3EFRA

Biotin protein ligase r40g mutant from aquifex aeolicus in complex with biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
b'MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGGLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 67
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efrA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efrA01
4C8QC 3PCOA 3PGGA 4F7UA 4XU0A 3M4QA 2Q5IA 1WQWA 2ZR3A 4M77G 3W3SA 4K87A 4TVYA 4XTVA 1N9RA 1Z7MA 4H2SA 2EJGA 4XEMA 2YLCA 4M77F 1Z7NA 5E3IA 2DZCA 2DJZA 4E51A 1B7YA 2DQ3A 4OLFA 1YGBA 2ZZFA 4JUVA 4OP0A 4M7AC 4M75A 1E1TA 4PNOA 3BFMA 5GANe 4Y91A 1U1TA 4YREA 1ADJA 4C92G 4M78A 4V2SA 4CH5A 1JJCA 3QO8A 3A31A 3RACA 3JCMd 3M4PA 3I7FA 1NJ2A 2RA2A 4F7UE 2AMCA 4HWTA 1NJ6A 4H2TA 1Y96B 4YYEA 4EMKC 4H2YA 4YRNA 5GAMd 1NNHA 4CS4A 3BJUA 3QUIA 4TWAA 3JB9J 1EQRA 2RHSB 5GAOp 3TEHB 4A54A 1J5WA 4ZTUB 1X55A 11ASA 2RB6A 2ZR2A 1H4QA 2EJ9A 5GAN6 4M75E 4YRLA 3HXZA 5CAIA 4J6YA 3V8JA 4H2VA 3KFUA 4P72A 2ZINA 4RQEA 4WJ3M 5GAN2 1X56A 5GAN3 1M8VA 5GANh 4P3PA 4M78E 2ZTGA 3JCMP 1FYFA 3WQZA 4C92C 5GANg 3UH0A 3V8LA 1VQZA 4X9DA 2P5IA 2CGHA 4M75C 3BDUA 1ASZA 5GMKj 3RKWA 1B76A 3VU3C 4JRIA 4M7AB 1YFSA 3RIRA 5HGQA 1H4SA 2ZXFA 4YRFA 2ALYB 3HTZA 1LJOA 1USYC 2I4MA 4UP8A 1JRIA 4PJOE 2YHTA 4YRGA 3QO7A 2AKWB 4XEOA 4XTXA 1I8FA 4C8QF 1EVLA 4RCBA 4HWRA 2E1HA 1NJ1A 1X2HA 3HY0A 1X2GA 4EMKB 2DEQA 2JN0A 1WU7A 2ODRC 3HRKA 3P8TA 1SESA 4YCWA 1N9WA 2EAYA 3RKXA 4RCCA 2RHQA 1B34A 4M7AG 1ASYA 3SB2A 4PJOC 1GGMA 3HXXA 2VXFA 5GAN4 3V7RA 2PMFA 4DQ2A 3NEMA 3MF1A 3PCOB 4F7UB 3FIFA 2DKGA 2E3CA 2I4NA 4M7DA 4NCXA 2DTOA 2Q7EA 4HT9A 4JRKA 2J3MA 3QO3A 4J15A 5LJ3j 5GMKl 4C8QD 3NENA 2E5AA 4YCUA 4TQDA 5K1PA 4YROA 4CH3A 3SWNA 1B7YB 4H2XA 3QHSA 1W66A 4BW9A 5K1XA 5GAN5 4M75B 3V8KA 1H641 4QVDA 5GMKm 4M77A 4KQEA 5LJ5j 4M78B 4F7UG 5GAN7 1JJCB 4BWAA 2HNIA 3RESA 1EOVA 1YCYA 4J5YA 2J3LA 3FB9A 4M7DD 5GAN8 2ZT8A 4YRQA 2AMCB 3E9HA 1KMMA 2DXUA 3JCMV 3HSBA 3REXA 3A7RA 5GAOr 4QVCA 1E24A 5GMKe 3HFZA 1HTTA 1B8AA 5C52B 4HWSA 1QE0A 3JCMJ 4EMGA 3QSUA 3HXUA 4M75G 2DXTA 4C92F 4MMLA 1PYSA 2ZZEA 3NETA 4X5OA 2DVEA 4M75F 3TUPA 4M77D 1KQ2A 4M78G 5LJ3f 4PJOB 3RUXA 3JCMX 3VBBA 5GANd 4P75A 2QHSA 1NYQA 4Q15A 3IALA 1WPYA 1EIYA 3UFGA 3JCMb 3HFOA 4YP0A 3R07A 3FJPA 1X54A 3IKLA 3A7UA 4XU1A 4XTYA 1EFWA 2EWNA 4TVAA 2E10A 1RIQA 1BBUA 4YRPA 4C92D 3A5YA 2XTIA 1N9SA 4HT8A 5GMKh 3UGTA 3TEGA 1WYDA 4PJOG 3MF2A 1BBWA 5KNNA 2EL9A 1BIAA 4P73A 3VQVA 3RGLA 4PJOF 5LJ3e 2CIMA 3A32A 3IKMB 4P71A 4XQ3A 4NL3A 4M78C 2RHSA 1LOJA 1L0WA 4KR2A 1U1SA 5GAMj 3JB9I 3RL6A 1H4TA 2Q7HA 2E41A 1ADYA 2QHTA 1B34B 1B70A 4PG3A 4C8QA 5LJ5e 3A7AA 3L4GA 3V7SA 1YB3A 1NYRA 3EFRA 3LSQA 2C8MA 1D3BA 1IL2A 2ZT7A 4XTWA 1NJ5A 4P3NA 4YRCA 4CS3A 3QO5A 2FB7A 1KOGA 1YFRA 4H2UA 4P72C 2FYKA 3A74A 1BIBA 2ZNIA 4M7AF 2E65A 2IY5A 4HWPA 4K88A 3L2ZA 3SWNB 2ZIMA 5LJ3h 4H2XB 3HXWA 4RDXA 2DQ0A 2VC8A 5LJ3g 4YRMA 3CMQA 4XTZA 2ZCEA 1WLEA 2DU5A 4XU2A 1NJ8A 4CH6A 2I2LA 4HA8A 3EFSA 4C8QE 4PHCA 4P73C 4XU3A 3GIBA 4P71C 4CS2A 4CH4A 5GAMf 5LJ5h 12ASA 4EMKA 2XGTA 3RERA 1G5IA 5GAOn 3ICAA 1H4VB 4N0AA 3REUA 3BY7A 2YLBA 5LJ5g 1TH7A 4M7AD 3MEYA 2DTIA 3HFZB 3UGQA 3M4GA 3OD1A 4H2WA 4DPGA 4H02A 4F7UF 3HY1A 1PYSB 4NL2A 4P74A 4M7DE 5GAOq 2ZT5A 1E1OA 4YRKA 3JCMe 4ZTZB 4C92A 3JB9G 1EIYB 1HXDA 3DSQA 1M5Q1 4ZIBA 2ZGWA 3HXYA 4UPAA 4HVCA 5I21A 4YPFA 3JB9F 2ARSA 4L87A 5GAMe 3P8VA 4WI1A 2ZNJA 4M7DC 3L1AA 2EJFA 4K86A 3NELA 2RM4A 4M77E 1G51A 4TVAB 4YRRA 2P0LA 1C0AA 3QNEA 4M78F 1SETA 1G5HA 2ZT6A 1X01A 1KMNA 1USYA 3JCMQ 3SWNC 4UP7A 5C51B 4P3OA 1I4K1 2Y90A 2RD1A 3RKYA 1SRYA 5LJ5f 3VQWA 4XTUA 2C7IA 2G4CA 4EO4A 3HFVA 2DTHA 3JCMW 4M77C 4N0AC 2CJAA 2PMEA 4C92E 3JCMh 2K57A 4M75D 3JB9D 3HRIA 2ZZGA 3IG2A 2QHUA 1Y96A 4TVWA 1I5LA 3JCMg 4YRIA 4J6WA 4YRJA 4P74C 4PJOA 3HFNA 4M78D 4EMHA 5GAMh 1B70B 4UP9A 2QTXA 4C8QB 2Q7GA 3L4GB 2Q5HA 3TEHA 4G84A 4YRSA 5GAMg 1D3BB 4RMFA 1WNLA 2DU7A 1EVKA 5GANj 4WF2A 2RHQB 3E9IA 5GAOl 4NOYA 2DDZA 2ODRD 3LC0A 5DY9A 3VQYA 4JLIA 2IY5B 1YFTA 2CJ9A 1HK9A 4P75C 5LJ3d 5F5WA 1I81A 2ARTA 1SERA 4TTVA 4M7DB 1ATIA 4G85A 2I4LA 3INZA 4PJOD 4MMKA 2I4OA 3LSSA 5GAOm 3BW1A 2ZIOA 4C8QG 1WQ7A 4M7AA 1E22A 5ELOA 3JCMc 4KR3A 1JBMA 4RQFA 1QF6A 1MGQA 4X9CA 5LJ5d 2ALYA 3QTCA 4TQFA 4YDQA 1LNXA 1LYLA 3A5ZA 4HWOA 3JCMf 2ARUA 3HXVA 3VQXA 4M77B 5GMKi 1HC7A 3P8YA 4LNSA 4AH6A 2DZ9A 2AKWA 4YRTA 5ELNA 2E64A 2VXEA 4M7DG 4J6XA 3RF1A 3G1ZA 1KQ1A 4Q6GA 5GANf 4M7DF 4YCVA 3AHUA 4O2DA 4WJ4A 3PZCA 3JB9H 4A53A 4EX5A 5C53B 3V7CA 2QHVA 4M7AE 3ERRA 4C92B 2CJBA
chains in the Genus database with same CATH superfamily
4F7UA 3HRUA 3O8VA 4UC4A 2ZR3A 4FT2A 4BI3A 4XTVA 1WJRA 2BIVA 3CCUA 1N9RA 4C5GA 1UGSB 1YITT 2EJGA 2YLCA 2XIDA 2LJ1A 5HCKA 4OLFA 2ZZFA 1UHCA 4OP0A 2F5KA 4Y91A 3CC4A 4PJMA 4E6RA 1C6VX 1MMDA 4A63B 4ORZA 5L8RE 2DL8A 4HWTA 5CQXA 6AT1B 1W1FA 3OMGA 2DO3A 3AT1B 2CP6A 2OTJA 4J9EA 2ZPBB 1GXIE 1QVGA 4BD3A 3JB9J 2RHSB 4ZTUB 1X2KA 3TEHB 2QTVA 3CCVT 8AT1B 2O4XB 4GBQA 2ZR2A 4YRLA 4J8OA 3V8JA 4P72A 4Z02A 4FSXA 4CC3A 1X56A 5GAN3 3S6WA 2QG9B 2RH2A 2PTKA 4VUBA 2ZTGA 1HD3A 3QPHA 3CCQQ 4CC2A 4J7IA 2W10A 5GANg 4X9DA 1E7OA 1GCQC 1JJ2S 4KUDK 4M75C 5GMKj 4E7JA 1B76A 1NE8A 2DYBA 1VQ7A 3CBMA 2B86A 1D1BA 2GFAA 1H4SA 2ZXFA 3HRSA 5A2QE 4N4HA 1AZEA 3M59A 3R6NA 1UGQB 2F1LA 1D0ZA 2K6DA 1I8FA 1FYNA 5KE2A 2HSEB 3CC7A 3M0RA 2FZKB 3URGA 1X2HA 3HY0A 1AD5A 2ODRC 3HRKA 3EAEA 3CCUT 2LTOA 1ZA1B 1VQ5Q 2HEQA 4YCWA 1TU0B 3RKXA 4RCCA 2RHQA 5L23A 3SB2A 9ATCB 4PJOC 2FL7A 2KXDA 1UGPB 2HDAA 3NEMA 2YRVA 4DQ2A 1WFWA 3FIFA 2YDLA 3HRTA 5CVIA 1F1BB 1MMGA 4NCXA 3Q1JA 2RQTA 3CC4T 3CCRA 2WSEE 2P0KA 4C8QD 3OY9A 4MDXA 4IIMA 1OYXA 4TQDA 4Z8AA 4CH3A 3SWNA 1R0CB 1W66A 5KYUB 1UJ0A 4M75B 1G8XA 3NTHA 4R55A 4IURA 4BB7A 3EHQA 4OMOA 4OMLA 1H641 4QVDA 1ABOA 4JZ3A 1PC0A 3QDRB 4KGVB 4KQEA 2OTJT 4M78B 5GAN7 1NPRA 2GGRA 2VKNA 1ZA2B 4FYVB 3CCJT 1EOVA 2X9HA 2QA4A 4J5YA 2KVQG 1JXOA 4M7DD 1M27C 4HKEA 4C0FA 3E9HA 1KMMA 2DXUA 3LW5E 3REXA 4IUTA 3UATA 2K5IA 4QVCA 3JV3A 1RAGB 5GMKe 3HFZA 5IAYA 4J9BA 5C52B 4HWSA 3HXUA 2AKKA 4IIOA 4C5IA 4MMLA 1GFCA 1PSEA 3GLXA 4ELYC 4OVAA 2DETA 1T0JA 1VIEA 1ABQA 4PJOB 3JCMX 3CCRQ 5CIUA 2BTTA 2ENMA 2QHSA 2HSPA 3IALA 1WPYA 3I55A 1VQ7T 2Z0WA 1PWTA 3UFGA 1TXQA 1WYXA 2J6FA 3JCMb 3L2UA 3DKMA 3R07A 4ME7A 3A7UA 2CP7A 5CKFA 1LVKA 5GJWB 1EFWA 3TVTA 2EWNA 2E10A 1YI2Q 3QKJA 4C92D 1TOVA 3CC7T 2CP5A 1R0BG 2LCSA 1PKSA 4AT1B 4RTWA 3TEGA 2JZ2A 3H0HA 3M0QA 3I35A 2OTLA 5CQYA 1KQSS 1BIAA 4J9HA 3A32A 1D0XA 4XQ3A 1S72A 4QVZA 1SKUB 3M0TA 2YUOA 2K3BA 1L0WA 2D8JA 2K79A 3RL6A 1NZ9A 2E41A 3CCRT 2QHTA 2ABLA 1B34B 1B70A 2EGCA 3L4GA 3A7AA 2L8DA 1OEBA 3M58A 3I55Q 2CSQA 2R58A 5D6YA 1NJ5A 1N5ZA 2V8KA 1WHMA 2EYQA 2V8IA 4OB1B 2DL4A 2E4HA 3OYIA 2E5KA 2FPDA 1YHQQ 1EZZB 2AT1B 2FYKA 2KR3A 5KYNA 1OV3A 2QA4T 2JVVA 2IY5A 5LJ3h 4FW1A 1W6XA 1J3TA 2KYMA 3VUZA 1YJNA 1PM3A 4DBQA 3RMSA 1VQLA 2ZCEA 2DXBA 1WLEA 2DU5A 4CH6A 1R77A 2COYA 4PHCA 4X34A 4P73C 1S72Q 1Y7XA 2HZYA 3CBPA 4A4GA 5LJ5h 1QP2A 3LLRA 4A4EA 2RI2A 1IO6A 2EKOA 3CCMQ 3REUA 1SHFA 2YLBA 2OI3A 3EG9A 2NUTB 1BI2A 1RABB 2RPNA 3I55T 3UGQA 2E6ZA 3P8HA 1UECA 3CPWP 4F7UF 1NJIU 1WI7A 2A0FB 2O01E 5GAOq 4CRIA 2M9UA 1RLQC 3QWYA 4YRKA 2DL7A 2XI9A 4LDWA 2K5FA 2CYZB 3DSQA 3MEWA 3HXYA 1Q86U 4UPAA 2I0NA 3G6EA 3LYIA 2LCLA 2RO0A 2OTLT 2CDTA 3T9NA 2EJFA 3NELA 8ATCB 2C0IA 4N4IA 1VQLQ 1S72T 1C0AA 1NJIC 3C4SA 1SETA 3CC2Q 2X4JA 1X01A 5C51B 1KHCA 2HD0A 1I4K1 2VV5A 4ZTFA 1U8RA 2BE9B 2QQRA 4LD6A 3KUFA 2CREA 1YN8A 2DTHA 4M77C 1Q86C 3OB9A 2DD4A 4ANJA 4RTXA 4M75D 1W2BP 1IGUA 2ZZGA 2QHUA 1Y96A 4TVWA 4KUIA 4YRIA 2H8HA 4YRJA 2JXBA 2BZYA 4P74C 4M78D 4EMHA 5GAMh 2E3HA 2QYZA 1BK2A 1C1AA 2JMAA 5C6SA 4MDWA 2E12A 1X75C 4YRSA 2A08A 1OPLA 2VGNA 2X3WD 2A8EA 2RHYA 3VS2A 1EVKA 5CCAA 1YJNT 2HQXA 4ZTJA 4B9WA 3QDFA 3E9IA 4PLLA 2EQKA 1BB9A 5GAOl 2QK0A 1JEGA 2DRKA 2LQ8A 3QG1A 2ODRD 3LC0A 2VWFA 3HP9A 4P75C 1HK9A 1NBEB 2PZ1A 1MMNA 1I07A 2K5LA 2NUZA 2O9VA 3INZA 3IQLA 4PJOD 3C12A 3BW1A 4DOVA 4GY5A 1RAHB 1WQ7A 2LVMA 2CT4A 3OYMA 1Q81U 2RQWA 2O9SA 1VQ8A 3EFOB 1VQMQ 5CR2A 4C5HA 3EGXB 3G71A 2DILA 4X9CA 3RMQA 4DEYA 2ALYA 1LYLA 3A5ZA 2QAZA 2KY9A 3JCMf 3HXVA 2X3XD 4L6V5 4M77B 1KD1R 2X4YA 1M9SA 4F04B 1VQ4Q 2QEXA 3OYGA 2YUNA 3G6ET 5FW9A 4CI0C 1VQ6Q 3OYAA 2NWMA 2A7YA 1M2OA 3AHUA 4O2DA 5KCOA 2NLUA 1Q81C 3V7CA 2PU9B 4M7AE 4ZNXA 4LE9A 4C8QC 3PCOA 3OSSC 2Q5IA 1WQWA 3M0UA 2ZPEB 2ZPIB 3W3SA 1OZ3A 1VIFA 5A0GA 1Z7MA 4H2SA 1Z9ZA 1YIJA 3FRNA 2D1XA 4B6MA 1WJQA 2JJ9A 2DJZA 2XMFA 5DLQE 1T0HA 3ULRB 3PVQA 4JUVA 1VQ8Q 1K0XA 3G71Q 4JDSA 4EDUA 2V1RA 1U1TA 2EVRA 4YREA 3VS6A 2A28A 3GF5A 2JTEA 4CH5A 3J80E 4KH0B 3A31A 5EG2A 2QEXQ 3JCMd 2EYWA 4BI4A 1NJ2A 4Y92A 2AMCA 1NJ6A 3FLGA 4H2TA 1UTIA 1JU5C 3CCLA 1ZSZA 3S3OA 1VQKA 4YRNA 1OQKA 5I2SA 3BJUA 2OAUA 4E2FB 3E9FA 3WVEB 3FDRA 4LXCA 1NYGA 1H4QA 4JS4A 2EJ9A 5GAN6 2ECZA 1JB0E 2YXYA 2ZINA 4WJ3M 1ZUYA 5GANh 2XDPA 1K73U 1PCXA 1VQ8T 3G71T 1H3ZA 1FYFA 4C92C 1OPKA 4Y28E 1EIFA 1VQZA 2R5AA 