3EFRA

Biotin protein ligase r40g mutant from aquifex aeolicus in complex with biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGGLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 67
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efrA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efrA01
3NETA 3HFZA 4HT8A 1E1OA 1I4K1 1WPYA 3M4PA 5GAOr 1H4QA 4PJOE 4H2VA 2I4NA 5GAN3 1Z7MA 4HWPA 5LJ3f 3V7RA 4YCVA 3TEHB 1YFSA 1E22A 1H4TA 2DZ9A 1JRIA 1QF6A 4NCXA 1LNXA 2DEQA 3EFRA 5LJ3g 3A31A 1JJCA 3VQWA 4EMKC 3JB9D 4PG3A 4M77E 4F7UF 1NYRA 1E1TA 4C8QD 1WQWA 1USYA 1LJOA 4P73A 2RHSA 4C92E 3RF1A 1LOJA 4K88A 1N9SA 2EWNA 4DQ2A 1X2GA 4X9CA 2DU7A 4F7UB 1Y96A 5GANd 2E1HA 4A53A 2ZNIA 2ODRD 3HFOA 1WQ7A 2YHTA 4CS3A 2CJAA 3L4GA 4M7AD 2EJFA 3RERA 5ELOA 4XQ3A 3CMQA 5LJ5f 3JCMV 1NJ6A 4UP7A 4ZIBA 1X54A 1X01A 3ERRA 3JCMQ 5LJ5g 1QE0A 4M7DG 1HXDA 1J5WA 3G1ZA 4OP0A 1WYDA 4H02A 3V8JA 1B34B 4NL2A 4M75A 2YLCA 2QHUA 4YYEA 12ASA 2RHQB 4PJOA 1NYQA 5LJ5h 2VXEA 4WJ4A 2EAYA 5K1PA 1WLEA 5I21A 2CJ9A 4M7DF 3INZA 1SERA 4M7DE 3JCMJ 4M78D 4EMGA 3SWNB 5GANj 1B7YA 4XU0A 3RL6A 4M7AE 4HA8A 1HTTA 2HNIA 5GANg 1X2HA 4M77A 3QHSA 2J3MA 5GAOp 5GMKl 2QHVA 4MMKA 4HT9A 4C92A 4E51A 4YRSA 3JCMc 4CH4A 2ZGWA 2ZIMA 1D3BB 2Q7EA 3BFMA 5GANh 3UH0A 2E41A 3V7SA 3DSQA 1L0WA 3JCMf 3RIRA 1U1TA 1H4SA 1ATIA 4P75A 3JCMg 2I4LA 4P72C 1SESA 3JB9J 2RHQA 4CH5A 4XTZA 4QVDA 2J3LA 1JJCB 4K86A 5LJ3d 3M4GA 2ZTGA 2PMFA 3JCMh 5GMKh 4Q15A 3QO3A 5K1XA 2QTXA 5GAMf 2DQ3A 4M7DA 2DZCA 2ZT7A 2G4CA 4M75G 4KR3A 1Y96B 4M7AA 4P74A 1KMMA 5GAMg 5ELNA 4PJOG 5GAOm 1N9RA 3A7RA 3L4GB 4N0AA 5GAN4 1YB3A 2ZIOA 4M75F 3QO8A 3FIFA 2ZT8A 3JB9H 1IL2A 2I4MA 1MGQA 2ALYB 3SWNC 4EO4A 4RQEA 4PJOF 4M77G 1ADYA 3UGQA 5LJ5d 4AH6A 4HVCA 4P71C 4C92G 5LJ3j 3MF1A 4A54A 4M75B 3V8KA 4TTVA 4YP0A 4M78A 4PJOB 4M77F 3HXUA 4J6XA 3HRKA 3EFSA 1KOGA 4C92F 4QVCA 1B7YB 1NJ8A 3A74A 4TVYA 4ZTUB 3REUA 2CJBA 4BWAA 5LJ3h 3UFGA 4P3NA 4M77B 3QNEA 5LJ3e 3JB9G 4J6YA 1NNHA 4H2UA 4YRPA 2DTOA 4C92B 2DXTA 4C8QG 4TVAA 1JBMA 4KQEA 1EIYA 2AKWA 4RCBA 3MEYA 5C51B 4P3OA 4L87A 2E10A 5LJ5j 3IKLA 4TQDA 3JB9F 1EQRA 3V7CA 4HWRA 1EFWA 2I4OA 2ALYA 3V8LA 5GAOq 1B8AA 1YFRA 3JCMW 4V2SA 1USYC 4C8QE 4P73C 4PHCA 4MMLA 3E9IA 1EVLA 5C52B 3VQXA 4EMHA 4UPAA 5E3IA 4M7AG 4YRLA 2RA2A 4J6WA 3JCMd 4XTXA 2XGTA 3QSUA 4YDQA 5LJ5e 1KMNA 4YRIA 1SRYA 4YRGA 4M7AF 3TEGA 4YRJA 3HY1A 3VQYA 3BDUA 5HGQA 3PZCA 4UP9A 2Q7HA 11ASA 4M7DB 2ZINA 3VBBA 4M7AB 5GAOl 1H641 4M78G 3HRIA 4X5OA 4YREA 5CAIA 3L1AA 4M75C 3HFVA 3NEMA 5GAMd 3AHUA 5GAN2 4PJOC 1FYFA 2DKGA 5GANe 4YCUA 3RKWA 1BBUA 3QO5A 3ICAA 4M78F 3RUXA 4M78E 5GMKj 1ASYA 4XU1A 2DDZA 4M77C 2Q5HA 1RIQA 4C8QA 4XU2A 4C92C 4M78B 1W66A 4H2WA 4RQFA 1KQ1A 3HSBA 4XTUA 2ZZGA 4YROA 2FB7A 4PNOA 3RKXA 4K87A 2ZZEA 1YGBA 3BJUA 3W3SA 3JCMe 2DU5A 5GMKe 3BY7A 4Q6GA 4P3PA 5GAMj 3LC0A 4YPFA 5KNNA 2ZZFA 4BW9A 3P8TA 2QHSA 3FJPA 4YRCA 4P75C 4TVAB 1EIYB 3IG2A 2AKWB 4XU3A 3QUIA 3VU3C 3JB9I 5GMKi 1BBWA 2ARTA 4YCWA 2PMEA 5GAMh 2ZT5A 2K57A 4JRIA 4TQFA 4YRNA 3NENA 4TWAA 2DTHA 1NJ5A 2ODRC 3HXVA 2ZXFA 4M7DC 2EL9A 2E64A 3LSQA 4CH3A 4EMKA 4M7AC 1B70A 4P74C 3WQZA 1C0AA 1X55A 2DXUA 3SB2A 2Q7GA 4N0AC 1I8FA 3A32A 2ARUA 4WI1A 4F7UG 1NJ1A 4YRFA 3VQVA 1YCYA 2IY5A 2I2LA 4O2DA 2DVEA 2CIMA 1N9WA 4CS4A 4LNSA 1X56A 3HXXA 4M78C 5GAN5 2P0LA 4F7UE 1TH7A 5GAN7 3OD1A 4ZTZB 4RMFA 2AMCA 3TUPA 4C8QF 3MF2A 1ASZA 3PGGA 3PCOA 3RESA 3IKMB 3GIBA 4CH6A 2C7IA 3RACA 1NJ2A 3A7AA 4XTYA 4CS2A 5GAN8 1KQ2A 1PYSB 4M7DD 4C8QB 4TVWA 1U1SA 2P5IA 4H2YA 2DTIA 1LYLA 4H2XA 1I5LA 4UP8A 2C8MA 4KR2A 4RDXA 2EJGA 3TEHA 4YRQA 2YLBA 1BIAA 1SETA 4YRKA 1EVKA 3IALA 3M4QA 2CGHA 4J15A 1HK9A 3HFNA 3HXWA 1E24A 4XEMA 4WJ3M 2Q5IA 2ZR3A 3REXA 3A7UA 3LSSA 2ZT6A 1WNLA 3HY0A 3JCMP 3HTZA 5GANf 4YRMA 2VXFA 1G5IA 5C53B 3FB9A 2RD1A 3BW1A 4RCCA 1I81A 4F7UA 2ZNJA 4P72A 2XTIA 2DQ0A 1ADJA 4XTVA 3A5ZA 2RB6A 3JCMb 4J5YA 1PYSA 4H2SA 4DPGA 4WF2A 4EMKB 3A5YA 3I7FA 3P8VA 3RKYA 4HWTA 1B70B 4JRKA 3R07A 4XTWA 4JUVA 3RGLA 2QHTA 3KFUA 3UGTA 1M8VA 3HFZB 4HWOA 3NELA 3E9HA 3P8YA 5GAN6 1YFTA 4X9DA 1WU7A 1GGMA 1B34A 2E5AA 3L2ZA 2E65A 2ZR2A 3QTCA 2IY5B 2RM4A 1M5Q1 4JLIA 2ZCEA 4H2TA 5F5WA 3JCMX 1Z7NA 4C8QC 4M75D 3SWNA 5GAOn 3HXZA 2Y90A 1BIBA 4PJOD 1EOVA 1H4VB 3HXYA 4G85A 2AMCB 4Y91A 2RHSB 2JN0A 2FYKA 4OLFA 4G84A 4P71A 4HWSA 5GAMe 3PCOB 2E3CA 1VQZA 1HC7A 4YRTA 4NOYA 2DJZA 5GMKm 2VC8A 4M77D 4YRRA 5DY9A 1D3BA 2EJ9A 1G5HA 3QO7A 4EX5A 4XEOA 4C92D 4NL3A 1G51A 4H2XB 2ARSA 1B76A 4M75E
chains in the Genus database with same CATH superfamily
2LNVA 2HEQA 3WVDB 5IT9E 3P8HA 3OMGA 4C5IA 1MMNA 1YFSA 5KYUB 1H4TA 1JRIA 1UECA 4MZPA 2RJFA 4BI3A 4R55A 1OX9A 4N4GA 3A31A 3VQWA 1TUCA 3JB9D 4PG3A 2DEUA 4IUUA 2K79A 1NYRA 1E1TA 1Y07A 2DXCA 1X6GA 1USYA 4P73A 2EQJA 1LCKA 1X2GA 2X4JA 3DB3A 2X35A 3G6EQ 2R5AA 4F7UB 1NJIC 1Y96A 2MCNA 3M0SA 2V8JA 2JOYA 2ODRD 3GLXA 3M57A 2GGRA 2YHTA 2YRVA 3VS0A 2L3RA 2CJAA 2E5QA 2EKHA 1BYMA 5C6SA 3CMQA 1VQ8Q 4GLMA 1NJ6A 2DIGA 1X54A 2CZ1B 2Y4XA 1QW1A 2LDMA 3J81E 2ROLA 3G1ZA 1WYDA 4IIMA 4H02A 3V8JA 1B34B 4M75A 3OYIA 3LW5E 2QQ9A 2P84A 3M9QA 4WJ4A 2JJ9A 2YSQA 1WJRA 1CSKA 2H8HA 1BCOA 3INZA 1SERA 4M7DE 3OS5A 2VVKA 3CCMQ 3RL6A 4HA8A 3EG0A 2HNIA 4Y28E 2GCXA 1PSFA 4E51A 4LDVA 3CCQA 2CH4A 3MP6A 2Q7EA 1K9MR 1WDXA 1RAAB 3V7SA 4O5VA 1X2QA 3DSQA 1RI0A 4LVIA 1C0MA 1H4SA 4JJDA 2FRYA 3QZ9B 1SEMA 4P72C 4PLIA 2YUQA 3JB9J 4PFPA 4E2FB 1JO8A 2A7YA 3A8HB 3CQTA 2ESWA 1S72Q 3ME9A 4IIOA 4JS4A 1JEGA 2ZTGA 2EPDA 3CCRT 3AT1B 2PMFA 2O4XB 4BI4A 5K1XA 2O01E 3OYAA 2AIRB 2DLPA 2CS7A 4M7DA 2DZCA 1O75A 4WTOB 3HRUA 1I5OB 1N27A 1KMMA 4RTWA 1N9RA 1AWWA 2A08A 1BK2A 1IB8A 3A7RA 3FC3A 2RK2A 3NTHA 4ZN1A 2BE7D 4QVZA 2ZT8A 3QKJA 2ALYB 3SWNC 2F1LA 3P8DA 4QQDA 2L3SA 4M77G 4J9GA 2KT8A 2ZAEA 3EG3A 4N4HA 3C12A 4DOWA 3OY9A 3OYMA 5LJ5d 4AH6A 3M59A 1TOVA 1M9SA 3CBOA 2GF7A 3MF1A 4A54A 1M8MA 4OVAA 3V8KA 4PJOB 2XK0A 4E7SA 3PIOA 3HXUA 2LJ3A 2X3WD 4ANJA 3EH2A 2AT1B 2O4XA 4C92F 5LJ3h 3UFGA 4ZTFA 3PFSA 3OW2P 2DTOA 3UA7A 4C8QG 4TVAA 1JBMA 2OI3A 2VB6A 4KQEA 3OBYA 2COWA 2RHZA 3MEYA 4P3OA 2LJ1A 2LVMA 2DJQA 4KUDK 4RG2A 3QPHA 1RAHB 1ZA2B 3V7CA 3JB9F 2ALYA 1KK7A 1WXTA 4J9FA 1USYC 4P73C 4KBMB 4ZN3A 1AT1B 1VIEA 2D8JA 4J7IA 4M7AG 5AT1B 2F69A 2JM9A 4A4GA 2M0OA 5CKFA 4AMCA 3VRYA 4DEXA 4XTXA 1RAEB 2LNHB 4DBFA 2I0NA 3OYEA 2KMTA 2RJEA 1Q7YU 4YRJA 3HY1A 1D0YA 1YN8A 1YWPA 1UUEA 1JXMA 3MEVA 2X4XA 1WJQA 4OB3B 2ZINA 2K4YA 2HD0A 2CSIA 3OYLA 2KY9A 4YREA 1GCPA 1WI7A 4M75C 3NEMA 1ZQ1A 2GBQA 4X1VA 1XTDA 2COZA 3NFCA 1FYFA 3VS4A 3RMQA 2DVJA 4QKUA 2CP3A 4FM4B 4IUTA 4M78E 3CCRQ 2DD4A 5A0DA 1D1AA 2IVWA 2K7AA 1Q7YC 1VQ4A 3A1PA 1Y0MA 1Y71A 3EGXA 2JS0A 2HL5C 2CREA 4M78B 4FSSA 1KQ1A 2RNAA 3HSBA 3IQLA 3E9FA 3QJYA 4YROA 2MIOA 4PNOA 4K87A 2V1RA 1QVPA 2DO3A 2O88A 2VGNA 4ESRA 3OBWA 3P8TA 2QHSA 1UHCA 4KH0B 2QASA 2FZKB 3HPWA 3PNWC 1EIYB 3IG2A 3QUIA 3VU3C 3JB9I 3TQ7P 2KEAA 3OYGA 1OQKA 2ARTA 1YJ9T 2ZPHB 4XAXB 1PD1A 1K76A 3OYHA 2ZT5A 1U3OA 4JRIA 2DILA 1QVGP 4TQFA 4TWAA 2DTHA 1M90U 4BY6B 4M7DC 1NM7A 2E64A 2AKLA 2B86A 4EMKA 3CCUA 2ED0A 4BDZA 2DETA 3CCSA 2ECZA 2CP7A 3CD6T 1G83A 4NS5A 3FJ5A 1AD5A 1Z9ZA 1UB4A 1I8FA 2LX9A 3CPWS 3A32A 1RABB 2LT4A 4D8KA 2XKOC 2LCLA 4F7UG 1NJ1A 1QKWA 4YRFA 1VYVA 3LH5A 1G3SA 1NYGA 1YCYA 3G4ST 1KD1U 2IY5A 2I2LA 3CC2T 4MZTA 4BI8B 4LNSA 2XU8A 4MDXA 3A8MB 1WHJA 3VS5A 2P0LA 3X24B 2HBWA 4RMFA 4CC4B 2AMCA 3UWNA 3TUPA 4C8QF 3PCOA 2H3JA 4ATOA 1SHFA 5IN1A 3RACA 2PVOB 2FHDA 1BI0A 1SRMA 5GAN8 1KQ2A 1IRXA 4M7DD 2NLUA 2PNIA 3EG1A 2P5IA 4H2YA 2DTIA 1QCNA 1KD1C 4H2XA 5HK0A 2L2PA 2A0FB 2P0PA 1KSWA 3FLGA 1QCOA 2KT1A 1OULA 1QVFA 2EJGA 4YRQA 1BI1A 2JW4A 2YLBA 1SETA 2VWFA 2CZ0B 2CUBA 2O31A 1HK9A 3HFNA 1W6XA 1YJWT 2CSQA 1E24A 1PWTA 2P0KA 2ZT6A 3LGLA 3HY0A 1XJWB 3JCMP 4YRMA 5GANf 2D8HA 3FB9A 2XHCA 3M0QA 2EQKA 2DNUA 1JU5C 1HYOA 2CT4A 1OPLA 2DQ0A 3M53A 2QEXT 1VQOQ 2E3HA 3CCVA 4JRPA 2DL8A 3Q1JA 2RB6A 3JCMb 2QA4A 5A0LA 1M90R 3M56A 1NZ9A 4WF2A 3A5YA 4HWTA 2KSSA 4L59A 1B70B 1RACB 3EHQA 2K2MA 2DX1A 2CP2A 2J7IA 1KQSS 3QXEB 4JUVA 4D6WA 1NLOC 2FO0A 3TSZA 4AT1B 1EFNA 2F2VA 1ZUKA 5J39A 3CBMA 1MUZA 1YJ9Q 1GGMA 4B9XA 4FYVB 2E65A 2ZR2A 3QTCA 2ENMA 2RM4A 2DD5A 3CMET 4P5NA 1Z7NA 3UA6A 2M0YA 3E19A 2QDYB 2RN8A 4PJNA 1Q95G 1PC0A 5GAOn 3HXZA 3SD4A 1BIBA 1N6AA 4PJOD 3HXYA 4KULA 1Q82C 3MQZA 1WYXA 2RHSB 3CD6Q 2QYZA 4IKFA 1EZZB 2LJ0A 2VC8A 4BE0A 2EJ9A 3G4SQ 1K8AU 1G5HA 1PHTA 3X20B 5KE2A 1TXQA 3CC2Q 4EX5A 1NBEB 3OYYA 2BKDN 3MPUB 4VUBA 2DL3A 2PQWA 1AVZC 1E1OA 3JAME 1I4K1 2QQRA 3M4PA 1H4QA 5GJWB 2VYTA 1Z7MA 4IUPA 3MHXA 4TVRA 2DRKA 3V7RA 3TEHB 1E22A 1OPKA 2DZ9A 4NCXA 1LNXA 2DEQA 3EFRA 2K5FA 2FPEA 4EMKC 2PVDB 4M77E 4F7UF 2XG8D 1RADB 1IZ6A 3NTIA 2RHSA 3RF1A 1LOJA 3H9NA 1N9SA 2EQIA 1IO6A 2DU7A 3UPUA 1M1KU 4A53A 2V26A 5IHKA 3HFOA 1WQ7A 3HL8A 1FX7A 4CS3A 5CQYA 3CCLT 3CXCS 2EJFA 1RUWA 2JT4A 1YJWQ 1ZHIA 3G6EA 4UP7A 1WA7A 4ZIBA 4PJLA 1X01A 3ERRA 1AZEA 3ER0A 1B76A 5IXFA 4IUVA 1VYTA 5FU6C 2OAUA 2YRDA 2CUDA 4J9BA 