2CGHA

Crystal structure of biotin ligase from mycobacterium tuberculosis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
238
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOTIN LIGASE
publication title Active Site Conformational Changes Upon Reaction Intermediate Biotinyl-5'-AMP Binding in Biotin Protein Ligase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 82
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cghA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2cghA01
5K1PA 4BWAA 2VC8A 4P74A 4PHCA 4C92A 2ODRD 2ODRC 3OD1A 5GANd 3A31A 4YRNA 3EFRA 3KFUA 1JBMA 5GANj 3HY1A 4PNOA 1Z7NA 2ARSA 4P72C 5GAMh 2QHVA 3A32A 1USYA 1B76A 2P5IA 2QHTA 2ZR2A 2ZGWA 2XTIA 3HXVA 4C8QA 4WJ4A 3VQXA 1GGMA 12ASA 4F7UB 2AKWA 5GAMe 1BBWA 1X2HA 2I4NA 3IALA 4XU0A 3LSQA 1PYSB 2VXEA 4M75F 5GAOr 4RCCA 3LC0A 4YRRA 5LJ3j 3E9HA 2ZNIA 2ZNJA 4TQFA 1H4SA 3V7RA 4PJOD 4PJOC 1NYQA 2EAYA 4YRSA 4K88A 5C51B 1BIAA 4UP9A 3HXUA 4M7AD 4M7AC 2I4LA 4YRMA 1E1TA 4HWTA 3UFGA 1NJ5A 3NENA 1G5IA 4XTZA 5GAMf 4HWPA 4P71C 2RA2A 1WNLA 3RL6A 2I2LA 1I8FA 3MEYA 2DXUA 3A74A 2DEQA 2IY5A 3HRKA 2DZ9A 3MF1A 3A7AA 3BW1A 3HFZA 1B34A 3HFZB 5GANg 2ZINA 4H2YA 5LJ5d 1KMMA 2DU5A 3A7RA 3IKMB 4M77A 4M77B 3M4PA 4X9CA 1B7YA 1G5HA 5GMKh 5LJ5j 3JCMP 1WLEA 4YCUA 2DU7A 3RESA 4P73A 3R07A 1BBUA 3HY0A 2DTOA 4XTYA 3MF2A 1SRYA 3DSQA 4M75B 4XTUA 1EIYB 2RM4A 5GMKi 1WU7A 3NEMA 1FYFA 2CGHA 4DQ2A 5GMKe 4H2UA 5GAN5 4H2XA 3L2ZA 4H2XB 5GAN2 3HXWA 2Q7EA 1WQ7A 1ATIA 3M4GA 1JJCA 1JJCB 4KR2A 5LJ3g 1QF6A 4M78D 3QO7A 1B8AA 1X01A 4M77G 2Y90A 5HGQA 3NELA 3JB9D 1YCYA 1TH7A 1KQ1A 3HXXA 1EVKA 2PMFA 5GANh 4X9DA 4M75G 2JN0A 4C92F 2E1HA 1E22A 4M7DA 4M7DB 4YROA 1ASZA 5GAN4 2E64A 1X56A 3PZCA 2YLBA 4JLIA 1E1OA 5GANe 3P8VA 4C8QF 1X2GA 1YFSA 1HC7A 4YRFA 2AMCA 1SESA 3VQYA 5GAOl 5LJ5g 2ZZEA 1U1TA 2E41A 4K87A 3SWNC 3HFOA 4YRLA 3G1ZA 4RDXA 2G4CA 3UGTA 3JCMJ 4M7DG 4AH6A 1M8VA 4XEOA 1ADYA 3VQVA 4XTVA 2EL9A 4PJOE 1W66A 2RHQA 2RHQB 5LJ3e 5GANf 3QO3A 1RIQA 2RHSA 2RHSB 4YREA 4V2SA 3PCOA 4C92B 3PCOB 2ZR3A 4M7AE 4TVAA 2ZZFA 4WJ3M 3EFSA 5GMKl 4HWRA 4HVCA 2ZT5A 5GAN3 4P74C 4PG3A 2DQ3A 4XEMA 4CH5A 4C8QB 2Q5IA 3SB2A 3RERA 2XGTA 1N9WA 5LJ5h 4P72A 4YRQA 2AKWB 5LJ3f 4M77F 2DDZA 4YCWA 2EJGA 1L0WA 1EFWA 1KQ2A 1HXDA 2DTHA 4YYEA 4C92G 2J3LA 5LJ5e 1X55A 2ZXFA 2I4MA 3REXA 4JUVA 1ADJA 2PMEA 4CH4A 2ZIMA 2Q7GA 3P8YA 3JCMc 4RMFA 3V7CA 3VBBA 4C8QG 4YRKA 4PJOA 3JCMW 1YGBA 4M78E 2CIMA 3TEGA 3JCMd 4HT9A 2IY5B 3W3SA 4TVWA 4M7AA 3HFVA 5LJ5f 4XQ3A 4P71A 2QTXA 1B34B 4CS4A 3RKWA 4M7DF 4XTXA 3ERRA 3HSBA 3RACA 3I7FA 1B7YB 1NJ2A 4TTVA 4YRIA 3JCMQ 4TVYA 4RCBA 4XTWA 3BJUA 4WI1A 4CH3A 4A54A 4Q15A 4YRCA 4M77C 3JB9J 4PJOG 3HRIA 4QVDA 4JRKA 4J15A 4P73C 2DVEA 4XU2A 4LNSA 4M75C 3FIFA 5CAIA 4M7AG 3HXZA 4H2SA 3AHUA 4KQEA 2ARTA 4YDQA 2RD1A 4YRTA 4OLFA 3BFMA 1YFTA 4QVCA 3UGQA 4EMGA 4MMKA 4HWSA 3RKYA 2DQ0A 3RF1A 1EVLA 4YRJA 2ZT8A 2K57A 4M78A 4M78B 5E3IA 4P75C 4E51A 1IL2A 2I4OA 3JCMg 2RB6A 1EQRA 2E3CA 4HT8A 2ZCEA 3CMQA 4M7DC 2CJAA 3JB9I 1H641 4JRIA 2AMCB 3A5YA 2DZCA 3NETA 4YPFA 5GAN6 3TEHA 3TEHB 2VXFA 2E10A 4Q6GA 4NOYA 4M78G 4H2TA 4N0AC 4EMKA 4F7UE 2HNIA 4EMKB 1NNHA 2DTIA 4X5OA 3RIRA 2YHTA 2ZTGA 4XU3A 1NJ8A 3BDUA 1J5WA 3SWNA 3QSUA 1Z7MA 3BY7A 3V7SA 4TVAB 1NJ6A 4YRPA 4PJOF 3FB9A 1D3BA 3QO5A 3JCMh 4ZTZB 3M4QA 1JRIA 3L4GA 1HTTA 2C8MA 3L4GB 4UP8A 4ZTUB 4C92C 4M7AF 2DXTA 1X54A 4H02A 3REUA 4DPGA 4NL3A 2CJBA 4YCVA 4L87A 3V8KA 3QO8A 3JCMe 2E5AA 1USYC 1LNXA 1C0AA 4UPAA 4C8QD 4C8QC 1HK9A 1I5LA 4P3OA 4P3PA 4NCXA 3LSSA 3JB9H 3IKLA 4H2VA 4M77E 5KNNA 2ZZGA 5GAOn 2Q7HA 4ZIBA 2ARUA 1NYRA 4J5YA 4G85A 3JCMX 4J6YA 4TWAA 4M75E 4F7UA 5GAOm 2ZT7A 4O2DA 3JCMf 1EOVA 4A53A 3GIBA 1I81A 4PJOB 1MGQA 4WF2A 4TQDA 5ELOA 2EJ9A 2J3MA 5LJ3d 1PYSA 1H4VB 3QHSA 1KMNA 4OP0A 4M7AB 4M78F 4CS3A 3UH0A 4NL2A 3WQZA 3JCMb 1ASYA 2FB7A 3JB9F 4YP0A 5GMKm 1M5Q1 3RGLA 1NJ1A 3L1AA 4Y91A 4F7UG 4RQEA 5F5WA 3RUXA 3VU3C 4M77D 4M7DE 1G51A 2EJFA 5GAMd 3HTZA 4EX5A 5GAN7 3QTCA 4EMHA 3E9IA 3RKXA 5GAOp 2YLCA 5GAMj 3V8JA 1YFRA 3IG2A 4M75D 1BIBA 4J6WA 3A5ZA 3QUIA 3PGGA 3QNEA 2DKGA 1LYLA 1E24A 4M75A 1EIYA 1SERA 1LOJA 1N9SA 2P0LA 1U1SA 1WQWA 3P8TA 5GAN8 5K1XA 2QHSA 1H4TA 5C53B 3V8LA 3HFNA 11ASA 3FJPA 4MMLA 4M78C 4RQFA 1KOGA 4C92E 4XU1A 4M7DD 5DY9A 4K86A 5ELNA 2ZT6A 3A7UA 2Q5HA 4G84A 3TUPA 2FYKA 2ALYA 2ALYB 4YRGA 4P75A 4BW9A 1VQZA 4EO4A 2EWNA 3ICAA 4CH6A 4C8QE 2E65A 1YB3A 4HWOA 1I4K1 1WYDA 5C52B 1H4QA 1Y96A 5GAMg 1Y96B 5GMKj 1WPYA 3JB9G 2C7IA 2QHUA 4P3NA 4KR3A 3SWNB 4EMKC 4F7UF 4N0AA 4J6XA 2ZIOA 1N9RA 1LJOA 4CS2A 1D3BB 5LJ3h 2DJZA 4HA8A 2CJ9A 1QE0A 5I21A 4C92D 1SETA 4UP7A 5GAOq 3HXYA 1B70A 1B70B 3JCMV 4H2WA 3VQWA 3INZA
chains in the Genus database with same CATH superfamily
4BWAA 2VC8A 3CCUQ 4IIOA 4C92A 2JZ2A 1SF9A 3OD1A 2KRSA 3TU4K 3OYJA 3KFUA 1JBMA 3M0PA 5GANj 5CIUA 3HY1A 4P72C 2F2VA 3L2WA 1USYA 4QKUA 5FWCA 2EGEA 3OYDA 1ACMB 1CKAA 2WSEE 4WJ4A 3QYGB 2XDBA 1UHFA 1KFZA 1GGMA 1NLPC 12ASA 1Q82R 4F7UB 1AWXA 1VYTA 1GFDA 1VYVA 2HMAA 2I4NA 1B7TA 4XU0A 3LSQA 3EHRA 2KSSA 3LC0A 3NFCA 3E9HA 2ZNJA 2ZNIA 3UDCA 2RI2A 2COZA 3A8MB 5C51B 3C12A 1BIAA 3CCEA 2PVDB 2O31A 4UP9A 4YRMA 1WGSA 1XOVA 2DBKA 4HWTA 3UFGA 1NLOC 2RA2A 4RG8A 2IY5A 3HRKA 4FYWB 2DZ9A 4J9FA 3GPLA 3PTAA 3HFZA 3HFZB 4JJBA 5GANg 1AWJA 2ZINA 1NJIR 3IKMB 2M0OA 4A63B 3CD6A 3R07A 2OTJA 3HY0A 5A0DA 3P8BB 4XTYA 2R57A 3G6EQ 2NUTA 1EIYB 2RM4A 3NEMA 4JPBW 1UFFA 5GMKe 2ZPGB 1D1AA 2BTTA 1DJ7B 3VYHB 3OYCA 1X6OA 1W2BS 1SG5A 1GRIA 1B8AA 3X25B 1Y57A 3MKDA 1WI7A 2KQWA 1IHVA 1N6AA 3JB9D 1TH7A 1UGSB 1KQ1A 2PMFA 4OB0B 1E22A 2ZAEA 1H3ZA 3CC7Q 1IO6A 4J9DA 4JS5A 2CH4A 1X56A 1M2VB 1E1OA 1WFWA 5GANe 5KYYB 2OTJQ 4C8QF 4DEXA 5KCOA 1SKUB 3EH2A 4ELYC 3EGDA 3SDZA 3EGDB 2QQRA 1EX4A 5GAOl 2CP6A 2HSPA 3EG0A 4C0DC 2AIRB 1U1TA 2FPDA 4K87A 1SSHA 3LH0A 3I9QA 5IHNA 4YRLA 4RDXA 4AFUC 2G4CA 3UGTA 3H8ZA 2CH4W 2HBWA 2PUOB 1PNJA 2EL9A 4PJOE 5C6SA 2RHQA 2RHQB 5GANf 3OB9A 4E47A 4OGEA 2ZR3A 2ZZFA 1VQ8Q 3EFSA 5GMKl 1VQPT 4LVMA 1VQNA 5IH2A 2DF6A 2LJ0A 3I55T 4P74C 2DQ3A 3KBGA 1QVFP 3UWNA 4CH5A 4CC4B 1I07A 2D8HA 2A28A 4LE9A 5LJ5h 1QP2A 2QQSA 4CC7A 4YRQA 4YCWA 1WHGA 4WTOB 2LRQA 5I11A 1VQMT 1KQ2A 1N8RR 1K9MC 1HXDA 2DTHA 1OOTA 4YYEA 4LVIA 2J3LA 1VA7A 1NEGA 2XDPA 3REXA 1OZ3A 2HEQA 1JEGA 3P8YA 2KK4A 5KYUB 4RMFA 1KHIA 3X26B 1UB4A 3V7CA 1BB9A 4YTLA 3M0SA 1IHWA 3E9FA 1YGBA 4M78E 2CIMA 4Y28E 1VQNQ 2EQJA 4LD6A 2GGRA 3G4SA 3HHTB 4M7AA 2GTOA 3HFVA 3GNFB 1K9MU 1M1KC 1B34B 4XTXA 4LVJA 3HSBA 4XAXB 2WSCE 4TTVA 4FCYA 4XTWA 3BJUA 2XU8A 5DLQE 1KD1R 2PQWA 4A54A 4Q15A 2K9GA 4YRCA 4M77C 4IUQA 3HRIA 1Q7YR 4P73C 1MMGA 1ZQ1A 1W4SA 2RHIA 4XU2A 4OMQA 3VRZA 1VQPA 4M75C 5CAIA 3CCRT 2KRMA 4M7AG 3EFOB 3I55A 1YJNA 1AVZC 4YDQA 2IPOB 1ZSZA 2IIMA 2RD1A 4YRTA 4OLFA 1YFTA 4QVCA 1SRLA 4KGVB 1M1KU 5AT1B 4IKFA 1XQHA 3R6OA 1IGQA 3G4SQ 3RF1A 4JJNK 2ZT8A 1QWFA 3OMGA 2QQ9A 2EFIA 4HXJA 5E3IA 2JT4A 8ATCB 1KC8R 4P75C 1NM7A 4HCZA 1NEBA 3JCMg 2RB6A 1EQRA 2DETA 2E3CA 1QVFA 2QAZA 4M7DC 5CKFA 3TEEA 3LYIA 2AMCB 5D7UA 1TUDA 2HQHA 2GFAA 3WVEB 4J9BA 1D0YA 1D1BA 4TVRA 1MNDA 2FHDA 2VXFA 2E10A 2PUKB 2RK2A 2CP5A 4BY6B 1YJNQ 4N0AC 2L8DA 3CPWP 4F7UE 2HNIA 2DIGA 2ENMA 3M56A 3L2UA 2V8JA 4X5OA 1R77A 4JRPA 2CREA 2LCCA 2L3RA 2MAMA 2MWOA 3CCSA 1J5WA 2VVKA 4PFPA 3V7SA 2F5KA 3HTRA 1A0NB 4YRPA 1BI1A 2XG8D 2K5LA 2MIOA 1H3HA 3QO5A 4LXCA 2L89A 1JRIA 4KUDK 3NTHA 5EC7A 1G8XA 2VYTA 4KT0E 3CCMT 1YBYA 2V1QA 1VIFA 4DPGA 4BB7A 4L87A 3CCRA 1YJ9T 3V8KA 3JCMe 4FU6A 1OEBA 1ZX6A 1LNXA 1WHMA 1C0AA 1M9SA 4HT4A 2GTJA 4A4KA 3TVTA 3OYGA 2YRCA 3PMIA 3PIOA 4P3PA 1NE8A 2MYSA 4HVWA 2KXDA 2FZCB 2RHUA 5KNNA 3CMAQ 5KE2A 2Q7HA 3QJYA 4DA4A 1EFNA 4JJDA 3JCMX 2X9HA 3CCSQ 3E19A 1RI0A 3OYBA 3JCMf 3LWIA 1QVGS 3GIBA 1YJWA 1MGQA 1LCKA 4WF2A 2J05A 4J7FA 1WHJA 2XIDA 2DPPB 2K2VA 1H4VB 3QHSA 1WXBA 4IUPA 2K6DA 1C0MA 1SHFA 2R5AA 3REBB 2KI7A 3CCRQ 3THKA 1VQLT 4C0GA 3QPHA 1Q86C 1Y71A 2L0AA 2RQUA 1ASYA 2FB7A 1M5Q1 1NJ1A 3CC4T 4RQEA 2RN8A 1YI2T 3RUXA 2MK5A 3VS3A 2EJFA 5GAN7 2HSEB 3HRUA 5GAOp 2RQRA 4MZPA 3PVQA 1YFRA 1BIBA 2KXCA 3TQ7P 4J6WA 5HKCA 5CVIA 1W70A 3CPWA 4KH1B 3CCMA 4MDXA 2DMOA 1YJWQ 3JSCA 2H3JA 3MO8A 1TS9A 1LOJA 2QXFA 3VS5A 1Q86U 3UPUA 4ESRA 1U1SA 3PMTA 1WQWA 4LNPA 3P8TA 4N4HA 2FZKB 5K1XA 3KFVA 1R0BG 3HP9A 1H4TA 2GFUA 2ZPEB 3V8LA 5C53B 2YRDA 2ABLA 1OV3A 2RQVA 4BE1A 5D6YA 3CCLT 1KOGA 4XU1A 1BYMA 5DY9A 4JDSA 3A7UA 4G84A 3HKSA 1C1AA 3C0CA 1TTHB 1ZHIA 2FYKA 2Q5HA 1X2KA 4LUDA 3TSWA 2OI3A 2YUNA 1UHCA 4CH6A 2OX7A 2EKHA 4DBQA 1TWBA 4OF1A 1I4K1 1SHGA 2EGAA 4E7HA 2DJQA 2JMAA 2DFUA 3QYHB 1Y96A 1Y96B 3REAB 3M57A 3JB9G 2DYIA 1VQLA 4P3NA 1PC0A 4J9IA 3SWNB 4EMKC 3DLMA 1TUGB 3G71T 4BI8B 2DERA 2ROLA 4DBFA 2HZYA 3QBYA 3CC4A 1YI2A 2BIVA 3EG1A 2CJ9A 1WXTA 5A2QE 5I21A 2PTKA 2RJCA 3OBWA 3A8HB 3HXYA 1CSKA 1B70A 1B70B 1VQ5A 5K1PA 3H0FA 1UECA 2K4YA 2O01E 1UG1A 2D0QB 2ODRD 3QIIA 1BK2A 5IHKA 1MMDA 2YT6A 5GAMh 4FYYB 3A32A 3R6NA 5CK9A 2P5IA 3OYNA 2SEMA 4C8QA 3HXVA 3M0UA 2G6FX 4ZNXA 2FZGB 3CCJT 