2CGHA

Crystal structure of biotin ligase from mycobacterium tuberculosis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
238
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords BIOTIN LIGASE
publication title Active Site Conformational Changes Upon Reaction Intermediate Biotinyl-5'-AMP Binding in Biotin Protein Ligase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 82
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cghA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2cghA01
1SRYA 4HWTA 4LNSA 1JBMA 1I4K1 4M75D 1NJ1A 5GAOp 5GAOq 2ZIMA 4H2WA 1H4QA 1HXDA 3MF1A 4M78G 2ZT5A 2Y90A 1LYLA 1QE0A 1U1SA 4J15A 4C8QA 1EVKA 2DJZA 4P3OA 3PGGA 4XU3A 3JB9H 5GANf 4NOYA 1LJOA 2FYKA 2I4OA 4EMGA 4C92F 2DQ3A 5GAMg 2EJGA 4OLFA 3SWNA 4XU2A 3FIFA 2AKWB 1B76A 2DQ0A 4O2DA 2ALYA 5LJ5d 4AH6A 1WLEA 4MMKA 3JCMQ 4M7AB 4CH3A 4BWAA 2ZINA 3A7AA 4UP8A 4EMKC 3FB9A 4P3PA 4YRNA 3A74A 4C92D 4M7AC 5GAOm 1ADJA 2ZXFA 4YRSA 4WJ4A 4TVAB 5LJ5f 3NEMA 3BFMA 4RDXA 2ZZEA 3M4PA 5LJ5h 3JB9D 2Q7HA 1ATIA 5GAN4 5C53B 4HA8A 5GMKi 3MF2A 3A31A 1J5WA 5GMKh 4J6WA 4XU0A 4PJOF 1NYQA 2XTIA 5GANe 4HWOA 1H4TA 1HTTA 2E65A 1MGQA 2I2LA 4X9DA 3PZCA 5C52B 1WU7A 4M78B 2EWNA 2E5AA 1N9RA 2Q5IA 4P74A 4CS2A 4DPGA 4NCXA 2QTXA 3EFRA 4M75E 4RCCA 3QHSA 5GAN7 2AKWA 3HXVA 2DVEA 2EL9A 4M77F 4M78C 1B8AA 2DTOA 3M4GA 4PJOD 4P72C 3TEHB 4M7AA 4RMFA 5E3IA 1SESA 1VQZA 4HWPA 2ARUA 3IKLA 3HFOA 3BDUA 4M75G 1I5LA 2C7IA 3I7FA 4ZTZB 3HFNA 3IG2A 4H2XA 1NJ5A 3INZA 1B7YB 2DZ9A 4L87A 4H02A 4YRKA 1QF6A 3V7CA 5GAN3 2AMCB 4P73A 2Q7EA 4F7UF 4TVAA 5GMKe 1E1TA 2ODRC 1NJ2A 4P75C 4M77D 2QHUA 1U1TA 1ADYA 4YDQA 2I4MA 5LJ3d 3TUPA 3MEYA 2IY5B 5GAMf 1JRIA 4PNOA 5GAOl 3IKMB 4YPFA 3HTZA 3LSQA 1NJ6A 2E3CA 5GAN5 4WF2A 4C92E 1X56A 2QHSA 2ZT6A 3RL6A 3UGQA 1EVLA 2CJAA 4M78A 4TQDA 3V8KA 2P0LA 4P72A 3HRKA 4BW9A 3WQZA 3HSBA 1KQ2A 3QUIA 4QVCA 2Q5HA 4CH5A 4ZTUB 4XTWA 4C92G 3QO5A 3RESA 1G5HA 3TEHA 5ELOA 2DU5A 2EJ9A 2Q7GA 4X9CA 4YCVA 1KMNA 4YRTA 2RHSB 1B34B 5GMKm 1I81A 1YFTA 4P75A 1C0AA 4XTXA 3HXUA 1BBWA 1B7YA 1BIAA 1LNXA 2AMCA 4WI1A 4TVWA 4UP9A 4M75B 4K86A 4YRRA 3UH0A 4HT9A 3M4QA 3JCMV 3PCOB 4M7DF 5GAOr 3JB9F 4JUVA 4EMKB 1D3BB 4PJOE 1WNLA 5GAMe 1WYDA 3LSSA 2ZR2A 2IY5A 3LC0A 4N0AC 4M75C 4A53A 4JLIA 5LJ3g 2YLBA 5LJ3j 1X01A 4CH4A 2RB6A 4Q15A 5ELNA 4PJOG 3V7RA 5GAN2 3QSUA 1NYRA 4P71C 1NJ8A 2QHTA 5K1PA 3JCMd 2XGTA 1X2GA 2CJ9A 3G1ZA 5GAN8 1WQWA 4M7DD 5C51B 3V8LA 2PMFA 4YRIA 3FJPA 4HWSA 4HVCA 4H2SA 3NENA 1BIBA 4XTUA 3NELA 1YFRA 4C8QF 1B34A 4K88A 1L0WA 1EIYB 1N9SA 4C92B 2ZR3A 4A54A 2E1HA 1H4SA 4F7UE 4EMHA 3HXYA 4YP0A 3HY0A 1G51A 3SB2A 1IL2A 3V8JA 3BY7A 2ZCEA 4M75A 2J3LA 3R07A 5GMKl 5GANj 4NL2A 4C92C 2ZTGA 3PCOA 4EMKA 1D3BA 4EX5A 2ZZFA 1H4VB 4J5YA 1M5Q1 1TH7A 4F7UG 4P71A 1I8FA 3HXXA 1PYSB 4C8QD 4YRLA 1YB3A 3QO8A 4H2UA 3JB9J 4V2SA 3RGLA 4YCWA 1JJCB 4CH6A 1ASYA 4YYEA 1KOGA 4RCBA 5LJ5e 1Z7MA 4RQEA 3HXZA 2ZNIA 11ASA 3P8VA 4UPAA 4J6YA 2HNIA 3JCMP 5HGQA 1B70B 4YRGA 3HRIA 3JCMg 1E1OA 4PJOB 4NL3A 3QTCA 4H2TA 3RUXA 1E24A 4ZIBA 3VU3C 1EIYA 4PJOC 4C92A 1BBUA 5KNNA 3JCMW 1YCYA 1KQ1A 2DXUA 2DZCA 2RD1A 2YHTA 4M7DE 1HK9A 5LJ3f 4M77B 2CJBA 1SETA 5LJ3h 4TQFA 5CAIA 2ZT7A 1FYFA 2ZT8A 4XU1A 4M7AF 3DSQA 2K57A 2ARSA 3VQWA 3QNEA 4YRCA 4M77C 3L1AA 1PYSA 3A7RA 4OP0A 2DKGA 1EOVA 3JB9G 3P8YA 12ASA 4RQFA 4TTVA 3VQYA 1JJCA 2P5IA 3E9IA 3L4GB 1N9WA 3QO3A 3JCMJ 5GANd 4F7UB 3ICAA 1WQ7A 1EQRA 4TVYA 4PG3A 4YRQA 2JN0A 2ZZGA 1B70A 2FB7A 4M7AD 3HFVA 2DTHA 4PJOA 1LOJA 1Y96B 4YRMA 1Z7NA 2DTIA 4C8QE 3RF1A 3VQXA 4YREA 3HY1A 1GGMA 3KFUA 3REUA 5GANh 2EJFA 2CGHA 2RHQB 4M78F 5GAMj 4UP7A 4QVDA 3CMQA 5LJ3e 4YRPA 2ZIOA 3BW1A 3RKWA 4YROA 4XTYA 4C8QG 3HFZB 4M77E 4M77A 3GIBA 4P74C 4YRJA 4P3NA 3ERRA 3VQVA 3A32A 2VXFA 3RKXA 4XTVA 3TEGA 3RERA 3RIRA 3A5ZA 2ARTA 1EFWA 4K87A 4WJ3M 4H2XB 2RHSA 3NETA 4M77G 1YGBA 5K1XA 3V7SA 3EFSA 4M78D 1USYC 4G84A 3JCMf 4PHCA 3VBBA 3UFGA 3L4GA 3JCMh 4F7UA 1E22A 4JRKA 1X2HA 4CS3A 4N0AA 4M7DB 1WPYA 3RKYA 5GANg 2PMEA 3JCMb 2DEQA 3JCMX 3QO7A 2QHVA 4P73C 3REXA 4KR2A 5I21A 4HT8A 4X5OA 3L2ZA 1X54A 4EO4A 1KMMA 1Y96A 4TWAA 2E64A 3JCMc 5GAOn 3A5YA 4Q6GA 4M7DC 4E51A 2J3MA 2ODRD 2VC8A 2ZNJA 2DXTA 3HXWA 2RM4A 2RA2A 4MMLA 2RHQA 4Y91A 1X55A 2I4NA 2CIMA 5F5WA 3P8TA 2VXEA 3HFZA 4J6XA 4G85A 4HWRA 5GAN6 1G5IA 4M7AE 2I4LA 2ZGWA 4KR3A 1YFSA 4XTZA 1RIQA 5LJ5g 1USYA 3A7UA 5LJ5j 3RACA 1SERA 5DY9A 4C8QB 5GAMd 4KQEA 1M8VA 3BJUA 3JCMe 5GMKj 1ASZA 2E10A 3IALA 3W3SA 4DQ2A 3OD1A 3UGTA 3SWNB 2DDZA 4XEMA 4M7AG 1NNHA 2C8MA 4JRIA 4C8QC 2YLCA 4M75F 2ALYB 4M7DA 4YRFA 2EAYA 4CS4A 4H2YA 3E9HA 3SWNC 2G4CA 3JB9I 4XQ3A 2DU7A 1H641 5GAMh 4H2VA 4XEOA 1W66A 2E41A 1HC7A 4M78E 4M7DG 4YCUA 3AHUA
chains in the Genus database with same CATH superfamily
3UF4A 4LNSA 2BKDN 4FT4A 2DM1A 1SSHA 1UGRB 5DLQE 1YJ9Q 1XTDA 4M75D 2D0NA 2DD4A 1TTHB 4H2WA 4DBRA 3A8LB 4A4KA 1G3SA 1GCPA 3MHXA 3QG1A 3HP9A 2Y90A 3CC4A 4Q5WA 4Z02A 1K8AU 1W70A 5ECAA 1IGUA 1LYLA 1QE0A 1QQJA 1UGPB 3PGGA 2BIVA 4XU3A 3JB9H 5GANf 2YUPA 3QYGB 2VV5A 2O9VA 3ME9A 4OF1A 4EMGA 2YDLA 2EJGA 3SWNA 1R8OB 2F5TX 3VKIA 1G3TA 1T0HA 2XDBA 2DQ0A 3RNJA 3HRSA 2CP6A 4O2DA 5LJ5d 4AH6A 1VQKA 4OB1B 4MMKA 3JCMQ 4BWAA 1OV3A 4EMKC 1OULA 3FB9A 2DL4A 3A74A 2ZXFA 4WJ4A 4MZMA 4KULA 2OI3A 1QP3A 4KGZB 2RNAA 5LJ5f 3S3NA 1C6VX 4RDXA 2ZZEA 3M4PA 5LJ5h 2Q7HA 5C53B 1ZSGA 4E7IA 3PMTA 1K9MU 1FMWA 2M51A 2GNCA 4DEXA 3MQZA 1JXOA 5GMKh 1PC0A 2FEIA 2LT4A 3UA6A 1Y07A 3VYHB 2XTIA 3FRNA 4X9DA 1MGQA 2A8EA 3PZCA 4KRTA 3PMIA 3CCVA 4LDYA 2E5AA 4CS2A 3VS6A 2CZ7B 3G7ZA 3CMAA 3M4YA 1R0BG 2AKWA 2O4XA 2FPEA 2JZ2A 4BD3A 2AKKA 2OTJA 1QVGP 4P72C 4RMFA 1SESA 1QP2A 3BDUA 4M75G 2KNBB 4QKUA 1I5LA 2C7IA 3I7FA 1M90C 2DZ9A 4E7LA 3DLMA 3MCAB 4EIKA 4YRKA 4DBQA 5DM7R 2Q7EA 2EYQA 3CCMQ 3VS3A 3PTAA 1Q81C 2QHUA 4YDQA 2BZ8A 1KSWA 1M9SA 1Y71A 2O9SA 1RAHB 4FYVB 2K2MA 3VYGA 5CCAA 3M58A 4PNOA 5GAOl 4YPFA 1OZ3A 1SHFA 2KXDA 4P5NA 3I55Q 1BCMA 5GAN5 3G71A 4C92E 2CJAA 4M78A 1LPLA 4IKFA 3HRKA 3VUZA 2JUFA 1UDLA 4JZ4A 1KQ2A 2O31A 8ATCB 3JSCA 1TS9A 2MWOA 4ZTUB 2LJ0A 1OU9A 1WXUA 2CUDA 3RESA 3OMCA 3TEHA 2K5LA 2LX9A 1VQOQ 2Q7GA 2ZAEA 4YRTA 1B34B 1KK7A 1VQLQ 2J6OA 1Z9ZA 4ZTJA 2CSQA 1J3TA 3CCLT 2F1LA 4X1VA 3DKMA 1Q7YU 1Q82U 2YRDA 4ZNXA 1C0MA 3OY9A 2C06A 2CT3A 4BI4A 2F69A 3X26B 2JTFA 3S3OA 2OTLA 4TVWA 1KQSS 1GBQA 3UA7A 3CXCA 2ZPEB 5GAOr 4JUVA 4EMKB 1D3BB 5GAMe 3LSSA 3CPWP 3PFSA 1ZLMA 3CCJQ 3LC0A 2X4YA 1N8RU 2LTOA 3I5RA 3ZBDA 4RTZA 2LQWA 3CCQT 3ZL7C 1VQPQ 2P0KA 1JJ2S 4J8OA 1SF9A 3E9FA 3V7RA 1ZUYA 1NYRA 3QSUA 4P71C 2H8HA 3D7SB 1HD3A 1YCSB 1V76A 5GAN8 1NBEB 4M7DD 4PJLA 1BK2A 2PMFA 1BYMA 2X51A 3FJPA 4HVCA 4IUPA 1UUEA 4ZN1A 3EGUA 4JPBW 3NENA 3GNGA 3FEOA 3MP1A 2QK0A 1VQNT 1YFRA 2DLPA 4C5HA 5EC7A 5FRMA 2DA9A 1O9SA 4F7UE 3I56T 4EMHA 1AWOA 1PSEA 3KFVA 4YP0A 3HY0A 3SB2A 4LUEA 3RMSA 3BY7A 2DE0X 1S72T 1K9AA 2J3LA 1M2VA 5GMKl 1BB9A 3OBYA 4J5YA 1KC8C 1IRXA 3CC7A 4HVUA 2GFAA 1MMGA 1PYSB 3META 1DJ7B 4C8QD 4YRLA 2JNGA 3JB9J 2G3RA 4E7SA 4YCWA 5AT1B 4YYEA 3G4SA 1KOGA 3T9NA 3H6ZA 2A36A 5LJ5e 4A4FA 3CCRA 2COZA 2QEXT 2KRNA 1B70B 4YRGA 4QVZA 3HRIA 1E1OA 2DVJA 1SHGA 4MDXA 1VQ7T 3RUXA 1VQ6Q 4LE9A 2E4HA 2R57A 3E2UA 3NGPA 4JJCA 1U06A 2EGCA 3MKDA 2VWFA 1XJWB 3OMGA 4PJOC 5CKHA 4XK8E 4C92A 4A4GA 1BBUA 4ELZC 2RJDA 2DYBA 1D09B 2DZCA 1Y7XA 1B7TA 1HK9A 2COYA 2CJBA 1SETA 1Q82R 5KYUB 1YJ9T 1M90U 3LWHA 3J7AF 3CC2A 2ESWA 5FLXE 3QNEA 4YRCA 4KGVB 2FHDA 2FO0A 4PJNA 1Q81U 4OP0A 2DKGA 3A7RA 2KK4A 3NFCA 4E6RA 3JB9G 1T3SA 1JJCA 1XNIA 2P5IA 3E9IA 3A8HB 2DD5A 2AZVA 4YRQA 1VUBA 4HCCA 3CCUQ 5IH2A 2ZZGA 2MWPA 2YUNA 1G3WA 2JTEA 1Y96B 1PD1A 1GCQC 2HDAA 2DTIA 1LVKA 2IPOB 2RI5A 4JJDA 2NUZA 2QQRA 1N27A 5CVIA 3HY1A 4Z88A 1WYXA 4MZTA 3MEWA 4M78F 4QVDA 2BZYA 3OYMA 1YI2Q 4YRPA 5KYNA 3BW1A 4LDWA 3RKWA 4YROA 4XTYA 4C8QG 1AT1B 4M77A 1WJSA 1EIFA 3RKXA 4F04B 1M8MA 1AHJB 3H9NA 3A5ZA 5I22A 4E7ZA 4ZGEB 2X3XD 2M0OA 2VGNA 2FG0A 2K3BA 3CCQA 4X34A 4M77G 3V7SA 3JCMf 1WI7A 1QWFA 4ZTFA 3JCMh 4F7UA 1H3HA 3OYDA 4JRKA 1NM7A 5CIUA 2RQVA 4N0AA 3C0CA 3GPLA 1WPYA 1ARKA 2YSQA 2DEQA 3KBGA 1Q86U 3OS1A 2L8DA 1W4SA 2FPDA 3M57A 1KMMA 4N4GA 2O01E 1PWTA 2LCSA 4Q6GA 1K73U 3CBPA 2YWWA 3QJYA 2VC8A 3HHTB 2M16A 4OB0B 2RHQA 2JM8A 3J80E 3VRYA 4L59A 2BUDA 2AK5A 4IIMA 3DLLA 4Y92A 2VXEA 2QQSA 4L5GA 3CCMT 4J6XA 4G85A 4HWRA 4M7AE 2ZPGB 4FW1A 5A0GA 1YFSA 1RIQA 1USYA 2K4YA 1VQ5Q 2WSEE 3RACA 1M90R 4BI3A 3I55T 1ASZA 3A1PA 5A2QE 4DQ2A 2PUKB 3SWNB 4R0KA 2DDZA 4LUDA 2JOYA 1NNHA 4JRPA 3EHQA 4J9BA 2JMCA 1KD1U 2LJ1A 1Q81R 4BY6B 2QEXA 2QA4A 4H2YA 1KQSP 4JLGA 3VS7A 4IUTA 1VQ7A 3JB9I 4E7KA 4H2VA 2E41A 1VQOT 1HC7A 1D1AA 2A37A 1VQLT 3JCMV 3AHUA 3M0PA 4HWTA 2CS7A 5J3BA 4Z8AA 3CCEQ 5GAOq 4HXJA 2ZIMA 2CP3A 1HXDA 4PKCC 1YJ9A 2ED1A 2LQNA 1N5ZA 2DL7A 1VQ4Q 4AT1B 2KBTA 2V8JA 3A8GB 3CCJT 2CT4A 1E7OA 1OYXA 2IIMA 1LJOA 2I4OA 2XG8D 4C92F 1VQPT 2XK0A 2AKWB 2O4XB 1B76A 4FYXB 4HKEA 1IZ6A 2ALYA 4IURA 3OYKA 1ACMB 1PRLC 3OS5A 2QASA 2V1RA 4CH3A 3M5AA 3OYJA 2HAXA 2ZINA 2EIFA 4FYWB 4P3PA 3I5SA 