2DXUA

Crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation r48a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
235
structure length
231
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKISFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--[acetyl-CoA-carboxylase] ligase
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 67
structure length 231
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dxuA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dxuA01
1U1TA 3HXZA 3RL6A 4Q6GA 4V2SA 3HTZA 3SWNC 4DPGA 4M7DG 4M75F 2ZGWA 4M77B 2IY5A 1WQ7A 2DXUA 4XTZA 4HWSA 2E5AA 4L87A 4H2SA 1WU7A 1WPYA 4PNOA 4RCCA 2Q7HA 4YCWA 4UP7A 3VBBA 4OP0A 4PJOB 1EVLA 2C7IA 1H4SA 3NENA 1HC7A 4UPAA 4K88A 2JN0A 2FYKA 3REXA 4EO4A 4UP8A 2FB7A 3JCMW 1B7YA 1U1SA 3P8TA 3WQZA 1YGBA 3V7CA 4CH6A 4YRIA 4M7DE 2ODRD 2QHUA 3VQVA 1B70B 3MF1A 2AMCB 4C92B 5LJ3h 3HY1A 3HFZA 2J3LA 4KQEA 1BBWA 4YRCA 4M7DF 2ZINA 4NL2A 1M5Q1 4P74C 2QTXA 3V7SA 4KR2A 2YHTA 3AHUA 2DQ0A 3QO3A 4M78C 5LJ5d 3RIRA 4H2TA 2I4NA 4ZTZB 1RIQA 1H4QA 5GMKe 4XTUA 3NEMA 1KQ2A 4WF2A 3FB9A 1E24A 1TH7A 4A53A 3BJUA 4PHCA 4YRLA 5GAMh 4XTWA 3M4PA 2P0LA 3TEGA 1YCYA 1WNLA 1YFTA 3OD1A 4EX5A 1KMMA 2EL9A 4P3NA 2RHQA 1ADJA 4X5OA 3QUIA 2QHSA 3UGQA 3A7UA 3E9IA 4F7UA 3HFZB 5HGQA 1EIYB 2E10A 2DTOA 5GAN4 3DSQA 4J6XA 4J6WA 4YRGA 4YPFA 3BW1A 4M78G 5LJ5g 3JCMd 1B76A 2I4LA 4P73A 2ZZEA 2DZ9A 4M7AG 4YYEA 4NL3A 3W3SA 3BY7A 4PJOD 4C8QC 1LJOA 1N9WA 1I8FA 3HRKA 3VQYA 4M77A 3V8JA 4M75G 4EMKA 5GMKi 4PG3A 5K1XA 2DU7A 1BBUA 1EQRA 3JCMX 4H2WA 2EJGA 3V8KA 4PJOA 4JLIA 4HT8A 1PYSB 3FJPA 2QHVA 3QO5A 4G85A 4M78E 2Y90A 5GMKh 3RERA 4X9CA 1M8VA 2QHTA 2YLCA 4XTXA 4XTYA 4M78F 3PGGA 3JB9J 4C92C 2E65A 1GGMA 3M4QA 4YP0A 4M7AF 3RF1A 3JCMg 3QO7A 4HWPA 4XTVA 2RHSA 2VC8A 1B70A 2AMCA 4YRKA 1KQ1A 2VXEA 1X2HA 4MMKA 4P3OA 4C8QG 4YRRA 3KFUA 3HXYA 4P72C 4TVWA 4HT9A 3GIBA 4EMKB 1NNHA 4P71A 5GMKm 4ZTUB 4CH5A 2HNIA 4YRPA 5GANd 2VXFA 3BDUA 1NJ8A 4X9DA 12ASA 1YFRA 2XTIA 4Q15A 1NJ5A 1HTTA 4TWAA 4H2XB 4YDQA 3UFGA 4M77E 2ZT8A 2DXTA 1NJ1A 4C92G 5GAN2 3INZA 3JCMc 4C8QE 5DY9A 4K87A 2Q5IA 4P3PA 4CS3A 2I4OA 2DDZA 3A7AA 2RHSB 3HRIA 1G51A 4XU2A 4WJ3M 4YRFA 4ZIBA 2ZNJA 4YRMA 4C8QF 4HVCA 2ZZFA 4EMGA 1VQZA 1NYQA 4XEOA 1EIYA 5I21A 2Q7GA 3NETA 5GMKj 4UP9A 2K57A 2DJZA 4HWRA 5LJ3d 3RESA 2J3MA 4A54A 2CJAA 2E41A 4EMHA 5GANg 4C92E 2CJBA 4YRTA 2E64A 2EWNA 2PMFA 2C8MA 3A5ZA 4TTVA 4DQ2A 3LSQA 4C92F 1EOVA 3JB9I 2DTIA 4XU3A 4M7AD 3A31A 3FIFA 3L2ZA 4N0AA 1L0WA 2PMEA 2ZZGA 3SWNB 1PYSA 1SRYA 5GAMd 1ASZA 3QHSA 1KMNA 3IG2A 1X55A 4P73C 4YROA 5GAN3 4E51A 4M75D 3JB9G 4NCXA 3QTCA 2EAYA 3MEYA 5GAN5 4HA8A 3L1AA 3UH0A 2ALYB 4AH6A 3JCMP 3JCMJ 3ICAA 2DU5A 5LJ3g 4P75A 2DZCA 2Q7EA 1Y96B 2EJFA 4H2VA 4M77C 3RKYA 3JCMh 2ZIOA 4EMKC 3MF2A 5GAOn 3E9HA 4M75A 3JCMQ 1BIBA 3HY0A 3L4GA 4JRIA 3QO8A 4PJOC 1Z7NA 4F7UG 2ARSA 1ADYA 4J6YA 2ZT6A 1QF6A 1USYA 4YREA 1EVKA 1LYLA 4CS4A 4YRJA 1E1OA 2RD1A 11ASA 4M7DD 5GAMg 3JB9F 1X01A 3JCMV 1LOJA 5LJ5j 2ZXFA 4H2XA 3LC0A 1N9RA 5LJ5f 5GAOq 4M7AB 2ZTGA 1E1TA 2G4CA 3V8LA 2ARTA 5LJ5e 1X54A 3IKLA 3JB9H 2E1HA 4QVCA 2ZT7A 4M77G 4F7UE 1SESA 4M7DA 4JRKA 3RKXA 3A74A 3HXUA 2YLBA 1D3BB 4M75B 2E3CA 4P71C 1HXDA 3L4GB 4CS2A 1H4VB 3HXWA 4F7UF 4CH3A 3M4GA 1B8AA 4PJOG 3ERRA 4YRNA 1WQWA 3QSUA 5K1PA 4H02A 2DKGA 5GAOr 1JRIA 1HK9A 5E3IA 1E22A 4QVDA 4J15A 3JCMf 3R07A 5F5WA 5KNNA 3HXXA 5GAN6 3P8VA 3TEHB 4NOYA 4P72A 2I2LA 4M77F 3JCMe 4C8QB 1H641 1QE0A 4PJOE 4BW9A 4M7DB 3SWNA 3PZCA 2ZIMA 3RUXA 2ODRC 4XU0A 3V7RA 1I5LA 4XEMA 4PJOF 1YFSA 4WI1A 2AKWB 1WLEA 3RACA 4H2UA 2ZR3A 4XU1A 2ALYA 4G84A 3A7RA 4YRQA 3EFSA 1Y96A 2DEQA 4TQDA 3RGLA 5LJ5h 1LNXA 5C51B 3JB9D 3LSSA 4Y91A 1MGQA 5GAOp 4RCBA 4YRSA 4YCVA 4CH4A 4N0AC 5GAN8 4M78D 1YB3A 2IY5B 3G1ZA 5C52B 2ZNIA 4TVYA 2P5IA 4RMFA 2ZT5A 4HWTA 1W66A 2CIMA 4P74A 4RQFA 4M7AC 4OLFA 2RM4A 1BIAA 2XGTA 4KR3A 1I81A 4TQFA 2Q5HA 1H4TA 4M78A 4P75C 4WJ4A 5ELNA 4M7AA 2ZCEA 5GANj 3RKWA 5GANf 3IKMB 1B7YB 4J5YA 4M75C 2EJ9A 1JJCA 3HFVA 1WYDA 5GANe 1NYRA 2CGHA 5ELOA 4MMLA 1D3BA 3JCMb 4TVAA 1EFWA 1IL2A 3HXVA 1B34A 1Z7MA 3NELA 5C53B 1ASYA 1USYC 2ARUA 5GAOl 1J5WA 4LNSA 2RB6A 3BFMA 4M77D 4XQ3A 3PCOA 2RA2A 4C8QD 5CAIA 1ATIA 3REUA 4RQEA 3HFNA 3SB2A 1JBMA 4M78B 5GAOm 3I7FA 3P8YA 4O2DA 5LJ3j 2CJ9A 3EFRA 5LJ3f 3HSBA 4M7DC 2I4MA 4K86A 3VU3C 2ZR2A 3TEHA 1C0AA 1I4K1 2RHQB 4C8QA 5LJ3e 1JJCB 2DTHA 3VQXA 1N9SA 3TUPA 4HWOA 3VQWA 3UGTA 4F7UB 1KOGA 4TVAB 1SERA 1G5IA 1B34B 4C92D 1G5HA 2AKWA 3QNEA 4M7AE 1X2GA 3CMQA 1X56A 4BWAA 1SETA 1NJ6A 4YCUA 5GAMj 3A5YA 5GAMf 1FYFA 3PCOB 2DVEA 3HFOA 3IALA 2DQ3A 4H2YA 5GAN7 4RDXA 5GMKl 1NJ2A 4M75E 4C92A 5GAMe 3A32A 4JUVA 5GANh
chains in the Genus database with same CATH superfamily
2PNIA 4R56A 2C0IA 1AWJA 4M7DG 3AT1B 2DXUA 4BDZA 4XTZA 2FZCB 3I9QA 3M5AA 1MMNA 2PQWA 3SDZA 4FSXA 7AT1B 1WPYA 4RCCA 1RI9A 1FWZA 3CXCS 1K9MC 4DBHA 4OP0A 4O5VA 1EVLA 1BU1A 1AT1B 3UWNA 2M02A 2SRCA 1H4SA 4IIMA 1HJDA 1RLPC 4UPAA 3REBB 1Q82C 5CVIA 2FYKA 1I0CA 2DEUA 2FB7A 1VQ5A 2JJ9A 3JCMW 1U1SA 4BY6C 2C06A 4JRQA 3NFCA 2ODRD 4AG1C 3L42A 3MF1A 5LJ3h 4AG2C 2PTKA 4RTWA 3HFZA 3G4SA 1X2KA 1VQ4T 3EG0A 2HQHA 1TUCA 2MF2A 4OMOA 3CCRT 1Q86U 1YN8A 3AHUA 4KULA 3QWXX 2C0TA 2EGCA 3KBGA 3RIRA 3LH0A 5DLQE 1RIQA 4DOVA 1K9MU 1YWPA 2DL4A 4LVIA 3NEMA 3HL8A 1X27A 1TH7A 3BJUA 2QQBA 1VYVA 2DRKA 1Q82U 2P0LA 1SRMA 4QKUA 4JS4A 1YCYA 2JT4A 3OYYA 1Q7YR 1YFTA 4EX5A 4QQDA 3S6WA 2E12A 2MWOA 4FYXB 1VQLT 1QKWA 3CCJT 3HFZB 1IRXA 2VB6A 3X24B 1C1AA 4A4FA 2E10A 1JJ2P 2DTOA 5EC7A 5GAN4 3LWHA 4EDUA 4J6XA 2QEXA 1R8OB 2JVVA 2YXYA 3SHWA 3BW1A 1Y0MA 3CCVT 3A8GB 5LJ5g 2NUTA 2YDLA 2DZ9A 3KFVA 1QVPA 2L8DA 4NL3A 3W3SA 1D0YA 3OBYA 2J6FA 1GBRA 3DKMA 4C5HA 2XK0A 3A5ZB 4M77A 1VQ8Q 1MV0B 3OB9A 1YBYA 1VQ5Q 1PRLC 3TREA 1E6HA 3I55Q 3C94A 1JQQA 1UGSB 5K1XA 1MUZA 4OMMA 2DXCA 2J7IA 3OS1A 4G85A 1Q7YC 1LVKA 2DIGA 1OI1A 1X75C 4LUDA 4A4GA 4CC7A 3RERA 3WXMB 5CO7A 2HMAA 1SSFA 3JB9J 4LD9K 2NLUA 2HBWA 4BI3A 2LX9A 2NUTB 3EGDB 3JCMg 3QO7A 2RHSA 1B70A 2AMCA 2RK1A 2ZAEA 1QVGS 4CC2A 1NM7A 2DD5A 1ZUUA 4TVWA 3GIBA 4DBRA 3VYGA 5IHNA 2X51A 5GMKm 2D0NA 2YUOA 4GY5A 4YRPA 3MEWA 2BE9B 3BDLA 2DVJA 3F70A 4Q15A 1NJ5A 1Q7YU 2DFUA 4TWAA 2HCKA 1VQ7A 4M77E 2LCLA 1UGPB 1QMCA 2QEXQ 3G1JA 2BZYA 4K87A 2A37A 2GFUA 2GGRA 2Q5IA 4JZ4A 4P3PA 4DEYA 3A7AA 2RHSB 1IO6A 1D09B 4BE0A 1M1KR 4HVCA 1W1FA 1JEGA 4MZTA 4BB7A 4QT7A 3S3MA 5GMKj 1RACB 3FJ5A 3CMEA 3TEEA 1OX9A 3RESA 5LJ3d 2OTLA 2RH2A 5GANg 5CKFA 4HT4A 4TVRA 2EWNA 5FU6C 4FW2A 1ACMB 4ZNXA 1VQ4Q 3WVDB 2MMPA 3GF5A 3CCRQ 3M0SA 1UB4A 1QVFA 1N8RR 4M7AD 3FIFA 2K7AA 3L2ZA 4N0AA 2PMEA 2EGAA 2CP6A 2KRMA 3IG2A 1ASZA 4M75D 2EAYA 3GNGA 2KMTA 2QG9B 1W4SA 3CCSA 1M1KC 3EG3A 3O8VA 2DF6A 1WGSA 4RUGA 3JCMJ 1RLQC 4FT4A 2DZCA 2RF0A 5CKHA 1Y96B 1PKSA 3CPWS 2EJFA 3PNWC 1VQLQ 4M77C 4QVZA 2K3BA 4RTTA 3X25B 3RMSA 2ZIOA 3QYHB 5GAOn 4IURA 1WJQA 2EKHA 3MHXA 4M75A 2OAUA 5FROA 3L4GA 4JRIA 2K4YA 1M8MA 1ZA1B 3VUBA 3RBBB 4HCZA 3CCVQ 3CD6T 1GCPA 2DERA 1ADYA 2ZT6A 3NMZC 2ZPGB 1EVKA 1WXUA 4CS4A 3THKA 4FYVB 4RTVA 1HSQA 2Y4YA 1ABOA 2QQSA 5GAMg 1T0JA 1N8RC 1X01A 1LOJA 3OS5A 5LJ5j 2G6FX 5LJ5f 4HCKA 5GAOq 1K9AA 4M7AB 2XG8D 1E1TA 2XMFA 3CMEQ 1E7OA 1M1KU 2E1HA 2OTLQ 2ZT7A 4XAXB 4M77G 4F7UE 3PE0A 1FMKA 1SESA 4GLKA 1VQOA 1P92A 4M75B 3L4GB 1RI0A 1KQSS 4J9HA 3HXWA 4F7UF 2LP5A 3M4GA 2AKLA 2HBPA 1YWOA 2ECZA 4C0DB 1GFDA 2DKGA 5IAYA 5GAOr 1JRIA 2FVUA 1MNEA 5E3IA 2CP5A 1VQPT 4PJNA 2V8IA 2KNBB 1O75A 1N8RU 3FC3A 2M51A 5KYWA 1T0HA 3JCMf 5KNNA 2WSFE 3I56T 5GAN6 4NOYA 4UC4A 2ED0A 1H641 4ZTFA 2NWMA 4PJOE 4BW9A 1VQMA 3SWNA 3VS1A 4FYYB 1GXIE 2JMAA 3LWIA 4XU0A 4PJOF 1YFSA 5IXBA 2NYSA 1E6GA 2EVRA 4FCYA 4H2UA 3ULRB 2E5QA 3CCMT 3EFSA 3X20B 3CD6A 2RO0A 4N4IA 4PLIA 5LJ5h 4FSSA 2DM1A 1MGQA 5A0DA 5KYWB 4CH4A 4N0AC 5GAN8 2IY5B 1FMVA 3QWYA 3EH1A 4TVYA 2KEAA 3EAEA 2ZT5A 4RQFA 4M7AC 4OMQA 1WYXA 4IIOA 1W2BS 1CSKA 2M0OA 3CXCP 2Q5HA 4PJMA 5IH2A 3JRZA 3GOXA 3UDCA 3OYGA 2RJEA 1PD1A 3EGXA 5GANj 3A98A 5GANf 2QDYB 4M75C 4F17A 4ORZA 2K3YA 1VYUA 4XK8E 1WYDA 2HQXA 1UTIA 1VQPA 4LNPA 2KYBA 4C0DC 1B34A 2ARUA 2R57A 4JLGA 1TSFA 3GLXA 2J05A 4O6JA 4LNSA 2JXBA 2A08A 3M4YA 1WHMA 3H9NA 5CCAA 4XQ3A 3OSVA 5CQYA 2LT4A 1VQMQ 3CBOA 4C8QD 5KH6A 4ZTJA 1EZZB 3SB2A 2AK5A 2GBQA 2VV5A 4FYWB 3P8YA 4O2DA 2JUFA 3J81E 1QP3A 4LXCA 1YITT 1M27C 2YRVA 3VU3C 1UGRB 2B86A 1RADB 2QTVA 4C8QA 2E70A 3CD6Q 4LUEA 3VQXA 1N9SA 1QVGA 2D9TA 1SERA 1B34B 4C92D 2LQ8A 2AKWA 3QNEA 2M16A 1NYFA 2FEIA 1X56A 2LQWA 4A63B 2J06A 1U3OA 3VRZA 5GAMj 1JXMA 5GAMf 4KUDK 2E5KA 5DLOA 3CC2A 2DQ3A 4JJCA 5GAN7 1NJ2A 4C92A 5GANh 1IGUA 1U1TA 4J9BA 2LTOA 1MMGA 2ENMA 3SWNC 2RPNA 3NTIA 1LPLA 2OAWA 4H2SA 1WU7A 5FU7B 3VBBA 2DO3A 1SPKA 2MI6A 4J7IA 3CC4A 2W10A 4J9EA 1IHVA 1VQPQ 3NENA 2XD0A 4D8KA 1EIFA 4K88A 3MQZA 8ATCB 3J7AF 2VYTA 1B7YA 2E3IA 2O9SA 4M7DE 3GBQA 3VQVA 3E9GA 4C92B 1M9SA 2FZGB 5AYFA 4M7DF 3QPHA 1AD5A 2ZINA 2RN8A 4NL2A 1M5Q1 2XI9A 2ZPBB 3PT9A 1QVGP 3A8OB 1BYMA 4PJLA 2HQEA 3E19A 2DQ0A 5LJ5d 