2CGHA

Crystal structure of biotin ligase from mycobacterium tuberculosis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
258
structure length
238
Chain Sequence
RPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTTARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Conformational Changes Upon Reaction Intermediate Biotinyl-5'-AMP Binding in Biotin Protein Ligase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords BIOTIN LIGASE
total genus 82
structure length 238
sequence length 258
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2cghA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2cghA01
2CJAA 5GMKl 3HXZA 4C92C 3JCMW 4H2VA 2CJBA 3M4QA 2YLCA 4DQ2A 5GANe 2E10A 4M75C 1Z7MA 1M5Q1 2I4OA 3PZCA 4F7UG 4M7DG 1EOVA 1EIYA 4TVAA 4OP0A 5C53B 2J3MA 1B34A 3VQWA 3QSUA 1E22A 2EJGA 5GAN8 3NETA 3JCMe 2ZNJA 2DQ3A 2K57A 2QHSA 2Q5HA 4TQDA 5ELOA 4HVCA 4YYEA 3V7CA 4M75B 3BDUA 3NELA 1HTTA 4J5YA 4N0AC 1KQ1A 3NENA 4PJOC 5GMKi 3JCMP 2VXFA 4O2DA 2QTXA 4YRMA 3V7SA 4CH5A 2RD1A 4XTZA 2DZCA 1WU7A 3JB9F 5LJ3e 4PJOA 3SWNC 2CIMA 3RACA 1ASZA 3UH0A 3HXWA 1WQ7A 4LNSA 1C0AA 4C92E 4RMFA 1ADYA 2QHTA 4M77A 2EJFA 4C92B 3ICAA 4L87A 3A31A 4C8QF 1EQRA 2ZT5A 2ZGWA 5LJ3h 4M78B 4XEOA 2AKWB 1B76A 4K86A 1H641 5GAOp 5F5WA 3I7FA 3PCOB 3A5ZA 3RL6A 4XQ3A 2EJ9A 4C8QD 1I81A 4MMLA 3JCMg 1JRIA 5LJ5d 2Q7GA 1LNXA 1HC7A 4M78G 2ZZGA 2RHSA 1ASYA 1X54A 2Q7EA 4C8QA 1E1OA 2E41A 4HT8A 4M75F 4RCCA 3LSQA 2DXTA 5GAMd 4CH4A 2Y90A 4PJOE 3HXVA 4P73A 1BIAA 4QVDA 11ASA 3HRIA 4F7UB 1SESA 2RHQA 5LJ3g 1BBUA 3A5YA 2DJZA 4P71C 4M77F 2FYKA 3IKLA 1NJ2A 1L0WA 3QO7A 5K1PA 4XTXA 4JRKA 1G5IA 4C92G 3TEGA 3BY7A 4A53A 3G1ZA 1Y96B 4HA8A 4PJOF 2ZNIA 3JB9G 4YREA 1JJCA 4CS2A 2RA2A 1NYRA 5KNNA 4H2XB 1NJ5A 4EX5A 4NOYA 2ZT7A 5LJ5g 4YRNA 1FYFA 4XU1A 4K88A 4RDXA 4YRKA 4M78D 5GAOq 2ZZFA 4P3NA 2PMEA 4JLIA 2ZR2A 2RB6A 5GAMg 5GANf 4C8QG 1WLEA 4HWPA 1H4SA 4YDQA 1YFRA 3JB9J 1KMNA 5GAN7 1NYQA 2I4LA 3OD1A 2DZ9A 3P8TA 1D3BA 4X9DA 3BW1A 3L4GA 3VQXA 4YRRA 1J5WA 1EIYB 4XU0A 5C51B 3PGGA 1JBMA 4J6YA 1B70A 2RM4A 4M7DE 3QO3A 3V8KA 2DQ0A 1TH7A 1KOGA 1M8VA 4PHCA 2DEQA 3UGTA 2ZXFA 1USYC 2ALYB 3A32A 4NL2A 3JCMQ 3MEYA 3QUIA 4YCVA 3RESA 1WPYA 2AMCB 3HFZB 1QE0A 4EMHA 1NJ1A 2ZTGA 3LSSA 4WI1A 1YB3A 2ZR3A 1USYA 3DSQA 4Q6GA 3SWNA 2ARTA 3L1AA 3A7UA 4PJOG 3RKWA 3RF1A 1WNLA 2DVEA 3L2ZA 4M78F 3ERRA 4C8QE 4H02A 4YRTA 1HXDA 4C8QB 1I8FA 5GAMe 4YRQA 2XTIA 5GMKj 5LJ5h 4P3PA 1NJ8A 4A54A 4M7DF 4P75C 4YP0A 12ASA 1B70B 4NCXA 4M7DD 1ATIA 4QVCA 1GGMA 4M75A 2ODRC 2Q5IA 3QNEA 2I2LA 1X2GA 3RIRA 4Q15A 5HGQA 4H2XA 5GAN2 2YLBA 4YRCA 2FB7A 4NL3A 2J3LA 2QHVA 4J15A 4P75A 4YPFA 4YRJA 2ZCEA 3P8VA 5GAOr 3HTZA 4XTWA 3QO5A 2DTIA 2E1HA 3JCMb 3EFSA 4WF2A 3M4GA 4HWTA 5GAOm 2ZZEA 5GAN4 3BFMA 1KQ2A 4M7AF 4P74A 4TVWA 3VQVA 2PMFA 1NNHA 5GAMf 3EFRA 4WJ3M 4M75D 3RERA 4PJOB 3FB9A 2JN0A 3UFGA 3A74A 2P5IA 4YCUA 1SRYA 4OLFA 2C7IA 4TQFA 5GANh 1BBWA 4TVYA 1I5LA 1X01A 4YRPA 5I21A 4P3OA 2ODRD 2P0LA 3UGQA 4UP8A 3HFNA 4M7AB 4H2TA 4E51A 4M78A 1N9SA 3M4PA 3JCMJ 4XTUA 1B34B 3RKYA 4ZTUB 1PYSA 4JUVA 3IALA 1G51A 3HXUA 1SERA 4H2UA 4XTYA 3JB9I 3IKMB 4F7UA 2ARSA 3E9HA 4EMGA 5GAN5 4K87A 4P72C 1NJ6A 5GMKe 5GAMh 2CJ9A 3MF2A 1LOJA 4ZIBA 2YHTA 3REUA 1KMMA 3JCMX 5GAOn 2RHQB 1H4QA 3HY1A 4JRIA 1EVLA 2ARUA 4C92F 4F7UF 2HNIA 2AMCA 1ADJA 1YGBA 3JCMd 3PCOA 3TEHB 3NEMA 1W66A 4N0AA 3HSBA 2C8MA 4YRSA 3HFVA 2AKWA 5LJ3f 4M7DA 3R07A 1X2HA 2E65A 5LJ3j 2DDZA 3IG2A 1YFTA 1U1TA 4PNOA 5GAMj 4PJOD 5GAOl 4TTVA 3LC0A 3GIBA 4YROA 4HWRA 4TWAA 4RQEA 3E9IA 3KFUA 3W3SA 4HWOA 4CH6A 3HFZA 5GANd 2E64A 1YFSA 3WQZA 5LJ5j 5LJ3d 1E24A 1LJOA 4M77D 3QO8A 1JJCB 1Z7NA 3A7AA 2CGHA 3P8YA 4M77C 4V2SA 4DPGA 1WQWA 5K1XA 1LYLA 4H2WA 4M77B 4C92A 4M75G 4M7AD 4YRLA 5GMKm 1X56A 5GAN3 4M7AG 4UPAA 3FIFA 4AH6A 4UP7A 3INZA 4G85A 2VXEA 4YRGA 4X9CA 5C52B 4KR3A 4RQFA 2ALYA 4KQEA 4XU2A 4M77G 2I4MA 5GANj 4M78E 2E5AA 5CAIA 4C8QC 1E1TA 5GMKh 1B7YA 4P74C 1EVKA 2I4NA 1SETA 1PYSB 1B8AA 1X55A 3TUPA 1BIBA 4CS4A 1D3BB 2ZIOA 3HXXA 1IL2A 3HXYA 4M7AA 2DTHA 4PG3A 4TVAB 2EL9A 3JCMc 3VBBA 4H2YA 5GAN6 1B7YB 4KR2A 2VC8A 4EO4A 3SWNB 4M7AC 4BWAA 3V8LA 2IY5B 3JCMV 3QHSA 3RKXA 4HWSA 4M7DB 2ZINA 4M77E 4MMKA 4XTVA 4Y91A 1Y96A 2DTOA 3JCMh 4CS3A 3V7RA 2DKGA 4EMKB 4RCBA 3HFOA 4UP9A 3MF1A 1MGQA 4CH3A 1H4VB 4J6XA 4ZTZB 4G84A 4YRFA 3JB9H 4HT9A 4P73C 2G4CA 3BJUA 2Q7HA 4M75E 3FJPA 4YCWA 1U1SA 2ZT8A 4M78C 4H2SA 4X5OA 3QTCA 3V8JA 3HY0A 3AHUA 4EMKA 5LJ5e 4P71A 5DY9A 1WYDA 2QHUA 3SB2A 3VQYA 3TEHA 2RHSB 3VU3C 1VQZA 3HRKA 3RGLA 4F7UE 2DXUA 2IY5A 3A7RA 4EMKC 1RIQA 2ZT6A 3RUXA 4WJ4A 2DU7A 4P72A 4J6WA 4M7DC 1QF6A 3L4GB 1G5HA 2XGTA 4XEMA 5E3IA 2EAYA 3JCMf 1EFWA 3REXA 5LJ5f 2ZIMA 4XU3A 2E3CA 2DU5A 1H4TA 2EWNA 1YCYA 3CMQA 4M7AE 4BW9A 4YRIA 1I4K1 5GANg 3JB9D 5ELNA 1HK9A 1N9RA 1N9WA 4C92D
chains in the Genus database with same CATH superfamily
2BKDN 1VQ7A 4Z88A 3TVTA 1S72Q 1AT1B 3NHNA 1D1BA 3TSZA 3M4QA 1PCXA 5I2MA 4DQ2A 5GANe 2PU9B 3FJ5A 1JXMA 2H3EB 4M75C 2GQVA 3VS4A 2EFIA 4A4HA 1KJWA 4JLGA 3EFOB 4F7UG 1R0BG 2A3LA 4CI0C 5C53B 2EJGA 4RTWA 5GAN8 3G71A 5CKBA 2CUDA 3CCQA 1FMVA 3JCMe 2ZNJA 1ZBJA 4XK8E 5ELOA 2P0KA 4HVCA 1YWPA 4GBQA 1KQ1A 3J81E 4QQ6A 1Y57A 2R58A 2GQIA 3CC2T 3SFMA 3QZ9B 2L3QA 2B86A 3FLGA 1RLPC 5LJ3e 2CP5A 2OAUA 3SWNC 2KQWA 3UH0A 3JSCA 3MEVA 4LNSA 3C94A 3L2UA 2XG8D 1ADYA 1K4US 2QHTA 1K1ZA 2RF0A 3ICAA 2K7AA 1N6AA 2DRMA 4WCIA 4KUDK 4K86A 1P92A 3A5ZA 1ZQ1A 2Y4XA 3M56A 1JRIA 1MMAA 1OQKA 2YUNA 5KYXA 4JDSA 1ZUUA 2A08A 1QP3A 1ASYA 4RKUE 3NFCA 4C8QA 2E41A 5FU6C 4J83A 2QG9B 4PJMA 1VQ6T 4CH4A 4PFZA 4PJOE 4P73A 1BIAA 1YJWA 2CZ1B 2RNAA 4FYVB 3HRIA 3MP6A 5J3BA 2VKNA 4PJLA 5DM7R 2RHQA 4LDWA 3M58A 2DJZA 4M77F 4X34A 1T3SA 4E47A 2QGGA 4C92G 2E4HA 4PFOA 2NUZA 5HKCA 4YREA 1JJCA 1MV3A 5HCKA 2RA2A 4KGZB 1ZLMA 5FWBA 3OYLA 4LD6A 3OBYA 3TU4K 2RPNA 4NOYA 4FCYA 4XU1A 4K88A 2J6KA 2CSQA 4J9BA 2FRYA 4QQGA 1ZUYA 3GBQA 1IGQA 1RADB 2RQTA 3OS2A 3VQXA 2L3SA 3DKMA 2FVUA 3VRZA 1QWFA 4QQDA 4ELZC 5KE3A 1EIYB 4D8KA 3L2WA 4M7DE 2JS2A 3H0HA 2X4JA 4BY6C 1M8VA 2DEQA 4IUTA 1VIEA 3UGTA 3J80E 2ALYB 4KH1B 2GNCA 2JM8A 2FEIA 3GF5A 1NPPA 3LGFA 4E7IA 3HFZB 3L42A 1QE0A 2KRNA 1AOJA 4OVAA 2ZR3A 1USYA 1HJDA 3M53A 5IXFA 1YJWT 1YHQT 3L1AA 2J06A 5FU7B 5IHNA 3LX7A 1SHGA 4PJOG 3ER0A 2YRCA 1UDLA 3L2ZA 2ED0A 4M78F 3L2RA 2R5MA 4HCCA 2RQWA 1YN8A 2LC4A 5C0MA 4YRQA 3CPWA 2C0OA 1VQPT 1X75C 5LJ5h 2KRSA 2ZPHB 4YP0A 1JJ2S 4M7DF 4P75C 12ASA 1B70B 1YFNA 1QKXA 2M1HA 1ATIA 2Q5IA 3CCUQ 2I2LA 2DE0X 2KGTA 4ZTFA 2FB7A 4P75A 4YRJA 2ZCEA 1LVKA 1UTIA 3H9NA 3P8VA 3VUBA 2IVWA 4EIKA 4X1VA 2DLPA 3HTZA 2DTIA 3JCMb 4FYXB 2DYIA 2V1QA 2E6ZA 3R6OA 4J9FA 4DA4A 2M0OA 1Q81U 2YSQA 8AT1B 4LN2A 3OBWA 2VB6A 1VQ8A 2KVQG 2RHXA 3VS0A 2AIRB 1YITT 3EFRA 4M75D 4IUUA 1Q81C 3A74A 3A8HB 1VQLA 2DMOA 2MIOA 1RAAB 5GANh 1D0ZA 1X01A 1WXBA 4R55A 4ORZA 2K2VA 2JT4A 2RJDA 1AWJA 4P3OA 4RTTA 2CS7A 2P0LA 5J26A 4WTOB 4UP8A 4M7AB 3ZFJA 4H2TA 3WVDB 4RG2A 1OEBA 1XQHA 4M78A 3M4PA 3JCMJ 3OYAA 4RMOA 1B34B 4R56A 4HCZA 1VQLQ 3IALA 4H2UA 3JB9I 2VGMA 3GPLA 1Y7XA 2H8HA 1PD1A 2ARSA 5GAN5 4P72C 1YNZA 4CRIA 5KYYA 2BZXA 2F2XA 2KE9A 5HK3A 1U06A 1E6HA 1LOJA 1PHTA 1QMCA 4ZIBA 2GGRA 3REUA 1SKUB 2RHQB 4CC4B 3G4SA 1EVLA 3RR6A 4F7UF 2E5QA 2HNIA 3O8VA 1VQ5Q 2AMCA 2V8JA 1K0SA 2ECZA 1W66A 2JMCA 4J7IA 4YRSA 1VUBA 2BIVA 1X2HA 2E65A 2JS0A 4LDYA 3NGPA 4KT0E 5GAMj 1I1JA 3OYIA 3LC0A 5GJVB 3HHTB 3KFUA 3W3SA 1H8KA 2XDBA 1GBRA 5GANd 1YJWQ 1NPRA 2M0YA 3EHRA 3I56T 4A4GA 2XDDA 2D0NA 2L89A 2FG0A 3M55A 3NTKA 4M77D 4HCBA 1JJCB 2CGHA 4PK4A 2P0PA 4QW2A 2EW3A 2ZCFB 1WQWA 4M77B 1GXIE 2HKQB 1OI1A 2Y4YA 4FSSA 4P5NA 3G7ZA 2XD0A 5GMKm 2JXBA 3H41A 3CC7Q 2DX1A 3CCQQ 2RH2A 1W70A 4G85A 4YRGA 2LVMA 1BI3A 2ALYA 1H3ZA 4KQEA 4XU2A 2JVVA 4M77G 2L0AA 3CPWS 5GANj 4M78E 2ENMA 1YI2A 1E1TA 4OB0B 5IAYA 1Z9ZA 2E5KA 4P74C 1XNIA 1D3BB 1IL2A 4YTLA 4M7AA 1KD1C 4ANJA 2LCSA 2RI2A 3JCMc 3OYEA 1WHKA 4H2YA 4A4FA 1NEBA 1WX6A 5GAN6 2K3BA 3CMAA 1B7YB 2LRQA 3CC7A 4EO4A 3SWNB 4OMLA 4BWAA 4M7DB 4BY6B 4Q5WA 2ZINA 4Y91A 1NJIU 2RN8A 1QVFS 2RK2A 2HEQA 5A0LA 4CH3A 4E7ZA 4J6XA 1H4VB 4G84A 3JB9H 3BJUA 2Q7HA 2F5KA 4YCWA 1U1SA 2KT1A 2R5AA 2BUDA 3EGXB 3OYYA 4X5OA 3QTCA 1SSFA 5A0GA 1WHGA 1K8AU 4J9GA 2LCLA 1KQSA 1UJYA 3CCMA 2F1LA 2XIDA 2JTFA 3MPUB 4PKCC 1VQZA 2E12A 2KMTA 2DPPB 1NLOC 2ATCB 3OYMA 1RIQA 3CCEQ 3RUXA 4B9XA 5I22A 2MF2A 1KD1R 1QF6A 1QCFA 1UJ0A 2XGTA 1RAHB 4E7HA 2CUBA 2ED1A 1EFWA 1YBYA 5LJ5f 2DBMA 2DU5A 3CMQA 3OYBA 1D0XA 4LVMA 3LH0A 2GFAA 2IG0A 1QP2A 4L87A 1N9WA 1QVGA 4AG2C 2QEXT 2ZPIB 3HL8A 2CJAA 4DBFA 1M3AA 2KROA 4C92C 3KFVA 1KQSS 1EX4A 3CXCP 1Y0MA 5M9OA 2CJBA 2LJ0A 1H3HA 1FX7A 1M5Q1 2KNBB 2RK1A 6AT1B 2F2WA 1VQ6A 2X4YA 4TVAA 1SSHA 5L23A 2GTJA 2J3MA 3VQWA 1E22A 2K3XA 3UDCA 2DQ3A 2D1XA 3N5BB 2A28A 1UUEA 4ZN3A 3C95A 1VQ8Q 3CCVA 1PRLC 3V7CA 3BDUA 1HTTA 4N4GA 4J5YA 1UHFA 2QK0A 2V8KA 1QVFP 2VWFA 4O2DA 2QTXA 2C06A 4YRMA 3GLXA 7AT1B 2HCKA 1YITQ 2CIMA 3OYHA 3HXWA 1WHMA 1WQ7A 2MK5A 2D8JA 5D6WA 4C92E 1C0AA 1BYMA 3OS1A 