3VS0A 3VU3C 1OOTA 3UDCA 2LX7A 1X6OA 3M55A 5DLOA 5HGQA 3CCVA 2MWOA 4E7KA 1FMWA 3HTZA 4IUPA 4JJDA 1WDXA 2MK5A 3UPUA 2I4MA 2CZ7B 4UP8A 2M0YA 1JRIA 1M1KR 2DRMA 1YITQ 1K73C 4YRGA 1VQKQ 3QO7A 2MYSA 2J6OA 5A0DA 2CP0A 1NJ1A 4RG8A 2JN0A 4II1A 3P8TA 2VUBA 5KYYB 1YIJT 4OMFB 3O5ZA 4PFZA 5IHIA 4M7AG 1ASYA 2PVGB 5HKCA 4IKFA 2HCKA 1N8RU 3VS7A 3EGDB 3L2QA 3OYKA 3I56A 1ZBXA 4F7UB 2I4NA 1OZ2A 4M7DA 2DTOA 2X35A 1QCFA 4JRKA 2KQWA 2HL3A 3QO3A 4J9IA 2X4XA 5LJ3j 1Q7YR 5FU6B 1AWOA 2E5AA 4YCUA 2PNIA 4PJJA 2M02A 2L5QA 4H2XA 3C94A 2GQVA 1TWBA 3CCVQ 4LDYA 2RHZA 3CCLT 1WHLA 2ROTA 2RHUA 5CKDA 1VQKT 1QLYA 2KMTA 1N8RC 4ZGEB 2KK4A 5LJ5j 1T3LA 4BY6C 4BI8B 2HNIA 1Q81R 3RESA 1X43A 3DLLA 4ZN1A 2J3LA 3OQ5A 3JCMV 1H92A 3A7RA 5GAOr 2CZ0B 1M1FA 3QJYA 3MPUB 1M2VB 3BDLA 2NUPA 4FIBA 3QSUA 5LL6S 2CH4A 2F5TX 2YT6A 1PYSA 2DVEA 2Y4XA 1QCNA 4M77D 1VOMA 2LMJA 3M56A 4JS5A 1O75A 5LJ3f 2A37A 1UGVA 5J39A 3OYEA 1NYQA 2CS7A 4Q15A 5CKEA 3G7ZA 1EIYA 3CCJA 2AK5A 1D09B 1C0MA 3FJPA 3CXCP 1RADB 3CCUQ 4TVAA 2E5QA 1BBUA 4YRPA 4HCCA 4HT8A 3UGTA 1SF9A 4AG2C 2L3QA 1ZLMA 5GJVB 3OS5A 4EIKA 3EH1A 3H0FA 5KNNA 2EL9A 2FRYA 4LN2A 4BY6B 3CC4Q 3RGLA 1UG1A 1QMCA 5LJ3e 2CIMA 3CPWS 4P71A 2DBKA 4LUDA 3I56T 4M78C 2RHSA 3CQTA 1LOJA 3FEOA 2KBTA 1R8OB 1Y0MA 1U1SA 2SEMA 4Z88A 5GAMj 4E7ZA 3JB9I 5C0MA 1HYOA 1I1JA 1ADYA 1WHGA 4PG3A 4X1VA 2CH4W 4FT4A 2OTJQ 5LJ5e 1SG5A 1YB3A 1A0NB 2QQBA 3CCJQ 2E6NA 1D3BA 4QT7A 1IL2A 4XTWA 2JTMA 1UE9A 1SSHA 4H2UA 1FX7A 3OYBA 1M8MA 3MO8A 3CD6A 1K73R 3LGFA 1VQOA 3L2ZA 3SWNB 2ZIMA 2DFUA 3CCSA 1IHVA 3HXWA 3KFVA 3OBWA 4RTVA 1PD0A 4RDXA 1G5VA 2LP5A 1SRMA 3EH2A 3CMQA 1W4SA 1NJ8A 4HA8A 2KGTA 1QVGP 4C8QE 1VQ7Q 3A8MB 1Y71A 4CH4A 1QP3A 2DVJA 5GAMf 1FWZA 1B3QA 4ZGJB 4A4HA 3RERA 2KT8A 1G5IA 2RQUA 2LT1A 1H4VB 4N0AA 2GBQA 3BY7A 1YNZA 3HFZB 4P5NA 2EKHA 2JMCA 2XG8D 3CC7Q 4BACA 4H02A 4DPGA 2RNAA 3HY1A 5IXFA 1ARKA 4NL2A 4M7DE 1TUDA 1X2QA 2K2VA 4IUVA 1QVFP 4HT4A 3KBGA 1N8RR 3JB9G 1HXDA 3SFMA 4LD9K 1M5Q1 1VQOQ 2IPOB 1CKBA 1GCQA 3JB9F 1G2BA 2KSSA 5GAMe 3M57A 3OW2P 1XTDA 1VQPA 2QXFA 3L1AA 1YWOA 4K86A 1IHWA 2EPDA 3QNEA 1K76A 2K7AA 2RHXA 3TSWA 1WIEA 1PKTA 3UA7A 1KMNA 3M9QA 3JCMQ 2DBMA 1SRYA 3L2VA 4JJCA 3VQWA 4XTUA 3U23A 4LDUA 2C7IA 4L59A 4EO4A 2PQWA 4J9DA 5I2MA 3JCMW 2JS0A 2PMEA 4C92E 2LRQA 2QA4Q 2K57A 3OYNA 2DL3A 2KROA 2PVOB 1Y57A 1QKWA 3IG2A 1AT1B 1KD1U 3JCMg 1I5LA 1Z9QA 2CP2A 4NS5A 4PJOA 3HFNA 1M90R 1B70B 4J7FA 3CD6T 3PVLA 1VQOT 3OBYA 3L4GB 2C0TA 4WTOB 3CCST 4G84A 3NTIA 3EG0A 2DK3A 2EQIA 4RMFA 2EW3A 2DYIA 3CPWA 1WNLA 1P92A 5CKBA 2DU7A 5GANj 2MI6A 4OMPA 1M3AA 2BUDA 4AMCA 1Q82U 5EC7A 1VQPQ 2YUQA 1VA7A 4AFQC 2ZAEA 3VQYA 4RUGA 2IY5B 5F5WA 2CJ9A 2RI3A 1BI1A 1KD1C 3ME9A 4AFSC 2I4LA 4MMKA 1IRXA 2IVWA 1WHJA 2AZSA 4C8QG 4GLMA 4BE2A 1V1CA 1WGSA 2XICA 3EHRA 4J9FA 4AFUC 4M7AA 3ASKA 3M5AA 1RUWA 1YJ9A 5ELOA 3JCMc 1JBMA 1V29B 4YDQA 1Q82C 4HWOA 4KBMB 2ARUA 2OTLQ 5GMKi 3P8YA 3MP1A 5D7UA 2AKWA 3QBYA 5ELNA 3EG9B 3GNFB 3L2WA 2E64A 2FHDA 2VXEA 3TU4K 1ZUUA 4B9XA 4M7DG 2OX7A 3RF1A 1TUGB 2D0NA 2CUDA 4D6WA 1VQNA 3P8DA 5GANf 3HHTB 4M7DF 2RI5A 1AZGB 1VQPT 4WJ4A 3JB9H 2WACA 3UWNA 4A53A 5FU7C 4EX5A 5C53B 1Y07A 1W70A 1AWJA 3LH5A 4JPBW 3PGGA 2JNGA 2LQKA 4XU0A 5J3BA 4A4FA 3OA6A 2AHJB 5HK3A 4K87A 1WXBA 4TVYA 4DOWA 5ECAA 5IT9E 2SRCA 2LZ6B 4XEMA 1QCOA 3CEYA 5E3IA 2MPXC 1B7YA 1JJ2P 2DQ3A 1OU8A 1AEYA 3DLMA 3A8OB 2JW4A 2FZGB 4DA4A 1NYFA 2KXCA 3BFMA 2XKOC 5GANe 1YJNQ 1PNJA 3VYHB 2JTFA 2V8JA 4C92G 3ER0A 2DJQA 2NUTA 3RR6A 3UT1A 1JJCA 3QO8A 3CMAA 3RACA 2VB6A 2HQEA 3R6OA 5CK9A 4RTYA 1WHKA 1WJSA 3OYYA 2K4YA 1M1KU 1Y96B 4EMKC 4C0GA 1NNHA 3MJXA 1OX9A 3QUIA 5KYWA 2DMOA 5GAOp 4A54A 1K4US 3A8GB 1UB4A 4M75E 3HXZA 2BZXA 5FU7B 4J6YA 5CAIA 1LCKA 5GAN2 2J7IA 1QKXA 1VQ9A 4WCIA 4GLKA 1YJ9T 4P3PA 3E1SA 4M78E 3OYCA 1KC8R 3WQZA 3G6EQ 3UH0A 1M1KC 3V8LA 2KDSA 1ACMB 2EQMA 2JT4A 2EYZA 2GQIA 4BE1A 2CGHA 2KEAA 1Q7YU 1ASZA 2RN8A 2HAXA 3LX7A 7AT1B 4JRIA 3WVDB 1GRIA 1NLOC 4LNPA 1YFSA 4KULA 3RIRA 1VQNT 2NYSA 3CCEA 2R57A 4ZGDB 4YRFA 2ALYB 1KHIA 4DBFA 1AOJA 1MV3A 2WSCE 2WSFE 4FL6A 4J9CA 1USYC 3N5BB 3QYHB 4PJOE 2YHTA 1JO8A 1WX6A 2KAFA 1WZOA 2RF0A 3HTRA 2K9GA 2IG0A 4RCBA 2E1HA 1MNEA 2DF6A 1X2GA 4EMKB 1WU7A 2LQWA 1Q7YC 1SESA 3X24B 3PTAA 4DEXA 2O88A 4J9GA 1N9WA 2RQVA 2O31A 1YWPA 4MZTA 4QW2A 1U06A 1GGMA 4K11A 2PMFA 3V7RA 1M4ZA 4HXJA 3MF1A 2RQRA 4RTZA 1KSWA 2E3CA 3PCOB 3LWIA 2DIQA 3CMEA 2Q7EA 1GBRA 1S1NA 2J05A 2M1HA 4FCYA 1Q82R 5KH6A 3NENA 2RK1A 4JZ4A 5K1PA 3CMAT 2LQNA 2D0QB 2L3RA 3EG2A 3QHSA 4QKUA 5K1XA 3EFOA 4QQ6A 3UF4A 3GPLA 3ZBDA 3JAME 3VUBA 4KH1B 5GMKm 1YJWA 4M77A 1IXDA 3TCJA 4RKUE 1YBYA 1KQSP 1YCYA 5I22A 5GAN8 2AMCB 3ZEHA 3HSBA 1VQ9T 1QWEA 2COWA 1ZSZB 1E24A 3FJ5A 1HTTA 1B8AA 1QE0A 3M0PA 1KJWA 4M75G 2O2OA 2EQUA 3C0CA 3GBQA 4M75F 3CMEQ 1KIKA 4Q5WA 2QGFB 1RAFB 4M78G 1RAEB 3RUXA 4P75A 4BE0A 2RJDA 2G6FX 1M3BA 3X20B 3CCET 3EG3A 3HFOA 4YP0A 3CBOA 3NHNA 2BE7D 3X28B 1YIJQ 3OS2A 2RHIA 1GCPA 4LUEA 5CKHA 1RIQA 1ZQ1A 5KYXA 5FU6C 1N9SA 3D7SB 2KRNA 1G83A 1OI1A 3QYGB 2R5MA 4PJOG 4FYYB 2XU8A 2HQHA 4PJOF 3IKMB 4AFZC 4NL3A 4XAXB 2EBPA 2VASA 4LDVA 4KR2A 4ELZC 3CMET 1QVFS 3MKDA 2EGEA 3CCLQ 3A8LB 3OYLA 2XK0A 1T3SA 1VUBA 3PIOA 4C8QA 1OU9A 2EIFA 3V7SA 1HJDA 1NYRA 2LT4A 3L42A 3OW2S 2ZT7A 2JS2A 4P3NA 1MUZA 4YRCA 2ZPFB 1YJWT 2FB7A 2JOYA 1KOGA 3MCAB 4P72C 2XD0A 1BIBA 1TSFA 2J6KA 4M7AF 1PD1A 3HL8A 4HWPA 2PVDB 2OAWA 3META 1GFDA 4K88A 5D6WA 4H2XB 1BCMA 4HCBA 2HKQB 4OB2B 2ED1A 4XK8E 2RMOA 2VYTA 1TTHB 1B7TA 2VC8A 3CXCA 1I5OB 2QDLA 4PKCC 2QQAA 4YRMA 1IZ6A 1VYVA 2GF7A 4JLGA 2I2LA 2K2MA 3MEAA 3EFSA 3SDZA 1YP5A 3PMTA 4XU3A 2DAQA 3GIBA 5IHKA 4P71C 12ASA 2XGTA 2AIRB 5GAOn 3ICAA 4PK4A 2XDDA 3OS1A 2ZZDA 3MEYA 1K8AR 2AKLA 2NUPB 1SPKA 4H2WA 2JM8A 1BI3A 1PYSB 2YRDA 2IIMA 2CP3A 2KNBB 2ZT5A 2JUFA 1XOVA 1M90U 1SEMA 1UGRB 4ZTZB 3JSCA 3RNJA 4C92A 1EIYB 2QQSA 3CCQA 3I56Q 2ZGWA 4HCKA 5I21A 5IHNA 3OS0A 4YPFA 3E19A 3X26B 4C0DB 3SD4A 1WLPB 2COZA 2ZNJA 1QWFA 2QQ9A 1GL5A 4M77E 4TVAB 2P0LA 2LC4A 1LPLA 3H6ZA 3MEUA 4IUUA 1M3CA 2ZT6A 1YFNA 4UP7A 3SWNC 2JM9A 2Y90A 2D9TA 2RD1A 1M90C 3RKYA 2KE9A 3VRYA 2HBPA 2RJEA 2FRWA 2HKNA 5LJ5f 1U5SA 3TEEA 1X27A 1BI0A 2ED0A 2VGMA 3HFVA 1M2VA 2EYYA 4N0AC 1AWWA 4OMQA 2CJAA 2E3IA 3JCMh 2RK2A 3JB9D 3HRIA 4ESRA 2KRSA 2H3EB 2W0ZA 5FLXE 1VQ5A 1NPPA 2VVKA 4BDYA 2L89A 4J6WA 2DEUA 3OYJA 4UP9A 2QTXA 2Q7GA 1Q95G 4PFOA 3TEHA 2X51A 2O4XA 1D3BB 2MOXA 2XDBA 1NG2A 4FU6A 4OGEA 2RHQB 3LGLA 4LVKA 3H9NA 4N4GA 1WHHA 2DDZA 1QVFA 1RAAB 3OYDA 5DY9A 3PT9A 4JLIA 1YFTA 5LJ3d 1I81A 2LX9A 3L2RA 2ARTA 2DX1A 1SERA 4ATOA 1XNIA 4TTVA 2A36A 2MF2A 4LVIA 1IB8A 4G85A 2I4OA 2ZPGB 1FXXA 3OW2A 2L0AA 3PFSA 1DJ7B 1E22A 1VYUA 1H8KA 3VYGA 4RQFA 4HVWA 1MGQA 5LJ5d 4TQFA 1BBZA 1LNXA 4TVRA 4PJNA 3A98A 3E9GA 4AH6A 2DZ9A 1W2BS 4YRTA 1ZX6A 2CT3A 2MMPA 4J6XA 3CCQT 3PNWC 1KQ1A 4Q6GA 2DIGA 4LVMA 4YCVA 3PZCA 1V76A 2D6FA 3VJPA 2V1QA 4O6JA 3GNGA 3TREA 3VS3A 1PRMC 1KK7A 1WA7A 4D8KA 3S3MA 3M4QA 5AYFA 4M77G 3RBBB 2YRCA 2HL5C 4LDXA 1D1AA 4JRQA 4E7IA 2LNHB 3BE3A 4M77F 1YI2A 1Z7NA 1H3HA 2DZCA 3CD6Q 4E51A 5I11A 5A0LA 1KC8U 2C06A 1UEBA 1YGBA 4QQDA 5KYUA 3DB3A 3A8HB 3CCSQ 1BYMA 3OMCA 4M7AC 5KCHA 4M75A 1VQ5T 1E1TA 4PNOA 1RLPC 1ADJA 3ZL7C 2M16A 1KG1A 4M78A 3VV0A 4V2SA 4JJBA 1QW1A 3E2UA 1UHFA 4F16A 4OF1A 3M4PA 3I7FA 2RA2A 3PE0A 4F7UE 3DB4A 1AHJB 2C0OA 4YYEA 4H2YA 1XJWB 5GAMd 1KC8C 1X69A 3JRZA 4CS4A 2F2WA 4TWAA 1EQRA 2ESWA 1J5WA 1X55A 4F14A 11ASA 2RB6A 4H2VA 3KFUA 2V26A 3F70A 1K0SA 4RQEA 3NPFA 4PL6A 1UJYA 1YHQA 1M8VA 4Z89A 1FMVA 3MP6A 2FPFA 1RACB 3JCMP 1E6HA 4O5VA 3G4SA 2P5IA 1RL2A 1PRLC 1NLPC 3BDUA 3RKWA 1X6GA 4M7AB 4KRTA 1GBQA 1JJ2A 1K9AA 2GCXA 2ZCFB 2QI2A 2Y4YA 2M0OA 1JQQA 1LJOA 3NFCA 1RAIB 3CCMA 4D8DA 4OMMA 2AKWB 4XEOA 4XTXA 2H3JA 2AZVA 4C8QF 3P8BB 1MNDA 1NEBA 3OSVA 1D0YA 1EVLA 4HWRA 3H0IA 2DEQA 4PLIA 3MEVA 2EQJA 2YSQA 3M54A 2FZCB 5FWBA 4OB0B 1BU1A 2EAYA 1B34A 1YI2T 2ZPHB 4IUQA 2DA9A 3VKIA 5FWCA 4C5EA 3HXXA 2VXFA 4RTTA 3VS5A 5GAN4 1W2BA 2DKGA 4JJNK 2YWWA 4HT9A 2G3RA 3G4SQ 2J3MA 1K9MU 1G3SA 3C95A 4J15A 5GMKl 4YROA 3EGUA 3NGPA 1B7YB 2L2PA 3CC2A 4BW9A 5GAN5 4R0KA 1OULA 2DNUA 3V8KA 1WXUA 2F69A 3M53A 1QVPA 3J7AF 2MAMA 1CSKA 4F7UG 4E7LA 1YJ9Q 1JJCB 4BWAA 3PIPA 4KGXB 1IREB 3FB9A 2ZT8A 4CC4B 3NTKA 4YRQA 1K9MC 1AVZC 1YHQT 1B07A 2CUBA 1ZUKA 4RG2A 2GFUA 1RI9A 3JCMJ 4EMGA 2ATCB 4C92F 2DXTA 2QDYB 5KYWB 4J83A 1VYTA 1VQNQ 3PMIA 3G4ST 2ZZEA 3NETA 2A3LA 4DBRA 4X5OA 1X6BA 4OMNA 4LVLA 3TUPA 5IN1A 1KQ2A 1WXTA 3VBBA 1ZBJA 5GANd 2LJ0A 3MP8A 2YUPA 2DM1A 5IXBA 2FG0A 4RTUA 3REAB 3TQ7P 1N6AA 1X54A 3IKLA 3MQZA 4XU1A 3CCMT 2P0PA 4XTYA 2KRMA 3M4YA 2M51A 3THKA 4C0ZA 2CKKA 3A5YA 3HKSA 4L5GA 2XTIA 1O9SA 1QQJA 5GMKh 1PG5B 1VQMA 1WYDA 3MF2A 1BBWA 2K3YA 3NMZC 2KYBA 3QZ9B 4P73A 3VQVA 1BKBA 1K1ZA 3A1PA 3CMAQ 4JRPA 1VQ4A 1N27A 2PUKB 3OYFA 1KQSA 1VQ6A 4CC7A 2DERA 3A5ZB 1H4TA 2Q7HA 1D1CA 4FYXB 1VQLT 3REBB 4HVVA 1K8AU 2FEIA 3SEMA 3KXTA 1ZSZC 4KGZB 1AWXA 3CC2T 3EFRA 3LSQA 2C8MA 2F2VA 3RDVA 1CKAA 3QWXX 4CS3A 3QO5A 