2DXUA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
231
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKISFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 231
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxuA01
4C92G 1X56A 3JB9G 4YP0A 4YRJA 4YRGA 2ODRD 3EFRA 5GAN8 2ZZFA 2DDZA 3BFMA 1YGBA 4F7UF 2ZT8A 1WYDA 1NNHA 3NELA 4M78F 3HFZA 4YPFA 4EMGA 4YRMA 1PYSB 4OP0A 4K87A 2E10A 4EMKC 2ZZGA 4XU0A 4P73A 3W3SA 4H2YA 4O2DA 4Q6GA 4HWPA 5GANf 1B7YB 5GMKh 2G4CA 1YFTA 4NCXA 1NJ5A 3JCMd 4RCBA 3V8JA 3BJUA 2FYKA 3HY0A 5HGQA 4XTWA 3JCMQ 1E22A 2RHQB 3UFGA 4M77A 1WNLA 1VQZA 2RA2A 4P71C 4M77G 4YDQA 2YHTA 3SWNC 1B76A 4PJOA 4RQEA 1WQWA 2E65A 4HVCA 4YRPA 3HRIA 4PJOG 4XTVA 1LYLA 2Q7GA 4CS2A 4M7DC 1I4K1 4C8QA 1X54A 5ELNA 2CJ9A 3RGLA 2ZT5A 3A5YA 5GAOl 4JLIA 2P0LA 2DJZA 1PYSA 5GAMg 4YRQA 1SRYA 3A32A 1EVLA 3IALA 4L87A 3MF2A 1B7YA 2Q7EA 4CH6A 4CS3A 3VQYA 1U1SA 3JCMe 5GAOq 5C52B 2DU7A 1M8VA 4C92C 3RKXA 4X9CA 4XTZA 3ERRA 4P72A 3RKYA 4JRIA 1EIYB 2RHQA 5LJ5g 4CS4A 4J6YA 5GAMh 4M78C 1HC7A 1ASZA 4XU3A 3BY7A 2J3LA 4MMLA 3IKMB 4M77E 2P5IA 3LSQA 3QUIA 4NOYA 2ZGWA 4YRRA 2ZXFA 4XU2A 2DQ3A 4PJOE 1H4TA 2I4NA 2ZZEA 4C8QD 2PMFA 4YRLA 4TVWA 3L2ZA 4H2UA 2DZ9A 2VXEA 3JB9J 5LJ3d 4C8QE 3VQWA 3QNEA 3QO7A 4P74A 1G51A 2E1HA 2J3MA 4M75F 5GAMf 4UP7A 4TVYA 4M7AF 3TEHA 1B34B 4PHCA 3SB2A 3NEMA 1Y96B 4XQ3A 3HXYA 3JB9H 4HWTA 5GMKl 1EOVA 2IY5B 1YFRA 1EIYA 1G5HA 2ZR3A 1WQ7A 3WQZA 4YCUA 2E3CA 3QO3A 4C92F 3JB9F 3QTCA 4HT9A 1B70B 4C8QB 4WJ3M 5GAN3 4HA8A 5LJ5f 2DXTA 2I4LA 3L4GB 1L0WA 1YCYA 1ADJA 2ZT7A 4CH3A 2RD1A 3M4GA 1G5IA 3QO8A 4EMHA 3L1AA 2QHSA 3TEGA 3IKLA 1USYC 1JJCB 3FB9A 4YCWA 3UGQA 4N0AA 5GAOn 3HXZA 1I5LA 1U1TA 3JCMP 5LJ3e 2EWNA 5C53B 1NJ6A 4G84A 3P8VA 2YLBA 3NETA 2C7IA 4LNSA 1TH7A 5GAN5 4X5OA 1M5Q1 4EMKB 3DSQA 4M7DD 3JCMc 4CH4A 1B34A 1ASYA 4XTXA 2ODRC 1Y96A 2E64A 4M7DE 4P75C 5K1PA 5C51B 5GANd 4KR2A 4M77F 2ARTA 2IY5A 1HK9A 5GAOp 1H4QA 5GANj 2XTIA 2QHUA 2AMCB 1BBUA 4EO4A 5GMKi 1D3BB 1B70A 3REUA 4PJOF 4E51A 1MGQA 1Z7MA 2VXFA 2EAYA 3L4GA 4YRKA 2QTXA 3M4PA 3JCMW 5F5WA 4JRKA 4C8QG 2DXUA 1KOGA 4H2WA 4QVDA 3G1ZA 3HRKA 1I81A 3R07A 4M75C 3SWNB 1ATIA 1X2HA 2EJFA 4M7AC 1JJCA 4AH6A 3MEYA 4MMKA 4M78D 2I4MA 3A31A 4ZTUB 4M7DB 3TEHB 4F7UE 1LJOA 2I2LA 5LJ3h 3QHSA 2PMEA 3HY1A 2Q5HA 1WPYA 3INZA 3HTZA 1QE0A 3AHUA 4YRFA 1FYFA 4EMKA 3A74A 4RDXA 1HTTA 3RUXA 3VU3C 2DKGA 2DEQA 2CJBA 4A54A 4YRNA 4XU1A 2ZINA 3RESA 2QHTA 2RB6A 1N9WA 2RHSB 3NENA 5GANe 3HXUA 4XTUA 1SERA 4YROA 5GAN6 3RACA 4J6XA 4WF2A 3EFSA 2ZT6A 3E9HA 4F7UB 2DTOA 4TVAA 2AMCA 1D3BA 2DZCA 3JCMg 4P73C 4M78B 4ZTZB 4J5YA 4P71A 4YCVA 4BW9A 5LJ3j 1X55A 3ICAA 1EFWA 3TUPA 2CIMA 3V7RA 3SWNA 1KQ2A 4HWRA 1C0AA 2ZNJA 3A5ZA 4P3NA 1E24A 2ZTGA 3LC0A 4Q15A 5GAN7 1EQRA 4M7DA 3OD1A 1BIAA 4M77C 4NL3A 2HNIA 2K57A 3PCOB 4YRIA 4ZIBA 4YREA 4M7DG 3JCMh 5GMKe 3HFOA 4TWAA 3UGTA 3RIRA 1X2GA 3JCMJ 4PJOC 3HSBA 4P3PA 3QO5A 1WLEA 2RHSA 3HXXA 2I4OA 2C8MA 1JRIA 5GAMd 2CGHA 4NL2A 3KFUA 1KMNA 1H4SA 2YLCA 3HXWA 5GANh 2Y90A 3CMQA 5GAN4 4H2VA 3RERA 1NYRA 3V8LA 11ASA 4C92A 3VQVA 4TTVA 3FJPA 4F7UA 1H4VB 2CJAA 2ZCEA 5GAOr 2RM4A 3I7FA 4KQEA 4M78A 1W66A 4F7UG 1HXDA 3JB9I 2Q5IA 1SETA 1JBMA 4J15A 4M78G 3JCMf 4H2SA 1YFSA 5LJ5d 1QF6A 4H2XB 2XGTA 1RIQA 1B8AA 3HFNA 5LJ5j 2ALYB 2DQ0A 4XEOA 4P72C 4PNOA 4H2TA 2DTHA 1KMMA 4RCCA 5GAOm 3RL6A 3PCOA 1LNXA 2QHVA 5E3IA 3JCMb 4M75D 2Q7HA 4J6WA 4M7AD 1EVKA 3JCMV 1H641 5LJ3g 3HFVA 3A7RA 4TVAB 4CH5A 3PGGA 4M75E 4M7AE 4WJ4A 5GAMe 2E5AA 4OLFA 2ZIOA 3A7AA 3V7CA 4HWOA 1BIBA 4UP8A 2E41A 4YRCA 4XTYA 4C92D 3RF1A 3JB9D 3A7UA 4C8QF 4YRSA 4P74C 4YYEA 4C92E 2ZNIA 2ZR2A 4UPAA 3HXVA 4UP9A 4M78E 4DQ2A 5LJ5e 1LOJA 3JCMX 4H2XA 2EL9A 4K86A 1NJ1A 3RKWA 4YRTA 4DPGA 4M75B 5GMKj 3V8KA 2ALYA 4M7AB 1NJ8A 4WI1A 1USYA 4BWAA 2JN0A 3MF1A 3P8TA 4HWSA 4XEMA 2DTIA 1NYQA 5KNNA 4PG3A 4A53A 5I21A 1E1OA 2AKWB 3IG2A 4X9DA 4P3OA 4C92B 4HT8A 4H02A 2DVEA 4Y91A 4K88A 2ARUA 4RMFA 1GGMA 4JUVA 1E1TA 4M77D 4N0AC 4RQFA 5LJ3f 2EJGA 1NJ2A 5GMKm 4P75A 1X01A 2ZIMA 1I8FA 5CAIA 5DY9A 1YB3A 3HFZB 4PJOD 1J5WA 4TQDA 3REXA 4KR3A 4G85A 5GANg 5K1XA 1SESA 2ARSA 12ASA 3QSUA 1ADYA 2VC8A 4QVCA 1N9SA 1WU7A 3FIFA 3GIBA 5LJ5h 5ELOA 3VQXA 4M7DF 4V2SA 4M75A 3UH0A 1KQ1A 4TQFA 3BW1A 4M7AA 3PZCA 3LSSA 3VBBA 4M75G 4M7AG 5GAN2 3P8YA 1Z7NA 4C8QC 4M77B 2FB7A 5GAMj 3BDUA 3E9IA 4EX5A 2AKWA 2DU5A 3M4QA 1N9RA 3V7SA 2EJ9A 1BBWA 4PJOB 1IL2A
chains in the Genus database with same CATH superfamily
3JB9G 4YP0A 3RNJA 4AMCA 4YRGA 2ZZFA 3CBOA 2DDZA 3BFMA 3HRTA 5FU7B 3FDRA 3EH2A 5IHKA 2HDAA 2ECZA 4EMGA 2R58A 1UJ0A 1ZQ1A 4UC4A 3HP9A 1PYSB 4K87A 4RTWA 5A2QE 4EMKC 2EGAA 2HBPA 1VOMA 4A4HA 1JO8A 3P8BB 4O2DA 4Q6GA 2E12A 1N8RR 5GANf 1SSFA 4C0ZA 4FYVB 1B7YB 1NPPA 2WSEE 1QLYA 3VS7A 4NCXA 2E3IA 1Q86C 3HY0A 1WZOA 5IXBA 1E22A 4OB0B 3OS0A 3QYHB 3CBMA 4J9FA 2OTLQ 4AFQC 1RACB 1NG2A 3VKIA 4IKFA 4FYYB 2L89A 4P71C 3LGFA 4JJNK 3OYEA 3M0QA 4OB1B 2PTKA 2YHTA 3SWNC 2A08A 2VWFA 4N4GA 2IPOB 4RQEA 5EG2A 1IHWA 4PJOG 4XTVA 3JRZA 4M7DC 1I4K1 2KXDA 2FRWA 1X54A 2KNBB 4EIKA 1M30A 2ZT5A 4JLIA 4HVWA 3VS0A 1PYSA 3CCMA 4YRQA 1WJQA 4LD6A 3PTAA 2CSIA 1RAFB 2CS7A 1SRYA 3G71T 1QVPA 3A32A 4C0DC 4L87A 1WLPB 2D8JA 1WIEA 2EYYA 3H8ZA 1ARKA 1B7YA 3H6ZA 3VRZA 3VQYA 3SHWA 1PRMC 2KEAA 1ZUUA 2DU7A 3RKXA 4X9CA 2HSEB 4P72A 3CC7A 3MCAB 1UTIA 1CSKA 2P0KA 1S72Q 2CYZB 4FSSA 2DPPB 1QKWA 3LSQA 1D1AA 3OYJA 4FW1A 3CD6T 2ZGWA 4YRRA 2ZXFA 4XU2A 2B8AA 2F1LA 4N4IA 2DRKA 4AFZC 4PJOE 2EPDA 1JB0E 2YUOA 4C8QD 2JOYA 2FPEA 4OMLA 2DZ9A 5FU6B 4C5EA 3JB9J 3CCRQ 1YJWA 4C8QE 3QNEA 3QDFA 5KYNA 3EFOB 4P74A 1OX9A 4IURA 1G51A 3DB4A 4DEYA 1T0JA 3TEHA 3CEYA 2FHDA 3HXYA 3LH5A 3E19A 2IY5B 3CCUQ 4LVMA 2DJQA 3URGA 2K79A 1G5HA 3WQZA 2EYWA 4C92F 1PKTA 4HT9A 1B70B 4IUUA 3SDZA 2COZA 1QW1A 3R6OA 3L4GB 1YCYA 1ADJA 4CH3A 2DVJA 1YI2Q 5AT1B 1VYVA 4EMHA 3IKLA 3UGQA 2DL3A 1B07A 1D1CA 5GAOn 2FZGB 4DEXA 1U1TA 2KQWA 5LJ3e 3CPFA 1VQ5Q 5C53B 3FLGA 1UDLA 3P8VA 1OULA 1TH7A 4A4FA 2L3PA 3LGLA 1M5Q1 4BI4A 1WFWA 3JCMc 1VQ4A 1KSWA 2RI3A 1WHGA 3GNFB 4P75C 4KR2A 2IY5A 2MWOA 3CPWP 5GANj 2XTIA 1VQLT 1Q81R 1D3BB 1MNEA 2RQTA 2RHZA 1B70A 2NLUA 2FZKB 3C95A 1MGQA 2EAYA 3L4GA 2GFUA 2QTXA 2ED1A 3CPWS 4QVDA 3G1ZA 3HRKA 3OYDA 2K9GA 2DL5A 4BE2A 1UGSB 1VQMQ 2IG0A 4FYXB 5IHIA 4IUPA 2I4MA 4OMQA 1ABOA 2QG9B 3I9QA 3OW2S 1S72A 1Q82U 3S3MA 1Y0MA 1N8RC 1M2VB 1QE0A 3VS6A 3MP1A 4YRFA 1VQ9T 3A74A 1YJ9T 1HTTA 3F70A 4QW2A 4A54A 4YRNA 4NS5A 3RESA 2QHTA 3DLLA 3CXCS 2L3RA 2V8JA 2GNCA 1SERA 2FG0A 2BUDA 1K9AA 4WF2A 2HBWA 3EFSA 1YJNA 3EG9B 1OOTA 4JRPA 1D3BA 2KT8A 3JCMg 4J5YA 2DL8A 5LJ3j 2DBMA 3TUPA 1C6VX 3LLRA 2K5FA 1N6AA 3QKJA 1OQKA 2A0FB 4HCCA 3A8OB 3CCUA 1IB8A 4Q15A 3LC0A 2VUBA 1JJ2A 1UHFA 1ZUKA 1BIAA 2DE0X 2ZPBB 3IQLA 1EX4A 1M2VA 2OAUA 3RIRA 1YIJA 3BDLA 2VKNA 8AT1B 3G71Q 3QO5A 4C5HA 1IHVA 1JRIA 3FEOA 4Z88A 4ELZC 2DF6A 2YLCA 5GANh 3CMQA 1VYUA 1JXMA 3V8LA 3G1JA 1SKUB 1H4VB 4XK8E 2FPFA 2ZCEA 3PMIA 2SRCA 4KUIA 1W66A 1HXDA 2P4TA 3OYIA 3PMTA 1NBEB 4M78G 3JCMf 1YFSA 2YUNA 2XGTA 3CD6Q 3CCMT 1B8AA 3NTKA 2DQ0A 4P72C 1QCOA 2A36A 4O6JA 4CI0C 4JDSA 4BUGA 1Y57A 2QHVA 4BDZA 3JCMb 5HK0A 3L2WA 2JXBA 4CC3A 2Q7HA 4J6WA 2PNIA 3CC7T 2M02A 5L23A 4CH5A 3TEEA 2ENMA 3PVQA 1Q7YR 1AWJA 2DBKA 5I2MA 4WJ4A 2DXCA 3VS2A 3MPUB 2KGTA 2R57A 4MZMA 1JQQA 2E41A 4UP8A 4GBQA 2F2VA 4C92D 2DETA 2QA4A 2CP2A 3PE0A 4P74C 4C92E 4D8DA 5AYFA 1YJWT 1BB9A 2ESWA 2HEQA 4M78E 1U5SA 3OW2A 2X4WA 1TUDA 2EL9A 3AT1B 3LX7A 3RKWA 1BI3A 3REAB 4O5VA 4WI1A 1USYA 2F2XA 4C5GA 4LVLA 2FVUA 2E5KA 2V26A 3QWXX 1LCKA 2BZXA 1TU0B 1GFDA 2FEIA 4E2FB 1UEBA 3CXCA 3IG2A 4HT8A 2DVEA 1LVKA 2NYSA 4OGEA 2QQAA 4FL6A 1Q81C 1TWBA 4PFZA 5FU6C 1UGVA 2NUTB 4KBMB 5GMKm 1YFNA 4E7LA 1I0CA 1YB3A 5I22A 1K1ZA 1MV3A 3REXA 2CREA 5FWBA 1VQLQ 5D6WA 1WXTA 3QJ6A 3A98A 4LDWA 4L59A 3GP8A 1ADYA 5I11A 1N9SA 1WU7A 2RH2A 1UJYA 2PUOB 1Q86R 4JZ3A 2GTOA 1W2BA 4M7DF 4V2SA 2MMPA 3NTHA 4AT1B 4M75G 1VQ4T 2CSQA 2VGMA 4M7AG 3ASKA 3DB3A 5FRNA 2FB7A 1BCMA 3BDUA 2EQIA 4RKUE 2JT4A 4BY6B 3CCEA 1FX7A 4L5GA 3V7SA 4PJOB 1YJ9Q 1OU8A 3EG3A 4OVAA 2KRMA 2KBTA 2ODRD 4PJLA 2K7AA 2NUTA 4F7UF 4J9IA 4J83A 5CCAA 1IXDA 1KD1U 4YPFA 2PVGB 3VS1A 2ED0A 5IH2A 2RHIA 3C12A 3MJXA 4M4ZA 4HVUA 2ZAEA 4XU0A 3W3SA 3S6WA 1S72T 2M51A 4KUDK 2G4CA 1GFCA 1UFFA 3H0HA 1QVFP 3BJUA 2FYKA 1KK7A 1ZSGA 5IHNA 5J39A 2RA2A 4FW2A 1PWTA 1AT1B 4M77G 3PIOA 2CP3A 4LD9K 1QVFS 1YJNT 2P0QA 4YDQA 4PJOA 2L0AA 4RTVA 2E65A 2X35A 1UHCA 2YUQA 4C8QA 3M56A 2CJ9A 3RGLA 3ZEHA 3A5YA 3VYGA 2NWMA 2P0LA 2MOXA 2OX7A 1W6XA 2DJZA 3CCSA 3CCUT 5GAMg 1KC8U 1W70A 1OYXA 5D7UA 3META 2AHJB 4AG1C 3D7SB 1D0YA 3TU4K 2Q7EA 1O9SA 4CS3A 2JZ2A 1YIJT 2DYBA 5C52B 3CCMQ 5GJVB 4ZTFA 3ERRA 2YDLA 1AZGB 2O01E 5LJ5g 2BE7D 4J6YA 4RMOA 1M90R 2E4HA 1VQNA 3Q1JA 3OB9A 1HC7A 2K5LA 4XU3A 3OYMA 2AK5A 1X6GA 2AZVA 4ANJA 4M77E 2P5IA 2KMTA 4IIOA 1T0HA 4LVIA 3SD4A 3QUIA 2D9TA 4BI3A 1QP2A 2JM8A 1G8XA 2RJDA 4RG2A 3CC7Q 1RAGB 1YHQQ 2CDTA 2RQUA 2DQ3A 5CKHA 3A8GB 