4XTYA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 63 with fluorine in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 94
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtyA01
4M7AG 5LJ5d 3HRKA 4C8QD 4YYEA 1NYQA 4M75D 2ZCEA 4EMKA 1NJ1A 4P72C 4YRIA 3L4GB 3L1AA 2Q7EA 4M77F 3P8VA 4YPFA 5GAN6 1JRIA 3RKXA 4EMKB 3A74A 4YRLA 2ZZGA 2Q5IA 2DEQA 3E9HA 5DY9A 5LJ3g 4PJOC 2PMFA 1X2GA 3QO7A 4M7AC 4XTYA 3EFSA 4EMGA 2DTOA 4J6YA 2I4MA 4C8QB 4M75B 4P3OA 2CGHA 3PCOA 5GAOp 1LYLA 4YRGA 5GAOm 3V7CA 3PCOB 1E1TA 1L0WA 2JN0A 1SESA 3JCMb 1WNLA 5GANj 5CAIA 1I5LA 4NL2A 4P71A 3IALA 2ZZEA 1X2HA 4PJOD 3QUIA 3QNEA 4RQFA 1BIBA 3HFOA 2EAYA 4P73A 3HTZA 1X54A 1Z7NA 5GAN4 4LNSA 5GMKj 4M7DE 4NOYA 1SETA 3HSBA 2ZNIA 3TEHA 2Q7HA 2ARTA 3JB9D 2Q7GA 5GMKm 3RKYA 1HK9A 4UP9A 3TEHB 5GAMe 2Q5HA 4F7UF 2HNIA 4M7AA 4G84A 5LJ5f 1USYC 4PJOB 1WU7A 3KFUA 2RA2A 5LJ3d 2DDZA 4M7AB 4P3NA 5GANh 2EL9A 3HXZA 3HFNA 1B8AA 5LJ5e 3NEMA 1E1OA 2YHTA 3VQXA 2ZT7A 1NJ8A 3BY7A 4YDQA 2DJZA 2AMCA 5GAOr 5GMKh 3A5ZA 2ZIMA 2CJBA 4YRKA 3JCMe 4C92C 2AMCB 3HFVA 4P74C 4YRCA 2YLCA 4CH6A 4C8QG 4J6XA 2ZTGA 1ATIA 4M75G 3NENA 4YRNA 1IL2A 1SRYA 4EMHA 1KQ2A 3ICAA 4QVDA 3W3SA 3A5YA 3HRIA 1I81A 3IKMB 4H2TA 3HXVA 1B70A 2I4OA 4C92D 5KNNA 1D3BA 1B34A 4M75C 3FJPA 2ARUA 4EO4A 1B70B 1YFRA 3V8JA 1B34B 1N9RA 2QHSA 2DXUA 3VU3C 3OD1A 4ZTZB 3RACA 4F7UE 4P75C 4KR3A 2C8MA 4X9CA 1W66A 11ASA 4A53A 4CS3A 4KR2A 1PYSB 3M4GA 3JCMc 5GAMj 5K1XA 4M7AF 2ZZFA 1HTTA 4O2DA 4P74A 4OP0A 4NL3A 5LJ3f 2FB7A 1KMMA 4PJOG 4C92B 4N0AC 1X56A 2ZR3A 1NJ5A 3JB9H 3CMQA 4L87A 1Y96B 3V7RA 3L4GA 4H02A 2P5IA 2PMEA 2XTIA 5LJ5j 5ELNA 4XTWA 5LJ3e 3TEGA 3UGQA 2EWNA 3JB9G 4JRIA 3SB2A 5GAN7 3SWNC 1GGMA 2J3MA 3RUXA 4HWTA 1NYRA 4Q15A 4XTZA 4CS2A 4C8QA 2RM4A 2EJ9A 2QHVA 4M75A 3RL6A 5GAMh 4ZTUB 3RGLA 4RQEA 3IKLA 4M78E 4P75A 1WLEA 4EX5A 2DZ9A 2ZGWA 2E1HA 2RD1A 3LC0A 3QO5A 4XTVA 4H2XB 2XGTA 5GAOl 3FIFA 5LJ5h 1E22A 3IG2A 4M7DC 4E51A 5GMKi 4N0AA 4YRRA 4PNOA 1U1SA 1RIQA 3HXYA 4XU0A 3UGTA 3JCMh 1NNHA 4P72A 4X5OA 4J15A 3JCMJ 1EIYA 5GAN8 3R07A 2P0LA 2CIMA 1ADYA 3BFMA 2E64A 1EIYB 3SWNB 2E5AA 2VXEA 3V8KA 2E3CA 1WQ7A 4PJOA 3VQYA 5C53B 4YRSA 4Q6GA 3REUA 1Z7MA 2I2LA 2ALYB 1WQWA 1H4QA 3INZA 1HC7A 4C92G 3AHUA 4TVAB 2RB6A 4M7DD 3LSQA 4K86A 4M77E 3P8TA 4HWRA 4YRQA 2ZINA 2DU7A 5LJ3j 4YRPA 1M8VA 4TQDA 4V2SA 3GIBA 3NELA 2DQ0A 2I4NA 2VXFA 4C8QF 3QHSA 4M77D 1JJCA 2I4LA 3G1ZA 4M75F 1NJ2A 3M4PA 4M7DB 2E41A 1JJCB 1E24A 1NJ6A 1G5HA 3PGGA 5GAOq 1HXDA 2ODRC 5GAMg 4XEOA 4RCCA 5GAN5 4QVCA 1EQRA 2E65A 1KMNA 4UPAA 3HY1A 4H2VA 4YCUA 2DVEA 3VQWA 2DQ3A 1YGBA 4J5YA 5LJ3h 4M77B 1YFSA 1USYA 2DU5A 1MGQA 4HT8A 1N9SA 3UH0A 2AKWA 4YP0A 2E10A 2RHSB 3REXA 3JCMg 4CH4A 2ODRD 1PYSA 2AKWB 5GAN3 4DPGA 1H4TA 5C51B 4YRJA 1X55A 2ARSA 4UP8A 4JUVA 4PJOF 1EVKA 4C92A 4BW9A 4XQ3A 1Y96A 1BIAA 3A32A 4HWOA 3A7UA 4CS4A 3P8YA 4RMFA 3JCMW 2CJAA 2DKGA 3HFZA 3JB9F 2IY5B 2RHQB 5GANg 3UFGA 4C8QE 3HFZB 5GAMd 3RIRA 3JB9J 4CH3A 1LOJA 4YRFA 4WF2A 2ZXFA 4M7DF 4TTVA 1LNXA 4P3PA 1QE0A 1ASYA 3FB9A 3RESA 4YCWA 1ASZA 4M7DG 4M78C 2QTXA 1FYFA 2DTHA 2G4CA 3WQZA 1I8FA 4XTXA 4F7UB 4AH6A 12ASA 4P73C 4HA8A 2C7IA 1BBWA 1B76A 3BDUA 4H2UA 1X01A 4H2XA 1B7YA 2EJFA 3JCMd 2DXTA 4K87A 4X9DA 1B7YB 3HXXA 1I4K1 4M77G 2ZT8A 4TQFA 4RDXA 4A54A 3M4QA 3A7AA 3DSQA 2VC8A 2ZIOA 4M78D 4XU1A 4XEMA 4XU2A 3L2ZA 3E9IA 2J3LA 3MEYA 4PJOE 4M7AE 4YRTA 3SWNA 5GANd 2YLBA 4MMLA 4OLFA 4RCBA 3QO8A 2ALYA 4C92F 4M77C 4TVAA 4YRMA 2Y90A 4M78A 4H2WA 5GMKl 4HVCA 1YFTA 4TVWA 4KQEA 4Y91A 3TUPA 4M78B 4M7AD 1WPYA 5I21A 3RKWA 1N9WA 1VQZA 3I7FA 3BJUA 5GAMf 4ZIBA 4K88A 1EOVA 3HXWA 2K57A 4JRKA 2ZR2A 4J6WA 4TWAA 1SERA 5F5WA 4M7DA 4YROA 1J5WA 2DTIA 1U1TA 3VQVA 2QHTA 1KQ1A 4XTUA 1JBMA 1EFWA 3MF1A 4HWSA 4F7UG 4PHCA 3ERRA 1H4SA 3JCMf 4MMKA 1QF6A 3V7SA 4P71C 4WJ3M 2FYKA 5ELOA 3JCMQ 4M77A 5HGQA 5GAN2 1H4VB 4NCXA 4BWAA 1YB3A 3JB9I 3HY0A 1G51A 5LJ5g 2QHUA 1KOGA 4DQ2A 3MF2A 1BBUA 4CH5A 2RHSA 3NETA 3QTCA 2ZNJA 1M5Q1 1EVLA 4C92E 5GANf 1WYDA 4JLIA 4EMKC 3RF1A 2EJGA 3JCMV 4WJ4A 1YCYA 2ZT5A 3JCMP 2ZT6A 4M78F 4WI1A 1TH7A 3EFRA 1ADJA 5GANe 5K1PA 4TVYA 5GAOn 4C8QC 4M78G 3HXUA 2IY5A 3PZCA 4UP7A 2RHQA 3RERA 3A7RA 4G85A 1H641 3BW1A 4H2YA 3QO3A 4YCVA 1D3BB 1G5IA 3JCMX 1C0AA 5GMKe 2DZCA 3LSSA 5C52B 4HT9A 4H2SA 4M75E 3V8LA 4XU3A 3QSUA 2CJ9A 1LJOA 4HWPA 4PG3A 5E3IA 4YREA 3VBBA 3A31A 4F7UA
chains in the Genus database with same CATH superfamily
1UJYA 1NYQA 1GBRA 3E2UA 1WZOA 3EG0A 4P72C 4YRIA 2Q7EA 5GAN6 4YRLA 1W70A 1YIJT 4QW2A 2DEQA 1YI2A 2KQWA 5LJ3g 2PMFA 1X2GA 2HD0A 3G6EA 3GPLA 4EMGA 2RQWA 1YWOA 2YUOA 2KI7A 4M75B 2EFIA 4J9BA 4ZTFA 4IIMA 4E2FB 1VIFA 5J3BA 5GAOp 4D8DA 5GJVB 5GAOm 3E1SA 3V7CA 1JJ2S 1K73C 3JCMb 2KGTA 2DJQA 2LVMA 2ZZEA 2K3BA 4PJOD 3QNEA 5D6WA 5KH6A 5GAN4 4LNSA 4C0GA 2OTJT 3MEWA 2DL8A 1UECA 2KR3A 3OBWA 2ARTA 1Q81R 4IUQA 2Q7GA 3CC4T 1DJ7B 2YT6A 2RK1A 1HK9A 4II1A 3RKYA 3H6ZA 4JJNK 2L3PA 3GBQA 2Q5HA 2HNIA 1FX7A 5LJ5f 2COZA 2GGRA 2QQBA 3CC2T 3CMEA 3KFUA 4M7AB 1BI3A 1G83A 1YCSB 2XDPA 2EL9A 2H8HA 3HXZA 2FZGB 3NEMA 3S3MA 2R5MA 1AWWA 4BE1A 1W2BP 4CC2A 3PVLA 2QDYB 3VQXA 4MZMA 1S1NA 3I35A 4YDQA 2DJZA 4HVWA 5GAOr 3UWNA 2EYXA 4YRKA 1UUEA 3C4SA 3HFVA 4YRCA 2GBQA 4A4HA 1WXTA 2YLCA 4C8QG 1OULA 3EG9A 2CZ1B 3NENA 4YRNA 2X4WA 4OMNA 3A8GB 3QXEB 1KK7A 1ZUKA 1VQNQ 1N5ZA 1JXMA 3H0FA 4QVDA 3P8BB 2M16A 2ZPIB 2COWA 3W3SA 1TWBA 2V1RA 1E6GA 4OB0B 3CCST 2I4OA 2J7IA 4C92D 2JZ2A 1TTHB 3V8JA 2FPDA 4ZTZB 1V76A 1QP2A 2DL3A 1YBYA 2HL5C 2KSSA 1W66A 4KR2A 3OYNA 2A28A 5GAMj 1BBZA 3VS7A 4OP0A 5DLOA 4PLIA 5LJ3f 1IO6A 3ULRB 1KMMA 3E19A 3PVQA 2ZR3A 4L87A 1KQSP 4C5HA 2C0TA 1VQNA 2KK4A 2P5IA 2PMEA 1T3SA 2HL3A 5LJ5j 1MV0B 1NPPA 4IKFA 1K9MC 3JB9G 4LVKA 3HHTB 1GGMA 2RQUA 3M4YA 4QVZA 3FEOA 5A2QE 2D1XA 1RABB 3GP8A 2GF7A 4C8QA 1TOVA 2CZ6B 3UF4A 2CP3A 2E12A 3M57A 4OMMA 1J3TA 4DBRA 1Q82U 1K76A 4E6RA 3UT1A 1WLEA 1ZQ1A 5FW9A 3PFSA 1JU5C 3LW5E 1YHQQ 2BTTA 2DXCA 4XTVA 3OYEA 4H2XB 2FL7A 2XG8D 5CCAA 1VQ8Q 2QI2A 3NFCA 1FMWA 1E22A 3A98A 4PNOA 2KRNA 1D1BA 4XU0A 1VQOQ 3CCLA 4P72A 1RAFB 1VQ5T 3JCMJ 2A37A 2RJEA 2YRVA 3CCMT 2DBMA 3VQYA 3RBBB 4Q6GA 2EGAA 1WQWA 1WIEA 2ALYB 2K2VA 4YTLA 3LSQA 4K86A 4HCZA 4JLGA 2ZINA 2AK5A 3RR6A 4HVUA 2RNAA 3L42A 1GFDA 3M0SA 5LJ3j 3UPUA 1YITT 1WX6A 2ROLA 3SHWA 4E7IA 1GBQA 4ESRA 4V2SA 2DIQA 4C8QF 1VQOA 2DL5A 3MPUB 1VQ7A 2F2WA 1KIKA 2FZKB 4RG2A 1VUBA 1XNIA 1AWXA 1NJ6A 1WGSA 3PGGA 2HEQA 2LP5A 2E5KA 2X51A 1QVFP 2RMOA 2E65A 1VQPT 1PSEA 3PMTA 5L8RE 4YCUA 2CP0A 2OI3A 3LLRA 1QCNA 3LGFA 2L0AA 4M77B 1D0ZA 2DU5A 1MGQA 1X6OA 3OYJA 4DOVA 3REBB 5FRMA 2AKWA 1B07A 2E10A 1M1FA 3OMGA 5CKHA 1Q82C 4F17A 1H4TA 3X26B 4C0DC 1ARKA 4LVMA 4UP8A 1W6XA 3L2RA 4PFZA 4KBMB 8ATCB 3OYCA 1BIAA 5I2MA 4ZTJA 2EKOA 3JCMW 4BD3A 1S72Q 2LQNA 3JB9F 2IY5B 3UFGA 2JUFA 2DD5A 5GAMd 1VQKA 3LYIA 1BKBA 2ZXFA 4TTVA 5I22A 3QJ6A 1G8XA 3H0IA 4YCWA 3CCRT 3MKDA 4M78C 4B9XA 3WQZA 4C5IA 1I8FA 12ASA 1RLQC 2WSEE 1BBWA 3UA6A 1SSHA 2J6FA 2RJDA 4ATOA 2A8EA 2EJFA 3OYIA 3HKSA 1NE8A 1XQHA 1JJ2P 4K87A 4X9DA 2E4HA 2RPNA 1Q7YC 3HXXA 2D0QB 3WXMB 2ZT8A 3CCEA 4N4GA 4OF1A 1YJ9A 3UDCA 4XEMA 1R8OB 1F1BB 3I56Q 1C6VX 3E9IA 1RAIB 2P0KA 1KJWA 5GANd 2YLBA 4IURA 1WHJA 2JTMA 3QO8A 1RAEB 2RHIA 2QASA 3NTIA 4F16A 4YRMA 1X2QA 3HTRA 4FW2A 2HBWA 1N9WA 1VQZA 4PLLA 1SPKA 2RO0A 2DPPB 3OSSC 4RTUA 4ZIBA 2G6FX 4JS4A 1VQLQ 1EOVA 3HXWA 2CP6A 2RH2A 4JRQA 2QA4A 2CSQA 4J6WA 1SERA 1ZUYA 4RTTA 5AT1B 3RNJA 3GF5A 1J5WA 4YROA 4J9HA 2EYWA 2Z0WA 4RMOA 3I9QA 2GTJA 2CZ0B 2DD4A 1G3TA 1D1CA 1M2OA 5L23A 2KROA 3ERRA 1H4SA 4Z8AA 3META 2DRKA 4MMKA 5A0LA 2P0QA 1M90U 4J8OA 1ZSZC 5FU6B 5GAN2 2DFUA 1UTIA 2YRDA 3QWYA 3J81E 3VRYA 3HY0A 1QVPA 4JS5A 3VV0A 1G51A 3CCQT 1Y71A 2EPDA 4DQ2A 1M1KU 1VQLA 3MF2A 1BBUA 2DAQA 4Z02A 2RHSA 4ZGDB 3OW2S 5FWBA 1M2VA 2D0NA 1GCQC 1RI0A 3JCMV 4DBHA 5DM7R 1YCYA 3JV3A 1ZX6A 2FPEA 4HCCA 2QGFB 1WHMA 5GANe 1SG5A 5GAOn 4L6V5 4M78G 1QW1A 3PZCA 4UP7A 3A7RA 4OGCA 1AZEA 5KCOA 4H2YA 2LNVA 1QVGA 1D3BB 2BKDN 2DZCA 1JB0E 5GMKe 2R5AA 2ZCFB 4HT9A 4H2SA 4M75E 2R58A 1MMDA 3G4SA 2ENMA 4PKCC 4HCBA 1WHLA 1YJWQ 2O01E 1VYVA 1IB8A 1KHCA 3MHXA 3M0TA 3VKIA 3A31A 1WLPB 4M7AG 1U06A 3C0CA 4IUPA 3HRKA 4YYEA 5HK3A 1W1FA 5KYWA 2XHCA 4M75D 1EIFA 4HKEA 3VS1A 3L4GB 2GFAA 3L1AA 4GLKA 2FEIA 2QQ9A 4LN2A 3RKXA 4EMKB 1HJDA 3A74A 1XJWB 2KXDA 1FWZA 4PJOC 4XTYA 3KFVA 3WVEB 2BIVA 3CD6T 3I55A 4P3OA 2CGHA 2K4YA 2QXFA 1YJWA 4DEYA 1VQ4T 4YRGA 2A0FB 1ZA2B 1WHKA 1SESA 2RHZA 3G1JA 2L3RA 3QUIA 1M1KC 4X34A 1BIBA 1ABQA 2VYTA 3HFOA 1X54A 4M7DE 3HSBA 1AOJA 2OTLT 1T0HA 3DLMA 2E6ZA 2JMCA 3HRSA 3TEHB 2F2XA 3G71Q 4OMFB 4M7AA 2MWOA 1D1AA 1USYC 2FZCB 4LDUA 3A8OB 2IPOB 2L3SA 1YWPA 2GQIA 1VQ9A 2DXBA 1YJNA 2FVUA 4P3NA 3LX7A 5GANh 2QQRA 1CKBA 3VJPA 2LJ0A 4A63B 1E1OA 2NUPB 2AKLA 2YHTA 1T3LA 5ECAA 4TVRA 1YIJQ 1TSFA 3M55A 3VS6A 4FCYA 5GMKh 1ZHIA 1MNEA 3CCUA 3A5ZA 3JCMe 4J9IA 4C92C 2AMCB 2D6FA 2H3EB 3L2WA 4FYWB 4CH6A 3GLXA 4J6XA 2ZTGA 1ATIA 5FRNA 1X43A 3EHQA 3C12A 