3EFRA

Biotin protein ligase r40g mutant from aquifex aeolicus in complex with biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGGLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
total genus 67
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efrA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efrA01
4P72C 2VXFA 4YYEA 2RD1A 3JCMg 1YCYA 2DVEA 4NCXA 5ELNA 4P74A 5C52B 4H2VA 2EJ9A 3RIRA 4F7UF 1KOGA 4O2DA 5LJ3f 4CH4A 4KQEA 3HTZA 4PJOD 2EJFA 3HXUA 3I7FA 3QUIA 3HXYA 3L1AA 2AKWA 4YRIA 2ZIOA 3WQZA 4J5YA 1ADYA 4LNSA 4ZTUB 1JBMA 1BBWA 1PYSB 3V8LA 4P72A 5C53B 4YCVA 1IL2A 2ZNJA 2J3LA 2ZXFA 3JCMc 1I4K1 2QHVA 5HGQA 3EFSA 3E9HA 3TEGA 3A74A 2E3CA 1USYA 5GMKh 3JB9J 4RDXA 3HSBA 2FB7A 4EMKA 4TVWA 5GAN4 2DZCA 4XEMA 1B8AA 4TWAA 3FB9A 4M78G 4P73C 1U1TA 5C51B 4C8QA 2RM4A 4PNOA 2JN0A 1D3BA 2YLCA 4EMGA 5GANg 1NYQA 4C92B 4M75B 1WLEA 4H2YA 3LSSA 4CH6A 3TUPA 2EAYA 2DQ0A 3HFVA 5GAMd 1EVLA 4A54A 4H2TA 3HXWA 5LJ3j 3UGTA 2QHTA 4WJ3M 3HXVA 3CMQA 4P3OA 5GMKj 3V7SA 5CAIA 3BDUA 2E10A 3JCMV 4A53A 3L4GA 2DKGA 2ZTGA 4WF2A 1NJ8A 4PHCA 3JCMh 3TEHA 4M78D 4M7DF 3SWNC 2ZZEA 3LSQA 4C8QG 4J15A 4YREA 3HXZA 3HFOA 4V2SA 4YRSA 4XTVA 2Q7GA 1G5HA 2ZR2A 4NOYA 5ELOA 2DTOA 1HTTA 4YPFA 2VXEA 4XTWA 1WNLA 5LJ5h 4M75D 1ADJA 4M75G 2AMCB 2G4CA 3MF2A 1NJ1A 2XTIA 4XTZA 4C92A 5GAMh 4M77G 1NNHA 4QVDA 2QHUA 3HFZB 2DJZA 4M75A 1Z7NA 3A7AA 2ZT7A 2Q7HA 4AH6A 2ALYA 4C8QB 2ZZFA 4TVYA 2P0LA 3HFNA 4M7AE 3IALA 3P8VA 1B76A 4XU3A 4EMKB 1J5WA 4K87A 3A7UA 1NJ6A 2CJ9A 4WI1A 4M78F 4M7DD 4M78A 2I4OA 3LC0A 3JB9G 3VU3C 3AHUA 3W3SA 1SESA 2CJAA 2DXTA 2YLBA 4Q6GA 3HFZA 5GAOp 4YRPA 4M7DC 4F7UE 1E1TA 4N0AC 1USYC 1X54A 4M7AB 4EMHA 4H2XA 1E1OA 3M4PA 2E41A 4HWSA 4N0AA 2PMEA 4J6YA 5GANe 3RKXA 3P8TA 5LJ3d 1YFSA 4C8QD 4UP9A 3HY1A 5GANd 4XQ3A 3JCMX 5LJ3e 4RCCA 2RB6A 1B7YB 4EO4A 4HWTA 2ZR3A 2PMFA 4C8QE 4YRQA 3PCOB 3HXXA 4YRMA 4YRFA 1HK9A 3QO8A 1I8FA 4UP8A 1WPYA 2Q5HA 2QHSA 1JJCA 4C92E 1I5LA 3NENA 3JCMe 3VQVA 3PCOA 3QSUA 5GAMf 4YRGA 4HT8A 4H2WA 5GAN3 1LYLA 4M78E 2CJBA 3QHSA 1EQRA 4E51A 3HRKA 3QNEA 3ERRA 1ASZA 5DY9A 3BFMA 2RHSB 3RKYA 4NL3A 1H4SA 1M8VA 4L87A 1EIYA 5LJ5e 3A32A 1KQ1A 2CGHA 3RESA 1SETA 12ASA 4H02A 4UPAA 4RQFA 1HXDA 4C92C 3JB9F 4JUVA 4M75E 3JB9H 4M7DG 2QTXA 2RHQA 4M77C 4M77F 3RGLA 4M7DB 4CS2A 2J3MA 1EOVA 2DDZA 4PJOC 3JCMW 4YCWA 4JRIA 4M7AC 4HWRA 4M77D 1N9WA 3A7RA 1SRYA 4Q15A 1B70B 4CH3A 2DQ3A 11ASA 2HNIA 4DPGA 5GAOr 4M7AD 4HWOA 3BJUA 4F7UG 5GAOn 1QE0A 4CH5A 2DXUA 1YGBA 4K86A 1FYFA 2RHQB 4M75F 1W66A 1BIBA 4MMLA 4NL2A 1NJ2A 3RERA 4F7UA 4M78C 5LJ5g 2ZT8A 5GAN5 4TTVA 3FIFA 2RHSA 1B70A 1YFRA 3P8YA 4XU2A 1I81A 3IKMB 2ARTA 1N9RA 3MEYA 4M7DA 1H4VB 5LJ3g 2ZT5A 4Y91A 4XU0A 4YRCA 2YHTA 3RL6A 4KR2A 1ATIA 1B7YA 1WQ7A 3VQWA 4YRNA 1B34B 4P3NA 4PG3A 4EX5A 1U1SA 4RCBA 3PZCA 4HT9A 1Z7MA 3M4QA 1H4TA 4KR3A 4OLFA 3RKWA 4X9DA 4C92D 3SB2A 2I2LA 3UH0A 4M7AA 1SERA 1RIQA 4C8QF 4X9CA 3V8KA 1G51A 2DTIA 4M77A 1C0AA 1Y96B 1X55A 3G1ZA 4M7AG 5KNNA 4P74C 4PJOE 4OP0A 2ODRD 3JB9I 2ZGWA 1E22A 5GAOq 4M78B 2Q7EA 4YROA 4XEOA 5K1XA 2EL9A 3SWNA 4YRLA 3QTCA 1KMNA 2ZIMA 5GANf 2I4MA 1NJ5A 5GAN2 1YFTA 3V8JA 5GAN6 4QVCA 1WYDA 1X2GA 2Q5IA 2ZINA 1TH7A 4H2XB 1ASYA 1YB3A 1WU7A 2C7IA 5K1PA 1N9SA 4YDQA 3HY0A 4BWAA 3JCMJ 3BW1A 2AMCA 3SWNB 3JCMP 3FJPA 5GAMg 4XTXA 2DU5A 2DZ9A 2AKWB 3VQYA 5GAOl 1LNXA 3JCMf 4P71A 4PJOG 5LJ5j 2ALYB 1X2HA 4J6XA 4RQEA 4CS3A 4JRKA 3TEHB 1E24A 4PJOB 4YRTA 2E5AA 4YRKA 4YCUA 3REXA 3UFGA 4H2UA 3L4GB 3M4GA 4EMKC 1KMMA 3NEMA 1Y96A 1M5Q1 1G5IA 4ZTZB 2EWNA 2CIMA 2VC8A 4G85A 3UGQA 2DU7A 3V7CA 2ODRC 3MF1A 2ZCEA 4C92F 4HA8A 1X01A 4X5OA 2IY5A 1JRIA 3JCMb 3ICAA 3QO5A 4PJOA 3RF1A 2ZT6A 4CS4A 1EFWA 3BY7A 3QO3A 4YRJA 2Y90A 2EJGA 1GGMA 3RACA 3EFRA 5GAMe 5E3IA 2FYKA 3E9IA 5GANh 2E64A 3IG2A 1X56A 3PGGA 2K57A 4DQ2A 3A5ZA 5F5WA 4M75C 3GIBA 1H641 2E1HA 3KFUA 3R07A 3A5YA 4RMFA 3OD1A 2ZNIA 5LJ3h 2I4LA 1LJOA 3JCMd 1D3BB 4F7UB 4HVCA 1EVKA 3VBBA 4HWPA 4M77E 1MGQA 4P75C 4M7DE 3RUXA 1NYRA 1KQ2A 4P3PA 5GAOm 4YP0A 4JLIA 4MMKA 3HRIA 4C92G 5LJ5d 3NETA 4TQDA 5GANj 4XTYA 4P71C 4ZIBA 1LOJA 3JB9D 4P75A 1BBUA 3A31A 2ZZGA 5GMKi 1L0WA 2E65A 4XTUA 4J6WA 5GAN8 1JJCB 1H4QA 4M77B 4C8QC 3VQXA 1QF6A 5GAN7 4P73A 2XGTA 2DEQA 5GAMj 3L2ZA 1HC7A 1PYSA 1BIAA 4H2SA 3INZA 2P5IA 4TQFA 2RA2A 4XU1A 3DSQA 2ARSA 5I21A 3V7RA 4TVAB 4M7AF 3REUA 5GMKl 4K88A 4BW9A 3JCMQ 1EIYB 1B34A 1VQZA 2IY5B 4YRRA 2ARUA 2C8MA 3IKLA 4WJ4A 4TVAA 5GMKm 4G84A 4UP7A 1WQWA 2I4NA 5GMKe 5LJ5f 3QO7A 4PJOF 2DTHA 3NELA
chains in the Genus database with same CATH superfamily
2VV5A 3OB9A 1X2KA 4YYEA 2RD1A 2KAFA 1K8AR 5C52B 4XK8E 4H2VA 2EJ9A 3OSSC 4F7UF 4IIMA 2HQXA 5DLOA 3CPWS 1PRMC 3PVQA 1UHFA 1HSQA 3DB3A 1QVPA 2EVRA 4RTVA 1G5VA 3HXYA 3L1AA 1KQSA 2F69A 4LNSA 3OBYA 1JBMA 5L8RE 5J3BA 1SHGA 3V8LA 1BK2A 5C53B 2DJQA 1OPKA 1PKTA 1VQNQ 1KQSS 2EGAA 5IHKA 2ECZA 4J9IA 2KR3A 5L23A 2WACA 2A7YA 3CCSQ 5HGQA 4C5IA 2BKDN 4LD6A 4XAXB 4RDXA 4EMKA 1WHJA 2YUQA 1FWZA 4JZ3A 2FRYA 2Y4XA 1M2VB 3X25B 3EHQA 3DLLA 1X69A 3CC7Q 2XG8D 1WGSA 2ED1A 3GNGA 5C51B 3LH0A 1N8RC 2HSEB 5IHNA 1D3BA 1NYQA 2MI6A 3OYIA 3L2UA 3TUPA 1AWXA 4AFZC 2CUDA 5A2QE 3HFVA 2LT1A 4H2TA 1NM7A 3HXWA 2DYIA 4ZGDB 1K0SA 1BKBA 1IO6A 1QWFA 3QYHB 4WJ3M 1NYGA 2J06A 4P3OA 5GMKj 5CAIA 1X6BA 3BDUA 2PZ1A 3JCMV 2ZTGA 4Y92A 1NJ8A 3PE0A 1KC8R 3JCMh 3QWXX 4BB7A 1W2BP 3LSQA 4R55A 3L2WA 1VQNA 1AZGB 4YRSA 4XTVA 2F2XA 5DM7R 5AT1B 2EKHA 2K5IA 2KGTA 4XTWA 1W4SA 4M75D 1WIEA 1SF9A 2O31A 7AT1B 2ZAEA 3A8OB 1ADJA 2AMCB 2G4CA 3REAB 1VA7A 2M0YA 1GCQC 2J05A 2IG0A 2PTKA 1YBYA 2QHUA 4QT7A 2JXBA 3QKJA 2JMAA 3G71Q 1IGQA 2CP5A 2AIRB 2LZ6B 4LVLA 2O2OA 3HFNA 2J6KA 4DOWA 3P8VA 1B76A 4K87A 1PKSA 1IRXA 1B07A 1M2VA 2EQIA 3C12A 2GFUA 1M1KU 1SESA 2AZVA 2F5TX 4JJNK 5GAOp 2CH4A 1E1TA 3JV3A 4VUBA 4EMHA 4J9FA 3M4PA 4J9CA 5GANe 3RKXA 1OZ3A 2B86A 5LJ3d 2RI3A 5D7UA 3M0TA 1QLYA 3OYGA 2RO0A 3CEYA 4C8QD 4DOVA 1YN8A 1BI2A 5GANd 3CCQA 4OMMA 3D7SB 2IPOB 3CMAQ 2HL3A 1YFNA 2LX7A 4OB1B 1D1BA 1N8RR 3X28B 1WHHA 4HWTA 4LUDA 3QJ6A 3ZFJA 3HXXA 4YRFA 1C6VX 1HK9A 3QDRB 3X20B 2HBPA 3BE3A 1JJCA 3NENA 4ME7A 1R77A 1KIKA 3CC2A 2JS2A 5CK9A 5GAN3 1TWBA 2ABLA 3VRZA 2MF2A 4M78E 2MCNA 3CCVQ 3QNEA 2K5FA 3ERRA 3WVEB 1MNEA 3MKDA 1VQMA 3X26B 1ZSZA 2G6FX 1H4SA 1W2BS 2NUPB 1KQ1A 2COZA 4EDUA 3OYNA 3SDZA 1ZA1B 2QQSA 4M7DG 3RGLA 1YI2T 2HKNA 3I5SA 5C6SA 2DDZA 2J6FA 2X4YA 2EBPA 1AWJA 3I55A 1V1CA 4PFPA 4FIBA 3M0QA 1JO8A 5LL6S 1NZ9A 1VQMQ 2M1HA 2P0KA 1YIJA 2FO0A 2DQ3A 3QWYA 5GAOr 4M7AD 1HJDA 1VQMT 2DXUA 4BDZA 2E6ZA 2LQKA 1W66A 4E7IA 2FL7A 4F7UA 2KK4A 4HCKA 3CCUQ 2B8AA 2W0ZA 4RKUE 1YI2Q 2ZT8A 5GAN5 1ZBJA 1JB0E 4DA4A 2M16A 2PVDB 4IIOA 3CCLA 2BZXA 1ARKA 1XOVA 3QPHA 3IKMB 2NUTB 4QKUA 3PTAA 2YUOA 4AFUC 2GTOA 4FM4B 5LJ3g 4XU0A 3CCMA 2WSFE 1YIJQ 1PG5B 5I2MA 4QQDA 1B7YA 3TSWA 5CCAA 2V26A 3N5BB 4L5GA 4P3NA 4PG3A 4EX5A 1WFWA 3PZCA 3ZEHA 4KR3A 1N6AA 1OYXA 3RKWA 1VQ7Q 3UH0A 3PMTA 1VYTA 3LH5A 1EX4A 2OAWA 3DLMA 1IREB 3GLXA 3EG9B 3L42A 4A63B 3FLGA 4CC3A 1RIQA 3T9NA 1XTDA 3CC7T 2DTIA 1KQSP 1VQ5T 3G1ZA 3H9NA 1OPLA 1Q86R 4PJOE 4ZNXA 1XNIA 4OP0A 2ODRD 3JB9I 2ZGWA 1E22A 2KVQG 1R8OB 3OS1A 5CQXA 5K1XA 2EL9A 2ZCFB 2QA4T 3S3NA 1RUWA 4E7SA 3E19A 4DEXA 3QTCA 4KRTA 3PMIA 1KMNA 4B6MA 3E9GA 3TU4K 4E7HA 3MP8A 1NJ5A 3CCQQ 3V8JA 2ZINA 2F2VA 1X2GA 2C0OA 1MMDA 1WU7A 2QA4Q 1RACB 2PU9B 2C7IA 5K1PA 1H8KA 4B9WA 1RAIB 3C0CA 3JCMJ 2GTJA 2EFIA 3BW1A 2BUDA 1ACMB 1K9MU 1VQKA 3MCAB 3I55Q 3RNJA 2NWMA 2EYYA 4ORZA 3LGLA 1WHMA 1U5SA 1MMGA 2M9UA 4P71A 2HSPA 3HRUA 3EFOB 1VQ7A 3G7ZA 2KYBA 2X35A 2ALYB 4J6XA 4RQEA 2CH4W 1M1GA 1U3OA 3TEHB 2L3QA 2E5AA 4YRKA 2YRCA 3OS2A 3REXA 3GOXA 3L4GB 3M4GA 3OMGA 3CC4A 3G6EQ 2EWNA 3ZL7C 1C1AA 1UGPB 3OYJA 4G85A 3UGQA 2JUFA 1WJQA 2YDLA 2JVVA 4C92F 3EAEA 4HA8A 2DETA 2PNIA 3NTIA 5J26A 3TEEA 1RAEB 4X5OA 4LDVA 2K3BA 2IY5A 3JCMb 5IN1A 2H3JA 4DBFA 3EGUA 5IH2A 2Y90A 1GGMA 2KDSA 3RACA 1NJIU 5GAMe 1IHVA 3CBMA 1X56A 1WI7A 1X43A 2DPPB 5ECAA 4FT4A 3KFUA 1YJ9A 3R07A 4RMFA 3OD1A 2E3IA 1K9MC 1FYNA 3QZ5B 5A0DA 3JCMd 4F7UB 3UA6A 4HVCA 3OYFA 4IUQA 4C0ZA 2LP5A 5GAOm 2JS0A 4MMKA 2RQWA 3HRIA 4C92G 2ROTA 5GANj 4XTYA 4ZIBA 1LOJA 4Y28E 2XIDA 3JB9D 1BBUA 4A4FA 2ZZGA 5GMKi 4XTUA 4J6WA 2K2VA 4JJDA 4IURA 4C8QC 1YHQA 2L89A 3VS1A 4P73A 4P5NA 1M4ZA 3LGFA 1HC7A 3MEUA 1TSFA 4H2SA 3INZA 1SRLA 4M7AF 2EQJA 2K4YA 1H92A 5CVIA 2RH2A 2V8IA 4BY6C 4G84A 1LCKA 1WX6A 1WQWA 1K73U 5CKEA 4MZMA 3O8VA 2QEXA 1JJ2P 4P74A 4A4EA 3H41A 2EPDA 1S72T 1KOGA 1VQ6T 4PLLA 2OI3A 2MPXC 3THKA 4RTZA 3HTZA 2GCXA 3UPUA 4D8KA 4RTWA 4OMFB 1WA7A 3NGPA 5FLXE 3HXUA 4RG2A 4AG2C 3WQZA 1UG1A 4ZTUB 2JTFA 1S1NA 2FZGB 3M59A 4AG1C 1PYSB 2NLUA 3SD4A 2XDDA 2EGEA 3VS6A 1QVGA 2CP6A 2ZNJA 4JS5A 3WXMB 1CSKA 2J3LA 2BZYA 4F04B 3G71A 2FPEA 2EQUA 4N4GA 2QHVA 1W2BA 3E9HA 3WVDB 2HQHA 3CCSA 2E3CA 4PL6A 3CCJQ 2D1XA 2CZ6B 2FB7A 3VS7A 3VYGA 4MZPA 1VQ5Q 2CUBA 5GAN4 2BE7D 2HKQB 1PWTA 3FB9A 2GGRA 4P73C 4BY6B 3OMCA 1QQJA 2RM4A 2FG0A 3QG1A 3A98A 3A8HB 2YLCA 1KG1A 4ZTJA 1WLEA 