2DXUA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
231
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKISFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
total genus 67
structure length 231
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxuA01
5LJ3j 3HXUA 4HWPA 1SERA 2Y90A 4PJOE 4HWRA 4BW9A 5C52B 4M77F 2DTIA 3HXYA 4TWAA 4UPAA 11ASA 4HA8A 1LOJA 1SETA 2DXUA 4X9CA 3HRIA 2VC8A 3V7CA 4TVAB 4EMHA 3LSQA 2G4CA 3M4GA 3TEGA 2Q7EA 5K1PA 4M7AA 3HXVA 4A53A 2ALYB 3RGLA 1WQWA 1JBMA 1G5IA 2ZINA 4C8QC 1G5HA 4J15A 4CS3A 3JCMf 4F7UB 3MF2A 1NJ2A 4CH5A 4YDQA 4JRIA 1BBWA 4F7UG 1YFRA 1HK9A 2RB6A 1X2GA 2ZTGA 3IKMB 4YRMA 1I5LA 1GGMA 4C8QA 4M75G 2EJFA 1NJ6A 1E24A 4TQDA 3HXXA 3A74A 2ZT5A 1JRIA 2I4NA 5LJ3h 2I4OA 5GAOn 4HWOA 3V8JA 3TUPA 4NL3A 3P8YA 3WQZA 5GAMg 1KOGA 4C8QB 2ARSA 4M77A 5GAN4 4P72A 4EX5A 4WJ4A 1X01A 3L4GB 2ARUA 3QTCA 4HVCA 4H02A 4KR2A 4UP7A 4ZTZB 1BIAA 2DZ9A 4M75B 2QHVA 3JCMP 5LJ5e 2DQ0A 5HGQA 1LYLA 2K57A 3E9IA 2YLBA 3FB9A 1USYC 2ALYA 2AMCB 3RKWA 4RCBA 1PYSB 2DJZA 1H4TA 2RHSA 3UGTA 4YRSA 1KMNA 2C8MA 4HT8A 3RACA 2ZNIA 4M7AG 4DPGA 4M78G 5GANf 2E3CA 1KQ1A 4YYEA 5GMKi 5LJ3e 3HXZA 2EJ9A 3PZCA 5GAMf 4M7DB 4ZTUB 4P75A 4C8QG 2CJAA 1WPYA 3UGQA 2IY5B 2EL9A 4YRRA 3SWNB 2EAYA 4N0AC 4C92E 3HY0A 3A5ZA 5LJ5d 5LJ5h 3I7FA 5LJ5j 1YCYA 1Y96B 4H2XA 3LC0A 3JCMX 3G1ZA 3RL6A 3SWNA 4C92B 5K1XA 4KQEA 4YRGA 4PNOA 2ZIOA 3V8KA 3RKXA 4P71A 2DDZA 1D3BA 4WI1A 4TTVA 2DTHA 1NNHA 3VQWA 1B70B 3V7SA 4Q6GA 3HFZB 4M78B 4M7DF 2E5AA 4X5OA 4XU0A 3A31A 2RHQA 1HC7A 5GANd 4N0AA 1E1OA 4PJOG 3VBBA 2AKWB 1N9SA 4M7DG 2ARTA 3MEYA 5GAN6 3A5YA 3RUXA 5CAIA 3BFMA 4C92D 3QHSA 1YFTA 1B76A 1SRYA 3R07A 4O2DA 3VQYA 4F7UA 3REXA 4C8QE 3FIFA 3UFGA 1H641 1SESA 3ERRA 4M77D 3IKLA 3REUA 4YRIA 4KR3A 5GAOq 4H2WA 5GAOm 4M75F 3HXWA 5GAOp 1I81A 3JCMd 2Q5IA 4RQEA 4XTVA 2Q5HA 4WJ3M 4PHCA 4M7DD 1B7YA 4NL2A 2EJGA 1WU7A 1G51A 2I4LA 4K87A 1D3BB 1E1TA 3VQVA 3EFSA 5GANe 4XQ3A 3RERA 2E1HA 4E51A 5GANh 4TVAA 4PJOC 1YFSA 1ADYA 3NENA 4P72C 3RF1A 2I2LA 1LNXA 3JB9F 1N9RA 5GMKm 4YP0A 2Q7HA 1E22A 2DQ3A 2JN0A 1WYDA 4J6YA 4QVDA 2C7IA 1QF6A 1HXDA 4H2SA 3PGGA 5GMKe 3QO8A 5C51B 1B34A 1EQRA 1M8VA 5GMKl 4YPFA 1NYQA 4J5YA 4L87A 4YCWA 3BY7A 4MMKA 1RIQA 4G85A 4TVYA 4M77E 3CMQA 1USYA 4PG3A 5LJ3f 4C8QD 3M4QA 4H2YA 4K86A 1I4K1 4XTWA 4F7UE 5GAMe 4Q15A 4RMFA 2RM4A 2I4MA 1NYRA 3JCMb 5GANj 5GAN8 1EVKA 3HSBA 1C0AA 1NJ8A 4EO4A 1X55A 3JCMh 2QHUA 3GIBA 1EOVA 3NEMA 2QHSA 4J6WA 3RESA 5GAN5 3V7RA 2Q7GA 3HY1A 5GAMh 4M78F 5F5WA 2E65A 4C92C 2J3MA 3TEHB 3JCMc 2CIMA 4PJOD 4EMKC 1B8AA 2HNIA 4XTXA 2ZZEA 3HFZA 1B7YB 2AKWA 3HTZA 1B70A 5LJ3g 1X2HA 4CH6A 1H4QA 3JCMe 1I8FA 4RCCA 1X54A 3LSSA 1M5Q1 3E9HA 2RA2A 4P74C 4MMLA 4PJOF 4YRPA 3P8VA 4XU2A 2ZZFA 5E3IA 5GAN7 1MGQA 1L0WA 3VU3C 3HFNA 4XTZA 12ASA 1Y96A 4XTUA 5GAOr 3QNEA 5GAOl 2ODRC 4P71C 2VXEA 4V2SA 2PMFA 4YCVA 5ELOA 2ZCEA 1TH7A 3VQXA 3L2ZA 2YLCA 2EWNA 3M4PA 1KMMA 3JCMJ 3A32A 4YRKA 4YCUA 3OD1A 4M7AF 4CS2A 2DZCA 4HT9A 2ODRD 4UP9A 4M7AC 4TVWA 4YROA 3HFVA 1N9WA 2DU5A 4LNSA 4M78C 3JB9H 2ZGWA 3PCOA 3QO7A 1WNLA 3TEHA 4PJOA 1Z7NA 2E10A 1ASZA 2E64A 2P0LA 4ZIBA 2CJ9A 4RQFA 4P75C 3JCMQ 1JJCB 4Y91A 4P74A 4M7AB 3V8LA 1BBUA 5GAMd 3SB2A 5KNNA 1QE0A 1U1SA 4J6XA 1WQ7A 3JB9D 3HFOA 1ATIA 3IG2A 4YREA 1EIYA 4A54A 4P3PA 2E41A 1B34B 4OP0A 4WF2A 3HRKA 4NOYA 3BDUA 2QTXA 3A7UA 4M75A 3JB9J 3A7RA 4YRFA 3SWNC 2DU7A 2J3LA 2AMCA 5GMKh 4C92F 1PYSA 4BWAA 3QO3A 5GAN2 3JB9I 4C8QF 3AHUA 2CJBA 4C92G 3L4GA 1W66A 4JRKA 2FB7A 4XTYA 2ZR3A 4NCXA 4P3NA 4EMGA 1BIBA 1U1TA 3INZA 4M7DC 2ZT6A 1JJCA 2XTIA 4H2UA 2PMEA 3W3SA 3RKYA 2VXFA 2YHTA 4EMKA 4PJOB 1YB3A 4CH4A 2DKGA 3L1AA 2RD1A 4YRLA 5LJ3d 1YGBA 4F7UF 4YRJA 4M7AD 4YRTA 2ZT8A 4M78D 2RHSB 3BJUA 3JCMW 1EFWA 3DSQA 4EMKB 2CGHA 3IALA 3QSUA 4UP8A 5GMKj 1VQZA 4YRCA 5GAMj 2ZIMA 4M75D 5GANg 2DTOA 4TQFA 4AH6A 4YRNA 1H4VB 4P3OA 2DXTA 3BW1A 4JUVA 2ZXFA 4CS4A 4H2TA 4M77B 3EFRA 1NJ1A 3QUIA 4M77G 3NETA 4H2VA 1KQ2A 3UH0A 4CH3A 4P73C 4XEOA 4M78E 1J5WA 5LJ5g 3FJPA 2P5IA 4JLIA 4C92A 4M7AE 1LJOA 3P8TA 5C53B 3ICAA 1ASYA 4HWTA 4P73A 2ZR2A 1HTTA 2DEQA 3A7AA 2FYKA 1WLEA 3JCMV 4K88A 3PCOB 3JCMg 2XGTA 4M75E 4DQ2A 1Z7MA 4M77C 4XEMA 2RHQB 4M7DA 2QHTA 3JB9G 4G84A 3RIRA 4M78A 1IL2A 1NJ5A 2IY5A 1H4SA 5LJ5f 1EIYB 4YRQA 4RDXA 2ZT7A 4XU1A 4XU3A 4HWSA 5I21A 1ADJA 3KFUA 2ZZGA 5GAN3 1EVLA 5DY9A 5ELNA 4QVCA 4OLFA 1X56A 4H2XB 3MF1A 2ZNJA 3NELA 3QO5A 4X9DA 2DVEA 1FYFA 4M7DE 4M75C
chains in the Genus database with same CATH superfamily
5LJ3j 1YN8A 3L2WA 1LVKA 1NJIC 3CC4Q 4M77F 3HXYA 4TWAA 1K73R 3CCVQ 1QVGA 2JZ2A 3M54A 1LOJA 5CKDA 2QEXA 3HRIA 1R8OB 2Z0WA 4TVAB 2RQUA 3LSQA 1MMNA 2FG0A 2G4CA 1ZSGA 2NLUA 2WSFE 2Q7EA 5K1PA 3RNJA 4A53A 4UC4A 1WQWA 4F14A 1ZA1B 3RMQA 4ELYC 2ZINA 1NJ2A 4YDQA 4FYXB 4F7UG 2RB6A 1M1KU 2DNUA 4YRMA 2QGFB 1YJWA 1I5LA 2PVGB 2DL3A 3HXXA 3OYFA 5LJ3h 2Y4YA 3MJXA 3TUPA 5FU6C 5CKEA 4BY6B 2EYYA 4EX5A 5FLXE 1Q7YR 1AOJA 3L4GB 4KR2A 3REAB 4ZTZB 1BIAA 2DZ9A 4M75B 3FB9A 2RHYA 1USYC 1X69A 5HK0A 2ALYA 3M4YA 3RKWA 4RCBA 1MMDA 2DJZA 3VS2A 1IRXA 2FZKB 1WIEA 1KJWA 4HT8A 3CCST 4J9GA 2A37A 3VS6A 2KMTA 2RO0A 4RG2A 5A0LA 2CT4A 3HXZA 3JV3A 2XDPA 1FMVA 1PHTA 4P75A 2B86A 2R5AA 4CC4B 1AZEA 4ZTFA 1U06A 3OBYA 1AVZC 5CQXA 5FU6B 2EL9A 3EG1A 3SWNB 4PFZA 1N6AA 4N0AC 1KK7A 4C92E 4ATOA 1IREB 2RK1A 3BDLA 1YCYA 3LC0A 2CS7A 3UF4A 4C92B 5K1XA 1OEBA 2LQ8A 2ZIOA 2QTVA 4P71A 3G6EA 4OMOA 2LJ3A 4CRIA 2P0PA 4WI1A 2AHJB 2JS2A 1NNHA 3VQWA 4FYVB 5FROA 2OI3A 1VQ7Q 3QG1A 4BDZA 4M78B 4VUBA 3A31A 5GANd 4N0AA 3X26B 1W4SA 5IT9E 1G3YA 1N9SA 2AK5A 1JEGA 5GAN6 1SKUB 1YIJT 1WGSA 2QQ9A 2JMCA 2FO0A 3QDRB 4L5GA 1JQQA 2KE9A 2DIGA 2XU8A 1B76A 1H3ZA 2CSIA 2DFUA 3REXA 4C8QE 3M59A 5HKCA 1H3HA 3UFGA 2HQEA 1VQKT 4F16A 4J7FA 4O6JA 1YIJA 2RI3A 2FPFA 3S3MA 5GAOp 1WXBA 1QCFA 4WJ3M 3M0RA 4QQGA 3G4SQ 2JNGA 2X4JA 1MHNA 3NGPA 1WU7A 1G51A 2CZ7B 1D3BB 4OMQA 3EFSA 2OTLQ 2E1HA 2O88A 4TVAA 3WVDB 1YFSA 3GF5A 3NENA 4Q5WA 2CUDA 1LNXA 2XD0A 3LWIA 2DVJA 5KYNA 3OYYA 2HKQB 2MWPA 2RJEA 4C5GA 3CMEQ 1MNDA 2LT4A 5KH6A 1HXDA 4H2SA 3PGGA 1BYMA 1B34A 1N27A 1AWOA 4L87A 4YCWA 2OTJA 2EBPA 2QDYB 4XK8E 1VQNA 1SEMA 5LJ3f 3M4QA 1I4K1 4A4FA 2K6DA 4LUDA 4HKEA 4E7IA 4RMFA 1ZUKA 2I4MA 1WZOA 5GANj 2CUBA 4HCCA 2E5QA 3HSBA 4PJNA 2A36A 3CCSA 1RLPC 3QZ9B 3LX7A 1VQOA 1X55A 3EH1A 4AG2C 2LT1A 3OYEA 4LDVA 3V7RA 2VASA 1EFNA 3HY1A 3CCRA 2O01E 1SHGA 2KXCA 2J3MA 1TG0A 2GFAA 3TEHB 2CIMA 2HDAA 2J6OA 2DYBA 1BI2A 4HXJA 4KGVB 4AFUC 1YJNT 1TUDA 1B7YB 3OY9A 3HFZA 4BI8B 1B70A 2FL7A 2L3SA 5LJ3g 3CD6A 3PE0A 4Y28E 3JCMe 3C95A 4TVRA 4GY5A 4BE1A 2GCXA 2RHZA 1X54A 4P74C 3PMIA 4MMLA 3FRNA 2QEXQ 3P8VA 2ZCFB 3WVEB 1X6GA 3A8OB 3CC7T 3OW2A 3VU3C 3ZEHA 1G3WA 3NHNA 2CZ1B 4XTZA 12ASA 5GAOl 2OX7A 3MCAB 4BD3A 1QVGS 2L3RA 4A4GA 4FT4A 1TH7A 3A32A 2MOXA 4M7AF 1SHFA 3DLLA 4M7AC 2O2OA 5IHNA 3HFVA 4F04B 3OA6A 2XI9A 4M78C 2RHIA 1YI2A 1QQJA 3M57A 2E10A 3VS0A 2X35A 2DXBA 4ZIBA 4JRQA 2R5MA 3LH0A 2KRSA 4E2FB 2EYQA 4LDWA 1UJYA 3U23A 2CZ6B 2QA4Q 2RJCA 5KNNA 2HL3A 3JB9D 1ZBXA 2EQIA 1ATIA 3IG2A 1EIYA 1RAAB 5FU7B 2A28A 1VQMT 3R6NA 2VYTA 3HRKA 2DO3A 1Q82C 3QJ6A 1VQLT 2RHUA 1X2QA 4YRFA 2RJFA 4C0DB 2CP3A 3EGDB 4C92F 4FL6A 8AT1B 2ZPFB 3OYJA 4DEYA 3AHUA 2VVKA 2X9HA 1ZA2B 4C92G 4BACA 1UGQB 1XNIA 4JRKA 2FB7A 2KT8A 4EMGA 2HSEB 3INZA 2DEUA 2C0IA 2E12A 1JJCA 1RADB 1UGRB 4PL6A 2EIFA 1H8KA 2QYZA 2HQHA 1VQPT 1WHGA 3QJYA 1YCSB 4C5HA 2J06A 3META 1EFWA 3DSQA 3CQTA 5GMKj 5CKHA 1P92A 1Q86C 1ZHIA 3EG2A 1VQZA 5HCKA 2E6ZA 5GAMj 4YRCA 1H92A 3G71T 2DTOA 3BE3A 4AH6A 1VYVA 2CP5A 3CC2A 2ZXFA 2DM1A 4H2TA 1BCMA 3EFRA 1UB4A 3S6WA 1V29B 2RJDA 1NJIU 1D1AA 4KH1B 1OPKA 1GRIA 2BZYA 3FDRA 2DD4A 4IUPA 2DAQA 4CH3A 4XEOA 2H3JA 2J6KA 4ZNXA 2QQSA 3EH2A 3CPFA 5AYFA 3VS1A 2JMAA 1OU9A 2LCCA 2KAFA 3P8TA 5C53B 4P5NA 3ICAA 4PJJA 2ZR2A 2V8IA 2XG8D 3A7AA 4FYWB 4OMPA 1QKWA 3JCMV 1YJNA 3JCMg 3HPWA 2XGTA 3EGDA 3CPWA 2OTLA 2QHTA 3ZL7C 1M1GA 3JB9G 4G84A 4ZN1A 2J7IA 3P8HA 1Q86U 3OMCA 2K5LA 4XU1A 4HWSA 3CCJQ 3P8BB 1PRMC 2COWA 1JJ2P 3CPWP 4OLFA 1X56A 4LDYA 2MF2A 4X9DA 3A5ZB 1M1KC 2KROA 1QP3A 1SERA 2LQNA 2Y90A 1WLPB 4ZGDB 4HWRA 3EFOB 4BW9A 5I2MA 1RAFB 11ASA 3UWNA 3CCVT 4HA8A 5EG2A 5FWCA 4C5IA 4LDUA 2DXUA 2XDDA 2VC8A 4JJCA 1Y07A 3VKIA 4BUGA 4M7AA 3A8LB 1M3BA 5IXFA 3QZ5B 1K8AC 2A0FB 4BB7A 1G5IA 4J9EA 2ED1A 4C8QC 1G5HA 2DBMA 4CS3A 1M9SA 1VQ9A 4JRIA 1YFRA 3LGLA 2DPPB 3LH5A 3CCEQ 4J9DA 2EJFA 2NUTB 1M1KR 1OV3A 2ROTA 1D09B 1PSEA 5GJVB 1YJ9T 1YJ9Q 4OVAA 1JRIA 2JVVA 3MEWA 2I4NA 5GAOn 2LX9A 3VUBA 4F17A 1S72Q 1T0JA 4NL3A 1VQOT 1KOGA 1WDXA 2XKOC 4RG8A 1QP2A 3CCRT 3MEVA 5IXBA 1OX8A 2CKKA 1QVFP 5KYWA 2M9UA 2QXFA 4J9HA 1VQ4A 2RHSA 2L3PA 3UGTA 4YRSA 1KMNA 2SEMA 1B07A 2NYSA 2QQBA 3VS3A 1UE9A 2J6FA 3ZFJA 3TSWA 2L0AA 3VS5A 1R0BG 2E3CA 3A8MB 3CCLQ 4DBQA 3CCET 4YTLA 4OMLA 4CC7A 1VA7A 4ZTUB 1X2KA 1WJQA 4C8QG 2CJAA 4E47A 2AT1B 2IY5B 4YRRA 3M0TA 4RUGA 5EC7A 2CT3A 1BB9A 1AWJA 4HVWA 3HY0A 4B9XA 2MAMA 5LJ5h 3I7FA 5LJ5j 1Y96B 4C0DC 