2LVMA 4PFPA 3CCMQ 4H2TA 4BUGA 4ZTZB 1H92A 1H4QA 5GMKe 4E47A 4C5EA 1D0ZA 3O5ZA 2RQUA 1UUEA 1KQ2A 4C5IA 1E24A 4PHCA 1XJWB 5GAMh 3EG1A 1WHGA 2HZYA 1MV3A 2P0QA 1C0MA 1WNLA 3OD1A 1OX8A 4OGEA 1HD3A 2KXDA 2RHQA 1QVFS 1ADJA 3QXEB 2H3EB 2CKKA 3MO8A 1M1GA 3QUIA 3QDFA 3A7UA 3OSSC 5KE2A 3WVEB 1EIYB 3LYIA 3M0UA 1VQ5T 1IB8A 2B8AA 3NTHA 1X6BA 4R0KA 5KYUA 1Q86R 4YPFA 3JCMd 4LVKA 4AFUC 4KGXB 3JSCA 3LGFA 2HL5C 4YYEA 1TWBA 2FRWA 3BY7A 3G4ST 1IXDA 1X43A 2DAQA 4BACA 1UGQB 2LCCA 4C8QC 1N9WA 2DPPB 4X34A 2MCNA 1R0BG 3HRKA 5M9OA 3V8JA 2O88A 2CH4A 3LH5A 2P4RA 1QWEA 1Q82R 5GMKi 4PG3A 2DU7A 1BBUA 3JCMX 4BI8B 4R55A 1NPRA 2CH4W 2I0NA 4FIBA 1D1BA 4BE1A 4HT8A 1BI3A 1KQSA 4OMNA 4DOWA 2Y90A 2H3JA 3DB3A 2F2XA 2QHTA 2YLCA 3M54A 3PGGA 2LNVA 1NZ9A 4C92C 3M4QA 2XDBA 4LVJA 3OYCA 2OJ2A 3OW2S 1G5VA 1R0CB 4YRKA 1KQ1A 2VXEA 4K11A 5HY6A 4IUUA 4MMKA 2RI2A 3CPWP 5J39A 1Q86C 4C8QG 2HD0A 1QKXA 2QEXT 3HXYA 1NNHA 3QZ5B 3VJPA 4ZTUB 2K5FA 4JPBW 5GANd 2LMJA 1IZ6A 1QWFA 5HK3A 4H2XB 3UFGA 1WLPB 2DXTA 3E2UA 4ZN1A 4C92G 4RKUE 3JCMc 4B9WA 1WHHA 3OYDA 2DDZA 4WJ3M 1G51A 1NYGA 4KUIA 3RNJA 2ZNJA 3MP1A 4GLMA 2CREA 3BE3A 2DD4A 4J9CA 4XEOA 1O9SA 2Q7GA 2K9GA 3NETA 4UP9A 2K57A 4LDVA 4OMFB 1HYOA 1M3CA 5D6XA 1S1NA 4A54A 1W2BA 1SHGA 2E41A 1F1BB 5A0GA 2D8HA 3PMIA 2EKOA 1UE9A 2C8MA 5ECAA 3OYNA 3A5ZA 1MHNA 5I22A 5FW9A 5KYYB 2HKQB 1M2VB 3JB9I 3MJXA 4XU3A 1H3ZA 2ABLA 5EG2A 2DYBA 4ELYC 2V26A 2QA4A 1I1JA 5GAMd 2VGMA 1VQ7T 4YROA 9ATCB 1B7TA 1ZX6A 2J6OA 4E7ZA 5GAN3 3JB9G 4NCXA 3MEYA 3OYJA 3EG9B 5GAN5 3L1AA 2ALYB 1K0SA 3JCMP 3EGDA 2A3LA 2DU5A 2Q7EA 2RQTA 1N27A 3UA6A 1XNIA 1AZGB 2JZ2A 4E7IA 1VIEA 2EQUA 4OB2B 3HY0A 3JCMQ 3QZ9B 2BZXA 4PKCC 3CMET 5KCOA 1PCXA 2ARSA 5FRNA 1K8AR 4BI4A 2OTLT 4J6YA 2EYWA 3TU4K 2EQIA 1QF6A 4YREA 1K73R 2FPDA 3M0RA 2RD1A 11ASA 3OBWA 3G4SQ 1TUDA 3LC0A 1N9RA 4HCCA 2QK0A 2DL3A 4KBMB 3QKJA 4EIKA 1FYNA 1X54A 4ATOA 4QVCA 1YJWA 4JRKA 3OYIA 1KG1A 3HXUA 1D3BB 1HXDA 4CS2A 2BE7D 2X9HA 3FLGA 3CCST 3ERRA 1YIJA 1WQWA 1RAGB 4DEXA 3QSUA 4A4KA 1PWTA 5KE3A 3PMTA 2QA4Q 2QXFA 2L2PA 1E22A 4RG2A 1K8AC 1BBZA 4QVDA 1AVZC 2CZ6B 1GRIA 2M0YA 4J9GA 1V76A 3DLMA 3HXXA 1G2BA 1WHJA 1K73C 3TEHB 2CSIA 4Z89A 4M77F 2DBKA 2CZ0B 1PRMC 1SF9A 1OYXA 3VV0A 1H3HA 2ODRC 2KDSA 3V7RA 1BB9A 5A0LA 3RACA 1XTDA 1G3TA 3H0HA 4OB0B 2A28A 3J80E 2OTJA 3A7RA 4G84A 1I07A 2SEMA 1Y96A 1VQOT 4TQDA 3RGLA 2KQWA 1LNXA 3EH2A 5C51B 5GAOp 4YCVA 2PZ1A 5FWCA 2CDTA 1FXXA 1K8AU 1YNZA 4M78D 1M30A 4HCBA 1YB3A 3CC7A 4MDXA 2YRCA 5C52B 4AFSC 3PFSA 3G6EA 1K73U 2LC4A 4QQ6A 4RMFA 1D1AA 4HWTA 1YJ9A 1MMAA 2AT1B 2CIMA 1M3AA 5CR2A 2JS2A 2X4YA 2F1LA 1WHLA 1I81A 1WA7A 3IQLA 1GFCA 4FL6A 2MYSA 4M78A 4F14A 4WJ4A 5ELNA 4M7AA 2EFIA 1NLOC 3RKWA 2DK3A 1UDLA 5J3BA 2AHJB 4J5YA 3OYLA 1VQMT 2EJ9A 1U8RA 1JJCA 1NYRA 2CGHA 1A0NB 4MMLA 1UHFA 3JCMb 2RHIA 1VQ7Q 4LDXA 1QCFA 3NELA 2MK5A 2HL3A 1J5WA 4DA4A 1VQ9A 1B3QA 5CAIA 1TS9A 4KGZB 2L89A 4M78B 2FPEA 1UEBA 3I7FA 4E7KA 4K86A 3A8HB 2HSEB 3OW2A 3PIOA 2JNGA 3LW5E 5LJ3e 1JJCB 2DTHA 1TTHB 2A7YA 4HWOA 1S72T 3TUPA 3Q1JA 2CP3A 2DNUA 3UGTA 1QVFP 1PNJA 4F7UB 3HPWA 2JW4A 2YUNA 4Z02A 3UA7A 2BIVA 3VRYA 4M7AE 2E3HA 5DM7R 2AIRB 3KXTA 3CCQT 1VIFA 5CKEA 4E7JA 4ZGJB 1NJ6A 1FYFA 2O2OA 2KAFA 1J3TA 2PVOB 1SKUB 4RTZA 4RDXA 1NJIR 3P8DA 4M75E 3M55A 1FX7A 4JUVA 4C0GA 3HXZA 4KRTA 2YT6A 3ZBDA 3I5RA 4V2SA 4DPGA 2IY5A 1BI1A 4M75F 1FMWA 3CCSQ 4Z8AA 2E5AA 4PNOA 2Q7HA 3D7SB 4UP7A 4F04B 4ZGDB 4PJOB 2JMCA 5D6YA 4HVUA 1NE8A 2ZZDA 3PIPA 3REXA 4EO4A 3OY9A 1AHJB 4L5GA 4IKFA 2VUBA 2KE9A 3P8TA 1YGBA 1VQ9Q 3WQZA 4CH6A 1WDXA 2RQRA 4D6WA 1KHCA 8AT1B 2Y4XA 3HY1A 2XDPA 2J3LA 4Y28E 4KQEA 1BBWA 1RUWA 4YRCA 1V29B 2K79A 3A8LB 1YHQA 3TVTA 2IPOB 3CMAT 3HP9A 4KR2A 2YHTA 1NJIC 4M78C 2PUKB 3CC2T 2O31A 3CCEA 2ZCFB 3M59A 1IHWA 1QCOA 1VQOQ 1S72A 4XTUA 2KT8A 4FT2A 1KIKA 1YJNA 2MPXC 4WF2A 4A53A 2RI5A 1PM3A 1M90R 3TEGA 2X35A 2DE0X 1M3BA 3CCQA 1GBQA 2EL9A 1RL2A 4LE9A 2EQKA 4OMPA 2BTTA 2QHSA 3UGQA 3CC4T 2OI3A 1VA7A 2KVQG 3VS3A 5HGQA 4QW2A 2ROLA 3C0CA 2QI2A 5HCKA 5KYXA 3DSQA 1SG5A 4J6WA 3C95A 4YRGA 4M78G 4JJBA 1NJIU 2K3XA 1B76A 2ZZEA 5GJWB 4M7AG 3G71A 2LJ0A 5IHIA 2DRMA 1CKBA 1WXTA 1K0XA 2P0PA 2GNCA 1SSHA 2CZ1B 2GQVA 4II1A 3VS7A 1I8FA 1DJ7B 4M75G 2C0OA 4Q5WA 1YCSB 2KBTA 2EJGA 2XIDA 2JTEA 1PYSB 3QO5A 1M90C 2QHVA 3QYGB 5A2QE 1CKAA 4PL6A 5LL6S 1M8VA 2QDLA 2COYA 5KYXB 4XTYA 1NEGA 1YHQQ 2E65A 1GGMA 3QJ6A 3CMAA 2HAXA 4YP0A 1ZA2B 1G8XA 3CCEQ 4FW1A 4J7FA 4HWPA 2QAZA 4XTVA 3L2UA 1TOVA 4E7HA 2VC8A 2DL5A 5GJVB 1S72Q 5C6SA 1ZHIA 1X2HA 3MEAA 1VQ6A 4P3OA 2E4HA 2E6ZA 3KFUA 1NLPC 4MZMA 3QG1A 2KYMA 1JO8A 4BE2A 1RAHB 4HT9A 1NEBA 3HHTB 4PFOA 2VKNA 4J9DA 3CCQQ 3LGLA 2L3PA 2V8KA 4LD6A 4E2FB 4P71A 2NUZA 3OYEA 4CH5A 2QGFB 3H8ZA 4NS5A 1BCOA 4KT0E 1V1CA 2VXFA 2RJFA 3BDUA 4X9DA 12ASA 1I5OB 3EG2A 1M90U 2XTIA 2KR3A 2RQWA 1HTTA 3NGPA 2RHUA 5J26A 4M4ZA 4YDQA 4C0FA 4CC4B 1YI2A 2EYQA 2ZT8A 2NS6A 5GAN2 3OYFA 1VUBA 3INZA 4C8QE 5DY9A 2D0QB 1WFWA 3HRIA 3LLRA 4YRFA 2ZPHB 5IXFA 1KK7A 1Q95G 4C8QF 4E6RA 1C6VX 1ZUKA 4EMGA 1EIYA 5I21A 2DJZA 4HWRA 2K6DA 2FL7A 1K4US 4C92E 2CJBA 2RHXA 4Z88A 2E64A 3M56A 2PMFA 2EPDA 3HKSA 1GL5A 2L5QA 2PVGB 4C92F 3GNFB 1EOVA 2DTIA 3CMAQ 3CCLA 2P4TA 1PHTA 5KYNA 3CC2Q 1L0WA 2ZZGA 1KMNA 4RTYA 3MP8A 1IGQA 2ZPEB 2H8HA 2XKOC 3VKIA 4E51A 1AWWA 1VOMA 2KRNA 4PFZA 3EHQA 3PTAA 2KT1A 3OA6A 1WX6A 1PD0A 3RKYA 3C4SA 1OPLA 2BUDA 3HRUA 3CC4Q 4AFQC 4KGVB 3MF2A 5FU7C 2LNHB 1BIBA 4BY6B 3NHNA 1YI2Q 3ME9A 1D1CA 1ZBJA 2LX7A 2LZ6B 2HSPA 1VQKA 1USYA 4QQGA 4F16A 2V8JA 3RMQA 5IT9E 4IUTA 3JB9F 3I35A 3JCMV 2NUPA 2X4XA 1B07A 4H2XA 4J9FA 4HXJA 2XICA 2MAMA 2F2WA 3MEVA 3V8LA 1KC8R 2QGGA 1TXQA 3MEUA 2PVDB 3VUZA 4EPCA 5LJ5e 2M9UA 2ARTA 1Z9QA 3IKLA 3JB9H 3GP8A 2QA4T 3HTRA 3E1SA 1WJRA 3RKXA 2YLBA 4ESRA 4P71C 1OV3A 1H4VB 5HKCA 4CH3A 4RTXA 1B8AA 2O9VA 1SHFA 4YRNA 2HEQA 3R6NA 3CCLQ 1OU9A 2LQNA 2COWA 4H02A 5K1PA 5HK0A 2DL7A 1H8KA 3L2WA 2K2MA 2NUPB 1TG0A 4J15A 1UJ0A 2FRYA 3R07A 5F5WA 5KYYA 3P8VA 1M2VA 2KY9A 3GPLA 2R5MA 3E9FA 3EFOB 4P72A 1KHIA 2EIFA 2V1QA 3OMCA 3JCMe 3H41A 3P8BB 1JJ2A 1WHKA 2LT1A 4IUVA 2F5KA 4OVAA 1KC8C 2F69A 1XQHA 5IHKA 3OQ5A 5KCHA 1KQSP 1Z9ZA 2QQ9A 3RDVA 1VQ8A 4XU1A 3EG9A 2ZR3A 2RMOA 5L23A 2ALYA 3I55A 2L3SA 5I11A 1VQKQ 1YJWT 2CP7A 2LRQA 2COZA 2KRSA 1YFNA 1Y07A 1U5SA 3LSSA 4Y91A 2X3XD 3MP6A 4YRSA 4AT1B 1YIJT 3UATA 4PJJA 1QQJA 1BI0A 1SEMA 2P5IA 3CCUA 5AT1B 4P74A 5L8RE 4OLFA 2XGTA 1NG2A 4E7SA 4TQFA 3G7ZA 1RABB 3SEMA 1KC8U 2EBPA 1MNDA 2E6NA 3IKMB 5I2MA 3TCJA 1UHCA 4N4GA 2R5AA 3NTKA 1QW1A 1AWXA 4BD3A 1JXOA 2LDMA 2DLPA 2K5LA 5GANe 3H0FA 2KGTA 1X2QA 1D3BA 1ARKA 4TVAA 1IL2A 1SRLA 1X69A 4MDWA 1Z7MA 1ASYA 3UPUA 1USYC 2GQIA 1KFZA 5GAOl 2OTJT 2O4XA 2RB6A 3BFMA 4M77D 3T9NA 4CC3A 1D0XA 3PCOA 1ATIA 3HFNA 1JB0E 2W0ZA 2D6FA 1JBMA 4JS5A 2AZVA 3KUFA 5GAOm 1OEBA 3CC7T 1W2BP 2J6KA 3EFRA 3TSZA 3G6ET 2ZPFB 2ZR2A 1UG1A 3OYKA 4J8OA 3TEHA 1I4K1 2YUQA 5FU6B 1YJ9T 2BZ8A 2X3WD 3M0TA 1KOGA 4TVAB 1BK2A 2CP2A 2LCSA 1VQ4A 3EGUA 1X2GA 2D1XA 3CCRA 4A4EA 2CZ7B 2KROA 2O4XB 5CK9A 3M0PA 1SETA 3CCUQ 4YCUA 3A5YA 2A8EA 3PCOB 4H2YA 1IREB 1PC0A 3VS4A 5GMKl 1VYTA 5GAMe 2DETA 2IVWA 4P72C 3UT1A 4LDWA 3RL6A 4Q6GA 2RHZA 3FDRA 2K5IA 1JU5C 2DMOA 3HTZA 2L0AA 1WIEA 2CS7A 4M77B 2ZGWA 1WQ7A 3HRTA 4HWSA 4L87A 1WJSA 1OZ2A 1VQ9T 3MCAB 3VS5A 1QCNA 4YCWA 1PKTA 4JJDA 1VQLA 3QDRB 4LVMA 2C7IA 3CCJA 2FZKB 1Y7XA 1HC7A 1N5ZA 2KXCA 2JN0A 2DX1A 2GF7A 1ZSZA 4UP8A 3MKDA 1RAFB 1ZQ1A 3CCVA 1X6OA 3V7CA 4YRIA 2L3RA 2QHUA 2FO0A 1B70B 2AMCB 1ZLMA 2EYXA 2MWPA 2EQJA 2QQRA 4CI0C 2GTJA 4VUBA 4P74C 2QTXA 3V7SA 3R6OA 3QO3A 1Q81R 4CRIA 1ZBXA 2JOYA 4RTUA 4DBQA 2I4NA 3CPFA 1YJWQ 1PG5B 2MIOA 2RQVA 3EHRA 3M53A 4JJNK 3PVQA 2XDDA 3FB9A 4FU6A 4ELZC 1N6AA 4YRLA 2M1HA 4XTWA 2ATCB 3QBYA 3M4PA 1ZSZB 1YIJQ 4YTLA 1KMMA 4P3NA 2CT3A 4X5OA 2LJ1A 3E9IA 4F7UA 2R58A 4RG8A 5C0MA 2HDAA 3DLLA 2RHYA 3QJYA 3S3OA 2I4LA 4OB3B 4P73A 3DB4A 3I5SA 2JM9A 1RAEB 3N5BB 4P5NA 3CCJQ 1LCKA 1OULA 4PJOD 3OS2A 4HVVA 2YSQA 4A4HA 1Q81C 1LJOA 4MZPA 1YHQT 3VQYA 1ABQA 1BI2A 2OTJQ 4EMKA 3CCET 1EQRA 4H2WA 2LJ3A 2IG0A 2YUPA 3VS0A 1W70A 3V8KA 4PJOA 4LDUA 4JLIA 1YJNT 3FJPA 2MOXA 4M78E 3ASKA 2BKDN 3CBPA 5GMKh 4X9CA 2QASA 3CC7Q 4XTXA 4M78F 3L2VA 3G6EQ 1OU8A 2CSQA 4L6V5 4M7AF 3RF1A 4LVLA 3ER0A 3CBMA 2JTFA 2XHCA 1YJ9Q 1BCMA 1U06A 3VYHB 4YRRA 2A36A 1PSEA 2P0KA 1Q81U 4AMCA 4EMKB 2FPFA 2RJCA 1VQNT 3L2RA 3CXCA 2CUDA 3G71T 2HNIA 3FRNA 4B6MA 1NJ8A 2DXBA 1ZSZC 4FM4B 3OYHA 1YFRA 2F2VA 2IIMA 1UJYA 2DA9A 3S3NA 1ZUYA 1NJ1A 2WSCE 2WSEE 4N4HA 4CS3A 2I4OA 4XU2A 4ZIBA 1RAIB 1JJ2S 4YRMA 3OW2P 2ZZFA 5CIUA 3VS6A 2K2VA 4IUPA 1VQZA 1NYQA 4JDSA 5D6WA 1KJWA 3OS0A 4J83A 2CUBA 5FRMA 3C12A 2DL8A 4LDYA 2J3MA 4JZ3A 2CJAA 4EMHA 1VQ6T 4YRTA 2EYZA 1T3SA 4TTVA 2GTOA 4DQ2A 4HVWA 2ED1A 3LSQA 1BKBA 3A31A 2CP0A 2KSSA 3UF4A 3SWNB 2AZSA 1PYSA 3QHSA 1X55A 1YI2T 4P73C 3QTCA 4HA8A 3UH0A 4ME7A 4AH6A 1VQNA 1TUGB 3ICAA 2JM8A 5LJ3g 4P75A 4DBFA 1G3SA 4LN2A 1M4ZA 4H2VA 3TQ7P 2RJDA 3JCMh 1UFFA 4EMKC 5CQXA 3E9HA 1RAAB 2XU8A 1UECA 2D8JA 