1VQOT 3I5RA 5IHIA 2EAYA 1C0MA 1EVLA 4A54A 2XDPA 2QYZA 2KMTA 1WHGA 3S3MA 4J9DA 3M0RA 4LNPA 4MDWA 3OSVA 3HXVA 3CCLT 2PUOB 3V7SA 4C0FA 3OYLA 2E10A 4C0DC 3L4GA 1P92A 2R5MA 3MEVA 4PHCA 4M78D 3GF5A 2LCCA 4YREA 4C8QG 4J15A 5CKHA 4KGVB 2Q7GA 2KRSA 2ZR2A 4NOYA 3MEAA 5ELOA 1WNLA 1VQ4Q 4HCZA 4JRPA 2CS7A 1EIFA 2FRWA 2VUBA 4C92A 1NNHA 4QVDA 1U8RA 3RR6A 2DJZA 4HVUA 2LJ1A 1QP3A 4FL6A 4F16A 2HL5C 3CCJT 4FW2A 4M7AE 6AT1B 2JM8A 3IALA 4XU3A 1J5WA 3OS0A 4KT0E 4OMNA 4M78F 1JQQA 1W1FA 1T0JA 3JB9G 4LVKA 3CCEA 1UHCA 2CJAA 5IT9E 5D6YA 2XKOC 2NYSA 1TUCA 3SEMA 4F7UE 1IHWA 1IB8A 5J39A 3OA6A 1EZZB 1VIFA 1BBZA 1USYC 1Y57A 3HRSA 4KGXB 1E1OA 1Q82R 2EKOA 2E12A 2A08A 2COYA 2E41A 3DKMA 4IKFA 5CO7A 2A37A 4OMOA 1T3LA 1YJWT 2KBTA 4RCCA 3EH2A 3CD6A 2DLPA 4EO4A 2QQ9A 2L5QA 4C8QE 2K7AA 4BI3A 1RI0A 2PQWA 3QXEB 4C0GA 1ZBXA 3PCOA 5GAMf 2QA4A 1BB9A 1VQ4A 1VQKT 2J6OA 2F2WA 4H2WA 2QGFB 3SFMA 1LYLA 2L0AA 1BU1A 3QHSA 3I9QA 5KYYB 3CCLQ 1X6OA 2CZ0B 1ASZA 5DY9A 3KBGA 3RKYA 2R57A 1VYVA 4L87A 5LJ5e 3A32A 3HTRA 2PUKB 2CGHA 2ZPIB 1SETA 12ASA 4H02A 4RQFA 1ZLMA 3JB9F 2FEIA 4JUVA 3JB9H 5GJVB 5CKDA 5KYWB 2RHQA 4E7KA 3JCMW 4PJOC 1YNZA 3CQTA 4M77D 4L6V5 1VQ9T 1SRYA 2CP3A 1B70B 4CH3A 1G3SA 2RJEA 2ZPGB 4F7UG 5GAOn 3ULRB 3UWNA 1VQ9Q 4CH5A 2KXDA 2MIOA 1YGBA 4K86A 1FYFA 1SHFA 1BIBA 2ZZDA 2YRDA 3RERA 4M78C 3RMSA 5LJ5g 4CRIA 3I56T 4TTVA 3CC2T 1O9SA 2HBWA 4WTOB 1B70A 1YFRA 3P8YA 2FVUA 4XU2A 1I81A 1ABQA 1M27C 1R0BG 3JRZA 4GLKA 4E7JA 2IIMA 2ARTA 1YITT 3CCRT 1UUEA 2C06A 1H4VB 1OI1A 1SSFA 4Y91A 1UGSB 3J81E 4YRCA 4CC4B 1UFFA 1KD1U 1ATIA 1M2OA 3RL6A 4KR2A 2XDBA 1TG0A 1KC8C 3QDFA 4KBMB 4DBQA 3M4QA 4X9DA 2I2LA 3CCJA 2RHIA 1JJ2S 3TSZA 1YWPA 1SERA 3NELA 4BE0A 4IUUA 1V76A 2LCSA 3A8MB 4E6RA 4X9CA 3V8KA 1VQLT 3EG3A 1C0AA 5FU7C 1JU5C 2CT4A 4JJBA 4M7AG 1X55A 5KNNA 2X3XD 2XU8A 3I55T 2L3RA 1D09B 4OGCA 1QVGP 4M78B 2DF6A 2Q7EA 3EFOA 2ROLA 1MHNA 5KYUB 2XICA 2JT4A 3IQLA 2HD0A 2AZSA 1VQ8T 4HVWA 3O5ZA 3SWNA 1M90R 1Q81R 1Y07A 1T0HA 2LTOA 2ZPHB 3EH1A 2JW4A 3E9FA 4QVCA 1BCOA 5GAN6 2Q5IA 1ASYA 2LDMA 2X4XA 1YB3A 2QTVA 3I56A 2DBMA 1Q7YR 1MV3A 2WSCE 4OF1A 4Z89A 2AMCA 2JJ9A 3JCMP 2AKWB 4DEYA 5CIUA 2JZ2A 1LNXA 2M51A 2RQTA 1ZHIA 4PJOG 2DX1A 4J7FA 5LJ5j 1O75A 2A8EA 1RABB 4JRKA 4CS3A 1K8AU 3REBB 1M1FA 3UFGA 5FU6B 3NEMA 1Y96A 1M5Q1 1ZQ1A 1YHQQ 2YXYA 3NHNA 1KJWA 3QBYA 2LQ8A 4PJLA 1JXOA 1FMWA 3RBBB 1SRMA 3ER0A 1PSEA 4J9GA 5D6WA 1NE8A 5CKBA 3G4SQ 3ICAA 3BDLA 3UF4A 3QO5A 4PJOA 3RF1A 2ZT6A 3OYCA 3AT1B 1TOVA 4FCYA 4CS4A 3QO3A 1GRIA 2VWFA 1AWOA 2DAQA 1K4US 5E3IA 3VS3A 2FYKA 5KE2A 4OB2B 2D0NA 2V1RA 4DQ2A 3A5ZA 1VQ6A 4M75C 1YJ9Q 1WHKA 1YCSB 1M30A 3A5YA 3FEOA 3Q1JA 1K8AC 2ZNIA 1WXBA 2NS6A 3S3OA 2VVKA 4WCIA 3VBBA 2ZPBB 4M77E 4JS4A 1MGQA 1TTHB 4M7DE 2FHDA 4E7ZA 1KQ2A 2CYZB 4P3PA 2MWOA 3CD6T 4YP0A 1JJ2A 1VQPQ 3NETA 2GQVA 2LRQA 3A31A 1OU9A 2JMCA 5GAN8 1WZOA 2X9HA 3A1PA 3LWIA 4M77B 2CP0A 5HK3A 1Q86U 1JJCB 2DL8A 4BACA 3VQXA 3CC4Q 2XGTA 1S72Q 5FRNA 4IUVA 1H3HA 3L2ZA 1PYSA 4X1VA 5FROA 1M1KC 2P5IA 1UGRB 1J3TA 3DSQA 4PFOA 5I21A 2ARSA 2OTJT 4TVAB 2K5LA 2DL5A 4LE9A 2DE0X 4BW9A 3VUZA 1B34A 1VQZA 2IY5B 1G2BA 2ARUA 1ZSZB 1VOMA 3VS4A 4UP7A 1TUDA 2I4NA 1KD1R 5LJ5f 9ATCB 3H6ZA 2DTHA 2P0PA 4JLGA 2NUTA 3JCMg 2DVEA 2XHCA 5ELNA 2GNCA 3RIRA 4O2DA 3SHWA 4CH4A 4KQEA 3TQ7P 1UE9A 4Z88A 4TVRA 3CCRQ 1YJNA 4PJOD 1XJWB 1NYFA 3I7FA 1MNDA 3QUIA 1W70A 5D6XA 1I5OB 1YJWA 4YRIA 4Q5WA 2ESWA 4M4ZA 1BBWA 1E6GA 5KCOA 3VKIA 5KYNA 1IL2A 2QQRA 2RHUA 1NPRA 2HQEA 4KH0B 1VQPA 2ZXFA 3JCMc 2LNHB 3OS5A 4FSXA 3EFSA 3L2QA 4QW2A 3H0HA 5GMKh 3GP8A 5M9OA 3GPLA 4BE2A 2QASA 3FJ5A 3HSBA 4A4HA 3CCUA 5FW9A 2DZCA 1OV3A 1B8AA 1VQOA 3EG0A 4LVJA 4E47A 3UDCA 1U1TA 5I2SA 4PNOA 1VQ7T 4EMGA 2AK5A 5GANg 3MQZA 1OX8A 4C92B 4CI0C 1D0YA 4H2YA 1WXTA 2MYSA 5FU7B 3LSSA 4K11A 4ATOA 2DQ0A 3META 2E5QA 5C0MA 2CKKA 5LJ3j 4LUEA 3UGTA 1OEBA 2QHTA 3G4ST 1YWOA 2YT6A 4KH1B 2LX9A 5IXBA 3LWHA 4A53A 2RQRA 2DKGA 1YITQ 4WF2A 2DRKA 2QDLA 2RF0A 1Y0MA 2JM9A 1S72A 4Z02A 2ZZEA 3CXCP 4V2SA 2KT8A 3P8BB 1X27A 1G5HA 3EGDA 1V29B 3GNFB 1HTTA 4YPFA 1SEMA 2VXEA 2IVWA 5LJ5h 1OOTA 3H0IA 1YJWQ 2PVOB 4M75G 2P4TA 1KD1C 3MF2A 4XTZA 5GAMh 5I22A 1Q82U 4M77G 2CP7A 2SEMA 2BTTA 1I07A 1Z7NA 2ZT7A 3M4YA 4N4HA 2ALYA 2EQKA 2P0LA 3M0PA 2OTLT 3PIOA 1DJ7B 3A7UA 2DL3A 1NJ6A 2CJ9A 3OYYA 3CPWA 4M78A 4DBRA 2I4OA 2LQNA 2HEQA 4UC4A 3LC0A 3VU3C 2VYTA 2HDAA 2DXTA 4PJNA 4Q6GA 4KUIA 4YRPA 2A0FB 1G3YA 4KULA 4M7DC 1Q95G 3OBWA 8AT1B 1Q82C 1N5ZA 3FDRA 4M7AB 4PK4A 4H2XA 2CREA 4LN2A 4HWSA 2DIGA 3MPUB 1YJNT 2QK0A 4J6YA 3P8TA 2CDTA 1YFSA 1OQKA 4UP9A 3HY1A 1X2QA 1QWEA 2E4HA 3HP9A 5IXFA 3M54A 1SPKA 3JCMX 1MMNA 5LJ3e 2RB6A 4BUGA 2QEXQ 1R0CB 5FWCA 4PJMA 2ZR3A 1K76A 2EQMA 1NEGA 4YRQA 4PKCC 3LW5E 3QO8A 1AEYA 2X4JA 2AKLA 1WPYA 4J7IA 2Q5HA 1I5LA 8ATCB 3JCMe 1YIJT 2JOYA 4YTLA 4ZN1A 2E6NA 3QIIA 2VB6A 3E1SA 1YJNQ 4HT8A 1FXXA 2EIFA 1AWWA 4DBHA 3BFMA 2RHSB 4NL3A 3OY9A 1W6XA 2CZ1B 1KHIA 3M55A 3RESA 2QQAA 1HXDA 1M3BA 3ASKA 4IUPA 2QTXA 3I56Q 4M77C 1ZA2B 4M7DB 3C94A 3CCUT 2LJ0A 1BYMA 4JRIA 4A4GA 3OYAA 4M7AC 1ZX6A 1TU0B 1N9WA 2MK5A 3A7RA 2SRCA 2DO3A 11ASA 3VS0A 4DPGA 4HWOA 1QMCA 3BJUA 3KXTA 1RAGB 1Z9ZA 2RHQB 5DLQE 1UGVA 4M75F 4NL2A 1NJ2A 3UT1A 4RTUA 2RN8A 4D6WA 4ELZC 3JSCA 5KYYA 4MDXA 4A4KA 4J83A 1OX9A 2BE9B 2K2MA 4HCCA 4J9EA 1YP5A 1KHCA 4BI8B 1N9RA 1UEBA 3UA7A 2CP2A 4M7DA 2DMOA 1Q7YU 1GBRA 2JTMA 5HCKA 1RLQC 2GQIA 2DERA 2M0OA 2XK0A 3FC3A 1K73R 1WQ7A 1QVFP 4YRNA 3F70A 2K9GA 5EG2A 4JRQA 1B34B 3CXCA 1Q81U 1U1SA 1M90U 1VYUA 3CC7A 1H4TA 4FU6A 1QCOA 4OLFA 3A8LB 1OU8A 1K9AA 4C92D 3SB2A 3HL8A 3OYMA 1X75C 4M7AA 3OYDA 2DEUA 1GBQA 1M9SA 3MP1A 4C8QF 1G51A 3EG1A 3A8GB 4M77A 4HXJA 1RLPC 2X3WD 1Q86C 1MUZA 1Y96B 2X51A 1M3AA 4C5EA 3HRTA 4LDUA 2DNUA 2O4XA 3NTHA 1FMVA 2F1LA 5GAOq 2G3RA 1PHTA 4YROA 3HKSA 5KE3A 1VQNT 3CCMQ 1OULA 2ED0A 3NPFA 1UTIA 2ZIMA 2HZYA 1QVFA 1YFTA 1UDLA 2DL4A 4H2XB 4BD3A 1WLPB 3CCMT 2KRMA 1VQ8A 1GFCA 3HY0A 4BWAA 3A5ZB 3JAME 2DZ9A 3LYIA 3VQYA 5GAOl 2E70A 1LPLA 3JCMf 1PD1A 2LNVA 2K79A 1NJIR 4JJCA 1VQLA 1E24A 4PJOB 1F1BB 3C4SA 4YRTA 4HT4A 4GBQA 4YCUA 4BI4A 2AKKA 4EMKC 1KMMA 1G5IA 4ZTZB 1ABOA 3EG9A 1KFZA 2D8HA 1G83A 2DILA 2VC8A 2EW3A 4F17A 2DU7A 4RTYA 3V7CA 2VASA 2ODRC 1EFNA 3MF1A 2ZCEA 3PFSA 1X01A 1QCNA 3EGDB 1UJYA 4LXCA 4ESRA 2XI9A 1K0XA 4J9BA 3MEWA 2KEAA 1Z9QA 2EYZA 1EFWA 2P0QA 2W10A 2CSIA 1JEGA 3KFVA 2DM1A 2EJGA 1IZ6A 3EFRA 3ZBDA 1PCXA 1VQPT 5GANh 2E64A 2RPNA 4PLIA 1D1AA 2DRMA 3CC2Q 3PGGA 5F5WA 1H641 2E1HA 1NEBA 1K9MR 2QAZA 4OB0B 3CCRA 1YITA 2F5KA 2E3HA 1D3BB 1EVKA 4HWPA 1KK7A 3CMET 4AT1B 4P75C 2C0TA 4FT2A 2V8JA 1NYRA 3LX7A 3M56A 4RMOA 1TUGB 2KE9A 2JNGA 5I11A 3I35A 4JLIA 2O88A 4FSSA 3CCQT 3P8DA 5LJ5d 4TQDA 1OZ2A 2KYMA 3MO8A 4P75A 1D1CA 1L0WA 2E65A 1QP2A 3TVTA 1B7TA 1H4QA 4OVAA 1JXMA 1Q7YC 1WXUA 4LD9K 1VQ9A 4D8DA 4AMCA 2GFAA 1BIAA 2RK2A 3CCVT 3REUA 3CCVA 2OAUA 3G1JA 5GMKl 4K88A 2KROA 3JCMQ 2EGCA 3CBPA 1EIYB 4YRRA 2KI7A 4WJ4A 1NJIC 4R0KA 2KQWA 1WHLA 5GMKe 3QO7A 4PJOF 2OTJA 3ME9A 4P72C 2VXFA 2EYXA 4KUDK 1YCYA 4NCXA 4O5VA 2O01E 4O6JA 3OYBA 1PSFA 3M58A 3TREA 3OYHA 5KYXB 5LJ3f 2J7IA 2DVJA 2LJ3A 2COWA 4ZN3A 2DIQA 2EJFA 1TS9A 2AKWA 1QVGS 5A0LA 2ZIOA 4J5YA 4OMLA 1ADYA 3RDVA 4LVMA 3CD6Q 4P72A 4BE1A 4YCVA 1I0CA 2O9SA 1I4K1 3M53A 4E7LA 4LDXA 2K3XA 3TEGA 2RQVA 2DL7A 3A74A 1USYA 1ZSGA 3JB9J 1PM3A 2VKNA 4FYWB 4TVWA 2HMAA 1N27A 4XEMA 1QKWA 2YRVA 4TWAA 3HHTB 1PRLC 4M78G 4FYVB 3PVLA 2OX7A 1QVFS 1GFDA 4ELYC 2DXBA 4C8QA 2JN0A 4M75B 1GL5A 4CH6A 5GAMd 3VRYA 1A0NB 2RJDA 1SKUB 2CZ7B 2DD5A 3J7AF 3R6OA 4PFZA 4QVZA 3CMQA 3QZ9B 3L2VA 1UGQB 2KXCA 3X24B 2RHXA 3PNWC 2K6DA 1M3CA 2LT4A 2PVGB 2GBQA 3TEHA 3PT9A 4M7DF 3SWNC 1FMKA 2YSQA 2KT1A 3KUFA 3HXZA 3HFOA 5HK0A 1AT1B 1IXDA 1PD0A 1T3SA 2RJCA 2D6FA 2X4WA 4JPBW 2DTOA 1VQOQ 1IGUA 1ZUUA 3CMEA 3TCJA 1D0XA 2KNBB 1NJ1A 2XTIA 2YUPA 3DB4A 3HFZB 3EG2A 2FZKB 4M75A 1B3QA 1ZUKA 3A7AA 2WSEE 2Q7HA 4AH6A 2DA9A 4C8QB 2ZZFA 4TVYA 5KH6A 5KYUA 4CC7A 4CC2A 3CCST 4AFQC 5GJWB 4EMKB 4LVIA 4WI1A 4M7DD 2Z0WA 2GF7A 1GCPA 3J80E 2MWPA 3OW2A 3AHUA 2O4XB 3W3SA 2QDYB 2LVMA 2YLBA 1BI3A 3HFZA 3VV0A 4C5HA 4N0AC 2RMOA 4N4IA 4ZTFA 3FRNA 1X54A 1FX7A 4QQGA 1XQHA 5KYWA 1Y7XA 5KCHA 3G71T 4N0AA 3U23A 2D8JA 2YUNA 3LLRA 2KSSA 1VQ6Q 2PMEA 2YWWA 1VQLQ 3EHRA 2D0QB 4RG8A 2RI5A 3M5AA 1I1JA 4XQ3A 2H3EB 1B7YB 2QEXT 2FPFA 2K3YA 3QYGB 2PMFA 1KC8U 3PCOB 4YRMA 2M02A 1I8FA 4UP8A 2VGNA 2QHSA 2BIVA 4C92E 3VQVA 4OMQA 3E2UA 3QSUA 1X6GA 4YRGA 3QJYA 1K1ZA 1G3TA 2CJBA 3EGXB 1G3WA 1U06A 1EQRA 3UATA 4E51A 3HRKA 1UECA 4Z8AA 4RUGA 2KRNA 3C95A 1M8VA 4LDWA 4JDSA 1EIYA 2RQUA 2CT3A 1RAFB 5FU6C 4UPAA 3VS2A 4C92C 2V8KA 4M75E 1NPPA 4M77F 3OYEA 2HAXA 4CS2A 2J3MA 1EOVA 4FYXB 4YCWA 4HVVA 1GXIE 1BCMA 2L3PA 4HWRA 1GCQA 3S6WA 3VJPA 4Q15A 3CMEQ 2HNIA 4NS5A 2XD0A 4F14A 1QE0A 2JTEA 1D0ZA 4MMLA 2CSQA 2ZPFB 2MMPA 1UB4A 4C0DB 1TXQA 2VGMA 4IUTA 1VQ4T 1YJ9T 5A0GA 4EPCA 1NBEB 3EGXA 3FIFA 2RHSA 1Q81C 3URGA 2DYBA 5CKFA 2DXCA 3CBOA 5IAYA 3G4SA 1NG2A 1Y71A 2D9TA 