4RKUE 4OGEA 2JTEA 1PSFA 4WTOB 4PNOA 3UATA 4YRGA 3V8KA 4E7SA 1B3QA 3PVQA 5I22A 1OZ3A 2DDZA 1XTDA 1S1NA 1W70A 3A98A 1B70B 2QG9B 3V7SA 2EYWA 5D6YA 3HFZB 4N4HA 2HBWA 4M7DF 1IGQA 2QQRA 4X5OA 4XU0A 2G3RA 2PQWA 2XK0A 2CP2A 2XICA 2MYSA 1VYTA 2X4YA 2ARTA 3A5YA 3DB4A 2K5IA 2F2VA 1UG1A 2NUZA 1VQ5A 3BFMA 3QHSA 4HCZA 1KIKA 1NYGA 2BTTA 3OS5A 3VRZA 4O2DA 3VQYA 3FIFA 2CP6A 4JJNK 1H641 2MIOA 1QMCA 2VKNA 2FEIA 5GAOq 2DILA 5GAOm 2ENMA 3QWXX 4M75F 3HXWA 3UDCA 2K3YA 1I81A 4RQEA 2GBQA 4CC3A 4PHCA 3MKDA 4IURA 3H0HA 4M7DD 1B7YA 4NL2A 2EJGA 1K9MU 3CCLA 3L2VA 3CC4A 2I4LA 4K87A 5FW9A 1N8RC 1K73C 3SHWA 4B9WA 4XQ3A 1VQ7A 3RERA 2E3IA 5GANh 3SD4A 3I56Q 4PJOC 4PK4A 4QVZA 1ADYA 2JTMA 7AT1B 2AZSA 4M4ZA 2CP7A 1N9RA 1VQPQ 1N5ZA 2QASA 2CH4W 4YP0A 4PLIA 2DQ3A 2JN0A 4JZ3A 3L2UA 2X4XA 4QVDA 5KCOA 1X75C 1YNZA 5DM7R 2ZPGB 1F1BB 2IVWA 1ZSZB 5GMKe 3QO8A 2DX1A 1M8VA 2YWWA 2RI5A 2RQWA 3BY7A 1PKSA 4MMKA 4G85A 3KXTA 2O4XA 2Y4XA 4JRPA 4LD9K 3CMQA 2RH2A 3MHXA 4PG3A 1WXUA 2DMOA 1NYRA 5CR2A 4OMNA 5J26A 3EG3A 2F2XA 1C0AA 2QA4A 3OYIA 1NJ8A 5CIUA 4EO4A 4J9IA 3JCMh 1YP5A 2QHUA 3GIBA 1WHKA 3I9QA 3RESA 1ZX6A 5GAN5 1K76A 3DKMA 1MMGA 1TUCA 2SRCA 4M78F 2E65A 2FZGB 3VRYA 1XJWB 4J8OA 1FYNA 2E5KA 4PJOD 5J39A 2A8EA 3G6ET 2HNIA 4IUQA 4XTXA 5DLOA 4J9BA 1WXTA 1FX7A 2AKWA 3CXCA 4CH6A 1GL5A 4RTTA 1H4QA 3H6ZA 1QKXA 1I8FA 1OOTA 2RQTA 1VQ4T 4RCCA 4FIBA 2JXBA 2RI2A 2HKNA 5KYWB 2LQWA 4RTVA 5E3IA 3TVTA 3OYCA 1M27C 3HFNA 4E7LA 1Q7YC 4PJMA 5GAOr 3QNEA 5KCHA 3UA7A 3HRSA 3RMSA 4V2SA 2FHDA 4AFSC 1KQSS 5ELOA 3VQXA 3ME9A 2ABLA 3M4PA 2AKKA 3JCMJ 1KMMA 4CS2A 1AT1B 5HY6A 2ODRD 1I0CA 2L5QA 4TVWA 4YROA 1G3SA 2E3HA 4PKCC 2DU5A 1VIEA 2V8JA 3H41A 2E64A 2P0LA 2YUPA 5FRMA 1MNEA 2MI6A 2L8DA 2KXDA 5FWBA 3JCMQ 1UFFA 5GAMd 3A8HB 1QE0A 2M51A 1WQ7A 1QVFS 1YITT 4YREA 3M9QA 3THKA 4A4KA 1B34B 1ZSZC 1YBYA 2MMPA 3BDUA 2GTOA 4RTWA 4IIOA 3A7UA 1O75A 3R6OA 1PD1A 2QDLA 2ZPBB 4KULA 3SEMA 2QK0A 3M56A 5GMKh 4RTUA 1XQHA 3SDZA 4KT0E 5ECAA 3QO3A 3QYHB 2DRMA 4EPCA 1N8RU 4HVVA 1UEBA 3VV0A 3JB9I 4O5VA 4QT7A 2LCLA 2C06A 2CJBA 2R57A 1W66A 1BI0A 4XTYA 1QVGP 2ZR3A 3EHQA 1BIBA 1U1TA 1NPPA 2LTOA 4H2UA 2FRWA 1JO8A 2PMEA 2GQVA 1VQNT 2YUQA 1BKBA 2VXFA 2KNBB 2YHTA 4MDXA 4PJOB 1YB3A 4CH4A 1YFNA 3HHTB 2KRNA 2DKGA 3L1AA 2RD1A 2GGRA 1LPLA 3C12A 4F7UF 2JJ9A 4AG1C 4E7JA 2EQJA 2H8HA 3QXEB 4YRTA 4LDXA 1RL2A 4EMKB 2DERA 3QSUA 3TU4K 3G7ZA 2ZIMA 4M75D 5GANg 4PJLA 3ZBDA 2KQWA 2O31A 3VS4A 3VUZA 4J9FA 2O9SA 2DXTA 3BW1A 1MV3A 3HL8A 4Z8AA 2ED0A 4CS4A 1G5VA 2WSEE 4M77G 3NETA 2M0OA 4OB0B 1KC8U 2WSCE 2O4XB 4HCKA 2OTLT 4P73C 5KYYA 3H8ZA 2DF6A 4M78E 1EIFA 4M7AE 1VQMQ 4KUDK 1N8RR 2O9VA 2F69A 4HWTA 2YUOA 9ATCB 1NPRA 1UGVA 2FYKA 3J80E 3C0CA 1RUWA 4K88A 4FU6A 1UTIA 3H0FA 4ME7A 1Z7MA 4DBRA 3PIOA 1YWPA 2RHQB 2YRDA 2L3QA 4M78A 1K8AU 1IL2A 4OMFB 4JJDA 2L2PA 4RTXA 2ZT7A 1RAIB 1VQ8A 5GAN3 5IN1A 4MZTA 4IIMA 4QVCA 1YJWT 3MF1A 3NELA 3OS1A 1YJWQ 1VQMA 2HEQA 1SSHA 1LCKA 3OYMA 1K1ZA 5KYXB 3UA6A 2M0YA 1S72T 4HWPA 4PJOE 1ZUYA 1JB0E 2DTIA 2DD5A 2DETA 2BE7D 1T3LA 2JT4A 4BI3A 1K9MR 4X9CA 1M90R 3P8DA 2HZYA 4JS4A 1NJIR 3ER0A 3V7CA 2RN8A 4Y92A 3EAEA 3M4GA 3FLGA 1TU0B 5AT1B 3CMAA 3HXVA 3RGLA 1RABB 2PNIA 3QIIA 4OB2B 4F7UB 1BBWA 5KYYB 2F2WA 3UPUA 1T0HA 1X2GA 2ZTGA 2P0KA 2VV5A 3MP1A 4M75G 3OYNA 1NJ6A 1WHJA 1NM7A 5A2QE 3A74A 2ZT5A 3P8YA 3WQZA 2YSQA 3UT1A 1IZ6A 4C8QB 1M90U 2ARSA 4M77A 4WJ4A 4P72A 1CSKA 2BKDN 2DL7A 2V1QA 1YHQT 3VS7A 1YHQQ 4FW2A 4H02A 4UP7A 2QHVA 5HGQA 4FCYA 2MPXC 1LYLA 1Z9QA 3I55A 1ZLMA 2YLBA 4JS5A 4BE0A 3KBGA 4CI0C 2AMCB 2EQKA 3RACA 1PD0A 3H9NA 4LVKA 2P0QA 3FC3A 3CCUQ 1KQ1A 4YYEA 4HCBA 3EFOA 2E4HA 2EJ9A 5GAMf 4M7DB 3CC2T 1WPYA 3UGQA 4KUIA 1K8AR 2YDLA 1JU5C 2COZA 4KRTA 4DA4A 2K7AA 2BZ8A 2HMAA 3CCQT 1JJ2S 4H2XA 3G1ZA 3RL6A 1VQ4Q 4LD6A 4KQEA 4CC2A 3GLXA 3N5BB 1IO6A 1QW1A 2DTHA 3L2QA 2GTJA 1Y0MA 3CBPA 1TS9A 2RHQA 1HC7A 3PT9A 4GBQA 4E7KA 1NLOC 1Q7YU 4PJOG 1E1OA 3OYGA 3M58A 3VBBA 1FXXA 2IPOB 1J3TA 2AKWB 4KGZB 2E70A 3MEYA 3FJ5A 3C94A 3E9GA 1I07A 2CZ0B 3CMEA 1K0SA 1SRYA 3R07A 5I2SA 1KHIA 4B6MA 3GBQA 4BDYA 3ERRA 1ZBJA 3REUA 1SF9A 3JCMd 4A4EA 1UGSB 2HQXA 4R56A 1FWZA 3MQZA 3HKSA 3FEOA 1E1TA 3VQVA 1G3TA 3TEEA 2PU9B 5GANe 3CCVA 2OTJT 2JUFA 2GNCA 4E51A 1YI2Q 3HP9A 4LN2A 1KD1U 5C0MA 4AT1B 4P72C 3RF1A 2I2LA 1VQ5Q 1VQ5T 4LE9A 3OYAA 5FRNA 5GMKm 1NE8A 3X20B 2Q7HA 1E22A 1RI0A 3C4SA 1SRLA 1WYDA 3CXCP 1R0CB 1GBRA 5C6SA 2C7IA 1QF6A 3HRTA 5GMKl 2D0QB 4C0FA 4J5YA 2EYZA 1QVFA 1M2VA 2M16A 1PRLC 1RIQA 2KYMA 1U5SA 2IG0A 3CCJT 2DBKA 2RMOA 1WI7A 3GP8A 2R58A 3E1SA 4C8QD 4H2YA 3OQ5A 3CC7A 4K86A 1VQNQ 4ORZA 3PMTA 4Q15A 5KE3A 3JCMb 4FT2A 2DE0X 1MMAA 3JAME 1PCXA 4IUUA 1Y7XA 1FMKA 1UECA 2BZXA 4EDUA 2EGCA 4A4HA 4J6WA 4PFPA 4KGXB 2Q7GA 4Z02A 5GAMh 2MK5A 5F5WA 4C92C 2ZZDA 5IH2A 1OQKA 1BI1A 1Y57A 5M9OA 1X2HA 1YJ9A 2DYIA 1X6BA 2D0NA 3LSSA 1TTHB 1HD3A 3E9HA 2RQRA 4RTZA 3CXCS 4YRPA 1Z9ZA 4XU2A 4FW1A 1YI2T 1SSFA 4EIKA 5GAN7 5J3BA 1ABOA 2HL5C 1G2BA 1L0WA 2IIMA 1VQ6T 4RTYA 2LVMA 1GFDA 1WHLA 1Y96A 2K2MA 1WJSA 3EGXB 4A63B 1VQOQ 2ODRC 3IQLA 2VXEA 4JDSA 2HBPA 3S3OA 4YCVA 3CPWS 3OSSC 1EZZB 3L2ZA 2COYA 2YLCA 2EWNA 3E19A 2HAXA 4YRKA 3OD1A 2DZCA 1WYXA 2GQIA 2KGTA 3G71Q 2FRYA 1GCQC 3NMZC 3CCMQ 1N9WA 2QQAA 1M3AA 4JZ4A 4LNSA 5CK9A 3JB9H 1BBZA 3PCOA 3QO7A 3TEHA 2FVUA 1Z7NA 1ASZA 2CJ9A 4RQFA 3RBBB 4FM4B 1JJCB 4Y91A 2KSSA 3V8LA 3CEYA 1NZ9A 3CD6T 1YHQA 3SB2A 3LLRA 2P84A 3CCLT 3KFVA 3HFOA 1K0XA 2W10A 2JW4A 4IUVA 4A54A 4IKFA 2YUNA 4OP0A 4WF2A 4NOYA 3QYGB 2BIVA 3NPFA 2JM9A 2LJ0A 2QTXA 3TREA 3JB9J 3KUFA 1VQKQ 2PUKB 3EGXA 3L2RA 2J3LA 1D1CA 2LP5A 2AMCA 3NTKA 4JPBW 4BWAA 3CBOA 2DRKA 2AIRB 2DA9A 4RMOA 5CO7A 3CCUA 3D7SB 4BE2A 1M90C 4FSXA 4K11A 2CP0A 3L4GA 1I1JA 1ARKA 2KYBA 3HRUA 1VQ9T 4NCXA 1KD1R 2JOYA 4M7DC 2ZT6A 1TOVA 2NS6A 1GCQA 3DLMA 3W3SA 3M53A 3RKYA 3WXMB 4EMKA 3CMAT 2A3LA 2LX7A 1RACB 4YRLA 3F70A 4IUTA 5LJ3d 1YGBA 1VQ6A 1EX4A 1TUGB 2KI7A 4M7AD 2LCSA 2ZT8A 4J7IA 4M78D 4II1A 2RHSB 2AKLA 1KC8C 1I5OB 1BCOA 1ZQ1A 5D6XA 1IXDA 1WJRA 1D1BA 3A1PA 3H0IA 3QDFA 1NEGA 1S72A 1BK2A 3SFMA 4YRNA 3OYKA 1CKBA 5A0DA 3CCMT 2EKHA 3TSZA 4ZN3A 3M5AA 3CCQQ 2MCNA 1OYXA 3MP8A 3NTIA 4N4IA 1VQPA 3CCSQ 4H2VA 1IHWA 2YRCA 2JM8A 4ELZC 2B8AA 5LJ5g 3GOXA 4C92A 2W0ZA 3GNGA 4JLGA 1LJOA 4Z89A 1NLPC 1NG2A 4R55A 4C0ZA 4P73A 3OYDA 2DEQA 2K79A 2PVDB 3JRZA 1WLEA 3MP6A 2OJ2A 3CMET 2AZVA 1JJ2A 1WFWA 3M55A 4GLMA 4DQ2A 3EHRA 1YJNQ 4M77C 1UHFA 3RIRA 1D0ZA 1NJ5A 2IY5A 1H4SA 2HD0A 4AFQC 1EIYB 1VQ8T 2LZ6B 1VQ8Q 1RI9A 5I21A 2VWFA 3KFUA 2ZZGA 1Y71A 4X1VA 1EVLA 1X6OA 1XOVA 2DJQA 1OX9A 2ZNJA 4LUEA 1IHVA 1PM3A 1AWWA 4R0KA 2DVEA 4M75C 2EYXA 1QWFA 2OTJQ 3HXUA 3DB3A 3OW2P 2GF7A 5C52B 4LVIA 4UPAA 4BY6C 2D9TA 1SETA 1M2VB 2A08A 4EMHA 2LJ1A 4DOVA 1E6HA 1OU8A 3TEGA 2YXYA 4L59A 4QQ6A 2ALYB 3G1JA 3J7AF 1VUBA 4L6V5 1JBMA 4QKUA 5I11A 5CCAA 4J15A 2HCKA 3JCMf 2F5TX 2BE9B 3MF2A 4CH5A 1HK9A 4ZGJB 2KK4A 3IKMB 4C0GA 1GGMA 3VJPA 4C8QA 3S3NA 1E24A 5KYXA 1W1FA 1VQLQ 4TQDA 2X4WA 1M1FA 2KVQG 2RF0A 3E9FA 1MUZA 6AT1B 1PC0A 4OB3B 2I4OA 2LNVA 4HWOA 5L8RE 3V8JA 1JXMA 1HYOA 5GAMg 1KSWA 5GAN4 4ANJA 3CC4T 1X01A 1WA7A 2ARUA 3QTCA 4HVCA 1C1AA 2OAWA 3JCMP 5LJ5e 2DQ0A 2K57A 1W6XA 1X43A 1GBQA 3E9IA 2D1XA 1D0XA 1SRMA 1G8XA 1PYSB 1H4TA 1KG1A 3G6EQ 2F1LA 1GFCA 2C8MA 5CVIA 4HVUA 3OSVA 2ZNIA 3L42A 4M7AG 3NTHA 1YWOA 2DL8A 1W2BS 4DPGA 4M78G 4D6WA 5GANf 2ZAEA 5GMKi 5LJ3e 1U8RA 1Q81U 4ZGEB 1OPLA 3PZCA 3TQ7P 2J05A 3TCJA 1UUEA 2D6FA 2KRMA 4HT4A 3CC2Q 1WHHA 1VOMA 5D6WA 1W2BA 1OULA 2EAYA 2X3WD 1Q95G 1ABQA 3I5RA 3A5ZA 5LJ5d 2K3XA 4X34A 3JCMX 1BI3A 3SWNA 2ZPEB 1ZUUA 4QQDA 3O5ZA 3RKXA 2CDTA 1D3BA 2NUPB 3EG9B 4TTVA 1E7OA 1VQ7T 1V1CA 4Q6GA 2E5AA 4LVMA 2XIDA 1KQSP 2EQMA 3CC7Q 3GPLA 1RAEB 3LYIA 5D7UA 4ESRA 4AMCA 2FZCB 4M7DG 2OAUA 3HTRA 3RUXA 3RDVA 5CAIA 4C92D 1YFTA 2QI2A 2V26A 4F7UA 3Q1JA 4E6RA 1KHCA 1QWEA 8ATCB 2PTKA 5KYUB 1IB8A 1SESA 2GFUA 2VGMA 4M77D 3IKLA 2ECZA 4YRIA 4KR3A 4H2WA 2P4RA 2DLPA 3MEAA 1HSQA 2Q5IA 4XTVA 3QBYA 2Q5HA 5HK3A 5A0GA 2RPNA 4FYYB 2QA4T 2V8KA 4D8DA 3OS2A 1E6GA 4KBMB 5LL6S 2D8HA 2A7YA 5CKFA 3MEUA 4LVJA 2K2VA 3JB9F 2KEAA 3CMAQ 4FSSA 2LRQA 2EKOA 1HJDA 1GCPA 3CCQA 3AT1B 4J6YA 1VIFA 3OB9A 3OYBA 2XDBA 1QCNA 3LWHA 5C51B 2JTFA 3GNFB 1PKTA 2PUOB 1EQRA 4YPFA 3CCRQ 1K9MC 1NYQA 2BUDA 4D8KA 1RAGB 2RNAA 2QAZA 3CCEA 5CQYA 5IAYA 4TVYA 2NUPA 3EG9A 2DL4A 4M77E 5IHKA 4BI4A 3M0SA 1M8MA 2DXCA 1ZSZA 1USYA 2XHCA 2KDSA 4XTWA 4F7UE 2VB6A 5GAMe 3LW5E 2RM4A 4OGCA 2EGAA 1AHJB 5GAN8 2KBTA 3QKJA 1EVKA 1C6VX 1TSFA 5L23A 4PFOA 2XMFA 1UJ0A 3MO8A 3I55T 4QW2A 3REBB 1EOVA 1CKAA 3I55Q 3NEMA 2QHSA 2EGEA 2ZPIB 1GXIE 4OMMA 1KC8R 3LGFA 2M1HA 3QWYA 1NEBA 1D0YA 1VQLA 3OW2S 3JCMc 1VQKA 5CKBA 3M0PA 1JXOA 4EMKC 1B8AA 4NS5A 2ZZEA 4XAXB 2LC4A 3HTZA 2LMJA 3X24B 2PVOB 4E7HA 1NBEB 1V76A 3PIPA 2LNHB 1Q82U 3CD6Q 1ACMB 1M5Q1 1KD1C 1U3OA 2RA2A 3PNWC 4PJOF 2CREA 2CYZB 3PTAA 2X3XD 2C0TA 2ZZFA 1QLYA 1M2OA 1R77A 3VYHB 2EFIA 1BU1A 2QGGA 1DJ7B 1MGQA 2CH4A 3X28B 1C0MA 1AEYA 4XTUA 3PVLA 2FPEA 