4H2UA 1WJRA 5LJ3d 2CZ1B 1IRXA 1R0BG 2DIQA 1TOVA 2J3MA 4C0FA 2DILA 5GAMf 4UP7A 1E6GA 3QYGB 3CCJA 3M0RA 4OMOA 1I5OB 1G3TA 1YJWQ 1B34B 3SB2A 3FRNA 1BI2A 3PVLA 4XQ3A 5CKDA 1I1JA 1KQSA 2J7IA 3JB9H 1VQPQ 1OU9A 1G83A 1W1FA 1WDXA 2ZPEB 3G6ET 2ZR3A 1WQ7A 1YCSB 2RJEA 3O5ZA 2RN8A 4AFUC 4ZTJA 3QTCA 5GAN3 4HA8A 5M9OA 5LJ5f 1ZX6A 1RL2A 2QA4T 4JJCA 4YTLA 1G5IA 3A1PA 3QO8A 4Z02A 2QHSA 3TEGA 2RPNA 1USYC 3HXZA 1WHMA 2ROTA 2A28A 2EWNA 3HRUA 4BE1A 1QCNA 1KC8C 4G84A 1E6HA 2XG8D 5EC7A 5HY6A 3RBBB 2C7IA 4LNSA 1QMCA 2YT6A 2QDYB 1JU5C 3CCQA 4X5OA 3I55Q 4JPBW 3UDCA 3ME9A 1RAEB 4M7DD 4JRQA 4A4GA 4F04B 1B34A 4XTXA 1J3TA 3QIIA 3HL8A 2D6FA 1B3QA 2XU8A 4M7DE 4F14A 3LWIA 1HK9A 4XAXB 1H4QA 1MNDA 2YXYA 1M90U 1X6BA 1VQ4Q 1BBUA 1X75C 1ZBJA 3REUA 4E51A 2PQWA 1Z7MA 2GCXA 1UE9A 1XQHA 2HSPA 4C8QG 1AHJB 1KOGA 2RNAA 3R07A 1X2HA 4BD3A 2JTFA 1O75A 4DOVA 4GLMA 3A5ZB 2RQWA 1LPLA 4ZTUB 3TEHB 4F7UE 3OYBA 2AZSA 5J3BA 3QHSA 3A8MB 1RADB 1OPKA 1MV0B 3M55A 2DX1A 4J9EA 5HKCA 3INZA 2KK4A 3AHUA 2K6DA 2LX7A 1FYFA 1BKBA 2K3BA 2R5AA 2DEQA 1YHQA 3QDRB 2ZINA 3LWHA 2RHSB 1Z9ZA 1SPKA 3CCET 5GANe 3OYAA 2P84A 4YROA 3L2VA 5GAN6 5KE2A 3QJYA 3RACA 4FYWB 1GXIE 4Z89A 1PCXA 4TVAA 4QQDA 1EZZB 1AWOA 4M78B 4BE0A 5I2SA 1NM7A 4BW9A 3TSWA 2KYMA 1EFWA 3G7ZA 1Q82R 4BB7A 2CIMA 1YJNQ 1VQ6A 2GFAA 3M59A 1VQPA 2OI3A 1KFZA 3MKDA 4LNPA 3M0UA 3X24B 3A5ZA 2LJ1A 1E24A 4HVVA 2ZTGA 3L2RA 5CQXA 2DLPA 3OD1A 1VQMT 3PCOB 2LQKA 5A0LA 2EGEA 4BY6C 2DL7A 3EGUA 2AKLA 2CKKA 1X2GA 2A8EA 3JCMJ 4PJOC 4P3PA 2VYTA 2RHSA 1Y7XA 2V1RA 1NEBA 2MYSA 2CZ0B 4D6WA 5KYWB 1KMNA 1M90C 1H4SA 1NJIR 2Y90A 4RTXA 1YIJQ 5GAN4 3HHTB 2X4JA 5CKFA 2SEMA 4C92A 3TREA 3I55A 1OEBA 3CCVQ 5GAOr 1RAAB 4KQEA 4M78A 3TVTA 2XI9A 3JB9I 1JBMA 3GPLA 2QDLA 1RI9A 3CCST 1YN8A 2ZPGB 3ZFJA 5LJ5j 2QTVA 1RLPC 1R0CB 1XTDA 2KDSA 4H2TA 1TUCA 1TTHB 2L3SA 2LC4A 2YRDA 1QWEA 1KMMA 2VGNA 4RCCA 1PG5B 1T3LA 3PCOA 3MEVA 2Z0WA 2ZPHB 4J7FA 3SFMA 1K0XA 1VQ7Q 4BI8B 3A7RA 2MAMA 3L2QA 1VQNT 3PGGA 2O31A 3ZBDA 1BI1A 2DMOA 4DBRA 1SHGA 3RMQA 5KYWA 1H3HA 3V7CA 2D0QB 4YRCA 4J9HA 3PNWC 4XTYA 1Y71A 2HQXA 3A7UA 4LDXA 4YRSA 9ATCB 3G6EQ 4YYEA 2ZNIA 2JMAA 2ZR2A 2KE9A 1FMWA 3I5RA 3OYCA 4JS5A 3H9NA 1P92A 4B6MA 3HXVA 2F69A 3JCMX 2QA4Q 1NJ1A 4YRTA 4MZTA 4M75B 4M7AB 4E6RA 1F1BB 4MZPA 4BWAA 3L42A 1FYNA 1RAHB 4FM4B 3CCJT 4HWSA 2EQMA 1NYQA 5CKEA 4PG3A 4A53A 5I21A 4LN2A 2J05A 2RI5A 2AKWB 1TS9A 4PL6A 4P3OA 1TG0A 4LDVA 1JXOA 4L6V5 3CCLA 4Y91A 4K88A 2KAFA 2ARUA 4J8OA 4RMFA 2J06A 4JUVA 2EBPA 3KXTA 2EQKA 1NJIU 1CKBA 2EJGA 4QQ6A 4LDYA 1AOJA 2D8HA 1BU1A 3EG2A 4JZ4A 1I8FA 5CAIA 2EKHA 1J5WA 4TQDA 1M3CA 2PVDB 4DA4A 4G85A 1RI0A 2MPXC 5K1XA 2QQ9A 2OTJQ 3FIFA 2HD0A 1GCPA 5LJ5h 5ELOA 1OPLA 3H0IA 3CCQT 3VQXA 1D1BA 4M75A 3UH0A 4M7AA 3PZCA 3UA7A 2VB6A 3NTIA 2O4XB 3VBBA 2NUPB 4J9BA 5IAYA 1D0ZA 3CCVA 5GAN2 3P8YA 2GF7A 4M77B 2RHUA 1RUWA 4CC7A 4EX5A 3UWNA 2AKWA 3M4QA 2LJ3A 2DIGA 1ZHIA 2LCSA 2EJ9A 1DJ7B 2HKNA 1QVGP 3M5AA 3DKMA 4C92G 3FC3A 1X56A 1GBRA 4B9WA 1KIKA 5GAN8 2XDPA 3CCEQ 2ZT8A 5HCKA 3EH1A 1PC0A 2COWA 2C0IA 2M1HA 4PLLA 1QVGS 1VQ7A 4OP0A 2ZPFB 2E10A 1Q82C 2ZZGA 8ATCB 1PHTA 2RJFA 4P73A 1K4US 3E9GA 2R5MA 3TQ7P 4ESRA 2EW3A 3FJ5A 2KSSA 4RCBA 1YHQT 1VQ8A 3CC4T 2O4XA 4JJBA 2NUPA 4BDYA 4XTWA 3G6EA 3JCMQ 1HD3A 2EKOA 2V8IA 3RR6A 1AD5A 3UFGA 1BK2A 4M77A 2DA9A 2XIDA 2O2OA 2MIOA 5CKBA 1VQKQ 1WGSA 2K4YA 4ZN1A 3C0CA 3CPWA 1KD1R 1NJIC 2DL4A 4HVCA 4YRPA 3JAME 1LYLA 2Q7GA 2PU9B 2HQEA 5ELNA 1K9MU 2BTTA 4OB2B 1G3WA 2HAXA 1VQ6T 3E2UA 5GAOl 1VQPT 3EG1A 3M0TA 4KGVB 3G4ST 2KI7A 3SEMA 3GNGA 2D0NA 5C6SA 2QGGA 1U1SA 3JCMe 3CCSQ 4OB3B 3MP6A 2NS6A 4C92C 4EPCA 1UECA 4XTZA 4JRIA 3VS4A 1EIYB 2E6NA 4FSXA 3GLXA 4M78C 2OTJA 2RF0A 5DM7R 3M4YA 2J3LA 1AWXA 3ULRB 3VJPA 3A8HB 5IXFA 1IO6A 2CZ6B 4OMFB 4NOYA 3I55T 3VS5A 4E7HA 1KC8R 1VQNQ 4LVJA 2ZZEA 2PMFA 4YRLA 4TVWA 2X4YA 3L2ZA 2DYIA 2PZ1A 2LNHB 2HQHA 1K73U 3EGDB 1WA7A 2VASA 4Y92A 3OYNA 1I07A 2B86A 3NGPA 3CQTA 2E1HA 1NEGA 2GBQA 4TVYA 3R6NA 4IIMA 3NEMA 4ZGDB 1Y96B 4KGZB 1EIYA 5KYYB 5FRMA 4E7SA 3CCJQ 1WI7A 5DLQE 1MMDA 2E3CA 3QO3A 4GY5A 3JB9F 2QI2A 4C8QB 1XOVA 2DXTA 2ZZDA 2X3WD 2I4LA 1L0WA 4ZN3A 2ZT7A 1WHJA 2LT1A 3TSZA 1EIFA 3VV0A 2X51A 3M4GA 1ZSZA 3EHQA 1FMVA 2VVKA 4C5IA 3L1AA 1NZ9A 1K9MC 1JJCB 3FB9A 4KRTA 3OS1A 4YCWA 1M4ZA 3HPWA 1M1KU 3EGDA 2YLBA 1M8MA 1VQKA 2FRYA 2DNUA 3MEUA 5GAN5 2JJ9A 3DSQA 1IGUA 1H8KA 3EG0A 3M9QA 1G2BA 5CO7A 4KH1B 1ASYA 2ODRC 1Y96A 2E64A 4Y28E 5A0DA 3MP8A 5K1PA 5C51B 3CCQQ 5GANd 4IUQA 2ARTA 4BACA 3CCLT 2DO3A 4R0KA 2EFIA 4LUEA 5KYYA 2QHUA 4TVRA 2XMFA 5GMKi 1PNJA 4EO4A 2C0OA 2W10A 4PJOF 4PJMA 2FL7A 1UGQB 4YRKA 3JCMW 4JRKA 2DXUA 2V8KA 4H2WA 4M75C 4M7AC 4OMMA 1JJCA 2K3YA 4F16A 4AH6A 2DFUA 3MEYA 4MMKA 3WVEB 4LUDA 1LJOA 2CUBA 3DLMA 1WHHA 3HY1A 3REBB 3VRYA 2HMAA 1WPYA 1SF9A 3HRSA 3E9FA 4X34A 2JMCA 2QQBA 3VU3C 2DKGA 3CCVT 2CJBA 4XU1A 3NENA 3HXUA 4XTUA 2W0ZA 1Z9QA 4J6XA 4AFSC 3CC4Q 2KXCA 2P4RA 4HCKA 2MF2A 1KD1C 4DBFA 4QKUA 1V76A 4P73C 4ZTZB 3OBYA 1YITA 2M16A 4DBHA 1X55A 1FXXA 1PM3A 2LQNA 1VQ7T 2KROA 5LL6S 2DM1A 1D09B 4J9CA 5CK9A 5GAN7 5CR2A 2XDDA 1EQRA 4M77C 2JNGA 2HNIA 2K57A 4OGCA 4ZIBA 3EHRA 4M7DG 4JS4A 1VQ6Q 4FT4A 1M9SA 3JCMh 5GMKe 3HFOA 2XDBA 4TWAA 1VQ8T 4RUGA 2WSFE 3HSBA 3QWYA 4X1VA 2MK5A 3OYKA 2H3EB 3G4SQ 3OSSC 4KT0E 1HYOA 3HXXA 2I4OA 4ORZA 2KVQG 1AEYA 2J6KA 2CGHA 4NL2A 3HXWA 1PD0A 2LX9A 4H2VA 1X2KA 11ASA 3VQVA 2X3XD 2CJAA 2M0OA 1K76A 3OS5A 4F7UG 1ZA1B 4AG2C 3GOXA 2GGRA 4OMPA 4H2SA 3T9NA 1M1GA 3CC2Q 2H3JA 2KRSA 4J7IA 1RIQA 2A37A 3EGXB 1TSFA 1MMGA 1YNZA 2JW4A 4PNOA 1M1FA 3RL6A 5E3IA 7AT1B 2M0YA 4FCYA 1BCOA 3P8DA 1EVKA 3JCMV 2V1QA 1QVFA 1VIFA 5LJ3g 2K3XA 3HFVA 4TVAB 2OTJT 1B7TA 1ZBXA 1MHNA 3UATA 4E7IA 5L8RE 5GAMe 2E5AA 4OLFA 2Y4XA 3OMGA 5KCHA 2EIFA 2JVVA 1BIBA 1EFNA 2DRMA 3RF1A 3NPFA 3JB9D 3I56Q 1N27A 4A4EA 4ELYC 3RMSA 3CMAA 3GBQA 1QWFA 2EQUA 1G5VA 2E70A 1M3BA 2DXBA 3PFSA 3X20B 1PKSA 4ME7A 5LJ5e 2AKKA 2DAQA 4E7JA 1RABB 2KYBA 3M54A 4KGXB 4K86A 1GCQA 1QP3A 3EGXA 1IREB 3V8KA 2KT1A 3ZL7C 5GMKj 4HCBA 1NJ8A 2JN0A 3CC4A 2GQVA 3P8TA 5CIUA 2DTIA 1ABQA 1S1NA 1X43A 4R56A 5D6YA 5FWCA 3OSVA 1C1AA 4C92B 4WCIA 5C0MA 1ZSZC 2LT4A 1WYXA 4ZGEB 4RQFA 5LJ3f 4RTYA 1OV3A 2DD5A 2ZIMA 5DY9A 3H0FA 2QEXA 3HFZB 4PJOD 3CCLQ 4KR3A 1VQOA 1H3ZA 1SESA 1JJ2P 2MI6A 12ASA 3QSUA 2ARSA 3G4SA 4OF1A 1ZA2B 2RMOA 2VC8A 4J9DA 4RTTA 2LQWA 2ROLA 2XICA 1HSQA 3GIBA 1VQKT 1UG1A 3NHNA 3P8HA 4TQFA 4MDXA 2LMJA 1JJ2S 1G3SA 3NFCA 4J9GA 4PFPA 3VYHB 1N8RU 1Z7NA 4C8QC 4ATOA 5GAMj 4PJNA 2DU5A 3UF4A 4LVKA 5KH6A 3CC2A 3NMZC 2CP0A 1XNIA 3MO8A 1IL2A 1TXQA 1M3AA 2E5QA 4YRJA 2WACA 1N5ZA 1WXUA 3EFRA 4K11A 2DD4A 1YGBA 3CMEQ 2LRQA 3ER0A 1WYDA 1NNHA 3NELA 4M78F 3HFZA 3KBGA 4YRMA 2LJ0A 2YSQA 1PD1A 3C94A 2QGFB 4RTZA 3MEAA 4H2YA 1XJWB 2LDMA 2OTLA 4HWPA 6AT1B 3VUBA 4IUTA 5GMKh 3LYIA 1YFTA 2CT3A 1NJ5A 3JCMd 2YRVA 3I56A 4B9XA 3V8JA 1OX8A 4QQGA 1RLQC 2BZ8A 3EFOA 5HGQA 2RHQB 3L2UA 3M58A 3UA6A 1WNLA 2DERA 1VQZA 2O9VA 2QQRA 1U3OA 5GJWB 1VQ8Q 2ABLA 3KFVA 1B76A 1WQWA 4C0GA 1SRLA 3HRIA 4PFOA 4CS2A 1YITT 2D1XA 4QT7A 2VV5A 4FIBA 2CH4A 3A8LB 1UGRB 2G3RA 4Z8AA 3OW2P 1V1CA 1SEMA 3IALA 1EVLA 3WVDB 1YBYA 3MF2A 2BZYA 4CH6A 2FZCB 1OZ3A 1WHLA 5GAOq 3CXCP 3X28B 1M8VA 1GBQA 1M27C 4OMNA 3RKYA 1NPRA 2RHQA 4CS4A 3OYGA 3HTRA 5KE3A 5GAMh 4HCZA 1ASZA 3BY7A 4MMLA 5D6XA 2F5TX 3IKMB 2HL5C 1K9MR 2AIRB 3CCRA 2JM9A 2CH4W 3PT9A 1K0SA 2HZYA 1PSEA 1KHIA 1H92A 1H4TA 2I4NA 2QYZA 2AT1B 2IVWA 2COYA 2LNVA 2HKQB 1YP5A 2E3HA 4QVZA 2XKOC 1BBZA 2VXEA 2EYZA 1MMAA 1UGPB 3OYLA 2YUPA 2LTOA 2A7YA 1W2BP 3UT1A 3VQWA 2HL3A 1NYFA 3QO7A 1M2OA 3KUFA 2XHCA 2LQ8A 2KRNA 1X69A 4RG8A 1NE8A 4M75F 2ZPIB 4M7AF 1A0NB 1PRLC 4PHCA 3CMEA 1W2BS 4KULA 2H8HA 3OYFA 4DBQA 4HWTA 5GMKl 1SRMA 1EOVA 2X4XA 2LCLA 2OAWA 1YI2A 5IN1A 2K2VA 1YFRA 5KYXB 1Y07A 4YCUA 1C0MA 2BE9B 4WJ3M 4II1A 2I0NA 2QXFA 1VQ5A 1QQJA 1V29B 2RD1A 2L8DA 3OQ5A 5FU7C 2J6FA 2RK2A 4D8KA 3CMAT 4CC2A 1GCQC 1K73R 2F5KA 2C0TA 2CZ7B 3J81E 1Q81U 3EG9A 1K8AR 4PJJA 2RI2A 2DK3A 4N0AA 1I5LA 2RHYA 3JCMP 3OYHA 1BI0A 1NJ6A 3NETA 1RAIB 1KJWA 4CC4B 3X26B 4VUBA 2OJ2A 2LZ6B 1WXBA 3TCJA 4EMKB 1GL5A 4R55A 4CH4A 3JSCA 2RK1A 1VA7A 2RQRA 1T3SA 3MHXA 2GTJA 2X9HA 1QKXA 4M77F 5DLOA 5GAOp 3GF5A 1SSHA 3QG1A 1AWWA 5KYXA 2A3LA 2FPDA 1IZ6A 1VQMA 5J26A 2AMCB 4PK4A 1NLOC 1FWZA 2L5QA 2BKDN 4HXJA 2VXFA 1NYGA 1M1KR 3M4PA 5F5WA 4RTUA 3M0SA 1D0XA 2BIVA 2QEXT 1X27A 1G3YA 1VQOT 1I81A 1ATIA 3SWNB 2EJFA 1SHFA 4M78D 5IT9E 3A31A 4LDUA 4M7DB 4JLGA 2I2LA 5LJ3h 2PMEA 2Q5HA 2MCNA 2XK0A 3HTZA 1AVZC 2K2MA 4EMKA 4RDXA 4HT4A 3RUXA 3H41A 2KR3A 4C0DB 3LW5E 3WXMB 2RB6A 2CP5A 1N9WA 2JTMA 5FLXE 1ZLMA 4KH0B 1WJSA 1KHCA 1IGQA 2QASA 3M57A 3CC2T 1UUEA 4CRIA 1ZSZB 3I5SA 3LH0A 2ZT6A 3E9HA 4F7UB 2DTOA 2AMCA 2DZCA 1SG5A 4F17A 3OA6A 2O88A 2P0PA 1WHKA 4P71A 4YCVA 3ICAA 2L2PA 1K8AU 2J6OA 3V7RA 3SWNA 3X25B 1KQ2A 1JEGA 2F2WA 4HWRA 1C0AA 2ZNJA 4P3NA 1UB4A 1ZUYA 2G6FX 1YITQ 2OTLT 3M0PA 4M7DA 3G71A 4NL3A 1NLPC 4YRIA 3JV3A 4YREA 4FT2A 2M9UA 