2LCLA 3MEYA 4LDYA 4OB3B 2ATCB 1MMAA 2ZT5A 4RTXA 4R56A 1VQKQ 2DK3A 1AZEA 4KGZB 2YHTA 3VQWA 2V1QA 4RCBA 2XMFA 4HT9A 2A28A 2L3SA 2A36A 3G6ET 1Z7MA 3CMAT 3NTKA 2ZPEB 3CCET 1RADB 3H0FA 2P84A 1QCFA 2AT1B 3CMAA 2P4RA 1VUBA 1ZUYA 2L2PA 3VS5A 5FWBA 2OTJQ 2HCKA 4J8OA 2QI2A 1E7OA 1RAAB 2NUZA 4P74C 4AFSC 2FZCB 2EYWA 4L59A 1ZSZC 1AD5A 2EYQA 2AHJB 2FPDA 4XEOA 2RNAA 1M90C 3G6EA 4YRLA 3CPWP 1PC0A 1H3ZA 3OW2P 5GANf 2I4MA 1PNJA 4OGEA 4BDYA 5GAN2 2H8HA 1WYDA 2OTLQ 1TH7A 1N8RU 3H8ZA 2Y4YA 1N9SA 4FYYB 4YDQA 2DFUA 3VUBA 3VYHB 1MV0B 3NMZC 3SWNB 3L2RA 3FJPA 5GAMg 4XTXA 3OW2S 2DU5A 1AVZC 3CXCS 5HKCA 4ZGJB 1WJSA 1LVKA 4FW1A 4C5GA 4PJJA 1VIEA 1X2HA 5EC7A 3CCEQ 1AHJB 5AYFA 1WYXA 5CQYA 3R6NA 4RTTA 4H2UA 2RHYA 2KY9A 4B9XA 2RI2A 2CIMA 1M8MA 1KSWA 2DBKA 4EIKA 2MAMA 1VQ5A 3P8HA 3MJXA 3CC4T 1JRIA 4II1A 2RJFA 2R5AA 3BY7A 3M57A 4YRJA 3CPFA 1YHQT 1QW1A 3E9IA 1QKXA 2DD4A 2RHZA 2OTLA 2O9VA 4MZTA 3HPWA 3IG2A 2K57A 1SG5A 3GIBA 1RL2A 3GBQA 4QQ6A 1HD3A 5CR2A 1AOJA 4X34A 1BI1A 2LQWA 3M0UA 2QG9B 1G8XA 5LJ3h 1NLOC 1LJOA 1RI9A 2I4LA 1CKAA 1RAHB 3RMQA 3RUXA 2R58A 4ANJA 4E2FB 3MHXA 5KYXA 2BZ8A 2OJ2A 4P71C 2E5KA 4HCBA 1YI2A 1VQ8Q 4OMPA 2LMJA 4GY5A 1HYOA 1NLPC 3MP6A 4ZGEB 5FRMA 3OYKA 1QF6A 1SSHA 2ENMA 5HY6A 2MOXA 2I0NA 5GAN7 2C0IA 2DEQA 5GAMj 1CKBA 2LC4A 1WJRA 2L8DA 2QXFA 4J9HA 4TQFA 2RA2A 4XU1A 3V7RA 1BI0A 1M1KR 3M0SA 4GLMA 2NUPA 2A3LA 1K73C 3NFCA 2C8MA 3IKLA 1E6HA 4TVAA 5GMKm 3OQ5A 3M9QA 2QGGA 4HKEA 2RK1A 2QQBA 1UJ0A 1WDXA 3PIPA 4JZ4A
chains in the Genus database with same CATH topology
2VV5A 3OB9A 4YYEA 2RD1A 2KAFA 5C52B 4XK8E 4H2VA 2EJ9A 3OSSC 4F7UF 2HQXA 5DLOA 3CPWS 3DB3A 1QVPA 1G5VA 3HXYA 3L1AA 1KQSA 2F69A 4LNSA 3OBYA 1JBMA 5L8RE 5J3BA 3V8LA 5C53B 1KQSS 2WACA 2A7YA 5HGQA 4C5IA 2BKDN 4LD6A 4XAXB 4RDXA 4EMKA 1FWZA 2Y4XA 3X25B 3DLLA 2XG8D 1WGSA 3GNGA 5C51B 3LH0A 1N8RC 1D3BA 1NYQA 2MI6A 3OYIA 3L2UA 3TUPA 5A2QE 3HFVA 2LT1A 4H2TA 3HXWA 4ZGDB 1BKBA 3QYHB 4WJ3M 4P3OA 5GMKj 5CAIA 3BDUA 3JCMV 2ZTGA 1NJ8A 3JCMh 4BB7A 3LSQA 4R55A 3L2WA 1VQNA 4YRSA 4XTVA 5DM7R 2K5IA 4XTWA 1W4SA 4M75D 1ADJA 2AMCB 3A8OB 2G4CA 2IG0A 1YBYA 2QHUA 3QKJA 4LVLA 3HFNA 4DOWA 4K87A 3P8VA 1B76A 3C12A 2GFUA 1M1KU 1SESA 2F5TX 4JJNK 5GAOp 1E1TA 4VUBA 4EMHA 3M4PA 5GANe 3RKXA 1OZ3A 5LJ3d 2RI3A 3OYGA 2RO0A 3CEYA 4C8QD 4DOVA 1BI2A 5GANd 3CCQA 4OB1B 3X28B 4HWTA 3QJ6A 3ZFJA 3HXXA 4YRFA 3QDRB 1HK9A 3X20B 2HBPA 1JJCA 3NENA 4ME7A 3CC2A 5CK9A 5GAN3 2MF2A 4M78E 3QNEA 2K5FA 3ERRA 3WVEB 1VQMA 3X26B 1H4SA 1W2BS 1KQ1A 4EDUA 3OYNA 3SDZA 2QQSA 4M7DG 3RGLA 1YI2T 5C6SA 2DDZA 2X4YA 3I55A 4FIBA 5LL6S 1NZ9A 2M1HA 2P0KA 1YIJA 2DQ3A 5GAOr 4M7AD 1VQMT 2DXUA 4BDZA 2E6ZA 2LQKA 1W66A 4E7IA 2FL7A 4F7UA 2KK4A 2B8AA 4RKUE 2ZT8A 5GAN5 1JB0E 4DA4A 2M16A 2PVDB 3CCLA 1XOVA 3QPHA 3IKMB 3PTAA 5LJ3g 4FM4B 4XU0A 3CCMA 2WSFE 5I2MA 4QQDA 1B7YA 5CCAA 3N5BB 4L5GA 4P3NA 4PG3A 4EX5A 3PZCA 3ZEHA 4KR3A 1N6AA 1OYXA 3RKWA 3UH0A 3PMTA 3DLMA 1IREB 3GLXA 3L42A 3FLGA 1RIQA 3T9NA 1XTDA 3CC7T 2DTIA 1VQ5T 3G1ZA 4PJOE 1XNIA 4OP0A 2ODRD 3JB9I 2ZGWA 1E22A 2KVQG 1R8OB 3OS1A 5CQXA 5K1XA 2EL9A 2ZCFB 2QA4T 3S3NA 3E19A 3QTCA 3PMIA 1KMNA 3E9GA 3TU4K 4E7HA 3MP8A 1NJ5A 3V8JA 2ZINA 1X2GA 1WU7A 2C7IA 2PU9B 5K1PA 4B9WA 3JCMJ 3BW1A 2EFIA 2BUDA 1K9MU 1VQKA 3MCAB 3LGLA 2M9UA 4P71A 3HRUA 1VQ7A 3G7ZA 2X35A 2ALYB 4J6XA 4RQEA 1M1GA 3TEHB 2E5AA 4YRKA 3OS2A 3REXA 3GOXA 3L4GB 3M4GA 3OMGA 3CC4A 2EWNA 1UGPB 3OYJA 4G85A 3UGQA 2JUFA 1WJQA 2JVVA 4C92F 3EAEA 4HA8A 3NTIA 5J26A 3TEEA 4X5OA 4LDVA 2IY5A 3JCMb 5IN1A 2H3JA 2Y90A 1GGMA 2KDSA 3RACA 1NJIU 5GAMe 3CBMA 1X56A 2DPPB 4FT4A 3KFUA 1YJ9A 3R07A 4RMFA 3OD1A 1K9MC 3QZ5B 5A0DA 3JCMd 4F7UB 4HVCA 3OYFA 4IUQA 4C0ZA 5GAOm 4MMKA 3HRIA 4C92G 5GANj 4XTYA 4ZIBA 1LOJA 4Y28E 2XIDA 3JB9D 1BBUA 4A4FA 2ZZGA 5GMKi 4XTUA 4J6WA 2K2VA 4IURA 4C8QC 1YHQA 2L89A 4P73A 4P5NA 1M4ZA 3LGFA 1HC7A 3MEUA 4H2SA 3INZA 4M7AF 2EQJA 2K4YA 5CVIA 2RH2A 2V8IA 4BY6C 4G84A 1WQWA 1K73U 5CKEA 4MZMA 3O8VA 2QEXA 4P74A 4A4EA 1S72T 1KOGA 1VQ6T 4PLLA 3HTZA 2GCXA 3UPUA 4OMFB 5FLXE 3HXUA 4RG2A 3WQZA 4ZTUB 2JTFA 3M59A 1PYSB 2NLUA 3SD4A 2XDDA 2ZNJA 1QVGA 4JS5A 3WXMB 2J3LA 3G71A 2EQUA 4N4GA 2QHVA 1W2BA 3E9HA 3WVDB 3CCSA 2E3CA 4PL6A 2CZ6B 2FB7A 3VYGA 4MZPA 5GAN4 3FB9A 4P73C 4BY6B 3OMCA 2RM4A 3QG1A 3A8HB 2YLCA 1KG1A 4ZTJA 1WLEA 1VQOT 2EAYA 1EVLA 4A54A 2XDPA 2KMTA 3S3MA 3HXVA 4MDWA 3OSVA 3CCLT 2PUOB 3V7SA 4C0FA 3OYLA 2E10A 4C0DC 3L4GA 1P92A 2R5MA 3MEVA 4PHCA 4M78D 3GF5A 2LCCA 4YREA 4C8QG 4J15A 5CKHA 2Q7GA 2ZR2A 4NOYA 3MEAA 5ELOA 1WNLA 4HCZA 4JRPA 2CS7A 1EIFA 4C92A 2VUBA 1NNHA 4QVDA 1U8RA 2DJZA 1QP3A 4FL6A 3CCJT 4M7AE 3IALA 4XU3A 1J5WA 3OS0A 4KT0E 4M78F 3JB9G 4LVKA 3CCEA 2CJAA 5IT9E 5D6YA 2XKOC 4F7UE 5J39A 3OA6A 1VIFA 1USYC 3HRSA 1E1OA 2EKOA 2E12A 3DKMA 2E41A 4IKFA 5CO7A 1YJWT 4RCCA 3CD6A 4EO4A 2QQ9A 2L5QA 4C8QE 4BI3A 1RI0A 2PQWA 3QXEB 4C0GA 1ZBXA 3PCOA 5GAMf 2QA4A 1VQ4A 1VQKT 4H2WA 3SFMA 1LYLA 3QHSA 1ASZA 1X6OA 2CZ0B 5DY9A 3KBGA 3RKYA 2R57A 4L87A 5LJ5e 3A32A 2PUKB 2CGHA 2ZPIB 1SETA 12ASA 4H02A 4RQFA 3JB9F 4JUVA 3JB9H 5CKDA 2RHQA 4E7KA 3JCMW 4PJOC 4M77D 4L6V5 1VQ9T 1SRYA 1B70B 4CH3A 1G3SA 2RJEA 2ZPGB 4F7UG 5GAOn 3UWNA 4CH5A 1YGBA 4K86A 1FYFA 1BIBA 2ZZDA 3RERA 4M78C 3RMSA 5LJ5g 4CRIA 3I56T 4TTVA 3CC2T 1O9SA 1B70A 1YFRA 3P8YA 2FVUA 4XU2A 1I81A 3JRZA 4GLKA 4E7JA 2ARTA 1YITT 3CCRT 2C06A 1H4VB 1OI1A 1SSFA 1UGSB 4Y91A 3J81E 4YRCA 3RL6A 1KD1U 1ATIA 4KR2A 2XDBA 1KC8C 4KBMB 3M4QA 4X9DA 2I2LA 3CCJA 2RHIA 1JJ2S 1SERA 4BE0A 4IUUA 1VQLT 3A8MB 4X9CA 3V8KA 1C0AA 5FU7C 1X55A 4M7AG 5KNNA 2XU8A 3I55T 2L3RA 4OGCA 4M78B 2Q7EA 1MHNA 2XICA 2HD0A 1VQ8T 3SWNA 1Y07A 2LTOA 2ZPHB 3E9FA 4QVCA 5GAN6 1ASYA 2Q5IA 2LDMA 2X4XA 1YB3A 3I56A 2WSCE 4OF1A 2AMCA 3JCMP 2AKWB 5CIUA 2JZ2A 1LNXA 1ZHIA 4PJOG 4J7FA 5LJ5j 1O75A 2A8EA 4CS3A 4JRKA 1K8AU 1M1FA 3UFGA 5FU6B 3NEMA 1Y96A 1M5Q1 1ZQ1A 3QBYA 2LQ8A 3ER0A 1PSEA 5D6WA 1NE8A 5CKBA 3ICAA 3BDLA 3QO5A 4PJOA 3RF1A 2ZT6A 3OYCA 4CS4A 3QO3A 2DAQA 5E3IA 2FYKA 5KE2A 4OB2B 4DQ2A 3A5ZA 1VQ6A 4M75C 3A5YA 3FEOA 3Q1JA 1K8AC 2ZNIA 2NS6A 3S3OA 3VBBA 2ZPBB 4M77E 4JS4A 1MGQA 4M7DE 2FHDA 1KQ2A 2CYZB 4P3PA 2MWOA 3CD6T 4YP0A 1JJ2A 3NETA 2GQVA 2LRQA 3A31A 5GAN8 3LWIA 1JJCB 4M77B 1Q86U 5HK3A 4BACA 3VQXA 2XGTA 5FRNA 4IUVA 3L2ZA 1PYSA 5FROA 1M1KC 2P5IA 1UGRB 3DSQA 2ARSA 5I21A 4TVAB 2OTJT 2K5LA 4BW9A 3VUZA 1B34A 1VQZA 2IY5B 2ARUA 4UP7A 2I4NA 5LJ5f 3H6ZA 2DTHA 2P0PA 4JLGA 3JCMg 2DVEA 2XHCA 5ELNA 3RIRA 4O2DA 4CH4A 4KQEA 4TVRA 1YJNA 4PJOD 3I7FA 3QUIA 5D6XA 1YJWA 4YRIA 4Q5WA 1BBWA 5KCOA 3VKIA 1IL2A 2QQRA 2RHUA 1NPRA 2HQEA 1VQPA 2ZXFA 3JCMc 3OS5A 4FSXA 3EFSA 3L2QA 4QW2A 5GMKh 3GP8A 5M9OA 3GPLA 4BE2A 3HSBA 4A4HA 3CCUA 2DZCA 1B8AA 1VQOA 4LVJA 4E47A 3UDCA 1U1TA 5I2SA 4PNOA 1VQ7T 4EMGA 5GANg 3MQZA 4C92B 4CI0C 4H2YA 5FU7B 3LSSA 2DQ0A 4ATOA 3META 2E5QA 5C0MA 2CKKA 5LJ3j 3UGTA 2QHTA 3G4ST 2LX9A 3LWHA 4A53A 2DKGA 4WF2A 1S72A 4Z02A 2ZZEA 4V2SA 3P8BB 1G5HA 1V29B 3GNFB 1HTTA 4YPFA 2VXEA 2IVWA 5LJ5h 2PVOB 4M75G 2P4TA 1KD1C 3MF2A 4XTZA 5GAMh 1Q82U 4M77G 1Z7NA 2ZT7A 3M4YA 4N4HA 2ALYA 2EQKA 2P0LA 2OTLT 3PIOA 1DJ7B 3A7UA 1NJ6A 2CJ9A 3OYYA 3CPWA 4M78A 2I4OA 4UC4A 3LC0A 3VU3C 2VYTA 2DXTA 4Q6GA 4KUIA 4YRPA 4M7DC 1G3YA 4KULA 3OBWA 1Q82C 3FDRA 4M7AB 4H2XA 4HWSA 2DIGA 1YJNT 4J6YA 3P8TA 1YFSA 4UP9A 3HY1A 3HP9A 3M54A 3JCMX 5LJ3e 2RB6A 4BUGA 2ZR3A 2EQMA 4YRQA 4PKCC 3LW5E 3QO8A 2X4JA 1WPYA 4J7IA 2Q5HA 1I5LA 3JCMe 1YIJT 2JOYA 4YTLA 4ZN1A 2E6NA 3QIIA 3E1SA 4HT8A 1FXXA 2EIFA 3BFMA 2RHSB 4NL3A 3OY9A 2CZ1B 1KHIA 3M55A 3RESA 2QQAA 1HXDA 3ASKA 4IUPA 2QTXA 4M77C 4M7DB 3C94A 3CCUT 1BYMA 4JRIA 4A4GA 3OYAA 4M7AC 1N9WA 3A7RA 2DO3A 11ASA 4DPGA 4HWOA 3BJUA 3KXTA 2RHQB 5DLQE 4M75F 4NL2A 1NJ2A 3UT1A 4D6WA 4ELZC 3JSCA 4MDXA 4A4KA 4J83A 4HCCA 1KHCA 4BI8B 1N9RA 1UEBA 4M7DA 1Q7YU 2JTMA 2M0OA 2XK0A 3FC3A 1WQ7A 4YRNA 3F70A 5EG2A 4JRQA 1B34B 3CXCA 1Q81U 1U1SA 1M90U 3CC7A 1H4TA 4FU6A 4OLFA 3A8LB 4C92D 3SB2A 3HL8A 3OYMA 1X75C 4M7AA 3OYDA 1M9SA 3MP1A 4C8QF 1G51A 3A8GB 4M77A 1Q86C 1Y96B 4C5EA 3HRTA 4LDUA 2O4XA 3NTHA 5GAOq 2G3RA 4YROA 3HKSA 5KE3A 1VQNT 2ZIMA 1QVFA 1YFTA 4H2XB 4BD3A 3CCMT 1VQ8A 3HY0A 4BWAA 3A5ZB 3JAME 2DZ9A 3LYIA 3VQYA 5GAOl 2E70A 3JCMf 2LNVA 1VQLA 1E24A 4PJOB 3C4SA 4YRTA 4HT4A 4YCUA 4BI4A 4EMKC 1KMMA 1G5IA 4ZTZB 2VC8A 2DU7A 3V7CA 2ODRC 3MF1A 2ZCEA 3PFSA 1X01A 2XI9A 3MEWA 1EFWA 2P0QA 2EJGA 1IZ6A 3EFRA 3ZBDA 1VQPT 5GANh 2E64A 4PLIA 3PGGA 5F5WA 1H641 2E1HA 4OB0B 3CCRA 1YITA 2F5KA 1D3BB 1EVKA 4HWPA 3CMET 4P75C 4FT2A 2V8JA 1NYRA 3LX7A 3M56A 4RMOA 2JNGA 4JLIA 3CCQT 3P8DA 5LJ5d 4TQDA 1OZ2A 3MO8A 4P75A 1L0WA 2E65A 1QP2A 1H4QA 4OVAA 1Q7YC 4LD9K 1VQ9A 2GFAA 1BIAA 2RK2A 3CCVT 3REUA 3CCVA 2OAUA 5GMKl 4K88A 3JCMQ 3CBPA 1EIYB 4YRRA 4WJ4A 1NJIC 2KQWA 5GMKe 3QO7A 4PJOF 2OTJA 3ME9A 4P72C 2VXFA 4KUDK 1YCYA 4NCXA 4O5VA 2O01E 4O6JA 3OYBA 1PSFA 3M58A 3TREA 3OYHA 5LJ3f 4ZN3A 2DIQA 2EJFA 2AKWA 1QVGS 5A0LA 2ZIOA 4J5YA 1ADYA 4LVMA 4P72A 4BE1A 4YCVA 1I4K1 3M53A 4E7LA 4LDXA 2K3XA 3TEGA 3A74A 