1SPKA 4P71C 1YIJQ 2PMFA 2ZCEA 3ASKA 4LXCA 2KT1A 3G4SA 4Z88A 4YCUA 5GJWB 1UHCA 2E6NA 2I0NA 4ZTJA 4HT9A 2G6FX 3CCMA 4UP9A 3ULRB 2EQUA 1K73U 2HSPA 2M02A 2CSQA 2ZGWA 2ROLA 1WNLA 2PZ1A 4PJOA 5FU7C 2ESWA 4P75C 3OYLA 2L89A 3CBMA 4P74A 4M7AB 1BBUA 1OI1A 2RHXA 1U1SA 4J6XA 3CCUT 3EGUA 2FPDA 2DL5A 3X25B 2QEXT 3PFSA 3I56T 4P3PA 2E41A 1NYFA 4M75A 3A7RA 1W2BP 3SWNC 2YRVA 1QVPA 4AFZC 2DU7A 1IGUA 4WCIA 1PYSA 2DIQA 4DEXA 1KQSA 5GAN2 4C8QF 3G71A 1X27A 2X51A 2P4TA 2RK2A 2WACA 2EVRA 2K3BA 3QPHA 1UDLA 2F5KA 3OMGA 4LNPA 4DOWA 4P3NA 5KE2A 1QCOA 1PG5B 1FMWA 2XTIA 2ATCB 2KR3A 3I5SA 1SG5A 1OZ2A 4OB1B 2MWOA 1TXQA 3J81E 1RAHB 1YITA 4YRJA 1UGPB 4C5EA 2VUBA 3EG0A 1T3SA 4MZMA 4N4GA 5KYUA 3BJUA 1AZGB 2K5FA 3JCMW 4PLLA 2CGHA 3IALA 5IHIA 4UP8A 4E7ZA 1M3CA 2NUTA 1Q82R 2LDMA 3O8VA 3VYGA 2H3EB 2K9GA 4TQFA 1H4VB 4DBFA 4P3OA 1M30A 4JUVA 3OS0A 1VYUA 4MDWA 4M77B 3RR6A 1PWTA 1NJ1A 3QUIA 4GLKA 2DK3A 1G83A 3G4ST 1KFZA 1M4ZA 2EPDA 1KQ2A 3E2UA 2KY9A 2EW3A 3UH0A 4LVLA 4DBHA 1A0NB 1J5WA 1YITQ 1K9AA 2K4YA 2YT6A 3FJPA 2P5IA 4JLIA 2C0OA 2RQVA 1RLQC 2D8JA 1Q81C 1K4US 2LQKA 5DLQE 1VQ6Q 2V1RA 3NFCA 1ASYA 3M0QA 1TWBA 1AWXA 1MV0B 1HTTA 3A8GB 3URGA 3PCOB 4M75E 3I56A 4KH0B 1O9SA 4XEMA 1AD5A 4M7DA 4MZPA 1WHMA 2NWMA 5LJ5f 1Q81R 1Q86R 4JJBA 3I35A 4YRQA 4RDXA 3M0UA 4XU3A 1ADJA 1VQ9Q 3T9NA 4J9CA 5DY9A 3MPUB 3CCJA 5ELNA 2ZPHB 1PNJA 4H2XB 3JSCA 3OYHA 1WX6A 1B7TA 3QO5A 2VGNA 4J83A 4OF1A 1FYFA 4M7DE 2JS0A 3OBWA
chains in the Genus database with same CATH topology
5LJ3j 3L2WA 1NJIC 4M77F 3HXYA 4TWAA 1QVGA 2JZ2A 3M54A 1LOJA 5CKDA 2QEXA 3HRIA 1R8OB 4TVAB 3LSQA 2G4CA 2NLUA 2WSFE 2Q7EA 5K1PA 4A53A 4UC4A 1WQWA 3RMQA 4ELYC 2ZINA 1NJ2A 4YDQA 4F7UG 2RB6A 1M1KU 4YRMA 1YJWA 1I5LA 2PVGB 3HXXA 3OYFA 5LJ3h 2Y4YA 3TUPA 5FU6C 5CKEA 4BY6B 4EX5A 5FLXE 3L4GB 4KR2A 4ZTZB 1BIAA 2DZ9A 4M75B 3FB9A 2RHYA 1USYC 5HK0A 2ALYA 3M4YA 3RKWA 4RCBA 2DJZA 4HT8A 3CCST 2KMTA 2RO0A 4RG2A 5A0LA 3HXZA 2XDPA 4P75A 2R5AA 4ZTFA 3OBYA 5CQXA 5FU6B 2EL9A 3SWNB 1N6AA 4N0AC 4C92E 4ATOA 1IREB 2RK1A 3BDLA 1YCYA 3LC0A 2CS7A 4C92B 5K1XA 2LQ8A 2ZIOA 4P71A 3G6EA 4CRIA 2P0PA 4WI1A 2AHJB 1NNHA 3VQWA 5FROA 3QG1A 4BDZA 4M78B 4VUBA 3A31A 5GANd 4N0AA 3X26B 1W4SA 5IT9E 1G3YA 1N9SA 5GAN6 1YIJT 1WGSA 2QQ9A 3QDRB 4L5GA 2DIGA 2XU8A 1B76A 1H3ZA 3REXA 4C8QE 3M59A 5HKCA 3UFGA 2HQEA 1VQKT 4J7FA 4O6JA 1YIJA 2RI3A 3S3MA 5GAOp 4WJ3M 4QQGA 2JNGA 2X4JA 1MHNA 1WU7A 1G51A 2CZ7B 1D3BB 3EFSA 2E1HA 4TVAA 3WVDB 1YFSA 3GF5A 3NENA 4Q5WA 1LNXA 2XD0A 3LWIA 3OYYA 2MWPA 2RJEA 4C5GA 2LT4A 5KH6A 1HXDA 4H2SA 3PGGA 1BYMA 1B34A 1N27A 4L87A 4YCWA 2OTJA 2QDYB 4XK8E 1VQNA 5LJ3f 3M4QA 1I4K1 4A4FA 4HKEA 4E7IA 4RMFA 2I4MA 5GANj 4HCCA 2E5QA 3HSBA 3CCSA 3QZ9B 3LX7A 1VQOA 1X55A 2LT1A 3OYEA 4LDVA 3V7RA 3HY1A 3CCRA 2O01E 2J3MA 2GFAA 3TEHB 2CIMA 1BI2A 1YJNT 3HFZA 1B7YB 3OY9A 4BI8B 1B70A 2FL7A 5LJ3g 3CD6A 4Y28E 3JCMe 3C95A 4TVRA 4GY5A 4BE1A 2GCXA 2RHZA 1X54A 4P74C 3PMIA 4MMLA 3FRNA 3P8VA 2ZCFB 3WVEB 3A8OB 3CC7T 3OW2A 3VU3C 3ZEHA 1G3WA 2CZ1B 4XTZA 12ASA 5GAOl 3MCAB 4BD3A 1QVGS 2L3RA 4A4GA 4FT4A 1TH7A 3A32A 4M7AF 3DLLA 4M7AC 3HFVA 3OA6A 2XI9A 4M78C 2RHIA 1YI2A 3M57A 2E10A 2X35A 2DXBA 4ZIBA 4JRQA 2R5MA 3LH0A 2EYQA 4LDWA 2CZ6B 2RJCA 5KNNA 3JB9D 1ZBXA 3IG2A 1ATIA 1EIYA 5FU7B 1VQMT 2VYTA 3HRKA 2DO3A 1Q82C 3QJ6A 1VQLT 2RHUA 4YRFA 2RJFA 4C0DB 4C92F 4FL6A 2ZPFB 3OYJA 3AHUA 4C92G 4BACA 1UGQB 1XNIA 4JRKA 2FB7A 4EMGA 3INZA 2E12A 1JJCA 1UGRB 4PL6A 2EIFA 1VQPT 3QJYA 4C5HA 3META 1EFWA 3DSQA 5GMKj 5CKHA 1P92A 1Q86C 1ZHIA 1VQZA 4YRCA 5GAMj 2E6ZA 3G71T 2DTOA 4AH6A 3CC2A 2ZXFA 4H2TA 3EFRA 1UB4A 1V29B 2RJDA 3S6WA 1NJIU 3FDRA 2DD4A 4IUPA 2DAQA 4CH3A 4XEOA 2H3JA 2QQSA 3CPFA 5AYFA 2LCCA 2KAFA 3P8TA 5C53B 4P5NA 3ICAA 2ZR2A 2V8IA 2XG8D 3A7AA 3JCMV 1YJNA 3JCMg 3HPWA 2XGTA 3CPWA 2OTLA 2QHTA 1M1GA 3JB9G 4G84A 4ZN1A 3P8HA 1Q86U 3OMCA 2K5LA 4XU1A 4HWSA 3P8BB 4OLFA 1X56A 4LDYA 2MF2A 4X9DA 3A5ZB 1M1KC 1QP3A 1SERA 2Y90A 4ZGDB 4HWRA 4BW9A 5I2MA 11ASA 3UWNA 3CCVT 4HA8A 5EG2A 4C5IA 4LDUA 2DXUA 2XDDA 2VC8A 1Y07A 3VKIA 4BUGA 4M7AA 3A8LB 3QZ5B 1K8AC 4BB7A 1G5IA 4C8QC 1G5HA 4CS3A 1M9SA 1VQ9A 4JRIA 1YFRA 3LGLA 2DPPB 2EJFA 1PSEA 1YJ9T 4OVAA 1JRIA 2JVVA 3MEWA 2I4NA 5GAOn 2LX9A 3VUBA 4NL3A 1KOGA 1VQOT 4RG8A 2XKOC 1QP2A 3CCRT 3MEVA 2CKKA 2M9UA 2QXFA 1VQ4A 2RHSA 3UGTA 4YRSA 1KMNA 2QQBA 3ZFJA 2E3CA 3A8MB 3CCET 4YTLA 4ZTUB 1WJQA 4C8QG 2CJAA 4E47A 2IY5B 4YRRA 3HY0A 4B9XA 2MAMA 5LJ5h 3I7FA 5LJ5j 1Y96B 4C0DC 4RKUE 4OGEA 1PSFA 4YRGA 4PNOA 3V8KA 1OZ3A 2DDZA 1XTDA 1B70B 3V7SA 5D6YA 3HFZB 4N4HA 4M7DF 2QQRA 4X5OA 4XU0A 2G3RA 2PQWA 2XK0A 2XICA 2X4YA 2ARTA 3A5YA 3DB4A 2K5IA 1VQ5A 3BFMA 3QHSA 4HCZA 3OS5A 4O2DA 3VQYA 3FIFA 4JJNK 1H641 5GAOq 5GAOm 4M75F 3HXWA 3UDCA 2K3YA 1I81A 4RQEA 4PHCA 4IURA 4M7DD 1B7YA 4NL2A 2EJGA 1K9MU 3CCLA 3L2VA 3CC4A 2I4LA 4K87A 1N8RC 1K73C 4B9WA 1VQ7A 4XQ3A 3RERA 5GANh 3SD4A 4PJOC 4QVZA 1ADYA 2JTMA 1N9RA 4YP0A 4PLIA 2DQ3A 2JN0A 3L2UA 2X4XA 4QVDA 5KCOA 1X75C 5DM7R 2ZPGB 2IVWA 5GMKe 3QO8A 1M8VA 2RI5A 3BY7A 4MMKA 4G85A 3KXTA 2O4XA 2Y4XA 4JRPA 4LD9K 3CMQA 2RH2A 4PG3A 3MHXA 1NYRA 5CR2A 5J26A 1C0AA 2QA4A 3OYIA 1NJ8A 5CIUA 4EO4A 3JCMh 2QHUA 3GIBA 3RESA 5GAN5 3DKMA 4M78F 2E65A 4J8OA 4PJOD 5J39A 2A8EA 3G6ET 2HNIA 4IUQA 4XTXA 5DLOA 1FX7A 2AKWA 3CXCA 4CH6A 1H4QA 3H6ZA 1I8FA 1VQ4T 4RCCA 4FIBA 2RI2A 5E3IA 3OYCA 3HFNA 4E7LA 1Q7YC 5GAOr 3QNEA 5KCHA 3HRSA 3OBWA 3RMSA 4V2SA 2FHDA 1KQSS 5ELOA 3VQXA 3ME9A 3M4PA 1KMMA 3JCMJ 4CS2A 5HY6A 2ODRD 2L5QA 4TVWA 4YROA 1G3SA 4PKCC 2DU5A 1VIEA 2V8JA 2E64A 2P0LA 5FRMA 2MI6A 2L8DA 3JCMQ 5GAMd 3A8HB 1QE0A 1WQ7A 1QVFS 1YITT 4YREA 3M9QA 4A4KA 1B34B 1YBYA 2MMPA 3BDUA 3A7UA 1O75A 3R6OA 2ZPBB 4KULA 3M56A 5GMKh 1XQHA 4KT0E 3SDZA 3QO3A 3QYHB 4EPCA 1N8RU 1UEBA 3VV0A 3JB9I 4O5VA 2LCLA 2C06A 2CJBA 2R57A 1W66A 1BI0A 4XTYA 2ZR3A 1BIBA 1U1TA 1NPPA 2LTOA 4H2UA 2PMEA 2GQVA 1VQNT 1BKBA 2VXFA 2YHTA 4MDXA 4PJOB 1YB3A 4CH4A 3HHTB 2DKGA 3L1AA 2RD1A 3C12A 4F7UF 4E7JA 2EQJA 3QXEB 4YRTA 4LDXA 1RL2A 4EMKB 3QSUA 3TU4K 3G7ZA 2ZIMA 4M75D 5GANg 3ZBDA 2KQWA 3VUZA 2DXTA 3BW1A 3HL8A 4CS4A 1G5VA 2WSEE 4M77G 3NETA 2M0OA 4OB0B 1KC8U 2WSCE 2O4XB 2OTLT 4P73C 3H8ZA 4M78E 1EIFA 4M7AE 4KUDK 2F69A 4HWTA 1NPRA 2FYKA 3J80E 4K88A 4FU6A 4ME7A 1Z7MA 3PIOA 2RHQB 4M78A 1K8AU 1IL2A 4OMFB 2ZT7A 1VQ8A 5GAN3 5IN1A 4MZTA 4QVCA 1YJWT 3MF1A 3NELA 3OS1A 1VQMA 3OYMA 1S72T 4HWPA 4PJOE 1JB0E 2DTIA 2DD5A 4BI3A 4X9CA 3P8DA 4JS4A 3ER0A 3V7CA 3EAEA 3M4GA 3FLGA 3CMAA 3HXVA 3RGLA 3QIIA 4OB2B 4F7UB 1BBWA 3UPUA 1X2GA 2ZTGA 2P0KA 2VV5A 3MP1A 4M75G 3OYNA 1NJ6A 5A2QE 3A74A 2ZT5A 3P8YA 3WQZA 3UT1A 1IZ6A 4C8QB 1M90U 2ARSA 4M77A 4WJ4A 4P72A 2BKDN 1YHQT 4H02A 4UP7A 2QHVA 5HGQA 1LYLA 3I55A 2YLBA 4JS5A 4BE0A 3KBGA 4CI0C 2AMCB 2EQKA 3RACA 4LVKA 2P0QA 3FC3A 1KQ1A 4YYEA 4HCBA 2EJ9A 5GAMf 4M7DB 3CC2T 1WPYA 3UGQA 4KUIA 4DA4A 3CCQT 1JJ2S 4H2XA 3G1ZA 3RL6A 4KQEA 4LD6A 3GLXA 3N5BB 1QW1A 2DTHA 3L2QA 3CBPA 2RHQA 1HC7A 3PT9A 4E7KA 1E1OA 1Q7YU 4PJOG 3OYGA 3M58A 3VBBA 1FXXA 2AKWB 2E70A 3MEYA 3C94A 3E9GA 2CZ0B 3CMEA 1SRYA 3R07A 5I2SA 1KHIA 4BDYA 3ERRA 3REUA 3JCMd 4A4EA 1UGSB 2HQXA 4R56A 1FWZA 3MQZA 3HKSA 3FEOA 1E1TA 3VQVA 2OTJT 1G3TA 2PU9B 3TEEA 5GANe 3CCVA 2JUFA 4E51A 3HP9A 1KD1U 5C0MA 4P72C 3RF1A 2I2LA 1VQ5T 3OYAA 5FRNA 5GMKm 1NE8A 3X20B 2Q7HA 1E22A 1RI0A 3C4SA 1WYDA 5C6SA 2C7IA 1QF6A 3HRTA 5GMKl 2D0QB 4C0FA 4J5YA 1QVFA 2M16A 1RIQA 2IG0A 3CCJT 3GP8A 2R58A 3E1SA 4C8QD 4H2YA 3OQ5A 3CC7A 4K86A 3PMTA 4Q15A 5KE3A 3JCMb 4FT2A 3JAME 4IUUA 1Y7XA 4EDUA 4A4HA 4J6WA 2Q7GA 4Z02A 5GAMh 5F5WA 4C92C 2ZZDA 1BI1A 5M9OA 1X2HA 1YJ9A 3LSSA 3E9HA 3CXCS 4YRPA 4XU2A 1YI2T 1SSFA 5GAN7 5J3BA 1L0WA 1VQ6T 2LVMA 1Y96A 1WJSA 2ODRC 2VXEA 4JDSA 2HBPA 3S3OA 4YCVA 3CPWS 3OSSC 3L2ZA 2YLCA 2EWNA 3E19A 2HAXA 4YRKA 3OD1A 2DZCA 1N9WA 2QQAA 4LNSA 5CK9A 3JB9H 3PCOA 3QO7A 3TEHA 2FVUA 1Z7NA 1ASZA 2CJ9A 4RQFA 4FM4B 1JJCB 4Y91A 2KSSA 3V8LA 3CEYA 1NZ9A 3CD6T 1YHQA 3SB2A 3LLRA 3CCLT 3HFOA 4IUVA 4A54A 4IKFA 4OP0A 4WF2A 4NOYA 3QYGB 2BIVA 2QTXA 3TREA 3JB9J 3KUFA 2PUKB 3L2RA 2J3LA 2AMCA 3NTKA 4BWAA 3CBOA 4RMOA 5CO7A 3CCUA 4BE2A 1M90C 4FSXA 3L4GA 3HRUA 1VQ9T 4NCXA 2JOYA 4M7DC 2ZT6A 2NS6A 3DLMA 3W3SA 3M53A 3RKYA 3WXMB 4EMKA 3CMAT 2A3LA 4YRLA 3F70A 4IUTA 5LJ3d 1YGBA 1VQ6A 4M7AD 2ZT8A 4J7IA 4II1A 2RHSB 4M78D 1KC8C 1ZQ1A 5D6XA 1WJRA 1S72A 3SFMA 4YRNA 3OYKA 5A0DA 3CCMT 4ZN3A 3M5AA 1OYXA 3MP8A 3NTIA 4N4IA 1VQPA 4H2VA 4ELZC 2B8AA 5LJ5g 3GOXA 4C92A 3GNGA 4JLGA 1LJOA 4R55A 4C0ZA 4P73A 3OYDA 2DEQA 2PVDB 3JRZA 1WLEA 3MP6A 3CMET 1JJ2A 3M55A 4DQ2A 4M77C 3RIRA 1NJ5A 2IY5A 1H4SA 2HD0A 1EIYB 1VQ8T 5I21A 3KFUA 2ZZGA 1Y71A 1EVLA 1X6OA 1XOVA 2ZNJA 2DVEA 4M75C 3HXUA 3DB3A 2GF7A 5C52B 4LVIA 4UPAA 4BY6C 2D9TA 1SETA 4EMHA 4DOVA 3TEGA 4L59A 4QQ6A 2ALYB 3J7AF 1VUBA 4L6V5 1JBMA 5CCAA 4J15A 3JCMf 2F5TX 3MF2A 4CH5A 1HK9A 4ZGJB 2KK4A 3IKMB 4C0GA 1GGMA 3VJPA 4C8QA 3S3NA 1E24A 4TQDA 2X4WA 1M1FA 2KVQG 3E9FA 4OB3B 2I4OA 2LNVA 4HWOA 5L8RE 3V8JA 5GAMg 5GAN4 3CC4T 1X01A 2ARUA 