2MK5A 3G71A 1KQ2A 1D0YA 3I5SA 3EAEA 2AT1B 2L2PA 3MP8A 1VQ6T 3JRZA 2R57A 2CSIA 1AD5A 1TXQA 3HXVA 4BI3A 3MJXA 9ATCB 4EIKA 2ARUA 4EO4A 1B70B 3M0UA 5C0MA 3OD1A 1YIJA 2BE9B 3M59A 2OTJQ 4KR3A 1GL5A 4J9EA 2K9GA 4AFUC 4A53A 2LNHB 1PYSB 2F5TX 3CC4Q 1OQKA 4M7AF 2ZZFA 4JRPA 1HTTA 2J6KA 4NL3A 2FB7A 3ZL7C 4PJOG 3OBYA 2VVKA 3CC2Q 5CO7A 3JB9H 3CMQA 1GCQA 2KRMA 4BY6C 5ELNA 2NLUA 1OZ2A 5J26A 3UGQA 2PQWA 3PTAA 4KUDK 3SB2A 3UA7A 4GLMA 5GAN7 3OYLA 1KD1U 2J3MA 2AKKA 1C1AA 3RUXA 4OB2B 2DEUA 3FDRA 1NYRA 1QKXA 2RQVA 4CS2A 3OYFA 2RM4A 2EJ9A 1BYMA 1BI0A 2OTJA 1LPLA 2YRCA 4ZTUB 1MNDA 5HCKA 2YWWA 1OEBA 2VGNA 2X4YA 5A0GA 1X75C 4C0DB 2XGTA 4KH0B 3FIFA 2EKHA 2FRWA 5GMKi 1VIEA 3CXCP 4PFPA 1SRMA 3CC7T 3CCSQ 1UGSB 5J39A 2LZ6B 2ZPBB 2RN8A 3QG1A 3JCMh 5KE2A 4LD9K 3SEMA 1K9MU 2LQ8A 2DYIA 1NPRA 4ZGEB 3BFMA 2FRYA 1KC8U 3SWNB 2VXEA 1WQ7A 4PJOA 5C53B 2KT8A 1Z7MA 2I2LA 1H4QA 1CSKA 4C92G 3AHUA 2RB6A 5HK0A 4M77E 2FPFA 3OYAA 2DE0X 1M1GA 2QTVA 4YRQA 2ECZA 3G6ET 4L5GA 3CCVT 2XIDA 3EGDB 1OOTA 1KSWA 1M8VA 4TQDA 1WJRA 3EG1A 3Q1JA 4CC3A 4BE0A 3LH0A 5CK9A 4FYVB 2I4NA 3T9NA 1Z9ZA 2VXFA 4M77D 1M90R 3EFOB 2NUTB 2LT4A 4M7DB 1JJCB 1G5HA 4RTZA 5GAOq 3NHNA 3VYGA 3OW2P 1Y7XA 1K4US 3CPWA 2A08A 1K1ZA 4UPAA 2SRCA 4H2VA 1KD1C 1YGBA 4J5YA 1YFSA 1USYA 2F2VA 4N4HA 1QVFA 1WJSA 4B9WA 3J7AF 2MMPA 1N9SA 3TSZA 2KVQG 4F04B 4IUVA 3CMET 3JCMg 3VUZA 1VQ5Q 2RHYA 5D7UA 2LC4A 3M53A 5C51B 4PJOF 4C92A 3CCMQ 4ELZC 4E7SA 4K11A 1Y96A 4HWOA 1WHGA 3P8YA 4RMFA 2RJFA 2CJAA 2HKQB 1PD1A 2HDAA 4KT0E 1HD3A 2RHQB 1RAGB 2DYBA 1RI9A 4C8QE 3HFZB 1YITQ 4CH3A 2WSFE 5CIUA 1LOJA 2MWPA 4WF2A 1KC8C 1OI1A 4P3PA 2XDBA 5HY6A 1ASZA 2QTXA 1FYFA 4CC4B 2HCKA 4LVJA 2KY9A 1UG1A 3GNGA 1X01A 3CEYA 1VQPQ 2O9VA 2M1HA 3TQ7P 4FM4B 3A7AA 3LWIA 1N6AA 1NM7A 2CP5A 3VYHB 2GTOA 1TUDA 2J3LA 4BDYA 3MEYA 1JJ2A 3CMAT 1Y0MA 3P8HA 3REAB 3OYYA 5FU7C 4C92F 4TVAA 2XK0A 2EYQA 2Y90A 2DNUA 4H2WA 5GMKl 4HVCA 4Q5WA 2EQUA 3S3NA 1PRMC 4Y91A 1WPYA 1OX9A 5M9OA 3OS5A 1YHQA 1N8RC 4AG2C 1VQ8A 2FHDA 1Q7YU 2QHTA 7AT1B 1KQ1A 3CCRQ 1JBMA 2F5KA 1K73R 2X4XA 3MCAB 1M3CA 4F7UG 1CKAA 1VYTA 1NJIU 3DKMA 2HQHA 1IRXA 3JCMf 4AG1C 1QF6A 2JVVA 3CCLT 5IXBA 1R77A 4Y92A 2QYZA 1YB3A 3JB9I 3OYHA 1SHFA 4JJCA 1Q86U 4LDYA 4CH5A 5I2SA 3NETA 3QTCA 2ZNJA 1M5Q1 1WYDA 3CCJT 3RF1A 4LVIA 1RADB 4WJ4A 2AIRB 3MP6A 2KMTA 3PE0A 2ZT5A 4AFSC 3CCRA 2X3XD 5IHIA 1NZ9A 2QG9B 2COYA 3QYHB 2KBTA 4PL6A 2BZXA 4TVYA 2E3IA 4ZGJB 2EQKA 1VQ7T 3TU4K 4G85A 4OMPA 1H641 3QO3A 4YCVA 2WSCE 4CRIA 3M0PA 2EYZA 3N5BB 5C52B 5HKCA 3ASKA 2K2MA 3MO8A 3UATA 4FSXA 3QPHA 1W4SA 4PG3A 4DBFA 2LCSA 4YREA 2XICA 3FRNA 4F7UA 2EVRA 5LJ5d 3KUFA 2AZVA 3EG2A 2XI9A 2ZCEA 4EMKA 1OX8A 1K8AU 3P8VA 1JRIA 4N4IA 4J7IA 2ZZGA 2V26A 3E9HA 3HRUA 1S72A 3QO7A 3MP1A 3CCQQ 2V8IA 4M7AC 1MHNA 3EFSA 2KE9A 2DTOA 4J6YA 2I4MA 4C8QB 5CVIA 1NJIC 4DOWA 3CBPA 3PMIA 2DA9A 2B8AA 2O9SA 3PCOB 1E1TA 2JN0A 2RI5A 2YUPA 1VQKT 1WNLA 2G3RA 1K9MR 1I5LA 4HXJA 3IALA 2ED1A 2P0PA 3H8ZA 3CXCS 1Q86C 2ZPHB 2EAYA 3HTZA 3NTKA 2EQIA 4OB1B 2BZYA 1VA7A 1M4ZA 2QQSA 1SETA 1E6HA 4HCKA 4BY6B 2ZNIA 2LTOA 1AWJA 1B3QA 3TEHA 2Q7HA 1QCFA 3CCQA 1AZGB 5GMKm 4UP9A 2OX7A 3QKJA 5GAMe 4F7UF 3I56A 4G84A 1WU7A 2NWMA 2P4TA 5LJ3d 2DDZA 4OMQA 2EBPA 3CCET 1PG5B 1Q81U 2I0NA 1YJ9T 4UC4A 3X20B 1B8AA 2JS2A 5LJ5e 5LL6S 2D9TA 4Y28E 2W0ZA 1NJ8A 2AMCA 1PC0A 2ZIMA 3S3OA 3OQ5A 1G5VA 5FROA 1QCOA 1RACB 1VOMA 2MCNA 4M75G 3CD6Q 2PU9B 2GNCA 4LUEA 4EMHA 1X6GA 1K8AC 4OB3B 3ICAA 5CKFA 4FW1A 3GNFB 1D0XA 3M9QA 3EH1A 3KBGA 1SHGA 2MPXC 4ELYC 2E5QA 2OAUA 2JTEA 2QA4T 5KYXB 1B70A 1ZBJA 2EW3A 3C95A 5KNNA 1QWFA 1YFRA 2QHSA 1B34B 1QLYA 2DXUA 3RACA 1ABOA 2O4XB 4X9CA 2JTFA 2OTLQ 2KEAA 4CS3A 4IIOA 4A4KA 3OYDA 2VGMA 3M4GA 3JCMc 5K1XA 1IGUA 1I5OB 4O2DA 4P74A 1NYGA 2CP2A 2P4RA 2L3QA 8AT1B 3V7RA 1KHIA 1TUGB 1VQLT 1QKWA 2XTIA 3LH5A 5LJ3e 2O2OA 4JZ4A 1Q82R 4HWTA 4Q15A 4MZPA 1UE9A 1UHCA 1ZA1B 4KGVB 3VUBA 1BCMA 4FYYB 4M75A 3L2QA 1VQMT 3PT9A 4J7FA 3RL6A 1BU1A 5KYUB 1WXUA 5GAMh 1WHHA 1UEBA 1Q81C 3BDLA 2HQXA 3RGLA 3IKLA 4M78E 4P75A 1NBEB 4PK4A 4EX5A 2C0OA 2ZGWA 3SD4A 2E1HA 2RD1A 1VQ6Q 3EHRA 4RTVA 5GAOl 5LJ5h 3G4ST 1JXOA 4N0AA 4HT4A 4BUGA 1RIQA 2PVGB 3HXYA 3QDFA 2ATCB 3UGTA 2LDMA 4AT1B 1NNHA 4B6MA 3BE3A 1GXIE 1M30A 5GAN8 2DBKA 3QBYA 3R07A 1PKTA 1ADYA 2E64A 4LXCA 1EIYB 2E5AA 3V8KA 2RK2A 1T0JA 2HZYA 3REUA 1EZZB 3X25B 3INZA 1Y07A 1TG0A 1Q7YR 4M7DD 2XKOC 3P8DA 4HWRA 1JEGA 4CC7A 2DU7A 3O5ZA 2K5LA 4FU6A 1M9SA 1XTDA 4KRTA 1TS9A 3I55T 1UJ0A 3C94A 1BK2A 5I11A 2AZSA 4X1VA 1KG1A 4WCIA 2VASA 2NUTA 1V1CA 2CYZB 2MYSA 2RI3A 2ZPEB 3QHSA 1JJCA 2I4LA 4M75F 3OYMA 4FT4A 1NJ2A 3M4PA 3OSVA 1E24A 2FO0A 1W2BA 1PWTA 4AMCA 5CQYA 1SSFA 5GAMg 4XEOA 1NLPC 4BDZA 4RCCA 1M3AA 2LCCA 3HY1A 5IH2A 2DVEA 2XU8A 1PHTA 3VQWA 3CPWS 2A7YA 2LX7A 5LJ3h 1G3SA 4NS5A 3OW2A 2J6OA 4HT8A 2VWFA 2GFUA 3CC7Q 3UH0A 1MUZA 1I07A 2M02A 2RHSB 4LVLA 4R56A 2CH4W 2ODRD 3OS0A 1VQ9T 4D6WA 1YJNT 2E3HA 1M2VB 4YRJA 1X55A 1FXXA 1Z9QA 2K7AA 4JUVA 3H9NA 4QT7A 4XQ3A 3A32A 2YXYA 1O9SA 4CS4A 3CCUT 2V8JA 1FMKA 3VS4A 3HFZA 2HMAA 1AWOA 2DL7A 3G6EQ 1H8KA 3CCVQ 5GANg 2M51A 2QEXT 4E7HA 2OJ2A 3ZBDA 4YRFA 4M7DF 4J9FA 2O88A 1KQSA 1QE0A 1ASYA 1WJQA 3M56A 3FLGA 3DB3A 2DTHA 3H41A 2HSEB 2G4CA 2HQEA 4P73C 2AHJB 2C7IA 2HBPA 4H2UA 3CC4A 2L89A 4IUUA 4J9DA 5KYWB 5IN1A 4H2XA 2K3YA 2DXTA 2EGCA 4PJMA 4JDSA 3CC2A 1B7YB 4M77G 3IQLA 4ME7A 3F70A 1QMCA 1BI2A 3M4QA 3CCVA 4JZ3A 2VC8A 2ZZDA 2ZIOA 2LRQA 2ABLA 2XMFA 4XU1A 1ZLMA 4KULA 1YNZA 2JS0A 4PJOE 1I0CA 3CMEQ 4YRTA 1Y57A 4LUDA 5FU6C 4C5GA 1B7TA 2FG0A 4MMLA 4OLFA 4RCBA 3HL8A 2ALYA 4QQ6A 5D6XA 2ROTA 1ZBXA 2PUOB 1YI2T 4KQEA 1O75A 4M78B 5IAYA 2C06A 5I21A 3TUPA 3I7FA 3BJUA 5GAMf 1WDXA 4E7JA 4K88A 4JJDA 3EH2A 1NG2A 4RG8A 1OU9A 4JRKA 2EGEA 1QP3A 1X2KA 2J05A 2ZR2A 3EGXB 3CCSA 4JJBA 1K0SA 3M0RA 1GFCA 2QAZA 5CQXA 5IHKA 4HWSA 4PHCA 2A36A 2E70A 1H3HA 4KH1B 2YUQA 1M1KR 2MOXA 3NTHA 3E9FA 4R0KA 3V7SA 1H92A 1UGQB 4WJ3M 2FYKA 4XAXB 5HGQA 4M77A 2LQWA 4NCXA 3PIPA 5AYFA 2LJ3A 1G3WA 1OV3A 1KOGA 3QZ5B 3A5ZB 4C0FA 1OPKA 5CKBA 4ANJA 5KYYB 1N8RU 4C92E 1KFZA 5GANf 3CMAQ 4EMKC 4RTXA 2NYSA 2EJGA 2CZ7B 1SRLA 2JJ9A 2IG0A 3M0QA 5IHNA 3JCMP 2ZT6A 1R0CB 1TH7A 3EFRA 1FYNA 5K1PA 1QWEA 3OYKA 4DEXA 1EFNA 3HXUA 2IY5A 3OS2A 3RERA 3L2VA 1G5IA 3JCMX 3A8MB 1C0AA 3LSSA 1LVKA 2LX9A 5IT9E 2V1QA 4PFOA 4EPCA 1GRIA 5FWCA 2YSQA 3V8LA 3OB9A 4XU3A 3QSUA 2CJ9A 1ZSZB 1LJOA 1AT1B 4AFZC 4HWPA 5E3IA 3M54A 3RDVA 3VS2A 1NEBA 2MAMA 2RHUA 3ZFJA 1MMAA 3O8VA 3CMAA 5DLQE 1VQ5A 1GCPA 3M58A 4C8QD 2LCLA 2MI6A 1LCKA 3JAME 3NGPA 4RUGA 2DO3A 1NJ1A 1TU0B 4BACA 4M77F 3CCMA 3CCLQ 4YPFA 2Q5IA 3G7ZA 3A8LB 1UFFA 1R0BG 5EG2A 1PD0A 1ZUUA 5DY9A 2PZ1A 3TSWA 4E47A 2MIOA 2DILA 3TREA 1YITA 2JM8A 3DB4A 2RF0A 3PCOA 3CCJQ 1IHVA 2JOYA 1VQNT 4ORZA 1LYLA 1C0MA 1YN8A 4J9CA 2EIFA 1L0WA 1PSFA 3R6NA 2EYYA 5GANj 5CAIA 4NL2A 4P71A 2JNGA 1X2HA 4RQFA 6AT1B 1MV3A 2QDLA 4L59A 4P73A 1VQ7Q 1PM3A 2JM9A 1VQPA 1Z7NA 1PKSA 2VUBA 5GMKj 4ZN3A 5IXFA 4NOYA 4FT2A 3RMSA 3JB9D 3HP9A 3GOXA 2KRSA 4KGZB 4A4EA 1AVZC 4BB7A 3MQZA 2CDTA 4PJOB 2RA2A 4ZN1A 1M27C 1UB4A 1UGVA 3CCJA 5CKEA 4MDXA 4FIBA 3M5AA 3HFNA 1PCXA 3X28B 3OY9A 4LDWA 2ZT7A 3BY7A 3A1PA 3CPWP 1H3ZA 2CJBA 4M4ZA 2WACA 3OYGA 4P74C 5A0DA 2KAFA 5CR2A 4OVAA 1IXDA 1N27A 1IL2A 3EG9B 3CPFA 3HRTA 4PJLA 1SRYA 1NLOC 1UGPB 4C0ZA 2KXCA 4QQGA 2CH4A 1ACMB 1YHQT 4DBQA 2A3LA 5KYXA 1VQ8T 3A5YA 3QYGB 1VQKQ 3HRIA 3NPFA 1I81A 3IKMB 2CREA 4H2TA 4AFQC 1D3BA 1B34A 1HYOA 1VQOT 2J06A 1BCOA 4M75C 3RMQA 3FJPA 2EQMA 2CT4A 2O4XA 2V8KA 1N9RA 2YUNA 3VU3C 1OZ3A 3VS5A 3S6WA 2ED0A 1K9AA 4F7UE 4P75C 3J80E 2C8MA 11ASA 2XD0A 2O31A 1QVGS 3L2UA 2PUKB 4E7ZA 1RAAB 2NUZA 4GBQA 4JPBW 2QQAA 1KD1R 2PTKA 3VS3A 4C92B 4N0AC 1X56A 1NJ5A 1BB9A 1Y96B 4H02A 3NMZC 3CCEQ 3L4GA 2JXBA 2ZPGB 1YJ9Q 1XOVA 3CQTA 1UDLA 4XTWA 3TEGA 2EWNA 4JRIA 3MEAA 2SEMA 4FYXB 3SWNC 4KGXB 2KYMA 4KUIA 3TVTA 1X6BA 4XTZA 4OMLA 3AT1B 1X27A 2F69A 2ZAEA 5KYUA 2VV5A 2VB6A 2QHVA 2KDSA 1IHWA 5KE3A 2CKKA 2CUDA 4RKUE 1D09B 4RQEA 2DZ9A 2D8HA 2MF2A 4HVVA 3LC0A 3R6OA 3QO5A 1G3YA 4A4GA 2L8DA 4LD6A 1YP5A 2PVDB 3IG2A 2DIGA 4M7DC 2NS6A 4E51A 1IZ6A 2QA4Q 3PNWC 2D8JA 4YRRA 3E9GA 1KC8R 3QZ9B 1U1SA 3TEEA 4D8KA 2Y4YA 2IIMA 4X5OA 4J15A 3I5RA 1EIYA 4RTYA 5KYNA 1BI1A 2P0LA 2DF6A 2CIMA 2K79A 2E3CA 5EC7A 4F14A 4YRSA 2QK0A 3LGLA 1HC7A 4TVAB 1U8RA 1TUCA 2YDLA 1S72T 3P8TA 1EX4A 4PJJA 2NUPA 2W10A 3VS0A 4YRPA 2M0OA 3GIBA 3NELA 2DQ0A 4Z89A 2GQVA 2JMAA 3JSCA 3G1ZA 4FL6A 2KYBA 2CP7A 1RUWA 2E41A 2M0YA 1P92A 4O5VA 1VQMQ 2BUDA 1AHJB 3MEVA 1HXDA 3OA6A 3LWHA 1NEGA 2ODRC 3OMCA 2HSPA 2DL4A 4A4FA 5GAN5 4QVCA 1SKUB 1EQRA 1KMNA 1W2BS 3ER0A 4CI0C 2ESWA 1VQ4Q 1PNJA 1N8RR 1MMNA 2X3WD 4PJNA 5FLXE 4R55A 1VYUA 2DQ3A 2RQTA 3G4SQ 2K6DA 2BZ8A 4XK8E 3I56T 2X35A 4YP0A 2LT1A 3MEUA 2DMOA 3REXA 3ME9A 4CH4A 2VKNA 1PYSA 2AKWB 3FJ5A 5GAN3 4DPGA 3QWXX 2ARSA 2DRMA 1EVKA 1RL2A 3KXTA 2CS7A 1M8MA 1VQMA 2RQRA 1WA7A 1UGRB 1OU8A 3CD6A 4BW9A 4E7LA 3A7UA 2K3XA 1IREB 2DKGA 4E7KA 1VQ4A 4OMOA 