3VQXA 1VQOQ 2JTFA 2ED0A 2RPNA 2AKWA 3E1SA 3CCLA 1NBEB 2RJFA 3CC4Q 4J9HA 4Z02A 1YI2Q 1JQQA 2K79A 4M75F 4RCCA 5LJ3j 1K4US 1PCXA 2HKQB 4PJOC 2EAYA 4J8OA 3EG2A 2EQIA 2P4RA 3NTKA 1VQ5Q 5I2SA 3HXUA 4DBHA 2GBQA 3L2VA 4M7AD 3ULRB 3CPFA 1WLPB 2VUBA 2RHZA 3NENA 1G5IA 4XTZA 4HWPA 4P71C 3I5SA 3RL6A 2I2LA 1AWOA 1Q82U 3S6WA 3HL8A 3SFMA 3MF1A 1Y07A 5CQYA 2KRNA 4H2YA 4EDUA 1G5VA 5LJ5d 4D8KA 4FT4A 2V8IA 4X9CA 1YITA 2F69A 2DU7A 2RJDA 3CCLQ 1BBUA 3GLXA 4XTUA 2X4JA 5GMKi 4PFZA 1WHLA 5FROA 2L3SA 3EHQA 4H2UA 2QASA 4ZN1A 2M16A 5GAN5 2DEUA 1FMKA 1ATIA 4KR2A 2F2XA 5LJ3g 3QO7A 2X51A 3MEUA 4MZMA 4JZ3A 5FWBA 1X01A 2J06A 2KT1A 2NS6A 2L2PA 5HGQA 4L6V5 1YCYA 3SEMA 5I2MA 1SRMA 1M30A 3VS2A 2ZPHB 1KHCA 2AT1B 4YROA 1P92A 2LC4A 2ZPFB 4OGCA 1YNZA 2E64A 2HL5C 1M90R 2D1XA 5A0GA 1YITQ 4FYXB 1WJRA 3ZEHA 2C0IA 3UF4A 1JXMA 1X2GA 1HC7A 2KYMA 4IIMA 2FEIA 1SESA 4GLKA 4PKCC 2OTLT 4AFZC 2F5TX 4BE2A 2LJ3A 1K76A 3HFOA 5CQXA 3G1ZA 3VYGA 1S72T 4AH6A 1N5ZA 4PK4A 2F2WA 3D7SB 1W66A 5LJ3e 1YHQT 3QO3A 4M4ZA 1G3SA 2BZ8A 4LUEA 4V2SA 4C92B 1MUZA 4TVAA 2KVQG 1Y7XA 1VIEA 4HVCA 2PVOB 1NZ9A 4PG3A 2MOXA 2CP0A 4XEMA 2Q5IA 3C4SA 1YP5A 3OSVA 2LCLA 4P72A 2DDZA 5LJ3f 1KK7A 4ZGEB 1ABOA 2F1LA 2FPEA 1L0WA 1UEBA 1BBZA 2X35A 4C92G 1X55A 1OPLA 3M9QA 1OI1A 1ADJA 2HQXA 2RF0A 2JJ9A 3JCMc 1MV0B 4ATOA 1MMNA 1M1GA 3CMET 4II1A 3CXCS 2LVMA 3ASKA 3CQTA 3TEGA 1AD5A 2CSIA 2IY5B 4CC2A 1VYUA 4XQ3A 3SHWA 1W2BA 2OTLA 2ZPBB 2VV5A 3OYHA 3I7FA 2GNCA 1Q81R 4YRIA 4OB1B 1S72A 4TVYA 4WI1A 1PRLC 2NUTB 1OX9A 2JVVA 1PD1A 1X27A 3BE3A 4JRKA 4VUBA 3PT9A 1PHTA 5FU7B 3NGPA 3CCEQ 4H2SA 3AHUA 2YRVA 3H9NA 4BDZA 2O4XA 1WJSA 8AT1B 3MP6A 3X24B 3LLRA 4YRJA 4C5EA 4LDUA 2VASA 1EZZB 2C06A 2DXCA 2PU9B 2P84A 2LMJA 3MPUB 2RH2A 3CD6Q 4ZGJB 3VJPA 3JB9I 4IUTA 1FMWA 4IUVA 3CMEA 2CZ1B 1VQ9T 1VUBA 2RK1A 4E7KA 2COWA 3TEHA 3TEHB 4HVVA 1NNHA 1RADB 2NUPA 2D8JA 2ZTGA 2J7IA 3A98A 3BDUA 4QQ6A 2YWWA 4D6WA 3PNWC 2R58A 1NJ6A 2DBMA 5J26A 4PJOF 1D3BA 1WHHA 1X6BA 4F04B 2C8MA 3VUBA 2SRCA 3MP8A 4O5VA 1X54A 2CJBA 4YCVA 2LNHB 1BI3A 1KSWA 4A4HA 3QO8A 3CMEQ 2YDLA 4C8QD 3RR6A 1FMVA 1I5LA 4J9GA 4P3OA 4X1VA 1V29B 2EYQA 2A7YA 2EW3A 4ZN3A 3RMQA 1RL2A 3MEVA 2CT3A 2KEAA 2ARUA 4J6YA 4TWAA 1BCMA 2HAXA 4JJCA 3M53A 1EOVA 1OYXA 2A36A 1PYSA 2KE9A 1VQ9A 4B9WA 2LDMA 4M7AB 1N27A 2NUZA 2D9TA 2DAQA 4M78F 2E70A 1NYFA 4FW2A 1X2QA 1O75A 2HKNA 4O6JA 1GXIE 4YP0A 2HL3A 3OS1A 2JXBA 4Y91A 3GF5A 1K73C 1EIFA 5GAMd 4EMHA 1HYOA 3RKXA 2YLCA 2QYZA 3VRYA 3SD4A 1ZSZB 2AZSA 2EPDA 1HD3A 1M4ZA 4M75A 4Q5WA 3CEYA 2EYXA 1N9SA 2CP7A 1YWPA 4ZTJA 2YUPA 1VQMA 3QXEB 2E6NA 1K73U 1X43A 4Y92A 4Z88A 3HFNA 1Z9ZA 2XICA 4C92E 3H0IA 5L23A 1GCPA 1VQ6T 4K86A 5ELNA 1OU9A 3NMZC 4YRGA 4P75A 2FO0A 2L5QA 3H6ZA 4J83A 1VQPQ 4CRIA 2RMOA 3I55Q 3OS0A 2NYSA 3M54A 3H0HA 2RHYA 2LT4A 3OYEA 4LDYA 1WYDA 1K8AC 1H4QA 4RTVA 2DX1A 4OMFB 2IVWA 4BY6C 2C7IA 1RABB 4RTXA 4F7UF 4N0AA 2KT8A 5CCAA 5J3BA 1VQMQ 1WHKA 2EYWA 5LJ3h 2DA9A 2DJZA 1B3QA 1QE0A 1X69A 4C92D 3H41A 1K9AA 2DL8A 2QI2A 3DKMA 5KE3A 4JLGA 3VQWA 5EG2A 3INZA 1QVGA 1KIKA 1OZ2A 3NPFA 1K8AU 4YRNA 3EFRA 2E5QA 4LDWA 2BE7D 3OMCA 1Z7NA 2ARSA 3CCVT 3MCAB 1IRXA 2V1RA 4WCIA 2ZR2A 2ZGWA 2XTIA 4E2FB 2EKOA 3A8LB 1JJ2S 1HSQA 2EGCA 4PL6A 1ZBXA 2ZZDA 1RAAB 1BCOA 2DL5A 2DVJA 2LP5A 2X4XA 1VQ6A 3OW2S 2VXEA 3M0QA 5GAOr 4YRRA 4RTUA 4TQFA 2K3YA 3TCJA 1BI0A 3EG9A 1NYQA 3EG9B 4K88A 4KUIA 5FW9A 2PNIA 2I4LA 3A8OB 1E1TA 3L42A 2A8EA 1VQ7T 2M0YA 2Y4YA 3OYLA 2DILA 1WNLA 2ROTA 2DXUA 3A74A 1YCSB 2NLUA 1QKXA 3HRSA 2QEXT 4OMNA 5CKHA 1KJWA 3QKJA 3A7AA 2X4YA 3CC2T 2XD0A 1M1KR 1OPKA 2X3XD 2DU5A 1WIEA 1ZLMA 1B7YA 2IG0A 5GMKh 5LJ5j 3JCMP 1WLEA 2RNAA 2CUDA 3QJ6A 3Q1JA 1VQ6Q 3MF2A 2DNUA 1YJ9A 3UA6A 1T3LA 1AZEA 1SRYA 5M9OA 3DSQA 1WU7A 2LX9A 4DQ2A 1IGUA 3ME9A 1UGPB 1PKTA 2YSQA 4EIKA 3L2ZA 5KH6A 3I5RA 4C0FA 3G1JA 3EG3A 2MWPA 3M4GA 1JJCA 1JJCB 1QF6A 3OY9A 2A3LA 4AMCA 2XK0A 5FU6B 1AHJB 1VOMA 1FX7A 2MPXC 2RO0A 2L3PA 3NELA 2ECZA 1EVKA 5GANh 4X9DA 2JN0A 5D6XA 4MZTA 4ORZA 4IUUA 1UTIA 2XHCA 1J3TA 1ASZA 4B6MA 5KYXA 1M8MA 1VQKT 5DM7R 3PZCA 4JLIA 3CCMQ 1G3WA 1NPPA 4IURA 1YJ9Q 4YRFA 3OSSC 2E4HA 3VQYA 3TSZA 5LJ5g 1VQ7A 3UA7A 1BU1A 1QCNA 2E3IA 2KR3A 2E41A 3SWNC 3OS5A 3CCQT 3JCMJ 5KYNA 2BKDN 5CKBA 3I56T 2V8KA 1ADYA 3VQVA 4XTVA 3VKIA 1ZUUA 1M90U 3P8DA 4M7AE 4BI4A 2BE9B 4FIBA 5GAN3 1FXXA 2HDAA 4C8QB 3RERA 1N9WA 1Q82C 1M3CA 1VQLQ 1LPLA 1M3BA 2AKWB 4M77F 1WDXA 2AKLA 2EJGA 1GBQA 1VQ7Q 3P8HA 2LTOA 1U3OA 1W1FA 5LJ5e 4JUVA 4RMOA 2PMEA 1U8RA 1ABQA 3EGUA 3WVDB 3E2UA 1TOVA 1MMAA 4C8QG 1VQKA 1ZSGA 1IZ6A 4PJOA 3JCMW 2H8HA 2W10A 3X28B 4E7LA 2BZYA 3W3SA 4N4GA 3G71A 3DLLA 5LJ5f 2MMPA 3M0TA 4P71A 4KRTA 2QTXA 4CS4A 1ZA2B 3CXCP 1NJIC 4M7DF 3ERRA 3MHXA 2DD5A 1OU8A 3RACA 3X20B 2KGTA 2K3BA 1Q86R 2AHJB 3I56A 3E9GA 3JCMQ 4RCBA 2VB6A 4R55A 2MCNA 1XTDA 2GQIA 1OQKA 3JAME 1WYXA 4LDXA 1C6VX 4PJOG 1GCQC 3DB3A 4BDYA 1UJ0A 3HRTA 4KBMB 2FPFA 4RG2A 3JRZA 2QTVA 1PM3A 2ARTA 2J6KA 1HJDA 3OYKA 3BFMA 2J6FA 3FC3A 1KQSS 3CCJA 2E12A 3C95A 4MMKA 2YUOA 4A4GA 4AT1B 1NJIU 4HWSA 5D6WA 3G71Q 2K57A 4M78A 2NWMA 4M78B 4D8DA 1W2BP 3S3OA 3AT1B 2KYBA 4E51A 1I5OB 1IL2A 2LZ6B 3M5AA 4HT8A 2ZCEA 6AT1B 3CMQA 5HK0A 2CJAA 1KG1A 3G6ET 1H641 4JRIA 3A5YA 2LQWA 2MI6A 1JO8A 2MF2A 1NPRA 2R5MA 3QWXX 3NETA 4YPFA 5GAN6 3OYMA 4Q6GA 4NOYA 1PSEA 2C0OA 4M78G 5HK3A 3NTIA 2DTIA 3RIRA 3OBYA 3CCJQ 1I1JA 3OQ5A 3G7ZA 3ER0A 1UDLA 3QSUA 1Z7MA 1BKBA 3BY7A 2CZ0B 4RTYA 4TVAB 2CUBA 1D1CA 2B86A 3FB9A 3JCMh 1IXDA 2E6ZA 4ZTZB 3CC7T 3M4QA 2AZVA 3OYFA 1AZGB 4C92C 4F14A 2OTJT 2CDTA 5FRNA 4H02A 2HBPA 2M51A 4JZ4A 1ZA1B 3CXCA 2E5AA 1USYC 2CKKA 3A8GB 1N8RC 2RJEA 3FDRA 2LT1A 2J6OA 3N5BB 3LSSA 3JB9H 3IKLA 2WACA 3MEAA 4H2VA 2GCXA 2ED1A 2ZZGA 4LVLA 2V26A 2COYA 3U23A 2YXYA 2D0NA 4J9CA 1NYRA 4G85A 4PJNA 2BZXA 1PG5B 3PIPA 4F7UA 4A53A 2DXBA 1I81A 1VQ8T 4GLMA 3J80E 4TQDA 5C0MA 4JS4A 3G6EA 5LJ3d 2J3MA 5ELOA 1WJQA 4P5NA 3I35A 3RNJA 4OP0A 3PFSA 4E7SA 4HCKA 1R0CB 1N8RU 3S3MA 2EIFA 3CBMA 2JS2A 3ZFJA 3UH0A 3JCMb 1SEMA 1WZOA 3JB9F 3RGLA 1KD1C 4BI3A 4F7UG 1NYGA 4QW2A 1YHQA 2VGNA 1Q7YC 1ZBJA 3ZL7C 5GAMj 3V8JA 3IG2A 3OA6A 1E6HA 4OMOA 3GOXA 3CC7A 1D0ZA 1G83A 2X4WA 3QUIA 3OS2A 2O2OA 4FSSA 4FW1A 5FU7C 3PGGA 1RLQC 2DKGA 1VQNT 1E24A 1LYLA 2O4XB 1EIYA 1SERA 4J9EA 1RAEB 2A37A 3QZ9B 2P0LA 3META 2DRMA 5GAN8 2B8AA 1KC8C 1KD1U 2H3EB 2QA4T 2OTLQ 1Q7YU 1YN8A 2DRKA 5I22A 3QG1A 1S72Q 4RQFA 2GQVA 3LWHA 4ME7A 2LCSA 2ZT6A 1YHQQ 2ALYA 1IREB 2ALYB 4FM4B 2JTEA 2GF7A 1RAGB 2LJ1A 3ICAA 1VQ8A 4C8QE 5GJWB 5CKEA 2CP3A 3QWYA 1X6GA 1YB3A 4HWOA 4FYVB 1M2VA 4B9XA 3LX7A 5C52B 5KYYA 2NUPB 5GAMg 1KC8U 1WPYA 4C0DB 1E6GA 1QMCA 4KR3A 3G4ST 1GBRA 3FRNA 2LNVA 4HVUA 1GFCA 1QQJA 4J6XA 4AG2C 1N9RA 4CS2A 1D3BB 3VS4A 1G3TA 3FJ5A 4K11A 4HA8A 1V76A 3J81E 2LQ8A 2YUQA 4C5HA 4UP7A 2M02A 4PJJA 3VS7A 2EBPA 2KDSA 1TUCA 2E5KA 1AT1B 4P74A 1SPKA 1QWEA 1WA7A 4PHCA 2ODRC 3URGA 5GANd 3A31A 2RQWA 2EQKA 4PNOA 1FYNA 4XK8E 1YJNT 3BDLA 2QHVA 1B76A 2QHTA 2G3RA 2XDDA 5KYWA 5KYWB 2DL7A 3OYYA 2QA4A 3OYIA 4OMMA 5GAMe 2P4TA 1BBWA 2CYZB 1X2HA 3IALA 1FWZA 4GY5A 1E7OA 1U5SA 2O9SA 1PYSB 1RAHB 2HD0A 5DLOA 2OJ2A 1H4SA 1JJ2P 3V7RA 4DBRA 4PJOD 1SSFA 3A1PA 4C5GA 3LW5E 5KYUA 2JM8A 4YRSA 1QVGP 4Z89A 1LVKA 3RDVA 3L2QA 3NHNA 2FL7A 4M7AC 4KGXB 2Z0WA 3OW2P 3EGXA 3EGXB 3CBOA 4KGZB 1X75C 1NJ5A 3RMSA 5GAMf 3M58A 1I8FA 3MEYA 2PVGB 2DEQA 5HY6A 2Y4XA 3CMAT 1IB8A 2DD4A 4HCCA 3BW1A 1YFNA 1B34A 3GBQA 2VKNA 2QA4Q 3J7AF 1KMMA 3A7RA 3CCST 4M77A 4M77B 3M4PA 1G5HA 2QDYB 4YCUA 3RESA 4P73A 1JXOA 2DTOA 2M9UA 1K1ZA 2FG0A 1M27C 2KY9A 2ATCB 2LQNA 4M75B 1YIJT 4R56A 1VQ9Q 1RACB 1ZSZC 2PZ1A 2CGHA 1FYFA 1UGRB 1TG0A 1YWOA 4H2XA 2O9VA 1RUWA 1XJWB 9ATCB 5GAN2 4H2XB 3HXWA 2Q7EA 3EFOA 3RBBB 1T0HA 1WQ7A 1Z9QA 2P0PA 4M78D 1U06A 2DYBA 1WX6A 4M77G 3O5ZA 3VS6A 3WXMB 2Y90A 1PD0A 4RTZA 3L2RA 2P0QA 2ZPIB 3FEOA 3HXXA 4M75G 4C92F 2EVRA 2E1HA 5CKDA 2DLPA 4M7DA 3M55A 1AOJA 4M7DB 4OB2B 1GL5A 1CKBA 2JM9A 5GAN4 2RI5A 3MJXA 2YLBA 2FVUA 4KULA 1YJWT 3P8VA 1YFSA 2DL3A 1MNEA 1PRMC 2AMCA 5CO7A 1JB0E 2KNBB 4ANJA 4C5IA 2RQTA 2ZZEA 1QLYA 2A08A 3UT1A 1OULA 1ZUYA 4M7DG 3CMAA 2DK3A 1PWTA 1JJ2A 1M8VA 4XEOA 1G2BA 1JU5C 5IXFA 1QVFS 3QDRB 1RIQA 2QQAA 2ESWA 2RHSA 2RHSB 4YREA 3PCOA 3T9NA 3PCOB 4FL6A 2JMCA 4L5GA 3OW2A 4WJ3M 4F17A 4HWRA 2L3QA 4ZGDB 2ZT5A 3PE0A 3IQLA 1YIJA 2VWFA 4L59A 1MHNA 2DM1A 3MP1A 1T3SA 2JTMA 3MEWA 4NS5A 1M2OA 1ARKA 3SB2A 4N4IA 5IXBA 1RLPC 4BD3A 2XGTA 2JOYA 1MV3A 1O9SA 2X3WD 5IHIA 5IT9E 3GP8A 1EFWA 2I0NA 1K9MR 1RAFB 1H92A 2ZCFB 1V1CA 2ZXFA 2I4MA 4CH4A 3C94A 1QCFA 2ZIMA 2Q7GA 3FLGA 1RI9A 1UGQB 3VBBA 1UJYA 4YRKA 5GJVB 1M1FA 2KMTA 2AK5A 3JCMd 1YIJQ 4HT9A 5KCHA 4TVWA 1T0JA 4LVKA 5LL6S 5L8RE 2QQBA 1TSFA 3RKWA 1VQOT 4PJLA 1ZUKA 1B7YB 1NJ2A 2A0FB 4ELZC 2M1HA 2JS0A 2K5FA 4A4FA 2LQKA 3LGFA 3UATA 3QZ5B 2XMFA 4CH3A 1K73R 3TREA 5J39A 3JB9J 3F70A 3M4YA 4QVDA 3KXTA 1QP3A 4J15A 2WSFE 2DVEA 3OYAA 4LNSA 3FIFA 1VQ5T 3HXZA 2DL4A 4KQEA 3CCVA 2P0KA 1WXUA 1BI2A 4PLIA 3UGQA 1Q95G 2CZ6B 4EMGA 1AEYA 3RKYA 5A0LA 3LGLA 2DQ0A 