4XTYA

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 63 with fluorine in place of 2'oh
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
264
structure length
264
Chain Sequence
TDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 94
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xtyA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xtyA01
3UFGA 4X9DA 4J6XA 2I4NA 3EFRA 1W66A 1H4SA 4C8QA 1LJOA 5GAMf 1EQRA 1HC7A 3JCMc 2RB6A 2Y90A 2RM4A 5GAN7 4N0AA 2ALYB 4M78B 5GAOq 4E51A 4XTZA 3SWNC 4M7DA 4M7AC 4JUVA 3A7UA 1SESA 2ZR2A 1N9SA 3JCMb 3JCMW 4HT9A 5GAOn 3ICAA 4V2SA 4M78A 3RL6A 3HXYA 5GAN4 5I21A 4YRKA 5GAOm 3A7AA 4WJ4A 3A31A 1I81A 4J6WA 1EVLA 4CH4A 3GIBA 3IALA 4J15A 2VC8A 2ZIMA 4H2XB 1BBUA 3MF1A 5LJ3d 3A5YA 4ZTZB 3SB2A 4M78C 1B76A 2C8MA 3A74A 1KQ2A 1NJ6A 1B34B 3SWNB 2XGTA 3CMQA 1C0AA 4M7AF 1USYA 4YRJA 4P72C 1X55A 3I7FA 4WF2A 3HXWA 1ATIA 1E24A 1H4TA 3LSQA 3MEYA 4P71C 4KQEA 4F7UG 2IY5A 4OLFA 2ODRD 4BWAA 3HFOA 2Q7HA 1D3BB 5GANf 3RUXA 4YRQA 5GAN6 2DQ3A 4H2VA 2QHSA 3BDUA 4TVWA 3W3SA 4PJOE 1X2GA 3RIRA 5LJ3g 1EOVA 4M78G 1JBMA 2ZZFA 4UPAA 3QO8A 3HRIA 4YRGA 5K1PA 4TVAA 4NCXA 4YRCA 2QHVA 1WU7A 1H641 5GAOp 4DPGA 3RKXA 4XEOA 4HWPA 4KR2A 3RKWA 2ZXFA 1X54A 1KQ1A 4LNSA 5GMKh 4P73A 4TWAA 4YPFA 2EJFA 2E41A 4P74C 3JCMd 2J3MA 3KFUA 1Y96A 4F7UA 4M75D 5C53B 4YRRA 3RACA 1B8AA 2DU5A 3QO7A 12ASA 4XTYA 1YFSA 3BJUA 4QVCA 2AKWB 3VBBA 1YB3A 2ZZGA 3HTZA 2ZNIA 4Y91A 4WI1A 4EMKA 5GMKe 4HWRA 4C8QB 1ADJA 2CJ9A 4JLIA 4M78F 4M77C 1YCYA 2K57A 3L2ZA 4M7AA 2RHSB 1PYSB 1WYDA 5LJ5g 4G84A 3HY0A 4F7UE 4PJOD 1LYLA 4XEMA 3MF2A 4C92B 4H2SA 1ADYA 3HRKA 2CJBA 2RHSA 3LC0A 4C8QG 1L0WA 2FYKA 4M75E 2ZZEA 3PZCA 4RMFA 4EMKB 4M77A 1EIYA 3ERRA 3FB9A 3M4PA 4C8QF 3QO5A 4P3NA 3V8LA 4C92A 4YP0A 1B70A 4HWOA 3PCOB 5CAIA 3HSBA 1JRIA 4M7DF 3IG2A 4P3OA 1WPYA 5GANg 2EJ9A 5K1XA 2QHTA 4M75A 4K87A 3FJPA 4J5YA 2G4CA 4C92E 4C8QD 1IL2A 2DQ0A 4H2WA 3IKLA 3V7RA 3JCMQ 3RF1A 2RHQB 5HGQA 1N9RA 5ELNA 4P74A 4DQ2A 2RA2A 4M75B 1M8VA 4PHCA 2YLBA 3JB9I 4EX5A 4P73C 3TEHA 3E9HA 2ZTGA 3VQVA 5GAMh 4M77F 4PJOG 4M7DC 1EFWA 2AMCA 4YRNA 3BFMA 2Q5IA 4MMKA 3IKMB 3V7CA 3RKYA 4XTXA 2ZT6A 2P5IA 4H02A 4HA8A 4XU0A 4H2YA 4UP7A 4M7AE 4M77G 1KOGA 3RERA 4XU3A 1G5IA 2ZT8A 1WQ7A 2FB7A 5LJ5d 2E5AA 3G1ZA 4M75F 4XTWA 2DTOA 1HTTA 1VQZA 1BIBA 1X2HA 4QVDA 2RD1A 2J3LA 3HFZB 1G51A 4M77B 5LJ5f 1NYQA 1EIYB 1E1OA 5GAN5 1QF6A 4BW9A 4XQ3A 3RESA 1FYFA 3JCMJ 1NJ2A 4M7DE 4PJOF 1YFTA 4CH5A 3SWNA 1QE0A 2DTIA 2E65A 3QO3A 2DJZA 2VXFA 3A32A 2ZGWA 2ZT5A 4N0AC 1D3BA 2JN0A 3JB9J 3AHUA 3JB9D 1PYSA 4M7AD 4TQDA 3TEGA 4EMKC 1U1SA 1JJCB 4JRKA 2E3CA 3A7RA 4YRFA 3JCMh 3E9IA 3INZA 4XTVA 5GAN2 5GAOr 4EMHA 4M77E 1GGMA 4YRSA 4Q6GA 4RCBA 4PJOB 1RIQA 2AKWA 3VQXA 4P75C 3QSUA 4C92F 2QTXA 5GMKl 2ARTA 3BW1A 2EWNA 3HFNA 3L4GB 4M7DG 4X5OA 1LNXA 4YCUA 3WQZA 3EFSA 3L1AA 4TVAB 3OD1A 5GAMj 5E3IA 11ASA 3TUPA 1NJ1A 3M4GA 3JCMe 2Q5HA 4OP0A 4JRIA 2ZCEA 4YCVA 3VU3C 4YROA 4YYEA 4CS4A 4UP9A 4TVYA 4AH6A 1WLEA 2I4MA 2ODRC 4M7DB 2ZT7A 4CH3A 5GANh 3JCMX 3FIFA 4O2DA 2ALYA 1G5HA 4XTUA 1J5WA 1HXDA 1JJCA 3HFZA 4HT8A 2Q7EA 1E22A 2ARSA 3P8VA 5GMKi 1B34A 4NOYA 5LJ5e 2CJAA 4M78E 2DDZA 5DY9A 4M75G 5GAMg 4RDXA 4P71A 3HXXA 4KR3A 4C8QE 4HVCA 1WNLA 4G85A 4H2XA 5LJ3h 2QHUA 2E1HA 3QTCA 4ZTUB 2PMFA 4L87A 1USYC 1WQWA 2DU7A 4C92D 3QUIA 2AMCB 2ZINA 1KMNA 2DXUA 1NJ5A 2CIMA 2I4LA 1NYRA 2E64A 2DXTA 1BIAA 4TQFA 4M75C 3JCMV 2Q7GA 4PJOA 1TH7A 3VQWA 5F5WA 3NETA 2CGHA 3A5ZA 5C52B 3UH0A 1U1TA 1BBWA 4EMGA 3JB9F 1Z7NA 3NENA 5C51B 5GAMd 3L4GA 2DVEA 1ASZA 5GANd 3BY7A 1YGBA 5GAOl 3TEHB 4YRMA 3V8KA 2PMEA 4WJ3M 5LJ3j 4RCCA 1E1TA 1B70B 3P8TA 3HXUA 2P0LA 1EVKA 2RHQA 4YREA 3NEMA 5GMKj 3QHSA 3REXA 2C7IA 2XTIA 1SETA 4X9CA 2YLCA 3DSQA 3HFVA 4P75A 4M78D 1NJ8A 4PG3A 4CH6A 4YRPA 2DEQA 2EJGA 3QNEA 2YHTA 1N9WA 3JB9H 5LJ3f 4YRTA 3PCOA 1B7YB 5LJ5j 3UGQA 5GANj 1SERA 3JCMf 4YCWA 2EAYA 4M77D 1Z7MA 1HK9A 2ZR3A 4C92G 3V7SA 1M5Q1 2DZCA 4C8QC 3JCMg 4P3PA 4HWSA 3LSSA 4YRIA 2ARUA 3PGGA 4M7AB 2ZIOA 4H2UA 1YFRA 1Y96B 4F7UB 4NL3A 5GAN3 1H4VB 1KMMA 4Q15A 4UP8A 4YRLA 4M7DD 2VXEA 4TTVA 3HXVA 3R07A 1I5LA 4XU2A 4A54A 3REUA 2HNIA 3HXZA 4K86A 4RQEA 5LJ3e 2EL9A 5ELOA 4YDQA 3NELA 2DKGA 4A53A 4MMLA 4PNOA 4HWTA 4RQFA 4F7UF 5GAMe 2ZNJA 4EO4A 3JB9G 4CS2A 4J6YA 3V8JA 5GAN8 3UGTA 3RGLA 4NL2A 1I8FA 1NNHA 4H2TA 5GMKm 1ASYA 1X01A 3P8YA 1SRYA 2DZ9A 4P72A 2IY5B 3HY1A 2E10A 4PJOC 4CS3A 2I4OA 5KNNA 1H4QA 4XU1A 1I4K1 5LJ5h 4C92C 4ZIBA 4M7AG 1LOJA 3VQYA 5GANe 1B7YA 3JCMP 1MGQA 4K88A 1X56A 2DTHA 3M4QA 2I2LA
chains in the Genus database with same CATH superfamily
2EQUA 1YJNQ 2NUTB 1D0XA 3EFRA 2EGEA 4LVLA 1Y7XA 4IUUA 2QXFA 3JCMc 2RB6A 2RM4A 1GRIA 4M78B 2HCKA 4C5HA 4XTZA 3SWNC 2DETA 4JUVA 5A0DA 3VKIA 4O6JA 4IURA 4Z02A 1N9SA 3JCMb 4OB1B 1JXMA 1ZLMA 5GAOn 4M78A 3EAEA 1R0CB 3HXYA 2RJDA 2HMAA 1I81A 4J6WA 4CH4A 2LJ0A 1KC8R 2VC8A 3PFSA 3OYMA 2MAMA 2CT3A 1BBUA 3CC4A 2COWA 1M1FA 2ABLA 3SB2A 4B9WA 1KQ2A 1NJ6A 1XQHA 2RJEA 4CC4B 4M7AF 2DRKA 1TWBA 2CYZB 2YT6A 4P72C 5J39A 3I7FA 1VYUA 2DL5A 1VIFA 2RJFA 2PU9B 5KYXB 3I55A 1NJIR 3FEOA 2HSPA 4F7UG 2JMAA 5LL6S 1RUWA 2PVOB 1PRLC 5GANf 3RUXA 5M9OA 4YRQA 5GAN6 1ZUYA 3BDUA 1VQOA 4X1VA 3FDRA 4LD6A 1D1AA 1KHCA 2M0YA 4CC7A 4PJOE 1X2GA 3RIRA 5LJ3g 4M78G 2DMOA 1QP2A 3PVLA 3QPHA 1MMAA 4XAXB 4UPAA 3CCVA 4PJLA 2MWPA 4YRGA 2JXBA 1XNIA 2FO0A 3SD4A 3M55A 1H641 1YJ9Q 1FMKA 2V1QA 3RKXA 4HCCA 2HL3A 4DBQA 2ZXFA 2FPDA 2V8IA 4PLIA 2VB6A 4P73A 1WZOA 5FW9A 2DRMA 4YPFA 3NTKA 2EJFA 2E41A 1SPKA 3CPWP 3M56A 4OMLA 1VQNQ 1IB8A 1NPRA 3PMIA 2A3LA 4F7UA 3I56T 1VQLQ 1YHQA 3OBWA 3M0SA 2DU5A 2AKWB 3C94A 3VBBA 3UT1A 2AKLA 1D09B 1Q86U 4F17A 3HTZA 2EYXA 4Y91A 3GOXA 1DJ7B 2QEXQ 4C8QB 1ADJA 2KXDA 4JLIA 1YCYA 2J6OA 3L2ZA 1WYDA 1PWTA 1ZSZC 2HBPA 2E5KA 4Q5WA 4F7UE 2PUKB 3QDFA 1Y0MA 4FCYA 1KC8C 2F2WA 1X6GA 1RI9A 2RHSA 3LC0A 1K9MU 1MHNA 1KFZA 4RMFA 4EMKB 1RAFB 1QCFA 3GP8A 2DEUA 1X75C 3MEAA 2QQRA 2K2MA 2DL8A 2COYA 4YP0A 2OTJA 5I22A 2HQHA 2XD0A 1ZA2B 2CSQA 1WPYA 2KBTA 1K0SA 2QHTA 2LC4A 1QKWA 1VQNT 2DE0X 2KK4A 4C8QD 2DQ0A 4H2WA 4MDXA 3RF1A 2BIVA 1N9RA 5ELNA 3REAB 1FYNA 1M8VA 3MQZA 4PHCA 1M30A 2YLBA 4LUEA 4P73C 2LNHB 3HKSA 1QQJA 2X4YA 1B3QA 2ZTGA 3VQVA 2FZKB 4PJOG 4M7DC 2AMCA 1UDLA 2Q5IA 2DNUA 3RKYA 2ZT6A 3GBQA 1PD1A 4UP7A 4XU0A 1Y07A 4FL6A 4BI4A 1G5IA 1FMWA 3H8ZA 4M75F 2RK1A 2DTOA 5D7UA 3KXTA 3M57A 4LVMA 4QVDA 3OYLA 4LDUA 3CXCP 2VVKA 4ZTJA 3HFZB 1EIYB 1TU0B 4PKCC 1VQOQ 4BUGA 4GBQA 1QF6A 3M53A 3EGUA 2XDPA 2VYTA 2YRDA 1NJ2A 1YFTA 5KYWB 2E12A 2X4XA 2CP3A 3QO3A 2DJZA 2ZGWA 2ZT5A 2Y4XA 4M7AD 1PYSA 1YITA 1NG2A 3OSVA 3KFVA 3Q1JA 3CC2T 2E3CA 5CKHA 2QA4A 5FWCA 1M9SA 2DBKA 3INZA 1WHHA 1W6XA 5GAOr 4M77E 2G3RA 2J7IA 4YRSA 4RCBA 1JO8A 3QSUA 3EG2A 2ARTA 3BW1A 2K4YA 4HVVA 2IVWA 2EWNA 4LVJA 1KQSA 1KD1R 3WQZA 3TUPA 3L1AA 3OD1A 3URGA 1OOTA 3BDLA 3M4GA 4DEYA 3HP9A 1AZGB 4J9FA 2KNBB 4OP0A 3CC4T 2ZCEA 2GQVA 2A37A 4E6RA 2K6DA 2SRCA 1OU9A 1K8AR 3H0IA 2RF0A 2BZ8A 4DBRA 1JJCA 1VUBA 2E6NA 2DXBA 1VQLT 1QVFA 1K9AA 1N27A 2ESWA 3CCEA 2MYSA 1B34A 4WCIA 2ZAEA 4M75G 5GAMg 3HXXA 2K7AA 1CKAA 5LJ3h 2E1HA 2LJ1A 4L87A 1TG0A 1VOMA 2L0AA 3CCRT 2DU7A 1UGRB 3CCRA 2ZINA 5CQYA 1FXXA 1NJ5A 2I4LA 2PNIA 3EG9B 1IZ6A 1NYRA 5EG2A 1Q82C 1ZA1B 1Q82R 2GFAA 3VRZA 4M75C 2Q7GA 4HVWA 5F5WA 4JS5A 2A36A 2CGHA 4PFOA 3R6OA 4ME7A 4MZMA 3REBB 4AFSC 3CCQQ 1U1TA 2JJ9A 3OMCA 2KVQG 2B8AA 2QDLA 2RHUA 1GBRA 1C0MA 1K73C 4E7ZA 5I2SA 3O5ZA 2WSCE 5IXBA 4IKFA 2QK0A 3BY7A 2CH4W 3S3NA 1YGBA 3TEHB 1RACB 1MNDA 4WJ3M 5LJ3j 3VS5A 4UC4A 4JJNK 2O01E 4D6WA 2RHQA 3NFCA 3NEMA 1VQOT 3TSWA 5FLXE 1Y57A 3E2UA 1S72A 3MEUA 1W2BS 4J9CA 4BE0A 4CH6A 4PG3A 3A98A 2YHTA 1X69A 1N9WA 5LJ3f 3G4ST 3C12A 3UGQA 4BB7A 4Z89A 1MMDA 1SERA 3JCMf 1VQ6A 2HQXA 2EQKA 4YCWA 4M77D 1PRMC 1M8MA 3D7SB 3CPWA 1FX7A 3OQ5A 2DZCA 5HCKA 3CMAA 3L2WA 4AMCA 1YJNA 1T3SA 1AWWA 4LN2A 4PFZA 1YP5A 4HVUA 2IIMA 1Y96B 1YFRA 1OPLA 1R0BG 3LYIA 4NL3A 5HK0A 4YRLA 2RQWA 3UF4A 3HXVA 4QT7A 4JPBW 2DILA 2FRYA 5KCHA 3NELA 1C1AA 1ZUUA 2OJ2A 4LVIA 1A0NB 1W2BA 2P0KA 3EG0A 3BE3A 4KH0B 2KROA 2XICA 5A0GA 4OMQA 3META 2ZNJA 1AHJB 4EO4A 4IUTA 1WJRA 2LX9A 3ASKA 2BZYA 1PC0A 3HRUA 4J6YA 2CH4A 3V8JA 1UE9A 2CREA 1PHTA 1I8FA 1Q81U 1ASYA 3A8HB 3MP1A 3CCLT 5CKBA 1YI2Q 4A4FA 5DLOA 3E9FA 1RAIB 3EGDB 2IY5B 1QLYA 3HY1A 2HKNA 2E6ZA 3VRYA 3OMGA 3MP8A 5KE2A 2LT4A 2I4OA 5KNNA 3E9GA 4JRQA 2GFUA 2AZSA 3QWXX 1T3LA 1UG1A 4FT2A 3JCMP 2JM8A 3L2QA 1QCNA 3ZBDA 3M4QA 2I2LA 2DQ3A 1VQ9T 4JZ3A 4JS4A 1W1FA 3LGFA 3TEEA 2I4NA 4C8QA 2F1LA 1LJOA 3L2UA 1HC7A 2Y90A 2FPFA 2K2VA 5GAN7 4KT0E 3VV0A 5CO7A 1PNJA 2K9GA 5FRMA 4M7AC 2XI9A 3A7UA 1MV0B 1M90R 3X25B 2F2VA 1V29B 2D0NA 3H0HA 3JCMW 4HT9A 3ICAA 2L5QA 1WX6A 1RAEB 5GJVB 4YRKA 3A7AA 4LXCA 1VYVA 2H3JA 3GIBA 2J05A 1Z9QA 1O75A 2QDYB 4J15A 2ZIMA 3PE0A 5LJ3d 3F70A 3X20B 2EIFA 1NEBA 2CDTA 3A5YA 4RTVA 4M78C 2C8MA 2ZCFB 2ZPGB 3CQTA 3SWNB 4AFQC 2XK0A 2XGTA 3P8DA 1USYA 4YRJA 1NBEB 3G71Q 5CKEA 3HXWA 5IAYA 1WHLA 1YJWA 1H4TA 3H0FA 