3EFRA

Biotin protein ligase r40g mutant from aquifex aeolicus in complex with biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGGLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
total genus 67
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efrA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efrA01
4UP8A 4G84A 4XQ3A 2AKWA 3PCOB 4YRIA 4M75E 1SERA 2E64A 4K87A 5GAMg 4YROA 2RHQA 4XEOA 1PYSB 4PHCA 1BIAA 3FIFA 3HFZB 3E9HA 2ODRC 4WJ4A 1H641 4HT8A 1WLEA 4HWSA 4M7DF 3HFNA 4YREA 2ALYB 3A7UA 1X2HA 2RHSB 4P75A 3E9IA 4K88A 2VC8A 1WPYA 4F7UA 2ZT8A 3REUA 4HA8A 1HTTA 5LJ5d 1SRYA 5I21A 4M78G 2ZIOA 4H2SA 4CS4A 4C8QE 1LYLA 4HWTA 2DTOA 1JJCB 1HXDA 4C8QB 1HK9A 4C8QD 4XU3A 1NJ5A 5GANh 3V8KA 3IKMB 5GANj 2Y90A 4YRRA 2YLBA 2ZNIA 2DKGA 1B7YB 3VU3C 1YFSA 4WI1A 4OP0A 4M75A 4KR3A 3LSQA 3HRIA 4M75D 4CH6A 4P72C 2CIMA 2QHSA 4YCWA 3JCMh 3JCMX 2AMCB 2C7IA 2ZINA 2DZCA 4HWPA 4M7AC 1E1TA 4YRMA 1B76A 2DTHA 4TVWA 3UH0A 2J3MA 4JUVA 4PNOA 4TTVA 5GAN4 4XEMA 4JLIA 2VXEA 3SWNA 4F7UE 4J15A 4KQEA 2I2LA 4P74C 4TVAB 1NJ2A 2YLCA 1Y96B 5GAOl 4C92D 1Z7MA 3VQYA 4C8QC 4J6YA 3TEHA 4UP9A 2ZCEA 4M7AD 3BW1A 5GANd 2J3LA 4CH4A 4YRKA 4XU2A 4H02A 4C92G 3JCMJ 2ZR3A 4M77F 2DU5A 5GANg 3LC0A 3V7SA 5HGQA 1EIYA 1IL2A 4XTUA 3P8VA 4YRNA 3V7CA 4H2VA 1VQZA 3NENA 4CS2A 4EO4A 2DU7A 5GAN6 2QHTA 1NYRA 1MGQA 4M7DC 3HFVA 2RD1A 4M77B 4WF2A 1N9SA 2Q7HA 3RERA 2E10A 5GAOm 3V8JA 3QNEA 4EMHA 4WJ3M 3M4PA 1I8FA 4ZTZB 2CJAA 4JRIA 4C92C 3DSQA 4M78D 3A74A 2Q5IA 4RQEA 3FB9A 1NJ8A 1SESA 5GAMh 3M4QA 1ATIA 1B34B 4N0AA 2P5IA 4UPAA 4YRJA 1EVLA 3JCMd 4OLFA 4UP7A 3VQXA 5LJ3j 3QSUA 5LJ3f 5LJ3h 4H2WA 4C92E 3MEYA 4YP0A 1U1SA 1W66A 5LJ5j 3HXVA 4CH3A 1EVKA 4YCUA 3JCMP 4TQFA 3RKWA 3W3SA 5DY9A 1WNLA 2ZR2A 3JCMf 3RIRA 2ZT7A 5GAOq 4J6XA 4XU0A 5C52B 3P8YA 4NCXA 4P71A 3TEHB 1USYA 3LSSA 4M7AF 2XTIA 4TVYA 3UFGA 4EMKC 3P8TA 1JBMA 1B70B 3IKLA 4YRPA 1H4SA 2ARUA 1KOGA 2E65A 4XTXA 2ZZFA 5LJ5h 3UGQA 3A7RA 3SWNB 1KQ2A 3JB9H 4P73A 4YPFA 3ERRA 1BBUA 3HRKA 3EFSA 4PJOD 1EFWA 4Q15A 1B34A 3RESA 3QO3A 2CJ9A 4C8QF 4HWOA 2ZT6A 1B70A 1L0WA 1EIYB 1ASYA 4KR2A 2RB6A 2K57A 3L1AA 4M77G 5GMKj 4P72A 2DDZA 5GMKl 3A32A 1KQ1A 2ARTA 5LJ5e 4M75F 3JCMb 4E51A 3RKXA 1G5HA 4XTVA 5ELOA 3QUIA 1X01A 3GIBA 3JCMQ 1U1TA 3G1ZA 4RCBA 4RDXA 1H4QA 1JJCA 3WQZA 4CH5A 5ELNA 1YCYA 1WU7A 5GANe 1QF6A 2EAYA 4X9DA 4XTZA 4M77E 3VBBA 2EWNA 4YRQA 1I81A 4PJOC 3JB9I 4A53A 4C92F 4F7UG 2ZT5A 2FB7A 4P75C 4YRTA 4F7UF 1H4VB 3RUXA 2I4LA 3IG2A 3IALA 2E41A 2ALYA 2C8MA 3OD1A 4HT9A 1Y96A 4ZTUB 2CJBA 4HWRA 4TVAA 5GAOr 1I5LA 3BDUA 1PYSA 1I4K1 3PGGA 1Z7NA 2ZZEA 4M77A 5GAOp 4A54A 4EMGA 3QO8A 1YGBA 3L2ZA 5GAN8 5E3IA 2DXTA 2I4NA 3VQWA 1WYDA 2Q7GA 2AMCA 2ODRD 5GAN5 3FJPA 4M75G 11ASA 5GMKm 5GAMf 3HXWA 1YB3A 2ZXFA 3L4GB 4K86A 5GAMj 3A5ZA 3QTCA 2E1HA 1SETA 1LNXA 1EQRA 12ASA 4YDQA 1J5WA 4M75B 1EOVA 4P3OA 3V8LA 1GGMA 1B7YA 3HY1A 3INZA 4PJOG 1NJ1A 4C8QG 4M78B 4X5OA 4L87A 3V7RA 2ZZGA 5GAMd 4X9CA 1C0AA 1BBWA 1B8AA 3RL6A 2RHQB 5LJ5f 2ARSA 2AKWB 2P0LA 1D3BB 3JB9F 3NETA 4XTWA 2ZNJA 4ZIBA 2RHSA 2HNIA 3PZCA 1KMNA 2PMEA 4PJOE 4M75C 4DQ2A 1FYFA 2ZIMA 5GAN2 4LNSA 4P71C 4M78E 4JRKA 4Y91A 4PG3A 5K1PA 1NYQA 3HXXA 2DTIA 1X2GA 3HFZA 3BFMA 4XTYA 2XGTA 4YRSA 1JRIA 4CS3A 5GAMe 3RKYA 1NNHA 2E3CA 3RF1A 4M7DD 1YFRA 5GMKi 4O2DA 1G51A 3HTZA 5GAN3 2QHVA 4M7DA 2Q5HA 4PJOA 4M7AB 4C8QA 2EJGA 3SWNC 5GAOn 4QVCA 2QHUA 3HFOA 4H2TA 3RACA 2PMFA 5LJ3g 3A7AA 4PJOF 4M78C 4H2YA 3JCMe 4C92A 3HY0A 2EJ9A 4NL2A 3HXYA 4F7UB 1N9WA 2G4CA 1G5IA 4J5YA 3HSBA 4YYEA 4H2XB 4EX5A 5LJ3e 2ZGWA 3QO5A 2DQ0A 5K1XA 2IY5B 5GANf 3JCMW 1WQWA 2RM4A 1KMMA 3PCOA 1ASZA 1M5Q1 1QE0A 3MF2A 5F5WA 3TUPA 1HC7A 1X56A 4M7AE 3SB2A 1E24A 1USYC 1E22A 3JCMV 4P3PA 1TH7A 3EFRA 3R07A 2DJZA 4P3NA 1RIQA 2DEQA 4J6WA 2YHTA 2E5AA 1ADJA 4BW9A 3AHUA 5KNNA 1X54A 5C51B 3HXUA 4EMKA 4N0AC 3REXA 4M7DE 4QVDA 1E1OA 3ICAA 2EJFA 1M8VA 4EMKB 3BJUA 2DQ3A 1X55A 4YRFA 4V2SA 2Q7EA 4YRCA 4M77D 3RGLA 4TWAA 4YRGA 3UGTA 3I7FA 4RMFA 3JCMc 4MMLA 4TQDA 5GMKh 5LJ3d 5CAIA 2DXUA 1D3BA 2JN0A 3VQVA 3QHSA 1NJ6A 3M4GA 3NELA 1N9RA 2DZ9A 4RCCA 1H4TA 1ADYA 5GAN7 4M7AA 2IY5A 4RQFA 2I4OA 2QTXA 4AH6A 3A5YA 4H2UA 3JCMg 4BWAA 2DVEA 4H2XA 4NL3A 3KFUA 3JB9J 4M78A 1YFTA 3MF1A 2CGHA 4HVCA 4YRLA 4P73C 1LOJA 5GMKe 3TEGA 4M78F 4XU1A 2RA2A 3HXZA 2ZTGA 4C92B 4P74A 4DPGA 2FYKA 4M7AG 3A31A 3QO7A 3NEMA 3BY7A 3JB9D 1BIBA 1WQ7A 2EL9A 5C53B 3L4GA 2VXFA 5LJ5g 4MMKA 4M77C 4PJOB 4M7DB 4NOYA 4YCVA 4M7DG 3JB9G 1LJOA 3CMQA 2I4MA 4G85A 4Q6GA
chains in the Genus database with same CATH superfamily
2FL7A 2AKWA 3PCOB 4OB2B 1SERA 2E64A 4K87A 5GAMg 1VQPA 2RHQA 1D1BA 1PYSB 1HD3A 2RMOA 2DFUA 4DOVA 1WJSA 3DB4A 1WGSA 3PE0A 1WLEA 4HWSA 3MP1A 3E19A 1A0NB 2C0TA 1YHQA 3MEUA 2ECZA 2RHSB 1RAGB 4P75A 2AZSA 3E9IA 4K88A 4RKUE 3JV3A 3OQ5A 1PNJA 4FSSA 5LJ5d 2MMPA 4FIBA 2DL4A 1BI1A 1K9MU 1MMGA 2YUQA 2DTOA 1Q81U 1NEBA 1JJCB 1HXDA 3CXCS 4C8QD 4Z8AA 3OS2A 2LDMA 1X27A 2DL3A 2LQKA 3IKMB 4YRRA 3N5BB 3CMET 1UGSB 1HYOA 2E5QA 2HSEB 2I0NA 3OW2P 1YJNQ 1AZEA 5FRMA 3QJYA 1YFSA 1OZ2A 4M75A 4KR3A 3LSQA 3EGDB 3H6ZA 1W2BS 4M75D 4YCWA 1KQSS 2C7IA 4M7AC 4YRMA 1YJWA 1YBYA 3I56T 3CCMQ 2DXCA 4JLIA 5J39A 1KFZA 3CD6T 4J9HA 4ANJA 1IREB 2YLCA 1CKBA 4C92D 2JS2A 4AT1B 2JNGA 3LLRA 1NJIU 4VUBA 7AT1B 2JW4A 3WXMB 2WSEE 5FW9A 2A08A 2ZCEA 4QQGA 2MK5A 2IPOB 2V8IA 1YITA 2EIFA 4J8OA 2KXDA 2ZAEA 1W70A 2L3SA 5HGQA 3A5ZB 1IL2A 4IUVA 4PLIA 3P8VA 3G4SA 4H2VA 3EG3A 4E47A 3NENA 2AZVA 3CCRQ 2DU7A 4E7IA 1X6OA 3EG1A 4M7DC 4QT7A 3EG0A 2NUTA 4F04B 2QEXA 4JZ4A 2YRCA 1M8MA 4E7SA 4WJ3M 4MDWA 2CJAA 2DBMA 2QK0A 4C92C 2L5QA 1VQKQ 1X75C 2EYXA 1NYFA 2K3BA 4RQEA 2E12A 2CH4W 2KNBB 1Y07A 2QQSA 5FU6B 5GAMh 1VQOQ 1N8RC 3M4QA 4LE9A 1X43A 1VQMA 1YI2T 2YXYA 4JJCA 1OZ3A 2A7YA 3JCMd 8ATCB 1K73R 1T3LA 3I56A 4H2WA 2LCLA 4C92E 3TSWA 1U1SA 4E2FB 5D6XA 2GQIA 4KGXB 1E6GA 3PFSA 2E3HA 3JCMP 4TQFA 2GFUA 1I5OB 1AT1B 2BZXA 5DY9A 5IHKA 2ZR2A 2IIMA 3RIRA 5GAOq 2L2PA 3P8YA 1ZUKA 1W2BA 2EGEA 4M4ZA 1BK2A 3LSSA 3UFGA 5KH6A 1B70B 3IKLA 1LCKA 3I9QA 2ARUA 1T0HA 1M1KC 3A7RA 1K8AU 3OYAA 3ERRA 5D6YA 2BUDA 2L3RA 4PJOD 4Q15A 1B34A 4JS4A 1YITT 4C8QF 1R77A 5AYFA 4RTZA 2DMOA 4QQDA 2XIDA 2X3WD 1GFDA 2V1QA 1EIYB 2XMFA 3QBYA 1ASYA 2D1XA 2K57A 2QTVA 4JS5A 4F17A 3UWNA 2AHJB 4ZNXA 3G4ST 4CRIA 3G71Q 2ARTA 3A32A 1M2VA 3JCMb 3LH5A 3TCJA 1WI7A 2DXBA 4KULA 1U1TA 4RCBA 1VQOT 3LGLA 3EG9A 2X3XD 4CH5A 3FDRA 5CQYA 1WU7A 2J06A 4XTZA 2FHDA 3M0TA 1M90C 2ZZDA 5I22A 4PJOC 2KYBA 3LGFA 5FLXE 1H4VB 3RUXA 4LDVA 3IG2A 4A63B 4PJMA 2ALYA 2LNHB 2QYZA 1VQ9Q 4E7HA 2GTOA 3BDUA 1NLPC 2LZ6B 2RF0A 3A1PA 5KYYA 3PGGA 2AKKA 5A0LA 3PMTA 4M77A 1BU1A 3M9QA 3UT1A 2KDSA 2O01E 3DLLA 3GNFB 2B8AA 4L6V5 4MZMA 5CQXA 1ZSZB 2O88A 5LL6S 1G3TA 4OF1A 3VKIA 1Q86C 2K7AA 2AMCA 5GAN5 3FJPA 4M75G 2ODRD 11ASA 2CKKA 2LTOA 4JLGA 3HHTB 4CC7A 3HXWA 3CC7T 4K86A 4ZGEB 2V8JA 1RAFB 2EW3A 1I07A 1LNXA 12ASA 1VQ6A 4DEYA 1EOVA 1TUDA 1U5SA 1UGQB 1B7YA 3HY1A 3A8LB 3MCAB 2PVGB 3M54A 1GRIA 1Y71A 2FEIA 4X9CA 4P5NA 4A4EA 1B8AA 1FMVA 1QVFP 2OTJQ 5KYXB 2P4RA 1Y57A 2XKOC 1IZ6A 2EKHA 3EGXB 2P0LA 2EQUA 4FL6A 1VQ5T 1D3BB 3JB9F 3UPUA 2QDLA 1FWZA 2KRMA 2NLUA 2QGGA 5HK3A 2RK2A 3CCLT 4RTVA 4ZIBA 1OU9A 3CPWS 2ROTA 4Z89A 1KMNA 2PMEA 4LNSA 2MCNA 5GAN2 4M78E 2O9VA 4JRKA 4LVLA 1B07A 2DTIA 1Q95G 2DETA 4XTYA 2JM8A 2G3RA 3EHQA 1NNHA 2E3CA 3RF1A 4M7DD 1YFRA 2DYIA 3L2RA 2CP5A 3HP9A 1YITQ 3KBGA 5GAN3 2KR3A 2XG8D 2GGRA 1OI1A 4GBQA 1K8AC 4PJOA 5GAOn 4QVCA 1M4ZA 1M1KU 2XICA 2QHUA 3CPFA 3A7AA 1K73C 1MV3A 2HBPA 1YJWT 4J9FA 2LJ3A 4FSXA 8AT1B 3CC7A 1KQSA 3CC2A 5A0GA 3P8DA 4Z02A 3H9NA 4YYEA 3GF5A 4EX5A 1KD1C 2WSFE 2LCSA 2KXCA 3G1JA 3PMIA 5K1XA 2IY5B 2GNCA 2JMCA 4PFPA 2RM4A 1KHIA 1K8AR 1WXBA 2MF2A 1M5Q1 3KUFA 3MF2A 1EIFA 2CP0A 4GLKA 5CVIA 4M7AE 3X20B 5AT1B 4C5IA 3JCMV 3OSSC 1U3OA 3RMSA 1UUEA 3R07A 2YWWA 4Q5WA 1MNEA 2DEQA 4AMCA 1ADJA 3QXEB 3HXUA 3VS0A 3REXA 4M7DE 4QVDA 1OYXA 4OMPA 1C1AA 1QP2A 2HKQB 2A0FB 1TSFA 3M0PA 1ABQA 2RH2A 2RI2A 1VQNQ 2VUBA 3HPWA 2HQEA 1KJWA 2RHYA 3QWXX 3BJUA 1CSKA 1X55A 4V2SA 2Q7EA 3MHXA 2R58A 2M0OA 4KT0E 4M77D 1AOJA 3OYBA 1YI2A 2ZPEB 2LMJA 4KBMB 4RMFA 2P0PA 4OGCA 1GL5A 1MHNA 1YWOA 1YJWQ 3I35A 4LXCA 4RCCA 2J6FA 1N8RR 3CCVA 2RQVA 1ADYA 2QTXA 2QI2A 3A5YA 4H2UA 1YWPA 2MWOA 1MMAA 4ZN3A 3BE3A 3KFUA 3JB9J 3CMAA 3MF1A 3CD6Q 4HVCA 1Z9ZA 1Q82C 1VQ8Q 3HXZA 1VQ9T 1FX7A 1KIKA 3CPWA 3A31A 4A4GA 3LYIA 3JB9D 2KQWA 3TVTA 1AHJB 3I55Q 3CCEQ 1C6VX 2LX7A 3CMQA 2PVDB 1SF9A 4LDXA 4G84A 2A37A 1K73U 4J9DA 4PHCA 1BIAA 3PIPA 3FIFA 3HFZB 2ODRC 4WJ4A 3GBQA 2IG0A 2KSSA 4M7DF 1WYXA 1TU0B 1LVKA 3A7UA 3EGUA 1WPYA 2EYQA 3RMQA 3MKDA 4F7UA 2ZT8A 3REUA 1JB0E 1SEMA 5HK0A 3CCQQ 1OQKA 1WJRA 5I21A 4N4GA 4M78G 1VQOA 1OU8A 2YSQA 3GOXA 2ZIOA 1W4SA 1G8XA 1LYLA 3QZ5B 4HWTA 1VQKT 3C95A 4C8QB 4E7JA 1VQ7Q 1M27C 2Y4XA 1R8OB 3V8KA 1QW1A 2ZPIB 5IXBA 1PRLC 5FWCA 4AG2C 3QYGB 3REAB 5KYYB 2HL3A 4WI1A 1UE9A 4AFSC 2QA4A 1QWFA 2CSIA 1EZZB 4JRQA 2XHCA 3WVDB 1SPKA 4CH6A 3TU4K 1VQ8T 3MP6A 