3EFRA

Biotin protein ligase r40g mutant from aquifex aeolicus in complex with biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGGLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 67
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efrA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efrA01
4WJ4A 1H641 2ZGWA 3HY0A 4J6XA 1PYSA 1YGBA 2ZCEA 4WJ3M 4M7DB 1X01A 4YRIA 4P73C 2DZCA 3HY1A 4X9DA 4M77D 4A54A 1KMMA 1NJ2A 3QNEA 3JCMf 2DXUA 4YRQA 2E3CA 2ZR2A 1EIYB 4CS2A 2CJAA 3QO5A 3IG2A 3BFMA 3AHUA 3UGTA 3VQXA 3JB9H 1NYQA 3NENA 3VQWA 4M75F 4M78D 4F7UE 4M75A 5GAMj 3HXXA 4PJOG 4M7DD 2PMEA 2FB7A 3RKXA 2RA2A 1USYA 5GAOq 1X2HA 1NYRA 2AKWB 1LOJA 2Q5IA 3IKMB 4CH5A 2I4NA 3QO7A 2P0LA 4H2SA 4YRMA 2RM4A 2VC8A 3JCMg 4KR3A 1SESA 4TTVA 1TH7A 5GANj 1D3BA 4M7AA 3EFSA 4YCUA 4P75A 4NL2A 2PMFA 2ODRC 4M75C 3JB9F 2E41A 4G84A 3RL6A 4C92G 1LJOA 2DJZA 1B34B 2XTIA 4PHCA 3TEGA 4OLFA 1X55A 4TQFA 3HFVA 4QVDA 5K1PA 1I81A 2ZNIA 3HXZA 1WNLA 4E51A 2AMCA 1BIBA 3GIBA 2ARSA 4P71A 4EMKB 2EAYA 1G5IA 1SETA 3RKWA 1SERA 3QUIA 2ZT5A 4XTXA 4NCXA 3JCMW 3PCOB 1U1SA 5GAN7 2ZIOA 3A32A 4TWAA 2YLBA 4M75E 2IY5A 3JCMe 4V2SA 4MMLA 4ZIBA 3JB9I 3OD1A 5GAN2 1C0AA 4CS3A 4YRFA 5GAOr 1Y96A 2FYKA 3FJPA 2DVEA 3VQYA 4RCCA 3JCMh 4YREA 1HK9A 4M7DF 3JCMd 3ICAA 2RHSB 5KNNA 1HXDA 4XU2A 2JN0A 3RF1A 4M7DA 1IL2A 1EFWA 4OP0A 1FYFA 2ZT6A 4YRJA 3HFZB 3HTZA 2Q5HA 3E9HA 4XQ3A 4K86A 3P8VA 2E64A 4M77C 5I21A 1EIYA 4CH4A 2RHQB 4P73A 1YCYA 4PJOB 4RDXA 4M77B 1KQ1A 4X9CA 4UP7A 5GMKi 3REUA 3MF2A 5GAMf 4JRIA 4N0AA 1ASZA 4M7DC 1HTTA 3BJUA 3P8YA 2DQ0A 1YFTA 2DTOA 4M78B 5LJ3d 1YB3A 1BBWA 4K88A 4C8QD 5GAN8 5GMKj 2ALYB 4M77E 4PJOD 3NEMA 3WQZA 1SRYA 3JCMQ 4HWSA 4KQEA 2ZT7A 4P3OA 1MGQA 4C92B 2ZZGA 4Y91A 3ERRA 4XEOA 1ADYA 4EO4A 4M7AG 2DU7A 4WF2A 4YRRA 1B34A 4N0AC 3L1AA 3TEHB 5GAN4 4P3NA 4M78E 1EVKA 2XGTA 4YDQA 5CAIA 5GAMg 4C8QG 4RQEA 4M7DE 5GMKm 1LNXA 4ZTZB 3I7FA 1NJ8A 4C92D 3DSQA 1EOVA 4XTVA 3A5ZA 2ZT8A 3KFUA 4J6WA 4RCBA 3PCOA 3M4QA 1QE0A 3RERA 2E5AA 4TVAB 4EMGA 1I5LA 3FB9A 1B7YB 4JUVA 4P72A 1WLEA 2ZZEA 4XU1A 2CJ9A 2J3MA 3HXWA 4CH3A 3V8KA 2I2LA 4AH6A 1PYSB 3RIRA 1RIQA 4EMKC 2G4CA 4UP9A 2RHSA 3HXYA 3A5YA 5GAMe 4F7UG 4YRCA 3HFZA 4J5YA 3QHSA 4YRTA 5ELOA 1ATIA 2DDZA 4YRLA 1Z7NA 4H02A 1NNHA 2C7IA 4UP8A 5GAMh 3SWNC 3PZCA 1WU7A 4HWPA 3LSSA 4PJOF 3QO8A 4P72C 4M77F 5LJ5f 5GAMd 2CIMA 2ZZFA 3W3SA 2DZ9A 3QTCA 5F5WA 4M77A 3SWNB 2EJFA 3R07A 4RMFA 3RESA 3RGLA 1NJ5A 3SB2A 1X56A 2K57A 4J15A 4RQFA 3V8JA 4WI1A 5GAOn 4PNOA 3A31A 4HT9A 4YPFA 4M78F 2EWNA 1BBUA 4H2VA 4JRKA 1WPYA 4M78A 3QO3A 5LJ3j 4HA8A 2ALYA 4C92F 1D3BB 3UGQA 3HSBA 2QHVA 4PJOC 3MF1A 4P74C 3JCMb 2E65A 5GAN5 5LJ5g 3VQVA 4YRSA 3JCMc 4C8QB 4BWAA 2DTIA 1M5Q1 5GAN6 2ZXFA 4XU0A 3TEHA 3HRIA 3RKYA 2C8MA 4J6YA 1H4VB 1ASYA 1ADJA 1JJCB 3P8TA 3E9IA 4M78C 1NJ6A 4NL3A 4M75G 1EVLA 4P3PA 4XTUA 4M7AD 1H4SA 2AKWA 5GAOl 5K1XA 1H4TA 1B76A 1GGMA 4C92C 2J3LA 4YROA 1YFRA 4PG3A 3JB9D 2ZIMA 4PJOE 1YFSA 4YRKA 3M4PA 4TVYA 4TVAA 1B7YA 5GANf 1G51A 1N9SA 2RB6A 4H2XB 4H2WA 4HWOA 2DXTA 2EJ9A 2YLCA 4XTZA 3JCMV 1JBMA 2VXEA 2ARUA 3UFGA 5LJ5e 3JB9G 1QF6A 4F7UB 1L0WA 3HRKA 4BW9A 2E1HA 4YCVA 2Q7EA 5E3IA 1B8AA 4H2UA 5LJ5h 5GAOp 2DTHA 4LNSA 4C92E 1E1OA 2DKGA 4EMKA 5LJ5d 1I4K1 2ZINA 1WYDA 4ZTUB 5ELNA 3NETA 1X54A 1BIAA 3RUXA 1E1TA 4HT8A 4XTWA 1HC7A 5GANg 5GMKe 3L2ZA 12ASA 3REXA 3A7AA 1N9WA 2P5IA 2DU5A 1KMNA 4K87A 3BDUA 3SWNA 1B70B 3V8LA 4HWTA 11ASA 4M77G 3FIFA 3L4GB 2HNIA 1G5HA 3VU3C 5GMKh 3MEYA 2E10A 4H2YA 5GAN3 2ZNJA 3HXUA 3IALA 5GMKl 4L87A 3BY7A 4EX5A 5C53B 2Q7HA 4O2DA 3JCMX 1H4QA 4M78G 3INZA 1VQZA 1NJ1A 1I8FA 4M7AF 2QHUA 3A7RA 5LJ3f 4M7DG 4EMHA 1W66A 2I4LA 3V7CA 4DQ2A 1X2GA 4C8QF 4A53A 2RHQA 3TUPA 3BW1A 4C8QA 4YRPA 4PJOA 4UPAA 4P74A 1USYC 3HFOA 4M75B 4MMKA 3CMQA 2EL9A 2CGHA 1Z7MA 4YRNA 2DQ3A 1JJCA 5GANe 5C51B 3A74A 4QVCA 1E24A 2ZTGA 1LYLA 4HWRA 1KQ2A 2CJBA 2Y90A 5GANh 4M7AC 2YHTA 5C52B 4P75C 2QHSA 2QTXA 2DEQA 5LJ3g 1EQRA 2VXFA 5GANd 3G1ZA 3V7RA 3UH0A 2ARTA 2ODRD 4M7AB 4M75D 4C8QC 3EFRA 4NOYA 1KOGA 4X5OA 4C92A 3IKLA 5HGQA 4KR2A 4H2XA 4XEMA 3NELA 4G85A 5DY9A 1WQ7A 3JB9J 4Q6GA 2I4OA 4P71C 1M8VA 4F7UF 4XTYA 2RD1A 5GAOm 4F7UA 2AMCB 3JCMJ 1U1TA 2I4MA 3QSUA 4JLIA 4H2TA 4M7AE 2EJGA 4TQDA 2ZR3A 3HFNA 4TVWA 2Q7GA 4CH6A 5LJ5j 4C8QE 3VBBA 3LC0A 3V7SA 4YYEA 3JCMP 3HXVA 4HVCA 2IY5B 4Q15A 5LJ3e 2QHTA 4XU3A 4DPGA 3PGGA 4YP0A 1WQWA 4CS4A 1N9RA 3M4GA 1B70A 4YCWA 3LSQA 3A7UA 4YRGA 1E22A 1J5WA 1JRIA 1Y96B 3RACA 3L4GA 5LJ3h
chains in the Genus database with same CATH superfamily
5KCOA 1PYSA 2ZCEA 2LCCA 3A8LB 2LC4A 2DZCA 2JUFA 1KMMA 2K6DA 3QNEA 1T3LA 3CCRA 2DXUA 4A4GA 4IUPA 2JTEA 4BE1A 5FWBA 2E3CA 2NWMA 4PJLA 1VQOA 1Q82R 1JXMA 4RMOA 3UGTA 1AHJB 2LVMA 1VQ9Q 4F17A 3RNJA 1U3OA 3ER0A 3PTAA 2DL5A 3NGPA 4J9EA 3DB4A 2ZPIB 2H3JA 1X2HA 3IKMB 2A0FB 1OV3A 2V1RA 2RI3A 2WACA 3CCMQ 3QO7A 3D7SB 1MMDA 4KBMB 4X34A 1RAIB 1YJNQ 1TTHB 4M7AA 3EFSA 4P75A 4M75C 3F70A 4J7FA 3PIOA 2FZGB 2DJZA 1M2OA 4PHCA 2P4RA 3OYBA 2GFAA 3QJ6A 1UECA 5EC7A 3M9QA 1YIJQ 4E51A 4BDYA 1ABQA 2RMOA 1UJ0A 1GFCA 3WXMB 2LP5A 2XICA 5LL6S 1FX7A 2RJEA 1SETA 3RKWA 1GBRA 3A5ZB 3QUIA 4RUGA 2MOXA 3MJXA 2HBWA 1QVGS 4B9XA 2JOYA 2RI2A 3CCVT 2K2VA 2HSEB 3A32A 1RAHB 4M75E 3I55A 3VRZA 3OS0A 2LJ0A 4ZIBA 1RLQC 5GAN2 1C0AA 4CS3A 1Y96A 2YRCA 2FYKA 2K5FA 1Q86U 5KYYB 1KFZA 1HK9A 2JVVA 2DF6A 1HXDA 5KNNA 2JN0A 3TU4K 1IL2A 5D6YA 5FU7B 1GL5A 2GQIA 3HFZB 3HTZA 2E12A 4K86A 3E9HA 4XQ3A 3FEOA 5IXFA 1X27A 1YITQ 3G6ET 1AZEA 3P8VA 4FYYB 4DOVA 3CBPA 5I21A 2COYA 4CH4A 1PCXA 2NUZA 1K9AA 4DEXA 4OMNA 4DBRA 4A4EA 1UUEA 1KQ1A 4UP7A 4KT0E 5GAMf 4JRIA 2RK2A 1K8AC 4N0AA 1QCNA 1LVKA 4M7DC 2QQBA 4HVVA 2DQ0A 3OB9A 3G71Q 2DEUA 5FWCA 3MHXA 1BBWA 3OW2S 2DVJA 4C8QD 1SSFA 1R77A 3NEMA 1SRYA 2GBQA 2ZT7A 4P3OA 4PK4A 4LVJA 1ADYA 2EW3A 5KYNA 2QA4T 1B34A 2YXYA 1S72T 3TEHB 4M78E 5AT1B 1VQ8A 4M7DE 1K1ZA 3C0CA 2HQHA 1RI9A 1MMGA 3RBBB 4J9IA 3I7FA 1SF9A 1NJ8A 5A0DA 1OU9A 1TOVA 2EKOA 1YJWT 1QMCA 3KFUA 3OYJA 3PCOA 1QE0A 3RERA 4RKUE 2KAFA 1YHQQ 1IB8A 4JS4A 4JUVA 5IH2A 2IIMA 1KHCA 2VGMA 3TSWA 3H0IA 2ED0A 2ZZEA 2RQVA 4ZGDB 3EAEA 2QEXQ 1RIQA 4EMKC 1K73C 3A5YA 3EG1A 2NUTA 2GCXA 2EYYA 2LRQA 4F7UG 1NPRA 4J5YA 1LPLA 5ELOA 1BI1A 2C7IA 3KXTA 2PNIA 3OYAA 1OU8A 1VQKT 1K76A 4IKFA 2CIMA 3W3SA 1M1GA 1NYGA 2E6ZA 3R07A 3X28B 3RESA 1IGQA 1ZBJA 2K57A 4LN2A 3LH0A 2ECZA 3IQLA 2AKKA 1K4US 4ORZA 3OA6A 3CCRQ 4IUQA 3A31A 2ENMA 3PIPA 3QG1A 4ZGJB 4M78A 1VQOQ 3S3MA 4C92F 1D3BB 1H92A 2QHVA 4PJOC 3VQVA 4DA4A 3I5SA 2J6OA 3QWYA 1YJ9A 4BWAA 2NLUA 3EH1A 1M30A 1WJQA 3VRYA 3PVQA 4FT2A 2RH2A 4D8DA 4NL3A 3OYHA 1H3ZA 1VYUA 4XTUA 4Z02A 2QI2A 3NTHA 4BUGA 2LCLA 4JZ4A 4KUDK 2BUDA 1VQ5T 1H4TA 1TUDA 3DB3A 1GGMA 1YFRA 1N8RU 2ZIMA 4PJOE 2CUDA 1M8MA 3G4ST 4FIBA 4TVYA 4TVAA 2COWA 1B7YA 4BI8B 1VQ7A 1G51A 4JRPA 4KGVB 2YLCA 3OYLA 1G2BA 1M1KR 2DJQA 2KYBA 4LUDA 1JB0E 2FVUA 2PVGB 1PD0A 4F7UB 2K3XA 3CMET 2EGCA 4BW9A 3OYIA 2E1HA 4YCVA 5E3IA 3CC4T 3I55Q 1Z9QA 2DD4A 1YN8A 2F5TX 3EFOB 3QXEB 2DKGA 4EMKA 1WYDA 3TSZA 1ZSZC 1X54A 4KRTA 4OB1B 1HC7A 3REXA 3VS2A 1TUCA 2F2VA 4K87A 1B70B 3I56A 2MWPA 4M77G 1AD5A 3M5AA 2EGEA 2HNIA 1G5HA 5GMKh 2E10A 3MEUA 3HXUA 4ME7A 1WHHA 2D6FA 2DYIA 3I5RA 4QQGA 1FXXA 2AZSA 3JCMX 3INZA 4M7AF 3A7RA 2LTOA 2IPOB 1WXBA 1HD3A 5J26A 8ATCB 2A08A 4EMHA 2O01E 1M90U 1M2VB 2JTMA 2QTVA 4DQ2A 3A8OB 4C8QF 1Q86C 4A53A 2K4YA 1MNDA 3CPWA 2DM1A 1OYXA 1VIFA 3M57A 3CBMA 4PJOA 4YRPA 4MMKA 3CPFA 2EQJA 1ZA2B 3QJYA 1Z7MA 4YRNA 2DQ3A 2D0QB 5GANe 2BZ8A 2VB6A 1Q81C 4E7LA 2YRVA 2ZTGA 4HWRA 2WSFE 4Y92A 2YHTA 1D1CA 2QHSA 3LX7A 4M4ZA 3G1ZA 5C6SA 2LQWA 1KOGA 2L3QA 4H2XA 4XEMA 2BKDN 4G85A 1D0XA 2F1LA 4Q6GA 4AFZC 2LZ6B 1M8VA 3PFSA 3QDRB 2J06A 4FSSA 2RD1A 2HAXA 2R5AA 1KK7A 1U8RA 4K11A 1TXQA 3PNWC 3OBYA 2V8IA 3QSUA 2YRDA 2EJGA 4TQDA 5C0MA 1UGVA 2R5MA 2ZPGB 2RN8A 2Y4XA 2Q7GA 4CH6A 3JRZA 5I2MA 4AT1B 3FC3A 1N6AA 1YIJA 3HXVA 2V1QA 1AT1B 5LJ3e 2QHTA 4XU3A 4E7JA 4YP0A 1ZSZA 2GNCA 1VIEA 3M4GA 2HEQA 3LSQA 1GCPA 2HKNA 1SSHA 3L4GA 2K5LA 3NHNA 1S1NA 2BE7D 1PSFA 3HY0A 4J6XA 1AVZC 3OMCA 4WJ3M 2X51A 3HHTB 2KSSA 3L2UA 4P73C 1BI0A 2M0OA 4M77D 4JPBW 2CP3A 1NJ2A 1QVFP 4D6WA 1WGSA 4LDXA 1EIYB 2OTJT 3P8HA 3QO5A 3IG2A 4MZMA 3VQXA 1VQLT 4J9CA 1NYQA 2R57A 1AWXA 4M75F 3NENA 1KD1U 5GAMj 3HXXA 2NUPA 1YITA 2FB7A 2PMEA 4KULA 3RKXA 2GQVA 2RA2A 3REAB 5CKEA 3OYGA 1MNEA 2KYMA 2LJ3A 2AKWB 1LOJA 2O9VA 4RTXA 3X24B 4CC3A 5CK9A 5KYXB 2DRKA 3CCSQ 2I4NA 3UWNA 5IAYA 1YJ9Q 4YRMA 1HJDA 4H2SA 5KYWA 3JCMg 1K8AR 2CP7A 2CKKA 4C5HA 1TH7A 5GANj 1ZUUA 2FHDA 4J9FA 3L2VA 4RTYA 4NL2A 2PMFA 2ODRC 1YNZA 3G71A 2E41A 4G84A 4C92G 1NJIR 1BU1A 3TEGA 5FROA 4OLFA 1ZQ1A 2F69A 3H6ZA 1ZLMA 1VUBA 4LVLA 2OTLQ 1IREB 1YBYA 1SPKA 4LUEA 4GBQA 4N4IA 1VQ7Q 2EAYA 1G5IA 3J80E 2BZXA 2JMAA 1U06A 4XTXA 2KRNA 1P92A 4AFSC 1K73U 2DA9A 3MP1A 1GXIE 5GJVB 2CZ7B 2DXBA 3VS5A 1WFWA 3ZL7C 4KH0B 3KFVA 1VQNT 1QVFA 3PMTA 3FJPA 4XAXB 3JCMh 1N8RC 5FLXE 4E7SA 4M7DF 3MPUB 3JCMd 2RHSB 2PZ1A 1FYFA 