2DXUA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
231
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKISFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 67
structure length 231
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxuA01
1X54A 1E24A 4JRKA 5GANg 3UGQA 3HXZA 4TWAA 2AMCA 4P72A 3SWNB 4P75A 2FYKA 1SRYA 4WJ3M 4M78D 2DXUA 4C92G 4M7DA 3V7RA 1WU7A 4M7AG 1KOGA 3TUPA 4XTUA 3JCMf 3UGTA 2ZNIA 2E3CA 1HK9A 4G84A 4F7UB 4M75F 4YRNA 4PJOA 5ELOA 2Y90A 4F7UG 4M77B 2ZR3A 3FIFA 2QHUA 1RIQA 3NENA 1L0WA 5GAN5 1SETA 1WYDA 4P71A 4RQFA 1HTTA 1YFRA 5LJ5j 4Q6GA 11ASA 2ODRD 5GAN4 2QTXA 1I81A 4YCVA 3RKXA 1MGQA 1X2HA 3MF2A 1H4QA 2DU5A 4WJ4A 2ZZFA 1HC7A 3JCMX 5DY9A 3ERRA 1PYSA 3L4GB 3RACA 4C92F 3JB9J 2DZ9A 4XU2A 4M7AF 5GAMd 3HRIA 4P73C 1NJ1A 2VC8A 4X9DA 4UP8A 4CH6A 4LNSA 4F7UF 5GANd 4PJOD 4MMLA 4HT8A 1KMNA 1N9SA 2DJZA 1ASZA 4DPGA 3A5ZA 1YFTA 1HXDA 2ZNJA 4P74C 2ZT7A 4X5OA 3ICAA 5C52B 1BBWA 2CJAA 1EQRA 3L1AA 2ODRC 2EWNA 3NEMA 4M78G 2Q5IA 3HFZA 3LSSA 4H2XB 4E51A 4P72C 4M77A 3QSUA 1LOJA 5LJ3j 4P75C 2DVEA 3R07A 4K88A 3JCMe 2G4CA 5F5WA 1LNXA 3A31A 4M75E 3V8LA 2DTHA 4M7DC 4YPFA 5LJ5f 1FYFA 4YRTA 4YRRA 2XGTA 1WQ7A 4HWRA 4PJOC 1SERA 3QHSA 2Q5HA 5ELNA 3W3SA 3JCMQ 3M4GA 4RMFA 3QUIA 3EFRA 3L4GA 2HNIA 4RCBA 4EMKB 4XTVA 4P71C 2EJGA 1QE0A 5GAN8 3JB9H 4XQ3A 1B7YA 2ZCEA 4M78F 2EJ9A 4X9CA 2E64A 4C92E 3JB9G 3A32A 1YB3A 4M7AE 4YROA 1EFWA 1JRIA 4CH5A 4MMKA 4V2SA 2ZXFA 2DKGA 5GAMj 4C8QB 3HXVA 3VQXA 2ZT5A 2DQ3A 1WPYA 4F7UE 5GANj 4C8QG 1H4SA 4EMGA 3VBBA 2RHQB 2QHTA 3JCMh 4OLFA 2Q7EA 3JCMV 5GAN7 5GMKl 4KR2A 4C92B 4M7AB 4RCCA 2QHVA 5K1XA 3JCMc 5LJ3d 3VQVA 4CH4A 3HXUA 3JB9F 3IALA 1NJ8A 1B34B 3V8JA 4CS4A 4RDXA 4KR3A 1KMMA 1LJOA 4M77C 1M8VA 4TVAA 1U1SA 3TEHB 5LJ5e 4XEMA 4C8QF 5GAOl 3RIRA 5GAOr 4EMKA 2QHSA 3E9IA 3GIBA 1JJCB 2EJFA 2RA2A 4NCXA 1I4K1 1NJ2A 1H641 4K86A 5GAN2 3M4PA 4ZIBA 1C0AA 3RUXA 3V8KA 4QVCA 4YRJA 4M75A 2E1HA 4HA8A 4NL3A 3SB2A 3AHUA 1Z7NA 1BIAA 3REUA 2ALYA 4XEOA 4M78E 3HRKA 1J5WA 4J5YA 1N9WA 3TEGA 2YLBA 3LSQA 1QF6A 4M7DD 2J3LA 3JCMJ 4P3OA 3L2ZA 4G85A 4PHCA 3A5YA 2I4LA 2RHQA 3HSBA 1EVLA 4HWTA 1W66A 1EVKA 3JCMP 1B70B 2E65A 3SWNA 3A7UA 4C92A 2DQ0A 1TH7A 4M7AA 5GMKj 4XTYA 1X01A 1X56A 1YGBA 4M78B 4CS2A 1BBUA 1G5HA 3V7SA 3HY1A 5LJ5h 3HY0A 4M75D 4XTWA 4F7UA 4ZTUB 4BWAA 3HFOA 1BIBA 1KQ2A 5GAOq 1B8AA 3QO5A 4OP0A 3WQZA 1H4TA 3PGGA 3QTCA 1KQ1A 1ADJA 3PCOB 4TTVA 4C8QE 4XU1A 3P8VA 4YP0A 1D3BB 5GMKi 2ZIMA 3QO3A 3MEYA 4PG3A 3QO8A 1EIYB 3JB9I 3KFUA 2YLCA 2EAYA 4EMKC 4YRPA 4XTZA 3MF1A 5HGQA 4H2UA 3UFGA 4Y91A 2E5AA 3P8TA 2J3MA 4M75C 4KQEA 5GAMe 4M7DG 4J6YA 4TQDA 2CIMA 2ARUA 4M77D 4H2WA 3V7CA 4A54A 4DQ2A 4PJOB 1I5LA 3BJUA 3PZCA 1NJ5A 2DZCA 1Z7MA 4PJOG 3VU3C 2I4NA 2PMEA 2ZGWA 3JCMg 3REXA 1NNHA 3RF1A 4BW9A 2C8MA 2ARSA 4YRGA 4M78A 3A7AA 1IL2A 1G51A 4YREA 4JLIA 4L87A 2ZINA 1G5IA 1WQWA 3HFVA 2ZT6A 3RKYA 4J15A 4H2XA 2RB6A 1NYRA 2RHSB 5LJ3f 4HWSA 4PNOA 3SWNC 4C92C 4YRMA 1JBMA 1E22A 1PYSB 4YRCA 4M7AC 2Q7GA 1WLEA 5I21A 3INZA 4M7DF 2CGHA 4HVCA 4RQEA 3PCOA 3FJPA 4EO4A 1ASYA 2YHTA 2ZTGA 2K57A 4A53A 1WNLA 3A74A 5C53B 4PJOF 4P3NA 4NL2A 4TQFA 4N0AA 2RD1A 3HXYA 1EIYA 3RERA 3FB9A 5GAMh 2EL9A 2RM4A 3NETA 4WI1A 3HXWA 5GANh 1M5Q1 2ZR2A 2ZZGA 4Q15A 1NJ6A 2VXEA 1USYA 2AKWB 2DTOA 3UH0A 5GMKm 3HFZB 5E3IA 4UPAA 3BY7A 2P5IA 5GAN3 2ZIOA 2XTIA 5GAMf 2ZT8A 4NOYA 4C8QA 1YFSA 3JCMd 1B76A 5GANf 4M77G 1VQZA 3P8YA 2P0LA 4CH3A 4JRIA 3JCMb 3IG2A 4XTXA 2E10A 4ZTZB 3I7FA 5GAOm 5K1PA 4YRFA 5GMKe 2RHSA 4H2VA 1ATIA 4XU3A 5CAIA 4YRIA 5LJ5g 3LC0A 2Q7HA 1E1OA 4M78C 1YCYA 3JB9D 1H4VB 3CMQA 1B7YB 2JN0A 5LJ3e 2FB7A 1B34A 4QVDA 4EX5A 3BFMA 3IKMB 4TVWA 4K87A 4C8QD 1GGMA 3TEHA 4M7DE 3BDUA 4M77F 4CS3A 2ZZEA 2I2LA 2C7IA 1Y96B 4YRLA 1JJCA 2IY5B 2I4MA 4YCUA 3RGLA 3BW1A 3HFNA 4PJOE 2ARTA 4H2SA 4TVYA 4YDQA 2DXTA 2AKWA 1EOVA 3QNEA 4XU0A 2VXFA 3A7RA 4N0AC 2DEQA 4EMHA 4C92D 4UP7A 2AMCB 5KNNA 5C51B 3JCMW 3IKLA 4M7AD 2E41A 3QO7A 3RL6A 1X55A 4M7DB 2DTIA 1E1TA 5GMKh 4YRSA 4YRKA 2DU7A 1USYC 3DSQA 5GAN6 4YYEA 1N9RA 5LJ3g 3G1ZA 5GANe 4H2TA 3HXXA 5LJ5d 4WF2A 4C8QC 1B70A 4TVAB 1U1TA 4JUVA 2DDZA 5LJ3h 1LYLA 2PMFA 1ADYA 12ASA 5GAOn 4P3PA 4J6WA 4H2YA 3RESA 2CJ9A 4HWPA 4P73A 3RKWA 4M75B 4J6XA 3NELA 3HTZA 3M4QA 4AH6A 4M75G 2ALYB 4YRQA 4YCWA 4HT9A 4HWOA 1Y96A 3E9HA 4UP9A 2IY5A 4H02A 3VQWA 2CJBA 4P74A 1SESA 4O2DA 1I8FA 1NYQA 5GAOp 4M77E 1X2GA 3OD1A 1D3BA 3EFSA 5GAMg 3VQYA 2I4OA
chains in the Genus database with same CATH superfamily
3EG9B 5GANg 3UGQA 4LVKA 4P72A 4KGVB 1WXBA 4P75A 1UHCA 1XQHA 4M78D 2DXUA 2QA4A 4C92G 3OW2S 5KE2A 1WU7A 1UUEA 3TUPA 1MV0B 2ZNIA 2E3CA 3QG1A 4F7UB 1P92A 4M75F 4PJOA 1RAEB 4BDZA 4M77B 2KQWA 5IXFA 2QHUA 2RJCA 3LH0A 2CZ7B 5GAN5 5I2MA 2Y4XA 4A4EA 2VASA 5LJ5j 1SRLA 11ASA 4A63B 4RTZA 1XNIA 3KXTA 4J7FA 2QTXA 1I81A 2RO0A 3CC2Q 1PG5B 3MF2A 2LQ8A 3CCUA 3REBB 3JCMX 3CCSQ 1SSFA 1SPKA 1GXIE 1PYSA 1VQ4T 3CCVA 2L3RA 3CCLA 3JB9J 1D0YA 2DZ9A 1ABQA 3M59A 1W4SA 1PSEA 1NJIC 2QYZA 1JB0E 4P73C 3G4SA 2VC8A 3ZL7C 4UP8A 3MO8A 1YJNA 1SHGA 1Y0MA 3VS0A 3EG9A 2QK0A 3G7ZA 1YJ9Q 2FHDA 1ASZA 4DPGA 1NLPC 4C0DC 1UDLA 1YFTA 3CD6Q 2FL7A 2DRMA 3ICAA 2DXCA 2KEAA 2M0YA 3CBPA 3L1AA 4C5GA 2JS2A 1ZBXA 1NPRA 3NEMA 3HFZA 1M9SA 1UGSB 1EFNA 1XTDA 2VWFA 4M77A 4ZN3A 3I56T 1LOJA 2MMPA 1O75A 1JJ2S 4K88A 4AFQC 2PUOB 3CCEA 4HCCA 1VQ9Q 3UATA 2EVRA 1VA7A 5AT1B 1I5OB 3WXMB 1M1KR 3OMGA 4AFUC 2EQMA 3VJPA 2FZKB 2L89A 4E7ZA 2XGTA 2H8HA 3QHSA 3QDFA 3PTAA 5ELNA 2CSIA 3JCMQ 1K8AR 4RMFA 2FO0A 3GNGA 2HNIA 4EMKB 4XTVA 2EJGA 4JRQA 2KRNA 4X9CA 1M2VA 2E64A 3JB9G 1BBZA 1X43A 4M7AE 4FCYA 4MMKA 2ZXFA 1M27C 1OYXA 2JMCA 3QJ6A 3CC4T 4C8QB 1GCQA 4IUTA 4KUIA 2YUNA 5HK3A 4F7UE 4RMOA 4AG1C 1NPPA 3VBBA 1BU1A 1UECA 1Q82C 1VOMA 2RJEA 4MZTA 4PK4A 3JCMh 1FWZA 4DOWA 1H3HA 2MWPA 2K9GA 1ZSZC 4VUBA 4RCCA 2QHVA 5K1XA 5FU6B 3ULRB 3H9NA 3VQVA 1D1AA 1VQ5T 1ZUKA 3RMSA 3V8JA 3QPHA 1PKTA 2KRMA 1TTHB 2VUBA 3D7SB 4TVAA 1U1SA 1GRIA 4PJNA 5KYUB 1IHWA 4EMKA 3E9IA 2RA2A 1I4K1 1H641 4O6JA 5GAN2 3M4PA 1X6OA 3RUXA 4QVCA 3M0PA 1FMWA 2EYWA 3S3OA 4J9FA 4MDXA 2EIFA 3MP6A 4M75A 2KMTA 4D6WA 4NL3A 1VQMT 1KC8U 3EG3A 2A37A 1VQPQ 1Q7YC 3UA7A 1KD1R 5J39A 3CCQA 3PIPA 3A1PA 4DA4A 2DE0X 5CQYA 3G71T 4CRIA 1M2OA 3EFOB 1YBYA 2HDAA 4TVRA 2DD4A 1QKXA 3OYGA 5FRMA 3MPUB 4HKEA 1W66A 3QWYA 3JCMP 1B70B 2HKQB 1BCMA 4FW2A 4CC2A 3CEYA 5I22A 3H0IA 3RDVA 5GMKj 1X56A 2QTVA 3RMQA 2KXDA 1G5HA 3HL8A 3C94A 2A7YA 3M0UA 2EW3A 1I07A 2C0IA 2DYIA 2KROA 2M1HA 4UC4A 5KYXB 1CKAA 3OA6A 4ZTUB 2K3BA 4BI3A 1VQLA 1FMVA 1YJWA 5KYUA 1YI2A 2NUPB 3OYIA 1QP3A 1M4ZA 5IAYA 1VQ6Q 1NE8A 1K73C 2M9UA 4LVJA 1D09B 4ESRA 4J8OA 4JS4A 4C8QE 3P8VA 3HRUA 2V1RA 1SF9A 2R5MA 3QO3A 2IIMA 3CXCP 3CCRA 4JRPA 2YLCA 1OPKA 5HGQA 3DB4A 3FC3A 3FDRA 1TG0A 3EFOA 2E5AA 4DEYA 4RG8A 2EQUA 4DEXA 1OQKA 2CIMA 4M77D 4A54A 1K9AA 2BE9B 4LN2A 1PRLC 1YFNA 2Z0WA 4KUDK 2LVMA 2I4NA 5I11A 3CMET 3QZ5B 3JCMg 3REXA 1NNHA 4BW9A 4ATOA 4OMPA 3A7AA 1N8RR 1G51A 4RTTA 2HD0A 2HQHA 3PT9A 2CKKA 5KYXA 5M9OA 1XOVA 2JMAA 1NBEB 1T3SA 1YP5A 2LRQA 2RB6A 3QJYA 5LJ3f 4D8DA 4H2XA 2FPEA 1LVKA 2NUPA 4M7AC 2Q7GA 1WLEA 2D8JA 1WYXA 1RABB 5A0LA 1WI7A 2L2PA 4B6MA 2RHXA 3SDZA 1VQOA 1YHQA 2OTJA 4EO4A 1GBQA 3A74A 3OYBA 1KSWA 1MMNA 4KRTA 3TSZA 1AZEA 4N0AA 1UE9A 1NG2A 5CO7A 4PJMA 5GAMh 2GNCA 2FPDA 1M5Q1 4LVLA 1VQ7Q 1U06A 4Q15A 2LQKA 1IREB 3UH0A 2DTOA 5GMKm 2FRYA 1V76A 4OGCA 3GNFB 2P5IA 3PFSA 2QGFB 4NOYA 2JVVA 4JLGA 1YFSA 2COZA 4E7HA 1B76A 5KCOA 2DJQA 1VQ8T 1TUCA 2CH4A 4FM4B 5CR2A 4E6RA 4MZPA 3R6NA 2LT4A 2DF6A 4H2VA 1I0CA 3M0SA 2XHCA 5CAIA 1JXOA 1PD0A 1UEBA 3OS2A 3LC0A 4IIOA 2Q7HA 4J9EA 1X2QA 1OZ3A 1H4VB 3CXCA 3MEWA 5LJ3e 4QVDA 2JM9A 3BFMA 1M1KC 1ZX6A 4OMNA 4LDYA 4C8QD 1GGMA 3TEHA 4M7DE 2RHIA 1YIJA 2ZZEA 4C0DB 5KYYA 1TU0B 2GGRA 1K8AC 1QKWA 4YCUA 3HFNA 4H2SA 1VQKA 2DXTA 2ZPIB 2CDTA 4PJJA 5CKEA 3QNEA 1W2BS 3E1SA 1Q86R 4HCBA 5FU7C 1HSQA 3DLMA 3CCMA 2AMCB 5KNNA 3X24B 1YITT 5GJWB 3IKLA 2GFAA 2E41A 4L59A 2E5KA 3M55A 1KHCA 2Y4YA 3TREA 4YRKA 4C0GA 4Z02A 1USYC 4YYEA 2V8KA 8ATCB 3EHRA 3HXXA 4C8QC 1KFZA 4PFOA 1LYLA 2K5LA 1K9MR 2DIQA 1G83A 3CCJT 1GFDA 4EIKA 1KHIA 1R0CB 4H2YA 1WX6A 1VQ4A 4P73A 1IRXA 5L8RE 3NELA 4J6XA 1H8KA 2R58A 2ALYB 3TEEA 4YRQA 4YCWA 4HT9A 4HWOA 1QVGS 4A4HA 3A8MB 5CKDA 2MAMA 5GAMg 2HSEB 4RTUA 2JW4A 2FEIA 3QDRB 4BD3A 2I4OA 2XD0A 4RKUE 4JRKA 3HXZA 2AMCA 2EYXA 3A5ZB 4M4ZA 3J80E 3M0QA 4WJ3M 4WTOB 1ZSZB 2X4JA 1BK2A 1KD1C 4LUDA 3I56A 4QQGA 4F14A 4XTUA 3JCMf 2DPPB 2NS6A 3EG2A 3UGTA 1HK9A 2RMOA 4PFZA 4J9IA 1KQSS 2GTOA 4YRNA 3G6EA 4DBHA 3CC2T 1UJYA 3E19A 5J3BA 2RQUA 3CCST 2PUKB 2HCKA 4LXCA 4BDYA 1WYDA 2VB6A 4RQFA 4QKUA 3X20B 5ECAA 2XDPA 2KRSA 2JS0A 1WHJA 1ZBJA 1YWPA 5FLXE 5D6YA 4J83A 4YCVA 1MGQA 1H4QA 1KK7A 3L2UA 1ZUUA 3LWIA 1HC7A 4LNPA 3ERRA 1OX8A 2BZXA 2H3JA 1YJ9T 2J6FA 4JJCA 3OY9A 4M7AF 1SG5A 2A28A 3CD6T 3CC4A 1X6GA 2K2MA 3CPWA 1NJ1A 4GLKA 4IUPA 4CH6A 4F7UF 4MMLA 3NTIA 4OMFB 1Q81U 4HT8A 1N9SA 4R0KA 1WXUA 3EGDA 3A5ZA 2I0NA 