5GAOm 1ADJA 1WHGA 2NS6A 5CO7A 3NEMA 3SFMA 1GFCA 2J6KA 4EPCA 3TVTA 1ATIA 2HSEB 3C94A 4OMOA 5GMKi 3MF2A 4J6WA 4XU0A 2KVQG 3NMZC 3LGLA 2KQWA 2VUBA 1H4TA 2HKQB 1FMVA 1HTTA 2I2LA 5C52B 4M78B 4DPGA 4M75E 1NJIC 2NUTA 3HXVA 2EL9A 2HL3A 4M77F 1B8AA 1W2BS 2FVUA 1YJWQ 1KC8R 2ROTA 2XI9A 4PJOD 3TEHB 3MEUA 1AOJA 4M7AA 5E3IA 3TREA 4HWPA 3QKJA 2ARUA 1UECA 1NLPC 1VQ6T 1NYGA 1W1FA 3OSVA 4RTTA 4AFUC 1NJ5A 2RI2A 1UG1A 4L87A 2M02A 2LMJA 2LZ6B 3V7CA 1TU0B 3R6NA 5GAN3 4F7UF 4RTWA 1E1TA 1NJ2A 4P75C 2RQTA 1U1TA 2DBMA 3CCMA 1ADYA 2HEQA 4OMFB 1ZUUA 4CC2A 3TUPA 1D0XA 4ATOA 3MEYA 2B8AA 2DIQA 1JO8A 5GAMf 3OYAA 1WHKA 2KYMA 3HTZA 1FXXA 1IHVA 1NJ6A 2E3CA 2KY9A 4JDSA 2ZT6A 2YUQA 1EVLA 4FSXA 2NUPA 1RABB 4J9HA 2A08A 4LXCA 1WHMA 5FU7C 4LN2A 3LYIA 3CBMA 5FU6B 4CH5A 4LVIA 4XTWA 1WHHA 3CCUT 1G5HA 5D6YA 2DU5A 2EJ9A 4YCVA 2HMAA 1YHQQ 5GMKm 2HSPA 1I81A 1KJWA 1VQLA 4BDZA 1BBWA 2KSSA 5FROA 4FSSA 2AMCA 2NYSA 4K86A 4YRRA 5HKCA 3UH0A 1M2VB 1VA7A 3WXMB 1YI2T 4KGXB 4HT9A 1TUGB 3JV3A 1YITA 1SEMA 2ZR2A 2IY5A 2G6FX 1YJNA 4N0AC 3EFOB 3X25B 2HD0A 5LJ3g 1MNDA 1X01A 1V1CA 1H92A 1OX9A 4Q15A 2KRMA 4PJOG 1VQPA 2AIRB 3PVQA 2GTOA 1X2GA 2CP2A 3G1ZA 2RK1A 4FYYB 4FM4B 1P92A 4HWSA 2VKNA 1SRMA 3SHWA 2DL3A 4RTUA 4RMOA 2DJQA 5KE2A 2X35A 4FT2A 3MEVA 1N9SA 2FZKB 2HBWA 4C92B 2ZR3A 1OZ2A 2H3EB 1IGQA 3HXYA 2PVOB 2R5MA 2RPNA 1IL2A 3O8VA 4AG2C 4M75A 1X75C 3OS0A 4OMQA 1JXMA 5GANj 4N4IA 3TSWA 3LH0A 1ZA1B 4LDVA 2P0PA 1F1BB 3J81E 2ZZFA 2JVVA 1H4VB 1TH7A 4D8DA 2A0FB 4ZGDB 5HCKA 4N4HA 3EHRA 5KCOA 1VQ5T 1XOVA 1IHWA 3VJPA 1JJCB 1ASYA 3OYCA 1VQ9Q 2E5KA 1S1NA 2HZYA 4UPAA 3EH2A 1RLPC 2EYXA 3X24B 4LVMA 4NL3A 2Y4XA 1E24A 1NJIU 2MMPA 1VQ6A 3CD6T 5FU7B 1EIYA 1NE8A 2DRKA 1MV3A 2KRSA 2ABLA 5LL6S 1KQ1A 3PNWC 2F2VA 3CQTA 2YHTA 4QT7A 4M7DE 4M77B 4VUBA 3UATA 3OYGA 3CCET 3EGXA 4TQFA 1MV0B 1QLYA 2PZ1A 2ZT7A 5L23A 5C6SA 4M7AF 3A5ZB 1Q95G 4B9WA 4C0DC 2ARSA 1VQ4T 2YRCA 1D1CA 5FWBA 4RG8A 1VQ8Q 1RADB 4RQFA 1W6XA 4A4HA 2DX1A 4BE1A 3M0QA 4F7UB 2V1QA 1G8XA 4QW2A 4TVYA 2ECZA 4PG3A 2AKLA 4J83A 3CCUA 2CP0A 1JQQA 1Z7NA 4C8QE 2A7YA 1XQHA 1QVGA 1K0XA 4JJBA 4E7JA 3EH1A 2CH4W 2O2OA 2ZPBB 5EG2A 2E6ZA 2RHQB 2FRWA 1BI0A 3Q1JA 1K0SA 2D0QB 2E3IA 4C0GA 1VQKQ 2CZ1B 3LH5A 2MPXC 3REBB 4M77E 4YRJA 2IG0A 1QVFS 3ERRA 4HCKA 4Z89A 3FLGA 1M27C 4XTVA 3TEGA 3RERA 1VYVA 2RMOA 2RN8A 1W2BP 2FL7A 3EGDA 2LX7A 4K87A 2YT6A 3LW5E 5K1XA 1ZA2B 4PHCA 5CK9A 1I0CA 4B6MA 2JS2A 4CS3A 2HQEA 4DOVA 5GANg 2PMEA 1UHCA 2QHVA 4RG2A 4J9CA 3URGA 4QQGA 5FW9A 1YJWT 4EO4A 4PJMA 3QWXX 2PNIA 1K4US 1G83A 3EFOA 1QMCA 1X6OA 3CMAQ 2ZNJA 1AVZC 2DXTA 2CP5A 1NJIR 2LQKA 4O6JA 2MYSA 2EGEA 4FL6A 5L8RE 4Y91A 2OTJQ 1X55A 3MO8A 4GBQA 2QAZA 2CH4A 4EDUA 2JMAA 2LNVA 2XU8A 1NEGA 2L5QA 1T3LA 5LJ5g 3G1JA 4JS4A 1VIFA 5KE3A 3LGFA 2EGAA 4ZGJB 3CPWA 1PG5B 1M8VA 1RLQC 1VQ5A 2KR3A 4E7HA 2EW3A 4E2FB 1MMNA 3W3SA 1PRMC 1IREB 3ULRB 2C8MA 1AWXA 4C0FA 4C0DB 5KYWA 2YLCA 4M75F 2ALYB 4M7DA 5GJVB 2EAYA 1MMAA 3SWNC 2VYTA 4J9GA 2VB6A 2G4CA 2DU7A 1H641 1X43A 4OVAA 4BY6C 2EQKA 1TUCA 1W66A 2BZXA 1I5OB 1YHQT 4M7DG 4YCUA 1AZEA 3E19A 2Z0WA 2XKOC 1H8KA 4B9XA 1RAGB 1WA7A 1JBMA 2W0ZA 1I4K1 3C12A 2KAFA 2L2PA 4GY5A 5J39A 3GBQA 5GAOp 2EVRA 2GF7A 2FZGB 3EG9A 3CCEA 3WVEB 3E1SA 2ZT5A 4DBHA 3VS4A 1U1SA 4A4EA 1BKBA 3JAME 1UEBA 4C8QA 1EVKA 3L2UA 2RHUA 3TQ7P 4NOYA 3VS5A 1K76A 2OTLQ 3CCLA 2DQ3A 2PU9B 1CKAA 4XU2A 5KYYA 2NUTB 2FZCB 3TCJA 2EYZA 5GJWB 3OW2A 2ZCFB 1WLEA 2A28A 1FYNA 2EYYA 4M7AB 3H41A 4IUQA 2QGGA 2P4TA 1M3BA 3KUFA 3A7AA 2XMFA 4YRNA 2LT1A 4ORZA 3FC3A 1SSFA 1I1JA 1C1AA 2SEMA 4ZN3A 1VYTA 5CR2A 2GCXA 5GAN4 4M4ZA 2LP5A 2CZ0B 1OOTA 3A31A 4OGCA 1J5WA 4AFZC 4JRQA 3X28B 3CBOA 1VQNA 1X27A 2RQWA 1YNZA 3UWNA 1R77A 1PNJA 4KH0B 1WU7A 2NUPB 5KH6A 1M1GA 2EKHA 2JTMA 2ZZDA 3I56A 4NCXA 1YWOA 1VQ9T 2QQ9A 3EFRA 4RCCA 3QHSA 4DA4A 5GAN7 1PKTA 2QDLA 1S72A 2DVEA 4J7FA 4M78C 3CC7Q 2DTOA 3M4GA 2OAWA 1YJWA 1VQZA 2KYBA 3RDVA 3IKLA 3HFOA 1ZBJA 3G4SQ 3EG1A 5CKFA 1ZQ1A 2FPFA 2L3RA 4ZTZB 5AYFA 3TSZA 3CCRQ 1M1KC 2EFIA 4H02A 1QF6A 1KC8U 2AMCB 4P73A 2VASA 4TVAA 2EPDA 1OI1A 2RO0A 2COWA 5CQYA 2EBPA 2I4MA 4KBMB 5LJ3d 1QW1A 2IY5B 8AT1B 2GTJA 3H8ZA 3CD6Q 1IO6A 3LSQA 2QTVA 1UFFA 3M59A 4OMLA 4WF2A 3CXCS 1RAIB 2QHSA 2FRYA 1VQ8T 3RL6A 3UGQA 4MZPA 2NLUA 4P72A 1K8AC 4BW9A 3WQZA 3HSBA 1TG0A 2K9GA 4BE0A 3QUIA 4QVCA 1WX6A 4WCIA 2DF6A 1H3ZA 1VQMQ 3QO5A 4GLMA 4NS5A 5D7UA 1QVFP 4X9CA 2DIGA 2RHSB 2C0OA 5FU6C 2JW4A 2MAMA 4RTYA 1YFTA 1C0AA 5IHNA 4DEYA 1YN8A 2LDMA 1B7YA 1LNXA 1WHJA 2KEAA 4UP9A 2OX7A 3MP8A 3M54A 4M75B 2DEUA 4AG1C 2B86A 3GLXA 1V29B 1WJRA 1VQKT 2M0YA 3M4QA 4M7DF 3JB9F 4KH1B 1WYDA 2ED0A 1WNLA 1G2BA 2GQVA 4PJOE 2F2WA 4PJJA 1G5VA 1QCNA 2L0AA 2VGMA 3U23A 4A53A 4JLIA 1PM3A 3EG2A 4PK4A 2CUBA 5LJ3j 4CH4A 2WSCE 1K9MC 2DFUA 4PLIA 2J06A 2PQWA 1QCOA 5GAN2 5K1PA 2V8KA 2ZPFB 1WGSA 1NZ9A 3UT1A 2AT1B 4AFSC 2P4RA 3I9QA 2KI7A 3CEYA 3C95A 3NELA 2LCCA 1KQSA 3A8MB 4C8QF 4K88A 3CCSQ 1EIYB 4JJNK 5HK0A 2E1HA 2KT1A 3CMAT 2DPPB 3QPHA 1UGSB 1G51A 5CQXA 3R07A 3VS2A 2OTJT 3EGXB 2ROLA 2YRVA 4C92C 3PCOA 1MMDA 1JJ2A 1GXIE 2BE7D 3ZFJA 1M5Q1 3OYIA 4P71A 4LDUA 2MOXA 2J7IA 1YB3A 1PSFA 1MHNA 3IQLA 3RGLA 4CH6A 2DXCA 4FCYA 2C0IA 1Z7MA 4RQEA 3HXZA 3PIPA 2MCNA 1VQ9A 3NTIA 2EQJA 4J9IA 3F70A 3P8VA 1YIJQ 5DLOA 1RI9A 4J6YA 2ZPIB 2GBQA 4CC7A 2HNIA 4R56A 3P8BB 2QG9B 2JXBA 3JCMg 4E47A 1M4ZA 3PT9A 3QTCA 3L2VA 4PFOA 1A0NB 2DXBA 3VU3C 1OPKA 2K6DA 3MJXA 3S6WA 2PUOB 3I55A 2DNUA 1M1FA 1QKWA 4HVWA 1YCYA 4TVRA 5C0MA 5IT9E 2QA4Q 1KFZA 4ME7A 1VIEA 4JS5A 2RD1A 3EG0A 2RHZA 1WXBA 3OYNA 2XDPA 1GFDA 1GRIA 1PCXA 1QKXA 1Q7YC 1KIKA 4QQDA 1FYFA 2ZT8A 2D8JA 3DSQA 2HL5C 5I2SA 3P8HA 3EGDB 4M77C 1EOVA 2ENMA 1VQOA 4TTVA 1VQ8A 3H0IA 3QO3A 5IHKA 5GANd 1NPPA 1YP5A 1ZUKA 2PVDB 2RHXA 1N8RC 2OTLT 2DAQA 1RAFB 4HT4A 2DO3A 4C5IA 3HFVA 3EG3A 4PJOA 4YRMA 1IB8A 4QQ6A 3RF1A 4HCBA 3CCJA 3EAEA 1GGMA 3QDFA 3M0UA 1RI0A 5IN1A 5GANh 5GAMj 4UP7A 5LJ3e 2ZIOA 4IUVA 3VV0A 3GIBA 1PHTA 2WSFE 3VQVA 3A32A 2VXFA 1ZX6A 3C4SA 4WJ3M 3QXEB 3A8OB 4H2XB 2RHSA 4RKUE 3NETA 1RACB 2QYZA 1YGBA 1AWJA 1OU8A 3EFSA 4M78D 1USYC 3VBBA 3UFGA 3L4GA 2P84A 2J6FA 4J9EA 4MDWA 5KYWB 2E6NA 1GCQA 1ZSZB 4M7DB 3RKYA 3JCMb 1D0YA 4P73C 5I21A 3CC7T 3L2ZA 2W10A 1X54A 1WLPB 4TWAA 2E64A 3JCMc 1MNEA 5GAOn 3A5YA 4PLLA 3OBWA 2QXFA 5CKEA 4E51A 4J7IA 7AT1B 3HKSA 3G4ST 2RM4A 1GL5A 2IVWA 3CMEQ 3OYYA 3CXCP 3CCRT 3REAB 2O88A 2DERA 2K2VA 2E12A 4OGEA 2I4NA 5F5WA 3P8TA 4RTVA 3EG9B 2YUOA 1B3QA 4OMNA 3HFZA 3I35A 2XD0A 5GAN6 2ZGWA 4KR3A 3A7UA 4II1A 5LJ5j 1AWWA 4C8QB 4KQEA 2LCLA 2XDDA 4LD9K 5GMKj 1M1KR 1OQKA 2E10A 2K3XA 3IALA 1X69A 4AMCA 1NYFA 4XAXB 3NTKA 3UGTA 3P8DA 1TSFA 5KYYB 1BI2A 4JRIA 1M3CA 1EFNA 5HY6A 5KCHA 4YRFA 3L2RA 4CS4A 1X6GA 1WZOA 3JRZA 3NPFA 3CC2T 1EZZB 3OS2A 2RJEA 4XQ3A 4CC3A 2X9HA 1OEBA 3M53A 1VQMT 5A0LA 1YBYA 4OB3B 3OYEA 5KYXA 3G6EQ 4KUDK 4XEOA 2JJ9A 3KXTA 3GF5A 2HCKA 1RAEB 1K8AR 1SRYA 4HVVA 1ABQA 3H0FA 2EKOA 3OYBA 3NTHA 3CPFA 1NJ1A 1HYOA 2BTTA 4LDXA 1H4QA 4CRIA 3QBYA 2AZSA 3MF1A 4M78G 2V26A 2YXYA 1HSQA 3M0RA 3CC4Q 2OJ2A 2H3JA 4J15A 2JT4A 2E3HA 2DJZA 4P3OA 2L3SA 4AFQC 2FYKA 2K79A 3GNFB 2QGFB 5GAMg 4OLFA 1NG2A 3MEAA 3FIFA 4Y28E 4LNPA 1NEBA 1YITQ 1GBRA 1E6GA 4ANJA 1YI2A 1YJNQ 1SG5A 2WACA 1M3AA 1PKSA 1X6BA 2KGTA 1FWZA 3GP8A 1SPKA 4D8KA 1K9MR 5HK3A 2MIOA 3SD4A 2X4WA 4CI0C 4UP8A 1HJDA 1M2OA 4C92D 2LQ8A 4M7AC 4FU6A 3CCST 1Q86C 3SEMA 2MI6A 4YRSA 4F17A 2CDTA 3QYHB 4TVAB 2E70A 2CSIA 2X4JA 2JS0A 3BFMA 3FDRA 2XIDA 1K73C 2DK3A 2D9TA 3JB9D 1BI3A 1KHCA 5IAYA 1UTIA 4HA8A 1WJQA 2DL5A 3OYFA 1I07A 2K7AA 3M56A 3NHNA 4JZ3A 4PJOF 1NYQA 3M0SA 5IXBA 1QVPA 5GANe 1M30A 3OSSC 3CCVQ 4HWOA 1ABOA 2E65A 2LNHB 1BI1A 2EWNA 2DYIA 1BBZA 2GQIA 1N9RA 2ATCB 2Q5IA 4P74A 3PIOA 3H0HA 1G3YA 3QZ9B 2QTXA 3O5ZA 2QQBA 1YIJT 1U3OA 1SKUB 2E5QA 3TEEA 3S3MA 1Z9QA 3SDZA 2KMTA 2A3LA 1KD1C 1X2QA 3UDCA 3QJ6A 3GOXA 2HKNA 2CP7A 2VVKA 4KUIA 3HFNA 2KE9A 3IG2A 2QI2A 4H2XA 2ZPHB 3INZA 1B7YB 3MPUB 3OW2P 3X20B 2Y4YA 3LLRA 2KXCA 2EYWA 4OMMA 1EX4A 1PD0A 3L2WA 3HTRA 5GMKe 3TU4K 2KDSA 4O5VA 1WHLA 2ODRC 2QA4T 1RAAB 4M77D 1AD5A 1ZSZA 2L89A 1JRIA 3IKMB 4CC4B 3G71Q 4BE2A 3L42A 3CD6A 1U5SA 2DILA 1W2BA 1X56A 1UGQB 4PL6A 1BCOA 4TQDA 3V8KA 2P0LA 4LVJA 2PTKA 1WXTA 1Q7YR 2Q5HA 4DOWA 1WFWA 1D1BA 4C92G 1SRLA 5ELOA 4BB7A 1VQMA 1KMNA 3HL8A 1VQ4A 4C0ZA 2P0QA 4OMPA 1TOVA 4P75A 4K11A 3VS1A 1N8RR 4XTXA 3HXUA 3LX7A 1BIAA 3OYHA 3QWYA 4WTOB 1FMKA 4WI1A 2RF0A 1JB0E 4L6V5 3PCOB 4OB2B 2M1HA 2PVGB 4F14A 1O75A 2RQUA 1YFNA 4M75C 1K1ZA 2RK2A 3HRUA 1OX8A 2YLBA 5J26A 2F5KA 1KHIA 2RB6A 1UE9A 5ELNA 2I0NA 1NJ8A 2QHTA 3JCMd 2XGTA 4KT0E 2CZ6B 3PE0A 2CJ9A 1WQWA 3E9GA 5C51B 3V8LA 4YRIA 4ESRA 1AEYA 4H2SA 1TUDA 1BIBA 4ELYC 4XTUA 1N6AA 4J9DA 1RL2A 1BU1A 4LD6A 1B34A 3ER0A 1L0WA 3DB3A 4A54A 1JU5C 3CCSA 1H4SA 5CKBA 3A98A 3V8JA 3CMET 3OYLA 2ZCEA 2RH2A 3QIIA 2HBPA 2M9UA 4NL2A 4D6WA 2ZTGA 4EMKA 1WDXA 1D3BA 2HQXA 3WVDB 4EX5A 5I2MA 4F7UG 1I8FA 3HXXA 1YWPA 2D8HA 3QO8A 4H2UA 5FRNA 4IIOA 4V2SA 3THKA 3ZEHA 4RCBA 2MK5A 5I11A 2L3PA 2RQRA 