4XTYA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 63 with fluorine in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 94
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtyA01
5CAIA 1B70B 1Y96A 2YLCA 5LJ3h 4YRKA 2I2LA 1EFWA 3EFSA 1JJCA 4C8QG 4PJOA 4M77A 4MMLA 5GAMe 3VU3C 3QO8A 2CJAA 4JRKA 4PJOD 3MEYA 4PJOF 1QF6A 5LJ5j 2I4NA 2AMCA 3HY0A 4YCWA 2ZZGA 2DDZA 4J6XA 3M4GA 3P8YA 1SRYA 3QSUA 4M7AA 1W66A 2C7IA 2CJ9A 3JCMW 4N0AA 4EO4A 4HA8A 4P75C 3HFVA 4JRIA 2ZINA 2DEQA 4YCUA 3LSSA 3DSQA 4G85A 3TEHB 4H2VA 3OD1A 2EL9A 3HY1A 3TEGA 4YREA 3RUXA 1M5Q1 4F7UB 4NL3A 4P74A 5GAN7 4TWAA 1KMMA 2CGHA 2DZ9A 2PMEA 1H641 3IALA 4N0AC 5LJ3d 5GAOq 4G84A 4YP0A 4H2SA 4YRNA 1NNHA 2QHVA 1YCYA 4XTXA 3PCOB 4C8QA 4Y91A 4CH3A 4PJOB 3HXZA 4XU3A 4V2SA 4YRRA 4M75B 4PJOG 4DQ2A 4M77D 4ZIBA 5LJ3j 2K57A 5LJ5g 1EIYA 1H4QA 3JCMQ 2ZIMA 5GMKi 1Z7NA 2Q7HA 3A31A 2ZZEA 5K1PA 2CIMA 3JCMg 2VC8A 3VQXA 3LSQA 1H4VB 3SB2A 2ZIOA 4M7AF 3JCMJ 4YRJA 1KQ2A 1YFSA 2Q7EA 3NELA 5GAMf 4JUVA 1ADJA 4TQFA 2EJ9A 3A7RA 5GANd 2P5IA 3P8TA 3RKXA 2IY5A 4J6WA 1J5WA 1B34B 2DJZA 1WQWA 4XTVA 1HXDA 4M78B 1SESA 1I81A 3V8JA 2I4LA 1E24A 3QO7A 2RM4A 1B8AA 2ARTA 2ZT5A 2YLBA 1X2GA 2DQ3A 4P73A 4ZTUB 1JRIA 2FYKA 3HTZA 4YDQA 1L0WA 3JCMP 2DTIA 4ZTZB 2DXUA 2AKWB 1QE0A 1H4TA 3A5ZA 4C8QB 4OP0A 5KNNA 4EMGA 2ZXFA 3A74A 1NJ8A 4EX5A 4XU1A 1IL2A 4O2DA 3MF2A 4AH6A 2YHTA 2ZGWA 3JB9I 3JCMd 4C92B 2ARUA 4XTUA 3HFZA 4UPAA 2CJBA 4XTWA 4WJ3M 2QHTA 4NOYA 4PJOC 2DU7A 3HFNA 4M7DD 1E22A 4HWOA 4TVAA 3JCMX 4JLIA 2QHUA 1FYFA 4M7DG 2Q5HA 4C92C 4YYEA 1YGBA 2AKWA 4F7UE 1EVKA 2RD1A 1GGMA 3UGQA 4M78C 1TH7A 4M7AB 2ARSA 3RKYA 3IG2A 4YROA 1B34A 4C92D 4P3OA 4PHCA 3FJPA 1ADYA 2I4MA 3E9HA 4KR2A 3MF1A 5DY9A 2DTOA 4HT8A 3HRIA 4EMHA 2Q5IA 4M77B 4M78F 1I5LA 4C8QE 5GAN2 3JCMb 4EMKB 4YRGA 4H2UA 4M77C 1B70A 3HXUA 1X54A 3HRKA 3R07A 2RHQA 3V7RA 4H2YA 1LOJA 5GAN4 3L1AA 2E65A 3VQYA 4RQFA 3JB9D 1NJ6A 2E3CA 4X9CA 4YRPA 1WNLA 4H2TA 4RDXA 2VXEA 1BBUA 3HFZB 4WJ4A 2J3MA 5GMKh 4KQEA 4M75A 3P8VA 4P74C 1B76A 1N9RA 4XU2A 4M78A 4NL2A 4HT9A 3NETA 3PZCA 5F5WA 1N9WA 1MGQA 3KFUA 3SWNC 2HNIA 4XEMA 5E3IA 2P0LA 5C51B 3A7AA 5C52B 3RESA 4M75C 2ZR2A 3JCMc 1B7YA 3JB9F 3RL6A 4YRSA 3RIRA 1WPYA 5GANh 4XU0A 4M7DE 3PGGA 3QUIA 5LJ3f 2E41A 1NJ2A 4J5YA 4OLFA 4CH6A 1EVLA 4TTVA 3W3SA 1JBMA 3UGTA 3JB9G 2ZT7A 2C8MA 4P3NA 1JJCB 2RB6A 3RACA 2EJFA 1D3BA 3RKWA 2G4CA 4RQEA 3QNEA 3HXVA 3UH0A 5GAN6 3A32A 4M7AC 3WQZA 5C53B 4XQ3A 4C8QD 3IKMB 4M75F 1HC7A 1X56A 1YFRA 4RMFA 4P75A 4F7UG 2DZCA 1LYLA 1USYC 3REXA 4X9DA 1NJ1A 4C8QF 1VQZA 5LJ3e 1NJ5A 4M78E 2ALYA 5GANf 1NYQA 4KR3A 3L2ZA 3PCOA 5GAOp 4H02A 4M77G 1WQ7A 3BJUA 4K88A 4J6YA 1LJOA 4TVAB 5GANj 3HSBA 2ODRD 3BFMA 3NENA 3VQVA 3CMQA 1WLEA 1E1OA 4UP8A 3HFOA 1BBWA 3TEHA 5GAN5 3V7SA 1D3BB 3EFRA 2RHSA 3TUPA 3L4GB 5GAOn 1WU7A 4EMKC 4CS2A 2ALYB 4J15A 3JB9H 3HXYA 3BW1A 5ELNA 1SETA 3RF1A 2ZNIA 4CH5A 3JB9J 5GMKe 3RERA 3V8KA 2ZTGA 4CS3A 1U1TA 4TQDA 5GANe 1USYA 2IY5B 2ZT8A 5GAMg 4A54A 3NEMA 3A7UA 4P71A 4TVWA 3L4GA 4K86A 3HXWA 2DKGA 4YRCA 4MMKA 4NCXA 3REUA 4C92F 4YRQA 3VQWA 4M75E 5ELOA 1I8FA 2RHQB 4YRLA 4PNOA 4C92E 5GMKj 1G5IA 1EOVA 3E9IA 4M7AD 5GAOl 1Y96B 4BW9A 2J3LA 2DVEA 4P73C 2ZZFA 4M78G 3IKLA 4Q15A 4C92G 4RCCA 3JCMe 3QTCA 4M78D 1SERA 4QVDA 1G51A 5GAN3 4P72C 4HWTA 4M75D 4QVCA 5LJ5d 1EIYB 4M7DA 1HTTA 1KOGA 1NYRA 2AMCB 4Q6GA 4HWSA 4C8QC 4XTZA 5GMKm 3VBBA 4M7DF 4P71C 3RGLA 4M7AE 2Y90A 1EQRA 4YRFA 4P72A 1KQ1A 3AHUA 2XGTA 4UP9A 4P3PA 4E51A 2DU5A 4LNSA 4H2WA 3SWNA 3INZA 3V7CA 1BIBA 4M7AG 2DQ0A 2QTXA 2EJGA 1BIAA 1X2HA 3M4PA 2FB7A 1RIQA 3ICAA 4YRIA 1ASZA 4WI1A 1PYSA 1LNXA 3LC0A 2E10A 4XTYA 3HXXA 1WYDA 3BY7A 5LJ5f 2VXFA 4C92A 3JCMh 5GAOr 5HGQA 4L87A 5GAN8 3JCMf 4A53A 4CH4A 4M7DB 2ZR3A 3QO5A 2DXTA 3I7FA 3QHSA 5LJ5h 3SWNB 1YFTA 4DPGA 1H4SA 3QO3A 2DTHA 4M7DC 12ASA 1G5HA 1E1TA 2JN0A 4HVCA 3ERRA 3FB9A 3BDUA 3UFGA 4XEOA 5LJ3g 1ATIA 4YPFA 2PMFA 4X5OA 1X55A 1Z7MA 4H2XA 4PJOE 4EMKA 2I4OA 4M75G 1PYSB 1X01A 1YB3A 4TVYA 2XTIA 4F7UF 2ZT6A 3M4QA 4K87A 4YRMA 1C0AA 3JCMV 2RHSB 5GMKl 1B7YB 1U1SA 4YRTA 1M8VA 3GIBA 5GAMh 5GAMd 4CS4A 2E5AA 2E64A 4M77F 11ASA 2EWNA 5GAOm 4WF2A 4HWPA 3G1ZA 2RA2A 2E1HA 1I4K1 2ODRC 5GAMj 3A5YA 5GANg 5K1XA 1ASYA 3V8LA 4UP7A 2ZNJA 2EAYA 3FIFA 1N9SA 5LJ5e 1KMNA 4RCBA 2ZCEA 2Q7GA 4PG3A 2QHSA 4H2XB 4YCVA 4M77E 1HK9A 4BWAA 4F7UA 5I21A 4HWRA
chains in the Genus database with same CATH superfamily
4Z02A 1YJNT 2YLCA 5LJ3h 1ZUYA 4QW2A 2DL8A 3QWYA 3ER0A 1BK2A 2LRQA 4PJOA 2EQUA 2Y4YA 3VU3C 4JRKA 2GFUA 3MEYA 4PJOF 4PLLA 1QF6A 2AMCA 2COWA 4BE1A 3M4GA 2NUZA 4JJNK 1AOJA 2DILA 2CH4W 3LX7A 3P8YA 5KCOA 2JVVA 2CJ9A 1KD1R 1UGRB 2AKKA 5FWBA 4H2VA 3OD1A 3HY1A 2K2MA 5GAN7 3ZL7C 2PMEA 4G84A 5I2MA 1N8RU 1NNHA 4XTXA 2LX9A 3WXMB 3G4ST 3H0HA 4CH3A 3DLLA 3LYIA 2HSEB 3A1PA 2D1XA 4LVJA 1S1NA 3CCJT 3OYEA 2RF0A 1X2KA 2A37A 2V1QA 3ASKA 2LVMA 2RNAA 5A2QE 5GMKi 1Z7NA 2Q7HA 1AWXA 2LTOA 2CIMA 4N4GA 2IG0A 4OMNA 1FMWA 1GRIA 4M4ZA 1KHCA 4CC2A 1N27A 4DOWA 4GLMA 3MEUA 1KHIA 3BE3A 2RQVA 3GP8A 3CCMT 3CC2A 4JUVA 4TQFA 2J6KA 1GCQC 1VQ7Q 2COZA 3GLXA 1D0XA 2DPPB 1J5WA 3VYGA 1B34B 4OGEA 2YSQA 4XTVA 1HXDA 1VQMA 7AT1B 2OTJQ 1SESA 2XD0A 1QP3A 3OYLA 3QO7A 2X35A 2RM4A 2MMPA 2XHCA 1M3BA 1KK7A 4YDQA 3MPUB 1L0WA 2MWOA 1G8XA 2X4WA 2JS0A 4Q5WA 3CCUT 4F17A 1QE0A 4DBHA 3HRTA 3A74A 1VYTA 2FEIA 2PVGB 2GQIA 5CR2A 3CCST 1GL5A 2ZPFB 2L0AA 1LVKA 3I56T 2ZGWA 1VQ8Q 1GFCA 2DF6A 1QCOA 4IUUA 3FDRA 2ZZDA 2CJBA 1TUGB 2XICA 1Z9QA 3M9QA 4NOYA 2EBPA 1RADB 1S72Q 2J7IA 1SHFA 2DU7A 4BACA 2LQNA 1WHGA 1WIEA 3E9FA 1Q81U 2QGFB 2O01E 8ATCB 2ED0A 2F5KA 3CCJA 5A0GA 3E19A 1YITT 1YGBA 1UTIA 1WHMA 5KH6A 2B8AA 2VGMA 2YDLA 2RD1A 2ZPBB 4M78C 1TH7A 1PSEA 3MEVA 2ARSA 4PLIA 2X4YA 3RKYA 4OB3B 4ZGEB 1WLPB 4LDWA 3ME9A 2RN8A 9ATCB 3FJPA 4JZ4A 1X43A 4A4GA 3HRIA 2Q5IA 3EGXA 3T9NA 1TXQA 4AMCA 3CCSQ 4EMKB 2O4XA 4FT2A 4M77C 2DL3A 3CPFA 5IHIA 3L2RA 1YJWA 3MJXA 3NMZC 2CUBA 1M1KR 3V7RA 4JPBW 1F1BB 2G3RA 1QCNA 4XAXB 5CKDA 4Y92A 1WNLA 2VXEA 4ELYC 2J3MA 1D1AA 4CRIA 3P8VA 3CCEA 2EYQA 2EGCA 2KXDA 4NL2A 4HT9A 1VQLA 3KFUA 1UECA 1QVGA 1X27A 3G71T 3A7AA 5C52B 2HKNA 4M75C 3JCMc 1B7YA 1JXOA 3RIRA 4XU0A 4QKUA 2V1RA 2MK5A 1C6VX 2DYIA 4F7UA 2MI6A 3OYBA 1AD5A 2E41A 4J7IA 4MDXA 2O9SA 2CUDA 2KRSA 1VQ4T 4J5YA 1K76A 2XDPA 2LCSA 4E7IA 3QZ5B 3W3SA 2WACA 4LUEA 2AIRB 3P8HA 4L5GA 4P3NA 2L3QA 1JJCB 3EG0A 2OTJT 2XI9A 4JJDA 1G2BA 1GXIE 3HXVA 2ABLA 2F2XA 5GAN6 1VQ8T 2YUOA 1YWOA 3IKMB 4M75F 1YFRA 3FRNA 3G7ZA 4FL6A 2KEAA 2DZCA 1LYLA 2DYBA 4R56A 1VQZA 1ZHIA 3UWNA 5D7UA 2YXYA 5GANf 1SF9A 4J9CA 3M0RA 2D6FA 4GBQA 2DEUA 4TVAB 1YFNA 4DOVA 2ODRD 2YRDA 4F16A 1YI2T 1FYNA 3EFOA 1Y7XA 3NENA 3VQVA 1ZQ1A 1W6XA 2L89A 1G3WA 1SHGA 2P4TA 4KRTA 2FPEA 4AFUC 2IVWA 1RLQC 4ZGDB 3I55A 1R77A 1YIJQ 2KAFA 2GGRA 4OMLA 2MYSA 1UGVA 2BTTA 4RTTA 2BIVA 1U8RA 2ZPEB 5CIUA 4J9DA 2JXBA 1A0NB 2E12A 1VQ9A 3RF1A 1M1KC 4CH5A 3RERA 4CS3A 1WHKA 4TQDA 3X26B 2O4XB 3I35A 3MP1A 2EYYA 3A7UA 2O31A 1UHCA 2FRWA 2XDDA 3L4GA 4K86A 1UJYA 2CP5A 2DKGA 4NCXA 2FVUA 1W2BA 3VQWA 2DMOA 2A7YA 1M3AA 4ATOA 1G5IA 5DM7R 1M4ZA 4M7AD 2K2VA 1Y96B 2L3RA 3O8VA 2DVEA 2H3EB 5KE2A 2CT4A 1OQKA 3M0SA 3G71Q 2ZZFA 4Q15A 1B07A 4RCCA 3UT1A 3CQTA 2NYSA 3H9NA 2EKOA 1SERA 4QVDA 1G3TA 1N8RC 5GAN3 1P92A 4QVCA 4M7DA 1WHLA 1WHHA 4HWSA 2O2OA 1RAHB 1EQRA 2IPOB 3LH0A 3AHUA 3LGLA 4P3PA 1MHNA 1SKUB 3M0QA 4FW2A 4FM4B 1WDXA 3V7CA 4KH1B 3CCJQ 2R5MA 2HQEA 2EIFA 1Q7YC 1VQ4Q 4IUQA 2DX1A 1O9SA 1ASZA 4WI1A 3REAB 2KR3A 2NLUA 3CC2T 4J9FA 1PYSA 3NHNA 2XIDA 4L6V5 1NJIR 2LJ3A 1M30A 5KYUA 2KNBB 1VQ6T 5GAOr 2PQWA 4ZN1A 2RQWA 2JMAA 2PUOB 5ECAA 2DXTA 1CKBA 3SWNB 2SRCA 2ZPIB 4DPGA 3OA6A 3M53A 5GJVB 4AFSC 4M7DC 2DJQA 3VS5A 1E1TA 1FXXA 3ERRA 1NPRA 2XDBA 2EYWA 1D0ZA 3I9QA 4XEOA 1ATIA 4X5OA 1NEBA 1QCFA 4N4HA 5IN1A 1K0SA 1I1JA 3UDCA 4PJOE 2DD5A 1X01A 5D6YA 5AT1B 5CKEA 4E7ZA 4YRMA 1V1CA 3JCMV 3OYIA 2K5IA 2LQWA 1ACMB 1FWZA 2JOYA 4JJCA 3TSZA 3CCQA 4WF2A 2EW3A 5CCAA 3A98A 2ODRC 5GAMj 5GANg 5K1XA 3V8LA 2JJ9A 1N9SA 5LJ5e 1KMNA 3KFVA 1D09B 2L3PA 3EG3A 4MZPA 4PG3A 1MMGA 2DBKA 1HK9A 2JTEA 1X75C 2X3WD 5CAIA 4C5HA 2OTLA 1B70B 1RAGB 5KYYB 1Q86C 4YRKA 1LPLA 1T3SA 2D9TA 1EFWA 2PUKB 1IZ6A 1PC0A 2DL7A 3QJ6A 4M77A 1KQSS 5GAMe 1AEYA 3QO8A 3G71A 1RL2A 2QEXT 1YJNA 3CBOA 2I4NA 4YCWA 2DDZA 3QWXX 1Y71A 3REBB 1XOVA 1YWPA 3CC7T 3GNFB 2DAQA 2P0KA 4IUPA 2GCXA 4N0AA 1Q7YU 4JRIA 4FYYB 4E7LA 4KGVB 4YCUA 2OI3A 3CC4T 4HT4A 4YREA 1H641 3PE0A 4N0AC 5LJ3d 3CC2Q 3IALA 1M8MA 4YRNA 2QHVA 1YIJT 1YCYA 1UUEA 2A8EA 1IRXA 4DEXA 1TTHB 2RI2A 3CMAQ 1PG5B 2PU9B 3R6NA 2JMCA 4YRRA 1VQ9Q 2K3BA 4M77D 2RHIA 5LJ3j 3O5ZA 1M1FA 1T3LA 1VQPQ 1D1CA 1O75A 3I55Q 1NE8A 1OZ2A 2GFAA 3VQXA 2BKDN 2JM9A 3QIIA 5A0LA 1H4VB 4ELZC 4FYVB 4YRJA 4TVRA 2VB6A 1ZA1B 3UA7A 5FWCA 2EJ9A 3CCUA 1M27C 3MEWA 1WZOA 1VQOQ 4BB7A 3P8TA 2IY5A 4J6WA 3A8HB 1WQWA 2CT3A 1N8RR 3CPWP 2I4LA 1X6OA 2ZT5A 2DQ3A 4J83A 1VYUA 4KT0E 2ATCB 2HDAA 4AFZC 3JCMP 4Z88A 2KE9A 3SFMA 1NEGA 