1H92A 1VQ9T 3DB4A 4YYEA 12ASA 1M27C 1Y57A 2RHQB 4XK8E 1FYNA 1WHKA 2VXEA 2QEXQ 1M1KC 2KR3A 1GL5A 4M7DF 1ZSZC 5DLQE 4M78D 4EMGA 3SWNB 2M51A 2LQKA 5GANj 1Q81C 1B7YA 4A4HA 4M7AE 1R0BG 1X2HA 4M77A 2KI7A 4ORZA 1M2VA 2J3MA 5GAOp 2FRWA 3JCMc 2K2VA 4CH4A 4FYXB 3L2RA 1X27A 3CCMA 1K8AR 1WXUA 3CMEQ 5DM7R 1PRLC 2BTTA 1Z9QA 3NTKA 3OA6A 4E7HA 1ATIA 1K73U 2QGGA 2E6NA 3EFOA 3EGDA 3OQ5A 4P75A 3MEAA 1DJ7B 5KE3A 3PTAA 2MK5A 2RHQA 1KC8U 2J3LA 2BIVA 3OMCA 4RTTA 2CZ6B 5LJ3d 2R58A 4EDUA 2AZSA 1YI2Q 2X4YA 1VQKT 1VQMT 1YITT 2XDBA 3J80E 1BU1A 5GAMf 3THKA 1QKXA 2E3IA 4KR3A 1Y96B 3PT9A 4M7AA 3S6WA 1S72A 4KRTA 5GAMg 1K9MU 5GAOm 1E6GA 3CCJT 3TSWA 5J3BA 4E7ZA 3MP8A 2WACA 5KYXA 2FPDA 5GAN4 1YB3A 1YHQT 2ZIOA 1YCSB 2EGAA 3FIFA 4J7FA 4Q5WA 3JB9H 2QQSA 4RQEA 2W0ZA 5I2MA 2KK4A 2ZPFB 4PJOF 2BZYA 3EAEA 2DXBA 4HVCA 4C92G 4LDUA 4M75B 1AOJA 4YP0A 1FWZA 4LDXA 1VQ6T 1K0SA 4QVCA 2IPOB 3CCLQ 3G7ZA 4TVYA 3CC4T 1N8RU 2RMOA 4II1A 1FMVA 2HQHA 1WHLA 2DAQA 3TCJA 4P3NA 2ZPEB 1ABOA 4PLLA 3JB9G 1NNHA 4H2UA 2PU9B 1M3AA 4C0GA 1YP5A 1JJ2A 2JUFA 1VQ9Q 5CVIA 3DKMA 3GP8A 4Z88A 1B8AA 2YWWA 2NUTA 1YFRA 5DLOA 1PKTA 2MF2A 3E9IA 1K4US 1NPRA 3URGA 4JZ4A 2ZPIB 5E3IA 4MDWA 2MOXA 1GCQA 3KBGA 1K73R 3GF5A 4E47A 4J6WA 3JCMd 1VQPT 4WCIA 3M0TA 2Z0WA 4CI0C 1KC8R 1JXOA 5LJ5e 2ZPBB 4YRIA 1SRYA 4YRGA 3TEGA 3BDUA 3PZCA 2XDPA 5KH6A 4RTVA 4LN2A 1BI2A 3CPWA 11ASA 4M7DB 2F5KA 1QVFP 2FL7A 2RPNA 5GAOl 2AK5A 4GBQA 3HFVA 2XI9A 5GAN2 1PNJA 5GANe 3H6ZA 4YCUA 3RKWA 2YT6A 1T0JA 4M78F 3RUXA 4BDYA 1VQKQ 2C0TA 1VQMQ 1YITQ 1ASYA 1NE8A 1TG0A 4M77C 2Q5HA 3LYIA 3CCQT 4XU2A 3RDVA 1W66A 2K3XA 3QDFA 1U5SA 4XTUA 1D0XA 2BUDA 1X75C 4R0KA 5D6YA 2RQTA 3CCJQ 3RKXA 1YGBA 2JS2A 2HMAA 2QGFB 2BE9B 2EBPA 2L3PA 2PVGB 5CIUA 1YHQQ 3MO8A 1N8RR 4Q6GA 3HRTA 2MWPA 5GAMj 3LC0A 5A2QE 2WSCE 3FJPA 4YRCA 4P75C 4TVAB 3L2WA 3QJ6A 2GTJA 3E1SA 3G1JA 4YCWA 2PMEA 1VQ6Q 1UEBA 3PE0A 4FU6A 4LVMA 4BD3A 3CC4Q 3LLRA 3HXVA 4JRQA 4IURA 4AFZC 2OTJT 4A63B 4M7AC 1HD3A 3WQZA 2KROA 4HCKA 3SB2A 3U23A 3OS2A 2IIMA 8ATCB 1KQSA 3FDRA 2J05A 1X6BA 1J3TA 4Z89A 3CCET 1W4SA 1M2OA 3KUFA 1OU8A 5AYFA 2DVEA 1YWOA 3FEOA 4CS4A 1IHWA 1PM3A 1VQ7T 1V76A 3GBQA 5GAN7 1VQPQ 1S1NA 5CCAA 4OMOA 1ASZA 4AFQC 2RJCA 3RESA 3GIBA 2HSEB 2C7IA 2R5MA 2B8AA 5FWCA 3UF4A 3EGXB 4TVWA 1ZUUA 1U1SA 1XOVA 3E9GA 4F16A 2P4TA 1ZSGA 3GPLA 2DFUA 1W1FA 3VUZA 1BIAA 4YRKA 4ME7A 5L23A 3IALA 4HT4A 1WGSA 4J15A 1GCQC 2KDSA 2OAWA 1KHCA 9ATCB 4E7KA 5CKEA 4FW1A 3RNJA 5CO7A 3CCQQ 1WHHA 3HTZA 1SG5A 1WHGA 2VXFA 1G5IA 1VQNT 2RD1A 4C0DC 2GTOA 1VUBA 2YRCA 2LCSA 2ZNJA 2XTIA 1M3CA 1ADJA 2OTLA 4CC2A 4ZGJB 3A5ZA 2X51A 3F70A 4EMKB 4ZGDB 3P8VA 1OV3A 1ZUYA 3R07A 2EGCA 1QP2A 3MKDA 1FMWA 3KFUA 4PK4A 1VQOA 2PUKB 1RAFB 3OS0A 2G3RA 1YFTA 1KIKA 2A36A 3UATA 3L2ZA 1Y7XA 2DL4A 2IY5B 1M5Q1 3TREA 2QTVA 1OYXA 1OZ2A 3I5SA 4M75D 2OTJQ 1YJ9A 4HCBA 3A98A 2JNGA 4G85A 2AMCB 1VQ5A 4UC4A 2L89A 4B6MA 4OLFA 5FU6B 2AHJB 5GAMe 3PCOB 4KGZB 1YIJT 2COYA 4RTYA 3REBB 3CCEQ 2DE0X 2GQIA 2K3YA 5DY9A 1W2BA 1D3BA 1BI3A 1ZSZB 3CD6A 3H41A 3R6NA 4NL3A 6AT1B 3S3OA 4M4ZA 3OS1A 1G51A 4H2XB 3PVLA 4KT0E 1VOMA 4RTXA 1VQ7Q 2DBMA 1P92A 1AWJA 4H2VA 2I4NA 2ROTA 3G4SA 3CC2A 4YCVA 1TTHB 2KRSA 5C0MA 1GFCA 2JM8A 2KBTA 1JJCA 3KXTA 3PMTA 3CCST 5IAYA 1M90C 1VQLT 4J9CA 2QDLA 4C92E 2J06A 2EWNA 1N5ZA 2EVRA 3J7AF 3LWHA 2CYZB 4GLKA 4KUIA 4A4FA 2E70A 2EQMA 2E1HA 2ZNIA 1WLPB 4CC7A 1ZSZA 2Y4YA 5KYYB 3VS6A 2JMCA 3L4GA 1JJ2P 3RERA 5ELOA 4XQ3A 5LJ5f 2DL5A 3JCMV 3L42A 2KRNA 3QZ5B 5LJ5g 1QE0A 4M7DG 1HXDA 1J5WA 4LD6A 3CC7T 4E6RA 1VQNQ 2KRMA 4OP0A 2KXCA 2VGMA 2YLCA 2QHUA 2HDAA 4E7IA 1YJWA 3N5BB 5LJ5h 2EAYA 5K1PA 3M55A 1PKSA 5CKHA 1MV0B 4D8DA 3JCMJ 2LMJA 4XU0A 3VKIA 5CKBA 1I0CA 3H0IA 3OYBA 1HTTA 1AEYA 5KCHA 5GANg 2YDLA 3P8BB 7AT1B 4LVJA 1PCXA 1IHVA 2D6FA 5HCKA 2QEXA 1T3LA 4MMKA 3CPWP 1TS9A 4C92A 2YUNA 4YRSA 5I2SA 2WSFE 3LX7A 5KYYA 3PIPA 1KJWA 3ZEHA 2ZIMA 1JQQA 5GANh 3OSVA 5KYWA 3UH0A 1U8RA 4JZ3A 1XQHA 1SRLA 2AZVA 1QQJA 5FW9A 1B3QA 2K6DA 2VKNA 1WFWA 3OYNA 3QBYA 1T3SA 1R8OB 3HTRA 4C5HA 3CMEA 1YIJQ 4CH5A 4XTZA 2NUZA 4LVLA 4PJMA 1YJNA 5IHIA 2XMFA 1UGVA 4LD9K 1BKBA 1SHGA 2O9VA 3OYCA 4KH1B 1Q86U 1MMAA 3D7SB 2ZT7A 3S3NA 4BACA 2OX7A 3CMAT 4C0ZA 4PJOG 3VS3A 1YI2A 3OYKA 2KNBB 1EIFA 4N0AA 2E6ZA 3UT1A 4M75F 2HL3A 1WZOA 2DF6A 1IL2A 2I4MA 3CCSQ 1M4ZA 1QWFA 3QIIA 4EO4A 2GNCA 1KFZA 3M0PA 4FL6A 3A8GB 1VQLQ 1IGQA 3ULRB 3VUBA 1ARKA 2G6FX 1V29B 4TTVA 4DOVA 1TSFA 4FIBA 1TU0B 2GFAA 5CQXA 1ACMB 4HCZA 3M4YA 2LC4A 3H8ZA 1KOGA 3I55T 4LVKA 1B7YB 3G71T 3MJXA 4ZTUB 1K8AC 1SKUB 2LZ6B 2CJBA 2RQUA 3REUA 4BWAA 1KQSP 3TVTA 3OB9A 4M77B 5LJ3e 1M2VB 5HK3A 4J6YA 3CC7Q 1D0ZA 3JSCA 1OI1A 4GY5A 1RLQC 2AKWA 4OMNA 4RCBA 3CCLA 5C51B 1R77A 4L87A 2NUPA 5CKDA 5LJ5j 3IKLA 2X4WA 1EQRA 4TQDA 1EFWA 3QDRB 2NWMA 5GAOq 4C8QE 4PHCA 4MMLA 1EVLA 4RKUE 5FRMA 3VQXA 4EMHA 4UPAA 3LH0A 2KVQG 3O8VA 1UJYA 3EFOB 3OSSC 3EGDB 4YRLA 1VQ8A 2RA2A 5EG2A 3LGFA 3I56T 3QSUA 4YDQA 1IGUA 2E4HA 4BUGA 3G6ET 5HGQA 4AFSC 1UJ0A 2MMPA 4OMPA 2KXDA 5D7UA 4QQ6A 3A8LB 2KAFA 4PL6A 4LDWA 2HKNA 1Q86R 3X25B 2YXYA 4LXCA 4M7AB 1WHMA 4M78G 3HRIA 4FCYA 3C95A 5D6XA 4FT4A 3AHUA 2MAMA 1D09B 2DKGA 5KYXB 2L8DA 1BB9A 1C1AA 2D0QB 2C0IA 4MZMA 1BBUA 3QO5A 3ICAA 2PZ1A 3M0UA 3VS1A 4DBQA 4XU1A 2NYSA 2EQUA 2FZCB 5FU7C 4Z02A 4C8QA 1YBYA 4C92C 3META 4H2WA 4JJNK 2H3EB 2ZCFB 3CMAQ 2RHIA 1UTIA 4J9HA 2XDDA 2FB7A 1VQKA 2ZZEA 3C0CA 1YITA 1VQMA 3BJUA 3CXCP 2YUPA 3JCMe 1LVKA 5GMKe 4P3PA 1M1FA 4YPFA 2HQEA 1AHJB 2LT1A 3M0RA 1NEBA 3CCJA 4OMLA 1OX8A 4XU3A 1O9SA 1K73C 3VYHB 4HCCA 1MMDA 1KHIA 3CPFA 5GAMh 1VIFA 1KC8C 2K57A 2F2WA 1UFFA 2NUTB 1WXBA 1RI9A 3NENA 3I55Q 5IXBA 3G71Q 1NJ5A 2ODRC 1PD0A 2ZXFA 3LSQA 1TUDA 2HBPA 4CH3A 1W2BP 3OYFA 2EYZA 2DXUA 1VQ6A 2HQXA 3C4SA 2PTKA 1NJIU 1FMKA 4C0DB 1K9MC 3CC4A 4N0AC 1PG5B 2CT3A 3ZFJA 1QVFS 2ARUA 4HVWA 2AKKA 4CC3A 1E6HA 2M1HA 2JMAA 1QLYA 2CIMA 4HXJA 2ZPGB 4J9DA 1CKAA 3H0FA 1X6OA 4F7UE 1X2KA 4ZTZB 4L5GA 2DBKA 1JB0E 4FYYB 3I56Q 1X69A 4OMMA 3MF2A 3BE3A 3X26B 3A8OB 3IKMB 2JTEA 3RMSA 2ABLA 5KCOA 4XTYA 4HVUA 4ZTJA 4CS2A 1N8RC 4AFUC 2JTMA 3TU4K 1VQPA 1PYSB 3EG2A 1SSHA 3MEWA 1LYLA 2EYYA 3EG9A 3ZL7C 1I5LA 3SHWA 2PUOB 1H8KA 2MPXC 2RHUA 4UP8A 2KQWA 4A4EA 2C8MA 1MNEA 1UGSB 4KR2A 5KYUA 1OOTA 1EVKA 1OZ3A 4WJ3M 1H3ZA 4JS5A 2ZR3A 3REXA 2EFIA 2JXBA 1WNLA 2DPPB 2DYBA 5C53B 2R57A 4DEYA 5HKCA 2CKKA 1I81A 2A37A 3M58A 4F7UA 4B9WA 2JTFA 1TUGB 3DLMA 1PYSA 4J5YA 4DPGA 3I7FA 2CDTA 2D0NA 4JRKA 4XTWA 1RL2A 4KGXB 2J6FA 3CCRA 1G2BA 3RGLA 2QHTA 4RMOA 1GRIA 3UGTA 1NJIR 4F14A 3OYDA 3OW2S 3HFZB 4HWOA 1G3YA 2A8EA 2RI3A 4X9DA 1WU7A 1B34A 2E5AA 1XNIA 5CK9A 4JLIA 1NYFA 1MHNA 4H2TA 2QI2A 4FSXA 3JCMX 4HVVA 4C8QC 4A4KA 1H4VB 1X43A 1EOVA 2JN0A 2FYKA 4P71A 3MP1A 4HWSA 2LRQA 2E3CA 1VQZA 1HC7A 4YRTA 3KFVA 2M02A 4NOYA 2WSEE 5GMKm 2OTJA 1WIEA 4M77D 4YRRA 2D1XA 3QO7A 1GBRA 1OEBA 1AZGB 2ARSA 2E12A 3NETA 3HFZA 4HT8A 1WPYA 3CCEA 5GAOr 2DERA 4PJOE 5GAN3 1M1GA 4HWPA 2A3LA 5LJ3f 2RF0A 1QF6A 4QT7A 5LJ3g 1VQ7A 1UHFA 2CP0A 1NEGA 2DRMA 3R6OA 1QWEA 2L5QA 4C8QD 1WQWA 1LJOA 1SSFA 1UG1A 1C6VX 4K88A 2DMOA 4DQ2A 2L0AA 2V8KA 4X9CA 3FRNA 5GANd 4LUEA 3A5ZB 3HHTB 4J83A 4BE2A 5CR2A 1G3WA 4M7AD 4F17A 1UGQB 1AWXA 4YTLA 2A28A 5A0GA 3NGPA 1B07A 3JCMQ 3S3MA 3MCAB 3ASKA 3M54A 3QYHB 4RG8A 2HKQB 2E5KA 1IXDA 4FT2A 4NL2A 1MV3A 1UGPB 2DM1A 2RJDA 2DYIA 5ECAA 4PJOA 1NYQA 3VYGA 1H3HA 1WLEA 5I21A 2CJ9A 5FROA 1QVGS 3L2UA 2K5LA 2RQWA 4DBHA 1VQNA 1ZX6A 2HSPA 4OMFB 3QHSA 5LL6S 2QHVA 5GMKl 5I11A 4HT9A 3CBPA 2V8IA 4RUGA 2FPFA 3TEEA 4RTUA 2ZGWA 2KYMA 1D3BB 4AG2C 2XICA 3BFMA 1A0NB 3EHRA 5GJVB 2RI5A 2E41A 4ZNXA 3CXCA 3JV3A 2QQAA 4HKEA 1L0WA 4E7JA 3JCMf 4PFOA 1UE9A 1PRMC 1I1JA 3RIRA 1U1TA 2HAXA 4LNPA 8AT1B 3JCMg 2I4LA 2QAZA 1VQ4T 1SESA 2OTLT 4IUQA 2F5TX 1EX4A 4KGVB 4QVDA 1JJCB 2MYSA 2RK1A 4K86A 1D1CA 1E7OA 3M4GA 2XD0A 3BDLA 3O5ZA 3JCMh 4PFZA 5GMKh 4Q15A 3QO3A 3L2VA 4OB0B 1VQOT 1YIJA 2QTXA 2DQ3A 4J8OA 1IREB 2G4CA 4M75G 3VJPA 3VS2A 2C0OA 1JJ2S 4P74A 1T0HA 5ELNA 5D6WA 3I35A 4OB1B 3I9QA 3SFMA 4ZGEB 2LTOA 3L4GB 3QO8A 1MGQA 1VQ5T 2JVVA 1ADYA 3UGQA 5M9OA 4EPCA 2VUBA 4P71C 5LJ3j 2O2OA 3MEUA 4M78A 3CCUT 2EYQA 4M77F 2YUOA 3JRZA 4J6XA 1GFDA 3HRKA 1W70A 3EFSA 1VQLA 4DBRA 5FWBA 2ATCB 1NJ8A 3A74A 3HKSA 1B7TA 1Q7YR 3QNEA 1OU9A 3C94A 5FU7B 2EKOA 4YRPA 1NG2A 4J9EA 1WJSA 4C92B 2DXTA 1PSEA 2EIFA 1EIYA 3SEMA 1VA7A 5FRNA 2E10A 3L2QA 5KYWB 1UGRB 5IHNA 4HWRA 3EH1A 1K0XA 2I4OA 3V8LA 1SF9A 3JCMW 4V2SA 3GOXA 3CC7A 1K1ZA 2RHXA 3REAB 5C52B 4AG1C 4C0FA 4E7LA 5J26A 4JDSA 1BCMA 3RR6A 5FLXE 3HRSA 4C5GA 2XGTA 4C5EA 4BE1A 3T9NA 1LPLA 1KMNA 3DLLA 4M7AF 3VQYA 2CH4W 1GBQA 4UP9A 4PJJA 2Q7HA 3VBBA 2P0QA 1U06A 3SDZA 1H641 4X5OA 4OMQA 5CAIA 3L1AA 2P4RA 2QQBA 5GAMd 1RLPC 1VQ4Q 2JZ2A 3CEYA 2EGEA 2OTLQ 2LQ8A 2RQVA 4PJOC 2F2XA 2ZZDA 3PMIA 2DL7A 4L6V5 5EC7A 2RH2A 4LE9A 3ZBDA 3NMZC 1NPPA 2K5IA 5GMKj 2SEMA 2DDZA 3QYGB 2MWOA 1RIQA 2LX7A 3CCVT 1Q82U 2QA4T 2DIQA 4RQFA 4O6JA 2X3XD 5L8RE 1G5VA 1MNDA 2ZZGA 4R56A 1RAIB 4BB7A 4DA4A 2RI2A 