1YFRA 1VQ9Q 3A74A 2ZNIA 3CXCS 2E65A 4BDZA 5D6XA 3QZ5B 1UDLA 4ZN3A 2DQ0A 2DE0X 1K8AC 5LJ3g 1EFNA 2DL5A 3MHXA 1NEGA 4XTZA 1TG0A 2XHCA 4XU2A 4EPCA 3X25B 2LDMA 4LVJA 2ROLA 2GNCA 3VS1A 3EGXA 3CCEQ 4CS2A 3SHWA 4AG1C 4EMKA 1U3OA 3FC3A 1ZHIA 2CSIA 1UFFA 5LJ5g 1TH7A 3I9QA 4M7AD 2DTIA 2DPPB 1G3TA 2RJCA 3M4GA 2EFIA 2CZ1B 3OD1A 5FROA 5M9OA 4OGCA 4P74A 3EG1A 1MHNA 2L3PA 1E1OA 1IGQA 4FSSA 2P4TA 1TS9A 3VRZA 1M1GA 1PHTA 2PUOB 3JCMe 4DBHA 1VQMT 2HBWA 4ZIBA 1FMKA 2MWPA 2P4RA 4HVCA 4OB3B 2ARSA 4L87A 3P8VA 4YTLA 3LWHA 4WI1A 4F17A 1K9MR 3G1JA 5FRNA 4M7DC 3CPFA 2RM4A 5IH2A 2RJFA 1G51A 4YRRA 5AT1B 5KYXB 1VQ4T 2QASA 4FW2A 4M78F 4E7SA 2EYXA 4E47A 1UUEA 3QJ6A 4HVUA 1G5HA 1MV0B 3UA6A 1VQ6T 1USYA 2KI7A 2L3SA 5HY6A 2EGAA 4P3OA 2DLPA 2QGGA 1QVGS 2B8AA 1YJWQ 4HCZA 1YITA 2FPEA 2J06A 1RI0A 1NM7A 2LJ3A 2G4CA 2P84A 4KT0E 3TSZA 3OYHA 5J26A 4R56A 1NJIR 2FVUA 1SRLA 2BKDN 3QIIA 2D8HA 3ZFJA 1SHGA 2F2XA 1XQHA 1G3WA 4FM4B 1BCOA 3QXEB 4A4KA 4C8QB 3J81E 2P0QA 2Q5HA 3GP8A 3S3NA 1MMAA 5GAMg 1Q86R 4BUGA 1KFZA 4PFPA 1M30A 4WF2A 2NS6A 3H8ZA 2FO0A 3I5SA 4M4ZA 1E6GA 4NOYA 5DM7R 3VS4A 1YCSB 2QEXT 3GOXA 2MCNA 2E70A 4M7DB 2OJ2A 1ZSGA 3HPWA 1ATIA 2LCCA 3LSSA 5FRMA 5GAOm 4C0DC 2ZIOA 1SSFA 4MZPA 3LH0A 2HMAA 2GTOA 2CZ6B 4KR3A 2K3XA 4RMOA 1G3YA 1QF6A 3QTCA 3M0SA 2GTJA 1I0CA 2MIOA 2X4WA 5KE3A 3I5RA 3VQXA 1HC7A 1TUCA 4LNSA 4E7HA 2LNVA 4PJLA 2DD5A 1EX4A 1HSQA 3G1ZA 2BZ8A 2DXCA 1JXMA 4QQGA 1OX8A 5KYYA 1PSFA 4MZMA 2KT1A 3H41A 5HK0A 3EGDA 2QHVA 3ERRA 3WXMB 4C92B 4FYWB 2CJBA 5CO7A
chains in the Genus database with same CATH topology
4F7UA 3HRUA 3O8VA 4UC4A 2ZR3A 4FT2A 4BI3A 4XTVA 1WJRA 2BIVA 3CCUA 1N9RA 4C5GA 1UGSB 1YITT 2EJGA 2YLCA 2XIDA 4OLFA 2ZZFA 4OP0A 2F5KA 4Y91A 3CC4A 5L8RE 4HWTA 5CQXA 3OMGA 2DO3A 2OTJA 2ZPBB 1GXIE 1QVGA 4BD3A 3JB9J 2RHSB 4ZTUB 3TEHB 3CCVT 2O4XB 2ZR2A 4YRLA 4J8OA 3V8JA 4P72A 4Z02A 4FSXA 1X56A 5GAN3 3S6WA 2RH2A 4VUBA 2ZTGA 3QPHA 4J7IA 5GANg 4X9DA 1JJ2S 4KUDK 4M75C 5GMKj 4E7JA 1B76A 1NE8A 1VQ7A 3CBMA 2GFAA 1H4SA 2ZXFA 3HRSA 5A2QE 4N4HA 3M59A 1UGQB 1I8FA 5KE2A 3CC7A 3URGA 1X2HA 3HY0A 2ODRC 3HRKA 3EAEA 3CCUT 2LTOA 4YCWA 3RKXA 4RCCA 2RHQA 3SB2A 4PJOC 2FL7A 1UGPB 3NEMA 2YRVA 4DQ2A 3FIFA 3HRTA 5CVIA 4NCXA 3Q1JA 3CC4T 3CCRA 2WSEE 2P0KA 4C8QD 3OY9A 4MDXA 1OYXA 4TQDA 4CH3A 3SWNA 1W66A 4M75B 3NTHA 4R55A 4IURA 4BB7A 1H641 4QVDA 3QDRB 4KQEA 2OTJT 4M78B 5GAN7 1NPRA 3CCJT 1EOVA 2QA4A 4J5YA 2KVQG 4M7DD 4HKEA 4C0FA 3E9HA 1KMMA 2DXUA 3LW5E 3REXA 4IUTA 2K5IA 4QVCA 5GMKe 3HFZA 5IAYA 5C52B 4HWSA 3HXUA 4C5IA 4MMLA 1PSEA 3GLXA 4ELYC 4OVAA 1VIEA 4PJOB 3JCMX 5CIUA 2QHSA 3IALA 1WPYA 3I55A 1VQ7T 3UFGA 3JCMb 3L2UA 3DKMA 3R07A 4ME7A 3A7UA 5CKFA 1EFWA 2EWNA 2E10A 3QKJA 4C92D 3CC7T 3TEGA 2JZ2A 2OTLA 5CQYA 1KQSS 1BIAA 3A32A 4XQ3A 1S72A 4QVZA 1L0WA 3RL6A 1NZ9A 2E41A 3CCRT 2QHTA 1B34B 1B70A 3L4GA 3A7AA 2L8DA 3M58A 2R58A 5D6YA 1NJ5A 2V8KA 4OB1B 2EYQA 2V8IA 3OYIA 2FYKA 2QA4T 2JVVA 2IY5A 5LJ3h 3VUZA 1YJNA 3RMSA 1VQLA 2ZCEA 2DXBA 1WLEA 2DU5A 4CH6A 4PHCA 4X34A 4P73C 1Y7XA 3CBPA 4A4GA 5LJ5h 1QP2A 3LLRA 4A4EA 2RI2A 2EKOA 3REUA 2YLBA 1BI2A 3I55T 3UGQA 2E6ZA 3P8HA 4F7UF 1NJIU 2O01E 5GAOq 4CRIA 2M9UA 4YRKA 2XI9A 4LDWA 2K5FA 2CYZB 3DSQA 3MEWA 3HXYA 1Q86U 4UPAA 3G6EA 3LYIA 2LCLA 2RO0A 2OTLT 3T9NA 2EJFA 3NELA 4N4IA 1S72T 1C0AA 1NJIC 3C4SA 1SETA 2X4JA 1X01A 5C51B 1KHCA 2HD0A 1I4K1 2VV5A 4ZTFA 1U8RA 2QQRA 4LD6A 3KUFA 2DTHA 4M77C 1Q86C 3OB9A 2DD4A 4M75D 2ZZGA 2QHUA 1Y96A 4TVWA 4KUIA 4YRIA 4YRJA 4P74C 4M78D 4EMHA 5GAMh 5C6SA 4MDWA 2E12A 1X75C 4YRSA 2VGNA 2A8EA 2RHYA 1EVKA 5CCAA 1YJNT 2HQXA 4ZTJA 4B9WA 3E9IA 4PLLA 2EQKA 5GAOl 2LQ8A 3QG1A 2ODRD 3LC0A 3HP9A 4P75C 1HK9A 2K5LA 3INZA 4PJOD 3C12A 3BW1A 4DOVA 4GY5A 1WQ7A 2LVMA 3OYMA 1Q81U 1VQ8A 5CR2A 4C5HA 3G71A 4X9CA 3RMQA 2ALYA 1LYLA 3A5ZA 2KY9A 3JCMf 3HXVA 4L6V5 4M77B 2X4YA 1M9SA 2QEXA 3OYGA 3G6ET 4CI0C 3OYAA 2A7YA 3AHUA 4O2DA 5KCOA 2NLUA 1Q81C 3V7CA 2PU9B 4M7AE 4C8QC 3PCOA 3OSSC 2Q5IA 1WQWA 2ZPEB 2ZPIB 3W3SA 1OZ3A 1VIFA 5A0GA 1Z7MA 4H2SA 1YIJA 3FRNA 1WJQA 2DJZA 5DLQE 4JUVA 4JDSA 4EDUA 1U1TA 4YREA 3GF5A 4CH5A 3J80E 3A31A 5EG2A 3JCMd 4BI4A 1NJ2A 2AMCA 1NJ6A 3FLGA 4H2TA 3CCLA 4YRNA 3S3OA 1VQKA 5I2SA 3BJUA 2OAUA 3E9FA 3WVEB 3FDRA 1H4QA 4JS4A 2EJ9A 5GAN6 1JB0E 2ZINA 4WJ3M 5GANh 2XDPA 1K73U 1VQ8T 3G71T 1H3ZA 1FYFA 4C92C 4Y28E 1EIFA 1VQZA 2R5AA 3VU3C 3UDCA 1X6OA 3M55A 5DLOA 5HGQA 3CCVA 2MWOA 4E7KA 3HTZA 4IUPA 2I4MA 3UPUA 2CZ7B 4UP8A 1JRIA 1K73C 4YRGA 3QO7A 5A0DA 1NJ1A 4RG8A 2JN0A 4II1A 3P8TA 2VUBA 1YIJT 4OMFB 4M7AG 1ASYA 2PVGB 5HKCA 4IKFA 1N8RU 3L2QA 3OYKA 3I56A 1ZBXA 4F7UB 2I4NA 1OZ2A 4M7DA 2DTOA 2X35A 4JRKA 2KQWA 3QO3A 2X4XA 5LJ3j 5FU6B 2E5AA 4YCUA 2L5QA 4H2XA 3C94A 2GQVA 4LDYA 2RHZA 3CCLT 2RHUA 5CKDA 1VQKT 2KMTA 1N8RC 4ZGEB 2KK4A 5LJ5j 4BY6C 4BI8B 2HNIA 3RESA 3DLLA 4ZN1A 2J3LA 3OQ5A 3JCMV 3A7RA 5GAOr 2CZ0B 1M1FA 3QJYA 3BDLA 4FIBA 3QSUA 5LL6S 2F5TX 1PYSA 2DVEA 2Y4XA 4M77D 3M56A 4JS5A 1O75A 5LJ3f 5J39A 3OYEA 1NYQA 2CS7A 4Q15A 5CKEA 3G7ZA 1EIYA 3CCJA 3FJPA 4TVAA 2E5QA 1BBUA 4YRPA 4HCCA 4HT8A 3UGTA 3OS5A 5KNNA 2EL9A 4BY6B 3RGLA 5LJ3e 2CIMA 3CPWS 4P71A 3I56T 4M78C 2RHSA 1LOJA 3FEOA 1R8OB 1U1SA 5GAMj 3JB9I 5C0MA 1ADYA 4PG3A 4FT4A 5LJ5e 1YB3A 2QQBA 2E6NA 1D3BA 1IL2A 4XTWA 2JTMA 4H2UA 1FX7A 3OYBA 3MO8A 3CD6A 3LGFA 1VQOA 3L2ZA 3SWNB 2ZIMA 3CCSA 3HXWA 3OBWA 4RDXA 1G5VA 3CMQA 1W4SA 1NJ8A 4HA8A 4C8QE 3A8MB 1Y71A 4CH4A 1QP3A 5GAMf 1FWZA 4ZGJB 4A4HA 3RERA 1G5IA 2LT1A 1H4VB 4N0AA 3BY7A 3HFZB 4P5NA 2XG8D 4BACA 4H02A 4DPGA 3HY1A 4NL2A 4M7DE 2K2VA 4IUVA 4HT4A 3KBGA 3JB9G 1HXDA 3SFMA 4LD9K 1M5Q1 3JB9F 2KSSA 5GAMe 3M57A 1XTDA 1VQPA 2QXFA 3L1AA 4K86A 3QNEA 2RHXA 1KMNA 3M9QA 3JCMQ 1SRYA 3L2VA 3VQWA 4XTUA 2C7IA 4LDUA 4L59A 4EO4A 2PQWA 5I2MA 3JCMW 2PMEA 4C92E 2LRQA 2K57A 3OYNA 2PVOB 3IG2A 1KD1U 3JCMg 1I5LA 4NS5A 4PJOA 3HFNA 1B70B 4J7FA 3CD6T 1VQOT 3OBYA 3L4GB 3CCST 4G84A 2DK3A 3NTIA 4RMFA 3CPWA 1WNLA 1P92A 5CKBA 2DU7A 5GANj 2MI6A 2BUDA 1Q82U 3VQYA 2IY5B 5F5WA 2CJ9A 2RI3A 1BI1A 1KD1C 3ME9A 2I4LA 4MMKA 2IVWA 4C8QG 4BE2A 1WGSA 2XICA 4M7AA 3ASKA 3M5AA 1YJ9A 5ELOA 3JCMc 1JBMA 1V29B 4YDQA 1Q82C 4HWOA 4KBMB 2ARUA 5GMKi 3P8YA 3MP1A 2AKWA 3QBYA 5ELNA 3GNFB 3L2WA 2E64A 2FHDA 2VXEA 3TU4K 4B9XA 4M7DG 3RF1A 4D6WA 1VQNA 3P8DA 5GANf 3HHTB 4M7DF 2RI5A 1VQPT 4WJ4A 3JB9H 2WACA 3UWNA 4A53A 5FU7C 4EX5A 5C53B 1Y07A 3PGGA 2JNGA 2LQKA 4XU0A 5J3BA 4A4FA 3OA6A 2AHJB 5HK3A 4K87A 4TVYA 4DOWA 5IT9E 4XEMA 3CEYA 5E3IA 1B7YA 2DQ3A 3DLMA 3A8OB 4DA4A 3BFMA 5GANe 2XKOC 3VYHB 2JTFA 2V8JA 4C92G 3ER0A 3UT1A 1JJCA 3QO8A 3CMAA 3RACA 2HQEA 3R6OA 5CK9A 1WJSA 3OYYA 2K4YA 1M1KU 1Y96B 4EMKC 4C0GA 1NNHA 3QUIA 5GAOp 4A54A 3A8GB 1UB4A 4M75E 3HXZA 5CAIA 5FU7B 4J6YA 5GAN2 1VQ9A 4GLKA 1YJ9T 4P3PA 3E1SA 4M78E 3OYCA 3WQZA 3UH0A 1M1KC 3V8LA 2KDSA 2EQMA 4BE1A 2CGHA 1Q7YU 1ASZA 2HAXA 3LX7A 4JRIA 3WVDB 1YFSA 4KULA 3RIRA 1VQNT 3CCEA 2R57A 4ZGDB 4YRFA 2ALYB 1KHIA 2WSCE 2WSFE 4FL6A 1USYC 3N5BB 3QYHB 4PJOE 2YHTA 2KAFA 2IG0A 4RCBA 2E1HA 1X2GA 4EMKB 1WU7A 1Q7YC 1SESA 3X24B 3PTAA 1N9WA 4MZTA 4QW2A 1GGMA 2PMFA 3V7RA 1M4ZA 3MF1A 3PCOB 2E3CA 3LWIA 2DIQA 3CMEA 2Q7EA 2M1HA 5KH6A 3NENA 2RK1A 5K1PA 3CMAT 2D0QB 2L3RA 3QHSA 5K1XA 4QQ6A 3GPLA 3ZBDA 3JAME 3VUBA 5GMKm 1YJWA 4M77A 3TCJA 4RKUE 1YBYA 1YCYA 5GAN8 2AMCB 3ZEHA 3HSBA 1VQ9T 1E24A 1HTTA 1B8AA 1QE0A 4M75G 2EQUA 4M75F 4Q5WA 4M78G 3RUXA 4P75A 4BE0A 2RJDA 3X20B 3CCET 3HFOA 4YP0A 3CBOA 3X28B 3OS2A 2RHIA 5CKHA 1RIQA 1ZQ1A 5FU6C 1N9SA 1OI1A 3QYGB 2R5MA 4PJOG 2XU8A 4PJOF 3IKMB 4NL3A 4XAXB 4LDVA 4KR2A 4ELZC 3CMET 1QVFS 3A8LB 3OYLA 2XK0A 1VUBA 3PIOA 4C8QA 2EIFA 3V7SA 1NYRA 2LT4A 3L42A 3OW2S 2ZT7A 4P3NA 4YRCA 2ZPFB 1YJWT 2FB7A 2JOYA 1KOGA 3MCAB 4P72C 2XD0A 1BIBA 4M7AF 3HL8A 4HWPA 2PVDB 3META 4K88A 5D6WA 4H2XB 4HCBA 4OB2B 4XK8E 2VYTA 2VC8A 3CXCA 4PKCC 2QQAA 4YRMA 1IZ6A 2GF7A 4JLGA 2I2LA 3MEAA 3EFSA 3SDZA 3PMTA 4XU3A 2DAQA 3GIBA 4P71C 12ASA 2XGTA 5GAOn 3ICAA 2XDDA 3OS1A 2ZZDA 3MEYA 4H2WA 1BI3A 1PYSB 2ZT5A 2JUFA 1XOVA 1M90U 1UGRB 4ZTZB 3JSCA 4C92A 1EIYB 2QQSA 3CCQA 2ZGWA 5I21A 3OS0A 4YPFA 3E19A 3X26B 4C0DB 3SD4A 2ZNJA 2QQ9A 4M77E 4TVAB 2P0LA 2LC4A 3H6ZA 3MEUA 4IUUA 2ZT6A 4UP7A 3SWNC 2Y90A 2D9TA 2RD1A 1M90C 3RKYA 2HBPA 2RJEA 5LJ5f 3TEEA 1BI0A 2VGMA 3HFVA 4N0AC 2CJAA 3JCMh 2RK2A 3JB9D 3HRIA 5FLXE 1VQ5A 1NPPA 4BDYA 2L89A 4J6WA 3OYJA 4UP9A 2QTXA 2Q7GA 3TEHA 2O4XA 1D3BB 2XDBA 4FU6A 4OGEA 2RHQB 3LGLA 4LVKA 4N4GA 2DDZA 1QVFA 3OYDA 5DY9A 3PT9A 4JLIA 1YFTA 5LJ3d 1I81A 2LX9A 3L2RA 2ARTA 1SERA 4ATOA 1XNIA 4TTVA 2MF2A 4LVIA 4G85A 2I4OA 2ZPGB 1FXXA 3OW2A 3PFSA 1DJ7B 1E22A 3VYGA 4RQFA 1MGQA 5LJ5d 4TQFA 1LNXA 4TVRA 3E9GA 4AH6A 2DZ9A 1W2BS 4YRTA 2MMPA 4J6XA 3CCQT 3PNWC 1KQ1A 4Q6GA 2DIGA 4LVMA 4YCVA 3PZCA 2D6FA 3VJPA 4O6JA 3TREA 3GNGA 3S3MA 3M4QA 5AYFA 4M77G 4LDXA 4JRQA 4E7IA 4M77F 1YI2A 1Z7NA 2DZCA 4E51A 5A0LA 1KC8U 2C06A 1UEBA 1YGBA 4QQDA 3DB3A 3A8HB 1BYMA 3OMCA 4M7AC 5KCHA 4M75A 1VQ5T 1E1TA 4PNOA 1ADJA 2M16A 1KG1A 4M78A 3VV0A 4V2SA 1QW1A 4OF1A 