2ZT7A 4X5OA 1ZSZA 2OI3A 4EPCA 1V1CA 4F16A 3M0RA 2EGAA 2CJAA 1BB9A 1N5ZA 2E3HA 2EWNA 1QCFA 2D6FA 1QP2A 1WHKA 4M78G 4AFZC 1YNZA 2A3LA 1UG1A 4E51A 5LJ3j 1OI1A 1VQ5A 3VRYA 1ABOA 3E9FA 3JCMe 5F5WA 1LNXA 3A31A 4M7DC 2ZPBB 1M1FA 2BE7D 1FXXA 4YRTA 2GBQA 3SFMA 4HWRA 1MNDA 1N8RC 1YITQ 2JTMA 2ZZDA 2PU9B 1IZ6A 1UGVA 2KYBA 3EFRA 1BI3A 1WDXA 3LWHA 5FROA 4RCBA 1VQMA 2RHZA 1A0NB 2K6DA 4N4HA 5KCHA 4PFPA 5GJVB 5IHIA 2ZCEA 2ZPEB 1K4US 1RAGB 5CKFA 3G71A 2MIOA 3FLGA 4C92E 1BKBA 3A32A 1YB3A 4YROA 4CH5A 2IVWA 1WIEA 1Y71A 1ACMB 3VQXA 2LJ3A 2DQ3A 2LNHB 4WCIA 2KR3A 4EMGA 6AT1B 2BKDN 2HSPA 4FYXB 3META 2GFUA 2RHQB 1G2BA 2QHTA 1NJIU 3JCMV 4RTVA 3UA6A 5GMKl 5GAN7 2XMFA 1ZHIA 3MCAB 4M7AB 1VYUA 1D0XA 2DRKA 2P0PA 3TSWA 3IALA 1NJ8A 1CSKA 4KR3A 1LJOA 2OJ2A 1JXMA 1RADB 5IT9E 4OB3B 1VQPT 4C8QF 3P8HA 2QHSA 1VQNT 1JJCB 4NCXA 4ZIBA 2B86A 1NLOC 2CZ6B 3H0HA 4PLIA 3MQZA 3OYAA 1VIFA 1VYVA 3OYFA 2E1HA 1D1CA 3OYKA 3SB2A 2GQVA 2NUZA 2QGGA 1IXDA 5L23A 1X27A 5KYWB 5DM7R 3M57A 3EGXB 4GLMA 3OS5A 2RQTA 3LSQA 1QF6A 2J3LA 2AT1B 3M53A 4B9XA 4N4GA 3L2ZA 4JJBA 2WSEE 4PHCA 1AZGB 3CMEA 2RHQA 1Z9ZA 2HL5C 4HWTA 2RK2A 2MOXA 2X35A 4OB2B 3R6OA 3OBWA 2DQ0A 4E7SA 1TH7A 4O5VA 4M7AA 1M90R 3CMAT 2DM1A 4XTYA 1X01A 2COYA 1YGBA 4CS2A 1AVZC 1G3YA 1VQ6T 1BBUA 1PC0A 5LJ5h 2ROTA 2ED0A 4F7UA 2X3XD 4BUGA 1NEGA 5DLQE 3HFOA 3MP1A 3L2VA 4F17A 3Q1JA 1Q82U 1WXTA 1AWJA 3QO5A 4ZNXA 4OP0A 2BIVA 1AWOA 1VUBA 4BI8B 4OMQA 1ADJA 2QEXQ 1K9MC 2XKOC 1WHHA 3PCOB 2C0OA 2ZPGB 1D3BB 3MEYA 3LLRA 3A8HB 4LVIA 3LYIA 2EGEA 3CBOA 2O9SA 5FU7B 3VUZA 1IGUA 4C0FA 5KYWA 2DL3A 4J9CA 3NHNA 4BY6B 4YRPA 1RAIB 2QQ9A 1M3AA 4OB0B 4Y91A 2KGTA 1XJWB 4HVUA 5GAMe 4TQDA 3LW5E 1W2BP 1VQ8A 2ARUA 1JQQA 3PMTA 1NYGA 3OYCA 1I5LA 1WGSA 2K5IA 1NJ5A 2QQAA 3QXEB 4PJOG 1ARKA 2L8DA 2ZGWA 2YXYA 1Q7YU 4E7IA 2JZ2A 3NTHA 1D1BA 4MDWA 1BYMA 2ZINA 1WQWA 4FL6A 3RKYA 4CC7A 2RHSB 4PNOA 2BZYA 1UGRB 1RI0A 2YSQA 2RK1A 4C92C 1JBMA 2QASA 1TSFA 4BACA 1RACB 3S3MA 2F5KA 2RJFA 5I21A 3INZA 4M7DF 2CGHA 2DD5A 3PCOA 2KSSA 1VQ7T 2ZCFB 1S72Q 2YHTA 5C53B 4PKCC 1QVFS 2LZ6B 1WFWA 2DILA 3RERA 3FRNA 3GBQA 1RUWA 2CREA 2RQRA 3MP8A 3HXWA 1AD5A 1R77A 2OTLT 2ZZGA 1USYA 1OV3A 2DVJA 2K2VA 1K73U 1W6XA 2DMOA 2ZIOA 2XTIA 2A0FB 4C8QA 1VQNQ 2VVKA 3S6WA 5GANf 2HL3A 4M77G 1VQZA 4OMLA 2HKNA 2O01E 3JCMb 1TOVA 3IG2A 1G3SA 4Z89A 1E6HA 2LX7A 4JZ4A 3CCJA 1KQSP 4ORZA 1PHTA 3LGLA 3SEMA 4R56A 2RHSA 5LJ5g 1HJDA 2RNAA 2KY9A 4ELZC 1E1OA 2PVDB 1YCYA 2O2OA 3JB9D 3S3NA 2DIGA 1TS9A 2ECZA 4QVZA 5C6SA 2LJ1A 2JN0A 2OX7A 1B7YB 4HT4A 2YUPA 3I55Q 1YCSB 3TQ7P 1SEMA 2C0TA 4XAXB 4ZTFA 5HKCA 2CP5A 3OYMA 2MYSA 3I5SA 4LDVA 3OYEA 3CMAQ 2M02A 2I2LA 2L5QA 2C7IA 1Y96B 4YRLA 1PSFA 2L3QA 2IY5B 1GFCA 5A2QE 2I4MA 4QQDA 2LX9A 2PQWA 2ARTA 4RTXA 1EOVA 4XU0A 3VS6A 2HBWA 4OMMA 3VKIA 2AK5A 3H6ZA 2CUDA 2DEQA 2X4WA 1C1AA 4KT0E 4UP7A 3VS3A 5C51B 5CQXA 4M7AD 4ZTJA 2G6FX 3C0CA 1MUZA 2DERA 3RL6A 1VYTA 3CC2A 1X55A 4M7DB 5GMKh 4YRSA 2GCXA 3CCSA 2IPOB 4IIMA 3G1ZA 5GANe 4WF2A 3ZBDA 1B70A 4HXJA 4JUVA 2ED1A 2KT1A 1G3TA 1ADYA 12ASA 4P3PA 2FZCB 3RESA 1YJ9A 3CC7Q 4HWPA 2PVGB 1OU8A 3OBYA 3QKJA 3PMIA 2O31A 2RPNA 3CD6A 3EH2A 4FIBA 4AH6A 2EGCA 3EH1A 4M75G 2J05A 5IHNA 5FWCA 2V8JA 1Y96A 4UP9A 4X1VA 2IY5A 4E2FB 1SESA 1I8FA 2WSCE 2KK4A 3X26B 3VQYA 1VQ9A 2DLPA 1E24A 3ASKA 1RI9A 3SWNB 4KH1B 1M1KU 4ZGEB 2RHYA 4M7DA 4A4KA 3DKMA 4A4GA 4K11A 4IUUA 2RI2A 4G84A 1K8AU 5CIUA 1H3ZA 2SRCA 4Z88A 3LX7A 2CZ1B 3CCET 2E3IA 5FWBA 5ELOA 3VYHB 2ZR3A 2JTFA 2LNVA 1RIQA 3NPFA 3OYNA 3NENA 1L0WA 2OTLQ 1SETA 3OW2P 1T0HA 1HTTA 1YFRA 4Q6GA 2HEQA 1M90C 2DO3A 5GAN4 2L3SA 3RKXA 2DU5A 5DY9A 1RAFB 2DBKA 3RACA 4C92F 1QQJA 2K79A 2LCSA 5CK9A 3HRIA 4OB1B 4X9DA 4LNSA 5GANd 4PLLA 1KMNA 4GBQA 2DJZA 4C5EA 4J9HA 1HXDA 2ZNJA 4P74C 1K76A 1W70A 1IO6A 1MMGA 2QAZA 2H3EB 2K3XA 2J06A 3J7AF 4FSXA 2M51A 2DETA 3A8GB 1MV3A 2VKNA 4BY6C 2W10A 3HTRA 2F1LA 2ZPFB 2DVEA 3RNJA 3P8BB 3R07A 4IUQA 1U5SA 4LUEA 3GOXA 2G4CA 2D0QB 2XDDA 4YPFA 1T0JA 3G1JA 5LJ5f 1VQPA 1QWEA 3EGUA 3L2WA 1K1ZA 4YRRA 1WQ7A 2D8HA 1ZLMA 2QA4Q 1KD1U 1SERA 4BI4A 3L2RA 2ATCB 2Q5HA 1TUGB 2MCNA 1C6VX 3QUIA 1JJ2P 1MMDA 1LPLA 4P71C 2M0OA 2JTEA 4CC3A 5GAN8 4XQ3A 1PRMC 2EQJA 2GTJA 2DL7A 1NEBA 3PNWC 2K7AA 1O9SA 2LQWA 1EFWA 2O88A 4V2SA 1SHFA 4PL6A 4X34A 1FX7A 1WPYA 5GANj 1H4SA 4JPBW 3URGA 3CCUQ 2QXFA 2YWWA 4MZMA 2LMJA 1JEGA 4BB7A 1D0ZA 4J9DA 3M9QA 3CCLQ 1X75C 2QI2A 2LJ0A 9ATCB 4C5IA 2Q7EA 3JV3A 1VQ6A 4P5NA 3AT1B 3G4SQ 3OW2A 4C92B 1YJNQ 4HVWA 2J7IA 2KXCA 2EYYA 2XICA 4FYYB 3JCMc 5LJ3d 2C06A 1C0MA 3HXUA 3JB9F 2DXBA 4HCKA 1B34B 1UGQB 3MHXA 4IUVA 5LJ5e 3RIRA 4YDQA 2XU8A 5FW9A 2EJFA 1C0AA 1KG1A 1UFFA 2QDYB 1E7OA 4E7JA 4HVVA 4FSSA 5IXBA 3CCEQ 3EHQA 3OYYA 4HA8A 3AHUA 1Z7NA 1BIAA 1QVFP 2ALYA 3KUFA 4XEOA 1UTIA 4M78E 2LTOA 3HRKA 1J5WA 2E6NA 1N8RU 4M7DD 4P3OA 2JUFA 2SEMA 3A5YA 1LCKA 2I4LA 3TU4K 2XI9A 5C0MA 3EG0A 1EVLA 3M0TA 4DOVA 3CBMA 3VRZA 1AWXA 2E65A 4C92A 4RTWA 1K0XA 3OYHA 2X51A 4Y92A 1OX9A 3V7SA 4XTWA 1JJ2A 3QIIA 2QEXT 1X69A 1TXQA 2RQWA 4JJNK 4BWAA 3I9QA 5D6XA 1EZZB 5GAOq 3CXCS 1B8AA 4AFSC 2HAXA 1VQ7A 1YHQT 3C95A 1H4TA 1G3WA 1PKSA 3PGGA 5I2SA 2FG0A 1AEYA 4XU1A 4YP0A 1YN8A 3KBGA 1PD1A 2OTLA 2F2VA 3QO8A 1GL5A 1EIYB 4XTZA 2XK0A 3UPUA 3IQLA 3M58A 3ZEHA 4BE0A 3P8TA 2J3MA 1W1FA 2NUTB 5HK0A 3P8DA 4Y28E 2DFUA 2KVQG 2LCLA 3GLXA 2HZYA 4PJOB 3EG1A 1KC8R 2CUBA 2CH4W 1Z7MA 3CQTA 3VU3C 2JNGA 4C5HA 2KI7A 3M5AA 1WLPB 2ABLA 2ARSA 1WA7A 4BE2A 4YRGA 3CCQQ 3U23A 2OAUA 4YREA 4L87A 4KULA 2JJ9A 2RH2A 2YRCA 3A98A 4FU6A 1U3OA 1X2KA 3HRSA 1S72T 3OSSC 3SWNC 3FEOA 4OF1A 4A4FA 4QQ6A 4YRMA 3O8VA 4YRCA 1E22A 1PYSB 1M8MA 2NLUA 5A0GA 4HVCA 4RQEA 4RG2A 1Q86U 2YUQA 1ASYA 1UJ0A 2K57A 1WNLA 2E70A 4NL2A 1QCOA 3RR6A 4TQFA 2RD1A 3HXYA 1EIYA 4E7KA 1VQKT 3FB9A 3FJ5A 1PWTA 1AHJB 1VQLQ 1ZQ1A 1YJWQ 2ZR2A 2EYQA 3CCMT 1YI2Q 1NJ6A 2VXEA 2AKWB 2NUTA 4N4IA 3HFZB 1GCPA 2AKLA 5E3IA 1BI0A 4R55A 5GAMf 3VS1A 1K9MU 4B9WA 3JCMd 1QW1A 2R57A 1RAAB 3HPWA 2P0LA 4CH3A 1TWBA 3H0FA 3MEUA 3CCRQ 4OGEA 2DX1A 4ZTZB 4FYWB 5GAOm 3I55T 5K1PA 4KGXB 5GMKe 1ATIA 4XU3A 3HRTA 4YRIA 2DEUA 2RQVA 1Q86C 2JXBA 2BZ8A 1GBRA 4M78C 1MNEA 3QZ9B 1NYFA 3CMQA 2CZ0B 3OYDA 4L5GA 2XG8D 1M2VB 1QCNA 4TVWA 4KBMB 2QQBA 4FYVB 2EYZA 3BDUA 3CPWS 4CS3A 1AOJA 1JJCA 1PCXA 3RGLA 3BW1A 5LL6S 5HCKA 4FT2A 4PJOE 2BUDA 4TVYA 4BE1A 2VGMA 2LT1A 3NTKA 2AKWA 4DBQA 1Y07A 1X6BA 3M54A 1VQOQ 5CKBA 1YHQQ 4C92D 3EGXA 3C4SA 1EIFA 2OTJQ 1FMKA 2DTIA 1E1TA 3G6ET 2XDBA 2DU7A 3DSQA 5GAN6 5LJ3g 3CC7T 3ME9A 4H2TA 2KT8A 1WHLA 2QQSA 4TVAB 1U1TA 2DL4A 3H8ZA 2DDZA 1I1JA 3A8LB 5GAOn 1MMAA 4J6WA 3LGFA 2VV5A 3N5BB 2CT4A 1PM3A 3T9NA 3TCJA 1RLQC 4JZ3A 3RKWA 2D9TA 4M75B 5IH2A 1ZSGA 2JT4A 3MEVA 1NZ9A 3VYGA 2DNUA 2X3WD 2HMAA 3E9HA 3NGPA 4H02A 3VQWA 2CJBA 4P74A 4LDXA 3L42A 2F2XA 4M77E 5GAOp 1X2GA 2CT3A 4ZGJB 1D3BA 3EFSA 2DK3A 2DA9A 1OOTA 1X54A 4ELYC 4TWAA 2LC4A 4JJDA 2FYKA 1SRYA 1QVGP 1WJQA 1R0BG 3V7RA 1YIJQ 1YITA 4M7AG 1KOGA 1S1NA 2F69A 1VQKQ 2Y90A 4F7UG 3FIFA 5J26A 2KE9A 2MPXC 2X4XA 5HY6A 5EG2A 4QW2A 3CCMQ 2AZSA 4P71A 4ZGDB 1BI2A 1N27A 2O4XB 4ZN1A 2ODRD 2YDLA 2K3YA 2CP3A 2WSFE 4LD9K 2V26A 2E5QA 1X2HA 4WJ4A 2ZZFA 2OAWA 3L4GB 2P0QA 2EBPA 1B07A 4XU2A 4ANJA 5GAMd 2QQRA 1KIKA 3JRZA 4PJOD 3MJXA 1VQ4Q 1CKBA 3MKDA 2X4YA 3I5RA 4KGZB 3X28B 2MWOA 1W2BA 5C52B 2E4HA 1BBWA 2CP7A 1EQRA 2ODRC 4J7IA 3J81E 4IKFA 2Q5IA 3MEAA 2R5AA 4D8KA 1V29B 2AZVA 1K0SA 1R8OB 3LSSA 2QA4T 4H2XB 1NM7A 4P72C 3QSUA 4P75C 3TVTA 1FYNA 3QYGB 2K5FA 1YWOA 1OZ2A 4M75E 3V8LA 2DTHA 1KC8C 4LDUA 2O4XA 1M3CA 1M1GA 1FYFA 5KE3A 2D0NA 3VV0A 4PJOC 3UF4A 3W3SA 3I56Q 3M56A 3H41A 3M4GA 3L4GA 3PVQA 3G6EQ 1QE0A 3JB9H 1B7YA 3L2QA 4M78F 3CCUT 2CSQA 1PNJA 1QMCA 2EJ9A 2J6OA 3E2UA 2AIRB 3OSVA 3CCVT 3CCLT 1QVGA 4L6V5 1JRIA 2NYSA 2EPDA 2DKGA 5GAMj 1M90U 2A36A 3HXVA 3G4ST 5FRNA 2ZT5A 3QYHB 4C8QG 2QG9B 3KFVA 1YJNT 2FZGB 2FVUA 3DB3A 1BI1A 3BE3A 3VS2A 4F04B 3CC4Q 4OLFA 4C0ZA 1Q81R 4PJLA 2LDMA 4KR2A 2QEXA 3UDCA 2G3RA 1KQSA 3THKA 4CH4A 2B8AA 4CS4A 4RDXA 1JU5C 1KMMA 4M77C 2VGNA 1M8VA 2RHUA 2CP6A 5D6WA 3TEHB 4XEMA 5GAOl 1J3TA 5GAOr 5KYYB 1SRMA 2RI3A 3GIBA 1NJ2A 4K86A 3V8KA 1VQ5Q 4YRJA 2KAFA 3OB9A 1WJRA 4XK8E 1AWWA 2ROLA 3VS7A 3M4YA 1MHNA 3REUA 2PNIA 3QWXX 1WHMA 1RLPC 2JOYA 3OQ5A 5D7UA 4J5YA 1N9WA 3PVLA 3TEGA 2YLBA 3JCMJ 2L0AA 2X9HA 5DLOA 3F70A 4G85A 1VQMQ 2DL5A 3HSBA 2JM8A 1EVKA 3JSCA 1GCQC 4Z8AA 1RL2A 3SWNA 5KH6A 3G71Q 3A7UA 2MF2A 4II1A 5A0DA 2PTKA 1S72A 4AG2C 4M78B 3HY1A 3HY0A 2WACA 4M75D 4J9GA 2AKKA 4JS5A 5CCAA 7AT1B 1BIBA 1KQ2A 1WJSA 2GQIA 3PIOA 3X25B 1NJIR 1BCOA 3WQZA 3QTCA 3O5ZA 1KQ1A 2EQKA 3HHTB 4TTVA 1VQNA 4DBRA 1OEBA 3EAEA 5GMKi 2ZIMA 4PG3A 4OVAA 2DBMA 1AT1B 4CI0C 1T3LA 1DJ7B 1M30A 2ENMA 8AT1B 3CPWP 3JB9I 2K4YA 3KFUA 1QWFA 2EAYA 4EMKC 3MF1A 4JDSA 4H2UA 1Q95G 3UFGA 5AYFA 1B3QA 4DBFA 3VS4A 4M75C 3CCQT 1G5VA 4KQEA 4M7DG 4J6YA 2YT6A 4RUGA 2LP5A 4H2WA 3V7CA 1UB4A 4DQ2A 3BJUA 2HQEA 3PZCA 2IG0A 2AHJB 2DZCA 2DAQA 5CKHA 2CS7A 3REAB 2PMEA 1ZUYA 3I55A 3SD4A 3RF1A 4J9BA 2C8MA 