4XTYA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 63 with fluorine in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 94
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtyA01
4X9CA 5LJ3f 1Z7MA 3JCMJ 3IALA 2J3LA 3PCOB 3SB2A 2RHQA 3V7RA 2RHSB 2DKGA 1LJOA 1YFSA 2I4LA 4JRIA 4XU0A 1HC7A 4XU2A 4E51A 3V7SA 4P73C 4YRRA 4H02A 5GAMg 4PNOA 4YCUA 1RIQA 2QTXA 2CJAA 4ZTUB 4YRFA 1HTTA 2ZCEA 4YYEA 5GAMj 4K86A 3PCOA 4PJOD 4H2XB 2RHSA 5LJ5e 1KMNA 2JN0A 4YP0A 3QO8A 4F7UG 3L4GB 2Q7EA 1EVLA 3HXUA 5GANg 1ASYA 1WQ7A 4YRSA 3A74A 4M77G 4YCVA 2YLBA 3QTCA 1ATIA 4M7DG 5GAN4 2DU7A 4C8QF 3HFZB 3JCMW 4WF2A 4CH6A 1G51A 3JCMX 4HWPA 3TEHB 4H2XA 3A32A 3IKLA 2ZNJA 3L4GA 2ZT5A 1WQWA 2DQ0A 4PHCA 3HTZA 1I5LA 4M7AD 3P8TA 1YFTA 2ZT7A 4XTVA 4XTXA 4X9DA 3HY0A 3HFZA 3R07A 2ODRC 1B70B 3TEHA 1YCYA 2E64A 1EFWA 4C92F 5HGQA 2FYKA 3SWNC 2QHUA 4AH6A 3RERA 4YROA 2RB6A 1BBUA 4TWAA 4PJOB 5GMKl 4A54A 1B70A 5C53B 4EMKC 4RCBA 2DZCA 4HWSA 4YPFA 4DPGA 4C92D 4P75C 3TEGA 1NJ2A 4P72A 3RF1A 1YB3A 3IG2A 5K1PA 4QVCA 5GAOr 1EQRA 4XEOA 4KR3A 2DJZA 3NETA 4JUVA 4PJOA 4M78D 5GANe 5GMKe 3AHUA 3HFOA 3JCMd 3PGGA 3JB9D 5ELOA 4YRIA 4P71C 3VQYA 4YREA 1BIBA 4M7AB 5GMKi 5LJ5j 3V8KA 4HT8A 1M5Q1 1WU7A 4JRKA 4EMHA 12ASA 3HSBA 1M8VA 4J15A 3VQXA 4M75D 4L87A 1KQ1A 4UP9A 1EOVA 5LJ5f 1I4K1 3EFSA 3A7UA 1MGQA 2I4NA 4C8QC 1YGBA 4M7AA 3E9IA 2YHTA 4RMFA 1B7YB 4PJOE 2RM4A 3RESA 1ADYA 2CJBA 4RCCA 4J5YA 4XTUA 3M4GA 4XTZA 4C92B 2YLCA 2AMCB 4YCWA 5GAOp 1E24A 3HXZA 4M77F 2P0LA 4PJOF 4TVYA 4Y91A 1B7YA 2PMEA 3RKWA 5KNNA 4M78B 2E1HA 1KOGA 5GAOm 3ERRA 4UP8A 3LSQA 1C0AA 3L2ZA 1JJCB 4C92A 2AMCA 2ZGWA 5LJ3d 4M7AE 5GAN3 3P8YA 4TVWA 4C8QE 4M77D 3FIFA 3LSSA 4UP7A 4M7DD 1H4TA 4OP0A 2I4MA 2VXFA 4N0AA 4M78A 1JBMA 3HXWA 2DU5A 3JCMP 5GAMf 4HT9A 3A7AA 1JJCA 4M7AF 4NOYA 2DXUA 3BDUA 1U1TA 5GMKj 5GANj 3G1ZA 4YRLA 3UFGA 1BIAA 2DDZA 4K88A 3L1AA 1NYQA 3BFMA 2K57A 2E3CA 5GANf 4C92E 5GAMd 1H4QA 1WNLA 4KQEA 1N9RA 3A31A 1G5IA 2ALYB 3INZA 2ZZEA 5GAN6 3RKXA 4M78E 4J6WA 11ASA 4YRNA 1BBWA 4H2WA 4V2SA 1PYSB 1X54A 4F7UB 4ZTZB 4WI1A 4H2SA 3UH0A 5LJ3h 2ALYA 4M77B 4HWOA 4J6YA 4M7DB 5I21A 4M78F 1I8FA 1X2GA 4H2UA 4P72C 1WPYA 2I4OA 3JB9F 4G84A 1I81A 1X56A 2EWNA 4XU1A 1NJ5A 4YRQA 2VC8A 3OD1A 1PYSA 4PJOC 2XTIA 1QE0A 4C8QG 4JLIA 1NYRA 4TVAB 4CS3A 4M77A 3V8LA 4J6XA 5E3IA 4XTWA 4M75F 4M7DA 2DTOA 2E5AA 1D3BB 4XQ3A 4YDQA 1B76A 1NJ6A 2CJ9A 2P5IA 3JCMc 4P74C 3RACA 4CH4A 2Q5IA 1ASZA 2E41A 4YRKA 3RGLA 2G4CA 3A5YA 3P8VA 4TVAA 4P74A 3EFRA 1WLEA 1ADJA 4M7AC 1D3BA 4CH3A 1J5WA 1KMMA 2Q7HA 1TH7A 3MF2A 2VXEA 3RL6A 1E1TA 4CS2A 2ZIMA 2RD1A 4M77E 4YRJA 1U1SA 1X55A 4M7DE 4YRCA 4RQFA 5LJ5d 2DQ3A 5C51B 3JCMV 4F7UF 3RIRA 4P3NA 3JCMb 3QUIA 4P3PA 4XU3A 4KR2A 4OLFA 3HFNA 3VU3C 3HY1A 3BY7A 4UPAA 3REXA 5LJ3g 1X01A 4EO4A 4M7DF 2I2LA 3QO7A 4C92C 4CH5A 1LOJA 2J3MA 3FJPA 3JCMQ 4CS4A 1H641 3HXXA 2ZR3A 3JCMe 4HWTA 4LNSA 3JCMh 2AKWB 3HRKA 4H2TA 2ODRD 3GIBA 2C7IA 4N0AC 4M78C 1USYC 1B34B 3E9HA 2QHTA 5GAOn 3I7FA 5DY9A 2EJGA 3QO3A 4M75B 2Q7GA 3IKMB 1HK9A 1USYA 4YRMA 4NCXA 3FB9A 1E22A 2ARUA 2AKWA 3A7RA 2ZNIA 1H4SA 4X5OA 4O2DA 3PZCA 4M75C 1B34A 1Z7NA 4HWRA 3VQVA 4YRTA 5ELNA 4M75A 4P73A 3VBBA 1SERA 4QVDA 3HXYA 4HA8A 5LJ5h 4WJ3M 3JB9H 2ZR2A 4P3OA 1H4VB 1SESA 4H2YA 1NNHA 3QNEA 4PJOG 2FB7A 4NL2A 2CIMA 1QF6A 1IL2A 3NELA 1Y96B 2CGHA 2DVEA 1SETA 3BJUA 2EJ9A 5GANd 5GAN7 2RA2A 4ZIBA 4G85A 2E65A 1LNXA 2HNIA 3A5ZA 3M4PA 3QO5A 3VQWA 4WJ4A 5LJ3e 4RDXA 3UGQA 4PG3A 1B8AA 5GAN5 3QHSA 1VQZA 4M75E 2XGTA 4C8QD 3TUPA 3SWNB 1Y96A 3V7CA 4TQDA 2EJFA 1EIYB 2ZT8A 4M77C 4TQFA 4TTVA 4F7UA 4M7AG 3JCMg 4A53A 1NJ8A 2Q5HA 4M7DC 1WYDA 3NENA 2QHSA 4HVCA 4EMKB 2DZ9A 5CAIA 3JB9J 4Q6GA 4XEMA 3CMQA 4Q15A 1SRYA 3HFVA 3SWNA 5GAOl 3JB9I 2EAYA 1EIYA 3RUXA 5GAMe 3JCMf 1FYFA 2ZZFA 5GAMh 4EMKA 1N9SA 3WQZA 4DQ2A 4YRPA 1EVKA 3V8JA 4P75A 1L0WA 5GAN8 2ARTA 5C52B 4C92G 2DTHA 2EL9A 4F7UE 4NL3A 5LJ5g 1N9WA 5GMKh 5GANh 3REUA 2ZT6A 3M4QA 2IY5B 1HXDA 3W3SA 3NEMA 5GAN2 5F5WA 2DXTA 2E10A 2PMFA 3LC0A 1LYLA 3MEYA 4BW9A 4M78G 4C8QB 3MF1A 4XTYA 4P71A 4YRGA 4MMKA 3JB9G 2ZZGA 3DSQA 4RQEA 3QSUA 4EMGA 1G5HA 1W66A 2C8MA 2DTIA 1YFRA 2IY5A 4EX5A 4H2VA 1JRIA 1GGMA 1KQ2A 4M75G 2RHQB 2ZINA 3RKYA 2ZIOA 5K1XA 4C8QA 2ZTGA 5GMKm 3KFUA 5LJ3j 2ARSA 3HXVA 3UGTA 3BW1A 5GAOq 2QHVA 3HRIA 4MMLA 1E1OA 2Y90A 4BWAA 2ZXFA 1X2HA 2DEQA 4K87A 1NJ1A 3ICAA
chains in the Genus database with same CATH superfamily
1VQKT 3C4SA 1S1NA 2G6FX 1VQLT 2M16A 3PCOB 2RHQA 2RHSB 2DKGA 4IIOA 4JRIA 4LE9A 4XU0A 1Q7YC 4PJNA 4J9IA 1UECA 4F16A 4E51A 1WA7A 1WLPB 2RH2A 1RIQA 1TTHB 2KY9A 1TG0A 2CUBA 2HKQB 2GNCA 5GAMj 4Z8AA 2RJDA 4RG2A 3L2VA 2J6OA 2JN0A 2DILA 4DA4A 2Q7EA 1RAGB 2PU9B 3G4SQ 5GANg 1ASYA 4YRSA 1C0MA 2CP2A 3MEWA 2OTJT 1XQHA 1ATIA 3QTCA 2XU8A 1MMNA 4OB3B 2MMPA 4CH6A 4HWPA 2JS2A 3TEHB 4H2XA 1FXXA 3NTHA 3L4GA 1PRMC 1WQWA 1OU8A 4PHCA 4IUQA 4LUEA 4M7AD 2ZT7A 4Z88A 1KQSS 1D0ZA 3HY0A 2E3IA 4RKUE 3R07A 1ARKA 3CBPA 2WSEE 1VQ6A 1N8RU 1VQOQ 2W10A 2M51A 4GLMA 2DMOA 2E70A 1OZ3A 3RERA 4II1A 2XMFA 2RO0A 2QAZA 4K11A 4BDYA 2CT3A 1B70A 3META 4EMKC 5I11A 3CCVT 4O5VA 4HWSA 4YPFA 4C92D 4P75C 1YNZA 3IQLA 3TEGA 1Y57A 1SRLA 1KK7A 5K1PA 1EQRA 4B9WA 4KR3A 2DJZA 2H3JA 3OYBA 2NUPA 4PJOA 4M78D 1GXIE 2J05A 5GANe 4PJLA 1T3SA 1WHMA 3JB9D 5ELOA 2CP0A 3SDZA 2ED0A 4J9HA 3J80E 5D6YA 2BKDN 3LH0A 4HT8A 2DL7A 1HSQA 2L2PA 3VRYA 3LGLA 4M75D 4JPBW 4UP9A 2KE9A 1G3YA 1N8RR 2C0TA 1EOVA 1I4K1 2I4NA 1YI2T 1ZQ1A 2LJ3A 1KIKA 2V8KA 3EGUA 3FJ5A 4PJOE 1RAIB 2A28A 1M90R 4XTUA 3M4GA 4DOVA 2MWPA 2YLCA 3GNGA 1D1AA 2L3PA 2YXYA 1Q86U 4CRIA 3LGFA 4YCWA 5KH6A 1E24A 3HXZA 4M77F 1QP2A 2L89A 2P0LA 3HL8A 1V29B 4TVYA 4Y91A 4KUDK 1B7YA 2PMEA 5KNNA 2RHZA 2VWFA 1U8RA 2E1HA 3HHTB 2GF7A 1KOGA 4DOWA 2EW3A 3LSQA 1C0AA 3L2ZA 2DXBA 3P8HA 2DX1A 5I22A 2E6ZA 4TVWA 4KUIA 4C8QE 2QI2A 1X43A 3OS1A 3J7AF 4UP7A 4JRPA 4M7DD 3O8VA 1BCMA 2GCXA 1SSHA 4J9GA 3NTIA 2MAMA 5FRMA 1PKSA 3A1PA 3A7AA 4M7AF 2MCNA 4NOYA 2LQNA 3NPFA 5GANj 3A98A 3HTRA 5M9OA 1BIAA 1VQLQ 1H8KA 3HKSA 1WIEA 1NYQA 4FU6A 4CC2A 2K57A 4BE0A 1M30A 5GANf 1PKTA 2YRDA 1Q86R 4IUVA 4B6MA 3E2UA 4XK8E 2ALYB 3X25B 2K9GA 2ZPEB 1B3QA 3S6WA 2RQTA 4J6WA 3CCQQ 1XOVA 5KYWA 1MMAA 1BBWA 4C0GA 1PYSB 4F7UB 1Q82C 4ANJA 4M77B 4HWOA 4J6YA 1K73R 5I21A 4M78F 1OPLA 1WHGA 1H3HA 3JB9F 2I4OA 2ZZDA 2F2WA 1B07A 3EG1A 3VS1A 4PJOC 4FL6A 3UPUA 1ZSZB 1VQ8A 4AG1C 4TVAB 4CS3A 3V8LA 4M75F 2ATCB 1YJNQ 5A0LA 3S3OA 2VGMA 1KG1A 1I07A 2JM8A 2P5IA 2CT4A 4CI0C 3RACA 2X4XA 1TOVA 3VKIA 1JXOA 2RF0A 4YRKA 4GY5A 3UA7A 4P74A 2ZPGB 4CH3A 2J6FA 4JZ3A 2LP5A 3FDRA 1QVFP 4LUDA 2KT8A 3CCEQ 2RJEA 3RL6A 5KYXB 3I55A 1XJWB 4ELZC 2ZIMA 2P4TA 1RAEB 5CKHA 3SHWA 2ZPBB 2NUTB 4D8DA 2BZXA 1AT1B 1X75C 1W2BA 1X55A 1RI0A 3URGA 4AFQC 2XG8D 3CPWA 5FU6C 5LJ5d 4XAXB 2QDYB 3CEYA 2PQWA 2MK5A 3RIRA 3M0UA 1F1BB 2DRMA 2LQWA 1Q81U 4HT4A 1IHVA 4M7DF 2I2LA 3QO7A 3X20B 3FJPA 2LCSA 2KSSA 1AVZC 3JCMe 1RLQC 2RI2A 1NPRA 3GIBA 2C7IA 1IZ6A 1Y71A 4EDUA 2ABLA 3NFCA 1YP5A 3EG9B 1K9MC 4QQDA 2AZSA 2E5KA 2EJGA 4M75B 4HVVA 1M4ZA 3IKMB 3C94A 4ZTFA 3EHQA 4LVIA 2QEXT 4A4KA 3FLGA 2CREA 2ZNIA 4WTOB 1QCNA 1RABB 1QP3A 3H6ZA 1VQPA 2EYQA 1NG2A 4P73A 5GJVB 1WJSA 4QVDA 4HA8A 1FX7A 2M1HA 5LJ5h 3P8DA 1Q81R 2CZ1B 1VQ7T 3G71Q 3BE3A 1W4SA 4PJOG 2LRQA 2CGHA 1VQMT 1NEGA 1YWPA 4G85A 4JJCA 2E65A 2EQKA 2HNIA 2QQSA 3E1SA 3M4PA 4WJ4A 2DL4A 3CD6A 2CP3A 3UGQA 1GBQA 1B8AA 2DAQA 5IHNA 1RL2A 2DF6A 3V7CA 4X1VA 1BI3A 4PL6A 3MPUB 3NENA 1K76A 3HP9A 1WYDA 2IG0A 5AYFA 4PJJA 4E7JA 1Z9QA 3CMQA 4Q15A 1SRYA 1PG5B 2MI6A 3OYIA 4OMNA 2DL8A 2CZ7B 2RNAA 2E4HA 3QDRB 3JCMf 1FYFA 2ZZFA 4PFPA 3DB4A 3NTKA 2PNIA 1N6AA 2V26A 1N9SA 3CCSQ 2ED1A 2EGAA 1M2OA 1YIJT 1D1CA 1ZSGA 2L3RA 2COZA 2XICA 2DTHA 3UWNA 2EL9A 5D6XA 2DERA 1N9WA 5GMKh 1KFZA 3REUA 2ZT6A 6AT1B 4FW2A 4CC3A 5F5WA 1LCKA 2DXTA 2GFUA 1K0SA 1K8AC 1ZBJA 3UF4A 4C8QB 4XTYA 4LN2A 4PJMA 1VQ4T 4ZGJB 2K3BA 4MMKA 2XI9A 3PTAA 4BY6C 2DTIA 3OS2A 1YFRA 2P0KA 2JW4A 3G4SA 1VQNQ 2V1RA 3KFUA 1ZA1B 1MV0B 1YHQT 2QHVA 2MWOA 4MMLA 1NEBA 2HQEA 3CCRQ 3A8HB 4OGCA 4X9CA 1Z7MA 3I56Q 3IALA 2J3LA 1N5ZA 3SB2A 3OMCA 5A2QE 2I4LA 1WJQA 5IH2A 3EH2A 4P73C 5GAMg 2EKHA 2QTXA 3JV3A 5A0GA 2PVDB 1VQOA 1Q7YU 4ZTUB 4YRFA 1HTTA 1BU1A 4ZGEB 1QKWA 2VKNA 4J9EA 3MEAA 4BI3A 3RDVA 1KMNA 4RTZA 4YP0A 3QO8A 4PFZA 3PNWC 2NWMA 1BI0A 1WQ7A 2FG0A 3ASKA 3A8LB 4N4HA 3DB3A 4WF2A 3EAEA 5IXFA 1G51A 4LVMA 4C0FA 3GLXA 2HEQA 2FPDA 1FMVA 4OMQA 3IKLA 2ZNJA 1OQKA 4Y28E 2SRCA 3CQTA 2DQ0A 4ZNXA 2JTMA 1VYVA 1I5LA 1OOTA 4F04B 4XTVA 2F2VA 2HKNA 1YWOA 1W6XA 4AFUC 4X9DA 3EHRA 4VUBA 3HFZA 3RMQA 1XNIA 1VQPQ 1YCYA 2E64A 3ZL7C 1EFWA 1IB8A 2NYSA 3CC7Q 3L2QA 4PLLA 4E7ZA 1Q7YR 2QHUA 4AH6A 3CMET 5CKFA 4EPCA 2XK0A 1I0CA 1JXMA 3LW5E 2FZCB 1EFNA 1SKUB 1UJYA 2DZCA 1SRMA 1U3OA 1WHLA 4J9FA 2KT1A 4P72A 1YB3A 3OYEA 1JEGA 1IHWA 4QVCA 1IGUA 2OX7A 4R56A 3R6NA 5C0MA 4JUVA 2J06A 4LDYA 3T9NA 3AHUA 3SEMA 3HFOA 1WX6A 4Y92A 4OMMA 2O4XB 5KE3A 2QQ9A 5GMKi 2YSQA 4FYVB 1M5Q1 