1USYA 3JB9J 4TVWA 1N27A 4XEMA 2YRVA 4TWAA 3HHTB 4M78G 1QVFS 4ELYC 2DXBA 4C8QA 2JN0A 4M75B 4CH6A 5GAMd 2RJDA 2CZ7B 2DD5A 3J7AF 3R6OA 4QVZA 3CMQA 3QZ9B 3L2VA 1UGQB 3X24B 2RHXA 3PNWC 2LT4A 2PVGB 3TEHA 3PT9A 4M7DF 3SWNC 3KUFA 3HXZA 3HFOA 5HK0A 2RJCA 2D6FA 2X4WA 2DTOA 3CMEA 3TCJA 1NJ1A 2XTIA 3DB4A 3HFZB 4M75A 3A7AA 2WSEE 2Q7HA 4AH6A 4C8QB 2ZZFA 4TVYA 5KH6A 3CCST 4EMKB 4LVIA 4WI1A 4M7DD 2GF7A 3J80E 2MWPA 3OW2A 3AHUA 2O4XB 3W3SA 2QDYB 2LVMA 2YLBA 1BI3A 3HFZA 3VV0A 4C5HA 4N0AC 4N4IA 4ZTFA 3FRNA 1X54A 1FX7A 4QQGA 1XQHA 1Y7XA 5KCHA 3G71T 4N0AA 2PMEA 3LLRA 2KSSA 2D0QB 4RG8A 2RI5A 3M5AA 4XQ3A 1B7YB 2QEXT 2K3YA 3QYGB 2PMFA 1KC8U 3PCOB 4YRMA 1I8FA 4UP8A 2VGNA 2QHSA 2BIVA 4C92E 3VQVA 3QSUA 4YRGA 3QJYA 1G3TA 2CJBA 1G3WA 1EQRA 4E51A 3HRKA 3C95A 1M8VA 4LDWA 4JDSA 1EIYA 5FU6C 4UPAA 4C92C 2V8KA 4M75E 1NPPA 4M77F 3OYEA 2HAXA 4CS2A 2J3MA 1EOVA 4YCWA 1GXIE 4HWRA 3S6WA 3VJPA 4Q15A 2HNIA 4NS5A 2XD0A 1QE0A 4MMLA 2ZPFB 2MMPA 1UB4A 4C0DB 2VGMA 4IUTA 1VQ4T 1YJ9T 5A0GA 4EPCA 3FIFA 2RHSA 1Q81C 3URGA 5CKFA 2DXCA 3CBOA 5IAYA 3G4SA 1Y71A 2D9TA 2LCLA 3MEYA 4LDYA 4OB3B 2ZT5A 4R56A 2DK3A 2YHTA 3VQWA 4RCBA 4HT9A 1Z7MA 3G6ET 3CMAT 3NTKA 2ZPEB 3CCET 3CMAA 1VUBA 2QI2A 4J8OA 4P74C 4L59A 2EYQA 2AHJB 4XEOA 1M90C 3G6EA 4YRLA 1H3ZA 5GANf 2I4MA 4OGEA 4BDYA 5GAN2 1WYDA 1TH7A 1N8RU 3H8ZA 2Y4YA 1N9SA 4YDQA 3VUBA 3VYHB 3SWNB 3L2RA 3FJPA 5GAMg 4XTXA 3OW2S 2DU5A 3CXCS 5HKCA 4ZGJB 1WJSA 4C5GA 1VIEA 1X2HA 1AHJB 5AYFA 5CQYA 4H2UA 2RHYA 2KY9A 4B9XA 2RI2A 2CIMA 2MAMA 1VQ5A 3P8HA 3CC4T 1JRIA 4II1A 2RJFA 2R5AA 3BY7A 3M57A 4YRJA 3CPFA 1YHQT 1QW1A 3E9IA 2DD4A 2RHZA 2OTLA 4MZTA 3HPWA 3IG2A 2K57A 3GIBA 1RL2A 4QQ6A 5CR2A 4X34A 1BI1A 5LJ3h 2I4LA 1LJOA 3RMQA 3RUXA 2R58A 3MHXA 4P71C 4HCBA 1YI2A 4GY5A 3MP6A 4ZGEB 5FRMA 3OYKA 1QF6A 5HY6A 5GAN7 2DEQA 5GAMj 2LC4A 1WJRA 2L8DA 2QXFA 4TQFA 2RA2A 4XU1A 3V7RA 1BI0A 2A3LA 1K73C 3NFCA 2C8MA 3IKLA 4TVAA 5GMKm 3OQ5A 3M9QA 4HKEA 2RK1A 2QQBA 3PIPA 3NELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P72 C;  2VXF A;  4YYE A;  2RD1 A;  3JCM g;  1YCY A;  2DVE A;  4NCX A;  5ELN A;  4P74 A;  5C52 B;  4H2V A;  2EJ9 A;  3RIR A;  4F7U F;  1KOG A;  4O2D A;  5LJ3 f;  4CH4 A;  4KQE A;  3HTZ A;  4PJO D;  2EJF A;  3HXU A;  3I7F A;  3QUI A;  3HXY A;  3L1A A;  2AKW A;  4YRI A;  2ZIO A;  3WQZ A;  4J5Y A;  1ADY A;  4LNS A;  4ZTU B;  1JBM A;  1BBW A;  1PYS B;  3V8L A;  4P72 A;  5C53 B;  4YCV A;  1IL2 A;  2ZNJ A;  2J3L A;  2ZXF A;  3JCM c;  1I4K 1;  2QHV A;  5HGQ A;  3EFS A;  3E9H A;  3TEG A;  3A74 A;  2E3C A;  1USY A;  5GMK h;  3JB9 J;  4RDX A;  3HSB A;  2FB7 A;  4EMK A;  4TVW A;  5GAN 4;  2DZC A;  4XEM A;  1B8A A;  4TWA A;  3FB9 A;  4M78 G;  4P73 C;  1U1T A;  5C51 B;  4C8Q A;  2RM4 A;  4PNO A;  2JN0 A;  1D3B A;  2YLC A;  4EMG A;  5GAN g;  1NYQ A;  4C92 B;  4M75 B;  1WLE A;  4H2Y A;  3LSS A;  4CH6 A;  3TUP A;  2EAY A;  2DQ0 A;  3HFV A;  5GAM d;  1EVL A;  4A54 A;  4H2T A;  3HXW A;  5LJ3 j;  3UGT A;  2QHT A;  4WJ3 M;  3HXV A;  3CMQ A;  4P3O A;  5GMK j;  3V7S A;  5CAI A;  3BDU A;  2E10 A;  3JCM V;  4A53 A;  3L4G A;  2DKG A;  2ZTG A;  4WF2 A;  1NJ8 A;  4PHC A;  3JCM h;  3TEH A;  4M78 D;  4M7D F;  3SWN C;  2ZZE A;  3LSQ A;  4C8Q G;  4J15 A;  4YRE A;  3HXZ A;  3HFO A;  4V2S A;  4YRS A;  4XTV A;  2Q7G A;  1G5H A;  2ZR2 A;  4NOY A;  5ELO A;  2DTO A;  1HTT A;  4YPF A;  2VXE A;  4XTW A;  1WNL A;  5LJ5 h;  4M75 D;  1ADJ A;  4M75 G;  2AMC B;  2G4C A;  3MF2 A;  1NJ1 A;  2XTI A;  4XTZ A;  4C92 A;  5GAM h;  4M77 G;  1NNH A;  4QVD A;  2QHU A;  3HFZ B;  2DJZ A;  4M75 A;  1Z7N A;  3A7A A;  2ZT7 A;  2Q7H A;  4AH6 A;  2ALY A;  4C8Q B;  2ZZF A;  4TVY A;  2P0L A;  3HFN A;  4M7A E;  3IAL A;  3P8V A;  1B76 A;  4XU3 A;  4EMK B;  1J5W A;  4K87 A;  3A7U A;  1NJ6 A;  2CJ9 A;  4WI1 A;  4M78 F;  4M7D D;  4M78 A;  2I4O A;  3LC0 A;  3JB9 G;  3VU3 C;  3AHU A;  3W3S A;  1SES A;  2CJA A;  2DXT A;  2YLB A;  4Q6G A;  3HFZ A;  5GAO p;  4YRP A;  4M7D C;  4F7U E;  1E1T A;  4N0A C;  1USY C;  1X54 A;  4M7A B;  4EMH A;  4H2X A;  1E1O A;  3M4P A;  2E41 A;  4HWS A;  4N0A A;  2PME A;  4J6Y A;  5GAN e;  3RKX A;  3P8T A;  5LJ3 d;  1YFS A;  4C8Q D;  4UP9 A;  3HY1 A;  5GAN d;  4XQ3 A;  3JCM X;  5LJ3 e;  4RCC A;  2RB6 A;  1B7Y B;  4EO4 A;  4HWT A;  2ZR3 A;  2PMF A;  4C8Q E;  4YRQ A;  3PCO B;  3HXX A;  4YRM A;  4YRF A;  1HK9 A;  3QO8 A;  1I8F A;  4UP8 A;  1WPY A;  2Q5H A;  2QHS A;  1JJC A;  4C92 E;  1I5L A;  3NEN A;  3JCM e;  3VQV A;  3PCO A;  3QSU A;  5GAM f;  4YRG A;  4HT8 A;  4H2W A;  5GAN 3;  1LYL A;  4M78 E;  2CJB A;  3QHS A;  1EQR A;  4E51 A;  3HRK A;  3QNE A;  3ERR A;  1ASZ A;  5DY9 A;  3BFM A;  2RHS B;  3RKY A;  4NL3 A;  1H4S A;  1M8V A;  4L87 A;  1EIY A;  5LJ5 e;  3A32 A;  1KQ1 A;  2CGH A;  3RES A;  1SET A;  12AS A;  4H02 A;  4UPA A;  4RQF A;  1HXD A;  4C92 C;  3JB9 F;  4JUV A;  4M75 E;  3JB9 H;  4M7D G;  2QTX A;  2RHQ A;  4M77 C;  4M77 F;  3RGL A;  4M7D B;  4CS2 A;  2J3M A;  1EOV A;  2DDZ A;  4PJO C;  3JCM W;  4YCW A;  4JRI A;  4M7A C;  4HWR A;  4M77 D;  1N9W A;  3A7R A;  1SRY A;  4Q15 A;  1B70 B;  4CH3 A;  2DQ3 A;  11AS A;  2HNI A;  4DPG A;  5GAO r;  4M7A D;  4HWO A;  3BJU A;  4F7U G;  5GAO n;  1QE0 A;  4CH5 A;  2DXU A;  1YGB A;  4K86 A;  1FYF A;  2RHQ B;  4M75 F;  1W66 A;  1BIB A;  4MML A;  4NL2 A;  1NJ2 A;  3RER A;  4F7U A;  4M78 C;  5LJ5 g;  2ZT8 A;  5GAN 5;  4TTV A;  3FIF A;  2RHS A;  1B70 A;  1YFR A;  3P8Y A;  4XU2 A;  1I81 A;  3IKM B;  2ART A;  1N9R A;  3MEY A;  4M7D A;  1H4V B;  5LJ3 g;  2ZT5 A;  4Y91 A;  4XU0 A;  4YRC A;  2YHT A;  3RL6 A;  4KR2 A;  1ATI A;  1B7Y A;  1WQ7 A;  3VQW A;  4YRN A;  1B34 B;  4P3N A;  4PG3 A;  4EX5 A;  1U1S A;  4RCB A;  3PZC A;  4HT9 A;  1Z7M A;  3M4Q A;  1H4T A;  4KR3 A;  4OLF A;  3RKW A;  4X9D A;  4C92 D;  3SB2 A;  2I2L A;  3UH0 A;  4M7A A;  1SER A;  1RIQ A;  4C8Q F;  4X9C A;  3V8K A;  1G51 A;  2DTI A;  4M77 A;  1C0A A;  1Y96 B;  1X55 A;  3G1Z A;  4M7A G;  5KNN A;  4P74 C;  4PJO E;  4OP0 A;  2ODR D;  3JB9 I;  2ZGW A;  1E22 A;  5GAO q;  4M78 B;  2Q7E A;  4YRO A;  4XEO A;  5K1X A;  2EL9 A;  3SWN A;  4YRL A;  3QTC A;  1KMN A;  2ZIM A;  5GAN f;  2I4M A;  1NJ5 A;  5GAN 2;  1YFT A;  3V8J A;  5GAN 6;  4QVC A;  1WYD A;  1X2G A;  2Q5I A;  2ZIN A;  1TH7 A;  4H2X B;  1ASY A;  1YB3 A;  1WU7 A;  2C7I A;  5K1P A;  1N9S A;  4YDQ A;  3HY0 A;  4BWA A;  3JCM J;  3BW1 A;  2AMC A;  3SWN B;  3JCM P;  3FJP A;  5GAM g;  4XTX A;  2DU5 A;  2DZ9 A;  2AKW B;  3VQY A;  5GAO l;  1LNX A;  3JCM f;  4P71 A;  4PJO G;  5LJ5 j;  2ALY B;  1X2H A;  4J6X A;  4RQE A;  4CS3 A;  4JRK A;  3TEH B;  1E24 A;  4PJO B;  4YRT A;  2E5A A;  4YRK A;  4YCU A;  3REX A;  3UFG A;  4H2U A;  3L4G B;  3M4G A;  4EMK C;  1KMM A;  3NEM A;  1Y96 A;  1M5Q 1;  1G5I A;  4ZTZ B;  2EWN A;  2CIM A;  2VC8 A;  4G85 A;  3UGQ A;  2DU7 A;  3V7C A;  2ODR C;  3MF1 A;  2ZCE A;  4C92 F;  4HA8 A;  1X01 A;  4X5O A;  2IY5 A;  1JRI A;  3JCM b;  3ICA A;  3QO5 A;  4PJO A;  3RF1 A;  2ZT6 A;  4CS4 A;  1EFW A;  3BY7 A;  3QO3 A;  4YRJ A;  2Y90 A;  2EJG A;  1GGM A;  3RAC A;  3EFR A;  5GAM e;  5E3I A;  2FYK A;  3E9I A;  5GAN h;  2E64 A;  3IG2 A;  1X56 A;  3PGG A;  2K57 A;  4DQ2 A;  3A5Z A;  5F5W A;  4M75 C;  3GIB A;  1H64 1;  2E1H A;  3KFU A;  3R07 A;  3A5Y A;  4RMF A;  3OD1 A;  2ZNI A;  5LJ3 h;  2I4L A;  1LJO A;  3JCM d;  1D3B B;  4F7U B;  4HVC A;  1EVK A;  3VBB A;  4HWP A;  4M77 E;  1MGQ A;  4P75 C;  4M7D E;  3RUX A;  1NYR A;  1KQ2 A;  4P3P A;  5GAO m;  4YP0 A;  4JLI A;  4MMK A;  3HRI A;  4C92 G;  5LJ5 d;  3NET A;  4TQD A;  5GAN j;  4XTY A;  4P71 C;  4ZIB A;  1LOJ A;  3JB9 D;  4P75 A;  1BBU A;  3A31 A;  2ZZG A;  5GMK i;  1L0W A;  2E65 A;  4XTU A;  4J6W A;  5GAN 8;  1JJC B;  1H4Q A;  4M77 B;  4C8Q C;  3VQX A;  1QF6 A;  5GAN 7;  4P73 A;  2XGT A;  2DEQ A;  5GAM j;  3L2Z A;  1HC7 A;  1PYS A;  1BIA A;  4H2S A;  3INZ A;  2P5I A;  4TQF A;  2RA2 A;  4XU1 A;  3DSQ A;  2ARS A;  5I21 A;  3V7R A;  4TVA B;  4M7A F;  3REU A;  5GMK l;  4K88 A;  4BW9 A;  3JCM Q;  1EIY B;  1B34 A;  1VQZ A;  2IY5 B;  4YRR A;  2ARU A;  2C8M A;  3IKL A;  4WJ4 A;  4TVA A;  5GMK m;  4G84 A;  4UP7 A;  1WQW A;  2I4N A;  5GMK e;  5LJ5 f;  3QO7 A;  4PJO F;  2DTH A;  3NEL A; 
#chains in the Genus database with same CATH topology
