2DXUA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
231
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKISFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 231
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxuA01
2EJ9A 4M77B 1B76A 1B7YB 1E1OA 3CMQA 4ZTUB 5GANh 3JB9G 4P75A 4PHCA 4M77D 4M7AB 3AHUA 2Q7EA 1J5WA 3JCMX 3A7UA 4F7UA 2I4MA 4M75F 4M7DC 3TEGA 3A31A 4RCCA 2K57A 3KFUA 3PCOA 3GIBA 4C92A 4M77A 1B7YA 2J3MA 4HWSA 4M7AC 4M7AA 1EQRA 5LJ3j 4XTZA 4YPFA 3P8VA 1WPYA 3UFGA 1EIYB 4WJ4A 4C8QG 3JCMQ 4J6WA 4XU1A 3M4QA 5C53B 1H4VB 4CH5A 5HGQA 3PGGA 2CJBA 3A74A 1B8AA 2I2LA 4XTWA 2RM4A 4K87A 4M78B 4F7UG 3IKLA 3TEHB 2Y90A 4YRFA 1SERA 2ZTGA 4UPAA 1N9SA 1KMNA 4M7DG 1RIQA 4K88A 4M78D 3LC0A 2JN0A 1EIYA 3JCMJ 5ELOA 3TUPA 1VQZA 4C8QE 3NELA 2ZNIA 2IY5B 4YRRA 1G51A 4C92G 4H2YA 3M4PA 4O2DA 1YFRA 3JCMd 5GAN5 4M7AG 3HXYA 2E5AA 3FIFA 4M78A 3RKWA 3TEHA 4QVCA 2RB6A 4TWAA 5LJ5e 3BFMA 3W3SA 4H02A 3L1AA 3VQVA 2EAYA 1KQ2A 3JCMg 3QHSA 4YRGA 3REUA 3VQYA 3JB9D 2AKWB 5F5WA 2IY5A 2QHVA 12ASA 4C92E 4PJOC 4YRCA 4XTUA 4A53A 2DQ0A 3HSBA 1X54A 2VC8A 3JCMW 4M77E 5GMKj 4XU2A 5LJ5h 3UH0A 5GAOr 2DKGA 1G5IA 1BIAA 4M7AE 3VQXA 1YGBA 4HWRA 4BW9A 4J5YA 3RERA 5LJ3d 3M4GA 3HXWA 4YCUA 2AKWA 4DQ2A 5GAN8 1EOVA 4YCWA 3VBBA 2ZT5A 4H2UA 3A7AA 4H2SA 2Q7HA 4RQFA 2RA2A 4P72A 5LJ3g 4C8QD 2DXTA 4V2SA 5GAMj 4KR2A 4P3PA 4X9CA 4ZIBA 4EMKC 2DDZA 3A7RA 2DU5A 4P74A 3RUXA 2EWNA 1BIBA 4XQ3A 4M7DB 2QTXA 2FB7A 4PJOG 2DU7A 3QNEA 4P73C 4M7DD 4XU3A 5GANj 3HXZA 4J15A 2DQ3A 4M78E 4XTVA 4P71A 4RCBA 3IG2A 5DY9A 2DEQA 2PMEA 3MF2A 3EFSA 4C92D 3RKYA 2HNIA 5K1XA 4JUVA 1JBMA 2J3LA 4M7AD 2DXUA 4M7DA 5GAN6 2QHTA 3OD1A 4YRKA 3JB9I 4KR3A 3EFRA 4RDXA 4E51A 1LJOA 4X9DA 1EVKA 4PNOA 4M75C 3HXVA 3QO7A 1SRYA 1NJ6A 1IL2A 2RD1A 1ATIA 2ODRC 3E9IA 2DZ9A 2ZGWA 1PYSB 3VQWA 4C92F 1WYDA 5GAOn 4TVWA 4M77F 4X5OA 1X56A 1WLEA 2QHUA 3HFVA 11ASA 4AH6A 3LSSA 1YB3A 1NJ5A 4YYEA 3HRIA 3JCMf 2E1HA 3HY1A 1LYLA 3BDUA 1E1TA 4XTXA 3G1ZA 4EMHA 1D3BB 3MEYA 1PYSA 2DZCA 4P3NA 1X2GA 2ARUA 3BJUA 1WQ7A 3QTCA 4YREA 5GAMd 1NYQA 4Y91A 3VU3C 4Q6GA 1M5Q1 1B70B 3L4GB 1HK9A 4YRIA 4H2TA 3HFOA 1HTTA 3IKMB 4CS4A 1JJCB 4M75G 5GAMg 1Z7NA 2ZZEA 4PJOB 2DTOA 1KOGA 4RQEA 1KQ1A 3JCMP 5GANd 4PJOD 1D3BA 1USYC 1USYA 2E64A 4F7UE 2ZZFA 2ZR2A 4M7DE 1X01A 3BY7A 4MMLA 5LJ3f 1M8VA 4YRSA 1MGQA 5GANg 1B70A 3L4GA 3NEMA 4M78F 2ZNJA 1H641 1NYRA 3UGQA 5LJ5j 3RIRA 1X55A 3RF1A 3RGLA 1JRIA 3RACA 1JJCA 1NJ8A 1YFSA 4PJOA 4TQFA 3P8TA 4YRNA 2ZIOA 2DTHA 2G4CA 4A54A 4HWPA 1I5LA 4L87A 4JLIA 1N9RA 2EJGA 3INZA 4NCXA 2CJ9A 4WI1A 2E65A 4EMGA 5CAIA 3IALA 2ZZGA 4EMKB 2QHSA 2CJAA 4YP0A 4XEOA 3L2ZA 3QUIA 2CGHA 4K86A 4MMKA 3JB9F 4Q15A 3JCMV 3JB9J 4WJ3M 2E10A 5GMKi 4EX5A 4N0AC 1ASZA 5GAN2 4N0AA 2ZINA 2ZXFA 3E9HA 5GAN7 1E24A 4EMKA 1E22A 1Y96B 2CIMA 5C52B 1NNHA 2ARSA 4HT8A 2ZT6A 2I4LA 2Q5IA 4YDQA 1U1SA 4P73A 3SWNC 2YHTA 3LSQA 3FB9A 1NJ2A 2P5IA 4UP9A 3RL6A 4M75B 2P0LA 4H2XB 4C8QF 3P8YA 5K1PA 4M75D 2DTIA 4EO4A 1I4K1 3JB9H 3JCMe 4LNSA 4YCVA 1Y96A 4J6XA 5GMKl 2XTIA 3WQZA 1I81A 4UP7A 4C8QC 4PJOE 2DVEA 3A32A 4F7UF 3DSQA 5LJ5d 5GAN3 4CH6A 4M7DF 1QF6A 3QO3A 5ELNA 4M75A 5I21A 2YLBA 4H2XA 1ADJA 2ZR3A 4DPGA 3JCMh 4P75C 5GAMf 3HRKA 5LJ5g 2C8MA 3HFNA 4RMFA 5GAOl 3HXUA 3I7FA 3SB2A 4YROA 1W66A 1WU7A 3V7SA 4M7AF 4C92C 5LJ3e 1C0AA 1SESA 5GANf 2ZT7A 3ERRA 4M77C 3REXA 3HTZA 1H4SA 2DJZA 4G84A 2Q7GA 4CS3A 2I4OA 4OP0A 3V8KA 4NOYA 4YRMA 2EJFA 3RKXA 4HT9A 1FYFA 2E3CA 4YRPA 5LJ3h 1Z7MA 3HXXA 4HWOA 2ZCEA 1YFTA 3QSUA 4H2VA 1U1TA 2EL9A 3NENA 2RHSB 4TQDA 1WQWA 4G85A 3V8JA 1G5HA 1KMMA 1BBUA 2YLCA 1H4TA 4M75E 4M77G 2ALYB 1X2HA 4HA8A 4M78C 2ZT8A 2RHSA 3FJPA 4PJOF 4QVDA 4YRQA 4KQEA 2ZIMA 4NL3A 3HY0A 3V7CA 5GMKe 1EFWA 3MF1A 1ADYA 4XEMA 1SETA 2RHQB 5GMKm 3UGTA 4CS2A 4TVYA 1HXDA 3SWNB 4NL2A 2ALYA 4YRTA 3QO8A 1N9WA 5GAOq 2C7IA 2AMCB 2VXEA 5GAN4 4UP8A 2E41A 1WNLA 3A5ZA 4ZTZB 3A5YA 5GMKh 3ICAA 1LNXA 1ASYA 1HC7A 1H4QA 3HFZB 5GAOm 4TVAB 3V8LA 5GAOp 4CH3A 2RHQA 4TTVA 3PZCA 1YCYA 2XGTA 5LJ5f 1L0WA 4XU0A 5GAMe 4WF2A 4C8QB 1B34B 2Q5HA 4PG3A 3SWNA 4P72C 4M78G 4HWTA 3QO5A 2AMCA 2FYKA 1QE0A 4JRIA 1LOJA 2ARTA 4XTYA 3V7RA 3R07A 4P3OA 2PMFA 4YRJA 4J6YA 3NETA 5GANe 4F7UB 1NJ1A 4P74C 3HFZA 4TVAA 2ODRD 5GAMh 4YRLA 4JRKA 5E3IA 3JCMc 3BW1A 4HVCA 3RESA 4C8QA 5C51B 1B34A 1EVLA 4CH4A 2I4NA 3JCMb 1GGMA 4BWAA 5KNNA 4H2WA 3PCOB 1I8FA 4C92B 4P71C 4OLFA 1TH7A 1BBWA 2VXFA
chains in the Genus database with same CATH superfamily
4M77B 1B76A 2JNGA 4X34A 4MDWA 2K7AA 5IAYA 3CCSA 3A7UA 1E6GA 4PFOA 4CC7A 2AZVA 2P0PA 3CC2A 4RCCA 2JJ9A 3EFOB 1T3LA 4LN2A 3CC7T 1Q86U 2O4XB 2FPDA 4KUIA 4OMMA 2J3MA 1VQKA 3UWNA 4OMQA 4M7AA 1X6GA 1EQRA 2ZPEB 2EBPA 4E7LA 1Y57A 2AIRB 5A2QE 4C8QG 4BY6C 2A0FB 3M4QA 5C53B 4RTVA 2ROTA 3ASKA 2K3XA 3CD6T 2EGCA 1PCXA 1UJYA 5CVIA 2XMFA 4K87A 4F7UG 4J9CA 4UPAA 2JN0A 1EIYA 5ELOA 3TUPA 4AFQC 2VVKA 1QWFA 1VQZA 4IUVA 2QGFB 2I0NA 3M57A 2F2XA 4C92G 1PRMC 3FC3A 2FPEA 5IT9E 3LGFA 1YFRA 3NHNA 1AWWA 1VQ6A 2BKDN 1JJ2P 3CPWA 3PMTA 2ATCB 2E5AA 3REBB 3TEHA 2M0YA 2LJ3A 4TWAA 5LJ5e 2KVQG 2VB6A 1AT1B 1KFZA 3OBWA 1N27A 1U3OA 4JJBA 2FZKB 3QHSA 3OYDA 2AKWB 2P4RA 3J7AF 4ZNXA 3PFSA 2JXBA 2CKKA 1YJWT 3JCMW 5GMKj 4C0DB 2DYIA 1TS9A 1G5IA 4M7AE 1K9MR 3VQXA 3G71A 1YGBA 1TG0A 4F04B 4HWRA 3M5AA 3DKMA 4BW9A 2KYMA 5CKEA 3CXCS 1EZZB 3M0RA 1QW1A 2KE9A 2LNHB 1FYNA 4YCUA 4YCWA 2K2MA 1UE9A 1BU1A 3VBBA 3MP6A 3ZFJA 2ZT5A 4N4IA 3PIOA 1TUGB 4Z89A 4C8QD 5FRNA 2DXTA 5IXFA 1J3TA 2JS2A 4KR2A 1KD1R 1UECA 4X9CA 3CMET 2DDZA 3A7RA 2C0IA 2SRCA 2EFIA 2DU5A 3LWHA 4FT2A 2V8IA 4M7DB 2FB7A 3CCQT 2PVGB 3MEAA 4E6RA 2CZ0B 2DQ3A 2YUOA 3A8GB 4P71A 5DY9A 7AT1B 4C92D 3J80E 2HQHA 2HNIA 1RADB 2KBTA 5D6XA 2HBPA 3QG1A 1R8OB 2D0NA 5I11A 5GAN6 2QHTA 4YRKA 3VYGA 2KAFA 2HQXA 2DXBA 4E51A 4UC4A 1LJOA 2CH4A 1OX9A 3M58A 1BKBA 3GF5A 1AEYA 1ZA2B 4KUDK 3RBBB 1SHFA 2RD1A 1ATIA 1NJ6A 5KCHA 1UHFA 2LCCA 3QIIA 2FRWA 1UJ0A 2E3HA 1AOJA 3CC7Q 2F1LA 3OYGA 5FROA 4BI4A 1V76A 2WSCE 2QHUA 1R77A 3HFVA 1SHGA 4C5EA 3G1JA 2COYA 3H6ZA 1OX8A 3BDUA 1M3CA 1YFNA 4XTXA 2QI2A 3G1ZA 1D3BB 1PYSA 1WQ7A 2LZ6B 3CD6Q 1ARKA 2KT1A 1V29B 2KGTA 1S72Q 2DO3A 2CP0A 3VU3C 1MMAA 1YITT 1ABOA 4OGCA 1MV0B 1Z7NA 2QQAA 4PJOB 4GBQA 1KOGA 3L2UA 1NBEB 1ZSGA 3JCMP 1JXOA 2E64A 4F7UE 4A4KA 1I1JA 2JMAA 3M0SA 2XICA 2XDPA 3CXCA 4MMLA 3PNWC 1JEGA 1MGQA 1B70A 1M1FA 3NEMA 2P0QA 5IHKA 3S3NA 3RF1A 3RGLA 4HT4A 1OI1A 1JRIA 3H9NA 1NJ8A 2K4YA 3OYLA 4RTXA 4TQFA 2RO0A 3OS0A 2DYBA 4O6JA 1I5LA 4Y92A 2X51A 3OYCA 2LQKA 4ZTFA 2RHUA 5CAIA 5KYWB 1YJWQ 2ZZGA 2QASA 3QYHB 3IALA 1OU8A 1PC0A 3UT1A 4XEOA 3HP9A 1GCQC 2DMOA 1Q7YC 5A0DA 2EKHA 4MMKA 5CCAA 4TVRA 3JB9F 1O75A 3JCMV 1VQ4T 2E10A 5GMKi 3VS7A 1QCOA 1UGSB 1KC8U 3MPUB 4BUGA 3ME9A 3I56T 2ZINA 2XG8D 2ZXFA 5GAN7 3E9HA 1RAEB 2J6FA 2X4XA 1E24A 4EMKA 2ZZDA 2QDLA 4KH0B 4HT8A 4D6WA 2I4LA 3X26B 2EKOA 4DA4A 2Q5IA 4YDQA 1SRMA 2YT6A 4P73A 1E6HA 1K8AU 1UTIA 1YCSB 4QQDA 4BB7A 3RL6A 5CO7A 3E1SA 5I22A 3PMIA 3OW2P 1PRLC 3P8YA 4LNSA 4YCVA 1S1NA 4JZ3A 5GMKl 1I5OB 3VRZA 2XTIA 4F16A 4C8QC 3JV3A 2YWWA 2RQWA 1ZLMA 4RUGA 1BI0A 3FJ5A 5ELNA 2ROLA 2DL8A 2VWFA 4H2XA 1ADJA 2ZR3A 3EH2A 4L6V5 2K5LA 3EGXA 3JCMh 3OYIA 3HRKA 5LJ5g 2C8MA 4RMFA 2RPNA 4YROA 2GFUA 4EDUA 1M4ZA 1Q81R 4J7IA 4C92C 2COWA 3L2RA 1JU5C 3M0UA 2ZT7A 2KYBA 1ZSZB 1RUWA 2DJZA 4OMNA 2E5QA 2CP6A 3KBGA 5ECAA 2Q7GA 1RAIB 4CS3A 3V8KA 2MK5A 4B9WA 4FW1A 4D8KA 3FLGA 4HT9A 2GQIA 5LJ3h 2EW3A 3CC7A 2CH4W 3UDCA 2M16A 1YITQ 2EL9A 2RHSB 5EG2A 5CQXA 4KGXB 3BDLA 1YJ9T 2LCLA 3V8JA 3E2UA 1OQKA 3CD6A 1H4TA 1S72A 4M77G 4LUDA 2C0TA 2ALYB 2DL3A 1G3YA 3CPWP 4PFZA 2KNBB 4M78C 2EYXA 2P84A 1YJNT 4JJNK 4QVDA 2JZ2A 2Y4YA 4C5HA 1NYFA 2O01E 2ZIMA 5HY6A 4KQEA 5IHIA 3EH1A 1WIEA 1XOVA 2RQUA 4LDYA 2A3LA 3MEUA 1QQJA 3TREA 2H3EB 4AFUC 1WFWA 1K0SA 1X69A 1KSWA 5D6WA 1V1CA 3E9GA 1D0ZA 2A8EA 4O5VA 1VQNQ 5GJVB 2AMCB 1UHCA 5GAN4 3VUZA 2E41A 2CZ1B 1LNXA 1ASYA 1CKAA 3LGLA 1VQ4Q 4HVUA 3TU4K 3DB4A 1ZBXA 3LX7A 3M56A 4CH3A 3QZ5B 4DBHA 2RHQA 1X2QA 3QBYA 2ZPGB 3I56Q 4KGZB 3PZCA 1FX7A 4Z02A 4XU0A 5GAMe 1L0WA 4WF2A 1YJWA 1B34B 1YNZA 5FWCA 3SWNA 1WA7A 3CC4T 2RJDA 2ZPFB 3CCSQ 4LVKA 4IIOA 3QO5A 1QE0A 2PUKB 2V1RA 3G6ET 1I0CA 3OQ5A 1WDXA 5KH6A 1NJ1A 1JXMA 3KFVA 2ODRD 4LUEA 2JW4A 3OY9A 2GQVA 3NTKA 4FYVB 4LDUA 3HL8A 5FU6B 2QXFA 4CRIA 1YP5A 2L3QA 2DPPB 5C6SA 1N5ZA 1B7YB 3CMQA 5GANh 4M77D 5M9OA 2Q7EA 3JCMX 2NUPB 4IIMA 2E6NA 4ZGDB 3CCQA 1WJQA 3TEGA 1OULA 4ZGJB 3E19A 4DEXA 1IRXA 1BBZA 3G4ST 1NZ9A 1B3QA 2KXCA 4A4FA 4M77A 2GCXA 4KGVB 1K9MC 3P8DA 3O5ZA 2K3YA 2DXCA 2EYQA 3EG1A 3UA7A 5LJ3j 2RF0A 4OVAA 2J7IA 4MZPA 4Q5WA 1M90R 1WPYA 3UFGA 3VS5A 2LCSA 1ZX6A 3CCET 1TXQA 1VQ7T 3M9QA 2DL7A 2O4XA 5HGQA 3PGGA 2EVRA 2F2VA 4FYXB 2I2LA 4XTWA 1KD1C 2RM4A 3IKLA 2Y90A 4YRFA 4M7DG 1RIQA 4K88A 1Q7YU 3JCMJ 3G7ZA 3GP8A 2AT1B 1QCFA 4FYWB 5EC7A 4H2YA 1C0MA 2EQIA 4O2DA 1I07A 3JCMd 3HRUA 5GAN5 4M7AG 3FIFA 3HHTB 3LLRA 1IB8A 1SPKA 2ENMA 2RB6A 2AKLA 1MMNA 3CEYA 2PNIA 2A28A 3W3SA 