3UA7A 4M77A 2EJFA 5IXBA 5KYUA 1B7TA 1O9SA 3A31A 1EQRA 2NYSA 4NS5A 2ZGWA 4XEOA 3A1PA 4C5EA 2AKWB 4JPBW 1BI0A 2NWMA 2PVGB 1B76A 4E7JA 1BI2A 1H641 5F5WA 3E9GA 3PT9A 3I7FA 3PCOB 1RI9A 2EJ9A 1VQMQ 4IIOA 5LJ5d 2E6NA 3C12A 3CCLA 2LQ8A 2LT4A 4FM4B 4BB7A 2RHSA 2DL4A 1X54A 2JW4A 1E1OA 1VQLT 1R0CB 2XMFA 1WXUA 4C5HA 1J3TA 2DXTA 5DLOA 2Y90A 1X27A 4QVDA 3CMEQ 3EGXA 2DO3A 2YWWA 4F7UB 1SESA 2NLUA 3QYHB 2EVRA 4E7LA 2ZPEB 1NJ2A 1UGSB 1QQJA 1L0WA 3FEOA 3QO7A 3TEGA 2QA4Q 4RG8A 1IXDA 2KYBA 2RJEA 4FIBA 1VA7A 5LL6S 3ZBDA 4PJOF 4HA8A 1M9SA 4CS2A 1NYRA 2J6OA 2RMOA 5KNNA 2LNVA 1KHCA 3QIIA 1NJ5A 5LJ5g 4PFPA 3LH5A 1FYFA 4JZ3A 1GL5A 1M30A 2ZZFA 4JLIA 2FL7A 3HPWA 1MNEA 3CCRA 5GAMg 3VS7A 3EG3A 2D6FA 3CXCS 1WIEA 2DZ9A 4X9DA 3G6EA 2LCCA 2QASA 1YIJT 3EFOA 5C51B 3PGGA 2LTOA 1ZA2B 4BI8B 4OMNA 1TH7A 3CCVQ 1D09B 2ZXFA 1USYC 3UF4A 3MEYA 3QUIA 1K9MU 3RESA 2MI6A 1WPYA 2AMCB 4WI1A 2YDLA 1D0YA 1YB3A 3M54A 1ZUKA 3DSQA 1Y71A 3MO8A 4A4EA 4PJNA 4F04B 1JXOA 1KQSP 2FO0A 1G2BA 1TU0B 3LLRA 1MMGA 3RF1A 1U3OA 1WNLA 1EIFA 2DVEA 2DL7A 4FL6A 3ERRA 1NZ9A 1VQ5T 1OYXA 1QLYA 1X6BA 1I8FA 5GAMe 1Q7YC 3MP1A 3UPUA 3QYGB 3CCLQ 4J9IA 1WHHA 5KYWA 1OU9A 1U8RA 2RHIA 1WJSA 3CQTA 2PVDB 3QNEA 4LXCA 3RIRA 3SEMA 1S72A 5HGQA 1WYXA 2EPDA 3P8HA 2HBPA 2L2PA 1VYUA 4RTYA 2QYZA 2VUBA 5EC7A 5D6YA 4F17A 2V8IA 4LDXA 3GNFB 5AT1B 3HRUA 3LGLA 3QO5A 4C0DC 4WF2A 2LJ3A 1UFFA 1YHQA 1M90C 3BFMA 2K5LA 1RAFB 4TVWA 4P74A 2RO0A 5KE2A 3CBPA 1VQ4T 1BBZA 2EYZA 4WJ3M 2L3PA 1C1AA 4PJOB 1I07A 2HKNA 3ME9A 4IUPA 3G6ET 2OI3A 2P5IA 1SRYA 1UEBA 2B8AA 4TQFA 1BBWA 4KULA 2HQHA 2YT6A 1V1CA 4KBMB 3HFNA 2CT4A 4L6V5 4RTZA 3RKYA 1OX8A 3AT1B 1IRXA 1SERA 1VQ5A 1M8MA 2JZ2A 3P8DA 1NE8A 4GLMA 1W2BA 2DNUA 1TOVA 2KXDA 2XK0A 3E9HA 4JRPA 2RI5A 4JJDA 4LD9K 3LWHA 2YXYA 1H92A 2J05A 2QAZA 3CPWP 1K73U 2FPFA 4J9DA 4BDYA 3HY1A 2EQUA 2SRCA 5A2QE 2ARUA 2DA9A 1W6XA 1IO6A 3CC7T 4FYWB 1BI1A 2JUFA 1G3SA 2OTJA 2LQWA 3UT1A 1RL2A 3TCJA 2K5FA 1YFTA 3IG2A 1U1TA 1TG0A 4PJOD 2LQNA 2WSEE 1VQ7Q 4Y28E 3E9IA 4KRTA 4C5IA 1TTHB 4DBRA 3CMEA 1YFSA 3WQZA 1E24A 1N8RR 3HRSA 4IKFA 3G71Q 4RTUA 1Z7NA 2DFUA 3P8YA 4M77C 1HSQA 4DPGA 3EG9A 1LYLA 3I5RA 4J9HA 4HXJA 1M1KC 3VUZA 3MCAB 5GAN3 2COZA 3HP9A 1VQMA 4M7AG 3G4ST 4C0DB 1Q86R 1T0JA 3GNGA 4KR3A 3M0SA 4RQFA 4II1A 2L8DA 2AZSA 2YRVA 2YRDA 4RTXA 2M51A 4C8QC 1NYGA 2QDYB 4OGEA 3LW5E 1CKBA 2JMAA 2CH4A 3EAEA 1PYSB 3TUPA 1X55A 2K79A 4CS4A 2EGCA 2ZIOA 2RJFA 2JNGA 3KUFA 1OOTA 1ZHIA 1SRLA 4PG3A 1MUZA 2O01E 4OMQA 1MNDA 2CP2A 5CKHA 2EL9A 3VBBA 4KR2A 2VC8A 1A0NB 1TUDA 4JZ4A 3QHSA 2HSPA 4OB1B 4M77E 1M2VA 4XTVA 1Y96A 2HQXA 4HT4A 3VS5A 2DTOA 4CS3A 5DLQE 2DKGA 4EMKB 3I9QA 3G1JA 3META 2HL5C 4UP9A 3A8OB 1TUGB 4ZTZB 3PMIA 1QCOA 2FZGB 3OA6A 1PSEA 4M78C 1GBQA 5CQYA 4H2SA 2NUPA 1YJ9Q 3QBYA 3HY0A 4D8DA 5HK0A 4OMOA 4LVKA 3CEYA 2DIQA 1G83A 4AFUC 5CVIA 2BE7D 4EMKC 2RQRA 2DF6A 3A7RA 2IY5A 3CMAT 2ZT6A 4TVRA 2C0IA 4A4KA 2P84A 2VV5A 1JO8A 2FPEA 4KGXB 3HRTA 2RI3A 1UGPB 3T9NA 2BE9B 1YJNA 4XEMA 5E3IA 1K9AA 3H0FA 4JJNK 3SDZA 1K73R 1QKWA 4XU3A 2EQMA 3OYFA 2EWNA 1YCYA 1K73C 1NLPC 2K2MA 3FDRA 5KCOA 2F69A 3VS1A 1I4K1 1XOVA 4DOVA 5KYNA 2LT1A 1HK9A 3CMET 1N9RA 2MOXA 2P4TA 1KD1U 4H2VA 2YLCA 1IHWA 1VYVA 3VKIA 1VQ9T 1YWOA 2I4OA 3PZCA 4M7DG 4OP0A 1B34A 2HZYA 3NETA 1FWZA 9ATCB 5EG2A 2Q5HA 2EYQA 3EG1A 1VQ6Q 1QW1A 3VRYA 2PQWA 4YYEA 3JRZA 4M75B 4Z8AA 4N0AC 5IH2A 3NENA 1M1KU 4PJOC 5GMKi 3H6ZA 2NS6A 2VXFA 3C4SA 3TEEA 4CH5A 3EHQA 1R77A 2RD1A 3OY9A 3EGDB 4XTZA 2DZCA 1VQOA 3JB9F 1WU7A 4BACA 4PJOA 3CXCA 3U23A 3RACA 1BU1A 2DERA 3OB9A 4RMFA 1MHNA 2LMJA 2QDLA 1UG1A 2QQRA 3E1SA 2AHJB 1PM3A 1X69A 4ATOA 4HKEA 1VQKT 5LJ3h 4M78B 2X51A 4IUVA 1LPLA 4OF1A 3ZEHA 3OS0A 1UECA 3SHWA 3L2VA 2VASA 1T0HA 1GRIA 2EIFA 4C8QD 1I81A 4MMLA 1M3BA 4MDXA 2CREA 4M78G 2ZZGA 5FRMA 2Q7EA 2HSEB 1M27C 3VJPA 1FMKA 2K5IA 1KFZA 4HT8A 4AFQC 2BZYA 1D1CA 3LSQA 2YUPA 1LCKA 2DIGA 1UGVA 2ROLA 1QCNA 3MEUA 1M4ZA 5LJ3g 4AMCA 1PKTA 4ZGEB 4P71C 2VYTA 2VVKA 1YIJQ 3S3OA 1KG1A 3IKLA 2HQEA 5K1PA 2XICA 1E7OA 5FU6B 1G5IA 1IHVA 3BY7A 2J7IA 2O9VA 5FW9A 1Y96B 2ZNIA 3P8BB 2H3JA 1ZX6A 5I2SA 2AK5A 1VIFA 1JEGA 3CCVT 1VOMA 4EX5A 2ZT7A 4YRNA 4K11A 2RHUA 4RDXA 2Z0WA 2XDPA 1U5SA 1CKAA 1NJIR 4P3NA 1JU5C 2PMEA 2QEXA 2ZR2A 5GANf 4C8QG 4HWPA 4YDQA 1YFRA 3OYDA 3CCUT 5GAN7 3CC4Q 2OAWA 2IPOB 2I4LA 3OD1A 4L59A 3P8TA 1RAGB 3BW1A 3CCET 3L4GA 4YRRA 4AFSC 1J5WA 4XU0A 3RMSA 1BK2A 3NMZC 1JBMA 4FT4A 4MZPA 3QO3A 4C0GA 5KYWB 1Q7YR 1VQ4A 2DQ0A 1KOGA 1ZBXA 4OB3B 2QQBA 3EGUA 3VYGA 1YJNT 3A32A 1Q95G 3PMTA 4NL2A 3JCMQ 2YUQA 3OYKA 5IT9E 1MMNA 3MJXA 1NM7A 1SRMA 1NJ1A 1PNJA 2O9SA 3PIOA 1YHQQ 1CSKA 3SWNA 5IHIA 1G8XA 3X26B 2FRWA 4EPCA 3QG1A 4E6RA 1YCSB 2YUOA 1X2KA 3RKWA 1WFWA 2C0TA 4C8QE 1VQMT 1HXDA 2COYA 3I56Q 1OV3A 3WXMB 3RDVA 2XTIA 3M9QA 2MWOA 2GTOA 4P3PA 4DEYA 1NJ8A 4A54A 4NCXA 4M7DD 2QA4A 5FROA 4QVCA 2ODRC 5KYXB 4PL6A 3ASKA 1X2GA 2JTMA 1B3QA 4ZGDB 4H2XA 3QXEB 5GAN2 3X25B 1N8RC 4YRCA 2J3LA 4YPFA 2QA4T 1S1NA 5ECAA 5HY6A 3CCMQ 5CO7A 2QXFA 1K8AC 2AT1B 2OTLQ 1ACMB 2EBPA 2QQAA 3DLMA 2KT8A 3EFSA 4GY5A 4MZTA 2PZ1A 5GAN4 3CCRT 2GF7A 5KH6A 1G3TA 1JJ2P 3EG0A 1KIKA 2PMFA 1AD5A 2JN0A 3KXTA 1VQPA 3CD6A 4OLFA 2C7IA 2DL8A 3PE0A 4TVYA 1I5LA 1BKBA 4YRPA 5I21A 1UHCA 2ROTA 3URGA 2R57A 3TSWA 2ODRD 3NTHA 1Q82U 2DK3A 4OMFB 2LQKA 1N9SA 4ME7A 1X6GA 2OTJQ 3S3MA 4N4IA 1RLQC 5CKEA 4ZTUB 1PYSA 1HYOA 1VQ4Q 4E2FB 4JUVA 2X4XA 1MV0B 3LWIA 4L5GA 3OYCA 3HXUA 4XTYA 2EQIA 3IKMB 1M1GA 4F7UA 1JB0E 2KRMA 1WJRA 4EMGA 1OZ3A 4ZN1A 4HVVA 1PD0A 4DBHA 5GAMh 1Q7YU 1RAIB 3PVLA 3QJYA 2X35A 3M0UA 3JCMX 5GAOn 1H4QA 4UC4A 4BE2A 3EG9B 2KAFA 3OW2P 2LZ6B 1I0CA 1SEMA 3PCOA 1IB8A 2BTTA 3TEHB 1ABOA 5IN1A 4AT1B 2C8MA 3OQ5A 3CCLT 3HFVA 2EQKA 3R07A 3QWYA 5FLXE 2XHCA 2D8HA 5LJ3j 2DDZA 4FW1A 4ESRA 1SG5A 4PNOA 5GAOl 4TTVA 4YROA 4OMMA 1PRMC 4HWRA 4TWAA 3VS6A 2A0FB 3CC2A 1IGUA 4CH6A 3HFZA 2ZPFB 2NUTB 3A8LB 3CCJT 1VQNQ 1LJOA 3QO8A 3OSSC 4ZGJB 3CCEA 2NUPB 2JOYA 3I55A 1PWTA 3MKDA 2G6FX 2CP3A 4LNPA 1V29B 5K1XA 4H2WA 2W10A 4C92A 2EKHA 4LUEA 1BCOA 3EG2A 3FIFA 4B9WA 1SPKA 4UP7A 1AWWA 2VXEA 1V76A 5C52B 3MHXA 3EH1A 2I4MA 3MEWA 4CC2A 2E5AA 1B7YA 2A8EA 4PLLA 1EVKA 2I4NA 2FZKB 1SETA 3PFSA 1B8AA 3PTAA 1NG2A 1BIBA 2ZPBB 2I0NA 1W2BP 3HXYA 2JJ9A 1AHJB 3DLLA 1UE9A 2DTHA 3G4SQ 3MP8A 1YJ9T 4CC3A 1DJ7B 2DJQA 2CZ0B 4Z02A 1ARKA 1UGQB 2XKOC 2DD5A 5FU7C 2GBQA 3OYNA 2IY5B 3JCMV 3RKXA 2HDAA 4HWSA 2LDMA 5L8RE 1B07A 1I5OB 3CCJQ 3JCMh 4DOWA 1FMWA 1VQNT 3V7RA 1Q81R 1XTDA 2KR3A 4RCBA 2CP7A 4IUQA 2DM1A 3HFOA 1Z9QA 2OTJT 1MGQA 4JJBA 2P0QA 1UGRB 2G3RA 2KXCA 4HT9A 4P73C 4YRFA 3VS2A 4M75E 3PVQA 3E19A 3I55T 1WLPB 4MDWA 4BI3A 2CSIA 1VQ7T 4EMKA 5LJ5e 3AHUA 2A7YA 1FXXA 1E6GA 3CCJA 3IQLA 3VQYA 3G6EQ 2HD0A 3TEHA 1WA7A 1PC0A 4BI4A 2CKKA 3VU3C 2HAXA 2M02A 4FT2A 1AEYA 4F16A 2L3RA 2CZ6B 3QZ5B 4P72A 2DRKA 4M7DC 3HTRA 3L4GB 1YP5A 1G5HA 4CC7A 2MMPA 2EAYA 3JCMf 4BUGA 3PNWC 1XJWB 4QVZA 5CKFA 1H4TA 4YRIA 1ZSGA 1EFNA 5GANg 2DL3A 4BD3A 1AWXA 1NBEB 3CC2Q 1VQOQ 1K0XA 5GMKl 2X4WA 3HXZA 3RMQA 4LDVA 3JCMW 1NYFA 3I35A 1RI0A 1C6VX 2K6DA 4Z89A 1BB9A 2E10A 3H8ZA 3OYJA 2NUTA 1Z7MA 2KY9A 2AKKA 3FRNA 3CCQT 2EKOA 1EIYA 1EOVA 2FHDA 3CD6Q 3I55Q 4LE9A 3QSUA 3A8GB 1GFCA 2ABLA 4J9EA 3VV0A 2K57A 1VQKQ 2QHSA 4TQDA 3M5AA 1M90U 3NTIA 3NELA 2OX7A 2OTLT 3RBBB 2K4YA 3JCMP 2E70A 3M0TA 5KYUB 3S6WA 3V7SA 1W4SA 5GJWB 1WGSA 1AVZC 1ZSZB 3D7SB 2XU8A 2A36A 4BE0A 1ASZA 3REAB 3CCRQ 2O4XA 3QWXX 1PKSA 1VQ9A 3X20B 4C92B 2DBKA 3C0CA 5CK9A 4C8QF 2ZT5A 5FWCA 1OX9A 2RHYA 5GAOp 2QQ9A 3E9FA 3RL6A 1YI2Q 4XQ3A 3JCMg 2P4RA 2Q7GA 1LNXA 1HC7A 2AZVA 5CIUA 2ZZDA 2FPDA 4C0ZA 3M57A 1R8OB 2KI7A 4M75F 4RCCA 5KYYB 1X6OA 5GAMd 1MMDA 3HXVA 4OMPA 11ASA 2DXCA 3Q1JA 1YIJA 5D7UA 2EGEA 3I56A 4J8OA 1WJQA 1N27A 1BBUA 3A5YA 2V1RA 4OB2B 2FYKA 2FZCB 2M9UA 3CCMT 4XTXA 4JRKA 2RQVA 2AKLA 1TXQA 2LP5A 1M1FA 4BE1A 1TWBA 4A53A 3G1ZA 1M2VB 3E2UA 3JB9G 1WDXA 4LUDA 1PG5B 4H2XB 2HMAA 3J7AF 3EGDA 2OTLA 4YRKA 4M78D 5GAOq 2ESWA 2RB6A 3QKJA 2DXBA 1WLEA 1H4SA 3CCST 3MEAA 3JB9J 1KMNA 1NYQA 1YITA 1D3BA 4J7FA 5C6SA 4C5GA 1QVGP 2WACA 2PUOB 4B6MA 4J6YA 1B70A 4VUBA 5A0DA 2RM4A 3V8KA 4AG1C 3UWNA 3WVEB 4PHCA 1RUWA 4RUGA 1EZZB 1VQPQ 3QDFA 3CD6T 4EDUA 3DB3A 1OZ2A 3UA6A 4YCVA 2KEAA 2IIMA 4A63B 4BDZA 3M4YA 4EMHA 1GFDA 3X24B 2ZTGA 3LSSA 3MQZA 3CC4A 4Q6GA 1FYNA 4QT7A 2EGAA 3O5ZA 2MYSA 4FW2A 2ARTA 4R0KA 2X3XD 3A7UA 3I5SA 3CC4T 4HVWA 4HCKA 4LVIA 1VQ9Q 2ZPGB 2QQSA 1K9MR 3RNJA 1M90R 4H02A 4YRTA 1AZEA 4C8QB 1Q82R 5GMKj 2X9HA 2QTVA 4AFZC 2J6FA 3R6NA 4KGVB 2CP6A 4O5VA 1M1KR 2XI9A 1GGMA 4M75A 3A5ZB 1WXTA 4MZMA 4Q15A 1KK7A 2E3IA 2YLBA 2O88A 2QHVA 4GLKA 4E7SA 4NL3A 4J15A 1G5VA 2LX9A 1AZGB 1M2OA 5D6XA 4JJCA 5GAOr 3THKA 3CPFA 2KK4A 4XTWA 4JS5A 3TQ7P 2E1HA 3LYIA 4ELYC 1KC8C 2QGFB 1YJ9A 3M4GA 2EYXA 3A8MB 4HWTA 5GAOm 4M4ZA 2ZZEA 3OMGA 3ULRB 3GOXA 1KQ2A 4N4HA 4M7AF 3VQVA 1NNHA 2RQUA 3KBGA 5GAMf 2COWA 3RERA 3FB9A 2DAQA 3UFGA 1BCMA 4YCUA 1VQNA 1G3YA 3UATA 3REBB 1ZA1B 1OU8A 1O75A 1WHLA 1QWEA 2DILA 2CZ7B 3UGQA 1VQKA 1AWOA 1S72T 4E51A 4FYYB 4XTUA 