3LSQA 4P71C 2A8EA 2ODRD 4BWAA 1K73U 1M2OA 4AG2C 2K3XA 3AT1B 2COZA 4H2VA 1UEBA 2L3PA 3PTAA 2YXYA 3I55Q 3CCMT 2QA4T 1QW1A 3CCUQ 2KAFA 1EOVA 3X24B 4HCBA 5CK9A 3QO8A 5K1PA 2CKKA 2WSFE 4NCXA 1IRXA 3S3OA 3CC4Q 4IIMA 2DFUA 5GAOp 2RQUA 4DPGA 3CBMA 4P5NA 1X43A 1M2VA 4FW1A 4KGZB 2FPEA 1K0XA 4TWAA 2VV5A 3VYHB 3SEMA 4P74C 1VQMQ 3KFUA 2O88A 3LGLA 2V8KA 3OYNA 5IT9E 1B8AA 1ZSZA 1H8KA 5A0LA 1IO6A 1M3AA 1P92A 3MCAB 3P8HA 2DL3A 3J81E 4BD3A 1G3TA 2ZZGA 5FU6C 1KIKA 1UUEA 4E2FB 3OS1A 2CJ9A 3CD6Q 4M78F 2X3XD 3PMTA 4M7AA 2P4RA 3VS1A 4HKEA 3HY0A 3I35A 2DYBA 4R56A 4PJOD 2KE9A 1LYLA 2JNGA 3OW2S 2RHYA 3PIOA 3GPLA 4XEMA 2JUFA 4H2SA 1ADYA 2CJBA 2X9HA 1L0WA 2OAUA 2FYKA 1ZQ1A 1U5SA 2NUPA 2K5IA 4M77A 1K8AC 3ERRA 1G3WA 3FB9A 3TQ7P 1OV3A 2K3BA 2VGMA 4C8QF 3QO5A 2O4XB 1EFNA 1GFDA 1B70A 3J7AF 2X3WD 2DL4A 1ZSZB 4NS5A 4M7DF 1TUDA 3A8LB 4P3OA 5K1XA 3A8MB 4Z88A 2G4CA 2GF7A 2LMJA 4Y28E 4C92E 4EIKA 2CP7A 3HTRA 1NM7A 1Q7YU 1IGQA 5IHKA 3V7RA 1Q7YR 4EDUA 2LX7A 2E5QA 4M75B 4C0FA 4ELYC 1M2VB 3QKJA 4EX5A 2K5FA 1BI2A 5GAMh 2LQNA 3FRNA 1VQ4T 4YRNA 3M0RA 2FZGB 3V7CA 4XTXA 4DOVA 4CI0C 2HEQA 4H2YA 4M7AE 2DPPB 2VGNA 4M77G 1R8OB 4BDZA 3RERA 2Y4YA 1WQ7A 2EPDA 1RLPC 5L23A 1Q82U 1HTTA 3OYEA 2OTLQ 1WHGA 2MIOA 2O4XA 5D6WA 5CIUA 1UJ0A 2LVMA 5L8RE 1YCSB 4M77B 1J3TA 4E7JA 1NYQA 4XQ3A 1TTHB 3RESA 3C95A 4PJOF 4E7IA 1M90C 3SWNA 1QE0A 2DTIA 4QKUA 2E65A 4QQGA 3M5AA 4FIBA 2JN0A 3JB9J 3CCLQ 1NLPC 2QI2A 3JB9D 3AHUA 2DIQA 1IGUA 1QVGP 4TQDA 2YSQA 4OGEA 4F04B 3G6EA 4JRKA 1WHMA 2DD4A 2O9SA 3OYYA 4B6MA 4YRFA 2LJ3A 1W4SA 2QQBA 1M1KC 4XTVA 3VS4A 5GAN2 4EMHA 4ZGDB 2DL7A 2LP5A 4C92F 2QA4Q 3PNWC 4AG1C 1M90U 2K5LA 2MF2A 2JMCA 3HFNA 3L4GB 4X5OA 4LDXA 1LNXA 4YCUA 1BU1A 4TVAB 11ASA 5E3IA 3G6EQ 3TSZA 1OYXA 1XOVA 4LD9K 2ZPEB 3JSCA 1CKBA 2W10A 1HSQA 1UJYA 5AYFA 4GLKA 4TVYA 4AH6A 2ZZDA 1WLEA 2YUNA 2JTEA 2RI3A 1K9MC 4CH3A 3CCMQ 3DLLA 3KBGA 1JXOA 4KGXB 4OGCA 3CCVQ 1LVKA 5CR2A 1J5WA 2LCLA 4BACA 4HT8A 3UWNA 1TUCA 3OYIA 2P0QA 5GMKi 3JAME 2CZ6B 1MV3A 1SEMA 2CJAA 1G83A 4KR3A 1YFNA 2LQWA 4OB3B 1D0YA 4H2XA 4Z8AA 4A4GA 3OS2A 2KQWA 1WQWA 2QQ9A 2RK2A 4C92D 2DXUA 2CIMA 4DOWA 3CC7Q 3QZ9B 3SDZA 1SKUB 1BIAA 3MEVA 3JCMV 2AT1B 1JJ2S 2M9UA 3UH0A 3JB9F 2RQVA 4KRTA 3VS3A 2XHCA 3NENA 3KUFA 1C6VX 4CRIA 3CCEQ 2DVEA 3ZFJA 1ASZA 1X27A 1IHWA 1BCMA 4FYYB 2XIDA 4FSXA 2FZCB 4RCCA 4TVRA 3EHQA 3P8TA 1YITT 2KRMA 1V76A 5GMKj 2DVJA 1JJ2P 5CCAA 2DLPA 2YLCA 3I56Q 4OMPA 4LE9A 1PD0A 4M78D 1NJ8A 4R0KA 4N4HA 2DEQA 1YI2A 3VS2A 4YRTA 3PCOA 2VWFA 3ZL7C 4DA4A 1AD5A 1AT1B 5GANj 3LWHA 1GCPA 4J9GA 4BDYA 3QZ5B 3CC2Q 1Z7MA 4RTTA 2CZ1B 2XU8A 2KT1A 3VS0A 2J06A 3O8VA 3R6NA 1M4ZA 1N5ZA 3QIIA 3JCMg 1AWJA 2BTTA 2JTMA 2FL7A 4HXJA 1WJSA 3PGGA 2HZYA 2ZIOA 4H2UA 3VJPA 5KYYA 1UGVA 3OYBA 1QVPA 4F16A 1H4VB 3WXMB 4M7DD 3OBYA 3R07A 3OA6A 1SG5A 1X2KA 1OU8A 4II1A 3HXZA 2P0PA 4K86A 3CCMA 2D9TA 5LJ3e 2OTLT 1VYTA 2BE7D 4MDWA 2EL9A 2DKGA 3FLGA 4A53A 2Z0WA 3QG1A 5C6SA 1OX9A 3CCVT 2PVDB 1WHJA 4A4KA 4B9XA 2XMFA 4CS2A 3LH0A 3G4SQ 4NL2A 4FYWB 1NNHA 2QGGA 4OVAA 4H2TA 1VA7A 3CPFA 1M1GA 1RABB 3A8GB 1SRYA 2DZ9A 4C5IA 3QYGB 1TUGB 4RG2A 3M0TA 1YHQT 3CD6T 1NLOC 1H4QA 2L8DA 1LOJA 3GNFB 5GANe 4RTYA 2KY9A 2E70A 1MGQA 4K88A 1X56A 4HCKA 3HL8A 3VUZA 3FC3A 3DB3A 1OZ3A 4X9DA 4QQDA 2ZPBB 1W66A 1H4SA 2KGTA 3EG1A 5GAMf 4BI8B 2ALYB 4E51A 5GAOq 1WFWA 3L2RA 1Q81R 2VUBA 3QWYA 2DIGA 2DERA 2CSIA 3OYAA 4V2SA 4J8OA 5GAN4 1KD1U 5I21A 1Z9ZA 1GL5A 4FW2A 4WJ4A 3A31A 3OYFA 3M4YA 2VKNA 5AT1B 1KC8U 4H2XB 3MF1A 3OYDA 4ZTZB 3A74A 3I9QA 1RADB 3I56A 2OX7A 5I2MA 2LCCA 5KYUB 3SHWA 3E1SA 1X55A 3EGXA 1X6OA 4WF2A 3CBOA 1KSWA 1ATIA 4EPCA 2QQSA 1W2BP 4OMNA 3G7ZA 5HKCA 3MP6A 4MZTA 3FJ5A 3CC2A 2Q7HA 1QVFP 1GBQA 2M1HA 1YITQ 4TVWA 3PVQA 2GNCA 3CCJT 1UGPB 2ZZFA 2GTJA 2NYSA 1HD3A 4J9DA 3CMET 3HRIA 4TVAA 4YRCA 1ZSGA 3U23A 2AK5A 2EGAA 3J80E 8AT1B 2FVUA 4XEOA 4KR2A 1I07A 4QQ6A 2O31A 1JQQA 3RKWA 4RTWA 4L6V5 1VQ5A 1X54A 5GMKh 1BI3A 1G3SA 3LH5A 4PLLA 4AT1B 2HDAA 5FRNA 4JJBA 3JCMd 1M27C 2YWWA 2LZ6B 5CVIA 5KYYB 4IIOA 1PG5B 3CC7T 2CP2A 2RO0A 3QO7A 4E7KA 12ASA 3EFOA 4XTYA 2BUDA 4QVCA 3CPWS 1YB3A 2OAWA 2KEAA 2FRWA 1GFCA 2X4JA 2ZPFB 4EMKA 3JRZA 3OSSC 4XK8E 4HWRA 1OEBA 4FYXB 1OX8A 4IUPA 4E47A 2K57A 2RHSB 1MMNA 1PYSB 5LJ5g 4G84A 4C92B 1UHFA 2V1RA 1VQ9Q 3HRKA 1JU5C 2DJQA 5KYWA 4RKUE 2O2OA 2EW3A 3QJYA 3CCQT 4BE2A 4M75E 3PZCA 3MEWA 4BE1A 3CMEQ 1EIYA 1AEYA 5J26A 3M4PA 5CKFA 3L42A 2RHIA 1RI0A 1BKBA 3TCJA 3CCLA 2MWOA 3LX7A 4HWOA 3PCOB 2EKHA 2SEMA 3H41A 4RG8A 3CC7A 4M75A 5GJWB 1GXIE 1YJ9A 1N8RC 1JJ2A 1WGSA 1BB9A 4FYVB 2RH2A 2JM9A 5HGQA 3JCMQ 2DO3A 1JB0E 1RAAB 3JB9I 1ACMB 4OF1A 4JRPA 3CCST 3E9HA 2LNVA 4M77F 5FU7C 1YI2T 2A28A 1NJIC 3BFMA 4MMKA 1ABOA 4C5EA 4H02A 2CUBA 4HA8A 3G4SA 1XTDA 3OYCA 1KOGA 2RMOA 4OB0B 1PKTA 2FB7A 5EC7A 5LJ5d 2E5AA 3G1ZA 4E7SA 1AOJA 1VQZA 1BIBA 3H6ZA 2FEIA 2QG9B 2OTJT 1T0JA 3L2VA 1VQ5T 2F5TX 4GLMA 4E7HA 1Y71A 2EYYA 1M1KR 5GAN5 1E1OA 4BW9A 4C5GA 2J6FA 3JCMJ 4JLGA 2RI5A 3CD6A 1YJ9T 4C0ZA 2HD0A 2V26A 2VXFA 2GBQA 4N0AC 1D3BA 1SSFA 2D1XA 1WXBA 1WLPB 3TEGA 4EMKC 3DB4A 1U1SA 2X35A 5IHNA 1JEGA 3A7RA 2AHJB 1UFFA 3P8BB 3UPUA 1GGMA 1M3CA 4Q6GA 4PJOB 1RIQA 2M16A 1VQ4A 3X28B 4HCZA 2AKWA 2JTFA 2QTXA 4RMOA 3HRTA 1UECA 4M7DG 1ZBJA 1QMCA 2WACA 5GAMj 2L2PA 2KMTA 2DF6A 3GF5A 2LTOA 3EG3A 4O5VA 2NUTA 2Q5HA 4JRIA 4YTLA 4UP9A 2XDBA 1KK7A 4PK4A 2I4MA 1VQKQ 4M7DB 2KYMA 1I0CA 4OB2B 2ZT7A 2R58A 4O2DA 2P84A 1SHFA 3M59A 4KUIA 1G5HA 1NYFA 3OYGA 1UGQB 2BE9B 1Q86C 1K1ZA 5D6YA 2Q7EA 1E22A 1E6GA 1YBYA 2ARSA 1VQPQ 4K11A 3EHRA 2ATCB 5KE3A 4IUQA 1CSKA 4NOYA 4X34A 1T0HA 4M78E 2M0OA 1OULA 3M58A 4OMOA 4HT4A 4C8QE 2EQJA 1YIJA 4HVCA 1WDXA 1WNLA 1KD1C 4G85A 3VS6A 2QHUA 3QTCA 4ZTUB 5KYXA 1O9SA 1OPKA 2RN8A 8ATCB 1KMNA 3EH1A 5KH6A 2AZVA 1BCOA 1VIEA 2QASA 1VQ7T 3T9NA 1PSFA 1S1NA 4PJOA 1WXUA 3VQWA 2I0NA 3LWIA 4RTUA 5C52B 1YIJQ 1U06A 1UTIA 1YJNT 1NE8A 1BBWA 1E7OA 3OW2A 1G5VA 1Q81C 1K73R 3SFMA 2O9VA 1B07A 1HJDA 4ESRA 2W0ZA 5GAOl 4ORZA 4YRMA 2JOYA 3WVEB 1VQNA 2YUPA 2LQKA 1B70B 1Q86R 4YREA 3OYJA 2CS7A 4FT4A 2AKKA 3QHSA 1NEGA 2H8HA 4PL6A 3REXA 2XTIA 4X9CA 5A2QE 4P75A 2NLUA 2KSSA 5DLQE 3CBPA 2EJGA 1PKSA 3CCSQ 2JS0A 3JB9H 2ROTA 2QEXA 5LJ5j 4KBMB 2EYQA 2LT1A 1YN8A 4D8KA 3G71T 4ZN1A 2EAYA 2NUPB 1HK9A 1I5OB 4ZNXA 2MI6A 4DEXA 3CXCS 3JV3A 4JJCA 1YHQQ 4C8QC 4C0DB 1BI1A 4P3PA 4N4IA 2GGRA 2OI3A 3LSSA 2CUDA 4YRIA 1WI7A 4M7AB 4J9EA 4CC2A 1QP3A 1W70A 2DYIA 1VQ4Q 3VS7A 1EX4A 1D1BA 5GAN3 1KG1A 1TSFA 2L89A 4UP8A 2RNAA 3C4SA 2D8JA 3NGPA 1VQ8Q 4PJNA 2EFIA 1B7TA 2XKOC 4D8DA 1AVZC 2HNIA 2OTLA 2HKQB 4RQEA 4RTXA 4KH1B 1RAHB 1R77A 3X26B 1OI1A 3ZEHA 2RI2A 4HWTA 4RQFA 2JS2A 4F7UF 5GAMe 2LRQA 1EZZB 2KR3A 3JB9G 1N8RU 2F5KA 4ZTFA 1XJWB 2KRSA 3G71A 3S6WA 5GAN8 4J9HA 4ZN3A 4LNPA 3LLRA 2QTVA 1X01A 5ECAA 3OS5A 4A63B 4P72A 1QVGS 1NJIU 3CMAT 1BK2A 1TS9A 2PTKA 2X51A 4CS3A 5LJ5h 4C92C 5HK3A 4M7AG 4ZIBA 3RR6A 1OQKA 2KDSA 3TREA 1B7YA 4OMMA 2DTHA 5C0MA 3OYKA 4CC3A 3OS0A 2JT4A 2PVGB 1YWOA 3UFGA 4J6XA 3I5SA 1EQRA 1X2QA 4N0AA 3QBYA 3S3MA 3TVTA 1SRLA 3MKDA 2K79A 4M7DA 2YDLA 2B86A 3EFOB 1SESA 2ZR2A 2AIRB 1E6HA 2RHZA 1IXDA 1OZ2A 3RL6A 2MOXA 4C0GA 1H3HA 5GAOm 4BY6B 1VQ5Q 3THKA 1EVLA 1NPPA 5FU6B 3OY9A 3IALA 1H3ZA 2FHDA 3A5ZB 4LDVA 5KCOA 1BI0A 3N5BB 2DAQA 1IREB 1B76A 5FU7B 1B34B 3QXEB 1C0AA 3CMQA 2IPOB 1AWOA 1H92A 4KUDK 1HYOA 2GTOA 2BKDN 1E24A 2ROLA 3MEYA 1SRMA 4KQEA 7AT1B 3EGDA 2IY5A 3CCET 3EGXB 2MCNA 4OLFA 2C0IA 1KQSS 1VQLA 5KYUA 3HFOA 1D3BB 3C0CA 3CEYA 1RL2A 1VQKT 2QHSA 1VQ7Q 3W3SA 4FU6A 2JZ2A 2JW4A 3VUBA 2V8JA 3GNGA 1QKXA 1JBMA 3CCUA 1N8RR 2JVVA 1ZX6A 3CMEA 2EBPA 3ULRB 2HL5C 1QWEA 5IN1A 2QHVA 1WU7A 2J6KA 3M0QA 4HWPA 1LPLA 1KQ1A 3EH2A 4LNSA 4OMFB 3NHNA 2A7YA 2D0QB 2J3MA 2D8HA 3NTHA 4A4EA 1Y96A 4M75D 5C53B 1SF9A 4YRRA 3QDRB 3RACA 2EGCA 4RTZA 1YFSA 2QYZA 3BJUA 3UA6A 3VYGA 3UDCA 1VQKA 2EVRA 1ZBXA 2ED1A 2ZNIA 4WI1A 5GMKe 2ENMA 3G6ET 5FWBA 2MMPA 1EIFA 3CCSA 1WA7A 4M77C 1WJQA 2E4HA 1Q95G 3UATA 1BYMA 2KT8A 3MF2A 1UGSB 2MPXC 1BBZA 3CCUT 1X6BA 6AT1B 3CCQA 2F69A 3A1PA 2E3HA 2CP6A 4C8QG 2ZZEA 2EQIA 2HSEB 2YUOA 3M0PA 1M1KU 1VQ6T 2OTJQ 2G6FX 4BI3A 1QCOA 4P3NA 3V8LA 4C92A 1KQSP 3ME9A 3DKMA 5CAIA 3HSBA 1JRIA 5D6XA 4WTOB 3IG2A 1MUZA 5GANg 2EJ9A 2HQEA 1V1CA 3RBBB 4K87A 3FJPA 4J5YA 3CMAQ 1WXTA 3GLXA 1VQMT 2GCXA 4RUGA 1IL2A 2CZ0B 2R5MA 3IKLA 4JJDA 1K76A 2NUZA 2RHQB 4P74A 4DQ2A 2RA2A 3TEHA 3TU4K 3EG9A 4PJMA 2M02A 1K9MR 2WSEE 1SSHA 1EFWA 2GQIA 1YIJT 3RMSA 5DM7R 4KGVB 1K4US 2QEXT 3IKMB 2P5IA 1PM3A 2YRCA 4XU3A 1D0ZA 2ZT8A 3E19A 1YWPA 2R5AA 2KI7A 1VQ7A 2KXCA 4XTWA 1UB4A 1X2HA 4JDSA 2YUQA 2RD1A 4ZGJB 2CT4A 2YRVA 5CKDA 2J3LA 3MO8A 1G51A 5LJ5f 1QWFA 2LQ8A 1FYFA 4M7DE 1WYXA 1AZEA 1VQ8T 4PFPA 3HHTB 1RLQC 4CH5A 9ATCB 2P4TA 1MNEA 2RQTA 3WVDB 3A32A 3OYHA 4LDWA 4PJJA 2FG0A 3I5RA 4ATOA 5FROA 1VQ9A 2LDMA 1JJCB 2XG8D 1GCQA 3M0UA 3JCMh 1FWZA 3E9IA 4KULA 2D6FA 4L59A 2C0TA 3QJ6A 3M9QA 3VQXA 4P75C 2KRNA 3IQLA 4QW2A 5GMKl 4QVZA 1GCQC 1PSEA 4DBHA 4DBFA 1G2BA 2PQWA 3EFSA 2EQMA 