3EFRA

Biotin protein ligase r40g mutant from aquifex aeolicus in complex with biotin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
233
Chain Sequence
MFKNLIWLKEVDSTQERLKEWNVSYGTALVADRQTKGRGGLGRKWLSQEGGLYFSFLLNPKEFENLLQLPLVLGLSVSEALEEITEIPFSLKWPNDVYFQEKKVSGVLRELSKDKLIVGIGINVNQREIPEEIKDRATTLYEITGKDWDRKEVLLKVLKRISENLKKFKEKSFKEFKGKIESKMLYLGEEVKLLGEGKITGKLVGLSEKGGALILTEEGIKEILSGEFSLRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin [acetyl-CoA-carboxylase] ligase
publication title Structural and functional studies of the biotin protein ligase from Aquifex aeolicus reveal a critical role for a conserved residue in target specificity
pubmed rcsb
source organism Aquifex aeolicus
total genus 67
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3efrA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3efrA01
2Q7HA 3JCMP 3V7SA 4C8QB 5GAOn 3BFMA 4M7AE 2QHUA 4N0AC 1YCYA 1B7YB 2ZZEA 1SRYA 1I5LA 1KMMA 3HFNA 2E65A 3JB9G 1JJCB 4XTXA 4P72A 4M77A 4DQ2A 1WLEA 3JCMf 3INZA 1NJ2A 3HFZA 1HC7A 4M75E 5E3IA 2DDZA 3RUXA 1C0AA 5LJ5f 3RL6A 1HK9A 2ZTGA 1JBMA 4M78A 3V8JA 1W66A 5C52B 2G4CA 3OD1A 1BIBA 1USYA 2RHQB 1NNHA 3L4GB 1YFSA 4YREA 4EMKA 4XU0A 1NJ1A 4YROA 2AKWA 4Q6GA 5CAIA 3DSQA 3I7FA 2VXFA 4PJOB 3IKMB 3QO7A 4F7UG 2DQ0A 3A5ZA 4YRGA 3SB2A 4PHCA 5GAN4 4YYEA 4M7DB 4NOYA 3SWNC 4J6XA 1N9SA 4N0AA 4KR2A 4HT8A 4XU1A 3FB9A 4C8QC 4M77D 5HGQA 4C8QG 4C92E 1H641 2FYKA 1B34B 2QHTA 3A5YA 3HSBA 4M78D 3HXYA 2I4LA 1Y96A 3RACA 2Q5IA 3A74A 2YHTA 4M77E 3JCMd 3G1ZA 3V7CA 1EQRA 4K86A 5GMKh 3JCMW 2E41A 3JCMQ 4YRRA 4EO4A 4M7AB 4PNOA 4M78E 1D3BA 4E51A 4HVCA 4H02A 11ASA 5GANf 1Z7MA 1BBUA 1TH7A 4YRQA 4M75B 4QVCA 3HXXA 4CS2A 4XTUA 3ERRA 4K88A 4P71C 4PJOG 4C8QF 1E1OA 4TVAA 3VQXA 4H2VA 2AMCA 2YLBA 3HY0A 3BW1A 2E1HA 1L0WA 4RQFA 3V8KA 2VC8A 2CJAA 4CH6A 5GAN5 3SWNA 1WYDA 3JCMX 3IG2A 5C51B 5K1PA 4M7DC 3QUIA 1E22A 2ALYA 5GAN3 3HY1A 2EJ9A 3M4GA 4TTVA 1YFRA 1ADJA 4P3PA 1M8VA 4M75D 5GMKm 4JRIA 5LJ3j 3JCMJ 4RDXA 3JCMh 12ASA 2RHSA 3VBBA 5GAN2 5LJ5j 4H2XB 1B70A 5LJ3f 3QSUA 5GAMj 2HNIA 2CGHA 4DPGA 4MMKA 2XGTA 1B8AA 2ZT6A 4TWAA 3HFOA 2P0LA 3VU3C 5I21A 2RHQA 4YRCA 4ZIBA 5GAMf 1ATIA 4K87A 4J5YA 4PJOF 4MMLA 4JUVA 1QF6A 2DTOA 4YRLA 1X2GA 4Q15A 4C92B 4M7AG 3RESA 3HRIA 2VXEA 4CH5A 3BY7A 4NL2A 2Q5HA 1G51A 4XU3A 3MF2A 3MEYA 4P71A 1HXDA 4O2DA 4M7DF 1ADYA 4M75G 1E24A 4UPAA 1J5WA 4YRSA 4EMGA 4M77B 1FYFA 3LSSA 3HFZB 1LJOA 1H4QA 3NENA 1H4VB 2ZZGA 2E10A 3QNEA 5GAOp 4M7DA 3JB9H 4M78B 3QO3A 3JB9F 1E1TA 1WQWA 2ZCEA 2E3CA 1WPYA 4C92D 2ZZFA 4UP8A 1SETA 4RQEA 4YCVA 2J3MA 2C8MA 3HXZA 4EMKB 2I4MA 3VQYA 1EIYA 3TEGA 3TUPA 2AKWB 2DXTA 1B34A 3E9HA 4C8QE 2EJFA 1SESA 4M7AF 3QTCA 4TQFA 4J6WA 2RD1A 1WQ7A 4P3NA 5K1XA 3M4QA 1JRIA 2QTXA 1G5HA 4XTVA 3JB9J 1PYSB 5GMKe 2ZNJA 4TVYA 2ZIMA 4P75C 5LJ3d 3TEHA 2ZR2A 4XEMA 4H2WA 2ZT7A 2IY5A 3CMQA 4XU2A 2E5AA 1NJ5A 5LJ5d 4YRMA 1VQZA 4F7UF 2ODRC 3VQWA 2Q7EA 5GAMd 3MF1A 3W3SA 5GANj 5GANh 4CS3A 4C92G 4YRNA 4KR3A 2FB7A 4HT9A 2DZCA 4V2SA 4YRFA 3IALA 3JCMg 3LSQA 4F7UA 4HWTA 4Y91A 4M77G 4WJ4A 3ICAA 4PJOC 4J15A 4YCWA 5C53B 1EOVA 4WI1A 1X55A 2ARUA 1YFTA 1KOGA 2ARTA 1X2HA 4BWAA 3PCOB 4M78C 3RGLA 4M78G 5GAOq 1WU7A 2I4OA 4YP0A 2PMFA 3WQZA 2ZIOA 2I4NA 5GMKl 4M7DE 1WNLA 4HWRA 5GAN8 4C8QA 1YGBA 4YCUA 2J3LA 3JCMe 4H2UA 4P74C 4HWPA 1B7YA 4JLIA 1QE0A 5KNNA 5LJ5e 1MGQA 4H2XA 1JJCA 4X9DA 4ZTZB 5LJ3h 4YRIA 4J6YA 2ZGWA 3VQVA 1H4TA 3A7RA 4RMFA 1KMNA 4H2YA 4H2SA 3HXVA 4P75A 4OP0A 5LJ5h 4P73C 3BDUA 3EFRA 4TVAB 2AMCB 4CS4A 5GAMh 4G84A 4WF2A 2DVEA 1B76A 4M77F 3NELA 3SWNB 2EL9A 5GAOl 3BJUA 5F5WA 2RM4A 1M5Q1 3RIRA 1NYRA 3L4GA 3RF1A 3JCMb 2ALYB 3HRKA 4M7AC 4YPFA 5GAOm 1GGMA 3JB9I 2Q7GA 4M78F 5GAN7 3A32A 4QVDA 2RHSB 4PJOA 3AHUA 4M75C 5GANd 4OLFA 1B70B 2P5IA 3A31A 4BW9A 4G85A 3HXUA 2EWNA 4KQEA 1LYLA 2K57A 4F7UE 2ARSA 3FIFA 3P8TA 1KQ1A 4CH3A 1NJ6A 3UFGA 2DJZA 4C8QD 1X01A 5GANg 5ELNA 4P74A 3PGGA 1RIQA 4TQDA 1U1TA 2DU7A 3A7UA 1IL2A 2CJBA 2ZXFA 1BBWA 2ZINA 3R07A 3QO5A 3JCMV 2XTIA 3KFUA 4PG3A 3L1AA 4P73A 3QO8A 2DEQA 3RERA 1PYSA 2DTHA 4EMHA 2ODRD 4A54A 3FJPA 4JRKA 3P8YA 3RKYA 4LNSA 2RA2A 4CH4A 2DKGA 4UP9A 1X54A 3HXWA 4M75F 3REXA 1N9RA 5GANe 3LC0A 4AH6A 4M7AA 1NYQA 2ZR3A 2RB6A 5GMKi 1U1SA 5GAOr 4UP7A 3E9IA 4NL3A 1EVLA 3RKXA 1EFWA 3QHSA 1EVKA 1YB3A 3V7RA 3NETA 3PZCA 4YRJA 2CJ9A 4C92C 2ZT5A 1LOJA 4L87A 1EIYB 4ZTUB 4H2TA 4HA8A 4PJOD 4M75A 3JCMc 3EFSA 5LJ3g 1N9WA 2DQ3A 4XEOA 4HWOA 2DTIA 2QHSA 1I4K1 2ZNIA 5LJ5g 1H4SA 1SERA 2DXUA 4P72C 5GAMg 4M77C 4YRTA 1ASYA 4PJOE 4M7DD 3PCOA 5GMKj 2DU5A 1Y96B 3TEHB 2C7IA 2EAYA 3HFVA 4XTWA 3RKWA 4TVWA 4YRKA 2IY5B 4RCBA 4XQ3A 2JN0A 1I81A 4NCXA 3M4PA 4WJ3M 1KQ2A 4RCCA 2ZT8A 5ELOA 1USYC 3L2ZA 4YDQA 1LNXA 1G5IA 2CIMA 2E64A 5DY9A 3JB9D 1D3BB 5LJ3e 2QHVA 2YLCA 3NEMA 1BIAA 4YRPA 4EMKC 4X9CA 4A53A 3GIBA 3IKLA 1X56A 1NJ8A 4P3OA 3UGQA 3UH0A 4F7UB 4EX5A 2DZ9A 5GAMe 5GAN6 2Y90A 4C92F 3HTZA 1I8FA 3V8LA 3A7AA 4HWSA 2EJGA 4M7AD 1Z7NA 4X5OA 1ASZA 3UGTA 1HTTA 4M7DG 3P8VA 3REUA 4XTYA 4C92A 2I2LA 4XTZA 2PMEA
chains in the Genus database with same CATH superfamily
5GAOn 5KYYA 4P5NA 4J9FA 1TSFA 3CCVT 1B7YB 3MPUB 3HFNA 3I55A 3JB9G 4P72A 2KT8A 4C5EA 2P0PA 4E7IA 1WLEA 2O9SA 1RAFB 5E3IA 1BKBA 2KBTA 1V29B 2YUOA 4HCCA 1YHQA 3CC2A 2FHDA 1WHJA 1ZUKA 2G4CA 1B07A 3QWXX 1BIBA 1PWTA 3CPWS 2RHQB 3RBBB 5J3BA 1YFSA 1KK7A 1VQ7A 4EMKA 4J9GA 3OS0A 1YJ9A 3L42A 2C0OA 2RJCA 2LC4A 1VQ4T 1AEYA 2DYIA 4Q6GA 5CAIA 3DSQA 1VQNQ 1YJWA 1SSFA 4E7ZA 4FW1A 1VYTA 3QO7A 4DEYA 4J8OA 1JU5C 1QVGA 3A5ZA 4PHCA 1M1GA 1SHGA 1MUZA 4YYEA 3M54A 1X69A 1WXBA 1IGQA 1QLYA 1D0XA 2AKKA 3TVTA 4AT1B 2GCXA 1TG0A 3RMSA 4XU1A 3FB9A 3I56Q 4QT7A 1KQSS 4C92E 4RTZA 3HRUA 1M90U 2CP7A 5DLOA 2X4YA 1KC8U 1X75C 2QEXT 2EFIA 2FVUA 2OTJQ 3H9NA 1WLPB 5GMKh 4PKCC 4M7AB 1EIFA 2E4HA 2FZCB 2OAUA 2DFUA 2M0OA 5GANf 1VQ8A 5CKFA 2DPPB 2XU8A 3HRSA 1ZUUA 4JLGA 4JPBW 4QVCA 1YJNA 2RHIA 2JM9A 3UATA 4XTUA 2A3LA 2LZ6B 2GQVA 4PJOG 5C0MA 3ZEHA 3CCRQ 4H2VA 2AMCA 2ED1A 2HBPA 2Y4YA 2YLBA 3HL8A 1K73C 3OYGA 2PNIA 1WHGA 5KE2A 5HCKA 2LJ0A 4DOWA 5C51B 2NLUA 5CKHA 1YP5A 1Q86R 3QUIA 1Q7YR 1E22A 3HY1A 2K4YA 3M4GA 1UDLA 2OI3A 1ADJA 3QZ5B 2K9GA 2EKOA 4LVLA 2F1LA 1ARKA 1BCMA 1UEBA 4AFQC 1RAHB 5LJ3j 1WIEA 3DB3A 2LQNA 1UG1A 4ZN3A 2BZYA 5I2MA 2DXBA 5LJ5j 1B70A 1ZHIA 5LJ3f 2V8JA 1M3CA 3UPUA 1VOMA 4DPGA 3OYMA 1NJIC 1ZA2B 2X4WA 4J9HA 1PSEA 3VU3C 5I21A 4QQGA 4YRCA 4K87A 3EHRA 3UWNA 5FRNA 3MP1A 1T0JA 2KMTA 1X6GA 4N4HA 5FU6C 1ZBXA 1NYGA 1BI0A 4ZTJA 1K9MC 2CYZB 1K8AR 5KYYB 3MF2A 4JS5A 1HXDA 4O2DA 3SDZA 3PNWC 3OYDA 4YRSA 1UFFA 2ZPHB 4EMGA 2KDSA 1GCQC 3VYHB 1QWFA 2ZZGA 4JJBA 4KULA 3QNEA 3EG9A 2ZTGA 2P4RA 3QO3A 2DO3A 5D6WA 4BI4A 1W2BS 2J6OA 2ZZFA 4UP8A 1MMAA 4YCVA 2J3MA 1IHWA 5FU7C 4EMKB 2I4MA 1PM3A 4MZMA 3CCMA 3PE0A 3TEGA 3TUPA 2J7IA 3VJPA 1RLPC 3CCVQ 1B34A 2L3PA 3E9HA 2LCLA 1SESA 4LVKA 2VWFA 2WSFE 2LQKA 4J6WA 2GTJA 1WX6A 4BACA 4P3NA 1QCOA 3M5AA 3M4QA 2NYSA 1C6VX 1JRIA 2HEQA 1PYSB 3JB9J 4TVYA 2ZIMA 5KH6A 2EYYA 2MI6A 3CCUT 2PUOB 1KIKA 4GLKA 4PFZA 1QCFA 2ZR2A 2ZT7A 3CMQA 3A1PA 4XU2A 4YRMA 2DILA 2IIMA 3HTRA 4MDWA 3M56A 4DA4A 1ZUYA 2JJ9A 3UA6A 1V1CA 4J83A 1VQLA 2KE9A 2KRSA 3X20B 3AT1B 2E70A 1VQ4Q 2EQUA 4OMPA 2EQIA 1OPKA 4M77G 2FZGB 4FM4B 4WJ4A 1NPPA 5C53B 3L2QA 2VGNA 1XQHA 1MV0B 2F5KA 3MP6A 3RGLA 1CKAA 4M78G 2JTFA 4J9EA 5GAOq 2I4OA 1G83A 3CC7A 3WVDB 1Y7XA 4ZN1A 5GJVB 1WNLA 3KXTA 2ENMA 1MMNA 5GAN8 4C8QA 2QQSA 2J3LA 3JCMe 2CP3A 4ZTFA 5KNNA 1K0SA 5LJ5e 3CPFA 2HQHA 1JJCA 2PZ1A 3KBGA 4YRIA 3QJYA 1BK2A 3CPWA 2QYZA 3VQVA 1H4TA 3A7RA 5IHKA 1H92A 4H2SA 1PRLC 1R0CB 4LUEA 4TVRA 3EFRA 2COWA 2AMCB 2SEMA 4G84A 2K79A 1TTHB 3CCEA 2DVEA 3CD6T 4PJJA 2YUQA 3MHXA 3ZFJA 2XDDA 3L4GA 1K76A 1IZ6A 3A8MB 1IXDA 2A7YA 1T3SA 3PFSA 3JCMb 1TWBA 2RQVA 1SSHA 3JB9I 2RJDA 4RTWA 4MZPA 5GAN7 4C0GA 1NG2A 1PNJA 2RI5A 1WXUA 2P84A 3G6ET 3VS0A 4M75C 3AHUA 3FJ5A 1AT1B 4HXJA 5GANd 1B70B 1NM7A 5IHNA 4CI0C 3HXUA 3LWIA 4KQEA 4F17A 1LYLA 2K57A 4BDZA 2ARSA 1EFNA 3CMEQ 1KQSA 3O8VA 4HVUA 1PRMC 5AT1B 3G71Q 2DJZA 3P8BB 1X01A 2M1HA 4TQDA 3GF5A 2DU7A 3A7UA 2MIOA 5J39A 1IL2A 4PK4A 1M3AA 2CJBA 1VQ9Q 3R07A 3QO5A 2LP5A 3JCMV 1HYOA 4A4EA 1NE8A 1WDXA 2YRVA 3E2UA 4J7FA 3M55A 4PL6A 1FYNA 1QP2A 3U23A 2DTHA 4RG8A 4DBQA 1Q81R 1M1KR 1SRMA 2RA2A 2DKGA 1MV3A 1V76A 3EG9B 4M75F 5HK0A 1Q82C 1N9RA 2COZA 2QQRA 4AH6A 4ATOA 1VA7A 3H0HA 5GAOr 1RAAB 4JRPA 2OX7A 3QWYA 5A0DA 2VUBA 2DAQA 4YRJA 3V7RA 1MMDA 3NETA 3L2VA 1UJYA 4ZTUB 1TUGB 4M75A 3JCMc 2WACA 2LQ8A 2MMPA 3EFSA 2CZ1B 4XEOA 1TU0B 2VVKA 2ZNIA 2CP5A 5CCAA 2DBMA 4YRTA 1KG1A 1ASYA 2K3XA 5J26A 4PJOE 1K73U 2PVOB 5GMKj 3S3MA 1Y96B 5KCOA 2LCCA 5FU6B 4PLIA 3PMTA 3HFVA 3RKWA 4Y92A 4YRKA 4J7IA 3FLGA 2CDTA 2JN0A 3CCSQ 4WJ3M 4RCCA 2ZT8A 5ELOA 1O75A 1USYC 2QG9B 1G5IA 2MF2A 1D3BB 5IXBA 1PSFA 2HBWA 2EQKA 3CCJA 2BKDN 2EVRA 1VQNT 5GAMe 2V1RA 1PKSA 1NJIU 2OAWA 1OU9A 2NUTA 2JT4A 2QGGA 3G4SA 5KYUA 3TU4K 3CCUQ 3UGTA 3QYHB 4M7DG 3ULRB 4JRQA 2V8KA 3OW2S 3MO8A 2DD4A 1D1BA 3V7SA 5CKEA 4C8QB 3BFMA 2EPDA 1K9MU 4E7HA 1HD3A 3OYYA 