2DQ3A

Crystal structure of aq_298
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
425
Chain Sequence
MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGTDVIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
publication title Crystal structure of aq_298
rcsb
source organism Aquifex aeolicus
total genus 133
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dq3A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dq3A02
4Q6GA 1BBWA 1X2HA 2ODRC 4P72A 4O2DA 4TVWA 3E9HA 4P72C 1QE0A 2ZIOA 3HRKA 4P74A 3QTCA 2Q7GA 2ARUA 5HGQA 1EVLA 4P74C 3UFGA 2QHVA 4YRNA 4HWSA 4HA8A 2E10A 4YREA 3HFZB 2Q5IA 2C8MA 4XU0A 3VBBA 2DZ9A 3RKXA 4TQFA 2ZR2A 2DQ0A 1ADJA 4HWPA 5C51B 2DVEA 1NJ6A 2ZCEA 1Z7NA 2AMCB 2ZT8A 4YRTA 1WQ7A 3RUXA 2QHSA 4PG3A 4UPAA 3A5ZA 1ASZA 4CS4A 4RMFA 2RHQB 4YRSA 3M4PA 1B7YA 4WJ3M 3HFZA 5F5WA 1WNLA 2DTHA 4YRIA 4DQ2A 2ZGWA 1EIYB 4TTVA 4YROA 3TEHA 5ELNA 2FYKA 3ERRA 1ASYA 2AMCA 4OLFA 2I4NA 3VQVA 4KQEA 3FJPA 2IY5B 1E1TA 1WU7A 4NCXA 1X01A 2RHQA 2DEQA 2CJ9A 3G1ZA 4P73C 2ZINA 4UP8A 4G84A 1WLEA 2E64A 2DDZA 4E51A 4ZTUB 1BIBA 3RF1A 1L0WA 1NNHA 4UP7A 3MEYA 3REUA 1SETA 3LSSA 3P8YA 3HXZA 2AKWA 1QF6A 4CS3A 2P5IA 2E5AA 1G5HA 4YRGA 2EJFA 4WF2A 2ZNJA 3TEGA 2I4OA 4ZTZB 4XEOA 1USYA 4H2UA 4CH4A 1USYC 3L2ZA 4YCUA 4AH6A 4P3NA 3VQWA 3RL6A 3A7UA 1SESA 4YP0A 1C0AA 3HY0A 3PZCA 4YRPA 1YB3A 4XTYA 4YCVA 1SRYA 3MF2A 3IKLA 1YGBA 12ASA 4YRKA 4P75A 3DSQA 3PCOB 1HC7A 4LNSA 4CH3A 4CS2A 1B7YB 4P75C 4K86A 4BWAA 4XTZA 1H4VB 3KFUA 3QO5A 1NYQA 4Q15A 3UGTA 2ZR3A 4TVAB 5KNNA 3TEHB 4XTWA 1PYSB 4DPGA 3HRIA 3V8KA 2ZT6A 1LYLA 3VQXA 4TWAA 1EQRA 2DU5A 1ATIA 4YRRA 1E24A 1BBUA 2I4LA 2I4MA 4PHCA 2QHTA 1X55A 3R07A 4OP0A 3RGLA 3EFRA 3V8LA 1WQWA 3PCOA 3LSQA 2ZZGA 4H2TA 1NYRA 4YRLA 4L87A 1G51A 2DKGA 2DQ3A 3V8JA 4BW9A 3QO7A 2DJZA 4TVAA 3L4GA 3RACA 1PYSA 3P8VA 2E1HA 2AKWB 5E3IA 3WQZA 1RIQA 2EJ9A 1W66A 3EFSA 3L1AA 2CGHA 3RIRA 4P73A 2EAYA 2XTIA 3NETA 4WJ4A 2ARTA 2C7IA 4H2XB 3HXWA 3UGQA 4KR3A 3HXUA 2ARSA 3IALA 5C53B 3P8TA 3V7RA 1J5WA 3I7FA 1SERA 2G4CA 4YRCA 4YRQA 1B76A 1KOGA 4HWOA 4H02A 2E65A 1YFTA 1B70A 4KR2A 4CH6A 4HVCA 3NELA 4UP9A 1G5IA 2ZT5A 3IG2A 3MF1A 1NJ5A 1EFWA 3BFMA 3V7SA 2ZIMA 4EX5A 4H2XA 2QHUA 3HXXA 4XU2A 4ZIBA 4RQFA 2CIMA 5K1XA 4K87A 2J3MA 2ZNIA 4XTUA 3M4QA 1JJCA 1N9WA 1YFSA 3QO8A 3IKMB 2EJGA 1GGMA 3ICAA 4HWTA 3A7AA 1KMNA 2XGTA 1ADYA 3A32A 4YYEA 4G85A 3A7RA 4CH5A 2ZZEA 1H4TA 4J15A 3L4GB 4XU3A 2J3LA 1NJ1A 3A74A 3HXVA 5C52B 5ELOA 4TQDA 2DTOA 1EOVA 2E3CA 2CJAA 3HFVA 1IL2A 1H4QA 1H4SA 1YFRA 3RKYA 3RKWA 3UH0A 3OD1A 2PMEA 2EL9A 4XTVA 2E41A 2EWNA 4H2WA 3HY1A 3NENA 3HTZA 4YRMA 3W3SA 2Q7EA 3A31A 1Z7MA 3CMQA 4H2SA 1B70B 2DXTA 2HNIA 2PMFA 3A5YA 1NJ8A 2ALYB 1VQZA 3TUPA 4HWRA 4K88A 1E1OA 2CJBA 2ZTGA 3BJUA 4EO4A 2DXUA 2ZXFA 4XTXA 2DU7A 4YCWA 3VQYA 4H2VA 5K1PA 2RHSB 2DTIA 4TVYA 4YPFA 2ODRD 1WPYA 4P71A 1X2GA 2Q7HA 2ZZFA 4P3OA 4P71C 3LC0A 1JJCB 4XEMA 1FYFA 1KMMA 4YDQA 4H2YA 2ALYA 4YRJA 1EIYA 3QNEA 1BIAA 4P3PA 4X5OA 1EVKA 1HTTA 2Q5HA 4RDXA 1X54A 1WYDA 4RQEA 2RHSA 4YRFA 3E9IA 2ZT7A 2IY5A 1NJ2A 4WI1A 2DZCA 3REXA 3HXYA 1X56A 1HXDA 11ASA 3NEMA 3V7CA 1E22A 1B8AA 2P0LA 4XU1A
chains in the Genus database with same CATH superfamily
4LWSA 4GX0A 5CN0A 1YXBA 1X2HA 3UO2A 3JCUZ 1JVMA 2QEXV 4BIUA 4JPRA 5JJNB 4MW3A 4YY3B 3S3XA 2ARUA 4GUNA 3IAYA 2P7TC 1IURA 1AVMA 4LF8O 4HWSA 3R65A 2EILC 4DV5B 2XAFA 2Q5IA 1W59A 1NR7A 3VBBA 2UXDB 2R72A 2DZ9A 2Q67A 4HZ3A 1Q6UA 2ZR2A 4WFFA 3TETA 2DQ0A 4JTCB 1ADJA 5J2TB 4FK5C 2BCCH 4FLVA 5C51B 2DVEA 4A5UB 4MVMA 2ZE7A 1SZTA 2G38A 1Q6IA 3APQA 1FYJA 1H2NA 1AILA 1EN5A 2PGGA 2F4VO 1HNWO 4JI3O 1VQLV 4UCSA 2QWRB 4LF6O 1JJOA 1TVKA 2B5UA 4DV7O 2YXLA 2YIBD 1Y4MA 4HYOA 3L75H 5F5WA 1WNLA 4F6RB 4YRIA 3ABKC 4DQ2A 2ZGWA 2YS8A 4PA7A 4JYAO 1SZXA 3K0DA 3CRCA 3ABLC 2L35A 3NXSA 1QNMA 2AMCA 2P67A 2JGDA 2I4NA 2GTAA 5DN6G 1H8HG 4FZ0A 5EZYB 3L70H 4WBNA 4NXMO 1NVPB 1VQPV 3ZN0A 3Q4HA 3SYOA 5L3FA 2UUAB 3R66A 1WU7A 2A06H 4JI2B 4NCXA 2X6CA 1KKCA 4GX2A 3M8AA 2NR5A 3G1ZA 2IH1C 2HHHB 1BGYH 1TUBA 2E75B 2X0LA 4L8JA 1K9MW 4LF7O 3E8GA 4UCTA 1IX9A 2N04A 3ZS8C 1UFIA 2PTMA 1AP6A 2UUCO 3WU2Z 1Q90D 1GAXA 2JVDA 1BIBA 1L0WA 4X9QA 5EYPB 1KP3A 4FJCC 1H2MA 3MEYA 3UKMA 2P90A 3REUA 2W0XA 3B8NA 4JI8O 3FYEB 4LWSB 1JQ0A 3H1LH 3J7AU 4W4KA 1VQMV 3W7UA 1AP5A 2P5IA 2MK3A 1AI6A 4LF5O 2XT9A 3SJAC 4ZTZB 4N21A 1USYA 4UXNA 3W7SA 1VP7A 3L2ZA 5FNVA 1JA8A 2WAMA 1B04A 4B3MO 1XOUA 2Q9LA 3N2GB 1AJNA 2EULA 5EC2C 2VQEB 2ZT9B 4O4HA 3OR7C 5LL6Y 2NNUA 2WA3A 2RDCA 5B1BC 4RO2A 3PZCA 1N8RW 1FXKC 3BVOA 4YCVA 2DYSC 5LHHA 2P6JA 4JAUA 3MF2A 5DM6V 3CCEV 3JAMN 1ZX3A 2ODMA 3VOUA 1HP8A 1HC7A 1U96A 3J81N 1JPXA 2OTJV 3CE2A 1XL4A 4G28B 3H1HH 1XUQA 2QGNA 1M56B 3E8HA 4ASUG 3DTUB 1XNQO 4K3AA 1D5NA 1NYQA 2EIKC 2ZR3A 1PV0A 1I94B 2JEXA 1M1KW 1NTKH 2BOCC 4JI6O 1PYSB 3V8KA 1LYLA 2EIMB 1EQRA 2JGDB 4G2KA 5KLVH 4YRRA 5LMNO 2JJ1G 4LVMA 2IU0A 4OP0A 3FX7A 5LHIA 4JI1B 3ZEDA 4O4IA 1S5JA 1TUBB 3FAVA 2AZ0A 2Y0IA 3ASOC 4H2TA 1IBMB 1NYRA 1G6UA 2DQ3A 1RP3B 2DJZA 2XAQA 2EINC 3I56V 4QE9A 1M56C 3CCQV 3RACA 4Z2WA 2ZQMA 1J95A 2Q68A 2E1HA 1N32O 4DR1B 2EIMC 3EFSA 5LOVA 4JI7B 3STLC 4JI5O 3RIRA 2B1IA 1AJQA 4AQYB 4OXSA 4YY3O 2Z5UA 5FNVB 4J7ZA 4ZOLA 4DV3B 5HFLA 1WNSA 4LC1A 2PUSA 3CC7V 2DJVA 1CXZB 3V7RA 1HW7A 5IY5B 1NQTA 4TV9B 1TUEB 2UXDO 3K59A 1K5SA 4HWOA 4O4HB 4TUYB 5FPOA 4H02A 4JF3A 5JCOC 1NKDA 4MTFA 