4XTYA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 63 with fluorine in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 94
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtyA01
1NJ6A 4YRLA 4XTWA 4M7DF 3RERA 3MF2A 4XQ3A 3QTCA 4TWAA 1I5LA 1VQZA 2YLCA 2K57A 3HXZA 1SETA 3RGLA 1BIBA 4PNOA 4XU2A 3UGTA 3A7RA 4RQEA 4DPGA 1KMNA 3LC0A 3G1ZA 5GMKm 4YRMA 3M4GA 4MMLA 1NJ5A 3JCMV 5LJ5d 1JJCB 4M75G 4P3PA 5GANf 4XEOA 4TVWA 4M77E 3VQYA 1KQ1A 4WI1A 4YRJA 1I81A 1KMMA 1E24A 2E65A 1YFTA 4P3NA 3BFMA 4TQFA 2EJGA 3MEYA 3PGGA 4YRCA 5GANd 3IKLA 5GAMh 3M4PA 2PMFA 4M7AA 4YREA 1NYQA 3RKWA 1X2GA 5GAN2 4C92E 4QVDA 3FIFA 1HC7A 2DQ0A 1JRIA 1NJ2A 1MGQA 5GAOl 4M7AF 4HWTA 3HXYA 3PZCA 2J3LA 4YRPA 4G85A 3RUXA 3PCOA 3IG2A 4RMFA 4KR2A 2AMCB 3AHUA 5LJ5e 2Q7GA 3RIRA 4PG3A 3ERRA 3P8TA 4EMKC 4HWRA 4RQFA 4DQ2A 3RKXA 1JBMA 4M78D 4O2DA 5C53B 1H4QA 2ALYA 4H2WA 4BWAA 3JB9D 2ARTA 4F7UA 4CS3A 1ADYA 1G51A 2FB7A 3BDUA 3NEMA 2J3MA 1WPYA 4MMKA 4RDXA 4J6YA 2RD1A 4C8QE 4P75A 4P72A 5LJ3e 3JCMP 4PHCA 2RM4A 3EFSA 2ALYB 1GGMA 2DTOA 4M78A 4A53A 4F7UB 4PJOE 1YB3A 2ZINA 3P8YA 2C7IA 4M77G 4P75C 3BJUA 3L1AA 4HT9A 3LSQA 4HWSA 1HTTA 2QHTA 4M78C 4P71C 1B7YB 3REXA 4M78B 3JCMc 4YRQA 4XU0A 3WQZA 2DEQA 4M75F 4N0AC 1E1OA 3A7AA 5C51B 4K88A 1PYSA 4C92G 4YRGA 4P73A 1NJ1A 1EVKA 4L87A 1RIQA 4UP9A 4M7DA 5GAMe 1WNLA 3QUIA 4XTXA 4RCCA 4JRIA 1PYSB 2ZZGA 1USYC 4P3OA 3HSBA 4YRFA 3CMQA 2ZT7A 4P74A 4J6WA 12ASA 4YDQA 5LJ5f 1N9WA 5GAN5 4M7DB 1L0WA 2QHSA 3P8VA 5C52B 2ZGWA 1KOGA 2DDZA 4P74C 1WU7A 3IALA 4UPAA 4HVCA 1B34A 3JCMQ 4KQEA 2VC8A 3JCMd 1WQWA 2DVEA 3RACA 2DZCA 1QE0A 5E3IA 1FYFA 4BW9A 4C8QG 1X2HA 5GANj 3A5YA 3A74A 4AH6A 2Q7EA 4V2SA 4X9DA 3UGQA 2RA2A 4YCUA 1H641 4PJOG 4YRTA 5LJ3f 2E3CA 1I8FA 4E51A 4M7AD 2E64A 4XTYA 5GANg 1B76A 1SESA 4HA8A 5GANh 2E41A 4EMGA 2ODRC 5GMKi 2RHQA 1ASZA 2DXTA 2JN0A 3SWNA 5GMKj 4YYEA 3RL6A 2ZT8A 2QHVA 2DTIA 4H2UA 2CIMA 5LJ3d 3JB9G 5GAN3 4HWOA 4M77F 3MF1A 5GAN8 3SWNC 1Z7MA 4HWPA 2RHQB 5CAIA 3R07A 1H4VB 3SWNB 3NETA 5GMKh 1B8AA 1EQRA 2ZT6A 1EVLA 3HY1A 4YP0A 3HY0A 3HRIA 3JCMe 4M7AC 4QVCA 4TVYA 3L2ZA 1WLEA 1H4TA 4M7AB 5GAMf 1ATIA 4X9CA 2C8MA 2RHSA 1LJOA 4C92F 2DU5A 3NELA 3HFOA 2EWNA 5K1PA 3A32A 1W66A 1YCYA 2ZNJA 3PCOB 3VQWA 4H2YA 4H2XA 2RHSB 1Z7NA 4XTZA 3W3SA 4H2SA 4CH4A 5GAMd 4M75D 5ELNA 4EO4A 1HK9A 3QHSA 2AKWA 4Q15A 3IKMB 4NCXA 4JUVA 4RCBA 3A7UA 4F7UE 1B70A 1TH7A 2P5IA 4P72C 1EIYA 4M75A 2P0LA 4C8QF 1J5WA 2DZ9A 3VBBA 1BIAA 1X56A 4M7DD 3OD1A 4M78E 4HT8A 2I4LA 4PJOF 1M8VA 4M75C 1B70B 1SERA 4Y91A 1EIYB 4JLIA 4M75B 2CJ9A 2I4NA 1BBUA 2Q5IA 3JB9I 4OLFA 1Y96A 1NJ8A 2G4CA 4J6XA 3HXVA 4LNSA 1LOJA 3E9IA 3VQXA 3A31A 4H2TA 3JCMf 2E5AA 4P73C 2YLBA 3JB9F 3BW1A 3QO3A 2E10A 5DY9A 5LJ5j 2VXEA 3QO8A 4Q6GA 2DKGA 1E1TA 3TEHA 4YRRA 1Y96B 4M7DC 1QF6A 2ZR2A 3L4GA 1M5Q1 2ODRD 1C0AA 3HXXA 5GAN7 3E9HA 4M7DE 2XTIA 3I7FA 2ZIOA 1H4SA 2Q7HA 5LJ5g 4ZTZB 5LJ5h 4WF2A 3TEHB 3V7CA 3HTZA 2I4OA 5LJ3j 4CS4A 3QO7A 3L4GB 4M77D 4H02A 5GMKl 4CH5A 4YCWA 1B34B 4F7UG 2ARUA 3TEGA 3EFRA 5GAOn 5LJ3g 2IY5A 4TTVA 4YRSA 5LJ3h 4YCVA 2E1HA 1JJCA 2ARSA 1ADJA 5F5WA 2YHTA 4M77A 2RB6A 4M78G 4C92D 5GAN6 3HXUA 5GAN4 1YFRA 1HXDA 3JCMJ 2IY5B 3JB9H 4TVAA 3QSUA 4XU3A 3M4QA 3JCMX 4M77C 4JRKA 3HFNA 1X54A 3QO5A 4M77B 3DSQA 1WQ7A 2DXUA 1BBWA 4J15A 1G5HA 4XTVA 3QNEA 4XU1A 5GAMj 4K86A 11ASA 2DJZA 4C92A 4TVAB 4YPFA 3TUPA 4M7AE 1N9RA 2EJFA 1X55A 2EAYA 1LNXA 4YRNA 5GAMg 4C92C 2ZIMA 1WYDA 3HFVA 2ZCEA 4XEMA 2ZZFA 3HXWA 4M7DG 4X5OA 5ELOA 3LSSA 4C92B 2CJAA 4H2VA 2DTHA 4C8QD 3A5ZA 2AMCA 5GAOq 4WJ3M 1EOVA 4J5YA 2ZXFA 5GAOm 4EX5A 4WJ4A 3FB9A 2VXFA 2DU7A 4PJOD 1EFWA 4EMKA 2I2LA 1U1SA 1E22A 3HRKA 3JB9J 4K87A 3FJPA 3JCMW 1D3BA 4A54A 2CJBA 3ICAA 1X01A 3VU3C 4NOYA 2HNIA 4YRIA 3RESA 3V8JA 1YGBA 4C8QA 4H2XB 4CS2A 3V8LA 4EMKB 5GAOp 2ZZEA 4KR3A 2ZR3A 4CH6A 2FYKA 1ASYA 2AKWB 2ZT5A 2ZTGA 4G84A 4PJOA 1D3BB 4XTUA 2I4MA 4C8QC 1IL2A 3V7SA 5K1XA 1YFSA 2PMEA 4CH3A 4C8QB 3HFZA 2QHUA 4PJOC 4YRKA 4F7UF 5GANe 3UFGA 5I21A 1B7YA 4PJOB 3V7RA 4UP7A 4M75E 3BY7A 4ZIBA 4P71A 1LYLA 3RF1A 3UH0A 5KNNA 4UP8A 2XGTA 3HFZB 1U1TA 1NYRA 3VQVA 4N0AA 4EMHA 2CGHA 3KFUA 4M78F 4YROA 4NL3A 2QTXA 1G5IA 4M7AG 4NL2A 4TQDA 2ZNIA 2EL9A 5HGQA 5GMKe 3GIBA 3JCMg 1I4K1 3REUA 3JCMh 4ZTUB 3NENA 1KQ2A 2DQ3A 1NNHA 2Y90A 3RKYA 1USYA 2Q5HA 3V8KA 4OP0A 1SRYA 1N9SA 2EJ9A 5GAOr 3INZA 3JCMb 3SB2A
chains in the Genus database with same CATH superfamily
3OYCA 3QIIA 2E5KA 2JS0A 1NJ6A 2YDLA 4XTWA 1VQ7T 4M7DF 3PMTA 3RERA 3MF2A 3A1PA 3CCJA 3E9FA 2CUDA 1M1KR 2K57A 2AT1B 4R56A 1BIBA 4XU2A 3A7RA 2OTLA 4RQEA 3CPWS 3G1ZA 5I22A 1WX6A 3M4GA 1VQPA 1ZLMA 4J9GA 2XICA 1G2BA 5GANf 4P3PA 4XEOA 4TVWA 2E3IA 3QBYA 4MZPA 1KQ1A 4YRJA 1H92A 1E24A 3CCJT 4P3NA 2J6OA 4RG8A 1R0BG 2M0YA 1QKWA 3G4ST 3IKLA 4LDVA 2OTLT 1OPKA 2YUPA 4C92E 3CCLQ 1VQPT 2GCXA 1VQNQ 4OB2B 2CSIA 1MGQA 4NS5A 1RAFB 3CBOA 5GAOl 3HXYA 2J3LA 2AZSA 4LVMA 1HD3A 3PE0A 3UT1A 2Y4YA 2KGTA 2MOXA 3CCUQ 3AHUA 1EZZB 1UGRB 1X75C 2O01E 1PRMC 4J8OA 4FW1A 3TSZA 3HTRA 1FXXA 3RKXA 4O2DA 4M78D 5C53B 1EX4A 3M9QA 4H2WA 4BWAA 4CS3A 2ATCB 4MMKA 4HVWA 2CP7A 4E7LA 4P72A 4P75A 3CC7T 3EFSA 3G6ET 2A36A 5HK3A 2K7AA 2JTFA 2GF7A 1SRMA 3L2QA 1PC0A 2QHTA 3MPUB 4A4FA 1B7YB 3REXA 2LC4A 3A7AA 1E1OA 1WIEA 4LE9A 3UPUA 4IIOA 1GXIE 4K88A 4C92G 4FW2A 3IQLA 5FLXE 2IIMA 2LTOA 1KD1U 4P73A 1M90C 1EVKA 2O9VA 1NPRA 1Y71A 1RUWA 1X43A 5C6SA 4LXCA 1YHQA 5FRNA 1CKBA 1QKXA 2BTTA 2LT1A 4RCCA 3VYGA 2LX7A 2F2XA 4P3OA 3HSBA 4P74A 2ZT7A 2QDLA 2XG8D 2DRMA 2KAFA 1MMNA 2LCSA 2QHSA 3UWNA 3P8VA 5C52B 2DDZA 1BI0A 1AWXA 1C1AA 2HL5C 4E7HA 4UPAA 1B34A 3JCMQ 2KT1A 2VC8A 4EPCA 1Q86U 1SSFA 4IUUA 1OI1A 5GANj 4LDXA 2ENMA 1UEBA 2DD4A 1X69A 2GTJA 3A5YA 4V2SA 4YRTA 5LJ3f 4ZGEB 1B07A 1BI2A 3OYNA 3QDRB 2FVUA 2ZPGB 5GANg 1SESA 4AFZC 4EMGA 4DBFA 1IREB 2BZXA 2DXTA 4YYEA 5GMKj 1JO8A 2ZT8A 2XK0A 4XAXB 3DB3A 1QQJA 3QDFA 3VS2A 5GAN3 2DVJA 3MF1A 1AEYA 1Z7MA 1MNDA 1TS9A 4Z02A 4HWPA 5CAIA 3R07A 1Y7XA 3NETA 1M1FA 3ULRB 1VQ7Q 1JXOA 4YP0A 3HY0A 3JCMe 2DRKA 4M7AC 5KH6A 1UHCA 1XTDA 1YBYA 3L2ZA 4ELYC 2YRDA 5GAMf 3M0UA 1H8KA 4LUDA 2HBPA 3G71A 2C8MA 8AT1B 1VQOT 1LJOA 4C92F 1PKTA 3VJPA 5K1PA 2RHUA 1YI2T 3DKMA 5J39A 3VQWA 3ZEHA 4H2YA 1UECA 5HKCA 2RNAA 3ZFJA 5IT9E 4X1VA 4EO4A 2Y4XA 5CKFA 3FRNA 1MMAA 4FYVB 2BKDN 1WJRA 2M02A 1NLOC 3D7SB 3M55A 1KD1R 1GFDA 3CCSA 3VS4A 3MEAA 3G4SQ 2YRCA 2DZ9A 4RKUE 1KG1A 4J9EA 1BIAA 2P4TA 3FDRA 1VQPQ 2ZAEA 3OYGA 4M75C 4RTVA 2DM1A 1QCFA 3OS1A 4ZTFA 1YJ9Q 2CJ9A 1K9MC 2I4NA 1MUZA 1Y96A 1NJ8A 2M16A 1WXBA 4LNPA 4QKUA 5L8RE 1Q86R 3X28B 3JSCA 3A31A 4H2TA 2RHIA 2A7YA 4O6JA 5DY9A 5KYUB 1BKBA 1VQ8A 4KUDK 2DKGA 1I0CA 2HDAA 2FPDA 1Y96B 4M7DC 3L4GA 4B6MA 1YJWT 5GAN7 1DJ7B 2ED0A 1PG5B 1U3OA 1YP5A 3CC7Q 3G6EQ 2KEAA 5LJ3j 3L4GB 4KH1B 2HEQA 1M4ZA 5CIUA 1Q81U 3OSSC 2FRYA 1K1ZA 3QZ5B 5CK9A 4HVUA 4E47A 4E6RA 1PRLC 2VASA 2QQAA 3QJ6A 1VQKA 2FZGB 5GAOn 3S3NA 5LJ3g 3JRZA 1ZQ1A 1VQ8T 4VUBA 3MP8A 3CPFA 1ADJA 5F5WA 1E7OA 2ZPIB 3EG2A 3PFSA 4ELZC 1X6OA 2EFIA 4C92D 4N4IA 5KYXB 1BCOA 3OYKA 2EVRA 2K5FA 4AFSC 3M4QA 1VQLA 2EGEA 3VV0A 4ANJA 1K73C 2DXUA 1CSKA 4J9CA 3OSVA 3QNEA 5GAMj 1K8AC 1YCSB 4DEYA 2DK3A 1PD0A 1Z9ZA 3GF5A 3QJYA 3EGXA 1VQKT 3TUPA 4M7AE 1VOMA 4OF1A 3ZBDA 3UA7A 2VB6A 2JNGA 5GAMg 3OS0A 4KH0B 1ACMB 3JV3A 1TWBA 4XEMA 3C94A 4TVRA 2R57A 3LSSA 1VQ9A 3OBWA 4IKFA 3LLRA 4H2VA 2R5MA 5GAOq 4LDWA 4WJ3M 2E70A 3EGXB 4J5YA 2EYYA 4GLMA 5GAOm 4WJ4A 2VXFA 2DU7A 2VWFA 1VQLT 2EW3A 2I2LA 3HRKA 4E7IA 3JB9J 3FJPA 2KR3A 1K0SA 4NOYA 5CQYA 3RESA 3REAB 3V8JA 3PMIA 4C8QA 3LGLA 5CCAA 2EKOA 1ZSGA 5GAOp 4KR3A 2FYKA 5D7UA 2QDYB 3A98A 1YJNQ 2I0NA 2PMEA 3LWHA 4C8QB 1VQ9T 2RQVA 2F69A 3CCRT 2K6DA 4PJOC 8ATCB 4FT4A 2K5IA 2LNVA 2RQUA 1OX8A 5I21A 2ROLA 3V7RA 2JS2A 2HMAA 4M75E 1M30A 3OYYA 4JJBA 3PIPA 1UE9A 3CCLA 1G83A 1VQOQ 3VQVA 3I5RA 3M0RA 2CS7A 1VQNA 3I55Q 2KRSA 2CZ1B 4M7AG 1YI2Q 1SSHA 3E19A 4WTOB 2XMFA 1FMKA 3CCUA 1Q81R 2QEXT 2COWA 1QVFP 1NNHA 2DA9A 2ROTA 2Y90A 3PT9A 2D8HA 2ZZDA 4OP0A 3NFCA 2RHZA 1N9SA 2EJ9A 3TU4K 2GBQA 3QYGB 4KT0E 3OQ5A 1JJ2A 3CCLT 2DX1A 2JTMA 2QQBA 4YRLA 4DA4A 3TVTA 3QTCA 5IN1A 1FMVA 4TWAA 4X34A 1SETA 3RGLA 4BI3A 3UGTA 3CEYA 2YRVA 5IHKA 4DPGA 1KMNA 1MV3A 2LCCA 2XKOC 4ZGDB 3OYDA 4MMLA 1IRXA 1NJ5A 2MIOA 5HCKA 5GJWB 1NM7A 2LQKA 4M75G 2X3WD 3OMCA 1OX9A 2D6FA 3CCMT 4FYXB 3EG9B 1I81A 2FO0A 2RJDA 2E65A 1YJWQ 3S3OA 2EKHA 3OYHA 3EGUA 3MEYA 1SG5A 5CKHA 4YRCA 3CCQA 5GANd 4O5VA 5GAMh 4M7AA 4YREA 1NYQA 1SPKA 3X25B 4L59A 4QVDA 1M9SA 2L0AA 1S72T 1NJ2A 4M7AF 1JQQA 3VS3A 1RLQC 3H8ZA 4L5GA 3CXCA 2RQWA 2DXBA 4KR2A 1MNEA 2XDPA 5LJ5e 4PG3A 4BDYA 3ERRA 3P8TA 4HWRA 2CYZB 4RQFA 1JJ2S 2YXYA 2OTJT 2O2OA 4J83A 2ALYA 3CCQT 4JRPA 4F7UA 3EGDA 2MPXC 3NEMA 4J6YA 1RACB 4PFZA 1WHGA 2RD1A 1PHTA 1SF9A 2ALYB 1YFNA 2COYA 1GGMA 4C5HA 4M78A 4F7UB 4PJOE 2AHJB 3EGDB 1YB3A 2PVDB 2C7IA 4MDXA 1ARKA 3L1AA 1ZSZA 2W10A 4HT9A 1OZ2A 3LSQA 4HWSA 2QGFB 1VQ7A 3RMQA 4HVVA 2NLUA 3ME9A 2XI9A 4LN2A 4P71C 1ABQA 