1ZSGA 4BE2A 1UHFA 3RIRA 3SDZA 3JB9J 5D6YA 3I55Q 1QQJA 2QGGA 4EDUA 1LNXA 2IVWA 2KT1A 3FB9A 4OGEA 3RESA 2KNBB 4MDWA 1PRLC 4M7DG 2E6NA 1U5SA 4LDVA 2PNIA 4XTXA 2CT3A 3H0HA 4F7UB 1KQSS 2OTLA 1SF9A 4HA8A 5C6SA 4AH6A 1B76A 2L5QA 4LDXA 3BDUA 4GY5A 3WVDB 3QDRB 1B7YA 3JCMd 2B86A 1FMVA 2M9UA 2X4JA 2RJCA 4C5EA 1U3OA 2GCXA 2JT4A 4WTOB 3EGUA 1I4K1 2BE7D 4TQFA 4RDXA 1I1JA 4A54A 3FC3A 3THKA 3DSQA 1WXBA 4M78D 4VUBA 4XU2A 3L2ZA 2LMJA 3OS1A 1A0NB 1WFWA 2Y4XA 4M7AE 1RAHB 3SWNA 1VQ9Q 1YJNQ 1M90C 3CXCA 4M77C 3QIIA 3PIOA 4J9GA 2X9HA 4M78A 1NYFA 2LQKA 3EG3A 3SFMA 1YFTA 4TVWA 3EGDA 4M7AD 3CCUQ 3RKWA 2RI2A 3A8HB 4DA4A 1VQ6A 2QEXQ 3U23A 2K57A 3EGXA 5GJWB 2CUBA 1JQQA 4MZTA 1NJIR 1YJWT 3EFOA 4TWAA 2F1LA 5F5WA 4M7DA 2DTIA 1U1TA 3VQVA 1G2BA 4J83A 4XTUA 4LNPA 4LE9A 3URGA 2PVOB 1EFWA 3MF1A 1Q95G 2DX1A 3QJYA 1YFNA 1Q86R 4BI4A 1M3BA 3D7SB 5KCHA 3CBMA 3X24B 2HKNA 4O6JA 1V29B 4RTWA 2C0IA 3VRZA 1K0XA 4QQDA 5ELOA 3JCMQ 2LJ1A 1H4VB 1K73U 4BWAA 1OPLA 5CKDA 5FU7B 1RLPC 3DLLA 2EQJA 5LJ5g 2QHUA 2ZPFB 5KYYA 1E7OA 2QEXA 2OAWA 1WI7A 1IGQA 3TCJA 1OYXA 4Z88A 1EVLA 1QVFS 1AEYA 1HSQA 4JLIA 4IUTA 3OYBA 2DERA 2HAXA 3CBOA 1QVGP 1WYXA 2DLPA 4M78F 4WI1A 4ZNXA 1X69A 3ZEHA 1ADJA 4C8QC 1JO8A 2JW4A 2RHQA 1YI2Q 2H3JA 2DM1A 3BW1A 2DVJA 2XDDA 3HPWA 2K5FA 2P84A 4FSSA 1ZSZA 2RHXA 4P5NA 1MMGA 3G71T 3CC7A 1K8AR 1SEMA 2DK3A 2K5IA 2DETA 3VBBA 4BI8B 4QKUA 4P71C
chains in the Genus database with same CATH topology
1NYQA 4P72C 4YRIA 2Q7EA 5GAN6 4YRLA 1YIJT 4QW2A 2DEQA 1YI2A 2KQWA 5LJ3g 2PMFA 1X2GA 2HD0A 3G6EA 3GPLA 4EMGA 4M75B 2EFIA 4ZTFA 1VIFA 5J3BA 5GAOp 5GAOm 3E1SA 3V7CA 1JJ2S 1K73C 3JCMb 2LVMA 2ZZEA 4PJOD 3QNEA 5D6WA 5KH6A 5GAN4 4LNSA 4C0GA 2OTJT 3MEWA 3OBWA 2ARTA 4IUQA 2Q7GA 3CC4T 1DJ7B 2RK1A 1HK9A 4II1A 3RKYA 3H6ZA 4JJNK 2Q5HA 2HNIA 1FX7A 5LJ5f 2QQBA 3CC2T 3CMEA 3KFUA 4M7AB 1BI3A 2XDPA 2EL9A 3HXZA 3NEMA 3S3MA 2R5MA 4BE1A 2QDYB 3VQXA 4MZMA 4YDQA 2DJZA 5GAOr 3UWNA 4YRKA 4YRCA 3C4SA 3HFVA 4A4HA 2YLCA 4C8QG 2CZ1B 3NENA 4YRNA 2X4WA 3A8GB 3QXEB 4QVDA 3P8BB 2M16A 2ZPIB 3W3SA 4OB0B 3CCST 2I4OA 4C92D 2JZ2A 3V8JA 4ZTZB 1QP2A 1YBYA 2KSSA 1W66A 4KR2A 3OYNA 5GAMj 4OP0A 5DLOA 4PLIA 5LJ3f 1KMMA 3E19A 2ZR3A 4L87A 4C5HA 1VQNA 2KK4A 2P5IA 2PMEA 5LJ5j 1NPPA 4IKFA 1K9MC 3JB9G 4LVKA 3HHTB 1GGMA 3M4YA 4QVZA 3FEOA 5A2QE 3GP8A 2GF7A 4C8QA 2CZ6B 2E12A 3M57A 1Q82U 3UT1A 1WLEA 1ZQ1A 3PFSA 3LW5E 2DXCA 4XTVA 3OYEA 4H2XB 2FL7A 2XG8D 5CCAA 2QI2A 3NFCA 1E22A 4PNOA 4XU0A 3CCLA 4P72A 1VQ5T 3JCMJ 2RJEA 2YRVA 3CCMT 3VQYA 4Q6GA 2ALYB 1WQWA 2K2VA 4YTLA 3LSQA 4K86A 4HCZA 4JLGA 2ZINA 3L42A 5LJ3j 3UPUA 1YITT 4E7IA 4V2SA 2DIQA 4C8QF 1VQOA 1VQ7A 4RG2A 1VUBA 1XNIA 1NJ6A 1WGSA 3PGGA 2E65A 1VQPT 1PSEA 3PMTA 5L8RE 4YCUA 3LLRA 3LGFA 4M77B 2DU5A 1MGQA 1X6OA 3OYJA 4DOVA 5FRMA 2AKWA 2E10A 1M1FA 3OMGA 5CKHA 1Q82C 1H4TA 3X26B 4C0DC 4LVMA 4UP8A 3L2RA 4KBMB 3OYCA 1BIAA 5I2MA 4ZTJA 2EKOA 3JCMW 4BD3A 3JB9F 2IY5B 3UFGA 2JUFA 2DD5A 5GAMd 1VQKA 3LYIA 1BKBA 2ZXFA 4TTVA 3QJ6A 4YCWA 3CCRT 4M78C 4B9XA 3WQZA 4C5IA 1I8FA 12ASA 2WSEE 1BBWA 2RJDA 4ATOA 2A8EA 2EJFA 3OYIA 3HKSA 1NE8A 1XQHA 4K87A 4X9DA 1Q7YC 3HXXA 2D0QB 3WXMB 2ZT8A 3CCEA 4N4GA 4OF1A 1YJ9A 3UDCA 4XEMA 1R8OB 3E9IA 2P0KA 5GANd 2YLBA 4IURA 2JTMA 3QO8A 2RHIA 3NTIA 4YRMA 1VQZA 1N9WA 4PLLA 2RO0A 2DPPB 3OSSC 4ZIBA 4JS4A 1EOVA 3HXWA 2RH2A 4JRQA 2QA4A 4J6WA 1SERA 3GF5A 1J5WA 4YROA 4RMOA 2CZ0B 2DD4A 1G3TA 3ERRA 1H4SA 3META 4MMKA 5A0LA 2P0QA 1M90U 4J8OA 5FU6B 5GAN2 3J81E 3HY0A 1QVPA 4JS5A 3VV0A 1G51A 3CCQT 1Y71A 4DQ2A 1M1KU 1VQLA 3MF2A 1BBUA 2DAQA 4Z02A 2RHSA 4ZGDB 3OW2S 1RI0A 3JCMV 5DM7R 1YCYA 4HCCA 5GANe 5GAOn 4L6V5 4M78G 1QW1A 3PZCA 4UP7A 3A7RA 4OGCA 5KCOA 4H2YA 2LNVA 1QVGA 1D3BB 2BKDN 2DZCA 1JB0E 5GMKe 2R5AA 2ZCFB 4HT9A 4H2SA 4M75E 2R58A 3G4SA 4PKCC 4HCBA 2O01E 3MHXA 1KHCA 3VKIA 3A31A 4M7AG 4IUPA 3HRKA 4YYEA 5HK3A 2XHCA 4M75D 1EIFA 4HKEA 3L4GB 2GFAA 3L1AA 4GLKA 2QQ9A 3RKXA 4EMKB 3A74A 1FWZA 4PJOC 4XTYA 3WVEB 2BIVA 3CD6T 3I55A 4P3OA 2CGHA 2K4YA 2QXFA 1YJWA 1VQ4T 4YRGA 1SESA 2RHZA 2L3RA 3QUIA 1M1KC 4X34A 1BIBA 2VYTA 3HFOA 1X54A 4M7DE 3HSBA 2OTLT 3DLMA 2E6ZA 3HRSA 3TEHB 4OMFB 4M7AA 2MWOA 1USYC 4LDUA 3A8OB 1VQ9A 2DXBA 1YJNA 2FVUA 4P3NA 3LX7A 5GANh 2QQRA 3VJPA 1E1OA 2YHTA 4TVRA 3M55A 5GMKh 1ZHIA 3CCUA 3A5ZA 3JCMe 4C92C 2AMCB 2D6FA 3L2WA 4CH6A 3GLXA 4J6XA 2ZTGA 1ATIA 5FRNA 3C12A 3G71A 1KQ2A 3EAEA 3MP8A 1VQ6T 3JRZA 2R57A 3HXVA 4BI3A 2ARUA 4EO4A 1B70B 5C0MA 3OD1A 1YIJA 3M59A 4KR3A 4A53A 1PYSB 2F5TX 4M7AF 2ZZFA 4JRPA 1HTTA 4NL3A 2FB7A 4PJOG 3OBYA 5CO7A 3JB9H 3CMQA 4BY6C 5ELNA 2NLUA 1OZ2A 5J26A 3UGQA 2PQWA 3PTAA 4KUDK 3SB2A 3OYLA 5GAN7 1KD1U 2J3MA 3RUXA 4OB2B 3FDRA 1NYRA 4CS2A 3OYFA 2RM4A 2EJ9A 1BYMA 1BI0A 2OTJA 4ZTUB 2VGNA 2X4YA 5A0GA 1X75C 4C0DB 2XGTA 3FIFA 5GMKi 1VIEA 3CC7T 1UGSB 5J39A 2ZPBB 3QG1A 3JCMh 5KE2A 4LD9K 1K9MU 2LQ8A 1NPRA 4ZGEB 3BFMA 1KC8U 3SWNB 2VXEA 1WQ7A 4PJOA 5C53B 1Z7MA 2I2LA 1H4QA 4C92G 3AHUA 2RB6A 5HK0A 4M77E 3OYAA 1M1GA 4YRQA 3G6ET 4L5GA 3CCVT 2XIDA 1M8VA 4TQDA 1WJRA 3Q1JA 4BE0A 3LH0A 5CK9A 2I4NA 3T9NA 2VXFA 4M77D 4M7DB 2LT4A 1JJCB 1G5HA 5GAOq 3VYGA 1Y7XA 3CPWA 4UPAA 4H2VA 1KD1C 1YGBA 4J5YA 1YFSA 1USYA 4N4HA 1QVFA 1WJSA 4B9WA 3J7AF 2MMPA 1N9SA 2KVQG 4IUVA 3CMET 3JCMg 3VUZA 2RHYA 2LC4A 3M53A 5C51B 4PJOF 4C92A 4ELZC 1Y96A 4HWOA 3P8YA 4RMFA 2RJFA 2CJAA 4KT0E 2RHQB 4C8QE 3HFZB 4CH3A 2WSFE 5CIUA 1LOJA 2MWPA 4WF2A 1KC8C 1OI1A 4P3PA 2XDBA 5HY6A 1ASZA 2QTXA 1FYFA 4LVJA 2KY9A 3GNGA 1X01A 3CEYA 2M1HA 4FM4B 3A7AA 3LWIA 1N6AA 3VYHB 2J3LA 4BDYA 3MEYA 1JJ2A 3CMAT 3P8HA 3OYYA 5FU7C 4C92F 4TVAA 2XK0A 2EYQA 2Y90A 4H2WA 5GMKl 4HVCA 4Q5WA 2EQUA 3S3NA 4Y91A 1WPYA 5M9OA 3OS5A 1YHQA 1N8RC 1VQ8A 2FHDA 1Q7YU 2QHTA 1KQ1A 1JBMA 2F5KA 2X4XA 3MCAB 4F7UG 1NJIU 3DKMA 3JCMf 1QF6A 2JVVA 3CCLT 1YB3A 3JB9I 3OYHA 1Q86U 4LDYA 4CH5A 5I2SA 3NETA 3QTCA 2ZNJA 1M5Q1 1WYDA 3CCJT 3RF1A 4LVIA 4WJ4A 3MP6A 2KMTA 2ZT5A 3CCRA 1NZ9A 3QYHB 4PL6A 4TVYA 4ZGJB 2EQKA 1VQ7T 3TU4K 4G85A 1H641 3QO3A 4YCVA 2WSCE 4CRIA 3N5BB 5C52B 5HKCA 3ASKA 3MO8A 4FSXA 3QPHA 1W4SA 4PG3A 4YREA 2XICA 3FRNA 4F7UA 5LJ5d 3KUFA 2XI9A 2ZCEA 4EMKA 1K8AU 3P8VA 1JRIA 4N4IA 4J7IA 2ZZGA 3E9HA 3HRUA 1S72A 3QO7A 3MP1A 2V8IA 4M7AC 1MHNA 3EFSA 2DTOA 4J6YA 2I4MA 4C8QB 5CVIA 1NJIC 4DOWA 3CBPA 3PMIA 2B8AA 3PCOB 1E1TA 2JN0A 2RI5A 1VQKT 1WNLA 2G3RA 1I5LA 3IALA 2P0PA 3CXCS 3H8ZA 1Q86C 2ZPHB 2EAYA 3HTZA 3NTKA 4OB1B 2QQSA 1M4ZA 1SETA 4BY6B 2ZNIA 2LTOA 3TEHA 2Q7HA 3CCQA 5GMKm 4UP9A 3QKJA 5GAMe 4F7UF 3I56A 4G84A 1WU7A 2P4TA 5LJ3d 2DDZA 3CCET 1Q81U 1YJ9T 4UC4A 3X20B 1B8AA 5LJ5e 5LL6S 2D9TA 4Y28E 1NJ8A 2AMCA 2ZIMA 3S3OA 3OQ5A 1G5VA 5FROA 4M75G 2PU9B 4EMHA 1K8AC 4OB3B 3ICAA 5CKFA 3GNFB 3M9QA 3KBGA 4ELYC 2E5QA 2OAUA 2QA4T 1B70A 3C95A 5KNNA 1YFRA 2QHSA 1B34B 2DXUA 3RACA 2O4XB 4X9CA 2JTFA 4CS3A 4A4KA 3OYDA 2VGMA 3M4GA 3JCMc 5K1XA 4O2DA 4P74A 3V7RA 1KHIA 1VQLT 2XTIA 5LJ3e 4HWTA 4Q15A 4MZPA 3VUBA 4M75A 3L2QA 1VQMT 3PT9A 4J7FA 3RL6A 5GAMh 1UEBA 1Q81C 3BDLA 2HQXA 3RGLA 3IKLA 4M78E 4P75A 4EX5A 2ZGWA 3SD4A 2E1HA 2RD1A 5GAOl 5LJ5h 3G4ST 4N0AA 4HT4A 4BUGA 1RIQA 2PVGB 3HXYA 3UGTA 2LDMA 1NNHA 1GXIE 5GAN8 3R07A 3QBYA 1ADYA 2E64A 1EIYB 2E5AA 3V8KA 2RK2A 3REUA 3X25B 3INZA 1Y07A 4M7DD 2XKOC 3P8DA 4HWRA 2DU7A 2K5LA 4FU6A 1M9SA 1XTDA 3I55T 3C94A 1KG1A 2CYZB 2RI3A 2ZPEB 3QHSA 1JJCA 2I4LA 4M75F 3OYMA 4FT4A 1NJ2A 3M4PA 3OSVA 1E24A 1W2BA 5CQYA 1SSFA 5GAMg 4XEOA 4BDZA 4RCCA 2LCCA 3HY1A 2DVEA 2XU8A 3VQWA 3CPWS 2A7YA 5LJ3h 1G3SA 4NS5A 3OW2A 4HT8A 2GFUA 3UH0A 2RHSB 4LVLA 4R56A 2ODRD 3OS0A 1VQ9T 4D6WA 1YJNT 4YRJA 1X55A 1FXXA 4JUVA 4XQ3A 3A32A 1O9SA 4CS4A 3CCUT 2V8JA 3HFZA 5GANg 2QEXT 4E7HA 3ZBDA 4YRFA 4M7DF 1KQSA 1QE0A 1ASYA 1WJQA 3M56A 3FLGA 3DB3A 2DTHA 2G4CA 2HQEA 4P73C 2AHJB 2C7IA 2HBPA 4H2UA 3CC4A 2L89A 4IUUA 5IN1A 4H2XA 2K3YA 2DXTA 4JDSA 3CC2A 1B7YB 4M77G 4ME7A 3F70A 1BI2A 3M4QA 3CCVA 2VC8A 2ZZDA 2ZIOA 2LRQA 4XU1A 4KULA 4PJOE 4YRTA 5FU6C 4C5GA 4MMLA 4OLFA 4RCBA 3HL8A 2ALYA 4QQ6A 5D6XA 1ZBXA 2PUOB 1YI2T 4KQEA 1O75A 4M78B 5IAYA 2C06A 5I21A 3TUPA 3I7FA 3BJUA 5GAMf 4E7JA 4K88A 4RG8A 4JRKA 1QP3A 2ZR2A 3CCSA 5CQXA 4HWSA 4PHCA 2E70A 3NTHA 3E9FA 3V7SA 1UGQB 4WJ3M 2FYKA 4XAXB 5HGQA 4M77A 4NCXA 3PIPA 5AYFA 1G3WA 1KOGA 3QZ5B 3A5ZB 4C0FA 5CKBA 1N8RU 4C92E 5GANf 4EMKC 2EJGA 2CZ7B 2IG0A 3JCMP 2ZT6A 1TH7A 3EFRA 5K1PA 3OYKA 3HXUA 2IY5A 3OS2A 3RERA 3L2VA 1G5IA 3JCMX 3A8MB 1C0AA 3LSSA 2LX9A 5IT9E 4EPCA 3V8LA 3OB9A 4XU3A 3QSUA 2CJ9A 1LJOA 4HWPA 5E3IA 3M54A 2MAMA 3ZFJA 2RHUA 3O8VA 3CMAA 5DLQE 1VQ5A 3M58A 4C8QD 2LCLA 2MI6A 3JAME 2DO3A 1NJ1A 4BACA 4M77F 3CCMA 4YPFA 2Q5IA 3G7ZA 3A8LB 5EG2A 5DY9A 4E47A 3TREA 1YITA 3DB4A 3PCOA 2JOYA 1VQNT 1LYLA 2EIFA 1L0WA 1PSFA 5GANj 5CAIA 4NL2A 4P71A 2JNGA 1X2HA 4RQFA 4P73A 4L59A 1VQPA 1Z7NA 2VUBA 5GMKj 4ZN3A 4NOYA 4FT2A 3RMSA 3JB9D 3HP9A 3GOXA 4A4EA 4BB7A 3MQZA 4PJOB 2RA2A 4ZN1A 1UB4A 3CCJA 5CKEA 4MDXA 4FIBA 3M5AA 3HFNA 3X28B 3OY9A 4LDWA 2ZT7A 3BY7A 1H3ZA 2CJBA 2WACA 3OYGA 4P74C 5A0DA 2KAFA 