1YJ9T 4N4HA 3JCMh 2GQVA 2DERA 1RLQC 2CT3A 1E1TA 3CMEQ 1B76A 1CKAA 4B9XA 1X6GA 2CDTA 4HCZA 4PNOA 3SDZA 1M3BA 4ELZC 2AT1B 5GAN4 3M58A 3CC7Q 3VRZA 2F5KA 2COWA 4F7UE 4J15A 1TG0A 4KQEA 2I2LA 1YFNA 4TVAB 3H0IA 3M0RA 1Y96B 1VA7A 2NUPA 2K2VA 4C8QC 4UP9A 5CCAA 1S72Q 3CCUQ 4M7AD 2J3LA 2DE0X 2HDAA 4XU2A 3G71T 3JCMJ 3TEEA 4IURA 4M77F 2LQNA 1WJQA 2D0NA 5GANg 1SKUB 3V7SA 1EIYA 2DD5A 3JAME 3AT1B 4PFZA 5I11A 2JUFA 4QKUA 1QKXA 3CC4T 4CS2A 2GCXA 2RI3A 1K0SA 1ZBJA 4FW1A 3NGPA 2QHTA 1YCSB 1QP3A 4QVZA 2CZ6B 4ZGDB 4HCKA 2RN8A 5DLQE 2X51A 4A4KA 3L42A 2KVQG 3RERA 3V8JA 4KUIA 1WHGA 3A8MB 5D7UA 2QA4T 4FYYB 1Q82U 4LVJA 5HKCA 2DVJA 1NJ8A 1RAAB 4HCBA 5L8RE 1WDXA 4UP7A 5HY6A 1IO6A 1M9SA 5C0MA 3QSUA 1FMKA 3MEYA 1BKBA 1W66A 2BE9B 5LJ5j 3UF4A 2XDBA 2LT4A 2EGAA 3J81E 1KC8U 1ZBXA 3M53A 1KD1U 3I5SA 4ZN1A 2W10A 4J6XA 3QPHA 4XU0A 5C52B 2JTMA 3G71A 3GNGA 2GF7A 2NUPB 4BDZA 2XK0A 1D1CA 3M4YA 1NLOC 3P8TA 1GBQA 1TOVA 1KOGA 5LJ5h 4AFZC 3JB9H 4P73A 4YPFA 1BBUA 3HRKA 3EAEA 2RJEA 3HRUA 4CC2A 3ZEHA 1WHHA 1EFWA 1PKSA 1UGRB 2YT6A 1VOMA 2NUZA 2RB6A 1G2BA 2QA4Q 4E7KA 2CZ1B 1O75A 2Y4YA 1IGQA 2DDZA 5LJ5e 3M56A 2FRYA 4J9BA 2PU9B 2L3QA 2DLPA 1G5HA 3H0FA 3QUIA 1GFCA 1X01A 3JCMQ 1JXOA 1UDLA 2KI7A 3G1ZA 2DIQA 9ATCB 2RQUA 2RO0A 3OYFA 1H4QA 3WQZA 2MPXC 3MO8A 4K11A 2R57A 1QF6A 2QG9B 2JJ9A 3CCRT 5I2SA 2KROA 5IN1A 1JU5C 1VQNT 4YRTA 4F7UG 2ZT5A 3QDFA 3PNWC 2I4LA 1RUWA 3IALA 2E41A 2LCCA 3CEYA 1IHWA 2DL5A 4ZTUB 2CJBA 2NWMA 4LN2A 3VUZA 2CREA 5GAOp 4A54A 1WHMA 3CXCA 1NPRA 4EMGA 3L2WA 3QO8A 3L2ZA 2DXTA 2DRKA 3OBYA 2Q7GA 4DOWA 2AK5A 1N27A 5GMKm 5GAMf 1VQ4T 4CC4B 5GAMj 3OYNA 1SETA 3S3OA 5CKDA 3V8LA 3INZA 3MEWA 1VQLA 4PJOG 2B86A 4X5OA 3EHRA 2R5MA 2QAZA 3CCUA 4TVRA 1H3ZA 2O2OA 2EQKA 1X69A 4F16A 1JJ2A 1BBWA 2YRDA 2RHQB 3OYMA 2AKWB 1FMWA 3X24B 2ESWA 1ZLMA 2X4YA 1NEGA 4XTWA 1B3QA 3CCMA 2DIGA 1Q7YR 4Y28E 2ZNJA 4BACA 3CCRA 2HNIA 2HAXA 3PZCA 4PJOE 3OYDA 1UJYA 4DQ2A 4P71C 1BCOA 1BI3A 2SRCA 1RAHB 5K1PA 1GBRA 4UC4A 2J05A 4OVAA 3R6OA 1X2GA 4R56A 4YRSA 1JRIA 4CS3A 2EYZA 1YNZA 3TQ7P 4EIKA 2BZYA 1WHKA 4LUEA 2D6FA 2QQRA 4FYXB 3OW2S 3FC3A 1G51A 2ZCFB 2BKDN 3CC2T 4R55A 4YTLA 2QHVA 2Q5HA 4M7AB 4C8QA 2EJGA 3SWNC 2RJFA 2ROLA 4H2TA 3RACA 2CH4A 3JCMe 4J7FA 3HY0A 3NFCA 4F7UB 5EC7A 2G4CA 2DYBA 2XU8A 1NE8A 4H2XB 2CYZB 1N6AA 1MUZA 4JJBA 2NYSA 1XTDA 2HCKA 2DQ0A 1W6XA 1X2KA 3A8HB 1DJ7B 2RHZA 3O8VA 2AIRB 2DA9A 1WQWA 1ABOA 1QMCA 1VIFA 1AD5A 1KK7A 1E24A 3THKA 2FVUA 4JPBW 2DAQA 2DJZA 4P3NA 3REBB 1RIQA 1OULA 1PKTA 4J6WA 2YHTA 2E70A 1X54A 5FROA 2HL5C 4EMKA 2MWPA 3ICAA 2G6FX 5CKEA 1P92A 4OMQA 1QVFA 1Q81R 2JXBA 3NHNA 4EMKB 2CP3A 2K3YA 4HXJA 4FT2A 2NS6A 1W1FA 3VJPA 1D0YA 1UTIA 3F70A 1QVGA 3UGTA 2YRVA 5KYUA 1YJNA 4FYWB 3JCMc 4TQDA 2DXUA 3M0UA 2M9UA 1D3BA 3VQVA 4PJJA 5GJWB 1NZ9A 3EGXA 1NJ6A 1N9RA 2DZ9A 1Z9QA 1VQ9A 1D1AA 3G7ZA 2FZCB 4AFQC 5GAN7 4B6MA 2K5FA 2C06A 4RQFA 2I4OA 4AH6A 2JS0A 3JCMg 4BWAA 2DVEA 4H2XA 4NL3A 1OPLA 5KCOA 1LPLA 1YHQT 1TTHB 2CGHA 3LW5E 2P0QA 1WZOA 1S72A 2RA2A 3LWIA 3EH1A 1ACMB 2K3XA 4M7AG 2QGFB 1OEBA 3J7AF 1ZUUA 1BIBA 1WQ7A 2VB6A 2FZGB 2VXFA 2CP7A 5KE2A 5J26A 4HVWA 4M77C 4RMOA 2LNVA 1UECA 1ZSZA 3RR6A 3G6ET 1Q7YC 4YCVA 1PG5B 2ATCB 3NPFA 1PCXA 1E6HA 2ZPFB 4UP8A 4YRIA 1M1GA 4XQ3A 4XEOA 3E9FA 5IXFA 1H641 3M0SA 4HT8A 1F1BB 3D7SB 2PQWA 3HFNA 4YREA 1QCNA 2ALYB 1X2HA 1VQNA 2VC8A 4KGZB 1Q86R 2V8KA 4FT4A 1WHJA 1HTTA 1SRYA 3MEVA 4CS4A 4H2SA 1TUCA 4C8QE 2W0ZA 3SEMA 3EG9B 3GPLA 2DRMA 1BI0A 3Q1JA 1PWTA 2LC4A 1NJ5A 1YIJT 4IKFA 2Y90A 2YLBA 2ZNIA 1JJ2S 2HKNA 4ORZA 1AWXA 2DKGA 2GFAA 3VU3C 1YJNT 1UG1A 3HRIA 2F5TX 2E6ZA 2F2VA 1FYNA 3HKSA 2CIMA 1VQ7T 2QHSA 4DBRA 3PIOA 5CKFA 4HWPA 4L5GA 3UH0A 3CC2Q 1D0XA 4JJDA 4JUVA 1V1CA 2D8HA 1NYGA 1WLPB 3L2QA 5KYXA 1SG5A 1TWBA 1R0BG 1NJ2A 3M5AA 1SHGA 4BI4A 1R0CB 2PTKA 2VGNA 2R5AA 4HCCA 1IGUA 4J6YA 1ZX6A 3X28B 2YUOA 2BIVA 2RK1A 4JRPA 4C92G 1PSFA 1G3YA 2RHUA 3ER0A 1G3SA 3E9GA 2DBKA 1I1JA 3QKJA 5FRNA 2X4XA 3PVLA 3V7CA 2A36A 4EO4A 1RADB 2QXFA 2P84A 4PL6A 1MGQA 3A8OB 1Y7XA 3CD6A 3LH0A 2RD1A 4M77B 2GTJA 3VS7A 5KCHA 2Q7HA 1TS9A 2ENMA 1YHQQ 5EG2A 2KGTA 3CPWP 3QNEA 4EMHA 2DK3A 3M4PA 1I8FA 3OS0A 4ZTZB 3DKMA 3ZFJA 3CMAT 5CK9A 4M78D 3A74A 2Q5IA 3FB9A 1SESA 1X2QA 1BBZA 1XNIA 4N0AA 4ELYC 3C0CA 1GCQA 2VWFA 1EVLA 4OLFA 3EH2A 3CCQT 4NS5A 1YI2Q 3VQXA 5LJ3j 2A3LA 5LJ3f 5LJ3h 2OI3A 2DJQA 3GLXA 4C0GA 1SSHA 4CH3A 4DEXA 1XJWB 2K6DA 3HTRA 3I5RA 3QG1A 4YCUA 3RKWA 3W3SA 4DBHA 3OYCA 3JCMf 2CS7A 4B9WA 3O5ZA 1M2VB 3JSCA 1JXMA 2XDDA 4P71A 1USYA 4EMKC 4G85A 2MIOA 4RUGA 3X26B 2ED0A 1JBMA 1H4SA 2L0AA 2K5IA 5DLOA 4XTXA 2ZZFA 3UGQA 2M16A 4X1VA 1M2OA 3ME9A 1EFNA 2EQIA 3UA7A 1UHCA 1YIJQ 4BD3A 2CJ9A 4RG2A 2FG0A 3E2UA 2BTTA 3CBPA 2ZT6A 1B70A 2Z0WA 1L0WA 3ZBDA 3I56Q 4M77G 5GMKj 3FLGA 4IUUA 1NJIC 2JM9A 2MYSA 4P72A 3VS3A 2CUBA 3EGDA 4MZTA 4BI3A 4L59A 2DPPB 4E51A 3RKXA 2LRQA 5ELOA 5IHIA 3GIBA 1JEGA 2ZPHB 1KC8R 1VYTA 2DL8A 5FU7B 4RDXA 3ASKA 3CXCP 2RQWA 5J3BA 2YUNA 1JJCA 2EBPA 3OYLA 1K9AA 3LWHA 5DM7R 4C0FA 1K4US 2QEXQ 4PLLA 2EAYA 4X9DA 4M77E 2EWNA 4YRQA 4IUTA 1I81A 1ZA2B 3JB9I 1VQMQ 2VKNA 1W2BP 2BE7D 4F7UF 2C8MA 2DNUA 2K2MA 1QQJA 3OD1A 1ZSZC 4HT9A 1Y96A 2OAWA 5CIUA 1UB4A 4HWRA 4TVAA 5GAOr 2PZ1A 4GLMA 3KXTA 1I5LA 1PYSA 1I4K1 2NUTB 1BYMA 2OTLT 4OB3B 1AWOA 2P0KA 3VYGA 1G3WA 4E7LA 1H8KA 4HT4A 5E3IA 5A0DA 1VQLT 3VQWA 4LD9K 4LDUA 1WYDA 2H3EB 2FPEA 3CCUT 4LNPA 4GY5A 1SRLA 4C0DC 1X6BA 3A5ZA 2ED1A 4R0KA 2E1HA 2WACA 3TREA 2HSPA 1EQRA 1J5WA 2A28A 2KE9A 3J80E 3S3NA 4DA4A 1QWEA 2D8JA 1UJ0A 4M78B 2ABLA 1HSQA 1V29B 2EQMA 3CCMT 4KH0B 1PM3A 1C0AA 2J6KA 4HVVA 1VQ5Q 2JTFA 2KT8A 1YN8A 2F69A 3S3MA 2ARSA 1UGVA 1WHLA 2QASA 3A98A 4OMFB 3NETA 3EG2A 3VS2A 4CC3A 1IRXA 3C4SA 3QJ6A 2E4HA 4M75C 1FYFA 2ZIMA 5HCKA 1VQPT 1NBEB 4PG3A 4BB7A 1NYQA 3HXXA 2F2WA 3HFZA 3BFMA 5GAMe 3RKYA 2KBTA 1VQ6Q 1ZHIA 3MQZA 3HTZA 3HRTA 4BE0A 3CCST 1UHFA 1OX9A 2CZ7B 2L89A 4JJNK 5M9OA 4N4IA 2FO0A 5A2QE 3QDRB 1M3CA 5LJ3g 1VQ5A 1OV3A 2L3PA 4H2YA 1M90U 1J3TA 3ULRB 1WFWA 2EJ9A 4NL2A 3HXYA 2OTLA 3ZL7C 2DD4A 2RJCA 1GCPA 3CMEA 3HSBA 1RAIB 4RTUA 5LJ3e 3S6WA 5CKHA 4J7IA 1M30A 5GANf 2RHXA 3JCMW 2PUOB 2LX9A 1AZGB 2D9TA 2V26A 4C5HA 1KMMA 3PCOA 1MMNA 1TUGB 3KFVA 1JJ2P 1HC7A 1X56A 4EDUA 3OYJA 1E22A 4LDWA 1TH7A 3R6NA 1UFFA 4RTXA 1M90R 1PD1A 2E5AA 1O9SA 2X9HA 3AHUA 5KNNA 3X25B 3GP8A 5C51B 1KD1R 4N0AC 1BB9A 1YJ9A 3CCQA 4CI0C 2K5LA 1PRMC 3H41A 3CMAQ 3SHWA 1WXUA 1M8VA 2EPDA 2DQ3A 4PJNA 4QQ6A 4YRFA 3H8ZA 1VQ6T 2VASA 1M1FA 2KMTA 3P8BB 1Q82R 4KH1B 4RG8A 4TWAA 4YRGA 3VS5A 2VYTA 1KC8C 2OJ2A 2O31A 3OBWA 3I7FA 5GMKh 5KYWA 4RTYA 4J9GA 2JN0A 4HKEA 3QHSA 3M4GA 3NELA 3QZ9B 2K79A 3G4SQ 1XQHA 2IY5A 4WTOB 1C0MA 2DILA 2QQBA 1WX6A 1WA7A 4E6RA 2FPDA 4AG1C 3OMCA 4C5GA 1U8RA 1K9MR 1YP5A 1AWWA 4XK8E 4LD6A 3TEGA 4M78F 4XU1A 1IXDA 4P74A 2ZPBB 1OOTA 2EL9A 3L4GA 4ATOA 2LJ0A 1Y0MA 2CT4A 5FWBA 3VS6A 4PJOB 2V1RA 4NOYA 2CSQA 4M7DG 5CKBA 4WCIA 3JB9G 4KUDK 4BW9A 5CO7A 3TSZA 3CCET 2RPNA 1NM7A 4M75E 1PC0A 4YROA 4OB0B 2D0QB 3E9HA 2HQXA 1T3SA 5IHNA 1QVFS 2JT4A 1V76A 2RQRA 2E6NA 1Q81C 1QVGP 1VQ8A 2HZYA 2KYMA 1RLPC 4HA8A 4BUGA 1T0JA 4LVKA 3M55A 4Y92A 4BE2A 3VS1A 3M57A 4C5EA 4JZ3A 3IQLA 3E1SA 2COZA 2LQWA 1HK9A 4XU3A 5GANh 4OMLA 5GANj 2M02A 2DF6A 4O5VA 4BY6C 1UEBA 1B7YB 4OP0A 1N5ZA 1KSWA 2EFIA 4ESRA 2QQ9A 3BDLA 4P72C 1Q7YU 2RI5A 4PFOA 3JCMX 2AMCB 2ZINA 4KGVB 2DZCA 2IVWA 4IUPA 2C0OA 2DTHA 1VQLQ 4TVWA 2J3MA 4TTVA 3NMZC 4XEMA 2VXEA 1PD0A 3SWNA 1VQKA 2XD0A 1MV0B 3WVEB 4A4FA 2CUDA 4P74C 5ECAA 5GAOl 3MEAA 1Z7MA 2CP2A 4LDYA 3OYKA 3VQYA 2RNAA 3TEHA 5CR2A 1ARKA 3OY9A 2KK4A 3L2UA 3BW1A 5GANd 4CH4A 4YRKA 1RABB 4H02A 2H8HA 2ZR3A 3CCEA 2DU5A 3LC0A 1ZA1B 2HMAA 2CZ0B 4XTUA 1QLYA 4YRNA 1VQZA 2LP5A 2JVVA 5GAN6 3MP8A 2E5KA 4QW2A 1NYRA 3SFMA 3HFVA 2X35A 3CCSA 2OAUA 3OYEA 4WF2A 1N9SA 3PVQA 3OB9A 2E10A 5GAOm 3P8HA 2QQAA 4JRIA 3JRZA 3DSQA 3M59A 2E3IA 1K76A 1RI9A 1RACB 3RNJA 4MZPA 3C94A 2DEUA 1ATIA 3QYHB 5KE3A 1B34B 1D09B 1S1NA 2AKLA 2P5IA 4LVMA 4UPAA 4YRJA 1M1KR 1H92A 2MOXA 1N8RU 4YP0A 3CCLA 3NTIA 1GXIE 3OYHA 4ME7A 1AEYA 2A8EA 3HXVA 2HQHA 1EVKA 2X4JA 1WNLA 2J7IA 4XAXB 2KAFA 2HEQA 3CCJT 2ZT7A 3SD4A 4FYVB 2O4XB 4J9IA 3OA6A 4NCXA 2M51A 3TEHB 2JZ2A 4M7AF 2XTIA 4TVYA 2JTEA 2K9GA 3VV0A 4FU6A 4YRPA 3OSVA 2E65A 2HD0A 2KEAA 3FRNA 3SWNB 1KQ2A 5FU7C 4J9EA 2JOYA 2BZ8A 1AWJA 3EFSA 4PK4A 3OMGA 3RESA 3QO3A 3OS5A 4C0ZA 3META 4HWOA 2KRNA 4HVUA 3FEOA 3OYIA 1B7TA 4KR2A 3CCLQ 3L1AA 3VUBA 1KQSP 2YDLA 5GMKl 1KQ1A 1VQPQ 2FZKB 2O4XA 4M75F 1JO8A 2OTLQ 5GJVB 4XTVA 2KY9A 4ZTFA 4O6JA 1G83A 2EQJA 1VQ7A 2PUKB 2OX7A 1I0CA 3CBOA 1ZSGA 4OGEA 5ELNA 2F2XA 5I2MA 1YCYA 5GANe 1VQ4A 1OX8A 1VYVA 4F14A 3VBBA 3G6EQ 4BDYA 4FW2A 2DX1A 4A53A 4IUQA 4C92F 2FB7A 2YUPA 4P75C 2F1LA 2XI9A 1M3AA 1SSFA 1TXQA 1ZUYA 1VYUA 4LUDA 3CCVQ 3PT9A 3C12A 1KHCA 1Z7NA 2ZZEA 3UA6A 2X4WA 3VYHB 4X34A 4EPCA 5GAN8 1YGBA 3NTKA 3I55A 3CCJA 2I4NA 4MDXA 1VQ4Q 4RTWA 5IAYA 1U06A 3L2VA 1JQQA 1VIEA 4IIOA 3L4GB 3MJXA 1YB3A 2ZXFA 3URGA 4KRTA 2MAMA 3QTCA 