1K97A 1P4RA 2EJRA 3WG7C 4JI0B 4CH6A 5JH7A 4HVCA 5LP6C 3TXQA 5BY1A 3ZHTA 4UB6Z 2IJHA 1Q86W 1T5EA 3NELA 4FLTA 1OCZC 1DF5A 1H2KA 1NJ5A 1EFWA 4U3JA 2WLJA 2PZSA 3F5WC 4I5SA 5LMUO 3V7SA 3P30A 4EX5A 4WFBV 3JATA 1GM9A 1VF7A 4JYBA 3K9SA 2DWDC 1X4TA 4E4EA 1RSOB 4JI4B 5B1AC 5IY5C 3KKYA 4NB5A 4DUYB 4XTUA 1YTFD 1NZ6A 4TWKA 3ETGA 3M4QA 2QTSA 3W7WA 2ZM6B 1XREA 3CCVV 4NXNB 1BHAA 1GKFA 4LNUA 3IKMB 2B1GA 1L8DA 3RT3C 4U3FH 4X62O 1Y74A 1GGMA 4HWTA 4O4IB 3AG3B 3FAVB 3T1YB 3AK1A 2MW2B 5D5PA 3CX5F 4RAIA 4GZRB 2HHHO 4XDLA 3TXSA 2W6IG 4H13B 1V55B 3O65A 1JFFA 3JD1A 3UCSC 4AILC 4J10A 3BA9A 4O2AA 4YHHB 4YIPA 1RM1C 1VQ9V 3CSXA 4LFAB 4UV8A 1Z5WA 1G4YB 3MQZA 5LOVB 4LVIA 1PL0A 3A74A 5C52B 1EOVA 4X66B 1WPXA 1QR9A 2LP7A 3P3PA 3K57A 3HKCA 3RKWA 2X6AA 4I50B 1OZ0A 2E41A 5IYBO 4H2WA 1M90W 3NENA 2P4KA 3HTZA 4PDRA 5CBHA 2DW4A 4UB8Z 3OEEG 4FM2A 1MSDA 3CCMV 2HNIA 3OTFA 5E1AC 4PV1B 5JH7B 2R9IA 1I08A 2OIGA 2F1MA 1GO3F 1QLEB 5IJ9A 1YHQV 2UUBO 1Z2GA 4HWRA 5IYZA 4K88A 1E1OA 2QKAA 4DR5O 1LNQA 2ZTGA 2ZE5A 1R73A 4X65B 2BOBC 5K1PA 5KUMA 2RHSB 2WWWA 2OCHA 2WA4A 2ODRD 1MZFA 2YIAA 1Y76B 2Y4TA 1I94O 3JAKB 4NTWA 5JQGB 3KZIZ 3G4SV 1BCCH 1JX9A 4YDQA 2ALYA 1E1QG 4YRJA 1EIYA 3QNEA 1MNGA 4JI1O 2W6JG 2Q5HA 2RMKB 4QGPA 1QVGU 1HNWB 2F4VB 1WYDA 3JD3A 1FFXA 4J42A 4IT5A 1IBMO 3E9IA 4WI1A 3OFNG 4O2AB 3REXA 5JJJB 4DV6B 3HXYA 1X59A 3J80N 2KB1A 11ASA 5CMUA 3B4SA 2Q69A 3JARA 3ABTA 4I4TA 1E22A 1B8AA 1HNZB 4JI7O 2C2AA 3FKSG 4FLYA 2F66C 3HKCB 5ITZA 4NXMB 5HFMA 2YICA 2ODRC 4TVWA 1EZVH 3BCCH 1W2BU 3JSLA 1VQKV 3ICXA 1K33A 3D3IA 2FMLA 3GB7C 3E22A 1YI2V 2A3QA 3L72H 4J11A 3QF7A 3WB1A 1K5QA 1EVLA 5C93A 1CPYA 4P74C 4PA6A 3MHHC 5C8YA 2UUCB 2Q8VA 4ICGA 4X20A 2C8MA 4RUFA 3SJCC 3K5OA 2QTOA 3THOA 4LVLA 2OCCB 4JI8B 3CRMA 1MOFA 5B1NA 1GN3A 5H2FZ 1Z7NA 2ZT8A 2ZXWC 4LF5B 4DR3O 5CA1B 1BZKA 3LDDA 3LSUA 2QHSA 3RYCA 4UPAA 2BE3A 3A5ZA 4HNAA 3N2KA 2BTQB 5IJ0A 3M4PA 3T1HB 3D36C 4B3MB 1VQ4V 4WJ3M 2EBOA 4JGSA 4JI4O 4HBNA 1HWYA 2DYRB 3OMIB 2DTHA 1K73W 1EIYB 2ZM6O 2XNDG 3TEHA 5ELNA 4GLXA 2CUGA 1ASYA 5BR8O 3ZRSA 5TISZ 1FFXB 1OCCC 2GTSA 3FJPA 1E1TA 3JSNA 2DEQA 1OCOC 4P73C 1W0KG 4F6RA 1KP2A 3QVNA 4GYCB 3JARB 1KU9A 3FB8C 2E64A 4G84A 2DYRC 4I55A 2R9AA 3U10A 2HVKC 3E83A 1NNHA 4JZGA 1F51A 3AG2C 1Z5VA 3ABUA 3AG1C 3EFFK 5H6RA 1H8EG 3WB2A 3OMNB 4X66O 3LSSA 3QG5A 4H44B 2JDIG 5EZYA 2YIBA 3K5NA 1QF6A 3UM7A 4CS3A 3B2EE 2E5AA 1G5HA 4ZI7B 4WF2A 1KUQA 1YSCA 3F7YC 2ZNJA 3TEGA 2EILB 1R3KC 4Z1VA 5C8YB 1VF6A 4K8ZA 4YCUA 1QCEA 2VRZA 1FJGB 1K3EA 3A7UA 1M57B 5EYPA 1XL6A 1N32B 4JTDB 4LFCO 1L0LH 3OMAB 1DGSA 2XASA 4KXRA 4YJ2B 5H6QA 4JI5B 1FXKA 5EBMC 4BIZA 3P32A 1SRYA 4TV8B 3RYCB 4X65O 4HNAB 3N2KB 5IJ0B 3M99B 3DSQA 3ABKB 3STZC 1QHTA 4P75C 2ZE6A 4NR1A 1IBKB 2Y4UA 3KFUA 3QO5A 3ABLB 3CD6V 4TVAB 4RUEA 3HKDB 4XTWA 2GHYA 3W7XA 3N2GA 3TEHB 2CGOA 4DPGA 2KG7B 1IDSA 4UUJC 1BL8A 1M57C 4MVZA 3VQXA 1S5HC 1G8MA 1ATIA 3K58A 3A8TA 2LO1A 2I4MA 2JEUA 3CXHF 2YXYA 5B1OA 5IT9N 3BABA 3OT7A 4PHCA 1S72V 2QHTA 5LMUB 4GT1A 1GMGA 4DW1A 5KA6A 1KMIZ 5L3DA 3OR6C 2VQFO 1MMMA 1WQWA 2RQ6A 2UXCB 1VEWA 4DV6O 1AB3A 3OGIB 3TK1A 4YRLA 4L87A 2DKGA 3K0GA 1N4CA 3QO7A 4I55B 1Q8IA 3BA8A 4O2BA 1N0NA 3ABMB 2LGQA 1P7GA 1PYSA 4U7OA 4X1IA 1B06A 4Z1MG 2AXTZ 3B77A 3P8VA 1HNZO 3K79A 2QKSA 2NS6A 1K7DA 1RIQA 4X62B 5CA3A 1R6NA 2B9ZA 2EAYA 2GUZA 2LW7A 3FB5C 3SPJA 2PI4A 2C7IA 3CMAV 3HXUA 3IALA 5C53B 5B3SC 3P8TA 3RN4A 4R8CA 2ETNA 5AG2A 4YRQA 1BS3A 2YUAA 4NYKA 3CMEV 4WF9V 5JCOA 2UXBB 2X6BA 5B1BB 3HKEB 4EFBA 1UPGA 3ABMC 2O57A 1IZ3A 5LP6A 1FXKB 2DYSB 1PL4A 3N27A 2WPDG 4ZHQA 5EIBD 4UP9A 4H0LB 1QBZA 2Y69C 3CCLV 1D2DA 3MF1A 2JS5A 1V9PA 3BFMA 2ZIMA 3AK2A 2JRIA 2EZOA 3T4ZA 1D5AA 3SPGA 2EIKB 2QDOA 4UCVA 3T1HO 3C90A 4J41A 5L3EA 1XBLA 4K35A 2YSUB 2GBOA 2R9RB 3JD0A 5K1XA 4K87A 4TV9A 2J3MA 3MD0A 4TUYA 2IJJA 1IBLB 2YIDA 2E74B 4MTXA 1JJCA 1EFRG 2UUBB 3QO8A 2QWNB 2K9PA 2HKOA 4MVQA 4DR5B 1VQ5V 3ASOB 2KSDA 3CEIA 4MTOA 4R50A 1WA8B 4K8XA 3AG4C 2EINB 3RVYA 4GX1A 3OAAG 3U0ZA 4J7KA 4O2BB 3G6EV 1VF5B 2CE4A 1EN4A 4X1IB 1RSOA 5KHHA 2FYUH 4XU3A 1NJ1A 5EIBC 1O9GA 2DMXA 4AI8A 1N0JA 1SS3A 4FVMA 4O4JA 5CB4A 4TQDA 2GUZB 1TA8A 2E3CA 2V1DA 1IL2A 3RKYA 2WLNA 3SPCA 3OD1A 2PMEA 1ZSPA 5KMGB 4B3RB 2EWNA 2AW9A 3OGCC 1TGOA 2QWQB 4F6EA 3WG7B 1FJGO 5H9CA 5LP6B 2Q5ZA 3CMQA 1RPOA 5DECA 2DXTA 1Q5OA 4PD4F 5KUKA 2K1EA 1BHBA 3WB0A 1OCZB 4ZHQB 1KKDA 4XDJA 1R6TA 1NJIW 4DR6B 4JYYA 1JR9A 3EXAA 2H94A 1SQPH 2CJBA 3NR7A 4EO4A 4I50A 2DXUA 5LXTB 2ZXFA 1K34A 2DU7A 4YCWA 4H2VA 3MAQA 4ZBMA 4J7JA 1OJHA 3CYOA 1IBKO 1YZBA 5B1AB 4D7TA 4UCOA 3G6BA 4UV9A 2HR3A 4PELA 4IYIA 3AG7A 4B08A 3RBZA 3JALA 1JJCB 3ZHVA 1FYFA 2F93B 4H2YA 3A0BZ 1M5IA 4DV4B 1EM1A 4DR3B 1BSMA 2JK5C 5IE9A 2UXCO 4RDXA 4TSFG 4I7ZB 1B6QA 2WLLA 3TGUH 2RHSA 4YRFA 1WN7A 1RM1B 2IY5A 1XMOB 1Y76A 4DV1O 1KQSU 2YC0A 2Y48A 3ZRXA 2YXHA 3K04A 3JAKA 1KB9F 1S77D 1HXDA 5JQGA 3NEMA 2XUMA 4BW5A 4O4JB 5CB4B 3V7CA 1P49A 5BR8B 2CTWA 2OIEA 1WPBA 3ZRWB 4DV2O 2XHBA 2H3OA 1R3LC 2A79B 4Q6GA 1WB8A 1YTFB 4EB6B 4P72C 1QE0A 2ZIOA 4FMTA 2HJFC 1SQXH 4P74A 3QTCA 1R6KA 2HVJC 1WP8A 3MDSA 2DOSA 3L9DA 3F7VC 2UU9O 4JYCA 4P9PA 2QHVA 2UXBO 4YREA 3HFZB 2AHZA 4XU0A 2JJ2G 1SF9A 1FS0G 1PP9H 1VMGA 1FD9A 3HKBA 4K0KB 4HWPA 3ZMSA 1KBHA 5LGUA 3E2EA 4CC5A 3OEHG 2ZKOA 4FLWA 1YDXA 3RUXA 4PG3A 3ETQA 4CS4A 3D36A 4RMFA 3L71H 2RHQB 2IJKA 4YRSA 2RJZA 3JALB 2E5LO 1BE3H 4MSWC 5FLXN 1IBLO 