DRK A;  2K3Y A;  4OB3 B;  2PVD B;  4XU2 A;  2QQA A;  4AFQ C;  4N4H A;  3C95 A;  3PFS A;  3EFO B;  2QI2 A;  1BIB A;  1OEB A;  4OMF B;  2DMO A;  1NPR A;  3A5Z B;  1GXI E;  2GQI A;  1D0Y A;  2K79 A;  2DKG A;  3BW1 A;  3I5R A;  4LN2 A;  4C92 D;  1GL5 A;  3IKM B;  1PKT A;  1YJN A;  3REB B;  2MF2 A;  3VQY A;  4OMP A;  4RG2 A;  3CC4 A;  4A4G A;  3QWY A;  2R5A A;  1WHG A;  2CP7 A;  4M77 A;  1YP5 A;  2CZ7 B;  3A1P A;  2AKW A;  1HTT A;  1H3H A;  2QA4 A;  5GAM d;  2XDP A;  3F70 A;  3OB9 A;  2ZT5 A;  5CIU A;  4M7A A;  1IHV A;  3HTR A;  4JUV A;  4C5H A;  2RM4 A;  3HP9 A;  4CH6 A;  2QQS A;  4Q15 A;  1VQO A;  2O9V A;  5D6X A;  4E7S A;  2YUP A;  2G3R A;  4ESR A;  1YFS A;  4M4Z A;  5IH2 A;  2RJE A;  3OQ5 A;  3P8D A;  3TVT A;  4BE0 A;  5GJW B;  4CH5 A;  4IIM A;  2CSQ A;  5GMK l;  3P8Y A;  1V29 B;  2JTM A;  4RTY A;  1GCQ C;  1YJ9 Q;  1N9R A;  1W2B S;  4KR2 A;  3VS3 A;  3GIB A;  5IT9 E;  1VQ6 T;  5K1X A;  4HT9 A;  1N27 A;  3V8L A;  2XK0 A;  4PJJ A;  4L6V 5;  4K11 A;  4C0D B;  2FVU A;  3PTA A;  4EMK B;  4V2S A;  1YBY A;  1S72 T;  2NYS A;  1M5Q 1;  2YDL A;  2CZ0 B;  2GBQ A;  4PJN A;  4HCC A;  3TEH A;  2WSC E;  4E6R A;  1KQ1 A;  2R58 A;  3A5Y A;  1E6H A;  1H4T A;  2F5K A;  3DB4 A;  2KBT A;  4E2F B;  4TWA A;  1W2B P;  4HCK A;  2YUQ A;  2A8E A;  1QMC A; 
#chains in the Genus database with same CATH homology
 2JZ2 A;  2KK4 A;  3JCM Q;  4M75 B;  3PGG A;  4H2W A;  4HCB A;  3UPU A;  4O6J A;  3OS0 A;  4N0A A;  1VQ5 A;  1VQP T;  4C5G A;  3EAE A;  2LDM A;  4UP7 A;  1K8A U;  4Q6G A;  3OS1 A;  4JS4 A;  4CS2 A;  3FC3 A;  2ZXF A;  2KVQ G;  4M78 D;  3MEU A;  2DEQ A;  4LDY A;  1BIA A;  1KQS S;  3MP6 A;  3IG2 A;  4LVJ A;  4C0G A;  3M59 A;  2QQR A;  3L4G B;  3L42 A;  2I2L A;  2KMT A;  1Y96 B;  4LVM A;  2QEX A;  2IVW A;  3HRI A;  4P72 A;  4M7D G;  4PG3 A;  4A4K A;  3SWN A;  4M7A E;  5ELN A;  2XDB A;  3ICA A;  3CME A;  3RER A;  4LDX A;  4UPA A;  2CJ9 A;  2Y4X A;  4HWR A;  3S3O A;  4Q5W A;  1WNL A;  3INZ A;  3IKL A;  1M1K C;  3L1A A;  3VQV A;  4EX5 A;  1JJC B;  3CBO A;  3G4S T;  3JB9 H;  3H8Z A;  3TEH B;  3BY7 A;  4TVR A;  1KD1 C;  4K86 A;  5LJ5 e;  5DM7 R;  3VUB A;  1YJ9 A;  4BWA