5D6WA 2QA4T 3PE0A 3R6OA 1GBRA 1M3AA 3M9QA 4HKEA 2FVUA 1KQ1A 2JTFA 3MJXA 1X6OA 3OSVA 3VYGA 1KC8C 3EFSA 1MGQA 5KCOA 3CMAQ 1D0YA 4J7IA 2FPFA 4M7AA 3E9IA 3CCUQ 2DEUA 4FSSA 2DYBA 1ADYA 1AWXA 4J5YA 4XTZA 1VQLA 1M3CA 4F14A 2AMCB 2H8HA 2KAFA 3I35A 3A8MB 3CBOA 3H0FA 4HVUA 3HRSA 2RQRA 5GAOp 3EGDA 2JM9A 2V1QA 4C5IA 2NLUA 2CP5A 4KH0B 2OI3A 1NJIC 2KNBB 1D1BA 1R77A 4C92A 1BK2A 3CCQA 4M7AE 1CSKA 5GAN3 3M0TA 2HD0A 3P8YA 4M77D 2HL5C 2R58A 2CYZB 2I4MA 4NS5A 4N0AA 3CCLQ 4M78A 1JBMA 4D6WA 2QQRA 2DU5A 3JCMP 1YHQQ 5GAMf 3CXCP 3CCJT 1JJCA 3OW2A 2LTOA 1KD1C 2DXUA 3BDUA 3G1ZA 4YRLA 1WHHA 4K88A 3OY9A 1YJ9Q 2JXBA 3EG2A 3L1AA 5CIUA 4A4FA 2FHDA 4C92E 5GAMd 1YJNA 4KQEA 2LNVA 4F17A 2VB6A 1G5IA 1W2BP 2OJ2A 3F70A 3INZA 3CPWP 4M78E 4V2SA 4ZTZB 1UGQB 2FPEA 2EQMA 1G2BA 4LVLA 1T3LA 3CCEA 1HJDA 1Q82U 2R5MA 5CO7A 4MZTA 4P72C 2XHCA 1TSFA 1R0CB 1PCXA 1WPYA 1G3SA 2I0NA 3H8ZA 2EWNA 2HL3A 3WXMB 1NJ5A 3EH1A 1NBEB 1PHTA 2P0PA 2HSEB 1ZUYA 2YRCA 3OD1A 4FYXB 2J7IA 3CC4Q 1VQ5Q 1I1JA 4PKCC 1KSWA 2IPOB 4M7DA 1E7OA 2E5AA 2BE7D 1D3BB 4XQ3A 8AT1B 1QVFS 1NJ6A 1Y0MA 2CJ9A 1OU9A 1ZSZC 2KRSA 2O31A 2AIRB 1TWBA 4JS4A 3OS0A 3EGXA 2RK1A 2C0OA 3CMEQ 2KROA 2DETA 1R8OB 2EQIA 3EFRA 1FMWA 2GTJA 1ADJA 4M7AC 2Q7HA 1WXUA 1M2VB 4LDWA 1BKBA 2JT4A 4CS2A 2OTLQ 2IIMA 2ZPIB 2SEMA 1Q82R 2DFUA 1U1SA 3DKMA 4M7DE 1MV3A 1JJ2P 3OBYA 1CKBA 3A8GB 3THKA 5CKEA 2DQ3A 3OA6A 3VS2A 3H0IA 4D8KA 5C51B 5J3BA 4F7UF 1WGSA 4RTVA 4P3NA 3EFOB 3QUIA 3JCMb 4ZTJA 4XU3A 4KR2A 4OLFA 2L8DA 1OX8A 4PK4A 2YWWA 5LJ3g 1X01A 4C92C 5KCHA 1LOJA 1WDXA 2J3MA 3CC2T 1AZEA 2M0YA 3G71A 1H641 2MF2A 2ZPHB 3MHXA 2ZR3A 2JUFA 4CC4B 2AKWB 3HRKA 4H2TA 2ODRD 2JS0A 1OZ2A 3LWIA 4N0AC 1IREB 2A3LA 4M78C 3MP6A 1WHKA 3E9HA 2QHTA 1QWFA 5KYYB 1MNEA 2Q7GA 4LDXA 4YRMA 2OAWA 2MYSA 1K9MU 5IHKA 4NCXA 3FB9A 3QYHB 1BI1A 2ARUA 1AWWA 4X5OA 4O2DA 3PZCA 4M75C 1VQKQ 2LZ6B 1B34A 4BB7A 2MOXA 2AK5A 3VBBA 4YTLA 4OMPA 4DEXA 5I2SA 3L42A 4GLKA 5KYUB 1PSEA 4WJ3M 2ZR2A 3ME9A 1H4VB 2GBQA 4E7LA 4OB1B 3ZEHA 2CKKA 2OAUA 2FB7A 3E9FA 4NL2A 1Y96B 2LX9A 3CCSA 1SETA 5GANd 5GAN7 2P84A 1VYUA 1T0JA 1LNXA 3I9QA 1QCFA 5LJ3e 2H3EB 3MP1A 1UDLA 1PM3A 2OTJQ 3QHSA 4C8QD 3TUPA 5HKCA 2YUOA 1K9MR 1GCPA 2L5QA 1ZLMA 4TQDA 2F1LA 2ZT8A 3BDLA 4TQFA 4JJBA 4C5GA 3JCMg 4A53A 5EC7A 4M7AG 4M7DC 1NJ8A 4WCIA 2QHSA 4B9XA 2NUZA 4EMKB 2P0QA 2DZ9A 3RR6A 2JTEA 4XEMA 1MUZA 3QKJA 5J39A 1VQNA 1V1CA 3SWNA 3HFVA 4MZMA 4RTXA 2DL3A 1DJ7B 2ENMA 4HXJA 2EAYA 1AZGB 2K5IA 1EIYA 3RUXA 3QJ6A 3CXCA 2R57A 4RG8A 3DLMA 9ATCB 3CCRA 2GQIA 2ZCFB 1QW1A 3GBQA 2YUNA 3MEUA 4RTTA 3M54A 3I56A 3MCAB 4C92G 3CCVQ 4BD3A 5GANh 4MDWA 5L8RE 3DLLA 3W3SA 3OB9A 2PMFA 2X4JA 3LC0A 4L59A 2K3YA 4M78G 1E6GA 3CPFA 3M56A 3CCMT 4P71A 4BW9A 2X4WA 1VOMA 3JB9G 3DSQA 3M4YA 1NZ9A 3E19A 3S3NA 1K8AU 3QSUA 1YFNA 1G5HA 2DO3A 2ECZA 1W66A 2X4YA 1X6GA 1V76A 4BI8B 1TUCA 4QKUA 2ZPFB 2IY5A 4EX5A 1GGMA 1KQ2A 4M75G 2RHQB 3RKYA 5LJ3j 3I55T 3BW1A 3SD4A 5CKBA 5GAOq 4IURA 3J81E 2NS6A 1M3BA 3PVLA 2Y90A 4Z02A 1W1FA 2ZXFA 1YI2Q 3ICAA 1UE9A 5LJ3f 2YUQA 3V7RA 2DBMA 2K4YA 1YFSA 1OPKA 2FRYA 1VQ9T 2EBPA 2KR3A 5IAYA 1HC7A 2EYYA 2GFAA 4YRRA 4H02A 4YCUA 2DNUA 3O5ZA 3WVEB 1YITT 2DXCA 4L6V5 2PUOB 1C1AA 2ZCEA 4K86A 3CC7A 3PCOA 1O9SA 4H2XB 2RHSA 1K8AR 3CC2Q 4L5GA 3L4GB 2QDLA 3VS3A 1GCQA 4OF1A 3HXUA 5CKDA 1OEBA 1VA7A 4DBHA 4E7KA 3OYKA 3M0RA 4YCVA 5FRNA 2YLBA 1I5OB 1M1GA 4M7DG 3NHNA 1AD5A 2K7AA 5GAN4 4QQGA 4C8QF 1H3ZA 4N4IA 1UHFA 3JCMX 1JJ2A 1SF9A 1UFFA 2A37A 4FW1A 4A4EA 2M0OA 3KUFA 3G6ET 2EQJA 1TUDA 3QG1A 1SSFA 3OYNA 3OYLA 3HTZA 2KYMA 2JNGA 1K0XA 1FWZA 1M1KC 2BIVA 2XD0A 1GFDA 2AT1B 2B86A 1B70B 3TEHA 4ELYC 3N5BB 2KVQG 4KT0E 3QYGB 5HGQA 2FYKA 3SWNC 2LT1A 2VVKA 3OYCA 2GTOA 4YROA 1BBUA 3CMAA 2CZ6B 4TWAA 4N4GA 2NUPB 4PJOB 4C0DC 5CR2A 2E3HA 3CD6T 3CCUA 3JAME 5HK3A 1QVGA 3UDCA 3VRZA 1NJ2A 2KEAA 2LDMA 1AEYA 4XEOA 4FT2A 3X26B 2AHJB 4OMFB 3JCMd 3PGGA 4P71C 1G3WA 2JOYA 2HDAA 3JSCA 4OB0B 4RUGA 3M55A 3OW2P 1NYGA 1HD3A 3V8KA 4TVRA 4JRKA 2X9HA 2PTKA 12ASA 3HSBA 4J15A 4FYYB 3VQXA 5CK9A 4L87A 1UG1A 2CH4A 2KI7A 3A7UA 2K2VA 3CCLA 5FU6B 4AT1B 3QJYA 2D0NA 3C0CA 1YGBA 1YHQA 1KC8U 2YHTA 2ROLA 2D1XA 4RMFA 2A0FB 1B7YB 3LWHA 1G8XA 4O6JA 1UTIA 2HSPA 3MEVA 1S72T 1OYXA 2AKLA 5HK0A 1YJ9A 2A8EA 3GOXA 4J9CA 2CP6A 1R0BG 1IRXA 1M8MA 3SFMA 3PMIA 3TCJA 3CCMQ 3RKWA 1KQSA 5GAOm 3ERRA 1YJWT 3G4ST 1Y7XA 2HBPA 1RAHB 2RHXA 1NJIU 4KH1B 2EGEA 1GCQC 2AZVA 2ROTA 3LSSA 1H4TA 2HAXA 1WI7A 1G5VA 2RHUA 4HT9A 1EX4A 1W2BS 3ER0A 1KC8R 3P8BB 1U1TA 3CPWS 1ABOA 2KXCA 1YCSB 2FL7A 2K79A 3CC4A 2KQWA 2K3XA 1VQ5A 3OBWA 3GNFB 3QIIA 1KD1U 1TS9A 2QEXQ 5KYWB 3BFMA 1WXBA 3GP8A 1VQOT 1WYXA 1QMCA 3QBYA 1VQ9Q 1H4QA 4BE2A 4KGXB 4HCCA 3A31A 2LMJA 1K1ZA 1QKXA 1UEBA 3FRNA 1YITQ 2V8IA 2A08A 3M59A 2YRVA 2F2XA 11ASA 3CMEA 3RNJA 4YRNA 3LYIA 4H2WA 2CSQA 4WI1A 4QT7A 4FM4B 4JLGA 1NJIR 3RMSA 4H2SA 1PRLC 3UH0A 2ALYA 2JMAA 5AT1B 5I2MA 1VQ7Q 1AWJA 2OTLA 1MHNA 1I8FA 2HQHA 4H2UA 3D7SB 1VQMQ 4DBRA 3G6EQ 2DYIA 4XU1A 2LNHB 1D0XA 1PYSA 2DM1A 2XTIA 1BB9A 4JLIA 1PD1A 1NYRA 4M77A 3OSSC 2XDPA 3M53A 3C95A 1KD1R 3TREA 3UT1A 1XTDA 1NLPC 2WSFE 2QA4A 2LJ1A 1GFCA 1JQQA 3JCMc 1PC0A 3L2UA 3MP8A 2Q5IA 1SEMA 1ACMB 2CSIA 2E41A 3RGLA 1ZSZA 3M57A 2G4CA 2KRNA 3A5YA 3P8VA 4TVAA 1WZOA 2D9TA 3TU4K 2KK4A 2HZYA 4E7SA 1FYNA 1YN8A 3REAB 1J5WA 2RPNA 1KMMA 2EFIA 1TH7A 1P92A 2VXEA 4HCZA 2ZAEA 5D7UA 2RJFA 2EIFA 2DIGA 3OMGA 4M77E 2FEIA 3OYYA 1RAFB 2FO0A 1ZA2B 4BY6B 4C5EA 1YIJQ 4YRCA 4RQFA 1VQKA 3QXEB 1UJ0A 3PFSA 4C0ZA 4P3PA 3BY7A 3MKDA 3REXA 4BI4A 2NUTA 4EO4A 5L23A 1VQ4Q 2DD5A 2QG9B 2RQVA 2XKOC 5IT9E 2C06A 3M5AA 4CS4A 4HWTA 4LNSA 1NM7A 3QDFA 1USYC 2O9SA 3I7FA 4A4GA 2RHYA 3TEEA 2VGNA 3CCJA 2OTJA 4RTUA 2RQUA 2L3SA 2RI3A 2RN8A 2V8JA 3A7RA 1S72Q 3M58A 5IHIA 1GRIA 2Z0WA 1Z7NA 3EG9A 3OYFA 4ZN1A 1Z9ZA 3LLRA 2XDBA 3Q1JA 3L2WA 4YRTA 2L0AA 4KRTA 4M75A 5ELNA 1A0NB 3KBGA 4LD6A 2LQ8A 3CCQT 3HXYA 1SERA 3G7ZA 4LD9K 2DE0X 3JB9H 2P4RA 4HCBA 1MMGA 1YJWQ 4H2YA 4DBQA 1NNHA 2EYXA 2CZ0B 3NGPA 1QVPA 4FCYA 1X2QA 2QXFA 4OMOA 2CIMA 1QF6A 4JJDA 1WJRA 1IL2A 3FEOA 3NELA 1WHJA 4IIMA 3HPWA 2RA2A 1HYOA 3A5ZA 2D0QB 3QO5A 3VQWA 2BTTA 4RDXA 1H92A 3CCVA 3M0SA 1QLYA 4M75E 5FU7B 4OB2B 4AFZC 2HMAA 1YJNT 2EJFA 4M77C 4M4ZA 4TTVA 3QZ5B 2BUDA 4HVCA 1RUWA 1VQ6T 2RMOA 1OULA 5CAIA 2K5FA 3GF5A 1Y07A 4RTWA 3AT1B 2JVVA 4CC7A 5GAOl 1M90U 2LCLA 3CCET 4PLIA 4C5HA 2QGGA 2KMTA 5GAMh 4LDVA 4ORZA 1UGVA 3WQZA 4YRPA 2EKOA 1YI2A 2VUBA 5GAN8 2YT6A 5C52B 5LJ5g 4JS5A 1HXDA 1RACB 3NEMA 2EPDA 1TUGB 5GAN2 2E10A 2M02A 3MEYA 2D8JA 1AOJA 1AHJB 3EG0A 4LXCA 2E12A 3A8OB 1BBZA 2ZZGA 3PVQA 1M9SA 3S3MA 3CC2A 4J8OA 2DLPA 4IUTA 1JRIA 2M9UA 3PIPA 1SG5A 2QA4Q 4IUPA 4C8QA 2ZTGA 2PVOB 3HXVA 2RK2A 1PSFA 5CQYA 2LCCA 1E1OA 4BWAA 1X2HA 2DEQA 4K87A 2PVGB 4OVAA 2J6KA 3JCMJ 2F5KA 1X2KA 3PT9A 1ZX6A 3C12A 2JZ2A 1LJOA 1U5SA 4LVJA 1QVGP 2F5TX 4XU2A 2GQVA 3V7SA 1SHGA 4PNOA 1JU5C 2RQWA 2CJAA 2W0ZA 3KXTA 3G71T 2K2MA 1NYFA 1UGPB 4BE1A 4YYEA 5DLOA 4KULA 4PJOD 5LJ5e 1K73U 5IN1A 7AT1B 4F7UG 1OV3A 2QGFB 4X34A 1EVLA 4BACA 3A74A 5CQXA 4M77G 1K4US 1OI1A 4HCKA 1EIFA 2DU7A 3HFZB 3JCMW 3HRUA 3A32A 2EGCA 3WVDB 1QWEA 4OGEA 1VIFA 2ZT5A 5FW9A 2WSCE 2DJQA 4LDUA 1IGQA 2KYBA 3CCJQ 4R0KA 1TXQA 4A63B 3P8TA 1YFTA 1UB4A 2GGRA 4XTXA 1N8RC 2ODRC 1PWTA 2DL5A 2Y4XA 1M1KU 1ZUKA 2EYZA 4UC4A 1ABQA 1ZUUA 4J7FA 1Q95G 4C92F 2O2OA 3KFVA 4KGVB 1W70A 3GPLA 2AKKA 1M90C 3CCST 3REBB 3G1JA 2RB6A 4BUGA 3MO8A 1KQSP 5GMKl 4A54A 5C53B 1LVKA 4RCBA 4IKFA 1KHCA 3OW2S 4DPGA 1X6BA 2XIDA 1MMDA 4P5NA 3RF1A 3IG2A 3FC3A 3PMTA 5GAOr 1QQJA 2EVRA 5HY6A 3NETA 1ZBXA 3VS6A 2VV5A 1VQ8T 5GMKe 4RMOA 4YRIA 2B8AA 3CCMA 3VQYA 2HCKA 3EG3A 4YREA 1BIBA 3VJPA 3JRZA 4M7AB 5LJ5j 4FYWB 2HQXA 8ATCB 1VQNT 1E6HA 2X35A 1WU7A 4EMHA 1VQ6Q 3TSWA 2QTVA 2DVJA 1M8VA 1BYMA 1M1KR 2YDLA 3U23A 4JJNK 1CKAA 3VS5A 1KHIA 1NLOC 5LJ5f 3CCRT 5GJWB 4C8QC 3VS7A 4E6RA 2O4XA 2RHIA 1ZHIA 2C0IA 2EYWA 3I56T 3EGDB 3I5SA 5J26A 3QWYA 2RM4A 3RESA 2CJBA 4RCCA 1Q86C 2DPPB 1PNJA 2JMCA 3OQ5A 4C92B 1RLPC 3M0PA 2QEXA 1RADB 1VQ9A 2QK0A 2ESWA 4PJOF 1WXTA 1JO8A 4M78B 1YITA 2MPXC 4UP8A 2X51A 1JJCB 4AFSC 2AMCA 2ZGWA 5LJ3d 3L2RA 5LL6S 1K73C 3H0HA 3OYJA 3TQ7P 2QQBA 1VIEA 4FSXA 3FIFA 3M0QA 4OP0A 2VXFA 1VQ7A 1X69A 3HXWA 2LVMA 5C6SA 5FWBA 1UGRB 2RJCA 1VQMA 1U06A 1LPLA 3VUZA 4A4HA 3G6EA 5GMKj 3QZ9B 4FT4A 5DM7R 2DD4A 3UFGA 2DDZA 4RTYA 4R55A 5FWCA 4QW2A 1B7TA 1VQPT 2RI5A 1JB0E 2E3CA 1MNDA 3A5ZB 3OYGA 1WNLA 1N9RA 4AG2C 3CC7T 2LT4A 3VV0A 2BZYA 4OMLA 2ZZEA 4ZGDB 5GAN6 1IXDA 3RKXA 5IXBA 3H9NA 1N27A 5CCAA 3UATA 2O9VA 1X54A 5ECAA 4E7IA 3TSZA 2G3RA 2CH4W 5LJ3h 4MZPA 1AWOA 3NMZC 4BDZA 1X27A 4M7DB 2QQAA 1VUBA 2KRMA 1X2GA 2CS7A 1C6VX 1YIJA 4G84A 1I81A 1X56A 4QVZA 4YRQA 2VC8A 3EGXB 2DIQA 4J83A 2MIOA 1QE0A 4C8QG 1YBYA 3OYHA 4J6XA 5E3IA 1UUEA 4XTWA 1FMKA 2DTOA 3TVTA 4YDQA 1B76A 2CUDA 2CP7A 1SPKA 1VQ4A 2D8HA 3VS0A 4MDXA 3CMAT 1BI2A 4P74C 4CH4A 1M1FA 3X28B 1ASZA 4Q5WA 2LX7A 1RI9A 5CVIA 3CCUT 1WFWA 3MQZA 1J3TA 4ESRA 1WLEA 5HCKA 