1NJ1A 3JCMe 2PZ1A 2F2XA 4YROA 4YCVA 3VU3C 1FMVA 4YYEA 2L3RA 4CS4A 2ODRC 2EKOA 5GANh 4J9IA 2DM1A 3FIFA 3JCMX 2ALYA 3M54A 4J9BA 4XTUA 4GY5A 3RNJA 3HPWA 2EYWA 2DA9A 3H9NA 3OW2P 1HXDA 1N6AA 4FM4B 4VUBA 4LUDA 3HFZA 1Q7YC 1QVGA 2C06A 3P8VA 5LJ5e 2DDZA 5DY9A 3HRSA 4L5GA 4RDXA 4A4HA 4P71A 2H3EB 2KYBA 2DBMA 1VQPA 2ZPIB 1G3YA 2PMFA 1USYC 2HBWA 3PIPA 2A08A 3QUIA 2AMCB 4M4ZA 4JZ4A 2E64A 2DXTA 1K8AU 1D1CA 4J7FA 4TQFA 2HAXA 5I11A 3OB9A 1TH7A 3NETA 3A5ZA 5CQXA 1VQ6Q 4EMGA 1YJWQ 1Z7NA 4N4GA 2LCSA 5HY6A 2ZPHB 5C51B 2RQRA 5GAMd 3L4GA 3QYHB 3UA7A 5GANd 1VQ8A 1UHCA 3V8KA 2CZ7B 2PMEA 1S72Q 3A8OB 1VQMA 1KJWA 1E1TA 3HXUA 2P0LA 4BY6C 1EVKA 3MHXA 1TOVA 4Y92A 3NMZC 2QGFB 1PCXA 2RJCA 2C7IA 1SETA 2X4WA 1VQPT 3DSQA 3HFVA 1ABQA 2DXCA 4F14A 2VASA 1NZ9A 4YRPA 2BZXA 3QNEA 2PUOB 1B7YB 1NYGA 2DD5A 2M51A 4IUVA 1U3OA 2ZR3A 2L3SA 2QQAA 4C92G 3CCRQ 3MJXA 3V7SA 2R57A 4ANJA 4MZPA 1F1BB 1M5Q1 1ZHIA 3ER0A 1WIEA 5IHIA 4HWSA 2NWMA 2E3IA 4R55A 2C0OA 4J7IA 1SHGA 3CXCA 2ARUA 4LVKA 4F7UB 2DX1A 2K3YA 4LDYA 2L3QA 1I1JA 1RAGB 5KYNA 1YJWT 3CCJQ 1KMMA 4Q15A 1IHVA 2VXEA 4TTVA 2RHXA 1I5LA 3LW5E 4XU2A 4A54A 3REUA 1S72T 1LCKA 5ELOA 1KHIA 4C0DC 4YDQA 1ZUKA 4E7LA 4AFUC 3G1JA 4MMLA 5J3BA 2RPNA 1G8XA 4PNOA 2CP5A 4ELZC 3CCJA 4ZGEB 2DK3A 3NTIA 1MMGA 1YNZA 2XDDA 3NPFA 1AWXA 5IH2A 3RGLA 3UGTA 4FSSA 3PT9A 1U8RA 2EYZA 5GMKm 2A0FB 3MPUB 3P8YA 1QVFS 2IG0A 2CP0A 2E10A 4J83A 3RMQA 1M3BA 4PJOC 1ARKA 2MK5A 2ED0A 2NS6A 2ECZA 4XU1A 1I4K1 3DLMA 3VQYA 2QAZA 3RDVA 5IXFA 1TXQA 1WHKA 3I55T 4AFZC
chains in the Genus database with same CATH topology
2EQUA 3EFRA 4LVLA 1Y7XA 4IUUA 2QXFA 3JCMc 2RB6A 2RM4A 4M78B 4C5HA 4XTZA 3SWNC 4JUVA 5A0DA 3VKIA 4O6JA 4IURA 4Z02A 1N9SA 3JCMb 4OB1B 5GAOn 4M78A 3EAEA 3HXYA 2RJDA 1I81A 4J6WA 4CH4A 2VC8A 3PFSA 3OYMA 2MAMA 1BBUA 3CC4A 1M1FA 3SB2A 4B9WA 1KQ2A 1NJ6A 1XQHA 2RJEA 4M7AF 2CYZB 4P72C 5J39A 3I7FA 1VIFA 2RJFA 2PU9B 3I55A 3FEOA 4F7UG 5LL6S 2PVOB 5GANf 3RUXA 5M9OA 4YRQA 5GAN6 3BDUA 1VQOA 3FDRA 4LD6A 1KHCA 4PJOE 1X2GA 3RIRA 5LJ3g 4M78G 1QP2A 3QPHA 4XAXB 4UPAA 3CCVA 2MWPA 4YRGA 1XNIA 3SD4A 3M55A 1H641 3RKXA 4HCCA 2ZXFA 4PLIA 2V8IA 4P73A 4YPFA 3NTKA 2EJFA 2E41A 3M56A 1NPRA 3PMIA 2A3LA 4F7UA 3I56T 1YHQA 3OBWA 2DU5A 2AKWB 3C94A 3VBBA 3UT1A 1Q86U 3HTZA 4Y91A 3GOXA 1DJ7B 4C8QB 1ADJA 4JLIA 1YCYA 3L2ZA 1WYDA 2HBPA 4F7UE 4Q5WA 2PUKB 1KC8C 2RHSA 3LC0A 1K9MU 1MHNA 4RMFA 4EMKB 3GP8A 1X75C 3MEAA 2QQRA 4YP0A 2OTJA 2XD0A 1WPYA 2QHTA 2LC4A 1VQNT 2KK4A 4C8QD 2DQ0A 4H2WA 4MDXA 3RF1A 2BIVA 1N9RA 5ELNA 1M8VA 3MQZA 4PHCA 2YLBA 4P73C 3HKSA 2X4YA 2ZTGA 3VQVA 4PJOG 4M7DC 2AMCA 2Q5IA 3RKYA 2ZT6A 4UP7A 4XU0A 1Y07A 4FL6A 4BI4A 1G5IA 3H8ZA 4M75F 2RK1A 2DTOA 3KXTA 3M57A 4LVMA 4QVDA 3OYLA 4LDUA 4ZTJA 3HFZB 1EIYB 4PKCC 4BUGA 1QF6A 3M53A 2XDPA 2VYTA 1NJ2A 1YFTA 2E12A 2X4XA 3QO3A 2DJZA 2ZGWA 2ZT5A 2Y4XA 4M7AD 1PYSA 1YITA 3OSVA 3Q1JA 3CC2T 2E3CA 5CKHA 2QA4A 1M9SA 3INZA 5GAOr 4M77E 2G3RA 4YRSA 4RCBA 3QSUA 2ARTA 3BW1A 2K4YA 2IVWA 2EWNA 4LVJA 1KQSA 3WQZA 3TUPA 3L1AA 3OD1A 3URGA 3BDLA 3M4GA 3HP9A 4OP0A 3CC4T 2ZCEA 2GQVA 1JJCA 1VUBA 2E6NA 2DXBA 1VQLT 1QVFA 1N27A 3CCEA 1B34A 4M75G 5GAMg 3HXXA 5LJ3h 2E1HA 4L87A 3CCRT 2DU7A 1UGRB 3CCRA 2ZINA 5CQYA 1FXXA 1NJ5A 2I4LA 1NYRA 1IZ6A 5EG2A 1Q82C 2GFAA 4M75C 2Q7GA 5F5WA 4JS5A 2CGHA 3R6OA 4ME7A 4MZMA 1U1TA 3OMCA 2KVQG 2B8AA 2RHUA 1K73C 5I2SA 2WSCE 4IKFA 3BY7A 1YGBA 3S3NA 3TEHB 4WJ3M 5LJ3j 4UC4A 4JJNK 2O01E 4D6WA 2RHQA 3NFCA 3NEMA 1VQOT 5FLXE 1S72A 3MEUA 1W2BS 4BE0A 4CH6A 4PG3A 2YHTA 1N9WA 5LJ3f 3G4ST 3C12A 3UGQA 4BB7A 1SERA 3JCMf 1VQ6A 2HQXA 4YCWA 2EQKA 4M77D 3CPWA 1FX7A 3OQ5A 2DZCA 3CMAA 3L2WA 1YJNA 1YFRA 1Y96B 3LYIA 4NL3A 5HK0A 4YRLA 3HXVA 5KCHA 3NELA 4LVIA 1W2BA 2P0KA 2XICA 5A0GA 3META 2ZNJA 1AHJB 4EO4A 4IUTA 1WJRA 2LX9A 3ASKA 3HRUA 4J6YA 3V8JA 1I8FA 1Q81U 1ASYA 3A8HB 3MP1A 3CCLT 5CKBA 4A4FA 5DLOA 3E9FA 2IY5B 3HY1A 2E6ZA 3OMGA 3MP8A 5KE2A 2LT4A 2I4OA 5KNNA 4JRQA 3E9GA 2GFUA 4FT2A 3JCMP 3L2QA 3ZBDA 3M4QA 2DQ3A 2I2LA 1VQ9T 4JS4A 3LGFA 3TEEA 2I4NA 4C8QA 1LJOA 3L2UA 1HC7A 2Y90A 2K2VA 5GAN7 4KT0E 3VV0A 5CO7A 5FRMA 4M7AC 2XI9A 3A7UA 3X25B 1V29B 3JCMW 4HT9A 3ICAA 2L5QA 4YRKA 3A7AA 2H3JA 3GIBA 1O75A 2QDYB 4J15A 2ZIMA 5LJ3d 3F70A 3X20B 2EIFA 3A5YA 4M78C 2C8MA 2ZCFB 2ZPGB 3SWNB 2XGTA 2XK0A 3P8DA 1USYA 4YRJA 5CKEA 3HXWA 5IAYA 1H4TA 1YJWA 3LSQA 4P71C 2A8EA 2ODRD 4BWAA 1K73U 2K3XA 4H2VA 1UEBA 3PTAA 3CCMT 2QA4T 1QW1A 2KAFA 1EOVA 3X24B 4HCBA 5CK9A 3QO8A 5K1PA 2CKKA 2WSFE 4NCXA 3S3OA 5GAOp 4DPGA 3CBMA 4P5NA 4TWAA 2VV5A 3VYHB 4P74C 3KFUA 3LGLA 2V8KA 3OYNA 5IT9E 1B8AA 5A0LA 1P92A 3MCAB 3P8HA 3J81E 4BD3A 1G3TA 2ZZGA 5FU6C 3OS1A 2CJ9A 4M78F 3PMTA 4M7AA 3HY0A 4HKEA 4PJOD 4R56A 1LYLA 2JNGA 3OW2S 2RHYA 3PIOA 3GPLA 4XEMA 2JUFA 4H2SA 1ADYA 2CJBA 1L0WA 2OAUA 2FYKA 1ZQ1A 2K5IA 4M77A 1K8AC 3ERRA 1G3WA 3FB9A 2VGMA 4C8QF 3QO5A 2O4XB 1B70A 3J7AF 4NS5A 4M7DF 3A8LB 4P3OA 5K1XA 3A8MB 2G4CA 2GF7A 4Y28E 4C92E 1Q7YU 3V7RA 4EDUA 2E5QA 4M75B 4C0FA 4ELYC 3QKJA 4EX5A 2K5FA 1BI2A 5GAMh 3FRNA 1VQ4T 4YRNA 3V7CA 4XTXA 4DOVA 4CI0C 4H2YA 4M7AE 2DPPB 2VGNA 4M77G 1R8OB 4BDZA 3RERA 2Y4YA 1WQ7A 1Q82U 1HTTA 3OYEA 2O4XA 5D6WA 5CIUA 2LVMA 5L8RE 4M77B 4E7JA 1NYQA 4XQ3A 3RESA 3C95A 4PJOF 4E7IA 1M90C 3SWNA 1QE0A 2DTIA 2E65A 4QQGA 3M5AA 4FIBA 2JN0A 3JB9J 3AHUA 2QI2A 3JB9D 2DIQA 4TQDA 4OGEA 3G6EA 4JRKA 2DD4A 3OYYA 4YRFA 1W4SA 2QQBA 1M1KC 4XTVA 5GAN2 4EMHA 4ZGDB 4C92F 3PNWC 1M90U 2K5LA 2MF2A 3HFNA 3L4GB 4X5OA 4LDXA 1LNXA 4YCUA 4TVAB 11ASA 5E3IA 4LD9K 1OYXA 1XOVA 2ZPEB 3JSCA 5AYFA 4GLKA 4TVYA 4AH6A 2ZZDA 1WLEA 2RI3A 1K9MC 4CH3A 3DLLA 3KBGA 4OGCA 5CR2A 1J5WA 2LCLA 4BACA 4HT8A 3UWNA 3OYIA 2P0QA 5GMKi 3JAME 2CZ6B 2CJAA 4KR3A 4OB3B 4H2XA 4A4GA 3OS2A 2KQWA 1WQWA 2QQ9A 2RK2A 4C92D 2DXUA 2CIMA 4DOWA 3QZ9B 3SDZA 1BIAA 3MEVA 3JCMV 1JJ2S 2M9UA 3UH0A 3JB9F 2XHCA 3NENA 3KUFA 4CRIA 2DVEA 3ZFJA 1ASZA 2XIDA 4FSXA 4TVRA 4RCCA 3P8TA 1YITT 5GMKj 5CCAA 2YLCA 4M78D 1NJ8A 4N4HA 2DEQA 1YI2A 4YRTA 3PCOA 4DA4A 5GANj 3LWHA 4BDYA 3QZ5B 1Z7MA 2CZ1B 2XU8A 3O8VA 1M4ZA 3QIIA 3JCMg 2JTMA 2FL7A 1WJSA 3PGGA 2ZIOA 4H2UA 3VJPA 3OYBA 1QVPA 1H4VB 3WXMB 4M7DD 3OBYA 3R07A 3OA6A 4II1A 3HXZA 2P0PA 4K86A 3CCMA 2D9TA 5LJ3e 2OTLT 2EL9A 4MDWA 2DKGA 3FLGA 4A53A 3QG1A 5C6SA 3CCVT 2PVDB 4A4KA 4B9XA 4CS2A 3LH0A 4NL2A 1NNHA 4H2TA 4OVAA 3CPFA 1M1GA 3A8GB 1SRYA 2DZ9A 4C5IA 3QYGB 4RG2A 1YHQT 3CD6T 1H4QA 2L8DA 1LOJA 3GNFB 5GANe 2KY9A 2E70A 1MGQA 4K88A 1X56A 3HL8A 3VUZA 3FC3A 3DB3A 1OZ3A 4X9DA 4QQDA 2ZPBB 1W66A 1H4SA 5GAMf 4BI8B 2ALYB 4E51A 5GAOq 3L2RA 2VUBA 2DIGA 3OYAA 4V2SA 4J8OA 5GAN4 1KD1U 5I21A 4WJ4A 3A31A 3OYFA 3M4YA 1KC8U 4H2XB 3MF1A 3OYDA 4ZTZB 3A74A 3I56A 5I2MA 2LCCA 3E1SA 1X55A 1X6OA 4WF2A 3CBOA 1ATIA 4EPCA 2QQSA 3G7ZA 5HKCA 3MP6A 4MZTA 3CC2A 2Q7HA 2M1HA 4TVWA 3CCJT 1UGPB 2ZZFA 3CMET 3HRIA 4TVAA 4YRCA 3J80E 2FVUA 4XEOA 4KR2A 4QQ6A 3RKWA 1X54A 4L6V5 1VQ5A 5GMKh 1BI3A 1G3SA 4PLLA 5FRNA 3JCMd 5CVIA 3CC7T 2RO0A 3QO7A 4E7KA 12ASA 4XTYA 2BUDA 4QVCA 3CPWS 1YB3A 2X4JA 2ZPFB 4EMKA 3JRZA 3OSSC 4XK8E 4HWRA 4IUPA 4E47A 2K57A 2RHSB 1PYSB 5LJ5g 4G84A 4C92B 3HRKA 4RKUE 3QJYA 4BE2A 3CCQT 4M75E 3PZCA 3MEWA 4BE1A 1EIYA 5J26A 3M4PA 5CKFA 3L42A 2RHIA 1RI0A 1BKBA 3TCJA 3CCLA 2MWOA 3LX7A 4HWOA 3PCOB 4RG8A 3CC7A 4M75A 1GXIE 1YJ9A 1N8RC 1JJ2A 1WGSA 2RH2A 5HGQA 3JCMQ 2DO3A 1JB0E 3JB9I 4OF1A 4JRPA 3CCST 3E9HA 2LNVA 4M77F 5FU7C 1YI2T 1NJIC 3BFMA 4MMKA 4C5EA 4H02A 4HA8A 3G4SA 1XTDA 3OYCA 1KOGA 4OB0B 2FB7A 5LJ5d 2E5AA 3G1ZA 1VQZA 1BIBA 3H6ZA 2OTJT 3L2VA 1VQ5T 2F5TX 4E7HA 1Y71A 1E1OA 5GAN5 4BW9A 4C5GA 3JCMJ 4JLGA 2RI5A 3CD6A 1YJ9T 4C0ZA 2HD0A 2VXFA 4N0AC 1D3BA 1SSFA 3TEGA 4EMKC 3DB4A 1U1SA 2X35A 3A7RA 2AHJB 3P8BB 3UPUA 1GGMA 4Q6GA 4PJOB 1RIQA 2M16A 1VQ4A 3X28B 4HCZA 2AKWA 2JTFA 2QTXA 4RMOA 3HRTA 4M7DG 2WACA 5GAMj 2KMTA 3GF5A 2LTOA 4O5VA 2Q5HA 4JRIA 4YTLA 4UP9A 2XDBA 2I4MA 4M7DB 4OB2B 2ZT7A 2R58A 4O2DA 3M59A 4KUIA 1G5HA 3OYGA 1UGQB 1Q86C 5D6YA 2Q7EA 1E22A 1YBYA 2ARSA 5KE3A 4IUQA 4X34A 4NOYA 4M78E 2M0OA 3M58A 4HT4A 4C8QE 2EQJA 1YIJA 4HVCA 1WNLA 1KD1C 4G85A 2QHUA 3QTCA 4ZTUB 1O9SA 1KMNA 5KH6A 1VIEA 1VQ7T 3T9NA 1PSFA 4PJOA 3VQWA 3LWIA 5C52B 1YJNT 1NE8A 1BBWA 3OW2A 1G5VA 1Q81C 3SFMA 5GAOl 4YRMA 2JOYA 3WVEB 1VQNA 2LQKA 1B70B 4YREA 3OYJA 2CS7A 4FT4A 3QHSA 4PL6A 3REXA 2XTIA 4X9CA 5A2QE 4P75A 2NLUA 2KSSA 5DLQE 3CBPA 2EJGA 3JB9H 2QEXA 5LJ5j 4KBMB 2EYQA 2LT1A 3G71T 4ZN1A 2EAYA 1HK9A 2MI6A 3CXCS 4C8QC 4C0DB 1BI1A 4P3PA 4N4IA 3LSSA 4YRIA 4M7AB 1KG1A 1QP3A 5GAN3 2L89A 4UP8A 3C4SA 2EFIA 2XKOC 2HNIA 2OTLA 4RQEA 3X26B 1OI1A 3ZEHA 2RI2A 4HWTA 4RQFA 4F7UF 5GAMe 2LRQA 3JB9G 1N8RU 2F5KA 4ZTFA 3G71A 3S6WA 5GAN8 4ZN3A 3LLRA 1X01A 3OS5A 4P72A 1QVGS 1NJIU 3CMAT 4CS3A 5LJ5h 4C92C 5HK3A 4M7AG 4ZIBA 2KDSA 3TREA 1B7YA 2DTHA 5C0MA 3OYKA 3OS0A 2PVGB 3UFGA 4J6XA 1EQRA 4N0AA 3QBYA 3S3MA 4M7DA 1SESA 2ZR2A 2RHZA 1OZ2A 3RL6A 4C0GA 5GAOm 4BY6B 1EVLA 1NPPA 5FU6B 3OY9A 3IALA 1H3ZA 2FHDA 3A5ZB 4LDVA 5KCOA 1BI0A 3N5BB 2DAQA 1IREB 1B76A 5FU7B 1B34B 3QXEB 