3QTCA 4HVCA 3JCMP 5LJ5e 2DQ0A 2K57A 3E9IA 1PYSB 1H4TA 1KG1A 2C8MA 5CVIA 3OSVA 2ZNIA 3L42A 4M7AG 3NTHA 1W2BS 4DPGA 4M78G 4D6WA 5GANf 5GMKi 5LJ3e 1U8RA 1Q81U 4ZGEB 3PZCA 3TCJA 2D6FA 4HT4A 1W2BA 5D6WA 2EAYA 3A5ZA 5LJ5d 2K3XA 4X34A 3JCMX 1BI3A 3SWNA 2ZPEB 4QQDA 3RKXA 1D3BA 4TTVA 1VQ7T 4Q6GA 2E5AA 4LVMA 2XIDA 2EQMA 3GPLA 3LYIA 4M7DG 2OAUA 3RUXA 5CAIA 4C92D 1YFTA 2QI2A 4F7UA 3Q1JA 1KHCA 1SESA 2GFUA 2VGMA 4M77D 3IKLA 4YRIA 4KR3A 4H2WA 3MEAA 2Q5IA 4XTVA 3QBYA 2Q5HA 5HK3A 5A0GA 2V8KA 3OS2A 4KBMB 5LL6S 2A7YA 5CKFA 3MEUA 4LVJA 2K2VA 3JB9F 2LRQA 2EKOA 3CCQA 4J6YA 1VIFA 3OB9A 3OYBA 2XDBA 3LWHA 5C51B 2JTFA 3GNFB 2PUOB 1EQRA 4YPFA 1K9MC 1NYQA 2BUDA 3CCEA 5CQYA 5IAYA 4TVYA 4M77E 4BI4A 2DXCA 1USYA 2XHCA 2KDSA 4XTWA 4F7UE 5GAMe 3LW5E 2RM4A 4OGCA 1AHJB 5GAN8 3QKJA 1EVKA 3MO8A 3I55T 4QW2A 1EOVA 3NEMA 2QHSA 2ZPIB 1GXIE 3LGFA 2M1HA 1VQLA 3OW2S 3JCMc 1VQKA 5CKBA 4EMKC 1B8AA 2ZZEA 4NS5A 4XAXB 2LC4A 3HTZA 3X24B 2PVOB 4E7HA 3PIPA 1Q82U 1M5Q1 1KD1C 3PNWC 2RA2A 4PJOF 2CYZB 3PTAA 2ZZFA 3VYHB 2EFIA 1DJ7B 1MGQA 3X28B 4XTUA 4P71C 2PMFA 2ZCEA 3ASKA 3G4SA 4YCUA 2E6NA 4ZTJA 4HT9A 3CCMA 4UP9A 2EQUA 1K73U 2ZGWA 1WNLA 4PJOA 5FU7C 4P75C 3OYLA 2L89A 3CBMA 4P74A 4M7AB 1BBUA 1OI1A 2RHXA 1U1SA 4J6XA 3CCUT 3X25B 2QEXT 3PFSA 3I56T 4P3PA 2E41A 4M75A 3A7RA 3SWNC 2YRVA 1QVPA 2DU7A 1PYSA 2DIQA 1KQSA 5GAN2 4C8QF 3G71A 2P4TA 2RK2A 2WACA 3QPHA 2F5KA 3OMGA 4DOWA 4P3NA 5KE2A 2XTIA 1OZ2A 4OB1B 2MWOA 3J81E 1YITA 4YRJA 1UGPB 4C5EA 2VUBA 4MZMA 4N4GA 3BJUA 2K5FA 3JCMW 4PLLA 2CGHA 3IALA 4UP8A 2LDMA 3O8VA 3VYGA 4TQFA 1H4VB 4P3OA 4JUVA 3OS0A 4MDWA 4M77B 1NJ1A 3QUIA 4GLKA 2DK3A 3G4ST 1M4ZA 1KQ2A 2KY9A 3UH0A 4LVLA 1J5WA 2K4YA 3FJPA 2P5IA 4JLIA 1Q81C 2LQKA 5DLQE 3NFCA 1ASYA 1HTTA 3A8GB 3URGA 3PCOB 4M75E 3I56A 1O9SA 4XEMA 4M7DA 4MZPA 5LJ5f 4YRQA 4RDXA 4XU3A 1ADJA 3T9NA 5DY9A 3CCJA 5ELNA 2ZPHB 4H2XB 3JSCA 3OYHA 3QO5A 2VGNA 4J83A 4OF1A 1FYFA 4M7DE 2QA4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 j;  3HXU A;  4HWP A;  1SER A;  2Y90 A;  4PJO E;  4HWR A;  4BW9 A;  5C52 B;  4M77 F;  2DTI A;  3HXY A;  4TWA A;  4UPA A;  11AS A;  4HA8 A;  1LOJ A;  1SET A;  2DXU A;  4X9C A;  3HRI A;  2VC8 A;  3V7C A;  4TVA B;  4EMH A;  3LSQ A;  2G4C A;  3M4G A;  3TEG A;  2Q7E A;  5K1P A;  4M7A A;  3HXV A;  4A53 A;  2ALY B;  3RGL A;  1WQW A;  1JBM A;  1G5I A;  2ZIN A;  4C8Q C;  1G5H A;  4J15 A;  4CS3 A;  3JCM f;  4F7U B;  3MF2 A;  1NJ2 A;  4CH5 A;  4YDQ A;  4JRI A;  1BBW A;  4F7U G;  1YFR A;  1HK9 A;  2RB6 A;  1X2G A;  2ZTG A;  3IKM B;  4YRM A;  1I5L A;  1GGM A;  4C8Q A;  4M75 G;  2EJF A;  1NJ6 A;  1E24 A;  4TQD A;  3HXX A;  3A74 A;  2ZT5 A;  1JRI A;  2I4N A;  5LJ3 h;  2I4O A;  5GAO n;  4HWO A;  3V8J A;  3TUP A;  4NL3 A;  3P8Y A;  3WQZ A;  5GAM g;  1KOG A;  4C8Q B;  2ARS A;  4M77 A;  5GAN 4;  4P72 A;  4EX5 A;  4WJ4 A;  1X01 A;  3L4G B;  2ARU A;  3QTC A;  4HVC A;  4H02 A;  4KR2 A;  4UP7 A;  4ZTZ B;  1BIA A;  2DZ9 A;  4M75 B;  2QHV A;  3JCM P;  5LJ5 e;  2DQ0 A;  5HGQ A;  1LYL A;  2K57 A;  3E9I A;  2YLB A;  3FB9 A;  1USY C;  2ALY A;  2AMC B;  3RKW A;  4RCB A;  1PYS B;  2DJZ A;  1H4T A;  2RHS A;  3UGT A;  4YRS A;  1KMN A;  2C8M A;  4HT8 A;  3RAC A;  2ZNI A;  4M7A G;  4DPG A;  4M78 G;  5GAN f;  2E3C A;  1KQ1 A;  4YYE A;  5GMK i;  5LJ3 e;  3HXZ A;  2EJ9 A;  3PZC A;  5GAM f;  4M7D B;  4ZTU B;  4P75 A;  4C8Q G;  2CJA A;  1WPY A;  3UGQ A;  2IY5 B;  2EL9 A;  4YRR A;  3SWN B;  2EAY A;  4N0A C;  4C92 E;  3HY0 A;  3A5Z A;  5LJ5 d;  5LJ5 h;  3I7F A;  5LJ5 j;  1YCY A;  1Y96 B;  4H2X A;  3LC0 A;  3JCM X;  3G1Z A;  3RL6 A;  3SWN A;  4C92 B;  5K1X A;  4KQE A;  4YRG A;  4PNO A;  2ZIO A;  3V8K A;  3RKX A;  4P71 A;  2DDZ A;  1D3B A;  4WI1 A;  4TTV A;  2DTH A;  1NNH A;  3VQW A;  1B70 B;  3V7S A;  4Q6G A;  3HFZ B;  4M78 B;  4M7D F;  2E5A A;  4X5O A;  4XU0 A;  3A31 A;  2RHQ A;  1HC7 A;  5GAN d;  4N0A A;  1E1O A;  4PJO G;  3VBB A;  2AKW B;  1N9S A;  4M7D G;  2ART A;  3MEY A;  5GAN 6;  3A5Y A;  3RUX A;  5CAI A;  3BFM A;  4C92 D;  3QHS A;  1YFT A;  1B76 A;  1SRY A;  3R07 A;  4O2D A;  3VQY A;  4F7U A;  3REX A;  4C8Q E;  3FIF A;  3UFG A;  1H64 1;  1SES A;  3ERR A;  4M77 D;  3IKL A;  3REU A;  4YRI A;  4KR3 A;  5GAO q;  4H2W A;  5GAO m;  4M75 F;  3HXW A;  5GAO p;  1I81 A;  3JCM d;  2Q5I A;  4RQE A;  4XTV A;  2Q5H A;  4WJ3 M;  4PHC A;  4M7D D;  1B7Y A;  4NL2 A;  2EJG A;  1WU7 A;  1G51 A;  2I4L A;  4K87 A;  1D3B B;  1E1T A;  3VQV A;  3EFS A;  5GAN e;  4XQ3 A;  3RER A;  2E1H A;  4E51 A;  5GAN h;  4TVA A;  4PJO C;  1YFS A;  1ADY A;  3NEN A;  4P72 C;  3RF1 A;  2I2L A;  1LNX A;  3JB9 F;  1N9R A;  5GMK m;  4YP0 A;  2Q7H A;  1E22 A;  2DQ3 A;  2JN0 A;  1WYD A;  4J6Y A;  4QVD A;  2C7I A;  1QF6 A;  1HXD A;  4H2S A;  3PGG A;  5GMK e;  3QO8 A;  5C51 B;  1B34 A;  1EQR A;  1M8V A;  5GMK l;  4YPF A;  1NYQ A;  4J5Y A;  4L87 A;  4YCW A;  3BY7 A;  4MMK A;  1RIQ A;  4G85 A;  4TVY A;  4M77 E;  3CMQ A;  1USY A;  4PG3 A;  5LJ3 f;  4C8Q D;  3M4Q A;  4H2Y A;  4K86 A;  1I4K 1;  4XTW A;  4F7U E;  5GAM e;  4Q15 A;  4RMF A;  2RM4 A;  2I4M A;  1NYR A;  3JCM b;  5GAN j;  5GAN 8;  1EVK A;  3HSB A;  1C0A A;  1NJ8 A;  4EO4 A;  1X55 A;  3JCM h;  2QHU A;  3GIB A;  1EOV A;  3NEM A;  2QHS A;  4J6W A;  3RES A;  5GAN 5;  3V7R A;  2Q7G A;  3HY1 A;  5GAM h;  4M78 F;  5F5W A;  2E65 A;  4C92 C;  2J3M A;  3TEH B;  3JCM c;  2CIM A;  4PJO D;  4EMK C;  1B8A A;  2HNI A;  4XTX A;  2ZZE A;  3HFZ A;  1B7Y B;  2AKW A;  3HTZ A;  1B70 A;  5LJ3 g;  1X2H A;  4CH6 A;  1H4Q A;  3JCM e;  1I8F A;  4RCC A;  1X54 A;  3LSS A;  1M5Q 1;  3E9H A;  2RA2 A;  4P74 C;  4MML A;  4PJO F;  4YRP A;  3P8V A;  4XU2 A;  2ZZF A;  5E3I A;  5GAN 7;  1MGQ A;  1L0W A;  3VU3 C;  3HFN A;  4XTZ A;  12AS A;  1Y96 A;  4XTU A;  5GAO r;  3QNE A;  5GAO l;  2ODR C;  4P71 C;  2VXE A;  4V2S A;  2PMF A;  4YCV A;  5ELO A;  2ZCE A;  1TH7 A;  3VQX A;  3L2Z A;  2YLC A;  2EWN A;  3M4P A;  1KMM A;  3JCM J;  3A32 A;  4YRK A;  4YCU A;  3OD1 A;  4M7A F;  4CS2 A;  2DZC A;  4HT9 A;  2ODR D;  4UP9 A;  4M7A C;  4TVW A;  4YRO A;  3HFV A;  1N9W A;  2DU5 A;  4LNS A;  4M78 C;  3JB9 H;  2ZGW A;  3PCO A;  3QO7 A;  1WNL A;  3TEH A;  4PJO A;  1Z7N A;  2E10 A;  1ASZ A;  2E64 A;  2P0L A;  4ZIB A;  2CJ9 A;  4RQF A;  4P75 C;  3JCM Q;  1JJC B;  4Y91 A;  4P74 A;  4M7A B;  3V8L A;  1BBU A;  5GAM d;  3SB2 A;  5KNN A;  1QE0 A;  1U1S A;  4J6X A;  1WQ7 A;  3JB9 D;  3HFO A;  1ATI A;  3IG2 A;  4YRE A;  1EIY A;  4A54 A;  4P3P A;  2E41 A;  1B34 B;  4OP0 A;  4WF2 A;  3HRK A;  4NOY A;  3BDU A;  2QTX A;  3A7U A;  4M75 A;  3JB9 J;  3A7R A;  4YRF A;  3SWN C;  2DU7 A;  2J3L A;  2AMC A;  5GMK h;  4C92 F;  1PYS A;  4BWA A;  3QO3 A;  5GAN 2;  3JB9 I;  4C8Q F;  3AHU A;  2CJB A;  4C92 G;  3L4G A;  1W66 A;  4JRK A;  2FB7 A;  4XTY A;  2ZR3 A;  4NCX A;  4P3N A;  4EMG A;  1BIB A;  1U1T A;  3INZ A;  4M7D C;  2ZT6 A;  1JJC A;  2XTI A;  4H2U A;  2PME A;  3W3S A;  3RKY A;  2VXF A;  2YHT A;  4EMK A;  4PJO B;  1YB3 A;  4CH4 A;  2DKG A;  3L1A A;  2RD1 A;  4YRL A;  5LJ3 d;  1YGB A;  4F7U F;  4YRJ A;  4M7A D;  4YRT A;  2ZT8 A;  4M78 D;  2RHS B;  3BJU A;  3JCM W;  1EFW A;  3DSQ A;  4EMK B;  2CGH A;  3IAL A;  3QSU A;  4UP8 A;  5GMK j;  1VQZ A;  4YRC A;  5GAM j;  2ZIM A;  4M75 D;  5GAN g;  2DTO A;  4TQF A;  4AH6 A;  4YRN A;  1H4V B;  4P3O A;  2DXT A;  3BW1 A;  4JUV A;  2ZXF A;  4CS4 A;  4H2T A;  4M77 B;  3EFR A;  1NJ1 A;  3QUI A;  4M77 G;  3NET A;  4H2V A;  1KQ2 A;  3UH0 A;  4CH3 A;  4P73 C;  4XEO A;  4M78 E;  1J5W A;  5LJ5 g;  3FJP A;  2P5I A;  4JLI A;  4C92 A;  4M7A E;  1LJO A;  3P8T A;  5C53 B;  3ICA A;  1ASY A;  4HWT A;  4P73 A;  2ZR2 A;  1HTT A;  2DEQ A;  3A7A A;  2FYK A;  1WLE A;  3JCM V;  4K88 A;  3PCO B;  3JCM g;  2XGT A;  4M75 E;  4DQ2 A;  1Z7M A;  4M77 C;  4XEM A;  2RHQ B;  4M7D A;  2QHT A;  3JB9 G;  4G84 A;  3RIR A;  4M78 A;  1IL2 A;  1NJ5 A;  2IY5 A;  1H4S A;  5LJ5 f;  1EIY B;  4YRQ A;  4RDX A;  2ZT7 A;  4XU1 A;  4XU3 A;  4HWS A;  5I21 A;  1ADJ A;  3KFU A;  2ZZG A;  5GAN 3;  1EVL A;  5DY9 A;  5ELN A;  4QVC A;  4OLF A;  1X56 A;  4H2X B;  3MF1 A;  2ZNJ A;  3NEL A;  3QO5 A;  4X9D A;  2DVE A;  1FYF A;  4M7D E;  4M75 C; 
#chains in the Genus database with same CATH topology