4FYWB 3I56T 1YCYA 1G8XA 1SF9A 1I5LA 1JJCB 2YSQA 4DQ2A 1VIFA 1W2BA 4OB2B 2DDZA 3RUXA 2RI2A 2A28A 1JXOA 5CO7A 2OJ2A 4E7LA 3M0PA 1JBMA 5C52B 4IUQA 1FX7A 1OZ2A 1USYA 4KBMB 1NNHA 2RQRA 1WA7A 2F2WA 2A08A 3L4GB 4OGCA 4CC7A 4YREA 2R57A 3PVQA 4YROA 2LJ3A 2QA4A 2RHYA 4A4FA 4QVZA 3URGA 2L2PA 1OEBA 5DM7R 1K9AA 1TXQA 4F7UG 1M2OA 2AHJB 1VQ6A 3CCRT 4YRGA 1W1FA 3SB2A 3CD6Q 2LRQA 2E3HA 4M7DB 3OBYA 1RL2A 3P8DA 1U8RA 4J6XA 1PC0A 1UGVA 1UHFA 4J9CA 3DB4A 2HZYA 1SPKA 1YI2A 1JQQA 1N8RR 1S1NA 3CCLA 1T0HA 2FYKA 1WHMA 2XIDA 1YN8A 4IUVA 4LDUA 3G6EQ 3HXYA 1UE9A 1RLQC 3A74A 4M77E 3QYGB 2DETA 1UGPB 4LXCA 2KXDA 3HHTB 3VS7A 3JCMW 2E41A 4YRRA 4E2FB 1I5OB 1VQMA 3VRZA 4M78E 2W10A 2F2VA 3CCVA 1RUWA 2M9UA 1BBZA 1NPRA 2DRMA 4OF1A 1Z7MA 1BBUA 4YRQA 4M75B 3EG3A 5CQXA 3MCAB 4D8DA 4HVVA 3ERRA 2J06A 1KD1C 1UGSB 3VQXA 3OYCA 1XJWB 3A8LB 3BW1A 4RQFA 4CH6A 2ZCFB 2B8AA 4C0ZA 4DBRA 4RTYA 1WYDA 3CXCS 2M51A 5K1PA 2NUPA 1KHCA 2XKOC 1FMWA 2EJ9A 2F69A 4B9WA 3A8OB 3GNFB 1OZ3A 5A0LA 4M75D 5GMKm 3PIOA 1XTDA 2BZ8A 2RHSA 1ZBJA 2Z0WA 4H2XB 3EFOA 4RTVA 2K5LA 2XD0A 4MMKA 3MEUA 3BE3A 1VQKQ 2CUBA 2D9TA 1W70A 2NUTB 5KYUB 2B86A 4ZIBA 4R56A 1Y07A 4PJOF 3VV0A 1ZSZC 2L3SA 1X2GA 5KE3A 2AKLA 4M7AG 1M1FA 1RAEB 2R58A 4CH5A 3BY7A 4NL2A 4PJLA 2Q5HA 2RO0A 3GPLA 2DJQA 8ATCB 1J5WA 4AFUC 2QEXA 1FYFA 4HCBA 1LJOA 2M02A 2DRKA 4OMMA 1S72Q 1XOVA 3RDVA 2E10A 2DA9A 2JTEA 5GAOp 4MZTA 1Q82U 2COYA 1WQWA 2E3CA 1WPYA 2QQBA 2FRYA 4HCZA 2QTVA 1SETA 2KT1A 1WZOA 2I0NA 1G2BA 3M58A 2C8MA 3HXZA 3THKA 5FWBA 2BTTA 3VQYA 1EIYA 4B9XA 3UDCA 2CH4A 2CP2A 1JJ2S 4EPCA 3UT1A 2DXTA 1H8KA 4C8QE 2EJFA 1AOJA 4TQFA 2PUKB 4ZGJB 4LVIA 1VQ5Q 2DERA 2KNBB 2X3WD 4XTVA 1HSQA 2EW3A 2ZNJA 4P75C 1K9MR 2YRCA 1Y0MA 3I5RA 4C5IA 4H2WA 2E5AA 1NJ5A 3J81E 3VQWA 1B3QA 3EG1A 1C0MA 5GANj 1PD0A 4KR3A 1E7OA 1YITQ 3OQ5A 4LD6A 3REAB 3EG0A 4FCYA 3DLMA 2JOYA 2DZCA 2D0NA 2QDYB 4OGEA 4FIBA 1QVFP 2ESWA 2PQWA 1I0CA 4PFOA 4HWTA 2MCNA 3OW2A 3SD4A 3KFVA 4WI1A 1IHVA 2W0ZA 2QAZA 2FL7A 1M9SA 3PCOB 4M78C 1RABB 3CMET 3DKMA 4E7SA 1AD5A 4YP0A 4BI3A 3LLRA 5FRMA 1PHTA 3G71T 4M7DE 1SEMA 3CMAA 2EGAA 4P74C 2YUPA 3OB9A 4JLIA 3QZ9B 1VQ9T 1OOTA 1B7TA 4X9DA 4ZTZB 2VKNA 2KRMA 4J6YA 1EX4A 2L0AA 4P75A 3HXVA 3MEWA 4XK8E 1FWZA 2L5QA 2ZPIB 1BU1A 4EDUA 5CKDA 4WF2A 4M77F 3NELA 5F5WA 2HMAA 1BI1A 3QDRB 1NYRA 2NUPB 1YIJQ 3HRKA 1M2VA 1GGMA 2LNHB 1VQ8T 4M78F 1NEBA 3VS3A 2JMCA 1D1AA 3H41A 2RHSB 1SRLA 4E47A 3EFOB 3CCUA 3WXMB 3E1SA 4F7UE 3NFCA 1BI3A 1KQ1A 1VQPQ 4KGZB 3OA6A 4IKFA 5ELNA 4P74A 1RIQA 4CRIA 3CCST 3OYEA 1BI2A 2CZ0B 2R5AA 2K2VA 3CBMA 3L1AA 2ZPFB 2X3XD 3RERA 2LDMA 1OU8A 2R5MA 3OMCA 1UB4A 2ODRD 4A4HA 1IREB 3RKYA 2HQXA 1QVPA 1X54A 2HDAA 3A5ZB 3GP8A 3EH2A 5GANe 1QVGP 3JSCA 2K5FA 2ZR3A 2RB6A 4UP7A 1VQOQ 3M0TA 1VUBA 2DYBA 3OYLA 4DEXA 3QHSA 3PZCA 3R6NA 4A63B 2CJ9A 4C92C 3EGDA 3CCQQ 1EIYB 2QGFB 1Q86C 4H2TA 4PJOD 2LNVA 1Q7YC 1N9WA 1K4US 2EKHA 6AT1B 1X2QA 2PVDB 1GCQA 3CXCA 3LGFA 4RG2A 1KD1U 1H4SA 2OTLT 2KY9A 5HY6A 3CD6A 4HT4A 2DU5A 3X24B 1K1ZA 1NLPC 2C7IA 3TSZA 2VV5A 2ZZDA 4XQ3A 1I81A 4BUGA 4R55A 4NCXA 1VYUA 1KQ2A 3L2ZA 4YDQA 5LJ3e 2QHVA 3NEMA 4X9CA 2KRNA 1X56A 2A8EA 3I55Q 4GLMA 4P3OA 2F5TX 4Z8AA 1AZGB 4C92F 1K8AC 5KYXA 3V8LA 2DL7A 1YFNA 1YHQQ 3A7AA 2CT4A 4HWSA 4RKUE 1X6OA 2LX7A 2IG0A 3G7ZA 1E6GA 5IHIA 4M4ZA 1HTTA 5D7UA 3A98A 4JDSA 2VGMA 3LH0A 4C92A 2I2LA 1G5VA 4XTZA 3OYFA 1RAGB 1M90R 1VQ7Q 4ANJA 4RTXA 3JCMP 5I2SA 2RNAA 1VQLT 4M7AE 3M0SA 2HSPA 5CKBA 3KUFA 1KC8R 2ZZEA 1PKTA 2LQWA 1KMMA 4UC4A 1BB9A 4XTXA 2AT1B 1FMVA 2ABLA 1NJ2A 2F2XA 3HFZA 3RMQA 1D1CA 1YBYA 3RL6A 1HK9A 1OYXA 1M4ZA 2NUZA 1P92A 2XMFA 4O5VA 1JJ2A 2RHXA 5AYFA 3V8JA 2JXBA 1W66A 4PJNA 2V26A 2ECZA 1NBEB 7AT1B 1SHFA 2CUDA 1XNIA 3OYHA 2ZAEA 1NJ1A 1M2VB 1R77A 2AKWA 2G6FX 3OS5A 4JJDA 3OYKA 4OMQA 2FZKB 1MNEA 1T3LA 4KUIA 1GXIE 2V8IA 1Y71A 4BE1A 2WSCE 2KSSA 3OYBA 1N9SA 4HT8A 3LX7A 1VQ8Q 2H8HA 4M77D 5HGQA 4C8QG 4LDYA 2EQMA 3L2UA 3F70A 1VQNA 4J9DA 2DEUA 1YJNQ 1B34B 2QHTA 3A5YA 5DLQE 4M78D 3RACA 2YHTA 1H3ZA 3JCMd 4LN2A 3V7CA 3JRZA 2EQJA 1VQKT 4K86A 2BZXA 3JCMQ 4EO4A 2DLPA 2JS0A 2GQIA 3TREA 4E51A 4HVCA 1NEGA 3I56A 11ASA 3TEEA 3EGDB 2M16A 4GY5A 2GNCA 4IUPA 2KK4A 4CS2A 2LJ1A 3EH1A 3JV3A 3VRYA 4DBFA 3REBB 2OTJA 1L0WA 1S72T 3V8KA 2VC8A 3MEVA 2CJAA 4RTTA 4BE2A 1PG5B 3JCMX 3T9NA 3M9QA 3OYIA 3OYAA 4RUGA 3OBWA 1N5ZA 2ALYA 1IB8A 5FU7B 3H6ZA 1OX9A 1M30A 1M8VA 2FO0A 2ZPEB 4E7KA 1G3WA 3JCMJ 3JCMh 5C6SA 12ASA 3M4YA 3VBBA 1ZSGA 5GAN2 1U06A 2DE0X 2MAMA 3OS1A 3CCRA 4QW2A 3QSUA 4FU6A 3E19A 1VQ5T 5KYXB 2OTLQ 2QASA 1X6BA 2XGTA 2CZ6B 5FROA 3CPWP 5LL6S 2AZVA 2RHQA 1ATIA 2ROTA 2ZPGB 2E3IA 4MMLA 4JUVA 1UJ0A 1Q81C 1M1KC 4ELZC 3OYJA 4YRLA 3ZL7C 4C92B 3DLLA 1AVZC 2FG0A 2GBQA 3NMZC 3RESA 4IIOA 1KD1R 2LT4A 3S3NA 2JW4A 3CCMQ 1G51A 1I1JA 2JS2A 1GRIA 4ZNXA 3H0FA 1YITT 3MEYA 4II1A 3VS5A 4M75G 1E24A 1DJ7B 1WFWA 2QK0A 3SHWA 1ZLMA 5IAYA 1ZA1B 1KFZA 2ZPBB 3HFZB 1H4QA 3QIIA 1H4VB 4GBQA 2XDPA 2DL4A 2RHZA 3G4ST 4K11A 4PFPA 3ME9A 2CSIA 3JB9F 1E1TA 2PU9B 2ZCEA 1RI9A 2RMOA 2YWWA 4C92D 4RQEA 1FMKA 1KQSP 1RAIB 3G1JA 1WHLA 2GFUA 1VQLQ 2AKWB 1Q86U 3NTHA 4M7AF 3QTCA 2AIRB 5CVIA 2KROA 2RD1A 1WQ7A 3PT9A 5K1XA 3X25B 3WVEB 1E6HA 2VB6A 2SRCA 2CZ7B 2EGCA 2V1QA 4RMOA 5ECAA 5GMKe 2X9HA 3TEHA 4FYVB 3META 4IUUA 3H0IA 2IY5A 3LH5A 2QDLA 3H8ZA 3M57A 2ODRC 3M53A 2Q7EA 2AZSA 4X1VA 5GAMd 3W3SA 2EYWA 3O5ZA 4BD3A 4CS3A 4YRNA 1YIJT 2FB7A 4FT2A 4V2SA 4YRFA 3IALA 3JCMg 2Y4XA 3LSQA 2E6ZA 4Y91A 1K8AU 4PJOC 5FW9A 1VQ6T 4YCWA 2ARUA 3M0UA 3CCEQ 2ARTA 1X2HA 1ZQ1A 3LW5E 3MQZA 4C5GA 1VQPT 1U5SA 2PMFA 3WQZA 2ZIOA 1OQKA 3QG1A 2XDBA 4HWRA 2FRWA 1C1AA 2LT1A 1YGBA 4YCUA 2DX1A 4H2UA 4OMLA 3QXEB 1VQ4A 4HWPA 2L3QA 1QE0A 4KUDK 2DD5A 1MGQA 2HCKA 3QJ6A 3IQLA 4C0FA 4RMFA 2JMAA 1KMNA 4OP0A 4ORZA 3PVLA 4CS4A 5GAMh 2DF6A 2FPDA 4YTLA 2GFAA 4B6MA 2L89A 2RM4A 4FT4A 3RIRA 3RF1A 4E7JA 3VYGA 2KAFA 1VQMT 2ALYB 2BIVA 2YRDA 3PIPA 3NTKA 3RNJA 5GAOm 1VQOT 2D6FA 2O2OA 2CP0A 4F04B 3CCQT 3A32A 3EGXA 3NGPA 4QVDA 3CC4T 1K73R 4PJOA 1NYFA 2O01E 1X27A 5IT9E 2P5IA 2DL5A 4DBHA 3A31A 4Y28E 1N8RC 3D7SB 2EWNA 3S6WA 2BUDA 1CKBA 2DM1A 1QKXA 1W2BP 3OSVA 3SFMA 3P8TA 4CH3A 1NJ6A 3FC3A 3UFGA 5KYWA 3OMGA 2EIFA 3C95A 1VYVA 3X26B 1QMCA 2O31A 2KEAA 1BBWA 2ZINA 1NJIR 3KFUA 3EHQA 2QQ9A 5CR2A 2JVVA 2O4XA 3I55T 4IIMA 1PYSA 2EBPA 4A54A 4JRKA 3P8YA 2LCSA 4LNSA 4JZ3A 4CH4A 3CMEA 4UP9A 1TUCA 2C0IA 2GTOA 1WI7A 1YHQT 4FSXA 4OMNA 3CC2T 1ZSZA 3FRNA 1R0BG 3LC0A 3G71A 5GMKi 1U1SA 2XG8D 1YWPA 2RN8A 4NL3A 1EVLA 1EFWA 1EVKA 1YB3A 1OX8A 4KH0B 3M0QA 2GGRA 2ZT5A 1VQ9A 1VQ7T 2RPNA 1QW1A 1YJ9T 4HA8A 4Q5WA 3X28B 5KYNA 3Q1JA 3CCJQ 3R6OA 1I4K1 2O9VA 1YJWT 1BCOA 2DXUA 5GAMg 4M77C 3NHNA 5D6YA 1H3HA 3VS4A 2YT6A 3QPHA 1MNDA 4FYXB 3G4SQ 2IVWA 3TEHB 1NZ9A 2KQWA 1WJRA 2C06A 4XTWA 2IY5B 3M4PA 2HQEA 2CP6A 4OB0B 1LNXA 5CIUA 2CIMA 2A0FB 3JB9D 1OULA 1BIAA 3EGUA 4OVAA 3GIBA 2DVJA 1OV3A 2WSEE 1NJ8A 2DZ9A 5GAN6 3HP9A 2Y90A 4ZGDB 3OS2A 3MEAA 4MDXA 5D6XA 2EJGA 4M7AD 1Z7NA 1WJSA 4N4GA 1ASZA 2X51A 3GNGA 1PD1A 1Q81U 1M1KU 2XHCA 3P8VA 1UUEA 2P0QA 1GL5A 3REUA 2GF7A 3CCSA 3A8HB 2PMEA 2Q7HA 1N6AA 1NLOC 3C94A 2QHUA 4N0AC 2MWOA 3MKDA 2QA4Q 1SRYA 4A4GA 2E65A 5L23A 2EYQA 4M77A 4OMOA 4LE9A 3JCMf 2QI2A 3INZA 1YJNT 1HC7A 4M75E 1C0AA 2HSEB 1N27A 5LJ5f 5L8RE 3SEMA 1VQ6Q 2D0QB 1IO6A 4X34A 4HCKA 4M78A 1KJWA 2L3RA 3OD1A 1AHJB 3BDLA 1GFCA 4Z89A 2A37A 3L2WA 2KVQG 1X2KA 4XU0A 3CMAT 1UGQB 4AFZC 1YI2Q 4QQDA 3CCLQ 2PTKA 3PMIA 3EGXB 3I7FA 2VXFA 4PJOB 3IKMB 4BY6C 2OTLA 2IPOB 2QQAA 1R8OB 3LYIA 2DQ0A 2CT3A 2KYBA 1M3BA 4F14A 5GAN4 1UGRB 3MP8A 5IH2A 4NOYA 5KYWB 2MOXA 4L59A 3SWNC 2CKKA 1VQMQ 4N0AA 4O6JA 3J7AF 4KR2A 2HKQB 2YDLA 2CS7A 4C8QC 2JUFA 2L8DA 4FW2A 2CREA 1H641 4AG2C 3CC4Q 1JB0E 2O4XB 3MJXA 3HSBA 5HK3A 4BB7A 2I4LA 1Y96A 2HL3A 3C4SA 4ZGEB 2Q5IA 3G1ZA 4HVWA 1EQRA 1ZSZB 2YXYA 2XK0A 1VIEA 4KH1B 4PNOA 1D3BA 4H02A 4LUDA 2FPFA 1TH7A 1IGUA 1AZEA 3CCMT 3VS1A 2DNUA 4N4IA 3G6EA 3HXXA 1I07A 4K88A 4P71C 1Q82R 3M59A 3JAME 4C8QF 1E1OA 3A8GB 4TVAA 4FL6A 1QVFS 1RADB 1TUDA 4D8KA 3HY0A 2E1HA 3OW2P 3CC2Q 5GAN5 3C0CA 4DOVA 3SWNA 3TCJA 4C0DC 2KI7A 2K7AA 3IG2A 3TSWA 2EYZA 1QCNA 4M7DC 2RJFA 2O88A 1OPLA 5GAN3 4HKEA 4TTVA 1YFRA 3E9GA 4P3PA 4PLLA 4JJNK 4BI8B 1YJ9Q 4JRIA 4NS5A 1MMGA 1LPLA 4RDXA 2HD0A 4ELYC 2M0YA 3M0RA 2DIQA 2DXCA 3HRTA 2QEXQ 1AWXA 1ABQA 1YJWQ 4QKUA 2HNIA 5GAMj 1N8RU 2CGHA 4BE0A 2KR3A 2RK2A 1B8AA 2ZT6A 4TWAA 3HFOA 2P0LA 2X35A 4KRTA 3QKJA 4AFSC 5GAMf 4D6WA 3FEOA 3CBOA 5KCHA 4J5YA 1QF6A 2ED0A 2DTOA 1WYXA 4Q15A 2HL5C 4E6RA 1U3OA 3CC7T 3HRIA 2VXEA 1ACMB 2RQUA 2HAXA 1AWJA 1PCXA 8AT1B 4XU3A 2VYTA 2XI9A 3P8HA 1F1BB 5EC7A 4P71A 4M7DF 2DIGA 1ADYA 3VS2A 4UPAA 1A0NB 1QQJA 4M77B 4F16A 3HPWA 3GOXA 3LSSA 2ROLA 2E5QA 1X43A 3NENA 1VQKA 1TS9A 3TQ7P 5GJWB 3NTIA 3JB9H 4M7DA 4M78B 1ZX6A 3CCET 1MHNA 4WTOB 4VUBA 4KT0E 3UF4A 2D8HA 2MPXC 2RH2A 4Z88A 1HJDA 3OY9A 3C12A 1QP3A 1UHCA 5CQYA 4LVMA 4EIKA 2RF0A 3RR6A 4OB3B 3N5BB 3VKIA 1WHKA 3FDRA 3GBQA 2QTXA 3CEYA 3I5SA 1S72A 1G5HA 2LMJA 1WJQA 3I9QA 2H3JA 4R0KA 2P0KA 4PJMA 5LJ3d 4WCIA 1AWWA 4XEMA 