4XTYA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 63 with fluorine in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
264
Chain Sequence
b'TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 94
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtyA01
4NCXA 2EJ9A 1WLEA 4CH5A 4YDQA 2E41A 3DSQA 1HC7A 2E10A 4J6YA 4X5OA 3SWNB 2E1HA 1G51A 5C53B 5GAOn 3UH0A 3P8TA 2ZTGA 4UPAA 3JCMV 4YRTA 1JJCA 4CH6A 1B7YA 1IL2A 3LSQA 4NL3A 4M77A 1C0AA 3BW1A 5GAMe 5GMKe 1QE0A 4YCWA 4M78C 3NELA 3BDUA 2QTXA 4C8QE 3FIFA 4WJ3M 4YRRA 1BBWA 2ZZEA 3RF1A 5GMKm 3MF1A 4X9DA 2Q5IA 4PJOF 5K1PA 2RHSA 4F7UF 3JCMf 2ZIMA 3QSUA 4M75C 5DY9A 1B76A 4P3OA 1PYSB 4H2SA 3HY1A 3QNEA 2YHTA 5GAN5 4YRFA 2QHTA 2I2LA 4WJ4A 4YCUA 4C92E 3E9IA 4K88A 1LYLA 4YRSA 1JBMA 4JUVA 1GGMA 4M7AA 3ERRA 4YRLA 5GMKl 2DTHA 2EJFA 3QHSA 5GANf 3BY7A 2QHSA 3JB9D 1WQWA 3PCOB 3VBBA 3BFMA 3JB9G 3M4QA 5LJ5j 4TVAB 3JCMJ 3V8JA 3A7UA 3IG2A 3SB2A 5GAMh 4P75A 3MEYA 4TVYA 5LJ5h 4PNOA 3JCMb 4N0AC 1EFWA 1SESA 1Y96B 1JJCB 2ZCEA 1HXDA 4YCVA 3SWNA 4PG3A 1LNXA 5I21A 3HXUA 1NJ5A 5E3IA 3VQWA 2DVEA 4EMHA 4M7DB 4XU0A 4YPFA 2QHVA 4HWRA 4YRJA 1U1SA 3CMQA 3L4GA 2Q7EA 3FJPA 3RKWA 3HFOA 5LJ3f 2EAYA 1SRYA 1X54A 1VQZA 4PJOE 4M77D 3HFNA 4OLFA 5GMKi 3REUA 2ZR2A 1WPYA 4M77G 3VQXA 4F7UE 2EJGA 1FYFA 1LJOA 3RESA 4C8QC 4J5YA 4V2SA 4M7DD 1WQ7A 3REXA 3JCMg 4XU3A 3HXWA 2ZINA 1EIYB 4YRQA 4J6WA 5GAMd 2CGHA 2DQ3A 5LJ5d 4E51A 2J3MA 4M7AB 4Q6GA 1PYSA 4RQFA 4YRKA 2RB6A 4CH4A 2VXFA 4OP0A 3NEMA 2I4LA 3IKLA 4YREA 2E65A 1J5WA 2ARUA 3OD1A 1N9RA 3IALA 4C92C 2ZIOA 5GANg 4RCCA 1HTTA 2CJBA 1E1TA 1EVKA 1NYQA 3PCOA 4M75A 3RUXA 4M7AD 4TVAA 3M4PA 4M7AG 4CS4A 4UP7A 1H4TA 1B8AA 3PZCA 4XQ3A 1Y96A 4X9CA 3L2ZA 4HVCA 2ODRC 1MGQA 4TQDA 3L4GB 2IY5B 5LJ5e 2XGTA 4XEOA 4YRMA 2ARTA 3LSSA 1BIBA 2EWNA 2E64A 4HA8A 4M7DA 4HT8A 1ATIA 2PMEA 1Z7NA 4P73A 2DZ9A 2Y90A 1WU7A 4N0AA 3E9HA 5LJ3g 3JB9F 2JN0A 4RDXA 4NOYA 4HWSA 3P8YA 1KMNA 1YFTA 1KOGA 5GAOq 1YCYA 3TUPA 3RERA 1H4SA 5C52B 5LJ3j 1USYC 4PJOC 4J15A 3HXXA 3TEHA 3A7RA 3JB9I 4M78B 3G1ZA 2RHQB 1EIYA 3HXVA 2EL9A 2VXEA 11ASA 2QHUA 4XTVA 1N9WA 2P0LA 4ZTUB 1KMMA 4L87A 1NNHA 4P71C 4M75B 2G4CA 1HK9A 4M78D 5F5WA 1JRIA 4M78G 4M77F 3ICAA 4P3PA 2Q7HA 1YGBA 3HFZB 2AMCB 4Q15A 3JB9H 4YRPA 4HT9A 2I4OA 5GAOr 3RKYA 2DTIA 4A53A 3KFUA 4M77C 5ELOA 2DU5A 3VQYA 4M75D 1H4QA 2YLBA 3QO5A 4P74A 3PGGA 4M75G 2FYKA 2J3LA 2CJ9A 2XTIA 4C92A 3V8LA 2IY5A 4UP9A 5LJ3d 2E5AA 3HY0A 1L0WA 2K57A 4YRGA 1X2HA 5GAN6 2ZZFA 2ALYB 4QVCA 4JLIA 3QO3A 3GIBA 3EFSA 5HGQA 1ADYA 1LOJA 3JCMW 4HWOA 2I4NA 3TEHB 2ZGWA 1B34A 5GAN2 4M7AF 4M7DG 4O2DA 4WF2A 3LC0A 4P72C 5ELNA 3V7SA 1H641 3IKMB 4H2UA 2P5IA 4EMKC 2C8MA 4PHCA 1ADJA 1NJ2A 4M78A 2YLCA 2DKGA 1EQRA 4EX5A 4HWPA 2RHQA 2ZR3A 2HNIA 3JCMh 3QTCA 4XEMA 3UGQA 1ASZA 3V8KA 4C8QB 2ZT7A 4H02A 4TTVA 3A74A 4P75C 5LJ3e 4CS3A 3JB9J 1KQ1A 4YYEA 4M77E 1H4VB 1E22A 1NJ6A 4DPGA 3SWNC 2PMFA 4KR3A 5GAMf 1X2GA 4PJOA 3HFVA 2AKWA 5LJ5f 5GAOl 2DDZA 5GANj 2ZT5A 4WI1A 3VQVA 2I4MA 4ZTZB 4YRCA 3HFZA 3QO8A 2AMCA 3MF2A 5GANh 1I5LA 4C8QD 4KQEA 4LNSA 2E3CA 1EOVA 2ZT6A 3HRIA 4C8QG 3HXYA 3NETA 4H2WA 4TVWA 4RQEA 4C92B 1WNLA 3R07A 3HRKA 4K86A 1X55A 2ZT8A 4P3NA 1G5HA 4P71A 4G84A 4H2TA 2ARSA 1KQ2A 4XTYA 2DEQA 3HXZA 4YP0A 4JRKA 4EO4A 1D3BB 3RKXA 3RIRA 2DTOA 3M4GA 1B70B 1BBUA 3NENA 4BW9A 2DXTA 3UFGA 4TWAA 1B34B 3JCMd 1YFSA 4M78F 2DQ0A 4C92D 3A5ZA 1W66A 2ZZGA 3JCMX 4MMLA 4M7AE 2ALYA 4C92G 2Q7GA 4H2VA 3EFRA 1I4K1 1WYDA 3A32A 1N9SA 5LJ3h 4HWTA 1X01A 4YROA 4KR2A 4JRIA 4M75F 1ASYA 2DXUA 1X56A 5GANd 2CJAA 4YRNA 2DU7A 1I81A 2ODRD 3A7AA 4RMFA 12ASA 4C8QA 3FB9A 2FB7A 4PJOB 2AKWB 3AHUA 1M5Q1 4F7UB 4EMGA 3I7FA 4P72A 1M8VA 4YRIA 5GAN7 4H2XA 1YB3A 3VU3C 3JCMe 1E24A 3RACA 3W3SA 4MMKA 5GAMg 3HSBA 4EMKA 4M7DF 5LJ5g 4CS2A 3RL6A 1SERA 3P8VA 4TQFA 2DJZA 5GAN8 3QO7A 2ZNIA 4AH6A 4M7DC 5GAMj 5GMKj 4PJOD 2ZXFA 4P73C 3UGTA 2VC8A 4PJOG 1TH7A 5GMKh 4K87A 4F7UG 3JCMQ 4RCBA 2CIMA 4XU1A 5GANe 5KNNA 1B7YB 1SETA 2RM4A 5GAN3 5GAN4 2RA2A 1G5IA 1D3BA 4M77B 4M78E 4XTUA 1EVLA 1NJ8A 4BWAA 2C7IA 4XTZA 1NJ1A 1I8FA 4DQ2A 1B70A 1RIQA 1YFRA 4H2YA 3JCMc 1U1TA 4J6XA 3WQZA 1Z7MA 4XTXA 3QUIA 5GAOm 2DZCA 4M7AC 3L1AA 4QVDA 4C8QF 4CH3A 4M75E 3INZA 2RHSB 3HTZA 5K1XA 4ZIBA 3V7RA 3A5YA 2Q5HA 4G85A 4XU2A 4A54A 5CAIA 4NL2A 1QF6A 3RGLA 3BJUA 2ZNJA 2RD1A 4Y91A 4H2XB 3A31A 5GAOp 1USYA 1BIAA 4EMKB 1E1OA 4UP8A 4C92F 4M7DE 4F7UA 5C51B 1NYRA 4P74C 4XTWA 3JCMP 3TEGA 3V7CA
chains in the Genus database with same CATH superfamily
1QVFS 3LGFA 1H3HA 3IQLA 4CH5A 3EGXB 1FX7A 1VOMA 4OMMA 2F1LA 3OYGA 4X5OA 1ZSZB 2E1HA 1K0XA 2NS6A 5FU7C 4R0KA 2LRQA 5IN1A 5GAOn 4ZNXA 3H0HA 1JJCA 4CH6A 1IL2A 4NL3A 4M77A 3OBWA 1C0MA 2K2VA 2CP2A 1OPLA 1QE0A 1PC0A 2A8EA 1LCKA 3VKIA 2PZ1A 2CP0A 4E7ZA 2ENMA 3M0RA 1AEYA 3OYEA 3CQTA 2A0FB 3NGPA 2ZZEA 1NLOC 4JJDA 3RF1A 4PJOF 1ZUKA 2DYIA 2ZIMA 4JJNK 3GLXA 2KI7A 4OB0B 2RJCA 1VYUA 1H3ZA 3QNEA 5A0GA 2XU8A 5KYXB 5GAN5 2I2LA 2NUPA 3E9IA 3PVLA 3CD6Q 4GLKA 3QDFA 2DTHA 1X27A 3PNWC 5GANf 1QP3A 1VQ8T 2QHSA 1WQWA 3VBBA 4L59A 1WHGA 1IHWA 2CSIA 3M4QA 3CCSA 3V8JA 3IG2A 2AK5A 1TWBA 2F5KA 2I0NA 3SB2A 2E5QA 2YRCA 3EGXA 4PNOA 2JMCA 1Y96B 2DAQA 3Q1JA 3OYHA 4PG3A 4YCVA 4B6MA 5I21A 1IB8A 1TOVA 3VQWA 4IURA 1MHNA 3S6WA 1ZUYA 4XU0A 2P4RA 1M3CA 3CMQA 1KJWA 4LUEA 3TCJA 1X54A 3H8ZA 1QCOA 4LVLA 1CKAA 5GMKi 1MMNA 2ZR2A 2QGGA 1LJOA 3RESA 4C8QC 3G71Q 4L6V5 5M9OA 3REXA 3JCMg 1GCPA 3CCQT 2OI3A 3MPUB 1W70A 3HPWA 1GCQC 2CGHA 1AHJB 1QKWA 2J3MA 4M7AB 4Q6GA 3CC7T 1KQSA 2PQWA 4RTUA 4YRKA 1A0NB 1X2QA 5KYXA 3GBQA 3NEMA 2I4LA 3H0FA 1OOTA 1N9RA 4C0GA 2ZIOA 8AT1B 3GP8A 1VQ4A 2VASA 1PKSA 4M75A 2O9VA 3OS5A 2ECZA 2PVGB 1TUDA 2HKQB 3CCRA 4QT7A 4CS4A 3ZEHA 3PZCA 1RAIB 1Y96A 1KQSS 2CP5A 4X9CA 3DKMA 2DBKA 3A8OB 3MKDA 4B9XA 3L4GB 2XGTA 4Y28E 4YRMA 2IY5B 2ARTA 3NHNA 2JJ9A 1BI1A 3LSSA 4RTVA 2X51A 2KR3A 1ZHIA 2LCSA 4HA8A 4HT8A 1YJWT 2WSFE 4A4FA 1T0HA 2DZ9A 2LVMA 1RLQC 1WU7A 2VB6A 5KYUB 3JB9F 4OB3B 3G4SA 3CCMA 2QEXA 2EQMA 3NPFA 3OYNA 5GAOq 2H3JA 1YI2T 1YCYA 1S1NA 4N4IA 1VQPA 1H4SA 2YUOA 3CCJA 1VQ8Q 3TEHA 4J15A 3HXXA 4C5GA 1UEBA 4M78B 2LMJA 3G1ZA 2A3LA 3CC4T 5KH6A 2EQUA 1E6GA 2D6FA 1OI1A 2P0LA 1VQMT 2DE0X 1KMMA 4P71C 1UGVA 4PJJA 2JOYA 4M77F 3ICAA 1PSEA 4Q15A 2JNGA 4FW1A 2DTIA 4A53A 3KFUA 1XQHA 2M1HA 3CMET 2CREA 4PJNA 2R5AA 1H4QA 2PUOB 3PGGA 2J3LA 2CJ9A 3I55A 2IY5A 2NUTB 3CCQQ 1UHFA 2DETA 1MV3A 1L0WA 2K57A 5FWCA 4YRGA 3A5ZB 3CCET 1X2HA 4Y92A 2HZYA 3QO3A 1J3TA 2K5IA 2DM1A 5KYUA 1LOJA 3FRNA 4BACA 2HBPA 1AD5A 1NYGA 1B34A 2EQKA 3HRUA 3VRZA 5GAN2 1VA7A 1B7TA 3V7SA 1H641 2XI9A 3OMCA 4RTXA 2JVVA 4HCBA 2RHYA 3TEEA 4EMKC 4PHCA 5C0MA 4M78A 1IGUA 1EQRA 1YJNQ 4HWPA 4X34A 1NEGA 3CMAT 2JS0A 2RK2A 2MOXA 2HNIA 3EAEA 1YITT 4GY5A 1M4ZA 3V8KA 2QQ9A 1WYXA 3SHWA 1H92A 3A74A 1QWEA 3CPWP 1WGSA 3BE3A 3JB9J 1OV3A 1WDXA 1KQ1A 2XMFA 4YYEA 1I07A 2DD5A 1H4VB 3SWNC 2PMFA 3E2UA 5GAMf 2JM9A 5LJ5f 2DXBA 3UT1A 3RMSA 1YJWQ 2I4MA 2RQUA 3EGUA 3GNFB 4ZTZB 3CBOA 2ZAEA 2QQBA 4JPBW 5GANh 1I5LA 1NPRA 2K79A 4C8QD 4LNSA 2E3CA 3HRIA 4H2WA 3FC3A 2CP7A 3DB4A 3H9NA 1WNLA 4C92B 4RQEA 3HRKA 2COZA 3CXCA 1K8AC 2ABLA 4K86A 1X6GA 3JAME 1X2KA 2KE9A 1YI2Q 2LQWA 1M90U 1G5HA 3L2WA 5A2QE 4FYWB 3HXZA 3TSZA 4JRKA 1U8RA 1D3BB 3RKXA 5CO7A 2NUTA 1PNJA 1D1CA 2QXFA 4BW9A 3CC4Q 1K8AR 4N4HA 4TWAA 2ZPBB 1YFSA 1UE9A 3A5ZA 4LNPA 4M7AE 2K5LA 3E9FA 3JSCA 5EC7A 3QJ6A 1VQMQ 4H2VA 3PVQA 2EW3A 3CXCS 2GQVA 5IAYA 3TREA 2COYA 4J9GA 4BD3A 4DBQA 4M75F 3CD6A 1AZGB 2RHUA 5GANd 2GFAA 1YIJT 2L8DA 4OGCA 2GFUA 4YRNA 3QZ5B 3LW5E 2BTTA 3A7AA 4RMFA 3CMEQ 1IHVA 3WVDB 1EX4A 2GNCA 2DL3A 1R77A 4PJOB 2V1QA 2XG8D 2C0TA 2J6FA 1AOJA 2CSQA 3I7FA 1AWXA 1NLPC 3SD4A 1Q82R 1CKBA 2BIVA 3VU3C 3JCMe 1D1AA 3O8VA 4MMKA 2FZKB 4C5HA 3HSBA 1IXDA 2E12A 4QQDA 3MJXA 3CCEQ 1UHCA 1N27A 4FYYB 3CCLT 4YTLA 3QO7A 1Z9ZA 2E6ZA 2ZXFA 3UGTA 1ARKA 2E3HA 1UG1A 3C4SA 1WIEA 1DJ7B 1TUCA 2BZYA 4OB1B 3MEVA 3LYIA 2M02A 1SETA 1D3BA 4JZ4A 4OMFB 1X75C 4M78E 4XTUA 1EVLA 3G71A 2RPNA 3CMAQ 1K73C 2DEUA 4H2YA 3RNJA 2RJFA 3JCMc 4J6XA 1YITQ 3I5RA 2A28A 3WQZA 1Q81U 3OYMA 2DMOA 1NE8A 3M57A 1JJ2P 2D1XA 2PVDB 1VQ7T 3OS2A 2L3RA 2K7AA 4FT4A 3INZA 2RN8A 2RHSB 3OYFA 3A5YA 2P84A 4XU2A 1FWZA 3MP8A 4LUDA 3RGLA 2RD1A 2HCKA 3EGDB 4H2XB 5GAOp 1XNIA 9ATCB 1MNEA 5IHKA 2HQXA 2DL7A 2D8HA 3WXMB 4AFQC 4UP8A 2G6FX 2WSEE 5C51B 1X6BA 4A4GA 2IPOB 1NYRA 2Y4XA 1QP2A 4P74C 4XTWA 1SG5A 3R6OA 2R5MA 3BDLA 1SRLA 4F17A 3QDRB 3QWYA 3EG9A 4YDQA 3H41A 2E10A 4J6YA 3G1JA 2M0OA 3CC2T 2QQAA 3OS0A 4Q5WA 2BE9B 4BUGA 2CP6A 3D7SB 3LSQA 1YIJQ 3BW1A 5GAMe 5GMKe 1C6VX 1F1BB 1VQ8A 2DIQA 2MK5A 3NELA 4BI4A 1T0JA 4BDYA 2PUKB 4BY6C 1KD1U 3NTKA 4ESRA 5CIUA 3MF1A 2AZSA 5K1PA 2Q5IA 1U06A 1N8RU 2RHSA 4MZTA 4F7UF 2EYYA 3QG1A 1MNDA 3A8MB 5DY9A 3CCLQ 3SFMA 1G3WA 1AZEA 1B76A 4J7FA 5J39A 4BE0A 5I2SA 1K9MC 4YRFA 2QHTA 5C6SA 3EGDA 3NMZC 4C92E 4AFSC 4YRSA 4KGXB 1JBMA 1QLYA 3VS6A 3X25B 3ERRA 4YRLA 5GMKl 3T9NA 3U23A 4FSXA 3PCOB 4E7LA 1K9MR 4AT1B 5IHNA 