1C0AA 3CMQA 4KUDK 2BKDN 1E24A 3MEYA 4KQEA 2IY5A 3CCET 4OLFA 1KQSS 1VQLA 3HFOA 1D3BB 3CEYA 1RL2A 1VQKT 2QHSA 3W3SA 4FU6A 2JZ2A 3VUBA 2V8JA 3GNGA 1JBMA 3CCUA 2JVVA 3CMEA 5IN1A 2QHVA 1WU7A 4HWPA 1KQ1A 4LNSA 4OMFB 2A7YA 2D0QB 2J3MA 3NTHA 4A4EA 1Y96A 4M75D 5C53B 4YRRA 3QDRB 3RACA 1YFSA 3BJUA 3VYGA 3UDCA 1VQKA 1ZBXA 2ZNIA 4WI1A 5GMKe 3G6ET 2MMPA 1EIFA 3CCSA 4M77C 1WJQA 1BYMA 3MF2A 1UGSB 3CCUT 3CCQA 2F69A 4C8QG 2ZZEA 1M1KU 1VQ6T 4BI3A 4P3NA 3V8LA 4C92A 3ME9A 3DKMA 5CAIA 3HSBA 1JRIA 5D6XA 3IG2A 5GANg 2EJ9A 2HQEA 4K87A 3FJPA 4J5YA 3GLXA 1VQMT 2GCXA 1IL2A 2CZ0B 2R5MA 3IKLA 2RHQB 4P74A 4DQ2A 2RA2A 3TEHA 3TU4K 2WSEE 1EFWA 1YIJT 3RMSA 5DM7R 2QEXT 3IKMB 2P5IA 4XU3A 2ZT8A 3E19A 2R5AA 1VQ7A 4XTWA 1UB4A 1X2HA 4JDSA 2RD1A 4ZGJB 2YRVA 5CKDA 2J3LA 3MO8A 1G51A 5LJ5f 2LQ8A 1FYFA 4M7DE 1VQ8T 3HHTB 4CH5A 2P4TA 3WVDB 3A32A 3OYHA 4LDWA 4ATOA 5FROA 1VQ9A 2LDMA 1JJCB 2XG8D 3JCMh 1FWZA 3E9IA 4KULA 2D6FA 4L59A 3QJ6A 3M9QA 3VQXA 4P75C 4QW2A 5GMKl 4QVZA 1PSEA 2PQWA 3EFSA 2EQMA 1NJ1A 3JCMe 4YROA 4YCVA 3VU3C 4YYEA 2L3RA 4CS4A 2ODRC 2EKOA 5GANh 3JCMX 3FIFA 2ALYA 3M54A 4XTUA 4GY5A 3HPWA 1HXDA 1N6AA 4FM4B 4VUBA 3HFZA 1Q7YC 1QVGA 2C06A 3P8VA 5LJ5e 2DDZA 5DY9A 3HRSA 4L5GA 4RDXA 4A4HA 4P71A 1VQPA 2ZPIB 1G3YA 2PMFA 1USYC 3PIPA 3QUIA 2AMCB 2E64A 2DXTA 1K8AU 4J7FA 4TQFA 2HAXA 3OB9A 1TH7A 3NETA 3A5ZA 5CQXA 4EMGA 1Z7NA 4N4GA 5HY6A 2ZPHB 5C51B 5GAMd 3L4GA 3QYHB 5GANd 1VQ8A 3V8KA 2CZ7B 2PMEA 3A8OB 1E1TA 1VQMA 3HXUA 2P0LA 4BY6C 1EVKA 3MHXA 2RJCA 2C7IA 1SETA 2X4WA 1VQPT 3DSQA 3HFVA 2DXCA 1NZ9A 4YRPA 3QNEA 2PUOB 1B7YB 2DD5A 4IUVA 2ZR3A 2QQAA 4C92G 3V7SA 2R57A 4MZPA 1M5Q1 1ZHIA 3ER0A 4HWSA 4R55A 4J7IA 3CXCA 2ARUA 4LVKA 4F7UB 2K3YA 4LDYA 1YJWT 1KMMA 4Q15A 2VXEA 4TTVA 2RHXA 1I5LA 3LW5E 4XU2A 4A54A 3REUA 1S72T 5ELOA 1KHIA 4C0DC 4YDQA 4E7LA 4MMLA 5J3BA 4PNOA 4ELZC 3CCJA 4ZGEB 2DK3A 3NTIA 2XDDA 3UGTA 3RGLA 3PT9A 1U8RA 5GMKm 3P8YA 1QVFS 2IG0A 2E10A 4J83A 3RMQA 4PJOC 2NS6A 4XU1A 1I4K1 3DLMA 3VQYA 3I55T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UFG A;  4X9D A;  4J6X A;  2I4N A;  3EFR A;  1W66 A;  1H4S A;  4C8Q A;  1LJO A;  5GAM f;  1EQR A;  1HC7 A;  3JCM c;  2RB6 A;  2Y90 A;  2RM4 A;  5GAN 7;  4N0A A;  2ALY B;  4M78 B;  5GAO q;  4E51 A;  4XTZ A;  3SWN C;  4M7D A;  4M7A C;  4JUV A;  3A7U A;  1SES A;  2ZR2 A;  1N9S A;  3JCM b;  3JCM W;  4HT9 A;  5GAO n;  3ICA A;  4V2S A;  4M78 A;  3RL6 A;  3HXY A;  5GAN 4;  5I21 A;  4YRK A;  5GAO m;  3A7A A;  4WJ4 A;  3A31 A;  1I81 A;  4J6W A;  1EVL A;  4CH4 A;  3GIB A;  3IAL A;  4J15 A;  2VC8 A;  2ZIM A;  4H2X B;  1BBU A;  3MF1 A;  5LJ3 d;  3A5Y A;  4ZTZ B;  3SB2 A;  4M78 C;  1B76 A;  2C8M A;  3A74 A;  1KQ2 A;  1NJ6 A;  1B34 B;  3SWN B;  2XGT A;  3CMQ A;  1C0A A;  4M7A F;  1USY A;  4YRJ A;  4P72 C;  1X55 A;  3I7F A;  4WF2 A;  3HXW A;  1ATI A;  1E24 A;  1H4T A;  3LSQ A;  3MEY A;  4P71 C;  4KQE A;  4F7U G;  2IY5 A;  4OLF A;  2ODR D;  4BWA A;  3HFO A;  2Q7H A;  1D3B B;  5GAN f;  3RUX A;  4YRQ A;  5GAN 6;  2DQ3 A;  4H2V A;  2QHS A;  3BDU A;  4TVW A;  3W3S A;  4PJO E;  1X2G A;  3RIR A;  5LJ3 g;  1EOV A;  4M78 G;  1JBM A;  2ZZF A;  4UPA A;  3QO8 A;  3HRI A;  4YRG A;  5K1P A;  4TVA A;  4NCX A;  4YRC A;  2QHV A;  1WU7 A;  1H64 1;  5GAO p;  4DPG A;  3RKX A;  4XEO A;  4HWP A;  4KR2 A;  3RKW A;  2ZXF A;  1X54 A;  1KQ1 A;  4LNS A;  5GMK h;  4P73 A;  4TWA A;  4YPF A;  2EJF A;  2E41 A;  4P74 C;  3JCM d;  2J3M A;  3KFU A;  1Y96 A;  4F7U A;  4M75 D;  5C53 B;  4YRR A;  3RAC A;  1B8A A;  2DU5 A;  3QO7 A;  12AS A;  4XTY A;  1YFS A;  3BJU A;  4QVC A;  2AKW B;  3VBB A;  1YB3 A;  2ZZG A;  3HTZ A;  2ZNI A;  4Y91 A;  4WI1 A;  4EMK A;  5GMK e;  4HWR A;  4C8Q B;  1ADJ A;  2CJ9 A;  4JLI A;  4M78 F;  4M77 C;  1YCY A;  2K57 A;  3L2Z A;  4M7A A;  2RHS B;  1PYS B;  1WYD A;  5LJ5 g;  4G84 A;  3HY0 A;  4F7U E;  4PJO D;  1LYL A;  4XEM A;  3MF2 A;  4C92 B;  4H2S A;  1ADY A;  3HRK A;  2CJB A;  2RHS A;  3LC0 A;  4C8Q G;  1L0W A;  2FYK A;  4M75 E;  2ZZE A;  3PZC A;  4RMF A;  4EMK B;  4M77 A;  1EIY A;  3ERR A;  3FB9 A;  3M4P A;  4C8Q F;  3QO5 A;  4P3N A;  3V8L A;  4C92 A;  4YP0 A;  1B70 A;  4HWO A;  3PCO B;  5CAI A;  3HSB A;  1JRI A;  4M7D F;  3IG2 A;  4P3O A;  1WPY A;  5GAN g;  2EJ9 A;  5K1X A;  2QHT A;  4M75 A;  4K87 A;  3FJP A;  4J5Y A;  2G4C A;  4C92 E;  4C8Q D;  1IL2 A;  2DQ0 A;  4H2W A;  3IKL A;  3V7R A;  3JCM Q;  3RF1 A;  2RHQ B;  5HGQ A;  1N9R A;  5ELN A;  4P74 A;  4DQ2 A;  2RA2 A;  4M75 B;  1M8V A;  4PHC A;  2YLB A;  3JB9 I;  4EX5 A;  4P73 C;  3TEH A;  3E9H A;  2ZTG A;  3VQV A;  5GAM h;  4M77 F;  4PJO G;  4M7D C;  1EFW A;  2AMC A;  4YRN A;  3BFM A;  2Q5I A;  4MMK A;  3IKM B;  3V7C A;  3RKY A;  4XTX A;  2ZT6 A;  2P5I A;  4H02 A;  4HA8 A;  4XU0 A;  4H2Y A;  4UP7 A;  4M7A E;  4M77 G;  1KOG A;  3RER A;  4XU3 A;  1G5I A;  2ZT8 A;  1WQ7 A;  2FB7 A;  5LJ5 d;  2E5A A;  3G1Z A;  4M75 F;  4XTW A;  2DTO A;  1HTT A;  1VQZ A;  1BIB A;  1X2H A;  4QVD A;  2RD1 A;  2J3L A;  3HFZ B;  1G51 A;  4M77 B;  5LJ5 f;  1NYQ A;  1EIY B;  1E1O A;  5GAN 5;  1QF6 A;  4BW9 A;  4XQ3 A;  3RES A;  1FYF A;  3JCM J;  1NJ2 A;  4M7D E;  4PJO F;  1YFT A;  4CH5 A;  3SWN A;  1QE0 A;  2DTI A;  2E65 A;  3QO3 A;  2DJZ A;  2VXF A;  3A32 A;  2ZGW A;  2ZT5 A;  4N0A C;  1D3B A;  2JN0 A;  3JB9 J;  3AHU A;  3JB9 D;  1PYS A;  4M7A D;  4TQD A;  3TEG A;  4EMK C;  1U1S A;  1JJC B;  4JRK A;  2E3C A;  3A7R A;  4YRF A;  3JCM h;  3E9I A;  3INZ A;  4XTV A;  5GAN 2;  5GAO r;  4EMH A;  4M77 E;  1GGM A;  4YRS A;  4Q6G A;  4RCB A;  4PJO B;  1RIQ A;  2AKW A;  3VQX A;  4P75 C;  3QSU A;  4C92 F;  2QTX A;  5GMK l;  2ART A;  3BW1 A;  2EWN A;  3HFN A;  3L4G B;  4M7D G;  4X5O A;  1LNX A;  4YCU A;  3WQZ A;  3EFS A;  3L1A A;  4TVA B;  3OD1 A;  5GAM j;  5E3I A;  11AS A;  3TUP A;  1NJ1 A;  3M4G A;  3JCM e;  2Q5H A;  4OP0 A;  4JRI A;  2ZCE A;  4YCV A;  3VU3 C;  4YRO A;  4YYE A;  4CS4 A;  4UP9 A;  4TVY A;  4AH6 A;  1WLE A;  2I4M A;  2ODR C;  4M7D B;  2ZT7 A;  4CH3 A;  5GAN h;  3JCM X;  3FIF A;  4O2D A;  2ALY A;  1G5H A;  4XTU A;  1J5W A;  1HXD A;  1JJC A;  3HFZ A;  4HT8 A;  2Q7E A;  1E22 A;  2ARS A;  3P8V A;  5GMK i;  1B34 A;  4NOY A;  5LJ5 e;  2CJA A;  4M78 E;  2DDZ A;  5DY9 A;  4M75 G;  5GAM g;  4RDX A;  4P71 A;  3HXX A;  4KR3 A;  4C8Q E;  4HVC A;  1WNL A;  4G85 A;  4H2X A;  5LJ3 h;  2QHU A;  2E1H A;  3QTC A;  4ZTU B;  2PMF A;  4L87 A;  1USY C;  1WQW A;  2DU7 A;  4C92 D;  3QUI A;  2AMC B;  2ZIN A;  1KMN A;  2DXU A;  1NJ5 A;  2CIM A;  2I4L A;  1NYR A;  2E64 A;  2DXT A;  1BIA A;  4TQF A;  4M75 C;  3JCM V;  2Q7G A;  4PJO A;  1TH7 A;  3VQW A;  5F5W A;  3NET A;  2CGH A;  3A5Z A;  5C52 B;  3UH0 A;  1U1T A;  1BBW A;  4EMG A;  3JB9 F;  1Z7N A;  3NEN A;  5C51 B;  5GAM d;  3L4G A;  2DVE A;  1ASZ A;  5GAN d;  3BY7 A;  1YGB A;  5GAO l;  3TEH B;  4YRM A;  3V8K A;  2PME A;  4WJ3 M;  5LJ3 j;  4RCC A;  1E1T A;  1B70 B;  3P8T A;  3HXU A;  2P0L A;  1EVK A;  2RHQ A;  4YRE A;  3NEM A;  5GMK j;  3QHS A;  3REX A;  2C7I A;  2XTI A;  1SET A;  4X9C A;  2YLC A;  3DSQ A;  3HFV A;  4P75 A;  4M78 D;  1NJ8 A;  4PG3 A;  4CH6 A;  4YRP A;  2DEQ A;  2EJG A;  3QNE A;  2YHT A;  1N9W A;  3JB9 H;  5LJ3 f;  4YRT A;  3PCO A;  1B7Y B;  5LJ5 j;  3UGQ A;  5GAN j;  1SER A;  3JCM f;  4YCW A;  2EAY A;  4M77 D;  1Z7M A;  1HK9 A;  2ZR3 A;  4C92 G;  3V7S A;  1M5Q 1;  2DZC A;  4C8Q C;  3JCM g;  4P3P A;  4HWS A;  3LSS A;  4YRI A;  2ARU A;  3PGG A;  4M7A B;  2ZIO A;  4H2U A;  1YFR A;  1Y96 B;  4F7U B;  4NL3 A;  5GAN 3;  1H4V B;  1KMM A;  4Q15 A;  4UP8 A;  4YRL A;  4M7D D;  2VXE A;  4TTV A;  3HXV A;  3R07 A;  1I5L A;  4XU2 A;  4A54 A;  3REU A;  2HNI A;  3HXZ A;  4K86 A;  4RQE A;  5LJ3 e;  2EL9 A;  5ELO A;  4YDQ A;  3NEL A;  2DKG A;  4A53 A;  4MML A;  4PNO A;  4HWT A;  4RQF A;  4F7U F;  5GAM e;  2ZNJ A;  4EO4 A;  3JB9 G;  4CS2 A;  4J6Y A;  3V8J A;  5GAN 8;  3UGT A;  3RGL A;  4NL2 A;  1I8F A;  1NNH A;  4H2T A;  5GMK m;  1ASY A;  1X01 A;  3P8Y A;  1SRY A;  2DZ9 A;  4P72 A;  2IY5 B;  3HY1 A;  2E10 A;  4PJO C;  4CS3 A;  2I4O A;  5KNN A;  1H4Q A;  4XU1 A;  1I4K 1;  5LJ5 h;  4C92 C;  4ZIB A;  4M7A G;  1LOJ A;  3VQY A;  5GAN e;  1B7Y A;  3JCM P;  1MGQ A;  4K88 A;  1X56 A;  2DTH A;  3M4Q A;  2I2L A; 
#chains in the Genus database with same CATH topology