1BYMA 4RTUA 5LJ5d 1VQZA 4F7UF 2JM8A 9ATCB 3MF1A 4BDYA 1SKUB 5GANh 2AK5A 4C92G 1QVGS 1AWOA 3CMAQ 1GCPA 4HT9A 1M90C 4ESRA 4F7UA 1VQ5A 3QBYA 4AG1C 2E5KA 1WXTA 3ZBDA 1O9SA 1KC8C 2BE7D 3ICAA 1RACB 2JZ2A 3J80E 2EYXA 4J15A 1Y57A 3CXCP 1M27C 1EOVA 1X55A 1EZZB 4C5HA 1YFTA 1KOGA 4JZ4A 1D0ZA 2VASA 4LDXA 2JNGA 4BWAA 1WU7A 4L6V5 3VUZA 2I4NA 5GMKl 2D1XA 2K3BA 1YITA 1B7YA 1LVKA 1QKWA 4BY6B 5A0GA 2KXCA 3UA7A 4H2XA 5LJ3h 3CBPA 4JS4A 2ZGWA 4QQ6A 2HKNA 4H2YA 5LJ5h 1D0YA 5HKCA 1YNZA 5FWCA 3BDUA 4P73C 4TVAB 1B76A 4ME7A 4L5GA 3SWNB 2EL9A 5GAOl 2A36A 3BJUA 4FYYB 4LD9K 1M5Q1 5I22A 4LDWA 2PVGB 2MK5A 1JO8A 5A2QE 3LGLA 4M7AC 4YPFA 4CC3A 2G3RA 1UTIA 2EGEA 2Q7GA 1ABOA 2KYMA 2CH4W 2K5IA 4OMFB 3CCJT 1Z9QA 4BW9A 4OLFA 1GBRA 3VUBA 2LX9A 4G85A 1G3YA 1UECA 3FIFA 2OTJT 1G3SA 3PTAA 1SG5A 1OI1A 5M9OA 2MYSA 4AMCA 2P4TA 4C8QD 5GANg 1YIJA 1JJ2P 2DK3A 2RJEA 3PGGA 3QDFA 1U1TA 1W4SA 2YUNA 2ZXFA 5EG2A 4FSSA 2QXFA 2XTIA 2DMOA 2LTOA 2CSQA 2DBKA 4PG3A 4Z02A 4LNPA 1Q7YU 4P73A 3QO8A 2K3YA 2FPEA 3EG2A 2DEQA 5CK9A 1GFDA 1WHHA 4EMHA 3FJPA 3NPFA 1K0XA 4KGXB 2RHUA 4C0DB 5I11A 2J6KA 2ATCB 1YCSB 1RI0A 1JXMA 3CQTA 3EAEA 3HXWA 1VQPA 2D8JA 3REXA 1LCKA 1FXXA 4M7AA 1NYQA 2J05A 1W6XA 1M8MA 3E9FA 3VS6A 4IURA 3E9IA 3RKXA 3ASKA 3CC7Q 3OYNA 1G3TA 1QVFA 2K2MA 4L87A 1LOJA 2NWMA 3OSSC 3I35A 2MWPA 2DQ3A 5LJ3g 2X4JA 4CC4B 2QA4T 4HWOA 2DTIA 2QHSA 2K6DA 1JEGA 5LJ5g 1WGSA 1SERA 4IUTA 4P72C 2LVMA 4A4KA 2RQWA 4M7DD 3PCOA 4KGVB 2H3EB 4LDVA 1QWEA 4J9BA 2XICA 5IN1A 1D09B 2RK1A 4OB1B 2EAYA 4XAXB 2E12A 3S3OA 4TVWA 1CSKA 4RCBA 2J6FA 1J3TA 1VQOA 2BE9B 1Q95G 4JJCA 4J9IA 2DL3A 2X4XA 3CCQA 2E64A 5DY9A 1KHIA 2YLCA 3CC4A 4EMKC 3GLXA 4YRPA 4A53A 4CC2A 1YI2T 3IKLA 1YWOA 2C0TA 5IXFA 2RI3A 3CCLT 3UGQA 3UH0A 4F7UB 4EX5A 4LVJA 1IRXA 3HTZA 2JTMA 3ER0A 2FEIA 1I8FA 1Z9ZA 3LWHA 1TOVA 3HKSA 2E6NA 2DL8A 4X5OA 2NS6A 3L2RA 5FLXE 2RQTA 1GBQA 4XTYA 1KSWA 2KGTA
chains in the Genus database with same CATH topology
5GAOn 4P5NA 3CCVT 1B7YB 3HFNA 3I55A 3JB9G 4P72A 4C5EA 2P0PA 4E7IA 1WLEA 5E3IA 1BKBA 1V29B 4HCCA 1YHQA 3CC2A 2FHDA 2G4CA 1BIBA 3CPWS 2RHQB 5J3BA 1YFSA 1VQ7A 4EMKA 3OS0A 1YJ9A 3L42A 2RJCA 2LC4A 1VQ4T 4Q6GA 5CAIA 3DSQA 1YJWA 1SSFA 3QO7A 4J8OA 1QVGA 3A5ZA 4PHCA 1M1GA 4YYEA 3M54A 2GCXA 3RMSA 4XU1A 3FB9A 1KQSS 4C92E 3HRUA 1M90U 5DLOA 2X4YA 1KC8U 1X75C 2QEXT 2EFIA 2FVUA 5GMKh 4PKCC 4M7AB 1EIFA 2OAUA 2M0OA 5GANf 1VQ8A 5CKFA 2DPPB 2XU8A 3HRSA 4JLGA 4QVCA 1YJNA 2RHIA 4XTUA 2A3LA 2GQVA 4PJOG 5C0MA 3ZEHA 4H2VA 2AMCA 2HBPA 2Y4YA 2YLBA 3HL8A 1K73C 3OYGA 5KE2A 4DOWA 5C51B 2NLUA 5CKHA 3QUIA 1E22A 3HY1A 2K4YA 3M4GA 1ADJA 3QZ5B 2EKOA 4LVLA 1UEBA 5LJ3j 3DB3A 4ZN3A 5I2MA 2DXBA 5LJ5j 1B70A 1ZHIA 5LJ3f 2V8JA 3UPUA 4DPGA 3OYMA 1NJIC 2X4WA 1PSEA 3VU3C 5I21A 4QQGA 4YRCA 4K87A 3UWNA 5FRNA 3MP1A 2KMTA 4N4HA 5FU6C 1ZBXA 1BI0A 4ZTJA 1K9MC 2CYZB 3MF2A 4JS5A 1HXDA 4O2DA 3SDZA 3PNWC 3OYDA 4YRSA 2ZPHB 4EMGA 2KDSA 3VYHB 2ZZGA 4KULA 3QNEA 3QO3A 2DO3A 5D6WA 4BI4A 1W2BS 2ZZFA 4UP8A 4YCVA 2J3MA 5FU7C 4EMKB 2I4MA 4MZMA 3CCMA 3TEGA 3TUPA 3VJPA 1B34A 3E9HA 2LCLA 1SESA 4LVKA 2WSFE 2LQKA 4J6WA 4BACA 4P3NA 3M5AA 3M4QA 1JRIA 1PYSB 3JB9J 4TVYA 2ZIMA 5KH6A 2MI6A 3CCUT 2PUOB 4GLKA 2ZR2A 2ZT7A 3CMQA 4XU2A 4YRMA 4MDWA 3M56A 4DA4A 4J83A 1VQLA 3X20B 2E70A 2EQUA 4M77G 4FM4B 4WJ4A 1NPPA 5C53B 3L2QA 2VGNA 1XQHA 2F5KA 3MP6A 3RGLA 4M78G 5GAOq 2JTFA 2I4OA 3CC7A 3WVDB 1Y7XA 4ZN1A 1WNLA 3KXTA 5GAN8 4C8QA 2QQSA 2J3LA 3JCMe 4ZTFA 5KNNA 5LJ5e 3CPFA 1JJCA 3KBGA 4YRIA 3QJYA 3CPWA 3VQVA 1H4TA 3A7RA 4H2SA 4TVRA 3EFRA 2AMCB 4G84A 3CCEA 2DVEA 3CD6T 3MHXA 3ZFJA 2XDDA 3L4GA 1IZ6A 3A8MB 2A7YA 3PFSA 3JCMb 3JB9I 2RJDA 4MZPA 5GAN7 4C0GA 2RI5A 3G6ET 3AHUA 4M75C 5GANd 1B70B 4CI0C 3HXUA 3LWIA 4KQEA 1LYLA 2K57A 4BDZA 2ARSA 1KQSA 3O8VA 2DJZA 3P8BB 1X01A 2M1HA 4TQDA 3GF5A 2DU7A 3A7UA 5J39A 1IL2A 2CJBA 3R07A 3QO5A 3JCMV 4A4EA 1NE8A 2YRVA 4J7FA 3M55A 4PL6A 1QP2A 2DTHA 4RG8A 2RA2A 2DKGA 4M75F 5HK0A 1Q82C 1N9RA 2QQRA 4AH6A 4ATOA 5GAOr 4JRPA 5A0DA 2VUBA 2DAQA 4YRJA 3V7RA 3NETA 3L2VA 4ZTUB 4M75A 3JCMc 2WACA 2LQ8A 2MMPA 3EFSA 2CZ1B 4XEOA 2ZNIA 5CCAA 4YRTA 1KG1A 1ASYA 2K3XA 5J26A 4PJOE 1K73U 2PVOB 5GMKj 3S3MA 1Y96B 5KCOA 2LCCA 5FU6B 4PLIA 3PMTA 3HFVA 3RKWA 4YRKA 4J7IA 3FLGA 2JN0A 4WJ3M 4RCCA 2ZT8A 5ELOA 1O75A 1USYC 1G5IA 2MF2A 1D3BB 1PSFA 2EQKA 3CCJA 2BKDN 1VQNT 5GAMe 1NJIU 3G4SA 3TU4K 3UGTA 3QYHB 4M7DG 4JRQA 2V8KA 3OW2S 3MO8A 2DD4A 3V7SA 5CKEA 4C8QB 3BFMA 1K9MU 4E7HA 3OYYA 3I56T 1YCYA 1I5LA 1JJCB 4DQ2A 1VIFA 1W2BA 4OB2B 2DDZA 3RUXA 2RI2A 5CO7A 4E7LA 1JBMA 5C52B 4IUQA 1FX7A 1OZ2A 1USYA 4KBMB 1NNHA 3L4GB 4OGCA 4YREA 2R57A 4YROA 2QA4A 2RHYA 4A4FA 4QVZA 3URGA 5DM7R 4F7UG 2AHJB 1VQ6A 3CCRT 4YRGA 3SB2A 2LRQA 4M7DB 3OBYA 1RL2A 3P8DA 1U8RA 4J6XA 3DB4A 1YI2A 3CCLA 2FYKA 2XIDA 4IUVA 4LDUA 3HXYA 3A74A 4M77E 3QYGB 1UGPB 3HHTB 3JCMW 2E41A 4YRRA 1VQMA 4M78E 3CCVA 2M9UA 4OF1A 1NPRA 1Z7MA 1BBUA 4YRQA 4M75B 5CQXA 3MCAB 3ERRA 1KD1C 1UGSB 3VQXA 3OYCA 3A8LB 3BW1A 4RQFA 4CH6A 2ZCFB 2B8AA 4C0ZA 1WYDA 3CXCS 5K1PA 1KHCA 2XKOC 2EJ9A 2F69A 4B9WA 3A8OB 3GNFB 1OZ3A 5A0LA 4M75D 5GMKm 3PIOA 1XTDA 2RHSA 4H2XB 2K5LA 2XD0A 4MMKA 3MEUA 2D9TA 4ZIBA 4R56A 1Y07A 4PJOF 3VV0A 1X2GA 5KE3A 4M7AG 1M1FA 2R58A 4CH5A 3BY7A 4NL2A 2Q5HA 2RO0A 3GPLA 1J5WA 2QEXA 1FYFA 4HCBA 1LJOA 1XOVA 2E10A 5GAOp 4MZTA 1Q82U 1WQWA 2E3CA 1WPYA 2QQBA 4HCZA 1SETA 3M58A 2C8MA 3HXZA 3VQYA 1EIYA 4B9XA 3UDCA 1JJ2S 4EPCA 3UT1A 2DXTA 4C8QE 2EJFA 4TQFA 2PUKB 4ZGJB 4LVIA 4XTVA 2ZNJA 4P75C 4H2WA 4C5IA 2E5AA 1NJ5A 3J81E 3VQWA 5GANj 4KR3A 3OQ5A 4LD6A 3DLMA 2JOYA 2DZCA 2QDYB 4OGEA 4FIBA 2PQWA 4HWTA 3OW2A 3SD4A 4WI1A 2FL7A 1M9SA 3PCOB 4M78C 3CMET 3DKMA 4YP0A 4BI3A 3LLRA 5FRMA 3G71T 4M7DE 3CMAA 4P74C 3OB9A 4JLIA 3QZ9B 1VQ9T 4X9DA 4ZTZB 4J6YA 4P75A 3HXVA 3MEWA 4XK8E 1FWZA 2L5QA 2ZPIB 4EDUA 5CKDA 4WF2A 4M77F 3NELA 5F5WA 1BI1A 3QDRB 1NYRA 3HRKA 1GGMA 1VQ8T 4M78F 2RHSB 4E47A 3CCUA 3WXMB 3E1SA 4F7UE 3NFCA 1BI3A 1KQ1A 3OA6A 4IKFA 5ELNA 4P74A 1RIQA 4CRIA 3CCST 3OYEA 1BI2A 2CZ0B 2R5AA 2K2VA 3CBMA 3L1AA 2ZPFB 3RERA 2LDMA 2R5MA 3OMCA 1UB4A 2ODRD 4A4HA 1IREB 3RKYA 1QVPA 2HQXA 1X54A 3A5ZB 3GP8A 5GANe 3JSCA 2K5FA 2ZR3A 2RB6A 4UP7A 1VUBA 3OYLA 3QHSA 3PZCA 2CJ9A 4C92C 1EIYB 1Q86C 4H2TA 4PJOD 2LNVA 1Q7YC 1N9WA 2PVDB 3CXCA 3LGFA 4RG2A 1KD1U 1H4SA 2OTLT 2KY9A 5HY6A 3CD6A 4HT4A 2DU5A 3X24B 2C7IA 2VV5A 2ZZDA 4XQ3A 1I81A 4BUGA 4R55A 4NCXA 1KQ2A 3L2ZA 4YDQA 5LJ3e 2QHVA 3NEMA 4X9CA 1X56A 2A8EA 4P3OA 2F5TX 4C92F 1K8AC 3V8LA 3A7AA 4HWSA 4RKUE 1X6OA 2IG0A 3G7ZA 1HTTA 4JDSA 2VGMA 3LH0A 4C92A 2I2LA 1G5VA 3OYFA 4XTZA 3JCMP 5I2SA 1VQLT 4M7AE 5CKBA 3KUFA 2ZZEA 1KMMA 4UC4A 4XTXA 1NJ2A 3HFZA 3RMQA 1YBYA 3RL6A 1HK9A 1OYXA 1M4ZA 4O5VA 1P92A 2ZTGA 1JJ2A 2RHXA 5AYFA 3V8JA 1W66A 1XNIA 3OYHA 1NJ1A 2AKWA 3OS5A 3OYKA 4KUIA 1GXIE 2V8IA 1Y71A 4BE1A 2WSCE 2KSSA 3OYBA 1N9SA 4HT8A 3LX7A 4M77D 5HGQA 4C8QG 4LDYA 2EQMA 3L2UA 3F70A 1VQNA 1B34B 2QHTA 3A5YA 5DLQE 4M78D 3RACA 2YHTA 1H3ZA 3JCMd 3V7CA 3JRZA 2EQJA 1VQKT 4K86A 3JCMQ 4EO4A 3TREA 4E51A 4HVCA 3I56A 11ASA 3TEEA 2M16A 4GY5A 4IUPA 2KK4A 4CS2A 2OTJA 1L0WA 1S72T 3V8KA 2VC8A 3MEVA 2CJAA 4BE2A 3JCMX 3T9NA 3M9QA 3OYIA 3OYAA 3OBWA 2ALYA 5FU7B 3H6ZA 1M8VA 2ZPEB 4E7KA 1G3WA 3JCMJ 3JCMh 5C6SA 12ASA 3M4YA 3VBBA 5GAN2 2MAMA 3OS1A 3CCRA 4QW2A 3QSUA 4FU6A 3E19A 1VQ5T 2XGTA 2CZ6B 5FROA 5LL6S 2RHQA 1ATIA 2ZPGB 4MMLA 4JUVA 1Q81C 1M1KC 4ELZC 3OYJA 4YRLA 4C92B 3DLLA 3RESA 2LT4A 3S3NA 1G51A 1YITT 3MEYA 4II1A 4M75G 1E24A 1DJ7B 5IAYA 2ZPBB 3HFZB 1H4QA 3QIIA 1H4VB 2XDPA 2RHZA 3G4ST 3ME9A 3JB9F 1E1TA 2PU9B 2ZCEA 4C92D 4RQEA 2GFUA 2AKWB 1Q86U 3NTHA 4M7AF 3QTCA 5CVIA 2RD1A 1WQ7A 3PT9A 5K1XA 3X25B 3WVEB 2CZ7B 4RMOA 5GMKe 3TEHA 3META 4IUUA 2IY5A 3H8ZA 3M57A 2ODRC 3M53A 2Q7EA 5GAMd 3W3SA 4BD3A 4CS3A 4YRNA 1YIJT 2FB7A 4FT2A 4V2SA 4YRFA 3IALA 3JCMg 2Y4XA 3LSQA 2E6ZA 4Y91A 1K8AU 4PJOC 4YCWA 1VQ6T 2ARUA 2ARTA 1X2HA 1ZQ1A 3LW5E 3MQZA 4C5GA 1VQPT 2PMFA 3WQZA 2ZIOA 3QG1A 2XDBA 4HWRA 2LT1A 1YGBA 4YCUA 4H2UA 3QXEB 1VQ4A 4HWPA 1QE0A 4KUDK 2DD5A 1MGQA 3QJ6A 4C0FA 4RMFA 1KMNA 4OP0A 4CS4A 5GAMh 4YTLA 2GFAA 2L89A 2RM4A 4FT4A 3RIRA 3RF1A 4E7JA 3VYGA 2KAFA 1VQMT 2ALYB 2BIVA 3PIPA 3NTKA 5GAOm 1VQOT 2D6FA 3CCQT 3A32A 4QVDA 3CC4T 4PJOA 2O01E 5IT9E 2P5IA 3A31A 4Y28E 1N8RC 2EWNA 3S6WA 2BUDA 3OSVA 3SFMA 3P8TA 4CH3A 1NJ6A 3FC3A 3UFGA 3OMGA 2EIFA 3C95A 3X26B 1BBWA 2ZINA 3KFUA 2QQ9A 5CR2A 2JVVA 2O4XA 3I55T 1PYSA 4A54A 4JRKA 3P8YA 4LNSA 4CH4A 3CMEA 4UP9A 1YHQT 3CC2T 4FSXA 3FRNA 3LC0A 3G71A 5GMKi 1U1SA 2XG8D 1EVLA 4NL3A 1EFWA 1EVKA 1YB3A 2ZT5A 1VQ9A 1VQ7T 1QW1A 1YJ9T 4HA8A 4Q5WA 3X28B 3Q1JA 3R6OA 1I4K1 1YJWT 2DXUA 5GAMg 4M77C 5D6YA 3QPHA 2IVWA 3TEHB 1NZ9A 2KQWA 1WJRA 2C06A 4XTWA 2IY5B 3M4PA 2HQEA 4OB0B 1LNXA 5CIUA 2CIMA 3JB9D 1BIAA 4OVAA 3GIBA 2WSEE 1NJ8A 2DZ9A 5GAN6 3HP9A 2Y90A 4ZGDB 3OS2A 3MEAA 4MDXA 5D6XA 2EJGA 4M7AD 1Z7NA 1WJSA 4N4GA 1ASZA 3GNGA 1Q81U 1M1KU 2XHCA 3P8VA 2P0QA 3REUA 2GF7A 3CCSA 3A8HB 2PMEA 2Q7HA 1N6AA 3C94A 2QHUA 4N0AC 2MWOA 1SRYA 4A4GA 2E65A 2EYQA 4M77A 3JCMf 2QI2A 3INZA 1YJNT 1HC7A 