1B07A 2SRCA 2ZNIA 11ASA 1Y0MA 2LJ3A 1Y57A 5A0DA 2L3QA 1KG1A 3JCMP 5HGQA 1YIJA 2EQMA 3MP6A 6AT1B 4PJOB 2EQUA 1LCKA 1VYUA 5D6WA 4BDYA 4H2TA 3DB4A 2LRQA 2RHIA 1OPLA 4ZIBA 2HQHA 3G6ET 1X2KA 2RHYA 2R5AA 2KROA 2QQAA 5KNNA 3JCMW 1UGVA 2DXUA 2EQIA 1QCFA 1QVGS 5LJ3f 3CC2Q 1RUWA 5LJ3h 4BACA 2DL8A 4C5GA 5CAIA 2QDYB 4IUUA 2D6FA 1TWBA 4XU1A 2K57A 5CKDA 3VQWA 3CC4T 3L1AA 1PYSA 1CSKA 3P8YA 4PFPA 12ASA 4LVLA 1YHQA 3VQYA 1R0CB 2CREA 3L4GB 1N9WA 3QDRB 3JCMJ 3ICAA 1WQ7A 1EQRA 2DBKA 1JJ2P 2JN0A 3VS0A 4UC4A 4YTLA 1YITT 1B70A 2FB7A 4M7AD 1YJNT 2DTHA 3VRZA 1LOJA 3BDLA 2DRMA 4PFZA 3VQXA 2XHCA 2V8IA 3CCLQ 4YREA 4A63B 1U8RA 9ATCB 3KFUA 3M0TA 3REUA 2EJFA 2CGHA 2X4XA 2AHJB 2K3YA 3CMQA 1QWEA 2C0TA 2LVMA 4LVKA 3VUBA 3HFZB 4P74C 4P3NA 5KYUA 2CYZB 4HCZA 3RIRA 2ARTA 3CCQQ 1EFWA 3RR6A 2KT8A 1Q86R 3HRTA 1TXQA 3CCVT 1WIEA 4G84A 4RTXA 4FW2A 1VOMA 1K73R 2CKKA 1E22A 1ZBXA 4F16A 3R6OA 2DETA 2DMOA 4C5EA 4BI8B 3CPWS 1IXDA 1X2HA 2F2XA 1AZGB 2XICA 3M9QA 3OQ5A 4FIBA 2LC4A 3JCMX 3QO7A 3REXA 4KR2A 4HT8A 1VQNQ 3ASKA 4X5OA 2RI3A 2K5IA 2BE9B 1Y96A 5KYXB 1UJYA 1ZSZC 4M7DC 2J3MA 2ODRD 3FJ5A 3I56Q 3HXWA 1QVFA 2D1XA 3AT1B 1MUZA 2RA2A 2X3WD 1CKBA 3QZ5B 4MMLA 3L2QA 2J05A 3PVLA 1S72Q 2R58A 1T0JA 3CMEA 3UPUA 3HPWA 1NLOC 2CIMA 5FWCA 2GGRA 2NWMA 5IXFA 1KD1R 1G5IA 3OA6A 4GLKA 2I4LA 4XTZA 2GFUA 3BE3A 1UB4A 1SERA 5DY9A 5GAMd 3M55A 3BJUA 2RJCA 5D6XA 3LWIA 1JEGA 1FX7A 3JCMe 3G71T 3RMQA 3OD1A 1UHFA 1ZHIA 4M7AG 4XEMA 2QEXQ 4J9FA 3RBBB 1UJ0A 4BUGA 4C8QC 5IHIA 1VQ7Q 1D0ZA 2K5FA 3N5BB 3E9HA 1Q82C 4RUGA 2OAUA 1M1KU 1E6HA 4R55A 5GAMh 4DBFA 2JM9A 3OW2S 3G6EA 2MF2A 4M78E 2RJFA 1NPRA 5M9OA 3OB9A
chains in the Genus database with same CATH topology
4LNSA 2BKDN 4FT4A 1UGRB 5DLQE 1XTDA 4M75D 2DD4A 4H2WA 3A8LB 4A4KA 1G3SA 3MHXA 3QG1A 3HP9A 2Y90A 3CC4A 4Q5WA 4Z02A 1K8AU 1LYLA 1QE0A 1UGPB 3PGGA 2BIVA 4XU3A 3JB9H 5GANf 3QYGB 2VV5A 3ME9A 4OF1A 4EMGA 2EJGA 3SWNA 1R8OB 2F5TX 3VKIA 1G3TA 2XDBA 2DQ0A 3HRSA 4O2DA 5LJ5d 4AH6A 1VQKA 4OB1B 4MMKA 3JCMQ 4BWAA 4EMKC 3FB9A 3A74A 2ZXFA 4WJ4A 4MZMA 4KULA 1QP3A 5LJ5f 4RDXA 3S3NA 2ZZEA 3M4PA 5LJ5h 2Q7HA 5C53B 4E7IA 3PMTA 1K9MU 3MQZA 5GMKh 2LT4A 1Y07A 3VYHB 2XTIA 3FRNA 4X9DA 1MGQA 2A8EA 3PZCA 3PMIA 3CCVA 4LDYA 2E5AA 4CS2A 2CZ7B 3G7ZA 3CMAA 3M4YA 2AKWA 2O4XA 2JZ2A 4BD3A 2OTJA 4P72C 4RMFA 1SESA 1QP2A 3BDUA 4M75G 1NPRA 1I5LA 2C7IA 3I7FA 1M90C 2DZ9A 4E7LA 3DLMA 3MCAB 4YRKA 5DM7R 2Q7EA 2EYQA 3PTAA 1Q81C 2QHUA 4YDQA 1M9SA 1Y71A 3VYGA 5CCAA 3M58A 4PNOA 5GAOl 4YPFA 1OZ3A 4P5NA 5GAN5 3G71A 4C92E 2CJAA 4M78A 4IKFA 3HRKA 3VUZA 2JUFA 1KQ2A 3JSCA 2MWOA 4ZTUB 3RESA 3OMCA 3TEHA 2K5LA 2LX9A 2Q7GA 4YRTA 1B34B 4ZTJA 3CCLT 3DKMA 1Q7YU 1Q82U 3OY9A 2C06A 4BI4A 2F69A 3X26B 2JTFA 3S3OA 2OTLA 4TVWA 1KQSS 3CXCA 2ZPEB 5GAOr 4JUVA 4EMKB 1D3BB 5GAMe 3LSSA 3PFSA 3LC0A 2X4YA 1N8RU 2LTOA 3ZBDA 3CCQT 2P0KA 1JJ2S 4J8OA 3E9FA 3V7RA 4P71C 1NYRA 3QSUA 5GAN8 4M7DD 2PMFA 1BYMA 3FJPA 4HVCA 4IUPA 4ZN1A 3NENA 3GNGA 3FEOA 3MP1A 1VQNT 1YFRA 4C5HA 5FRMA 1O9SA 4F7UE 3I56T 4EMHA 4YP0A 1PSEA 3HY0A 3SB2A 3RMSA 3BY7A 1S72T 2J3LA 5GMKl 3OBYA 4J5YA 1KC8C 3CC7A 2GFAA 1PYSB 3META 1DJ7B 4C8QD 4YRLA 2JNGA 3JB9J 2G3RA 4YCWA 4YYEA 3G4SA 1KOGA 3T9NA 3H6ZA 5LJ5e 4A4FA 3CCRA 2QEXT 1B70B 4YRGA 4QVZA 3HRIA 1E1OA 4MDXA 1VQ7T 3RUXA 2R57A 3OMGA 4PJOC 5CKHA 4XK8E 4C92A 4A4GA 1BBUA 4ELZC 2RJDA 2DZCA 1Y7XA 1HK9A 2CJBA 1SETA 1YJ9T 1M90U 3LWHA 3J7AF 3CC2A 5FLXE 3QNEA 4YRCA 2FHDA 1Q81U 4OP0A 2DKGA 3A7RA 2KK4A 3NFCA 3JB9G 1JJCA 1XNIA 2P5IA 3E9IA 3A8HB 2DD5A 4YRQA 1VUBA 4HCCA 2ZZGA 2MWPA 1G3WA 1Y96B 2DTIA 2RI5A 2QQRA 1N27A 5CVIA 3HY1A 4MZTA 3MEWA 4M78F 4QVDA 3OYMA 4YRPA 3BW1A 4LDWA 3RKWA 4YROA 4XTYA 4C8QG 4M77A 1WJSA 1EIFA 3RKXA 1AHJB 3A5ZA 4ZGEB 2M0OA 2VGNA 3CCQA 4X34A 4M77G 3V7SA 3JCMf 4ZTFA 3JCMh 4F7UA 3OYDA 4JRKA 5CIUA 4N0AA 3GPLA 1WPYA 2DEQA 3KBGA 1Q86U 3OS1A 2L8DA 1W4SA 3M57A 1KMMA 4N4GA 2O01E 4Q6GA 1K73U 3CBPA 3QJYA 2VC8A 3HHTB 2M16A 4OB0B 2RHQA 3J80E 2BUDA 4L59A 3DLLA 2VXEA 2QQSA 4L5GA 3CCMT 4J6XA 4G85A 4HWRA 4M7AE 2ZPGB 5A0GA 1YFSA 1RIQA 1USYA 2K4YA 2WSEE 3RACA 4BI3A 3I55T 1ASZA 5A2QE 4DQ2A 2PUKB 3SWNB 2DDZA 2JOYA 1NNHA 4JRPA 1KD1U 4BY6B 2QEXA 2QA4A 4H2YA 4JLGA 4IUTA 1VQ7A 3JB9I 4E7KA 4H2VA 2E41A 1VQOT 1HC7A 1VQLT 3AHUA 3JCMV 4HWTA 2CS7A 5J3BA 5GAOq 2ZIMA 1HXDA 4PKCC 1YJ9A 2V8JA 3A8GB 3CCJT 1OYXA 1LJOA 2I4OA 2XG8D 4C92F 1VQPT 2XK0A 2AKWB 2O4XB 1B76A 4HKEA 1IZ6A 2ALYA 4IURA 3OYKA 3OS5A 4CH3A 3M5AA 3OYJA 2HAXA 2ZINA 2EIFA 4P3PA 5GAOm 1ADJA 2NS6A 5CO7A 3NEMA 3SFMA 4EPCA 1ATIA 3C94A 5GMKi 3MF2A 4J6WA 4XU0A 2KVQG 3LGLA 2KQWA 2VUBA 1H4TA 1HTTA 2I2LA 5C52B 4M78B 4DPGA 4M75E 1NJIC 3HXVA 2EL9A 4M77F 1B8AA 1W2BS 2FVUA 2XI9A 4PJOD 3TEHB 3MEUA 4M7AA 5E3IA 3TREA 4HWPA 3QKJA 2ARUA 1VQ6T 3OSVA 1NJ5A 2RI2A 4L87A 3V7CA 5GAN3 4F7UF 1E1TA 1NJ2A 4P75C 1U1TA 3CCMA 1ADYA 4OMFB 3TUPA 4ATOA 3MEYA 2B8AA 2DIQA 5GAMf 3OYAA 3HTZA 1FXXA 1NJ6A 2E3CA 2KY9A 4JDSA 2ZT6A 1EVLA 4FSXA 5FU7C 3LYIA 3CBMA 5FU6B 4CH5A 4LVIA 4XTWA 3CCUT 1G5HA 5D6YA 2DU5A 2EJ9A 4YCVA 5GMKm 1I81A 1VQLA 4BDZA 1BBWA 2KSSA 5FROA 2AMCA 4YRRA 4K86A 5HKCA 3UH0A 3WXMB 1YI2T 4HT9A 1YITA 2ZR2A 2IY5A 1YJNA 4N0AC 3X25B 2HD0A 5LJ3g 1X01A 4Q15A 4PJOG 1VQPA 1X2GA 3G1ZA 2RK1A 4FM4B 1P92A 4HWSA 4RMOA 5KE2A 2X35A 4FT2A 3MEVA 1N9SA 4C92B 2ZR3A 1OZ2A 3HXYA 2PVOB 2R5MA 1IL2A 3O8VA 4M75A 1X75C 3OS0A 5GANj 4N4IA 3LH0A 4LDVA 2P0PA 3J81E 2ZZFA 2JVVA 1H4VB 1TH7A 4ZGDB 4N4HA 5KCOA 1VQ5T 1XOVA 3VJPA 1JJCB 1ASYA 3OYCA 4UPAA 3X24B 4LVMA 4NL3A 2Y4XA 1E24A 1NJIU 2MMPA 1VQ6A 3CD6T 5FU7B 1EIYA 1NE8A 5LL6S 1KQ1A 3PNWC 2YHTA 4M7DE 4M77B 4VUBA 3OYGA 3CCET 4TQFA 2ZT7A 5C6SA 4M7AF 3A5ZB 4B9WA 4C0DC 2ARSA 1VQ4T 4RG8A 4RQFA 4A4HA 4BE1A 4F7UB 4QW2A 4TVYA 4PG3A 4J83A 3CCUA 1Z7NA 4C8QE 2A7YA 1XQHA 1QVGA 4E7JA 2ZPBB 5EG2A 2E6ZA 2RHQB 1BI0A 3Q1JA 2D0QB 4C0GA 2CZ1B 4M77E 4YRJA 2IG0A 1QVFS 3ERRA 3FLGA 4XTVA 3TEGA 3RERA 2FL7A 4K87A 3LW5E 5K1XA 4PHCA 5CK9A 4CS3A 2HQEA 4DOVA 5GANg 2PMEA 2QHVA 4RG2A 3URGA 4QQGA 1YJWT 4EO4A 1X6OA 2ZNJA 2DXTA 2LQKA 4O6JA 4FL6A 5L8RE 4Y91A 1X55A 3MO8A 4EDUA 2LNVA 2XU8A 2L5QA 5LJ5g 4JS4A 1VIFA 5KE3A 3LGFA 4ZGJB 3CPWA 1M8VA 1VQ5A 4E7HA 3W3SA 1IREB 2C8MA 4C0FA 4C0DB 2YLCA 4M75F 2ALYB 4M7DA 2EAYA 3SWNC 2VYTA 2G4CA 2DU7A 1H641 4OVAA 4BY6C 2EQKA 1W66A 1YHQT 4M7DG 4YCUA 3E19A 2XKOC 4B9XA 1JBMA 1I4K1 3C12A 2KAFA 4GY5A 5J39A 5GAOp 2GF7A 3CCEA 3WVEB 3E1SA 2ZT5A 1U1SA 4A4EA 1BKBA 3JAME 1UEBA 4C8QA 1EVKA 3L2UA 2RHUA 4NOYA 3CCLA 2DQ3A 2PU9B 4XU2A 3TCJA 3OW2A 2ZCFB 1WLEA 4M7AB 4IUQA 2P4TA 3KUFA 3A7AA 4YRNA 2LT1A 3FC3A 1SSFA 4ZN3A 5CR2A 2GCXA 5GAN4 2CZ0B 3A31A 4OGCA 1J5WA 4JRQA 3X28B 3CBOA 1VQNA 3UWNA 1WU7A 5KH6A 1M1GA 2JTMA 2ZZDA 3I56A 4NCXA 1VQ9T 2QQ9A 3EFRA 4RCCA 3QHSA 4DA4A 5GAN7 1S72A 2DVEA 4J7FA 4M78C 2DTOA 3M4GA 1YJWA 1VQZA 3IKLA 3HFOA 1ZQ1A 2L3RA 4ZTZB 5AYFA 1M1KC 2EFIA 4H02A 1QF6A 1KC8U 2AMCB 4P73A 4TVAA 1OI1A 2RO0A 5CQYA 2I4MA 4KBMB 5LJ3d 1QW1A 2IY5B 3H8ZA 3LSQA 3M59A 4WF2A 3CXCS 2QHSA 3RL6A 1VQ8T 3UGQA 4MZPA 2NLUA 4P72A 1K8AC 4BW9A 3WQZA 3HSBA 4BE0A 3QUIA 4QVCA 1H3ZA 3QO5A 4NS5A 4X9CA 2DIGA 2RHSB 5FU6C 2MAMA 1YFTA 1C0AA 2LDMA 1B7YA 1LNXA 4UP9A 4M75B 3MP8A 3M54A 3GLXA 1V29B 1WJRA 1VQKT 3M4QA 4M7DF 3JB9F 1WYDA 4PJOE 1WNLA 2GQVA 1G5VA 2VGMA 4A53A 4JLIA 5LJ3j 4CH4A 2WSCE 1K9MC 4PLIA 2PQWA 5GAN2 5K1PA 2V8KA 2ZPFB 1WGSA 1NZ9A 3UT1A 3CEYA 3C95A 3NELA 2LCCA 1KQSA 3A8MB 4C8QF 4K88A 1EIYB 4JJNK 5HK0A 2E1HA 3CMAT 2DPPB 3QPHA 1UGSB 1G51A 5CQXA 3R07A 2OTJT 4C92C 2YRVA 3PCOA 1JJ2A 1GXIE 3ZFJA 1M5Q1 3OYIA 4P71A 4LDUA 1YB3A 1PSFA 1MHNA 3RGLA 4CH6A 2DXCA 1Z7MA 4RQEA 3HXZA 3PIPA 1VQ9A 3NTIA 2EQJA 3F70A 3P8VA 5DLOA 4J6YA 2ZPIB 2HNIA 4R56A 3P8BB 3JCMg 4E47A 1M4ZA 3PT9A 3QTCA 3L2VA 2DXBA 3VU3C 3S6WA 2PUOB 3I55A 1M1FA 5C0MA 1YCYA 4TVRA 5IT9E 4ME7A 1VIEA 4JS5A 2RD1A 2RHZA 3OYNA 2XDPA 1Q7YC 4QQDA 1FYFA 2ZT8A 3DSQA 5I2SA 3P8HA 4M77C 1EOVA 1VQOA 4TTVA 1VQ8A 3QO3A 5GANd 1NPPA 2RHXA 1N8RC 2PVDB 2OTLT 2DAQA 4HT4A 2DO3A 4C5IA 3HFVA 4PJOA 4YRMA 4QQ6A 3RF1A 4HCBA 3CCJA 3EAEA 1GGMA 1RI0A 5IN1A 5GANh 5GAMj 4UP7A 5LJ3e 2ZIOA 4IUVA 3VV0A 3GIBA 2WSFE 3VQVA 3A32A 2VXFA 3C4SA 4WJ3M 3QXEB 3A8OB 4H2XB 2RHSA 4RKUE 3NETA 1YGBA 3EFSA 4M78D 1USYC 3VBBA 3UFGA 3L4GA 4MDWA 2E6NA 4M7DB 3RKYA 3JCMb 4P73C 5I21A 3CC7T 3L2ZA 1X54A 4TWAA 2E64A 3JCMc 5GAOn 3A5YA 4PLLA 3OBWA 2QXFA 5CKEA 4E51A 4J7IA 3HKSA 3G4ST 2RM4A 2IVWA 3OYYA 3CCRT 2K2VA 2E12A 4OGEA 2I4NA 5F5WA 3P8TA 3HFZA 2XD0A 5GAN6 2ZGWA 4KR3A 3A7UA 4II1A 5LJ5j 4C8QB 4KQEA 2LCLA 2XDDA 4LD9K 5GMKj 2E10A 2K3XA 3IALA 4XAXB 3NTKA 3UGTA 3P8DA 1BI2A 4JRIA 5HY6A 5KCHA 4YRFA 3L2RA 4CS4A 3JRZA 3CC2T 3OS2A 2RJEA 4XQ3A 1VQMT 3M53A 4KUDK 5A0LA 1YBYA 4OB3B 3OYEA 4XEOA 3KXTA 3GF5A 1SRYA 2EKOA 3OYBA 3NTHA 3CPFA 1NJ1A 4LDXA 1H4QA 4CRIA 3QBYA 3MF1A 4M78G 2H3JA 4J15A 4P3OA 2DJZA 2FYKA 3GNFB 5GAMg 4OLFA 3MEAA 3FIFA 4Y28E 1YI2A 2WACA 1FWZA 3GP8A 5HK3A 3SD4A 4CI0C 2X4WA 4UP8A 4C92D 2LQ8A 4M7AC 4FU6A 3CCST 1Q86C 4YRSA 2MI6A 3QYHB 4TVAB 2E70A 3BFMA 2X4JA 3FDRA 2XIDA 1K73C 2DK3A 2D9TA 3JB9D 1BI3A 1KHCA 5IAYA 4HA8A 1WJQA 3OYFA 3M56A 4PJOF 1NYQA 1QVPA 5GANe 3OSSC 4HWOA 2E65A 1BI1A 2EWNA 2Q5IA 1N9RA 4P74A 3PIOA 1G3YA 3QZ9B 2QTXA 2QQBA 1YIJT 2E5QA 3TEEA 3S3MA 3SDZA 2KMTA 2A3LA 1KD1C 3UDCA 3QJ6A 3GOXA 4KUIA 3HFNA 3IG2A 4H2XA 2QI2A 2ZPHB 3INZA 1B7YB 3X20B 2Y4YA 3LLRA 3L2WA 5GMKe 3TU4K 2KDSA 4O5VA 2ODRC 2QA4T 4M77D 2L89A 1JRIA 3IKMB 4BE2A 3L42A 3CD6A 1W2BA 1X56A 1UGQB 4PL6A 4TQDA 3V8KA 2P0LA 4LVJA 2Q5HA 4DOWA 4C92G 5ELOA 4BB7A 1VQMA 1KMNA 3HL8A 1VQ4A 4C0ZA 2P0QA 4P75A 4XTXA 3HXUA 3LX7A 1BIAA 3OYHA 4WI1A 1JB0E 4L6V5 3PCOB 4OB2B 2M1HA 2PVGB 1O75A 4M75C 2RK2A 3HRUA 2YLBA 5J26A 2F5KA 1KHIA 2RB6A 5ELNA 1NJ8A 2QHTA 3JCMd 2XGTA 4KT0E 2CZ6B 2CJ9A 1WQWA 3E9GA 5C51B 3V8LA 4YRIA 4H2SA 1BIBA 4ELYC 4XTUA 1N6AA 1RL2A 4LD6A 1B34A 3ER0A 1L0WA 3DB3A 4A54A 3CCSA 1H4SA 5CKBA 3V8JA 3CMET 3OYLA 2ZCEA 2RH2A 3QIIA 2HBPA 2M9UA 4NL2A 4D6WA 2ZTGA 4EMKA 1D3BA 2HQXA 3WVDB 4EX5A 5I2MA 4F7UG 1I8FA 3HXXA 3QO8A 4H2UA 5FRNA 4V2SA 3ZEHA 4RCBA 2ZNIA 11ASA 5A0DA 1KG1A 3JCMP 5HGQA 1YIJA 2EQMA 3MP6A 4PJOB 2EQUA 5D6WA 4BDYA 4H2TA 3DB4A 2LRQA 2RHIA 4ZIBA 3G6ET 2RHYA 2R5AA 2QQAA 5KNNA 3JCMW 2DXUA 1QVGS 5LJ3f 5LJ3h 4BACA 4C5GA 5CAIA 2QDYB 4IUUA 2D6FA 4XU1A 2K57A 5CKDA 3VQWA 3CC4T 3L1AA 1PYSA 3P8YA 4LVLA 12ASA 1YHQA 3VQYA 3L4GB 1N9WA 3QDRB 3JCMJ 3ICAA 1WQ7A 1EQRA 2JN0A 4UC4A 4YTLA 1YITT 1B70A 2FB7A 4M7AD 1YJNT 2DTHA 1LOJA 3BDLA 3VQXA 2XHCA 2V8IA 4YREA 1U8RA 3KFUA 3REUA 2EJFA 2CGHA 2X4XA 2AHJB 2K3YA 3CMQA 2LVMA 4LVKA 3VUBA 3HFZB 4P74C 4P3NA 2CYZB 4HCZA 3RIRA 2ARTA 1EFWA 3HRTA 3CCVT 4G84A 2CKKA 1E22A 1ZBXA 3R6OA 4C5EA 4BI8B 3CPWS 1X2HA 2XICA 3M9QA 3OQ5A 4FIBA 2LC4A 3JCMX 3QO7A 3REXA 4KR2A 4HT8A 3ASKA 4X5OA 2RI3A 2K5IA 1Y96A 4M7DC 2J3MA 2ODRD 3HXWA 1QVFA 3QZ5B 2RA2A 4MMLA 3L2QA 2R58A 3CMEA 3UPUA 3HPWA 2CIMA 1G5IA 3OA6A 4GLKA 2I4LA 4XTZA 2GFUA 1UB4A 1SERA 5DY9A 5GAMd 3M55A 3BJUA 2RJCA 5D6XA 3LWIA 1FX7A 3JCMe 3G71T 3RMQA 3OD1A 1ZHIA 4M7AG 4XEMA 4BUGA 4C8QC 2K5FA 3N5BB 3E9HA 1Q82C 2OAUA 1M1KU 4R55A 5GAMh 3OW2S 3G6EA 2MF2A 4M78E 2RJFA 5CKFA 5M9OA 3OB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRY A;  4HWT A;  4LNS A;  1JBM A;  1I4K 1;  4M75 D;  1NJ1 A;  5GAO p;  5GAO q;  2ZIM A;  4H2W A;  1H4Q A;  1HXD A;  3MF1 A;  4M78 G;  2ZT5 A;  2Y90 A;  1LYL A;  1QE0 A;  1U1S A;  4J15 A;  4C8Q A;  1EVK A;  2DJZ A;  4P3O A;  3PGG A;  4XU3 A;  3JB9 H;  5GAN f;  4NOY A;  1LJO A;  2FYK A;  2I4O A;  4EMG A;  4C92 F;  2DQ3 A;  5GAM g;  2EJG A;  4OLF A;  3SWN A;  4XU2 A;  3FIF A;  2AKW B;  1B76 A;  2DQ0 A;  4O2D A;  2ALY A;  5LJ5 d;  4AH6 A;  1WLE A;  4MMK A;  3JCM Q;  4M7A B;  4CH3 A;  4BWA A;  2ZIN A;  3A7A A;  4UP8 A;  4EMK C;  3FB9 A;  4P3P A;  4YRN A;  3A74 A;  4C92 D;  4M7A C;  5GAO m;  1ADJ A;  2ZXF A;  4YRS A;  4WJ4 A;  4TVA B;  5LJ5 f;  3NEM A;  3BFM A;  4RDX A;  2ZZE A;  3M4P A;  5LJ5 h;  3JB9 D;  2Q7H A;  1ATI A;  5GAN 4;  5C53 B;  4HA8 A;  5GMK i;  3MF2 A;  3A31 A;  1J5W A;  5GMK h;  4J6W A;  4XU0 A;  4PJO F;  1NYQ A;  2XTI A;  5GAN e;  4HWO A;  1H4T A;  1HTT A;  2E65 A;  1MGQ A;  2I2L A;  4X9D A;  3PZC A;  5C52 B;  1WU7 A;  4M78 B;  2EWN A;  2E5A A;  1N9R A;  2Q5I A;  4P74 A;  4CS2 A;  4DPG A;  4NCX A;  2QTX A;  3EFR A;  4M75 E;  4RCC A;  3QHS A;  5GAN 7;  2AKW A;  3HXV A;  2DVE A;  2EL9 A;  4M77 F;  4M78 C;  1B8A A;  2DTO A;  3M4G A;  4PJO D;  4P72 C;  3TEH B;  4M7A A;  4RMF A;  5E3I A;  1SES A;  1VQZ A;  4HWP A;  2ARU A;  3IKL A;  3HFO A;  3BDU A;  4M75 G;  1I5L A;  2C7I A;  3I7F A;  4ZTZ B;  3HFN A;  3IG2 A;  4H2X A;  1NJ5 A;  3INZ A;  1B7Y B;  2DZ9 A;  4L87 A;  4H02 A;  4YRK A;  1QF6 A;  3V7C A;  5GAN 3;  2AMC B;  4P73 A;  2Q7E A;  4F7U F;  4TVA A;  5GMK e;  1E1T A;  2ODR C;  1NJ2 A;  4P75 C;  4M77 D;  2QHU A;  1U1T A;  1ADY A;  4YDQ A;  2I4M A;  5LJ3 d;  3TUP A;  3MEY A;  2IY5 B;  5GAM f;  1JRI A;  4PNO A;  5GAO l;  3IKM B;  4YPF A;  3HTZ A;  3LSQ A;  1NJ6 A;  2E3C A;  5GAN 5;  4WF2 A;  4C92 E;  1X56 A;  2QHS A;  2ZT6 A;  3RL6 A;  3UGQ A;  1EVL A;  2CJA A;  4M78 A;  4TQD A;  3V8K A;  2P0L A;  4P72 A;  3HRK A;  4BW9 A;  3WQZ A;  3HSB A;  1KQ2 A;  3QUI A;  4QVC A;  2Q5H A;  4CH5 A;  4ZTU B;  4XTW A;  4C92 G;  3QO5 A;  3RES A;  1G5H A;  3TEH A;  5ELO A;  2DU5 A;  2EJ9 A;  2Q7G A;  4X9C A;  4YCV A;  1KMN A;  4YRT A;  2RHS B;  1B34 B;  5GMK m;  1I81 A;  1YFT A;  4P75 A;  1C0A A;  4XTX A;  3HXU A;  1BBW A;  1B7Y A;  1BIA A;  1LNX A;  2AMC A;  4WI1 A;  4TVW A;  4UP9 A;  4M75 B;  4K86 A;  4YRR A;  3UH0 A;  4HT9 A;  3M4Q A;  3JCM V;  3PCO B;  4M7D F;  5GAO r;  3JB9 F;  4JUV A;  4EMK B;  1D3B B;  4PJO E;  1WNL A;  5GAM e;  1WYD A;  3LSS A;  2ZR2 A;  2IY5 A;  3LC0 A;  4N0A C;  4M75 C;  4A53 A;  4JLI A;  5LJ3 g;  2YLB A;  5LJ3 j;  1X01 A;  4CH4 A;  2RB6 A;  4Q15 A;  5ELN A;  4PJO G;  3V7R A;  5GAN 2;  3QSU A;  1NYR A;  4P71 C;  1NJ8 A;  2QHT A;  5K1P A;  3JCM d;  2XGT A;  1X2G A;  2CJ9 A;  3G1Z A;  5GAN 8;  1WQW A;  4M7D D;  5C51 B;  3V8L A;  2PMF A;  4YRI A;  3FJP A;  4HWS A;  4HVC A;  4H2S A;  3NEN A;  1BIB A;  4XTU A;  3NEL A;  1YFR A;  4C8Q F;  1B34 A;  4K88 A;  1L0W A;  1EIY B;  1N9S A;  4C92 B;  2ZR3 A;  4A54 A;  2E1H A;  1H4S A;  4F7U E;  4EMH A;  3HXY A;  4YP0 A;  3HY0 A;  1G51 A;  3SB2 A;  1IL2 A;  3V8J A;  3BY7 A;  2ZCE A;  4M75 A;  2J3L A;  3R07 A;  5GMK l;  5GAN j;  4NL2 A;  4C92 C;  2ZTG A;  3PCO A;  4EMK A;  1D3B A;  4EX5 A;  2ZZF A;  1H4V B;  4J5Y A;  1M5Q 1;  1TH7 A;  4F7U G;  4P71 A;  1I8F A;  3HXX A;  1PYS B;  4C8Q D;  4YRL A;  1YB3 A;  3QO8 A;  4H2U A;  3JB9 J;  4V2S A;  3RGL A;  4YCW A;  1JJC B;  4CH6 A;  1ASY A;  4YYE A;  1KOG A;  4RCB A;  5LJ5 e;  1Z7M A;  4RQE A;  3HXZ A;  2ZNI A;  11AS A;  3P8V A;  4UPA A;  4J6Y A;  2HNI A;  3JCM P;  5HGQ A;  1B70 B;  4YRG A;  3HRI A;  3JCM g;  1E1O A;  4PJO B;  4NL3 A;  3QTC A;  4H2T A;  3RUX A;  1E24 A;  4ZIB A;  3VU3 C;  1EIY A;  4PJO C;  4C92 A;  1BBU A;  5KNN A;  3JCM W;  1YCY A;  1KQ1 A;  2DXU A;  2DZC A;  2RD1 A;  2YHT A;  4M7D E;  1HK9 A;  5LJ3 f;  4M77 B;  2CJB A;  1SET A;  5LJ3 h;  4TQF A;  5CAI A;  2ZT7 A;  1FYF A;  2ZT8 A;  4XU1 A;  4M7A F;  3DSQ A;  2K57 A;  2ARS A;  3VQW A;  3QNE A;  4YRC A;  4M77 C;  3L1A A;  1PYS A;  3A7R A;  4OP0 A;  2DKG A;  1EOV A;  3JB9 G;  3P8Y A;  12AS A;  4RQF A;  4TTV A;  3VQY A;  1JJC A;  2P5I A;  3E9I A;  3L4G B;  1N9W A;  3QO3 A;  3JCM J;  5GAN d;  4F7U B;  3ICA A;  1WQ7 A;  1EQR A;  4TVY A;  4PG3 A;  4YRQ A;  2JN0 A;  2ZZG A;  1B70 A;  2FB7 A;  4M7A D;  3HFV A;  2DTH A;  4PJO A;  1LOJ A;  1Y96 B;  4YRM A;  1Z7N A;  2DTI A;  4C8Q E;  3RF1 A;  3VQX A;  4YRE A;  3HY1 A;  1GGM A;  3KFU A;  3REU A;  5GAN h;  2EJF A;  2CGH A;  2RHQ B;  4M78 F;  5GAM j;  4UP7 A;  4QVD A;  3CMQ A;  5LJ3 e;  4YRP A;  2ZIO A;  3BW1 A;  3RKW A;  4YRO A;  4XTY A;  4C8Q G;  3HFZ B;  4M77 E;  4M77 A;  3GIB A;  4P74 C;  4YRJ A;  4P3N A;  3ERR A;  3VQV A;  3A32 A;  2VXF A;  3RKX A;  4XTV A;  3TEG A;  3RER A;  3RIR A;  3A5Z A;  2ART A;  1EFW A;  4K87 A;  4WJ3 M;  4H2X B;  2RHS A;  3NET A;  4M77 G;  1YGB A;  5K1X A;  3V7S A;  3EFS A;  4M78 D;  1USY C;  4G84 A;  3JCM f;  4PHC A;  3VBB A;  3UFG A;  3L4G A;  3JCM h;  4F7U A;  1E22 A;  4JRK A;  1X2H A;  4CS3 A;  4N0A A;  4M7D B;  1WPY A;  3RKY A;  5GAN g;  2PME A;  3JCM b;  2DEQ A;  3JCM X;  3QO7 A;  2QHV A;  4P73 C;  3REX A;  4KR2 A;  5I21 A;  4HT8 A;  4X5O A;  3L2Z A;  1X54 A;  4EO4 A;  1KMM A;  1Y96 A;  4TWA A;  2E64 A;  3JCM c;  5GAO n;  3A5Y A;  4Q6G A;  4M7D C;  4E51 A;  2J3M A;  2ODR D;  2VC8 A;  2ZNJ A;  2DXT A;  3HXW A;  2RM4 A;  2RA2 A;  4MML A;  2RHQ A;  4Y91 A;  1X55 A;  2I4N A;  2CIM A;  5F5W A;  3P8T A;  2VXE A;  3HFZ A;  4J6X A;  4G85 A;  4HWR A;  5GAN 6;  1G5I A;  4M7A E;  2I4L A;  2ZGW A;  4KR3 A;  1YFS A;  4XTZ A;  1RIQ A;  5LJ5 g;  1USY A;  3A7U A;  5LJ5 j;  3RAC A;  1SER A;  5DY9 A;  4C8Q B;  5GAM d;  4KQE A;  1M8V A;  3BJU A;  3JCM e;  5GMK j;  1ASZ A;  2E10 A;  3IAL A;  3W3S A;  4DQ2 A;  3OD1 A;  3UGT A;  3SWN B;  2DDZ A;  4XEM A;  4M7A G;  1NNH A;  2C8M A;  4JRI A;  4C8Q C;  2YLC A;  4M75 F;  2ALY B;  4M7D A;  4YRF A;  2EAY A;  4CS4 A;  4H2Y A;  3E9H A;  3SWN C;  2G4C A;  3JB9 I;  4XQ3 A;  2DU7 A;  1H64 1;  5GAM h;  4H2V A;  4XEO A;  1W66 A;  2E41 A;  1HC7 A;  4M78 E;  4M7D G;  4YCU A;  3AHU A; 
#chains in the Genus database with same CATH topology