1UGSB 2HL3A 1IGQA 4M78B 2LDMA 3JCMc 5CKEA 1VIEA 4M75F 2W0ZA 1ZSZB 1VQLQ 1I1JA 3S6WA 1KC8C 3OBYA 2RHXA 1D0YA 1NJ1A 3RBBB 1ZX6A 3QWYA 2DERA 2PNIA 1B3QA 2O4XB 4M7DA 1WNLA 4ESRA 2MK5A 3RDVA 1GL5A 3MHXA 2ZZGA 1WGSA 4YRFA 3CXCS 4BY6C 2NUZA 4YDQA 1VQ9Q 5GAN5 4M7DB 2X51A 1L0WA 3CCRQ 3G7ZA 1EIFA 4BE2A 4PFOA 1WU7A 3IALA 4HVCA 4KQEA 3G4SA 4ME7A 2BZ8A 1QE0A 4BW9A 3M0QA 2B86A 1T3LA 4J9DA 3M57A 2MMPA 3CBMA 5FU6C 4AH6A 2GFAA 4X9DA 3UGQA 4FU6A 4PJOG 2EQKA 1YJ9A 4OB3B 2DYBA 2FZKB 4HCKA 2B8AA 5IXBA 4M7AD 2V1QA 1WHMA 2QEXQ 2ODRC 3T9NA 2GFUA 1ASZA 3OW2P 1M2VA 2MWPA 5IHIA 4RMOA 2H8HA 1T3SA 2DJQA 4R0KA 5LJ3d 3JB9G 1YN8A 3OY9A 4ZNXA 3X20B 1AHJB 3SWNC 2CT3A 2HAXA 1VQMQ 2FZCB 4C5IA 1GRIA 4II1A 1M2VB 5EG2A 3DLMA 1B8AA 1EQRA 3CC7A 1G3YA 3G6EA 4OVAA 4QVCA 2FPEA 5CKDA 1YJ9T 1QVGA 2K3BA 1H4TA 1OPLA 1ATIA 5AYFA 4X9CA 1V1CA 4OMFB 1WHJA 1M3AA 1O75A 3NELA 3HFOA 1NJIC 1MHNA 3P8BB 2EWNA 2KRNA 5D6XA 2QA4A 3A32A 1YCYA 1WFWA 5AT1B 4H2XA 2PUKB 1Z7NA 3W3SA 4CH4A 2EGCA 5GAMd 4M75D 1TG0A 5IHNA 5ECAA 4Q15A 3CCMQ 3OYEA 4NCXA 3LW5E 1IHVA 2DFUA 2IG0A 2EBPA 2KI7A 2FG0A 4N4GA 2KK4A 2HKNA 1W2BP 1B70A 2P0PA 4RTYA 4HCBA 4F17A 4YTLA 1G3SA 2CP5A 2P0LA 1J5WA 2DL4A 2FEIA 1X56A 4M7DD 4BI8B 3RMSA 3OD1A 2QA4T 1V29B 2YSQA 1VQ4T 4HT8A 2I4LA 4PJOF 1S72Q 1B70B 1K0XA 4HXJA 4Y91A 5CVIA 2RQTA 2DILA 3GP8A 3JAME 2QQRA 2DL5A 2JMAA 5A0GA 2RHYA 2Q5IA 2X9HA 1VUBA 4OLFA 3M58A 3FEOA 4J6XA 4LNSA 2YUOA 5IXFA 2CP6A 1RAGB 1OYXA 2OTJQ 2YLBA 3JB9F 2E10A 3A8MB 3QO8A 4Q6GA 3TEHA 4GLKA 4YRRA 3CCQQ 3BE3A 2FRWA 4BACA 1QVGS 1W4SA 1X27A 1M90R 1C0AA 3HXXA 3E9HA 1YITQ 1GBRA 4ZGJB 2BE9B 4PFPA 4KUIA 3TEHB 3EH2A 1OU8A 4FL6A 5KYYA 1YJNA 3E1SA 3M0TA 3HTZA 1H3HA 2HKQB 1TUGB 2JM8A 4JJDA 1WJSA 2QTVA 4FCYA 3HPWA 3M56A 1B34B 5FU7C 1QCNA 5HK0A 5KYNA 3TEGA 3MEUA 2R5AA 1A0NB 2IY5A 4YCVA 1D1BA 4ZTJA 3OYIA 1JJCA 3MKDA 1VQOA 1NG2A 4A63B 3I55A 1BCMA 4RTZA 2MAMA 5GAN6 5KE2A 1YI2A 2COZA 3C12A 3M0PA 3J81E 1HXDA 3JCMJ 2IY5B 1K9AA 3QSUA 2PTKA 4XU3A 3NTKA 4M77C 4JRKA 1Q82U 1YJNT 3CD6Q 3QO5A 4PJMA 3MEWA 1WQ7A 4J15A 1G5HA 3HL8A 2OJ2A 3VUBA 2VKNA 4C92A 2K2VA 2ZPFB 4PJNA 1UG1A 4MZMA 2QAZA 3CQTA 2CH4W 3C4SA 2EJFA 1X55A 2LQNA 2ZIMA 2PU9B 4C92B 1N6AA 3I55T 3CMET 2CJAA 2NS6A 4BE1A 2AMCA 1KQSP 1QW1A 4LVJA 2ZXFA 2QQ9A 3VRYA 4PJOD 2ED1A 1E22A 4E7KA 1Y07A 3QYHB 4DEXA 3TEEA 1D3BA 3VU3C 4GBQA 3VYHB 4CS2A 2DIQA 5LL6S 3TREA 2A3LA 4L6V5 1K8AU 3QZ9B 2KVQG 4J9BA 2ZT5A 2ZTGA 1KD1C 5FRMA 3CC2Q 1D3BB 4XTUA 2I4MA 1IL2A 1YFSA 2ESWA 3VS7A 4EIKA 1YJWA 4CH3A 2HQXA 4J7IA 3HFZA 2XD0A 3KUFA 4A4HA 1X2KA 2EYWA 2V8KA 5GANe 2K9GA 3HRUA 2VGMA 2BE7D 2RMOA 3BY7A 2WACA 4P71A 2HCKA 5KNNA 3RF1A 3UH0A 3VS1A 1QWEA 2E3HA 1AT1B 3HFZB 1U1TA 1NZ9A 1PSFA 4FSSA 4EMHA 3KFUA 2EYXA 2CDTA 3QWXX 4OGEA 4MZTA 1N8RU 4LD6A 2EL9A 5HGQA 5GMKe 2PZ1A 3JCMh 3H41A 4ZTUB 1K9MR 1F1BB 3NENA 2WSCE 2DL7A 5FWBA 3I5SA 1LVKA 1FMWA 1JXMA 2AZVA 1SRYA 2ZPEB 5DM7R 4IUPA 2A37A 2BZYA 2QG9B 1AZGB 4JS4A 2V26A 3SB2A 2V1RA 3A8LB 3FC3A 2O31A 4OMQA 2M0OA 1Q82R 2QA4Q 1VQ4Q 1GCPA 4LDYA 2K79A 3M53A 1IGUA 4RTTA 1R77A 4PJLA 1NEGA 1D0XA 2DL3A 5I11A 1X6GA 2NUPA 5I2SA 2DIGA 4AMCA 4A4KA 3UATA 1IZ6A 3VS6A 5GMKm 4YRMA 3P8DA 1Q95G 1RL2A 2VYTA 3JCMV 1PKSA 2PUOB 2YUQA 5CKBA 5KCOA 3MCAB 2RJEA 2EQJA 4M77E 1UGQB 2E4HA 3EAEA 4DBHA 3VQYA 4WI1A 5A0DA 2QQSA 1KMMA 1YFTA 4TQFA 4IIMA 3PGGA 3RNJA 4C5GA 1U06A 1VYUA 2PVGB 2PMFA 3X26B 2RI5A 3ASKA 3RKWA 1X2GA 4C0ZA 4ATOA 3CCRA 3FIFA 1K8AR 2L3RA 2QGGA 2DQ0A 1JRIA 2XU8A 3G1JA 4HWTA 2M51A 4KULA 1T0JA 2E6ZA 3PZCA 2LRQA 4K11A 4G85A 3RUXA 4E7ZA 3PCOA 2KDSA 4RMFA 1ZUYA 2DPPB 2Q7GA 3RIRA 2DEUA 3I56A 2L2PA 1Y57A 1JU5C 1OEBA 2K2MA 3OYAA 4DQ2A 3SFMA 4BE0A 3KBGA 2JM9A 4Z89A 2EQUA 2ARTA 2QEXA 3NHNA 1ADYA 1G51A 2FB7A 3BDUA 2J3MA 1IHWA 1OZ3A 3E2UA 1Q7YC 1N8RR 2RO0A 5LJ3e 3JCMP 4PHCA 2RM4A 2A28A 4QW2A 2JTEA 4A53A 3P8YA 2JW4A 3L2VA 1VQMA 1RADB 4M77G 4P75C 3BJUA 2FL7A 1ZUKA 2DL8A 2LNHB 3RR6A 3CMAQ 2X35A 3I56T 2MF2A 3CMEQ 3CCVA 3CPWP 1UFFA 3PNWC 2DAQA 4YRQA 4XU0A 2H3JA 3GNFB 2DEQA 1RI9A 4N0AC 5C51B 3CC4T 1D09B 5FROA 1Z9QA 2HZYA 1T0HA 1RAIB 1UGPB 4YRGA 5HY6A 3OS2A 4J7FA 4L87A 1RIQA 3EG1A 2QASA 2NYSA 2O88A 5GAMe 4Q5WA 4LVIA 2GQVA 3QUIA 1GCQC 1VQMT 3CCMA 2OX7A 1D1CA 3CMQA 4FSXA 3L42A 5EC7A 4J6WA 4D8DA 2NWMA 2V8JA 1N9WA 3Q1JA 3CCVT 3AT1B 2LJ1A 2CREA 1KOGA 1V76A 4P74C 3A8HB 2DLPA 2XIDA 3FLGA 3NTIA 2A08A 3JCMd 3RACA 4GY5A 4J9IA 3ER0A 3TQ7P 1FYFA 2DD5A 3A74A 1S72A 2Q7EA 1ABOA 2BUDA 2E3CA 4JS5A 2Z0WA 5FU7B 1RABB 4HA8A 2E41A 1EFNA 4QQGA 1TUDA 5FWCA 5GMKi 2RHQA 4DBQA 2P0KA 4AG1C 2KNBB 2JN0A 2ABLA 4RTXA 3RL6A 5A2QE 1KHIA 1RAHB 2OTJA 2QHVA 2DTIA 5A0LA 1SKUB 2L3QA 5CQXA 4M77F 5GAN8 2AKLA 3M59A 2RHQB 5L23A 3HHTB 3VRZA 2HSEB 1H4VB 2CSQA 3MQZA 1YITA 1PD1A 1BI1A 2L3PA 1OU9A 3HRIA 2P0QA 4TVYA 3M4YA 3EG0A 1WLEA 1YIJT 4M7AB 1NBEB 2FHDA 2CZ7B 2RHSA 1CKAA 2HQEA 2RI2A 2DYIA 2DU5A 1QWFA 1TOVA 1UJYA 2R58A 1M3BA 1SHGA 2ZNJA 1WZOA 3NTHA 1ZBJA 2QXFA 2RHSB 2DF6A 2PQWA 5ELNA 2AKWA 2AK5A 2JJ9A 3QHSA 3IKMB 1K76A 1YITT 2KROA 4JUVA 2CUBA 2VV5A 1RI0A 1UDLA 3EG3A 5IAYA 3CD6A 2F2VA 1TH7A 2P5IA 4AFUC 1LCKA 2DNUA 4LUEA 1MMDA 4M75A 4ORZA 2C0OA 2YT6A 4LVKA 2OAUA 1NYGA 3VBBA 1BBZA 2DE0X 2LT4A 1WI7A 1M8VA 1G5VA 1NJIU 4QQ6A 4M75B 1UHFA 4JJNK 3NMZC 1BBUA 1PM3A 1WJQA 2JMCA 3HXVA 3QPHA 1AVZC 2CZ0B 3VQXA 2D9TA 4P5NA 3JCMf 1P92A 3VS0A 3CD6T 2JT4A 3BW1A 1TTHB 2VXEA 1E1TA 1WXUA 4KBMB 3MJXA 4F04B 1C0MA 4HT4A 1QF6A 1M5Q1 2JXBA 4JPBW 3I7FA 2L5QA 2ZIOA 1H4SA 5LJ5h 4WF2A 1M1KC 4BB7A 3CC2A 1NLPC 4RTUA 3V7CA 2YWWA 2I4OA 3QO7A 2EYZA 2XDBA 4M77D 3HRSA 5GMKl 3U23A 1NE8A 2ZPHB 2X4JA 3I56Q 1M90U 2ARUA 2J06A 4QVZA 3EFRA 2LQWA 2H3EB 3CC4Q 4YRSA 1BYMA 2X4XA 1SEMA 1KFZA 2HSPA 3GBQA 2RB6A 1VQ6T 2DMOA 2BIVA 1YFRA 1WXTA 4OMNA 3UF4A 3JB9H 3P8HA 1KJWA 3CC2T 1QVFS 1X54A 1D0ZA 4JLGA 3NGPA 3QKJA 3M54A 1NYFA 4JJCA 4CC4B 1AZEA 11ASA 3SDZA 2CH4A 3CCVQ 3OS5A 4YPFA 1WA7A 3HRTA 1M1GA 1ZBXA 5D6WA 2DBKA 2GQIA 4ZN1A 2LQ8A 2EAYA 4YRNA 4AFQC 4F14A 2ZCEA 4X5OA 5ELOA 2G3RA 1K4US 1W6XA 2OAWA 2DTHA 3A5ZA 1VQ4A 3VS5A 1ZUUA 4BDZA 1AWWA 2KMTA 5KCHA 1EOVA 3BDLA 4EX5A 3FB9A 1VA7A 1EFWA 1PNJA 4C0GA 2J6FA 4PK4A 5D6YA 9ATCB 3DB4A 1O9SA 3JCMW 1AOJA 3J80E 2CKKA 1FYNA 3A5ZB 3LYIA 2CJBA 2HQHA 3ICAA 2M1HA 1NJIR 1YGBA 2LMJA 4H2XB 4PLLA 1RAEB 3V8LA 2ZZEA 4CH6A 1ASYA 3PVQA 4PJOA 2HD0A 5CR2A 3QXEB 4C8QC 3ZL7C 3TSWA 2E5QA 4KGXB 3WXMB 2K5LA 2LJ0A 4WCIA 5DLOA 2LX9A 3UFGA 1B7YA 2VVKA 4PJOB 4UP7A 2P84A 3CCEA 2F5TX 2K3XA 2NUTA 1YIJQ 4ZIBA 2EQMA 4RG2A 4UP8A 3MO8A 1R8OB 1KSWA 4A4GA 4N0AA 1QCOA 2EGAA 2LP5A 4YROA 4NL3A 3MEVA 1RAAB 2QTXA 4AT1B 4NL2A 5KE3A 2RJCA 2NUTB 2KE9A 4TQDA 2KYMA 1YWPA 2IPOB 4M4ZA 4JDSA 3JCMg 1I4K1 4CC3A 2KBTA 2X3XD 1WLPB 1HYOA 2DQ3A 4JZ3A 2L8DA 2RN8A 1IB8A 3RKYA 1GCQA 4Z8AA 1TUCA 1I07A 1U5SA 2KXDA 3CCET 1VQ5Q 3EFOA 1M27C 3INZA 3JCMb 2KRMA 1WHLA 3S3MA 1K9MU 3WVEB 2MYSA 4XQ3A 2X4WA 4HCCA 4OMMA 5KYYB 4B9XA 3OW2A 1I5LA 1VQZA 3EFOB 4OMPA 2YLCA 4IUVA 3HXZA 4AG2C 1GBQA 1UGVA 1Y0MA 2KQWA 4PNOA 3CMAA 1PSEA 1BK2A 2JOYA 3O8VA 2WSEE 3CMEA 3LC0A 2RK1A 1XNIA 1D1AA 3X24B 5LJ5d 1YHQT 3MP1A 1JJCB 1KHCA 2F5KA 1YNZA 4JRQA 1MMGA 1X2QA 2MWOA 3UDCA 1SHFA 4PJJA 1QP2A 5J26A 3GOXA 2QYZA 1G8XA 1OOTA 3BFMA 4CRIA 3OMGA 2EJGA 1HSQA 1M2OA 1R0CB 3M4PA 3CMAT 1IXDA 3REBB 3CBPA 3THKA 5GAN2 1HC7A 3SD4A 1OULA 2K4YA 3QG1A 3C0CA 1TXQA 3H0FA 1HJDA 4YRPA 4ZN3A 1QLYA 3IG2A 4C0DC 1B7TA 1W2BA 3OYJA 2AMCB 4QT7A 2CP3A 1K73U 1M8MA 4EMKC 3PTAA 1VQ6Q 4LVLA 2K3YA 1N5ZA 1JBMA 1H4QA 4EDUA 1J3TA 4BD3A 3JB9D 2AKKA 3OW2S 2ZPBB 1WPYA 4OMLA 4RDXA 1M3CA 4C8QE 3L2UA 2VGNA 1N27A 4B9WA 3CCJQ 2DTOA 3E9GA 2ZINA 4OB1B 2VUBA 1WHKA 4FT2A 3G71T 1HTTA 2OTLQ 2KT8A 4M78C 3URGA 1Q86C 1ZSZC 4F16A 3WQZA 2JUFA 4KGVB 1WDXA 3O5ZA 2J6KA 1PCXA 1VYTA 1PYSA 5KYUA 2JZ2A 2RH2A 1BI3A 1I5OB 3GLXA 2DO3A 1ZA2B 4UP9A 3FJ5A 1Q7YU 1U8RA 4XTXA 4JRIA 4MDWA 1KIKA 1PYSB 5M9OA 1USYC 3CCST 1AWJA 3R6NA 1S1NA 12ASA 5LJ5f 4RUGA 4BY6B 2AIRB 1W2BS 1Q82C 2ZGWA 3DLLA 1PWTA 4DOWA 2D0NA 3H6ZA 1WQWA 2DVEA 2DZCA 1ZA1B 3C95A 5E3IA 2EIFA 4C8QG 3OYFA 1X2HA 3OYLA 2LZ6B 2LJ3A 3LGFA 2RJFA 2RA2A 4YCUA 1H641 5FU6B 1X6BA 1I8FA 4E51A 2XDDA 2NUPB 5KYXA 5C0MA 3LWIA 1JJ2P 2E64A 2RK2A 4XTYA 1B76A 5GANh 2E6NA 5KYWA 1MV0B 2XHCA 4N4HA 4PLIA 3SWNA 3F70A 1RLPC 2HBWA 3L2WA 4H2UA 2CIMA 3OYBA 2L89A 1NEBA 1KQSA 2J05A 3CCEQ 4HWOA 3LH5A 1K73R 1C6VX 5KYWB 3OYMA 4CC2A 1G3WA 3SWNB 3LH0A 5GMKh 2ZT6A 1EVLA 3PIOA 1UJ0A 3HY1A 4OGCA 2MI6A 2ECZA 4E7SA 4RTWA 4PL6A 2FPFA 3WVDB 4A4EA 4R55A 1QVPA 2GTOA 4OB0B 3TCJA 2D8JA 1W1FA 2D1XA 2JVVA 1QP3A 1WHHA 1W66A 3PCOB 4Y28E 1YHQQ 3CC4A 5IH2A 4XTZA 4H2SA 1QMCA 2C0TA 1HK9A 2RI3A 1OV3A 1AD5A 3CXCP 1N8RC 2C06A 4RCBA 3KFVA 3R6OA 2RQRA 3EHQA 3A7UA 3H9NA 4F7UE 2A8EA 4P72C 1EIYA 4CC7A 2GGRA 4C8QF 1AWOA 1Q7YR 3H0HA 2EYQA 4M78E 2WSFE 1TU0B 4HCZA 1SERA 1VIFA 1EIYB 4JLIA 3PVLA 7AT1B 3I35A 1Q81C 1GFCA 2G6FX 3A8OB 3HKSA 2SRCA 1KQSS 2GNCA 2L3SA 3JB9I 1E6GA 2G4CA 1OQKA 1LOJA 3E9IA 2CP0A 3META 3OA6A 3H0IA 