3M59A 1EVLA 4RKUE 5FU6C 4CC3A 2FRWA 1KQSP 1AWWA 1M90C 5KYXB 3S3NA 1UGVA 2I4OA 2K7AA 1PKSA 2CSQA 1K0SA 4DOWA 3CPWS 3EAEA 2DE0X 3JV3A 1RAIB 1UUEA 2DZCA 5IAYA 4MDWA 4H2TA 4E7IA 3CCVQ 4EMKA 2QEXA 4EMKB 3CC2A 2LX7A 2YHTA 1K8AR 4XU3A 2BUDA 4BE0A 1VQOA 1NJ8A 4HKEA 2RHXA 3SWNA 1VQ4T 3GNGA 2QGFB 4EPCA 2W0ZA 1Y0MA 4OMLA 4RUGA 3VS1A 3L4GA 1HTTA 3L4GB 4UP8A 4ZTUB 2K3XA 4E7ZA 4LD9K 2JNGA 1YITT 4M7AF 2HQEA 3PVLA 1G3YA 2DXTA 3REUA 4NL3A 3VS0A 4OMPA 4RTTA 4E7JA 1K0XA 1D09B 2EYYA 4UPAA 3QDFA 1W6XA 4C8QC 1HK9A 2C0TA 1QKWA 2KBTA 3O8VA 3M0RA 2CP2A 4NCXA 2VGMA 2QEXQ 4M77E 1TXQA 2CS7A 5GAOn 4X34A 3CC2Q 4QVZA 4HCBA 4ZIBA 4GBQA 4J5YA 4M75E 4Z8AA 3CCUT 5GAOm 2ZT7A 4O2DA 4C0ZA 4AFQC 4F16A 2OAUA 5AYFA 4PJOB 4AG1C 2EJ9A 2CZ7B 4FSXA 2RI3A 1KMNA 1R8OB 2D6FA 5HCKA 1PSFA 2QGGA 4A4EA 4BACA 4ZTFA 1QCOA 1QVPA 2QDLA 4PFOA 3DB4A 4CS3A 3LH5A 4NL2A 4QQGA 1Q81C 3WQZA 1KQSA 3CCQA 4DOVA 4OVAA 1M3AA 5GMKm 2HCKA 2QK0A 2EQUA 3L1AA 4UC4A 5F5WA 3VU3C 1NG2A 4M77D 4M7DE 1G51A 4QQDA 4OB3B 1VQ4A 3HTZA 4EX5A 3QTCA 4J7IA 4KH0B 3VV0A 3E9IA 5CR2A 4PLLA 4M75D 2E3HA 2XKOC 4QT7A 3A5ZA 3A5ZB 3ZBDA 1VQKQ 1GCQA 1TU0B 2AKKA 4BUGA 2K5IA 3QNEA 3VUZA 1Q81U 1OX8A 2EYZA 1UE9A 1D0XA 2EQMA 1I0CA 2QHSA 3CBPA 2DO3A 2KROA 3HPWA 5IN1A 4E6RA 2DIQA 2O88A 5FLXE 5FRMA 3CCQQ 11ASA 3FJPA 4MMLA 4M78C 4CI0C 3I56Q 4PJMA 4M7DD 3TUPA 1QW1A 2JW4A 2JUFA 2KAFA 4BW9A 2QG9B 1VQZA 3EH1A 3CCUA 2K2MA 4RTWA 1VQ4Q 4EO4A 3MQZA 2EWNA 4LN2A 4LDVA 2XI9A 2E65A 3CCET 1XNIA 5ECAA 5GMKj 1F1BB 2QHUA 1B07A 1S1NA 4R0KA 2FRYA 2ZIOA 4JRQA 4DEYA 1LJOA 4AFSC 3KUFA 4FT2A 2OAWA 1H8KA 1SETA 5GAOq 3CD6T 7AT1B 2CT4A 3JCMV 4H2WA
chains in the Genus database with same CATH topology
4BWAA 2VC8A 4C92A 2JZ2A 3OD1A 3TU4K 3OYJA 3KFUA 1JBMA 5GANj 3HY1A 5CIUA 4P72C 3L2WA 1USYA 3OYDA 4WJ4A 2WSEE 3QYGB 2XDBA 1GGMA 12ASA 4F7UB 2I4NA 4XU0A 3LSQA 2KSSA 3LC0A 3NFCA 3E9HA 2ZNJA 2ZNIA 3UDCA 2RI2A 3A8MB 5C51B 3C12A 1BIAA 3CCEA 2PVDB 4UP9A 4YRMA 1WGSA 1XOVA 4HWTA 3UFGA 2RA2A 4RG8A 2IY5A 3HRKA 2DZ9A 3GPLA 3PTAA 3HFZA 3HFZB 5GANg 2ZINA 3IKMB 2M0OA 3CD6A 3R07A 2OTJA 3HY0A 5A0DA 3P8BB 4XTYA 2R57A 1EIYB 2RM4A 3NEMA 5GMKe 2ZPGB 3VYHB 1DJ7B 3OYCA 1X6OA 1W2BS 1B8AA 3X25B 2KQWA 1N6AA 3JB9D 1TH7A 1UGSB 1KQ1A 2PMFA 4OB0B 1E22A 1H3ZA 4JS5A 1X56A 1E1OA 5GANe 4C8QF 5KCOA 4ELYC 3SDZA 2QQRA 5GAOl 4C0DC 1U1TA 4K87A 3LH0A 4YRLA 4RDXA 2G4CA 3UGTA 3H8ZA 2PUOB 2EL9A 4PJOE 5C6SA 2RHQA 2RHQB 5GANf 3OB9A 4E47A 4OGEA 2ZR3A 2ZZFA 3EFSA 5GMKl 1VQPT 4LVMA 1VQNA 3I55T 4P74C 2DQ3A 3KBGA 3UWNA 4CH5A 5LJ5h 1QP2A 2QQSA 4YRQA 4YCWA 2LRQA 1VQMT 1KQ2A 1K9MC 1HXDA 2DTHA 4YYEA 4LVIA 2J3LA 2XDPA 3REXA 1OZ3A 3P8YA 2KK4A 4RMFA 1KHIA 3X26B 1UB4A 3V7CA 4YTLA 3E9FA 1YGBA 4M78E 2CIMA 4Y28E 2EQJA 4LD6A 3G4SA 3HHTB 4M7AA 3HFVA 3GNFB 1K9MU 1M1KC 1B34B 4XTXA 4LVJA 3HSBA 4XAXB 2WSCE 4TTVA 4XTWA 3BJUA 2XU8A 5DLQE 2PQWA 4A54A 4Q15A 4YRCA 4M77C 4IUQA 3HRIA 4P73C 1ZQ1A 1W4SA 2RHIA 4XU2A 1VQPA 4M75C 5CAIA 3CCRT 4M7AG 3I55A 1YJNA 4YDQA 2RD1A 4YRTA 4OLFA 1YFTA 4QVCA 1M1KU 4IKFA 1XQHA 3R6OA 3RF1A 4JJNK 2ZT8A 3OMGA 2QQ9A 2EFIA 5E3IA 4P75C 4HCZA 3JCMg 2RB6A 1EQRA 2E3CA 1QVFA 4M7DC 5CKFA 3TEEA 3LYIA 2AMCB 2GFAA 3WVEB 4TVRA 2FHDA 2VXFA 2E10A 2PUKB 2RK2A 4BY6B 4N0AC 2L8DA 4F7UE 2HNIA 2DIGA 3M56A 3L2UA 2V8JA 4X5OA 4JRPA 2LCCA 2L3RA 2MAMA 2MWOA 3CCSA 1J5WA 3V7SA 2F5KA 4YRPA 1BI1A 2XG8D 2K5LA 3QO5A 2L89A 1JRIA 4KUDK 3NTHA 2VYTA 4KT0E 3CCMT 1YBYA 1VIFA 4DPGA 4BB7A 4L87A 3CCRA 1YJ9T 3V8KA 3JCMe 4FU6A 1LNXA 1C0AA 1M9SA 4HT4A 4A4KA 3OYGA 3PMIA 3PIOA 4P3PA 1NE8A 2RHUA 5KNNA 5KE2A 2Q7HA 3QJYA 4DA4A 3JCMX 3E19A 1RI0A 3OYBA 3JCMf 3LWIA 1QVGS 3GIBA 1YJWA 1MGQA 4WF2A 4J7FA 2XIDA 2DPPB 2K2VA 1H4VB 3QHSA 4IUPA 2R5AA 1VQLT 4C0GA 3QPHA 1Q86C 1Y71A 1ASYA 2FB7A 1M5Q1 1NJ1A 3CC4T 4RQEA 1YI2T 3RUXA 2EJFA 5GAN7 3HRUA 5GAOp 4MZPA 1YFRA 1BIBA 4J6WA 5HKCA 5CVIA 3CPWA 3CCMA 4MDXA 3JSCA 2H3JA 3MO8A 1LOJA 2QXFA 1Q86U 3UPUA 1U1SA 3PMTA 1WQWA 3P8TA 4N4HA 5K1XA 3HP9A 1H4TA 2GFUA 2ZPEB 3V8LA 5C53B 4BE1A 5D6YA 3CCLT 1KOGA 4XU1A 1BYMA 5DY9A 4JDSA 3A7UA 4G84A 3HKSA 2Q5HA 1ZHIA 2FYKA 4CH6A 4OF1A 1I4K1 4E7HA 3QYHB 1Y96A 1Y96B 3M57A 3JB9G 1VQLA 4P3NA 3SWNB 4EMKC 3DLMA 3G71T 4BI8B 3QBYA 3CC4A 1YI2A 2BIVA 2CJ9A 5A2QE 5I21A 2RJCA 3OBWA 3A8HB 3HXYA 1B70A 1B70B 1VQ5A 5K1PA 2K4YA 2O01E 2D0QB 2ODRD 3QIIA 5GAMh 3A32A 5CK9A 2P5IA 3OYNA 3HXVA 4C8QA 3VQXA 3CCJT 2JTFA 2AKWA 3E1SA 3CCLA 2RJFA 4Z02A 4M75F 4RCCA 5LJ3j 4PJOC 2EAYA 4J8OA 3NTKA 5I2SA 3HXUA 4M7AD 3L2VA 3CPFA 2VUBA 2RHZA 3NENA 1G5IA 4XTZA 4HWPA 4P71C 3RL6A 2I2LA 1Q82U 3S6WA 3HL8A 3SFMA 3MF1A 1Y07A 5CQYA 4H2YA 4EDUA 1G5VA 5LJ5d 4FT4A 2V8IA 4X9CA 1YITA 2F69A 2DU7A 2RJDA 1BBUA 3GLXA 4XTUA 2X4JA 5GMKi 5FROA 4H2UA 4ZN1A 2M16A 5GAN5 1ATIA 4KR2A 5LJ3g 3QO7A 3MEUA 4MZMA 1X01A 2NS6A 5HGQA 4L6V5 1YCYA 5I2MA 2ZPHB 1KHCA 4YROA 1P92A 2LC4A 2ZPFB 4OGCA 2E64A 5A0GA 1WJRA 3ZEHA 1X2GA 1HC7A 1SESA 4GLKA 4PKCC 2OTLT 2F5TX 4BE2A 3HFOA 5CQXA 3G1ZA 3VYGA 1S72T 4AH6A 1W66A 5LJ3e 1YHQT 3QO3A 1G3SA 4V2SA 4C92B 4TVAA 2KVQG 1Y7XA 1VIEA 4HVCA 2PVOB 1NZ9A 4PG3A 4XEMA 2Q5IA 3C4SA 3OSVA 2LCLA 4P72A 2DDZA 5LJ3f 4ZGEB 1L0WA 1UEBA 2X35A 4C92G 1X55A 3M9QA 1OI1A 1ADJA 2HQXA 3JCMc 4ATOA 1M1GA 3CMET 4II1A 3CXCS 2LVMA 3ASKA 3TEGA 2IY5B 4XQ3A 1W2BA 2OTLA 2ZPBB 2VV5A 3OYHA 3I7FA 4YRIA 4OB1B 1S72A 4TVYA 4WI1A 2JVVA 4JRKA 4VUBA 3PT9A 5FU7B 4H2SA 3AHUA 2YRVA 4BDZA 2O4XA 1WJSA 3MP6A 3X24B 3LLRA 4YRJA 4C5EA 4LDUA 2C06A 2DXCA 2PU9B 2RH2A 4ZGJB 3VJPA 3JB9I 4IUTA 4IUVA 3CMEA 2CZ1B 1VQ9T 1VUBA 2RK1A 4E7KA 3TEHA 3TEHB 1NNHA 2ZTGA 3BDUA 4QQ6A 4D6WA 3PNWC 2R58A 1NJ6A 5J26A 4PJOF 1D3BA 2C8MA 3VUBA 3MP8A 4O5VA 1X54A 2CJBA 4YCVA 1BI3A 4A4HA 3QO8A 4C8QD 1I5LA 4P3OA 1V29B 2EYQA 2A7YA 4ZN3A 3RMQA 1RL2A 3MEVA 2ARUA 4J6YA 4TWAA 2HAXA 1EOVA 3M53A 1OYXA 1PYSA 1VQ9A 4B9WA 2LDMA 4M7AB 1N27A 2D9TA 2DAQA 4M78F 2E70A 1O75A 4O6JA 1GXIE 4YP0A 3OS1A 4Y91A 3GF5A 1K73C 1EIFA 5GAMd 4EMHA 3RKXA 2YLCA 3SD4A 1M4ZA 4M75A 4Q5WA 3CEYA 1N9SA 4ZTJA 1VQMA 3QXEB 2E6NA 1K73U 3HFNA 2XICA 4C92E 1VQ6T 4K86A 5ELNA 4YRGA 4P75A 2L5QA 3H6ZA 4J83A 4CRIA 3OS0A 3M54A 2RHYA 2LT4A 3OYEA 4LDYA 1WYDA 1K8AC 1H4QA 4OMFB 2IVWA 4BY6C 2C7IA 4F7UF 4N0AA 5CCAA 5J3BA 5LJ3h 2DJZA 1QE0A 4C92D 2QI2A 3DKMA 5KE3A 4JLGA 3VQWA 5EG2A 3INZA 1QVGA 1OZ2A 1K8AU 4YRNA 3EFRA 2E5QA 4LDWA 3OMCA 1Z7NA 2ARSA 3CCVT 3MCAB 2ZR2A 2ZGWA 2XTIA 2EKOA 3A8LB 1JJ2S 4PL6A 1ZBXA 2ZZDA 2X4XA 1VQ6A 3OW2S 2VXEA 5GAOr 4YRRA 4TQFA 1NYQA 2K3YA 1BI0A 3TCJA 4K88A 4KUIA 2I4LA 3A8OB 1E1TA 3L42A 2A8EA 1VQ7T 2Y4YA 3OYLA 1WNLA 2DXUA 3A74A 2NLUA 3HRSA 2QEXT 5CKHA 3QKJA 3A7AA 2X4YA 3CC2T 2XD0A 2DU5A 1B7YA 2IG0A 5GMKh 5LJ5j 3JCMP 1WLEA 3QJ6A 3Q1JA 3MF2A 1YJ9A 1SRYA 3DSQA 5M9OA 1WU7A 2LX9A 4DQ2A 3ME9A 1UGPB 3L2ZA 5KH6A 4C0FA 2MWPA 3M4GA 1JJCA 1JJCB 1QF6A 3OY9A 2A3LA 2XK0A 5FU6B 1AHJB 1FX7A 2RO0A 3NELA 1EVKA 5GANh 4X9DA 2JN0A 5D6XA 4MZTA 4IUUA 2XHCA 1ASZA 1VQKT 5DM7R 3PZCA 4JLIA 1G3WA 1NPPA 4IURA 4YRFA 3OSSC 3VQYA 5LJ5g 1VQ7A 2E41A 3SWNC 3OS5A 3CCQT 3JCMJ 2BKDN 5CKBA 3I56T 2V8KA 1ADYA 3VQVA 4XTVA 3VKIA 1M90U 3P8DA 4M7AE 4BI4A 4FIBA 5GAN3 1FXXA 4C8QB 3RERA 1N9WA 1Q82C 2AKWB 4M77F 2EJGA 3P8HA 2LTOA 5LJ5e 4JUVA 4RMOA 2PMEA 1U8RA 3WVDB 4C8QG 1VQKA 1IZ6A 4PJOA 3JCMW 3X28B 4E7LA 3W3SA 4N4GA 3G71A 3DLLA 5LJ5f 2MMPA 4P71A 2QTXA 4CS4A 1NJIC 4M7DF 3ERRA 3MHXA 2DD5A 3RACA 3X20B 2AHJB 3I56A 3E9GA 3JCMQ 4RCBA 4R55A 1XTDA 3JAME 4LDXA 4PJOG 3DB3A 4BDYA 3HRTA 4KBMB 4RG2A 3JRZA 2ARTA 3OYKA 3BFMA 3FC3A 1KQSS 3CCJA 2E12A 3C95A 4MMKA 4A4GA 1NJIU 4HWSA 5D6WA 2K57A 4M78A 4M78B 3S3OA 4E51A 1IL2A 3M5AA 4HT8A 2ZCEA 3CMQA 5HK0A 2CJAA 1KG1A 3G6ET 1H641 4JRIA 3A5YA 2MI6A 2MF2A 1NPRA 2R5MA 3NETA 4YPFA 5GAN6 3OYMA 4Q6GA 4NOYA 1PSEA 4M78G 5HK3A 3NTIA 2DTIA 3RIRA 3OBYA 3OQ5A 3G7ZA 3ER0A 3QSUA 1Z7MA 1BKBA 3BY7A 2CZ0B 4TVAB 3FB9A 3JCMh 2E6ZA 4ZTZB 3CC7T 3M4QA 3OYFA 4C92C 2OTJT 5FRNA 4H02A 2HBPA 3CXCA 2E5AA 1USYC 2CKKA 3A8GB 1N8RC 2RJEA 3FDRA 2LT1A 3N5BB 3LSSA 3JB9H 3IKLA 2WACA 3MEAA 4H2VA 2GCXA 2ZZGA 4LVLA 1NYRA 4G85A 3PIPA 4F7UA 4A53A 2DXBA 1I81A 1VQ8T 3J80E 4TQDA 4JS4A 5C0MA 2J3MA 5LJ3d 3G6EA 5ELOA 1WJQA 4P5NA 4OP0A 3PFSA 1N8RU 3S3MA 2EIFA 3CBMA 3ZFJA 3UH0A 3JCMb 3JB9F 3RGLA 1KD1C 4BI3A 4F7UG 4QW2A 1YHQA 2VGNA 1Q7YC 5GAMj 3V8JA 3IG2A 3OA6A 3GOXA 3CC7A 2X4WA 3QUIA 3OS2A 5FU7C 3PGGA 2DKGA 1LYLA 1VQNT 1E24A 2O4XB 1EIYA 1SERA 3QZ9B 2P0LA 3META 5GAN8 2B8AA 1KC8C 1KD1U 2QA4T 1Q7YU 3QG1A 4RQFA 2GQVA 3LWHA 4ME7A 2ZT6A 2ALYA 1IREB 2ALYB 4FM4B 2GF7A 3ICAA 1VQ8A 4C8QE 5CKEA 1YB3A 4HWOA 4B9XA 3LX7A 5C52B 5GAMg 1KC8U 1WPYA 4C0DB 4KR3A 3G4ST 3FRNA 2LNVA 4J6XA 1N9RA 4CS2A 1D3BB 1G3TA 3J81E 4HA8A 2LQ8A 4C5HA 4UP7A 2KDSA 4P74A 4PHCA 2ODRC 3URGA 5GANd 3A31A 2EQKA 4PNOA 4XK8E 1YJNT 3BDLA 2QHVA 1B76A 2QHTA 2G3RA 2XDDA 3OYYA 2QA4A 3OYIA 5GAMe 2P4TA 1BBWA 2CYZB 1X2HA 3IALA 1FWZA 4GY5A 1PYSB 2HD0A 5DLOA 1H4SA 4PJOD 3V7RA 1SSFA 4C5GA 3LW5E 4YRSA 3L2QA 2FL7A 4M7AC 3CBOA 1X75C 1NJ5A 3RMSA 5GAMf 3M58A 1I8FA 3MEYA 2PVGB 2DEQA 5HY6A 2Y4XA 3CMAT 