 2EQU A;  1YJN Q;  2NUT B;  1D0X A;  3EFR A;  2EGE A;  4LVL A;  1Y7X A;  4IUU A;  2QXF A;  3JCM c;  2RB6 A;  2RM4 A;  1GRI A;  4M78 B;  2HCK A;  4C5H A;  4XTZ A;  3SWN C;  2DET A;  4JUV A;  5A0D A;  3VKI A;  4O6J A;  4IUR A;  4Z02 A;  1N9S A;  3JCM b;  4OB1 B;  1JXM A;  1ZLM A;  5GAO n;  4M78 A;  3EAE A;  1R0C B;  3HXY A;  2RJD A;  2HMA A;  1I81 A;  4J6W A;  4CH4 A;  2LJ0 A;  1KC8 R;  2VC8 A;  3PFS A;  3OYM A;  2MAM A;  2CT3 A;  1BBU A;  3CC4 A;  2COW A;  1M1F A;  2ABL A;  3SB2 A;  4B9W A;  1KQ2 A;  1NJ6 A;  1XQH A;  2RJE A;  4CC4 B;  4M7A F;  2DRK A;  1TWB A;  2CYZ B;  2YT6 A;  4P72 C;  5J39 A;  3I7F A;  1VYU A;  2DL5 A;  1VIF A;  2RJF A;  2PU9 B;  5KYX B;  3I55 A;  1NJI R;  3FEO A;  2HSP A;  4F7U G;  2JMA A;  5LL6 S;  1RUW A;  2PVO B;  1PRL C;  5GAN f;  3RUX A;  5M9O A;  4YRQ A;  5GAN 6;  1ZUY A;  3BDU A;  1VQO A;  4X1V A;  3FDR A;  4LD6 A;  1D1A A;  1KHC A;  2M0Y A;  4CC7 A;  4PJO E;  1X2G A;  3RIR A;  5LJ3 g;  4M78 G;  2DMO A;  1QP2 A;  3PVL A;  3QPH A;  1MMA A;  4XAX B;  4UPA A;  3CCV A;  4PJL A;  2MWP A;  4YRG A;  2JXB A;  1XNI A;  2FO0 A;  3SD4 A;  3M55 A;  1H64 1;  1YJ9 Q;  1FMK A;  2V1Q A;  3RKX A;  4HCC A;  2HL3 A;  4DBQ A;  2ZXF A;  2FPD A;  2V8I A;  4PLI A;  2VB6 A;  4P73 A;  1WZO A;  5FW9 A;  2DRM A;  4YPF A;  3NTK A;  2EJF A;  2E41 A;  1SPK A;  3CPW P;  3M56 A;  4OML A;  1VQN Q;  1IB8 A;  1NPR A;  3PMI A;  2A3L A;  4F7U A;  3I56 T;  1VQL Q;  1YHQ A;  3OBW A;  3M0S A;  2DU5 A;  2AKW B;  3C94 A;  3VBB A;  3UT1 A;  2AKL A;  1D09 B;  1Q86 U;  4F17 A;  3HTZ A;  2EYX A;  4Y91 A;  3GOX A;  1DJ7 B;  2QEX Q;  4C8Q B;  1ADJ A;  2KXD A;  4JLI A;  1YCY A;  2J6O A;  3L2Z A;  1WYD A;  1PWT A;  1ZSZ C;  2HBP A;  2E5K A;  4Q5W A;  4F7U E;  2PUK B;  3QDF A;  1Y0M A;  4FCY A;  1KC8 C;  2F2W A;  1X6G A;  1RI9 A;  2RHS A;  3LC0 A;  1K9M U;  1MHN A;  1KFZ A;  4RMF A;  4EMK B;  1RAF B;  1QCF A;  3GP8 A;  2DEU A;  1X75 C;  3MEA A;  2QQR A;  2K2M A;  2DL8 A;  2COY A;  4YP0 A;  2OTJ A;  5I22 A;  2HQH A;  2XD0 A;  1ZA2 B;  2CSQ A;  1WPY A;  2KBT A;  1K0S A;  2QHT A;  2LC4 A;  1QKW A;  1VQN T;  2DE0 X;  2KK4 A;  4C8Q D;  2DQ0 A;  4H2W A;  4MDX A;  3RF1 A;  2BIV A;  1N9R A;  5ELN A;  3REA B;  1FYN A;  1M8V A;  3MQZ A;  4PHC A;  1M30 A;  2YLB A;  4LUE A;  4P73 C;  2LNH B;  3HKS A;  1QQJ A;  2X4Y A;  1B3Q A;  2ZTG A;  3VQV A;  2FZK B;  4PJO G;  4M7D C;  2AMC A;  1UDL A;  2Q5I A;  2DNU A;  3RKY A;  2ZT6 A;  3GBQ A;  1PD1 A;  4UP7 A;  4XU0 A;  1Y07 A;  4FL6 A;  4BI4 A;  1G5I A;  1FMW A;  3H8Z A;  4M75 F;  2RK1 A;  2DTO A;  5D7U A;  3KXT A;  3M57 A;  4LVM A;  4QVD A;  3OYL A;  4LDU A;  3CXC P;  2VVK A;  4ZTJ A;  3HFZ B;  1EIY B;  1TU0 B;  4PKC C;  1VQO Q;  4BUG A;  4GBQ A;  1QF6 A;  3M53 A;  3EGU A;  2XDP A;  2VYT A;  2YRD A;  1NJ2 A;  1YFT A;  5KYW B;  2E12 A;  2X4X A;  2CP3 A;  3QO3 A;  2DJZ A;  2ZGW A;  2ZT5 A;  2Y4X A;  4M7A D;  1PYS A;  1YIT A;  1NG2 A;  3OSV A;  3KFV A;  3Q1J A;  3CC2 T;  2E3C A;  5CKH A;  2QA4 A;  5FWC A;  1M9S A;  2DBK A;  3INZ A;  1WHH A;  1W6X A;  5GAO r;  4M77 E;  2G3R A;  2J7I A;  4YRS A;  4RCB A;  1JO8 A;  3QSU A;  3EG2 A;  2ART A;  3BW1 A;  2K4Y A;  4HVV A;  2IVW A;  2EWN A;  4LVJ A;  1KQS A;  1KD1 R;  3WQZ A;  3TUP A;  3L1A A;  3OD1 A;  3URG A;  1OOT A;  3BDL A;  3M4G A;  4DEY A;  3HP9 A;  1AZG B;  4J9F A;  2KNB B;  4OP0 A;  3CC4 T;  2ZCE A;  2GQV A;  2A37 A;  4E6R A;  2K6D A;  2SRC A;  1OU9 A;  1K8A R;  3H0I A;  2RF0 A;  2BZ8 A;  4DBR A;  1JJC A;  1VUB A;  2E6N A;  2DXB A;  1VQL T;  1QVF A;  1K9A A;  1N27 A;  2ESW A;  3CCE A;  2MYS A;  1B34 A;  4WCI A;  2ZAE A;  4M75 G;  5GAM g;  3HXX A;  2K7A A;  1CKA A;  5LJ3 h;  2E1H A;  2LJ1 A;  4L87 A;  1TG0 A;  1VOM A;  2L0A A;  3CCR T;  2DU7 A;  1UGR B;  3CCR A;  2ZIN A;  5CQY A;  1FXX A;  1NJ5 A;  2I4L A;  2PNI A;  3EG9 B;  1IZ6 A;  1NYR A;  5EG2 A;  1Q82 C;  1ZA1 B;  1Q82 R;  2GFA A;  3VRZ A;  4M75 C;  2Q7G A;  4HVW A;  5F5W A;  4JS5 A;  2A36 A;  2CGH A;  4PFO A;  3R6O A;  4ME7 A;  4MZM A;  3REB B;  4AFS C;  3CCQ Q;  1U1T A;  2JJ9 A;  3OMC A;  2KVQ G;  2B8A A;  2QDL A;  2RHU A;  1GBR A;  1C0M A;  1K73 C;  4E7Z A;  5I2S A;  3O5Z A;  2WSC E;  5IXB A;  4IKF A;  2QK0 A;  3BY7 A;  2CH4 W;  3S3N A;  1YGB A;  3TEH B;  1RAC B;  1MND A;  4WJ3 M;  5LJ3 j;  3VS5 A;  4UC4 A;  4JJN K;  2O01 E;  4D6W A;  2RHQ A;  3NFC A;  3NEM A;  1VQO T;  3TSW A;  5FLX E;  1Y57 A;  3E2U A;  1S72 A;  3MEU A;  1W2B S;  4J9C A;  4BE0 A;  4CH6 A;  4PG3 A;  3A98 A;  2YHT A;  1X69 A;  1N9W A;  5LJ3 f;  3G4S T;  3C12 A;  3UGQ A;  4BB7 A;  4Z89 A;  1MMD A;  1SER A;  3JCM f;  1VQ6 A;  2HQX A;  2EQK A;  4YCW A;  4M77 D;  1PRM C;  1M8M A;  3D7S B;  3CPW A;  1FX7 A;  3OQ5 A;  2DZC A;  5HCK A;  3CMA A;  3L2W A;  4AMC A;  1YJN A;  1T3S A;  1AWW A;  4LN2 A;  4PFZ A;  1YP5 A;  4HVU A;  2IIM A;  1Y96 B;  1YFR A;  1OPL A;  1R0B G;  3LYI A;  4NL3 A;  5HK0 A;  4YRL A;  2RQW A;  3UF4 A;  3HXV A;  4QT7 A;  4JPB W;  2DIL A;  2FRY A;  5KCH A;  3NEL A;  1C1A A;  1ZUU A;  2OJ2 A;  4LVI A;  1A0N B;  1W2B A;  2P0K A;  3EG0 A;  3BE3 A;  4KH0 B;  2KRO A;  2XIC A;  5A0G A;  4OMQ A;  3MET A;  2ZNJ A;  1AHJ B;  4EO4 A;  4IUT A;  1WJR A;  2LX9 A;  3ASK A;  2BZY A;  1PC0 A;  3HRU A;  4J6Y A;  2CH4 A;  3V8J A;  1UE9 A;  2CRE A;  1PHT A;  1I8F A;  1Q81 U;  1ASY A;  3A8H B;  3MP1 A;  3CCL T;  5CKB A;  1YI2 Q;  4A4F A;  5DLO A;  3E9F A;  1RAI B;  3EGD B;  2IY5 B;  1QLY A;  3HY1 A;  2HKN A;  2E6Z A;  3VRY A;  3OMG A;  3MP8 A;  5KE2 A;  2LT4 A;  2I4O A;  5KNN A;  3E9G A;  4JRQ A;  2GFU A;  2AZS A;  3QWX X;  1T3L A;  1UG1 A;  4FT2 A;  3JCM P;  2JM8 A;  3L2Q A;  1QCN A;  3ZBD A;  3M4Q A;  2I2L A;  2DQ3 A;  1VQ9 T;  4JZ3 A;  4JS4 A;  1W1F A;  3LGF A;  3TEE A;  2I4N A;  4C8Q A;  2F1L A;  1LJO A;  3L2U A;  1HC7 A;  2Y90 A;  2FPF A;  2K2V A;  5GAN 7;  4KT0 E;  3VV0 A;  5CO7 A;  1PNJ A;  2K9G A;  5FRM A;  4M7A C;  2XI9 A;  3A7U A;  1MV0 B;  1M90 R;  3X25 B;  2F2V A;  1V29 B;  2D0N A;  3H0H A;  3JCM W;  4HT9 A;  3ICA A;  2L5Q A;  1WX6 A;  1RAE B;  5GJV B;  4YRK A;  3A7A A;  4LXC A;  1VYV A;  2H3J A;  3GIB A;  2J05 A;  1Z9Q A;  1O75 A;  2QDY B;  4J15 A;  2ZIM A;  3PE0 A;  5LJ3 d;  3F70 A;  3X20 B;  2EIF A;  1NEB A;  2CDT A;  3A5Y A;  4RTV A;  4M78 C;  2C8M A;  2ZCF B;  2ZPG B;  3CQT A;  3SWN B;  4AFQ C;  2XK0 A;  2XGT A;  3P8D A;  1USY A;  4YRJ A;  1NBE B;  3G71 Q;  5CKE A;  3HXW A;  5IAY A;  1WHL A;  1YJW A;  1H4T A;  3H0F A;  3LSQ A;  4P71 C;  2A8E A;  2ODR D;  4BWA A;  1K73 U;  1M2O A;  4AG2 C;  2K3X A;  3AT1 B;  2COZ A;  4H2V A;  1UEB A;  2L3P A;  3PTA A;  2YXY A;  3I55 Q;  3CCM T;  2QA4 T;  1QW1 A;  3CCU Q;  2KAF A;  1EOV A;  3X24 B;  4HCB A;  5CK9 A;  3QO8 A;  5K1P A;  2CKK A;  2WSF E;  4NCX A;  1IRX A;  3S3O A;  3CC4 Q;  4IIM A;  2DFU A;  5GAO p;  2RQU A;  4DPG A;  3CBM A;  4P5N A;  1X43 A;  1M2V A;  4FW1 A;  4KGZ B;  2FPE A;  1K0X A;  4TWA A;  2VV5 A;  3VYH B;  3SEM A;  4P74 C;  1VQM Q;  3KFU A;  2O88 A;  3LGL A;  2V8K A;  3OYN A;  5IT9 E;  1B8A A;  1ZSZ A;  1H8K A;  5A0L A;  1IO6 A;  1M3A A;  1P92 A;  3MCA B;  3P8H A;  2DL3 A;  3J81 E;  4BD3 A;  1G3T A;  2ZZG A;  5FU6 C;  1KIK A;  1UUE A;  4E2F B;  3OS1 A;  2CJ9 A;  3CD6 Q;  4M78 F;  2X3X D;  3PMT A;  4M7A A;  2P4R A;  3VS1 A;  4HKE A;  3HY0 A;  3I35 A;  2DYB A;  4R56 A;  4PJO D;  2KE9 A;  1LYL A;  2JNG A;  3OW2 S;  2RHY A;  3PIO A;  3GPL A;  4XEM A;  2JUF A;  4H2S A;  1ADY A;  2CJB A;  2X9H A;  1L0W A;  2OAU A;  2FYK A;  1ZQ1 A;  1U5S A;  2NUP A;  2K5I A;  4M77 A;  1K8A C;  3ERR A;  1G3W A;  3FB9 A;  3TQ7 P;  1OV3 A;  2K3B A;  2VGM A;  4C8Q F;  3QO5 A;  2O4X B;  1EFN A;  1GFD A;  1B70 A;  3J7A F;  2X3W D;  2DL4 A;  1ZSZ B;  4NS5 A;  4M7D F;  1TUD A;  3A8L B;  4P3O A;  5K1X A;  3A8M B;  4Z88 A;  2G4C A;  2GF7 A;  2LMJ A;  4Y28 E;  4C92 E;  4EIK A;  2CP7 A;  3HTR A;  1NM7 A;  1Q7Y U;  1IGQ A;  5IHK A;  3V7R A;  1Q7Y R;  4EDU A;  2LX7 A;  2E5Q A;  4M75 B;  4C0F A;  4ELY C;  1M2V B;  3QKJ A;  4EX5 A;  2K5F A;  1BI2 A;  5GAM h;  2LQN A;  3FRN A;  1VQ4 T;  4YRN A;  3M0R A;  2FZG B;  3V7C A;  4XTX A;  4DOV A;  4CI0 C;  2HEQ A;  4H2Y A;  4M7A E;  2DPP B;  2VGN A;  4M77 G;  1R8O B;  4BDZ A;  3RER A;  2Y4Y A;  1WQ7 A;  2EPD A;  1RLP C;  5L23 A;  1Q82 U;  1HTT A;  3OYE A;  2OTL Q;  1WHG A;  2MIO A;  2O4X A;  5D6W A;  5CIU A;  1UJ0 A;  2LVM A;  5L8R E;  1YCS B;  4M77 B;  1J3T A;  4E7J A;  1NYQ A;  4XQ3 A;  1TTH B;  3RES A;  3C95 A;  4PJO F;  4E7I A;  1M90 C;  3SWN A;  1QE0 A;  2DTI A;  4QKU A;  2E65 A;  4QQG A;  3M5A A;  4FIB A;  2JN0 A;  3JB9 J;  3CCL Q;  1NLP C;  2QI2 A;  3JB9 D;  3AHU A;  2DIQ A;  1IGU A;  1QVG P;  4TQD A;  2YSQ A;  4OGE A;  4F04 B;  3G6E A;  4JRK A;  1WHM A;  2DD4 A;  2O9S A;  3OYY A;  4B6M A;  4YRF A;  2LJ3 A;  1W4S A;  2QQB A;  1M1K C;  4XTV A;  3VS4 A;  5GAN 2;  4EMH A;  4ZGD B;  2DL7 A;  2LP5 A;  4C92 F;  2QA4 Q;  3PNW C;  4AG1 C;  1M90 U;  2K5L A;  2MF2 A;  2JMC A;  3HFN A;  3L4G B;  4X5O A;  4LDX A;  1LNX A;  4YCU A;  1BU1 A;  4TVA B;  11AS A;  5E3I A;  3G6E Q;  3TSZ A;  1OYX A;  1XOV A;  4LD9 K;  2ZPE B;  3JSC A;  1CKB A;  2W10 A;  1HSQ A;  1UJY A;  5AYF A;  4GLK A;  4TVY A;  4AH6 A;  2ZZD A;  1WLE A;  2YUN A;  2JTE A;  2RI3 A;  1K9M C;  4CH3 A;  3CCM Q;  3DLL A;  3KBG A;  1JXO A;  4KGX B;  4OGC A;  3CCV Q;  1LVK A;  5CR2 A;  1J5W A;  2LCL A;  4BAC A;  4HT8 A;  3UWN A;  1TUC A;  3OYI A;  2P0Q A;  5GMK i;  3JAM E;  2CZ6 B;  1MV3 A;  1SEM