2CZ6B 1VYVA 2EPDA 4E7JA 2E5AA 4P73C 3QO3A 5LJ5j 2KSSA 1ZHIA 3UA6A 1E6HA 2ZR2A 4KGZB 1UB4A 1XOVA 2ODRD 3J7AF 1IO6A 2YUNA 5J3BA 4M7DE 1H3ZA 2X4YA 2XTIA 2Q7HA 5LJ5g 4ZTZB 3I9QA 5FW9A 1JB0E 4CS4A 2MCNA 2IVWA 3G71Q 1YWOA 1JEGA 1NPPA 1KC8U 4H02A 4CH5A 1VQNT 4YCWA 4F7UG 1KK7A 1WYXA 3L2RA 3HP9A 1YIJA 4DBRA 2DBMA 4TTVA 5LJ3h 2E1HA 2ARSA 2YHTA 3CCUT 4IUQA 5DLQE 4M77A 3LX7A 4M78G 3HXUA 3M5AA 5GAN4 2P4RA 3EG9A 1LPLA 4FYYB 4Z88A 4TVAA 3EH1A 2O9SA 3JCMX 2QI2A 3HFNA 1G3TA 1FX7A 1XQHA 4M77B 1M1KU 3DSQA 3CCSQ 1BB9A 4IURA 2CT4A 4D6WA 4XTVA 1BBWA 4XU1A 4K86A 1SRLA 3NPFA 2DJZA 1FWZA 4TVAB 4BUGA 3SHWA 1VQ5A 2KXCA 4IUTA 2F2WA 4LDUA 1N9RA 1LNXA 1UUEA 2KY9A 4PKCC 4C92C 3HFVA 1WYDA 4QQDA 4JZ4A 2ZZFA 4FM4B 3N5BB 4M7DG 3HXWA 4E2FB 2CP2A 4C8QD 3VUZA 2DETA 3A8GB 2A0FB 3MP6A 2LCLA 4XK8E 3EHRA 4EMKA 1U1SA 4K87A 1VQ8Q 1XJWB 4D8KA 4A54A 2M9UA 1X01A 4C0DB 2HNIA 4YRIA 5GJVB 3GNGA 1QVGP 4C0FA 4KRTA 1VQ5T 3VKIA 4EMKB 4Y92A 2ZR3A 3CPWA 2AKWB 4G84A 6AT1B 3OB9A 2D0QB 3V7SA 5K1XA 1UTIA 4FYWB 2SEMA 2RF0A 2V8IA 1QVFA 2QHUA 2KYBA 4YRKA 4F7UF 3KXTA 4CI0C 2F1LA 2RPNA 2PVOB 4LD9K 2QK0A 1VQKQ 1TSFA 1LYLA 2XGTA 4OMOA 4HKEA 2DXCA 2EQIA 1NYRA 1BU1A 2J7IA 2CGHA 4M78F 4FIBA 1G5IA 4J9HA 2E12A 4J9FA 1W70A 2ZNIA 2C0IA 2O4XA 3GPLA 5CO7A 1KC8R 3GIBA 3REUA 5I2MA 3SEMA 4C5EA 1KQ2A 1VQ6A 4BI4A 2LVMA 2ZCFB 4UC4A 1USYA 2Q5HA 3V8KA 2OI3A 5GAOr 3M0SA 4DOVA
chains in the Genus database with same CATH topology
3OYCA 3QIIA 1NJ6A 4XTWA 1VQ7T 4M7DF 3PMTA 3RERA 3MF2A 3CCJA 3E9FA 2K57A 4R56A 1BIBA 4XU2A 3A7RA 2OTLA 4RQEA 3CPWS 3G1ZA 3M4GA 1VQPA 2XICA 4P3PA 5GANf 4XEOA 4TVWA 3QBYA 4MZPA 1KQ1A 4YRJA 1E24A 3CCJT 4P3NA 4RG8A 3G4ST 3IKLA 4LDVA 2OTLT 4C92E 1VQPT 2GCXA 4OB2B 1MGQA 4NS5A 3CBOA 5GAOl 3HXYA 2J3LA 4LVMA 3UT1A 2Y4YA 3AHUA 1UGRB 1X75C 2O01E 4J8OA 1FXXA 3RKXA 4O2DA 4M78D 5C53B 3M9QA 4H2WA 4BWAA 4CS3A 4MMKA 4E7LA 4P72A 4P75A 3CC7T 3EFSA 3G6ET 5HK3A 2JTFA 2GF7A 3L2QA 2QHTA 4A4FA 1B7YB 3REXA 2LC4A 3A7AA 1E1OA 3UPUA 1GXIE 4K88A 4C92G 5FLXE 2LTOA 1KD1U 4P73A 1M90C 1EVKA 1NPRA 1Y71A 1YHQA 5C6SA 5FRNA 3VYGA 2LT1A 4RCCA 4P3OA 3HSBA 4P74A 2ZT7A 2XG8D 2KAFA 2QHSA 3UWNA 3P8VA 5C52B 2DDZA 1BI0A 4E7HA 4UPAA 1B34A 3JCMQ 4EPCA 2VC8A 1Q86U 1SSFA 4IUUA 1OI1A 5GANj 4LDXA 1UEBA 2DD4A 3A5YA 4V2SA 4YRTA 5LJ3f 4ZGEB 1BI2A 3OYNA 3QDRB 2FVUA 2ZPGB 5GANg 1SESA 4EMGA 1IREB 2DXTA 4YYEA 5GMKj 2ZT8A 2XK0A 4XAXB 3DB3A 5GAN3 3MF1A 1Z7MA 4Z02A 4HWPA 5CAIA 3R07A 1Y7XA 3NETA 1M1FA 4YP0A 3HY0A 3JCMe 4M7AC 5KH6A 1XTDA 1YBYA 3L2ZA 4ELYC 5GAMf 2HBPA 3G71A 2C8MA 1VQOT 1LJOA 4C92F 3VJPA 5K1PA 2RHUA 1YI2T 3DKMA 5J39A 3VQWA 3ZEHA 4H2YA 5HKCA 3ZFJA 5IT9E 4EO4A 2Y4XA 5CKFA 3FRNA 2BKDN 1WJRA 3M55A 3CCSA 3MEAA 2DZ9A 4RKUE 1KG1A 1BIAA 2P4TA 3FDRA 3OYGA 4M75C 3OS1A 4ZTFA 2CJ9A 1K9MC 2I4NA 1Y96A 1NJ8A 2M16A 5L8RE 3X28B 3JSCA 3A31A 4H2TA 2RHIA 2A7YA 4O6JA 5DY9A 1BKBA 1VQ8A 4KUDK 2DKGA 1Y96B 4M7DC 3L4GA 1YJWT 5GAN7 1DJ7B 5LJ3j 3L4GB 1M4ZA 5CIUA 1Q81U 3OSSC 3QZ5B 5CK9A 4E47A 2QQAA 3QJ6A 1VQKA 3S3NA 5GAOn 5LJ3g 3JRZA 1ZQ1A 1VQ8T 4VUBA 3MP8A 3CPFA 1ADJA 5F5WA 2ZPIB 3PFSA 4ELZC 1X6OA 2EFIA 4C92D 4N4IA 3OYKA 2K5FA 3M4QA 1VQLA 3VV0A 1K73C 2DXUA 3OSVA 3QNEA 5GAMj 1K8AC 2DK3A 3GF5A 3QJYA 1VQKT 3TUPA 4M7AE 3ZBDA 4OF1A 2JNGA 5GAMg 3OS0A 4XEMA 3C94A 4TVRA 2R57A 3LSSA 1VQ9A 3OBWA 4IKFA 3LLRA 4H2VA 2R5MA 5GAOq 4LDWA 4WJ3M 2E70A 4J5YA 5GAOm 4WJ4A 2VXFA 2DU7A 1VQLT 2I2LA 3HRKA 4E7IA 3JB9J 3FJPA 4NOYA 5CQYA 3RESA 3V8JA 3PMIA 4C8QA 3LGLA 5CCAA 2EKOA 5GAOp 4KR3A 2FYKA 2QDYB 2PMEA 3LWHA 4C8QB 1VQ9T 2F69A 3CCRT 4PJOC 4FT4A 2K5IA 2LNVA 5I21A 3V7RA 4M75E 3OYYA 3PIPA 3CCLA 3VQVA 1VQNA 2CS7A 2CZ1B 4M7AG 3E19A 3CCUA 2QEXT 1NNHA 2Y90A 3PT9A 2ZZDA 4OP0A 3NFCA 2RHZA 1N9SA 2EJ9A 3TU4K 3QYGB 4KT0E 3OQ5A 1JJ2A 3CCLT 2JTMA 2QQBA 4YRLA 4DA4A 3QTCA 5IN1A 4TWAA 4X34A 1SETA 3RGLA 4BI3A 3UGTA 3CEYA 2YRVA 4DPGA 1KMNA 2LCCA 2XKOC 4ZGDB 3OYDA 4MMLA 1NJ5A 2LQKA 4M75G 3OMCA 2D6FA 3CCMT 1I81A 2RJDA 2E65A 3S3OA 3OYHA 3MEYA 5CKHA 4YRCA 3CCQA 5GANd 4O5VA 5GAMh 4M7AA 4YREA 1NYQA 3X25B 4L59A 4QVDA 1M9SA 1S72T 1NJ2A 4M7AF 3H8ZA 3CXCA 4L5GA 2DXBA 4KR2A 2XDPA 5LJ5e 4PG3A 4BDYA 3ERRA 3P8TA 4HWRA 2CYZB 4RQFA 1JJ2S 2OTJT 4J83A 2ALYA 3CCQT 4JRPA 4F7UA 3NEMA 4J6YA 2RD1A 2ALYB 1GGMA 4C5HA 4M78A 4F7UB 4PJOE 2AHJB 1YB3A 2PVDB 2C7IA 4MDXA 3L1AA 4HT9A 3LSQA 1OZ2A 4HWSA 1VQ7A 3RMQA 2NLUA 3ME9A 2XI9A 4P71C 1UGSB 4M78B 3JCMc 2LDMA 5CKEA 1VIEA 4M75F 3S6WA 1KC8C 3OBYA 2RHXA 1NJ1A 2O4XB 4M7DA 1WNLA 3MHXA 2ZZGA 1WGSA 4YRFA 3CXCS 4BY6C 4YDQA 5GAN5 4M7DB 1L0WA 3G7ZA 1EIFA 4BE2A 1WU7A 3IALA 4HVCA 4KQEA 3G4SA 4ME7A 1QE0A 4BW9A 3M57A 2MMPA 3CBMA 5FU6C 4AH6A 2GFAA 4X9DA 3UGQA 4FU6A 4PJOG 2EQKA 1YJ9A 4OB3B 2B8AA 4M7AD 2ODRC 3T9NA 2GFUA 1ASZA 2MWPA 4RMOA 5LJ3d 3JB9G 3OY9A 3X20B 1AHJB 3SWNC 2HAXA 4C5IA 4II1A 5EG2A 3DLMA 1B8AA 1EQRA 3CC7A 1G3YA 3G6EA 4OVAA 4QVCA 5CKDA 1YJ9T 1QVGA 1H4TA 1ATIA 5AYFA 4X9CA 4OMFB 1O75A 3NELA 3HFOA 1NJIC 1MHNA 3P8BB 2EWNA 5D6XA 2QA4A 3A32A 1YCYA 4H2XA 2PUKB 1Z7NA 3W3SA 4CH4A 5GAMd 4M75D 4Q15A 3OYEA 4NCXA 3LW5E 2IG0A 4N4GA 2KK4A 1B70A 2P0PA 4HCBA 4YTLA 1G3SA 2P0LA 1J5WA 1X56A 4M7DD 4BI8B 3RMSA 3OD1A 2QA4T 1V29B 1VQ4T 4HT8A 2I4LA 4PJOF 1B70B 4Y91A 5CVIA 3GP8A 3JAME 2QQRA 5A0GA 2RHYA 2Q5IA 1VUBA 4OLFA 3M58A 3FEOA 4J6XA 4LNSA 1OYXA 2YLBA 3JB9F 2E10A 3A8MB 3QO8A 4Q6GA 3TEHA 4GLKA 4YRRA 4BACA 1QVGS 1W4SA 1C0AA 3HXXA 3E9HA 4ZGJB 4KUIA 3TEHB 4FL6A 1YJNA 3E1SA 3HTZA 1WJSA 3HPWA 3M56A 1B34B 5FU7C 5HK0A 3TEGA 3MEUA 2R5AA 2IY5A 4YCVA 4ZTJA 3OYIA 1JJCA 1VQOA 3I55A 5GAN6 2MAMA 5KE2A 1YI2A 3C12A 3J81E 1HXDA 3JCMJ 2IY5B 3QSUA 4XU3A 3NTKA 4M77C 4JRKA 1Q82U 1YJNT 3QO5A 3MEWA 1WQ7A 4J15A 1G5HA 3HL8A 3VUBA 4C92A 2K2VA 2ZPFB 4MZMA 3C4SA 2EJFA 1X55A 2ZIMA 2PU9B 4C92B 1N6AA 2CJAA 3I55T 3CMET 2NS6A 2AMCA 4BE1A 1QW1A 4LVJA 2ZXFA 2QQ9A 4PJOD 1E22A 4E7KA 1Y07A 3QYHB 3TEEA 1D3BA 3VU3C 3VYHB 4CS2A 2DIQA 5LL6S 3TREA 2A3LA 4L6V5 1K8AU 3QZ9B 2KVQG 2ZT5A 2ZTGA 1KD1C 5FRMA 1D3BB 4XTUA 2I4MA 1IL2A 1YFSA 1YJWA 4CH3A 2HQXA 4J7IA 3HFZA 2XD0A 3KUFA 4A4HA 2V8KA 5GANe 3HRUA 2VGMA 3BY7A 2WACA 4P71A 5KNNA 3RF1A 3UH0A 3HFZB 1U1TA 1NZ9A 1PSFA 4EMHA 3KFUA 4OGEA 4MZTA 1N8RU 4LD6A 2EL9A 5HGQA 5GMKe 3JCMh 4ZTUB 3NENA 2WSCE 1SRYA 2ZPEB 5DM7R 4IUPA 4JS4A 3SB2A 3A8LB 3FC3A 2M0OA 4LDYA 3M53A 5I2SA 2DIGA 4A4KA 5GMKm 1IZ6A 4YRMA 3P8DA 1RL2A 2VYTA 3JCMV 2PUOB 5CKBA 5KCOA 3MCAB 2RJEA 2EQJA 4M77E 1UGQB 3EAEA 3VQYA 4WI1A 5A0DA 2QQSA 1KMMA 1YFTA 4TQFA 3PGGA 4C5GA 2PVGB 2PMFA 3X26B 2RI5A 3ASKA 3RKWA 1X2GA 4C0ZA 4ATOA 3CCRA 3FIFA 2L3RA 2DQ0A 1JRIA 2XU8A 4HWTA 4KULA 2E6ZA 3PZCA 2LRQA 4G85A 3RUXA 3PCOA 2KDSA 4RMFA 2DPPB 2Q7GA 3RIRA 3I56A 3OYAA 4DQ2A 3SFMA 4BE0A 3KBGA 2EQUA 2ARTA 2QEXA 1ADYA 1G51A 2FB7A 3BDUA 2J3MA 1OZ3A 1Q7YC 2RO0A 5LJ3e 3JCMP 4PHCA 2RM4A 4QW2A 4A53A 3P8YA 3L2VA 1VQMA 4M77G 4P75C 3BJUA 2FL7A 2X35A 3I56T 2MF2A 3CCVA 3PNWC 2DAQA 4YRQA 4XU0A 2H3JA 3GNFB 2DEQA 5C51B 4N0AC 3CC4T 5FROA 1UGPB 4YRGA 5HY6A 3OS2A 4J7FA 4L87A 1RIQA 5GAMe 4Q5WA 4LVIA 2GQVA 3QUIA 1VQMT 3CCMA 3CMQA 4FSXA 3L42A 4J6WA 2V8JA 1N9WA 3Q1JA 3CCVT 1KOGA 4P74C 3A8HB 2XIDA 3FLGA 3NTIA 3JCMd 3RACA 4GY5A 1FYFA 3ER0A 2DD5A 3A74A 1S72A 2Q7EA 2BUDA 2E3CA 4JS5A 5FU7B 4HA8A 2E41A 4QQGA 5GMKi 2RHQA 2P0KA 2JN0A 3RL6A 5A2QE 1KHIA 2OTJA 2QHVA 2DTIA 5A0LA 5CQXA 4M77F 5GAN8 3M59A 2RHQB 3HHTB 1H4VB 3MQZA 1YITA 1BI1A 3HRIA 2P0QA 4TVYA 3M4YA 1WLEA 1YIJT 4M7AB 2FHDA 2CZ7B 2RHSA 2HQEA 2RI2A 2DU5A 2R58A 2ZNJA 3NTHA 2QXFA 2RHSB 2PQWA 5ELNA 2AKWA 3QHSA 3IKMB 1YITT 4JUVA 2VV5A 1RI0A 5IAYA 3CD6A 1TH7A 2P5IA 4M75A 4LVKA 2OAUA 3VBBA 2LT4A 1M8VA 1G5VA 1NJIU 4QQ6A 4M75B 4JJNK 1BBUA 1WJQA 3HXVA 3QPHA 2CZ0B 3VQXA 2D9TA 4P5NA 3JCMf 1P92A 3CD6T 3BW1A 2VXEA 1E1TA 4KBMB 4HT4A 1QF6A 1M5Q1 3I7FA 2L5QA 2ZIOA 1H4SA 5LJ5h 4WF2A 1M1KC 4BB7A 3CC2A 3V7CA 2I4OA 3QO7A 2XDBA 4M77D 3HRSA 5GMKl 1NE8A 2ZPHB 2X4JA 1M90U 2ARUA 4QVZA 3EFRA 4YRSA 1BYMA 2X4XA 2RB6A 1VQ6T 2BIVA 1YFRA 3JB9H 3P8HA 3CC2T 1QVFS 1X54A 4JLGA 3QKJA 3M54A 11ASA 3SDZA 3OS5A 4YPFA 3HRTA 1M1GA 1ZBXA 5D6WA 4ZN1A 2LQ8A 2EAYA 4YRNA 2ZCEA 4X5OA 5ELOA 2G3RA 2DTHA 3A5ZA 1VQ4A 4BDZA 2KMTA 5KCHA 1EOVA 3BDLA 4EX5A 3FB9A 1EFWA 4C0GA 5D6YA 3DB4A 1O9SA 3JCMW 3J80E 2CKKA 3A5ZB 3LYIA 2CJBA 3ICAA 2M1HA 1YGBA 4H2XB 4PLLA 3V8LA 2ZZEA 4CH6A 1ASYA 4PJOA 2HD0A 5CR2A 3QXEB 4C8QC 2E5QA 3WXMB 2K5LA 5DLOA 2LX9A 3UFGA 1B7YA 4PJOB 4UP7A 3CCEA 2F5TX 2K3XA 4ZIBA 2EQMA 4RG2A 4UP8A 3MO8A 1R8OB 4A4GA 4N0AA 4YROA 4NL3A 3MEVA 2QTXA 4NL2A 5KE3A 2RJCA 4TQDA 4JDSA 3JCMg 1I4K1 2DQ3A 2L8DA 3RKYA 3CCET 3INZA 3JCMb 3S3MA 1K9MU 3WVEB 4XQ3A 2X4WA 4HCCA 4B9XA 3OW2A 1I5LA 1VQZA 2YLCA 4IUVA 3HXZA 2KQWA 4PNOA 3CMAA 1PSEA 2JOYA 3O8VA 2WSEE 3CMEA 3LC0A 2RK1A 1XNIA 3X24B 5LJ5d 1YHQT 3MP1A 1JJCB 1KHCA 2F5KA 4JRQA 2MWOA 3UDCA 5J26A 1QP2A 3GOXA 3BFMA 4CRIA 3OMGA 2EJGA 3M4PA 3CMAT 3CBPA 5GAN2 1HC7A 3SD4A 2K4YA 3QG1A 4YRPA 4ZN3A 3IG2A 4C0DC 1W2BA 3OYJA 2AMCB 1K73U 3PTAA 4EMKC 4LVLA 2K3YA 1JBMA 