3SD4A 3PE0A 4IUPA 3CXCP 1YITA 4H02A 3VQVA 2QEXT 3DLLA 2CT4A 2M51A 1YJNQ 3REUA 2QHVA 2YDLA 2B8AA 2LRQA 4II1A 4XTUA 1WHKA 3HSBA 2VC8A 4M77E 3UH0A 4L59A 2OTLT 2D1XA 4LXCA 2X4WA 2E5KA 2JTMA 1ZUUA 3C94A 5KCOA 3D7SB 5LJ3d 2LX9A 1WGSA 3HXWA 2AKWA 2DD4A 2F2WA 5IH2A 5FLXE 1YIJT 2Q7HA 2K2VA 1KJWA 4ZN3A 2FVUA 3PVLA 4HVVA 2BZXA 1K76A 4MZTA 3MHXA 4P74A 1PKSA 3G6EQ 4PJOG 4M7DD 1VQ4A 5GANj 3C95A 2QA4T 3I56A 2DEQA 2LT1A 1GXIE 4JUVA 1RAGB 2DETA 2J3LA 2DBMA 4M7AD 3M0QA 1TU0B 4M7DA 2AHJB 1VA7A 4CC4B 4HCCA 4KR3A 4BY6B 1JQQA 1MMGA 4PNOA 3M0TA 5CKHA 2NUTB 2BZYA 4M75C 3HXVA 3QO7A 2QQBA 1SRYA 1O9SA 4YTLA 1SKUB 2ODRC 2GFAA 2ZGWA 4RTTA 3RNJA 4C92F 1WYDA 5GAOn 2R58A 1U06A 4L5GA 4PJJA 1TUDA 2PVOB 11ASA 4AFSC 3LSSA 4EIKA 1YB3A 2X3XD 1NJ5A 4YYEA 3JCMf 4BE0A 3NTHA 1RI9A 2E1HA 2L5QA 1B07A 2C0OA 2Y4XA 3MO8A 2DZCA 4P3NA 1VQ7Q 1X2GA 1GCPA 3BJUA 3QTCA 1QVGP 4Y91A 1QVFS 3L4GB 1ZHIA 1HK9A 2GGRA 4H2TA 1YI2Q 2L3SA 1PHTA 3X28B 1JJCB 4DOVA 5GAMg 2KEAA 2DTOA 1H3HA 1VIFA 5GANd 4PJOD 1ABQA 2NS6A 1D3BA 1USYC 3J81E 2ZPBB 4OMLA 2ZZFA 1U8RA 1AWJA 4M7DE 1X01A 5LJ3f 1M8VA 3VJPA 3MKDA 4JJDA 4M78F 2OTJQ 1H641 3RIRA 1QVPA 1NEBA 1WXUA 3RACA 2CUBA 4PJOA 2FPFA 3P8TA 2QEXQ 2DTHA 1SSFA 5KE3A 2H3JA 2G4CA 4HWPA 2EQUA 2MAMA 4RTYA 4L87A 4JLIA 3INZA 4QW2A 4EMGA 3EG2A 3ZL7C 4JJCA 2H8HA 4YP0A 1OZ3A 1ZUYA 3A8LB 1W70A 1KQSP 1Q81C 4K86A 1VYTA 2ZCFB 2KRNA 2G6FX 3MJXA 2ZPHB 3OYEA 4WJ3M 4EX5A 2MWOA 4ANJA 5A0LA 1YJNA 4N0AC 1ASZA 1YIJQ 2RHYA 5KYWA 1W1FA 3VS2A 4ME7A 3VS1A 3VUBA 1Y96B 4ZTJA 2E12A 2ARSA 1P92A 1U1SA 1X43A 3QDFA 3LSQA 1K9MU 1NJ2A 4JRQA 2M0OA 1IO6A 5K1PA 2LQ8A 2K5IA 2XK0A 4J9BA 2GTOA 1M3BA 1IREB 2MI6A 2QA4Q 2KROA 1ZBJA 2RHZA 3WQZA 2CP5A 4UP7A 3VS3A 4PJOE 2DVEA 3A32A 4DOWA 3UPUA 5GAN3 1YWOA 1KD1U 4CH6A 1QF6A 3QO3A 3G6EA 4OF1A 2DIQA 1X6OA 4FM4B 3L2WA 1RAAB 3HFNA 2QQ9A 1OOTA 4OMPA 1QVFA 4LNPA 1WX6A 1WU7A 2DM1A 4J9GA 1M1KR 3NMZC 3QDRB 1N8RR 1D1CA 3M54A 5GANf 3ERRA 3HTZA 4B6MA 2XDDA 5FU7B 2Z0WA 3GPLA 1C1AA 1W2BS 8ATCB 4OP0A 4RKUE 3JAME 1JB0E 4NOYA 4YRMA 1FYFA 4YRPA 2DRMA 3OS1A 2RI5A 3HXXA 2WSFE 2CREA 3G4SA 4LD9K 3U23A 5KYNA 2BZ8A 1YFTA 1WI7A 1EX4A 1JO8A 3JRZA 3THKA 1ZSZA 5FU7C 4BDZA 4H2VA 4JPBW 1U1TA 3CBPA 3NENA 1PG5B 4PKCC 4TQDA 1WQWA 1WJRA 4AG2C 4E7SA 3MCAB 2RHIA 1VQ7A 3LWIA 1K9AA 1OV3A 1RI0A 2RNAA 4ATOA 3OYFA 3AT1B 1UB4A 1YI2A 4HA8A 2W10A 2CP7A 3H0FA 2RHSA 1D0YA 3FJPA 3ULRB 3A5ZB 4ELYC 1VOMA 2L0AA 3NTIA 1KC8R 1LCKA 2D9TA 5GMKe 2KT8A 3A8HB 3MF1A 1SETA 1G8XA 1T0JA 1BCMA 2ABLA 2MYSA 4EPCA 1NM7A 1UGQB 3OYHA 1HXDA 4NL2A 2ALYA 4Z88A 2OTJA 1JJ2S 3M59A 1W4SA 4FL6A 1K8AR 2G3RA 3JSCA 4WTOB 1VQPT 2DA9A 4HVWA 1XNIA 3A1PA 1M90C 2QEXA 2MWPA 4AT1B 5GAOm 3EG3A 1YCYA 2XGTA 3CMEQ 2F5KA 4C8QB 1XQHA 5KYUB 4HWTA 2AMCA 2O31A 1G3WA 4JRIA 1LOJA 3EG9B 1X27A 3CCQQ 2ARTA 1K4US 2CZ7B 2EQMA 2HAXA 4YRJA 4F17A 1T0HA 3PTAA 2VGMA 1KK7A 1QCNA 2DJQA 1X6BA 4F7UB 3CCRT 3DLMA 1QKXA 2A7YA 4BD3A 4C0GA 3M0PA 1KHIA 2NUZA 4IUUA 1YIJA 4JRKA 3BW1A 4E47A 4R55A 1B34A 1EVLA 2I4NA 4E7KA 1GGMA 5KNNA 3PCOB 4C92B 4P71C 2RK2A 5J39A 1TH7A 3NFCA 1K73R 2VXFA 3VV0A 1W2BA 1MV3A 4LD6A 3JB9G 4P75A 4PHCA 2I4MA 4M75F 1GBRA 1F1BB 3MEWA 3A31A 2DE0X 3QJ6A 2K57A 1FWZA 3S3OA 2E4HA 2QA4A 1UG1A 2LDMA 4CC3A 1B7YA 3VRYA 4HWSA 5I2MA 3OA6A 2NUPA 1G3SA 2VYTA 2ESWA 4WJ4A 1FMWA 3JCMQ 4J6WA 2LMJA 4J9FA 2DD5A 1H4VB 1Y0MA 4QT7A 3NGPA 2X9HA 3A74A 1VQMT 3TQ7P 2MPXC 2J6OA 1VYUA 2RK1A 4M78B 2DBKA 3RMSA 1SERA 2ZTGA 3HTRA 1LPLA 3LC0A 4F14A 2KSSA 1Q81U 4CC2A 4HKEA 2M1HA 2L8DA 1M8MA 3EG0A 9ATCB 2IY5B 1UGVA 1G51A 1H3ZA 1JJ2A 1X2KA 2CDTA 2DL4A 3EGUA 3HRTA 1NYGA 2F69A 3BFMA 1K0XA 2FG0A 3PT9A 1KQ2A 1NLPC 3OB9A 4LE9A 5KYYB 2RHXA 3JB9D 12ASA 2CP2A 2RI2A 1VQOT 2DQ0A 3SDZA 5CKBA 1X54A 4AFZC 3CMAT 1FMVA 5LJ5h 3Q1JA 4MZMA 1TSFA 4J83A 5GAOr 2DKGA 1BIAA 5KE2A 2AK5A 4WCIA 1PM3A 3RERA 1T3SA 1ACMB 3M4GA 1OPLA 1Y07A 1U5SA 3VS6A 2DILA 3C12A 4H2UA 3A7AA 1EFNA 3UA6A 4BE1A 4RQFA 3R6OA 1Q82R 2RA2A 4OGEA 3REAB 4P72A 1PNJA 4P3PA 5AT1B 4EMKC 1PKTA 3X25B 2MCNA 2JOYA 4E7HA 1OPKA 2EWNA 1BIBA 3RUXA 1KG1A 2DU7A 3QNEA 1DJ7B 1PSFA 2CS7A 4ESRA 4P73C 2HZYA 1HSQA 4XU3A 4GLKA 3HXZA 3CCRQ 1AZGB 3IG2A 2PMEA 3TEEA 3CMEA 3MF2A 1PD0A 1NJIR 5IHNA 3E9FA 3OD1A 2KI7A 4RDXA 3CBOA 4X9DA 1EVKA 2LVMA 2A08A 2KK4A 4OB3B 3OYYA 1VQ5T 1BI3A 1IL2A 2M9UA 3OW2S 3E9IA 2DZ9A 2YSQA 2YUPA 2DNUA 3L2QA 2X35A 3OBYA 1X56A 1WLEA 4AH6A 3OYKA 2W0ZA 3EFOA 1D1BA 1SG5A 2CT3A 2NUTA 1R0BG 3UATA 4J7FA 6AT1B 2ECZA 2JTEA 3MEYA 4J9DA 4KH1B 1WHLA 2ARUA 2RMOA 3URGA 5DLOA 3OSVA 4RMOA 2D8JA 3EGDB 2HSEB 3A8MB 1Y7XA 5IXBA 3CCLT 3IKMB 4GY5A 4CS4A 1M2VB 4PLIA 2KR3A 3H41A 1YJ9Q 1KQ1A 1M90U 2OJ2A 1BK2A 1UDLA 3H0IA 1USYA 4BI8B 4LDWA 1GFCA 5HK3A 3BY7A 1CKBA 1KIKA 2A36A 3L4GA 3NETA 4ORZA 2JM8A 1NYRA 5LJ5j 1X55A 2HKNA 3OYNA 1NEGA 2RJCA 1JJCA 3H8ZA 2O88A 2PZ1A 2HL5C 1ZQ1A 1VQ9T 2ZIOA 4YRNA 2XIDA 5FRMA 2D6FA 2FRYA 4OMFB 4PJMA 3O8VA 4XK8E 1RAFB 4A54A 1A0NB 2RQVA 1VQ8T 3P8BB 1M27C 4NCXA 5GJWB 2DVJA 2LJ1A 1VQOQ 3FDRA 2LJ0A 3CMAQ 4QQGA 2JTFA 4E2FB 3L2ZA 3OYBA 2ZPIB 2FO0A 3R6NA 1M1KC 1QKWA 2KDSA 3I5SA 1N8RC 4LDVA 4Q15A 3SFMA 1M30A 3NPFA 4K11A 3P8HA 5GAN2 2EQJA 4N0AA 2QGGA 3CC4Q 1NNHA 2R57A 3GLXA 4IUTA 2LQWA 4J8OA 3SWNC 4JS4A 4C5GA 2BTTA 2P5IA 4UP9A 1VQPA 3OW2A 4M75B 2P0LA 2XKOC 4C8QF 1Q86R 5L8RE 2GF7A 2DTIA 1I4K1 1M1GA 2P0KA 3HPWA 3T9NA 3JCMe 1Y96A 2A37A 2PTKA 3OS5A 2K6DA 2RH2A 1YBYA 2HQEA 4F7UF 3DSQA 2HD0A 5LJ5d 3HKSA 5I21A 2YLBA 2F5TX 2VGNA 4RTUA 4RG8A 1W2BP 4HCZA 3CCRA 3G4SQ 1KC8C 5GAOl 2D8HA 3I7FA 2VKNA 1VQ5Q 2R5MA 4FSSA 3IQLA 3V7SA 4E7JA 2RJEA 3KXTA 4CI0C 3CBMA 5LJ3e 2OAUA 4M77C 1K8AC 2EIFA 3REXA 3CCEQ 1H4SA 3EHQA 4FYYB 2RN8A 3WVEB 4DBFA 2KRMA 2IG0A 3GNFB 1K1ZA 2COZA 2QYZA 2EJFA 3X20B 2HMAA 4LVMA 4KT0E 2E3CA 4BI3A 5FW9A 3I5RA 3ZBDA 1Z7MA 2NWMA 2ZCEA 1UGRB 2HCKA 2FZCB 1VQLT 5I2SA 1S72T 3QSUA 2DEUA 4E7ZA 2E3IA 2GBQA 5CIUA 3CCLQ 1GRIA 1G2BA 2KXDA 1PSEA 4A4EA 3OMCA 4G85A 2FEIA 2X4JA 1G3TA 2RI3A 2X3WD 2VASA 1QLYA 2YLCA 2M02A 1IZ6A 1VQMA 3CCJT 1K73C 1X2HA 2ZT8A 3CQTA 2JS0A 2IVWA 4J9HA 2LP5A 5CKFA 2MF2A 1YJ9A 4YRQA 2C06A 1VQ9Q 1UGPB 1TUCA 2YRDA 3CCUT 1ADYA 1GCQA 2OTLQ 4XEMA 1W6XA 5DLQE 3RMQA 1VQ8Q 4TVYA 1UEBA 3GNGA 5KYXB 1VIEA 3A98A 4YRTA 3QO8A 2DK3A 1N9WA 5GAOq 4C0ZA 2C7IA 2VXEA 4RG2A 1WNLA 3A5ZA 1MHNA 1LVKA 2B86A 3HFZB 4R0KA 4TVAB 3V8LA 1OU9A 1NG2A 3TVTA 3CCVT 1VQOA 5LJ5f 2DERA 1WLPB 1BB9A 3OSSC 3CMAA 2CUDA 2Q5HA 4C0DC 4M78G 5J26A 2QQRA 4XTYA 4KBMB 3EHRA 3V7RA 4P3OA 2PMFA 1MMDA 1TWBA 5CQYA 4J6YA 2L89A 5GANe 2L2PA 3VS0A 4P74C 5GAMh 4YRLA 5E3IA 4HVCA 4OB0B 4C8QA 3CC4A 5C51B 2CP3A 4A63B 5KYUA 4NS5A 4BWAA 4KRTA 3S3MA 1VYVA 4OLFA 1BBWA 1AHJB 3EG9A 4PJLA 2EJ9A 1OZ2A 3VYHB 1E1OA 4ZTUB 4KULA 2R5AA 1NPRA 1QP3A 5D7UA 4M7AB 3AHUA 1E7OA 4PK4A 1J5WA 4F7UA 4M7DC 1YN8A 2O2OA 2EYYA 4LVIA 3KFUA 1D09B 1IGUA 2V8JA 1WJSA 1ZUKA 3PCOA 3GIBA 4C92A 2NLUA 4M7AC 1AVZC 1BI2A 4LDXA 4XTZA 4YPFA 4LVJA 3P8VA 1EIYB 3CCMT 4JS5A 2LTOA 2DIGA 2LT4A 4XU1A 4Y28E 2BE7D 2JVVA 4CH5A 1Q82C 3RR6A 1VQ5A 2XHCA 2CJBA 2EYZA 4QVZA 1B8AA 1XTDA 5HK0A 1AZEA 2RJFA 3ZEHA 3TEHB 1NPPA 4R56A 1N9SA 3GBQA 2DRKA 1KMNA 5D6YA 4M78D 1M1KU 1VQLQ 4DBQA 3CCEA 1HJDA 4LVLA 1N8RU 4C8QE 2AZSA 3NELA 2ZNIA 2OI3A 3META 4YRRA 2O9VA 1WHMA 3OYAA 3M4PA 1SRLA 5L23A 3UF4A 2MOXA 4E7IA 3HXYA 4M78A 1KHCA 3RKWA 4QVCA 2ED0A 1NJIC 3MEVA 3L1AA 3CCJQ 1QVGS 2EAYA 1PWTA 2LC4A 2YUQA 3JCMg 1QP2A 1GL5A 3CCLA 4YRGA 3VQYA 2IY5A 5F5WA 4C92E 1N6AA 4PJOC 4YRCA 1MNDA 4A53A 4ELZC 2DAQA 3MP8A 4N4HA 3I55T 2V8KA 2QAZA 4XU2A 1WHGA 3CCUQ 4FSXA 3MQZA 5FWBA 3TCJA 1Z9ZA 4J5YA 4J9IA 3PVQA 5KYYA 4DQ2A 5GAN8 1VQNT 1EOVA 1OYXA 1RLQC 1BI1A 1VQ9A 5CKDA 4H2SA 1YHQT 1TOVA 4VUBA 1Y71A 5LJ3g 2OTLA 1VQ8A 3OS2A 4V2SA 5GAMj 3CCVQ 3VS4A 4PLLA 4ZIBA 2EGAA 4RTWA 5C0MA 2HBWA 1RABB 3CCST 4XQ3A 2QTXA 1RLPC 2YRCA 1KQSS 4MDXA 3CC2T 1FXXA 3LH0A 4J15A 1HD3A 4M78E 4XTVA 2KQWA 2P4TA 4RCBA 4BE2A 3EFSA 3RKYA 1TTHB 3QWXX 2HEQA 5K1XA 2XI9A 1JBMA 3BE3A 1VQKT 3LW5E 2BUDA 1RAHB 5CK9A 2DXUA 4GLMA 1MUZA 3JB9I 3EFRA 4PJNA 3KUFA 2E70A 3LH5A 4Z8AA 3QWYA 3M55A 2JM9A 2CYZB 1PYSB 2XDBA 1ZA1B 2AKKA 2WSEE 3VQWA 2RQRA 8AT1B 4TVWA 2HKQB 4FT4A 4ZN1A 4M77F 3SHWA 4X5OA 4OMOA 2EGEA 2L3RA 2DL5A 3QJYA 1M3AA 1K73U 2JT4A 1M2OA 3HRIA 5HCKA 2PQWA 1QMCA 2JUFA 2VV5A 4C5IA 1LYLA 3CCMQ 3HY1A 2XU8A 1GBQA 1B7TA 1VQ6T 1E1TA 4EMHA 2J6KA 4YREA 1QVGA 5GAMd 3PIPA 1NYQA 2FL7A 4Q6GA 1M5Q1 1B70B 2J06A 4YRIA 2L3PA 3I35A 3HFOA 1VUBA 1GFDA 1HTTA 4FCYA 4M75G 3N5BB 2ZZEA 1D0XA 3MP1A 3OMGA 1ZSZC 2YRVA 4RQEA 2DX1A 4DBRA 1BCOA 3S6WA 1Q86C 4AG1C 3G71T 2E6ZA 1G5VA 2ZR2A 4YRSA 3EGDA 1SF9A 5GANg 2XD0A 3M4YA 2ZNJA 3UGQA 2V26A 2J05A 4A4GA 4BDYA 3QZ9B 1Z9QA 1MNEA 1M2VA 1WHJA 1YFSA 1VQLA 1WZOA 4AMCA 4PL6A 1PD1A 2FHDA 5IN1A 1N9RA 2EJGA 3C4SA 2CJ9A 4WI1A 2E65A 4ZGEB 5J3BA 4EMKB 2CZ6B 3I55Q 2QHSA 2CJAA 1WXTA 1KQSA 1NE8A 1VQPQ 1SEMA 4BACA 3QUIA 2CGHA 3H0HA 3CCJA 2GTJA 3JB9J 2BE9B 2IIMA 2HDAA 4FU6A 4A4HA 1YHQQ 4D8DA 3TSZA 3CCUA 2QK0A 1M9SA 1E22A 2CIMA 