3M4PA 3I7FA 2RA2A 4F7UE 3DB4A 1AHJB 4YYEA 4H2YA 5GAMd 1KC8C 3JRZA 4CS4A 4TWAA 1EQRA 1J5WA 1X55A 11ASA 2RB6A 4H2VA 3KFUA 3F70A 4RQEA 4PL6A 1YHQA 1M8VA 3MP6A 3JCMP 4O5VA 3G4SA 2P5IA 1RL2A 3BDUA 3RKWA 4M7AB 1JJ2A 2GCXA 2ZCFB 2QI2A 2Y4YA 2M0OA 1LJOA 3NFCA 3CCMA 2AKWB 4XEOA 4XTXA 2H3JA 4C8QF 3P8BB 3OSVA 1EVLA 4HWRA 2DEQA 4PLIA 3MEVA 2EQJA 3M54A 4OB0B 2EAYA 1B34A 1YI2T 2ZPHB 4IUQA 3VKIA 4C5EA 3HXXA 2VXFA 5GAN4 1W2BA 2DKGA 4JJNK 4HT9A 2G3RA 2J3MA 1K9MU 1G3SA 3C95A 4J15A 5GMKl 4YROA 1B7YB 3CC2A 4BW9A 5GAN5 3V8KA 2F69A 3M53A 1QVPA 3J7AF 2MAMA 4F7UG 4E7LA 1JJCB 4BWAA 3PIPA 1IREB 3FB9A 2ZT8A 3NTKA 4YRQA 1K9MC 1YHQT 4RG2A 2GFUA 3JCMJ 4EMGA 4C92F 2DXTA 2QDYB 4J83A 3PMIA 3G4ST 2ZZEA 3NETA 2A3LA 4X5OA 4LVLA 3TUPA 5IN1A 1KQ2A 3VBBA 5GANd 3MP8A 1N6AA 1X54A 3IKLA 3MQZA 4XU1A 3CCMT 2P0PA 4XTYA 3M4YA 4C0ZA 2CKKA 3A5YA 3HKSA 4L5GA 2XTIA 1O9SA 5GMKh 1VQMA 1WYDA 3MF2A 1BBWA 2K3YA 3QZ9B 4P73A 3VQVA 1BKBA 4JRPA 1VQ4A 1N27A 2PUKB 3OYFA 1KQSA 1VQ6A 3A5ZB 1H4TA 2Q7HA 1VQLT 1K8AU 3KXTA 3CC2T 3EFRA 3LSQA 2C8MA 4CS3A 3QO5A 1YFRA 3A74A 2ZNIA 3CXCS 2E65A 4BDZA 5D6XA 3QZ5B 4ZN3A 2DQ0A 1K8AC 5LJ3g 3MHXA 4XTZA 2XHCA 4XU2A 4EPCA 3X25B 2LDMA 4LVJA 4CS2A 4EMKA 3FC3A 1ZHIA 5LJ5g 1TH7A 4M7AD 2DTIA 2DPPB 1G3TA 2RJCA 3M4GA 2EFIA 2CZ1B 3OD1A 5FROA 5M9OA 4OGCA 4P74A 1MHNA 1E1OA 2P4TA 1M1GA 2PUOB 3JCMe 1VQMT 4ZIBA 2MWPA 4HVCA 2ARSA 4OB3B 4L87A 3P8VA 4YTLA 3LWHA 4WI1A 5FRNA 4M7DC 3CPFA 2RM4A 2RJFA 1G51A 4YRRA 1VQ4T 4M78F 4E47A 3QJ6A 1G5HA 1VQ6T 1USYA 5HY6A 4P3OA 1QVGS 2B8AA 4HCZA 1YITA 2G4CA 1RI0A 4KT0E 3OYHA 5J26A 4R56A 2FVUA 2BKDN 3QIIA 3ZFJA 1XQHA 1G3WA 4FM4B 3QXEB 4A4KA 4C8QB 3J81E 2P0QA 2Q5HA 3GP8A 3S3NA 5GAMg 4BUGA 4WF2A 2NS6A 3H8ZA 4NOYA 5DM7R 2QEXT 3GOXA 2E70A 4M7DB 3HPWA 1ATIA 2LCCA 3LSSA 5FRMA 5GAOm 2ZIOA 4C0DC 1SSFA 4MZPA 3LH0A 2CZ6B 4KR3A 2K3XA 4RMOA 1G3YA 1QF6A 3QTCA 2X4WA 5KE3A 3VQXA 1HC7A 4LNSA 4E7HA 2LNVA 2DD5A 3G1ZA 2DXCA 4QQGA 1PSFA 4MZMA 5HK0A 2QHVA 3ERRA 3WXMB 4C92B 2CJBA 5CO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q C;  3PCO A;  3PGG A;  4F7U A;  4XU0 A;  3M4Q A;  2Q5I A;  1WQW A;  2ZR3 A;  4M77 G;  3W3S A;  4K87 A;  4TVY A;  4XTV A;  1N9R A;  1Z7M A;  4H2S A;  2EJG A;  4XEM A;  2YLC A;  4M77 F;  1Z7N A;  5E3I A;  2DZC A;  2DJZ A;  4E51 A;  1B7Y A;  2DQ3 A;  4OLF A;  1YGB A;  2ZZF A;  4JUV A;  4OP0 A;  4M7A C;  4M75 A;  1E1T A;  4PNO A;  3BFM A;  5GAN e;  4Y91 A;  1U1T A;  4YRE A;  1ADJ A;  4C92 G;  4M78 A;  4V2S A;  4CH5 A;  1JJC A;  3QO8 A;  3A31 A;  3RAC A;  3JCM d;  3M4P A;  3I7F A;  1NJ2 A;  2RA2 A;  4F7U E;  2AMC A;  4HWT A;  1NJ6 A;  4H2T A;  1Y96 B;  4YYE A;  4EMK C;  4H2Y A;  4YRN A;  5GAM d;  1NNH A;  4CS4 A;  3BJU A;  3QUI A;  4TWA A;  3JB9 J;  1EQR A;  2RHS B;  5GAO p;  3TEH B;  4A54 A;  1J5W A;  4ZTU B;  1X55 A;  11AS A;  2RB6 A;  2ZR2 A;  1H4Q A;  2EJ9 A;  5GAN 6;  4M75 E;  4YRL A;  3HXZ A;  5CAI A;  4J6Y A;  3V8J A;  4H2V A;  3KFU A;  4P72 A;  2ZIN A;  4RQE A;  4WJ3 M;  5GAN 2;  1X56 A;  5GAN 3;  1M8V A;  5GAN h;  4P3P A;  4M78 E;  2ZTG A;  3JCM P;  1FYF A;  3WQZ A;  4C92 C;  5GAN g;  3UH0 A;  3V8L A;  1VQZ A;  4X9D A;  2P5I A;  2CGH A;  4M75 C;  3BDU A;  1ASZ A;  5GMK j;  3RKW A;  1B76 A;  3VU3 C;  4JRI A;  4M7A B;  1YFS A;  3RIR A;  5HGQ A;  1H4S A;  2ZXF A;  4YRF A;  2ALY B;  3HTZ A;  1LJO A;  1USY C;  2I4M A;  4UP8 A;  1JRI A;  4PJO E;  2YHT A;  4YRG A;  3QO7 A;  2AKW B;  4XEO A;  4XTX A;  1I8F A;  4C8Q F;  1EVL A;  4RCB A;  4HWR A;  2E1H A;  1NJ1 A;  1X2H A;  3HY0 A;  1X2G A;  4EMK B;  2DEQ A;  2JN0 A;  1WU7 A;  2ODR C;  3HRK A;  3P8T A;  1SES A;  4YCW A;  1N9W A;  2EAY A;  3RKX A;  4RCC A;  2RHQ A;  1B34 A;  4M7A G;  1ASY A;  3SB2 A;  4PJO C;  1GGM A;  3HXX A;  2VXF A;  5GAN 4;  3V7R A;  2PMF A;  4DQ2 A;  3NEM A;  3MF1 A;  3PCO B;  4F7U B;  3FIF A;  2DKG A;  2E3C A;  2I4N A;  4M7D A;  4NCX A;  2DTO A;  2Q7E A;  4HT9 A;  4JRK A;  2J3M A;  3QO3 A;  4J15 A;  5LJ3 j;  5GMK l;  4C8Q D;  3NEN A;  2E5A A;  4YCU A;  4TQD A;  5K1P A;  4YRO A;  4CH3 A;  3SWN A;  1B7Y B;  4H2X A;  3QHS A;  1W66 A;  4BW9 A;  5K1X A;  5GAN 5;  4M75 B;  3V8K A;  1H64 1;  4QVD A;  5GMK m;  4M77 A;  4KQE A;  5LJ5 j;  4M78 B;  4F7U G;  5GAN 7;  1JJC B;  4BWA A;  2HNI A;  3RES A;  1EOV A;  1YCY A;  4J5Y A;  2J3L A;  3FB9 A;  4M7D D;  5GAN 8;  2ZT8 A;  4YRQ A;  2AMC B;  3E9H A;  1KMM A;  2DXU A;  3JCM V;  3HSB A;  3REX A;  3A7R A;  5GAO r;  4QVC A;  1E24 A;  5GMK e;  3HFZ A;  1HTT A;  1B8A A;  5C52 B;  4HWS A;  1QE0 A;  3JCM J;  4EMG A;  3QSU A;  3HXU A;  4M75 G;  2DXT A;  4C92 F;  4MML A;  1PYS A;  2ZZE A;  3NET A;  4X5O A;  2DVE A;  4M75 F;  3TUP A;  4M77 D;  1KQ2 A;  4M78 G;  5LJ3 f;  4PJO B;  3RUX A;  3JCM X;  3VBB A;  5GAN d;  4P75 A;  2QHS A;  1NYQ A;  4Q15 A;  3IAL A;  1WPY A;  1EIY A;  3UFG A;  3JCM b;  3HFO A;  4YP0 A;  3R07 A;  3FJP A;  1X54 A;  3IKL A;  3A7U A;  4XU1 A;  4XTY A;  1EFW A;  2EWN A;  4TVA A;  2E10 A;  1RIQ A;  1BBU A;  4YRP A;  4C92 D;  3A5Y A;  2XTI A;  1N9S A;  4HT8 A;  5GMK h;  3UGT A;  3TEG A;  1WYD A;  4PJO G;  3MF2 A;  1BBW A;  5KNN A;  2EL9 A;  1BIA A;  4P73 A;  3VQV A;  3RGL A;  4PJO F;  5LJ3 e;  2CIM A;  3A32 A;  3IKM B;  4P71 A;  4XQ3 A;  4NL3 A;  4M78 C;  2RHS A;  1LOJ A;  1L0W A;  4KR2 A;  1U1S A;  5GAM j;  3JB9 I;  3RL6 A;  1H4T A;  2Q7H A;  2E41 A;  1ADY A;  2QHT A;  1B34 B;  1B70 A;  4PG3 A;  4C8Q A;  5LJ5 e;  3A7A A;  3L4G A;  3V7S A;  1YB3 A;  1NYR A;  3EFR A;  3LSQ A;  2C8M A;  1D3B A;  1IL2 A;  2ZT7 A;  4XTW A;  1NJ5 A;  4P3N A;  4YRC A;  4CS3 A;  3QO5 A;  2FB7 A;  1KOG A;  1YFR A;  4H2U A;  4P72 C;  2FYK A;  3A74 A;  1BIB A;  2ZNI A;  4M7A F;  2E65 A;  2IY5 A;  4HWP A;  4K88 A;  3L2Z A;  3SWN B;  2ZIM A;  5LJ3 h;  4H2X B;  3HXW A;  4RDX A;  2DQ0 A;  2VC8 A;  5LJ3 g;  4YRM A;  3CMQ A;  4XTZ A;  2ZCE A;  1WLE A;  2DU5 A;  4XU2 A;  1NJ8 A;  4CH6 A;  2I2L A;  4HA8 A;  3EFS A;  4C8Q E;  4PHC A;  4P73 C;  4XU3 A;  3GIB A;  4P71 C;  4CS2 A;  4CH4 A;  5GAM f;  5LJ5 h;  12AS A;  4EMK A;  2XGT A;  3RER A;  1G5I A;  5GAO n;  3ICA A;  1H4V B;  4N0A A;  3REU A;  3BY7 A;  2YLB A;  5LJ5 g;  1TH7 A;  4M7A D;  3MEY A;  2DTI A;  3HFZ B;  3UGQ A;  3M4G A;  3OD1 A;  4H2W A;  4DPG A;  4H02 A;  4F7U F;  3HY1 A;  1PYS B;  4NL2 A;  4P74 A;  4M7D E;  5GAO q;  2ZT5 A;  1E1O A;  4YRK A;  3JCM e;  4ZTZ B;  4C92 A;  3JB9 G;  1EIY B;  1HXD A;  3DSQ A;  1M5Q 1;  4ZIB A;  2ZGW A;  3HXY A;  4UPA A;  4HVC A;  5I21 A;  4YPF A;  3JB9 F;  2ARS A;  4L87 A;  5GAM e;  3P8V A;  4WI1 A;  2ZNJ A;  4M7D C;  3L1A A;  2EJF A;  4K86 A;  3NEL A;  2RM4 A;  4M77 E;  1G51 A;  4TVA B;  4YRR A;  2P0L A;  1C0A A;  3QNE A;  4M78 F;  1SET A;  1G5H A;  2ZT6 A;  1X01 A;  1KMN A;  1USY A;  3JCM Q;  3SWN C;  4UP7 A;  5C51 B;  4P3O A;  1I4K 1;  2Y90 A;  2RD1 A;  3RKY A;  1SRY A;  5LJ5 f;  3VQW A;  4XTU A;  2C7I A;  2G4C A;  4EO4 A;  3HFV A;  2DTH A;  3JCM W;  4M77 C;  4N0A C;  2CJA A;  2PME A;  4C92 E;  3JCM h;  2K57 A;  4M75 D;  3JB9 D;  3HRI A;  2ZZG A;  3IG2 A;  2QHU A;  1Y96 A;  4TVW A;  1I5L A;  3JCM g;  4YRI A;  4J6W A;  4YRJ A;  4P74 C;  4PJO A;  3HFN A;  4M78 D;  4EMH A;  5GAM h;  1B70 B;  4UP9 A;  2QTX A;  4C8Q B;  2Q7G A;  3L4G B;  2Q5H A;  3TEH A;  4G84 A;  4YRS A;  5GAM g;  1D3B B;  4RMF A;  1WNL A;  2DU7 A;  1EVK A;  5GAN j;  4WF2 A;  2RHQ B;  3E9I A;  5GAO l;  4NOY A;  2DDZ A;  2ODR D;  3LC0 A;  5DY9 A;  3VQY A;  4JLI A;  2IY5 B;  1YFT A;  2CJ9 A;  1HK9 A;  4P75 C;  5LJ3 d;  5F5W A;  1I81 A;  2ART A;  1SER A;  4TTV A;  4M7D B;  1ATI A;  4G85 A;  2I4L A;  3INZ A;  4PJO D;  4MMK A;  2I4O A;  3LSS A;  5GAO m;  3BW1 A;  2ZIO A;  4C8Q G;  1WQ7 A;  4M7A A;  1E22 A;  5ELO A;  3JCM c;  4KR3 A;  1JBM A;  4RQF A;  1QF6 A;  1MGQ A;  4X9C A;  5LJ5 d;  2ALY A;  3QTC A;  4TQF A;  4YDQ A;  1LNX A;  1LYL A;  3A5Z A;  4HWO A;  3JCM f;  2ARU A;  3HXV A;  3VQX A;  4M77 B;  5GMK i;  1HC7 A;  3P8Y A;  4LNS A;  4AH6 A;  2DZ9 A;  2AKW A;  4YRT A;  5ELN A;  2E64 A;  2VXE A;  4M7D G;  4J6X A;  3RF1 A;  3G1Z A;  1KQ1 A;  4Q6G A;  5GAN f;  4M7D F;  4YCV A;  3AHU A;  4O2D A;  4WJ4 A;  3PZC A;  3JB9 H;  4A53 A;  4EX5 A;  5C53 B;  3V7C A;  2QHV A;  4M7A E;  3ERR A;  4C92 B;  2CJB A; 
#chains in the Genus database with same CATH topology