4LFCB 2NLJC 4PI2A 2W0FC 2FYKA 4LH7A 1E1RG 2ITCC 3PN1A 2YEVA 4LH6A 4H33A 4XDKA 1YJWV 4J9ZB 2WLLB 4XBFA 5CA1A 5EC1C 5KAIZ 3RFRA 4Q20A 4UFZA 2IY5B 4WFAV 4PDLA 3ZMVA 1GM8A 2BTQA 3LNNA 4IIJB 4HAMA 2CJ9A 2ARHA 3H1JH 3SYQA 2ZINA 2UXNA 3FB7C 1MA1A 3JD4A 4FPPA 4D6TH 1N34O 4YIOA 1MABG 4GKKB 2WLIB 4JZ2A 1MG1A 1R3IC 2GSMB 3P8YA 2Q0OC 3HXZA 2WLHA 5LA6B 3RVZA 3G71V 2R70A 2VQFB 4MS2A 1PM9A 4YRGA 4B3RO 2EJFA 3SJBC 5LGNA 2I4OA 4XEOA 3JD2A 3K9AA 5DEDA 1COWG 1THZA 1GTOA 2JS3A 1OV9A 4QPJA 4AH6A 4P3NA 1IXBA 4ABMA 3HKBB 1PNKA 3CRQA 3OM3B 3KCXA 4BR6A 2P4VA 2QR4A 1SESA 4DR4O 2ITDC 4DR6O 4YP0A 2ZXWB 4NTXA 4LR3A 2WSSG 2QM7A 1G1XB 3BY6A 1YB3A 4X1YA 2P06A 3IKLA 4ZI7A 1YGBA 3LNMB 4YRKA 4PDMA 4P75A 3PCOB 3DXRA 4CS2A 5F2VO 1B3QA 3F5TA 4WFHA 4K86A 4R6ZA 1H4VB 5GW7A 2CTPA 3JYCA 3DC6A 4Q15A 4KFMA 5KNNA 3IJ4A 1L1FA 1OCCB 2YEVB 2OT5A 4DV4O 3H1IH 5CBGA 4YJ2A 3B09A 3X2QC 1EZJA 4TV8A 1X55A 5GTHZ 4DXWA 3R07A 1OCOB 1M9NA 1K8AW 1J5EB 1Q81W 3V8LA 1O9HA 4NVPA 2D3OW 5CBFA 1FKAO 5KHGA 2D2CB 3SPHA 1XMOO 3RW0A 3LSQA 2EIJC 4LCUC 4B3TO 1YITV 3K03A 3AG2B 3AG1B 4BW9A 1G51A 3V8JA 4TVAA 3HKDA 4X64B 3FD9A 4LF4B 3L4GA 5EBWC 1K4CC 2KG7A 3E86A 2FTKA 2VWJA 3BFRA 3ETEA 2QKCA 1S0VA 3SGIA 5L3GA 3TCUA 1KECA 2A0LA 5E3IA 3WQZA 2A7WA 5L3BA 1W66A 3L1AA 2CGHA 4FFBA 2OWOA 3GVMA 3UT5B 1WAZA 1NH2D 2P5OA 1F4NA 1JOYA 4FM0A 1QVFU 5CA0A 4R7CA 4H2XB 3HXWA 1ZL8A 1OCRC 3HR0A 4DYLA 4KR3A 1K4DC 1AR4A 4J80A 3I7FA 1Y67A 2AGAA 4YRCA 2ZD9A 2IJIA 1KOGA 1WJZA 4K0KO 3CCSV 2E65A 4UCUA 3SPIA 5BXZA 2RNBA 1VQ6V 4MTGA 3EHBB 3CRAA 3ZRVA 4X1YB 1DK1A 3H9VA 4IGGA 2OTLV 1G5IA 1H2LA 1ZAUA 4X8AA 2ZT5A 1YVWA 1U97A 3IG2A 3MHSC 3DXRB 1Q3EA 5IWAO 4FM1A 4AHCA 1NR1A 3RYIB 3ZJZA 3HXXA 4XU2A 3BEHA 3HPLC 4RQFA 2CIMA 3GWKC 1DTOA 2RN9A 1BMFG 2P22C 2WLKA 1V54C 4KUMA 5IDJA 3BRCA 2YI9A 2PYLA 3HKEA 1SQFA 4DR2B 1HDJA 4X1KA 1GN4A 2CDYA 1I5YA 4GCZA 4OPHA 2XOKG 4MVSA 1L0NH 4LP8A 1YJNV 4O4LB 1R1BA 2AZ2A 3ICAA 1NTZH 4WCEV 3JCZA 2XGTA 1ADYA 3A32A 4DK1A 4YYEA 5J2UA 3A7RA 1FPOA 4G85A 3L73H 3K06A 2ZZEA 4LVJA 3A0RA 1W0JG 3BHPA 5FL7G 4WFEA 3L4GB 4J15A 2LGWA 2CH7A 3JASB 1NTMH 2OYQA 1AR5A 3DGEA 1YJ9V 4GKKO 3E89A 5KX5A 4DUZB 4FLZA 4P2ZA 1PPJH 4FFBB 3HXVA 1HNXO 4PHZA 3APOA 4BAYA 1Q82W 5CA0B 3CCJV 4U7NA 1GN6A 1ROPA 1WA8A 3UH0A 3CCRV 3ZHRA 5B3SB 1DLBA 1ZL8B 3CCUV 1YF2A 5KAFZ 1ZUQA 3E35A 4DV1B 1SC5B 4CC6A 2RCVA 3PJSK 2Q7EA 4CZZA 3A31A 2V4DA 1Z7MA 1N36B 4JV5O 4KHPB 4LFBO 2QM8A 1NVPD 2PMFA 4NTYA 4BIOA 3AK3A 3A5YA 2Y69B 1NJ8A 5GONB 1ENVA 4DV2B 2A8EA 2JGUA 3TUPA 3OD4A 1VARA 4MW8A 2E76B 3OW2U 2QWOB 1P7BA 5KMGA 4XTXA 2NN4A 3G80A 1US6A 4YJ3B 1MSWD 4JTAB 2UU9B 4YPFA 5JWPA 1PKXA 1X2GA 2LFRA 1GN2A 1OHHG 2Q7HA 4X1KB 2F95B 2ZZFA 4P71C 4LBEC 5B66Z 3LC0A 4PA9A 2JIZG 2X7RB 5A9GA 4UVCA 5LYJB 2V7QG 2GV9A 3AG4B 1J5EO 3ZIAG 4X5OA 4PA4A 1HR0B 2LFSA 2KQXA 5J2UB 5LXTA 3I5DA 4QE7A 2IH3C 2FL4A 5J9PC 3CC2V 2ZT7A 1N33B 5GTIZ 1WP7A 2CK3G 2CH7B 1JMKC 1XHZA 2E5LB 1NT2B 1PD3A 4X64O 1P84F 3GWOA 4LF4O 5KX5B 3CC4V 1LUVA 2ADPA 1E79G 1VF6C 2ZDIC 3M7MX 2Q4PA 2P0LA 3EVKA 1RFYA 1VQ8V 4EEQA 3ZX6A 4TOIA 1BBWA 4P72A 4UVAA 4O2DA 3SYPA 1PNLA 2PYJA 2EZPA 3IC9A 3E9HA 3HRKA 2CTQA 4X89A 2Q7GA 1TVKB 5HGQA 4DR7B 3UFGA 4YRNA 3UQ8A 4HA8A 2CTRA 2E10A 2BSKA 5EK0A 1N34B 4OX9B 4FLUA 2H8PC 3RKXA 1ZTEA 4TQFA 2QJ1A 5LBQA 3ZRWA 1NJ6A 4KL1A 2ZCEA 1AI7A 3OUFA 4DW0A 2AMCB 4WBNB 4EB6A 4YRTA 1WQ7A 1AROP 3Q4HB 3ZMUA 2QWPB 2WLMA 2CGNA 3D3QA 1ASZA 3IGAC 2HP8A 5JJEB 1NS1A 4PI0A 3OTOB 3W7TA 1B7YA 2LW1A 3HFZA 4ZKIA 4DR2O 1XNRO 2LJ2A 4DR4B 4TTVA 5D5QA 1A32A 4YROA 4PJ0Z 2HJDA 3ERRA 1XILA 3LUTB 4OLFA 3VQVA 2ILMA 4KQEA 3B40A 2HEPA 4FIPC 5A2QN 1KD1W 1X01A 3AEIA 2RHQA 2BTOA 1GM7A 4EKWA 2DWEC 2N74A 4UP8A 1WLEA 4DUZO 1GRJA 2DDZA 5IYCO 4E51A 4DV5O 4ZTUB 3RF1A 2IW5A 4MVRA 4UP7A 1IVSA 1SKVA 4DV0B 4B3SB 1SETA 3ZHSA 3JAWA 3CRRA 4QIWF 1NI8A 4MT8A 1Y66A 2AKWA 4QPKA 1RPRA 1BQ0A 4G27B 1ZWIC 5H5NA 3E8FA 3RGBA 5KA5A 4IIJA 2A9HA 3DC5A 1I5XA 4B3TB 3ZBHA 1BQZA 1Y6XA 4H2UA 2BSKB 5FPRA 4CH4A 3RYHA 1USYC 3D8CA 1N36O 4KHPO 2HLDG 4UCRA 4I9QA 1SA0A 3VQWA 3RL6A 5E79Z 3RYFA 4LF9B 4FZ1A 2WLIA 3A2FA 1XI1A 1C0AA 4DO2A 5KHKA 1M93A 3ZHUA 3HY0A 4YRPA 3C3TA 5LA6A 1SQBH 3HB3B 4WFGA 1I7FA 2PF4E 4XTYA 3ZMTA 4GKJB 3ZN1A 2M6YA 4B7KA 3B8MA 12ASA 1S3JA 1M4UA 4LNSA 4CH3A 2UUAO 1Q7YW 1B7YB 4JI2O 2EX3A 4X88A 1XQ8A 4BWAA 2L6LA 4XTZA 5JVDA 4P30A 1XHXA 3CPWU 3UGTA 3IC7A 4C7UA 1UJWB 3T2MA 1FAFA 1JCHA 3SDLA 3HRIA 2ZT6A 4TWAA 2DU5A 1E24A 1BBUA 3CP1A 2I4LA 3SYCA 1HR0O 3CB2A 2QM4A 2XAJA 2DN9A 5IWAB 3RGLA 3EFRA 3K08A 2FB5A 3CHXA 1N33O 2YI8A 1FXHA 3PCOA 1PNMA 1VQNV 4P9OA 3I55V 4ZOLB 2Q0AA 2ZZGA 3AG3C 3CJHA 3OUSA 3S3WA 3LDEA 3C3SA 1XMQB 4CBCA 5B5EZ 1V55C 2CAZC 1YIJV 1ZLZA 1LUWA 2HFEC 3JAWB 4F4LA 5IYDO 4IYHA 2AKWB 4B7EA 2EJ9A 3KG2A 2VQEO 1QU7A 4DK0A 1S76D 1QLNA 4P73A 5LHGA 2XTIA 3NETA 4PA3A 3A0HZ 4U3JB 4WJ4A 2ARTA 2Q6AA 4FLXA 1ORQC 3RYHB 3ZMZA 4DR7O 3UGQA 3K5MA 3JATB 1SA0B 2ARSA 1H2SB 1FXVA 2UXXA 3ZCCA 4OX9O 1J5WA 3RYFB 1SERA 2G4CA 2IU3A 5KHIA 1B76A 4LF8B 4TT3G 4OGQB 4OPAA 2LQTA 1AJPA 4JAAA 1YFTA 1HNXB 1B70A 4KR2A 4LNUB 1EN6A 1K92A 3P3NA 3UT5A 4JASA 3FB6C 2IM9A 1Y74B 2QA4V 1JJ2U 1DF4A 1QLEC 2AHYA 3IFXA 4H2XA 5JVDB 2QHUA 4ZIBA 3OTOO 3LDCA 4QNHB 4JI3B 5L3CA 4LF6B 1IXMA 3SR2C 1JFFB 4DV7B 4JV5B 4LFBB 1F23A 2ZNIA 2N05A 3K5LA 1SQQH 4UVBA 3X2QB 3T1CA 3E8BA 4I0XA 2PI5A 4DRXA 1FFTB 1WB7A 1QQCA 1URFA 3CS5A 4JYAB 