5C52B 2V1QA 3QXEB 2ZT6A 3A8OB 2X4YA 1XJWB 2O9SA 2PUOB 4OB2B 2YHTA 3FB9A 3QYGB 4HXJA 2QTVA 4PFPA 1X75C 3I9QA 2KY9A 2LQNA 5A0GA 2D0QB 4H2XB 3QKJA 4C0FA 4M75D 2PVDB 3EGXB 2YUNA 3CC2Q 2DF6A 4OB1B 4EO4A 2DFUA 4RTZA 3JB9H 2GNCA 4J6XA 1IXDA 3CCVA 1Q82U 1I81A 2QQSA 2RQTA 5DM7R 1VQKQ 3M53A 2OX7A 1UUEA 4M7DF 3VKIA 4M75A 4FW2A 4IKFA 4DPGA 2LX7A 4P75C 5GAMf 4IURA 4P5NA 1G83A 3HXUA 3SB2A 1QVFP 1W66A 1Q7YR 4M7AF 5FU6C 1R0CB 1WYXA 1UFFA 2FZGB 4IUQA 3TSWA 3RDVA 1C0AA 1SESA 1AWOA 4QQ6A 1C6VX 1NJIU 2K5FA 3WXMB 4G84A 2HSPA 2I4OA 1YWPA 1IHWA 2SEMA 2NYSA 3FRNA 1VQMQ 3RKXA 1VQ6Q 2YXYA 2MMPA 4HWOA 3LYIA 5HKCA 4JLGA 3WVDB 4JDSA 1WHHA 4B9XA 4XAXB 3L2VA 2CSQA 2KMTA 1RL2A 1YI2T 2WACA 1WXBA 3CCMA 1H8KA 3X24B 2QDYB 1G5HA 1KMMA 1BBUA 4JRPA 2K3BA 3G71Q 3SEMA 4M4ZA 2DLPA 1NLOC 1OEBA 4M75E 3CPFA 4JZ4A 5AYFA 2OTJT 3OYMA 1AD5A 4J9EA 4PJOF 1FMKA 2LNVA 2OAWA 4NL3A 1EIFA 3HY0A 3V7CA 1EFWA 4HCBA 2RHQB 5CR2A 5GMKm 3ER0A 3UGTA 4CS2A 1IHVA 1H92A 2HL3A 2K9GA 3DB3A 2EYWA 3SWNB 2PU9B 2EPDA 1AWXA 2K79A 3CPWS 2EQKA 1SSHA 4UP8A 1HYOA 4ZTZB 2ED1A 3A5YA 5GMKh 3ICAA 2VUBA 3HRSA 2QG9B 1HC7A 1H4QA 2KRSA 5GAOp 3F70A 4TTVA 2MIOA 1Q95G 5KYXA 4FIBA 3I55A 3OYJA 4PG3A 3QPHA 4P72C 3FEOA 2FYKA 1BYMA 3R07A 4N4GA 4HCKA 2IPOB 3HFZA 4TVAA 1IGQA 1VQNA 3EAEA 2JMCA 1CSKA 1RACB 4QKUA 3JCMc 4X1VA 3C0CA 1D1AA 3RESA 1YHQA 2CSIA 3L42A 4DEYA 1QWEA 5LL6S 2BIVA 3JCMb 4CH4A 4H2WA 1I8FA 2ZAEA 3GOXA
chains in the Genus database with same CATH topology
4M77B 1B76A 2JNGA 4X34A 4MDWA 5IAYA 3CCSA 3A7UA 2P0PA 3CC2A 4RCCA 3CC7T 1Q86U 2O4XB 4KUIA 2J3MA 1VQKA 3UWNA 4M7AA 1EQRA 2ZPEB 4E7LA 5A2QE 4C8QG 4BY6C 3M4QA 5C53B 3ASKA 2K3XA 3CD6T 5CVIA 4K87A 4F7UG 4UPAA 2JN0A 1EIYA 5ELOA 3TUPA 1VQZA 4IUVA 3M57A 4C92G 3FC3A 5IT9E 3LGFA 1YFRA 1VQ6A 2BKDN 3CPWA 3PMTA 2E5AA 3TEHA 4TWAA 5LJ5e 2KVQG 3OBWA 1N27A 3QHSA 3OYDA 2AKWB 3J7AF 3PFSA 2CKKA 1YJWT 3JCMW 5GMKj 4C0DB 1G5IA 4M7AE 3VQXA 3G71A 1YGBA 4HWRA 3M5AA 3DKMA 4BW9A 5CKEA 3CXCS 1QW1A 4YCUA 4YCWA 3VBBA 3MP6A 3ZFJA 2ZT5A 4N4IA 3PIOA 4C8QD 5FRNA 2DXTA 4KR2A 4X9CA 3CMET 2DDZA 3A7RA 2EFIA 2DU5A 3LWHA 4FT2A 2V8IA 4M7DB 2FB7A 3CCQT 2PVGB 3MEAA 2CZ0B 2DQ3A 3A8GB 4P71A 5DY9A 4C92D 3J80E 2HNIA 5D6XA 2HBPA 3QG1A 1R8OB 5GAN6 2QHTA 4YRKA 3VYGA 2KAFA 2HQXA 2DXBA 4E51A 4UC4A 1LJOA 3M58A 1BKBA 3GF5A 1NJ6A 4KUDK 2RD1A 1ATIA 5KCHA 2LCCA 3QIIA 3OYGA 5FROA 4BI4A 2WSCE 2QHUA 3HFVA 4C5EA 3H6ZA 3BDUA 3G1ZA 4XTXA 2QI2A 1D3BB 1PYSA 1WQ7A 1V29B 2DO3A 3VU3C 1YITT 4OGCA 1Z7NA 2QQAA 4PJOB 1KOGA 3L2UA 3JCMP 2E64A 4F7UE 4A4KA 2XICA 2XDPA 3CXCA 4MMLA 3PNWC 1MGQA 1B70A 1M1FA 3NEMA 2P0QA 3S3NA 3RF1A 3RGLA 4HT4A 1OI1A 1JRIA 1NJ8A 2K4YA 3OYLA 4TQFA 2RO0A 3OS0A 4O6JA 1I5LA 3OYCA 2LQKA 4ZTFA 2RHUA 5CAIA 3IALA 2ZZGA 3QYHB 3UT1A 4XEOA 3HP9A 1Q7YC 5A0DA 4MMKA 5CCAA 4TVRA 3JB9F 1O75A 3JCMV 1VQ4T 2E10A 5GMKi 1UGSB 1KC8U 4BUGA 3ME9A 3I56T 2ZINA 2XG8D 2ZXFA 5GAN7 3E9HA 2X4XA 1E24A 4EMKA 2ZZDA 4HT8A 4D6WA 2I4LA 3X26B 2EKOA 4DA4A 2Q5IA 4YDQA 4P73A 1K8AU 4QQDA 4BB7A 3RL6A 5CO7A 3E1SA 3PMIA 3P8YA 4LNSA 4YCVA 5GMKl 2XTIA 4C8QC 1BI0A 5ELNA 4H2XA 1ADJA 2ZR3A 4L6V5 2K5LA 3JCMh 3OYIA 3HRKA 5LJ5g 2C8MA 4RMFA 4YROA 2GFUA 4EDUA 1M4ZA 4J7IA 4C92C 3L2RA 2ZT7A 2DJZA 2E5QA 3KBGA 2Q7GA 4CS3A 3V8KA 4B9WA 3FLGA 4HT9A 5LJ3h 3CC7A 3UDCA 2M16A 2EL9A 2RHSB 5EG2A 5CQXA 3BDLA 1YJ9T 2LCLA 3V8JA 3CD6A 1H4TA 1S72A 4M77G 2ALYB 1G3YA 4M78C 1YJNT 4JJNK 4QVDA 2JZ2A 2Y4YA 4C5HA 2ZIMA 2O01E 4KQEA 5HY6A 1XOVA 4LDYA 2A3LA 3MEUA 3TREA 5D6WA 3E9GA 2A8EA 4O5VA 2AMCB 5GAN4 3VUZA 2E41A 2CZ1B 1LNXA 1ASYA 3LGLA 3TU4K 3DB4A 1ZBXA 3LX7A 3M56A 4CH3A 3QZ5B 2RHQA 3QBYA 2ZPGB 3PZCA 1FX7A 4Z02A 4XU0A 5GAMe 1L0WA 4WF2A 1YJWA 1B34B 3SWNA 3CC4T 2RJDA 2ZPFB 4LVKA 3QO5A 1QE0A 2PUKB 3G6ET 3OQ5A 1NJ1A 5KH6A 2ODRD 3OY9A 2GQVA 3NTKA 4LDUA 3HL8A 5FU6B 2QXFA 4CRIA 2DPPB 5C6SA 1B7YB 3CMQA 5GANh 4M77D 5M9OA 2Q7EA 3JCMX 2E6NA 4ZGDB 3CCQA 1WJQA 3TEGA 4ZGJB 3E19A 3G4ST 1NZ9A 4A4FA 4M77A 2GCXA 1K9MC 3P8DA 2K3YA 2DXCA 2EYQA 5LJ3j 4OVAA 4MZPA 4Q5WA 1WPYA 3UFGA 3CCET 1VQ7T 3M9QA 2O4XA 5HGQA 3PGGA 2I2LA 4XTWA 1KD1C 2RM4A 3IKLA 2Y90A 4YRFA 4M7DG 1RIQA 4K88A 1Q7YU 3JCMJ 3G7ZA 3GP8A 4H2YA 4O2DA 3JCMd 3HRUA 5GAN5 4M7AG 3FIFA 3HHTB 3LLRA 2RB6A 3CEYA 3W3SA 3SD4A 1YITA 4IUPA 4H02A 3VQVA 2QEXT 3DLLA 3REUA 2QHVA 2B8AA 2LRQA 4II1A 4XTUA 3HSBA 2VC8A 4M77E 3UH0A 4L59A 2OTLT 2X4WA 2JTMA 3C94A 5KCOA 5LJ3d 2LX9A 1WGSA 3HXWA 2AKWA 2DD4A 5FLXE 1YIJT 2Q7HA 2K2VA 4ZN3A 2FVUA 4MZTA 3MHXA 4P74A 4PJOG 4M7DD 1VQ4A 5GANj 3C95A 2QA4T 3I56A 2DEQA 2LT1A 1GXIE 4JUVA 2J3LA 4M7AD 4M7DA 2AHJB 4HCCA 4KR3A 4BY6B 4PNOA 5CKHA 4M75C 3HXVA 3QO7A 2QQBA 1SRYA 1O9SA 4YTLA 2ODRC 2GFAA 2ZGWA 4C92F 1WYDA 5GAOn 2R58A 4L5GA 2PVOB 11ASA 3LSSA 1YB3A 1NJ5A 4YYEA 3JCMf 4BE0A 3NTHA 2E1HA 2L5QA 2Y4XA 3MO8A 2DZCA 4P3NA 1X2GA 3BJUA 3QTCA 4Y91A 1QVFS 3L4GB 1ZHIA 1HK9A 4H2TA 3X28B 1JJCB 4DOVA 5GAMg 2DTOA 1VIFA 5GANd 4PJOD 2NS6A 1D3BA 1USYC 3J81E 2ZPBB 2ZZFA 1U8RA 4M7DE 1X01A 5LJ3f 1M8VA 3VJPA 4M78F 1H641 3RIRA 1QVPA 3RACA 4PJOA 3P8TA 2DTHA 1SSFA 5KE3A 2H3JA 2G4CA 4HWPA 2EQUA 2MAMA 4L87A 4JLIA 3INZA 4QW2A 4EMGA 4YP0A 1OZ3A 3A8LB 1Q81C 4K86A 2ZCFB 2ZPHB 3OYEA 4WJ3M 4EX5A 2MWOA 5A0LA 1YJNA 4N0AC 1ASZA 2RHYA 4ME7A 3VUBA 1Y96B 4ZTJA 2E12A 2ARSA 1P92A 1U1SA 3LSQA 1K9MU 1NJ2A 4JRQA 2M0OA 5K1PA 2LQ8A 2K5IA 2XK0A 1IREB 2MI6A 2RHZA 3WQZA 4UP7A 4PJOE 2DVEA 3A32A 4DOWA 3UPUA 5GAN3 1KD1U 4CH6A 1QF6A 3QO3A 3G6EA 4OF1A 2DIQA 1X6OA 4FM4B 3L2WA 3HFNA 2QQ9A 1QVFA 1WU7A 3QDRB 5GANf 3M54A 3ERRA 3HTZA 2XDDA 5FU7B 3GPLA 1W2BS 4OP0A 4RKUE 3JAME 1JB0E 4NOYA 4YRMA 1FYFA 4YRPA 3OS1A 2RI5A 3HXXA 2WSFE 3G4SA 4LD9K 1YFTA 3JRZA 5FU7C 4BDZA 4H2VA 1U1TA 3CBPA 3NENA 4PKCC 4TQDA 1WQWA 1WJRA 3MCAB 2RHIA 1VQ7A 3LWIA 1RI0A 4ATOA 3OYFA 1UB4A 1YI2A 4HA8A 2RHSA 3FJPA 3A5ZB 4ELYC 3NTIA 2D9TA 5GMKe 3A8HB 3MF1A 1SETA 4EPCA 1UGQB 3OYHA 1HXDA 4NL2A 2ALYA 2OTJA 1JJ2S 3M59A 1W4SA 4FL6A 2G3RA 3JSCA 1VQPT 1XNIA 1M90C 2QEXA 2MWPA 5GAOm 2XGTA 1YCYA 2F5KA 4C8QB 1XQHA 4HWTA 2AMCA 1G3WA 4JRIA 1LOJA 2ARTA 2CZ7B 2EQMA 2HAXA 4YRJA 3PTAA 2VGMA 3NETA 4F7UB 3CCRT 3DLMA 2A7YA 4BD3A 4C0GA 1KHIA 4IUUA 1YIJA 4JRKA 3BW1A 4E47A 4R55A 1B34A 1EVLA 2I4NA 4E7KA 1GGMA 5KNNA 3PCOB 4C92B 4P71C 2RK2A 5J39A 1TH7A 3NFCA 2VXFA 3VV0A 1W2BA 4LD6A 3JB9G 4P75A 4PHCA 2I4MA 4M75F 3MEWA 3A31A 3QJ6A 2K57A 1FWZA 3S3OA 2QA4A 2LDMA 1B7YA 4HWSA 5I2MA 3OA6A 1G3SA 2VYTA 4WJ4A 3JCMQ 4J6WA 2DD5A 1H4VB 3A74A 1VQMT 2RK1A 4M78B 3RMSA 1SERA 2ZTGA 3LC0A 2KSSA 1Q81U 4HKEA 2M1HA 2L8DA 2IY5B 1G51A 1H3ZA 1JJ2A 3HRTA 2F69A 3BFMA 3PT9A 1KQ2A 3OB9A 2RHXA 3JB9D 12ASA 2RI2A 1VQOT 2DQ0A 3SDZA 5CKBA 1X54A 3CMAT 5LJ5h 3Q1JA 4MZMA 4J83A 5GAOr 2DKGA 1BIAA 5KE2A 3RERA 3M4GA 1Y07A 3C12A 4H2UA 3A7AA 4BE1A 4RQFA 3R6OA 2RA2A 4OGEA 4P72A 4P3PA 4EMKC 3X25B 2JOYA 4E7HA 3RUXA 2EWNA 1BIBA 1KG1A 2DU7A 3QNEA 1DJ7B 1PSFA 2CS7A 4P73C 4XU3A 4GLKA 3HXZA 3IG2A 2PMEA 3TEEA 3CMEA 3MF2A 3E9FA 3OD1A 4RDXA 3CBOA 4X9DA 1EVKA 2LVMA 2KK4A 4OB3B 3OYYA 1VQ5T 1BI3A 1IL2A 2M9UA 3OW2S 3E9IA 2DZ9A 3L2QA 2X35A 3OBYA 1X56A 1WLEA 4AH6A 3OYKA 4J7FA 3MEYA 2ARUA 3URGA 5DLOA 3OSVA 4RMOA 3A8MB 1Y7XA 3CCLT 3IKMB 4GY5A 4CS4A 4PLIA 1KQ1A 1M90U 1USYA 4BI8B 4LDWA 5HK3A 3BY7A 3L4GA 1NYRA 5LJ5j 1X55A 3OYNA 2RJCA 1JJCA 3H8ZA 1ZQ1A 1VQ9T 2ZIOA 4YRNA 2XIDA 5FRMA 2D6FA 4OMFB 3O8VA 4XK8E 4A54A 1VQ8T 3P8BB 4NCXA 3FDRA 4QQGA 2JTFA 3L2ZA 3OYBA 2ZPIB 1M1KC 2KDSA 1N8RC 4LDVA 4Q15A 3SFMA 3P8HA 5GAN2 2EQJA 4N0AA 1NNHA 2R57A 3GLXA 4IUTA 4J8OA 3SWNC 4JS4A 4C5GA 2P5IA 4UP9A 1VQPA 3OW2A 4M75B 2P0LA 2XKOC 4C8QF 5L8RE 2GF7A 2DTIA 1I4K1 1M1GA 2P0KA 3HPWA 3T9NA 3JCMe 1Y96A 3OS5A 2RH2A 1YBYA 2HQEA 4F7UF 3DSQA 2HD0A 5LJ5d 3HKSA 5I21A 2YLBA 2F5TX 2VGNA 4RG8A 4HCZA 3CCRA 1KC8C 5GAOl 3I7FA 2R5MA 3V7SA 4E7JA 2RJEA 3KXTA 4CI0C 3CBMA 5LJ3e 2OAUA 4M77C 1K8AC 2EIFA 3REXA 1H4SA 3WVEB 2IG0A 3GNFB 3X20B 2EJFA 4LVMA 4KT0E 2E3CA 4BI3A 1Z7MA 3ZBDA 2ZCEA 1UGRB 1VQLT 5I2SA 1S72T 3QSUA 5CIUA 1PSEA 4A4EA 3OMCA 4G85A 2X4JA 1G3TA 2RI3A 2YLCA 1IZ6A 1VQMA 3CCJT 1K73C 1X2HA 2ZT8A 2IVWA 5CKFA 2MF2A 1YJ9A 4YRQA 2C06A 1UGPB 3CCUT 1ADYA 4XEMA 5DLQE 3RMQA 4TVYA 1UEBA 3GNGA 1VIEA 4YRTA 3QO8A 2DK3A 1N9WA 5GAOq 4C0ZA 2C7IA 2VXEA 4RG2A 1WNLA 3A5ZA 1MHNA 3HFZB 4TVAB 3V8LA 3CCVT 1VQOA 5LJ5f 3OSSC 2Q5HA 3CMAA 4C0DC 4M78G 5J26A 2QQRA 4XTYA 4KBMB 3V7RA 4P3OA 2PMFA 5CQYA 4J6YA 2L89A 5GANe 4P74C 5GAMh 4YRLA 5E3IA 4HVCA 4OB0B 4C8QA 3CC4A 5C51B 4NS5A 4BWAA 3S3MA 4OLFA 1BBWA 1AHJB 2EJ9A 1OZ2A 3VYHB 1E1OA 4ZTUB 4KULA 2R5AA 1NPRA 1QP3A 4M7AB 3AHUA 1J5WA 4F7UA 4M7DC 4LVIA 3KFUA 2V8JA 1WJSA 3PCOA 3GIBA 4C92A 2NLUA 4M7AC 4LDXA 1BI2A 4XTZA 4YPFA 4LVJA 3P8VA 1EIYB 3CCMT 4JS5A 2LTOA 2DIGA 2LT4A 4XU1A 4Y28E 2JVVA 4CH5A 1Q82C 1VQ5A 2XHCA 2CJBA 4QVZA 1B8AA 1XTDA 5HK0A 2RJFA 3ZEHA 3TEHB 1NPPA 4R56A 1N9SA 1KMNA 5D6YA 4M78D 1M1KU 3CCEA 4LVLA 1N8RU 4C8QE 3NELA 2ZNIA 3META 4YRRA 3OYAA 3M4PA 4E7IA 3HXYA 4M78A 1KHCA 3RKWA 4QVCA 1NJIC 3MEVA 3L1AA 1QVGS 2EAYA 2LC4A 