 4F7U A;  3HRU A;  3O8V A;  4UC4 A;  2ZR3 A;  4FT2 A;  4BI3 A;  4XTV A;  1WJR A;  2BIV A;  3CCU A;  1N9R A;  4C5G A;  1UGS B;  1YIT T;  2EJG A;  2YLC A;  2XID A;  2LJ1 A;  5HCK A;  4OLF A;  2ZZF A;  1UHC A;  4OP0 A;  2F5K A;  4Y91 A;  3CC4 A;  4PJM A;  4E6R A;  1C6V X;  1MMD A;  4A63 B;  4ORZ A;  5L8R E;  2DL8 A;  4HWT A;  5CQX A;  6AT1 B;  1W1F A;  3OMG A;  2DO3 A;  3AT1 B;  2CP6 A;  2OTJ A;  4J9E A;  2ZPB B;  1GXI E;  1QVG A;  4BD3 A;  3JB9 J;  2RHS B;  4ZTU B;  1X2K A;  3TEH B;  2QTV A;  3CCV T;  8AT1 B;  2O4X B;  4GBQ A;  2ZR2 A;  4YRL A;  4J8O A;  3V8J A;  4P72 A;  4Z02 A;  4FSX A;  4CC3 A;  1X56 A;  5GAN 3;  3S6W A;  2QG9 B;  2RH2 A;  2PTK A;  4VUB A;  2ZTG A;  1HD3 A;  3QPH A;  3CCQ Q;  4CC2 A;  4J7I A;  2W10 A;  5GAN g;  4X9D A;  1E7O A;  1GCQ C;  1JJ2 S;  4KUD K;  4M75 C;  5GMK j;  4E7J A;  1B76 A;  1NE8 A;  2DYB A;  1VQ7 A;  3CBM A;  2B86 A;  1D1B A;  2GFA A;  1H4S A;  2ZXF A;  3HRS A;  5A2Q E;  4N4H A;  1AZE A;  3M59 A;  3R6N A;  1UGQ B;  2F1L A;  1D0Z A;  2K6D A;  1I8F A;  1FYN A;  5KE2 A;  2HSE B;  3CC7 A;  3M0R A;  2FZK B;  3URG A;  1X2H A;  3HY0 A;  1AD5 A;  2ODR C;  3HRK A;  3EAE A;  3CCU T;  2LTO A;  1ZA1 B;  1VQ5 Q;  2HEQ A;  4YCW A;  1TU0 B;  3RKX A;  4RCC A;  2RHQ A;  5L23 A;  3SB2 A;  9ATC B;  4PJO C;  2FL7 A;  2KXD A;  1UGP B;  2HDA A;  3NEM A;  2YRV A;  4DQ2 A;  1WFW A;  3FIF A;  2YDL A;  3HRT A;  5CVI A;  1F1B B;  1MMG A;  4NCX A;  3Q1J A;  2RQT A;  3CC4 T;  3CCR A;  2WSE E;  2P0K A;  4C8Q D;  3OY9 A;  4MDX A;  4IIM A;  1OYX A;  4TQD A;  4Z8A A;  4CH3 A;  3SWN A;  1R0C B;  1W66 A;  5KYU B;  1UJ0 A;  4M75 B;  1G8X A;  3NTH A;  4R55 A;  4IUR A;  4BB7 A;  3EHQ A;  4OMO A;  4OML A;  1H64 1;  4QVD A;  1ABO A;  4JZ3 A;  1PC0 A;  3QDR B;  4KGV B;  4KQE A;  2OTJ T;  4M78 B;  5GAN 7;  1NPR A;  2GGR A;  2VKN A;  1ZA2 B;  4FYV B;  3CCJ T;  1EOV A;  2X9H A;  2QA4 A;  4J5Y A;  2KVQ G;  1JXO A;  4M7D D;  1M27 C;  4HKE A;  4C0F A;  3E9H A;  1KMM A;  2DXU A;  3LW5 E;  3REX A;  4IUT A;  3UAT A;  2K5I A;  4QVC A;  3JV3 A;  1RAG B;  5GMK e;  3HFZ A;  5IAY A;  4J9B A;  5C52 B;  4HWS A;  3HXU A;  2AKK A;  4IIO A;  4C5I A;  4MML A;  1GFC A;  1PSE A;  3GLX A;  4ELY C;  4OVA A;  2DET A;  1T0J A;  1VIE A;  1ABQ A;  4PJO B;  3JCM X;  3CCR Q;  5CIU A;  2BTT A;  2ENM A;  2QHS A;  2HSP A;  3IAL A;  1WPY A;  3I55 A;  1VQ7 T;  2Z0W A;  1PWT A;  3UFG A;  1TXQ A;  1WYX A;  2J6F A;  3JCM b;  3L2U A;  3DKM A;  3R07 A;  4ME7 A;  3A7U A;  2CP7 A;  5CKF A;  1LVK A;  5GJW B;  1EFW A;  3TVT A;  2EWN A;  2E10 A;  1YI2 Q;  3QKJ A;  4C92 D;  1TOV A;  3CC7 T;  2CP5 A;  1R0B G;  2LCS A;  1PKS A;  4AT1 B;  4RTW A;  3TEG A;  2JZ2 A;  3H0H A;  3M0Q A;  3I35 A;  2OTL A;  5CQY A;  1KQS S;  1BIA A;  4J9H A;  3A32 A;  1D0X A;  4XQ3 A;  1S72 A;  4QVZ A;  1SKU B;  3M0T A;  2YUO A;  2K3B A;  1L0W A;  2D8J A;  2K79 A;  3RL6 A;  1NZ9 A;  2E41 A;  3CCR T;  2QHT A;  2ABL A;  1B34 B;  1B70 A;  2EGC A;  3L4G A;  3A7A A;  2L8D A;  1OEB A;  3M58 A;  3I55 Q;  2CSQ A;  2R58 A;  5D6Y A;  1NJ5 A;  1N5Z A;  2V8K A;  1WHM A;  2EYQ A;  2V8I A;  4OB1 B;  2DL4 A;  2E4H A;  3OYI A;  2E5K A;  2FPD A;  1YHQ Q;  1EZZ B;  2AT1 B;  2FYK A;  2KR3 A;  5KYN A;  1OV3 A;  2QA4 T;  2JVV A;  2IY5 A;  5LJ3 h;  4FW1 A;  1W6X A;  1J3T A;  2KYM A;  3VUZ A;  1YJN A;  1PM3 A;  4DBQ A;  3RMS A;  1VQL A;  2ZCE A;  2DXB A;  1WLE A;  2DU5 A;  4CH6 A;  1R77 A;  2COY A;  4PHC A;  4X34 A;  4P73 C;  1S72 Q;  1Y7X A;  2HZY A;  3CBP A;  4A4G A;  5LJ5 h;  1QP2 A;  3LLR A;  4A4E A;  2RI2 A;  1IO6 A;  2EKO A;  3CCM Q;  3REU A;  1SHF A;  2YLB A;  2OI3 A;  3EG9 A;  2NUT B;  1BI2 A;  1RAB B;  2RPN A;  3I55 T;  3UGQ A;  2E6Z A;  3P8H A;  1UEC A;  3CPW P;  4F7U F;  1NJI U;  1WI7 A;  2A0F B;  2O01 E;  5GAO q;  4CRI A;  2M9U A;  1RLQ C;  3QWY A;  4YRK A;  2DL7 A;  2XI9 A;  4LDW A;  2K5F A;  2CYZ B;  3DSQ A;  3MEW A;  3HXY A;  1Q86 U;  4UPA A;  2I0N A;  3G6E A;  3LYI A;  2LCL A;  2RO0 A;  2OTL T;  2CDT A;  3T9N A;  2EJF A;  3NEL A;  8ATC B;  2C0I A;  4N4I A;  1VQL Q;  1S72 T;  1C0A A;  1NJI C;  3C4S A;  1SET A;  3CC2 Q;  2X4J A;  1X01 A;  5C51 B;  1KHC A;  2HD0 A;  1I4K 1;  2VV5 A;  4ZTF A;  1U8R A;  2BE9 B;  2QQR A;  4LD6 A;  3KUF A;  2CRE A;  1YN8 A;  2DTH A;  4M77 C;  1Q86 C;  3OB9 A;  2DD4 A;  4ANJ A;  4RTX A;  4M75 D;  1W2B P;  1IGU A;  2ZZG A;  2QHU A;  1Y96 A;  4TVW A;  4KUI A;  4YRI A;  2H8H A;  4YRJ A;  2JXB A;  2BZY A;  4P74 C;  4M78 D;  4EMH A;  5GAM h;  2E3H A;  2QYZ A;  1BK2 A;  1C1A A;  2JMA A;  5C6S A;  4MDW A;  2E12 A;  1X75 C;  4YRS A;  2A08 A;  1OPL A;  2VGN A;  2X3W D;  2A8E A;  2RHY A;  3VS2 A;  1EVK A;  5CCA A;  1YJN T;  2HQX A;  4ZTJ A;  4B9W A;  3QDF A;  3E9I A;  4PLL A;  2EQK A;  1BB9 A;  5GAO l;  2QK0 A;  1JEG A;  2DRK A;  2LQ8 A;  3QG1 A;  2ODR D;  3LC0 A;  2VWF A;  3HP9 A;  4P75 C;  1HK9 A;  1NBE B;  2PZ1 A;  1MMN A;  1I07 A;  2K5L A;  2NUZ A;  2O9V A;  3INZ A;  3IQL A;  4PJO D;  3C12 A;  3BW1 A;  4DOV A;  4GY5 A;  1RAH B;  1WQ7 A;  2LVM A;  2CT4 A;  3OYM A;  1Q81 U;  2RQW A;  2O9S A;  1VQ8 A;  3EFO B;  1VQM Q;  5CR2 A;  4C5H A;  3EGX B;  3G71 A;  2DIL A;  4X9C A;  3RMQ A;  4DEY A;  2ALY A;  1LYL A;  3A5Z A;  2QAZ A;  2KY9 A;  3JCM f;  3HXV A;  2X3X D;  4L6V 5;  4M77 B;  1KD1 R;  2X4Y A;  1M9S A;  4F04 B;  1VQ4 Q;  2QEX A;  3OYG A;  2YUN A;  3G6E T;  5FW9 A;  4CI0 C;  1VQ6 Q;  3OYA A;  2NWM A;  2A7Y A;  1M2O A;  3AHU A;  4O2D A;  5KCO A;  2NLU A;  1Q81 C;  3V7C A;  2PU9 B;  4M7A E;  4ZNX A;  4LE9 A;  4C8Q C;  3PCO A;  3OSS C;  2Q5I A;  1WQW A;  3M0U A;  2ZPE B;  2ZPI B;  3W3S A;  1OZ3 A;  1VIF A;  5A0G A;  1Z7M A;  4H2S A;  1Z9Z A;  1YIJ A;  3FRN A;  2D1X A;  4B6M A;  1WJQ A;  2JJ9 A;  2DJZ A;  2XMF A;  5DLQ E;  1T0H A;  3ULR B;  3PVQ A;  4JUV A;  1VQ8 Q;  1K0X A;  3G71 Q;  4JDS A;  4EDU A;  2V1R A;  1U1T A;  2EVR A;  4YRE A;  3VS6 A;  2A28 A;  3GF5 A;  2JTE A;  4CH5 A;  3J80 E;  4KH0 B;  3A31 A;  5EG2 A;  2QEX Q;  3JCM d;  2EYW A;  4BI4 A;  1NJ2 A;  4Y92 A;  2AMC A;  1NJ6 A;  3FLG A;  4H2T A;  1UTI A;  1JU5 C;  3CCL A;  1ZSZ A;  3S3O A;  1VQK A;  4YRN A;  1OQK A;  5I2S A;  3BJU A;  2OAU A;  4E2F B;  3E9F A;  3WVE B;  3FDR A;  4LXC A;  1NYG A;  1H4Q A;  4JS4 A;  2EJ9 A;  5GAN 6;  2ECZ A;  1JB0 E;  2YXY A;  2ZIN A;  4WJ3 M;  1ZUY A;  5GAN h;  2XDP A;  1K73 U;  1PCX A;  1VQ8 T;  3G71 T;  1H3Z A;  1FYF A;  4C92 C;  1OPK A;  4Y28 E;  1EIF A;  1VQZ A;  2R5A A;  3VS0 A;  3VU3 C;  1OOT A;  3UDC A;  2LX7 A;  1X6O A;  3M55 A;  5DLO A;  5HGQ A;  3CCV A;  2MWO A;  4E7K A;  1FMW A;  3HTZ A;  4IUP A;  4JJD A;  1WDX A;  2MK5 A;  3UPU A;  2I4M A;  2CZ7 B;  4UP8 A;  2M0Y A;  1JRI A;  1M1K R;  2DRM A;  1YIT Q;  1K73 C;  4YRG A;  1VQK Q;  3QO7 A;  2MYS A;  2J6O A;  5A0D A;  2CP0 A;  1NJ1 A;  4RG8 A;  2JN0 A;  4II1 A;  3P8T A;  2VUB A;  5KYY B;  1YIJ T;  4OMF B;  3O5Z A;  4PFZ A;  5IHI A;  4M7A G;  1ASY A;  2PVG B;  5HKC A;  4IKF A;  2HCK A;  1N8R U;  3VS7 A;  3EGD B;  3L2Q A;  3OYK A;  3I56 A;  1ZBX A;  4F7U B;  2I4N A;  1OZ2 A;  4M7D A;  2DTO A;  2X35 A;  1QCF A;  4JRK A;  2KQW A;  2HL3 A;  3QO3 A;  4J9I A;  2X4X A;  5LJ3 j;  1Q7Y R;  5FU6 B;  1AWO A;  2E5A A;  4YCU A;  2PNI A;  4PJJ A;  2M02 A;  2L5Q A;  4H2X A;  3C94 A;  2GQV A;  1TWB A;  3CCV Q;  4LDY A;  2RHZ A;  3CCL T;  1WHL A;  2ROT A;  2RHU A;  5CKD A;  1VQK T;  1QLY A;  2KMT A;  1N8R C;  4ZGE B;  2KK4 A;  5LJ5 j;  1T3L A;  4BY6 C;  4BI8 B;  2HNI A;  1Q81 R;  3RES A;  1X43 A;  3DLL A;  4ZN1 A;  2J3L A;  3OQ5 A;  3JCM V;  1H92 A;  3A7R A;  5GAO r;  2CZ0 B;  1M1F A;  3QJY A;  3MPU B;  1M2V B;  3BDL A;  2NUP A;  4FIB A;  3QSU A;  5LL6 S;  2CH4 A;  2F5T X;  2YT6 A;  1PYS A;  2DVE A;  2Y4X A;  1QCN A;  4M77 D;  1VOM A;  2LMJ A;  3M56 A;  4JS5 A;  1O75 A;  5LJ3 f;  2A37 A;  1UGV A;  5J39 A;  3OYE A;  1NYQ A;  2CS7 A;  4Q15 A;  5CKE A;  3G7Z A;  1EIY A;  3CCJ A;  2AK5 A;  1D09 B;  1C0M A;  3FJP A;  3CXC P;  1RAD B;  3CCU Q;  4TVA A;  2E5Q A;  1BBU A;  4YRP A;  4HCC A;  4HT8 A;  3UGT A;  1SF9 A;  4AG2 C;  2L3Q A;  1ZLM A;  5GJV B;  3OS5 A;  4EIK A;  3EH1 A;  3H0F A;  5KNN A;  2EL9 A;  2FRY A;  4LN2 A;  4BY6 B;  3CC4 Q;  3RGL A;  1UG1 A;  1QMC A;  5LJ3 e;  2CIM A;  3CPW S;  4P71 A;  2DBK A;  4LUD A;  3I56 T;  4M78 C;  2RHS A;  3CQT A;  1LOJ A;  3FEO A;  2KBT A;  1R8O B;  1Y0M A;  1U1S A;  2SEM A;  4Z88 A;  5GAM j;  4E7Z A;  3JB9 I;  5C0M A;  1HYO A;  1I1J A;  1ADY A;  1WHG A;  4PG3 A;  4X1V A;  2CH4 W;  4FT4 A;  2OTJ Q;  5LJ5 e;  1SG5 A;  1YB3 A;  1A0N B;  2QQB A;  3CCJ Q;  2E6N A;  1D3B A;  4QT7 A;  1IL2 A;  4XTW A;  2JTM A;  1UE9 A;  1SSH A;  4H2U A;  1FX7 A;  3OYB A;  1M8M A;  3MO8 A;  3CD6 A;  1K73 R;  3LGF A;  1VQO A;  3L2Z A;  3SWN B;  2ZIM A;  2DFU A;  3CCS A;  1IHV A;  3HXW A;  3KFV A;  3OBW A;  4RTV A;  1PD0 A;  4RDX A;  1G5V A;  2LP5 A;  1SRM A;  3EH2 A;  3CMQ A;  1W4S A;  1NJ8 A;  4HA8 A;  2KGT A;  1QVG P;  4C8Q E;  1VQ7 Q;  3A8M B;  1Y71 A;  4CH4 A;  1QP3 A;  2DVJ A;  5GAM f;  1FWZ A;  1B3Q A;  4ZGJ B;  4A4H A;  3RER A;  2KT8 A;  1G5I A;  2RQU A;  2LT1 A;  1H4V B;  4N0A A;  2GBQ A;  3BY7 A;  1YNZ A;  3HFZ B;  4P5N A;  2EKH A;  2JMC A;  2XG8 D;  3CC7 Q;  4BAC A;  4H02 A;  4DPG A;  2RNA A;  3HY1 A;  5IXF A;  1ARK A;  4NL2 A;  4M7D E;  1TUD A;  1X2Q A;  2K2V A;  4IUV A;  1QVF P;  4HT4 A;  3KBG A;  1N8R R;  3JB9 G;  1HXD A;  3SFM A;  4LD9 K;  1M5Q 1;  1VQO Q;  2IPO B;  1CKB A;  1GCQ A;  3JB9 F;  1G2B A;  2KSS