A;  2CJA A;  1G83 A;  4KR3 A;  1YFN A;  2LQW A;  4OB3 B;  1D0Y A;  4H2X A;  4Z8A A;  4A4G A;  3OS2 A;  2KQW A;  1WQW A;  2QQ9 A;  2RK2 A;  4C92 D;  2DXU A;  2CIM A;  4DOW A;  3CC7 Q;  3QZ9 B;  3SDZ A;  1SKU B;  1BIA A;  3MEV A;  3JCM V;  2AT1 B;  1JJ2 S;  2M9U A;  3UH0 A;  3JB9 F;  2RQV A;  4KRT A;  3VS3 A;  2XHC A;  3NEN A;  3KUF A;  1C6V X;  4CRI A;  3CCE Q;  2DVE A;  3ZFJ A;  1ASZ A;  1X27 A;  1IHW A;  1BCM A;  4FYY B;  2XID A;  4FSX A;  2FZC B;  4RCC A;  4TVR A;  3EHQ A;  3P8T A;  1YIT T;  2KRM A;  1V76 A;  5GMK j;  2DVJ A;  1JJ2 P;  5CCA A;  2DLP A;  2YLC A;  3I56 Q;  4OMP A;  4LE9 A;  1PD0 A;  4M78 D;  1NJ8 A;  4R0K A;  4N4H A;  2DEQ A;  1YI2 A;  3VS2 A;  4YRT A;  3PCO A;  2VWF A;  3ZL7 C;  4DA4 A;  1AD5 A;  1AT1 B;  5GAN j;  3LWH A;  1GCP A;  4J9G A;  4BDY A;  3QZ5 B;  3CC2 Q;  1Z7M A;  4RTT A;  2CZ1 B;  2XU8 A;  2KT1 A;  3VS0 A;  2J06 A;  3O8V A;  3R6N A;  1M4Z A;  1N5Z A;  3QII A;  3JCM g;  1AWJ A;  2BTT A;  2JTM A;  2FL7 A;  4HXJ A;  1WJS A;  3PGG A;  2HZY A;  2ZIO A;  4H2U A;  3VJP A;  5KYY A;  1UGV A;  3OYB A;  1QVP A;  4F16 A;  1H4V B;  3WXM B;  4M7D D;  3OBY A;  3R07 A;  3OA6 A;  1SG5 A;  1X2K A;  1OU8 A;  4II1 A;  3HXZ A;  2P0P A;  4K86 A;  3CCM A;  2D9T A;  5LJ3 e;  2OTL T;  1VYT A;  2BE7 D;  4MDW A;  2EL9 A;  2DKG A;  3FLG A;  4A53 A;  2Z0W A;  3QG1 A;  5C6S A;  1OX9 A;  3CCV T;  2PVD B;  1WHJ A;  4A4K A;  4B9X A;  2XMF A;  4CS2 A;  3LH0 A;  3G4S Q;  4NL2 A;  4FYW B;  1NNH A;  2QGG A;  4OVA A;  4H2T A;  1VA7 A;  3CPF A;  1M1G A;  1RAB B;  3A8G B;  1SRY A;  2DZ9 A;  4C5I A;  3QYG B;  1TUG B;  4RG2 A;  3M0T A;  1YHQ T;  3CD6 T;  1NLO C;  1H4Q A;  2L8D A;  1LOJ A;  3GNF B;  5GAN e;  4RTY A;  2KY9 A;  2E70 A;  1MGQ A;  4K88 A;  1X56 A;  4HCK A;  3HL8 A;  3VUZ A;  3FC3 A;  3DB3 A;  1OZ3 A;  4X9D A;  4QQD A;  2ZPB B;  1W66 A;  1H4S A;  2KGT A;  3EG1 A;  5GAM f;  4BI8 B;  2ALY B;  4E51 A;  5GAO q;  1WFW A;  3L2R A;  1Q81 R;  2VUB A;  3QWY A;  2DIG A;  2DER A;  2CSI A;  3OYA A;  4V2S A;  4J8O A;  5GAN 4;  1KD1 U;  5I21 A;  1Z9Z A;  1GL5 A;  4FW2 A;  4WJ4 A;  3A31 A;  3OYF A;  3M4Y A;  2VKN A;  5AT1 B;  1KC8 U;  4H2X B;  3MF1 A;  3OYD A;  4ZTZ B;  3A74 A;  3I9Q A;  1RAD B;  3I56 A;  2OX7 A;  5I2M A;  2LCC A;  5KYU B;  3SHW A;  3E1S A;  1X55 A;  3EGX A;  1X6O A;  4WF2 A;  3CBO A;  1KSW A;  1ATI A;  4EPC A;  2QQS A;  1W2B P;  4OMN A;  3G7Z A;  5HKC A;  3MP6 A;  4MZT A;  3FJ5 A;  3CC2 A;  2Q7H A;  1QVF P;  1GBQ A;  2M1H A;  1YIT Q;  4TVW A;  3PVQ A;  2GNC A;  3CCJ T;  1UGP B;  2ZZF A;  2GTJ A;  2NYS A;  1HD3 A;  4J9D A;  3CME T;  3HRI A;  4TVA A;  4YRC A;  1ZSG A;  3U23 A;  2AK5 A;  2EGA A;  3J80 E;  8AT1 B;  2FVU A;  4XEO A;  4KR2 A;  1I07 A;  4QQ6 A;  2O31 A;  1JQQ A;  3RKW A;  4RTW A;  4L6V 5;  1VQ5 A;  1X54 A;  5GMK h;  1BI3 A;  1G3S A;  3LH5 A;  4PLL A;  4AT1 B;  2HDA A;  5FRN A;  4JJB A;  3JCM d;  1M27 C;  2YWW A;  2LZ6 B;  5CVI A;  5KYY B;  4IIO A;  1PG5 B;  3CC7 T;  2CP2 A;  2RO0 A;  3QO7 A;  4E7K A;  12AS A;  3EFO A;  4XTY A;  2BUD A;  4QVC A;  3CPW S;  1YB3 A;  2OAW A;  2KEA A;  2FRW A;  1GFC A;  2X4J A;  2ZPF B;  4EMK A;  3JRZ A;  3OSS C;  4XK8 E;  4HWR A;  1OEB A;  4FYX B;  1OX8 A;  4IUP A;  4E47 A;  2K57 A;  2RHS B;  1MMN A;  1PYS B;  5LJ5 g;  4G84 A;  4C92 B;  1UHF A;  2V1R A;  1VQ9 Q;  3HRK A;  1JU5 C;  2DJQ A;  5KYW A;  4RKU E;  2O2O A;  2EW3 A;  3QJY A;  3CCQ T;  4BE2 A;  4M75 E;  3PZC A;  3MEW A;  4BE1 A;  3CME Q;  1EIY A;  1AEY A;  5J26 A;  3M4P A;  5CKF A;  3L42 A;  2RHI A;  1RI0 A;  1BKB A;  3TCJ A;  3CCL A;  2MWO A;  3LX7 A;  4HWO A;  3PCO B;  2EKH A;  2SEM A;  3H41 A;  4RG8 A;  3CC7 A;  4M75 A;  5GJW B;  1GXI E;  1YJ9 A;  1N8R C;  1JJ2 A;  1WGS A;  1BB9 A;  4FYV B;  2RH2 A;  2JM9 A;  5HGQ A;  3JCM Q;  2DO3 A;  1JB0 E;  1RAA B;  3JB9 I;  1ACM B;  4OF1 A;  4JRP A;  3CCS T;  3E9H A;  2LNV A;  4M77 F;  5FU7 C;  1YI2 T;  2A28 A;  1NJI C;  3BFM A;  4MMK A;  1ABO A;  4C5E A;  4H02 A;  2CUB A;  4HA8 A;  3G4S A;  1XTD A;  3OYC A;  1KOG A;  2RMO A;  4OB0 B;  1PKT A;  2FB7 A;  5EC7 A;  5LJ5 d;  2E5A A;  3G1Z A;  4E7S A;  1AOJ A;  1VQZ A;  1BIB A;  3H6Z A;  2FEI A;  2QG9 B;  2OTJ T;  1T0J A;  3L2V A;  1VQ5 T;  2F5T X;  4GLM A;  4E7H A;  1Y71 A;  2EYY A;  1M1K R;  5GAN 5;  1E1O A;  4BW9 A;  4C5G A;  2J6F A;  3JCM J;  4JLG A;  2RI5 A;  3CD6 A;  1YJ9 T;  4C0Z A;  2HD0 A;  2V26 A;  2VXF A;  2GBQ A;  4N0A C;  1D3B A;  1SSF A;  2D1X A;  1WXB A;  1WLP B;  3TEG A;  4EMK C;  3DB4 A;  1U1S A;  2X35 A;  5IHN A;  1JEG A;  3A7R A;  2AHJ B;  1UFF A;  3P8B B;  3UPU A;  1GGM A;  1M3C A;  4Q6G A;  4PJO B;  1RIQ A;  2M16 A;  1VQ4 A;  3X28 B;  4HCZ A;  2AKW A;  2JTF A;  2QTX A;  4RMO A;  3HRT A;  1UEC A;  4M7D G;  1ZBJ A;  1QMC A;  2WAC A;  5GAM j;  2L2P A;  2KMT A;  2DF6 A;  3GF5 A;  2LTO A;  3EG3 A;  4O5V A;  2NUT A;  2Q5H A;  4JRI A;  4YTL A;  4UP9 A;  2XDB A;  1KK7 A;  4PK4 A;  2I4M A;  1VQK Q;  4M7D B;  2KYM A;  1I0C A;  4OB2 B;  2ZT7 A;  2R58 A;  4O2D A;  2P84 A;  1SHF A;  3M59 A;  4KUI A;  1G5H A;  1NYF A;  3OYG A;  1UGQ B;  2BE9 B;  1Q86 C;  1K1Z A;  5D6Y A;  2Q7E A;  1E22 A;  1E6G A;  1YBY A;  2ARS A;  1VQP Q;  4K11 A;  3EHR A;  2ATC B;  5KE3 A;  4IUQ A;  1CSK A;  4NOY A;  4X34 A;  1T0H A;  4M78 E;  2M0O A;  1OUL A;  3M58 A;  4OMO A;  4HT4 A;  4C8Q E;  2EQJ A;  1YIJ A;  4HVC A;  1WDX A;  1WNL A;  1KD1 C;  4G85 A;  3VS6 A;  2QHU A;  3QTC A;  4ZTU B;  5KYX A;  1O9S A;  1OPK A;  2RN8 A;  8ATC B;  1KMN A;  3EH1 A;  5KH6 A;  2AZV A;  1BCO A;  1VIE A;  2QAS A;  1VQ7 T;  3T9N A;  1PSF A;  1S1N A;  4PJO A;  1WXU A;  3VQW A;  2I0N A;  3LWI A;  4RTU A;  5C52 B;  1YIJ Q;  1U06 A;  1UTI A;  1YJN T;  1NE8 A;  1BBW A;  1E7O A;  3OW2 A;  1G5V A;  1Q81 C;  1K73 R;  3SFM A;  2O9V A;  1B07 A;  1HJD A;  4ESR A;  2W0Z A;  5GAO l;  4ORZ A;  4YRM A;  2JOY A;  3WVE B;  1VQN A;  2YUP A;  2LQK A;  1B70 B;  1Q86 R;  4YRE A;  3OYJ A;  2CS7 A;  4FT4 A;  2AKK A;  3QHS A;  1NEG A;  2H8H A;  4PL6 A;  3REX A;  2XTI A;  4X9C A;  5A2Q E;  4P75 A;  2NLU A;  2KSS A;  5DLQ E;  3CBP A;  2EJG A;  1PKS A;  3CCS Q;  2JS0 A;  3JB9 H;  2ROT A;  2QEX A;  5LJ5 j;  4KBM B;  2EYQ A;  2LT1 A;  1YN8 A;  4D8K A;  3G71 T;  4ZN1 A;  2EAY A;  2NUP B;  1HK9 A;  1I5O B;  4ZNX A;  2MI6 A;  4DEX A;  3CXC S;  3JV3 A;  4JJC A;  1YHQ Q;  4C8Q C;  4C0D B;  1BI1 A;  4P3P A;  4N4I A;  2GGR A;  2OI3 A;  3LSS A;  2CUD A;  4YRI A;  1WI7 A;  4M7A B;  4J9E A;  4CC2 A;  1QP3 A;  1W70 A;  2DYI A;  1VQ4 Q;  3VS7 A;  1EX4 A;  1D1B A;  5GAN 3;  1KG1 A;  1TSF A;  2L89 A;  4UP8 A;  2RNA A;  3C4S A;  2D8J A;  3NGP A;  1VQ8 Q;  4PJN A;  2EFI A;  1B7T A;  2XKO C;  4D8D A;  1AVZ C;  2HNI A;  2OTL A;  2HKQ B;  4RQE A;  4RTX A;  4KH1 B;  1RAH B;  1R77 A;  3X26 B;  1OI1 A;  3ZEH A;  2RI2 A;  4HWT A;  4RQF A;  2JS2 A;  4F7U F;  5GAM e;  2LRQ A;  1EZZ B;  2KR3 A;  3JB9 G;  1N8R U;  2F5K A;  4ZTF A;  1XJW B;  2KRS A;  3G71 A;  3S6W A;  5GAN 8;  4J9H A;  4ZN3 A;  4LNP A;  3LLR A;  2QTV A;  1X01 A;  5ECA A;  3OS5 A;  4A63 B;  4P72 A;  1QVG S;  1NJI U;  3CMA T;  1BK2 A;  1TS9 A;  2PTK A;  2X51 A;  4CS3 A;  5LJ5 h;  4C92 C;  5HK3 A;  4M7A G;  4ZIB A;  3RR6 A;  1OQK A;  2KDS A;  3TRE A;  1B7Y A;  4OMM A;  2DTH A;  5C0M A;  3OYK A;  4CC3 A;  3OS0 A;  2JT4 A;  2PVG B;  1YWO A;  3UFG A;  4J6X A;  3I5S A;  1EQR A;  1X2Q A;  4N0A A;  3QBY A;  3S3M A;  3TVT A;  1SRL A;  3MKD A;  2K79 A;  4M7D A;  2YDL A;  2B86 A;  3EFO B;  1SES A;  2ZR2 A;  2AIR B;  1E6H A;  2RHZ A;  1IXD A;  1OZ2 A;  3RL6 A;  2MOX A;  4C0G A;  1H3H A;  5GAO m;  4BY6 B;  1VQ5 Q;  3THK A;  1EVL A;  1NPP A;  5FU6 B;  3OY9 A;  3IAL A;  1H3Z A;  2FHD A;  3A5Z B;  4LDV A;  5KCO A;  1BI0 A;  3N5B B;  2DAQ A;  1IRE B;  1B76 A;  5FU7 B;  1B34 B;  3QXE B;  1C0A A;  3CMQ A;  2IPO B;  1AWO A;  1H92 A;  4KUD K;  1HYO A;  2GTO A;  2BKD N;  1E24 A;  2ROL A;  3MEY A;  1SRM A;  4KQE A;  7AT1 B;  3EGD A;  2IY5 A;  3CCE T;  3EGX B;  2MCN A;  4OLF A;  2C0I A;  1KQS S;  1VQL A;  5KYU A;  3HFO A;  1D3B B;  3C0C A;  3CEY A;  1RL2 A;  1VQK T;  2QHS A;  1VQ7 Q;  3W3S A;  4FU6 A;  2JZ2 A;  2JW4 A;  3VUB A;  2V8J A;  3GNG A;  1QKX A;  1JBM A;  3CCU A;  1N8R R;  2JVV A;  1ZX6 A;  3CME A;  2EBP A;  3ULR B;  2HL5 C;  1QWE A;  5IN1 A;  2QHV A;  1WU7 A;  2J6K A;  3M0Q A;  4HWP A;  1LPL A;  1KQ1 A;  3EH2 A;  4LNS A;  4OMF B;  3NHN A;  2A7Y A;  2D0Q B;  2J3M A;  2D8H A;  3NTH A;  4A4E A;  1Y96 A;  4M75 D;  5C53 B;  1SF9 A;  4YRR A;  3QDR B;  3RAC A;  2EGC A;  4RTZ A;  1YFS A;  2QYZ A;  3BJU A;  3UA6 A;  3VYG A;  3UDC A;  1VQK A;  2EVR A;  1ZBX A;  2ED1 A;  2ZNI A;  4WI1 A;  5GMK e;  2ENM A;  3G6E T;  5FWB A;  2MMP A;  1EIF A;  3CCS A;  1WA7 A;  4M77 C;  1WJQ A;  2E4H A;  1Q95 G;  3UAT A;  1BYM A;  2KT8 A;  3MF2 A;  1UGS B;  2MPX C;  1BBZ A;  3CCU T;  1X6B A;  6AT1 B;  3CCQ A;  2F69 A;  