3QO8A 4PJOC 1Z7NA 1EFNA 1OQKA 4F7UG 4OB1B 2RNAA 3I56A 2ZPIB 2A0FB 1PSFA 4KH0B 1KSWA 2O01E 2DJQA 1KD1R 1LYLA 3FEOA 4YRJA 4OF1A 1E1OA 3H0IA 4M7DD 4BDYA 3JAME 3PVLA 1AOJA 1OOTA 2ZXFA 1WZOA 4ANJA 3EGXB 2ZTGA 1R77A 2CYZB 2EYYA 3U23A 2G4CA 3CCLT 4J9IA 1GCQA 1G3WA 3VS2A 1NPPA 3CCMA 1NBEB 3QIIA 4M7DA 2EGEA 2PU9B 4AFZC 3A74A 1K1ZA 1YJNQ 2F5TX 3OYAA 2E3CA 3X26B 2YRDA 2P84A 4PJOG 4GBQA 3ZFJA 3X28B 1AEYA 5IN1A 3TSWA 1Y71A 1HK9A 3OMGA 2VWFA 4ZGEB 3URGA 2GFAA 1OPKA 5FLXE 1Y57A 2FHDA 2X4WA 1TU0B 2L3QA 1KD1C 2JTMA 1ZSGA 3M57A 2RI3A 2I2LA 3M0QA 1VQKT 4OGCA 1VQNQ 4C8QB 1AWOA 1QE0A 3G71Q 1T3LA 4M7DB 3PZCA 2ZIMA 3RUXA 3ZL7C 3NPFA 4WCIA 1I5LA 4XEMA 1M2OA 4WI1A 4X1VA 3OYBA 5I2SA 1WLEA 2AKWB 3L2QA 4JRPA 2KI7A 3A1PA 3SD4A 2DILA 1X6GA 3I56Q 3JV3A 4YRQA 6AT1B 2X4JA 4KH1B 2G3RA 3CQTA 2DEQA 3HRSA 2DBMA 4E7LA 4IUQA 3JB9D 1QP2A 1QLYA 3A8MB 2EW3A 4RCBA 3ZEHA 3CEYA 1AZEA 5CKDA 1MMDA 3G1ZA 4OMLA 4ZN3A 2ZNIA 1YITA 1KD1U 3P8HA 2FG0A 1K76A 2ESWA 2DIQA 2PUOB 1W66A 3META 4D8DA 2RM4A 1BIAA 2OX7A 4KR3A 4PLLA 1VQ6Q 1H4TA 2VVKA 4P75C 1WXBA 4L59A 2ZCEA 1WI7A 2DYIA 4WTOB 1B7YB 4HKEA 3CPWA 2QYZA 3HFVA 5ELOA 2AKKA 2V1RA 3H6ZA 1EFWA 3HXVA 2HKNA 5CKBA 5C53B 2EQMA 2Z0WA 1VQ8T 2WACA 2RK2A 4PK4A 3I55T 2ROTA 1G3YA 2KK4A 2LQKA 2RA2A 3M9QA 3REUA 4RQEA 3LX7A 1GCQC 3M58A 4B9XA 2JS0A 2VGNA 1K9MR 3MPUB 5LJ3j 2CJ9A 5LJ3f 3HSBA 4M7DC 2I4MA 3RR6A 1M1FA 3SFMA 3CCUT 4RMOA 1C0AA 3EFOA 2YWWA 2RHQB 4C5GA 3VQWA 2GCXA 1G83A 1G5IA 1YP5A 1W6XA 1XOVA 1G5HA 3CMQA 5FWBA 2QQAA 4C0ZA 2VASA 1UGVA 3OYMA 4BWAA 1YITQ 5KYUB 2CT4A 4Y92A 1OZ3A 5D7UA 2DVEA 3REAB 3HFOA 3IALA 1EX4A 3A32A 1SRYA
chains in the Genus database with same CATH topology
4R56A 4M7DG 4BDZA 2DXUA 4XTZA 3M5AA 2PQWA 3SDZA 4FSXA 1WPYA 4RCCA 1FWZA 3CXCS 1K9MC 4OP0A 4O5VA 1EVLA 3UWNA 1H4SA 4UPAA 1Q82C 5CVIA 2FYKA 2FB7A 1VQ5A 3JCMW 1U1SA 4BY6C 2C06A 4JRQA 3NFCA 2ODRD 3L42A 3MF1A 5LJ3h 3HFZA 3G4SA 1VQ4T 2MF2A 3CCRT 1Q86U 3AHUA 4KULA 3KBGA 3RIRA 3LH0A 5DLQE 1RIQA 4DOVA 1K9MU 4LVIA 3NEMA 3HL8A 1TH7A 3BJUA 2QQBA 1Q82U 2P0LA 4JS4A 1YCYA 3OYYA 1YFTA 4EX5A 4QQDA 3S6WA 2E12A 2MWOA 1VQLT 3CCJT 3HFZB 3X24B 4A4FA 2E10A 2DTOA 5GAN4 3LWHA 4EDUA 4J6XA 2QEXA 1R8OB 2JVVA 3BW1A 3CCVT 3A8GB 5LJ5g 2DZ9A 1QVPA 2L8DA 4NL3A 3W3SA 3OBYA 3DKMA 4C5HA 2XK0A 3A5ZB 4M77A 3OB9A 1YBYA 3TREA 3C94A 1UGSB 5K1XA 2DXCA 3OS1A 4G85A 1Q7YC 2DIGA 1OI1A 1X75C 4A4GA 3RERA 3WXMB 5CO7A 1SSFA 3JB9J 4LD9K 2NLUA 4BI3A 2LX9A 3JCMg 3QO7A 2RHSA 1B70A 2AMCA 2RK1A 1QVGS 2DD5A 4TVWA 3GIBA 3VYGA 5GMKm 4GY5A 4YRPA 3MEWA 3BDLA 3F70A 4Q15A 1NJ5A 1Q7YU 4TWAA 1VQ7A 4M77E 2LCLA 1UGPB 4K87A 2GFUA 2Q5IA 4P3PA 3A7AA 2RHSB 4BE0A 4HVCA 4MZTA 4BB7A 3S3MA 5GMKj 3CMEA 3TEEA 5LJ3d 3RESA 2OTLA 2RH2A 5GANg 5CKFA 4HT4A 4TVRA 2EWNA 5FU6C 3WVDB 2MMPA 3GF5A 1UB4A 1QVFA 4M7AD 3FIFA 3L2ZA 4N0AA 2PMEA 1ASZA 3IG2A 4M75D 2EAYA 3GNGA 2KMTA 1W4SA 3CCSA 1M1KC 3O8VA 1WGSA 3JCMJ 4FT4A 2DZCA 5CKHA 1Y96B 3CPWS 2EJFA 3PNWC 4M77C 4QVZA 3X25B 3RMSA 2ZIOA 3QYHB 5GAOn 4IURA 1WJQA 3MHXA 4M75A 2OAUA 5FROA 3L4GA 4JRIA 2K4YA 3VUBA 4HCZA 3CD6T 1ADYA 2ZT6A 2ZPGB 1EVKA 4CS4A 2Y4YA 2QQSA 5GAMg 1N8RC 1X01A 1LOJA 3OS5A 5LJ5j 5LJ5f 5GAOq 4M7AB 2XG8D 1E1TA 1M1KU 2E1HA 2ZT7A 4XAXB 4M77G 4F7UE 1SESA 4GLKA 1VQOA 1P92A 4M75B 3L4GB 1RI0A 1KQSS 3HXWA 4F7UF 3M4GA 2HBPA 4C0DB 2DKGA 5IAYA 5GAOr 1JRIA 2FVUA 5E3IA 1VQPT 2V8IA 1O75A 1N8RU 3FC3A 3JCMf 5KNNA 2WSFE 3I56T 5GAN6 4NOYA 4UC4A 1H641 4ZTFA 4PJOE 4BW9A 1VQMA 3SWNA 1GXIE 3LWIA 4XU0A 4PJOF 1YFSA 4H2UA 2E5QA 3CCMT 3EFSA 3X20B 3CD6A 2RO0A 4N4IA 4PLIA 5LJ5h 1MGQA 5A0DA 4CH4A 4N0AC 5GAN8 2IY5B 4TVYA 3EAEA 2ZT5A 4RQFA 4M7AC 1W2BS 2M0OA 2Q5HA 3JRZA 3GOXA 3UDCA 3OYGA 2RJEA 5GANj 5GANf 2QDYB 4M75C 2K3YA 4XK8E 1WYDA 2HQXA 1VQPA 4C0DC 1B34A 2ARUA 2R57A 4JLGA 3GLXA 4O6JA 4LNSA 3M4YA 5CCAA 4XQ3A 3OSVA 5CQYA 2LT4A 3CBOA 4C8QD 5KH6A 4ZTJA 3SB2A 2VV5A 3P8YA 4O2DA 2JUFA 3J81E 1QP3A 1YITT 2YRVA 3VU3C 1UGRB 4C8QA 2E70A 3VQXA 1N9SA 1QVGA 2D9TA 1SERA 1B34B 4C92D 2LQ8A 2AKWA 3QNEA 2M16A 1X56A 5GAMj 5GAMf 4KUDK 5DLOA 3CC2A 2DQ3A 5GAN7 1NJ2A 4C92A 5GANh 1U1TA 2LTOA 3SWNC 3NTIA 4H2SA 1WU7A 5FU7B 3VBBA 2DO3A 2MI6A 4J7IA 3CC4A 3NENA 2XD0A 1EIFA 4K88A 3MQZA 3J7AF 2VYTA 1B7YA 4M7DE 3VQVA 3E9GA 4C92B 1M9SA 5AYFA 4M7DF 3QPHA 2ZINA 4NL2A 1M5Q1 2XI9A 2ZPBB 3PT9A 3A8OB 1BYMA 2HQEA 3E19A 2DQ0A 5LJ5d 2LVMA 4H2TA 4BUGA 4ZTZB 1H4QA 5GMKe 4E47A 4C5EA 1KQ2A 4C5IA 1E24A 4PHCA 5GAMh 2P0QA 1WNLA 3OD1A 4OGEA 2RHQA 1QVFS 1ADJA 3QXEB 2CKKA 3MO8A 1M1GA 3QUIA 3A7UA 3OSSC 5KE2A 3WVEB 1EIYB 3LYIA 1VQ5T 2B8AA 3NTHA 4YPFA 3JCMd 4LVKA 3JSCA 3LGFA 4YYEA 3BY7A 3G4ST 2DAQA 4BACA 1UGQB 2LCCA 4C8QC 1N9WA 2DPPB 4X34A 3HRKA 5M9OA 3V8JA 5GMKi 4PG3A 2DU7A 1BBUA 3JCMX 4BI8B 4R55A 1NPRA 4FIBA 4BE1A 4HT8A 1BI3A 1KQSA 4DOWA 2Y90A 2H3JA 3DB3A 2QHTA 2YLCA 3M54A 3PGGA 2LNVA 1NZ9A 4C92C 3M4QA 2XDBA 4LVJA 3OYCA 3OW2S 1G5VA 4YRKA 1KQ1A 2VXEA 5HY6A 4IUUA 4MMKA 2RI2A 1Q86C 5J39A 4C8QG 2HD0A 2QEXT 3HXYA 1NNHA 3QZ5B 3VJPA 4ZTUB 2K5FA 5GANd 1IZ6A 5HK3A 4H2XB 3UFGA 2DXTA 4ZN1A 4C92G 4RKUE 3JCMc 4B9WA 3OYDA 2DDZA 4WJ3M 1G51A 4KUIA 2ZNJA 3MP1A 2DD4A 4XEOA 1O9SA 2Q7GA 3NETA 4UP9A 2K57A 4LDVA 4OMFB 5D6XA 1W2BA 4A54A 2E41A 5A0GA 3PMIA 2EKOA 2C8MA 3OYNA 3A5ZA 1MHNA 3JB9I 4XU3A 1H3ZA 5EG2A 4ELYC 2QA4A 5GAMd 2VGMA 1VQ7T 4YROA 5GAN3 3JB9G 4NCXA 3MEYA 3OYJA 5GAN5 3L1AA 2ALYB 3JCMP 2A3LA 2DU5A 2Q7EA 1N27A 1XNIA 2JZ2A 4E7IA 1VIEA 2EQUA 4OB2B 3HY0A 3JCMQ 3QZ9B 4PKCC 3CMET 5KCOA 2ARSA 5FRNA 4BI4A 2OTLT 4J6YA 3TU4K 1QF6A 4YREA 2RD1A 11ASA 3OBWA 3LC0A 1N9RA 4HCCA 4KBMB 3QKJA 1X54A 4ATOA 4QVCA 1YJWA 4JRKA 3OYIA 1KG1A 3HXUA 1D3BB 1HXDA 4CS2A 3FLGA 3CCST 3ERRA 1YIJA 1WQWA 3QSUA 4A4KA 5KE3A 3PMTA 2QXFA 1E22A 4RG2A 1K8AC 4QVDA 2CZ6B 3DLMA 3HXXA 1K73C 3TEHB 4M77F 2CZ0B 1OYXA 3VV0A 2ODRC 2KDSA 3V7RA 5A0LA 3RACA 1XTDA 1G3TA 4OB0B 3J80E 2OTJA 3A7RA 4G84A 1Y96A 1VQOT 4TQDA 3RGLA 2KQWA 1LNXA 5C51B 5GAOp 4YCVA 1K8AU 1FXXA 4M78D 4HCBA 1YB3A 3CC7A 4MDXA 5C52B 3PFSA 3G6EA 1K73U 2LC4A 4QQ6A 4RMFA 4HWTA 1YJ9A 2CIMA 5CR2A 2X4YA 1I81A 4FL6A 4M78A 4WJ4A 5ELNA 4M7AA 2EFIA 3RKWA 2DK3A 5J3BA 2AHJB 4J5YA 3OYLA 1VQMT 2EJ9A 1U8RA 1JJCA 1NYRA 2CGHA 4MMLA 3JCMb 2RHIA 4LDXA 3NELA 1J5WA 4DA4A 1VQ9A 5CAIA 2L89A 4M78B 1UEBA 3I7FA 4E7KA 4K86A 3A8HB 3OW2A 3PIOA 2JNGA 3LW5E 5LJ3e 1JJCB 2DTHA 3TUPA 2A7YA 4HWOA 1S72T 3Q1JA 3UGTA 4F7UB 3HPWA 4Z02A 2BIVA 4M7AE 5DM7R 3KXTA 3CCQT 1VIFA 5CKEA 4E7JA 4ZGJB 1NJ6A 1FYFA 2KAFA 2PVOB 4RDXA 3P8DA 4M75E 3M55A 1FX7A 4JUVA 4C0GA 3HXZA 3ZBDA 4V2SA 4DPGA 2IY5A 1BI1A 4M75F 2E5AA 4PNOA 2Q7HA 4UP7A 4ZGDB 4PJOB 5D6YA 1NE8A 2ZZDA 3PIPA 3REXA 4EO4A 3OY9A 1AHJB 4L5GA 4IKFA 2VUBA 3P8TA 3WQZA 1YGBA 4CH6A 4D6WA 1KHCA 3HY1A 2Y4XA 2XDPA 2J3LA 4Y28E 4KQEA 1BBWA 4YRCA 1V29B 3A8LB 1YHQA 3CMAT 3HP9A 4KR2A 2YHTA 1NJIC 4M78C 2PUKB 3CC2T 3CCEA 2ZCFB 3M59A 1S72A 4XTUA 4FT2A 1YJNA 4WF2A 4A53A 2RI5A 3TEGA 2X35A 3CCQA 2EL9A 1RL2A 2EQKA 2QHSA 3UGQA 3CC4T 2KVQG 5HGQA 4QW2A 2QI2A 3DSQA 4J6WA 3C95A 4YRGA 4M78G 1NJIU 2K3XA 1B76A 2ZZEA 4M7AG 3G71A 2P0PA 2CZ1B 2GQVA 4II1A 1I8FA 1DJ7B 4M75G 4Q5WA 2EJGA 2XIDA 1PYSB 3QO5A 1M90C 2QHVA 3QYGB 5A2QE 5LL6S 4PL6A 1M8VA 4XTYA 2E65A 1GGMA 3QJ6A 3CMAA 2HAXA 4YP0A 4J7FA 4HWPA 4XTVA 3L2UA 4E7HA 2VC8A 5C6SA 1ZHIA 1X2HA 3MEAA 1VQ6A 4P3OA 3KFUA 2E6ZA 4MZMA 3QG1A 4BE2A 4HT9A 3HHTB 3LGLA 2V8KA 4LD6A 4P71A 3OYEA 4CH5A 3H8ZA 4NS5A 4KT0E 2VXFA 3BDUA 2RJFA 4X9DA 12ASA 2XTIA 1M90U 1HTTA 2RHUA 5J26A 4YDQA 4C0FA 1YI2A 2EYQA 2ZT8A 2NS6A 5GAN2 3OYFA 1VUBA 3INZA 4C8QE 5DY9A 2D0QB 3HRIA 3LLRA 4YRFA 2ZPHB 4C8QF 4EMGA 1EIYA 5I21A 2DJZA 4HWRA 2FL7A 4C92E 2CJBA 2RHXA 2E64A 3M56A 2PMFA 3HKSA 2L5QA 2PVGB 4C92F 3GNFB 1EOVA 2DTIA 3CCLA 2P4TA 1L0WA 2ZZGA 1KMNA 3MP8A 2ZPEB 2XKOC 3VKIA 4E51A 3PTAA 3OA6A 3RKYA 3C4SA 2BUDA 3HRUA 3MF2A 5FU7C 1BIBA 4BY6B 3ME9A 1VQKA 1USYA 4QQGA 2V8JA 3RMQA 5IT9E 4IUTA 3JB9F 3JCMV 2X4XA 4H2XA 2XICA 2MAMA 3MEVA 3V8LA 3MEUA 2PVDB 3VUZA 4EPCA 5LJ5e 2M9UA 2ARTA 3IKLA 3JB9H 3GP8A 2QA4T 3E1SA 1WJRA 3RKXA 2YLBA 4P71C 1H4VB 5HKCA 4CH3A 1B8AA 4YRNA 5K1PA 4H02A 5HK0A 3L2WA 4J15A 3R07A 5F5WA 3P8VA 2KY9A 3GPLA 2R5MA 3E9FA 4P72A 1KHIA 2EIFA 3OMCA 3JCMe 1JJ2A 3P8BB 2LT1A 4IUVA 2F5KA 4OVAA 1KC8C 2F69A 1XQHA 3OQ5A 5KCHA 1VQ8A 2QQ9A 2ZR3A 4XU1A 2ALYA 3I55A 1YJWT 2LRQA 1Y07A 3LSSA 4Y91A 3MP6A 4YRSA 1YIJT 1BI0A 2P5IA 3CCUA 4P74A 5L8RE 4OLFA 2XGTA 4TQFA 3G7ZA 1KC8U 2E6NA 3IKMB 5I2MA 3TCJA 4N4GA 2R5AA 3NTKA 1QW1A 4BD3A 2LDMA 2K5LA 5GANe 1D3BA 4TVAA 1IL2A 4MDWA 1Z7MA 1ASYA 3UPUA 1USYC 5GAOl 2OTJT 2O4XA 2RB6A 3BFMA 4M77D 3T9NA 3PCOA 1ATIA 3HFNA 1JB0E 2D6FA 1JBMA 4JS5A 3KUFA 5GAOm 3CC7T 3EFRA 3G6ET 2ZPFB 2ZR2A 3OYKA 4J8OA 3TEHA 1I4K1 5FU6B 1YJ9T 1KOGA 4TVAB 1VQ4A 1X2GA 3CCRA 4A4EA 2CZ7B 2O4XB 5CK9A 1SETA 4YCUA 3A5YA 2A8EA 3PCOB 4H2YA 1IREB 5GMKl 5GAMe 2IVWA 4P72C 3UT1A 4LDWA 3RL6A 4Q6GA 2RHZA 3FDRA 2K5IA 3HTZA 2CS7A 2ZGWA 4M77B 1WQ7A 3HRTA 4HWSA 4L87A 1WJSA 1OZ2A 1VQ9T 3MCAB 4YCWA 1VQLA 3QDRB 4LVMA 2C7IA 3CCJA 1Y7XA 1HC7A 2JN0A 2GF7A 