4ZTZB 1PM3A 2DXUA 1BKBA 2AKWB 3VS6A 3UATA 2KXCA 1M1KU 1QWEA 5KNNA 1U3OA 2EGEA 1HD3A 2DVJA 2ZXFA 1NJ8A 2VGNA 1IL2A 4AH6A 5HCKA 4FU6A 4A4HA 5CKBA 3JCMd 3CXCA 2ARUA 2L8DA 3QYGB 4XTUA 2CZ0B 1KC8R 2EPDA 1OPKA 2QHTA 1OYXA 1QLYA 3X28B 1VIEA 3QKJA 3TEEA 3ULRB 2DL5A 1EX4A 2M16A 5HKCA 1E22A 5KYUB 1ZSZC 1FYFA 1D1BA 1T0JA 3WVEB 1UFFA 1VQ6Q 1Y57A 2Q5HA 1YI2Q 3OYDA 2AKWA 3FJ5A 2V26A 4XK8E 3UGQA 4PL6A 5FW9A 3JV3A 3JSCA 4RTVA 4PHCA 3OYJA 2YUPA 2CP2A 3DB3A 4KR2A 3OW2P 5DY9A 3NFCA 2O9VA 2J05A 2DTOA 5CKHA 4HT8A 3CD6Q 4EMHA 3NPFA 2RO0A 5GAN2 1AZEA 3QBYA 3JCMb 3FC3A 4H2UA 2EGAA 1B70A 2QQAA 2QAZA 1X54A 3PIPA 2DM1A 2M02A 2NWMA 1OU9A 4F14A 2X51A 4H2YA 4LXCA 2E65A 1Q86R 3VQYA 4RQFA 1WYXA 2H8HA 4X9CA 1YJWT 2CSIA 4HVWA 4WJ4A 5KYWA 1M2VB 2COYA 4P74C 1B76A 2RJFA 1N9RA 2AHJB 1N9WA 1W4SA 2PVOB 3JRZA 2HNIA 3SD4A 5E3IA 2P0LA 1KSWA 1VQOT 2VKNA 3JB9F 3RL6A 3NTIA 3PGGA 3QUIA 1YJNQ 1AWOA 1QP2A 5LJ3f 1E6GA 2AT1B 4CH6A 2AK5A 3OY9A 2GQVA 1PCXA 4BUGA 1JBMA 3VYHB 2AZVA 2ZT7A 4JZ3A 1KC8C 3RACA 2EJFA 2YRVA 3IQLA 4QQGA 4FSSA 2KMTA 4OMFB 3QNEA 2YWWA 3P8DA 1YJ9T 2R57A 5I22A 4M7AC 3A32A 5C53B 2KI7A 1VQMT 1XTDA 1HC7A 3KXTA 3I5RA 4F7UG 2CYZB 1NJ1A 3TCJA 5LJ3e 2PNIA 2ALYA 3I55T 4KR3A 5HY6A 1QKXA 5GAOp 2YUNA 4R0KA 1WQ7A 1MNDA 1I0CA 2DRKA 4J6YA 1S72A 3M56A 1GBQA 2D0QB 3EG9A 2CZ1B 3L2QA 3ZFJA 5FU6C 1ZBXA 1E1OA 2DXBA 1IHWA 3HFOA 1BBWA 4UP8A 1RI0A 4PJMA 3V7SA 1MUZA 4RUGA 1D3BB 1VQNA 3FLGA 1SPKA 1NBEB 1RAEB 1WU7A 4II1A 4BY6B 3JB9H 4RMOA 4ZGJB 2HBWA 3TREA 3HXYA 1NG2A 5EG2A 1NYGA 2ROLA 1YI2A 2RJEA 3OBYA 1JJ2S 1U1TA 1UEBA 4JJBA 1KQSA 3VRYA 3X25B 4A54A 4P71A 4MDWA 2VASA 4TVWA 2PTKA 2RH2A 1Z9ZA 1CSKA 1FX7A 4GY5A 3HXWA 4MMKA 1WFWA 4PKCC 3I56A 3M58A 3REUA 4YRQA 2XMFA 3EH2A 5HK3A 4HCBA 3CXCP 4C92E 1ABQA 3CCLT 3MEAA 3E9IA 1TU0B 4LDVA 3VS7A 1QWFA 3NGPA 3JCMe 3G4SQ 2QQ9A 3QTCA 2QYZA 3PT9A 2G6FX 2C0TA 4BDYA 4A63B 4B9XA 1G3SA 1YHQQ 3VUZA 5IXBA 1PKTA 3PMTA 1MNEA 4J9HA 3OMCA 4XTZA 5GMKm 2FL7A 4P71C 2RPNA 1QW1A 4M7AE 1G5VA 2ZAEA 1RAAB 1BI3A 4E51A 2DU5A 4IIOA 3HPWA 4LNSA 1C1AA 1K73C 4A4EA 1BIBA 2DQ0A 1W2BP 1NJIU 3OYMA 1NZ9A 3ICAA 4YRIA 4MZMA 4ORZA 1YBYA 2EFIA 1OPLA 2LT4A 1VQNQ 2JTFA 1LNXA 3HXXA 2D0NA 1GCPA 3BY7A 1WYDA 5LJ5f 1J3TA 2VXFA 4LD9K 2HZYA 4LDUA 4KULA 4C92A 3VV0A 2V8IA 5HGQA 1JQQA 2JUFA 5GAN8 3JCMf 4A53A 4CH4A 4JRQA 2HKQB 2LMJA 2RHYA 4CI0C 1K8AU 5LJ5h 3I7FA 4WTOB 1RACB 4VUBA 5J26A 1YFTA 2E6ZA 2K3YA 1H4SA 3QO3A 4RG8A 2JN0A 1M9SA 3NTHA 1IHVA 2EVRA 3OMGA 2WSEE 1EZZB 5LJ3g 4OB1B 2PMFA 1MMDA 3GBQA 3I56Q 4BDZA 2Y4XA 1Z7MA 4H2XA 2ROTA 3L2WA 2I4OA 4M75G 1K9MC 3OYNA 1YB3A 2RJDA 5HK0A 3M4QA 1C0AA 3VS3A 1PRMC 2KSSA 3QPHA 1K8AR 2DLPA 4IUVA 4JLGA 1U1SA 3RDVA 4B9WA 4YRTA 3GIBA 4RTZA 3L42A 1TOVA 5A0DA 4CS4A 4M77F 1BCMA 2K79A 4J9BA 5GAOm 2A36A 1QKWA 2HEQA 2NUTB 4HWPA 1XJWB 1WJQA 2HSPA 2RA2A 1KG1A 1I4K1 4GLKA 3J7AF 1AWJA 4RCBA 2ZCEA 2QA4A 2VVKA 1VQ9T 4YCVA 2LCLA 1C0MA 2LNHB 2DERA 1B3QA 2MOXA 2A3LA 3F70A 1NM7A 3H8ZA 2O88A 3M55A 1K4US 2YT6A 1ZX6A 3EFSA 1JJCA 1EIFA 4MMLA 4PJJA 2KQWA 1PNJA 1QVFS 3VKIA 3QG1A 3A8OB 1M3CA 3ZBDA 1SRYA 2C7IA 1W66A 3VUBA 4Z8AA 2QEXA 2FPDA 3JCMW 2DD4A 2HAXA 2VYTA 4EO4A 4P75C 4DEYA 5IAYA 2ZINA 2DEQA 1YIJA 3DSQA 3H41A 4G85A 1WXBA 1PKSA 3OSVA 2ECZA 1R8OB 3RUXA 4F7UB 2CGHA 2DZ9A 3X24B 3J81E 1SSHA 3E1SA 3WVDB 3EFOB 3L2UA 4FCYA 2SEMA 4C8QA 2FZKB 3G1JA 1KC8U 5KYWB 3THKA 3QDFA 4PJOB 3M0TA 4KUDK 4XU3A 2E5QA 3MP6A 3MQZA 2P84A 4M75B 4KGXB 4DQ2A 1Q86U 4LD6A 5IHKA 1H4QA 1BI1A 1KFZA 4E7JA 5J3BA 2CSQA 2VC8A 3SB2A 1Y0MA 2ZIOA 3JCMJ 1KQ2A 1YFSA 1LCKA 3NELA 1W1FA 3EGDA 4EIKA 2P5IA 2DE0X 1HSQA 2KYBA 2QA4T 3RKXA 2K9GA 3M5AA 2BZ8A 3PVLA 4X1VA 2YLBA 4ZTUB 1JRIA 2FYKA 2LJ1A 1ZBJA 3HTZA 2FRYA 1UE9A 3GOXA 2DTIA 4ZTJA 4C0DB 2KDSA 4OMMA 3GPLA 1H4TA 3A5ZA 4OP0A 3E2UA 5D6XA 2RQRA 2LX7A 3LWIA 1Q82C 3RMQA 2E3HA 1WHJA 2PVDB 1QVPA 1KJWA 3OS0A 1UB4A 2K4YA 1VQ6A 1IREB 3EGUA 3JB9I 3CEYA 2NS6A 1JJ2A 1MV0B 2R58A 3CCVA 2P0QA 4WJ3M 4WCIA 2HQHA 4PJOC 3EG2A 2DK3A 2RHXA 4M7DD 2P4RA 4MZTA 4TVAA 2X4JA 1WGSA 1VQPA 4M7DG 1MMNA 1JJ2P 1UJ0A 4OMOA 4C92C 2M0YA 3PIOA 1AVZC 1RAIB 2NUTA 1EVKA 4LUDA 3RNJA 2A0FB 4HCKA 3IG2A 2J06A 4ME7A 2VV5A 2CP0A 3E9HA 2HCKA 4QT7A 3MF1A 1AT1B 4X34A 4M77B 3CCLA 4PFZA 4M78F 3CCQT 5CKFA 1I5LA 4C8QE 1VQLQ 1SRMA 1RLPC 3R6OA 4C5EA 1ABOA 2LJ0A 3HXUA 3N5BB 2JNGA 3HRUA 2KRMA 4F04B 1YCSB 1ZA2B 2NUPA 4PFPA 4E2FB 1IO6A 5GAN4 1IXDA 2QG9B 3M59A 2YUQA 1NJ6A 2E3CA 4YRPA 4JS5A 3X20B 4H2TA 4RDXA 3HFZB 3CC4A 4M75A 1RAFB 4XU2A 5KYYA 2D8HA 3EG1A 1BBZA 4J9GA 4M78A 3J80E 3OYAA 3OB9A 2EQKA 3NETA 1MGQA 2WSFE 2IIMA 3CCSA 4XEMA 5C51B 3HL8A 1BB9A 3RESA 1OU8A 3OYGA 4YRSA 5GANh 3SEMA 2FHDA 3UF4A 3MKDA 4LVLA 3PTAA 1I5OB 5DLQE 3GF5A 3EHQA 1NJ2A 1QMCA 5I11A 3URGA 3HTRA 3UGTA 2KROA 4AG2C 2OAWA 2C8MA 3A5ZB 5CO7A 2GF7A 5LL6S 4PFOA 3S3MA 2W0ZA 4KBMB 2LQ8A 3VS4A 4C8QD 2ZPGB 3CCMQ 1YITQ 4P75A 2MPXC 2F5TX 3CCVT 4FW1A 1M2VA 2CZ6B 3LW5E 3REXA 4X9DA 3A8MB 4C8QF 2AKLA 1YHQT 4M78E 1OOTA 1NYQA 2FZCB 3L2ZA 4H02A 4M77G 4K88A 1LJOA 3OYHA 1D0YA 1VIFA 1VOMA 3DLMA 1Q82U 1YITA 1WLEA 1QQJA 3TEHA 1PRLC 5FROA 5GAN5 1H3HA 1R0BG 2EKHA 1VQKA 1G3YA 2DA9A 4O5VA 4EMKC 4L59A 4CS2A 3G6ET 2K7AA 2ALYB 1VA7A 4QVZA 2CH4A 3BW1A 5ELNA 2LDMA 1SETA 3CPWS 2QDLA 3MP8A 3CXCS 4LDYA 2ZNIA 3JB9J 2X9HA 3RBBB 1BU1A 1NPPA 1USYA 2ZT8A 1QVFA 5GAMg 3S3NA 1IB8A 2L3SA 1WXTA 1SSFA 2GTOA 1T0HA 3EAEA 1ZLMA 3CCRQ 2JS2A 3HKSA 1BYMA 2OAUA 1U06A 2KVQG 1WJSA 4C92F 4J9IA 4PJLA 2GTJA 4NS5A 4M75E 3EHRA 3VS1A 5ELOA 4PK4A 4PNOA 2ENMA 2OTLQ 3PNWC 1MV3A 1IGUA 1VQ5Q 1IGQA 1TG0A 4BW9A 3QDRB 2J3LA 3M4YA 4P73C 4IURA 3IKLA 4C92G 4ANJA 2XG8D 4M78D 2JTMA 4P72C 3LGFA 4HWTA 4M75D 5J39A 1EIYB 1HTTA 4Q6GA 2QEXQ 3H0IA 1HYOA 1YHQA 2OJ2A 2XKOC 1VQMQ 3VBBA 3FEOA 2Y90A 4YRFA 3TU4K 4P72A 2NUPB 4UP9A 1XQHA 3CCLQ 4H2WA 4N4IA 2QI2A 3INZA 4M7AG 1OULA 3G6EA 2LC4A 1YP5A 2EJGA 1BIAA 3RMSA 3M4PA 2FB7A 1RIQA 1Y07A 4ESRA 1ZUKA 5FU7C 1KD1U 1GCQA 4XTYA 2OTLT 3EGXB 2CREA 3C94A 3D7SB 3M57A 4JDSA 4BI3A 4L87A 2QGGA 3OQ5A 4M7DB 4AG1C 5L8RE 1JB0E 2RK2A 1PSFA 2KK4A 3E9GA 1G5HA 4HVCA 3UFGA 1SEMA 4HVUA 1B7TA 3CC7A 4KUIA 4YPFA 1VQOA 1VQKT 3H0FA 1X55A 1PD1A 5CQXA 4UC4A 2DL4A 4P5NA 2F2VA 1QVGP 1PYSB 4TVYA 2XTIA 4K87A 3A8LB 5FRMA 2E6NA 3OS5A 5GMKl 2KBTA 1B7YB 3MCAB 4ZNXA 1M8VA 1K9MU 5GAMh 2E5AA 4DBQA 2EWNA 4FYWB 1Q7YR 2DBMA 3G1ZA 2BZXA 2M1HA 2E1HA 4D8DA 3A5YA 1ASYA 1V76A 4UP7A 2ZNJA 1ZSZB 3ZEHA 2EAYA 2MCNA 1K0XA 2QQBA 4RTXA 3OYKA 4CC7A 4B6MA 4D8KA 3CCVQ 1VUBA 5EC7A 4M77E 4BWAA 5I21A 1TWBA 4HWRA 3CCUQ 1NYFA 1Y96A 4RG2A 3CCET 2I2LA 1X69A 1JXMA 2KT8A 3OW2A 4Y28E 4ZN3A 4C8QG 2LNVA 2KT1A 2CJAA 2FZGB 4JS4A 2L5QA 2ZPHB 4PJOD 2Z0WA 5LJ5j 3HY0A 5FLXE 1YJWQ 2ZZGA 1Q95G 4E47A 4J6XA 1ZSGA 4IUTA 2BZYA 4C0FA 2QTVA 4RKUE 3DB4A 1K73U 1EFNA 4HKEA 3QSUA 4M7AA 4A4FA 3CMAA 4LVMA 1BCOA 4HA8A 3HFVA 2CP3A 4QQ6A 4AT1B 3LSSA 1QVGS 1TUDA 3TEHB 3NTKA 2EQMA 2XK0A 2EL9A 3TEGA 5C0MA 1M5Q1 4NL3A 4P74A 4TWAA 1KMMA 5D6WA 3SDZA 1QVFP 5GAOq 4YP0A 4H2SA 3G6EQ 3EG9B 3PCOB 4Y91A 4IKFA 2OTJA 3HXZA 4LVIA 4BE2A 4V2SA 3PVQA 5CVIA 4OMPA 4PJOG 1K9MR 4ZIBA 1BI2A 2DFUA 2K57A 5LJ5g 3KUFA 1PWTA 1WX6A 1EIYA 2DRMA 3JCMQ 4DA4A 3CD6T 2ZIMA 5K1PA 3A31A 2ZZEA 1YNZA 3JCMg 1RABB 3UA6A 3LSQA 2CKKA 1AHJB 2MF2A 1GBRA 2RQTA 4C5IA 2J6FA 4M7AF 1XNIA 2K5LA 1M90R 2Q7EA 5GAMf 1ADJA 3A7RA 5GANd 1X6GA 4AFQC 3CBMA 4LE9A 4J9EA 1KQSP 2DJZA 1G83A 1VQ8A 5IT9E 4M78B 2K6DA 2C0IA 1I81A 3V8JA 1UGSB 2R5AA 1OX9A 1E24A 1B8AA 2ARTA 2WSCE 3U23A 2DXCA 1X2GA 1Q81R 4P73A 5IH2A 3CMET 2JM8A 3JAME 5KYXA 4C8QB 3CCQQ 2DETA 4EMGA 5C6SA 4EX5A 4XU1A 1K73R 4O2DA 3OSSC 3MF2A 2YHTA 3META 4YYEA 5IXFA 1PHTA 3CPWA 4C92B 1TUCA 1SG5A 1OI1A 3HFZA 4UPAA 2EYZA 4XTWA 1ZSZA 5CQYA 4FSXA 1K1ZA 4BD3A 2RI3A 3P8BB 2M9UA 3H6ZA 3HFNA 3MO8A 5AYFA 3S6WA 4HWOA 3JCMX 4JLIA 2QHUA 2XU8A 1VQ7T 2E3IA 1NJIC 1W2BS 2ESWA 4C0GA 3PFSA 3SHWA 2RJCA 4F7UE 4LDXA 2EQIA 1GGMA 4M7AB 4BI4A 4LVKA 1VYVA 5GJWB 1KIKA 4YROA 3CMAT 1B34A 4C92D 1OV3A 3CCRA 4P3OA 1H3ZA 1N6AA 4FYXB 1ADYA 2I4MA 3OYCA 3L2VA 4HCCA 1VQPT 2KRNA 3I5SA 4LNPA 1X6BA 4YRGA 4CC4B 2AZSA 2CP6A 3AT1B 3HRKA 3R07A 1H8KA 2CS7A 2RHQA 5IHNA 2RQUA 1LOJA 1V29B 3L1AA 2J6OA 5CK9A 1FMKA 3CMEA 3JB9D 3MHXA 4DBFA 2C06A 2DNUA 1BBUA 2E4HA 1Q81C 5GMKh 4KQEA 3RR6A 1UG1A 3UPUA 2EQJA 4KH0B 3BDLA 3PZCA 5F5WA 4OGCA 3HHTB 3CC4Q 4FIBA 3SWNC 3TSWA 1WXUA 2ZR2A 2MIOA 1I07A 3C0CA 3HRSA 1WPYA 2ZCFB 4ZTFA 2QK0A 3A8GB 4M7DE 1RUWA 1SRLA 3HP9A 4BI8B 2BUDA 4R55A 3C95A 4JRPA 3KBGA 4OLFA 1M1GA 1YN8A 1EVLA 4TTVA 3LLRA 5KYNA 3JB9G 3EGDB 4A4KA 2K3XA 2RB6A 1VQ4A 1D3BA 3OBWA 2BE7D 1DJ7B 3RKWA 1M90C 2C0OA 2G4CA 4RQEA 3G4SA 3UH0A 1UGQB 3WQZA 1JEGA 4XQ3A 3C12A 3QXEB 1X56A 2A28A 3LH5A 4RMFA 3OS1A 1NLPC 2BE9B 1USYC 1OX8A 2VUBA 2W10A 2M0OA 1NJ5A 2HQXA 2MAMA 3M0PA 4KGZB 3PCOA 2F1LA 2X3XD 3BJUA 1N5ZA 2V8JA 5GANj 3HSBA 1K8AC 1M2OA 1MMAA 2OX7A 3BFMA 2P0PA 3CMQA 2QDYB 2FPFA 5KCHA 3EFRA 2RHSA 2HL5C 3TUPA 3S3OA 3L4GB 5GAOn 2LCCA 3GNGA 2GBQA 4J15A 1H92A 