A;  4MDX A;  3I56 A;  4C8Q B;  3RUX A;  5C52 B;  4UP9 A;  1U1S A;  1W66 A;  3ME9 A;  2EWN A;  3M55 A;  2VC8 A;  3R6O A;  3WXM B;  4WJ3 M;  5GMK e;  2RI2 A;  3PIO A;  4R55 A;  2DXC A;  5KE3 A;  1HXD A;  3SWN C;  3CBM A;  4QQG A;  4MZP A;  3TEG A;  4L5G A;  3X28 B;  3LWI A;  2DIG A;  3NTK A;  3RMS A;  4JS5 A;  5GMK j;  2YLC A;  2V8I A;  3OSV A;  4EMG A;  1VQ9 A;  3DLM A;  1Z7N A;  4DPG A;  3O8V A;  3VUZ A;  4XTV A;  3ERR A;  3HY0 A;  2VGM A;  5CCA A;  2JUF A;  1PYS B;  3CC7 A;  2RB6 A;  4JLI A;  3QNE A;  1E1T A;  5IAY A;  2ALY B;  4F7U F;  1KD1 U;  1AHJ B;  3JCM d;  1EIY B;  3CCE A;  5GAO m;  1NPP A;  5FRO A;  2EIF A;  2WAC A;  4HWO A;  3KFU A;  5GAN d;  2JTF A;  2AMC A;  3LH0 A;  2YHT A;  4CS4 A;  4C5I A;  2CKK A;  2DVE A;  3HHT B;  1M90 U;  3UGQ A;  1YHQ T;  3G6E A;  2QTX A;  1UGS B;  3MF1 A;  3HL8 A;  1VQL T;  4BI8 B;  4IUU A;  4Z02 A;  1GGM A;  4BI4 A;  4P73 A;  4WF2 A;  4J6X A;  2BUD A;  4FM4 B;  3PMI A;  5KCO A;  3REU A;  2RHU A;  5DLO A;  2QHT A;  3WVE B;  3MP8 A;  3OYE A;  4D6W A;  4HVC A;  3QSU A;  4NOY A;  4NS5 A;  3ZEH A;  2HNI A;  2PU9 B;  2PUK B;  2ZR2 A;  4QVC A;  2IG0 A;  3MF2 A;  3CCM T;  2RHQ A;  3LGF A;  1H4V B;  4QQD A;  3CC2 T;  1VIE A;  3MEY A;  1WLE A;  1YGB A;  2LC4 A;  3CCQ A;  4K88 A;  5HGQ A;  1W4S A;  1XNI A;  2Q7E A;  2QQB A;  3C12 A;  4JRI A;  4RMF A;  3RAC A;  2ODR D;  3TRE A;  3HRU A;  4C8Q E;  2IY5 A;  4F7U E;  4M7D E;  4P71 C;  3OYD A;  3TUP A;  4BI3 A;  2L8D A;  3L4G A;  5GMK i;  3TEE A;  3A5Z A;  4HWP A;  3UFG A;  4O5V A;  2DU7 A;  3OSS C;  4J7I A;  5GAN 2;  2J3L A;  4N4I A;  1NZ9 A;  2ZR3 A;  5LJ5 h;  4NCX A;  2EL9 A;  4F7U G;  4OB0 B;  4LD6 A;  2EQJ A;  3NTH A;  1MGQ A;  3PT9 A;  3RKX A;  1OZ3 A;  2BKD N;  3OY9 A;  4AH6 A;  3HXY A;  3SD4 A;  2EKO A;  4OGE A;  3P8V A;  1Q86 U;  4M75 A;  4J7F A;  1NYR A;  3QO7 A;  4NL2 A;  4CS3 A;  5EG2 A;  2RO0 A;  5F5W A;  4GY5 A;  4YCW A;  2MWP A;  2HQX A;  1M1F A;  3QZ5 B;  1O9S A;  3QO3 A;  2LTO A;  1OI1 A;  4KQE A;  4E47 A;  4OB2 B;  1M1K U;  3CCM A;  4WI1 A;  3DLL A;  5GAN j;  4M7A C;  2ZZF A;  5GAO l;  5FRN A;  4PJO D;  4YRE A;  3CMQ A;  1YFT A;  2PQW A;  4QVZ A;  