4YRJA 4LDYA 4N4HA 2RF0A 3HRTA 3I56Q 2RJCA 3CCVA 2CYZB 1UGRB 1OQKA 4ZTJA 1G3YA 2RHQB 4P73A 1M4ZA 4E7IA 2DXCA 1PSEA 4NS5A 5GMKi 4L59A 2RHUA 4BDZA 3UDCA 1K9MC 5HY6A 1HTTA 1VQLQ 2P0QA 1OZ2A 4JZ3A 4Q5WA 2DTOA 1IRXA 1MMNA 5CKFA 4LXCA 5LJ3d 4A63B 3QKJA 2E70A 1YB3A 4E2FB 1UGPB 3WQZA 2AT1B 1CSKA 1RAGB 1B3QA 3HPWA 4C92B 4Y91A 5D6XA 2JS2A 3ERRA 4EO4A 4M7AG 4YRRA 1V76A 3S6WA 2CT3A 4N0AC 3L1AA 5GAN4 4P3NA 1XNIA 3EG3A 1EVKA 2JTFA 2XGTA 5CAIA 4FCYA 2YUPA 4C8QG 4RQEA 2L2PA 2FO0A 3OS1A 2DL4A 5GMKm 2RHIA 3E9FA 4X1VA 4ZTZB 3DLMA 3MKDA 4P5NA 1M90C 1K0SA 1WHLA 4C92D 2DETA 3DSQA 1EOVA 1UJYA 3A5ZA 3HL8A 3X25B 2CH4A 1AOJA 2KI7A 4J6WA 3QPHA 1TS9A 2E5AA 1VQ4T 4EMGA 2AK5A 3FB9A 1I5LA 2QA4A 5KE3A 3EGDB 3L2QA 4F16A 4FW1A 4P72A 1S72A 1MMAA 1GRIA 2XIDA 3SD4A 1X75C 4CH3A 2SEMA 5KYYA 1PYSB 4ELZC 2G4CA 4UP9A 2ZCFB 3HXYA 2CUBA 1XJWB 2GFUA 1VQNQ 3I9QA 2MAMA 3GP8A 3H0FA 4XK8E 1RABB 1PNJA 1VA7A 3HFZA 2XMFA 2DBKA 1YJWA 4OB3B 1ATIA 4J9GA 2KVQG 4HXJA 4YRLA 1SEMA 2ZAEA 3CMAQ 3CC2T 1NZ9A 3PZCA 4PJOF 4QKUA 4M77F 1I0CA 1KG1A 2ZZFA 5CR2A 1OPKA 2DZ9A 4OMMA 5F5WA 2DRMA 1WZOA 3SWNB 4RMFA 3RGLA 1X56A 3DKMA 5HK3A 2K3BA 2XKOC 3NPFA 5GAOn 2ZPFB 3VS7A 2EWNA 5FU6B 1BBUA 4H2VA 2O9SA 2QQRA 1SHFA 2L3PA 4AG1C 2KRSA 2OAUA 3EG9B 3QZ5B 5AYFA 2XU8A 4WTOB 2EIFA 4PKCC 3CC7T 1VQPT 1AWOA 1JQQA 1Q81U 3MF1A 4HKEA 5KYUB 4C5IA 2A7YA 4GLMA 5LJ5g 5GAN5 4C8QB 1E6HA 1UFFA 3CCUT 5GAN6 1CKAA 4OB0B 2EYQA 3JSCA 3TEHA 2LT4A 4EDUA 1ADJA 1N5ZA 3QYGB 3P8TA 4RG2A 4M78C 3UT1A 1EVLA 4M75G 1Q86R 4P3PA 3GLXA 5A2QE 1OX9A 4M7AD 1X69A 2A8EA 4IIOA 1N27A 5GAOl 1G3TA 2VVKA 1QP3A 1B76A 3KUFA 4PFZA 1KD1C 1UEBA 1MUZA 3MEWA 1KHIA 4C0DC 5CKDA 5GANf 3C95A 1N9SA 3GPLA 4H2WA 2MK5A 2EQMA 2NYSA 2EBPA 4CC7A 4GY5A 4J83A 2ARUA 1WXUA 3VJPA 1QF6A 3EHQA 4KGXB 4LDUA 5D7UA 1KQSP 2Q7EA 1B8AA 5LJ5h 5GAOp 1VQ5A 2BZYA 4LVIA 2HL3A 5LJ5d 4ZTUB 5ELNA 2RQTA 3QWXX 2YWWA 1YWPA 5ECAA 3NETA 1BIAA 1WYXA 3RUXA 3G4SA 2MWOA 2IG0A 4XTWA 3H9NA 1SRLA 1EIFA 2RHXA 5GMKe 12ASA 1U5SA 2DU5A 1E7OA 3BDUA 4TVRA 3UPUA 3CD6T 4QT7A 4CRIA 4OF1A 3FIFA 1G8XA 2EQIA 2HQEA 5I2SA 3EG0A 2RHZA 2CH4W 1TG0A 1Q7YC 1J3TA 3CCVQ 5GAN3 2QDYB 3VS3A 2MIOA 3ME9A 1PKTA 2GGRA 4L87A 3BY7A 3GNGA 1NE8A 1H4QA 4M78G 1VQZA 5LJ3f 3OSVA 4M7DG 2I4LA 1DJ7B 2QASA 2CP2A 3LWIA 3TUPA 3S3OA 1UHFA 1YFNA 2G6FX 5EG2A 1Q95G 1Y07A 2L8DA 2DPPB 1VYTA 1USYC 3HFOA 4M75B 4UPAA 2EL9A 3G6EQ 3S3NA 2A36A 1Y57A 4IUUA 1B07A 1X2KA 1KQ2A 4ZGEB 1ABOA 5C52B 1WA7A 2JM9A 2QTXA 3NMZC 2RJDA 3UH0A 3QDFA 4FL6A 4M75D 3EFRA 4X5OA 1BI2A 1KQSA 2LX7A 1BKBA 1QP2A 2FPEA 4KR2A 2X4XA 3NELA 3CCSA 2DL7A 2W10A 1WXTA 4C0GA 2I4OA 2X3XD 4P71C 2XD0A 4XTYA 5IXBA 4F7UA 2EVRA 2AMCB 3JCMJ 1X6GA 2QQAA 1U1TA 3CCQT 3OYEA 4JLIA 4HVWA 1BBZA 4R55A 4H2TA 2QA4Q 1V1CA 3EFOA 1S72Q 4TVWA 1F1BB 2A28A 3CPWP 2R58A 2JZ2A 4PFOA 2O4XB 3M0RA 1BK2A 2X4JA 1UGSB 1NG2A 4YYEA 2CREA 4IUVA 2OTLA 2IY5B 4PJNA 3CCJT 4RTWA 2D8JA 2K5IA 1B70A 4PJMA 4YRGA 1YJWQ 1E22A 1VQ8T 3M0QA 4C0FA 1YI2T 4WJ4A 1H641 2ZGWA 2GTJA 4FYWB 1YGBA 1NYFA 3M55A 5A0GA 4M7DB 1MHNA 3HY1A 3FJ5A 3LGFA 4X9DA 2IVWA 4A54A 4GLKA 2K7AA 2KY9A 4BY6B 1K9MU 2F2WA 5L23A 3LYIA 3A8GB 1N8RR 1ARKA 4HCCA 1M2VA 2PUOB 2CJAA 4CS2A 2RQUA 1OEBA 2ZPBB 3VV0A 1OOTA 3ASKA 3ULRB 2NS6A 4M78D 2H8HA 2RQRA 3LWHA 3VS4A 1GBQA 4PJOG 4M7DD 2M1HA 1VQKQ 1H8KA 2D8HA 1AWWA 1USYA 3QZ9B 2P0LA 2C0IA 2RM4A 2VC8A 4RTUA 2QYZA 1SESA 4TTVA 2V8KA 2OTJA 1JJ2A 1G5VA 3CCET 4YCUA 1VQLA 2COZA 3O5ZA 1VQ6T 5KCHA 2G3RA 4PLIA 5CVIA 1LJOA 2XTIA 1ZUKA 2P84A 1VQMT 3L42A 4RG8A 2MMPA 1X55A 3HFVA 1PD1A 5A0LA 2ZPHB 1QLYA 3HXZA 4QVZA 1BIBA 2PVDB 4P71A 4EMKB 1I5OB 4FM4B 3VS1A 4RTVA 1SERA 2DK3A 2DL8A 2ZT5A 1YWOA 2OI3A 4NCXA 1QWFA 3I35A 2QQSA 1QQJA 3JCMW 3CCQQ 5GAN7 1A0NB 1RAEB 2MPXC 3EGUA 2ZIOA 4DBQA 3CXCA 1M90R 4TWAA 2HD0A 3JCMe 1JO8A 4OVAA 2P0KA 1EZZB 4MMLA 3CPWS 1VQ5Q 4OMLA 1M1FA 1X2QA 1PG5B 2AHJB 1OULA 4RCCA 3G4SQ 1EX4A 1UTIA 2DIGA 2K2MA 1M3AA 4DEYA 4XU2A 3MQZA 4JDSA 2ZT6A 1OZ3A 4OGEA 2PU9B 2E5KA 2JS0A 7AT1B 4O5VA 1EIYA 1WHJA 3CMEQ 1YCYA 1R8OB 3OYFA 1KC8U 1ZX6A 1Y7XA 4PJOB 4M77B 3CC4Q 4X9CA 1VQNA 3REUA 3WVDB 3MF2A 2MI6A 2CZ1B 4E47A 4BE0A 5KH6A 5FRMA 2LNVA 3CMAA 1OPLA 3Q1JA 2AKLA 1W2BA 1CKBA 3L2RA 1D1BA 2RHYA 5KYXA 2FPFA 3HP9A 4ANJA 2GF7A 1NLOC 3CCLT 1H3HA 2EPDA 2ALYB 4FW2A 2M16A 4PJOD 2FG0A 2L3RA 3JCMQ 1MGQA 4ZTFA 1WI7A 1JU5C 2HMAA 4JJBA 4XEOA 4OB2B 5CO7A 4WF2A 4EIKA 4LDWA 3VKIA 3GBQA 4JJCA 4KGZB 2XDDA 3GF5A 2J05A 1SRMA 2LJ1A 4YDQA 5GAMg 1HSQA 1LNXA 3M54A 1FMWA 1K0XA 3T9NA 3EG2A 4AFUC 2VKNA 1UGQB 2CZ6B 1JXOA 4E7KA 2AIRB 2PVOB 4RTTA 3M4QA 2J6KA 4E6RA 5IHIA 2I0NA 2PQWA 3UATA 3OBWA 1G83A 1Y71A 3OQ5A 1WLEA 2JNGA 1KD1R 4XU1A 2OJ2A 2J3MA 3N5BB 4AMCA 4AH6A 2HBPA 4C0ZA 4QQ6A 2DERA 4L5GA 2RHSA 3OS5A 4IIMA 4FU6A 1VQ9T 2BIVA 4CC2A 4YRCA 3QHSA 4YRTA 2EQUA 2DDZA 2C0TA 4H02A 1NNHA 2QXFA 1Q7YU 5GAMh 3SWNC 5KE2A 1VQ4A 1WU7A 2CT4A 3LSSA 4HWPA 4P72C 5GAMd 3QTCA 2PUKB 4FSXA 4J9HA 4HCKA 3CCMT 2EJFA 1NJ5A 5IHKA 2YSQA 4O6JA 2LQNA 2CSQA 3RMSA 1YJNT 4WI1A 3TQ7P 2RNAA 4PNOA 3UA7A 4HT9A 1GFDA 4YPFA 4M78F 2YDLA 5FU7C 1NBEB 3QO3A 1D0ZA 1KIKA 2C06A 5LJ3j 4HA8A 1T0HA 2H3EB 3CC2A 1HYOA 5IN1A 4UC4A 3O8VA 1YIJT 3JCMb 1FMKA 2E65A 1E6GA 1AZGB 1QKXA 3JCMc 1K73R 1M5Q1 2ZXFA 4XU0A 4LVKA 2ZZDA 3HRIA 2DAQA 3RKYA 1FYNA 2HDAA 1QVFS 1ASYA 1JJCB 2FRWA 4J8OA 1QVGP 1UDLA 2OTJQ 4F14A 1IHWA 2LQKA 1H4SA 5HCKA 3CQTA 2LQ8A 2O2OA 3CC7A 2J3LA 1ACMB 4PG3A 3THKA 3JB9D 4JRQA 1VQPA 3G6EA 2DE0X 4OMPA 2F2XA 4A4KA 2DO3A 1Q82U 4BI3A 1YFSA 2VYTA 4PFPA 3HKSA 3A8HB 1QCFA 4Y28E 2L0AA 2RB6A 4J9BA 2EJ9A 1R0CB 3EHRA 3VS6A 4XTZA 3JCMV 2QQ9A 2VXEA 1YITT 2X35A 5LJ5e 1WX6A 3RMQA 3HRKA 4F04B 1BCOA 4H2UA 2KE9A 2DTHA 3A98A 1I4K1 4JLGA 2VASA 1RLPC 1YCSB 2QGFB 2M9UA 3M0TA 1W6XA 3EGXB 2ESWA 1I07A 2ROLA 3G71T 3L2ZA 4IURA 2WSCE 2P5IA 1KMNA 1X6OA 5IT9E 3TEEA 2QDLA 3SWNA 3V8LA 4HWTA 3OW2P 4HCBA 3BE3A 3MEYA 4H2YA 2F5KA 2OAWA 2ZNJA 3IALA 3CBOA 5GMKl 4WCIA 4ELYC 2L3SA 5C53B 2Q7HA 4O2DA 3EG9A 2KMTA 3M0SA 1NJ1A 1JEGA 2QHUA 1QVGA 2DYBA 3A1PA 2HL5C 5CQXA 2KROA 3RDVA 3GNFB 4VUBA 2FL7A 4Z8AA 5KYUA 3M58A 1X2GA 3M56A 3BW1A 4C8QA 3CD6A 2DNUA 4ZNXA 2K3YA 4ZN3A 1Y0MA 2LNHB 4ATOA 5I11A 1PWTA 5J39A 3A74A 4QVCA 1E24A 1YHQT 4R0KA 2P0PA 3HTRA 1LYLA 4FT4A 1KC8C 2CJBA 4HCZA 1PM3A 1RACB 3X26B 1FWZA 3M0UA 2DFUA 3V7RA 4DBFA 2ARTA 2ODRD 2KT8A 3UA6A 2QEXT 4M7AB 2CZ0B 2E3IA 4NOYA 1VQKA 4DOWA 2YUNA 3OYYA 5DY9A 1RL2A 1XQHA 3EH2A 1MV3A 3PVLA 3P8BB 5GAOm 3P8DA 2J6FA 4E7ZA 1C1AA 2I4MA 2EYWA 4Z88A 2VGNA 3G7ZA 3OW2A 3VUZA 4AFQC 3U23A 2LCSA 2QK0A 3CCRT 5LJ5j 1WHMA 3OYKA 3VBBA 3LC0A 3V7SA 3JCMP 1Q81R 1M3CA 1BYMA 4PJJA 2EKHA 1VQOT 2VWFA 4DPGA 4MZTA 4PLLA 3PGGA 3ZFJA 1WQWA 1N9RA 2OX7A 2M51A 4YCWA 3A7UA 3PMIA 3OMGA 1J5WA 1Y96B 5FW9A 2DX1A 1AWJA 4MDXA 3CCQA 1VQ4Q 2V8JA 1RADB 4BY6C 1NJIC 1X01A 4OMFB 4YRIA 2KK4A 1WJSA 2LT1A 1O9SA 3G1JA 3OYCA 3JCMf 4YRQA 2ZR2A 1PHTA 1IZ6A 5J3BA 3M53A 3CCJA 3BFMA 3AHUA 4II1A 3JB9H 2WSEE 3VQWA 1BB9A 2HSPA 1I1JA 2BTTA 4F7UE 4M75A 4B9WA 3CC2Q 2KEAA 2XI9A 1QCOA 3RR6A 8AT1B 1NM7A 2LX9A 1YI2A 4E7HA 3CMEA 5GAOq 2KT1A 1UG1A 1W70A 1NYRA 2CP5A 1WDXA 2Q5IA 4CH5A 2O31A 2A3LA 3SHWA 3CC4A 4YTLA 2YUQA 4KR3A 3R6NA 2FEIA 2DD5A 2Y4YA 1D3BA 2CP0A 3NTIA 3JB9F 5CCAA 3RL6A 3I55T 3QIIA 1B34B 2XK0A 4DBHA 4IUTA 4MZPA 3CC7Q 4TQFA 1VQPQ 4QVDA 5K1PA 1I81A 3QBYA 2ZNIA 4LD9K 1WNLA 4D8KA 2AMCA 3GIBA 2A37A 1C6VX 3C94A 2ARSA 3FDRA 5I22A 3OY9A 2X4YA 3L2WA 3CCUQ 2KNBB 3TVTA 1UB4A 2DL3A 1KJWA 5DM7R 3CCEA 1QW1A 3PCOB 1U1SA 2O4XA 1RI0A 1RAAB 3GOXA 3H0HA 1VQ6A 2YLBA 3AT1B 2IY5A 3MEVA 2MCNA 4V2SA 1VQMA 3LLRA 3JB9I 1RUWA 1UHCA 1WLPB 3OD1A 1UE9A 1SKUB 2JXBA 4B6MA 4YRFA 5GAOr 1RAFB 4KUIA 2DVEA 3VQYA 4YREA 3VYHB 2ATCB 1EFNA 5FRNA 3ICAA 1Q82C 3RF1A 1JJ2P 4M7DA 1EFWA 4OP0A 2NUTB 4QW2A 4LE9A 2Q5HA 2JW4A 2RPNA 2FPDA 2QGGA 4JJDA 2E64A 4OMOA 4M77C 1ZBXA 1BI3A 5M9OA 4LDVA 2FZCB 1KQSS 2CS7A 4OMQA 1M1KU 2P4TA 4RDXA 1MV0B 3X20B 2DMOA 4ZN1A 3OYMA 1O75A 4Z89A 2QG9B 2VUBA 2RQWA 2XG8D 1PKSA 3MP8A 1ASZA 5HK0A 3BJUA 1SHGA 4J7IA 3P8YA 1YFTA 4LVMA 4M78B 3DLLA 4FYVB 3KBGA 4K88A 3CXCP 3R6OA 1IGUA 3C4SA 3CD6Q 3E1SA 5GMKj 1XTDA 5GAN8 2SRCA 4M77E 2K9GA 2ABLA 4HWSA 4KQEA 2ZZGA 3H8ZA 2DU7A 2FRYA 4C0DB 2EFIA 1PC0A 1ZHIA 1QKWA 2D9TA 3MP6A 2KQWA 3E9GA 3MCAB 2HQXA 1NPPA 3SFMA 3OSSC 3CCLA 2CDTA 1WJRA 4KH1B 2DLPA 1IHVA 4XTVA 3SDZA 2M0YA 2ZT8A 1NEBA 2JM8A 2KXDA 4RCBA 1K9MR 3MEAA 2MYSA 4BB7A 3TREA 4TVAB 1B7YB 4N4GA 5IHNA 1TWBA 1W2BP 4ESRA 3ZBDA 2YT6A 3H41A 1G3WA 1YP5A 1D09B 2J7IA 1W4SA 2CJ9A 3HXWA 5DLOA 2DIQA 3V8KA 2I2LA 1VOMA 3RIRA 3TCJA 1ZUYA 4CI0C 3E2UA 3VYGA 5GAMe 2RJFA 1TSFA 4AG2C 3LW5E 1Z7NA 2M02A 1M9SA 4RTZA 4UP8A 2VV5A 2X4WA 1JJ2S 1NLPC 3A8MB 4L6V5 3QO8A 2E4HA 5LJ5f 2O88A 1ZSGA 4M77A 3CCST 4BI4A 1YJ9T 1C0MA 3SB2A 4CC4B 4J15A 2D1XA 3LGLA 1M3BA 1NEGA 4RQFA 3V8JA 4R56A 1GCQC 3M0PA 2CP6A 2E3HA 2EQKA 4JRKA 1WPYA 1B7TA 3CCJQ 1VQ9A 4BACA 3FLGA 1M27C 2ALYA 4BD3A 2PTKA 3NFCA 1VQ8Q 3UGQA 2RI5A 2KBTA 3HSBA 2JMCA 4P74C 1YI2Q 2OTLT 4PL6A 