3I56T 2PUKB 1KQSP 3UGTA 1Q95G 3VS3A 1CKAA 2C06A 1WX6A 3THKA 1GRIA 3MQZA 3M53A 1YWPA 1WLEA 3OBWA 2C8MA 5GAMd 3KFUA 3OS2A 1OZ2A 1KQSS 2QK0A 5FW9A 3RERA 2EYXA 1NYRA 4IUVA 3RDVA 4TTVA 3CD6A 3FJPA 1Q7YU 1QVGA 4F7UA 5A0GA 1VQ9Q 3VUZA 1QCFA 2RM4A 2Y4YA 3CBPA 3I7FA 2ZCFB 2PVOB 2Q5IA 1SETA 2K5IA 4DOWA 4J15A 3QZ5B 3J7AF 3OYYA 2JUFA 5LJ5d 1QF6A 4H2XB 4ZGJB 4Q5WA 3HFNA 4A63B 2ALYB 4XEOA 3QZ9B 3OY9A 2DTHA 2JS0A 5GAOm 3S3NA 4FU6A 3PIPA 1LNXA 4M75D 1AZEA 1W4SA 2KY9A 4M7AD 2DEUA 1H641 4M75E 3O8VA 2RO0A 4M7AE 4GLKA 4PLIA 5KYUB 2QQSA 2YRCA 4JJDA 2ZIOA 3A7AA 4HWOA 3CCRT 2JTEA 5HK3A 2E6ZA 3I35A 4C8QF 2EVRA 2O9SA 1X6OA 1BYMA 4ZNXA 1E7OA 2NUZA 1K73C 1HJDA 4UPAA 5CVIA 4LXCA 1K8AC 1YWOA 2EYQA 1VIEA 4LE9A 2EGCA 2CP7A 2HCKA 4UP9A 1ACMB 4DQ2A 1LOJA 1KG1A 4A4KA 4H2XA 3CMAQ 3S3OA 4DPGA 2CT4A 1MMNA 2YWWA 2QAZA 2XD0A 2ALYA 4EDUA 1X2QA 4N4HA 4WTOB 4E47A 3MF1A 3OMCA 3U23A 4XEMA 3CMET 1Q86U 5KNNA 2GQIA 1E1OA 2RQVA 2CP6A 3BE3A 3MEWA 4X9DA 2LVMA 3UPUA 3N5BB 1YI2T 3EAEA 4MDWA 2FO0A 4H02A 2RJCA 3HKSA 2RHXA 2IIMA 1VQLA 2CUDA 5ECAA 1E1TA 1GGMA 4M77D 4N0AC 2LP5A 1U8RA 5KYUA 1VYTA 1NJ2A 1VQ5T 5CQYA 1Q7YC 1FMKA 4P75A 4P5NA 1X01A 2ATCB 1VUBA 1M1KC 4PKCC 5KCOA 5GANg 2EQJA 4QVCA 1MUZA 1U06A 1R77A 2QEXQ 5FROA 4HKEA 1VQOQ 2LCCA 1KQ1A 3BW1A 4E7ZA 3LSSA 1OI1A 1VQ9A 3QBYA 1YJ9A 2JS2A 3J80E 2WSCE 1TUGB 3C4SA 3E9IA 3QPHA 1R8OB 3E1SA 1PSFA 1N9RA 2MWPA 3QXEB 1BBWA 4E7KA 2L3QA
chains in the Genus database with same CATH topology
3JB9G 4YP0A 4YRGA 2ZZFA 3CBOA 2DDZA 3BFMA 3HRTA 5FU7B 3FDRA 4EMGA 2R58A 1ZQ1A 4UC4A 3HP9A 1PYSB 4K87A 5A2QE 4EMKC 2HBPA 4A4HA 3P8BB 4O2DA 4Q6GA 2E12A 5GANf 1SSFA 4C0ZA 1B7YB 1NPPA 2WSEE 4NCXA 1Q86C 3HY0A 1E22A 4OB0B 3OS0A 3QYHB 3CBMA 3VKIA 4IKFA 2L89A 4P71C 3LGFA 4JJNK 3OYEA 4OB1B 2YHTA 3SWNC 4RQEA 4N4GA 5EG2A 4PJOG 4XTVA 3JRZA 4M7DC 1I4K1 1X54A 2ZT5A 4JLIA 1PYSA 3CCMA 4YRQA 1WJQA 4LD6A 3PTAA 2CS7A 1SRYA 3G71T 1QVPA 3A32A 4C0DC 4L87A 3H8ZA 1B7YA 3H6ZA 3VQYA 2DU7A 3RKXA 4X9CA 4P72A 3CC7A 3MCAB 2P0KA 2CYZB 2DPPB 3LSQA 3OYJA 3CD6T 2ZGWA 4YRRA 2ZXFA 4XU2A 2B8AA 4N4IA 4PJOE 1JB0E 4C8QD 2JOYA 2DZ9A 5FU6B 4C5EA 3JB9J 1YJWA 4C8QE 3QNEA 4P74A 4IURA 1G51A 3DB4A 3TEHA 3CEYA 2FHDA 3HXYA 3E19A 2IY5B 4LVMA 3URGA 1G5HA 3WQZA 4C92F 4HT9A 1B70B 4IUUA 3SDZA 1QW1A 3R6OA 3L4GB 1YCYA 1ADJA 4CH3A 4EMHA 3IKLA 3UGQA 5GAOn 1U1TA 2KQWA 5LJ3e 3CPFA 5C53B 3FLGA 3P8VA 1TH7A 4A4FA 3LGLA 1M5Q1 4BI4A 3JCMc 1VQ4A 2RI3A 3GNFB 4P75C 4KR2A 2IY5A 2MWOA 5GANj 2XTIA 1VQLT 1D3BB 2RHZA 1B70A 2NLUA 3C95A 1MGQA 2EAYA 3L4GA 2GFUA 2QTXA 3CPWS 4QVDA 3G1ZA 3HRKA 3OYDA 4BE2A 1UGSB 2IG0A 4IUPA 2I4MA 3OW2S 1S72A 1Q82U 3S3MA 1N8RC 1QE0A 3MP1A 4YRFA 1VQ9T 3A74A 1HTTA 1YJ9T 3F70A 4QW2A 4A54A 4YRNA 4NS5A 3RESA 2QHTA 3DLLA 3CXCS 2L3RA 2V8JA 1SERA 2BUDA 4WF2A 3EFSA 1YJNA 4JRPA 1D3BA 3JCMg 4J5YA 5LJ3j 3TUPA 3LLRA 2K5FA 1N6AA 3QKJA 4HCCA 3A8OB 3CCUA 4Q15A 3LC0A 2VUBA 1JJ2A 1BIAA 4E7KA 2ZPBB 2OAUA 3RIRA 1YIJA 3BDLA 3QO5A 4C5HA 1JRIA 3FEOA 4ELZC 2YLCA 5GANh 3CMQA 3V8LA 1H4VB 4XK8E 2ZCEA 3PMIA 4KUIA 1W66A 1HXDA 2P4TA 3OYIA 3PMTA 4M78G 3JCMf 1YFSA 2XGTA 3CCMT 1B8AA 3NTKA 2DQ0A 4P72C 4O6JA 4CI0C 4JDSA 4BUGA 2QHVA 4BDZA 3JCMb 5HK0A 3L2WA 2Q7HA 4J6WA 3CC7T 4CH5A 3TEEA 5I2MA 4WJ4A 2DXCA 2R57A 4MZMA 4UP8A 2E41A 4C92D 2QA4A 4P74C 4C92E 5AYFA 1YJWT 4M78E 3OW2A 2X4WA 2EL9A 3LX7A 3RKWA 1BI3A 4O5VA 4WI1A 1USYA 4C5GA 4LVLA 2FVUA 1UEBA 3CXCA 3IG2A 4HT8A 2DVEA 2QQAA 4OGEA 4FL6A 1Q81C 5FU6C 4KBMB 5GMKm 4E7LA 1YB3A 3REXA 5D6WA 3QJ6A 4LDWA 4L59A 3GP8A 1ADYA 1N9SA 1WU7A 2RH2A 2PUOB 1W2BA 4M7DF 4V2SA 2MMPA 3NTHA 4M75G 1VQ4T 2VGMA 4M7AG 3ASKA 3DB3A 5FRNA 2FB7A 3BDUA 4RKUE 4BY6B 3CCEA 1FX7A 4L5GA 3V7SA 4PJOB 4OVAA 2ODRD 4F7UF 4J83A 5CCAA 1KD1U 4YPFA 2PVGB 2RHIA 3C12A 4XU0A 3W3SA 3S6WA 1S72T 4KUDK 2G4CA 3BJUA 2FYKA 5J39A 2RA2A 4M77G 3PIOA 4LD9K 1QVFS 1YJNT 2P0QA 4YDQA 4PJOA 2E65A 2X35A 4C8QA 3M56A 2CJ9A 3RGLA 3ZEHA 3A5YA 3VYGA 2P0LA 2DJZA 3CCSA 3CCUT 5GAMg 1KC8U 1OYXA 3META 2AHJB 3TU4K 2Q7EA 1O9SA 4CS3A 2JZ2A 1YIJT 5C52B 4ZTFA 3ERRA 2O01E 5LJ5g 4J6YA 4RMOA 1VQNA 3Q1JA 3OB9A 1HC7A 2K5LA 4XU3A 3OYMA 4M77E 2P5IA 2KMTA 4LVIA 3SD4A 3QUIA 2D9TA 4BI3A 1QP2A 2RJDA 4RG2A 2DQ3A 5CKHA 3A8GB 4H2UA 1WJRA 5LJ3d 2CZ1B 2DIQA 2J3MA 4C0FA 5GAMf 4UP7A 3QYGB 3CCJA 1G3TA 1B34B 3SB2A 3FRNA 1BI2A 4XQ3A 5CKDA 1KQSA 3JB9H 2ZPEB 3G6ET 2ZR3A 1WQ7A 2RJEA 4ZTJA 3QTCA 5GAN3 4HA8A 5M9OA 5LJ5f 1RL2A 2QA4T 4YTLA 1G5IA 3QO8A 4Z02A 2QHSA 3TEGA 1USYC 3HXZA 2EWNA 3HRUA 4BE1A 1KC8C 4G84A 2XG8D 5HY6A 2C7IA 4LNSA 2QDYB 3CCQA 4X5OA 3UDCA 3ME9A 4M7DD 4JRQA 4A4GA 1B34A 4XTXA 3QIIA 3HL8A 2D6FA 2XU8A 4M7DE 3LWIA 1HK9A 4XAXB 1H4QA 1M90U 1BBUA 1X75C 3REUA 4E51A 2PQWA 1Z7MA 2GCXA 1XQHA 4C8QG 1AHJB 1KOGA 3R07A 1X2HA 4BD3A 2JTFA 1O75A 4DOVA 3A5ZB 4ZTUB 3TEHB 4F7UE 3OYBA 5J3BA 3QHSA 3A8MB 3M55A 5HKCA 3INZA 2KK4A 3AHUA 1FYFA 1BKBA 2R5AA 2DEQA 1YHQA 3QDRB 2ZINA 3LWHA 2RHSB 3CCET 5GANe 3OYAA 4YROA 3L2VA 5GAN6 5KE2A 3QJYA 3RACA 1GXIE 4TVAA 4QQDA 4M78B 4BE0A 5I2SA 4BW9A 1EFWA 3G7ZA 4BB7A 2CIMA 1VQ6A 2GFAA 3M59A 1VQPA 3X24B 3A5ZA 1E24A 2ZTGA 3L2RA 5CQXA 3OD1A 3PCOB 2LQKA 5A0LA 4BY6C 2CKKA 1X2GA 2A8EA 3JCMJ 4PJOC 4P3PA 2VYTA 2RHSA 1Y7XA 2CZ0B 4D6WA 1KMNA 1M90C 1H4SA 2Y90A 5GAN4 3HHTB 2X4JA 5CKFA 4C92A 3TREA 3I55A 5GAOr 4KQEA 4M78A 2XI9A 3JB9I 1JBMA 3GPLA 3CCST 2ZPGB 3ZFJA 5LJ5j 1XTDA 2KDSA 4H2TA 2LC4A 1KMMA 2VGNA 4RCCA 3PCOA 3MEVA 2ZPHB 4J7FA 3SFMA 4BI8B 3A7RA 2MAMA 3L2QA 1VQNT 3PGGA 3ZBDA 1BI1A 3RMQA 3V7CA 2D0QB 4YRCA 3PNWC 4XTYA 1Y71A 2HQXA 3A7UA 4LDXA 4YRSA 4YYEA 2ZNIA 2ZR2A 3OYCA 4JS5A 1P92A 3HXVA 2F69A 3JCMX 1NJ1A 4YRTA 4MZTA 4M75B 4M7AB 4MZPA 4BWAA 3L42A 4FM4B 3CCJT 4HWSA 2EQMA 1NYQA 5CKEA 4PG3A 4A53A 5I21A 2RI5A 2AKWB 4PL6A 4P3OA 4LDVA 4L6V5 3CCLA 4Y91A 4K88A 2KAFA 2ARUA 4J8OA 4RMFA 4JUVA 3KXTA 2EQKA 1NJIU 2EJGA 4QQ6A 4LDYA 1I8FA 5CAIA 1J5WA 4TQDA 2PVDB 4DA4A 4G85A 1RI0A 5K1XA 2QQ9A 3FIFA 2HD0A 5LJ5h 5ELOA 3CCQT 3VQXA 4M75A 3UH0A 4M7AA 3PZCA 3NTIA 2O4XB 3VBBA 5IAYA 3CCVA 5GAN2 3P8YA 2GF7A 4M77B 2RHUA 4EX5A 3UWNA 2AKWA 3M4QA 2DIGA 1ZHIA 2EJ9A 1DJ7B 3M5AA 3DKMA 4C92G 3FC3A 1X56A 4B9WA 5GAN8 2XDPA 2ZT8A 2M1HA 4PLLA 1QVGS 1VQ7A 4OP0A 2ZPFB 2E10A 1Q82C 2ZZGA 2RJFA 4P73A 3E9GA 2R5MA 2KSSA 4RCBA 1YHQT 1VQ8A 3CC4T 2O4XA 4BDYA 4XTWA 3G6EA 3JCMQ 2EKOA 2V8IA 3UFGA 4M77A 2XIDA 5CKBA 1WGSA 2K4YA 4ZN1A 3CPWA 1NJIC 4HVCA 4YRPA 3JAME 1LYLA 2Q7GA 2PU9B 2HQEA 5ELNA 1K9MU 4OB2B 2HAXA 1G3WA 1VQ6T 5GAOl 1VQPT 3G4ST 3GNGA 5C6SA 1U1SA 3JCMe 4OB3B 3MP6A 2NS6A 4C92C 4EPCA 4XTZA 4JRIA 1EIYB 2E6NA 4FSXA 3GLXA 4M78C 2OTJA 5DM7R 3M4YA 2J3LA 3VJPA 3A8HB 2CZ6B 4OMFB 4NOYA 3I55T 4E7HA 4LVJA 2ZZEA 2PMFA 4YRLA 4TVWA 2X4YA 3L2ZA 1K73U 3OYNA 2E1HA 4TVYA 3NEMA 4ZGDB 1Y96B 1EIYA 5FRMA 5DLQE 2E3CA 3QO3A 4GY5A 3JB9F 2QI2A 4C8QB 1XOVA 2DXTA 2ZZDA 2I4LA 1L0WA 4ZN3A 2ZT7A 2LT1A 1EIFA 3VV0A 3M4GA 4C5IA 3L1AA 1NZ9A 1K9MC 1JJCB 3FB9A 3OS1A 4YCWA 1M4ZA 3HPWA 1M1KU 2YLBA 1VQKA 3MEUA 5GAN5 3DSQA 3M9QA 5CO7A 1ASYA 2ODRC 1Y96A 2E64A 4Y28E 5A0DA 3MP8A 5K1PA 5C51B 5GANd 2ARTA 4IUQA 4BACA 3CCLT 2DO3A 2EFIA 2QHUA 4TVRA 4EO4A 5GMKi 4PJOF 2FL7A 1UGQB 4YRKA 3JCMW 4JRKA 2DXUA 2V8KA 4H2WA 4M75C 4M7AC 1JJCA 2K3YA 4AH6A 3MEYA 4MMKA 3WVEB 1LJOA 3DLMA 3HY1A 1WPYA 3HRSA 3E9FA 4X34A 2QQBA 3VU3C 2DKGA 3CCVT 2CJBA 4XU1A 3NENA 3HXUA 4XTUA 4J6XA 2MF2A 1KD1C 4P73C 4ZTZB 3OBYA 1YITA 2M16A 1X55A 1FXXA 1VQ7T 5LL6S 5CK9A 5GAN7 5CR2A 2XDDA 1EQRA 4M77C 2JNGA 2HNIA 2K57A 4OGCA 4ZIBA 4M7DG 4JS4A 4FT4A 1M9SA 3JCMh 5GMKe 3HFOA 2XDBA 4TWAA 1VQ8T 2WSFE 3HSBA 3OYKA 3OSSC 4KT0E 3HXXA 2I4OA 2KVQG 2CGHA 4NL2A 3HXWA 2LX9A 4H2VA 11ASA 3VQVA 2CJAA 2M0OA 3OS5A 4F7UG 3GOXA 4H2SA 3T9NA 1M1GA 2H3JA 1RIQA 4J7IA 4PNOA 1M1FA 3RL6A 5E3IA 3P8DA 1EVKA 3JCMV 1QVFA 1VIFA 5LJ3g 2K3XA 3HFVA 4TVAB 2OTJT 1ZBXA 1MHNA 4E7IA 5L8RE 5GAMe 2E5AA 4OLFA 2Y4XA 3OMGA 5KCHA 2EIFA 2JVVA 1BIBA 3RF1A 3JB9D 1N27A 4A4EA 4ELYC 3RMSA 3CMAA 2EQUA 1G5VA 2E70A 2DXBA 3PFSA 3X20B 4ME7A 5LJ5e 2DAQA 4E7JA 3M54A 4K86A 1QP3A 5GMKj 1IREB 3V8KA 4HCBA 1NJ8A 2JN0A 3CC4A 2GQVA 3P8TA 5CIUA 2DTIA 4R56A 5D6YA 3OSVA 4C92B 5C0MA 2LT4A 4ZGEB 4RQFA 5LJ3f 2DD5A 2ZIMA 5DY9A 2QEXA 3HFZB 4PJOD 4KR3A 1VQOA 1H3ZA 1SESA 2ARSA 2MI6A 12ASA 3QSUA 3G4SA 4OF1A 2VC8A 2XICA 3GIBA 1VQKT 3P8HA 4TQFA 4MDXA 1JJ2S 1G3SA 3NFCA 1Z7NA 3VYHB 1N8RU 4C8QC 4ATOA 5GAMj 2DU5A 4LVKA 5KH6A 3CC2A 1XNIA 3MO8A 1IL2A 2E5QA 4YRJA 2WACA 3EFRA 2DD4A 1YGBA 2LRQA 3ER0A 1WYDA 1NNHA 3NELA 4M78F 3HFZA 3KBGA 4YRMA 3C94A 3MEAA 4H2YA 2LDMA 2OTLA 4HWPA 3VUBA 4IUTA 5GMKh 3LYIA 1YFTA 1NJ5A 3JCMd 2YRVA 3I56A 4B9XA 3V8JA 4QQGA 5HGQA 2RHQB 3L2UA 3M58A 1WNLA 1VQZA 2QQRA 1B76A 1WQWA 4C0GA 3HRIA 4CS2A 1YITT 2VV5A 4FIBA 3A8LB 1UGRB 2G3RA 3IALA 1EVLA 3WVDB 1YBYA 3MF2A 4CH6A 1OZ3A 5GAOq 3X28B 1M8VA 3RKYA 1NPRA 2RHQA 4CS4A 3OYGA 5KE3A 5GAMh 4HCZA 1ASZA 3BY7A 4MMLA 5D6XA 2F5TX 3IKMB 3CCRA 3PT9A 1PSEA 1KHIA 1H4TA 2I4NA 2IVWA 2LNVA 4QVZA 2XKOC 2VXEA 1UGPB 3OYLA 2LTOA 2A7YA 3UT1A 