A;  5GAM e;  3M57 A;  3OW2 P;  1XTD A;  1VQP A;  2QXF A;  3L1A A;  1YWO A;  4K86 A;  1IHW A;  2EPD A;  3QNE A;  1K76 A;  2K7A A;  2RHX A;  3TSW A;  1WIE A;  1PKT A;  3UA7 A;  1KMN A;  3M9Q A;  3JCM Q;  2DBM A;  1SRY A;  3L2V A;  4JJC A;  3VQW A;  4XTU A;  3U23 A;  4LDU A;  2C7I A;  4L59 A;  4EO4 A;  2PQW A;  4J9D A;  5I2M A;  3JCM W;  2JS0 A;  2PME A;  4C92 E;  2LRQ A;  2QA4 Q;  2K57 A;  3OYN A;  2DL3 A;  2KRO A;  2PVO B;  1Y57 A;  1QKW A;  3IG2 A;  1AT1 B;  1KD1 U;  3JCM g;  1I5L A;  1Z9Q A;  2CP2 A;  4NS5 A;  4PJO A;  3HFN A;  1M90 R;  1B70 B;  4J7F A;  3CD6 T;  3PVL A;  1VQO T;  3OBY A;  3L4G B;  2C0T A;  4WTO B;  3CCS T;  4G84 A;  3NTI A;  3EG0 A;  2DK3 A;  2EQI A;  4RMF A;  2EW3 A;  2DYI A;  3CPW A;  1WNL A;  1P92 A;  5CKB A;  2DU7 A;  5GAN j;  2MI6 A;  4OMP A;  1M3A A;  2BUD A;  4AMC A;  1Q82 U;  5EC7 A;  1VQP Q;  2YUQ A;  1VA7 A;  4AFQ C;  2ZAE A;  3VQY A;  4RUG A;  2IY5 B;  5F5W A;  2CJ9 A;  2RI3 A;  1BI1 A;  1KD1 C;  3ME9 A;  4AFS C;  2I4L A;  4MMK A;  1IRX A;  2IVW A;  1WHJ A;  2AZS A;  4C8Q G;  4GLM A;  4BE2 A;  1V1C A;  1WGS A;  2XIC A;  3EHR A;  4J9F A;  4AFU C;  4M7A A;  3ASK A;  3M5A A;  1RUW A;  1YJ9 A;  5ELO A;  3JCM c;  1JBM A;  1V29 B;  4YDQ A;  1Q82 C;  4HWO A;  4KBM B;  2ARU A;  2OTL Q;  5GMK i;  3P8Y A;  3MP1 A;  5D7U A;  2AKW A;  3QBY A;  5ELN A;  3EG9 B;  3GNF B;  3L2W A;  2E64 A;  2FHD A;  2VXE A;  3TU4 K;  1ZUU A;  4B9X A;  4M7D G;  2OX7 A;  3RF1 A;  1TUG B;  2D0N A;  2CUD A;  4D6W A;  1VQN A;  3P8D A;  5GAN f;  3HHT B;  4M7D F;  2RI5 A;  1AZG B;  1VQP T;  4WJ4 A;  3JB9 H;  2WAC A;  3UWN A;  4A53 A;  5FU7 C;  4EX5 A;  5C53 B;  1Y07 A;  1W70 A;  1AWJ A;  3LH5 A;  4JPB W;  3PGG A;  2JNG A;  2LQK A;  4XU0 A;  5J3B A;  4A4F A;  3OA6 A;  2AHJ B;  5HK3 A;  4K87 A;  1WXB A;  4TVY A;  4DOW A;  5ECA A;  5IT9 E;  2SRC A;  2LZ6 B;  4XEM A;  1QCO A;  3CEY A;  5E3I A;  2MPX C;  1B7Y A;  1JJ2 P;  2DQ3 A;  1OU8 A;  1AEY A;  3DLM A;  3A8O B;  2JW4 A;  2FZG B;  4DA4 A;  1NYF A;  2KXC A;  3BFM A;  2XKO C;  5GAN e;  1YJN Q;  1PNJ A;  3VYH B;  2JTF A;  2V8J A;  4C92 G;  3ER0 A;  2DJQ A;  2NUT A;  3RR6 A;  3UT1 A;  1JJC A;  3QO8 A;  3CMA A;  3RAC A;  2VB6 A;  2HQE A;  3R6O A;  5CK9 A;  4RTY A;  1WHK A;  1WJS A;  3OYY A;  2K4Y A;  1M1K U;  1Y96 B;  4EMK C;  4C0G A;  1NNH A;  3MJX A;  1OX9 A;  3QUI A;  5KYW A;  2DMO A;  5GAO p;  4A54 A;  1K4U S;  3A8G B;  1UB4 A;  4M75 E;  3HXZ A;  2BZX A;  5FU7 B;  4J6Y A;  5CAI A;  1LCK A;  5GAN 2;  2J7I A;  1QKX A;  1VQ9 A;  4WCI A;  4GLK A;  1YJ9 T;  4P3P A;  3E1S A;  4M78 E;  3OYC A;  1KC8 R;  3WQZ A;  3G6E Q;  3UH0 A;  1M1K C;  3V8L A;  2KDS A;  1ACM B;  2EQM A;  2JT4 A;  2EYZ A;  2GQI A;  4BE1 A;  2CGH A;  2KEA A;  1Q7Y U;  1ASZ A;  2RN8 A;  2HAX A;  3LX7 A;  7AT1 B;  4JRI A;  3WVD B;  1GRI A;  1NLO C;  4LNP A;  1YFS A;  4KUL A;  3RIR A;  1VQN T;  2NYS A;  3CCE A;  2R57 A;  4ZGD B;  4YRF A;  2ALY B;  1KHI A;  4DBF A;  1AOJ A;  1MV3 A;  2WSC E;  2WSF E;  4FL6 A;  4J9C A;  1USY C;  3N5B B;  3QYH B;  4PJO E;  2YHT A;  1JO8 A;  1WX6 A;  2KAF A;  1WZO A;  2RF0 A;  3HTR A;  2K9G A;  2IG0 A;  4RCB A;  2E1H A;  1MNE A;  2DF6 A;  1X2G A;  4EMK B;  1WU7 A;  2LQW A;  1Q7Y C;  1SES A;  3X24 B;  3PTA A;  4DEX A;  2O88 A;  4J9G A;  1N9W A;  2RQV A;  2O31 A;  1YWP A;  4MZT A;  4QW2 A;  1U06 A;  1GGM A;  4K11 A;  2PMF A;  3V7R A;  1M4Z A;  4HXJ A;  3MF1 A;  2RQR A;  4RTZ A;  1KSW A;  2E3C A;  3PCO B;  3LWI A;  2DIQ A;  3CME A;  2Q7E A;  1GBR A;  1S1N A;  2J05 A;  2M1H A;  4FCY A;  1Q82 R;  5KH6 A;  3NEN A;  2RK1 A;  4JZ4 A;  5K1P A;  3CMA T;  2LQN A;  2D0Q B;  2L3R A;  3EG2 A;  3QHS A;  4QKU A;  5K1X A;  3EFO A;  4QQ6 A;  3UF4 A;  3GPL A;  3ZBD A;  3JAM E;  3VUB A;  4KH1 B;  5GMK m;  1YJW A;  4M77 A;  1IXD A;  3TCJ A;  4RKU E;  1YBY A;  1KQS P;  1YCY A;  5I22 A;  5GAN 8;  2AMC B;  3ZEH A;  3HSB A;  1VQ9 T;  1QWE A;  2COW A;  1ZSZ B;  1E24 A;  3FJ5 A;  1HTT A;  1B8A A;  1QE0 A;  3M0P A;  1KJW A;  4M75 G;  2O2O A;  2EQU A;  3C0C A;  3GBQ A;  4M75 F;  3CME Q;  1KIK A;  4Q5W A;  2QGF B;  1RAF B;  4M78 G;  1RAE B;  3RUX A;  4P75 A;  4BE0 A;  2RJD A;  2G6F X;  1M3B A;  3X20 B;  3CCE T;  3EG3 A;  3HFO A;  4YP0 A;  3CBO A;  3NHN A;  2BE7 D;  3X28 B;  1YIJ Q;  3OS2 A;  2RHI A;  1GCP A;  4LUE A;  5CKH A;  1RIQ A;  1ZQ1 A;  5KYX A;  5FU6 C;  1N9S A;  3D7S B;  2KRN A;  1G83 A;  1OI1 A;  3QYG B;  2R5M A;  4PJO G;  4FYY B;  2XU8 A;  2HQH A;  4PJO F;  3IKM B;  4AFZ C;  4NL3 A;  4XAX B;  2EBP A;  2VAS A;  4LDV A;  4KR2 A;  4ELZ C;  3CME T;  1QVF S;  3MKD A;  2EGE A;  3CCL Q;  3A8L B;  3OYL A;  2XK0 A;  1T3S A;  1VUB A;  3PIO A;  4C8Q A;  1OU9 A;  2EIF A;  3V7S A;  1HJD A;  1NYR A;  2LT4 A;  3L42 A;  3OW2 S;  2ZT7 A;  2JS2 A;  4P3N A;  1MUZ A;  4YRC A;  2ZPF B;  1YJW T;  2FB7 A;  2JOY A;  1KOG A;  3MCA B;  4P72 C;  2XD0 A;  1BIB A;  1TSF A;  2J6K A;  4M7A F;  1PD1 A;  3HL8 A;  4HWP A;  2PVD B;  2OAW A;  3MET A;  1GFD A;  4K88 A;  5D6W A;  4H2X B;  1BCM A;  4HCB A;  2HKQ B;  4OB2 B;  2ED1 A;  4XK8 E;  2RMO A;  2VYT A;  1TTH B;  1B7T A;  2VC8 A;  3CXC A;  1I5O B;  2QDL A;  4PKC C;  2QQA A;  4YRM A;  1IZ6 A;  1VYV A;  2GF7 A;  4JLG A;  2I2L A;  2K2M A;  3MEA A;  3EFS A;  3SDZ A;  1YP5 A;  3PMT A;  4XU3 A;  2DAQ A;  3GIB A;  5IHK A;  4P71 C;  12AS A;  2XGT A;  2AIR B;  5GAO n;  3ICA A;  4PK4 A;  2XDD A;  3OS1 A;  2ZZD A;  3MEY A;  1K8A R;  2AKL A;  2NUP B;  1SPK A;  4H2W A;  2JM8 A;  1BI3 A;  1PYS B;  2YRD A;  2IIM A;  2CP3 A;  2KNB B;  2ZT5 A;  2JUF A;  1XOV A;  1M90 U;  1SEM A;  1UGR B;  4ZTZ B;  3JSC A;  3RNJ A;  4C92 A;  1EIY B;  2QQS A;  3CCQ A;  3I56 Q;  2ZGW A;  4HCK A;  5I21 A;  5IHN A;  3OS0 A;  4YPF A;  3E19 A;  3X26 B;  4C0D B;  3SD4 A;  1WLP B;  2COZ A;  2ZNJ A;  1QWF A;  2QQ9 A;  1GL5 A;  4M77 E;  4TVA B;  2P0L A;  2LC4 A;  1LPL A;  3H6Z A;  3MEU A;  4IUU A;  1M3C A;  2ZT6 A;  1YFN A;  4UP7 A;  3SWN C;  2JM9 A;  2Y90 A;  2D9T A;  2RD1 A;  1M90 C;  3RKY A;  2KE9 A;  3VRY A;  2HBP A;  2RJE A;  2FRW A;  2HKN A;  5LJ5 f;  1U5S A;  3TEE A;  1X27 A;  1BI0 A;  2ED0 A;  2VGM A;  3HFV A;  1M2V A;  2EYY A;  4N0A C;  1AWW A;  4OMQ A;  2CJA A;  2E3I A;  3JCM h;  2RK2 A;  3JB9 D;  3HRI A;  4ESR A;  2KRS A;  2H3E B;  2W0Z A;  5FLX E;  1VQ5 A;  1NPP A;  2VVK A;  4BDY A;  2L89 A;  4J6W A;  2DEU A;  3OYJ A;  4UP9 A;  2QTX A;  2Q7G A;  1Q95 G;  4PFO A;  3TEH A;  2X51 A;  2O4X A;  1D3B B;  2MOX A;  2XDB A;  1NG2 A;  4FU6 A;  4OGE A;  2RHQ B;  3LGL A;  4LVK A;  3H9N A;  4N4G A;  1WHH A;  2DDZ A;  1QVF A;  1RAA B;  3OYD A;  5DY9 A;  3PT9 A;  4JLI A;  1YFT A;  5LJ3 d;  1I81 A;  2LX9 A;  3L2R A;  2ART A;  2DX1 A;  1SER A;  4ATO A;  1XNI A;  4TTV A;  2A36 A;  2MF2 A;  4LVI A;  1IB8 A;  4G85 A;  2I4O A;  2ZPG B;  1FXX A;  3OW2 A;  2L0A A;  3PFS A;  1DJ7 B;  1E22 A;  1VYU A;  1H8K A;  3VYG A;  4RQF A;  4HVW A;  1MGQ A;  5LJ5 d;  4TQF A;  1BBZ A;  1LNX A;  4TVR A;  4PJN A;  3A98 A;  3E9G A;  4AH6 A;  2DZ9 A;  1W2B S;  4YRT A;  1ZX6 A;  2CT3 A;  2MMP A;  4J6X A;  3CCQ T;  3PNW C;  1KQ1 A;  4Q6G A;  2DIG A;  4LVM A;  4YCV A;  3PZC A;  1V76 A;  2D6F A;  3VJP A;  2V1Q A;  4O6J A;  3GNG A;  3TRE A;  3VS3 A;  1PRM C;  1KK7 A;  1WA7 A;  4D8K A;  3S3M A;  3M4Q A;  5AYF A;  4M77 G;  3RBB B;  2YRC A;  2HL5 C;  4LDX A;  1D1A A;  4JRQ A;  4E7I A;  2LNH B;  3BE3 A;  4M77 F;  1YI2 A;  1Z7N A;  1H3H A;  2DZC A;  3CD6 Q;  4E51 A;  5I11 A;  5A0L A;  1KC8 U;  2C06 A;  1UEB A;  1YGB A;  4QQD A;  5KYU A;  3DB3 A;  3A8H B;  3CCS Q;  1BYM A;  3OMC A;  4M7A C;  5KCH A;  4M75 A;  1VQ5 T;  1E1T A;  4PNO A;  1RLP C;  1ADJ A;  3ZL7 C;  2M16 A;  1KG1 A;  4M78 A;  3VV0 A;  4V2S A;  4JJB A;  1QW1 A;  3E2U A;  1UHF A;  4F16 A;  4OF1 A;  3M4P A;  3I7F A;  2RA2 A;  3PE0 A;  4F7U E;  3DB4 A;  1AHJ B;  2C0O A;  4YYE A;  4H2Y A;  1XJW B;  5GAM d;  1KC8 C;  1X69 A;  3JRZ A;  4CS4 A;  2F2W A;  4TWA A;  1EQR A;  2ESW A;  1J5W A;  1X55 A;  4F14 A;  11AS A;  2RB6 A;  4H2V A;  3KFU A;  2V26 A;  3F70 A;  1K0S A;  4RQE A;  3NPF A;  4PL6 A;  1UJY A;  1YHQ A;  1M8V A;  4Z89 A;  1FMV A;  3MP6 A;  2FPF A;  1RAC B;  3JCM P;  1E6H A;  4O5V A;  3G4S A;  2P5I A;  1RL2 A;  1PRL C;  1NLP C;  3BDU A;  3RKW A;  1X6G A;  4M7A B;  4KRT A;  1GBQ A;  1JJ2 A;  1K9A A;  2GCX A;  2ZCF B;  2QI2 A;  2Y4Y A;  2M0O A;  1JQQ A;  1LJO A;  3NFC A;  1RAI B;  3CCM A;  4D8D A;  4OMM A;  2AKW B;  4XEO A;  4XTX A;  2H3J A;  2AZV A;  4C8Q F;  3P8B B;  1MND A;  1NEB A;  3OSV A;  1D0Y A;  1EVL A;  4HWR A;  3H0I A;  2DEQ A;  4PLI A;  3MEV A;  2EQJ A;  2YSQ A;  3M54 A;  2FZC B;  5FWB A;  4OB0 B;  1BU1 A;  2EAY A;  1B34 A;  1YI2 T;  2ZPH B;  4IUQ A;  2DA9 A;  3VKI A;  5FWC A;  4C5E A;  3HXX A;  2VXF A;  4RTT A;  3VS5 A;  5GAN 4;  1W2B A;  2DKG A;  4JJN K;  2YWW A;  4HT9 A;  2G3R A;  3G4S Q;  2J3M A;  1K9M U;  1G3S A;  