2MPXC 2EYXA 3JCMJ 4LDUA 4QW2A 2JW4A 2NYSA 3UA6A 5GAMh 3CCQA 4P75A 4TVYA 3NTHA 2EYWA 3ULRB 5LJ5h 3JCMb 1EFWA 2QTVA 1SESA 2FEIA 1JJCB 1VQ7Q 3X24B 3HXUA 1NJ5A 3CBPA 5HCKA 3I9QA 1FMVA 3MP1A 4BDZA 4RG8A 3L2VA 1RAAB 3CBMA 4QKUA 4FL6A 2DVEA 4M7DB 2J6KA 1RI0A 2KSSA 4HWRA 1U1SA 3HFOA 4FT2A 1JB0E 3M4YA 2XDBA 2AZVA 3AT1B 1SRYA 1R8OB 2XK0A 2MCNA 1YJNA 5GJWB 3HFNA 4PJOE 3REUA 1HYOA 4N4GA 1WPYA 2EJGA 1FYFA 2HL5C 1C1AA 2H8HA 2LJ0A 4V2SA 2A36A 3EH2A 1WQ7A 1CSKA 1YCSB 4XU3A 1RI9A 2NUPB 2ZINA 1MMGA 2RMOA 3OYDA 5GAMd 5LJ5d 1I0CA 1YJ9Q 4ZTJA 2EVRA 4RQFA 1YJWA 2ROTA 4CH4A 2K2MA 2QASA 3CC2Q 1KK7A 2ARUA 3IALA 1LVKA 4JLGA 3J7AF 5GANg 1HTTA 1YI2A 2RI5A 2DVJA 1E1TA 1NYQA 3PCOA 2LX9A 1VQKQ 3RUXA 5CKDA 2ZPHB 3SDZA 1OQKA 4M7AG 2GF7A 5CKHA 1H4TA 1K76A 4UP7A 3UDCA 2RO0A 2KBTA 3CC4A 1PWTA 3L2ZA 1NJIU 2FG0A 1MGQA 2O01E 1KSWA 2LQNA 3ZL7C 1BI2A 2BZ8A 4LD9K 2EWNA 4M7DA 1ATIA 2PMEA 3VUBA 4JS4A 1Z7NA 4P73A 4OB2B 4HVWA 1GL5A 4DEYA 1OU8A 2JN0A 1JJ2A 4RTWA 1PD0A 2AKLA 2EGEA 4JRQA 3CMEA 3RERA 2QK0A 4WCIA 2DO3A 4F04B 5IHIA 3VS3A 2LQKA 4IKFA 2FZGB 2RNAA 5FU6C 2VXEA 2FVUA 2YRDA 4OMQA 1VQ9T 2QHUA 1VIFA 3CCEA 1N9WA 4FU6A 4A4HA 2OX7A 2RK1A 1NNHA 4M75B 1JJ2S 4C0DB 4A4KA 5L23A 2ROLA 4M78G 2Q7HA 3RDVA 5CK9A 2AMCB 1GCQA 4LVJA 1U5SA 2KDSA 3M0TA 4BI3A 4R55A 4M77C 2MWOA 4DEXA 3CMAA 2X4WA 2QAZA 3EG1A 1M90R 2YLBA 1PCXA 1KC8C 1YITA 2VUBA 4RTYA 4J9IA 2XTIA 2A37A 4AG2C 4UP9A 5LJ3d 4ATOA 4GBQA 3HY0A 2CUBA 3OSVA 4J9CA 1KC8R 2ALYB 2JTEA 3EFSA 2AT1B 2KRNA 1ADYA 5HGQA 4KT0E 3TEHB 3OY9A 4LVIA 1W4SA 4P72C 5ELNA 4H2UA 1VQOT 1WHLA 2P5IA 1KFZA 3TQ7P 4CC2A 4MDWA 1RL2A 2ZCFB 3C0CA 4E7IA 2IG0A 5FW9A 1FYNA 4XEMA 3QTCA 2KGTA 1ASZA 4H02A 5KCHA 2LP5A 4FCYA 2ZT7A 1SSFA 1M1KC 4TTVA 1UUEA 2MF2A 1ABOA 2RQTA 4E6RA 1Q7YU 3E1SA 5AT1B 2EGAA 3P8DA 3QJYA 4M77E 5L8RE 1E22A 1NJ6A 2YUQA 1ZSZC 1OULA 1X2GA 2DDZA 4WI1A 4OMNA 3VQVA 2DFUA 2PU9B 2CKKA 2X4XA 1M1KR 5IXFA 4YRCA 3QO8A 2AMCA 2D0NA 1Z9QA 2ESWA 4JRPA 3X20B 1YIJA 2W0ZA 1QVGP 2Z0WA 2YRVA 1D0ZA 1MUZA 5KYWA 4P3NA 1UB4A 4P71A 4H2TA 1KQ2A 2GTJA 2DEQA 4EO4A 1UGRB 2OAUA 4EDUA 2X9HA 3CCUT 4FYXB 3M4GA 2C06A 2KEAA 3UFGA 1B34B 1Q86U 3P8HA 2DQ0A 3RL6A 1VQ9Q 1W66A 2ALYA 4C92G 3UPUA 2W10A 3CCLA 1WYDA 3EHQA 1N9SA 2DLPA 3UF4A 5FROA 1TU0B 2KQWA 3VV0A 1SSHA 3PIOA 1W2BP 4FIBA 1ASYA 1SF9A 1RAHB 2KAFA 1GFCA 1HD3A 2EYQA 1M27C 1X56A 1G3TA 2DA9A 4LD6A 2RF0A 2COWA 2DU7A 1I81A 2K3BA 1TSFA 12ASA 4IIOA 2FB7A 1VQ5A 2EIFA 3EG0A 3WVEB 3PMIA 3OBYA 1JXMA 4F7UB 3ZBDA 4EMGA 2RI3A 3CPFA 1E24A 2F5TX 5GAMg 1T3LA 4EMKA 5LJ5g 4M7DF 1BI0A 3M54A 2JMAA 2DJZA 4LDWA 1G83A 2B8AA 2RJEA 5LL6S 3C12A 5GAMj 2QA4T 5GMKj 1WHJA 1NEBA 2YWWA 4PJOG 1QWFA 3VRYA 4RCBA 2DL4A 2KMTA 5GANe 1VQOQ 1K4US 3G6ET 1B7YB 5GAN4 2DERA 1G5IA 3CC7Q 1N8RC 2JTMA 4KH1B 2CT4A 4XTZA 1RIQA 4DQ2A 2OTLT 3HHTB 2RHIA 5I11A 2X3WD 2VGMA 1SHFA 1XTDA 5KE3A 2LT4A 1Y71A 4IUTA 3QUIA 4HT4A 1YJ9A 5GAOm 4E2FB 4M7AC 3L1AA 4C8QF 1N8RR 2HSEB 4M75E 1JXOA 4QQ6A 3PTAA 3CCVT 3CC2A 3VYHB 3VYGA 2BKDN 4G85A 4QQGA 5ECAA 5CAIA 2SRCA 3VS1A 2X4YA 3M55A 4IUUA 2ZNJA 4ME7A 1VQKA 4ANJA 3LGLA 1BYMA 1USYA 1BIAA 3LH0A 4ZTFA 4F7UA 2CS7A 2LCCA 2CH4A 2D0QB 2KXDA 1SPKA 5I2MA 3CCUQ 1GBRA 1YBYA 2KYMA 2XHCA 3TEGA 2VGNA 4BE2A 4ZGEB 2EJ9A 2EYZA 1WLEA 2M16A 1EZZB 5A0LA 2LCLA 3C95A 2QI2A 3OB9A 2KROA 1HC7A 2ZZDA 1M2OA 2MMPA 1G51A 2JTFA 2V8IA 3FDRA 3P8TA 2Y4YA 2ZTGA 4YRTA 1B7YA 4DBRA 2E70A 2MYSA 1OEBA 3UA7A 3RBBB 5IH2A 1C0AA 4DBFA 1G3SA 3TU4K 1BI3A 4O5VA 4D8DA 5HK3A 4M78C 2QTXA 4PL6A 3EH1A 3OW2P 3QBYA 4E47A 4OF1A 2YUNA 5IT9E 1BBWA 2C0OA 3OYYA 1Q82C 4HXJA 1WX6A 3QSUA 1I5OB 4PJLA 2CZ6B 1QVFP 4B9WA 4H2SA 3HY1A 2QA4Q 1WFWA 2FPFA 3CCRT 3VUZA 1X69A 5HKCA 2QDYB 1GGMA 2HSPA 2IIMA 2QGFB 3G6EQ 1NJIC 2EJFA 2QQRA 3EG9B 1D09B 2ZPEB 4RTTA 4DOWA 4F14A 2JS2A 2F2VA 3JB9G 2OTLQ 4PKCC 4TVAB 2KRSA 3MEYA 4KRTA 4N0AC 2MI6A 4KH0B 1NJIR 1UDLA 3G4ST 1QVGA 2L89A 1HXDA 1UGPB 4AG1C 1Y7XA 1LNXA 2O88A 3NFCA 4LN2A 2EGCA 4AMCA 3CCVQ 1VYVA 3A1PA 5E3IA 3S3MA 2J7IA 4J83A 4EMHA 4UC4A 4D6WA 2DBMA 3A98A 2FHDA 2Q7EA 3FJPA 1W1FA 3RKWA 5LJ3f 2EAYA 4CRIA 5DLOA 7AT1B 1IZ6A 4OLFA 2JZ2A 4PFOA 4M77G 1JEGA 3VQXA 1QVGS 4F7UE 4J5YA 1YNZA 3E9GA 1MMAA 2K6DA 1YFNA 3H0IA 1AVZC 1NYFA 1EIYB 4J6WA 2DQ3A 4E51A 1SHGA 2LNHB 2VXFA 4OP0A 2DXCA 3REAB 3IKLA 2J6OA 4YREA 2XDPA 4BI8B 3OD1A 4C92C 3TVTA 1E7OA 3I55T 1V76A 2VYTA 4IUQA 1EVKA 1HSQA 2F2WA 4Z89A 4M7AD 4TVAA 3M4PA 1M8MA 1AWOA 2BZXA 1X43A 1B8AA 1VYTA 1RADB 3OQ5A 1VQ9A 4HVCA 2LQ8A 1VIEA 2KY9A 5KYYB 2ODRC 4TQDA 4PFPA 1G3YA 5LJ5e 4XEOA 1B3QA 1IRXA 3M58A 1OZ3A 2ZPFB 1BIBA 1PRMC 2E64A 2HAXA 2JUFA 1WI7A 4PK4A 2O4XB 1QCFA 5FU7B 3CCRQ 2CZ1B 2WSCE 1RABB 2CP3A 4HWSA 3P8YA 1KMNA 1WHHA 1YFTA 3M59A 1WHMA 3TUPA 3HL8A 3PIPA 1I1JA 4PJOC 3A7RA 1WJRA 2HQEA 5D6WA 2CDTA 1ZLMA 2RHQB 1SKUB 2DL5A 1EIYA 3HXVA 2V1RA 3CPWA 4GLMA 11ASA 3OYIA 2QDLA 4R56A 4XTVA 1RUWA 3QWXX 1WZOA 3X28B 4EIKA 4JDSA 4ZTUB 1KQSP 4VUBA 2G4CA 3X26B 2GQIA 1VQNT 4M78D 2LT1A 1NZ9A 1O75A 1JRIA 5F5WA 4KBMB 4P3PA 1YGBA 1YWOA 3MP6A 2LC4A 1VQOA 2ED0A 4J9HA 3OA6A 2DD4A 4HT9A 2L5QA 4NS5A 1SRMA 2I4OA 5GAOr 3M0UA 3CC7A 3I35A 3RKYA 3L2QA 5ELOA 2P0QA 3CPWS 5EG2A 2F69A 3VS4A 4M75G 1VQ6T 5KYYA 4D8KA 4OMOA 4RKUE 2HMAA 2E5AA 1GXIE 2JM8A 2YT6A 3LH5A 5CQXA 3GOXA 2V8JA 4CC7A 5GAN6 2ZZFA 2O4XA 3I56T 1ABQA 4Z8AA 4HWOA 2QYZA 2X35A 2ATCB 1BCMA 2I4NA 2KT8A 1T3SA 1K8AU 4WF2A 3SEMA 1G5VA 4A63B 2G3RA 2K5FA 3KXTA 1R0CB 4LXCA 1LPLA 2C8MA 4PLIA 3VS2A 3E19A 2RHQA 3LWIA 3CCUA 4FW2A 2RQWA 2ZR3A 3UGQA 2WACA 2AHJB 4C8QB 2DNUA 2LZ6B 4P75C 2DRMA 5LJ3e 4M4ZA 1M1GA 4CS3A 2E5KA 1WXTA 3REBB 4ZN1A 1RAEB 4J9DA 1K0SA 4DPGA 3HFVA 2AKWA 5GAOl 4PLLA 5GANj 2OTJT 2ZT5A 2DILA 2P0PA 3MF2A 1PKTA 1RAFB 1EOVA 2D8JA 1UJ0A 2ZT6A 3NETA 3HXYA 4TVWA 2YDLA 1M2VB 1VQMA 1EIFA 1X55A 2KK4A 2XICA 2IVWA 3VS0A 4E7KA 4G84A 4J9BA 3P8BB 4LVKA 5DLQE 3L2RA 1B70B 3NENA 1PM3A 2J05A 4OMLA 1K9AA 2L2PA 3VS5A 2ZZGA 4EX5A 4C92D 1WA7A 2YXYA 4MMLA 2EFIA 1VQLT 4KUDK 3LLRA 3A32A 2QA4A 3A8HB 5LJ3h 1M9SA 3EFOA 2YSQA 1IO6A 4HWTA 1VQNQ 2RH2A 4KR2A 2E3IA 2FL7A 4TVRA 2DXUA 3G6EA 4MZMA 1FXXA 5HK0A 1K73U 2ODRD 5DM7R 2VV5A 2OTLA 1NBEB 3L42A 4C8QA 3FB9A 1M90C 3QKJA 1QW1A 1VQ6Q 1ZBJA 2GGRA 4P72A 3QPHA 1OPKA 2DJQA 4FSSA 1QKXA 3ME9A 3MEWA 4JS5A 2JT4A 3MHXA 2ZPIB 3M0SA 4BE1A 4O6JA 3CCVA 3P8VA 4TQFA 4ORZA 2BE7D 1YN8A 3I56Q 5GAN8 5KYWB 1M3BA 2XD0A 4M7DC 4AH6A 1ZA1B 1V29B 3A8GB 2HL3A 4PJOD 3KBGA 3LWHA 4P73C 2VC8A 3M56A 4HVVA 3OMGA 1M2VA 1TH7A 1Y0MA 4K87A 5CKEA 1GBQA 4F7UG 4Z88A 2CIMA 5KNNA 3CXCP 3ZFJA 1ZSZA 1UECA 4HCZA 1D1BA 3QZ9B 1S72T 1QQJA 1Y07A 1NJ1A 1B70A 1YFRA 3HTRA 1N6AA 2E6NA 2DX1A 3J80E 1ZBXA 1TTHB 4CC4B 4XTXA 3OYBA 3MQZA 2DZCA 2J06A 4CH3A 1UJYA 2HQHA 5J26A 4ZIBA 4LDYA 3V7RA 1AWJA 1OX8A 3R6NA 2OTJQ 2A08A 5CKBA 4BB7A 4JZ3A 1YWPA 1V1CA 3QYHB 4NL2A 1YHQT 4OGEA 3GNGA 2CYZB 1PHTA 4EMKB 1E1OA 1E6HA 4M7DE 2K3XA 4F16A 3UWNA 2VVKA 1NPPA 3V7CA 4NCXA 3DLMA 2HDAA 2E41A 2KXCA 3DSQA 1Q81C 1VQLQ 1K9MU 3SWNB 1YJNT 5C53B 4ZGDB 1K1ZA 2F2XA 1JO8A 3UH0A 4UPAA 3JCMV 3OYJA 1Q81R 4OVAA 4MDXA 4LE9A 1RAGB 4YCWA 5CVIA 3BDUA 2B86A 4C8QE 3FIFA 4OMPA 4WJ3M 4YRRA 2GTOA 2FRYA 5GMKm 4X9DA 2HD0A 2LJ3A 4HVUA 3JCMf 4WTOB 4M75C 4C0DC 2K3YA 4C5IA 1U3OA 4P3OA 4KUIA 1PYSB 3M5AA 2P4TA 2RQVA 2YHTA 4WJ4A 1N5ZA 4PFZA 4E7SA 4FM4B 4YCUA 4K88A 2FO0A 1LYLA 5HY6A 3F70A 4JUVA 1VQ7A 2LNVA 4M7AA 3ASKA 2PVOB 1QCNA 3QHSA 3BY7A 3HP9A 3JB9D 3N5BB 1S72Q 3BFMA 3LX7A 5LJ5j 2NLUA 3A7UA 5D7UA 2LTOA 3ER0A 1B07A 4ZGJB 2ZCEA 1KD1C 2X4JA 3SWNA 3JV3A 4RUGA 4RMOA 3S3NA 4J9EA 2RJDA 2VKNA 4X1VA 4YPFA 2QHVA 3OYCA 3HRSA 4YRJA 1KD1R 3L4GA 2A7YA 2XKOC 3VS7A 1YHQQ 1ZSGA 3RR6A 3A8LB 5D6XA 2V8KA 2AKKA 1VQZA 4M77D 4JJCA 3L2UA 4J9FA 3DLLA 1NG2A 1IREB 4M7DD 2GCXA 2M0YA 1M30A 3QYGB 3CCST 3G7ZA 3HXWA 1WHKA 4YRQA 1HJDA 4IUPA 3GPLA 1PYSA 3MEUA 2RB6A 2NWMA 1ZQ1A 1FMWA 3URGA 2DF6A 2E65A 1J5WA 3PFSA 3META 4RCCA 2CJBA 1BB9A 3JRZA 2HBWA 1WJSA 4XQ3A 2O2OA 2RHXA 2QQSA 2L3QA 1BK2A 2PTKA 1BKBA 1VQNA 2FPDA 1MV0B 2EBPA 1O9SA 1OX9A 2JXBA 4LVMA 2Y90A 2DIGA 4N0AA 3E9HA 5LJ3g 4Z02A 4RDXA 2KT1A 1WXUA 3QXEB 4NOYA 4RTZA 5I22A 3H6ZA 5FRMA 3CEYA 3PT9A 1KIKA 1KOGA 4KGZB 1G2BA 2AIRB 1VQ4T 1KC8U 2CZ7B 2FRWA 2O9SA 1EFNA 5C52B 5LJ3j 1USYC 2L3PA 3M53A 2QG9B 3JB9I 3OS1A 1VQ6A 2E4HA 1KHCA 4KGVB 2EL9A 4BY6B 2EKHA 3OYLA 3KFVA 2H3EB 2MIOA 3GF5A 1BU1A 1OU9A 2K9GA 4IUVA 3I56A 3THKA 1Y57A 4L87A 4CC3A 1G8XA 1MMDA 5CKFA 5IXBA 2KYBA 5CQYA 4J7IA 1HK9A 4XAXB 4C5EA 1UGQB 4A4EA 4EPCA 2K4YA 6AT1B 2SEMA 3M9QA 1TUGB 3HFZB 8ATCB 3JB9H 4YRPA 3CCMT 3FLGA 1H8KA 1UGSB 3TSWA 2QEXT 2XIDA 4XK8E 2DU5A 1PSFA 2RHZA 3VQYA 1VQPT 1JQQA 3KUFA 4ZN3A 4M75D 3CCJT 1M1KU 3QO5A 4P74A 2FYKA 4RG2A 1PG5B 4C92A 2L0AA 3C94A 3V8LA 3CCSQ 1AT1B 1QVPA 1UFFA 2RQRA 4QVCA 2OTJA 4JLIA 4DBHA 3GIBA 1PD1A 3JCMW 2YUPA 5A0DA 1W2BA 3MEAA 2ZGWA 4M7AF 2MWPA 1VQ5T 2EPDA 2XDDA 4M7DG 3S3OA 1VUBA 4O2DA 3LC0A 1RLPC 2KRMA 3IKMB 1TS9A 4AFUC 2HKNA 2EQJA 2KVQG 2DRKA 1P92A 2CZ0B 3OYKA 1ADJA 3O5ZA 1NJ2A 2YLCA 