 3UF4 A;  4LNS A;  2BKD N;  4FT4 A;  2DM1 A;  1SSH A;  1UGR B;  5DLQ E;  1YJ9 Q;  1XTD A;  4M75 D;  2D0N A;  2DD4 A;  1TTH B;  4H2W A;  4DBR A;  3A8L B;  4A4K A;  1G3S A;  1GCP A;  3MHX A;  3QG1 A;  3HP9 A;  2Y90 A;  3CC4 A;  4Q5W A;  4Z02 A;  1K8A U;  1W70 A;  5ECA A;  1IGU A;  1LYL A;  1QE0 A;  1QQJ A;  1UGP B;  3PGG A;  2BIV A;  4XU3 A;  3JB9 H;  5GAN f;  2YUP A;  3QYG B;  2VV5 A;  2O9V A;  3ME9 A;  4OF1 A;  4EMG A;  2YDL A;  2EJG A;  3SWN A;  1R8O B;  2F5T X;  3VKI A;  1G3T A;  1T0H A;  2XDB A;  2DQ0 A;  3RNJ A;  3HRS A;  2CP6 A;  4O2D A;  5LJ5 d;  4AH6 A;  1VQK A;  4OB1 B;  4MMK A;  3JCM Q;  4BWA A;  1OV3 A;  4EMK C;  1OUL A;  3FB9 A;  2DL4 A;  3A74 A;  2ZXF A;  4WJ4 A;  4MZM A;  4KUL A;  2OI3 A;  1QP3 A;  4KGZ B;  2RNA A;  5LJ5 f;  3S3N A;  1C6V X;  4RDX A;  2ZZE A;  3M4P A;  5LJ5 h;  2Q7H A;  5C53 B;  1ZSG A;  4E7I A;  3PMT A;  1K9M U;  1FMW A;  2M51 A;  2GNC A;  4DEX A;  3MQZ A;  1JXO A;  5GMK h;  1PC0 A;  2FEI A;  2LT4 A;  3UA6 A;  1Y07 A;  3VYH B;  2XTI A;  3FRN A;  4X9D A;  1MGQ A;  2A8E A;  3PZC A;  4KRT A;  3PMI A;  3CCV A;  4LDY A;  2E5A A;  4CS2 A;  3VS6 A;  2CZ7 B;  3G7Z A;  3CMA A;  3M4Y A;  1R0B G;  2AKW A;  2O4X A;  2FPE A;  2JZ2 A;  4BD3 A;  2AKK A;  2OTJ A;  1QVG P;  4P72 C;  4RMF A;  1SES A;  1QP2 A;  3BDU A;  4M75 G;  2KNB B;  4QKU A;  1I5L A;  2C7I A;  3I7F A;  1M90 C;  2DZ9 A;  4E7L A;  3DLM A;  3MCA B;  4EIK A;  4YRK A;  4DBQ A;  5DM7 R;  2Q7E A;  2EYQ A;  3CCM Q;  3VS3 A;  3PTA A;  1Q81 C;  2QHU A;  4YDQ A;  2BZ8 A;  1KSW A;  1M9S A;  1Y71 A;  2O9S A;  1RAH B;  4FYV B;  2K2M A;  3VYG A;  5CCA A;  3M58 A;  4PNO A;  5GAO l;  4YPF A;  1OZ3 A;  1SHF A;  2KXD A;  4P5N A;  3I55 Q;  1BCM A;  5GAN 5;  3G71 A;  4C92 E;  2CJA A;  4M78 A;  1LPL A;  4IKF A;  3HRK A;  3VUZ A;  2JUF A;  1UDL A;  4JZ4 A;  1KQ2 A;  2O31 A;  8ATC B;  3JSC A;  1TS9 A;  2MWO A;  4ZTU B;  2LJ0 A;  1OU9 A;  1WXU A;  2CUD A;  3RES A;  3OMC A;  3TEH A;  2K5L A;  2LX9 A;  1VQO Q;  2Q7G A;  2ZAE A;  4YRT A;  1B34 B;  1KK7 A;  1VQL Q;  2J6O A;  1Z9Z A;  4ZTJ A;  2CSQ A;  1J3T A;  3CCL T;  2F1L A;  4X1V A;  3DKM A;  1Q7Y U;  1Q82 U;  2YRD A;  4ZNX A;  1C0M A;  3OY9 A;  2C06 A;  2CT3 A;  4BI4 A;  2F69 A;  3X26 B;  2JTF A;  3S3O A;  2OTL A;  4TVW A;  1KQS S;  1GBQ A;  3UA7 A;  3CXC A;  2ZPE B;  5GAO r;  4JUV A;  4EMK B;  1D3B B;  5GAM e;  3LSS A;  3CPW P;  3PFS A;  1ZLM A;  3CCJ Q;  3LC0 A;  2X4Y A;  1N8R U;  2LTO A;  3I5R A;  3ZBD A;  4RTZ A;  2LQW A;  3CCQ T;  3ZL7 C;  1VQP Q;  2P0K A;  1JJ2 S;  4J8O A;  1SF9 A;  3E9F A;  3V7R A;  1ZUY A;  1NYR A;  3QSU A;  4P71 C;  2H8H A;  3D7S B;  1HD3 A;  1YCS B;  1V76 A;  5GAN 8;  1NBE B;  4M7D D;  4PJL A;  1BK2 A;  2PMF A;  1BYM A;  2X51 A;  3FJP A;  4HVC A;  4IUP A;  1UUE A;  4ZN1 A;  3EGU A;  4JPB W;  3NEN A;  3GNG A;  3FEO A;  3MP1 A;  2QK0 A;  1VQN T;  1YFR A;  2DLP A;  4C5H A;  5EC7 A;  5FRM A;  2DA9 A;  1O9S A;  4F7U E;  3I56 T;  4EMH A;  1AWO A;  1PSE A;  3KFV A;  4YP0 A;  3HY0 A;  3SB2 A;  4LUE A;  3RMS A;  3BY7 A;  2DE0 X;  1S72 T;  1K9A A;  2J3L A;  1M2V A;  5GMK l;  1BB9 A;  3OBY A;  4J5Y A;  1KC8 C;  1IRX A;  3CC7 A;  4HVU A;  2GFA A;  1MMG A;  1PYS B;  3MET A;  1DJ7 B;  4C8Q D;  4YRL A;  2JNG A;  3JB9 J;  2G3R A;  4E7S A;  4YCW A;  5AT1 B;  4YYE A;  3G4S A;  1KOG A;  3T9N A;  3H6Z A;  2A36 A;  5LJ5 e;  4A4F A;  3CCR A;  2COZ A;  2QEX T;  2KRN A;  1B70 B;  4YRG A;  4QVZ A;  3HRI A;  1E1O A;  2DVJ A;  1SHG A;  4MDX A;  1VQ7 T;  3RUX A;  1VQ6 Q;  4LE9 A;  2E4H A;  2R57 A;  3E2U A;  3NGP A;  4JJC A;  1U06 A;  2EGC A;  3MKD A;  2VWF A;  1XJW B;  3OMG A;  4PJO C;  5CKH A;  4XK8 E;  4C92 A;  4A4G A;  1BBU A;  4ELZ C;  2RJD A;  2DYB A;  1D09 B;  2DZC A;  1Y7X A;  1B7T A;  1HK9 A;  2COY A;  2CJB A;  1SET A;  1Q82 R;  5KYU B;  1YJ9 T;  1M90 U;  3LWH A;  3J7A F;  3CC2 A;  2ESW A;  5FLX E;  3QNE A;  4YRC A;  4KGV B;  2FHD A;  2FO0 A;  4PJN A;  1Q81 U;  4OP0 A;  2DKG A;  3A7R A;  2KK4 A;  3NFC A;  4E6R A;  3JB9 G;  1T3S A;  1JJC A;  1XNI A;  2P5I A;  3E9I A;  3A8H B;  2DD5 A;  2AZV A;  4YRQ A;  1VUB A;  4HCC A;  3CCU Q;  5IH2 A;  2ZZG A;  2MWP A;  2YUN A;  1G3W A;  2JTE A;  1Y96 B;  1PD1 A;  1GCQ C;  2HDA A;  2DTI A;  1LVK A;  2IPO B;  2RI5 A;  4JJD A;  2NUZ A;  2QQR A;  1N27 A;  5CVI A;  3HY1 A;  4Z88 A;  1WYX A;  4MZT A;  3MEW A;  4M78 F;  4QVD A;  2BZY A;  3OYM A;  1YI2 Q;  4YRP A;  5KYN A;  3BW1 A;  4LDW A;  3RKW A;  4YRO A;  4XTY A;  4C8Q G;  1AT1 B;  4M77 A;  1WJS A;  1EIF A;  3RKX A;  4F04 B;  1M8M A;  1AHJ B;  3H9N A;  3A5Z A;  5I22 A;  4E7Z A;  4ZGE B;  2X3X D;  2M0O A;  2VGN A;  2FG0 A;  2K3B A;  3CCQ A;  4X34 A;  4M77 G;  3V7S A;  3JCM f;  1WI7 A;  1QWF A;  4ZTF A;  3JCM h;  4F7U A;  1H3H A;  3OYD A;  4JRK A;  1NM7 A;  5CIU A;  2RQV A;  4N0A A;  3C0C A;  3GPL A;  1WPY A;  1ARK A;  2YSQ A;  2DEQ A;  3KBG A;  1Q86 U;  3OS1 A;  2L8D A;  1W4S A;  2FPD A;  3M57 A;  1KMM A;  4N4G A;  2O01 E;  1PWT A;  2LCS A;  4Q6G A;  1K73 U;  3CBP A;  2YWW A;  3QJY A;  2VC8 A;  3HHT B;  2M16 A;  4OB0 B;  2RHQ A;  2JM8 A;  3J80 E;  3VRY A;  4L59 A;  2BUD A;  2AK5 A;  4IIM A;  3DLL A;  4Y92 A;  2VXE A;  2QQS A;  4L5G A;  3CCM T;  4J6X A;  4G85 A;  4HWR A;  4M7A E;  2ZPG B;  4FW1 A;  5A0G A;  1YFS A;  1RIQ A;  1USY A;  2K4Y A;  1VQ5 Q;  2WSE E;  3RAC A;  1M90 R;  4BI3 A;  3I55 T;  1ASZ A;  3A1P A;  5A2Q E;  4DQ2 A;  2PUK B;  3SWN B;  4R0K A;  2DDZ A;  4LUD A;  2JOY A;  1NNH A;  4JRP A;  3EHQ A;  4J9B A;  2JMC A;  1KD1 U;  2LJ1 A;  1Q81 R;  4BY6 B;  2QEX A;  2QA4 A;  4H2Y A;  1KQS P;  4JLG A;  3VS7 A;  4IUT A;  1VQ7 A;  3JB9 I;  4E7K A;  4H2V A;  2E41 A;  1VQO T;  1HC7 A;  1D1A A;  2A37 A;  1VQL T;  3JCM V;  3AHU A;  3M0P A;  4HWT A;  2CS7 A;  5J3B A;  4Z8A A;  3CCE Q;  5GAO q;  4HXJ A;  2ZIM A;  2CP3 A;  1HXD A;  4PKC C;  1YJ9 A;  2ED1 A;  2LQN A;  1N5Z A;  2DL7 A;  1VQ4 Q;  4AT1 B;  2KBT A;  2V8J A;  3A8G B;  3CCJ T;  2CT4 A;  1E7O A;  1OYX A;  2IIM A;  1LJO A;  2I4O A;  2XG8 D;  4C92 F;  1VQP T;  2XK0 A;  2AKW B;  2O4X B;  1B76 A;  4FYX B;  4HKE A;  1IZ6 A;  2ALY A;  4IUR A;  3OYK A;  1ACM B;  1PRL C;  3OS5 A;  2QAS A;  2V1R A;  4CH3 A;  3M5A A;  3OYJ A;  2HAX A;  2ZIN A;  2EIF A;  4FYW B;  4P3P A;  3I5S A;  5GAO m;  1ADJ A;  1WHG A;  2NS6 A;  5CO7 A;  3NEM A;  3SFM A;  1GFC A;  2J6K A;  4EPC A;  3TVT A;  1ATI A;  2HSE B;  3C94 A;  4OMO A;  5GMK i;  3MF2 A;  4J6W A;  4XU0 A;  2KVQ G;  3NMZ C;  3LGL A;  2KQW A;  2VUB A;  1H4T A;  2HKQ B;  1FMV A;  1HTT A;  2I2L A;  5C52 B;  4M78 B;  4DPG A;  4M75 E;  1NJI C;  2NUT A;  3HXV A;  2EL9 A;  2HL3 A;  4M77 F;  1B8A A;  1W2B S;  2FVU A;  1YJW Q;  1KC8 R;  2ROT A;  2XI9 A;  4PJO D;  3TEH B;  3MEU A;  1AOJ A;  4M7A A;  5E3I A;  3TRE A;  4HWP A;  3QKJ A;  2ARU A;  1UEC A;  1NLP C;  1VQ6 T;  1NYG A;  1W1F A;  3OSV A;  4RTT A;  4AFU C;  1NJ5 A;  2RI2 A;  1UG1 A;  4L87 A;  2M02 A;  2LMJ A;  2LZ6 B;  3V7C A;  1TU0 B;  3R6N A;  5GAN 3;  4F7U F;  4RTW A;  1E1T A;  1NJ2 A;  4P75 C;  2RQT A;  1U1T A;  2DBM A;  3CCM A;  1ADY A;  2HEQ A;  4OMF B;  1ZUU A;  4CC2 A;  3TUP A;  1D0X A;  4ATO A;  3MEY A;  2B8A A;  2DIQ A;  1JO8 A;  5GAM f;  3OYA A;  1WHK A;  2KYM A;  3HTZ A;  1FXX A;  1IHV A;  1NJ6 A;  2E3C A;  2KY9 A;  4JDS A;  2ZT6 A;  2YUQ A;  1EVL A;  4FSX A;  2NUP A;  1RAB B;  4J9H A;  2A08 A;  4LXC A;  1WHM A;  5FU7 C;  4LN2 A;  3LYI A;  3CBM A;  5FU6 B;  4CH5 A;  4LVI A;  4XTW A;  1WHH A;  3CCU T;  1G5H A;  5D6Y A;  2DU5 A;  2EJ9 A;  4YCV A;  2HMA A;  1YHQ Q;  5GMK m;  2HSP A;  1I81 A;  1KJW A;  1VQL A;  4BDZ A;  1BBW A;  2KSS A;  5FRO A;  4FSS A;  2AMC A;  2NYS A;  4K86 A;  4YRR A;  5HKC A;  3UH0 A;  1M2V B;  1VA7 A;  3WXM B;  1YI2 T;  4KGX B;  4HT9 A;  1TUG B;  3JV3 A;  1YIT A;  1SEM A;  2ZR2 A;  2IY5 A;  2G6F X;  1YJN A;  4N0A C;  3EFO B;  3X25 B;  2HD0 A;  5LJ3 g;  1MND A;  1X01 A;  1V1C A;  1H92 A;  1OX9 A;  4Q15 A;  2KRM A;  4PJO G;  1VQP A;  2AIR B;  3PVQ A;  2GTO A;  1X2G A;  2CP2 A;  3G1Z A;  2RK1 A;  4FYY B;  4FM4 B;  1P92 A;  4HWS A;  2VKN A;  1SRM A;  3SHW A;  2DL3 A;  4RTU A;  4RMO A;  2DJQ A;  5KE2 A;  2X35 A;  4FT2 A;  3MEV A;  1N9S A;  2FZK B;  2HBW A;  4C92 B;  2ZR3 A;  1OZ2 A;  2H3E B;  1IGQ A;  3HXY A;  2PVO B;  2R5M A;  2RPN A;  1IL2 A;  3O8V A;  4AG2 C;  4M75 A;  1X75 C;  3OS0 A;  4OMQ A;  1JXM A;  5GAN j;  4N4I A;  3TSW A;  3LH0 A;  1ZA1 B;  4LDV A;  2P0P A;  1F1B B;  3J81 E;  2ZZF A;  2JVV A;  1H4V B;  1TH7 A;  4D8D A;  2A0F B;  4ZGD B;  5HCK A;  4N4H A;  3EHR A;  5KCO A;  1VQ5 T;  1XOV A;  1IHW A;  3VJP A;  1JJC B;  1ASY A;  3OYC A;  1VQ9 Q;  2E5K A;  1S1N A;  2HZY A;  4UPA A;  3EH2 A;  1RLP C;  2EYX A;  3X24 B;  4LVM A;  4NL3 A;  2Y4X A;  1E24 A;  1NJI U;  2MMP A;  1VQ6 A;  3CD6 T;  5FU7 B;  1EIY A;  1NE8 A;  2DRK A;  1MV3 A;  2KRS A;  2ABL A;  5LL6 S;  1KQ1 A;  3PNW C;  2F2V A;  3CQT A;  2YHT A;  4QT7 A;  4M7D E;  4M77 B;  4VUB A;  3UAT A;  3OYG A;  3CCE T;  3EGX A;  4TQF A;  1MV0 B;  1QLY A;  2PZ1 A;  2ZT7 A;  5L23 A;  5C6S A;  4M7A F;  3A5Z B;  1Q95 G;  4B9W A;  4C0D C;  2ARS A;  1VQ4 T;  2YRC A;  1D1C A;  5FWB A;  4RG8 A;  1VQ8 Q;  1RAD B;  4RQF A;  1W6X A;  4A4H A;  2DX1 A;  4BE1 A;  3M0Q A;  4F7U B;  2V1Q A;  1G8X A;  4QW2 A;  4TVY A;  2ECZ A;  4PG3 A;  2AKL A;  4J83 A;  3CCU A;  2CP0 A;  1JQQ A;  1Z7N A;  4C8Q E;  2A7Y A;  1XQH A;  1QVG A;  1K0X A;  4JJB A;  4E7J