3OS1A 1QVPA 4M78A 1H92A 1IL2A 3CCVQ 4JLIA 4YTLA 2LQNA 2KYMA 3CMAA 2V1QA 1G5IA 1HD3A 3HFVA 2ZT6A 2KDSA 4J15A 3OMCA 1NYRA 4HWSA 2XIDA 2FPFA 3CMEQ 1JO8A 3NMZC 1Y57A 5FU6C 2RF0A 1WHGA 4FT4A 3RBBB 2HQXA 1VQLT 4LVMA 1YJWT 1OULA 2KNBB 3FJPA 1SSHA 1YI2T 2ZTGA 4A53A 4PJOF 4P3NA 1ZA2B 3I35A 4OMOA 5CVIA 3EGDB 4AMCA 3OYJA 4E7LA 2EL9A 4RTYA 2RM4A 2LCCA 2PZ1A 1Q82R 3NETA 4WI1A 2ZPHB 3GF5A 1B7TA 1IGQA 1WZOA 4FW1A 5GANh 2CYZB 2VYTA 2NWMA 3CCRT 1RAHB 3SHWA 4LDWA 3UT1A 4UPAA 3BY7A 5GAN3 2ZT8A 2P4TA 2J6KA 3CC7A 2O9VA 2DL8A 2P84A 3P8YA 3E9GA 1ZA1B 4JRIA 1EX4A 2ZAEA 4XTXA 2E10A 2P4RA 2F2WA 3I7FA 4HCZA 4YRFA 3GP8A 2L3PA 5KYNA 3QBYA 3PE0A 1VQ8Q 2DYBA 3CPFA 1QLYA 2RJDA 5IHKA 2FB7A 2HBPA 1Q7YR 1B34A 2YRVA 4EX5A 3IKMB 3VS5A 2EKOA 4K87A 3LH5A 2EKHA 2M16A 3GPLA 4M77F 3ER0A 1UHFA 3VUBA 1VQOT 1UGPB 2F5TX 2E6ZA 1M3BA 2OTJT 2MK5A 4KH0B 1VQ9T 2QDLA 1F1BB 2KBTA 3HP9A 2W0ZA 1IB8A 2CP2A 2D1XA 2GF7A 2VXFA 3A7RA 5EC7A 4N0AC 1TUDA 4EMHA 3BDLA 3ZFJA 2COWA 2RI5A 2CP0A 5IN1A 3JCMW 3HKSA 3QO7A 3OYLA 4E47A 3NFCA 2EFIA 1N9RA 4CC4B 1HYOA 2EQIA 2P0KA 1SKUB 4Q5WA 1KJWA 5LJ5d 2YRDA 4QT7A 1K73R 2FRWA 3DLLA 5LJ3h 2YUOA 2PMFA 3OS0A 1N6AA 4LD6A 2RN8A 1Q81C 1VIEA 3A8OB 2CJ9A 1Y7XA 2ESWA 4IURA 1OPLA 1Z9QA 3WVEB 2E12A 3JAME 4AT1B 3HTZA 3WVDB 3M4QA 1E6GA 2V8IA 3CCJQ 4EDUA 3UWNA 3C12A 1IHVA 1OU9A 2BTTA 2A08A 4GY5A 1G8XA 1QVFA 1NYQA 4O2DA 4LE9A 1YIJT 4NS5A 3OD1A 2MI6A 2A8EA 4ME7A 2PVOB 1U8RA
chains in the Genus database with same CATH topology
5GANg 3UGQA 4LVKA 4P72A 4P75A 1XQHA 4M78D 2DXUA 2QA4A 4C92G 3OW2S 5KE2A 1WU7A 3TUPA 2ZNIA 2E3CA 3QG1A 4F7UB 1P92A 4M75F 4PJOA 4BDZA 4M77B 2KQWA 2QHUA 2RJCA 3LH0A 2CZ7B 5GAN5 5I2MA 2Y4XA 4A4EA 5LJ5j 11ASA 1XNIA 3KXTA 4J7FA 2QTXA 1I81A 2RO0A 3MF2A 2LQ8A 3CCUA 3JCMX 1SSFA 1GXIE 1PYSA 1VQ4T 3CCVA 2L3RA 3CCLA 3JB9J 2DZ9A 3M59A 1W4SA 1PSEA 1NJIC 1JB0E 4P73C 3G4SA 2VC8A 4UP8A 3MO8A 1YJNA 3G7ZA 2FHDA 1ASZA 4DPGA 4C0DC 1YFTA 2FL7A 3ICAA 2DXCA 3CBPA 3L1AA 4C5GA 1ZBXA 1NPRA 3NEMA 3HFZA 1M9SA 1UGSB 1XTDA 4M77A 4ZN3A 3I56T 1LOJA 2MMPA 1O75A 1JJ2S 4K88A 2PUOB 3CCEA 4HCCA 3WXMB 3OMGA 2EQMA 3VJPA 2L89A 2XGTA 3QHSA 3PTAA 5ELNA 3JCMQ 4RMFA 3GNGA 2HNIA 4EMKB 4XTVA 2EJGA 4JRQA 4X9CA 2E64A 3JB9G 4M7AE 4MMKA 2ZXFA 1OYXA 3QJ6A 3CC4T 4C8QB 4IUTA 4KUIA 5HK3A 4F7UE 4RMOA 1NPPA 3VBBA 1Q82C 2RJEA 4MZTA 3JCMh 1FWZA 4DOWA 2MWPA 4VUBA 4RCCA 2QHVA 5K1XA 5FU6B 3VQVA 1VQ5T 3RMSA 3V8JA 3QPHA 2VUBA 4TVAA 1U1SA 4EMKA 3E9IA 2RA2A 1I4K1 1H641 4O6JA 5GAN2 3M4PA 1X6OA 3RUXA 4QVCA 3S3OA 4MDXA 2EIFA 3MP6A 4M75A 2KMTA 4D6WA 4NL3A 1VQMT 1KC8U 1Q7YC 5J39A 3CCQA 3PIPA 4DA4A 5CQYA 3G71T 4CRIA 1YBYA 4TVRA 2DD4A 3OYGA 5FRMA 4HKEA 1W66A 3JCMP 1B70B 3CEYA 5GMKj 1X56A 3RMQA 1G5HA 3HL8A 3C94A 2A7YA 2M1HA 3OA6A 4UC4A 4ZTUB 4BI3A 1VQLA 1YJWA 1YI2A 3OYIA 1QP3A 1M4ZA 5IAYA 1NE8A 1K73C 2M9UA 4LVJA 4J8OA 4JS4A 4C8QE 3P8VA 3HRUA 3QO3A 2R5MA 3CCRA 4JRPA 2YLCA 5HGQA 3DB4A 3FC3A 3FDRA 2E5AA 4RG8A 2EQUA 2CIMA 4M77D 4A54A 4KUDK 2LVMA 2I4NA 3CMET 3QZ5B 3JCMg 3REXA 1NNHA 4BW9A 4ATOA 3A7AA 1G51A 2HD0A 3PT9A 2CKKA 5M9OA 1XOVA 2LRQA 4H2XA 2RB6A 3QJYA 5LJ3f 4M7AC 2Q7GA 1WLEA 5A0LA 1VQOA 2RHXA 3SDZA 1YHQA 2OTJA 4EO4A 3A74A 3OYBA 4N0AA 5CO7A 5GAMh 1M5Q1 4LVLA 4Q15A 2LQKA 1IREB 3UH0A 2DTOA 5GMKm 4OGCA 3GNFB 2P5IA 3PFSA 4NOYA 2JVVA 4JLGA 1YFSA 4E7HA 1B76A 5KCOA 1VQ8T 4FM4B 5CR2A 4MZPA 2LT4A 4H2VA 2XHCA 5CAIA 1UEBA 3OS2A 3LC0A 2Q7HA 1OZ3A 1H4VB 3CXCA 3MEWA 5LJ3e 4QVDA 1M1KC 3BFMA 4LDYA 4C8QD 1GGMA 3TEHA 4M7DE 2RHIA 1YIJA 2ZZEA 4C0DB 1K8AC 4YCUA 3HFNA 4H2SA 1VQKA 2DXTA 2ZPIB 5CKEA 3QNEA 1W2BS 3E1SA 4HCBA 5FU7C 3DLMA 3CCMA 2AMCB 5KNNA 3X24B 1YITT 3IKLA 2GFAA 2E41A 4L59A 3M55A 1KHCA 2Y4YA 3TREA 4YRKA 4C0GA 4Z02A 1USYC 4YYEA 2V8KA 3HXXA 4C8QC 1LYLA 2K5LA 2DIQA 3CCJT 1KHIA 4H2YA 1VQ4A 4P73A 5L8RE 3NELA 4J6XA 2R58A 2ALYB 3TEEA 4YRQA 4YCWA 4HT9A 4HWOA 1QVGS 4A4HA 3A8MB 5CKDA 2MAMA 5GAMg 3QDRB 2I4OA 4BD3A 2XD0A 4RKUE 4JRKA 3HXZA 2AMCA 3A5ZB 3J80E 4WJ3M 2X4JA 1KD1C 3I56A 4QQGA 4XTUA 3JCMf 2DPPB 2NS6A 3UGTA 1HK9A 1KQSS 4YRNA 3G6EA 3CC2T 3E19A 5J3BA 3CCST 2PUKB 4BDYA 1WYDA 4RQFA 3X20B 2XDPA 5FLXE 5D6YA 4J83A 4YCVA 1MGQA 1H4QA 3L2UA 1HC7A 3LWIA 3ERRA 2H3JA 1YJ9T 3OY9A 4M7AF 3CD6T 3CC4A 3CPWA 1NJ1A 4GLKA 4IUPA 4CH6A 4F7UF 4MMLA 3NTIA 4OMFB 1Q81U 4HT8A 1N9SA 3A5ZA 2ZT7A 4X5OA 4EPCA 2CJAA 2EWNA 2D6FA 1QP2A 4M78G 2A3LA 4E51A 5LJ3j 1OI1A 1VQ5A 3E9FA 3JCMe 5F5WA 1LNXA 3A31A 4M7DC 2ZPBB 1M1FA 1FXXA 4YRTA 3SFMA 4HWRA 1N8RC 2JTMA 2ZZDA 2PU9B 1IZ6A 3EFRA 1BI3A 3LWHA 5FROA 4RCBA 1VQMA 2RHZA 4N4HA 5KCHA 2ZCEA 2ZPEB 5CKFA 3G71A 3FLGA 4C92E 1BKBA 3A32A 1YB3A 4YROA 4CH5A 2IVWA 1Y71A 3VQXA 2DQ3A 4EMGA 2BKDN 3META 2GFUA 2RHQB 2QHTA 1NJIU 3JCMV 5GAN7 5GMKl 1ZHIA 3MCAB 4M7AB 2P0PA 3IALA 1NJ8A 4KR3A 1LJOA 5IT9E 4OB3B 1VQPT 4C8QF 3P8HA 2QHSA 1VQNT 1JJCB 4NCXA 4ZIBA 3MQZA 2CZ6B 4PLIA 3OYAA 1VIFA 3OYFA 2E1HA 3OYKA 3SB2A 2GQVA 5DM7R 3M57A 3OS5A 1QF6A 3LSQA 2J3LA 3M53A 4B9XA 4N4GA 3L2ZA 2WSEE 4PHCA 3CMEA 2RHQA 4HWTA 2RK2A 2X35A 4OB2B 3R6OA 3OBWA 2DQ0A 1TH7A 4O5VA 4M7AA 3CMAT 4XTYA 1X01A 1YGBA 4CS2A 1G3YA 1VQ6T 1BBUA 5LJ5h 4F7UA 4BUGA 5DLQE 3HFOA 3MP1A 3L2VA 3Q1JA 1Q82U 3QO5A 4OP0A 2BIVA 1VUBA 4BI8B 1ADJA 1K9MC 2XKOC 3PCOB 2ZPGB 1D3BB 3MEYA 3LLRA 3A8HB 4LVIA 3LYIA 3CBOA 5FU7B 3VUZA 4C0FA 4BY6B 4YRPA 2QQ9A 4OB0B 4Y91A 5GAMe 4TQDA 3LW5E 1VQ8A 2ARUA 3PMTA 3OYCA 1I5LA 1WGSA 2K5IA 1NJ5A 2QQAA 3QXEB 4PJOG 2L8DA 2ZGWA 1Q7YU 4E7IA 2JZ2A 3NTHA 4MDWA 1BYMA 2ZINA 1WQWA 4FL6A 3RKYA 2RHSB 4PNOA 1UGRB 1RI0A 4C92C 2RK1A 1JBMA 4BACA 3S3MA 2F5KA 2RJFA 5I21A 3INZA 4M7DF 2CGHA 2DD5A 3PCOA 2KSSA 1VQ7T 2ZCFB 2YHTA 5C53B 4PKCC 1QVFS 3RERA 3FRNA 3MP8A 3HXWA 2OTLT 2ZZGA 1USYA 2K2VA 1K73U 2ZIOA 2XTIA 4C8QA 3S6WA 5GANf 4M77G 1VQZA 2O01E 3JCMb 3IG2A 1G3SA 3CCJA 3LGLA 4R56A 2RHSA 5LJ5g 2KY9A 4ELZC 1E1OA 2PVDB 1YCYA 3JB9D 3S3NA 2DIGA 4QVZA 5C6SA 1B7YB 2JN0A 4HT4A 4XAXB 4ZTFA 5HKCA 3OYMA 4LDVA 3OYEA 2I2LA 2L5QA 2C7IA 1Y96B 4YRLA 1PSFA 2IY5B 5A2QE 2I4MA 4QQDA 2LX9A 2PQWA 2ARTA 1EOVA 4XU0A 3VKIA 3H6ZA 2DEQA 2X4WA 4KT0E 4UP7A 5C51B 5CQXA 4M7AD 4ZTJA 3RL6A 3CC2A 1X55A 4M7DB 5GMKh 4YRSA 2GCXA 3CCSA 3G1ZA 5GANe 4WF2A 3ZBDA 1B70A 4JUVA 1G3TA 1ADYA 12ASA 4P3PA 3RESA 1YJ9A 4HWPA 2PVGB 3OBYA 3QKJA 3PMIA 3CD6A 4FIBA 4AH6A 4M75G 2V8JA 1Y96A 4UP9A 2IY5A 1SESA 1I8FA 2WSCE 2KK4A 3X26B 3VQYA 1VQ9A 1E24A 3ASKA 3SWNB 1M1KU 4ZGEB 2RHYA 4M7DA 4A4KA 3DKMA 4A4GA 4IUUA 2RI2A 4G84A 1K8AU 5CIUA 1H3ZA 3LX7A 2CZ1B 3CCET 5ELOA 3VYHB 2ZR3A 2JTFA 2LNVA 1RIQA 3OYNA 3NENA 1L0WA 1SETA 1HTTA 1YFRA 4Q6GA 1M90C 2DO3A 5GAN4 3RKXA 2DU5A 5DY9A 3RACA 4C92F 5CK9A 3HRIA 4OB1B 4X9DA 4LNSA 5GANd 4PLLA 1KMNA 2DJZA 4C5EA 1HXDA 2ZNJA 4P74C 2K3XA 3J7AF 4FSXA 3A8GB 4BY6C 2ZPFB 2DVEA 3P8BB 3R07A 4IUQA 3GOXA 2G4CA 2D0QB 2XDDA 4YPFA 5LJ5f 1VQPA 3L2WA 4YRRA 1WQ7A 1KD1U 1SERA 4BI4A 3L2RA 2Q5HA 3QUIA 4P71C 2M0OA 5GAN8 4XQ3A 2EQJA 3PNWC 1O9SA 1EFWA 4V2SA 4PL6A 4X34A 1FX7A 1WPYA 5GANj 1H4SA 3URGA 2QXFA 4MZMA 4BB7A 3M9QA 1X75C 2QI2A 4C5IA 2Q7EA 1VQ6A 4P5NA 3OW2A 4C92B 2XICA 3JCMc 5LJ3d 2C06A 3HXUA 3JB9F 2DXBA 1B34B 1UGQB 3MHXA 4IUVA 5LJ5e 3RIRA 4YDQA 2XU8A 2EJFA 1C0AA 1KG1A 2QDYB 4E7JA 3OYYA 4HA8A 3AHUA 1Z7NA 1BIAA 2ALYA 3KUFA 4XEOA 4M78E 2LTOA 3HRKA 1J5WA 2E6NA 1N8RU 4M7DD 4P3OA 2JUFA 3A5YA 2I4LA 3TU4K 2XI9A 5C0MA 1EVLA 4DOVA 3CBMA 2E65A 4C92A 3OYHA 3V7SA 4XTWA 1JJ2A 3QIIA 2QEXT 4JJNK 4BWAA 5D6XA 5GAOq 3CXCS 1B8AA 2HAXA 1VQ7A 1YHQT 3C95A 1H4TA 1G3WA 3PGGA 5I2SA 4XU1A 4YP0A 3KBGA 2OTLA 3QO8A 1EIYB 4XTZA 2XK0A 3UPUA 3M58A 3ZEHA 4BE0A 3P8TA 2J3MA 5HK0A 3P8DA 4Y28E 2LCLA 2KVQG 3GLXA 4PJOB 1Z7MA 3VU3C 4C5HA 2JNGA 3M5AA 2ARSA 4BE2A 4YRGA 2OAUA 4YREA 4L87A 4KULA 2RH2A 4FU6A 3HRSA 1S72T 3OSSC 3SWNC 3FEOA 4OF1A 4A4FA 4QQ6A 4YRMA 3O8VA 4YRCA 1E22A 1PYSB 2NLUA 5A0GA 4HVCA 4RQEA 4RG2A 1Q86U 1ASYA 2K57A 1WNLA 2E70A 4NL2A 4TQFA 2RD1A 3HXYA 1EIYA 4E7KA 1VQKT 3FB9A 1AHJB 1ZQ1A 2ZR2A 2EYQA 3CCMT 1NJ6A 2VXEA 2AKWB 4N4IA 3HFZB 5E3IA 1BI0A 4R55A 5GAMf 1K9MU 4B9WA 3JCMd 1QW1A 2R57A 3HPWA 2P0LA 4CH3A 3MEUA 4OGEA 4ZTZB 5GAOm 3I55T 5K1PA 5GMKe 1ATIA 4XU3A 3HRTA 4YRIA 1Q86C 4M78C 3QZ9B 3CMQA 2CZ0B 3OYDA 4L5GA 2XG8D 4TVWA 4KBMB 2QQBA 3BDUA 3CPWS 4CS3A 1JJCA 3RGLA 3BW1A 5LL6S 4FT2A 4PJOE 2BUDA 4TVYA 4BE1A 2VGMA 2LT1A 3NTKA 2AKWA 1Y07A 3M54A 5CKBA 4C92D 3C4SA 1EIFA 2DTIA 1E1TA 3G6ET 2XDBA 2DU7A 3DSQA 5GAN6 5LJ3g 3CC7T 3ME9A 4H2TA 2QQSA 4TVAB 1U1TA 3H8ZA 2DDZA 3A8LB 5GAOn 4J6WA 3LGFA 2VV5A 3N5BB 3T9NA 3TCJA 3RKWA 2D9TA 4M75B 3MEVA 1NZ9A 3VYGA 3E9HA 4H02A 3VQWA 2CJBA 4P74A 4LDXA 3L42A 5GAOp 4M77E 1X2GA 4ZGJB 1D3BA 3EFSA 2DK3A 1X54A 4ELYC 4TWAA 2LC4A 2FYKA 1SRYA 1WJQA 3V7RA 1YITA 4M7AG 1KOGA 2F69A 2Y90A 4F7UG 3FIFA 5J26A 5HY6A 2X4XA 5EG2A 4QW2A 4P71A 4ZGDB 1BI2A 1N27A 2O4XB 4ZN1A 2ODRD 2K3YA 2WSFE 4LD9K 2E5QA 1X2HA 4WJ4A 2ZZFA 3L4GB 2P0QA 4XU2A 5GAMd 2QQRA 3JRZA 4PJOD 2X4YA 3X28B 2MWOA 1W2BA 5C52B 1BBWA 1EQRA 2ODRC 4J7IA 3J81E 4IKFA 2Q5IA 3MEAA 2R5AA 1V29B 3LSSA 