2DKGA 1K73R 1AWWA 2OJ2A 1UTIA 3JCMh 4DOVA 4P5NA 1SEMA 2D9TA 1RACB 1W2BS 1VQLA 1KG1A 5CR2A 4KR3A 2X3XD 4PJOA 3FEOA 1YP5A 2C0IA 3HFZA 3UATA 4KQEA 4C8QG 1M3AA 3R07A 2CT3A 5KE2A 2ZT8A 2M51A 3DB3A 1YJ9T 1VQ4Q 2P0KA 2O31A 4ELZC 2ARSA 2V26A 4XTYA 1ZUUA 4LDVA 1ZX6A 4YP0A 3RIRA 1Q95G 2DTOA 3MCAB 2M9UA 3J81E 1BBUA 1GRIA 4E7HA 2DXTA 4HCKA 3JCMd 4M78F 4CI0C 3JCMX 3FJ5A 5FLXE 2FZCB 1VQKT 2Q7GA 1Q7YC 3EFRA 1I4K1 2CH4W 3M0PA 4FYVB 3PMTA 1X01A 5AYFA 4YROA 1WLPB 4JRIA 3QIIA 2EQIA 3NTIA 3G4SQ 3CCMQ 1Q7YR 2DPPB 1BBZA 2QEXQ 2KNBB 2R58A 1GFDA 2CJAA 2GBQA 1S72A 1KHIA 1PRLC 3RMQA 2FPEA 1OYXA 2DK3A 2OAWA 1VQPQ 4E7JA 3CCJQ 2CUDA 2AKWB 3AHUA 3PE0A 4L5GA 1M5Q1 1WXBA 2MAMA 4HKEA 1JU5C 1M8VA 4YRIA 5GAN7 4H2XA 1YB3A 1FMKA 3RACA 3W3SA 1IGQA 5FU6B 4DA4A 4CS2A 1SERA 2PNIA 1QMCA 4IIMA 1Q86C 4J8OA 1W6XA 1R0BG 1WJQA 2ZNIA 1XJWB 2L3SA 2BUDA 5FWBA 1TXQA 2EKOA 3EG2A 4JJBA 3I5SA 1VQ5Q 1OZ2A 5GMKh 1YHQA 1TG0A 3JCMQ 3EHRA 3CD6T 1Q86R 1D0XA 2DL8A 4XU1A 1XOVA 2NUZA 3MO8A 4C0FA 2RM4A 5GAN3 2RA2A 4AFZC 4HCCA 4M77B 1NJ8A 4BWAA 5FRNA 5D6YA 4K11A 2C7IA 3OW2A 1M1FA 1I8FA 3EG3A 4QVZA 4C0ZA 1U1TA 3EFOB 1BCOA 1Z7MA 3I55Q 4II1A 2DYBA 2R57A 3OYAA 4PJMA 1D0YA 2ED1A 4LDXA 2ZPGB 3M0QA 4QVDA 2VWFA 5CCAA 4MZPA 2HEQA 3HTZA 5K1XA 5GJVB 2LDMA 1ACMB 3HKSA 1QVFA 2Q5HA 5J3BA 2LX7A 4A54A 4KULA 3VJPA 1X6OA 3OSSC 1QF6A 2LJ1A 3OW2S 3BJUA 4Y91A 3A31A 1ZA2B 4C92F 5KYNA 2RI2A 3G71T 5KCOA 4ELYC 1Q82U 1NM7A 3JCMP 3HRTA
chains in the Genus database with same CATH topology
1QVFS 3LGFA 4CH5A 1FX7A 3OYGA 4X5OA 2E1HA 2NS6A 5FU7C 2LRQA 5IN1A 5GAOn 1JJCA 4CH6A 1IL2A 4NL3A 4M77A 3OBWA 2K2VA 1QE0A 2A8EA 3VKIA 3OYEA 2ZZEA 3RF1A 4PJOF 2ZIMA 4JJNK 3GLXA 4OB0B 2RJCA 1H3ZA 3QNEA 5A0GA 2XU8A 5GAN5 2I2LA 3E9IA 4GLKA 2DTHA 3PNWC 5GANf 1QP3A 1VQ8T 2QHSA 1WQWA 3VBBA 4L59A 3M4QA 3CCSA 3V8JA 3IG2A 2F5KA 3SB2A 2E5QA 4PNOA 1Y96B 2DAQA 3Q1JA 3OYHA 4PG3A 4YCVA 5I21A 3VQWA 4IURA 1MHNA 3S6WA 4XU0A 3CMQA 3TCJA 1X54A 3H8ZA 4LVLA 5GMKi 2ZR2A 1LJOA 3RESA 4C8QC 4L6V5 5M9OA 3REXA 3JCMg 3CCQT 3HPWA 2CGHA 1AHJB 2J3MA 4M7AB 4Q6GA 3CC7T 1KQSA 2PQWA 4YRKA 3NEMA 2I4LA 1N9RA 4C0GA 2ZIOA 3GP8A 1VQ4A 4M75A 3OS5A 2PVGB 3CCRA 4CS4A 3ZEHA 3PZCA 1Y96A 1KQSS 4X9CA 3DKMA 3A8OB 4B9XA 3L4GB 2XGTA 4Y28E 4YRMA 2IY5B 2ARTA 3LSSA 1BI1A 1ZHIA 4HA8A 4HT8A 1YJWT 2WSFE 4A4FA 2DZ9A 2LVMA 1WU7A 3JB9F 4OB3B 3G4SA 3CCMA 2QEXA 2EQMA 3OYNA 5GAOq 2H3JA 1YI2T 1YCYA 4N4IA 1VQPA 1H4SA 3CCJA 3TEHA 4J15A 3HXXA 4C5GA 1UEBA 4M78B 3G1ZA 2A3LA 3CC4T 5KH6A 2EQUA 2D6FA 1OI1A 2P0LA 1VQMT 1KMMA 4P71C 2JOYA 4M77F 3ICAA 1PSEA 4Q15A 2JNGA 2DTIA 4A53A 3KFUA 1XQHA 2M1HA 3CMET 2R5AA 1H4QA 2PUOB 3PGGA 2J3LA 2CJ9A 3I55A 2IY5A 1L0WA 2K57A 4YRGA 3A5ZB 3CCET 1X2HA 3QO3A 2K5IA 1LOJA 3FRNA 4BACA 2HBPA 1B34A 2EQKA 3HRUA 5GAN2 3V7SA 1H641 2XI9A 3OMCA 2JVVA 4HCBA 2RHYA 3TEEA 4EMKC 4PHCA 5C0MA 4M78A 1EQRA 4HWPA 4X34A 3CMAT 2RK2A 2HNIA 3EAEA 1YITT 4GY5A 1M4ZA 3V8KA 2QQ9A 3A74A 1WGSA 3JB9J 1KQ1A 4YYEA 2DD5A 1H4VB 3SWNC 2PMFA 5GAMf 5LJ5f 2DXBA 3UT1A 3RMSA 2I4MA 3GNFB 4ZTZB 3CBOA 2QQBA 5GANh 1I5LA 1NPRA 4C8QD 4LNSA 2E3CA 3HRIA 4H2WA 3FC3A 4RQEA 3DB4A 4C92B 1WNLA 3HRKA 3CXCA 1K8AC 4K86A 3JAME 1M90U 1G5HA 3L2WA 5A2QE 3HXZA 4JRKA 1U8RA 1D3BB 3RKXA 5CO7A 2QXFA 4BW9A 4N4HA 4TWAA 2ZPBB 1YFSA 3A5ZA 4M7AE 2K5LA 3E9FA 3JSCA 4H2VA 3QJ6A 3CXCS 2GQVA 5IAYA 3TREA 4BD3A 4M75F 3CD6A 2RHUA 5GANd 2GFAA 1YIJT 2L8DA 4OGCA 2GFUA 4YRNA 3QZ5B 3LW5E 3A7AA 4RMFA 3WVDB 4PJOB 2XG8D 3I7FA 3SD4A 2BIVA 3VU3C 3JCMe 3O8VA 4MMKA 4C5HA 3HSBA 2E12A 4QQDA 3CCLT 1N27A 4YTLA 3QO7A 2E6ZA 2ZXFA 3UGTA 3C4SA 1DJ7B 4OB1B 3MEVA 3LYIA 1SETA 1D3BA 4OMFB 1X75C 4M78E 4XTUA 1EVLA 3G71A 1K73C 4H2YA 2RJFA 3JCMc 4J6XA 3WQZA 1Q81U 3OYMA 1NE8A 3M57A 2PVDB 1VQ7T 3OS2A 2L3RA 4FT4A 3INZA 2RHSB 3OYFA 3A5YA 4XU2A 1FWZA 3MP8A 3RGLA 2RD1A 4H2XB 5GAOp 1XNIA 2HQXA 3WXMB 4UP8A 2WSEE 5C51B 4A4GA 1NYRA 2Y4XA 1QP2A 4P74C 4XTWA 3R6OA 2R5MA 3BDLA 3QDRB 4YDQA 2E10A 4J6YA 2M0OA 3CC2T 2QQAA 3OS0A 4Q5WA 4BUGA 3LSQA 3BW1A 5GAMe 5GMKe 1VQ8A 2DIQA 3NELA 4BI4A 4BDYA 2PUKB 4BY6C 1KD1U 3NTKA 5CIUA 3MF1A 5K1PA 2Q5IA 1N8RU 2RHSA 4MZTA 4F7UF 3QG1A 3A8MB 5DY9A 3SFMA 1G3WA 1B76A 4J7FA 5J39A 4BE0A 5I2SA 1K9MC 4YRFA 2QHTA 5C6SA 4C92E 4YRSA 1JBMA 3X25B 3ERRA 4YRLA 5GMKl 3T9NA 4FSXA 3PCOB 4E7LA 3JCMJ 4LDUA 4QW2A 4P75A 5GAMh 3CCQA 4TVYA 3NTHA 5LJ5h 3JCMb 1EFWA 1SESA 1JJCB 3X24B 3HXUA 1NJ5A 3CBPA 3MP1A 4BDZA 4RG8A 3L2VA 3CBMA 4FL6A 2DVEA 4M7DB 1RI0A 2KSSA 4HWRA 1U1SA 3HFOA 4FT2A 1JB0E 3M4YA 2XDBA 1SRYA 1R8OB 2XK0A 1YJNA 3HFNA 4PJOE 3REUA 4N4GA 1WPYA 2EJGA 1FYFA 4V2SA 1WQ7A 4XU3A 2ZINA 3OYDA 5GAMd 5LJ5d 4ZTJA 4RQFA 1YJWA 4CH4A 2ARUA 3IALA 4JLGA 3J7AF 5GANg 1HTTA 1YI2A 2RI5A 1E1TA 1NYQA 3PCOA 2LX9A 3RUXA 5CKDA 2ZPHB 3SDZA 4M7AG 2GF7A 5CKHA 1H4TA 4UP7A 3UDCA 2RO0A 3CC4A 3L2ZA 1NJIU 1MGQA 2O01E 1BI2A 4LD9K 2EWNA 4M7DA 1ATIA 2PMEA 3VUBA 4JS4A 1Z7NA 4P73A 4OB2B 2JN0A 1JJ2A 4JRQA 3CMEA 3RERA 2DO3A 2LQKA 4IKFA 5FU6C 2VXEA 2FVUA 1VQ9T 2QHUA 1VIFA 3CCEA 1N9WA 4FU6A 4A4HA 2RK1A 1NNHA 4M75B 1JJ2S 4C0DB 4A4KA 4M78G 2Q7HA 5CK9A 2AMCB 4LVJA 2KDSA 4BI3A 4R55A 4M77C 2MWOA 3CMAA 2X4WA 2YLBA 1KC8C 1YITA 2VUBA 2XTIA 4UP9A 5LJ3d 4ATOA 3HY0A 3OSVA 2ALYB 3EFSA 5HGQA 1ADYA 4KT0E 3TEHB 3OY9A 4LVIA 1W4SA 4P72C 5ELNA 4H2UA 1VQOT 2P5IA 4MDWA 1RL2A 2ZCFB 4E7IA 2IG0A 4XEMA 3QTCA 1ASZA 4H02A 5KCHA 2ZT7A 1SSFA 1M1KC 4TTVA 2MF2A 1Q7YU 3E1SA 3P8DA 3QJYA 4M77E 5L8RE 1E22A 1NJ6A 1X2GA 2DDZA 4WI1A 3VQVA 2PU9B 2CKKA 2X4XA 4YRCA 3QO8A 2AMCA 4JRPA 3X20B 1YIJA 2YRVA 4P3NA 1UB4A 4P71A 4H2TA 1KQ2A 2DEQA 4EO4A 1UGRB 2OAUA 4EDUA 3CCUT 3M4GA 2C06A 3UFGA 1B34B 1Q86U 3P8HA 2DQ0A 3RL6A 1W66A 2ALYA 4C92G 3UPUA 3CCLA 1WYDA 1N9SA 5FROA 2KQWA 3VV0A 3PIOA 4FIBA 1ASYA 2KAFA 2EYQA 1X56A 1G3TA 4LD6A 2DU7A 1I81A 12ASA 2FB7A 1VQ5A 2EIFA 3WVEB 3PMIA 3OBYA 4F7UB 3ZBDA 4EMGA 2RI3A 3CPFA 1E24A 2F5TX 5GAMg 4EMKA 4M7DF 5LJ5g 1BI0A 3M54A 2DJZA 4LDWA 2B8AA 2RJEA 5LL6S 3C12A 2QA4T 5GAMj 5GMKj 4PJOG 4RCBA 2KMTA 5GANe 3G6ET 1B7YB 5GAN4 1G5IA 1N8RC 2JTMA 4XTZA 1RIQA 4DQ2A 2OTLT 3HHTB 2RHIA 2VGMA 1XTDA 5KE3A 2LT4A 1Y71A 4IUTA 3QUIA 4HT4A 1YJ9A 5GAOm 4M7AC 3L1AA 4C8QF 4M75E 4QQ6A 3PTAA 3CCVT 3CC2A 3VYHB 3VYGA 2BKDN 4G85A 4QQGA 5CAIA 2X4YA 3M55A 4IUUA 2ZNJA 4ME7A 1VQKA 3LGLA 1BYMA 1USYA 1BIAA 3LH0A 4ZTFA 4F7UA 2CS7A 2LCCA 2D0QB 5I2MA 1YBYA 2XHCA 3TEGA 4BE2A 2VGNA 4ZGEB 2EJ9A 1WLEA 2M16A 5A0LA 2LCLA 3C95A 2QI2A 3OB9A 1HC7A 2ZZDA 2MMPA 1G51A 2JTFA 2V8IA 3FDRA 3P8TA 2Y4YA 2ZTGA 4YRTA 1B7YA 2E70A 1C0AA 1G3SA 3TU4K 1BI3A 4O5VA 5HK3A 4M78C 2QTXA 4PL6A 3QBYA 4E47A 4OF1A 5IT9E 1BBWA 3OYYA 1Q82C 3QSUA 2CZ6B 4B9WA 4H2SA 3HY1A 3CCRT 3VUZA 5HKCA 2QDYB 1GGMA 1NJIC 2EJFA 2QQRA 2ZPEB 4DOWA 3JB9G 4PKCC 4TVAB 3MEYA 4N0AC 2MI6A 3G4ST 1QVGA 2L89A 1HXDA 1UGPB 1Y7XA 1LNXA 3NFCA 5E3IA 3S3MA 4J83A 4EMHA 4UC4A 4D6WA 2FHDA 2Q7EA 3FJPA 3RKWA 5LJ3f 2EAYA 4CRIA 5DLOA 1IZ6A 4OLFA 2JZ2A 4M77G 3VQXA 1QVGS 4F7UE 4J5YA 3E9GA 1EIYB 4J6WA 2DQ3A 4E51A 2VXFA 4OP0A 2DXCA 3IKLA 4YREA 2XDPA 4BI8B 3OD1A 4C92C 3I55T 2VYTA 4IUQA 1EVKA 4M7AD 4TVAA 3M4PA 1B8AA 3OQ5A 1VQ9A 4HVCA 2LQ8A 1VIEA 2KY9A 2ODRC 4TQDA 1G3YA 5LJ5e 4XEOA 3M58A 1OZ3A 2ZPFB 1BIBA 2E64A 2HAXA 2JUFA 2O4XB 5FU7B 2CZ1B 2WSCE 4HWSA 3P8YA 1KMNA 1YFTA 3M59A 3TUPA 3HL8A 3PIPA 4PJOC 3A7RA 1WJRA 2HQEA 5D6WA 2RHQB 1EIYA 3HXVA 3CPWA 11ASA 3OYIA 4R56A 4XTVA 3X28B 4JDSA 4ZTUB 4VUBA 2G4CA 3X26B 1VQNT 4M78D 2LT1A 1NZ9A 1O75A 1JRIA 5F5WA 4KBMB 4P3PA 1YGBA 3MP6A 2LC4A 1VQOA 3OA6A 2DD4A 4HT9A 2L5QA 4NS5A 2I4OA 5GAOr 3CC7A 3RKYA 3L2QA 5ELOA 2P0QA 3CPWS 5EG2A 2F69A 4M75G 1VQ6T 4RKUE 2E5AA 1GXIE 5CQXA 3GOXA 2V8JA 5GAN6 2ZZFA 2O4XA 3I56T 4HWOA 2X35A 2I4NA 1K8AU 4WF2A 1G5VA 2G3RA 2K5FA 3KXTA 2C8MA 4PLIA 3E19A 2RHQA 3LWIA 3CCUA 2ZR3A 3UGQA 2WACA 2AHJB 4C8QB 4P75C 5LJ3e 1M1GA 4CS3A 4ZN1A 4DPGA 3HFVA 2AKWA 5GAOl 4PLLA 5GANj 2OTJT 2ZT5A 2P0PA 3MF2A 1EOVA 2ZT6A 3NETA 3HXYA 4TVWA 1VQMA 1EIFA 1X55A 2KK4A 2XICA 2IVWA 4E7KA 4G84A 3P8BB 4LVKA 5DLQE 3L2RA 1B70B 3NENA 2ZZGA 4EX5A 4C92D 4MMLA 2EFIA 1VQLT 4KUDK 3LLRA 3A32A 2QA4A 3A8HB 5LJ3h 1M9SA 4HWTA 2RH2A 4KR2A 2FL7A 4TVRA 2DXUA 3G6EA 4MZMA 1FXXA 5HK0A 1K73U 2ODRD 5DM7R 2VV5A 2OTLA 3L42A 4C8QA 3FB9A 1M90C 3QKJA 1QW1A 4P72A 3QPHA 3ME9A 3MEWA 4JS5A 3MHXA 2ZPIB 4BE1A 4O6JA 3CCVA 3P8VA 4TQFA 5GAN8 2XD0A 4AH6A 4M7DC 1V29B 3A8GB 4PJOD 4P73C 3KBGA 3LWHA 2VC8A 3M56A 3OMGA 1TH7A 4K87A 5CKEA 4F7UG 2CIMA 5KNNA 3ZFJA 4HCZA 3QZ9B 1S72T 1Y07A 1NJ1A 1YFRA 1B70A 1N6AA 2E6NA 3J80E 1ZBXA 4XTXA 3OYBA 3MQZA 2DZCA 4CH3A 5J26A 4ZIBA 4LDYA 3V7RA 4BB7A 5CKBA 3QYHB 4NL2A 1YHQT 4OGEA 3GNGA 2CYZB 4EMKB 1E1OA 4M7DE 2K3XA 3UWNA 3V7CA 1NPPA 4NCXA 3DLMA 2E41A 3DSQA 1Q81C 1K9MU 3SWNB 1YJNT 5C53B 4ZGDB 3UH0A 4UPAA 3JCMV 3OYJA 4OVAA 4MDXA 4YCWA 5CVIA 3BDUA 4C8QE 3FIFA 4WJ3M 4YRRA 5GMKm 4X9DA 2HD0A 3JCMf 4M75C 4C0DC 2K3YA 4C5IA 4P3OA 4KUIA 1PYSB 3M5AA 2P4TA 2YHTA 4WJ4A 4YCUA 4FM4B 4K88A 1LYLA 5HY6A 3F70A 4JUVA 1VQ7A 2LNVA 4M7AA 3ASKA 2PVOB 3QHSA 