3VQWA 3QO7A 3KUFA 2XHCA 2LQ8A 4RG8A 1NE8A 4M75F 2ZPIB 4M7AF 4PHCA 3CMEA 1W2BS 4KULA 3OYFA 4HWTA 5GMKl 1EOVA 2X4XA 2LCLA 1YFRA 1YI2A 5IN1A 2K2VA 1Y07A 4YCUA 4WJ3M 4II1A 2QXFA 1VQ5A 1V29B 3OQ5A 2RD1A 2L8DA 5FU7C 3CMAT 2RK2A 2F5KA 2CZ7B 3J81E 1Q81U 2RI2A 2DK3A 4N0AA 1I5LA 2RHYA 3JCMP 3OYHA 1BI0A 1NJ6A 3NETA 3X26B 4VUBA 3TCJA 4EMKB 4R55A 4CH4A 3JSCA 2RK1A 3MHXA 4M77F 5DLOA 5GAOp 3GF5A 3QG1A 2A3LA 1IZ6A 1VQMA 5J26A 2AMCB 2L5QA 1FWZA 2BKDN 2VXFA 3M4PA 5F5WA 2BIVA 2QEXT 1G3YA 1VQOT 1I81A 1ATIA 3SWNB 2EJFA 4M78D 5IT9E 3A31A 4LDUA 4M7DB 4JLGA 2I2LA 5LJ3h 2PMEA 2Q5HA 2XK0A 3HTZA 4EMKA 4RDXA 4HT4A 3RUXA 4C0DB 3LW5E 3WXMB 2RB6A 1N9WA 2JTMA 5FLXE 1WJSA 1KHCA 3M57A 3CC2T 4CRIA 3LH0A 2ZT6A 3E9HA 4F7UB 2DTOA 2AMCA 2DZCA 3OA6A 2P0PA 4P71A 4YCVA 3ICAA 1K8AU 3V7RA 3SWNA 3X25B 1KQ2A 4HWRA 1C0AA 2ZNJA 4P3NA 1UB4A 2OTLT 4M7DA 3G71A 4NL3A 4YRIA 4YREA 4FT2A 2M9UA 3I56T 2PUKB 3UGTA 2C06A 3MQZA 3M53A 1WLEA 3OBWA 2C8MA 5GAMd 3KFUA 3OS2A 1OZ2A 1KQSS 3RERA 1NYRA 4IUVA 4TTVA 3CD6A 3FJPA 1Q7YU 1QVGA 4F7UA 5A0GA 3VUZA 2RM4A 2Y4YA 3CBPA 3I7FA 2ZCFB 2PVOB 2Q5IA 1SETA 2K5IA 4DOWA 4J15A 3QZ5B 3J7AF 3OYYA 2JUFA 5LJ5d 1QF6A 4H2XB 4ZGJB 4Q5WA 3HFNA 2ALYB 4XEOA 3QZ9B 3OY9A 2DTHA 5GAOm 3S3NA 4FU6A 3PIPA 1LNXA 4M75D 1W4SA 2KY9A 4M7AD 1H641 4M75E 3O8VA 2RO0A 4M7AE 4GLKA 4PLIA 2QQSA 2ZIOA 3A7AA 4HWOA 3CCRT 5HK3A 2E6ZA 4C8QF 1X6OA 1BYMA 1K73C 4UPAA 5CVIA 1K8AC 2EYQA 1VIEA 4UP9A 4DQ2A 1LOJA 1KG1A 4A4KA 4H2XA 3S3OA 4DPGA 2ALYA 2XD0A 4EDUA 4N4HA 4E47A 3MF1A 3OMCA 4XEMA 3CMET 1Q86U 5KNNA 1E1OA 3MEWA 4X9DA 2LVMA 3UPUA 3N5BB 1YI2T 3EAEA 4MDWA 4H02A 2RJCA 3HKSA 2RHXA 1VQLA 1GGMA 1E1TA 4M77D 4N0AC 1U8RA 1NJ2A 1VQ5T 5CQYA 1Q7YC 4P75A 4P5NA 1X01A 1VUBA 1M1KC 4PKCC 5KCOA 5GANg 2EQJA 4QVCA 5FROA 4HKEA 2LCCA 1KQ1A 3BW1A 3LSSA 1OI1A 1VQ9A 3QBYA 1YJ9A 3J80E 2WSCE 3C4SA 3E9IA 3QPHA 1R8OB 3E1SA 1PSFA 1N9RA 2MWPA 3QXEB 1BBWA 1VQMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 G;  1X56 A;  3JB9 G;  4YP0 A;  4YRJ A;  4YRG A;  2ODR D;  3EFR A;  5GAN 8;  2ZZF A;  2DDZ A;  3BFM A;  1YGB A;  4F7U F;  2ZT8 A;  1WYD A;  1NNH A;  3NEL A;  4M78 F;  3HFZ A;  4YPF A;  4EMG A;  4YRM A;  1PYS B;  4OP0 A;  4K87 A;  2E10 A;  4EMK C;  2ZZG A;  4XU0 A;  4P73 A;  3W3S A;  4H2Y A;  4O2D A;  4Q6G A;  4HWP A;  5GAN f;  1B7Y B;  5GMK h;  2G4C A;  1YFT A;  4NCX A;  1NJ5 A;  3JCM d;  4RCB A;  3V8J A;  3BJU A;  2FYK A;  3HY0 A;  5HGQ A;  4XTW A;  3JCM Q;  1E22 A;  2RHQ B;  3UFG A;  4M77 A;  1WNL A;  1VQZ A;  2RA2 A;  4P71 C;  4M77 G;  4YDQ A;  2YHT A;  3SWN C;  1B76 A;  4PJO A;  4RQE A;  1WQW A;  2E65 A;  4HVC A;  4YRP A;  3HRI A;  4PJO G;  4XTV A;  1LYL A;  2Q7G A;  4CS2 A;  4M7D C;  1I4K 1;  4C8Q A;  1X54 A;  5ELN A;  2CJ9 A;  3RGL A;  2ZT5 A;  3A5Y A;  5GAO l;  4JLI A;  2P0L A;  2DJZ A;  1PYS A;  5GAM g;  4YRQ A;  1SRY A;  3A32 A;  1EVL A;  3IAL A;  4L87 A;  3MF2 A;  1B7Y A;  2Q7E A;  4CH6 A;  4CS3 A;  3VQY A;  1U1S A;  3JCM e;  5GAO q;  5C52 B;  2DU7 A;  1M8V A;  4C92 C;  3RKX A;  4X9C A;  4XTZ A;  3ERR A;  4P72 A;  3RKY A;  4JRI A;  1EIY B;  2RHQ A;  5LJ5 g;  4CS4 A;  4J6Y A;  5GAM h;  4M78 C;  1HC7 A;  1ASZ A;  4XU3 A;  3BY7 A;  2J3L A;  4MML A;  3IKM B;  4M77 E;  2P5I A;  3LSQ A;  3QUI A;  4NOY A;  2ZGW A;  4YRR A;  2ZXF A;  4XU2 A;  2DQ3 A;  4PJO E;  1H4T A;  2I4N A;  2ZZE A;  4C8Q D;  2PMF A;  4YRL A;  4TVW A;  3L2Z A;  4H2U A;  2DZ9 A;  2VXE A;  3JB9 J;  5LJ3 d;  4C8Q E;  3VQW A;  3QNE A;  3QO7 A;  4P74 A;  1G51 A;  2E1H A;  2J3M A;  4M75 F;  5GAM f;  4UP7 A;  4TVY A;  4M7A F;  3TEH A;  1B34 B;  4PHC A;  3SB2 A;  3NEM A;  1Y96 B;  4XQ3 A;  3HXY A;  3JB9 H;  4HWT A;  5GMK l;  1EOV A;  2IY5 B;  1YFR A;  1EIY A;  1G5H A;  2ZR3 A;  1WQ7 A;  3WQZ A;  4YCU A;  2E3C A;  3QO3 A;  4C92 F;  3JB9 F;  3QTC A;  4HT9 A;  1B70 B;  4C8Q B;  4WJ3 M;  5GAN 3;  4HA8 A;  5LJ5 f;  2DXT A;  2I4L A;  3L4G B;  1L0W A;  1YCY A;  1ADJ A;  2ZT7 A;  4CH3 A;  2RD1 A;  3M4G A;  1G5I A;  3QO8 A;  4EMH A;  3L1A A;  2QHS A;  3TEG A;  3IKL A;  1USY C;  1JJC B;  3FB9 A;  4YCW A;  3UGQ A;  4N0A A;  5GAO n;  3HXZ A;  1I5L A;  1U1T A;  3JCM P;  5LJ3 e;  2EWN A;  5C53 B;  1NJ6 A;  4G84 A;  3P8V A;  2YLB A;  3NET A;  2C7I A;  4LNS A;  1TH7 A;  5GAN 5;  4X5O A;  1M5Q 1;  4EMK B;  3DSQ A;  4M7D D;  3JCM c;  4CH4 A;  1B34 A;  1ASY A;  4XTX A;  2ODR C;  1Y96 A;  2E64 A;  4M7D E;  4P75 C;  5K1P A;  5C51 B;  5GAN d;  4KR2 A;  4M77 F;  2ART A;  2IY5 A;  1HK9 A;  5GAO p;  1H4Q A;  5GAN j;  2XTI A;  2QHU A;  2AMC B;  1BBU A;  4EO4 A;  5GMK i;  1D3B B;  1B70 A;  3REU A;  4PJO F;  4E51 A;  1MGQ A;  1Z7M A;  2VXF A;  2EAY A;  3L4G A;  4YRK A;  2QTX A;  3M4P A;  3JCM W;  5F5W A;  4JRK A;  4C8Q G;  2DXU A;  1KOG A;  4H2W A;  4QVD A;  3G1Z A;  3HRK A;  1I81 A;  3R07 A;  4M75 C;  3SWN B;  1ATI A;  1X2H A;  2EJF A;  4M7A C;  1JJC A;  4AH6 A;  3MEY A;  4MMK A;  4M78 D;  2I4M A;  3A31 A;  4ZTU B;  4M7D B;  3TEH B;  4F7U E;  1LJO A;  2I2L A;  5LJ3 h;  3QHS A;  2PME A;  3HY1 A;  2Q5H A;  1WPY A;  3INZ A;  3HTZ A;  1QE0 A;  3AHU A;  4YRF A;  1FYF A;  4EMK A;  3A74 A;  4RDX A;  1HTT A;  3RUX A;  3VU3 C;  2DKG A;  2DEQ A;  2CJB A;  4A54 A;  4YRN A;  4XU1 A;  2ZIN A;  3RES A;  2QHT A;  2RB6 A;  1N9W A;  2RHS B;  3NEN A;  5GAN e;  3HXU A;  4XTU A;  1SER A;  4YRO A;  5GAN 6;  3RAC A;  4J6X A;  4WF2 A;  3EFS A;  2ZT6 A;  3E9H A;  4F7U B;  2DTO A;  4TVA A;  2AMC A;  1D3B A;  2DZC A;  3JCM g;  4P73 C;  4M78 B;  4ZTZ B;  4J5Y A;  4P71 A;  4YCV A;  4BW9 A;  5LJ3 j;  1X55 A;  3ICA A;  1EFW A;  3TUP A;  2CIM A;  3V7R A;  3SWN A;  1KQ2 A;  4HWR A;  1C0A A;  2ZNJ A;  3A5Z A;  4P3N A;  1E24 A;  2ZTG A;  3LC0 A;  4Q15 A;  5GAN 7;  1EQR A;  4M7D A;  3OD1 A;  1BIA A;  4M77 C;  4NL3 A;  2HNI A;  2K57 A;  3PCO B;  4YRI A;  4ZIB A;  4YRE A;  4M7D G;  3JCM h;  5GMK e;  3HFO A;  4TWA A;  3UGT A;  3RIR A;  1X2G A;  3JCM J;  4PJO C;  3HSB A;  4P3P A;  3QO5 A;  1WLE A;  2RHS A;  3HXX A;  2I4O A;  2C8M A;  1JRI A;  5GAM d;  2CGH A;  4NL2 A;  3KFU A;  1KMN A;  1H4S A;  2YLC A;  3HXW A;  5GAN h;  2Y90 A;  3CMQ A;  5GAN 4;  4H2V A;  3RER A;  1NYR A;  3V8L A;  11AS A;  4C92 A;  3VQV A;  4TTV A;  3FJP A;  4F7U A;  1H4V B;  2CJA A;  2ZCE A;  5GAO r;  2RM4 A;  3I7F A;  4KQE A;  4M78 A;  1W66 A;  4F7U G;  1HXD A;  3JB9 I;  2Q5I A;  1SET A;  1JBM A;  4J15 A;  4M78 G;  3JCM f;  4H2S A;  1YFS A;  5LJ5 d;  1QF6 A;  4H2X B;  2XGT A;  1RIQ A;  1B8A A;  3HFN A;  5LJ5 j;  2ALY B;  2DQ0 A;  4XEO A;  4P72 C;  4PNO A;  4H2T A;  2DTH A;  1KMM A;  4RCC A;  5GAO m;  3RL6 A;  3PCO A;  1LNX A;  2QHV A;  5E3I A;  3JCM b;  4M75 D;  2Q7H A;  4J6W A;  4M7A D;  1EVK A;  3JCM V;  1H64 1;  5LJ3 g;  3HFV A;  3A7R A;  4TVA B;  4CH5 A;  3PGG A;  4M75 E;  4M7A E;  4WJ4 A;  5GAM e;  2E5A A;  4OLF A;  2ZIO A;  3A7A A;  3V7C A;  4HWO A;  1BIB A;  4UP8 A;  2E41 A;  4YRC A;  4XTY A;  4C92 D;  3RF1 A;  3JB9 D;  3A7U A;  4C8Q F;  4YRS A;  4P74 C;  4YYE A;  4C92 E;  2ZNI A;  2ZR2 A;  4UPA A;  3HXV A;  4UP9 A;  4M78 E;  4DQ2 A;  5LJ5 e;  1LOJ A;  3JCM X;  4H2X A;  2EL9 A;  4K86 A;  1NJ1 A;  3RKW A;  4YRT A;  4DPG A;  4M75 B;  5GMK j;  3V8K A;  2ALY A;  4M7A B;  1NJ8 A;  4WI1 A;  1USY A;  4BWA A;  2JN0 A;  3MF1 A;  3P8T A;  4HWS A;  4XEM A;  2DTI A;  1NYQ A;  5KNN A;  4PG3 A;  4A53 A;  5I21 A;  1E1O A;  2AKW B;  3IG2 A;  4X9D A;  4P3O A;  4C92 B;  4HT8 A;  4H02 A;  2DVE A;  4Y91 A;  4K88 A;  2ARU A;  4RMF A;  1GGM A;  4JUV A;  1E1T A;  4M77 D;  4N0A C;  4RQF A;  5LJ3 f;  2EJG A;  1NJ2 A;  5GMK m;  4P75 A;  1X01 A;  2ZIM A;  1I8F A;  5CAI A;  5DY9 A;  1YB3 A;  3HFZ B;  4PJO D;  1J5W A;  4TQD A;  3REX A;  4KR3 A;  4G85 A;  5GAN g;  5K1X A;  1SES A;  2ARS A;  12AS A;  3QSU A;  1ADY A;  2VC8 A;  4QVC A;  1N9S A;  1WU7 A;  3FIF A;  3GIB A;  5LJ5 h;  5ELO A;  3VQX A;  4M7D F;  4V2S A;  4M75 A;  3UH0 A;  1KQ1 A;  4TQF A;  3BW1 A;  4M7A A;  3PZC A;  3LSS A;  3VBB A;  4M75 G;  4M7A G;  5GAN 2;  3P8Y A;  1Z7N A;  4C8Q C;  4M77 B;  2FB7 A;  5GAM j;  3BDU A;  3E9I A;  4EX5 A;  2AKW A;  2DU5 A;  3M4Q A;  1N9R A;  3V7S A;  2EJ9 A;  1BBW A;  4PJO B;  1IL2 A; 
#chains in the Genus database with same CATH topology