3JCMg 1QP2A 3CCLA 4YRGA 3VQYA 2IY5A 5F5WA 4C92E 1N6AA 4PJOC 4YRCA 4A53A 4ELZC 2DAQA 3MP8A 4N4HA 3I55T 2V8KA 4XU2A 4FSXA 3MQZA 3TCJA 4J5YA 4DQ2A 5GAN8 1VQNT 1EOVA 1OYXA 1BI1A 1VQ9A 5CKDA 4H2SA 1YHQT 4VUBA 1Y71A 5LJ3g 2OTLA 1VQ8A 3OS2A 4V2SA 5GAMj 4PLLA 4ZIBA 5C0MA 3CCST 4XQ3A 2QTXA 1KQSS 4MDXA 3CC2T 1FXXA 3LH0A 4J15A 4M78E 4XTVA 2KQWA 2P4TA 4RCBA 4BE2A 3EFSA 3RKYA 5K1XA 2XI9A 1JBMA 1VQKT 3LW5E 2BUDA 5CK9A 2DXUA 3JB9I 3EFRA 3KUFA 2E70A 3M55A 2CYZB 1PYSB 2XDBA 2WSEE 3VQWA 4TVWA 4FT4A 4ZN1A 4M77F 4X5OA 2L3RA 3QJYA 1K73U 3HRIA 2PQWA 2JUFA 2VV5A 4C5IA 1LYLA 3HY1A 2XU8A 1E1TA 1VQ6T 4EMHA 4YREA 1QVGA 5GAMd 3PIPA 1NYQA 2FL7A 4Q6GA 1M5Q1 1B70B 4YRIA 3HFOA 1VUBA 1HTTA 4M75G 3N5BB 2ZZEA 3MP1A 3OMGA 2YRVA 4RQEA 3S6WA 1Q86C 3G71T 2E6ZA 2ZR2A 1G5VA 4YRSA 5GANg 2XD0A 3M4YA 2ZNJA 3UGQA 4A4GA 4BDYA 3QZ9B 1YFSA 1VQLA 4PL6A 2FHDA 5IN1A 1N9RA 2EJGA 3C4SA 2CJ9A 4WI1A 2E65A 4ZGEB 5J3BA 4EMKB 2CZ6B 2QHSA 2CJAA 1KQSA 1NE8A 4BACA 3QUIA 2CGHA 3CCJA 3JB9J 4FU6A 4A4HA 3CCUA 1M9SA 1E22A 2CIMA 5C52B 3QXEB 2ZT6A 3A8OB 2X4YA 2PUOB 4OB2B 2YHTA 3FB9A 3QYGB 1X75C 2KY9A 5A0GA 2D0QB 4H2XB 3QKJA 4C0FA 4M75D 2PVDB 4OB1B 4EO4A 3JB9H 4J6XA 3CCVA 1Q82U 1I81A 2QQSA 5DM7R 3M53A 4M7DF 3VKIA 4M75A 4IKFA 4DPGA 4P75C 5GAMf 4IURA 4P5NA 3HXUA 3SB2A 1W66A 4M7AF 5FU6C 4IUQA 1C0AA 1SESA 4QQ6A 1NJIU 2K5FA 3WXMB 4G84A 2I4OA 3FRNA 3RKXA 2MMPA 4HWOA 3LYIA 5HKCA 4JLGA 3WVDB 4JDSA 4B9XA 4XAXB 3L2VA 2KMTA 1RL2A 1YI2T 2WACA 3CCMA 3X24B 2QDYB 1G5HA 1KMMA 1BBUA 4JRPA 4M75E 3CPFA 5AYFA 2OTJT 3OYMA 4PJOF 2LNVA 4NL3A 1EIFA 3HY0A 3V7CA 1EFWA 4HCBA 2RHQB 5CR2A 5GMKm 3ER0A 3UGTA 4CS2A 3DB3A 3SWNB 2PU9B 3CPWS 2EQKA 4UP8A 4ZTZB 3A5YA 5GMKh 3ICAA 2VUBA 3HRSA 1HC7A 1H4QA 5GAOp 3F70A 4TTVA 4FIBA 3I55A 3OYJA 4PG3A 3QPHA 4P72C 3FEOA 2FYKA 1BYMA 3R07A 4N4GA 3HFZA 4TVAA 1VQNA 3EAEA 3JCMc 1YHQA 3RESA 3L42A 4CH4A 5LL6S 2BIVA 3JCMb 4H2WA 1I8FA 3GOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ9 A;  4M77 B;  1B76 A;  1B7Y B;  1E1O A;  3CMQ A;  4ZTU B;  5GAN h;  3JB9 G;  4P75 A;  4PHC A;  4M77 D;  4M7A B;  3AHU A;  2Q7E A;  1J5W A;  3JCM X;  3A7U A;  4F7U A;  2I4M A;  4M75 F;  4M7D C;  3TEG A;  3A31 A;  4RCC A;  2K57 A;  3KFU A;  3PCO A;  3GIB A;  4C92 A;  4M77 A;  1B7Y A;  2J3M A;  4HWS A;  4M7A C;  4M7A A;  1EQR A;  5LJ3 j;  4XTZ A;  4YPF A;  3P8V A;  1WPY A;  3UFG A;  1EIY B;  4WJ4 A;  4C8Q G;  3JCM Q;  4J6W A;  4XU1 A;  3M4Q A;  5C53 B;  1H4V B;  4CH5 A;  5HGQ A;  3PGG A;  2CJB A;  3A74 A;  1B8A A;  2I2L A;  4XTW A;  2RM4 A;  4K87 A;  4M78 B;  4F7U G;  3IKL A;  3TEH B;  2Y90 A;  4YRF A;  1SER A;  2ZTG A;  4UPA A;  1N9S A;  1KMN A;  4M7D G;  1RIQ A;  4K88 A;  4M78 D;  3LC0 A;  2JN0 A;  1EIY A;  3JCM J;  5ELO A;  3TUP A;  1VQZ A;  4C8Q E;  3NEL A;  2ZNI A;  2IY5 B;  4YRR A;  1G51 A;  4C92 G;  4H2Y A;  3M4P A;  4O2D A;  1YFR A;  3JCM d;  5GAN 5;  4M7A G;  3HXY A;  2E5A A;  3FIF A;  4M78 A;  3RKW A;  3TEH A;  4QVC A;  2RB6 A;  4TWA A;  5LJ5 e;  3BFM A;  3W3S A;  4H02 A;  3L1A A;  3VQV A;  2EAY A;  1KQ2 A;  3JCM g;  3QHS A;  4YRG A;  3REU A;  3VQY A;  3JB9 D;  2AKW B;  5F5W A;  2IY5 A;  2QHV A;  12AS A;  4C92 E;  4PJO C;  4YRC A;  4XTU A;  4A53 A;  2DQ0 A;  3HSB A;  1X54 A;  2VC8 A;  3JCM W;  4M77 E;  5GMK j;  4XU2 A;  5LJ5 h;  3UH0 A;  5GAO r;  2DKG A;  1G5I A;  1BIA A;  4M7A E;  3VQX A;  1YGB A;  4HWR A;  4BW9 A;  4J5Y A;  3RER A;  5LJ3 d;  3M4G A;  3HXW A;  4YCU A;  2AKW A;  4DQ2 A;  5GAN 8;  1EOV A;  4YCW A;  3VBB A;  2ZT5 A;  4H2U A;  3A7A A;  4H2S A;  2Q7H A;  4RQF A;  2RA2 A;  4P72 A;  5LJ3 g;  4C8Q D;  2DXT A;  4V2S A;  5GAM j;  4KR2 A;  4P3P A;  4X9C A;  4ZIB A;  4EMK C;  2DDZ A;  3A7R A;  2DU5 A;  4P74 A;  3RUX A;  2EWN A;  1BIB A;  4XQ3 A;  4M7D B;  2QTX A;  2FB7 A;  4PJO G;  2DU7 A;  3QNE A;  4P73 C;  4M7D D;  4XU3 A;  5GAN j;  3HXZ A;  4J15 A;  2DQ3 A;  4M78 E;  4XTV A;  4P71 A;  4RCB A;  3IG2 A;  5DY9 A;  2DEQ A;  2PME A;  3MF2 A;  3EFS A;  4C92 D;  3RKY A;  2HNI A;  5K1X A;  4JUV A;  1JBM A;  2J3L A;  4M7A D;  2DXU A;  4M7D A;  5GAN 6;  2QHT A;  3OD1 A;  4YRK A;  3JB9 I;  4KR3 A;  3EFR A;  4RDX A;  4E51 A;  1LJO A;  4X9D A;  1EVK A;  4PNO A;  4M75 C;  3HXV A;  3QO7 A;  1SRY A;  1NJ6 A;  1IL2 A;  2RD1 A;  1ATI A;  2ODR C;  3E9I A;  2DZ9 A;  2ZGW A;  1PYS B;  3VQW A;  4C92 F;  1WYD A;  5GAO n;  4TVW A;  4M77 F;  4X5O A;  1X56 A;  1WLE A;  2QHU A;  3HFV A;  11AS A;  4AH6 A;  3LSS A;  1YB3 A;  1NJ5 A;  4YYE A;  3HRI A;  3JCM f;  2E1H A;  3HY1 A;  1LYL A;  3BDU A;  1E1T A;  4XTX A;  3G1Z A;  4EMH A;  1D3B B;  3MEY A;  1PYS A;  2DZC A;  4P3N A;  1X2G A;  2ARU A;  3BJU A;  1WQ7 A;  3QTC A;  4YRE A;  5GAM d;  1NYQ A;  4Y91 A;  3VU3 C;  4Q6G A;  1M5Q 1;  1B70 B;  3L4G B;  1HK9 A;  4YRI A;  4H2T A;  3HFO A;  1HTT A;  3IKM B;  4CS4 A;  1JJC B;  4M75 G;  5GAM g;  1Z7N A;  2ZZE A;  4PJO B;  2DTO A;  1KOG A;  4RQE A;  1KQ1 A;  3JCM P;  5GAN d;  4PJO D;  1D3B A;  1USY C;  1USY A;  2E64 A;  4F7U E;  2ZZF A;  2ZR2 A;  4M7D E;  1X01 A;  3BY7 A;  4MML A;  5LJ3 f;  1M8V A;  4YRS A;  1MGQ A;  5GAN g;  1B70 A;  3L4G A;  3NEM A;  4M78 F;  2ZNJ A;  1H64 1;  1NYR A;  3UGQ A;  5LJ5 j;  3RIR A;  1X55 A;  3RF1 A;  3RGL A;  1JRI A;  3RAC A;  1JJC A;  1NJ8 A;  1YFS A;  4PJO A;  4TQF A;  3P8T A;  4YRN A;  2ZIO A;  2DTH A;  2G4C A;  4A54 A;  4HWP A;  1I5L A;  4L87 A;  4JLI A;  1N9R A;  2EJG A;  3INZ A;  4NCX A;  2CJ9 A;  4WI1 A;  2E65 A;  4EMG A;  5CAI A;  3IAL A;  2ZZG A;  4EMK B;  2QHS A;  2CJA A;  4YP0 A;  4XEO A;  3L2Z A;  3QUI A;  2CGH A;  4K86 A;  4MMK A;  3JB9 F;  4Q15 A;  3JCM V;  3JB9 J;  4WJ3 M;  2E10 A;  5GMK i;  4EX5 A;  4N0A C;  1ASZ A;  5GAN 2;  4N0A A;  2ZIN A;  2ZXF A;  3E9H A;  5GAN 7;  1E24 A;  4EMK A;  1E22 A;  1Y96 B;  2CIM A;  5C52 B;  1NNH A;  2ARS A;  4HT8 A;  2ZT6 A;  2I4L A;  2Q5I A;  4YDQ A;  1U1S A;  4P73 A;  3SWN C;  2YHT A;  3LSQ A;  3FB9 A;  1NJ2 A;  2P5I A;  4UP9 A;  3RL6 A;  4M75 B;  2P0L A;  4H2X B;  4C8Q F;  3P8Y A;  5K1P A;  4M75 D;  2DTI A;  4EO4 A;  1I4K 1;  3JB9 H;  3JCM e;  4LNS A;  4YCV A;  1Y96 A;  4J6X A;  5GMK l;  2XTI A;  3WQZ A;  1I81 A;  4UP7 A;  4C8Q C;  4PJO E;  2DVE A;  3A32 A;  4F7U F;  3DSQ A;  5LJ5 d;  5GAN 3;  4CH6 A;  4M7D F;  1QF6 A;  3QO3 A;  5ELN A;  4M75 A;  5I21 A;  2YLB A;  4H2X A;  1ADJ A;  2ZR3 A;  4DPG A;  3JCM h;  4P75 C;  5GAM f;  3HRK A;  5LJ5 g;  2C8M A;  3HFN A;  4RMF A;  5GAO l;  3HXU A;  3I7F A;  3SB2 A;  4YRO A;  1W66 A;  1WU7 A;  3V7S A;  4M7A F;  4C92 C;  5LJ3 e;  1C0A A;  1SES A;  5GAN f;  2ZT7 A;  3ERR A;  4M77 C;  3REX A;  3HTZ A;  1H4S A;  2DJZ A;  4G84 A;  2Q7G A;  4CS3 A;  2I4O A;  4OP0 A;  3V8K A;  4NOY A;  4YRM A;  2EJF A;  3RKX A;  4HT9 A;  1FYF A;  2E3C A;  4YRP A;  5LJ3 h;  1Z7M A;  3HXX A;  4HWO A;  2ZCE A;  1YFT A;  3QSU A;  4H2V A;  1U1T A;  2EL9 A;  3NEN A;  2RHS B;  4TQD A;  1WQW A;  4G85 A;  3V8J A;  1G5H A;  1KMM A;  1BBU A;  2YLC A;  1H4T A;  4M75 E;  4M77 G;  2ALY B;  1X2H A;  4HA8 A;  4M78 C;  2ZT8 A;  2RHS A;  3FJP A;  4PJO F;  4QVD A;  4YRQ A;  4KQE A;  2ZIM A;  4NL3 A;  3HY0 A;  3V7C A;  5GMK e;  1EFW A;  3MF1 A;  1ADY A;  4XEM A;  1SET A;  2RHQ B;  5GMK m;  3UGT A;  4CS2 A;  4TVY A;  1HXD A;  3SWN B;  4NL2 A;  2ALY A;  4YRT A;  3QO8 A;  1N9W A;  5GAO q;  2C7I A;  2AMC B;  2VXE A;  5GAN 4;  4UP8 A;  2E41 A;  1WNL A;  3A5Z A;  4ZTZ B;  3A5Y A;  5GMK h;  3ICA A;  1LNX A;  1ASY A;  1HC7 A;  1H4Q A;  3HFZ B;  5GAO m;  4TVA B;  3V8L A;  5GAO p;  4CH3 A;  2RHQ A;  4TTV A;  3PZC A;  1YCY A;  2XGT A;  5LJ5 f;  1L0W A;  4XU0 A;  5GAM e;  4WF2 A;  4C8Q B;  1B34 B;  2Q5H A;  4PG3 A;  3SWN A;  4P72 C;  4M78 G;  4HWT A;  3QO5 A;  2AMC A;  2FYK A;  1QE0 A;  4JRI A;  1LOJ A;  2ART A;  4XTY A;  3V7R A;  3R07 A;  4P3O A;  2PMF A;  4YRJ A;  4J6Y A;  3NET A;  5GAN e;  4F7U B;  1NJ1 A;  4P74 C;  3HFZ A;  4TVA A;  2ODR D;  5GAM h;  4YRL A;  4JRK A;  5E3I A;  3JCM c;  3BW1 A;  4HVC A;  3RES A;  4C8Q A;  5C51 B;  1B34 A;  1EVL A;  4CH4 A;  2I4N A;  3JCM b;  1GGM A;  4BWA A;  5KNN A;  4H2W A;  3PCO B;  1I8F A;  4C92 B;  4P71 C;  4OLF A;  1TH7 A;  1BBW A;  2VXF A; 
#chains in the Genus database with same CATH topology