3BY7A 3HP9A 3JB9D 3N5BB 3BFMA 3LX7A 5LJ5j 2NLUA 3A7UA 2LTOA 3ER0A 4ZGJB 2ZCEA 1KD1C 2X4JA 3SWNA 4RMOA 3S3NA 2RJDA 4YPFA 2QHVA 3OYCA 3HRSA 4YRJA 3L4GA 2A7YA 2XKOC 3A8LB 5D6XA 2V8KA 1VQZA 4M77D 3L2UA 3DLLA 1IREB 4M7DD 2GCXA 3QYGB 3CCST 3G7ZA 3HXWA 4YRQA 4IUPA 3GPLA 1PYSA 3MEUA 2RB6A 1ZQ1A 3URGA 2E65A 1J5WA 3PFSA 3META 4RCCA 2CJBA 3JRZA 1WJSA 4XQ3A 2RHXA 2QQSA 1BKBA 1VQNA 1O9SA 4LVMA 2Y90A 2DIGA 4N0AA 3E9HA 5LJ3g 4Z02A 4RDXA 3QXEB 4NOYA 3H6ZA 5FRMA 3CEYA 3PT9A 1KOGA 1VQ4T 1KC8U 2CZ7B 5C52B 5LJ3j 1USYC 3M53A 3JB9I 3OS1A 1VQ6A 1KHCA 2EL9A 4BY6B 3OYLA 3GF5A 4IUVA 3I56A 4L87A 5CKFA 5CQYA 4J7IA 1HK9A 4XAXB 4C5EA 1UGQB 4A4EA 4EPCA 2K4YA 3M9QA 3HFZB 3JB9H 4YRPA 3CCMT 3FLGA 1UGSB 2QEXT 2XIDA 4XK8E 2DU5A 1PSFA 2RHZA 3VQYA 1VQPT 3KUFA 4ZN3A 4M75D 3CCJT 1M1KU 3QO5A 4P74A 2FYKA 4RG2A 4C92A 3C94A 3V8LA 1QVPA 4QVCA 2OTJA 4JLIA 3GIBA 3JCMW 5A0DA 1W2BA 3MEAA 4M7AF 2ZGWA 2MWPA 1VQ5T 2XDDA 4M7DG 3S3OA 1VUBA 4O2DA 3LC0A 3IKMB 2EQJA 2KVQG 1P92A 2CZ0B 3OYKA 1ADJA 1NJ2A 2YLCA 2DKGA 3JCMh 4DOVA 4P5NA 2D9TA 1W2BS 1VQLA 1KG1A 5CR2A 4KR3A 4PJOA 3FEOA 3HFZA 4KQEA 4C8QG 3R07A 5KE2A 2ZT8A 3DB3A 1YJ9T 2P0KA 4ELZC 2ARSA 4XTYA 4LDVA 4YP0A 3RIRA 2DTOA 3MCAB 2M9UA 3J81E 1BBUA 4E7HA 2DXTA 3JCMd 4M78F 4CI0C 3JCMX 5FLXE 1VQKT 2Q7GA 1Q7YC 3EFRA 1I4K1 3PMTA 1X01A 5AYFA 4YROA 4JRIA 3QIIA 3NTIA 2DPPB 2R58A 2CJAA 1S72A 1KHIA 3RMQA 1OYXA 2DK3A 4E7JA 2AKWB 3AHUA 4L5GA 1M5Q1 2MAMA 4HKEA 1M8VA 4YRIA 5GAN7 4H2XA 1YB3A 3RACA 3W3SA 5FU6B 4DA4A 4CS2A 1SERA 1Q86C 4J8OA 1WJQA 2ZNIA 2BUDA 2EKOA 1OZ2A 5GMKh 1YHQA 3JCMQ 3CD6T 4XU1A 1XOVA 3MO8A 4C0FA 2RM4A 5GAN3 2RA2A 4HCCA 4M77B 1NJ8A 4BWAA 5FRNA 5D6YA 2C7IA 3OW2A 1M1FA 1I8FA 4QVZA 4C0ZA 1U1TA 1Z7MA 4II1A 2R57A 3OYAA 4LDXA 2ZPGB 4QVDA 5CCAA 4MZPA 3HTZA 5K1XA 2LDMA 3HKSA 1QVFA 2Q5HA 5J3BA 4A54A 4KULA 3VJPA 1X6OA 3OSSC 1QF6A 3OW2S 3BJUA 4Y91A 3A31A 4C92F 2RI2A 3G71T 5KCOA 4ELYC 1Q82U 3JCMP 3HRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCX A;  2EJ9 A;  1WLE A;  4CH5 A;  4YDQ A;  2E41 A;  3DSQ A;  1HC7 A;  2E10 A;  4J6Y A;  4X5O A;  3SWN B;  2E1H A;  1G51 A;  5C53 B;  5GAO n;  3UH0 A;  3P8T A;  2ZTG A;  4UPA A;  3JCM V;  4YRT A;  1JJC A;  4CH6 A;  1B7Y A;  1IL2 A;  3LSQ A;  4NL3 A;  4M77 A;  1C0A A;  3BW1 A;  5GAM e;  5GMK e;  1QE0 A;  4YCW A;  4M78 C;  3NEL A;  3BDU A;  2QTX A;  4C8Q E;  3FIF A;  4WJ3 M;  4YRR A;  1BBW A;  2ZZE A;  3RF1 A;  5GMK m;  3MF1 A;  4X9D A;  2Q5I A;  4PJO F;  5K1P A;  2RHS A;  4F7U F;  3JCM f;  2ZIM A;  3QSU A;  4M75 C;  5DY9 A;  1B76 A;  4P3O A;  1PYS B;  4H2S A;  3HY1 A;  3QNE A;  2YHT A;  5GAN 5;  4YRF A;  2QHT A;  2I2L A;  4WJ4 A;  4YCU A;  4C92 E;  3E9I A;  4K88 A;  1LYL A;  4YRS A;  1JBM A;  4JUV A;  1GGM A;  4M7A A;  3ERR A;  4YRL A;  5GMK l;  2DTH A;  2EJF A;  3QHS A;  5GAN f;  3BY7 A;  2QHS A;  3JB9 D;  1WQW A;  3PCO B;  3VBB A;  3BFM A;  3JB9 G;  3M4Q A;  5LJ5 j;  4TVA B;  3JCM J;  3V8J A;  3A7U A;  3IG2 A;  3SB2 A;  5GAM h;  4P75 A;  3MEY A;  4TVY A;  5LJ5 h;  4PNO A;  3JCM b;  4N0A C;  1EFW A;  1SES A;  1Y96 B;  1JJC B;  2ZCE A;  1HXD A;  4YCV A;  3SWN A;  4PG3 A;  1LNX A;  5I21 A;  3HXU A;  1NJ5 A;  5E3I A;  3VQW A;  2DVE A;  4EMH A;  4M7D B;  4XU0 A;  4YPF A;  2QHV A;  4HWR A;  4YRJ A;  1U1S A;  3CMQ A;  3L4G A;  2Q7E A;  3FJP A;  3RKW A;  3HFO A;  5LJ3 f;  2EAY A;  1SRY A;  1X54 A;  1VQZ A;  4PJO E;  4M77 D;  3HFN A;  4OLF A;  5GMK i;  3REU A;  2ZR2 A;  1WPY A;  4M77 G;  3VQX A;  4F7U E;  2EJG A;  1FYF A;  1LJO A;  3RES A;  4C8Q C;  4J5Y A;  4V2S A;  4M7D D;  1WQ7 A;  3REX A;  3JCM g;  4XU3 A;  3HXW A;  2ZIN A;  1EIY B;  4YRQ A;  4J6W A;  5GAM d;  2CGH A;  2DQ3 A;  5LJ5 d;  4E51 A;  2J3M A;  4M7A B;  4Q6G A;  1PYS A;  4RQF A;  4YRK A;  2RB6 A;  4CH4 A;  2VXF A;  4OP0 A;  3NEM A;  2I4L A;  3IKL A;  4YRE A;  2E65 A;  1J5W A;  2ARU A;  3OD1 A;  1N9R A;  3IAL A;  4C92 C;  2ZIO A;  5GAN g;  4RCC A;  1HTT A;  2CJB A;  1E1T A;  1EVK A;  1NYQ A;  3PCO A;  4M75 A;  3RUX A;  4M7A D;  4TVA A;  3M4P A;  4M7A G;  4CS4 A;  4UP7 A;  1H4T A;  1B8A A;  3PZC A;  4XQ3 A;  1Y96 A;  4X9C A;  3L2Z A;  4HVC A;  2ODR C;  1MGQ A;  4TQD A;  3L4G B;  2IY5 B;  5LJ5 e;  2XGT A;  4XEO A;  4YRM A;  2ART A;  3LSS A;  1BIB A;  2EWN A;  2E64 A;  4HA8 A;  4M7D A;  4HT8 A;  1ATI A;  2PME A;  1Z7N A;  4P73 A;  2DZ9 A;  2Y90 A;  1WU7 A;  4N0A A;  3E9H A;  5LJ3 g;  3JB9 F;  2JN0 A;  4RDX A;  4NOY A;  4HWS A;  3P8Y A;  1KMN A;  1YFT A;  1KOG A;  5GAO q;  1YCY A;  3TUP A;  3RER A;  1H4S A;  5C52 B;  5LJ3 j;  1USY C;  4PJO C;  4J15 A;  3HXX A;  3TEH A;  3A7R A;  3JB9 I;  4M78 B;  3G1Z A;  2RHQ B;  1EIY A;  3HXV A;  2EL9 A;  2VXE A;  11AS A;  2QHU A;  4XTV A;  1N9W A;  2P0L A;  4ZTU B;  1KMM A;  4L87 A;  1NNH A;  4P71 C;  4M75 B;  2G4C A;  1HK9 A;  4M78 D;  5F5W A;  1JRI A;  4M78 G;  4M77 F;  3ICA A;  4P3P A;  2Q7H A;  1YGB A;  3HFZ B;  2AMC B;  4Q15 A;  3JB9 H;  4YRP A;  4HT9 A;  2I4O A;  5GAO r;  3RKY A;  2DTI A;  4A53 A;  3KFU A;  4M77 C;  5ELO A;  2DU5 A;  3VQY A;  4M75 D;  1H4Q A;  2YLB A;  3QO5 A;  4P74 A;  3PGG A;  4M75 G;  2FYK A;  2J3L A;  2CJ9 A;  2XTI A;  4C92 A;  3V8L A;  2IY5 A;  4UP9 A;  5LJ3 d;  2E5A A;  3HY0 A;  1L0W A;  2K57 A;  4YRG A;  1X2H A;  5GAN 6;  2ZZF A;  2ALY B;  4QVC A;  4JLI A;  3QO3 A;  3GIB A;  3EFS A;  5HGQ A;  1ADY A;  1LOJ A;  3JCM W;  4HWO A;  2I4N A;  3TEH B;  2ZGW A;  1B34 A;  5GAN 2;  4M7A F;  4M7D G;  4O2D A;  4WF2 A;  3LC0 A;  4P72 C;  5ELN A;  3V7S A;  1H64 1;  3IKM B;  4H2U A;  2P5I A;  4EMK C;  2C8M A;  4PHC A;  1ADJ A;  1NJ2 A;  4M78 A;  2YLC A;  2DKG A;  1EQR A;  4EX5 A;  4HWP A;  2RHQ A;  2ZR3 A;  2HNI A;  3JCM h;  3QTC A;  4XEM A;  3UGQ A;  1ASZ A;  3V8K A;  4C8Q B;  2ZT7 A;  4H02 A;  4TTV A;  3A74 A;  4P75 C;  5LJ3 e;  4CS3 A;  3JB9 J;  1KQ1 A;  4YYE A;  4M77 E;  1H4V B;  1E22 A;  1NJ6 A;  4DPG A;  3SWN C;  2PMF A;  4KR3 A;  5GAM f;  1X2G A;  4PJO A;  3HFV A;  2AKW A;  5LJ5 f;  5GAO l;  2DDZ A;  5GAN j;  2ZT5 A;  4WI1 A;  3VQV A;  2I4M A;  4ZTZ B;  4YRC A;  3HFZ A;  3QO8 A;  2AMC A;  3MF2 A;  5GAN h;  1I5L A;  4C8Q D;  4KQE A;  4LNS A;  2E3C A;  1EOV A;  2ZT6 A;  3HRI A;  4C8Q G;  3HXY A;  3NET A;  4H2W A;  4TVW A;  4RQE A;  4C92 B;  1WNL A;  3R07 A;  3HRK A;  4K86 A;  1X55 A;  2ZT8 A;  4P3N A;  1G5H A;  4P71 A;  4G84 A;  4H2T A;  2ARS A;  1KQ2 A;  4XTY A;  2DEQ A;  3HXZ A;  4YP0 A;  4JRK A;  4EO4 A;  1D3B B;  3RKX A;  3RIR A;  2DTO A;  3M4G A;  1B70 B;  1BBU A;  3NEN A;  4BW9 A;  2DXT A;  3UFG A;  4TWA A;  1B34 B;  3JCM d;  1YFS A;  4M78 F;  2DQ0 A;  4C92 D;  3A5Z A;  1W66 A;  2ZZG A;  3JCM X;  4MML A;  4M7A E;  2ALY A;  4C92 G;  2Q7G A;  4H2V A;  3EFR A;  1I4K 1;  1WYD A;  3A32 A;  1N9S A;  5LJ3 h;  4HWT A;  1X01 A;  4YRO A;  4KR2 A;  4JRI A;  4M75 F;  1ASY A;  2DXU A;  1X56 A;  5GAN d;  2CJA A;  4YRN A;  2DU7 A;  1I81 A;  2ODR D;  3A7A A;  4RMF A;  12AS A;  4C8Q A;  3FB9 A;  2FB7 A;  4PJO B;  2AKW B;  3AHU A;  1M5Q 1;  4F7U B;  4EMG A;  3I7F A;  4P72 A;  1M8V A;  4YRI A;  5GAN 7;  4H2X A;  1YB3 A;  3VU3 C;  3JCM e;  1E24 A;  3RAC A;  3W3S A;  4MMK A;  5GAM g;  3HSB A;  4EMK A;  4M7D F;  5LJ5 g;  4CS2 A;  3RL6 A;  1SER A;  3P8V A;  4TQF A;  2DJZ A;  5GAN 8;  3QO7 A;  2ZNI A;  4AH6 A;  4M7D C;  5GAM j;  5GMK j;  4PJO D;  2ZXF A;  4P73 C;  3UGT A;  2VC8 A;  4PJO G;  1TH7 A;  5GMK h;  4K87 A;  4F7U G;  3JCM Q;  4RCB A;  2CIM A;  4XU1 A;  5GAN e;  5KNN A;  1B7Y B;  1SET A;  2RM4 A;  5GAN 3;  5GAN 4;  2RA2 A;  1G5I A;  1D3B A;  4M77 B;  4M78 E;  4XTU A;  1EVL A;  1NJ8 A;  4BWA A;  2C7I A;  4XTZ A;  1NJ1 A;  1I8F A;  4DQ2 A;  1B70 A;  1RIQ A;  1YFR A;  4H2Y A;  3JCM c;  1U1T A;  4J6X A;  3WQZ A;  1Z7M A;  4XTX A;  3QUI A;  5GAO m;  2DZC A;  4M7A C;  3L1A A;  4QVD A;  4C8Q F;  4CH3 A;  4M75 E;  3INZ A;  2RHS B;  3HTZ A;  5K1X A;  4ZIB A;  3V7R A;  3A5Y A;  2Q5H A;  4G85 A;  4XU2 A;  4A54 A;  5CAI A;  4NL2 A;  1QF6 A;  3RGL A;  3BJU A;  2ZNJ A;  2RD1 A;  4Y91 A;  4H2X B;  3A31 A;  5GAO p;  1USY A;  1BIA A;  4EMK B;  1E1O A;  4UP8 A;  4C92 F;  4M7D E;  4F7U A;  5C51 B;  1NYR A;  4P74 C;  4XTW A;  3JCM P;  3TEG A;  3V7C A; 
#chains in the Genus database with same CATH topology