3QPHA 1D3BA 2KXDA 3MF2A 2KGTA 2XDDA 2E6NA 3H41A 2DBKA 5EG2A 1IO6A 1E1TA 1GL5A 4GBQA 2RD1A 4LVKA 4DBFA 4YRJA 1S72A 4E7HA 4JRQA 1Q81C 4EIKA 3JCMV 1VQ8Q 1M2VA 2K6DA 3HFNA 3ZFJA 3VUBA 3VU3C 2L3QA 3HY1A 4UPAA 2PZ1A 2R5AA 1YJWA 1PD0A 2FZKB 2DA9A 2DRKA 2BE9B 4JZ4A 1K9AA 4CH5A 1BCOA 3JCMQ 3CCLT 3CXCS 4PFOA 3HXXA 2O88A 1KJWA 3JCMh 3QWXX 3EFOA 2X3WD 1B34B 5GAOn 1NE8A 5DY9A 3QO3A 4AMCA 4J9BA 4QQ6A 2JJ9A 1HK9A 1YJ9T 2VASA 1USYA 3I55Q 2F69A 1E22A 2AKWA 1H4SA 3E9GA 1O75A 5KYYA 4HWRA 3VQVA 3HRTA 3OYMA 1QVFA 4P3OA 1UHCA 1SESA 3RBBB 2IVWA 5FROA 3QNEA 1QCOA 5DLQE 2YUPA 4KGZB 3OYAA 1VYTA 2DVEA 4DEYA 3BJUA 2EJ9A 4ZIBA 2EQUA 3ULRB 2Y4YA 5KYUA 2FZGB 3VYHB 1NPPA 2K5LA 5KE2A 4FIBA 3CC4T 3CBMA 1VQ5T 5FLXE 4PG3A 5GAN5 1VQZA 3ZBDA 2XGTA 3SWNB 1Y96A 3LX7A 2VYTA 4Z89A 1EIYB 4J9DA 3PIOA 4F7UA 2Q5HA 4C0DB 1D09B 5FU7C 4ZN3A 2LC4A 3JB9J 1M27C 4Q6GA 2QASA 2PUKB 2A7YA 3JB9I 1G3TA 5GAMe 5A0DA 3OYDA 1T0HA 5KYNA 2OTLT 1RAAB 1JJ2S 4EMKA 4ATOA 4DQ2A 1EVKA 3V8JA 2WACA 2X3XD 4JDSA 2O01E 4P75A 2KDSA 1G83A 1L0WA 4HVWA 1SHFA 2ARTA 2D6FA 4IUUA 3CD6Q 2COWA 4F7UE 4NL3A 1EZZB 3VS4A 3M4QA 2IY5B 3OS5A 2COYA 3UA6A 1LYLA 4YRGA 3MF1A 3X24B 1OX9A 2KBTA 4LNPA 2LJ0A 2A36A 4RQEA 2FRWA 4EMGA 2BZ8A 3I5RA 5KYXA 1TU0B 1UGSB 4KBMB 2C8MA 4E2FB 3LH5A 4H2VA 4ME7A 4E47A 2ZINA 2CDTA 2ZIOA 5K1XA 5GMKm 1QVGS 2ARSA 3UGTA 2HBWA 3HRIA 2QYZA 2DK3A 2E5QA 2LQKA 1NJ1A
chains in the Genus database with same CATH topology
1VQKT 3C4SA 1VQLT 2M16A 3PCOB 2RHQA 2RHSB 2DKGA 4JRIA 4XU0A 1Q7YC 4E51A 2RH2A 1RIQA 2KY9A 5GAMj 2RJDA 4RG2A 3L2VA 2JN0A 4DA4A 2Q7EA 2PU9B 5GANg 1ASYA 4YRSA 3MEWA 2OTJT 1XQHA 1ATIA 3QTCA 2XU8A 4OB3B 2MMPA 4CH6A 4HWPA 3TEHB 4H2XA 1FXXA 3NTHA 3L4GA 1WQWA 4PHCA 4IUQA 4M7AD 2ZT7A 1KQSS 3HY0A 4RKUE 3R07A 3CBPA 2WSEE 1VQ6A 1N8RU 2E70A 1OZ3A 3RERA 4II1A 2RO0A 4BDYA 1B70A 3META 4EMKC 3CCVT 4O5VA 4HWSA 4YPFA 4C92D 4P75C 3TEGA 5K1PA 1EQRA 4B9WA 4KR3A 2DJZA 3OYBA 2H3JA 4PJOA 4M78D 1GXIE 5GANe 3JB9D 5ELOA 3SDZA 3J80E 5D6YA 2BKDN 3LH0A 4HT8A 3LGLA 4M75D 4UP9A 1G3YA 1EOVA 1I4K1 2I4NA 1YI2T 1ZQ1A 2V8KA 4PJOE 4XTUA 3M4GA 4DOVA 2MWPA 2YLCA 3GNGA 1Q86U 4CRIA 3LGFA 4YCWA 5KH6A 1E24A 3HXZA 4M77F 1QP2A 2L89A 2P0LA 3HL8A 1V29B 4TVYA 4Y91A 4KUDK 1B7YA 2PMEA 5KNNA 2RHZA 1U8RA 2E1HA 3HHTB 2GF7A 1KOGA 4DOWA 3LSQA 1C0AA 3L2ZA 2DXBA 3P8HA 2E6ZA 4TVWA 4KUIA 4C8QE 2QI2A 3OS1A 3J7AF 4UP7A 4JRPA 4M7DD 3O8VA 2GCXA 3NTIA 2MAMA 5FRMA 3A7AA 4M7AF 4NOYA 5GANj 5M9OA 1BIAA 3HKSA 1NYQA 4FU6A 2K57A 4BE0A 5GANf 4IUVA 4XK8E 2ALYB 3X25B 2ZPEB 3S6WA 4J6WA 1XOVA 1BBWA 4C0GA 1PYSB 4F7UB 1Q82C 4M77B 4HWOA 4J6YA 5I21A 4M78F 2I4OA 3JB9F 2ZZDA 4PJOC 4FL6A 3UPUA 1VQ8A 4TVAB 4CS3A 3V8LA 4M75F 5A0LA 3S3OA 2VGMA 1KG1A 2P5IA 4CI0C 3RACA 2X4XA 3VKIA 4YRKA 4GY5A 4P74A 2ZPGB 4CH3A 3FDRA 2RJEA 3RL6A 3I55A 4ELZC 2ZIMA 2P4TA 5CKHA 2ZPBB 1X75C 1W2BA 1X55A 1RI0A 3URGA 2XG8D 3CPWA 5FU6C 5LJ5d 4XAXB 2QDYB 3CEYA 2PQWA 3RIRA 1Q81U 4HT4A 4M7DF 2I2LA 3QO7A 3X20B 3FJPA 2KSSA 3JCMe 2RI2A 1NPRA 3GIBA 2C7IA 1IZ6A 1Y71A 4EDUA 3NFCA 1K9MC 4QQDA 2EJGA 4M75B 3IKMB 1M4ZA 3C94A 4ZTFA 4LVIA 2QEXT 4A4KA 3FLGA 2ZNIA 1QP3A 3H6ZA 1VQPA 2EYQA 4P73A 1WJSA 4QVDA 4HA8A 2M1HA 1FX7A 5LJ5h 3P8DA 2CZ1B 1VQ7T 4PJOG 1W4SA 2LRQA 2CGHA 1VQMT 4G85A 2E65A 2EQKA 2HNIA 2QQSA 3E1SA 3M4PA 4WJ4A 3CD6A 3UGQA 1B8AA 2DAQA 1RL2A 3V7CA 1BI3A 4PL6A 3NENA 3HP9A 1WYDA 2IG0A 5AYFA 3CMQA 4E7JA 4Q15A 1SRYA 2MI6A 3OYIA 2CZ7B 3QDRB 3JCMf 1FYFA 2ZZFA 3DB4A 3NTKA 1N6AA 1N9SA 1YIJT 2L3RA 2XICA 2DTHA 3UWNA 2EL9A 5D6XA 1N9WA 5GMKh 3REUA 2ZT6A 5F5WA 2DXTA 2GFUA 1K8AC 4C8QB 4XTYA 1VQ4T 4ZGJB 4MMKA 2XI9A 3PTAA 4BY6C 2DTIA 3OS2A 1YFRA 2P0KA 3G4SA 3KFUA 2QHVA 1YHQT 2MWOA 4MMLA 2HQEA 3A8HB 4OGCA 4X9CA 1Z7MA 3IALA 2J3LA 3SB2A 3OMCA 5A2QE 2I4LA 1WJQA 4P73C 5GAMg 2QTXA 5A0GA 2PVDB 1VQOA 1Q7YU 4ZTUB 4YRFA 1HTTA 4ZGEB 3MEAA 4BI3A 1KMNA 4YP0A 3QO8A 3PNWC 1BI0A 1WQ7A 3ASKA 3A8LB 4N4HA 3DB3A 4WF2A 3EAEA 1G51A 4LVMA 4C0FA 3GLXA 3IKLA 2ZNJA 4Y28E 2DQ0A 2JTMA 1I5LA 4XTVA 4X9DA 3HFZA 4VUBA 3RMQA 1XNIA 1YCYA 2E64A 1EFWA 3L2QA 4PLLA 2QHUA 4AH6A 3CMET 5CKFA 4EPCA 2XK0A 3LW5E 2DZCA 4P72A 1YB3A 3OYEA 4QVCA 4R56A 5C0MA 4JUVA 4LDYA 3T9NA 3AHUA 3HFOA 2O4XB 5KE3A 2QQ9A 5GMKi 1M5Q1 5D6WA 2QA4T 3R6OA 3M9QA 4HKEA 2FVUA 1KQ1A 2JTFA 1X6OA 3OSVA 3VYGA 1KC8C 3EFSA 1MGQA 5KCOA 4J7IA 4M7AA 3E9IA 1ADYA 4J5YA 1VQLA 4XTZA 2AMCB 2KAFA 3A8MB 3CBOA 3HRSA 5GAOp 4C5IA 2NLUA 1NJIC 4C92A 3CCQA 4M7AE 5GAN3 2HD0A 3P8YA 4M77D 2R58A 2CYZB 2I4MA 4NS5A 4N0AA 4M78A 1JBMA 4D6WA 2QQRA 2DU5A 3JCMP 5GAMf 3CCJT 1JJCA 3OW2A 2LTOA 1KD1C 2DXUA 3BDUA 3G1ZA 4YRLA 4K88A 3OY9A 3L1AA 5CIUA 4A4FA 2FHDA 4C92E 5GAMd 1YJNA 4KQEA 2LNVA 1G5IA 3F70A 3INZA 4M78E 4V2SA 4ZTZB 1UGQB 2EQMA 4LVLA 3CCEA 1Q82U 2R5MA 5CO7A 4MZTA 4P72C 2XHCA 1WPYA 1G3SA 3H8ZA 2EWNA 3WXMB 1NJ5A 3OD1A 2P0PA 4PKCC 4M7DA 2E5AA 1QVFS 1D3BB 4XQ3A 1NJ6A 2CJ9A 4JS4A 3OS0A 2RK1A 1R8OB 3EFRA 1ADJA 4M7AC 2Q7HA 4LDWA 1BKBA 4CS2A 2ZPIB 3DKMA 1U1SA 4M7DE 3OBYA 3A8GB 5CKEA 2DQ3A 3OA6A 5C51B 5J3BA 4F7UF 1WGSA 4P3NA 3JCMb 3QUIA 4ZTJA 4XU3A 4KR2A 4OLFA 2L8DA 5LJ3g 1X01A 4C92C 5KCHA 1LOJA 2J3MA 3CC2T 3G71A 1H641 2MF2A 2ZPHB 3MHXA 2ZR3A 2JUFA 2AKWB 3HRKA 4H2TA 2ODRD 1OZ2A 3LWIA 4N0AC 1IREB 2A3LA 4M78C 3MP6A 3E9HA 2QHTA 2Q7GA 4LDXA 4YRMA 1K9MU 4NCXA 3FB9A 3QYHB 1BI1A 2ARUA 4X5OA 4O2DA 3PZCA 4M75C 1B34A 4BB7A 3VBBA 4YTLA 5I2SA 3L42A 4GLKA 1PSEA 4WJ3M 2ZR2A 3ME9A 1H4VB 4E7LA 4OB1B 3ZEHA 2CKKA 2OAUA 2FB7A 3E9FA 4NL2A 1Y96B 2LX9A 3CCSA 1SETA 5GANd 5GAN7 1LNXA 5LJ3e 3MP1A 3QHSA 4C8QD 3TUPA 5HKCA 2L5QA 4TQDA 2ZT8A 3BDLA 4TQFA 4C5GA 4M7AG 3JCMg 4A53A 1NJ8A 4M7DC 2QHSA 4B9XA 4EMKB 2P0QA 2DZ9A 4XEMA 3QKJA 5J39A 1VQNA 3HFVA 3SWNA 4MZMA 1DJ7B 2K5IA 2EAYA 1EIYA 3RUXA 3QJ6A 3CXCA 2R57A 4RG8A 3DLMA 3CCRA 2ZCFB 1QW1A 3MEUA 3M54A 3I56A 3MCAB 4C92G 4BD3A 5GANh 4MDWA 5L8RE 3DLLA 3W3SA 3OB9A 2PMFA 2X4JA 3LC0A 4L59A 2K3YA 4M78G 3M56A 3CPFA 3CCMT 4P71A 4BW9A 2X4WA 3JB9G 3DSQA 3M4YA 1NZ9A 3E19A 3S3NA 1K8AU 3QSUA 1G5HA 2DO3A 1W66A 2X4YA 4BI8B 2ZPFB 2IY5A 4EX5A 1GGMA 1KQ2A 4M75G 2RHQB 3RKYA 5LJ3j 3I55T 3BW1A 3SD4A 5CKBA 5GAOq 4IURA 3J81E 2NS6A 2Y90A 4Z02A 2ZXFA 3ICAA 5LJ3f 3V7RA 2K4YA 1YFSA 1VQ9T 1HC7A 5IAYA 2GFAA 4YRRA 4H02A 4YCUA 3WVEB 1YITT 2DXCA 4L6V5 2PUOB 2ZCEA 4K86A 3CC7A 3PCOA 1O9SA 4H2XB 2RHSA 4L5GA 3L4GB 4OF1A 3HXUA 5CKDA 4E7KA 3OYKA 4YCVA 5FRNA 2YLBA 1M1GA 4M7DG 1H3ZA 5GAN4 4QQGA 4C8QF 4N4IA 3JCMX 1JJ2A 4A4EA 2M0OA 3KUFA 3G6ET 2EQJA 3QG1A 1SSFA 3OYNA 3OYLA 3HTZA 2JNGA 1FWZA 1M1KC 2BIVA 2XD0A 1B70B 3TEHA 4ELYC 3N5BB 2KVQG 4KT0E 3QYGB 5HGQA 2FYKA 3SWNC 2LT1A 3OYCA 4YROA 1BBUA 3CMAA 2CZ6B 4TWAA 4N4GA 4PJOB 4C0DC 5CR2A 3CD6T 3CCUA 3JAME 5HK3A 1QVGA 3UDCA 1NJ2A 2LDMA 4XEOA 4FT2A 3X26B 2AHJB 4OMFB 3JCMd 3PGGA 4P71C 1G3WA 2JOYA 3JSCA 4OB0B 3M55A 3V8KA 4TVRA 4JRKA 12ASA 3HSBA 4J15A 3VQXA 5CK9A 4L87A 3A7UA 2K2VA 3CCLA 5FU6B 3QJYA 1YGBA 1YHQA 1KC8U 2YHTA 4RMFA 1B7YB 3LWHA 4O6JA 3MEVA 1S72T 1OYXA 5HK0A 1YJ9A 2A8EA 3GOXA 3SFMA 3PMIA 3TCJA 3RKWA 1KQSA 5GAOm 3ERRA 1YJWT 3G4ST 1Y7XA 2HBPA 2RHXA 1NJIU 3LSSA 1H4TA 2HAXA 1G5VA 2RHUA 4HT9A 1W2BS 3ER0A 3P8BB 1U1TA 3CPWS 2FL7A 3CC4A 2KQWA 2K3XA 1VQ5A 3OBWA 3GNFB 3QIIA 1KD1U 3BFMA 3GP8A 1VQOT 3QBYA 1H4QA 4BE2A 4HCCA 3A31A 1UEBA 3FRNA 2V8IA 3M59A 2YRVA 11ASA 3CMEA 4YRNA 3LYIA 4H2WA 4WI1A 4FM4B 4JLGA 3RMSA 4H2SA 3UH0A 2ALYA 5I2MA 2OTLA 1MHNA 1I8FA 4H2UA 4XU1A 1PYSA 2XTIA 4JLIA 1NYRA 4M77A 3OSSC 2XDPA 3M53A 3C95A 3TREA 3UT1A 1XTDA 2WSFE 2QA4A 3JCMc 3L2UA 3MP8A 2Q5IA 2E41A 3RGLA 2G4CA 3M57A 3A5YA 3P8VA 4TVAA 2D9TA 3TU4K 2KK4A 1J5WA 1KMMA 2EFIA 1TH7A 1P92A 2VXEA 4HCZA 2RJFA 2EIFA 2DIGA 3OMGA 4M77E 3OYYA 4C5EA 4BY6B 4YRCA 4RQFA 1VQKA 3QXEB 3PFSA 4C0ZA 4P3PA 3BY7A 3REXA 4BI4A 4EO4A 2DD5A 2XKOC 5IT9E 2C06A 3M5AA 4CS4A 4HWTA 4LNSA 1USYC 3I7FA 4A4GA 2RHYA 3TEEA 2VGNA 3CCJA 2OTJA 2RI3A 2V8JA 3A7RA 3M58A 1Z7NA 3OYFA 4ZN1A 3LLRA 2XDBA 3Q1JA 3L2WA 4YRTA 5ELNA 4M75A 3KBGA 4LD6A 2LQ8A 3CCQT 3HXYA 1SERA 3G7ZA 4LD9K 3JB9H 4HCBA 4H2YA 1NNHA 2CZ0B 1QVPA 2QXFA 2CIMA 1QF6A 1WJRA 1IL2A 3FEOA 3NELA 3HPWA 2RA2A 3A5ZA 2D0QB 3QO5A 3VQWA 4RDXA 3CCVA 4M75E 5FU7B 4OB2B 1YJNT 2EJFA 4M77C 4TTVA 3QZ5B 2BUDA 4HVCA 1VQ6T 5CAIA 2K5FA 3GF5A 1Y07A 2JVVA 5GAOl 1M90U 2LCLA 3CCET 4PLIA 4C5HA 2KMTA 5GAMh 4LDVA 3WQZA 4YRPA 2EKOA 1YI2A 2VUBA 5GAN8 5C52B 5LJ5g 4JS5A 1HXDA 3NEMA 5GAN2 2E10A 3MEYA 1AHJB 2E12A 3A8OB 2ZZGA 1M9SA 3S3MA 3CC2A 4J8OA 4IUTA 1JRIA 2M9UA 3PIPA 4IUPA 4C8QA 2ZTGA 2PVOB 3HXVA 2RK2A 1PSFA 5CQYA 2LCCA 1E1OA 4BWAA 1X2HA 2DEQA 4K87A 2PVGB 4OVAA 3JCMJ 2F5KA 3PT9A 3C12A 2JZ2A 1LJOA 4LVJA 2F5TX 4XU2A 2GQVA 3V7SA 4PNOA 2CJAA 3KXTA 3G71T 1UGPB 4BE1A 4YYEA 5DLOA 4KULA 4PJOD 5LJ5e 1K73U 5IN1A 4F7UG 4X34A 1EVLA 4BACA 3A74A 5CQXA 4M77G 1OI1A 1EIFA 2DU7A 3HFZB 3JCMW 3HRUA 3A32A 3WVDB 4OGEA 1VIFA 2ZT5A 2WSCE 4LDUA 3P8TA 1YFTA 1UB4A 4XTXA 1N8RC 2ODRC 2Y4XA 1M1KU 4UC4A 4J7FA 4C92F 3GPLA 1M90C 3CCST 2RB6A 4BUGA 3MO8A 5GMKl 4A54A 5C53B 4RCBA 