3CXCS 4YRSA 1VYVA 4QQDA 3CCMA 1D1AA 2DTIA 1VQ7T 2E6NA 3OYNA 2EGAA 2EYZA 2GTOA 2L89A 1WIEA 4J6YA 2C8MA 1YJNA 1H4VB 1IXDA 1Z9ZA 3E9IA 2X9HA 1NJ6A 5D6WA 3REBB 2AKWA 5K1XA 2XDBA 4YROA 2DBMA 1T0JA 4C92C 1PRMC 4LNPA 4YRKA 3M4PA 3CEYA 4EPCA 1KC8R 5HKCA 4H2XB 3JV3A 4HWOA 2DXTA 1ZA1B 1JBMA 3I56T 3UFGA 4HVUA 3WVEB 3JB9G 3HRSA 3CCEQ 1LCKA 1L0WA 3E19A 3JAME 1W2BS 3OS2A 1VQ6Q 4LNSA 4C92E 1E1OA 1VQMQ 1K8AU 3URGA 2ZINA 4JS5A 2B86A 2JT4A 2ROTA 2K79A 5CKHA 1E1TA 5L8RE 4HT8A 4C5GA 5GANg 1NJIU 2KDSA 2HKQB 3A7AA 4A4HA 1N9WA 3M59A 1ZSZB 1IO6A 4BE2A 11ASA 3QYHB 2C0OA 4JJNK 3MO8A 3L4GB 3VU3C 3J7AF 1G3SA 1TU0B 4LD6A 2KRMA 2XHCA 4EX5A 2D0NA 3LH5A 1GCQA 1I8FA 4OGCA 4C5EA 2MF2A 1W66A 3V7CA 3UF4A 2ZPEB 2RHQA 1TUGB 2QAZA 5CKBA 2KR3A 1XOVA 2DILA 5CQYA 1OX8A 2X3WD 4P74A 1QVPA 3CMQA 1W1FA 2CGHA 1FMVA 2NUPB 5FU6C 6AT1B 1JJCA 5C51B 2AZVA 2ED1A 3ZEHA 1SG5A 3VS0A 2BE9B 2W0ZA 3OYDA 2KXCA 1T3SA 4FYXB 4HT4A 2Y90A 5GANh 4M7AC 3META 1M1KC 4P75C 2DEQA 5LJ3g 1EQRA 5KYWB 2VXFA 4J9DA 5GANd 2KGTA 2XDPA 1AEYA 1X6BA 4C8QC 1Q7YR 4C92A 3IKLA 5HGQA 1BCMA 3C12A 3CCLQ 1WQ7A 3JB9J 3PT9A 3NTKA 2Z0WA 3VUBA 2HZYA 4F7UF 3CMAT 1WHKA 2EYXA 2B8AA 2CSIA 5CIUA 2E5QA 3FRNA 1YHQA 4MDWA 1KSWA 4M7AE 2ZR3A 2L5QA 3HFNA 2V26A 2LDMA 2RO0A 1OI1A 5DLQE 3J81E 2QEXA 4C8QE 3EGXA 3M4YA 9ATCB 4HVCA 2JJ9A 2YUOA 4A4FA 1WHGA 4Q15A 2HCKA 1D0YA 2LMJA 2RK1A 1R0BG 3BDLA 3SEMA 4CS4A 3CCUA 1PRLC 3EGDA 2FZKB 1QWEA 3HRUA 1V29B 3PE0A 1JRIA 1X43A 3RACA 5GJWB 5LJ3h
chains in the Genus database with same CATH topology
5KCOA 1PYSA 2ZCEA 2LCCA 3A8LB 2LC4A 2DZCA 2JUFA 1KMMA 3QNEA 3CCRA 2DXUA 4A4GA 4IUPA 4BE1A 2E3CA 1VQOA 4RMOA 3UGTA 1AHJB 2LVMA 3ER0A 3PTAA 3DB4A 2ZPIB 2H3JA 1X2HA 3IKMB 2RI3A 2WACA 3QO7A 4KBMB 4X34A 4M7AA 3EFSA 4P75A 4M75C 3F70A 4J7FA 3PIOA 2DJZA 4PHCA 3OYBA 2GFAA 3QJ6A 3M9QA 4E51A 4BDYA 3WXMB 2XICA 5LL6S 1FX7A 2RJEA 1SETA 3RKWA 3A5ZB 3QUIA 1QVGS 4B9XA 2JOYA 2RI2A 3CCVT 2K2VA 3A32A 4M75E 3I55A 3OS0A 4ZIBA 5GAN2 1C0AA 4CS3A 1Y96A 2FYKA 2K5FA 1Q86U 1HK9A 2JVVA 5KNNA 1HXDA 2JN0A 3TU4K 1IL2A 5D6YA 5FU7B 3HFZB 3HTZA 2E12A 4K86A 3E9HA 4XQ3A 3FEOA 3G6ET 3P8VA 4DOVA 3CBPA 5I21A 4CH4A 4A4EA 1KQ1A 4UP7A 4KT0E 5GAMf 4JRIA 2RK2A 1K8AC 4N0AA 4M7DC 2QQBA 2DQ0A 3OB9A 3MHXA 1BBWA 3OW2S 4C8QD 1SSFA 3NEMA 1SRYA 2ZT7A 4P3OA 4LVJA 1ADYA 2QA4T 1B34A 1S72T 3TEHB 4M78E 1VQ8A 4M7DE 3I7FA 1NJ8A 5A0DA 2EKOA 1YJWT 3KFUA 3OYJA 3PCOA 1QE0A 3RERA 4RKUE 2KAFA 4JS4A 4JUVA 1KHCA 2VGMA 2ZZEA 4ZGDB 3EAEA 1RIQA 4EMKC 1K73C 3A5YA 2GCXA 2LRQA 4F7UG 1NPRA 4J5YA 5ELOA 1BI1A 2C7IA 3KXTA 3OYAA 1VQKT 4IKFA 2CIMA 3W3SA 1M1GA 2E6ZA 3R07A 3X28B 3RESA 2K57A 3LH0A 3OA6A 4IUQA 3A31A 3PIPA 3QG1A 4ZGJB 4M78A 3S3MA 4C92F 1D3BB 2QHVA 4PJOC 3VQVA 4DA4A 1YJ9A 4BWAA 2NLUA 1WJQA 4FT2A 2RH2A 4NL3A 3OYHA 1H3ZA 4XTUA 4Z02A 2QI2A 3NTHA 4BUGA 2LCLA 4KUDK 2BUDA 1VQ5T 1H4TA 3DB3A 1GGMA 1YFRA 1N8RU 2ZIMA 4PJOE 3G4ST 4FIBA 4TVYA 4TVAA 1B7YA 4BI8B 1VQ7A 1G51A 4JRPA 2YLCA 3OYLA 1JB0E 2FVUA 2PVGB 4F7UB 2K3XA 3CMET 4BW9A 3OYIA 2E1HA 4YCVA 5E3IA 3CC4T 2DD4A 2F5TX 3QXEB 2DKGA 4EMKA 1WYDA 1X54A 4OB1B 1HC7A 3REXA 4K87A 1B70B 3I56A 2MWPA 4M77G 3M5AA 2HNIA 1G5HA 5GMKh 2E10A 3MEUA 3HXUA 4ME7A 2D6FA 4QQGA 1FXXA 3JCMX 3INZA 4M7AF 3A7RA 2LTOA 5J26A 4EMHA 2O01E 1M90U 2JTMA 4DQ2A 3A8OB 4C8QF 1Q86C 4A53A 2K4YA 3CPWA 1OYXA 4PJOA 1VIFA 3M57A 3CBMA 4YRPA 2EQJA 3CPFA 4MMKA 3QJYA 1Z7MA 4YRNA 2DQ3A 2D0QB 5GANe 1Q81C 4E7LA 2YRVA 2ZTGA 4HWRA 2WSFE 2YHTA 2QHSA 3LX7A 3G1ZA 5C6SA 1KOGA 4H2XA 4XEMA 2BKDN 4G85A 4Q6GA 1M8VA 3PFSA 3QDRB 2RD1A 2HAXA 2R5AA 1U8RA 3PNWC 3OBYA 2V8IA 3QSUA 2EJGA 4TQDA 5C0MA 2R5MA 2ZPGB 2Y4XA 2Q7GA 4CH6A 3JRZA 5I2MA 3FC3A 1N6AA 1YIJA 3HXVA 5LJ3e 2QHTA 4XU3A 4E7JA 4YP0A 1VIEA 3M4GA 3LSQA 3L4GA 2K5LA 1PSFA 3HY0A 4J6XA 3OMCA 4WJ3M 3HHTB 2KSSA 3L2UA 4P73C 1BI0A 2M0OA 4M77D 1NJ2A 4D6WA 1WGSA 4LDXA 1EIYB 2OTJT 3P8HA 3QO5A 3IG2A 4MZMA 3VQXA 1VQLT 1NYQA 3NENA 2R57A 4M75F 1KD1U 5GAMj 3HXXA 1YITA 2PMEA 2FB7A 4KULA 3RKXA 2GQVA 2RA2A 5CKEA 3OYGA 2AKWB 1LOJA 3X24B 5CK9A 2I4NA 3UWNA 5IAYA 4YRMA 4H2SA 3JCMg 2CKKA 4C5HA 1TH7A 5GANj 2FHDA 3L2VA 4NL2A 2PMFA 2ODRC 3G71A 2E41A 4G84A 4C92G 3TEGA 5FROA 4OLFA 1ZQ1A 2F69A 3H6ZA 1VUBA 4LVLA 1IREB 1YBYA 4N4IA 2EAYA 1G5IA 3J80E 4XTXA 1P92A 1K73U 3MP1A 1GXIE 2CZ7B 2DXBA 1VQNT 1QVFA 3PMTA 3FJPA 4XAXB 3JCMh 1N8RC 5FLXE 4M7DF 3JCMd 2RHSB 1FYFA 4YRJA 4LDYA 4N4HA 3HRTA 2RJCA 3CCVA 2CYZB 1UGRB 4ZTJA 1G3YA 2RHQB 4P73A 1M4ZA 4E7IA 2DXCA 1PSEA 4NS5A 5GMKi 4L59A 2RHUA 4BDZA 3UDCA 1K9MC 5HY6A 1HTTA 2P0QA 1OZ2A 4Q5WA 2DTOA 5CKFA 5LJ3d 3QKJA 2E70A 1YB3A 1UGPB 3WQZA 3HPWA 4C92B 4Y91A 5D6XA 3ERRA 4EO4A 4M7AG 4YRRA 3S6WA 4N0AC 3L1AA 5GAN4 4P3NA 1XNIA 1EVKA 2XGTA 2JTFA 5CAIA 4C8QG 4RQEA 3OS1A 5GMKm 2RHIA 3E9FA 4ZTZB 3DLMA 4P5NA 1M90C 4C92D 3DSQA 1EOVA 3A5ZA 3HL8A 3X25B 4J6WA 3QPHA 2E5AA 1VQ4T 4EMGA 1I5LA 3FB9A 2QA4A 5KE3A 3L2QA 4P72A 1S72A 2XIDA 3SD4A 1X75C 4CH3A 1PYSB 4ELZC 2G4CA 4UP9A 2ZCFB 3HXYA 2GFUA 2MAMA 3GP8A 4XK8E 3HFZA 1YJWA 4OB3B 1ATIA 2KVQG 4YRLA 3CC2T 1NZ9A 3PZCA 4PJOF 4M77F 1KG1A 2ZZFA 5CR2A 2DZ9A 5F5WA 3SWNB 4RMFA 3RGLA 1X56A 3DKMA 5HK3A 2XKOC 5GAOn 2ZPFB 2EWNA 5FU6B 1BBUA 4H2VA 2QQRA 2OAUA 3QZ5B 5AYFA 2XU8A 2EIFA 4PKCC 3CC7T 1VQPT 1Q81U 3MF1A 4HKEA 4C5IA 2A7YA 5GAN5 5LJ5g 4C8QB 3CCUT 5GAN6 4OB0B 2EYQA 3JSCA 3TEHA 2LT4A 4EDUA 1ADJA 3QYGB 3P8TA 4RG2A 4M78C 3UT1A 1EVLA 4M75G 4P3PA 3GLXA 5A2QE 4M7AD 2A8EA 1N27A 5GAOl 1G3TA 1QP3A 1B76A 3KUFA 1KD1C 1UEBA 3MEWA 1KHIA 4C0DC 5CKDA 5GANf 3C95A 1N9SA 3GPLA 4H2WA 2EQMA 4GY5A 4J83A 2ARUA 3VJPA 1QF6A 4LDUA 2Q7EA 1B8AA 5LJ5h 5GAOp 1VQ5A 4LVIA 5LJ5d 4ZTUB 5ELNA 3NETA 1BIAA 3RUXA 3G4SA 2MWOA 2IG0A 4XTWA 1EIFA 12ASA 2RHXA 5GMKe 2DU5A 3BDUA 4TVRA 3UPUA 3CD6T 4CRIA 4OF1A 3FIFA 2HQEA 5I2SA 2RHZA 1Q7YC 5GAN3 2QDYB 3ME9A 4L87A 3BY7A 3GNGA 1NE8A 1H4QA 4M78G 1VQZA 5LJ3f 3OSVA 4M7DG 2I4LA 1DJ7B 3LWIA 3TUPA 3S3OA 5EG2A 1Y07A 2L8DA 2DPPB 1USYC 4UPAA 3HFOA 4M75B 2EL9A 3S3NA 4IUUA 1KQ2A 4ZGEB 5C52B 2QTXA 2RJDA 3UH0A 4FL6A 4M75D 3EFRA 4X5OA 1BI2A 1KQSA 1BKBA 1QP2A 4KR2A 2X4XA 3NELA 3CCSA 4C0GA 2I4OA 4P71C 2XD0A 4XTYA 4F7UA 2AMCB 3JCMJ 2QQAA 1U1TA 3CCQT 3OYEA 4JLIA 4H2TA 4R55A 4TVWA 2R58A 2JZ2A 2O4XB 2X4JA 1UGSB 4YYEA 4IUVA 2OTLA 2IY5B 3CCJT 2K5IA 1B70A 4YRGA 1E22A 1VQ8T 4C0FA 1YI2T 4WJ4A 1H641 2ZGWA 1YGBA 3M55A 5A0GA 4M7DB 1MHNA 3HY1A 3LGFA 4X9DA 2IVWA 4A54A 4GLKA 2KY9A 4BY6B 1K9MU 3LYIA 3A8GB 4HCCA 2PUOB 2CJAA 4CS2A 2ZPBB 3VV0A 3ASKA 2NS6A 4M78D 3LWHA 4PJOG 4M7DD 2M1HA 1USYA 3QZ9B 2P0LA 2RM4A 2VC8A 1SESA 4TTVA 2V8KA 2OTJA 1JJ2A 1G5VA 3CCET 4YCUA 1VQLA 1VQ6T 5KCHA 2G3RA 4PLIA 5CVIA 1LJOA 2XTIA 1VQMT 3L42A 4RG8A 2MMPA 1X55A 3HFVA 5A0LA 2ZPHB 3HXZA 4QVZA 1BIBA 2PVDB 4P71A 4EMKB 4FM4B 1SERA 2DK3A 2ZT5A 4NCXA 2QQSA 3JCMW 5GAN7 2ZIOA 4TWAA 3CXCA 2HD0A 3JCMe 4OVAA 2P0KA 4MMLA 3CPWS 1M1FA 2AHJB 4RCCA 2DIGA 4XU2A 3MQZA 4JDSA 2ZT6A 1OZ3A 4OGEA 2PU9B 4O5VA 1EIYA 1YCYA 1R8OB 3OYFA 1KC8U 1Y7XA 4PJOB 4M77B 4X9CA 1VQNA 3REUA 3WVDB 3MF2A 2MI6A 2CZ1B 4E47A 4BE0A 5KH6A 5FRMA 2LNVA 3CMAA 3Q1JA 1W2BA 3L2RA 2RHYA 3HP9A 2GF7A 3CCLT 2ALYB 2M16A 4PJOD 2L3RA 3JCMQ 1MGQA 4ZTFA 4XEOA 4OB2B 5CO7A 4WF2A 4LDWA 3VKIA 2XDDA 3GF5A 4YDQA 5GAMg 1LNXA 3M54A 3T9NA 1UGQB 2CZ6B 4E7KA 2PVOB 3M4QA 2PQWA 3OBWA 1Y71A 3OQ5A 1WLEA 2JNGA 4XU1A 2J3MA 3N5BB 4AH6A 2HBPA 4C0ZA 4QQ6A 4L5GA 2RHSA 3OS5A 4FU6A 1VQ9T 2BIVA 4YRCA 3QHSA 4YRTA 2EQUA 2DDZA 4H02A 1NNHA 2QXFA 1Q7YU 5GAMh 3SWNC 5KE2A 1VQ4A 1WU7A 4HWPA 3LSSA 4P72C 5GAMd 3QTCA 2PUKB 4FSXA 3CCMT 2EJFA 1NJ5A 4O6JA 3RMSA 1YJNT 4WI1A 4PNOA 4HT9A 4YPFA 4M78F 5FU7C 3QO3A 2C06A 5LJ3j 4HA8A 3CC2A 5IN1A 4UC4A 3O8VA 1YIJT 3JCMb 2E65A 3JCMc 1M5Q1 2ZXFA 4XU0A 4LVKA 2ZZDA 3HRIA 2DAQA 3RKYA 1QVFS 1ASYA 1JJCB 4J8OA 2LQKA 1H4SA 2LQ8A 3CC7A 2J3LA 4PG3A 3JB9D 4JRQA 1VQPA 3G6EA 4A4KA 2DO3A 1Q82U 4BI3A 1YFSA 2VYTA 3HKSA 3A8HB 4Y28E 2RB6A 2EJ9A 4XTZA 3JCMV 2QQ9A 2VXEA 1YITT 2X35A 5LJ5e 3RMQA 3HRKA 4H2UA 2DTHA 1I4K1 4JLGA 2M9UA 3G71T 3L2ZA 4IURA 2WSCE 2P5IA 1KMNA 1X6OA 5IT9E 3TEEA 3SWNA 3V8LA 4HWTA 4HCBA 3MEYA 4H2YA 2F5KA 2ZNJA 3IALA 3CBOA 5GMKl 4ELYC 5C53B 2Q7HA 4O2DA 2KMTA 1NJ1A 2QHUA 1QVGA 5CQXA 3GNFB 4VUBA 2FL7A 3M58A 1X2GA 3M56A 3BW1A 4C8QA 3CD6A 2K3YA 4ZN3A 4ATOA 5J39A 3A74A 4QVCA 1E24A 1YHQT 2P0PA 1LYLA 4FT4A 1KC8C 2CJBA 4HCZA 3X26B 1FWZA 3V7RA 2ARTA 2ODRD 2QEXT 4M7AB 2CZ0B 4NOYA 1VQKA 4DOWA 3OYYA 5DY9A 1RL2A 1XQHA 3P8BB 5GAOm 3P8DA 2I4MA 2VGNA 3G7ZA 3OW2A 3VUZA 3CCRT 5LJ5j 3OYKA 3VBBA 3LC0A 3V7SA 3JCMP 1BYMA 1VQOT 4DPGA 4MZTA 3PGGA 4PLLA 3ZFJA 1WQWA 1N9RA 4YCWA 3A7UA 3PMIA 3OMGA 1J5WA 1Y96B 4MDXA 3CCQA 2V8JA 4BY6C 1NJIC 1X01A 4OMFB 4YRIA 2KK4A 1WJSA 2LT1A 1O9SA 3OYCA 3JCMf 4YRQA 2ZR2A 1IZ6A 5J3BA 3M53A 3CCJA 3BFMA 3AHUA 4II1A 3JB9H 2WSEE 3VQWA 4F7UE 4M75A 4B9WA 2XI9A 1YI2A 2LX9A 4E7HA 3CMEA 5GAOq 1NYRA 2Q5IA 4CH5A 2A3LA 3CC4A 4YTLA 4KR3A 2DD5A 2Y4YA 1D3BA 3NTIA 3JB9F 5CCAA 3RL6A 3I55T 3QIIA 1B34B 2XK0A 4IUTA 4MZPA 4TQFA 4QVDA 5K1PA 1I81A 3QBYA 