 4M77 B;  1B76 A;  2JNG A;  4X34 A;  4MDW A;  2K7A A;  5IAY A;  3CCS A;  3A7U A;  1E6G A;  4PFO A;  4CC7 A;  2AZV A;  2P0P A;  3CC2 A;  4RCC A;  2JJ9 A;  3EFO B;  1T3L A;  4LN2 A;  3CC7 T;  1Q86 U;  2O4X B;  2FPD A;  4KUI A;  4OMM A;  2J3M A;  1VQK A;  3UWN A;  4OMQ A;  4M7A A;  1X6G A;  1EQR A;  2ZPE B;  2EBP A;  4E7L A;  1Y57 A;  2AIR B;  5A2Q E;  4C8Q G;  4BY6 C;  2A0F B;  3M4Q A;  5C53 B;  4RTV A;  2ROT A;  3ASK A;  2K3X A;  3CD6 T;  2EGC A;  1PCX A;  1UJY A;  5CVI A;  2XMF A;  4K87 A;  4F7U G;  4J9C A;  4UPA A;  2JN0 A;  1EIY A;  5ELO A;  3TUP A;  4AFQ C;  2VVK A;  1QWF A;  1VQZ A;  4IUV A;  2QGF B;  2I0N A;  3M57 A;  2F2X A;  4C92 G;  1PRM C;  3FC3 A;  2FPE A;  5IT9 E;  3LGF A;  1YFR A;  3NHN A;  1AWW A;  1VQ6 A;  2BKD N;  1JJ2 P;  3CPW A;  3PMT A;  2ATC B;  2E5A A;  3REB B;  3TEH A;  2M0Y A;  2LJ3 A;  4TWA A;  5LJ5 e;  2KVQ G;  2VB6 A;  1AT1 B;  1KFZ A;  3OBW A;  1N27 A;  1U3O A;  4JJB A;  2FZK B;  3QHS A;  3OYD A;  2AKW B;  2P4R A;  3J7A F;  4ZNX A;  3PFS A;  2JXB A;  2CKK A;  1YJW T;  3JCM W;  5GMK j;  4C0D B;  2DYI A;  1TS9 A;  1G5I A;  4M7A E;  1K9M R;  3VQX A;  3G71 A;  1YGB A;  1TG0 A;  4F04 B;  4HWR A;  3M5A A;  3DKM A;  4BW9 A;  2KYM A;  5CKE A;  3CXC S;  1EZZ B;  3M0R A;  1QW1 A;  2KE9 A;  2LNH B;  1FYN A;  4YCU A;  4YCW A;  2K2M A;  1UE9 A;  1BU1 A;  3VBB A;  3MP6 A;  3ZFJ A;  2ZT5 A;  4N4I A;  3PIO A;  1TUG B;  4Z89 A;  4C8Q D;  5FRN A;  2DXT A;  5IXF A;  1J3T A;  2JS2 A;  4KR2 A;  1KD1 R;  1UEC A;  4X9C A;  3CME T;  2DDZ A;  3A7R A;  2C0I A;  2SRC A;  2EFI A;  2DU5 A;  3LWH A;  4FT2 A;  2V8I A;  4M7D B;  2FB7 A;  3CCQ T;  2PVG B;  3MEA A;  4E6R A;  2CZ0 B;  2DQ3 A;  2YUO A;  3A8G B;  4P71 A;  5DY9 A;  7AT1 B;  4C92 D;  3J80 E;  2HQH A;  2HNI A;  1RAD B;  2KBT A;  5D6X A;  2HBP A;  3QG1 A;  1R8O B;  2D0N A;  5I11 A;  5GAN 6;  2QHT A;  4YRK A;  3VYG A;  2KAF A;  2HQX A;  2DXB A;  4E51 A;  4UC4 A;  1LJO A;  2CH4 A;  1OX9 A;  3M58 A;  1BKB A;  3GF5 A;  1AEY A;  1ZA2 B;  4KUD K;  3RBB B;  1SHF A;  2RD1 A;  1ATI A;  1NJ6 A;  5KCH A;  1UHF A;  2LCC A;  3QII A;  2FRW A;  1UJ0 A;  2E3H A;  1AOJ A;  3CC7 Q;  2F1L A;  3OYG A;  5FRO A;  4BI4 A;  1V76 A;  2WSC E;  2QHU A;  1R77 A;  3HFV A;  1SHG A;  4C5E A;  3G1J A;  2COY A;  3H6Z A;  1OX8 A;  3BDU A;  1M3C A;  1YFN A;  4XTX A;  2QI2 A;  3G1Z A;  1D3B B;  1PYS A;  1WQ7 A;  2LZ6 B;  3CD6 Q;  1ARK A;  2KT1 A;  1V29 B;  2KGT A;  1S72 Q;  2DO3 A;  2CP0 A;  3VU3 C;  1MMA A;  1YIT T;  1ABO A;  4OGC A;  1MV0 B;  1Z7N A;  2QQA A;  4PJO B;  4GBQ A;  1KOG A;  3L2U A;  1NBE B;  1ZSG A;  3JCM P;  1JXO A;  2E64 A;  4F7U E;  4A4K A;  1I1J A;  2JMA A;  3M0S A;  2XIC A;  2XDP A;  3CXC A;  4MML A;  3PNW C;  1JEG A;  1MGQ A;  1B70 A;  1M1F A;  3NEM A;  2P0Q A;  5IHK A;  3S3N A;  3RF1 A;  3RGL A;  4HT4 A;  1OI1 A;  1JRI A;  3H9N A;  1NJ8 A;  2K4Y A;  3OYL A;  4RTX A;  4TQF A;  2RO0 A;  3OS0 A;  2DYB A;  4O6J A;  1I5L A;  4Y92 A;  2X51 A;  3OYC A;  2LQK A;  4ZTF A;  2RHU A;  5CAI A;  5KYW B;  1YJW Q;  2ZZG A;  2QAS A;  3QYH B;  3IAL A;  1OU8 A;  1PC0 A;  3UT1 A;  4XEO A;  3HP9 A;  1GCQ C;  2DMO A;  1Q7Y C;  5A0D A;  2EKH A;  4MMK A;  5CCA A;  4TVR A;  3JB9 F;  1O75 A;  3JCM V;  1VQ4 T;  2E10 A;  5GMK i;  3VS7 A;  1QCO A;  1UGS B;  1KC8 U;  3MPU B;  4BUG A;  3ME9 A;  3I56 T;  2ZIN A;  2XG8 D;  2ZXF A;  5GAN 7;  3E9H A;  1RAE B;  2J6F A;  2X4X A;  1E24 A;  4EMK A;  2ZZD A;  2QDL A;  4KH0 B;  4HT8 A;  4D6W A;  2I4L A;  3X26 B;  2EKO A;  4DA4 A;  2Q5I A;  4YDQ A;  1SRM A;  2YT6 A;  4P73 A;  1E6H A;  1K8A U;  1UTI A;  1YCS B;  4QQD A;  4BB7 A;  3RL6 A;  5CO7 A;  3E1S A;  5I22 A;  3PMI A;  3OW2 P;  1PRL C;  3P8Y A;  4LNS A;  4YCV A;  1S1N A;  4JZ3 A;  5GMK l;  1I5O B;  3VRZ A;  2XTI A;  4F16 A;  4C8Q C;  3JV3 A;  2YWW A;  2RQW A;  1ZLM A;  4RUG A;  1BI0 A;  3FJ5 A;  5ELN A;  2ROL A;  2DL8 A;  2VWF A;  4H2X A;  1ADJ A;  2ZR3 A;  3EH2 A;  4L6V 5;  2K5L A;  3EGX A;  3JCM h;  3OYI A;  3HRK A;  5LJ5 g;  2C8M A;  4RMF A;  2RPN A;  4YRO A;  2GFU A;  4EDU A;  1M4Z A;  1Q81 R;  4J7I A;  4C92 C;  2COW A;  3L2R A;  1JU5 C;  3M0U A;  2ZT7 A;  2KYB A;  1ZSZ B;  1RUW A;  2DJZ A;  4OMN A;  2E5Q A;  2CP6 A;  3KBG A;  5ECA A;  2Q7G A;  1RAI B;  4CS3 A;  3V8K A;  2MK5 A;  4B9W A;  4FW1 A;  4D8K A;  3FLG A;  4HT9 A;  2GQI A;  5LJ3 h;  2EW3 A;  3CC7 A;  2CH4 W;  3UDC A;  2M16 A;  1YIT Q;  2EL9 A;  2RHS B;  5EG2 A;  5CQX A;  4KGX B;  3BDL A;  1YJ9 T;  2LCL A;  3V8J A;  3E2U A;  1OQK A;  3CD6 A;  1H4T A;  1S72 A;  4M77 G;  4LUD A;  2C0T A;  2ALY B;  2DL3 A;  1G3Y A;  3CPW P;  4PFZ A;  2KNB B;  4M78 C;  2EYX A;  2P84 A;  1YJN T;  4JJN K;  4QVD A;  2JZ2 A;  2Y4Y A;  4C5H A;  1NYF A;  2O01 E;  2ZIM A;  5HY6 A;  4KQE A;  5IHI A;  3EH1 A;  1WIE A;  1XOV A;  2RQU A;  4LDY A;  2A3L A;  3MEU A;  1QQJ A;  3TRE A;  2H3E B;  4AFU C;  1WFW A;  1K0S A;  1X69 A;  1KSW A;  5D6W A;  1V1C A;  3E9G A;  1D0Z A;  2A8E A;  4O5V A;  1VQN Q;  5GJV B;  2AMC B;  1UHC A;  5GAN 4;  3VUZ A;  2E41 A;  2CZ1 B;  1LNX A;  1ASY A;  1CKA A;  3LGL A;  1VQ4 Q;  4HVU A;  3TU4 K;  3DB4 A;  1ZBX A;  3LX7 A;  3M56 A;  4CH3 A;  3QZ5 B;  4DBH A;  2RHQ A;  1X2Q A;  3QBY A;  2ZPG B;  3I56 Q;  4KGZ B;  3PZC A;  1FX7 A;  4Z02 A;  4XU0 A;  5GAM e;  1L0W A;  4WF2 A;  1YJW A;  1B34 B;  1YNZ A;  5FWC A;  3SWN A;  1WA7 A;  3CC4 T;  2RJD A;  2ZPF B;  3CCS Q;  4LVK A;  4IIO A;  3QO5 A;  1QE0 A;  2PUK B;  2V1R A;  3G6E T;  1I0C A;  3OQ5 A;  1WDX A;  5KH6 A;  1NJ1 A;  1JXM A;  3KFV A;  2ODR D;  4LUE A;  2JW4 A;  3OY9 A;  2GQV A;  3NTK A;  4FYV B;  4LDU A;  3HL8 A;  5FU6 B;  2QXF A;  4CRI A;  1YP5 A;  2L3Q A;  2DPP B;  5C6S A;  1N5Z A;  1B7Y B;  3CMQ A;  5GAN h;  4M77 D;  5M9O A;  2Q7E A;  3JCM X;  2NUP B;  4IIM A;  2E6N A;  4ZGD B;  3CCQ A;  1WJQ A;  3TEG A;  1OUL A;  4ZGJ B;  3E19 A;  4DEX A;  1IRX A;  1BBZ A;  3G4S T;  1NZ9 A;  1B3Q A;  2KXC A;  4A4F A;  4M77 A;  2GCX A;  4KGV B;  1K9M C;  3P8D A;  3O5Z A;  2K3Y A;  2DXC A;  2EYQ A;  3EG1 A;  3UA7 A;  5LJ3 j;  2RF0 A;  4OVA A;  2J7I A;  4MZP A;  4Q5W A;  1M90 R;  1WPY A;  3UFG A;  3VS5 A;  2LCS A;  1ZX6 A;  3CCE T;  1TXQ A;  1VQ7 T;  3M9Q A;  2DL7 A;  2O4X A;  5HGQ A;  3PGG A;  2EVR A;  2F2V A;  4FYX B;  2I2L A;  4XTW A;  1KD1 C;  2RM4 A;  3IKL A;  2Y90 A;  4YRF A;  4M7D G;  1RIQ A;  4K88 A;  1Q7Y U;  3JCM J;  3G7Z A;  3GP8 A;  2AT1 B;  1QCF A;  4FYW B;  5EC7 A;  4H2Y A;  1C0M A;  2EQI A;  4O2D A;  1I07 A;  3JCM d;  3HRU A;  5GAN 5;  4M7A G;  3FIF A;  3HHT B;  3LLR A;  1IB8 A;  1SPK A;  2ENM A;  2RB6 A;  2AKL A;  1MMN A;  3CEY A;  2PNI A;  2A28 A;  3W3S A;  3SD4 A;  3PE0 A;  4IUP A;  3CXC P;  1YIT A;  4H02 A;  3VQV A;  2QEX T;  3DLL A;  2CT4 A;  2M51 A;  1YJN Q;  3REU A;  2QHV A;  2YDL A;  2B8A A;  2LRQ A;  4II1 A;  4XTU A;  1WHK A;  3HSB A;  2VC8 A;  4M77 E;  3UH0 A;  4L59 A;  2OTL T;  2D1X A;  4LXC A;  2X4W A;  2E5K A;  2JTM A;  1ZUU A;  3C94 A;  5KCO A;  3D7S B;  5LJ3 d;  2LX9 A;  1WGS A;  3HXW A;  2AKW A;  2DD4 A;  2F2W A;  5IH2 A;  5FLX E;  1YIJ T;  2Q7H A;  2K2V A;  1KJW A;  4ZN3 A;  2FVU A;  3PVL A;  4HVV A;  2BZX A;  1K76 A;  4MZT A;  3MHX A;  4P74 A;  1PKS A;  3G6E Q;  4PJO G;  4M7D D;  1VQ4 A;  5GAN j;  3C95 A;  2QA4 T;  3I56 A;  2DEQ A;  2LT1 A;  1GXI E;  4JUV A;  1RAG B;  2DET A;  2J3L A;  2DBM A;  4M7A D;  3M0Q A;  1TU0 B;  4M7D A;  2AHJ B;  1VA7 A;  4CC4 B;  4HCC A;  4KR3 A;  4BY6 B;  1JQQ A;  1MMG A;  4PNO A;  3M0T A;  5CKH A;  2NUT B;  2BZY A;  4M75 C;  3HXV A;  3QO7 A;  2QQB A;  1SRY A;  1O9S A;  4YTL A;  1SKU B;  2ODR C;  2GFA A;  2ZGW A;  4RTT A;  3RNJ A;  4C92 F;  1WYD A;  5GAO n;  2R58 A;  1U06 A;  4L5G A;  4PJJ A;  1TUD A;  2PVO B;  11AS A;  4AFS C;  3LSS A;  4EIK A;  1YB3 A;  2X3X D;  1NJ5 A;  4YYE A;  3JCM f;  4BE0 A;  3NTH A;  1RI9 A;  2E1H A;  2L5Q A;  1B07 A;  2C0O A;  2Y4X A;  3MO8 A;  2DZC A;  4P3N A;  1VQ7 Q;  1X2G A;  1GCP A;  3BJU A;  3QTC A;  1QVG P;  4Y91 A;  1QVF S;  3L4G B;  1ZHI A;  1HK9 A;  2GGR A;  4H2T A;  1YI2 Q;  2L3S A;  1PHT A;  3X28 B;  1JJC B;  4DOV A;  5GAM g;  2KEA A;  2DTO A;  1H3H A;  1VIF A;  5GAN d;  4PJO D;  1ABQ A;  2NS6 A;  1D3B A;  1USY C;  3J81 E;  2ZPB B;  4OML A;  2ZZF A;  1U8R A;  1AWJ A;  4M7D E;  1X01 A;  5LJ3 f;  1M8V A;  3VJP A;  3MKD A;  4JJD A;  4M78 F;  2OTJ Q;  1H64 1;  3RIR A;  1QVP A;  1NEB A;  1WXU A;  3RAC A;  2CUB A;  4PJO A;  2FPF A;  3P8T A;  2QEX Q;  2DTH A;  1SSF A;  5KE3 A;  2H3J A;  2G4C A;  4HWP A;  2EQU A;  2MAM A;  4RTY A;  4L87 A;  4JLI A;  3INZ A;  4QW2 A;  4EMG A;  3EG2 A;  3ZL7 C;  4JJC A;  2H8H A;  4YP0 A;  1OZ3 A;  1ZUY A;  3A8L B;  1W70 A;  1KQS P;  1Q81 C;  4K86 A;  1VYT A;  2ZCF B;  2KRN A;  2G6F X;  3MJX A;  2ZPH B;  3OYE A;  4WJ3 M;  4EX5 A;  2MWO A;  4ANJ A;  5A0L A;  1YJN A;  4N0A C;  1ASZ A;  1YIJ Q;  2RHY A;  5KYW A;  1W1F A;  3VS2 A;  4ME7 A;  3VS1 A;  3VUB A;  1Y96 B;  4ZTJ A;  2E12 A;  2ARS A;  1P92 A;  1U1S A;  1X43 A;  3QDF A;  3LSQ A;  1K9M U;  1NJ2 A;  4JRQ A;  2M0O A;  1IO6 A;  5K1P A;  2LQ8 A;  2K5I A;  2XK0 A;  4J9B A;  2GTO A;  1M3B A;  1IRE B;  2MI6 A;  2QA4 Q;  2KRO A;  1ZBJ A;  2RHZ A;  3WQZ A;  2CP5 A;  4UP7 A;  3VS3 A;  4PJO E;  2DVE A;  3A32 A;  4DOW A;  3UPU A;  5GAN 3;  1YWO A;  1KD1 U;  4CH6 A;  1QF6 A;  3QO3 A;  3G6E A;  4OF1 A;  2DIQ A;  1X6O A;  4FM4 B;  3L2W A;  1RAA B;  3HFN A;  2QQ9 A;  1OOT A;  4OMP A;  1QVF A;  4LNP A;  1WX6 A;  1WU7 A;  2DM1 A;  4J9G A;  1M1K R;  3NMZ C;  3QDR B;  1N8R R;  1D1C A;  3M54 A;  