2DD4A 4HCCA 3BW1A 1B34A 3J7AF 1KMMA 3A7RA 3CCST 4M77A 4M77B 3M4PA 1G5HA 2QDYB 4YCUA 3RESA 4P73A 2DTOA 2M9UA 2KY9A 4M75B 1YIJT 4R56A 1FYFA 2CGHA 1UGRB 4H2XA 4H2XB 5GAN2 3HXWA 2Q7EA 1WQ7A 2P0PA 4M78D 4M77G 3WXMB 2Y90A 3L2RA 2P0QA 2ZPIB 3FEOA 3HXXA 4M75G 4C92F 2E1HA 5CKDA 4M7DA 3M55A 4M7DB 4OB2B 5GAN4 2RI5A 2YLBA 2FVUA 4KULA 1YJWT 3P8VA 1YFSA 2AMCA 5CO7A 1JB0E 4C5IA 2ZZEA 3UT1A 4M7DG 3CMAA 2DK3A 1JJ2A 1M8VA 4XEOA 1QVFS 3QDRB 1RIQA 2QQAA 2RHSA 2RHSB 4YREA 3PCOA 3T9NA 3PCOB 4FL6A 3OW2A 4L5GA 4WJ3M 4HWRA 4ZGDB 2ZT5A 1YIJA 4L59A 1MHNA 3MP1A 2JTMA 3MEWA 4NS5A 3SB2A 4N4IA 4BD3A 2XGTA 2JOYA 1O9SA 5IT9E 3GP8A 1EFWA 2ZCFB 2ZXFA 2I4MA 4CH4A 3C94A 2ZIMA 2Q7GA 3FLGA 1UGQB 3VBBA 4YRKA 1M1FA 2KMTA 3JCMd 4HT9A 5KCHA 4TVWA 4LVKA 5LL6S 5L8RE 2QQBA 3RKWA 1VQOT 1B7YB 1NJ2A 4ELZC 2M1HA 2K5FA 4A4FA 2LQKA 3LGFA 4CH3A 3QZ5B 3TREA 5J39A 3JB9J 3F70A 3M4YA 4QVDA 3KXTA 1QP3A 4J15A 2WSFE 2DVEA 3OYAA 4LNSA 3FIFA 1VQ5T 3HXZA 4KQEA 3CCVA 2P0KA 1BI2A 4PLIA 3UGQA 2CZ6B 4EMGA 3RKYA 5A0LA 3LGLA 2DQ0A 3M59A 1EVLA 4RKUE 5FU6C 1M90C 3S3NA 2I4OA 4DOWA 3CPWS 3EAEA 2DZCA 5IAYA 4MDWA 4H2TA 4E7IA 4EMKA 2QEXA 4EMKB 3CC2A 2YHTA 4XU3A 2BUDA 1VQOA 4BE0A 1NJ8A 4HKEA 2RHXA 3SWNA 1VQ4T 3GNGA 4EPCA 3L4GA 1HTTA 3L4GB 4UP8A 4ZTUB 2K3XA 4LD9K 2JNGA 1YITT 4M7AF 2HQEA 1G3YA 2DXTA 3REUA 4NL3A 4E7JA 4UPAA 4C8QC 1HK9A 3O8VA 4NCXA 2VGMA 4M77E 2CS7A 5GAOn 4X34A 4QVZA 4HCBA 4ZIBA 4J5YA 4M75E 3CCUT 5GAOm 2ZT7A 4O2DA 4C0ZA 2OAUA 5AYFA 4PJOB 2EJ9A 2CZ7B 4FSXA 2RI3A 1KMNA 1R8OB 2D6FA 1PSFA 4A4EA 4BACA 4ZTFA 1QVPA 3DB4A 4CS3A 4NL2A 4QQGA 1Q81C 3WQZA 1KQSA 3CCQA 4DOVA 4OVAA 5GMKm 2EQUA 3L1AA 4UC4A 5F5WA 3VU3C 4M77D 4M7DE 1G51A 4QQDA 4OB3B 1VQ4A 3HTZA 4EX5A 3QTCA 4J7IA 3VV0A 3E9IA 5CR2A 4PLLA 4M75D 2XKOC 3A5ZA 3A5ZB 3ZBDA 4BUGA 2K5IA 3QNEA 3VUZA 1Q81U 2EQMA 2QHSA 3CBPA 2DO3A 3HPWA 5IN1A 2DIQA 5FRMA 5FLXE 11ASA 3FJPA 4MMLA 4M78C 4CI0C 4M7DD 3TUPA 1QW1A 2JUFA 2KAFA 4BW9A 1VQZA 3CCUA 4EO4A 3MQZA 2EWNA 4LDVA 2XI9A 2E65A 3CCET 1XNIA 5GMKj 2QHUA 2ZIOA 4JRQA 1LJOA 3KUFA 4FT2A 1SETA 5GAOq 3CD6T 3JCMV 4H2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K1P A;  4BWA A;  2VC8 A;  4P74 A;  4PHC A;  4C92 A;  2ODR D;  2ODR C;  3OD1 A;  5GAN d;  3A31 A;  4YRN A;  3EFR A;  3KFU A;  1JBM A;  5GAN j;  3HY1 A;  4PNO A;  1Z7N A;  2ARS A;  4P72 C;  5GAM h;  2QHV A;  3A32 A;  1USY A;  1B76 A;  2P5I A;  2QHT A;  2ZR2 A;  2ZGW A;  2XTI A;  3HXV A;  4C8Q A;  4WJ4 A;  3VQX A;  1GGM A;  12AS A;  4F7U B;  2AKW A;  5GAM e;  1BBW A;  1X2H A;  2I4N A;  3IAL A;  4XU0 A;  3LSQ A;  1PYS B;  2VXE A;  4M75 F;  5GAO r;  4RCC A;  3LC0 A;  4YRR A;  5LJ3 j;  3E9H A;  2ZNI A;  2ZNJ A;  4TQF A;  1H4S A;  3V7R A;  4PJO D;  4PJO C;  1NYQ A;  2EAY A;  4YRS A;  4K88 A;  5C51 B;  1BIA A;  4UP9 A;  3HXU A;  4M7A D;  4M7A C;  2I4L A;  4YRM A;  1E1T A;  4HWT A;  3UFG A;  1NJ5 A;  3NEN A;  1G5I A;  4XTZ A;  5GAM f;  4HWP A;  4P71 C;  2RA2 A;  1WNL A;  3RL6 A;  2I2L A;  1I8F A;  3MEY A;  2DXU A;  3A74 A;  2DEQ A;  2IY5 A;  3HRK A;  2DZ9 A;  3MF1 A;  3A7A A;  3BW1 A;  3HFZ A;  1B34 A;  3HFZ B;  5GAN g;  2ZIN A;  4H2Y A;  5LJ5 d;  1KMM A;  2DU5 A;  3A7R A;  3IKM B;  4M77 A;  4M77 B;  3M4P A;  4X9C A;  1B7Y A;  1G5H A;  5GMK h;  5LJ5 j;  3JCM P;  1WLE A;  4YCU A;  2DU7 A;  3RES A;  4P73 A;  3R07 A;  1BBU A;  3HY0 A;  2DTO A;  4XTY A;  3MF2 A;  1SRY A;  3DSQ A;  4M75 B;  4XTU A;  1EIY B;  2RM4 A;  5GMK i;  1WU7 A;  3NEM A;  1FYF A;  2CGH A;  4DQ2 A;  5GMK e;  4H2U A;  5GAN 5;  4H2X A;  3L2Z A;  4H2X B;  5GAN 2;  3HXW A;  2Q7E A;  1WQ7 A;  1ATI A;  3M4G A;  1JJC A;  1JJC B;  4KR2 A;  5LJ3 g;  1QF6 A;  4M78 D;  3QO7 A;  1B8A A;  1X01 A;  4M77 G;  2Y90 A;  5HGQ A;  3NEL A;  3JB9 D;  1YCY A;  1TH7 A;  1KQ1 A;  3HXX A;  1EVK A;  2PMF A;  5GAN h;  4X9D A;  4M75 G;  2JN0 A;  4C92 F;  2E1H A;  1E22 A;  4M7D A;  4M7D B;  4YRO A;  1ASZ A;  5GAN 4;  2E64 A;  1X56 A;  3PZC A;  2YLB A;  4JLI A;  1E1O A;  5GAN e;  3P8V A;  4C8Q F;  1X2G A;  1YFS A;  1HC7 A;  4YRF A;  2AMC A;  1SES A;  3VQY A;  5GAO l;  5LJ5 g;  2ZZE A;  1U1T A;  2E41 A;  4K87 A;  3SWN C;  3HFO A;  4YRL A;  3G1Z A;  4RDX A;  2G4C A;  3UGT A;  3JCM J;  4M7D G;  4AH6 A;  1M8V A;  4XEO A;  1ADY A;  3VQV A;  4XTV A;  2EL9 A;  4PJO E;  1W66 A;  2RHQ A;  2RHQ B;  5LJ3 e;  5GAN f;  3QO3 A;  1RIQ A;  2RHS A;  2RHS B;  4YRE A;  4V2S A;  3PCO A;  4C92 B;  3PCO B;  2ZR3 A;  4M7A E;  4TVA A;  2ZZF A;  4WJ3 M;  3EFS A;  5GMK l;  4HWR A;  4HVC A;  2ZT5 A;  5GAN 3;  4P74 C;  4PG3 A;  2DQ3 A;  4XEM A;  4CH5 A;  4C8Q B;  2Q5I A;  3SB2 A;  3RER A;  2XGT A;  1N9W A;  5LJ5 h;  4P72 A;  4YRQ A;  2AKW B;  5LJ3 f;  4M77 F;  2DDZ A;  4YCW A;  2EJG A;  1L0W A;  1EFW A;  1KQ2 A;  1HXD A;  2DTH A;  4YYE A;  4C92 G;  2J3L A;  5LJ5 e;  1X55 A;  2ZXF A;  2I4M A;  3REX A;  4JUV A;  1ADJ A;  2PME A;  4CH4 A;  2ZIM A;  2Q7G A;  3P8Y A;  3JCM c;  4RMF A;  3V7C A;  3VBB A;  4C8Q G;  4YRK A;  4PJO A;  3JCM W;  1YGB A;  4M78 E;  2CIM A;  3TEG A;  3JCM d;  4HT9 A;  2IY5 B;  3W3S A;  4TVW A;  4M7A A;  3HFV A;  5LJ5 f;  4XQ3 A;  4P71 A;  2QTX A;  1B34 B;  4CS4 A;  3RKW A;  4M7D F;  4XTX A;  3ERR A;  3HSB A;  3RAC A;  3I7F A;  1B7Y B;  1NJ2 A;  4TTV A;  4YRI A;  3JCM Q;  4TVY A;  4RCB A;  4XTW A;  3BJU A;  4WI1 A;  4CH3 A;  4A54 A;  4Q15 A;  4YRC A;  4M77 C;  3JB9 J;  4PJO G;  3HRI A;  4QVD A;  4JRK A;  4J15 A;  4P73 C;  2DVE A;  4XU2 A;  4LNS A;  4M75 C;  3FIF A;  5CAI A;  4M7A G;  3HXZ A;  4H2S A;  3AHU A;  4KQE A;  2ART A;  4YDQ A;  2RD1 A;  4YRT A;  4OLF A;  3BFM A;  1YFT A;  4QVC A;  3UGQ A;  4EMG A;  4MMK A;  4HWS A;  3RKY A;  2DQ0 A;  3RF1 A;  1EVL A;  4YRJ A;  2ZT8 A;  2K57 A;  4M78 A;  4M78 B;  5E3I A;  4P75 C;  4E51 A;  1IL2 A;  2I4O A;  3JCM g;  2RB6 A;  1EQR A;  2E3C A;  4HT8 A;  2ZCE A;  3CMQ A;  4M7D C;  2CJA A;  3JB9 I;  1H64 1;  4JRI A;  2AMC B;  3A5Y A;  2DZC A;  3NET A;  4YPF A;  5GAN 6;  3TEH A;  3TEH B;  2VXF A;  2E10 A;  4Q6G A;  4NOY A;  4M78 G;  4H2T A;  4N0A C;  4EMK A;  4F7U E;  2HNI A;  4EMK B;  1NNH A;  2DTI A;  4X5O A;  3RIR A;  2YHT A;  2ZTG A;  4XU3 A;  1NJ8 A;  3BDU A;  1J5W A;  3SWN A;  3QSU A;  1Z7M A;  3BY7 A;  3V7S A;  4TVA B;  1NJ6 A;  4YRP A;  4PJO F;  3FB9 A;  1D3B A;  3QO5 A;  3JCM h;  4ZTZ B;  3M4Q A;  1JRI A;  3L4G A;  1HTT A;  2C8M A;  3L4G B;  4UP8 A;  4ZTU B;  4C92 C;  4M7A F;  2DXT A;  1X54 A;  4H02 A;  3REU A;  4DPG A;  4NL3 A;  2CJB A;  4YCV A;  4L87 A;  3V8K A;  3QO8 A;  3JCM e;  2E5A A;  1USY C;  1LNX A;  1C0A A;  4UPA A;  4C8Q D;  4C8Q C;  1HK9 A;  1I5L A;  4P3O A;  4P3P A;  4NCX A;  3LSS A;  3JB9 H;  3IKL A;  4H2V A;  4M77 E;  5KNN A;  2ZZG A;  5GAO n;  2Q7H A;  4ZIB A;  2ARU A;  1NYR A;  4J5Y A;  4G85 A;  3JCM X;  4J6Y A;  4TWA A;  4M75 E;  4F7U A;  5GAO m;  2ZT7 A;  4O2D A;  3JCM f;  1EOV A;  4A53 A;  3GIB A;  1I81 A;  4PJO B;  1MGQ A;  4WF2 A;  4TQD A;  5ELO A;  2EJ9 A;  2J3M A;  5LJ3 d;  1PYS A;  1H4V B;  3QHS A;  1KMN A;  4OP0 A;  4M7A B;  4M78 F;  4CS3 A;  3UH0 A;  4NL2 A;  3WQZ A;  3JCM b;  1ASY A;  2FB7 A;  3JB9 F;  4YP0 A;  5GMK m;  1M5Q 1;  3RGL A;  1NJ1 A;  3L1A A;  4Y91 A;  4F7U G;  4RQE A;  5F5W A;  3RUX A;  3VU3 C;  4M77 D;  4M7D E;  1G51 A;  2EJF A;  5GAM d;  3HTZ A;  4EX5 A;  5GAN 7;  3QTC A;  4EMH A;  3E9I A;  3RKX A;  5GAO p;  2YLC A;  5GAM j;  3V8J A;  1YFR A;  3IG2 A;  4M75 D;  1BIB A;  4J6W A;  3A5Z A;  3QUI A;  3PGG A;  3QNE A;  2DKG A;  1LYL A;  1E24 A;  4M75 A;  1EIY A;  1SER A;  1LOJ A;  1N9S A;  2P0L A;  1U1S A;  1WQW A;  3P8T A;  5GAN 8;  5K1X A;  2QHS A;  1H4T A;  5C53 B;  3V8L A;  3HFN A;  11AS A;  3FJP A;  4MML A;  4M78 C;  4RQF A;  1KOG A;  4C92 E;  4XU1 A;  4M7D D;  5DY9 A;  4K86 A;  5ELN A;  2ZT6 A;  3A7U A;  2Q5H A;  4G84 A;  3TUP A;  2FYK A;  2ALY A;  2ALY B;  4YRG A;  4P75 A;  4BW9 A;  1VQZ A;  4EO4 A;  2EWN A;  3ICA A;  4CH6 A;  4C8Q E;  2E65 A;  1YB3 A;  4HWO A;  1I4K 1;  1WYD A;  5C52 B;  1H4Q A;  1Y96 A;  5GAM g;  1Y96 B;  5GMK j;  1WPY A;  3JB9 G;  2C7I A;  2QHU A;  4P3N A;  4KR3 A;  3SWN B;  4EMK C;  4F7U F;  4N0A A;  4J6X A;  2ZIO A;  1N9R A;  1LJO A;  4CS2 A;  1D3B B;  5LJ3 h;  2DJZ A;  4HA8 A;  2CJ9 A;  1QE0 A;  5I21 A;  4C92 D;  1SET A;  4UP7 A;  5GAO q;  3HXY A;  1B70 A;  1B70 B;  3JCM V;  4H2W A;  3VQW A;  3INZ A; 
#chains in the Genus database with same CATH topology