1R8OB 2QA4T 4H2XB 4P72C 3QSUA 4P75C 3QYGB 2K5FA 1OZ2A 4M75E 3V8LA 2DTHA 1KC8C 4LDUA 2O4XA 1M1GA 1FYFA 5KE3A 3VV0A 4PJOC 3W3SA 3M56A 3M4GA 3L4GA 1QE0A 3JB9H 1B7YA 3L2QA 4M78F 3CCUT 2EJ9A 3OSVA 3CCVT 3CCLT 1QVGA 4L6V5 1JRIA 2DKGA 5GAMj 1M90U 3HXVA 3G4ST 5FRNA 2ZT5A 3QYHB 4C8QG 1YJNT 2FVUA 3DB3A 1BI1A 4OLFA 4C0ZA 2LDMA 4KR2A 2QEXA 3UDCA 2G3RA 1KQSA 4CH4A 2B8AA 4CS4A 4RDXA 1KMMA 4M77C 2VGNA 1M8VA 2RHUA 5D6WA 3TEHB 4XEMA 5GAOl 5GAOr 2RI3A 3GIBA 1NJ2A 4K86A 3V8KA 4YRJA 2KAFA 3OB9A 1WJRA 4XK8E 3M4YA 1MHNA 3REUA 2JOYA 3OQ5A 4J5YA 1N9WA 3TEGA 2YLBA 3JCMJ 5DLOA 3F70A 4G85A 3HSBA 1EVKA 3JSCA 1RL2A 3SWNA 5KH6A 3A7UA 2MF2A 4II1A 5A0DA 1S72A 4M78B 3HY1A 3HY0A 2WACA 4M75D 4JS5A 5CCAA 1BIBA 1KQ2A 1WJSA 3PIOA 3X25B 3WQZA 3QTCA 1KQ1A 2EQKA 3HHTB 4TTVA 1VQNA 3EAEA 5GMKi 2ZIMA 4PG3A 4OVAA 4CI0C 1DJ7B 3JB9I 2K4YA 3KFUA 2EAYA 4EMKC 3MF1A 4JDSA 4H2UA 3UFGA 5AYFA 4M75C 3CCQT 1G5VA 4KQEA 4M7DG 4J6YA 4H2WA 3V7CA 1UB4A 4DQ2A 3BJUA 2HQEA 3PZCA 2IG0A 2AHJB 2DZCA 2DAQA 5CKHA 2CS7A 2PMEA 3I55A 3SD4A 3RF1A 2C8MA 3OS1A 1QVPA 4M78A 1IL2A 4JLIA 4YTLA 3CMAA 1G5IA 3HFVA 2ZT6A 2KDSA 4J15A 3OMCA 1NYRA 4HWSA 2XIDA 5FU6C 4FT4A 2HQXA 1VQLT 4LVMA 1YJWT 3FJPA 1YI2T 2ZTGA 4A53A 4PJOF 4P3NA 5CVIA 3OYJA 4E7LA 2EL9A 2RM4A 2LCCA 3NETA 4WI1A 2ZPHB 3GF5A 5GANh 2CYZB 2VYTA 3CCRT 3UT1A 4LDWA 4UPAA 3BY7A 5GAN3 2ZT8A 2P4TA 3CC7A 3P8YA 3E9GA 4JRIA 4XTXA 2E10A 3I7FA 4HCZA 4YRFA 3GP8A 3QBYA 3CPFA 2RJDA 2FB7A 2HBPA 1B34A 2YRVA 4EX5A 3IKMB 2EKOA 4K87A 2M16A 3GPLA 4M77F 3ER0A 3VUBA 1VQOT 1UGPB 2F5TX 2E6ZA 2OTJT 1VQ9T 3HP9A 2GF7A 2VXFA 3A7RA 4N0AC 4EMHA 3BDLA 3ZFJA 2RI5A 3JCMW 5IN1A 3HKSA 3QO7A 3OYLA 4E47A 3NFCA 2EFIA 1N9RA 2P0KA 4Q5WA 5LJ5d 3DLLA 5LJ3h 2PMFA 3OS0A 1N6AA 4LD6A 1Q81C 1VIEA 3A8OB 2CJ9A 1Y7XA 4IURA 3WVEB 2E12A 3JAME 3HTZA 3WVDB 3M4QA 2V8IA 4EDUA 3UWNA 3C12A 4GY5A 4O2DA 1QVFA 1NYQA 1YIJT 4NS5A 3OD1A 2MI6A 2A8EA 4ME7A 2PVOB 1U8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X54 A;  1E24 A;  4JRK A;  5GAN g;  3UGQ A;  3HXZ A;  4TWA A;  2AMC A;  4P72 A;  3SWN B;  4P75 A;  2FYK A;  1SRY A;  4WJ3 M;  4M78 D;  2DXU A;  4C92 G;  4M7D A;  3V7R A;  1WU7 A;  4M7A G;  1KOG A;  3TUP A;  4XTU A;  3JCM f;  3UGT A;  2ZNI A;  2E3C A;  1HK9 A;  4G84 A;  4F7U B;  4M75 F;  4YRN A;  4PJO A;  5ELO A;  2Y90 A;  4F7U G;  4M77 B;  2ZR3 A;  3FIF A;  2QHU A;  1RIQ A;  3NEN A;  1L0W A;  5GAN 5;  1SET A;  1WYD A;  4P71 A;  4RQF A;  1HTT A;  1YFR A;  5LJ5 j;  4Q6G A;  11AS A;  2ODR D;  5GAN 4;  2QTX A;  1I81 A;  4YCV A;  3RKX A;  1MGQ A;  1X2H A;  3MF2 A;  1H4Q A;  2DU5 A;  4WJ4 A;  2ZZF A;  1HC7 A;  3JCM X;  5DY9 A;  3ERR A;  1PYS A;  3L4G B;  3RAC A;  4C92 F;  3JB9 J;  2DZ9 A;  4XU2 A;  4M7A F;  5GAM d;  3HRI A;  4P73 C;  1NJ1 A;  2VC8 A;  4X9D A;  4UP8 A;  4CH6 A;  4LNS A;  4F7U F;  5GAN d;  4PJO D;  4MML A;  4HT8 A;  1KMN A;  1N9S A;  2DJZ A;  1ASZ A;  4DPG A;  3A5Z A;  1YFT A;  1HXD A;  2ZNJ A;  4P74 C;  2ZT7 A;  4X5O A;  3ICA A;  5C52 B;  1BBW A;  2CJA A;  1EQR A;  3L1A A;  2ODR C;  2EWN A;  3NEM A;  4M78 G;  2Q5I A;  3HFZ A;  3LSS A;  4H2X B;  4E51 A;  4P72 C;  4M77 A;  3QSU A;  1LOJ A;  5LJ3 j;  4P75 C;  2DVE A;  3R07 A;  4K88 A;  3JCM e;  2G4C A;  5F5W A;  1LNX A;  3A31 A;  4M75 E;  3V8L A;  2DTH A;  4M7D C;  4YPF A;  5LJ5 f;  1FYF A;  4YRT A;  4YRR A;  2XGT A;  1WQ7 A;  4HWR A;  4PJO C;  1SER A;  3QHS A;  2Q5H A;  5ELN A;  3W3S A;  3JCM Q;  3M4G A;  4RMF A;  3QUI A;  3EFR A;  3L4G A;  2HNI A;  4RCB A;  4EMK B;  4XTV A;  4P71 C;  2EJG A;  1QE0 A;  5GAN 8;  3JB9 H;  4XQ3 A;  1B7Y A;  2ZCE A;  4M78 F;  2EJ9 A;  4X9C A;  2E64 A;  4C92 E;  3JB9 G;  3A32 A;  1YB3 A;  4M7A E;  4YRO A;  1EFW A;  1JRI A;  4CH5 A;  4MMK A;  4V2S A;  2ZXF A;  2DKG A;  5GAM j;  4C8Q B;  3HXV A;  3VQX A;  2ZT5 A;  2DQ3 A;  1WPY A;  4F7U E;  5GAN j;  4C8Q G;  1H4S A;  4EMG A;  3VBB A;  2RHQ B;  2QHT A;  3JCM h;  4OLF A;  2Q7E A;  3JCM V;  5GAN 7;  5GMK l;  4KR2 A;  4C92 B;  4M7A B;  4RCC A;  2QHV A;  5K1X A;  3JCM c;  5LJ3 d;  3VQV A;  4CH4 A;  3HXU A;  3JB9 F;  3IAL A;  1NJ8 A;  1B34 B;  3V8J A;  4CS4 A;  4RDX A;  4KR3 A;  1KMM A;  1LJO A;  4M77 C;  1M8V A;  4TVA A;  1U1S A;  3TEH B;  5LJ5 e;  4XEM A;  4C8Q F;  5GAO l;  3RIR A;  5GAO r;  4EMK A;  2QHS A;  3E9I A;  3GIB A;  1JJC B;  2EJF A;  2RA2 A;  4NCX A;  1I4K 1;  1NJ2 A;  1H64 1;  4K86 A;  5GAN 2;  3M4P A;  4ZIB A;  1C0A A;  3RUX A;  3V8K A;  4QVC A;  4YRJ A;  4M75 A;  2E1H A;  4HA8 A;  4NL3 A;  3SB2 A;  3AHU A;  1Z7N A;  1BIA A;  3REU A;  2ALY A;  4XEO A;  4M78 E;  3HRK A;  1J5W A;  4J5Y A;  1N9W A;  3TEG A;  2YLB A;  3LSQ A;  1QF6 A;  4M7D D;  2J3L A;  3JCM J;  4P3O A;  3L2Z A;  4G85 A;  4PHC A;  3A5Y A;  2I4L A;  2RHQ A;  3HSB A;  1EVL A;  4HWT A;  1W66 A;  1EVK A;  3JCM P;  1B70 B;  2E65 A;  3SWN A;  3A7U A;  4C92 A;  2DQ0 A;  1TH7 A;  4M7A A;  5GMK j;  4XTY A;  1X01 A;  1X56 A;  1YGB A;  4M78 B;  4CS2 A;  1BBU A;  1G5H A;  3V7S A;  3HY1 A;  5LJ5 h;  3HY0 A;  4M75 D;  4XTW A;  4F7U A;  4ZTU B;  4BWA A;  3HFO A;  1BIB A;  1KQ2 A;  5GAO q;  1B8A A;  3QO5 A;  4OP0 A;  3WQZ A;  1H4T A;  3PGG A;  3QTC A;  1KQ1 A;  1ADJ A;  3PCO B;  4TTV A;  4C8Q E;  4XU1 A;  3P8V A;  4YP0 A;  1D3B B;  5GMK i;  2ZIM A;  3QO3 A;  3MEY A;  4PG3 A;  3QO8 A;  1EIY B;  3JB9 I;  3KFU A;  2YLC A;  2EAY A;  4EMK C;  4YRP A;  4XTZ A;  3MF1 A;  5HGQ A;  4H2U A;  3UFG A;  4Y91 A;  2E5A A;  3P8T A;  2J3M A;  4M75 C;  4KQE A;  5GAM e;  4M7D G;  4J6Y A;  4TQD A;  2CIM A;  2ARU A;  4M77 D;  4H2W A;  3V7C A;  4A54 A;  4DQ2 A;  4PJO B;  1I5L A;  3BJU A;  3PZC A;  1NJ5 A;  2DZC A;  1Z7M A;  4PJO G;  3VU3 C;  2I4N A;  2PME A;  2ZGW A;  3JCM g;  3REX A;  1NNH A;  3RF1 A;  4BW9 A;  2C8M A;  2ARS A;  4YRG A;  4M78 A;  3A7A A;  1IL2 A;  1G51 A;  4YRE A;  4JLI A;  4L87 A;  2ZIN A;  1G5I A;  1WQW A;  3HFV A;  2ZT6 A;  3RKY A;  4J15 A;  4H2X A;  2RB6 A;  1NYR A;  2RHS B;  5LJ3 f;  4HWS A;  4PNO A;  3SWN C;  4C92 C;  4YRM A;  1JBM A;  1E22 A;  1PYS B;  4YRC A;  4M7A C;  2Q7G A;  1WLE A;  5I21 A;  3INZ A;  4M7D F;  2CGH A;  4HVC A;  4RQE A;  3PCO A;  3FJP A;  4EO4 A;  1ASY A;  2YHT A;  2ZTG A;  2K57 A;  4A53 A;  1WNL A;  3A74 A;  5C53 B;  4PJO F;  4P3N A;  4NL2 A;  4TQF A;  4N0A A;  2RD1 A;  3HXY A;  1EIY A;  3RER A;  3FB9 A;  5GAM h;  2EL9 A;  2RM4 A;  3NET A;  4WI1 A;  3HXW A;  5GAN h;  1M5Q 1;  2ZR2 A;  2ZZG A;  4Q15 A;  1NJ6 A;  2VXE A;  1USY A;  2AKW B;  2DTO A;  3UH0 A;  5GMK m;  3HFZ B;  5E3I A;  4UPA A;  3BY7 A;  2P5I A;  5GAN 3;  2ZIO A;  2XTI A;  5GAM f;  2ZT8 A;  4NOY A;  4C8Q A;  1YFS A;  3JCM d;  1B76 A;  5GAN f;  4M77 G;  1VQZ A;  3P8Y A;  2P0L A;  4CH3 A;  4JRI A;  3JCM b;  3IG2 A;  4XTX A;  2E10 A;  4ZTZ B;  3I7F A;  5GAO m;  5K1P A;  4YRF A;  5GMK e;  2RHS A;  4H2V A;  1ATI A;  4XU3 A;  5CAI A;  4YRI A;  5LJ5 g;  3LC0 A;  2Q7H A;  1E1O A;  4M78 C;  1YCY A;  3JB9 D;  1H4V B;  3CMQ A;  1B7Y B;  2JN0 A;  5LJ3 e;  2FB7 A;  1B34 A;  4QVD A;  4EX5 A;  3BFM A;  3IKM B;  4TVW A;  4K87 A;  4C8Q D;  1GGM A;  3TEH A;  4M7D E;  3BDU A;  4M77 F;  4CS3 A;  2ZZE A;  2I2L A;  2C7I A;  1Y96 B;  4YRL A;  1JJC A;  2IY5 B;  2I4M A;  4YCU A;  3RGL A;  3BW1 A;  3HFN A;  4PJO E;  2ART A;  4H2S A;  4TVY A;  4YDQ A;  2DXT A;  2AKW A;  1EOV A;  3QNE A;  4XU0 A;  2VXF A;  3A7R A;  4N0A C;  2DEQ A;  4EMH A;  4C92 D;  4UP7 A;  2AMC B;  5KNN A;  5C51 B;  3JCM W;  3IKL A;  4M7A D;  2E41 A;  3QO7 A;  3RL6 A;  1X55 A;  4M7D B;  2DTI A;  1E1T A;  5GMK h;  4YRS A;  4YRK A;  2DU7 A;  1USY C;  3DSQ A;  5GAN 6;  4YYE A;  1N9R A;  5LJ3 g;  3G1Z A;  5GAN e;  4H2T A;  3HXX A;  5LJ5 d;  4WF2 A;  4C8Q C;  1B70 A;  4TVA B;  1U1T A;  4JUV A;  2DDZ A;  5LJ3 h;  1LYL A;  2PMF A;  1ADY A;  12AS A;  5GAO n;  4P3P A;  4J6W A;  4H2Y A;  3RES A;  2CJ9 A;  4HWP A;  4P73 A;  3RKW A;  4M75 B;  4J6X A;  3NEL A;  3HTZ A;  3M4Q A;  4AH6 A;  4M75 G;  2ALY B;  4YRQ A;  4YCW A;  4HT9 A;  4HWO A;  1Y96 A;  3E9H A;  4UP9 A;  2IY5 A;  4H02 A;  3VQW A;  2CJB A;  4P74 A;  1SES A;  4O2D A;  1I8F A;  1NYQ A;  5GAO p;  4M77 E;  1X2G A;  3OD1 A;  1D3B A;  3EFS A;  5GAM g;  3VQY A;  2I4O A; 
#chains in the Genus database with same CATH topology