A;  3EH1 A;  2CH4 W;  2O2O A;  2ZPB B;  5EG2 A;  2E6Z A;  2RHQ B;  2FRW A;  1BI0 A;  3Q1J A;  1K0S A;  2D0Q B;  2E3I A;  4C0G A;  1VQK Q;  2CZ1 B;  3LH5 A;  2MPX C;  3REB B;  4M77 E;  4YRJ A;  2IG0 A;  1QVF S;  3ERR A;  4HCK A;  4Z89 A;  3FLG A;  1M27 C;  4XTV A;  3TEG A;  3RER A;  1VYV A;  2RMO A;  2RN8 A;  1W2B P;  2FL7 A;  3EGD A;  2LX7 A;  4K87 A;  2YT6 A;  3LW5 E;  5K1X A;  1ZA2 B;  4PHC A;  5CK9 A;  1I0C A;  4B6M A;  2JS2 A;  4CS3 A;  2HQE A;  4DOV A;  5GAN g;  2PME A;  1UHC A;  2QHV A;  4RG2 A;  4J9C A;  3URG A;  4QQG A;  5FW9 A;  1YJW T;  4EO4 A;  4PJM A;  3QWX X;  2PNI A;  1K4U S;  1G83 A;  3EFO A;  1QMC A;  1X6O A;  3CMA Q;  2ZNJ A;  1AVZ C;  2DXT A;  2CP5 A;  1NJI R;  2LQK A;  4O6J A;  2MYS A;  2EGE A;  4FL6 A;  5L8R E;  4Y91 A;  2OTJ Q;  1X55 A;  3MO8 A;  4GBQ A;  2QAZ A;  2CH4 A;  4EDU A;  2JMA A;  2LNV A;  2XU8 A;  1NEG A;  2L5Q A;  1T3L A;  5LJ5 g;  3G1J A;  4JS4 A;  1VIF A;  5KE3 A;  3LGF A;  2EGA A;  4ZGJ B;  3CPW A;  1PG5 B;  1M8V A;  1RLQ C;  1VQ5 A;  2KR3 A;  4E7H A;  2EW3 A;  4E2F B;  1MMN A;  3W3S A;  1PRM C;  1IRE B;  3ULR B;  2C8M A;  1AWX A;  4C0F A;  4C0D B;  5KYW A;  2YLC A;  4M75 F;  2ALY B;  4M7D A;  5GJV B;  2EAY A;  1MMA A;  3SWN C;  2VYT A;  4J9G A;  2VB6 A;  2G4C A;  2DU7 A;  1H64 1;  1X43 A;  4OVA A;  4BY6 C;  2EQK A;  1TUC A;  1W66 A;  2BZX A;  1I5O B;  1YHQ T;  4M7D G;  4YCU A;  1AZE A;  3E19 A;  2Z0W A;  2XKO C;  1H8K A;  4B9X A;  1RAG B;  1WA7 A;  1JBM A;  2W0Z A;  1I4K 1;  3C12 A;  2KAF A;  2L2P A;  4GY5 A;  5J39 A;  3GBQ A;  5GAO p;  2EVR A;  2GF7 A;  2FZG B;  3EG9 A;  3CCE A;  3WVE B;  3E1S A;  2ZT5 A;  4DBH A;  3VS4 A;  1U1S A;  4A4E A;  1BKB A;  3JAM E;  1UEB A;  4C8Q A;  1EVK A;  3L2U A;  2RHU A;  3TQ7 P;  4NOY A;  3VS5 A;  1K76 A;  2OTL Q;  3CCL A;  2DQ3 A;  2PU9 B;  1CKA A;  4XU2 A;  5KYY A;  2NUT B;  2FZC B;  3TCJ A;  2EYZ A;  5GJW B;  3OW2 A;  2ZCF B;  1WLE A;  2A28 A;  1FYN A;  2EYY A;  4M7A B;  3H41 A;  4IUQ A;  2QGG A;  2P4T A;  1M3B A;  3KUF A;  3A7A A;  2XMF A;  4YRN A;  2LT1 A;  4ORZ A;  3FC3 A;  1SSF A;  1I1J A;  1C1A A;  2SEM A;  4ZN3 A;  1VYT A;  5CR2 A;  2GCX A;  5GAN 4;  4M4Z A;  2LP5 A;  2CZ0 B;  1OOT A;  3A31 A;  4OGC A;  1J5W A;  4AFZ C;  4JRQ A;  3X28 B;  3CBO A;  1VQN A;  1X27 A;  2RQW A;  1YNZ A;  3UWN A;  1R77 A;  1PNJ A;  4KH0 B;  1WU7 A;  2NUP B;  5KH6 A;  1M1G A;  2EKH A;  2JTM A;  2ZZD A;  3I56 A;  4NCX A;  1YWO A;  1VQ9 T;  2QQ9 A;  3EFR A;  4RCC A;  3QHS A;  4DA4 A;  5GAN 7;  1PKT A;  2QDL A;  1S72 A;  2DVE A;  4J7F A;  4M78 C;  3CC7 Q;  2DTO A;  3M4G A;  2OAW A;  1YJW A;  1VQZ A;  2KYB A;  3RDV A;  3IKL A;  3HFO A;  1ZBJ A;  3G4S Q;  3EG1 A;  5CKF A;  1ZQ1 A;  2FPF A;  2L3R A;  4ZTZ B;  5AYF A;  3TSZ A;  3CCR Q;  1M1K C;  2EFI A;  4H02 A;  1QF6 A;  1KC8 U;  2AMC B;  4P73 A;  2VAS A;  4TVA A;  2EPD A;  1OI1 A;  2RO0 A;  2COW A;  5CQY A;  2EBP A;  2I4M A;  4KBM B;  5LJ3 d;  1QW1 A;  2IY5 B;  8AT1 B;  2GTJ A;  3H8Z A;  3CD6 Q;  1IO6 A;  3LSQ A;  2QTV A;  1UFF A;  3M59 A;  4OML A;  4WF2 A;  3CXC S;  1RAI B;  2QHS A;  2FRY A;  1VQ8 T;  3RL6 A;  3UGQ A;  4MZP A;  2NLU A;  4P72 A;  1K8A C;  4BW9 A;  3WQZ A;  3HSB A;  1TG0 A;  2K9G A;  4BE0 A;  3QUI A;  4QVC A;  1WX6 A;  4WCI A;  2DF6 A;  1H3Z A;  1VQM Q;  3QO5 A;  4GLM A;  4NS5 A;  5D7U A;  1QVF P;  4X9C A;  2DIG A;  2RHS B;  2C0O A;  5FU6 C;  2JW4 A;  2MAM A;  4RTY A;  1YFT A;  1C0A A;  5IHN A;  4DEY A;  1YN8 A;  2LDM A;  1B7Y A;  1LNX A;  1WHJ A;  2KEA A;  4UP9 A;  2OX7 A;  3MP8 A;  3M54 A;  4M75 B;  2DEU A;  4AG1 C;  2B86 A;  3GLX A;  1V29 B;  1WJR A;  1VQK T;  2M0Y A;  3M4Q A;  4M7D F;  3JB9 F;  4KH1 B;  1WYD A;  2ED0 A;  1WNL A;  1G2B A;  2GQV A;  4PJO E;  2F2W A;  4PJJ A;  1G5V A;  1QCN A;  2L0A A;  2VGM A;  3U23 A;  4A53 A;  4JLI A;  1PM3 A;  3EG2 A;  4PK4 A;  2CUB A;  5LJ3 j;  4CH4 A;  2WSC E;  1K9M C;  2DFU A;  4PLI A;  2J06 A;  2PQW A;  1QCO A;  5GAN 2;  5K1P A;  2V8K A;  2ZPF B;  1WGS A;  1NZ9 A;  3UT1 A;  2AT1 B;  4AFS C;  2P4R A;  3I9Q A;  2KI7 A;  3CEY A;  3C95 A;  3NEL A;  2LCC A;  1KQS A;  3A8M B;  4C8Q F;  4K88 A;  3CCS Q;  1EIY B;  4JJN K;  5HK0 A;  2E1H A;  2KT1 A;  3CMA T;  2DPP B;  3QPH A;  1UGS B;  1G51 A;  5CQX A;  3R07 A;  3VS2 A;  2OTJ T;  3EGX B;  2ROL A;  2YRV A;  4C92 C;  3PCO A;  1MMD A;  1JJ2 A;  1GXI E;  2BE7 D;  3ZFJ A;  1M5Q 1;  3OYI A;  4P71 A;  4LDU A;  2MOX A;  2J7I A;  1YB3 A;  1PSF A;  1MHN A;  3IQL A;  3RGL A;  4CH6 A;  2DXC A;  4FCY A;  2C0I A;  1Z7M A;  4RQE A;  3HXZ A;  3PIP A;  2MCN A;  1VQ9 A;  3NTI A;  2EQJ A;  4J9I A;  3F70 A;  3P8V A;  1YIJ Q;  5DLO A;  1RI9 A;  4J6Y A;  2ZPI B;  2GBQ A;  4CC7 A;  2HNI A;  4R56 A;  3P8B B;  2QG9 B;  2JXB A;  3JCM g;  4E47 A;  1M4Z A;  3PT9 A;  3QTC A;  3L2V A;  4PFO A;  1A0N B;  2DXB A;  3VU3 C;  1OPK A;  2K6D A;  3MJX A;  3S6W A;  2PUO B;  3I55 A;  2DNU A;  1M1F A;  1QKW A;  4HVW A;  1YCY A;  4TVR A;  5C0M A;  5IT9 E;  2QA4 Q;  1KFZ A;  4ME7 A;  1VIE A;  4JS5 A;  2RD1 A;  3EG0 A;  2RHZ A;  1WXB A;  3OYN A;  2XDP A;  1GFD A;  1GRI A;  1PCX A;  1QKX A;  1Q7Y C;  1KIK A;  4QQD A;  1FYF A;  2ZT8 A;  2D8J A;  3DSQ A;  2HL5 C;  5I2S A;  3P8H A;  3EGD B;  4M77 C;  1EOV A;  2ENM A;  1VQO A;  4TTV A;  1VQ8 A;  3H0I A;  3QO3 A;  5IHK A;  5GAN d;  1NPP A;  1YP5 A;  1ZUK A;  2PVD B;  2RHX A;  1N8R C;  2OTL T;  2DAQ A;  1RAF B;  4HT4 A;  2DO3 A;  4C5I A;  3HFV A;  3EG3 A;  4PJO A;  4YRM A;  1IB8 A;  4QQ6 A;  3RF1 A;  4HCB A;  3CCJ A;  3EAE A;  1GGM A;  3QDF A;  3M0U A;  1RI0 A;  5IN1 A;  5GAN h;  5GAM j;  4UP7 A;  5LJ3 e;  2ZIO A;  4IUV A;  3VV0 A;  3GIB A;  1PHT A;  2WSF E;  3VQV A;  3A32 A;  2VXF A;  1ZX6 A;  3C4S A;  4WJ3 M;  3QXE B;  3A8O B;  4H2X B;  2RHS A;  4RKU E;  3NET A;  1RAC B;  2QYZ A;  1YGB A;  1AWJ A;  1OU8 A;  3EFS A;  4M78 D;  1USY C;  3VBB A;  3UFG A;  3L4G A;  2P84 A;  2J6F A;  4J9E A;  4MDW A;  5KYW B;  2E6N A;  1GCQ A;  1ZSZ B;  4M7D B;  3RKY A;  3JCM b;  1D0Y A;  4P73 C;  5I21 A;  3CC7 T;  3L2Z A;  2W10 A;  1X54 A;  1WLP B;  4TWA A;  2E64 A;  3JCM c;  1MNE A;  5GAO n;  3A5Y A;  4PLL A;  3OBW A;  2QXF A;  5CKE A;  4E51 A;  4J7I A;  7AT1 B;  3HKS A;  3G4S T;  2RM4 A;  1GL5 A;  2IVW A;  3CME Q;  3OYY A;  3CXC P;  3CCR T;  3REA B;  2O88 A;  2DER A;  2K2V A;  2E12 A;  4OGE A;  2I4N A;  5F5W A;  3P8T A;  4RTV A;  3EG9 B;  2YUO A;  1B3Q A;  4OMN A;  3HFZ A;  3I35 A;  2XD0 A;  5GAN 6;  2ZGW A;  4KR3 A;  3A7U A;  4II1 A;  5LJ5 j;  1AWW A;  4C8Q B;  4KQE A;  2LCL A;  2XDD A;  4LD9 K;  5GMK j;  1M1K R;  1OQK A;  2E10 A;  2K3X A;  3IAL A;  1X69 A;  4AMC A;  1NYF A;  4XAX B;  3NTK A;  3UGT A;  3P8D A;  1TSF A;  5KYY B;  1BI2 A;  4JRI A;  1M3C A;  1EFN A;  5HY6 A;  5KCH A;  4YRF A;  3L2R A;  4CS4 A;  1X6G A;  1WZO A;  3JRZ A;  3NPF A;  3CC2 T;  1EZZ B;  3OS2 A;  2RJE A;  4XQ3 A;  4CC3 A;  2X9H A;  1OEB A;  3M53 A;  1VQM T;  5A0L A;  1YBY A;  4OB3 B;  3OYE A;  5KYX A;  3G6E Q;  4KUD K;  4XEO A;  2JJ9 A;  3KXT A;  3GF5 A;  2HCK A;  1RAE B;  1K8A R;  1SRY A;  4HVV A;  1ABQ A;  3H0F A;  2EKO A;  3OYB A;  3NTH A;  3CPF A;  1NJ1 A;  1HYO A;  2BTT A;  4LDX A;  1H4Q A;  4CRI A;  3QBY A;  2AZS A;  3MF1 A;  4M78 G;  2V26 A;  2YXY A;  1HSQ A;  3M0R A;  3CC4 Q;  2OJ2 A;  2H3J A;  4J15 A;  2JT4 A;  2E3H A;  2DJZ A;  4P3O A;  2L3S A;  4AFQ C;  2FYK A;  2K79 A;  3GNF B;  2QGF B;  5GAM g;  4OLF A;  1NG2 A;  3MEA A;  3FIF A;  4Y28 E;  4LNP A;  1NEB A;  1YIT Q;  1GBR A;  1E6G A;  4ANJ A;  1YI2 A;  1YJN Q;  1SG5 A;  2WAC A;  1M3A A;  1PKS A;  1X6B A;  2KGT A;  1FWZ A;  3GP8 A;  1SPK A;  4D8K A;  1K9M R;  5HK3 A;  2MIO A;  3SD4 A;  2X4W A;  4CI0 C;  4UP8 A;  1HJD A;  1M2O A;  4C92 D;  2LQ8 A;  4M7A C;  4FU6 A;  3CCS T;  1Q86 C;  3SEM A;  2MI6 A;  4YRS A;  4F17 A;  2CDT A;  3QYH B;  4TVA B;  2E70 A;  2CSI A;  2X4J A;  2JS0 A;  3BFM A;  3FDR A;  2XID A;  1K73 C;  2DK3 A;  2D9T A;  3JB9 D;  1BI3 A;  1KHC A;  5IAY A;  1UTI A;  4HA8 A;  1WJQ A;  2DL5 A;  3OYF A;  1I07 A;  2K7A A;  3M56 A;  3NHN A;  4JZ3 A;  4PJO F;  1NYQ A;  3M0S A;  5IXB A;  1QVP A;  5GAN e;  1M30 A;  3OSS C;  3CCV Q;  4HWO A;  1ABO A;  2E65 A;  2LNH B;  1BI1 A;  2EWN A;  2DYI A;  1BBZ A;  2GQI A;  1N9R A;  2ATC B;  2Q5I A;  4P74 A;  3PIO A;  3H0H A;  1G3Y A;  3QZ9 B;  2QTX A;  3O5Z A;  2QQB A;  1YIJ T;  1U3O A;  1SKU B;  2E5Q A;  3TEE A;  3S3M A;  1Z9Q A;  3SDZ A;  2KMT A;  2A3L A;  1KD1 C;  1X2Q A;  3UDC A;  3QJ6 A;  3GOX A;  2HKN A;  2CP7 A;  2VVK A;  4KUI A;  3HFN A;  2KE9 A;  3IG2 A;  2QI2 A;  4H2X A;  2ZPH B;  3INZ A;  1B7Y B;  3MPU B;  3OW2 P;  3X20 B;  2Y4Y A;  3LLR A;  2KXC A;  2EYW A;  4OMM A;  1EX4 A;  1PD0 A;  3L2W A;  3HTR A;  5GMK e;  3TU4 K;  2KDS A;  4O5V A;  1WHL A;  2ODR C;  2QA4 T;  1RAA B;  4M77 D;  1AD5 A;  1ZSZ A;  2L89 A;  1JRI A;  3IKM B;  4CC4 B;  3G71 Q;  4BE2 A;  3L42 A;  3CD6 A;  1U5S A;  