 5LJ3 j;  1YN8 A;  3L2W A;  1LVK A;  1NJI C;  3CC4 Q;  4M77 F;  3HXY A;  4TWA A;  1K73 R;  3CCV Q;  1QVG A;  2JZ2 A;  3M54 A;  1LOJ A;  5CKD A;  2QEX A;  3HRI A;  1R8O B;  2Z0W A;  4TVA B;  2RQU A;  3LSQ A;  1MMN A;  2FG0 A;  2G4C A;  1ZSG A;  2NLU A;  2WSF E;  2Q7E A;  5K1P A;  3RNJ A;  4A53 A;  4UC4 A;  1WQW A;  4F14 A;  1ZA1 B;  3RMQ A;  4ELY C;  2ZIN A;  1NJ2 A;  4YDQ A;  4FYX B;  4F7U G;  2RB6 A;  1M1K U;  2DNU A;  4YRM A;  2QGF B;  1YJW A;  1I5L A;  2PVG B;  2DL3 A;  3HXX A;  3OYF A;  5LJ3 h;  2Y4Y A;  3MJX A;  3TUP A;  5FU6 C;  5CKE A;  4BY6 B;  2EYY A;  4EX5 A;  5FLX E;  1Q7Y R;  1AOJ A;  3L4G B;  4KR2 A;  3REA B;  4ZTZ B;  1BIA A;  2DZ9 A;  4M75 B;  3FB9 A;  2RHY A;  1USY C;  1X69 A;  5HK0 A;  2ALY A;  3M4Y A;  3RKW A;  4RCB A;  1MMD A;  2DJZ A;  3VS2 A;  1IRX A;  2FZK B;  1WIE A;  1KJW A;  4HT8 A;  3CCS T;  4J9G A;  2A37 A;  3VS6 A;  2KMT A;  2RO0 A;  4RG2 A;  5A0L A;  2CT4 A;  3HXZ A;  3JV3 A;  2XDP A;  1FMV A;  1PHT A;  4P75 A;  2B86 A;  2R5A A;  4CC4 B;  1AZE A;  4ZTF A;  1U06 A;  3OBY A;  1AVZ C;  5CQX A;  5FU6 B;  2EL9 A;  3EG1 A;  3SWN B;  4PFZ A;  1N6A A;  4N0A C;  1KK7 A;  4C92 E;  4ATO A;  1IRE B;  2RK1 A;  3BDL A;  1YCY A;  3LC0 A;  2CS7 A;  3UF4 A;  4C92 B;  5K1X A;  1OEB A;  2LQ8 A;  2ZIO A;  2QTV A;  4P71 A;  3G6E A;  4OMO A;  2LJ3 A;  4CRI A;  2P0P A;  4WI1 A;  2AHJ B;  2JS2 A;  1NNH A;  3VQW A;  4FYV B;  5FRO A;  2OI3 A;  1VQ7 Q;  3QG1 A;  4BDZ A;  4M78 B;  4VUB A;  3A31 A;  5GAN d;  4N0A A;  3X26 B;  1W4S A;  5IT9 E;  1G3Y A;  1N9S A;  2AK5 A;  1JEG A;  5GAN 6;  1SKU B;  1YIJ T;  1WGS A;  2QQ9 A;  2JMC A;  2FO0 A;  3QDR B;  4L5G A;  1JQQ A;  2KE9 A;  2DIG A;  2XU8 A;  1B76 A;  1H3Z A;  2CSI A;  2DFU A;  3REX A;  4C8Q E;  3M59 A;  5HKC A;  1H3H A;  3UFG A;  2HQE A;  1VQK T;  4F16 A;  4J7F A;  4O6J A;  1YIJ A;  2RI3 A;  2FPF A;  3S3M A;  5GAO p;  1WXB A;  1QCF A;  4WJ3 M;  3M0R A;  4QQG A;  3G4S Q;  2JNG A;  2X4J A;  1MHN A;  3NGP A;  1WU7 A;  1G51 A;  2CZ7 B;  1D3B B;  4OMQ A;  3EFS A;  2OTL Q;  2E1H A;  2O88 A;  4TVA A;  3WVD B;  1YFS A;  3GF5 A;  3NEN A;  4Q5W A;  2CUD A;  1LNX A;  2XD0 A;  3LWI A;  2DVJ A;  5KYN A;  3OYY A;  2HKQ B;  2MWP A;  2RJE A;  4C5G A;  3CME Q;  1MND A;  2LT4 A;  5KH6 A;  1HXD A;  4H2S A;  3PGG A;  1BYM A;  1B34 A;  1N27 A;  1AWO A;  4L87 A;  4YCW A;  2OTJ A;  2EBP A;  2QDY B;  4XK8 E;  1VQN A;  1SEM A;  5LJ3 f;  3M4Q A;  1I4K 1;  4A4F A;  2K6D A;  4LUD A;  4HKE A;  4E7I A;  4RMF A;  1ZUK A;  2I4M A;  1WZO A;  5GAN j;  2CUB A;  4HCC A;  2E5Q A;  3HSB A;  4PJN A;  2A36 A;  3CCS A;  1RLP C;  3QZ9 B;  3LX7 A;  1VQO A;  1X55 A;  3EH1 A;  4AG2 C;  2LT1 A;  3OYE A;  4LDV A;  3V7R A;  2VAS A;  1EFN A;  3HY1 A;  3CCR A;  2O01 E;  1SHG A;  2KXC A;  2J3M A;  1TG0 A;  2GFA A;  3TEH B;  2CIM A;  2HDA A;  2J6O A;  2DYB A;  1BI2 A;  4HXJ A;  4KGV B;  4AFU C;  1YJN T;  1TUD A;  1B7Y B;  3OY9 A;  3HFZ A;  4BI8 B;  1B70 A;  2FL7 A;  2L3S A;  5LJ3 g;  3CD6 A;  3PE0 A;  4Y28 E;  3JCM e;  3C95 A;  4TVR A;  4GY5 A;  4BE1 A;  2GCX A;  2RHZ A;  1X54 A;  4P74 C;  3PMI A;  4MML A;  3FRN A;  2QEX Q;  3P8V A;  2ZCF B;  3WVE B;  1X6G A;  3A8O B;  3CC7 T;  3OW2 A;  3VU3 C;  3ZEH A;  1G3W A;  3NHN A;  2CZ1 B;  4XTZ A;  12AS A;  5GAO l;  2OX7 A;  3MCA B;  4BD3 A;  1QVG S;  2L3R A;  4A4G A;  4FT4 A;  1TH7 A;  3A32 A;  2MOX A;  4M7A F;  1SHF A;  3DLL A;  4M7A C;  2O2O A;  5IHN A;  3HFV A;  4F04 B;  3OA6 A;  2XI9 A;  4M78 C;  2RHI A;  1YI2 A;  1QQJ A;  3M57 A;  2E10 A;  3VS0 A;  2X35 A;  2DXB A;  4ZIB A;  4JRQ A;  2R5M A;  3LH0 A;  2KRS A;  4E2F B;  2EYQ A;  4LDW A;  1UJY A;  3U23 A;  2CZ6 B;  2QA4 Q;  2RJC A;  5KNN A;  2HL3 A;  3JB9 D;  1ZBX A;  2EQI A;  1ATI A;  3IG2 A;  1EIY A;  1RAA B;  5FU7 B;  2A28 A;  1VQM T;  3R6N A;  2VYT A;  3HRK A;  2DO3 A;  1Q82 C;  3QJ6 A;  1VQL T;  2RHU A;  1X2Q A;  4YRF A;  2RJF A;  4C0D B;  2CP3 A;  3EGD B;  4C92 F;  4FL6 A;  8AT1 B;  2ZPF B;  3OYJ A;  4DEY A;  3AHU A;  2VVK A;  2X9H A;  1ZA2 B;  4C92 G;  4BAC A;  1UGQ B;  1XNI A;  4JRK A;  2FB7 A;  2KT8 A;  4EMG A;  2HSE B;  3INZ A;  2DEU A;  2C0I A;  2E12 A;  1JJC A;  1RAD B;  1UGR B;  4PL6 A;  2EIF A;  1H8K A;  2QYZ A;  2HQH A;  1VQP T;  1WHG A;  3QJY A;  1YCS B;  4C5H A;  2J06 A;  3MET A;  1EFW A;  3DSQ A;  3CQT A;  5GMK j;  5CKH A;  1P92 A;  1Q86 C;  1ZHI A;  3EG2 A;  1VQZ A;  5HCK A;  2E6Z A;  5GAM j;  4YRC A;  1H92 A;  3G71 T;  2DTO A;  3BE3 A;  4AH6 A;  1VYV A;  2CP5 A;  3CC2 A;  2ZXF A;  2DM1 A;  4H2T A;  1BCM A;  3EFR A;  1UB4 A;  3S6W A;  1V29 B;  2RJD A;  1NJI U;  1D1A A;  4KH1 B;  1OPK A;  1GRI A;  2BZY A;  3FDR A;  2DD4 A;  4IUP A;  2DAQ A;  4CH3 A;  4XEO A;  2H3J A;  2J6K A;  4ZNX A;  2QQS A;  3EH2 A;  3CPF A;  5AYF A;  3VS1 A;  2JMA A;  1OU9 A;  2LCC A;  2KAF A;  3P8T A;  5C53 B;  4P5N A;  3ICA A;  4PJJ A;  2ZR2 A;  2V8I A;  2XG8 D;  3A7A A;  4FYW B;  4OMP A;  1QKW A;  3JCM V;  1YJN A;  3JCM g;  3HPW A;  2XGT A;  3EGD A;  3CPW A;  2OTL A;  2QHT A;  3ZL7 C;  1M1G A;  3JB9 G;  4G84 A;  4ZN1 A;  2J7I A;  3P8H A;  1Q86 U;  3OMC A;  2K5L A;  4XU1 A;  4HWS A;  3CCJ Q;  3P8B B;  1PRM C;  2COW A;  1JJ2 P;  3CPW P;  4OLF A;  1X56 A;  4LDY A;  2MF2 A;  4X9D A;  3A5Z B;  1M1K C;  2KRO A;  1QP3 A;  1SER A;  2LQN A;  2Y90 A;  1WLP B;  4ZGD B;  4HWR A;  3EFO B;  4BW9 A;  5I2M A;  1RAF B;  11AS A;  3UWN A;  3CCV T;  4HA8 A;  5EG2 A;  5FWC A;  4C5I A;  4LDU A;  2DXU A;  2XDD A;  2VC8 A;  4JJC A;  1Y07 A;  3VKI A;  4BUG A;  4M7A A;  3A8L B;  1M3B A;  5IXF A;  3QZ5 B;  1K8A C;  2A0F B;  4BB7 A;  1G5I A;  4J9E A;  2ED1 A;  4C8Q C;  1G5H A;  2DBM A;  4CS3 A;  1M9S A;  1VQ9 A;  4JRI A;  1YFR A;  3LGL A;  2DPP B;  3LH5 A;  3CCE Q;  4J9D A;  2EJF A;  2NUT B;  1M1K R;  1OV3 A;  2ROT A;  1D09 B;  1PSE A;  5GJV B;  1YJ9 T;  1YJ9 Q;  4OVA A;  1JRI A;  2JVV A;  3MEW A;  2I4N A;  5GAO n;  2LX9 A;  3VUB A;  4F17 A;  1S72 Q;  1T0J A;  4NL3 A;  1VQO T;  1KOG A;  1WDX A;  2XKO C;  4RG8 A;  1QP2 A;  3CCR T;  3MEV A;  5IXB A;  1OX8 A;  2CKK A;  1QVF P;  5KYW A;  2M9U A;  2QXF A;  4J9H A;  1VQ4 A;  2RHS A;  2L3P A;  3UGT A;  4YRS A;  1KMN A;  2SEM A;  1B07 A;  2NYS A;  2QQB A;  3VS3 A;  1UE9 A;  2J6F A;  3ZFJ A;  3TSW A;  2L0A A;  3VS5 A;  1R0B G;  2E3C A;  3A8M B;  3CCL Q;  4DBQ A;  3CCE T;  4YTL A;  4OML A;  4CC7 A;  1VA7 A;  4ZTU B;  1X2K A;  1WJQ A;  4C8Q G;  2CJA A;  4E47 A;  2AT1 B;  2IY5 B;  4YRR A;  3M0T A;  4RUG A;  5EC7 A;  2CT3 A;  1BB9 A;  1AWJ A;  4HVW A;  3HY0 A;  4B9X A;  2MAM A;  5LJ5 h;  3I7F A;  5LJ5 j;  1Y96 B;  4C0D C;  4RKU E;  4OGE A;  2JTE A;  1PSF A;  4WTO B;  4PNO A;  3UAT A;  4YRG A;  3V8K A;  4E7S A;  1B3Q A;  3PVQ A;  5I22 A;  1OZ3 A;  2DDZ A;  1XTD A;  1S1N A;  1W70 A;  3A98 A;  1B70 B;  2QG9 B;  3V7S A;  2EYW A;  5D6Y A;  3HFZ B;  4N4H A;  2HBW A;  4M7D F;  1IGQ A;  2QQR A;  4X5O A;  4XU0 A;  2G3R A;  2PQW A;  2XK0 A;  2CP2 A;  2XIC A;  2MYS A;  1VYT A;  2X4Y A;  2ART A;  3A5Y A;  3DB4 A;  2K5I A;  2F2V A;  1UG1 A;  2NUZ A;  1VQ5 A;  3BFM A;  3QHS A;  4HCZ A;  1KIK A;  1NYG A;  2BTT A;  3OS5 A;  3VRZ A;  4O2D A;  3VQY A;  3FIF A;  2CP6 A;  4JJN K;  1H64 1;  2MIO A;  1QMC A;  2VKN A;  2FEI A;  5GAO q;  2DIL A;  5GAO m;  2ENM A;  3QWX X;  4M75 F;  3HXW A;  3UDC A;  2K3Y A;  1I81 A;  4RQE A;  2GBQ A;  4CC3 A;  4PHC A;  3MKD A;  4IUR A;  3H0H A;  4M7D D;  1B7Y A;  4NL2 A;  2EJG A;  1K9M U;  3CCL A;  3L2V A;  3CC4 A;  2I4L A;  4K87 A;  5FW9 A;  1N8R C;  1K73 C;  3SHW A;  4B9W A;  4XQ3 A;  1VQ7 A;  3RER A;  2E3I A;  5GAN h;  3SD4 A;  3I56 Q;  4PJO C;  4PK4 A;  4QVZ A;  1ADY A;  2JTM A;  7AT1 B;  2AZS A;  4M4Z A;  2CP7 A;  1N9R A;  1VQP Q;  1N5Z A;  2QAS A;  2CH4 W;  4YP0 A;  4PLI A;  2DQ3 A;  2JN0 A;  4JZ3 A;  3L2U A;  2X4X A;  4QVD A;  5KCO A;  1X75 C;  1YNZ A;  5DM7 R;  2ZPG B;  1F1B B;  2IVW A;  1ZSZ B;  5GMK e;  3QO8 A;  2DX1 A;  1M8V A;  2YWW A;  2RI5 A;  2RQW A;  3BY7 A;  1PKS A;  4MMK A;  4G85 A;  3KXT A;  2O4X A;  2Y4X A;  4JRP A;  4LD9 K;  3CMQ A;  2RH2 A;  3MHX A;  4PG3 A;  1WXU A;  2DMO A;  1NYR A;  5CR2 A;  4OMN A;  5J26 A;  3EG3 A;  2F2X A;  1C0A A;  2QA4 A;  3OYI A;  1NJ8 A;  5CIU A;  4EO4 A;  4J9I A;  3JCM h;  1YP5 A;  2QHU A;  3GIB A;  1WHK A;  3I9Q A;  3RES A;  1ZX6 A;  5GAN 5;  1K76 A;  3DKM A;  1MMG A;  1TUC A;  2SRC A;  4M78 F;  2E65 A;  2FZG B;  3VRY A;  1XJW B;  4J8O A;  1FYN A;  2E5K A;  4PJO D;  5J39 A;  2A8E A;  3G6E T;  2HNI A;  4IUQ A;  4XTX A;  5DLO A;  4J9B A;  1WXT A;  1FX7 A;  2AKW A;  3CXC A;  4CH6 A;  1GL5 A;  4RTT A;  1H4Q A;  3H6Z A;  1QKX A;  1I8F A;  1OOT A;  2RQT A;  1VQ4 T;  4RCC A;  4FIB A;  2JXB A;  2RI2 A;  2HKN A;  5KYW B;  2LQW A;  4RTV A;  5E3I A;  3TVT A;  3OYC A;  1M27 C;  3HFN A;  4E7L A;  1Q7Y C;  4PJM A;  5GAO r;  3QNE A;  5KCH A;  3UA7 A;  3HRS A;  3RMS A;  4V2S A;  2FHD A;  4AFS C;  1KQS S;  5ELO A;  3VQX A;  3ME9 A;  2ABL A;  3M4P A;  2AKK A;  3JCM J;  1KMM A;  4CS2 A;  1AT1 B;  5HY6 A;  2ODR D;  1I0C A;  2L5Q A;  4TVW A;  4YRO A;  1G3S A;  2E3H A;  4PKC C;  2DU5 A;  1VIE A;  2V8J A;  3H41 A;  2E64 A;  2P0L A;  2YUP A;  5FRM A;  1MNE A;  2MI6 A;  2L8D A;  2KXD A;  5FWB A;  3JCM Q;  1UFF A;  5GAM d;  3A8H B;  1QE0 A;  2M51 A;  1WQ7 A;  1QVF S;  1YIT T;  4YRE A;  3M9Q A;  3THK A;  4A4K A;  1B34 B;  1ZSZ C;  1YBY A;  2MMP A;  3BDU A;  2GTO A;  4RTW A;  4IIO A;  3A7U A;  1O75 A;  3R6O A;  1PD1 A;  2QDL A;  2ZPB B;  4KUL A;  3SEM A;  2QK0 A;  3M56 A;  5GMK h;  4RTU A;  1XQH