3A1P A;  2E3H A;  2CP6 A;  4C8Q G;  2ZZE A;  2EQI A;  2HSE B;  2YUO A;  3M0P A;  1M1K U;  1VQ6 T;  2OTJ Q;  2G6F X;  4BI3 A;  1QCO A;  4P3N A;  3V8L A;  4C92 A;  1KQS P;  3ME9 A;  3DKM A;  5CAI A;  3HSB A;  1JRI A;  5D6X A;  4WTO B;  3IG2 A;  1MUZ A;  5GAN g;  2EJ9 A;  2HQE A;  1V1C A;  3RBB B;  4K87 A;  3FJP A;  4J5Y A;  3CMA Q;  1WXT A;  3GLX A;  1VQM T;  2GCX A;  4RUG A;  1IL2 A;  2CZ0 B;  2R5M A;  3IKL A;  4JJD A;  1K76 A;  2NUZ A;  2RHQ B;  4P74 A;  4DQ2 A;  2RA2 A;  3TEH A;  3TU4 K;  3EG9 A;  4PJM A;  2M02 A;  1K9M R;  2WSE E;  1SSH A;  1EFW A;  2GQI A;  1YIJ T;  3RMS A;  5DM7 R;  4KGV B;  1K4U S;  2QEX T;  3IKM B;  2P5I A;  1PM3 A;  2YRC A;  4XU3 A;  1D0Z A;  2ZT8 A;  3E19 A;  1YWP A;  2R5A A;  2KI7 A;  1VQ7 A;  2KXC A;  4XTW A;  1UB4 A;  1X2H A;  4JDS A;  2YUQ A;  2RD1 A;  4ZGJ B;  2CT4 A;  2YRV A;  5CKD A;  2J3L A;  3MO8 A;  1G51 A;  5LJ5 f;  1QWF A;  2LQ8 A;  1FYF A;  4M7D E;  1WYX A;  1AZE A;  1VQ8 T;  4PFP A;  3HHT B;  1RLQ C;  4CH5 A;  9ATC B;  2P4T A;  1MNE A;  2RQT A;  3WVD B;  3A32 A;  3OYH A;  4LDW A;  4PJJ A;  2FG0 A;  3I5R A;  4ATO A;  5FRO A;  1VQ9 A;  2LDM A;  1JJC B;  2XG8 D;  1GCQ A;  3M0U A;  3JCM h;  1FWZ A;  3E9I A;  4KUL A;  2D6F A;  4L59 A;  2C0T A;  3QJ6 A;  3M9Q A;  3VQX A;  4P75 C;  2KRN A;  3IQL A;  4QW2 A;  5GMK l;  4QVZ A;  1GCQ C;  1PSE A;  4DBH A;  4DBF A;  1G2B A;  2PQW A;  3EFS A;  2EQM A;  1NJ1 A;  3JCM e;  2PZ1 A;  2F2X A;  4YRO A;  4YCV A;  3VU3 C;  1FMV A;  4YYE A;  2L3R A;  4CS4 A;  2ODR C;  2EKO A;  5GAN h;  4J9I A;  2DM1 A;  3FIF A;  3JCM X;  2ALY A;  3M54 A;  4J9B A;  4XTU A;  4GY5 A;  3RNJ A;  3HPW A;  2EYW A;  2DA9 A;  3H9N A;  3OW2 P;  1HXD A;  1N6A A;  4FM4 B;  4VUB A;  4LUD A;  3HFZ A;  1Q7Y C;  1QVG A;  2C06 A;  3P8V A;  5LJ5 e;  2DDZ A;  5DY9 A;  3HRS A;  4L5G A;  4RDX A;  4A4H A;  4P71 A;  2H3E B;  2KYB A;  2DBM A;  1VQP A;  2ZPI B;  1G3Y A;  2PMF A;  1USY C;  2HBW A;  3PIP A;  2A08 A;  3QUI A;  2AMC B;  4M4Z A;  4JZ4 A;  2E64 A;  2DXT A;  1K8A U;  1D1C A;  4J7F A;  4TQF A;  2HAX A;  5I11 A;  3OB9 A;  1TH7 A;  3NET A;  3A5Z A;  5CQX A;  1VQ6 Q;  4EMG A;  1YJW Q;  1Z7N A;  4N4G A;  2LCS A;  5HY6 A;  2ZPH B;  5C51 B;  2RQR A;  5GAM d;  3L4G A;  3QYH B;  3UA7 A;  5GAN d;  1VQ8 A;  1UHC A;  3V8K A;  2CZ7 B;  2PME A;  1S72 Q;  3A8O B;  1VQM A;  1KJW A;  1E1T A;  3HXU A;  2P0L A;  4BY6 C;  1EVK A;  3MHX A;  1TOV A;  4Y92 A;  3NMZ C;  2QGF B;  1PCX A;  2RJC A;  2C7I A;  1SET A;  2X4W A;  1VQP T;  3DSQ A;  3HFV A;  1ABQ A;  2DXC A;  4F14 A;  2VAS A;  1NZ9 A;  4YRP A;  2BZX A;  3QNE A;  2PUO B;  1B7Y B;  1NYG A;  2DD5 A;  2M51 A;  4IUV A;  1U3O A;  2ZR3 A;  2L3S A;  2QQA A;  4C92 G;  3CCR Q;  3MJX A;  3V7S A;  2R57 A;  4ANJ A;  4MZP A;  1F1B B;  1M5Q 1;  1ZHI A;  3ER0 A;  1WIE A;  5IHI A;  4HWS A;  2NWM A;  2E3I A;  4R55 A;  2C0O A;  4J7I A;  1SHG A;  3CXC A;  2ARU A;  4LVK A;  4F7U B;  2DX1 A;  2K3Y A;  4LDY A;  2L3Q A;  1I1J A;  1RAG B;  5KYN A;  1YJW T;  3CCJ Q;  1KMM A;  4Q15 A;  1IHV A;  2VXE A;  4TTV A;  2RHX A;  1I5L A;  3LW5 E;  4XU2 A;  4A54 A;  3REU A;  1S72 T;  1LCK A;  5ELO A;  1KHI A;  4C0D C;  4YDQ A;  1ZUK A;  4E7L A;  4AFU C;  3G1J A;  4MML A;  5J3B A;  2RPN A;  1G8X A;  4PNO A;  2CP5 A;  4ELZ C;  3CCJ A;  4ZGE B;  2DK3 A;  3NTI A;  1MMG A;  1YNZ A;  2XDD A;  3NPF A;  1AWX A;  5IH2 A;  3RGL A;  3UGT A;  4FSS A;  3PT9 A;  1U8R A;  2EYZ A;  5GMK m;  2A0F B;  3MPU B;  3P8Y A;  1QVF S;  2IG0 A;  2CP0 A;  2E10 A;  4J83 A;  3RMQ A;  1M3B A;  4PJO C;  1ARK A;  2MK5 A;  2ED0 A;  2NS6 A;  2ECZ A;  4XU1 A;  1I4K 1;  3DLM A;  3VQY A;  2QAZ A;  3RDV A;  5IXF A;  1TXQ A;  1WHK A;  3I55 T;  4AFZ C; 
#chains in the Genus database with same CATH homology
 2EQU A;  3EFR A;  4LVL A;  1Y7X A;  4IUU A;  2QXF A;  3JCM c;  2RB6 A;  2RM4 A;  4M78 B;  4C5H A;  4XTZ A;  3SWN C;  4JUV A;  5A0D A;  3VKI A;  4O6J A;  4IUR A;  4Z02 A;  1N9S A;  3JCM b;  4OB1 B;  5GAO n;  4M78 A;  3EAE A;  3HXY A;  2RJD A;  1I81 A;  4J6W A;  4CH4 A;  2VC8 A;  3PFS A;  3OYM A;  2MAM A;  1BBU A;  3CC4 A;  1M1F A;  3SB2 A;  4B9W A;  1KQ2 A;  1NJ6 A;  1XQH A;  2RJE A;  4M7A F;  2CYZ B;  4P72 C;  5J39 A;  3I7F A;  1VIF A;  2RJF A;  2PU9 B;  3I55 A;  3FEO A;  4F7U G;  5LL6 S;  2PVO B;  5GAN f;  3RUX A;  5M9O A;  4YRQ A;  5GAN 6;  3BDU A;  1VQO A;  3FDR A;  4LD6 A;  1KHC A;  4PJO E;  1X2G A;  3RIR A;  5LJ3 g;  4M78 G;  1QP2 A;  3QPH A;  4XAX B;  4UPA A;  3CCV A;  2MWP A;  4YRG A;  1XNI A;  3SD4 A;  3M55 A;  1H64 1;  3RKX A;  4HCC A;  2ZXF A;  4PLI A;  2V8I A;  4P73 A;  4YPF A;  3NTK A;  2EJF A;  2E41 A;  3M56 A;  1NPR A;  3PMI A;  2A3L A;  4F7U A;  3I56 T;  1YHQ A;  3OBW A;  2DU5 A;  2AKW B;  3C94 A;  3VBB A;  3UT1 A;  1Q86 U;  3HTZ A;  4Y91 A;  3GOX A;  1DJ7 B;  4C8Q B;  1ADJ A;  4JLI A;  1YCY A;  3L2Z A;  1WYD A;  2HBP A;  4F7U E;  4Q5W A;  2PUK B;  1KC8 C;  2RHS A;  3LC0 A;  1K9M U;  1MHN A;  4RMF A;  4EMK B;  3GP8 A;  1X75 C;  3MEA A;  2QQR A;  4YP0 A;  2OTJ A;  2XD0 A;  1WPY A;  2QHT A;  2LC4 A;  1VQN T;  2KK4 A;  4C8Q D;  2DQ0 A;  4H2W A;  4MDX A;  3RF1 A;  2BIV A;  1N9R A;  5ELN A;  1M8V A;  3MQZ A;  4PHC A;  2YLB A;  4P73 C;  3HKS A;  2X4Y A;  2ZTG A;  3VQV A;  4PJO G;  4M7D C;  2AMC A;  2Q5I A;  3RKY A;  2ZT6 A;  4UP7 A;  4XU0 A;  1Y07 A;  4FL6 A;  4BI4 A;  1G5I A;  3H8Z A;  4M75 F;  2RK1 A;  2DTO A;  3KXT A;  3M57 A;  4LVM A;  4QVD A;  3OYL A;  4LDU A;  4ZTJ A;  3HFZ B;  1EIY B;  4PKC C;  4BUG A;  1QF6 A;  3M53 A;  2XDP A;  2VYT A;  1NJ2 A;  1YFT A;  2E12 A;  2X4X A;  3QO3 A;  2DJZ A;  2ZGW A;  2ZT5 A;  2Y4X A;  4M7A D;  1PYS A;  1YIT A;  3OSV A;  3Q1J A;  3CC2 T;  2E3C A;  5CKH A;  2QA4 A;  1M9S A;  3INZ A;  5GAO r;  4M77 E;  2G3R A;  4YRS A;  4RCB A;  3QSU A;  2ART A;  3BW1 A;  2K4Y A;  2IVW A;  2EWN A;  4LVJ A;  1KQS A;  3WQZ A;  3TUP A;  3L1A A;  3OD1 A;  3URG A;  3BDL A;  3M4G A;  3HP9 A;  4OP0 A;  3CC4 T;  2ZCE A;  2GQV A;  1JJC A;  1VUB A;  2E6N A;  2DXB A;  1VQL T;  1QVF A;  1N27 A;  3CCE A;  1B34 A;  4M75 G;  5GAM g;  3HXX A;  5LJ3 h;  2E1H A;  4L87 A;  3CCR T;  2DU7 A;  1UGR B;  3CCR A;  2ZIN A;  5CQY A;  1FXX A;  1NJ5 A;  2I4L A;  1NYR A;  1IZ6 A;  5EG2 A;  1Q82 C;  2GFA A;  4M75 C;  2Q7G A;  5F5W A;  4JS5 A;  2CGH A;  3R6O A;  4ME7 A;  4MZM A;  1U1T A;  3OMC A;  2KVQ G;  2B8A A;  2RHU A;  1K73 C;  5I2S A;  2WSC E;  4IKF A;  3BY7 A;  1YGB A;  3S3N A;  3TEH B;  4WJ3 M;  5LJ3 j;  4UC4 A;  4JJN K;  2O01 E;  4D6W A;  2RHQ A;  3NFC A;  3NEM A;  1VQO T;  5FLX E;  1S72 A;  3MEU A;  1W2B S;  4BE0 A;  4CH6 A;  4PG3 A;  2YHT A;  1N9W A;  5LJ3 f;  3G4S T;  3C12 A;  3UGQ A;  4BB7 A;  1SER A;  3JCM f;  1VQ6 A;  2HQX A;  4YCW A;  2EQK A;  4M77 D;  3CPW A;  1FX7 A;  3OQ5 A;  2DZC A;  3CMA A;  3L2W A;  1YJN A;  1YFR A;  1Y96 B;  3LYI A;  4NL3 A;  5HK0 A;  4YRL A;  3HXV A;  5KCH A;  3NEL A;  4LVI A;  1W2B A;  2P0K A;  2XIC A;  5A0G A;  3MET A;  2ZNJ A;  1AHJ B;  4EO4 A;  4IUT A;  1WJR A;  2LX9 A;  3ASK A;  3HRU A;  4J6Y A;  3V8J A;  1I8F A;  1Q81 U;  1ASY A;  3A8H B;  3MP1 A;  3CCL T;  5CKB A;  4A4F A;  5DLO A;  3E9F A;  2IY5 B;  3HY1 A;  2E6Z A;  3OMG A;  3MP8 A;  5KE2 A;  2LT4 A;  2I4O A;  5KNN A;  4JRQ A;  3E9G A;  2GFU A;  4FT2 A;  3JCM P;  3L2Q A;  3ZBD A;  3M4Q A;  2DQ3 A;  2I2L A;  1VQ9 T;  4JS4 A;  3LGF A;  3TEE A;  2I4N A;  4C8Q A;  1LJO A;  3L2U A;  1HC7 A;  2Y90 A;  2K2V A;  5GAN 7;  4KT0 E;  3VV0 A;  5CO7 A;  5FRM A;  4M7A C;  2XI9 A;  3A7U A;  3X25 B;  1V29 B;  3JCM W;  4HT9 A;  3ICA A;  2L5Q A;  4YRK A;  3A7A A;  2H3J A;  3GIB A;  1O75 A;  2QDY B;  4J15 A;  2ZIM A;  5LJ3 d;  3F70 A;  3X20 B;  2EIF A;  3A5Y A;  4M78 C;  2C8M A;  2ZCF B;  2ZPG B;  3SWN B;  2XGT A;  2XK0 A;  3P8D A;  1USY A;  4YRJ A;  5CKE A;  3HXW A;  5IAY A;  1H4T A;  1YJW A;  3LSQ A;  4P71 C;  2A8E A;  2ODR D;  4BWA A;  1K73 U;  2K3X A;  4H2V A;  1UEB A;  3PTA A;  3CCM T;  2QA4 T;  1QW1 A;  2KAF A;  1EOV A;  3X24 B;  4HCB A;  5CK9 A;  3QO8 A;  5K1P A;  2CKK A;  2WSF E;  4NCX A;  3S3O A;  5GAO p;  4DPG A;  3CBM A;  4P5N A;  4TWA A;  2VV5 A;  3VYH B;  4P74 C;  3KFU A;  3LGL A;  2V8K A;  3OYN A;  5IT9 E;  1B8A A;  5A0L A;  1P92 A;  3MCA B;  3P8H A;  3J81 E;  4BD3 A;  1G3T A;  2ZZG A;  5FU6 C;  3OS1 A;  2CJ9 A;  4M78 F;  3PMT A;  4M7A A;  3HY0 A;  4HKE A;  4PJO D;  4R56 A;  1LYL A;  2JNG A;  3OW2 S;  2RHY A;  3PIO A;  3GPL A;  4XEM A;  2JUF A;  4H2S A;  1ADY A;  2CJB A;  1L0W A;  2OAU A;  2FYK A;  1ZQ1 A;  2K5I A;  4M77 A;  1K8A C;  3ERR A;  1G3W A;  3FB9 A;  2VGM A;  4C8Q F;  3QO5 A;  2O4X B;  1B70 A;  3J7A F;  4NS5 A;  4M7D F;  3A8L B;  4P3O A;  5K1X A;  3A8M B;  2G4C A;  2GF7 A;  4Y28 E;  4C92 E;  1Q7Y U;  3V7R A;  4EDU A;  2E5Q A;  4M75 B;  4C0F A;  4ELY C;  3QKJ A;  4EX5 A;  2K5F A;  1BI2 A;  5GAM h;  3FRN A;  1VQ4 T;  4YRN A;  3V7C A;  4XTX