1LYL A;  1N8R C;  3QJ6 A;  3L2Z A;  4MML A;  5IN1 A;  4C5E A;  4XU1 A;  2KQW A;  4HKE A;  5HK0 A;  1N9W A;  4C0F A;  4PKC C;  1VQK T;  2KSS A;  1S72 A;  2V8J A;  4P3P A;  1KOG A;  1BBU A;  3E19 A;  4HWT A;  2EFI A;  2HBP A;  3E9H A;  2XTI A;  4H2Y A;  3OYJ A;  2CZ1 B;  4G85 A;  3EFS A;  4XK8 E;  2VUB A;  2K4Y A;  3I56 T;  3W3S A;  4ELY C;  4J6Y A;  2ZNI A;  1YI2 T;  2RJD A;  3HRS A;  2ZGW A;  4C92 E;  3KUF A;  2DXU A;  5GAO n;  1DJ7 B;  1PSE A;  2XG8 D;  3OYA A;  3QTC A;  4EDU A;  5FU6 C;  3T9N A;  2EQU A;  2RHQ B;  3UWN A;  4UC4 A;  4PJO C;  2CGH A;  4PJO A;  3G4S A;  1X2G A;  3I7F A;  3SDZ A;  4C92 G;  3CD6 A;  4KUI A;  3JB9 F;  1I8F A;  1VQM A;  2DIQ A;  2K5I A;  4H2X B;  2QXF A;  3VU3 C;  4XTW A;  1H4Q A;  2NS6 A;  3QII A;  3OBY A;  5GMK h;  2WSE E;  2AKW B;  1IZ6 A;  4M77 F;  5LJ3 e;  4ZGJ B;  4PJO B;  2ZCE A;  3ZBD A;  5A0G A;  4F7U A;  4ZTJ A;  2CIM A;  3HXU A;  4M7D A;  4RCB A;  4TVY A;  4XTY A;  5K1P A;  3JCM W;  1Q7Y U;  2DXT A;  5LJ3 j;  3CCJ A;  1JBM A;  1NE8 A;  1C0A A;  3L2Q A;  4DOV A;  2XU8 A;  3FRN A;  4BE1 A;  4BE2 A;  2ZPG B;  4CI0 C;  3URG A;  5CKB A;  3MEV A;  3CCU T;  1KHI A;  3A32 A;  4M77 E;  4P75 C;  3JCM f;  2JOY A;  1B70 B;  2E3C A;  2JVV A;  3L2V A;  2F69 A;  5L8R E;  4XU0 A;  3G6E T;  1X6O A;  1YJ9 T;  4II1 A;  2B8A A;  4BY6 C;  3FEO A;  2VXF A;  3CCL T;  4J8O A;  4C8Q G;  2LRQ A;  5GAN 6;  3RKY A;  1N9S A;  1WJQ A;  3PIP A;  2ZIM A;  4C92 B;  3QO8 A;  1YIJ A;  4M78 E;  2DQ3 A;  3E9F A;  3CPW S;  3CD6 T;  1YJN T;  3A7A A;  3OYI A;  5CKD A;  1Q86 C;  3FB9 A;  2Q5H A;  4TQF A;  2EJF A;  3JCM h;  3V7R A;  1B7Y B;  4YRP A;  1FYF A;  3HFZ B;  3M53 A;  3QPH A;  4LVI A;  1QVF S;  4WJ4 A;  3BJU A;  2GCX A;  2K57 A;  4FSX A;  3L2U A;  3UGT A;  1B76 A;  3J7A F;  2RHZ A;  1H64 1;  2ODR C;  4RG8 A;  3N5B B;  2EJG A;  4P5N A;  4BY6 B;  1M90 C;  4RQE A;  3SB2 A;  1NJ1 A;  2EAY A;  3V7S A;  3CBP A;  5I21 A;  1NJ6 A;  4L87 A;  4O2D A;  4J15 A;  3J80 E;  2RI5 A;  3LWH A;  2LT4 A;  5KNN A;  3LX7 A;  3MP1 A;  2VXE A;  2C06 A;  2D6F A;  1NJ8 A;  2HQE A;  5J26 A;  4C0Z A;  5GMK m;  3UDC A;  3BFM A;  2FL7 A;  3CCU A;  1H3Z A;  2XIC