4UP8A 1ZQ1A 3CCVA 1X6OA 3V7CA 4YRIA 2L3RA 2QHUA 1B70B 2AMCB 2MWPA 2EQJA 2QQRA 4CI0C 4VUBA 4P74C 2QTXA 3V7SA 3R6OA 3QO3A 4CRIA 1ZBXA 2JOYA 2I4NA 3CPFA 4JJNK 3M53A 2XDDA 3FB9A 4FU6A 4ELZC 1N6AA 4YRLA 2M1HA 4XTWA 3M4PA 3QBYA 4YTLA 1KMMA 4P3NA 4X5OA 3E9IA 4F7UA 2R58A 4RG8A 5C0MA 3DLLA 2RHYA 3QJYA 3S3OA 2I4LA 4OB3B 4P73A 3DB4A 3N5BB 4P5NA 4PJOD 3OS2A 4A4HA 1Q81C 1LJOA 4MZPA 1YHQT 3VQYA 1BI2A 4EMKA 3CCET 1EQRA 4H2WA 2IG0A 3V8KA 4PJOA 4LDUA 4JLIA 1YJNT 3FJPA 4M78E 3ASKA 2BKDN 3CBPA 5GMKh 4X9CA 4XTXA 4M78F 3L2VA 4L6V5 4M7AF 3RF1A 4LVLA 3ER0A 3CBMA 2JTFA 2XHCA 3VYHB 4YRRA 1PSEA 2P0KA 1Q81U 4EMKB 2RJCA 1VQNT 3L2RA 3CXCA 3G71T 2HNIA 3FRNA 1NJ8A 2DXBA 4FM4B 3OYHA 1YFRA 3S3NA 1NJ1A 2WSCE 2WSEE 4N4HA 4CS3A 2I4OA 4XU2A 4ZIBA 1JJ2S 4YRMA 2ZZFA 5CIUA 1VQZA 2K2VA 4IUPA 1NYQA 4JDSA 5D6WA 3OS0A 4J83A 5FRMA 3C12A 4LDYA 2J3MA 2CJAA 4EMHA 1VQ6T 4YRTA 4TTVA 4DQ2A 3LSQA 1BKBA 3A31A 2KSSA 3SWNB 1PYSA 3QHSA 1X55A 1YI2T 4P73C 3QTCA 4HA8A 3UH0A 4ME7A 4AH6A 1VQNA 3ICAA 5LJ3g 4P75A 1G3SA 1M4ZA 4H2VA 2RJDA 3JCMh 4EMKC 5CQXA 3E9HA 2XU8A 3QO8A 4PJOC 1Z7NA 4F7UG 4OB1B 3I56A 2ZPIB 1PSFA 2O01E 1LYLA 3FEOA 4YRJA 4OF1A 1E1OA 4M7DD 4BDYA 3JAME 2ZXFA 2ZTGA 2CYZB 2G4CA 3CCLT 1G3WA 1NPPA 3CCMA 3QIIA 4M7DA 2PU9B 3A74A 2F5TX 3OYAA 2E3CA 3X26B 4PJOG 3ZFJA 3X28B 5IN1A 1Y71A 1HK9A 3OMGA 4ZGEB 3URGA 2GFAA 5FLXE 2FHDA 2X4WA 1KD1C 2JTMA 3M57A 2RI3A 2I2LA 1VQKT 4OGCA 4C8QB 1QE0A 4M7DB 3PZCA 2ZIMA 3RUXA 1I5LA 4XEMA 4WI1A 3OYBA 5I2SA 1WLEA 2AKWB 3L2QA 4JRPA 3SD4A 4YRQA 2X4JA 2G3RA 2DEQA 3HRSA 4E7LA 4IUQA 3JB9D 1QP2A 3A8MB 4RCBA 3ZEHA 3CEYA 5CKDA 3G1ZA 4ZN3A 2ZNIA 1YITA 1KD1U 3P8HA 2DIQA 2PUOB 1W66A 3META 2RM4A 1BIAA 4KR3A 4PLLA 1H4TA 4P75C 4L59A 2ZCEA 1B7YB 4HKEA 3CPWA 3HFVA 5ELOA 3H6ZA 1EFWA 3HXVA 5CKBA 5C53B 2EQMA 1VQ8T 2WACA 2RK2A 3I55T 1G3YA 2KK4A 2LQKA 2RA2A 3M9QA 3REUA 4RQEA 3LX7A 3M58A 4B9XA 2VGNA 5LJ3j 2CJ9A 5LJ3f 3HSBA 4M7DC 2I4MA 1M1FA 3SFMA 3CCUT 4RMOA 1C0AA 2RHQB 4C5GA 3VQWA 2GCXA 1G5IA 1XOVA 1G5HA 3CMQA 2QQAA 4C0ZA 3OYMA 4BWAA 1OZ3A 2DVEA 3HFOA 3IALA 3A32A 1SRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U1T A;  3HXZ A;  3RL6 A;  4Q6G A;  4V2S A;  3HTZ A;  3SWN C;  4DPG A;  4M7D G;  4M75 F;  2ZGW A;  4M77 B;  2IY5 A;  1WQ7 A;  2DXU A;  4XTZ A;  4HWS A;  2E5A A;  4L87 A;  4H2S A;  1WU7 A;  1WPY A;  4PNO A;  4RCC A;  2Q7H A;  4YCW A;  4UP7 A;  3VBB A;  4OP0 A;  4PJO B;  1EVL A;  2C7I A;  1H4S A;  3NEN A;  1HC7 A;  4UPA A;  4K88 A;  2JN0 A;  2FYK A;  3REX A;  4EO4 A;  4UP8 A;  2FB7 A;  3JCM W;  1B7Y A;  1U1S A;  3P8T A;  3WQZ A;  1YGB A;  3V7C A;  4CH6 A;  4YRI A;  4M7D E;  2ODR D;  2QHU A;  3VQV A;  1B70 B;  3MF1 A;  2AMC B;  4C92 B;  5LJ3 h;  3HY1 A;  3HFZ A;  2J3L A;  4KQE A;  1BBW A;  4YRC A;  4M7D F;  2ZIN A;  4NL2 A;  1M5Q 1;  4P74 C;  2QTX A;  3V7S A;  4KR2 A;  2YHT A;  3AHU A;  2DQ0 A;  3QO3 A;  4M78 C;  5LJ5 d;  3RIR A;  4H2T A;  2I4N A;  4ZTZ B;  1RIQ A;  1H4Q A;  5GMK e;  4XTU A;  3NEM A;  1KQ2 A;  4WF2 A;  3FB9 A;  1E24 A;  1TH7 A;  4A53 A;  3BJU A;  4PHC A;  4YRL A;  5GAM h;  4XTW A;  3M4P A;  2P0L A;  3TEG A;  1YCY A;  1WNL A;  1YFT A;  3OD1 A;  4EX5 A;  1KMM A;  2EL9 A;  4P3N A;  2RHQ A;  1ADJ A;  4X5O A;  3QUI A;  2QHS A;  3UGQ A;  3A7U A;  3E9I A;  4F7U A;  3HFZ B;  5HGQ A;  1EIY B;  2E10 A;  2DTO A;  5GAN 4;  3DSQ A;  4J6X A;  4J6W A;  4YRG A;  4YPF A;  3BW1 A;  4M78 G;  5LJ5 g;  3JCM d;  1B76 A;  2I4L A;  4P73 A;  2ZZE A;  2DZ9 A;  4M7A G;  4YYE A;  4NL3 A;  3W3S A;  3BY7 A;  4PJO D;  4C8Q C;  1LJO A;  1N9W A;  1I8F A;  3HRK A;  3VQY A;  4M77 A;  3V8J A;  4M75 G;  4EMK A;  5GMK i;  4PG3 A;  5K1X A;  2DU7 A;  1BBU A;  1EQR A;  3JCM X;  4H2W A;  2EJG A;  3V8K A;  4PJO A;  4JLI A;  4HT8 A;  1PYS B;  3FJP A;  2QHV A;  3QO5 A;  4G85 A;  4M78 E;  2Y90 A;  5GMK h;  3RER A;  4X9C A;  1M8V A;  2QHT A;  2YLC A;  4XTX A;  4XTY A;  4M78 F;  3PGG A;  3JB9 J;  4C92 C;  2E65 A;  1GGM A;  3M4Q A;  4YP0 A;  4M7A F;  3RF1 A;  3JCM g;  3QO7 A;  4HWP A;  4XTV A;  2RHS A;  2VC8 A;  1B70 A;  2AMC A;  4YRK A;  1KQ1 A;  2VXE A;  1X2H A;  4MMK A;  4P3O A;  4C8Q G;  4YRR A;  3KFU A;  3HXY A;  4P72 C;  4TVW A;  4HT9 A;  3GIB A;  4EMK B;  1NNH A;  4P71 A;  5GMK m;  4ZTU B;  4CH5 A;  2HNI A;  4YRP A;  5GAN d;  2VXF A;  3BDU A;  1NJ8 A;  4X9D A;  12AS A;  1YFR A;  2XTI A;  4Q15 A;  1NJ5 A;  1HTT A;  4TWA A;  4H2X B;  4YDQ A;  3UFG A;  4M77 E;  2ZT8 A;  2DXT A;  1NJ1 A;  4C92 G;  5GAN 2;  3INZ A;  3JCM c;  4C8Q E;  5DY9 A;  4K87 A;  2Q5I A;  4P3P A;  4CS3 A;  2I4O A;  2DDZ A;  3A7A A;  2RHS B;  3HRI A;  1G51 A;  4XU2 A;  4WJ3 M;  4YRF A;  4ZIB A;  2ZNJ A;  4YRM A;  4C8Q F;  4HVC A;  2ZZF A;  4EMG A;  1VQZ A;  1NYQ A;  4XEO A;  1EIY A;  5I21 A;  2Q7G A;  3NET A;  5GMK j;  4UP9 A;  2K57 A;  2DJZ A;  4HWR A;  5LJ3 d;  3RES A;  2J3M A;  4A54 A;  2CJA A;  2E41 A;  4EMH A;  5GAN g;  4C92 E;  2CJB A;  4YRT A;  2E64 A;  2EWN A;  2PMF A;  2C8M A;  3A5Z A;  4TTV A;  4DQ2 A;  3LSQ A;  4C92 F;  1EOV A;  3JB9 I;  2DTI A;  4XU3 A;  4M7A D;  3A31 A;  3FIF A;  3L2Z A;  4N0A A;  1L0W A;  2PME A;  2ZZG A;  3SWN B;  1PYS A;  1SRY A;  5GAM d;  1ASZ A;  3QHS A;  1KMN A;  3IG2 A;  1X55 A;  4P73 C;  4YRO A;  5GAN 3;  4E51 A;  4M75 D;  3JB9 G;  4NCX A;  3QTC A;  2EAY A;  3MEY A;  5GAN 5;  4HA8 A;  3L1A A;  3UH0 A;  2ALY B;  4AH6 A;  3JCM P;  3JCM J;  3ICA A;  2DU5 A;  5LJ3 g;  4P75 A;  2DZC A;  2Q7E A;  1Y96 B;  2EJF A;  4H2V A;  4M77 C;  3RKY A;  3JCM h;  2ZIO A;  4EMK C;  3MF2 A;  5GAO n;  3E9H A;  4M75 A;  3JCM Q;  1BIB A;  3HY0 A;  3L4G A;  4JRI A;  3QO8 A;  4PJO C;  1Z7N A;  4F7U G;  2ARS A;  1ADY A;  4J6Y A;  2ZT6 A;  1QF6 A;  1USY A;  4YRE A;  1EVK A;  1LYL A;  4CS4 A;  4YRJ A;  1E1O A;  2RD1 A;  11AS A;  4M7D D;  5GAM g;  3JB9 F;  1X01 A;  3JCM V;  1LOJ A;  5LJ5 j;  2ZXF A;  4H2X A;  3LC0 A;  1N9R A;  5LJ5 f;  5GAO q;  4M7A B;  2ZTG A;  1E1T A;  2G4C A;  3V8L A;  2ART A;  5LJ5 e;  1X54 A;  3IKL A;  3JB9 H;  2E1H A;  4QVC A;  2ZT7 A;  4M77 G;  4F7U E;  1SES A;  4M7D A;  4JRK A;  3RKX A;  3A74 A;  3HXU A;  2YLB A;  1D3B B;  4M75 B;  2E3C A;  4P71 C;  1HXD A;  3L4G B;  4CS2 A;  1H4V B;  3HXW A;  4F7U F;  4CH3 A;  3M4G A;  1B8A A;  4PJO G;  3ERR A;  4YRN A;  1WQW A;  3QSU A;  5K1P A;  4H02 A;  2DKG A;  5GAO r;  1JRI A;  1HK9 A;  5E3I A;  1E22 A;  4QVD A;  4J15 A;  3JCM f;  3R07 A;  5F5W A;  5KNN A;  3HXX A;  5GAN 6;  3P8V A;  3TEH B;  4NOY A;  4P72 A;  2I2L A;  4M77 F;  3JCM e;  4C8Q B;  1H64 1;  1QE0 A;  4PJO E;  4BW9 A;  4M7D B;  3SWN A;  3PZC A;  2ZIM A;  3RUX A;  2ODR C;  4XU0 A;  3V7R A;  1I5L A;  4XEM A;  4PJO F;  1YFS A;  4WI1 A;  2AKW B;  1WLE A;  3RAC A;  4H2U A;  2ZR3 A;  4XU1 A;  2ALY A;  4G84 A;  3A7R A;  4YRQ A;  3EFS A;  1Y96 A;  2DEQ A;  4TQD A;  3RGL A;  5LJ5 h;  1LNX A;  5C51 B;  3JB9 D;  3LSS A;  4Y91 A;  1MGQ A;  5GAO p;  4RCB A;  4YRS A;  4YCV A;  4CH4 A;  4N0A C;  5GAN 8;  4M78 D;  1YB3 A;  2IY5 B;  3G1Z A;  5C52 B;  2ZNI A;  4TVY A;  2P5I A;  4RMF A;  2ZT5 A;  4HWT A;  1W66 A;  2CIM A;  4P74 A;  4RQF A;  4M7A C;  4OLF A;  2RM4 A;  1BIA A;  2XGT A;  4KR3 A;  1I81 A;  4TQF A;  2Q5H A;  1H4T A;  4M78 A;  4P75 C;  4WJ4 A;  5ELN A;  4M7A A;  2ZCE A;  5GAN j;  3RKW A;  5GAN f;  3IKM B;  1B7Y B;  4J5Y A;  4M75 C;  2EJ9 A;  1JJC A;  3HFV A;  1WYD A;  5GAN e;  1NYR A;  2CGH A;  5ELO A;  4MML A;  1D3B A;  3JCM b;  4TVA A;  1EFW A;  1IL2 A;  3HXV A;  1B34 A;  1Z7M A;  3NEL A;  5C53 B;  1ASY A;  1USY C;  2ARU A;  5GAO l;  1J5W A;  4LNS A;  2RB6 A;  3BFM A;  4M77 D;  4XQ3 A;  3PCO A;  2RA2 A;  4C8Q D;  5CAI A;  1ATI A;  3REU A;  4RQE A;  3HFN A;  3SB2 A;  1JBM A;  4M78 B;  5GAO m;  3I7F A;  3P8Y A;  4O2D A;  5LJ3 j;  2CJ9 A;  3EFR A;  5LJ3 f;  3HSB A;  4M7D C;  2I4M A;  4K86 A;  3VU3 C;  2ZR2 A;  3TEH A;  1C0A A;  1I4K 1;  2RHQ B;  4C8Q A;  5LJ3 e;  1JJC B;  2DTH A;  3VQX A;  1N9S A;  3TUP A;  4HWO A;  3VQW A;  3UGT A;  4F7U B;  1KOG A;  4TVA B;  1SER A;  1G5I A;  1B34 B;  4C92 D;  1G5H A;  2AKW A;  3QNE A;  4M7A E;  1X2G A;  3CMQ A;  1X56 A;  4BWA A;  1SET A;  1NJ6 A;  4YCU A;  5GAM j;  3A5Y A;  5GAM f;  1FYF A;  3PCO B;  2DVE A;  3HFO A;  3IAL A;  2DQ3 A;  4H2Y A;  5GAN 7;  4RDX A;  5GMK l;  1NJ2 A;  4M75 E;  4C92 A;  5GAM e;  3A32 A;  4JUV A;  5GAN h; 
#chains in the Genus database with same CATH topology