 3EG9 B;  5GAN g;  3UGQ A;  4LVK A;  4P72 A;  4KGV B;  1WXB A;  4P75 A;  1UHC A;  1XQH A;  4M78 D;  2DXU A;  2QA4 A;  4C92 G;  3OW2 S;  5KE2 A;  1WU7 A;  1UUE A;  3TUP A;  1MV0 B;  2ZNI A;  2E3C A;  3QG1 A;  4F7U B;  1P92 A;  4M75 F;  4PJO A;  1RAE B;  4BDZ A;  4M77 B;  2KQW A;  5IXF A;  2QHU A;  2RJC A;  3LH0 A;  2CZ7 B;  5GAN 5;  5I2M A;  2Y4X A;  4A4E A;  2VAS A;  5LJ5 j;  1SRL A;  11AS A;  4A63 B;  4RTZ A;  1XNI A;  3KXT A;  4J7F A;  2QTX A;  1I81 A;  2RO0 A;  3CC2 Q;  1PG5 B;  3MF2 A;  2LQ8 A;  3CCU A;  3REB B;  3JCM X;  3CCS Q;  1SSF A;  1SPK A;  1GXI E;  1PYS A;  1VQ4 T;  3CCV A;  2L3R A;  3CCL A;  3JB9 J;  1D0Y A;  2DZ9 A;  1ABQ A;  3M59 A;  1W4S A;  1PSE A;  1NJI C;  2QYZ A;  1JB0 E;  4P73 C;  3G4S A;  2VC8 A;  3ZL7 C;  4UP8 A;  3MO8 A;  1YJN A;  1SHG A;  1Y0M A;  3VS0 A;  3EG9 A;  2QK0 A;  3G7Z A;  1YJ9 Q;  2FHD A;  1ASZ A;  4DPG A;  1NLP C;  4C0D C;  1UDL A;  1YFT A;  3CD6 Q;  2FL7 A;  2DRM A;  3ICA A;  2DXC A;  2KEA A;  2M0Y A;  3CBP A;  3L1A A;  4C5G A;  2JS2 A;  1ZBX A;  1NPR A;  3NEM A;  3HFZ A;  1M9S A;  1UGS B;  1EFN A;  1XTD A;  2VWF A;  4M77 A;  4ZN3 A;  3I56 T;  1LOJ A;  2MMP A;  1O75 A;  1JJ2 S;  4K88 A;  4AFQ C;  2PUO B;  3CCE A;  4HCC A;  1VQ9 Q;  3UAT A;  2EVR A;  1VA7 A;  5AT1 B;  1I5O B;  3WXM B;  1M1K R;  3OMG A;  4AFU C;  2EQM A;  3VJP A;  2FZK B;  2L89 A;  4E7Z A;  2XGT A;  2H8H A;  3QHS A;  3QDF A;  3PTA A;  5ELN A;  2CSI A;  3JCM Q;  1K8A R;  4RMF A;  2FO0 A;  3GNG A;  2HNI A;  4EMK B;  4XTV A;  2EJG A;  4JRQ A;  2KRN A;  4X9C A;  1M2V A;  2E64 A;  3JB9 G;  1BBZ A;  1X43 A;  4M7A E;  4FCY A;  4MMK A;  2ZXF A;  1M27 C;  1OYX A;  2JMC A;  3QJ6 A;  3CC4 T;  4C8Q B;  1GCQ A;  4IUT A;  4KUI A;  2YUN A;  5HK3 A;  4F7U E;  4RMO A;  4AG1 C;  1NPP A;  3VBB A;  1BU1 A;  1UEC A;  1Q82 C;  1VOM A;  2RJE A;  4MZT A;  4PK4 A;  3JCM h;  1FWZ A;  4DOW A;  1H3H A;  2MWP A;  2K9G A;  1ZSZ C;  4VUB A;  4RCC A;  2QHV A;  5K1X A;  5FU6 B;  3ULR B;  3H9N A;  3VQV A;  1D1A A;  1VQ5 T;  1ZUK A;  3RMS A;  3V8J A;  3QPH A;  1PKT A;  2KRM A;  1TTH B;  2VUB A;  3D7S B;  4TVA A;  1U1S A;  1GRI A;  4PJN A;  5KYU B;  1IHW A;  4EMK A;  3E9I A;  2RA2 A;  1I4K 1;  1H64 1;  4O6J A;  5GAN 2;  3M4P A;  1X6O A;  3RUX A;  4QVC A;  3M0P A;  1FMW A;  2EYW A;  3S3O A;  4J9F A;  4MDX A;  2EIF A;  3MP6 A;  4M75 A;  2KMT A;  4D6W A;  4NL3 A;  1VQM T;  1KC8 U;  3EG3 A;  2A37 A;  1VQP Q;  1Q7Y C;  3UA7 A;  1KD1 R;  5J39 A;  3CCQ A;  3PIP A;  3A1P A;  4DA4 A;  2DE0 X;  5CQY A;  3G71 T;  4CRI A;  1M2O A;  3EFO B;  1YBY A;  2HDA A;  4TVR A;  2DD4 A;  1QKX A;  3OYG A;  5FRM A;  3MPU B;  4HKE A;  1W66 A;  3QWY A;  3JCM P;  1B70 B;  2HKQ B;  1BCM A;  4FW2 A;  4CC2 A;  3CEY A;  5I22 A;  3H0I A;  3RDV A;  5GMK j;  1X56 A;  2QTV A;  3RMQ A;  2KXD A;  1G5H A;  3HL8 A;  3C94 A;  2A7Y A;  3M0U A;  2EW3 A;  1I07 A;  2C0I A;  2DYI A;  2KRO A;  2M1H A;  4UC4 A;  5KYX B;  1CKA A;  3OA6 A;  4ZTU B;  2K3B A;  4BI3 A;  1VQL A;  1FMV A;  1YJW A;  5KYU A;  1YI2 A;  2NUP B;  3OYI A;  1QP3 A;  1M4Z A;  5IAY A;  1VQ6 Q;  1NE8 A;  1K73 C;  2M9U A;  4LVJ A;  1D09 B;  4ESR A;  4J8O A;  4JS4 A;  4C8Q E;  3P8V A;  3HRU A;  2V1R A;  1SF9 A;  2R5M A;  3QO3 A;  2IIM A;  3CXC P;  3CCR A;  4JRP A;  2YLC A;  1OPK A;  5HGQ A;  3DB4 A;  3FC3 A;  3FDR A;  1TG0 A;  3EFO A;  2E5A A;  4DEY A;  4RG8 A;  2EQU A;  4DEX A;  1OQK A;  2CIM A;  4M77 D;  4A54 A;  1K9A A;  2BE9 B;  4LN2 A;  1PRL C;  1YFN A;  2Z0W A;  4KUD K;  2LVM A;  2I4N A;  5I11 A;  3CME T;  3QZ5 B;  3JCM g;  3REX A;  1NNH A;  4BW9 A;  4ATO A;  4OMP A;  3A7A A;  1N8R R;  1G51 A;  4RTT A;  2HD0 A;  2HQH A;  3PT9 A;  2CKK A;  5KYX A;  5M9O A;  1XOV A;  2JMA A;  1NBE B;  1T3S A;  1YP5 A;  2LRQ A;  2RB6 A;  3QJY A;  5LJ3 f;  4D8D A;  4H2X A;  2FPE A;  1LVK A;  2NUP A;  4M7A C;  2Q7G A;  1WLE A;  2D8J A;  1WYX A;  1RAB B;  5A0L A;  1WI7 A;  2L2P A;  4B6M A;  2RHX A;  3SDZ A;  1VQO A;  1YHQ A;  2OTJ A;  4EO4 A;  1GBQ A;  3A74 A;  3OYB A;  1KSW A;  1MMN A;  4KRT A;  3TSZ A;  1AZE A;  4N0A A;  1UE9 A;  1NG2 A;  5CO7 A;  4PJM A;  5GAM h;  2GNC A;  2FPD A;  1M5Q 1;  4LVL A;  1VQ7 Q;  1U06 A;  4Q15 A;  2LQK A;  1IRE B;  3UH0 A;  2DTO A;  5GMK m;  2FRY A;  1V76 A;  4OGC A;  3GNF B;  2P5I A;  3PFS A;  2QGF B;  4NOY A;  2JVV A;  4JLG A;  1YFS A;  2COZ A;  4E7H A;  1B76 A;  5KCO A;  2DJQ A;  1VQ8 T;  1TUC A;  2CH4 A;  4FM4 B;  5CR2 A;  4E6R A;  4MZP A;  3R6N A;  2LT4 A;  2DF6 A;  4H2V A;  1I0C A;  3M0S A;  2XHC A;  5CAI A;  1JXO A;  1PD0 A;  1UEB A;  3OS2 A;  3LC0 A;  4IIO A;  2Q7H A;  4J9E A;  1X2Q A;  1OZ3 A;  1H4V B;  3CXC A;  3MEW A;  5LJ3 e;  4QVD A;  2JM9 A;  3BFM A;  1M1K C;  1ZX6 A;  4OMN A;  4LDY A;  4C8Q D;  1GGM A;  3TEH A;  4M7D E;  2RHI A;  1YIJ A;  2ZZE A;  4C0D B;  5KYY A;  1TU0 B;  2GGR A;  1K8A C;  1QKW A;  4YCU A;  3HFN A;  4H2S A;  1VQK A;  2DXT A;  2ZPI B;  2CDT A;  4PJJ A;  5CKE A;  3QNE A;  1W2B S;  3E1S A;  1Q86 R;  4HCB A;  5FU7 C;  1HSQ A;  3DLM A;  3CCM A;  2AMC B;  5KNN A;  3X24 B;  1YIT T;  5GJW B;  3IKL A;  2GFA A;  2E41 A;  4L59 A;  2E5K A;  3M55 A;  1KHC A;  2Y4Y A;  3TRE A;  4YRK A;  4C0G A;  4Z02 A;  1USY C;  4YYE A;  2V8K A;  8ATC B;  3EHR A;  3HXX A;  4C8Q C;  1KFZ A;  4PFO A;  1LYL A;  2K5L A;  1K9M R;  2DIQ A;  1G83 A;  3CCJ T;  1GFD A;  4EIK A;  1KHI A;  1R0C B;  4H2Y A;  1WX6 A;  1VQ4 A;  4P73 A;  1IRX A;  5L8R E;  3NEL A;  4J6X A;  1H8K A;  2R58 A;  2ALY B;  3TEE A;  4YRQ A;  4YCW A;  4HT9 A;  4HWO A;  1QVG S;  4A4H A;  3A8M B;  5CKD A;  2MAM A;  5GAM g;  2HSE B;  4RTU A;  2JW4 A;  2FEI A;  3QDR B;  4BD3 A;  2I4O A;  2XD0 A;  4RKU E;  4JRK A;  3HXZ A;  2AMC A;  2EYX A;  3A5Z B;  4M4Z A;  3J80 E;  3M0Q A;  4WJ3 M;  4WTO B;  1ZSZ B;  2X4J A;  1BK2 A;  1KD1 C;  4LUD A;  3I56 A;  4QQG A;  4F14 A;  4XTU A;  3JCM f;  2DPP B;  2NS6 A;  3EG2 A;  3UGT A;  1HK9 A;  2RMO A;  4PFZ A;  4J9I A;  1KQS S;  2GTO A;  4YRN A;  3G6E A;  4DBH A;  3CC2 T;  1UJY A;  3E19 A;  5J3B A;  2RQU A;  3CCS T;  2PUK B;  2HCK A;  4LXC A;  4BDY A;  1WYD A;  2VB6 A;  4RQF A;  4QKU A;  3X20 B;  5ECA A;  2XDP A;  2KRS A;  2JS0 A;  1WHJ A;  1ZBJ A;  1YWP A;  5FLX E;  5D6Y A;  4J83 A;  4YCV A;  1MGQ A;  1H4Q A;  1KK7 A;  3L2U A;  1ZUU A;  3LWI A;  1HC7 A;  4LNP A;  3ERR A;  1OX8 A;  2BZX A;  2H3J A;  1YJ9 T;  2J6F A;  4JJC A;  3OY9 A;  4M7A F;  1SG5 A;  2A28 A;  3CD6 T;  3CC4 A;  1X6G A;  2K2M A;  3CPW A;  1NJ1 A;  4GLK A;  4IUP A;  4CH6 A;  4F7U F;  4MML A;  3NTI A;  4OMF B;  1Q81 U;  4HT8 A;  1N9S A;  4R0K A;  1WXU A;  3EGD A;  3A5Z A;  2I0N A;  2ZT7 A;  4X5O A;  1ZSZ A;  2OI3 A;  4EPC A;  1V1C A;  4F16 A;  3M0R A;  2EGA A;  2CJA A;  1BB9 A;  1N5Z A;  2E3H A;  2EWN A;  1QCF A;  2D6F A;  1QP2 A;  1WHK A;  4M78 G;  4AFZ C;  1YNZ A;  2A3L A;  1UG1 A;  4E51 A;  5LJ3 j;  1OI1 A;  1VQ5 A;  3VRY A;  1ABO A;  3E9F A;  3JCM e;  5F5W A;  1LNX A;  3A31 A;  4M7D C;  2ZPB B;  1M1F A;  2BE7 D;  1FXX A;  4YRT A;  2GBQ A;  3SFM A;  4HWR A;  1MND A;  1N8R C;  1YIT Q;  2JTM A;  2ZZD A;  2PU9 B;  1IZ6 A;  1UGV A;  2KYB A;  3EFR A;  1BI3 A;  1WDX A;  3LWH A;  5FRO A;  4RCB A;  1VQM A;  2RHZ A;  1A0N B;  2K6D A;  4N4H A;  5KCH A;  4PFP A;  5GJV B;  5IHI A;  2ZCE A;  2ZPE B;  1K4U S;  1RAG B;  5CKF A;  3G71 A;  2MIO A;  3FLG A;  4C92 E;  1BKB A;  3A32 A;  1YB3 A;  4YRO A;  4CH5 A;  2IVW A;  1WIE A;  1Y71 A;  1ACM B;  3VQX A;  2LJ3 A;  2DQ3 A;  2LNH B;  4WCI A;  2KR3 A;  4EMG A;  6AT1 B;  2BKD N;  2HSP A;  4FYX B;  3MET A;  2GFU A;  2RHQ B;  1G2B A;  2QHT A;  1NJI U;  3JCM V;  4RTV A;  3UA6 A;  5GMK l;  5GAN 7;  2XMF A;  1ZHI A;  3MCA B;  4M7A B;  1VYU A;  1D0X A;  2DRK A;  2P0P A;  3TSW A;  3IAL A;  1NJ8 A;  1CSK A;  4KR3 A;  1LJO A;  2OJ2 A;  1JXM A;  1RAD B;  5IT9 E;  4OB3 B;  1VQP T;  4C8Q F;  3P8H A;  2QHS A;  1VQN T;  1JJC B;  4NCX A;  4ZIB A;  2B86 A;  1NLO C;  2CZ6 B;  3H0H A;  4PLI A;  3MQZ A;  3OYA A;  1VIF A;  1VYV A;  3OYF A;  2E1H A;  1D1C A;  3OYK A;  3SB2 A;  2GQV A;  2NUZ A;  2QGG A;  1IXD A;  5L23 A;  1X27 A;  5KYW B;  5DM7 R;  3M57 A;  3EGX B;  4GLM A;  3OS5 A;  2RQT A;  3LSQ A;  1QF6 A;  2J3L A;  2AT1 B;  3M53 A;  4B9X A;  4N4G A;  3L2Z A;  4JJB A;  2WSE E;  4PHC A;  1AZG B;  3CME A;  2RHQ A;  1Z9Z A;  2HL5 C;  4HWT A;  2RK2 A;  2MOX A;  2X35 A;  4OB2 B;  3R6O A;  3OBW A;  2DQ0 A;  4E7S A;  1TH7 A;  4O5V A;  4M7A A;  1M90 R;  3CMA T;  2DM1 A;  4XTY A;  1X01 A;  2COY A;  1YGB A;  4CS2 A;  1AVZ C;  1G3Y A;  1VQ6 T;  1BBU A;  1PC0 A;  5LJ5 h;  2ROT A;  2ED0 A;  4F7U A;  2X3X D;  4BUG A;  1NEG A;  5DLQ E;  3HFO A;  3MP1 A;  3L2V A;  4F17 A;  3Q1J A;  1Q82 U;  1WXT A;  1AWJ A;  3QO5 A;  4ZNX A;  4OP0 A;  2BIV A;  1AWO A;  1VUB A;  4BI8 B;  4OMQ A;  1ADJ A;  2QEX Q;  1K9M C;  2XKO C;  1WHH A;  3PCO B;  2C0O A;  2ZPG B;  1D3B B;  3MEY A;  3LLR A;  3A8H B;  4LVI A;  3LYI A;  2EGE A;  3CBO A;  2O9S A;  5FU7 B;  3VUZ A;  1IGU A;  4C0F A;  5KYW A;  2DL3 A;  4J9C A;  3NHN A;  4BY6 B;  4YRP A;  1RAI B;  2QQ9 A;  1M3A A;  4OB0 B;  4Y91 A;  2KGT A;  1XJW B;  4HVU A;  5GAM e;  4TQD A;  3LW5 E;  1W2B P;  1VQ8 A;  2ARU A;  1JQQ A;  3PMT A;  1NYG A;  3OYC A;  1I5L A;  1WGS A;  2K5I A;  1NJ5 A;  2QQA A;  3QXE B;  4PJO G;  1ARK A;  2L8D A;  2ZGW A;  2YXY A;  1Q7Y U;  4E7I A;  2JZ2 A;  3NTH A;  1D1B A;  4MDW A;  1BYM A;  2ZIN A;  1WQW A;  4FL6 A;  3RKY A;  4CC7 A;  2RHS B;  4PNO A;  2BZY A;  1UGR B;  1RI0 A;  2YSQ A;  2RK1 A;  4C92 C;  1JBM A;  2QAS A;  1TSF A;  