4M75E 1C0AA 5LJ5f 1N27A 5L8RE 2D0QB 4X34A 4M78A 2L3RA 3OD1A 1AHJB 3BDLA 3L2WA 2KVQG 4XU0A 3CMAT 1UGQB 4QQDA 3PMIA 3I7FA 2VXFA 4PJOB 3IKMB 4BY6C 2OTLA 2QQAA 1R8OB 3LYIA 2DQ0A 5GAN4 1UGRB 3MP8A 4NOYA 4L59A 3SWNC 2CKKA 4N0AA 4O6JA 3J7AF 4KR2A 2CS7A 4C8QC 2JUFA 2L8DA 1H641 1JB0E 2O4XB 3HSBA 5HK3A 4BB7A 2I4LA 1Y96A 3C4SA 4ZGEB 2Q5IA 3G1ZA 1EQRA 2XK0A 1VIEA 4PNOA 1D3BA 4H02A 1TH7A 3CCMT 4N4IA 3G6EA 3HXXA 4K88A 4P71C 3M59A 3JAME 4C8QF 1E1OA 3A8GB 4TVAA 4FL6A 1QVFS 3HY0A 2E1HA 5GAN5 4DOVA 3SWNA 3TCJA 4C0DC 3IG2A 4M7DC 2RJFA 5GAN3 4HKEA 4TTVA 1YFRA 3E9GA 4P3PA 4PLLA 4JJNK 4BI8B 4JRIA 4NS5A 4RDXA 2HD0A 4ELYC 2DIQA 2DXCA 3HRTA 5GAMj 2HNIA 1N8RU 2CGHA 4BE0A 2RK2A 1B8AA 2ZT6A 4TWAA 3HFOA 2P0LA 2X35A 3QKJA 5GAMf 4D6WA 3FEOA 3CBOA 5KCHA 4J5YA 1QF6A 2DTOA 4Q15A 3CC7T 3HRIA 2VXEA 2HAXA 4XU3A 2VYTA 2XI9A 3P8HA 4P71A 4M7DF 2DIGA 1ADYA 4UPAA 4M77B 3HPWA 3GOXA 3LSSA 2E5QA 3NENA 1VQKA 3NTIA 3JB9H 4M7DA 4M78B 3CCET 1MHNA 4VUBA 4KT0E 2RH2A 3OY9A 3C12A 1QP3A 5CQYA 4LVMA 4OB3B 3N5BB 3VKIA 3FDRA 2QTXA 3CEYA 1S72A 1G5HA 1WJQA 2H3JA 2P0KA 5LJ3d 4XEMA 1BYMA 5LJ5d 1VQZA 4F7UF 3MF1A 4BDYA 5GANh 4C92G 1QVGS 4HT9A 1M90C 4F7UA 1VQ5A 3QBYA 3ZBDA 1O9SA 1KC8C 3ICAA 2JZ2A 3J80E 4J15A 1EOVA 1X55A 4C5HA 1YFTA 1KOGA 4LDXA 2JNGA 4BWAA 1WU7A 2I4NA 4L6V5 3VUZA 5GMKl 1YITA 1B7YA 5A0GA 4BY6B 4H2XA 5LJ3h 3CBPA 4JS4A 2ZGWA 4QQ6A 4H2YA 5LJ5h 5HKCA 4P73C 3BDUA 4TVAB 1B76A 4ME7A 4L5GA 3SWNB 2EL9A 5GAOl 3BJUA 4LD9K 1M5Q1 4LDWA 2PVGB 5A2QE 3LGLA 4M7AC 4YPFA 2G3RA 2Q7GA 2K5IA 4OMFB 3CCJT 4BW9A 4OLFA 3VUBA 2LX9A 4G85A 1G3YA 3FIFA 2OTJT 1G3SA 3PTAA 1OI1A 5M9OA 4C8QD 2P4TA 5GANg 1YIJA 2DK3A 2RJEA 3PGGA 1U1TA 1W4SA 2ZXFA 5EG2A 2QXFA 2XTIA 2LTOA 4PG3A 4Z02A 1Q7YU 4P73A 3QO8A 2K3YA 2DEQA 5CK9A 4EMHA 3FJPA 2RHUA 4C0DB 1RI0A 3HXWA 3EAEA 1VQPA 3REXA 1FXXA 4M7AA 1NYQA 3E9FA 4IURA 3E9IA 3RKXA 3ASKA 3OYNA 1G3TA 1QVFA 4L87A 1LOJA 3OSSC 2MWPA 2DQ3A 5LJ3g 2X4JA 2QA4T 4HWOA 2DTIA 2QHSA 5LJ5g 1WGSA 1SERA 4IUTA 4P72C 2LVMA 4A4KA 4M7DD 3PCOA 4LDVA 2XICA 5IN1A 2RK1A 4OB1B 2EAYA 4XAXB 2E12A 3S3OA 4TVWA 4RCBA 1VQOA 2X4XA 3CCQA 2E64A 5DY9A 1KHIA 2YLCA 3CC4A 4EMKC 3GLXA 4YRPA 4A53A 3IKLA 1YI2T 2RI3A 3CCLT 3UGQA 3UH0A 4F7UB 4EX5A 4LVJA 3HTZA 2JTMA 3ER0A 1I8FA 3LWHA 3HKSA 2E6NA 4X5OA 2NS6A 3L2RA 5FLXE 4XTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7H A;  3JCM P;  3V7S A;  4C8Q B;  5GAO n;  3BFM A;  4M7A E;  2QHU A;  4N0A C;  1YCY A;  1B7Y B;  2ZZE A;  1SRY A;  1I5L A;  1KMM A;  3HFN A;  2E65 A;  3JB9 G;  1JJC B;  4XTX A;  4P72 A;  4M77 A;  4DQ2 A;  1WLE A;  3JCM f;  3INZ A;  1NJ2 A;  3HFZ A;  1HC7 A;  4M75 E;  5E3I A;  2DDZ A;  3RUX A;  1C0A A;  5LJ5 f;  3RL6 A;  1HK9 A;  2ZTG A;  1JBM A;  4M78 A;  3V8J A;  1W66 A;  5C52 B;  2G4C A;  3OD1 A;  1BIB A;  1USY A;  2RHQ B;  1NNH A;  3L4G B;  1YFS A;  4YRE A;  4EMK A;  4XU0 A;  1NJ1 A;  4YRO A;  2AKW A;  4Q6G A;  5CAI A;  3DSQ A;  3I7F A;  2VXF A;  4PJO B;  3IKM B;  3QO7 A;  4F7U G;  2DQ0 A;  3A5Z A;  4YRG A;  3SB2 A;  4PHC A;  5GAN 4;  4YYE A;  4M7D B;  4NOY A;  3SWN C;  4J6X A;  1N9S A;  4N0A A;  4KR2 A;  4HT8 A;  4XU1 A;  3FB9 A;  4C8Q C;  4M77 D;  5HGQ A;  4C8Q G;  4C92 E;  1H64 1;  2FYK A;  1B34 B;  2QHT A;  3A5Y A;  3HSB A;  4M78 D;  3HXY A;  2I4L A;  1Y96 A;  3RAC A;  2Q5I A;  3A74 A;  2YHT A;  4M77 E;  3JCM d;  3G1Z A;  3V7C A;  1EQR A;  4K86 A;  5GMK h;  3JCM W;  2E41 A;  3JCM Q;  4YRR A;  4EO4 A;  4M7A B;  4PNO A;  4M78 E;  1D3B A;  4E51 A;  4HVC A;  4H02 A;  11AS A;  5GAN f;  1Z7M A;  1BBU A;  1TH7 A;  4YRQ A;  4M75 B;  4QVC A;  3HXX A;  4CS2 A;  4XTU A;  3ERR A;  4K88 A;  4P71 C;  4PJO G;  4C8Q F;  1E1O A;  4TVA A;  3VQX A;  4H2V A;  2AMC A;  2YLB A;  3HY0 A;  3BW1 A;  2E1H A;  1L0W A;  4RQF A;  3V8K A;  2VC8 A;  2CJA A;  4CH6 A;  5GAN 5;  3SWN A;  1WYD A;  3JCM X;  3IG2 A;  5C51 B;  5K1P A;  4M7D C;  3QUI A;  1E22 A;  2ALY A;  5GAN 3;  3HY1 A;  2EJ9 A;  3M4G A;  4TTV A;  1YFR A;  1ADJ A;  4P3P A;  1M8V A;  4M75 D;  5GMK m;  4JRI A;  5LJ3 j;  3JCM J;  4RDX A;  3JCM h;  12AS A;  2RHS A;  3VBB A;  5GAN 2;  5LJ5 j;  4H2X B;  1B70 A;  5LJ3 f;  3QSU A;  5GAM j;  2HNI A;  2CGH A;  4DPG A;  4MMK A;  2XGT A;  1B8A A;  2ZT6 A;  4TWA A;  3HFO A;  2P0L A;  3VU3 C;  5I21 A;  2RHQ A;  4YRC A;  4ZIB A;  5GAM f;  1ATI A;  4K87 A;  4J5Y A;  4PJO F;  4MML A;  4JUV A;  1QF6 A;  2DTO A;  4YRL A;  1X2G A;  4Q15 A;  4C92 B;  4M7A G;  3RES A;  3HRI A;  2VXE A;  4CH5 A;  3BY7 A;  4NL2 A;  2Q5H A;  1G51 A;  4XU3 A;  3MF2 A;  3MEY A;  4P71 A;  1HXD A;  4O2D A;  4M7D F;  1ADY A;  4M75 G;  1E24 A;  4UPA A;  1J5W A;  4YRS A;  4EMG A;  4M77 B;  1FYF A;  3LSS A;  3HFZ B;  1LJO A;  1H4Q A;  3NEN A;  1H4V B;  2ZZG A;  2E10 A;  3QNE A;  5GAO p;  4M7D A;  3JB9 H;  4M78 B;  3QO3 A;  3JB9 F;  1E1T A;  1WQW A;  2ZCE A;  2E3C A;  1WPY A;  4C92 D;  2ZZF A;  4UP8 A;  1SET A;  4RQE A;  4YCV A;  2J3M A;  2C8M A;  3HXZ A;  4EMK B;  2I4M A;  3VQY A;  1EIY A;  3TEG A;  3TUP A;  2AKW B;  2DXT A;  1B34 A;  3E9H A;  4C8Q E;  2EJF A;  1SES A;  4M7A F;  3QTC A;  4TQF A;  4J6W A;  2RD1 A;  1WQ7 A;  4P3N A;  5K1X A;  3M4Q A;  1JRI A;  2QTX A;  1G5H A;  4XTV A;  3JB9 J;  1PYS B;  5GMK e;  2ZNJ A;  4TVY A;  2ZIM A;  4P75 C;  5LJ3 d;  3TEH A;  2ZR2 A;  4XEM A;  4H2W A;  2ZT7 A;  2IY5 A;  3CMQ A;  4XU2 A;  2E5A A;  1NJ5 A;  5LJ5 d;  4YRM A;  1VQZ A;  4F7U F;  2ODR C;  3VQW A;  2Q7E A;  5GAM d;  3MF1 A;  3W3S A;  5GAN j;  5GAN h;  4CS3 A;  4C92 G;  4YRN A;  4KR3 A;  2FB7 A;  4HT9 A;  2DZC A;  4V2S A;  4YRF A;  3IAL A;  3JCM g;  3LSQ A;  4F7U A;  4HWT A;  4Y91 A;  4M77 G;  4WJ4 A;  3ICA A;  4PJO C;  4J15 A;  4YCW A;  5C53 B;  1EOV A;  4WI1 A;  1X55 A;  2ARU A;  1YFT A;  1KOG A;  2ART A;  1X2H A;  4BWA A;  3PCO B;  4M78 C;  3RGL A;  4M78 G;  5GAO q;  1WU7 A;  2I4O A;  4YP0 A;  2PMF A;  3WQZ A;  2ZIO A;  2I4N A;  5GMK l;  4M7D E;  1WNL A;  4HWR A;  5GAN 8;  4C8Q A;  1YGB A;  4YCU A;  2J3L A;  3JCM e;  4H2U A;  4P74 C;  4HWP A;  1B7Y A;  4JLI A;  1QE0 A;  5KNN A;  5LJ5 e;  1MGQ A;  4H2X A;  1JJC A;  4X9D A;  4ZTZ B;  5LJ3 h;  4YRI A;  4J6Y A;  2ZGW A;  3VQV A;  1H4T A;  3A7R A;  4RMF A;  1KMN A;  4H2Y A;  4H2S A;  3HXV A;  4P75 A;  4OP0 A;  5LJ5 h;  4P73 C;  3BDU A;  3EFR A;  4TVA B;  2AMC B;  4CS4 A;  5GAM h;  4G84 A;  4WF2 A;  2DVE A;  1B76 A;  4M77 F;  3NEL A;  3SWN B;  2EL9 A;  5GAO l;  3BJU A;  5F5W A;  2RM4 A;  1M5Q 1;  3RIR A;  1NYR A;  3L4G A;  3RF1 A;  3JCM b;  2ALY B;  3HRK A;  4M7A C;  4YPF A;  5GAO m;  1GGM A;  3JB9 I;  2Q7G A;  4M78 F;  5GAN 7;  3A32 A;  4QVD A;  2RHS B;  4PJO A;  3AHU A;  4M75 C;  5GAN d;  4OLF A;  1B70 B;  2P5I A;  3A31 A;  4BW9 A;  4G85 A;  3HXU A;  2EWN A;  4KQE A;  1LYL A;  2K57 A;  4F7U E;  2ARS A;  3FIF A;  3P8T A;  1KQ1 A;  4CH3 A;  1NJ6 A;  3UFG A;  2DJZ A;  4C8Q D;  1X01 A;  5GAN g;  5ELN A;  4P74 A;  3PGG A;  1RIQ A;  4TQD A;  1U1T A;  2DU7 A;  3A7U A;  1IL2 A;  2CJB A;  2ZXF A;  1BBW A;  2ZIN A;  3R07 A;  3QO5 A;  3JCM V;  2XTI A;  3KFU A;  4PG3 A;  3L1A A;  4P73 A;  3QO8 A;  2DEQ A;  3RER A;  1PYS A;  2DTH A;  4EMH A;  2ODR D;  4A54 A;  3FJP A;  4JRK A;  3P8Y A;  3RKY A;  4LNS A;  2RA2 A;  4CH4 A;  2DKG A;  4UP9 A;  1X54 A;  3HXW A;  4M75 F;  3REX A;  1N9R A;  5GAN e;  3LC0 A;  4AH6 A;  4M7A A;  1NYQ A;  2ZR3 A;  2RB6 A;  5GMK i;  1U1S A;  5GAO r;  4UP7 A;  3E9I A;  4NL3 A;  1EVL A;  3RKX A;  1EFW A;  3QHS A;  1EVK A;  1YB3 A;  3V7R A;  3NET A;  3PZC A;  4YRJ A;  2CJ9 A;  4C92 C;  2ZT5 A;  1LOJ A;  4L87 A;  1EIY B;  4ZTU B;  4H2T A;  4HA8 A;  4PJO D;  4M75 A;  3JCM c;  3EFS A;  5LJ3 g;  1N9W A;  2DQ3 A;  4XEO A;  4HWO A;  2DTI A;  2QHS A;  1I4K 1;  2ZNI A;  5LJ5 g;  1H4S A;  1SER A;  2DXU A;  4P72 C;  5GAM g;  4M77 C;  4YRT A;  1ASY A;  4PJO E;  4M7D D;  3PCO A;  5GMK j;  2DU5 A;  1Y96 B;  3TEH B;  2C7I A;  2EAY A;  3HFV A;  4XTW A;  3RKW A;  4TVW A;  4YRK A;  2IY5 B;  4RCB A;  4XQ3 A;  2JN0 A;  1I81 A;  4NCX A;  3M4P A;  4WJ3 M;  1KQ2 A;  4RCC A;  2ZT8 A;  5ELO A;  1USY C;  3L2Z A;  4YDQ A;  1LNX A;  1G5I A;  2CIM A;  2E64 A;  5DY9 A;  3JB9 D;  1D3B B;  5LJ3 e;  2QHV A;  2YLC A;  3NEM A;  1BIA A;  4YRP A;  4EMK C;  4X9C A;  4A53 A;  3GIB A;  3IKL A;  1X56 A;  1NJ8 A;  4P3O A;  3UGQ A;  3UH0 A;  4F7U B;  4EX5 A;  2DZ9 A;  5GAM e;  5GAN 6;  2Y90 A;  4C92 F;  3HTZ A;  1I8F A;  3V8L A;  3A7A A;  4HWS A;  2EJG A;  4M7A D;  1Z7N A;  4X5O A;  1ASZ A;  3UGT A;  1HTT A;  4M7D G;  3P8V A;  3REU A;  4XTY A;  4C92 A;  2I2L A;  4XTZ A;  2PME A; 
#chains in the Genus database with same CATH topology