 4BWA A;  2VC8 A;  3CCU Q;  4IIO A;  4C92 A;  2JZ2 A;  1SF9 A;  3OD1 A;  2KRS A;  3TU4 K;  3OYJ A;  3KFU A;  1JBM A;  3M0P A;  5GAN j;  5CIU A;  3HY1 A;  4P72 C;  2F2V A;  3L2W A;  1USY A;  4QKU A;  5FWC A;  2EGE A;  3OYD A;  1ACM B;  1CKA A;  2WSE E;  4WJ4 A;  3QYG B;  2XDB A;  1UHF A;  1KFZ A;  1GGM A;  1NLP C;  12AS A;  1Q82 R;  4F7U B;  1AWX A;  1VYT A;  1GFD A;  1VYV A;  2HMA A;  2I4N A;  1B7T A;  4XU0 A;  3LSQ A;  3EHR A;  2KSS A;  3LC0 A;  3NFC A;  3E9H A;  2ZNJ A;  2ZNI A;  3UDC A;  2RI2 A;  2COZ A;  3A8M B;  5C51 B;  3C12 A;  1BIA A;  3CCE A;  2PVD B;  2O31 A;  4UP9 A;  4YRM A;  1WGS A;  1XOV A;  2DBK A;  4HWT A;  3UFG A;  1NLO C;  2RA2 A;  4RG8 A;  2IY5 A;  3HRK A;  4FYW B;  2DZ9 A;  4J9F A;  3GPL A;  3PTA A;  3HFZ A;  3HFZ B;  4JJB A;  5GAN g;  1AWJ A;  2ZIN A;  1NJI R;  3IKM B;  2M0O A;  4A63 B;  3CD6 A;  3R07 A;  2OTJ A;  3HY0 A;  5A0D A;  3P8B B;  4XTY A;  2R57 A;  3G6E Q;  2NUT A;  1EIY B;  2RM4 A;  3NEM A;  4JPB W;  1UFF A;  5GMK e;  2ZPG B;  1D1A A;  2BTT A;  1DJ7 B;  3VYH B;  3OYC A;  1X6O A;  1W2B S;  1SG5 A;  1GRI A;  1B8A A;  3X25 B;  1Y57 A;  3MKD A;  1WI7 A;  2KQW A;  1IHV A;  1N6A A;  3JB9 D;  1TH7 A;  1UGS B;  1KQ1 A;  2PMF A;  4OB0 B;  1E22 A;  2ZAE A;  1H3Z A;  3CC7 Q;  1IO6 A;  4J9D A;  4JS5 A;  2CH4 A;  1X56 A;  1M2V B;  1E1O A;  1WFW A;  5GAN e;  5KYY B;  2OTJ Q;  4C8Q F;  4DEX A;  5KCO A;  1SKU B;  3EH2 A;  4ELY C;  3EGD A;  3SDZ A;  3EGD B;  2QQR A;  1EX4 A;  5GAO l;  2CP6 A;  2HSP A;  3EG0 A;  4C0D C;  2AIR B;  1U1T A;  2FPD A;  4K87 A;  1SSH A;  3LH0 A;  3I9Q A;  5IHN A;  4YRL A;  4RDX A;  4AFU C;  2G4C A;  3UGT A;  3H8Z A;  2CH4 W;  2HBW A;  2PUO B;  1PNJ A;  2EL9 A;  4PJO E;  5C6S A;  2RHQ A;  2RHQ B;  5GAN f;  3OB9 A;  4E47 A;  4OGE A;  2ZR3 A;  2ZZF A;  1VQ8 Q;  3EFS A;  5GMK l;  1VQP T;  4LVM A;  1VQN A;  5IH2 A;  2DF6 A;  2LJ0 A;  3I55 T;  4P74 C;  2DQ3 A;  3KBG A;  1QVF P;  3UWN A;  4CH5 A;  4CC4 B;  1I07 A;  2D8H A;  2A28 A;  4LE9 A;  5LJ5 h;  1QP2 A;  2QQS A;  4CC7 A;  4YRQ A;  4YCW A;  1WHG A;  4WTO B;  2LRQ A;  5I11 A;  1VQM T;  1KQ2 A;  1N8R R;  1K9M C;  1HXD A;  2DTH A;  1OOT A;  4YYE A;  4LVI A;  2J3L A;  1VA7 A;  1NEG A;  2XDP A;  3REX A;  1OZ3 A;  2HEQ A;  1JEG A;  3P8Y A;  2KK4 A;  5KYU B;  4RMF A;  1KHI A;  3X26 B;  1UB4 A;  3V7C A;  1BB9 A;  4YTL A;  3M0S A;  1IHW A;  3E9F A;  1YGB A;  4M78 E;  2CIM A;  4Y28 E;  1VQN Q;  2EQJ A;  4LD6 A;  2GGR A;  3G4S A;  3HHT B;  4M7A A;  2GTO A;  3HFV A;  3GNF B;  1K9M U;  1M1K C;  1B34 B;  4XTX A;  4LVJ A;  3HSB A;  4XAX B;  2WSC E;  4TTV A;  4FCY A;  4XTW A;  3BJU A;  2XU8 A;  5DLQ E;  1KD1 R;  2PQW A;  4A54 A;  4Q15 A;  2K9G A;  4YRC A;  4M77 C;  4IUQ A;  3HRI A;  1Q7Y R;  4P73 C;  1MMG A;  1ZQ1 A;  1W4S A;  2RHI A;  4XU2 A;  4OMQ A;  3VRZ A;  1VQP A;  4M75 C;  5CAI A;  3CCR T;  2KRM A;  4M7A G;  3EFO B;  3I55 A;  1YJN A;  1AVZ C;  4YDQ A;  2IPO B;  1ZSZ A;  2IIM A;  2RD1 A;  4YRT A;  4OLF A;  1YFT A;  4QVC A;  1SRL A;  4KGV B;  1M1K U;  5AT1 B;  4IKF A;  1XQH A;  3R6O A;  1IGQ A;  3G4S Q;  3RF1 A;  4JJN K;  2ZT8 A;  1QWF A;  3OMG A;  2QQ9 A;  2EFI A;  4HXJ A;  5E3I A;  2JT4 A;  8ATC B;  1KC8 R;  4P75 C;  1NM7 A;  4HCZ A;  1NEB A;  3JCM g;  2RB6 A;  1EQR A;  2DET A;  2E3C A;  1QVF A;  2QAZ A;  4M7D C;  5CKF A;  3TEE A;  3LYI A;  2AMC B;  5D7U A;  1TUD A;  2HQH A;  2GFA A;  3WVE B;  4J9B A;  1D0Y A;  1D1B A;  4TVR A;  1MND A;  2FHD A;  2VXF A;  2E10 A;  2PUK B;  2RK2 A;  2CP5 A;  4BY6 B;  1YJN Q;  4N0A C;  2L8D A;  3CPW P;  4F7U E;  2HNI A;  2DIG A;  2ENM A;  3M56 A;  3L2U A;  2V8J A;  4X5O A;  1R77 A;  4JRP A;  2CRE A;  2LCC A;  2L3R A;  2MAM A;  2MWO A;  3CCS A;  1J5W A;  2VVK A;  4PFP A;  3V7S A;  2F5K A;  3HTR A;  1A0N B;  4YRP A;  1BI1 A;  2XG8 D;  2K5L A;  2MIO A;  1H3H A;  3QO5 A;  4LXC A;  2L89 A;  1JRI A;  4KUD K;  3NTH A;  5EC7 A;  1G8X A;  2VYT A;  4KT0 E;  3CCM T;  1YBY A;  2V1Q A;  1VIF A;  4DPG A;  4BB7 A;  4L87 A;  3CCR A;  1YJ9 T;  3V8K A;  3JCM e;  4FU6 A;  1OEB A;  1ZX6 A;  1LNX A;  1WHM A;  1C0A A;  1M9S A;  4HT4 A;  2GTJ A;  4A4K A;  3TVT A;  3OYG A;  2YRC A;  3PMI A;  3PIO A;  4P3P A;  1NE8 A;  2MYS A;  4HVW A;  2KXD A;  2FZC B;  2RHU A;  5KNN A;  3CMA Q;  5KE2 A;  2Q7H A;  3QJY A;  4DA4 A;  1EFN A;  4JJD A;  3JCM X;  2X9H A;  3CCS Q;  3E19 A;  1RI0 A;  3OYB A;  3JCM f;  3LWI A;  1QVG S;  3GIB A;  1YJW A;  1MGQ A;  1LCK A;  4WF2 A;  2J05 A;  4J7F A;  1WHJ A;  2XID A;  2DPP B;  2K2V A;  1H4V B;  3QHS A;  1WXB A;  4IUP A;  2K6D A;  1C0M A;  1SHF A;  2R5A A;  3REB B;  2KI7 A;  3CCR Q;  3THK A;  1VQL T;  4C0G A;  3QPH A;  1Q86 C;  1Y71 A;  2L0A A;  2RQU A;  1ASY A;  2FB7 A;  1M5Q 1;  1NJ1 A;  3CC4 T;  4RQE A;  2RN8 A;  1YI2 T;  3RUX A;  2MK5 A;  3VS3 A;  2EJF A;  5GAN 7;  2HSE B;  3HRU A;  5GAO p;  2RQR A;  4MZP A;  3PVQ A;  1YFR A;  1BIB A;  2KXC A;  3TQ7 P;  4J6W A;  5HKC A;  5CVI A;  1W70 A;  3CPW A;  4KH1 B;  3CCM A;  4MDX A;  2DMO A;  1YJW Q;  3JSC A;  2H3J A;  3MO8 A;  1TS9 A;  1LOJ A;  2QXF A;  3VS5 A;  1Q86 U;  3UPU A;  4ESR A;  1U1S A;  3PMT A;  1WQW A;  4LNP A;  3P8T A;  4N4H A;  2FZK B;  5K1X A;  3KFV A;  1R0B G;  3HP9 A;  1H4T A;  2GFU A;  2ZPE B;  3V8L A;  5C53 B;  2YRD A;  2ABL A;  1OV3 A;  2RQV A;  4BE1 A;  5D6Y A;  3CCL T;  1KOG A;  4XU1 A;  1BYM A;  5DY9 A;  4JDS A;  3A7U A;  4G84 A;  3HKS A;  1C1A A;  3C0C A;  1TTH B;  1ZHI A;  2FYK A;  2Q5H A;  1X2K A;  4LUD A;  3TSW A;  2OI3 A;  2YUN A;  1UHC A;  4CH6 A;  2OX7 A;  2EKH A;  4DBQ A;  1TWB A;  4OF1 A;  1I4K 1;  1SHG A;  2EGA A;  4E7H A;  2DJQ A;  2JMA A;  2DFU A;  3QYH B;  1Y96 A;  1Y96 B;  3REA B;  3M57 A;  3JB9 G;  2DYI A;  1VQL A;  4P3N A;  1PC0 A;  4J9I A;  3SWN B;  4EMK C;  3DLM A;  1TUG B;  3G71 T;  4BI8 B;  2DER A;  2ROL A;  4DBF A;  2HZY A;  3QBY A;  3CC4 A;  1YI2 A;  2BIV A;  3EG1 A;  2CJ9 A;  1WXT A;  5A2Q E;  5I21 A;  2PTK A;  2RJC A;  3OBW A;  3A8H B;  3HXY A;  1CSK A;  1B70 A;  1B70 B;  1VQ5 A;  5K1P A;  3H0F A;  1UEC A;  2K4Y A;  2O01 E;  1UG1 A;  2D0Q B;  2ODR D;  3QII A;  1BK2 A;  5IHK A;  1MMD A;  2YT6 A;  5GAM h;  4FYY B;  3A32 A;  3R6N A;  5CK9 A;  2P5I A;  3OYN A;  2SEM A;  4C8Q A;  3HXV A;  3M0U A;  2G6F X;  4ZNX A;  2FZG B;  3CCJ T;  3VQX A;  1VQO Q;  2JTF A;  2ED0 A;  2RPN A;  2AKW A;  3E1S A;  3CCL A;  1NBE B;  2RJF A;  3CC4 Q;  4J9H A;  4Z02 A;  1YI2 Q;  1JQQ A;  2K79 A;  4M75 F;  4RCC A;  5LJ3 j;  1K4U S;  1PCX A;  2HKQ B;  4PJO C;  2EAY A;  4J8O A;  3EG2 A;  2EQI A;  2P4R A;  3NTK A;  1VQ5 Q;  5I2S A;  3HXU A;  4DBH A;  2GBQ A;  3L2V A;  4M7A D;  3ULR B;  3CPF A;  1WLP B;  2VUB A;  2RHZ A;  3NEN A;  1G5I A;  4XTZ A;  4HWP A;  4P71 C;  3I5S A;  3RL6 A;  2I2L A;  1AWO A;  1Q82 U;  3S6W A;  3HL8 A;  3SFM A;  3MF1 A;  1Y07 A;  5CQY A;  2KRN A;  4H2Y A;  4EDU A;  1G5V A;  5LJ5 d;  4D8K A;  4FT4 A;  2V8I A;  4X9C A;  1YIT A;  2F69 A;  2DU7 A;  2RJD A;  3CCL Q;  1BBU A;  3GLX A;  4XTU A;  2X4J A;  5GMK i;  4PFZ A;  1WHL A;  5FRO A;  2L3S A;  3EHQ A;  4H2U A;  2QAS A;  4ZN1 A;  2M16 A;  5GAN 5;  2DEU A;  1FMK A;  1ATI A;  4KR2 A;  2F2X A;  5LJ3 g;  3QO7 A;  2X51 A;  3MEU A;  4MZM A;  4JZ3 A;  5FWB A;  1X01 A;  2J06 A;  2KT1 A;  2NS6 A;  2L2P A;  5HGQ A;  4L6V 5;  1YCY A;  3SEM A;  5I2M A;  1SRM A;  1M30 A;  3VS2 A;  2ZPH B;  1KHC A;  2AT1 B;  4YRO A;  1P92 A;  2LC4 A;  2ZPF B;  4OGC A;  1YNZ A;  2E64 A;  2HL5 C;  1M90 R;  2D1X A;  5A0G A;  1YIT Q;  4FYX B;  1WJR A;  3ZEH A;  2C0I A;  3UF4 A;  1JXM A;  1X2G A;  1HC7 A;  2KYM A;  4IIM A;  2FEI A;  1SES A;  4GLK A;  4PKC C;  2OTL T;  4AFZ C;  2F5T X;  4BE2 A;  2LJ3 A;  1K76 A;  3HFO A;  5CQX A;  3G1Z A;  3VYG A;  1S72 T;  4AH6 A;  1N5Z A;  4PK4 A;  2F2W A;  3D7S B;  1W66 A;  5LJ3 e;  1YHQ T;  3QO3 A;  4M4Z A;  1G3S A;  2BZ8 A;  4LUE A;  4V2S A;  4C92 B;  1MUZ A;  4TVA A;  2KVQ G;  1Y7X A;  1VIE A;  4HVC A;  2PVO B;  1NZ9 A;  4PG3 A;  2MOX A;  2CP0 A;  4XEM A;  2Q5I A;  3C4S A;  1YP5 A;  3OSV A;  2LCL A;  4P72 A;  2DDZ A;  5LJ3 f;  1KK7 A;  4ZGE B;  1ABO A;  2F1L A;  2FPE A;  1L0W A;  1UEB A;  1BBZ A;  2X35 A;  4C92 G;  1X55 A;  1OPL A;  3M9Q A;  1OI1 A;  1ADJ A;  2HQX A;  2RF0 A;  2JJ9 A;  3JCM c;  1MV0 B;  4ATO A;  1MMN A;  1M1G A;  3CME T;  4II1 A;  3CXC S;  2LVM A;  3ASK A;  3CQT A;  3TEG A;  1AD5 A;  2CSI A;  2IY5 B;  4CC2 A;  1VYU A;  4XQ3 A;  3SHW A;  1W2B A;  2OTL A;  2ZPB B;  2VV5 A;  3OYH A;  3I7F A;  2GNC A;  1Q81 R;  4YRI A;  4OB1 B;  1S72 A;  4TVY A;  4WI1 A;  1PRL C;  2NUT B;  1OX9 A;  2JVV A;  1PD1 A;  1X27 A;  3BE3 A;  4JRK A;  4VUB A;  3PT9 A;  1PHT A;  5FU7 B;  3NGP A;  3CCE Q;  4H2S A;  3AHU A;  2YRV A;  3H9N A;  4BDZ A;  2O4X A;  1WJS A;  8AT1 B;  3MP6 A;  3X24 B;  3LLR A;  4YRJ A;  4C5E A;  4LDU A;  2VAS A;  1EZZ B;  2C06 A;  2DXC A;  2PU9 B;  2P84 A;  2LMJ A;  3MPU B;  2RH2 A;  3CD6 Q;  4ZGJ B;  3VJP A;  3JB9 I;  4IUT A;  1FMW A;  4IUV A;  3CME A;  2CZ1 B;  1VQ9 T;  1VUB A;  2RK1 A;  4E7K A;  2COW A;  3TEH A;  3TEH B;  4HVV A;  1NNH A;  1RAD B;  2NUP A;  2D8J A;  2ZTG A;  2J7I A;  3A98 A;  3BDU A;  4QQ6 A;  2YWW A;  4D6W A;  3PNW C;  2R58 A;  1NJ6 A;  2DBM A;  5J26 A;  4PJO F;  1D3B A;  1WHH A;  1X6B A;  4F04 B;  2C8M A;  3VUB A;  2SRC A;  3MP8 A;  4O5V A;  1X54 A;  2CJB A;  4YCV A;  2LNH B;  1BI3 A;  1KSW A;  4A4H A;  3QO8 A;  3CME Q;  2YDL A;  4C8Q D;  3RR6 A;  1FMV A;  1I5L A;  