3OYFA 1WA7A 4YTLA 2LZ6B 4C0ZA 2QQRA 3CCEQ 1R0CB 4IIMA 1TS9A 3OW2S 2LP5A 5GMKe 3V8KA 2ZTGA 2F69A 5GANe 2IY5B 3NEMA 1OEBA 4K11A 3OS2A 3VRZA 2HL3A 1K9AA 2JT4A 2KYMA 4YRCA 4Z89A 1E7OA 2MWPA 4OB0B 4O6JA 3VS0A 1Q82R 4RTUA 2K5FA 1I8FA 2RHQB 4YRLA 2DIGA 5KYXB 2E70A 2M51A 5GMKj 4QQDA 2JW4A 3LWHA 5M9OA 2HMAA 1EOVA 5GAOl 4RTWA 4E7HA 3M0UA 4M78G 4HVVA 4E6RA 2VWFA 2DIQA 1VQ5T 1G51A 2DO3A 2FO0A 1NLOC 5LJ5d 3DKMA 2FG0A 1KOGA 1VQKQ 1NYRA 2AMCB 2B86A 4C8QC 1YJ9Q 4E7SA 5FU7B 4M7DF 3RGLA 4DBRA 2LQKA 3C4SA 4FT4A 6AT1B 1KQ1A 1E6HA 1TSFA 2XGTA 2KGTA 3QZ9B 1BI0A 2A08A 1ZUUA 3CD6A 1VQNT 3VJPA 3M54A 3SWNA 4LN2A 1HJDA 3TQ7P 4C5GA 5FU6B 5KE3A 2QTXA 2H3JA 2ED1A 1X2HA 2HD0A 2KY9A 1YJ9A 1JU5C 3LC0A 2E10A 1OZ3A 2L2PA 3CC7Q 2F2WA 3CBPA 2YRCA 1WI7A 5DLOA 2RHZA 5I2SA 3JCMh 4EPCA 1UHFA 1VQLT 2ZR3A 3QO5A 3QHSA 4HXJA 2QASA 2RMOA 3VS2A 1KD1C 2DTHA 1S72T 2CZ7B 3OYYA 12ASA 1CKAA 4OMQA 3FB9A 3BDUA 3EH1A 4BE0A 3QJYA 1M90U 1AWWA 5L23A 1VQ7A 2QQSA 4PJNA 2V8KA 5FRNA 1UGPB 1AZGB 1U5SA 3CMEQ 1GFDA 2CP7A 2I0NA 4EMKA 2CDTA 4CC3A 2QA4Q 4F7UF 3TVTA 2X4XA 1ARKA 3Q1JA 1VQ5A 2GNCA 2ZT6A 2RHSB 2QXFA 1UDLA 4J7FA 8AT1B 3PMIA 2D8JA 1X2QA 2RHUA 2EYXA 2HBPA 5GAMd 1W70A 2E64A 11ASA 2RI5A 3CCRT 4D6WA 4RTYA 3QYHB 4E7KA 2PZ1A 1FMVA 3CCMA 2RK1A 1JO8A 1RI9A 3FIFA 4OB2B 4OVAA 1WJRA 4EDUA 4C0DC 2E5KA 1PD0A 4J8OA 4OF1A 2Q7GA 2JZ2A 2QHSA 4H2XB 4BY6C 2LT1A 4HCZA
chains in the Genus database with same CATH topology
4Z02A 1YJNT 2YLCA 5LJ3h 4QW2A 3ER0A 2LRQA 4PJOA 2EQUA 2Y4YA 3VU3C 4JRKA 2GFUA 3MEYA 4PJOF 4PLLA 1QF6A 2AMCA 4BE1A 3M4GA 4JJNK 3LX7A 3P8YA 5KCOA 2JVVA 2CJ9A 1UGRB 4H2VA 3OD1A 3HY1A 5GAN7 2PMEA 4G84A 5I2MA 1N8RU 1NNHA 4XTXA 2LX9A 3WXMB 3G4ST 4CH3A 3DLLA 3LYIA 4LVJA 3CCJT 3OYEA 3ASKA 2LVMA 5A2QE 5GMKi 1Z7NA 2Q7HA 2CIMA 2LTOA 4N4GA 2IG0A 1KHCA 1N27A 4DOWA 3MEUA 1KHIA 3CCMT 3GP8A 3CC2A 4JUVA 4TQFA 3GLXA 2DPPB 1J5WA 3VYGA 1B34B 4OGEA 4XTVA 1HXDA 1VQMA 1SESA 2XD0A 1QP3A 3OYLA 3QO7A 2X35A 2RM4A 2MMPA 2XHCA 4YDQA 1L0WA 2MWOA 2X4WA 4Q5WA 3CCUT 1QE0A 3HRTA 3A74A 2PVGB 5CR2A 3CCST 2ZPFB 3I56T 2ZGWA 4IUUA 3FDRA 2ZZDA 2CJBA 2XICA 3M9QA 4NOYA 2DU7A 4BACA 3E9FA 1Q81U 2O01E 2F5KA 3CCJA 5A0GA 3E19A 1YITT 1YGBA 5KH6A 4YYEA 2B8AA 2VGMA 2RD1A 2ZPBB 4M78C 1TH7A 1PSEA 3MEVA 2ARSA 4PLIA 2X4YA 3RKYA 4OB3B 4ZGEB 4LDWA 3ME9A 3FJPA 4A4GA 3HRIA 2Q5IA 3T9NA 4EMKB 2O4XA 4FT2A 4M77C 3CPFA 3L2RA 1YJWA 3V7RA 2G3RA 4XAXB 5CKDA 1WNLA 2VXEA 4ELYC 2J3MA 4CRIA 3P8VA 3CCEA 2EYQA 4NL2A 4HT9A 1VQLA 3KFUA 1QVGA 3G71T 3A7AA 5C52B 4M75C 3JCMc 1B7YA 3RIRA 4XU0A 2MI6A 3OYBA 2E41A 4J7IA 4MDXA 1VQ4T 4J5YA 2XDPA 4E7IA 3QZ5B 3W3SA 2WACA 3P8HA 4L5GA 4P3NA 1JJCB 2OTJT 2XI9A 1GXIE 3HXVA 5GAN6 1VQ8T 3IKMB 4M75F 1YFRA 3FRNA 3G7ZA 4FL6A 2DZCA 1LYLA 4R56A 1VQZA 1ZHIA 3UWNA 5GANf 2D6FA 4TVAB 4DOVA 2ODRD 1YI2T 1Y7XA 3NENA 3VQVA 1ZQ1A 2L89A 1G3WA 2P4TA 2IVWA 4ZGDB 3I55A 2KAFA 2BIVA 1U8RA 2ZPEB 5CIUA 2E12A 1VQ9A 3RF1A 1M1KC 4CH5A 3RERA 4CS3A 4TQDA 3X26B 2O4XB 3MP1A 3A7UA 2XDDA 3L4GA 4K86A 2DKGA 4NCXA 2FVUA 1W2BA 3VQWA 2A7YA 4ATOA 1G5IA 5DM7R 1M4ZA 4M7AD 2K2VA 1Y96B 2L3RA 3O8VA 2DVEA 5KE2A 2ZZFA 4Q15A 4RCCA 3UT1A 2EKOA 1SERA 4QVDA 1G3TA 1N8RC 5GAN3 1P92A 4QVCA 4M7DA 4HWSA 1EQRA 3LH0A 3AHUA 3LGLA 4P3PA 1MHNA 4FM4B 3V7CA 2R5MA 2HQEA 2EIFA 1Q7YC 4IUQA 1O9SA 1ASZA 4WI1A 2NLUA 3CC2T 1PYSA 2XIDA 4L6V5 1VQ6T 5GAOr 2PQWA 4ZN1A 2PUOB 2DXTA 3SWNB 2ZPIB 4DPGA 3OA6A 3M53A 4M7DC 1E1TA 1FXXA 3ERRA 1NPRA 2XDBA 4XEOA 1ATIA 4X5OA 4N4HA 5IN1A 3UDCA 4PJOE 2DD5A 1X01A 5D6YA 5CKEA 4YRMA 3JCMV 3OYIA 2K5IA 1FWZA 2JOYA 3CCQA 4WF2A 5CCAA 2ODRC 5GAMj 5GANg 5K1XA 3V8LA 1N9SA 5LJ5e 1KMNA 4MZPA 4PG3A 1HK9A 1X75C 5CAIA 4C5HA 2OTLA 1B70B 1Q86C 4YRKA 2D9TA 1EFWA 2PUKB 1IZ6A 3QJ6A 4M77A 1KQSS 5GAMe 3QO8A 3G71A 1RL2A 2QEXT 1YJNA 3CBOA 2I4NA 4YCWA 2DDZA 1Y71A 1XOVA 3CC7T 3GNFB 2DAQA 2P0KA 4IUPA 2GCXA 4N0AA 1Q7YU 4JRIA 4E7LA 4YCUA 3CC4T 4HT4A 4YREA 1H641 3IALA 4N0AC 5LJ3d 4YRNA 2QHVA 1YIJT 1YCYA 2A8EA 2RI2A 2PU9B 4YRRA 4M77D 2RHIA 5LJ3j 1M1FA 1O75A 1NE8A 1OZ2A 2GFAA 3VQXA 2BKDN 3QIIA 5A0LA 1H4VB 4ELZC 4YRJA 4TVRA 2EJ9A 3CCUA 3MEWA 4BB7A 3P8TA 2IY5A 4J6WA 3A8HB 1WQWA 2I4LA 1X6OA 2ZT5A 2DQ3A 4J83A 4KT0E 3JCMP 3SFMA 4ZTZB 2DXUA 1BKBA 2AKWB 1M1KU 5KNNA 2ZXFA 1NJ8A 2VGNA 1IL2A 4AH6A 4FU6A 4A4HA 5CKBA 3JCMd 3CXCA 2ARUA 2L8DA 3QYGB 4XTUA 2CZ0B 2QHTA 1OYXA 3X28B 1VIEA 3QKJA 3TEEA 5HKCA 2M16A 1E22A 1FYFA 3WVEB 2Q5HA 3OYDA 2AKWA 4XK8E 3UGQA 4PL6A 3JSCA 4PHCA 3OYJA 3DB3A 4KR2A 5DY9A 3NFCA 2DTOA 5CKHA 4HT8A 4EMHA 2RO0A 5GAN2 3QBYA 3JCMb 3FC3A 4H2UA 1B70A 2QQAA 1X54A 3PIPA 4H2YA 2E65A 3VQYA 4RQFA 4X9CA 1YJWT 4WJ4A 4P74C 1B76A 2RJFA 1N9RA 2AHJB 1N9WA 1W4SA 2PVOB 3JRZA 2HNIA 3SD4A 5E3IA 2P0LA 1VQOT 3JB9F 3RL6A 3NTIA 3PGGA 3QUIA 1QP2A 5LJ3f 4CH6A 3OY9A 2GQVA 4BUGA 1JBMA 3VYHB 2ZT7A 1KC8C 3RACA 2EJFA 2YRVA 4QQGA 4OMFB 2KMTA 3QNEA 3P8DA 1YJ9T 2R57A 4M7AC 3A32A 5C53B 1VQMT 1XTDA 1HC7A 3KXTA 4F7UG 2CYZB 1NJ1A 3TCJA 5LJ3e 2ALYA 3I55T 4KR3A 5HY6A 5GAOp 1WQ7A 4J6YA 1S72A 3M56A 2D0QB 2CZ1B 3L2QA 3ZFJA 5FU6C 1ZBXA 1E1OA 2DXBA 4UP8A 3HFOA 1BBWA 1RI0A 3V7SA 1D3BB 1VQNA 3FLGA 1WU7A 4II1A 4BY6B 3JB9H 4RMOA 4ZGJB 3HXYA 3TREA 5EG2A 1YI2A 2RJEA 3OBYA 1JJ2S 1U1TA 1UEBA 1KQSA 3X25B 4A54A 4P71A 4MDWA 4TVWA 2RH2A 1FX7A 4GY5A 3HXWA 4MMKA 4PKCC 3I56A 3M58A 3REUA 4YRQA 5HK3A 4HCBA 4C92E 3CCLT 3MEAA 3E9IA 4LDVA 3JCMe 2QQ9A 3QTCA 3PT9A 4BDYA 4B9XA 1G3SA 3VUZA 3PMTA 3OMCA 4XTZA 5GMKm 2FL7A 4P71C 1QW1A 4M7AE 1G5VA 1BI3A 4E51A 2DU5A 3HPWA 4LNSA 1K73C 4A4EA 1BIBA 2DQ0A 1NJIU 3OYMA 1NZ9A 3ICAA 4YRIA 4MZMA 1YBYA 2EFIA 2LT4A 2JTFA 1LNXA 3HXXA 1WYDA 3BY7A 5LJ5f 2VXFA 4LD9K 4LDUA 4KULA 4C92A 3VV0A 2V8IA 5HGQA 5GAN8 2JUFA 3JCMf 4A53A 4CH4A 4JRQA 2RHYA 4CI0C 1K8AU 5LJ5h 3I7FA 4VUBA 5J26A 1YFTA 2E6ZA 2K3YA 1H4SA 3QO3A 4RG8A 2JN0A 1M9SA 3NTHA 2WSEE 3OMGA 5LJ3g 4OB1B 2PMFA 4BDZA 2Y4XA 1Z7MA 4H2XA 3L2WA 2I4OA 4M75G 1K9MC 3OYNA 1YB3A 2RJDA 3M4QA 5HK0A 1C0AA 2KSSA 3QPHA 4IUVA 4JLGA 1U1SA 4B9WA 4YRTA 3GIBA 3L42A 5A0DA 4CS4A 4M77F 5GAOm 4HWPA 1WJQA 2RA2A 1KG1A 1I4K1 4GLKA 3J7AF 4RCBA 2ZCEA 2QA4A 1VQ9T 4YCVA 2LCLA 2A3LA 3F70A 3H8ZA 3M55A 3EFSA 1JJCA 1EIFA 4MMLA 2KQWA 1QVFS 3VKIA 3QG1A 3A8OB 3ZBDA 1SRYA 2C7IA 1W66A 3VUBA 2QEXA 3JCMW 2DD4A 2HAXA 2VYTA 4EO4A 4P75C 5IAYA 2ZINA 2DEQA 1YIJA 3DSQA 4G85A 3OSVA 1R8OB 3RUXA 4F7UB 2CGHA 2DZ9A 3X24B 3J81E 3E1SA 3WVDB 3L2UA 4C8QA 1KC8U 4PJOB 4KUDK 4XU3A 2E5QA 3MP6A 3MQZA 4M75B 4DQ2A 1Q86U 4LD6A 1H4QA 1BI1A 4E7JA 5J3BA 2VC8A 3SB2A 2ZIOA 3JCMJ 1KQ2A 1YFSA 3NELA 2P5IA 2QA4T 3RKXA 3M5AA 2YLBA 4ZTUB 1JRIA 2FYKA 3HTZA 3GOXA 4ZTJA 2DTIA 4C0DB 2KDSA 3GPLA 1H4TA 3A5ZA 4OP0A 5D6XA 3LWIA 1Q82C 3RMQA 2PVDB 1QVPA 3OS0A 1UB4A 2K4YA 1VQ6A 1IREB 3JB9I 3CEYA 2NS6A 1JJ2A 2R58A 3CCVA 2P0QA 4WJ3M 4PJOC 2DK3A 2RHXA 4M7DD 4MZTA 4TVAA 2X4JA 1WGSA 1VQPA 4M7DG 4C92C 3PIOA 1EVKA 3IG2A 4ME7A 2VV5A 3E9HA 3MF1A 4X34A 4M77B 3CCLA 4M78F 3CCQT 5CKFA 1I5LA 4C8QE 3R6OA 4C5EA 3HXUA 3N5BB 2JNGA 3HRUA 5GAN4 3M59A 1NJ6A 2E3CA 4YRPA 4JS5A 3X20B 4H2TA 4RDXA 3HFZB 3CC4A 4M75A 4XU2A 3OYAA 4M78A 3J80E 3OB9A 2EQKA 3NETA 1MGQA 2WSFE 3CCSA 4XEMA 5C51B 3HL8A 3RESA 3OYGA 4YRSA 5GANh 2FHDA 4LVLA 3PTAA 5DLQE 3GF5A 1NJ2A 3URGA 3UGTA 2C8MA 3A5ZB 5CO7A 2GF7A 5LL6S 3S3MA 4KBMB 2LQ8A 4C8QD 2ZPGB 4P75A 2F5TX 3CCVT 2CZ6B 3REXA 3LW5E 4X9DA 3A8MB 4C8QF 1YHQT 4M78E 1NYQA 3L2ZA 4H02A 4M77G 4K88A 1LJOA 3OYHA 1VIFA 3DLMA 1Q82U 1YITA 1WLEA 3TEHA 5FROA 5GAN5 1VQKA 1G3YA 4O5VA 4EMKC 4L59A 4CS2A 3G6ET 2ALYB 4QVZA 3BW1A 5ELNA 2LDMA 1SETA 3CPWS 3MP8A 3CXCS 4LDYA 2ZNIA 3JB9J 1NPPA 1USYA 2ZT8A 1QVFA 5GAMg 3S3NA 1SSFA 3EAEA 3HKSA 1BYMA 2OAUA 2KVQG 1WJSA 4C92F 4NS5A 4M75E 5ELOA 4PNOA 3PNWC 4BW9A 3QDRB 2J3LA 3M4YA 4P73C 4IURA 3IKLA 4C92G 2XG8D 4M78D 2JTMA 4P72C 3LGFA 4HWTA 4M75D 5J39A 1EIYB 1HTTA 4Q6GA 1YHQA 2XKOC 3VBBA 3FEOA 2Y90A 4YRFA 3TU4K 4P72A 4UP9A 1XQHA 4H2WA 4N4IA 2QI2A 3INZA 4M7AG 3G6EA 2LC4A 2EJGA 1BIAA 3RMSA 3M4PA 2FB7A 1RIQA 1Y07A 5FU7C 1KD1U 4XTYA 2OTLT 3C94A 3M57A 4JDSA 4BI3A 4L87A 3OQ5A 4M7DB 5L8RE 1JB0E 2RK2A 1G5HA 1PSFA 2KK4A 3E9GA 4HVCA 3UFGA 3CC7A 4KUIA 4YPFA 1VQOA 1VQKT 1X55A 5CQXA 4UC4A 4P5NA 1PYSB 4TVYA 2XTIA 4K87A 3A8LB 5FRMA 2E6NA 3OS5A 5GMKl 1B7YB 3MCAB 1M8VA 1K9MU 5GAMh 2E5AA 2EWNA 3G1ZA 2M1HA 2E1HA 3A5YA 1ASYA 4UP7A 2ZNJA 3ZEHA 2EAYA 2QQBA 3OYKA 1VUBA 4M77E 4BWAA 5I21A 4HWRA 1Y96A 4RG2A 3CCET 2I2LA 3OW2A 4Y28E 4ZN3A 4C8QG 2LNVA 2CJAA 4JS4A 2L5QA 2ZPHB 4PJOD 5LJ5j 3HY0A 5FLXE 2ZZGA 4E47A 4J6XA 4IUTA 4C0FA 4RKUE 1K73U 3DB4A 4HKEA 3QSUA 4M7AA 4A4FA 3CMAA 4LVMA 4HA8A 3HFVA 4QQ6A 3LSSA 1QVGS 3TEHB 3NTKA 2EQMA 2XK0A 2EL9A 3TEGA 5C0MA 1M5Q1 4NL3A 4P74A 4TWAA 1KMMA 5D6WA 3SDZA 5GAOq 4YP0A 4H2SA 3PCOB 4Y91A 4IKFA 2OTJA 3HXZA 4LVIA 4BE2A 4V2SA 5CVIA 4PJOG 4ZIBA 1BI2A 2K57A 5LJ5g 3KUFA 1EIYA 3JCMQ 4DA4A 3CD6T 2ZIMA 5K1PA 3A31A 2ZZEA 3JCMg 3LSQA 2CKKA 1AHJB 2MF2A 4C5IA 4M7AF 1XNIA 2K5LA 2Q7EA 5GAMf 1ADJA 3A7RA 5GANd 3CBMA 2DJZA 1VQ8A 5IT9E 4M78B 1I81A 