4IKFA 1KHCA 3OW2S 4DPGA 2XIDA 4P5NA 3RF1A 3IG2A 3FC3A 3PMTA 5GAOr 5HY6A 3NETA 1ZBXA 2VV5A 1VQ8T 5GMKe 4RMOA 4YRIA 2B8AA 3CCMA 3VQYA 4YREA 1BIBA 3VJPA 3JRZA 4M7AB 5LJ5j 2HQXA 1VQNT 2X35A 1WU7A 4EMHA 1BYMA 1M8VA 4JJNK 1KHIA 5LJ5f 3CCRT 4C8QC 2O4XA 2RHIA 1ZHIA 3I56T 5J26A 2RM4A 3RESA 2CJBA 4RCCA 1Q86C 2DPPB 3OQ5A 4C92B 2QEXA 1VQ9A 4PJOF 4M78B 1YITA 4UP8A 1JJCB 2AMCA 2ZGWA 5LJ3d 3L2RA 5LL6S 1K73C 3OYJA 2QQBA 1VIEA 4FSXA 3FIFA 4OP0A 2VXFA 1VQ7A 3HXWA 2LVMA 5C6SA 1UGRB 2RJCA 1VQMA 3VUZA 4A4HA 3G6EA 5GMKj 3QZ9B 4FT4A 5DM7R 2DD4A 3UFGA 2DDZA 4R55A 4QW2A 1VQPT 2RI5A 1JB0E 2E3CA 3A5ZB 3OYGA 1WNLA 1N9RA 3CC7T 2LT4A 3VV0A 2ZZEA 4ZGDB 5GAN6 3RKXA 1N27A 5CCAA 1X54A 4E7IA 2G3RA 5LJ3h 4MZPA 4BDZA 4M7DB 2QQAA 1VUBA 1X2GA 2CS7A 1YIJA 4G84A 1I81A 1X56A 4QVZA 4YRQA 2VC8A 2DIQA 4J83A 1QE0A 4C8QG 1YBYA 3OYHA 4J6XA 5E3IA 4XTWA 2DTOA 4YDQA 1B76A 1VQ4A 4MDXA 3CMAT 1BI2A 4P74C 4CH4A 1M1FA 3X28B 1ASZA 4Q5WA 3CCUT 5CVIA 3MQZA 1WLEA 3QPHA 1D3BA 3MF2A 2XDDA 2E6NA 5EG2A 1E1TA 2RD1A 4LVKA 4YRJA 1S72A 4E7HA 4JRQA 1Q81C 3JCMV 3HFNA 3ZFJA 3VUBA 3VU3C 3HY1A 4UPAA 2R5AA 1YJWA 4CH5A 3CCLT 3JCMQ 3CXCS 3HXXA 3JCMh 1B34B 5GAOn 1NE8A 5DY9A 3QO3A 1YJ9T 4QQ6A 1HK9A 1USYA 2F69A 1E22A 2AKWA 1H4SA 3E9GA 1O75A 4HWRA 3VQVA 3HRTA 3OYMA 1QVFA 4P3OA 1SESA 2IVWA 5FROA 3QNEA 5DLQE 3OYAA 2DVEA 3BJUA 2EJ9A 4ZIBA 2EQUA 2Y4YA 3VYHB 1NPPA 2K5LA 5KE2A 4FIBA 3CC4T 3CBMA 1VQ5T 5FLXE 4PG3A 5GAN5 1VQZA 3ZBDA 2XGTA 3SWNB 1Y96A 3LX7A 2VYTA 1EIYB 3PIOA 4F7UA 2Q5HA 4C0DB 5FU7C 4ZN3A 2LC4A 3JB9J 4Q6GA 2PUKB 2A7YA 3JB9I 1G3TA 5GAMe 5A0DA 3OYDA 2OTLT 1JJ2S 4EMKA 4ATOA 4DQ2A 1EVKA 3V8JA 2WACA 2O01E 4JDSA 4P75A 2KDSA 1L0WA 2ARTA 2D6FA 4IUUA 4F7UE 4NL3A 3M4QA 2IY5B 3OS5A 1LYLA 4YRGA 3MF1A 3X24B 4RQEA 4EMGA 1UGSB 4KBMB 2C8MA 4H2VA 4ME7A 4E47A 2ZINA 2ZIOA 5K1XA 5GMKm 1QVGS 2ARSA 3UGTA 3HRIA 2DK3A 2E5QA 2LQKA 1NJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9C A;  5LJ3 f;  1Z7M A;  3JCM J;  3IAL A;  2J3L A;  3PCO B;  3SB2 A;  2RHQ A;  3V7R A;  2RHS B;  2DKG A;  1LJO A;  1YFS A;  2I4L A;  4JRI A;  4XU0 A;  1HC7 A;  4XU2 A;  4E51 A;  3V7S A;  4P73 C;  4YRR A;  4H02 A;  5GAM g;  4PNO A;  4YCU A;  1RIQ A;  2QTX A;  2CJA A;  4ZTU B;  4YRF A;  1HTT A;  2ZCE A;  4YYE A;  5GAM j;  4K86 A;  3PCO A;  4PJO D;  4H2X B;  2RHS A;  5LJ5 e;  1KMN A;  2JN0 A;  4YP0 A;  3QO8 A;  4F7U G;  3L4G B;  2Q7E A;  1EVL A;  3HXU A;  5GAN g;  1ASY A;  1WQ7 A;  4YRS A;  3A74 A;  4M77 G;  4YCV A;  2YLB A;  3QTC A;  1ATI A;  4M7D G;  5GAN 4;  2DU7 A;  4C8Q F;  3HFZ B;  3JCM W;  4WF2 A;  4CH6 A;  1G51 A;  3JCM X;  4HWP A;  3TEH B;  4H2X A;  3A32 A;  3IKL A;  2ZNJ A;  3L4G A;  2ZT5 A;  1WQW A;  2DQ0 A;  4PHC A;  3HTZ A;  1I5L A;  4M7A D;  3P8T A;  1YFT A;  2ZT7 A;  4XTV A;  4XTX A;  4X9D A;  3HY0 A;  3HFZ A;  3R07 A;  2ODR C;  1B70 B;  3TEH A;  1YCY A;  2E64 A;  1EFW A;  4C92 F;  5HGQ A;  2FYK A;  3SWN C;  2QHU A;  4AH6 A;  3RER A;  4YRO A;  2RB6 A;  1BBU A;  4TWA A;  4PJO B;  5GMK l;  4A54 A;  1B70 A;  5C53 B;  4EMK C;  4RCB A;  2DZC A;  4HWS A;  4YPF A;  4DPG A;  4C92 D;  4P75 C;  3TEG A;  1NJ2 A;  4P72 A;  3RF1 A;  1YB3 A;  3IG2 A;  5K1P A;  4QVC A;  5GAO r;  1EQR A;  4XEO A;  4KR3 A;  2DJZ A;  3NET A;  4JUV A;  4PJO A;  4M78 D;  5GAN e;  5GMK e;  3AHU A;  3HFO A;  3JCM d;  3PGG A;  3JB9 D;  5ELO A;  4YRI A;  4P71 C;  3VQY A;  4YRE A;  1BIB A;  4M7A B;  5GMK i;  5LJ5 j;  3V8K A;  4HT8 A;  1M5Q 1;  1WU7 A;  4JRK A;  4EMH A;  12AS A;  3HSB A;  1M8V A;  4J15 A;  3VQX A;  4M75 D;  4L87 A;  1KQ1 A;  4UP9 A;  1EOV A;  5LJ5 f;  1I4K 1;  3EFS A;  3A7U A;  1MGQ A;  2I4N A;  4C8Q C;  1YGB A;  4M7A A;  3E9I A;  2YHT A;  4RMF A;  1B7Y B;  4PJO E;  2RM4 A;  3RES A;  1ADY A;  2CJB A;  4RCC A;  4J5Y A;  4XTU A;  3M4G A;  4XTZ A;  4C92 B;  2YLC A;  2AMC B;  4YCW A;  5GAO p;  1E24 A;  3HXZ A;  4M77 F;  2P0L A;  4PJO F;  4TVY A;  4Y91 A;  1B7Y A;  2PME A;  3RKW A;  5KNN A;  4M78 B;  2E1H A;  1KOG A;  5GAO m;  3ERR A;  4UP8 A;  3LSQ A;  1C0A A;  3L2Z A;  1JJC B;  4C92 A;  2AMC A;  2ZGW A;  5LJ3 d;  4M7A E;  5GAN 3;  3P8Y A;  4TVW A;  4C8Q E;  4M77 D;  3FIF A;  3LSS A;  4UP7 A;  4M7D D;  1H4T A;  4OP0 A;  2I4M A;  2VXF A;  4N0A A;  4M78 A;  1JBM A;  3HXW A;  2DU5 A;  3JCM P;  5GAM f;  4HT9 A;  3A7A A;  1JJC A;  4M7A F;  4NOY A;  2DXU A;  3BDU A;  1U1T A;  5GMK j;  5GAN j;  3G1Z A;  4YRL A;  3UFG A;  1BIA A;  2DDZ A;  4K88 A;  3L1A A;  1NYQ A;  3BFM A;  2K57 A;  2E3C A;  5GAN f;  4C92 E;  5GAM d;  1H4Q A;  1WNL A;  4KQE A;  1N9R A;  3A31 A;  1G5I A;  2ALY B;  3INZ A;  2ZZE A;  5GAN 6;  3RKX A;  4M78 E;  4J6W A;  11AS A;  4YRN A;  1BBW A;  4H2W A;  4V2S A;  1PYS B;  1X54 A;  4F7U B;  4ZTZ B;  4WI1 A;  4H2S A;  3UH0 A;  5LJ3 h;  2ALY A;  4M77 B;  4HWO A;  4J6Y A;  4M7D B;  5I21 A;  4M78 F;  1I8F A;  1X2G A;  4H2U A;  4P72 C;  1WPY A;  2I4O A;  3JB9 F;  4G84 A;  1I81 A;  1X56 A;  2EWN A;  4XU1 A;  1NJ5 A;  4YRQ A;  2VC8 A;  3OD1 A;  1PYS A;  4PJO C;  2XTI A;  1QE0 A;  4C8Q G;  4JLI A;  1NYR A;  4TVA B;  4CS3 A;  4M77 A;  3V8L A;  4J6X A;  5E3I A;  4XTW A;  4M75 F;  4M7D A;  2DTO A;  2E5A A;  1D3B B;  4XQ3 A;  4YDQ A;  1B76 A;  1NJ6 A;  2CJ9 A;  2P5I A;  3JCM c;  4P74 C;  3RAC A;  4CH4 A;  2Q5I A;  1ASZ A;  2E41 A;  4YRK A;  3RGL A;  2G4C A;  3A5Y A;  3P8V A;  4TVA A;  4P74 A;  3EFR A;  1WLE A;  1ADJ A;  4M7A C;  1D3B A;  4CH3 A;  1J5W A;  1KMM A;  2Q7H A;  1TH7 A;  3MF2 A;  2VXE A;  3RL6 A;  1E1T A;  4CS2 A;  2ZIM A;  2RD1 A;  4M77 E;  4YRJ A;  1U1S A;  1X55 A;  4M7D E;  4YRC A;  4RQF A;  5LJ5 d;  2DQ3 A;  5C51 B;  3JCM V;  4F7U F;  3RIR A;  4P3N A;  3JCM b;  3QUI A;  4P3P A;  4XU3 A;  4KR2 A;  4OLF A;  3HFN A;  3VU3 C;  3HY1 A;  3BY7 A;  4UPA A;  3REX A;  5LJ3 g;  1X01 A;  4EO4 A;  4M7D F;  2I2L A;  3QO7 A;  4C92 C;  4CH5 A;  1LOJ A;  2J3M A;  3FJP A;  3JCM Q;  4CS4 A;  1H64 1;  3HXX A;  2ZR3 A;  3JCM e;  4HWT A;  4LNS A;  3JCM h;  2AKW B;  3HRK A;  4H2T A;  2ODR D;  3GIB A;  2C7I A;  4N0A C;  4M78 C;  1USY C;  1B34 B;  3E9H A;  2QHT A;  5GAO n;  3I7F A;  5DY9 A;  2EJG A;  3QO3 A;  4M75 B;  2Q7G A;  3IKM B;  1HK9 A;  1USY A;  4YRM A;  4NCX A;  3FB9 A;  1E22 A;  2ARU A;  2AKW A;  3A7R A;  2ZNI A;  1H4S A;  4X5O A;  4O2D A;  3PZC A;  4M75 C;  1B34 A;  1Z7N A;  4HWR A;  3VQV A;  4YRT A;  5ELN A;  4M75 A;  4P73 A;  3VBB A;  1SER A;  4QVD A;  3HXY A;  4HA8 A;  5LJ5 h;  4WJ3 M;  3JB9 H;  2ZR2 A;  4P3O A;  1H4V B;  1SES A;  4H2Y A;  1NNH A;  3QNE A;  4PJO G;  2FB7 A;  4NL2 A;  2CIM A;  1QF6 A;  1IL2 A;  3NEL A;  1Y96 B;  2CGH A;  2DVE A;  1SET A;  3BJU A;  2EJ9 A;  5GAN d;  5GAN 7;  2RA2 A;  4ZIB A;  4G85 A;  2E65 A;  1LNX A;  2HNI A;  3A5Z A;  3M4P A;  3QO5 A;  3VQW A;  4WJ4 A;  5LJ3 e;  4RDX A;  3UGQ A;  4PG3 A;  1B8A A;  5GAN 5;  3QHS A;  1VQZ A;  4M75 E;  2XGT A;  4C8Q D;  3TUP A;  3SWN B;  1Y96 A;  3V7C A;  4TQD A;  2EJF A;  1EIY B;  2ZT8 A;  4M77 C;  4TQF A;  4TTV A;  4F7U A;  4M7A G;  3JCM g;  4A53 A;  1NJ8 A;  2Q5H A;  4M7D C;  1WYD A;  3NEN A;  2QHS A;  4HVC A;  4EMK B;  2DZ9 A;  5CAI A;  3JB9 J;  4Q6G A;  4XEM A;  3CMQ A;  4Q15 A;  1SRY A;  3HFV A;  3SWN A;  5GAO l;  3JB9 I;  2EAY A;  1EIY A;  3RUX A;  5GAM e;  3JCM f;  1FYF A;  2ZZF A;  5GAM h;  4EMK A;  1N9S A;  3WQZ A;  4DQ2 A;  4YRP A;  1EVK A;  3V8J A;  4P75 A;  1L0W A;  5GAN 8;  2ART A;  5C52 B;  4C92 G;  2DTH A;  2EL9 A;  4F7U E;  4NL3 A;  5LJ5 g;  1N9W A;  5GMK h;  5GAN h;  3REU A;  2ZT6 A;  3M4Q A;  2IY5 B;  1HXD A;  3W3S A;  3NEM A;  5GAN 2;  5F5W A;  2DXT A;  2E10 A;  2PMF A;  3LC0 A;  1LYL A;  3MEY A;  4BW9 A;  4M78 G;  4C8Q B;  3MF1 A;  4XTY A;  4P71 A;  4YRG A;  4MMK A;  3JB9 G;  2ZZG A;  3DSQ A;  4RQE A;  3QSU A;  4EMG A;  1G5H A;  1W66 A;  2C8M A;  2DTI A;  1YFR A;  2IY5 A;  4EX5 A;  4H2V A;  1JRI A;  1GGM A;  1KQ2 A;  4M75 G;  2RHQ B;  2ZIN A;  3RKY A;  2ZIO A;  5K1X A;  4C8Q A;  2ZTG A;  5GMK m;  3KFU A;  5LJ3 j;  2ARS A;  3HXV A;  3UGT A;  3BW1 A;  5GAO q;  2QHV A;  3HRI A;  4MML A;  1E1O A;  2Y90 A;  4BWA A;  2ZXF A;  1X2H A;  2DEQ A;  4K87 A;  1NJ1 A;  3ICA A; 
#chains in the Genus database with same CATH topology