 2VV5 A;  3OB9 A;  1X2K A;  4YYE A;  2RD1 A;  2KAF A;  1K8A R;  5C52 B;  4XK8 E;  4H2V A;  2EJ9 A;  3OSS C;  4F7U F;  4IIM A;  2HQX A;  5DLO A;  3CPW S;  1PRM C;  3PVQ A;  1UHF A;  1HSQ A;  3DB3 A;  1QVP A;  2EVR A;  4RTV A;  1G5V A;  3HXY A;  3L1A A;  1KQS A;  2F69 A;  4LNS A;  3OBY A;  1JBM A;  5L8R E;  5J3B A;  1SHG A;  3V8L A;  1BK2 A;  5C53 B;  2DJQ A;  1OPK A;  1PKT A;  1VQN Q;  1KQS S;  2EGA A;  5IHK A;  2ECZ A;  4J9I A;  2KR3 A;  5L23 A;  2WAC A;  2A7Y A;  3CCS Q;  5HGQ A;  4C5I A;  2BKD N;  4LD6 A;  4XAX B;  4RDX A;  4EMK A;  1WHJ A;  2YUQ A;  1FWZ A;  4JZ3 A;  2FRY A;  2Y4X A;  1M2V B;  3X25 B;  3EHQ A;  3DLL A;  1X69 A;  3CC7 Q;  2XG8 D;  1WGS A;  2ED1 A;  3GNG A;  5C51 B;  3LH0 A;  1N8R C;  2HSE B;  5IHN A;  1D3B A;  1NYQ A;  2MI6 A;  3OYI A;  3L2U A;  3TUP A;  1AWX A;  4AFZ C;  2CUD A;  5A2Q E;  3HFV A;  2LT1 A;  4H2T A;  1NM7 A;  3HXW A;  2DYI A;  4ZGD B;  1K0S A;  1BKB A;  1IO6 A;  1QWF A;  3QYH B;  4WJ3 M;  1NYG A;  2J06 A;  4P3O A;  5GMK j;  5CAI A;  1X6B A;  3BDU A;  2PZ1 A;  3JCM V;  2ZTG A;  4Y92 A;  1NJ8 A;  3PE0 A;  1KC8 R;  3JCM h;  3QWX X;  4BB7 A;  1W2B P;  3LSQ A;  4R55 A;  3L2W A;  1VQN A;  1AZG B;  4YRS A;  4XTV A;  2F2X A;  5DM7 R;  5AT1 B;  2EKH A;  2K5I A;  2KGT A;  4XTW A;  1W4S A;  4M75 D;  1WIE A;  1SF9 A;  2O31 A;  7AT1 B;  2ZAE A;  3A8O B;  1ADJ A;  2AMC B;  2G4C A;  3REA B;  1VA7 A;  2M0Y A;  1GCQ C;  2J05 A;  2IG0 A;  2PTK A;  1YBY A;  2QHU A;  4QT7 A;  2JXB A;  3QKJ A;  2JMA A;  3G71 Q;  1IGQ A;  2CP5 A;  2AIR B;  2LZ6 B;  4LVL A;  2O2O A;  3HFN A;  2J6K A;  4DOW A;  3P8V A;  1B76 A;  4K87 A;  1PKS A;  1IRX A;  1B07 A;  1M2V A;  2EQI A;  3C12 A;  2GFU A;  1M1K U;  1SES A;  2AZV A;  2F5T X;  4JJN K;  5GAO p;  2CH4 A;  1E1T A;  3JV3 A;  4VUB A;  4EMH A;  4J9F A;  3M4P A;  4J9C A;  5GAN e;  3RKX A;  1OZ3 A;  2B86 A;  5LJ3 d;  2RI3 A;  5D7U A;  3M0T A;  1QLY A;  3OYG A;  2RO0 A;  3CEY A;  4C8Q D;  4DOV A;  1YN8 A;  1BI2 A;  5GAN d;  3CCQ A;  4OMM A;  3D7S B;  2IPO B;  3CMA Q;  2HL3 A;  1YFN A;  2LX7 A;  4OB1 B;  1D1B A;  1N8R R;  3X28 B;  1WHH A;  4HWT A;  4LUD A;  3QJ6 A;  3ZFJ A;  3HXX A;  4YRF A;  1C6V X;  1HK9 A;  3QDR B;  3X20 B;  2HBP A;  3BE3 A;  1JJC A;  3NEN A;  4ME7 A;  1R77 A;  1KIK A;  3CC2 A;  2JS2 A;  5CK9 A;  5GAN 3;  1TWB A;  2ABL A;  3VRZ A;  2MF2 A;  4M78 E;  2MCN A;  3CCV Q;  3QNE A;  2K5F A;  3ERR A;  3WVE B;  1MNE A;  3MKD A;  1VQM A;  3X26 B;  1ZSZ A;  2G6F X;  1H4S A;  1W2B S;  2NUP B;  1KQ1 A;  2COZ A;  4EDU A;  3OYN A;  3SDZ A;  1ZA1 B;  2QQS A;  4M7D G;  3RGL A;  1YI2 T;  2HKN A;  3I5S A;  5C6S A;  2DDZ A;  2J6F A;  2X4Y A;  2EBP A;  1AWJ A;  3I55 A;  1V1C A;  4PFP A;  4FIB A;  3M0Q A;  1JO8 A;  5LL6 S;  1NZ9 A;  1VQM Q;  2M1H A;  2P0K A;  1YIJ A;  2FO0 A;  2DQ3 A;  3QWY A;  5GAO r;  4M7A D;  1HJD A;  1VQM T;  2DXU A;  4BDZ A;  2E6Z A;  2LQK A;  1W66 A;  4E7I A;  2FL7 A;  4F7U A;  2KK4 A;  4HCK A;  3CCU Q;  2B8A A;  2W0Z A;  4RKU E;  1YI2 Q;  2ZT8 A;  5GAN 5;  1ZBJ A;  1JB0 E;  4DA4 A;  2M16 A;  2PVD B;  4IIO A;  3CCL A;  2BZX A;  1ARK A;  1XOV A;  3QPH A;  3IKM B;  2NUT B;  4QKU A;  3PTA A;  2YUO A;  4AFU C;  2GTO A;  4FM4 B;  5LJ3 g;  4XU0 A;  3CCM A;  2WSF E;  1YIJ Q;  1PG5 B;  5I2M A;  4QQD A;  1B7Y A;  3TSW A;  5CCA A;  2V26 A;  3N5B B;  4L5G A;  4P3N A;  4PG3 A;  4EX5 A;  1WFW A;  3PZC A;  3ZEH A;  4KR3 A;  1N6A A;  1OYX A;  3RKW A;  1VQ7 Q;  3UH0 A;  3PMT A;  1VYT A;  3LH5 A;  1EX4 A;  2OAW A;  3DLM A;  1IRE B;  3GLX A;  3EG9 B;  3L42 A;  4A63 B;  3FLG A;  4CC3 A;  1RIQ A;  3T9N A;  1XTD A;  3CC7 T;  2DTI A;  1KQS P;  1VQ5 T;  3G1Z A;  3H9N A;  1OPL A;  1Q86 R;  4PJO E;  4ZNX A;  1XNI A;  4OP0 A;  2ODR D;  3JB9 I;  2ZGW A;  1E22 A;  2KVQ G;  1R8O B;  3OS1 A;  5CQX A;  5K1X A;  2EL9 A;  2ZCF B;  2QA4 T;  3S3N A;  1RUW A;  4E7S A;  3E19 A;  4DEX A;  3QTC A;  4KRT A;  3PMI A;  1KMN A;  4B6M A;  3E9G A;  3TU4 K;  4E7H A;  3MP8 A;  1NJ5 A;  3CCQ Q;  3V8J A;  2ZIN A;  2F2V A;  1X2G A;  2C0O A;  1MMD A;  1WU7 A;  2QA4 Q;  1RAC B;  2PU9 B;  2C7I A;  5K1P A;  1H8K A;  4B9W A;  1RAI B;  3C0C A;  3JCM J;  2GTJ A;  2EFI A;  3BW1 A;  2BUD A;  1ACM B;  1K9M U;  1VQK A;  3MCA B;  3I55 Q;  3RNJ A;  2NWM A;  2EYY A;  4ORZ A;  3LGL A;  1WHM A;  1U5S A;  1MMG A;  2M9U A;  4P71 A;  2HSP A;  3HRU A;  3EFO B;  1VQ7 A;  3G7Z A;  2KYB A;  2X35 A;  2ALY B;  4J6X A;  4RQE A;  2CH4 W;  1M1G A;  1U3O A;  3TEH B;  2L3Q A;  2E5A A;  4YRK A;  2YRC A;  3OS2 A;  3REX A;  3GOX A;  3L4G B;  3M4G A;  3OMG A;  3CC4 A;  3G6E Q;  2EWN A;  3ZL7 C;  1C1A A;  1UGP B;  3OYJ A;  4G85 A;  3UGQ A;  2JUF A;  1WJQ A;  2YDL A;  2JVV A;  4C92 F;  3EAE A;  4HA8 A;  2DET A;  2PNI A;  3NTI A;  5J26 A;  3TEE A;  1RAE B;  4X5O A;  4LDV A;  2K3B A;  2IY5 A;  3JCM b;  5IN1 A;  2H3J A;  4DBF A;  3EGU A;  5IH2 A;  2Y90 A;  1GGM A;  2KDS A;  3RAC A;  1NJI U;  5GAM e;  1IHV A;  3CBM A;  1X56 A;  1WI7 A;  1X43 A;  2DPP B;  5ECA A;  4FT4 A;  3KFU A;  1YJ9 A;  3R07 A;  4RMF A;  3OD1 A;  2E3I A;  1K9M C;  1FYN A;  3QZ5 B;  5A0D A;  3JCM d;  4F7U B;  3UA6 A;  4HVC A;  3OYF A;  4IUQ A;  4C0Z A;  2LP5 A;  5GAO m;  2JS0 A;  4MMK A;  2RQW A;  3HRI A;  4C92 G;  2ROT A;  5GAN j;  4XTY A;  4ZIB A;  1LOJ A;  4Y28 E;  2XID A;  3JB9 D;  1BBU A;  4A4F A;  2ZZG A;  5GMK i;  4XTU A;  4J6W A;  2K2V A;  4JJD A;  4IUR A;  4C8Q C;  1YHQ A;  2L89 A;  3VS1 A;  4P73 A;  4P5N A;  1M4Z A;  3LGF A;  1HC7 A;  3MEU A;  1TSF A;  4H2S A;  3INZ A;  1SRL A;  4M7A F;  2EQJ A;  2K4Y A;  1H92 A;  5CVI A;  2RH2 A;  2V8I A;  4BY6 C;  4G84 A;  1LCK A;  1WX6 A;  1WQW A;  1K73 U;  5CKE A;  4MZM A;  3O8V A;  2QEX A;  1JJ2 P;  4P74 A;  4A4E A;  3H41 A;  2EPD A;  1S72 T;  1KOG A;  1VQ6 T;  4PLL A;  2OI3 A;  2MPX C;  3THK A;  4RTZ A;  3HTZ A;  2GCX A;  3UPU A;  4D8K A;  4RTW A;  4OMF B;  1WA7 A;  3NGP A;  5FLX E;  3HXU A;  4RG2 A;  4AG2 C;  3WQZ A;  1UG1 A;  4ZTU B;  2JTF A;  1S1N A;  2FZG B;  3M59 A;  4AG1 C;  1PYS B;  2NLU A;  3SD4 A;  2XDD A;  2EGE A;  3VS6 A;  1QVG A;  2CP6 A;  2ZNJ A;  4JS5 A;  3WXM B;  1CSK A;  2J3L A;  2BZY A;  4F04 B;  3G71 A;  2FPE A;  2EQU A;  4N4G A;  2QHV A;  1W2B A;  3E9H A;  3WVD B;  2HQH A;  3CCS A;  2E3C A;  4PL6 A;  3CCJ Q;  2D1X A;  2CZ6 B;  2FB7 A;  3VS7 A;  3VYG A;  4MZP A;  1VQ5 Q;  2CUB A;  5GAN 4;  2BE7 D;  2HKQ B;  1PWT A;  3FB9 A;  2GGR A;  4P73 C;  4BY6 B;  3OMC A;  1QQJ A;  2RM4 A;  2FG0 A;  3QG1 A;  3A98 A;  3A8H B;  2YLC A;  1KG1 A;  4ZTJ A;  1WLE A;  1VQO T;  3I5R A;  5IHI A;  2EAY A;  1C0M A;  1EVL A;  4A54 A;  2XDP A;  2QYZ A;  2KMT A;  1WHG A;  3S3M A;  4J9D A;  3M0R A;  4LNP A;  4MDW A;  3OSV A;  3HXV A;  3CCL T;  2PUO B;  3V7S A;  4C0F A;  3OYL A;  2E10 A;  4C0D C;  3L4G A;  1P92 A;  2R5M A;  3MEV A;  4PHC A;  4M78 D;  3GF5 A;  2LCC A;  4YRE A;  4C8Q G;  4J15 A;  5CKH A;  4KGV B;  2Q7G A;  2KRS A;  2ZR2 A;  4NOY A;  3MEA A;  5ELO A;  1WNL A;  1VQ4 Q;  4HCZ A;  4JRP A;  2CS7 A;  1EIF A;  2FRW A;  2VUB A;  4C92 A;  1NNH A;  4QVD A;  1U8R A;  3RR6 A;  2DJZ A;  4HVU A;  2LJ1 A;  1QP3 A;  4FL6 A;  4F16 A;  2HL5 C;  3CCJ T;  4FW2 A;  4M7A E;  6AT1 B;  2JM8 A;  3IAL A;  4XU3 A;  1J5W A;  3OS0 A;  4KT0 E;  4OMN A;  4M78 F;  1JQQ A;  1W1F A;  1T0J A;  3JB9 G;  4LVK A;  3CCE A;  1UHC A;  2CJA A;  5IT9 E;  5D6Y A;  2XKO C;  2NYS A;  1TUC A;  3SEM A;  4F7U E;  1IHW A;  1IB8 A;  5J39 A;  3OA6 A;  1EZZ B;  1VIF A;  1BBZ A;  1USY C;  1Y57 A;  3HRS A;  4KGX B;  1E1O A;  1Q82 R;  2EKO A;  2E12 A;  2A08 A;  2COY A;  2E41 A;  3DKM A;  4IKF A;  5CO7 A;  2A37 A;  4OMO A;  1T3L A;  1YJW T;  2KBT A;  4RCC A;  3EH2 A;  3CD6 A;  2DLP A;  4EO4 A;  2QQ9 A;  2L5Q A;  4C8Q E;  2K7A A;  4BI3 A;  1RI0 A;  2PQW A;  3QXE B;  4C0G A;  1ZBX A;  3PCO A;  5GAM f;  2QA4 A;  1BB9 A;  1VQ4 A;  1VQK T;  2J6O A;  2F2W A;  4H2W A;  2QGF B;  3SFM A;  1LYL A;  2L0A A;  1BU1 A;  3QHS A;  3I9Q A;  5KYY B;  3CCL Q;  1X6O A;  2CZ0 B;  1ASZ A;  5DY9 A;  3KBG A;  3RKY A;  2R57 A;  1VYV A;  4L87 A;  5LJ5 e;  3A32 A;  3HTR A;  2PUK B;  2CGH A;  2ZPI B;  1SET A;  12AS A;  4H02 A;  4RQF A;  1ZLM A;  3JB9 F;  2FEI A;  4JUV A;  3JB9 H;  5GJV B;  5CKD A;  5KYW B;  2RHQ A;  4E7K A;  3JCM W;  4PJO C;  1YNZ A;  3CQT A;  4M77 D;  4L6V 5;  1VQ9 T;  1SRY A;  2CP3 A;  1B70 B;  4CH3 A;  1G3S A;  2RJE A;  2ZPG B;  4F7U G;  5GAO n;  3ULR B;  3UWN A;  1VQ9 Q;  4CH5 A;  2KXD A;  2MIO A;  1YGB A;  4K86 A;  1FYF A;  1SHF A;  1BIB A;  2ZZD A;  2YRD A;  3RER A;  4M78 C;  3RMS A;  5LJ5 g;  4CRI A;  3I56 T;  4TTV A;  3CC2 T;  1O9S A;  2HBW A;  4WTO B;  1B70 A;  1YFR A;  3P8Y A;  2FVU A;  4XU2 A;  1I81 A;  1ABQ A;  1M27 C;  1R0B G;  3JRZ A;  4GLK A;  4E7J A;  2IIM A;  2ART A;  1YIT T;  3CCR T;  1UUE A;  2C06 A;  1H4V B;  1OI1 A;  1SSF A;  4Y91 A;  1UGS B;  3J81 E;  4YRC A;  4CC4 B;  1UFF A;  1KD1 U;  1ATI A;  1M2O A;  3RL6 A;  4KR2 A;  2XDB A;  1TG0 A;  1KC8 C;  3QDF A;  4KBM B;  4DBQ A;  3M4Q A;  4X9D A;  2I2L A;  3CCJ A;  2RHI A;  1JJ2 S;  3TSZ A;  1YWP A;  1SER A;  3NEL A;  4BE0 A;  4IUU A;  1V76 A;  2LCS A;  3A8M B;  4E6R A;  4X9C A;  3V8K A;  1VQL T;  3EG3 A;  1C0A A;  5FU7 C;  1JU5 C;  2CT4 A;  4JJB A;  4M7A G;  1X55 A;  5KNN A;  2X3X D;  2XU8 A;  3I55 T;  2L3R A;  1D09 B;  4OGC A;  1QVG P;  4M78 B;  2DF6 A;  2Q7E A;  3EFO A;  2ROL A;  1MHN A;  5KYU B;  2XIC A;  2JT4 A;  3IQL A;  2HD0 A;  2AZS A;  1VQ8 T;  4HVW A;  3O5Z A;  3SWN A;  1M90 R;  1Q81 R;  1Y07 A;  