1S5LZ 1N9WA 1YFSA 4DR1O 4I9WA 2EJGA 1YEWA 2VWKA 2EIJB 3A7AA 1F4MA 4IHJA 1AR1B 1KMNA 1EBOA 1AI5A 4AQYO 1F7YA 3RYIA 1SQGA 3BPZA 4PDVA 4CH5A 3CJHB 2KKWA 2GDSA 4DV3O 4D7SA 1H4TA 4QJFB 4JAVA 1GK9A 3ASNB 4RWUA 4LF7B 2J3LA 1KYOF 1YCIA 5BMVA 4DV0O 2FKXA 2XAGA 3KCYA 4B3SO 1GH6A 1TAEA 5BZBA 5EBLC 4JI0O 3ETDA 2XTAA 5ELOA 2DTOA 5IJ9B 4O4LA 2CJAA 3HFVA 1H4QA 1H4SA 5IYZB 1YFRA 1OCRB 3FFQA 4NKGB 4YXWG 1Q43A 1I0HA 1R3JC 4MVOA 2EL9A 1VQOV 2EJ7A 4XTVA 3HY1A 3H1KH 3FYIB 4EFEA 4YRMA 3T4DA 2XAHA 3K3WA 2DE0X 3W3SA 3JASA 1NU1H 3O9OA 3OE7G 1XEQA 1LR1A 3ASNC 3CXCU 3ZHQA 4LF9O 4H2SA 1B70B 4H37A 4DUYO 3L74H 1VQ7V 2VS0A 2ALYB 1VQZA 5LGTA 2PY5A 2Z0AA 4NXNO 3H01A 4GKJO 5J2TA 2OCCC 3SYAA 1H2GA 3BJUA 3G67A 2Y0PA 1V54B 3VQYA 3T1YO 4IL6Z 1SQVH 2DTIA 4TVYA 1VIBA 1WPYA 2ATKC 2Q73A 4P71A 2HG5C 3CWBH 1NH2B 4I0XB 2Z3YA 2ZE8A 4P3OA 4DRXB 4YHHO 1XNQB 4XEMA 3UO3A 1KMMA 5GONA 1CP9A 4LFAO 2ADQB 4I4TB 3SJQC 4MVUA 4JI6B 1QR8A 1BIAA 4P3PA 4IHJB 3U11A 2QE7G 5ITZB 1EVKA 1HTTA 5LMNB 1KC8W 2QSAA 2YDEA 4FFKA 1X54A 3ML0A 4RQEA 5KHJA 1BT8A 4YJ3A 4LVKA 1XDCA 1NJ2A 3E22B 4J9YB 1Q6HA 2DZCA 3WFVA 2F23A 4W4LA 1X56A 1XMQO 2IBZH 1H38A 1XNRB 5BMVB 4HT4A 4N23A 3BAAA 2ZDIA 4KP4A 1NBMG 1CEZA 4X20B 2M7WA 5LYJA 1MZEA 3TJTA 3RWRD 4E2LA 2F43G 4GX5A 4XU1A 1AI4A
chains in the Genus database with same CATH topology
2A79B 4Q6GA 1BBWA 4GX0A 5CN0A 1X2HA 4UVAA 2ODRC 4O2DA 3SYPA 4P72A 4TVWA 1PNLA 1YTFB 2EZPA 1W2BU 3E9HA 1JVMA 1VQKV 2QEXV 4P72C 1K33A 4BIUA 4FMTA 3D3IA 4JPRA 1QE0A 3GB7C 2ZIOA 3HRKA 2HJFC 4MW3A 4P74A 3QTCA 1YI2V 1R6KA 4X89A 2HVJC 2Q7GA 2ARUA 5HGQA 1K5QA 1EVLA 3F7VC 5C93A 1CPYA 4JYCA 4P74C 4P9PA 3UFGA 2P7TC 2QHVA 4YRNA 4HWSA 4PA6A 4HA8A 3MHHC 2E10A 4YREA 3R65A 5EK0A 3HFZB 2EILC 2AHZA 2XAFA 2Q5IA 2C8MA 4XU0A 2H8PC 2JJ2G 1FS0G 1NR7A 3VBBA 4RUFA 2DZ9A 2QTOA 3RKXA 4LVLA 2Q67A 4HZ3A 2OCCB 4TQFA 2ZR2A 4WFFA 3TETA 2DQ0A 1MOFA 4JTCB 1ADJA 4HWPA 5LBQA 4FK5C 3ZMSA 5C51B 3ZRWA 2DVEA 1NJ6A 2ZCEA 5B1NA 1Z7NA 1AI7A 3OUFA 4MVMA 5LGUA 3E2EA 2AMCB 2ZT8A 3OEHG 2ZXWC 1SZTA 4YRTA 1WQ7A 1AROP 3RUXA 3LDDA 2QHSA 3ZMUA 4PG3A 4UPAA 2WLMA 1VQLV 3A5ZA 1ASZA 4CS4A 3D36A 3IGAC 4RMFA 2RHQB 4YRSA 2B5UA 2IJKA 3M4PA 1Y4MA 1VQ4V 4HYOA 4MSWC 3W7TA 1B7YA 2EBOA 4JGSA 3HFZA 4ZKIA 1WNLA 1HWYA 5F5WA 4WJ3M 2DYRB 3OMIB 2DTHA 4YRIA 1K73W 3ABKC 4DQ2A 2ZGWA 1EIYB 4PA7A 2NLJC 4TTVA 2XNDG 4YROA 3TEHA 3K0DA 5ELNA 2W0FC 2FYKA 3ABLC 3ERRA 3NXSA 1E1RG 3LUTB 2ITCC 1ASYA 2YEVA 2AMCA 2P67A 3ZRSA 4H33A 4XDKA 4OLFA 1YJWV 2I4NA 3VQVA 5DN6G 4J9ZB 1H8HG 2WLLB 1OCCC 4XBFA 4KQEA 1NVPB 5EC1C 1VQPV 3ZN0A 4Q20A 3FJPA 2IY5B 4FIPC 4WFAV 3SYOA 5L3FA 1KD1W 4PDLA 1E1TA 1WU7A 3ZMVA 4NCXA 1X01A 1GM8A 2X6CA 3AEIA 4GX2A 2RHQA 2DEQA 4HAMA 2CJ9A 1GM7A 1OCOC 2IH1C 4EKWA 3G1ZA 4P73C 3SYQA 1W0KG 2ZINA 2X0LA 1K9MW 2DWEC 3E8GA 4UP8A 1KP2A 2UXNA 4G84A 1WLEA 3FB8C 3FB7C 2E64A 2DYRC 3JD4A 2DDZA 4FPPA 5IYCO 4E51A 4ZTUB 1BIBA 3RF1A 2IW5A 2HVKC 1L0WA 3E83A 1NNHA 4MVRA 4UP7A 3AG2C 3AG1C 1F51A 1KP3A 1MABG 3ABUA 4FJCC 3UKMA 2P90A 3MEYA 3REUA 2WLIB 3EFFK 5H6RA 1H8EG 1MG1A 3OMNB 3B8NA 1R3IC 1SETA 2GSMB 1JQ0A 3FYEB 3LSSA 3P8YA 3HXZA 2WLHA 4QIWF 1VQMV 2JDIG 4MT8A 1Y66A 2AKWA 3W7UA 3RVZA 4QPKA 3G71V 1RPRA 3UM7A 4CS3A 1QF6A 4G27B 4MS2A 2P5IA 2E5AA 1G5HA 1ZWIC 4YRGA 2MK3A 1AI6A 2EJFA 3E8FA 4WF2A 5LGNA 1YSCA 3F7YC 5KA5A 2ZNJA 2I4OA 2EILB 3TEGA 4N21A 2A9HA 1R3KC 1USYA 4XEOA 1I5XA 4UXNA 3JD2A 3W7SA 4H2UA 3K9AA 1COWG 1THZA 1USYC 3L2ZA 4CH4A 2WAMA 1GTOA 4YCUA 1QCEA 2HLDG 4QPJA 4P3NA 4AH6A 1PNKA 3VQWA 3OM3B 1K3EA 3RL6A 3A7UA 1M57B 1SESA 2ITDC 1XL6A 1KOGA 4YP0A 1AJNA 4JTDB 2ZXWB 5EC2C 2WLIA 3OMAB 1C0AA 2WSSG 4DO2A 2QM7A 2XASA 3OR7C 5H6QA 1FXKA 2NNUA 5EBMC 5B1BC 4RO2A 4BIZA 3HY0A 3PZCA 3BY6A 1N8RW 4YRPA 1YB3A 3HB3B 4WFGA 1FXKC 4XTYA 3P32A 1SRYA 2DYSC 3ZMTA 5LHHA 2P6JA 4JAUA 3MF2A 5DM6V 3ZN1A 3IKLA 4BW9A 1YGBA 3LNMB 3CCEV 3B8MA 12ASA 1S3JA 3VOUA 3M99B 4YRKA 4PDMA 3DSQA 4P75A 3PCOB 1HC7A 4LNSA 4CH3A 4CS2A 1Q7YW 1JPXA 1B7YB 4WFHA 3ABKB 2OTJV 1XL4A 4X88A 3STZC 4G28B 4P75C 4K86A 4BWAA 4R6ZA 4XTZA 1M56B 3E8HA 4P30A 5GW7A 4ASUG 1H4VB 3DTUB 3JYCA 3CPWU 3KFUA 3QO5A 3ABLB 1NYQA 2EIKC 4Q15A 3CD6V 2ZR3A 3IC7A 4KFMA 4TVAB 3UGTA 4RUEA 3TEHB 1UJWB 2GHYA 2JEXA 3T2MA 3W7XA 4XTWA 1M1KW 1JCHA 2BOCC 1L1FA 1PYSB 4DPGA 3HRIA 3V8KA 1OCCB 1BL8A 1M57C 4MVZA 2YEVB 1S5HC 2OT5A 4UUJC 5CBGA 2EIMB 1EQRA 1LYLA 4TWAA 4G2KA 1G8MA 1ATIA 2DU5A 4YRRA 1E24A 1BBUA 3CP1A 2I4LA 2I4MA 3SYCA 3X2QC 2JEUA 4PHCA 1EZJA 2JJ1G 5B1OA 4LVMA 1S72V 2QHTA 2XAJA 1X55A 4DXWA 2IU0A 4GT1A 1GMGA 3R07A 1OCOB 4OP0A 1M9NA 5KA6A 1K8AW 3EFRA 5L3DA 5LHIA 1Q81W 3RGLA 3K08A 3V8LA 3OR6C 2D3OW 5CBFA 1FXHA 1WQWA 3PCOA 3SPHA 3RW0A 1PNMA 1VQNV 3ASOC 4P9OA 3LSQA 3I55V 2EIJC 2ZZGA 3AG3C 4H2TA 4LCUC 1NYRA 3TK1A 4YRLA 4L87A 1YITV 3K03A 3AG2B 2DQ3A 3AG1B 3K0GA 1G51A 3QO7A 2DKGA 2DJZA 3V8JA 2XAQA 2EINC 3I56V 4QE9A 1M56C 4TVAA 3OUSA 3LDEA 3ABMB 3CCQV 3L4GA 5EBWC 3RACA 4CBCA 1K4CC 4U7OA 3E86A 4Z1MG 1V55C 2FTKA 3B77A 2ZQMA 1YIJV 1PYSA 3P8VA 3ETEA 1J95A 2Q68A 3K79A 2HFEC 5L3GA 2QKSA 1S0VA 3TCUA 1KECA 2A0LA 2E1HA 4F4LA 2NS6A 5IYDO 2AKWB 5E3IA 1K7DA 3WQZA 1RIQA 2EIMC 3KG2A 2EJ9A 5CA3A 5L3BA 1W66A 3EFSA 2CGHA 3L1AA 3STLC 1S76D 1QLNA 1R6NA 2B1IA 1AJQA 4P73A 5LHGA 3RIRA 1NH2D 2EAYA 2XTIA 1F4NA 1JOYA 4OXSA 4PA3A 3NETA 1QVFU 4WJ4A 3FB5C 2ARTA 2Q6AA 1ORQC 2Z5UA 3SPJA 4R7CA 2PI4A 3ZMZA 5HFLA 