 1VQK T;  3C4S A;  1S1N A;  2G6F X;  1VQL T;  2M16 A;  3PCO B;  2RHQ A;  2RHS B;  2DKG A;  4IIO A;  4JRI A;  4LE9 A;  4XU0 A;  1Q7Y C;  4PJN A;  4J9I A;  1UEC A;  4F16 A;  4E51 A;  1WA7 A;  1WLP B;  2RH2 A;  1RIQ A;  1TTH B;  2KY9 A;  1TG0 A;  2CUB A;  2HKQ B;  2GNC A;  5GAM j;  4Z8A A;  2RJD A;  4RG2 A;  3L2V A;  2J6O A;  2JN0 A;  2DIL A;  4DA4 A;  2Q7E A;  1RAG B;  2PU9 B;  3G4S Q;  5GAN g;  1ASY A;  4YRS A;  1C0M A;  2CP2 A;  3MEW A;  2OTJ T;  1XQH A;  1ATI A;  3QTC A;  2XU8 A;  1MMN A;  4OB3 B;  2MMP A;  4CH6 A;  4HWP A;  2JS2 A;  3TEH B;  4H2X A;  1FXX A;  3NTH A;  3L4G A;  1PRM C;  1WQW A;  1OU8 A;  4PHC A;  4IUQ A;  4LUE A;  4M7A D;  2ZT7 A;  4Z88 A;  1KQS S;  1D0Z A;  3HY0 A;  2E3I A;  4RKU E;  3R07 A;  1ARK A;  3CBP A;  2WSE E;  1VQ6 A;  1N8R U;  1VQO Q;  2W10 A;  2M51 A;  4GLM A;  2DMO A;  2E70 A;  1OZ3 A;  3RER A;  4II1 A;  2XMF A;  2RO0 A;  2QAZ A;  4K11 A;  4BDY A;  2CT3 A;  1B70 A;  3MET A;  4EMK C;  5I11 A;  3CCV T;  4O5V A;  4HWS A;  4YPF A;  4C92 D;  4P75 C;  1YNZ A;  3IQL A;  3TEG A;  1Y57 A;  1SRL A;  1KK7 A;  5K1P A;  1EQR A;  4B9W A;  4KR3 A;  2DJZ A;  2H3J A;  3OYB A;  2NUP A;  4PJO A;  4M78 D;  1GXI E;  2J05 A;  5GAN e;  4PJL A;  1T3S A;  1WHM A;  3JB9 D;  5ELO A;  2CP0 A;  3SDZ A;  2ED0 A;  4J9H A;  3J80 E;  5D6Y A;  2BKD N;  3LH0 A;  4HT8 A;  2DL7 A;  1HSQ A;  2L2P A;  3VRY A;  3LGL A;  4M75 D;  4JPB W;  4UP9 A;  2KE9 A;  1G3Y A;  1N8R R;  2C0T A;  1EOV A;  1I4K 1;  2I4N A;  1YI2 T;  1ZQ1 A;  2LJ3 A;  1KIK A;  2V8K A;  3EGU A;  3FJ5 A;  4PJO E;  1RAI B;  2A28 A;  1M90 R;  4XTU A;  3M4G A;  4DOV A;  2MWP A;  2YLC A;  3GNG A;  1D1A A;  2L3P A;  2YXY A;  1Q86 U;  4CRI A;  3LGF A;  4YCW A;  5KH6 A;  1E24 A;  3HXZ A;  4M77 F;  1QP2 A;  2L89 A;  2P0L A;  3HL8 A;  1V29 B;  4TVY A;  4Y91 A;  4KUD K;  1B7Y A;  2PME A;  5KNN A;  2RHZ A;  2VWF A;  1U8R A;  2E1H A;  3HHT B;  2GF7 A;  1KOG A;  4DOW A;  2EW3 A;  3LSQ A;  1C0A A;  3L2Z A;  2DXB A;  3P8H A;  2DX1 A;  5I22 A;  2E6Z A;  4TVW A;  4KUI A;  4C8Q E;  2QI2 A;  1X43 A;  3OS1 A;  3J7A F;  4UP7 A;  4JRP A;  4M7D D;  3O8V A;  1BCM A;  2GCX A;  1SSH A;  4J9G A;  3NTI A;  2MAM A;  5FRM A;  1PKS A;  3A1P A;  3A7A A;  4M7A F;  2MCN A;  4NOY A;  2LQN A;  3NPF A;  5GAN j;  3A98 A;  3HTR A;  5M9O A;  1BIA A;  1VQL Q;  1H8K A;  3HKS A;  1WIE A;  1NYQ A;  4FU6 A;  4CC2 A;  2K57 A;  4BE0 A;  1M30 A;  5GAN f;  1PKT A;  2YRD A;  1Q86 R;  4IUV A;  4B6M A;  3E2U A;  4XK8 E;  2ALY B;  3X25 B;  2K9G A;  2ZPE B;  1B3Q A;  3S6W A;  2RQT A;  4J6W A;  3CCQ Q;  1XOV A;  5KYW A;  1MMA A;  1BBW A;  4C0G A;  1PYS B;  4F7U B;  1Q82 C;  4ANJ A;  4M77 B;  4HWO A;  4J6Y A;  1K73 R;  5I21 A;  4M78 F;  1OPL A;  1WHG A;  1H3H A;  3JB9 F;  2I4O A;  2ZZD A;  2F2W A;  1B07 A;  3EG1 A;  3VS1 A;  4PJO C;  4FL6 A;  3UPU A;  1ZSZ B;  1VQ8 A;  4AG1 C;  4TVA B;  4CS3 A;  3V8L A;  4M75 F;  2ATC B;  1YJN Q;  5A0L A;  3S3O A;  2VGM A;  1KG1 A;  1I07 A;  2JM8 A;  2P5I A;  2CT4 A;  4CI0 C;  3RAC A;  2X4X A;  1TOV A;  3VKI A;  1JXO A;  2RF0 A;  4YRK A;  4GY5 A;  3UA7 A;  4P74 A;  2ZPG B;  4CH3 A;  2J6F A;  4JZ3 A;  2LP5 A;  3FDR A;  1QVF P;  4LUD A;  2KT8 A;  3CCE Q;  2RJE A;  3RL6 A;  5KYX B;  3I55 A;  1XJW B;  4ELZ C;  2ZIM A;  2P4T A;  1RAE B;  5CKH A;  3SHW A;  2ZPB B;  2NUT B;  4D8D A;  2BZX A;  1AT1 B;  1X75 C;  1W2B A;  1X55 A;  1RI0 A;  3URG A;  4AFQ C;  2XG8 D;  3CPW A;  5FU6 C;  5LJ5 d;  4XAX B;  2QDY B;  3CEY A;  2PQW A;  2MK5 A;  3RIR A;  3M0U A;  1F1B B;  2DRM A;  2LQW A;  1Q81 U;  4HT4 A;  1IHV A;  4M7D F;  2I2L A;  3QO7 A;  3X20 B;  3FJP A;  2LCS A;  2KSS A;  1AVZ C;  3JCM e;  1RLQ C;  2RI2 A;  1NPR A;  3GIB A;  2C7I A;  1IZ6 A;  1Y71 A;  4EDU A;  2ABL A;  3NFC A;  1YP5 A;  3EG9 B;  1K9M C;  4QQD A;  2AZS A;  2E5K A;  2EJG A;  4M75 B;  4HVV A;  1M4Z A;  3IKM B;  3C94 A;  4ZTF A;  3EHQ A;  4LVI A;  2QEX T;  4A4K A;  3FLG A;  2CRE A;  2ZNI A;  4WTO B;  1QCN A;  1RAB B;  1QP3 A;  3H6Z A;  1VQP A;  2EYQ A;  1NG2 A;  4P73 A;  5GJV B;  1WJS A;  4QVD A;  4HA8 A;  1FX7 A;  2M1H A;  5LJ5 h;  3P8D A;  1Q81 R;  2CZ1 B;  1VQ7 T;  3G71 Q;  3BE3 A;  1W4S A;  4PJO G;  2LRQ A;  2CGH A;  1VQM T;  1NEG A;  1YWP A;  4G85 A;  4JJC A;  2E65 A;  2EQK A;  2HNI A;  2QQS A;  3E1S A;  3M4P A;  4WJ4 A;  2DL4 A;  3CD6 A;  2CP3 A;  3UGQ A;  1GBQ A;  1B8A A;  2DAQ A;  5IHN A;  1RL2 A;  2DF6 A;  3V7C A;  4X1V A;  1BI3 A;  4PL6 A;  3MPU B;  3NEN A;  1K76 A;  3HP9 A;  1WYD A;  2IG0 A;  5AYF A;  4PJJ A;  4E7J A;  1Z9Q A;  3CMQ A;  4Q15 A;  1SRY A;  1PG5 B;  2MI6 A;  3OYI A;  4OMN A;  2DL8 A;  2CZ7 B;  2RNA A;  2E4H A;  3QDR B;  3JCM f;  1FYF A;  2ZZF A;  4PFP A;  3DB4 A;  3NTK A;  2PNI A;  1N6A A;  2V26 A;  1N9S A;  3CCS Q;  2ED1 A;  2EGA A;  1M2O A;  1YIJ T;  1D1C A;  1ZSG A;  2L3R A;  2COZ A;  2XIC A;  2DTH A;  3UWN A;  2EL9 A;  5D6X A;  2DER A;  1N9W A;  5GMK h;  1KFZ A;  3REU A;  2ZT6 A;  6AT1 B;  4FW2 A;  4CC3 A;  5F5W A;  1LCK A;  2DXT A;  2GFU A;  1K0S A;  1K8A C;  1ZBJ A;  3UF4 A;  4C8Q B;  4XTY A;  4LN2 A;  4PJM A;  1VQ4 T;  4ZGJ B;  2K3B A;  4MMK A;  2XI9 A;  3PTA A;  4BY6 C;  2DTI A;  3OS2 A;  1YFR A;  2P0K A;  2JW4 A;  3G4S A;  1VQN Q;  2V1R A;  3KFU A;  1ZA1 B;  1MV0 B;  1YHQ T;  2QHV A;  2MWO A;  4MML A;  1NEB A;  2HQE A;  3CCR Q;  3A8H B;  4OGC A;  4X9C A;  1Z7M A;  3I56 Q;  3IAL A;  2J3L A;  1N5Z A;  3SB2 A;  3OMC A;  5A2Q E;  2I4L A;  1WJQ A;  5IH2 A;  3EH2 A;  4P73 C;  5GAM g;  2EKH A;  2QTX A;  3JV3 A;  5A0G A;  2PVD B;  1VQO A;  1Q7Y U;  4ZTU B;  4YRF A;  1HTT A;  1BU1 A;  4ZGE B;  1QKW A;  2VKN A;  4J9E A;  3MEA A;  4BI3 A;  3RDV A;  1KMN A;  4RTZ A;  4YP0 A;  3QO8 A;  4PFZ A;  3PNW C;  2NWM A;  1BI0 A;  1WQ7 A;  2FG0 A;  3ASK A;  3A8L B;  4N4H A;  3DB3 A;  4WF2 A;  3EAE A;  5IXF A;  1G51 A;  4LVM A;  4C0F A;  3GLX A;  2HEQ A;  2FPD A;  1FMV A;  4OMQ A;  3IKL A;  2ZNJ A;  1OQK A;  4Y28 E;  2SRC A;  3CQT A;  2DQ0 A;  4ZNX A;  2JTM A;  1VYV A;  1I5L A;  1OOT A;  4F04 B;  4XTV A;  2F2V A;  2HKN A;  1YWO A;  1W6X A;  4AFU C;  4X9D A;  3EHR A;  4VUB A;  3HFZ A;  3RMQ A;  1XNI A;  1VQP Q;  1YCY A;  2E64 A;  3ZL7 C;  1EFW A;  1IB8 A;  2NYS A;  3CC7 Q;  3L2Q A;  4PLL A;  4E7Z A;  1Q7Y R;  2QHU A;  4AH6 A;  3CME T;  5CKF A;  4EPC A;  2XK0 A;  1I0C A;  1JXM A;  3LW5 E;  2FZC B;  1EFN A;  1SKU B;  1UJY A;  2DZC A;  1SRM A;  1U3O A;  1WHL A;  4J9F A;  2KT1 A;  4P72 A;  1YB3 A;  3OYE A;  1JEG A;  1IHW A;  4QVC A;  1IGU A;  2OX7 A;  4R56 A;  3R6N A;  5C0M A;  4JUV A;  2J06 A;  4LDY A;  3T9N A;  3AHU A;  3SEM A;  3HFO A;  1WX6 A;  4Y92 A;  4OMM A;  2O4X B;  5KE3 A;  2QQ9 A;  5GMK i;  2YSQ A;  4FYV B;  1M5Q 1;  5D6W A;  2QA4 T;  3PE0 A;  3R6O A;  1GBR A;  1M3A A;  3M9Q A;  4HKE A;  2FVU A;  1KQ1 A;  2JTF A;  3MJX A;  1X6O A;  3OSV A;  3VYG A;  1KC8 C;  3EFS A;  1MGQ A;  5KCO A;  3CMA Q;  1D0Y A;  4J7I A;  2FPF A;  4M7A A;  3E9I A;  3CCU Q;  2DEU A;  4FSS A;  2DYB A;  1ADY A;  1AWX A;  4J5Y A;  4XTZ A;  1VQL A;  1M3C A;  4F14 A;  2AMC B;  2H8H A;  2KAF A;  3I35 A;  3A8M B;  3CBO A;  3H0F A;  4HVU A;  3HRS A;  2RQR A;  5GAO p;  3EGD A;  2JM9 A;  2V1Q A;  4C5I A;  2NLU A;  2CP5 A;  4KH0 B;  2OI3 A;  1NJI C;  2KNB B;  1D1B A;  1R77 A;  4C92 A;  1BK2 A;  3CCQ A;  4M7A E;  1CSK A;  5GAN 3;  3M0T A;  2HD0 A;  3P8Y A;  4M77 D;  2HL5 C;  2R58 A;  2CYZ B;  2I4M A;  4NS5 A;  4N0A A;  3CCL Q;  4M78 A;  1JBM A;  4D6W A;  2QQR A;  2DU5 A;  3JCM P;  1YHQ Q;  5GAM f;  3CXC P;  3CCJ T;  1JJC A;  3OW2 A;  2LTO A;  1KD1 C;  2DXU A;  3BDU A;  3G1Z A;  4YRL A;  1WHH A;  4K88 A;  3OY9 A;  1YJ9 Q;  2JXB A;  3EG2 A;  3L1A A;  5CIU A;  4A4F A;  2FHD A;  4C92 E;  5GAM d;  1YJN A;  4KQE A;  2LNV A;  4F17 A;  2VB6 A;  1G5I A;  1W2B P;  2OJ2 A;  3F70 A;  3INZ A;  3CPW P;  4M78 E;  4V2S A;  4ZTZ B;  1UGQ B;  2FPE A;  2EQM A;  1G2B A;  4LVL A;  1T3L A;  3CCE A;  1HJD A;  1Q82 U;  2R5M A;  5CO7 A;  4MZT A;  4P72 C;  2XHC A;  1TSF A;  1R0C B;  1PCX A;  1WPY A;  1G3S A;  2I0N A;  3H8Z A;  2EWN A;  2HL3 A;  3WXM B;  1NJ5 A;  3EH1 A;  1NBE B;  1PHT A;  2P0P A;  2HSE B;  1ZUY A;  2YRC A;  3OD1 A;  4FYX B;  2J7I A;  3CC4 Q;  1VQ5 Q;  1I1J A;  4PKC C;  1KSW A;  2IPO B;  4M7D A;  1E7O A;  2E5A A;  2BE7 D;  1D3B B;  4XQ3 A;  8AT1 B;  1QVF S;  1NJ6 A;  1Y0M A;  2CJ9 A;  1OU9 A;  1ZSZ C;  2KRS A;  2O31 A;  2AIR B;  1TWB A;  4JS4 A;  3OS0 A;  3EGX A;  2RK1 A;  2C0O A;  3CME Q;  2KRO A;  2DET A;  1R8O B;  2EQI A;  3EFR A;  1FMW A;  2GTJ A;  1ADJ A;  4M7A C;  2Q7H A;  1WXU A;  1M2V B;  4LDW A;  1BKB A;  2JT4 A;  4CS2 A;  2OTL Q;  2IIM A;  2ZPI B;  2SEM A;  1Q82 R;  2DFU A;  1U1S A;  3DKM A;  4M7D E;  1MV3 A;  1JJ2 P;  3OBY A;  1CKB A;  3A8G B;  3THK A;  5CKE A;  2DQ3 A;  3OA6 A;  3VS2 A;  3H0I A;  4D8K A;  5C51 B;  5J3B A;  4F7U F;  1WGS A;  4RTV A;  4P3N A;  3EFO B;  3QUI A;  3JCM b;  4ZTJ A;  4XU3 A;  4KR2 A;  4OLF A;  2L8D A;  1OX8 A;  4PK4 A;  2YWW A;  5LJ3 g;  1X01 A;  4C92 C;  5KCH A;  1LOJ A;  1WDX A;  2J3M A;  3CC2 T;  1AZE A;  2M0Y A;  3G71 A;  1H64 1;  2MF2 A;  2ZPH B;  3MHX A;  2ZR3 A;  2JUF A;  4CC4 B;  2AKW B;  3HRK A;  4H2T A;  2ODR D;  2JS0 A;  1OZ2 A;  3LWI A;  4N0A C;  1IRE B;  2A3L A;  4M78 C;  3MP6 A;  1WHK A;  3E9H A;  2QHT A;  1QWF A;  5KYY B;  1MNE A;  2Q7G A;  4LDX A;  4YRM A;  2OAW A;  2MYS A;  1K9M U;  5IHK A;  4NCX A;  3FB9 A;  3QYH B;  1BI1 A;  2ARU A;  1AWW A;  4X5O A;  4O2D A;  3PZC A;  4M75 C;  1VQK Q;  2LZ6 B;  1B34 A;  4BB7 A;  2MOX A;  2AK5 A;  3VBB A;  4YTL