1T0H A;  2LTO A;  2ZPH B;  3EH1 A;  2JW4 A;  3E9F A;  4QVC A;  1BCO A;  5GAN 6;  2Q5I A;  1ASY A;  2LDM A;  2X4X A;  1YB3 A;  2QTV A;  3I56 A;  2DBM A;  1Q7Y R;  1MV3 A;  2WSC E;  4OF1 A;  4Z89 A;  2AMC A;  2JJ9 A;  3JCM P;  2AKW B;  4DEY A;  5CIU A;  2JZ2 A;  1LNX A;  2M51 A;  2RQT A;  1ZHI A;  4PJO G;  2DX1 A;  4J7F A;  5LJ5 j;  1O75 A;  2A8E A;  1RAB B;  4JRK A;  4CS3 A;  1K8A U;  3REB B;  1M1F A;  3UFG A;  5FU6 B;  3NEM A;  1Y96 A;  1M5Q 1;  1ZQ1 A;  1YHQ Q;  2YXY A;  3NHN A;  1KJW A;  3QBY A;  2LQ8 A;  4PJL A;  1JXO A;  1FMW A;  3RBB B;  1SRM A;  3ER0 A;  1PSE A;  4J9G A;  5D6W A;  1NE8 A;  5CKB A;  3G4S Q;  3ICA A;  3BDL A;  3UF4 A;  3QO5 A;  4PJO A;  3RF1 A;  2ZT6 A;  3OYC A;  3AT1 B;  1TOV A;  4FCY A;  4CS4 A;  3QO3 A;  1GRI A;  2VWF A;  1AWO A;  2DAQ A;  1K4U S;  5E3I A;  3VS3 A;  2FYK A;  5KE2 A;  4OB2 B;  2D0N A;  2V1R A;  4DQ2 A;  3A5Z A;  1VQ6 A;  4M75 C;  1YJ9 Q;  1WHK A;  1YCS B;  1M30 A;  3A5Y A;  3FEO A;  3Q1J A;  1K8A C;  2ZNI A;  1WXB A;  2NS6 A;  3S3O A;  2VVK A;  4WCI A;  3VBB A;  2ZPB B;  4M77 E;  4JS4 A;  1MGQ A;  1TTH B;  4M7D E;  2FHD A;  4E7Z A;  1KQ2 A;  2CYZ B;  4P3P A;  2MWO A;  3CD6 T;  4YP0 A;  1JJ2 A;  1VQP Q;  3NET A;  2GQV A;  2LRQ A;  3A31 A;  1OU9 A;  2JMC A;  5GAN 8;  1WZO A;  2X9H A;  3A1P A;  3LWI A;  4M77 B;  2CP0 A;  5HK3 A;  1Q86 U;  1JJC B;  2DL8 A;  4BAC A;  3VQX A;  3CC4 Q;  2XGT A;  1S72 Q;  5FRN A;  4IUV A;  1H3H A;  3L2Z A;  1PYS A;  4X1V A;  5FRO A;  1M1K C;  2P5I A;  1UGR B;  1J3T A;  3DSQ A;  4PFO A;  5I21 A;  2ARS A;  2OTJ T;  4TVA B;  2K5L A;  2DL5 A;  4LE9 A;  2DE0 X;  4BW9 A;  3VUZ A;  1B34 A;  1VQZ A;  2IY5 B;  1G2B A;  2ARU A;  1ZSZ B;  1VOM A;  3VS4 A;  4UP7 A;  1TUD A;  2I4N A;  1KD1 R;  5LJ5 f;  9ATC B;  3H6Z A;  2DTH A;  2P0P A;  4JLG A;  2NUT A;  3JCM g;  2DVE A;  2XHC A;  5ELN A;  2GNC A;  3RIR A;  4O2D A;  3SHW A;  4CH4 A;  4KQE A;  3TQ7 P;  1UE9 A;  4Z88 A;  4TVR A;  3CCR Q;  1YJN A;  4PJO D;  1XJW B;  1NYF A;  3I7F A;  1MND A;  3QUI A;  1W70 A;  5D6X A;  1I5O B;  1YJW A;  4YRI A;  4Q5W A;  2ESW A;  4M4Z A;  1BBW A;  1E6G A;  5KCO A;  3VKI A;  5KYN A;  1IL2 A;  2QQR A;  2RHU A;  1NPR A;  2HQE A;  4KH0 B;  1VQP A;  2ZXF A;  3JCM c;  2LNH B;  3OS5 A;  4FSX A;  3EFS A;  3L2Q A;  4QW2 A;  3H0H A;  5GMK h;  3GP8 A;  5M9O A;  3GPL A;  4BE2 A;  2QAS A;  3FJ5 A;  3HSB A;  4A4H A;  3CCU A;  5FW9 A;  2DZC A;  1OV3 A;  1B8A A;  1VQO A;  3EG0 A;  4LVJ A;  4E47 A;  3UDC A;  1U1T A;  5I2S A;  4PNO A;  1VQ7 T;  4EMG A;  2AK5 A;  5GAN g;  3MQZ A;  1OX8 A;  4C92 B;  4CI0 C;  1D0Y A;  4H2Y A;  1WXT A;  2MYS A;  5FU7 B;  3LSS A;  4K11 A;  4ATO A;  2DQ0 A;  3MET A;  2E5Q A;  5C0M A;  2CKK A;  5LJ3 j;  4LUE A;  3UGT A;  1OEB A;  2QHT A;  3G4S T;  1YWO A;  2YT6 A;  4KH1 B;  2LX9 A;  5IXB A;  3LWH A;  4A53 A;  2RQR A;  2DKG A;  1YIT Q;  4WF2 A;  2DRK A;  2QDL A;  2RF0 A;  1Y0M A;  2JM9 A;  1S72 A;  4Z02 A;  2ZZE A;  3CXC P;  4V2S A;  2KT8 A;  3P8B B;  1X27 A;  1G5H A;  3EGD A;  1V29 B;  3GNF B;  1HTT A;  4YPF A;  1SEM A;  2VXE A;  2IVW A;  5LJ5 h;  1OOT A;  3H0I A;  1YJW Q;  2PVO B;  4M75 G;  2P4T A;  1KD1 C;  3MF2 A;  4XTZ A;  5GAM h;  5I22 A;  1Q82 U;  4M77 G;  2CP7 A;  2SEM A;  2BTT A;  1I07 A;  1Z7N A;  2ZT7 A;  3M4Y A;  4N4H A;  2ALY A;  2EQK A;  2P0L A;  3M0P A;  2OTL T;  3PIO A;  1DJ7 B;  3A7U A;  2DL3 A;  1NJ6 A;  2CJ9 A;  3OYY A;  3CPW A;  4M78 A;  4DBR A;  2I4O A;  2LQN A;  2HEQ A;  4UC4 A;  3LC0 A;  3VU3 C;  2VYT A;  2HDA A;  2DXT A;  4PJN A;  4Q6G A;  4KUI A;  4YRP A;  2A0F B;  1G3Y A;  4KUL A;  4M7D C;  1Q95 G;  3OBW A;  8AT1 B;  1Q82 C;  1N5Z A;  3FDR A;  4M7A B;  4PK4 A;  4H2X A;  2CRE A;  4LN2 A;  4HWS A;  2DIG A;  3MPU B;  1YJN T;  2QK0 A;  4J6Y A;  3P8T A;  2CDT A;  1YFS A;  1OQK A;  4UP9 A;  3HY1 A;  1X2Q A;  1QWE A;  2E4H A;  3HP9 A;  5IXF A;  3M54 A;  1SPK A;  3JCM X;  1MMN A;  5LJ3 e;  2RB6 A;  4BUG A;  2QEX Q;  1R0C B;  5FWC A;  4PJM A;  2ZR3 A;  1K76 A;  2EQM A;  1NEG A;  4YRQ A;  4PKC C;  3LW5 E;  3QO8 A;  1AEY A;  2X4J A;  2AKL A;  1WPY A;  4J7I A;  2Q5H A;  1I5L A;  8ATC B;  3JCM e;  1YIJ T;  2JOY A;  4YTL A;  4ZN1 A;  2E6N A;  3QII A;  2VB6 A;  3E1S A;  1YJN Q;  4HT8 A;  1FXX A;  2EIF A;  1AWW A;  4DBH A;  3BFM A;  2RHS B;  4NL3 A;  3OY9 A;  1W6X A;  2CZ1 B;  1KHI A;  3M55 A;  3RES A;  2QQA A;  1HXD A;  1M3B A;  3ASK A;  4IUP A;  2QTX A;  3I56 Q;  4M77 C;  1ZA2 B;  4M7D B;  3C94 A;  3CCU T;  2LJ0 A;  1BYM A;  4JRI A;  4A4G A;  3OYA A;  4M7A C;  1ZX6 A;  1TU0 B;  1N9W A;  2MK5 A;  3A7R A;  2SRC A;  2DO3 A;  11AS A;  3VS0 A;  4DPG A;  4HWO A;  1QMC A;  3BJU A;  3KXT A;  1RAG B;  1Z9Z A;  2RHQ B;  5DLQ E;  1UGV A;  4M75 F;  4NL2 A;  1NJ2 A;  3UT1 A;  4RTU A;  2RN8 A;  4D6W A;  4ELZ C;  3JSC A;  5KYY A;  4MDX A;  4A4K A;  4J83 A;  1OX9 A;  2BE9 B;  2K2M A;  4HCC A;  4J9E A;  1YP5 A;  1KHC A;  4BI8 B;  1N9R A;  1UEB A;  3UA7 A;  2CP2 A;  4M7D A;  2DMO A;  1Q7Y U;  1GBR A;  2JTM A;  5HCK A;  1RLQ C;  2GQI A;  2DER A;  2M0O A;  2XK0 A;  3FC3 A;  1K73 R;  1WQ7 A;  1QVF P;  4YRN A;  3F70 A;  2K9G A;  5EG2 A;  4JRQ A;  1B34 B;  3CXC A;  1Q81 U;  1U1S A;  1M90 U;  1VYU A;  3CC7 A;  1H4T A;  4FU6 A;  1QCO A;  4OLF A;  3A8L B;  1OU8 A;  1K9A A;  4C92 D;  3SB2 A;  3HL8 A;  3OYM A;  1X75 C;  4M7A A;  3OYD A;  2DEU A;  1GBQ A;  1M9S A;  3MP1 A;  4C8Q F;  1G51 A;  3EG1 A;  3A8G B;  4M77 A;  4HXJ A;  1RLP C;  2X3W D;  1Q86 C;  1MUZ A;  1Y96 B;  2X51 A;  1M3A A;  4C5E A;  3HRT A;  4LDU A;  2DNU A;  2O4X A;  3NTH A;  1FMV A;  2F1L A;  5GAO q;  2G3R A;  1PHT A;  4YRO A;  3HKS A;  5KE3 A;  1VQN T;  3CCM Q;  1OUL A;  2ED0 A;  3NPF A;  1UTI A;  2ZIM A;  2HZY A;  1QVF A;  1YFT A;  1UDL A;  2DL4 A;  4H2X B;  4BD3 A;  1WLP B;  3CCM T;  2KRM A;  1VQ8 A;  1GFC A;  3HY0 A;  4BWA A;  3A5Z B;  3JAM E;  2DZ9 A;  3LYI A;  3VQY A;  5GAO l;  2E70 A;  1LPL A;  3JCM f;  1PD1 A;  2LNV A;  2K79 A;  1NJI R;  4JJC A;  1VQL A;  1E24 A;  4PJO B;  1F1B B;  3C4S A;  4YRT A;  4HT4 A;  4GBQ A;  4YCU A;  4BI4 A;  2AKK A;  4EMK C;  1KMM A;  1G5I A;  4ZTZ B;  1ABO A;  3EG9 A;  1KFZ A;  2D8H A;  1G83 A;  2DIL A;  2VC8 A;  2EW3 A;  4F17 A;  2DU7 A;  4RTY A;  3V7C A;  2VAS A;  2ODR C;  1EFN A;  3MF1 A;  2ZCE A;  3PFS A;  1X01 A;  1QCN A;  3EGD B;  1UJY A;  4LXC A;  4ESR A;  2XI9 A;  1K0X A;  4J9B A;  3MEW A;  2KEA A;  1Z9Q A;  2EYZ A;  1EFW A;  2P0Q A;  2W10 A;  2CSI A;  1JEG A;  3KFV A;  2DM1 A;  2EJG A;  1IZ6 A;  3EFR A;  3ZBD A;  1PCX A;  1VQP T;  5GAN h;  2E64 A;  2RPN A;  4PLI A;  1D1A A;  2DRM A;  3CC2 Q;  3PGG A;  5F5W A;  1H64 1;  2E1H A;  1NEB A;  1K9M R;  2QAZ A;  4OB0 B;  3CCR A;  1YIT A;  2F5K A;  2E3H A;  1D3B B;  1EVK A;  4HWP A;  1KK7 A;  3CME T;  4AT1 B;  4P75 C;  2C0T A;  4FT2 A;  2V8J A;  1NYR A;  3LX7 A;  3M56 A;  4RMO A;  1TUG B;  2KE9 A;  2JNG A;  5I11 A;  3I35 A;  4JLI A;  2O88 A;  4FSS A;  3CCQ T;  3P8D A;  5LJ5 d;  4TQD A;  1OZ2 A;  2KYM A;  3MO8 A;  4P75 A;  1D1C A;  1L0W A;  2E65 A;  1QP2 A;  3TVT A;  1B7T A;  1H4Q A;  4OVA A;  1JXM A;  1Q7Y C;  1WXU A;  4LD9 K;  1VQ9 A;  4D8D A;  4AMC A;  2GFA A;  1BIA A;  2RK2 A;  3CCV T;  3REU A;  3CCV A;  2OAU A;  3G1J A;  5GMK l;  4K88 A;  2KRO A;  3JCM Q;  2EGC A;  3CBP A;  1EIY B;  4YRR A;  2KI7 A;  4WJ4 A;  1NJI C;  4R0K A;  2KQW A;  1WHL A;  5GMK e;  3QO7 A;  4PJO F;  2OTJ A;  3ME9 A;  4P72 C;  2VXF A;  2EYX A;  4KUD K;  1YCY A;  4NCX A;  4O5V A;  2O01 E;  4O6J A;  3OYB A;  1PSF A;  3M58 A;  3TRE A;  3OYH A;  5KYX B;  5LJ3 f;  2J7I A;  2DVJ A;  2LJ3 A;  2COW A;  4ZN3 A;  2DIQ A;  2EJF A;  1TS9 A;  2AKW A;  1QVG S;  5A0L A;  2ZIO A;  4J5Y A;  4OML A;  1ADY A;  3RDV A;  4LVM A;  3CD6 Q;  4P72 A;  4BE1 A;  4YCV A;  1I0C A;  2O9S A;  1I4K 1;  3M53 A;  4E7L A;  4LDX A;  2K3X A;  3TEG A;  2RQV A;  2DL7 A;  3A74 A;  1USY A;  1ZSG A;  3JB9 J;  1PM3 A;  2VKN A;  4FYW B;  4TVW A;  2HMA A;  1N27 A;  4XEM A;  1QKW A;  2YRV A;  4TWA A;  3HHT B;  1PRL C;  4M78 G;  4FYV B;  3PVL A;  2OX7 A;  1QVF S;  1GFD A;  4ELY C;  2DXB A;  4C8Q A;  2JN0 A;  4M75 B;  1GL5 A;  4CH6 A;  5GAM d;  3VRY A;  1A0N B;  2RJD A;  1SKU B;  2CZ7 B;  2DD5 A;  3J7A F;  3R6O A;  4PFZ A;  4QVZ A;  3CMQ A;  3QZ9 B;  3L2V A;  1UGQ B;  2KXC A;  3X24 B;  2RHX A;  3PNW C;  2K6D A;  1M3C A;  2LT4 A;  2PVG B;  2GBQ A;  3TEH A;  3PT9 A;  4M7D F;  3SWN C;  1FMK A;  2YSQ A;  2KT1 A;  3KUF A;  3HXZ A;  3HFO A;  5HK0 A;  1AT1 B;  1IXD A;  1PD0 A;  1T3S A;  2RJC A;  2D6F A;  2X4W A;  4JPB W;  2DTO A;  1VQO Q;  1IGU A;  1ZUU A;  3CME A;  3TCJ A;  1D0X A;  2KNB B;  1NJ1 A;  2XTI A;  2YUP A;  3DB4 A;  3HFZ B;  3EG2 A;  2FZK B;  4M75 A;  1B3Q A;  1ZUK A;  3A7A A;  2WSE E;  2Q7H A;  4AH6 A;  2DA9 A;  4C8Q B;  2ZZF A;  4TVY A;  5KH6 A;  5KYU A;  4CC7 A;  4CC2 A;  3CCS T;  4AFQ C;  5GJW B;  4EMK B;  4LVI A;  