2ZNIA 4LD9K 1WNLA 2AMCA 3GIBA 3C94A 2ARSA 3FDRA 3OY9A 2X4YA 3L2WA 1UB4A 5DM7R 3CCEA 1QW1A 3PCOB 1U1SA 2O4XA 1RI0A 3GOXA 1VQ6A 2YLBA 2IY5A 3MEVA 4V2SA 1VQMA 3LLRA 3JB9I 3OD1A 4YRFA 5GAOr 4KUIA 2DVEA 3VQYA 4YREA 3VYHB 5FRNA 3ICAA 1Q82C 3RF1A 4M7DA 1EFWA 4OP0A 4QW2A 2Q5HA 2E64A 4M77C 1ZBXA 1BI3A 5M9OA 4LDVA 1KQSS 2CS7A 1M1KU 2P4TA 4RDXA 3X20B 4ZN1A 3OYMA 1O75A 2VUBA 2XG8D 3MP8A 1ASZA 5HK0A 3BJUA 4J7IA 3P8YA 1YFTA 4LVMA 4M78B 3DLLA 3KBGA 4K88A 3R6OA 3C4SA 3E1SA 5GMKj 1XTDA 5GAN8 4M77E 4HWSA 4KQEA 2ZZGA 3H8ZA 2DU7A 4C0DB 2EFIA 1ZHIA 2D9TA 3MP6A 2KQWA 3E9GA 3MCAB 2HQXA 1NPPA 3SFMA 3OSSC 3CCLA 1WJRA 4XTVA 3SDZA 2ZT8A 4RCBA 3MEAA 4BB7A 3TREA 4TVAB 1B7YB 4N4GA 3ZBDA 1G3WA 2CJ9A 1W4SA 3HXWA 5DLOA 2DIQA 3V8KA 2I2LA 3RIRA 3TCJA 4CI0C 3VYGA 5GAMe 2RJFA 3LW5E 1Z7NA 1M9SA 4UP8A 2VV5A 2X4WA 1JJ2S 3A8MB 4L6V5 3QO8A 5LJ5f 4M77A 3CCST 4BI4A 1YJ9T 3SB2A 4J15A 3LGLA 4RQFA 3V8JA 4R56A 2EQKA 4JRKA 1WPYA 1VQ9A 4BACA 3FLGA 2ALYA 4BD3A 3NFCA 3UGQA 2RI5A 3HSBA 4P74C 2OTLT 4PL6A 3CXCS 4YRSA 4QQDA 3CCMA 2DTIA 1VQ7T 2E6NA 3OYNA 2L89A 2C8MA 4J6YA 1YJNA 1H4VB 3E9IA 1NJ6A 5D6WA 2AKWA 5K1XA 2XDBA 4YROA 4C92C 4YRKA 3M4PA 3CEYA 4EPCA 5HKCA 4H2XB 4HWOA 2DXTA 1JBMA 3I56T 3UFGA 3WVEB 3JB9G 3HRSA 1L0WA 3E19A 3JAME 1W2BS 3OS2A 4LNSA 4C92E 1E1OA 1K8AU 3URGA 2ZINA 4JS5A 5CKHA 1E1TA 5L8RE 4HT8A 4C5GA 5GANg 1NJIU 2KDSA 3A7AA 4A4HA 1N9WA 3M59A 4BE2A 11ASA 3QYHB 4JJNK 3MO8A 3L4GB 3VU3C 3J7AF 1G3SA 4LD6A 2XHCA 4EX5A 1I8FA 4OGCA 4C5EA 2MF2A 1W66A 3V7CA 2ZPEB 2RHQA 5CKBA 1XOVA 5CQYA 4P74A 1QVPA 3CMQA 2CGHA 5FU6C 1JJCA 5C51B 3ZEHA 3OYDA 4HT4A 2Y90A 5GANh 4M7AC 3META 1M1KC 4P75C 2DEQA 5LJ3g 1EQRA 2VXFA 5GANd 2XDPA 4C8QC 4C92A 3IKLA 5HGQA 3C12A 1WQ7A 3JB9J 3PT9A 3NTKA 3VUBA 4F7UF 3CMAT 2B8AA 5CIUA 2E5QA 3FRNA 1YHQA 4MDWA 4M7AE 2ZR3A 2L5QA 3HFNA 2LDMA 2RO0A 1OI1A 5DLQE 3J81E 2QEXA 4C8QE 3M4YA 4HVCA 4A4FA 4Q15A 2RK1A 3BDLA 4CS4A 3CCUA 3HRUA 1V29B 1JRIA 3RACA 5LJ3h
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ4 A;  1H64 1;  2ZGW A;  3HY0 A;  4J6X A;  1PYS A;  1YGB A;  2ZCE A;  4WJ3 M;  4M7D B;  1X01 A;  4YRI A;  4P73 C;  2DZC A;  3HY1 A;  4X9D A;  4M77 D;  4A54 A;  1KMM A;  1NJ2 A;  3QNE A;  3JCM f;  2DXU A;  4YRQ A;  2E3C A;  2ZR2 A;  1EIY B;  4CS2 A;  2CJA A;  3QO5 A;  3IG2 A;  3BFM A;  3AHU A;  3UGT A;  3VQX A;  3JB9 H;  1NYQ A;  3NEN A;  3VQW A;  4M75 F;  4M78 D;  4F7U E;  4M75 A;  5GAM j;  3HXX A;  4PJO G;  4M7D D;  2PME A;  2FB7 A;  3RKX A;  2RA2 A;  1USY A;  5GAO q;  1X2H A;  1NYR A;  2AKW B;  1LOJ A;  2Q5I A;  3IKM B;  4CH5 A;  2I4N A;  3QO7 A;  2P0L A;  4H2S A;  4YRM A;  2RM4 A;  2VC8 A;  3JCM g;  4KR3 A;  1SES A;  4TTV A;  1TH7 A;  5GAN j;  1D3B A;  4M7A A;  3EFS A;  4YCU A;  4P75 A;  4NL2 A;  2PMF A;  2ODR C;  4M75 C;  3JB9 F;  2E41 A;  4G84 A;  3RL6 A;  4C92 G;  1LJO A;  2DJZ A;  1B34 B;  2XTI A;  4PHC A;  3TEG A;  4OLF A;  1X55 A;  4TQF A;  3HFV A;  4QVD A;  5K1P A;  1I81 A;  2ZNI A;  3HXZ A;  1WNL A;  4E51 A;  2AMC A;  1BIB A;  3GIB A;  2ARS A;  4P71 A;  4EMK B;  2EAY A;  1G5I A;  1SET A;  3RKW A;  1SER A;  3QUI A;  2ZT5 A;  4XTX A;  4NCX A;  3JCM W;  3PCO B;  1U1S A;  5GAN 7;  2ZIO A;  3A32 A;  4TWA A;  2YLB A;  4M75 E;  2IY5 A;  3JCM e;  4V2S A;  4MML A;  4ZIB A;  3JB9 I;  3OD1 A;  5GAN 2;  1C0A A;  4CS3 A;  4YRF A;  5GAO r;  1Y96 A;  2FYK A;  3FJP A;  2DVE A;  3VQY A;  4RCC A;  3JCM h;  4YRE A;  1HK9 A;  4M7D F;  3JCM d;  3ICA A;  2RHS B;  5KNN A;  1HXD A;  4XU2 A;  2JN0 A;  3RF1 A;  4M7D A;  1IL2 A;  1EFW A;  4OP0 A;  1FYF A;  2ZT6 A;  4YRJ A;  3HFZ B;  3HTZ A;  2Q5H A;  3E9H A;  4XQ3 A;  4K86 A;  3P8V A;  2E64 A;  4M77 C;  5I21 A;  1EIY A;  4CH4 A;  2RHQ B;  4P73 A;  1YCY A;  4PJO B;  4RDX A;  4M77 B;  1KQ1 A;  4X9C A;  4UP7 A;  5GMK i;  3REU A;  3MF2 A;  5GAM f;  4JRI A;  4N0A A;  1ASZ A;  4M7D C;  1HTT A;  3BJU A;  3P8Y A;  2DQ0 A;  1YFT A;  2DTO A;  4M78 B;  5LJ3 d;  1YB3 A;  1BBW A;  4K88 A;  4C8Q D;  5GAN 8;  5GMK j;  2ALY B;  4M77 E;  4PJO D;  3NEM A;  3WQZ A;  1SRY A;  3JCM Q;  4HWS A;  4KQE A;  2ZT7 A;  4P3O A;  1MGQ A;  4C92 B;  2ZZG A;  4Y91 A;  3ERR A;  4XEO A;  1ADY A;  4EO4 A;  4M7A G;  2DU7 A;  4WF2 A;  4YRR A;  1B34 A;  4N0A C;  3L1A A;  3TEH B;  5GAN 4;  4P3N A;  4M78 E;  1EVK A;  2XGT A;  4YDQ A;  5CAI A;  5GAM g;  4C8Q G;  4RQE A;  4M7D E;  5GMK m;  1LNX A;  4ZTZ B;  3I7F A;  1NJ8 A;  4C92 D;  3DSQ A;  1EOV A;  4XTV A;  3A5Z A;  2ZT8 A;  3KFU A;  4J6W A;  4RCB A;  3PCO A;  3M4Q A;  1QE0 A;  3RER A;  2E5A A;  4TVA B;  4EMG A;  1I5L A;  3FB9 A;  1B7Y B;  4JUV A;  4P72 A;  1WLE A;  2ZZE A;  4XU1 A;  2CJ9 A;  2J3M A;  3HXW A;  4CH3 A;  3V8K A;  2I2L A;  4AH6 A;  1PYS B;  3RIR A;  1RIQ A;  4EMK C;  2G4C A;  4UP9 A;  2RHS A;  3HXY A;  3A5Y A;  5GAM e;  4F7U G;  4YRC A;  3HFZ A;  4J5Y A;  3QHS A;  4YRT A;  5ELO A;  1ATI A;  2DDZ A;  4YRL A;  1Z7N A;  4H02 A;  1NNH A;  2C7I A;  4UP8 A;  5GAM h;  3SWN C;  3PZC A;  1WU7 A;  4HWP A;  3LSS A;  4PJO F;  3QO8 A;  4P72 C;  4M77 F;  5LJ5 f;  5GAM d;  2CIM A;  2ZZF A;  3W3S A;  2DZ9 A;  3QTC A;  5F5W A;  4M77 A;  3SWN B;  2EJF A;  3R07 A;  4RMF A;  3RES A;  3RGL A;  1NJ5 A;  3SB2 A;  1X56 A;  2K57 A;  4J15 A;  4RQF A;  3V8J A;  4WI1 A;  5GAO n;  4PNO A;  3A31 A;  4HT9 A;  4YPF A;  4M78 F;  2EWN A;  1BBU A;  4H2V A;  4JRK A;  1WPY A;  4M78 A;  3QO3 A;  5LJ3 j;  4HA8 A;  2ALY A;  4C92 F;  1D3B B;  3UGQ A;  3HSB A;  2QHV A;  4PJO C;  3MF1 A;  4P74 C;  3JCM b;  2E65 A;  5GAN 5;  5LJ5 g;  3VQV A;  4YRS A;  3JCM c;  4C8Q B;  4BWA A;  2DTI A;  1M5Q 1;  5GAN 6;  2ZXF A;  4XU0 A;  3TEH A;  3HRI A;  3RKY A;  2C8M A;  4J6Y A;  1H4V B;  1ASY A;  1ADJ A;  1JJC B;  3P8T A;  3E9I A;  4M78 C;  1NJ6 A;  4NL3 A;  4M75 G;  1EVL A;  4P3P A;  4XTU A;  4M7A D;  1H4S A;  2AKW A;  5GAO l;  5K1X A;  1H4T A;  1B76 A;  1GGM A;  4C92 C;  2J3L A;  4YRO A;  1YFR A;  4PG3 A;  3JB9 D;  2ZIM A;  4PJO E;  1YFS A;  4YRK A;  3M4P A;  4TVY A;  4TVA A;  1B7Y A;  5GAN f;  1G51 A;  1N9S A;  2RB6 A;  4H2X B;  4H2W A;  4HWO A;  2DXT A;  2EJ9 A;  2YLC A;  4XTZ A;  3JCM V;  1JBM A;  2VXE A;  2ARU A;  3UFG A;  5LJ5 e;  3JB9 G;  1QF6 A;  4F7U B;  1L0W A;  3HRK A;  4BW9 A;  2E1H A;  4YCV A;  2Q7E A;  5E3I A;  1B8A A;  4H2U A;  5LJ5 h;  5GAO p;  2DTH A;  4LNS A;  4C92 E;  1E1O A;  2DKG A;  4EMK A;  5LJ5 d;  1I4K 1;  2ZIN A;  1WYD A;  4ZTU B;  5ELN A;  3NET A;  1X54 A;  1BIA A;  3RUX A;  1E1T A;  4HT8 A;  4XTW A;  1HC7 A;  5GAN g;  5GMK e;  3L2Z A;  12AS A;  3REX A;  3A7A A;  1N9W A;  2P5I A;  2DU5 A;  1KMN A;  4K87 A;  3BDU A;  3SWN A;  1B70 B;  3V8L A;  4HWT A;  11AS A;  4M77 G;  3FIF A;  3L4G B;  2HNI A;  1G5H A;  3VU3 C;  5GMK h;  3MEY A;  2E10 A;  4H2Y A;  5GAN 3;  2ZNJ A;  3HXU A;  3IAL A;  5GMK l;  4L87 A;  3BY7 A;  4EX5 A;  5C53 B;  2Q7H A;  4O2D A;  3JCM X;  1H4Q A;  4M78 G;  3INZ A;  1VQZ A;  1NJ1 A;  1I8F A;  4M7A F;  2QHU A;  3A7R A;  5LJ3 f;  4M7D G;  4EMH A;  1W66 A;  2I4L A;  3V7C A;  4DQ2 A;  1X2G A;  4C8Q F;  4A53 A;  2RHQ A;  3TUP A;  3BW1 A;  4C8Q A;  4YRP A;  4PJO A;  4UPA A;  4P74 A;  1USY C;  3HFO A;  4M75 B;  4MMK A;  3CMQ A;  2EL9 A;  2CGH A;  1Z7M A;  4YRN A;  2DQ3 A;  1JJC A;  5GAN e;  5C51 B;  3A74 A;  4QVC A;  1E24 A;  2ZTG A;  1LYL A;  4HWR A;  1KQ2 A;  2CJB A;  2Y90 A;  5GAN h;  4M7A C;  2YHT A;  5C52 B;  4P75 C;  2QHS A;  2QTX A;  2DEQ A;  5LJ3 g;  1EQR A;  2VXF A;  5GAN d;  3G1Z A;  3V7R A;  3UH0 A;  2ART A;  2ODR D;  4M7A B;  4M75 D;  4C8Q C;  3EFR A;  4NOY A;  1KOG A;  4X5O A;  4C92 A;  3IKL A;  5HGQ A;  4KR2 A;  4H2X A;  4XEM A;  3NEL A;  4G85 A;  5DY9 A;  1WQ7 A;  3JB9 J;  4Q6G A;  2I4O A;  4P71 C;  1M8V A;  4F7U F;  4XTY A;  2RD1 A;  5GAO m;  4F7U A;  2AMC B;  3JCM J;  1U1T A;  2I4M A;  3QSU A;  4JLI A;  4H2T A;  4M7A E;  2EJG A;  4TQD A;  2ZR3 A;  3HFN A;  4TVW A;  2Q7G A;  4CH6 A;  5LJ5 j;  4C8Q E;  3VBB A;  3LC0 A;  3V7S A;  4YYE A;  3JCM P;  3HXV A;  4HVC A;  2IY5 B;  4Q15 A;  5LJ3 e;  2QHT A;  4XU3 A;  4DPG A;  3PGG A;  4YP0 A;  1WQW A;  4CS4 A;  1N9R A;  3M4G A;  1B70 A;  4YCW A;  3LSQ A;  3A7U A;  4YRG A;  1E22 A;  1J5W A;  1JRI A;  1Y96 B;  3RAC A;  3L4G A;  5LJ3 h; 
#chains in the Genus database with same CATH topology