4D8DA 4YDQA 4M75B 4IIMA 5D6WA 3VS4A 4P3OA 1HJDA 2FRWA 1GGMA 4LVIA 1NJIR 2M0YA 1NJ1A 4C8QG 3DB3A 4OB1B 1YJ9Q 4JDSA 4L87A 5IH2A 3V7RA 3DLMA 2ZZGA 5GAMd 1G5VA 2FPFA 3RDVA 1NG2A 2KRSA 3RL6A 1SRMA 3CCJQ 3HRSA 5LJ5f 1PSEA 5KYWB 1IB8A 3CCSQ 5L23A 2RHIA 2LVMA 2COYA 4RTTA 2RHSA 4J9CA 1Q86U 1S72T 1XOVA 4BE1A 1BI2A 1K9MC 4AFUC 1UGPB 1RAEB 3OS1A 2H3JA 4OMNA 4A4HA 4Y91A 1QKWA 1QCFA 2LQ8A 4C0DB 4OMMA 3H0HA 2XGTA 2M1HA 4J83A 4DBQA 4ZTJA 1WIEA 2EGCA 3G6EA 1RL2A 5GMKi 4O2DA 2RJDA 4M7DA 1MMDA 2QEXT 2K4YA 3I55T 3HFOA 1NPPA 3A8GB 2PMFA 4PJOF 4M78C 1K0XA 1IHVA 2VGMA 2O9SA 1QVGS 2ZPGB 4C92A 4D8KA 2C0IA 1ZQ1A 3EFOB 5KYUB 1GCQC 1WXTA 1PHTA 1N9WA 4D6WA 2PVOB 1G5IA 3U23A 4J5YA 2MI6A 2DO3A 1VQMT 3MPUB 1D0ZA 3FJ5A 2ZGWA 3QIIA 1QCOA 3QO5A 4Z88A 2DL7A 2VV5A 2VVKA 1VUBA 3HL8A 1ASZA 4FCYA 1QE0A 1YIJA 5F5WA 3TUPA 4DBFA 4ZGJB 3SB2A 1SHFA 1USYC 4P3PA 1E7OA 2SEMA 3EFRA 2J6OA 3LX7A 2OTJA 5KYNA 2PNIA 4II1A 1RI0A 2XDPA 1E1OA 3T9NA 1QVPA 3NTHA 3M0QA 2EJFA 2P4TA 1AVZC 2QDYB 3PTAA 3UDCA 5IT9E 2GBQA 1H3HA 4YRCA 3RGLA 1EX4A 4OMOA 4E7ZA 4FM4B 1OPKA 3VRYA 2RQTA 3CC4A 3OYYA 4MMLA 6AT1B 2EVRA 1BCMA 5LJ3d 4PJLA 5CAIA 2EYWA 2HBWA 2LT1A 3OW2A 1H4TA 3CQTA 4M7AA 1K1ZA 3UATA 2WSCE 3QWYA 4M78A 5FU6C 1YFTA 2EYYA 4YRLA 4P73C 1LOJA 1KG1A 5GMKe 2KT1A 3EFOA 2ZTGA 2DM1A 4C92B 5C6SA 1MNDA 3RBBB 3CCVT 4DPGA 2FYKA 1FXXA 3QO7A 3NEMA 3BY7A 5C53B 5LJ5g 4PKCC 4MMKA 4BY6B 2OTJT 2L8DA 4M7DB 2EKOA 2JMAA 1LJOA 2LJ1A 4BI8B 3CBMA 2CP6A 3OYGA 2I4MA 3CC4Q 4Q6GA
chains in the Genus database with same CATH topology
2FL7A 2AKWA 3PCOB 4OB2B 1SERA 2E64A 4K87A 5GAMg 1VQPA 2RHQA 1PYSB 4DOVA 1WJSA 3DB4A 1WGSA 1WLEA 4HWSA 3MP1A 3E19A 1YHQA 3MEUA 2RHSB 4P75A 3E9IA 4K88A 4RKUE 3OQ5A 5LJ5d 2MMPA 4FIBA 1BI1A 1K9MU 2DTOA 1Q81U 1JJCB 1HXDA 3CXCS 4C8QD 3OS2A 2LDMA 2LQKA 3IKMB 4YRRA 3N5BB 3CMET 1UGSB 2E5QA 5FRMA 3QJYA 1YFSA 1OZ2A 4M75A 4KR3A 3LSQA 3H6ZA 1W2BS 4M75D 4YCWA 1KQSS 2C7IA 4M7AC 4YRMA 1YJWA 1YBYA 3I56T 2DXCA 4JLIA 5J39A 3CD6T 1IREB 2YLCA 4C92D 2JNGA 3LLRA 1NJIU 4VUBA 3WXMB 2WSEE 2ZCEA 4QQGA 2V8IA 1YITA 2EIFA 4J8OA 5HGQA 3A5ZB 1IL2A 4IUVA 4PLIA 3P8VA 3G4SA 4H2VA 4E47A 3NENA 2DU7A 4E7IA 1X6OA 4M7DC 2QEXA 4WJ3M 4MDWA 2CJAA 4C92C 2L5QA 1X75C 4RQEA 2E12A 1Y07A 2QQSA 5FU6B 5GAMh 1N8RC 3M4QA 1VQMA 1YI2T 1OZ3A 2A7YA 3JCMd 3I56A 4H2WA 2LCLA 4C92E 1U1SA 5D6XA 3PFSA 3JCMP 4TQFA 2GFUA 5DY9A 2ZR2A 3RIRA 5GAOq 3P8YA 1W2BA 3LSSA 3UFGA 5KH6A 1B70B 3IKLA 2ARUA 1M1KC 3A7RA 1K8AU 3OYAA 3ERRA 5D6YA 2BUDA 2L3RA 4PJOD 4Q15A 1B34A 4JS4A 1YITT 4C8QF 5AYFA 4QQDA 2XIDA 1EIYB 3QBYA 1ASYA 2K57A 4JS5A 3UWNA 2AHJB 3A32A 3G4ST 4CRIA 2ARTA 3JCMb 3TCJA 2DXBA 4KULA 1U1TA 4RCBA 1VQOT 3LGLA 4CH5A 3FDRA 5CQYA 1WU7A 4XTZA 2FHDA 1M90C 2ZZDA 4PJOC 3LGFA 5FLXE 1H4VB 3RUXA 4LDVA 3IG2A 2ALYA 4E7HA 3BDUA 3PGGA 5A0LA 3PMTA 4M77A 3M9QA 3UT1A 2KDSA 2O01E 3DLLA 3GNFB 2B8AA 4L6V5 4MZMA 5CQXA 5LL6S 1G3TA 4OF1A 3VKIA 1Q86C 2AMCA 2ODRD 5GAN5 3FJPA 4M75G 11ASA 2CKKA 2LTOA 4JLGA 3HHTB 3HXWA 4K86A 3CC7T 4ZGEB 2V8JA 1LNXA 12ASA 1VQ6A 1EOVA 1UGQB 1B7YA 3HY1A 3A8LB 3MCAB 2PVGB 3M54A 1Y71A 4X9CA 4P5NA 4A4EA 1B8AA 2XKOC 1IZ6A 2P0LA 2EQUA 4FL6A 1VQ5T 1D3BB 3JB9F 3UPUA 1FWZA 2NLUA 5HK3A 2RK2A 3CCLT 4ZIBA 3CPWS 1KMNA 2PMEA 4LNSA 5GAN2 4M78E 4JRKA 4LVLA 2DTIA 4XTYA 2G3RA 1NNHA 2E3CA 3RF1A 4M7DD 1YFRA 3L2RA 3HP9A 3KBGA 5GAN3 2XG8D 4PJOA 1K8AC 1OI1A 5GAOn 4QVCA 1M4ZA 1M1KU 2XICA 2QHUA 3A7AA 3CPFA 1K73C 2HBPA 1YJWT 4FSXA 3CC7A 1KQSA 3CC2A 5A0GA 3P8DA 4Z02A 4YYEA 3GF5A 4EX5A 1KD1C 2WSFE 3PMIA 5K1XA 2IY5B 2RM4A 1KHIA 2MF2A 1M5Q1 3KUFA 3MF2A 1EIFA 4GLKA 5CVIA 4M7AE 3X20B 4C5IA 3JCMV 3OSSC 3RMSA 3R07A 4Q5WA 2DEQA 1ADJA 3QXEB 3HXUA 3REXA 4M7DE 4QVDA 1OYXA 1QP2A 2RH2A 2RI2A 2VUBA 3HPWA 2HQEA 2RHYA 3BJUA 1X55A 4V2SA 2Q7EA 3MHXA 2R58A 2M0OA 4KT0E 4M77D 3OYBA 1YI2A 2ZPEB 4KBMB 4RMFA 2P0PA 4OGCA 1MHNA 4RCCA 3CCVA 1ADYA 2QTXA 2QI2A 3A5YA 4H2UA 2MWOA 4ZN3A 3KFUA 3JB9J 3CMAA 3MF1A 4HVCA 1Q82C 3HXZA 1VQ9T 1FX7A 3CPWA 3A31A 4A4GA 3LYIA 3JB9D 2KQWA 1AHJB 3CMQA 2PVDB 4LDXA 4G84A 1K73U 4PHCA 1BIAA 3PIPA 3FIFA 3HFZB 2ODRC 4WJ4A 2IG0A 2KSSA 4M7DF 3A7UA 1WPYA 2EYQA 3RMQA 4F7UA 2ZT8A 3REUA 1JB0E 5HK0A 1WJRA 5I21A 4N4GA 4M78G 1VQOA 3GOXA 2ZIOA 1W4SA 1LYLA 3QZ5B 4HWTA 1VQKT 3C95A 4C8QB 4E7JA 2Y4XA 1R8OB 3V8KA 1QW1A 2ZPIB 3QYGB 4WI1A 2QA4A 4JRQA 2XHCA 3WVDB 4CH6A 3TU4K 1VQ8T 3MP6A 1YJ9T 4N4HA 3JCMh 2GQVA 1E1TA 1B76A 4B9XA 4HCZA 4PNOA 3SDZA 4ELZC 5GAN4 3M58A 2F5KA 4F7UE 4J15A 4KQEA 2I2LA 4TVAB 1Y96B 2K2VA 4C8QC 4UP9A 5CCAA 4M7AD 2J3LA 4XU2A 3G71T 3JCMJ 3TEEA 4IURA 4M77F 1WJQA 5GANg 3V7SA 1EIYA 2DD5A 3JAME 2JUFA 3CC4T 4CS2A 2GCXA 2RI3A 2QHTA 4QVZA 1QP3A 2CZ6B 4ZGDB 5DLQE 4A4KA 3L42A 2KVQG 3RERA 3V8JA 4KUIA 3A8MB 2QA4T 1Q82U 4LVJA 5HKCA 1NJ8A 4HCBA 5L8RE 4UP7A 5HY6A 1M9SA 5C0MA 3QSUA 3MEYA 1BKBA 1W66A 5LJ5j 2XDBA 2LT4A 3J81E 1KC8U 1ZBXA 3M53A 1KD1U 4ZN1A 4J6XA 3QPHA 4XU0A 5C52B 2JTMA 3G71A 3GNGA 2GF7A 4BDZA 2XK0A 3M4YA 3P8TA 1KOGA 5LJ5h 3JB9H 4P73A 4YPFA 1BBUA 3HRKA 3EAEA 2RJEA 3HRUA 1EFWA 3ZEHA 1UGRB 2RB6A 4E7KA 2CZ1B 1O75A 2Y4YA 2DDZA 5LJ5e 3M56A 2PU9B 1G5HA 3QUIA 1X01A 3JCMQ 3G1ZA 2DIQA 2RO0A 3OYFA 1H4QA 3WQZA 3MO8A 2R57A 1QF6A 3CCRT 5I2SA 5IN1A 1VQNT 4YRTA 4F7UG 2ZT5A 3PNWC 2I4LA 3IALA 2E41A 2LCCA 3CEYA 4ZTUB 2CJBA 3VUZA 5GAOp 4A54A 3CXCA 1NPRA 4EMGA 3L2WA 3QO8A 3L2ZA 2DXTA 2Q7GA 3OBYA 4DOWA 1N27A 5GMKm 5GAMf 1VQ4T 5GAMj 3OYNA 1SETA 3S3OA 5CKDA 3V8LA 3INZA 3MEWA 1VQLA 4PJOG 4X5OA 2R5MA 3CCUA 4TVRA 1H3ZA 2EQKA 1JJ2A 1BBWA 2RHQB 3OYMA 2AKWB 3X24B 2X4YA 4XTWA 3CCMA 2DIGA 4Y28E 2ZNJA 4BACA 3CCRA 2HNIA 3PZCA 2HAXA 4PJOE 3OYDA 4P71C 4DQ2A 1BI3A 5K1PA 4UC4A 4OVAA 3R6OA 1X2GA 4R56A 4YRSA 1JRIA 4CS3A 2D6FA 2QQRA 3OW2S 3FC3A 1G51A 2ZCFB 2BKDN 3CC2T 4R55A 4YTLA 2QHVA 2Q5HA 4M7AB 4C8QA 2EJGA 3SWNC 2RJFA 4H2TA 3RACA 3JCMe 4J7FA 3HY0A 3NFCA 4F7UB 2G4CA 2XU8A 1NE8A 4H2XB 2CYZB 1N6AA 1XTDA 2DQ0A 3A8HB 1DJ7B 2RHZA 3O8VA 1WQWA 1VIFA 1E24A 2FVUA 2DAQA 2DJZA 4P3NA 1RIQA 4J6WA 2YHTA 2E70A 1X54A 5FROA 4EMKA 2MWPA 3ICAA 5CKEA 1P92A 1QVFA 4EMKB 2K3YA 4FT2A 2NS6A 3VJPA 3F70A 1QVGA 3UGTA 2YRVA 1YJNA 3JCMc 4TQDA 2DXUA 2M9UA 1D3BA 3VQVA 1NZ9A 1NJ6A 1N9RA 2DZ9A 1VQ9A 3G7ZA 5GAN7 2K5FA 2C06A 4RQFA 2I4OA 4AH6A 3JCMg 4BWAA 2DVEA 4H2XA 4NL3A 5KCOA 1YHQT 2CGHA 3LW5E 2P0QA 1S72A 2RA2A 3LWIA 2K3XA 4M7AG 3J7AF 1BIBA 1WQ7A 2VXFA 5KE2A 5J26A 4M77C 4RMOA 2LNVA 1Q7YC 3G6ET 4YCVA 2ZPFB 4UP8A 4YRIA 1M1GA 4XQ3A 4XEOA 3E9FA 1H641 4HT8A 2PQWA 3HFNA 4YREA 2ALYB 1X2HA 1VQNA 2VC8A 2V8KA 4FT4A 1HTTA 1SRYA 3MEVA 4CS4A 4H2SA 4C8QE 3GPLA 1BI0A 3Q1JA 2LC4A 1NJ5A 1YIJT 4IKFA 2Y90A 2YLBA 2ZNIA 1JJ2S 2DKGA 2GFAA 3VU3C 1YJNT 3HRIA 2F5TX 2E6ZA 3HKSA 2CIMA 1VQ7T 2QHSA 3PIOA 5CKFA 4HWPA 4L5GA 3UH0A 4JUVA 3L2QA 1NJ2A 3M5AA 4BI4A 2VGNA 4HCCA 2R5AA 4J6YA 3X28B 2BIVA 2RK1A 4JRPA 4C92G 1PSFA 1G3YA 2RHUA 3ER0A 1G3SA 3E9GA 3QKJA 5FRNA 2X4XA 3V7CA 4EO4A 2QXFA 4PL6A 1MGQA 3A8OB 1Y7XA 3CD6A 3LH0A 2RD1A 4M77B 5KCHA 2Q7HA 5EG2A 3QNEA 4EMHA 2DK3A 3M4PA 1I8FA 3OS0A 4ZTZB 3DKMA 3ZFJA 3CMAT 5CK9A 4M78D 3A74A 2Q5IA 3FB9A 1SESA 1XNIA 4N0AA 4ELYC 1EVLA 4OLFA 3CCQT 4NS5A 3VQXA 5LJ3j 2A3LA 5LJ3f 5LJ3h 3GLXA 4C0GA 4CH3A 3QG1A 4YCUA 3RKWA 3W3SA 3OYCA 3JCMf 2CS7A 4B9WA 3JSCA 2XDDA 4P71A 1USYA 4EMKC 3X26B 1JBMA 1H4SA 2K5IA 5DLOA 4XTXA 2ZZFA 3UGQA 2M16A 3ME9A 4BD3A 2CJ9A 4RG2A 3CBPA 2ZT6A 1B70A 1L0WA 3ZBDA 4M77G 5GMKj 3FLGA 4IUUA 1NJIC 4P72A 4MZTA 4BI3A 4L59A 2DPPB 4E51A 3RKXA 2LRQA 5ELOA 3GIBA 2ZPHB 5FU7B 4RDXA 3ASKA 5J3BA 1JJCA 3OYLA 3LWHA 5DM7R 4C0FA 4PLLA 2EAYA 4X9DA 4M77E 2EWNA 4YRQA 4IUTA 1I81A 3JB9I 4F7UF 2C8MA 3OD1A 4HT9A 1Y96A 5CIUA 1UB4A 4HWRA 4TVAA 5GAOr 3KXTA 1I5LA 1PYSA 1I4K1 1BYMA 2OTLT 4OB3B 2P0KA 3VYGA 1G3WA 4E7LA 4HT4A 5E3IA 5A0DA 1VQLT 3VQWA 4LD9K 4LDUA 1WYDA 3CCUT 4GY5A 4C0DC 3A5ZA 2E1HA 2WACA 3TREA 1EQRA 1J5WA 3J80E 3S3NA 4DA4A 4M78B 1V29B 2EQMA 3CCMT 1C0AA 2JTFA 2F69A 3S3MA 2ARSA 4OMFB 3NETA 3C4SA 3QJ6A 4M75C 1FYFA 2ZIMA 1VQPT 4PG3A 4BB7A 1NYQA 3HXXA 3HFZA 3BFMA 5GAMe 3RKYA 1ZHIA 3MQZA 3HTZA 3HRTA 4BE0A 3CCST 2CZ7B 4JJNK 2L89A 5M9OA 4N4IA 5A2QE 3QDRB 5LJ3g 1VQ5A 4H2YA 1M90U 2EJ9A 4NL2A 3HXYA 2OTLA 2DD4A 2RJCA 3CMEA 3HSBA 5LJ3e 3S6WA 5CKHA 4J7IA 5GANf 2RHXA 3JCMW 2PUOB 2LX9A 2D9TA 4C5HA 1KMMA 3PCOA 1HC7A 1X56A 4EDUA 3OYJA 1E22A 4LDWA 1TH7A 2E5AA 1O9SA 3AHUA 5KNNA 3X25B 3GP8A 5C51B 4N0AC 1YJ9A 3CCQA 4CI0C 2K5LA 1M8VA 2DQ3A 4QQ6A 4YRFA 3H8ZA 1VQ6T 1M1FA 2KMTA 3P8BB 4RG8A 4TWAA 4YRGA 2VYTA 1KC8C 3OBWA 3I7FA 5GMKh 2JN0A 4HKEA 3QHSA 3M4GA 3NELA 3QZ9B 1XQHA 2IY5A 2QQBA 3OMCA 4C5GA 1U8RA 4XK8E 4LD6A 3TEGA 4M78F 4XU1A 4P74A 2ZPBB 2EL9A 3L4GA 4ATOA 4PJOB 4NOYA 4M7DG 5CKBA 3JB9G 4KUDK 4BW9A 5CO7A 3CCET 4M75E 4YROA 4OB0B 2D0QB 3E9HA 2HQXA 1QVFS 2E6NA 1Q81C 1VQ8A 4HA8A 4BUGA 4LVKA 3M55A 4BE2A 3M57A 4C5EA 3E1SA 1HK9A 4XU3A 5GANh 5GANj 4O5VA 4BY6C 1UEBA 1B7YB 4OP0A 2EFIA 2QQ9A 3BDLA 4P72C 1Q7YU 2RI5A 3JCMX 2AMCB 2ZINA 2DZCA 2IVWA 4IUPA 2DTHA 4TVWA 2J3MA 4TTVA 4XEMA 2VXEA 3SWNA 