2C7IA 4LC1A 4H2XB 3HXWA 3UGQA 3CMAV 1OCRC 4KR3A 3CC7V 1K4DC 3HXUA 2ARSA 3IALA 5C53B 1FXVA 2UXXA 5B3SC 3ZCCA 1J5WA 3P8TA 3V7RA 3I7FA 4R8CA 1SERA 2G4CA 4YRCA 2IU3A 5IY5B 1B76A 4YRQA 1NQTA 2IJIA 1TUEB 2ZD9A 3CMEV 4TT3G 4WF9V 1K5SA 2X6BA 5B1BB 3CCSV 4HWOA 3ABMC 4H02A 2E65A 3SPIA 4JF3A 1AJPA 1FXKB 1NKDA 2DYSB 1K97A 1P4RA 2EJRA 4MTFA 3WG7C 1VQ6V 1B70A 4MTGA 2WPDG 3EHBB 1YFTA 4CH6A 4KR2A 4HVCA 3ZRVA 2ZT6A 1Q86W 3NELA 2IJHA 4J15A 4UP9A 1QBZA 1K92A 2OTLV 4JASA 2Y69C 1G5IA 3FB6C 4X8AA 1OCZC 3CCLV 2ZT5A 3IG2A 1DF5A 1NJ5A 3MF1A 1EFWA 3MHSC 2WLJA 2QA4V 3F5WC 4I5SA 2ZIMA 1JJ2U 3BFMA 3P30A 1DF4A 3V7SA 2EZOA 4EX5A 4WFBV 1QLEC 2AHYA 3T4ZA 3IFXA 5KNNA 3SPGA 2EIKB 1NR1A 3ZJZA 4H2XA 2QHUA 3HXXA 4ZTZB 4XU2A 4ZIBA 3BEHA 3HPLC 5L3EA 1GM9A 3LDCA 4QNHB 1DTOA 4RQFA 2CIMA 5L3CA 4JYBA 2DWDC 1BMFG 1IXMA 2WLKA 2R9RB 2YSUB 1V54C 3JD0A 4KUMA 5IDJA 4K87A 5K1XA 2J3MA 1F23A 2ZNIA 3MD0A 2IJJA 4UVBA 5B1AC 3X2QB 3T1CA 3E8BA 5IY5C 4XTUA 1YTFD 2PI5A 4TWKA 3ETGA 3M4QA 1FFTB 4MTXA 3W7WA 1I5YA 4GCZA 1JJCA 1EFRG 2XOKG 4MVSA 3CCVV 1BHAA 1GKFA 1N9WA 3QO8A 1YFSA 3IKMB 4LP8A 2B1GA 1YJNV 4I9WA 2EJGA 2HKOA 4MVQA 1VQ5V 3ASOB 1GGMA 2EIJB 3ICAA 3AG3B 4HWTA 3A7AA 4MTOA 1F4MA 1AR1B 4WCEV 3JCZA 1KMNA 1EBOA 1AI5A 4R50A 1ADYA 2XGTA 3AG4C 4RAIA 2EINB 3RVYA 3A32A 4YYEA 4GX1A 4PDVA 4XDLA 3OAAG 3A7RA 4G85A 4YCVA 4CH5A 2W6IG 3K06A 2ZZEA 4LVJA 1V55B 3A0RA 1W0JG 4WFEA 5FL7G 3JD1A 4QJFB 3G6EV 1H4TA 4JAVA 3L4GB 1GK9A 3ASNB 1RM1C 4XU3A 3DGEA 1YJ9V 1VQ9V 1NJ1A 2J3LA 3E89A 2XAGA 4UV8A 1G4YB 3MQZA 4LVIA 1PL0A 4P2ZA 5BZBA 3A74A 3HXVA 5EBLC 5C52B 3ETDA 4TQDA 5ELOA 2DTOA 1EOVA 4BAYA 1WPXA 1Q82W 2CJAA 1QR9A 2V1DA 2LP7A 2E3CA 3CCJV 3HFVA 4H2SA 1H4QA 1H4SA 1IL2A 4U7NA 1YFRA 3RKYA 1OCRB 1ROPA 2WLNA 3RKWA 3UH0A 3CCRV 3SPCA 2X6AA 3OD1A 4YXWG 1R3JC 1DLBA 4MVOA 5B3SB 3CCUV 2EL9A 2PMEA 1VQOV 4XTVA 1OZ0A 2E41A 5IYBO 2EWNA 4H2WA 3E35A 3HY1A 1M90W 3NENA 3HTZA 3FYIB 3OGCC 4YRMA 3T4DA 2XAHA 3K3WA 4PDRA 5CBHA 3W3SA 3PJSK 2Q7EA 2DW4A 3WG7B 5H9CA 3OE7G 4CZZA 3A31A 1Z7MA 3ASNC 3CXCU 3OEEG 3CCMV 3CMQA 1RPOA 2QM8A 1B70B 1NVPD 5KUKA 4H37A 5E1AC 2K1EA 1BHBA 2DXTA 2R9IA 2HNIA 2PMFA 3A5YA 2Y69B 1NJ8A 1OCZB 1KKDA 1VQ7V 4XDJA 2ALYB 1ENVA 1NJIW 1GO3F 1VQZA 5LGTA 2A8EA 3TUPA 1QLEB 1YHQV 4HWRA 3H01A 4MW8A 4K88A 1E1OA 2H94A 2OCCC 3SYAA 1H2GA 3OW2U 2CJBA 1LNQA 2ZTGA 3BJUA 1P7BA 4EO4A 1R73A 1V54B 2DXUA 2ZXFA 4XTXA 1K34A 2DU7A 2BOBC 4YCWA 4H2VA 5KUMA 4ZBMA 2RHSB 3VQYA 5K1PA 2WWWA 1MSWD 3CYOA 4JTAB 2DTIA 4TVYA 4YPFA 5B1AB 2ODRD 4UV9A 1PKXA 1WPYA 2ATKC 2HR3A 1X2GA 2LFRA 1OHHG 2HG5C 4P71A 1NH2B 4PELA 2Z3YA 2Q7HA 2ZZFA 4P3OA 4P71C 4LBEC 3RBZA 3LC0A 4PA9A 2JIZG 1JJCB 4XEMA 3VQXA 1FYFA 3G4SV 1KMMA 1JX9A 2X7RB 4H2YA 4YDQA 1CP9A 4UVCA 2ALYA 1E1QG 4YRJA 3SJQC 4MVUA 2V7QG 1EIYA 1QR8A 3QNEA 1BIAA 4P3PA 3AG4B 2QE7G 3ZIAG 4X5OA 1EVKA 4PA4A 2W6JG 1HTTA 2JK5C 2LFSA 1KC8W 2Q5HA 4RDXA 4TSFG 1QVGU 1WYDA 1X54A 3ML0A 4RQEA 1B6QA 2WLLA 3JD3A 4QE7A 2IH3C 2RHSA 4YRFA 5J9PC 3E9IA 3CC2V 2ZT7A 4LVKA 1RM1B 2IY5A 1NJ2A 4WI1A 3OFNG 4J9YB 2DZCA 2CK3G 3REXA 3WFVA 1KQSU 1PD3A 2Y48A 3HXYA 3GWOA 3ZRXA 1X56A 1H38A 3K04A 3CC4V 4HT4A 4N23A 1S77D 2KB1A 1HXDA 11ASA 2ZDIA 4KP4A 3NEMA 1NBMG 5CMUA 1CEZA 1E79G 2M7WA 2Q69A 4BW5A 3V7CA 2ZDIC 3ABTA 1E22A 1B8AA 2C2AA 3FKSG 2P0LA 4E2LA 3ZRWB 1VQ8V 2F43G 5HFMA 4GX5A 4XU1A 1R3LC 1AI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q6G A;  1BBW A;  1X2H A;  2ODR C;  4P72 A;  4O2D A;  4TVW A;  3E9H A;  4P72 C;  1QE0 A;  2ZIO A;  3HRK A;  4P74 A;  3QTC A;  2Q7G A;  2ARU A;  5HGQ A;  1EVL A;  4P74 C;  3UFG A;  2QHV A;  4YRN A;  4HWS A;  4HA8 A;  2E10 A;  4YRE A;  3HFZ B;  2Q5I A;  2C8M A;  4XU0 A;  3VBB A;  2DZ9 A;  3RKX A;  4TQF A;  2ZR2 A;  2DQ0 A;  1ADJ A;  4HWP A;  5C51 B;  2DVE A;  1NJ6 A;  2ZCE A;  1Z7N A;  2AMC B;  2ZT8 A;  4YRT A;  1WQ7 A;  3RUX A;  2QHS A;  4PG3 A;  4UPA A;  3A5Z A;  1ASZ A;  4CS4 A;  4RMF A;  2RHQ B;  4YRS A;  3M4P A;  1B7Y A;  4WJ3 M;  3HFZ A;  5F5W A;  1WNL A;  2DTH A;  4YRI A;  4DQ2 A;  2ZGW A;  1EIY B;  4TTV A;  4YRO A;  3TEH A;  5ELN A;  2FYK A;  3ERR A;  1ASY A;  2AMC A;  4OLF A;  2I4N A;  3VQV A;  4KQE A;  3FJP A;  2IY5 B;  1E1T A;  1WU7 A;  4NCX A;  1X01 A;  2RHQ A;  2DEQ A;  2CJ9 A;  3G1Z A;  4P73 C;  2ZIN A;  4UP8 A;  4G84 A;  1WLE A;  2E64 A;  2DDZ A;  4E51 A;  4ZTU B;  1BIB A;  3RF1 A;  1L0W A;  1NNH A;  4UP7 A;  3MEY A;  3REU A;  1SET A;  3LSS A;  3P8Y A;  3HXZ A;  2AKW A;  1QF6 A;  4CS3 A;  2P5I A;  2E5A A;  1G5H A;  4YRG A;  2EJF A;  4WF2 A;  2ZNJ A;  3TEG A;  2I4O A;  4ZTZ B;  4XEO A;  1USY A;  4H2U A;  4CH4 A;  1USY C;  3L2Z A;  4YCU A;  4AH6 A;  4P3N A;  3VQW A;  3RL6 A;  3A7U A;  1SES A;  4YP0 A;  1C0A A;  3HY0 A;  3PZC A;  4YRP A;  1YB3 A;  4XTY A;  4YCV A;  1SRY A;  3MF2 A;  3IKL A;  1YGB A;  12AS A;  4YRK A;  4P75 A;  3DSQ A;  3PCO B;  1HC7 A;  4LNS A;  4CH3 A;  4CS2 A;  1B7Y B;  4P75 C;  4K86 A;  4BWA A;  4XTZ A;  1H4V B;  3KFU A;  3QO5 A;  1NYQ A;  4Q15 A;  3UGT A;  2ZR3 A;  4TVA B;  5KNN A;  3TEH B;  4XTW A;  1PYS B;  4DPG A;  3HRI A;  3V8K A;  2ZT6 A;  1LYL A;  3VQX A;  4TWA A;  1EQR A;  2DU5 A;  1ATI A;  4YRR A;  1E24 A;  1BBU A;  2I4L A;  2I4M A;  4PHC A;  2QHT A;  1X55 A;  3R07 A;  4OP0 A;  3RGL A;  3EFR A;  3V8L A;  1WQW A;  3PCO A;  3LSQ A;  2ZZG A;  4H2T A;  1NYR A;  4YRL A;  4L87 A;  1G51 A;  