2DIL A;  1W2B A;  1X56 A;  1UGQ B;  4PL6 A;  1BCO A;  4TQD A;  3V8K A;  2P0L A;  4LVJ A;  2PTK A;  1WXT A;  1Q7Y R;  2Q5H A;  4DOW A;  1WFW A;  1D1B A;  4C92 G;  1SRL A;  5ELO A;  4BB7 A;  1VQM A;  1KMN A;  3HL8 A;  1VQ4 A;  4C0Z A;  2P0Q A;  4OMP A;  1TOV A;  4P75 A;  4K11 A;  3VS1 A;  1N8R R;  4XTX A;  3HXU A;  3LX7 A;  1BIA A;  3OYH A;  3QWY A;  4WTO B;  1FMK A;  4WI1 A;  2RF0 A;  1JB0 E;  4L6V 5;  3PCO B;  4OB2 B;  2M1H A;  2PVG B;  4F14 A;  1O75 A;  2RQU A;  1YFN A;  4M75 C;  1K1Z A;  2RK2 A;  3HRU A;  1OX8 A;  2YLB A;  5J26 A;  2F5K A;  1KHI A;  2RB6 A;  1UE9 A;  5ELN A;  2I0N A;  1NJ8 A;  2QHT A;  3JCM d;  2XGT A;  4KT0 E;  2CZ6 B;  3PE0 A;  2CJ9 A;  1WQW A;  3E9G A;  5C51 B;  3V8L A;  4YRI A;  4ESR A;  1AEY A;  4H2S A;  1TUD A;  1BIB A;  4ELY C;  4XTU A;  1N6A A;  4J9D A;  1RL2 A;  1BU1 A;  4LD6 A;  1B34 A;  3ER0 A;  1L0W A;  3DB3 A;  4A54 A;  1JU5 C;  3CCS A;  1H4S A;  5CKB A;  3A98 A;  3V8J A;  3CME T;  3OYL A;  2ZCE A;  2RH2 A;  3QII A;  2HBP A;  2M9U A;  4NL2 A;  4D6W A;  2ZTG A;  4EMK A;  1WDX A;  1D3B A;  2HQX A;  3WVD B;  4EX5 A;  5I2M A;  4F7U G;  1I8F A;  3HXX A;  1YWP A;  2D8H A;  3QO8 A;  4H2U A;  5FRN A;  4IIO A;  4V2S A;  3THK A;  3ZEH A;  4RCB A;  2MK5 A;  5I11 A;  2L3P A;  2RQR A;  1B07 A;  2SRC A;  2ZNI A;  11AS A;  1Y0M A;  2LJ3 A;  1Y57 A;  5A0D A;  2L3Q A;  1KG1 A;  3JCM P;  5HGQ A;  1YIJ A;  2EQM A;  3MP6 A;  6AT1 B;  4PJO B;  2EQU A;  1LCK A;  1VYU A;  5D6W A;  4BDY A;  4H2T A;  3DB4 A;  2LRQ A;  2RHI A;  1OPL A;  4ZIB A;  2HQH A;  3G6E T;  1X2K A;  2RHY A;  2R5A A;  2KRO A;  2QQA A;  5KNN A;  3JCM W;  1UGV A;  2DXU A;  2EQI A;  1QCF A;  1QVG S;  5LJ3 f;  3CC2 Q;  1RUW A;  5LJ3 h;  4BAC A;  2DL8 A;  4C5G A;  5CAI A;  2QDY B;  4IUU A;  2D6F A;  1TWB A;  4XU1 A;  2K57 A;  5CKD A;  3VQW A;  3CC4 T;  3L1A A;  1PYS A;  1CSK A;  3P8Y A;  4PFP A;  12AS A;  4LVL A;  1YHQ A;  3VQY A;  1R0C B;  2CRE A;  3L4G B;  1N9W A;  3QDR B;  3JCM J;  3ICA A;  1WQ7 A;  1EQR A;  2DBK A;  1JJ2 P;  2JN0 A;  3VS0 A;  4UC4 A;  4YTL A;  1YIT T;  1B70 A;  2FB7 A;  4M7A D;  1YJN T;  2DTH A;  3VRZ A;  1LOJ A;  3BDL A;  2DRM A;  4PFZ A;  3VQX A;  2XHC A;  2V8I A;  3CCL Q;  4YRE A;  4A63 B;  1U8R A;  9ATC B;  3KFU A;  3M0T A;  3REU A;  2EJF A;  2CGH A;  2X4X A;  2AHJ B;  2K3Y A;  3CMQ A;  1QWE A;  2C0T A;  2LVM A;  4LVK A;  3VUB A;  3HFZ B;  4P74 C;  4P3N A;  5KYU A;  2CYZ B;  4HCZ A;  3RIR A;  2ART A;  3CCQ Q;  1EFW A;  3RR6 A;  2KT8 A;  1Q86 R;  3HRT A;  1TXQ A;  3CCV T;  1WIE A;  4G84 A;  4RTX A;  4FW2 A;  1VOM A;  1K73 R;  2CKK A;  1E22 A;  1ZBX A;  4F16 A;  3R6O A;  2DET A;  2DMO A;  4C5E A;  4BI8 B;  3CPW S;  1IXD A;  1X2H A;  2F2X A;  1AZG B;  2XIC A;  3M9Q A;  3OQ5 A;  4FIB A;  2LC4 A;  3JCM X;  3QO7 A;  3REX A;  4KR2 A;  4HT8 A;  1VQN Q;  3ASK A;  4X5O A;  2RI3 A;  2K5I A;  2BE9 B;  1Y96 A;  5KYX B;  1UJY A;  1ZSZ C;  4M7D C;  2J3M A;  2ODR D;  3FJ5 A;  3I56 Q;  3HXW A;  1QVF A;  2D1X A;  3AT1 B;  1MUZ A;  2RA2 A;  2X3W D;  1CKB A;  3QZ5 B;  4MML A;  3L2Q A;  2J05 A;  3PVL A;  1S72 Q;  2R58 A;  1T0J A;  3CME A;  3UPU A;  3HPW A;  1NLO C;  2CIM A;  5FWC A;  2GGR A;  2NWM A;  5IXF A;  1KD1 R;  1G5I A;  3OA6 A;  4GLK A;  2I4L A;  4XTZ A;  2GFU A;  3BE3 A;  1UB4 A;  1SER A;  5DY9 A;  5GAM d;  3M55 A;  3BJU A;  2RJC A;  5D6X A;  3LWI A;  1JEG A;  1FX7 A;  3JCM e;  3G71 T;  3RMQ A;  3OD1 A;  1UHF A;  1ZHI A;  4M7A G;  4XEM A;  2QEX Q;  4J9F A;  3RBB B;  1UJ0 A;  4BUG A;  4C8Q C;  5IHI A;  1VQ7 Q;  1D0Z A;  2K5F A;  3N5B B;  3E9H A;  1Q82 C;  4RUG A;  2OAU A;  1M1K U;  1E6H A;  4R55 A;  5GAM h;  4DBF A;  2JM9 A;  3OW2 S;  3G6E A;  2MF2 A;  4M78 E;  2RJF A;  1NPR A;  5M9O A;  3OB9 A; 
#chains in the Genus database with same CATH homology
 4LNS A;  2BKD N;  4FT4 A;  1UGR B;  5DLQ E;  1XTD A;  4M75 D;  2DD4 A;  4H2W A;  3A8L B;  4A4K A;  1G3S A;  3MHX A;  3QG1 A;  3HP9 A;  2Y90 A;  3CC4 A;  4Q5W A;  4Z02 A;  1K8A U;  1LYL A;  1QE0 A;  1UGP B;  3PGG A;  2BIV A;  4XU3 A;  3JB9 H;  5GAN f;  3QYG B;  2VV5 A;  3ME9 A;  4OF1 A;  4EMG A;  2EJG A;  3SWN A;  1R8O B;  2F5T X;  3VKI A;  1G3T A;  2XDB A;  2DQ0 A;  3HRS A;  4O2D A;  5LJ5 d;  4AH6 A;  1VQK A;  4OB1 B;  4MMK A;  3JCM Q;  4BWA A;  4EMK C;  3FB9 A;  3A74 A;  2ZXF A;  4WJ4 A;  4MZM A;  4KUL A;  1QP3 A;  5LJ5 f;  4RDX A;  3S3N A;  2ZZE A;  3M4P A;  5LJ5 h;  2Q7H A;  5C53 B;  4E7I A;  3PMT A;  1K9M U;  3MQZ A;  5GMK h;  2LT4 A;  1Y07 A;  3VYH B;  2XTI A;  3FRN A;  4X9D A;  1MGQ A;  2A8E A;  3PZC A;  3PMI A;  3CCV A;  4LDY A;  2E5A A;  4CS2 A;  2CZ7 B;  3G7Z A;  3CMA A;  3M4Y A;  2AKW A;  2O4X A;  2JZ2 A;  4BD3 A;  2OTJ A;  4P72 C;  4RMF A;  1SES A;  1QP2 A;  3BDU A;  4M75 G;  1NPR A;  1I5L A;  2C7I A;  3I7F A;  1M90 C;  2DZ9 A;  4E7L A;  3DLM A;  3MCA B;  4YRK A;  5DM7 R;  2Q7E A;  2EYQ A;  3PTA A;  1Q81 C;  2QHU A;  4YDQ A;  1M9S A;  1Y71 A;  3VYG A;  5CCA A;  3M58 A;  4PNO A;  5GAO l;  4YPF A;  1OZ3 A;  4P5N A;  5GAN 5;  3G71 A;  4C92 E;  2CJA A;  4M78 A;  4IKF A;  3HRK A;  3VUZ A;  2JUF A;  1KQ2 A;  3JSC A;  2MWO A;  4ZTU B;  3RES A;  3OMC A;  3TEH A;  2K5L A;  2LX9 A;  2Q7G A;  4YRT A;  1B34 B;  4ZTJ A;  3CCL T;  3DKM A;  1Q7Y U;  1Q82 U;  3OY9 A;  2C06 A;  4BI4 A;  2F69 A;  3X26 B;  2JTF A;  3S3O A;  2OTL A;  4TVW A;  1KQS S;  3CXC A;  2ZPE B;  5GAO r;  4JUV A;  4EMK B;  1D3B B;  5GAM e;  3LSS A;  3PFS A;  3LC0 A;  2X4Y A;  1N8R U;  2LTO A;  3ZBD A;  3CCQ T;  2P0K A;  1JJ2 S;  4J8O A;  3E9F A;  3V7R A;  4P71 C;  1NYR A;  3QSU A;  5GAN 8;  4M7D D;  2PMF A;  1BYM A;  3FJP A;  4HVC A;  4IUP A;  4ZN1 A;  3NEN A;  3GNG A;  3FEO A;  3MP1 A;  1VQN T;  1YFR A;  4C5H A;  5FRM A;  1O9S A;  4F7U E;  3I56 T;  4EMH A;  4YP0 A;  1PSE A;  3HY0 A;  3SB2 A;  3RMS A;  3BY7 A;  1S72 T;  2J3L A;  5GMK l;  3OBY A;  4J5Y A;  1KC8 C;  3CC7 A;  2GFA A;  1PYS B;  3MET A;  1DJ7 B;  4C8Q D;  4YRL A;  2JNG A;  3JB9 J;  2G3R A;  4YCW A;  4YYE A;  3G4S A;  1KOG A;  3T9N A;  3H6Z A;  5LJ5 e;  4A4F A;  3CCR A;  2QEX T;  1B70 B;  4YRG A;  4QVZ A;  3HRI A;  1E1O A;  4MDX A;  1VQ7 T;  3RUX A;  2R57 A;  3OMG A;  4PJO C;  5CKH A;  4XK8 E;  4C92 A;  4A4G A;  1BBU A;  4ELZ C;  2RJD A;  2DZC A;  1Y7X A;  1HK9 A;  2CJB A;  1SET A;  1YJ9 T;  1M90 U;  3LWH A;  3J7A F;  3CC2 A;  5FLX E;  3QNE A;  4YRC A;  2FHD A;  1Q81 U;  4OP0 A;  2DKG A;  3A7R A;  2KK4 A;  3NFC A;  3JB9 G;  1JJC A;  1XNI A;  2P5I A;  3E9I A;  3A8H B;  2DD5 A;  4YRQ A;  1VUB A;  4HCC A;  2ZZG A;  2MWP A;  1G3W A;  1Y96 B;  2DTI A;  2RI5 A;  2QQR A;  1N27 A;  5CVI A;  3HY1 A;  4MZT A;  3MEW A;  4M78 F;  4QVD A;  3OYM A;  4YRP A;  3BW1 A;  4LDW A;  3RKW A;  4YRO A;  4XTY A;  4C8Q G;  4M77 A;  1WJS A;  1EIF A;  3RKX A;  1AHJ B;  3A5Z A;  4ZGE B;  2M0O A;  2VGN A;  3CCQ A;  4X34 A;  4M77 G;  3V7S A;  3JCM f;  4ZTF A;  3JCM h;  4F7U A;  3OYD A;  4JRK A;  5CIU A;  4N0A A;  3GPL A;  1WPY A;  2DEQ A;  3KBG A;  1Q86 U;  3OS1 A;  2L8D A;  1W4S A;  3M57 A;  1KMM A;  4N4G A;  2O01 E;  4Q6G A;  1K73 U;  3CBP A;  3QJY A;  2VC8 A;  3HHT B;  2M16 A;  4OB0 B;  2RHQ A;  3J80 E;  2BUD A;  4L59 A;  3DLL A;  2VXE A;  2QQS A;  4L5G A;  3CCM T;  4J6X A;  4G85 A;  4HWR A;  4M7A E;  2ZPG B;  5A0G A;  1YFS A;  1RIQ A;  1USY A;  2K4Y A;  2WSE E;  3RAC A;  4BI3 A;  3I55 T;  1ASZ A;  5A2Q E;  4DQ2 A;  2PUK B;  3SWN B;  2DDZ A;  2JOY A;  1NNH A;  4JRP A;  1KD1 U;  4BY6 B;  2QEX A;  2QA4 A;  4H2Y A;  4JLG A;  4IUT A;  1VQ7 A;  3JB9 I;  4E7K A;  4H2V A;  2E41 A;  1VQO T;  1HC7 A;  1VQL T;  3AHU A;  3JCM V;  4HWT A;  2CS7 A;  5J3B A;  5GAO q;  2ZIM A;  1HXD A;  4PKC C;  1YJ9 A;  2V8J A;  3A8G B;  3CCJ T;  1OYX A;  1LJO A;  2I4O A;  2XG8 D;  4C92 F;  1VQP T;  2XK0 A;  2AKW B;  2O4X B;  1B76 A;  4HKE A;  1IZ6 A;  2ALY A;  4IUR A;  3OYK A;  3OS5 A;  4CH3 A;  3M5A A;  3OYJ A;  2HAX A;  2ZIN A;  2EIF A;  4P3P A;  5GAO m;  1ADJ A;  2NS6 A;  5CO7 A;  3NEM A;  3SFM A;  4EPC A;  1ATI A;  3C94 A;  5GMK i;  3MF2 A;  4J6W A;  4XU0 A;  2KVQ G;  3LGL A;  2KQW A;  2VUB A;  1H4T A;  1HTT A;  2I2L A;  5C52 B;  4M78 B;  4DPG A;  4M75 E;  1NJI C;  3HXV A;  2EL9 A;  4M77 F;  1B8A A;  1W2B S;  2FVU A;  2XI9 A;  4PJO D;  3TEH B;  3MEU A;  4M7A A;  5E3I A;  3TRE A;  4HWP A;  3QKJ A;  2ARU A;  1VQ6 T;  3OSV A;  1NJ5 A;  2RI2 A;  4L87 A;  3V7C A;  5GAN 3;  4F7U F;  1E1T A;  1NJ2 A;  4P75 C;  1U1T A;  3CCM A;  1ADY A;  4OMF B;  3TUP A;  4ATO A;  3MEY A;  2B8A A;  2DIQ A;  5GAM f;  3OYA A;  3HTZ A;  1FXX A;  1NJ6 A;  2E3C A;  2KY9 A;  4JDS A;  2ZT6 A;  1EVL A;  4FSX A;  5FU7 C;  3LYI A;  3CBM A;  5FU6 B;  4CH5 A;  4LVI A;  4XTW A;  3CCU T;  1G5H A;  5D6Y A;  2DU5 A;  2EJ9 A;  4YCV A;  5GMK m;  1I81 A;  1VQL A;  4BDZ A;  1BBW A;  2KSS A;  5FRO A;  2AMC A;  4YRR A;  4K86 A;  5HKC A;  3UH0 A;  3WXM B;  1YI2 T;  4HT9 A;  1YIT A;  2ZR2 A;  