1RABB 3JV3A 2EYWA 1D1AA 3CBOA 3VYHB 1SF9A 2DVJA 1PSFA 4JS4A 2EYYA 1G51A 2W0ZA 4PJJA 4Y92A 2GFUA 1ZSZC 1WHJA 4JRQA 1W2BS 1WZOA 1NEGA 2MWPA 1OPKA 2LJ1A 1QVFA 4K87A 1NJ6A 2D0QB 4F14A 2M16A 5GMKe 4DEXA 1QVGS 2CJ9A 2DD4A 1ZSZA 3MF2A 4LDUA 2CP0A 1N5ZA 1VYTA 2YHTA 8ATCB 1KMMA 4ZNXA 4JRIA 4C92F 2CH4W 1OPLA 2O2OA 3ZL7C 4IURA 1ADJA 1YGBA 3JCMd 3JAME 1NJIC 1N8RU 1M3CA 2RHZA 3NEMA 3X28B 1K8AR 3M0QA 3M59A 4N0AA 3HSBA 2HBWA 2AKWA 5LJ3f 4M7DA 1IZ6A 5FRNA 2X3WD 3OW2S 3VS3A 3FC3A 1IREB 4J9CA 3GIBA 1TUCA 4RQEA 2KYMA 4HWOA 3CCSA 2CDTA 2E64A 1G3WA 5AYFA 5LJ5j 5LJ3d 2PUKB 5CQXA 3DB4A 3A7AA 1JJ2A 4V2SA 4DBQA 2JTEA 2SEMA 2QI2A 1T3LA 2K3YA 3BDLA 3OS5A 2DL5A 4XAXB 4M75G 4D6WA 4M7AD 4HVUA 1YJNQ 4YRLA 1X56A 3OW2A 3S3NA 4UPAA 4AH6A 4KUIA 1ABQA 2CT3A 3INZA 1Q82C 4X9CA 2A37A 2MAMA 2O4XB 2WSFE 3CCSQ 1X2QA 3OSVA 2K9GA 5I11A 2CYZB 4RTVA 2EQJA 2BZ8A 5CAIA 5J39A 1VQOT 4FSXA 1Y07A 5GMKh 1RAEB 3OMCA 3CMAQ 4FU6A 2DETA 1K9MC 2PVOB 1JQQA 5IHKA 3OYGA 4C0FA 2GCXA 1Q86U 3HXXA 1RACB 3QJ6A 2PTKA 4TVAB 3PIPA 1TSFA 1Q86C 4LVJA 3F70A 2KBTA 3HKSA 1VQ8T 2DYBA 1KC8U 4M7AC 3V8LA 2V26A 2O31A 4O6JA 1KSWA 2WSCE 2F2VA 5CR2A 3G71T 2PNIA 4MMKA 3CBMA 2E3HA 5KCHA 3A98A 2JM9A 2DEUA 4LVLA 4KH0B 4IIMA 3MF1A 2VGNA 1X43A 2G4CA 3FJPA 2LX7A 4PLIA 4E7KA 2ZT8A 3GP8A 1K76A 1WI7A 3V8JA 1UB4A 4P71A 2ZAEA 1KC8R 4OGCA 5DY9A 3M0PA 1WYDA 2QHUA 1KHIA 3SB2A 3L2QA 1HD3A 2KDSA 1OULA 2RHSB 3QPHA 3QDRB 2F5TX 3HRKA 3RGLA 4F7UE 2DXUA 5CKDA 4WJ4A 2QEXQ 2DU7A 2KSSA 2RJCA 4J6WA 1YI2T 1C0MA 1GCQA 4QKUA 3TREA 2MPXC 1W1FA 2HL3A 3REXA 2LNHB 3SD4A 1SHFA 2ZIMA 3H0IA 3EH2A 2E3CA 2MCNA 3CCUA 3NPFA 4ZTJA 4M7AE 1TS9A 1QVPA 4BW9A 2OJ2A 1GCPA 3BE3A 2L5QA 5CCAA 3JB9D 1GCQC 5ELNA 3M0RA 1F1BB 4C92D 2D9TA
chains in the Genus database with same CATH topology
2BKDN 1VQ7A 3M4QA 5I2MA 4DQ2A 5GANe 2PU9B 4M75C 2GQVA 2EFIA 4A4HA 4JLGA 4F7UG 2A3LA 4CI0C 5C53B 2EJGA 5GAN8 3CCQA 3G71A 5CKBA 3JCMe 2ZNJA 4XK8E 5ELOA 2P0KA 4HVCA 1KQ1A 3J81E 4QQ6A 2R58A 3CC2T 3SFMA 3QZ9B 3FLGA 5LJ3e 2OAUA 3SWNC 2KQWA 3UH0A 3JSCA 3MEVA 4LNSA 3C94A 3L2UA 2XG8D 1ADYA 2QHTA 3ICAA 1N6AA 4KUDK 4K86A 1P92A 3A5ZA 1ZQ1A 2Y4XA 3M56A 1JRIA 4JDSA 1QP3A 1ASYA 4RKUE 3NFCA 4C8QA 2E41A 5FU6C 4J83A 1VQ6T 4CH4A 4PJOE 4P73A 1BIAA 1YJWA 2CZ1B 3HRIA 3MP6A 5J3BA 5DM7R 2RHQA 4LDWA 3M58A 2DJZA 4M77F 4X34A 4E47A 4C92G 5HKCA 4YREA 1JJCA 2RA2A 3OYLA 4LD6A 3OBYA 3TU4K 4NOYA 4XU1A 4K88A 4QQGA 3OS2A 3VQXA 3DKMA 2FVUA 4QQDA 4ELZC 5KE3A 1EIYB 3L2WA 4M7DE 2X4JA 4BY6C 1M8VA 2DEQA 4IUTA 1VIEA 3UGTA 3J80E 2ALYB 3GF5A 1NPPA 3LGFA 4E7IA 3HFZB 3L42A 1QE0A 4OVAA 2ZR3A 1USYA 3M53A 1YJWT 1YHQT 3L1AA 5FU7B 3LX7A 4PJOG 3ER0A 3L2ZA 4M78F 3L2RA 2R5MA 4HCCA 5C0MA 2LC4A 4YRQA 3CPWA 1VQPT 1X75C 5LJ5h 2ZPHB 4YP0A 1JJ2S 4M7DF 4P75C 12ASA 1B70B 2M1HA 1ATIA 2Q5IA 2I2LA 4ZTFA 4P75A 2FB7A 4YRJA 2ZCEA 3P8VA 3VUBA 2IVWA 3HTZA 2DTIA 3JCMb 2E6ZA 3R6OA 4DA4A 2M0OA 1Q81U 3OBWA 1VQ8A 2KVQG 2RHXA 1YITT 3EFRA 4M75D 4IUUA 1Q81C 3A74A 3A8HB 1VQLA 5GANh 1X01A 4R55A 2RJDA 2K2VA 4P3OA 2CS7A 2P0LA 5J26A 4UP8A 4M7AB 3ZFJA 4H2TA 3WVDB 4RG2A 1XQHA 4M78A 3M4PA 3JCMJ 3OYAA 4RMOA 1B34B 4R56A 4HCZA 3IALA 4H2UA 3JB9I 2VGMA 3GPLA 1Y7XA 2ARSA 5GAN5 4P72C 4CRIA 5HK3A 1LOJA 4ZIBA 3REUA 2RHQB 3G4SA 1EVLA 4F7UF 2E5QA 2HNIA 3O8VA 2AMCA 2V8JA 1W66A 4J7IA 4YRSA 1VUBA 2BIVA 1X2HA 2E65A 4LDYA 4KT0E 5GAMj 3OYIA 3LC0A 3HHTB 3KFUA 3W3SA 2XDBA 5GANd 1NPRA 3I56T 4A4GA 2XDDA 2L89A 4M77D 3NTKA 3M55A 1JJCB 4HCBA 2CGHA 2P0PA 4QW2A 2ZCFB 1WQWA 4M77B 1GXIE 1OI1A 2Y4YA 4P5NA 3G7ZA 2XD0A 5GMKm 2RH2A 4G85A 4YRGA 2LVMA 1BI3A 2ALYA 1H3ZA 4KQEA 4XU2A 2JVVA 4M77G 3CPWS 5GANj 4M78E 1YI2A 1E1TA 4OB0B 5IAYA 4P74C 1XNIA 1D3BB 1IL2A 4YTLA 4M7AA 1KD1C 2RI2A 3JCMc 3OYEA 4H2YA 4A4FA 3CMAA 5GAN6 1B7YB 2LRQA 3CC7A 4EO4A 3SWNB 4BWAA 4M7DB 4BY6B 4Q5WA 2ZINA 4Y91A 1NJIU 1QVFS 2RK2A 5A0LA 4CH3A 1H4VB 4J6XA 4G84A 3JB9H 3BJUA 2Q7HA 2F5KA 4YCWA 1U1SA 2R5AA 2BUDA 3OYYA 4X5OA 3QTCA 1SSFA 5A0GA 1K8AU 2LCLA 1KQSA 3CCMA 2XIDA 2JTFA 1VQZA 4PKCC 2E12A 2KMTA 2DPPB 1RIQA 3OYMA 3RUXA 4B9XA 2MF2A 1QF6A 2XGTA 4E7HA 1EFWA 1YBYA 5LJ5f 2DU5A 3CMQA 3OYBA 4LVMA 3LH0A 2GFAA 2IG0A 1QP2A 4L87A 1N9WA 1QVGA 2QEXT 2ZPIB 3HL8A 2CJAA 4C92C 1KQSS 5M9OA 2CJBA 1FX7A 1M5Q1 2RK1A 1VQ6A 2X4YA 4TVAA 2J3MA 3VQWA 1E22A 2K3XA 3UDCA 2DQ3A 3N5BB 4ZN3A 3C95A 3CCVA 3V7CA 3BDUA 1HTTA 4N4GA 4J5YA 2V8KA 4O2DA 2QTXA 2C06A 4YRMA 3GLXA 2CIMA 3OYHA 3HXWA 1WQ7A 1C0AA 5D6WA 4C92E 1BYMA 3OS1A 4M77A 2EJFA 1O9SA 3A31A 1EQRA 4NS5A 2ZGWA 4XEOA 4C5EA 2AKWB 1BI0A 2PVGB 1B76A 4E7JA 1BI2A 1H641 5F5WA 3E9GA 3PT9A 3I7FA 3PCOB 2EJ9A 5LJ5d 2E6NA 3C12A 3CCLA 2LQ8A 2LT4A 4FM4B 4BB7A 2RHSA 1X54A 1E1OA 1VQLT 4C5HA 2DXTA 5DLOA 2Y90A 4QVDA 2DO3A 4F7UB 1SESA 2NLUA 3QYHB 4E7LA 2ZPEB 1NJ2A 1UGSB 1L0WA 3FEOA 3QO7A 3TEGA 4RG8A 4FIBA 2RJEA 5LL6S 3ZBDA 4PJOF 4HA8A 1M9SA 4CS2A 1NYRA 5KNNA 2LNVA 1KHCA 3QIIA 1NJ5A 5LJ5g 1FYFA 2ZZFA 4JLIA 2FL7A 3HPWA 3CCRA 5GAMg 2D6FA 3CXCS 2DZ9A 4X9DA 3G6EA 2LCCA 1YIJT 5C51B 3PGGA 2LTOA 4BI8B 1TH7A 2ZXFA 1USYC 3MEYA 3QUIA 1K9MU 3RESA 2MI6A 1WPYA 2AMCB 4WI1A 1YB3A 3M54A 3DSQA 1Y71A 3MO8A 4A4EA 3LLRA 3RF1A 1WNLA 1EIFA 2DVEA 4FL6A 3ERRA 1NZ9A 1VQ5T 1OYXA 1I8FA 5GAMe 1Q7YC 3MP1A 3UPUA 3QYGB 1U8RA 2RHIA 1WJSA 2PVDB 3QNEA 3RIRA 1S72A 5HGQA 3P8HA 2HBPA 2VUBA 5D6YA 2V8IA 4LDXA 3GNFB 3HRUA 3LGLA 3QO5A 4C0DC 4WF2A 1YHQA 1M90C 3BFMA 2K5LA 4TVWA 4P74A 2RO0A 5KE2A 3CBPA 1VQ4T 4WJ3M 4PJOB 4IUPA 3ME9A 3G6ET 2P5IA 1SRYA 1UEBA 2B8AA 4TQFA 1BBWA 4KULA 4KBMB 3HFNA 4L6V5 3RKYA 1SERA 1VQ5A 2JZ2A 3P8DA 1NE8A 1W2BA 2XK0A 3E9HA 4JRPA 2RI5A 4LD9K 3LWHA 1K73U 4BDYA 3HY1A 2EQUA 5A2QE 2ARUA 3CC7T 1BI1A 2JUFA 1G3SA 2OTJA 3UT1A 1RL2A 3TCJA 2K5FA 1YFTA 3IG2A 1U1TA 4PJOD 2WSEE 4Y28E 3E9IA 4C5IA 3CMEA 1YFSA 3WQZA 1E24A 3HRSA 4IKFA 1Z7NA 3P8YA 4M77C 4DPGA 1LYLA 1M1KC 3VUZA 3MCAB 5GAN3 3HP9A 1VQMA 4M7AG 3G4ST 4C0DB 4KR3A 3GNGA 4RQFA 4II1A 2L8DA 2YRVA 4C8QC 2QDYB 4OGEA 3LW5E 3EAEA 1PYSB 3TUPA 1X55A 4CS4A 2ZIOA 2RJFA 2JNGA 3KUFA 1ZHIA 4PG3A 2O01E 5CKHA 2EL9A 3VBBA 4KR2A 2VC8A 3QHSA 4OB1B 4M77E 4XTVA 1Y96A 2HQXA 4HT4A 2DTOA 4CS3A 5DLQE 2DKGA 4EMKB 3META 4UP9A 3A8OB 4ZTZB 3PMIA 3OA6A 1PSEA 4M78C 5CQYA 4H2SA 3QBYA 3HY0A 5HK0A 4LVKA 3CEYA 2DIQA 5CVIA 3A7RA 4EMKC 2IY5A 3CMAT 2ZT6A 4TVRA 4A4KA 2VV5A 3HRTA 2RI3A 1UGPB 3T9NA 1YJNA 4XEMA 5E3IA 4JJNK 3SDZA 4XU3A 2EQMA 3OYFA 2EWNA 1YCYA 1K73C 3FDRA 5KCOA 2F69A 1I4K1 1XOVA 4DOVA 2LT1A 1HK9A 3CMET 1N9RA 2P4TA 1KD1U 4H2VA 2YLCA 3VKIA 1VQ9T 2I4OA 3PZCA 4M7DG 4OP0A 1B34A 3NETA 1FWZA 5EG2A 2Q5HA 2EYQA 1QW1A 2PQWA 4YYEA 3JRZA 4M75B 4N0AC 3NENA 1M1KU 4PJOC 5GMKi 3H6ZA 2NS6A 2VXFA 3C4SA 3TEEA 4CH5A 2RD1A 3OY9A 4XTZA 2DZCA 1VQOA 3JB9F 1WU7A 4BACA 4PJOA 3CXCA 3RACA 3OB9A 4RMFA 1MHNA 2QQRA 3E1SA 2AHJB 4ATOA 4HKEA 1VQKT 5LJ3h 4M78B 4IUVA 4OF1A 3ZEHA 3OS0A 3L2VA 2EIFA 4C8QD 1I81A 4MMLA 4MDXA 4M78G 2ZZGA 5FRMA 2Q7EA 3VJPA 2K5IA 4HT8A 3LSQA 2DIGA 3MEUA 1M4ZA 5LJ3g 4ZGEB 4P71C 2VYTA 3S3OA 1KG1A 3IKLA 2HQEA 5K1PA 2XICA 5FU6B 1G5IA 3BY7A 1Y96B 2ZNIA 3P8BB 2H3JA 5I2SA 1VIFA 3CCVT 4EX5A 2ZT7A 4YRNA 2RHUA 4RDXA 2XDPA 4P3NA 2PMEA 2QEXA 2ZR2A 5GANf 4C8QG 4HWPA 4YDQA 1YFRA 3OYDA 3CCUT 5GAN7 2I4LA 3OD1A 4L59A 3P8TA 3BW1A 3CCET 3L4GA 4YRRA 1J5WA 4XU0A 3RMSA 1JBMA 4FT4A 4MZPA 3QO3A 4C0GA 1VQ4A 2DQ0A 1KOGA 1ZBXA 4OB3B 2QQBA 3VYGA 3A32A 1YJNT 3PMTA 3OYKA 4NL2A 3JCMQ 5IT9E 1NJ1A 3PIOA 3SWNA 3X26B 4EPCA 3QG1A 3RKWA 4C8QE 1VQMT 1HXDA 3WXMB 2XTIA 3M9QA 2MWOA 4P3PA 1NJ8A 4A54A 4NCXA 4M7DD 2QA4A 5FROA 4QVCA 2ODRC 4PL6A 3ASKA 1X2GA 2JTMA 4ZGDB 4H2XA 3QXEB 5GAN2 3X25B 1N8RC 4YRCA 2J3LA 4YPFA 2QA4T 5HY6A 5CO7A 2QXFA 1K8AC 2QQAA 3DLMA 3EFSA 4GY5A 4MZTA 3CCRT 5GAN4 2GF7A 5KH6A 1G3TA 2PMFA 2JN0A 3KXTA 1VQPA 3CD6A 4OLFA 2C7IA 4TVYA 1I5LA 1BKBA 4YRPA 5I21A 3URGA 2R57A 2ODRD 3NTHA 1Q82U 2DK3A 4OMFB 2LQKA 1N9SA 4ME7A 3S3MA 4N4IA 5CKEA 4ZTUB 1PYSA 4JUVA 2X4XA 3LWIA 4L5GA 3OYCA 3HXUA 4XTYA 3IKMB 1M1GA 4F7UA 1JB0E 1WJRA 4EMGA 1OZ3A 4ZN1A 5GAMh 1Q7YU 3QJYA 2X35A 3JCMX 5GAOn 1H4QA 4UC4A 4BE2A 2KAFA 3PCOA 3TEHB 5IN1A 2C8MA 3OQ5A 3HFVA 3CCLT 2EQKA 3R07A 5FLXE 2XHCA 5LJ3j 2DDZA 4PNOA 5GAOl 4TTVA 4YROA 4HWRA 4TWAA 3CC2A 4CH6A 3HFZA 2ZPFB 3A8LB 3CCJT 1LJOA 3QO8A 3OSSC 4ZGJB 3CCEA 2JOYA 3I55A 1V29B 5K1XA 4H2WA 4C92A 3FIFA 4B9WA 4UP7A 2VXEA 5C52B 3MHXA 2I4MA 3MEWA 2E5AA 1B7YA 2A8EA 4PLLA 1EVKA 2I4NA 1SETA 3PFSA 1B8AA 3PTAA 1BIBA 2ZPBB 3HXYA 1AHJB 3DLLA 2DTHA 3MP8A 1YJ9T 1DJ7B 2CZ0B 4Z02A 1UGQB 2XKOC 2DD5A 5FU7C 3OYNA 2IY5B 3JCMV 3RKXA 4HWSA 2LDMA 5L8RE 1VQNT 3JCMh 4DOWA 3V7RA 1XTDA 4RCBA 3HFOA 4IUQA 2OTJT 1MGQA 2P0QA 1UGRB 2G3RA 4YRFA 4HT9A 4P73C 4M75E 3E19A 3I55T 4MDWA 4BI3A 1VQ7T 3AHUA 4EMKA 5LJ5e 2A7YA 1FXXA 3CCJA 3VQYA 2HD0A 3TEHA 4BI4A 2CKKA 3VU3C 2HAXA 4FT2A 2L3RA 2CZ6B 3QZ5B 4P72A 4M7DC 3L4GB 1G5HA 2MMPA 2EAYA 3JCMf 4BUGA 3PNWC 4QVZA 5CKFA 1H4TA 4YRIA 5GANg 4BD3A 5GMKl 2X4WA 3HXZA 3RMQA 4LDVA 3JCMW 1RI0A 2E10A 3H8ZA 3OYJA 1Z7MA 2KY9A 3FRNA 3CCQT 2EKOA 1EIYA 1EOVA 2FHDA 3QSUA 3A8GB 3VV0A 2K57A 2QHSA 4TQDA 