A;  3CCE T;  5LJ5 g;  2BIV A;  3IAL A;  4ZN3 A;  3OYM A;  1XOV A;  3TCJ A;  1B8A A;  1G3W A;  3A8H B;  3MEA A;  4MZM A;  4C8Q C;  1PYS A;  4ZTU B;  3QBY A;  2DAQ A;  5CAI A;  4XTX A;  1Y71 A;  2E70 A;  3OMG A;  3C94 A;  2K3X A;  2Q7G A;  3GF5 A;  1X75 C;  3GOX A;  2MWO A;  4OP0 A;  3RKW A;  4BDZ A;  1RIQ A;  4TTV A;  3CPW A;  2D9T A;  3LGL A;  1YJW T;  2QHU A;  3V7C A;  3P8T A;  1M4Z A;  4F7U B;  2XDD A;  4E7J A;  4IUV A;  5DY9 A;  2DU5 A;  3NET A;  5GAN 3;  1OYX A;  3V8K A;  4X9C A;  3OMC A;  1G3S A;  4PJO G;  4P73 C;  2RHS A;  4ME7 A;  2X4X A;  4FIB A;  4TVA A;  2AHJ B;  2VV5 A;  1X55 A;  3JAM E;  4E7L A;  1UGP B;  4M7A F;  3OS5 A;  2CJB A;  4JLG A;  2ZIN A;  1EOV A;  3M57 A;  3KBG A;  1USY A;  3A7U A;  4YRR A;  3MO8 A;  2JN0 A;  5A0L A;  2LCC A;  3QKJ A;  1P92 A;  2E6Z A;  1Y07 A;  2C7I A;  4H02 A;  4CH4 A;  4M7A D;  3LC0 A;  4H2S A;  4ZTF A;  3HRK A;  4J6W A;  2M1H A;  4YRC A;  3CXC S;  1L0W A;  2DQ0 A;  3GLX A;  4PNO A;  3L2W A;  4YCV A;  1LNX A;  4HT8 A;  4A4F A;  4JRK A;  1BYM A;  2ARS A;  2CZ6 B;  2XHC A;  2M0O A;  2VYT A;  2X35 A;  3RF1 A;  2ZPI B;  4KUD K;  3C4S A;  4IUR A;  4DOW A;  2WSF E;  2XI9 A;  5GAM h;  1B70 A;  2E6N A;  5CKF A;  1SER A;  4JDS A;  4G84 A;  2FYK A;  2ZT7 A;  2ZZD A;  3JCM e;  2E1H A;  4ZIB A;  3OYF A;  2ZT6 A;  2I4L A;  3DB3 A;  2P0P A;  1ASZ A;  4BUG A;  5CK9 A;  5ELO A;  2PUO B;  3NEL A;  1R8O B;  5GAN 7;  4C8Q D;  2MAM A;  4RCC A;  2DDZ A;  1VQM T;  3JCM c;  1VQN T;  1NNH A;  1RI0 A;  2YLB A;  1YFR A;  1VIF A;  3MCA B;  3NEN A;  1KG1 A;  5J3B A;  2GFA A;  3E1S A;  3FDR A;  1JJ2 S;  1UGR B;  1VQ7 A;  4BDY A;  4EO4 A;  3PZC A;  1Z7M A;  5CKE A;  1NJI U;  4A53 A;  4C92 F;  1BI2 A;  4IUP A;  3JB9 G;  1Q7Y C;  2XID A;  4XEM A;  3M4Q A;  4HWS A;  1VQL A;  3JCM P;  3HPW A;  3CCR T;  5GAO r;  5GAM j;  4JRP A;  1FX7 A;  1XTD A;  4XQ3 A;  4P75 A;  2ZIO A;  3JB9 J;  1BI0 A;  4XU3 A;  3CCJ T;  1SET A;  2DPP B;  1I5L A;  2PMF A;  4YRJ A;  3VKI A;  2P0K A;  4ZGD B;  2ZT8 A;  2O4X B;  4P71 A;  2DXB A;  3HXW A;  2I4O A;  2H3J A;  2E41 A;  3A74 A;  4YRQ A;  4A4E A;  1LOJ A;  4RDX A;  3VJP A;  1G51 A;  4TQD A;  4DA4 A;  