4BAC A;  1RAC B;  3S3M A;  2F5K A;  2RJF A;  5I21 A;  3INZ A;  4M7D F;  2CGH A;  2DD5 A;  3PCO A;  2KSS A;  1VQ7 T;  2ZCF B;  1S72 Q;  2YHT A;  5C53 B;  4PKC C;  1QVF S;  2LZ6 B;  1WFW A;  2DIL A;  3RER A;  3FRN A;  3GBQ A;  1RUW A;  2CRE A;  2RQR A;  3MP8 A;  3HXW A;  1AD5 A;  1R77 A;  2OTL T;  2ZZG A;  1USY A;  1OV3 A;  2DVJ A;  2K2V A;  1K73 U;  1W6X A;  2DMO A;  2ZIO A;  2XTI A;  2A0F B;  4C8Q A;  1VQN Q;  2VVK A;  3S6W A;  5GAN f;  2HL3 A;  4M77 G;  1VQZ A;  4OML A;  2HKN A;  2O01 E;  3JCM b;  1TOV A;  3IG2 A;  1G3S A;  4Z89 A;  1E6H A;  2LX7 A;  4JZ4 A;  3CCJ A;  1KQS P;  4ORZ A;  1PHT A;  3LGL A;  3SEM A;  4R56 A;  2RHS A;  5LJ5 g;  1HJD A;  2RNA A;  2KY9 A;  4ELZ C;  1E1O A;  2PVD B;  1YCY A;  2O2O A;  3JB9 D;  3S3N A;  2DIG A;  1TS9 A;  2ECZ A;  4QVZ A;  5C6S A;  2LJ1 A;  2JN0 A;  2OX7 A;  1B7Y B;  4HT4 A;  2YUP A;  3I55 Q;  1YCS B;  3TQ7 P;  1SEM A;  2C0T A;  4XAX B;  4ZTF A;  5HKC A;  2CP5 A;  3OYM A;  2MYS A;  3I5S A;  4LDV A;  3OYE A;  3CMA Q;  2M02 A;  2I2L A;  2L5Q A;  2C7I A;  1Y96 B;  4YRL A;  1PSF A;  2L3Q A;  2IY5 B;  1GFC A;  5A2Q E;  2I4M A;  4QQD A;  2LX9 A;  2PQW A;  2ART A;  4RTX A;  1EOV A;  4XU0 A;  3VS6 A;  2HBW A;  4OMM A;  3VKI A;  2AK5 A;  3H6Z A;  2CUD A;  2DEQ A;  2X4W A;  1C1A A;  4KT0 E;  4UP7 A;  3VS3 A;  5C51 B;  5CQX A;  4M7A D;  4ZTJ A;  2G6F X;  3C0C A;  1MUZ A;  2DER A;  3RL6 A;  1VYT A;  3CC2 A;  1X55 A;  4M7D B;  5GMK h;  4YRS A;  2GCX A;  3CCS A;  2IPO B;  4IIM A;  3G1Z A;  5GAN e;  4WF2 A;  3ZBD A;  1B70 A;  4HXJ A;  4JUV A;  2ED1 A;  2KT1 A;  1G3T A;  1ADY A;  12AS A;  4P3P A;  2FZC B;  3RES A;  1YJ9 A;  3CC7 Q;  4HWP A;  2PVG B;  1OU8 A;  3OBY A;  3QKJ A;  3PMI A;  2O31 A;  2RPN A;  3CD6 A;  3EH2 A;  4FIB A;  4AH6 A;  2EGC A;  3EH1 A;  4M75 G;  2J05 A;  5IHN A;  5FWC A;  2V8J A;  1Y96 A;  4UP9 A;  4X1V A;  2IY5 A;  4E2F B;  1SES A;  1I8F A;  2WSC E;  2KK4 A;  3X26 B;  3VQY A;  1VQ9 A;  2DLP A;  1E24 A;  3ASK A;  1RI9 A;  3SWN B;  4KH1 B;  1M1K U;  4ZGE B;  2RHY A;  4M7D A;  4A4K A;  3DKM A;  4A4G A;  4K11 A;  4IUU A;  2RI2 A;  4G84 A;  1K8A U;  5CIU A;  1H3Z A;  2SRC A;  4Z88 A;  3LX7 A;  2CZ1 B;  3CCE T;  2E3I A;  5FWB A;  5ELO A;  3VYH B;  2ZR3 A;  2JTF A;  2LNV A;  1RIQ A;  3NPF A;  3OYN A;  3NEN A;  1L0W A;  2OTL Q;  1SET A;  3OW2 P;  1T0H A;  1HTT A;  1YFR A;  4Q6G A;  2HEQ A;  1M90 C;  2DO3 A;  5GAN 4;  2L3S A;  3RKX A;  2DU5 A;  5DY9 A;  1RAF B;  2DBK A;  3RAC A;  4C92 F;  1QQJ A;  2K79 A;  2LCS A;  5CK9 A;  3HRI A;  4OB1 B;  4X9D A;  4LNS A;  5GAN d;  4PLL A;  1KMN A;  4GBQ A;  2DJZ A;  4C5E A;  4J9H A;  1HXD A;  2ZNJ A;  4P74 C;  1K76 A;  1W70 A;  1IO6 A;  1MMG A;  2QAZ A;  2H3E B;  2K3X A;  2J06 A;  3J7A F;  4FSX A;  2M51 A;  2DET A;  3A8G B;  1MV3 A;  2VKN A;  4BY6 C;  2W10 A;  3HTR A;  2F1L A;  2ZPF B;  2DVE A;  3RNJ A;  3P8B B;  3R07 A;  4IUQ A;  1U5S A;  4LUE A;  3GOX A;  2G4C A;  2D0Q B;  2XDD A;  4YPF A;  1T0J A;  3G1J A;  5LJ5 f;  1VQP A;  1QWE A;  3EGU A;  3L2W A;  1K1Z A;  4YRR A;  1WQ7 A;  2D8H A;  1ZLM A;  2QA4 Q;  1KD1 U;  1SER A;  4BI4 A;  3L2R A;  2ATC B;  2Q5H A;  1TUG B;  2MCN A;  1C6V X;  3QUI A;  1JJ2 P;  1MMD A;  1LPL A;  4P71 C;  2M0O A;  2JTE A;  4CC3 A;  5GAN 8;  4XQ3 A;  1PRM C;  2EQJ A;  2GTJ A;  2DL7 A;  1NEB A;  3PNW C;  2K7A A;  1O9S A;  2LQW A;  1EFW A;  2O88 A;  4V2S A;  1SHF A;  4PL6 A;  4X34 A;  1FX7 A;  1WPY A;  5GAN j;  1H4S A;  4JPB W;  3URG A;  3CCU Q;  2QXF A;  2YWW A;  4MZM A;  2LMJ A;  1JEG A;  4BB7 A;  1D0Z A;  4J9D A;  3M9Q A;  3CCL Q;  1X75 C;  2QI2 A;  2LJ0 A;  9ATC B;  4C5I A;  2Q7E A;  3JV3 A;  1VQ6 A;  4P5N A;  3AT1 B;  3G4S Q;  3OW2 A;  4C92 B;  1YJN Q;  4HVW A;  2J7I A;  2KXC A;  2EYY A;  2XIC A;  4FYY B;  3JCM c;  5LJ3 d;  2C06 A;  1C0M A;  3HXU A;  3JB9 F;  2DXB A;  4HCK A;  1B34 B;  1UGQ B;  3MHX A;  4IUV A;  5LJ5 e;  3RIR A;  4YDQ A;  2XU8 A;  5FW9 A;  2EJF A;  1C0A A;  1KG1 A;  1UFF A;  2QDY B;  1E7O A;  4E7J A;  4HVV A;  4FSS A;  5IXB A;  3CCE Q;  3EHQ A;  3OYY A;  4HA8 A;  3AHU A;  1Z7N A;  1BIA A;  1QVF P;  2ALY A;  3KUF A;  4XEO A;  1UTI A;  4M78 E;  2LTO A;  3HRK A;  1J5W A;  2E6N A;  1N8R U;  4M7D D;  4P3O A;  2JUF A;  2SEM A;  3A5Y A;  1LCK A;  2I4L A;  3TU4 K;  2XI9 A;  5C0M A;  3EG0 A;  1EVL A;  3M0T A;  4DOV A;  3CBM A;  3VRZ A;  1AWX A;  2E65 A;  4C92 A;  4RTW A;  1K0X A;  3OYH A;  2X51 A;  4Y92 A;  1OX9 A;  3V7S A;  4XTW A;  1JJ2 A;  3QII A;  2QEX T;  1X69 A;  1TXQ A;  2RQW A;  4JJN K;  4BWA A;  3I9Q A;  5D6X A;  1EZZ B;  5GAO q;  3CXC S;  1B8A A;  4AFS C;  2HAX A;  1VQ7 A;  1YHQ T;  3C95 A;  1H4T A;  1G3W A;  1PKS A;  3PGG A;  5I2S A;  2FG0 A;  1AEY A;  4XU1 A;  4YP0 A;  1YN8 A;  3KBG A;  1PD1 A;  2OTL A;  2F2V A;  3QO8 A;  1GL5 A;  1EIY B;  4XTZ A;  2XK0 A;  3UPU A;  3IQL A;  3M58 A;  3ZEH A;  4BE0 A;  3P8T A;  2J3M A;  1W1F A;  2NUT B;  5HK0 A;  3P8D A;  4Y28 E;  2DFU A;  2KVQ G;  2LCL A;  3GLX A;  2HZY A;  4PJO B;  3EG1 A;  1KC8 R;  2CUB A;  2CH4 W;  1Z7M A;  3CQT A;  3VU3 C;  2JNG A;  4C5H A;  2KI7 A;  3M5A A;  1WLP B;  2ABL A;  2ARS A;  1WA7 A;  4BE2 A;  4YRG A;  3CCQ Q;  3U23 A;  2OAU A;  4YRE A;  4L87 A;  4KUL A;  2JJ9 A;  2RH2 A;  2YRC A;  3A98 A;  4FU6 A;  1U3O A;  1X2K A;  3HRS A;  1S72 T;  3OSS C;  3SWN C;  3FEO A;  4OF1 A;  4A4F A;  4QQ6 A;  4YRM A;  3O8V A;  4YRC A;  1E22 A;  1PYS B;  1M8M A;  2NLU A;  5A0G A;  4HVC A;  4RQE A;  4RG2 A;  1Q86 U;  2YUQ A;  1ASY A;  1UJ0 A;  2K57 A;  1WNL A;  2E70 A;  4NL2 A;  1QCO A;  3RR6 A;  4TQF A;  2RD1 A;  3HXY A;  1EIY A;  4E7K A;  1VQK T;  3FB9 A;  3FJ5 A;  1PWT A;  1AHJ B;  1VQL Q;  1ZQ1 A;  1YJW Q;  2ZR2 A;  2EYQ A;  3CCM T;  1YI2 Q;  1NJ6 A;  2VXE A;  2AKW B;  2NUT A;  4N4I A;  3HFZ B;  1GCP A;  2AKL A;  5E3I A;  1BI0 A;  4R55 A;  5GAM f;  3VS1 A;  1K9M U;  4B9W A;  3JCM d;  1QW1 A;  2R57 A;  1RAA B;  3HPW A;  2P0L A;  4CH3 A;  1TWB A;  3H0F A;  3MEU A;  3CCR Q;  4OGE A;  2DX1 A;  4ZTZ B;  4FYW B;  5GAO m;  3I55 T;  5K1P A;  4KGX B;  5GMK e;  1ATI A;  4XU3 A;  3HRT A;  4YRI A;  2DEU A;  2RQV A;  1Q86 C;  2JXB A;  2BZ8 A;  1GBR A;  4M78 C;  1MNE A;  3QZ9 B;  1NYF A;  3CMQ A;  2CZ0 B;  3OYD A;  4L5G A;  2XG8 D;  1M2V B;  1QCN A;  4TVW A;  4KBM B;  2QQB A;  4FYV B;  2EYZ A;  3BDU A;  3CPW S;  4CS3 A;  1AOJ A;  1JJC A;  1PCX A;  3RGL A;  3BW1 A;  5LL6 S;  5HCK A;  4FT2 A;  4PJO E;  2BUD A;  4TVY A;  4BE1 A;  2VGM A;  2LT1 A;  3NTK A;  2AKW A;  4DBQ A;  1Y07 A;  1X6B A;  3M54 A;  1VQO Q;  5CKB A;  1YHQ Q;  4C92 D;  3EGX A;  3C4S A;  1EIF A;  2OTJ Q;  1FMK A;  2DTI A;  1E1T A;  3G6E T;  2XDB A;  2DU7 A;  3DSQ A;  5GAN 6;  5LJ3 g;  3CC7 T;  3ME9 A;  4H2T A;  2KT8 A;  1WHL A;  2QQS A;  4TVA B;  1U1T A;  2DL4 A;  3H8Z A;  2DDZ A;  1I1J A;  3A8L B;  5GAO n;  1MMA A;  4J6W A;  3LGF A;  2VV5 A;  3N5B B;  2CT4 A;  1PM3 A;  3T9N A;  3TCJ A;  1RLQ C;  4JZ3 A;  3RKW A;  2D9T A;  4M75 B;  5IH2 A;  1ZSG A;  2JT4 A;  3MEV A;  1NZ9 A;  3VYG A;  2DNU A;  2X3W D;  2HMA A;  3E9H A;  3NGP A;  4H02 A;  3VQW A;  2CJB A;  4P74 A;  4LDX A;  3L42 A;  2F2X A;  4M77 E;  5GAO p;  1X2G A;  2CT3 A;  4ZGJ B;  1D3B A;  3EFS A;  2DK3 A;  2DA9 A;  1OOT A;  1X54 A;  4ELY C;  4TWA A;  2LC4 A;  4JJD A;  2FYK A;  1SRY A;  1QVG P;  1WJQ A;  1R0B G;  3V7R A;  1YIJ Q;  1YIT A;  4M7A G;  1KOG A;  1S1N A;  2F69 A;  1VQK Q;  2Y90 A;  4F7U G;  3FIF A;  5J26 A;  2KE9 A;  2MPX C;  2X4X A;  5HY6 A;  5EG2 A;  4QW2 A;  3CCM Q;  2AZS A;  4P71 A;  4ZGD B;  1BI2 A;  1N27 A;  2O4X B;  4ZN1 A;  2ODR D;  2YDL A;  2K3Y A;  2CP3 A;  2WSF E;  4LD9 K;  2V26 A;  2E5Q A;  1X2H A;  4WJ4 A;  2ZZF A;  2OAW A;  3L4G B;  2P0Q A;  2EBP A;  1B07 A;  4XU2 A;  4ANJ A;  5GAM d;  2QQR A;  1KIK A;  3JRZ A;  4PJO D;  3MJX A;  1VQ4 Q;  1CKB A;  3MKD A;  2X4Y A;  3I5R A;  4KGZ B;  3X28 B;  2MWO A;  1W2B A;  5C52 B;  2E4H A;  1BBW A;  2CP7 A;  1EQR A;  2ODR C;  4J7I A;  3J81 E;  4IKF A;  2Q5I A;  3MEA A;  2R5A A;  4D8K A;  1V29 B;  2AZV A;  1K0S A;  1R8O B;  3LSS A;  2QA4 T;  4H2X B;  1NM7 A;  4P72 C;  3QSU A;  4P75 C;  3TVT A;  1FYN A;  3QYG B;  2K5F A;  1YWO A;  1OZ2 A;  4M75 E;  3V8L A;  2DTH A;  1KC8 C;  4LDU A;  2O4X A;  1M3C A;  1M1G A;  1FYF A;  5KE3 A;  2D0N A;  3VV0 A;  4PJO C;  3UF4 A;  3W3S A;  3I56 Q;  3M56 A;  3H41 A;  3M4G A;  3L4G A;  3PVQ A;  3G6E Q;  1QE0 A;  3JB9 H;  1B7Y A;  3L2Q A;  4M78 F;  3CCU T;  2CSQ A;  1PNJ A;  1QMC A;  2EJ9 A;  2J6O A;  3E2U A;  2AIR B;  3OSV A;  3CCV T;  3CCL T;  1QVG A;  4L6V 5;  1JRI A;  2NYS A;  2EPD A;  2DKG A;  5GAM j;  1M90 U;  2A36 A;  3HXV A;  3G4S T;  5FRN A;  2ZT5 A;  3QYH B;  4C8Q G;  2QG9 B;  3KFV A;  1YJN T;  2FZG B;  2FVU A;  3DB3 A;  1BI1 A;  3BE3 A;  3VS2 A;  4F04 B;  3CC4 Q;  4OLF A;  4C0Z A;  1Q81 R;  4PJL A;  2LDM A;  4KR2 A;  2QEX A;  3UDC A;  2G3R A;  1KQS A;  