5CR2A 4OVAA 1N27A 1IL2A 3CPFA 3HRTA 1SRYA 1UGPB 4C0ZA 4QQGA 1YHQT 2A3LA 1VQ8T 3A5YA 3QYGB 3HRIA 1I81A 3IKMB 4H2TA 1D3BA 1B34A 1VQOT 4M75C 3RMQA 3FJPA 2EQMA 2O4XA 2V8KA 1N9RA 3VU3C 1OZ3A 3S6WA 4F7UE 4P75C 3J80E 2C8MA 11ASA 2XD0A 1QVGS 3L2UA 2PUKB 2QQAA 4C92B 4N0AC 1X56A 1NJ5A 1Y96B 4H02A 3L4GA 2ZPGB 1XOVA 4XTWA 3TEGA 2EWNA 4JRIA 3MEAA 3SWNC 4KUIA 4XTZA 2F69A 2VV5A 2QHVA 2KDSA 5KE3A 2CKKA 4RKUE 4RQEA 2DZ9A 2MF2A 3LC0A 3R6OA 3QO5A 1G3YA 4A4GA 2L8DA 4LD6A 2PVDB 3IG2A 2DIGA 4M7DC 2NS6A 4E51A 1IZ6A 3PNWC 4YRRA 3E9GA 3QZ9B 1U1SA 3TEEA 2Y4YA 4X5OA 4J15A 1EIYA 1BI1A 2P0LA 2CIMA 2E3CA 4YRSA 3LGLA 1HC7A 4TVAB 1U8RA 1S72T 3P8TA 4YRPA 2M0OA 3GIBA 3NELA 2DQ0A 2GQVA 3JSCA 3G1ZA 4FL6A 2E41A 1P92A 4O5VA 2BUDA 1AHJB 3MEVA 1HXDA 3OA6A 3LWHA 2ODRC 3OMCA 4A4FA 5GAN5 4QVCA 1EQRA 1KMNA 1W2BS 3ER0A 4CI0C 5FLXE 4R55A 2DQ3A 4XK8E 3I56T 2X35A 4YP0A 2LT1A 3MEUA 3REXA 3ME9A 4CH4A 1PYSA 2AKWB 5GAN3 4DPGA 2ARSA 1EVKA 1RL2A 3KXTA 2CS7A 1VQMA 1UGRB 3CD6A 4BW9A 4E7LA 3A7UA 2K3XA 1IREB 2DKGA 4E7KA 1VQ4A 4BE2A 3RIRA 3SDZA 3JB9J 5D6YA 4EDUA 1LNXA 2IVWA 3FB9A 4OGEA 3RESA 4MDWA 4M7DG 2E6NA 4LDVA 4XTXA 4F7UB 1KQSS 4AH6A 2OTLA 4HA8A 5C6SA 1B76A 2L5QA 4LDXA 3BDUA 4GY5A 3WVDB 3QDRB 1B7YA 3JCMd 2X4JA 2M9UA 4C5EA 2RJCA 2GCXA 1I4K1 4TQFA 4RDXA 3FC3A 4A54A 3DSQA 4M78D 4VUBA 4XU2A 3L2ZA 3OS1A 2Y4XA 4M7AE 3SWNA 1M90C 3CXCA 4M77C 3QIIA 3PIOA 4M78A 2LQKA 3SFMA 1YFTA 4TVWA 4M7AD 3RKWA 2RI2A 3A8HB 4DA4A 1VQ6A 2K57A 4MZTA 1YJWT 4TWAA 5F5WA 4M7DA 2DTIA 1U1TA 3VQVA 4J83A 4XTUA 3URGA 2PVOB 1EFWA 3MF1A 3QJYA 4BI4A 5KCHA 3CBMA 3X24B 4O6JA 1V29B 5ELOA 4QQDA 3JCMQ 1H4VB 1K73U 4BWAA 5CKDA 5FU7B 3DLLA 2EQJA 5LJ5g 2QHUA 2ZPFB 2QEXA 3TCJA 1OYXA 1EVLA 1QVFS 4JLIA 4IUTA 3OYBA 2HAXA 3CBOA 4M78F 4WI1A 3ZEHA 1ADJA 4C8QC 2RHQA 2H3JA 3BW1A 2XDDA 3HPWA 2K5FA 2RHXA 4P5NA 3G71T 3CC7A 2DK3A 2K5IA 3VBBA 4BI8B 4P71C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A G;  5LJ5 d;  3HRK A;  4C8Q D;  4YYE A;  1NYQ A;  4M75 D;  2ZCE A;  4EMK A;  1NJ1 A;  4P72 C;  4YRI A;  3L4G B;  3L1A A;  2Q7E A;  4M77 F;  3P8V A;  4YPF A;  5GAN 6;  1JRI A;  3RKX A;  4EMK B;  3A74 A;  4YRL A;  2ZZG A;  2Q5I A;  2DEQ A;  3E9H A;  5DY9 A;  5LJ3 g;  4PJO C;  2PMF A;  1X2G A;  3QO7 A;  4M7A C;  4XTY A;  3EFS A;  4EMG A;  2DTO A;  4J6Y A;  2I4M A;  4C8Q B;  4M75 B;  4P3O A;  2CGH A;  3PCO A;  5GAO p;  1LYL A;  4YRG A;  5GAO m;  3V7C A;  3PCO B;  1E1T A;  1L0W A;  2JN0 A;  1SES A;  3JCM b;  1WNL A;  5GAN j;  5CAI A;  1I5L A;  4NL2 A;  4P71 A;  3IAL A;  2ZZE A;  1X2H A;  4PJO D;  3QUI A;  3QNE A;  4RQF A;  1BIB A;  3HFO A;  2EAY A;  4P73 A;  3HTZ A;  1X54 A;  1Z7N A;  5GAN 4;  4LNS A;  5GMK j;  4M7D E;  4NOY A;  1SET A;  3HSB A;  2ZNI A;  3TEH A;  2Q7H A;  2ART A;  3JB9 D;  2Q7G A;  5GMK m;  3RKY A;  1HK9 A;  4UP9 A;  3TEH B;  5GAM e;  2Q5H A;  4F7U F;  2HNI A;  4M7A A;  4G84 A;  5LJ5 f;  1USY C;  4PJO B;  1WU7 A;  3KFU A;  2RA2 A;  5LJ3 d;  2DDZ A;  4M7A B;  4P3N A;  5GAN h;  2EL9 A;  3HXZ A;  3HFN A;  1B8A A;  5LJ5 e;  3NEM A;  1E1O A;  2YHT A;  3VQX A;  2ZT7 A;  1NJ8 A;  3BY7 A;  4YDQ A;  2DJZ A;  2AMC A;  5GAO r;  5GMK h;  3A5Z A;  2ZIM A;  2CJB A;  4YRK A;  3JCM e;  4C92 C;  2AMC B;  3HFV A;  4P74 C;  4YRC A;  2YLC A;  4CH6 A;  4C8Q G;  4J6X A;  2ZTG A;  1ATI A;  4M75 G;  3NEN A;  4YRN A;  1IL2 A;  1SRY A;  4EMH A;  1KQ2 A;  3ICA A;  4QVD A;  3W3S A;  3A5Y A;  3HRI A;  1I81 A;  3IKM B;  4H2T A;  3HXV A;  1B70 A;  2I4O A;  4C92 D;  5KNN A;  1D3B A;  1B34 A;  4M75 C;  3FJP A;  2ARU A;  4EO4 A;  1B70 B;  1YFR A;  3V8J A;  1B34 B;  1N9R A;  2QHS A;  2DXU A;  3VU3 C;  3OD1 A;  4ZTZ B;  3RAC A;  4F7U E;  4P75 C;  4KR3 A;  2C8M A;  4X9C A;  1W66 A;  11AS A;  4A53 A;  4CS3 A;  4KR2 A;  1PYS B;  3M4G A;  3JCM c;  5GAM j;  5K1X A;  4M7A F;  2ZZF A;  1HTT A;  4O2D A;  4P74 A;  4OP0 A;  4NL3 A;  5LJ3 f;  2FB7 A;  1KMM A;  4PJO G;  4C92 B;  4N0A C;  1X56 A;  2ZR3 A;  1NJ5 A;  3JB9 H;  3CMQ A;  4L87 A;  1Y96 B;  3V7R A;  3L4G A;  4H02 A;  2P5I A;  2PME A;  2XTI A;  5LJ5 j;  5ELN A;  4XTW A;  5LJ3 e;  3TEG A;  3UGQ A;  2EWN A;  3JB9 G;  4JRI A;  3SB2 A;  5GAN 7;  3SWN C;  1GGM A;  2J3M A;  3RUX A;  4HWT A;  1NYR A;  4Q15 A;  4XTZ A;  4CS2 A;  4C8Q A;  2RM4 A;  2EJ9 A;  2QHV A;  4M75 A;  3RL6 A;  5GAM h;  4ZTU B;  3RGL A;  4RQE A;  3IKL A;  4M78 E;  4P75 A;  1WLE A;  4EX5 A;  2DZ9 A;  2ZGW A;  2E1H A;  2RD1 A;  3LC0 A;  3QO5 A;  4XTV A;  4H2X B;  2XGT A;  5GAO l;  3FIF A;  5LJ5 h;  1E22 A;  3IG2 A;  4M7D C;  4E51 A;  5GMK i;  4N0A A;  4YRR A;  4PNO A;  1U1S A;  1RIQ A;  3HXY A;  4XU0 A;  3UGT A;  3JCM h;  1NNH A;  4P72 A;  4X5O A;  4J15 A;  3JCM J;  1EIY A;  5GAN 8;  3R07 A;  2P0L A;  2CIM A;  1ADY A;  3BFM A;  2E64 A;  1EIY B;  3SWN B;  2E5A A;  2VXE A;  3V8K A;  2E3C A;  1WQ7 A;  4PJO A;  3VQY A;  5C53 B;  4YRS A;  4Q6G A;  3REU A;  1Z7M A;  2I2L A;  2ALY B;  1WQW A;  1H4Q A;  3INZ A;  1HC7 A;  4C92 G;  3AHU A;  4TVA B;  2RB6 A;  4M7D D;  3LSQ A;  4K86 A;  4M77 E;  3P8T A;  4HWR A;  4YRQ A;  2ZIN A;  2DU7 A;  5LJ3 j;  4YRP A;  1M8V A;  4TQD A;  4V2S A;  3GIB A;  3NEL A;  2DQ0 A;  2I4N A;  2VXF A;  4C8Q F;  3QHS A;  4M77 D;  1JJC A;  2I4L A;  3G1Z A;  4M75 F;  1NJ2 A;  3M4P A;  4M7D B;  2E41 A;  1JJC B;  1E24 A;  1NJ6 A;  1G5H A;  3PGG A;  5GAO q;  1HXD A;  2ODR C;  5GAM g;  4XEO A;  4RCC A;  5GAN 5;  4QVC A;  1EQR A;  2E65 A;  1KMN A;  4UPA A;  3HY1 A;  4H2V A;  4YCU A;  2DVE A;  3VQW A;  2DQ3 A;  1YGB A;  4J5Y A;  5LJ3 h;  4M77 B;  1YFS A;  1USY A;  2DU5 A;  1MGQ A;  4HT8 A;  1N9S A;  3UH0 A;  2AKW A;  4YP0 A;  2E10 A;  2RHS B;  3REX A;  3JCM g;  4CH4 A;  2ODR D;  1PYS A;  2AKW B;  5GAN 3;  4DPG A;  1H4T A;  5C51 B;  4YRJ A;  1X55 A;  2ARS A;  4UP8 A;  4JUV A;  4PJO F;  1EVK A;  4C92 A;  4BW9 A;  4XQ3 A;  1Y96 A;  1BIA A;  3A32 A;  4HWO A;  3A7U A;  4CS4 A;  3P8Y A;  4RMF A;  3JCM W;  2CJA A;  2DKG A;  3HFZ A;  3JB9 F;  2IY5 B;  2RHQ B;  5GAN g;  3UFG A;  4C8Q E;  3HFZ B;  5GAM d;  3RIR A;  3JB9 J;  4CH3 A;  1LOJ A;  4YRF A;  4WF2 A;  2ZXF A;  4M7D F;  4TTV A;  1LNX A;  4P3P A;  1QE0 A;  1ASY A;  3FB9 A;  3RES A;  4YCW A;  1ASZ A;  4M7D G;  4M78 C;  2QTX A;  1FYF A;  2DTH A;  2G4C A;  3WQZ A;  1I8F A;  4XTX A;  4F7U B;  4AH6 A;  12AS A;  4P73 C;  4HA8 A;  2C7I A;  1BBW A;  1B76 A;  3BDU A;  4H2U A;  1X01 A;  4H2X A;  1B7Y A;  2EJF A;  3JCM d;  2DXT A;  4K87 A;  4X9D A;  1B7Y B;  3HXX A;  1I4K 1;  4M77 G;  2ZT8 A;  4TQF A;  4RDX A;  4A54 A;  3M4Q A;  3A7A A;  3DSQ A;  2VC8 A;  2ZIO A;  4M78 D;  4XU1 A;  4XEM A;  4XU2 A;  3L2Z A;  3E9I A;  2J3L A;  3MEY A;  4PJO E;  4M7A E;  4YRT A;  3SWN A;  5GAN d;  2YLB A;  4MML A;  4OLF A;  4RCB A;  3QO8 A;  2ALY A;  4C92 F;  4M77 C;  4TVA A;  4YRM A;  2Y90 A;  4M78 A;  4H2W A;  5GMK l;  4HVC A;  1YFT A;  4TVW A;  4KQE A;  4Y91 A;  3TUP A;  4M78 B;  4M7A D;  1WPY A;  5I21 A;  3RKW A;  1N9W A;  1VQZ A;  3I7F A;  3BJU A;  5GAM f;  4ZIB A;  4K88 A;  1EOV A;  3HXW A;  2K57 A;  4JRK A;  2ZR2 A;  4J6W A;  4TWA A;  1SER A;  5F5W A;  4M7D A;  4YRO A;  1J5W A;  2DTI A;  1U1T A;  3VQV A;  2QHT A;  1KQ1 A;  4XTU A;  1JBM A;  1EFW A;  3MF1 A;  4HWS A;  4F7U G;  4PHC A;  3ERR A;  1H4S A;  3JCM f;  4MMK A;  1QF6 A;  3V7S A;  4P71 C;  4WJ3 M;  2FYK A;  5ELO A;  3JCM Q;  4M77 A;  5HGQ A;  5GAN 2;  1H4V B;  4NCX A;  4BWA A;  1YB3 A;  3JB9 I;  3HY0 A;  1G51 A;  5LJ5 g;  2QHU A;  1KOG A;  4DQ2 A;  3MF2 A;  1BBU A;  4CH5 A;  2RHS A;  3NET A;  3QTC A;  2ZNJ A;  1M5Q 1;  1EVL A;  4C92 E;  5GAN f;  1WYD A;  4JLI A;  4EMK C;  3RF1 A;  2EJG A;  3JCM V;  4WJ4 A;  1YCY A;  2ZT5 A;  3JCM P;  2ZT6 A;  4M78 F;  4WI1 A;  1TH7 A;  3EFR A;  1ADJ A;  5GAN e;  5K1P A;  4TVY A;  5GAO n;  4C8Q C;  4M78 G;  3HXU A;  2IY5 A;  3PZC A;  4UP7 A;  2RHQ A;  3RER A;  3A7R A;  4G85 A;  1H64 1;  3BW1 A;  4H2Y A;  3QO3 A;  4YCV A;  1D3B B;  1G5I A;  3JCM X;  1C0A A;  5GMK e;  2DZC A;  3LSS A;  5C52 B;  4HT9 A;  4H2S A;  4M75 E;  3V8L A;  4XU3 A;  3QSU A;  2CJ9 A;  1LJO A;  4HWP A;  4PG3 A;  5E3I A;  4YRE A;  3VBB A;  3A31 A;  4F7U A; 
#chains in the Genus database with same CATH topology