 2PNI A;  4R56 A;  2C0I A;  1AWJ A;  4M7D G;  3AT1 B;  2DXU A;  4BDZ A;  4XTZ A;  2FZC B;  3I9Q A;  3M5A A;  1MMN A;  2PQW A;  3SDZ A;  4FSX A;  7AT1 B;  1WPY A;  4RCC A;  1RI9 A;  1FWZ A;  3CXC S;  1K9M C;  4DBH A;  4OP0 A;  4O5V A;  1EVL A;  1BU1 A;  1AT1 B;  3UWN A;  2M02 A;  2SRC A;  1H4S A;  4IIM A;  1HJD A;  1RLP C;  4UPA A;  3REB B;  1Q82 C;  5CVI A;  2FYK A;  1I0C A;  2DEU A;  2FB7 A;  1VQ5 A;  2JJ9 A;  3JCM W;  1U1S A;  4BY6 C;  2C06 A;  4JRQ A;  3NFC A;  2ODR D;  4AG1 C;  3L42 A;  3MF1 A;  5LJ3 h;  4AG2 C;  2PTK A;  4RTW A;  3HFZ A;  3G4S A;  1X2K A;  1VQ4 T;  3EG0 A;  2HQH A;  1TUC A;  2MF2 A;  4OMO A;  3CCR T;  1Q86 U;  1YN8 A;  3AHU A;  4KUL A;  3QWX X;  2C0T A;  2EGC A;  3KBG A;  3RIR A;  3LH0 A;  5DLQ E;  1RIQ A;  4DOV A;  1K9M U;  1YWP A;  2DL4 A;  4LVI A;  3NEM A;  3HL8 A;  1X27 A;  1TH7 A;  3BJU A;  2QQB A;  1VYV A;  2DRK A;  1Q82 U;  2P0L A;  1SRM A;  4QKU A;  4JS4 A;  1YCY A;  2JT4 A;  3OYY A;  1Q7Y R;  1YFT A;  4EX5 A;  4QQD A;  3S6W A;  2E12 A;  2MWO A;  4FYX B;  1VQL T;  1QKW A;  3CCJ T;  3HFZ B;  1IRX A;  2VB6 A;  3X24 B;  1C1A A;  4A4F A;  2E10 A;  1JJ2 P;  2DTO A;  5EC7 A;  5GAN 4;  3LWH A;  4EDU A;  4J6X A;  2QEX A;  1R8O B;  2JVV A;  2YXY A;  3SHW A;  3BW1 A;  1Y0M A;  3CCV T;  3A8G B;  5LJ5 g;  2NUT A;  2YDL A;  2DZ9 A;  3KFV A;  1QVP A;  2L8D A;  4NL3 A;  3W3S A;  1D0Y A;  3OBY A;  2J6F A;  1GBR A;  3DKM A;  4C5H A;  2XK0 A;  3A5Z B;  4M77 A;  1VQ8 Q;  1MV0 B;  3OB9 A;  1YBY A;  1VQ5 Q;  1PRL C;  3TRE A;  1E6H A;  3I55 Q;  3C94 A;  1JQQ A;  1UGS B;  5K1X A;  1MUZ A;  4OMM A;  2DXC A;  2J7I A;  3OS1 A;  4G85 A;  1Q7Y C;  1LVK A;  2DIG A;  1OI1 A;  1X75 C;  4LUD A;  4A4G A;  4CC7 A;  3RER A;  3WXM B;  5CO7 A;  2HMA A;  1SSF A;  3JB9 J;  4LD9 K;  2NLU A;  2HBW A;  4BI3 A;  2LX9 A;  2NUT B;  3EGD B;  3JCM g;  3QO7 A;  2RHS A;  1B70 A;  2AMC A;  2RK1 A;  2ZAE A;  1QVG S;  4CC2 A;  1NM7 A;  2DD5 A;  1ZUU A;  4TVW A;  3GIB A;  4DBR A;  3VYG A;  5IHN A;  2X51 A;  5GMK m;  2D0N A;  2YUO A;  4GY5 A;  4YRP A;  3MEW A;  2BE9 B;  3BDL A;  2DVJ A;  3F70 A;  4Q15 A;  1NJ5 A;  1Q7Y U;  2DFU A;  4TWA A;  2HCK A;  1VQ7 A;  4M77 E;  2LCL A;  1UGP B;  1QMC A;  2QEX Q;  3G1J A;  2BZY A;  4K87 A;  2A37 A;  2GFU A;  2GGR A;  2Q5I A;  4JZ4 A;  4P3P A;  4DEY A;  3A7A A;  2RHS B;  1IO6 A;  1D09 B;  4BE0 A;  1M1K R;  4HVC A;  1W1F A;  1JEG A;  4MZT A;  4BB7 A;  4QT7 A;  3S3M A;  5GMK j;  1RAC B;  3FJ5 A;  3CME A;  3TEE A;  1OX9 A;  3RES A;  5LJ3 d;  2OTL A;  2RH2 A;  5GAN g;  5CKF A;  4HT4 A;  4TVR A;  2EWN A;  5FU6 C;  4FW2 A;  1ACM B;  4ZNX A;  1VQ4 Q;  3WVD B;  2MMP A;  3GF5 A;  3CCR Q;  3M0S A;  1UB4 A;  1QVF A;  1N8R R;  4M7A D;  3FIF A;  2K7A A;  3L2Z A;  4N0A A;  2PME A;  2EGA A;  2CP6 A;  2KRM A;  3IG2 A;  1ASZ A;  4M75 D;  2EAY A;  3GNG A;  2KMT A;  2QG9 B;  1W4S A;  3CCS A;  1M1K C;  3EG3 A;  3O8V A;  2DF6 A;  1WGS A;  4RUG A;  3JCM J;  1RLQ C;  4FT4 A;  2DZC A;  2RF0 A;  5CKH A;  1Y96 B;  1PKS A;  3CPW S;  2EJF A;  3PNW C;  1VQL Q;  4M77 C;  4QVZ A;  2K3B A;  4RTT A;  3X25 B;  3RMS A;  2ZIO A;  3QYH B;  5GAO n;  4IUR A;  1WJQ A;  2EKH A;  3MHX A;  4M75 A;  2OAU A;  5FRO A;  3L4G A;  4JRI A;  2K4Y A;  1M8M A;  1ZA1 B;  3VUB A;  3RBB B;  4HCZ A;  3CCV Q;  3CD6 T;  1GCP A;  2DER A;  1ADY A;  2ZT6 A;  3NMZ C;  2ZPG B;  1EVK A;  1WXU A;  4CS4 A;  3THK A;  4FYV B;  4RTV A;  1HSQ A;  2Y4Y A;  1ABO A;  2QQS A;  5GAM g;  1T0J A;  1N8R C;  1X01 A;  1LOJ A;  3OS5 A;  5LJ5 j;  2G6F X;  5LJ5 f;  4HCK A;  5GAO q;  1K9A A;  4M7A B;  2XG8 D;  1E1T A;  2XMF A;  3CME Q;  1E7O A;  1M1K U;  2E1H A;  2OTL Q;  2ZT7 A;  4XAX B;  4M77 G;  4F7U E;  3PE0 A;  1FMK A;  1SES A;  4GLK A;  1VQO A;  1P92 A;  4M75 B;  3L4G B;  1RI0 A;  1KQS S;  4J9H A;  3HXW A;  4F7U F;  2LP5 A;  3M4G A;  2AKL A;  2HBP A;  1YWO A;  2ECZ A;  4C0D B;  1GFD A;  2DKG A;  5IAY A;  5GAO r;  1JRI A;  2FVU A;  1MNE A;  5E3I A;  2CP5 A;  1VQP T;  4PJN A;  2V8I A;  2KNB B;  1O75 A;  1N8R U;  3FC3 A;  2M51 A;  5KYW A;  1T0H A;  3JCM f;  5KNN A;  2WSF E;  3I56 T;  5GAN 6;  4NOY A;  4UC4 A;  2ED0 A;  1H64 1;  4ZTF A;  2NWM A;  4PJO E;  4BW9 A;  1VQM A;  3SWN A;  3VS1 A;  4FYY B;  1GXI E;  2JMA A;  3LWI A;  4XU0 A;  4PJO F;  1YFS A;  5IXB A;  2NYS A;  1E6G A;  2EVR A;  4FCY A;  4H2U A;  3ULR B;  2E5Q A;  3CCM T;  3EFS A;  3X20 B;  3CD6 A;  2RO0 A;  4N4I A;  4PLI A;  5LJ5 h;  4FSS A;  2DM1 A;  1MGQ A;  5A0D A;  5KYW B;  4CH4 A;  4N0A C;  5GAN 8;  2IY5 B;  1FMV A;  3QWY A;  3EH1 A;  4TVY A;  2KEA A;  3EAE A;  2ZT5 A;  4RQF A;  4M7A C;  4OMQ A;  1WYX A;  4IIO A;  1W2B S;  1CSK A;  2M0O A;  3CXC P;  2Q5H A;  4PJM A;  5IH2 A;  3JRZ A;  3GOX A;  3UDC A;  3OYG A;  2RJE A;  1PD1 A;  3EGX A;  5GAN j;  3A98 A;  5GAN f;  2QDY B;  4M75 C;  4F17 A;  4ORZ A;  2K3Y A;  1VYU A;  4XK8 E;  1WYD A;  2HQX A;  1UTI A;  1VQP A;  4LNP A;  2KYB A;  4C0D C;  1B34 A;  2ARU A;  2R57 A;  4JLG A;  1TSF A;  3GLX A;  2J05 A;  4O6J A;  4LNS A;  2JXB A;  2A08 A;  3M4Y A;  1WHM A;  3H9N A;  5CCA A;  4XQ3 A;  3OSV A;  5CQY A;  2LT4 A;  1VQM Q;  3CBO A;  4C8Q D;  5KH6 A;  4ZTJ A;  1EZZ B;  3SB2 A;  2AK5 A;  2GBQ A;  2VV5 A;  4FYW B;  3P8Y A;  4O2D A;  2JUF A;  3J81 E;  1QP3 A;  4LXC A;  1YIT T;  1M27 C;  2YRV A;  3VU3 C;  1UGR B;  2B86 A;  1RAD B;  2QTV A;  4C8Q A;  2E70 A;  3CD6 Q;  4LUE A;  3VQX A;  1N9S A;  1QVG A;  2D9T A;  1SER A;  1B34 B;  4C92 D;  2LQ8 A;  2AKW A;  3QNE A;  2M16 A;  1NYF A;  2FEI A;  1X56 A;  2LQW A;  4A63 B;  2J06 A;  1U3O A;  3VRZ A;  5GAM j;  1JXM A;  5GAM f;  4KUD K;  2E5K A;  5DLO A;  3CC2 A;  2DQ3 A;  4JJC A;  5GAN 7;  1NJ2 A;  4C92 A;  5GAN h;  1IGU A;  1U1T A;  4J9B A;  2LTO A;  1MMG A;  2ENM A;  3SWN C;  2RPN A;  3NTI A;  1LPL A;  2OAW A;  4H2S A;  1WU7 A;  5FU7 B;  3VBB A;  2DO3 A;  1SPK A;  2MI6 A;  4J7I A;  3CC4 A;  2W10 A;  4J9E A;  1IHV A;  1VQP Q;  3NEN A;  2XD0 A;  4D8K A;  1EIF A;  4K88 A;  3MQZ A;  8ATC B;  3J7A F;  2VYT A;  1B7Y A;  2E3I A;  2O9S A;  4M7D E;  3GBQ A;  3VQV A;  3E9G A;  4C92 B;  1M9S A;  2FZG B;  5AYF A;  4M7D F;  3QPH A;  1AD5 A;  2ZIN A;  2RN8 A;  4NL2 A;  1M5Q 1;  2XI9 A;  2ZPB B;  3PT9 A;  1QVG P;  3A8O B;  1BYM A;  4PJL A;  2HQE A;  3E19 A;  2DQ0 A;  5LJ5 d;  2LVM A;  4PFP A;  3CCM Q;  4H2T A;  4BUG A;  4ZTZ B;  1H92 A;  1H4Q A;  5GMK e;  4E47 A;  4C5E A;  1D0Z A;  3O5Z A;  2RQU A;  1UUE A;  1KQ2 A;  4C5I A;  1E24 A;  4PHC A;  1XJW B;  5GAM h;  3EG1 A;  1WHG A;  2HZY A;  1MV3 A;  2P0Q A;  1C0M A;  1WNL A;  3OD1 A;  1OX8 A;  4OGE A;  1HD3 A;  2KXD A;  2RHQ A;  1QVF S;  1ADJ A;  3QXE B;  2H3E B;  2CKK A;  3MO8 A;  1M1G A;  3QUI A;  3QDF A;  3A7U A;  3OSS C;  5KE2 A;  3WVE B;  1EIY B;  3LYI A;  3M0U A;  1VQ5 T;  1IB8 A;  2B8A A;  3NTH A;  1X6B A;  4R0K A;  5KYU A;  1Q86 R;  4YPF A;  3JCM d;  4LVK A;  4AFU C;  4KGX B;  3JSC A;  3LGF A;  2HL5 C;  4YYE A;  1TWB A;  2FRW A;  3BY7 A;  3G4S T;  1IXD A;  1X43 A;  2DAQ A;  4BAC A;  1UGQ B;  2LCC A;  4C8Q C;  1N9W A;  2DPP B;  4X34 A;  2MCN A;  1R0B G;  3HRK A;  5M9O A;  3V8J A;  2O88 A;  2CH4 A;  3LH5 A;  2P4R A;  1QWE A;  1Q82 R;  5GMK i;  4PG3 A;  2DU7 A;  1BBU A;  3JCM X;  4BI8 B;  4R55 A;  1NPR A;  2CH4 W;  2I0N A;  4FIB A;  1D1B A;  4BE1 A;  4HT8 A;  1BI3 A;  1KQS A;  4OMN A;  4DOW A;  2Y90 A;  2H3J A;  3DB3 A;  2F2X A;  2QHT A;  2YLC A;  3M54 A;  3PGG A;  2LNV A;  1NZ9 A;  4C92 C;  3M4Q A;  2XDB A;  4LVJ A;  3OYC A;  2OJ2 A;  3OW2 S;  1G5V A;  1R0C B;  4YRK A;  1KQ1 A;  2VXE A;  4K11 A;  5HY6 A;  4IUU A;  4MMK A;  2RI2 A;  3CPW P;  5J39 A;  1Q86 C;  4C8Q G;  2HD0 A;  1QKX A;  2QEX T;  3HXY A;  1NNH A;  3QZ5 B;  3VJP A;  4ZTU B;  2K5F A;  4JPB W;  5GAN d;  2LMJ A;  1IZ6 A;  1QWF A;  5HK3 A;  4H2X B;  3UFG A;  1WLP B;  2DXT A;  3E2U A;  4ZN1 A;  4C92 G;  4RKU E;  3JCM c;  4B9W A;  1WHH A;  3OYD A;  2DDZ A;  4WJ3 M;  1G51 A;  1NYG A;  4KUI A;  3RNJ A;  2ZNJ A;  3MP1 A;  4GLM A;  2CRE A;  3BE3 A;  2DD4 A;  4J9C A;  4XEO A;  1O9S A;  2Q7G A;  2K9G A;  3NET A;  4UP9 A;  2K57 A;  4LDV A;  4OMF B;  1HYO A;  1M3C A;  5D6X A;  1S1N A;  4A54 A;  1W2B A;  1SHG A;  2E41 A;  1F1B B;  5A0G A;  2D8H A;  3PMI A;  2EKO A;  1UE9 A;  2C8M A;  5ECA A;  3OYN A;  3A5Z A;  1MHN A;  5I22 A;  5FW9 A;  5KYY B;  2HKQ B;  1M2V B;  3JB9 I;  3MJX A;  4XU3 A;  1H3Z A;  2ABL A;  5EG2 A;  2DYB A;  4ELY C;  2V26 A;  2QA4 A;  1I1J A;  5GAM d;  2VGM A;  1VQ7 T;  4YRO A;  9ATC B;  1B7T A;  1ZX6 A;  2J6O A;  4E7Z A;  5GAN 3;  3JB9 G;  4NCX A;  3MEY A;  3OYJ A;  3EG9 B;  5GAN 5;  3L1A A;  2ALY B;  1K0S A;  3JCM P;  3EGD A;  2A3L A;  2DU5 A;  2Q7E A;  2RQT A;  1N27 A;  3UA6 A;  1XNI A;  1AZG B;  2JZ2 A;  4E7I A;  1VIE A;  2EQU A;  4OB2 B;  3HY0 A;  3JCM Q;  3QZ9 B;  2BZX A;  4PKC C;  3CME T;  5KCO A;  1PCX A;  2ARS A;  5FRN A;  1K8A R;  4BI4 A;  2OTL T;  4J6Y A;  2EYW A;  3TU4 K;  2EQI A;  1QF6 A;  4YRE A;  1K73 R;  2FPD A;  3M0R A;  2RD1 A;  11AS A;  3OBW A;  3G4S Q;  1TUD A;  3LC0 A;  1N9R A;  4HCC A;  2QK0 A;  2DL3 A;  4KBM B;  3QKJ A;  4EIK A;  1FYN A;  1X54 A;  4ATO A;  4QVC A;  1YJW A;  4JRK A;  3OYI A;  1KG1 A;  3HXU A;  1D3B B;  1HXD A;  4CS2 A;  2BE7 D;  2X9H A;  3FLG A;  3CCS T;  3ERR A;  1YIJ A;  1WQW A;  1RAG B;  4DEX A;  3QSU A;  4A4K A;  1PWT A;  5KE3 A;  3PMT A;  2QA4 Q;  2QXF A;  2L2P A;  1E22 A;  4RG2 A;  1K8A C;  1BBZ A;  4QVD A;  1AVZ C;  