 3JB9 G;  4YP0 A;  3RNJ A;  4AMC A;  4YRG A;  2ZZF A;  3CBO A;  2DDZ A;  3BFM A;  3HRT A;  5FU7 B;  3FDR A;  3EH2 A;  5IHK A;  2HDA A;  2ECZ A;  4EMG A;  2R58 A;  1UJ0 A;  1ZQ1 A;  4UC4 A;  3HP9 A;  1PYS B;  4K87 A;  4RTW A;  5A2Q E;  4EMK C;  2EGA A;  2HBP A;  1VOM A;  4A4H A;  1JO8 A;  3P8B B;  4O2D A;  4Q6G A;  2E12 A;  1N8R R;  5GAN f;  1SSF A;  4C0Z A;  4FYV B;  1B7Y B;  1NPP A;  2WSE E;  1QLY A;  3VS7 A;  4NCX A;  2E3I A;  1Q86 C;  3HY0 A;  1WZO A;  5IXB A;  1E22 A;  4OB0 B;  3OS0 A;  3QYH B;  3CBM A;  4J9F A;  2OTL Q;  4AFQ C;  1RAC B;  1NG2 A;  3VKI A;  4IKF A;  4FYY B;  2L89 A;  4P71 C;  3LGF A;  4JJN K;  3OYE A;  3M0Q A;  4OB1 B;  2PTK A;  2YHT A;  3SWN C;  2A08 A;  2VWF A;  4N4G A;  2IPO B;  4RQE A;  5EG2 A;  1IHW A;  4PJO G;  4XTV A;  3JRZ A;  4M7D C;  1I4K 1;  2KXD A;  2FRW A;  1X54 A;  2KNB B;  4EIK A;  1M30 A;  2ZT5 A;  4JLI A;  4HVW A;  3VS0 A;  1PYS A;  3CCM A;  4YRQ A;  1WJQ A;  4LD6 A;  3PTA A;  2CSI A;  1RAF B;  2CS7 A;  1SRY A;  3G71 T;  1QVP A;  3A32 A;  4C0D C;  4L87 A;  1WLP B;  2D8J A;  1WIE A;  2EYY A;  3H8Z A;  1ARK A;  1B7Y A;  3H6Z A;  3VRZ A;  3VQY A;  3SHW A;  1PRM C;  2KEA A;  1ZUU A;  2DU7 A;  3RKX A;  4X9C A;  2HSE B;  4P72 A;  3CC7 A;  3MCA B;  1UTI A;  1CSK A;  2P0K A;  1S72 Q;  2CYZ B;  4FSS A;  2DPP B;  1QKW A;  3LSQ A;  1D1A A;  3OYJ A;  4FW1 A;  3CD6 T;  2ZGW A;  4YRR A;  2ZXF A;  4XU2 A;  2B8A A;  2F1L A;  4N4I A;  2DRK A;  4AFZ C;  4PJO E;  2EPD A;  1JB0 E;  2YUO A;  4C8Q D;  2JOY A;  2FPE A;  4OML A;  2DZ9 A;  5FU6 B;  4C5E A;  3JB9 J;  3CCR Q;  1YJW A;  4C8Q E;  3QNE A;  3QDF A;  5KYN A;  3EFO B;  4P74 A;  1OX9 A;  4IUR A;  1G51 A;  3DB4 A;  4DEY A;  1T0J A;  3TEH A;  3CEY A;  2FHD A;  3HXY A;  3LH5 A;  3E19 A;  2IY5 B;  3CCU Q;  4LVM A;  2DJQ A;  3URG A;  2K79 A;  1G5H A;  3WQZ A;  2EYW A;  4C92 F;  1PKT A;  4HT9 A;  1B70 B;  4IUU A;  3SDZ A;  2COZ A;  1QW1 A;  3R6O A;  3L4G B;  1YCY A;  1ADJ A;  4CH3 A;  2DVJ A;  1YI2 Q;  5AT1 B;  1VYV A;  4EMH A;  3IKL A;  3UGQ A;  2DL3 A;  1B07 A;  1D1C A;  5GAO n;  2FZG B;  4DEX A;  1U1T A;  2KQW A;  5LJ3 e;  3CPF A;  1VQ5 Q;  5C53 B;  3FLG A;  1UDL A;  3P8V A;  1OUL A;  1TH7 A;  4A4F A;  2L3P A;  3LGL A;  1M5Q 1;  4BI4 A;  1WFW A;  3JCM c;  1VQ4 A;  1KSW A;  2RI3 A;  1WHG A;  3GNF B;  4P75 C;  4KR2 A;  2IY5 A;  2MWO A;  3CPW P;  5GAN j;  2XTI A;  1VQL T;  1Q81 R;  1D3B B;  1MNE A;  2RQT A;  2RHZ A;  1B70 A;  2NLU A;  2FZK B;  3C95 A;  1MGQ A;  2EAY A;  3L4G A;  2GFU A;  2QTX A;  2ED1 A;  3CPW S;  4QVD A;  3G1Z A;  3HRK A;  3OYD A;  2K9G A;  2DL5 A;  4BE2 A;  1UGS B;  1VQM Q;  2IG0 A;  4FYX B;  5IHI A;  4IUP A;  2I4M A;  4OMQ A;  1ABO A;  2QG9 B;  3I9Q A;  3OW2 S;  1S72 A;  1Q82 U;  3S3M A;  1Y0M A;  1N8R C;  1M2V B;  1QE0 A;  3VS6 A;  3MP1 A;  4YRF A;  1VQ9 T;  3A74 A;  1YJ9 T;  1HTT A;  3F70 A;  4QW2 A;  4A54 A;  4YRN A;  4NS5 A;  3RES A;  2QHT A;  3DLL A;  3CXC S;  2L3R A;  2V8J A;  2GNC A;  1SER A;  2FG0 A;  2BUD A;  1K9A A;  4WF2 A;  2HBW A;  3EFS A;  1YJN A;  3EG9 B;  1OOT A;  4JRP A;  1D3B A;  2KT8 A;  3JCM g;  4J5Y A;  2DL8 A;  5LJ3 j;  2DBM A;  3TUP A;  1C6V X;  3LLR A;  2K5F A;  1N6A A;  3QKJ A;  1OQK A;  2A0F B;  4HCC A;  3A8O B;  3CCU A;  1IB8 A;  4Q15 A;  3LC0 A;  2VUB A;  1JJ2 A;  1UHF A;  1ZUK A;  1BIA A;  2DE0 X;  2ZPB B;  3IQL A;  1EX4 A;  1M2V A;  2OAU A;  3RIR A;  1YIJ A;  3BDL A;  2VKN A;  8AT1 B;  3G71 Q;  3QO5 A;  4C5H A;  1IHV A;  1JRI A;  3FEO A;  4Z88 A;  4ELZ C;  2DF6 A;  2YLC A;  5GAN h;  3CMQ A;  1VYU A;  1JXM A;  3V8L A;  3G1J A;  1SKU B;  1H4V B;  4XK8 E;  2FPF A;  2ZCE A;  3PMI A;  2SRC A;  4KUI A;  1W66 A;  1HXD A;  2P4T A;  3OYI A;  3PMT A;  1NBE B;  4M78 G;  3JCM f;  1YFS A;  2YUN A;  2XGT A;  3CD6 Q;  3CCM T;  1B8A A;  3NTK A;  2DQ0 A;  4P72 C;  1QCO A;  2A36 A;  4O6J A;  4CI0 C;  4JDS A;  4BUG A;  1Y57 A;  2QHV A;  4BDZ A;  3JCM b;  5HK0 A;  3L2W A;  2JXB A;  4CC3 A;  2Q7H A;  4J6W A;  2PNI A;  3CC7 T;  2M02 A;  5L23 A;  4CH5 A;  3TEE A;  2ENM A;  3PVQ A;  1Q7Y R;  1AWJ A;  2DBK A;  5I2M A;  4WJ4 A;  2DXC A;  3VS2 A;  3MPU B;  2KGT A;  2R57 A;  4MZM A;  1JQQ A;  2E41 A;  4UP8 A;  4GBQ A;  2F2V A;  4C92 D;  2DET A;  2QA4 A;  2CP2 A;  3PE0 A;  4P74 C;  4C92 E;  4D8D A;  5AYF A;  1YJW T;  1BB9 A;  2ESW A;  2HEQ A;  4M78 E;  1U5S A;  3OW2 A;  2X4W A;  1TUD A;  2EL9 A;  3AT1 B;  3LX7 A;  3RKW A;  1BI3 A;  3REA B;  4O5V A;  4WI1 A;  1USY A;  2F2X A;  4C5G A;  4LVL A;  2FVU A;  2E5K A;  2V26 A;  3QWX X;  1LCK A;  2BZX A;  1TU0 B;  1GFD A;  2FEI A;  4E2F B;  1UEB A;  3CXC A;  3IG2 A;  4HT8 A;  2DVE A;  1LVK A;  2NYS A;  4OGE A;  2QQA A;  4FL6 A;  1Q81 C;  1TWB A;  4PFZ A;  5FU6 C;  1UGV A;  2NUT B;  4KBM B;  5GMK m;  1YFN A;  4E7L A;  1I0C A;  1YB3 A;  5I22 A;  1K1Z A;  1MV3 A;  3REX A;  2CRE A;  5FWB A;  1VQL Q;  5D6W A;  1WXT A;  3QJ6 A;  3A98 A;  4LDW A;  4L59 A;  3GP8 A;  1ADY A;  5I11 A;  1N9S A;  1WU7 A;  2RH2 A;  1UJY A;  2PUO B;  1Q86 R;  4JZ3 A;  2GTO A;  1W2B A;  4M7D F;  4V2S A;  2MMP A;  3NTH A;  4AT1 B;  4M75 G;  1VQ4 T;  2CSQ A;  2VGM A;  4M7A G;  3ASK A;  3DB3 A;  5FRN A;  2FB7 A;  1BCM A;  3BDU A;  2EQI A;  4RKU E;  2JT4 A;  4BY6 B;  3CCE A;  1FX7 A;  4L5G A;  3V7S A;  4PJO B;  1YJ9 Q;  1OU8 A;  3EG3 A;  4OVA A;  2KRM A;  2KBT A;  2ODR D;  4PJL A;  2K7A A;  2NUT A;  4F7U F;  4J9I A;  4J83 A;  5CCA A;  1IXD A;  1KD1 U;  4YPF A;  2PVG B;  3VS1 A;  2ED0 A;  5IH2 A;  2RHI A;  3C12 A;  3MJX A;  4M4Z A;  4HVU A;  2ZAE A;  4XU0 A;  3W3S A;  3S6W A;  1S72 T;  2M51 A;  4KUD K;  2G4C A;  1GFC A;  1UFF A;  3H0H A;  1QVF P;  3BJU A;  2FYK A;  1KK7 A;  1ZSG A;  5IHN A;  5J39 A;  2RA2 A;  4FW2 A;  1PWT A;  1AT1 B;  4M77 G;  3PIO A;  2CP3 A;  4LD9 K;  1QVF S;  1YJN T;  2P0Q A;  4YDQ A;  4PJO A;  2L0A A;  4RTV A;  2E65 A;  2X35 A;  1UHC A;  2YUQ A;  4C8Q A;  3M56 A;  2CJ9 A;  3RGL A;  3ZEH A;  3A5Y A;  3VYG A;  2NWM A;  2P0L A;  2MOX A;  2OX7 A;  1W6X A;  2DJZ A;  3CCS A;  3CCU T;  5GAM g;  1KC8 U;  1W70 A;  1OYX A;  5D7U A;  3MET A;  2AHJ B;  4AG1 C;  3D7S B;  1D0Y A;  3TU4 K;  2Q7E A;  1O9S A;  4CS3 A;  2JZ2 A;  1YIJ T;  2DYB A;  5C52 B;  3CCM Q;  5GJV B;  4ZTF A;  3ERR A;  2YDL A;  1AZG B;  2O01 E;  5LJ5 g;  2BE7 D;  4J6Y A;  4RMO A;  1M90 R;  2E4H A;  1VQN A;  3Q1J A;  3OB9 A;  1HC7 A;  2K5L A;  4XU3 A;  3OYM A;  2AK5 A;  1X6G A;  2AZV A;  4ANJ A;  4M77 E;  2P5I A;  2KMT A;  4IIO A;  1T0H A;  4LVI A;  3SD4 A;  3QUI A;  2D9T A;  4BI3 A;  1QP2 A;  2JM8 A;  1G8X A;  2RJD A;  4RG2 A;  3CC7 Q;  1RAG B;  1YHQ Q;  2CDT A;  2RQU A;  2DQ3 A;  5CKH A;  3A8G B;  4H2U A;  1WJR A;  5LJ3 d;  2CZ1 B;  1IRX A;  1R0B G;  2DIQ A;  1TOV A;  2J3M A;  4C0F A;  2DIL A;  5GAM f;  4UP7 A;  1E6G A;  3QYG B;  3CCJ A;  3M0R A;  4OMO A;  1I5O B;  1G3T A;  1YJW Q;  1B34 B;  3SB2 A;  3FRN A;  1BI2 A;  3PVL A;  4XQ3 A;  5CKD A;  1I1J A;  1KQS A;  2J7I A;  3JB9 H;  1VQP Q;  1OU9 A;  1G83 A;  1W1F A;  1WDX A;  2ZPE B;  3G6E T;  2ZR3 A;  1WQ7 A;  1YCS B;  2RJE A;  3O5Z A;  2RN8 A;  4AFU C;  4ZTJ A;  3QTC A;  5GAN 3;  4HA8 A;  5M9O A;  5LJ5 f;  1ZX6 A;  1RL2 A;  2QA4 T;  4JJC A;  4YTL A;  1G5I A;  3A1P A;  3QO8 A;  4Z02 A;  2QHS A;  3TEG A;  2RPN A;  1USY C;  3HXZ A;  1WHM A;  2ROT A;  2A28 A;  2EWN A;  3HRU A;  4BE1 A;  1QCN A;  1KC8 C;  4G84 A;  1E6H A;  2XG8 D;  5EC7 A;  5HY6 A;  3RBB B;  2C7I A;  4LNS A;  1QMC A;  2YT6 A;  2QDY B;  1JU5 C;  3CCQ A;  4X5O A;  3I55 Q;  4JPB W;  3UDC A;  3ME9 A;  1RAE B;  4M7D D;  4JRQ A;  4A4G A;  4F04 B;  1B34 A;  4XTX A;  1J3T A;  3QII A;  3HL8 A;  2D6F A;  1B3Q A;  2XU8 A;  4M7D E;  4F14 A;  3LWI A;  1HK9 A;  4XAX B;  1H4Q A;  1MND A;  2YXY A;  1M90 U;  1X6B A;  1VQ4 Q;  1BBU A;  1X75 C;  1ZBJ A;  3REU A;  4E51 A;  2PQW A;  1Z7M A;  2GCX A;  1UE9 A;  1XQH A;  2HSP A;  4C8Q G;  1AHJ B;  1KOG A;  2RNA A;  3R07 A;  1X2H A;  4BD3 A;  2JTF A;  1O75 A;  4DOV A;  4GLM A;  3A5Z B;  2RQW A;  1LPL A;  4ZTU B;  3TEH B;  4F7U E;  3OYB A;  2AZS A;  5J3B A;  3QHS A;  3A8M B;  1RAD B;  1OPK A;  1MV0 B;  3M55 A;  2DX1 A;  4J9E A;  5HKC A;  3INZ A;  2KK4 A;  3AHU A;  2K6D A;  2LX7 A;  1FYF A;  1BKB A;  2K3B A;  2R5A A;  2DEQ A;  1YHQ A;  3QDR B;  2ZIN A;  3LWH A;  2RHS B;  1Z9Z A;  1SPK A;  3CCE T;  5GAN e;  3OYA A;  2P84 A;  4YRO A;  3L2V A;  5GAN 6;  5KE2 A;  3QJY A;  3RAC A;  4FYW B;  1GXI E;  4Z89 A;  1PCX A;  4TVA A;  4QQD A;  1EZZ B;  1AWO A;  4M78 B;  4BE0 A;  5I2S A;  1NM7 A;  4BW9 A;  3TSW A;  2KYM A;  1EFW A;  3G7Z A;  1Q82 R;  4BB7 A;  2CIM A;  1YJN Q;  1VQ6 A;  2GFA A;  3M59 A;  1VQP A;  2OI3 A;  1KFZ A;  3MKD A;  4LNP A;  3M0U A;  3X24 B;  3A5Z A;  2LJ1 A;  1E24 A;  4HVV A;  2ZTG A;  3L2R A;  5CQX A;  2DLP A;  3OD1 A;  1VQM T;  3PCO B;  2LQK A;  5A0L A;  2EGE A;  4BY6 C;  2DL7 A;  3EGU A;  2AKL A;  2CKK A;  1X2G A;  2A8E A;  3JCM J;  4PJO C;  4P3P A;  2VYT A;  2RHS A;  1Y7X A;  2V1R A;  1NEB A;  2MYS A;  2CZ0 B;  4D6W A;  5KYW B;  1KMN A;  1M90 C;  1H4S A;  1NJI R;  2Y90 A;  4RTX A;  1YIJ Q;  5GAN 4;  3HHT B;  2X4J A;  5CKF A;  2SEM A;  4C92 A;  3TRE A;  3I55 A;  1OEB A;  3CCV Q;  5GAO r;  1RAA B;  4KQE A;  4M78 A;  3TVT A;  2XI9 A;  3JB9 I;  1JBM A;  3GPL A;  2QDL A;  1RI9 A;  3CCS T;  1YN8 A;  2ZPG B;  3ZFJ A;  5LJ5 j;  2QTV A;  1RLP C;  1R0C B;  1XTD A;  2KDS A;  4H2T A;  1TUC A;  1TTH B;  2L3S A;  2LC4 A;  2YRD A;  1QWE A;  1KMM A;  2VGN A;  4RCC A;  1PG5 B;  1T3L A;  3PCO A;  3MEV A;  2Z0W A;  2ZPH B;  4J7F A;  3SFM A;  