 1UJY A;  1NYQ A;  1GBR A;  3E2U A;  1WZO A;  3EG0 A;  4P72 C;  4YRI A;  2Q7E A;  5GAN 6;  4YRL A;  1W70 A;  1YIJ T;  4QW2 A;  2DEQ A;  1YI2 A;  2KQW A;  5LJ3 g;  2PMF A;  1X2G A;  2HD0 A;  3G6E A;  3GPL A;  4EMG A;  2RQW A;  1YWO A;  2YUO A;  2KI7 A;  4M75 B;  2EFI A;  4J9B A;  4ZTF A;  4IIM A;  4E2F B;  1VIF A;  5J3B A;  5GAO p;  4D8D A;  5GJV B;  5GAO m;  3E1S A;  3V7C A;  1JJ2 S;  1K73 C;  3JCM b;  2KGT A;  2DJQ A;  2LVM A;  2ZZE A;  2K3B A;  4PJO D;  3QNE A;  5D6W A;  5KH6 A;  5GAN 4;  4LNS A;  4C0G A;  2OTJ T;  3MEW A;  2DL8 A;  1UEC A;  2KR3 A;  3OBW A;  2ART A;  1Q81 R;  4IUQ A;  2Q7G A;  3CC4 T;  1DJ7 B;  2YT6 A;  2RK1 A;  1HK9 A;  4II1 A;  3RKY A;  3H6Z A;  4JJN K;  2L3P A;  3GBQ A;  2Q5H A;  2HNI A;  1FX7 A;  5LJ5 f;  2COZ A;  2GGR A;  2QQB A;  3CC2 T;  3CME A;  3KFU A;  4M7A B;  1BI3 A;  1G83 A;  1YCS B;  2XDP A;  2EL9 A;  2H8H A;  3HXZ A;  2FZG B;  3NEM A;  3S3M A;  2R5M A;  1AWW A;  4BE1 A;  1W2B P;  4CC2 A;  3PVL A;  2QDY B;  3VQX A;  4MZM A;  1S1N A;  3I35 A;  4YDQ A;  2DJZ A;  4HVW A;  5GAO r;  3UWN A;  2EYX A;  4YRK A;  1UUE A;  3C4S A;  3HFV A;  4YRC A;  2GBQ A;  4A4H A;  1WXT A;  2YLC A;  4C8Q G;  1OUL A;  3EG9 A;  2CZ1 B;  3NEN A;  4YRN A;  2X4W A;  4OMN A;  3A8G B;  3QXE B;  1KK7 A;  1ZUK A;  1VQN Q;  1N5Z A;  1JXM A;  3H0F A;  4QVD A;  3P8B B;  2M16 A;  2ZPI B;  2COW A;  3W3S A;  1TWB A;  2V1R A;  1E6G A;  4OB0 B;  3CCS T;  2I4O A;  2J7I A;  4C92 D;  2JZ2 A;  1TTH B;  3V8J A;  2FPD A;  4ZTZ B;  1V76 A;  1QP2 A;  2DL3 A;  1YBY A;  2HL5 C;  2KSS A;  1W66 A;  4KR2 A;  3OYN A;  2A28 A;  5GAM j;  1BBZ A;  3VS7 A;  4OP0 A;  5DLO A;  4PLI A;  5LJ3 f;  1IO6 A;  3ULR B;  1KMM A;  3E19 A;  3PVQ A;  2ZR3 A;  4L87 A;  1KQS P;  4C5H A;  2C0T A;  1VQN A;  2KK4 A;  2P5I A;  2PME A;  1T3S A;  2HL3 A;  5LJ5 j;  1MV0 B;  1NPP A;  4IKF A;  1K9M C;  3JB9 G;  4LVK A;  3HHT B;  1GGM A;  2RQU A;  3M4Y A;  4QVZ A;  3FEO A;  5A2Q E;  2D1X A;  1RAB B;  3GP8 A;  2GF7 A;  4C8Q A;  1TOV A;  2CZ6 B;  3UF4 A;  2CP3 A;  2E12 A;  3M57 A;  4OMM A;  1J3T A;  4DBR A;  1Q82 U;  1K76 A;  4E6R A;  3UT1 A;  1WLE A;  1ZQ1 A;  5FW9 A;  3PFS A;  1JU5 C;  3LW5 E;  1YHQ Q;  2BTT A;  2DXC A;  4XTV A;  3OYE A;  4H2X B;  2FL7 A;  2XG8 D;  5CCA A;  1VQ8 Q;  2QI2 A;  3NFC A;  1FMW A;  1E22 A;  3A98 A;  4PNO A;  2KRN A;  1D1B A;  4XU0 A;  1VQO Q;  3CCL A;  4P72 A;  1RAF B;  1VQ5 T;  3JCM J;  2A37 A;  2RJE A;  2YRV A;  3CCM T;  2DBM A;  3VQY A;  3RBB B;  4Q6G A;  2EGA A;  1WQW A;  1WIE A;  2ALY B;  2K2V A;  4YTL A;  3LSQ A;  4K86 A;  4HCZ A;  4JLG A;  2ZIN A;  2AK5 A;  3RR6 A;  4HVU A;  2RNA A;  3L42 A;  1GFD A;  3M0S A;  5LJ3 j;  3UPU A;  1YIT T;  1WX6 A;  2ROL A;  3SHW A;  4E7I A;  1GBQ A;  4ESR A;  4V2S A;  2DIQ A;  4C8Q F;  1VQO A;  2DL5 A;  3MPU B;  1VQ7 A;  2F2W A;  1KIK A;  2FZK B;  4RG2 A;  1VUB A;  1XNI A;  1AWX A;  1NJ6 A;  1WGS A;  3PGG A;  2HEQ A;  2LP5 A;  2E5K A;  2X51 A;  1QVF P;  2RMO A;  2E65 A;  1VQP T;  1PSE A;  3PMT A;  5L8R E;  4YCU A;  2CP0 A;  2OI3 A;  3LLR A;  1QCN A;  3LGF A;  2L0A A;  4M77 B;  1D0Z A;  2DU5 A;  1MGQ A;  1X6O A;  3OYJ A;  4DOV A;  3REB B;  5FRM A;  2AKW A;  1B07 A;  2E10 A;  1M1F A;  3OMG A;  5CKH A;  1Q82 C;  4F17 A;  1H4T A;  3X26 B;  4C0D C;  1ARK A;  4LVM A;  4UP8 A;  1W6X A;  3L2R A;  4PFZ A;  4KBM B;  8ATC B;  3OYC A;  1BIA A;  5I2M A;  4ZTJ A;  2EKO A;  3JCM W;  4BD3 A;  1S72 Q;  2LQN A;  3JB9 F;  2IY5 B;  3UFG A;  2JUF A;  2DD5 A;  5GAM d;  1VQK A;  3LYI A;  1BKB A;  2ZXF A;  4TTV A;  5I22 A;  3QJ6 A;  1G8X A;  3H0I A;  4YCW A;  3CCR T;  3MKD A;  4M78 C;  4B9X A;  3WQZ A;  4C5I A;  1I8F A;  12AS A;  1RLQ C;  2WSE E;  1BBW A;  3UA6 A;  1SSH A;  2J6F A;  2RJD A;  4ATO A;  2A8E A;  2EJF A;  3OYI A;  3HKS A;  1NE8 A;  1XQH A;  1JJ2 P;  4K87 A;  4X9D A;  2E4H A;  2RPN A;  1Q7Y C;  3HXX A;  2D0Q B;  3WXM B;  2ZT8 A;  3CCE A;  4N4G A;  4OF1 A;  1YJ9 A;  3UDC A;  4XEM A;  1R8O B;  1F1B B;  3I56 Q;  1C6V X;  3E9I A;  1RAI B;  2P0K A;  1KJW A;  5GAN d;  2YLB A;  4IUR A;  1WHJ A;  2JTM A;  3QO8 A;  1RAE B;  2RHI A;  2QAS A;  3NTI A;  4F16 A;  4YRM A;  1X2Q A;  3HTR A;  4FW2 A;  2HBW A;  1N9W A;  1VQZ A;  4PLL A;  1SPK A;  2RO0 A;  2DPP B;  3OSS C;  4RTU A;  4ZIB A;  2G6F X;  4JS4 A;  1VQL Q;  1EOV A;  3HXW A;  2CP6 A;  2RH2 A;  4JRQ A;  2QA4 A;  2CSQ A;  4J6W A;  1SER A;  1ZUY A;  4RTT A;  5AT1 B;  3RNJ A;  3GF5 A;  1J5W A;  4YRO A;  4J9H A;  2EYW A;  2Z0W A;  4RMO A;  3I9Q A;  2GTJ A;  2CZ0 B;  2DD4 A;  1G3T A;  1D1C A;  1M2O A;  5L23 A;  2KRO A;  3ERR A;  1H4S A;  4Z8A A;  3MET A;  2DRK A;  4MMK A;  5A0L A;  2P0Q A;  1M90 U;  4J8O A;  1ZSZ C;  5FU6 B;  5GAN 2;  2DFU A;  1UTI A;  2YRD A;  3QWY A;  3J81 E;  3VRY A;  3HY0 A;  1QVP A;  4JS5 A;  3VV0 A;  1G51 A;  3CCQ T;  1Y71 A;  2EPD A;  4DQ2 A;  1M1K U;  1VQL A;  3MF2 A;  1BBU A;  2DAQ A;  4Z02 A;  2RHS A;  4ZGD B;  3OW2 S;  5FWB A;  1M2V A;  2D0N A;  1GCQ C;  1RI0 A;  3JCM V;  4DBH A;  5DM7 R;  1YCY A;  3JV3 A;  1ZX6 A;  2FPE A;  4HCC A;  2QGF B;  1WHM A;  5GAN e;  1SG5 A;  5GAO n;  4L6V 5;  4M78 G;  1QW1 A;  3PZC A;  4UP7 A;  3A7R A;  4OGC A;  1AZE A;  5KCO A;  4H2Y A;  2LNV A;  1QVG A;  1D3B B;  2BKD N;  2DZC A;  1JB0 E;  5GMK e;  2R5A A;  2ZCF B;  4HT9 A;  4H2S A;  4M75 E;  2R58 A;  1MMD A;  3G4S A;  2ENM A;  4PKC C;  4HCB A;  1WHL A;  1YJW Q;  2O01 E;  1VYV A;  1IB8 A;  1KHC A;  3MHX A;  3M0T A;  3VKI A;  3A31 A;  1WLP B;  4M7A G;  1U06 A;  3C0C A;  4IUP A;  3HRK A;  4YYE A;  5HK3 A;  1W1F A;  5KYW A;  2XHC A;  4M75 D;  1EIF A;  4HKE A;  3VS1 A;  3L4G B;  2GFA A;  3L1A A;  4GLK A;  2FEI A;  2QQ9 A;  4LN2 A;  3RKX A;  4EMK B;  1HJD A;  3A74 A;  1XJW B;  2KXD A;  1FWZ A;  4PJO C;  4XTY A;  3KFV A;  3WVE B;  2BIV A;  3CD6 T;  3I55 A;  4P3O A;  2CGH A;  2K4Y A;  2QXF A;  1YJW A;  4DEY A;  1VQ4 T;  4YRG A;  2A0F B;  1ZA2 B;  1WHK A;  1SES A;  2RHZ A;  3G1J A;  2L3R A;  3QUI A;  1M1K C;  4X34 A;  1BIB A;  1ABQ A;  2VYT A;  3HFO A;  1X54 A;  4M7D E;  3HSB A;  1AOJ A;  2OTL T;  1T0H A;  3DLM A;  2E6Z A;  2JMC A;  3HRS A;  3TEH B;  2F2X A;  3G71 Q;  4OMF B;  4M7A A;  2MWO A;  1D1A A;  1USY C;  2FZC B;  4LDU A;  3A8O B;  2IPO B;  2L3S A;  1YWP A;  2GQI A;  1VQ9 A;  2DXB A;  1YJN A;  2FVU A;  4P3N A;  3LX7 A;  5GAN h;  2QQR A;  1CKB A;  3VJP A;  2LJ0 A;  4A63 B;  1E1O A;  2NUP B;  2AKL A;  2YHT A;  1T3L A;  5ECA A;  4TVR A;  1YIJ Q;  1TSF A;  3M55 A;  3VS6 A;  4FCY A;  5GMK h;  1ZHI A;  1MNE A;  3CCU A;  3A5Z A;  3JCM e;  4J9I A;  4C92 C;  2AMC B;  2D6F A;  2H3E B;  3L2W A;  4FYW B;  4CH6 A;  3GLX A;  4J6X A;  2ZTG A;  1ATI A;  5FRN A;  1X43 A;  3EHQ A;  3C12 A;  2MK5 A;  3G71 A;  1KQ2 A;  1D0Y A;  3I5S A;  3EAE A;  2AT1 B;  2L2P A;  3MP8 A;  1VQ6 T;  3JRZ A;  2R57 A;  2CSI A;  1AD5 A;  1TXQ A;  3HXV A;  4BI3 A;  3MJX A;  9ATC B;  4EIK A;  2ARU A;  4EO4 A;  1B70 B;  3M0U A;  5C0M A;  3OD1 A;  1YIJ A;  2BE9 B;  3M59 A;  2OTJ Q;  4KR3 A;  1GL5 A;  4J9E A;  2K9G A;  4AFU C;  4A53 A;  2LNH B;  1PYS B;  2F5T X;  3CC4 Q;  1OQK A;  4M7A F;  2ZZF A;  4JRP A;  1HTT A;  2J6K A;  4NL3 A;  2FB7 A;  3ZL7 C;  4PJO G;  3OBY A;  2VVK A;  3CC2 Q;  5CO7 A;  3JB9 H;  3CMQ A;  1GCQ A;  2KRM A;  4BY6 C;  5ELN A;  2NLU A;  1OZ2 A;  5J26 A;  3UGQ A;  2PQW A;  3PTA A;  4KUD K;  3SB2 A;  3UA7 A;  4GLM A;  5GAN 7;  3OYL A;  1KD1 U;  2J3M A;  2AKK A;  1C1A A;  3RUX A;  4OB2 B;  2DEU A;  3FDR A;  1NYR A;  1QKX A;  2RQV A;  4CS2 A;  3OYF A;  2RM4 A;  2EJ9 A;  1BYM A;  1BI0 A;  2OTJ A;  1LPL A;  2YRC A;  4ZTU B;  1MND A;  5HCK A;  2YWW A;  1OEB A;  2VGN A;  2X4Y A;  5A0G A;  1X75 C;  4C0D B;  2XGT A;  4KH0 B;  3FIF A;  2EKH A;  2FRW A;  5GMK i;  1VIE A;  3CXC P;  4PFP A;  1SRM A;  3CC7 T;  3CCS Q;  1UGS B;  5J39 A;  2LZ6 B;  2ZPB B;  2RN8 A;  3QG1 A;  3JCM h;  5KE2 A;  4LD9 K;  3SEM A;  1K9M U;  2LQ8 A;  2DYI A;  1NPR A;  4ZGE B;  3BFM A;  2FRY A;  1KC8 U;  3SWN B;  2VXE A;  1WQ7 A;  4PJO A;  5C53 B;  2KT8 A;  1Z7M A;  2I2L A;  1H4Q A;  1CSK A;  4C92 G;  3AHU A;  2RB6 A;  5HK0 A;  4M77 E;  2FPF A;  3OYA A;  2DE0 X;  1M1G A;  2QTV A;  4YRQ A;  2ECZ A;  3G6E T;  4L5G A;  3CCV T;  2XID A;  3EGD B;  1OOT A;  1KSW A;  1M8V A;  4TQD A;  1WJR A;  3EG1 A;  3Q1J A;  4CC3 A;  4BE0 A;  3LH0 A;  5CK9 A;  4FYV B;  2I4N A;  3T9N A;  1Z9Z A;  2VXF A;  4M77 D;  1M90 R;  3EFO B;  2NUT B;  2LT4 A;  4M7D B;  1JJC B;  1G5H A;  4RTZ A;  5GAO q;  3NHN A;  3VYG A;  3OW2 P;  1Y7X A;  1K4U S;  3CPW A;  2A08 A;  1K1Z A;  4UPA A;  2SRC A;  4H2V A;  1KD1 C;  1YGB A;  4J5Y A;  1YFS A;  1USY A;  2F2V A;  4N4H A;  1QVF A;  1WJS A;  4B9W A;  3J7A F;  2MMP A;  1N9S A;  3TSZ A;  2KVQ G;  4F04 B;  4IUV A;  3CME T;  3JCM g;  3VUZ A;  1VQ5 Q;  2RHY A;  5D7U A;  2LC4 A;  3M53 A;  5C51 B;  4PJO F;  4C92 A;  3CCM Q;  4ELZ C;  4E7S A;  4K11 A;  1Y96 A;  4HWO A;  1WHG A;  3P8Y A;  4RMF A;  2RJF A;  2CJA A;  2HKQ B;  1PD1 A;  2HDA A;  4KT0 E;  1HD3 A;  2RHQ B;  1RAG B;  2DYB A;  1RI9 A;  4C8Q E;  3HFZ B;  1YIT Q;  4CH3 A;  2WSF E;  5CIU A;  1LOJ A;  2MWP A;  4WF2 A;  1KC8 C;  1OI1 A;  4P3P A;  2XDB A;  5HY6 A;  1ASZ A;  2QTX A;  1FYF A;  4CC4 B;  2HCK A;  4LVJ A;  2KY9 A;  1UG1 A;  3GNG A;  1X01 A;  3CEY A;  1VQP Q;  2O9V A;  2M1H A;  3TQ7 P;  4FM4 B;  3A7A A;  3LWI A;  1N6A A;  1NM7 A;  2CP5 A;  3VYH B;  2GTO A;  1TUD A;  2J3L A;  4BDY A;  3MEY A;  1JJ2 A;  3CMA T;  1Y0M A;  3P8H A;  3REA B;  3OYY A;  5FU7 C;  4C92 F;  4TVA A;  2XK0 A;  2EYQ A;  2Y90 A;  2DNU A;  4H2W