1H4QA 4EDUA 4BD3A 3JB9D 3OW2S 2ZPBB 1WPYA 4RDXA 4C8QE 3L2UA 2VGNA 1N27A 4B9WA 2DTOA 3E9GA 2ZINA 4OB1B 2VUBA 4FT2A 3G71T 1HTTA 4M78C 3URGA 1Q86C 3WQZA 2JUFA 1PYSA 2JZ2A 2RH2A 1BI3A 3GLXA 2DO3A 4UP9A 1Q7YU 1U8RA 4XTXA 4JRIA 4MDWA 1PYSB 5M9OA 1USYC 3CCST 12ASA 5LJ5f 4BY6B 1W2BS 1Q82C 2ZGWA 3DLLA 4DOWA 3H6ZA 1WQWA 2DVEA 2DZCA 3C95A 5E3IA 2EIFA 4C8QG 3OYFA 1X2HA 3OYLA 3LGFA 2RJFA 2RA2A 4YCUA 1H641 5FU6B 1I8FA 4E51A 2XDDA 5C0MA 3LWIA 2E64A 2RK2A 4XTYA 1B76A 5GANh 2E6NA 2XHCA 4N4HA 4PLIA 3SWNA 3F70A 3L2WA 4H2UA 2CIMA 3OYBA 2L89A 1KQSA 4HWOA 3OYMA 1G3WA 3SWNB 3LH0A 5GMKh 2ZT6A 1EVLA 3PIOA 3HY1A 4OGCA 2MI6A 4PL6A 3WVDB 4A4EA 4R55A 1QVPA 4OB0B 3TCJA 2JVVA 1QP3A 1W66A 3PCOB 4Y28E 3CC4A 4XTZA 4H2SA 1HK9A 2RI3A 1N8RC 2C06A 4RCBA 3R6OA 3A7UA 4F7UE 2A8EA 4P72C 1EIYA 4C8QF 2EYQA 4M78E 2WSFE 4HCZA 1SERA 1VIFA 1EIYB 4JLIA 1Q81C 3A8OB 3HKSA 1KQSS 3JB9I 2G4CA 1LOJA 3E9IA 3META 3OA6A 2CZ6B 2E5AA 4E7JA 4P73C 3QO3A 5LJ5j 2KSSA 1ZHIA 2ZR2A 1UB4A 1XOVA 2ODRD 3J7AF 5J3BA 4M7DE 1H3ZA 2X4YA 2XTIA 2Q7HA 5LJ5g 4ZTZB 1JB0E 4CS4A 2IVWA 1NPPA 1KC8U 4H02A 4CH5A 1VQNT 4YCWA 4F7UG 3L2RA 3HP9A 1YIJA 4TTVA 5LJ3h 2E1HA 2ARSA 2YHTA 3CCUT 4IUQA 5DLQE 4M77A 3LX7A 4M78G 3HXUA 3M5AA 5GAN4 4TVAA 3JCMX 2QI2A 3HFNA 1G3TA 1FX7A 1XQHA 4M77B 1M1KU 3DSQA 1BBWA 4IURA 4D6WA 4XTVA 4XU1A 4K86A 2DJZA 1FWZA 4TVAB 4BUGA 1VQ5A 4IUTA 4LDUA 1N9RA 1LNXA 4PKCC 2KY9A 4C92C 3HFVA 1WYDA 4QQDA 2ZZFA 4FM4B 3N5BB 4M7DG 3HXWA 4C8QD 3VUZA 3A8GB 3MP6A 2LCLA 4XK8E 4EMKA 1U1SA 4K87A 4A54A 2M9UA 1X01A 4C0DB 2HNIA 4YRIA 3GNGA 4C0FA 1VQ5T 3VKIA 4EMKB 2ZR3A 3CPWA 2AKWB 4G84A 3OB9A 2D0QB 3V7SA 5K1XA 2V8IA 1QVFA 2QHUA 4YRKA 4F7UF 3KXTA 4CI0C 2PVOB 4LD9K 1LYLA 2XGTA 4HKEA 2DXCA 1NYRA 2CGHA 4M78F 4FIBA 1G5IA 2E12A 2ZNIA 2O4XA 3GPLA 5CO7A 3GIBA 3REUA 5I2MA 4C5EA 1KQ2A 1VQ6A 4BI4A 2LVMA 2ZCFB 4UC4A 1USYA 2Q5HA 3V8KA 5GAOr 4DOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ6 A;  4YRL A;  4XTW A;  4M7D F;  3RER A;  3MF2 A;  4XQ3 A;  3QTC A;  4TWA A;  1I5L A;  1VQZ A;  2YLC A;  2K57 A;  3HXZ A;  1SET A;  3RGL A;  1BIB A;  4PNO A;  4XU2 A;  3UGT A;  3A7R A;  4RQE A;  4DPG A;  1KMN A;  3LC0 A;  3G1Z A;  5GMK m;  4YRM A;  3M4G A;  4MML A;  1NJ5 A;  3JCM V;  5LJ5 d;  1JJC B;  4M75 G;  4P3P A;  5GAN f;  4XEO A;  4TVW A;  4M77 E;  3VQY A;  1KQ1 A;  4WI1 A;  4YRJ A;  1I81 A;  1KMM A;  1E24 A;  2E65 A;  1YFT A;  4P3N A;  3BFM A;  4TQF A;  2EJG A;  3MEY A;  3PGG A;  4YRC A;  5GAN d;  3IKL A;  5GAM h;  3M4P A;  2PMF A;  4M7A A;  4YRE A;  1NYQ A;  3RKW A;  1X2G A;  5GAN 2;  4C92 E;  4QVD A;  3FIF A;  1HC7 A;  2DQ0 A;  1JRI A;  1NJ2 A;  1MGQ A;  5GAO l;  4M7A F;  4HWT A;  3HXY A;  3PZC A;  2J3L A;  4YRP A;  4G85 A;  3RUX A;  3PCO A;  3IG2 A;  4RMF A;  4KR2 A;  2AMC B;  3AHU A;  5LJ5 e;  2Q7G A;  3RIR A;  4PG3 A;  3ERR A;  3P8T A;  4EMK C;  4HWR A;  4RQF A;  4DQ2 A;  3RKX A;  1JBM A;  4M78 D;  4O2D A;  5C53 B;  1H4Q A;  2ALY A;  4H2W A;  4BWA A;  3JB9 D;  2ART A;  4F7U A;  4CS3 A;  1ADY A;  1G51 A;  2FB7 A;  3BDU A;  3NEM A;  2J3M A;  1WPY A;  4MMK A;  4RDX A;  4J6Y A;  2RD1 A;  4C8Q E;  4P75 A;  4P72 A;  5LJ3 e;  3JCM P;  4PHC A;  2RM4 A;  3EFS A;  2ALY B;  1GGM A;  2DTO A;  4M78 A;  4A53 A;  4F7U B;  4PJO E;  1YB3 A;  2ZIN A;  3P8Y A;  2C7I A;  4M77 G;  4P75 C;  3BJU A;  3L1A A;  4HT9 A;  3LSQ A;  4HWS A;  1HTT A;  2QHT A;  4M78 C;  4P71 C;  1B7Y B;  3REX A;  4M78 B;  3JCM c;  4YRQ A;  4XU0 A;  3WQZ A;  2DEQ A;  4M75 F;  4N0A C;  1E1O A;  3A7A A;  5C51 B;  4K88 A;  1PYS A;  4C92 G;  4YRG A;  4P73 A;  1NJ1 A;  1EVK A;  4L87 A;  1RIQ A;  4UP9 A;  4M7D A;  5GAM e;  1WNL A;  3QUI A;  4XTX A;  4RCC A;  4JRI A;  1PYS B;  2ZZG A;  1USY C;  4P3O A;  3HSB A;  4YRF A;  3CMQ A;  2ZT7 A;  4P74 A;  4J6W A;  12AS A;  4YDQ A;  5LJ5 f;  1N9W A;  5GAN 5;  4M7D B;  1L0W A;  2QHS A;  3P8V A;  5C52 B;  2ZGW A;  1KOG A;  2DDZ A;  4P74 C;  1WU7 A;  3IAL A;  4UPA A;  4HVC A;  1B34 A;  3JCM Q;  4KQE A;  2VC8 A;  3JCM d;  1WQW A;  2DVE A;  3RAC A;  2DZC A;  1QE0 A;  5E3I A;  1FYF A;  4BW9 A;  4C8Q G;  1X2H A;  5GAN j;  3A5Y A;  3A74 A;  4AH6 A;  2Q7E A;  4V2S A;  4X9D A;  3UGQ A;  2RA2 A;  4YCU A;  1H64 1;  4PJO G;  4YRT A;  5LJ3 f;  2E3C A;  1I8F A;  4E51 A;  4M7A D;  2E64 A;  4XTY A;  5GAN g;  1B76 A;  1SES A;  4HA8 A;  5GAN h;  2E41 A;  4EMG A;  2ODR C;  5GMK i;  2RHQ A;  1ASZ A;  2DXT A;  2JN0 A;  3SWN A;  5GMK j;  4YYE A;  3RL6 A;  2ZT8 A;  2QHV A;  2DTI A;  4H2U A;  2CIM A;  5LJ3 d;  3JB9 G;  5GAN 3;  4HWO A;  4M77 F;  3MF1 A;  5GAN 8;  3SWN C;  1Z7M A;  4HWP A;  2RHQ B;  5CAI A;  3R07 A;  1H4V B;  3SWN B;  3NET A;  5GMK h;  1B8A A;  1EQR A;  2ZT6 A;  1EVL A;  3HY1 A;  4YP0 A;  3HY0 A;  3HRI A;  3JCM e;  4M7A C;  4QVC A;  4TVY A;  3L2Z A;  1WLE A;  1H4T A;  4M7A B;  5GAM f;  1ATI A;  4X9C A;  2C8M A;  2RHS A;  1LJO A;  4C92 F;  2DU5 A;  3NEL A;  3HFO A;  2EWN A;  5K1P A;  3A32 A;  1W66 A;  1YCY A;  2ZNJ A;  3PCO B;  3VQW A;  4H2Y A;  4H2X A;  2RHS B;  1Z7N A;  4XTZ A;  3W3S A;  4H2S A;  4CH4 A;  5GAM d;  4M75 D;  5ELN A;  4EO4 A;  1HK9 A;  3QHS A;  2AKW A;  4Q15 A;  3IKM B;  4NCX A;  4JUV A;  4RCB A;  3A7U A;  4F7U E;  1B70 A;  1TH7 A;  2P5I A;  4P72 C;  1EIY A;  4M75 A;  2P0L A;  4C8Q F;  1J5W A;  2DZ9 A;  3VBB A;  1BIA A;  1X56 A;  4M7D D;  3OD1 A;  4M78 E;  4HT8 A;  2I4L A;  4PJO F;  1M8V A;  4M75 C;  1B70 B;  1SER A;  4Y91 A;  1EIY B;  4JLI A;  4M75 B;  2CJ9 A;  2I4N A;  1BBU A;  2Q5I A;  3JB9 I;  4OLF A;  1Y96 A;  1NJ8 A;  2G4C A;  4J6X A;  3HXV A;  4LNS A;  1LOJ A;  3E9I A;  3VQX A;  3A31 A;  4H2T A;  3JCM f;  2E5A A;  4P73 C;  2YLB A;  3JB9 F;  3BW1 A;  3QO3 A;  2E10 A;  5DY9 A;  5LJ5 j;  2VXE A;  3QO8 A;  4Q6G A;  2DKG A;  1E1T A;  3TEH A;  4YRR A;  1Y96 B;  4M7D C;  1QF6 A;  2ZR2 A;  3L4G A;  1M5Q 1;  2ODR D;  1C0A A;  3HXX A;  5GAN 7;  3E9H A;  4M7D E;  2XTI A;  3I7F A;  2ZIO A;  1H4S A;  2Q7H A;  5LJ5 g;  4ZTZ B;  5LJ5 h;  4WF2 A;  3TEH B;  3V7C A;  3HTZ A;  2I4O A;  5LJ3 j;  4CS4 A;  3QO7 A;  3L4G B;  4M77 D;  4H02 A;  5GMK l;  4CH5 A;  4YCW A;  1B34 B;  4F7U G;  2ARU A;  3TEG A;  3EFR A;  5GAO n;  5LJ3 g;  2IY5 A;  4TTV A;  4YRS A;  5LJ3 h;  4YCV A;  2E1H A;  1JJC A;  2ARS A;  1ADJ A;  5F5W A;  2YHT A;  4M77 A;  2RB6 A;  4M78 G;  4C92 D;  5GAN 6;  3HXU A;  5GAN 4;  1YFR A;  1HXD A;  3JCM J;  2IY5 B;  3JB9 H;  4TVA A;  3QSU A;  4XU3 A;  3M4Q A;  3JCM X;  4M77 C;  4JRK A;  3HFN A;  1X54 A;  3QO5 A;  4M77 B;  3DSQ A;  1WQ7 A;  2DXU A;  1BBW A;  4J15 A;  1G5H A;  4XTV A;  3QNE A;  4XU1 A;  5GAM j;  4K86 A;  11AS A;  2DJZ A;  4C92 A;  4TVA B;  4YPF A;  3TUP A;  4M7A E;  1N9R A;  2EJF A;  1X55 A;  2EAY A;  1LNX A;  4YRN A;  5GAM g;  4C92 C;  2ZIM A;  1WYD A;  3HFV A;  2ZCE A;  4XEM A;  2ZZF A;  3HXW A;  4M7D G;  4X5O A;  5ELO A;  3LSS A;  4C92 B;  2CJA A;  4H2V A;  2DTH A;  4C8Q D;  3A5Z A;  2AMC A;  5GAO q;  4WJ3 M;  1EOV A;  4J5Y A;  2ZXF A;  5GAO m;  4EX5 A;  4WJ4 A;  3FB9 A;  2VXF A;  2DU7 A;  4PJO D;  1EFW A;  4EMK A;  2I2L A;  1U1S A;  1E22 A;  3HRK A;  3JB9 J;  4K87 A;  3FJP A;  3JCM W;  1D3B A;  4A54 A;  2CJB A;  3ICA A;  1X01 A;  3VU3 C;  4NOY A;  2HNI A;  4YRI A;  3RES A;  3V8J A;  1YGB A;  4C8Q A;  4H2X B;  4CS2 A;  3V8L A;  4EMK B;  5GAO p;  2ZZE A;  4KR3 A;  2ZR3 A;  4CH6 A;  2FYK A;  1ASY A;  2AKW B;  2ZT5 A;  2ZTG A;  4G84 A;  4PJO A;  1D3B B;  4XTU A;  2I4M A;  4C8Q C;  1IL2 A;  3V7S A;  5K1X A;  1YFS A;  2PME A;  4CH3 A;  4C8Q B;  3HFZ A;  2QHU A;  4PJO C;  4YRK A;  4F7U F;  5GAN e;  3UFG A;  5I21 A;  1B7Y A;  4PJO B;  3V7R A;  4UP7 A;  4M75 E;  3BY7 A;  4ZIB A;  4P71 A;  1LYL A;  3RF1 A;  3UH0 A;  5KNN A;  4UP8 A;  2XGT A;  3HFZ B;  1U1T A;  1NYR A;  3VQV A;  4N0A A;  4EMH A;  2CGH A;  3KFU A;  4M78 F;  4YRO A;  4NL3 A;  2QTX A;  1G5I A;  4M7A G;  4NL2 A;  4TQD A;  2ZNI A;  2EL9 A;  5HGQ A;  5GMK e;  3GIB A;  3JCM g;  1I4K 1;  3REU A;  3JCM h;  4ZTU B;  3NEN A;  1KQ2 A;  2DQ3 A;  1NNH A;  2Y90 A;  3RKY A;  1USY A;  2Q5H A;  3V8K A;  4OP0 A;  1SRY A;  1N9S A;  2EJ9 A;  5GAO r;  3INZ A;  3JCM b;  3SB2 A; 
#chains in the Genus database with same CATH topology