2DKG A;  2DQ3 A;  3V8J A;  4BW9 A;  3QO7 A;  2DJZ A;  4TVA A;  3L4G A;  3RAC A;  1PYS A;  3P8V A;  2E1H A;  2AKW B;  5E3I A;  3WQZ A;  1RIQ A;  2EJ9 A;  1W66 A;  3EFS A;  3L1A A;  2CGH A;  3RIR A;  4P73 A;  2EAY A;  2XTI A;  3NET A;  4WJ4 A;  2ART A;  2C7I A;  4H2X B;  3HXW A;  3UGQ A;  4KR3 A;  3HXU A;  2ARS A;  3IAL A;  5C53 B;  3P8T A;  3V7R A;  1J5W A;  3I7F A;  1SER A;  2G4C A;  4YRC A;  4YRQ A;  1B76 A;  1KOG A;  4HWO A;  4H02 A;  2E65 A;  1YFT A;  1B70 A;  4KR2 A;  4CH6 A;  4HVC A;  3NEL A;  4UP9 A;  1G5I A;  2ZT5 A;  3IG2 A;  3MF1 A;  1NJ5 A;  1EFW A;  3BFM A;  3V7S A;  2ZIM A;  4EX5 A;  4H2X A;  2QHU A;  3HXX A;  4XU2 A;  4ZIB A;  4RQF A;  2CIM A;  5K1X A;  4K87 A;  2J3M A;  2ZNI A;  4XTU A;  3M4Q A;  1JJC A;  1N9W A;  1YFS A;  3QO8 A;  3IKM B;  2EJG A;  1GGM A;  3ICA A;  4HWT A;  3A7A A;  1KMN A;  2XGT A;  1ADY A;  3A32 A;  4YYE A;  4G85 A;  3A7R A;  4CH5 A;  2ZZE A;  1H4T A;  4J15 A;  3L4G B;  4XU3 A;  2J3L A;  1NJ1 A;  3A74 A;  3HXV A;  5C52 B;  5ELO A;  4TQD A;  2DTO A;  1EOV A;  2E3C A;  2CJA A;  3HFV A;  1IL2 A;  1H4Q A;  1H4S A;  1YFR A;  3RKY A;  3RKW A;  3UH0 A;  3OD1 A;  2PME A;  2EL9 A;  4XTV A;  2E41 A;  2EWN A;  4H2W A;  3HY1 A;  3NEN A;  3HTZ A;  4YRM A;  3W3S A;  2Q7E A;  3A31 A;  1Z7M A;  3CMQ A;  4H2S A;  1B70 B;  2DXT A;  2HNI A;  2PMF A;  3A5Y A;  1NJ8 A;  2ALY B;  1VQZ A;  3TUP A;  4HWR A;  4K88 A;  1E1O A;  2CJB A;  2ZTG A;  3BJU A;  4EO4 A;  2DXU A;  2ZXF A;  4XTX A;  2DU7 A;  4YCW A;  3VQY A;  4H2V A;  5K1P A;  2RHS B;  2DTI A;  4TVY A;  4YPF A;  2ODR D;  1WPY A;  4P71 A;  1X2G A;  2Q7H A;  2ZZF A;  4P3O A;  4P71 C;  3LC0 A;  1JJC B;  4XEM A;  1FYF A;  1KMM A;  4YDQ A;  4H2Y A;  2ALY A;  4YRJ A;  1EIY A;  3QNE A;  1BIA A;  4P3P A;  4X5O A;  1EVK A;  1HTT A;  2Q5H A;  4RDX A;  1X54 A;  1WYD A;  4RQE A;  2RHS A;  4YRF A;  3E9I A;  2ZT7 A;  2IY5 A;  1NJ2 A;  4WI1 A;  2DZC A;  3REX A;  3HXY A;  1X56 A;  1HXD A;  11AS A;  3NEM A;  3V7C A;  1E22 A;  1B8A A;  2P0L A;  4XU1 A; 
#chains in the Genus database with same CATH topology
 4LWS A;  4GX0 A;  5CN0 A;  1YXB A;  1X2H A;  3UO2 A;  3JCU Z;  1JVM A;  2QEX V;  4BIU A;  4JPR A;  5JJN B;  4MW3 A;  4YY3 B;  3S3X A;  2ARU A;  4GUN A;  3IAY A;  2P7T C;  1IUR A;  1AVM A;  4LF8 O;  4HWS A;  3R65 A;  2EIL C;  4DV5 B;  2XAF A;  2Q5I A;  1W59 A;  1NR7 A;  3VBB A;  2UXD B;  2R72 A;  2DZ9 A;  2Q67 A;  4HZ3 A;  1Q6U A;  2ZR2 A;  4WFF A;  3TET A;  2DQ0 A;  4JTC B;  1ADJ A;  5J2T B;  4FK5 C;  2BCC H;  4FLV A;  5C51 B;  2DVE A;  4A5U B;  4MVM A;  2ZE7 A;  1SZT A;  2G38 A;  1Q6I A;  3APQ A;  1FYJ A;  1H2N A;  1AIL A;  1EN5 A;  2PGG A;  2F4V O;  1HNW O;  4JI3 O;  1VQL V;  4UCS A;  2QWR B;  4LF6 O;  1JJO A;  1TVK A;  2B5U A;  4DV7 O;  2YXL A;  2YIB D;  1Y4M A;  4HYO A;  3L75 H;  5F5W A;  1WNL A;  4F6R B;  4YRI A;  3ABK C;  4DQ2 A;  2ZGW A;  2YS8 A;  4PA7 A;  4JYA O;  1SZX A;  3K0D A;  3CRC A;  3ABL C;  2L35 A;  3NXS A;  1QNM A;  2AMC A;  2P67 A;  2JGD A;  2I4N A;  2GTA A;  5DN6 G;  1H8H G;  4FZ0 A;  5EZY B;  3L70 H;  4WBN A;  4NXM O;  1NVP B;  1VQP V;  3ZN0 A;  3Q4H A;  3SYO A;  5L3F A;  2UUA B;  3R66 A;  1WU7 A;  2A06 H;  4JI2 B;  4NCX A;  2X6C A;  1KKC A;  4GX2 A;  3M8A A;  2NR5 A;  3G1Z A;  2IH1 C;  2HHH B;  1BGY H;  1TUB A;  2E75 B;  2X0L A;  4L8J A;  1K9M W;  4LF7 O;  3E8G A;  4UCT A;  1IX9 A;  2N04 A;  3ZS8 C;  1UFI A;  2PTM A;  1AP6 A;  2UUC O;  3WU2 Z;  1Q90 D;  1GAX A;  2JVD A;  1BIB A;  1L0W A;  4X9Q A;  5EYP B;  1KP3 A;  4FJC C;  1H2M A;  3MEY A;  3UKM A;  2P90 A;  3REU A;  2W0X A;  3B8N A;  4JI8 O;  3FYE B;  4LWS B;  1JQ0 A;  3H1L H;  3J7A U;  4W4K A;  1VQM V;  3W7U A;  1AP5 A;  2P5I A;  2MK3 A;  1AI6 A;  4LF5 O;  2XT9 A;  3SJA C;  4ZTZ B;  4N21 A;  1USY A;  4UXN A;  3W7S A;  1VP7 A;  3L2Z A;  5FNV A;  1JA8 A;  2WAM A;  1B04 A;  4B3M O;  1XOU A;  2Q9L A;  3N2G B;  1AJN A;  2EUL A;  5EC2 C;  2VQE B;  2ZT9 B;  4O4H A;  3OR7 C;  5LL6 Y;  2NNU A;  2WA3 A;  2RDC A;  5B1B C;  4RO2 A;  3PZC A;  1N8R W;  1FXK C;  3BVO A;  4YCV A;  2DYS C;  5LHH A;  2P6J A;  4JAU A;  3MF2 A;  5DM6 V;  3CCE V;  3JAM N;  1ZX3 A;  2ODM A;  3VOU A;  1HP8 A;  1HC7 A;  1U96 A;  3J81 N;  1JPX A;  2OTJ V;  3CE2 A;  1XL4 A;  4G28 B;  3H1H H;  1XUQ A;  2QGN A;  1M56 B;  3E8H A;  4ASU G;  3DTU B;  1XNQ O;  4K3A A;  1D5N A;  1NYQ A;  2EIK C;  2ZR3 A;  1PV0 A;  1I94 B;  2JEX A;  1M1K W;  1NTK H;  2BOC C;  4JI6 O;  1PYS B;  3V8K A;  1LYL A;  2EIM B;  1EQR A;  2JGD B;  4G2K A;  5KLV H;  4YRR A;  5LMN O;  2JJ1 G;  4LVM A;  2IU0 A;  4OP0 A;  3FX7 A;  5LHI A;  4JI1 B;  3ZED A;  4O4I A;  1S5J A;  1TUB B;  3FAV A;  2AZ0 A;  2Y0I A;  3ASO C;  4H2T A;  1IBM B;  1NYR A;  1G6U A;  2DQ3 A;  1RP3 B;  2DJZ A;  2XAQ A;  2EIN C;  3I56 V;  4QE9 A;  1M56 C;  3CCQ V;  3RAC A;  4Z2W A;  2ZQM A;  1J95 A;  2Q68 A;  2E1H A;  1N32 O;  4DR1 B;  2EIM C;  3EFS A;  5LOV A;  4JI7 B;  3STL C;  4JI5 O;  3RIR A;  2B1I A;  1AJQ A;  4AQY B;  4OXS A;  4YY3 O;  2Z5U A;  5FNV B;  4J7Z A;  4ZOL A;  4DV3 B;  5HFL A;  1WNS A;  4LC1 A;  2PUS A;  3CC7 V;  2DJV A;  1CXZ B;  3V7R A;  1HW7 A;  5IY5 B;  1NQT A;  4TV9 B;  1TUE B;  2UXD O;  3K59 A;  1K5S A;  4HWO A;  4O4H B;  4TUY B;  5FPO A;  4H02 A;  4JF3 A;  5JCO C;  1NKD A;  4MTF A;  1K97 A;  1P4R A;  2EJR