3M5AA 1M90U 3NTIA 3NELA 2OTLT 2K4YA 3JCMP 2E70A 3S6WA 3V7SA 1W4SA 1WGSA 2XU8A 4BE0A 1ASZA 2O4XA 1VQ9A 3X20B 4C92B 5CK9A 4C8QF 2ZT5A 2RHYA 5GAOp 2QQ9A 3E9FA 3RL6A 4XQ3A 3JCMg 2Q7GA 1LNXA 1HC7A 5CIUA 2ZZDA 4C0ZA 3M57A 1R8OB 4M75F 4RCCA 1X6OA 5GAMd 3HXVA 11ASA 2DXCA 3Q1JA 1YIJA 3I56A 4J8OA 1WJQA 1N27A 1BBUA 3A5YA 4OB2B 2FYKA 2M9UA 3CCMT 4XTXA 4JRKA 1M1FA 4BE1A 4A53A 3G1ZA 3JB9G 4H2XB 3J7AF 2OTLA 4YRKA 4M78D 5GAOq 2RB6A 3QKJA 2DXBA 1WLEA 1H4SA 3CCST 3MEAA 3JB9J 1KMNA 1NYQA 1YITA 1D3BA 4J7FA 5C6SA 4C5GA 2WACA 2PUOB 4J6YA 1B70A 4VUBA 5A0DA 2RM4A 3V8KA 3UWNA 3WVEB 4PHCA 3CD6T 4EDUA 3DB3A 1OZ2A 4YCVA 4BDZA 3M4YA 4EMHA 3LSSA 3X24B 2ZTGA 3MQZA 3CC4A 4Q6GA 2ARTA 3A7UA 3CC4T 4LVIA 2ZPGB 2QQSA 4H02A 4YRTA 4C8QB 5GMKj 4O5VA 2XI9A 1GGMA 4M75A 3A5ZB 4MZMA 4Q15A 2YLBA 2QHVA 4GLKA 4NL3A 4J15A 1G5VA 2LX9A 5D6XA 5GAOr 3CPFA 2KK4A 4XTWA 4JS5A 2E1HA 3LYIA 4ELYC 1KC8C 1YJ9A 3M4GA 4HWTA 3A8MB 5GAOm 2ZZEA 3OMGA 3GOXA 1KQ2A 4N4HA 4M7AF 3VQVA 1NNHA 3KBGA 5GAMf 3RERA 3FB9A 2DAQA 3UFGA 4YCUA 1VQNA 1G3YA 1O75A 2CZ7B 3UGQA 1VQKA 1S72T 4E51A 4XTUA 3CBOA 3VYHB 1PSFA 4JS4A 1G51A 2GFUA 4JRQA 1W2BS 2MWPA 1QVFA 4K87A 1NJ6A 2D0QB 2M16A 5GMKe 1QVGS 2CJ9A 2DD4A 3MF2A 4LDUA 2YHTA 1KMMA 4JRIA 4C92F 4IURA 1ADJA 1YGBA 3JCMd 3JAME 1NJIC 1N8RU 2RHZA 3NEMA 3X28B 3M59A 4N0AA 3HSBA 2AKWA 5LJ3f 4M7DA 1IZ6A 5FRNA 3OW2S 3FC3A 1IREB 3GIBA 4RQEA 4HWOA 3CCSA 2E64A 1G3WA 5AYFA 5LJ5j 5LJ3d 2PUKB 5CQXA 3DB4A 3A7AA 1JJ2A 4V2SA 2QI2A 3BDLA 2K3YA 3OS5A 4XAXB 4M75G 4D6WA 4M7AD 4YRLA 1X56A 3OW2A 3S3NA 4UPAA 4AH6A 4KUIA 3INZA 1Q82C 4X9CA 2MAMA 2O4XB 2WSFE 3OSVA 2CYZB 2EQJA 5CAIA 5J39A 1VQOT 4FSXA 1Y07A 5GMKh 3OMCA 4FU6A 1K9MC 2PVOB 3OYGA 4C0FA 2GCXA 1Q86U 3HXXA 3QJ6A 4TVAB 3PIPA 1Q86C 4LVJA 3F70A 1VQ8T 3HKSA 1KC8U 4M7AC 3V8LA 4O6JA 2WSCE 5CR2A 3G71T 4MMKA 3CBMA 5KCHA 4LVLA 3MF1A 2VGNA 2G4CA 3FJPA 4PLIA 4E7KA 2ZT8A 3GP8A 3V8JA 1UB4A 4P71A 4OGCA 5DY9A 1WYDA 2QHUA 1KHIA 3SB2A 3L2QA 2KDSA 2RHSB 3QPHA 3HRKA 2F5TX 3QDRB 3RGLA 4F7UE 2DXUA 5CKDA 4WJ4A 2DU7A 2KSSA 2RJCA 4J6WA 1YI2T 3TREA 3REXA 3SD4A 2ZIMA 2E3CA 3CCUA 4ZTJA 4M7AE 4BW9A 1QVPA 2L5QA 5CCAA 3JB9D 5ELNA 4C92D 2D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJA A;  5GMK l;  3HXZ A;  4C92 C;  3JCM W;  4H2V A;  2CJB A;  3M4Q A;  2YLC A;  4DQ2 A;  5GAN e;  2E10 A;  4M75 C;  1Z7M A;  1M5Q 1;  2I4O A;  3PZC A;  4F7U G;  4M7D G;  1EOV A;  1EIY A;  4TVA A;  4OP0 A;  5C53 B;  2J3M A;  1B34 A;  3VQW A;  3QSU A;  1E22 A;  2EJG A;  5GAN 8;  3NET A;  3JCM e;  2ZNJ A;  2DQ3 A;  2K57 A;  2QHS A;  2Q5H A;  4TQD A;  5ELO A;  4HVC A;  4YYE A;  3V7C A;  4M75 B;  3BDU A;  3NEL A;  1HTT A;  4J5Y A;  4N0A C;  1KQ1 A;  3NEN A;  4PJO C;  5GMK i;  3JCM P;  2VXF A;  4O2D A;  2QTX A;  4YRM A;  3V7S A;  4CH5 A;  2RD1 A;  4XTZ A;  2DZC A;  1WU7 A;  3JB9 F;  5LJ3 e;  4PJO A;  3SWN C;  2CIM A;  3RAC A;  1ASZ A;  3UH0 A;  3HXW A;  1WQ7 A;  4LNS A;  1C0A A;  4C92 E;  4RMF A;  1ADY A;  2QHT A;  4M77 A;  2EJF A;  4C92 B;  3ICA A;  4L87 A;  3A31 A;  4C8Q F;  1EQR A;  2ZT5 A;  2ZGW A;  5LJ3 h;  4M78 B;  4XEO A;  2AKW B;  1B76 A;  4K86 A;  1H64 1;  5GAO p;  5F5W A;  3I7F A;  3PCO B;  3A5Z A;  3RL6 A;  4XQ3 A;  2EJ9 A;  4C8Q D;  1I81 A;  4MML A;  3JCM g;  1JRI A;  5LJ5 d;  2Q7G A;  1LNX A;  1HC7 A;  4M78 G;  2ZZG A;  2RHS A;  1ASY A;  1X54 A;  2Q7E A;  4C8Q A;  1E1O A;  2E41 A;  4HT8 A;  4M75 F;  4RCC A;  3LSQ A;  2DXT A;  5GAM d;  4CH4 A;  2Y90 A;  4PJO E;  3HXV A;  4P73 A;  1BIA A;  4QVD A;  11AS A;  3HRI A;  4F7U B;  1SES A;  2RHQ A;  5LJ3 g;  1BBU A;  3A5Y A;  2DJZ A;  4P71 C;  4M77 F;  2FYK A;  3IKL A;  1NJ2 A;  1L0W A;  3QO7 A;  5K1P A;  4XTX A;  4JRK A;  1G5I A;  4C92 G;  3TEG A;  3BY7 A;  4A53 A;  3G1Z A;  1Y96 B;  4HA8 A;  4PJO F;  2ZNI A;  3JB9 G;  4YRE A;  1JJC A;  4CS2 A;  2RA2 A;  1NYR A;  5KNN A;  4H2X B;  1NJ5 A;  4EX5 A;  4NOY A;  2ZT7 A;  5LJ5 g;  4YRN A;  1FYF A;  4XU1 A;  4K88 A;  4RDX A;  4YRK A;  4M78 D;  5GAO q;  2ZZF A;  4P3N A;  2PME A;  4JLI A;  2ZR2 A;  2RB6 A;  5GAM g;  5GAN f;  4C8Q G;  1WLE A;  4HWP A;  1H4S A;  4YDQ A;  1YFR A;  3JB9 J;  1KMN A;  5GAN 7;  1NYQ A;  2I4L A;  3OD1 A;  2DZ9 A;  3P8T A;  1D3B A;  4X9D A;  3BW1 A;  3L4G A;  3VQX A;  4YRR A;  1J5W A;  1EIY B;  4XU0 A;  5C51 B;  3PGG A;  1JBM A;  4J6Y A;  1B70 A;  2RM4 A;  4M7D E;  3QO3 A;  3V8K A;  2DQ0 A;  1TH7 A;  1KOG A;  1M8V A;  4PHC A;  2DEQ A;  3UGT A;  2ZXF A;  1USY C;  2ALY B;  3A32 A;  4NL2 A;  3JCM Q;  3MEY A;  3QUI A;  4YCV A;  3RES A;  1WPY A;  2AMC B;  3HFZ B;  1QE0 A;  4EMH A;  1NJ1 A;  2ZTG A;  3LSS A;  4WI1 A;  1YB3 A;  2ZR3 A;  1USY A;  3DSQ A;  4Q6G A;  3SWN A;  2ART A;  3L1A A;  3A7U A;  4PJO G;  3RKW A;  3RF1 A;  1WNL A;  2DVE A;  3L2Z A;  4M78 F;  3ERR A;  4C8Q E;  4H02 A;  4YRT A;  1HXD A;  4C8Q B;  1I8F A;  5GAM e;  4YRQ A;  2XTI A;  5GMK j;  5LJ5 h;  4P3P A;  1NJ8 A;  4A54 A;  4M7D F;  4P75 C;  4YP0 A;  12AS A;  1B70 B;  4NCX A;  4M7D D;  1ATI A;  4QVC A;  1GGM A;  4M75 A;  2ODR C;  2Q5I A;  3QNE A;  2I2L A;  1X2G A;  3RIR A;  4Q15 A;  5HGQ A;  4H2X A;  5GAN 2;  2YLB A;  4YRC A;  2FB7 A;  4NL3 A;  2J3L A;  2QHV A;  4J15 A;  4P75 A;  4YPF A;  4YRJ A;  2ZCE A;  3P8V A;  5GAO r;  3HTZ A;  4XTW A;  3QO5 A;  2DTI A;  2E1H A;  3JCM b;  3EFS A;  4WF2 A;  3M4G A;  4HWT A;  5GAO m;  2ZZE A;  5GAN 4;  3BFM A;  1KQ2 A;  4M7A F;  4P74 A;  4TVW A;  3VQV A;  2PMF A;  1NNH A;  5GAM f;  3EFR A;  4WJ3 M;  4M75 D;  3RER A;  4PJO B;  3FB9 A;  2JN0 A;  3UFG A;  3A74 A;  2P5I A;  4YCU A;  1SRY A;  4OLF A;  2C7I A;  4TQF A;  5GAN h;  1BBW A;  4TVY A;  1I5L A;  1X01 A;  4YRP A;  5I21 A;  4P3O A;  2ODR D;  2P0L A;  3UGQ A;  4UP8 A;  3HFN A;  4M7A B;  4H2T A;  4E51 A;  4M78 A;  1N9S A;  3M4P A;  3JCM J;  4XTU A;  1B34 B;  3RKY A;  4ZTU B;  1PYS A;  4JUV A;  3IAL A;  1G51 A;  3HXU A;  1SER A;  4H2U A;  4XTY A;  3JB9 I;  3IKM B;  4F7U A;  2ARS A;  3E9H A;  4EMG A;  5GAN 5;  4K87 A;  4P72 C;  1NJ6 A;  5GMK e;  5GAM h;  2CJ9 A;  3MF2 A;  1LOJ A;  4ZIB A;  2YHT A;  3REU A;  1KMM A;  3JCM X;  5GAO n;  2RHQ B;  1H4Q A;  3HY1 A;  4JRI A;  1EVL A;  2ARU A;  4C92 F;  4F7U F;  2HNI A;  2AMC A;  1ADJ A;  1YGB A;  3JCM d;  3PCO A;  3TEH B;  3NEM A;  1W66 A;  4N0A A;  3HSB A;  2C8M A;  4YRS A;  3HFV A;  2AKW A;  5LJ3 f;  4M7D A;  3R07 A;  1X2H A;  2E65 A;  5LJ3 j;  2DDZ A;  3IG2 A;  1YFT A;  1U1T A;  4PNO A;  5GAM j;  4PJO D;  5GAO l;  4TTV A;  3LC0 A;  3GIB A;  4YRO A;  4HWR A;  4TWA A;  4RQE A;  3E9I A;  3KFU A;  3W3S A;  4HWO A;  4CH6 A;  3HFZ A;  5GAN d;  2E64 A;  1YFS A;  3WQZ A;  5LJ5 j;  5LJ3 d;  1E24 A;  1LJO A;  4M77 D;  3QO8 A;  1JJC B;  1Z7N A;  3A7A A;  2CGH A;  3P8Y A;  4M77 C;  4V2S A;  4DPG A;  1WQW A;  5K1X A;  1LYL A;  4H2W A;  4M77 B;  4C92 A;  4M75 G;  4M7A D;  4YRL A;  5GMK m;  1X56 A;  5GAN 3;  4M7A G;  4UPA A;  3FIF A;  4AH6 A;  4UP7 A;  3INZ A;  4G85 A;  2VXE A;  4YRG A;  4X9C A;  5C52 B;  4KR3 A;  4RQF A;  2ALY A;  4KQE A;  4XU2 A;  4M77 G;  2I4M A;  5GAN j;  4M78 E;  2E5A A;  5CAI A;  4C8Q C;  1E1T A;  5GMK h;  1B7Y A;  4P74 C;  1EVK A;  2I4N A;  1SET A;  1PYS B;  1B8A A;  1X55 A;  3TUP A;  1BIB A;  4CS4 A;  1D3B B;  2ZIO A;  3HXX A;  1IL2 A;  3HXY A;  4M7A A;  2DTH A;  4PG3 A;  4TVA B;  2EL9 A;  3JCM c;  3VBB A;  4H2Y A;  5GAN 6;  1B7Y B;  4KR2 A;  2VC8 A;  4EO4 A;  3SWN B;  4M7A C;  4BWA A;  3V8L A;  2IY5 B;  3JCM V;  3QHS A;  3RKX A;  4HWS A;  4M7D B;  2ZIN A;  4M77 E;  4MMK A;  4XTV A;  4Y91 A;  1Y96 A;  2DTO A;  3JCM h;  4CS3 A;  3V7R A;  2DKG A;  4EMK B;  4RCB A;  3HFO A;  4UP9 A;  3MF1 A;  1MGQ A;  4CH3 A;  1H4V B;  4J6X A;  4ZTZ B;  4G84 A;  4YRF A;  3JB9 H;  4HT9 A;  4P73 C;  2G4C A;  3BJU A;  2Q7H A;  4M75 E;  3FJP A;  4YCW A;  1U1S A;  2ZT8 A;  4M78 C;  4H2S A;  4X5O A;  3QTC A;  3V8J A;  3HY0 A;  3AHU A;  4EMK A;  5LJ5 e;  4P71 A;  5DY9 A;  1WYD A;  2QHU A;  3SB2 A;  3VQY A;  3TEH A;  2RHS B;  3VU3 C;  1VQZ A;  3HRK A;  3RGL A;  4F7U E;  2DXU A;  2IY5 A;  3A7R A;  4EMK C;  1RIQ A;  2ZT6 A;  3RUX A;  4WJ4 A;  2DU7 A;  4P72 A;  4J6W A;  4M7D C;  1QF6 A;  3L4G B;  1G5H A;  2XGT A;  4XEM A;  5E3I A;  2EAY A;  3JCM f;  1EFW A;  3REX A;  5LJ5 f;  2ZIM A;  4XU3 A;  2E3C A;  2DU5 A;  1H4T A;  2EWN A;  1YCY A;  3CMQ A;  4M7A E;  4BW9 A;  4YRI A;  1I4K 1;  5GAN g;  3JB9 D;  5ELN A;  1HK9 A;  1N9R A;  1N9W A;  4C92 D; 
#chains in the Genus database with same CATH topology