A;  4DOV A;  4CI0 C;  4H2Y A;  4M7A E;  2DPP B;  2VGN A;  4M77 G;  1R8O B;  4BDZ A;  3RER A;  2Y4Y A;  1WQ7 A;  1Q82 U;  1HTT A;  3OYE A;  2O4X A;  5D6W A;  5CIU A;  2LVM A;  5L8R E;  4M77 B;  4E7J A;  1NYQ A;  4XQ3 A;  3RES A;  3C95 A;  4PJO F;  4E7I A;  1M90 C;  3SWN A;  1QE0 A;  2DTI A;  2E65 A;  4QQG A;  3M5A A;  4FIB A;  2JN0 A;  3JB9 J;  3AHU A;  2QI2 A;  3JB9 D;  2DIQ A;  4TQD A;  4OGE A;  3G6E A;  4JRK A;  2DD4 A;  3OYY A;  4YRF A;  1W4S A;  2QQB A;  1M1K C;  4XTV A;  5GAN 2;  4EMH A;  4ZGD B;  4C92 F;  3PNW C;  1M90 U;  2K5L A;  2MF2 A;  3HFN A;  3L4G B;  4X5O A;  4LDX A;  1LNX A;  4YCU A;  4TVA B;  11AS A;  5E3I A;  4LD9 K;  1OYX A;  1XOV A;  2ZPE B;  3JSC A;  5AYF A;  4GLK A;  4TVY A;  4AH6 A;  2ZZD A;  1WLE A;  2RI3 A;  1K9M C;  4CH3 A;  3DLL A;  3KBG A;  4OGC A;  5CR2 A;  1J5W A;  2LCL A;  4BAC A;  4HT8 A;  3UWN A;  3OYI A;  2P0Q A;  5GMK i;  3JAM E;  2CZ6 B;  2CJA A;  4KR3 A;  4OB3 B;  4H2X A;  4A4G A;  3OS2 A;  2KQW A;  1WQW A;  2QQ9 A;  2RK2 A;  4C92 D;  2DXU A;  2CIM A;  4DOW A;  3QZ9 B;  3SDZ A;  1BIA A;  3MEV A;  3JCM V;  1JJ2 S;  2M9U A;  3UH0 A;  3JB9 F;  2XHC A;  3NEN A;  3KUF A;  4CRI A;  2DVE A;  3ZFJ A;  1ASZ A;  2XID A;  4FSX A;  4TVR A;  4RCC A;  3P8T A;  1YIT T;  5GMK j;  5CCA A;  2YLC A;  4M78 D;  1NJ8 A;  4N4H A;  2DEQ A;  1YI2 A;  4YRT A;  3PCO A;  4DA4 A;  5GAN j;  3LWH A;  4BDY A;  3QZ5 B;  1Z7M A;  2CZ1 B;  2XU8 A;  3O8V A;  1M4Z A;  3QII A;  3JCM g;  2JTM A;  2FL7 A;  1WJS A;  3PGG A;  2ZIO A;  4H2U A;  3VJP A;  3OYB A;  1QVP A;  1H4V B;  3WXM B;  4M7D D;  3OBY A;  3R07 A;  3OA6 A;  4II1 A;  3HXZ A;  2P0P A;  4K86 A;  3CCM A;  2D9T A;  5LJ3 e;  2OTL T;  2EL9 A;  4MDW A;  2DKG A;  3FLG A;  4A53 A;  3QG1 A;  5C6S A;  3CCV T;  2PVD B;  4A4K A;  4B9X A;  4CS2 A;  3LH0 A;  4NL2 A;  1NNH A;  4H2T A;  4OVA A;  3CPF A;  1M1G A;  3A8G B;  1SRY A;  2DZ9 A;  4C5I A;  3QYG B;  4RG2 A;  1YHQ T;  3CD6 T;  1H4Q A;  2L8D A;  1LOJ A;  3GNF B;  5GAN e;  2KY9 A;  2E70 A;  1MGQ A;  4K88 A;  1X56 A;  3HL8 A;  3VUZ A;  3FC3 A;  3DB3 A;  1OZ3 A;  4X9D A;  4QQD A;  2ZPB B;  1W66 A;  1H4S A;  5GAM f;  4BI8 B;  2ALY B;  4E51 A;  5GAO q;  3L2R A;  2VUB A;  2DIG A;  3OYA A;  4V2S A;  4J8O A;  5GAN 4;  1KD1 U;  5I21 A;  4WJ4 A;  3A31 A;  3OYF A;  3M4Y A;  1KC8 U;  4H2X B;  3MF1 A;  3OYD A;  4ZTZ B;  3A74 A;  3I56 A;  5I2M A;  2LCC A;  3E1S A;  1X55 A;  1X6O A;  4WF2 A;  3CBO A;  1ATI A;  4EPC A;  2QQS A;  3G7Z A;  5HKC A;  3MP6 A;  4MZT A;  3CC2 A;  2Q7H A;  2M1H A;  4TVW A;  3CCJ T;  1UGP B;  2ZZF A;  3CME T;  3HRI A;  4TVA A;  4YRC A;  3J80 E;  2FVU A;  4XEO A;  4KR2 A;  4QQ6 A;  3RKW A;  1X54 A;  4L6V 5;  1VQ5 A;  5GMK h;  1BI3 A;  1G3S A;  4PLL A;  5FRN A;  3JCM d;  5CVI A;  3CC7 T;  2RO0 A;  3QO7 A;  4E7K A;  12AS A;  4XTY A;  2BUD A;  4QVC A;  3CPW S;  1YB3 A;  2X4J A;  2ZPF B;  4EMK A;  3JRZ A;  3OSS C;  4XK8 E;  4HWR A;  4IUP A;  4E47 A;  2K57 A;  2RHS B;  1PYS B;  5LJ5 g;  4G84 A;  4C92 B;  3HRK A;  4RKU E;  3QJY A;  4BE2 A;  3CCQ T;  4M75 E;  3PZC A;  3MEW A;  4BE1 A;  1EIY A;  5J26 A;  3M4P A;  5CKF A;  3L42 A;  2RHI A;  1RI0 A;  1BKB A;  3TCJ A;  3CCL A;  2MWO A;  3LX7 A;  4HWO A;  3PCO B;  4RG8 A;  3CC7 A;  4M75 A;  1GXI E;  1YJ9 A;  1N8R C;  1JJ2 A;  1WGS A;  2RH2 A;  5HGQ A;  3JCM Q;  2DO3 A;  1JB0 E;  3JB9 I;  4OF1 A;  4JRP A;  3CCS T;  3E9H A;  2LNV A;  4M77 F;  5FU7 C;  1YI2 T;  1NJI C;  3BFM A;  4MMK A;  4C5E A;  4H02 A;  4HA8 A;  3G4S A;  1XTD A;  3OYC A;  1KOG A;  4OB0 B;  2FB7 A;  5LJ5 d;  2E5A A;  3G1Z A;  1VQZ A;  1BIB A;  3H6Z A;  2OTJ T;  3L2V A;  1VQ5 T;  2F5T X;  4E7H A;  1Y71 A;  1E1O A;  5GAN 5;  4BW9 A;  4C5G A;  3JCM J;  4JLG A;  2RI5 A;  3CD6 A;  1YJ9 T;  4C0Z A;  2HD0 A;  2VXF A;  4N0A C;  1D3B A;  1SSF A;  3TEG A;  4EMK C;  3DB4 A;  1U1S A;  2X35 A;  3A7R A;  2AHJ B;  3P8B B;  3UPU A;  1GGM A;  4Q6G A;  4PJO B;  1RIQ A;  2M16 A;  1VQ4 A;  3X28 B;  4HCZ A;  2AKW A;  2JTF A;  2QTX A;  4RMO A;  3HRT A;  4M7D G;  2WAC A;  5GAM j;  2KMT A;  3GF5 A;  2LTO A;  4O5V A;  2Q5H A;  4JRI A;  4YTL A;  4UP9 A;  2XDB A;  2I4M A;  4M7D B;  4OB2 B;  2ZT7 A;  2R58 A;  4O2D A;  3M59 A;  4KUI A;  1G5H A;  3OYG A;  1UGQ B;  1Q86 C;  5D6Y A;  2Q7E A;  1E22 A;  1YBY A;  2ARS A;  5KE3 A;  4IUQ A;  4X34 A;  4NOY A;  4M78 E;  2M0O A;  3M58 A;  4HT4 A;  4C8Q E;  2EQJ A;  1YIJ A;  4HVC A;  1WNL A;  1KD1 C;  4G85 A;  2QHU A;  3QTC A;  4ZTU B;  1O9S A;  1KMN A;  5KH6 A;  1VIE A;  1VQ7 T;  3T9N A;  1PSF A;  4PJO A;  3VQW A;  3LWI A;  5C52 B;  1YJN T;  1NE8 A;  1BBW A;  3OW2 A;  1G5V A;  1Q81 C;  3SFM A;  5GAO l;  4YRM A;  2JOY A;  3WVE B;  1VQN A;  2LQK A;  1B70 B;  4YRE A;  3OYJ A;  2CS7 A;  4FT4 A;  3QHS A;  4PL6 A;  3REX A;  2XTI A;  4X9C A;  5A2Q E;  4P75 A;  2NLU A;  2KSS A;  5DLQ E;  3CBP A;  2EJG A;  3JB9 H;  2QEX A;  5LJ5 j;  4KBM B;  2EYQ A;  2LT1 A;  3G71 T;  4ZN1 A;  2EAY A;  1HK9 A;  2MI6 A;  3CXC S;  4C8Q C;  4C0D B;  1BI1 A;  4P3P A;  4N4I A;  3LSS A;  4YRI A;  4M7A B;  1KG1 A;  1QP3 A;  5GAN 3;  2L89 A;  4UP8 A;  3C4S A;  2EFI A;  2XKO C;  2HNI A;  2OTL A;  4RQE A;  3X26 B;  1OI1 A;  3ZEH A;  2RI2 A;  4HWT A;  4RQF A;  4F7U F;  5GAM e;  2LRQ A;  3JB9 G;  1N8R U;  2F5K A;  4ZTF A;  3G71 A;  3S6W A;  5GAN 8;  4ZN3 A;  3LLR A;  1X01 A;  3OS5 A;  4P72 A;  1QVG S;  1NJI U;  3CMA T;  4CS3 A;  5LJ5 h;  4C92 C;  5HK3 A;  4M7A G;  4ZIB A;  2KDS A;  3TRE A;  1B7Y A;  2DTH A;  5C0M A;  3OYK A;  3OS0 A;  2PVG B;  3UFG A;  4J6X A;  1EQR A;  4N0A A;  3QBY A;  3S3M A;  4M7D A;  1SES A;  2ZR2 A;  2RHZ A;  1OZ2 A;  3RL6 A;  4C0G A;  5GAO m;  4BY6 B;  1EVL A;  1NPP A;  5FU6 B;  3OY9 A;  3IAL A;  1H3Z A;  2FHD A;  3A5Z B;  4LDV A;  5KCO A;  1BI0 A;  3N5B B;  2DAQ A;  1IRE B;  1B76 A;  5FU7 B;  1B34 B;  3QXE B;  1C0A A;  3CMQ A;  4KUD K;  2BKD N;  1E24 A;  3MEY A;  4KQE A;  2IY5 A;  3CCE T;  4OLF A;  1KQS S;  1VQL A;  3HFO A;  1D3B B;  3CEY A;  1RL2 A;  1VQK T;  2QHS A;  3W3S A;  4FU6 A;  2JZ2 A;  3VUB A;  2V8J A;  3GNG A;  1JBM A;  3CCU A;  2JVV A;  3CME A;  5IN1 A;  2QHV A;  1WU7 A;  4HWP A;  1KQ1 A;  4LNS A;  4OMF B;  2A7Y A;  2D0Q B;  2J3M A;  3NTH A;  4A4E A;  1Y96 A;  4M75 D;  5C53 B;  4YRR A;  3QDR B;  3RAC A;  1YFS A;  3BJU A;  3VYG A;  3UDC A;  1VQK A;  1ZBX A;  2ZNI A;  4WI1 A;  5GMK e;  3G6E T;  2MMP A;  1EIF A;  3CCS A;  4M77 C;  1WJQ A;  1BYM A;  3MF2 A;  1UGS B;  3CCU T;  3CCQ A;  2F69 A;  4C8Q G;  2ZZE A;  1M1K U;  1VQ6 T;  4BI3 A;  4P3N A;  3V8L A;  4C92 A;  3ME9 A;  3DKM A;  5CAI A;  3HSB A;  1JRI A;  5D6X A;  3IG2 A;  5GAN g;  2EJ9 A;  2HQE A;  4K87 A;  3FJP A;  4J5Y A;  3GLX A;  1VQM T;  2GCX A;  1IL2 A;  2CZ0 B;  2R5M A;  3IKL A;  2RHQ B;  4P74 A;  4DQ2 A;  2RA2 A;  3TEH A;  3TU4 K;  2WSE E;  1EFW A;  1YIJ T;  3RMS A;  5DM7 R;  2QEX T;  3IKM B;  2P5I A;  4XU3 A;  2ZT8 A;  3E19 A;  2R5A A;  1VQ7 A;  4XTW A;  1UB4 A;  1X2H A;  4JDS A;  2RD1 A;  4ZGJ B;  2YRV A;  5CKD A;  2J3L A;  3MO8 A;  1G51 A;  5LJ5 f;  2LQ8 A;  1FYF A;  4M7D E;  1VQ8 T;  3HHT B;  4CH5 A;  2P4T A;  3WVD B;  3A32 A;  3OYH A;  4LDW A;  4ATO A;  5FRO A;  1VQ9 A;  2LDM A;  1JJC B;  2XG8 D;  3JCM h;  1FWZ A;  3E9I A;  4KUL A;  2D6F A;  4L59 A;  3QJ6 A;  3M9Q A;  3VQX A;  4P75 C;  4QW2 A;  5GMK l;  4QVZ A;  1PSE A;  2PQW A;  3EFS A;  2EQM A;  1NJ1 A;  3JCM e;  4YRO A;  4YCV A;  3VU3 C;  4YYE A;  2L3R A;  4CS4 A;  2ODR C;  2EKO A;  5GAN h;  3JCM X;  3FIF A;  2ALY A;  3M54 A;  4XTU A;  4GY5 A;  3HPW A;  1HXD A;  1N6A A;  4FM4 B;  4VUB A;  3HFZ A;  1Q7Y C;  1QVG A;  2C06 A;  3P8V A;  5LJ5 e;  2DDZ A;  5DY9 A;  3HRS A;  4L5G A;  4RDX A;  4A4H A;  4P71 A;  1VQP A;  2ZPI B;  1G3Y A;  2PMF A;  1USY C;  3PIP A;  3QUI A;  2AMC B;  2E64 A;  2DXT A;  1K8A U;  4J7F A;  4TQF A;  2HAX A;  3OB9 A;  1TH7 A;  3NET A;  3A5Z A;  5CQX A;  4EMG A;  1Z7N A;  4N4G A;  5HY6 A;  2ZPH B;  5C51 B;  5GAM d;  3L4G A;  3QYH B;  5GAN d;  1VQ8 A;  3V8K A;  2CZ7 B;  2PME A;  3A8O B;  1E1T A;  1VQM A;  3HXU A;  2P0L A;  4BY6 C;  1EVK A;  3MHX A;  2RJC A;  2C7I A;  1SET A;  2X4W A;  1VQP T;  3DSQ A;  3HFV A;  2DXC A;  1NZ9 A;  4YRP A;  3QNE A;  2PUO B;  1B7Y B;  2DD5 A;  4IUV A;  2ZR3 A;  2QQA A;  4C92 G;  3V7S A;  2R57 A;  4MZP A;  1M5Q 1;  1ZHI A;  3ER0 A;  4HWS A;  4R55 A;  4J7I A;  3CXC A;  2ARU A;  4LVK A;  4F7U B;  2K3Y A;  4LDY A;  1YJW T;  1KMM A;  4Q15 A;  2VXE A;  4TTV A;  2RHX A;  1I5L A;  3LW5 E;  4XU2 A;  4A54 A;  3REU A;  1S72 T;  5ELO A;  1KHI A;  4C0D C;  4YDQ A;  4E7L A;  4MML A;  5J3B A;  4PNO A;  4ELZ C;  3CCJ A;  4ZGE B;  2DK3 A;  3NTI A;  2XDD A;  3UGT A;  3RGL A;  3PT9 A;  1U8R A;  5GMK m;  3P8Y A;  1QVF S;  2IG0 A;  2E10 A;  4J83 A;  3RMQ A;  4PJO C;  2NS6 A;  4XU1 A;  1I4K 1;  3DLM A;  3VQY A;  3I55 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...