2IY5 A;  1YJN A;  4N0A C;  3X25 B;  2HD0 A;  5LJ3 g;  1X01 A;  4Q15 A;  4PJO G;  1VQP A;  1X2G A;  3G1Z A;  2RK1 A;  4FM4 B;  1P92 A;  4HWS A;  4RMO A;  5KE2 A;  2X35 A;  4FT2 A;  3MEV A;  1N9S A;  4C92 B;  2ZR3 A;  1OZ2 A;  3HXY A;  2PVO B;  2R5M A;  1IL2 A;  3O8V A;  4M75 A;  1X75 C;  3OS0 A;  5GAN j;  4N4I A;  3LH0 A;  4LDV A;  2P0P A;  3J81 E;  2ZZF A;  2JVV A;  1H4V B;  1TH7 A;  4ZGD B;  4N4H A;  5KCO A;  1VQ5 T;  1XOV A;  3VJP A;  1JJC B;  1ASY A;  3OYC A;  4UPA A;  3X24 B;  4LVM A;  4NL3 A;  2Y4X A;  1E24 A;  1NJI U;  2MMP A;  1VQ6 A;  3CD6 T;  5FU7 B;  1EIY A;  1NE8 A;  5LL6 S;  1KQ1 A;  3PNW C;  2YHT A;  4M7D E;  4M77 B;  4VUB A;  3OYG A;  3CCE T;  4TQF A;  2ZT7 A;  5C6S A;  4M7A F;  3A5Z B;  4B9W A;  4C0D C;  2ARS A;  1VQ4 T;  4RG8 A;  4RQF A;  4A4H A;  4BE1 A;  4F7U B;  4QW2 A;  4TVY A;  4PG3 A;  4J83 A;  3CCU A;  1Z7N A;  4C8Q E;  2A7Y A;  1XQH A;  1QVG A;  4E7J A;  2ZPB B;  5EG2 A;  2E6Z A;  2RHQ B;  1BI0 A;  3Q1J A;  2D0Q B;  4C0G A;  2CZ1 B;  4M77 E;  4YRJ A;  2IG0 A;  1QVF S;  3ERR A;  3FLG A;  4XTV A;  3TEG A;  3RER A;  2FL7 A;  4K87 A;  3LW5 E;  5K1X A;  4PHC A;  5CK9 A;  4CS3 A;  2HQE A;  4DOV A;  5GAN g;  2PME A;  2QHV A;  4RG2 A;  3URG A;  4QQG A;  1YJW T;  4EO4 A;  1X6O A;  2ZNJ A;  2DXT A;  2LQK A;  4O6J A;  4FL6 A;  5L8R E;  4Y91 A;  1X55 A;  3MO8 A;  4EDU A;  2LNV A;  2XU8 A;  2L5Q A;  5LJ5 g;  4JS4 A;  1VIF A;  5KE3 A;  3LGF A;  4ZGJ B;  3CPW A;  1M8V A;  1VQ5 A;  4E7H A;  3W3S A;  1IRE B;  2C8M A;  4C0F A;  4C0D B;  2YLC A;  4M75 F;  2ALY B;  4M7D A;  2EAY A;  3SWN C;  2VYT A;  2G4C A;  2DU7 A;  1H64 1;  4OVA A;  4BY6 C;  2EQK A;  1W66 A;  1YHQ T;  4M7D G;  4YCU A;  3E19 A;  2XKO C;  4B9X A;  1JBM A;  1I4K 1;  3C12 A;  2KAF A;  4GY5 A;  5J39 A;  5GAO p;  2GF7 A;  3CCE A;  3WVE B;  3E1S A;  2ZT5 A;  1U1S A;  4A4E A;  1BKB A;  3JAM E;  1UEB A;  4C8Q A;  1EVK A;  3L2U A;  2RHU A;  4NOY A;  3CCL A;  2DQ3 A;  2PU9 B;  4XU2 A;  3TCJ A;  3OW2 A;  2ZCF B;  1WLE A;  4M7A B;  4IUQ A;  2P4T A;  3KUF A;  3A7A A;  4YRN A;  2LT1 A;  3FC3 A;  1SSF A;  4ZN3 A;  5CR2 A;  2GCX A;  5GAN 4;  2CZ0 B;  3A31 A;  4OGC A;  1J5W A;  4JRQ A;  3X28 B;  3CBO A;  1VQN A;  3UWN A;  1WU7 A;  5KH6 A;  1M1G A;  2JTM A;  2ZZD A;  3I56 A;  4NCX A;  1VQ9 T;  2QQ9 A;  3EFR A;  4RCC A;  3QHS A;  4DA4 A;  5GAN 7;  1S72 A;  2DVE A;  4J7F A;  4M78 C;  2DTO A;  3M4G A;  1YJW A;  1VQZ A;  3IKL A;  3HFO A;  1ZQ1 A;  2L3R A;  4ZTZ B;  5AYF A;  1M1K C;  2EFI A;  4H02 A;  1QF6 A;  1KC8 U;  2AMC B;  4P73 A;  4TVA A;  1OI1 A;  2RO0 A;  5CQY A;  2I4M A;  4KBM B;  5LJ3 d;  1QW1 A;  2IY5 B;  3H8Z A;  3LSQ A;  3M59 A;  4WF2 A;  3CXC S;  2QHS A;  3RL6 A;  1VQ8 T;  3UGQ A;  4MZP A;  2NLU A;  4P72 A;  1K8A C;  4BW9 A;  3WQZ A;  3HSB A;  4BE0 A;  3QUI A;  4QVC A;  1H3Z A;  3QO5 A;  4NS5 A;  4X9C A;  2DIG A;  2RHS B;  5FU6 C;  2MAM A;  1YFT A;  1C0A A;  2LDM A;  1B7Y A;  1LNX A;  4UP9 A;  4M75 B;  3MP8 A;  3M54 A;  3GLX A;  1V29 B;  1WJR A;  1VQK T;  3M4Q A;  4M7D F;  3JB9 F;  1WYD A;  4PJO E;  1WNL A;  2GQV A;  1G5V A;  2VGM A;  4A53 A;  4JLI A;  5LJ3 j;  4CH4 A;  2WSC E;  1K9M C;  4PLI A;  2PQW A;  5GAN 2;  5K1P A;  2V8K A;  2ZPF B;  1WGS A;  1NZ9 A;  3UT1 A;  3CEY A;  3C95 A;  3NEL A;  2LCC A;  1KQS A;  3A8M B;  4C8Q F;  4K88 A;  1EIY B;  4JJN K;  5HK0 A;  2E1H A;  3CMA T;  2DPP B;  3QPH A;  1UGS B;  1G51 A;  5CQX A;  3R07 A;  2OTJ T;  4C92 C;  2YRV A;  3PCO A;  1JJ2 A;  1GXI E;  3ZFJ A;  1M5Q 1;  3OYI A;  4P71 A;  4LDU A;  1YB3 A;  1PSF A;  1MHN A;  3RGL A;  4CH6 A;  2DXC A;  1Z7M A;  4RQE A;  3HXZ A;  3PIP A;  1VQ9 A;  3NTI A;  2EQJ A;  3F70 A;  3P8V A;  5DLO A;  4J6Y A;  2ZPI B;  2HNI A;  4R56 A;  3P8B B;  3JCM g;  4E47 A;  1M4Z A;  3PT9 A;  3QTC A;  3L2V A;  2DXB A;  3VU3 C;  3S6W A;  2PUO B;  3I55 A;  1M1F A;  5C0M A;  1YCY A;  4TVR A;  5IT9 E;  4ME7 A;  1VIE A;  4JS5 A;  2RD1 A;  2RHZ A;  3OYN A;  2XDP A;  1Q7Y C;  4QQD A;  1FYF A;  2ZT8 A;  3DSQ A;  5I2S A;  3P8H A;  4M77 C;  1EOV A;  1VQO A;  4TTV A;  1VQ8 A;  3QO3 A;  5GAN d;  1NPP A;  2RHX A;  1N8R C;  2PVD B;  2OTL T;  2DAQ A;  4HT4 A;  2DO3 A;  4C5I A;  3HFV A;  4PJO A;  4YRM A;  4QQ6 A;  3RF1 A;  4HCB A;  3CCJ A;  3EAE A;  1GGM A;  1RI0 A;  5IN1 A;  5GAN h;  5GAM j;  4UP7 A;  5LJ3 e;  2ZIO A;  4IUV A;  3VV0 A;  3GIB A;  2WSF E;  3VQV A;  3A32 A;  2VXF A;  3C4S A;  4WJ3 M;  3QXE B;  3A8O B;  4H2X B;  2RHS A;  4RKU E;  3NET A;  1YGB A;  3EFS A;  4M78 D;  1USY C;  3VBB A;  3UFG A;  3L4G A;  4MDW A;  2E6N A;  4M7D B;  3RKY A;  3JCM b;  4P73 C;  5I21 A;  3CC7 T;  3L2Z A;  1X54 A;  4TWA A;  2E64 A;  3JCM c;  5GAO n;  3A5Y A;  4PLL A;  3OBW A;  2QXF A;  5CKE A;  4E51 A;  4J7I A;  3HKS A;  3G4S T;  2RM4 A;  2IVW A;  3OYY A;  3CCR T;  2K2V A;  2E12 A;  4OGE A;  2I4N A;  5F5W A;  3P8T A;  3HFZ A;  2XD0 A;  5GAN 6;  2ZGW A;  4KR3 A;  3A7U A;  4II1 A;  5LJ5 j;  4C8Q B;  4KQE A;  2LCL A;  2XDD A;  4LD9 K;  5GMK j;  2E10 A;  2K3X A;  3IAL A;  4XAX B;  3NTK A;  3UGT A;  3P8D A;  1BI2 A;  4JRI A;  5HY6 A;  5KCH A;  4YRF A;  3L2R A;  4CS4 A;  3JRZ A;  3CC2 T;  3OS2 A;  2RJE A;  4XQ3 A;  1VQM T;  3M53 A;  4KUD K;  5A0L A;  1YBY A;  4OB3 B;  3OYE A;  4XEO A;  3KXT A;  3GF5 A;  1SRY A;  2EKO A;  3OYB A;  3NTH A;  3CPF A;  1NJ1 A;  4LDX A;  1H4Q A;  4CRI A;  3QBY A;  3MF1 A;  4M78 G;  2H3J A;  4J15 A;  4P3O A;  2DJZ A;  2FYK A;  3GNF B;  5GAM g;  4OLF A;  3MEA A;  3FIF A;  4Y28 E;  1YI2 A;  2WAC A;  1FWZ A;  3GP8 A;  5HK3 A;  3SD4 A;  4CI0 C;  2X4W A;  4UP8 A;  4C92 D;  2LQ8 A;  4M7A C;  4FU6 A;  3CCS T;  1Q86 C;  4YRS A;  2MI6 A;  3QYH B;  4TVA B;  2E70 A;  3BFM A;  2X4J A;  3FDR A;  2XID A;  1K73 C;  2DK3 A;  2D9T A;  3JB9 D;  1BI3 A;  1KHC A;  5IAY A;  4HA8 A;  1WJQ A;  3OYF A;  3M56 A;  4PJO F;  1NYQ A;  1QVP A;  5GAN e;  3OSS C;  4HWO A;  2E65 A;  1BI1 A;  2EWN A;  2Q5I A;  1N9R A;  4P74 A;  3PIO A;  1G3Y A;  3QZ9 B;  2QTX A;  2QQB A;  1YIJ T;  2E5Q A;  3TEE A;  3S3M A;  3SDZ A;  2KMT A;  2A3L A;  1KD1 C;  3UDC A;  3QJ6 A;  3GOX A;  4KUI A;  3HFN A;  3IG2 A;  4H2X A;  2QI2 A;  2ZPH B;  3INZ A;  1B7Y B;  3X20 B;  2Y4Y A;  3LLR A;  3L2W A;  5GMK e;  3TU4 K;  2KDS A;  4O5V A;  2ODR C;  2QA4 T;  4M77 D;  2L89 A;  1JRI A;  3IKM B;  4BE2 A;  3L42 A;  3CD6 A;  1W2B A;  1X56 A;  1UGQ B;  4PL6 A;  4TQD A;  3V8K A;  2P0L A;  4LVJ A;  2Q5H A;  4DOW A;  4C92 G;  5ELO A;  4BB7 A;  1VQM A;  1KMN A;  3HL8 A;  1VQ4 A;  4C0Z A;  2P0Q A;  4P75 A;  4XTX A;  3HXU A;  3LX7 A;  1BIA A;  3OYH A;  4WI1 A;  1JB0 E;  4L6V 5;  3PCO B;  4OB2 B;  2M1H A;  2PVG B;  1O75 A;  4M75 C;  2RK2 A;  3HRU A;  2YLB A;  5J26 A;  2F5K A;  1KHI A;  2RB6 A;  5ELN A;  1NJ8 A;  2QHT A;  3JCM d;  2XGT A;  4KT0 E;  2CZ6 B;  2CJ9 A;  1WQW A;  3E9G A;  5C51 B;  3V8L A;  4YRI A;  4H2S A;  1BIB A;  4ELY C;  4XTU A;  1N6A A;  1RL2 A;  4LD6 A;  1B34 A;  3ER0 A;  1L0W A;  3DB3 A;  4A54 A;  3CCS A;  1H4S A;  5CKB A;  3V8J A;  3CME T;  3OYL A;  2ZCE A;  2RH2 A;  3QII A;  2HBP A;  2M9U A;  4NL2 A;  4D6W A;  2ZTG A;  4EMK A;  1D3B A;  2HQX A;  3WVD B;  4EX5 A;  5I2M A;  4F7U G;  1I8F A;  3HXX A;  3QO8 A;  4H2U A;  5FRN A;  4V2S A;  3ZEH A;  4RCB A;  2ZNI A;  11AS A;  5A0D A;  1KG1 A;  3JCM P;  5HGQ A;  1YIJ A;  2EQM A;  3MP6 A;  4PJO B;  2EQU A;  5D6W A;  4BDY A;  4H2T A;  3DB4 A;  2LRQ A;  2RHI A;  4ZIB A;  3G6E T;  2RHY A;  2R5A A;  2QQA A;  5KNN A;  3JCM W;  2DXU A;  1QVG S;  5LJ3 f;  5LJ3 h;  4BAC A;  4C5G A;  5CAI A;  2QDY B;  4IUU A;  2D6F A;  4XU1 A;  2K57 A;  5CKD A;  3VQW A;  3CC4 T;  3L1A A;  1PYS A;  3P8Y A;  4LVL A;  12AS A;  1YHQ A;  3VQY A;  3L4G B;  1N9W A;  3QDR B;  3JCM J;  3ICA A;  1WQ7 A;  1EQR A;  2JN0 A;  4UC4 A;  4YTL A;  1YIT T;  1B70 A;  2FB7 A;  4M7A D;  1YJN T;  2DTH A;  1LOJ A;  3BDL A;  3VQX A;  2XHC A;  2V8I A;  4YRE A;  1U8R A;  3KFU A;  3REU A;  2EJF A;  2CGH A;  2X4X A;  2AHJ B;  2K3Y A;  3CMQ A;  2LVM A;  4LVK A;  3VUB A;  3HFZ B;  4P74 C;  4P3N A;  2CYZ B;  4HCZ A;  3RIR A;  2ART A;  1EFW A;  3HRT A;  3CCV T;  4G84 A;  2CKK A;  1E22 A;  1ZBX A;  3R6O A;  4C5E A;  4BI8 B;  3CPW S;  1X2H A;  2XIC A;  3M9Q A;  3OQ5 A;  4FIB A;  2LC4 A;  3JCM X;  3QO7 A;  3REX A;  4KR2 A;  4HT8 A;  3ASK A;  4X5O A;  2RI3 A;  2K5I A;  1Y96 A;  4M7D C;  2J3M A;  2ODR D;  3HXW A;  1QVF A;  3QZ5 B;  2RA2 A;  4MML A;  3L2Q A;  2R58 A;  3CME A;  3UPU A;  3HPW A;  2CIM A;  1G5I A;  3OA6 A;  4GLK A;  2I4L A;  4XTZ A;  2GFU A;  1UB4 A;  1SER A;  5DY9 A;  5GAM d;  3M55 A;  3BJU A;  2RJC A;  5D6X A;  3LWI A;  1FX7 A;  3JCM e;  3G71 T;  3RMQ A;  3OD1 A;  1ZHI A;  4M7A G;  4XEM A;  4BUG A;  4C8Q C;  2K5F A;  3N5B B;  3E9H A;  1Q82 C;  2OAU A;  1M1K U;  4R55 A;  5GAM h;  3OW2 S;  3G6E A;  2MF2 A;  4M78 E;  2RJF A;  5CKF A;  5M9O A;  3OB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...