3THK A;  4CH4 A;  2B8A A;  4CS4 A;  4RDX A;  1JU5 C;  1KMM A;  4M77 C;  2VGN A;  1M8V A;  2RHU A;  2CP6 A;  5D6W A;  3TEH B;  4XEM A;  5GAO l;  1J3T A;  5GAO r;  5KYY B;  1SRM A;  2RI3 A;  3GIB A;  1NJ2 A;  4K86 A;  3V8K A;  1VQ5 Q;  4YRJ A;  2KAF A;  3OB9 A;  1WJR A;  4XK8 E;  1AWW A;  2ROL A;  3VS7 A;  3M4Y A;  1MHN A;  3REU A;  2PNI A;  3QWX X;  1WHM A;  1RLP C;  2JOY A;  3OQ5 A;  5D7U A;  4J5Y A;  1N9W A;  3PVL A;  3TEG A;  2YLB A;  3JCM J;  2L0A A;  2X9H A;  5DLO A;  3F70 A;  4G85 A;  1VQM Q;  2DL5 A;  3HSB A;  2JM8 A;  1EVK A;  3JSC A;  1GCQ C;  4Z8A A;  1RL2 A;  3SWN A;  5KH6 A;  3G71 Q;  3A7U A;  2MF2 A;  4II1 A;  5A0D A;  2PTK A;  1S72 A;  4AG2 C;  4M78 B;  3HY1 A;  3HY0 A;  2WAC A;  4M75 D;  4J9G A;  2AKK A;  4JS5 A;  5CCA A;  7AT1 B;  1BIB A;  1KQ2 A;  1WJS A;  2GQI A;  3PIO A;  3X25 B;  1NJI R;  1BCO A;  3WQZ A;  3QTC A;  3O5Z A;  1KQ1 A;  2EQK A;  3HHT B;  4TTV A;  1VQN A;  4DBR A;  1OEB A;  3EAE A;  5GMK i;  2ZIM A;  4PG3 A;  4OVA A;  2DBM A;  1AT1 B;  4CI0 C;  1T3L A;  1DJ7 B;  1M30 A;  2ENM A;  8AT1 B;  3CPW P;  3JB9 I;  2K4Y A;  3KFU A;  1QWF A;  2EAY A;  4EMK C;  3MF1 A;  4JDS A;  4H2U A;  1Q95 G;  3UFG A;  5AYF A;  1B3Q A;  4DBF A;  3VS4 A;  4M75 C;  3CCQ T;  1G5V A;  4KQE A;  4M7D G;  4J6Y A;  2YT6 A;  4RUG A;  2LP5 A;  4H2W A;  3V7C A;  1UB4 A;  4DQ2 A;  3BJU A;  2HQE A;  3PZC A;  2IG0 A;  2AHJ B;  2DZC A;  2DAQ A;  5CKH A;  2CS7 A;  3REA B;  2PME A;  1ZUY A;  3I55 A;  3SD4 A;  3RF1 A;  4J9B A;  2C8M A;  3OS1 A;  1QVP A;  4M78 A;  1H92 A;  1IL2 A;  3CCV Q;  4JLI A;  4YTL A;  2LQN A;  2KYM A;  3CMA A;  2V1Q A;  1G5I A;  1HD3 A;  3HFV A;  2ZT6 A;  2KDS A;  4J15 A;  3OMC A;  1NYR A;  4HWS A;  2XID A;  2FPF A;  3CME Q;  1JO8 A;  3NMZ C;  1Y57 A;  5FU6 C;  2RF0 A;  1WHG A;  4FT4 A;  3RBB B;  2HQX A;  1VQL T;  4LVM A;  1YJW T;  1OUL A;  2KNB B;  3FJP A;  1SSH A;  1YI2 T;  2ZTG A;  4A53 A;  4PJO F;  4P3N A;  1ZA2 B;  3I35 A;  4OMO A;  5CVI A;  3EGD B;  4AMC A;  3OYJ A;  4E7L A;  2EL9 A;  4RTY A;  2RM4 A;  2LCC A;  2PZ1 A;  1Q82 R;  3NET A;  4WI1 A;  2ZPH B;  3GF5 A;  1B7T A;  1IGQ A;  1WZO A;  4FW1 A;  5GAN h;  2CYZ B;  2VYT A;  2NWM A;  3CCR T;  1RAH B;  3SHW A;  4LDW A;  3UT1 A;  4UPA A;  3BY7 A;  5GAN 3;  2ZT8 A;  2P4T A;  2J6K A;  3CC7 A;  2O9V A;  2DL8 A;  2P84 A;  3P8Y A;  3E9G A;  1ZA1 B;  4JRI A;  1EX4 A;  2ZAE A;  4XTX A;  2E10 A;  2P4R A;  2F2W A;  3I7F A;  4HCZ A;  4YRF A;  3GP8 A;  2L3P A;  5KYN A;  3QBY A;  3PE0 A;  1VQ8 Q;  2DYB A;  3CPF A;  1QLY A;  2RJD A;  5IHK A;  2FB7 A;  2HBP A;  1Q7Y R;  1B34 A;  2YRV A;  4EX5 A;  3IKM B;  3VS5 A;  2EKO A;  4K87 A;  3LH5 A;  2EKH A;  2M16 A;  3GPL A;  4M77 F;  3ER0 A;  1UHF A;  3VUB A;  1VQO T;  1UGP B;  2F5T X;  2E6Z A;  1M3B A;  2OTJ T;  2MK5 A;  4KH0 B;  1VQ9 T;  2QDL A;  1F1B B;  2KBT A;  3HP9 A;  2W0Z A;  1IB8 A;  2CP2 A;  2D1X A;  2GF7 A;  2VXF A;  3A7R A;  5EC7 A;  4N0A C;  1TUD A;  4EMH A;  3BDL A;  3ZFJ A;  2COW A;  2RI5 A;  2CP0 A;  5IN1 A;  3JCM W;  3HKS A;  3QO7 A;  3OYL A;  4E47 A;  3NFC A;  2EFI A;  1N9R A;  4CC4 B;  1HYO A;  2EQI A;  2P0K A;  1SKU B;  4Q5W A;  1KJW A;  5LJ5 d;  2YRD A;  4QT7 A;  1K73 R;  2FRW A;  3DLL A;  5LJ3 h;  2YUO A;  2PMF A;  3OS0 A;  1N6A A;  4LD6 A;  2RN8 A;  1Q81 C;  1VIE A;  3A8O B;  2CJ9 A;  1Y7X A;  2ESW A;  4IUR A;  1OPL A;  1Z9Q A;  3WVE B;  2E12 A;  3JAM E;  4AT1 B;  3HTZ A;  3WVD B;  3M4Q A;  1E6G A;  2V8I A;  3CCJ Q;  4EDU A;  3UWN A;  3C12 A;  1IHV A;  1OU9 A;  2BTT A;  2A08 A;  4GY5 A;  1G8X A;  1QVF A;  1NYQ A;  4O2D A;  4LE9 A;  1YIJ T;  4NS5 A;  3OD1 A;  2MI6 A;  2A8E A;  4ME7 A;  2PVO B;  1U8R A; 
#chains in the Genus database with same CATH homology
 5GAN g;  3UGQ A;  4LVK A;  4P72 A;  4P75 A;  1XQH A;  4M78 D;  2DXU A;  2QA4 A;  4C92 G;  3OW2 S;  5KE2 A;  1WU7 A;  3TUP A;  2ZNI A;  2E3C A;  3QG1 A;  4F7U B;  1P92 A;  4M75 F;  4PJO A;  4BDZ A;  4M77 B;  2KQW A;  2QHU A;  2RJC A;  3LH0 A;  2CZ7 B;  5GAN 5;  5I2M A;  2Y4X A;  4A4E A;  5LJ5 j;  11AS A;  1XNI A;  3KXT A;  4J7F A;  2QTX A;  1I81 A;  2RO0 A;  3MF2 A;  2LQ8 A;  3CCU A;  3JCM X;  1SSF A;  1GXI E;  1PYS A;  1VQ4 T;  3CCV A;  2L3R A;  3CCL A;  3JB9 J;  2DZ9 A;  3M59 A;  1W4S A;  1PSE A;  1NJI C;  1JB0 E;  4P73 C;  3G4S A;  2VC8 A;  4UP8 A;  3MO8 A;  1YJN A;  3G7Z A;  2FHD A;  1ASZ A;  4DPG A;  4C0D C;  1YFT A;  2FL7 A;  3ICA A;  2DXC A;  3CBP A;  3L1A A;  4C5G A;  1ZBX A;  1NPR A;  3NEM A;  3HFZ A;  1M9S A;  1UGS B;  1XTD A;  4M77 A;  4ZN3 A;  3I56 T;  1LOJ A;  2MMP A;  1O75 A;  1JJ2 S;  4K88 A;  2PUO B;  3CCE A;  4HCC A;  3WXM B;  3OMG A;  2EQM A;  3VJP A;  2L89 A;  2XGT A;  3QHS A;  3PTA A;  5ELN A;  3JCM Q;  4RMF A;  3GNG A;  2HNI A;  4EMK B;  4XTV A;  2EJG A;  4JRQ A;  4X9C A;  2E64 A;  3JB9 G;  4M7A E;  4MMK A;  2ZXF A;  1OYX A;  3QJ6 A;  3CC4 T;  4C8Q B;  4IUT A;  4KUI A;  5HK3 A;  4F7U E;  4RMO A;  1NPP A;  3VBB A;  1Q82 C;  2RJE A;  4MZT A;  3JCM h;  1FWZ A;  4DOW A;  2MWP A;  4VUB A;  4RCC A;  2QHV A;  5K1X A;  5FU6 B;  3VQV A;  1VQ5 T;  3RMS A;  3V8J A;  3QPH A;  2VUB A;  4TVA A;  1U1S A;  4EMK A;  3E9I A;  2RA2 A;  1I4K 1;  1H64 1;  4O6J A;  5GAN 2;  3M4P A;  1X6O A;  3RUX A;  4QVC A;  3S3O A;  4MDX A;  2EIF A;  3MP6 A;  4M75 A;  2KMT A;  4D6W A;  4NL3 A;  1VQM T;  1KC8 U;  1Q7Y C;  5J39 A;  3CCQ A;  3PIP A;  4DA4 A;  5CQY A;  3G71 T;  4CRI A;  1YBY A;  4TVR A;  2DD4 A;  3OYG A;  5FRM A;  4HKE A;  1W66 A;  3JCM P;  1B70 B;  3CEY A;  5GMK j;  1X56 A;  3RMQ A;  1G5H A;  3HL8 A;  3C94 A;  2A7Y A;  2M1H A;  3OA6 A;  4UC4 A;  4ZTU B;  4BI3 A;  1VQL A;  1YJW A;  1YI2 A;  3OYI A;  1QP3 A;  1M4Z A;  5IAY A;  1NE8 A;  1K73 C;  2M9U A;  4LVJ A;  4J8O A;  4JS4 A;  4C8Q E;  3P8V A;  3HRU A;  3QO3 A;  2R5M A;  3CCR A;  4JRP A;  2YLC A;  5HGQ A;  3DB4 A;  3FC3 A;  3FDR A;  2E5A A;  4RG8 A;  2EQU A;  2CIM A;  4M77 D;  4A54 A;  4KUD K;  2LVM A;  2I4N A;  3CME T;  3QZ5 B;  3JCM g;  3REX A;  1NNH A;  4BW9 A;  4ATO A;  3A7A A;  1G51 A;  2HD0 A;  3PT9 A;  2CKK A;  5M9O A;  1XOV A;  2LRQ A;  4H2X A;  2RB6 A;  3QJY A;  5LJ3 f;  4M7A C;  2Q7G A;  1WLE A;  5A0L A;  1VQO A;  2RHX A;  3SDZ A;  1YHQ A;  2OTJ A;  4EO4 A;  3A74 A;  3OYB A;  4N0A A;  5CO7 A;  5GAM h;  1M5Q 1;  4LVL A;  4Q15 A;  2LQK A;  1IRE B;  3UH0 A;  2DTO A;  5GMK m;  4OGC A;  3GNF B;  2P5I A;  3PFS A;  4NOY A;  2JVV A;  4JLG A;  1YFS A;  4E7H A;  1B76 A;  5KCO A;  1VQ8 T;  4FM4 B;  5CR2 A;  4MZP A;  2LT4 A;  4H2V A;  2XHC A;  5CAI A;  1UEB A;  3OS2 A;  3LC0 A;  2Q7H A;  1OZ3 A;  1H4V B;  3CXC A;  3MEW A;  5LJ3 e;  4QVD A;  1M1K C;  3BFM A;  4LDY A;  4C8Q D;  1GGM A;  3TEH A;  4M7D E;  2RHI A;  1YIJ A;  2ZZE A;  4C0D B;  1K8A C;  4YCU A;  3HFN A;  4H2S A;  1VQK A;  2DXT A;  2ZPI B;  5CKE A;  3QNE A;  1W2B S;  3E1S A;  4HCB A;  5FU7 C;  3DLM A;  3CCM A;  2AMC B;  5KNN A;  3X24 B;  1YIT T;  3IKL A;  2GFA A;  2E41 A;  4L59 A;  3M55 A;  1KHC A;  2Y4Y A;  3TRE A;  4YRK A;  4C0G A;  4Z02 A;  1USY C;  4YYE A;  2V8K A;  3HXX A;  4C8Q C;  1LYL A;  2K5L A;  2DIQ A;  3CCJ T;  1KHI A;  4H2Y A;  1VQ4 A;  4P73 A;  5L8R E;  3NEL A;  4J6X A;  2R58 A;  2ALY B;  3TEE A;  4YRQ A;  4YCW A;  4HT9 A;  4HWO A;  1QVG S;  4A4H A;  3A8M B;  5CKD A;  2MAM A;  5GAM g;  3QDR B;  2I4O A;  4BD3 A;  2XD0 A;  4RKU E;  4JRK A;  3HXZ A;  2AMC A;  3A5Z B;  3J80 E;  4WJ3 M;  2X4J A;  1KD1 C;  3I56 A;  4QQG A;  4XTU A;  3JCM f;  2DPP B;  2NS6 A;  3UGT A;  1HK9 A;  1KQS S;  4YRN A;  3G6E A;  3CC2 T;  3E19 A;  5J3B A;  3CCS T;  2PUK B;  4BDY A;  1WYD A;  4RQF A;  3X20 B;  2XDP A;  5FLX E;  5D6Y A;  4J83 A;  4YCV A;  1MGQ A;  1H4Q A;  3L2U A;  1HC7 A;  3LWI A;  3ERR A;  2H3J A;  1YJ9 T;  3OY9 A;  4M7A F;  3CD6 T;  3CC4 A;  3CPW A;  1NJ1 A;  4GLK A;  4IUP A;  4CH6 A;  4F7U F;  4MML A;  3NTI A;  4OMF B;  1Q81 U;  4HT8 A;  1N9S A;  3A5Z A;  2ZT7 A;  4X5O A;  4EPC A;  2CJA A;  2EWN A;  2D6F A;  1QP2 A;  4M78 G;  2A3L A;  4E51 A;  5LJ3 j;  1OI1 A;  1VQ5 A;  3E9F A;  3JCM e;  5F5W A;  1LNX A;  3A31 A;  4M7D C;  2ZPB B;  1M1F A;  1FXX A;  4YRT A;  3SFM A;  4HWR A;  1N8R C;  2JTM A;  2ZZD A;  2PU9 B;  1IZ6 A;  3EFR A;  1BI3 A;  3LWH A;  5FRO A;  4RCB A;  1VQM A;  2RHZ A;  4N4H A;  5KCH A;  2ZCE A;  2ZPE B;  5CKF A;  3G71 A;  3FLG A;  4C92 E;  1BKB A;  3A32 A;  1YB3 A;  4YRO A;  4CH5 A;  2IVW A;  1Y71 A;  3VQX A;  2DQ3 A;  4EMG A;  2BKD N;  3MET A;  2GFU A;  2RHQ B;  2QHT A;  1NJI U;  3JCM V;  5GAN 7;  5GMK l;  1ZHI A;  3MCA B;  4M7A B;  2P0P A;  3IAL A;  1NJ8 A;  4KR3 A;  1LJO A;  5IT9 E;  4OB3 B;  1VQP T;  4C8Q F;  3P8H A;  2QHS A;  1VQN T;  1JJC B;  4NCX A;  4ZIB A;  3MQZ A;  2CZ6 B;  4PLI A;  3OYA A;  1VIF A;  3OYF A;  2E1H A;  3OYK A;  3SB2 A;  2GQV A;  5DM7 R;  3M57 A;  3OS5 A;  1QF6 A;  3LSQ A;  2J3L A;  3M53 A;  4B9X A;  4N4G