A;  3WG7 C;  4JI0 B;  4CH6 A;  5JH7 A;  4HVC A;  5LP6 C;  3TXQ A;  5BY1 A;  3ZHT A;  4UB6 Z;  2IJH A;  1Q86 W;  1T5E A;  3NEL A;  4FLT A;  1OCZ C;  1DF5 A;  1H2K A;  1NJ5 A;  1EFW A;  4U3J A;  2WLJ A;  2PZS A;  3F5W C;  4I5S A;  5LMU O;  3V7S A;  3P30 A;  4EX5 A;  4WFB V;  3JAT A;  1GM9 A;  1VF7 A;  4JYB A;  3K9S A;  2DWD C;  1X4T A;  4E4E A;  1RSO B;  4JI4 B;  5B1A C;  5IY5 C;  3KKY A;  4NB5 A;  4DUY B;  4XTU A;  1YTF D;  1NZ6 A;  4TWK A;  3ETG A;  3M4Q A;  2QTS A;  3W7W A;  2ZM6 B;  1XRE A;  3CCV V;  4NXN B;  1BHA A;  1GKF A;  4LNU A;  3IKM B;  2B1G A;  1L8D A;  3RT3 C;  4U3F H;  4X62 O;  1Y74 A;  1GGM A;  4HWT A;  4O4I B;  3AG3 B;  3FAV B;  3T1Y B;  3AK1 A;  2MW2 B;  5D5P A;  3CX5 F;  4RAI A;  4GZR B;  2HHH O;  4XDL A;  3TXS A;  2W6I G;  4H13 B;  1V55 B;  3O65 A;  1JFF A;  3JD1 A;  3UCS C;  4AIL C;  4J10 A;  3BA9 A;  4O2A A;  4YHH B;  4YIP A;  1RM1 C;  1VQ9 V;  3CSX A;  4LFA B;  4UV8 A;  1Z5W A;  1G4Y B;  3MQZ A;  5LOV B;  4LVI A;  1PL0 A;  3A74 A;  5C52 B;  1EOV A;  4X66 B;  1WPX A;  1QR9 A;  2LP7 A;  3P3P A;  3K57 A;  3HKC A;  3RKW A;  2X6A A;  4I50 B;  1OZ0 A;  2E41 A;  5IYB O;  4H2W A;  1M90 W;  3NEN A;  2P4K A;  3HTZ A;  4PDR A;  5CBH A;  2DW4 A;  4UB8 Z;  3OEE G;  4FM2 A;  1MSD A;  3CCM V;  2HNI A;  3OTF A;  5E1A C;  4PV1 B;  5JH7 B;  2R9I A;  1I08 A;  2OIG A;  2F1M A;  1GO3 F;  1QLE B;  5IJ9 A;  1YHQ V;  2UUB O;  1Z2G A;  4HWR A;  5IYZ A;  4K88 A;  1E1O A;  2QKA A;  4DR5 O;  1LNQ A;  2ZTG A;  2ZE5 A;  1R73 A;  4X65 B;  2BOB C;  5K1P A;  5KUM A;  2RHS B;  2WWW A;  2OCH A;  2WA4 A;  2ODR D;  1MZF A;  2YIA A;  1Y76 B;  2Y4T A;  1I94 O;  3JAK B;  4NTW A;  5JQG B;  3KZI Z;  3G4S V;  1BCC H;  1JX9 A;  4YDQ A;  2ALY A;  1E1Q G;  4YRJ A;  1EIY A;  3QNE A;  1MNG A;  4JI1 O;  2W6J G;  2Q5H A;  2RMK B;  4QGP A;  1QVG U;  1HNW B;  2F4V B;  1WYD A;  3JD3 A;  1FFX A;  4J42 A;  4IT5 A;  1IBM O;  3E9I A;  4WI1 A;  3OFN G;  4O2A B;  3REX A;  5JJJ B;  4DV6 B;  3HXY A;  1X59 A;  3J80 N;  2KB1 A;  11AS A;  5CMU A;  3B4S A;  2Q69 A;  3JAR A;  3ABT A;  4I4T A;  1E22 A;  1B8A A;  1HNZ B;  4JI7 O;  2C2A A;  3FKS G;  4FLY A;  2F66 C;  3HKC B;  5ITZ A;  4NXM B;  5HFM A;  2YIC A;  2ODR C;  4TVW A;  1EZV H;  3BCC H;  1W2B U;  3JSL A;  1VQK V;  3ICX A;  1K33 A;  3D3I A;  2FML A;  3GB7 C;  3E22 A;  1YI2 V;  2A3Q A;  3L72 H;  4J11 A;  3QF7 A;  3WB1 A;  1K5Q A;  1EVL A;  5C93 A;  1CPY A;  4P74 C;  4PA6 A;  3MHH C;  5C8Y A;  2UUC B;  2Q8V A;  4ICG A;  4X20 A;  2C8M A;  4RUF A;  3SJC C;  3K5O A;  2QTO A;  3THO A;  4LVL A;  2OCC B;  4JI8 B;  3CRM A;  1MOF A;  5B1N A;  1GN3 A;  5H2F Z;  1Z7N A;  2ZT8 A;  2ZXW C;  4LF5 B;  4DR3 O;  5CA1 B;  1BZK A;  3LDD A;  3LSU A;  2QHS A;  3RYC A;  4UPA A;  2BE3 A;  3A5Z A;  4HNA A;  3N2K A;  2BTQ B;  5IJ0 A;  3M4P A;  3T1H B;  3D36 C;  4B3M B;  1VQ4 V;  4WJ3 M;  2EBO A;  4JGS A;  4JI4 O;  4HBN A;  1HWY A;  2DYR B;  3OMI B;  2DTH A;  1K73 W;  1EIY B;  2ZM6 O;  2XND G;  3TEH A;  5ELN A;  4GLX A;  2CUG A;  1ASY A;  5BR8 O;  3ZRS A;  5TIS Z;  1FFX B;  1OCC C;  2GTS A;  3FJP A;  1E1T A;  3JSN A;  2DEQ A;  1OCO C;  4P73 C;  1W0K G;  4F6R A;  1KP2 A;  3QVN A;  4GYC B;  3JAR B;  1KU9 A;  3FB8 C;  2E64 A;  4G84 A;  2DYR C;  4I55 A;  2R9A A;  3U10 A;  2HVK C;  3E83 A;  1NNH A;  4JZG A;  1F51 A;  3AG2 C;  1Z5V A;  3ABU A;  3AG1 C;  3EFF K;  5H6R A;  1H8E G;  3WB2 A;  3OMN B;  4X66 O;  3LSS A;  3QG5 A;  4H44 B;  2JDI G;  5EZY A;  2YIB A;  3K5N A;  1QF6 A;  3UM7 A;  4CS3 A;  3B2E E;  2E5A A;  1G5H A;  4ZI7 B;  4WF2 A;  1KUQ A;  1YSC A;  3F7Y C;  2ZNJ A;  3TEG A;  2EIL B;  1R3K C;  4Z1V A;  5C8Y B;  1VF6 A;  4K8Z A;  4YCU A;  1QCE A;  2VRZ A;  1FJG B;  1K3E A;  3A7U A;  1M57 B;  5EYP A;  1XL6 A;  1N32 B;  4JTD B;  4LFC O;  1L0L H;  3OMA B;  1DGS A;  2XAS A;  4KXR A;  4YJ2 B;  5H6Q A;  4JI5 B;  1FXK A;  5EBM C;  4BIZ A;  3P32 A;  1SRY A;  4TV8 B;  3RYC B;  4X65 O;  4HNA B;  3N2K B;  5IJ0 B;  3M99 B;  3DSQ A;  3ABK B;  3STZ C;  1QHT A;  4P75 C;  2ZE6 A;  4NR1 A;  1IBK B;  2Y4U A;  3KFU A;  3QO5 A;  3ABL B;  3CD6 V;  4TVA B;  4RUE A;  3HKD B;  4XTW A;  2GHY A;  3W7X A;  3N2G A;  3TEH B;  2CGO A;  4DPG A;  2KG7 B;  1IDS A;  4UUJ C;  1BL8 A;  1M57 C;  4MVZ A;  3VQX A;  1S5H C;  1G8M A;  1ATI A;  3K58 A;  3A8T A;  2LO1 A;  2I4M A;  2JEU A;  3CXH F;  2YXY A;  5B1O A;  5IT9 N;  3BAB A;  3OT7 A;  4PHC A;  1S72 V;  2QHT A;  5LMU B;  4GT1 A;  1GMG A;  4DW1 A;  5KA6 A;  1KMI Z;  5L3D A;  3OR6 C;  2VQF O;  1MMM A;  1WQW A;  2RQ6 A;  2UXC B;  1VEW A;  4DV6 O;  1AB3 A;  3OGI B;  3TK1 A;  4YRL A;  4L87 A;  2DKG A;  3K0G A;  1N4C A;  3QO7 A;  4I55 B;  1Q8I A;  3BA8 A;  4O2B A;  1N0N A;  3ABM B;  2LGQ A;  1P7G A;  1PYS A;  4U7O A;  4X1I A;  1B06 A;  4Z1M G;  2AXT Z;  3B77 A;  3P8V A;  1HNZ O;  3K79 A;  2QKS A;  2NS6 A;  1K7D A;  1RIQ A;  4X62 B;  5CA3 A;  1R6N A;  2B9Z A;  2EAY A;  2GUZ A;  2LW7 A;  3FB5 C;  3SPJ A;  2PI4 A;  2C7I A;  3CMA V;  3HXU A;  3IAL A;  5C53 B;  5B3S C;  3P8T A;  3RN4 A;  4R8C A;  2ETN A;  5AG2 A;  4YRQ A;  1BS3 A;  2YUA A;  4NYK A;  3CME V;  4WF9 V;  5JCO A;  2UXB B;  2X6B A;  5B1B B;  3HKE B;  4EFB A;  1UPG A;  3ABM C;  2O57 A;  1IZ3 A;  5LP6 A;  1FXK B;  2DYS B;  1PL4 A;  3N27 A;  2WPD G;  4ZHQ A;  5EIB D;  4UP9 A;  4H0L B;  1QBZ A;  