2CZ6 B;  1GRI A;  2M0Y A;  4J9G A;  1V76 A;  3DLM A;  3HXX A;  1G2B A;  1WHJ A;  1K73 C;  3TEH B;  2CSI A;  4Z89 A;  4M77 F;  2DBK A;  2CZ0 B;  1PRM C;  1SF9 A;  1OYX A;  3VV0 A;  1H3H A;  2ODR C;  2KDS A;  3V7R A;  1BB9 A;  5A0L A;  3RAC A;  1XTD A;  1G3T A;  3H0H A;  4OB0 B;  2A28 A;  3J80 E;  2OTJ A;  3A7R A;  4G84 A;  1I07 A;  2SEM A;  1Y96 A;  1VQO T;  4TQD A;  3RGL A;  2KQW A;  1LNX A;  3EH2 A;  5C51 B;  5GAO p;  4YCV A;  2PZ1 A;  5FWC A;  2CDT A;  1FXX A;  1K8A U;  1YNZ A;  4M78 D;  1M30 A;  4HCB A;  1YB3 A;  3CC7 A;  4MDX A;  2YRC A;  5C52 B;  4AFS C;  3PFS A;  3G6E A;  1K73 U;  2LC4 A;  4QQ6 A;  4RMF A;  1D1A A;  4HWT A;  1YJ9 A;  1MMA A;  2AT1 B;  2CIM A;  1M3A A;  5CR2 A;  2JS2 A;  2X4Y A;  2F1L A;  1WHL A;  1I81 A;  1WA7 A;  3IQL A;  1GFC A;  4FL6 A;  2MYS A;  4M78 A;  4F14 A;  4WJ4 A;  5ELN A;  4M7A A;  2EFI A;  1NLO C;  3RKW A;  2DK3 A;  1UDL A;  5J3B A;  2AHJ B;  4J5Y A;  3OYL A;  1VQM T;  2EJ9 A;  1U8R A;  1JJC A;  1NYR A;  2CGH A;  1A0N B;  4MML A;  1UHF A;  3JCM b;  2RHI A;  1VQ7 Q;  4LDX A;  1QCF A;  3NEL A;  2MK5 A;  2HL3 A;  1J5W A;  4DA4 A;  1VQ9 A;  1B3Q A;  5CAI A;  1TS9 A;  4KGZ B;  2L89 A;  4M78 B;  2FPE A;  1UEB A;  3I7F A;  4E7K A;  4K86 A;  3A8H B;  2HSE B;  3OW2 A;  3PIO A;  2JNG A;  3LW5 E;  5LJ3 e;  1JJC B;  2DTH A;  1TTH B;  2A7Y A;  4HWO A;  1S72 T;  3TUP A;  3Q1J A;  2CP3 A;  2DNU A;  3UGT A;  1QVF P;  1PNJ A;  4F7U B;  3HPW A;  2JW4 A;  2YUN A;  4Z02 A;  3UA7 A;  2BIV A;  3VRY A;  4M7A E;  2E3H A;  5DM7 R;  2AIR B;  3KXT A;  3CCQ T;  1VIF A;  5CKE A;  4E7J A;  4ZGJ B;  1NJ6 A;  1FYF A;  2O2O A;  2KAF A;  1J3T A;  2PVO B;  1SKU B;  4RTZ A;  4RDX A;  1NJI R;  3P8D A;  4M75 E;  3M55 A;  1FX7 A;  4JUV A;  4C0G A;  3HXZ A;  4KRT A;  2YT6 A;  3ZBD A;  3I5R A;  4V2S A;  4DPG A;  2IY5 A;  1BI1 A;  4M75 F;  1FMW A;  3CCS Q;  4Z8A A;  2E5A A;  4PNO A;  2Q7H A;  3D7S B;  4UP7 A;  4F04 B;  4ZGD B;  4PJO B;  2JMC A;  5D6Y A;  4HVU A;  1NE8 A;  2ZZD A;  3PIP A;  3REX A;  4EO4 A;  3OY9 A;  1AHJ B;  4L5G A;  4IKF A;  2VUB A;  2KE9 A;  3P8T A;  1YGB A;  1VQ9 Q;  3WQZ A;  4CH6 A;  1WDX A;  2RQR A;  4D6W A;  1KHC A;  8AT1 B;  2Y4X A;  3HY1 A;  2XDP A;  2J3L A;  4Y28 E;  4KQE A;  1BBW A;  1RUW A;  4YRC A;  1V29 B;  2K79 A;  3A8L B;  1YHQ A;  3TVT A;  2IPO B;  3CMA T;  3HP9 A;  4KR2 A;  2YHT A;  1NJI C;  4M78 C;  2PUK B;  3CC2 T;  2O31 A;  3CCE A;  2ZCF B;  3M59 A;  1IHW A;  1QCO A;  1VQO Q;  1S72 A;  4XTU A;  2KT8 A;  4FT2 A;  1KIK A;  1YJN A;  2MPX C;  4WF2 A;  4A53 A;  2RI5 A;  1PM3 A;  1M90 R;  3TEG A;  2X35 A;  2DE0 X;  1M3B A;  3CCQ A;  1GBQ A;  2EL9 A;  1RL2 A;  4LE9 A;  2EQK A;  4OMP A;  2BTT A;  2QHS A;  3UGQ A;  3CC4 T;  2OI3 A;  1VA7 A;  2KVQ G;  3VS3 A;  5HGQ A;  4QW2 A;  2ROL A;  3C0C A;  2QI2 A;  5HCK A;  5KYX A;  3DSQ A;  1SG5 A;  4J6W A;  3C95 A;  4YRG A;  4M78 G;  4JJB A;  1NJI U;  2K3X A;  1B76 A;  2ZZE A;  5GJW B;  4M7A G;  3G71 A;  2LJ0 A;  5IHI A;  2DRM A;  1CKB A;  1WXT A;  1K0X A;  2P0P A;  2GNC A;  1SSH A;  2CZ1 B;  2GQV A;  4II1 A;  3VS7 A;  1I8F A;  1DJ7 B;  4M75 G;  2C0O A;  4Q5W A;  1YCS B;  2KBT A;  2EJG A;  2XID A;  2JTE A;  1PYS B;  3QO5 A;  1M90 C;  2QHV A;  3QYG B;  5A2Q E;  1CKA A;  4PL6 A;  5LL6 S;  1M8V A;  2QDL A;  2COY A;  5KYX B;  4XTY A;  1NEG A;  1YHQ Q;  2E65 A;  1GGM A;  3QJ6 A;  3CMA A;  2HAX A;  4YP0 A;  1ZA2 B;  1G8X A;  3CCE Q;  4FW1 A;  4J7F A;  4HWP A;  2QAZ A;  4XTV A;  3L2U A;  1TOV A;  4E7H A;  2VC8 A;  2DL5 A;  5GJV B;  1S72 Q;  5C6S A;  1ZHI A;  1X2H A;  3MEA A;  1VQ6 A;  4P3O A;  2E4H A;  2E6Z A;  3KFU A;  1NLP C;  4MZM A;  3QG1 A;  2KYM A;  1JO8 A;  4BE2 A;  1RAH B;  4HT9 A;  1NEB A;  3HHT B;  4PFO A;  2VKN A;  4J9D A;  3CCQ Q;  3LGL A;  2L3P A;  2V8K A;  4LD6 A;  4E2F B;  4P71 A;  2NUZ A;  3OYE A;  4CH5 A;  2QGF B;  3H8Z A;  4NS5 A;  1BCO A;  4KT0 E;  1V1C A;  2VXF A;  2RJF A;  3BDU A;  4X9D A;  12AS A;  1I5O B;  3EG2 A;  1M90 U;  2XTI A;  2KR3 A;  2RQW A;  1HTT A;  3NGP A;  2RHU A;  5J26 A;  4M4Z A;  4YDQ A;  4C0F A;  4CC4 B;  1YI2 A;  2EYQ A;  2ZT8 A;  2NS6 A;  5GAN 2;  3OYF A;  1VUB A;  3INZ A;  4C8Q E;  5DY9 A;  2D0Q B;  1WFW A;  3HRI A;  3LLR A;  4YRF A;  2ZPH B;  5IXF A;  1KK7 A;  1Q95 G;  4C8Q F;  4E6R A;  1C6V X;  1ZUK A;  4EMG A;  1EIY A;  5I21 A;  2DJZ A;  4HWR A;  2K6D A;  2FL7 A;  1K4U S;  4C92 E;  2CJB A;  2RHX A;  4Z88 A;  2E64 A;  3M56 A;  2PMF A;  2EPD A;  3HKS A;  1GL5 A;  2L5Q A;  2PVG B;  4C92 F;  3GNF B;  1EOV A;  2DTI A;  3CMA Q;  3CCL A;  2P4T A;  1PHT A;  5KYN A;  3CC2 Q;  1L0W A;  2ZZG A;  1KMN A;  4RTY A;  3MP8 A;  1IGQ A;  2ZPE B;  2H8H A;  2XKO C;  3VKI A;  4E51 A;  1AWW A;  1VOM A;  2KRN A;  4PFZ A;  3EHQ A;  3PTA A;  2KT1 A;  3OA6 A;  1WX6 A;  1PD0 A;  3RKY A;  3C4S A;  1OPL A;  2BUD A;  3HRU A;  3CC4 Q;  4AFQ C;  4KGV B;  3MF2 A;  5FU7 C;  2LNH B;  1BIB A;  4BY6 B;  3NHN A;  1YI2 Q;  3ME9 A;  1D1C A;  1ZBJ A;  2LX7 A;  2LZ6 B;  2HSP A;  1VQK A;  1USY A;  4QQG A;  4F16 A;  2V8J A;  3RMQ A;  5IT9 E;  4IUT A;  3JB9 F;  3I35 A;  3JCM V;  2NUP A;  2X4X A;  1B07 A;  4H2X A;  4J9F A;  4HXJ A;  2XIC A;  2MAM A;  2F2W A;  3MEV A;  3V8L A;  1KC8 R;  2QGG A;  1TXQ A;  3MEU A;  2PVD B;  3VUZ A;  4EPC A;  5LJ5 e;  2M9U A;  2ART A;  1Z9Q A;  3IKL A;  3JB9 H;  3GP8 A;  2QA4 T;  3HTR A;  3E1S A;  1WJR A;  3RKX A;  2YLB A;  4ESR A;  4P71 C;  1OV3 A;  1H4V B;  5HKC A;  4CH3 A;  4RTX A;  1B8A A;  2O9V A;  1SHF A;  4YRN A;  2HEQ A;  3R6N A;  3CCL Q;  1OU9 A;  2LQN A;  2COW A;  4H02 A;  5K1P A;  5HK0 A;  2DL7 A;  1H8K A;  3L2W A;  2K2M A;  2NUP B;  1TG0 A;  4J15 A;  1UJ0 A;  2FRY A;  3R07 A;  5F5W A;  5KYY A;  3P8V A;  1M2V A;  2KY9 A;  3GPL A;  2R5M A;  3E9F A;  3EFO B;  4P72 A;  1KHI A;  2EIF A;  2V1Q A;  3OMC A;  3JCM e;  3H41 A;  3P8B B;  1JJ2 A;  1WHK A;  2LT1 A;  4IUV A;  2F5K A;  4OVA A;  1KC8 C;  2F69 A;  1XQH A;  5IHK A;  3OQ5 A;  5KCH A;  1KQS P;  1Z9Z A;  2QQ9 A;  3RDV A;  1VQ8 A;  4XU1 A;  3EG9 A;  2ZR3 A;  2RMO A;  5L23 A;  2ALY A;  3I55 A;  2L3S A;  5I11 A;  1VQK Q;  1YJW T;  2CP7 A;  2LRQ A;  2COZ A;  2KRS A;  1YFN A;  1Y07 A;  1U5S A;  3LSS A;  4Y91 A;  2X3X D;  3MP6 A;  4YRS A;  4AT1 B;  1YIJ T;  3UAT A;  4PJJ A;  1QQJ A;  1BI0 A;  1SEM A;  2P5I A;  3CCU A;  5AT1 B;  4P74 A;  5L8R E;  4OLF A;  2XGT A;  1NG2 A;  4E7S A;  4TQF A;  3G7Z A;  1RAB B;  3SEM A;  1KC8 U;  2EBP A;  1MND A;  2E6N A;  3IKM B;  5I2M A;  3TCJ A;  1UHC A;  4N4G A;  2R5A A;  3NTK A;  1QW1 A;  1AWX A;  4BD3 A;  1JXO A;  2LDM A;  2DLP A;  2K5L A;  5GAN e;  3H0F A;  2KGT A;  1X2Q A;  1D3B A;  1ARK A;  4TVA A;  1IL2 A;  1SRL A;  1X69 A;  4MDW A;  1Z7M A;  1ASY A;  3UPU A;  1USY C;  2GQI A;  1KFZ A;  5GAO l;  2OTJ T;  2O4X A;  2RB6 A;  3BFM A;  4M77 D;  3T9N A;  4CC3 A;  1D0X A;  3PCO A;  1ATI A;  3HFN A;  1JB0 E;  2W0Z A;  2D6F A;  1JBM A;  4JS5 A;  2AZV A;  3KUF A;  5GAO m;  1OEB A;  3CC7 T;  1W2B P;  2J6K A;  3EFR A;  3TSZ A;  3G6E T;  2ZPF B;  2ZR2 A;  1UG1 A;  3OYK A;  4J8O A;  3TEH A;  1I4K 1;  2YUQ A;  5FU6 B;  1YJ9 T;  2BZ8 A;  2X3W D;  3M0T A;  1KOG A;  4TVA B;  1BK2 A;  2CP2 A;  2LCS A;  1VQ4 A;  3EGU A;  1X2G A;  2D1X A;  3CCR A;  4A4E A;  2CZ7 B;  2KRO A;  2O4X B;  5CK9 A;  3M0P A;  1SET A;  3CCU Q;  4YCU A;  3A5Y A;  2A8E A;  3PCO B;  4H2Y A;  1IRE B;  1PC0 A;  3VS4 A;  5GMK l;  1VYT A;  5GAM e;  2DET A;  2IVW A;  4P72 C;  3UT1 A;  4LDW A;  3RL6 A;  4Q6G A;  2RHZ A;  3FDR A;  2K5I A;  1JU5 C;  2DMO A;  3HTZ A;  2L0A A;  1WIE A;  2CS7 A;  4M77 B;  2ZGW A;  1WQ7 A;  3HRT A;  4HWS A;  4L87 A;  1WJS A;  1OZ2 A;  1VQ9 T;  3MCA B;  3VS5 A;  1QCN A;  4YCW A;  1PKT A;  4JJD A;  1VQL A;  3QDR B;  4LVM A;  2C7I A;  3CCJ A;  2FZK B;  1Y7X A;  1HC7 A;  1N5Z A;  2KXC A;  2JN0 A;  2DX1 A;  2GF7 A;  1ZSZ A;  4UP8 A;  3MKD A;  1RAF B;  1ZQ1 A;  3CCV A;  1X6O A;  3V7C A;  4YRI A;  2L3R A;  2QHU A;  2FO0 A;  1B70 B;  2AMC B;  1ZLM A;  2EYX A;  2MWP A;  2EQJ A;  2QQR A;  4CI0 C;  2GTJ A;  4VUB A;  4P74 C;  2QTX A;  3V7S A;  3R6O A;  3QO3 A;  1Q81 R;  4CRI A;  1ZBX A;  2JOY A;  4RTU A;  4DBQ A;  2I4N A;  3CPF A;  1YJW Q;  1PG5 B;  2MIO A;  2RQV A;  3EHR A;  3M53 A;  4JJN K;  3PVQ A;  2XDD A;  3FB9 A;  4FU6 A;  4ELZ C;  1N6A A;  4YRL A;  2M1H A;  4XTW A;  2ATC B;  3QBY A;  3M4P A;  1ZSZ B;  1YIJ Q;  4YTL A;  1KMM A;  4P3N A;  2CT3 A;  4X5O A;  2LJ1 A;  3E9I A;  4F7U A;  2R58 A;  4RG8 A;  5C0M A;  2HDA A;  3DLL A;  2RHY A;  3QJY A;  3S3O A;  2I4L A;  4OB3 B;  4P73 A;  3DB4 A;  3I5S A;  2JM9 A;  1RAE B;  3N5B B;  4P5N A;  3CCJ Q;  1LCK A;  1OUL A;  4PJO D;  3OS2 A;  4HVV A;  2YSQ A;  4A4H A;  1Q81 C;  1LJO A;  4MZP A;  1YHQ T;  3VQY A;  1ABQ A;  1BI2 A;  2OTJ Q;  4EMK A;  3CCE T;  1EQR A;  4H2W A;  2LJ3 A;  2IG0 A;  2YUP A;  3VS0 A;  1W70 A;  3V8K A;  4PJO A;  4LDU A;  4JLI A;  1YJN T;  3FJP A;  2MOX