3W3SA 1SPKA 3PVQA 2DU5A 3BY7A 1MMGA 3WXMB 5KNNA 2ZZFA 2L3QA 1AWOA 1VQ5Q 4BW9A 3CMAA 1KD1R 2QK0A 4OGEA 2AKWB 4QQGA 3VS7A 5GMKi 2FVUA 1M30A 1YJNT 3CCUQ 1BBWA 2NUPB 1TWBA 2EW3A 2CZ7B 4Y92A 4YRNA 1G3TA 2J6KA 1R0CB 1BBZA 2EL9A 4F04B 1QMCA 2BZXA 4Z8AA 5KYNA 2LCCA 1B70A 4P74C 1Q86C 1C0AA 1YI2T 2CP5A 3I5RA 1X55A 3UDCA 2DA9A 2Q7GA 4K11A 3I55A 2LP5A 5IH2A 3G71A 4QW2A 2VV5A 4WI1A 2SRCA 4OF1A 3OW2A 3VQVA 1VYUA 4O2DA 1D1BA 4JLGA 1WX6A 4LUDA 1N9WA 1ABQA 4ELYC 1X56A 2J6OA 3VRZA 1V1CA 3HXXA 3QG1A 3WVEB 1UDLA 4M78C 5GAN5 1TH7A 4JJCA 3OD1A 2K9GA 1CKBA 2GQVA 3PGGA 1QCFA 4EIKA 2IG0A 2D9TA 3NHNA 4CH6A 4J9IA 1QP3A 1NJ2A 3A7AA 3GNGA 1YNZA 2X9HA 2LQWA 4LDYA 1VQ9A 1Q81U 3OYJA 2V1QA 4C8QB 3I56A 1Q82R 3QWXX 3M5AA 1RAGB 2BZ8A 2QG9B 2QXFA 2KYBA 3NPFA 1ZBJA 4FW2A 2KGTA 2LQNA 4X34A 4RDXA 3TEHA 1HJDA 2MI6A 1KG1A 2NS6A 3H0HA 2C06A 2EYXA 3M4QA 2CGHA 1YFNA 4OGCA 1VQ8T 1I07A 4BY6C 3HXWA 4XEMA 2W10A 1F1BB 4ELZC 2Q5IA 3A7UA 3CCVQ 3LSSA 3EGUA 2ED1A 2M16A 2CP6A 3GNFB 2QA4Q 1M3BA 3LWIA 2OJ2A 5HY6A 3E2UA 2RQRA 3BW1A 4RCCA 2M9UA 4P72A 3QWYA 2K3BA 1W2BS 4PKCC 4XTVA 4JPBW 3X28B 4RTZA 4H2SA 2EYWA 2HZYA 3RKYA 1ZLMA 3CCMT 1NLPC 2DK3A 2O9SA 1HSQA 1ZA1B 4JJBA 1M8VA 1YJNQ 3NELA 3E9HA 3P8YA 4OB2B 5GAN6 1G8XA 4CRIA 1ZBXA 2ZCEA 5F5WA 2FG0A 4FYWB 2XIDA 3VV0A 1GXIE 5I22A 2VASA 3SWNA 1YHQA 2Y90A 1FXXA 1QVGA 2HCKA 4Y91A 2RO0A 4G84A 1K9AA 2DJZA 1M1KR 2RHYA 1S72T 1Q81R 2FZGB 4XEOA 2FEIA 3HP9A 4C92D 2KE9A 2GFUA 4N4IA 3RBBB 3EG9B 4M75E
chains in the Genus database with same CATH topology
2LNVA 3WVDB 5IT9E 3P8HA 3OMGA 4C5IA 1YFSA 1H4TA 1JRIA 4MZPA 2RJFA 4BI3A 4R55A 4N4GA 3A31A 3VQWA 3JB9D 4PG3A 4IUUA 1NYRA 1E1TA 1Y07A 2DXCA 1USYA 4P73A 2EQJA 1X2GA 2X4JA 3DB3A 2X35A 2R5AA 4F7UB 1NJIC 1Y96A 2V8JA 2JOYA 2ODRD 3GLXA 3M57A 2YHTA 2YRVA 2L3RA 2CJAA 2E5QA 1BYMA 5C6SA 3CMQA 1NJ6A 2DIGA 1X54A 2CZ1B 2Y4XA 1QW1A 2LDMA 3J81E 3G1ZA 1WYDA 4H02A 3V8JA 1B34B 4M75A 3OYIA 3LW5E 2QQ9A 3M9QA 4WJ4A 1WJRA 3INZA 1SERA 4M7DE 3OS5A 3RL6A 4HA8A 2HNIA 4Y28E 2GCXA 1PSFA 4E51A 4LDVA 3CCQA 3MP6A 2Q7EA 3V7SA 4O5VA 3DSQA 1RI0A 4LVIA 1H4SA 3QZ9B 4P72C 4PLIA 3JB9J 2A7YA 3A8HB 3ME9A 4JS4A 2ZTGA 3CCRT 2PMFA 2O4XB 4BI4A 5K1XA 2O01E 3OYAA 2CS7A 4M7DA 2DZCA 1O75A 3HRUA 1N27A 1KMMA 1N9RA 3A7RA 3FC3A 2RK2A 3NTHA 4ZN1A 4QVZA 2ZT8A 3QKJA 2ALYB 3SWNC 3P8DA 4QQDA 4M77G 4N4HA 3C12A 4DOWA 3OY9A 3OYMA 5LJ5d 4AH6A 3M59A 3CBOA 1M9SA 2GF7A 3MF1A 4A54A 4OVAA 3V8KA 4PJOB 2XK0A 3PIOA 3HXUA 2O4XA 4C92F 5LJ3h 3UFGA 4ZTFA 3PFSA 2DTOA 4C8QG 4TVAA 1JBMA 4KQEA 3OBYA 2RHZA 3MEYA 4P3OA 2LVMA 4KUDK 4RG2A 3QPHA 3JB9F 3V7CA 2ALYA 1USYC 4P73C 4KBMB 4ZN3A 1VIEA 4J7IA 4M7AG 2F69A 4A4GA 2M0OA 5CKFA 4XTXA 3OYEA 2KMTA 2RJEA 1Q7YU 4YRJA 3HY1A 3MEVA 2X4XA 1WJQA 4OB3B 2ZINA 2K4YA 2HD0A 3OYLA 2KY9A 4YREA 4M75C 3NEMA 1ZQ1A 1XTDA 3NFCA 1FYFA 3RMQA 4FM4B 4IUTA 4M78E 2DD4A 5A0DA 2IVWA 1Q7YC 1VQ4A 1Y71A 4M78B 1KQ1A 3HSBA 3QJYA 3E9FA 4YROA 4PNOA 4K87A 1QVPA 2DO3A 2VGNA 3OBWA 3P8TA 2QHSA 3HPWA 3PNWC 1EIYB 3IG2A 3QUIA 3VU3C 3JB9I 3OYGA 2ARTA 1YJ9T 2ZPHB 4XAXB 3OYHA 2ZT5A 4JRIA 4TQFA 4TWAA 2DTHA 1M90U 4BY6B 4M7DC 2E64A 4EMKA 3CCUA 4BDZA 3CCSA 3CD6T 4NS5A 1UB4A 1I8FA 2LX9A 3CPWS 3A32A 2LT4A 2XKOC 2LCLA 4F7UG 1NJ1A 4YRFA 1G3SA 1YCYA 3G4ST 1KD1U 2IY5A 2I2LA 3CC2T 4MZTA 4BI8B 4LNSA 2XU8A 4MDXA 3A8MB 2P0LA 3X24B 4RMFA 2AMCA 3UWNA 3TUPA 4C8QF 3PCOA 2H3JA 4ATOA 5IN1A 3RACA 2PVOB 2FHDA 1BI0A 5GAN8 1KQ2A 4M7DD 2NLUA 2P5IA 4H2YA 2DTIA 1KD1C 4H2XA 5HK0A 2P0PA 3FLGA 1QVFA 2EJGA 4YRQA 1BI1A 2YLBA 1SETA 2CZ0B 1HK9A 3HFNA 1E24A 1YJWT 2P0KA 2ZT6A 3LGLA 3HY0A 3JCMP 4YRMA 5GANf 3FB9A 2XHCA 2EQKA 2DQ0A 3M53A 2QEXT 3CCVA 4JRPA 3Q1JA 2RB6A 3JCMb 2QA4A 5A0LA 3M56A 1NZ9A 4WF2A 3A5YA 4HWTA 2KSSA 4L59A 1B70B 1KQSS 3QXEB 4JUVA 4D6WA 5J39A 3CBMA 1GGMA 4B9XA 2E65A 2ZR2A 3QTCA 2RM4A 2DD5A 3CMET 4P5NA 1Z7NA 3E19A 2QDYB 5GAOn 3HXZA 3SD4A 4PJOD 1BIBA 1N6AA 3HXYA 4KULA 1Q82C 3MQZA 2RHSB 4IKFA 2VC8A 4BE0A 2EJ9A 1K8AU 1G5HA 3X20B 5KE2A 4EX5A 3OYYA 2BKDN 4VUBA 2PQWA 1E1OA 3JAME 1I4K1 2QQRA 3M4PA 1H4QA 2VYTA 1Z7MA 4IUPA 3MHXA 4TVRA 3V7RA 3TEHB 1E22A 2DZ9A 4NCXA 1LNXA 2DEQA 3EFRA 2K5FA 4EMKC 2PVDB 4M77E 4F7UF 2XG8D 1IZ6A 3NTIA 2RHSA 3RF1A 1LOJA 1N9SA 2DU7A 3UPUA 1M1KU 4A53A 3HFOA 1WQ7A 3HL8A 1FX7A 4CS3A 5CQYA 3CCLT 3CXCS 2EJFA 1ZHIA 3G6EA 4UP7A 4ZIBA 1X01A 3ERRA 3ER0A 4IUVA 5FU6C 2OAUA 1VQ9T 3DB4A 4YYEA 12ASA 2RHQB 4XK8E 2VXEA 1M1KC 4M7DF 5DLQE 4M78D 1B7YA 4EMGA 3SWNB 5GANj 2LQKA 1Q81C 4A4HA 4M7AE 1X2HA 4M77A 2J3MA 5GAOp 3JCMc 2K2VA 4CH4A 3L2RA 3CCMA 5DM7R 3NTKA 3OA6A 4E7HA 1ATIA 1K73U 2E6NA 3OQ5A 4P75A 3MEAA 1DJ7B 5KE3A 3PTAA 2RHQA 1KC8U 2J3LA 2BIVA 3OMCA 2CZ6B 5LJ3d 2R58A 4EDUA 2X4YA 1VQKT 1VQMT 1YITT 2XDBA 3J80E 5GAMf 4KR3A 1Y96B 3PT9A 4M7AA 3S6WA 1S72A 5GAMg 1K9MU 5GAOm 3CCJT 5J3BA 3MP8A 2WACA 5GAN4 1YB3A 1YHQT 2ZIOA 3FIFA 4J7FA 4Q5WA 3JB9H 2QQSA 4RQEA 5I2MA 2KK4A 2ZPFB 4PJOF 3EAEA 2DXBA 4HVCA 4C92G 4LDUA 4M75B 4YP0A 1FWZA 4LDXA 1VQ6T 4QVCA 3G7ZA 4TVYA 3CC4T 1N8RU 4II1A 2DAQA 3TCJA 4P3NA 2ZPEB 4PLLA 3JB9G 1NNHA 4H2UA 2PU9B 4C0GA 1JJ2A 2JUFA 5CVIA 3DKMA 3GP8A 1B8AA 1YFRA 5DLOA 2MF2A 3E9IA 1NPRA 3URGA 2ZPIB 5E3IA 4MDWA 3KBGA 3GF5A 4E47A 4J6WA 3JCMd 1VQPT 4CI0C 5LJ5e 2ZPBB 4YRIA 1SRYA 4YRGA 3TEGA 3BDUA 3PZCA 2XDPA 5KH6A 1BI2A 3CPWA 11ASA 4M7DB 2F5KA 2FL7A 5GAOl 3HFVA 2XI9A 5GAN2 5GANe 3H6ZA 4YCUA 3RKWA 4M78F 3RUXA 4BDYA 1ASYA 1NE8A 4M77C 2Q5HA 3LYIA 3CCQT 4XU2A 1W66A 2K3XA 4XTUA 2BUDA 1X75C 5D6YA 3RKXA 1YGBA 2PVGB 5CIUA 3MO8A 4Q6GA 3HRTA 2MWPA 5GAMj 3LC0A 5A2QE 2WSCE 3FJPA 4YRCA 4P75C 4TVAB 3L2WA 3QJ6A 3E1SA 4YCWA 2PMEA 1UEBA 4FU6A 4LVMA 4BD3A 3LLRA 3HXVA 4JRQA 4IURA 2OTJT 4M7AC 3WQZA 3SB2A 3OS2A 1KQSA 3FDRA 3CCET 1W4SA 3KUFA 5AYFA 2DVEA 3FEOA 4CS4A 1VQ7T 5GAN7 5CCAA 1ASZA 2RJCA 3RESA 3GIBA 2C7IA 2R5MA 2B8AA 4TVWA 1U1SA 1XOVA 3E9GA 2P4TA 3GPLA 3VUZA 1BIAA 4YRKA 4ME7A 3IALA 4HT4A 1WGSA 4J15A 2KDSA 1KHCA 4E7KA 5CKEA 5CO7A 3HTZA 2VXFA 1G5IA 1VQNT 2RD1A 4C0DC 1VUBA 2ZNJA 2XTIA 1ADJA 2OTLA 3A5ZA 4ZGJB 3F70A 4EMKB 4ZGDB 3P8VA 3R07A 1QP2A 3KFUA 1VQOA 2PUKB 3OS0A 2G3RA 1YFTA 3L2ZA 1Y7XA 2IY5B 1M5Q1 3TREA 1OYXA 1OZ2A 4M75D 1YJ9A 4HCBA 2JNGA 4G85A 2AMCB 1VQ5A 4UC4A 2L89A 4OLFA 5FU6B 2AHJB 5GAMe 3PCOB 1YIJT 2K3YA 5DY9A 1W2BA 1D3BA 1BI3A 3CD6A 4NL3A 1G51A 3S3OA 3OS1A 4H2XB 4KT0E 1P92A 4H2VA 2I4NA 3G4SA 3CC2A 4YCVA 5C0MA 1JJCA 3KXTA 3PMTA 3CCST 5IAYA 1M90C 1VQLT 4C92E 2EWNA 3J7AF 3LWHA 2CYZB 4GLKA 4KUIA 4A4FA 2E70A 2EQMA 2E1HA 2ZNIA 2Y4YA 3L4GA 3RERA 5ELOA 4XQ3A 5LJ5f 3JCMV 3L42A 3QZ5B 5LJ5g 1QE0A 4M7DG 1HXDA 1J5WA 4LD6A 3CC7T 4OP0A 2VGMA 2YLCA 2QHUA 4E7IA 1YJWA 3N5BB 5LJ5h 2EAYA 5K1PA 3M55A 5CKHA 3JCMJ 4XU0A 3VKIA 5CKBA 3OYBA 1HTTA 5KCHA 5GANg 4LVJA 3P8BB 2D6FA 2QEXA 4MMKA 4C92A 4YRSA 5I2SA 2WSFE 3LX7A 3PIPA 3ZEHA 2ZIMA 5GANh 3OSVA 3UH0A 1U8RA 1XQHA 3OYNA 3QBYA 1R8OB 4C5HA 3CMEA 4CH5A 4XTZA 4LVLA 1YJNA 4LD9K 1BKBA 3OYCA 1Q86U 2ZT7A 3S3NA 4BACA 3CMAT 4C0ZA 4PJOG 1YI2A 3OYKA 1EIFA 4N0AA 2E6ZA 3UT1A 4M75F 1IL2A 2I4MA 1M4ZA 3QIIA 4EO4A 4FL6A 3A8GB 3VUBA 4TTVA 1V29B 4DOVA 4FIBA 2GFAA 5CQXA 4HCZA 3M4YA 2LC4A 3H8ZA 1KOGA 3I55T 4LVKA 1B7YB 3G71T 4ZTUB 1K8AC 3REUA 2CJBA 4BWAA 3OB9A 4M77B 5LJ3e 5HK3A 4J6YA 3JSCA 1OI1A 4GY5A 2AKWA 4RCBA 3CCLA 5C51B 4L87A 5CKDA 5LJ5j 3IKLA 4TQDA 2X4WA 1EQRA 1EFWA 3QDRB 5GAOq 4C8QE 4PHCA 4MMLA 1EVLA 4RKUE 5FRMA 3VQXA 4EMHA 4UPAA 3LH0A 2KVQG 3O8VA 3OSSC 4YRLA 1VQ8A 2RA2A 5EG2A 3LGFA 3I56T 3QSUA 4YDQA 4BUGA 3G6ET 5HGQA 2MMPA 4QQ6A 3A8LB 2KAFA 4PL6A 4LDWA 3X25B 4M7AB 4M78G 3HRIA 3C95A 5D6XA 4FT4A 3AHUA 2MAMA 2DKGA 2L8DA 2D0QB 4MZMA 1BBUA 3QO5A 3ICAA 4XU1A 2EQUA 5FU7C 4Z02A 4C8QA 1YBYA 4C92C 3META 4H2WA 4JJNK 2ZCFB 2RHIA 2XDDA 2FB7A 1VQKA 2ZZEA 1YITA 1VQMA 3BJUA 3JCMe 5GMKe 4P3PA 1M1FA 4YPFA 2HQEA 1AHJB 2LT1A 3CCJA 4XU3A 1O9SA 1K73C 3VYHB 4HCCA 1KHIA 3CPFA 5GAMh 1VIFA 1KC8C 2K57A 3NENA 1NJ5A 2ODRC 2ZXFA 3LSQA 4CH3A 2HBPA 3OYFA 2DXUA 1VQ6A 2HQXA 3C4SA 1NJIU 4C0DB 1K9MC 3CC4A 4N0AC 3ZFJA 1QVFS 2ARUA 2M1HA 2CIMA 2ZPGB 1X6OA 4F7UE 4ZTZB 4L5GA 1JB0E 3MF2A 3X26B 3A8OB 3IKMB 3RMSA 5KCOA 4XTYA 4ZTJA 4CS2A 1N8RC 2JTMA 3TU4K 1VQPA 1PYSB 3MEWA 1LYLA 1I5LA 2PUOB 2RHUA 4UP8A 2KQWA 4A4EA 2C8MA 1UGSB 4KR2A 1EVKA 1OZ3A 4WJ3M 1H3ZA 4JS5A 2ZR3A 3REXA 2EFIA 1WNLA 2DPPB 5C53B 2R57A 5HKCA 2CKKA 1I81A 3M58A 4F7UA 4B9WA 2JTFA 3DLMA 1PYSA 4J5YA 4DPGA 3I7FA 4JRKA 4XTWA 1RL2A 3CCRA 3RGLA 2QHTA 4RMOA 3UGTA 3OYDA 3OW2S 3HFZB 4HWOA 1G3YA 2A8EA 2RI3A 4X9DA 1WU7A 1B34A 2E5AA 1XNIA 5CK9A 4JLIA 1MHNA 4H2TA 2QI2A 4FSXA 3JCMX 4C8QC 4A4KA 1H4VB 1EOVA 2JN0A 2FYKA 4P71A 3MP1A 4HWSA 2LRQA 2E3CA 1VQZA 1HC7A 4YRTA 4NOYA 2WSEE 5GMKm 2OTJA 4M77D 4YRRA 3QO7A 2ARSA 2E12A 3NETA 3HFZA 4HT8A 1WPYA 3CCEA 5GAOr 4PJOE 5GAN3 1M1GA 4HWPA 2A3LA 5LJ3f 1QF6A 5LJ3g 1VQ7A 3R6OA 2L5QA 4C8QD 1WQWA 1LJOA 1SSFA 4K88A 4DQ2A 2V8KA 4X9CA 3FRNA 5GANd 3A5ZB 3HHTB 4J83A 4BE2A 5CR2A 1G3WA 4M7AD 1UGQB 4YTLA 5A0GA 3JCMQ 3S3MA 3MCAB 3ASKA 3M54A 3QYHB 4RG8A 4FT2A 4NL2A 1UGPB 