5GAN f;  3ERR A;  3HTZ A;  4B6M A;  2XDD A;  5FU7 B;  2Z0W A;  3GPL A;  1C1A A;  1W2B S;  8ATC B;  4OP0 A;  4RKU E;  3JAM E;  1JB0 E;  4NOY A;  4YRM A;  1FYF A;  4YRP A;  2DRM A;  3OS1 A;  2RI5 A;  3HXX A;  2WSF E;  2CRE A;  3G4S A;  4LD9 K;  3U23 A;  5KYN A;  2BZ8 A;  1YFT A;  1WI7 A;  1EX4 A;  1JO8 A;  3JRZ A;  3THK A;  1ZSZ A;  5FU7 C;  4BDZ A;  4H2V A;  4JPB W;  1U1T A;  3CBP A;  3NEN A;  1PG5 B;  4PKC C;  4TQD A;  1WQW A;  1WJR A;  4AG2 C;  4E7S A;  3MCA B;  2RHI A;  1VQ7 A;  3LWI A;  1K9A A;  1OV3 A;  1RI0 A;  2RNA A;  4ATO A;  3OYF A;  3AT1 B;  1UB4 A;  1YI2 A;  4HA8 A;  2W10 A;  2CP7 A;  3H0F A;  2RHS A;  1D0Y A;  3FJP A;  3ULR B;  3A5Z B;  4ELY C;  1VOM A;  2L0A A;  3NTI A;  1KC8 R;  1LCK A;  2D9T A;  5GMK e;  2KT8 A;  3A8H B;  3MF1 A;  1SET A;  1G8X A;  1T0J A;  1BCM A;  2ABL A;  2MYS A;  4EPC A;  1NM7 A;  1UGQ B;  3OYH A;  1HXD A;  4NL2 A;  2ALY A;  4Z88 A;  2OTJ A;  1JJ2 S;  3M59 A;  1W4S A;  4FL6 A;  1K8A R;  2G3R A;  3JSC A;  4WTO B;  1VQP T;  2DA9 A;  4HVW A;  1XNI A;  3A1P A;  1M90 C;  2QEX A;  2MWP A;  4AT1 B;  5GAO m;  3EG3 A;  1YCY A;  2XGT A;  3CME Q;  2F5K A;  4C8Q B;  1XQH A;  5KYU B;  4HWT A;  2AMC A;  2O31 A;  1G3W A;  4JRI A;  1LOJ A;  3EG9 B;  1X27 A;  3CCQ Q;  2ART A;  1K4U S;  2CZ7 B;  2EQM A;  2HAX A;  4YRJ A;  4F17 A;  1T0H A;  3PTA A;  2VGM A;  1KK7 A;  1QCN A;  2DJQ A;  1X6B A;  4F7U B;  3CCR T;  3DLM A;  1QKX A;  2A7Y A;  4BD3 A;  4C0G A;  3M0P A;  1KHI A;  2NUZ A;  4IUU A;  1YIJ A;  4JRK A;  3BW1 A;  4E47 A;  4R55 A;  1B34 A;  1EVL A;  2I4N A;  4E7K A;  1GGM A;  5KNN A;  3PCO B;  4C92 B;  4P71 C;  2RK2 A;  5J39 A;  1TH7 A;  3NFC A;  1K73 R;  2VXF A;  3VV0 A;  1W2B A;  1MV3 A;  4LD6 A;  3JB9 G;  4P75 A;  4PHC A;  2I4M A;  4M75 F;  1GBR A;  1F1B B;  3MEW A;  3A31 A;  2DE0 X;  3QJ6 A;  2K57 A;  1FWZ A;  3S3O A;  2E4H A;  2QA4 A;  1UG1 A;  2LDM A;  4CC3 A;  1B7Y A;  3VRY A;  4HWS A;  5I2M A;  3OA6 A;  2NUP A;  1G3S A;  2VYT A;  2ESW A;  4WJ4 A;  1FMW A;  3JCM Q;  4J6W A;  2LMJ A;  4J9F A;  2DD5 A;  1H4V B;  1Y0M A;  4QT7 A;  3NGP A;  2X9H A;  3A74 A;  1VQM T;  3TQ7 P;  2MPX C;  2J6O A;  1VYU A;  2RK1 A;  4M78 B;  2DBK A;  3RMS A;  1SER A;  2ZTG A;  3HTR A;  1LPL A;  3LC0 A;  4F14 A;  2KSS A;  1Q81 U;  4CC2 A;  4HKE A;  2M1H A;  2L8D A;  1M8M A;  3EG0 A;  9ATC B;  2IY5 B;  1UGV A;  1G51 A;  1H3Z A;  1JJ2 A;  1X2K A;  2CDT A;  2DL4 A;  3EGU A;  3HRT A;  1NYG A;  2F69 A;  3BFM A;  1K0X A;  2FG0 A;  3PT9 A;  1KQ2 A;  1NLP C;  3OB9 A;  4LE9 A;  5KYY B;  2RHX A;  3JB9 D;  12AS A;  2CP2 A;  2RI2 A;  1VQO T;  2DQ0 A;  3SDZ A;  5CKB A;  1X54 A;  4AFZ C;  3CMA T;  1FMV A;  5LJ5 h;  3Q1J A;  4MZM A;  1TSF A;  4J83 A;  5GAO r;  2DKG A;  1BIA A;  5KE2 A;  2AK5 A;  4WCI A;  1PM3 A;  3RER A;  1T3S A;  1ACM B;  3M4G A;  1OPL A;  1Y07 A;  1U5S A;  3VS6 A;  2DIL A;  3C12 A;  4H2U A;  3A7A A;  1EFN A;  3UA6 A;  4BE1 A;  4RQF A;  3R6O A;  1Q82 R;  2RA2 A;  4OGE A;  3REA B;  4P72 A;  1PNJ A;  4P3P A;  5AT1 B;  4EMK C;  1PKT A;  3X25 B;  2MCN A;  2JOY A;  4E7H A;  1OPK A;  2EWN A;  1BIB A;  3RUX A;  1KG1 A;  2DU7 A;  3QNE A;  1DJ7 B;  1PSF A;  2CS7 A;  4ESR A;  4P73 C;  2HZY A;  1HSQ A;  4XU3 A;  4GLK A;  3HXZ A;  3CCR Q;  1AZG B;  3IG2 A;  2PME A;  3TEE A;  3CME A;  3MF2 A;  1PD0 A;  1NJI R;  5IHN A;  3E9F A;  3OD1 A;  2KI7 A;  4RDX A;  3CBO A;  4X9D A;  1EVK A;  2LVM A;  2A08 A;  2KK4 A;  4OB3 B;  3OYY A;  1VQ5 T;  1BI3 A;  1IL2 A;  2M9U A;  3OW2 S;  3E9I A;  2DZ9 A;  2YSQ A;  2YUP A;  2DNU A;  3L2Q A;  2X35 A;  3OBY A;  1X56 A;  1WLE A;  4AH6 A;  3OYK A;  2W0Z A;  3EFO A;  1D1B A;  1SG5 A;  2CT3 A;  2NUT A;  1R0B G;  3UAT A;  4J7F A;  6AT1 B;  2ECZ A;  2JTE A;  3MEY A;  4J9D A;  4KH1 B;  1WHL A;  2ARU A;  2RMO A;  3URG A;  5DLO A;  3OSV A;  4RMO A;  2D8J A;  3EGD B;  2HSE B;  3A8M B;  1Y7X A;  5IXB A;  3CCL T;  3IKM B;  4GY5 A;  4CS4 A;  1M2V B;  4PLI A;  2KR3 A;  3H41 A;  1YJ9 Q;  1KQ1 A;  1M90 U;  2OJ2 A;  1BK2 A;  1UDL A;  3H0I A;  1USY A;  4BI8 B;  4LDW A;  1GFC A;  5HK3 A;  3BY7 A;  1CKB A;  1KIK A;  2A36 A;  3L4G A;  3NET A;  4ORZ A;  2JM8 A;  1NYR A;  5LJ5 j;  1X55 A;  2HKN A;  3OYN A;  1NEG A;  2RJC A;  1JJC A;  3H8Z A;  2O88 A;  2PZ1 A;  2HL5 C;  1ZQ1 A;  1VQ9 T;  2ZIO A;  4YRN A;  2XID A;  5FRM A;  2D6F A;  2FRY A;  4OMF B;  4PJM A;  3O8V A;  4XK8 E;  1RAF B;  4A54 A;  1A0N B;  2RQV A;  1VQ8 T;  3P8B B;  1M27 C;  4NCX A;  5GJW B;  2DVJ A;  2LJ1 A;  1VQO Q;  3FDR A;  2LJ0 A;  3CMA Q;  4QQG A;  2JTF A;  4E2F B;  3L2Z A;  3OYB A;  2ZPI B;  2FO0 A;  3R6N A;  1M1K C;  1QKW A;  2KDS A;  3I5S A;  1N8R C;  4LDV A;  4Q15 A;  3SFM A;  1M30 A;  3NPF A;  4K11 A;  3P8H A;  5GAN 2;  2EQJ A;  4N0A A;  2QGG A;  3CC4 Q;  1NNH A;  2R57 A;  3GLX A;  4IUT A;  2LQW A;  4J8O A;  3SWN C;  4JS4 A;  4C5G A;  2BTT A;  2P5I A;  4UP9 A;  1VQP A;  3OW2 A;  4M75 B;  2P0L A;  2XKO C;  4C8Q F;  1Q86 R;  5L8R E;  2GF7 A;  2DTI A;  1I4K 1;  1M1G A;  2P0K A;  3HPW A;  3T9N A;  3JCM e;  1Y96 A;  2A37 A;  2PTK A;  3OS5 A;  2K6D A;  2RH2 A;  1YBY A;  2HQE A;  4F7U F;  3DSQ A;  2HD0 A;  5LJ5 d;  3HKS A;  5I21 A;  2YLB A;  2F5T X;  2VGN A;  4RTU A;  4RG8 A;  1W2B P;  4HCZ A;  3CCR A;  3G4S Q;  1KC8 C;  5GAO l;  2D8H A;  3I7F A;  2VKN A;  1VQ5 Q;  2R5M A;  4FSS A;  3IQL A;  3V7S A;  4E7J A;  2RJE A;  3KXT A;  4CI0 C;  3CBM A;  5LJ3 e;  2OAU A;  4M77 C;  1K8A C;  2EIF A;  3REX A;  3CCE Q;  1H4S A;  3EHQ A;  4FYY B;  2RN8 A;  3WVE B;  4DBF A;  2KRM A;  2IG0 A;  3GNF B;  1K1Z A;  2COZ A;  2QYZ A;  2EJF A;  3X20 B;  2HMA A;  4LVM A;  4KT0 E;  2E3C A;  4BI3 A;  5FW9 A;  3I5R A;  3ZBD A;  1Z7M A;  2NWM A;  2ZCE A;  1UGR B;  2HCK A;  2FZC B;  1VQL T;  5I2S A;  1S72 T;  3QSU A;  2DEU A;  4E7Z A;  2E3I A;  2GBQ A;  5CIU A;  3CCL Q;  1GRI A;  1G2B A;  2KXD A;  1PSE A;  4A4E A;  3OMC A;  4G85 A;  2FEI A;  2X4J A;  1G3T A;  2RI3 A;  2X3W D;  2VAS A;  1QLY A;  2YLC A;  2M02 A;  1IZ6 A;  1VQM A;  3CCJ T;  1K73 C;  1X2H A;  2ZT8 A;  3CQT A;  2JS0 A;  2IVW A;  4J9H A;  2LP5 A;  5CKF A;  2MF2 A;  1YJ9 A;  4YRQ A;  2C06 A;  1VQ9 Q;  1UGP B;  1TUC A;  2YRD A;  3CCU T;  1ADY A;  1GCQ A;  2OTL Q;  4XEM A;  1W6X A;  5DLQ E;  3RMQ A;  1VQ8 Q;  4TVY A;  1UEB A;  3GNG A;  5KYX B;  1VIE A;  3A98 A;  4YRT A;  3QO8 A;  2DK3 A;  1N9W A;  5GAO q;  4C0Z A;  2C7I A;  2VXE A;  4RG2 A;  1WNL A;  3A5Z A;  1MHN A;  1LVK A;  2B86 A;  3HFZ B;  4R0K A;  4TVA B;  3V8L A;  1OU9 A;  1NG2 A;  3TVT A;  3CCV T;  1VQO A;  5LJ5 f;  2DER A;  1WLP B;  1BB9 A;  3OSS C;  3CMA A;  2CUD A;  2Q5H A;  4C0D C;  4M78 G;  5J26 A;  2QQR A;  4XTY A;  4KBM B;  3EHR A;  3V7R A;  4P3O A;  2PMF A;  1MMD A;  1TWB A;  5CQY A;  4J6Y A;  2L89 A;  5GAN e;  2L2P A;  3VS0 A;  4P74 C;  5GAM h;  4YRL A;  5E3I A;  4HVC A;  4OB0 B;  4C8Q A;  3CC4 A;  5C51 B;  2CP3 A;  4A63 B;  5KYU A;  4NS5 A;  4BWA A;  4KRT A;  3S3M A;  1VYV A;  4OLF A;  1BBW A;  1AHJ B;  3EG9 A;  4PJL A;  2EJ9 A;  1OZ2 A;  3VYH B;  1E1O A;  4ZTU B;  4KUL A;  2R5A A;  1NPR A;  1QP3 A;  5D7U A;  4M7A B;  3AHU A;  1E7O A;  4PK4 A;  1J5W A;  4F7U A;  4M7D C;  1YN8 A;  2O2O A;  2EYY A;  4LVI A;  3KFU A;  1D09 B;  1IGU A;  2V8J A;  1WJS A;  1ZUK A;  3PCO A;  3GIB A;  4C92 A;  2NLU A;  4M7A C;  1AVZ C;  1BI2 A;  4LDX A;  4XTZ A;  4YPF A;  4LVJ A;  3P8V A;  1EIY B;  3CCM T;  4JS5 A;  2LTO A;  2DIG A;  2LT4 A;  4XU1 A;  4Y28 E;  2BE7 D;  2JVV A;  4CH5 A;  1Q82 C;  3RR6 A;  1VQ5 A;  2XHC A;  2CJB A;  2EYZ A;  4QVZ A;  1B8A A;  1XTD A;  5HK0 A;  1AZE A;  2RJF A;  3ZEH A;  3TEH B;  1NPP A;  4R56 A;  1N9S A;  3GBQ A;  2DRK A;  1KMN A;  5D6Y A;  4M78 D;  1M1K U;  1VQL Q;  4DBQ A;  3CCE A;  1HJD A;  4LVL A;  1N8R U;  4C8Q E;  2AZS A;  3NEL A;  2ZNI A;  2OI3 A;  3MET A;  4YRR A;  2O9V A;  1WHM A;  3OYA A;  3M4P A;  1SRL A;  5L23 A;  3UF4 A;  2MOX A;  4E7I A;  3HXY A;  4M78 A;  1KHC A;  3RKW A;  4QVC A;  2ED0 A;  1NJI C;  3MEV A;  3L1A A;  3CCJ Q;  1QVG S;  2EAY A;  1PWT A;  2LC4 A;  2YUQ A;  3JCM g;  1QP2 A;  1GL5 A;  3CCL A;  4YRG A;  3VQY A;  2IY5 A;  5F5W A;  4C92 E;  1N6A A;  4PJO C;  4YRC A;  1MND A;  4A53 A;  4ELZ C;  2DAQ A;  3MP8 A;  4N4H A;  3I55 T;  2V8K A;  2QAZ A;  4XU2 A;  1WHG A;  3CCU Q;  4FSX A;  3MQZ A;  5FWB A;  3TCJ A;  1Z9Z A;  4J5Y A;  4J9I A;  3PVQ A;  5KYY A;  4DQ2 A;  5GAN 8;  1VQN T;  1EOV A;  1OYX A;  1RLQ C;  1BI1 A;  1VQ9 A;  5CKD A;  4H2S A;  1YHQ T;  1TOV A;  4VUB A;  1Y71 A;  5LJ3 g;  2OTL A;  1VQ8 A;  3OS2 A;  4V2S A;  5GAM j;  3CCV Q;  3VS4 A;  4PLL A;  4ZIB A;  2EGA A;  4RTW A;  5C0M A;  2HBW A;  1RAB B;  3CCS T;  4XQ3 A;  2QTX A;  1RLP C;  2YRC A;  1KQS S;  4MDX A;  3CC2 T;  1FXX A;  3LH0 A;  4J15 A;  1HD3 A;  4M78 E;  4XTV A;  2KQW A;  2P4T A;  4RCB A;  4BE2 A;  3EFS A;  3RKY A;  1TTH B;  3QWX X;  2HEQ A;  5K1X A;  2XI9 