 5KCO A;  1PYS A;  2ZCE A;  2LCC A;  3A8L B;  2LC4 A;  2DZC A;  2JUF A;  1KMM A;  2K6D A;  3QNE A;  1T3L A;  3CCR A;  2DXU A;  4A4G A;  4IUP A;  2JTE A;  4BE1 A;  5FWB A;  2E3C A;  2NWM A;  4PJL A;  1VQO A;  1Q82 R;  1JXM A;  4RMO A;  3UGT A;  1AHJ B;  2LVM A;  1VQ9 Q;  4F17 A;  3RNJ A;  1U3O A;  3ER0 A;  3PTA A;  2DL5 A;  3NGP A;  4J9E A;  3DB4 A;  2ZPI B;  2H3J A;  1X2H A;  3IKM B;  2A0F B;  1OV3 A;  2V1R A;  2RI3 A;  2WAC A;  3CCM Q;  3QO7 A;  3D7S B;  1MMD A;  4KBM B;  4X34 A;  1RAI B;  1YJN Q;  1TTH B;  4M7A A;  3EFS A;  4P75 A;  4M75 C;  3F70 A;  4J7F A;  3PIO A;  2FZG B;  2DJZ A;  1M2O A;  4PHC A;  2P4R A;  3OYB A;  2GFA A;  3QJ6 A;  1UEC A;  5EC7 A;  3M9Q A;  1YIJ Q;  4E51 A;  4BDY A;  1ABQ A;  2RMO A;  1UJ0 A;  1GFC A;  3WXM B;  2LP5 A;  2XIC A;  5LL6 S;  1FX7 A;  2RJE A;  1SET A;  3RKW A;  1GBR A;  3A5Z B;  3QUI A;  4RUG A;  2MOX A;  3MJX A;  2HBW A;  1QVG S;  4B9X A;  2JOY A;  2RI2 A;  3CCV T;  2K2V A;  2HSE B;  3A32 A;  1RAH B;  4M75 E;  3I55 A;  3VRZ A;  3OS0 A;  2LJ0 A;  4ZIB A;  1RLQ C;  5GAN 2;  1C0A A;  4CS3 A;  1Y96 A;  2YRC A;  2FYK A;  2K5F A;  1Q86 U;  5KYY B;  1KFZ A;  1HK9 A;  2JVV A;  2DF6 A;  1HXD A;  5KNN A;  2JN0 A;  3TU4 K;  1IL2 A;  5D6Y A;  5FU7 B;  1GL5 A;  2GQI A;  3HFZ B;  3HTZ A;  2E12 A;  4K86 A;  3E9H A;  4XQ3 A;  3FEO A;  5IXF A;  1X27 A;  1YIT Q;  3G6E T;  1AZE A;  3P8V A;  4FYY B;  4DOV A;  3CBP A;  5I21 A;  2COY A;  4CH4 A;  1PCX A;  2NUZ A;  1K9A A;  4DEX A;  4OMN A;  4DBR A;  4A4E A;  1UUE A;  1KQ1 A;  4UP7 A;  4KT0 E;  5GAM f;  4JRI A;  2RK2 A;  1K8A C;  4N0A A;  1QCN A;  1LVK A;  4M7D C;  2QQB A;  4HVV A;  2DQ0 A;  3OB9 A;  3G71 Q;  2DEU A;  5FWC A;  3MHX A;  1BBW A;  3OW2 S;  2DVJ A;  4C8Q D;  1SSF A;  1R77 A;  3NEM A;  1SRY A;  2GBQ A;  2ZT7 A;  4P3O A;  4PK4 A;  4LVJ A;  1ADY A;  2EW3 A;  5KYN A;  2QA4 T;  1B34 A;  2YXY A;  1S72 T;  3TEH B;  4M78 E;  5AT1 B;  1VQ8 A;  4M7D E;  1K1Z A;  3C0C A;  2HQH A;  1RI9 A;  1MMG A;  3RBB B;  4J9I A;  3I7F A;  1SF9 A;  1NJ8 A;  5A0D A;  1OU9 A;  1TOV A;  2EKO A;  1YJW T;  1QMC A;  3KFU A;  3OYJ A;  3PCO A;  1QE0 A;  3RER A;  4RKU E;  2KAF A;  1YHQ Q;  1IB8 A;  4JS4 A;  4JUV A;  5IH2 A;  2IIM A;  1KHC A;  2VGM A;  3TSW A;  3H0I A;  2ED0 A;  2ZZE A;  2RQV A;  4ZGD B;  3EAE A;  2QEX Q;  1RIQ A;  4EMK C;  1K73 C;  3A5Y A;  3EG1 A;  2NUT A;  2GCX A;  2EYY A;  2LRQ A;  4F7U G;  1NPR A;  4J5Y A;  1LPL A;  5ELO A;  1BI1 A;  2C7I A;  3KXT A;  2PNI A;  3OYA A;  1OU8 A;  1VQK T;  1K76 A;  4IKF A;  2CIM A;  3W3S A;  1M1G A;  1NYG A;  2E6Z A;  3R07 A;  3X28 B;  3RES A;  1IGQ A;  1ZBJ A;  2K57 A;  4LN2 A;  3LH0 A;  2ECZ A;  3IQL A;  2AKK A;  1K4U S;  4ORZ A;  3OA6 A;  3CCR Q;  4IUQ A;  3A31 A;  2ENM A;  3PIP A;  3QG1 A;  4ZGJ B;  4M78 A;  1VQO Q;  3S3M A;  4C92 F;  1D3B B;  1H92 A;  2QHV A;  4PJO C;  3VQV A;  4DA4 A;  3I5S A;  2J6O A;  3QWY A;  1YJ9 A;  4BWA A;  2NLU A;  3EH1 A;  1M30 A;  1WJQ A;  3VRY A;  3PVQ A;  4FT2 A;  2RH2 A;  4D8D A;  4NL3 A;  3OYH A;  1H3Z A;  1VYU A;  4XTU A;  4Z02 A;  2QI2 A;  3NTH A;  4BUG A;  2LCL A;  4JZ4 A;  4KUD K;  2BUD A;  1VQ5 T;  1H4T A;  1TUD A;  3DB3 A;  1GGM A;  1YFR A;  1N8R U;  2ZIM A;  4PJO E;  2CUD A;  1M8M A;  3G4S T;  4FIB A;  4TVY A;  4TVA A;  2COW A;  1B7Y A;  4BI8 B;  1VQ7 A;  1G51 A;  4JRP A;  4KGV B;  2YLC A;  3OYL A;  1G2B A;  1M1K R;  2DJQ A;  2KYB A;  4LUD A;  1JB0 E;  2FVU A;  2PVG B;  1PD0 A;  4F7U B;  2K3X A;  3CME T;  2EGC A;  4BW9 A;  3OYI A;  2E1H A;  4YCV A;  5E3I A;  3CC4 T;  3I55 Q;  1Z9Q A;  2DD4 A;  1YN8 A;  2F5T X;  3EFO B;  3QXE B;  2DKG A;  4EMK A;  1WYD A;  3TSZ A;  1ZSZ C;  1X54 A;  4KRT A;  4OB1 B;  1HC7 A;  3REX A;  3VS2 A;  1TUC A;  2F2V A;  4K87 A;  1B70 B;  3I56 A;  2MWP A;  4M77 G;  1AD5 A;  3M5A A;  2EGE A;  2HNI A;  1G5H A;  5GMK h;  2E10 A;  3MEU A;  3HXU A;  4ME7 A;  1WHH A;  2D6F A;  2DYI A;  3I5R A;  4QQG A;  1FXX A;  2AZS A;  3JCM X;  3INZ A;  4M7A F;  3A7R A;  2LTO A;  2IPO B;  1WXB A;  1HD3 A;  5J26 A;  8ATC B;  2A08 A;  4EMH A;  2O01 E;  1M90 U;  1M2V B;  2JTM A;  2QTV A;  4DQ2 A;  3A8O B;  4C8Q F;  1Q86 C;  4A53 A;  2K4Y A;  1MND A;  3CPW A;  2DM1 A;  1OYX A;  1VIF A;  3M57 A;  3CBM A;  4PJO A;  4YRP A;  4MMK A;  3CPF A;  2EQJ A;  1ZA2 B;  3QJY A;  1Z7M A;  4YRN A;  2DQ3 A;  2D0Q B;  5GAN e;  2BZ8 A;  2VB6 A;  1Q81 C;  4E7L A;  2YRV A;  2ZTG A;  4HWR A;  2WSF E;  4Y92 A;  2YHT A;  1D1C A;  2QHS A;  3LX7 A;  4M4Z A;  3G1Z A;  5C6S A;  2LQW A;  1KOG A;  2L3Q A;  4H2X A;  4XEM A;  2BKD N;  4G85 A;  1D0X A;  2F1L A;  4Q6G A;  4AFZ C;  2LZ6 B;  1M8V A;  3PFS A;  3QDR B;  2J06 A;  4FSS A;  2RD1 A;  2HAX A;  2R5A A;  1KK7 A;  1U8R A;  4K11 A;  1TXQ A;  3PNW C;  3OBY A;  2V8I A;  3QSU A;  2YRD A;  2EJG A;  4TQD A;  5C0M A;  1UGV A;  2R5M A;  2ZPG B;  2RN8 A;  2Y4X A;  2Q7G A;  4CH6 A;  3JRZ A;  5I2M A;  4AT1 B;  3FC3 A;  1N6A A;  1YIJ A;  3HXV A;  2V1Q A;  1AT1 B;  5LJ3 e;  2QHT A;  4XU3 A;  4E7J A;  4YP0 A;  1ZSZ A;  2GNC A;  1VIE A;  3M4G A;  2HEQ A;  3LSQ A;  1GCP A;  2HKN A;  1SSH A;  3L4G A;  2K5L A;  3NHN A;  1S1N A;  2BE7 D;  1PSF A;  3HY0 A;  4J6X A;  1AVZ C;  3OMC A;  4WJ3 M;  2X51 A;  3HHT B;  2KSS A;  3L2U A;  4P73 C;  1BI0 A;  2M0O A;  4M77 D;  4JPB W;  2CP3 A;  1NJ2 A;  1QVF P;  4D6W A;  1WGS A;  4LDX A;  1EIY B;  2OTJ T;  3P8H A;  3QO5 A;  3IG2 A;  4MZM A;  3VQX A;  1VQL T;  4J9C A;  1NYQ A;  2R57 A;  1AWX A;  4M75 F;  3NEN A;  1KD1 U;  5GAM j;  3HXX A;  2NUP A;  1YIT A;  2FB7 A;  2PME A;  4KUL A;  3RKX A;  2GQV A;  2RA2 A;  3REA B;  5CKE A;  3OYG A;  1MNE A;  2KYM A;  2LJ3 A;  2AKW B;  1LOJ A;  2O9V A;  4RTX A;  3X24 B;  4CC3 A;  5CK9 A;  5KYX B;  2DRK A;  3CCS Q;  2I4N A;  3UWN A;  5IAY A;  1YJ9 Q;  4YRM A;  1HJD A;  4H2S A;  5KYW A;  3JCM g;  1K8A R;  2CP7 A;  2CKK A;  4C5H A;  1TH7 A;  5GAN j;  1ZUU A;  2FHD A;  4J9F A;  3L2V A;  4RTY A;  4NL2 A;  2PMF A;  2ODR C;  1YNZ A;  3G71 A;  2E41 A;  4G84 A;  4C92 G;  1NJI R;  1BU1 A;  3TEG A;  5FRO A;  4OLF A;  1ZQ1 A;  2F69 A;  3H6Z A;  1ZLM A;  1VUB A;  4LVL A;  2OTL Q;  1IRE B;  1YBY A;  1SPK A;  4LUE A;  4GBQ A;  4N4I A;  1VQ7 Q;  2EAY A;  1G5I A;  3J80 E;  2BZX A;  2JMA A;  1U06 A;  4XTX A;  2KRN A;  1P92 A;  4AFS C;  1K73 U;  2DA9 A;  3MP1 A;  1GXI E;  5GJV B;  2CZ7 B;  2DXB A;  3VS5 A;  1WFW A;  3ZL7 C;  4KH0 B;  3KFV A;  1VQN T;  1QVF A;  3PMT A;  3FJP A;  4XAX B;  3JCM h;  1N8R C;  5FLX E;  4E7S A;  4M7D F;  3MPU B;  3JCM d;  2RHS B;  2PZ1 A;  1FYF A;  4YRJ A;  4LDY A;  4N4H A;  2RF0 A;  3HRT A;  3I56 Q;  2RJC A;  3CCV A;  2CYZ B;  1UGR B;  1OQK A;  4ZTJ A;  1G3Y A;  2RHQ B;  4P73 A;  1M4Z A;  4E7I A;  2DXC A;  1PSE A;  4NS5 A;  5GMK i;  4L59 A;  2RHU A;  4BDZ A;  3UDC A;  1K9M C;  5HY6 A;  1HTT A;  1VQL Q;  2P0Q A;  1OZ2 A;  4JZ3 A;  4Q5W A;  2DTO A;  1IRX A;  1MMN A;  5CKF A;  4LXC A;  5LJ3 d;  4A63 B;  3QKJ A;  2E70 A;  1YB3 A;  4E2F B;  1UGP B;  3WQZ A;  2AT1 B;  1CSK A;  1RAG B;  1B3Q A;  3HPW A;  4C92 B;  4Y91 A;  5D6X A;  2JS2 A;  3ERR A;  4EO4 A;  4M7A G;  4YRR A;  1V76 A;  3S6W A;  2CT3 A;  4N0A C;  3L1A A;  5GAN 4;  4P3N A;  1XNI A;  3EG3 A;  1EVK A;  2JTF A;  2XGT A;  5CAI A;  4FCY A;  2YUP A;  4C8Q G;  4RQE A;  2L2P A;  2FO0 A;  3OS1 A;  2DL4 A;  5GMK m;  2RHI A;  3E9F A;  4X1V A;  4ZTZ B;  3DLM A;  3MKD A;  4P5N A;  1M90 C;  1K0S A;  1WHL A;  4C92 D;  2DET A;  3DSQ A;  1EOV A;  1UJY A;  3A5Z A;  3HL8 A;  3X25 B;  2CH4 A;  1AOJ A;  2KI7 A;  4J6W A;  3QPH A;  1TS9 A;  2E5A A;  1VQ4 T;  4EMG A;  2AK5 A;  3FB9 A;  1I5L A;  2QA4 A;  5KE3 A;  3EGD B;  3L2Q A;  4F16 A;  4FW1 A;  4P72 A;  1S72 A;  1MMA A;  1GRI A;  2XID A;  3SD4 A;  1X75 C;  4CH3 A;  2SEM A;  5KYY A;  1PYS B;  4ELZ C;  2G4C A;  4UP9 A;  2ZCF B;  3HXY A;  2CUB A;  1XJW B;  2GFU A;  1VQN Q;  3I9Q A;  2MAM A;  3GP8 A;  3H0F A;  4XK8 E;  1RAB B;  1PNJ A;  1VA7 A;  3HFZ A;  2XMF A;  2DBK A;  1YJW A;  4OB3 B;  1ATI A;  4J9G A;  2KVQ G;  4HXJ A;  4YRL A;  1SEM A;  2ZAE A;  3CMA Q;  3CC2 T;  1NZ9 A;  3PZC A;  4PJO F;  4QKU A;  4M77 F;  1I0C A;  1KG1 A;  2ZZF A;  5CR2 A;  1OPK A;  2DZ9 A;  4OMM A;  5F5W A;  2DRM A;  1WZO A;  3SWN B;  4RMF A;  3RGL A;  1X56 A;  3DKM A;  5HK3 A;  2K3B A;  2XKO C;  3NPF A;  5GAO n;  2ZPF B;  3VS7 A;  2EWN A;  5FU6 B;  1BBU A;  4H2V A;  2O9S A;  2QQR A;  1SHF A;  2L3P A;  4AG1 C;  2KRS A;  2OAU A;  3EG9 B;  3QZ5 B;  5AYF A;  2XU8 A;  4WTO B;  2EIF A;  4PKC C;  3CC7 T;  1VQP T;  1AWO A;  1JQQ A;  1Q81 U;  3MF1 A;  4HKE A;  5KYU B;  4C5I A;  2A7Y A;  4GLM A;  5LJ5 g;  5GAN 5;  4C8Q B;  1E6H A;  1UFF A;  3CCU T;  5GAN 6;  1CKA A;  4OB0 B;  2EYQ A;  3JSC A;  3TEH A;  2LT4 A;  4EDU A;  1ADJ A;  1N5Z A;  3QYG B;  3P8T A;  4RG2 A;  4M78 C;  3UT1 A;  1EVL A;  4M75 G;  1Q86 R;  4P3P A;  3GLX A;  5A2Q E;  1OX9 A;  4M7A D;  1X69 A;  2A8E A;  4IIO A;  1N27 A;  5GAO l;  1G3T A;  2VVK A;  1QP3 A;  1B76 A;  3KUF A;  4PFZ A;  1KD1 C;  1UEB A;  1MUZ A;  3MEW A;  1KHI A;  4C0D C;  5CKD A;  5GAN f;  3C95 A;  1N9S A;  3GPL A;  4H2W A;  2MK5 A;  2EQM A;  2NYS A;  2EBP A;  4CC7 A;  4GY5 A;  4J83 A;  2ARU A;  1WXU A;  3VJP A;  1QF6 A;  3EHQ A;  4KGX B;  4LDU A;  5D7U A;  1KQS P;  2Q7E A;  1B8A A;  5LJ5 h;  5GAO p;  1VQ5 A;  2BZY A;  4LVI A;  2HL3 A;  5LJ5 d;  4ZTU B;  5ELN A;  2RQT A;  3QWX X;  2YWW A;  1YWP A;  5ECA A;  3NET A;  1BIA A;  1WYX A;  3RUX A;  3G4S A;  2MWO A;  2IG0 A;  4XTW A;  3H9N A;  1SRL A;  1EIF A;  2RHX A;  