2RJDA 4PJOA 1NYQA 3VYGA 1WLEA 5I21A 2CJ9A 5FROA 1QVGS 3L2UA 2K5LA 1VQNA 4OMFB 3QHSA 5LL6S 2QHVA 5GMKl 4HT9A 3CBPA 2V8IA 3TEEA 2ZGWA 1D3BB 2XICA 3BFMA 2RI5A 2E41A 3CXCA 2QQAA 4HKEA 1L0WA 4E7JA 3JCMf 3RIRA 1U1TA 2HAXA 3JCMg 2I4LA 1VQ4T 1SESA 2OTLT 4IUQA 2F5TX 4QVDA 1JJCB 2RK1A 4K86A 3M4GA 2XD0A 3BDLA 3JCMh 5GMKh 4Q15A 3QO3A 3L2VA 4OB0B 1VQOT 1YIJA 2QTXA 2DQ3A 4J8OA 1IREB 2G4CA 4M75G 3VJPA 1JJ2S 4P74A 5ELNA 5D6WA 4OB1B 3SFMA 4ZGEB 2LTOA 3L4GB 3QO8A 1MGQA 1VQ5T 2JVVA 1ADYA 3UGQA 5M9OA 4EPCA 2VUBA 4P71C 5LJ3j 3MEUA 4M78A 3CCUT 2EYQA 4M77F 3JRZA 4J6XA 3HRKA 3EFSA 1VQLA 1NJ8A 3A74A 3HKSA 3QNEA 3C94A 5FU7B 2EKOA 4YRPA 1WJSA 4C92B 2DXTA 1PSEA 2EIFA 1EIYA 5FRNA 2E10A 3L2QA 1UGRB 4HWRA 2I4OA 3V8LA 3JCMW 4V2SA 3GOXA 3CC7A 2RHXA 5C52B 4C0FA 4E7LA 5J26A 4JDSA 5FLXE 3HRSA 4C5GA 2XGTA 4C5EA 4BE1A 3T9NA 1KMNA 3DLLA 4M7AF 3VQYA 4UP9A 2Q7HA 3VBBA 2P0QA 3SDZA 1H641 4X5OA 5CAIA 3L1AA 2QQBA 5GAMd 2JZ2A 3CEYA 2LQ8A 4PJOC 2ZZDA 3PMIA 4L6V5 2RH2A 3ZBDA 1NPPA 2K5IA 5GMKj 2DDZA 3QYGB 2MWOA 1RIQA 3CCVT 1Q82U 2QA4T 2DIQA 4RQFA 4O6JA 5L8RE 1G5VA 2ZZGA 4R56A 4BB7A 4DA4A 2RI2A 3W3SA 2DU5A 3BY7A 3WXMB 5KNNA 2ZZFA 4BW9A 3CMAA 4OGEA 2AKWB 4QQGA 5GMKi 2FVUA 1YJNT 1BBWA 2CZ7B 4YRNA 1G3TA 2EL9A 2LCCA 1B70A 4P74C 1Q86C 1C0AA 1YI2T 1X55A 3UDCA 2Q7GA 3I55A 3G71A 4QW2A 2VV5A 4WI1A 4OF1A 3OW2A 3VQVA 4O2DA 4JLGA 1N9WA 4ELYC 1X56A 3HXXA 3QG1A 3WVEB 4M78C 5GAN5 1TH7A 3OD1A 3PGGA 2GQVA 2IG0A 2D9TA 4CH6A 1QP3A 1NJ2A 3A7AA 3GNGA 4LDYA 1VQ9A 1Q81U 3OYJA 4C8QB 3I56A 3M5AA 2QXFA 4X34A 4RDXA 3TEHA 2MI6A 1KG1A 2NS6A 2C06A 3M4QA 2CGHA 4OGCA 1VQ8T 4BY6C 3HXWA 4XEMA 4ELZC 2Q5IA 3A7UA 3LSSA 2M16A 3GNFB 3LWIA 5HY6A 3BW1A 4RCCA 2M9UA 4P72A 1W2BS 4PKCC 4XTVA 3X28B 4H2SA 3RKYA 3CCMT 2DK3A 1M8VA 3NELA 3E9HA 3P8YA 4OB2B 5GAN6 4CRIA 1ZBXA 2ZCEA 5F5WA 2XIDA 3VV0A 1GXIE 3SWNA 1YHQA 2Y90A 1FXXA 1QVGA 4Y91A 2RO0A 4G84A 2DJZA 2RHYA 1S72T 4XEOA 3HP9A 4C92D 2GFUA 4N4IA 1B76A 4M75E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NET A;  3HFZ A;  4HT8 A;  1E1O A;  1I4K 1;  1WPY A;  3M4P A;  5GAO r;  1H4Q A;  4PJO E;  4H2V A;  2I4N A;  5GAN 3;  1Z7M A;  4HWP A;  5LJ3 f;  3V7R A;  4YCV A;  3TEH B;  1YFS A;  1E22 A;  1H4T A;  2DZ9 A;  1JRI A;  1QF6 A;  4NCX A;  1LNX A;  2DEQ A;  3EFR A;  5LJ3 g;  3A31 A;  1JJC A;  3VQW A;  4EMK C;  3JB9 D;  4PG3 A;  4M77 E;  4F7U F;  1NYR A;  1E1T A;  4C8Q D;  1WQW A;  1USY A;  1LJO A;  4P73 A;  2RHS A;  4C92 E;  3RF1 A;  1LOJ A;  4K88 A;  1N9S A;  2EWN A;  4DQ2 A;  1X2G A;  4X9C A;  2DU7 A;  4F7U B;  1Y96 A;  5GAN d;  2E1H A;  4A53 A;  2ZNI A;  2ODR D;  3HFO A;  1WQ7 A;  2YHT A;  4CS3 A;  2CJA A;  3L4G A;  4M7A D;  2EJF A;  3RER A;  5ELO A;  4XQ3 A;  3CMQ A;  5LJ5 f;  3JCM V;  1NJ6 A;  4UP7 A;  4ZIB A;  1X54 A;  1X01 A;  3ERR A;  3JCM Q;  5LJ5 g;  1QE0 A;  4M7D G;  1HXD A;  1J5W A;  3G1Z A;  4OP0 A;  1WYD A;  4H02 A;  3V8J A;  1B34 B;  4NL2 A;  4M75 A;  2YLC A;  2QHU A;  4YYE A;  12AS A;  2RHQ B;  4PJO A;  1NYQ A;  5LJ5 h;  2VXE A;  4WJ4 A;  2EAY A;  5K1P A;  1WLE A;  5I21 A;  2CJ9 A;  4M7D F;  3INZ A;  1SER A;  4M7D E;  3JCM J;  4M78 D;  4EMG A;  3SWN B;  5GAN j;  1B7Y A;  4XU0 A;  3RL6 A;  4M7A E;  4HA8 A;  1HTT A;  2HNI A;  5GAN g;  1X2H A;  4M77 A;  3QHS A;  2J3M A;  5GAO p;  5GMK l;  2QHV A;  4MMK A;  4HT9 A;  4C92 A;  4E51 A;  4YRS A;  3JCM c;  4CH4 A;  2ZGW A;  2ZIM A;  1D3B B;  2Q7E A;  3BFM A;  5GAN h;  3UH0 A;  2E41 A;  3V7S A;  3DSQ A;  1L0W A;  3JCM f;  3RIR A;  1U1T A;  1H4S A;  1ATI A;  4P75 A;  3JCM g;  2I4L A;  4P72 C;  1SES A;  3JB9 J;  2RHQ A;  4CH5 A;  4XTZ A;  4QVD A;  2J3L A;  1JJC B;  4K86 A;  5LJ3 d;  3M4G A;  2ZTG A;  2PMF A;  3JCM h;  5GMK h;  4Q15 A;  3QO3 A;  5K1X A;  2QTX A;  5GAM f;  2DQ3 A;  4M7D A;  2DZC A;  2ZT7 A;  2G4C A;  4M75 G;  4KR3 A;  1Y96 B;  4M7A A;  4P74 A;  1KMM A;  5GAM g;  5ELN A;  4PJO G;  5GAO m;  1N9R A;  3A7R A;  3L4G B;  4N0A A;  5GAN 4;  1YB3 A;  2ZIO A;  4M75 F;  3QO8 A;  3FIF A;  2ZT8 A;  3JB9 H;  1IL2 A;  2I4M A;  1MGQ A;  2ALY B;  3SWN C;  4EO4 A;  4RQE A;  4PJO F;  4M77 G;  1ADY A;  3UGQ A;  5LJ5 d;  4AH6 A;  4HVC A;  4P71 C;  4C92 G;  5LJ3 j;  3MF1 A;  4A54 A;  4M75 B;  3V8K A;  4TTV A;  4YP0 A;  4M78 A;  4PJO B;  4M77 F;  3HXU A;  4J6X A;  3HRK A;  3EFS A;  1KOG A;  4C92 F;  4QVC A;  1B7Y B;  1NJ8 A;  3A74 A;  4TVY A;  4ZTU B;  3REU A;  2CJB A;  4BWA A;  5LJ3 h;  3UFG A;  4P3N A;  4M77 B;  3QNE A;  5LJ3 e;  3JB9 G;  4J6Y A;  1NNH A;  4H2U A;  4YRP A;  2DTO A;  4C92 B;  2DXT A;  4C8Q G;  4TVA A;  1JBM A;  4KQE A;  1EIY A;  2AKW A;  4RCB A;  3MEY A;  5C51 B;  4P3O A;  4L87 A;  2E10 A;  5LJ5 j;  3IKL A;  4TQD A;  3JB9 F;  1EQR A;  3V7C A;  4HWR A;  1EFW A;  2I4O A;  2ALY A;  3V8L A;  5GAO q;  1B8A A;  1YFR A;  3JCM W;  4V2S A;  1USY C;  4C8Q E;  4P73 C;  4PHC A;  4MML A;  3E9I A;  1EVL A;  5C52 B;  3VQX A;  4EMH A;  4UPA A;  5E3I A;  4M7A G;  4YRL A;  2RA2 A;  4J6W A;  3JCM d;  4XTX A;  2XGT A;  3QSU A;  4YDQ A;  5LJ5 e;  1KMN A;  4YRI A;  1SRY A;  4YRG A;  4M7A F;  3TEG A;  4YRJ A;  3HY1 A;  3VQY A;  3BDU A;  5HGQ A;  3PZC A;  4UP9 A;  2Q7H A;  11AS A;  4M7D B;  2ZIN A;  3VBB A;  4M7A B;  5GAO l;  1H64 1;  4M78 G;  3HRI A;  4X5O A;  4YRE A;  5CAI A;  3L1A A;  4M75 C;  3HFV A;  3NEM A;  5GAM d;  3AHU A;  5GAN 2;  4PJO C;  1FYF A;  2DKG A;  5GAN e;  4YCU A;  3RKW A;  1BBU A;  3QO5 A;  3ICA A;  4M78 F;  3RUX A;  4M78 E;  5GMK j;  1ASY A;  4XU1 A;  2DDZ A;  4M77 C;  2Q5H A;  1RIQ A;  4C8Q A;  4XU2 A;  4C92 C;  4M78 B;  1W66 A;  4H2W A;  4RQF A;  1KQ1 A;  3HSB A;  4XTU A;  2ZZG A;  4YRO A;  2FB7 A;  4PNO A;  3RKX A;  4K87 A;  2ZZE A;  1YGB A;  3BJU A;  3W3S A;  3JCM e;  2DU5 A;  5GMK e;  3BY7 A;  4Q6G A;  4P3P A;  5GAM j;  3LC0 A;  4YPF A;  5KNN A;  2ZZF A;  4BW9 A;  3P8T A;  2QHS A;  3FJP A;  4YRC A;  4P75 C;  4TVA B;  1EIY B;  3IG2 A;  2AKW B;  4XU3 A;  3QUI A;  3VU3 C;  3JB9 I;  5GMK i;  1BBW A;  2ART A;  4YCW A;  2PME A;  5GAM h;  2ZT5 A;  2K57 A;  4JRI A;  4TQF A;  4YRN A;  3NEN A;  4TWA A;  2DTH A;  1NJ5 A;  2ODR C;  3HXV A;  2ZXF A;  4M7D C;  2EL9 A;  2E64 A;  3LSQ A;  4CH3 A;  4EMK A;  4M7A C;  1B70 A;  4P74 C;  3WQZ A;  1C0A A;  1X55 A;  2DXU A;  3SB2 A;  2Q7G A;  4N0A C;  1I8F A;  3A32 A;  2ARU A;  4WI1 A;  4F7U G;  1NJ1 A;  4YRF A;  3VQV A;  1YCY A;  2IY5 A;  2I2L A;  4O2D A;  2DVE A;  2CIM A;  1N9W A;  4CS4 A;  4LNS A;  1X56 A;  3HXX A;  4M78 C;  5GAN 5;  2P0L A;  4F7U E;  1TH7 A;  5GAN 7;  3OD1 A;  4ZTZ B;  4RMF A;  2AMC A;  3TUP A;  4C8Q F;  3MF2 A;  1ASZ A;  3PGG A;  3PCO A;  3RES A;  3IKM B;  3GIB A;  4CH6 A;  2C7I A;  3RAC A;  1NJ2 A;  3A7A A;  4XTY A;  4CS2 A;  5GAN 8;  1KQ2 A;  1PYS B;  4M7D D;  4C8Q B;  4TVW A;  1U1S A;  2P5I A;  4H2Y A;  2DTI A;  1LYL A;  4H2X A;  1I5L A;  4UP8 A;  2C8M A;  4KR2 A;  4RDX A;  2EJG A;  3TEH A;  4YRQ A;  2YLB A;  1BIA A;  1SET A;  4YRK A;  1EVK A;  3IAL A;  3M4Q A;  2CGH A;  4J15 A;  1HK9 A;  3HFN A;  3HXW A;  1E24 A;  4XEM A;  4WJ3 M;  2Q5I A;  2ZR3 A;  3REX A;  3A7U A;  3LSS A;  2ZT6 A;  1WNL A;  3HY0 A;  3JCM P;  3HTZ A;  5GAN f;  4YRM A;  2VXF A;  1G5I A;  5C53 B;  3FB9 A;  2RD1 A;  3BW1 A;  4RCC A;  1I81 A;  4F7U A;  2ZNJ A;  4P72 A;  2XTI A;  2DQ0 A;  1ADJ A;  4XTV A;  3A5Z A;  2RB6 A;  3JCM b;  4J5Y A;  1PYS A;  4H2S A;  4DPG A;  4WF2 A;  4EMK B;  3A5Y A;  3I7F A;  3P8V A;  3RKY A;  4HWT A;  1B70 B;  4JRK A;  3R07 A;  4XTW A;  4JUV A;  3RGL A;  2QHT A;  3KFU A;  3UGT A;  1M8V A;  3HFZ B;  4HWO A;  3NEL A;  3E9H A;  3P8Y A;  5GAN 6;  1YFT A;  4X9D A;  1WU7 A;  1GGM A;  1B34 A;  2E5A A;  3L2Z A;  2E65 A;  2ZR2 A;  3QTC A;  2IY5 B;  2RM4 A;  1M5Q 1;  4JLI A;  2ZCE A;  4H2T A;  5F5W A;  3JCM X;  1Z7N A;  4C8Q C;  4M75 D;  3SWN A;  5GAO n;  3HXZ A;  2Y90 A;  1BIB A;  4PJO D;  1EOV A;  1H4V B;  3HXY A;  4G85 A;  2AMC B;  4Y91 A;  2RHS B;  2JN0 A;  2FYK A;  4OLF A;  4G84 A;  4P71 A;  4HWS A;  5GAM e;  3PCO B;  2E3C A;  1VQZ A;  1HC7 A;  4YRT A;  4NOY A;  2DJZ A;  5GMK m;  2VC8 A;  4M77 D;  4YRR A;  5DY9 A;  1D3B A;  2EJ9 A;  1G5H A;  3QO7 A;  4EX5 A;  4XEO A;  4C92 D;  4NL3 A;  1G51 A;  4H2X B;  2ARS A;  1B76 A;  4M75 E; 
#chains in the Genus database with same CATH topology