A;  5GMK l;  4HVC A;  4Q5W A;  2EQU A;  3S3N A;  1PRM C;  4Y91 A;  1WPY A;  1OX9 A;  5M9O A;  3OS5 A;  1YHQ A;  1N8R C;  4AG2 C;  1VQ8 A;  2FHD A;  1Q7Y U;  2QHT A;  7AT1 B;  1KQ1 A;  3CCR Q;  1JBM A;  2F5K A;  1K73 R;  2X4X A;  3MCA B;  1M3C A;  4F7U G;  1CKA A;  1VYT A;  1NJI U;  3DKM A;  2HQH A;  1IRX A;  3JCM f;  4AG1 C;  1QF6 A;  2JVV A;  3CCL T;  5IXB A;  1R77 A;  4Y92 A;  2QYZ A;  1YB3 A;  3JB9 I;  3OYH A;  1SHF A;  4JJC A;  1Q86 U;  4LDY A;  4CH5 A;  5I2S A;  3NET A;  3QTC A;  2ZNJ A;  1M5Q 1;  1WYD A;  3CCJ T;  3RF1 A;  4LVI A;  1RAD B;  4WJ4 A;  2AIR B;  3MP6 A;  2KMT A;  3PE0 A;  2ZT5 A;  4AFS C;  3CCR A;  2X3X D;  5IHI A;  1NZ9 A;  2QG9 B;  2COY A;  3QYH B;  2KBT A;  4PL6 A;  2BZX A;  4TVY A;  2E3I A;  4ZGJ B;  2EQK A;  1VQ7 T;  3TU4 K;  4G85 A;  4OMP A;  1H64 1;  3QO3 A;  4YCV A;  2WSC E;  4CRI A;  3M0P A;  2EYZ A;  3N5B B;  5C52 B;  5HKC A;  3ASK A;  2K2M A;  3MO8 A;  3UAT A;  4FSX A;  3QPH A;  1W4S A;  4PG3 A;  4DBF A;  2LCS A;  4YRE A;  2XIC A;  3FRN A;  4F7U A;  2EVR A;  5LJ5 d;  3KUF A;  2AZV A;  3EG2 A;  2XI9 A;  2ZCE A;  4EMK A;  1OX8 A;  1K8A U;  3P8V A;  1JRI A;  4N4I A;  4J7I A;  2ZZG A;  2V26 A;  3E9H A;  3HRU A;  1S72 A;  3QO7 A;  3MP1 A;  3CCQ Q;  2V8I A;  4M7A C;  1MHN A;  3EFS A;  2KE9 A;  2DTO A;  4J6Y A;  2I4M A;  4C8Q B;  5CVI A;  1NJI C;  4DOW A;  3CBP A;  3PMI A;  2DA9 A;  2B8A A;  2O9S A;  3PCO B;  1E1T A;  2JN0 A;  2RI5 A;  2YUP A;  1VQK T;  1WNL A;  2G3R A;  1K9M R;  1I5L A;  4HXJ A;  3IAL A;  2ED1 A;  2P0P A;  3H8Z A;  3CXC S;  1Q86 C;  2ZPH B;  2EAY A;  3HTZ A;  3NTK A;  2EQI A;  4OB1 B;  2BZY A;  1VA7 A;  1M4Z A;  2QQS A;  1SET A;  1E6H A;  4HCK A;  4BY6 B;  2ZNI A;  2LTO A;  1AWJ A;  1B3Q A;  3TEH A;  2Q7H A;  1QCF A;  3CCQ A;  1AZG B;  5GMK m;  4UP9 A;  2OX7 A;  3QKJ A;  5GAM e;  4F7U F;  3I56 A;  4G84 A;  1WU7 A;  2NWM A;  2P4T A;  5LJ3 d;  2DDZ A;  4OMQ A;  2EBP A;  3CCE T;  1PG5 B;  1Q81 U;  2I0N A;  1YJ9 T;  4UC4 A;  3X20 B;  1B8A A;  2JS2 A;  5LJ5 e;  5LL6 S;  2D9T A;  4Y28 E;  2W0Z A;  1NJ8 A;  2AMC A;  1PC0 A;  2ZIM A;  3S3O A;  3OQ5 A;  1G5V A;  5FRO A;  1QCO A;  1RAC B;  1VOM A;  2MCN A;  4M75 G;  3CD6 Q;  2PU9 B;  2GNC A;  4LUE A;  4EMH A;  1X6G A;  1K8A C;  4OB3 B;  3ICA A;  5CKF A;  4FW1 A;  3GNF B;  1D0X A;  3M9Q A;  3EH1 A;  3KBG A;  1SHG A;  2MPX C;  4ELY C;  2E5Q A;  2OAU A;  2JTE A;  2QA4 T;  5KYX B;  1B70 A;  1ZBJ A;  2EW3 A;  3C95 A;  5KNN A;  1QWF A;  1YFR A;  2QHS A;  1B34 B;  1QLY A;  2DXU A;  3RAC A;  1ABO A;  2O4X B;  4X9C A;  2JTF A;  2OTL Q;  2KEA A;  4CS3 A;  4IIO A;  4A4K A;  3OYD A;  2VGM A;  3M4G A;  3JCM c;  5K1X A;  1IGU A;  1I5O B;  4O2D A;  4P74 A;  1NYG A;  2CP2 A;  2P4R A;  2L3Q A;  8AT1 B;  3V7R A;  1KHI A;  1TUG B;  1VQL T;  1QKW A;  2XTI A;  3LH5 A;  5LJ3 e;  2O2O A;  4JZ4 A;  1Q82 R;  4HWT A;  4Q15 A;  4MZP A;  1UE9 A;  1UHC A;  1ZA1 B;  4KGV B;  3VUB A;  1BCM A;  4FYY B;  4M75 A;  3L2Q A;  1VQM T;  3PT9 A;  4J7F A;  3RL6 A;  1BU1 A;  5KYU B;  1WXU A;  5GAM h;  1WHH A;  1UEB A;  1Q81 C;  3BDL A;  2HQX A;  3RGL A;  3IKL A;  4M78 E;  4P75 A;  1NBE B;  4PK4 A;  4EX5 A;  2C0O A;  2ZGW A;  3SD4 A;  2E1H A;  2RD1 A;  1VQ6 Q;  3EHR A;  4RTV A;  5GAO l;  5LJ5 h;  3G4S T;  1JXO A;  4N0A A;  4HT4 A;  4BUG A;  1RIQ A;  2PVG B;  3HXY A;  3QDF A;  2ATC B;  3UGT A;  2LDM A;  4AT1 B;  1NNH A;  4B6M A;  3BE3 A;  1GXI E;  1M30 A;  5GAN 8;  2DBK A;  3QBY A;  3R07 A;  1PKT A;  1ADY A;  2E64 A;  4LXC A;  1EIY B;  2E5A A;  3V8K A;  2RK2 A;  1T0J A;  2HZY A;  3REU A;  1EZZ B;  3X25 B;  3INZ A;  1Y07 A;  1TG0 A;  1Q7Y R;  4M7D D;  2XKO C;  3P8D A;  4HWR A;  1JEG A;  4CC7 A;  2DU7 A;  3O5Z A;  2K5L A;  4FU6 A;  1M9S A;  1XTD A;  4KRT A;  1TS9 A;  3I55 T;  1UJ0 A;  3C94 A;  1BK2 A;  5I11 A;  2AZS A;  4X1V A;  1KG1 A;  4WCI A;  2VAS A;  2NUT A;  1V1C A;  2CYZ B;  2MYS A;  2RI3 A;  2ZPE B;  3QHS A;  1JJC A;  2I4L A;  4M75 F;  3OYM A;  4FT4 A;  1NJ2 A;  3M4P A;  3OSV A;  1E24 A;  2FO0 A;  1W2B A;  1PWT A;  4AMC A;  5CQY A;  1SSF A;  5GAM g;  4XEO A;  1NLP C;  4BDZ A;  4RCC A;  1M3A A;  2LCC A;  3HY1 A;  5IH2 A;  2DVE A;  2XU8 A;  1PHT A;  3VQW A;  3CPW S;  2A7Y A;  2LX7 A;  5LJ3 h;  1G3S A;  4NS5 A;  3OW2 A;  2J6O A;  4HT8 A;  2VWF A;  2GFU A;  3CC7 Q;  3UH0 A;  1MUZ A;  1I07 A;  2M02 A;  2RHS B;  4LVL A;  4R56 A;  2CH4 W;  2ODR D;  3OS0 A;  1VQ9 T;  4D6W A;  1YJN T;  2E3H A;  1M2V B;  4YRJ A;  1X55 A;  1FXX A;  1Z9Q A;  2K7A A;  4JUV A;  3H9N A;  4QT7 A;  4XQ3 A;  3A32 A;  2YXY A;  1O9S A;  4CS4 A;  3CCU T;  2V8J A;  1FMK A;  3VS4 A;  3HFZ A;  2HMA A;  1AWO A;  2DL7 A;  3G6E Q;  1H8K A;  3CCV Q;  5GAN g;  2M51 A;  2QEX T;  4E7H A;  2OJ2 A;  3ZBD A;  4YRF A;  4M7D F;  4J9F A;  2O88 A;  1KQS A;  1QE0 A;  1ASY A;  1WJQ A;  3M56 A;  3FLG A;  3DB3 A;  2DTH A;  3H41 A;  2HSE B;  2G4C A;  2HQE A;  4P73 C;  2AHJ B;  2C7I A;  2HBP A;  4H2U A;  3CC4 A;  2L89 A;  4IUU A;  4J9D A;  5KYW B;  5IN1 A;  4H2X A;  2K3Y A;  2DXT A;  2EGC A;  4PJM A;  4JDS A;  3CC2 A;  1B7Y B;  4M77 G;  3IQL A;  4ME7 A;  3F70 A;  1QMC A;  1BI2 A;  3M4Q A;  3CCV A;  4JZ3 A;  2VC8 A;  2ZZD A;  2ZIO A;  2LRQ A;  2ABL A;  2XMF A;  4XU1 A;  1ZLM A;  4KUL A;  1YNZ A;  2JS0 A;  4PJO E;  1I0C A;  3CME Q;  4YRT A;  1Y57 A;  4LUD A;  5FU6 C;  4C5G A;  1B7T A;  2FG0 A;  4MML A;  4OLF A;  4RCB A;  3HL8 A;  2ALY A;  4QQ6 A;  5D6X A;  2ROT A;  1ZBX A;  2PUO B;  1YI2 T;  4KQE A;  1O75 A;  4M78 B;  5IAY A;  2C06 A;  5I21 A;  3TUP A;  3I7F A;  3BJU A;  5GAM f;  1WDX A;  4E7J A;  4K88 A;  4JJD A;  3EH2 A;  1NG2 A;  4RG8 A;  1OU9 A;  4JRK A;  2EGE A;  1QP3 A;  1X2K A;  2J05 A;  2ZR2 A;  3EGX B;  3CCS A;  4JJB A;  1K0S A;  3M0R A;  1GFC A;  2QAZ A;  5CQX A;  5IHK A;  4HWS A;  4PHC A;  2A36 A;  2E70 A;  1H3H A;  4KH1 B;  2YUQ A;  1M1K R;  2MOX A;  3NTH A;  3E9F A;  4R0K A;  3V7S A;  1H92 A;  1UGQ B;  4WJ3 M;  2FYK A;  4XAX B;  5HGQ A;  4M77 A;  2LQW A;  4NCX A;  3PIP A;  5AYF A;  2LJ3 A;  1G3W A;  1OV3 A;  1KOG A;  3QZ5 B;  3A5Z B;  4C0F A;  1OPK A;  5CKB A;  4ANJ A;  5KYY B;  1N8R U;  4C92 E;  1KFZ A;  5GAN f;  3CMA Q;  4EMK C;  4RTX A;  2NYS A;  2EJG A;  2CZ7 B;  1SRL A;  2JJ9 A;  2IG0 A;  3M0Q A;  5IHN A;  3JCM P;  2ZT6 A;  1R0C B;  1TH7 A;  3EFR A;  1FYN A;  5K1P A;  1QWE A;  3OYK A;  4DEX A;  1EFN A;  3HXU A;  2IY5 A;  3OS2 A;  3RER A;  3L2V A;  1G5I A;  3JCM X;  3A8M B;  1C0A A;  3LSS A;  1LVK A;  2LX9 A;  5IT9 E;  2V1Q A;  4PFO A;  4EPC A;  1GRI A;  5FWC A;  2YSQ A;  3V8L A;  3OB9 A;  4XU3 A;  3QSU A;  2CJ9 A;  1ZSZ B;  1LJO A;  1AT1 B;  4AFZ C;  4HWP A;  5E3I A;  3M54 A;  3RDV A;  3VS2 A;  1NEB A;  2MAM A;  2RHU A;  3ZFJ A;  1MMA A;  3O8V A;  3CMA A;  5DLQ E;  1VQ5 A;  1GCP A;  3M58 A;  4C8Q D;  2LCL A;  2MI6 A;  1LCK A;  3JAM E;  3NGP A;  4RUG A;  2DO3 A;  1NJ1 A;  1TU0 B;  4BAC A;  4M77 F;  3CCM A;  3CCL Q;  4YPF A;  2Q5I A;  3G7Z A;  3A8L B;  1UFF A;  1R0B G;  5EG2 A;  1PD0 A;  1ZUU A;  5DY9 A;  2PZ1 A;  3TSW A;  4E47 A;  2MIO A;  2DIL A;  3TRE A;  1YIT A;  2JM8 A;  3DB4 A;  2RF0 A;  3PCO A;  3CCJ Q;  1IHV A;  2JOY A;  1VQN T;  4ORZ A;  1LYL A;  1C0M A;  1YN8 A;  4J9C A;  2EIF A;  1L0W A;  1PSF A;  3R6N A;  2EYY A;  5GAN j;  5CAI A;  4NL2 A;  4P71 A;  2JNG A;  1X2H A;  4RQF A;  6AT1 B;  1MV3 A;  2QDL A;  4L59 A;  4P73 A;  1VQ7 Q;  1PM3 A;  2JM9 A;  1VQP A;  1Z7N A;  1PKS A;  2VUB A;  5GMK j;  4ZN3 A;  5IXF A;  4NOY A;  4FT2 A;  3RMS A;  3JB9 D;  3HP9 A;  3GOX A;  2KRS A;  4KGZ B;  4A4E A;  1AVZ C;  4BB7 A;  3MQZ A;  2CDT A;  4PJO B;  2RA2 A;  4ZN1 A;  1M27 C;  1UB4 A;  1UGV A;  3CCJ A;  5CKE A;  4MDX A;  4FIB A;  3M5A A;  3HFN A;  1PCX A;  3X28 B;  3OY9 A;  4LDW A;  2ZT7 A;  3BY7 A;  3A1P A;  3CPW P;  1H3Z A;  2CJB A;  4M4Z A;  2WAC A;  3OYG A;  4P74 C;  5A0D A;  2KAF A;  5CR2 A;  4OVA A;  1IXD A;  1N27 A;  1IL2 A;  3EG9 B;  3CPF A;  3HRT A;  4PJL A;  1SRY A;  1NLO C;  1UGP B;  4C0Z A;  2KXC A;  4QQG A;  2CH4 A;  1ACM B;  1YHQ T;  4DBQ A;  2A3L A;  5KYX A;  1VQ8 T;  3A5Y A;  3QYG B;  1VQK Q;  3HRI A;  3NPF A;  1I81 A;  3IKM B;  2CRE A;  4H2T A;  4AFQ C;  1D3B A;  1B34 A;  1HYO A;  1VQO T;  2J06 A;  1BCO A;  4M75 C;  3RMQ A;  3FJP A;  2EQM A;  2CT4 A;  2O4X A;  2V8K A;  1N9R A;  2YUN A;  3VU3 C;  1OZ3 A;  3VS5 A;  3S6W A;  2ED0 A;  1K9A A;  4F7U E;  4P75 C;  3J80 E;  2C8M A;  11AS A;  2XD0 A;  2O31 A;  1QVG S;  3L2U A;  2PUK B;  4E7Z A;  1RAA B;  2NUZ A;  4GBQ A;  4JPB W;  2QQA A;  1KD1 R;  2PTK A;  3VS3 A;  4C92 B;  4N0A C;  1X56 A;  1NJ5 A;  1BB9 A;  1Y96 B;  4H02 A;  3NMZ C;  3CCE Q;  3L4G A;  2JXB A;  2ZPG B;  1YJ9 Q;  1XOV A;  3CQT A;  1UDL A;  4XTW A;  3TEG A;  2EWN A;  4JRI A;  3MEA A;  2SEM A;  4FYX B;  3SWN C;  4KGX B;  2KYM A;  4KUI A;  3TVT A;  1X6B A;  4XTZ A;  4OML A;  3AT1 B;  1X27 A;  2F69 