 5GAO n;  5KYY A;  4P5N A;  4J9F A;  1TSF A;  3CCV T;  1B7Y B;  3MPU B;  3HFN A;  3I55 A;  3JB9 G;  4P72 A;  2KT8 A;  4C5E A;  2P0P A;  4E7I A;  1WLE A;  2O9S A;  1RAF B;  5E3I A;  1BKB A;  2KBT A;  1V29 B;  2YUO A;  4HCC A;  1YHQ A;  3CC2 A;  2FHD A;  1WHJ A;  1ZUK A;  2G4C A;  1B07 A;  3QWX X;  1BIB A;  1PWT A;  3CPW S;  2RHQ B;  3RBB B;  5J3B A;  1YFS A;  1KK7 A;  1VQ7 A;  4EMK A;  4J9G A;  3OS0 A;  1YJ9 A;  3L42 A;  2C0O A;  2RJC A;  2LC4 A;  1VQ4 T;  1AEY A;  2DYI A;  4Q6G A;  5CAI A;  3DSQ A;  1VQN Q;  1YJW A;  1SSF A;  4E7Z A;  4FW1 A;  1VYT A;  3QO7 A;  4DEY A;  4J8O A;  1JU5 C;  1QVG A;  3A5Z A;  4PHC A;  1M1G A;  1SHG A;  1MUZ A;  4YYE A;  3M54 A;  1X69 A;  1WXB A;  1IGQ A;  1QLY A;  1D0X A;  2AKK A;  3TVT A;  4AT1 B;  2GCX A;  1TG0 A;  3RMS A;  4XU1 A;  3FB9 A;  3I56 Q;  4QT7 A;  1KQS S;  4C92 E;  4RTZ A;  3HRU A;  1M90 U;  2CP7 A;  5DLO A;  2X4Y A;  1KC8 U;  1X75 C;  2QEX T;  2EFI A;  2FVU A;  2OTJ Q;  3H9N A;  1WLP B;  5GMK h;  4PKC C;  4M7A B;  1EIF A;  2E4H A;  2FZC B;  2OAU A;  2DFU A;  2M0O A;  5GAN f;  1VQ8 A;  5CKF A;  2DPP B;  2XU8 A;  3HRS A;  1ZUU A;  4JLG A;  4JPB W;  4QVC A;  1YJN A;  2RHI A;  2JM9 A;  3UAT A;  4XTU A;  2A3L A;  2LZ6 B;  2GQV A;  4PJO G;  5C0M A;  3ZEH A;  3CCR Q;  4H2V A;  2AMC A;  2ED1 A;  2HBP A;  2Y4Y A;  2YLB A;  3HL8 A;  1K73 C;  3OYG A;  2PNI A;  1WHG A;  5KE2 A;  5HCK A;  2LJ0 A;  4DOW A;  5C51 B;  2NLU A;  5CKH A;  1YP5 A;  1Q86 R;  3QUI A;  1Q7Y R;  1E22 A;  3HY1 A;  2K4Y A;  3M4G A;  1UDL A;  2OI3 A;  1ADJ A;  3QZ5 B;  2K9G A;  2EKO A;  4LVL A;  2F1L A;  1ARK A;  1BCM A;  1UEB A;  4AFQ C;  1RAH B;  5LJ3 j;  1WIE A;  3DB3 A;  2LQN A;  1UG1 A;  4ZN3 A;  2BZY A;  5I2M A;  2DXB A;  5LJ5 j;  1B70 A;  1ZHI A;  5LJ3 f;  2V8J A;  1M3C A;  3UPU A;  1VOM A;  4DPG A;  3OYM A;  1NJI C;  1ZA2 B;  2X4W A;  4J9H A;  1PSE A;  3VU3 C;  5I21 A;  4QQG A;  4YRC A;  4K87 A;  3EHR A;  3UWN A;  5FRN A;  3MP1 A;  1T0J A;  2KMT A;  1X6G A;  4N4H A;  5FU6 C;  1ZBX A;  1NYG A;  1BI0 A;  4ZTJ A;  1K9M C;  2CYZ B;  1K8A R;  5KYY B;  3MF2 A;  4JS5 A;  1HXD A;  4O2D A;  3SDZ A;  3PNW C;  3OYD A;  4YRS A;  1UFF A;  2ZPH B;  4EMG A;  2KDS A;  1GCQ C;  3VYH B;  1QWF A;  2ZZG A;  4JJB A;  4KUL A;  3QNE A;  3EG9 A;  2ZTG A;  2P4R A;  3QO3 A;  2DO3 A;  5D6W A;  4BI4 A;  1W2B S;  2J6O A;  2ZZF A;  4UP8 A;  1MMA A;  4YCV A;  2J3M A;  1IHW A;  5FU7 C;  4EMK B;  2I4M A;  1PM3 A;  4MZM A;  3CCM A;  3PE0 A;  3TEG A;  3TUP A;  2J7I A;  3VJP A;  1RLP C;  3CCV Q;  1B34 A;  2L3P A;  3E9H A;  2LCL A;  1SES A;  4LVK A;  2VWF A;  2WSF E;  2LQK A;  4J6W A;  2GTJ A;  1WX6 A;  4BAC A;  4P3N A;  1QCO A;  3M5A A;  3M4Q A;  2NYS A;  1C6V X;  1JRI A;  2HEQ A;  1PYS B;  3JB9 J;  4TVY A;  2ZIM A;  5KH6 A;  2EYY A;  2MI6 A;  3CCU T;  2PUO B;  1KIK A;  4GLK A;  4PFZ A;  1QCF A;  2ZR2 A;  2ZT7 A;  3CMQ A;  3A1P A;  4XU2 A;  4YRM A;  2DIL A;  2IIM A;  3HTR A;  4MDW A;  3M56 A;  4DA4 A;  1ZUY A;  2JJ9 A;  3UA6 A;  1V1C A;  4J83 A;  1VQL A;  2KE9 A;  2KRS A;  3X20 B;  3AT1 B;  2E70 A;  1VQ4 Q;  2EQU A;  4OMP A;  2EQI A;  1OPK A;  4M77 G;  2FZG B;  4FM4 B;  4WJ4 A;  1NPP A;  5C53 B;  3L2Q A;  2VGN A;  1XQH A;  1MV0 B;  2F5K A;  3MP6 A;  3RGL A;  1CKA A;  4M78 G;  2JTF A;  4J9E A;  5GAO q;  2I4O A;  1G83 A;  3CC7 A;  3WVD B;  1Y7X A;  4ZN1 A;  5GJV B;  1WNL A;  3KXT A;  2ENM A;  1MMN A;  5GAN 8;  4C8Q A;  2QQS A;  2J3L A;  3JCM e;  2CP3 A;  4ZTF A;  5KNN A;  1K0S A;  5LJ5 e;  3CPF A;  2HQH A;  1JJC A;  2PZ1 A;  3KBG A;  4YRI A;  3QJY A;  1BK2 A;  3CPW A;  2QYZ A;  3VQV A;  1H4T A;  3A7R A;  5IHK A;  1H92 A;  4H2S A;  1PRL C;  1R0C B;  4LUE A;  4TVR A;  3EFR A;  2COW A;  2AMC B;  2SEM A;  4G84 A;  2K79 A;  1TTH B;  3CCE A;  2DVE A;  3CD6 T;  4PJJ A;  2YUQ A;  3MHX A;  3ZFJ A;  2XDD A;  3L4G A;  1K76 A;  1IZ6 A;  3A8M B;  1IXD A;  2A7Y A;  1T3S A;  3PFS A;  3JCM b;  1TWB A;  2RQV A;  1SSH A;  3JB9 I;  2RJD A;  4RTW A;  4MZP A;  5GAN 7;  4C0G A;  1NG2 A;  1PNJ A;  2RI5 A;  1WXU A;  2P84 A;  3G6E T;  3VS0 A;  4M75 C;  3AHU A;  3FJ5 A;  1AT1 B;  4HXJ A;  5GAN d;  1B70 B;  1NM7 A;  5IHN A;  4CI0 C;  3HXU A;  3LWI A;  4KQE A;  4F17 A;  1LYL A;  2K57 A;  4BDZ A;  2ARS A;  1EFN A;  3CME Q;  1KQS A;  3O8V A;  4HVU A;  1PRM C;  5AT1 B;  3G71 Q;  2DJZ A;  3P8B B;  1X01 A;  2M1H A;  4TQD A;  3GF5 A;  2DU7 A;  3A7U A;  2MIO A;  5J39 A;  1IL2 A;  4PK4 A;  1M3A A;  2CJB A;  1VQ9 Q;  3R07 A;  3QO5 A;  2LP5 A;  3JCM V;  1HYO A;  4A4E A;  1NE8 A;  1WDX A;  2YRV A;  3E2U A;  4J7F A;  3M55 A;  4PL6 A;  1FYN A;  1QP2 A;  3U23 A;  2DTH A;  4RG8 A;  4DBQ A;  1Q81 R;  1M1K R;  1SRM A;  2RA2 A;  2DKG A;  1MV3 A;  1V76 A;  3EG9 B;  4M75 F;  5HK0 A;  1Q82 C;  1N9R A;  2COZ A;  2QQR A;  4AH6 A;  4ATO A;  1VA7 A;  3H0H A;  5GAO r;  1RAA B;  4JRP A;  2OX7 A;  3QWY A;  5A0D A;  2VUB A;  2DAQ A;  4YRJ A;  3V7R A;  1MMD A;  3NET A;  3L2V A;  1UJY A;  4ZTU B;  1TUG B;  4M75 A;  3JCM c;  2WAC A;  2LQ8 A;  2MMP A;  3EFS A;  2CZ1 B;  4XEO A;  1TU0 B;  2VVK A;  2ZNI A;  2CP5 A;  5CCA A;  2DBM A;  4YRT A;  1KG1 A;  1ASY A;  2K3X A;  5J26 A;  4PJO E;  1K73 U;  2PVO B;  5GMK j;  3S3M A;  1Y96 B;  5KCO A;  2LCC A;  5FU6 B;  4PLI A;  3PMT A;  3HFV A;  3RKW A;  4Y92 A;  4YRK A;  4J7I A;  3FLG A;  2CDT A;  2JN0 A;  3CCS Q;  4WJ3 M;  4RCC A;  2ZT8 A;  5ELO A;  1O75 A;  1USY C;  2QG9 B;  1G5I A;  2MF2 A;  1D3B B;  5IXB A;  1PSF A;  2HBW A;  2EQK A;  3CCJ A;  2BKD N;  2EVR A;  1VQN T;  5GAM e;  2V1R A;  1PKS A;  1NJI U;  2OAW A;  1OU9 A;  2NUT A;  2JT4 A;  2QGG A;  3G4S A;  5KYU A;  3TU4 K;  3CCU Q;  3UGT A;  3QYH B;  4M7D G;  3ULR B;  4JRQ A;  2V8K A;  3OW2 S;  3MO8 A;  2DD4 A;  1D1B A;  3V7S A;  5CKE A;  4C8Q B;  3BFM A;  2EPD A;  1K9M U;  4E7H A;  1HD3 A;  3OYY A;  4FYW B;  3I56 T;  1YCY A;  1G8X A;  1SF9 A;  1I5L A;  1JJC B;  2YSQ A;  4DQ2 A;  1VIF A;  1W2B A;  4OB2 B;  2DDZ A;  3RUX A;  2RI2 A;  2A28 A;  1JXO A;  5CO7 A;  2OJ2 A;  4E7L A;  3M0P A;  1JBM A;  5C52 B;  4IUQ A;  1FX7 A;  1OZ2 A;  1USY A;  4KBM B;  1NNH A;  2RQR A;  1WA7 A;  2F2W A;  2A08 A;  3L4G B;  4OGC A;  4CC7 A;  4YRE A;  2R57 A;  3PVQ A;  4YRO A;  2LJ3 A;  2QA4 A;  2RHY A;  4A4F A;  4QVZ A;  3URG A;  2L2P A;  1OEB A;  5DM7 R;  1K9A A;  1TXQ A;  4F7U G;  1M2O A;  2AHJ B;  1VQ6 A;  3CCR T;  4YRG A;  1W1F A;  3SB2 A;  3CD6 Q;  2LRQ A;  2E3H A;  4M7D B;  3OBY A;  1RL2 A;  3P8D A;  1U8R A;  4J6X A;  1PC0 A;  1UGV A;  1UHF A;  4J9C A;  3DB4 A;  2HZY A;  1SPK A;  1YI2 A;  1JQQ A;  1N8R R;  1S1N A;  3CCL A;  1T0H A;  2FYK A;  1WHM A;  2XID A;  1YN8 A;  4IUV A;  4LDU A;  3G6E Q;  3HXY A;  1UE9 A;  1RLQ C;  3A74 A;  4M77 E;  3QYG B;  2DET A;  1UGP B;  4LXC A;  2KXD A;  3HHT B;  3VS7 A;  3JCM W;  2E41 A;  4YRR A;  4E2F B;  1I5O B;  1VQM A;  3VRZ A;  4M78 E;  2W10 A;  2F2V A;  3CCV A;  1RUW A;  2M9U A;  1BBZ A;  1NPR A;  2DRM A;  4OF1 A;  1Z7M A;  1BBU A;  4YRQ A;  4M75 B;  3EG3 A;  5CQX A;  3MCA B;  4D8D A;  4HVV A;  3ERR A;  2J06 A;  1KD1 C;  1UGS B;  3VQX A;  3OYC A;  1XJW B;  3A8L B;  3BW1 A;  4RQF A;  4CH6 A;  2ZCF B;  2B8A A;  4C0Z A;  4DBR A;  4RTY A;  1WYD A;  3CXC S;  2M51 A;  5K1P A;  2NUP A;  1KHC A;  2XKO C;  1FMW A;  2EJ9 A;  2F69 A;  4B9W A;  3A8O B;  3GNF B;  1OZ3 A;  5A0L A;  4M75 D;  5GMK m;  3PIO A;  1XTD A;  2BZ8 A;  2RHS A;  1ZBJ A;  2Z0W A;  4H2X B;  3EFO A;  4RTV A;  2K5L A;  2XD0 A;  4MMK A;  3MEU A;  3BE3 A;  1VQK Q;  2CUB A;  2D9T A;  1W70 A;  2NUT B;  5KYU B;  2B86 A;  4ZIB A;  4R56 A;  1Y07 A;  4PJO F;  3VV0 A;  1ZSZ C;  2L3S A;  1X2G A;  5KE3 A;  2AKL A;  4M7A G;  1M1F A;  1RAE B;  2R58 A;  4CH5 A;  3BY7 A;  4NL2 A;  4PJL A;  2Q5H A;  2RO0 A;  3GPL A;  2DJQ A;  8ATC B;  1J5W A;  4AFU C;  2QEX A;  1FYF A;  4HCB A;  1LJO A;  2M02 A;  2DRK A;  4OMM A;  1S72 Q;  1XOV A;  3RDV A;  2E10 A;  2DA9 A;  2JTE A;  5GAO p;  4MZT A;  1Q82 U;  2COY A;  1WQW A;  2E3C A;  1WPY A;  2QQB A;  2FRY A;  4HCZ A;  2QTV A;  1SET A;  2KT1 A;  1WZO A;  2I0N A;  1G2B A;  3M58 A;  2C8M A;  3HXZ A;  3THK A;  5FWB A;  2BTT A;  3VQY A;  1EIY A;  4B9X A;  3UDC A;  2CH4 A;  2CP2 A;  1JJ2 S;  4EPC A;  3UT1 A;  2DXT A;  1H8K A;  4C8Q E;  2EJF A;  1AOJ A;  4TQF A;  2PUK B;  4ZGJ B;  4LVI A;  1VQ5 Q;  2DER A;  2KNB B;  2X3W D;  4XTV A;  1HSQ A;  2EW3 A;  2ZNJ A;  4P75 C;  1K9M R;  2YRC A;  1Y0M A;  3I5R A;  4C5I A;  4H2W A;  2E5A A;  1NJ5 A;  3J81 E;  3VQW A;  1B3Q A;  3EG1 A;  1C0M A;  5GAN j;  1PD0 A;  4KR3 A;  1E7O A;  1YIT Q;  3OQ5 A;  4LD6 A;  3REA B;  3EG0 A;  4FCY A;  3DLM A;  2JOY A;  2DZC A;  2D0N A;  2QDY B;  4OGE A;  4FIB A;  1QVF P;  2ESW A;  2PQW A;  1I0C A;  4PFO A;  4HWT A;  2MCN A;  3OW2 A;  3SD4 A;  3KFV A;  4WI1 A;  1IHV A;  2W0Z A;  2QAZ A;  2FL7 A;  1M9S A;  3PCO B;  4M78 C;  1RAB B;  3CME T;  3DKM A;  4E7S A;  1AD5 A;  4YP0 A;  4BI3 A;  3LLR A;  5FRM A;  1PHT A;  3G71 T;  4M7D E;  1SEM A;  3CMA A;  2EGA A;  4P74 C;  2YUP A;  3OB9 A;  4JLI A;  3QZ9 B;  1VQ9 T;  1OOT A;  1B7T A;  4X9D A;  4ZTZ B;  2VKN A;  2KRM A;  4J6Y A;  1EX4 A;  2L0A A;  4P75 A;  3HXV A;  3MEW A;  4XK8 E;  1FWZ A;  2L5Q A;  2ZPI B;  1BU1 A;  4EDU A;  5CKD A;  4WF2 A;  4M77 F;  3NEL A;  5F5W A;  2HMA A;  1BI1 A;  3QDR B;  1NYR A;  2NUP B;  