A;  4OMP A;  4DEX A;  5I2S A;  3L42 A;  4GLK A;  5KYU B;  1PSE A;  4WJ3 M;  2ZR2 A;  3ME9 A;  1H4V B;  2GBQ A;  4E7L A;  4OB1 B;  3ZEH A;  2CKK A;  2OAU A;  2FB7 A;  3E9F A;  4NL2 A;  1Y96 B;  2LX9 A;  3CCS A;  1SET A;  5GAN d;  5GAN 7;  2P84 A;  1VYU A;  1T0J A;  1LNX A;  3I9Q A;  1QCF A;  5LJ3 e;  2H3E B;  3MP1 A;  1UDL A;  1PM3 A;  2OTJ Q;  3QHS A;  4C8Q D;  3TUP A;  5HKC A;  2YUO A;  1K9M R;  1GCP A;  2L5Q A;  1ZLM A;  4TQD A;  2F1L A;  2ZT8 A;  3BDL A;  4TQF A;  4JJB A;  4C5G A;  3JCM g;  4A53 A;  5EC7 A;  4M7A G;  4M7D C;  1NJ8 A;  4WCI A;  2QHS A;  4B9X A;  2NUZ A;  4EMK B;  2P0Q A;  2DZ9 A;  3RR6 A;  2JTE A;  4XEM A;  1MUZ A;  3QKJ A;  5J39 A;  1VQN A;  1V1C A;  3SWN A;  3HFV A;  4MZM A;  4RTX A;  2DL3 A;  1DJ7 B;  2ENM A;  4HXJ A;  2EAY A;  1AZG B;  2K5I A;  1EIY A;  3RUX A;  3QJ6 A;  3CXC A;  2R57 A;  4RG8 A;  3DLM A;  9ATC B;  3CCR A;  2GQI A;  2ZCF B;  1QW1 A;  3GBQ A;  2YUN A;  3MEU A;  4RTT A;  3M54 A;  3I56 A;  3MCA B;  4C92 G;  3CCV Q;  4BD3 A;  5GAN h;  4MDW A;  5L8R E;  3DLL A;  3W3S A;  3OB9 A;  2PMF A;  2X4J A;  3LC0 A;  4L59 A;  2K3Y A;  4M78 G;  1E6G A;  3CPF A;  3M56 A;  3CCM T;  4P71 A;  4BW9 A;  2X4W A;  1VOM A;  3JB9 G;  3DSQ A;  3M4Y A;  1NZ9 A;  3E19 A;  3S3N A;  1K8A U;  3QSU A;  1YFN A;  1G5H A;  2DO3 A;  2ECZ A;  1W66 A;  2X4Y A;  1X6G A;  1V76 A;  4BI8 B;  1TUC A;  4QKU A;  2ZPF B;  2IY5 A;  4EX5 A;  1GGM A;  1KQ2 A;  4M75 G;  2RHQ B;  3RKY A;  5LJ3 j;  3I55 T;  3BW1 A;  3SD4 A;  5CKB A;  5GAO q;  4IUR A;  3J81 E;  2NS6 A;  1M3B A;  3PVL A;  2Y90 A;  4Z02 A;  1W1F A;  2ZXF A;  1YI2 Q;  3ICA A;  1UE9 A;  5LJ3 f;  2YUQ A;  3V7R A;  2DBM A;  2K4Y A;  1YFS A;  1OPK A;  2FRY A;  1VQ9 T;  2EBP A;  2KR3 A;  5IAY A;  1HC7 A;  2EYY A;  2GFA A;  4YRR A;  4H02 A;  4YCU A;  2DNU A;  3O5Z A;  3WVE B;  1YIT T;  2DXC A;  4L6V 5;  2PUO B;  1C1A A;  2ZCE A;  4K86 A;  3CC7 A;  3PCO A;  1O9S A;  4H2X B;  2RHS A;  1K8A R;  3CC2 Q;  4L5G A;  3L4G B;  2QDL A;  3VS3 A;  1GCQ A;  4OF1 A;  3HXU A;  5CKD A;  1OEB A;  1VA7 A;  4DBH A;  4E7K A;  3OYK A;  3M0R A;  4YCV A;  5FRN A;  2YLB A;  1I5O B;  1M1G A;  4M7D G;  3NHN A;  1AD5 A;  2K7A A;  5GAN 4;  4QQG A;  4C8Q F;  1H3Z A;  4N4I A;  1UHF A;  3JCM X;  1JJ2 A;  1SF9 A;  1UFF A;  2A37 A;  4FW1 A;  4A4E A;  2M0O A;  3KUF A;  3G6E T;  2EQJ A;  1TUD A;  3QG1 A;  1SSF A;  3OYN A;  3OYL A;  3HTZ A;  2KYM A;  2JNG A;  1K0X A;  1FWZ A;  1M1K C;  2BIV A;  2XD0 A;  1GFD A;  2AT1 B;  2B86 A;  1B70 B;  3TEH A;  4ELY C;  3N5B B;  2KVQ G;  4KT0 E;  3QYG B;  5HGQ A;  2FYK A;  3SWN C;  2LT1 A;  2VVK A;  3OYC A;  2GTO A;  4YRO A;  1BBU A;  3CMA A;  2CZ6 B;  4TWA A;  4N4G A;  2NUP B;  4PJO B;  4C0D C;  5CR2 A;  2E3H A;  3CD6 T;  3CCU A;  3JAM E;  5HK3 A;  1QVG A;  3UDC A;  3VRZ A;  1NJ2 A;  2KEA A;  2LDM A;  1AEY A;  4XEO A;  4FT2 A;  3X26 B;  2AHJ B;  4OMF B;  3JCM d;  3PGG A;  4P71 C;  1G3W A;  2JOY A;  2HDA A;  3JSC A;  4OB0 B;  4RUG A;  3M55 A;  3OW2 P;  1NYG A;  1HD3 A;  3V8K A;  4TVR A;  4JRK A;  2X9H A;  2PTK A;  12AS A;  3HSB A;  4J15 A;  4FYY B;  3VQX A;  5CK9 A;  4L87 A;  1UG1 A;  2CH4 A;  2KI7 A;  3A7U A;  2K2V A;  3CCL A;  5FU6 B;  4AT1 B;  3QJY A;  2D0N A;  3C0C A;  1YGB A;  1YHQ A;  1KC8 U;  2YHT A;  2ROL A;  2D1X A;  4RMF A;  2A0F B;  1B7Y B;  3LWH A;  1G8X A;  4O6J A;  1UTI A;  2HSP A;  3MEV A;  1S72 T;  1OYX A;  2AKL A;  5HK0 A;  1YJ9 A;  2A8E A;  3GOX A;  4J9C A;  2CP6 A;  1R0B G;  1IRX A;  1M8M A;  3SFM A;  3PMI A;  3TCJ A;  3CCM Q;  3RKW A;  1KQS A;  5GAO m;  3ERR A;  1YJW T;  3G4S T;  1Y7X A;  2HBP A;  1RAH B;  2RHX A;  1NJI U;  4KH1 B;  2EGE A;  1GCQ C;  2AZV A;  2ROT A;  3LSS A;  1H4T A;  2HAX A;  1WI7 A;  1G5V A;  2RHU A;  4HT9 A;  1EX4 A;  1W2B S;  3ER0 A;  1KC8 R;  3P8B B;  1U1T A;  3CPW S;  1ABO A;  2KXC A;  1YCS B;  2FL7 A;  2K79 A;  3CC4 A;  2KQW A;  2K3X A;  1VQ5 A;  3OBW A;  3GNF B;  3QII A;  1KD1 U;  1TS9 A;  2QEX Q;  5KYW B;  3BFM A;  1WXB A;  3GP8 A;  1VQO T;  1WYX A;  1QMC A;  3QBY A;  1VQ9 Q;  1H4Q A;  4BE2 A;  4KGX B;  4HCC A;  3A31 A;  2LMJ A;  1K1Z A;  1QKX A;  1UEB A;  3FRN A;  1YIT Q;  2V8I A;  2A08 A;  3M59 A;  2YRV A;  2F2X A;  11AS A;  3CME A;  3RNJ A;  4YRN A;  3LYI A;  4H2W A;  2CSQ A;  4WI1 A;  4QT7 A;  4FM4 B;  4JLG A;  1NJI R;  3RMS A;  4H2S A;  1PRL C;  3UH0 A;  2ALY A;  2JMA A;  5AT1 B;  5I2M A;  1VQ7 Q;  1AWJ A;  2OTL A;  1MHN A;  1I8F A;  2HQH A;  4H2U A;  3D7S B;  1VQM Q;  4DBR A;  3G6E Q;  2DYI A;  4XU1 A;  2LNH B;  1D0X A;  1PYS A;  2DM1 A;  2XTI A;  1BB9 A;  4JLI A;  1PD1 A;  1NYR A;  4M77 A;  3OSS C;  2XDP A;  3M53 A;  3C95 A;  1KD1 R;  3TRE A;  3UT1 A;  1XTD A;  1NLP C;  2WSF E;  2QA4 A;  2LJ1 A;  1GFC A;  1JQQ A;  3JCM c;  1PC0 A;  3L2U A;  3MP8 A;  2Q5I A;  1SEM A;  1ACM B;  2CSI A;  2E41 A;  3RGL A;  1ZSZ A;  3M57 A;  2G4C A;  2KRN A;  3A5Y A;  3P8V A;  4TVA A;  1WZO A;  2D9T A;  3TU4 K;  2KK4 A;  2HZY A;  4E7S A;  1FYN A;  1YN8 A;  3REA B;  1J5W A;  2RPN A;  1KMM A;  2EFI A;  1TH7 A;  1P92 A;  2VXE A;  4HCZ A;  2ZAE A;  5D7U A;  2RJF A;  2EIF A;  2DIG A;  3OMG A;  4M77 E;  2FEI A;  3OYY A;  1RAF B;  2FO0 A;  1ZA2 B;  4BY6 B;  4C5E A;  1YIJ Q;  4YRC A;  4RQF A;  1VQK A;  3QXE B;  1UJ0 A;  3PFS A;  4C0Z A;  4P3P A;  3BY7 A;  3MKD A;  3REX A;  4BI4 A;  2NUT A;  4EO4 A;  5L23 A;  1VQ4 Q;  2DD5 A;  2QG9 B;  2RQV A;  2XKO C;  5IT9 E;  2C06 A;  3M5A A;  4CS4 A;  4HWT A;  4LNS A;  1NM7 A;  3QDF A;  1USY C;  2O9S A;  3I7F A;  4A4G A;  2RHY A;  3TEE A;  2VGN A;  3CCJ A;  2OTJ A;  4RTU A;  2RQU A;  2L3S A;  2RI3 A;  2RN8 A;  2V8J A;  3A7R A;  1S72 Q;  3M58 A;  5IHI A;  1GRI A;  2Z0W A;  1Z7N A;  3EG9 A;  3OYF A;  4ZN1 A;  1Z9Z A;  3LLR A;  2XDB A;  3Q1J A;  3L2W A;  4YRT A;  2L0A A;  4KRT A;  4M75 A;  5ELN A;  1A0N B;  3KBG A;  4LD6 A;  2LQ8 A;  3CCQ T;  3HXY A;  1SER A;  3G7Z A;  4LD9 K;  2DE0 X;  3JB9 H;  2P4R A;  4HCB A;  1MMG A;  1YJW Q;  4H2Y A;  4DBQ A;  1NNH A;  2EYX A;  2CZ0 B;  3NGP A;  1QVP A;  4FCY A;  1X2Q A;  2QXF A;  4OMO A;  2CIM A;  1QF6 A;  4JJD A;  1WJR A;  1IL2 A;  3FEO A;  3NEL A;  1WHJ A;  4IIM A;  3HPW A;  2RA2 A;  1HYO A;  3A5Z A;  2D0Q B;  3QO5 A;  3VQW A;  2BTT A;  4RDX A;  1H92 A;  3CCV A;  3M0S A;  1QLY A;  4M75 E;  5FU7 B;  4OB2 B;  4AFZ C;  2HMA A;  1YJN T;  2EJF A;  4M77 C;  4M4Z A;  4TTV A;  3QZ5 B;  2BUD A;  4HVC A;  1RUW A;  1VQ6 T;  2RMO A;  1OUL A;  5CAI A;  2K5F A;  3GF5 A;  1Y07 A;  4RTW A;  3AT1 B;  2JVV A;  4CC7 A;  5GAO l;  1M90 U;  2LCL A;  3CCE T;  4PLI A;  4C5H A;  2QGG A;  2KMT A;  5GAM h;  4LDV A;  4ORZ A;  1UGV A;  3WQZ A;  4YRP A;  2EKO A;  1YI2 A;  2VUB A;  5GAN 8;  2YT6 A;  5C52 B;  5LJ5 g;  4JS5 A;  1HXD A;  1RAC B;  3NEM A;  2EPD A;  1TUG B;  5GAN 2;  2E10 A;  2M02 A;  3MEY A;  2D8J A;  1AOJ A;  1AHJ B;  3EG0 A;  4LXC A;  2E12 A;  3A8O B;  1BBZ A;  2ZZG A;  3PVQ A;  1M9S A;  3S3M A;  3CC2 A;  4J8O A;  2DLP A;  4IUT A;  1JRI A;  2M9U A;  3PIP A;  1SG5 A;  2QA4 Q;  4IUP A;  4C8Q A;  2ZTG A;  2PVO B;  3HXV A;  2RK2 A;  1PSF A;  5CQY A;  2LCC A;  1E1O A;  4BWA A;  1X2H A;  2DEQ A;  4K87 A;  2PVG B;  4OVA A;  2J6K A;  3JCM J;  2F5K A;  1X2K A;  3PT9 A;  1ZX6 A;  3C12 A;  2JZ2 A;  1LJO A;  1U5S A;  4LVJ A;  1QVG P;  2F5T X;  4XU2 A;  2GQV A;  3V7S A;  1SHG A;  4PNO A;  1JU5 C;  2RQW A;  2CJA A;  2W0Z A;  3KXT A;  3G71 T;  2K2M A;  1NYF A;  1UGP B;  4BE1 A;  4YYE A;  5DLO A;  4KUL A;  4PJO D;  5LJ5 e;  1K73 U;  5IN1 A;  7AT1 B;  4F7U G;  1OV3 A;  2QGF B;  4X34 A;  1EVL A;  4BAC A;  3A74 A;  5CQX A;  4M77 G;  1K4U S;  1OI1 A;  4HCK A;  1EIF A;  2DU7 A;  3HFZ B;  3JCM W;  3HRU A;  3A32 A;  2EGC A;  3WVD B;  1QWE A;  4OGE A;  1VIF A;  2ZT5 A;  5FW9 A;  2WSC E;  2DJQ A;  4LDU A;  1IGQ A;  2KYB A;  3CCJ Q;  4R0K A;  1TXQ A;  4A63 B;  3P8T A;  1YFT A;  1UB4 A;  2GGR A;  4XTX A;  1N8R C;  2ODR C;  1PWT A;  2DL5 A;  2Y4X A;  1M1K U;  1ZUK A;  2EYZ A;  4UC4 A;  1ABQ A;  1ZUU A;  4J7F A;  1Q95 G;  4C92 F;  2O2O A;  3KFV A;  4KGV B;  1W70 A;  3GPL A;  2AKK A;  1M90 C;  3CCS T;  3REB B;  3G1J A;  2RB6 A;  4BUG A;  3MO8 A;  1KQS P;  5GMK l;  4A54 A;  5C53 B;  1LVK A;  4RCB A;  4IKF A;  1KHC A;  3OW2 S;  4DPG A;  1X6B A;  2XID A;  1MMD A;  4P5N A;  3RF1 A;  3IG2 A;  3FC3 A;  3PMT A;  5GAO r;  1QQJ A;  2EVR A;  5HY6 A;  3NET A;  1ZBX A;  3VS6 A;  2VV5 A;  1VQ8 T;  5GMK e;  4RMO A;  4YRI A;  2B8A A;  3CCM A;  3VQY A;  2HCK A;  3EG3 A;  4YRE A;  1BIB A;  3VJP A;  3JRZ A;  4M7A B;  5LJ5 j;  4FYW B;  2HQX A;  8ATC B;  1VQN T;  1E6H A;  2X35 A;  1WU7 A;  4EMH A;  1VQ6 Q;  3TSW A;  2QTV A;  2DVJ A;  1M8V A;  1BYM A;  1M1K R;  2YDL A;  3U23 A;  4JJN K;  1CKA A;  3VS5 A;  1KHI A;  1NLO C;  5LJ5 f;  3CCR T;  5GJW B;  4C8Q C;  3VS7 A;  4E6R A;  2O4X A;  2RHI A;  1ZHI A;  2C0I A;  2EYW A;  3I56 T;  3EGD