A;  2ZAE A;  5KYU A;  2VV5 A;  2VB6 A;  2QHV A;  2KDS A;  1IHW A;  5KE3 A;  2CKK A;  2CUD A;  4RKU E;  1D09 B;  4RQE A;  2DZ9 A;  2D8H A;  2MF2 A;  4HVV A;  3LC0 A;  3R6O A;  3QO5 A;  1G3Y A;  4A4G A;  2L8D A;  4LD6 A;  1YP5 A;  2PVD B;  3IG2 A;  2DIG A;  4M7D C;  2NS6 A;  4E51 A;  1IZ6 A;  2QA4 Q;  3PNW C;  2D8J A;  4YRR A;  3E9G A;  1KC8 R;  3QZ9 B;  1U1S A;  3TEE A;  4D8K A;  2Y4Y A;  2IIM A;  4X5O A;  4J15 A;  3I5R A;  1EIY A;  4RTY A;  5KYN A;  1BI1 A;  2P0L A;  2DF6 A;  2CIM A;  2K79 A;  2E3C A;  5EC7 A;  4F14 A;  4YRS A;  2QK0 A;  3LGL A;  1HC7 A;  4TVA B;  1U8R A;  1TUC A;  2YDL A;  1S72 T;  3P8T A;  1EX4 A;  4PJJ A;  2NUP A;  2W10 A;  3VS0 A;  4YRP A;  2M0O A;  3GIB A;  3NEL A;  2DQ0 A;  4Z89 A;  2GQV A;  2JMA A;  3JSC A;  3G1Z A;  4FL6 A;  2KYB A;  2CP7 A;  1RUW A;  2E41 A;  2M0Y A;  1P92 A;  4O5V A;  1VQM Q;  2BUD A;  1AHJ B;  3MEV A;  1HXD A;  3OA6 A;  3LWH A;  1NEG A;  2ODR C;  3OMC A;  2HSP A;  2DL4 A;  4A4F A;  5GAN 5;  4QVC A;  1SKU B;  1EQR A;  1KMN A;  1W2B S;  3ER0 A;  4CI0 C;  2ESW A;  1VQ4 Q;  1PNJ A;  1N8R R;  1MMN A;  2X3W D;  4PJN A;  5FLX E;  4R55 A;  1VYU A;  2DQ3 A;  2RQT A;  3G4S Q;  2K6D A;  2BZ8 A;  4XK8 E;  3I56 T;  2X35 A;  4YP0 A;  2LT1 A;  3MEU A;  2DMO A;  3REX A;  3ME9 A;  4CH4 A;  2VKN A;  1PYS A;  2AKW B;  3FJ5 A;  5GAN 3;  4DPG A;  3QWX X;  2ARS A;  2DRM A;  1EVK A;  1RL2 A;  3KXT A;  2CS7 A;  1M8M A;  1VQM A;  2RQR A;  1WA7 A;  1UGR B;  1OU8 A;  3CD6 A;  4BW9 A;  4E7L A;  3A7U A;  2K3X A;  1IRE B;  2DKG A;  4E7K A;  1VQ4 A;  4OMO A;  1ZSG A;  4BE2 A;  1UHF A;  3RIR A;  3SDZ A;  3JB9 J;  5D6Y A;  3I55 Q;  1QQJ A;  2QGG A;  4EDU A;  1LNX A;  2IVW A;  2KT1 A;  3FB9 A;  4OGE A;  3RES A;  2KNB B;  4MDW A;  1PRL C;  4M7D G;  2E6N A;  1U5S A;  4LDV A;  2PNI A;  4XTX A;  2CT3 A;  3H0H A;  4F7U B;  1KQS S;  2OTL A;  1SF9 A;  4HA8 A;  5C6S A;  4AH6 A;  1B76 A;  2L5Q A;  4LDX A;  3BDU A;  4GY5 A;  3WVD B;  3QDR B;  1B7Y A;  3JCM d;  2B86 A;  1FMV A;  2M9U A;  2X4J A;  2RJC A;  4C5E A;  1U3O A;  2GCX A;  2JT4 A;  4WTO B;  3EGU A;  1I4K 1;  2BE7 D;  4TQF A;  4RDX A;  1I1J A;  4A54 A;  3FC3 A;  3THK A;  3DSQ A;  1WXB A;  4M78 D;  4VUB A;  4XU2 A;  3L2Z A;  2LMJ A;  3OS1 A;  1A0N B;  1WFW A;  2Y4X A;  4M7A E;  1RAH B;  3SWN A;  1VQ9 Q;  1YJN Q;  1M90 C;  3CXC A;  4M77 C;  3QII A;  3PIO A;  4J9G A;  2X9H A;  4M78 A;  1NYF A;  2LQK A;  3EG3 A;  3SFM A;  1YFT A;  4TVW A;  3EGD A;  4M7A D;  3CCU Q;  3RKW A;  2RI2 A;  3A8H B;  4DA4 A;  1VQ6 A;  2QEX Q;  3U23 A;  2K57 A;  3EGX A;  5GJW B;  2CUB A;  1JQQ A;  4MZT A;  1NJI R;  1YJW T;  3EFO A;  4TWA A;  2F1L A;  5F5W A;  4M7D A;  2DTI A;  1U1T A;  3VQV A;  1G2B A;  4J83 A;  4XTU A;  4LNP A;  4LE9 A;  3URG A;  2PVO B;  1EFW A;  3MF1 A;  1Q95 G;  2DX1 A;  3QJY A;  1YFN A;  1Q86 R;  4BI4 A;  1M3B A;  3D7S B;  5KCH A;  3CBM A;  3X24 B;  2HKN A;  4O6J A;  1V29 B;  4RTW A;  2C0I A;  3VRZ A;  1K0X A;  4QQD A;  5ELO A;  3JCM Q;  2LJ1 A;  1H4V B;  1K73 U;  4BWA A;  1OPL A;  5CKD A;  5FU7 B;  1RLP C;  3DLL A;  2EQJ A;  5LJ5 g;  2QHU A;  2ZPF B;  5KYY A;  1E7O A;  2QEX A;  2OAW A;  1WI7 A;  1IGQ A;  3TCJ A;  1OYX A;  4Z88 A;  1EVL A;  1QVF S;  1AEY A;  1HSQ A;  4JLI A;  4IUT A;  3OYB A;  2DER A;  2HAX A;  3CBO A;  1QVG P;  1WYX A;  2DLP A;  4M78 F;  4WI1 A;  4ZNX A;  1X69 A;  3ZEH A;  1ADJ A;  4C8Q C;  1JO8 A;  2JW4 A;  2RHQ A;  1YI2 Q;  2H3J A;  2DM1 A;  3BW1 A;  2DVJ A;  2XDD A;  3HPW A;  2K5F A;  2P84 A;  4FSS A;  1ZSZ A;  2RHX A;  4P5N A;  1MMG A;  3G71 T;  3CC7 A;  1K8A R;  1SEM A;  2DK3 A;  2K5I A;  2DET A;  3VBB A;  4BI8 B;  4QKU A;  4P71 C; 
#chains in the Genus database with same CATH homology
 1NYQ A;  4P72 C;  4YRI A;  2Q7E A;  5GAN 6;  4YRL A;  1YIJ T;  4QW2 A;  2DEQ A;  1YI2 A;  2KQW A;  5LJ3 g;  2PMF A;  1X2G A;  2HD0 A;  3G6E A;  3GPL A;  4EMG A;  4M75 B;  2EFI A;  4ZTF A;  1VIF A;  5J3B A;  5GAO p;  5GAO m;  3E1S A;  3V7C A;  1JJ2 S;  1K73 C;  3JCM b;  2LVM A;  2ZZE A;  4PJO D;  3QNE A;  5D6W A;  5KH6 A;  5GAN 4;  4LNS A;  4C0G A;  2OTJ T;  3MEW A;  3OBW A;  2ART A;  4IUQ A;  2Q7G A;  3CC4 T;  1DJ7 B;  2RK1 A;  1HK9 A;  4II1 A;  3RKY A;  3H6Z A;  4JJN K;  2Q5H A;  2HNI A;  1FX7 A;  5LJ5 f;  2QQB A;  3CC2 T;  3CME A;  3KFU A;  4M7A B;  1BI3 A;  2XDP A;  2EL9 A;  3HXZ A;  3NEM A;  3S3M A;  2R5M A;  4BE1 A;  2QDY B;  3VQX A;  4MZM A;  4YDQ A;  2DJZ A;  5GAO r;  3UWN A;  4YRK A;  4YRC A;  3C4S A;  3HFV A;  4A4H A;  2YLC A;  4C8Q G;  2CZ1 B;  3NEN A;  4YRN A;  2X4W A;  3A8G B;  3QXE B;  4QVD A;  3P8B B;  2M16 A;  2ZPI B;  3W3S A;  4OB0 B;  3CCS T;  2I4O A;  4C92 D;  2JZ2 A;  3V8J A;  4ZTZ B;  1QP2 A;  1YBY A;  2KSS A;  1W66 A;  4KR2 A;  3OYN A;  5GAM j;  4OP0 A;  5DLO A;  4PLI A;  5LJ3 f;  1KMM A;  3E19 A;  2ZR3 A;  4L87 A;  4C5H A;  1VQN A;  2KK4 A;  2P5I A;  2PME A;  5LJ5 j;  1NPP A;  4IKF A;  1K9M C;  3JB9 G;  4LVK A;  3HHT B;  1GGM A;  3M4Y A;  4QVZ A;  3FEO A;  5A2Q E;  3GP8 A;  2GF7 A;  4C8Q A;  2CZ6 B;  2E12 A;  3M57 A;  1Q82 U;  3UT1 A;  1WLE A;  1ZQ1 A;  3PFS A;  3LW5 E;  2DXC A;  4XTV A;  3OYE A;  4H2X B;  2FL7 A;  2XG8 D;  5CCA A;  2QI2 A;  3NFC A;  1E22 A;  4PNO A;  4XU0 A;  3CCL A;  4P72 A;  1VQ5 T;  3JCM J;  2RJE A;  2YRV A;  3CCM T;  3VQY A;  4Q6G A;  2ALY B;  1WQW A;  2K2V A;  4YTL A;  3LSQ A;  4K86 A;  4HCZ A;  4JLG A;  2ZIN A;  3L42 A;  5LJ3 j;  3UPU A;  1YIT T;  4E7I A;  4V2S A;  2DIQ A;  4C8Q F;  1VQO A;  1VQ7 A;  4RG2 A;  1VUB A;  1XNI A;  1NJ6 A;  1WGS A;  3PGG A;  2E65 A;  1VQP T;  1PSE A;  3PMT A;  5L8R E;  4YCU A;  3LLR A;  3LGF A;  4M77 B;  2DU5 A;  1MGQ A;  1X6O A;  3OYJ A;  4DOV A;  5FRM A;  2AKW A;  2E10 A;  1M1F A;  3OMG A;  5CKH A;  1Q82 C;  1H4T A;  3X26 B;  4C0D C;  4LVM A;  4UP8 A;  3L2R A;  4KBM B;  3OYC A;  1BIA A;  5I2M A;  4ZTJ A;  2EKO A;  3JCM W;  4BD3 A;  3JB9 F;  2IY5 B;  3UFG A;  2JUF A;  2DD5 A;  5GAM d;  1VQK A;  3LYI A;  1BKB A;  2ZXF A;  4TTV A;  3QJ6 A;  4YCW A;  3CCR T;  4M78 C;  4B9X A;  3WQZ A;  4C5I A;  1I8F A;  12AS A;  2WSE E;  1BBW A;  2RJD A;  4ATO A;  2A8E A;  2EJF A;  3OYI A;  3HKS A;  1NE8 A;  1XQH A;  4K87 A;  4X9D A;  1Q7Y C;  3HXX A;  2D0Q B;  3WXM B;  2ZT8 A;  3CCE A;  4N4G A;  4OF1 A;  1YJ9 A;  3UDC A;  4XEM A;  1R8O B;  3E9I A;  2P0K A;  5GAN d;  2YLB A;  4IUR A;  2JTM A;  3QO8 A;  2RHI A;  3NTI A;  4YRM A;  1VQZ A;  1N9W A;  4PLL A;  2RO0 A;  2DPP B;  3OSS C;  4ZIB A;  4JS4 A;  1EOV A;  3HXW A;  2RH2 A;  4JRQ A;  2QA4 A;  4J6W A;  1SER A;  3GF5 A;  1J5W A;  4YRO A;  4RMO A;  2CZ0 B;  2DD4 A;  1G3T A;  3ERR A;  1H4S A;  3MET A;  4MMK A;  5A0L A;  2P0Q A;  1M90 U;  4J8O A;  5FU6 B;  5GAN 2;  3J81 E;  3HY0 A;  1QVP A;  4JS5 A;  3VV0 A;  1G51 A;  3CCQ T;  1Y71 A;  4DQ2 A;  1M1K U;  1VQL A;  3MF2 A;  1BBU A;  2DAQ A;  4Z02 A;  2RHS A;  4ZGD B;  3OW2 S;  1RI0 A;  3JCM V;  5DM7 R;  1YCY A;  4HCC A;  5GAN e;  5GAO n;  4L6V 5;  4M78 G;  1QW1 A;  3PZC A;  4UP7 A;  3A7R A;  4OGC A;  5KCO A;  4H2Y A;  2LNV A;  1QVG A;  1D3B B;  2BKD N;  2DZC A;  1JB0 E;  5GMK e;  2R5A A;  2ZCF B;  4HT9 A;  4H2S A;  4M75 E;  2R58 A;  3G4S A;  4PKC C;  4HCB A;  2O01 E;  3MHX A;  1KHC A;  3VKI A;  3A31 A;  4M7A G;  4IUP A;  3HRK A;  4YYE A;  5HK3 A;  2XHC A;  4M75 D;  1EIF A;  4HKE A;  3L4G B;  2GFA A;  3L1A A;  4GLK A;  2QQ9 A;  3RKX A;  4EMK B;  3A74 A;  1FWZ A;  4PJO C;  4XTY A;  3WVE B;  2BIV A;  3CD6 T;  3I55 A;  4P3O A;  2CGH A;  2K4Y A;  2QXF A;  1YJW A;  1VQ4 T;  4YRG A;  1SES A;  2RHZ A;  2L3R A;  3QUI A;  1M1K C;  4X34 A;  1BIB A;  2VYT A;  3HFO A;  1X54 A;  4M7D E;  3HSB A;  2OTL T;  3DLM A;  2E6Z A;  3HRS A;  3TEH B;  4OMF B;  4M7A A;  2MWO A;  1USY C;  4LDU A;  3A8O B;  1VQ9 A;  2DXB A;  1YJN A;  2FVU A;  4P3N A;  3LX7 A;  5GAN h;  2QQR A;  3VJP A;  1E1O A;  2YHT A;  4TVR A;  3M55 A;  5GMK h;  1ZHI A;  3CCU A;  3A5Z A;  3JCM e;  4C92 C;  2AMC B;  2D6F A;  3L2W A;  4CH6 A;  3GLX A;  4J6X A;  2ZTG A;  1ATI A;  5FRN A;  3C12 A;  3G71 A;  1KQ2 A;  3EAE A;  3MP8 A;  1VQ6 T;  3JRZ A;  2R57 A;  3HXV A;  4BI3 A;  2ARU A;  4EO4 A;  1B70 B;  5C0M A;  3OD1 A;  1YIJ A;  3M59 A;  4KR3 A;  4A53 A;  1PYS B;  2F5T X;  4M7A F;  2ZZF A;  4JRP A;  1HTT A;  4NL3 A;  2FB7 A;  4PJO G;  3OBY A;  5CO7 A;  3JB9 H;  3CMQ A;  4BY6 C;  5ELN A;  2NLU A;  1OZ2 A;  5J26 A;  3UGQ A;  2PQW A;  3PTA A;  4KUD K;  3SB2 A;  3OYL A;  5GAN 7;  1KD1 U;  2J3M A;  3RUX A;  4OB2 B;  3FDR A;  1NYR A;  4CS2 A;  3OYF A;  2RM4 A;  2EJ9 A;  1BYM A;  1BI0 A;  2OTJ A;  4ZTU B;  2VGN A;  2X4Y A;  5A0G A;  1X75 C;  4C0D B;  2XGT A;  3FIF A;  5GMK i;  1VIE A;  3CC7 T;  1UGS B;  5J39 A;  2ZPB B;  3QG1 A;  3JCM h;  5KE2 A;  4LD9 K;  1K9M U;  2LQ8 A;  1NPR A;  4ZGE B;  3BFM A;  1KC8 U;  3SWN B;  2VXE A;  1WQ7 A;  4PJO A;  5C53 B;  1Z7M A;  2I2L A;  1H4Q