A;  4M78 E;  3ASK A;  2BKD N;  3CBP A;  5GMK h;  4X9C A;  2QAS A;  3CC7 Q;  4XTX A;  4M78 F;  3L2V A;  3G6E Q;  1OU8 A;  2CSQ A;  4L6V 5;  4M7A F;  3RF1 A;  4LVL A;  3ER0 A;  3CBM A;  2JTF A;  2XHC A;  1YJ9 Q;  1BCM A;  1U06 A;  3VYH B;  4YRR A;  2A36 A;  1PSE A;  2P0K A;  1Q81 U;  4AMC A;  4EMK B;  2FPF A;  2RJC A;  1VQN T;  3L2R A;  3CXC A;  2CUD A;  3G71 T;  2HNI A;  3FRN A;  4B6M A;  1NJ8 A;  2DXB A;  1ZSZ C;  4FM4 B;  3OYH A;  1YFR A;  2F2V A;  2IIM A;  1UJY A;  2DA9 A;  3S3N A;  1ZUY A;  1NJ1 A;  2WSC E;  2WSE E;  4N4H A;  4CS3 A;  2I4O A;  4XU2 A;  4ZIB A;  1RAI B;  1JJ2 S;  4YRM A;  3OW2 P;  2ZZF A;  5CIU A;  3VS6 A;  2K2V A;  4IUP A;  1VQZ A;  1NYQ A;  4JDS A;  5D6W A;  1KJW A;  3OS0 A;  4J83 A;  2CUB A;  5FRM A;  3C12 A;  2DL8 A;  4LDY A;  2J3M A;  4JZ3 A;  2CJA A;  4EMH A;  1VQ6 T;  4YRT A;  2EYZ A;  1T3S A;  4TTV A;  2GTO A;  4DQ2 A;  4HVW A;  2ED1 A;  3LSQ A;  1BKB A;  3A31 A;  2CP0 A;  2KSS A;  3UF4 A;  3SWN B;  2AZS A;  1PYS A;  3QHS A;  1X55 A;  1YI2 T;  4P73 C;  3QTC A;  4HA8 A;  3UH0 A;  4ME7 A;  4AH6 A;  1VQN A;  1TUG B;  3ICA A;  2JM8 A;  5LJ3 g;  4P75 A;  4DBF A;  1G3S A;  4LN2 A;  1M4Z A;  4H2V A;  3TQ7 P;  2RJD A;  3JCM h;  1UFF A;  4EMK C;  5CQX A;  3E9H A;  1RAA B;  2XU8 A;  1UEC A;  2D8J A;  3QO8 A;  4PJO C;  1Z7N A;  1EFN A;  1OQK A;  4F7U G;  4OB1 B;  2RNA A;  3I56 A;  2ZPI B;  2A0F B;  1PSF A;  4KH0 B;  1KSW A;  2O01 E;  2DJQ A;  1KD1 R;  1LYL A;  3FEO A;  4YRJ A;  4OF1 A;  1E1O A;  3H0I A;  4M7D D;  4BDY A;  3JAM E;  3PVL A;  1AOJ A;  1OOT A;  2ZXF A;  1WZO A;  4ANJ A;  3EGX B;  2ZTG A;  1R77 A;  2CYZ B;  2EYY A;  3U23 A;  2G4C A;  3CCL T;  4J9I A;  1GCQ A;  1G3W A;  3VS2 A;  1NPP A;  3CCM A;  1NBE B;  3QII A;  4M7D A;  2EGE A;  2PU9 B;  4AFZ C;  3A74 A;  1K1Z A;  1YJN Q;  2F5T X;  3OYA A;  2E3C A;  3X26 B;  2YRD A;  2P84 A;  4PJO G;  4GBQ A;  3ZFJ A;  3X28 B;  1AEY A;  5IN1 A;  3TSW A;  1Y71 A;  1HK9 A;  3OMG A;  2VWF A;  4ZGE B;  3URG A;  2GFA A;  1OPK A;  5FLX E;  1Y57 A;  2FHD A;  2X4W A;  1TU0 B;  2L3Q A;  1KD1 C;  2JTM A;  1ZSG A;  3M57 A;  2RI3 A;  2I2L A;  3M0Q A;  1VQK T;  4OGC A;  1VQN Q;  4C8Q B;  1AWO A;  1QE0 A;  3G71 Q;  1T3L A;  4M7D B;  3PZC A;  2ZIM A;  3RUX A;  3ZL7 C;  3NPF A;  4WCI A;  1I5L A;  4XEM A;  1M2O A;  4WI1 A;  4X1V A;  3OYB A;  5I2S A;  1WLE A;  2AKW B;  3L2Q A;  4JRP A;  2KI7 A;  3A1P A;  3SD4 A;  2DIL A;  1X6G A;  3I56 Q;  3JV3 A;  4YRQ A;  6AT1 B;  2X4J A;  4KH1 B;  2G3R A;  3CQT A;  2DEQ A;  3HRS A;  2DBM A;  4E7L A;  4IUQ A;  3JB9 D;  1QP2 A;  1QLY A;  3A8M B;  2EW3 A;  4RCB A;  3ZEH A;  3CEY A;  1AZE A;  5CKD A;  1MMD A;  3G1Z A;  4OML A;  4ZN3 A;  2ZNI A;  1YIT A;  1KD1 U;  3P8H A;  2FG0 A;  1K76 A;  2ESW A;  2DIQ A;  2PUO B;  1W66 A;  3MET A;  4D8D A;  2RM4 A;  1BIA A;  2OX7 A;  4KR3 A;  4PLL A;  1VQ6 Q;  1H4T A;  2VVK A;  4P75 C;  1WXB A;  4L59 A;  2ZCE A;  1WI7 A;  2DYI A;  4WTO B;  1B7Y B;  4HKE A;  3CPW A;  2QYZ A;  3HFV A;  5ELO A;  2AKK A;  2V1R A;  3H6Z A;  1EFW A;  3HXV A;  2HKN A;  5CKB A;  5C53 B;  2EQM A;  2Z0W A;  1VQ8 T;  2WAC A;  2RK2 A;  4PK4 A;  3I55 T;  2ROT A;  1G3Y A;  2KK4 A;  2LQK A;  2RA2 A;  3M9Q A;  3REU A;  4RQE A;  3LX7 A;  1GCQ C;  3M58 A;  4B9X A;  2JS0 A;  2VGN A;  1K9M R;  3MPU B;  5LJ3 j;  2CJ9 A;  5LJ3 f;  3HSB A;  4M7D C;  2I4M A;  3RR6 A;  1M1F A;  3SFM A;  3CCU T;  4RMO A;  1C0A A;  3EFO A;  2YWW A;  2RHQ B;  4C5G A;  3VQW A;  2GCX A;  1G83 A;  1G5I A;  1YP5 A;  1W6X A;  1XOV A;  1G5H A;  3CMQ A;  5FWB A;  2QQA A;  4C0Z A;  2VAS A;  1UGV A;  3OYM A;  4BWA A;  1YIT Q;  5KYU B;  2CT4 A;  4Y92 A;  1OZ3 A;  5D7U A;  2DVE A;  3REA B;  3HFO A;  3IAL A;  1EX4 A;  3A32 A;  1SRY A; 
#chains in the Genus database with same CATH homology
 4R56 A;  4M7D G;  4BDZ A;  2DXU A;  4XTZ A;  3M5A A;  2PQW A;  3SDZ A;  4FSX A;  1WPY A;  4RCC A;  1FWZ A;  3CXC S;  1K9M C;  4OP0 A;  4O5V A;  1EVL A;  3UWN A;  1H4S A;  4UPA A;  1Q82 C;  5CVI A;  2FYK A;  2FB7 A;  1VQ5 A;  3JCM W;  1U1S A;  4BY6 C;  2C06 A;  4JRQ A;  3NFC A;  2ODR D;  3L42 A;  3MF1 A;  5LJ3 h;  3HFZ A;  3G4S A;  1VQ4 T;  2MF2 A;  3CCR T;  1Q86 U;  3AHU A;  4KUL A;  3KBG A;  3RIR A;  3LH0 A;  5DLQ E;  1RIQ A;  4DOV A;  1K9M U;  4LVI A;  3NEM A;  3HL8 A;  1TH7 A;  3BJU A;  2QQB A;  1Q82 U;  2P0L A;  4JS4 A;  1YCY A;  3OYY A;  1YFT A;  4EX5 A;  4QQD A;  3S6W A;  2E12 A;  2MWO A;  1VQL T;  3CCJ T;  3HFZ B;  3X24 B;  4A4F A;  2E10 A;  2DTO A;  5GAN 4;  3LWH A;  4EDU A;  4J6X A;  2QEX A;  1R8O B;  2JVV A;  3BW1 A;  3CCV T;  3A8G B;  5LJ5 g;  2DZ9 A;  1QVP A;  2L8D A;  4NL3 A;  3W3S A;  3OBY A;  3DKM A;  4C5H A;  2XK0 A;  3A5Z B;  4M77 A;  3OB9 A;  1YBY A;  3TRE A;  3C94 A;  1UGS B;  5K1X A;  2DXC A;  3OS1 A;  4G85 A;  1Q7Y C;  2DIG A;  1OI1 A;  1X75 C;  4A4G A;  3RER A;  3WXM B;  5CO7 A;  1SSF A;  3JB9 J;  4LD9 K;  2NLU A;  4BI3 A;  2LX9 A;  3JCM g;  3QO7 A;  2RHS A;  1B70 A;  2AMC A;  2RK1 A;  1QVG S;  2DD5 A;  4TVW A;  3GIB A;  3VYG A;  5GMK m;  4GY5 A;  4YRP A;  3MEW A;  3BDL A;  3F70 A;  4Q15 A;  1NJ5 A;  1Q7Y U;  4TWA A;  1VQ7 A;  4M77 E;  2LCL A;  1UGP B;  4K87 A;  2GFU A;  2Q5I A;  4P3P A;  3A7A A;  2RHS B;  4BE0 A;  4HVC A;  4MZT A;  4BB7 A;  3S3M A;  5GMK j;  3CME A;  3TEE A;  5LJ3 d;  3RES A;  2OTL A;  2RH2 A;  5GAN g;  5CKF A;  4HT4 A;  4TVR A;  2EWN A;  5FU6 C;  3WVD B;  2MMP A;  3GF5 A;  1UB4 A;  1QVF A;  4M7A D;  3FIF A;  3L2Z A;  4N0A A;  2PME A;  1ASZ A;  3IG2 A;  4M75 D;  2EAY A;  3GNG A;  2KMT A;  1W4S A;  3CCS A;  1M1K C;  3O8V A;  1WGS A;  3JCM J;  4FT4 A;  2DZC A;  5CKH A;  1Y96 B;  3CPW S;  2EJF A;  3PNW C;  4M77 C;  4QVZ A;  3X25 B;  3RMS A;  2ZIO A;  3QYH B;  5GAO n;  4IUR A;  1WJQ A;  3MHX A;  4M75 A;  2OAU A;  5FRO A;  3L4G A;  4JRI A;  2K4Y A;  3VUB A;  4HCZ A;  3CD6 T;  1ADY A;  2ZT6 A;  2ZPG B;  1EVK A;  4CS4 A;  2Y4Y A;  2QQS A;  5GAM g;  1N8R C;  1X01 A;  1LOJ A;  3OS5 A;  5LJ5 j;  5LJ5 f;  5GAO q;  4M7A B;  2XG8 D;  1E1T A;  1M1K U;  2E1H A;  2ZT7 A;  4XAX B;  4M77 G;  4F7U E;  1SES A;  4GLK A;  1VQO A;  1P92 A;  4M75 B;  3L4G B;  1RI0 A;  1KQS S;  3HXW A;  4F7U F;  3M4G A;  2HBP A;  4C0D B;  2DKG A;  5IAY A;  5GAO r;  1JRI A;  2FVU A;  5E3I A;  1VQP T;  2V8I A;  1O75 A;  1N8R U;  3FC3 A;  3JCM f;  5KNN A;  2WSF E;  3I56 T;  5GAN 6;  4NOY A;  4UC4 A;  1H64 1;  4ZTF A;  4PJO E;  4BW9 A;  1VQM A;  3SWN A;  1GXI E;  3LWI A;  4XU0 A;  4PJO F;  1YFS A;  4H2U A;  2E5Q A;  3CCM T;  3EFS A;  3X20 B;  3CD6 A;  2RO0 A;  4N4I A;  4PLI A;  5LJ5 h;  1MGQ A;  5A0D A;  4CH4 A;  4N0A C;  5GAN 8;  2IY5 B;  4TVY A;  3EAE A;  2ZT5 A;  4RQF A;  4M7A C;  1W2B S;  2M0O A;  2Q5H A;  3JRZ A;  3GOX A;  3UDC A;  3OYG A;  2RJE A;  5GAN j;  5GAN f;  2QDY B;  4M75 C;  2K3Y A;  4XK8 E;  1WYD A;  2HQX A;  1VQP A;  4C0D C;  1B34 A;  2ARU A;  2R57 A;  4JLG A;  3GLX A;  4O6J A;  4LNS A;  3M4Y A;  5CCA A;  4XQ3 A;  3OSV A;  5CQY A;  2LT4 A;  3CBO A;  4C8Q D;  5KH6 A;  4ZTJ A;  3SB2 A;  2VV5 A;  3P8Y A;  4O2D A;  2JUF A;  3J81 E;  1QP3 A;  1YIT T;  2YRV A;  3VU3 C;  1UGR B;  4C8Q A;  2E70 A;  3VQX A;  1N9S A;  1QVG A;  2D9T A;  1SER A;  1B34 B;  4C92 D;  2LQ8 A;  2AKW A;  3QNE A;  2M16 A;  1X56 A;  5GAM j;  5GAM f;  4KUD K;  5DLO A;  3CC2 A;  2DQ3 A;  5GAN 7;  1NJ2 A;  4C92 A;  5GAN h;  1U1T A;  2LTO A;  3SWN C;  3NTI A;  4H2S A;  1WU7 A;  5FU7 B;  3VBB A;  2DO3 A;  2MI6 A;  4J7I A;  3CC4 A;  3NEN A;  2XD0 A;  1EIF A;  4K88 A;  3MQZ A;  3J7A F;  2VYT A;  1B7Y A;  4M7D E;  3VQV A;  3E9G A;  4C92 B;  1M9S A;  5AYF A;  4M7D F;  3QPH A;  2ZIN A;  4NL2 A;  1M5Q 1;  2XI9 A;  2ZPB B;  3PT9 A;  3A8O B;  1BYM A;  2HQE A;  3E19 A;  2DQ0 A;  5LJ5 d;  2LVM A;  4H2T A;  4BUG A;  4ZTZ B;  1H4Q A;  5GMK e;  4E47 A;  4C5E A;  1KQ2 A;  4C5I A;  1E24 A;  4PHC A;  5GAM h;  2P0Q A;  1WNL A;  3OD1 A;  4OGE A;  2RHQ A;  1QVF S;  1ADJ A;  3QXE B;  2CKK A;  3MO8 A;  1M1G A;  3QUI A;  3A7U A;  3OSS C;  5KE2 A;  3WVE B;  1EIY B;  3LYI A;  1VQ5 T;  2B8A A;  3NTH A;  4YPF A;  3JCM d;  4LVK A;  3JSC A;  3LGF A;  4YYE A;  3BY7 A;  3G4S T;  2DAQ A;  4BAC A;  1UGQ B;  2LCC A;  4C8Q C;  1N9W A;  2DPP B;  4X34 A;  3HRK A;  5M9O A;  3V8J A;  5GMK i;  4PG3 A;  2DU7 A;  1BBU A;  3JCM X;  4BI8 B;  4R55 A;  1NPR A;  4FIB A;  4BE1 A;  4HT8 A;  1BI3 A;  1KQS A;  4DOW A;  2Y90 A;  2H3J A;  3DB3 A;  2QHT A;  2YLC A;  3M54 A;  3PGG A;  2LNV A;  1NZ9 A;  4C92 C;  3M4Q A;  2XDB A;  4LVJ A;  3OYC A;  3OW2 S;  1G5V A;  4YRK A;  1KQ1 A;  2VXE A;  5HY6 A;  4IUU A;  4MMK A;  2RI2 A;  1Q86 C;  5J39 A;  4C8Q G;  2HD0 A;  2QEX T;  3HXY A;  1NNH A;  3QZ5 B;  3VJP A;  4ZTU B;  2K5F A;  5GAN d;  1IZ6 A;  5HK3 A;  4H2X B;  3UFG A;  2DXT A;  4ZN1 A;  4C92 G;  4RKU E;  3JCM c;  4B9W A;  3OYD A;  2DDZ A;  4WJ3 M;  1G51 A;  4KUI A;  2ZNJ A;  3MP1 A;  2DD4 A;  4XEO A;  1O9S