 3OYC A;  3QII A;  2E5K A;  2JS0 A;  1NJ6 A;  2YDL A;  4XTW A;  1VQ7 T;  4M7D F;  3PMT A;  3RER A;  3MF2 A;  3A1P A;  3CCJ A;  3E9F A;  2CUD A;  1M1K R;  2K57 A;  2AT1 B;  4R56 A;  1BIB A;  4XU2 A;  3A7R A;  2OTL A;  4RQE A;  3CPW S;  3G1Z A;  5I22 A;  1WX6 A;  3M4G A;  1VQP A;  1ZLM A;  4J9G A;  2XIC A;  1G2B A;  5GAN f;  4P3P A;  4XEO A;  4TVW A;  2E3I A;  3QBY A;  4MZP A;  1KQ1 A;  4YRJ A;  1H92 A;  1E24 A;  3CCJ T;  4P3N A;  2J6O A;  4RG8 A;  1R0B G;  2M0Y A;  1QKW A;  3G4S T;  3IKL A;  4LDV A;  2OTL T;  1OPK A;  2YUP A;  4C92 E;  3CCL Q;  1VQP T;  2GCX A;  1VQN Q;  4OB2 B;  2CSI A;  1MGQ A;  4NS5 A;  1RAF B;  3CBO A;  5GAO l;  3HXY A;  2J3L A;  2AZS A;  4LVM A;  1HD3 A;  3PE0 A;  3UT1 A;  2Y4Y A;  2KGT A;  2MOX A;  3CCU Q;  3AHU A;  1EZZ B;  1UGR B;  1X75 C;  2O01 E;  1PRM C;  4J8O A;  4FW1 A;  3TSZ A;  3HTR A;  1FXX A;  3RKX A;  4O2D A;  4M78 D;  5C53 B;  1EX4 A;  3M9Q A;  4H2W A;  4BWA A;  4CS3 A;  2ATC B;  4MMK A;  4HVW A;  2CP7 A;  4E7L A;  4P72 A;  4P75 A;  3CC7 T;  3EFS A;  3G6E T;  2A36 A;  5HK3 A;  2K7A A;  2JTF A;  2GF7 A;  1SRM A;  3L2Q A;  1PC0 A;  2QHT A;  3MPU B;  4A4F A;  1B7Y B;  3REX A;  2LC4 A;  3A7A A;  1E1O A;  1WIE A;  4LE9 A;  3UPU A;  4IIO A;  1GXI E;  4K88 A;  4C92 G;  4FW2 A;  3IQL A;  5FLX E;  2IIM A;  2LTO A;  1KD1 U;  4P73 A;  1M90 C;  1EVK A;  2O9V A;  1NPR A;  1Y71 A;  1RUW A;  1X43 A;  5C6S A;  4LXC A;  1YHQ A;  5FRN A;  1CKB A;  1QKX A;  2BTT A;  2LT1 A;  4RCC A;  3VYG A;  2LX7 A;  2F2X A;  4P3O A;  3HSB A;  4P74 A;  2ZT7 A;  2QDL A;  2XG8 D;  2DRM A;  2KAF A;  1MMN A;  2LCS A;  2QHS A;  3UWN A;  3P8V A;  5C52 B;  2DDZ A;  1BI0 A;  1AWX A;  1C1A A;  2HL5 C;  4E7H A;  4UPA A;  1B34 A;  3JCM Q;  2KT1 A;  2VC8 A;  4EPC A;  1Q86 U;  1SSF A;  4IUU A;  1OI1 A;  5GAN j;  4LDX A;  2ENM A;  1UEB A;  2DD4 A;  1X69 A;  2GTJ A;  3A5Y A;  4V2S A;  4YRT A;  5LJ3 f;  4ZGE B;  1B07 A;  1BI2 A;  3OYN A;  3QDR B;  2FVU A;  2ZPG B;  5GAN g;  1SES A;  4AFZ C;  4EMG A;  4DBF A;  1IRE B;  2BZX A;  2DXT A;  4YYE A;  5GMK j;  1JO8 A;  2ZT8 A;  2XK0 A;  4XAX B;  3DB3 A;  1QQJ A;  3QDF A;  3VS2 A;  5GAN 3;  2DVJ A;  3MF1 A;  1AEY A;  1Z7M A;  1MND A;  1TS9 A;  4Z02 A;  4HWP A;  5CAI A;  3R07 A;  1Y7X A;  3NET A;  1M1F A;  3ULR B;  1VQ7 Q;  1JXO A;  4YP0 A;  3HY0 A;  3JCM e;  2DRK A;  4M7A C;  5KH6 A;  1UHC A;  1XTD A;  1YBY A;  3L2Z A;  4ELY C;  2YRD A;  5GAM f;  3M0U A;  1H8K A;  4LUD A;  2HBP A;  3G71 A;  2C8M A;  8AT1 B;  1VQO T;  1LJO A;  4C92 F;  1PKT A;  3VJP A;  5K1P A;  2RHU A;  1YI2 T;  3DKM A;  5J39 A;  3VQW A;  3ZEH A;  4H2Y A;  1UEC A;  5HKC A;  2RNA A;  3ZFJ A;  5IT9 E;  4X1V A;  4EO4 A;  2Y4X A;  5CKF A;  3FRN A;  1MMA A;  4FYV B;  2BKD N;  1WJR A;  2M02 A;  1NLO C;  3D7S B;  3M55 A;  1KD1 R;  1GFD A;  3CCS A;  3VS4 A;  3MEA A;  3G4S Q;  2YRC A;  2DZ9 A;  4RKU E;  1KG1 A;  4J9E A;  1BIA A;  2P4T A;  3FDR A;  1VQP Q;  2ZAE A;  3OYG A;  4M75 C;  4RTV A;  2DM1 A;  1QCF A;  3OS1 A;  4ZTF A;  1YJ9 Q;  2CJ9 A;  1K9M C;  2I4N A;  1MUZ A;  1Y96 A;  1NJ8 A;  2M16 A;  1WXB A;  4LNP A;  4QKU A;  5L8R E;  1Q86 R;  3X28 B;  3JSC A;  3A31 A;  4H2T A;  2RHI A;  2A7Y A;  4O6J A;  5DY9 A;  5KYU B;  1BKB A;  1VQ8 A;  4KUD K;  2DKG A;  1I0C A;  2HDA A;  2FPD A;  1Y96 B;  4M7D C;  3L4G A;  4B6M A;  1YJW T;  5GAN 7;  1DJ7 B;  2ED0 A;  1PG5 B;  1U3O A;  1YP5 A;  3CC7 Q;  3G6E Q;  2KEA A;  5LJ3 j;  3L4G B;  4KH1 B;  2HEQ A;  1M4Z A;  5CIU A;  1Q81 U;  3OSS C;  2FRY A;  1K1Z A;  3QZ5 B;  5CK9 A;  4HVU A;  4E47 A;  4E6R A;  1PRL C;  2VAS A;  2QQA A;  3QJ6 A;  1VQK A;  2FZG B;  5GAO n;  3S3N A;  5LJ3 g;  3JRZ A;  1ZQ1 A;  1VQ8 T;  4VUB A;  3MP8 A;  3CPF A;  1ADJ A;  5F5W A;  1E7O A;  2ZPI B;  3EG2 A;  3PFS A;  4ELZ C;  1X6O A;  2EFI A;  4C92 D;  4N4I A;  5KYX B;  1BCO A;  3OYK A;  2EVR A;  2K5F A;  4AFS C;  3M4Q A;  1VQL A;  2EGE A;  3VV0 A;  4ANJ A;  1K73 C;  2DXU A;  1CSK A;  4J9C A;  3OSV A;  3QNE A;  5GAM j;  1K8A C;  1YCS B;  4DEY A;  2DK3 A;  1PD0 A;  1Z9Z A;  3GF5 A;  3QJY A;  3EGX A;  1VQK T;  3TUP A;  4M7A E;  1VOM A;  4OF1 A;  3ZBD A;  3UA7 A;  2VB6 A;  2JNG A;  5GAM g;  3OS0 A;  4KH0 B;  1ACM B;  3JV3 A;  1TWB A;  4XEM A;  3C94 A;  4TVR A;  2R57 A;  3LSS A;  1VQ9 A;  3OBW A;  4IKF A;  3LLR A;  4H2V A;  2R5M A;  5GAO q;  4LDW A;  4WJ3 M;  2E70 A;  3EGX B;  4J5Y A;  2EYY A;  4GLM A;  5GAO m;  4WJ4 A;  2VXF A;  2DU7 A;  2VWF A;  1VQL T;  2EW3 A;  2I2L A;  3HRK A;  4E7I A;  3JB9 J;  3FJP A;  2KR3 A;  1K0S A;  4NOY A;  5CQY A;  3RES A;  3REA B;  3V8J A;  3PMI A;  4C8Q A;  3LGL A;  5CCA A;  2EKO A;  1ZSG A;  5GAO p;  4KR3 A;  2FYK A;  5D7U A;  2QDY B;  3A98 A;  1YJN Q;  2I0N A;  2PME A;  3LWH A;  4C8Q B;  1VQ9 T;  2RQV A;  2F69 A;  3CCR T;  2K6D A;  4PJO C;  8ATC B;  4FT4 A;  2K5I A;  2LNV A;  2RQU A;  1OX8 A;  5I21 A;  2ROL A;  3V7R A;  2JS2 A;  2HMA A;  4M75 E;  1M30 A;  3OYY A;  4JJB A;  3PIP A;  1UE9 A;  3CCL A;  1G83 A;  1VQO Q;  3VQV A;  3I5R A;  3M0R A;  2CS7 A;  1VQN A;  3I55 Q;  2KRS A;  2CZ1 B;  4M7A G;  1YI2 Q;  1SSH A;  3E19 A;  4WTO B;  2XMF A;  1FMK A;  3CCU A;  1Q81 R;  2QEX T;  2COW A;  1QVF P;  1NNH A;  2DA9 A;  2ROT A;  2Y90 A;  3PT9 A;  2D8H A;  2ZZD A;  4OP0 A;  3NFC A;  2RHZ A;  1N9S A;  2EJ9 A;  3TU4 K;  2GBQ A;  3QYG B;  4KT0 E;  3OQ5 A;  1JJ2 A;  3CCL T;  2DX1 A;  2JTM A;  2QQB A;  4YRL A;  4DA4 A;  3TVT A;  3QTC A;  5IN1 A;  1FMV A;  4TWA A;  4X34 A;  1SET A;  3RGL A;  4BI3 A;  3UGT A;  3CEY A;  2YRV A;  5IHK A;  4DPG A;  1KMN A;  1MV3 A;  2LCC A;  2XKO C;  4ZGD B;  3OYD A;  4MML A;  1IRX A;  1NJ5 A;  2MIO A;  5HCK A;  5GJW B;  1NM7 A;  2LQK A;  4M75 G;  2X3W D;  3OMC A;  1OX9 A;  2D6F A;  3CCM T;  4FYX B;  3EG9 B;  1I81 A;  2FO0 A;  2RJD A;  2E65 A;  1YJW Q;  3S3O A;  2EKH A;  3OYH A;  3EGU A;  3MEY A;  1SG5 A;  5CKH A;  4YRC A;  3CCQ A;  5GAN d;  4O5V A;  5GAM h;  4M7A A;  4YRE A;  1NYQ A;  1SPK A;  3X25 B;  4L59 A;  4QVD A;  1M9S A;  2L0A A;  1S72 T;  1NJ2 A;  4M7A F;  1JQQ A;  3VS3 A;  1RLQ C;  3H8Z A;  4L5G A;  3CXC A;  2RQW A;  2DXB A;  4KR2 A;  1MNE A;  2XDP A;  5LJ5 e;  4PG3 A;  4BDY A;  3ERR A;  3P8T A;  4HWR A;  2CYZ B;  4RQF A;  1JJ2 S;  2YXY A;  2OTJ T;  2O2O A;  4J83 A;  2ALY A;  3CCQ T;  4JRP A;  4F7U A;  3EGD A;  2MPX C;  3NEM A;  4J6Y A;  1RAC B;  4PFZ A;  1WHG A;  2RD1 A;  1PHT A;  1SF9 A;  2ALY B;  1YFN A;  2COY A;  1GGM A;  4C5H A;  4M78 A;  4F7U B;  4PJO E;  2AHJ B;  3EGD B;  1YB3 A;  2PVD B;  2C7I A;  4MDX A;  1ARK A;  3L1A A;  1ZSZ A;  2W10 A;  4HT9 A;  1OZ2 A;  3LSQ A;  4HWS A;  2QGF B;  1VQ7 A;  3RMQ A;  4HVV A;  2NLU A;  3ME9 A;  2XI9 A;  4LN2 A;  4P71 C;  1ABQ A;  1UGS B;  2HL3 A;  1IGQ A;  4M78 B;  2LDM A;  3JCM c;  5CKE A;  1VIE A;  4M75 F;  2W0Z A;  1ZSZ B;  1VQL Q;  1I1J A;  3S6W A;  1KC8 C;  3OBY A;  2RHX A;  1D0Y A;  1NJ1 A;  3RBB B;  1ZX6 A;  3QWY A;  2DER A;  2PNI A;  1B3Q A;  2O4X B;  4M7D A;  1WNL A;  4ESR A;  2MK5 A;  3RDV A;  1GL5 A;  3MHX A;  2ZZG A;  1WGS A;  4YRF A;  3CXC S;  4BY6 C;  2NUZ A;  4YDQ A;  1VQ9 Q;  5GAN 5;  4M7D B;  2X51 A;  1L0W A;  3CCR Q;  3G7Z A;  1EIF A;  4BE2 A;  4PFO A;  1WU7 A;  3IAL A;  4HVC A;  4KQE A;  3G4S A;  4ME7 A;  2BZ8 A;  1QE0 A;  4BW9 A;  3M0Q A;  2B86 A;  1T3L A;  4J9D A;  3M57 A;  2MMP A;  3CBM A;  5FU6 C;  4AH6 A;  2GFA A;  4X9D A;  3UGQ A;  4FU6 A;  4PJO G;  2EQK A;  1YJ9 A;  4OB3 B;  2DYB A;  2FZK B;  4HCK A;  2B8A A;  5IXB A;  4M7A D;  2V1Q A;  1WHM A;  2QEX Q;  2ODR C;  3T9N A;  2GFU A;  1ASZ A;  3OW2 P;  1M2V A;  2MWP A;  5IHI A;  4RMO A;  2H8H A;  1T3S A;  2DJQ A;  4R0K A;  5LJ3 d;  3JB9 G;  1YN8 A;  3OY9 A;  4ZNX A;  3X20 B;  1AHJ B;  3SWN C;  2CT3 A;  2HAX A;  1VQM Q;  2FZC B;  4C5I A;  1GRI A;  4II1 A;  1M2V B;  5EG2 A;  3DLM A;  1B8A A;  1EQR A;  3CC7 A;  1G3Y A;  3G6E A;  4OVA A;  4QVC A;  2FPE A;  5CKD A;  1YJ9 T;  1QVG A;  2K3B A;  1H4T A;  1OPL A;  1ATI A;  5AYF A;  4X9C A;  1V1C A;  4OMF B;  1WHJ A;  1M3A A;  1O75 A;  3NEL A;  3HFO A;  1NJI C;  1MHN A;  3P8B B;  2EWN A;  2KRN A;  5D6X A;  2QA4 A;  3A32 A;  1YCY A;  1WFW A;  5AT1 B;  4H2X A;  2PUK B;  1Z7N A;  3W3S A;  4CH4 A;  2EGC A;  5GAM d;  4M75 D;  1TG0 A;  5IHN A;  5ECA A;  4Q15 A;  3CCM Q;  3OYE A;  4NCX A;  3LW5 E;  1IHV A;  2DFU A;  2IG0 A;  2EBP A;  2KI7 A;  2FG0 A;  4N4G A;  2KK4 A;  2HKN A;  1W2B P;  1B70 A;  2P0P A;  4RTY A;  4HCB A;  4F17 A;  4YTL A;  1G3S A;  2CP5 A;  2P0L A;  1J5W A;  2DL4 A;  2FEI A;  1X56 A;  4M7D D;  4BI8 B;  3RMS A;  3OD1 A;  2QA4 T;  1V29 B;  2YSQ A;  1VQ4 T;  4HT8 A;  2I4L A;  4PJO F;  1S72 Q;  1B70 B;  1K0X A;  4HXJ A;  4Y91 A;  5CVI A;  2RQT A;  2DIL A;  3GP8 A;  3JAM E;  2QQR A;  2DL5 A;  2JMA A;  5A0G A;  2RHY A;  2Q5I A;  2X9H A;  1VUB A;  4OLF A;  3M58 A;  3FEO A;  4J6X A;  4LNS A;  2YUO A;  5IXF A;  2CP6 A;  1RAG B;  1OYX A;  2OTJ Q;  2YLB A;  3JB9 F;  2E10 A;  3A8M B;  3QO8 A;  4Q6G A;  3TEH A;  4GLK A;  4YRR A;  3CCQ Q;  3BE3 A;  2FRW A;  4BAC A;  1QVG S;  1W4S A;  1X27 A;  1M90 R;  1C0A A;  3HXX A;  3E9H A;  1YIT Q;  1GBR A;  4ZGJ B;  2BE9 B;  4PFP A;  4KUI A;  3TEH B;  3EH2 A;  1OU8 A;  4FL6 A;  5KYY A;  1YJN A;  3E1S A;  3M0T A;  3HTZ A;  1H3H A;  2HKQ B;  1TUG B;  2JM8 A;  4JJD A;  1WJS A;  2QTV A;  4FCY A;  3HPW A;  3M56 A;  1B34 B;  5FU7 C;  1QCN A;  5HK0 A;  5KYN A;  3TEG A;  3MEU A;  2R5A A;  1A0N B;  2IY5 A;  4YCV A;  1D1B A;  4ZTJ A;  3OYI A;  1JJC A;  3MKD A;  1VQO A;  1NG2 A;  4A63 B;  3I55 A;  1BCM A;  4RTZ A;  2MAM A;  5GAN 