4J9G A;  4P3O A;  4X1V A;  1V29 B;  2EYQ A;  2A7Y A;  2EW3 A;  4ZN3 A;  3RMQ A;  1RL2 A;  3MEV A;  2CT3 A;  2KEA A;  2ARU A;  4J6Y A;  4TWA A;  1BCM A;  2HAX A;  4JJC A;  3M53 A;  1EOV A;  1OYX A;  2A36 A;  1PYS A;  2KE9 A;  1VQ9 A;  4B9W A;  2LDM A;  4M7A B;  1N27 A;  2NUZ A;  2D9T A;  2DAQ A;  4M78 F;  2E70 A;  1NYF A;  4FW2 A;  1X2Q A;  1O75 A;  2HKN A;  4O6J A;  1GXI E;  4YP0 A;  2HL3 A;  3OS1 A;  2JXB A;  4Y91 A;  3GF5 A;  1K73 C;  1EIF A;  5GAM d;  4EMH A;  1HYO A;  3RKX A;  2YLC A;  2QYZ A;  3VRY A;  3SD4 A;  1ZSZ B;  2AZS A;  2EPD A;  1HD3 A;  1M4Z A;  4M75 A;  4Q5W A;  3CEY A;  2EYX A;  1N9S A;  2CP7 A;  1YWP A;  4ZTJ A;  2YUP A;  1VQM A;  3QXE B;  2E6N A;  1K73 U;  1X43 A;  4Y92 A;  4Z88 A;  3HFN A;  1Z9Z A;  2XIC A;  4C92 E;  3H0I A;  5L23 A;  1GCP A;  1VQ6 T;  4K86 A;  5ELN A;  1OU9 A;  3NMZ C;  4YRG A;  4P75 A;  2FO0 A;  2L5Q A;  3H6Z A;  4J83 A;  1VQP Q;  4CRI A;  2RMO A;  3I55 Q;  3OS0 A;  2NYS A;  3M54 A;  3H0H A;  2RHY A;  2LT4 A;  3OYE A;  4LDY A;  1WYD A;  1K8A C;  1H4Q A;  4RTV A;  2DX1 A;  4OMF B;  2IVW A;  4BY6 C;  2C7I A;  1RAB B;  4RTX A;  4F7U F;  4N0A A;  2KT8 A;  5CCA A;  5J3B A;  1VQM Q;  1WHK A;  2EYW A;  5LJ3 h;  2DA9 A;  2DJZ A;  1B3Q A;  1QE0 A;  1X69 A;  4C92 D;  3H41 A;  1K9A A;  2DL8 A;  2QI2 A;  3DKM A;  5KE3 A;  4JLG A;  3VQW A;  5EG2 A;  3INZ A;  1QVG A;  1KIK A;  1OZ2 A;  3NPF A;  1K8A U;  4YRN A;  3EFR A;  2E5Q A;  4LDW A;  2BE7 D;  3OMC A;  1Z7N A;  2ARS A;  3CCV T;  3MCA B;  1IRX A;  2V1R A;  4WCI A;  2ZR2 A;  2ZGW A;  2XTI A;  4E2F B;  2EKO A;  3A8L B;  1JJ2 S;  1HSQ A;  2EGC A;  4PL6 A;  1ZBX A;  2ZZD A;  1RAA B;  1BCO A;  2DL5 A;  2DVJ A;  2LP5 A;  2X4X A;  1VQ6 A;  3OW2 S;  2VXE A;  3M0Q A;  5GAO r;  4YRR A;  4RTU A;  4TQF A;  2K3Y A;  3TCJ A;  1BI0 A;  3EG9 A;  1NYQ A;  3EG9 B;  4K88 A;  4KUI A;  5FW9 A;  2PNI A;  2I4L A;  3A8O B;  1E1T A;  3L42 A;  2A8E A;  1VQ7 T;  2M0Y A;  2Y4Y A;  3OYL A;  2DIL A;  1WNL A;  2ROT A;  2DXU A;  3A74 A;  1YCS B;  2NLU A;  1QKX A;  3HRS A;  2QEX T;  4OMN A;  5CKH A;  1KJW A;  3QKJ A;  3A7A A;  2X4Y A;  3CC2 T;  2XD0 A;  1M1K R;  1OPK A;  2X3X D;  2DU5 A;  1WIE A;  1ZLM A;  1B7Y A;  2IG0 A;  5GMK h;  5LJ5 j;  3JCM P;  1WLE A;  2RNA A;  2CUD A;  3QJ6 A;  3Q1J A;  1VQ6 Q;  3MF2 A;  2DNU A;  1YJ9 A;  3UA6 A;  1T3L A;  1AZE A;  1SRY A;  5M9O A;  3DSQ A;  1WU7 A;  2LX9 A;  4DQ2 A;  1IGU A;  3ME9 A;  1UGP B;  1PKT A;  2YSQ A;  4EIK A;  3L2Z A;  5KH6 A;  3I5R A;  4C0F A;  3G1J A;  3EG3 A;  2MWP A;  3M4G A;  1JJC A;  1JJC B;  1QF6 A;  3OY9 A;  2A3L A;  4AMC A;  2XK0 A;  5FU6 B;  1AHJ B;  1VOM A;  1FX7 A;  2MPX C;  2RO0 A;  2L3P A;  3NEL A;  2ECZ A;  1EVK A;  5GAN h;  4X9D A;  2JN0 A;  5D6X A;  4MZT A;  4ORZ A;  4IUU A;  1UTI A;  2XHC A;  1J3T A;  1ASZ A;  4B6M A;  5KYX A;  1M8M A;  1VQK T;  5DM7 R;  3PZC A;  4JLI A;  3CCM Q;  1G3W A;  1NPP A;  4IUR A;  1YJ9 Q;  4YRF A;  3OSS C;  2E4H A;  3VQY A;  3TSZ A;  5LJ5 g;  1VQ7 A;  3UA7 A;  1BU1 A;  1QCN A;  2E3I A;  2KR3 A;  2E41 A;  3SWN C;  3OS5 A;  3CCQ T;  3JCM J;  5KYN A;  2BKD N;  5CKB A;  3I56 T;  2V8K A;  1ADY A;  3VQV A;  4XTV A;  3VKI A;  1ZUU A;  1M90 U;  3P8D A;  4M7A E;  4BI4 A;  2BE9 B;  4FIB A;  5GAN 3;  1FXX A;  2HDA A;  4C8Q B;  3RER A;  1N9W A;  1Q82 C;  1M3C A;  1VQL Q;  1LPL A;  1M3B A;  2AKW B;  4M77 F;  1WDX A;  2AKL A;  2EJG A;  1GBQ A;  1VQ7 Q;  3P8H A;  2LTO A;  1U3O A;  1W1F A;  5LJ5 e;  4JUV A;  4RMO A;  2PME A;  1U8R A;  1ABQ A;  3EGU A;  3WVD B;  3E2U A;  1TOV A;  1MMA A;  4C8Q G;  1VQK A;  1ZSG A;  1IZ6 A;  4PJO A;  3JCM W;  2H8H A;  2W10 A;  3X28 B;  4E7L A;  2BZY A;  3W3S A;  4N4G A;  3G71 A;  3DLL A;  5LJ5 f;  2MMP A;  3M0T A;  4P71 A;  4KRT A;  2QTX A;  4CS4 A;  1ZA2 B;  3CXC P;  1NJI C;  4M7D F;  3ERR A;  3MHX A;  2DD5 A;  1OU8 A;  3RAC A;  3X20 B;  2KGT A;  2K3B A;  1Q86 R;  2AHJ B;  3I56 A;  3E9G A;  3JCM Q;  4RCB A;  2VB6 A;  4R55 A;  2MCN A;  1XTD A;  2GQI A;  1OQK A;  3JAM E;  1WYX A;  4LDX A;  1C6V X;  4PJO G;  1GCQ C;  3DB3 A;  4BDY A;  1UJ0 A;  3HRT A;  4KBM B;  2FPF A;  4RG2 A;  3JRZ A;  2QTV A;  1PM3 A;  2ART A;  2J6K A;  1HJD A;  3OYK A;  3BFM A;  2J6F A;  3FC3 A;  1KQS S;  3CCJ A;  2E12 A;  3C95 A;  4MMK A;  2YUO A;  4A4G A;  4AT1 B;  1NJI U;  4HWS A;  5D6W A;  3G71 Q;  2K57 A;  4M78 A;  2NWM A;  4M78 B;  4D8D A;  1W2B P;  3S3O A;  3AT1 B;  2KYB A;  4E51 A;  1I5O B;  1IL2 A;  2LZ6 B;  3M5A A;  4HT8 A;  2ZCE A;  6AT1 B;  3CMQ A;  5HK0 A;  2CJA A;  1KG1 A;  3G6E T;  1H64 1;  4JRI A;  3A5Y A;  2LQW A;  2MI6 A;  1JO8 A;  2MF2 A;  1NPR A;  2R5M A;  3QWX X;  3NET A;  4YPF A;  5GAN 6;  3OYM A;  4Q6G A;  4NOY A;  1PSE A;  2C0O A;  4M78 G;  5HK3 A;  3NTI A;  2DTI A;  3RIR A;  3OBY A;  3CCJ Q;  1I1J A;  3OQ5 A;  3G7Z A;  3ER0 A;  1UDL A;  3QSU A;  1Z7M A;  1BKB A;  3BY7 A;  2CZ0 B;  4RTY A;  4TVA B;  2CUB A;  1D1C A;  2B86 A;  3FB9 A;  3JCM h;  1IXD A;  2E6Z A;  4ZTZ B;  3CC7 T;  3M4Q A;  2AZV A;  3OYF A;  1AZG B;  4C92 C;  4F14 A;  2OTJ T;  2CDT A;  5FRN A;  4H02 A;  2HBP A;  2M51 A;  4JZ4 A;  1ZA1 B;  3CXC A;  2E5A A;  1USY C;  2CKK A;  3A8G B;  1N8R C;  2RJE A;  3FDR A;  2LT1 A;  2J6O A;  3N5B B;  3LSS A;  3JB9 H;  3IKL A;  2WAC A;  3MEA A;  4H2V A;  2GCX A;  2ED1 A;  2ZZG A;  4LVL A;  2V26 A;  2COY A;  3U23 A;  2YXY A;  2D0N A;  4J9C A;  1NYR A;  4G85 A;  4PJN A;  2BZX A;  1PG5 B;  3PIP A;  4F7U A;  4A53 A;  2DXB A;  1I81 A;  1VQ8 T;  4GLM A;  3J80 E;  4TQD A;  5C0M A;  4JS4 A;  3G6E A;  5LJ3 d;  2J3M A;  5ELO A;  1WJQ A;  4P5N A;  3I35 A;  3RNJ A;  4OP0 A;  3PFS A;  4E7S A;  4HCK A;  1R0C B;  1N8R U;  3S3M A;  2EIF A;  3CBM A;  2JS2 A;  3ZFJ A;  3UH0 A;  3JCM b;  1SEM A;  1WZO A;  3JB9 F;  3RGL A;  1KD1 C;  4BI3 A;  4F7U G;  1NYG A;  4QW2 A;  1YHQ A;  2VGN A;  1Q7Y C;  1ZBJ A;  3ZL7 C;  5GAM j;  3V8J A;  3IG2 A;  3OA6 A;  1E6H A;  4OMO A;  3GOX A;  3CC7 A;  1D0Z A;  1G83 A;  2X4W A;  3QUI A;  3OS2 A;  2O2O A;  4FSS A;  4FW1 A;  5FU7 C;  3PGG A;  1RLQ C;  2DKG A;  1VQN T;  1E24 A;  1LYL A;  2O4X B;  1EIY A;  1SER A;  4J9E A;  1RAE B;  2A37 A;  3QZ9 B;  2P0L A;  3MET A;  2DRM A;  5GAN 8;  2B8A A;  1KC8 C;  1KD1 U;  2H3E B;  2QA4 T;  2OTL Q;  1Q7Y U;  1YN8 A;  2DRK A;  5I22 A;  3QG1 A;  1S72 Q;  4RQF A;  2GQV A;  3LWH A;  4ME7 A;  2LCS A;  2ZT6 A;  1YHQ Q;  2ALY A;  1IRE B;  2ALY B;  4FM4 B;  2JTE A;  2GF7 A;  1RAG B;  2LJ1 A;  3ICA A;  1VQ8 A;  4C8Q E;  5GJW B;  5CKE A;  2CP3 A;  3QWY A;  1X6G A;  1YB3 A;  4HWO A;  4FYV B;  1M2V A;  4B9X A;  3LX7 A;  5C52 B;  5KYY A;  2NUP B;  5GAM g;  1KC8 U;  1WPY A;  4C0D B;  1E6G A;  1QMC A;  4KR3 A;  3G4S T;  1GBR A;  3FRN A;  2LNV A;  4HVU A;  1GFC A;  1QQJ A;  4J6X A;  4AG2 C;  1N9R A;  4CS2 A;  1D3B B;  3VS4 A;  1G3T A;  3FJ5 A;  4K11 A;  4HA8 A;  1V76 A;  3J81 E;  2LQ8 A;  2YUQ A;  4C5H A;  4UP7 A;  2M02 A;  4PJJ A;  3VS7 A;  2EBP A;  2KDS A;  1TUC A;  2E5K A;  1AT1 B;  4P74 A;  1SPK A;  1QWE A;  1WA7 A;  4PHC A;  2ODR C;  3URG A;  5GAN d;  3A31 A;  2RQW A;  2EQK A;  4PNO A;  1FYN A;  4XK8 E;  1YJN T;  3BDL A;  2QHV A;  1B76 A;  2QHT A;  2G3R A;  2XDD A;  5KYW A;  5KYW B;  2DL7 A;  3OYY A;  2QA4 A;  3OYI A;  4OMM A;  5GAM e;  2P4T A;  1BBW A;  2CYZ B;  1X2H A;  3IAL A;  1FWZ A;  4GY5 A;  1E7O A;  1U5S A;  2O9S A;  1PYS B;  1RAH B;  2HD0 A;  5DLO A;  2OJ2 A;  1H4S A;  1JJ2 P;  3V7R A;  4DBR A;  4PJO D;  1SSF A;  3A1P A;  4C5G A;  3LW5 E;  5KYU A;  2JM8 A;  4YRS A;  1QVG P;  4Z89 A;  1LVK A;  3RDV A;  3L2Q A;  3NHN A;  2FL7 A;  4M7A C;  4KGX B;  2Z0W A;  3OW2 P;  3EGX A;  3EGX B;  3CBO A;  4KGZ B;  1X75 C;  1NJ5 A;  3RMS A;  5GAM f;  3M58 A;  1I8F A;  3MEY A;  2PVG B;  2DEQ A;  5HY6 A;  2Y4X A;  3CMA T;  1IB8 A;  2DD4 A;  4HCC A;  3BW1 A;  1YFN A;  1B34 A;  3GBQ A;  2VKN A;  2QA4 Q;  3J7A F;  1KMM A;  3A7R A;  3CCS T;  4M77 A;  4M77 B;  3M4P A;  1G5H A;  2QDY B;  4YCU A;  3RES A;  4P73 A;  1JXO A;  2DTO A;  2M9U A;  1K1Z A;  2FG0 A;  1M27 C;  2KY9 A;  2ATC B;  2LQN A;  4M75 B;  1YIJ T;  4R56 A;  1VQ9 Q;  1RAC B;  1ZSZ C;  2PZ1 A;  2CGH A;  1FYF A;  1UGR B;  1TG0 A;  1YWO A;  4H2X A;  2O9V A;  1RUW A;  1XJW B;  9ATC B;  5GAN 2;  4H2X B;  3HXW A;  2Q7E A;  3EFO A;  3RBB B;  1T0H A;  1WQ7 A;  1Z9Q A;  2P0P A;  4M78 D;  1U06 A;  2DYB A;  1WX6 A;  4M77 G;  3O5Z A;  3VS6 A;  3WXM B;  2Y90 A;  1PD0 A;  4RTZ A;  3L2R A;  2P0Q A;  2ZPI B;  3FEO A;  3HXX A;  4M75 G;  4C92 F;  2EVR A;  2E1H A;  5CKD A;  2DLP A;  4M7D A;  3M55 A;  1AOJ A;  4M7D B;  4OB2 B;  1GL5 A;  1CKB A;  2JM9 A;  5GAN 4;  2RI5 A;  3MJX A;  2YLB A;  2FVU A;  4KUL A;  1YJW T;  3P8V A;  1YFS A;  2DL3 A;  1MNE A;  1PRM C;  2AMC A;  5CO7 A;  1JB0 E;  2KNB B;  4ANJ A;  4C5I A;  2RQT A;  2ZZE A;  1QLY A;  2A08 A;  3UT1 A;  1OUL A;  1ZUY A;  4M7D G;  3CMA A;  2DK3 A;  1PWT A;  1JJ2 A;  1M8V A;  4XEO A;  