5GMK e;  12AS A;  1U5S A;  2DU5 A;  1E7O A;  3BDU A;  4TVR A;  3UPU A;  3CD6 T;  4QT7 A;  4CRI A;  4OF1 A;  3FIF A;  1G8X A;  2EQI A;  2HQE A;  5I2S A;  3EG0 A;  2RHZ A;  2CH4 W;  1TG0 A;  1Q7Y C;  1J3T A;  3CCV Q;  5GAN 3;  2QDY B;  3VS3 A;  2MIO A;  3ME9 A;  1PKT A;  2GGR A;  4L87 A;  3BY7 A;  3GNG A;  1NE8 A;  1H4Q A;  4M78 G;  1VQZ A;  5LJ3 f;  3OSV A;  4M7D G;  2I4L A;  1DJ7 B;  2QAS A;  2CP2 A;  3LWI A;  3TUP A;  3S3O A;  1UHF A;  1YFN A;  2G6F X;  5EG2 A;  1Q95 G;  1Y07 A;  2L8D A;  2DPP B;  1VYT A;  1USY C;  3HFO A;  4M75 B;  4UPA A;  2EL9 A;  3G6E Q;  3S3N A;  2A36 A;  1Y57 A;  4IUU A;  1B07 A;  1X2K A;  1KQ2 A;  4ZGE B;  1ABO A;  5C52 B;  1WA7 A;  2JM9 A;  2QTX A;  3NMZ C;  2RJD A;  3UH0 A;  3QDF A;  4FL6 A;  4M75 D;  3EFR A;  4X5O A;  1BI2 A;  1KQS A;  2LX7 A;  1BKB A;  1QP2 A;  2FPE A;  4KR2 A;  2X4X A;  3NEL A;  3CCS A;  2DL7 A;  2W10 A;  1WXT A;  4C0G A;  2I4O A;  2X3X D;  4P71 C;  2XD0 A;  4XTY A;  5IXB A;  4F7U A;  2EVR A;  2AMC B;  3JCM J;  1X6G A;  2QQA A;  1U1T A;  3CCQ T;  3OYE A;  4JLI A;  4HVW A;  1BBZ A;  4R55 A;  4H2T A;  2QA4 Q;  1V1C A;  3EFO A;  1S72 Q;  4TVW A;  1F1B B;  2A28 A;  3CPW P;  2R58 A;  2JZ2 A;  4PFO A;  2O4X B;  3M0R A;  1BK2 A;  2X4J A;  1UGS B;  1NG2 A;  4YYE A;  2CRE A;  4IUV A;  2OTL A;  2IY5 B;  4PJN A;  3CCJ T;  4RTW A;  2D8J A;  2K5I A;  1B70 A;  4PJM A;  4YRG A;  1YJW Q;  1E22 A;  1VQ8 T;  3M0Q A;  4C0F A;  1YI2 T;  4WJ4 A;  1H64 1;  2ZGW A;  2GTJ A;  4FYW B;  1YGB A;  1NYF A;  3M55 A;  5A0G A;  4M7D B;  1MHN A;  3HY1 A;  3FJ5 A;  3LGF A;  4X9D A;  2IVW A;  4A54 A;  4GLK A;  2K7A A;  2KY9 A;  4BY6 B;  1K9M U;  2F2W A;  5L23 A;  3LYI A;  3A8G B;  1N8R R;  1ARK A;  4HCC A;  1M2V A;  2PUO B;  2CJA A;  4CS2 A;  2RQU A;  1OEB A;  2ZPB B;  3VV0 A;  1OOT A;  3ASK A;  3ULR B;  2NS6 A;  4M78 D;  2H8H A;  2RQR A;  3LWH A;  3VS4 A;  1GBQ A;  4PJO G;  4M7D D;  2M1H A;  1VQK Q;  1H8K A;  2D8H A;  1AWW A;  1USY A;  3QZ9 B;  2P0L A;  2C0I A;  2RM4 A;  2VC8 A;  4RTU A;  2QYZ A;  1SES A;  4TTV A;  2V8K A;  2OTJ A;  1JJ2 A;  1G5V A;  3CCE T;  4YCU A;  1VQL A;  2COZ A;  3O5Z A;  1VQ6 T;  5KCH A;  2G3R A;  4PLI A;  5CVI A;  1LJO A;  2XTI A;  1ZUK A;  2P84 A;  1VQM T;  3L42 A;  4RG8 A;  2MMP A;  1X55 A;  3HFV A;  1PD1 A;  5A0L A;  2ZPH B;  1QLY A;  3HXZ A;  4QVZ A;  1BIB A;  2PVD B;  4P71 A;  4EMK B;  1I5O B;  4FM4 B;  3VS1 A;  4RTV A;  1SER A;  2DK3 A;  2DL8 A;  2ZT5 A;  1YWO A;  2OI3 A;  4NCX A;  1QWF A;  3I35 A;  2QQS A;  1QQJ A;  3JCM W;  3CCQ Q;  5GAN 7;  1A0N B;  1RAE B;  2MPX C;  3EGU A;  2ZIO A;  4DBQ A;  3CXC A;  1M90 R;  4TWA A;  2HD0 A;  3JCM e;  1JO8 A;  4OVA A;  2P0K A;  1EZZ B;  4MML A;  3CPW S;  1VQ5 Q;  4OML A;  1M1F A;  1X2Q A;  1PG5 B;  2AHJ B;  1OUL A;  4RCC A;  3G4S Q;  1EX4 A;  1UTI A;  2DIG A;  2K2M A;  1M3A A;  4DEY A;  4XU2 A;  3MQZ A;  4JDS A;  2ZT6 A;  1OZ3 A;  4OGE A;  2PU9 B;  2E5K A;  2JS0 A;  7AT1 B;  4O5V A;  1EIY A;  1WHJ A;  3CME Q;  1YCY A;  1R8O B;  3OYF A;  1KC8 U;  1ZX6 A;  1Y7X A;  4PJO B;  4M77 B;  3CC4 Q;  4X9C A;  1VQN A;  3REU A;  3WVD B;  3MF2 A;  2MI6 A;  2CZ1 B;  4E47 A;  4BE0 A;  5KH6 A;  5FRM A;  2LNV A;  3CMA A;  1OPL A;  3Q1J A;  2AKL A;  1W2B A;  1CKB A;  3L2R A;  1D1B A;  2RHY A;  5KYX A;  2FPF A;  3HP9 A;  4ANJ A;  2GF7 A;  1NLO C;  3CCL T;  1H3H A;  2EPD A;  2ALY B;  4FW2 A;  2M16 A;  4PJO D;  2FG0 A;  2L3R A;  3JCM Q;  1MGQ A;  4ZTF A;  1WI7 A;  1JU5 C;  2HMA A;  4JJB A;  4XEO A;  4OB2 B;  5CO7 A;  4WF2 A;  4EIK A;  4LDW A;  3VKI A;  3GBQ A;  4JJC A;  4KGZ B;  2XDD A;  3GF5 A;  2J05 A;  1SRM A;  2LJ1 A;  4YDQ A;  5GAM g;  1HSQ A;  1LNX A;  3M54 A;  1FMW A;  1K0X A;  3T9N A;  3EG2 A;  4AFU C;  2VKN A;  1UGQ B;  2CZ6 B;  1JXO A;  4E7K A;  2AIR B;  2PVO B;  4RTT A;  3M4Q A;  2J6K A;  4E6R A;  5IHI A;  2I0N A;  2PQW A;  3UAT A;  3OBW A;  1G83 A;  1Y71 A;  3OQ5 A;  1WLE A;  2JNG A;  1KD1 R;  4XU1 A;  2OJ2 A;  2J3M A;  3N5B B;  4AMC A;  4AH6 A;  2HBP A;  4C0Z A;  4QQ6 A;  2DER A;  4L5G A;  2RHS A;  3OS5 A;  4IIM A;  4FU6 A;  1VQ9 T;  2BIV A;  4CC2 A;  4YRC A;  3QHS A;  4YRT A;  2EQU A;  2DDZ A;  2C0T A;  4H02 A;  1NNH A;  2QXF A;  1Q7Y U;  5GAM h;  3SWN C;  5KE2 A;  1VQ4 A;  1WU7 A;  2CT4 A;  3LSS A;  4HWP A;  4P72 C;  5GAM d;  3QTC A;  2PUK B;  4FSX A;  4J9H A;  4HCK A;  3CCM T;  2EJF A;  1NJ5 A;  5IHK A;  2YSQ A;  4O6J A;  2LQN A;  2CSQ A;  3RMS A;  1YJN T;  4WI1 A;  3TQ7 P;  2RNA A;  4PNO A;  3UA7 A;  4HT9 A;  1GFD A;  4YPF A;  4M78 F;  2YDL A;  5FU7 C;  1NBE B;  3QO3 A;  1D0Z A;  1KIK A;  2C06 A;  5LJ3 j;  4HA8 A;  1T0H A;  2H3E B;  3CC2 A;  1HYO A;  5IN1 A;  4UC4 A;  3O8V A;  1YIJ T;  3JCM b;  1FMK A;  2E65 A;  1E6G A;  1AZG B;  1QKX A;  3JCM c;  1K73 R;  1M5Q 1;  2ZXF A;  4XU0 A;  4LVK A;  2ZZD A;  3HRI A;  2DAQ A;  3RKY A;  1FYN A;  2HDA A;  1QVF S;  1ASY A;  1JJC B;  2FRW A;  4J8O A;  1QVG P;  1UDL A;  2OTJ Q;  4F14 A;  1IHW A;  2LQK A;  1H4S A;  5HCK A;  3CQT A;  2LQ8 A;  2O2O A;  3CC7 A;  2J3L A;  1ACM B;  4PG3 A;  3THK A;  3JB9 D;  4JRQ A;  1VQP A;  3G6E A;  2DE0 X;  4OMP A;  2F2X A;  4A4K A;  2DO3 A;  1Q82 U;  4BI3 A;  1YFS A;  2VYT A;  4PFP A;  3HKS A;  3A8H B;  1QCF A;  4Y28 E;  2L0A A;  2RB6 A;  4J9B A;  2EJ9 A;  1R0C B;  3EHR A;  3VS6 A;  4XTZ A;  3JCM V;  2QQ9 A;  2VXE A;  1YIT T;  2X35 A;  5LJ5 e;  1WX6 A;  3RMQ A;  3HRK A;  4F04 B;  1BCO A;  4H2U A;  2KE9 A;  2DTH A;  3A98 A;  1I4K 1;  4JLG A;  2VAS A;  1RLP C;  1YCS B;  2QGF B;  2M9U A;  3M0T A;  1W6X A;  3EGX B;  2ESW A;  1I07 A;  2ROL A;  3G71 T;  3L2Z A;  4IUR A;  2WSC E;  2P5I A;  1KMN A;  1X6O A;  5IT9 E;  3TEE A;  2QDL A;  3SWN A;  3V8L A;  4HWT A;  3OW2 P;  4HCB A;  3BE3 A;  3MEY A;  4H2Y A;  2F5K A;  2OAW A;  2ZNJ A;  3IAL A;  3CBO A;  5GMK l;  4WCI A;  4ELY C;  2L3S A;  5C53 B;  2Q7H A;  4O2D A;  3EG9 A;  2KMT A;  3M0S A;  1NJ1 A;  1JEG A;  2QHU A;  1QVG A;  2DYB A;  3A1P A;  2HL5 C;  5CQX A;  2KRO A;  3RDV A;  3GNF B;  4VUB A;  2FL7 A;  4Z8A A;  5KYU A;  3M58 A;  1X2G A;  3M56 A;  3BW1 A;  4C8Q A;  3CD6 A;  2DNU A;  4ZNX A;  2K3Y A;  4ZN3 A;  1Y0M A;  2LNH B;  4ATO A;  5I11 A;  1PWT A;  5J39 A;  3A74 A;  4QVC A;  1E24 A;  1YHQ T;  4R0K A;  2P0P A;  3HTR A;  1LYL A;  4FT4 A;  1KC8 C;  2CJB A;  4HCZ A;  1PM3 A;  1RAC B;  3X26 B;  1FWZ A;  3M0U A;  2DFU A;  3V7R A;  4DBF A;  2ART A;  2ODR D;  2KT8 A;  3UA6 A;  2QEX T;  4M7A B;  2CZ0 B;  2E3I A;  4NOY A;  1VQK A;  4DOW A;  2YUN A;  3OYY A;  5DY9 A;  1RL2 A;  1XQH A;  3EH2 A;  1MV3 A;  3PVL A;  3P8B B;  5GAO m;  3P8D A;  2J6F A;  4E7Z A;  1C1A A;  2I4M A;  2EYW A;  4Z88 A;  2VGN A;  3G7Z A;  3OW2 A;  3VUZ A;  4AFQ C;  3U23 A;  2LCS A;  2QK0 A;  3CCR T;  5LJ5 j;  1WHM A;  3OYK A;  3VBB A;  3LC0 A;  3V7S A;  3JCM P;  1Q81 R;  1M3C A;  1BYM A;  4PJJ A;  2EKH A;  1VQO T;  2VWF A;  4DPG A;  4MZT A;  4PLL A;  3PGG A;  3ZFJ A;  1WQW A;  1N9R A;  2OX7 A;  2M51 A;  4YCW A;  3A7U A;  3PMI A;  3OMG A;  1J5W A;  1Y96 B;  5FW9 A;  2DX1 A;  1AWJ A;  4MDX A;  3CCQ A;  1VQ4 Q;  2V8J A;  1RAD B;  4BY6 C;  1NJI C;  1X01 A;  4OMF B;  4YRI A;  2KK4 A;  1WJS A;  2LT1 A;  1O9S A;  3G1J A;  3OYC A;  3JCM f;  4YRQ A;  2ZR2 A;  1PHT A;  1IZ6 A;  5J3B A;  3M53 A;  3CCJ A;  3BFM A;  3AHU A;  4II1 A;  3JB9 H;  2WSE E;  3VQW A;  1BB9 A;  2HSP A;  1I1J A;  2BTT A;  4F7U E;  4M75 A;  4B9W A;  3CC2 Q;  2KEA A;  2XI9 A;  1QCO A;  3RR6 A;  8AT1 B;  1NM7 A;  2LX9 A;  1YI2 A;  4E7H A;  3CME A;  5GAO q;  2KT1 A;  1UG1 A;  1W70 A;  1NYR A;  2CP5 A;  1WDX A;  2Q5I A;  4CH5 A;  2O31 A;  2A3L A;  3SHW A;  3CC4 A;  4YTL A;  2YUQ A;  4KR3 A;  3R6N A;  2FEI A;  2DD5 A;  2Y4Y A;  1D3B A;  2CP0 A;  3NTI A;  3JB9 F;  5CCA A;  3RL6 A;  3I55 T;  3QII A;  1B34 B;  2XK0 A;  4DBH A;  4IUT A;  4MZP A;  3CC7 Q;  4TQF A;  1VQP Q;  4QVD A;  5K1P A;  1I81 A;  3QBY A;  2ZNI A;  4LD9 K;  1WNL A;  4D8K A;  2AMC A;  3GIB A;  2A37 A;  1C6V X;  3C94 A;  2ARS A;  3FDR A;  5I22 A;  3OY9 A;  2X4Y A;  3L2W A;  3CCU Q;  2KNB B;  3TVT A;  1UB4 A;  2DL3 A;  1KJW A;  5DM7 R;  3CCE A;  1QW1 A;  3PCO B;  1U1S A;  2O4X A;  1RI0 A;  1RAA B;  3GOX A;  3H0H A;  1VQ6 A;  2YLB A;  3AT1 B;  2IY5 A;  3MEV A;  2MCN A;  4V2S A;  1VQM A;  3LLR A;  3JB9 I;  1RUW A;  1UHC A;  1WLP B;  3OD1 A;  1UE9 A;  1SKU B;  2JXB A;  4B6M A;  4YRF A;  5GAO r;  1RAF B;  4KUI A;  2DVE A;  3VQY A;  4YRE A;  3VYH B;  2ATC B;  1EFN A;  5FRN A;  3ICA A;  1Q82 C;  3RF1 A;  1JJ2 P;  4M7D A;  1EFW A;  4OP0 A;  2NUT B;  4QW2 A;  4LE9 A;  2Q5H A;  2JW4 A;  2RPN A;  2FPD A;  2QGG A;  4JJD A;  2E64 A;  4OMO A;  4M77 C;  1ZBX A;  1BI3 A;  5M9O A;  4LDV A;  2FZC B;  1KQS S;  2CS7 A;  4OMQ A;  1M1K U;  2P4T A;  4RDX A;  1MV0 B;  3X20 B;  2DMO A;  4ZN1 A;  3OYM A;  1O75 A;  4Z89 A;  2QG9 B;  2VUB A;  2RQW A;  2XG8 D;  1PKS A;  3MP8 A;  1ASZ A;  5HK0 A;  3BJU A;  1SHG A;  4J7I A;  3P8Y A;  1YFT A;  4LVM A;  4M78 B;  3DLL A;  4FYV B;  3KBG A;  4K88 A;  3CXC P;  3R6O A;  1IGU A;  3C4S A;  3CD6 Q;  3E1S A;  5GMK j;  1XTD A;  5GAN 8;  2SRC A;  4M77 E;  2K9G A;  2ABL A;  4HWS A;  4KQE A;  2ZZG A;  3H8Z A;  2DU7 A;  2FRY A;  4C0D B;  2EFI A;  1PC0 A;  1ZHI A;  1QKW A;  2D9T A;  3MP6 A;  2KQW A;  3E9G A;  3MCA B;  2HQX A;  1NPP A;  3SFM A;  3OSS C;  3CCL A;  2CDT A;  1WJR A;  4KH1 B;  2DLP A;  1IHV A;  4XTV A;  3SDZ A;  2M0Y A;  2ZT8 A;  1NEB A;  2JM8 A;  2KXD A;  4RCB A;  1K9M R;  3MEA A;  2MYS A;  4BB7 A;  3TRE A;  4TVA B;  1B7Y B;  4N4G A;  5IHN A;  1TWB A;  1W2B P;  4ESR A;  3ZBD A;  2YT6 A;  3H41 A;  1G3W A;  1YP5 A;  1D09 B;  2J7I A;  1W4S A;  2CJ9 A;  3HXW A;  5DLO A;  2DIQ A;  3V8K A;  2I2L A;  1VOM A;  3RIR A;  3TCJ A;  1ZUY A;  4CI0 C;  3E2U A;  3VYG A;  5GAM e;  2RJF A;  1TSF A;  4AG2 C;  3LW5 E;  1Z7N A;  2M02 A;  1M9S A;  4RTZ A;  4UP8 A;  2VV5 A;  2X4W A;  1JJ2 S;  1NLP C;  3A8M B;  4L6V 5;  3QO8 A;  2E4H A;  5LJ5 f;  2O88 A;  1ZSG A;  4M77 A;  3CCS T;  4BI4 A;  1YJ9 T;  1C0M A;  3SB2 A;  4CC4 B;  4J15 A;  2D1X A;  3LGL A;  1M3B A;  1NEG A;  4RQF A;  3V8J A;  4R56 A;  1GCQ C;  3M0P A;  2CP6 A;  2E3H A;  2EQK A;  4JRK A;  1WPY A;  1B7T A;  3CCJ Q;  1VQ9 A;  4BAC A;  3FLG A;  1M27 C;  2ALY A;  4BD3 A;  2PTK A;  3NFC A;  1VQ8 Q;  3UGQ A;  2RI5 A;  2KBT A;  3HSB A;  2JMC A;  4P74 C;  1YI2 Q;  2OTL T;  4PL6 A;  3CXC S;  4YRS A;  1VYV A;  4QQD A;  3CCM A;  1D1A A;  2DTI A;  1VQ7 T;  2E6N A;  3OYN A;  2EGA A;  2EYZ A;  2GTO A;  2L89 A;  1WIE A;  4J6Y A;  2C8M A;  1YJN A;  1H4V B;  1IXD A;  1Z9Z A;  3E9I A;  2X9H A;  1NJ6 A;  5D6W A;  3REB B;  2AKW A;  5K1X A;  2XDB A;  4YRO A;  2DBM A;  1T0J A;  4C92 C;  1PRM C;  4LNP A;  4YRK A;  3M4P A;  3CEY A;  4EPC A;  1KC8 R;  5HKC A;  4H2X B;  3JV3 A;  4HWO A;  2DXT A;  1ZA1 B;  1JBM A;  3I56 T;  3UFG A;  4HVU A;  3WVE B;  3JB9 G;  3HRS A;  3CCE Q;  1LCK A;  1L0W A;  3E19 A;  3JAM E;  1W2B S;  3OS2 A;  1VQ6 Q;  4LNS A;  4C92 E;  1E1O A;  1VQM Q;  1K8A U;  3URG A;  2ZIN A;  4JS5 A;  2B86 A;  2JT4 A;  2ROT A;  2K79 A;  5CKH A;  1E1T A;  5L8R E;  4HT8 A;  4C5G A;  5GAN g;  1NJI U;  2KDS A;  2HKQ B;  3A7A A;  4A4H A;  1N9W A;  3M59 A;  1ZSZ B;  1IO6 A;  4BE2 A;  11AS A;  3QYH B;  2C0O A;  4JJN K;  3MO8 A;  3L4G B;  3VU3 C;  3J7A F;  1G3S A;  1TU0 B;  4LD6 A;  2KRM A;  2XHC A;  4EX5 A;  2D0N A;  3LH5 A;  1GCQ A;  1I8F A;  4OGC A;  4C5E A;  2MF2 A;  1W66 A;  3V7C A;  3UF4 A;  2ZPE B;  2RHQ A;  1TUG B;  2QAZ A;  5CKB A;  2KR3 A;  1XOV A;  2DIL A;  5CQY A;  1OX8 A;  2X3W D;  4P74 A;  1QVP A;  3CMQ A;  1W1F A;  2CGH A;  1FMV A;  2NUP B;  5FU6 C;  6AT1 B;  1JJC A;  5C51 B;  2AZV A;  2ED1 A;  3ZEH A;  1SG5 A;  3VS0 A;  2BE9 B;  2W0Z A;  3OYD A;  2KXC A;  1T3S A;  4FYX B;  4HT4 A;  2Y90 A;  5GAN h;  4M7A C;  3MET A;  1M1K C;  4P75 C;  2DEQ A;  5LJ3 g;  1EQR A;  5KYW B;  2VXF A;  4J9D A;  5GAN d;  2KGT A;  2XDP A;  1AEY A;  1X6B A;  4C8Q C;  1Q7Y R;  4C92 A;  3IKL A;  5HGQ A;  1BCM A;  3C12 A;  3CCL Q;  1WQ7 A;  3JB9 J;  3PT9 A;  3NTK A;  2Z0W A;  3VUB A;  2HZY A;  4F7U F;  3CMA T;  1WHK A;  2EYX A;  2B8A A;  2CSI A;  5CIU A;  2E5Q A;  3FRN A;  1YHQ A;  4MDW A;  1KSW A;  4M7A E;  2ZR3 A;  2L5Q A;  3HFN A;  2V26 A;  2LDM A;  2RO0 A;  1OI1 A;  5DLQ E;  3J81 E;  2QEX A;  4C8Q E;  3EGX A;  3M4Y A;  9ATC B;  4HVC A;  2JJ9 A;  2YUO A;  4A4F A;  1WHG A;  4Q15 A;  2HCK A;  1D0Y A;  2LMJ A;  2RK1 A;  1R0B G;  3BDL A;  3SEM A;  4CS4 A;  3CCU A;  1PRL C;  3EGD A;  2FZK B;  1QWE A;  3HRU A;  1V29 B;  3PE0 A;  1JRI A;  1X43 A;  3RAC A;  5GJW B;  5LJ3 h; 
#chains in the Genus database with same CATH homology
 5KCO A;  1PYS A;  2ZCE A;  2LCC A;  3A8L B;  2LC4 A;  2DZC A;  2JUF A;  1KMM A;  3QNE A;  3CCR A;  2DXU A;  4A4G A;  4IUP A;  4BE1 A;  2E3C A;  1VQO A;  4RMO A;  3UGT A;  1AHJ B;  2LVM A;  3ER0 A;  3PTA A;  3DB4 A;  2ZPI B;  2H3J A;  1X2H A;  3IKM B;  2RI3 A;  2WAC A;  3QO7 A;  4KBM B;  4X34 A;  4M7A A;  3EFS A;  4P75 A;  4M75 C;  3F70 A;  4J7F A;  3PIO A;  2DJZ A;  4PHC A;  3OYB A;  2GFA A;  3QJ6 A;  3M9Q A;  4E51 A;  4BDY A;  3WXM B;  2XIC A;  5LL6 S;  1FX7 A;  2RJE A;  1SET A;  3RKW A;  3A5Z B;  3QUI A;  1QVG S;  4B9X A;  2JOY A;  2RI2 A;  3CCV T;  2K2V A;  3A32 A;  4M75 E;  3I55 A;  3OS0 A;  4ZIB A;  5GAN 2;  1C0A A;  4CS3 A;  1Y96 A;  2FYK A;  2K5F A;  1Q86 U;  1HK9 A;  2JVV A;  5KNN A;  1HXD A;  2JN0 A;  3TU4 K;  1IL2 A;  5D6Y A;  5FU7 B;  3HFZ B;  3HTZ A;  2E12 A;  4K86 A;  3E9H A;  4XQ3 A;  3FEO A;  3G6E T;  3P8V A;  4DOV A;  3CBP A;  5I21 A;  4CH4 A;  4A4E A;  1KQ1 A;  4UP7 A;  4KT0 E;  5GAM f;  4JRI A;  2RK2 A;  1K8A C;  4N0A A;  4M7D C;  2QQB A;  2DQ0 A;  3OB9 A;  3MHX A;  1BBW A;  3OW2 S;  4C8Q D;  1SSF A;  3NEM A;  1SRY A;  2ZT7 A;  4P3O A;  4LVJ A;  1ADY A;  2QA4 T;  1B34 A;  1S72 T;  3TEH B;  4M78 E;  1VQ8 A;  4M7D E;  3I7F A;  1NJ8 A;  5A0D A;  2EKO A;  1YJW T;  3KFU A;  3OYJ A;  3PCO A;  1QE0 A;  3RER A;  4RKU E;  2KAF A;  4JS4 A;  4JUV A;  1KHC A;  2VGM A;  2ZZE A;  4ZGD B;  3EAE A;  1RIQ A;  4EMK C;  1K73 C;  3A5Y A;  2GCX A;  2LRQ A;  4F7U G;  1NPR A;  4J5Y A;  5ELO A;  1BI1 A;  2C7I A;  3KXT A;  3OYA A;  1VQK T;  4IKF A;  2CIM A;  3W3S A;  1M1G A;  2E6Z A;  3R07 A;  3X28 B;  3RES A;  2K57 A;  3LH0 A;  3OA6 A;  4IUQ A;  3A31 A;  3PIP A;  3QG1 A;  4ZGJ B;  4M78 A;  3S3M A;  4C92 F;  1D3B B;  2QHV A;  4PJO C;  3VQV A;  4DA4 A;  1YJ9 A;  4BWA A;  2NLU A;  1WJQ A;  4FT2 A;  2RH2 A;  4NL3 A;  3OYH A;  1H3Z A;  4XTU A;  4Z02 A;  2QI2 A;  3NTH A;  4BUG A;  2LCL A;  4KUD K;  2BUD A;  1VQ5 T;  1H4T A;  3DB3 A;  1GGM A;  1YFR A;  1N8R U;  2ZIM A;  4PJO E;  3G4S T;  4FIB A;  4TVY A;  4TVA A;  1B7Y A;  4BI8 B;  1VQ7 A;  1G51 A;  4JRP A;  2YLC A;  3OYL A;  1JB0 E;  2FVU A;  2PVG B;  4F7U B;  2K3X A;  3CME T;  4BW9 A;  3OYI A;  2E1H A;  4YCV A;  5E3I A;  3CC4 T;  2DD4 A;  2F5T X;  3QXE B;  2DKG A;  4EMK A;  1WYD A;  1X54 A;  4OB1 B;  1HC7 A;  3REX A;  4K87 A;  1B70 B;  3I56 A;  2MWP A;  4M77 G;  3M5A A;  2HNI A;  1G5H A;  5GMK h;  2E10 A;  3MEU A;  3HXU A;  4ME7 A;  2D6F A;  4QQG A;  1FXX A;  3JCM X;  3INZ A;  4M7A F;  3A7R A;  2LTO A;  5J26 A;  4EMH A;  2O01 E;  1M90 U;  2JTM A;  4DQ2 A;  3A8O B;  4C8Q F;  1Q86 C;  4A53 A;  2K4Y A;  3CPW A;  1OYX A;  4PJO A;  1VIF A;  3M57 A;  3CBM A;  4YRP A;  2EQJ A;  3CPF A;  4MMK A;  3QJY A;  1Z7M A;  4YRN A;  2DQ3 A;  2D0Q B;  5GAN e;  1Q81 C;  4E7L A;  2YRV A;  2ZTG A;  4HWR A;  2WSF E;  2YHT A;  2QHS A;  3LX7 A;  3G1Z A;  5C6S A;  1KOG A;  4H2X A;  4XEM A;  2BKD N;  4G85 A;  4Q6G A;  1M8V A;  3PFS A;  3QDR B;  2RD1 A;  2HAX A;  2R5A A;  1U8R A;  3PNW C;  3OBY A;  2V8I A;  3QSU A;  2EJG A;  4TQD A;  5C0M A;  2R5M A;  2ZPG B;  2Y4X A;  2Q7G A;  4CH6 A;  3JRZ A;  5I2M A;  3FC3 A;  1N6A A;  1YIJ A;  3HXV A;  5LJ3 e;  2QHT A;  4XU3 A;  4E7J A;  4YP0 A;  1VIE A;  3M4G A;  3LSQ A;  3L4G A;  2K5L A;  1PSF A;  3HY0 A;  4J6X A;  3OMC A;  4WJ3 M;  3HHT B;  2KSS A;  3L2U A;  4P73 C;  1BI0 A;  2M0O A;  4M77 D;  1NJ2 A;  4D6W A;  1WGS A;  4LDX A;  1EIY B;  2OTJ T;  3P8H A;  3QO5 A;  3IG2 A;  4MZM A;  3VQX A;  1VQL T;  1NYQ A;  3NEN A;  2R57 A;  4M75 F;  1KD1 U;  5GAM j;  3HXX A;  1YIT A;  2PME A;  2FB7 A;  4KUL A;  3RKX A;  2GQV A;  2RA2 A;  5CKE A;  3OYG A;  2AKW B;  1LOJ A;  3X24 B;  5CK9 A;  2I4N A;  3UWN A;  5IAY A;  4YRM A;  4H2S A;  3JCM g;  2CKK A;  4C5H A;  1TH7 A;  5GAN j;  2FHD A;  3L2V A;  4NL2 A;  2PMF A;  2ODR C;  3G71 A;  2E41 A;  4G84 A;  4C92 G;  3TEG A;  5FRO A;  4OLF A;  1ZQ1 A;  2F69 A;  3H6Z A;  1VUB A;  4LVL A;  1IRE B;  1YBY A;  4N4I A;  2EAY A;  1G5I A;  3J80 E;  4XTX A;  1P92 A;  1K73 U;  3MP1 A;  1GXI E;  2CZ7 B;  2DXB A;  1VQN T;  1QVF A;  3PMT A;  3FJP A;  4XAX B;  3JCM h;  1N8R C;  5FLX E;  4M7D F;  3JCM d;  2RHS B;  1FYF A;  4YRJ A;  4LDY A;  4N4H A;  3HRT A;  2RJC A;  3CCV A;  2CYZ B;  1UGR B;  4ZTJ A;  1G3Y A;  2RHQ B;  4P73 A;  1M4Z A;  4E7I A;  2DXC A;  1PSE A;  4NS5 A;  5GMK i;  4L59 A;  2RHU A;  4BDZ A;  3UDC A;  1K9M C;  5HY6 A;  1HTT A;  2P0Q A;  1OZ2 A;  4Q5W A;  2DTO A;  5CKF A;  5LJ3 d;  3QKJ A;  2E70 A;  1YB3 A;  1UGP B;  3WQZ A;  3HPW A;  4C92 B;  4Y91 A;  5D6X A;  3ERR A;  4EO4 A;  4M7A G;  4YRR A;  3S6W A;  4N0A C;  3L1A A;  5GAN 4;  4P3N A;  1XNI A;  1EVK A;  2XGT A;  2JTF A;  5CAI A;  4C8Q G;  4RQE A;  3OS1 A;  5GMK m;  2RHI A;  3E9F A;  4ZTZ B;  3DLM A;  4P5N A;  1M90 C;  4C92 D;  3DSQ A;  1EOV A;  3A5Z A;  3HL8 A;  3X25 B;  4J6W A;  3QPH A;  2E5A A;  1VQ4 T;  4EMG A;  1I5L A;  3FB9 A;  2QA4 A;  5KE3 A;  3L2Q A;  4P72 A;  1S72 A;  2XID A;  3SD4 A;  1X75 C;  4CH3 A;  1PYS B;  4ELZ C;  2G4C A;  4UP9 A;  2ZCF B;  3HXY A;  2GFU A;  2MAM A;  3GP8 A;  4XK8 E;  3HFZ A;  