6;  5KE2 A;  1YI2 A;  2COZ A;  3C12 A;  3M0P A;  3J81 E;  1HXD A;  3JCM J;  2IY5 B;  1K9A A;  3QSU A;  2PTK A;  4XU3 A;  3NTK A;  4M77 C;  4JRK A;  1Q82 U;  1YJN T;  3CD6 Q;  3QO5 A;  4PJM A;  3MEW A;  1WQ7 A;  4J15 A;  1G5H A;  3HL8 A;  2OJ2 A;  3VUB A;  2VKN A;  4C92 A;  2K2V A;  2ZPF B;  4PJN A;  1UG1 A;  4MZM A;  2QAZ A;  3CQT A;  2CH4 W;  3C4S A;  2EJF A;  1X55 A;  2LQN A;  2ZIM A;  2PU9 B;  4C92 B;  1N6A A;  3I55 T;  3CME T;  2CJA A;  2NS6 A;  4BE1 A;  2AMC A;  1KQS P;  1QW1 A;  4LVJ A;  2ZXF A;  2QQ9 A;  3VRY A;  4PJO D;  2ED1 A;  1E22 A;  4E7K A;  1Y07 A;  3QYH B;  4DEX A;  3TEE A;  1D3B A;  3VU3 C;  4GBQ A;  3VYH B;  4CS2 A;  2DIQ A;  5LL6 S;  3TRE A;  2A3L A;  4L6V 5;  1K8A U;  3QZ9 B;  2KVQ G;  4J9B A;  2ZT5 A;  2ZTG A;  1KD1 C;  5FRM A;  3CC2 Q;  1D3B B;  4XTU A;  2I4M A;  1IL2 A;  1YFS A;  2ESW A;  3VS7 A;  4EIK A;  1YJW A;  4CH3 A;  2HQX A;  4J7I A;  3HFZ A;  2XD0 A;  3KUF A;  4A4H A;  1X2K A;  2EYW A;  2V8K A;  5GAN e;  2K9G A;  3HRU A;  2VGM A;  2BE7 D;  2RMO A;  3BY7 A;  2WAC A;  4P71 A;  2HCK A;  5KNN A;  3RF1 A;  3UH0 A;  3VS1 A;  1QWE A;  2E3H A;  1AT1 B;  3HFZ B;  1U1T A;  1NZ9 A;  1PSF A;  4FSS A;  4EMH A;  3KFU A;  2EYX A;  2CDT A;  3QWX X;  4OGE A;  4MZT A;  1N8R U;  4LD6 A;  2EL9 A;  5HGQ A;  5GMK e;  2PZ1 A;  3JCM h;  3H41 A;  4ZTU B;  1K9M R;  1F1B B;  3NEN A;  2WSC E;  2DL7 A;  5FWB A;  3I5S A;  1LVK A;  1FMW A;  1JXM A;  2AZV A;  1SRY A;  2ZPE B;  5DM7 R;  4IUP A;  2A37 A;  2BZY A;  2QG9 B;  1AZG B;  4JS4 A;  2V26 A;  3SB2 A;  2V1R A;  3A8L B;  3FC3 A;  2O31 A;  4OMQ A;  2M0O A;  1Q82 R;  2QA4 Q;  1VQ4 Q;  1GCP A;  4LDY A;  2K79 A;  3M53 A;  1IGU A;  4RTT A;  1R77 A;  4PJL A;  1NEG A;  1D0X A;  2DL3 A;  5I11 A;  1X6G A;  2NUP A;  5I2S A;  2DIG A;  4AMC A;  4A4K A;  3UAT A;  1IZ6 A;  3VS6 A;  5GMK m;  4YRM A;  3P8D A;  1Q95 G;  1RL2 A;  2VYT A;  3JCM V;  1PKS A;  2PUO B;  2YUQ A;  5CKB A;  5KCO A;  3MCA B;  2RJE A;  2EQJ A;  4M77 E;  1UGQ B;  2E4H A;  3EAE A;  4DBH A;  3VQY A;  4WI1 A;  5A0D A;  2QQS A;  1KMM A;  1YFT A;  4TQF A;  4IIM A;  3PGG A;  3RNJ A;  4C5G A;  1U06 A;  1VYU A;  2PVG B;  2PMF A;  3X26 B;  2RI5 A;  3ASK A;  3RKW A;  1X2G A;  4C0Z A;  4ATO A;  3CCR A;  3FIF A;  1K8A R;  2L3R A;  2QGG A;  2DQ0 A;  1JRI A;  2XU8 A;  3G1J A;  4HWT A;  2M51 A;  4KUL A;  1T0J A;  2E6Z A;  3PZC A;  2LRQ A;  4K11 A;  4G85 A;  3RUX A;  4E7Z A;  3PCO A;  2KDS A;  4RMF A;  1ZUY A;  2DPP B;  2Q7G A;  3RIR A;  2DEU A;  3I56 A;  2L2P A;  1Y57 A;  1JU5 C;  1OEB A;  2K2M A;  3OYA A;  4DQ2 A;  3SFM A;  4BE0 A;  3KBG A;  2JM9 A;  4Z89 A;  2EQU A;  2ART A;  2QEX A;  3NHN A;  1ADY A;  1G51 A;  2FB7 A;  3BDU A;  2J3M A;  1IHW A;  1OZ3 A;  3E2U A;  1Q7Y C;  1N8R R;  2RO0 A;  5LJ3 e;  3JCM P;  4PHC A;  2RM4 A;  2A28 A;  4QW2 A;  2JTE A;  4A53 A;  3P8Y A;  2JW4 A;  3L2V A;  1VQM A;  1RAD B;  4M77 G;  4P75 C;  3BJU A;  2FL7 A;  1ZUK A;  2DL8 A;  2LNH B;  3RR6 A;  3CMA Q;  2X35 A;  3I56 T;  2MF2 A;  3CME Q;  3CCV A;  3CPW P;  1UFF A;  3PNW C;  2DAQ A;  4YRQ A;  4XU0 A;  2H3J A;  3GNF B;  2DEQ A;  1RI9 A;  4N0A C;  5C51 B;  3CC4 T;  1D09 B;  5FRO A;  1Z9Q A;  2HZY A;  1T0H A;  1RAI B;  1UGP B;  4YRG A;  5HY6 A;  3OS2 A;  4J7F A;  4L87 A;  1RIQ A;  3EG1 A;  2QAS A;  2NYS A;  2O88 A;  5GAM e;  4Q5W A;  4LVI A;  2GQV A;  3QUI A;  1GCQ C;  1VQM T;  3CCM A;  2OX7 A;  1D1C A;  3CMQ A;  4FSX A;  3L42 A;  5EC7 A;  4J6W A;  4D8D A;  2NWM A;  2V8J A;  1N9W A;  3Q1J A;  3CCV T;  3AT1 B;  2LJ1 A;  2CRE A;  1KOG A;  1V76 A;  4P74 C;  3A8H B;  2DLP A;  2XID A;  3FLG A;  3NTI A;  2A08 A;  3JCM d;  3RAC A;  4GY5 A;  4J9I A;  3ER0 A;  3TQ7 P;  1FYF A;  2DD5 A;  3A74 A;  1S72 A;  2Q7E A;  1ABO A;  2BUD A;  2E3C A;  4JS5 A;  2Z0W A;  5FU7 B;  1RAB B;  4HA8 A;  2E41 A;  1EFN A;  4QQG A;  1TUD A;  5FWC A;  5GMK i;  2RHQ A;  4DBQ A;  2P0K A;  4AG1 C;  2KNB B;  2JN0 A;  2ABL A;  4RTX A;  3RL6 A;  5A2Q E;  1KHI A;  1RAH B;  2OTJ A;  2QHV A;  2DTI A;  5A0L A;  1SKU B;  2L3Q A;  5CQX A;  4M77 F;  5GAN 8;  2AKL A;  3M59 A;  2RHQ B;  5L23 A;  3HHT B;  3VRZ A;  2HSE B;  1H4V B;  2CSQ A;  3MQZ A;  1YIT A;  1PD1 A;  1BI1 A;  2L3P A;  1OU9 A;  3HRI A;  2P0Q A;  4TVY A;  3M4Y A;  3EG0 A;  1WLE A;  1YIJ T;  4M7A B;  1NBE B;  2FHD A;  2CZ7 B;  2RHS A;  1CKA A;  2HQE A;  2RI2 A;  2DYI A;  2DU5 A;  1QWF A;  1TOV A;  1UJY A;  2R58 A;  1M3B A;  1SHG A;  2ZNJ A;  1WZO A;  3NTH A;  1ZBJ A;  2QXF A;  2RHS B;  2DF6 A;  2PQW A;  5ELN A;  2AKW A;  2AK5 A;  2JJ9 A;  3QHS A;  3IKM B;  1K76 A;  1YIT T;  2KRO A;  4JUV A;  2CUB A;  2VV5 A;  1RI0 A;  1UDL A;  3EG3 A;  5IAY A;  3CD6 A;  2F2V A;  1TH7 A;  2P5I A;  4AFU C;  1LCK A;  2DNU A;  4LUE A;  1MMD A;  4M75 A;  4ORZ A;  2C0O A;  2YT6 A;  4LVK A;  2OAU A;  1NYG A;  3VBB A;  1BBZ A;  2DE0 X;  2LT4 A;  1WI7 A;  1M8V A;  1G5V A;  1NJI U;  4QQ6 A;  4M75 B;  1UHF A;  4JJN K;  3NMZ C;  1BBU A;  1PM3 A;  1WJQ A;  2JMC A;  3HXV A;  3QPH A;  1AVZ C;  2CZ0 B;  3VQX A;  2D9T A;  4P5N A;  3JCM f;  1P92 A;  3VS0 A;  3CD6 T;  2JT4 A;  3BW1 A;  1TTH B;  2VXE A;  1E1T A;  1WXU A;  4KBM B;  3MJX A;  4F04 B;  1C0M A;  4HT4 A;  1QF6 A;  1M5Q 1;  2JXB A;  4JPB W;  3I7F A;  2L5Q A;  2ZIO A;  1H4S A;  5LJ5 h;  4WF2 A;  1M1K C;  4BB7 A;  3CC2 A;  1NLP C;  4RTU A;  3V7C A;  2YWW A;  2I4O A;  3QO7 A;  2EYZ A;  2XDB A;  4M77 D;  3HRS A;  5GMK l;  3U23 A;  1NE8 A;  2ZPH B;  2X4J A;  3I56 Q;  1M90 U;  2ARU A;  2J06 A;  4QVZ A;  3EFR A;  2LQW A;  2H3E B;  3CC4 Q;  4YRS A;  1BYM A;  2X4X A;  1SEM A;  1KFZ A;  2HSP A;  3GBQ A;  2RB6 A;  1VQ6 T;  2DMO A;  2BIV A;  1YFR A;  1WXT A;  4OMN A;  3UF4 A;  3JB9 H;  3P8H A;  1KJW A;  3CC2 T;  1QVF S;  1X54 A;  1D0Z A;  4JLG A;  3NGP A;  3QKJ A;  3M54 A;  1NYF A;  4JJC A;  4CC4 B;  1AZE A;  11AS A;  3SDZ A;  2CH4 A;  3CCV Q;  3OS5 A;  4YPF A;  1WA7 A;  3HRT A;  1M1G A;  1ZBX A;  5D6W A;  2DBK A;  2GQI A;  4ZN1 A;  2LQ8 A;  2EAY A;  4YRN A;  4AFQ C;  4F14 A;  2ZCE A;  4X5O A;  5ELO A;  2G3R A;  1K4U S;  1W6X A;  2OAW A;  2DTH A;  3A5Z A;  1VQ4 A;  3VS5 A;  1ZUU A;  4BDZ A;  1AWW A;  2KMT A;  5KCH A;  1EOV A;  3BDL A;  4EX5 A;  3FB9 A;  1VA7 A;  1EFW A;  1PNJ A;  4C0G A;  2J6F A;  4PK4 A;  5D6Y A;  9ATC B;  3DB4 A;  1O9S A;  3JCM W;  1AOJ A;  3J80 E;  2CKK A;  1FYN A;  3A5Z B;  3LYI A;  2CJB A;  2HQH A;  3ICA A;  2M1H A;  1NJI R;  1YGB A;  2LMJ A;  4H2X B;  4PLL A;  1RAE B;  3V8L A;  2ZZE A;  4CH6 A;  1ASY A;  3PVQ A;  4PJO A;  2HD0 A;  5CR2 A;  3QXE B;  4C8Q C;  3ZL7 C;  3TSW A;  2E5Q A;  4KGX B;  3WXM B;  2K5L A;  2LJ0 A;  4WCI A;  5DLO A;  2LX9 A;  3UFG A;  1B7Y A;  2VVK A;  4PJO B;  4UP7 A;  2P84 A;  3CCE A;  2F5T X;  2K3X A;  2NUT A;  1YIJ Q;  4ZIB A;  2EQM A;  4RG2 A;  4UP8 A;  3MO8 A;  1R8O B;  1KSW A;  4A4G A;  4N0A A;  1QCO A;  2EGA A;  2LP5 A;  4YRO A;  4NL3 A;  3MEV A;  1RAA B;  2QTX A;  4AT1 B;  4NL2 A;  5KE3 A;  2RJC A;  2NUT B;  2KE9 A;  4TQD A;  2KYM A;  1YWP A;  2IPO B;  4M4Z A;  4JDS A;  3JCM g;  1I4K 1;  4CC3 A;  2KBT A;  2X3X D;  1WLP B;  1HYO A;  2DQ3 A;  4JZ3 A;  2L8D A;  2RN8 A;  1IB8 A;  3RKY A;  1GCQ A;  4Z8A A;  1TUC A;  1I07 A;  1U5S A;  2KXD A;  3CCE T;  1VQ5 Q;  3EFO A;  1M27 C;  3INZ A;  3JCM b;  2KRM A;  1WHL A;  3S3M A;  1K9M U;  3WVE B;  2MYS A;  4XQ3 A;  2X4W A;  4HCC A;  4OMM A;  5KYY B;  4B9X A;  3OW2 A;  1I5L A;  1VQZ A;  3EFO B;  4OMP A;  2YLC A;  4IUV A;  3HXZ A;  4AG2 C;  1GBQ A;  1UGV A;  1Y0M A;  2KQW A;  4PNO A;  3CMA A;  1PSE A;  1BK2 A;  2JOY A;  3O8V A;  2WSE E;  3CME A;  3LC0 A;  2RK1 A;  1XNI A;  1D1A A;  3X24 B;  5LJ5 d;  1YHQ T;  3MP1 A;  1JJC B;  1KHC A;  2F5K A;  1YNZ A;  4JRQ A;  1MMG A;  1X2Q A;  2MWO A;  3UDC A;  1SHF A;  4PJJ A;  1QP2 A;  5J26 A;  3GOX A;  2QYZ A;  1G8X A;  1OOT A;  3BFM A;  4CRI A;  3OMG A;  2EJG A;  1HSQ A;  1M2O A;  1R0C B;  3M4P A;  3CMA T;  1IXD A;  3REB B;  3CBP A;  3THK A;  5GAN 2;  1HC7 A;  3SD4 A;  1OUL A;  2K4Y A;  3QG1 A;  3C0C A;  1TXQ A;  3H0F A;  1HJD A;  4YRP A;  4ZN3 A;  1QLY A;  3IG2 A;  4C0D C;  1B7T A;  1W2B A;  3OYJ A;  2AMC B;  4QT7 A;  2CP3 A;  1K73 U;  1M8M A;  4EMK C;  3PTA A;  1VQ6 Q;  4LVL A;  2K3Y A;  1N5Z A;  1JBM A;  1H4Q A;  4EDU A;  1J3T A;  4BD3 A;  3JB9 D;  2AKK A;  3OW2 S;  2ZPB B;  1WPY A;  4OML A;  4RDX A;  1M3C A;  4C8Q E;  3L2U A;  2VGN A;  1N27 A;  4B9W A;  3CCJ Q;  2DTO A;  3E9G A;  2ZIN A;  4OB1 B;  2VUB A;  1WHK A;  4FT2 A;  3G71 T;  1HTT A;  2OTL Q;  2KT8 A;  4M78 C;  3URG A;  1Q86 C;  1ZSZ C;  4F16 A;  3WQZ A;  2JUF A;  4KGV B;  1WDX A;  3O5Z A;  2J6K A;  1PCX A;  1VYT A;  1PYS A;  5KYU A;  2JZ2 A;  2RH2 A;  1BI3 A;  1I5O B;  3GLX A;  2DO3 A;  1ZA2 B;  4UP9 A;  3FJ5 A;  1Q7Y U;  1U8R A;  4XTX A;  4JRI A;  4MDW A;  1KIK A;  1PYS B;  5M9O A;  1USY C;  3CCS T;  1AWJ A;  3R6N A;  1S1N