 1QVF S;  3LGF A;  1H3H A;  3IQL A;  4CH5 A;  3EGX B;  1FX7 A;  1VOM A;  4OMM A;  2F1L A;  3OYG A;  4X5O A;  1ZSZ B;  2E1H A;  1K0X A;  2NS6 A;  5FU7 C;  4R0K A;  2LRQ A;  5IN1 A;  5GAO n;  4ZNX A;  3H0H A;  1JJC A;  4CH6 A;  1IL2 A;  4NL3 A;  4M77 A;  3OBW A;  1C0M A;  2K2V A;  2CP2 A;  1OPL A;  1QE0 A;  1PC0 A;  2A8E A;  1LCK A;  3VKI A;  2PZ1 A;  2CP0 A;  4E7Z A;  2ENM A;  3M0R A;  1AEY A;  3OYE A;  3CQT A;  2A0F B;  3NGP A;  2ZZE A;  1NLO C;  4JJD A;  3RF1 A;  4PJO F;  1ZUK A;  2DYI A;  2ZIM A;  4JJN K;  3GLX A;  2KI7 A;  4OB0 B;  2RJC A;  1VYU A;  1H3Z A;  3QNE A;  5A0G A;  2XU8 A;  5KYX B;  5GAN 5;  2I2L A;  2NUP A;  3E9I A;  3PVL A;  3CD6 Q;  4GLK A;  3QDF A;  2DTH A;  1X27 A;  3PNW C;  5GAN f;  1QP3 A;  1VQ8 T;  2QHS A;  1WQW A;  3VBB A;  4L59 A;  1WHG A;  1IHW A;  2CSI A;  3M4Q A;  3CCS A;  3V8J A;  3IG2 A;  2AK5 A;  1TWB A;  2F5K A;  2I0N A;  3SB2 A;  2E5Q A;  2YRC A;  3EGX A;  4PNO A;  2JMC A;  1Y96 B;  2DAQ A;  3Q1J A;  3OYH A;  4PG3 A;  4YCV A;  4B6M A;  5I21 A;  1IB8 A;  1TOV A;  3VQW A;  4IUR A;  1MHN A;  3S6W A;  1ZUY A;  4XU0 A;  2P4R A;  1M3C A;  3CMQ A;  1KJW A;  4LUE A;  3TCJ A;  1X54 A;  3H8Z A;  1QCO A;  4LVL A;  1CKA A;  5GMK i;  1MMN A;  2ZR2 A;  2QGG A;  1LJO A;  3RES A;  4C8Q C;  3G71 Q;  4L6V 5;  5M9O A;  3REX A;  3JCM g;  1GCP A;  3CCQ T;  2OI3 A;  3MPU B;  1W70 A;  3HPW A;  1GCQ C;  2CGH A;  1AHJ B;  1QKW A;  2J3M A;  4M7A B;  4Q6G A;  3CC7 T;  1KQS A;  2PQW A;  4RTU A;  4YRK A;  1A0N B;  1X2Q A;  5KYX A;  3GBQ A;  3NEM A;  2I4L A;  3H0F A;  1OOT A;  1N9R A;  4C0G A;  2ZIO A;  8AT1 B;  3GP8 A;  1VQ4 A;  2VAS A;  1PKS A;  4M75 A;  2O9V A;  3OS5 A;  2ECZ A;  2PVG B;  1TUD A;  2HKQ B;  3CCR A;  4QT7 A;  4CS4 A;  3ZEH A;  3PZC A;  1RAI B;  1Y96 A;  1KQS S;  2CP5 A;  4X9C A;  3DKM A;  2DBK A;  3A8O B;  3MKD A;  4B9X A;  3L4G B;  2XGT A;  4Y28 E;  4YRM A;  2IY5 B;  2ART A;  3NHN A;  2JJ9 A;  1BI1 A;  3LSS A;  4RTV A;  2X51 A;  2KR3 A;  1ZHI A;  2LCS A;  4HA8 A;  4HT8 A;  1YJW T;  2WSF E;  4A4F A;  1T0H A;  2DZ9 A;  2LVM A;  1RLQ C;  1WU7 A;  2VB6 A;  5KYU B;  3JB9 F;  4OB3 B;  3G4S A;  3CCM A;  2QEX A;  2EQM A;  3NPF A;  3OYN A;  5GAO q;  2H3J A;  1YI2 T;  1YCY A;  1S1N A;  4N4I A;  1VQP A;  1H4S A;  2YUO A;  3CCJ A;  1VQ8 Q;  3TEH A;  4J15 A;  3HXX A;  4C5G A;  1UEB A;  4M78 B;  2LMJ A;  3G1Z A;  2A3L A;  3CC4 T;  5KH6 A;  2EQU A;  1E6G A;  2D6F A;  1OI1 A;  2P0L A;  1VQM T;  2DE0 X;  1KMM A;  4P71 C;  1UGV A;  4PJJ A;  2JOY A;  4M77 F;  3ICA A;  1PSE A;  4Q15 A;  2JNG A;  4FW1 A;  2DTI A;  4A53 A;  3KFU A;  1XQH A;  2M1H A;  3CME T;  2CRE A;  4PJN A;  2R5A A;  1H4Q A;  2PUO B;  3PGG A;  2J3L A;  2CJ9 A;  3I55 A;  2IY5 A;  2NUT B;  3CCQ Q;  1UHF A;  2DET A;  1MV3 A;  1L0W A;  2K57 A;  5FWC A;  4YRG A;  3A5Z B;  3CCE T;  1X2H A;  4Y92 A;  2HZY A;  3QO3 A;  1J3T A;  2K5I A;  2DM1 A;  5KYU A;  1LOJ A;  3FRN A;  4BAC A;  2HBP A;  1AD5 A;  1NYG A;  1B34 A;  2EQK A;  3HRU A;  3VRZ A;  5GAN 2;  1VA7 A;  1B7T A;  3V7S A;  1H64 1;  2XI9 A;  3OMC A;  4RTX A;  2JVV A;  4HCB A;  2RHY A;  3TEE A;  4EMK C;  4PHC A;  5C0M A;  4M78 A;  1IGU A;  1EQR A;  1YJN Q;  4HWP A;  4X34 A;  1NEG A;  3CMA T;  2JS0 A;  2RK2 A;  2MOX A;  2HNI A;  3EAE A;  1YIT T;  4GY5 A;  1M4Z A;  3V8K A;  2QQ9 A;  1WYX A;  3SHW A;  1H92 A;  3A74 A;  1QWE A;  3CPW P;  1WGS A;  3BE3 A;  3JB9 J;  1OV3 A;  1WDX A;  1KQ1 A;  2XMF A;  4YYE A;  1I07 A;  2DD5 A;  1H4V B;  3SWN C;  2PMF A;  3E2U A;  5GAM f;  2JM9 A;  5LJ5 f;  2DXB A;  3UT1 A;  3RMS A;  1YJW Q;  2I4M A;  2RQU A;  3EGU A;  3GNF B;  4ZTZ B;  3CBO A;  2ZAE A;  2QQB A;  4JPB W;  5GAN h;  1I5L A;  1NPR A;  2K79 A;  4C8Q D;  4LNS A;  2E3C A;  3HRI A;  4H2W A;  3FC3 A;  2CP7 A;  3DB4 A;  3H9N A;  1WNL A;  4C92 B;  4RQE A;  3HRK A;  2COZ A;  3CXC A;  1K8A C;  2ABL A;  4K86 A;  1X6G A;  3JAM E;  1X2K A;  2KE9 A;  1YI2 Q;  2LQW A;  1M90 U;  1G5H A;  3L2W A;  5A2Q E;  4FYW B;  3HXZ A;  3TSZ A;  4JRK A;  1U8R A;  1D3B B;  3RKX A;  5CO7 A;  2NUT A;  1PNJ A;  1D1C A;  2QXF A;  4BW9 A;  3CC4 Q;  1K8A R;  4N4H A;  4TWA A;  2ZPB B;  1YFS A;  1UE9 A;  3A5Z A;  4LNP A;  4M7A E;  2K5L A;  3E9F A;  3JSC A;  5EC7 A;  3QJ6 A;  1VQM Q;  4H2V A;  3PVQ A;  2EW3 A;  3CXC S;  2GQV A;  5IAY A;  3TRE A;  2COY A;  4J9G A;  4BD3 A;  4DBQ A;  4M75 F;  3CD6 A;  1AZG B;  2RHU A;  5GAN d;  2GFA A;  1YIJ T;  2L8D A;  4OGC A;  2GFU A;  4YRN A;  3QZ5 B;  3LW5 E;  2BTT A;  3A7A A;  4RMF A;  3CME Q;  1IHV A;  3WVD B;  1EX4 A;  2GNC A;  2DL3 A;  1R77 A;  4PJO B;  2V1Q A;  2XG8 D;  2C0T A;  2J6F A;  1AOJ A;  2CSQ A;  3I7F A;  1AWX A;  1NLP C;  3SD4 A;  1Q82 R;  1CKB A;  2BIV A;  3VU3 C;  3JCM e;  1D1A A;  3O8V A;  4MMK A;  2FZK B;  4C5H A;  3HSB A;  1IXD A;  2E12 A;  4QQD A;  3MJX A;  3CCE Q;  1UHC A;  1N27 A;  4FYY B;  3CCL T;  4YTL A;  3QO7 A;  1Z9Z A;  2E6Z A;  2ZXF A;  3UGT A;  1ARK A;  2E3H A;  1UG1 A;  3C4S A;  1WIE A;  1DJ7 B;  1TUC A;  2BZY A;  4OB1 B;  3MEV A;  3LYI A;  2M02 A;  1SET A;  1D3B A;  4JZ4 A;  4OMF B;  1X75 C;  4M78 E;  4XTU A;  1EVL A;  3G71 A;  2RPN A;  3CMA Q;  1K73 C;  2DEU A;  4H2Y A;  3RNJ A;  2RJF A;  3JCM c;  4J6X A;  1YIT Q;  3I5R A;  2A28 A;  3WQZ A;  1Q81 U;  3OYM A;  2DMO A;  1NE8 A;  3M57 A;  1JJ2 P;  2D1X A;  2PVD B;  1VQ7 T;  3OS2 A;  2L3R A;  2K7A A;  4FT4 A;  3INZ A;  2RN8 A;  2RHS B;  3OYF A;  3A5Y A;  2P84 A;  4XU2 A;  1FWZ A;  3MP8 A;  4LUD A;  3RGL A;  2RD1 A;  2HCK A;  3EGD B;  4H2X B;  5GAO p;  1XNI A;  9ATC B;  1MNE A;  5IHK A;  2HQX A;  2DL7 A;  2D8H A;  3WXM B;  4AFQ C;  4UP8 A;  2G6F X;  2WSE E;  5C51 B;  1X6B A;  4A4G A;  2IPO B;  1NYR A;  2Y4X A;  1QP2 A;  4P74 C;  4XTW A;  1SG5 A;  3R6O A;  2R5M A;  3BDL A;  1SRL A;  4F17 A;  3QDR B;  3QWY A;  3EG9 A;  4YDQ A;  3H41 A;  2E10 A;  4J6Y A;  3G1J A;  2M0O A;  3CC2 T;  2QQA A;  3OS0 A;  4Q5W A;  2BE9 B;  4BUG A;  2CP6 A;  3D7S B;  3LSQ A;  1YIJ Q;  3BW1 A;  5GAM e;  5GMK e;  1C6V X;  1F1B B;  1VQ8 A;  2DIQ A;  2MK5 A;  3NEL A;  4BI4 A;  1T0J A;  4BDY A;  2PUK B;  4BY6 C;  1KD1 U;  3NTK A;  4ESR A;  5CIU A;  3MF1 A;  2AZS A;  5K1P A;  2Q5I A;  1U06 A;  1N8R U;  2RHS A;  4MZT A;  4F7U F;  2EYY A;  3QG1 A;  1MND A;  3A8M B;  5DY9 A;  3CCL Q;  3SFM A;  1G3W A;  1AZE A;  1B76 A;  4J7F A;  5J39 A;  4BE0 A;  5I2S A;  1K9M C;  4YRF A;  2QHT A;  5C6S A;  3EGD A;  3NMZ C;  4C92 E;  4AFS C;  4YRS A;  4KGX B;  1JBM A;  1QLY A;  3VS6 A;  3X25 B;  3ERR A;  4YRL A;  5GMK l;  3T9N A;  3U23 A;  4FSX A;  3PCO B;  4E7L A;  1K9M R;  4AT1 B;  5IHN A;  2MPX C;  2EYX A;  3JCM J;  4LDU A;  4QW2 A;  2JW4 A;  2NYS A;  3UA6 A;  5GAM h;  3CCQ A;  4P75 A;  4TVY A;  3NTH A;  2EYW A;  3ULR B;  5LJ5 h;  3JCM b;  1EFW A;  2QTV A;  1SES A;  2FEI A;  1JJC B;  1VQ7 Q;  3X24 B;  3HXU A;  1NJ5 A;  3CBP A;  5HCK A;  3I9Q A;  1FMV A;  3MP1 A;  4BDZ A;  4RG8 A;  3L2V A;  1RAA B;  3CBM A;  4QKU A;  4FL6 A;  2DVE A;  4M7D B;  2J6K A;  1RI0 A;  2KSS A;  4HWR A;  1U1S A;  3HFO A;  4FT2 A;  1JB0 E;  3M4Y A;  2XDB A;  2AZV A;  3AT1 B;  1SRY A;  1R8O B;  2XK0 A;  2MCN A;  1YJN A;  5GJW B;  3HFN A;  4PJO E;  3REU A;  1HYO A;  4N4G A;  1WPY A;  2EJG A;  1FYF A;  2HL5 C;  1C1A A;  2H8H A;  2LJ0 A;  4V2S A;  2A36 A;  3EH2 A;  1WQ7 A;  1CSK A;  1YCS B;  4XU3 A;  1RI9 A;  2NUP B;  2ZIN A;  1MMG A;  2RMO A;  3OYD A;  5GAM d;  5LJ5 d;  1I0C A;  1YJ9 Q;  4ZTJ A;  2EVR A;  4RQF A;  1YJW A;  2ROT A;  4CH4 A;  2K2M A;  2QAS A;  3CC2 Q;  1KK7 A;  2ARU A;  3IAL A;  1LVK A;  4JLG A;  3J7A F;  5GAN g;  1HTT A;  1YI2 A;  2RI5 A;  2DVJ A;  1E1T A;  1NYQ A;  3PCO A;  2LX9 A;  1VQK Q;  3RUX A;  5CKD A;  2ZPH B;  3SDZ A;  1OQK A;  4M7A G;  2GF7 A;  5CKH A;  1H4T A;  1K76 A;  4UP7 A;  3UDC A;  2RO0 A;  2KBT A;  3CC4 A;  1PWT A;  3L2Z A;  1NJI U;  2FG0 A;  1MGQ A;  2O01 E;  1KSW A;  2LQN A;  3ZL7 C;  1BI2 A;  2BZ8 A;  4LD9 K;  2EWN A;  4M7D A;  1ATI A;  2PME A;  3VUB A;  4JS4 A;  1Z7N A;  4P73 A;  4OB2 B;  4HVW A;  1GL5 A;  4DEY A;  1OU8 A;  2JN0 A;  1JJ2 A;  4RTW A;  1PD0 A;  2AKL A;  2EGE A;  4JRQ A;  3CME A;  3RER A;  2QK0 A;  4WCI A;  2DO3 A;  4F04 B;  5IHI A;  3VS3 A;  2LQK A;  4IKF A;  2FZG B;  2RNA A;  5FU6 C;  2VXE A;  2FVU A;  2YRD A;  4OMQ A;  1VQ9 T;  2QHU A;  1VIF A;  3CCE A;  1N9W A;  4FU6 A;  4A4H A;  2OX7 A;  2RK1 A;  1NNH A;  4M75 B;  1JJ2 S;  4C0D B;  4A4K A;  5L23 A;  2ROL A;  4M78 G;  2Q7H A;  3RDV A;  5CK9 A;  2AMC B;  1GCQ A;  4LVJ A;  1U5S A;  2KDS A;  3M0T A;  4BI3 A;  4R55 A;  4M77 C;  2MWO A;  4DEX A;  3CMA A;  2X4W A;  2QAZ A;  3EG1 A;  1M90 R;  2YLB A;  1PCX A;  1KC8 C;  1YIT A;  2VUB A;  4RTY A;  4J9I A;  2XTI A;  2A37 A;  4AG2 C;  4UP9 A;  5LJ3 d;  4ATO A;  4GBQ A;  3HY0 A;  2CUB A;  3OSV A;  4J9C A;  1KC8 R;  2ALY B;  2JTE A;  3EFS A;  2AT1 B;  2KRN A;  1ADY A;  5HGQ A;  4KT0 E;  3TEH B;  3OY9 A;  4LVI A;  1W4S A;  4P72 C;  5ELN A;  4H2U A;  1VQO T;  1WHL A;  2P5I A;  1KFZ A;  3TQ7 P;  4CC2 A;  4MDW A;  1RL2 A;  2ZCF B;  3C0C A;  4E7I A;  2IG0 A;  5FW9 A;  1FYN A;  4XEM A;  3QTC A;  2KGT A;  1ASZ A;  4H02 A;  5KCH A;  2LP5 A;  4FCY A;  2ZT7 A;  1SSF A;  1M1K C;  4TTV A;  1UUE A;  2MF2 A;  1ABO A;  2RQT A;  4E6R A;  1Q7Y U;  3E1S A;  5AT1 B;  2EGA A;  3P8D A;  3QJY A;  4M77 E;  5L8R E;  1E22 A;  1NJ6 A;  2YUQ A;  1ZSZ C;  1OUL A;  1X2G A;  2DDZ A;  4WI1 A;  4OMN A;  3VQV A;  2DFU A;  2PU9 B;  2CKK A;  2X4X A;  1M1K R;  5IXF A;  4YRC A;  3QO8 A;  2AMC A;  2D0N A;  1Z9Q A;  2ESW