A;  3SDZ A;  4KT0 E;  5ECA A;  3QO3 A;  3QYH B;  2DRM A;  4EPC A;  1N8R U;  4HVV A;  1UEB A;  3VV0 A;  3JB9 I;  4O5V A;  4QT7 A;  2LCL A;  2C06 A;  2CJB A;  2R57 A;  1W66 A;  1BI0 A;  4XTY A;  1QVG P;  2ZR3 A;  3EHQ A;  1BIB A;  1U1T A;  1NPP A;  2LTO A;  4H2U A;  2FRW A;  1JO8 A;  2PME A;  2GQV A;  1VQN T;  2YUQ A;  1BKB A;  2VXF A;  2KNB B;  2YHT A;  4MDX A;  4PJO B;  1YB3 A;  4CH4 A;  1YFN A;  3HHT B;  2KRN A;  2DKG A;  3L1A A;  2RD1 A;  2GGR A;  1LPL A;  3C12 A;  4F7U F;  2JJ9 A;  4AG1 C;  4E7J A;  2EQJ A;  2H8H A;  3QXE B;  4YRT A;  4LDX A;  1RL2 A;  4EMK B;  2DER A;  3QSU A;  3TU4 K;  3G7Z A;  2ZIM A;  4M75 D;  5GAN g;  4PJL A;  3ZBD A;  2KQW A;  2O31 A;  3VS4 A;  3VUZ A;  4J9F A;  2O9S A;  2DXT A;  3BW1 A;  1MV3 A;  3HL8 A;  4Z8A A;  2ED0 A;  4CS4 A;  1G5V A;  2WSE E;  4M77 G;  3NET A;  2M0O A;  4OB0 B;  1KC8 U;  2WSC E;  2O4X B;  4HCK A;  2OTL T;  4P73 C;  5KYY A;  3H8Z A;  2DF6 A;  4M78 E;  1EIF A;  4M7A E;  1VQM Q;  4KUD K;  1N8R R;  2O9V A;  2F69 A;  4HWT A;  2YUO A;  9ATC B;  1NPR A;  1UGV A;  2FYK A;  3J80 E;  3C0C A;  1RUW A;  4K88 A;  4FU6 A;  1UTI A;  3H0F A;  4ME7 A;  1Z7M A;  4DBR A;  3PIO A;  1YWP A;  2RHQ B;  2YRD A;  2L3Q A;  4M78 A;  1K8A U;  1IL2 A;  4OMF B;  4JJD A;  2L2P A;  4RTX A;  2ZT7 A;  1RAI B;  1VQ8 A;  5GAN 3;  5IN1 A;  4MZT A;  4IIM A;  4QVC A;  1YJW T;  3MF1 A;  3NEL A;  3OS1 A;  1YJW Q;  1VQM A;  2HEQ A;  1SSH A;  1LCK A;  3OYM A;  1K1Z A;  5KYX B;  3UA6 A;  2M0Y A;  1S72 T;  4HWP A;  4PJO E;  1ZUY A;  1JB0 E;  2DTI A;  2DD5 A;  2DET A;  2BE7 D;  1T3L A;  2JT4 A;  4BI3 A;  1K9M R;  4X9C A;  1M90 R;  3P8D A;  2HZY A;  4JS4 A;  1NJI R;  3ER0 A;  3V7C A;  2RN8 A;  4Y92 A;  3EAE A;  3M4G A;  3FLG A;  1TU0 B;  5AT1 B;  3CMA A;  3HXV A;  3RGL A;  1RAB B;  2PNI A;  3QII A;  4OB2 B;  4F7U B;  1BBW A;  5KYY B;  2F2W A;  3UPU A;  1T0H A;  1X2G A;  2ZTG A;  2P0K A;  2VV5 A;  3MP1 A;  4M75 G;  3OYN A;  1NJ6 A;  1WHJ A;  1NM7 A;  5A2Q E;  3A74 A;  2ZT5 A;  3P8Y A;  3WQZ A;  2YSQ A;  3UT1 A;  1IZ6 A;  4C8Q B;  1M90 U;  2ARS A;  4M77 A;  4WJ4 A;  4P72 A;  1CSK A;  2BKD N;  2DL7 A;  2V1Q A;  1YHQ T;  3VS7 A;  1YHQ Q;  4FW2 A;  4H02 A;  4UP7 A;  2QHV A;  5HGQ A;  4FCY A;  2MPX C;  1LYL A;  1Z9Q A;  3I55 A;  1ZLM A;  2YLB A;  4JS5 A;  4BE0 A;  3KBG A;  4CI0 C;  2AMC B;  2EQK A;  3RAC A;  1PD0 A;  3H9N A;  4LVK A;  2P0Q A;  3FC3 A;  3CCU Q;  1KQ1 A;  4YYE A;  4HCB A;  3EFO A;  2E4H A;  2EJ9 A;  5GAM f;  4M7D B;  3CC2 T;  1WPY A;  3UGQ A;  4KUI A;  1K8A R;  2YDL A;  1JU5 C;  2COZ A;  4KRT A;  4DA4 A;  2K7A A;  2BZ8 A;  2HMA A;  3CCQ T;  1JJ2 S;  4H2X A;  3G1Z A;  3RL6 A;  1VQ4 Q;  4LD6 A;  4KQE A;  4CC2 A;  3GLX A;  3N5B B;  1IO6 A;  1QW1 A;  2DTH A;  3L2Q A;  2GTJ A;  1Y0M A;  3CBP A;  1TS9 A;  2RHQ A;  1HC7 A;  3PT9 A;  4GBQ A;  4E7K A;  1NLO C;  1Q7Y U;  4PJO G;  1E1O A;  3OYG A;  3M58 A;  3VBB A;  1FXX A;  2IPO B;  1J3T A;  2AKW B;  4KGZ B;  2E70 A;  3MEY A;  3FJ5 A;  3C94 A;  3E9G A;  1I07 A;  2CZ0 B;  3CME A;  1K0S A;  1SRY A;  3R07 A;  5I2S A;  1KHI A;  4B6M A;  3GBQ A;  4BDY A;  3ERR A;  1ZBJ A;  3REU A;  1SF9 A;  3JCM d;  4A4E A;  1UGS B;  2HQX A;  4R56 A;  1FWZ A;  3MQZ A;  3HKS A;  3FEO A;  1E1T A;  3VQV A;  1G3T A;  3TEE A;  2PU9 B;  5GAN e;  3CCV A;  2OTJ T;  2JUF A;  2GNC A;  4E51 A;  1YI2 Q;  3HP9 A;  4LN2 A;  1KD1 U;  5C0M A;  4AT1 B;  4P72 C;  3RF1 A;  2I2L A;  1VQ5 Q;  1VQ5 T;  4LE9 A;  3OYA A;  5FRN A;  5GMK m;  1NE8 A;  3X20 B;  2Q7H A;  1E22 A;  1RI0 A;  3C4S A;  1SRL A;  1WYD A;  3CXC P;  1R0C B;  1GBR A;  5C6S A;  2C7I A;  1QF6 A;  3HRT A;  5GMK l;  2D0Q B;  4C0F A;  4J5Y A;  2EYZ A;  1QVF A;  1M2V A;  2M16 A;  1PRL C;  1RIQ A;  2KYM A;  1U5S A;  2IG0 A;  3CCJ T;  2DBK A;  2RMO A;  1WI7 A;  3GP8 A;  2R58 A;  3E1S A;  4C8Q D;  4H2Y A;  3OQ5 A;  3CC7 A;  4K86 A;  1VQN Q;  4ORZ A;  3PMT A;  4Q15 A;  5KE3 A;  3JCM b;  4FT2 A;  2DE0 X;  1MMA A;  3JAM E;  1PCX A;  4IUU A;  1Y7X A;  1FMK A;  1UEC A;  2BZX A;  4EDU A;  2EGC A;  4A4H A;  4J6W A;  4PFP A;  4KGX B;  2Q7G A;  4Z02 A;  5GAM h;  2MK5 A;  5F5W A;  4C92 C;  2ZZD A;  5IH2 A;  1OQK A;  1BI1 A;  1Y57 A;  5M9O A;  1X2H A;  1YJ9 A;  2DYI A;  1X6B A;  2D0N A;  3LSS A;  1TTH B;  1HD3 A;  3E9H A;  2RQR A;  4RTZ A;  3CXC S;  4YRP A;  1Z9Z A;  4XU2 A;  4FW1 A;  1YI2 T;  1SSF A;  4EIK A;  5GAN 7;  5J3B A;  1ABO A;  2HL5 C;  1G2B A;  1L0W A;  2IIM A;  1VQ6 T;  4RTY A;  2LVM A;  1GFD A;  1WHL A;  1Y96 A;  2K2M A;  1WJS A;  3EGX B;  4A63 B;  1VQO Q;  2ODR C;  3IQL A;  2VXE A;  4JDS A;  2HBP A;  3S3O A;  4YCV A;  3CPW S;  3OSS C;  1EZZ B;  3L2Z A;  2COY A;  2YLC A;  2EWN A;  3E19 A;  2HAX A;  4YRK A;  3OD1 A;  2DZC A;  1WYX A;  2GQI A;  2KGT A;  3G71 Q;  2FRY A;  1GCQ C;  3NMZ C;  3CCM Q;  1N9W A;  2QQA A;  1M3A A;  4JZ4 A;  4LNS A;  5CK9 A;  3JB9 H;  1BBZ A;  3PCO A;  3QO7 A;  3TEH A;  2FVU A;  1Z7N A;  1ASZ A;  2CJ9 A;  4RQF A;  3RBB B;  4FM4 B;  1JJC B;  4Y91 A;  2KSS A;  3V8L A;  3CEY A;  1NZ9 A;  3CD6 T;  1YHQ A;  3SB2 A;  3LLR A;  2P84 A;  3CCL T;  3KFV A;  3HFO A;  1K0X A;  2W10 A;  2JW4 A;  4IUV A;  4A54 A;  4IKF A;  2YUN A;  4OP0 A;  4WF2 A;  4NOY A;  3QYG B;  2BIV A;  3NPF A;  2JM9 A;  2LJ0 A;  2QTX A;  3TRE A;  3JB9 J;  3KUF A;  1VQK Q;  2PUK B;  3EGX A;  3L2R A;  2J3L A;  1D1C A;  2LP5 A;  2AMC A;  3NTK A;  4JPB W;  4BWA A;  3CBO A;  2DRK A;  2AIR B;  2DA9 A;  4RMO A;  5CO7 A;  3CCU A;  3D7S B;  4BE2 A;  1M90 C;  4FSX A;  4K11 A;  2CP0 A;  3L4G A;  1I1J A;  1ARK A;  2KYB A;  3HRU A;  1VQ9 T;  4NCX A;  1KD1 R;  2JOY A;  4M7D C;  2ZT6 A;  1TOV A;  2NS6 A;  1GCQ A;  3DLM A;  3W3S A;  3M53 A;  3RKY A;  3WXM B;  4EMK A;  3CMA T;  2A3L A;  2LX7 A;  1RAC B;  4YRL A;  3F70 A;  4IUT A;  5LJ3 d;  1YGB A;  1VQ6 A;  1EX4 A;  1TUG B;  2KI7 A;  4M7A D;  2LCS A;  2ZT8 A;  4J7I A;  4M78 D;  4II1 A;  2RHS B;  2AKL A;  1KC8 C;  1I5O B;  1BCO A;  1ZQ1 A;  5D6X A;  1IXD A;  1WJR A;  1D1B A;  3A1P A;  3H0I A;  3QDF A;  1NEG A;  1S72 A;  1BK2 A;  3SFM A;  4YRN A;  3OYK A;  1CKB A;  5A0D A;  3CCM T;  2EKH A;  3TSZ A;  4ZN3 A;  3M5A A;  3CCQ Q;  2MCN A;  1OYX A;  3MP8 A;  3NTI A;  4N4I A;  1VQP A;  3CCS Q;  4H2V A;  1IHW A;  2YRC A;  2JM8 A;  4ELZ C;  2B8A A;  5LJ5 g;  3GOX A;  4C92 A;  2W0Z A;  3GNG A;  4JLG A;  1LJO A;  4Z89 A;  1NLP C;  1NG2 A;  4R55 A;  4C0Z A;  4P73 A;  3OYD A;  2DEQ A;  2K79 A;  2PVD B;  3JRZ A;  1WLE A;  3MP6 A;  2OJ2 A;  3CME T;  2AZV A;  1JJ2 A;  1WFW A;  3M55 A;  4GLM A;  4DQ2 A;  3EHR A;  1YJN Q;  4M77 C;  1UHF A;  3RIR A;  1D0Z A;  1NJ5 A;  2IY5 A;  1H4S A;  2HD0 A;  4AFQ C;  1EIY B;  1VQ8 T;  2LZ6 B;  1VQ8 Q;  1RI9 A;  5I21 A;  2VWF A;  3KFU A;  2ZZG A;  1Y71 A;  4X1V A;  1EVL A;  1X6O A;  1XOV A;  2DJQ A;  1OX9 A;  2ZNJ A;  4LUE A;  1IHV A;  1PM3 A;  1AWW A;  4R0K A;  2DVE A;  4M75 C;  2EYX A;  1QWF A;  2OTJ Q;  3HXU A;  3DB3 A;  3OW2 P;  2GF7 A;  5C52 B;  4LVI A;  4UPA A;  4BY6 C;  2D9T A;  1SET A;  1M2V B;  2A08 A;  4EMH A;  2LJ1 A;  4DOV A;  1E6H A;  1OU8 A;  3TEG A;  2YXY A;  4L59 A;  4QQ6 A;  2ALY B;  3G1J A;  3J7A F;  1VUB A;  4L6V 5;  1JBM A;  4QKU A;  5I11 A;  5CCA A;  4J15 A;  2HCK A;  3JCM f;  2F5T X;  2BE9 B;  3MF2 A;  4CH5 A;  1HK9 A;  4ZGJ B;  2KK4 A;  3IKM B;  4C0G A;  1GGM A;  3VJP A;  4C8Q A;  3S3N A;  1E24 A;  5KYX A;  1W1F A;  1VQL Q;  4TQD A;  2X4W A;  1M1F A;  2KVQ G;  2RF0 A;  3E9F A;  1MUZ A;  6AT1 B;  1PC0 A;  4OB3 B;  2I4O A;  2LNV A;  4HWO A;  5L8R E;  3V8J A;  1JXM A;  1HYO A;  5GAM g;  1KSW A;  5GAN 4;  4ANJ A;  3CC4 T;  1X01 A;  1WA7 A;  2ARU A;  3QTC A;  4HVC A;  1C1A A;  2OAW A;  3JCM P;  5LJ5 e;  2DQ0 A;  2K57 A;  1W6X A;  1X43 A;  1GBQ A;  3E9I A;  2D1X A;  1D0X A;  1SRM A;  1G8X A;  1PYS B;  1H4T A;  1KG1 A;  3G6E Q;  2F1L A;  1GFC A;  2C8M A;  5CVI A;  4HVU A;  3OSV A;  2ZNI A;  3L42 A;  4M7A G;  3NTH A;  1YWO A;  2DL8 A;  1W2B S;  4DPG A;  4M78 G;  4D6W A;  5GAN f;  2ZAE A;  5GMK i;  5LJ3 e;  1U8R A;  1Q81 U;  4ZGE B;  1OPL A;  3PZC A;  3TQ7 P;  2J05 A;  3TCJ A;  1UUE A;  2D6F A;  2KRM A;  4HT4 A;  3CC2 Q;  1WHH A;  1VOM A;  5D6W A;  1W2B A;  1OUL A;  2EAY A;  2X3W D;  1Q95 G;  1ABQ A;  3I5R A;  3A5Z A;  5LJ5 d;  2K3X A;  4X34 A;  3JCM X;  1BI3 A;  3SWN A;  2ZPE B;  1ZUU A;  4QQD A;  3O5Z A;  3RKX A;  2CDT A;  1D3B A;  2NUP B;  3EG9 B;  4TTV A;  1E7O A;  1VQ7 T;  1V1C A;  4Q6G A;  2E5A A;  4LVM A;  2XID A;  1KQS P;  2EQM A;  3CC7 Q;  3GPL A;  1RAE B;  3LYI A;  5D7U A;  4ESR A;  4AMC A;  2FZC B;  4M7D G;  2OAU A;  3HTR A;  3RUX A;  3RDV A;  5CAI A;  4C92 D;  1YFT A;  2QI2 A;  2V26 A;  4F7U A;  3Q1J A;  4E6R A;  1KHC A;  1QWE A;  8ATC B;  2PTK A;  5KYU B;  1IB8 A;  1SES A;  2GFU A;  2VGM A;  4M77 D;  3IKL A;  2ECZ A;  4YRI A;  4KR3 A;  4H2W A;  2P4R A;  2DLP A;  3MEA A;  1HSQ A;  2Q5I A;  4XTV