1IL2 A;  5C51 B;  4M75 F;  3WQZ A;  3CC2 A;  4XTU A;  4M7A B;  5D6W A;  3CCQ T;  1QE0 A;  1K9M U;  4MDW A;  1O75 A;  3DSQ A;  3JCM g;  1K73 U;  2M16 A;  4ELZ C;  2LQK A;  2Y90 A;  1KC8 U;  2QDY B;  2RHS B;  2E5A A;  3PNW C;  1EIY A;  2HAX A;  1G3Y A;  4P72 C;  3CCL A;  3L2R A;  1XQH A;  3S6W A;  3OW2 A;  4QVD A;  4M78 C;  4YRM A;  3DKM A;  5LL6 S;  1FXX A;  5GAO q;  3HFN A;  2L89 A;  3M4Y A;  1YIT A;  1U1T A;  2DZ9 A;  5KE2 A;  5CO7 A;  5FU7 B;  3S3N A;  4M7D D;  2P0L A;  2DTI A;  4RQF A;  5A0D A;  4A54 A;  3PCO A;  1Q82 C;  4M7D F;  3ER0 A;  1X01 A;  2KDS A;  3M56 A;  2E10 A;  1QP2 A;  3CXC A;  3VV0 A;  5LJ3 g;  4RMO A;  3MQZ A;  2LX9 A;  4DQ2 A;  3S3M A;  5FU7 C;  2MMP A;  4IUT A;  1EVK A;  3FIF A;  1VQ6 A;  1N6A A;  1KQ2 A;  2LQ8 A;  4IUQ A;  2V8K A;  3SFM A;  4YCU A;  2XD0 A;  4YRT A;  3EFR A;  1UB4 A;  4B9X A;  4RKU E;  4E51 A;  4IKF A;  4BAC A;  4P74 A;  1QVG A;  4Y91 A;  1QF6 A;  1E1O A;  3JCM J;  3Q1J A;  1YJW A;  3GP8 A;  5GAO p;  4X9D A;  1B34 B;  2AMC B;  3HXV A;  3QYH B;  4MZT A;  2OAU A;  2OTJ A;  1B7Y A;  3X26 B;  1QVF A;  1D3B A;  3G1Z A;  5CQY A;  2VGN A;  2K5F A;  1EVL A;  3QJY A;  1Y7X A;  2P5I A;  2Q5I A;  2E12 A;  3CCV A;  2CJA A;  1EQR A;  1QVG S;  4H2X A;  2CS7 A;  1NJI C;  3G71 A;  3LW5 E;  5GAN 5;  4M75 E;  4K87 A;  3JB9 I;  2XGT A;  5GAN f;  3RES A;  3A8G B;  3R07 A;  1WU7 A;  3TU4 K;  4C92 C;  1K73 C;  3QYG B;  3OYG A;  4YTL A;  3UT1 A;  4LVL A;  1E22 A;  4M78 B;  1BI3 A;  5KCH A;  2ART A;  3JSC A;  4YP0 A;  4OLF A;  5FRM A;  5GAM f;  1UEB A;  4Y28 E;  2PVO B;  4LDW A;  5C0M A;  2I4M A;  4P3O A;  4H2T A;  4YRS A;  3AHU A;  1ZBX A;  4C8Q F;  2E5Q A;  1BKB A;  4HA8 A;  1W2B A;  3JCM X;  3KXT A;  2EJ9 A;  3A8L B;  4J5Y A;  1Q81 U;  5LJ5 j;  4XEO A;  3A8O B;  4H2U A;  2DD4 A;  2DJZ A;  1VQ4 A;  3OD1 A;  4YDQ A;  3VBB A;  3NFC A;  3NTI A;  1Q81 C;  1Y96 A;  2E64 A;  3E9G A;  4C92 A;  4YRN A;  1BBW A;  4ATO A;  2DZC A;  4M78 F;  1EFW A;  3M54 A;  4M7A G;  5GAM e;  1VQ5 T;  2DTO A;  4HCZ A;  1ASY A;  1K8A C;  2DK3 A;  2ZPB B;  1MHN A;  3CPF A;  1JB0 E;  4YRL A;  3E9I A;  2QHS A;  3OYK A;  1WYD A;  3GNF B;  1KQS A;  2GFU