A;  4JRP A;  3X20 B;  1YIJ A;  2W0Z A;  1QVG P;  2Z0W A;  2YRV A;  1D0Z A;  1MUZ A;  5KYW A;  4P3N A;  1UB4 A;  4P71 A;  4H2T A;  1KQ2 A;  2GTJ A;  2DEQ A;  4EO4 A;  1UGR B;  2OAU A;  4EDU A;  2X9H A;  3CCU T;  4FYX B;  3M4G A;  2C06 A;  2KEA A;  3UFG A;  1B34 B;  1Q86 U;  3P8H A;  2DQ0 A;  3RL6 A;  1VQ9 Q;  1W66 A;  2ALY A;  4C92 G;  3UPU A;  2W10 A;  3CCL A;  1WYD A;  3EHQ A;  1N9S A;  2DLP A;  3UF4 A;  5FRO A;  1TU0 B;  2KQW A;  3VV0 A;  1SSH A;  3PIO A;  1W2B P;  4FIB A;  1ASY A;  1SF9 A;  1RAH B;  2KAF A;  1GFC A;  1HD3 A;  2EYQ A;  1M27 C;  1X56 A;  1G3T A;  2DA9 A;  4LD6 A;  2RF0 A;  2COW A;  2DU7 A;  1I81 A;  2K3B A;  1TSF A;  12AS A;  4IIO A;  2FB7 A;  1VQ5 A;  2EIF A;  3EG0 A;  3WVE B;  3PMI A;  3OBY A;  1JXM A;  4F7U B;  3ZBD A;  4EMG A;  2RI3 A;  3CPF A;  1E24 A;  2F5T X;  5GAM g;  1T3L A;  4EMK A;  5LJ5 g;  4M7D F;  1BI0 A;  3M54 A;  2JMA A;  2DJZ A;  4LDW A;  1G83 A;  2B8A A;  2RJE A;  5LL6 S;  3C12 A;  5GAM j;  2QA4 T;  5GMK j;  1WHJ A;  1NEB A;  2YWW A;  4PJO G;  1QWF A;  3VRY A;  4RCB A;  2DL4 A;  2KMT A;  5GAN e;  1VQO Q;  1K4U S;  3G6E T;  1B7Y B;  5GAN 4;  2DER A;  1G5I A;  3CC7 Q;  1N8R C;  2JTM A;  4KH1 B;  2CT4 A;  4XTZ A;  1RIQ A;  4DQ2 A;  2OTL T;  3HHT B;  2RHI A;  5I11 A;  2X3W D;  2VGM A;  1SHF A;  1XTD A;  5KE3 A;  2LT4 A;  1Y71 A;  4IUT A;  3QUI A;  4HT4 A;  1YJ9 A;  5GAO m;  4E2F B;  4M7A C;  3L1A A;  4C8Q F;  1N8R R;  2HSE B;  4M75 E;  1JXO A;  4QQ6 A;  3PTA A;  3CCV T;  3CC2 A;  3VYH B;  3VYG A;  2BKD N;  4G85 A;  4QQG A;  5ECA A;  5CAI A;  2SRC A;  3VS1 A;  2X4Y A;  3M55 A;  4IUU A;  2ZNJ A;  4ME7 A;  1VQK A;  4ANJ A;  3LGL A;  1BYM A;  1USY A;  1BIA A;  3LH0 A;  4ZTF A;  4F7U A;  2CS7 A;  2LCC A;  2CH4 A;  2D0Q B;  2KXD A;  1SPK A;  5I2M A;  3CCU Q;  1GBR A;  1YBY A;  2KYM A;  2XHC A;  3TEG A;  2VGN A;  4BE2 A;  4ZGE B;  2EJ9 A;  2EYZ A;  1WLE A;  2M16 A;  1EZZ B;  5A0L A;  2LCL A;  3C95 A;  2QI2 A;  3OB9 A;  2KRO A;  1HC7 A;  2ZZD A;  1M2O A;  2MMP A;  1G51 A;  2JTF A;  2V8I A;  3FDR A;  3P8T A;  2Y4Y A;  2ZTG A;  4YRT A;  1B7Y A;  4DBR A;  2E70 A;  2MYS A;  1OEB A;  3UA7 A;  3RBB B;  5IH2 A;  1C0A A;  4DBF A;  1G3S A;  3TU4 K;  1BI3 A;  4O5V A;  4D8D A;  5HK3 A;  4M78 C;  2QTX A;  4PL6 A;  3EH1 A;  3OW2 P;  3QBY A;  4E47 A;  4OF1 A;  2YUN A;  5IT9 E;  1BBW A;  2C0O A;  3OYY A;  1Q82 C;  4HXJ A;  1WX6 A;  3QSU A;  1I5O B;  4PJL A;  2CZ6 B;  1QVF P;  4B9W A;  4H2S A;  3HY1 A;  2QA4 Q;  1WFW A;  2FPF A;  3CCR T;  3VUZ A;  1X69 A;  5HKC A;  2QDY B;  1GGM A;  2HSP A;  2IIM A;  2QGF B;  3G6E Q;  1NJI C;  2EJF A;  2QQR A;  3EG9 B;  1D09 B;  2ZPE B;  4RTT A;  4DOW A;  4F14 A;  2JS2 A;  2F2V A;  3JB9 G;  2OTL Q;  4PKC C;  4TVA B;  2KRS A;  3MEY A;  4KRT A;  4N0A C;  2MI6 A;  4KH0 B;  1NJI R;  1UDL A;  3G4S T;  1QVG A;  2L89 A;  1HXD A;  1UGP B;  4AG1 C;  1Y7X A;  1LNX A;  2O88 A;  3NFC A;  4LN2 A;  2EGC A;  4AMC A;  3CCV Q;  1VYV A;  3A1P A;  5E3I A;  3S3M A;  2J7I A;  4J83 A;  4EMH A;  4UC4 A;  4D6W A;  2DBM A;  3A98 A;  2FHD A;  2Q7E A;  3FJP A;  1W1F A;  3RKW A;  5LJ3 f;  2EAY A;  4CRI A;  5DLO A;  7AT1 B;  1IZ6 A;  4OLF A;  2JZ2 A;  4PFO A;  4M77 G;  1JEG A;  3VQX A;  1QVG S;  4F7U E;  4J5Y A;  1YNZ A;  3E9G A;  1MMA A;  2K6D A;  1YFN A;  3H0I A;  1AVZ C;  1NYF A;  1EIY B;  4J6W A;  2DQ3 A;  4E51 A;  1SHG A;  2LNH B;  2VXF A;  4OP0 A;  2DXC A;  3REA B;  3IKL A;  2J6O A;  4YRE A;  2XDP A;  4BI8 B;  3OD1 A;  4C92 C;  3TVT A;  1E7O A;  3I55 T;  1V76 A;  2VYT A;  4IUQ A;  1EVK A;  1HSQ A;  2F2W A;  4Z89 A;  4M7A D;  4TVA A;  3M4P A;  1M8M A;  1AWO A;  2BZX A;  1X43 A;  1B8A A;  1VYT A;  1RAD B;  3OQ5 A;  1VQ9 A;  4HVC A;  2LQ8 A;  1VIE A;  2KY9 A;  5KYY B;  2ODR C;  4TQD A;  4PFP A;  1G3Y A;  5LJ5 e;  4XEO A;  1B3Q A;  1IRX A;  3M58 A;  1OZ3 A;  2ZPF B;  1BIB A;  1PRM C;  2E64 A;  2HAX A;  2JUF A;  1WI7 A;  4PK4 A;  2O4X B;  1QCF A;  5FU7 B;  3CCR Q;  2CZ1 B;  2WSC E;  1RAB B;  2CP3 A;  4HWS A;  3P8Y A;  1KMN A;  1WHH A;  1YFT A;  3M59 A;  1WHM A;  3TUP A;  3HL8 A;  3PIP A;  1I1J A;  4PJO C;  3A7R A;  1WJR A;  2HQE A;  5D6W A;  2CDT A;  1ZLM A;  2RHQ B;  1SKU B;  2DL5 A;  1EIY A;  3HXV A;  2V1R A;  3CPW A;  4GLM A;  11AS A;  3OYI A;  2QDL A;  4R56 A;  4XTV A;  1RUW A;  3QWX X;  1WZO A;  3X28 B;  4EIK A;  4JDS A;  4ZTU B;  1KQS P;  4VUB A;  2G4C A;  3X26 B;  2GQI A;  1VQN T;  4M78 D;  2LT1 A;  1NZ9 A;  1O75 A;  1JRI A;  5F5W A;  4KBM B;  4P3P A;  1YGB A;  1YWO A;  3MP6 A;  2LC4 A;  1VQO A;  2ED0 A;  4J9H A;  3OA6 A;  2DD4 A;  4HT9 A;  2L5Q A;  4NS5 A;  1SRM A;  2I4O A;  5GAO r;  3M0U A;  3CC7 A;  3I35 A;  3RKY A;  3L2Q A;  5ELO A;  2P0Q A;  3CPW S;  5EG2 A;  2F69 A;  3VS4 A;  4M75 G;  1VQ6 T;  5KYY A;  4D8K A;  4OMO A;  4RKU E;  2HMA A;  2E5A A;  1GXI E;  2JM8 A;  2YT6 A;  3LH5 A;  5CQX A;  3GOX A;  2V8J A;  4CC7 A;  5GAN 6;  2ZZF A;  2O4X A;  3I56 T;  1ABQ A;  4Z8A A;  4HWO A;  2QYZ A;  2X35 A;  2ATC B;  1BCM A;  2I4N A;  2KT8 A;  1T3S A;  1K8A U;  4WF2 A;  3SEM A;  1G5V A;  4A63 B;  2G3R A;  2K5F A;  3KXT A;  1R0C B;  4LXC A;  1LPL A;  2C8M A;  4PLI A;  3VS2 A;  3E19 A;  2RHQ A;  3LWI A;  3CCU A;  4FW2 A;  2RQW A;  2ZR3 A;  3UGQ A;  2WAC A;  2AHJ B;  4C8Q B;  2DNU A;  2LZ6 B;  4P75 C;  2DRM A;  5LJ3 e;  4M4Z A;  1M1G A;  4CS3 A;  2E5K A;  1WXT A;  3REB B;  4ZN1 A;  1RAE B;  4J9D A;  1K0S A;  4DPG A;  3HFV A;  2AKW A;  5GAO l;  4PLL A;  5GAN j;  2OTJ T;  2ZT5 A;  2DIL A;  2P0P A;  3MF2 A;  1PKT A;  1RAF B;  1EOV A;  2D8J A;  1UJ0 A;  2ZT6 A;  3NET A;  3HXY A;  4TVW A;  2YDL A;  1M2V B;  1VQM A;  1EIF A;  1X55 A;  2KK4 A;  2XIC A;  2IVW A;  3VS0 A;  4E7K A;  4G84 A;  4J9B A;  3P8B B;  4LVK A;  5DLQ E;  3L2R A;  1B70 B;  3NEN A;  1PM3 A;  2J05 A;  4OML A;  1K9A A;  2L2P A;  3VS5 A;  2ZZG A;  4EX5 A;  4C92 D;  1WA7 A;  2YXY A;  4MML A;  2EFI A;  1VQL T;  4KUD K;  3LLR A;  3A32 A;  2QA4 A;  3A8H B;  5LJ3 h;  1M9S A;  3EFO A;  2YSQ A;  1IO6 A;  4HWT A;  1VQN Q;  2RH2 A;  4KR2 A;  2E3I A;  2FL7 A;  4TVR A;  2DXU A;  3G6E A;  4MZM A;  1FXX A;  5HK0 A;  1K73 U;  2ODR D;  5DM7 R;  2VV5 A;  2OTL A;  1NBE B;  3L42 A;  4C8Q A;  3FB9 A;  1M90 C;  3QKJ A;  1QW1 A;  1VQ6 Q;  1ZBJ A;  2GGR A;  4P72 A;  3QPH A;  1OPK A;  2DJQ A;  4FSS A;  1QKX A;  3ME9 A;  3MEW A;  4JS5 A;  2JT4 A;  3MHX A;  2ZPI B;  3M0S A;  4BE1 A;  4O6J A;  3CCV A;  3P8V A;  4TQF A;  4ORZ A;  2BE7 D;  1YN8 A;  3I56 Q;  5GAN 8;  5KYW B;  1M3B A;  2XD0 A;  4M7D C;  4AH6 A;  1ZA1 B;  1V29 B;  3A8G B;  2HL3 A;  4PJO D;  3KBG A;  3LWH A;  4P73 C;  2VC8 A;  3M56 A;  4HVV A;  3OMG A;  1M2V A;  1TH7 A;  1Y0M A;  4K87 A;  5CKE A;  1GBQ A;  4F7U G;  4Z88 A;  2CIM A;  5KNN A;  3CXC P;  3ZFJ A;  1ZSZ A;  1UEC A;  4HCZ A;  1D1B A;  3QZ9 B;  1S72 T;  1QQJ A;  1Y07 A;  1NJ1 A;  1B70 A;  1YFR A;  3HTR A;  1N6A A;  2E6N A;  2DX1 A;  3J80 E;  1ZBX A;  1TTH B;  4CC4 B;  4XTX A;  3OYB A;  3MQZ A;  2DZC A;  2J06 A;  4CH3 A;  1UJY A;  2HQH A;  5J26 A;  4ZIB A;  4LDY A;  3V7R A;  1AWJ A;  1OX8 A;  3R6N A;  2OTJ Q;  2A08 A;  5CKB A;  4BB7 A;  4JZ3 A;  1YWP A;  1V1C A;  3QYH B;  4NL2 A;  1YHQ T;  4OGE A;  3GNG A;  2CYZ B;  1PHT A;  4EMK B;  1E1O A;  1E6H A;  4M7D E;  2K3X A;  4F16 A;  3UWN A;  2VVK A;  1NPP A;  3V7C A;  4NCX A;  3DLM A;  2HDA A;  2E41 A;  2KXC A;  3DSQ A;  1Q81 C;  1VQL Q;  1K9M U;  3SWN B;  1YJN T;  5C53 B;  4ZGD B;  1K1Z A;  2F2X A;  1JO8 A;  3UH0 A;  4UPA A;  3JCM V;  3OYJ A;  1Q81 R;  4OVA A;  4MDX A;  4LE9 A;  1RAG B;  4YCW A;  5CVI A;  3BDU A;  2B86 A;  4C8Q E;  3FIF A;  4OMP A;  4WJ3 M;  4YRR A;  2GTO A;  2FRY A;  5GMK m;  4X9D A;  2HD0 A;  2LJ3 A;  4HVU A;  3JCM f;  4WTO B;  4M75 C;  4C0D C;  2K3Y A;  4C5I A;  1U3O A;  4P3O A;  4KUI A;  1PYS B;  3M5A A;  2P4T A;  2RQV A;  2YHT A;  4WJ4 A;  1N5Z A;  4PFZ A;  4E7S A;  4FM4 B;  4YCU A;  4K88 A;  2FO0 A;  1LYL A;  5HY6 A;  3F70 A;  4JUV A;  1VQ7 A;  2LNV A;  4M7A A;  3ASK A;  2PVO B;  1QCN A;  3QHS A;  3BY7 A;  3HP9 A;  3JB9 D;  3N5B B;  1S72 Q;  3BFM A;  3LX7 A;  5LJ5 j;  2NLU A;  3A7U A;  5D7U A;  2LTO A;  3ER0 A;  1B07 A;  4ZGJ B;  2ZCE A;  1KD1 C;  2X4J A;  3SWN A;  3JV3 A;  4RUG A;  4RMO A;  3S3N A;  4J9E A;  2RJD A;  2VKN A;  4X1V A;  4YPF A;  2QHV A;  3OYC A;  3HRS A;  4YRJ A;  1KD1 R;  3L4G A;  2A7Y A;  2XKO C;  3VS7 A;  1YHQ Q;  1ZSG A;  3RR6 A;  3A8L B;  5D6X A;  2V8K A;  2AKK A;  1VQZ A;  4M77 D;  4JJC A;  3L2U A;  4J9F A;  3DLL A;  1NG2 A;  1IRE B;  4M7D D;  2GCX A;  2M0Y A;  1M30 A;  3QYG B;  3CCS T;  3G7Z A;  3HXW A;  1WHK A;  4YRQ A;  1HJD A;  4IUP A;  3GPL A;  1PYS A;  3MEU A;  2RB6 A;  2NWM A;  1ZQ1 A;  1FMW A;  3URG A;  2DF6 A;  2E65 A;  1J5W A;  3PFS A;  3MET A;  4RCC A;  2CJB A;  1BB9 A;  3JRZ A;  2HBW A;  1WJS A;  4XQ3 A;  2O2O A;  2RHX A;  2QQS A;  2L3Q A;  1BK2 A;  2PTK