1VQKA 2XD0A 3WVEB 4A4FA 4P74C 5GAOl 3MEAA 1Z7MA 4LDYA 3OYKA 3VQYA 3TEHA 5CR2A 3OY9A 2KK4A 3L2UA 3BW1A 5GANd 4CH4A 4YRKA 4H02A 2ZR3A 3CCEA 2DU5A 3LC0A 2CZ0B 4XTUA 4YRNA 1VQZA 2JVVA 5GAN6 3MP8A 4QW2A 1NYRA 3SFMA 3HFVA 2X35A 3CCSA 2OAUA 3OYEA 4WF2A 1N9SA 3OB9A 2E10A 5GAOm 3P8HA 2QQAA 4JRIA 3JRZA 3DSQA 3M59A 4MZPA 3C94A 1ATIA 3QYHB 5KE3A 1B34B 2P5IA 4LVMA 4UPAA 4YRJA 1N8RU 4YP0A 3CCLA 3NTIA 1GXIE 3OYHA 4ME7A 2A8EA 3HXVA 1EVKA 2X4JA 1WNLA 4XAXB 2KAFA 3CCJT 2ZT7A 3SD4A 2O4XB 3OA6A 4NCXA 3TEHB 2JZ2A 4M7AF 2XTIA 4TVYA 3VV0A 4FU6A 4YRPA 3OSVA 2E65A 2HD0A 3FRNA 3SWNB 1KQ2A 5FU7C 2JOYA 3EFSA 3OMGA 3RESA 3QO3A 3OS5A 4C0ZA 3META 4HWOA 3FEOA 3OYIA 4KR2A 3L1AA 3VUBA 5GMKl 1KQ1A 2O4XA 4M75F 4XTVA 2KY9A 4ZTFA 4O6JA 2EQJA 1VQ7A 2PUKB 3CBOA 4OGEA 5ELNA 5I2MA 1YCYA 5GANe 1VQ4A 3VBBA 4BDYA 4A53A 4C92F 4IUQA 2FB7A 4P75C 2XI9A 1SSFA 3PT9A 3C12A 1KHCA 1Z7NA 2ZZEA 2X4WA 3VYHB 1YGBA 4X34A 4EPCA 5GAN8 3NTKA 3I55A 3CCJA 2I4NA 4MDXA 5IAYA 3L2VA 1VIEA 3L4GB 1YB3A 2ZXFA 3URGA 2MAMA 3QTCA 4YDQA 4M75B 5D6WA 4P3OA 1GGMA 4LVIA 1NJ1A 4C8QG 3DB3A 4OB1B 4JDSA 4L87A 3V7RA 3DLMA 2ZZGA 5GAMd 1G5VA 3RL6A 3HRSA 5LJ5f 1PSEA 2RHIA 2LVMA 2RHSA 1Q86U 1S72T 1XOVA 4BE1A 1BI2A 1K9MC 1UGPB 3OS1A 2H3JA 4A4HA 4Y91A 2LQ8A 4C0DB 2XGTA 2M1HA 4J83A 4ZTJA 3G6EA 1RL2A 5GMKi 4O2DA 2RJDA 4M7DA 2QEXT 2K4YA 3I55T 3HFOA 1NPPA 3A8GB 2PMFA 4PJOF 4M78C 2VGMA 1QVGS 2ZPGB 4C92A 1ZQ1A 1N9WA 4D6WA 2PVOB 1G5IA 4J5YA 2MI6A 2DO3A 1VQMT 2ZGWA 3QIIA 3QO5A 2VV5A 1VUBA 3HL8A 1ASZA 1QE0A 1YIJA 5F5WA 3TUPA 4ZGJB 3SB2A 1USYC 4P3PA 3EFRA 3LX7A 2OTJA 4II1A 1RI0A 2XDPA 1E1OA 3T9NA 1QVPA 3NTHA 2EJFA 2P4TA 2QDYB 3PTAA 3UDCA 5IT9E 4YRCA 3RGLA 4FM4B 3CC4A 3OYYA 4MMLA 5LJ3d 5CAIA 2LT1A 3OW2A 1H4TA 4M7AA 2WSCE 4M78A 5FU6C 1YFTA 4YRLA 4P73C 1LOJA 1KG1A 5GMKe 2ZTGA 4C92B 3CCVT 5C6SA 4DPGA 2FYKA 1FXXA 3QO7A 3NEMA 3BY7A 5C53B 5LJ5g 4PKCC 4MMKA 4BY6B 2OTJT 2L8DA 4M7DB 2EKOA 1LJOA 4BI8B 3CBMA 3OYGA 2I4MA 4G85A 4Q6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP8 A;  4G84 A;  4XQ3 A;  2AKW A;  3PCO B;  4YRI A;  4M75 E;  1SER A;  2E64 A;  4K87 A;  5GAM g;  4YRO A;  2RHQ A;  4XEO A;  1PYS B;  4PHC A;  1BIA A;  3FIF A;  3HFZ B;  3E9H A;  2ODR C;  4WJ4 A;  1H64 1;  4HT8 A;  1WLE A;  4HWS A;  4M7D F;  3HFN A;  4YRE A;  2ALY B;  3A7U A;  1X2H A;  2RHS B;  4P75 A;  3E9I A;  4K88 A;  2VC8 A;  1WPY A;  4F7U A;  2ZT8 A;  3REU A;  4HA8 A;  1HTT A;  5LJ5 d;  1SRY A;  5I21 A;  4M78 G;  2ZIO A;  4H2S A;  4CS4 A;  4C8Q E;  1LYL A;  4HWT A;  2DTO A;  1JJC B;  1HXD A;  4C8Q B;  1HK9 A;  4C8Q D;  4XU3 A;  1NJ5 A;  5GAN h;  3V8K A;  3IKM B;  5GAN j;  2Y90 A;  4YRR A;  2YLB A;  2ZNI A;  2DKG A;  1B7Y B;  3VU3 C;  1YFS A;  4WI1 A;  4OP0 A;  4M75 A;  4KR3 A;  3LSQ A;  3HRI A;  4M75 D;  4CH6 A;  4P72 C;  2CIM A;  2QHS A;  4YCW A;  3JCM h;  3JCM X;  2AMC B;  2C7I A;  2ZIN A;  2DZC A;  4HWP A;  4M7A C;  1E1T A;  4YRM A;  1B76 A;  2DTH A;  4TVW A;  3UH0 A;  2J3M A;  4JUV A;  4PNO A;  4TTV A;  5GAN 4;  4XEM A;  4JLI A;  2VXE A;  3SWN A;  4F7U E;  4J15 A;  4KQE A;  2I2L A;  4P74 C;  4TVA B;  1NJ2 A;  2YLC A;  1Y96 B;  5GAO l;  4C92 D;  1Z7M A;  3VQY A;  4C8Q C;  4J6Y A;  3TEH A;  4UP9 A;  2ZCE A;  4M7A D;  3BW1 A;  5GAN d;  2J3L A;  4CH4 A;  4YRK A;  4XU2 A;  4H02 A;  4C92 G;  3JCM J;  2ZR3 A;  4M77 F;  2DU5 A;  5GAN g;  3LC0 A;  3V7S A;  5HGQ A;  1EIY A;  1IL2 A;  4XTU A;  3P8V A;  4YRN A;  3V7C A;  4H2V A;  1VQZ A;  3NEN A;  4CS2 A;  4EO4 A;  2DU7 A;  5GAN 6;  2QHT A;  1NYR A;  1MGQ A;  4M7D C;  3HFV A;  2RD1 A;  4M77 B;  4WF2 A;  1N9S A;  2Q7H A;  3RER A;  2E10 A;  5GAO m;  3V8J A;  3QNE A;  4EMH A;  4WJ3 M;  3M4P A;  1I8F A;  4ZTZ B;  2CJA A;  4JRI A;  4C92 C;  3DSQ A;  4M78 D;  3A74 A;  2Q5I A;  4RQE A;  3FB9 A;  1NJ8 A;  1SES A;  5GAM h;  3M4Q A;  1ATI A;  1B34 B;  4N0A A;  2P5I A;  4UPA A;  4YRJ A;  1EVL A;  3JCM d;  4OLF A;  4UP7 A;  3VQX A;  5LJ3 j;  3QSU A;  5LJ3 f;  5LJ3 h;  4H2W A;  4C92 E;  3MEY A;  4YP0 A;  1U1S A;  1W66 A;  5LJ5 j;  3HXV A;  4CH3 A;  1EVK A;  4YCU A;  3JCM P;  4TQF A;  3RKW A;  3W3S A;  5DY9 A;  1WNL A;  2ZR2 A;  3JCM f;  3RIR A;  2ZT7 A;  5GAO q;  4J6X A;  4XU0 A;  5C52 B;  3P8Y A;  4NCX A;  4P71 A;  3TEH B;  1USY A;  3LSS A;  4M7A F;  2XTI A;  4TVY A;  3UFG A;  4EMK C;  3P8T A;  1JBM A;  1B70 B;  3IKL A;  4YRP A;  1H4S A;  2ARU A;  1KOG A;  2E65 A;  4XTX A;  2ZZF A;  5LJ5 h;  3UGQ A;  3A7R A;  3SWN B;  1KQ2 A;  3JB9 H;  4P73 A;  4YPF A;  3ERR A;  1BBU A;  3HRK A;  3EFS A;  4PJO D;  1EFW A;  4Q15 A;  1B34 A;  3RES A;  3QO3 A;  2CJ9 A;  4C8Q F;  4HWO A;  2ZT6 A;  1B70 A;  1L0W A;  1EIY B;  1ASY A;  4KR2 A;  2RB6 A;  2K57 A;  3L1A A;  4M77 G;  5GMK j;  4P72 A;  2DDZ A;  5GMK l;  3A32 A;  1KQ1 A;  2ART A;  5LJ5 e;  4M75 F;  3JCM b;  4E51 A;  3RKX A;  1G5H A;  4XTV A;  5ELO A;  3QUI A;  1X01 A;  3GIB A;  3JCM Q;  1U1T A;  3G1Z A;  4RCB A;  4RDX A;  1H4Q A;  1JJC A;  3WQZ A;  4CH5 A;  5ELN A;  1YCY A;  1WU7 A;  5GAN e;  1QF6 A;  2EAY A;  4X9D A;  4XTZ A;  4M77 E;  3VBB A;  2EWN A;  4YRQ A;  1I81 A;  4PJO C;  3JB9 I;  4A53 A;  4C92 F;  4F7U G;  2ZT5 A;  2FB7 A;  4P75 C;  4YRT A;  4F7U F;  1H4V B;  3RUX A;  2I4L A;  3IG2 A;  3IAL A;  2E41 A;  2ALY A;  2C8M A;  3OD1 A;  4HT9 A;  1Y96 A;  4ZTU B;  2CJB A;  4HWR A;  4TVA A;  5GAO r;  1I5L A;  3BDU A;  1PYS A;  1I4K 1;  3PGG A;  1Z7N A;  2ZZE A;  4M77 A;  5GAO p;  4A54 A;  4EMG A;  3QO8 A;  1YGB A;  3L2Z A;  5GAN 8;  5E3I A;  2DXT A;  2I4N A;  3VQW A;  1WYD A;  2Q7G A;  2AMC A;  2ODR D;  5GAN 5;  3FJP A;  4M75 G;  11AS A;  5GMK m;  5GAM f;  3HXW A;  1YB3 A;  2ZXF A;  3L4G B;  4K86 A;  5GAM j;  3A5Z A;  3QTC A;  2E1H A;  1SET A;  1LNX A;  1EQR A;  12AS A;  4YDQ A;  1J5W A;  4M75 B;  1EOV A;  4P3O A;  3V8L A;  1GGM A;  1B7Y A;  3HY1 A;  3INZ A;  4PJO G;  1NJ1 A;  4C8Q G;  4M78 B;  4X5O A;  4L87 A;  3V7R A;  2ZZG A;  5GAM d;  4X9C A;  1C0A A;  1BBW A;  1B8A A;  3RL6 A;  2RHQ B;  5LJ5 f;  2ARS A;  2AKW B;  2P0L A;  1D3B B;  3JB9 F;  3NET A;  4XTW A;  2ZNJ A;  4ZIB A;  2RHS A;  2HNI A;  3PZC A;  1KMN A;  2PME A;  4PJO E;  4M75 C;  4DQ2 A;  1FYF A;  2ZIM A;  5GAN 2;  4LNS A;  4P71 C;  4M78 E;  4JRK A;  4Y91 A;  4PG3 A;  5K1P A;  1NYQ A;  3HXX A;  2DTI A;  1X2G A;  3HFZ A;  3BFM A;  4XTY A;  2XGT A;  4YRS A;  1JRI A;  4CS3 A;  5GAM e;  3RKY A;  1NNH A;  2E3C A;  3RF1 A;  4M7D D;  1YFR A;  5GMK i;  4O2D A;  1G51 A;  3HTZ A;  5GAN 3;  2QHV A;  4M7D A;  2Q5H A;  4PJO A;  4M7A B;  4C8Q A;  2EJG A;  3SWN C;  5GAO n;  4QVC A;  2QHU A;  3HFO A;  4H2T A;  3RAC A;  2PMF A;  5LJ3 g;  3A7A A;  4PJO F;  4M78 C;  4H2Y A;  3JCM e;  4C92 A;  3HY0 A;  2EJ9 A;  4NL2 A;  3HXY A;  4F7U B;  1N9W A;  2G4C A;  1G5I A;  4J5Y A;  3HSB A;  4YYE A;  4H2X B;  4EX5 A;  5LJ3 e;  2ZGW A;  3QO5 A;  2DQ0 A;  5K1X A;  2IY5 B;  5GAN f;  3JCM W;  1WQW A;  2RM4 A;  1KMM A;  3PCO A;  1ASZ A;  1M5Q 1;  1QE0 A;  3MF2 A;  5F5W A;  3TUP A;  1HC7 A;  1X56 A;  4M7A E;  3SB2 A;  1E24 A;  1USY C;  1E22 A;  3JCM V;  4P3P A;  1TH7 A;  3EFR A;  3R07 A;  2DJZ A;  4P3N A;  1RIQ A;  2DEQ A;  4J6W A;  2YHT A;  2E5A A;  1ADJ A;  4BW9 A;  3AHU A;  5KNN A;  1X54 A;  5C51 B;  3HXU A;  4EMK A;  4N0A C;  3REX A;  4M7D E;  4QVD A;  1E1O A;  3ICA A;  2EJF A;  1M8V A;  4EMK B;  3BJU A;  2DQ3 A;  1X55 A;  4YRF A;  4V2S A;  2Q7E A;  4YRC A;  4M77 D;  3RGL A;  4TWA A;  4YRG A;  3UGT A;  3I7F A;  4RMF A;  3JCM c;  4MML A;  4TQD A;  5GMK h;  5LJ3 d;  5CAI A;  2DXU A;  1D3B A;  2JN0 A;  3VQV A;  3QHS A;  1NJ6 A;  3M4G A;  3NEL A;  1N9R A;  2DZ9 A;  4RCC A;  1H4T A;  1ADY A;  5GAN 7;  4M7A A;  2IY5 A;  4RQF A;  2I4O A;  2QTX A;  4AH6 A;  3A5Y A;  4H2U A;  3JCM g;  4BWA A;  2DVE A;  4H2X A;  4NL3 A;  3KFU A;  3JB9 J;  4M78 A;  1YFT A;  3MF1 A;  2CGH A;  4HVC A;  4YRL A;  4P73 C;  1LOJ A;  5GMK e;  3TEG A;  4M78 F;  4XU1 A;  2RA2 A;  3HXZ A;  2ZTG A;  4C92 B;  4P74 A;  4DPG A;  2FYK A;  4M7A G;  3A31 A;  3QO7 A;  3NEM A;  3BY7 A;  3JB9 D;  1BIB A;  1WQ7 A;  2EL9 A;  5C53 B;  3L4G A;  2VXF A;  5LJ5 g;  4MMK A;  4M77 C;  4PJO B;  4M7D B;  4NOY A;  4YCV A;  4M7D G;  3JB9 G;  1LJO A;  3CMQ A;  2I4M A;  4G85 A;  4Q6G A; 
#chains in the Genus database with same CATH topology