3V8JA 1UGSB 2R5AA 1E24A 1B8AA 2ARTA 2WSCE 2DXCA 1X2GA 4P73A 3CMET 3JAME 4C8QB 4EMGA 5C6SA 4EX5A 4XU1A 4O2DA 3OSSC 3MF2A 2YHTA 3META 3CPWA 4C92B 1OI1A 3HFZA 4UPAA 4XTWA 5CQYA 4FSXA 4BD3A 2RI3A 3P8BB 2M9UA 3H6ZA 3HFNA 3MO8A 5AYFA 3S6WA 4HWOA 3JCMX 4JLIA 2QHUA 2XU8A 1VQ7T 1NJIC 1W2BS 4C0GA 3PFSA 2RJCA 4F7UE 4LDXA 1GGMA 4M7AB 4BI4A 4LVKA 4YROA 3CMAT 1B34A 4C92D 4P3OA 3CCRA 1H3ZA 1N6AA 1ADYA 2I4MA 3OYCA 3L2VA 4HCCA 1VQPT 4YRGA 3HRKA 3R07A 2CS7A 2RHQA 1LOJA 1V29B 3L1AA 5CK9A 3CMEA 3JB9D 3MHXA 2C06A 1BBUA 1Q81C 5GMKh 4KQEA 3UPUA 2EQJA 3PZCA 3BDLA 5F5WA 4OGCA 3HHTB 4FIBA 3SWNC 2ZR2A 3HRSA 1WPYA 2ZCFB 4ZTFA 3A8GB 4M7DE 3HP9A 4BI8B 2BUDA 4R55A 3C95A 4JRPA 3KBGA 4OLFA 1M1GA 1EVLA 4TTVA 3LLRA 3JB9G 4A4KA 2K3XA 2RB6A 1VQ4A 1D3BA 3OBWA 1DJ7B 3RKWA 1M90C 2G4CA 4RQEA 3G4SA 3UH0A 1UGQB 3WQZA 4XQ3A 3C12A 3QXEB 1X56A 4RMFA 3OS1A 1USYC 2VUBA 2M0OA 1NJ5A 2HQXA 2MAMA 3PCOA 3BJUA 2V8JA 5GANj 3HSBA 1K8AC 3BFMA 2P0PA 3CMQA 2QDYB 5KCHA 3EFRA 2RHSA 3TUPA 3S3OA 3L4GB 5GAOn 2LCCA 3GNGA 4J15A 3OYFA 4YTLA 4C0ZA 2QQRA 3OW2S 5GMKe 3V8KA 2ZTGA 2F69A 5GANe 2IY5B 3NEMA 3OS2A 4YRCA 2MWPA 4OB0B 4O6JA 2K5FA 1I8FA 2RHQB 4YRLA 2DIGA 2E70A 5GMKj 4QQDA 3LWHA 5M9OA 1EOVA 5GAOl 4E7HA 4M78G 2DIQA 1VQ5T 1G51A 2DO3A 5LJ5d 3DKMA 1KOGA 1NYRA 2AMCB 4C8QC 5FU7B 4M7DF 3RGLA 2LQKA 3C4SA 4FT4A 1KQ1A 2XGTA 3QZ9B 1BI0A 3CD6A 1VQNT 3VJPA 3M54A 3SWNA 4C5GA 5FU6B 5KE3A 2QTXA 2H3JA 1X2HA 2HD0A 2KY9A 1YJ9A 3LC0A 2E10A 1OZ3A 3CBPA 5DLOA 2RHZA 5I2SA 3JCMh 4EPCA 1VQLT 2ZR3A 3QO5A 3QHSA 1KD1C 2LT1A 2DTHA 1S72T 2CZ7B 3OYYA 12ASA 3FB9A 3BDUA 4BE0A 3QJYA 1M90U 1VQ7A 2QQSA 2V8KA 5FRNA 1UGPB 4EMKA 4F7UF 2ZT6A 2X4XA 3Q1JA 1VQ5A 2RHSB 2QXFA 4J7FA 3PMIA 2RHUA 2HBPA 5GAMd 2E64A 11ASA 2RI5A 3CCRT 4D6WA 3QYHB 4E7KA 3CCMA 2RK1A 3FIFA 4OB2B 4OVAA 1WJRA 4EDUA 4C0DC 4OF1A 4J8OA 2Q7GA 2JZ2A 2QHSA 4H2XB 4BY6C 4F7UA 4HCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAI A;  1B70 B;  1Y96 A;  2YLC A;  5LJ3 h;  4YRK A;  2I2L A;  1EFW A;  3EFS A;  1JJC A;  4C8Q G;  4PJO A;  4M77 A;  4MML A;  5GAM e;  3VU3 C;  3QO8 A;  2CJA A;  4JRK A;  4PJO D;  3MEY A;  4PJO F;  1QF6 A;  5LJ5 j;  2I4N A;  2AMC A;  3HY0 A;  4YCW A;  2ZZG A;  2DDZ A;  4J6X A;  3M4G A;  3P8Y A;  1SRY A;  3QSU A;  4M7A A;  1W66 A;  2C7I A;  2CJ9 A;  3JCM W;  4N0A A;  4EO4 A;  4HA8 A;  4P75 C;  3HFV A;  4JRI A;  2ZIN A;  2DEQ A;  4YCU A;  3LSS A;  3DSQ A;  4G85 A;  3TEH B;  4H2V A;  3OD1 A;  2EL9 A;  3HY1 A;  3TEG A;  4YRE A;  3RUX A;  1M5Q 1;  4F7U B;  4NL3 A;  4P74 A;  5GAN 7;  4TWA A;  1KMM A;  2CGH A;  2DZ9 A;  2PME A;  1H64 1;  3IAL A;  4N0A C;  5LJ3 d;  5GAO q;  4G84 A;  4YP0 A;  4H2S A;  4YRN A;  1NNH A;  2QHV A;  1YCY A;  4XTX A;  3PCO B;  4C8Q A;  4Y91 A;  4CH3 A;  4PJO B;  3HXZ A;  4XU3 A;  4V2S A;  4YRR A;  4M75 B;  4PJO G;  4DQ2 A;  4M77 D;  4ZIB A;  5LJ3 j;  2K57 A;  5LJ5 g;  1EIY A;  1H4Q A;  3JCM Q;  2ZIM A;  5GMK i;  1Z7N A;  2Q7H A;  3A31 A;  2ZZE A;  5K1P A;  2CIM A;  3JCM g;  2VC8 A;  3VQX A;  3LSQ A;  1H4V B;  3SB2 A;  2ZIO A;  4M7A F;  3JCM J;  4YRJ A;  1KQ2 A;  1YFS A;  2Q7E A;  3NEL A;  5GAM f;  4JUV A;  1ADJ A;  4TQF A;  2EJ9 A;  3A7R A;  5GAN d;  2P5I A;  3P8T A;  3RKX A;  2IY5 A;  4J6W A;  1J5W A;  1B34 B;  2DJZ A;  1WQW A;  4XTV A;  1HXD A;  4M78 B;  1SES A;  1I81 A;  3V8J A;  2I4L A;  1E24 A;  3QO7 A;  2RM4 A;  1B8A A;  2ART A;  2ZT5 A;  2YLB A;  1X2G A;  2DQ3 A;  4P73 A;  4ZTU B;  1JRI A;  2FYK A;  3HTZ A;  4YDQ A;  1L0W A;  3JCM P;  2DTI A;  4ZTZ B;  2DXU A;  2AKW B;  1QE0 A;  1H4T A;  3A5Z A;  4C8Q B;  4OP0 A;  5KNN A;  4EMG A;  2ZXF A;  3A74 A;  1NJ8 A;  4EX5 A;  4XU1 A;  1IL2 A;  4O2D A;  3MF2 A;  4AH6 A;  2YHT A;  2ZGW A;  3JB9 I;  3JCM d;  4C92 B;  2ARU A;  4XTU A;  3HFZ A;  4UPA A;  2CJB A;  4XTW A;  4WJ3 M;  2QHT A;  4NOY A;  4PJO C;  2DU7 A;  3HFN A;  4M7D D;  1E22 A;  4HWO A;  4TVA A;  3JCM X;  4JLI A;  2QHU A;  1FYF A;  4M7D G;  2Q5H A;  4C92 C;  4YYE A;  1YGB A;  2AKW A;  4F7U E;  1EVK A;  2RD1 A;  1GGM A;  3UGQ A;  4M78 C;  1TH7 A;  4M7A B;  2ARS A;  3RKY A;  3IG2 A;  4YRO A;  1B34 A;  4C92 D;  4P3O A;  4PHC A;  3FJP A;  1ADY A;  2I4M A;  3E9H A;  4KR2 A;  3MF1 A;  5DY9 A;  2DTO A;  4HT8 A;  3HRI A;  4EMH A;  2Q5I A;  4M77 B;  4M78 F;  1I5L A;  4C8Q E;  5GAN 2;  3JCM b;  4EMK B;  4YRG A;  4H2U A;  4M77 C;  1B70 A;  3HXU A;  1X54 A;  3HRK A;  3R07 A;  2RHQ A;  3V7R A;  4H2Y A;  1LOJ A;  5GAN 4;  3L1A A;  2E65 A;  3VQY A;  4RQF A;  3JB9 D;  1NJ6 A;  2E3C A;  4X9C A;  4YRP A;  1WNL A;  4H2T A;  4RDX A;  2VXE A;  1BBU A;  3HFZ B;  4WJ4 A;  2J3M A;  5GMK h;  4KQE A;  4M75 A;  3P8V A;  4P74 C;  1B76 A;  1N9R A;  4XU2 A;  4M78 A;  4NL2 A;  4HT9 A;  3NET A;  3PZC A;  5F5W A;  1N9W A;  1MGQ A;  3KFU A;  3SWN C;  2HNI A;  4XEM A;  5E3I A;  2P0L A;  5C51 B;  3A7A A;  5C52 B;  3RES A;  4M75 C;  2ZR2 A;  3JCM c;  1B7Y A;  3JB9 F;  3RL6 A;  4YRS A;  3RIR A;  1WPY A;  5GAN h;  4XU0 A;  4M7D E;  3PGG A;  3QUI A;  5LJ3 f;  2E41 A;  1NJ2 A;  4J5Y A;  4OLF A;  4CH6 A;  1EVL A;  4TTV A;  3W3S A;  1JBM A;  3UGT A;  3JB9 G;  2ZT7 A;  2C8M A;  4P3N A;  1JJC B;  2RB6 A;  3RAC A;  2EJF A;  1D3B A;  3RKW A;  2G4C A;  4RQE A;  3QNE A;  3HXV A;  3UH0 A;  5GAN 6;  3A32 A;  4M7A C;  3WQZ A;  5C53 B;  4XQ3 A;  4C8Q D;  3IKM B;  4M75 F;  1HC7 A;  1X56 A;  1YFR A;  4RMF A;  4P75 A;  4F7U G;  2DZC A;  1LYL A;  1USY C;  3REX A;  4X9D A;  1NJ1 A;  4C8Q F;  1VQZ A;  5LJ3 e;  1NJ5 A;  4M78 E;  2ALY A;  5GAN f;  1NYQ A;  4KR3 A;  3L2Z A;  3PCO A;  5GAO p;  4H02 A;  4M77 G;  1WQ7 A;  3BJU A;  4K88 A;  4J6Y A;  1LJO A;  4TVA B;  5GAN j;  3HSB A;  2ODR D;  3BFM A;  3NEN A;  3VQV A;  3CMQ A;  1WLE A;  1E1O A;  4UP8 A;  3HFO A;  1BBW A;  3TEH A;  5GAN 5;  3V7S A;  1D3B B;  3EFR A;  2RHS A;  3TUP A;  3L4G B;  5GAO n;  1WU7 A;  4EMK C;  4CS2 A;  2ALY B;  4J15 A;  3JB9 H;  3HXY A;  3BW1 A;  5ELN A;  1SET A;  3RF1 A;  2ZNI A;  4CH5 A;  3JB9 J;  5GMK e;  3RER A;  3V8K A;  2ZTG A;  4CS3 A;  1U1T A;  4TQD A;  5GAN e;  1USY A;  2IY5 B;  2ZT8 A;  5GAM g;  4A54 A;  3NEM A;  3A7U A;  4P71 A;  4TVW A;  3L4G A;  4K86 A;  3HXW A;  2DKG A;  4YRC A;  4MMK A;  4NCX A;  3REU A;  4C92 F;  4YRQ A;  3VQW A;  4M75 E;  5ELO A;  1I8F A;  2RHQ B;  4YRL A;  4PNO A;  4C92 E;  5GMK j;  1G5I A;  1EOV A;  3E9I A;  4M7A D;  5GAO l;  1Y96 B;  4BW9 A;  2J3L A;  2DVE A;  4P73 C;  2ZZF A;  4M78 G;  3IKL A;  4Q15 A;  4C92 G;  4RCC A;  3JCM e;  3QTC A;  4M78 D;  1SER A;  4QVD A;  1G51 A;  5GAN 3;  4P72 C;  4HWT A;  4M75 D;  4QVC A;  5LJ5 d;  1EIY B;  4M7D A;  1HTT A;  1KOG A;  1NYR A;  2AMC B;  4Q6G A;  4HWS A;  4C8Q C;  4XTZ A;  5GMK m;  3VBB A;  4M7D F;  4P71 C;  3RGL A;  4M7A E;  2Y90 A;  1EQR A;  4YRF A;  4P72 A;  1KQ1 A;  3AHU A;  2XGT A;  4UP9 A;  4P3P A;  4E51 A;  2DU5 A;  4LNS A;  4H2W A;  3SWN A;  3INZ A;  3V7C A;  1BIB A;  4M7A G;  2DQ0 A;  2QTX A;  2EJG A;  1BIA A;  1X2H A;  3M4P A;  2FB7 A;  1RIQ A;  3ICA A;  4YRI A;  1ASZ A;  4WI1 A;  1PYS A;  1LNX A;  3LC0 A;  2E10 A;  4XTY A;  3HXX A;  1WYD A;  3BY7 A;  5LJ5 f;  2VXF A;  4C92 A;  3JCM h;  5GAO r;  5HGQ A;  4L87 A;  5GAN 8;  3JCM f;  4A53 A;  4CH4 A;  4M7D B;  2ZR3 A;  3QO5 A;  2DXT A;  3I7F A;  3QHS A;  5LJ5 h;  3SWN B;  1YFT A;  4DPG A;  1H4S A;  3QO3 A;  2DTH A;  4M7D C;  12AS A;  1G5H A;  1E1T A;  2JN0 A;  4HVC A;  3ERR A;  3FB9 A;  3BDU A;  3UFG A;  4XEO A;  5LJ3 g;  1ATI A;  4YPF A;  2PMF A;  4X5O A;  1X55 A;  1Z7M A;  4H2X A;  4PJO E;  4EMK A;  2I4O A;  4M75 G;  1PYS B;  1X01 A;  1YB3 A;  4TVY A;  2XTI A;  4F7U F;  2ZT6 A;  3M4Q A;  4K87 A;  4YRM A;  1C0A A;  3JCM V;  2RHS B;  5GMK l;  1B7Y B;  1U1S A;  4YRT A;  1M8V A;  3GIB A;  5GAM h;  5GAM d;  4CS4 A;  2E5A A;  2E64 A;  4M77 F;  11AS A;  2EWN A;  5GAO m;  4WF2 A;  4HWP A;  3G1Z A;  2RA2 A;  2E1H A;  1I4K 1;  2ODR C;  5GAM j;  3A5Y A;  5GAN g;  5K1X A;  1ASY A;  3V8L A;  4UP7 A;  2ZNJ A;  2EAY A;  3FIF A;  1N9S A;  5LJ5 e;  1KMN A;  4RCB A;  2ZCE A;  2Q7G A;  4PG3 A;  2QHS A;  4H2X B;  4YCV A;  4M77 E;  1HK9 A;  4BWA A;  4F7U A;  5I21 A;  4HWR A; 
#chains in the Genus database with same CATH topology