3C95 A;  4J15 A;  5GMK l;  4YRO A;  3EGU A;  3NGP A;  1B7Y B;  2L2P A;  3CC2 A;  4BW9 A;  5GAN 5;  4R0K A;  1OUL A;  2DNU A;  3V8K A;  1WXU A;  2F69 A;  3M53 A;  1QVP A;  3J7A F;  2MAM A;  1CSK A;  4F7U G;  4E7L A;  1YJ9 Q;  1JJC B;  4BWA A;  3PIP A;  4KGX B;  1IRE B;  3FB9 A;  2ZT8 A;  4CC4 B;  3NTK A;  4YRQ A;  1K9M C;  1AVZ C;  1YHQ T;  1B07 A;  2CUB A;  1ZUK A;  4RG2 A;  2GFU A;  1RI9 A;  3JCM J;  4EMG A;  2ATC B;  4C92 F;  2DXT A;  2QDY B;  5KYW B;  4J83 A;  1VYT A;  1VQN Q;  3PMI A;  3G4S T;  2ZZE A;  3NET A;  2A3L A;  4DBR A;  4X5O A;  1X6B A;  4OMN A;  4LVL A;  3TUP A;  5IN1 A;  1KQ2 A;  1WXT A;  3VBB A;  1ZBJ A;  5GAN d;  2LJ0 A;  3MP8 A;  2YUP A;  2DM1 A;  5IXB A;  2FG0 A;  4RTU A;  3REA B;  3TQ7 P;  1N6A A;  1X54 A;  3IKL A;  3MQZ A;  4XU1 A;  3CCM T;  2P0P A;  4XTY A;  2KRM A;  3M4Y A;  2M51 A;  3THK A;  4C0Z A;  2CKK A;  3A5Y A;  3HKS A;  4L5G A;  2XTI A;  1O9S A;  1QQJ A;  5GMK h;  1PG5 B;  1VQM A;  1WYD A;  3MF2 A;  1BBW A;  2K3Y A;  3NMZ C;  2KYB A;  3QZ9 B;  4P73 A;  3VQV A;  1BKB A;  1K1Z A;  3A1P A;  3CMA Q;  4JRP A;  1VQ4 A;  1N27 A;  2PUK B;  3OYF A;  1KQS A;  1VQ6 A;  4CC7 A;  2DER A;  3A5Z B;  1H4T A;  2Q7H A;  1D1C A;  4FYX B;  1VQL T;  3REB B;  4HVV A;  1K8A U;  2FEI A;  3SEM A;  3KXT A;  1ZSZ C;  4KGZ B;  1AWX A;  3CC2 T;  3EFR A;  3LSQ A;  2C8M A;  2F2V A;  3RDV A;  1CKA A;  3QWX X;  4CS3 A;  3QO5 A;  1YFR A;  1VQ9 Q;  3A74 A;  2ZNI A;  3CXC S;  2E65 A;  4BDZ A;  5D6X A;  3QZ5 B;  1UDL A;  4ZN3 A;  2DQ0 A;  2DE0 X;  1K8A C;  5LJ3 g;  1EFN A;  2DL5 A;  3MHX A;  1NEG A;  4XTZ A;  1TG0 A;  2XHC A;  4XU2 A;  4EPC A;  3X25 B;  2LDM A;  4LVJ A;  2ROL A;  2GNC A;  3VS1 A;  3EGX A;  3CCE Q;  4CS2 A;  3SHW A;  4AG1 C;  4EMK A;  1U3O A;  3FC3 A;  1ZHI A;  2CSI A;  1UFF A;  5LJ5 g;  1TH7 A;  3I9Q A;  4M7A D;  2DTI A;  2DPP B;  1G3T A;  2RJC A;  3M4G A;  2EFI A;  2CZ1 B;  3OD1 A;  5FRO A;  5M9O A;  4OGC A;  4P74 A;  3EG1 A;  1MHN A;  2L3P A;  1E1O A;  1IGQ A;  4FSS A;  2P4T A;  1TS9 A;  3VRZ A;  1M1G A;  1PHT A;  2PUO B;  3JCM e;  4DBH A;  1VQM T;  2HBW A;  4ZIB A;  1FMK A;  2MWP A;  2P4R A;  4HVC A;  4OB3 B;  2ARS A;  4L87 A;  3P8V A;  4YTL A;  3LWH A;  4WI1 A;  4F17 A;  1K9M R;  3G1J A;  5FRN A;  4M7D C;  3CPF A;  2RM4 A;  5IH2 A;  2RJF A;  1G51 A;  4YRR A;  5AT1 B;  5KYX B;  1VQ4 T;  2QAS A;  4FW2 A;  4M78 F;  4E7S A;  2EYX A;  4E47 A;  1UUE A;  3QJ6 A;  4HVU A;  1G5H A;  1MV0 B;  3UA6 A;  1VQ6 T;  1USY A;  2KI7 A;  2L3S A;  5HY6 A;  2EGA A;  4P3O A;  2DLP A;  2QGG A;  1QVG S;  2B8A A;  1YJW Q;  4HCZ A;  1YIT A;  2FPE A;  2J06 A;  1RI0 A;  1NM7 A;  2LJ3 A;  2G4C A;  2P84 A;  4KT0 E;  3TSZ A;  3OYH A;  5J26 A;  4R56 A;  1NJI R;  2FVU A;  1SRL A;  2BKD N;  3QII A;  2D8H A;  3ZFJ A;  1SHG A;  2F2X A;  1XQH A;  1G3W A;  4FM4 B;  1BCO A;  3QXE B;  4A4K A;  4C8Q B;  3J81 E;  2P0Q A;  2Q5H A;  3GP8 A;  3S3N A;  1MMA A;  5GAM g;  1Q86 R;  4BUG A;  1KFZ A;  4PFP A;  1M30 A;  4WF2 A;  2NS6 A;  3H8Z A;  2FO0 A;  3I5S A;  4M4Z A;  1E6G A;  4NOY A;  5DM7 R;  3VS4 A;  1YCS B;  2QEX T;  3GOX A;  2MCN A;  2E70 A;  4M7D B;  2OJ2 A;  1ZSG A;  3HPW A;  1ATI A;  2LCC A;  3LSS A;  5FRM A;  5GAO m;  4C0D C;  2ZIO A;  1SSF A;  4MZP A;  3LH0 A;  2HMA A;  2GTO A;  2CZ6 B;  4KR3 A;  2K3X A;  4RMO A;  1G3Y A;  1QF6 A;  3QTC A;  3M0S A;  2GTJ A;  1I0C A;  2MIO A;  2X4W A;  5KE3 A;  3I5R A;  3VQX A;  1HC7 A;  1TUC A;  4LNS A;  4E7H A;  2LNV A;  4PJL A;  2DD5 A;  1EX4 A;  1HSQ A;  3G1Z A;  2BZ8 A;  2DXC A;  1JXM A;  4QQG A;  1OX8 A;  5KYY A;  1PSF A;  4MZM A;  2KT1 A;  3H41 A;  5HK0 A;  3EGD A;  2QHV A;  3ERR A;  3WXM B;  4C92 B;  4FYW B;  2CJB A;  5CO7 A; 
#chains in the Genus database with same CATH homology
 4F7U A;  3HRU A;  3O8V A;  4UC4 A;  2ZR3 A;  4FT2 A;  4BI3 A;  4XTV A;  1WJR A;  2BIV A;  3CCU A;  1N9R A;  4C5G A;  1UGS B;  1YIT T;  2EJG A;  2YLC A;  2XID A;  4OLF A;  2ZZF A;  4OP0 A;  2F5K A;  4Y91 A;  3CC4 A;  5L8R E;  4HWT A;  5CQX A;  3OMG A;  2DO3 A;  2OTJ A;  2ZPB B;  1GXI E;  1QVG A;  4BD3 A;  3JB9 J;  2RHS B;  4ZTU B;  3TEH B;  3CCV T;  2O4X B;  2ZR2 A;  4YRL A;  4J8O A;  3V8J A;  4P72 A;  4Z02 A;  4FSX A;  1X56 A;  5GAN 3;  3S6W A;  2RH2 A;  4VUB A;  2ZTG A;  3QPH A;  4J7I A;  5GAN g;  4X9D A;  1JJ2 S;  4KUD K;  4M75 C;  5GMK j;  4E7J A;  1B76 A;  1NE8 A;  1VQ7 A;  3CBM A;  2GFA A;  1H4S A;  2ZXF A;  3HRS A;  5A2Q E;  4N4H A;  3M59 A;  1UGQ B;  1I8F A;  5KE2 A;  3CC7 A;  3URG A;  1X2H A;  3HY0 A;  2ODR C;  3HRK A;  3EAE A;  3CCU T;  2LTO A;  4YCW A;  3RKX A;  4RCC A;  2RHQ A;  3SB2 A;  4PJO C;  2FL7 A;  1UGP B;  3NEM A;  2YRV A;  4DQ2 A;  3FIF A;  3HRT A;  5CVI A;  4NCX A;  3Q1J A;  3CC4 T;  3CCR A;  2WSE E;  2P0K A;  4C8Q D;  3OY9 A;  4MDX A;  1OYX A;  4TQD A;  4CH3 A;  3SWN A;  1W66 A;  4M75 B;  3NTH A;  4R55 A;  4IUR A;  4BB7 A;  1H64 1;  4QVD A;  3QDR B;  4KQE A;  2OTJ T;  4M78 B;  5GAN 7;  1NPR A;  3CCJ T;  1EOV A;  2QA4 A;  4J5Y A;  2KVQ G;  4M7D D;  4HKE A;  4C0F A;  3E9H A;  1KMM A;  2DXU A;  3LW5 E;  3REX A;  4IUT A;  2K5I A;  4QVC A;  5GMK e;  3HFZ A;  5IAY A;  5C52 B;  4HWS A;  3HXU A;  4C5I A;  4MML A;  1PSE A;  3GLX A;  4ELY C;  4OVA A;  1VIE A;  4PJO B;  3JCM X;  5CIU A;  2QHS A;  3IAL A;  1WPY A;  3I55 A;  1VQ7 T;  3UFG A;  3JCM b;  3L2U A;  3DKM A;  3R07 A;  4ME7 A;  3A7U A;  5CKF A;  1EFW A;  2EWN A;  2E10 A;  3QKJ A;  4C92 D;  3CC7 T;  3TEG A;  2JZ2 A;  2OTL A;  5CQY A;  1KQS S;  1BIA A;  3A32 A;  4XQ3 A;  1S72 A;  4QVZ A;  1L0W A;  3RL6 A;  1NZ9 A;  2E41 A;  3CCR T;  2QHT A;  1B34 B;  1B70 A;  3L4G A;  3A7A A;  2L8D A;  3M58 A;  2R58 A;  5D6Y A;  1NJ5 A;  2V8K A;  4OB1 B;  2EYQ A;  2V8I A;  3OYI A;  2FYK A;  2QA4 T;  2JVV A;  2IY5 A;  5LJ3 h;  3VUZ A;  1YJN A;  3RMS A;  1VQL A;  2ZCE A;  2DXB A;  1WLE A;  2DU5 A;  4CH6 A;  4PHC A;  4X34 A;  4P73 C;  1Y7X A;  3CBP A;  4A4G A;  5LJ5 h;  1QP2 A;  3LLR A;  4A4E A;  2RI2 A;  2EKO A;  3REU A;  2YLB A;  1BI2 A;  3I55 T;  3UGQ A;  2E6Z A;  3P8H A;  4F7U F;  1NJI U;  2O01 E;  5GAO q;  4CRI A;  2M9U A;  4YRK A;  2XI9 A;  4LDW A;  2K5F A;  2CYZ B;  3DSQ A;  3MEW A;  3HXY A;  1Q86 U;  4UPA A;  3G6E A;  3LYI A;  2LCL A;  2RO0 A;  2OTL T;  3T9N A;  2EJF A;  3NEL A;  4N4I A;  1S72 T;  1C0A A;  1NJI C;  3C4S A;  1SET A;  2X4J A;  1X01 A;  5C51 B;  1KHC A;  2HD0 A;  1I4K 1;  2VV5 A;  4ZTF A;  1U8R A;  2QQR A;  4LD6 A;  3KUF A;  2DTH A;  4M77 C;  1Q86 C;  3OB9 A;  2DD4 A;  4M75 D;  2ZZG A;  2QHU A;  1Y96 A;  4TVW A;  4KUI A;  4YRI A;  4YRJ A;  4P74 C;  4M78 D;  4EMH A;  5GAM h;  5C6S A;  4MDW A;  2E12 A;  1X75 C;  4YRS A;  2VGN A;  2A8E A;  2RHY A;  1EVK A;  5CCA A;  1YJN T;  2HQX A;  4ZTJ A;  4B9W A;  3E9I A;  4PLL A;  2EQK A;  5GAO l;  2LQ8 A;  3QG1 A;  2ODR D;  3LC0 A;  3HP9 A;  4P75 C;  1HK9 A;  2K5L A;  3INZ A;  4PJO D;  3C12 A;  3BW1 A;  4DOV A;  4GY5 A;  1WQ7 A;  2LVM A;  3OYM A;  1Q81 U;  1VQ8 A;  5CR2 A;  4C5H A;  3G71 A;  4X9C A;  3RMQ A;  2ALY A;  1LYL A;  3A5Z A;  2KY9 A;  3JCM f;  3HXV A;  4L6V 5;  4M77 B;  2X4Y A;  1M9S A;  2QEX A;  3OYG A;  3G6E T;  4CI0 C;  3OYA A;  2A7Y A;  3AHU A;  4O2D A;  5KCO A;  2NLU A;  1Q81 C;  3V7C A;  2PU9 B;  4M7A E;  4C8Q C;  3PCO A;  3OSS C;  2Q5I A;  1WQW A;  2ZPE B;  2ZPI B;  3W3S A;  1OZ3 A;  1VIF A;  5A0G A;  1Z7M A;  4H2S A;  1YIJ A;  3FRN A;  1WJQ A;  2DJZ A;  5DLQ E;  4JUV A;  4JDS A;  4EDU A;  1U1T A;  4YRE A;  3GF5 A;  4CH5 A;  3J80 E;  3A31 A;  5EG2 A;  3JCM d;  4BI4 A;  1NJ2 A;  2AMC A;  1NJ6 A;  3FLG A;  4H2T A;  3CCL A;  4YRN A;  3S3O A;  1VQK A;  5I2S A;  3BJU A;  2OAU A;  3E9F A;  3WVE B;  3FDR A;  1H4Q A;  4JS4 A;  2EJ9 A;  5GAN 6;  1JB0 E;  2ZIN A;  4WJ3 M;  5GAN h;  2XDP A;  1K73 U;  1VQ8 T;  3G71 T;  1H3Z A;  1FYF A;  4C92 C;  4Y28 E;  1EIF A;  1VQZ A;  2R5A A;  3VU3 C;  3UDC A;  1X6O A;  3M55 A;  5DLO A;  5HGQ A;  3CCV A;  2MWO A;  4E7K A;  3HTZ A;  4IUP A;  2I4M A;  3UPU A;  2CZ7 B;  4UP8 A;  1JRI A;  1K73 C;  4YRG A;  3QO7 A;  5A0D A;  1NJ1 A;  4RG8 A;  2JN0 A;  4II1 A;  3P8T A;  2VUB A;  1YIJ T;  4OMF B;  4M7A G;  1ASY A;  2PVG B;  5HKC A;  4IKF A;  1N8R U;  3L2Q A;  3OYK A;  3I56 A;  1ZBX A;  4F7U B;  2I4N A;  1OZ2 A;  4M7D A;  2DTO A;  2X35 A;  4JRK A;  2KQW A;  3QO3 A;  2X4X A;  5LJ3 j;  5FU6 B;  2E5A A;  4YCU A;  2L5Q A;  4H2X A;  3C94 A;  2GQV A;  4LDY A;  2RHZ A;  3CCL T;  2RHU A;  5CKD A;  1VQK T;  2KMT A;  1N8R C;  4ZGE B;  2KK4 A;  5LJ5 j;  4BY6 C;  4BI8 B;  2HNI A;  3RES A;  3DLL A;  4ZN1 A;  2J3L A;  3OQ5 A;  3JCM V;  3A7R A;  5GAO r;  2CZ0 B;  1M1F A;  3QJY A;  3BDL A;  4FIB A;  3QSU A;  5LL6 S;  2F5T X;  1PYS A;  2DVE A;  2Y4X A;  4M77 D;  3M56 A;  4JS5 A;  1O75 A;  5LJ3 f;  5J39 A;  3OYE A;  1NYQ A;  2CS7 A;  4Q15 A;  5CKE A;  3G7Z A;  1EIY A;  3CCJ A;  3FJP A;  4TVA A;  2E5Q A;  1BBU A;  