A;  3L2Z A;  2WSE E;  4PHC A;  3CME A;  2RHQ A;  4HWT A;  2RK2 A;  2X35 A;  4OB2 B;  3R6O A;  3OBW A;  2DQ0 A;  1TH7 A;  4O5V A;  4M7A A;  3CMA T;  4XTY A;  1X01 A;  1YGB A;  4CS2 A;  1G3Y A;  1VQ6 T;  1BBU A;  5LJ5 h;  4F7U A;  4BUG A;  5DLQ E;  3HFO A;  3MP1 A;  3L2V A;  3Q1J A;  1Q82 U;  3QO5 A;  4OP0 A;  2BIV A;  1VUB A;  4BI8 B;  1ADJ A;  1K9M C;  2XKO C;  3PCO B;  2ZPG B;  1D3B B;  3MEY A;  3LLR A;  3A8H B;  4LVI A;  3LYI A;  3CBO A;  5FU7 B;  3VUZ A;  4C0F A;  4BY6 B;  4YRP A;  2QQ9 A;  4OB0 B;  4Y91 A;  5GAM e;  4TQD A;  3LW5 E;  1VQ8 A;  2ARU A;  3PMT A;  3OYC A;  1I5L A;  1WGS A;  2K5I A;  1NJ5 A;  2QQA A;  3QXE B;  4PJO G;  2L8D A;  2ZGW A;  1Q7Y U;  4E7I A;  2JZ2 A;  3NTH A;  4MDW A;  1BYM A;  2ZIN A;  1WQW A;  4FL6 A;  3RKY A;  2RHS B;  4PNO A;  1UGR B;  1RI0 A;  4C92 C;  2RK1 A;  1JBM A;  4BAC A;  3S3M A;  2F5K A;  2RJF A;  5I21 A;  3INZ A;  4M7D F;  2CGH A;  2DD5 A;  3PCO A;  2KSS A;  1VQ7 T;  2ZCF B;  2YHT A;  5C53 B;  4PKC C;  1QVF S;  3RER A;  3FRN A;  3MP8 A;  3HXW A;  2OTL T;  2ZZG A;  1USY A;  2K2V A;  1K73 U;  2ZIO A;  2XTI A;  4C8Q A;  3S6W A;  5GAN f;  4M77 G;  1VQZ A;  2O01 E;  3JCM b;  3IG2 A;  1G3S A;  3CCJ A;  3LGL A;  4R56 A;  2RHS A;  5LJ5 g;  2KY9 A;  4ELZ C;  1E1O A;  2PVD B;  1YCY A;  3JB9 D;  3S3N A;  2DIG A;  4QVZ A;  5C6S A;  1B7Y B;  2JN0 A;  4HT4 A;  4XAX B;  4ZTF A;  5HKC A;  3OYM A;  4LDV A;  3OYE A;  2I2L A;  2L5Q A;  2C7I A;  1Y96 B;  4YRL A;  1PSF A;  2IY5 B;  5A2Q E;  2I4M A;  4QQD A;  2LX9 A;  2PQW A;  2ART A;  1EOV A;  4XU0 A;  3VKI A;  3H6Z A;  2DEQ A;  2X4W A;  4KT0 E;  4UP7 A;  5C51 B;  5CQX A;  4M7A D;  4ZTJ A;  3RL6 A;  3CC2 A;  1X55 A;  4M7D B;  5GMK h;  4YRS A;  2GCX A;  3CCS A;  3G1Z A;  5GAN e;  4WF2 A;  3ZBD A;  1B70 A;  4JUV A;  1G3T A;  1ADY A;  12AS A;  4P3P A;  3RES A;  1YJ9 A;  4HWP A;  2PVG B;  3OBY A;  3QKJ A;  3PMI A;  3CD6 A;  4FIB A;  4AH6 A;  4M75 G;  2V8J A;  1Y96 A;  4UP9 A;  2IY5 A;  1SES A;  1I8F A;  2WSC E;  2KK4 A;  3X26 B;  3VQY A;  1VQ9 A;  1E24 A;  3ASK A;  3SWN B;  1M1K U;  4ZGE B;  2RHY A;  4M7D A;  4A4K A;  3DKM A;  4A4G A;  4IUU A;  2RI2 A;  4G84 A;  1K8A U;  5CIU A;  1H3Z A;  3LX7 A;  2CZ1 B;  3CCE T;  5ELO A;  3VYH B;  2ZR3 A;  2JTF A;  2LNV A;  1RIQ A;  3OYN A;  3NEN A;  1L0W A;  1SET A;  1HTT A;  1YFR A;  4Q6G A;  1M90 C;  2DO3 A;  5GAN 4;  3RKX A;  2DU5 A;  5DY9 A;  3RAC A;  4C92 F;  5CK9 A;  3HRI A;  4OB1 B;  4X9D A;  4LNS A;  5GAN d;  4PLL A;  1KMN A;  2DJZ A;  4C5E A;  1HXD A;  2ZNJ A;  4P74 C;  2K3X A;  3J7A F;  4FSX A;  3A8G B;  4BY6 C;  2ZPF B;  2DVE A;  3P8B B;  3R07 A;  4IUQ A;  3GOX A;  2G4C A;  2D0Q B;  2XDD A;  4YPF A;  5LJ5 f;  1VQP A;  3L2W A;  4YRR A;  1WQ7 A;  1KD1 U;  1SER A;  4BI4 A;  3L2R A;  2Q5H A;  3QUI A;  4P71 C;  2M0O A;  5GAN 8;  4XQ3 A;  2EQJ A;  3PNW C;  1O9S A;  1EFW A;  4V2S A;  4PL6 A;  4X34 A;  1FX7 A;  1WPY A;  5GAN j;  1H4S A;  3URG A;  2QXF A;  4MZM A;  4BB7 A;  3M9Q A;  1X75 C;  2QI2 A;  4C5I A;  2Q7E A;  1VQ6 A;  4P5N A;  3OW2 A;  4C92 B;  2XIC A;  3JCM c;  5LJ3 d;  2C06 A;  3HXU A;  3JB9 F;  2DXB A;  1B34 B;  1UGQ B;  3MHX A;  4IUV A;  5LJ5 e;  3RIR A;  4YDQ A;  2XU8 A;  2EJF A;  1C0A A;  1KG1 A;  2QDY B;  4E7J A;  3OYY A;  4HA8 A;  3AHU A;  1Z7N A;  1BIA A;  2ALY A;  3KUF A;  4XEO A;  4M78 E;  2LTO A;  3HRK A;  1J5W A;  2E6N A;  1N8R U;  4M7D D;  4P3O A;  2JUF A;  3A5Y A;  2I4L A;  3TU4 K;  2XI9 A;  5C0M A;  1EVL A;  4DOV A;  3CBM A;  2E65 A;  4C92 A;  3OYH A;  3V7S A;  4XTW A;  1JJ2 A;  3QII A;  2QEX T;  4JJN K;  4BWA A;  5D6X A;  5GAO q;  3CXC S;  1B8A A;  2HAX A;  1VQ7 A;  1YHQ T;  3C95 A;  1H4T A;  1G3W A;  3PGG A;  5I2S A;  4XU1 A;  4YP0 A;  3KBG A;  2OTL A;  3QO8 A;  1EIY B;  4XTZ A;  2XK0 A;  3UPU A;  3M58 A;  3ZEH A;  4BE0 A;  3P8T A;  2J3M A;  5HK0 A;  3P8D A;  4Y28 E;  2LCL A;  2KVQ G;  3GLX A;  4PJO B;  1Z7M A;  3VU3 C;  4C5H A;  2JNG A;  3M5A A;  2ARS A;  4BE2 A;  4YRG A;  2OAU A;  4YRE A;  4L87 A;  4KUL A;  2RH2 A;  4FU6 A;  3HRS A;  1S72 T;  3OSS C;  3SWN C;  3FEO A;  4OF1 A;  4A4F A;  4QQ6 A;  4YRM A;  3O8V A;  4YRC A;  1E22 A;  1PYS B;  2NLU A;  5A0G A;  4HVC A;  4RQE A;  4RG2 A;  1Q86 U;  1ASY A;  2K57 A;  1WNL A;  2E70 A;  4NL2 A;  4TQF A;  2RD1 A;  3HXY A;  1EIY A;  4E7K A;  1VQK T;  3FB9 A;  1AHJ B;  1ZQ1 A;  2ZR2 A;  2EYQ A;  3CCM T;  1NJ6 A;  2VXE A;  2AKW B;  4N4I A;  3HFZ B;  5E3I A;  1BI0 A;  4R55 A;  5GAM f;  1K9M U;  4B9W A;  3JCM d;  1QW1 A;  2R57 A;  3HPW A;  2P0L A;  4CH3 A;  3MEU A;  4OGE A;  4ZTZ B;  5GAO m;  3I55 T;  5K1P A;  5GMK e;  1ATI A;  4XU3 A;  3HRT A;  4YRI A;  1Q86 C;  4M78 C;  3QZ9 B;  3CMQ A;  2CZ0 B;  3OYD A;  4L5G A;  2XG8 D;  4TVW A;  4KBM B;  2QQB A;  3BDU A;  3CPW S;  4CS3 A;  1JJC A;  3RGL A;  3BW1 A;  5LL6 S;  4FT2 A;  4PJO E;  2BUD A;  4TVY A;  4BE1 A;  2VGM A;  2LT1 A;  3NTK A;  2AKW A;  1Y07 A;  3M54 A;  5CKB A;  4C92 D;  3C4S A;  1EIF A;  2DTI A;  1E1T A;  3G6E T;  2XDB A;  2DU7 A;  3DSQ A;  5GAN 6;  5LJ3 g;  3CC7 T;  3ME9 A;  4H2T A;  2QQS A;  4TVA B;  1U1T A;  3H8Z A;  2DDZ A;  3A8L B;  5GAO n;  4J6W A;  3LGF A;  2VV5 A;  3N5B B;  3T9N A;  3TCJ A;  3RKW A;  2D9T A;  4M75 B;  3MEV A;  1NZ9 A;  3VYG A;  3E9H A;  4H02 A;  3VQW A;  2CJB A;  4P74 A;  4LDX A;  3L42 A;  5GAO p;  4M77 E;  1X2G A;  4ZGJ B;  1D3B A;  3EFS A;  2DK3 A;  1X54 A;  4ELY C;  4TWA A;  2LC4 A;  2FYK A;  1SRY A;  1WJQ A;  3V7R A;  1YIT A;  4M7A G;  1KOG A;  2F69 A;  2Y90 A;  4F7U G;  3FIF A;  5J26 A;  5HY6 A;  2X4X A;  5EG2 A;  4QW2 A;  4P71 A;  4ZGD B;  1BI2 A;  1N27 A;  2O4X B;  4ZN1 A;  2ODR D;  2K3Y A;  2WSF E;  4LD9 K;  2E5Q A;  1X2H A;  4WJ4 A;  2ZZF A;  3L4G B;  2P0Q A;  4XU2 A;  5GAM d;  2QQR A;  3JRZ A;  4PJO D;  2X4Y A;  3X28 B;  2MWO A;  1W2B A;  5C52 B;  1BBW A;  1EQR A;  2ODR C;  4J7I A;  3J81 E;  4IKF A;  2Q5I A;  3MEA A;  2R5A A;  1V29 B;  3LSS A;  1R8O B;  2QA4 T;  4H2X B;  4P72 C;  3QSU A;  4P75 C;  3QYG B;  2K5F A;  1OZ2 A;  4M75 E;  3V8L A;  2DTH A;  1KC8 C;  4LDU A;  2O4X A;  1M1G A;  1FYF A;  5KE3 A;  3VV0 A;  4PJO C;  3W3S A;  3M56 A;  3M4G A;  3L4G A;  1QE0 A;  3JB9 H;  1B7Y A;  3L2Q A;  4M78 F;  3CCU T;  2EJ9 A;  3OSV A;  3CCV T;  3CCL T;  1QVG A;  4L6V 5;  1JRI A;  2DKG A;  5GAM j;  1M90 U;  3HXV A;  3G4S T;  5FRN A;  2ZT5 A;  3QYH B;  4C8Q G;  1YJN T;  2FVU A;  3DB3 A;  1BI1 A;  4OLF A;  4C0Z A;  2LDM A;  4KR2 A;  2QEX A;  3UDC A;  2G3R A;  1KQS A;  4CH4 A;  2B8A A;  4CS4 A;  4RDX A;  1KMM A;  4M77 C;  2VGN A;  1M8V A;  2RHU A;  5D6W A;  3TEH B;  4XEM A;  5GAO l;  5GAO r;  2RI3 A;  3GIB A;  1NJ2 A;  4K86 A;  3V8K A;  4YRJ A;  2KAF A;  3OB9 A;  1WJR A;  4XK8 E;  3M4Y A;  1MHN A;  3REU A;  2JOY A;  3OQ5 A;  4J5Y A;  1N9W A;  3TEG A;  2YLB A;  3JCM J;  5DLO A;  3F70 A;  4G85 A;  3HSB A;  1EVK A;  3JSC A;  1RL2 A;  3SWN A;  5KH6 A;  3A7U A;  2MF2 A;  4II1 A;  5A0D A;  1S72 A;  4M78 B;  3HY1 A;  3HY0 A;  2WAC A;  4M75 D;  4JS5 A;  5CCA A;  1BIB A;  1KQ2 A;  1WJS A;  3PIO A;  3X25 B;  3WQZ A;  3QTC A;  1KQ1 A;  2EQK A;  3HHT B;  4TTV A;  1VQN A;  3EAE A;  5GMK i;  2ZIM A;  4PG3 A;  4OVA A;  4CI0 C;  1DJ7 B;  3JB9 I;  2K4Y A;  3KFU A;  2EAY A;  4EMK C;  3MF1 A;  4JDS A;  4H2U A;  3UFG A;  5AYF A;  4M75 C;  3CCQ T;  1G5V A;  4KQE A;  4M7D G;  4J6Y A;  4H2W A;  3V7C A;  1UB4 A;  4DQ2 A;  3BJU A;  2HQE A;  3PZC A;  2IG0 A;  2AHJ B;  2DZC A;  2DAQ A;  5CKH A;  2CS7 A;  2PME A;  3I55 A;  3SD4 A;  3RF1 A;  2C8M A;  3OS1 A;  1QVP A;  4M78 A;  1IL2 A;  4JLI A;  4YTL A;  3CMA A;  1G5I A;  3HFV A;  2ZT6 A;  2KDS A;  4J15 A;  3OMC A;  1NYR A;  4HWS A;  2XID A;  5FU6 C;  4FT4 A;  2HQX A;  1VQL T;  4LVM A;  1YJW T;  3FJP A;  1YI2 T;  2ZTG A;  4A53 A;  4PJO F;  4P3N A;  5CVI A;  3OYJ A;  4E7L A;  2EL9 A;  2RM4 A;  2LCC A;  3NET A;  4WI1 A;  2ZPH B;  3GF5 A;  5GAN h;  2CYZ B;  2VYT A;  3CCR T;  3UT1 A;  4LDW A;  4UPA A;  3BY7 A;  5GAN 3;  2ZT8 A;  2P4T A;  3CC7 A;  3P8Y A;  3E9G A;  4JRI A;  4XTX A;  2E10 A;  3I7F A;  4HCZ A;  4YRF A;  3GP8 A;  3QBY A;  3CPF A;  2RJD A;  2FB7 A;  2HBP A;  1B34 A;  2YRV A;  4EX5 A;  3IKM B;  2EKO A;  4K87 A;  2M16 A;  3GPL A;  4M77 F;  3ER0 A;  3VUB A;  1VQO T;  1UGP B;  2F5T X;  2E6Z A;  2OTJ T;  1VQ9 T;  3HP9 A;  2GF7 A;  2VXF A;  3A7R A;  4N0A C;  4EMH A;  3BDL A;  3ZFJ A;  2RI5 A;  3JCM W;  5IN1 A;  3HKS A;  3QO7 A;  3OYL A;  4E47 A;  3NFC A;  2EFI A;  1N9R A;  2P0K A;  4Q5W A;  5LJ5 d;  3DLL A;  5LJ3 h;  2PMF A;  3OS0 A;  1N6A A;  4LD6 A;  1Q81 C;  1VIE A;  3A8O B;  2CJ9 A;  1Y7X A;  4IUR A;  3WVE B;  2E12 A;  3JAM E;  3HTZ A;  3WVD B;  3M4Q A;  2V8I A;  4EDU A;  3UWN A;  3C12 A;  4GY5 A;  4O2D A;  1QVF A;  1NYQ A;  1YIJ T;  4NS5 A;  3OD1 A;  2MI6 A;  2A8E A;  4ME7 A;  2PVO B;  1U8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...