A;  1JBM A;  3BE3 A;  1VQK T;  3LW5 E;  2BUD A;  1RAH B;  5CK9 A;  2DXU A;  4GLM A;  1MUZ A;  3JB9 I;  3EFR A;  4PJN A;  3KUF A;  2E70 A;  3LH5 A;  4Z8A A;  3QWY A;  3M55 A;  2JM9 A;  2CYZ B;  1PYS B;  2XDB A;  1ZA1 B;  2AKK A;  2WSE E;  3VQW A;  2RQR A;  8AT1 B;  4TVW A;  2HKQ B;  4FT4 A;  4ZN1 A;  4M77 F;  3SHW A;  4X5O A;  4OMO A;  2EGE A;  2L3R A;  2DL5 A;  3QJY A;  1M3A A;  1K73 U;  2JT4 A;  1M2O A;  3HRI A;  5HCK A;  2PQW A;  1QMC A;  2JUF A;  2VV5 A;  4C5I A;  1LYL A;  3CCM Q;  3HY1 A;  2XU8 A;  1GBQ A;  1B7T A;  1VQ6 T;  1E1T A;  4EMH A;  2J6K A;  4YRE A;  1QVG A;  5GAM d;  3PIP A;  1NYQ A;  2FL7 A;  4Q6G A;  1M5Q 1;  1B70 B;  2J06 A;  4YRI A;  2L3P A;  3I35 A;  3HFO A;  1VUB A;  1GFD A;  1HTT A;  4FCY A;  4M75 G;  3N5B B;  2ZZE A;  1D0X A;  3MP1 A;  3OMG A;  1ZSZ C;  2YRV A;  4RQE A;  2DX1 A;  4DBR A;  1BCO A;  3S6W A;  1Q86 C;  4AG1 C;  3G71 T;  2E6Z A;  1G5V A;  2ZR2 A;  4YRS A;  3EGD A;  1SF9 A;  5GAN g;  2XD0 A;  3M4Y A;  2ZNJ A;  3UGQ A;  2V26 A;  2J05 A;  4A4G A;  4BDY A;  3QZ9 B;  1Z9Q A;  1MNE A;  1M2V A;  1WHJ A;  1YFS A;  1VQL A;  1WZO A;  4AMC A;  4PL6 A;  1PD1 A;  2FHD A;  5IN1 A;  1N9R A;  2EJG A;  3C4S A;  2CJ9 A;  4WI1 A;  2E65 A;  4ZGE B;  5J3B A;  4EMK B;  2CZ6 B;  3I55 Q;  2QHS A;  2CJA A;  1WXT A;  1KQS A;  1NE8 A;  1VQP Q;  1SEM A;  4BAC A;  3QUI A;  2CGH A;  3H0H A;  3CCJ A;  2GTJ A;  3JB9 J;  2BE9 B;  2IIM A;  2HDA A;  4FU6 A;  4A4H A;  1YHQ Q;  4D8D A;  3TSZ A;  3CCU A;  2QK0 A;  1M9S A;  1E22 A;  2CIM A;  5C52 B;  2V1Q A;  3QXE B;  2ZT6 A;  3A8O B;  2X4Y A;  1XJW B;  2O9S A;  2PUO B;  4OB2 B;  2YHT A;  3FB9 A;  3QYG B;  4HXJ A;  2QTV A;  4PFP A;  1X75 C;  3I9Q A;  2KY9 A;  2LQN A;  5A0G A;  2D0Q B;  4H2X B;  3QKJ A;  4C0F A;  4M75 D;  2PVD B;  3EGX B;  2YUN A;  3CC2 Q;  2DF6 A;  4OB1 B;  4EO4 A;  2DFU A;  4RTZ A;  3JB9 H;  2GNC A;  4J6X A;  1IXD A;  3CCV A;  1Q82 U;  1I81 A;  2QQS A;  2RQT A;  5DM7 R;  1VQK Q;  3M53 A;  2OX7 A;  1UUE A;  4M7D F;  3VKI A;  4M75 A;  4FW2 A;  4IKF A;  4DPG A;  2LX7 A;  4P75 C;  5GAM f;  4IUR A;  4P5N A;  1G83 A;  3HXU A;  3SB2 A;  1QVF P;  1W66 A;  1Q7Y R;  4M7A F;  5FU6 C;  1R0C B;  1WYX A;  1UFF A;  2FZG B;  4IUQ A;  3TSW A;  3RDV A;  1C0A A;  1SES A;  1AWO A;  4QQ6 A;  1C6V X;  1NJI U;  2K5F A;  3WXM B;  4G84 A;  2HSP A;  2I4O A;  1YWP A;  1IHW A;  2SEM A;  2NYS A;  3FRN A;  1VQM Q;  3RKX A;  1VQ6 Q;  2YXY A;  2MMP A;  4HWO A;  3LYI A;  5HKC A;  4JLG A;  3WVD B;  4JDS A;  1WHH A;  4B9X A;  4XAX B;  3L2V A;  2CSQ A;  2KMT A;  1RL2 A;  1YI2 T;  2WAC A;  1WXB A;  3CCM A;  1H8K A;  3X24 B;  2QDY B;  1G5H A;  1KMM A;  1BBU A;  4JRP A;  2K3B A;  3G71 Q;  3SEM A;  4M4Z A;  2DLP A;  1NLO C;  1OEB A;  4M75 E;  3CPF A;  4JZ4 A;  5AYF A;  2OTJ T;  3OYM A;  1AD5 A;  4J9E A;  4PJO F;  1FMK A;  2LNV A;  2OAW A;  4NL3 A;  1EIF A;  3HY0 A;  3V7C A;  1EFW A;  4HCB A;  2RHQ B;  5CR2 A;  5GMK m;  3ER0 A;  3UGT A;  4CS2 A;  1IHV A;  1H92 A;  2HL3 A;  2K9G A;  3DB3 A;  2EYW A;  3SWN B;  2PU9 B;  2EPD A;  1AWX A;  2K79 A;  3CPW S;  2EQK A;  1SSH A;  4UP8 A;  1HYO A;  4ZTZ B;  2ED1 A;  3A5Y A;  5GMK h;  3ICA A;  2VUB A;  3HRS A;  2QG9 B;  1HC7 A;  1H4Q A;  2KRS A;  5GAO p;  3F70 A;  4TTV A;  2MIO A;  1Q95 G;  5KYX A;  4FIB A;  3I55 A;  3OYJ A;  4PG3 A;  3QPH A;  4P72 C;  3FEO A;  2FYK A;  1BYM A;  3R07 A;  4N4G A;  4HCK A;  2IPO B;  3HFZ A;  4TVA A;  1IGQ A;  1VQN A;  3EAE A;  2JMC A;  1CSK A;  1RAC B;  4QKU A;  3JCM c;  4X1V A;  3C0C A;  1D1A A;  3RES A;  1YHQ A;  2CSI A;  3L42 A;  4DEY A;  1QWE A;  5LL6 S;  2BIV A;  3JCM b;  4CH4 A;  4H2W A;  1I8F A;  2ZAE A;  3GOX A; 
#chains in the Genus database with same CATH homology
 4M77 B;  1B76 A;  2JNG A;  4X34 A;  4MDW A;  5IAY A;  3CCS A;  3A7U A;  2P0P A;  3CC2 A;  4RCC A;  3CC7 T;  1Q86 U;  2O4X B;  4KUI A;  2J3M A;  1VQK A;  3UWN A;  4M7A A;  1EQR A;  2ZPE B;  4E7L A;  5A2Q E;  4C8Q G;  4BY6 C;  3M4Q A;  5C53 B;  3ASK A;  2K3X A;  3CD6 T;  5CVI A;  4K87 A;  4F7U G;  4UPA A;  2JN0 A;  1EIY A;  5ELO A;  3TUP A;  1VQZ A;  4IUV A;  3M57 A;  4C92 G;  3FC3 A;  5IT9 E;  3LGF A;  1YFR A;  1VQ6 A;  2BKD N;  3CPW A;  3PMT A;  2E5A A;  3TEH A;  4TWA A;  5LJ5 e;  2KVQ G;  3OBW A;  1N27 A;  3QHS A;  3OYD A;  2AKW B;  3J7A F;  3PFS A;  2CKK A;  1YJW T;  3JCM W;  5GMK j;  4C0D B;  1G5I A;  4M7A E;  3VQX A;  3G71 A;  1YGB A;  4HWR A;  3M5A A;  3DKM A;  4BW9 A;  5CKE A;  3CXC S;  1QW1 A;  4YCU A;  4YCW A;  3VBB A;  3MP6 A;  3ZFJ A;  2ZT5 A;  4N4I A;  3PIO A;  4C8Q D;  5FRN A;  2DXT A;  4KR2 A;  4X9C A;  3CME T;  2DDZ A;  3A7R A;  2EFI A;  2DU5 A;  3LWH A;  4FT2 A;  2V8I A;  4M7D B;  2FB7 A;  3CCQ T;  2PVG B;  3MEA A;  2CZ0 B;  2DQ3 A;  3A8G B;  4P71 A;  5DY9 A;  4C92 D;  3J80 E;  2HNI A;  5D6X A;  2HBP A;  3QG1 A;  1R8O B;  5GAN 6;  2QHT A;  4YRK A;  3VYG A;  2KAF A;  2HQX A;  2DXB A;  4E51 A;  4UC4 A;  1LJO A;  3M58 A;  1BKB A;  3GF5 A;  1NJ6 A;  4KUD K;  2RD1 A;  1ATI A;  5KCH A;  2LCC A;  3QII A;  3OYG A;  5FRO A;  4BI4 A;  2WSC E;  2QHU A;  3HFV A;  4C5E A;  3H6Z A;  3BDU A;  3G1Z A;  4XTX A;  2QI2 A;  1D3B B;  1PYS A;  1WQ7 A;  1V29 B;  2DO3 A;  3VU3 C;  1YIT T;  4OGC A;  1Z7N A;  2QQA A;  4PJO B;  1KOG A;  3L2U A;  3JCM P;  2E64 A;  4F7U E;  4A4K A;  2XIC A;  2XDP A;  3CXC A;  4MML A;  3PNW C;  1MGQ A;  1B70 A;  1M1F A;  3NEM A;  2P0Q A;  3S3N A;  3RF1 A;  3RGL A;  4HT4 A;  1OI1 A;  1JRI A;  1NJ8 A;  2K4Y A;  3OYL A;  4TQF A;  2RO0 A;  3OS0 A;  4O6J A;  1I5L A;  3OYC A;  2LQK A;  4ZTF A;  2RHU A;  5CAI A;  3IAL A;  2ZZG A;  3QYH B;  3UT1 A;  4XEO A;  3HP9 A;  1Q7Y C;  5A0D A;  4MMK A;  5CCA A;  4TVR A;  3JB9 F;  1O75 A;  3JCM V;  1VQ4 T;  2E10 A;  5GMK i;  1UGS B;  1KC8 U;  4BUG A;  3ME9 A;  3I56 T;  2ZIN A;  2XG8 D;  2ZXF A;  5GAN 7;  3E9H A;  2X4X A;  1E24 A;  4EMK A;  2ZZD A;  4HT8 A;  4D6W A;  2I4L A;  3X26 B;  2EKO A;  4DA4 A;  2Q5I A;  4YDQ A;  4P73 A;  1K8A U;  4QQD A;  4BB7 A;  3RL6 A;  5CO7 A;  3E1S A;  3PMI A;  3P8Y A;  4LNS A;  4YCV A;  5GMK l;  2XTI A;  4C8Q C;  1BI0 A;  5ELN A;  4H2X A;  1ADJ A;  2ZR3 A;  4L6V 5;  2K5L A;  3JCM h;  3OYI A;  3HRK A;  5LJ5 g;  2C8M A;  4RMF A;  4YRO A;  2GFU A;  4EDU A;  1M4Z A;  4J7I A;  4C92 C;  3L2R A;  2ZT7 A;  2DJZ A;  2E5Q A;  3KBG A;  2Q7G A;  4CS3 A;  3V8K A;  4B9W A;  3FLG A;  4HT9 A;  5LJ3 h;  3CC7 A;  3UDC A;  2M16 A;  2EL9 A;  2RHS B;  5EG2 A;  5CQX A;  3BDL A;  1YJ9 T;  2LCL A;  3V8J A;  3CD6 A;  1H4T A;  1S72 A;  4M77 G;  2ALY B;  1G3Y A;  4M78 C;  1YJN T;  4JJN K;  4QVD A;  2JZ2 A;  2Y4Y A;  4C5H A;  2ZIM A;  2O01 E;  4KQE A;  5HY6 A;  1XOV A;  4LDY A;  2A3L A;  3MEU A;  3TRE A;  5D6W A;  3E9G A;  2A8E A;  4O5V A;  2AMC B;  5GAN 4;  3VUZ A;  2E41 A;  2CZ1 B;  1LNX A;  1ASY A;  3LGL A;  3TU4 K;  3DB4 A;  1ZBX A;  3LX7 A;  3M56 A;  4CH3 A;  3QZ5 B;  2RHQ A;  3QBY A;  2ZPG B;  3PZC A;  1FX7 A;  4Z02 A;  4XU0 A;  5GAM e;  1L0W A;  4WF2 A;  1YJW A;  1B34 B;  3SWN A;  3CC4 T;  2RJD A;  2ZPF B;  4LVK A;  3QO5 A;  1QE0 A;  2PUK B;  3G6E T;  3OQ5 A;  1NJ1 A;  5KH6 A;  2ODR D;  3OY9 A;  2GQV A;  3NTK A;  4LDU A;  3HL8 A;  5FU6 B;  2QXF A;  4CRI A;  2DPP B;  5C6S A;  1B7Y B;  3CMQ A;  5GAN h;  4M77 D;  5M9O A;  2Q7E A;  3JCM X;  2E6N A;  4ZGD B;  3CCQ A;  1WJQ A;  3TEG A;  4ZGJ B;  3E19 A;  3G4S T;  1NZ9 A;  4A4F A;  4M77 A;  2GCX A;  1K9M C;  3P8D A;  2K3Y A;  2DXC A;  2EYQ A;  5LJ3 j;  4OVA A;  4MZP A;  4Q5W A;  1WPY A;  3UFG A;  3CCE T;  1VQ7 T;  3M9Q A;  2O4X A;  5HGQ A;  3PGG A;  2I2L A;  4XTW A;  1KD1 C;  2RM4 A;  3IKL A;  2Y90 A;  4YRF A;  4M7D G;  1RIQ A;  4K88 A;  1Q7Y U;  3JCM J;  3G7Z A;  3GP8 A;  4H2Y A;  4O2D A;  3JCM d;  3HRU A;  5GAN 5;  4M7A G;  3FIF A;  3HHT B;  3LLR A;  2RB6 A;  3CEY A;  3W3S A;  3SD4 A;  1YIT A;  4IUP A;  4H02 A;  3VQV A;  2QEX T;  3DLL A;  3REU A;  2QHV A;  2B8A A;  2LRQ A;  4II1 A;  4XTU A;  3HSB A;  2VC8 A;  4M77 E;  3UH0 A;  4L59 A;  2OTL T;  2X4W A;  2JTM A;  3C94 A;  5KCO A;  5LJ3 d;  2LX9 A;  1WGS A;  3HXW A;  2AKW A;  2DD4 A;  5FLX E;  1YIJ T;  2Q7H A;  2K2V A;  4ZN3 A;  2FVU A;  4MZT A;  3MHX A;  4P74 A;  4PJO G;  4M7D D;  1VQ4 A;  5GAN j;  3C95 A;  2QA4 T;  3I56 A;  2DEQ A;  2LT1 A;  1GXI E;  4JUV A;  2J3L A;  4M7A D;  4M7D A;  2AHJ B;  4HCC A;  4KR3 A;  4BY6 B;  4PNO A;  5CKH A;  4M75 C;  3HXV A;  3QO7 A;  2QQB A;  1SRY A;  1O9S A;  4YTL A;  2ODR C;  2GFA A;  2ZGW A;  4C92 F;  1WYD A;  5GAO n;  2R58 A;  4L5G A;  2PVO B;  11AS A;  3LSS A;  1YB3 A;  1NJ5 A;  4YYE A;  3JCM f;  4BE0 A;  3NTH A;  2E1H A;  2L5Q A;  2Y4X A;  3MO8 A;  2DZC A;  4P3N A;  1X2G A;  3BJU A;  3QTC A;  4Y91 A;  1QVF S;  3L4G B;  1ZHI A;  1HK9 A;  4H2T A;  3X28 B;  1JJC B;  4DOV A;  5GAM g;  2DTO A;  1VIF A;  5GAN d;  4PJO D;  2NS6 A;  1D3B A;  1USY C;  3J81 E;  2ZPB B;  