1G2B A;  1JU5 C;  5IXF A;  1QVF S;  3QDR B;  1RIQ A;  2QQA A;  2ESW A;  2RHS A;  2RHS B;  4YRE A;  3PCO A;  3T9N A;  3PCO B;  4FL6 A;  2JMC A;  4L5G A;  3OW2 A;  4WJ3 M;  4F17 A;  4HWR A;  2L3Q A;  4ZGD B;  2ZT5 A;  3PE0 A;  3IQL A;  1YIJ A;  2VWF A;  4L59 A;  1MHN A;  2DM1 A;  3MP1 A;  1T3S A;  2JTM A;  3MEW A;  4NS5 A;  1M2O A;  1ARK A;  3SB2 A;  4N4I A;  5IXB A;  1RLP C;  4BD3 A;  2XGT A;  2JOY A;  1MV3 A;  1O9S A;  2X3W D;  5IHI A;  5IT9 E;  3GP8 A;  1EFW A;  2I0N A;  1K9M R;  1RAF B;  1H92 A;  2ZCF B;  1V1C A;  2ZXF A;  2I4M A;  4CH4 A;  3C94 A;  1QCF A;  2ZIM A;  2Q7G A;  3FLG A;  1RI9 A;  1UGQ B;  3VBB A;  1UJY A;  4YRK A;  5GJV B;  1M1F A;  2KMT A;  2AK5 A;  3JCM d;  1YIJ Q;  4HT9 A;  5KCH A;  4TVW A;  1T0J A;  4LVK A;  5LL6 S;  5L8R E;  2QQB A;  1TSF A;  3RKW A;  1VQO T;  4PJL A;  1ZUK A;  1B7Y B;  1NJ2 A;  2A0F B;  4ELZ C;  2M1H A;  2JS0 A;  2K5F A;  4A4F A;  2LQK A;  3LGF A;  3UAT A;  3QZ5 B;  2XMF A;  4CH3 A;  1K73 R;  3TRE A;  5J39 A;  3JB9 J;  3F70 A;  3M4Y A;  4QVD A;  3KXT A;  1QP3 A;  4J15 A;  2WSF E;  2DVE A;  3OYA A;  4LNS A;  3FIF A;  1VQ5 T;  3HXZ A;  2DL4 A;  4KQE A;  3CCV A;  2P0K A;  1WXU A;  1BI2 A;  4PLI A;  3UGQ A;  1Q95 G;  2CZ6 B;  4EMG A;  1AEY A;  3RKY A;  5A0L A;  3LGL A;  2DQ0 A;  3M59 A;  1EVL A;  4RKU E;  5FU6 C;  4CC3 A;  2FRW A;  1KQS P;  1AWW A;  1M90 C;  5KYX B;  3S3N A;  1UGV A;  2I4O A;  2K7A A;  1PKS A;  2CSQ A;  1K0S A;  4DOW A;  3CPW S;  3EAE A;  2DE0 X;  3JV3 A;  1RAI B;  1UUE A;  2DZC A;  5IAY A;  4MDW A;  4H2T A;  4E7I A;  3CCV Q;  4EMK A;  2QEX A;  4EMK B;  3CC2 A;  2LX7 A;  2YHT A;  1K8A R;  4XU3 A;  2BUD A;  4BE0 A;  1VQO A;  1NJ8 A;  4HKE A;  2RHX A;  3SWN A;  1VQ4 T;  3GNG A;  2QGF B;  4EPC A;  2W0Z A;  1Y0M A;  4OML A;  4RUG A;  3VS1 A;  3L4G A;  1HTT A;  3L4G B;  4UP8 A;  4ZTU B;  2K3X A;  4E7Z A;  4LD9 K;  2JNG A;  1YIT T;  4M7A F;  2HQE A;  3PVL A;  1G3Y A;  2DXT A;  3REU A;  4NL3 A;  3VS0 A;  4OMP A;  4RTT A;  4E7J A;  1K0X A;  1D09 B;  2EYY A;  4UPA A;  3QDF A;  1W6X A;  4C8Q C;  1HK9 A;  2C0T A;  1QKW A;  2KBT A;  3O8V A;  3M0R A;  2CP2 A;  4NCX A;  2VGM A;  2QEX Q;  4M77 E;  1TXQ A;  2CS7 A;  5GAO n;  4X34 A;  3CC2 Q;  4QVZ A;  4HCB A;  4ZIB A;  4GBQ A;  4J5Y A;  4M75 E;  4Z8A A;  3CCU T;  5GAO m;  2ZT7 A;  4O2D A;  4C0Z A;  4AFQ C;  4F16 A;  2OAU A;  5AYF A;  4PJO B;  4AG1 C;  2EJ9 A;  2CZ7 B;  4FSX A;  2RI3 A;  1KMN A;  1R8O B;  2D6F A;  5HCK A;  1PSF A;  2QGG A;  4A4E A;  4BAC A;  4ZTF A;  1QCO A;  1QVP A;  2QDL A;  4PFO A;  3DB4 A;  4CS3 A;  3LH5 A;  4NL2 A;  4QQG A;  1Q81 C;  3WQZ A;  1KQS A;  3CCQ A;  4DOV A;  4OVA A;  1M3A A;  5GMK m;  2HCK A;  2QK0 A;  2EQU A;  3L1A A;  4UC4 A;  5F5W A;  3VU3 C;  1NG2 A;  4M77 D;  4M7D E;  1G51 A;  4QQD A;  4OB3 B;  1VQ4 A;  3HTZ A;  4EX5 A;  3QTC A;  4J7I A;  4KH0 B;  3VV0 A;  3E9I A;  5CR2 A;  4PLL A;  4M75 D;  2E3H A;  2XKO C;  4QT7 A;  3A5Z A;  3A5Z B;  3ZBD A;  1VQK Q;  1GCQ A;  1TU0 B;  2AKK A;  4BUG A;  2K5I A;  3QNE A;  3VUZ A;  1Q81 U;  1OX8 A;  2EYZ A;  1UE9 A;  1D0X A;  2EQM A;  1I0C A;  2QHS A;  3CBP A;  2DO3 A;  2KRO A;  3HPW A;  5IN1 A;  4E6R A;  2DIQ A;  2O88 A;  5FLX E;  5FRM A;  3CCQ Q;  11AS A;  3FJP A;  4MML A;  4M78 C;  4CI0 C;  3I56 Q;  4PJM A;  4M7D D;  3TUP A;  1QW1 A;  2JW4 A;  2JUF A;  2KAF A;  4BW9 A;  2QG9 B;  1VQZ A;  3EH1 A;  3CCU A;  2K2M A;  4RTW A;  1VQ4 Q;  4EO4 A;  3MQZ A;  2EWN A;  4LN2 A;  4LDV A;  2XI9 A;  2E65 A;  3CCE T;  1XNI A;  5ECA A;  5GMK j;  1F1B B;  2QHU A;  1B07 A;  1S1N A;  4R0K A;  2FRY A;  2ZIO A;  4JRQ A;  4DEY A;  1LJO A;  4AFS C;  3KUF A;  4FT2 A;  2OAW A;  1H8K A;  1SET A;  5GAO q;  3CD6 T;  7AT1 B;  2CT4 A;  3JCM V;  4H2W A; 
#chains in the Genus database with same CATH homology
 4BWA A;  2VC8 A;  4C92 A;  2JZ2 A;  3OD1 A;  3TU4 K;  3OYJ A;  3KFU A;  1JBM A;  5GAN j;  3HY1 A;  5CIU A;  4P72 C;  3L2W A;  1USY A;  3OYD A;  4WJ4 A;  2WSE E;  3QYG B;  2XDB A;  1GGM A;  12AS A;  4F7U B;  2I4N A;  4XU0 A;  3LSQ A;  2KSS A;  3LC0 A;  3NFC A;  3E9H A;  2ZNJ A;  2ZNI A;  3UDC A;  2RI2 A;  3A8M B;  5C51 B;  3C12 A;  1BIA A;  3CCE A;  2PVD B;  4UP9 A;  4YRM A;  1WGS A;  1XOV A;  4HWT A;  3UFG A;  2RA2 A;  4RG8 A;  2IY5 A;  3HRK A;  2DZ9 A;  3GPL A;  3PTA A;  3HFZ A;  3HFZ B;  5GAN g;  2ZIN A;  3IKM B;  2M0O A;  3CD6 A;  3R07 A;  2OTJ A;  3HY0 A;  5A0D A;  3P8B B;  4XTY A;  2R57 A;  1EIY B;  2RM4 A;  3NEM A;  5GMK e;  2ZPG B;  3VYH B;  1DJ7 B;  3OYC A;  1X6O A;  1W2B S;  1B8A A;  3X25 B;  2KQW A;  1N6A A;  3JB9 D;  1TH7 A;  1UGS B;  1KQ1 A;  2PMF A;  4OB0 B;  1E22 A;  1H3Z A;  4JS5 A;  1X56 A;  1E1O A;  5GAN e;  4C8Q F;  5KCO A;  4ELY C;  3SDZ A;  2QQR A;  5GAO l;  4C0D C;  1U1T A;  4K87 A;  3LH0 A;  4YRL A;  4RDX A;  2G4C A;  3UGT A;  3H8Z A;  2PUO B;  2EL9 A;  4PJO E;  5C6S A;  2RHQ A;  2RHQ B;  5GAN f;  3OB9 A;  4E47 A;  4OGE A;  2ZR3 A;  2ZZF A;  3EFS A;  5GMK l;  1VQP T;  4LVM A;  1VQN A;  3I55 T;  4P74 C;  2DQ3 A;  3KBG A;  3UWN A;  4CH5 A;  5LJ5 h;  1QP2 A;  2QQS A;  4YRQ A;  4YCW A;  2LRQ A;  1VQM T;  1KQ2 A;  1K9M C;  1HXD A;  2DTH A;  4YYE A;  4LVI A;  2J3L A;  2XDP A;  3REX A;  1OZ3 A;  3P8Y A;  2KK4 A;  4RMF A;  1KHI A;  3X26 B;  1UB4 A;  3V7C A;  4YTL A;  3E9F A;  1YGB A;  4M78 E;  2CIM A;  4Y28 E;  2EQJ A;  4LD6 A;  3G4S A;  3HHT B;  4M7A A;  3HFV A;  3GNF B;  1K9M U;  1M1K C;  1B34 B;  4XTX A;  4LVJ A;  3HSB A;  4XAX B;  2WSC E;  4TTV A;  4XTW A;  3BJU A;  2XU8 A;  5DLQ E;  2PQW A;  4A54 A;  4Q15 A;  4YRC A;  4M77 C;  4IUQ A;  3HRI A;  4P73 C;  1ZQ1 A;  1W4S A;  2RHI A;  4XU2 A;  1VQP A;  4M75 C;  5CAI A;  3CCR T;  4M7A G;  3I55 A;  1YJN A;  4YDQ A;  2RD1 A;  4YRT A;  4OLF A;  1YFT A;  4QVC A;  1M1K U;  4IKF A;  1XQH A;  3R6O A;  3RF1 A;  4JJN K;  2ZT8 A;  3OMG A;  2QQ9 A;  2EFI A;  5E3I A;  4P75 C;  4HCZ A;  3JCM g;  2RB6 A;  1EQR A;  2E3C A;  1QVF A;  4M7D C;  5CKF A;  3TEE A;  3LYI A;  2AMC B;  2GFA A;  3WVE B;  4TVR A;  2FHD A;  2VXF A;  2E10 A;  2PUK B;  2RK2 A;  4BY6 B;  4N0A C;  2L8D A;  4F7U E;  2HNI A;  2DIG A;  3M56 A;  3L2U A;  2V8J A;  4X5O A;  4JRP A;  2LCC A;  2L3R A;  2MAM A;  2MWO A;  3CCS A;  1J5W A;  3V7S A;  2F5K A;  4YRP A;  1BI1 A;  2XG8 D;  2K5L A;  3QO5 A;  2L89 A;  1JRI A;  4KUD K;  3NTH A;  2VYT A;  4KT0 E;  3CCM T;  1YBY A;  1VIF A;  4DPG A;  4BB7 A;  4L87 A;  3CCR A;  1YJ9 T;  3V8K A;  3JCM e;  4FU6 A;  1LNX A;  1C0A A;  1M9S A;  4HT4 A;  4A4K A;  3OYG A;  3PMI A;  3PIO A;  4P3P A;  1NE8 A;  2RHU A;  5KNN A;  5KE2 A;  2Q7H A;  3QJY A;  4DA4 A;  3JCM X;  3E19 A;  1RI0 A;  3OYB A;  3JCM f;  3LWI A;  1QVG S;  3GIB A;  1YJW A;  1MGQ A;  4WF2 A;  4J7F A;  2XID A;  2DPP B;  2K2V A;  1H4V B;  3QHS A;  4IUP A;  2R5A A;  1VQL T;  4C0G A;  3QPH A;  1Q86 C;  1Y71 A;  1ASY A;  2FB7 A;  1M5Q 1;  1NJ1 A;  3CC4 T;  4RQE A;  1YI2 T;  3RUX A;  2EJF A;  5GAN 7;  3HRU A;  5GAO p;  4MZP A;  1YFR A;  1BIB A;  4J6W A;  5HKC A;  5CVI A;  3CPW A;  3CCM A;  4MDX A;  3JSC A;  2H3J A;  3MO8 A;  1LOJ A;  2QXF A;  1Q86 U;  3UPU A;  1U1S A;  3PMT A;  1WQW A;  3P8T A;  4N4H A;  5K1X A;  3HP9 A;  1H4T A;  2GFU A;  2ZPE B;  3V8L A;  5C53 B;  4BE1 A;  5D6Y A;  3CCL T;  1KOG A;  4XU1 A;  1BYM A;  5DY9 A;  4JDS A;  3A7U A;  4G84 A;  3HKS A;  2Q5H A;  1ZHI A;  2FYK A;  4CH6 A;  4OF1 A;  1I4K 1;  4E7H A;  3QYH B;  1Y96 A;  1Y96 B;  3M57 A;  3JB9 G;  1VQL A;  4P3N A;  3SWN B;  4EMK C;  3DLM A;  3G71 T;  4BI8 B;  3QBY A;  3CC4 A;  1YI2 A;  2BIV A;  2CJ9 A;  5A2Q E;  5I21 A;  2RJC A;  3OBW A;  3A8H B;  3HXY A;  1B70 A;  1B70 B;  1VQ5 A;  5K1P A;  2K4Y A;  2O01 E;  2D0Q B;  2ODR D;  3QII A;  5GAM h;  3A32 A;  5CK9 A;  2P5I A;  3OYN A;  3HXV A;  4C8Q A;  3VQX A;  3CCJ T;  2JTF A;  2AKW A;  3E1S A;  3CCL A;  2RJF A;  4Z02 A;  4M75 F;  4RCC A;  5LJ3 j;  4PJO C;  2EAY A;  4J8O A;  3NTK A;  5I2S A;  3HXU A;  4M7A D;  3L2V A;  3CPF A;  2VUB A;  2RHZ A;  3NEN A;  1G5I A;  4XTZ A;  4HWP A;  4P71 C;  3RL6 A;  2I2L A;  1Q82 U;  3S6W A;  3HL8 A;  3SFM A;  3MF1 A;  1Y07 A;  5CQY A;  4H2Y A;  4EDU A;  1G5V A;  5LJ5 d;  4FT4 A;  2V8I A;  4X9C A;  1YIT A;  2F69 A;  2DU7 A;  2RJD A;  1BBU A;  3GLX A;  4XTU A;  2X4J A;  5GMK i;  5FRO A;  4H2U A;  4ZN1 A;  2M16 A;  5GAN 5;  1ATI A;  4KR2 A;  5LJ3 g;  3QO7 A;  3MEU A;  4MZM A;  1X01 A;  2NS6 A;  5HGQ A;  4L6V 5;  1YCY A;  5I2M A;  2ZPH B;  1KHC A;  4YRO A;  1P92 A;  2LC4 A;  2ZPF B;  4OGC A;  2E64 A;  5A0G A;  1WJR A;  3ZEH A;  1X2G A;  1HC7 A;  1SES A;  4GLK A;  4PKC C;  2OTL T;  2F5T X;  4BE2 A;  3HFO A;  5CQX A;  3G1Z A;  3VYG A;  1S72 T;  4AH6 A;  1W66 A;  5LJ3 e;  1YHQ T;  3QO3 A;  1G3S A;  4V2S A;  4C92 B;  4TVA A;  2KVQ G;  1Y7X A;  1VIE A;  4HVC A;  2PVO B;  1NZ9 A;  4PG3 A;  4XEM A;  2Q5I A;  3C4S A;  3OSV A;  2LCL A;  4P72 A;  2DDZ A;  5LJ3 f;  4ZGE B;  1L0W A;  1UEB