 4Z02 A;  1YJN T;  2YLC A;  5LJ3 h;  1ZUY A;  4QW2 A;  2DL8 A;  3QWY A;  3ER0 A;  1BK2 A;  2LRQ A;  4PJO A;  2EQU A;  2Y4Y A;  3VU3 C;  4JRK A;  2GFU A;  3MEY A;  4PJO F;  4PLL A;  1QF6 A;  2AMC A;  2COW A;  4BE1 A;  3M4G A;  2NUZ A;  4JJN K;  1AOJ A;  2DIL A;  2CH4 W;  3LX7 A;  3P8Y A;  5KCO A;  2JVV A;  2CJ9 A;  1KD1 R;  1UGR B;  2AKK A;  5FWB A;  4H2V A;  3OD1 A;  3HY1 A;  2K2M A;  5GAN 7;  3ZL7 C;  2PME A;  4G84 A;  5I2M A;  1N8R U;  1NNH A;  4XTX A;  2LX9 A;  3WXM B;  3G4S T;  3H0H A;  4CH3 A;  3DLL A;  3LYI A;  2HSE B;  3A1P A;  2D1X A;  4LVJ A;  1S1N A;  3CCJ T;  3OYE A;  2RF0 A;  1X2K A;  2A37 A;  2V1Q A;  3ASK A;  2LVM A;  2RNA A;  5A2Q E;  5GMK i;  1Z7N A;  2Q7H A;  1AWX A;  2LTO A;  2CIM A;  4N4G A;  2IG0 A;  4OMN A;  1FMW A;  1GRI A;  4M4Z A;  1KHC A;  4CC2 A;  1N27 A;  4DOW A;  4GLM A;  3MEU A;  1KHI A;  3BE3 A;  2RQV A;  3GP8 A;  3CCM T;  3CC2 A;  4JUV A;  4TQF A;  2J6K A;  1GCQ C;  1VQ7 Q;  2COZ A;  3GLX A;  1D0X A;  2DPP B;  1J5W A;  3VYG A;  1B34 B;  4OGE A;  2YSQ A;  4XTV A;  1HXD A;  1VQM A;  7AT1 B;  2OTJ Q;  1SES A;  2XD0 A;  1QP3 A;  3OYL A;  3QO7 A;  2X35 A;  2RM4 A;  2MMP A;  2XHC A;  1M3B A;  1KK7 A;  4YDQ A;  3MPU B;  1L0W A;  2MWO A;  1G8X A;  2X4W A;  2JS0 A;  4Q5W A;  3CCU T;  4F17 A;  1QE0 A;  4DBH A;  3HRT A;  3A74 A;  1VYT A;  2FEI A;  2PVG B;  2GQI A;  5CR2 A;  3CCS T;  1GL5 A;  2ZPF B;  2L0A A;  1LVK A;  3I56 T;  2ZGW A;  1VQ8 Q;  1GFC A;  2DF6 A;  1QCO A;  4IUU A;  3FDR A;  2ZZD A;  2CJB A;  1TUG B;  2XIC A;  1Z9Q A;  3M9Q A;  4NOY A;  2EBP A;  1RAD B;  1S72 Q;  2J7I A;  1SHF A;  2DU7 A;  4BAC A;  2LQN A;  1WHG A;  1WIE A;  3E9F A;  1Q81 U;  2QGF B;  2O01 E;  8ATC B;  2ED0 A;  2F5K A;  3CCJ A;  5A0G A;  3E19 A;  1YIT T;  1YGB A;  1UTI A;  1WHM A;  5KH6 A;  2B8A A;  2VGM A;  2YDL A;  2RD1 A;  2ZPB B;  4M78 C;  1TH7 A;  1PSE A;  3MEV A;  2ARS A;  4PLI A;  2X4Y A;  3RKY A;  4OB3 B;  4ZGE B;  1WLP B;  4LDW A;  3ME9 A;  2RN8 A;  9ATC B;  3FJP A;  4JZ4 A;  1X43 A;  4A4G A;  3HRI A;  2Q5I A;  3EGX A;  3T9N A;  1TXQ A;  4AMC A;  3CCS Q;  4EMK B;  2O4X A;  4FT2 A;  4M77 C;  2DL3 A;  3CPF A;  5IHI A;  3L2R A;  1YJW A;  3MJX A;  3NMZ C;  2CUB A;  1M1K R;  3V7R A;  4JPB W;  1F1B B;  2G3R A;  1QCN A;  4XAX B;  5CKD A;  4Y92 A;  1WNL A;  2VXE A;  4ELY C;  2J3M A;  1D1A A;  4CRI A;  3P8V A;  3CCE A;  2EYQ A;  2EGC A;  2KXD A;  4NL2 A;  4HT9 A;  1VQL A;  3KFU A;  1UEC A;  1QVG A;  1X27 A;  3G71 T;  3A7A A;  5C52 B;  2HKN A;  4M75 C;  3JCM c;  1B7Y A;  1JXO A;  3RIR A;  4XU0 A;  4QKU A;  2V1R A;  2MK5 A;  1C6V X;  2DYI A;  4F7U A;  2MI6 A;  3OYB A;  1AD5 A;  2E41 A;  4J7I A;  4MDX A;  2O9S A;  2CUD A;  2KRS A;  1VQ4 T;  4J5Y A;  1K76 A;  2XDP A;  2LCS A;  4E7I A;  3QZ5 B;  3W3S A;  2WAC A;  4LUE A;  2AIR B;  3P8H A;  4L5G A;  4P3N A;  2L3Q A;  1JJC B;  3EG0 A;  2OTJ T;  2XI9 A;  4JJD A;  1G2B A;  1GXI E;  3HXV A;  2ABL A;  2F2X A;  5GAN 6;  1VQ8 T;  2YUO A;  1YWO A;  3IKM B;  4M75 F;  1YFR A;  3FRN A;  3G7Z A;  4FL6 A;  2KEA A;  2DZC A;  1LYL A;  2DYB A;  4R56 A;  1VQZ A;  1ZHI A;  3UWN A;  5D7U A;  2YXY A;  5GAN f;  1SF9 A;  4J9C A;  3M0R A;  2D6F A;  4GBQ A;  2DEU A;  4TVA B;  1YFN A;  4DOV A;  2ODR D;  2YRD A;  4F16 A;  1YI2 T;  1FYN A;  3EFO A;  1Y7X A;  3NEN A;  3VQV A;  1ZQ1 A;  1W6X A;  2L89 A;  1G3W A;  1SHG A;  2P4T A;  4KRT A;  2FPE A;  4AFU C;  2IVW A;  1RLQ C;  4ZGD B;  3I55 A;  1R77 A;  1YIJ Q;  2KAF A;  2GGR A;  4OML A;  2MYS A;  1UGV A;  2BTT A;  4RTT A;  2BIV A;  1U8R A;  2ZPE B;  5CIU A;  4J9D A;  2JXB A;  1A0N B;  2E12 A;  1VQ9 A;  3RF1 A;  1M1K C;  4CH5 A;  3RER A;  4CS3 A;  1WHK A;  4TQD A;  3X26 B;  2O4X B;  3I35 A;  3MP1 A;  2EYY A;  3A7U A;  2O31 A;  1UHC A;  2FRW A;  2XDD A;  3L4G A;  4K86 A;  1UJY A;  2CP5 A;  2DKG A;  4NCX A;  2FVU A;  1W2B A;  3VQW A;  2DMO A;  2A7Y A;  1M3A A;  4ATO A;  1G5I A;  5DM7 R;  1M4Z A;  4M7A D;  2K2V A;  1Y96 B;  2L3R A;  3O8V A;  2DVE A;  2H3E B;  5KE2 A;  2CT4 A;  1OQK A;  3M0S A;  3G71 Q;  2ZZF A;  4Q15 A;  1B07 A;  4RCC A;  3UT1 A;  3CQT A;  2NYS A;  3H9N A;  2EKO A;  1SER A;  4QVD A;  1G3T A;  1N8R C;  5GAN 3;  1P92 A;  4QVC A;  4M7D A;  1WHL A;  1WHH A;  4HWS A;  2O2O A;  1RAH B;  1EQR A;  2IPO B;  3LH0 A;  3AHU A;  3LGL A;  4P3P A;  1MHN A;  1SKU B;  3M0Q A;  4FW2 A;  4FM4 B;  1WDX A;  3V7C A;  4KH1 B;  3CCJ Q;  2R5M A;  2HQE A;  2EIF A;  1Q7Y C;  1VQ4 Q;  4IUQ A;  2DX1 A;  1O9S A;  1ASZ A;  4WI1 A;  3REA B;  2KR3 A;  2NLU A;  3CC2 T;  4J9F A;  1PYS A;  3NHN A;  2XID A;  4L6V 5;  1NJI R;  2LJ3 A;  1M30 A;  5KYU A;  2KNB B;  1VQ6 T;  5GAO r;  2PQW A;  4ZN1 A;  2RQW A;  2JMA A;  2PUO B;  5ECA A;  2DXT A;  1CKB A;  3SWN B;  2SRC A;  2ZPI B;  4DPG A;  3OA6 A;  3M53 A;  5GJV B;  4AFS C;  4M7D C;  2DJQ A;  3VS5 A;  1E1T A;  1FXX A;  3ERR A;  1NPR A;  2XDB A;  2EYW A;  1D0Z A;  3I9Q A;  4XEO A;  1ATI A;  4X5O A;  1NEB A;  1QCF A;  4N4H A;  5IN1 A;  1K0S A;  1I1J A;  3UDC A;  4PJO E;  2DD5 A;  1X01 A;  5D6Y A;  5AT1 B;  5CKE A;  4E7Z A;  4YRM A;  1V1C A;  3JCM V;  3OYI A;  2K5I A;  2LQW A;  1ACM B;  1FWZ A;  2JOY A;  4JJC A;  3TSZ A;  3CCQ A;  4WF2 A;  2EW3 A;  5CCA A;  3A98 A;  2ODR C;  5GAM j;  5GAN g;  5K1X A;  3V8L A;  2JJ9 A;  1N9S A;  5LJ5 e;  1KMN A;  3KFV A;  1D09 B;  2L3P A;  3EG3 A;  4MZP A;  4PG3 A;  1MMG A;  2DBK A;  1HK9 A;  2JTE A;  1X75 C;  2X3W D;  5CAI A;  4C5H A;  2OTL A;  1B70 B;  1RAG B;  5KYY B;  1Q86 C;  4YRK A;  1LPL A;  1T3S A;  2D9T A;  1EFW A;  2PUK B;  1IZ6 A;  1PC0 A;  2DL7 A;  3QJ6 A;  4M77 A;  1KQS S;  5GAM e;  1AEY A;  3QO8 A;  3G71 A;  1RL2 A;  2QEX T;  1YJN A;  3CBO A;  2I4N A;  4YCW A;  2DDZ A;  3QWX X;  1Y71 A;  3REB B;  1XOV A;  1YWP A;  3CC7 T;  3GNF B;  2DAQ A;  2P0K A;  4IUP A;  2GCX A;  4N0A A;  1Q7Y U;  4JRI A;  4FYY B;  4E7L A;  4KGV B;  4YCU A;  2OI3 A;  3CC4 T;  4HT4 A;  4YRE A;  1H64 1;  3PE0 A;  4N0A C;  5LJ3 d;  3CC2 Q;  3IAL A;  1M8M A;  4YRN A;  2QHV A;  1YIJ T;  1YCY A;  1UUE A;  2A8E A;  1IRX A;  4DEX A;  1TTH B;  2RI2 A;  3CMA Q;  1PG5 B;  2PU9 B;  3R6N A;  2JMC A;  4YRR A;  1VQ9 Q;  2K3B A;  4M77 D;  2RHI A;  5LJ3 j;  3O5Z A;  1M1F A;  1T3L A;  1VQP Q;  1D1C A;  1O75 A;  3I55 Q;  1NE8 A;  1OZ2 A;  2GFA A;  3VQX A;  2BKD N;  2JM9 A;  3QII A;  5A0L A;  1H4V B;  4ELZ C;  4FYV B;  4YRJ A;  4TVR A;  2VB6 A;  1ZA1 B;  3UA7 A;  5FWC A;  2EJ9 A;  3CCU A;  1M27 C;  3MEW A;  1WZO A;  1VQO Q;  4BB7 A;  3P8T A;  2IY5 A;  4J6W A;  3A8H B;  1WQW A;  2CT3 A;  1N8R R;  3CPW P;  2I4L A;  1X6O A;  2ZT5 A;  2DQ3 A;  4J83 A;  1VYU A;  4KT0 E;  2ATC B;  2HDA A;  4AFZ C;  3JCM P;  4Z88 A;  2KE9 A;  3SFM A;  1NEG A;  4ZTZ B;  1PM3 A;  2DXU A;  1BKB A;  2AKW B;  3VS6 A;  3UAT A;  2KXC A;  1M1K U;  1QWE A;  5KNN A;  1U3O A;  2EGE A;  1HD3 A;  2DVJ A;  2ZXF A;  1NJ8 A;  2VGN A;  1IL2 A;  4AH6 A;  5HCK A;  4FU6 A;  4A4H A;  5CKB A;  3JCM d;  3CXC A;  2ARU A;  2L8D A;  3QYG B;  4XTU A;  2CZ0 B;  1KC8 R;  2EPD A;  1OPK A;  2QHT A;  1OYX A;  1QLY A;  3X28 B;  1VIE A;  3QKJ A;  3TEE A;  3ULR B;  2DL5 A;  1EX4 A;  2M16 A;  5HKC A;  1E22 A;  5KYU B;  1ZSZ C;  1FYF A;  1D1B A;  1T0J A;  3WVE B;  1UFF A;  1VQ6 Q;  1Y57 A;  2Q5H A;  1YI2 Q;  3OYD A;  2AKW A;  3FJ5 A;  2V26 A;  4XK8 E;  3UGQ A;  4PL6 A;  5FW9 A;  3JV3 A;  3JSC A;  4RTV A;  4PHC A;  3OYJ A;  2YUP A;  2CP2 A;  3DB3 A;  4KR2 A;  3OW2 P;  5DY9 A;  3NFC A;  2O9V A;  2J05 A;  2DTO A;  5CKH A;  4HT8 A;  3CD6 Q;  4EMH A;  3NPF A;  2RO0 A;  5GAN 2;  1AZE A;  3QBY A;  3JCM b;  3FC3 A;  4H2U A;  2EGA A;  1B70 A;  2QQA A;  2QAZ A;  1X54 A;  3PIP A;  2DM1 A;  2M02 A;  2NWM A;  1OU9 A;  4F14 A;  2X51 A;  4H2Y A;  4LXC A;  2E65 A;  1Q86 R;  3VQY A;  4RQF A;  1WYX A;  2H8H A;  4X9C A;  1YJW T;  2CSI A;  4HVW A;  4WJ4 A;  5KYW A;  1M2V B;  2COY A;  4P74 C;  1B76 A;  2RJF A;  1N9R A;  2AHJ B;  1N9W A;  1W4S A;  2PVO B;  3JRZ A;  2HNI A;  3SD4 A;  5E3I A;  2P0L A;  1KSW A;  1VQO T;  2VKN A;  3JB9 F;  3RL6 A;  3NTI A;  3PGG A;  3QUI A;  1YJN Q;  1AWO A;  1QP2 A;  5LJ3 f;  1E6G A;  2AT1 B;  4CH6 A;  2AK5 A;  3OY9 A;  2GQV A;  1PCX A;  4BUG A;  1JBM A;  3VYH B;  2AZV A;  2ZT7 A;  4JZ3 A;  1KC8 C;  3RAC A;  2EJF A;  2YRV A;  3IQL A;  4QQG A;  4FSS A;  2KMT A;  4OMF B;  3QNE A;  2YWW A;  3P8D A;  1YJ9 T;  2R57 A;  5I22 A;  4M7A C;  3A32 A;  5C53 B;  2KI7 A;  1VQM T;  1XTD A;  1HC7 A;  3KXT A;  3I5R A;  4F7U G;  2CYZ B;  1NJ1 A;  3TCJ A;  5LJ3 e;  2PNI A;  2ALY A;  3I55 T;  4KR3 A;  5HY6 A;  1QKX A;  5GAO p;  2YUN A;  4R0K A;  1WQ7 A;  1MND A;  1I0C A;  2DRK A;  4J6Y A;  1S72 A;  3M56 A;  1GBQ A;  2D0Q B;  3EG9 A;  2CZ1 B;  3L2Q A;  3ZFJ A;  5FU6 C;  1ZBX A;  1E1O A;  2DXB A;  1IHW A;  3HFO A;  1BBW A;  4UP8 A;  1RI0 A;  4PJM A;  3V7S A;  1MUZ A;  4RUG A;  1D3B B;  1VQN A;  3FLG A;  1SPK A;  1NBE B;  1RAE B;  1WU7 A;  4II1 A;  4BY6 B;  3JB9 H;  4RMO A;  4ZGJ B;  2HBW A;  3TRE A;  3HXY A;  1NG2 A;  5EG2 A;  1NYG A;  2ROL A;  1YI2 A;  2RJE A;  3OBY A;  1JJ2 S;  1U1T A;  1UEB A;  4JJB A;  1KQS A;  3VRY A;  3X25 B;  4A54 A;  4P71 A;  4MDW A;  2VAS A;  4TVW A;  2PTK A;  2RH2 A;  1Z9Z A;  1CSK A;  1FX7 A;  4GY5 A;  3HXW A;  4MMK A;  1WFW A;  4PKC C;  3I56 A;  3M58 A;  3REU A;  4YRQ A;  2XMF A;  3EH2 A;  5HK3 A;  4HCB A;  3CXC P;  4C92 E;  1ABQ A;  3CCL T;  3MEA A;  3E9I A;  1TU0 B;  4LDV A;  3VS7 A;  1QWF A;  3NGP A;  3JCM e;  3G4S Q;  2QQ9 A;  3QTC A;  2QYZ A;  3PT9 A;  2G6F X;  2C0T A;  4BDY A;  4A63 B;  4B9X A;  1G3S A;  1YHQ Q;  3VUZ A;  5IXB A;  1PKT A;  3PMT A;  1MNE A;  4J9H A;  3OMC A;  4XTZ A;  5GMK m;  2FL7 A;  4P71 C;  2RPN A;  1QW1 A;  4M7A E;  1G5V A;  2ZAE A;  1RAA B;  1BI3 A;  4E51 A;  2DU5 A;  4IIO A;  3HPW A;  4LNS A;  1C1A A;  1K73 C;  4A4E A;  1BIB A;  2DQ0 A;  1W2B P;  1NJI U;  3OYM A;  1NZ9 A;  3ICA A;  4YRI A;  4MZM A;  4ORZ A;  1YBY A;  2EFI A;  1OPL A;  2LT4 A;  1VQN Q;  2JTF A;  1LNX A;  3HXX A;  2D0N A;  1GCP A;  3BY7 A;  1WYD A;  5LJ5 f;  1J3T A;  2VXF A;  4LD9 K;  2HZY A;  4LDU A;  4KUL A;  4C92 A;  3VV0 A;  2V8I A;  5HGQ A;  1JQQ A;  2JUF A;  5GAN 8;  3JCM f;  4A53 A;  4CH4 A;  4JRQ A;  2HKQ B;  2LMJ A;  2RHY A;  4CI0 C;  1K8A U;  5LJ5 h;  3I7F A;  4WTO B;  1RAC B;  4VUB A;  5J26 A;  1YFT A;  2E6Z A;  2K3Y A;  1H4S A;  3QO3 A;  4RG8 A;  2JN0 A;  1M9S A;  3NTH A;  1IHV A;  2EVR A;  3OMG A;  2WSE E;  1EZZ B;  5LJ3 g;  4OB1 B;  2PMF A;  1MMD A;  3GBQ A;  3I56 Q;  4BDZ A;  2Y4X A;  1Z7M A;  4H2X A;  2ROT A;  3L2W A;  2I4O A;  4M75 G;  1K9M C;  3OYN A;  1YB3 A;  2RJD A;  5HK0 A;  3M4Q A;  1C0A A;  3VS3 A;  1PRM C;  2KSS A;  3QPH A;  1K8A R;  2DLP A;  4IUV A;  4JLG A;  1U1S A;  3RDV A;  4B9W A;  4YRT A;  3GIB A;  4RTZ A;  3L42 A;  1TOV A;  5A0D A;  4CS4 A;  4M77 F;  1BCM A;  2K79 A;  4J9B A;  5GAO m;  2A36 A;  1QKW A;  2HEQ A;  2NUT B;  4HWP A;  1XJW B;  1WJQ A;  2HSP A;  2RA2 A;  1KG1 A;  1I4K 1;  4GLK A;  3J7A F;  1AWJ A;  4RCB A;  2ZCE A;  2QA4 A;  2VVK A;  1VQ9 T;  4YCV A;  2LCL A;  1C0M A;  2LNH B;  2DER A;  1B3Q A;  2MOX A;  2A3L A;  3F70 A;  1NM7 A;  3H8Z A;  2O88 A;  3M55 A;  1K4U S;  2YT6 A;  1ZX6 A;  3EFS A;  1JJC A;  1EIF A;  4MML A;  4PJJ A;  2KQW A;  1PNJ A;  1QVF S;  3VKI A;  3QG1 A;  3A8O B;  1M3C A;  3ZBD A;  1SRY A;  2C7I A;  1W66 A;  3VUB A;  4Z8A A;  2QEX A;  2FPD A;  3JCM W;  2DD4 A;  2HAX A;  2VYT A;  4EO4 A;  4P75 C;  4DEY A;  5IAY A;  2ZIN A;  2DEQ A;  1YIJ A;  3DSQ A;  3H41 A;  4G85 A;  1WXB A;  1PKS A;  3OSV A;  2ECZ A;  1R8O B;  3RUX A;  4F7U B;  2CGH A;  2DZ9 A;  3X24 B;  3J81 E;  1SSH A;  3E1S A;  3WVD B;  3EFO B;  3L2U A;  4FCY A;  2SEM A;  4C8Q A;  2FZK B;  3G1J A;  1KC8 U;  5KYW B;  3THK A;  3QDF A;  4PJO B;  3M0T A;  4KUD K;  4XU3 A;  2E5Q A;  3MP6 A;  3MQZ A;  2P84 A;  4M75 B;  4KGX B;  4DQ2 A;  1Q86 U;  4LD6 A;  5IHK A;  1H4Q A;  1BI1 A;  1KFZ A;  4E7J A;  5J3B A;  2CSQ A;  2VC8 A;  3SB2 A;  1Y0M A;  2ZIO A;  3JCM J;  1KQ2 A;  1YFS A;  1LCK A;  3NEL A;  1W1F A;  3EGD A;  4EIK A;  2P5I A;  2DE0 X;  1HSQ A;  2KYB A;  2QA4 T;  3RKX A;  2K9G A;  3M5A A;  2BZ8 A;  3PVL A;  4X1V A;  2YLB A;  4ZTU B;  1JRI A;  2FYK A;  2LJ1 A;  1ZBJ A;  3HTZ A;  2FRY A;  1UE9 A;  3GOX A;  2DTI A;  4ZTJ A;  4C0D B;  2KDS A;  4OMM A;  3GPL A;  1H4T A;  3A5Z A;  4OP0 A;  3E2U A;  5D6X A;  2RQR A;  2LX7 A;  3LWI A;  1Q82 C;  3RMQ A;  2E3H A;  1WHJ A;  2PVD B;  1QVP A;  1KJW A;  3OS0 A;  1UB4 A;  2K4Y A;  1VQ6 A;  1IRE B;  3EGU A;  3JB9 I;  3CEY A;  2NS6 A;  1JJ2 A;  1MV0 B;  2R58 A;  3CCV A;  2P0Q A;  4WJ3 M;  4WCI A;  2HQH A;  4PJO C;  3EG2 A;  2DK3 A;  2RHX A;  4M7D D;  2P4R A;  4MZT A;  4TVA A;  2X4J A;  1WGS A;  1VQP A;  4M7D G;  1MMN A;  1JJ2 P;  1UJ0 A;  4OMO A;  4C92 C;  2M0Y A;  3PIO A;  1AVZ C;  1RAI B;  2NUT A;  1EVK A;  4LUD A;  3RNJ A;  2A0F B;  4HCK A;  3IG2 A;  2J06 A;  4ME7 A;  2VV5 A;  2CP0 A;  3E9H A;  2HCK A;  4QT7 A;  3MF1 A;  1AT1 B;  4X34 A;  4M77 B;  3CCL A;  4PFZ A;  4M78 F;  3CCQ T;  5CKF A;  1I5L A;  4C8Q E;  1VQL Q;  1SRM A;  1RLP C;  3R6O A;  4C5E A;  1ABO A;  2LJ0 A;  3HXU A;  3N5B B;  2JNG A;  3HRU A;  2KRM A;  4F04 B;  1YCS B;  1ZA2 B;  2NUP A;  4PFP A;  4E2F B;  1IO6 A;  5GAN 4;  1IXD A;  2QG9 B;  3M59 A;  2YUQ A;  1NJ6 A;  2E3C A;  4YRP A;  4JS5 A;  3X20 B;  4H2T A;  4RDX A;  3HFZ B;  3CC4 A;  4M75 A;  1RAF B;  4XU2 A;  5KYY A;  2D8H A;  3EG1 A;  1BBZ A;  4J9G A;  4M78 A;  3J80 E;  3OYA A;  3OB9 A;  2EQK A;  3NET A;  1MGQ A;  2WSF E;  2IIM A;  3CCS A;  4XEM A;  5C51 B;  3HL8 A;  1BB9 A;  3RES A;  1OU8 A;  3OYG A;  4YRS A;  5GAN h;  3SEM A;  2FHD A;  3UF4 A;  3MKD A;  4LVL A;  3PTA A;  1I5O B;  5DLQ E;  3GF5 A;  3EHQ A;  1NJ2 A;  1QMC A;  5I11 A;  3URG A;  3HTR A;  3UGT A;  2KRO A;  4AG2 C;  2OAW A;  2C8M A;  3A5Z B;  5CO7 A;  2GF7 A;  5LL6 S;  4PFO A;  3S3M A;  2W0Z A;  4KBM B;  2LQ8 A;  3VS4 A;  4C8Q D;  2ZPG B;  3CCM Q;  1YIT Q;  4P75 A;  2MPX C;  2F5T X;  3CCV T;  4FW1 A;  1M2V A;  2CZ6 B;  3LW5 E;  3REX A;  4X9D A;  3A8M B;  4C8Q F;  2AKL A;  1YHQ T;  4M78 E;  1OOT A;  1NYQ A;  2FZC B;  3L2Z A;  4H02 A;  4M77 G;  4K88 A;  1LJO A;  3OYH A;  1D0Y A;  1VIF A;  1VOM A;  3DLM A;  1Q82 U;  1YIT A;  1WLE A;  1QQJ A;  3TEH A;  1PRL C;  5FRO A;  5GAN 5;  1H3H A;  1R0B G;  2EKH A;  1VQK A;  1G3Y A;  2DA9 A;  4O5V A;  4EMK C;  4L59 A;  4CS2 A;  3G6E T;  2K7A A;  2ALY B;  1VA7 A;  4QVZ A;  2CH4 A;  3BW1 A;  5ELN A;  2LDM A;  1SET A;  3CPW S;  2QDL A;  3MP8 A;  3CXC S;  4LDY A;  2ZNI A;  3JB9 J;  2X9H A;  3RBB B;  1BU1 A;  1NPP A;  1USY A;  2ZT8 A;  1QVF A;  5GAM g;  3S3N A;  1IB8 A;  2L3S A;  1WXT A;  1SSF A;  2GTO A;  1T0H A;  3EAE A;  1ZLM A;  3CCR Q;  2JS2 A;  3HKS A;  1BYM A;  2OAU A;  1U06 A;  2KVQ G;  1WJS A;  4C92 F;  4J9I A;  4PJL A;  2GTJ A;  4NS5 A;  4M75 E;  3EHR A;  3VS1 A;  5ELO A;  4PK4 A;  4PNO A;  2ENM A;  2OTL Q;  3PNW C;  1MV3 A;  1IGU A;  1VQ5 Q;  1IGQ A;  1TG0 A;  4BW9 A;  3QDR B;  2J3L A;  3M4Y A;  4P73 C;  4IUR A;  3IKL A;  4C92 G;  4ANJ A;  2XG8 D;  4M78 D;  2JTM A;  4P72 C;  3LGF A;  4HWT A;  4M75 D;  5J39 A;  1EIY B;  1HTT A;  4Q6G A;  2QEX Q;  3H0I A;  1HYO A;  1YHQ A;  2OJ2 A;  2XKO C;  1VQM Q;  3VBB A;  3FEO A;  2Y90 A;  4YRF A;  3TU4 K;  4P72 A;  2NUP B;  4UP9 A;  1XQH A;  3CCL Q;  4H2W A;  4N4I A;  2QI2 A;  3INZ A;  4M7A G;  1OUL A;  3G6E A;  2LC4 A;  1YP5 A;  2EJG A;  1BIA A;  3RMS A;  3M4P A;  2FB7 A;  1RIQ A;  1Y07 A;  4ESR A;  1ZUK A;  5FU7 C;  1KD1 U;  1GCQ A;  4XTY A;  2OTL T;  3EGX B;  2CRE A;  3C94 A;  3D7S B;  3M57 A;  4JDS A;  4BI3 A;  4L87 A;  2QGG A;  3OQ5 A;  4M7D B;  4AG1 C;  5L8R E;  1JB0 E;  2RK2 A;  1PSF A;  2KK4 A;  3E9G A;  1G5H A;  4HVC A;  3UFG A;  1SEM A;  4HVU A;  1B7T A;  3CC7 A;  4KUI A;  4YPF A;  1VQO A;  1VQK T;  3H0F A;  1X55 A;  1PD1 A;  5CQX A;  4UC4 A;  2DL4 A;  4P5N A;  2F2V A;  1QVG P;  1PYS B;  4TVY A;  2XTI A;  4K87 A;  3A8L B;  5FRM A;  2E6N A;  3OS5 A;  5GMK l;  2KBT A;  1B7Y B;  3MCA B;  4ZNX A;  1M8V A;  1K9M U;  5GAM h;  2E5A A;  4DBQ A;  2EWN A;  4FYW B;  1Q7Y R;  2DBM A;  3G1Z A;  2BZX A;  2M1H A;  2E1H A;  4D8D A;  3A5Y A;  1ASY A;  1V76 A;  4UP7 A;  2ZNJ A;  1ZSZ B;  3ZEH A;  2EAY A;  2MCN A;  1K0X A;  2QQB A;  4RTX A;  3OYK A;  4CC7 A;  4B6M A;  4D8K A;  3CCV Q;  1VUB A;  5EC7 A;  4M77 E;  4BWA A;  5I21 A;  1TWB A;  4HWR A;  3CCU Q;  1NYF A;  1Y96 A;  4RG2 A;  3CCE T;  2I2L A;  1X69 A;  1JXM A;  2KT8 A;  3OW2 A;  4Y28 E;  4ZN3 A;  4C8Q G;  2LNV A;  2KT1 A;  2CJA A;  2FZG B;  4JS4 A;  2L5Q A;  2ZPH B;  4PJO D;  2Z0W A;  5LJ5 j;  3HY0 A;  5FLX E;  1YJW Q;  2ZZG A;  1Q95 G;  4E47 A;  4J6X A;  1ZSG A;  4IUT A;  2BZY A;  4C0F A;  2QTV A;  4RKU E;  3DB4 A;  1K73 U;  1EFN A;  4HKE A;  3QSU A;  4M7A A;  4A4F A;  3CMA A;  4LVM A;  1BCO A;  4HA8 A;  3HFV A;  2CP3 A;  4QQ6 A;  4AT1 B;  3LSS A;  1QVG S;  1TUD A;  3TEH B;  3NTK A;  2EQM A;  2XK0 A;  2EL9 A;  3TEG A;  5C0M A;  1M5Q 1;  4NL3 A;  4P74 A;  4TWA A;  1KMM A;  5D6W A;  3SDZ A;  1QVF P;  5GAO q;  4YP0 A;  4H2S A;  3G6E Q;  3EG9 B;  3PCO B;  4Y91 A;  4IKF A;  2OTJ A;  3HXZ A;  4LVI A;  4BE2 A;  4V2S A;  3PVQ A;  5CVI A;  4OMP A;  4PJO G;  1K9M R;  4ZIB A;  1BI2 A;  2DFU A;  2K57 A;  5LJ5 g;  3KUF A;  1PWT A;  1WX6 A;  1EIY A;  2DRM A;  3JCM Q;  4DA4 A;  3CD6 T;  2ZIM A;  5K1P A;  3A31 A;  2ZZE A;  1YNZ A;  3JCM g;  1RAB B;  3UA6 A;  3LSQ A;  2CKK A;  1AHJ B;  2MF2 A;  1GBR A;  2RQT A;  4C5I A;  2J6F A;  4M7A F;  1XNI A;  2K5L A;  1M90 R;  2Q7E A;  5GAM f;  1ADJ A;  3A7R A;  5GAN d;  1X6G A;  4AFQ C;  3CBM A;  4LE9 A;  4J9E A;  1KQS P;  2DJZ A;  1G83 A;  1VQ8 A;  5IT9 E;  4M78 B;  2K6D A;  2C0I A;  1I81 A;  3V8J A;  1UGS B;  2R5A A;  1OX9 A;  1E24 A;  1B8A A;  2ART A;  2WSC E;  3U23 A;  2DXC A;  1X2G A;  1Q81 R;  4P73 A;  5IH2 A;  3CME T;  2JM8 A;  3JAM E;  5KYX A;  4C8Q B;  3CCQ Q;  2DET A;  4EMG A;  5C6S A;  4EX5 A;  4XU1 A;  1K73 R;  4O2D A;  3OSS C;  3MF2 A;  2YHT A;  3MET A;  4YYE A;  5IXF A;  1PHT A;  3CPW A;  4C92 B;  1TUC A;  1SG5 A;  1OI1 A;  3HFZ A;  4UPA A;  2EYZ A;  4XTW A;  1ZSZ A;  5CQY A;  4FSX A;  1K1Z A;  4BD3 A;  2RI3 A;  3P8B B;  2M9U A;  3H6Z A;  3HFN A;  3MO8 A;  5AYF A;  3S6W A;  4HWO A;  3JCM X;  4JLI A;  2QHU A;  2XU8 A;  1VQ7 T;  2E3I A;  1NJI C;  1W2B S;  2ESW A;  4C0G A;  3PFS A;  3SHW A;  2RJC A;  4F7U E;  4LDX A;  2EQI A;  1GGM A;  4M7A