1YIJ Q;  3HRK A;  1M2V A;  1GGM A;  2LNH B;  1VQ8 T;  4M78 F;  1NEB A;  3VS3 A;  2JMC A;  1D1A A;  3H41 A;  2RHS B;  1SRL A;  4E47 A;  3EFO B;  3CCU A;  3WXM B;  3E1S A;  4F7U E;  3NFC A;  1BI3 A;  1KQ1 A;  1VQP Q;  4KGZ B;  3OA6 A;  4IKF A;  5ELN A;  4P74 A;  1RIQ A;  4CRI A;  3CCS T;  3OYE A;  1BI2 A;  2CZ0 B;  2R5A A;  2K2V A;  3CBM A;  3L1A A;  2ZPF B;  2X3X D;  3RER A;  2LDM A;  1OU8 A;  2R5M A;  3OMC A;  1UB4 A;  2ODR D;  4A4H A;  1IRE B;  3RKY A;  2HQX A;  1QVP A;  1X54 A;  2HDA A;  3A5Z B;  3GP8 A;  3EH2 A;  5GAN e;  1QVG P;  3JSC A;  2K5F A;  2ZR3 A;  2RB6 A;  4UP7 A;  1VQO Q;  3M0T A;  1VUB A;  2DYB A;  3OYL A;  4DEX A;  3QHS A;  3PZC A;  3R6N A;  4A63 B;  2CJ9 A;  4C92 C;  3EGD A;  3CCQ Q;  1EIY B;  2QGF B;  1Q86 C;  4H2T A;  4PJO D;  2LNV A;  1Q7Y C;  1N9W A;  1K4U S;  2EKH A;  6AT1 B;  1X2Q A;  2PVD B;  1GCQ A;  3CXC A;  3LGF A;  4RG2 A;  1KD1 U;  1H4S A;  2OTL T;  2KY9 A;  5HY6 A;  3CD6 A;  4HT4 A;  2DU5 A;  3X24 B;  1K1Z A;  1NLP C;  2C7I A;  3TSZ A;  2VV5 A;  2ZZD A;  4XQ3 A;  1I81 A;  4BUG A;  4R55 A;  4NCX A;  1VYU A;  1KQ2 A;  3L2Z A;  4YDQ A;  5LJ3 e;  2QHV A;  3NEM A;  4X9C A;  2KRN A;  1X56 A;  2A8E A;  3I55 Q;  4GLM A;  4P3O A;  2F5T X;  4Z8A A;  1AZG B;  4C92 F;  1K8A C;  5KYX A;  3V8L A;  2DL7 A;  1YFN A;  1YHQ Q;  3A7A A;  2CT4 A;  4HWS A;  4RKU E;  1X6O A;  2LX7 A;  2IG0 A;  3G7Z A;  1E6G A;  5IHI A;  4M4Z A;  1HTT A;  5D7U A;  3A98 A;  4JDS A;  2VGM A;  3LH0 A;  4C92 A;  2I2L A;  1G5V A;  4XTZ A;  3OYF A;  1RAG B;  1M90 R;  1VQ7 Q;  4ANJ A;  4RTX A;  3JCM P;  5I2S A;  2RNA A;  1VQL T;  4M7A E;  3M0S A;  2HSP A;  5CKB A;  3KUF A;  1KC8 R;  2ZZE A;  1PKT A;  2LQW A;  1KMM A;  4UC4 A;  1BB9 A;  4XTX A;  2AT1 B;  1FMV A;  2ABL A;  1NJ2 A;  2F2X A;  3HFZ A;  3RMQ A;  1D1C A;  1YBY A;  3RL6 A;  1HK9 A;  1OYX A;  1M4Z A;  2NUZ A;  1P92 A;  2XMF A;  4O5V A;  1JJ2 A;  2RHX A;  5AYF A;  3V8J A;  2JXB A;  1W66 A;  4PJN A;  2V26 A;  2ECZ A;  1NBE B;  7AT1 B;  1SHF A;  2CUD A;  1XNI A;  3OYH A;  2ZAE A;  1NJ1 A;  1M2V B;  1R77 A;  2AKW A;  2G6F X;  3OS5 A;  4JJD A;  3OYK A;  4OMQ A;  2FZK B;  1MNE A;  1T3L A;  4KUI A;  1GXI E;  2V8I A;  1Y71 A;  4BE1 A;  2WSC E;  2KSS A;  3OYB A;  1N9S A;  4HT8 A;  3LX7 A;  1VQ8 Q;  2H8H A;  4M77 D;  5HGQ A;  4C8Q G;  4LDY A;  2EQM A;  3L2U A;  3F70 A;  1VQN A;  4J9D A;  2DEU A;  1YJN Q;  1B34 B;  2QHT A;  3A5Y A;  5DLQ E;  4M78 D;  3RAC A;  2YHT A;  1H3Z A;  3JCM d;  4LN2 A;  3V7C A;  3JRZ A;  2EQJ A;  1VQK T;  4K86 A;  2BZX A;  3JCM Q;  4EO4 A;  2DLP A;  2JS0 A;  2GQI A;  3TRE A;  4E51 A;  4HVC A;  1NEG A;  3I56 A;  11AS A;  3TEE A;  3EGD B;  2M16 A;  4GY5 A;  2GNC A;  4IUP A;  2KK4 A;  4CS2 A;  2LJ1 A;  3EH1 A;  3JV3 A;  3VRY A;  4DBF A;  3REB B;  2OTJ A;  1L0W A;  1S72 T;  3V8K A;  2VC8 A;  3MEV A;  2CJA A;  4RTT A;  4BE2 A;  1PG5 B;  3JCM X;  3T9N A;  3M9Q A;  3OYI A;  3OYA A;  4RUG A;  3OBW A;  1N5Z A;  2ALY A;  1IB8 A;  5FU7 B;  3H6Z A;  1OX9 A;  1M30 A;  1M8V A;  2FO0 A;  2ZPE B;  4E7K A;  1G3W A;  3JCM J;  3JCM h;  5C6S A;  12AS A;  3M4Y A;  3VBB A;  1ZSG A;  5GAN 2;  1U06 A;  2DE0 X;  2MAM A;  3OS1 A;  3CCR A;  4QW2 A;  3QSU A;  4FU6 A;  3E19 A;  1VQ5 T;  5KYX B;  2OTL Q;  2QAS A;  1X6B A;  2XGT A;  2CZ6 B;  5FRO A;  3CPW P;  5LL6 S;  2AZV A;  2RHQ A;  1ATI A;  2ROT A;  2ZPG B;  2E3I A;  4MML A;  4JUV A;  1UJ0 A;  1Q81 C;  1M1K C;  4ELZ C;  3OYJ A;  4YRL A;  3ZL7 C;  4C92 B;  3DLL A;  1AVZ C;  2FG0 A;  2GBQ A;  3NMZ C;  3RES A;  4IIO A;  1KD1 R;  2LT4 A;  3S3N A;  2JW4 A;  3CCM Q;  1G51 A;  1I1J A;  2JS2 A;  1GRI A;  4ZNX A;  3H0F A;  1YIT T;  3MEY A;  4II1 A;  3VS5 A;  4M75 G;  1E24 A;  1DJ7 B;  1WFW A;  2QK0 A;  3SHW A;  1ZLM A;  5IAY A;  1ZA1 B;  1KFZ A;  2ZPB B;  3HFZ B;  1H4Q A;  3QII A;  1H4V B;  4GBQ A;  2XDP A;  2DL4 A;  2RHZ A;  3G4S T;  4K11 A;  4PFP A;  3ME9 A;  2CSI A;  3JB9 F;  1E1T A;  2PU9 B;  2ZCE A;  1RI9 A;  2RMO A;  2YWW A;  4C92 D;  4RQE A;  1FMK A;  1KQS P;  1RAI B;  3G1J A;  1WHL A;  2GFU A;  1VQL Q;  2AKW B;  1Q86 U;  3NTH A;  4M7A F;  3QTC A;  2AIR B;  5CVI A;  2KRO A;  2RD1 A;  1WQ7 A;  3PT9 A;  5K1X A;  3X25 B;  3WVE B;  1E6H A;  2VB6 A;  2SRC A;  2CZ7 B;  2EGC A;  2V1Q A;  4RMO A;  5ECA A;  5GMK e;  2X9H A;  3TEH A;  4FYV B;  3MET A;  4IUU A;  3H0I A;  2IY5 A;  3LH5 A;  2QDL A;  3H8Z A;  3M57 A;  2ODR C;  3M53 A;  2Q7E A;  2AZS A;  4X1V A;  5GAM d;  3W3S A;  2EYW A;  3O5Z A;  4BD3 A;  4CS3 A;  4YRN A;  1YIJ T;  2FB7 A;  4FT2 A;  4V2S A;  4YRF A;  3IAL A;  3JCM g;  2Y4X A;  3LSQ A;  2E6Z A;  4Y91 A;  1K8A U;  4PJO C;  5FW9 A;  1VQ6 T;  4YCW A;  2ARU A;  3M0U A;  3CCE Q;  2ART A;  1X2H A;  1ZQ1 A;  3LW5 E;  3MQZ A;  4C5G A;  1VQP T;  1U5S A;  2PMF A;  3WQZ A;  2ZIO A;  1OQK A;  3QG1 A;  2XDB A;  4HWR A;  2FRW A;  1C1A A;  2LT1 A;  1YGB A;  4YCU A;  2DX1 A;  4H2U A;  4OML A;  3QXE B;  1VQ4 A;  4HWP A;  2L3Q A;  1QE0 A;  4KUD K;  2DD5 A;  1MGQ A;  2HCK A;  3QJ6 A;  3IQL A;  4C0F A;  4RMF A;  2JMA A;  1KMN A;  4OP0 A;  4ORZ A;  3PVL A;  4CS4 A;  5GAM h;  2DF6 A;  2FPD A;  4YTL A;  2GFA A;  4B6M A;  2L89 A;  2RM4 A;  4FT4 A;  3RIR A;  3RF1 A;  4E7J A;  3VYG A;  2KAF A;  1VQM T;  2ALY B;  2BIV A;  2YRD A;  3PIP A;  3NTK A;  3RNJ A;  5GAO m;  1VQO T;  2D6F A;  2O2O A;  2CP0 A;  4F04 B;  3CCQ T;  3A32 A;  3EGX A;  3NGP A;  4QVD A;  3CC4 T;  1K73 R;  4PJO A;  1NYF A;  2O01 E;  1X27 A;  5IT9 E;  2P5I A;  2DL5 A;  4DBH A;  3A31 A;  4Y28 E;  1N8R C;  3D7S B;  2EWN A;  3S6W A;  2BUD A;  1CKB A;  2DM1 A;  1QKX A;  1W2B P;  3OSV A;  3SFM A;  3P8T A;  4CH3 A;  1NJ6 A;  3FC3 A;  3UFG A;  5KYW A;  3OMG A;  2EIF A;  3C95 A;  1VYV A;  3X26 B;  1QMC A;  2O31 A;  2KEA A;  1BBW A;  2ZIN A;  1NJI R;  3KFU A;  3EHQ A;  2QQ9 A;  5CR2 A;  2JVV A;  2O4X A;  3I55 T;  4IIM A;  1PYS A;  2EBP A;  4A54 A;  4JRK A;  3P8Y A;  2LCS A;  4LNS A;  4JZ3 A;  4CH4 A;  3CME A;  4UP9 A;  1TUC A;  2C0I A;  2GTO A;  1WI7 A;  1YHQ T;  4FSX A;  4OMN A;  3CC2 T;  1ZSZ A;  3FRN A;  1R0B G;  3LC0 A;  3G71 A;  5GMK i;  1U1S A;  2XG8 D;  1YWP A;  2RN8 A;  4NL3 A;  1EVL A;  1EFW A;  1EVK A;  1YB3 A;  1OX8 A;  4KH0 B;  3M0Q A;  2GGR A;  2ZT5 A;  1VQ9 A;  1VQ7 T;  2RPN A;  1QW1 A;  1YJ9 T;  4HA8 A;  4Q5W A;  3X28 B;  5KYN A;  3Q1J A;  3CCJ Q;  3R6O A;  1I4K 1;  2O9V A;  1YJW T;  1BCO A;  2DXU A;  5GAM g;  4M77 C;  3NHN A;  5D6Y A;  1H3H A;  3VS4 A;  2YT6 A;  3QPH A;  1MND A;  4FYX B;  3G4S Q;  2IVW A;  3TEH B;  1NZ9 A;  2KQW A;  1WJR A;  2C06 A;  4XTW A;  2IY5 B;  3M4P A;  2HQE A;  2CP6 A;  4OB0 B;  1LNX A;  5CIU A;  2CIM A;  2A0F B;  3JB9 D;  1OUL A;  1BIA A;  3EGU A;  4OVA A;  3GIB A;  2DVJ A;  1OV3 A;  2WSE E;  1NJ8 A;  2DZ9 A;  5GAN 6;  3HP9 A;  2Y90 A;  4ZGD B;  3OS2 A;  3MEA A;  4MDX A;  5D6X A;  2EJG A;  4M7A D;  1Z7N A;  1WJS A;  4N4G A;  1ASZ A;  2X51 A;  3GNG A;  1PD1 A;  1Q81 U;  1M1K U;  2XHC A;  3P8V A;  1UUE A;  2P0Q A;  1GL5 A;  3REU A;  2GF7 A;  3CCS A;  3A8H B;  2PME A;  2Q7H A;  1N6A A;  1NLO C;  3C94 A;  2QHU A;  4N0A C;  2MWO A;  3MKD A;  2QA4 Q;  1SRY A;  4A4G A;  2E65 A;  5L23 A;  2EYQ A;  4M77 A;  4OMO A;  4LE9 A;  3JCM f;  2QI2 A;  3INZ A;  1YJN T;  1HC7 A;  4M75 E;  1C0A A;  2HSE B;  1N27 A;  5LJ5 f;  5L8R E;  3SEM A;  1VQ6 Q;  2D0Q B;  1IO6 A;  4X34 A;  4HCK A;  4M78 A;  1KJW A;  2L3R A;  3OD1 A;  1AHJ B;  3BDL A;  1GFC A;  4Z89 A;  2A37 A;  3L2W A;  2KVQ G;  1X2K A;  4XU0 A;  3CMA T;  1UGQ B;  4AFZ C;  1YI2 Q;  4QQD A;  3CCL Q;  2PTK A;  3PMI A;  3EGX B;  3I7F A;  2VXF A;  4PJO B;  3IKM B;  4BY6 C;  2OTL A;  2IPO B;  2QQA A;  1R8O B;  3LYI A;  2DQ0 A;  2CT3 A;  2KYB A;  1M3B A;  4F14 A;  5GAN 4;  1UGR B;  3MP8 A;  5IH2 A;  4NOY A;  5KYW B;  2MOX A;  4L59 A;  3SWN C;  2CKK A;  1VQM Q;  4N0A A;  4O6J A;  3J7A F;  4KR2 A;  2HKQ B;  2YDL A;  2CS7 A;  4C8Q C;  2JUF A;  2L8D A;  4FW2 A;  2CRE A;  1H64 1;  4AG2 C;  3CC4 Q;  1JB0 E;  2O4X B;  3MJX A;  3HSB A;  5HK3 A;  4BB7 A;  2I4L A;  1Y96 A;  2HL3 A;  3C4S A;  4ZGE B;  2Q5I A;  3G1Z A;  4HVW A;  1EQR A;  1ZSZ B;  2YXY A;  2XK0 A;  1VIE A;  4KH1 B;  4PNO A;  1D3B A;  4H02 A;  4LUD A;  2FPF A;  1TH7 A;  1IGU A;  1AZE A;  3CCM T;  3VS1 A;  2DNU A;  4N4I A;  3G6E A;  3HXX A;  1I07 A;  4K88 A;  4P71 C;  1Q82 R;  3M59 A;  3JAM E;  4C8Q F;  1E1O A;  3A8G B;  4TVA A;  4FL6 A;  1QVF S;  1RAD B;  1TUD A;  4D8K A;  3HY0 A;  2E1H A;  3OW2 P;  3CC2 Q;  5GAN 5;  3C0C A;  4DOV A;  3SWN A;  3TCJ A;  4C0D C;  2KI7 A;  2K7A A;  3IG2 A;  3TSW A;  2EYZ A;  1QCN A;  4M7D C;  2RJF A;  2O88 A;  1OPL A;  5GAN 3;  4HKE A;  4TTV A;  1YFR A;  3E9G A;  4P3P A;  4PLL A;  4JJN K;  4BI8 B;  1YJ9 Q;  4JRI A;  4NS5 A;  1MMG A;  1LPL A;  4RDX A;  2HD0 A;  4ELY C;  2M0Y A;  3M0R A;  2DIQ A;  2DXC A;  3HRT A;  2QEX Q;  1AWX A;  1ABQ A;  1YJW Q;  4QKU A;  2HNI A;  5GAM j;  1N8R U;  2CGH A;  4BE0 A;  2KR3 A;  2RK2 A;  1B8A A;  