A;  4C92 G;  3AHU A;  2RB6 A;  5HK0 A;  4M77 E;  3OYA A;  1M1G A;  4YRQ A;  3G6E T;  4L5G A;  3CCV T;  2XID A;  1M8V A;  4TQD A;  1WJR A;  3Q1J A;  4BE0 A;  3LH0 A;  5CK9 A;  2I4N A;  3T9N A;  2VXF A;  4M77 D;  4M7D B;  2LT4 A;  1JJC B;  1G5H A;  5GAO q;  3VYG A;  1Y7X A;  3CPW A;  4UPA A;  4H2V A;  1KD1 C;  1YGB A;  4J5Y A;  1YFS A;  1USY A;  4N4H A;  1QVF A;  1WJS A;  4B9W A;  3J7A F;  2MMP A;  1N9S A;  2KVQ G;  4IUV A;  3CME T;  3JCM g;  3VUZ A;  2RHY A;  2LC4 A;  3M53 A;  5C51 B;  4PJO F;  4C92 A;  4ELZ C;  1Y96 A;  4HWO A;  3P8Y A;  4RMF A;  2RJF A;  2CJA A;  4KT0 E;  2RHQ B;  4C8Q E;  3HFZ B;  4CH3 A;  2WSF E;  5CIU A;  1LOJ A;  2MWP A;  4WF2 A;  1KC8 C;  1OI1 A;  4P3P A;  2XDB A;  5HY6 A;  1ASZ A;  2QTX A;  1FYF A;  4LVJ A;  2KY9 A;  3GNG A;  1X01 A;  3CEY A;  2M1H A;  4FM4 B;  3A7A A;  3LWI A;  1N6A A;  3VYH B;  2J3L A;  4BDY A;  3MEY A;  1JJ2 A;  3CMA T;  3P8H A;  3OYY A;  5FU7 C;  4C92 F;  4TVA A;  2XK0 A;  2EYQ A;  2Y90 A;  4H2W A;  5GMK l;  4HVC A;  4Q5W A;  2EQU A;  3S3N A;  4Y91 A;  1WPY A;  5M9O A;  3OS5 A;  1YHQ A;  1N8R C;  1VQ8 A;  2FHD A;  1Q7Y U;  2QHT A;  1KQ1 A;  1JBM A;  2F5K A;  2X4X A;  3MCA B;  4F7U G;  1NJI U;  3DKM A;  3JCM f;  1QF6 A;  2JVV A;  3CCL T;  1YB3 A;  3JB9 I;  3OYH A;  1Q86 U;  4LDY A;  4CH5 A;  5I2S A;  3NET A;  3QTC A;  2ZNJ A;  1M5Q 1;  1WYD A;  3CCJ T;  3RF1 A;  4LVI A;  4WJ4 A;  3MP6 A;  2KMT A;  2ZT5 A;  3CCR A;  1NZ9 A;  3QYH B;  4PL6 A;  4TVY A;  4ZGJ B;  2EQK A;  1VQ7 T;  3TU4 K;  4G85 A;  1H64 1;  3QO3 A;  4YCV A;  2WSC E;  4CRI A;  3N5B B;  5C52 B;  5HKC A;  3ASK A;  3MO8 A;  4FSX A;  3QPH A;  1W4S A;  4PG3 A;  4YRE A;  2XIC A;  3FRN A;  4F7U A;  5LJ5 d;  3KUF A;  2XI9 A;  2ZCE A;  4EMK A;  1K8A U;  3P8V A;  1JRI A;  4N4I A;  4J7I A;  2ZZG A;  3E9H A;  3HRU A;  1S72 A;  3QO7 A;  3MP1 A;  2V8I A;  4M7A C;  1MHN A;  3EFS A;  2DTO A;  4J6Y A;  2I4M A;  4C8Q B;  5CVI A;  1NJI C;  4DOW A;  3CBP A;  3PMI A;  2B8A A;  3PCO B;  1E1T A;  2JN0 A;  2RI5 A;  1VQK T;  1WNL A;  2G3R A;  1I5L A;  3IAL A;  2P0P A;  3CXC S;  3H8Z A;  1Q86 C;  2ZPH B;  2EAY A;  3HTZ A;  3NTK A;  4OB1 B;  2QQS A;  1M4Z A;  1SET A;  4BY6 B;  2ZNI A;  2LTO A;  3TEH A;  2Q7H A;  3CCQ A;  5GMK m;  4UP9 A;  3QKJ A;  5GAM e;  4F7U F;  3I56 A;  4G84 A;  1WU7 A;  2P4T A;  5LJ3 d;  2DDZ A;  3CCE T;  1Q81 U;  1YJ9 T;  4UC4 A;  3X20 B;  1B8A A;  5LJ5 e;  5LL6 S;  2D9T A;  4Y28 E;  1NJ8 A;  2AMC A;  2ZIM A;  3S3O A;  3OQ5 A;  1G5V A;  5FRO A;  4M75 G;  2PU9 B;  4EMH A;  1K8A C;  4OB3 B;  3ICA A;  5CKF A;  3GNF B;  3M9Q A;  3KBG A;  4ELY C;  2E5Q A;  2OAU A;  2QA4 T;  1B70 A;  3C95 A;  5KNN A;  1YFR A;  2QHS A;  1B34 B;  2DXU A;  3RAC A;  2O4X B;  4X9C A;  2JTF A;  4CS3 A;  4A4K A;  3OYD A;  2VGM A;  3M4G A;  3JCM c;  5K1X A;  4O2D A;  4P74 A;  3V7R A;  1KHI A;  1VQL T;  2XTI A;  5LJ3 e;  4HWT A;  4Q15 A;  4MZP A;  3VUB A;  4M75 A;  3L2Q A;  1VQM T;  3PT9 A;  4J7F A;  3RL6 A;  5GAM h;  1UEB A;  1Q81 C;  3BDL A;  2HQX A;  3RGL A;  3IKL A;  4M78 E;  4P75 A;  4EX5 A;  2ZGW A;  3SD4 A;  2E1H A;  2RD1 A;  5GAO l;  5LJ5 h;  3G4S T;  4N0A A;  4HT4 A;  4BUG A;  1RIQ A;  2PVG B;  3HXY A;  3UGT A;  2LDM A;  1NNH A;  1GXI E;  5GAN 8;  3R07 A;  3QBY A;  1ADY A;  2E64 A;  1EIY B;  2E5A A;  3V8K A;  2RK2 A;  3REU A;  3X25 B;  3INZ A;  1Y07 A;  4M7D D;  2XKO C;  3P8D A;  4HWR A;  2DU7 A;  2K5L A;  4FU6 A;  1M9S A;  1XTD A;  3I55 T;  3C94 A;  1KG1 A;  2CYZ B;  2RI3 A;  2ZPE B;  3QHS A;  1JJC A;  2I4L A;  4M75 F;  3OYM A;  4FT4 A;  1NJ2 A;  3M4P A;  3OSV A;  1E24 A;  1W2B A;  5CQY A;  1SSF A;  5GAM g;  4XEO A;  4BDZ A;  4RCC A;  2LCC A;  3HY1 A;  2DVE A;  2XU8 A;  3VQW A;  3CPW S;  2A7Y A;  5LJ3 h;  1G3S A;  4NS5 A;  3OW2 A;  4HT8 A;  2GFU A;  3UH0 A;  2RHS B;  4LVL A;  4R56 A;  2ODR D;  3OS0 A;  1VQ9 T;  4D6W A;  1YJN T;  4YRJ A;  1X55 A;  1FXX A;  4JUV A;  4XQ3 A;  3A32 A;  1O9S A;  4CS4 A;  3CCU T;  2V8J A;  3HFZ A;  5GAN g;  2QEX T;  4E7H A;  3ZBD A;  4YRF A;  4M7D F;  1KQS A;  1QE0 A;  1ASY A;  1WJQ A;  3M56 A;  3FLG A;  3DB3 A;  2DTH A;  2G4C A;  2HQE A;  4P73 C;  2AHJ B;  2C7I A;  2HBP A;  4H2U A;  3CC4 A;  2L89 A;  4IUU A;  5IN1 A;  4H2X A;  2K3Y A;  2DXT A;  4JDS A;  3CC2 A;  1B7Y B;  4M77 G;  4ME7 A;  3F70 A;  1BI2 A;  3M4Q A;  3CCV A;  2VC8 A;  2ZZD A;  2ZIO A;  2LRQ A;  4XU1 A;  4KUL A;  4PJO E;  4YRT A;  5FU6 C;  4C5G A;  4MML A;  4OLF A;  4RCB A;  3HL8 A;  2ALY A;  4QQ6 A;  5D6X A;  1ZBX A;  2PUO B;  1YI2 T;  4KQE A;  1O75 A;  4M78 B;  5IAY A;  2C06 A;  5I21 A;  3TUP A;  3I7F A;  3BJU A;  5GAM f;  4E7J A;  4K88 A;  4RG8 A;  4JRK A;  1QP3 A;  2ZR2 A;  3CCS A;  5CQX A;  4HWS A;  4PHC A;  2E70 A;  3NTH A;  3E9F A;  3V7S A;  1UGQ B;  4WJ3 M;  2FYK A;  4XAX B;  5HGQ A;  4M77 A;  4NCX A;  3PIP A;  5AYF A;  1G3W A;  1KOG A;  3QZ5 B;  3A5Z B;  4C0F A;  5CKB A;  1N8R U;  4C92 E;  5GAN f;  4EMK C;  2EJG A;  2CZ7 B;  2IG0 A;  3JCM P;  2ZT6 A;  1TH7 A;  3EFR A;  5K1P A;  3OYK A;  3HXU A;  2IY5 A;  3OS2 A;  3RER A;  3L2V A;  1G5I A;  3JCM X;  3A8M B;  1C0A A;  3LSS A;  2LX9 A;  5IT9 E;  4EPC A;  3V8L A;  3OB9 A;  4XU3 A;  3QSU A;  2CJ9 A;  1LJO A;  4HWP A;  5E3I A;  3M54 A;  2MAM A;  3ZFJ A;  2RHU A;  3O8V A;  3CMA A;  5DLQ E;  1VQ5 A;  3M58 A;  4C8Q D;  2LCL A;  2MI6 A;  3JAM E;  2DO3 A;  1NJ1 A;  4BAC A;  4M77 F;  3CCM A;  4YPF A;  2Q5I A;  3G7Z A;  3A8L B;  5EG2 A;  5DY9 A;  4E47 A;  3TRE A;  1YIT A;  3DB4 A;  3PCO A;  2JOY A;  1VQN T;  1LYL A;  2EIF A;  1L0W A;  1PSF A;  5GAN j;  5CAI A;  4NL2 A;  4P71 A;  2JNG A;  1X2H A;  4RQF A;  4P73 A;  4L59 A;  1VQP A;  1Z7N A;  2VUB A;  5GMK j;  4ZN3 A;  4NOY A;  4FT2 A;  3RMS A;  3JB9 D;  3HP9 A;  3GOX A;  4A4E A;  4BB7 A;  3MQZ A;  4PJO B;  2RA2 A;  4ZN1 A;  1UB4 A;  3CCJ A;  5CKE A;  4MDX A;  4FIB A;  3M5A A;  3HFN A;  3X28 B;  3OY9 A;  4LDW A;  2ZT7 A;  3BY7 A;  1H3Z A;  2CJB A;  2WAC A;  3OYG A;  4P74 C;  5A0D A;  2KAF A;  5CR2 A;  4OVA A;  1N27 A;  1IL2 A;  3CPF A;  3HRT A;  1SRY A;  1UGP B;  4C0Z A;  4QQG A;  1YHQ T;  2A3L A;  1VQ8 T;  3A5Y A;  3QYG B;  3HRI A;  1I81 A;  3IKM B;  4H2T A;  1D3B A;  1B34 A;  1VQO T;  4M75 C;  3RMQ A;  3FJP A;  2EQM A;  2O4X A;  2V8K A;  1N9R A;  3VU3 C;  1OZ3 A;  3S6W A;  4F7U E;  4P75 C;  3J80 E;  2C8M A;  11AS A;  2XD0 A;  1QVG S;  3L2U A;  2PUK B;  2QQA A;  4C92 B;  4N0A C;  1X56 A;  1NJ5 A;  1Y96 B;  4H02 A;  3L4G A;  2ZPG B;  1XOV A;  4XTW A;  3TEG A;  2EWN A;  4JRI A;  3MEA A;  3SWN C;  4KUI A;  4XTZ A;  2F69 A;  2VV5 A;  2QHV A;  2KDS A;  5KE3 A;  2CKK A;  4RKU E;  4RQE A;  2DZ9 A;  2MF2 A;  3LC0 A;  3R6O A;  3QO5 A;  1G3Y A;  4A4G A;  2L8D A;  4LD6 A;  2PVD B;  3IG2 A;  2DIG A;  4M7D C;  2NS6 A;  4E51 A;  1IZ6 A;  3PNW C;  4YRR A;  3E9G A;  3QZ9 B;  1U1S A;  3TEE A;  2Y4Y A;  4X5O A;  4J15 A;  1EIY A;  1BI1 A;  2P0L A;  2CIM A;  2E3C A;  4YRS A;  3LGL A;  1HC7 A;  4TVA B;  1U8R A;  1S72 T;  3P8T A;  4YRP A;  2M0O A;  3GIB A;  3NEL A;  2DQ0 A;  2GQV A;  3JSC A;  3G1Z A;  4FL6 A;  2E41 A;  1P92 A;  4O5V A;  2BUD A;  1AHJ B;  3MEV A;  1HXD A;  3OA6 A;  3LWH A;  2ODR C;  3OMC A;  4A4F A;  5GAN 5;  4QVC A;  1EQR A;  1KMN A;  1W2B S;  3ER0 A;  4CI0 C;  5FLX E;  4R55 A;  2DQ3 A;  4XK8 E;  3I56 T;  2X35 A;  4YP0 A;  2LT1 A;  3MEU A;  3REX A;  3ME9 A;  4CH4 A;  1PYS A;  2AKW B;  5GAN 3;  4DPG A;  2ARS A;  1EVK A;  1RL2 A;  3KXT A;  2CS7 A;  1VQM A;  1UGR B;  3CD6 A;  4BW9 A;  4E7L A;  3A7U A;  2K3X A;  1IRE B;  2DKG A;  4E7K A;  1VQ4 A;  4BE2 A;  3RIR A;  3SDZ A;  3JB9 J;  5D6Y A;  4EDU A;  1LNX A;  2IVW A;  3FB9 A;  4OGE A;  3RES A;  4MDW A;  4M7D G;  2E6N A;  4LDV A;  4XTX A;  4F7U B;  1KQS S;  4AH6 A;  2OTL A;  4HA8 A;  5C6S A;  1B76 A;  2L5Q A;  4LDX A;  3BDU A;  4GY5 A;  3WVD B;  3QDR B;  1B7Y A;  3JCM d;  2X4J A;  2M9U A;  4C5E A;  2RJC A;  2GCX A;  1I4K 1;  4TQF A;  4RDX A;  3FC3 A;  4A54 A;  3DSQ A;  4M78 D;  4VUB A;  4XU2 A;  3L2Z A;  3OS1 A;  2Y4X A;  4M7A E;  3SWN A;  1M90 C;  3CXC A;  4M77 C;  3QII A;  3PIO A;  4M78 A;  2LQK A;  3SFM A;  1YFT A;  4TVW A;  4M7A D;  3RKW A;  2RI2 A;  3A8H B;  4DA4 A;  1VQ6 A;  2K57 A;  4MZT A;  1YJW T;  4TWA A;  5F5W A;  4M7D A;  2DTI A;  1U1T A;  3VQV A;  4J83 A;  4XTU A;  3URG A;  2PVO B;  1EFW A;  3MF1 A;  3QJY A;  4BI4 A;  5KCH A;  3CBM A;  3X24 B;  4O6J A;  1V29 B;  5ELO A;  4QQD A;  3JCM Q;  1H4V B;  1K73 U;  4BWA A;  5CKD A;  5FU7 B;  3DLL A;  2EQJ A;  5LJ5 g;  2QHU A;  2ZPF B;  2QEX A;  3TCJ A;  1OYX A;  1EVL A;  1QVF S;  4JLI A;  4IUT A;  3OYB A;  2HAX A;  3CBO A;  4M78 F;  4WI1 A;  3ZEH A;  1ADJ A;  4C8Q C;  2RHQ A;  2H3J A;  3BW1 A;  2XDD A;  3HPW A;  2K5F A;  2RHX A;  4P5N A;  3G71 T;  3CC7 A;  2DK3 A;  2K5I A;  3VBB A;  4BI8 B;  4P71 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...