B;  4BI4 A;  4LVK A;  1VYV A;  5GJW B;  1KIK A;  4YRO A;  3CMA T;  1B34 A;  4C92 D;  1OV3 A;  3CCR A;  4P3O A;  1H3Z A;  1N6A A;  4FYX B;  1ADY A;  2I4M A;  3OYC A;  3L2V A;  4HCC A;  1VQP T;  2KRN A;  3I5S A;  4LNP A;  1X6B A;  4YRG A;  4CC4 B;  2AZS A;  2CP6 A;  3AT1 B;  3HRK A;  3R07 A;  1H8K A;  2CS7 A;  2RHQ A;  5IHN A;  2RQU A;  1LOJ A;  1V29 B;  3L1A A;  2J6O A;  5CK9 A;  1FMK A;  3CME A;  3JB9 D;  3MHX A;  4DBF A;  2C06 A;  2DNU A;  1BBU A;  2E4H A;  1Q81 C;  5GMK h;  4KQE A;  3RR6 A;  1UG1 A;  3UPU A;  2EQJ A;  4KH0 B;  3BDL A;  3PZC A;  5F5W A;  4OGC A;  3HHT B;  3CC4 Q;  4FIB A;  3SWN C;  3TSW A;  1WXU A;  2ZR2 A;  2MIO A;  1I07 A;  3C0C A;  3HRS A;  1WPY A;  2ZCF B;  4ZTF A;  2QK0 A;  3A8G B;  4M7D E;  1RUW A;  1SRL A;  3HP9 A;  4BI8 B;  2BUD A;  4R55 A;  3C95 A;  4JRP A;  3KBG A;  4OLF A;  1M1G A;  1YN8 A;  1EVL A;  4TTV A;  3LLR A;  5KYN A;  3JB9 G;  3EGD B;  4A4K A;  2K3X A;  2RB6 A;  1VQ4 A;  1D3B A;  3OBW A;  2BE7 D;  1DJ7 B;  3RKW A;  1M90 C;  2C0O A;  2G4C A;  4RQE A;  3G4S A;  3UH0 A;  1UGQ B;  3WQZ A;  1JEG A;  4XQ3 A;  3C12 A;  3QXE B;  1X56 A;  2A28 A;  3LH5 A;  4RMF A;  3OS1 A;  1NLP C;  2BE9 B;  1USY C;  1OX8 A;  2VUB A;  2W10 A;  2M0O A;  1NJ5 A;  2HQX A;  2MAM A;  3M0P A;  4KGZ B;  3PCO A;  2F1L A;  2X3X D;  3BJU A;  1N5Z A;  2V8J A;  5GAN j;  3HSB A;  1K8A C;  1M2O A;  1MMA A;  2OX7 A;  3BFM A;  2P0P A;  3CMQ A;  2QDY B;  2FPF A;  5KCH A;  3EFR A;  2RHS A;  2HL5 C;  3TUP A;  3S3O A;  3L4G B;  5GAO n;  2LCC A;  3GNG A;  2GBQ A;  4J15 A;  1H92 A;  3OYF A;  1WA7 A;  4YTL A;  2LZ6 B;  4C0Z A;  2QQR A;  3CCE Q;  1R0C B;  4IIM A;  1TS9 A;  3OW2 S;  2LP5 A;  5GMK e;  3V8K A;  2ZTG A;  2F69 A;  5GAN e;  2IY5 B;  3NEM A;  1OEB A;  4K11 A;  3OS2 A;  3VRZ A;  2HL3 A;  1K9A A;  2JT4 A;  2KYM A;  4YRC A;  4Z89 A;  1E7O A;  2MWP A;  4OB0 B;  4O6J A;  3VS0 A;  1Q82 R;  4RTU A;  2K5F A;  1I8F A;  2RHQ B;  4YRL A;  2DIG A;  5KYX B;  2E70 A;  2M51 A;  5GMK j;  4QQD A;  2JW4 A;  3LWH A;  5M9O A;  2HMA A;  1EOV A;  5GAO l;  4RTW A;  4E7H A;  3M0U A;  4M78 G;  4HVV A;  4E6R A;  2VWF A;  2DIQ A;  1VQ5 T;  1G51 A;  2DO3 A;  2FO0 A;  1NLO C;  5LJ5 d;  3DKM A;  2FG0 A;  1KOG A;  1VQK Q;  1NYR A;  2AMC B;  2B86 A;  4C8Q C;  1YJ9 Q;  4E7S A;  5FU7 B;  4M7D F;  3RGL A;  4DBR A;  2LQK A;  3C4S A;  4FT4 A;  6AT1 B;  1KQ1 A;  1E6H A;  1TSF A;  2XGT A;  2KGT A;  3QZ9 B;  1BI0 A;  2A08 A;  1ZUU A;  3CD6 A;  1VQN T;  3VJP A;  3M54 A;  3SWN A;  4LN2 A;  1HJD A;  3TQ7 P;  4C5G A;  5FU6 B;  5KE3 A;  2QTX A;  2H3J A;  2ED1 A;  1X2H A;  2HD0 A;  2KY9 A;  1YJ9 A;  1JU5 C;  3LC0 A;  2E10 A;  1OZ3 A;  2L2P A;  3CC7 Q;  2F2W A;  3CBP A;  2YRC A;  1WI7 A;  5DLO A;  2RHZ A;  5I2S A;  3JCM h;  4EPC A;  1UHF A;  1VQL T;  2ZR3 A;  3QO5 A;  3QHS A;  4HXJ A;  2QAS A;  2RMO A;  3VS2 A;  1KD1 C;  2DTH A;  1S72 T;  2CZ7 B;  3OYY A;  12AS A;  1CKA A;  4OMQ A;  3FB9 A;  3BDU A;  3EH1 A;  4BE0 A;  3QJY A;  1M90 U;  1AWW A;  5L23 A;  1VQ7 A;  2QQS A;  4PJN A;  2V8K A;  5FRN A;  1UGP B;  1AZG B;  1U5S A;  3CME Q;  1GFD A;  2CP7 A;  2I0N A;  4EMK A;  2CDT A;  4CC3 A;  2QA4 Q;  4F7U F;  3TVT A;  2X4X A;  1ARK A;  3Q1J A;  1VQ5 A;  2GNC A;  2ZT6 A;  2RHS B;  2QXF A;  1UDL A;  4J7F A;  8AT1 B;  3PMI A;  2D8J A;  1X2Q A;  2RHU A;  2EYX A;  2HBP A;  5GAM d;  1W70 A;  2E64 A;  11AS A;  2RI5 A;  3CCR T;  4D6W A;  4RTY A;  3QYH B;  4E7K A;  2PZ1 A;  1FMV A;  3CCM A;  2RK1 A;  1JO8 A;  1RI9 A;  3FIF A;  4OB2 B;  4OVA A;  1WJR A;  4EDU A;  4C0D C;  2E5K A;  1PD0 A;  4J8O A;  4OF1 A;  2Q7G A;  2JZ2 A;  2QHS A;  4H2X B;  4BY6 C;  2LT1 A;  4HCZ A; 
#chains in the Genus database with same CATH homology
 4Z02 A;  1YJN T;  2YLC A;  5LJ3 h;  4QW2 A;  3ER0 A;  2LRQ A;  4PJO A;  2EQU A;  2Y4Y A;  3VU3 C;  4JRK A;  2GFU A;  3MEY A;  4PJO F;  4PLL A;  1QF6 A;  2AMC A;  4BE1 A;  3M4G A;  4JJN K;  3LX7 A;  3P8Y A;  5KCO A;  2JVV A;  2CJ9 A;  1UGR B;  4H2V A;  3OD1 A;  3HY1 A;  5GAN 7;  2PME A;  4G84 A;  5I2M A;  1N8R U;  1NNH A;  4XTX A;  2LX9 A;  3WXM B;  3G4S T;  4CH3 A;  3DLL A;  3LYI A;  4LVJ A;  3CCJ T;  3OYE A;  3ASK A;  2LVM A;  5A2Q E;  5GMK i;  1Z7N A;  2Q7H A;  2CIM A;  2LTO A;  4N4G A;  2IG0 A;  1KHC A;  1N27 A;  4DOW A;  3MEU A;  1KHI A;  3CCM T;  3GP8 A;  3CC2 A;  4JUV A;  4TQF A;  3GLX A;  2DPP B;  1J5W A;  3VYG A;  1B34 B;  4OGE A;  4XTV A;  1HXD A;  1VQM A;  1SES A;  2XD0 A;  1QP3 A;  3OYL A;  3QO7 A;  2X35 A;  2RM4 A;  2MMP A;  2XHC A;  4YDQ A;  1L0W A;  2MWO A;  2X4W A;  4Q5W A;  3CCU T;  1QE0 A;  3HRT A;  3A74 A;  2PVG B;  5CR2 A;  3CCS T;  2ZPF B;  3I56 T;  2ZGW A;  4IUU A;  3FDR A;  2ZZD A;  2CJB A;  2XIC A;  3M9Q A;  4NOY A;  2DU7 A;  4BAC A;  3E9F A;  1Q81 U;  2O01 E;  2F5K A;  3CCJ A;  5A0G A;  3E19 A;  1YIT T;  1YGB A;  5KH6 A;  4YYE A;  2B8A A;  2VGM A;  2RD1 A;  2ZPB B;  4M78 C;  1TH7 A;  1PSE A;  3MEV A;  2ARS A;  4PLI A;  2X4Y A;  3RKY A;  4OB3 B;  4ZGE B;  4LDW A;  3ME9 A;  3FJP A;  4A4G A;  3HRI A;  2Q5I A;  3T9N A;  4EMK B;  2O4X A;  4FT2 A;  4M77 C;  3CPF A;  3L2R A;  1YJW A;  3V7R A;  2G3R A;  4XAX B;  5CKD A;  1WNL A;  2VXE A;  4ELY C;  2J3M A;  4CRI A;  3P8V A;  3CCE A;  2EYQ A;  4NL2 A;  4HT9 A;  1VQL A;  3KFU A;  1QVG A;  3G71 T;  3A7A A;  5C52 B;  4M75 C;  3JCM c;  1B7Y A;  3RIR A;  4XU0 A;  2MI6 A;  3OYB A;  2E41 A;  4J7I A;  4MDX A;  1VQ4 T;  4J5Y A;  2XDP A;  4E7I A;  3QZ5 B;  3W3S A;  2WAC A;  3P8H A;  4L5G A;  4P3N A;  1JJC B;  2OTJ T;  2XI9 A;  1GXI E;  3HXV A;  5GAN 6;  1VQ8 T;  3IKM B;  4M75 F;  1YFR A;  3FRN A;  3G7Z A;  4FL6 A;  2DZC A;  1LYL A;  4R56 A;  1VQZ A;  1ZHI A;  3UWN A;  5GAN f;  2D6F A;  4TVA B;  4DOV A;  2ODR D;  1YI2 T;  1Y7X A;  3NEN A;  3VQV A;  1ZQ1 A;  2L89 A;  1G3W A;  2P4T A;  2IVW A;  4ZGD B;  3I55 A;  2KAF A;  2BIV A;  1U8R A;  2ZPE B;  5CIU A;  2E12 A;  1VQ9 A;  3RF1 A;  1M1K C;  4CH5 A;  3RER A;  4CS3 A;  4TQD A;  3X26 B;  2O4X B;  3MP1 A;  3A7U A;  2XDD A;  3L4G A;  4K86 A;  2DKG A;  4NCX A;  2FVU A;  1W2B A;  3VQW A;  2A7Y A;  4ATO A;  1G5I A;  5DM7 R;  1M4Z A;  4M7A D;  2K2V A;  1Y96 B;  2L3R A;  3O8V A;  2DVE A;  5KE2 A;  2ZZF A;  4Q15 A;  4RCC A;  3UT1 A;  2EKO A;  1SER A;  4QVD A;  1G3T A;  1N8R C;  5GAN 3;  1P92 A;  4QVC A;  4M7D A;  4HWS A;  1EQR A;  3LH0 A;  3AHU A;  3LGL A;  4P3P A;  1MHN A;  4FM4 B;  3V7C A;  2R5M A;  2HQE A;  2EIF A;  1Q7Y C;  4IUQ A;  1O9S A;  1ASZ A;  4WI1 A;  2NLU A;  3CC2 T;  1PYS A;  2XID A;  4L6V 5;  1VQ6 T;  5GAO r;  2PQW A;  4ZN1 A;  2PUO B;  2DXT A;  3SWN B;  2ZPI B;  4DPG A;  3OA6 A;  3M53 A;  4M7D C;  1E1T A;  1FXX A;  3ERR A;  1NPR A;  2XDB A;  4XEO A;  1ATI A;  4X5O A;  4N4H A;  5IN1 A;  3UDC A;  4PJO E;  2DD5 A;  1X01 A;  5D6Y A;  5CKE A;  4YRM A;  3JCM V;  3OYI A;  2K5I A;  1FWZ A;  2JOY A;  3CCQ A;  4WF2 A;  5CCA A;  2ODR C;  5GAM j;  5GAN g;  5K1X A;  3V8L A;  1N9S A;  5LJ5 e;  1KMN A;  4MZP A;  4PG3 A;  1HK9 A;  1X75 C;  5CAI A;  4C5H A;  2OTL A;  1B70 B;  1Q86 C;  4YRK A;  2D9T A;  1EFW A;  2PUK B;  1IZ6 A;  3QJ6 A;  4M77 A;  1KQS S;  5GAM e;  3QO8 A;  3G71 A;  1RL2 A;  2QEX T;  1YJN A;  3CBO A;  2I4N A;  4YCW A;  2DDZ A;  1Y71 A;  1XOV A;  3CC7 T;  3GNF B;  2DAQ A;  2P0K A;  4IUP A;  2GCX A;  4N0A A;  1Q7Y U;  4JRI A;  4E7L A;  4YCU A;  3CC4 T;  4HT4 A;  4YRE A;  1H64 1;  3IAL A;  4N0A C;  5LJ3 d;  4YRN A;  2QHV A;  1YIJ T;  1YCY A;  2A8E A;  2RI2 A;  2PU9 B;  4YRR A;  4M77 D;  2RHI A;  5LJ3 j;  1M1F A;  1O75 A;  1NE8 A;  1OZ2 A;  2GFA A;  3VQX A;  2BKD N;  3QII A;  5A0L A;  1H4V B;  4ELZ C;  4YRJ A;  4TVR A;  2EJ9 A;  3CCU A;  3MEW A;  4BB7 A;  3P8T A;  2IY5 A;  4J6W A;  3A8H B;  1WQW A;  2I4L A;  1X6O A;  2ZT5 A;  2DQ3 A;  4J83 A;  4KT0 E;  3JCM P;  3SFM A;  4ZTZ B;  2DXU A;  1BKB A;  2AKW B;  1M1K U;  5KNN A;  2ZXF A;  1NJ8 A;  2VGN A;  1IL2 A;  4AH6 A;  4FU6 A;  4A4H A;  5CKB A;  3JCM d;  3CXC A;  2ARU A;  2L8D A;  3QYG B;  4XTU A;  2CZ0 B;  2QHT A;  1OYX A;  3X28 B;  1VIE A;  3QKJ A;  3TEE A;  5HKC A;  2M16 A;  1E22 A;  1FYF A;  3WVE B;  2Q5H A;  3OYD A;  2AKW A;  4XK8 E;  3UGQ A;  4PL6 A;  3JSC A;  4PHC A;  3OYJ A;  3DB3 A;  4KR2 A;  5DY9 A;  3NFC A;  2DTO A;  5CKH A;  4HT8 A;  4EMH A;  2RO0 A;  5GAN 2;  3QBY A;  3JCM b;  3FC3 A;  4H2U A;  1B70 A;  2QQA A;  1X54 A;  3PIP A;  4H2Y A;  2E65 A;  3VQY A;  4RQF A;  4X9C A;  1YJW T;  4WJ4 A;  4P74 C;  1B76 A;  2RJF A;  1N9R A;  2AHJ B;  1N9W A;  1W4S A;  2PVO B;  3JRZ A;  2HNI A;  3SD4 A;  5E3I A;  2P0L A;  1VQO T;  3JB9 F;  3RL6 A;  3NTI A;  3PGG A;  3QUI A;  1QP2 A;  5LJ3 f;  4CH6 A;  3OY9 A;  2GQV A;  4BUG A;  1JBM A;  3VYH B;  2ZT7 A;  1KC8 C;  3RAC A;  2EJF A;  2YRV A;  4QQG A;  4OMF B;  2KMT A;  3QNE A;  3P8D A;  1YJ9 T;  2R57 A;  4M7A C;  3A32 A;  5C53 B;  1VQM T;  1XTD A;  1HC7 A;  3KXT