2ZT6 A;  4TWA A;  3HFO A;  2P0L A;  2X35 A;  4KRT A;  3QKJ A;  4AFS C;  5GAM f;  4D6W A;  3FEO A;  3CBO A;  5KCH A;  4J5Y A;  1QF6 A;  2ED0 A;  2DTO A;  1WYX A;  4Q15 A;  2HL5 C;  4E6R A;  1U3O A;  3CC7 T;  3HRI A;  2VXE A;  1ACM B;  2RQU A;  2HAX A;  1AWJ A;  1PCX A;  8AT1 B;  4XU3 A;  2VYT A;  2XI9 A;  3P8H A;  1F1B B;  5EC7 A;  4P71 A;  4M7D F;  2DIG A;  1ADY A;  3VS2 A;  4UPA A;  1A0N B;  1QQJ A;  4M77 B;  4F16 A;  3HPW A;  3GOX A;  3LSS A;  2ROL A;  2E5Q A;  1X43 A;  3NEN A;  1VQK A;  1TS9 A;  3TQ7 P;  5GJW B;  3NTI A;  3JB9 H;  4M7D A;  4M78 B;  1ZX6 A;  3CCE T;  1MHN A;  4WTO B;  4VUB A;  4KT0 E;  3UF4 A;  2D8H A;  2MPX C;  2RH2 A;  4Z88 A;  1HJD A;  3OY9 A;  3C12 A;  1QP3 A;  1UHC A;  5CQY A;  4LVM A;  4EIK A;  2RF0 A;  3RR6 A;  4OB3 B;  3N5B B;  3VKI A;  1WHK A;  3FDR A;  3GBQ A;  2QTX A;  3CEY A;  3I5S A;  1S72 A;  1G5H A;  2LMJ A;  1WJQ A;  3I9Q A;  2H3J A;  4R0K A;  2P0K A;  4PJM A;  5LJ3 d;  4WCI A;  1AWW A;  4XEM A;  1BYM A;  4RTU A;  5LJ5 d;  1VQZ A;  4F7U F;  2JM8 A;  9ATC B;  3MF1 A;  4BDY A;  1SKU B;  5GAN h;  2AK5 A;  4C92 G;  1QVG S;  1AWO A;  3CMA Q;  1GCP A;  4HT9 A;  1M90 C;  4ESR A;  4F7U A;  1VQ5 A;  3QBY A;  4AG1 C;  2E5K A;  1WXT A;  3ZBD A;  1O9S A;  1KC8 C;  2BE7 D;  3ICA A;  1RAC B;  2JZ2 A;  3J80 E;  2EYX A;  4J15 A;  1Y57 A;  3CXC P;  1M27 C;  1EOV A;  1X55 A;  1EZZ B;  4C5H A;  1YFT A;  1KOG A;  4JZ4 A;  1D0Z A;  2VAS A;  4LDX A;  2JNG A;  4BWA A;  1WU7 A;  4L6V 5;  3VUZ A;  2I4N A;  5GMK l;  2D1X A;  2K3B A;  1YIT A;  1B7Y A;  1LVK A;  1QKW A;  4BY6 B;  5A0G A;  2KXC A;  3UA7 A;  4H2X A;  5LJ3 h;  3CBP A;  4JS4 A;  2ZGW A;  4QQ6 A;  2HKN A;  4H2Y A;  5LJ5 h;  1D0Y A;  5HKC A;  1YNZ A;  5FWC A;  3BDU A;  4P73 C;  4TVA B;  1B76 A;  4ME7 A;  4L5G A;  3SWN B;  2EL9 A;  5GAO l;  2A36 A;  3BJU A;  4FYY B;  4LD9 K;  1M5Q 1;  5I22 A;  4LDW A;  2PVG B;  2MK5 A;  1JO8 A;  5A2Q E;  3LGL A;  4M7A C;  4YPF A;  4CC3 A;  2G3R A;  1UTI A;  2EGE A;  2Q7G A;  1ABO A;  2KYM A;  2CH4 W;  2K5I A;  4OMF B;  3CCJ T;  1Z9Q A;  4BW9 A;  4OLF A;  1GBR A;  3VUB A;  2LX9 A;  4G85 A;  1G3Y A;  1UEC A;  3FIF A;  2OTJ T;  1G3S A;  3PTA A;  1SG5 A;  1OI1 A;  5M9O A;  2MYS A;  4AMC A;  2P4T A;  4C8Q D;  5GAN g;  1YIJ A;  1JJ2 P;  2DK3 A;  2RJE A;  3PGG A;  3QDF A;  1U1T A;  1W4S A;  2YUN A;  2ZXF A;  5EG2 A;  4FSS A;  2QXF A;  2XTI A;  2DMO A;  2LTO A;  2CSQ A;  2DBK A;  4PG3 A;  4Z02 A;  4LNP A;  1Q7Y U;  4P73 A;  3QO8 A;  2K3Y A;  2FPE A;  3EG2 A;  2DEQ A;  5CK9 A;  1GFD A;  1WHH A;  4EMH A;  3FJP A;  3NPF A;  1K0X A;  4KGX B;  2RHU A;  4C0D B;  5I11 A;  2J6K A;  2ATC B;  1YCS B;  1RI0 A;  1JXM A;  3CQT A;  3EAE A;  3HXW A;  1VQP A;  2D8J A;  3REX A;  1LCK A;  1FXX A;  4M7A A;  1NYQ A;  2J05 A;  1W6X A;  1M8M A;  3E9F A;  3VS6 A;  4IUR A;  3E9I A;  3RKX A;  3ASK A;  3CC7 Q;  3OYN A;  1G3T A;  1QVF A;  2K2M A;  4L87 A;  1LOJ A;  2NWM A;  3OSS C;  3I35 A;  2MWP A;  2DQ3 A;  5LJ3 g;  2X4J A;  4CC4 B;  2QA4 T;  4HWO A;  2DTI A;  2QHS A;  2K6D A;  1JEG A;  5LJ5 g;  1WGS A;  1SER A;  4IUT A;  4P72 C;  2LVM A;  4A4K A;  2RQW A;  4M7D D;  3PCO A;  4KGV B;  2H3E B;  4LDV A;  1QWE A;  4J9B A;  2XIC A;  5IN1 A;  1D09 B;  2RK1 A;  4OB1 B;  2EAY A;  4XAX B;  2E12 A;  3S3O A;  4TVW A;  1CSK A;  4RCB A;  2J6F A;  1J3T A;  1VQO A;  2BE9 B;  1Q95 G;  4JJC A;  4J9I A;  2DL3 A;  2X4X A;  3CCQ A;  2E64 A;  5DY9 A;  1KHI A;  2YLC A;  3CC4 A;  4EMK C;  3GLX A;  4YRP A;  4A53 A;  4CC2 A;  1YI2 T;  3IKL A;  1YWO A;  2C0T A;  5IXF A;  2RI3 A;  3CCL T;  3UGQ A;  3UH0 A;  4F7U B;  4EX5 A;  4LVJ A;  1IRX A;  3HTZ A;  2JTM A;  3ER0 A;  2FEI A;  1I8F A;  1Z9Z A;  3LWH A;  1TOV A;  3HKS A;  2E6N A;  2DL8 A;  4X5O A;  2NS6 A;  3L2R A;  5FLX E;  2RQT A;  1GBQ A;  4XTY A;  1KSW A;  2KGT A; 
#chains in the Genus database with same CATH homology
 5GAO n;  4P5N A;  3CCV T;  1B7Y B;  3HFN A;  3I55 A;  3JB9 G;  4P72 A;  4C5E A;  2P0P A;  4E7I A;  1WLE A;  5E3I A;  1BKB A;  1V29 B;  4HCC A;  1YHQ A;  3CC2 A;  2FHD A;  2G4C A;  1BIB A;  3CPW S;  2RHQ B;  5J3B A;  1YFS A;  1VQ7 A;  4EMK A;  3OS0 A;  1YJ9 A;  3L42 A;  2RJC A;  2LC4 A;  1VQ4 T;  4Q6G A;  5CAI A;  3DSQ A;  1YJW A;  1SSF A;  3QO7 A;  4J8O A;  1QVG A;  3A5Z A;  4PHC A;  1M1G A;  4YYE A;  3M54 A;  2GCX A;  3RMS A;  4XU1 A;  3FB9 A;  1KQS S;  4C92 E;  3HRU A;  1M90 U;  5DLO A;  2X4Y A;  1KC8 U;  1X75 C;  2QEX T;  2EFI A;  2FVU A;  5GMK h;  4PKC C;  4M7A B;  1EIF A;  2OAU A;  2M0O A;  5GAN f;  1VQ8 A;  5CKF A;  2DPP B;  2XU8 A;  3HRS A;  4JLG A;  4QVC A;  1YJN A;  2RHI A;  4XTU A;  2A3L A;  2GQV A;  4PJO G;  5C0M A;  3ZEH A;  4H2V A;  2AMC A;  2HBP A;  2Y4Y A;  2YLB A;  3HL8 A;  1K73 C;  3OYG A;  5KE2 A;  4DOW A;  5C51 B;  2NLU A;  5CKH A;  3QUI A;  1E22 A;  3HY1 A;  2K4Y A;  3M4G A;  1ADJ A;  3QZ5 B;  2EKO A;  4LVL A;  1UEB A;  5LJ3 j;  3DB3 A;  4ZN3 A;  5I2M A;  2DXB A;  5LJ5 j;  1B70 A;  1ZHI A;  5LJ3 f;  2V8J A;  3UPU A;  4DPG A;  3OYM A;  1NJI C;  2X4W A;  1PSE A;  3VU3 C;  5I21 A;  4QQG A;  4YRC A;  4K87 A;  3UWN A;  5FRN A;  3MP1 A;  2KMT A;  4N4H A;  5FU6 C;  1ZBX A;  1BI0 A;  4ZTJ A;  1K9M C;  2CYZ B;  3MF2 A;  4JS5 A;  1HXD A;  4O2D A;  3SDZ A;  3PNW C;  3OYD A;  4YRS A;  2ZPH B;  4EMG A;  2KDS A;  3VYH B;  2ZZG A;  4KUL A;  3QNE A;  3QO3 A;  2DO3 A;  5D6W A;  4BI4 A;  1W2B S;  2ZZF A;  4UP8 A;  4YCV A;  2J3M A;  5FU7 C;  4EMK B;  2I4M A;  4MZM A;  3CCM A;  3TEG A;  3TUP A;  3VJP A;  1B34 A;  3E9H A;  2LCL A;  1SES A;  4LVK A;  2WSF E;  2LQK A;  4J6W A;  4BAC A;  4P3N A;  3M5A A;  3M4Q A;  1JRI A;  1PYS B;  3JB9 J;  4TVY A;  2ZIM A;  5KH6 A;  2MI6 A;  3CCU T;  2PUO B;  4GLK A;  2ZR2 A;  2ZT7 A;  3CMQ A;  4XU2 A;  4YRM A;  4MDW A;  3M56 A;  4DA4 A;  4J83 A;  1VQL A;  3X20 B;  2E70 A;  2EQU A;  4M77 G;  4FM4 B;  4WJ4 A;  1NPP A;  5C53 B;  3L2Q A;  2VGN A;  1XQH A;  2F5K A;  3MP6 A;  3RGL A;  4M78 G;  5GAO q;  2JTF A;  2I4O A;  3CC7 A;  3WVD B;  1Y7X A;  4ZN1 A;  1WNL A;  3KXT A;  5GAN 8;  4C8Q A;  2QQS A;  2J3L A;  3JCM e;  4ZTF A;  5KNN A;  5LJ5 e;  3CPF A;  1JJC A;  3KBG A;  4YRI A;  3QJY A;  3CPW A;  3VQV A;  1H4T A;  3A7R A;  4H2S A;  4TVR A;  3EFR A;  2AMC B;  4G84 A;  3CCE A;  2DVE A;  3CD6 T;  3MHX A;  3ZFJ A;  2XDD A;  3L4G A;  1IZ6 A;  3A8M B;  2A7Y A;  3PFS A;  3JCM b;  3JB9 I;  2RJD A;  4MZP A;  5GAN 7;  4C0G A;  2RI5 A;  3G6E T;  3AHU A;  4M75 C;  5GAN d;  1B70 B;  4CI0 C;  3HXU A;  3LWI A;  4KQE A;  1LYL A;  2K57 A;  4BDZ A;  2ARS A;  1KQS A;  3O8V A;  2DJZ A;  3P8B B;  1X01 A;  2M1H A;  4TQD A;  3GF5 A;  2DU7 A;  3A7U A;  5J39 A;  1IL2 A;  2CJB A;  3R07 A;  3QO5 A;  3JCM V;  4A4E A;  1NE8 A;  2YRV A;  4J7F A;  3M55 A;  4PL6 A;  1QP2 A;  2DTH A;  4RG8 A;  2RA2 A;  2DKG A;  4M75 F;  5HK0 A;  1Q82 C;  1N9R A;  2QQR A;  4AH6 A;  4ATO A;  5GAO r;  4JRP A;  5A0D A;  2VUB A;  2DAQ A;  4YRJ A;  3V7R A;  3NET A;  3L2V A;  4ZTU B;  4M75 A;  3JCM c;  2WAC A;  2LQ8 A;  2MMP A;  3EFS A;  2CZ1 B;  4XEO A;  2ZNI A;  5CCA A;  4YRT A;  1KG1 A;  1ASY A;  2K3X A;  5J26 A;  4PJO E;  1K73 U;  2PVO B;  5GMK j;  3S3M A;  1Y96 B;  5KCO A;  2LCC A;  5FU6 B;  4PLI A;  3PMT A;  3HFV A;  3RKW A;  4YRK A;  4J7I A;  3FLG A;  2JN0 A;  4WJ3 M;  4RCC A;  2ZT8 A;  5ELO A;  1O75 A;  1USY C;  1G5I A;  2MF2 A;  1D3B B;  1PSF A;  2EQK A;  3CCJ A;  2BKD N;  1VQN T;  5GAM e;  1NJI U;  3G4S A;  3TU4 K;  3UGT A;  3QYH B;  4M7D G;  4JRQ A;  2V8K A;  3OW2 S;  3MO8 A;  2DD4 A;  3V7S A;  5CKE A;  4C8Q B;  3BFM A;  1K9M U;  4E7H A;  3OYY A;  3I56 T;  1YCY A;  1I5L A;  1JJC B;  4DQ2 A;  1VIF A;  1W2B A;  4OB2 B;  2DDZ A;  3RUX A;  2RI2 A;  5CO7 A;  4E7L A;  1JBM A;  5C52 B;  4IUQ A;  1FX7 A;  1OZ2 A;  1USY A;  4KBM B;  1NNH A;  3L4G B;  4OGC A;  4YRE A;  2R57 A;  4YRO A;  2QA4 A;  2RHY A;  4A4F A;  4QVZ A;  3URG A;  5DM7 R;  4F7U G;  2AHJ B;  1VQ6 A;  3CCR T;  4YRG A;  3SB2 A;  2LRQ A;  4M7D B;  3OBY A;  1RL2 A;  3P8D A;  1U8R A;  4J6X A;  3DB4 A;  1YI2 A;  3CCL A;  2FYK A;  2XID A;  4IUV A;  4LDU A;  3HXY A;  3A74 A;  4M77 E;  3QYG B;  1UGP B;  3HHT B;  3JCM W;  2E41 A;  4YRR A;  1VQM A;  4M78 E;  3CCV A;  2M9U A;  4OF1 A;  1NPR A;  1Z7M A;  1BBU A;  4YRQ A;  4M75 B;  5CQX A;  3MCA B;  3ERR A;  1KD1 C;  1UGS B;  3VQX A;  3OYC A;  3A8L B;  3BW1 A;  4RQF A;  4CH6 A;  2ZCF B;  2B8A A;  4C0Z A;  1WYD A;  3CXC S;  5K1P A;  1KHC A;  2XKO C;  2EJ9 A;  2F69 A;  4B9W A;  3A8O B;  3GNF B;  1OZ3 A;  5A0L A;  4M75 D;  5GMK m;  3PIO A;  1XTD A;  2RHS A;  4H2X B;  2K5L A;  2XD0 A;  4MMK A;  3MEU A;  2D9T A;  4ZIB A;  4R56 A;  1Y07 A;  4PJO F;  3VV0 A;  1X2G A;  5KE3 A;  4M7A G;  1M1F A;  2R58 A;  4CH5 A;  3BY7 A;  4NL2 A;  2Q5H A;  2RO0 A;  3GPL A;  1J5W A;  2QEX A;  1FYF A;  4HCB A;  1LJO A;  1XOV A;  2E10 A;  5GAO p;  4MZT A;  1Q82 U;  1WQW A;  2E3C A;  1WPY A;  2QQB A;  4HCZ A;  1SET A;  3M58 A;  2C8M