 2BKD N;  1VQ7 A;  4Z88 A;  3TVT A;  1S72 Q;  1AT1 B;  3NHN A;  1D1B A;  3TSZ A;  3M4Q A;  1PCX A;  5I2M A;  4DQ2 A;  5GAN e;  2PU9 B;  3FJ5 A;  1JXM A;  2H3E B;  4M75 C;  2GQV A;  3VS4 A;  2EFI A;  4A4H A;  1KJW A;  4JLG A;  3EFO B;  4F7U G;  1R0B G;  2A3L A;  4CI0 C;  5C53 B;  2EJG A;  4RTW A;  5GAN 8;  3G71 A;  5CKB A;  2CUD A;  3CCQ A;  1FMV A;  3JCM e;  2ZNJ A;  1ZBJ A;  4XK8 E;  5ELO A;  2P0K A;  4HVC A;  1YWP A;  4GBQ A;  1KQ1 A;  3J81 E;  4QQ6 A;  1Y57 A;  2R58 A;  2GQI A;  3CC2 T;  3SFM A;  3QZ9 B;  2L3Q A;  2B86 A;  3FLG A;  1RLP C;  5LJ3 e;  2CP5 A;  2OAU A;  3SWN C;  2KQW A;  3UH0 A;  3JSC A;  3MEV A;  4LNS A;  3C94 A;  3L2U A;  2XG8 D;  1ADY A;  1K4U S;  2QHT A;  1K1Z A;  2RF0 A;  3ICA A;  2K7A A;  1N6A A;  2DRM A;  4WCI A;  4KUD K;  4K86 A;  1P92 A;  3A5Z A;  1ZQ1 A;  2Y4X A;  3M56 A;  1JRI A;  1MMA A;  1OQK A;  2YUN A;  5KYX A;  4JDS A;  1ZUU A;  2A08 A;  1QP3 A;  1ASY A;  4RKU E;  3NFC A;  4C8Q A;  2E41 A;  5FU6 C;  4J83 A;  2QG9 B;  4PJM A;  1VQ6 T;  4CH4 A;  4PFZ A;  4PJO E;  4P73 A;  1BIA A;  1YJW A;  2CZ1 B;  2RNA A;  4FYV B;  3HRI A;  3MP6 A;  5J3B A;  2VKN A;  4PJL A;  5DM7 R;  2RHQ A;  4LDW A;  3M58 A;  2DJZ A;  4M77 F;  4X34 A;  1T3S A;  4E47 A;  2QGG A;  4C92 G;  2E4H A;  4PFO A;  2NUZ A;  5HKC A;  4YRE A;  1JJC A;  1MV3 A;  5HCK A;  2RA2 A;  4KGZ B;  1ZLM A;  5FWB A;  3OYL A;  4LD6 A;  3OBY A;  3TU4 K;  2RPN A;  4NOY A;  4FCY A;  4XU1 A;  4K88 A;  2J6K A;  2CSQ A;  4J9B A;  2FRY A;  4QQG A;  1ZUY A;  3GBQ A;  1IGQ A;  1RAD B;  2RQT A;  3OS2 A;  3VQX A;  2L3S A;  3DKM A;  2FVU A;  3VRZ A;  1QWF A;  4QQD A;  4ELZ C;  5KE3 A;  1EIY B;  4D8K A;  3L2W A;  4M7D E;  2JS2 A;  3H0H A;  2X4J A;  4BY6 C;  1M8V A;  2DEQ A;  4IUT A;  1VIE A;  3UGT A;  3J80 E;  2ALY B;  4KH1 B;  2GNC A;  2JM8 A;  2FEI A;  3GF5 A;  1NPP A;  3LGF A;  4E7I A;  3HFZ B;  3L42 A;  1QE0 A;  2KRN A;  1AOJ A;  4OVA A;  2ZR3 A;  1USY A;  1HJD A;  3M53 A;  5IXF A;  1YJW T;  1YHQ T;  3L1A A;  2J06 A;  5FU7 B;  5IHN A;  3LX7 A;  1SHG A;  4PJO G;  3ER0 A;  2YRC A;  1UDL A;  3L2Z A;  2ED0 A;  4M78 F;  3L2R A;  2R5M A;  4HCC A;  2RQW A;  1YN8 A;  2LC4 A;  5C0M A;  4YRQ A;  3CPW A;  2C0O A;  1VQP T;  1X75 C;  5LJ5 h;  2KRS A;  2ZPH B;  4YP0 A;  1JJ2 S;  4M7D F;  4P75 C;  12AS A;  1B70 B;  1YFN A;  1QKX A;  2M1H A;  1ATI A;  2Q5I A;  3CCU Q;  2I2L A;  2DE0 X;  2KGT A;  4ZTF A;  2FB7 A;  4P75 A;  4YRJ A;  2ZCE A;  1LVK A;  1UTI A;  3H9N A;  3P8V A;  3VUB A;  2IVW A;  4EIK A;  4X1V A;  2DLP A;  3HTZ A;  2DTI A;  3JCM b;  4FYX B;  2DYI A;  2V1Q A;  2E6Z A;  3R6O A;  4J9F A;  4DA4 A;  2M0O A;  1Q81 U;  2YSQ A;  8AT1 B;  4LN2 A;  3OBW A;  2VB6 A;  1VQ8 A;  2KVQ G;  2RHX A;  3VS0 A;  2AIR B;  1YIT T;  3EFR A;  4M75 D;  4IUU A;  1Q81 C;  3A74 A;  3A8H B;  1VQL A;  2DMO A;  2MIO A;  1RAA B;  5GAN h;  1D0Z A;  1X01 A;  1WXB A;  4R55 A;  4ORZ A;  2K2V A;  2JT4 A;  2RJD A;  1AWJ A;  4P3O A;  4RTT A;  2CS7 A;  2P0L A;  5J26 A;  4WTO B;  4UP8 A;  4M7A B;  3ZFJ A;  4H2T A;  3WVD B;  4RG2 A;  1OEB A;  1XQH A;  4M78 A;  3M4P A;  3JCM J;  3OYA A;  4RMO A;  1B34 B;  4R56 A;  4HCZ A;  1VQL Q;  3IAL A;  4H2U A;  3JB9 I;  2VGM A;  3GPL A;  1Y7X A;  2H8H A;  1PD1 A;  2ARS A;  5GAN 5;  4P72 C;  1YNZ A;  4CRI A;  5KYY A;  2BZX A;  2F2X A;  2KE9 A;  5HK3 A;  1U06 A;  1E6H A;  1LOJ A;  1PHT A;  1QMC A;  4ZIB A;  2GGR A;  3REU A;  1SKU B;  2RHQ B;  4CC4 B;  3G4S A;  1EVL A;  3RR6 A;  4F7U F;  2E5Q A;  2HNI A;  3O8V A;  1VQ5 Q;  2AMC A;  2V8J A;  1K0S A;  2ECZ A;  1W66 A;  2JMC A;  4J7I A;  4YRS A;  1VUB A;  2BIV A;  1X2H A;  2E65 A;  2JS0 A;  4LDY A;  3NGP A;  4KT0 E;  5GAM j;  1I1J A;  3OYI A;  3LC0 A;  5GJV B;  3HHT B;  3KFU A;  3W3S A;  1H8K A;  2XDB A;  1GBR A;  5GAN d;  1YJW Q;  1NPR A;  2M0Y A;  3EHR A;  3I56 T;  4A4G A;  2XDD A;  2D0N A;  2L89 A;  2FG0 A;  3M55 A;  3NTK A;  4M77 D;  4HCB A;  1JJC B;  2CGH A;  4PK4 A;  2P0P A;  4QW2 A;  2EW3 A;  2ZCF B;  1WQW A;  4M77 B;  1GXI E;  2HKQ B;  1OI1 A;  2Y4Y A;  4FSS A;  4P5N A;  3G7Z A;  2XD0 A;  5GMK m;  2JXB A;  3H41 A;  3CC7 Q;  2DX1 A;  3CCQ Q;  2RH2 A;  1W70 A;  4G85 A;  4YRG A;  2LVM A;  1BI3 A;  2ALY A;  1H3Z A;  4KQE A;  4XU2 A;  2JVV A;  4M77 G;  2L0A A;  3CPW S;  5GAN j;  4M78 E;  2ENM A;  1YI2 A;  1E1T A;  4OB0 B;  5IAY A;  1Z9Z A;  2E5K A;  4P74 C;  1XNI A;  1D3B B;  1IL2 A;  4YTL A;  4M7A A;  1KD1 C;  4ANJ A;  2LCS A;  2RI2 A;  3JCM c;  3OYE A;  1WHK A;  4H2Y A;  4A4F A;  1NEB A;  1WX6 A;  5GAN 6;  2K3B A;  3CMA A;  1B7Y B;  2LRQ A;  3CC7 A;  4EO4 A;  3SWN B;  4OML A;  4BWA A;  4M7D B;  4BY6 B;  4Q5W A;  2ZIN A;  4Y91 A;  1NJI U;  2RN8 A;  1QVF S;  2RK2 A;  2HEQ A;  5A0L A;  4CH3 A;  4E7Z A;  4J6X A;  1H4V B;  4G84 A;  3JB9 H;  3BJU A;  2Q7H A;  2F5K A;  4YCW A;  1U1S A;  2KT1 A;  2R5A A;  2BUD A;  3EGX B;  3OYY A;  4X5O A;  3QTC A;  1SSF A;  5A0G A;  1WHG A;  1K8A U;  4J9G A;  2LCL A;  1KQS A;  1UJY A;  3CCM A;  2F1L A;  2XID A;  2JTF A;  3MPU B;  4PKC C;  1VQZ A;  2E12 A;  2KMT A;  2DPP B;  1NLO C;  2ATC B;  3OYM A;  1RIQ A;  3CCE Q;  3RUX A;  4B9X A;  5I22 A;  2MF2 A;  1KD1 R;  1QF6 A;  1QCF A;  1UJ0 A;  2XGT A;  1RAH B;  4E7H A;  2CUB A;  2ED1 A;  1EFW A;  1YBY A;  5LJ5 f;  2DBM A;  2DU5 A;  3CMQ A;  3OYB A;  1D0X A;  4LVM A;  3LH0 A;  2GFA A;  2IG0 A;  1QP2 A;  4L87 A;  1N9W A;  1QVG A;  4AG2 C;  2QEX T;  2ZPI B;  3HL8 A;  2CJA A;  4DBF A;  1M3A A;  2KRO A;  4C92 C;  3KFV A;  1KQS S;  1EX4 A;  3CXC P;  1Y0M A;  5M9O A;  2CJB A;  2LJ0 A;  1H3H A;  1FX7 A;  1M5Q 1;  2KNB B;  2RK1 A;  6AT1 B;  2F2W A;  1VQ6 A;  2X4Y A;  4TVA A;  1SSH A;  5L23 A;  2GTJ A;  2J3M A;  3VQW A;  1E22 A;  2K3X A;  3UDC A;  2DQ3 A;  2D1X A;  3N5B B;  2A28 A;  1UUE A;  4ZN3 A;  3C95 A;  1VQ8 Q;  3CCV A;  1PRL C;  3V7C A;  3BDU A;  1HTT A;  4N4G A;  4J5Y A;  1UHF A;  2QK0 A;  2V8K A;  1QVF P;  2VWF A;  4O2D A;  2QTX A;  2C06 A;  4YRM A;  3GLX A;  7AT1 B;  2HCK A;  1YIT Q;  2CIM A;  3OYH A;  3HXW A;  1WHM A;  1WQ7 A;  2MK5 A;  2D8J A;  5D6W A;  4C92 E;  1C0A A;  1BYM A;  3OS1 A;  3UA7 A;  4M77 A;  2EJF A;  5IXB A;  5KYU A;  1B7T A;  1O9S A;  3A31 A;  1EQR A;  2NYS A;  4NS5 A;  2ZGW A;  4XEO A;  3A1P A;  4C5E A;  2AKW B;  4JPB W;  1BI0 A;  2NWM A;  2PVG B;  1B76 A;  4E7J A;  1BI2 A;  1H64 1;  5F5W A;  3E9G A;  3PT9 A;  3I7F A;  3PCO B;  1RI9 A;  2EJ9 A;  1VQM Q;  4IIO A;  5LJ5 d;  2E6N A;  3C12 A;  3CCL A;  2LQ8 A;  2LT4 A;  4FM4 B;  4BB7 A;  2RHS A;  2DL4 A;  1X54 A;  2JW4 A;  1E1O A;  1VQL T;  1R0C B;  2XMF A;  1WXU A;  4C5H A;  1J3T A;  2DXT A;  5DLO A;  2Y90 A;  1X27 A;  4QVD A;  3CME Q;  3EGX A;  2DO3 A;  2YWW A;  4F7U B;  1SES A;  2NLU A;  3QYH B;  2EVR A;  4E7L A;  2ZPE B;  1NJ2 A;  1UGS B;  1QQJ A;  1L0W A;  3FEO A;  3QO7 A;  3TEG A;  2QA4 Q;  4RG8 A;  1IXD A;  2KYB A;  2RJE A;  4FIB A;  1VA7 A;  5LL6 S;  3ZBD A;  4PJO F;  4HA8 A;  1M9S A;  4CS2 A;  1NYR A;  2J6O A;  2RMO A;  5KNN A;  2LNV A;  1KHC A;  3QII A;  1NJ5 A;  5LJ5 g;  4PFP A;  3LH5 A;  1FYF A;  4JZ3 A;  1GL5 A;  1M30 A;  2ZZF A;  4JLI A;  2FL7 A;  3HPW A;  1MNE A;  3CCR A;  5GAM g;  3VS7 A;  3EG3 A;  2D6F A;  3CXC S;  1WIE A;  2DZ9 A;  4X9D A;  3G6E A;  2LCC A;  2QAS A;  1YIJ T;  3EFO A;  5C51 B;  3PGG A;  2LTO A;  1ZA2 B;  4BI8 B;  4OMN A;  1TH7 A;  3CCV Q;  1D09 B;  2ZXF A;  1USY C;  3UF4 A;  3MEY A;  3QUI A;  1K9M U;  3RES A;  2MI6 A;  1WPY A;  2AMC B;  4WI1 A;  2YDL A;  1D0Y A;  1YB3 A;  3M54 A;  1ZUK A;  3DSQ A;  1Y71 A;  3MO8 A;  4A4E A;  4PJN A;  4F04 B;  1JXO A;  1KQS P;  2FO0 A;  1G2B A;  1TU0 B;  3LLR A;  1MMG A;  3RF1 A;  1U3O A;  1WNL A;  1EIF A;  2DVE A;  2DL7 A;  4FL6 A;  3ERR A;  1NZ9 A;  1VQ5 T;  1OYX A;  1QLY A;  1X6B A;  1I8F A;  5GAM e;  1Q7Y C;  3MP1 A;  3UPU A;  3QYG B;  3CCL Q;  4J9I A;  1WHH A;  5KYW A;  1OU9 A;  1U8R A;  2RHI A;  1WJS A;  3CQT A;  2PVD B;  3QNE A;  4LXC A;  3RIR A;  3SEM A;  1S72 A;  5HGQ A;  1WYX A;  2EPD A;  3P8H A;  2HBP A;  2L2P A;  1VYU A;  4RTY A;  2QYZ A;  2VUB A;  5EC7 A;  5D6Y A;  4F17 A;  2V8I A;  4LDX A;  3GNF B;  5AT1 B;  3HRU A;  3LGL A;  3QO5 A;  4C0D C;  4WF2 A;  2LJ3 A;  1UFF A;  1YHQ A;  1M90 C;  3BFM A;  2K5L A;  1RAF B;  4TVW A;  4P74 A;  2RO0 A;  5KE2 A;  3CBP A;  1VQ4 T;  1BBZ A;  2EYZ A;  4WJ3 M;  2L3P A;  1C1A A;  4PJO B;  1I07 A;  2HKN A;  3ME9 A;  4IUP A;  3G6E T;  2OI3 A;  2P5I A;  1SRY A;  1UEB A;  2B8A A;  4TQF A;  1BBW A;  4KUL A;  2HQH A;  2YT6 A;  1V1C A;  4KBM B;  3HFN A;  2CT4 A;  4L6V 5;  4RTZ A;  3RKY A;  1OX8 A;  3AT1 B;  1IRX A;  1SER A;  1VQ5 A;  1M8M A;  2JZ2 A;  3P8D A;  1NE8 A;  4GLM A;  1W2B A;  2DNU A;  1TOV A;  2KXD A;  2XK0 A;  3E9H A;  4JRP A;  2RI5 A;  4JJD A;  4LD9 K;  3LWH A;  2YXY A;  1H92 A;  2J05 A;  2QAZ A;  3CPW P;  1K73 U;  2FPF A;  4J9D A;  4BDY A;  3HY1 A;  2EQU A;  2SRC A;  5A2Q E;  2ARU A;  2DA9 A;  1W6X A;  1IO6 A;  3CC7 T;  4FYW B;  1BI1 A;  2JUF A;  1G3S A;  2OTJ A;  2LQW A;  3UT1 A;  1RL2 A;  3TCJ A;  2K5F A;  1YFT A;  3IG2 A;  1U1T A;  1TG0 A;  4PJO D;  2LQN A;  2WSE E;  1VQ7 Q;  4Y28 E;  3E9I A;  4KRT A;  4C5I A;  1TTH B;  4DBR A;  3CME A;  1YFS A;  3WQZ A;  1E24 A;  1N8R R;  3HRS A;  4IKF A;  3G71 Q;  4RTU A;  1Z7N A;  2DFU A;  3P8Y A;  4M77 C;  1HSQ A;  4DPG A;  3EG9 A;  1LYL A;  3I5R A;  4J9H A;  4HXJ A;  1M1K C;  3VUZ A;  3MCA B;  5GAN 3;  2COZ A;  3HP9 A;  1VQM A;  4M7A G;  3G4S T;  4C0D B;  1Q86 R;  1T0J A;  3GNG A;  4KR3 A;  3M0S A;  4RQF A;  4II1 A;  2L8D A;  2AZS A;  2YRV A;  2YRD A;  4RTX A;  2M51 A;  4C8Q C;  1NYG A;  2QDY B;  4OGE A;  3LW5 E;  1CKB A;  2JMA A;  2CH4 A;  3EAE A;  1PYS B;  3TUP A;  1X55 A;  2K79 A;  4CS4 A;  2EGC A;  2ZIO A;  2RJF A;  2JNG A;  3KUF A;  1OOT A;  1ZHI A;  1SRL A;  4PG3 A;  1MUZ A;  2O01 E;  4OMQ A;  1MND A;  2CP2 A;  5CKH A;  2EL9 A;  3VBB A;  4KR2 A;  2VC8 A;  1A0N B;  1TUD A;  4JZ4 A;  3QHS A;  2HSP A;  4OB1 B;  4M77 E;  1M2V A;  4XTV A;  1Y96 A;  2HQX A;  4HT4 A;  3VS5 A;  2DTO A;  4CS3 A;  5DLQ E;  2DKG A;  4EMK B;  3I9Q A;  3G1J A;  3MET A;  2HL5 C;  4UP9 A;  3A8O B;  1TUG B;  4ZTZ B;  3PMI A;  1QCO A;  2FZG B;  3OA6 A;  1PSE A;  4M78 C;  1GBQ A;  5CQY A;  4H2S A;  2NUP A;  1YJ9 Q;  3QBY A;  3HY0 A;  4D8D A;  5HK0 A;  4OMO A;  4LVK A;  3CEY A;  2DIQ A;  1G83 A;  4AFU C;  5CVI A;  2BE7 D;  4EMK C;  2RQR A;  2DF6 A;  3A7R A;  2IY5 A;  3CMA T;  2ZT6 A;  4TVR A;  2C0I A;  4A4K A;  2P84 A;  2VV5 A;  1JO8 A;  2FPE A;  4KGX B;  3HRT A;  2RI3 A;  1UGP B;  3T9N A;  2BE9 B;  1YJN A;  4XEM A;  5E3I A;  1K9A A;  3H0F A;  4JJN K;  3SDZ A;  1K73 R;  1QKW A;  4XU3 A;  2EQM A;  3OYF A;  2EWN A;  1YCY A;  1K73 C;  1NLP C;  2K2M A;  3FDR A;  5KCO A;  2F69 A;  3VS1 A;  1I4K 1;  1XOV A;  4DOV A;  5KYN A;  2LT1 A;  1HK9 A;  3CME T;  1N9R A;  2MOX A;  2P4T A;  1KD1 U;  4H2V A;  2YLC A;  1IHW A;  1VYV A;  3VKI A;  1VQ9 T;  1YWO A;  2I4O A;  3PZC A;  4M7D G;  4OP0 A;  1B34 A;  2HZY A;  3NET A;  1FWZ A;  9ATC B;  5EG2 A;  2Q5H A;  2EYQ A;  3EG1 A;  1VQ6 Q;  1QW1 A;  3VRY A;  2PQW A;  4YYE A;  3JRZ A;  4M75 B;  4Z8A A;  4N0A C;  5IH2 A;  3NEN A;  1M1K U;  4PJO C;  5GMK i;  3H6Z A;  2NS6 A;  2VXF A;  3C4S A;  3TEE A;  4CH5 A;  3EHQ A;  1R77 A;  2RD1 A;  3OY9 A;  3EGD B;  4XTZ A;  2DZC A;  1VQO A;  3JB9 F;  1WU7 A;  4BAC A;  4PJO A;  3CXC A;  3U23 A;  3RAC A;  1BU1 A;  2DER A;  3OB9 A;  4RMF A;  1MHN A;  2LMJ A;  2QDL A;  1UG1 A;  2QQR A;  3E1S A;  2AHJ B;  1PM3 A;  1X69 A;  4ATO A;  4HKE A;  1VQK T;  5LJ3 h;  4M78 B;  2X51 A;  4IUV A;  1LPL A;  4OF1 A;  3ZEH A;  3OS0 A;  1UEC A;  3SHW A;  3L2V A;  2VAS A;  1T0H A;  1GRI A;  2EIF A;  4C8Q D;  1I81 A;  4MML A;  1M3B A;  4MDX A;  2CRE A;  4M78 G;  2ZZG A;  5FRM A;  2Q7E A;  2HSE B;  1M27 C;  3VJP A;  1FMK A;  2K5I A;  1KFZ A;  4HT8 A;  4AFQ C;  2BZY A;  1D1C A;  3LSQ A;  2YUP A;  1LCK A;  2DIG A;  1UGV A;  2ROL A;  1QCN A;  3MEU A;  1M4Z A;  5LJ3 g;  4AMC A;  1PKT A;  4ZGE B;  4P71 C;  2VYT A;  2VVK A;  1YIJ Q;  3S3O A;  1KG1 A;  3IKL A;  2HQE A;  5K1P A;  2XIC A;  1E7O A;  5FU6 B;  1G5I A;  1IHV A;  3BY7 A;  2J7I A;  2O9V A;  5FW9 A;  1Y96 B;  2ZNI A;  3P8B B;  2H3J A;  1ZX6 A;  5I2S A;  2AK5 A;  1VIF A;  1JEG A;  3CCV T;  1VOM A;  4EX5 A;  2ZT7 A;  4YRN A;  4K11 A;  2RHU A;  4RDX A;  2Z0W A;  2XDP A;  1U5S A;  1CKA A;  1NJI R;  4P3N A;  1JU5 C;  2PME A;  2QEX A;  2ZR2 A;  5GAN f;  4C8Q G;  4HWP A;  4YDQ A;  1YFR A;  3OYD A;  3CCU T;  5GAN 7;  3CC4 Q;  2OAW A;  2IPO B;  2I4L A;  3OD1 A;  4L59 A;  3P8T A;  1RAG B;  3BW1 A;  3CCE T;  3L4G A;  4YRR A;  4AFS C;  1J5W A;  4XU0 A;  3RMS A;  1BK2 A;  3NMZ C;  1JBM A;  4FT4 A;  4MZP A;  3QO3 A;  4C0G A;  5KYW B;  1Q7Y R;  1VQ4 A;  2DQ0 A;  1KOG A;  1ZBX A;  4OB3 B;  2QQB A;  3EGU A;  3VYG A;  1YJN T;  3A32 A;  1Q95 G;  3PMT A;  4NL2 A;  3JCM Q;  2YUQ A;  3OYK A;  5IT9 E;  1MMN A;  3MJX A;  1NM7 A;  1SRM A;  1NJ1 A;  1PNJ A;  2O9S A;  3PIO A;  1YHQ Q;  1CSK A;  3SWN A;  5IHI A;  1G8X A;  3X26 B;  2FRW A;  4EPC A;  3QG1 A;  4E6R A;  1YCS B;  2YUO A;  1X2K A;  3RKW A;  1WFW A;  2C0T A;  4C8Q E;  1VQM T;  1HXD A;  2COY A;  3I56 Q;  1OV3 A;  3WXM B;  3RDV A;  2XTI A;  3M9Q A;  2MWO A;  2GTO A;  4P3P A;  4DEY A;  1NJ8 A;  4A54 A;  4NCX A;  4M7D D;  2QA4 A;  5FRO A;  4QVC A;  2ODR C;  5KYX B;  4PL6 A;  3ASK A;  1X2G A;  2JTM A;  1B3Q A;  4ZGD B;  4H2X A;  3QXE B;  5GAN 2;  3X25 B;  1N8R C;  4YRC A;  2J3L A;  4YPF A;  2QA4 T;  1S1N A;  5ECA A;  5HY6 A;  3CCM Q;  5CO7 A;  2QXF A;  1K8A C;  2AT1 B;  2OTL Q;  1ACM B;  2EBP A;  2QQA A;  3DLM A;  2KT8 A;  3EFS A;  4GY5 A;  4MZT A;  2PZ1 A;  5GAN 4;  3CCR T;  2GF7 A;  5KH6 A;  1G3T A;  1JJ2 P;  3EG0 A;  1KIK A;  2PMF A;  1AD5 A;  2JN0 A;  3KXT A;  1VQP A;  3CD6 A;  4OLF A;  2C7I A;  2DL8 A;  3PE0 A;  4TVY A;  1I5L A;  1BKB A;  4YRP A;  5I21 A;  1UHC A;  2ROT A;  3URG A;  2R57 A;  3TSW A;  2ODR D;  3NTH A;  1Q82 U;  2DK3 A;  4OMF B;  2LQK A;  1N9S A;  4ME7 A;  1X6G A;  2OTJ Q;  3S3M A;  4N4I A;  1RLQ C;  5CKE A;  4ZTU B;  1PYS A;  1HYO A;  1VQ4 Q;  4E2F B;  4JUV A;  2X4X A;  1MV0 B;  3LWI A;  4L5G A;  3OYC A;  3HXU A;  4XTY A;  2EQI A;  3IKM B;  1M1G A;  4F7U A;  1JB0 E;  2KRM A;  1WJR A;  4EMG A;  1OZ3 A;  4ZN1 A;  4HVV A;  1PD0 A;  4DBH A;  5GAM h;  1Q7Y U;  1RAI B;  3PVL A;  3QJY A;  2X35 A;  3M0U A;  3JCM X;  5GAO n;  1H4Q A;  4UC4 A;  4BE2 A;  3EG9 B;  2KAF A;  3OW2 P;  2LZ6 B;  1I0C A;  1SEM A;  3PCO A;  1IB8 A;  2BTT A;  3TEH B;  1ABO A;  5IN1 A;  4AT1 B;  2C8M A;  3OQ5 A;  3CCL T;  3HFV A;  2EQK A;  3R07 A;  3QWY A;  5FLX E;  2XHC A;  2D8H A;  5LJ3 j;  2DDZ A;  4FW1 A;  4ESR A;  1SG5 A;  4PNO A;  5GAO l;  4TTV A;  4YRO A;  4OMM A;  1PRM C;  4HWR A;  4TWA A;  3VS6 A;  2A0F B;  3CC2 A;  1IGU A;  4CH6 A;  3HFZ A;  2ZPF B;  2NUT B;  3A8L B;  3CCJ T;  1VQN Q;  1LJO A;  3QO8 A;  3OSS C;  4ZGJ B;  3CCE A;  2NUP B;  2JOY A;  3I55 A;  1PWT A;  3MKD A;  2G6F X;  2CP3 A;  4LNP A;  1V29 B;  5K1X A;  4H2W A;  2W10 A;  4C92 A;  2EKH A;  4LUE A;  1BCO A;  3EG2 A;  3FIF A;  4B9W A;  1SPK A;  4UP7 A;  1AWW A;  2VXE A;  1V76 A;  5C52 B;  3MHX A;  3EH1 A;  2I4M A;  3MEW A;  4CC2 A;  2E5A A;  1B7Y A;  2A8E A;  4PLL A;  1EVK A;  2I4N A;  2FZK B;  1SET A;  3PFS A;  1B8A A;  3PTA A;  1NG2 A;  1BIB A;  2ZPB B;  2I0N A;  1W2B P;  3HXY A;  2JJ9 A;  1AHJ B;  3DLL A;  1UE9 A;  2DTH A;  3G4S Q;  3MP8 A;  1YJ9 T;  4CC3 A;  1DJ7 B;  2DJQ A;  2CZ0 B;  4Z02 A;  1ARK A;  1UGQ B;  2XKO C;  2DD5 A;  5FU7 C;  2GBQ A;  3OYN A;  2IY5 B;  3JCM V;  3RKX A;  2HDA A;  4HWS A;  2LDM A;  5L8R E;  1B07 A;  1I5O B;  3CCJ Q;  3JCM h;  4DOW A;  1FMW A;  1VQN T;  3V7R A;  1Q81 R;  1XTD A;  2KR3 A;  4RCB A;  2CP7 A;  4IUQ A;  2DM1 A;  3HFO A;  1Z9Q A;  2OTJ T;  1MGQ A;  4JJB A;  2P0Q A;  1UGR B;  2G3R A;  2KXC A;  4HT9 A;  4P73 C;  4YRF A;  3VS2 A;  4M75 E;  3PVQ A;  3E19 A;  3I55 T;  1WLP B;  4MDW A;  4BI3 A;  2CSI A;  1VQ7 T;  4EMK A;  5LJ5 e;  3AHU A;  2A7Y A;  1FXX A;  1E6G A;  3CCJ A;  3IQL A;  3VQY A;  3G6E Q;  2HD0 A;  3TEH A;  1WA7 A;  1PC0 A;  4BI4 A;  2CKK A;  3VU3 C;  2HAX A;  2M02 A;  4FT2 A;  1AEY A;  4F16 A;  2L3R A;  2CZ6 B;  3QZ5 B;  4P72 A;  2DRK A;  4M7D C;  3HTR A;  3L4G B;  1YP5 A;  1G5H A;  4CC7 A;  2MMP A;  2EAY A;  3JCM f;  4BUG A;  3PNW C;  1XJW B;  4QVZ A;  5CKF A;  1H4T A;  4YRI A;  1ZSG A;  1EFN A;  5GAN g;  2DL3 A;  4BD3 A;  1AWX A;  1NBE B;  3CC2 Q;  1VQO Q;  1K0X A;  5GMK l;  2X4W A;  3HXZ A;  3RMQ A;  4LDV A;  3JCM W;  1NYF A;  3I35 A;  1RI0 A;  1C6V X;  2K6D A;  4Z89 A;  1BB9 A;  2E10 A;  3H8Z A;  3OYJ A;  2NUT A;  1Z7M A;  2KY9 A;  2AKK A;  3FRN A;  3CCQ T;  2EKO A;  1EIY A;  1EOV A;  2FHD A;  3CD6 Q;  3I55 Q;  4LE9 A;  3QSU A;  3A8G B;  1GFC A;  2ABL A;  4J9E A;  3VV0 A;  2K57 A;  1VQK Q;  2QHS A;  4TQD A;  3M5A A;  1M90 U;  3NTI A;  3NEL A;  2OX7 A;  2OTL T;  3RBB B;  2K4Y A;  3JCM P;  2E70 A;  3M0T A;  5KYU B;  3S6W A;  3V7S A;  1W4S A;  5GJW B;  1WGS A;  1AVZ C;  1ZSZ B;  3D7S B;  2XU8 A;  2A36 A;  4BE0 A;  1ASZ A;  3REA B;  3CCR Q;  2O4X A;  3QWX X;  1PKS A;  1VQ9 A;  3X20 B;  4C92 B;  2DBK A;  3C0C A;  5CK9 A;  4C8Q F;  2ZT5 A;  5FWC A;  1OX9 A;  2RHY A;  5GAO p;  2QQ9 A;  3E9F A;  3RL6 A;  1YI2 Q;  4XQ3 A;  3JCM g;  2P4R A;  2Q7G A;  1LNX A;  1HC7 A;  2AZV A;  5CIU A;  2ZZD A;  2FPD A;  4C0Z A;  3M57 A;  1R8O B;  2KI7 A;  4M75 F;  4RCC A;  5KYY B;  1X6O A;  5GAM d;  1MMD A;  3HXV A;  4OMP A;  11AS A;  2DXC A;  3Q1J A;  1YIJ A;  5D7U A;  2EGE A;  3I56 A;  4J8O A;  1WJQ A;  1N27 A;  1BBU A;  3A5Y A;  2V1R A;  4OB2 B;  2FYK A;  2FZC B;  2M9U A;  3CCM T;  4XTX A;  4JRK A;  2RQV A;  2AKL A;  1TXQ A;  2LP5 A;  1M1F A;  4BE1 A;  1TWB A;  4A53 A;  3G1Z A;  1M2V B;  3E2U A;  3JB9 G;  1WDX A;  4LUD A;  1PG5 B;  4H2X B;  2HMA A;  3J7A F;  3EGD A;  2OTL A;  4YRK A;  4M78 D;  5GAO q;  2ESW A;  2RB6 A;  3QKJ A;  2DXB A;  1WLE A;  1H4S A;  3CCS T;  3MEA A;  3JB9 J;  1KMN A;  1NYQ A;  1YIT A;  1D3B A;  4J7F A;  5C6S A;  4C5G A;  1QVG P;  2WAC A;  2PUO B;  4B6M A;  4J6Y A;  1B70 A;  4VUB A;  5A0D A;  2RM4 A;  3V8K A;  4AG1 C;  3UWN A;  3WVE B;  4PHC A;  1RUW A;  4RUG A;  1EZZ B;  1VQP Q;  3QDF A;  3CD6 T;  4EDU A;  3DB3 A;  1OZ2 A;  3UA6 A;  4YCV A;  2KEA A;  2IIM