A;  4F7U G;  2CYZ B;  1NJ1 A;  3TCJ A;  5LJ3 e;  2ALY A;  3I55 T;  4KR3 A;  5HY6 A;  5GAO p;  1WQ7 A;  4J6Y A;  1S72 A;  3M56 A;  2D0Q B;  2CZ1 B;  3L2Q A;  3ZFJ A;  5FU6 C;  1ZBX A;  1E1O A;  2DXB A;  4UP8 A;  3HFO A;  1BBW A;  1RI0 A;  3V7S A;  1D3B B;  1VQN A;  3FLG A;  1WU7 A;  4II1 A;  4BY6 B;  3JB9 H;  4RMO A;  4ZGJ B;  3HXY A;  3TRE A;  5EG2 A;  1YI2 A;  2RJE A;  3OBY A;  1JJ2 S;  1U1T A;  1UEB A;  1KQS A;  3X25 B;  4A54 A;  4P71 A;  4MDW A;  4TVW A;  2RH2 A;  1FX7 A;  4GY5 A;  3HXW A;  4MMK A;  4PKC C;  3I56 A;  3M58 A;  3REU A;  4YRQ A;  5HK3 A;  4HCB A;  4C92 E;  3CCL T;  3MEA A;  3E9I A;  4LDV A;  3JCM e;  2QQ9 A;  3QTC A;  3PT9 A;  4BDY A;  4B9X A;  1G3S A;  3VUZ A;  3PMT A;  3OMC A;  4XTZ A;  5GMK m;  2FL7 A;  4P71 C;  1QW1 A;  4M7A E;  1G5V A;  1BI3 A;  4E51 A;  2DU5 A;  3HPW A;  4LNS A;  1K73 C;  4A4E A;  1BIB A;  2DQ0 A;  1NJI U;  3OYM A;  1NZ9 A;  3ICA A;  4YRI A;  4MZM A;  1YBY A;  2EFI A;  2LT4 A;  2JTF A;  1LNX A;  3HXX A;  1WYD A;  3BY7 A;  5LJ5 f;  2VXF A;  4LD9 K;  4LDU A;  4KUL A;  4C92 A;  3VV0 A;  2V8I A;  5HGQ A;  5GAN 8;  2JUF A;  3JCM f;  4A53 A;  4CH4 A;  4JRQ A;  2RHY A;  4CI0 C;  1K8A U;  5LJ5 h;  3I7F A;  4VUB A;  5J26 A;  1YFT A;  2E6Z A;  2K3Y A;  1H4S A;  3QO3 A;  4RG8 A;  2JN0 A;  1M9S A;  3NTH A;  2WSE E;  3OMG A;  5LJ3 g;  4OB1 B;  2PMF A;  4BDZ A;  2Y4X A;  1Z7M A;  4H2X A;  3L2W A;  2I4O A;  4M75 G;  1K9M C;  3OYN A;  1YB3 A;  2RJD A;  3M4Q A;  5HK0 A;  1C0A A;  2KSS A;  3QPH A;  4IUV A;  4JLG A;  1U1S A;  4B9W A;  4YRT A;  3GIB A;  3L42 A;  5A0D A;  4CS4 A;  4M77 F;  5GAO m;  4HWP A;  1WJQ A;  2RA2 A;  1KG1 A;  1I4K 1;  4GLK A;  3J7A F;  4RCB A;  2ZCE A;  2QA4 A;  1VQ9 T;  4YCV A;  2LCL A;  2A3L A;  3F70 A;  3H8Z A;  3M55 A;  3EFS A;  1JJC A;  1EIF A;  4MML A;  2KQW A;  1QVF S;  3VKI A;  3QG1 A;  3A8O B;  3ZBD A;  1SRY A;  2C7I A;  1W66 A;  3VUB A;  2QEX A;  3JCM W;  2DD4 A;  2HAX A;  2VYT A;  4EO4 A;  4P75 C;  5IAY A;  2ZIN A;  2DEQ A;  1YIJ A;  3DSQ A;  4G85 A;  3OSV A;  1R8O B;  3RUX A;  4F7U B;  2CGH A;  2DZ9 A;  3X24 B;  3J81 E;  3E1S A;  3WVD B;  3L2U A;  4C8Q A;  1KC8 U;  4PJO B;  4KUD K;  4XU3 A;  2E5Q A;  3MP6 A;  3MQZ A;  4M75 B;  4DQ2 A;  1Q86 U;  4LD6 A;  1H4Q A;  1BI1 A;  4E7J A;  5J3B A;  2VC8 A;  3SB2 A;  2ZIO A;  3JCM J;  1KQ2 A;  1YFS A;  3NEL A;  2P5I A;  2QA4 T;  3RKX A;  3M5A A;  2YLB A;  4ZTU B;  1JRI A;  2FYK A;  3HTZ A;  3GOX A;  4ZTJ A;  2DTI A;  4C0D B;  2KDS A;  3GPL A;  1H4T A;  3A5Z A;  4OP0 A;  5D6X A;  3LWI A;  1Q82 C;  3RMQ A;  2PVD B;  1QVP A;  3OS0 A;  1UB4 A;  2K4Y A;  1VQ6 A;  1IRE B;  3JB9 I;  3CEY A;  2NS6 A;  1JJ2 A;  2R58 A;  3CCV A;  2P0Q A;  4WJ3 M;  4PJO C;  2DK3 A;  2RHX A;  4M7D D;  4MZT A;  4TVA A;  2X4J A;  1WGS A;  1VQP A;  4M7D G;  4C92 C;  3PIO A;  1EVK A;  3IG2 A;  4ME7 A;  2VV5 A;  3E9H A;  3MF1 A;  4X34 A;  4M77 B;  3CCL A;  4M78 F;  3CCQ T;  5CKF A;  1I5L A;  4C8Q E;  3R6O A;  4C5E A;  3HXU A;  3N5B B;  2JNG A;  3HRU A;  5GAN 4;  3M59 A;  1NJ6 A;  2E3C A;  4YRP A;  4JS5 A;  3X20 B;  4H2T A;  4RDX A;  3HFZ B;  3CC4 A;  4M75 A;  4XU2 A;  3OYA A;  4M78 A;  3J80 E;  3OB9 A;  2EQK A;  3NET A;  1MGQ A;  2WSF E;  3CCS A;  4XEM A;  5C51 B;  3HL8 A;  3RES A;  3OYG A;  4YRS A;  5GAN h;  2FHD A;  4LVL A;  3PTA A;  5DLQ E;  3GF5 A;  1NJ2 A;  3URG A;  3UGT A;  2C8M A;  3A5Z B;  5CO7 A;  2GF7 A;  5LL6 S;  3S3M A;  4KBM B;  2LQ8 A;  4C8Q D;  2ZPG B;  4P75 A;  2F5T X;  3CCV T;  2CZ6 B;  3REX A;  3LW5 E;  4X9D A;  3A8M B;  4C8Q F;  1YHQ T;  4M78 E;  1NYQ A;  3L2Z A;  4H02 A;  4M77 G;  4K88 A;  1LJO A;  3OYH A;  1VIF A;  3DLM A;  1Q82 U;  1YIT A;  1WLE A;  3TEH A;  5FRO A;  5GAN 5;  1VQK A;  1G3Y A;  4O5V A;  4EMK C;  4L59 A;  4CS2 A;  3G6E T;  2ALY B;  4QVZ A;  3BW1 A;  5ELN A;  2LDM A;  1SET A;  3CPW S;  3MP8 A;  3CXC S;  4LDY A;  2ZNI A;  3JB9 J;  1NPP A;  1USY A;  2ZT8 A;  1QVF A;  5GAM g;  3S3N A;  1SSF A;  3EAE A;  3HKS A;  1BYM A;  2OAU A;  2KVQ G;  1WJS A;  4C92 F;  4NS5 A;  4M75 E;  5ELO A;  4PNO A;  3PNW C;  4BW9 A;  3QDR B;  2J3L A;  3M4Y A;  4P73 C;  4IUR A;  3IKL A;  4C92 G;  2XG8 D;  4M78 D;  2JTM A;  4P72 C;  3LGF A;  4HWT A;  4M75 D;  5J39 A;  1EIY B;  1HTT A;  4Q6G A;  1YHQ A;  2XKO C;  3VBB A;  3FEO A;  2Y90 A;  4YRF A;  3TU4 K;  4P72 A;  4UP9 A;  1XQH A;  4H2W A;  4N4I A;  2QI2 A;  3INZ A;  4M7A G;  3G6E A;  2LC4 A;  2EJG A;  1BIA A;  3RMS A;  3M4P A;  2FB7 A;  1RIQ A;  1Y07 A;  5FU7 C;  1KD1 U;  4XTY A;  2OTL T;  3C94 A;  3M57 A;  4JDS A;  4BI3 A;  4L87 A;  3OQ5 A;  4M7D B;  5L8R E;  1JB0 E;  2RK2 A;  1G5H A;  1PSF A;  2KK4 A;  3E9G A;  4HVC A;  3UFG A;  3CC7 A;  4KUI A;  4YPF A;  1VQO A;  1VQK T;  1X55 A;  5CQX A;  4UC4 A;  4P5N A;  1PYS B;  4TVY A;  2XTI A;  4K87 A;  3A8L B;  5FRM A;  2E6N A;  3OS5 A;  5GMK l;  1B7Y B;  3MCA B;  1M8V A;  1K9M U;  5GAM h;  2E5A A;  2EWN A;  3G1Z A;  2M1H A;  2E1H A;  3A5Y A;  1ASY A;  4UP7 A;  2ZNJ A;  3ZEH A;  2EAY A;  2QQB A;  3OYK A;  1VUB A;  4M77 E;  4BWA A;  5I21 A;  4HWR A;  1Y96 A;  4RG2 A;  3CCE T;  2I2L A;  3OW2 A;  4Y28 E;  4ZN3 A;  4C8Q G;  2LNV A;  2CJA A;  4JS4 A;  2L5Q A;  2ZPH B;  4PJO D;  5LJ5 j;  3HY0 A;  5FLX E;  2ZZG A;  4E47 A;  4J6X A;  4IUT A;  4C0F A;  4RKU E;  1K73 U;  3DB4 A;  4HKE A;  3QSU A;  4M7A A;  4A4F A;  3CMA A;  4LVM A;  4HA8 A;  3HFV A;  4QQ6 A;  3LSS A;  1QVG S;  3TEH B;  3NTK A;  2EQM A;  2XK0 A;  2EL9 A;  3TEG A;  5C0M A;  1M5Q 1;  4NL3 A;  4P74 A;  4TWA A;  1KMM A;  5D6W A;  3SDZ A;  5GAO q;  4YP0 A;  4H2S A;  3PCO B;  4Y91 A;  4IKF A;  2OTJ A;  3HXZ A;  4LVI A;  4BE2 A;  4V2S A;  5CVI A;  4PJO G;  4ZIB A;  1BI2 A;  2K57 A;  5LJ5 g;  3KUF A;  1EIY A;  3JCM Q;  4DA4 A;  3CD6 T;  2ZIM A;  5K1P A;  3A31 A;  2ZZE A;  3JCM g;  3LSQ A;  2CKK A;  1AHJ B;  2MF2 A;  4C5I A;  4M7A F;  1XNI A;  2K5L A;  2Q7E A;  5GAM f;  1ADJ A;  3A7R A;  5GAN d;  3CBM A;  2DJZ A;  1VQ8 A;  5IT9 E;  4M78 B;  1I81 A;  3V8J A;  1UGS B;  2R5A A;  1E24 A;  1B8A A;  2ART A;  2WSC E;  2DXC A;  1X2G A;  4P73 A;  3CME T;  3JAM E;  4C8Q B;  4EMG A;  5C6S A;  4EX5 A;  4XU1 A;  4O2D A;  3OSS C;  3MF2 A;  2YHT A;  3MET A;  3CPW A;  4C92 B;  1OI1 A;  3HFZ A;  4UPA A;  4XTW A;  5CQY A;  4FSX A;  4BD3 A;  2RI3 A;  3P8B B;  2M9U A;  3H6Z A;  3HFN A;  3MO8 A;  5AYF A;  3S6W A;  4HWO A;  3JCM X;  4JLI A;  2QHU A;  2XU8 A;  1VQ7 T;  1NJI C;  1W2B S;  4C0G A;  3PFS A;  2RJC A;  4F7U E;  4LDX A;  1GGM A;  4M7A B;  4BI4 A;  4LVK A;  4YRO A;  3CMA T;  1B34 A;  4C92 D;  4P3O A;  3CCR A;  1H3Z A;  1N6A A;  1ADY A;  2I4M A;  3OYC A;  3L2V A;  4HCC A;  1VQP T;  4YRG A;  3HRK A;  3R07 A;  2CS7 A;  2RHQ A;  1LOJ A;  1V29 B;  3L1A A;  5CK9 A;  3CME A;  3JB9 D;  3MHX A;  2C06 A;  1BBU A;  1Q81 C;  5GMK h;  4KQE A;  3UPU A;  2EQJ A;  3PZC A;  3BDL A;  5F5W A;  4OGC A;  3HHT B;  4FIB A;  3SWN C;  2ZR2 A;  3HRS A;  1WPY A;  2ZCF B;  4ZTF A;  3A8G B;  4M7D E;  3HP9 A;  4BI8 B;  2BUD A;  4R55 A;  3C95 A;  4JRP A;  3KBG A;  4OLF A;  1M1G A;  1EVL A;  4TTV A;  3LLR A;  3JB9 G;  4A4K A;  2K3X A;  2RB6 A;  1VQ4 A;  1D3B A;  3OBW A;  1DJ7 B;  3RKW A;  1M90 C;  2G4C A;  4RQE A;  3G4S A;  3UH0 A;  1UGQ B;  3WQZ A;  4XQ3 A;  3C12 A;  3QXE B;  1X56 A;  4RMF A;  3OS1 A;  1USY C;  2VUB A;  2M0O A;  1NJ5 A;  2HQX A;  2MAM A;  3PCO A;  3BJU A;  2V8J A;  5GAN j;  3HSB A;  1K8A C;  3BFM A;  2P0P A;  3CMQ A;  2QDY B;  5KCH A;  3EFR A;  2RHS A;  3TUP A;  3S3O A;  3L4G B;  5GAO n;  2LCC A;  3GNG A;  4J15 A;  3OYF A;  4YTL A;  4C0Z A;  2QQR A;  3OW2 S;  5GMK e;  3V8K A;  2ZTG A;  2F69 A;  5GAN e;  2IY5 B;  3NEM A;  3OS2 A;  4YRC A;  2MWP A;  4OB0 B;  4O6J A;  2K5F A;  1I8F A;  2RHQ B;  4YRL A;  2DIG A;  2E70 A;  5GMK j;  4QQD A;  3LWH A;  5M9O A;  1EOV A;  5GAO l;  4E7H A;  4M78 G;  2DIQ A;  1VQ5 T;  1G51 A;  2DO3 A;  5LJ5 d;  3DKM A;  1KOG A;  1NYR A;  2AMC B;  4C8Q C;  5FU7 B;  4M7D F;  3RGL A;  2LQK A;  3C4S A;  4FT4 A;  1KQ1 A;  2XGT A;  3QZ9 B;  1BI0 A;  3CD6 A;  1VQN T;  3VJP A;  3M54 A;  3SWN A;  4C5G A;  5FU6 B;  5KE3 A;  2QTX A;  2H3J A;  1X2H A;  2HD0 A;  2KY9 A;  1YJ9 A;  3LC0 A;  2E10 A;  1OZ3 A;  3CBP A;  5DLO A;  2RHZ A;  5I2S A;  3JCM h;  4EPC A;  1VQL T;  2ZR3 A;  3QO5 A;  3QHS A;  1KD1 C;  2LT1 A;  2DTH A;  1S72 T;  2CZ7 B;  3OYY A;  12AS A;  3FB9 A;  3BDU A;  4BE0 A;  3QJY A;  1M90 U;  1VQ7 A;  2QQS A;  2V8K A;  5FRN A;  1UGP B;  4EMK A;  4F7U F;  2ZT6 A;  2X4X A;  3Q1J A;  1VQ5 A;  2RHS B;  2QXF A;  4J7F A;  3PMI A;  2RHU A;  2HBP A;  5GAM d;  2E64 A;  11AS A;  2RI5 A;  3CCR T;  4D6W A;  3QYH B;  4E7K A;  3CCM A;  2RK1 A;  3FIF A;  4OB2 B;  4OVA A;  1WJR A;  4EDU A;  4C0D C;  4OF1 A;  4J8O A;  2Q7G A;  2JZ2 A;  2QHS A;  4H2X B;  4BY6 C;  4F7U A;  4HCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...