A;  12AS A;  5LJ5 f;  4RUG A;  4BY6 B;  2AIR B;  1W2B S;  1Q82 C;  2ZGW A;  3DLL A;  1PWT A;  4DOW A;  2D0N A;  3H6Z A;  1WQW A;  2DVE A;  2DZC A;  1ZA1 B;  3C95 A;  5E3I A;  2EIF A;  4C8Q G;  3OYF A;  1X2H A;  3OYL A;  2LZ6 B;  2LJ3 A;  3LGF A;  2RJF A;  2RA2 A;  4YCU A;  1H64 1;  5FU6 B;  1X6B A;  1I8F A;  4E51 A;  2XDD A;  2NUP B;  5KYX A;  5C0M A;  3LWI A;  1JJ2 P;  2E64 A;  2RK2 A;  4XTY A;  1B76 A;  5GAN h;  2E6N A;  5KYW A;  1MV0 B;  2XHC A;  4N4H A;  4PLI A;  3SWN A;  3F70 A;  1RLP C;  2HBW A;  3L2W A;  4H2U A;  2CIM A;  3OYB A;  2L89 A;  1NEB A;  1KQS A;  2J05 A;  3CCE Q;  4HWO A;  3LH5 A;  1K73 R;  1C6V X;  5KYW B;  3OYM A;  4CC2 A;  1G3W A;  3SWN B;  3LH0 A;  5GMK h;  2ZT6 A;  1EVL A;  3PIO A;  1UJ0 A;  3HY1 A;  4OGC A;  2MI6 A;  2ECZ A;  4E7S A;  4RTW A;  4PL6 A;  2FPF A;  3WVD B;  4A4E A;  4R55 A;  1QVP A;  2GTO A;  4OB0 B;  3TCJ A;  2D8J A;  1W1F A;  2D1X A;  2JVV A;  1QP3 A;  1WHH A;  1W66 A;  3PCO B;  4Y28 E;  1YHQ Q;  3CC4 A;  5IH2 A;  4XTZ A;  4H2S A;  1QMC A;  2C0T A;  1HK9 A;  2RI3 A;  1OV3 A;  1AD5 A;  3CXC P;  1N8R C;  2C06 A;  4RCB A;  3KFV A;  3R6O A;  2RQR A;  3EHQ A;  3A7U A;  3H9N A;  4F7U E;  2A8E A;  4P72 C;  1EIY A;  4CC7 A;  2GGR A;  4C8Q F;  1AWO A;  1Q7Y R;  3H0H A;  2EYQ A;  4M78 E;  2WSF E;  1TU0 B;  4HCZ A;  1SER A;  1VIF A;  1EIY B;  4JLI A;  3PVL A;  7AT1 B;  3I35 A;  1Q81 C;  1GFC A;  2G6F X;  3A8O B;  3HKS A;  2SRC A;  1KQS S;  2GNC A;  2L3S A;  3JB9 I;  1E6G A;  2G4C A;  1OQK A;  1LOJ A;  3E9I A;  2CP0 A;  3MET A;  3OA6 A;  3H0I A;  2CZ6 B;  1VYV A;  2EPD A;  4E7J A;  2E5A A;  4P73 C;  3QO3 A;  5LJ5 j;  2KSS A;  1ZHI A;  3UA6 A;  1E6H A;  2ZR2 A;  4KGZ B;  1UB4 A;  1XOV A;  2ODR D;  3J7A F;  1IO6 A;  2YUN A;  5J3B A;  4M7D E;  1H3Z A;  2X4Y A;  2XTI A;  2Q7H A;  5LJ5 g;  4ZTZ B;  3I9Q A;  5FW9 A;  1JB0 E;  4CS4 A;  2MCN A;  2IVW A;  3G71 Q;  1YWO A;  1JEG A;  1NPP A;  1KC8 U;  4H02 A;  4CH5 A;  1VQN T;  4YCW A;  4F7U G;  1KK7 A;  1WYX A;  3L2R A;  3HP9 A;  1YIJ A;  4DBR A;  2DBM A;  4TTV A;  5LJ3 h;  2E1H A;  2ARS A;  2YHT A;  3CCU T;  4IUQ A;  5DLQ E;  4M77 A;  3LX7 A;  4M78 G;  3HXU A;  3M5A A;  5GAN 4;  2P4R A;  3EG9 A;  1LPL A;  4FYY B;  4Z88 A;  4TVA A;  3EH1 A;  2O9S A;  3JCM X;  2QI2 A;  3HFN A;  1G3T A;  1FX7 A;  1XQH A;  4M77 B;  1M1K U;  3DSQ A;  3CCS Q;  1BB9 A;  4IUR A;  2CT4 A;  4D6W A;  4XTV A;  1BBW A;  4XU1 A;  4K86 A;  1SRL A;  3NPF A;  2DJZ A;  1FWZ A;  4TVA B;  4BUG A;  3SHW A;  1VQ5 A;  2KXC A;  4IUT A;  2F2W A;  4LDU A;  1N9R A;  1LNX A;  1UUE A;  2KY9 A;  4PKC C;  4C92 C;  3HFV A;  1WYD A;  4QQD A;  4JZ4 A;  2ZZF A;  4FM4 B;  3N5B B;  4M7D G;  3HXW A;  4E2F B;  2CP2 A;  4C8Q D;  3VUZ A;  2DET A;  3A8G B;  2A0F B;  3MP6 A;  2LCL A;  4XK8 E;  3EHR A;  4EMK A;  1U1S A;  4K87 A;  1VQ8 Q;  1XJW B;  4D8K A;  4A54 A;  2M9U A;  1X01 A;  4C0D B;  2HNI A;  4YRI A;  5GJV B;  3GNG A;  1QVG P;  4C0F A;  4KRT A;  1VQ5 T;  3VKI A;  4EMK B;  4Y92 A;  2ZR3 A;  3CPW A;  2AKW B;  4G84 A;  6AT1 B;  3OB9 A;  2D0Q B;  3V7S A;  5K1X A;  1UTI A;  4FYW B;  2SEM A;  2RF0 A;  2V8I A;  1QVF A;  2QHU A;  2KYB A;  4YRK A;  4F7U F;  3KXT A;  4CI0 C;  2F1L A;  2RPN A;  2PVO B;  4LD9 K;  2QK0 A;  1VQK Q;  1TSF A;  1LYL A;  2XGT A;  4OMO A;  4HKE A;  2DXC A;  2EQI A;  1NYR A;  1BU1 A;  2J7I A;  2CGH A;  4M78 F;  4FIB A;  1G5I A;  4J9H A;  2E12 A;  4J9F A;  1W70 A;  2ZNI A;  2C0I A;  2O4X A;  3GPL A;  5CO7 A;  1KC8 R;  3GIB A;  3REU A;  5I2M A;  3SEM A;  4C5E A;  1KQ2 A;  1VQ6 A;  4BI4 A;  2LVM A;  2ZCF B;  4UC4 A;  1USY A;  2Q5H A;  3V8K A;  2OI3 A;  5GAO r;  3M0S A;  4DOV A; 
#chains in the Genus database with same CATH homology
 3OYC A;  3QII A;  1NJ6 A;  4XTW A;  1VQ7 T;  4M7D F;  3PMT A;  3RER A;  3MF2 A;  3CCJ A;  3E9F A;  2K57 A;  4R56 A;  1BIB A;  4XU2 A;  3A7R A;  2OTL A;  4RQE A;  3CPW S;  3G1Z A;  3M4G A;  1VQP A;  2XIC A;  4P3P A;  5GAN f;  4XEO A;  4TVW A;  3QBY A;  4MZP A;  1KQ1 A;  4YRJ A;  1E24 A;  3CCJ T;  4P3N A;  4RG8 A;  3G4S T;  3IKL A;  4LDV A;  2OTL T;  4C92 E;  1VQP T;  2GCX A;  4OB2 B;  1MGQ A;  4NS5 A;  3CBO A;  5GAO l;  3HXY A;  2J3L A;  4LVM A;  3UT1 A;  2Y4Y A;  3AHU A;  1UGR B;  1X75 C;  2O01 E;  4J8O A;  1FXX A;  3RKX A;  4O2D A;  4M78 D;  5C53 B;  3M9Q A;  4H2W A;  4BWA A;  4CS3 A;  4MMK A;  4E7L A;  4P72 A;  4P75 A;  3CC7 T;  3EFS A;  3G6E T;  5HK3 A;  2JTF A;  2GF7 A;  3L2Q A;  2QHT A;  4A4F A;  1B7Y B;  3REX A;  2LC4 A;  3A7A A;  1E1O A;  3UPU A;  1GXI E;  4K88 A;  4C92 G;  5FLX E;  2LTO A;  1KD1 U;  4P73 A;  1M90 C;  1EVK A;  1NPR A;  1Y71 A;  1YHQ A;  5C6S A;  5FRN A;  3VYG A;  2LT1 A;  4RCC A;  4P3O A;  3HSB A;  4P74 A;  2ZT7 A;  2XG8 D;  2KAF A;  2QHS A;  3UWN A;  3P8V A;  5C52 B;  2DDZ A;  1BI0 A;  4E7H A;  4UPA A;  1B34 A;  3JCM Q;  4EPC A;  2VC8 A;  1Q86 U;  1SSF A;  4IUU A;  1OI1 A;  5GAN j;  4LDX A;  1UEB A;  2DD4 A;  3A5Y A;  4V2S A;  4YRT A;  5LJ3 f;  4ZGE B;  1BI2 A;  3OYN A;  3QDR B;  2FVU A;  2ZPG B;  5GAN g;  1SES A;  4EMG A;  1IRE B;  2DXT A;  4YYE A;  5GMK j;  2ZT8 A;  2XK0 A;  4XAX B;  3DB3 A;  5GAN 3;  3MF1 A;  1Z7M A;  4Z02 A;  4HWP A;  5CAI A;  3R07 A;  1Y7X A;  3NET A;  1M1F A;  4YP0 A;  3HY0 A;  3JCM e;  4M7A C;  5KH6 A;  1XTD A;  1YBY A;  3L2Z A;  4ELY C;  5GAM f;  2HBP A;  3G71 A;  2C8M A;  1VQO T;  1LJO A;  4C92 F;  3VJP A;  5K1P A;  2RHU A;  1YI2 T;  3DKM A;  5J39 A;  3VQW A;  3ZEH A;  4H2Y A;  5HKC A;  3ZFJ A;  5IT9 E;  4EO4 A;  2Y4X A;  5CKF A;  3FRN A;  2BKD N;  1WJR A;  3M55 A;  3CCS A;  3MEA A;  2DZ9 A;  4RKU E;  1KG1 A;  1BIA A;  2P4T A;  3FDR A;  3OYG A;  4M75 C;  3OS1 A;  4ZTF A;  2CJ9 A;  1K9M C;  2I4N A;  1Y96 A;  1NJ8 A;  2M16 A;  5L8R E;  3X28 B;  3JSC A;  3A31 A;  4H2T A;  2RHI A;  2A7Y A;  4O6J A;  5DY9 A;  1BKB A;  1VQ8 A;  4KUD K;  2DKG A;  1Y96 B;  4M7D C;  3L4G A;  1YJW T;  5GAN 7;  1DJ7 B;  5LJ3 j;  3L4G B;  1M4Z A;  5CIU A;  1Q81 U;  3OSS C;  3QZ5 B;  5CK9 A;  4E47 A;  2QQA A;  3QJ6 A;  1VQK A;  3S3N A;  5GAO n;  5LJ3 g;  3JRZ A;  1ZQ1 A;  1VQ8 T;  4VUB A;  3MP8 A;  3CPF A;  1ADJ A;  5F5W A;  2ZPI B;  3PFS A;  4ELZ C;  1X6O A;  2EFI A;  4C92 D;  4N4I A;  3OYK A;  2K5F A;  3M4Q A;  1VQL A;  3VV0 A;  1K73 C;  2DXU A;  3OSV A;  3QNE A;  5GAM j;  1K8A C;  2DK3 A;  3GF5 A;  3QJY A;  1VQK T;  3TUP A;  4M7A E;  3ZBD A;  4OF1 A;  2JNG A;  5GAM g;  3OS0 A;  4XEM A;  3C94 A;  4TVR A;  2R57 A;  3LSS A;  1VQ9 A;  3OBW A;  4IKF A;  3LLR A;  4H2V A;  2R5M A;  5GAO q;  4LDW A;  4WJ3 M;  2E70 A;  4J5Y A;  5GAO m;  4WJ4 A;  2VXF A;  2DU7 A;  1VQL T;  2I2L A;  3HRK A;  4E7I A;  3JB9 J;  3FJP A;  4NOY A;  5CQY A;  3RES A;  3V8J A;  3PMI A;  4C8Q A;  3LGL A;  5CCA A;  2EKO A;  5GAO p;  4KR3 A;  2FYK A;  2QDY B;  2PME A;  3LWH A;  4C8Q B;  1VQ9 T;  2F69 A;  3CCR T;  4PJO C;  4FT4 A;  2K5I A;  2LNV A;  5I21 A;  3V7R A;  4M75 E;  3OYY A;  3PIP A;  3CCL A;  3VQV A;  1VQN A;  2CS7 A;  2CZ1 B;  4M7A G;  3E19 A;  3CCU A;  2QEX T;  1NNH A;  2Y90 A;  3PT9 A;  2ZZD A;  4OP0 A;  3NFC A;  2RHZ A;  1N9S A;  2EJ9 A;  3TU4 K;  3QYG B;  4KT0 E;  3OQ5 A;  1JJ2 A;  3CCL T;  2JTM A;  2QQB A;  4YRL A;  4DA4 A;  3QTC A;  5IN1 A;  4TWA A;  4X34 A;  1SET A;  3RGL A;  4BI3 A;  3UGT A;  3CEY A;  2YRV A;  4DPG A;  1KMN A;  2LCC A;  2XKO C;  4ZGD B;  3OYD A;  4MML A;  1NJ5 A;  2LQK A;  4M75 G;  3OMC A;  2D6F A;  3CCM T;  1I81 A;  2RJD A;  2E65 A;  3S3O A;  3OYH A;  3MEY A;  5CKH A;  4YRC A;  3CCQ A;  5GAN d;  4O5V A;  5GAM h;  4M7A A;  4YRE A;  1NYQ A;  3X25 B;  4L59 A;  4QVD A;  1M9S A;  1S72 T;  1NJ2 A;  4M7A F;  3H8Z A;  3CXC A;  4L5G A;  2DXB A;  4KR2 A;  2XDP A;  5LJ5 e;  4PG3 A;  4BDY A;  3ERR A;  3P8T A;  4HWR A;  2CYZ B;  4RQF A;  1JJ2 S;  2OTJ T;  4J83 A;  2ALY A;  3CCQ T;  4JRP A;  4F7U A;  3NEM A;  4J6Y A;  2RD1 A;  2ALY B;  1GGM A;  4C5H A;  4M78 A;  4F7U B;  4PJO E;  2AHJ B;  1YB3 A;  2PVD B;  2C7I A;  4MDX A;  3L1A A;  4HT9 A;  3LSQ A;  1OZ2 A;  4HWS A;  1VQ7 A;  3RMQ A;  2NLU A;  3ME9 A;  2XI9 A;  4P71 C;  1UGS B;  4M78 B;  3JCM c;  2LDM A;  5CKE A;  1VIE A;  4M75 F;  3S6W A;  1KC8 C;  3OBY A;  2RHX A;  1NJ1 A;  2O4X B;  4M7D A;  1WNL A;  3MHX A;  2ZZG A;  1WGS A;  4YRF A;  3CXC S;  4BY6 C;  4YDQ A;  5GAN 5;  4M7D B;  1L0W A;  3G7Z A;  1EIF A;  4BE2 A;  1WU7 A;  3IAL A;  4HVC A;  4KQE A;  3G4S A;  4ME7 A;  1QE0 A;  4BW9 A;  3M57 A;  2MMP A;  3CBM A;  5FU6 C;  4AH6 A;  2GFA A;  4X9D A;  3UGQ A;  4FU6 A;  4PJO G;  2EQK A;  1YJ9 A;  4OB3 B;  2B8A A;  4M7A D;  2ODR C;  3T9N A;  2GFU A;  1ASZ A;  2MWP A;  4RMO A;  5LJ3 d;  3JB9 G;  3OY9 A;  3X20 B;  1AHJ B;  3SWN C;  2HAX A;  4C5I A;  4II1 A;  5EG2 A;  3DLM A;  1B8A A;  1EQR A;  3CC7 A;  1G3Y A;  3G6E A;  4OVA A;  4QVC A;  5CKD A;  1YJ9 T;  1QVG A;  1H4T A;  1ATI A;  5AYF A;  4X9C A;  4OMF