A;  4A63 B;  4BDZ A;  3M4Y A;  4EMH A;  1GFD A;  3X24 B;  2ZTG A;  3LSS A;  3MQZ A;  3CC4 A;  4Q6G A;  1FYN A;  4QT7 A;  2EGA A;  3O5Z A;  2MYS A;  4FW2 A;  2ART A;  4R0K A;  2X3X D;  3A7U A;  3I5S A;  3CC4 T;  4HVW A;  4HCK A;  4LVI A;  1VQ9 Q;  2ZPG B;  2QQS A;  1K9M R;  3RNJ A;  1M90 R;  4H02 A;  4YRT A;  1AZE A;  4C8Q B;  1Q82 R;  5GMK j;  2X9H A;  2QTV A;  4AFZ C;  2J6F A;  3R6N A;  4KGV B;  2CP6 A;  4O5V A;  1M1K R;  2XI9 A;  1GGM A;  4M75 A;  3A5Z B;  1WXT A;  4MZM A;  4Q15 A;  1KK7 A;  2E3I A;  2YLB A;  2O88 A;  2QHV A;  4GLK A;  4E7S A;  4NL3 A;  4J15 A;  1G5V A;  2LX9 A;  1AZG B;  1M2O A;  5D6X A;  4JJC A;  5GAO r;  3THK A;  3CPF A;  2KK4 A;  4XTW A;  4JS5 A;  3TQ7 P;  2E1H A;  3LYI A;  4ELY C;  1KC8 C;  2QGF B;  1YJ9 A;  3M4G A;  2EYX A;  3A8M B;  4HWT A;  5GAO m;  4M4Z A;  2ZZE A;  3OMG A;  3ULR B;  3GOX A;  1KQ2 A;  4N4H A;  4M7A F;  3VQV A;  1NNH A;  2RQU A;  3KBG A;  5GAM f;  2COW A;  3RER A;  3FB9 A;  2DAQ A;  3UFG A;  1BCM A;  4YCU A;  1VQN A;  1G3Y A;  3UAT A;  3REB B;  1ZA1 B;  1OU8 A;  1O75 A;  1WHL A;  1QWE A;  2DIL A;  2CZ7 B;  3UGQ A;  1VQK A;  1AWO A;  1S72 T;  4E51 A;  4FYY B;  4XTU A;  1RAB B;  3JV3 A;  2EYW A;  1D1A A;  3CBO A;  3VYH B;  1SF9 A;  2DVJ A;  1PSF A;  4JS4 A;  2EYY A;  1G51 A;  2W0Z A;  4PJJ A;  4Y92 A;  2GFU A;  1ZSZ C;  1WHJ A;  4JRQ A;  1W2B S;  1WZO A;  1NEG A;  2MWP A;  1OPK A;  2LJ1 A;  1QVF A;  4K87 A;  1NJ6 A;  2D0Q B;  4F14 A;  2M16 A;  5GMK e;  4DEX A;  1QVG S;  2CJ9 A;  2DD4 A;  1ZSZ A;  3MF2 A;  4LDU A;  2CP0 A;  1N5Z A;  1VYT A;  2YHT A;  8ATC B;  1KMM A;  4ZNX A;  4JRI A;  4C92 F;  2CH4 W;  1OPL A;  2O2O A;  3ZL7 C;  4IUR A;  1ADJ A;  1YGB A;  3JCM d;  3JAM E;  1NJI C;  1N8R U;  1M3C A;  2RHZ A;  3NEM A;  3X28 B;  1K8A R;  3M0Q A;  3M59 A;  4N0A A;  3HSB A;  2HBW A;  2AKW A;  5LJ3 f;  4M7D A;  1IZ6 A;  5FRN A;  2X3W D;  3OW2 S;  3VS3 A;  3FC3 A;  1IRE B;  4J9C A;  3GIB A;  1TUC A;  4RQE A;  2KYM A;  4HWO A;  3CCS A;  2CDT A;  2E64 A;  1G3W A;  5AYF A;  5LJ5 j;  5LJ3 d;  2PUK B;  5CQX A;  3DB4 A;  3A7A A;  1JJ2 A;  4V2S A;  4DBQ A;  2JTE A;  2SEM A;  2QI2 A;  1T3L A;  2K3Y A;  3BDL A;  3OS5 A;  2DL5 A;  4XAX B;  4M75 G;  4D6W A;  4M7A D;  4HVU A;  1YJN Q;  4YRL A;  1X56 A;  3OW2 A;  3S3N A;  4UPA A;  4AH6 A;  4KUI A;  1ABQ A;  2CT3 A;  3INZ A;  1Q82 C;  4X9C A;  2A37 A;  2MAM A;  2O4X B;  2WSF E;  3CCS Q;  1X2Q A;  3OSV A;  2K9G A;  5I11 A;  2CYZ B;  4RTV A;  2EQJ A;  2BZ8 A;  5CAI A;  5J39 A;  1VQO T;  4FSX A;  1Y07 A;  5GMK h;  1RAE B;  3OMC A;  3CMA Q;  4FU6 A;  2DET A;  1K9M C;  2PVO B;  1JQQ A;  5IHK A;  3OYG A;  4C0F A;  2GCX A;  1Q86 U;  3HXX A;  1RAC B;  3QJ6 A;  2PTK A;  4TVA B;  3PIP A;  1TSF A;  1Q86 C;  4LVJ A;  3F70 A;  2KBT A;  3HKS A;  1VQ8 T;  2DYB A;  1KC8 U;  4M7A C;  3V8L A;  2V26 A;  2O31 A;  4O6J A;  1KSW A;  2WSC E;  2F2V A;  5CR2 A;  3G71 T;  2PNI A;  4MMK A;  3CBM A;  2E3H A;  5KCH A;  3A98 A;  2JM9 A;  2DEU A;  4LVL A;  4KH0 B;  4IIM A;  3MF1 A;  2VGN A;  1X43 A;  2G4C A;  3FJP A;  2LX7 A;  4PLI A;  4E7K A;  2ZT8 A;  3GP8 A;  1K76 A;  1WI7 A;  3V8J A;  1UB4 A;  4P71 A;  2ZAE A;  1KC8 R;  4OGC A;  5DY9 A;  3M0P A;  1WYD A;  2QHU A;  1KHI A;  3SB2 A;  3L2Q A;  1HD3 A;  2KDS A;  1OUL A;  2RHS B;  3QPH A;  3QDR B;  2F5T X;  3HRK A;  3RGL A;  4F7U E;  2DXU A;  5CKD A;  4WJ4 A;  2QEX Q;  2DU7 A;  2KSS A;  2RJC A;  4J6W A;  1YI2 T;  1C0M A;  1GCQ A;  4QKU A;  3TRE A;  2MPX C;  1W1F A;  2HL3 A;  3REX A;  2LNH B;  3SD4 A;  1SHF A;  2ZIM A;  3H0I A;  3EH2 A;  2E3C A;  2MCN A;  3CCU A;  3NPF A;  4ZTJ A;  4M7A E;  1TS9 A;  1QVP A;  4BW9 A;  2OJ2 A;  1GCP A;  3BE3 A;  2L5Q A;  5CCA A;  3JB9 D;  1GCQ C;  5ELN A;  3M0R A;  1F1B B;  4C92 D;  2D9T A; 
#chains in the Genus database with same CATH homology
 2BKD N;  1VQ7 A;  3M4Q A;  5I2M A;  4DQ2 A;  5GAN e;  2PU9 B;  4M75 C;  2GQV A;  2EFI A;  4A4H A;  4JLG A;  4F7U G;  2A3L A;  4CI0 C;  5C53 B;  2EJG A;  5GAN 8;  3CCQ A;  3G71 A;  5CKB A;  3JCM e;  2ZNJ A;  4XK8 E;  5ELO A;  2P0K A;  4HVC A;  1KQ1 A;  3J81 E;  4QQ6 A;  2R58 A;  3CC2 T;  3SFM A;  3QZ9 B;  3FLG A;  5LJ3 e;  2OAU A;  3SWN C;  2KQW A;  3UH0 A;  3JSC A;  3MEV A;  4LNS A;  3C94 A;  3L2U A;  2XG8 D;  1ADY A;  2QHT A;  3ICA A;  1N6A A;  4KUD K;  4K86 A;  1P92 A;  3A5Z A;  1ZQ1 A;  2Y4X A;  3M56 A;  1JRI A;  4JDS A;  1QP3 A;  1ASY A;  4RKU E;  3NFC A;  4C8Q A;  2E41 A;  5FU6 C;  4J83 A;  1VQ6 T;  4CH4 A;  4PJO E;  4P73 A;  1BIA A;  1YJW A;  2CZ1 B;  3HRI A;  3MP6 A;  5J3B A;  5DM7 R;  2RHQ A;  4LDW A;  3M58 A;  2DJZ A;  4M77 F;  4X34 A;  4E47 A;  4C92 G;  5HKC A;  4YRE A;  1JJC A;  2RA2 A;  3OYL A;  4LD6 A;  3OBY A;  3TU4 K;  4NOY A;  4XU1 A;  4K88 A;  4QQG A;  3OS2 A;  3VQX A;  3DKM A;  2FVU A;  4QQD A;  4ELZ C;  5KE3 A;  1EIY B;  3L2W A;  4M7D E;  2X4J A;  4BY6 C;  1M8V A;  2DEQ A;  4IUT A;  1VIE A;  3UGT A;  3J80 E;  2ALY B;  3GF5 A;  1NPP A;  3LGF A;  4E7I A;  3HFZ B;  3L42 A;  1QE0 A;  4OVA A;  2ZR3 A;  1USY A;  3M53 A;  1YJW T;  1YHQ T;  3L1A A;  5FU7 B;  3LX7 A;  4PJO G;  3ER0 A;  3L2Z A;  4M78 F;  3L2R A;  2R5M A;  4HCC A;  5C0M A;  2LC4 A;  4YRQ A;  3CPW A;  1VQP T;  1X75 C;  5LJ5 h;  2ZPH B;  4YP0 A;  1JJ2 S;  4M7D F;  4P75 C;  12AS A;  1B70 B;  2M1H A;  1ATI A;  2Q5I A;  2I2L A;  4ZTF A;  4P75 A;  2FB7 A;  4YRJ A;  2ZCE A;  3P8V A;  3VUB A;  2IVW A;  3HTZ A;  2DTI A;  3JCM b;  2E6Z A;  3R6O A;  4DA4 A;  2M0O A;  1Q81 U;  3OBW A;  1VQ8 A;  2KVQ G;  2RHX A;  1YIT T;  3EFR A;  4M75 D;  4IUU A;  1Q81 C;  3A74 A;  3A8H B;  1VQL A;  5GAN h;  1X01 A;  4R55 A;  2RJD A;  2K2V A;  4P3O A;  2CS7 A;  2P0L A;  5J26 A;  4UP8 A;  4M7A B;  3ZFJ A;  4H2T A;  3WVD B;  4RG2 A;  1XQH A;  4M78 A;  3M4P A;  3JCM J;  3OYA A;  4RMO A;  1B34 B;  4R56 A;  4HCZ A;  3IAL A;  4H2U A;  3JB9 I;  2VGM A;  3GPL A;  1Y7X A;  2ARS A;  5GAN 5;  4P72 C;  4CRI A;  5HK3 A;  1LOJ A;  4ZIB A;  3REU A;  2RHQ B;  3G4S A;  1EVL A;  4F7U F;  2E5Q A;  2HNI A;  3O8V A;  2AMC A;  2V8J A;  1W66 A;  4J7I A;  4YRS A;  1VUB A;  2BIV A;  1X2H A;  2E65 A;  4LDY A;  4KT0 E;  5GAM j;  3OYI A;  3LC0 A;  3HHT B;  3KFU A;  3W3S A;  2XDB A;  5GAN d;  1NPR A;  3I56 T;  4A4G A;  2XDD A;  2L89 A;  4M77 D;  3NTK A;  3M55 A;  1JJC B;  4HCB A;  2CGH A;  2P0P A;  4QW2 A;  2ZCF B;  1WQW A;  4M77 B;  1GXI E;  1OI1 A;  2Y4Y A;  4P5N A;  3G7Z A;  2XD0 A;  5GMK m;  2RH2 A;  4G85 A;  4YRG A;  2LVM A;  1BI3 A;  2ALY A;  1H3Z A;  4KQE A;  4XU2 A;  2JVV A;  4M77 G;  3CPW S;  5GAN j;  4M78 E;  1YI2 A;  1E1T A;  4OB0 B;  5IAY A;  4P74 C;  1XNI A;  1D3B B;  1IL2 A;  4YTL A;  4M7A A;  1KD1 C;  2RI2 A;  3JCM c;  3OYE A;  4H2Y A;  4A4F A;  3CMA A;  5GAN 6;  1B7Y B;  2LRQ A;  3CC7 A;  4EO4 A;  3SWN B;  4BWA A;  4M7D B;  4BY6 B;  4Q5W A;  2ZIN A;  4Y91 A;  1NJI U;  1QVF S;  2RK2 A;  5A0L A;  4CH3 A;  1H4V B;  4J6X A;  4G84 A;  3JB9 H;  3BJU A;  2Q7H A;  2F5K A;  4YCW A;  1U1S A;  2R5A A;  2BUD A;  3OYY A;  4X5O A;  3QTC A;  1SSF A;  5A0G A;  1K8A U;  2LCL A;  1KQS A;  3CCM A;  2XID A;  2JTF A;  1VQZ A;  4PKC C;  2E12 A;  2KMT A;  2DPP B;  1RIQ A;  3OYM A;  3RUX A;  4B9X A;  2MF2 A;  1QF6 A;  2XGT A;  4E7H A;  1EFW A;  1YBY A;  5LJ5 f;  2DU5 A;  3CMQ A;  3OYB A;  4LVM A;  3LH0 A;  2GFA A;  2IG0 A;  1QP2 A;  4L87 A;  1N9W A;  1QVG A;  2QEX T;  2ZPI B;  3HL8 A;  2CJA A;  4C92 C;  1KQS S;  5M9O A;  2CJB A;  1FX7 A;  1M5Q 1;  2RK1 A;  1VQ6 A;  2X4Y A;  4TVA A;  2J3M A;  3VQW A;  1E22 A;  2K3X A;  3UDC A;  2DQ3 A;  3N5B B;  4ZN3 A;  3C95 A;  3CCV A;  3V7C A;  3BDU A;  1HTT A;  4N4G A;  4J5Y A;  2V8K A;  4O2D A;  2QTX A;  2C06 A;  4YRM A;  3GLX A;  2CIM A;  3OYH A;  3HXW A;  1WQ7 A;  1C0A A;  5D6W A;  4C92 E;  1BYM A;  3OS1 A;  4M77 A;  2EJF A;  1O9S A;  3A31 A;  1EQR A;  4NS5 A;  2ZGW A;  4XEO A;  4C5E A;  2AKW B;  1BI0 A;  2PVG B;  1B76 A;  4E7J A;  1BI2 A;  1H64 1;  5F5W A;  3E9G A;  3PT9 A;  3I7F A;  3PCO B;  2EJ9 A;  5LJ5 d;  2E6N A;  3C12 A;  3CCL A;  2LQ8 A;  2LT4 A;  4FM4 B;  4BB7 A;  2RHS A;  1X54 A;  1E1O A;  1VQL T;  4C5H A;  2DXT A;  5DLO A;  2Y90 A;  4QVD A;  2DO3 A;  4F7U B;  1SES A;  2NLU A;  3QYH B;  4E7L A;  2ZPE B;  1NJ2 A;  1UGS B;  1L0W A;  3FEO A;  3QO7 A;  3TEG A;  4RG8 A;  4FIB A;  2RJE A;  5LL6 S;  3ZBD A;  4PJO F;  4HA8 A;  1M9S A;  4CS2 A;  1NYR A;  5KNN A;  2LNV A;  1KHC A;  3QII A;  1NJ5 A;  5LJ5 g;  1FYF A;  2ZZF A;  4JLI A;  2FL7 A;  3HPW A;  3CCR A;  5GAM g;  2D6F A;  3CXC S;  2DZ9 A;  4X9D A;  3G6E A;  2LCC A;  1YIJ T;  5C51 B;  3PGG A;  2LTO A;  4BI8 B;  1TH7 A;  2ZXF A;  1USY C;  3MEY A;  3QUI A;  1K9M U;  3RES A;  2MI6 A;  1WPY A;  2AMC B;  4WI1 A;  1YB3 A;  3M54 A;  3DSQ A;  1Y71 A;  3MO8 A;  4A4E A;  3LLR A;  3RF1 A;  1WNL A;  1EIF A;  2DVE A;  4FL6 A;  3ERR A;  1NZ9 A;  1VQ5 T;  1OYX A;  1I8F A;  5GAM e;  1Q7Y C;  3MP1 A;  3UPU A;  3QYG