4YRP A;  4HCC A;  4HT8 A;  3UGT A;  3OS5 A;  5KNN A;  2EL9 A;  4BY6 B;  3RGL A;  5LJ3 e;  2CIM A;  3CPW S;  4P71 A;  3I56 T;  4M78 C;  2RHS A;  1LOJ A;  3FEO A;  1R8O B;  1U1S A;  5GAM j;  3JB9 I;  5C0M A;  1ADY A;  4PG3 A;  4FT4 A;  5LJ5 e;  1YB3 A;  2QQB A;  2E6N A;  1D3B A;  1IL2 A;  4XTW A;  2JTM A;  4H2U A;  1FX7 A;  3OYB A;  3MO8 A;  3CD6 A;  3LGF A;  1VQO A;  3L2Z A;  3SWN B;  2ZIM A;  3CCS A;  3HXW A;  3OBW A;  4RDX A;  1G5V A;  3CMQ A;  1W4S A;  1NJ8 A;  4HA8 A;  4C8Q E;  3A8M B;  1Y71 A;  4CH4 A;  1QP3 A;  5GAM f;  1FWZ A;  4ZGJ B;  4A4H A;  3RER A;  1G5I A;  2LT1 A;  1H4V B;  4N0A A;  3BY7 A;  3HFZ B;  4P5N A;  2XG8 D;  4BAC A;  4H02 A;  4DPG A;  3HY1 A;  4NL2 A;  4M7D E;  2K2V A;  4IUV A;  4HT4 A;  3KBG A;  3JB9 G;  1HXD A;  3SFM A;  4LD9 K;  1M5Q 1;  3JB9 F;  2KSS A;  5GAM e;  3M57 A;  1XTD A;  1VQP A;  2QXF A;  3L1A A;  4K86 A;  3QNE A;  2RHX A;  1KMN A;  3M9Q A;  3JCM Q;  1SRY A;  3L2V A;  3VQW A;  4XTU A;  2C7I A;  4LDU A;  4L59 A;  4EO4 A;  2PQW A;  5I2M A;  3JCM W;  2PME A;  4C92 E;  2LRQ A;  2K57 A;  3OYN A;  2PVO B;  3IG2 A;  1KD1 U;  3JCM g;  1I5L A;  4NS5 A;  4PJO A;  3HFN A;  1B70 B;  4J7F A;  3CD6 T;  1VQO T;  3OBY A;  3L4G B;  3CCS T;  4G84 A;  2DK3 A;  3NTI A;  4RMF A;  3CPW A;  1WNL A;  1P92 A;  5CKB A;  2DU7 A;  5GAN j;  2MI6 A;  2BUD A;  1Q82 U;  3VQY A;  2IY5 B;  5F5W A;  2CJ9 A;  2RI3 A;  1BI1 A;  1KD1 C;  3ME9 A;  2I4L A;  4MMK A;  2IVW A;  4C8Q G;  4BE2 A;  1WGS A;  2XIC A;  4M7A A;  3ASK A;  3M5A A;  1YJ9 A;  5ELO A;  3JCM c;  1JBM A;  1V29 B;  4YDQ A;  1Q82 C;  4HWO A;  4KBM B;  2ARU A;  5GMK i;  3P8Y A;  3MP1 A;  2AKW A;  3QBY A;  5ELN A;  3GNF B;  3L2W A;  2E64 A;  2FHD A;  2VXE A;  3TU4 K;  4B9X A;  4M7D G;  3RF1 A;  4D6W A;  1VQN A;  3P8D A;  5GAN f;  3HHT B;  4M7D F;  2RI5 A;  1VQP T;  4WJ4 A;  3JB9 H;  2WAC A;  3UWN A;  4A53 A;  5FU7 C;  4EX5 A;  5C53 B;  1Y07 A;  3PGG A;  2JNG A;  2LQK A;  4XU0 A;  5J3B A;  4A4F A;  3OA6 A;  2AHJ B;  5HK3 A;  4K87 A;  4TVY A;  4DOW A;  5IT9 E;  4XEM A;  3CEY A;  5E3I A;  1B7Y A;  2DQ3 A;  3DLM A;  3A8O B;  4DA4 A;  3BFM A;  5GAN e;  2XKO C;  3VYH B;  2JTF A;  2V8J A;  4C92 G;  3ER0 A;  3UT1 A;  1JJC A;  3QO8 A;  3CMA A;  3RAC A;  2HQE A;  3R6O A;  5CK9 A;  1WJS A;  3OYY A;  2K4Y A;  1M1K U;  1Y96 B;  4EMK C;  4C0G A;  1NNH A;  3QUI A;  5GAO p;  4A54 A;  3A8G B;  1UB4 A;  4M75 E;  3HXZ A;  5CAI A;  5FU7 B;  4J6Y A;  5GAN 2;  1VQ9 A;  4GLK A;  1YJ9 T;  4P3P A;  3E1S A;  4M78 E;  3OYC A;  3WQZ A;  3UH0 A;  1M1K C;  3V8L A;  2KDS A;  2EQM A;  4BE1 A;  2CGH A;  1Q7Y U;  1ASZ A;  2HAX A;  3LX7 A;  4JRI A;  3WVD B;  1YFS A;  4KUL A;  3RIR A;  1VQN T;  3CCE A;  2R57 A;  4ZGD B;  4YRF A;  2ALY B;  1KHI A;  2WSC E;  2WSF E;  4FL6 A;  1USY C;  3N5B B;  3QYH B;  4PJO E;  2YHT A;  2KAF A;  2IG0 A;  4RCB A;  2E1H A;  1X2G A;  4EMK B;  1WU7 A;  1Q7Y C;  1SES A;  3X24 B;  3PTA A;  1N9W A;  4MZT A;  4QW2 A;  1GGM A;  2PMF A;  3V7R A;  1M4Z A;  3MF1 A;  3PCO B;  2E3C A;  3LWI A;  2DIQ A;  3CME A;  2Q7E A;  2M1H A;  5KH6 A;  3NEN A;  2RK1 A;  5K1P A;  3CMA T;  2D0Q B;  2L3R A;  3QHS A;  5K1X A;  4QQ6 A;  3GPL A;  3ZBD A;  3JAM E;  3VUB A;  5GMK m;  1YJW A;  4M77 A;  3TCJ A;  4RKU E;  1YBY A;  1YCY A;  5GAN 8;  2AMC B;  3ZEH A;  3HSB A;  1VQ9 T;  1E24 A;  1HTT A;  1B8A A;  1QE0 A;  4M75 G;  2EQU A;  4M75 F;  4Q5W A;  4M78 G;  3RUX A;  4P75 A;  4BE0 A;  2RJD A;  3X20 B;  3CCE T;  3HFO A;  4YP0 A;  3CBO A;  3X28 B;  3OS2 A;  2RHI A;  5CKH A;  1RIQ A;  1ZQ1 A;  5FU6 C;  1N9S A;  1OI1 A;  3QYG B;  2R5M A;  4PJO G;  2XU8 A;  4PJO F;  3IKM B;  4NL3 A;  4XAX B;  4LDV A;  4KR2 A;  4ELZ C;  3CME T;  1QVF S;  3A8L B;  3OYL A;  2XK0 A;  1VUB A;  3PIO A;  4C8Q A;  2EIF A;  3V7S A;  1NYR A;  2LT4 A;  3L42 A;  3OW2 S;  2ZT7 A;  4P3N A;  4YRC A;  2ZPF B;  1YJW T;  2FB7 A;  2JOY A;  1KOG A;  3MCA B;  4P72 C;  2XD0 A;  1BIB A;  4M7A F;  3HL8 A;  4HWP A;  2PVD B;  3MET A;  4K88 A;  5D6W A;  4H2X B;  4HCB A;  4OB2 B;  4XK8 E;  2VYT A;  2VC8 A;  3CXC A;  4PKC C;  2QQA A;  4YRM A;  1IZ6 A;  2GF7 A;  4JLG A;  2I2L A;  3MEA A;  3EFS A;  3SDZ A;  3PMT A;  4XU3 A;  2DAQ A;  3GIB A;  4P71 C;  12AS A;  2XGT A;  5GAO n;  3ICA A;  2XDD A;  3OS1 A;  2ZZD A;  3MEY A;  4H2W A;  1BI3 A;  1PYS B;  2ZT5 A;  2JUF A;  1XOV A;  1M90 U;  1UGR B;  4ZTZ B;  3JSC A;  4C92 A;  1EIY B;  2QQS A;  3CCQ A;  2ZGW A;  5I21 A;  3OS0 A;  4YPF A;  3E19 A;  3X26 B;  4C0D B;  3SD4 A;  2ZNJ A;  2QQ9 A;  4M77 E;  4TVA B;  2P0L A;  2LC4 A;  3H6Z A;  3MEU A;  4IUU A;  2ZT6 A;  4UP7 A;  3SWN C;  2Y90 A;  2D9T A;  2RD1 A;  1M90 C;  3RKY A;  2HBP A;  2RJE A;  5LJ5 f;  3TEE A;  1BI0 A;  2VGM A;  3HFV A;  4N0A C;  2CJA A;  3JCM h;  2RK2 A;  3JB9 D;  3HRI A;  5FLX E;  1VQ5 A;  1NPP A;  4BDY A;  2L89 A;  4J6W A;  3OYJ A;  4UP9 A;  2QTX A;  2Q7G A;  3TEH A;  2O4X A;  1D3B B;  2XDB A;  4FU6 A;  4OGE A;  2RHQ B;  3LGL A;  4LVK A;  4N4G A;  2DDZ A;  1QVF A;  3OYD A;  5DY9 A;  3PT9 A;  4JLI A;  1YFT A;  5LJ3 d;  1I81 A;  2LX9 A;  3L2R A;  2ART A;  1SER A;  4ATO A;  1XNI A;  4TTV A;  2MF2 A;  4LVI A;  4G85 A;  2I4O A;  2ZPG B;  1FXX A;  3OW2 A;  3PFS A;  1DJ7 B;  1E22 A;  3VYG A;  4RQF A;  1MGQ A;  5LJ5 d;  4TQF A;  1LNX A;  4TVR A;  3E9G A;  4AH6 A;  2DZ9 A;  1W2B S;  4YRT A;  2MMP A;  4J6X A;  3CCQ T;  3PNW C;  1KQ1 A;  4Q6G A;  2DIG A;  4LVM A;  4YCV A;  3PZC A;  2D6F A;  3VJP A;  4O6J A;  3TRE A;  3GNG A;  3S3M A;  3M4Q A;  5AYF A;  4M77 G;  4LDX A;  4JRQ A;  4E7I A;  4M77 F;  1YI2 A;  1Z7N A;  2DZC A;  4E51 A;  5A0L A;  1KC8 U;  2C06 A;  1UEB A;  1YGB A;  4QQD A;  3DB3 A;  3A8H B;  1BYM A;  3OMC A;  4M7A C;  5KCH A;  4M75 A;  1VQ5 T;  1E1T A;  4PNO A;  1ADJ A;  2M16 A;  1KG1 A;  4M78 A;  3VV0 A;  4V2S A;  1QW1 A;  4OF1 A;  3M4P A;  3I7F A;  2RA2 A;  4F7U E;  3DB4 A;  1AHJ B;  4YYE A;  4H2Y A;  5GAM d;  1KC8 C;  3JRZ A;  4CS4 A;  4TWA A;  1EQR A;  1J5W A;  1X55 A;  11AS A;  2RB6 A;  4H2V A;  3KFU A;  3F70 A;  4RQE A;  4PL6 A;  1YHQ A;  1M8V A;  3MP6 A;  3JCM P;  4O5V A;  3G4S A;  2P5I A;  1RL2 A;  3BDU A;  3RKW A;  4M7A B;  1JJ2 A;  2GCX A;  2ZCF B;  2QI2 A;  2Y4Y A;  2M0O A;  1LJO A;  3NFC A;  3CCM A;  2AKW B;  4XEO A;  4XTX A;  2H3J A;  4C8Q F;  3P8B B;  3OSV A;  1EVL A;  4HWR A;  2DEQ A;  4PLI A;  3MEV A;  2EQJ A;  3M54 A;  4OB0 B;  2EAY A;  1B34 A;  1YI2 T;  2ZPH B;  4IUQ A;  3VKI A;  4C5E A;  3HXX A;  2VXF A;  5GAN 4;  1W2B A;  2DKG A;  4JJN K;  4HT9 A;  2G3R A;  2J3M A;  1K9M U;  1G3S A;  3C95 A;  4J15 A;  5GMK l;  4YRO A;  1B7Y B;  3CC2 A;  4BW9 A;  5GAN 5;  3V8K A;  2F69 A;  3M53 A;  1QVP A;  3J7A F;  2MAM A;  4F7U G;  4E7L A;  1JJC B;  4BWA A;  3PIP A;  1IRE B;  3FB9 A;  2ZT8 A;  3NTK A;  4YRQ A;  1K9M C;  1YHQ T;  4RG2 A;  2GFU A;  3JCM J;  4EMG A;  4C92 F;  2DXT A;  2QDY B;  4J83 A;  3PMI A;  3G4S T;  2ZZE A;  3NET A;  2A3L A;  4X5O A;  4LVL A;  3TUP A;  5IN1 A;  1KQ2 A;  3VBB A;  5GAN d;  3MP8 A;  1N6A A;  1X54 A;  3IKL A;  3MQZ A;  4XU1 A;  3CCM T;  2P0P A;  4XTY A;  3M4Y A;  4C0Z A;  2CKK A;  3A5Y A;  3HKS A;  4L5G A;  2XTI A;  1O9S A;  5GMK h;  1VQM A;  1WYD A;  3MF2 A;  1BBW A;  2K3Y A;  3QZ9 B;  4P73 A;  3VQV A;  1BKB A;  4JRP A;  1VQ4 A;  1N27 A;  2PUK B;  3OYF A;  1KQS A;  1VQ6 A;  3A5Z B;  1H4T A;  2Q7H A;  1VQL T;  1K8A U;  3KXT A;  3CC2 T;  3EFR A;  3LSQ A;  2C8M A;  4CS3 A;  3QO5 A;  1YFR A;  3A74 A;  2ZNI A;  3CXC S;  2E65 A;  4BDZ A;  5D6X A;  3QZ5 B;  4ZN3 A;  2DQ0 A;  1K8A C;  5LJ3 g;  3MHX A;  4XTZ A;  2XHC A;  4XU2 A;  4EPC A;  3X25 B;  2LDM A;  4LVJ A;  4CS2 A;  4EMK A;  3FC3 A;  1ZHI A;  5LJ5 g;  1TH7 A;  4M7A D;  2DTI A;  2DPP B;  1G3T A;  2RJC A;  3M4G A;  2EFI A;  2CZ1 B;  3OD1 A;  5FRO A;  5M9O A;  4OGC A;  4P74 A;  1MHN A;  1E1O A;  2P4T A;  1M1G A;  2PUO B;  3JCM e;  1VQM T;  4ZIB A;  2MWP A;  4HVC A;  2ARS A;  4OB3 B;  4L87 A;  3P8V A;  4YTL A;  3LWH A;  4WI1 A;  5FRN A;  4M7D C;  3CPF A;  2RM4 A;  2RJF A;  1G51 A;  4YRR A;  1VQ4 T;  4M78 F;  4E47 A;  3QJ6 A;  1G5H A;  1VQ6 T;  1USY A;  5HY6 A;  4P3O A;  1QVG S;  2B8A A;  4HCZ A;  1YIT A;  2G4C A;  1RI0 A;  4KT0 E;  3OYH A;  5J26 A;  4R56 A;  2FVU A;  2BKD N;  3QII A;  3ZFJ A;  1XQH A;  1G3W A;  4FM4 B;  3QXE B;  4A4K A;  4C8Q B;  3J81 E;  2P0Q A;  2Q5H A;  3GP8 A;  3S3N A;  5GAM g;  4BUG A;  4WF2 A;  2NS6 A;  3H8Z A;  4NOY A;  5DM7 R;  2QEX T;  3GOX A;  2E70 A;  4M7D B;  3HPW A;  1ATI A;  2LCC A;  3LSS A;  5FRM A;  5GAO m;  2ZIO A;  4C0D C;  1SSF A;  4MZP A;  3LH0 A;  2CZ6 B;  4KR3 A;  2K3X A;  4RMO A;  1G3Y A;  1QF6 A;  3QTC A;  2X4W A;  5KE3 A;  3VQX A;  1HC7 A;  4LNS A;  4E7H A;  2LNV A;  2DD5 A;  3G1Z A;  2DXC A;  4QQG A;  1PSF A;  4MZM A;  5HK0 A;  2QHV A;  3ERR A;  3WXM B;  4C92 B;  2CJB A;  5CO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...