 2FL7 A;  2AKW A;  3PCO B;  4OB2 B;  1SER A;  2E64 A;  4K87 A;  5GAM g;  1VQP A;  2RHQ A;  1D1B A;  1PYS B;  1HD3 A;  2RMO A;  2DFU A;  4DOV A;  1WJS A;  3DB4 A;  1WGS A;  3PE0 A;  1WLE A;  4HWS A;  3MP1 A;  3E19 A;  1A0N B;  2C0T A;  1YHQ A;  3MEU A;  2ECZ A;  2RHS B;  1RAG B;  4P75 A;  2AZS A;  3E9I A;  4K88 A;  4RKU E;  3JV3 A;  3OQ5 A;  1PNJ A;  4FSS A;  5LJ5 d;  2MMP A;  4FIB A;  2DL4 A;  1BI1 A;  1K9M U;  1MMG A;  2YUQ A;  2DTO A;  1Q81 U;  1NEB A;  1JJC B;  1HXD A;  3CXC S;  4C8Q D;  4Z8A A;  3OS2 A;  2LDM A;  1X27 A;  2DL3 A;  2LQK A;  3IKM B;  4YRR A;  3N5B B;  3CME T;  1UGS B;  1HYO A;  2E5Q A;  2HSE B;  2I0N A;  3OW2 P;  1YJN Q;  1AZE A;  5FRM A;  3QJY A;  1YFS A;  1OZ2 A;  4M75 A;  4KR3 A;  3LSQ A;  3EGD B;  3H6Z A;  1W2B S;  4M75 D;  4YCW A;  1KQS S;  2C7I A;  4M7A C;  4YRM A;  1YJW A;  1YBY A;  3I56 T;  3CCM Q;  2DXC A;  4JLI A;  5J39 A;  1KFZ A;  3CD6 T;  4J9H A;  4ANJ A;  1IRE B;  2YLC A;  1CKB A;  4C92 D;  2JS2 A;  4AT1 B;  2JNG A;  3LLR A;  1NJI U;  4VUB A;  7AT1 B;  2JW4 A;  3WXM B;  2WSE E;  5FW9 A;  2A08 A;  2ZCE A;  4QQG A;  2MK5 A;  2IPO B;  2V8I A;  1YIT A;  2EIF A;  4J8O A;  2KXD A;  2ZAE A;  1W70 A;  2L3S A;  5HGQ A;  3A5Z B;  1IL2 A;  4IUV A;  4PLI A;  3P8V A;  3G4S A;  4H2V A;  3EG3 A;  4E47 A;  3NEN A;  2AZV A;  3CCR Q;  2DU7 A;  4E7I A;  1X6O A;  3EG1 A;  4M7D C;  4QT7 A;  3EG0 A;  2NUT A;  4F04 B;  2QEX A;  4JZ4 A;  2YRC A;  1M8M A;  4E7S A;  4WJ3 M;  4MDW A;  2CJA A;  2DBM A;  2QK0 A;  4C92 C;  2L5Q A;  1VQK Q;  1X75 C;  2EYX A;  1NYF A;  2K3B A;  4RQE A;  2E12 A;  2CH4 W;  2KNB B;  1Y07 A;  2QQS A;  5FU6 B;  5GAM h;  1VQO Q;  1N8R C;  3M4Q A;  4LE9 A;  1X43 A;  1VQM A;  1YI2 T;  2YXY A;  4JJC A;  1OZ3 A;  2A7Y A;  3JCM d;  8ATC B;  1K73 R;  1T3L A;  3I56 A;  4H2W A;  2LCL A;  4C92 E;  3TSW A;  1U1S A;  4E2F B;  5D6X A;  2GQI A;  4KGX B;  1E6G A;  3PFS A;  2E3H A;  3JCM P;  4TQF A;  2GFU A;  1I5O B;  1AT1 B;  2BZX A;  5DY9 A;  5IHK A;  2ZR2 A;  2IIM A;  3RIR A;  5GAO q;  2L2P A;  3P8Y A;  1ZUK A;  1W2B A;  2EGE A;  4M4Z A;  1BK2 A;  3LSS A;  3UFG A;  5KH6 A;  1B70 B;  3IKL A;  1LCK A;  3I9Q A;  2ARU A;  1T0H A;  1M1K C;  3A7R A;  1K8A U;  3OYA A;  3ERR A;  5D6Y A;  2BUD A;  2L3R A;  4PJO D;  4Q15 A;  1B34 A;  4JS4 A;  1YIT T;  4C8Q F;  1R77 A;  5AYF A;  4RTZ A;  2DMO A;  4QQD A;  2XID A;  2X3W D;  1GFD A;  2V1Q A;  1EIY B;  2XMF A;  3QBY A;  1ASY A;  2D1X A;  2K57 A;  2QTV A;  4JS5 A;  4F17 A;  3UWN A;  2AHJ B;  4ZNX A;  3G4S T;  4CRI A;  3G71 Q;  2ART A;  3A32 A;  1M2V A;  3JCM b;  3LH5 A;  3TCJ A;  1WI7 A;  2DXB A;  4KUL A;  1U1T A;  4RCB A;  1VQO T;  3LGL A;  3EG9 A;  2X3X D;  4CH5 A;  3FDR A;  5CQY A;  1WU7 A;  2J06 A;  4XTZ A;  2FHD A;  3M0T A;  1M90 C;  2ZZD A;  5I22 A;  4PJO C;  2KYB A;  3LGF A;  5FLX E;  1H4V B;  3RUX A;  4LDV A;  3IG2 A;  4A63 B;  4PJM A;  2ALY A;  2LNH B;  2QYZ A;  1VQ9 Q;  4E7H A;  2GTO A;  3BDU A;  1NLP C;  2LZ6 B;  2RF0 A;  3A1P A;  5KYY A;  3PGG A;  2AKK A;  5A0L A;  3PMT A;  4M77 A;  1BU1 A;  3M9Q A;  3UT1 A;  2KDS A;  2O01 E;  3DLL A;  3GNF B;  2B8A A;  4L6V 5;  4MZM A;  5CQX A;  1ZSZ B;  2O88 A;  5LL6 S;  1G3T A;  4OF1 A;  3VKI A;  1Q86 C;  2K7A A;  2AMC A;  5GAN 5;  3FJP A;  4M75 G;  2ODR D;  11AS A;  2CKK A;  2LTO A;  4JLG A;  3HHT B;  4CC7 A;  3HXW A;  3CC7 T;  4K86 A;  4ZGE B;  2V8J A;  1RAF B;  2EW3 A;  1I07 A;  1LNX A;  12AS A;  1VQ6 A;  4DEY A;  1EOV A;  1TUD A;  1U5S A;  1UGQ B;  1B7Y A;  3HY1 A;  3A8L B;  3MCA B;  2PVG B;  3M54 A;  1GRI A;  1Y71 A;  2FEI A;  4X9C A;  4P5N A;  4A4E A;  1B8A A;  1FMV A;  1QVF P;  2OTJ Q;  5KYX B;  2P4R A;  1Y57 A;  2XKO C;  1IZ6 A;  2EKH A;  3EGX B;  2P0L A;  2EQU A;  4FL6 A;  1VQ5 T;  1D3B B;  3JB9 F;  3UPU A;  2QDL A;  1FWZ A;  2KRM A;  2NLU A;  2QGG A;  5HK3 A;  2RK2 A;  3CCL T;  4RTV A;  4ZIB A;  1OU9 A;  3CPW S;  2ROT A;  4Z89 A;  1KMN A;  2PME A;  4LNS A;  2MCN A;  5GAN 2;  4M78 E;  2O9V A;  4JRK A;  4LVL A;  1B07 A;  2DTI A;  1Q95 G;  2DET A;  4XTY A;  2JM8 A;  2G3R A;  3EHQ A;  1NNH A;  2E3C A;  3RF1 A;  4M7D D;  1YFR A;  2DYI A;  3L2R A;  2CP5 A;  3HP9 A;  1YIT Q;  3KBG A;  5GAN 3;  2KR3 A;  2XG8 D;  2GGR A;  1OI1 A;  4GBQ A;  1K8A C;  4PJO A;  5GAO n;  4QVC A;  1M4Z A;  1M1K U;  2XIC A;  2QHU A;  3CPF A;  3A7A A;  1K73 C;  1MV3 A;  2HBP A;  1YJW T;  4J9F A;  2LJ3 A;  4FSX A;  8AT1 B;  3CC7 A;  1KQS A;  3CC2 A;  5A0G A;  3P8D A;  4Z02 A;  3H9N A;  4YYE A;  3GF5 A;  4EX5 A;  1KD1 C;  2WSF E;  2LCS A;  2KXC A;  3G1J A;  3PMI A;  5K1X A;  2IY5 B;  2GNC A;  2JMC A;  4PFP A;  2RM4 A;  1KHI A;  1K8A R;  1WXB A;  2MF2 A;  1M5Q 1;  3KUF A;  3MF2 A;  1EIF A;  2CP0 A;  4GLK A;  5CVI A;  4M7A E;  3X20 B;  5AT1 B;  4C5I A;  3JCM V;  3OSS C;  1U3O A;  3RMS A;  1UUE A;  3R07 A;  2YWW A;  4Q5W A;  1MNE A;  2DEQ A;  4AMC A;  1ADJ A;  3QXE B;  3HXU A;  3VS0 A;  3REX A;  4M7D E;  4QVD A;  1OYX A;  4OMP A;  1C1A A;  1QP2 A;  2HKQ B;  2A0F B;  1TSF A;  3M0P A;  1ABQ A;  2RH2 A;  2RI2 A;  1VQN Q;  2VUB A;  3HPW A;  2HQE A;  1KJW A;  2RHY A;  3QWX X;  3BJU A;  1CSK A;  1X55 A;  4V2S A;  2Q7E A;  3MHX A;  2R58 A;  2M0O A;  4KT0 E;  4M77 D;  1AOJ A;  3OYB A;  1YI2 A;  2ZPE B;  2LMJ A;  4KBM B;  4RMF A;  2P0P A;  4OGC A;  1GL5 A;  1MHN A;  1YWO A;  1YJW Q;  3I35 A;  4LXC A;  4RCC A;  2J6F A;  1N8R R;  3CCV A;  2RQV A;  1ADY A;  2QTX A;  2QI2 A;  3A5Y A;  4H2U A;  1YWP A;  2MWO A;  1MMA A;  4ZN3 A;  3BE3 A;  3KFU A;  3JB9 J;  3CMA A;  3MF1 A;  3CD6 Q;  4HVC A;  1Z9Z A;  1Q82 C;  1VQ8 Q;  3HXZ A;  1VQ9 T;  1FX7 A;  1KIK A;  3CPW A;  3A31 A;  4A4G A;  3LYI A;  3JB9 D;  2KQW A;  3TVT A;  1AHJ B;  3I55 Q;  3CCE Q;  1C6V X;  2LX7 A;  3CMQ A;  2PVD B;  1SF9 A;  4LDX A;  4G84 A;  2A37 A;  1K73 U;  4J9D A;  4PHC A;  1BIA A;  3PIP A;  3FIF A;  3HFZ B;  2ODR C;  4WJ4 A;  3GBQ A;  2IG0 A;  2KSS A;  4M7D F;  1WYX A;  1TU0 B;  1LVK A;  3A7U A;  3EGU A;  1WPY A;  2EYQ A;  3RMQ A;  3MKD A;  4F7U A;  2ZT8 A;  3REU A;  1JB0 E;  1SEM A;  5HK0 A;  3CCQ Q;  1OQK A;  1WJR A;  5I21 A;  4N4G A;  4M78 G;  1VQO A;  1OU8 A;  2YSQ A;  3GOX A;  2ZIO A;  1W4S A;  1G8X A;  1LYL A;  3QZ5 B;  4HWT A;  1VQK T;  3C95 A;  4C8Q B;  4E7J A;  1VQ7 Q;  1M27 C;  2Y4X A;  1R8O B;  3V8K A;  1QW1 A;  2ZPI B;  5IXB A;  1PRL C;  5FWC A;  4AG2 C;  3QYG B;  3REA B;  5KYY B;  2HL3 A;  4WI1 A;  1UE9 A;  4AFS C;  2QA4 A;  1QWF A;  2CSI A;  1EZZ B;  4JRQ A;  2XHC A;  3WVD B;  1SPK A;  4CH6 A;  3TU4 K;  1VQ8 T;  3MP6 A;  1YJ9 T;  4N4H A;  3JCM h;  2GQV A;  2DER A;  1RLQ C;  2CT3 A;  1E1T A;  3CME Q;  1B76 A;  1CKA A;  4B9X A;  1X6G A;  2CDT A;  4HCZ A;  4PNO A;  3SDZ A;  1M3B A;  4ELZ C;  2AT1 B;  5GAN 4;  3M58 A;  3CC7 Q;  3VRZ A;  2F5K A;  2COW A;  4F7U E;  4J15 A;  1TG0 A;  4KQE A;  2I2L A;  1YFN A;  4TVA B;  3H0I A;  3M0R A;  1Y96 B;  1VA7 A;  2NUP A;  2K2V A;  4C8Q C;  4UP9 A;  5CCA A;  1S72 Q;  3CCU Q;  4M7A D;  2J3L A;  2DE0 X;  2HDA A;  4XU2 A;  3G71 T;  3JCM J;  3TEE A;  4IUR A;  4M77 F;  2LQN A;  1WJQ A;  2D0N A;  5GAN g;  1SKU B;  3V7S A;  1EIY A;  2DD5 A;  3JAM E;  3AT1 B;  4PFZ A;  5I11 A;  2JUF A;  4QKU A;  1QKX A;  3CC4 T;  4CS2 A;  2GCX A;  2RI3 A;  1K0S A;  1ZBJ A;  4FW1 A;  3NGP A;  2QHT A;  1YCS B;  1QP3 A;  4QVZ A;  2CZ6 B;  4ZGD B;  4HCK A;  2RN8 A;  5DLQ E;  2X51 A;  4A4K A;  3L42 A;  2KVQ G;  3RER A;  3V8J A;  4KUI A;  1WHG A;  3A8M B;  5D7U A;  2QA4 T;  4FYY B;  1Q82 U;  4LVJ A;  5HKC A;  2DVJ A;  1NJ8 A;  1RAA B;  4HCB A;  5L8R E;  1WDX A;  4UP7 A;  5HY6 A;  1IO6 A;  1M9S A;  5C0M A;  3QSU A;  1FMK A;  3MEY A;  1BKB A;  1W66 A;  2BE9 B;  5LJ5 j;  3UF4 A;  2XDB A;  2LT4 A;  2EGA A;  3J81 E;  1KC8 U;  1ZBX A;  3M53 A;  1KD1 U;  3I5S A;  4ZN1 A;  2W10 A;  4J6X A;  3QPH A;  4XU0 A;  5C52 B;  2JTM A;  3G71 A;  3GNG A;  2GF7 A;  2NUP B;  4BDZ A;  2XK0 A;  1D1C A;  3M4Y A;  1NLO C;  3P8T A;  1GBQ A;  1TOV A;  1KOG A;  5LJ5 h;  4AFZ C;  3JB9 H;  4P73 A;  4YPF A;  1BBU A;  3HRK A;  3EAE A;  2RJE A;  3HRU A;  4CC2 A;  3ZEH A;  1WHH A;  1EFW A;  1PKS A;  1UGR B;  2YT6 A;  1VOM A;  2NUZ A;  2RB6 A;  1G2B A;  2QA4 Q;  4E7K A;  2CZ1 B;  1O75 A;  2Y4Y A;  1IGQ A;  2DDZ A;  5LJ5 e;  3M56 A;  2FRY A;  4J9B A;  2PU9 B;  2L3Q A;  2DLP A;  1G5H A;  3H0F A;  3QUI A;  1GFC A;  1X01 A;  3JCM Q;  1JXO A;  1UDL A;  2KI7 A;  3G1Z A;  2DIQ A;  9ATC B;  2RQU A;  2RO0 A;  3OYF A;  1H4Q A;  3WQZ A;  2MPX C;  3MO8 A;  4K11 A;  2R57 A;  1QF6 A;  2QG9 B;  2JJ9 A;  3CCR T;  5I2S A;  2KRO A;  5IN1 A;  1JU5 C;  1VQN T;  4YRT A;  4F7U G;  2ZT5 A;  3QDF A;  3PNW C;  2I4L A;  1RUW A;  3IAL A;  2E41 A;  2LCC A;  3CEY A;  1IHW A;  2DL5 A;  4ZTU B;  2CJB A;  2NWM A;  4LN2 A;  3VUZ A;  2CRE A;  5GAO p;  4A54 A;  1WHM A;  3CXC A;  1NPR A;  4EMG A;  3L2W A;  3QO8 A;  3L2Z A;  2DXT A;  2DRK A;  3OBY A;  2Q7G A;  4DOW A;  2AK5 A;  1N27 A;  5GMK m;  5GAM f;  1VQ4 T;  4CC4 B;  5GAM j;  3OYN A;  1SET A;  3S3O A;  5CKD A;  3V8L A;  3INZ A;  3MEW A;  1VQL A;  4PJO G;  2B86 A;  4X5O A;  3EHR A;  2R5M A;  2QAZ A;  3CCU A;  4TVR A;  1H3Z A;  2O2O A;  2EQK A;  1X69 A;  4F16 A;  1JJ2 A;  1BBW A;  2YRD A;  2RHQ B;  3OYM A;  2AKW B;  1FMW A;  3X24 B;  2ESW A;  1ZLM A;  2X4Y A;  1NEG A;  4XTW A;  1B3Q A;  3CCM A;  2DIG A;  1Q7Y R;  4Y28 E;  2ZNJ A;  4BAC A;  3CCR A;  2HNI A;  2HAX A;  3PZC A;  4PJO E;  3OYD A;  1UJY A;  4DQ2 A;  4P71 C;  1BCO A;  1BI3 A;  2SRC A;  1RAH B;  5K1P A;  1GBR A;  4UC4 A;  