A;  2X35 A;  4C92 G;  1X55 A;  3M9Q A;  1OI1 A;  1ADJ A;  2HQX A;  3JCM c;  4ATO A;  1M1G A;  3CME T;  4II1 A;  3CXC S;  2LVM A;  3ASK A;  3TEG A;  2IY5 B;  4XQ3 A;  1W2B A;  2OTL A;  2ZPB B;  2VV5 A;  3OYH A;  3I7F A;  4YRI A;  4OB1 B;  1S72 A;  4TVY A;  4WI1 A;  2JVV A;  4JRK A;  4VUB A;  3PT9 A;  5FU7 B;  4H2S A;  3AHU A;  2YRV A;  4BDZ A;  2O4X A;  1WJS A;  3MP6 A;  3X24 B;  3LLR A;  4YRJ A;  4C5E A;  4LDU A;  2C06 A;  2DXC A;  2PU9 B;  2RH2 A;  4ZGJ B;  3VJP A;  3JB9 I;  4IUT A;  4IUV A;  3CME A;  2CZ1 B;  1VQ9 T;  1VUB A;  2RK1 A;  4E7K A;  3TEH A;  3TEH B;  1NNH A;  2ZTG A;  3BDU A;  4QQ6 A;  4D6W A;  3PNW C;  2R58 A;  1NJ6 A;  5J26 A;  4PJO F;  1D3B A;  2C8M A;  3VUB A;  3MP8 A;  4O5V A;  1X54 A;  2CJB A;  4YCV A;  1BI3 A;  4A4H A;  3QO8 A;  4C8Q D;  1I5L A;  4P3O A;  1V29 B;  2EYQ A;  2A7Y A;  4ZN3 A;  3RMQ A;  1RL2 A;  3MEV A;  2ARU A;  4J6Y A;  4TWA A;  2HAX A;  1EOV A;  3M53 A;  1OYX A;  1PYS A;  1VQ9 A;  4B9W A;  2LDM A;  4M7A B;  1N27 A;  2D9T A;  2DAQ A;  4M78 F;  2E70 A;  1O75 A;  4O6J A;  1GXI E;  4YP0 A;  3OS1 A;  4Y91 A;  3GF5 A;  1K73 C;  1EIF A;  5GAM d;  4EMH A;  3RKX A;  2YLC A;  3SD4 A;  1M4Z A;  4M75 A;  4Q5W A;  3CEY A;  1N9S A;  4ZTJ A;  1VQM A;  3QXE B;  2E6N A;  1K73 U;  3HFN A;  2XIC A;  4C92 E;  1VQ6 T;  4K86 A;  5ELN A;  4YRG A;  4P75 A;  2L5Q A;  3H6Z A;  4J83 A;  4CRI A;  3OS0 A;  3M54 A;  2RHY A;  2LT4 A;  3OYE A;  4LDY A;  1WYD A;  1K8A C;  1H4Q A;  4OMF B;  2IVW A;  4BY6 C;  2C7I A;  4F7U F;  4N0A A;  5CCA A;  5J3B A;  5LJ3 h;  2DJZ A;  1QE0 A;  4C92 D;  2QI2 A;  3DKM A;  5KE3 A;  4JLG A;  3VQW A;  5EG2 A;  3INZ A;  1QVG A;  1OZ2 A;  1K8A U;  4YRN A;  3EFR A;  2E5Q A;  4LDW A;  3OMC A;  1Z7N A;  2ARS A;  3CCV T;  3MCA B;  2ZR2 A;  2ZGW A;  2XTI A;  2EKO A;  3A8L B;  1JJ2 S;  4PL6 A;  1ZBX A;  2ZZD A;  2X4X A;  1VQ6 A;  3OW2 S;  2VXE A;  5GAO r;  4YRR A;  4TQF A;  1NYQ A;  2K3Y A;  1BI0 A;  3TCJ A;  4K88 A;  4KUI A;  2I4L A;  3A8O B;  1E1T A;  3L42 A;  2A8E A;  1VQ7 T;  2Y4Y A;  3OYL A;  1WNL A;  2DXU A;  3A74 A;  2NLU A;  3HRS A;  2QEX T;  5CKH A;  3QKJ A;  3A7A A;  2X4Y A;  3CC2 T;  2XD0 A;  2DU5 A;  1B7Y A;  2IG0 A;  5GMK h;  5LJ5 j;  3JCM P;  1WLE A;  3QJ6 A;  3Q1J A;  3MF2 A;  1YJ9 A;  1SRY A;  3DSQ A;  5M9O A;  1WU7 A;  2LX9 A;  4DQ2 A;  3ME9 A;  1UGP B;  3L2Z A;  5KH6 A;  4C0F A;  2MWP A;  3M4G A;  1JJC A;  1JJC B;  1QF6 A;  3OY9 A;  2A3L A;  2XK0 A;  5FU6 B;  1AHJ B;  1FX7 A;  2RO0 A;  3NEL A;  1EVK A;  5GAN h;  4X9D A;  2JN0 A;  5D6X A;  4MZT A;  4IUU A;  2XHC A;  1ASZ A;  1VQK T;  5DM7 R;  3PZC A;  4JLI A;  1G3W A;  1NPP A;  4IUR A;  4YRF A;  3OSS C;  3VQY A;  5LJ5 g;  1VQ7 A;  2E41 A;  3SWN C;  3OS5 A;  3CCQ T;  3JCM J;  2BKD N;  5CKB A;  3I56 T;  2V8K A;  1ADY A;  3VQV A;  4XTV A;  3VKI A;  1M90 U;  3P8D A;  4M7A E;  4BI4 A;  4FIB A;  5GAN 3;  1FXX A;  4C8Q B;  3RER A;  1N9W A;  1Q82 C;  2AKW B;  4M77 F;  2EJG A;  3P8H A;  2LTO A;  5LJ5 e;  4JUV A;  4RMO A;  2PME A;  1U8R A;  3WVD B;  4C8Q G;  1VQK A;  1IZ6 A;  4PJO A;  3JCM W;  3X28 B;  4E7L A;  3W3S A;  4N4G A;  3G71 A;  3DLL A;  5LJ5 f;  2MMP A;  4P71 A;  2QTX A;  4CS4 A;  1NJI C;  4M7D F;  3ERR A;  3MHX A;  2DD5 A;  3RAC A;  3X20 B;  2AHJ B;  3I56 A;  3E9G A;  3JCM Q;  4RCB A;  4R55 A;  1XTD A;  3JAM E;  4LDX A;  4PJO G;  3DB3 A;  4BDY A;  3HRT A;  4KBM B;  4RG2 A;  3JRZ A;  2ART A;  3OYK A;  3BFM A;  3FC3 A;  1KQS S;  3CCJ A;  2E12 A;  3C95 A;  4MMK A;  4A4G A;  1NJI U;  4HWS A;  5D6W A;  2K57 A;  4M78 A;  4M78 B;  3S3O A;  4E51 A;  1IL2 A;  3M5A A;  4HT8 A;  2ZCE A;  3CMQ A;  5HK0 A;  2CJA A;  1KG1 A;  3G6E T;  1H64 1;  4JRI A;  3A5Y A;  2MI6 A;  2MF2 A;  1NPR A;  2R5M A;  3NET A;  4YPF A;  5GAN 6;  3OYM A;  4Q6G A;  4NOY A;  1PSE A;  4M78 G;  5HK3 A;  3NTI A;  2DTI A;  3RIR A;  3OBY A;  3OQ5 A;  3G7Z A;  3ER0 A;  3QSU A;  1Z7M A;  1BKB A;  3BY7 A;  2CZ0 B;  4TVA B;  3FB9 A;  3JCM h;  2E6Z A;  4ZTZ B;  3CC7 T;  3M4Q A;  3OYF A;  4C92 C;  2OTJ T;  5FRN A;  4H02 A;  2HBP A;  3CXC A;  2E5A A;  1USY C;  2CKK A;  3A8G B;  1N8R C;  2RJE A;  3FDR A;  2LT1 A;  3N5B B;  3LSS A;  3JB9 H;  3IKL A;  2WAC A;  3MEA A;  4H2V A;  2GCX A;  2ZZG A;  4LVL A;  1NYR A;  4G85 A;  3PIP A;  4F7U A;  4A53 A;  2DXB A;  1I81 A;  1VQ8 T;  3J80 E;  4TQD A;  4JS4 A;  5C0M A;  2J3M A;  5LJ3 d;  3G6E A;  5ELO A;  1WJQ A;  4P5N A;  4OP0 A;  3PFS A;  1N8R U;  3S3M A;  2EIF A;  3CBM A;  3ZFJ A;  3UH0 A;  3JCM b;  3JB9 F;  3RGL A;  1KD1 C;  4BI3 A;  4F7U G;  4QW2 A;  1YHQ A;  2VGN A;  1Q7Y C;  5GAM j;  3V8J A;  3IG2 A;  3OA6 A;  3GOX A;  3CC7 A;  2X4W A;  3QUI A;  3OS2 A;  5FU7 C;  3PGG A;  2DKG A;  1LYL A;  1VQN T;  1E24 A;  2O4X B;  1EIY A;  1SER A;  3QZ9 B;  2P0L A;  3MET A;  5GAN 8;  2B8A A;  1KC8 C;  1KD1 U;  2QA4 T;  1Q7Y U;  3QG1 A;  4RQF A;  2GQV A;  3LWH A;  4ME7 A;  2ZT6 A;  2ALY A;  1IRE B;  2ALY B;  4FM4 B;  2GF7 A;  3ICA A;  1VQ8 A;  4C8Q E;  5CKE A;  1YB3 A;  4HWO A;  4B9X A;  3LX7 A;  5C52 B;  5GAM g;  1KC8 U;  1WPY A;  4C0D B;  4KR3 A;  3G4S T;  3FRN A;  2LNV A;  4J6X A;  1N9R A;  4CS2 A;  1D3B B;  1G3T A;  3J81 E;  4HA8 A;  2LQ8 A;  4C5H A;  4UP7 A;  2KDS A;  4P74 A;  4PHC A;  2ODR C;  3URG A;  5GAN d;  3A31 A;  2EQK A;  4PNO A;  4XK8 E;  1YJN T;  3BDL A;  2QHV A;  1B76 A;  2QHT A;  2G3R A;  2XDD A;  3OYY A;  2QA4 A;  3OYI A;  5GAM e;  2P4T A;  1BBW A;  2CYZ B;  1X2H A;  3IAL A;  1FWZ A;  4GY5 A;  1PYS B;  2HD0 A;  5DLO A;  1H4S A;  4PJO D;  3V7R A;  1SSF A;  4C5G A;  3LW5 E;  4YRS A;  3L2Q A;  2FL7 A;  4M7A C;  3CBO A;  1X75 C;  1NJ5 A;  3RMS A;  5GAM f;  3M58 A;  1I8F A;  3MEY A;  2PVG B;  2DEQ A;  5HY6 A;  2Y4X A;  3CMA T;  2DD4 A;  4HCC A;  3BW1 A;  1B34 A;  3J7A F;  1KMM A;  3A7R A;  3CCS T;  4M77 A;  4M77 B;  3M4P A;  1G5H A;  2QDY B;  4YCU A;  3RES A;  4P73 A;  2DTO A;  2M9U A;  2KY9 A;  4M75 B;  1YIJ T;  4R56 A;  1FYF A;  2CGH A;  1UGR B;  4H2X A;  4H2X B;  5GAN 2;  3HXW A;  2Q7E A;  1WQ7 A;  2P0P A;  4M78 D;  4M77 G;  3WXM B;  2Y90 A;  3L2R A;  2P0Q A;  2ZPI B;  3FEO A;  3HXX A;  4M75 G;  4C92 F;  2E1H A;  5CKD A;  4M7D A;  3M55 A;  4M7D B;  4OB2 B;  5GAN 4;  2RI5 A;  2YLB A;  2FVU A;  4KUL A;  1YJW T;  3P8V A;  1YFS A;  2AMC A;  5CO7 A;  1JB0 E;  4C5I A;  2ZZE A;  3UT1 A;  4M7D G;  3CMA A;  2DK3 A;  1JJ2 A;  1M8V A;  4XEO A;  1QVF S;  3QDR B;  1RIQ A;  2QQA A;  2RHS A;  2RHS B;  4YRE A;  3PCO A;  3T9N A;  3PCO B;  4FL6 A;  3OW2 A;  4L5G A;  4WJ3 M;  4HWR A;  4ZGD B;  2ZT5 A;  1YIJ A;  4L59 A;  1MHN A;  3MP1 A;  2JTM A;  3MEW A;  4NS5 A;  3SB2 A;  4N4I A;  4BD3 A;  2XGT A;  2JOY A;  1O9S A;  5IT9 E;  3GP8 A;  1EFW A;  2ZCF B;  2ZXF A;  2I4M A;  4CH4 A;  3C94 A;  2ZIM A;  2Q7G A;  3FLG A;  1UGQ B;  3VBB A;  4YRK A;  1M1F A;  2KMT A;  3JCM d;  4HT9 A;  5KCH A;  4TVW A;  4LVK A;  5LL6 S;  5L8R E;  2QQB A;  3RKW A;  1VQO T;  1B7Y B;  1NJ2 A;  4ELZ C;  2M1H A;  2K5F A;  4A4F A;  2LQK A;  3LGF A;  4CH3 A;  3QZ5 B;  3TRE A;  5J39 A;  3JB9 J;  3F70 A;  3M4Y A;  4QVD A;  3KXT A;  1QP3 A;  4J15 A;  2WSF E;  2DVE A;  3OYA A;  4LNS A;  3FIF A;  1VQ5 T;  3HXZ A;  4KQE A;  3CCV A;  2P0K A;  1BI2 A;  4PLI A;  3UGQ A;  2CZ6 B;  4EMG A;  3RKY A;  5A0L A;  3LGL A;  2DQ0 A;  3M59 A;  1EVL A;  4RKU E;  5FU6 C;  1M90 C;  3S3N A;  2I4O A;  4DOW A;  3CPW S;  3EAE A;  2DZC A;  5IAY A;  4MDW A;  4H2T A;  4E7I A;  4EMK A;  2QEX A;  4EMK B;  3CC2 A;  2YHT A;  4XU3 A;  2BUD A;  1VQO A;  4BE0 A;  1NJ8 A;  4HKE A;  2RHX A;  3SWN A;  1VQ4 T;  3GNG A;  4EPC A;  3L4G A;  1HTT A;  3L4G B;  4UP8 A;  4ZTU B;  2K3X A;  4LD9 K;  2JNG A;  1YIT T;  4M7A F;  2HQE A;  1G3Y A;  2DXT A;  3REU A;  4NL3 A;  4E7J A;  4UPA A;  4C8Q C;  1HK9 A;  3O8V A;  4NCX A;  2VGM A;  4M77 E;  2CS7 A;  5GAO n;  4X34 A;  4QVZ A;  4HCB A;  4ZIB A;  4J5Y A;  4M75 E;  3CCU T;  5GAO m;  2ZT7 A;  4O2D A;  4C0Z A;  2OAU A;  5AYF A;  4PJO B;  2EJ9 A;  2CZ7 B;  4FSX A;  2RI3 A;  1KMN A;  1R8O B;  2D6F A;  1PSF A;  4A4E A;  4BAC A;  4ZTF A;  1QVP A;  3DB4 A;  4CS3 A;  4NL2 A;  4QQG A;  1Q81 C;  3WQZ A;  1KQS A;  3CCQ A;  4DOV A;  4OVA A;  5GMK m;  2EQU A;  3L1A A;  4UC4 A;  5F5W A;  3VU3 C;  4M77 D;  4M7D E;  1G51 A;  4QQD A;  4OB3 B;  1VQ4 A;  3HTZ A;  4EX5 A;  3QTC A;  4J7I A;  3VV0 A;  3E9I A;  5CR2 A;  4PLL A;  4M75 D;  2XKO C;  3A5Z A;  3A5Z B;  3ZBD A;  4BUG A;  2K5I A;  3QNE A;  3VUZ A;  1Q81 U;  2EQM A;  2QHS A;  3CBP A;  2DO3 A;  3HPW A;  5IN1 A;  2DIQ A;  5FRM A;  5FLX E;  11AS A;  3FJP A;  4MML A;  4M78 C;  4CI0 C;  4M7D D;  3TUP A;  1QW1 A;  2JUF A;  2KAF A;  4BW9 A;  1VQZ A;  3CCU A;  4EO4 A;  3MQZ A;  2EWN A;  4LDV A;  2XI9 A;  2E65 A;  3CCE T;  1XNI A;  5GMK j;  2QHU A;  2ZIO A;  4JRQ A;  1LJO A;  3KUF A;  4FT2 A;  1SET A;  5GAO q;  3CD6 T;  3JCM V;  4H2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...