A;  3QBY A;  2Q5H A;  5HK3 A;  5A0G A;  2RPN A;  4FYY B;  2QA4 T;  2V8K A;  4D8D A;  3OS2 A;  1E6G A;  4KBM B;  5LL6 S;  2D8H A;  2A7Y A;  5CKF A;  3MEU A;  4LVJ A;  2K2V A;  3JB9 F;  2KEA A;  3CMA Q;  4FSS A;  2LRQ A;  2EKO A;  1HJD A;  1GCP A;  3CCQ A;  3AT1 B;  4J6Y A;  1VIF A;  3OB9 A;  3OYB A;  2XDB A;  1QCN A;  3LWH A;  5C51 B;  2JTF A;  3GNF B;  1PKT A;  2PUO B;  1EQR A;  4YPF A;  3CCR Q;  1K9M C;  1NYQ A;  2BUD A;  4D8K A;  1RAG B;  2RNA A;  2QAZ A;  3CCE A;  5CQY A;  5IAY A;  4TVY A;  2NUP A;  3EG9 A;  2DL4 A;  4M77 E;  5IHK A;  4BI4 A;  3M0S A;  1M8M A;  2DXC A;  1ZSZ A;  1USY A;  2XHC A;  2KDS A;  4XTW A;  4F7U E;  2VB6 A;  5GAM e;  3LW5 E;  2RM4 A;  4OGC A;  2EGA A;  1AHJ B;  5GAN 8;  2KBT A;  3QKJ A;  1EVK A;  1C6V X;  1TSF A;  5L23 A;  4PFO A;  2XMF A;  1UJ0 A;  3MO8 A;  3I55 T;  4QW2 A;  3REB B;  1EOV A;  1CKA A;  3I55 Q;  3NEM A;  2QHS A;  2EGE A;  2ZPI B;  1GXI E;  4OMM A;  1KC8 R;  3LGF A;  2M1H A;  3QWY A;  1NEB A;  1D0Y A;  1VQL A;  3OW2 S;  3JCM c;  1VQK A;  5CKB A;  3M0P A;  1JXO A;  4EMK C;  1B8A A;  4NS5 A;  2ZZE A;  4XAX B;  2LC4 A;  3HTZ A;  2LMJ A;  3X24 B;  2PVO B;  4E7H A;  1NBE B;  1V76 A;  3PIP A;  2LNH B;  1Q82 U;  3CD6 Q;  1ACM B;  1M5Q 1;  1KD1 C;  1U3O A;  2RA2 A;  3PNW C;  4PJO F;  2CRE A;  2CYZ B;  3PTA A;  2X3X D;  2C0T A;  2ZZF A;  1QLY A;  1M2O A;  1R77 A;  3VYH B;  2EFI A;  1BU1 A;  2QGG A;  1DJ7 B;  1MGQ A;  2CH4 A;  3X28 B;  1C0M A;  1AEY A;  4XTU A;  3PVL A;  2FPE A;  1SPK A;  4P71 C;  1YIJ Q;  2PMF A;  2ZCE A;  3ASK A;  4LXC A;  2KT1 A;  3G4S A;  4Z88 A;  4YCU A;  5GJW B;  1UHC A;  2E6N A;  2I0N A;  4ZTJ A;  4HT9 A;  2G6F X;  3CCM A;  4UP9 A;  3ULR B;  2EQU A;  1K73 U;  2HSP A;  2M02 A;  2CSQ A;  2ZGW A;  2ROL A;  1WNL A;  2PZ1 A;  4PJO A;  5FU7 C;  2ESW A;  4P75 C;  3OYL A;  2L89 A;  3CBM A;  4P74 A;  4M7A B;  1BBU A;  1OI1 A;  2RHX A;  1U1S A;  4J6X A;  3CCU T;  3EGU A;  2FPD A;  2DL5 A;  3X25 B;  2QEX T;  3PFS A;  3I56 T;  4P3P A;  2E41 A;  1NYF A;  4M75 A;  3A7R A;  1W2B P;  3SWN C;  2YRV A;  1QVP A;  4AFZ C;  2DU7 A;  1IGU A;  4WCI A;  1PYS A;  2DIQ A;  4DEX A;  1KQS A;  5GAN 2;  4C8Q F;  3G71 A;  1X27 A;  2X51 A;  2P4T A;  2RK2 A;  2WAC A;  2EVR A;  2K3B A;  3QPH A;  1UDL A;  2F5K A;  3OMG A;  4LNP A;  4DOW A;  4P3N A;  5KE2 A;  1QCO A;  1PG5 B;  1FMW A;  2XTI A;  2ATC B;  2KR3 A;  3I5S A;  1SG5 A;  1OZ2 A;  4OB1 B;  2MWO A;  1TXQ A;  3J81 E;  1RAH B;  1YIT A;  4YRJ A;  1UGP B;  4C5E A;  2VUB A;  3EG0 A;  1T3S A;  4MZM A;  4N4G A;  5KYU A;  3BJU A;  1AZG B;  2K5F A;  3JCM W;  4PLL A;  2CGH A;  3IAL A;  5IHI A;  4UP8 A;  4E7Z A;  1M3C A;  2NUT A;  1Q82 R;  2LDM A;  3O8V A;  3VYG A;  2H3E B;  2K9G A;  4TQF A;  1H4V B;  4DBF A;  4P3O A;  1M30 A;  4JUV A;  3OS0 A;  1VYU A;  4MDW A;  4M77 B;  3RR6 A;  1PWT A;  1NJ1 A;  3QUI A;  4GLK A;  2DK3 A;  1G83 A;  3G4S T;  1KFZ A;  1M4Z A;  2EPD A;  1KQ2 A;  3E2U A;  2KY9 A;  2EW3 A;  3UH0 A;  4LVL A;  4DBH A;  1A0N B;  1J5W A;  1YIT Q;  1K9A A;  2K4Y A;  2YT6 A;  3FJP A;  2P5I A;  4JLI A;  2C0O A;  2RQV A;  1RLQ C;  2D8J A;  1Q81 C;  1K4U S;  2LQK A;  5DLQ E;  1VQ6 Q;  2V1R A;  3NFC A;  1ASY A;  3M0Q A;  1TWB A;  1AWX A;  1MV0 B;  1HTT A;  3A8G B;  3URG A;  3PCO B;  4M75 E;  3I56 A;  4KH0 B;  1O9S A;  4XEM A;  1AD5 A;  4M7D A;  4MZP A;  1WHM A;  2NWM A;  5LJ5 f;  1Q81 R;  1Q86 R;  4JJB A;  3I35 A;  4YRQ A;  4RDX A;  3M0U A;  4XU3 A;  1ADJ A;  1VQ9 Q;  3T9N A;  4J9C A;  5DY9 A;  3MPU B;  3CCJ A;  5ELN A;  2ZPH B;  1PNJ A;  4H2X B;  3JSC A;  3OYH A;  1WX6 A;  1B7T A;  3QO5 A;  2VGN A;  4J83 A;  4OF1 A;  1FYF A;  4M7D E;  2JS0 A;  3OBW A; 
#chains in the Genus database with same CATH homology
 5LJ3 j;  3L2W A;  1NJI C;  4M77 F;  3HXY A;  4TWA A;  1QVG A;  2JZ2 A;  3M54 A;  1LOJ A;  5CKD A;  2QEX A;  3HRI A;  1R8O B;  4TVA B;  3LSQ A;  2G4C A;  2NLU A;  2WSF E;  2Q7E A;  5K1P A;  4A53 A;  4UC4 A;  1WQW A;  3RMQ A;  4ELY C;  2ZIN A;  1NJ2 A;  4YDQ A;  4F7U G;  2RB6 A;  1M1K U;  4YRM A;  1YJW A;  1I5L A;  2PVG B;  3HXX A;  3OYF A;  5LJ3 h;  2Y4Y A;  3TUP A;  5FU6 C;  5CKE A;  4BY6 B;  4EX5 A;  5FLX E;  3L4G B;  4KR2 A;  4ZTZ B;  1BIA A;  2DZ9 A;  4M75 B;  3FB9 A;  2RHY A;  1USY C;  5HK0 A;  2ALY A;  3M4Y A;  3RKW A;  4RCB A;  2DJZ A;  4HT8 A;  3CCS T;  2KMT A;  2RO0 A;  4RG2 A;  5A0L A;  3HXZ A;  2XDP A;  4P75 A;  2R5A A;  4ZTF A;  3OBY A;  5CQX A;  5FU6 B;  2EL9 A;  3SWN B;  1N6A A;  4N0A C;  4C92 E;  4ATO A;  1IRE B;  2RK1 A;  3BDL A;  1YCY A;  3LC0 A;  2CS7 A;  4C92 B;  5K1X A;  2LQ8 A;  2ZIO A;  4P71 A;  3G6E A;  4CRI A;  2P0P A;  4WI1 A;  2AHJ B;  1NNH A;  3VQW A;  5FRO A;  3QG1 A;  4BDZ A;  4M78 B;  4VUB A;  3A31 A;  5GAN d;  4N0A A;  3X26 B;  1W4S A;  5IT9 E;  1G3Y A;  1N9S A;  5GAN 6;  1YIJ T;  1WGS A;  2QQ9 A;  3QDR B;  4L5G A;  2DIG A;  2XU8 A;  1B76 A;  1H3Z A;  3REX A;  4C8Q E;  3M59 A;  5HKC A;  3UFG A;  2HQE A;  1VQK T;  4J7F A;  4O6J A;  1YIJ A;  2RI3 A;  3S3M A;  5GAO p;  4WJ3 M;  4QQG A;  2JNG A;  2X4J A;  1MHN A;  1WU7 A;  1G51 A;  2CZ7 B;  1D3B B;  3EFS A;  2E1H A;  4TVA A;  3WVD B;  1YFS A;  3GF5 A;  3NEN A;  4Q5W A;  1LNX A;  2XD0 A;  3LWI A;  3OYY A;  2MWP A;  2RJE A;  4C5G A;  2LT4 A;  5KH6 A;  1HXD A;  4H2S A;  3PGG A;  1BYM A;  1B34 A;  1N27 A;  4L87 A;  4YCW A;  2OTJ A;  2QDY B;  4XK8 E;  1VQN A;  5LJ3 f;  3M4Q A;  1I4K 1;  4A4F A;  4HKE A;  4E7I A;  4RMF A;  2I4M A;  5GAN j;  4HCC A;  2E5Q A;  3HSB A;  3CCS A;  3QZ9 B;  3LX7 A;  1VQO A;  1X55 A;  2LT1 A;  3OYE A;  4LDV A;  3V7R A;  3HY1 A;  3CCR A;  2O01 E;  2J3M A;  2GFA A;  3TEH B;  2CIM A;  1BI2 A;  1YJN T;  3HFZ A;  1B7Y B;  3OY9 A;  4BI8 B;  1B70 A;  2FL7 A;  5LJ3 g;  3CD6 A;  4Y28 E;  3JCM e;  3C95 A;  4TVR A;  4GY5 A;  4BE1 A;  2GCX A;  2RHZ A;  1X54 A;  4P74 C;  3PMI A;  4MML A;  3FRN A;  3P8V A;  2ZCF B;  3WVE B;  3A8O B;  3CC7 T;  3OW2 A;  3VU3 C;  3ZEH A;  1G3W A;  2CZ1 B;  4XTZ A;  12AS A;  5GAO l;  3MCA B;  4BD3 A;  1QVG S;  2L3R A;  4A4G A;  4FT4 A;  1TH7 A;  3A32 A;  4M7A F;  3DLL A;  4M7A C;  3HFV A;  3OA6 A;  2XI9 A;  4M78 C;  2RHI A;  1YI2 A;  3M57 A;  2E10 A;  2X35 A;  2DXB A;  4ZIB A;  4JRQ A;  2R5M A;  3LH0 A;  2EYQ A;  4LDW A;  2CZ6 B;  2RJC A;  5KNN A;  3JB9 D;  1ZBX A;  3IG2 A;  1ATI A;  1EIY A;  5FU7 B;  1VQM T;  2VYT A;  3HRK A;  2DO3 A;  1Q82 C;  3QJ6 A;  1VQL T;  2RHU A;  4YRF A;  2RJF A;  4C0D B;  4C92 F;  4FL6 A;  2ZPF B;  3OYJ A;  3AHU A;  4C92 G;  4BAC A;  1UGQ B;  1XNI A;  4JRK A;  2FB7 A;  4EMG A;  3INZ A;  2E12 A;  1JJC A;  1UGR B;  4PL6 A;  2EIF A;  1VQP T;  3QJY A;  4C5H A;  3MET A;  1EFW A;  3DSQ A;  5GMK j;  5CKH A;  1P92 A;  1Q86 C;  1ZHI A;  1VQZ A;  4YRC A;  5GAM j;  2E6Z A;  3G71 T;  2DTO A;  4AH6 A;  3CC2 A;  2ZXF A;  4H2T A;  3EFR A;  1UB4 A;  1V29 B;  2RJD A;  3S6W A;  1NJI U;  3FDR A;  2DD4 A;  4IUP A;  2DAQ A;  4CH3 A;  4XEO A;  2H3J A;  2QQS A;  3CPF A;  5AYF A;  2LCC A;  2KAF A;  3P8T A;  5C53 B;  4P5N A;  3ICA A;  2ZR2 A;  2V8I A;  2XG8 D;  3A7A A;  3JCM V;  1YJN A;  3JCM g;  3HPW A;  2XGT A;  3CPW A;  2OTL A;  2QHT A;  1M1G A;  3JB9 G;  4G84 A;  4ZN1 A;  3P8H A;  1Q86 U;  3OMC A;  2K5L A;  4XU1 A;  4HWS A;  3P8B B;  4OLF A;  1X56 A;  4LDY A;  2MF2 A;  4X9D A;  3A5Z B;  1M1K C;  1QP3 A;  1SER A;  2Y90 A;  4ZGD B;  4HWR A;  4BW9 A;  5I2M A;  11AS A;  3UWN A;  3CCV T;  4HA8 A;  5EG2 A;  4C5I A;  4LDU A;  2DXU A;  2XDD A;  2VC8 A;  1Y07 A;  3VKI A;  4BUG A;  4M7A A;  3A8L B;  3QZ5 B;  1K8A C;  4BB7 A;  1G5I A;  4C8Q C;  1G5H A;  4CS3 A;  1M9S A;  1VQ9 A;  4JRI A;  1YFR A;  3LGL A;  2DPP B;  2EJF A;  1PSE A;  1YJ9 T;  4OVA A;  1JRI A;  2JVV A;  3MEW A;  2I4N A;  5GAO n;  2LX9 A;  3VUB A;  4NL3 A;  1KOG A;  1VQO T;  4RG8 A;  2XKO C;  1QP2 A;  3CCR T;  3MEV A;  2CKK A;  2M9U A;  2QXF A;  1VQ4 A;  2RHS A;  3UGT A;  4YRS A;  1KMN A;  2QQB A;  3ZFJ A;  2E3C A;  3A8M B;  3CCE T;  4YTL A;  4ZTU B;  1WJQ A;  4C8Q G;  2CJA A;  4E47 A;  2IY5 B;  4YRR A;  3HY0 A;  4B9X A;  2MAM A;  5LJ5 h;  3I7F A;  5LJ5 j;  1Y96 B;  4C0D C;  4RKU E;  4OGE A;  1PSF A;  4YRG A;  4PNO A;  3V8K A;  1OZ3 A;  2DDZ A;  1XTD A;  1B70 B;  3V7S A;  5D6Y A;  3HFZ B;  4N4H A;  4M7D F;  2QQR A;  4X5O A;  4XU0 A;  2G3R A;  2PQW A;  2XK0 A;  2XIC A;  2X4Y A;  2ART A;  3A5Y A;  3DB4 A;  2K5I A;  1VQ5 A;  3BFM A;  3QHS A;  4HCZ A;  3OS5 A;  4O2D A;  3VQY A;  3FIF A;  4JJN K;  1H64 1;  5GAO q;  5GAO m;  4M75 F;  3HXW A;  3UDC A;  2K3Y A;  1I81 A;  4RQE A;  4PHC A;  4IUR A;  4M7D D;  1B7Y A;  4NL2 A;  2EJG A;  1K9M U;  3CCL A;  3L2V A;  3CC4 A;  2I4L A;  4K87 A;  1N8R C;  1K73 C;  4B9W A;  1VQ7 A;  4XQ3 A;  3RER A;  5GAN h;  3SD4 A;  4PJO C;  4QVZ A;  1ADY A;  2JTM A;  1N9R A;  4YP0 A;  4PLI A;  2DQ3 A;  2JN0 A;  3L2U A;  2X4X A;  4QVD A;  5KCO A;  1X75 C;  5DM7 