1K0X A;  1VQ7 Q;  4BI8 B;  3A7R A;  2MAM A;  3L2Q A;  1VQN T;  3PGG A;  2O31 A;  3ZBD A;  1BI1 A;  2DMO A;  4DBR A;  1SHG A;  3RMQ A;  5KYW A;  1H3H A;  3V7C A;  2D0Q B;  4YRC A;  4J9H A;  3PNW C;  4XTY A;  1Y71 A;  2HQX A;  3A7U A;  4LDX A;  4YRS A;  9ATC B;  3G6E Q;  4YYE A;  2ZNI A;  2JMA A;  2ZR2 A;  2KE9 A;  1FMW A;  3I5R A;  3OYC A;  4JS5 A;  3H9N A;  1P92 A;  4B6M A;  3HXV A;  2F69 A;  3JCM X;  2QA4 Q;  1NJ1 A;  4YRT A;  4MZT A;  4M75 B;  4M7A B;  4E6R A;  1F1B B;  4MZP A;  4BWA A;  3L42 A;  1FYN A;  1RAH B;  4FM4 B;  3CCJ T;  4HWS A;  2EQM A;  1NYQ A;  5CKE A;  4PG3 A;  4A53 A;  5I21 A;  4LN2 A;  2J05 A;  2RI5 A;  2AKW B;  1TS9 A;  4PL6 A;  4P3O A;  1TG0 A;  4LDV A;  1JXO A;  4L6V 5;  3CCL A;  4Y91 A;  4K88 A;  2KAF A;  2ARU A;  4J8O A;  4RMF A;  2J06 A;  4JUV A;  2EBP A;  3KXT A;  2EQK A;  1NJI U;  1CKB A;  2EJG A;  4QQ6 A;  4LDY A;  1AOJ A;  2D8H A;  1BU1 A;  3EG2 A;  4JZ4 A;  1I8F A;  5CAI A;  2EKH A;  1J5W A;  4TQD A;  1M3C A;  2PVD B;  4DA4 A;  4G85 A;  1RI0 A;  2MPX C;  5K1X A;  2QQ9 A;  2OTJ Q;  3FIF A;  2HD0 A;  1GCP A;  5LJ5 h;  5ELO A;  1OPL A;  3H0I A;  3CCQ T;  3VQX A;  1D1B A;  4M75 A;  3UH0 A;  4M7A A;  3PZC A;  3UA7 A;  2VB6 A;  3NTI A;  2O4X B;  3VBB A;  2NUP B;  4J9B A;  5IAY A;  1D0Z A;  3CCV A;  5GAN 2;  3P8Y A;  2GF7 A;  4M77 B;  2RHU A;  1RUW A;  4CC7 A;  4EX5 A;  3UWN A;  2AKW A;  3M4Q A;  2LJ3 A;  2DIG A;  1ZHI A;  2LCS A;  2EJ9 A;  1DJ7 B;  2HKN A;  1QVG P;  3M5A A;  3DKM A;  4C92 G;  3FC3 A;  1X56 A;  1GBR A;  4B9W A;  1KIK A;  5GAN 8;  2XDP A;  3CCE Q;  2ZT8 A;  5HCK A;  3EH1 A;  1PC0 A;  2COW A;  2C0I A;  2M1H A;  4PLL A;  1QVG S;  1VQ7 A;  4OP0 A;  2ZPF B;  2E10 A;  1Q82 C;  2ZZG A;  8ATC B;  1PHT A;  2RJF A;  4P73 A;  1K4U S;  3E9G A;  2R5M A;  3TQ7 P;  4ESR A;  2EW3 A;  3FJ5 A;  2KSS A;  4RCB A;  1YHQ T;  1VQ8 A;  3CC4 T;  2O4X A;  4JJB A;  2NUP A;  4BDY A;  4XTW A;  3G6E A;  3JCM Q;  1HD3 A;  2EKO A;  2V8I A;  3RR6 A;  1AD5 A;  3UFG A;  1BK2 A;  4M77 A;  2DA9 A;  2XID A;  2O2O A;  2MIO A;  5CKB A;  1VQK Q;  1WGS A;  2K4Y A;  4ZN1 A;  3C0C A;  3CPW A;  1KD1 R;  1NJI C;  2DL4 A;  4HVC A;  4YRP A;  3JAM E;  1LYL A;  2Q7G A;  2PU9 B;  2HQE A;  5ELN A;  1K9M U;  2BTT A;  4OB2 B;  1G3W A;  2HAX A;  1VQ6 T;  3E2U A;  5GAO l;  1VQP T;  3EG1 A;  3M0T A;  4KGV B;  3G4S T;  2KI7 A;  3SEM A;  3GNG A;  2D0N A;  5C6S A;  2QGG A;  1U1S A;  3JCM e;  3CCS Q;  4OB3 B;  3MP6 A;  2NS6 A;  4C92 C;  4EPC A;  1UEC A;  4XTZ A;  4JRI A;  3VS4 A;  1EIY B;  2E6N A;  4FSX A;  3GLX A;  4M78 C;  2OTJ A;  2RF0 A;  5DM7 R;  3M4Y A;  2J3L A;  1AWX A;  3ULR B;  3VJP A;  3A8H B;  5IXF A;  1IO6 A;  2CZ6 B;  4OMF B;  4NOY A;  3I55 T;  3VS5 A;  4E7H A;  1KC8 R;  1VQN Q;  4LVJ A;  2ZZE A;  2PMF A;  4YRL A;  4TVW A;  2X4Y A;  3L2Z A;  2DYI A;  2PZ1 A;  2LNH B;  2HQH A;  1K73 U;  3EGD B;  1WA7 A;  2VAS A;  4Y92 A;  3OYN A;  1I07 A;  2B86 A;  3NGP A;  3CQT A;  2E1H A;  1NEG A;  2GBQ A;  4TVY A;  3R6N A;  4IIM A;  3NEM A;  4ZGD B;  1Y96 B;  4KGZ B;  1EIY A;  5KYY B;  5FRM A;  4E7S A;  3CCJ Q;  1WI7 A;  5DLQ E;  1MMD A;  2E3C A;  3QO3 A;  4GY5 A;  3JB9 F;  2QI2 A;  4C8Q B;  1XOV A;  2DXT A;  2ZZD A;  2X3W D;  2I4L A;  1L0W A;  4ZN3 A;  2ZT7 A;  1WHJ A;  2LT1 A;  3TSZ A;  1EIF A;  3VV0 A;  2X51 A;  3M4G A;  1ZSZ A;  3EHQ A;  1FMV A;  2VVK A;  4C5I A;  3L1A A;  1NZ9 A;  1K9M C;  1JJC B;  3FB9 A;  4KRT A;  3OS1 A;  4YCW A;  1M4Z A;  3HPW A;  1M1K U;  3EGD A;  2YLB A;  1M8M A;  1VQK A;  2FRY A;  2DNU A;  3MEU A;  5GAN 5;  2JJ9 A;  3DSQ A;  1IGU A;  1H8K A;  3EG0 A;  3M9Q A;  1G2B A;  5CO7 A;  4KH1 B;  1ASY A;  2ODR C;  1Y96 A;  2E64 A;  4Y28 E;  5A0D A;  3MP8 A;  5K1P A;  5C51 B;  3CCQ Q;  5GAN d;  4IUQ A;  2ART A;  4BAC A;  3CCL T;  2DO3 A;  4R0K A;  2EFI A;  4LUE A;  5KYY A;  2QHU A;  4TVR A;  2XMF A;  5GMK i;  1PNJ A;  4EO4 A;  2C0O A;  2W10 A;  4PJO F;  4PJM A;  2FL7 A;  1UGQ B;  4YRK A;  3JCM W;  4JRK A;  2DXU A;  2V8K A;  4H2W A;  4M75 C;  4M7A C;  4OMM A;  1JJC A;  2K3Y A;  4F16 A;  4AH6 A;  2DFU A;  3MEY A;  4MMK A;  3WVE B;  4LUD A;  1LJO A;  2CUB A;  3DLM A;  1WHH A;  3HY1 A;  3REB B;  3VRY A;  2HMA A;  1WPY A;  1SF9 A;  3HRS A;  3E9F A;  4X34 A;  2JMC A;  2QQB A;  3VU3 C;  2DKG A;  3CCV T;  2CJB A;  4XU1 A;  3NEN A;  3HXU A;  4XTU A;  2W0Z A;  1Z9Q A;  4J6X A;  4AFS C;  3CC4 Q;  2KXC A;  2P4R A;  4HCK A;  2MF2 A;  1KD1 C;  4DBF A;  4QKU A;  1V76 A;  4P73 C;  4ZTZ B;  3OBY A;  1YIT A;  2M16 A;  4DBH A;  1X55 A;  1FXX A;  1PM3 A;  2LQN A;  1VQ7 T;  2KRO A;  5LL6 S;  2DM1 A;  1D09 B;  4J9C A;  5CK9 A;  5GAN 7;  5CR2 A;  2XDD A;  1EQR A;  4M77 C;  2JNG A;  2HNI A;  2K57 A;  4OGC A;  4ZIB A;  3EHR A;  4M7D G;  4JS4 A;  1VQ6 Q;  4FT4 A;  1M9S A;  3JCM h;  5GMK e;  3HFO A;  2XDB A;  4TWA A;  1VQ8 T;  4RUG A;  2WSF E;  3HSB A;  3QWY A;  4X1V A;  2MK5 A;  3OYK A;  2H3E B;  3G4S Q;  3OSS C;  4KT0 E;  1HYO A;  3HXX A;  2I4O A;  4ORZ A;  2KVQ G;  1AEY A;  2J6K A;  2CGH A;  4NL2 A;  3HXW A;  1PD0 A;  2LX9 A;  4H2V A;  1X2K A;  11AS A;  3VQV A;  2X3X D;  2CJA A;  2M0O A;  1K76 A;  3OS5 A;  4F7U G;  1ZA1 B;  4AG2 C;  3GOX A;  2GGR A;  4OMP A;  4H2S A;  3T9N A;  1M1G A;  3CC2 Q;  2H3J A;  2KRS A;  4J7I A;  1RIQ A;  2A37 A;  3EGX B;  1TSF A;  1MMG A;  1YNZ A;  2JW4 A;  4PNO A;  1M1F A;  3RL6 A;  5E3I A;  7AT1 B;  2M0Y A;  4FCY A;  1BCO A;  3P8D A;  1EVK A;  3JCM V;  2V1Q A;  1QVF A;  1VIF A;  5LJ3 g;  2K3X A;  3HFV A;  4TVA B;  2OTJ T;  1B7T A;  1ZBX A;  1MHN A;  3UAT A;  4E7I A;  5L8R E;  5GAM e;  2E5A A;  4OLF A;  2Y4X A;  3OMG A;  5KCH A;  2EIF A;  2JVV A;  1BIB A;  1EFN A;  2DRM A;  3RF1 A;  3NPF A;  3JB9 D;  3I56 Q;  1N27 A;  4A4E A;  4ELY C;  3RMS A;  3CMA A;  3GBQ A;  1QWF A;  2EQU A;  1G5V A;  2E70 A;  1M3B A;  2DXB A;  3PFS A;  3X20 B;  1PKS A;  4ME7 A;  5LJ5 e;  2AKK A;  2DAQ A;  4E7J A;  1RAB B;  2KYB A;  3M54 A;  4KGX B;  4K86 A;  1GCQ A;  1QP3 A;  3EGX A;  1IRE B;  3V8K A;  2KT1 A;  3ZL7 C;  5GMK j;  4HCB A;  1NJ8 A;  2JN0 A;  3CC4 A;  2GQV A;  3P8T A;  5CIU A;  2DTI A;  1ABQ A;  1S1N A;  1X43 A;  4R56 A;  5D6Y A;  5FWC A;  3OSV A;  1C1A A;  4C92 B;  4WCI A;  5C0M A;  1ZSZ C;  2LT4 A;  1WYX A;  4ZGE B;  4RQF A;  5LJ3 f;  4RTY A;  1OV3 A;  2DD5 A;  2ZIM A;  5DY9 A;  3H0F A;  2QEX A;  3HFZ B;  4PJO D;  3CCL Q;  4KR3 A;  1VQO A;  1H3Z A;  1SES A;  1JJ2 P;  2MI6 A;  12AS A;  3QSU A;  2ARS A;  3G4S A;  4OF1 A;  1ZA2 B;  2RMO A;  2VC8 A;  4J9D A;  4RTT A;  2LQW A;  2ROL A;  2XIC A;  1HSQ A;  3GIB A;  1VQK T;  1UG1 A;  3NHN A;  3P8H A;  4TQF A;  4MDX A;  2LMJ A;  1JJ2 S;  1G3S A;  3NFC A;  4J9G A;  4PFP A;  3VYH B;  1N8R U;  1Z7N A;  4C8Q C;  4ATO A;  5GAM j;  4PJN A;  2DU5 A;  3UF4 A;  4LVK A;  5KH6 A;  3CC2 A;  3NMZ C;  2CP0 A;  1XNI A;  3MO8 A;  1IL2 A;  1TXQ A;  1M3A A;  2E5Q A;  4YRJ A;  2WAC A;  1N5Z A;  1WXU A;  3EFR A;  4K11 A;  2DD4 A;  1YGB A;  3CME Q;  2LRQ A;  3ER0 A;  1WYD A;  1NNH A;  3NEL A;  4M78 F;  3HFZ A;  3KBG A;  4YRM A;  2LJ0 A;  2YSQ A;  1PD1 A;  3C94 A;  2QGF B;  4RTZ A;  3MEA A;  4H2Y A;  1XJW B;  2LDM A;  2OTL A;  4HWP A;  6AT1 B;  3VUB A;  4IUT A;  5GMK h;  3LYI A;  1YFT A;  2CT3 A;  1NJ5 A;  3JCM d;  2YRV A;  3I56 A;  4B9X A;  3V8J A;  1OX8 A;  4QQG A;  1RLQ C;  2BZ8 A;  3EFO A;  5HGQ A;  2RHQ B;  3L2U A;  3M58 A;  3UA6 A;  1WNL A;  2DER A;  1VQZ A;  2O9V A;  2QQR A;  1U3O A;  5GJW B;  1VQ8 Q;  2ABL A;  3KFV A;  1B76 A;  1WQW A;  4C0G A;  1SRL A;  3HRI A;  4PFO A;  4CS2 A;  1YIT T;  2D1X A;  4QT7 A;  2VV5 A;  4FIB A;  2CH4 A;  3A8L B;  1UGR B;  2G3R A;  4Z8A A;  3OW2 P;  1V1C A;  1SEM A;  3IAL A;  1EVL A;  3WVD B;  1YBY A;  3MF2 A;  2BZY A;  4CH6 A;  2FZC B;  1OZ3 A;  1WHL A;  5GAO q;  3CXC P;  3X28 B;  1M8V A;  1GBQ A;  1M27 C;  4OMN A;  3RKY A;  1NPR A;  2RHQ A;  4CS4 A;  3OYG A;  3HTR A;  5KE3 A;  5GAM h;  4HCZ A;  1ASZ A;  3BY7 A;  4MML A;  5D6X A;  2F5T X;  3IKM B;  2HL5 C;  1K9M R;  2AIR B;  3CCR A;  2JM9 A;  2CH4 W;  3PT9 A;  1K0S A;  2HZY A;  1PSE A;  1KHI A;  1H92 A;  1H4T A;  2I4N A;  2QYZ A;  2AT1 B;  2IVW A;  2COY A;  2LNV A;  2HKQ B;  1YP5 A;  2E3H A;  4QVZ A;  2XKO C;  1BBZ A;  2VXE A;  2EYZ A;  1MMA A;  1UGP B;  3OYL A;  2YUP A;  2LTO A;  2A7Y A;  1W2B P;  3UT1 A;  3VQW A;  2HL3 A;  1NYF A;  3QO7 A;  1M2O A;  3KUF A;  2XHC A;  2LQ8 A;  2KRN A;  1X69 A;  4RG8 A;  1NE8 A;  4M75 F;  2ZPI B;  4M7A F;  1A0N B;  1PRL C;  4PHC A;  3CME A;  1W2B S;  4KUL A;  2H8H A;  3OYF A;  4DBQ A;  4HWT A;  5GMK l;  1SRM A;  1EOV A;  2X4X A;  2LCL A;  2OAW A;  1YI2 A;  5IN1 A;  2K2V A;  1YFR A;  5KYX B;  1Y07 A;  4YCU A;  1C0M A;  2BE9 B;  4WJ3 M;  4II1 A;  2I0N A;  2QXF A;  1VQ5 A;  1QQJ A;  1V29 B;  2RD1 A;  2L8D A;  3OQ5 A;  5FU7 C;  2J6F A;  2RK2 A;  4D8K A;  3CMA T;  4CC2 A;  1GCQ C;  1K73 R;  2F5K A;  2C0T A;  2CZ7 B;  3J81 E;  1Q81 U;  3EG9 A;  1K8A R;  4PJJ A;  2RI2 A;  2DK3 A;  4N0A A;  1I5L A;  2RHY A;  3JCM P;  3OYH A;  1BI0 A;  1NJ6 A;  3NET A;  1RAI B;  1KJW A;  4CC4 B;  3X26 B;  4VUB A;  2OJ2 A;  2LZ6 B;  1WXB A;  3TCJ A;  4EMK B;  1GL5 A;  4R55 A;  4CH4 A;  3JSC A;  2RK1 A;  1VA7 A;  2RQR A;  1T3S A;  3MHX A;  2GTJ A;  2X9H A;  1QKX A;  4M77 F;  5DLO A;  5GAO p;  3GF5 A;  1SSH A;  3QG1 A;  1AWW A;  5KYX A;  2A3L A;  2FPD A;  1IZ6 A;  1VQM A;  5J26 A;  2AMC B;  4PK4 A;  1NLO C;  1FWZ A;  2L5Q A;  2BKD N;  4HXJ A;  2VXF A;  1NYG A;  1M1K R;  3M4P A;  5F5W A;  4RTU A;  3M0S A;  1D0X A;  2BIV A;  2QEX T;  1X27 A;  1G3Y A;  1VQO T;  1I81 A;  1ATI A;  3SWN B;  2EJF A;  1SHF A;  4M78 D;  5IT9 E;  3A31 A;  4LDU A;  4M7D B;  4JLG A;  2I2L A;  5LJ3 h;  2PME A;  2Q5H A;  2MCN A;  2XK0 A;  3HTZ A;  1AVZ C;  2K2M A;  4EMK A;  4RDX A;  4HT4 A;  3RUX A;  3H41 A;  2KR3 A;  4C0D B;  3LW5 E;  3WXM B;  2RB6 A;  2CP5 A;  1N9W A;  2JTM A;  5FLX E;  1ZLM A;  4KH0 B;  1WJS A;  1KHC A;  1IGQ A;  2QAS A;  3M57 A;  3CC2 T;  1UUE A;  4CRI A;  1ZSZ B;  3I5S A;  3LH0 A;  2ZT6 A;  3E9H A;  4F7U B;  2DTO A;  2AMC A;  2DZC A;  1SG5 A;  4F17 A;  3OA6 A;  2O88 A;  2P0P A;  1WHK A;  4P71 A;  4YCV A;  3ICA A;  2L2P A;  1K8A U;  2J6O A;  3V7R A;  3SWN A;  3X25 B;  1KQ2 A;  1JEG A;  2F2W A;  4HWR A;  1C0A A;  2ZNJ A;  4P3N A;  1UB4 A;  1ZUY A;  2G6F X;  1YIT Q;  2OTL T;  3M0P A;  4M7D A;  3G71 A;  4NL3 A;  1NLP C;  4YRI A;  3JV3 A;  4YRE A;  4FT2 A;  2M9U A;  3I56 T;  2PUK B;  1KQS P;  3UGT A;  1Q95 G;  3VS3 A;  1CKA A;  2C06 A;  1WX6 A;  3THK A;  1GRI A;  3MQZ A;  3M53 A;  1YWP A;  1WLE A;  3OBW A;  2C8M A;  5GAM d;  3KFU A;  3OS2 A;  1OZ2 A;  1KQS S;  2QK0 A;  5FW9 A;  3RER A;  2EYX A;  1NYR A;  4IUV A;  3RDV A;  4TTV A;  3CD6 A;  3FJP A;  1Q7Y U;  1QVG A;  4F7U A;  5A0G A;  1VQ9 Q;  3VUZ A;  1QCF A;  2RM4 A;  2Y4Y A;  3CBP A;  3I7F A;  2ZCF B;  2PVO B;  2Q5I A;  1SET A;  2K5I A;  4DOW A;  4J15 A;  3QZ5 B;  3J7A F;  3OYY A;  2JUF A;  5LJ5 d;  1QF6 A;  4H2X B;  4ZGJ B;  4Q5W A;  3HFN A;  4A63 B;  2ALY B;  4XEO A;  3QZ9 B;  3OY9 A;  2DTH A;  2JS0 A;  5GAO m;  3S3N A;  4FU6 A;  3PIP A;  1LNX A;  4M75 D;  1AZE A;  1W4S A;  2KY9 A;  4M7A D;  2DEU A;  1H64 1;  4M75 E;  3O8V A;  2RO0 A;  4M7A E;  4GLK A;  4PLI A;  5KYU B;  2QQS A;  2YRC A;  4JJD A;  2ZIO A;  3A7A A;  4HWO A;  3CCR T;  2JTE A;  5HK3 A;  2E6Z A;  3I35 A;  4C8Q F;  2EVR A;  2O9S A;  1X6O A;  1BYM A;  4ZNX A;  1E7O A;  2NUZ A;  1K73 C;  1HJD A;  4UPA A;  5CVI A;  4LXC A;  1K8A C;  1YWO A;  2EYQ A;  1VIE A;  4LE9 A;  2EGC A;  2CP7 A;  2HCK A;  4UP9 A;  1ACM B;  4DQ2 A;  1LOJ A;  1KG1 A;  4A4K A;  4H2X A;  3CMA Q;  3S3O A;  4DPG A;  2CT4 A;  1MMN A;  2YWW A;  2QAZ A;  2XD0 A;  2ALY A;  4EDU A;  1X2Q A;  4N4H A;  4WTO B;  4E47 A;  3MF1 A;  3OMC A;  3U23 A;  4XEM A;  3CME T;  1Q86 U;  5KNN A;  2GQI A;  1E1O A;  2RQV A;  2CP6 A;  3BE3 A;  3MEW A;  4X9D A;  2LVM A;  3UPU A;  3N5B B;  1YI2 T;  3EAE A;  4MDW A;  2FO0 A;  4H02 A;  2RJC A;  3HKS A;  2RHX A;  2IIM A;  1VQL A;  2CUD A;  5ECA A;  1E1T A;  1GGM A;  4M77 D;  4N0A C;  2LP5 A;  1U8R A;  5KYU A;  1VYT A;  1NJ2 A;  1VQ5 T;  5CQY A;  1Q7Y C;  1FMK A;  4P75 A;  4P5N A;  1X01 A;  2ATC B;  1VUB A;  1M1K C;  4PKC C;  5KCO A;  5GAN g;  2EQJ A;  4QVC A;  1MUZ A;  1U06 A;  1R77 A;  2QEX Q;  5FRO A;  4HKE A;  1VQO Q;  2LCC A;  1KQ1 A;  3BW1 A;  4E7Z A;  3LSS A;  1OI1 A;  1VQ9 A;  3QBY A;  1YJ9 A;  2JS2 A;  3J80 E;  2WSC E;  1TUG B;  3C4S A;  3E9I A;  3QPH A;  1R8O B;  3E1S A;  1PSF A;  1N9R A;  2MWP A;  3QXE B;  1BBW A;  4E7K A;  2L3Q A; 
#chains in the Genus database with same CATH homology
 3JB9 G;  4YP0 A;  4YRG A;  2ZZF A;  3CBO A;  2DDZ A;  3BFM A;  3HRT A;  5FU7 B;  3FDR A;  4EMG A;  2R58 A;  1ZQ1 A;  4UC4 A;  3HP9 A;  1PYS B;  4K87 A;  5A2Q E;  4EMK C;  2HBP A;  4A4H A;  3P8B B;  4O2D A;  4Q6G A;  2E12 A;  5GAN f;  1SSF A;  4C0Z A;  1B7Y B;  1NPP A;  2WSE E;  4NCX A;  1Q86 C;  3HY0 A;  1E22 A;  4OB0 B;  3OS0 A;  3QYH B;  3CBM A;  3VKI A;  4IKF A;  2L89 A;  4P71 C;  3LGF A;  4JJN K;  3OYE A;  4OB1 B;  2YHT A;  3SWN C;  4RQE A;  4N4G A;  5EG2 A;  4PJO G;  4XTV A;  3JRZ A;  4M7D C;  1I4K 1;  1X54 A;  2ZT5 A;  4JLI A;  1PYS A;  3CCM A;  4YRQ A;  1WJQ A;  4LD6 A;  3PTA A;  2CS7 A;  1SRY A;  3G71 T;  1QVP A;  3A32 A;  4C0D C;  4L87 A;  3H8Z A;  1B7Y A;  3H6Z A;  3VQY A;  2DU7 A;  3RKX A;  4X9C A;  4P72 A;  3CC7 A;  3MCA B;  2P0K A;  2CYZ B;  2DPP B;  3LSQ A;  3OYJ A;  3CD6 T;  2ZGW A;  4YRR A;  2ZXF A;  4XU2 A;  2B8A A;  4N4I A;  4PJO E;  1JB0 E;  4C8Q D;  2JOY A;  2DZ9 A;  5FU6 B;  4C5E A;  3JB9 J;  1YJW A;  4C8Q E;  3QNE A;  4P74 A;  4IUR A;  1G51 A;  3DB4 A;  3TEH A;  3CEY A;  2FHD A;  3HXY A;  3E19 A;  2IY5 B;  4LVM A;  3URG A;  1G5H A;  3WQZ A;  4C92 F;  4HT9 A;  1B70 B;  4IUU A;  3SDZ A;  1QW1 A;  3R6O A;  3L4G B;  1YCY A;  1ADJ A;  4CH3 A;  4EMH A;  3IKL A;  3UGQ A;  5GAO n;  1U1T A;  2KQW A;  5LJ3 e;  3CPF A;  5C53 B;  3FLG A;  3P8V A;  1TH7 A;  4A4F A;  3LGL A;  1M5Q 1;  4BI4 A;  3JCM c;  1VQ4 A;  2RI3 A;  3GNF B;  4P75 C;  4KR2 A;  2IY5 A;  2MWO A;  5GAN j;  2XTI A;  1VQL T;  1D3B B;  2RHZ A;  1B70 A;  2NLU A;  3C95 A;  1MGQ A;  2EAY A;  3L4G A;  2GFU A;  2QTX A;  3CPW S;  4QVD A;  3G1Z A;  3HRK A;  3OYD A;  4BE2 A;  1UGS B;  2IG0 A;  4IUP A;  2I4M A;  3OW2 S;  1S72 A;  1Q82 U;  3S3M A;  1N8R C;  1QE0 A;  3MP1 A;  4YRF A;  1VQ9 T;  3A74 A;  1HTT A;  1YJ9 T;  3F70 A;  4QW2 A;  4A54 A;  4YRN A;  4NS5 A;  3RES A;  2QHT A;  3DLL A;  3CXC S;  2L3R A;  2V8J A;  1SER A;  2BUD A;  4WF2 A;  3EFS A;  1YJN A;  4JRP A;  1D3B A;  3JCM g;  4J5Y A;  5LJ3 j;  3TUP A;  3LLR A;  2K5F A;  1N6A A;  3QKJ A;  4HCC A;  3A8O B;  3CCU A;  4Q15 A;  3LC0 A;  2VUB A;  1JJ2 A;  1BIA A;  4E7K A;  2ZPB B;  2OAU A;  3RIR A;  1YIJ A;  3BDL A;  3QO5 A;  4C5H A;  1JRI A;  3FEO A;  4ELZ C;  2YLC A;  5GAN h;  3CMQ A;  3V8L A;  1H4V B;  4XK8 E;  2ZCE A;  3PMI A;  4KUI A;  1W66 A;  1HXD A;  2P4T A;  3OYI A;  3PMT A;  4M78 G;  3JCM f;  1YFS A;  2XGT A;  3CCM T;  1B8A A;  3NTK A;  2DQ0 A;  4P72 C;  4O6J A;  4CI0 C;  4JDS A;  4BUG A;  2QHV A;  4BDZ A;  3JCM b;  5HK0 A;  3L2W A;  2Q7H A;  4J6W A;  3CC7 T;  4CH5 A;  3TEE A;  5I2M A;  4WJ4 A;  2DXC A;  2R57 A;  4MZM A;  4UP8 A;  2E41 A;  4C92 D;  2QA4 A;  4P74 C;  4C92 E;  5AYF A;  1YJW T;  4M78 E;  3OW2 A;  2X4W A;  2EL9 A;  3LX7 A;  3RKW A;  1BI3 A;  4O5V A;  4WI1 A;  1USY A;  4C5G A;  4LVL A;  2FVU A;  1UEB A;  3CXC A;  3IG2 A;  4HT8 A;  2DVE A;  2QQA A;  4OGE A;  4FL6 A;  1Q81 C;  5FU6 C;  4KBM B;  5GMK m;  4E7L A;  1YB3 A;  3REX A;  5D6W A;  3QJ6 A;  4LDW A;  4L59 A;  3GP8 A;  1ADY A;  1N9S A;  1WU7 A;  2RH2 A;  2PUO B;  1W2B A;  4M7D F;  4V2S A;  2MMP A;  3NTH A;  4M75 G;  1VQ4 T;  2VGM A;  4M7A G;  3ASK A;  3DB3 A;  5FRN A;  2FB7 A;  3BDU A;  4RKU E;  4BY6 B;  3CCE A;  1FX7 A;  4L5G A;  3V7S A;  4PJO B;  4OVA A;  2ODR D;  4F7U F;  4J83 A;  5CCA A;  1KD1 U;  4YPF A;  2PVG B;  2RHI A;  3C12 A;  4XU0 A;  3W3S A;  3S6W A;  1S72 T;  4KUD K;  2G4C A;  3BJU A;  2FYK A;  5J39 A;  2RA2 A;  4M77 G;  3PIO A;  4LD9 K;  1QVF S;  1YJN T;  2P0Q A;  4YDQ A;  4PJO A;  2E65 A;  2X35 A;  4C8Q A;  3M56 A;  2CJ9 A;  3RGL A;  3ZEH A;  3A5Y A;  3VYG A;  2P0L A;  2DJZ A;  3CCS A;  3CCU T;  5GAM g;  1KC8 U;  1OYX A;  3MET A;  2AHJ B;  3TU4 K;  2Q7E A;  1O9S A;  4CS3 A;  2JZ2 A;  1YIJ T;  5C52 B;  4ZTF A;  3ERR A;  2O01 E;  5LJ5 g;  4J6Y A;  4RMO A;  1VQN A;  3Q1J A;  3OB9 A;  1HC7 A;  2K5L A;  4XU3 A;  3OYM A;  4M77 E;  2P5I A;  2KMT A;  4LVI A;  3SD4 A;  3QUI A;  2D9T A;  4BI3 A;  1QP2 A;  2RJD A;  4RG2 A;  2DQ3 A;  5CKH A;  3A8G B;  4H2U A;  1WJR A;  5LJ3 d;  2CZ1 B;  2DIQ A;  2J3M A;  4C0F A;  5GAM f;  4UP7 A;  3QYG B;  3CCJ A;  1G3T A;  1B34 B;  3SB2 A;  3FRN A;  1BI2 A;  4XQ3 A;  5CKD A;  1KQS A;  3JB9 H;  2ZPE B;  3G6E T;  2ZR3 A;  1WQ7 A;  2RJE A;  4ZTJ A;  3QTC A;  5GAN 3;  4HA8 A;  5M9O A;  5LJ5 f;  1RL2 A;  2QA4 T;  4YTL A;  1G5I A;  3QO8 A;  4Z02 A;  2QHS A;  3TEG A;  1USY C;  3HXZ A;  2EWN A;  3HRU A;  4BE1 A;  1KC8 C;  4G84 A;  2XG8 D;  5HY6 A;  2C7I A;  4LNS A;  2QDY B;  3CCQ A;  4X5O A;  3UDC A;  3ME9 A;  4M7D D;  4JRQ A;  4A4G A;  1B34 A;  4XTX A;  3QII A;  3HL8 A;  2D6F A;  2XU8 A;  4M7D E;  3LWI A;  1HK9 A;  4XAX B;  1H4Q A;  1M90 U;  1BBU A;  1X75 C;  3REU A;  4E51 A;  2PQW A;  1Z7M A;  2GCX A;  1XQH A;  4C8Q G;  1AHJ B;  1KOG A;  3R07 A;  1X2H A;  4BD3 A;  2JTF A;  1O75 A;  4DOV A;  3A5Z B;  4ZTU B;  3TEH B;  4F7U E;  3OYB A;  5J3B A;  3QHS A;  3A8M B;  3M55 A;  5HKC A;  3INZ A;  2KK4 A;  3AHU A;  1FYF A;  1BKB A;  2R5A A;  2DEQ A;  1YHQ A;  3QDR B;  2ZIN A;  3LWH A;  2RHS B;  3CCE T;  5GAN e;  3OYA A;  4YRO A;  3L2V A;  