B;  1O75 A;  3NEL A;  3HFO A;  1NJI C;  1MHN A;  3P8B B;  2EWN A;  5D6X A;  2QA4 A;  3A32 A;  1YCY A;  4H2X A;  2PUK B;  1Z7N A;  3W3S A;  4CH4 A;  5GAM d;  4M75 D;  4Q15 A;  3OYE A;  4NCX A;  3LW5 E;  2IG0 A;  4N4G A;  2KK4 A;  1B70 A;  2P0P A;  4HCB A;  4YTL A;  1G3S A;  2P0L A;  1J5W A;  1X56 A;  4M7D D;  4BI8 B;  3RMS A;  3OD1 A;  2QA4 T;  1V29 B;  1VQ4 T;  4HT8 A;  2I4L A;  4PJO F;  1B70 B;  4Y91 A;  5CVI A;  3GP8 A;  3JAM E;  2QQR A;  5A0G A;  2RHY A;  2Q5I A;  1VUB A;  4OLF A;  3M58 A;  3FEO A;  4J6X A;  4LNS A;  1OYX A;  2YLB A;  3JB9 F;  2E10 A;  3A8M B;  3QO8 A;  4Q6G A;  3TEH A;  4GLK A;  4YRR A;  4BAC A;  1QVG S;  1W4S A;  1C0A A;  3HXX A;  3E9H A;  4ZGJ B;  4KUI A;  3TEH B;  4FL6 A;  1YJN A;  3E1S A;  3HTZ A;  1WJS A;  3HPW A;  3M56 A;  1B34 B;  5FU7 C;  5HK0 A;  3TEG A;  3MEU A;  2R5A A;  2IY5 A;  4YCV A;  4ZTJ A;  3OYI A;  1JJC A;  1VQO A;  3I55 A;  5GAN 6;  2MAM A;  5KE2 A;  1YI2 A;  3C12 A;  3J81 E;  1HXD A;  3JCM J;  2IY5 B;  3QSU A;  4XU3 A;  3NTK A;  4M77 C;  4JRK A;  1Q82 U;  1YJN T;  3QO5 A;  3MEW A;  1WQ7 A;  4J15 A;  1G5H A;  3HL8 A;  3VUB A;  4C92 A;  2K2V A;  2ZPF B;  4MZM A;  3C4S A;  2EJF A;  1X55 A;  2ZIM A;  2PU9 B;  4C92 B;  1N6A A;  2CJA A;  3I55 T;  3CME T;  2NS6 A;  2AMC A;  4BE1 A;  1QW1 A;  4LVJ A;  2ZXF A;  2QQ9 A;  4PJO D;  1E22 A;  4E7K A;  1Y07 A;  3QYH B;  3TEE A;  1D3B A;  3VU3 C;  3VYH B;  4CS2 A;  2DIQ A;  5LL6 S;  3TRE A;  2A3L A;  4L6V 5;  1K8A U;  3QZ9 B;  2KVQ G;  2ZT5 A;  2ZTG A;  1KD1 C;  5FRM A;  1D3B B;  4XTU A;  2I4M A;  1IL2 A;  1YFS A;  1YJW A;  4CH3 A;  2HQX A;  4J7I A;  3HFZ A;  2XD0 A;  3KUF A;  4A4H A;  2V8K A;  5GAN e;  3HRU A;  2VGM A;  3BY7 A;  2WAC A;  4P71 A;  5KNN A;  3RF1 A;  3UH0 A;  3HFZ B;  1U1T A;  1NZ9 A;  1PSF A;  4EMH A;  3KFU A;  4OGE A;  4MZT A;  1N8R U;  4LD6 A;  2EL9 A;  5HGQ A;  5GMK e;  3JCM h;  4ZTU B;  3NEN A;  2WSC E;  1SRY A;  2ZPE B;  5DM7 R;  4IUP A;  4JS4 A;  3SB2 A;  3A8L B;  3FC3 A;  2M0O A;  4LDY A;  3M53 A;  5I2S A;  2DIG A;  4A4K A;  5GMK m;  1IZ6 A;  4YRM A;  3P8D A;  1RL2 A;  2VYT A;  3JCM V;  2PUO B;  5CKB A;  5KCO A;  3MCA B;  2RJE A;  2EQJ A;  4M77 E;  1UGQ B;  3EAE A;  3VQY A;  4WI1 A;  5A0D A;  2QQS A;  1KMM A;  1YFT A;  4TQF A;  3PGG A;  4C5G A;  2PVG B;  2PMF A;  3X26 B;  2RI5 A;  3ASK A;  3RKW A;  1X2G A;  4C0Z A;  4ATO A;  3CCR A;  3FIF A;  2L3R A;  2DQ0 A;  1JRI A;  2XU8 A;  4HWT A;  4KUL A;  2E6Z A;  3PZC A;  2LRQ A;  4G85 A;  3RUX A;  3PCO A;  2KDS A;  4RMF A;  2DPP B;  2Q7G A;  3RIR A;  3I56 A;  3OYA A;  4DQ2 A;  3SFM A;  4BE0 A;  3KBG A;  2EQU A;  2ART A;  2QEX A;  1ADY A;  1G51 A;  2FB7 A;  3BDU A;  2J3M A;  1OZ3 A;  1Q7Y C;  2RO0 A;  5LJ3 e;  3JCM P;  4PHC A;  2RM4 A;  4QW2 A;  4A53 A;  3P8Y A;  3L2V A;  1VQM A;  4M77 G;  4P75 C;  3BJU A;  2FL7 A;  2X35 A;  3I56 T;  2MF2 A;  3CCV A;  3PNW C;  2DAQ A;  4YRQ A;  4XU0 A;  2H3J A;  3GNF B;  2DEQ A;  5C51 B;  4N0A C;  3CC4 T;  5FRO A;  1UGP B;  4YRG A;  5HY6 A;  3OS2 A;  4J7F A;  4L87 A;  1RIQ A;  5GAM e;  4Q5W A;  4LVI A;  2GQV A;  3QUI A;  1VQM T;  3CCM A;  3CMQ A;  4FSX A;  3L42 A;  4J6W A;  2V8J A;  1N9W A;  3Q1J A;  3CCV T;  1KOG A;  4P74 C;  3A8H B;  2XID A;  3FLG A;  3NTI A;  3JCM d;  3RAC A;  4GY5 A;  1FYF A;  3ER0 A;  2DD5 A;  3A74 A;  1S72 A;  2Q7E A;  2BUD A;  2E3C A;  4JS5 A;  5FU7 B;  4HA8 A;  2E41 A;  4QQG A;  5GMK i;  2RHQ A;  2P0K A;  2JN0 A;  3RL6 A;  5A2Q E;  1KHI A;  2OTJ A;  2QHV A;  2DTI A;  5A0L A;  5CQX A;  4M77 F;  5GAN 8;  3M59 A;  2RHQ B;  3HHT B;  1H4V B;  3MQZ A;  1YIT A;  1BI1 A;  3HRI A;  2P0Q A;  4TVY A;  3M4Y A;  1WLE A;  1YIJ T;  4M7A B;  2FHD A;  2CZ7 B;  2RHS A;  2HQE A;  2RI2 A;  2DU5 A;  2R58 A;  2ZNJ A;  3NTH A;  2QXF A;  2RHS B;  2PQW A;  5ELN A;  2AKW A;  3QHS A;  3IKM B;  1YIT T;  4JUV A;  2VV5 A;  1RI0 A;  5IAY A;  3CD6 A;  1TH7 A;  2P5I A;  4M75 A;  4LVK A;  2OAU A;  3VBB A;  2LT4 A;  1M8V A;  1G5V A;  1NJI U;  4QQ6 A;  4M75 B;  4JJN K;  1BBU A;  1WJQ A;  3HXV A;  3QPH A;  2CZ0 B;  3VQX A;  2D9T A;  4P5N A;  3JCM f;  1P92 A;  3CD6 T;  3BW1 A;  2VXE A;  1E1T A;  4KBM B;  4HT4 A;  1QF6 A;  1M5Q 1;  3I7F A;  2L5Q A;  2ZIO A;  1H4S A;  5LJ5 h;  4WF2 A;  1M1K C;  4BB7 A;  3CC2 A;  3V7C A;  2I4O A;  3QO7 A;  2XDB A;  4M77 D;  3HRS A;  5GMK l;  1NE8 A;  2ZPH B;  2X4J A;  1M90 U;  2ARU A;  4QVZ A;  3EFR A;  4YRS A;  1BYM A;  2X4X A;  2RB6 A;  1VQ6 T;  2BIV A;  1YFR A;  3JB9 H;  3P8H A;  3CC2 T;  1QVF S;  1X54 A;  4JLG A;  3QKJ A;  3M54 A;  11AS A;  3SDZ A;  3OS5 A;  4YPF A;  3HRT A;  1M1G A;  1ZBX A;  5D6W A;  4ZN1 A;  2LQ8 A;  2EAY A;  4YRN A;  2ZCE A;  4X5O A;  5ELO A;  2G3R A;  2DTH A;  3A5Z A;  1VQ4 A;  4BDZ A;  2KMT A;  5KCH A;  1EOV A;  3BDL A;  4EX5 A;  3FB9 A;  1EFW A;  4C0G A;  5D6Y A;  3DB4 A;  1O9S A;  3JCM W;  3J80 E;  2CKK A;  3A5Z B;  3LYI A;  2CJB A;  3ICA A;  2M1H A;  1YGB A;  4H2X B;  4PLL A;  3V8L A;  2ZZE A;  4CH6 A;  1ASY A;  4PJO A;  2HD0 A;  5CR2 A;  3QXE B;  4C8Q C;  2E5Q A;  3WXM B;  2K5L A;  5DLO A;  2LX9 A;  3UFG A;  1B7Y A;  4PJO B;  4UP7 A;  3CCE A;  2F5T X;  2K3X A;  4ZIB A;  2EQM A;  4RG2 A;  4UP8 A;  3MO8 A;  1R8O B;  4A4G A;  4N0A A;  4YRO A;  4NL3 A;  3MEV A;  2QTX A;  4NL2 A;  5KE3 A;  2RJC A;  4TQD A;  4JDS A;  3JCM g;  1I4K 1;  2DQ3 A;  2L8D A;  3RKY A;  3CCE T;  3INZ A;  3JCM b;  3S3M A;  1K9M U;  3WVE B;  4XQ3 A;  2X4W A;  4HCC A;  4B9X A;  3OW2 A;  1I5L A;  1VQZ A;  2YLC A;  4IUV A;  3HXZ A;  2KQW A;  4PNO A;  3CMA A;  1PSE A;  2JOY A;  3O8V A;  2WSE E;  3CME A;  3LC0 A;  2RK1 A;  1XNI A;  3X24 B;  5LJ5 d;  1YHQ T;  3MP1 A;  1JJC B;  1KHC A;  2F5K A;  4JRQ A;  2MWO A;  3UDC A;  5J26 A;  1QP2 A;  3GOX A;  3BFM A;  4CRI A;  3OMG A;  2EJG A;  3M4P A;  3CMA T;  3CBP A;  5GAN 2;  1HC7 A;  3SD4 A;  2K4Y A;  3QG1 A;  4YRP A;  4ZN3 A;  3IG2 A;  4C0D C;  1W2B A;  3OYJ A;  2AMC B;  1K73 U;  3PTA A;  4EMK C;  4LVL A;  2K3Y A;  1JBM A;  1H4Q A;  4EDU A;  4BD3 A;  3JB9 D;  3OW2 S;  2ZPB B;  1WPY A;  4RDX A;  4C8Q E;  3L2U A;  2VGN A;  1N27 A;  4B9W A;  2DTO A;  3E9G A;  2ZIN A;  4OB1 B;  2VUB A;  4FT2 A;  3G71 T;  1HTT A;  4M78 C;  3URG A;  1Q86 C;  3WQZ A;  2JUF A;  1PYS A;  2JZ2 A;  2RH2 A;  1BI3 A;  3GLX A;  2DO3 A;  4UP9 A;  1Q7Y U;  1U8R A;  4XTX A;  4JRI A;  4MDW A;  1PYS B;  5M9O A;  1USY C;  3CCS T;  12AS A;  5LJ5 f;  4BY6 B;  1W2B S;  1Q82 C;  2ZGW A;  3DLL A;  4DOW A;  3H6Z A;  1WQW A;  2DVE A;  2DZC A;  3C95 A;  5E3I A;  2EIF A;  4C8Q G;  3OYF A;  1X2H A;  3OYL A;  3LGF A;  2RJF A;  2RA2 A;  4YCU A;  1H64 1;  5FU6 B;  1I8F A;  4E51 A;  2XDD A;  5C0M A;  3LWI A;  2E64 A;  2RK2 A;  4XTY A;  1B76 A;  5GAN h;  2E6N A;  2XHC A;  4N4H A;  4PLI A;  3SWN A;  3F70 A;  3L2W A;  4H2U A;  2CIM A;  3OYB A;  2L89 A;  1KQS A;  4HWO A;  3OYM A;  1G3W A;  3SWN B;  3LH0 A;  5GMK h;  2ZT6 A;  1EVL A;  3PIO A;  3HY1 A;  4OGC A;  2MI6 A;  4PL6 A;  3WVD B;  4A4E A;  4R55 A;  1QVP A;  4OB0 B;  3TCJ A;  2JVV A;  1QP3 A;  1W66 A;  3PCO B;  4Y28 E;  3CC4 A;  4XTZ A;  4H2S A;  1HK9 A;  2RI3 A;  1N8R C;  2C06 A;  4RCB A;  3R6O A;  3A7U A;  4F7U E;  2A8E A;  4P72 C;  1EIY A;  4C8Q F;  2EYQ A;  4M78 E;  2WSF E;  4HCZ A;  1SER A;  1VIF A;  1EIY B;  4JLI A;  1Q81 C;  3A8O B;  3HKS A;  1KQS S;  3JB9 I;  2G4C A;  1LOJ A;  3E9I A;  3MET A;  3OA6 A;  2CZ6 B;  2E5A A;  4E7J A;  4P73 C;  3QO3 A;  5LJ5 j;  2KSS A;  1ZHI A;  2ZR2 A;  1UB4 A;  1XOV A;  2ODR D;  3J7A F;  5J3B A;  4M7D E;  1H3Z A;  2X4Y A;  2XTI A;  2Q7H A;  5LJ5 g;  4ZTZ B;  1JB0 E;  4CS4 A;  2IVW A;  1NPP A;  1KC8 U;  4H02 A;  4CH5 A;  1VQN T;  4YCW A;  4F7U G;  3L2R A;  3HP9 A;  1YIJ A;  4TTV A;  5LJ3 h;  2E1H A;  2ARS A;  2YHT A;  3CCU T;  4IUQ A;  5DLQ E;  4M77 A;  3LX7 A;  4M78 G;  3HXU A;  3M5A A;  5GAN 4;  4TVA A;  3JCM X;  2QI2 A;  3HFN A;  1G3T A;  1FX7 A;  1XQH A;  4M77 B;  1M1K U;  3DSQ A;  1BBW A;  4IUR A;  4D6W A;  4XTV A;  4XU1 A;  4K86 A;  2DJZ A;  1FWZ A;  4TVA B;  4BUG A;  1VQ5 A;  4IUT A;  4LDU A;  1N9R A;  1LNX A;  4PKC C;  2KY9 A;  4C92 C;  3HFV A;  1WYD A;  4QQD A;  2ZZF A;  4FM4 B;  3N5B B;  4M7D G;  3HXW A;  4C8Q D;  3VUZ A;  3A8G B;  3MP6 A;  2LCL A;  4XK8 E;  4EMK A;  1U1S A;  4K87 A;  4A54 A;  2M9U A;  1X01 A;  4C0D B;  2HNI A;  4YRI A;  3GNG A;  4C0F A;  1VQ5 T;  3VKI A;  4EMK B;  2ZR3 A;  3CPW A;  2AKW B;  4G84 A;  3OB9 A;  2D0Q B;  3V7S A;  5K1X A;  2V8I A;  1QVF A;  2QHU A;  4YRK A;  4F7U F;  3KXT A;  4CI0 C;  2PVO B;  4LD9 K;  1LYL A;  2XGT A;  4HKE A;  2DXC A;  1NYR A;  2CGH A;  4M78 F;  4FIB A;  1G5I A;  2E12 A;  2ZNI A;  2O4X A;  3GPL A;  5CO7 A;  3GIB A;  3REU A;  5I2M A;  4C5E A;  1KQ2 A;  1VQ6 A;  4BI4 A;  2LVM A;  2ZCF B;  4UC4 A;  1USY A;  2Q5H A;  3V8K A;  5GAO r;  4DOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...