A;  4L59 A;  4CH3 A;  5I2S A;  3RMQ A;  4EPC A;  4GLK A;  1WJR A;  5GAM g;  3P8H A;  1KC8 C;  3V8J A;  3QZ9 B;  2RJF A;  3CMA T;  2L3R A;  4M75 C;  2QEX T;  5I2M A;  1VQ7 T;  5M9O A;  4QW2 A;  2X4J A;  3A8M B;  4NL3 A;  5DLQ E;  5LJ3 f;  1M1G A;  2ZCF B;  3X24 B;  2I4N A;  1WQ7 A;  2DD5 A;  4KBM B;  5GAN 8;  1JJC A;  3OYC A;  2XKO C;  3MET A;  1TH7 A;  4LDV A;  3J81 E;  5CKH A;  3FJP A;  5LJ5 f;  3CCS A;  4C8Q A;  1D3B B;  1QP3 A;  2E65 A;  3ASK A;  2D0Q B;  5HKC A;  2PVG B;  2QHV A;  1RL2 A;  4TVA B;  1YIJ T;  2QA4 T;  2X4W A;  4TVW A;  4X5O A;  1WPY A;  2LCL A;  4XTZ A;  5C6S A;  1VQ4 T;  2ARU A;  1N8R U;  3I55 A;  4CRI A;  2EYQ A;  3JRZ A;  5D6Y A;  5LJ5 d;  3QO5 A;  1NYQ A;  3MEW A;  1QW1 A;  2ZPH B;  4J83 A;  4ZN1 A;  2P0Q A;  3HFV A;  2ZPE B;  4FT4 A;  2F5T X;  5LJ3 d;  2Y4Y A;  2DO3 A;  2ZPF B;  4M78 A;  4FT2 A;  4ZTZ B;  3NEM A;  2NLU A;  3BDU A;  2ZZG A;  4BD3 A;  3CCR A;  2O4X A;  3H6Z A;  2L5Q A;  3CMA A;  4ZGE B;  5FU6 B;  2RHX A;  5CQX A;  4A4H A;  4E7K A;  4EMK A;  2JNG A;  1VQ9 T;  4M75 G;  1YHQ A;  5E3I A;  2R57 A;  1Q82 U;  3PMT A;  1YB3 A;  2EQK A;  3FLG A;  4YRI A;  1VUB A;  3QXE B;  2RHI A;  3CC7 T;  4OB1 B;  5GAN 4;  4LD9 K;  2ZNJ A;  2RK2 A;  2EQM A;  1QVP A;  5GAN h;  4VUB A;  2O01 E;  1USY C;  4PHC A;  2OTJ T;  1KMN A;  3VQW A;  1BI1 A;  2K5L A;  4YPF A;  2M9U A;  5CVI A;  5HK3 A;  3X25 B;  3GPL A;  1I81 A;  4YRG A;  5A2Q E;  5CR2 A;  2KY9 A;  4P3N A;  1PSF A;  1E24 A;  1ADY A;  1ZQ1 A;  4JRQ A;  1LJO A;  2QQ9 A;  3PCO B;  4KUL A;  1U8R A;  2ALY A;  1VQP A;  1G5H A;  1M9S A;  5GAN g;  1UGQ B;  1H4S A;  4MMK A;  1ZHI A;  1VQN A;  4YRK A;  2PME A;  2LT1 A;  3GNG A;  4KT0 E;  3P8B B;  4M77 G;  3SWN B;  1OZ2 A;  4JJN K;  1ADJ A;  2ZZE A;  1G5V A;  4XAX B;  5GAN e;  4LDU A;  3HRT A;  1KMM A;  2IY5 B;  3BDL A;  3M58 A;  3X20 B;  1SES A;  4OVA A;  3CCV T;  3HXX A;  4P74 C;  3HFO A;  2CYZ B;  1IRE B;  4YYE A;  1K9M C;  4KR3 A;  1NJ2 A;  2J3M A;  2X4Y A;  4OGC A;  3QHS A;  2RHY A;  3CME T;  1J5W A;  4M78 G;  2FHD A;  2R5M A;  3OYL A;  2RI3 A;  2RK1 A;  3M5A A;  2Q7H A;  3RL6 A;  4QQ6 A;  5HY6 A;  3A31 A;  3OYN A;  1X56 A;  