A;  2Q7G A;  3NET A;  4UP9 A;  2K57 A;  4LDV A;  4OMF B;  5D6X A;  1W2B A;  4A54 A;  2E41 A;  5A0G A;  3PMI A;  2EKO A;  2C8M A;  3OYN A;  3A5Z A;  1MHN A;  3JB9 I;  4XU3 A;  1H3Z A;  5EG2 A;  4ELY C;  2QA4 A;  5GAM d;  2VGM A;  1VQ7 T;  4YRO A;  5GAN 3;  3JB9 G;  4NCX A;  3MEY A;  3OYJ A;  5GAN 5;  3L1A A;  2ALY B;  3JCM P;  2A3L A;  2DU5 A;  2Q7E A;  1N27 A;  1XNI A;  2JZ2 A;  4E7I A;  1VIE A;  2EQU A;  4OB2 B;  3HY0 A;  3JCM Q;  3QZ9 B;  4PKC C;  3CME T;  5KCO A;  2ARS A;  5FRN A;  4BI4 A;  2OTL T;  4J6Y A;  3TU4 K;  1QF6 A;  4YRE A;  2RD1 A;  11AS A;  3OBW A;  3LC0 A;  1N9R A;  4HCC A;  4KBM B;  3QKJ A;  1X54 A;  4ATO A;  4QVC A;  1YJW A;  4JRK A;  3OYI A;  1KG1 A;  3HXU A;  1D3B B;  1HXD A;  4CS2 A;  3FLG A;  3CCS T;  3ERR A;  1YIJ A;  1WQW A;  3QSU A;  4A4K A;  5KE3 A;  3PMT A;  2QXF A;  1E22 A;  4RG2 A;  1K8A C;  4QVD A;  2CZ6 B;  3DLM A;  3HXX A;  1K73 C;  3TEH B;  4M77 F;  2CZ0 B;  1OYX A;  3VV0 A;  2ODR C;  2KDS A;  3V7R A;  5A0L A;  3RAC A;  1XTD A;  1G3T A;  4OB0 B;  3J80 E;  2OTJ A;  3A7R A;  4G84 A;  1Y96 A;  1VQO T;  4TQD A;  3RGL A;  2KQW A;  1LNX A;  5C51 B;  5GAO p;  4YCV A;  1K8A U;  1FXX A;  4M78 D;  4HCB A;  1YB3 A;  3CC7 A;  4MDX A;  5C52 B;  3PFS A;  3G6E A;  1K73 U;  2LC4 A;  4QQ6 A;  4RMF A;  4HWT A;  1YJ9 A;  2CIM A;  5CR2 A;  2X4Y A;  1I81 A;  4FL6 A;  4M78 A;  4WJ4 A;  5ELN A;  4M7A A;  2EFI A;  3RKW A;  2DK3 A;  5J3B A;  2AHJ B;  4J5Y A;  3OYL A;  1VQM T;  2EJ9 A;  1U8R A;  1JJC A;  1NYR A;  2CGH A;  4MML A;  3JCM b;  2RHI A;  4LDX A;  3NEL A;  1J5W A;  4DA4 A;  1VQ9 A;  5CAI A;  2L89 A;  4M78 B;  1UEB A;  3I7F A;  4E7K A;  4K86 A;  3A8H B;  3OW2 A;  3PIO A;  2JNG A;  3LW5 E;  5LJ3 e;  1JJC B;  2DTH A;  3TUP A;  2A7Y A;  4HWO A;  1S72 T;  3Q1J A;  3UGT A;  4F7U B;  3HPW A;  4Z02 A;  2BIV A;  4M7A E;  5DM7 R;  3KXT A;  3CCQ T;  1VIF A;  5CKE A;  4E7J A;  4ZGJ B;  1NJ6 A;  1FYF A;  2KAF A;  2PVO B;  4RDX A;  3P8D A;  4M75 E;  3M55 A;  1FX7 A;  4JUV A;  4C0G A;  3HXZ A;  3ZBD A;  4V2S A;  4DPG A;  2IY5 A;  1BI1 A;  4M75 F;  2E5A A;  4PNO A;  2Q7H A;  4UP7 A;  4ZGD B;  4PJO B;  5D6Y A;  1NE8 A;  2ZZD A;  3PIP A;  3REX A;  4EO4 A;  3OY9 A;  1AHJ B;  4L5G A;  4IKF A;  2VUB A;  3P8T A;  3WQZ A;  1YGB A;  4CH6 A;  4D6W A;  1KHC A;  3HY1 A;  2Y4X A;  2XDP A;  2J3L A;  4Y28 E;  4KQE A;  1BBW A;  4YRC A;  1V29 B;  3A8L B;  1YHQ A;  3CMA T;  3HP9 A;  4KR2 A;  2YHT A;  1NJI C;  4M78 C;  2PUK B;  3CC2 T;  3CCE A;  2ZCF B;  3M59 A;  1S72 A;  4XTU A;  4FT2 A;  1YJN A;  4WF2 A;  4A53 A;  2RI5 A;  3TEG A;  2X35 A;  3CCQ A;  2EL9 A;  1RL2 A;  2EQK A;  2QHS A;  3UGQ A;  3CC4 T;  2KVQ G;  5HGQ A;  4QW2 A;  2QI2 A;  3DSQ A;  4J6W A;  3C95 A;  4YRG A;  4M78 G;  1NJI U;  2K3X A;  1B76 A;  2ZZE A;  4M7A G;  3G71 A;  2P0P A;  2CZ1 B;  2GQV A;  4II1 A;  1I8F A;  1DJ7 B;  4M75 G;  4Q5W A;  2EJG A;  2XID A;  1PYS B;  3QO5 A;  1M90 C;  2QHV A;  3QYG B;  5A2Q E;  5LL6 S;  4PL6 A;  1M8V A;  4XTY A;  2E65 A;  1GGM A;  3QJ6 A;  3CMA A;  2HAX A;  4YP0 A;  4J7F A;  4HWP A;  4XTV A;  3L2U A;  4E7H A;  2VC8 A;  5C6S A;  1ZHI A;  1X2H A;  3MEA A;  1VQ6 A;  4P3O A;  3KFU A;  2E6Z A;  4MZM A;  3QG1 A;  4BE2 A;  4HT9 A;  3HHT B;  3LGL A;  2V8K A;  4LD6 A;  4P71 A;  3OYE A;  4CH5 A;  3H8Z A;  4NS5 A;  4KT0 E;  2VXF A;  3BDU A;  2RJF A;  4X9D A;  12AS A;  2XTI A;  1M90 U;  1HTT A;  2RHU A;  5J26 A;  4YDQ A;  4C0F A;  1YI2 A;  2EYQ A;  2ZT8 A;  2NS6 A;  5GAN 2;  3OYF A;  1VUB A;  3INZ A;  4C8Q E;  5DY9 A;  2D0Q B;  3HRI A;  3LLR A;  4YRF A;  2ZPH B;  4C8Q F;  4EMG A;  1EIY A;  5I21 A;  2DJZ A;  4HWR A;  2FL7 A;  4C92 E;  2CJB A;  2RHX A;  2E64 A;  3M56 A;  2PMF A;  3HKS A;  2L5Q A;  2PVG B;  4C92 F;  3GNF B;  1EOV A;  2DTI A;  3CCL A;  2P4T A;  1L0W A;  2ZZG A;  1KMN A;  3MP8 A;  2ZPE B;  2XKO C;  3VKI A;  4E51 A;  3PTA A;  3OA6 A;  3RKY A;  3C4S A;  2BUD A;  3HRU A;  3MF2 A;  5FU7 C;  1BIB A;  4BY6 B;  3ME9 A;  1VQK A;  1USY A;  4QQG A;  2V8J A;  3RMQ A;  5IT9 E;  4IUT A;  3JB9 F;  3JCM V;  2X4X A;  4H2X A;  2XIC A;  2MAM A;  3MEV A;  3V8L A;  3MEU A;  2PVD B;  3VUZ A;  4EPC A;  5LJ5 e;  2M9U A;  2ART A;  3IKL A;  3JB9 H;  3GP8 A;  2QA4 T;  3E1S A;  1WJR A;  3RKX A;  2YLB A;  4P71 C;  1H4V B;  5HKC A;  4CH3 A;  1B8A A;  4YRN A;  5K1P A;  4H02 A;  5HK0 A;  3L2W A;  4J15 A;  3R07 A;  5F5W A;  3P8V A;  2KY9 A;  3GPL A;  2R5M A;  3E9F A;  4P72 A;  1KHI A;  2EIF A;  3OMC A;  3JCM e;  1JJ2 A;  3P8B B;  2LT1 A;  4IUV A;  2F5K A;  4OVA A;  1KC8 C;  2F69 A;  1XQH A;  3OQ5 A;  5KCH A;  1VQ8 A;  2QQ9 A;  2ZR3 A;  4XU1 A;  2ALY A;  3I55 A;  1YJW T;  2LRQ A;  1Y07 A;  3LSS A;  4Y91 A;  3MP6 A;  4YRS A;  1YIJ T;  1BI0 A;  2P5I A;  3CCU A;  4P74 A;  5L8R E;  4OLF A;  2XGT A;  4TQF A;  3G7Z A;  1KC8 U;  2E6N A;  3IKM B;  5I2M A;  3TCJ A;  4N4G A;  2R5A A;  3NTK A;  1QW1 A;  4BD3 A;  2LDM A;  2K5L A;  5GAN e;  1D3B A;  4TVA A;  1IL2 A;  4MDW A;  1Z7M A;  1ASY A;  3UPU A;  1USY C;  5GAO l;  2OTJ T;  2O4X A;  2RB6 A;  3BFM A;  4M77 D;  3T9N A;  3PCO A;  1ATI A;  3HFN A;  1JB0 E;  2D6F A;  1JBM A;  4JS5 A;  3KUF A;  5GAO m;  3CC7 T;  3EFR A;  3G6E T;  2ZPF B;  2ZR2 A;  3OYK A;  4J8O A;  3TEH A;  1I4K 1;  5FU6 B;  1YJ9 T;  1KOG A;  4TVA B;  1VQ4 A;  1X2G A;  3CCR A;  4A4E A;  2CZ7 B;  2O4X B;  5CK9 A;  1SET A;  4YCU A;  3A5Y A;  2A8E A;  3PCO B;  4H2Y A;  1IRE B;  5GMK l;  5GAM e;  2IVW A;  4P72 C;  3UT1 A;  4LDW A;  3RL6 A;  4Q6G A;  2RHZ A;  3FDR A;  2K5I A;  3HTZ A;  2CS7 A;  2ZGW A;  4M77 B;  1WQ7 A;  3HRT A;  4HWS A;  4L87 A;  1WJS A;  1OZ2 A;  1VQ9 T;  3MCA B;  4YCW A;  1VQL A;  3QDR B;  4LVM A;  2C7I A;  3CCJ A;  1Y7X A;  1HC7 A;  2JN0 A;  2GF7 A;  4UP8 A;  1ZQ1 A;  3CCV A;  1X6O A;  3V7C A;  4YRI A;  2L3R A;  2QHU A;  1B70 B;  2AMC B;  2MWP A;  2EQJ A;  2QQR A;  4CI0 C;  4VUB A;  4P74 C;  2QTX A;  3V7S A;  3R6O A;  3QO3 A;  4CRI A;  1ZBX A;  2JOY A;  2I4N A;  3CPF A;  4JJN K;  3M53 A;  2XDD A;  3FB9 A;  4FU6 A;  4ELZ C;  1N6A A;  4YRL A;  2M1H A;  4XTW A;  3M4P A;  3QBY A;  4YTL A;  1KMM A;  4P3N A;  4X5O A;  3E9I A;  4F7U A;  2R58 A;  4RG8 A;  5C0M A;  3DLL A;  2RHY A;  3QJY A;  3S3O A;  2I4L A;  4OB3 B;  4P73 A;  3DB4 A;  3N5B B;  4P5N A;  4PJO D;  3OS2 A;  4A4H A;  1Q81 C;  1LJO A;  4MZP A;  1YHQ T;  3VQY A;  1BI2 A;  4EMK A;  3CCE T;  1EQR A;  4H2W A;  2IG0 A;  3V8K A;  4PJO A;  4LDU A;  4JLI A;  1YJN T;  3FJP A;  4M78 E;  3ASK A;  2BKD N;  3CBP A;  5GMK h;  4X9C A;  4XTX A;  4M78 F;  3L2V A;  4L6V 5;  4M7A F;  3RF1 A;  4LVL A;  3ER0 A;  3CBM A;  2JTF A;  2XHC A;  3VYH B;  4YRR A;  1PSE A;  2P0K A;  1Q81 U;  4EMK B;  2RJC A;  1VQN T;  3L2R A;  3CXC A;  3G71 T;  2HNI A;  3FRN A;  1NJ8 A;  2DXB A;  4FM4 B;  3OYH A;  1YFR A;  3S3N A;  1NJ1 A;  2WSC E;  2WSE E;  4N4H A;  4CS3 A;  2I4O A;  4XU2 A;  4ZIB A;  1JJ2 S;  4YRM A;  2ZZF A;  5CIU A;  1VQZ A;  2K2V A;  4IUP A;  1NYQ A;  4JDS A;  5D6W A;  3OS0 A;  4J83 A;  5FRM A;  3C12 A;  4LDY A;  2J3M A;  2CJA A;  4EMH A;  1VQ6 T;  4YRT A;  4TTV A;  4DQ2 A;  3LSQ A;  1BKB A;  3A31 A;  2KSS A;  3SWN B;  1PYS A;  3QHS A;  1X55 A;  1YI2 T;  4P73 C;  3QTC A;  4HA8 A;  3UH0 A;  4ME7 A;  4AH6 A;  1VQN A;  3ICA A;  5LJ3 g;  4P75 A;  1G3S A;  1M4Z A;  4H2V A;  2RJD A;  3JCM h;  4EMK C;  5CQX A;  3E9H A;  2XU8 A;  3QO8 A;  4PJO C;  1Z7N A;  4F7U G;  4OB1 B;  3I56 A;  2ZPI B;  1PSF A;  2O01 E;  1LYL A;  3FEO A;  4YRJ A;  4OF1 A;  1E1O A;  4M7D D;  4BDY A;  3JAM E;  2ZXF A;  2ZTG A;  2CYZ B;  2G4C A;  3CCL T;  1G3W A;  1NPP A;  3CCM A;  3QII A;  4M7D A;  2PU9 B;  3A74 A;  2F5T X;  3OYA A;  2E3C A;  3X26 B;  4PJO G;  3ZFJ A;  3X28 B;  5IN1 A;  1Y71 A;  1HK9 A;  3OMG A;  4ZGE B;  3URG A;  2GFA A;  5FLX E;  2FHD A;  2X4W A;  1KD1 C;  2JTM A;  3M57 A;  2RI3 A;  2I2L A;  1VQK T;  4OGC A;  4C8Q B;  1QE0 A;  4M7D B;  3PZC A;  2ZIM A;  3RUX A;  1I5L A;  4XEM A;  4WI1 A;  3OYB A;  5I2S A;  1WLE A;  2AKW B;  3L2Q A;  4JRP A;  3SD4 A;  4YRQ A;  2X4J A;  2G3R A;  2DEQ A;  3HRS A;  4E7L A;  4IUQ A;  3JB9 D;  1QP2 A;  3A8M B;  4RCB A;  3ZEH A;  3CEY A;  5CKD A;  3G1Z A;  4ZN3 A;  2ZNI A;  1YIT A;  1KD1 U;  3P8H A;  2DIQ A;  2PUO B;  1W66 A;  3MET A;  2RM4 A;  1BIA A;  4KR3 A;  4PLL A;  1H4T A;  4P75 C;  4L59 A;  2ZCE A;  1B7Y B;  4HKE A;  3CPW A;  3HFV A;  5ELO A;  3H6Z A;  1EFW A;  3HXV A;  5CKB A;  5C53 B;  2EQM A;  1VQ8 T;  2WAC A;  2RK2 A;  3I55 T;  1G3Y A;  2KK4 A;  2LQK A;  2RA2 A;  3M9Q A;  3REU A;  4RQE A;  3LX7 A;  3M58 A;  4B9X A;  2VGN A;  5LJ3 j;  2CJ9 A;  5LJ3 f;  3HSB A;  4M7D C;  2I4M A;  1M1F A;  3SFM A;  3CCU T;  4RMO A;  1C0A A;  2RHQ B;  4C5G A;  3VQW A;  2GCX A;  1G5I A;  1XOV A;  1G5H A;  3CMQ A;  2QQA A;  4C0Z A;  3OYM A;  4BWA A;  1OZ3 A;  2DVE A;  3HFO A;  3IAL A;  3A32 A;  1SRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...