2J05 A;  4OVA A;  3R6O A;  1X2G A;  4R56 A;  4YRS A;  1JRI A;  4CS3 A;  2EYZ A;  1YNZ A;  3TQ7 P;  4EIK A;  2BZY A;  1WHK A;  4LUE A;  2D6F A;  2QQR A;  4FYX B;  3OW2 S;  3FC3 A;  1G51 A;  2ZCF B;  2BKD N;  3CC2 T;  4R55 A;  4YTL A;  2QHV A;  2Q5H A;  4M7A B;  4C8Q A;  2EJG A;  3SWN C;  2RJF A;  2ROL A;  4H2T A;  3RAC A;  2CH4 A;  3JCM e;  4J7F A;  3HY0 A;  3NFC A;  4F7U B;  5EC7 A;  2G4C A;  2DYB A;  2XU8 A;  1NE8 A;  4H2X B;  2CYZ B;  1N6A A;  1MUZ A;  4JJB A;  2NYS A;  1XTD A;  2HCK A;  2DQ0 A;  1W6X A;  1X2K A;  3A8H B;  1DJ7 B;  2RHZ A;  3O8V A;  2AIR B;  2DA9 A;  1WQW A;  1ABO A;  1QMC A;  1VIF A;  1AD5 A;  1KK7 A;  1E24 A;  3THK A;  2FVU A;  4JPB W;  2DAQ A;  2DJZ A;  4P3N A;  3REB B;  1RIQ A;  1OUL A;  1PKT A;  4J6W A;  2YHT A;  2E70 A;  1X54 A;  5FRO A;  2HL5 C;  4EMK A;  2MWP A;  3ICA A;  2G6F X;  5CKE A;  1P92 A;  4OMQ A;  1QVF A;  1Q81 R;  2JXB A;  3NHN A;  4EMK B;  2CP3 A;  2K3Y A;  4HXJ A;  4FT2 A;  2NS6 A;  1W1F A;  3VJP A;  1D0Y A;  1UTI A;  3F70 A;  1QVG A;  3UGT A;  2YRV A;  5KYU A;  1YJN A;  4FYW B;  3JCM c;  4TQD A;  2DXU A;  3M0U A;  2M9U A;  1D3B A;  3VQV A;  4PJJ A;  5GJW B;  1NZ9 A;  3EGX A;  1NJ6 A;  1N9R A;  2DZ9 A;  1Z9Q A;  1VQ9 A;  1D1A A;  3G7Z A;  2FZC B;  4AFQ C;  5GAN 7;  4B6M A;  2K5F A;  2C06 A;  4RQF A;  2I4O A;  4AH6 A;  2JS0 A;  3JCM g;  4BWA A;  2DVE A;  4H2X A;  4NL3 A;  1OPL A;  5KCO A;  1LPL A;  1YHQ T;  1TTH B;  2CGH A;  3LW5 E;  2P0Q A;  1WZO A;  1S72 A;  2RA2 A;  3LWI A;  3EH1 A;  1ACM B;  2K3X A;  4M7A G;  2QGF B;  1OEB A;  3J7A F;  1ZUU A;  1BIB A;  1WQ7 A;  2VB6 A;  2FZG B;  2VXF A;  2CP7 A;  5KE2 A;  5J26 A;  4HVW A;  4M77 C;  4RMO A;  2LNV A;  1UEC A;  1ZSZ A;  3RR6 A;  3G6E T;  1Q7Y C;  4YCV A;  1PG5 B;  2ATC B;  3NPF A;  1PCX A;  1E6H A;  2ZPF B;  4UP8 A;  4YRI A;  1M1G A;  4XQ3 A;  4XEO A;  3E9F A;  5IXF A;  1H64 1;  3M0S A;  4HT8 A;  1F1B B;  3D7S B;  2PQW A;  3HFN A;  4YRE A;  1QCN A;  2ALY B;  1X2H A;  1VQN A;  2VC8 A;  4KGZ B;  1Q86 R;  2V8K A;  4FT4 A;  1WHJ A;  1HTT A;  1SRY A;  3MEV A;  4CS4 A;  4H2S A;  1TUC A;  4C8Q E;  2W0Z A;  3SEM A;  3EG9 B;  3GPL A;  2DRM A;  1BI0 A;  3Q1J A;  1PWT A;  2LC4 A;  1NJ5 A;  1YIJ T;  4IKF A;  2Y90 A;  2YLB A;  2ZNI A;  1JJ2 S;  2HKN A;  4ORZ A;  1AWX A;  2DKG A;  2GFA A;  3VU3 C;  1YJN T;  1UG1 A;  3HRI A;  2F5T X;  2E6Z A;  2F2V A;  1FYN A;  3HKS A;  2CIM A;  1VQ7 T;  2QHS A;  4DBR A;  3PIO A;  5CKF A;  4HWP A;  4L5G A;  3UH0 A;  3CC2 Q;  1D0X A;  4JJD A;  4JUV A;  1V1C A;  2D8H A;  1NYG A;  1WLP B;  3L2Q A;  5KYX A;  1SG5 A;  1TWB A;  1R0B G;  1NJ2 A;  3M5A A;  1SHG A;  4BI4 A;  1R0C B;  2PTK A;  2VGN A;  2R5A A;  4HCC A;  1IGU A;  4J6Y A;  1ZX6 A;  3X28 B;  2YUO A;  2BIV A;  2RK1 A;  4JRP A;  4C92 G;  1PSF A;  1G3Y A;  2RHU A;  3ER0 A;  1G3S A;  3E9G A;  2DBK A;  1I1J A;  3QKJ A;  5FRN A;  2X4X A;  3PVL A;  3V7C A;  2A36 A;  4EO4 A;  1RAD B;  2QXF A;  2P84 A;  4PL6 A;  1MGQ A;  3A8O B;  1Y7X A;  3CD6 A;  3LH0 A;  2RD1 A;  4M77 B;  2GTJ A;  3VS7 A;  5KCH A;  2Q7H A;  1TS9 A;  2ENM A;  1YHQ Q;  5EG2 A;  2KGT A;  3CPW P;  3QNE A;  4EMH A;  2DK3 A;  3M4P A;  1I8F A;  3OS0 A;  4ZTZ B;  3DKM A;  3ZFJ A;  3CMA T;  5CK9 A;  4M78 D;  3A74 A;  2Q5I A;  3FB9 A;  1SES A;  1X2Q A;  1BBZ A;  1XNI A;  4N0A A;  4ELY C;  3C0C A;  1GCQ A;  2VWF A;  1EVL A;  4OLF A;  3EH2 A;  3CCQ T;  4NS5 A;  1YI2 Q;  3VQX A;  5LJ3 j;  2A3L A;  5LJ3 f;  5LJ3 h;  2OI3 A;  2DJQ A;  3GLX A;  4C0G A;  1SSH A;  4CH3 A;  4DEX A;  1XJW B;  2K6D A;  3HTR A;  3I5R A;  3QG1 A;  4YCU A;  3RKW A;  3W3S A;  4DBH A;  3OYC A;  3JCM f;  2CS7 A;  4B9W A;  3O5Z A;  1M2V B;  3JSC A;  1JXM A;  2XDD A;  4P71 A;  1USY A;  4EMK C;  4G85 A;  2MIO A;  4RUG A;  3X26 B;  2ED0 A;  1JBM A;  1H4S A;  2L0A A;  2K5I A;  5DLO A;  4XTX A;  2ZZF A;  3UGQ A;  2M16 A;  4X1V A;  1M2O A;  3ME9 A;  1EFN A;  2EQI A;  3UA7 A;  1UHC A;  1YIJ Q;  4BD3 A;  2CJ9 A;  4RG2 A;  2FG0 A;  3E2U A;  2BTT A;  3CBP A;  2ZT6 A;  1B70 A;  2Z0W A;  1L0W A;  3ZBD A;  3I56 Q;  4M77 G;  5GMK j;  3FLG A;  4IUU A;  1NJI C;  2JM9 A;  2MYS A;  4P72 A;  3VS3 A;  2CUB A;  3EGD A;  4MZT A;  4BI3 A;  4L59 A;  2DPP B;  4E51 A;  3RKX A;  2LRQ A;  5ELO A;  5IHI A;  3GIB A;  1JEG A;  2ZPH B;  1KC8 R;  1VYT A;  2DL8 A;  5FU7 B;  4RDX A;  3ASK A;  3CXC P;  2RQW A;  5J3B A;  2YUN A;  1JJC A;  2EBP A;  3OYL A;  1K9A A;  3LWH A;  5DM7 R;  4C0F A;  1K4U S;  2QEX Q;  4PLL A;  2EAY A;  4X9D A;  4M77 E;  2EWN A;  4YRQ A;  4IUT A;  1I81 A;  1ZA2 B;  3JB9 I;  1VQM Q;  2VKN A;  1W2B P;  2BE7 D;  4F7U F;  2C8M A;  2DNU A;  2K2M A;  1QQJ A;  3OD1 A;  1ZSZ C;  4HT9 A;  1Y96 A;  2OAW A;  5CIU A;  1UB4 A;  4HWR A;  4TVA A;  5GAO r;  2PZ1 A;  4GLM A;  3KXT A;  1I5L A;  1PYS A;  1I4K 1;  2NUT B;  1BYM A;  2OTL T;  4OB3 B;  1AWO A;  2P0K A;  3VYG A;  1G3W A;  4E7L A;  1H8K A;  4HT4 A;  5E3I A;  5A0D A;  1VQL T;  3VQW A;  4LD9 K;  4LDU A;  1WYD A;  2H3E B;  2FPE A;  3CCU T;  4LNP A;  4GY5 A;  1SRL A;  4C0D C;  1X6B A;  3A5Z A;  2ED1 A;  4R0K A;  2E1H A;  2WAC A;  3TRE A;  2HSP A;  1EQR A;  1J5W A;  2A28 A;  2KE9 A;  3J80 E;  3S3N A;  4DA4 A;  1QWE A;  2D8J A;  1UJ0 A;  4M78 B;  2ABL A;  1HSQ A;  1V29 B;  2EQM A;  3CCM T;  4KH0 B;  1PM3 A;  1C0A A;  2J6K A;  4HVV A;  1VQ5 Q;  2JTF A;  2KT8 A;  1YN8 A;  2F69 A;  3S3M A;  2ARS A;  1UGV A;  1WHL A;  2QAS A;  3A98 A;  4OMF B;  3NET A;  3EG2 A;  3VS2 A;  4CC3 A;  1IRX A;  3C4S A;  3QJ6 A;  2E4H A;  4M75 C;  1FYF A;  2ZIM A;  5HCK A;  1VQP T;  1NBE B;  4PG3 A;  4BB7 A;  1NYQ A;  3HXX A;  2F2W A;  3HFZ A;  3BFM A;  5GAM e;  3RKY A;  2KBT A;  1VQ6 Q;  1ZHI A;  3MQZ A;  3HTZ A;  3HRT A;  4BE0 A;  3CCS T;  1UHF A;  1OX9 A;  2CZ7 B;  2L89 A;  4JJN K;  5M9O A;  4N4I A;  2FO0 A;  5A2Q E;  3QDR B;  1M3C A;  5LJ3 g;  1VQ5 A;  1OV3 A;  2L3P A;  4H2Y A;  1M90 U;  1J3T A;  3ULR B;  1WFW A;  2EJ9 A;  4NL2 A;  3HXY A;  2OTL A;  3ZL7 C;  2DD4 A;  2RJC A;  1GCP A;  3CME A;  3HSB A;  1RAI B;  4RTU A;  5LJ3 e;  3S6W A;  5CKH A;  4J7I A;  1M30 A;  5GAN f;  2RHX A;  3JCM W;  2PUO B;  2LX9 A;  1AZG B;  2D9T A;  2V26 A;  4C5H A;  1KMM A;  3PCO A;  1MMN A;  1TUG B;  3KFV A;  1JJ2 P;  1HC7 A;  1X56 A;  4EDU A;  3OYJ A;  1E22 A;  4LDW A;  1TH7 A;  3R6N A;  1UFF A;  4RTX A;  1M90 R;  1PD1 A;  2E5A A;  1O9S A;  2X9H A;  3AHU A;  5KNN A;  3X25 B;  3GP8 A;  5C51 B;  1KD1 R;  4N0A C;  1BB9 A;  1YJ9 A;  3CCQ A;  4CI0 C;  2K5L A;  1PRM C;  3H41 A;  3CMA Q;  3SHW A;  1WXU A;  1M8V A;  2EPD A;  2DQ3 A;  4PJN A;  4QQ6 A;  4YRF A;  3H8Z A;  1VQ6 T;  2VAS A;  1M1F A;  2KMT A;  3P8B B;  1Q82 R;  4KH1 B;  4RG8 A;  4TWA A;  4YRG A;  3VS5 A;  2VYT A;  1KC8 C;  2OJ2 A;  2O31 A;  3OBW A;  3I7F A;  5GMK h;  5KYW A;  4RTY A;  4J9G A;  2JN0 A;  4HKE A;  3QHS A;  3M4G A;  3NEL A;  3QZ9 B;  2K79 A;  3G4S Q;  1XQH A;  2IY5 A;  4WTO B;  1C0M A;  2DIL A;  2QQB A;  1WX6 A;  1WA7 A;  4E6R A;  2FPD A;  4AG1 C;  3OMC A;  4C5G A;  1U8R A;  1K9M R;  1YP5 A;  1AWW A;  4XK8 E;  4LD6 A;  3TEG A;  4M78 F;  4XU1 A;  1IXD A;  4P74 A;  2ZPB B;  1OOT A;  2EL9 A;  3L4G A;  4ATO A;  2LJ0 A;  1Y0M A;  2CT4 A;  5FWB A;  3VS6 A;  4PJO B;  2V1R A;  4NOY A;  2CSQ A;  4M7D G;  5CKB A;  4WCI A;  3JB9 G;  4KUD K;  4BW9 A;  5CO7 A;  3TSZ A;  3CCE T;  2RPN A;  1NM7 A;  4M75 E;  1PC0 A;  4YRO A;  4OB0 B;  2D0Q B;  3E9H A;  2HQX A;  1T3S A;  5IHN A;  1QVF S;  2JT4 A;  1V76 A;  2RQR A;  2E6N A;  1Q81 C;  1QVG P;  1VQ8 A;  2HZY A;  2KYM A;  1RLP C;  4HA8 A;  4BUG A;  1T0J A;  4LVK A;  3M55 A;  4Y92 A;  4BE2 A;  3VS1 A;  3M57 A;  4C5E A;  4JZ3 A;  3IQL A;  3E1S A;  2COZ A;  2LQW A;  1HK9 A;  4XU3 A;  5GAN h;  4OML A;  5GAN j;  2M02 A;  2DF6 A;  4O5V A;  4BY6 C;  1UEB A;  1B7Y B;  4OP0 A;  1N5Z A;  1KSW A;  2EFI A;  4ESR A;  2QQ9 A;  3BDL A;  4P72 C;  1Q7Y U;  2RI5 A;  4PFO A;  3JCM X;  2AMC B;  2ZIN A;  4KGV B;  2DZC A;  2IVW A;  4IUP A;  2C0O A;  2DTH A;  1VQL Q;  4TVW A;  2J3M A;  4TTV A;  3NMZ C;  4XEM A;  2VXE A;  1PD0 A;  3SWN A;  1VQK A;  2XD0 A;  1MV0 B;  3WVE B;  4A4F A;  2CUD A;  4P74 C;  5ECA A;  5GAO l;  3MEA A;  1Z7M A;  2CP2 A;  4LDY A;  3OYK A;  3VQY A;  2RNA A;  3TEH A;  5CR2 A;  1ARK A;  3OY9 A;  2KK4 A;  3L2U A;  3BW1 A;  5GAN d;  4CH4 A;  4YRK A;  1RAB B;  4H02 A;  2H8H A;  2ZR3 A;  3CCE A;  2DU5 A;  3LC0 A;  1ZA1 B;  2HMA A;  2CZ0 B;  4XTU A;  1QLY A;  4YRN A;  1VQZ A;  2LP5 A;  2JVV A;  5GAN 6;  3MP8 A;  2E5K A;  4QW2 A;  1NYR A;  3SFM A;  3HFV A;  2X35 A;  3CCS A;  2OAU A;  3OYE A;  4WF2 A;  1N9S A;  3PVQ A;  3OB9 A;  2E10 A;  5GAO m;  3P8H A;  2QQA A;  4JRI A;  3JRZ A;  3DSQ A;  3M59 A;  2E3I A;  1K76 A;  1RI9 A;  1RAC B;  3RNJ A;  4MZP A;  3C94 A;  2DEU A;  1ATI A;  3QYH B;  5KE3 A;  1B34 B;  1D09 B;  1S1N A;  2AKL A;  2P5I A;  4LVM A;  4UPA A;  4YRJ A;  1M1K R;  1H92 A;  