1YJW A;  4OB3 B;  1ATI A;  2KVQ G;  4YRL A;  3CC2 T;  1NZ9 A;  3PZC A;  4PJO F;  4M77 F;  1KG1 A;  2ZZF A;  5CR2 A;  2DZ9 A;  5F5W A;  3SWN B;  4RMF A;  3RGL A;  1X56 A;  3DKM A;  5HK3 A;  2XKO C;  5GAO n;  2ZPF B;  2EWN A;  5FU6 B;  1BBU A;  4H2V A;  2QQR A;  2OAU A;  3QZ5 B;  5AYF A;  2XU8 A;  2EIF A;  4PKC C;  3CC7 T;  1VQP T;  1Q81 U;  3MF1 A;  4HKE A;  4C5I A;  2A7Y A;  5GAN 5;  5LJ5 g;  4C8Q B;  3CCU T;  5GAN 6;  4OB0 B;  2EYQ A;  3JSC A;  3TEH A;  2LT4 A;  4EDU A;  1ADJ A;  3QYG B;  3P8T A;  4RG2 A;  4M78 C;  3UT1 A;  1EVL A;  4M75 G;  4P3P A;  3GLX A;  5A2Q E;  4M7A D;  2A8E A;  1N27 A;  5GAO l;  1G3T A;  1QP3 A;  1B76 A;  3KUF A;  1KD1 C;  1UEB A;  3MEW A;  1KHI A;  4C0D C;  5CKD A;  5GAN f;  3C95 A;  1N9S A;  3GPL A;  4H2W A;  2EQM A;  4GY5 A;  4J83 A;  2ARU A;  3VJP A;  1QF6 A;  4LDU A;  2Q7E A;  1B8A A;  5LJ5 h;  5GAO p;  1VQ5 A;  4LVI A;  5LJ5 d;  4ZTU B;  5ELN A;  3NET A;  1BIA A;  3RUX A;  3G4S A;  2MWO A;  2IG0 A;  4XTW A;  1EIF A;  12AS A;  2RHX A;  5GMK e;  2DU5 A;  3BDU A;  4TVR A;  3UPU A;  3CD6 T;  4CRI A;  4OF1 A;  3FIF A;  2HQE A;  5I2S A;  2RHZ A;  1Q7Y C;  5GAN 3;  2QDY B;  3ME9 A;  4L87 A;  3BY7 A;  3GNG A;  1NE8 A;  1H4Q A;  4M78 G;  1VQZ A;  5LJ3 f;  3OSV A;  4M7D G;  2I4L A;  1DJ7 B;  3LWI A;  3TUP A;  3S3O A;  5EG2 A;  1Y07 A;  2L8D A;  2DPP B;  1USY C;  4UPA A;  3HFO A;  4M75 B;  2EL9 A;  3S3N A;  4IUU A;  1KQ2 A;  4ZGE B;  5C52 B;  2QTX A;  2RJD A;  3UH0 A;  4FL6 A;  4M75 D;  3EFR A;  4X5O A;  1BI2 A;  1KQS A;  1BKB A;  1QP2 A;  4KR2 A;  2X4X A;  3NEL A;  3CCS A;  4C0G A;  2I4O A;  4P71 C;  2XD0 A;  4XTY A;  4F7U A;  2AMC B;  3JCM J;  2QQA A;  1U1T A;  3CCQ T;  3OYE A;  4JLI A;  4H2T A;  4R55 A;  4TVW A;  2R58 A;  2JZ2 A;  2O4X B;  2X4J A;  1UGS B;  4YYE A;  4IUV A;  2OTL A;  2IY5 B;  3CCJ T;  2K5I A;  1B70 A;  4YRG A;  1E22 A;  1VQ8 T;  4C0F A;  1YI2 T;  4WJ4 A;  1H64 1;  2ZGW A;  1YGB A;  3M55 A;  5A0G A;  4M7D B;  1MHN A;  3HY1 A;  3LGF A;  4X9D A;  2IVW A;  4A54 A;  4GLK A;  2KY9 A;  4BY6 B;  1K9M U;  3LYI A;  3A8G B;  4HCC A;  2PUO B;  2CJA A;  4CS2 A;  2ZPB B;  3VV0 A;  3ASK A;  2NS6 A;  4M78 D;  3LWH A;  4PJO G;  4M7D D;  2M1H A;  1USY A;  3QZ9 B;  2P0L A;  2RM4 A;  2VC8 A;  1SES A;  4TTV A;  2V8K A;  2OTJ A;  1JJ2 A;  1G5V A;  3CCE T;  4YCU A;  1VQL A;  1VQ6 T;  5KCH A;  2G3R A;  4PLI A;  5CVI A;  1LJO A;  2XTI A;  1VQM T;  3L42 A;  4RG8 A;  2MMP A;  1X55 A;  3HFV A;  5A0L A;  2ZPH B;  3HXZ A;  4QVZ A;  1BIB A;  2PVD B;  4P71 A;  4EMK B;  4FM4 B;  1SER A;  2DK3 A;  2ZT5 A;  4NCX A;  2QQS A;  3JCM W;  5GAN 7;  2ZIO A;  4TWA A;  3CXC A;  2HD0 A;  3JCM e;  4OVA A;  2P0K A;  4MML A;  3CPW S;  1M1F A;  2AHJ B;  4RCC A;  2DIG A;  4XU2 A;  3MQZ A;  4JDS A;  2ZT6 A;  1OZ3 A;  4OGE A;  2PU9 B;  4O5V A;  1EIY A;  1YCY A;  1R8O B;  3OYF A;  1KC8 U;  1Y7X A;  4PJO B;  4M77 B;  4X9C A;  1VQN A;  3REU A;  3WVD B;  3MF2 A;  2MI6 A;  2CZ1 B;  4E47 A;  4BE0 A;  5KH6 A;  5FRM A;  2LNV A;  3CMA A;  3Q1J A;  1W2B A;  3L2R A;  2RHY A;  3HP9 A;  2GF7 A;  3CCL T;  2ALY B;  2M16 A;  4PJO D;  2L3R A;  3JCM Q;  1MGQ A;  4ZTF A;  4XEO A;  4OB2 B;  5CO7 A;  4WF2 A;  4LDW A;  3VKI A;  2XDD A;  3GF5 A;  4YDQ A;  5GAM g;  1LNX A;  3M54 A;  3T9N A;  1UGQ B;  2CZ6 B;  4E7K A;  2PVO B;  3M4Q A;  2PQW A;  3OBW A;  1Y71 A;  3OQ5 A;  1WLE A;  2JNG A;  4XU1 A;  2J3M A;  3N5B B;  4AH6 A;  2HBP A;  4C0Z A;  4QQ6 A;  4L5G A;  2RHS A;  3OS5 A;  4FU6 A;  1VQ9 T;  2BIV A;  4YRC A;  3QHS A;  4YRT A;  2EQU A;  2DDZ A;  4H02 A;  1NNH A;  2QXF A;  1Q7Y U;  5GAM h;  3SWN C;  5KE2 A;  1VQ4 A;  1WU7 A;  4HWP A;  3LSS A;  4P72 C;  5GAM d;  3QTC A;  2PUK B;  4FSX A;  3CCM T;  2EJF A;  1NJ5 A;  4O6J A;  3RMS A;  1YJN T;  4WI1 A;  4PNO A;  4HT9 A;  4YPF A;  4M78 F;  5FU7 C;  3QO3 A;  2C06 A;  5LJ3 j;  4HA8 A;  3CC2 A;  5IN1 A;  4UC4 A;  3O8V A;  1YIJ T;  3JCM b;  2E65 A;  3JCM c;  1M5Q 1;  2ZXF A;  4XU0 A;  4LVK A;  2ZZD A;  3HRI A;  2DAQ A;  3RKY A;  1QVF S;  1ASY A;  1JJC B;  4J8O A;  2LQK A;  1H4S A;  2LQ8 A;  3CC7 A;  2J3L A;  4PG3 A;  3JB9 D;  4JRQ A;  1VQP A;  3G6E A;  4A4K A;  2DO3 A;  1Q82 U;  4BI3 A;  1YFS A;  2VYT A;  3HKS A;  3A8H B;  4Y28 E;  2RB6 A;  2EJ9 A;  4XTZ A;  3JCM V;  2QQ9 A;  2VXE A;  1YIT T;  2X35 A;  5LJ5 e;  3RMQ A;  3HRK A;  4H2U A;  2DTH A;  1I4K 1;  4JLG A;  2M9U A;  3G71 T;  3L2Z A;  4IUR A;  2WSC E;  2P5I A;  1KMN A;  1X6O A;  5IT9 E;  3TEE A;  3SWN A;  3V8L A;  4HWT A;  4HCB A;  3MEY A;  4H2Y A;  2F5K A;  2ZNJ A;  3IAL A;  3CBO A;  5GMK l;  4ELY C;  5C53 B;  2Q7H A;  4O2D A;  2KMT A;  1NJ1 A;  2QHU A;  1QVG A;  5CQX A;  3GNF B;  4VUB A;  2FL7 A;  3M58 A;  1X2G A;  3M56 A;  3BW1 A;  4C8Q A;  3CD6 A;  2K3Y A;  4ZN3 A;  4ATO A;  5J39 A;  3A74 A;  4QVC A;  1E24 A;  1YHQ T;  2P0P A;  1LYL A;  4FT4 A;  1KC8 C;  2CJB A;  4HCZ A;  3X26 B;  1FWZ A;  3V7R A;  2ART A;  2ODR D;  2QEX T;  4M7A B;  2CZ0 B;  4NOY A;  1VQK A;  4DOW A;  3OYY A;  5DY9 A;  1RL2 A;  1XQH A;  3P8B B;  5GAO m;  3P8D A;  2I4M A;  2VGN A;  3G7Z A;  3OW2 A;  3VUZ A;  3CCR T;  5LJ5 j;  3OYK A;  3VBB A;  3LC0 A;  3V7S A;  3JCM P;  1BYM A;  1VQO T;  4DPG A;  4MZT A;  3PGG A;  4PLL A;  3ZFJ A;  1WQW A;  1N9R A;  4YCW A;  3A7U A;  3PMI A;  3OMG A;  1J5W A;  1Y96 B;  4MDX A;  3CCQ A;  2V8J A;  4BY6 C;  1NJI C;  1X01 A;  4OMF B;  4YRI A;  2KK4 A;  1WJS A;  2LT1 A;  1O9S A;  3OYC A;  3JCM f;  4YRQ A;  2ZR2 A;  1IZ6 A;  5J3B A;  3M53 A;  3CCJ A;  3BFM A;  3AHU A;  4II1 A;  3JB9 H;  2WSE E;  3VQW A;  4F7U E;  4M75 A;  4B9W A;  2XI9 A;  1YI2 A;  2LX9 A;  4E7H A;  3CME A;  5GAO q;  1NYR A;  2Q5I A;  4CH5 A;  2A3L A;  3CC4 A;  4YTL A;  4KR3 A;  2DD5 A;  2Y4Y A;  1D3B A;  3NTI A;  3JB9 F;  5CCA A;  3RL6 A;  3I55 T;  3QII A;  1B34 B;  2XK0 A;  4IUT A;  4MZP A;  4TQF A;  4QVD A;  5K1P A;  1I81 A;  3QBY A;  2ZNI A;  4LD9 K;  1WNL A;  2AMC A;  3GIB A;  3C94 A;  2ARS A;  3FDR A;  3OY9 A;  2X4Y A;  3L2W A;  1UB4 A;  5DM7 R;  3CCE A;  1QW1 A;  3PCO B;  1U1S A;  2O4X A;  1RI0 A;  3GOX A;  1VQ6 A;  2YLB A;  2IY5 A;  3MEV A;  4V2S A;  1VQM A;  3LLR A;  3JB9 I;  3OD1 A;  4YRF A;  5GAO r;  4KUI A;  2DVE A;  3VQY A;  4YRE A;  3VYH B;  5FRN A;  3ICA A;  1Q82 C;  3RF1 A;  4M7D A;  1EFW A;  4OP0 A;  4QW2 A;  2Q5H A;  2E64 A;  4M77 C;  1ZBX A;  1BI3 A;  5M9O A;  4LDV A;  1KQS S;  2CS7 A;  1M1K U;  2P4T A;  4RDX A;  3X20 B;  4ZN1 A;  3OYM A;  1O75 A;  2VUB A;  2XG8 D;  3MP8 A;  1ASZ A;  5HK0 A;  3BJU A;  4J7I A;  3P8Y A;  1YFT A;  4LVM A;  4M78 B;  3DLL A;  3KBG A;  4K88 A;  3R6O A;  3C4S A;  3E1S A;  5GMK j;  1XTD A;  5GAN 8;  4M77 E;  4HWS A;  4KQE A;  2ZZG A;  3H8Z A;  2DU7 A;  4C0D B;  2EFI A;  1ZHI A;  2D9T A;  3MP6 A;  2KQW A;  3E9G A;  3MCA B;  2HQX A;  1NPP A;  3SFM A;  3OSS C;  3CCL A;  1WJR A;  4XTV A;  3SDZ A;  2ZT8 A;  4RCB A;  3MEA A;  4BB7 A;  3TRE A;  4TVA B;  1B7Y B;  4N4G A;  3ZBD A;  1G3W A;  2CJ9 A;  1W4S A;  3HXW A;  5DLO A;  2DIQ A;  3V8K A;  2I2L A;  3RIR A;  3TCJ A;  4CI0 C;  3VYG A;  5GAM e;  2RJF A;  3LW5 E;  1Z7N A;  1M9S A;  4UP8 A;  2VV5 A;  2X4W A;  1JJ2 S;  3A8M B;  4L6V 5;  3QO8 A;  5LJ5 f;  4M77 A;  3CCS T;  4BI4 A;  1YJ9 T;  3SB2 A;  4J15 A;  3LGL A;  4RQF A;  3V8J A;  4R56 A;  2EQK A;  4JRK A;  1WPY A;  1VQ9 A;  4BAC A;  3FLG A;  2ALY A;  4BD3 A;  3NFC A;  3UGQ A;  2RI5 A;  3HSB A;  4P74 C;  2OTL T;  4PL6 A;  3CXC S;  4YRS A;  4QQD A;  3CCM A;  2DTI A;  1VQ7 T;  2E6N A;  3OYN A;  2L89 A;  2C8M A;  4J6Y A;  1YJN A;  1H4V B;  3E9I A;  1NJ6 A;  5D6W A;  2AKW A;  5K1X A;  2XDB A;  4YRO A;  4C92 C;  4YRK A;  3M4P A;  3CEY A;  4EPC A;  5HKC A;  4H2X B;  4HWO A;  2DXT A;  1JBM A;  3I56 T;  3UFG A;  3WVE B;  3JB9 G;  3HRS A;  1L0W A;  3E19 A;  3JAM E;  1W2B S;  3OS2 A;  4LNS A;  4C92 E;  1E1O A;  1K8A U;  3URG A;  2ZIN A;  4JS5 A;  5CKH A;  1E1T A;  5L8R E;  4HT8 A;  4C5G A;  5GAN g;  1NJI U;  2KDS A;  3A7A A;  4A4H A;  1N9W A;  3M59 A;  4BE2 A;  11AS A;  3QYH B;  4JJN K;  3MO8 A;  3L4G B;  3VU3 C;  3J7A F;  1G3S A;  4LD6 A;  2XHC A;  4EX5 A;  1I8F A;  4OGC A;  4C5E A;  2MF2 A;  1W66 A;  3V7C A;  2ZPE B;  2RHQ A;  5CKB A;  1XOV A;  5CQY A;  4P74 A;  1QVP A;  3CMQ A;  2CGH A;  5FU6 C;  1JJC A;  5C51 B;  3ZEH A;  3OYD A;  4HT4 A;  2Y90 A;  5GAN h;  4M7A C;  3MET A;  1M1K C;  4P75 C;  2DEQ A;  5LJ3 g;  1EQR A;  2VXF A;  5GAN d;  2XDP A;  4C8Q C;  4C92 A;  3IKL A;  5HGQ A;  3C12 A;  1WQ7 A;  3JB9 J;  3PT9 A;  3NTK A;  3VUB A;  4F7U F;  3CMA T;  2B8A A;  5CIU A;  2E5Q A;  3FRN A;  1YHQ A;  4MDW A;  4M7A E;  2ZR3 A;  2L5Q A;  3HFN A;  2LDM A;  2RO0 A;  1OI1 A;  5DLQ E;  3J81 E;  2QEX A;  4C8Q E;  3M4Y A;  4HVC A;  4A4F A;  4Q15 A;  2RK1 A;  3BDL A;  4CS4 A;  3CCU A;  3HRU A;  1V29 B;  1JRI A;  3RAC A;  5LJ3 h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...