5GAN 6;  5KE2 A;  3QJY A;  3RAC A;  1GXI E;  4TVA A;  4QQD A;  4M78 B;  4BE0 A;  5I2S A;  4BW9 A;  1EFW A;  3G7Z A;  4BB7 A;  2CIM A;  1VQ6 A;  2GFA A;  3M59 A;  1VQP A;  3X24 B;  3A5Z A;  1E24 A;  2ZTG A;  3L2R A;  5CQX A;  3OD1 A;  3PCO B;  2LQK A;  5A0L A;  4BY6 C;  2CKK A;  1X2G A;  2A8E A;  3JCM J;  4PJO C;  4P3P A;  2VYT A;  2RHS A;  1Y7X A;  2CZ0 B;  4D6W A;  1KMN A;  1M90 C;  1H4S A;  2Y90 A;  5GAN 4;  3HHT B;  2X4J A;  5CKF A;  4C92 A;  3TRE A;  3I55 A;  5GAO r;  4KQE A;  4M78 A;  2XI9 A;  3JB9 I;  1JBM A;  3GPL A;  3CCS T;  2ZPG B;  3ZFJ A;  5LJ5 j;  1XTD A;  2KDS A;  4H2T A;  2LC4 A;  1KMM A;  2VGN A;  4RCC A;  3PCO A;  3MEV A;  2ZPH B;  4J7F A;  3SFM A;  4BI8 B;  3A7R A;  2MAM A;  3L2Q A;  1VQN T;  3PGG A;  3ZBD A;  1BI1 A;  3RMQ A;  3V7C A;  2D0Q B;  4YRC A;  3PNW C;  4XTY A;  1Y71 A;  2HQX A;  3A7U A;  4LDX A;  4YRS A;  4YYE A;  2ZNI A;  2ZR2 A;  3OYC A;  4JS5 A;  1P92 A;  3HXV A;  2F69 A;  3JCM X;  1NJ1 A;  4YRT A;  4MZT A;  4M75 B;  4M7A B;  4MZP A;  4BWA A;  3L42 A;  4FM4 B;  3CCJ T;  4HWS A;  2EQM A;  1NYQ A;  5CKE A;  4PG3 A;  4A53 A;  5I21 A;  2RI5 A;  2AKW B;  4PL6 A;  4P3O A;  4LDV A;  4L6V 5;  3CCL A;  4Y91 A;  4K88 A;  2KAF A;  2ARU A;  4J8O A;  4RMF A;  4JUV A;  3KXT A;  2EQK A;  1NJI U;  2EJG A;  4QQ6 A;  4LDY A;  1I8F A;  5CAI A;  1J5W A;  4TQD A;  2PVD B;  4DA4 A;  4G85 A;  1RI0 A;  5K1X A;  2QQ9 A;  3FIF A;  2HD0 A;  5LJ5 h;  5ELO A;  3CCQ T;  3VQX A;  4M75 A;  3UH0 A;  4M7A A;  3PZC A;  3NTI A;  2O4X B;  3VBB A;  5IAY A;  3CCV A;  5GAN 2;  3P8Y A;  2GF7 A;  4M77 B;  2RHU A;  4EX5 A;  3UWN A;  2AKW A;  3M4Q A;  2DIG A;  1ZHI A;  2EJ9 A;  1DJ7 B;  3M5A A;  3DKM A;  4C92 G;  3FC3 A;  1X56 A;  4B9W A;  5GAN 8;  2XDP A;  2ZT8 A;  2M1H A;  4PLL A;  1QVG S;  1VQ7 A;  4OP0 A;  2ZPF B;  2E10 A;  1Q82 C;  2ZZG A;  2RJF A;  4P73 A;  3E9G A;  2R5M A;  2KSS A;  4RCB A;  1YHQ T;  1VQ8 A;  3CC4 T;  2O4X A;  4BDY A;  4XTW A;  3G6E A;  3JCM Q;  2EKO A;  2V8I A;  3UFG A;  4M77 A;  2XID A;  5CKB A;  1WGS A;  2K4Y A;  4ZN1 A;  3CPW A;  1NJI C;  4HVC A;  4YRP A;  3JAM E;  1LYL A;  2Q7G A;  2PU9 B;  2HQE A;  5ELN A;  1K9M U;  4OB2 B;  2HAX A;  1G3W A;  1VQ6 T;  5GAO l;  1VQP T;  3G4S T;  3GNG A;  5C6S A;  1U1S A;  3JCM e;  4OB3 B;  3MP6 A;  2NS6 A;  4C92 C;  4EPC A;  4XTZ A;  4JRI A;  1EIY B;  2E6N A;  4FSX A;  3GLX A;  4M78 C;  2OTJ A;  5DM7 R;  3M4Y A;  2J3L A;  3VJP A;  3A8H B;  2CZ6 B;  4OMF B;  4NOY A;  3I55 T;  4E7H A;  4LVJ A;  2ZZE A;  2PMF A;  4YRL A;  4TVW A;  2X4Y A;  3L2Z A;  1K73 U;  3OYN A;  2E1H A;  4TVY A;  3NEM A;  4ZGD B;  1Y96 B;  1EIY A;  5FRM A;  5DLQ E;  2E3C A;  3QO3 A;  4GY5 A;  3JB9 F;  2QI2 A;  4C8Q B;  1XOV A;  2DXT A;  2ZZD A;  2I4L A;  1L0W A;  4ZN3 A;  2ZT7 A;  2LT1 A;  1EIF A;  3VV0 A;  3M4G A;  4C5I A;  3L1A A;  1NZ9 A;  1K9M C;  1JJC B;  3FB9 A;  3OS1 A;  4YCW A;  1M4Z A;  3HPW A;  1M1K U;  2YLB A;  1VQK A;  3MEU A;  5GAN 5;  3DSQ A;  3M9Q A;  5CO7 A;  1ASY A;  2ODR C;  1Y96 A;  2E64 A;  4Y28 E;  5A0D A;  3MP8 A;  5K1P A;  5C51 B;  5GAN d;  2ART A;  4IUQ A;  4BAC A;  3CCL T;  2DO3 A;  2EFI A;  2QHU A;  4TVR A;  4EO4 A;  5GMK i;  4PJO F;  2FL7 A;  1UGQ B;  4YRK A;  3JCM W;  4JRK A;  2DXU A;  2V8K A;  4H2W A;  4M75 C;  4M7A C;  1JJC A;  2K3Y A;  4AH6 A;  3MEY A;  4MMK A;  3WVE B;  1LJO A;  3DLM A;  3HY1 A;  1WPY A;  3HRS A;  3E9F A;  4X34 A;  2QQB A;  3VU3 C;  2DKG A;  3CCV T;  2CJB A;  4XU1 A;  3NEN A;  3HXU A;  4XTU A;  4J6X A;  2MF2 A;  1KD1 C;  4P73 C;  4ZTZ B;  3OBY A;  1YIT A;  2M16 A;  1X55 A;  1FXX A;  1VQ7 T;  5LL6 S;  5CK9 A;  5GAN 7;  5CR2 A;  2XDD A;  1EQR A;  4M77 C;  2JNG A;  2HNI A;  2K57 A;  4OGC A;  4ZIB A;  4M7D G;  4JS4 A;  4FT4 A;  1M9S A;  3JCM h;  5GMK e;  3HFO A;  2XDB A;  4TWA A;  1VQ8 T;  2WSF E;  3HSB A;  3OYK A;  3OSS C;  4KT0 E;  3HXX A;  2I4O A;  2KVQ G;  2CGH A;  4NL2 A;  3HXW A;  2LX9 A;  4H2V A;  11AS A;  3VQV A;  2CJA A;  2M0O A;  3OS5 A;  4F7U G;  3GOX A;  4H2S A;  3T9N A;  1M1G A;  2H3J A;  1RIQ A;  4J7I A;  4PNO A;  1M1F A;  3RL6 A;  5E3I A;  3P8D A;  1EVK A;  3JCM V;  1QVF A;  1VIF A;  5LJ3 g;  2K3X A;  3HFV A;  4TVA B;  2OTJ T;  1ZBX A;  1MHN A;  4E7I A;  5L8R E;  5GAM e;  2E5A A;  4OLF A;  2Y4X A;  3OMG A;  5KCH A;  2EIF A;  2JVV A;  1BIB A;  3RF1 A;  3JB9 D;  1N27 A;  4A4E A;  4ELY C;  3RMS A;  3CMA A;  2EQU A;  1G5V A;  2E70 A;  2DXB A;  3PFS A;  3X20 B;  4ME7 A;  5LJ5 e;  2DAQ A;  4E7J A;  3M54 A;  4K86 A;  1QP3 A;  5GMK j;  1IRE B;  3V8K A;  4HCB A;  1NJ8 A;  2JN0 A;  3CC4 A;  2GQV A;  3P8T A;  5CIU A;  2DTI A;  4R56 A;  5D6Y A;  3OSV A;  4C92 B;  5C0M A;  2LT4 A;  4ZGE B;  4RQF A;  5LJ3 f;  2DD5 A;  2ZIM A;  5DY9 A;  2QEX A;  3HFZ B;  4PJO D;  4KR3 A;  1VQO A;  1H3Z A;  1SES A;  2ARS A;  2MI6 A;  12AS A;  3QSU A;  3G4S A;  4OF1 A;  2VC8 A;  2XIC A;  3GIB A;  1VQK T;  3P8H A;  4TQF A;  4MDX A;  1JJ2 S;  1G3S A;  3NFC A;  1Z7N A;  3VYH B;  1N8R U;  4C8Q C;  4ATO A;  5GAM j;  2DU5 A;  4LVK A;  5KH6 A;  3CC2 A;  1XNI A;  3MO8 A;  1IL2 A;  2E5Q A;  4YRJ A;  2WAC A;  3EFR A;  2DD4 A;  1YGB A;  2LRQ A;  3ER0 A;  1WYD A;  1NNH A;  3NEL A;  4M78 F;  3HFZ A;  3KBG A;  4YRM A;  3C94 A;  3MEA A;  4H2Y A;  2LDM A;  2OTL A;  4HWP A;  3VUB A;  4IUT A;  5GMK h;  3LYI A;  1YFT A;  1NJ5 A;  3JCM d;  2YRV A;  3I56 A;  4B9X A;  3V8J A;  4QQG A;  5HGQ A;  2RHQ B;  3L2U A;  3M58 A;  1WNL A;  1VQZ A;  2QQR A;  1B76 A;  1WQW A;  4C0G A;  3HRI A;  4CS2 A;  1YIT T;  2VV5 A;  4FIB A;  3A8L B;  1UGR B;  2G3R A;  3IAL A;  1EVL A;  3WVD B;  1YBY A;  3MF2 A;  4CH6 A;  1OZ3 A;  5GAO q;  3X28 B;  1M8V A;  3RKY A;  1NPR A;  2RHQ A;  4CS4 A;  3OYG A;  5KE3 A;  5GAM h;  4HCZ A;  1ASZ A;  3BY7 A;  4MML A;  5D6X A;  2F5T X;  3IKM B;  3CCR A;  3PT9 A;  1PSE A;  1KHI A;  1H4T A;  2I4N A;  2IVW A;  2LNV A;  4QVZ A;  2XKO C;  2VXE A;  1UGP B;  3OYL A;  2LTO A;  2A7Y A;  3UT1 A;  3VQW A;  3QO7 A;  3KUF A;  2XHC A;  2LQ8 A;  4RG8 A;  1NE8 A;  4M75 F;  2ZPI B;  4M7A F;  4PHC A;  3CME A;  1W2B S;  4KUL A;  3OYF A;  4HWT A;  5GMK l;  1EOV A;  2X4X A;  2LCL A;  1YFR A;  1YI2 A;  5IN1 A;  2K2V A;  1Y07 A;  4YCU A;  4WJ3 M;  4II1 A;  2QXF A;  1VQ5 A;  1V29 B;  3OQ5 A;  2RD1 A;  2L8D A;  5FU7 C;  3CMA T;  2RK2 A;  2F5K A;  2CZ7 B;  3J81 E;  1Q81 U;  2RI2 A;  2DK3 A;  4N0A A;  1I5L A;  2RHY A;  3JCM P;  3OYH A;  1BI0 A;  1NJ6 A;  3NET A;  3X26 B;  4VUB A;  3TCJ A;  4EMK B;  4R55 A;  4CH4 A;  3JSC A;  2RK1 A;  3MHX A;  4M77 F;  5DLO A;  5GAO p;  3GF5 A;  3QG1 A;  2A3L A;  1IZ6 A;  1VQM A;  5J26 A;  2AMC B;  2L5Q A;  1FWZ A;  2BKD N;  2VXF A;  3M4P A;  5F5W A;  2BIV A;  2QEX T;  1G3Y A;  1VQO T;  1I81 A;  1ATI A;  3SWN B;  2EJF A;  4M78 D;  5IT9 E;  3A31 A;  4LDU A;  4M7D B;  4JLG A;  2I2L A;  5LJ3 h;  2PME A;  2Q5H A;  2XK0 A;  3HTZ A;  4EMK A;  4RDX A;  4HT4 A;  3RUX A;  4C0D B;  3LW5 E;  3WXM B;  2RB6 A;  1N9W A;  2JTM A;  5FLX E;  1WJS A;  1KHC A;  3M57 A;  3CC2 T;  4CRI A;  3LH0 A;  2ZT6 A;  3E9H A;  4F7U B;  2DTO A;  2AMC A;  2DZC A;  3OA6 A;  2P0P A;  4P71 A;  4YCV A;  3ICA A;  1K8A U;  3V7R A;  3SWN A;  3X25 B;  1KQ2 A;  4HWR A;  1C0A A;  2ZNJ A;  4P3N A;  1UB4 A;  2OTL T;  4M7D A;  3G71 A;  4NL3 A;  4YRI A;  4YRE A;  4FT2 A;  2M9U A;  3I56 T;  2PUK B;  3UGT A;  2C06 A;  3MQZ A;  3M53 A;  1WLE A;  3OBW A;  2C8M A;  5GAM d;  3KFU A;  3OS2 A;  1OZ2 A;  1KQS S;  3RER A;  1NYR A;  4IUV A;  4TTV A;  3CD6 A;  3FJP A;  1Q7Y U;  1QVG A;  4F7U A;  5A0G A;  3VUZ A;  2RM4 A;  2Y4Y A;  3CBP A;  3I7F A;  2ZCF B;  2PVO B;  2Q5I A;  1SET A;  2K5I A;  4DOW A;  4J15 A;  3QZ5 B;  3J7A F;  3OYY A;  2JUF A;  5LJ5 d;  1QF6 A;  4H2X B;  4ZGJ B;  4Q5W A;  3HFN A;  2ALY B;  4XEO A;  3QZ9 B;  3OY9 A;  2DTH A;  5GAO m;  3S3N A;  4FU6 A;  3PIP A;  1LNX A;  4M75 D;  1W4S A;  2KY9 A;  4M7A D;  1H64 1;  4M75 E;  3O8V A;  2RO0 A;  4M7A E;  4GLK A;  4PLI A;  2QQS A;  2ZIO A;  3A7A A;  4HWO A;  3CCR T;  5HK3 A;  2E6Z A;  4C8Q F;  1X6O A;  1BYM A;  1K73 C;  4UPA A;  5CVI A;  1K8A C;  2EYQ A;  1VIE A;  4UP9 A;  4DQ2 A;  1LOJ A;  1KG1 A;  4A4K A;  4H2X A;  3S3O A;  4DPG A;  2ALY A;  2XD0 A;  4EDU A;  4N4H A;  4E47 A;  3MF1 A;  3OMC A;  4XEM A;  3CME T;  1Q86 U;  5KNN A;  1E1O A;  3MEW A;  4X9D A;  2LVM A;  3UPU A;  3N5B B;  1YI2 T;  3EAE A;  4MDW A;  4H02 A;  2RJC A;  3HKS A;  2RHX A;  1VQL A;  1GGM A;  1E1T A;  4M77 D;  4N0A C;  1U8R A;  1NJ2 A;  1VQ5 T;  5CQY A;  1Q7Y C;  4P75 A;  4P5N A;  1X01 A;  1VUB A;  1M1K C;  4PKC C;  5KCO A;  5GAN g;  2EQJ A;  4QVC A;  5FRO A;  4HKE A;  2LCC A;  1KQ1 A;  3BW1 A;  3LSS A;  1OI1 A;  1VQ9 A;  3QBY A;  1YJ9 A;  3J80 E;  2WSC E;  3C4S A;  3E9I A;  3QPH A;  1R8O B;  3E1S A;  1PSF A;  1N9R A;  2MWP A;  3QXE B;  1BBW A;  1VQM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...