 2LNV A;  2HEQ A;  3WVD B;  5IT9 E;  3P8H A;  3OMG A;  4C5I A;  1MMN A;  1YFS A;  5KYU B;  1H4T A;  1JRI A;  1UEC A;  4MZP A;  2RJF A;  4BI3 A;  4R55 A;  1OX9 A;  4N4G A;  3A31 A;  3VQW A;  1TUC A;  3JB9 D;  4PG3 A;  2DEU A;  4IUU A;  2K79 A;  1NYR A;  1E1T A;  1Y07 A;  2DXC A;  1X6G A;  1USY A;  4P73 A;  2EQJ A;  1LCK A;  1X2G A;  2X4J A;  3DB3 A;  2X35 A;  3G6E Q;  2R5A A;  4F7U B;  1NJI C;  1Y96 A;  2MCN A;  3M0S A;  2V8J A;  2JOY A;  2ODR D;  3GLX A;  3M57 A;  2GGR A;  2YHT A;  2YRV A;  3VS0 A;  2L3R A;  2CJA A;  2E5Q A;  2EKH A;  1BYM A;  5C6S A;  3CMQ A;  1VQ8 Q;  4GLM A;  1NJ6 A;  2DIG A;  1X54 A;  2CZ1 B;  2Y4X A;  1QW1 A;  2LDM A;  3J81 E;  2ROL A;  3G1Z A;  1WYD A;  4IIM A;  4H02 A;  3V8J A;  1B34 B;  4M75 A;  3OYI A;  3LW5 E;  2QQ9 A;  2P84 A;  3M9Q A;  4WJ4 A;  2JJ9 A;  2YSQ A;  1WJR A;  1CSK A;  2H8H A;  1BCO A;  3INZ A;  1SER A;  4M7D E;  3OS5 A;  2VVK A;  3CCM Q;  3RL6 A;  4HA8 A;  3EG0 A;  2HNI A;  4Y28 E;  2GCX A;  1PSF A;  4E51 A;  4LDV A;  3CCQ A;  2CH4 A;  3MP6 A;  2Q7E A;  1K9M R;  1WDX A;  1RAA B;  3V7S A;  4O5V A;  1X2Q A;  3DSQ A;  1RI0 A;  4LVI A;  1C0M A;  1H4S A;  4JJD A;  2FRY A;  3QZ9 B;  1SEM A;  4P72 C;  4PLI A;  2YUQ A;  3JB9 J;  4PFP A;  4E2F B;  1JO8 A;  2A7Y A;  3A8H B;  3CQT A;  2ESW A;  1S72 Q;  3ME9 A;  4IIO A;  4JS4 A;  1JEG A;  2ZTG A;  2EPD A;  3CCR T;  3AT1 B;  2PMF A;  2O4X B;  4BI4 A;  5K1X A;  2O01 E;  3OYA A;  2AIR B;  2DLP A;  2CS7 A;  4M7D A;  2DZC A;  1O75 A;  4WTO B;  3HRU A;  1I5O B;  1N27 A;  1KMM A;  4RTW A;  1N9R A;  1AWW A;  2A08 A;  1BK2 A;  1IB8 A;  3A7R A;  3FC3 A;  2RK2 A;  3NTH A;  4ZN1 A;  2BE7 D;  4QVZ A;  2ZT8 A;  3QKJ A;  2ALY B;  3SWN C;  2F1L A;  3P8D A;  4QQD A;  2L3S A;  4M77 G;  4J9G A;  2KT8 A;  2ZAE A;  3EG3 A;  4N4H A;  3C12 A;  4DOW A;  3OY9 A;  3OYM A;  5LJ5 d;  4AH6 A;  3M59 A;  1TOV A;  1M9S A;  3CBO A;  2GF7 A;  3MF1 A;  4A54 A;  1M8M A;  4OVA A;  3V8K A;  4PJO B;  2XK0 A;  4E7S A;  3PIO A;  3HXU A;  2LJ3 A;  2X3W D;  4ANJ A;  3EH2 A;  2AT1 B;  2O4X A;  4C92 F;  5LJ3 h;  3UFG A;  4ZTF A;  3PFS A;  3OW2 P;  2DTO A;  3UA7 A;  4C8Q G;  4TVA A;  1JBM A;  2OI3 A;  2VB6 A;  4KQE A;  3OBY A;  2COW A;  2RHZ A;  3MEY A;  4P3O A;  2LJ1 A;  2LVM A;  2DJQ A;  4KUD K;  4RG2 A;  3QPH A;  1RAH B;  1ZA2 B;  3V7C A;  3JB9 F;  2ALY A;  1KK7 A;  1WXT A;  4J9F A;  1USY C;  4P73 C;  4KBM B;  4ZN3 A;  1AT1 B;  1VIE A;  2D8J A;  4J7I A;  4M7A G;  5AT1 B;  2F69 A;  2JM9 A;  4A4G A;  2M0O A;  5CKF A;  4AMC A;  3VRY A;  4DEX A;  4XTX A;  1RAE B;  2LNH B;  4DBF A;  2I0N A;  3OYE A;  2KMT A;  2RJE A;  1Q7Y U;  4YRJ A;  3HY1 A;  1D0Y A;  1YN8 A;  1YWP A;  1UUE A;  1JXM A;  3MEV A;  2X4X A;  1WJQ A;  4OB3 B;  2ZIN A;  2K4Y A;  2HD0 A;  2CSI A;  3OYL A;  2KY9 A;  4YRE A;  1GCP A;  1WI7 A;  4M75 C;  3NEM A;  1ZQ1 A;  2GBQ A;  4X1V A;  1XTD A;  2COZ A;  3NFC A;  1FYF A;  3VS4 A;  3RMQ A;  2DVJ A;  4QKU A;  2CP3 A;  4FM4 B;  4IUT A;  4M78 E;  3CCR Q;  2DD4 A;  5A0D A;  1D1A A;  2IVW A;  2K7A A;  1Q7Y C;  1VQ4 A;  3A1P A;  1Y0M A;  1Y71 A;  3EGX A;  2JS0 A;  2HL5 C;  2CRE A;  4M78 B;  4FSS A;  1KQ1 A;  2RNA A;  3HSB A;  3IQL A;  3E9F A;  3QJY A;  4YRO A;  2MIO A;  4PNO A;  4K87 A;  2V1R A;  1QVP A;  2DO3 A;  2O88 A;  2VGN A;  4ESR A;  3OBW A;  3P8T A;  2QHS A;  1UHC A;  4KH0 B;  2QAS A;  2FZK B;  3HPW A;  3PNW C;  1EIY B;  3IG2 A;  3QUI A;  3VU3 C;  3JB9 I;  3TQ7 P;  2KEA A;  3OYG A;  1OQK A;  2ART A;  1YJ9 T;  2ZPH B;  4XAX B;  1PD1 A;  1K76 A;  3OYH A;  2ZT5 A;  1U3O A;  4JRI A;  2DIL A;  1QVG P;  4TQF A;  4TWA A;  2DTH A;  1M90 U;  4BY6 B;  4M7D C;  1NM7 A;  2E64 A;  2AKL A;  2B86 A;  4EMK A;  3CCU A;  2ED0 A;  4BDZ A;  2DET A;  3CCS A;  2ECZ A;  2CP7 A;  3CD6 T;  1G83 A;  4NS5 A;  3FJ5 A;  1AD5 A;  1Z9Z A;  1UB4 A;  1I8F A;  2LX9 A;  3CPW S;  3A32 A;  1RAB B;  2LT4 A;  4D8K A;  2XKO C;  2LCL A;  4F7U G;  1NJ1 A;  1QKW A;  4YRF A;  1VYV A;  3LH5 A;  1G3S A;  1NYG A;  1YCY A;  3G4S T;  1KD1 U;  2IY5 A;  2I2L A;  3CC2 T;  4MZT A;  4BI8 B;  4LNS A;  2XU8 A;  4MDX A;  3A8M B;  1WHJ A;  3VS5 A;  2P0L A;  3X24 B;  2HBW A;  4RMF A;  4CC4 B;  2AMC A;  3UWN A;  3TUP A;  4C8Q F;  3PCO A;  2H3J A;  4ATO A;  1SHF A;  5IN1 A;  3RAC A;  2PVO B;  2FHD A;  1BI0 A;  1SRM A;  5GAN 8;  1KQ2 A;  1IRX A;  4M7D D;  2NLU A;  2PNI A;  3EG1 A;  2P5I A;  4H2Y A;  2DTI A;  1QCN A;  1KD1 C;  4H2X A;  5HK0 A;  2L2P A;  2A0F B;  2P0P A;  1KSW A;  3FLG A;  1QCO A;  2KT1 A;  1OUL A;  1QVF A;  2EJG A;  4YRQ A;  1BI1 A;  2JW4 A;  2YLB A;  1SET A;  2VWF A;  2CZ0 B;  2CUB A;  2O31 A;  1HK9 A;  3HFN A;  1W6X A;  1YJW T;  2CSQ A;  1E24 A;  1PWT A;  2P0K A;  2ZT6 A;  3LGL A;  3HY0 A;  1XJW B;  3JCM P;  4YRM A;  5GAN f;  2D8H A;  3FB9 A;  2XHC A;  3M0Q A;  2EQK A;  2DNU A;  1JU5 C;  1HYO A;  2CT4 A;  1OPL A;  2DQ0 A;  3M53 A;  2QEX T;  1VQO Q;  2E3H A;  3CCV A;  4JRP A;  2DL8 A;  3Q1J A;  2RB6 A;  3JCM b;  2QA4 A;  5A0L A;  1M90 R;  3M56 A;  1NZ9 A;  4WF2 A;  3A5Y A;  4HWT A;  2KSS A;  4L59 A;  1B70 B;  1RAC B;  3EHQ A;  2K2M A;  2DX1 A;  2CP2 A;  2J7I A;  1KQS S;  3QXE B;  4JUV A;  4D6W A;  1NLO C;  2FO0 A;  3TSZ A;  4AT1 B;  1EFN A;  2F2V A;  1ZUK A;  5J39 A;  3CBM A;  1MUZ A;  1YJ9 Q;  1GGM A;  4B9X A;  4FYV B;  2E65 A;  2ZR2 A;  3QTC A;  2ENM A;  2RM4 A;  2DD5 A;  3CME T;  4P5N A;  1Z7N A;  3UA6 A;  2M0Y A;  3E19 A;  2QDY B;  2RN8 A;  4PJN A;  1Q95 G;  1PC0 A;  5GAO n;  3HXZ A;  3SD4 A;  1BIB A;  1N6A A;  4PJO D;  3HXY A;  4KUL A;  1Q82 C;  3MQZ A;  1WYX A;  2RHS B;  3CD6 Q;  2QYZ A;  4IKF A;  1EZZ B;  2LJ0 A;  2VC8 A;  4BE0 A;  2EJ9 A;  3G4S Q;  1K8A U;  1G5H A;  1PHT A;  3X20 B;  5KE2 A;  1TXQ A;  3CC2 Q;  4EX5 A;  1NBE B;  3OYY A;  2BKD N;  3MPU B;  4VUB A;  2DL3 A;  2PQW A;  1AVZ C;  1E1O A;  3JAM E;  1I4K 1;  2QQR A;  3M4P A;  1H4Q A;  5GJW B;  2VYT A;  1Z7M A;  4IUP A;  3MHX A;  4TVR A;  2DRK A;  3V7R A;  3TEH B;  1E22 A;  1OPK A;  2DZ9 A;  4NCX A;  1LNX A;  2DEQ A;  3EFR A;  2K5F A;  2FPE A;  4EMK C;  2PVD B;  4M77 E;  4F7U F;  2XG8 D;  1RAD B;  1IZ6 A;  3NTI A;  2RHS A;  3RF1 A;  1LOJ A;  3H9N A;  1N9S A;  2EQI A;  1IO6 A;  2DU7 A;  3UPU A;  1M1K U;  4A53 A;  2V26 A;  5IHK A;  3HFO A;  1WQ7 A;  3HL8 A;  1FX7 A;  4CS3 A;  5CQY A;  3CCL T;  3CXC S;  2EJF A;  1RUW A;  2JT4 A;  1YJW Q;  1ZHI A;  3G6E A;  4UP7 A;  1WA7 A;  4ZIB A;  4PJL A;  1X01 A;  3ERR A;  1AZE A;  3ER0 A;  1B76 A;  5IXF A;  4IUV A;  1VYT A;  5FU6 C;  2OAU A;  2YRD A;  2CUD A;  4J9B A;  1H92 A;  1VQ9 T;  3DB4 A;  4YYE A;  12AS A;  1M27 C;  1Y57 A;  2RHQ B;  4XK8 E;  1FYN A;  1WHK A;  2VXE A;  2QEX Q;  1M1K C;  2KR3 A;  1GL5 A;  4M7D F;  1ZSZ C;  5DLQ E;  4M78 D;  4EMG A;  3SWN B;  2M51 A;  2LQK A;  5GAN j;  1Q81 C;  1B7Y A;  4A4H A;  4M7A E;  1R0B G;  1X2H A;  4M77 A;  2KI7 A;  4ORZ A;  1M2V A;  2J3M A;  5GAO p;  2FRW A;  3JCM c;  2K2V A;  4CH4 A;  4FYX B;  3L2R A;  1X27 A;  3CCM A;  1K8A R;  1WXU A;  3CME Q;  5DM7 R;  1PRL C;  2BTT A;  1Z9Q A;  3NTK A;  3OA6 A;  4E7H A;  1ATI A;  1K73 U;  2QGG A;  2E6N A;  3EFO A;  3EGD A;  3OQ5 A;  4P75 A;  3MEA A;  1DJ7 B;  5KE3 A;  3PTA A;  2MK5 A;  2RHQ A;  1KC8 U;  2J3L A;  2BIV A;  3OMC A;  4RTT A;  2CZ6 B;  5LJ3 d;  2R58 A;  4EDU A;  2AZS A;  1YI2 Q;  2X4Y A;  1VQK T;  1VQM T;  1YIT T;  2XDB A;  3J80 E;  1BU1 A;  5GAM f;  3THK A;  1QKX A;  2E3I A;  4KR3 A;  1Y96 B;  3PT9 A;  4M7A A;  3S6W A;  1S72 A;  4KRT A;  5GAM g;  1K9M U;  5GAO m;  1E6G A;  3CCJ T;  3TSW A;  5J3B A;  4E7Z A;  3MP8 A;  2WAC A;  5KYX A;  2FPD A;  5GAN 4;  1YB3 A;  1YHQ T;  2ZIO A;  1YCS B;  2EGA A;  3FIF A;  4J7F A;  4Q5W A;  3JB9 H;  2QQS A;  4RQE A;  2W0Z A;  5I2M A;  2KK4 A;  2ZPF B;  4PJO F;  2BZY A;  3EAE A;  2DXB A;  4HVC A;  4C92 G;  4LDU A;  4M75 B;  1AOJ A;  4YP0 A;  1FWZ A;  4LDX A;  1VQ6 T;  1K0S A;  4QVC A;  2IPO B;  3CCL Q;  3G7Z A;  4TVY A;  3CC4 T;  1N8R U;  2RMO A;  4II1 A;  1FMV A;  2HQH A;  1WHL A;  2DAQ A;  3TCJ A;  4P3N A;  2ZPE B;  1ABO A;  4PLL A;  3JB9 G;  1NNH A;  4H2U A;  2PU9 B;  1M3A A;  4C0G A;  1YP5 A;  1JJ2 A;  2JUF A;  1VQ9 Q;  5CVI A;  3DKM A;  3GP8 A;  4Z88 A;  1B8A A;  2YWW A;  2NUT A;  1YFR A;  5DLO A;  1PKT A;  2MF2 A;  3E9I A;  1K4U S;  1NPR A;  3URG A;  4JZ4 A;  2ZPI B;  5E3I A;  4MDW A;  2MOX A;  1GCQ A;  3KBG A;  1K73 R;  3GF5 A;  4E47 A;  4J6W A;  3JCM d;  1VQP T;  4WCI A;  3M0T A;  2Z0W A;  4CI0 C;  1KC8 R;  1JXO A;  5LJ5 e;  2ZPB B;  4YRI A;  1SRY A;  4YRG A;  3TEG A;  3BDU A;  3PZC A;  2XDP A;  5KH6 A;  4RTV A;  4LN2 A;  1BI2 A;  3CPW A;  11AS A;  4M7D B;  2F5K A;  1QVF P;  2FL7 A;  2RPN A;  5GAO l;  2AK5 A;  4GBQ A;  3HFV A;  2XI9 A;  5GAN 2;  1PNJ A;  5GAN e;  3H6Z A;  4YCU A;  3RKW A;  2YT6 A;  1T0J A;  4M78 F;  3RUX A;  4BDY A;  1VQK Q;  2C0T A;  1VQM Q;  1YIT Q;  1ASY A;  1NE8 A;  1TG0 A;  4M77 C;  2Q5H A;  3LYI A;  3CCQ T;  4XU2 A;  3RDV A;  1W66 A;  2K3X A;  3QDF A;  1U5S A;  4XTU A;  1D0X A;  2BUD A;  1X75 C;  4R0K A;  5D6Y A;  2RQT A;  3CCJ Q;  3RKX A;  1YGB A;  2JS2 A;  2HMA A;  2QGF B;  2BE9 B;  2EBP A;  2L3P A;  2PVG B;  5CIU A;  1YHQ Q;  3MO8 A;  1N8R R;  4Q6G A;  3HRT A;  2MWP A;  5GAM j;  3LC0 A;  5A2Q E;  2WSC E;  3FJP A;  4YRC A;  4P75 C;  4TVA B;  3L2W A;  3QJ6 A;  2GTJ A;  3E1S A;  3G1J A;  4YCW A;  2PME A;  1VQ6 Q;  1UEB A;  3PE0 A;  4FU6 A;  4LVM A;  4BD3 A;  3CC4 Q;  3LLR A;  3HXV A;  4JRQ A;  4IUR A;  4AFZ C;  2OTJ T;  4A63 B;  4M7A C;  1HD3 A;  3WQZ A;  2KRO A;  4HCK A;  3SB2 A;  3U23 A;  3OS2 A;  2IIM A;  8ATC B;  1KQS A;  3FDR A;  2J05 A;  1X6B A;  1J3T A;  4Z89 A;  3CCE T;  1W4S A;  1M2O A;  3KUF A;  1OU8 A;  5AYF A;  2DVE A;  1YWO A;  3FEO A;  4CS4 A;  1IHW A;  1PM3 A;  1VQ7 T;  1V76 A;  3GBQ A;  5GAN 7;  1VQP Q;  1S1N A;  5CCA A;  4OMO A;  1ASZ A;  4AFQ C;  2RJC A;  3RES A;  3GIB A;  2HSE B;  2C7I A;  2R5M A;  2B8A A;  5FWC A;  3UF4 A;  3EGX B;  4TVW A;  1ZUU A;  1U1S A;  1XOV A;  3E9G A;  4F16 A;  2P4T A;  1ZSG A;  3GPL A;  2DFU A;  1W1F A;  3VUZ A;  1BIA A;  4YRK A;  4ME7 A;  5L23 A;  3IAL A;  4HT4 A;  1WGS A;  4J15 A;  1GCQ C;  2KDS A;  2OAW A;  1KHC A;  9ATC B;  4E7K A;  5CKE A;  4FW1 A;  3RNJ A;  5CO7 A;  3CCQ Q;  1WHH A;  3HTZ A;  1SG5 A;  1WHG A;  2VXF A;  1G5I A;  1VQN T;  2RD1 A;  4C0D C;  2GTO A;  1VUB A;  2YRC A;  2LCS A;  2ZNJ A;  2XTI A;  1M3C A;  1ADJ A;  2OTL A;  4CC2 A;  4ZGJ B;  3A5Z A;  2X51 A;  3F70 A;  4EMK B;  4ZGD B;  3P8V A;  1OV3 A;  1ZUY A;  3R07 A;  2EGC A;  1QP2 A;  3MKD A;  1FMW A;  3KFU A;  4PK4 A;  1VQO A;  2PUK B;  1RAF B;  3OS0 A;  2G3R A;  1YFT A;  1KIK A;  2A36 A;  3UAT A;  3L2Z A;  1Y7X A;  2DL4 A;  2IY5 B;  1M5Q 1;  3TRE A;  2QTV A;  1OYX A;  1OZ2 A;  3I5S A;  4M75 D;  2OTJ Q;  1YJ9 A;  4HCB A;  3A98 A;  2JNG A;  4G85 A;  2AMC B;  1VQ5 A;  4UC4 A;  2L89 A;  4B6M A;  4OLF A;  5FU6 B;  2AHJ B;  5GAM e;  3PCO B;  4KGZ B;  1YIJ T;  2COY A;  4RTY A;  3REB B;  3CCE Q;  2DE0 X;  2GQI A;  2K3Y A;  5DY9 A;  1W2B A;  1D3B A;  1BI3 A;  1ZSZ B;  3CD6 A;  3H41 A;  3R6N A;  4NL3 A;  6AT1 B;  3S3O A;  4M4Z A;  3OS1 A;  1G51 A;  4H2X B;  3PVL A;  4KT0 E;  1VOM A;  4RTX A;  1VQ7 Q;  2DBM A;  1P92 A;  1AWJ A;  4H2V A;  2I4N A;  2ROT A;  3G4S A;  3CC2 A;  4YCV A;  1TTH B;  2KRS A;  5C0M A;  1GFC A;  2JM8 A;  2KBT A;  1JJC A;  3KXT A;  3PMT A;  3CCS T;  5IAY A;  1M90 C;  1VQL T;  4J9C A;  2QDL A;  4C92 E;  2J06 A;  2EWN A;  1N5Z A;  2EVR A;  3J7A F;  3LWH A;  2CYZ B;  4GLK A;  4KUI A;  4A4F A;  2E70 A;  2EQM A;  2E1H A;  2ZNI A;  1WLP B;  4CC7 A;  1ZSZ A;  2Y4Y A;  5KYY B;  3VS6 A;  2JMC A;  3L4G A;  1JJ2 P;  3RER A;  5ELO A;  4XQ3 A;  5LJ5 f;  2DL5 A;  3JCM V;  3L42 A;  2KRN A;  3QZ5 B;  5LJ5 g;  1QE0 A;  4M7D G;  1HXD A;  1J5W A;  4LD6 A;  3CC7 T;  4E6R A;  1VQN Q;  2KRM A;  4OP0 A;  2KXC A;  2VGM A;  2YLC A;  2QHU A;  2HDA A;  4E7I A;  1YJW A;  3N5B B;  5LJ5 h;  2EAY A;  5K1P A;  3M55 A;  1PKS A;  5CKH A;  1MV0 B;  4D8D A;  3JCM J;  2LMJ A;  4XU0 A;  3VKI A;  5CKB A;  1I0C A;  3H0I A;  3OYB A;  1HTT A;  1AEY A;  5KCH A;  5GAN g;  2YDL A;  3P8B B;  7AT1 B;  4LVJ A;  1PCX A;  1IHV A;  2D6F A;  5HCK A;  2QEX A;  1T3L A;  4MMK A;  3CPW P;  1TS9 A;  4C92 A;  2YUN A;  4YRS A;  5I2S A;  2WSF E;  3LX7 A;  5KYY A;  3PIP A;  1KJW A;  3ZEH A;  2ZIM A;  1JQQ A;  5GAN h;  3OSV A;  5KYW A;  3UH0 A;  1U8R A;  4JZ3 A;  1XQH A;  1SRL A;  2AZV A;  1QQJ A;  5FW9 A;  1B3Q A;  2K6D A;  2VKN A;  1WFW A;  3OYN A;  3QBY A;  1T3S A;  1R8O B;  3HTR A;  4C5H A;  3CME A;  1YIJ Q;  4CH5 A;  4XTZ A;  2NUZ A;  4LVL A;  4PJM A;  1YJN A;  5IHI A;  2XMF A;  1UGV A;  4LD9 K;  1BKB A;  1SHG A;  2O9V A;  3OYC A;  4KH1 B;  1Q86 U;  1MMA A;  3D7S B;  2ZT7 A;  3S3N A;  4BAC A;  2OX7 A;  3CMA T;  4C0Z A;  4PJO G;  3VS3 A;  1YI2 A;  3OYK A;  2KNB B;  1EIF A;  4N0A A;  2E6Z A;  3UT1 A;  4M75 F;  2HL3 A;  1WZO A;  2DF6 A;  1IL2 A;  2I4M A;  3CCS Q;  1M4Z A;  1QWF A;  3QII A;  4EO4 A;  2GNC A;  1KFZ A;  3M0P A;  4FL6 A;  3A8G B;  1VQL Q;  1IGQ A;  3ULR B;  3VUB A;  1ARK A;  2G6F X;  1V29 B;  4TTV A;  4DOV A;  1TSF A;  4FIB A;  1TU0 B;  2GFA A;  5CQX A;  1ACM B;  4HCZ A;  3M4Y A;  2LC4 A;  3H8Z A;  1KOG A;  3I55 T;  4LVK A;  1B7Y B;  3G71 T;  3MJX A;  4ZTU B;  1K8A C;  1SKU B;  2LZ6 B;  2CJB A;  2RQU A;  3REU A;  4BWA A;  1KQS P;  3TVT A;  3OB9 A;  4M77 B;  5LJ3 e;  1M2V B;  5HK3 A;  4J6Y A;  3CC7 Q;  1D0Z A;  3JSC A;  1OI1 A;  4GY5 A;  1RLQ C;  2AKW A;  4OMN A;  4RCB A;  3CCL A;  5C51 B;  1R77 A;  4L87 A;  2NUP A;  5CKD A;  5LJ5 j;  3IKL A;  2X4W A;  1EQR A;  4TQD A;  1EFW A;  3QDR B;  2NWM A;  5GAO q;  4C8Q E;  4PHC A;  4MML A;  1EVL A;  4RKU E;  5FRM A;  3VQX A;  4EMH A;  4UPA A;  3LH0 A;  2KVQ G;  3O8V A;  1UJY A;  3EFO B;  3OSS C;  3EGD B;  4YRL A;  1VQ8 A;  2RA2 A;  5EG2 A;  3LGF A;  3I56 T;  3QSU A;  4YDQ A;  1IGU A;  2E4H A;  4BUG A;  3G6E T;  5HGQ A;  4AFS C;  1UJ0 A;  2MMP A;  4OMP A;  2KXD A;  5D7U A;  4QQ6 A;  3A8L B;  2KAF A;  4PL6 A;  4LDW A;  2HKN A;  1Q86 R;  3X25 B;  2YXY A;  4LXC A;  4M7A B;  1WHM A;  4M78 G;  3HRI A;  4FCY A;  3C95 A;  5D6X A;  4FT4 A;  3AHU A;  2MAM A;  1D09 B;  2DKG A;  5KYX B;  2L8D A;  1BB9 A;  1C1A A;  2D0Q B;  2C0I A;  4MZM A;  1BBU A;  3QO5 A;  3ICA A;  2PZ1 A;  3M0U A;  3VS1 A;  4DBQ A;  4XU1 A;  2NYS A;  2EQU A;  2FZC B;  5FU7 C;  4Z02 A;  4C8Q A;  1YBY A;  4C92 C;  3MET A;  4H2W A;  4JJN K;  2H3E B;  2ZCF B;  3CMA Q;  2RHI A;  1UTI A;  4J9H A;  2XDD A;  2FB7 A;  1VQK A;  2ZZE A;  3C0C A;  1YIT A;  1VQM A;  3BJU A;  3CXC P;  2YUP A;  3JCM e;  1LVK A;  5GMK e;  4P3P A;  1M1F A;  4YPF A;  2HQE A;  1AHJ B;  2LT1 A;  3M0R A;  1NEB A;  3CCJ A;  4OML A;  1OX8 A;  4XU3 A;  1O9S A;  1K73 C;  3VYH B;  4HCC A;  1MMD A;  1KHI A;  3CPF A;  5GAM h;  1VIF A;  1KC8 C;  2K57 A;  2F2W A;  1UFF A;  2NUT B;  1WXB A;  1RI9 A;  3NEN A;  3I55 Q;  5IXB A;  3G71 Q;  1NJ5 A;  2ODR C;  1PD0 A;  2ZXF A;  3LSQ A;  1TUD A;  2HBP A;  4CH3 A;  1W2B P;  3OYF A;  2EYZ A;  2DXU A;  1VQ6 A;  2HQX A;  3C4S A;  2PTK A;  1NJI U;  1FMK A;  4C0D B;  1K9M C;  3CC4 A;  4N0A C;  1PG5 B;  2CT3 A;  3ZFJ A;  1QVF S;  2ARU A;  4HVW A;  2AKK A;  4CC3 A;  1E6H A;  2M1H A;  2JMA A;  1QLY A;  2CIM A;  4HXJ A;  2ZPG B;  4J9D A;  1CKA A;  3H0F A;  1X6O A;  4F7U E;  1X2K A;  4ZTZ B;  4L5G A;  2DBK A;  1JB0 E;  4FYY B;  3I56 Q;  1X69 A;  4OMM A;  3MF2 A;  3BE3 A;  3X26 B;  3A8O B;  3IKM B;  2JTE A;  3RMS A;  2ABL A;  5KCO A;  4XTY A;  4HVU A;  4ZTJ A;  4CS2 A;  1N8R C;  4AFU C;  2JTM A;  3TU4 K;  1VQP A;  1PYS B;  3EG2 A;  1SSH A;  3MEW A;  1LYL A;  2EYY A;  3EG9 A;  3ZL7 C;  1I5L A;  3SHW A;  2PUO B;  1H8K A;  2MPX C;  2RHU A;  4UP8 A;  2KQW A;  4A4E A;  2C8M A;  1MNE A;  1UGS B;  4KR2 A;  5KYU A;  1OOT A;  1EVK A;  1OZ3 A;  4WJ3 M;  1H3Z A;  4JS5 A;  2ZR3 A;  3REX A;  2EFI A;  2JXB A;  1WNL A;  2DPP B;  2DYB A;  5C53 B;  2R57 A;  4DEY A;  5HKC A;  2CKK A;  1I81 A;  2A37 A;  3M58 A;  4F7U A;  4B9W A;  2JTF A;  1TUG B;  3DLM A;  1PYS A;  4J5Y A;  4DPG A;  3I7F A;  2CDT A;  2D0N A;  4JRK A;  4XTW A;  1RL2 A;  4KGX B;  2J6F A;  3CCR A;  1G2B A;  3RGL A;  2QHT A;  4RMO A;  1GRI A;  3UGT A;  1NJI R;  4F14 A;  3OYD A;  3OW2 S;  3HFZ B;  4HWO A;  1G3Y A;  2A8E A;  2RI3 A;  4X9D A;  1WU7 A;  1B34 A;  2E5A A;  1XNI A;  5CK9 A;  4JLI A;  1NYF A;  1MHN A;  4H2T A;  2QI2 A;  4FSX A;  3JCM X;  4HVV A;  4C8Q C;  4A4K A;  1H4V B;  1X43 A;  1EOV A;  2JN0 A;  2FYK A;  4P71 A;  3MP1 A;  4HWS A;  2LRQ A;  2E3C A;  1VQZ A;  1HC7 A;  4YRT A;  3KFV A;  2M02 A;  4NOY A;  2WSE E;  5GMK m;  2OTJ A;  1WIE A;  4M77 D;  4YRR A;  2D1X A;  3QO7 A;  1GBR A;  1OEB A;  1AZG B;  2ARS A;  2E12 A;  3NET A;  3HFZ A;  4HT8 A;  1WPY A;  3CCE A;  5GAO r;  2DER A;  4PJO E;  5GAN 3;  1M1G A;  4HWP A;  2A3L A;  5LJ3 f;  2RF0 A;  1QF6 A;  4QT7 A;  5LJ3 g;  1VQ7 A;  1UHF A;  2CP0 A;  1NEG A;  2DRM A;  3R6O A;  1QWE A;  2L5Q A;  4C8Q D;  1WQW A;  1LJO A;  1SSF A;  1UG1 A;  1C6V X;  4K88 A;  2DMO A;  4DQ2 A;  2L0A A;  2V8K A;  4X9C A;  3FRN A;  5GAN d;  4LUE A;  3A5Z B;  3HHT B;  4J83 A;  4BE2 A;  5CR2 A;  1G3W A;  4M7A D;  4F17 A;  1UGQ B;  1AWX A;  4YTL A;  2A28 A;  5A0G A;  3NGP A;  1B07 A;  3JCM Q;  3S3M A;  3MCA B;  3ASK A;  3M54 A;  3QYH B;  4RG8 A;  2HKQ B;  2E5K A;  1IXD A;  4FT2 A;  4NL2 A;  1MV3 A;  1UGP B;  2DM1 A;  2RJD A;  2DYI A;  5ECA A;  4PJO A;  1NYQ A;  3VYG A;  1H3H A;  1WLE A;  5I21 A;  2CJ9 A;  5FRO A;  1QVG S;  3L2U A;  2K5L A;  2RQW A;  4DBH A;  1VQN A;  1ZX6 A;  2HSP A;  4OMF B;  3QHS A;  5LL6 S;  2QHV A;  5GMK l;  5I11 A;  4HT9 A;  3CBP A;  2V8I A;  4RUG A;  2FPF A;  3TEE A;  4RTU A;  2ZGW A;  2KYM A;  1D3B B;  4AG2 C;  2XIC A;  3BFM A;  1A0N B;  3EHR A;  5GJV B;  2RI5 A;  2E41 A;  4ZNX A;  3CXC A;  3JV3 A;  2QQA A;  4HKE A;  1L0W A;  4E7J A;  3JCM f;  4PFO A;  1UE9 A;  1PRM C;  1I1J A;  3RIR A;  1U1T A;  2HAX A;  4LNP A;  8AT1 B;  3JCM g;  2I4L A;  2QAZ A;  1VQ4 T;  1SES A;  2OTL T;  4IUQ A;  2F5T X;  1EX4 A;  4KGV B;  4QVD A;  1JJC B;  2MYS A;  2RK1 A;  4K86 A;  1D1C A;  1E7O A;  3M4G A;  2XD0 A;  3BDL A;  3O5Z A;  3JCM h;  4PFZ A;  5GMK h;  4Q15 A;  3QO3 A;  3L2V A;  4OB0 B;  1VQO T;  1YIJ A;  2QTX A;  2DQ3 A;  4J8O A;  1IRE B;  2G4C A;  4M75 G;  3VJP A;  3VS2 A;  2C0O A;  1JJ2 S;  4P74 A;  1T0H A;  5ELN A;  5D6W A;  3I35 