A;  1BKB A;  1VQN A;  2FPD A;  1MV0 B;  2EBP A;  1O9S A;  1OX9 A;  2JXB A;  4LVM A;  2Y90 A;  2DIG A;  4N0A A;  3E9H A;  5LJ3 g;  4Z02 A;  4RDX A;  2KT1 A;  1WXU A;  3QXE B;  4NOY A;  4RTZ A;  5I22 A;  3H6Z A;  5FRM A;  3CEY A;  3PT9 A;  1KIK A;  1KOG A;  4KGZ B;  1G2B A;  2AIR B;  1VQ4 T;  1KC8 U;  2CZ7 B;  2FRW A;  2O9S A;  1EFN A;  5C52 B;  5LJ3 j;  1USY C;  2L3P A;  3M53 A;  2QG9 B;  3JB9 I;  3OS1 A;  1VQ6 A;  2E4H A;  1KHC A;  4KGV B;  2EL9 A;  4BY6 B;  2EKH A;  3OYL A;  3KFV A;  2H3E B;  2MIO A;  3GF5 A;  1BU1 A;  1OU9 A;  2K9G A;  4IUV A;  3I56 A;  3THK A;  1Y57 A;  4L87 A;  4CC3 A;  1G8X A;  1MMD A;  5CKF A;  5IXB A;  2KYB A;  5CQY A;  4J7I A;  1HK9 A;  4XAX B;  4C5E A;  1UGQ B;  4A4E A;  4EPC A;  2K4Y A;  6AT1 B;  2SEM A;  3M9Q A;  1TUG B;  3HFZ B;  8ATC B;  3JB9 H;  4YRP A;  3CCM T;  3FLG A;  1H8K A;  1UGS B;  3TSW A;  2QEX T;  2XID A;  4XK8 E;  2DU5 A;  1PSF A;  2RHZ A;  3VQY A;  1VQP T;  1JQQ A;  3KUF A;  4ZN3 A;  4M75 D;  3CCJ T;  1M1K U;  3QO5 A;  4P74 A;  2FYK A;  4RG2 A;  1PG5 B;  4C92 A;  2L0A A;  3C94 A;  3V8L A;  3CCS Q;  1AT1 B;  1QVP A;  1UFF A;  2RQR A;  4QVC A;  2OTJ A;  4JLI A;  4DBH A;  3GIB A;  1PD1 A;  3JCM W;  2YUP A;  5A0D A;  1W2B A;  3MEA A;  2ZGW A;  4M7A F;  2MWP A;  1VQ5 T;  2EPD A;  2XDD A;  4M7D G;  3S3O A;  1VUB A;  4O2D A;  3LC0 A;  1RLP C;  2KRM A;  3IKM B;  1TS9 A;  4AFU C;  2HKN A;  2EQJ A;  2KVQ G;  2DRK A;  1P92 A;  2CZ0 B;  3OYK A;  1ADJ A;  3O5Z A;  1NJ2 A;  2YLC A;  2DKG A;  1K73 R;  1AWW A;  2OJ2 A;  1UTI A;  3JCM h;  4DOV A;  4P5N A;  1SEM A;  2D9T A;  1RAC B;  1W2B S;  1VQL A;  1KG1 A;  5CR2 A;  4KR3 A;  2X3X D;  4PJO A;  3FEO A;  1YP5 A;  2C0I A;  3HFZ A;  3UAT A;  4KQE A;  4C8Q G;  1M3A A;  3R07 A;  2CT3 A;  5KE2 A;  2ZT8 A;  2M51 A;  3DB3 A;  1YJ9 T;  1VQ4 Q;  2P0K A;  2O31 A;  4ELZ C;  2ARS A;  2V26 A;  4XTY A;  1ZUU A;  4LDV A;  1ZX6 A;  4YP0 A;  3RIR A;  1Q95 G;  2DTO A;  3MCA B;  2M9U A;  3J81 E;  1BBU A;  1GRI A;  4E7H A;  2DXT A;  4HCK A;  3JCM d;  4M78 F;  4CI0 C;  3JCM X;  3FJ5 A;  5FLX E;  2FZC B;  1VQK T;  2Q7G A;  1Q7Y C;  3EFR A;  1I4K 1;  2CH4 W;  3M0P A;  4FYV B;  3PMT A;  1X01 A;  5AYF A;  4YRO A;  1WLP B;  4JRI A;  3QII A;  2EQI A;  3NTI A;  3G4S Q;  3CCM Q;  1Q7Y R;  2DPP B;  1BBZ A;  2QEX Q;  2KNB B;  2R58 A;  1GFD A;  2CJA A;  2GBQ A;  1S72 A;  1KHI A;  1PRL C;  3RMQ A;  2FPE A;  1OYX A;  2DK3 A;  2OAW A;  1VQP Q;  4E7J A;  3CCJ Q;  2CUD A;  2AKW B;  3AHU A;  3PE0 A;  4L5G A;  1M5Q 1;  1WXB A;  2MAM A;  4HKE A;  1JU5 C;  1M8V A;  4YRI A;  5GAN 7;  4H2X A;  1YB3 A;  1FMK A;  3RAC A;  3W3S A;  1IGQ A;  5FU6 B;  4DA4 A;  4CS2 A;  1SER A;  2PNI A;  1QMC A;  4IIM A;  1Q86 C;  4J8O A;  1W6X A;  1R0B G;  1WJQ A;  2ZNI A;  1XJW B;  2L3S A;  2BUD A;  5FWB A;  1TXQ A;  2EKO A;  3EG2 A;  4JJB A;  3I5S A;  1VQ5 Q;  1OZ2 A;  5GMK h;  1YHQ A;  1TG0 A;  3JCM Q;  3EHR A;  3CD6 T;  1Q86 R;  1D0X A;  2DL8 A;  4XU1 A;  1XOV A;  2NUZ A;  3MO8 A;  4C0F A;  2RM4 A;  5GAN 3;  2RA2 A;  4AFZ C;  4HCC A;  4M77 B;  1NJ8 A;  4BWA A;  5FRN A;  5D6Y A;  4K11 A;  2C7I A;  3OW2 A;  1M1F A;  1I8F A;  3EG3 A;  4QVZ A;  4C0Z A;  1U1T A;  3EFO B;  1BCO A;  1Z7M A;  3I55 Q;  4II1 A;  2DYB A;  2R57 A;  3OYA A;  4PJM A;  1D0Y A;  2ED1 A;  4LDX A;  2ZPG B;  3M0Q A;  4QVD A;  2VWF A;  5CCA A;  4MZP A;  2HEQ A;  3HTZ A;  5K1X A;  5GJV B;  2LDM A;  1ACM B;  3HKS A;  1QVF A;  2Q5H A;  5J3B A;  2LX7 A;  4A54 A;  4KUL A;  3VJP A;  1X6O A;  3OSS C;  1QF6 A;  2LJ1 A;  3OW2 S;  3BJU A;  4Y91 A;  3A31 A;  1ZA2 B;  4C92 F;  5KYN A;  2RI2 A;  3G71 T;  5KCO A;  4ELY C;  1Q82 U;  1NM7 A;  3JCM P;  3HRT A; 
#chains in the Genus database with same CATH homology
 1QVF S;  3LGF A;  4CH5 A;  1FX7 A;  3OYG A;  4X5O A;  2E1H A;  2NS6 A;  5FU7 C;  2LRQ A;  5IN1 A;  5GAO n;  1JJC A;  4CH6 A;  1IL2 A;  4NL3 A;  4M77 A;  3OBW A;  2K2V A;  1QE0 A;  2A8E A;  3VKI A;  3OYE A;  2ZZE A;  3RF1 A;  4PJO F;  2ZIM A;  4JJN K;  3GLX A;  4OB0 B;  2RJC A;  1H3Z A;  3QNE A;  5A0G A;  2XU8 A;  5GAN 5;  2I2L A;  3E9I A;  4GLK A;  2DTH A;  3PNW C;  5GAN f;  1QP3 A;  1VQ8 T;  2QHS A;  1WQW A;  3VBB A;  4L59 A;  3M4Q A;  3CCS A;  3V8J A;  3IG2 A;  2F5K A;  3SB2 A;  2E5Q A;  4PNO A;  1Y96 B;  2DAQ A;  3Q1J A;  3OYH A;  4PG3 A;  4YCV A;  5I21 A;  3VQW A;  4IUR A;  1MHN A;  3S6W A;  4XU0 A;  3CMQ A;  3TCJ A;  1X54 A;  3H8Z A;  4LVL A;  5GMK i;  2ZR2 A;  1LJO A;  3RES A;  4C8Q C;  4L6V 5;  5M9O A;  3REX A;  3JCM g;  3CCQ T;  3HPW A;  2CGH A;  1AHJ B;  2J3M A;  4M7A B;  4Q6G A;  3CC7 T;  1KQS A;  2PQW A;  4YRK A;  3NEM A;  2I4L A;  1N9R A;  4C0G A;  2ZIO A;  3GP8 A;  1VQ4 A;  4M75 A;  3OS5 A;  2PVG B;  3CCR A;  4CS4 A;  3ZEH A;  3PZC A;  1Y96 A;  1KQS S;  4X9C A;  3DKM A;  3A8O B;  4B9X A;  3L4G B;  2XGT A;  4Y28 E;  4YRM A;  2IY5 B;  2ART A;  3LSS A;  1BI1 A;  1ZHI A;  4HA8 A;  4HT8 A;  1YJW T;  2WSF E;  4A4F A;  2DZ9 A;  2LVM A;  1WU7 A;  3JB9 F;  4OB3 B;  3G4S A;  3CCM A;  2QEX A;  2EQM A;  3OYN A;  5GAO q;  2H3J A;  1YI2 T;  1YCY A;  4N4I A;  1VQP A;  1H4S A;  3CCJ A;  3TEH A;  4J15 A;  3HXX A;  4C5G A;  1UEB A;  4M78 B;  3G1Z A;  2A3L A;  3CC4 T;  5KH6 A;  2EQU A;  2D6F A;  1OI1 A;  2P0L A;  1VQM T;  1KMM A;  4P71 C;  2JOY A;  4M77 F;  3ICA A;  1PSE A;  4Q15 A;  2JNG A;  2DTI A;  4A53 A;  3KFU A;  1XQH A;  2M1H A;  3CME T;  2R5A A;  1H4Q A;  2PUO B;  3PGG A;  2J3L A;  2CJ9 A;  3I55 A;  2IY5 A;  1L0W A;  2K57 A;  4YRG A;  3A5Z B;  3CCE T;  1X2H A;  3QO3 A;  2K5I A;  1LOJ A;  3FRN A;  4BAC A;  2HBP A;  1B34 A;  2EQK A;  3HRU A;  5GAN 2;  3V7S A;  1H64 1;  2XI9 A;  3OMC A;  2JVV A;  4HCB A;  2RHY A;  3TEE A;  4EMK C;  4PHC A;  5C0M A;  4M78 A;  1EQR A;  4HWP A;  4X34 A;  3CMA T;  2RK2 A;  2HNI A;  3EAE A;  1YIT T;  4GY5 A;  1M4Z A;  3V8K A;  2QQ9 A;  3A74 A;  1WGS A;  3JB9 J;  1KQ1 A;  4YYE A;  2DD5 A;  1H4V B;  3SWN C;  2PMF A;  5GAM f;  5LJ5 f;  2DXB A;  3UT1 A;  3RMS A;  2I4M A;  3GNF B;  4ZTZ B;  3CBO A;  2QQB A;  5GAN h;  1I5L A;  1NPR A;  4C8Q D;  4LNS A;  2E3C A;  3HRI A;  4H2W A;  3FC3 A;  4RQE A;  3DB4 A;  4C92 B;  1WNL A;  3HRK A;  3CXC A;  1K8A C;  4K86 A;  3JAM E;  1M90 U;  1G5H A;  3L2W A;  5A2Q E;  3HXZ A;  4JRK A;  1U8R A;  1D3B B;  3RKX A;  5CO7 A;  2QXF A;  4BW9 A;  4N4H A;  4TWA A;  2ZPB B;  1YFS A;  3A5Z A;  4M7A E;  2K5L A;  3E9F A;  3JSC A;  4H2V A;  3QJ6 A;  3CXC S;  2GQV A;  5IAY A;  3TRE A;  4BD3 A;  4M75 F;  3CD6 A;  2RHU A;  5GAN d;  2GFA A;  1YIJ T;  2L8D A;  4OGC A;  2GFU A;  4YRN A;  3QZ5 B;  3LW5 E;  3A7A A;  4RMF A;  3WVD B;  4PJO B;  2XG8 D;  3I7F A;  3SD4 A;  2BIV A;  3VU3 C;  3JCM e;  3O8V A;  4MMK A;  4C5H A;  3HSB A;  2E12 A;  4QQD A;  3CCL T;  1N27 A;  4YTL A;  3QO7 A;  2E6Z A;  2ZXF A;  3UGT A;  3C4S A;  1DJ7 B;  4OB1 B;  3MEV A;  3LYI A;  1SET A;  1D3B A;  4OMF B;  1X75 C;  4M78 E;  4XTU A;  1EVL A;  3G71 A;  1K73 C;  4H2Y A;  2RJF A;  3JCM c;  4J6X A;  3WQZ A;  1Q81 U;  3OYM A;  1NE8 A;  3M57 A;  2PVD B;  1VQ7 T;  3OS2 A;  2L3R A;  4FT4 A;  3INZ A;  2RHS B;  3OYF A;  3A5Y A;  4XU2 A;  1FWZ A;  3MP8 A;  3RGL A;  2RD1 A;  4H2X B;  5GAO p;  1XNI A;  2HQX A;  3WXM B;  4UP8 A;  2WSE E;  5C51 B;  4A4G A;  1NYR A;  2Y4X A;  1QP2 A;  4P74 C;  4XTW A;  3R6O A;  2R5M A;  3BDL A;  3QDR B;  4YDQ A;  2E10 A;  4J6Y A;  2M0O A;  3CC2 T;  2QQA A;  3OS0 A;  4Q5W A;  4BUG A;  3LSQ A;  3BW1 A;  5GAM e;  5GMK e;  1VQ8 A;  2DIQ A;  3NEL A;  4BI4 A;  4BDY A;  2PUK B;  4BY6 C;  1KD1 U;  3NTK A;  5CIU A;  3MF1 A;  5K1P A;  2Q5I A;  1N8R U;  2RHS A;  4MZT A;  4F7U F;  3QG1 A;  3A8M B;  5DY9 A;  3SFM A;  1G3W A;  1B76 A;  4J7F A;  5J39 A;  4BE0 A;  5I2S A;  1K9M C;  4YRF A;  2QHT A;  5C6S A;  4C92 E;  4YRS A;  1JBM A;  3X25 B;  3ERR A;  4YRL A;  5GMK l;  3T9N A;  4FSX A;  3PCO B;  4E7L A;  3JCM J;  4LDU A;  4QW2 A;  4P75 A;  5GAM h;  3CCQ A;  4TVY A;  3NTH A;  5LJ5 h;  3JCM b;  1EFW A;  1SES A;  1JJC B;  3X24 B;  3HXU A;  1NJ5 A;  3CBP A;  3MP1 A;  4BDZ A;  4RG8 A;  3L2V A;  3CBM A;  4FL6 A;  2DVE A;  4M7D B;  1RI0 A;  2KSS A;  4HWR A;  1U1S A;  3HFO A;  4FT2 A;  1JB0 E;  3M4Y A;  2XDB A;  1SRY A;  1R8O B;  2XK0 A;  1YJN A;  3HFN A;  4PJO E;  3REU A;  4N4G A;  1WPY A;  2EJG A;  1FYF A;  4V2S A;  1WQ7 A;  4XU3 A;  2ZIN A;  3OYD A;  5GAM d;  5LJ5 d;  4ZTJ A;  4RQF A;  1YJW A;  4CH4 A;  2ARU A;  3IAL A;  4JLG A;  3J7A F;  5GAN g;  1HTT A;  1YI2 A;  2RI5 A;  1E1T A;  1NYQ A;  3PCO A;  2LX9 A;  3RUX A;  5CKD A;  2ZPH B;  3SDZ A;  4M7A G;  2GF7 A;  5CKH A;  1H4T A;  4UP7 A;  3UDC A;  2RO0 A;  3CC4 A;  3L2Z A;  1NJI U;  1MGQ A;  2O01 E;  1BI2 A;  4LD9 K;  2EWN A;  4M7D A;  1ATI A;  2PME A;  3VUB A;  4JS4 A;  1Z7N A;  4P73 A;  4OB2 B;  2JN0 A;  1JJ2 A;  4JRQ A;  3CME A;  3RER A;  2DO3 A;  2LQK A;  4IKF A;  5FU6 C;  2VXE A;  2FVU