2MOX A;  1N8R U;  4YP0 A;  3CCL A;  3NTI A;  1GXI E;  3OYH A;  4ME7 A;  1AEY A;  2A8E A;  3HXV A;  2HQH A;  1EVK A;  2X4J A;  1WNL A;  2J7I A;  4XAX B;  2KAF A;  2HEQ A;  3CCJ T;  2ZT7 A;  3SD4 A;  4FYV B;  2O4X B;  4J9I A;  3OA6 A;  4NCX A;  2M51 A;  3TEH B;  2JZ2 A;  4M7A F;  2XTI A;  4TVY A;  2JTE A;  2K9G A;  3VV0 A;  4FU6 A;  4YRP A;  3OSV A;  2E65 A;  2HD0 A;  2KEA A;  3FRN A;  3SWN B;  1KQ2 A;  5FU7 C;  4J9E A;  2JOY A;  2BZ8 A;  1AWJ A;  3EFS A;  4PK4 A;  3OMG A;  3RES A;  3QO3 A;  3OS5 A;  4C0Z A;  3MET A;  4HWO A;  2KRN A;  4HVU A;  3FEO A;  3OYI A;  1B7T A;  4KR2 A;  3CCL Q;  3L1A A;  3VUB A;  1KQS P;  2YDL A;  5GMK l;  1KQ1 A;  1VQP Q;  2FZK B;  2O4X A;  4M75 F;  1JO8 A;  2OTL Q;  5GJV B;  4XTV A;  2KY9 A;  4ZTF A;  4O6J A;  1G83 A;  2EQJ A;  1VQ7 A;  2PUK B;  2OX7 A;  1I0C A;  3CBO A;  1ZSG A;  4OGE A;  5ELN A;  2F2X A;  5I2M A;  1YCY A;  5GAN e;  1VQ4 A;  1OX8 A;  1VYV A;  4F14 A;  3VBB A;  3G6E Q;  4BDY A;  4FW2 A;  2DX1 A;  4A53 A;  4IUQ A;  4C92 F;  2FB7 A;  2YUP A;  4P75 C;  2F1L A;  2XI9 A;  1M3A A;  1SSF A;  1TXQ A;  1ZUY A;  1VYU A;  4LUD A;  3CCV Q;  3PT9 A;  3C12 A;  1KHC A;  1Z7N A;  2ZZE A;  3UA6 A;  2X4W A;  3VYH B;  4X34 A;  4EPC A;  5GAN 8;  1YGB A;  3NTK A;  3I55 A;  3CCJ A;  2I4N A;  4MDX A;  1VQ4 Q;  4RTW A;  5IAY A;  1U06 A;  3L2V A;  1JQQ A;  1VIE A;  4IIO A;  3L4G B;  3MJX A;  1YB3 A;  2ZXF A;  3URG A;  4KRT A;  2MAM A;  3QTC A;  4D8D A;  4YDQ A;  4M75 B;  4IIM A;  5D6W A;  3VS4 A;  4P3O A;  1HJD A;  2FRW A;  1GGM A;  4LVI A;  1NJI R;  2M0Y A;  1NJ1 A;  4C8Q G;  3DB3 A;  4OB1 B;  1YJ9 Q;  4JDS A;  4L87 A;  5IH2 A;  3V7R A;  3DLM A;  2ZZG A;  5GAM d;  1G5V A;  2FPF A;  3RDV A;  1NG2 A;  2KRS A;  3RL6 A;  1SRM A;  3CCJ Q;  3HRS A;  5LJ5 f;  1PSE A;  5KYW B;  1IB8 A;  3CCS Q;  5L23 A;  2RHI A;  2LVM A;  2COY A;  4RTT A;  2RHS A;  4J9C A;  1Q86 U;  1S72 T;  1XOV A;  4BE1 A;  1BI2 A;  1K9M C;  4AFU C;  1UGP B;  1RAE B;  3OS1 A;  2H3J A;  4OMN A;  4A4H A;  4Y91 A;  1QKW A;  1QCF A;  2LQ8 A;  4C0D B;  4OMM A;  3H0H A;  2XGT A;  2M1H A;  4J83 A;  4DBQ A;  4ZTJ A;  1WIE A;  2EGC A;  3G6E A;  1RL2 A;  5GMK i;  4O2D A;  2RJD A;  4M7D A;  1MMD A;  2QEX T;  2K4Y A;  3I55 T;  3HFO A;  1NPP A;  3A8G B;  2PMF A;  4PJO F;  4M78 C;  1K0X A;  1IHV A;  2VGM A;  2O9S A;  1QVG S;  2ZPG B;  4C92 A;  4D8K A;  2C0I A;  1ZQ1 A;  3EFO B;  5KYU B;  1GCQ C;  1WXT A;  1PHT A;  1N9W A;  4D6W A;  2PVO B;  1G5I A;  3U23 A;  4J5Y A;  2MI6 A;  2DO3 A;  1VQM T;  3MPU B;  1D0Z A;  3FJ5 A;  2ZGW A;  3QII A;  1QCO A;  3QO5 A;  4Z88 A;  2DL7 A;  2VV5 A;  2VVK A;  1VUB A;  3HL8 A;  1ASZ A;  4FCY A;  1QE0 A;  1YIJ A;  5F5W A;  3TUP A;  4DBF A;  4ZGJ B;  3SB2 A;  1SHF A;  1USY C;  4P3P A;  1E7O A;  2SEM A;  3EFR A;  2J6O A;  3LX7 A;  2OTJ A;  5KYN A;  2PNI A;  4II1 A;  1RI0 A;  2XDP A;  1E1O A;  3T9N A;  1QVP A;  3NTH A;  3M0Q A;  2EJF A;  2P4T A;  1AVZ C;  2QDY B;  3PTA A;  3UDC A;  5IT9 E;  2GBQ A;  1H3H A;  4YRC A;  3RGL A;  1EX4 A;  4OMO A;  4E7Z A;  4FM4 B;  1OPK A;  3VRY A;  2RQT A;  3CC4 A;  3OYY A;  4MML A;  6AT1 B;  2EVR A;  1BCM A;  5LJ3 d;  4PJL A;  5CAI A;  2EYW A;  2HBW A;  2LT1 A;  3OW2 A;  1H4T A;  3CQT A;  4M7A A;  1K1Z A;  3UAT A;  2WSC E;  3QWY A;  4M78 A;  5FU6 C;  1YFT A;  2EYY A;  4YRL A;  4P73 C;  1LOJ A;  1KG1 A;  5GMK e;  2KT1 A;  3EFO A;  2ZTG A;  2DM1 A;  4C92 B;  5C6S A;  1MND A;  3RBB B;  3CCV T;  4DPG A;  2FYK A;  1FXX A;  3QO7 A;  3NEM A;  3BY7 A;  5C53 B;  5LJ5 g;  4PKC C;  4MMK A;  4BY6 B;  2OTJ T;  2L8D A;  4M7D B;  2EKO A;  2JMA A;  1LJO A;  2LJ1 A;  4BI8 B;  3CBM A;  2CP6 A;  3OYG A;  2I4M A;  3CC4 Q;  4Q6G A; 
#chains in the Genus database with same CATH homology
 2FL7 A;  2AKW A;  3PCO B;  4OB2 B;  1SER A;  2E64 A;  4K87 A;  5GAM g;  1VQP A;  2RHQ A;  1PYS B;  4DOV A;  1WJS A;  3DB4 A;  1WGS A;  1WLE A;  4HWS A;  3MP1 A;  3E19 A;  1YHQ A;  3MEU A;  2RHS B;  4P75 A;  3E9I A;  4K88 A;  4RKU E;  3OQ5 A;  5LJ5 d;  2MMP A;  4FIB A;  1BI1 A;  1K9M U;  2DTO A;  1Q81 U;  1JJC B;  1HXD A;  3CXC S;  4C8Q D;  3OS2 A;  2LDM A;  2LQK A;  3IKM B;  4YRR A;  3N5B B;  3CME T;  1UGS B;  2E5Q A;  5FRM A;  3QJY A;  1YFS A;  1OZ2 A;  4M75 A;  4KR3 A;  3LSQ A;  3H6Z A;  1W2B S;  4M75 D;  4YCW A;  1KQS S;  2C7I A;  4M7A C;  4YRM A;  1YJW A;  1YBY A;  3I56 T;  2DXC A;  4JLI A;  5J39 A;  3CD6 T;  1IRE B;  2YLC A;  4C92 D;  2JNG A;  3LLR A;  1NJI U;  4VUB A;  3WXM B;  2WSE E;  2ZCE A;  4QQG A;  2V8I A;  1YIT A;  2EIF A;  4J8O A;  5HGQ A;  3A5Z B;  1IL2 A;  4IUV A;  4PLI A;  3P8V A;  3G4S A;  4H2V A;  4E47 A;  3NEN A;  2DU7 A;  4E7I A;  1X6O A;  4M7D C;  2QEX A;  4WJ3 M;  4MDW A;  2CJA A;  4C92 C;  2L5Q A;  1X75 C;  4RQE A;  2E12 A;  1Y07 A;  2QQS A;  5FU6 B;  5GAM h;  1N8R C;  3M4Q A;  1VQM A;  1YI2 T;  1OZ3 A;  2A7Y A;  3JCM d;  3I56 A;  4H2W A;  2LCL A;  4C92 E;  1U1S A;  5D6X A;  3PFS A;  3JCM P;  4TQF A;  2GFU A;  5DY9 A;  2ZR2 A;  3RIR A;  5GAO q;  3P8Y A;  1W2B A;  3LSS A;  3UFG A;  5KH6 A;  1B70 B;  3IKL A;  2ARU A;  1M1K C;  3A7R A;  1K8A U;  3OYA A;  3ERR A;  5D6Y A;  2BUD A;  2L3R A;  4PJO D;  4Q15 A;  1B34 A;  4JS4 A;  1YIT T;  4C8Q F;  5AYF A;  4QQD A;  2XID A;  1EIY B;  3QBY A;  1ASY A;  2K57 A;  4JS5 A;  3UWN A;  2AHJ B;  3A32 A;  3G4S T;  4CRI A;  2ART A;  3JCM b;  3TCJ A;  2DXB A;  4KUL A;  1U1T A;  4RCB A;  1VQO T;  3LGL A;  4CH5 A;  3FDR A;  5CQY A;  1WU7 A;  4XTZ A;  2FHD A;  1M90 C;  2ZZD A;  4PJO C;  3LGF A;  5FLX E;  1H4V B;  3RUX A;  4LDV A;  3IG2 A;  2ALY A;  4E7H A;  3BDU A;  3PGG A;  5A0L A;  3PMT A;  4M77 A;  3M9Q A;  3UT1 A;  2KDS A;  2O01 E;  3DLL A;  3GNF B;  2B8A A;  4L6V 5;  4MZM A;  5CQX A;  5LL6 S;  1G3T A;  4OF1 A;  3VKI A;  1Q86 C;  2AMC A;  2ODR D;  5GAN 5;  3FJP A;  4M75 G;  11AS A;  2CKK A;  2LTO A;  4JLG A;  3HHT B;  3HXW A;  4K86 A;  3CC7 T;  4ZGE B;  2V8J A;  1LNX A;  12AS A;  1VQ6 A;  1EOV A;  1UGQ B;  1B7Y A;  3HY1 A;  3A8L B;  3MCA B;  2PVG B;  3M54 A;  1Y71 A;  4X9C A;  4P5N A;  4A4E A;  1B8A A;  2XKO C;  1IZ6 A;  2P0L A;  2EQU A;  4FL6 A;  1VQ5 T;  1D3B B;  3JB9 F;  3UPU A;  1FWZ A;  2NLU A;  5HK3 A;  2RK2 A;  3CCL T;  4ZIB A;  3CPW S;  1KMN A;  2PME A;  4LNS A;  5GAN 2;  4M78 E;  4JRK A;  4LVL A;  2DTI A;  4XTY A;  2G3R A;  1NNH A;  2E3C A;  3RF1 A;  4M7D D;  1YFR A;  3L2R A;  3HP9 A;  3KBG A;  5GAN 3;  2XG8 D;  4PJO A;  1K8A C;  1OI1 A;  5GAO n;  4QVC A;  1M4Z A;  1M1K U;  2XIC A;  2QHU A;  3A7A A;  3CPF A;  1K73 C;  2HBP A;  1YJW T;  4FSX A;  3CC7 A;  1KQS A;  3CC2 A;  5A0G A;  3P8D A;  4Z02 A;  4YYE A;  3GF5 A;  4EX5 A;  1KD1 C;  2WSF E;  3PMI A;  5K1X A;  2IY5 B;  2RM4 A;  1KHI A;  2MF2 A;  1M5Q 1;  3KUF A;  3MF2 A;  1EIF A;  4GLK A;  5CVI A;  4M7A E;  3X20 B;  4C5I A;  3JCM V;  3OSS C;  3RMS A;  3R07 A;  4Q5W A;  2DEQ A;  1ADJ A;  3QXE B;  3HXU A;  3REX A;  4M7D E;  4QVD A;  1OYX A;  1QP2 A;  2RH2 A;  2RI2 A;  2VUB A;  3HPW A;  2HQE A;  2RHY A;  3BJU A;  1X55 A;  4V2S A;  2Q7E A;  3MHX A;  2R58 A;  2M0O A;  4KT0 E;  4M77 D;  3OYB A;  1YI2 A;  2ZPE B;  4KBM B;  4RMF A;  2P0P A;  4OGC A;  1MHN A;  4RCC A;  3CCV A;  1ADY A;  2QTX A;  2QI2 A;  3A5Y A;  4H2U A;  2MWO A;  4ZN3 A;  3KFU A;  3JB9 J;  3CMA A;  3MF1 A;  4HVC A;  1Q82 C;  3HXZ A;  1VQ9 T;  1FX7 A;  3CPW A;  3A31 A;  4A4G A;  3LYI A;  3JB9 D;  2KQW A;  1AHJ B;  3CMQ A;  2PVD B;  4LDX A;  4G84 A;  1K73 U;  4PHC A;  1BIA A;  3PIP A;  3FIF A;  3HFZ B;  2ODR C;  4WJ4 A;  2IG0 A;  2KSS A;  4M7D F;  3A7U A;  1WPY A;  2EYQ A;  3RMQ A;  4F7U A;  2ZT8 A;  3REU A;  1JB0 E;  5HK0 A;  1WJR A;  5I21 A;  4N4G A;  4M78 G;  1VQO A;  3GOX A;  2ZIO A;  1W4S A;  1LYL A;  3QZ5 B;  4HWT A;  1VQK T;  3C95 A;  4C8Q B;  4E7J A;  2Y4X A;  1R8O B;  3V8K A;  1QW1 A;  2ZPI B;  3QYG B;  4WI1 A;  2QA4 A;  4JRQ A;  2XHC A;  3WVD B;  4CH6 A;  3TU4 K;  1VQ8 T;  3MP6 A;  1YJ9 T;  4N4H A;  3JCM h;  2GQV A;  1E1T A;  1B76 A;  4B9X A;  4HCZ A;  4PNO A;  3SDZ A;  4ELZ C;  5GAN 4;  3M58 A;  2F5K A;  4F7U E;  4J15 A;  4KQE A;  2I2L A;  4TVA B;  1Y96 B;  2K2V A;  4C8Q C;  4UP9 A;  5CCA A;  4M7A D;  2J3L A;  4XU2 A;  3G71 T;  3JCM J;  3TEE A;  4IUR A;  4M77 F;  1WJQ A;  5GAN g;  3V7S A;  1EIY A;  2DD5 A;  3JAM E;  2JUF A;  3CC4 T;  4CS2 A;  2GCX A;  2RI3 A;  2QHT A;  4QVZ A;  1QP3 A;  2CZ6 B;  4ZGD B;  5DLQ E;  4A4K A;  3L42 A;  2KVQ G;  3RER A;  3V8J A;  4KUI A;  3A8M B;  2QA4 T;  1Q82 U;  4LVJ A;  5HKC A;  1NJ8 A;  4HCB A;  5L8R E;  4UP7 A;  5HY6 A;  1M9S A;  5C0M A;  3QSU A;  3MEY A;  1BKB A;  1W66 A;  5LJ5 j;  2XDB A;  2LT4 A;  3J81 E;  1KC8 U;  1ZBX A;  3M53 A;  1KD1 U;  4ZN1 A;  4J6X A;  3QPH A;  4XU0 A;  5C52 B;  2JTM A;  3G71 A;  3GNG A;  2GF7 A;  4BDZ A;  2XK0 A;  3M4Y A;  3P8T A;  1KOG A;  5LJ5 h;  3JB9 H;  4P73 A;  4YPF A;  1BBU A;  3HRK A;  3EAE