B;  3I5S A;  5J26 A;  3QWY A;  2RM4 A;  3RES A;  2CJB A;  4RCC A;  1Q86 C;  2DPP B;  1PNJ A;  2JMC A;  3OQ5 A;  4C92 B;  1RLP C;  3M0P A;  2QEX A;  1RAD B;  1VQ9 A;  2QK0 A;  2ESW A;  4PJO F;  1WXT A;  1JO8 A;  4M78 B;  1YIT A;  2MPX C;  4UP8 A;  2X51 A;  1JJC B;  4AFS C;  2AMC A;  2ZGW A;  5LJ3 d;  3L2R A;  5LL6 S;  1K73 C;  3H0H A;  3OYJ A;  3TQ7 P;  2QQB A;  1VIE A;  4FSX A;  3FIF A;  3M0Q A;  4OP0 A;  2VXF A;  1VQ7 A;  1X69 A;  3HXW A;  2LVM A;  5C6S A;  5FWB A;  1UGR B;  2RJC A;  1VQM A;  1U06 A;  1LPL A;  3VUZ A;  4A4H A;  3G6E A;  5GMK j;  3QZ9 B;  4FT4 A;  5DM7 R;  2DD4 A;  3UFG A;  2DDZ A;  4RTY A;  4R55 A;  5FWC A;  4QW2 A;  1B7T A;  1VQP T;  2RI5 A;  1JB0 E;  2E3C A;  1MND A;  3A5Z B;  3OYG A;  1WNL A;  1N9R A;  4AG2 C;  3CC7 T;  2LT4 A;  3VV0 A;  2BZY A;  4OML A;  2ZZE A;  4ZGD B;  5GAN 6;  1IXD A;  3RKX A;  5IXB A;  3H9N A;  1N27 A;  5CCA A;  3UAT A;  2O9V A;  1X54 A;  5ECA A;  4E7I A;  3TSZ A;  2G3R A;  2CH4 W;  5LJ3 h;  4MZP A;  1AWO A;  3NMZ C;  4BDZ A;  1X27 A;  4M7D B;  2QQA A;  1VUB A;  2KRM A;  1X2G A;  2CS7 A;  1C6V X;  1YIJ A;  4G84 A;  1I81 A;  1X56 A;  4QVZ A;  4YRQ A;  2VC8 A;  3EGX B;  2DIQ A;  4J83 A;  2MIO A;  1QE0 A;  4C8Q G;  1YBY A;  3OYH A;  4J6X A;  5E3I A;  1UUE A;  4XTW A;  1FMK A;  2DTO A;  3TVT A;  4YDQ A;  1B76 A;  2CUD A;  2CP7 A;  1SPK A;  1VQ4 A;  2D8H A;  3VS0 A;  4MDX A;  3CMA T;  1BI2 A;  4P74 C;  4CH4 A;  1M1F A;  3X28 B;  1ASZ A;  4Q5W A;  2LX7 A;  1RI9 A;  5CVI A;  3CCU T;  1WFW A;  3MQZ A;  1J3T A;  4ESR A;  1WLE A;  5HCK A;  3QPH A;  1D3B A;  2KXD A;  3MF2 A;  2KGT A;  2XDD A;  2E6N A;  3H41 A;  2DBK A;  5EG2 A;  1IO6 A;  1E1T A;  1GL5 A;  4GBQ A;  2RD1 A;  4LVK A;  4DBF A;  4YRJ A;  1S72 A;  4E7H A;  4JRQ A;  1Q81 C;  4EIK A;  3JCM V;  1VQ8 Q;  1M2V A;  2K6D A;  3HFN A;  3ZFJ A;  3VUB A;  3VU3 C;  2L3Q A;  3HY1 A;  4UPA A;  2PZ1 A;  2R5A A;  1YJW A;  1PD0 A;  2FZK B;  2DA9 A;  2DRK A;  2BE9 B;  4JZ4 A;  1K9A A;  4CH5 A;  1BCO A;  3JCM Q;  3CCL T;  3CXC S;  4PFO A;  3HXX A;  2O88 A;  1KJW A;  3JCM h;  3QWX X;  3EFO A;  2X3W D;  1B34 B;  5GAO n;  1NE8 A;  5DY9 A;  3QO3 A;  4AMC A;  4J9B A;  4QQ6 A;  2JJ9 A;  1HK9 A;  1YJ9 T;  2VAS A;  1USY A;  3I55 Q;  2F69 A;  1E22 A;  2AKW A;  1H4S A;  3E9G A;  1O75 A;  5KYY A;  4HWR A;  3VQV A;  3HRT A;  3OYM A;  1QVF A;  4P3O A;  1UHC A;  1SES A;  3RBB B;  2IVW A;  5FRO A;  3QNE A;  1QCO A;  5DLQ E;  2YUP A;  4KGZ B;  3OYA A;  1VYT A;  2DVE A;  4DEY A;  3BJU A;  2EJ9 A;  4ZIB A;  2EQU A;  3ULR B;  2Y4Y A;  5KYU A;  2FZG B;  3VYH B;  1NPP A;  2K5L A;  5KE2 A;  4FIB A;  3CC4 T;  3CBM A;  1VQ5 T;  5FLX E;  4PG3 A;  5GAN 5;  1VQZ A;  3ZBD A;  2XGT A;  3SWN B;  1Y96 A;  3LX7 A;  2VYT A;  4Z89 A;  1EIY B;  4J9D A;  3PIO A;  4F7U A;  2Q5H A;  4C0D B;  1D09 B;  5FU7 C;  4ZN3 A;  2LC4 A;  3JB9 J;  1M27 C;  4Q6G A;  2QAS A;  2PUK B;  2A7Y A;  3JB9 I;  1G3T A;  5GAM e;  5A0D A;  3OYD A;  1T0H A;  5KYN A;  2OTL T;  1RAA B;  1JJ2 S;  4EMK A;  4ATO A;  4DQ2 A;  1EVK A;  3V8J A;  2WAC A;  2X3X D;  4JDS A;  2O01 E;  4P75 A;  2KDS A;  1G83 A;  1L0W A;  4HVW A;  1SHF A;  2ART A;  2D6F A;  4IUU A;  3CD6 Q;  2COW A;  4F7U E;  4NL3 A;  1EZZ B;  3VS4 A;  3M4Q A;  2IY5 B;  3OS5 A;  2COY A;  3UA6 A;  1LYL A;  4YRG A;  3MF1 A;  3X24 B;  1OX9 A;  2KBT A;  4LNP A;  2LJ0 A;  2A36 A;  4RQE A;  2FRW A;  4EMG A;  2BZ8 A;  3I5R A;  5KYX A;  1TU0 B;  1UGS B;  4KBM B;  2C8M A;  4E2F B;  3LH5 A;  4H2V A;  4ME7 A;  4E47 A;  2ZIN A;  2CDT A;  2ZIO A;  5K1X A;  5GMK m;  1QVG S;  2ARS A;  3UGT A;  2HBW A;  3HRI A;  2QYZ A;  2DK3 A;  2E5Q A;  2LQK A;  1NJ1 A; 
#chains in the Genus database with same CATH homology
 1VQK T;  3C4S A;  1VQL T;  2M16 A;  3PCO B;  2RHQ A;  2RHS B;  2DKG A;  4JRI A;  4XU0 A;  1Q7Y C;  4E51 A;  2RH2 A;  1RIQ A;  2KY9 A;  5GAM j;  2RJD A;  4RG2 A;  3L2V A;  2JN0 A;  4DA4 A;  2Q7E A;  2PU9 B;  5GAN g;  1ASY A;  4YRS A;  3MEW A;  2OTJ T;  1XQH A;  1ATI A;  3QTC A;  2XU8 A;  4OB3 B;  2MMP A;  4CH6 A;  4HWP A;  3TEH B;  4H2X A;  1FXX A;  3NTH A;  3L4G A;  1WQW A;  4PHC A;  4IUQ A;  4M7A D;  2ZT7 A;  1KQS S;  3HY0 A;  4RKU E;  3R07 A;  3CBP A;  2WSE E;  1VQ6 A;  1N8R U;  2E70 A;  1OZ3 A;  3RER A;  4II1 A;  2RO0 A;  4BDY A;  1B70 A;  3MET A;  4EMK C;  3CCV T;  4O5V A;  4HWS A;  4YPF A;  4C92 D;  4P75 C;  3TEG A;  5K1P A;  1EQR A;  4B9W A;  4KR3 A;  2DJZ A;  3OYB A;  2H3J A;  4PJO A;  4M78 D;  1GXI E;  5GAN e;  3JB9 D;  5ELO A;  3SDZ A;  3J80 E;  5D6Y A;  2BKD N;  3LH0 A;  4HT8 A;  3LGL A;  4M75 D;  4UP9 A;  1G3Y A;  1EOV A;  1I4K 1;  2I4N A;  1YI2 T;  1ZQ1 A;  2V8K A;  4PJO E;  4XTU A;  3M4G A;  4DOV A;  2MWP A;  2YLC A;  3GNG A;  1Q86 U;  4CRI A;  3LGF A;  4YCW A;  5KH6 A;  1E24 A;  3HXZ A;  4M77 F;  1QP2 A;  2L89 A;  2P0L A;  3HL8 A;  1V29 B;  4TVY A;  4Y91 A;  4KUD K;  1B7Y A;  2PME A;  5KNN A;  2RHZ A;  1U8R A;  2E1H A;  3HHT B;  2GF7 A;  1KOG A;  4DOW A;  3LSQ A;  1C0A A;  3L2Z A;  2DXB A;  3P8H A;  2E6Z A;  4TVW A;  4KUI A;  4C8Q E;  2QI2 A;  3OS1 A;  3J7A F;  4UP7 A;  4JRP A;  4M7D D;  3O8V A;  2GCX A;  3NTI A;  2MAM A;  5FRM A;  3A7A A;  4M7A F;  4NOY A;  5GAN j;  5M9O A;  1BIA A;  3HKS A;  1NYQ A;  4FU6 A;  2K57 A;  4BE0 A;  5GAN f;  4IUV A;  4XK8 E;  2ALY B;  3X25 B;  2ZPE B;  3S6W A;  4J6W A;  1XOV A;  1BBW A;  4C0G A;  1PYS B;  4F7U B;  1Q82 C;  4M77 B;  4HWO A;  4J6Y A;  5I21 A;  4M78 F;  2I4O A;  3JB9 F;  2ZZD A;  4PJO C;  4FL6 A;  3UPU A;  1VQ8 A;  4TVA B;  4CS3 A;  3V8L A;  4M75 F;  5A0L A;  3S3O A;  2VGM A;  1KG1 A;  2P5I A;  4CI0 C;  3RAC A;  2X4X A;  3VKI A;  4YRK A;  4GY5 A;  4P74 A;  2ZPG B;  4CH3 A;  3FDR A;  2RJE A;  3RL6 A;  3I55 A;  4ELZ C;  2ZIM A;  2P4T A;  5CKH A;  2ZPB B;  1X75 C;  1W2B A;  1X55 A;  1RI0 A;  3URG A;  2XG8 D;  3CPW A;  5FU6 C;  5LJ5 d;  4XAX B;  2QDY B;  3CEY A;  2PQW A;  3RIR A;  1Q81 U;  4HT4 A;  4M7D F;  2I2L A;  3QO7 A;  3X20 B;  3FJP A;  2KSS A;  3JCM e;  2RI2 A;  1NPR A;  3GIB A;  2C7I A;  1IZ6 A;  1Y71 A;  4EDU A;  3NFC A;  1K9M C;  4QQD A;  2EJG A;  4M75 B;  3IKM B;  1M4Z A;  3C94 A;  4ZTF A;  4LVI A;  2QEX T;  4A4K A;  3FLG A;  2ZNI A;  1QP3 A;  3H6Z A;  1VQP A;  2EYQ A;  4P73 A;  1WJS A;  4QVD A;  4HA8 A;  2M1H A;  1FX7 A;  5LJ5 h;  3P8D A;  2CZ1 B;  1VQ7 T;  4PJO G;  1W4S A;  2LRQ A;  2CGH A;  1VQM T;  4G85 A;  2E65 A;  2EQK A;  2HNI A;  2QQS A;  3E1S A;  3M4P A;  4WJ4 A;  3CD6 A;  3UGQ A;  1B8A A;  2DAQ A;  1RL2 A;  3V7C A;  1BI3 A;  4PL6 A;  3NEN A;  3HP9 A;  1WYD A;  2IG0 A;  5AYF A;  3CMQ A;  4E7J A;  4Q15 A;  1SRY A;  2MI6 A;  3OYI A;  2CZ7 B;  3QDR B;  3JCM f;  1FYF A;  2ZZF A;  3DB4 A;  3NTK A;  1N6A A;  1N9S A;  1YIJ T;  2L3R A;  2XIC A;  2DTH A;  3UWN A;  2EL9 A;  5D6X A;  1N9W A;  5GMK h;  3REU A;  2ZT6 A;  5F5W A;  2DXT A;  2GFU A;  1K8A C;  4C8Q B;  4XTY A;  1VQ4 T;  4ZGJ B;  4MMK A;  2XI9 A;  3PTA A;  4BY6 C;  2DTI A;  3OS2 A;  1YFR A;  2P0K A;  3G4S A;  3KFU A;  2QHV A;  1YHQ T;  2MWO A;  4MML A;  2HQE A;  3A8H B;  4OGC A;  4X9C A;  1Z7M A;  3IAL A;  2J3L A;  3SB2 A;  3OMC A;  5A2Q E;  2I4L A;  1WJQ A;  4P73 C;  5GAM g;  2QTX A;  5A0G A;  2PVD B;  1VQO A;  1Q7Y U;  4ZTU B;  4YRF A;  1HTT A;  4ZGE B;  3MEA A;  4BI3 A;  1KMN A;  4YP0 A;  3QO8 A;  3PNW C;  1BI0 A;  1WQ7 A;  3ASK A;  3A8L B;  4N4H A;  3DB3 A;  4WF2 A;  3EAE A;  1G51 A;  4LVM A;  4C0F A;  3GLX A;  3IKL A;  2ZNJ A;  4Y28 E;  2DQ0 A;  2JTM A;  1I5L A;  4XTV A;  4X9D A;  3HFZ A;  4VUB A;  3RMQ A;  1XNI A;  1YCY A;  2E64 A;  1EFW A;  3L2Q A;  4PLL A;  2QHU A;  4AH6 A;  3CME T;  5CKF A;  4EPC A;  2XK0 A;  3LW5 E;  2DZC A;  4P72 A;  1YB3 A;  3OYE A;  4QVC A;  4R56 A;  5C0M A;  4JUV A;  4LDY A;  3T9N A;  3AHU A;  3HFO A;  2O4X B;  5KE3 A;  2QQ9 A;  5GMK i;  1M5Q 1;  5D6W A;  2QA4 T;  3R6O A;  3M9Q A;  4HKE A;  2FVU A;  1KQ1 A;  2JTF A;  1X6O A;  3OSV A;  3VYG A;  1KC8 C;  3EFS A;  1MGQ A;  5KCO A;  4J7I A;  4M7A A;  3E9I A;  1ADY A;  4J5Y A;  1VQL A;  4XTZ A;  2AMC B;  2KAF A;  3A8M B;  3CBO A;  3HRS A;  5GAO p;  4C5I A;  2NLU A;  1NJI C;  4C92 A;  3CCQ A;  4M7A E;  5GAN 3;  2HD0 A;  3P8Y A;  4M77 D;  2R58 A;  2CYZ B;  2I4M A;  4NS5 A;  4N0A A;  4M78 A;  1JBM A;  4D6W A;  2QQR A;  2DU5 A;  3JCM P;  5GAM f;  3CCJ T;  1JJC A;  3OW2 A;  2LTO A;  1KD1 C;  2DXU A;  3BDU A;  3G1Z A;  4YRL A;  4K88 A;  3OY9 A;  3L1A A;  5CIU A;  4A4F A;  2FHD A;  4C92 E;  5GAM d;  1YJN A;  4KQE A;  2LNV A;  1G5I A;  3F70 A;  3INZ A;  4M78 E;  4V2S A;  4ZTZ B;  1UGQ B;  2EQM A;  4LVL A;  3CCE A;  1Q82 U;  2R5M A;  5CO7 A;  4MZT A;  4P72 C;  2XHC A;  1WPY A;  1G3S A;  3H8Z A;  2EWN A;  3WXM B;  1NJ5 A;  3OD1 A;  2P0P A;  4PKC C;  4M7D A;  2E5A A;  1QVF S;  1D3B B;  4XQ3 A;  1NJ6 A;  2CJ9 A;  4JS4 A;  3OS0 A;  2RK1 A;  1R8O B;  3EFR A;  1ADJ A;  4M7A