A;  1VQ9 T;  2QHU A;  1VIF A;  3CCE A;  1N9W A;  4FU6 A;  4A4H A;  2RK1 A;  1NNH A;  4M75 B;  1JJ2 S;  4C0D B;  4A4K A;  4M78 G;  2Q7H A;  5CK9 A;  2AMC B;  4LVJ A;  2KDS A;  4BI3 A;  4R55 A;  4M77 C;  2MWO A;  3CMA A;  2X4W A;  2YLB A;  1KC8 C;  1YIT A;  2VUB A;  2XTI A;  4UP9 A;  5LJ3 d;  4ATO A;  3HY0 A;  3OSV A;  2ALY B;  3EFS A;  5HGQ A;  1ADY A;  4KT0 E;  3TEH B;  3OY9 A;  4LVI A;  1W4S A;  4P72 C;  5ELN A;  4H2U A;  1VQO T;  2P5I A;  4MDW A;  1RL2 A;  2ZCF B;  4E7I A;  2IG0 A;  4XEM A;  3QTC A;  1ASZ A;  4H02 A;  5KCH A;  2ZT7 A;  1SSF A;  1M1K C;  4TTV A;  2MF2 A;  1Q7Y U;  3E1S A;  3P8D A;  3QJY A;  4M77 E;  5L8R E;  1E22 A;  1NJ6 A;  1X2G A;  2DDZ A;  4WI1 A;  3VQV A;  2PU9 B;  2CKK A;  2X4X A;  4YRC A;  3QO8 A;  2AMC A;  4JRP A;  3X20 B;  1YIJ A;  2YRV A;  4P3N A;  1UB4 A;  4P71 A;  4H2T A;  1KQ2 A;  2DEQ A;  4EO4 A;  1UGR B;  2OAU A;  4EDU A;  3CCU T;  3M4G A;  2C06 A;  3UFG A;  1B34 B;  1Q86 U;  3P8H A;  2DQ0 A;  3RL6 A;  1W66 A;  2ALY A;  4C92 G;  3UPU A;  3CCL A;  1WYD A;  1N9S A;  5FRO A;  2KQW A;  3VV0 A;  3PIO A;  4FIB A;  1ASY A;  2KAF A;  2EYQ A;  1X56 A;  1G3T A;  4LD6 A;  2DU7 A;  1I81 A;  12AS A;  2FB7 A;  1VQ5 A;  2EIF A;  3WVE B;  3PMI A;  3OBY A;  4F7U B;  3ZBD A;  4EMG A;  2RI3 A;  3CPF A;  1E24 A;  2F5T X;  5GAM g;  4EMK A;  4M7D F;  5LJ5 g;  1BI0 A;  3M54 A;  2DJZ A;  4LDW A;  2B8A A;  2RJE A;  5LL6 S;  3C12 A;  2QA4 T;  5GAM j;  5GMK j;  4PJO G;  4RCB A;  2KMT A;  5GAN e;  3G6E T;  1B7Y B;  5GAN 4;  1G5I A;  1N8R C;  2JTM A;  4XTZ A;  1RIQ A;  4DQ2 A;  2OTL T;  3HHT B;  2RHI A;  2VGM A;  1XTD A;  5KE3 A;  2LT4 A;  1Y71 A;  4IUT A;  3QUI A;  4HT4 A;  1YJ9 A;  5GAO m;  4M7A C;  3L1A A;  4C8Q F;  4M75 E;  4QQ6 A;  3PTA A;  3CCV T;  3CC2 A;  3VYH B;  3VYG A;  2BKD N;  4G85 A;  4QQG A;  5CAI A;  2X4Y A;  3M55 A;  4IUU A;  2ZNJ A;  4ME7 A;  1VQK A;  3LGL A;  1BYM A;  1USY A;  1BIA A;  3LH0 A;  4ZTF A;  4F7U A;  2CS7 A;  2LCC A;  2D0Q B;  5I2M A;  1YBY A;  2XHC A;  3TEG A;  4BE2 A;  2VGN A;  4ZGE B;  2EJ9 A;  1WLE A;  2M16 A;  5A0L A;  2LCL A;  3C95 A;  2QI2 A;  3OB9 A;  1HC7 A;  2ZZD A;  2MMP A;  1G51 A;  2JTF A;  2V8I A;  3FDR A;  3P8T A;  2Y4Y A;  2ZTG A;  4YRT A;  1B7Y A;  2E70 A;  1C0A A;  1G3S A;  3TU4 K;  1BI3 A;  4O5V A;  5HK3 A;  4M78 C;  2QTX A;  4PL6 A;  3QBY A;  4E47 A;  4OF1 A;  5IT9 E;  1BBW A;  3OYY A;  1Q82 C;  3QSU A;  2CZ6 B;  4B9W A;  4H2S A;  3HY1 A;  3CCR T;  3VUZ A;  5HKC A;  2QDY B;  1GGM A;  1NJI C;  2EJF A;  2QQR A;  2ZPE B;  4DOW A;  3JB9 G;  4PKC C;  4TVA B;  3MEY A;  4N0A C;  2MI6 A;  3G4S T;  1QVG A;  2L89 A;  1HXD A;  1UGP B;  1Y7X A;  1LNX A;  3NFC A;  5E3I A;  3S3M A;  4J83 A;  4EMH A;  4UC4 A;  4D6W A;  2FHD A;  2Q7E A;  3FJP A;  3RKW A;  5LJ3 f;  2EAY A;  4CRI A;  5DLO A;  1IZ6 A;  4OLF A;  2JZ2 A;  4M77 G;  3VQX A;  1QVG S;  4F7U E;  4J5Y A;  3E9G A;  1EIY B;  4J6W A;  2DQ3 A;  4E51 A;  2VXF A;  4OP0 A;  2DXC A;  3IKL A;  4YRE A;  2XDP A;  4BI8 B;  3OD1 A;  4C92 C;  3I55 T;  2VYT A;  4IUQ A;  1EVK A;  4M7A D;  4TVA A;  3M4P A;  1B8A A;  3OQ5 A;  1VQ9 A;  4HVC A;  2LQ8 A;  1VIE A;  2KY9 A;  2ODR C;  4TQD A;  1G3Y A;  5LJ5 e;  4XEO A;  3M58 A;  1OZ3 A;  2ZPF B;  1BIB A;  2E64 A;  2HAX A;  2JUF A;  2O4X B;  5FU7 B;  2CZ1 B;  2WSC E;  4HWS A;  3P8Y A;  1KMN A;  1YFT A;  3M59 A;  3TUP A;  3HL8 A;  3PIP A;  4PJO C;  3A7R A;  1WJR A;  2HQE A;  5D6W A;  2RHQ B;  1EIY A;  3HXV A;  3CPW A;  11AS A;  3OYI A;  4R56 A;  4XTV A;  3X28 B;  4JDS A;  4ZTU B;  4VUB A;  2G4C A;  3X26 B;  1VQN T;  4M78 D;  2LT1 A;  1NZ9 A;  1O75 A;  1JRI A;  5F5W A;  4KBM B;  4P3P A;  1YGB A;  3MP6 A;  2LC4 A;  1VQO A;  3OA6 A;  2DD4 A;  4HT9 A;  2L5Q A;  4NS5 A;  2I4O A;  5GAO r;  3CC7 A;  3RKY A;  3L2Q A;  5ELO A;  2P0Q A;  3CPW S;  5EG2 A;  2F69 A;  4M75 G;  1VQ6 T;  4RKU E;  2E5A A;  1GXI E;  5CQX A;  3GOX A;  2V8J A;  5GAN 6;  2ZZF A;  2O4X A;  3I56 T;  4HWO A;  2X35 A;  2I4N A;  1K8A U;  4WF2 A;  1G5V A;  2G3R A;  2K5F A;  3KXT A;  2C8M A;  4PLI A;  3E19 A;  2RHQ A;  3LWI A;  3CCU A;  2ZR3 A;  3UGQ A;  2WAC A;  2AHJ B;  4C8Q B;  4P75 C;  5LJ3 e;  1M1G A;  4CS3 A;  4ZN1 A;  4DPG A;  3HFV A;  2AKW A;  5GAO l;  4PLL A;  5GAN j;  2OTJ T;  2ZT5 A;  2P0P A;  3MF2 A;  1EOV A;  2ZT6 A;  3NET A;  3HXY A;  4TVW A;  1VQM A;  1EIF A;  1X55 A;  2KK4 A;  2XIC A;  2IVW A;  4E7K A;  4G84 A;  3P8B B;  4LVK A;  5DLQ E;  3L2R A;  1B70 B;  3NEN A;  2ZZG A;  4EX5 A;  4C92 D;  4MML A;  2EFI A;  1VQL T;  4KUD K;  3LLR A;  3A32 A;  2QA4 A;  3A8H B;  5LJ3 h;  1M9S A;  4HWT A;  2RH2 A;  4KR2 A;  2FL7 A;  4TVR A;  2DXU A;  3G6E A;  4MZM A;  1FXX A;  5HK0 A;  1K73 U;  2ODR D;  5DM7 R;  2VV5 A;  2OTL A;  3L42 A;  4C8Q A;  3FB9 A;  1M90 C;  3QKJ A;  1QW1 A;  4P72 A;  3QPH A;  3ME9 A;  3MEW A;  4JS5 A;  3MHX A;  2ZPI B;  4BE1 A;  4O6J A;  3CCV A;  3P8V A;  4TQF A;  5GAN 8;  2XD0 A;  4AH6 A;  4M7D C;  1V29 B;  3A8G B;  4PJO D;  4P73 C;  3KBG A;  3LWH A;  2VC8 A;  3M56 A;  3OMG A;  1TH7 A;  4K87 A;  5CKE A;  4F7U G;  2CIM A;  5KNN A;  3ZFJ A;  4HCZ A;  3QZ9 B;  1S72 T;  1Y07 A;  1NJ1 A;  1YFR A;  1B70 A;  1N6A A;  2E6N A;  3J80 E;  1ZBX A;  4XTX A;  3OYB A;  3MQZ A;  2DZC A;  4CH3 A;  5J26 A;  4ZIB A;  4LDY A;  3V7R A;  4BB7 A;  5CKB A;  3QYH B;  4NL2 A;  1YHQ T;  4OGE A;  3GNG A;  2CYZ B;  4EMK B;  1E1O A;  4M7D E;  2K3X A;  3UWN A;  3V7C A;  1NPP A;  4NCX A;  3DLM A;  2E41 A;  3DSQ A;  1Q81 C;  1K9M U;  3SWN B;  1YJN T;  5C53 B;  4ZGD B;  3UH0 A;  4UPA A;  3JCM V;  3OYJ A;  4OVA A;  4MDX A;  4YCW A;  5CVI A;  3BDU A;  4C8Q E;  3FIF A;  4WJ3 M;  4YRR A;  5GMK m;  4X9D A;  2HD0 A;  3JCM f;  4M75 C;  4C0D C;  2K3Y A;  4C5I A;  4P3O A;  4KUI A;  1PYS B;  3M5A A;  2P4T A;  2YHT A;  4WJ4 A;  4YCU A;  4FM4 B;  4K88 A;  1LYL A;  5HY6 A;  3F70 A;  4JUV A;  1VQ7 A;  2LNV A;  4M7A A;  3ASK A;  2PVO B;  3QHS A;  3BY7 A;  3HP9 A;  3JB9 D;  3N5B B;  3BFM A;  3LX7 A;  5LJ5 j;  2NLU A;  3A7U A;  2LTO A;  3ER0 A;  4ZGJ B;  2ZCE A;  1KD1 C;  2X4J A;  3SWN A;  4RMO A;  3S3N A;  2RJD A;  4YPF A;  2QHV A;  3OYC A;  3HRS A;  4YRJ A;  3L4G A;  2A7Y A;  2XKO C;  3A8L B;  5D6X A;  2V8K A;  1VQZ A;  4M77 D;  3L2U A;  3DLL A;  1IRE B;  4M7D D;  2GCX A;  3QYG B;  3CCS T;  3G7Z A;  3HXW A;  4YRQ A;  4IUP A;  3GPL A;  1PYS A;  3MEU A;  2RB6 A;  1ZQ1 A;  3URG A;  2E65 A;  1J5W A;  3PFS A;  3MET A;  4RCC A;  2CJB A;  3JRZ A;  1WJS A;  4XQ3 A;  2RHX A;  2QQS A;  1BKB A;  1VQN A;  1O9S A;  4LVM A;  2Y90 A;  2DIG A;  4N0A A;  3E9H A;  5LJ3 g;  4Z02 A;  4RDX A;  3QXE B;  4NOY A;  3H6Z A;  5FRM A;  3CEY A;  3PT9 A;  1KOG A;  1VQ4 T;  1KC8 U;  2CZ7 B;  5C52 B;  5LJ3 j;  1USY C;  3M53 A;  3JB9 I;  3OS1 A;  1VQ6 A;  1KHC A;  2EL9 A;  4BY6 B;  3OYL A;  3GF5 A;  4IUV A;  3I56 A;  4L87 A;  5CKF A;  5CQY A;  4J7I A;  1HK9 A;  4XAX B;  4C5E A;  1UGQ B;  4A4E A;  4EPC A;  2K4Y A;  3M9Q A;  3HFZ B;  3JB9 H;  4YRP A;  3CCM T;  3FLG A;  1UGS B;  2QEX T;  2XID A;  4XK8 E;  2DU5 A;  1PSF A;  2RHZ A;  3VQY A;  1VQP T;  3KUF A;  4ZN3 A;  4M75 D;  3CCJ T;  1M1K U;  3QO5 A;  4P74 A;  2FYK A;  4RG2 A;  4C92 A;  3C94 A;  3V8L A;  1QVP A;  4QVC A;  2OTJ A;  4JLI A;  3GIB A;  3JCM W;  5A0D A;  1W2B A;  3MEA A;  4M7A F;  2ZGW A;  2MWP A;  1VQ5 T;  2XDD A;  4M7D G;  3S3O A;  1VUB A;  4O2D A;  3LC0 A;  3IKM B;  2EQJ A;  2KVQ G;  1P92 A;  2CZ0 B;  3OYK A;  1ADJ A;  1NJ2 A;  2YLC A;  2DKG A;  3JCM h;  4DOV A;  4P5N A;  2D9T A;  1W2B S;  1VQL A;  1KG1 A;  5CR2 A;  4KR3 A;  4PJO A;  3FEO A;  3HFZ A;  4KQE A;  4C8Q G;  3R07 A;  5KE2 A;  2ZT8 A;  3DB3 A;  1YJ9 T;  2P0K A;  4ELZ C;  2ARS A;  4XTY A;  4LDV A;  4YP0 A;  3RIR A;  2DTO A;  3MCA B;  2M9U A;  3J81 E;  1BBU A;  4E7H A;  2DXT A;  3JCM d;  4M78 F;  4CI0 C;  3JCM X;  5FLX E;  1VQK T;  2Q7G A;  1Q7Y C;  3EFR A;  1I4K 1;  3PMT A;  1X01 A;  5AYF A;  4YRO A;  4JRI A;  3QII A;  3NTI A;  2DPP B;  2R58 A;  2CJA A;  1S72 A;  1KHI A;  3RMQ A;  1OYX A;  2DK3 A;  4E7J A;  2AKW B;  3AHU A;  4L5G A;  1M5Q 1;  2MAM A;  4HKE A;  1M8V A;  4YRI A;  5GAN 7;  4H2X A;  1YB3 A;  3RAC A;  3W3S A;  5FU6 B;  4DA4 A;  4CS2 A;  1SER A;  1Q86 C;  4J8O A;  1WJQ A;  2ZNI A;  2BUD A;  2EKO A;  1OZ2 A;  5GMK h;  1YHQ A;  3JCM Q;  3CD6 T;  4XU1 A;  1XOV A;  3MO8 A;  4C0F A;  2RM4 A;  5GAN 3;  2RA2 A;  4HCC A;  4M77 B;  1NJ8 A;  4BWA A;  5FRN A;  5D6Y A;  2C7I A;  3OW2 A;  1M1F A;  1I8F A;  4QVZ A;  4C0Z A;  1U1T A;  1Z7M A;  4II1 A;  2R57 A;  3OYA A;  4LDX A;  2ZPG B;  4QVD A;  5CCA A;  4MZP A;  3HTZ A;  5K1X A;  2LDM A;  3HKS A;  1QVF A;  2Q5H A;  5J3B A;  4A54 A;  4KUL A;  3VJP A;  1X6O A;  3OSS C;  1QF6 A;  3OW2 S;  3BJU A;  4Y91 A;  3A31 A;  4C92 F;  2RI2 A;  3G71 T;  5KCO A;  4ELY C;  1Q82 U;  3JCM P;  3HRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...