A;  2RJE A;  3HRU A;  1EFW A;  3ZEH A;  1UGR B;  2RB6 A;  4E7K A;  2CZ1 B;  1O75 A;  2Y4Y A;  2DDZ A;  5LJ5 e;  3M56 A;  2PU9 B;  1G5H A;  3QUI A;  1X01 A;  3JCM Q;  3G1Z A;  2DIQ A;  2RO0 A;  3OYF A;  1H4Q A;  3WQZ A;  3MO8 A;  2R57 A;  1QF6 A;  3CCR T;  5I2S A;  5IN1 A;  1VQN T;  4YRT A;  4F7U G;  2ZT5 A;  3PNW C;  2I4L A;  3IAL A;  2E41 A;  2LCC A;  3CEY A;  4ZTU B;  2CJB A;  3VUZ A;  5GAO p;  4A54 A;  3CXC A;  1NPR A;  4EMG A;  3L2W A;  3QO8 A;  3L2Z A;  2DXT A;  2Q7G A;  3OBY A;  4DOW A;  1N27 A;  5GMK m;  5GAM f;  1VQ4 T;  5GAM j;  3OYN A;  1SET A;  3S3O A;  5CKD A;  3V8L A;  3INZ A;  3MEW A;  1VQL A;  4PJO G;  4X5O A;  2R5M A;  3CCU A;  4TVR A;  1H3Z A;  2EQK A;  1JJ2 A;  1BBW A;  2RHQ B;  3OYM A;  2AKW B;  3X24 B;  2X4Y A;  4XTW A;  3CCM A;  2DIG A;  4Y28 E;  2ZNJ A;  4BAC A;  3CCR A;  2HNI A;  3PZC A;  2HAX A;  4PJO E;  3OYD A;  4P71 C;  4DQ2 A;  1BI3 A;  5K1P A;  4UC4 A;  4OVA A;  3R6O A;  1X2G A;  4R56 A;  4YRS A;  1JRI A;  4CS3 A;  2D6F A;  2QQR A;  3OW2 S;  3FC3 A;  1G51 A;  2ZCF B;  2BKD N;  3CC2 T;  4R55 A;  4YTL A;  2QHV A;  2Q5H A;  4M7A B;  4C8Q A;  2EJG A;  3SWN C;  2RJF A;  4H2T A;  3RAC A;  3JCM e;  4J7F A;  3HY0 A;  3NFC A;  4F7U B;  2G4C A;  2XU8 A;  1NE8 A;  4H2X B;  2CYZ B;  1N6A A;  1XTD A;  2DQ0 A;  3A8H B;  1DJ7 B;  2RHZ A;  3O8V A;  1WQW A;  1VIF A;  1E24 A;  2FVU A;  2DAQ A;  2DJZ A;  4P3N A;  1RIQ A;  4J6W A;  2YHT A;  2E70 A;  1X54 A;  5FRO A;  4EMK A;  2MWP A;  3ICA A;  5CKE A;  1P92 A;  1QVF A;  4EMK B;  2K3Y A;  4FT2 A;  2NS6 A;  3VJP A;  3F70 A;  1QVG A;  3UGT A;  2YRV A;  1YJN A;  3JCM c;  4TQD A;  2DXU A;  2M9U A;  1D3B A;  3VQV A;  1NZ9 A;  1NJ6 A;  1N9R A;  2DZ9 A;  1VQ9 A;  3G7Z A;  5GAN 7;  2K5F A;  2C06 A;  4RQF A;  2I4O A;  4AH6 A;  3JCM g;  4BWA A;  2DVE A;  4H2X A;  4NL3 A;  5KCO A;  1YHQ T;  2CGH A;  3LW5 E;  2P0Q A;  1S72 A;  2RA2 A;  3LWI A;  2K3X A;  4M7A G;  3J7A F;  1BIB A;  1WQ7 A;  2VXF A;  5KE2 A;  5J26 A;  4M77 C;  4RMO A;  2LNV A;  1Q7Y C;  3G6E T;  4YCV A;  2ZPF B;  4UP8 A;  4YRI A;  1M1G A;  4XQ3 A;  4XEO A;  3E9F A;  1H64 1;  4HT8 A;  2PQW A;  3HFN A;  4YRE A;  2ALY B;  1X2H A;  1VQN A;  2VC8 A;  2V8K A;  4FT4 A;  1HTT A;  1SRY A;  3MEV A;  4CS4 A;  4H2S A;  4C8Q E;  3GPL A;  1BI0 A;  3Q1J A;  2LC4 A;  1NJ5 A;  1YIJ T;  4IKF A;  2Y90 A;  2YLB A;  2ZNI A;  1JJ2 S;  2DKG A;  2GFA A;  3VU3 C;  1YJN T;  3HRI A;  2F5T X;  2E6Z A;  3HKS A;  2CIM A;  1VQ7 T;  2QHS A;  3PIO A;  5CKF A;  4HWP A;  4L5G A;  3UH0 A;  4JUV A;  3L2Q A;  1NJ2 A;  3M5A A;  4BI4 A;  2VGN A;  4HCC A;  2R5A A;  4J6Y A;  3X28 B;  2BIV A;  2RK1 A;  4JRP A;  4C92 G;  1PSF A;  1G3Y A;  2RHU A;  3ER0 A;  1G3S A;  3E9G A;  3QKJ A;  5FRN A;  2X4X A;  3V7C A;  4EO4 A;  2QXF A;  4PL6 A;  1MGQ A;  3A8O B;  1Y7X A;  3CD6 A;  3LH0 A;  2RD1 A;  4M77 B;  5KCH A;  2Q7H A;  5EG2 A;  3QNE A;  4EMH A;  2DK3 A;  3M4P A;  1I8F A;  3OS0 A;  4ZTZ B;  3DKM A;  3ZFJ A;  3CMA T;  5CK9 A;  4M78 D;  3A74 A;  2Q5I A;  3FB9 A;  1SES A;  1XNI A;  4N0A A;  4ELY C;  1EVL A;  4OLF A;  3CCQ T;  4NS5 A;  3VQX A;  5LJ3 j;  2A3L A;  5LJ3 f;  5LJ3 h;  3GLX A;  4C0G A;  4CH3 A;  3QG1 A;  4YCU A;  3RKW A;  3W3S A;  3OYC A;  3JCM f;  2CS7 A;  4B9W A;  3JSC A;  2XDD A;  4P71 A;  1USY A;  4EMK C;  3X26 B;  1JBM A;  1H4S A;  2K5I A;  5DLO A;  4XTX A;  2ZZF A;  3UGQ A;  2M16 A;  3ME9 A;  4BD3 A;  2CJ9 A;  4RG2 A;  3CBP A;  2ZT6 A;  1B70 A;  1L0W A;  3ZBD A;  4M77 G;  5GMK j;  3FLG A;  4IUU A;  1NJI C;  4P72 A;  4MZT A;  4BI3 A;  4L59 A;  2DPP B;  4E51 A;  3RKX A;  2LRQ A;  5ELO A;  3GIB A;  2ZPH B;  5FU7 B;  4RDX A;  3ASK A;  5J3B A;  1JJC A;  3OYL A;  3LWH A;  5DM7 R;  4C0F A;  4PLL A;  2EAY A;  4X9D A;  4M77 E;  2EWN A;  4YRQ A;  4IUT A;  1I81 A;  3JB9 I;  4F7U F;  2C8M A;  3OD1 A;  4HT9 A;  1Y96 A;  5CIU A;  1UB4 A;  4HWR A;  4TVA A;  5GAO r;  3KXT A;  1I5L A;  1PYS A;  1I4K 1;  1BYM A;  2OTL T;  4OB3 B;  2P0K A;  3VYG A;  1G3W A;  4E7L A;  4HT4 A;  5E3I A;  5A0D A;  1VQL T;  3VQW A;  4LD9 K;  4LDU A;  1WYD A;  3CCU T;  4GY5 A;  4C0D C;  3A5Z A;  2E1H A;  2WAC A;  3TRE A;  1EQR A;  1J5W A;  3J80 E;  3S3N A;  4DA4 A;  4M78 B;  1V29 B;  2EQM A;  3CCM T;  1C0A A;  2JTF A;  2F69 A;  3S3M A;  2ARS A;  4OMF B;  3NET A;  3C4S A;  3QJ6 A;  4M75 C;  1FYF A;  2ZIM A;  1VQP T;  4PG3 A;  4BB7 A;  1NYQ A;  3HXX A;  3HFZ A;  3BFM A;  5GAM e;  3RKY A;  1ZHI A;  3MQZ A;  3HTZ A;  3HRT A;  4BE0 A;  3CCS T;  2CZ7 B;  4JJN K;  2L89 A;  5M9O A;  4N4I A;  5A2Q E;  3QDR B;  5LJ3 g;  1VQ5 A;  4H2Y A;  1M90 U;  2EJ9 A;  4NL2 A;  3HXY A;  2OTL A;  2DD4 A;  2RJC A;  3CME A;  3HSB A;  5LJ3 e;  3S6W A;  5CKH A;  4J7I A;  5GAN f;  2RHX A;  3JCM W;  2PUO B;  2LX9 A;  2D9T A;  4C5H A;  1KMM A;  3PCO A;  1HC7 A;  1X56 A;  4EDU A;  3OYJ A;  1E22 A;  4LDW A;  1TH7 A;  2E5A A;  1O9S A;  3AHU A;  5KNN A;  3X25 B;  3GP8 A;  5C51 B;  4N0A C;  1YJ9 A;  3CCQ A;  4CI0 C;  2K5L A;  1M8V A;  2DQ3 A;  4QQ6 A;  4YRF A;  3H8Z A;  1VQ6 T;  1M1F A;  2KMT A;  3P8B B;  4RG8 A;  4TWA A;  4YRG A;  2VYT A;  1KC8 C;  3OBW A;  3I7F A;  5GMK h;  2JN0 A;  4HKE A;  3QHS A;  3M4G A;  3NEL A;  3QZ9 B;  1XQH A;  2IY5 A;  2QQB A;  3OMC A;  4C5G A;  1U8R A;  4XK8 E;  4LD6 A;  3TEG A;  4M78 F;  4XU1 A;  4P74 A;  2ZPB B;  2EL9 A;  3L4G A;  4ATO A;  4PJO B;  4NOY A;  4M7D G;  5CKB A;  3JB9 G;  4KUD K;  4BW9 A;  5CO7 A;  3CCE T;  4M75 E;  4YRO A;  4OB0 B;  2D0Q B;  3E9H A;  2HQX A;  1QVF S;  2E6N A;  1Q81 C;  1VQ8 A;  4HA8 A;  4BUG A;  4LVK A;  3M55 A;  4BE2 A;  3M57 A;  4C5E A;  3E1S A;  1HK9 A;  4XU3 A;  5GAN h;  5GAN j;  4O5V A;  4BY6 C;  1UEB A;  1B7Y B;  4OP0 A;  2EFI A;  2QQ9 A;  3BDL A;  4P72 C;  1Q7Y U;  2RI5 A;  3JCM X;  2AMC B;  2ZIN A;  2DZC A;  2IVW A;  4IUP A;  2DTH A;  4TVW A;  2J3M A;  4TTV A;  4XEM A;  2VXE A;  3SWN A;  1VQK A;  2XD0 A;  3WVE B;  4A4F A;  4P74 C;  5GAO l;  3MEA A;  1Z7M A;  4LDY A;  3OYK A;  3VQY A;  3TEH A;  5CR2 A;  3OY9 A;  2KK4 A;  3L2U A;  3BW1 A;  5GAN d;  4CH4 A;  4YRK A;  4H02 A;  2ZR3 A;  3CCE A;  2DU5 A;  3LC0 A;  2CZ0 B;  4XTU A;  4YRN A;  1VQZ A;  2JVV A;  5GAN 6;  3MP8 A;  4QW2 A;  1NYR A;  3SFM A;  3HFV A;  2X35 A;  3CCS A;  2OAU A;  3OYE A;  4WF2 A;  1N9S A;  3OB9 A;  2E10 A;  5GAO m;  3P8H A;  2QQA A;  4JRI A;  3JRZ A;  3DSQ A;  3M59 A;  4MZP A;  3C94 A;  1ATI A;  3QYH B;  5KE3 A;  1B34 B;  2P5I A;  4LVM A;  4UPA A;  4YRJ A;  1N8R U;  4YP0 A;  3CCL A;  3NTI A;  1GXI E;  3OYH A;  4ME7 A;  2A8E A;  3HXV A;  1EVK A;  2X4J A;  1WNL A;  4XAX B;  2KAF A;  3CCJ T;  2ZT7 A;  3SD4 A;  2O4X B;  3OA6 A;  4NCX A;  3TEH B;  2JZ2 A;  4M7A F;  2XTI A;  4TVY A;  3VV0 A;  4FU6 A;  4YRP A;  3OSV A;  2E65 A;  2HD0 A;  3FRN A;  3SWN B;  1KQ2 A;  5FU7 C;  2JOY A;  3EFS A;  3OMG A;  3RES A;  3QO3 A;  3OS5 A;  4C0Z A;  3MET A;  4HWO A;  3FEO A;  3OYI A;  4KR2 A;  3L1A A;  3VUB A;  5GMK l;  1KQ1 A;  2O4X A;  4M75 F;  4XTV A;  2KY9 A;  4ZTF A;  4O6J A;  2EQJ A;  1VQ7 A;  2PUK B;  3CBO A;  4OGE A;  5ELN A;  5I2M A;  1YCY A;  5GAN e;  1VQ4 A;  3VBB A;  4BDY A;  4A53 A;  4C92 F;  4IUQ A;  2FB7 A;  4P75 C;  2XI9 A;  1SSF A;  3PT9 A;  3C12 A;  1KHC A;  1Z7N A;  2ZZE A;  2X4W A;  3VYH B;  1YGB A;  4X34 A;  4EPC A;  5GAN 8;  3NTK A;  3I55 A;  3CCJ A;  2I4N A;  4MDX A;  5IAY A;  3L2V A;  1VIE A;  3L4G B;  1YB3 A;  2ZXF A;  3URG A;  2MAM A;  3QTC A;  4YDQ A;  4M75 B;  5D6W A;  4P3O A;  1GGM A;  4LVI A;  1NJ1 A;  4C8Q G;  3DB3 A;  4OB1 B;  4JDS A;  4L87 A;  3V7R A;  3DLM A;  2ZZG A;  5GAM d;  1G5V A;  3RL6 A;  3HRS A;  5LJ5 f;  1PSE A;  2RHI A;  2LVM A;  2RHS A;  1Q86 U;  1S72 T;  1XOV A;  4BE1 A;  1BI2 A;  1K9M C;  1UGP B;  3OS1 A;  2H3J A;  4A4H A;  4Y91 A;  2LQ8 A;  4C0D B;  2XGT A;  2M1H A;  4J83 A;  4ZTJ A;  3G6E A;  1RL2 A;  5GMK i;  4O2D A;  2RJD A;  4M7D A;  2QEX T;  2K4Y A;  3I55 T;  3HFO A;  1NPP A;  3A8G B;  2PMF A;  4PJO F;  4M78 C;  2VGM A;  1QVG S;  2ZPG B;  4C92 A;  1ZQ1 A;  1N9W A;  4D6W A;  2PVO B;  1G5I A;  4J5Y A;  2MI6 A;  2DO3 A;  1VQM T;  2ZGW A;  3QII A;  3QO5 A;  2VV5 A;  1VUB A;  3HL8 A;  1ASZ A;  1QE0 A;  1YIJ A;  5F5W A;  3TUP A;  4ZGJ B;  3SB2 A;  1USY C;  4P3P A;  3EFR A;  3LX7 A;  2OTJ A;  4II1 A;  1RI0 A;  2XDP A;  1E1O A;  3T9N A;  1QVP A;  3NTH A;  2EJF A;  2P4T A;  2QDY B;  3PTA A;  3UDC A;  5IT9 E;  4YRC A;  3RGL A;  4FM4 B;  3CC4 A;  3OYY A;  4MML A;  5LJ3 d;  5CAI A;  2LT1 A;  3OW2 A;  1H4T A;  4M7A A;  2WSC E;  4M78 A;  5FU6 C;  1YFT A;  4YRL A;  4P73 C;  1LOJ A;  1KG1 A;  5GMK e;  2ZTG A;  4C92 B;  3CCV T;  5C6S A;  4DPG A;  2FYK A;  1FXX A;  3QO7 A;  3NEM A;  3BY7 A;  5C53 B;  5LJ5 g;  4PKC C;  4MMK A;  4BY6 B;  2OTJ T;  2L8D A;  4M7D B;  2EKO A;  1LJO A;  4BI8 B;  3CBM A;  3OYG A;  2I4M A;  4G85 A;  4Q6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...