B;  1U8R A;  2RHI A;  1WJS A;  2PVD B;  3QNE A;  3RIR A;  1S72 A;  5HGQ A;  3P8H A;  2HBP A;  2VUB A;  5D6Y A;  2V8I A;  4LDX A;  3GNF B;  3HRU A;  3LGL A;  3QO5 A;  4C0D C;  4WF2 A;  1YHQ A;  1M90 C;  3BFM A;  2K5L A;  4TVW A;  4P74 A;  2RO0 A;  5KE2 A;  3CBP A;  1VQ4 T;  4WJ3 M;  4PJO B;  4IUP A;  3ME9 A;  3G6E T;  2P5I A;  1SRY A;  1UEB A;  2B8A A;  4TQF A;  1BBW A;  4KUL A;  4KBM B;  3HFN A;  4L6V 5;  3RKY A;  1SER A;  1VQ5 A;  2JZ2 A;  3P8D A;  1NE8 A;  1W2B A;  2XK0 A;  3E9H A;  4JRP A;  2RI5 A;  4LD9 K;  3LWH A;  1K73 U;  4BDY A;  3HY1 A;  2EQU A;  5A2Q E;  2ARU A;  3CC7 T;  1BI1 A;  2JUF A;  1G3S A;  2OTJ A;  3UT1 A;  1RL2 A;  3TCJ A;  2K5F A;  1YFT A;  3IG2 A;  1U1T A;  4PJO D;  2WSE E;  4Y28 E;  3E9I A;  4C5I A;  3CME A;  1YFS A;  3WQZ A;  1E24 A;  3HRS A;  4IKF A;  1Z7N A;  3P8Y A;  4M77 C;  4DPG A;  1LYL A;  1M1K C;  3VUZ A;  3MCA B;  5GAN 3;  3HP9 A;  1VQM A;  4M7A G;  3G4S T;  4C0D B;  4KR3 A;  3GNG A;  4RQF A;  4II1 A;  2L8D A;  2YRV A;  4C8Q C;  2QDY B;  4OGE A;  3LW5 E;  3EAE A;  1PYS B;  3TUP A;  1X55 A;  4CS4 A;  2ZIO A;  2RJF A;  2JNG A;  3KUF A;  1ZHI A;  4PG3 A;  2O01 E;  5CKH A;  2EL9 A;  3VBB A;  4KR2 A;  2VC8 A;  3QHS A;  4OB1 B;  4M77 E;  4XTV A;  1Y96 A;  2HQX A;  4HT4 A;  2DTO A;  4CS3 A;  5DLQ E;  2DKG A;  4EMK B;  3MET A;  4UP9 A;  3A8O B;  4ZTZ B;  3PMI A;  3OA6 A;  1PSE A;  4M78 C;  5CQY A;  4H2S A;  3QBY A;  3HY0 A;  5HK0 A;  4LVK A;  3CEY A;  2DIQ A;  5CVI A;  3A7R A;  4EMK C;  2IY5 A;  3CMA T;  2ZT6 A;  4TVR A;  4A4K A;  2VV5 A;  3HRT A;  2RI3 A;  1UGP B;  3T9N A;  1YJN A;  4XEM A;  5E3I A;  4JJN K;  3SDZ A;  4XU3 A;  2EQM A;  3OYF A;  2EWN A;  1YCY A;  1K73 C;  3FDR A;  5KCO A;  2F69 A;  1I4K 1;  1XOV A;  4DOV A;  2LT1 A;  1HK9 A;  3CME T;  1N9R A;  2P4T A;  1KD1 U;  4H2V A;  2YLC A;  3VKI A;  1VQ9 T;  2I4O A;  3PZC A;  4M7D G;  4OP0 A;  1B34 A;  3NET A;  1FWZ A;  5EG2 A;  2Q5H A;  2EYQ A;  1QW1 A;  2PQW A;  4YYE A;  3JRZ A;  4M75 B;  4N0A C;  3NEN A;  1M1K U;  4PJO C;  5GMK i;  3H6Z A;  2NS6 A;  2VXF A;  3C4S A;  3TEE A;  4CH5 A;  2RD1 A;  3OY9 A;  4XTZ A;  2DZC A;  1VQO A;  3JB9 F;  1WU7 A;  4BAC A;  4PJO A;  3CXC A;  3RAC A;  3OB9 A;  4RMF A;  1MHN A;  2QQR A;  3E1S A;  2AHJ B;  4ATO A;  4HKE A;  1VQK T;  5LJ3 h;  4M78 B;  4IUV A;  4OF1 A;  3ZEH A;  3OS0 A;  3L2V A;  2EIF A;  4C8Q D;  1I81 A;  4MML A;  4MDX A;  4M78 G;  2ZZG A;  5FRM A;  2Q7E A;  3VJP A;  2K5I A;  4HT8 A;  3LSQ A;  2DIG A;  3MEU A;  1M4Z A;  5LJ3 g;  4ZGE B;  4P71 C;  2VYT A;  3S3O A;  1KG1 A;  3IKL A;  2HQE A;  5K1P A;  2XIC A;  5FU6 B;  1G5I A;  3BY7 A;  1Y96 B;  2ZNI A;  3P8B B;  2H3J A;  5I2S A;  1VIF A;  3CCV T;  4EX5 A;  2ZT7 A;  4YRN A;  2RHU A;  4RDX A;  2XDP A;  4P3N A;  2PME A;  2QEX A;  2ZR2 A;  5GAN f;  4C8Q G;  4HWP A;  4YDQ A;  1YFR A;  3OYD A;  3CCU T;  5GAN 7;  2I4L A;  3OD1 A;  4L59 A;  3P8T A;  3BW1 A;  3CCE T;  3L4G A;  4YRR A;  1J5W A;  4XU0 A;  3RMS A;  1JBM A;  4FT4 A;  4MZP A;  3QO3 A;  4C0G A;  1VQ4 A;  2DQ0 A;  1KOG A;  1ZBX A;  4OB3 B;  2QQB A;  3VYG A;  3A32 A;  1YJN T;  3PMT A;  3OYK A;  4NL2 A;  3JCM Q;  5IT9 E;  1NJ1 A;  3PIO A;  3SWN A;  3X26 B;  4EPC A;  3QG1 A;  3RKW A;  4C8Q E;  1VQM T;  1HXD A;  3WXM B;  2XTI A;  3M9Q A;  2MWO A;  4P3P A;  1NJ8 A;  4A54 A;  4NCX A;  4M7D D;  2QA4 A;  5FRO A;  4QVC A;  2ODR C;  4PL6 A;  3ASK A;  1X2G A;  2JTM A;  4ZGD B;  4H2X A;  3QXE B;  5GAN 2;  3X25 B;  1N8R C;  4YRC A;  2J3L A;  4YPF A;  2QA4 T;  5HY6 A;  5CO7 A;  2QXF A;  1K8A C;  2QQA A;  3DLM A;  3EFS A;  4GY5 A;  4MZT A;  3CCR T;  5GAN 4;  2GF7 A;  5KH6 A;  1G3T A;  2PMF A;  2JN0 A;  3KXT A;  1VQP A;  3CD6 A;  4OLF A;  2C7I A;  4TVY A;  1I5L A;  1BKB A;  4YRP A;  5I21 A;  3URG A;  2R57 A;  2ODR D;  3NTH A;  1Q82 U;  2DK3 A;  4OMF B;  2LQK A;  1N9S A;  4ME7 A;  3S3M A;  4N4I A;  5CKE A;  4ZTU B;  1PYS A;  4JUV A;  2X4X A;  3LWI A;  4L5G A;  3OYC A;  3HXU A;  4XTY A;  3IKM B;  1M1G A;  4F7U A;  1JB0 E;  1WJR A;  4EMG A;  1OZ3 A;  4ZN1 A;  5GAM h;  1Q7Y U;  3QJY A;  2X35 A;  3JCM X;  5GAO n;  1H4Q A;  4UC4 A;  4BE2 A;  2KAF A;  3PCO A;  3TEH B;  5IN1 A;  2C8M A;  3OQ5 A;  3HFV A;  3CCL T;  2EQK A;  3R07 A;  5FLX E;  2XHC A;  5LJ3 j;  2DDZ A;  4PNO A;  5GAO l;  4TTV A;  4YRO A;  4HWR A;  4TWA A;  3CC2 A;  4CH6 A;  3HFZ A;  2ZPF B;  3A8L B;  3CCJ T;  1LJO A;  3QO8 A;  3OSS C;  4ZGJ B;  3CCE A;  2JOY A;  3I55 A;  1V29 B;  5K1X A;  4H2W A;  4C92 A;  3FIF A;  4B9W A;  4UP7 A;  2VXE A;  5C52 B;  3MHX A;  2I4M A;  3MEW A;  2E5A A;  1B7Y A;  2A8E A;  4PLL A;  1EVK A;  2I4N A;  1SET A;  3PFS A;  1B8A A;  3PTA A;  1BIB A;  2ZPB B;  3HXY A;  1AHJ B;  3DLL A;  2DTH A;  3MP8 A;  1YJ9 T;  1DJ7 B;  2CZ0 B;  4Z02 A;  1UGQ B;  2XKO C;  2DD5 A;  5FU7 C;  3OYN A;  2IY5 B;  3JCM V;  3RKX A;  4HWS A;  2LDM A;  5L8R E;  1VQN T;  3JCM h;  4DOW A;  3V7R A;  1XTD A;  4RCB A;  3HFO A;  4IUQ A;  2OTJ T;  1MGQ A;  2P0Q A;  1UGR B;  2G3R A;  4YRF A;  4HT9 A;  4P73 C;  4M75 E;  3E19 A;  3I55 T;  4MDW A;  4BI3 A;  1VQ7 T;  3AHU A;  4EMK A;  5LJ5 e;  2A7Y A;  1FXX A;  3CCJ A;  3VQY A;  2HD0 A;  3TEH A;  4BI4 A;  2CKK A;  3VU3 C;  2HAX A;  4FT2 A;  2L3R A;  2CZ6 B;  3QZ5 B;  4P72 A;  4M7D C;  3L4G B;  1G5H A;  2MMP A;  2EAY A;  3JCM f;  4BUG A;  3PNW C;  4QVZ A;  5CKF A;  1H4T A;  4YRI A;  5GAN g;  4BD3 A;  5GMK l;  2X4W A;  3HXZ A;  3RMQ A;  4LDV A;  3JCM W;  1RI0 A;  2E10 A;  3H8Z A;  3OYJ A;  1Z7M A;  2KY9 A;  3FRN A;  3CCQ T;  2EKO A;  1EIY A;  1EOV A;  2FHD A;  3QSU A;  3A8G B;  3VV0 A;  2K57 A;  2QHS A;  4TQD A;  3M5A A;  1M90 U;  3NTI A;  3NEL A;  2OTL T;  2K4Y A;  3JCM P;  2E70 A;  3S6W A;  3V7S A;  1W4S A;  1WGS A;  2XU8 A;  4BE0 A;  1ASZ A;  2O4X A;  1VQ9 A;  3X20 B;  4C92 B;  5CK9 A;  4C8Q F;  2ZT5 A;  2RHY A;  5GAO p;  2QQ9 A;  3E9F A;  3RL6 A;  4XQ3 A;  3JCM g;  2Q7G A;  1LNX A;  1HC7 A;  5CIU A;  2ZZD A;  4C0Z A;  3M57 A;  1R8O B;  4M75 F;  4RCC A;  1X6O A;  5GAM d;  3HXV A;  11AS A;  2DXC A;  3Q1J A;  1YIJ A;  3I56 A;  4J8O A;  1WJQ A;  1N27 A;  1BBU A;  3A5Y A;  4OB2 B;  2FYK A;  2M9U A;  3CCM T;  4XTX A;  4JRK A;  1M1F A;  4BE1 A;  4A53 A;  3G1Z A;  3JB9 G;  4H2X B;  3J7A F;  2OTL A;  4YRK A;  4M78 D;  5GAO q;  2RB6 A;  3QKJ A;  2DXB A;  1WLE A;  1H4S A;  3CCS T;  3MEA A;  3JB9 J;  1KMN A;  1NYQ A;  1YIT A;  1D3B A;  4J7F A;  5C6S A;  4C5G A;  2WAC A;  2PUO B;  4J6Y A;  1B70 A;  4VUB A;  5A0D A;  2RM4 A;  3V8K A;  3UWN A;  3WVE B;  4PHC A;  3CD6 T;  4EDU A;  3DB3 A;  1OZ2 A;  4YCV A;  4BDZ A;  3M4Y A;  4EMH A;  3LSS A;  3X24 B;  2ZTG A;  3MQZ A;  3CC4 A;  4Q6G A;  2ART A;  3A7U A;  3CC4 T;  4LVI A;  2ZPG B;  2QQS A;  4H02 A;  4YRT A;  4C8Q B;  5GMK j;  4O5V A;  2XI9 A;  1GGM A;  4M75 A;  3A5Z B;  4MZM A;  4Q15 A;  2YLB A;  2QHV A;  4GLK A;  4NL3 A;  4J15 A;  1G5V A;  2LX9 A;  5D6X A;  5GAO r;  3CPF A;  2KK4 A;  4XTW A;  4JS5 A;  2E1H A;  3LYI A;  4ELY C;  1KC8 C;  1YJ9 A;  3M4G A;  4HWT A;  3A8M B;  5GAO m;  2ZZE A;  3OMG A;  3GOX A;  1KQ2 A;  4N4H A;  4M7A F;  3VQV A;  1NNH A;  3KBG A;  5GAM f;  3RER A;  3FB9 A;  2DAQ A;  3UFG A;  4YCU A;  1VQN A;  1G3Y A;  1O75 A;  2CZ7 B;  3UGQ A;  1VQK A;  1S72 T;  4E51 A;  4XTU A;  3CBO A;  3VYH B;  1PSF A;  4JS4 A;  1G51 A;  2GFU A;  4JRQ A;  1W2B S;  2MWP A;  1QVF A;  4K87 A;  1NJ6 A;  2D0Q B;  2M16 A;  5GMK e;  1QVG S;  2CJ9 A;  2DD4 A;  3MF2 A;  4LDU A;  2YHT A;  1KMM A;  4JRI A;  4C92 F;  4IUR A;  1ADJ A;  1YGB A;  3JCM d;  3JAM E;  1NJI C;  1N8R U;  2RHZ A;  3NEM A;  3X28 B;  3M59 A;  4N0A A;  3HSB A;  2AKW A;  5LJ3 f;  4M7D A;  1IZ6 A;  5FRN A;  3OW2 S;  3FC3 A;  1IRE B;  3GIB A;  4RQE A;  4HWO A;  3CCS A;  2E64 A;  1G3W A;  5AYF A;  5LJ5 j;  5LJ3 d;  2PUK B;  5CQX A;  3DB4 A;  3A7A A;  1JJ2 A;  4V2S A;  2QI2 A;  3BDL A;  2K3Y A;  3OS5 A;  4XAX B;  4M75 G;  4D6W A;  4M7A D;  4YRL A;  1X56 A;  3OW2 A;  3S3N A;  4UPA A;  4AH6 A;  4KUI A;  3INZ A;  1Q82 C;  4X9C A;  2MAM A;  2O4X B;  2WSF E;  3OSV A;  2CYZ B;  2EQJ A;  5CAI A;  5J39 A;  1VQO T;  4FSX A;  1Y07 A;  5GMK h;  3OMC A;  4FU6 A;  1K9M C;  2PVO B;  3OYG A;  4C0F A;  2GCX A;  1Q86 U;  3HXX A;  3QJ6 A;  4TVA B;  3PIP A;  1Q86 C;  4LVJ A;  3F70 A;  1VQ8 T;  3HKS A;  1KC8 U;  4M7A C;  3V8L A;  4O6J A;  2WSC E;  5CR2 A;  3G71 T;  4MMK A;  3CBM A;  5KCH A;  4LVL A;  3MF1 A;  2VGN A;  2G4C A;  3FJP A;  4PLI A;  4E7K A;  2ZT8 A;  3GP8 A;  3V8J A;  1UB4 A;  4P71 A;  4OGC A;  5DY9 A;  1WYD A;  2QHU A;  1KHI A;  3SB2 A;  3L2Q A;  2KDS A;  2RHS B;  3QPH A;  3HRK A;  2F5T X;  3QDR B;  3RGL A;  4F7U E;  2DXU A;  5CKD A;  4WJ4 A;  2DU7 A;  2KSS A;  2RJC A;  4J6W A;  1YI2 T;  3TRE A;  3REX A;  3SD4 A;  2ZIM A;  2E3C A;  3CCU A;  4ZTJ A;  4M7A E;  4BW9 A;  1QVP A;  2L5Q A;  5CCA A;  3JB9 D;  5ELN A;  4C92 D;  2D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...