A;  4OB1 B;  3I9Q A;  3SFM A;  4ZGE B;  2LTO A;  3L4G B;  3QO8 A;  1MGQ A;  1VQ5 T;  2JVV A;  1ADY A;  3UGQ A;  5M9O A;  4EPC A;  2VUB A;  4P71 C;  5LJ3 j;  2O2O A;  3MEU A;  4M78 A;  3CCU T;  2EYQ A;  4M77 F;  2YUO A;  3JRZ A;  4J6X A;  1GFD A;  3HRK A;  1W70 A;  3EFS A;  1VQL A;  4DBR A;  5FWB A;  2ATC B;  1NJ8 A;  3A74 A;  3HKS A;  1B7T A;  1Q7Y R;  3QNE A;  1OU9 A;  3C94 A;  5FU7 B;  2EKO A;  4YRP A;  1NG2 A;  4J9E A;  1WJS A;  4C92 B;  2DXT A;  1PSE A;  2EIF A;  1EIY A;  3SEM A;  1VA7 A;  5FRN A;  2E10 A;  3L2Q A;  5KYW B;  1UGR B;  5IHN A;  4HWR A;  3EH1 A;  1K0X A;  2I4O A;  3V8L A;  1SF9 A;  3JCM W;  4V2S A;  3GOX A;  3CC7 A;  1K1Z A;  2RHX A;  3REA B;  5C52 B;  4AG1 C;  4C0F A;  4E7L A;  5J26 A;  4JDS A;  1BCM A;  3RR6 A;  5FLX E;  3HRS A;  4C5G A;  2XGT A;  4C5E A;  4BE1 A;  3T9N A;  1LPL A;  1KMN A;  3DLL A;  4M7A F;  3VQY A;  2CH4 W;  1GBQ A;  4UP9 A;  4PJJ A;  2Q7H A;  3VBB A;  2P0Q A;  1U06 A;  3SDZ A;  1H64 1;  4X5O A;  4OMQ A;  5CAI A;  3L1A A;  2P4R A;  2QQB A;  5GAM d;  1RLP C;  1VQ4 Q;  2JZ2 A;  3CEY A;  2EGE A;  2OTL Q;  2LQ8 A;  2RQV A;  4PJO C;  2F2X A;  2ZZD A;  3PMI A;  2DL7 A;  4L6V 5;  5EC7 A;  2RH2 A;  4LE9 A;  3ZBD A;  3NMZ C;  1NPP A;  2K5I A;  5GMK j;  2SEM A;  2DDZ A;  3QYG B;  2MWO A;  1RIQ A;  2LX7 A;  3CCV T;  1Q82 U;  2QA4 T;  2DIQ A;  4RQF A;  4O6J A;  2X3X D;  5L8R E;  1G5V A;  1MND A;  2ZZG A;  4R56 A;  1RAI B;  4BB7 A;  4DA4 A;  2RI2 A;  3W3S A;  1SPK A;  3PVQ A;  2DU5 A;  3BY7 A;  1MMG A;  3WXM B;  5KNN A;  2ZZF A;  2L3Q A;  1AWO A;  1VQ5 Q;  4BW9 A;  3CMA A;  1KD1 R;  2QK0 A;  4OGE A;  2AKW B;  4QQG A;  3VS7 A;  5GMK i;  2FVU A;  1M30 A;  1YJN T;  3CCU Q;  1BBW A;  2NUP B;  1TWB A;  2EW3 A;  2CZ7 B;  4Y92 A;  4YRN A;  1G3T A;  2J6K A;  1R0C B;  1BBZ A;  2EL9 A;  4F04 B;  1QMC A;  2BZX A;  4Z8A A;  5KYN A;  2LCC A;  1B70 A;  4P74 C;  1Q86 C;  1C0A A;  1YI2 T;  2CP5 A;  3I5R A;  1X55 A;  3UDC A;  2DA9 A;  2Q7G A;  4K11 A;  3I55 A;  2LP5 A;  5IH2 A;  3G71 A;  4QW2 A;  2VV5 A;  4WI1 A;  2SRC A;  4OF1 A;  3OW2 A;  3VQV A;  1VYU A;  4O2D A;  1D1B A;  4JLG A;  1WX6 A;  4LUD A;  1N9W A;  1ABQ A;  4ELY C;  1X56 A;  2J6O A;  3VRZ A;  1V1C A;  3HXX A;  3QG1 A;  3WVE B;  1UDL A;  4M78 C;  5GAN 5;  1TH7 A;  4JJC A;  3OD1 A;  2K9G A;  1CKB A;  2GQV A;  3PGG A;  1QCF A;  4EIK A;  2IG0 A;  2D9T A;  3NHN A;  4CH6 A;  4J9I A;  1QP3 A;  1NJ2 A;  3A7A A;  3GNG A;  1YNZ A;  2X9H A;  2LQW A;  4LDY A;  1VQ9 A;  1Q81 U;  3OYJ A;  2V1Q A;  4C8Q B;  3I56 A;  1Q82 R;  3QWX X;  3M5A A;  1RAG B;  2BZ8 A;  2QG9 B;  2QXF A;  2KYB A;  3NPF A;  1ZBJ A;  4FW2 A;  2KGT A;  2LQN A;  4X34 A;  4RDX A;  3TEH A;  1HJD A;  2MI6 A;  1KG1 A;  2NS6 A;  3H0H A;  2C06 A;  2EYX A;  3M4Q A;  2CGH A;  1YFN A;  4OGC A;  1VQ8 T;  1I07 A;  4BY6 C;  3HXW A;  4XEM A;  2W10 A;  1F1B B;  4ELZ C;  2Q5I A;  3A7U A;  3CCV Q;  3LSS A;  3EGU A;  2ED1 A;  2M16 A;  2CP6 A;  3GNF B;  2QA4 Q;  1M3B A;  3LWI A;  2OJ2 A;  5HY6 A;  3E2U A;  2RQR A;  3BW1 A;  4RCC A;  2M9U A;  4P72 A;  3QWY A;  2K3B A;  1W2B S;  4PKC C;  4XTV A;  4JPB W;  3X28 B;  4RTZ A;  4H2S A;  2EYW A;  2HZY A;  3RKY A;  1ZLM A;  3CCM T;  1NLP C;  2DK3 A;  2O9S A;  1HSQ A;  1ZA1 B;  4JJB A;  1M8V A;  1YJN Q;  3NEL A;  3E9H A;  3P8Y A;  4OB2 B;  5GAN 6;  1G8X A;  4CRI A;  1ZBX A;  2ZCE A;  5F5W A;  2FG0 A;  4FYW B;  2XID A;  3VV0 A;  1GXI E;  5I22 A;  2VAS A;  3SWN A;  1YHQ A;  2Y90 A;  1FXX A;  1QVG A;  2HCK A;  4Y91 A;  2RO0 A;  4G84 A;  1K9A A;  2DJZ A;  1M1K R;  2RHY A;  1S72 T;  1Q81 R;  2FZG B;  4XEO A;  2FEI A;  3HP9 A;  4C92 D;  2KE9 A;  2GFU A;  4N4I A;  3RBB B;  3EG9 B;  4M75 E; 
#chains in the Genus database with same CATH homology
 2LNV A;  3WVD B;  5IT9 E;  3P8H A;  3OMG A;  4C5I A;  1YFS A;  1H4T A;  1JRI A;  4MZP A;  2RJF A;  4BI3 A;  4R55 A;  4N4G A;  3A31 A;  3VQW A;  3JB9 D;  4PG3 A;  4IUU A;  1NYR A;  1E1T A;  1Y07 A;  2DXC A;  1USY A;  4P73 A;  2EQJ A;  1X2G A;  2X4J A;  3DB3 A;  2X35 A;  2R5A A;  4F7U B;  1NJI C;  1Y96 A;  2V8J A;  2JOY A;  2ODR D;  3GLX A;  3M57 A;  2YHT A;  2YRV A;  2L3R A;  2CJA A;  2E5Q A;  1BYM A;  5C6S A;  3CMQ A;  1NJ6 A;  2DIG A;  1X54 A;  2CZ1 B;  2Y4X A;  1QW1 A;  2LDM A;  3J81 E;  3G1Z A;  1WYD A;  4H02 A;  3V8J A;  1B34 B;  4M75 A;  3OYI A;  3LW5 E;  2QQ9 A;  3M9Q A;  4WJ4 A;  1WJR A;  3INZ A;  1SER A;  4M7D E;  3OS5 A;  3RL6 A;  4HA8 A;  2HNI A;  4Y28 E;  2GCX A;  1PSF A;  4E51 A;  4LDV A;  3CCQ A;  3MP6 A;  2Q7E A;  3V7S A;  4O5V A;  3DSQ A;  1RI0 A;  4LVI A;  1H4S A;  3QZ9 B;  4P72 C;  4PLI A;  3JB9 J;  2A7Y A;  3A8H B;  3ME9 A;  4JS4 A;  2ZTG A;  3CCR T;  2PMF A;  2O4X B;  4BI4 A;  5K1X A;  2O01 E;  3OYA A;  2CS7 A;  4M7D A;  2DZC A;  1O75 A;  3HRU A;  1N27 A;  1KMM A;  1N9R A;  3A7R A;  3FC3 A;  2RK2 A;  3NTH A;  4ZN1 A;  4QVZ A;  2ZT8 A;  3QKJ A;  2ALY B;  3SWN C;  3P8D A;  4QQD A;  4M77 G;  4N4H A;  3C12 A;  4DOW A;  3OY9 A;  3OYM A;  5LJ5 d;  4AH6 A;  3M59 A;  3CBO A;  1M9S A;  2GF7 A;  3MF1 A;  4A54 A;  4OVA A;  3V8K A;  4PJO B;  2XK0 A;  3PIO A;  3HXU A;  2O4X A;  4C92 F;  5LJ3 h;  3UFG A;  4ZTF A;  3PFS A;  2DTO A;  4C8Q G;  4TVA A;  1JBM A;  4KQE A;  3OBY A;  2RHZ A;  3MEY A;  4P3O A;  2LVM A;  4KUD K;  4RG2 A;  3QPH A;  3JB9 F;  3V7C A;  2ALY A;  1USY C;  4P73 C;  4KBM B;  4ZN3 A;  1VIE A;  4J7I A;  4M7A G;  2F69 A;  4A4G A;  2M0O A;  5CKF A;  4XTX A;  3OYE A;  2KMT A;  2RJE A;  1Q7Y U;  4YRJ A;  3HY1 A;  3MEV A;  2X4X A;  1WJQ A;  4OB3 B;  2ZIN A;  2K4Y A;  2HD0 A;  3OYL A;  2KY9 A;  4YRE A;  4M75 C;  3NEM A;  1ZQ1 A;  1XTD A;  3NFC A;  1FYF A;  3RMQ A;  4FM4 B;  4IUT A;  4M78 E;  2DD4 A;  5A0D A;  2IVW A;  1Q7Y C;  1VQ4 A;  1Y71 A;  4M78 B;  1KQ1 A;  3HSB A;  3QJY A;  3E9F A;  4YRO A;  4PNO A;  4K87 A;  1QVP A;  2DO3 A;  2VGN A;  3OBW A;  3P8T A;  2QHS A;  3HPW A;  3PNW C;  1EIY B;  3IG2 A;  3QUI A;  3VU3 C;  3JB9 I;  3OYG A;  2ART A;  1YJ9 T;  2ZPH B;  4XAX B;  3OYH A;  2ZT5 A;  4JRI A;  4TQF A;  4TWA A;  2DTH A;  1M90 U;  4BY6 B;  4M7D C;  2E64 A;  4EMK A;  3CCU A;  4BDZ A;  3CCS A;  3CD6 T;  4NS5 A;  1UB4 A;  1I8F A;  2LX9 A;  3CPW S;  3A32 A;  2LT4 A;  2XKO C;  2LCL A;  4F7U G;  1NJ1 A;  4YRF A;  1G3S A;  1YCY A;  3G4S T;  1KD1 U;  2IY5 A;  2I2L A;  3CC2 T;  4MZT A;  4BI8 B;  4LNS A;  2XU8 A;  4MDX A;  3A8M B;  2P0L A;  3X24 B;  4RMF A;  2AMC A;  3UWN A;  3TUP A;  4C8Q F;  3PCO A;  2H3J A;  4ATO A;  5IN1 A;  3RAC A;  2PVO B;  2FHD A;  1BI0 A;  5GAN 8;  1KQ2 A;  4M7D D;  2NLU A;  2P5I A;  4H2Y A;  2DTI A;  1KD1 C;  4H2X A;  5HK0 A;  2P0P A;  3FLG A;  1QVF A;  2EJG A;  4YRQ A;  1BI1 A;  2YLB A;  1SET A;  2CZ0 B;  1HK9 A;  3HFN A;  1E24 A;  1YJW T;  2P0K A;  2ZT6 A;  3LGL A;  3HY0 A;  3JCM P;  4YRM A;  5GAN f;  3FB9 A;  2XHC A;  2EQK A;  2DQ0 A;  3M53 A;  2QEX T;  3CCV A;  4JRP A;  3Q1J A;  2RB6 A;  3JCM b;  2QA4 A;  5A0L A;  3M56 A;  1NZ9 A;  4WF2 A;  3A5Y A;  4HWT A;  2KSS A;  4L59 A;  1B70 B;  1KQS S;  3QXE B;  4JUV A;  4D6W A;  5J39 A;  3CBM A;  1GGM A;  4B9X A;  2E65 A;  2ZR2 A;  3QTC A;  2RM4 A;  2DD5 A;  3CME T;  4P5N A;  1Z7N A;  3E19 A;  2QDY B;  5GAO n;  3HXZ A;  3SD4 A;  4PJO D;  1BIB A;  1N6A A;  3HXY A;  4KUL A;  1Q82 C;  3MQZ A;  2RHS B;  4IKF A;  2VC8 A;  4BE0 A;  2EJ9 A;  1K8A U;  1G5H A;  3X20 B;  5KE2 A;  4EX5 A;  3OYY A;  2BKD N;  4VUB A;  2PQW A;  1E1O A;  3JAM E;  1I4K 1;  2QQR A;  3M4P A;  1H4Q A;  2VYT A;  1Z7M A;  4IUP A;  3MHX A;  4TVR A;  3V7R A;  3TEH B;  1E22 A;  2DZ9 A;  4NCX A;  1LNX A;  2DEQ A;  3EFR A;  2K5F A;  4EMK C;  2PVD B;  4M77 E;  4F7U F;  2XG8 D;  1IZ6 A;  3NTI A;  2RHS A;  3RF1 A;  1LOJ A;  1N9S A;  2DU7 A;  3UPU A;  1M1K U;  4A53 A;  3HFO A;  1WQ7 A;  3HL8 A;  1FX7 A;  4CS3 A;  5CQY A;  3CCL T;  3CXC S;  2EJF A;  1ZHI A;  3G6E A;  4UP7 A;  4ZIB A;  1X01 A;  3ERR A;  3ER0 A;  4IUV A;  5FU6 C;  2OAU A;  1VQ9 T;  3DB4 A;  4YYE A;  12AS A;  2RHQ B;  4XK8 E;  2VXE A;  1M1K C;  4M7D F;  5DLQ E;  4M78 D;  1B7Y A;  4EMG A;  3SWN B;  5GAN j;  2LQK A;  1Q81 C;  4A4H A;  4M7A E;  1X2H A;  4M77 A;  2J3M A;  5GAO p;  3JCM c;  2K2V A;  4CH4 A;  3L2R A;  3CCM A;  5DM7 R;  3NTK A;  3OA6 A;  4E7H A;  1ATI A;  1K73 U;  2E6N A;  3OQ5 A;  4P75 A;  3MEA A;  1DJ7 B;  5KE3 A;  3PTA A;  2RHQ A;  1KC8 U;  2J3L A;  2BIV A;  3OMC A;  2CZ6 B;  5LJ3 d;  2R58 A;  4EDU A;  2X4Y A;  1VQK T;  1VQM T;  1YIT T;  2XDB A;  3J80 E;  5GAM f;  4KR3 A;  1Y96 B;  3PT9 A;  4M7A A;  3S6W A;  1S72 A;  5GAM g;  1K9M U;  5GAO m;  3CCJ T;  5J3B A;  3MP8 A;  2WAC A;  5GAN 4;  1YB3 A;  1YHQ T;  2ZIO A;  3FIF A;  4J7F A;  4Q5W A;  3JB9 H;  2QQS A;  4RQE A;  5I2M A;  2KK4 A;  2ZPF B;  4PJO F;  3EAE A;  2DXB A;  4HVC A;  4C92 G;  4LDU A;  4M75 B;  4YP0 A;  1FWZ A;  4LDX A;  1VQ6 T;  4QVC A;  3G7Z A;  4TVY A;  3CC4 T;  1N8R U;  