R;  2ZPG B;  2IVW A;  5GMK e;  3QO8 A;  1M8V A;  2RI5 A;  3BY7 A;  4MMK A;  4G85 A;  3KXT A;  2O4X A;  2Y4X A;  4JRP A;  4LD9 K;  3CMQ A;  2RH2 A;  4PG3 A;  3MHX A;  1NYR A;  5CR2 A;  5J26 A;  1C0A A;  2QA4 A;  3OYI A;  1NJ8 A;  5CIU A;  4EO4 A;  3JCM h;  2QHU A;  3GIB A;  3RES A;  5GAN 5;  3DKM A;  4M78 F;  2E65 A;  4J8O A;  4PJO D;  5J39 A;  2A8E A;  3G6E T;  2HNI A;  4IUQ A;  4XTX A;  5DLO A;  1FX7 A;  2AKW A;  3CXC A;  4CH6 A;  1H4Q A;  3H6Z A;  1I8F A;  1VQ4 T;  4RCC A;  4FIB A;  2RI2 A;  5E3I A;  3OYC A;  3HFN A;  4E7L A;  1Q7Y C;  5GAO r;  3QNE A;  5KCH A;  3HRS A;  3OBW A;  3RMS A;  4V2S A;  2FHD A;  1KQS S;  5ELO A;  3VQX A;  3ME9 A;  3M4P A;  1KMM A;  3JCM J;  4CS2 A;  5HY6 A;  2ODR D;  2L5Q A;  4TVW A;  4YRO A;  1G3S A;  4PKC C;  2DU5 A;  1VIE A;  2V8J A;  2E64 A;  2P0L A;  5FRM A;  2MI6 A;  2L8D A;  3JCM Q;  5GAM d;  3A8H B;  1QE0 A;  1WQ7 A;  1QVF S;  1YIT T;  4YRE A;  3M9Q A;  4A4K A;  1B34 B;  1YBY A;  2MMP A;  3BDU A;  3A7U A;  1O75 A;  3R6O A;  2ZPB B;  4KUL A;  3M56 A;  5GMK h;  1XQH A;  4KT0 E;  3SDZ A;  3QO3 A;  3QYH B;  4EPC A;  1N8R U;  1UEB A;  3VV0 A;  3JB9 I;  4O5V A;  2LCL A;  2C06 A;  2CJB A;  2R57 A;  1W66 A;  1BI0 A;  4XTY A;  2ZR3 A;  1BIB A;  1U1T A;  1NPP A;  2LTO A;  4H2U A;  2PME A;  2GQV A;  1VQN T;  1BKB A;  2VXF A;  2YHT A;  4MDX A;  4PJO B;  1YB3 A;  4CH4 A;  3HHT B;  2DKG A;  3L1A A;  2RD1 A;  3C12 A;  4F7U F;  4E7J A;  2EQJ A;  3QXE B;  4YRT A;  4LDX A;  1RL2 A;  4EMK B;  3QSU A;  3TU4 K;  3G7Z A;  2ZIM A;  4M75 D;  5GAN g;  3ZBD A;  2KQW A;  3VUZ A;  2DXT A;  3BW1 A;  3HL8 A;  4CS4 A;  1G5V A;  2WSE E;  4M77 G;  3NET A;  2M0O A;  4OB0 B;  1KC8 U;  2WSC E;  2O4X B;  2OTL T;  4P73 C;  3H8Z A;  4M78 E;  1EIF A;  4M7A E;  4KUD K;  2F69 A;  4HWT A;  1NPR A;  2FYK A;  3J80 E;  4K88 A;  4FU6 A;  4ME7 A;  1Z7M A;  3PIO A;  2RHQ B;  4M78 A;  1K8A U;  1IL2 A;  4OMF B;  2ZT7 A;  1VQ8 A;  5GAN 3;  5IN1 A;  4MZT A;  4QVC A;  1YJW T;  3MF1 A;  3NEL A;  3OS1 A;  1VQM A;  3OYM A;  1S72 T;  4HWP A;  4PJO E;  1JB0 E;  2DTI A;  2DD5 A;  4BI3 A;  4X9C A;  3P8D A;  4JS4 A;  3ER0 A;  3V7C A;  3EAE A;  3M4G A;  3FLG A;  3CMA A;  3HXV A;  3RGL A;  3QII A;  4OB2 B;  4F7U B;  1BBW A;  3UPU A;  1X2G A;  2ZTG A;  2P0K A;  2VV5 A;  3MP1 A;  4M75 G;  3OYN A;  1NJ6 A;  5A2Q E;  3A74 A;  2ZT5 A;  3P8Y A;  3WQZ A;  3UT1 A;  1IZ6 A;  4C8Q B;  1M90 U;  2ARS A;  4M77 A;  4WJ4 A;  4P72 A;  2BKD N;  1YHQ T;  4H02 A;  4UP7 A;  2QHV A;  5HGQ A;  1LYL A;  3I55 A;  2YLB A;  4JS5 A;  4BE0 A;  3KBG A;  4CI0 C;  2AMC B;  2EQK A;  3RAC A;  4LVK A;  2P0Q A;  3FC3 A;  1KQ1 A;  4YYE A;  4HCB A;  2EJ9 A;  5GAM f;  4M7D B;  3CC2 T;  1WPY A;  3UGQ A;  4KUI A;  4DA4 A;  3CCQ T;  1JJ2 S;  4H2X A;  3G1Z A;  3RL6 A;  4KQE A;  4LD6 A;  3GLX A;  3N5B B;  1QW1 A;  2DTH A;  3L2Q A;  3CBP A;  2RHQ A;  1HC7 A;  3PT9 A;  4E7K A;  1E1O A;  1Q7Y U;  4PJO G;  3OYG A;  3M58 A;  3VBB A;  1FXX A;  2AKW B;  2E70 A;  3MEY A;  3C94 A;  3E9G A;  2CZ0 B;  3CME A;  1SRY A;  3R07 A;  5I2S A;  1KHI A;  4BDY A;  3ERR A;  3REU A;  3JCM d;  4A4E A;  1UGS B;  2HQX A;  4R56 A;  1FWZ A;  3MQZ A;  3HKS A;  3FEO A;  1E1T A;  3VQV A;  2OTJ T;  1G3T A;  2PU9 B;  3TEE A;  5GAN e;  3CCV A;  2JUF A;  4E51 A;  3HP9 A;  1KD1 U;  5C0M A;  4P72 C;  3RF1 A;  2I2L A;  1VQ5 T;  3OYA A;  5FRN A;  5GMK m;  1NE8 A;  3X20 B;  2Q7H A;  1E22 A;  1RI0 A;  3C4S A;  1WYD A;  5C6S A;  2C7I A;  1QF6 A;  3HRT A;  5GMK l;  2D0Q B;  4C0F A;  4J5Y A;  1QVF A;  2M16 A;  1RIQ A;  2IG0 A;  3CCJ T;  3GP8 A;  2R58 A;  3E1S A;  4C8Q D;  4H2Y A;  3OQ5 A;  3CC7 A;  4K86 A;  3PMT A;  4Q15 A;  5KE3 A;  3JCM b;  4FT2 A;  3JAM E;  4IUU A;  1Y7X A;  4EDU A;  4A4H A;  4J6W A;  2Q7G A;  4Z02 A;  5GAM h;  5F5W A;  4C92 C;  2ZZD A;  1BI1 A;  5M9O A;  1X2H A;  1YJ9 A;  3LSS A;  3E9H A;  3CXC S;  4YRP A;  4XU2 A;  1YI2 T;  1SSF A;  5GAN 7;  5J3B A;  1L0W A;  1VQ6 T;  2LVM A;  1Y96 A;  1WJS A;  2ODR C;  2VXE A;  4JDS A;  2HBP A;  3S3O A;  4YCV A;  3CPW S;  3OSS C;  3L2Z A;  2YLC A;  2EWN A;  3E19 A;  2HAX A;  4YRK A;  3OD1 A;  2DZC A;  1N9W A;  2QQA A;  4LNS A;  5CK9 A;  3JB9 H;  3PCO A;  3QO7 A;  3TEH A;  2FVU A;  1Z7N A;  1ASZ A;  2CJ9 A;  4RQF A;  4FM4 B;  1JJC B;  4Y91 A;  2KSS A;  3V8L A;  3CEY A;  1NZ9 A;  3CD6 T;  1YHQ A;  3SB2 A;  3LLR A;  3CCL T;  3HFO A;  4IUV A;  4A54 A;  4IKF A;  4OP0 A;  4WF2 A;  4NOY A;  3QYG B;  2BIV A;  2QTX A;  3TRE A;  3JB9 J;  3KUF A;  2PUK B;  3L2R A;  2J3L A;  2AMC A;  3NTK A;  4BWA A;  3CBO A;  4RMO A;  5CO7 A;  3CCU A;  4BE2 A;  1M90 C;  4FSX A;  3L4G A;  3HRU A;  1VQ9 T;  4NCX A;  2JOY A;  4M7D C;  2ZT6 A;  2NS6 A;  3DLM A;  3W3S A;  3M53 A;  3RKY A;  3WXM B;  4EMK A;  3CMA T;  2A3L A;  4YRL A;  3F70 A;  4IUT A;  5LJ3 d;  1YGB A;  1VQ6 A;  4M7A D;  2ZT8 A;  4J7I A;  4II1 A;  2RHS B;  4M78 D;  1KC8 C;  1ZQ1 A;  5D6X A;  1WJR A;  1S72 A;  3SFM A;  4YRN A;  3OYK A;  5A0D A;  3CCM T;  4ZN3 A;  3M5A A;  1OYX A;  3MP8 A;  3NTI A;  4N4I A;  1VQP A;  4H2V A;  4ELZ C;  2B8A A;  5LJ5 g;  3GOX A;  4C92 A;  3GNG A;  4JLG A;  1LJO A;  4R55 A;  4C0Z A;  4P73 A;  3OYD A;  2DEQ A;  2PVD B;  3JRZ A;  1WLE A;  3MP6 A;  3CME T;  1JJ2 A;  3M55 A;  4DQ2 A;  4M77 C;  3RIR A;  1NJ5 A;  2IY5 A;  1H4S A;  2HD0 A;  1EIY B;  1VQ8 T;  5I21 A;  3KFU A;  2ZZG A;  1Y71 A;  1EVL A;  1X6O A;  1XOV A;  2ZNJ A;  2DVE A;  4M75 C;  3HXU A;  3DB3 A;  2GF7 A;  5C52 B;  4LVI A;  4UPA A;  4BY6 C;  2D9T A;  1SET A;  4EMH A;  4DOV A;  3TEG A;  4L59 A;  4QQ6 A;  2ALY B;  3J7A F;  1VUB A;  4L6V 5;  1JBM A;  5CCA A;  4J15 A;  3JCM f;  2F5T X;  3MF2 A;  4CH5 A;  1HK9 A;  4ZGJ B;  2KK4 A;  3IKM B;  4C0G A;  1GGM A;  3VJP A;  4C8Q A;  3S3N A;  1E24 A;  4TQD A;  2X4W A;  1M1F A;  2KVQ G;  3E9F A;  4OB3 B;  2I4O A;  2LNV A;  4HWO A;  5L8R E;  3V8J A;  5GAM g;  5GAN 4;  3CC4 T;  1X01 A;  2ARU A;  3QTC A;  4HVC A;  3JCM P;  5LJ5 e;  2DQ0 A;  2K57 A;  3E9I A;  1PYS B;  1H4T A;  1KG1 A;  2C8M A;  5CVI A;  3OSV A;  2ZNI A;  3L42 A;  4M7A G;  3NTH A;  1W2B S;  4DPG A;  4M78 G;  4D6W A;  5GAN f;  5GMK i;  5LJ3 e;  1U8R A;  1Q81 U;  4ZGE B;  3PZC A;  3TCJ A;  2D6F A;  4HT4 A;  1W2B A;  5D6W A;  2EAY A;  3A5Z A;  5LJ5 d;  2K3X A;  4X34 A;  3JCM X;  1BI3 A;  3SWN A;  2ZPE B;  4QQD A;  3RKX A;  1D3B A;  4TTV A;  1VQ7 T;  4Q6G A;  2E5A A;  4LVM A;  2XID A;  2EQM A;  3GPL A;  3LYI A;  4M7D G;  2OAU A;  3RUX A;  5CAI A;  4C92 D;  1YFT A;  2QI2 A;  4F7U A;  3Q1J A;  1KHC A;  1SES A;  2GFU A;  2VGM A;  4M77 D;  3IKL A;  4YRI A;  4KR3 A;  4H2W A;  3MEA A;  2Q5I A;  4XTV A;  3QBY A;  2Q5H A;  5HK3 A;  5A0G A;  2V8K A;  3OS2 A;  4KBM B;  5LL6 S;  2A7Y A;  5CKF A;  3MEU A;  4LVJ A;  2K2V A;  3JB9 F;  2LRQ A;  2EKO A;  3CCQ A;  4J6Y A;  1VIF A;  3OB9 A;  3OYB A;  2XDB A;  3LWH A;  5C51 B;  2JTF A;  3GNF B;  2PUO B;  1EQR A;  4YPF A;  1K9M C;  1NYQ A;  2BUD A;  3CCE A;  5CQY A;  5IAY A;  4TVY A;  4M77 E;  4BI4 A;  2DXC A;  1USY A;  2XHC A;  2KDS A;  4XTW A;  4F7U E;  5GAM e;  3LW5 E;  2RM4 A;  4OGC A;  1AHJ B;  5GAN 8;  3QKJ A;  1EVK A;  3MO8 A;  3I55 T;  4QW2 A;  1EOV A;  3NEM A;  2QHS A;  2ZPI B;  1GXI E;  3LGF A;  2M1H A;  1VQL A;  3OW2 S;  3JCM c;  1VQK A;  5CKB A;  4EMK C;  1B8A A;  2ZZE A;  4NS5 A;  4XAX B;  2LC4 A;  3HTZ A;  3X24 B;  2PVO B;  4E7H A;  3PIP A;  1Q82 U;  1M5Q 1;  1KD1 C;  3PNW C;  2RA2 A;  4PJO F;  2CYZ B;  3PTA A;  2ZZF A;  3VYH B;  2EFI A;  1DJ7 B;  1MGQ A;  3X28 B;  4XTU A;  4P71 C;  2PMF A;  2ZCE A;  3ASK A;  3G4S A;  4YCU A;  2E6N A;  4ZTJ A;  4HT9 A;  3CCM A;  4UP9 A;  2EQU A;  1K73 U;  2ZGW A;  1WNL A;  4PJO A;  5FU7 C;  4P75 C;  3OYL A;  2L89 A;  3CBM A;  4P74 A;  4M7A B;  1BBU A;  1OI1 A;  2RHX A;  1U1S A;  4J6X A;  3CCU T;  3X25 B;  2QEX T;  3PFS A;  3I56 T;  4P3P A;  2E41 A;  4M75 A;  3A7R A;  3SWN C;  2YRV A;  1QVP A;  2DU7 A;  1PYS A;  2DIQ A;  1KQS A;  5GAN 2;  4C8Q F;  3G71 A;  2P4T A;  2RK2 A;  2WAC A;  3QPH A;  2F5K A;  3OMG A;  4DOW A;  4P3N A;  5KE2 A;  2XTI A;  1OZ2 A;  4OB1 B;  2MWO A;  3J81 E;  1YIT A;  4YRJ A;  1UGP B;  4C5E A;  2VUB A;  4MZM A;  4N4G A;  3BJU A;  2K5F A;  3JCM W;  4PLL A;  2CGH A;  3IAL A;  4UP8 A;  2LDM A;  3O8V A;  3VYG A;  4TQF A;  1H4V B;  4P3O A;  4JUV A;  3OS0 A;  4MDW A;  4M77 B;  1NJ1 A;  3QUI A;  4GLK A;  2DK3 A;  3G4S T;  1M4Z A;  1KQ2 A;  2KY9 A;  3UH0 A;  4LVL A;  1J5W A;  2K4Y A;  3FJP A;  2P5I A;  4JLI A;  1Q81 C;  2LQK A;  5DLQ E;  3NFC A;  1ASY A;  1HTT A;  3A8G B;  3URG A;  3PCO B;  4M75 E;  3I56 A;  1O9S A;  4XEM A;  4M7D A;  4MZP A;  5LJ5 f;  4YRQ A;  4RDX A;  4XU3 A;  1ADJ A;  3T9N A;  5DY9 A;  3CCJ A;  5ELN A;  2ZPH B;  4H2X B;  3JSC A;  3OYH A;  3QO5 A;  2VGN A;  4J83 A;  4OF1 A;  1FYF A;  4M7D E;  2QA4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...