4WI1 A;  4M7D D;  2Z0W A;  2GF7 A;  1GCP A;  3J80 E;  2MWP A;  3OW2 A;  3AHU A;  2O4X B;  3W3S A;  2QDY B;  2LVM A;  2YLB A;  1BI3 A;  3HFZ A;  3VV0 A;  4C5H A;  4N0A C;  2RMO A;  4N4I A;  4ZTF A;  3FRN A;  1X54 A;  1FX7 A;  4QQG A;  1XQH A;  5KYW A;  1Y7X A;  5KCH A;  3G71 T;  4N0A A;  3U23 A;  2D8J A;  2YUN A;  3LLR A;  2KSS A;  1VQ6 Q;  2PME A;  2YWW A;  1VQL Q;  3EHR A;  2D0Q B;  4RG8 A;  2RI5 A;  3M5A A;  1I1J A;  4XQ3 A;  2H3E B;  1B7Y B;  2QEX T;  2FPF A;  2K3Y A;  3QYG B;  2PMF A;  1KC8 U;  3PCO B;  4YRM A;  2M02 A;  1I8F A;  4UP8 A;  2VGN A;  2QHS A;  2BIV A;  4C92 E;  3VQV A;  4OMQ A;  3E2U A;  3QSU A;  1X6G A;  4YRG A;  3QJY A;  1K1Z A;  1G3T A;  2CJB A;  3EGX B;  1G3W A;  1U06 A;  1EQR A;  3UAT A;  4E51 A;  3HRK A;  1UEC A;  4Z8A A;  4RUG A;  2KRN A;  3C95 A;  1M8V A;  4LDW A;  4JDS A;  1EIY A;  2RQU A;  2CT3 A;  1RAF B;  5FU6 C;  4UPA A;  3VS2 A;  4C92 C;  2V8K A;  4M75 E;  1NPP A;  4M77 F;  3OYE A;  2HAX A;  4CS2 A;  2J3M A;  1EOV A;  4FYX B;  4YCW A;  4HVV A;  1GXI E;  1BCM A;  2L3P A;  4HWR A;  1GCQ A;  3S6W A;  3VJP A;  4Q15 A;  3CME Q;  2HNI A;  4NS5 A;  2XD0 A;  4F14 A;  1QE0 A;  2JTE A;  1D0Z A;  4MML A;  2CSQ A;  2ZPF B;  2MMP A;  1UB4 A;  4C0D B;  1TXQ A;  2VGM A;  4IUT A;  1VQ4 T;  1YJ9 T;  5A0G A;  4EPC A;  1NBE B;  3EGX A;  3FIF A;  2RHS A;  1Q81 C;  3URG A;  2DYB A;  5CKF A;  2DXC A;  3CBO A;  5IAY A;  3G4S A;  1NG2 A;  1Y71 A;  2D9T A;  2LCL A;  3MEY A;  4LDY A;  4OB3 B;  2ATC B;  1MMA A;  2ZT5 A;  4RTX A;  4R56 A;  1VQK Q;  2DK3 A;  1AZE A;  4KGZ B;  2YHT A;  3VQW A;  2V1Q A;  4RCB A;  2XMF A;  4HT9 A;  2A28 A;  2L3S A;  2A36 A;  3G6E T;  1Z7M A;  3CMA T;  3NTK A;  2ZPE B;  3CCE T;  1RAD B;  3H0F A;  2P84 A;  1QCF A;  2AT1 B;  3CMA A;  2P4R A;  1VUB A;  1ZUY A;  2L2P A;  3VS5 A;  5FWB A;  2OTJ Q;  2HCK A;  4J8O A;  2QI2 A;  1E7O A;  1RAA B;  2NUZ A;  4P74 C;  4AFS C;  2FZC B;  2EYW A;  4L59 A;  1ZSZ C;  1AD5 A;  2EYQ A;  2AHJ B;  2FPD A;  4XEO A;  2RNA A;  1M90 C;  3G6E A;  4YRL A;  3CPW P;  1PC0 A;  1H3Z A;  3OW2 P;  5GAN f;  2I4M A;  1PNJ A;  4OGE A;  4BDY A;  5GAN 2;  2H8H A;  1WYD A;  2OTL Q;  1TH7 A;  1N8R U;  3H8Z A;  2Y4Y A;  1N9S A;  4FYY B;  4YDQ A;  2DFU A;  3VUB A;  3VYH B;  1MV0 B;  3NMZ C;  3SWN B;  3L2R A;  3FJP A;  5GAM g;  4XTX A;  3OW2 S;  2DU5 A;  1AVZ C;  3CXC S;  5HKC A;  4ZGJ B;  1WJS A;  1LVK A;  4FW1 A;  4C5G A;  4PJJ A;  1VIE A;  1X2H A;  5EC7 A;  3CCE Q;  1AHJ B;  5AYF A;  1WYX A;  5CQY A;  3R6N A;  4RTT A;  4H2U A;  2RHY A;  2KY9 A;  4B9X A;  2RI2 A;  2CIM A;  1M8M A;  1KSW A;  2DBK A;  4EIK A;  2MAM A;  1VQ5 A;  3P8H A;  3MJX A;  3CC4 T;  1JRI A;  4II1 A;  2RJF A;  2R5A A;  3BY7 A;  3M57 A;  4YRJ A;  3CPF A;  1YHQ T;  1QW1 A;  3E9I A;  1QKX A;  2DD4 A;  2RHZ A;  2OTL A;  2O9V A;  4MZT A;  3HPW A;  3IG2 A;  2K57 A;  1SG5 A;  3GIB A;  1RL2 A;  3GBQ A;  4QQ6 A;  1HD3 A;  5CR2 A;  1AOJ A;  4X34 A;  1BI1 A;  2LQW A;  3M0U A;  2QG9 B;  1G8X A;  5LJ3 h;  1NLO C;  1LJO A;  1RI9 A;  2I4L A;  1CKA A;  1RAH B;  3RMQ A;  3RUX A;  2R58 A;  4ANJ A;  4E2F B;  3MHX A;  5KYX A;  2BZ8 A;  2OJ2 A;  4P71 C;  2E5K A;  4HCB A;  1YI2 A;  1VQ8 Q;  4OMP A;  2LMJ A;  4GY5 A;  1HYO A;  1NLP C;  3MP6 A;  4ZGE B;  5FRM A;  3OYK A;  1QF6 A;  1SSH A;  2ENM A;  5HY6 A;  2MOX A;  2I0N A;  5GAN 7;  2C0I A;  2DEQ A;  5GAM j;  1CKB A;  2LC4 A;  1WJR A;  2L8D A;  2QXF A;  4J9H A;  4TQF A;  2RA2 A;  4XU1 A;  3V7R A;  1BI0 A;  1M1K R;  3M0S A;  4GLM A;  2NUP A;  2A3L A;  1K73 C;  3NFC A;  2C8M A;  3IKL A;  1E6H A;  4TVA A;  5GMK m;  3OQ5 A;  3M9Q A;  2QGG A;  4HKE A;  2RK1 A;  2QQB A;  1UJ0 A;  1WDX A;  3PIP A;  4JZ4 A; 
#chains in the Genus database with same CATH homology
 2VV5 A;  3OB9 A;  4YYE A;  2RD1 A;  2KAF A;  5C52 B;  4XK8 E;  4H2V A;  2EJ9 A;  3OSS C;  4F7U F;  2HQX A;  5DLO A;  3CPW S;  3DB3 A;  1QVP A;  1G5V A;  3HXY A;  3L1A A;  1KQS A;  2F69 A;  4LNS A;  3OBY A;  1JBM A;  5L8R E;  5J3B A;  3V8L A;  5C53 B;  1KQS S;  2WAC A;  2A7Y A;  5HGQ A;  4C5I A;  2BKD N;  4LD6 A;  4XAX B;  4RDX A;  4EMK A;  1FWZ A;  2Y4X A;  3X25 B;  3DLL A;  2XG8 D;  1WGS A;  3GNG A;  5C51 B;  3LH0 A;  1N8R C;  1D3B A;  1NYQ A;  2MI6 A;  3OYI A;  3L2U A;  3TUP A;  5A2Q E;  3HFV A;  2LT1 A;  4H2T A;  3HXW A;  4ZGD B;  1BKB A;  3QYH B;  4WJ3 M;  4P3O A;  5GMK j;  5CAI A;  3BDU A;  3JCM V;  2ZTG A;  1NJ8 A;  3JCM h;  4BB7 A;  3LSQ A;  4R55 A;  3L2W A;  1VQN A;  4YRS A;  4XTV A;  5DM7 R;  2K5I A;  4XTW A;  1W4S A;  4M75 D;  1ADJ A;  2AMC B;  3A8O B;  2G4C A;  2IG0 A;  1YBY A;  2QHU A;  3QKJ A;  4LVL A;  3HFN A;  4DOW A;  4K87 A;  3P8V A;  1B76 A;  3C12 A;  2GFU A;  1M1K U;  1SES A;  2F5T X;  4JJN K;  5GAO p;  1E1T A;  4VUB A;  4EMH A;  3M4P A;  5GAN e;  3RKX A;  1OZ3 A;  5LJ3 d;  2RI3 A;  3OYG A;  2RO0 A;  3CEY A;  4C8Q D;  4DOV A;  1BI2 A;  5GAN d;  3CCQ A;  4OB1 B;  3X28 B;  4HWT A;  3QJ6 A;  3ZFJ A;  3HXX A;  4YRF A;  3QDR B;  1HK9 A;  3X20 B;  2HBP A;  1JJC A;  3NEN A;  4ME7 A;  3CC2 A;  5CK9 A;  5GAN 3;  2MF2 A;  4M78 E;  3QNE A;  2K5F A;  3ERR A;  3WVE B;  1VQM A;  3X26 B;  1H4S A;  1W2B S;  1KQ1 A;  4EDU A;  3OYN A;  3SDZ A;  2QQS A;  4M7D G;  3RGL A;  1YI2 T;  5C6S A;  2DDZ A;  2X4Y A;  3I55 A;  4FIB A;  5LL6 S;  1NZ9 A;  2M1H A;  2P0K A;  1YIJ A;  2DQ3 A;  5GAO r;  4M7A D;  1VQM T;  2DXU A;  4BDZ A;  2E6Z A;  2LQK A;  1W66 A;  4E7I A;  2FL7 A;  4F7U A;  2KK4 A;  2B8A A;  4RKU E;  2ZT8 A;  5GAN 5;  1JB0 E;  4DA4 A;  2M16 A;  2PVD B;  3CCL A;  1XOV A;  3QPH A;  3IKM B;  3PTA A;  5LJ3 g;  4FM4 B;  4XU0 A;  3CCM A;  2WSF E;  5I2M A;  4QQD A;  1B7Y A;  5CCA A;  3N5B B;  4L5G A;  4P3N A;  4PG3 A;  4EX5 A;  3PZC A;  3ZEH A;  4KR3 A;  1N6A A;  1OYX A;  3RKW A;  3UH0 A;  3PMT A;  3DLM A;  1IRE B;  3GLX A;  3L42 A;  3FLG A;  1RIQ A;  3T9N A;  1XTD A;  3CC7 T;  2DTI A;  1VQ5 T;  3G1Z A;  4PJO E;  1XNI A;  4OP0 A;  2ODR D;  3JB9 I;  2ZGW A;  1E22 A;  2KVQ G;  1R8O B;  3OS1 A;  5CQX A;  5K1X A;  2EL9 A;  2ZCF B;  2QA4 T;  3S3N A;  3E19 A;  3QTC A;  3PMI A;  1KMN A;  3E9G A;  3TU4 K;  4E7H A;  3MP8 A;  1NJ5 A;  3V8J A;  2ZIN A;  1X2G A;  1WU7 A;  2C7I A;  2PU9 B;  5K1P A;  4B9W A;  3JCM J;  3BW1 A;  2EFI A;  2BUD A;  1K9M U;  1VQK A;  3MCA B;  3LGL A;  2M9U A;  4P71 A;  3HRU A;  1VQ7 A;  3G7Z A;  2X35 A;  2ALY B;  4J6X A;  4RQE A;  1M1G A;  3TEH B;  2E5A A;  4YRK A;  3OS2 A;  3REX A;  3GOX A;  3L4G B;  3M4G A;  3OMG A;  3CC4 A;  2EWN A;  1UGP B;  3OYJ A;  4G85 A;  3UGQ A;  2JUF A;  1WJQ A;  2JVV A;  4C92 F;  3EAE A;  4HA8 A;  3NTI A;  5J26 A;  3TEE A;  4X5O A;  4LDV A;  2IY5 A;  3JCM b;  5IN1 A;  2H3J A;  2Y90 A;  1GGM A;  2KDS A;  3RAC A;  1NJI U;  5GAM e;  3CBM A;  1X56 A;  2DPP B;  4FT4 A;  3KFU A;  1YJ9 A;  3R07 A;  4RMF A;  3OD1 A;  1K9M C;  3QZ5 B;  5A0D A;  3JCM d;  4F7U B;  4HVC A;  3OYF A;  4IUQ A;  4C0Z A;  5GAO m;  4MMK A;  3HRI A;  4C92 G;  5GAN j;  4XTY A;  4ZIB A;  1LOJ A;  4Y28 E;  2XID A;  3JB9 D;  1BBU A;  4A4F A;  2ZZG A;  5GMK i;  4XTU A;  4J6W A;  2K2V A;  4IUR A;  4C8Q C;  1YHQ A;  2L89 A;  4P73 A;  4P5N A;  1M4Z A;  3LGF A;  1HC7 A;  3MEU A;  4H2S A;  3INZ A;  4M7A F;  2EQJ A;  2K4Y A;  5CVI A;  2RH2 A;  2V8I A;  4BY6 C;  4G84 A;  1WQW A;  1K73 U;  5CKE A;  4MZM A;  3O8V A;  2QEX A;  4P74 A;  4A4E A;  1S72 T;  1KOG A;  1VQ6 T;  4PLL A;  3HTZ A;  2GCX A;  3UPU A;  4OMF B;  5FLX E;  3HXU A;  4RG2 A;  3WQZ A;  4ZTU B;  2JTF A;  3M59 A;  1PYS B;  2NLU A;  3SD4 A;  2XDD A;  2ZNJ A;  1QVG A;  4JS5 A;  3WXM B;  2J3L A;  3G71 A;  2EQU A;  4N4G A;  2QHV A;  1W2B A;  3E9H A;  3WVD B;  3CCS A;  2E3C A;  4PL6 A;  2CZ6 B;  2FB7 A;  3VYG A;  4MZP A;  5GAN 4;  3FB9 A;  4P73 C;  4BY6 B;  3OMC A;  2RM4 A;  3QG1 A;  3A8H B;  2YLC A;  1KG1 A;  4ZTJ A;  1WLE A;  1VQO T;  2EAY A;  1EVL A;  4A54 A;  2XDP A;  2KMT A;  3S3M A;  3HXV A;  4MDW A;  3OSV A;  3CCL T;  2PUO B;  3V7S A;  4C0F A;  3OYL A;  2E10 A;  4C0D C;  3L4G A;  1P92 A;  2R5M A;  3MEV A;  4PHC A;  4M78 D;  3GF5 A;  2LCC A;  4YRE A;  4C8Q G;  4J15 A;  5CKH A;  2Q7G A;  2ZR2 A;  4NOY A;  3MEA A;  5ELO A;  1WNL A;  4HCZ A;  4JRP A;  2CS7 A;  1EIF A;  4C92 A;  2VUB A;  1NNH A;  4QVD A;  1U8R A;  2DJZ A;  1QP3 A;  4FL6 A;  3CCJ T;  4M7A E;  3IAL A;  4XU3 A;  1J5W A;  3OS0 A;  4KT0 E;  4M78 F;  3JB9 G;  4LVK A;  3CCE A;  2CJA A;  5IT9 E;  5D6Y A;  2XKO C;  4F7U E;  5J39 A;  3OA6 A;  1VIF A;  1USY C;  3HRS A;  1E1O A;  2EKO A;  2E12 A;  3DKM A;  2E41 A;  4IKF A;  5CO7 A;  1YJW T;  4RCC A;  3CD6 A;  4EO4 A;  2QQ9 A;  2L5Q A;  4C8Q E;  4BI3 A;  1RI0 A;  2PQW A;  3QXE B;  4C0G A;  1ZBX A;  3PCO A;  5GAM f;  2QA4 A;  1VQ4 A;  1VQK T;  4H2W A;  3SFM A;  1LYL A;  3QHS A;  1ASZ A;  1X6O A;  2CZ0 B;  5DY9 A;  3KBG A;  3RKY A;  2R57 A;  4L87 A;  5LJ5 e;  3A32 A;  2PUK B;  2CGH A;  2ZPI