C;  2Q7H A;  4LDW A;  1BKB A;  4CS2 A;  2ZPI B;  3DKM A;  1U1S A;  4M7D E;  3OBY A;  3A8G B;  5CKE A;  2DQ3 A;  3OA6 A;  5C51 B;  5J3B A;  4F7U F;  1WGS A;  4P3N A;  3JCM b;  3QUI A;  4ZTJ A;  4XU3 A;  4KR2 A;  4OLF A;  2L8D A;  5LJ3 g;  1X01 A;  4C92 C;  5KCH A;  1LOJ A;  2J3M A;  3CC2 T;  3G71 A;  1H64 1;  2MF2 A;  2ZPH B;  3MHX A;  2ZR3 A;  2JUF A;  2AKW B;  3HRK A;  4H2T A;  2ODR D;  1OZ2 A;  3LWI A;  4N0A C;  1IRE B;  2A3L A;  4M78 C;  3MP6 A;  3E9H A;  2QHT A;  2Q7G A;  4LDX A;  4YRM A;  1K9M U;  4NCX A;  3FB9 A;  3QYH B;  1BI1 A;  2ARU A;  4X5O A;  4O2D A;  3PZC A;  4M75 C;  1B34 A;  4BB7 A;  3VBB A;  4YTL A;  5I2S A;  3L42 A;  4GLK A;  1PSE A;  4WJ3 M;  2ZR2 A;  3ME9 A;  1H4V B;  4E7L A;  4OB1 B;  3ZEH A;  2CKK A;  2OAU A;  2FB7 A;  3E9F A;  4NL2 A;  1Y96 B;  2LX9 A;  3CCS A;  1SET A;  5GAN d;  5GAN 7;  1LNX A;  5LJ3 e;  3MP1 A;  3QHS A;  4C8Q D;  3TUP A;  5HKC A;  2L5Q A;  4TQD A;  2ZT8 A;  3BDL A;  4TQF A;  4C5G A;  4M7A G;  3JCM g;  4A53 A;  1NJ8 A;  4M7D C;  2QHS A;  4B9X A;  4EMK B;  2P0Q A;  2DZ9 A;  4XEM A;  3QKJ A;  5J39 A;  1VQN A;  3HFV A;  3SWN A;  4MZM A;  1DJ7 B;  2K5I A;  2EAY A;  1EIY A;  3RUX A;  3QJ6 A;  3CXC A;  2R57 A;  4RG8 A;  3DLM A;  3CCR A;  2ZCF B;  1QW1 A;  3MEU A;  3M54 A;  3I56 A;  3MCA B;  4C92 G;  4BD3 A;  5GAN h;  4MDW A;  5L8R E;  3DLL A;  3W3S A;  3OB9 A;  2PMF A;  2X4J A;  3LC0 A;  4L59 A;  2K3Y A;  4M78 G;  3M56 A;  3CPF A;  3CCM T;  4P71 A;  4BW9 A;  2X4W A;  3JB9 G;  3DSQ A;  3M4Y A;  1NZ9 A;  3E19 A;  3S3N A;  1K8A U;  3QSU A;  1G5H A;  2DO3 A;  1W66 A;  2X4Y A;  4BI8 B;  2ZPF B;  2IY5 A;  4EX5 A;  1GGM A;  1KQ2 A;  4M75 G;  2RHQ B;  3RKY A;  5LJ3 j;  3I55 T;  3BW1 A;  3SD4 A;  5CKB A;  5GAO q;  4IUR A;  3J81 E;  2NS6 A;  2Y90 A;  4Z02 A;  2ZXF A;  3ICA A;  5LJ3 f;  3V7R A;  2K4Y A;  1YFS A;  1VQ9 T;  1HC7 A;  5IAY A;  2GFA A;  4YRR A;  4H02 A;  4YCU A;  3WVE B;  1YIT T;  2DXC A;  4L6V 5;  2PUO B;  2ZCE A;  4K86 A;  3CC7 A;  3PCO A;  1O9S A;  4H2X B;  2RHS A;  4L5G A;  3L4G B;  4OF1 A;  3HXU A;  5CKD A;  4E7K A;  3OYK A;  4YCV A;  5FRN A;  2YLB A;  1M1G A;  4M7D G;  1H3Z A;  5GAN 4;  4QQG A;  4C8Q F;  4N4I A;  3JCM X;  1JJ2 A;  4A4E A;  2M0O A;  3KUF A;  3G6E T;  2EQJ A;  3QG1 A;  1SSF A;  3OYN A;  3OYL A;  3HTZ A;  2JNG A;  1FWZ A;  1M1K C;  2BIV A;  2XD0 A;  1B70 B;  3TEH A;  4ELY C;  3N5B B;  2KVQ G;  4KT0 E;  3QYG B;  5HGQ A;  2FYK A;  3SWN C;  2LT1 A;  3OYC A;  4YRO A;  1BBU A;  3CMA A;  2CZ6 B;  4TWA A;  4N4G A;  4PJO B;  4C0D C;  5CR2 A;  3CD6 T;  3CCU A;  3JAM E;  5HK3 A;  1QVG A;  3UDC A;  1NJ2 A;  2LDM A;  4XEO A;  4FT2 A;  3X26 B;  2AHJ B;  4OMF B;  3JCM d;  3PGG A;  4P71 C;  1G3W A;  2JOY A;  3JSC A;  4OB0 B;  3M55 A;  3V8K A;  4TVR A;  4JRK A;  12AS A;  3HSB A;  4J15 A;  3VQX A;  5CK9 A;  4L87 A;  3A7U A;  2K2V A;  3CCL A;  5FU6 B;  3QJY A;  1YGB A;  1YHQ A;  1KC8 U;  2YHT A;  4RMF A;  1B7Y B;  3LWH A;  4O6J A;  3MEV A;  1S72 T;  1OYX A;  5HK0 A;  1YJ9 A;  2A8E A;  3GOX A;  3SFM A;  3PMI A;  3TCJ A;  3RKW A;  1KQS A;  5GAO m;  3ERR A;  1YJW T;  3G4S T;  1Y7X A;  2HBP A;  2RHX A;  1NJI U;  3LSS A;  1H4T A;  2HAX A;  1G5V A;  2RHU A;  4HT9 A;  1W2B S;  3ER0 A;  3P8B B;  1U1T A;  3CPW S;  2FL7 A;  3CC4 A;  2KQW A;  2K3X A;  1VQ5 A;  3OBW A;  3GNF B;  3QII A;  1KD1 U;  3BFM A;  3GP8 A;  1VQO T;  3QBY A;  1H4Q A;  4BE2 A;  4HCC A;  3A31 A;  1UEB A;  3FRN A;  2V8I A;  3M59 A;  2YRV A;  11AS A;  3CME A;  4YRN A;  3LYI A;  4H2W A;  4WI1 A;  4FM4 B;  4JLG A;  3RMS A;  4H2S A;  3UH0 A;  2ALY A;  5I2M A;  2OTL A;  1MHN A;  1I8F A;  4H2U A;  4XU1 A;  1PYS A;  2XTI A;  4JLI A;  1NYR A;  4M77 A;  3OSS C;  2XDP A;  3M53 A;  3C95 A;  3TRE A;  3UT1 A;  1XTD A;  2WSF E;  2QA4 A;  3JCM c;  3L2U A;  3MP8 A;  2Q5I A;  2E41 A;  3RGL A;  2G4C A;  3M57 A;  3A5Y A;  3P8V A;  4TVA A;  2D9T A;  3TU4 K;  2KK4 A;  1J5W A;  1KMM A;  2EFI A;  1TH7 A;  1P92 A;  2VXE A;  4HCZ A;  2RJF A;  2EIF A;  2DIG A;  3OMG A;  4M77 E;  3OYY A;  4C5E A;  4BY6 B;  4YRC A;  4RQF A;  1VQK A;  3QXE B;  3PFS A;  4C0Z A;  4P3P A;  3BY7 A;  3REX A;  4BI4 A;  4EO4 A;  2DD5 A;  2XKO C;  5IT9 E;  2C06 A;  3M5A A;  4CS4 A;  4HWT A;  4LNS A;  1USY C;  3I7F A;  4A4G A;  2RHY A;  3TEE A;  2VGN A;  3CCJ A;  2OTJ A;  2RI3 A;  2V8J A;  3A7R A;  3M58 A;  1Z7N A;  3OYF A;  4ZN1 A;  3LLR A;  2XDB A;  3Q1J A;  3L2W A;  4YRT A;  5ELN A;  4M75 A;  3KBG A;  4LD6 A;  2LQ8 A;  3CCQ T;  3HXY A;  1SER A;  3G7Z A;  4LD9 K;  3JB9 H;  4HCB A;  4H2Y A;  1NNH A;  2CZ0 B;  1QVP A;  2QXF A;  2CIM A;  1QF6 A;  1WJR A;  1IL2 A;  3FEO A;  3NEL A;  3HPW A;  2RA2 A;  3A5Z A;  2D0Q B;  3QO5 A;  3VQW A;  4RDX A;  3CCV A;  4M75 E;  5FU7 B;  4OB2 B;  1YJN T;  2EJF A;  4M77 C;  4TTV A;  3QZ5 B;  2BUD A;  4HVC A;  1VQ6 T;  5CAI A;  2K5F A;  3GF5 A;  1Y07 A;  2JVV A;  5GAO l;  1M90 U;  2LCL A;  3CCE T;  4PLI A;  4C5H A;  2KMT A;  5GAM h;  4LDV A;  3WQZ A;  4YRP A;  2EKO A;  1YI2 A;  2VUB A;  5GAN 8;  5C52 B;  5LJ5 g;  4JS5 A;  1HXD A;  3NEM A;  5GAN 2;  2E10 A;  3MEY A;  1AHJ B;  2E12 A;  3A8O B;  2ZZG A;  1M9S A;  3S3M A;  3CC2 A;  4J8O A;  4IUT A;  1JRI A;  2M9U A;  3PIP A;  4IUP A;  4C8Q A;  2ZTG A;  2PVO B;  3HXV A;  2RK2 A;  1PSF A;  5CQY A;  2LCC A;  1E1O A;  4BWA A;  1X2H A;  2DEQ A;  4K87 A;  2PVG B;  4OVA A;  3JCM J;  2F5K A;  3PT9 A;  3C12 A;  2JZ2 A;  1LJO A;  4LVJ A;  2F5T X;  4XU2 A;  2GQV A;  3V7S A;  4PNO A;  2CJA A;  3KXT A;  3G71 T;  1UGP B;  4BE1 A;  4YYE A;  5DLO A;  4KUL A;  4PJO D;  5LJ5 e;  1K73 U;  5IN1 A;  4F7U G;  4X34 A;  1EVL A;  4BAC A;  3A74 A;  5CQX A;  4M77 G;  1OI1 A;  1EIF A;  2DU7 A;  3HFZ B;  3JCM W;  3HRU A;  3A32 A;  3WVD B;  4OGE A;  1VIF A;  2ZT5 A;  2WSC E;  4LDU A;  3P8T A;  1YFT A;  1UB4 A;  4XTX A;  1N8R C;  2ODR C;  2Y4X A;  1M1K U;  4UC4 A;  4J7F A;  4C92 F;  3GPL A;  1M90 C;  3CCS T;  2RB6 A;  4BUG A;  3MO8 A;  5GMK l;  4A54 A;  5C53 B;  4RCB A;  4IKF A;  1KHC A;  3OW2 S;  4DPG A;  2XID A;  4P5N A;  3RF1 A;  3IG2 A;  3FC3 A;  3PMT A;  5GAO r;  5HY6 A;  3NET A;  1ZBX A;  2VV5 A;  1VQ8 T;  5GMK e;  4RMO A;  4YRI A;  2B8A A;  3CCM A;  3VQY A;  4YRE A;  1BIB A;  3VJP A;  3JRZ A;  4M7A B;  5LJ5 j;  2HQX A;  1VQN T;  2X35 A;  1WU7 A;  4EMH A;  1BYM A;  1M8V A;  4JJN K;  1KHI A;  5LJ5 f;  3CCR T;  4C8Q C;  2O4X A;  2RHI A;  1ZHI A;  3I56 T;  5J26 A;  2RM4 A;  3RES A;  2CJB A;  4RCC A;  1Q86 C;  2DPP B;  3OQ5 A;  4C92 B;  2QEX A;  1VQ9 A;  4PJO F;  4M78 B;  1YIT A;  4UP8 A;  1JJC B;  2AMC A;  2ZGW A;  5LJ3 d;  3L2R A;  5LL6 S;  1K73 C;  3OYJ A;  2QQB A;  1VIE A;  4FSX A;  3FIF A;  4OP0 A;  2VXF A;  1VQ7 A;  3HXW A;  2LVM A;  5C6S A;  1UGR B;  2RJC A;  1VQM A;  3VUZ A;  4A4H A;  3G6E A;  5GMK j;  3QZ9 B;  4FT4 A;  5DM7 R;  2DD4 A;  3UFG A;  2DDZ A;  4R55 A;  4QW2 A;  1VQP T;  2RI5 A;  1JB0 E;  2E3C A;  3A5Z B;  3OYG A;  1WNL A;  1N9R A;  3CC7 T;  2LT4 A;  3VV0 A;  2ZZE A;  4ZGD B;  5GAN 6;  3RKX A;  1N27 A;  5CCA A;  1X54 A;  4E7I A;  2G3R A;  5LJ3 h;  4MZP A;  4BDZ A;  4M7D B;  2QQA A;  1VUB A;  1X2G A;  2CS7 A;  1YIJ A;  4G84 A;  1I81 A;  1X56 A;  4QVZ A;  4YRQ A;  2VC8 A;  2DIQ A;  4J83 A;  1QE0 A;  4C8Q G;  1YBY A;  3OYH A;  4J6X A;  5E3I A;  4XTW A;  2DTO A;  4YDQ A;  1B76 A;  1VQ4 A;  4MDX A;  3CMA T;  1BI2 A;  4P74 C;  4CH4 A;  1M1F A;  3X28 B;  1ASZ A;  4Q5W A;  3CCU T;  5CVI A;  3MQZ A;  1WLE A;  3QPH A;  1D3B A;  3MF2 A;  2XDD A;  2E6N A;  5EG2 A;  1E1T A;  2RD1 A;  4LVK A;  4YRJ A;  1S72 A;  4E7H A;  4JRQ A;  1Q81 C;  3JCM V;  3HFN A;  3ZFJ A;  3VUB A;  3VU3 C;  3HY1 A;  4UPA A;  2R5A A;  1YJW A;  4CH5 A;  3CCL T;  3JCM Q;  3CXC S;  3HXX A;  3JCM h;  1B34 B;  5GAO n;  1NE8 A;  5DY9 A;  3QO3 A;  1YJ9 T;  4QQ6 A;  1HK9 A;  1USY A;  2F69 A;  1E22 A;  2AKW A;  1H4S A;  3E9G A;  1O75 A;  4HWR A;  3VQV A;  3HRT A;  3OYM A;  1QVF A;  4P3O A;  1SES A;  2IVW A;  5FRO A;  3QNE A;  5DLQ E;  3OYA A;  2DVE A;  3BJU A;  2EJ9 A;  4ZIB A;  2EQU A;  2Y4Y A;  3VYH B;  1NPP A;  2K5L A;  5KE2 A;  4FIB A;  3CC4 T;  3CBM A;  1VQ5 T;  5FLX E;  4PG3 A;  5GAN 5;  1VQZ A;  3ZBD A;  2XGT A;  3SWN B;  1Y96 A;  3LX7 A;  2VYT A;  1EIY B;  3PIO A;  4F7U A;  2Q5H A;  4C0D B;  5FU7 C;  4ZN3 A;  2LC4 A;  3JB9 J;  4Q6G A;  2PUK B;  2A7Y A;  3JB9 I;  1G3T A;  5GAM e;  5A0D A;  3OYD A;  2OTL T;  1JJ2 S;  4EMK A;  4ATO A;  4DQ2 A;  1EVK A;  3V8J A;  2WAC A;  2O01 E;  4JDS A;  4P75 A;  2KDS A;  1L0W A;  2ART A;  2D6F A;  4IUU A;  4F7U E;  4NL3 A;  3M4Q A;  2IY5 B;  3OS5 A;  1LYL A;  4YRG A;  3MF1 A;  3X24 B;  4RQE A;  4EMG A;  1UGS B;  4KBM B;  2C8M A;  4H2V A;  4ME7 A;  4E47 A;  2ZIN A;  2ZIO A;  5K1X A;  5GMK m;  1QVG S;  2ARS A;  3UGT A;  3HRI A;  2DK3 A;  2E5Q A;  2LQK A;  1NJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...