A;  3HXZ A;  3VQY A;  1EIY A;  4B9X A;  3UDC A;  1JJ2 S;  4EPC A;  3UT1 A;  2DXT A;  4C8Q E;  2EJF A;  4TQF A;  2PUK B;  4ZGJ B;  4LVI A;  4XTV A;  2ZNJ A;  4P75 C;  4H2W A;  4C5I A;  2E5A A;  1NJ5 A;  3J81 E;  3VQW A;  5GAN j;  4KR3 A;  3OQ5 A;  4LD6 A;  3DLM A;  2JOY A;  2DZC A;  2QDY B;  4OGE A;  4FIB A;  2PQW A;  4HWT A;  3OW2 A;  3SD4 A;  4WI1 A;  2FL7 A;  1M9S A;  3PCO B;  4M78 C;  3CME T;  3DKM A;  4YP0 A;  4BI3 A;  3LLR A;  5FRM A;  3G71 T;  4M7D E;  3CMA A;  4P74 C;  3OB9 A;  4JLI A;  3QZ9 B;  1VQ9 T;  4X9D A;  4ZTZ B;  4J6Y A;  4P75 A;  3HXV A;  3MEW A;  4XK8 E;  1FWZ A;  2L5Q A;  2ZPI B;  4EDU A;  5CKD A;  4WF2 A;  4M77 F;  3NEL A;  5F5W A;  1BI1 A;  3QDR B;  1NYR A;  3HRK A;  1GGM A;  1VQ8 T;  4M78 F;  2RHS B;  4E47 A;  3CCU A;  3WXM B;  3E1S A;  4F7U E;  3NFC A;  1BI3 A;  1KQ1 A;  3OA6 A;  4IKF A;  5ELN A;  4P74 A;  1RIQ A;  4CRI A;  3CCS T;  3OYE A;  1BI2 A;  2CZ0 B;  2R5A A;  2K2V A;  3CBM A;  3L1A A;  2ZPF B;  3RER A;  2LDM A;  2R5M A;  3OMC A;  1UB4 A;  2ODR D;  4A4H A;  1IRE B;  3RKY A;  1QVP A;  2HQX A;  1X54 A;  3A5Z B;  3GP8 A;  5GAN e;  3JSC A;  2K5F A;  2ZR3 A;  2RB6 A;  4UP7 A;  1VUB A;  3OYL A;  3QHS A;  3PZC A;  2CJ9 A;  4C92 C;  1EIY B;  1Q86 C;  4H2T A;  4PJO D;  2LNV A;  1Q7Y C;  1N9W A;  2PVD B;  3CXC A;  3LGF A;  4RG2 A;  1KD1 U;  1H4S A;  2OTL T;  2KY9 A;  5HY6 A;  3CD6 A;  4HT4 A;  2DU5 A;  3X24 B;  2C7I A;  2VV5 A;  2ZZD A;  4XQ3 A;  1I81 A;  4BUG A;  4R55 A;  4NCX A;  1KQ2 A;  3L2Z A;  4YDQ A;  5LJ3 e;  2QHV A;  3NEM A;  4X9C A;  1X56 A;  2A8E A;  4P3O A;  2F5T X;  4C92 F;  1K8A C;  3V8L A;  3A7A A;  4HWS A;  4RKU E;  1X6O A;  2IG0 A;  3G7Z A;  1HTT A;  4JDS A;  2VGM A;  3LH0 A;  4C92 A;  2I2L A;  1G5V A;  3OYF A;  4XTZ A;  3JCM P;  5I2S A;  1VQL T;  4M7A E;  5CKB A;  3KUF A;  2ZZE A;  1KMM A;  4UC4 A;  4XTX A;  1NJ2 A;  3HFZ A;  3RMQ A;  1YBY A;  3RL6 A;  1HK9 A;  1OYX A;  1M4Z A;  4O5V A;  1P92 A;  2ZTG A;  1JJ2 A;  2RHX A;  5AYF A;  3V8J A;  1W66 A;  1XNI A;  3OYH A;  1NJ1 A;  2AKW A;  3OS5 A;  3OYK A;  4KUI A;  1GXI E;  2V8I A;  1Y71 A;  4BE1 A;  2WSC E;  2KSS A;  3OYB A;  1N9S A;  4HT8 A;  3LX7 A;  4M77 D;  5HGQ A;  4C8Q G;  4LDY A;  2EQM A;  3L2U A;  3F70 A;  1VQN A;  1B34 B;  2QHT A;  3A5Y A;  5DLQ E;  4M78 D;  3RAC A;  2YHT A;  1H3Z A;  3JCM d;  3V7C A;  3JRZ A;  2EQJ A;  1VQK T;  4K86 A;  3JCM Q;  4EO4 A;  3TRE A;  4E51 A;  4HVC A;  3I56 A;  11AS A;  3TEE A;  2M16 A;  4GY5 A;  4IUP A;  2KK4 A;  4CS2 A;  2OTJ A;  1L0W A;  1S72 T;  3V8K A;  2VC8 A;  3MEV A;  2CJA A;  4BE2 A;  3JCM X;  3T9N A;  3M9Q A;  3OYI A;  3OYA A;  3OBW A;  2ALY A;  5FU7 B;  3H6Z A;  1M8V A;  2ZPE B;  4E7K A;  1G3W A;  3JCM J;  3JCM h;  5C6S A;  12AS A;  3M4Y A;  3VBB A;  5GAN 2;  2MAM A;  3OS1 A;  3CCR A;  4QW2 A;  3QSU A;  4FU6 A;  3E19 A;  1VQ5 T;  2XGT A;  2CZ6 B;  5FRO A;  5LL6 S;  2RHQ A;  1ATI A;  2ZPG B;  4MML A;  4JUV A;  1Q81 C;  1M1K C;  4ELZ C;  3OYJ A;  4YRL A;  4C92 B;  3DLL A;  3RES A;  2LT4 A;  3S3N A;  1G51 A;  1YIT T;  3MEY A;  4II1 A;  4M75 G;  1E24 A;  1DJ7 B;  5IAY A;  2ZPB B;  3HFZ B;  1H4Q A;  3QII A;  1H4V B;  2XDP A;  2RHZ A;  3G4S T;  3ME9 A;  3JB9 F;  1E1T A;  2PU9 B;  2ZCE A;  4C92 D;  4RQE A;  2GFU A;  2AKW B;  1Q86 U;  3NTH A;  4M7A F;  3QTC A;  5CVI A;  2RD1 A;  1WQ7 A;  3PT9 A;  5K1X A;  3X25 B;  3WVE B;  2CZ7 B;  4RMO A;  5GMK e;  3TEH A;  3MET A;  4IUU A;  2IY5 A;  3H8Z A;  3M57 A;  2ODR C;  3M53 A;  2Q7E A;  5GAM d;  3W3S A;  4BD3 A;  4CS3 A;  4YRN A;  1YIJ T;  2FB7 A;  4FT2 A;  4V2S A;  4YRF A;  3IAL A;  3JCM g;  2Y4X A;  3LSQ A;  2E6Z A;  4Y91 A;  1K8A U;  4PJO C;  4YCW A;  1VQ6 T;  2ARU A;  2ART A;  1X2H A;  1ZQ1 A;  3LW5 E;  3MQZ A;  4C5G A;  1VQP T;  2PMF A;  3WQZ A;  2ZIO A;  3QG1 A;  2XDB A;  4HWR A;  2LT1 A;  1YGB A;  4YCU A;  4H2U A;  3QXE B;  1VQ4 A;  4HWP A;  1QE0 A;  4KUD K;  2DD5 A;  1MGQ A;  3QJ6 A;  4C0F A;  4RMF A;  1KMN A;  4OP0 A;  4CS4 A;  5GAM h;  4YTL A;  2GFA A;  2L89 A;  2RM4 A;  4FT4 A;  3RIR A;  3RF1 A;  4E7J A;  3VYG A;  2KAF A;  1VQM T;  2ALY B;  2BIV A;  3PIP A;  3NTK A;  5GAO m;  1VQO T;  2D6F A;  3CCQ T;  3A32 A;  4QVD A;  3CC4 T;  4PJO A;  2O01 E;  5IT9 E;  2P5I A;  3A31 A;  4Y28 E;  1N8R C;  2EWN A;  3S6W A;  2BUD A;  3OSV A;  3SFM A;  3P8T A;  4CH3 A;  1NJ6 A;  3FC3 A;  3UFG A;  3OMG A;  2EIF A;  3C95 A;  3X26 B;  1BBW A;  2ZIN A;  3KFU A;  2QQ9 A;  5CR2 A;  2JVV A;  2O4X A;  3I55 T;  1PYS A;  4A54 A;  4JRK A;  3P8Y A;  4LNS A;  4CH4 A;  3CME A;  4UP9 A;  1YHQ T;  3CC2 T;  4FSX A;  3FRN A;  3LC0 A;  3G71 A;  5GMK i;  1U1S A;  2XG8 D;  1EVL A;  4NL3 A;  1EFW A;  1EVK A;  1YB3 A;  2ZT5 A;  1VQ9 A;  1VQ7 T;  1QW1 A;  1YJ9 T;  4HA8 A;  4Q5W A;  3X28 B;  3Q1J A;  3R6O A;  1I4K 1;  1YJW T;  2DXU A;  5GAM g;  4M77 C;  5D6Y A;  3QPH A;  2IVW A;  3TEH B;  1NZ9 A;  2KQW A;  1WJR A;  2C06 A;  4XTW A;  2IY5 B;  3M4P A;  2HQE A;  4OB0 B;  1LNX A;  5CIU A;  2CIM A;  3JB9 D;  1BIA A;  4OVA A;  3GIB A;  2WSE E;  1NJ8 A;  2DZ9 A;  5GAN 6;  3HP9 A;  2Y90 A;  4ZGD B;  3OS2 A;  3MEA A;  4MDX A;  5D6X A;  2EJG A;  4M7A D;  1Z7N A;  1WJS A;  4N4G A;  1ASZ A;  3GNG A;  1Q81 U;  1M1K U;  2XHC A;  3P8V A;  2P0Q A;  3REU A;  2GF7 A;  3CCS A;  3A8H B;  2PME A;  2Q7H A;  1N6A A;  3C94 A;  2QHU A;  4N0A C;  2MWO A;  1SRY A;  4A4G A;  2E65 A;  2EYQ A;  4M77 A;  3JCM f;  2QI2 A;  3INZ A;  1YJN T;  1HC7 A;  4M75 E;  1C0A A;  5LJ5 f;  1N27 A;  5L8R E;  2D0Q B;  4X34 A;  4M78 A;  2L3R A;  3OD1 A;  1AHJ B;  3BDL A;  3L2W A;  2KVQ G;  4XU0 A;  3CMA T;  1UGQ B;  4QQD A;  3PMI A;  3I7F A;  2VXF A;  4PJO B;  3IKM B;  4BY6 C;  2OTL A;  2QQA A;  1R8O B;  3LYI A;  2DQ0 A;  5GAN 4;  1UGR B;  3MP8 A;  4NOY A;  4L59 A;  3SWN C;  2CKK A;  4N0A A;  4O6J A;  3J7A F;  4KR2 A;  2CS7 A;  4C8Q C;  2JUF A;  2L8D A;  1H64 1;  1JB0 E;  2O4X B;  3HSB A;  5HK3 A;  4BB7 A;  2I4L A;  1Y96 A;  3C4S A;  4ZGE B;  2Q5I A;  3G1Z A;  1EQR A;  2XK0 A;  1VIE A;  4PNO A;  1D3B A;  4H02 A;  1TH7 A;  3CCM T;  4N4I A;  3G6E A;  3HXX A;  4K88 A;  4P71 C;  3M59 A;  3JAM E;  4C8Q F;  1E1O A;  3A8G B;  4TVA A;  4FL6 A;  1QVF S;  3HY0 A;  2E1H A;  5GAN 5;  4DOV A;  3SWN A;  3TCJ A;  4C0D C;  3IG2 A;  4M7D C;  2RJF A;  5GAN 3;  4HKE A;  4TTV A;  1YFR A;  3E9G A;  4P3P A;  4PLL A;  4JJN K;  4BI8 B;  4JRI A;  4NS5 A;  4RDX A;  2HD0 A;  4ELY C;  2DIQ A;  2DXC A;  3HRT A;  5GAM j;  2HNI A;  1N8R U;  2CGH A;  4BE0 A;  2RK2 A;  1B8A A;  2ZT6 A;  4TWA A;  3HFO A;  2P0L A;  2X35 A;  3QKJ A;  5GAM f;  4D6W A;  3FEO A;  3CBO A;  5KCH A;  4J5Y A;  1QF6 A;  2DTO A;  4Q15 A;  3CC7 T;  3HRI A;  2VXE A;  2HAX A;  4XU3 A;  2VYT A;  2XI9 A;  3P8H A;  4P71 A;  4M7D F;  2DIG A;  1ADY A;  4UPA A;  4M77 B;  3HPW A;  3GOX A;  3LSS A;  2E5Q A;  3NEN A;  1VQK A;  3NTI A;  3JB9 H;  4M7D A;  4M78 B;  3CCE T;  1MHN A;  4VUB A;  4KT0 E;  2RH2 A;  3OY9 A;  3C12 A;  1QP3 A;  5CQY A;  4LVM A;  4OB3 B;  3N5B B;  3VKI A;  3FDR A;  2QTX A;  3CEY A;  1S72 A;  1G5H A;  1WJQ A;  2H3J A;  2P0K A;  5LJ3 d;  4XEM A;  1BYM A;  5LJ5 d;  1VQZ A;  4F7U F;  3MF1 A;  4BDY A;  5GAN h;  4C92 G;  1QVG S;  4HT9 A;  1M90 C;  4F7U A;  1VQ5 A;  3QBY A;  3ZBD A;  1O9S A;  1KC8 C;  3ICA A;  2JZ2 A;  3J80 E;  4J15 A;  1EOV A;  1X55 A;  4C5H A;  1YFT A;  1KOG A;  4LDX A;  2JNG A;  4BWA A;  1WU7 A;  2I4N A;  4L6V 5;  3VUZ A;  5GMK l;  1YIT A;  1B7Y A;  5A0G A;  4BY6 B;  4H2X A;  5LJ3 h;  3CBP A;  4JS4 A;  2ZGW A;  4QQ6 A;  4H2Y A;  5LJ5 h;  5HKC A;  4P73 C;  3BDU A;  4TVA B;  1B76 A;  4ME7 A;  4L5G A;  3SWN B;  2EL9 A;  5GAO l;  3BJU A;  4LD9 K;  1M5Q 1;  4LDW A;  2PVG B;  5A2Q E;  3LGL A;  4M7A C;  4YPF A;  2G3R A;  2Q7G A;  2K5I A;  4OMF B;  3CCJ T;  4BW9 A;  4OLF A;  3VUB A;  2LX9 A;  4G85 A;  1G3Y A;  3FIF A;  2OTJ T;  1G3S A;  3PTA A;  1OI1 A;  5M9O A;  4C8Q D;  2P4T A;  5GAN g;  1YIJ A;  2DK3 A;  2RJE A;  3PGG A;  1U1T A;  1W4S A;  2ZXF A;  5EG2 A;  2QXF A;  2XTI A;  2LTO A;  4PG3 A;  4Z02 A;  1Q7Y U;  4P73 A;  3QO8 A;  2K3Y A;  2DEQ A;  5CK9 A;  4EMH A;  3FJP A;  2RHU A;  4C0D B;  1RI0 A;  3HXW A;  3EAE A;  1VQP A;  3REX A;  1FXX A;  4M7A A;  1NYQ A;  3E9F A;  4IUR A;  3E9I A;  3RKX A;  3ASK A;  3OYN A;  1G3T A;  1QVF A;  4L87 A;  1LOJ A;  3OSS C;  2MWP A;  2DQ3 A;  5LJ3 g;  2X4J A;  2QA4 T;  4HWO A;  2DTI A;  2QHS A;  5LJ5 g;  1WGS A;  1SER A;  4IUT A;  4P72 C;  2LVM A;  4A4K A;  4M7D D;  3PCO A;  4LDV A;  2XIC A;  5IN1 A;  2RK1 A;  4OB1 B;  2EAY A;  4XAX B;  2E12 A;  3S3O A;  4TVW A;  4RCB A;  1VQO A;  2X4X A;  3CCQ A;  2E64 A;  5DY9 A;  1KHI A;  2YLC A;  3CC4 A;  4EMK C;  3GLX A;  4YRP A;  4A53 A;  3IKL A;  1YI2 T;  2RI3 A;  3CCL T;  3UGQ A;  3UH0 A;  4F7U B;  4EX5 A;  4LVJ A;  3HTZ A;  2JTM A;  3ER0 A;  1I8F A;  3LWH A;  3HKS A;  2E6N A;  4X5O A;  2NS6 A;  3L2R A;  5FLX E;  4XTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...