1SSF A;  2K2V A;  3G7Z A;  3VYH B;  4BW9 A;  4HT4 A;  4LNS A;  3REX A;  2GF7 A;  5KH6 A;  4PL6 A;  1JJ2 A;  1YI2 A;  3QG1 A;  3OW2 S;  4YRF A;  1WQW A;  5LJ3 h;  4E7I A;  4EMH A;  4M7D C;  1VQ8 A;  4PLI A;  4B9W A;  2LNV A;  1KHC A;  1JRI A;  2KAF A;  3RIR A;  5J39 A;  3G71 T;  3QDR B;  1VQK A;  4N4G A;  4M77 C;  4EMK C;  2YRV A;  3CEY A;  4N0A C;  1B34 A;  3QUI A;  1ATI A;  4FU6 A;  3VYG A;  1VQZ A;  4PLL A;  3MHX A;  5FLX E;  1NJ5 A;  3M9Q A;  3WVD B;  2OTL A;  5C53 B;  3LYI A;  3VQX A;  3UH0 A;  1M8V A;  4H2V A;  2HD0 A;  3OYB A;  1YCY A;  3LSS A;  4OF1 A;  1SRY A;  1G5I A;  1X54 A;  2RJC A;  4BB7 A;  1EIF A;  3M4P A;  4R56 A;  2ZTG A;  3M4G A;  1YIT T;  1WGS A;  3HKS A;  3OBW A;  2P4T A;  2G4C A;  11AS A;  3OYY A;  1WJS A;  3CC4 T;  4YRO A;  2GQV A;  3LSQ A;  4C0D C;  3JCM b;  4LVK A;  4UP8 A;  2FB7 A;  4M77 D;  3OA6 A;  5AYF A;  3HSB A;  3A7R A;  1VQ8 T;  1G3T A;  3ZFJ A;  2A3L A;  2RH2 A;  3RGL A;  1VQO T;  2C8M A;  3HY1 A;  3CCS T;  4M75 D;  4X34 A;  4PJO E;  3JCM V;  2DTH A;  1X2H A;  3HXZ A;  3OYH A;  4E7H A;  3LLR A;  1HK9 A;  2A7Y A;  2MI6 A;  3I55 T;  1I4K 1;  12AS A;  2LVM A;  4FL6 A;  3JB9 D;  1FWZ A;  2RA2 A;  4M7D B;  3HFZ A;  3HTZ A;  1HC7 A;  2OTL T;  4M77 B;  2RD1 A;  4PJO F;  3OS2 A;  2K3Y A;  4OB3 B;  2PVD B;  4XU2 A;  2QQA A;  4N4H A;  3C95 A;  3PFS A;  2QI2 A;  1BIB A;  4OMF B;  1NPR A;  3A5Z B;  1GXI E;  2DKG A;  3BW1 A;  4C92 D;  3IKM B;  1YJN A;  2MF2 A;  3VQY A;  4RG2 A;  3CC4 A;  4A4G A;  2R5A A;  4M77 A;  2CZ7 B;  2AKW A;  1HTT A;  2QA4 A;  5GAM d;  2XDP A;  3F70 A;  3OB9 A;  2ZT5 A;  5CIU A;  4M7A A;  4JUV A;  4C5H A;  2RM4 A;  3HP9 A;  4CH6 A;  2QQS A;  4Q15 A;  1VQO A;  5D6X A;  2G3R A;  1YFS A;  2RJE A;  3OQ5 A;  3P8D A;  4BE0 A;  4CH5 A;  5GMK l;  3P8Y A;  1V29 B;  2JTM A;  1N9R A;  1W2B S;  4KR2 A;  3GIB A;  5IT9 E;  1VQ6 T;  5K1X A;  4HT9 A;  1N27 A;  3V8L A;  2XK0 A;  4L6V 5;  4C0D B;  2FVU A;  3PTA A;  4EMK B;  4V2S A;  1YBY A;  1S72 T;  1M5Q 1;  2CZ0 B;  4HCC A;  3TEH A;  2WSC E;  1KQ1 A;  2R58 A;  3A5Y A;  1H4T A;  2F5K A;  3DB4 A;  4TWA A;  2A8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...