4II1 A;  2DAQ A;  3TCJ A;  4P3N A;  2ZPE B;  4PLL A;  3JB9 G;  1NNH A;  4H2U A;  2PU9 B;  4C0G A;  1JJ2 A;  2JUF A;  5CVI A;  3DKM A;  3GP8 A;  1B8A A;  1YFR A;  5DLO A;  2MF2 A;  3E9I A;  1NPR A;  3URG A;  2ZPI B;  5E3I A;  4MDW A;  3KBG A;  3GF5 A;  4E47 A;  4J6W A;  3JCM d;  1VQP T;  4CI0 C;  5LJ5 e;  2ZPB B;  4YRI A;  1SRY A;  4YRG A;  3TEG A;  3BDU A;  3PZC A;  2XDP A;  5KH6 A;  1BI2 A;  3CPW A;  11AS A;  4M7D B;  2F5K A;  2FL7 A;  5GAO l;  3HFV A;  2XI9 A;  5GAN 2;  5GAN e;  3H6Z A;  4YCU A;  3RKW A;  4M78 F;  3RUX A;  4BDY A;  1ASY A;  1NE8 A;  4M77 C;  2Q5H A;  3LYI A;  3CCQ T;  4XU2 A;  1W66 A;  2K3X A;  4XTU A;  2BUD A;  1X75 C;  5D6Y A;  3RKX A;  1YGB A;  2PVG B;  5CIU A;  3MO8 A;  4Q6G A;  3HRT A;  2MWP A;  5GAM j;  3LC0 A;  5A2Q E;  2WSC E;  3FJP A;  4YRC A;  4P75 C;  4TVA B;  3L2W A;  3QJ6 A;  3E1S A;  4YCW A;  2PME A;  1UEB A;  4FU6 A;  4LVM A;  4BD3 A;  3LLR A;  3HXV A;  4JRQ A;  4IUR A;  2OTJ T;  4M7A C;  3WQZ A;  3SB2 A;  3OS2 A;  1KQS A;  3FDR A;  3CCE T;  1W4S A;  3KUF A;  5AYF A;  2DVE A;  3FEO A;  4CS4 A;  1VQ7 T;  5GAN 7;  5CCA A;  1ASZ A;  2RJC A;  3RES A;  3GIB A;  2C7I A;  2R5M A;  2B8A A;  4TVW A;  1U1S A;  1XOV A;  3E9G A;  2P4T A;  3GPL A;  3VUZ A;  1BIA A;  4YRK A;  4ME7 A;  3IAL A;  4HT4 A;  1WGS A;  4J15 A;  2KDS A;  1KHC A;  4E7K A;  5CKE A;  5CO7 A;  3HTZ A;  2VXF A;  1G5I A;  1VQN T;  2RD1 A;  4C0D C;  1VUB A;  2ZNJ A;  2XTI A;  1ADJ A;  2OTL A;  3A5Z A;  4ZGJ B;  3F70 A;  4EMK B;  4ZGD B;  3P8V A;  3R07 A;  1QP2 A;  3KFU A;  1VQO A;  2PUK B;  3OS0 A;  2G3R A;  1YFT A;  3L2Z A;  1Y7X A;  2IY5 B;  1M5Q 1;  3TRE A;  1OYX A;  1OZ2 A;  4M75 D;  1YJ9 A;  4HCB A;  2JNG A;  4G85 A;  2AMC B;  1VQ5 A;  4UC4 A;  2L89 A;  4OLF A;  5FU6 B;  2AHJ B;  5GAM e;  3PCO B;  1YIJ T;  2K3Y A;  5DY9 A;  1W2B A;  1D3B A;  1BI3 A;  3CD6 A;  4NL3 A;  1G51 A;  3S3O A;  3OS1 A;  4H2X B;  4KT0 E;  1P92 A;  4H2V A;  2I4N A;  3G4S A;  3CC2 A;  4YCV A;  5C0M A;  1JJC A;  3KXT A;  3PMT A;  3CCS T;  5IAY A;  1M90 C;  1VQL T;  4C92 E;  2EWN A;  3J7A F;  3LWH A;  2CYZ B;  4GLK A;  4KUI A;  4A4F A;  2E70 A;  2EQM A;  2E1H A;  2ZNI A;  2Y4Y A;  3L4G A;  3RER A;  5ELO A;  4XQ3 A;  5LJ5 f;  3JCM V;  3L42 A;  3QZ5 B;  5LJ5 g;  1QE0 A;  4M7D G;  1HXD A;  1J5W A;  4LD6 A;  3CC7 T;  4OP0 A;  2VGM A;  2YLC A;  2QHU A;  4E7I A;  1YJW A;  3N5B B;  5LJ5 h;  2EAY A;  5K1P A;  3M55 A;  5CKH A;  3JCM J;  4XU0 A;  3VKI A;  5CKB A;  3OYB A;  1HTT A;  5KCH A;  5GAN g;  4LVJ A;  3P8B B;  2D6F A;  2QEX A;  4MMK A;  4C92 A;  4YRS A;  5I2S A;  2WSF E;  3LX7 A;  3PIP A;  3ZEH A;  2ZIM A;  5GAN h;  3OSV A;  3UH0 A;  1U8R A;  1XQH A;  3OYN A;  3QBY A;  1R8O B;  4C5H A;  3CME A;  4CH5 A;  4XTZ A;  4LVL A;  1YJN A;  4LD9 K;  1BKB A;  3OYC A;  1Q86 U;  2ZT7 A;  3S3N A;  4BAC A;  3CMA T;  4C0Z A;  4PJO G;  1YI2 A;  3OYK A;  1EIF A;  4N0A A;  2E6Z A;  3UT1 A;  4M75 F;  1IL2 A;  2I4M A;  1M4Z A;  3QII A;  4EO4 A;  4FL6 A;  3A8G B;  3VUB A;  4TTV A;  1V29 B;  4DOV A;  4FIB A;  2GFA A;  5CQX A;  4HCZ A;  3M4Y A;  2LC4 A;  3H8Z A;  1KOG A;  3I55 T;  4LVK A;  1B7Y B;  3G71 T;  4ZTU B;  1K8A C;  3REU A;  2CJB A;  4BWA A;  3OB9 A;  4M77 B;  5LJ3 e;  5HK3 A;  4J6Y A;  3JSC A;  1OI1 A;  4GY5 A;  2AKW A;  4RCB A;  3CCL A;  5C51 B;  4L87 A;  5CKD A;  5LJ5 j;  3IKL A;  4TQD A;  2X4W A;  1EQR A;  1EFW A;  3QDR B;  5GAO q;  4C8Q E;  4PHC A;  4MML A;  1EVL A;  4RKU E;  5FRM A;  3VQX A;  4EMH A;  4UPA A;  3LH0 A;  2KVQ G;  3O8V A;  3OSS C;  4YRL A;  1VQ8 A;  2RA2 A;  5EG2 A;  3LGF A;  3I56 T;  3QSU A;  4YDQ A;  4BUG A;  3G6E T;  5HGQ A;  2MMP A;  4QQ6 A;  3A8L B;  2KAF A;  4PL6 A;  4LDW A;  3X25 B;  4M7A B;  4M78 G;  3HRI A;  3C95 A;  5D6X A;  4FT4 A;  3AHU A;  2MAM A;  2DKG A;  2L8D A;  2D0Q B;  4MZM A;  1BBU A;  3QO5 A;  3ICA A;  4XU1 A;  2EQU A;  5FU7 C;  4Z02 A;  4C8Q A;  1YBY A;  4C92 C;  3MET A;  4H2W A;  4JJN K;  2ZCF B;  2RHI A;  2XDD A;  2FB7 A;  1VQK A;  2ZZE A;  1YIT A;  1VQM A;  3BJU A;  3JCM e;  5GMK e;  4P3P A;  1M1F A;  4YPF A;  2HQE A;  1AHJ B;  2LT1 A;  3CCJ A;  4XU3 A;  1O9S A;  1K73 C;  3VYH B;  4HCC A;  1KHI A;  3CPF A;  5GAM h;  1VIF A;  1KC8 C;  2K57 A;  3NEN A;  1NJ5 A;  2ODR C;  2ZXF A;  3LSQ A;  4CH3 A;  2HBP A;  3OYF A;  2DXU A;  1VQ6 A;  2HQX A;  3C4S A;  1NJI U;  4C0D B;  1K9M C;  3CC4 A;  4N0A C;  3ZFJ A;  1QVF S;  2ARU A;  2M1H A;  2CIM A;  2ZPG B;  1X6O A;  4F7U E;  4ZTZ B;  4L5G A;  1JB0 E;  3MF2 A;  3X26 B;  3A8O B;  3IKM B;  3RMS A;  5KCO A;  4XTY A;  4ZTJ A;  4CS2 A;  1N8R C;  2JTM A;  3TU4 K;  1VQP A;  1PYS B;  3MEW A;  1LYL A;  1I5L A;  2PUO B;  2RHU A;  4UP8 A;  2KQW A;  4A4E A;  2C8M A;  1UGS B;  4KR2 A;  1EVK A;  1OZ3 A;  4WJ3 M;  1H3Z A;  4JS5 A;  2ZR3 A;  3REX A;  2EFI A;  1WNL A;  2DPP B;  5C53 B;  2R57 A;  5HKC A;  2CKK A;  1I81 A;  3M58 A;  4F7U A;  4B9W A;  2JTF A;  3DLM A;  1PYS A;  4J5Y A;  4DPG A;  3I7F A;  4JRK A;  4XTW A;  1RL2 A;  3CCR A;  3RGL A;  2QHT A;  4RMO A;  3UGT A;  3OYD A;  3OW2 S;  3HFZ B;  4HWO A;  1G3Y A;  2A8E A;  2RI3 A;  4X9D A;  1WU7 A;  1B34 A;  2E5A A;  1XNI A;  5CK9 A;  4JLI A;  1MHN A;  4H2T A;  2QI2 A;  4FSX A;  3JCM X;  4C8Q C;  4A4K A;  1H4V B;  1EOV A;  2JN0 A;  2FYK A;  4P71 A;  3MP1 A;  4HWS A;  2LRQ A;  2E3C A;  1VQZ A;  1HC7 A;  4YRT A;  4NOY A;  2WSE E;  5GMK m;  2OTJ A;  4M77 D;  4YRR A;  3QO7 A;  2ARS A;  2E12 A;  3NET A;  3HFZ A;  4HT8 A;  1WPY A;  3CCE A;  5GAO r;  4PJO E;  5GAN 3;  1M1G A;  4HWP A;  2A3L A;  5LJ3 f;  1QF6 A;  5LJ3 g;  1VQ7 A;  3R6O A;  2L5Q A;  4C8Q D;  1WQW A;  1LJO A;  1SSF A;  4K88 A;  4DQ2 A;  2V8K A;  4X9C A;  3FRN A;  5GAN d;  3A5Z B;  3HHT B;  4J83 A;  4BE2 A;  5CR2 A;  1G3W A;  4M7A D;  1UGQ B;  4YTL A;  5A0G A;  3JCM Q;  3S3M A;  3MCA B;  3ASK A;  3M54 A;  3QYH B;  4RG8 A;  4FT2 A;  4NL2 A;  1UGP B;  2RJD A;  4PJO A;  1NYQ A;  3VYG A;  1WLE A;  5I21 A;  2CJ9 A;  5FRO A;  1QVG S;  3L2U A;  2K5L A;  1VQN A;  4OMF B;  3QHS A;  5LL6 S;  2QHV A;  5GMK l;  4HT9 A;  3CBP A;  2V8I A;  3TEE A;  2ZGW A;  1D3B B;  2XIC A;  3BFM A;  2RI5 A;  2E41 A;  3CXC A;  2QQA A;  4HKE A;  1L0W A;  4E7J A;  3JCM f;  3RIR A;  1U1T A;  2HAX A;  3JCM g;  2I4L A;  1VQ4 T;  1SES A;  2OTL T;  4IUQ A;  2F5T X;  4QVD A;  1JJC B;  2RK1 A;  4K86 A;  3M4G A;  2XD0 A;  3BDL A;  3JCM h;  5GMK h;  4Q15 A;  3QO3 A;  3L2V A;  4OB0 B;  1VQO T;  1YIJ A;  2QTX A;  2DQ3 A;  4J8O A;  1IRE B;  2G4C A;  4M75 G;  3VJP A;  1JJ2 S;  4P74 A;  5ELN A;  5D6W A;  4OB1 B;  3SFM A;  4ZGE B;  2LTO A;  3L4G B;  3QO8 A;  1MGQ A;  1VQ5 T;  2JVV A;  1ADY A;  3UGQ A;  5M9O A;  4EPC A;  2VUB A;  4P71 C;  5LJ3 j;  3MEU A;  4M78 A;  3CCU T;  2EYQ A;  4M77 F;  3JRZ A;  4J6X A;  3HRK A;  3EFS A;  1VQL A;  1NJ8 A;  3A74 A;  3HKS A;  3QNE A;  3C94 A;  5FU7 B;  2EKO A;  4YRP A;  1WJS A;  4C92 B;  2DXT A;  1PSE A;  2EIF A;  1EIY A;  5FRN A;  2E10 A;  3L2Q A;  1UGR B;  4HWR A;  2I4O A;  3V8L A;  3JCM W;  4V2S A;  3GOX A;  3CC7 A;  2RHX A;  5C52 B;  4C0F A;  4E7L A;  5J26 A;  4JDS A;  5FLX E;  3HRS A;  4C5G A;  2XGT A;  4C5E A;  4BE1 A;  3T9N A;  1KMN A;  3DLL A;  4M7A F;  3VQY A;  4UP9 A;  2Q7H A;  3VBB A;  2P0Q A;  3SDZ A;  1H64 1;  4X5O A;  5CAI A;  3L1A A;  2QQB A;  5GAM d;  2JZ2 A;  3CEY A;  2LQ8 A;  4PJO C;  2ZZD A;  3PMI A;  4L6V 5;  2RH2 A;  3ZBD A;  1NPP A;  2K5I A;  5GMK j;  2DDZ A;  3QYG B;  2MWO A;  1RIQ A;  3CCV T;  1Q82 U;  2QA4 T;  2DIQ A;  4RQF A;  4O6J A;  5L8R E;  1G5V A;  2ZZG A;  4R56 A;  4BB7 A;  4DA4 A;  2RI2 A;  3W3S A;  2DU5 A;  3BY7 A;  3WXM B;  5KNN A;  2ZZF A;  4BW9 A;  3CMA A;  4OGE A;  2AKW B;  4QQG A;  5GMK i;  2FVU A;  1YJN T;  1BBW A;  2CZ7 B;  4YRN A;  1G3T A;  2EL9 A;  2LCC A;  1B70 A;  4P74 C;  1Q86 C;  1C0A A;  1YI2 T;  1X55 A;  3UDC A;  2Q7G A;  3I55 A;  3G71 A;  4QW2 A;  2VV5 A;  4WI1 A;  4OF1 A;  3OW2 A;  3VQV A;  4O2D A;  4JLG A;  1N9W A;  4ELY C;  1X56 A;  3HXX A;  3QG1 A;  3WVE B;  4M78 C;  5GAN 5;  1TH7 A;  3OD1 A;  3PGG A;  2GQV A;  2IG0 A;  2D9T A;  4CH6 A;  1QP3 A;  1NJ2 A;  3A7A A;  3GNG A;  4LDY A;  1VQ9 A;  1Q81 U;  3OYJ A;  4C8Q B;  3I56 A;  3M5A A;  2QXF A;  4X34 A;  4RDX A;  3TEH A;  2MI6 A;  1KG1 A;  2NS6 A;  2C06 A;  3M4Q A;  2CGH A;  4OGC A;  1VQ8 T;  4BY6 C;  3HXW A;  4XEM A;  4ELZ C;  2Q5I A;  3A7U A;  3LSS A;  2M16 A;  3GNF B;  3LWI A;  5HY6 A;  3BW1 A;  4RCC A;  2M9U A;  4P72 A;  1W2B S;  4PKC C;  4XTV A;  3X28 B;  4H2S A;  3RKY A;  3CCM T;  2DK3 A;  1M8V A;  3NEL A;  3E9H A;  3P8Y A;  4OB2 B;  5GAN 6;  4CRI A;  1ZBX A;  2ZCE A;  5F5W A;  2XID A;  3VV0 A;  1GXI E;  3SWN A;  1YHQ A;  2Y90 A;  1FXX A;  1QVG A;  4Y91 A;  2RO0 A;  4G84 A;  2DJZ A;  2RHY A;  1S72 T;  4XEO A;  3HP9 A;  4C92 D;  2GFU A;  4N4I A;  1B76 A;  4M75 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...