2ZZF A;  1U8R A;  4M7D E;  1X01 A;  5LJ3 f;  1M8V A;  3VJP A;  4M78 F;  1H64 1;  3RIR A;  1QVP A;  3RAC A;  4PJO A;  3P8T A;  2DTH A;  1SSF A;  5KE3 A;  2H3J A;  2G4C A;  4HWP A;  2EQU A;  2MAM A;  4L87 A;  4JLI A;  3INZ A;  4QW2 A;  4EMG A;  4YP0 A;  1OZ3 A;  3A8L B;  1Q81 C;  4K86 A;  2ZCF B;  2ZPH B;  3OYE A;  4WJ3 M;  4EX5 A;  2MWO A;  5A0L A;  1YJN A;  4N0A C;  1ASZ A;  2RHY A;  4ME7 A;  3VUB A;  1Y96 B;  4ZTJ A;  2E12 A;  2ARS A;  1P92 A;  1U1S A;  3LSQ A;  1K9M U;  1NJ2 A;  4JRQ A;  2M0O A;  5K1P A;  2LQ8 A;  2K5I A;  2XK0 A;  1IRE B;  2MI6 A;  2RHZ A;  3WQZ A;  4UP7 A;  4PJO E;  2DVE A;  3A32 A;  4DOW A;  3UPU A;  5GAN 3;  1KD1 U;  4CH6 A;  1QF6 A;  3QO3 A;  3G6E A;  4OF1 A;  2DIQ A;  1X6O A;  4FM4 B;  3L2W A;  3HFN A;  2QQ9 A;  1QVF A;  1WU7 A;  3QDR B;  5GAN f;  3M54 A;  3ERR A;  3HTZ A;  2XDD A;  5FU7 B;  3GPL A;  1W2B S;  4OP0 A;  4RKU E;  3JAM E;  1JB0 E;  4NOY A;  4YRM A;  1FYF A;  4YRP A;  3OS1 A;  2RI5 A;  3HXX A;  2WSF E;  3G4S A;  4LD9 K;  1YFT A;  3JRZ A;  5FU7 C;  4BDZ A;  4H2V A;  1U1T A;  3CBP A;  3NEN A;  4PKC C;  4TQD A;  1WQW A;  1WJR A;  3MCA B;  2RHI A;  1VQ7 A;  3LWI A;  1RI0 A;  4ATO A;  3OYF A;  1UB4 A;  1YI2 A;  4HA8 A;  2RHS A;  3FJP A;  3A5Z B;  4ELY C;  3NTI A;  2D9T A;  5GMK e;  3A8H B;  3MF1 A;  1SET A;  4EPC A;  1UGQ B;  3OYH A;  1HXD A;  4NL2 A;  2ALY A;  2OTJ A;  1JJ2 S;  3M59 A;  1W4S A;  4FL6 A;  2G3R A;  3JSC A;  1VQP T;  1XNI A;  1M90 C;  2QEX A;  2MWP A;  5GAO m;  2XGT A;  1YCY A;  2F5K A;  4C8Q B;  1XQH A;  4HWT A;  2AMC A;  1G3W A;  4JRI A;  1LOJ A;  2ART A;  2CZ7 B;  2EQM A;  2HAX A;  4YRJ A;  3PTA A;  2VGM A;  3NET A;  4F7U B;  3CCR T;  3DLM A;  2A7Y A;  4BD3 A;  4C0G A;  1KHI A;  4IUU A;  1YIJ A;  4JRK A;  3BW1 A;  4E47 A;  4R55 A;  1B34 A;  1EVL A;  2I4N A;  4E7K A;  1GGM A;  5KNN A;  3PCO B;  4C92 B;  4P71 C;  2RK2 A;  5J39 A;  1TH7 A;  3NFC A;  2VXF A;  3VV0 A;  1W2B A;  4LD6 A;  3JB9 G;  4P75 A;  4PHC A;  2I4M A;  4M75 F;  3MEW A;  3A31 A;  3QJ6 A;  2K57 A;  1FWZ A;  3S3O A;  2QA4 A;  2LDM A;  1B7Y A;  4HWS A;  5I2M A;  3OA6 A;  1G3S A;  2VYT A;  4WJ4 A;  3JCM Q;  4J6W A;  2DD5 A;  1H4V B;  3A74 A;  1VQM T;  2RK1 A;  4M78 B;  3RMS A;  1SER A;  2ZTG A;  3LC0 A;  2KSS A;  1Q81 U;  4HKE A;  2M1H A;  2L8D A;  2IY5 B;  1G51 A;  1H3Z A;  1JJ2 A;  3HRT A;  2F69 A;  3BFM A;  3PT9 A;  1KQ2 A;  3OB9 A;  2RHX A;  3JB9 D;  12AS A;  2RI2 A;  1VQO T;  2DQ0 A;  3SDZ A;  5CKB A;  1X54 A;  3CMA T;  5LJ5 h;  3Q1J A;  4MZM A;  4J83 A;  5GAO r;  2DKG A;  1BIA A;  5KE2 A;  3RER A;  3M4G A;  1Y07 A;  3C12 A;  4H2U A;  3A7A A;  4BE1 A;  4RQF A;  3R6O A;  2RA2 A;  4OGE A;  4P72 A;  4P3P A;  4EMK C;  3X25 B;  2JOY A;  4E7H A;  3RUX A;  2EWN A;  1BIB A;  1KG1 A;  2DU7 A;  3QNE A;  1DJ7 B;  1PSF A;  2CS7 A;  4P73 C;  4XU3 A;  4GLK A;  3HXZ A;  3IG2 A;  2PME A;  3TEE A;  3CME A;  3MF2 A;  3E9F A;  3OD1 A;  4RDX A;  3CBO A;  4X9D A;  1EVK A;  2LVM A;  2KK4 A;  4OB3 B;  3OYY A;  1VQ5 T;  1BI3 A;  1IL2 A;  2M9U A;  3OW2 S;  3E9I A;  2DZ9 A;  3L2Q A;  2X35 A;  3OBY A;  1X56 A;  1WLE A;  4AH6 A;  3OYK A;  4J7F A;  3MEY A;  2ARU A;  3URG A;  5DLO A;  3OSV A;  4RMO A;  3A8M B;  1Y7X A;  3CCL T;  3IKM B;  4GY5 A;  4CS4 A;  4PLI A;  1KQ1 A;  1M90 U;  1USY A;  4BI8 B;  4LDW A;  5HK3 A;  3BY7 A;  3L4G A;  1NYR A;  5LJ5 j;  1X55 A;  3OYN A;  2RJC A;  1JJC A;  3H8Z A;  1ZQ1 A;  1VQ9 T;  2ZIO A;  4YRN A;  2XID A;  5FRM A;  2D6F A;  4OMF B;  3O8V A;  4XK8 E;  4A54 A;  1VQ8 T;  3P8B B;  4NCX A;  3FDR A;  4QQG A;  2JTF A;  3L2Z A;  3OYB A;  2ZPI B;  1M1K C;  2KDS A;  1N8R C;  4LDV A;  4Q15 A;  3SFM A;  3P8H A;  5GAN 2;  2EQJ A;  4N0A A;  1NNH A;  2R57 A;  3GLX A;  4IUT A;  4J8O A;  3SWN C;  4JS4 A;  4C5G A;  2P5I A;  4UP9 A;  1VQP A;  3OW2 A;  4M75 B;  2P0L A;  2XKO C;  4C8Q F;  5L8R E;  2GF7 A;  2DTI A;  1I4K 1;  1M1G A;  2P0K A;  3HPW A;  3T9N A;  3JCM e;  1Y96 A;  3OS5 A;  2RH2 A;  1YBY A;  2HQE A;  4F7U F;  3DSQ A;  2HD0 A;  5LJ5 d;  3HKS A;  5I21 A;  2YLB A;  2F5T X;  2VGN A;  4RG8 A;  4HCZ A;  3CCR A;  1KC8 C;  5GAO l;  3I7F A;  2R5M A;  3V7S A;  4E7J A;  2RJE A;  3KXT A;  4CI0 C;  3CBM A;  5LJ3 e;  2OAU A;  4M77 C;  1K8A C;  2EIF A;  3REX A;  1H4S A;  3WVE B;  2IG0 A;  3GNF B;  3X20 B;  2EJF A;  4LVM A;  4KT0 E;  2E3C A;  4BI3 A;  1Z7M A;  3ZBD A;  2ZCE A;  1UGR B;  1VQL T;  5I2S A;  1S72 T;  3QSU A;  5CIU A;  1PSE A;  4A4E A;  3OMC A;  4G85 A;  2X4J A;  1G3T A;  2RI3 A;  2YLC A;  1IZ6 A;  1VQM A;  3CCJ T;  1K73 C;  1X2H A;  2ZT8 A;  2IVW A;  5CKF A;  2MF2 A;  1YJ9 A;  4YRQ A;  2C06 A;  1UGP B;  3CCU T;  1ADY A;  4XEM A;  5DLQ E;  3RMQ A;  4TVY A;  1UEB A;  3GNG A;  1VIE A;  4YRT A;  3QO8 A;  2DK3 A;  1N9W A;  5GAO q;  4C0Z A;  2C7I A;  2VXE A;  4RG2 A;  1WNL A;  3A5Z A;  1MHN A;  3HFZ B;  4TVA B;  3V8L A;  3CCV T;  1VQO A;  5LJ5 f;  3OSS C;  2Q5H A;  3CMA A;  4C0D C;  4M78 G;  5J26 A;  2QQR A;  4XTY A;  4KBM B;  3V7R A;  4P3O A;  2PMF A;  5CQY A;  4J6Y A;  2L89 A;  5GAN e;  4P74 C;  5GAM h;  4YRL A;  5E3I A;  4HVC A;  4OB0 B;  4C8Q A;  3CC4 A;  5C51 B;  4NS5 A;  4BWA A;  3S3M A;  4OLF A;  1BBW A;  1AHJ B;  2EJ9 A;  1OZ2 A;  3VYH B;  1E1O A;  4ZTU B;  4KUL A;  2R5A A;  1NPR A;  1QP3 A;  4M7A B;  3AHU A;  1J5W A;  4F7U A;  4M7D C;  4LVI A;  3KFU A;  2V8J A;  1WJS A;  3PCO A;  3GIB A;  4C92 A;  2NLU A;  4M7A C;  4LDX A;  1BI2 A;  4XTZ A;  4YPF A;  4LVJ A;  3P8V A;  1EIY B;  3CCM T;  4JS5 A;  2LTO A;  2DIG A;  2LT4 A;  4XU1 A;  4Y28 E;  2JVV A;  4CH5 A;  1Q82 C;  1VQ5 A;  2XHC A;  2CJB A;  4QVZ A;  1B8A A;  1XTD A;  5HK0 A;  2RJF A;  3ZEH A;  3TEH B;  1NPP A;  4R56 A;  1N9S A;  1KMN A;  5D6Y A;  4M78 D;  1M1K U;  3CCE A;  4LVL A;  1N8R U;  4C8Q E;  3NEL A;  2ZNI A;  3MET A;  4YRR A;  3OYA A;  3M4P A;  4E7I A;  3HXY A;  4M78 A;  1KHC A;  3RKW A;  4QVC A;  1NJI C;  3MEV A;  3L1A A;  1QVG S;  2EAY A;  2LC4 A;  3JCM g;  1QP2 A;  3CCL A;  4YRG A;  3VQY A;  2IY5 A;  5F5W A;  4C92 E;  1N6A A;  4PJO C;  4YRC A;  4A53 A;  4ELZ C;  2DAQ A;  3MP8 A;  4N4H A;  3I55 T;  2V8K A;  4XU2 A;  4FSX A;  3MQZ A;  3TCJ A;  4J5Y A;  4DQ2 A;  5GAN 8;  1VQN T;  1EOV A;  1OYX A;  1BI1 A;  1VQ9 A;  5CKD A;  4H2S A;  1YHQ T;  4VUB A;  1Y71 A;  5LJ3 g;  2OTL A;  1VQ8 A;  3OS2 A;  4V2S A;  5GAM j;  4PLL A;  4ZIB A;  5C0M A;  3CCS T;  4XQ3 A;  2QTX A;  1KQS S;  4MDX A;  3CC2 T;  1FXX A;  3LH0 A;  4J15 A;  4M78 E;  4XTV A;  2KQW A;  2P4T A;  4RCB A;  4BE2 A;  3EFS A;  3RKY A;  5K1X A;  2XI9 A;  1JBM A;  1VQK T;  3LW5 E;  2BUD A;  5CK9 A;  2DXU A;  3JB9 I;  3EFR A;  3KUF A;  2E70 A;  3M55 A;  2CYZ B;  1PYS B;  2XDB A;  2WSE E;  3VQW A;  4TVW A;  4FT4 A;  4ZN1 A;  4M77 F;  4X5O A;  2L3R A;  3QJY A;  1K73 U;  3HRI A;  2PQW A;  2JUF A;  2VV5 A;  4C5I A;  1LYL A;  3HY1 A;  2XU8 A;  1E1T A;  1VQ6 T;  4EMH A;  4YRE A;  1QVG A;  5GAM d;  3PIP A;  1NYQ A;  2FL7 A;  4Q6G A;  1M5Q 1;  1B70 B;  4YRI A;  3HFO A;  1VUB A;  1HTT A;  4M75 G;  3N5B B;  2ZZE A;  3MP1 A;  3OMG A;  2YRV A;  4RQE A;  3S6W A;  1Q86 C;  3G71 T;  2E6Z A;  2ZR2 A;  1G5V A;  4YRS A;  5GAN g;  2XD0 A;  3M4Y A;  2ZNJ A;  3UGQ A;  4A4G A;  4BDY A;  3QZ9 B;  1YFS A;  1VQL A;  4PL6 A;  2FHD A;  5IN1 A;  1N9R A;  2EJG A;  3C4S A;  2CJ9 A;  4WI1 A;  2E65 A;  4ZGE B;  5J3B A;  4EMK B;  2CZ6 B;  2QHS A;  2CJA A;  1KQS A;  1NE8 A;  4BAC A;  3QUI A;  2CGH A;  3CCJ A;  3JB9 J;  4FU6 A;  4A4H A;  3CCU A;  1M9S A;  1E22 A;  2CIM A;  5C52 B;  3QXE B;  2ZT6 A;  3A8O B;  2X4Y A;  2PUO B;  4OB2 B;  2YHT A;  3FB9 A;  3QYG B;  1X75 C;  2KY9 A;  5A0G A;  2D0Q B;  4H2X B;  3QKJ A;  4C0F A;  4M75 D;  2PVD B;  4OB1 B;  4EO4 A;  3JB9 H;  4J6X A;  3CCV A;  1Q82 U;  1I81 A;  2QQS A;  5DM7 R;  3M53 A;  4M7D F;  3VKI A;  4M75 A;  4IKF A;  4DPG A;  4P75 C;  5GAM f;  4IUR A;  4P5N A;  3HXU A;  3SB2 A;  1W66 A;  4M7A F;  5FU6 C;  4IUQ A;  1C0A A;  1SES A;  4QQ6 A;  1NJI U;  2K5F A;  3WXM B;  4G84 A;  2I4O A;  3FRN A;  3RKX A;  2MMP A;  4HWO A;  3LYI A;  5HKC A;  4JLG A;  3WVD B;  4JDS A;  4B9X A;  4XAX B;  3L2V A;  2KMT A;  1RL2 A;  1YI2 T;  2WAC A;  3CCM A;  3X24 B;  2QDY B;  1G5H A;  1KMM A;  1BBU A;  4JRP A;  4M75 E;  3CPF A;  5AYF A;  2OTJ T;  3OYM A;  4PJO F;  2LNV A;  4NL3 A;  1EIF A;  3HY0 A;  3V7C A;  1EFW A;  4HCB A;  2RHQ B;  5CR2 A;  5GMK m;  3ER0 A;  3UGT A;  4CS2 A;  3DB3 A;  3SWN B;  2PU9 B;  3CPW S;  2EQK A;  4UP8 A;  4ZTZ B;  3A5Y A;  5GMK h;  3ICA A;  2VUB A;  3HRS A;  1HC7 A;  1H4Q A;  5GAO p;  3F70 A;  4TTV A;  4FIB A;  3I55 A;  3OYJ A;  4PG3 A;  3QPH A;  4P72 C;  3FEO A;  2FYK A;  1BYM A;  3R07 A;  4N4G A;  3HFZ A;  4TVA A;  1VQN A;  3EAE A;  3JCM c;  1YHQ A;  3RES A;  3L42 A;  4CH4 A;  5LL6 S;  2BIV A;  3JCM b;  4H2W A;  1I8F A;  3GOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...