B;  1SET A;  12AS A;  4H02 A;  4RQF A;  3JB9 F;  4JUV A;  3JB9 H;  5CKD A;  2RHQ A;  4E7K A;  3JCM W;  4PJO C;  4M77 D;  4L6V 5;  1VQ9 T;  1SRY A;  1B70 B;  4CH3 A;  1G3S A;  2RJE A;  2ZPG B;  4F7U G;  5GAO n;  3UWN A;  4CH5 A;  1YGB A;  4K86 A;  1FYF A;  1BIB A;  2ZZD A;  3RER A;  4M78 C;  3RMS A;  5LJ5 g;  4CRI A;  3I56 T;  4TTV A;  3CC2 T;  1O9S A;  1B70 A;  1YFR A;  3P8Y A;  2FVU A;  4XU2 A;  1I81 A;  3JRZ A;  4GLK A;  4E7J A;  2ART A;  1YIT T;  3CCR T;  2C06 A;  1H4V B;  1OI1 A;  1SSF A;  1UGS B;  4Y91 A;  3J81 E;  4YRC A;  3RL6 A;  1KD1 U;  1ATI A;  4KR2 A;  2XDB A;  1KC8 C;  4KBM B;  3M4Q A;  4X9D A;  2I2L A;  3CCJ A;  2RHI A;  1JJ2 S;  1SER A;  4BE0 A;  4IUU A;  1VQL T;  3A8M B;  4X9C A;  3V8K A;  1C0A A;  5FU7 C;  1X55 A;  4M7A G;  5KNN A;  2XU8 A;  3I55 T;  2L3R A;  4OGC A;  4M78 B;  2Q7E A;  1MHN A;  2XIC A;  2HD0 A;  1VQ8 T;  3SWN A;  1Y07 A;  2LTO A;  2ZPH B;  3E9F A;  4QVC A;  5GAN 6;  1ASY A;  2Q5I A;  2LDM A;  2X4X A;  1YB3 A;  3I56 A;  2WSC E;  4OF1 A;  2AMC A;  3JCM P;  2AKW B;  5CIU A;  2JZ2 A;  1LNX A;  1ZHI A;  4PJO G;  4J7F A;  5LJ5 j;  1O75 A;  2A8E A;  4CS3 A;  4JRK A;  1K8A U;  1M1F A;  3UFG A;  5FU6 B;  3NEM A;  1Y96 A;  1M5Q 1;  1ZQ1 A;  3QBY A;  2LQ8 A;  3ER0 A;  1PSE A;  5D6W A;  1NE8 A;  5CKB A;  3ICA A;  3BDL A;  3QO5 A;  4PJO A;  3RF1 A;  2ZT6 A;  3OYC A;  4CS4 A;  3QO3 A;  2DAQ A;  5E3I A;  2FYK A;  5KE2 A;  4OB2 B;  4DQ2 A;  3A5Z A;  1VQ6 A;  4M75 C;  3A5Y A;  3FEO A;  3Q1J A;  1K8A C;  2ZNI A;  2NS6 A;  3S3O A;  3VBB A;  2ZPB B;  4M77 E;  4JS4 A;  1MGQ A;  4M7D E;  2FHD A;  1KQ2 A;  2CYZ B;  4P3P A;  2MWO A;  3CD6 T;  4YP0 A;  1JJ2 A;  3NET A;  2GQV A;  2LRQ A;  3A31 A;  5GAN 8;  3LWI A;  1JJC B;  4M77 B;  1Q86 U;  5HK3 A;  4BAC A;  3VQX A;  2XGT A;  5FRN A;  4IUV A;  3L2Z A;  1PYS A;  5FRO A;  1M1K C;  2P5I A;  1UGR B;  3DSQ A;  2ARS A;  5I21 A;  4TVA B;  2OTJ T;  2K5L A;  4BW9 A;  3VUZ A;  1B34 A;  1VQZ A;  2IY5 B;  2ARU A;  4UP7 A;  2I4N A;  5LJ5 f;  3H6Z A;  2DTH A;  2P0P A;  4JLG A;  3JCM g;  2DVE A;  2XHC A;  5ELN A;  3RIR A;  4O2D A;  4CH4 A;  4KQE A;  4TVR A;  1YJN A;  4PJO D;  3I7F A;  3QUI A;  5D6X A;  1YJW A;  4YRI A;  4Q5W A;  1BBW A;  5KCO A;  3VKI A;  1IL2 A;  2QQR A;  2RHU A;  1NPR A;  2HQE A;  1VQP A;  2ZXF A;  3JCM c;  3OS5 A;  4FSX A;  3EFS A;  3L2Q A;  4QW2 A;  5GMK h;  3GP8 A;  5M9O A;  3GPL A;  4BE2 A;  3HSB A;  4A4H A;  3CCU A;  2DZC A;  1B8A A;  1VQO A;  4LVJ A;  4E47 A;  3UDC A;  1U1T A;  5I2S A;  4PNO A;  1VQ7 T;  4EMG A;  5GAN g;  3MQZ A;  4C92 B;  4CI0 C;  4H2Y A;  5FU7 B;  3LSS A;  2DQ0 A;  4ATO A;  3MET A;  2E5Q A;  5C0M A;  2CKK A;  5LJ3 j;  3UGT A;  2QHT A;  3G4S T;  2LX9 A;  3LWH A;  4A53 A;  2DKG A;  4WF2 A;  1S72 A;  4Z02 A;  2ZZE A;  4V2S A;  3P8B B;  1G5H A;  1V29 B;  3GNF B;  1HTT A;  4YPF A;  2VXE A;  2IVW A;  5LJ5 h;  2PVO B;  4M75 G;  2P4T A;  1KD1 C;  3MF2 A;  4XTZ A;  5GAM h;  1Q82 U;  4M77 G;  1Z7N A;  2ZT7 A;  3M4Y A;  4N4H A;  2ALY A;  2EQK A;  2P0L A;  2OTL T;  3PIO A;  1DJ7 B;  3A7U A;  1NJ6 A;  2CJ9 A;  3OYY A;  3CPW A;  4M78 A;  2I4O A;  4UC4 A;  3LC0 A;  3VU3 C;  2VYT A;  2DXT A;  4Q6G A;  4KUI A;  4YRP A;  4M7D C;  1G3Y A;  4KUL A;  3OBW A;  1Q82 C;  3FDR A;  4M7A B;  4H2X A;  4HWS A;  2DIG A;  1YJN T;  4J6Y A;  3P8T A;  1YFS A;  4UP9 A;  3HY1 A;  3HP9 A;  3M54 A;  3JCM X;  5LJ3 e;  2RB6 A;  4BUG A;  2ZR3 A;  2EQM A;  4YRQ A;  4PKC C;  3LW5 E;  3QO8 A;  2X4J A;  1WPY A;  4J7I A;  2Q5H A;  1I5L A;  3JCM e;  1YIJ T;  2JOY A;  4YTL A;  4ZN1 A;  2E6N A;  3QII A;  3E1S A;  4HT8 A;  1FXX A;  2EIF A;  3BFM A;  2RHS B;  4NL3 A;  3OY9 A;  2CZ1 B;  1KHI A;  3M55 A;  3RES A;  2QQA A;  1HXD A;  3ASK A;  4IUP A;  2QTX A;  4M77 C;  4M7D B;  3C94 A;  3CCU T;  1BYM A;  4JRI A;  4A4G A;  3OYA A;  4M7A C;  1N9W A;  3A7R A;  2DO3 A;  11AS A;  4DPG A;  4HWO A;  3BJU A;  3KXT A;  2RHQ B;  5DLQ E;  4M75 F;  4NL2 A;  1NJ2 A;  3UT1 A;  4D6W A;  4ELZ C;  3JSC A;  4MDX A;  4A4K A;  4J83 A;  4HCC A;  1KHC A;  4BI8 B;  1N9R A;  1UEB A;  4M7D A;  1Q7Y U;  2JTM A;  2M0O A;  2XK0 A;  3FC3 A;  1WQ7 A;  4YRN A;  3F70 A;  5EG2 A;  4JRQ A;  1B34 B;  3CXC A;  1Q81 U;  1U1S A;  1M90 U;  3CC7 A;  1H4T A;  4FU6 A;  4OLF A;  3A8L B;  4C92 D;  3SB2 A;  3HL8 A;  3OYM A;  1X75 C;  4M7A A;  3OYD A;  1M9S A;  3MP1 A;  4C8Q F;  1G51 A;  3A8G B;  4M77 A;  1Q86 C;  1Y96 B;  4C5E A;  3HRT A;  4LDU A;  2O4X A;  3NTH A;  5GAO q;  2G3R A;  4YRO A;  3HKS A;  5KE3 A;  1VQN T;  2ZIM A;  1QVF A;  1YFT A;  4H2X B;  4BD3 A;  3CCM T;  1VQ8 A;  3HY0 A;  4BWA A;  3A5Z B;  3JAM E;  2DZ9 A;  3LYI A;  3VQY A;  5GAO l;  2E70 A;  3JCM f;  2LNV A;  1VQL A;  1E24 A;  4PJO B;  3C4S A;  4YRT A;  4HT4 A;  4YCU A;  4BI4 A;  4EMK C;  1KMM A;  1G5I A;  4ZTZ B;  2VC8 A;  2DU7 A;  3V7C A;  2ODR C;  3MF1 A;  2ZCE A;  3PFS A;  1X01 A;  2XI9 A;  3MEW A;  1EFW A;  2P0Q A;  2EJG A;  1IZ6 A;  3EFR A;  3ZBD A;  1VQP T;  5GAN h;  2E64 A;  4PLI A;  3PGG A;  5F5W A;  1H64 1;  2E1H A;  4OB0 B;  3CCR A;  1YIT A;  2F5K A;  1D3B B;  1EVK A;  4HWP A;  3CME T;  4P75 C;  4FT2 A;  2V8J A;  1NYR A;  3LX7 A;  3M56 A;  4RMO A;  2JNG A;  4JLI A;  3CCQ T;  3P8D A;  5LJ5 d;  4TQD A;  1OZ2 A;  3MO8 A;  4P75 A;  1L0W A;  2E65 A;  1QP2 A;  1H4Q A;  4OVA A;  1Q7Y C;  4LD9 K;  1VQ9 A;  2GFA A;  1BIA A;  2RK2 A;  3CCV T;  3REU A;  3CCV A;  2OAU A;  5GMK l;  4K88 A;  3JCM Q;  3CBP A;  1EIY B;  4YRR A;  4WJ4 A;  1NJI C;  2KQW A;  5GMK e;  3QO7 A;  4PJO F;  2OTJ A;  3ME9 A;  4P72 C;  2VXF A;  4KUD K;  1YCY A;  4NCX A;  4O5V A;  2O01 E;  4O6J A;  3OYB A;  1PSF A;  3M58 A;  3TRE A;  3OYH A;  5LJ3 f;  4ZN3 A;  2DIQ A;  2EJF A;  2AKW A;  1QVG S;  5A0L A;  2ZIO A;  4J5Y A;  1ADY A;  4LVM A;  4P72 A;  4BE1 A;  4YCV A;  1I4K 1;  3M53 A;  4E7L A;  4LDX A;  2K3X A;  3TEG A;  3A74 A;  1USY A;  3JB9 J;  4TVW A;  1N27 A;  4XEM A;  2YRV A;  4TWA A;  3HHT B;  4M78 G;  1QVF S;  4ELY C;  2DXB A;  4C8Q A;  2JN0 A;  4M75 B;  4CH6 A;  5GAM d;  2RJD A;  2CZ7 B;  2DD5 A;  3J7A F;  3R6O A;  4QVZ A;  3CMQ A;  3QZ9 B;  3L2V A;  1UGQ B;  3X24 B;  2RHX A;  3PNW C;  2LT4 A;  2PVG B;  3TEH A;  3PT9 A;  4M7D F;  3SWN C;  3KUF A;  3HXZ A;  3HFO A;  5HK0 A;  2RJC A;  2D6F A;  2X4W A;  2DTO A;  3CME A;  3TCJ A;  1NJ1 A;  2XTI A;  3DB4 A;  3HFZ B;  4M75 A;  3A7A A;  2WSE E;  2Q7H A;  4AH6 A;  4C8Q B;  2ZZF A;  4TVY A;  5KH6 A;  3CCS T;  4EMK B;  4LVI A;  4WI1 A;  4M7D D;  2GF7 A;  3J80 E;  2MWP A;  3OW2 A;  3AHU A;  2O4X B;  3W3S A;  2QDY B;  2LVM A;  2YLB A;  1BI3 A;  3HFZ A;  3VV0 A;  4C5H A;  4N0A C;  4N4I A;  4ZTF A;  3FRN A;  1X54 A;  1FX7 A;  4QQG A;  1XQH A;  1Y7X A;  5KCH A;  3G71 T;  4N0A A;  2PME A;  3LLR A;  2KSS A;  2D0Q B;  4RG8 A;  2RI5 A;  3M5A A;  4XQ3 A;  1B7Y B;  2QEX T;  2K3Y A;  3QYG B;  2PMF A;  1KC8 U;  3PCO B;  4YRM A;  1I8F A;  4UP8 A;  2VGN A;  2QHS A;  2BIV A;  4C92 E;  3VQV A;  3QSU A;  4YRG A;  3QJY A;  1G3T A;  2CJB A;  1G3W A;  1EQR A;  4E51 A;  3HRK A;  3C95 A;  1M8V A;  4LDW A;  4JDS A;  1EIY A;  5FU6 C;  4UPA A;  4C92 C;  2V8K A;  4M75 E;  1NPP A;  4M77 F;  3OYE A;  2HAX A;  4CS2 A;  2J3M A;  1EOV A;  4YCW A;  1GXI E;  4HWR A;  3S6W A;  3VJP A;  4Q15 A;  2HNI A;  4NS5 A;  2XD0 A;  1QE0 A;  4MML A;  2ZPF B;  2MMP A;  1UB4 A;  4C0D B;  2VGM A;  4IUT A;  1VQ4 T;  1YJ9 T;  5A0G A;  4EPC A;  3FIF A;  2RHS A;  1Q81 C;  3URG A;  5CKF A;  2DXC A;  3CBO A;  5IAY A;  3G4S A;  1Y71 A;  2D9T A;  2LCL A;  3MEY A;  4LDY A;  4OB3 B;  2ZT5 A;  4R56 A;  2DK3 A;  2YHT A;  3VQW A;  4RCB A;  4HT9 A;  1Z7M A;  3G6E T;  3CMA T;  3NTK A;  2ZPE B;  3CCE T;  3CMA A;  1VUB A;  2QI2 A;  4J8O A;  4P74 C;  4L59 A;  2EYQ A;  2AHJ B;  4XEO A;  1M90 C;  3G6E A;  4YRL A;  1H3Z A;  5GAN f;  2I4M A;  4OGE A;  4BDY A;  5GAN 2;  1WYD A;  1TH7 A;  1N8R U;  3H8Z A;  2Y4Y A;  1N9S A;  4YDQ A;  3VUB A;  3VYH B;  3SWN B;  3L2R A;  3FJP A;  5GAM g;  4XTX A;  3OW2 S;  2DU5 A;  3CXC S;  5HKC A;  4ZGJ B;  1WJS A;  4C5G A;  1VIE A;  1X2H A;  1AHJ B;  5AYF A;  5CQY A;  4H2U A;  2RHY A;  2KY9 A;  4B9X A;  2RI2 A;  2CIM A;  2MAM A;  1VQ5 A;  3P8H A;  3CC4 T;  1JRI A;  4II1 A;  2RJF A;  2R5A A;  3BY7 A;  3M57 A;  4YRJ A;  3CPF A;  1YHQ T;  1QW1 A;  3E9I A;  2DD4 A;  2RHZ A;  2OTL A;  4MZT A;  3HPW A;  3IG2 A;  2K57 A;  3GIB A;  1RL2 A;  4QQ6 A;  5CR2 A;  4X34 A;  1BI1 A;  5LJ3 h;  2I4L A;  1LJO A;  3RMQ A;  3RUX A;  2R58 A;  3MHX A;  4P71 C;  4HCB A;  1YI2 A;  4GY5 A;  3MP6 A;  4ZGE B;  5FRM A;  3OYK A;  1QF6 A;  5HY6 A;  5GAN 7;  2DEQ A;  5GAM j;  2LC4 A;  1WJR A;  2L8D A;  2QXF A;  4TQF A;  2RA2 A;  4XU1 A;  3V7R A;  1BI0 A;  2A3L A;  1K73 C;  3NFC A;  2C8M A;  3IKL A;  4TVA A;  5GMK m;  3OQ5 A;  3M9Q A;  4HKE A;  2RK1 A;  2QQB A;  3PIP A;  3NEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...