2Y69 C;  3CCL V;  1D2D A;  3MF1 A;  2JS5 A;  1V9P A;  3BFM A;  2ZIM A;  3AK2 A;  2JRI A;  2EZO A;  3T4Z A;  1D5A A;  3SPG A;  2EIK B;  2QDO A;  4UCV A;  3T1H O;  3C90 A;  4J41 A;  5L3E A;  1XBL A;  4K35 A;  2YSU B;  2GBO A;  2R9R B;  3JD0 A;  5K1X A;  4K87 A;  4TV9 A;  2J3M A;  3MD0 A;  4TUY A;  2IJJ A;  1IBL B;  2YID A;  2E74 B;  4MTX A;  1JJC A;  1EFR G;  2UUB B;  3QO8 A;  2QWN B;  2K9P A;  2HKO A;  4MVQ A;  4DR5 B;  1VQ5 V;  3ASO B;  2KSD A;  3CEI A;  4MTO A;  4R50 A;  1WA8 B;  4K8X A;  3AG4 C;  2EIN B;  3RVY A;  4GX1 A;  3OAA G;  3U0Z A;  4J7K A;  4O2B B;  3G6E V;  1VF5 B;  2CE4 A;  1EN4 A;  4X1I B;  1RSO A;  5KHH A;  2FYU H;  4XU3 A;  1NJ1 A;  5EIB C;  1O9G A;  2DMX A;  4AI8 A;  1N0J A;  1SS3 A;  4FVM A;  4O4J A;  5CB4 A;  4TQD A;  2GUZ B;  1TA8 A;  2E3C A;  2V1D A;  1IL2 A;  3RKY A;  2WLN A;  3SPC A;  3OD1 A;  2PME A;  1ZSP A;  5KMG B;  4B3R B;  2EWN A;  2AW9 A;  3OGC C;  1TGO A;  2QWQ B;  4F6E A;  3WG7 B;  1FJG O;  5H9C A;  5LP6 B;  2Q5Z A;  3CMQ A;  1RPO A;  5DEC A;  2DXT A;  1Q5O A;  4PD4 F;  5KUK A;  2K1E A;  1BHB A;  3WB0 A;  1OCZ B;  4ZHQ B;  1KKD A;  4XDJ A;  1R6T A;  1NJI W;  4DR6 B;  4JYY A;  1JR9 A;  3EXA A;  2H94 A;  1SQP H;  2CJB A;  3NR7 A;  4EO4 A;  4I50 A;  2DXU A;  5LXT B;  2ZXF A;  1K34 A;  2DU7 A;  4YCW A;  4H2V A;  3MAQ A;  4ZBM A;  4J7J A;  1OJH A;  3CYO A;  1IBK O;  1YZB A;  5B1A B;  4D7T A;  4UCO A;  3G6B A;  4UV9 A;  2HR3 A;  4PEL A;  4IYI A;  3AG7 A;  4B08 A;  3RBZ A;  3JAL A;  1JJC B;  3ZHV A;  1FYF A;  2F93 B;  4H2Y A;  3A0B Z;  1M5I A;  4DV4 B;  1EM1 A;  4DR3 B;  1BSM A;  2JK5 C;  5IE9 A;  2UXC O;  4RDX A;  4TSF G;  4I7Z B;  1B6Q A;  2WLL A;  3TGU H;  2RHS A;  4YRF A;  1WN7 A;  1RM1 B;  2IY5 A;  1XMO B;  1Y76 A;  4DV1 O;  1KQS U;  2YC0 A;  2Y48 A;  3ZRX A;  2YXH A;  3K04 A;  3JAK A;  1KB9 F;  1S77 D;  1HXD A;  5JQG A;  3NEM A;  2XUM A;  4BW5 A;  4O4J B;  5CB4 B;  3V7C A;  1P49 A;  5BR8 B;  2CTW A;  2OIE A;  1WPB A;  3ZRW B;  4DV2 O;  2XHB A;  2H3O A;  1R3L C;  2A79 B;  4Q6G A;  1WB8 A;  1YTF B;  4EB6 B;  4P72 C;  1QE0 A;  2ZIO A;  4FMT A;  2HJF C;  1SQX H;  4P74 A;  3QTC A;  1R6K A;  2HVJ C;  1WP8 A;  3MDS A;  2DOS A;  3L9D A;  3F7V C;  2UU9 O;  4JYC A;  4P9P A;  2QHV A;  2UXB O;  4YRE A;  3HFZ B;  2AHZ A;  4XU0 A;  2JJ2 G;  1SF9 A;  1FS0 G;  1PP9 H;  1VMG A;  1FD9 A;  3HKB A;  4K0K B;  4HWP A;  3ZMS A;  1KBH A;  5LGU A;  3E2E A;  4CC5 A;  3OEH G;  2ZKO A;  4FLW A;  1YDX A;  3RUX A;  4PG3 A;  3ETQ A;  4CS4 A;  3D36 A;  4RMF A;  3L71 H;  2RHQ B;  2IJK A;  4YRS A;  2RJZ A;  3JAL B;  2E5L O;  1BE3 H;  4MSW C;  5FLX N;  1IBL O;  4LFC B;  2NLJ C;  4PI2 A;  2W0F C;  2FYK A;  4LH7 A;  1E1R G;  2ITC C;  3PN1 A;  2YEV A;  4LH6 A;  4H33 A;  4XDK A;  1YJW V;  4J9Z B;  2WLL B;  4XBF A;  5CA1 A;  5EC1 C;  5KAI Z;  3RFR A;  4Q20 A;  4UFZ A;  2IY5 B;  4WFA V;  4PDL A;  3ZMV A;  1GM8 A;  2BTQ A;  3LNN A;  4IIJ B;  4HAM A;  2CJ9 A;  2ARH A;  3H1J H;  3SYQ A;  2ZIN A;  2UXN A;  3FB7 C;  1MA1 A;  3JD4 A;  4FPP A;  4D6T H;  1N34 O;  4YIO A;  1MAB G;  4GKK B;  2WLI B;  4JZ2 A;  1MG1 A;  1R3I C;  2GSM B;  3P8Y A;  2Q0O C;  3HXZ A;  2WLH A;  5LA6 B;  3RVZ A;  3G71 V;  2R70 A;  2VQF B;  4MS2 A;  1PM9 A;  4YRG A;  4B3R O;  2EJF A;  3SJB C;  5LGN A;  2I4O A;  4XEO A;  3JD2 A;  3K9A A;  5DED A;  1COW G;  1THZ A;  1GTO A;  2JS3 A;  1OV9 A;  4QPJ A;  4AH6 A;  4P3N A;  1IXB A;  4ABM A;  3HKB B;  1PNK A;  3CRQ A;  3OM3 B;  3KCX A;  4BR6 A;  2P4V A;  2QR4 A;  1SES A;  4DR4 O;  2ITD C;  4DR6 O;  4YP0 A;  2ZXW B;  4NTX A;  4LR3 A;  2WSS G;  2QM7 A;  1G1X B;  3BY6 A;  1YB3 A;  4X1Y A;  2P06 A;  3IKL A;  4ZI7 A;  1YGB A;  3LNM B;  4YRK A;  4PDM A;  4P75 A;  3PCO B;  3DXR A;  4CS2 A;  5F2V O;  1B3Q A;  3F5T A;  4WFH A;  4K86 A;  4R6Z A;  1H4V B;  5GW7 A;  2CTP A;  3JYC A;  3DC6 A;  4Q15 A;  4KFM A;  5KNN A;  3IJ4 A;  1L1F A;  1OCC B;  2YEV B;  2OT5 A;  4DV4 O;  3H1I H;  5CBG A;  4YJ2 A;  3B09 A;  3X2Q C;  1EZJ A;  4TV8 A;  1X55 A;  5GTH Z;  4DXW A;  3R07 A;  1OCO B;  1M9N A;  1K8A W;  1J5E B;  1Q81 W;  3V8L A;  1O9H A;  4NVP A;  2D3O W;  5CBF A;  1FKA O;  5KHG A;  2D2C B;  3SPH A;  1XMO O;  3RW0 A;  3LSQ A;  2EIJ C;  4LCU C;  4B3T O;  1YIT V;  3K03 A;  3AG2 B;  3AG1 B;  4BW9 A;  1G51 A;  3V8J A;  4TVA A;  3HKD A;  4X64 B;  3FD9 A;  4LF4 B;  3L4G A;  5EBW C;  1K4C C;  2KG7 A;  3E86 A;  2FTK A;  2VWJ A;  3BFR A;  3ETE A;  2QKC A;  1S0V A;  3SGI A;  5L3G A;  3TCU A;  1KEC A;  2A0L A;  5E3I A;  3WQZ A;  2A7W A;  5L3B A;  1W66 A;  3L1A A;  2CGH A;  4FFB A;  2OWO A;  3GVM A;  3UT5 B;  1WAZ A;  1NH2 D;  2P5O A;  1F4N A;  1JOY A;  4FM0 A;  1QVF U;  5CA0 A;  4R7C A;  4H2X B;  3HXW A;  1ZL8 A;  1OCR C;  3HR0 A;  4DYL A;  4KR3 A;  1K4D C;  1AR4 A;  4J80 A;  3I7F A;  1Y67 A;  2AGA A;  4YRC A;  2ZD9 A;  2IJI A;  1KOG A;  1WJZ A;  4K0K O;  3CCS V;  2E65 A;  4UCU A;  3SPI A;  5BXZ A;  2RNB A;  1VQ6 V;  4MTG A;  3EHB B;  3CRA A;  3ZRV A;  4X1Y B;  1DK1 A;  3H9V A;  4IGG A;  2OTL V;  1G5I A;  1H2L A;  1ZAU A;  4X8A A;  2ZT5 A;  1YVW A;  1U97 A;  3IG2 A;  3MHS C;  3DXR B;  1Q3E A;  5IWA O;  4FM1 A;  4AHC A;  1NR1 A;  3RYI B;  3ZJZ A;  3HXX A;  4XU2 A;  3BEH A;  3HPL C;  4RQF A;  2CIM A;  3GWK C;  1DTO A;  2RN9 A;  1BMF G;  2P22 C;  2WLK A;  1V54 C;  4KUM A;  5IDJ A;  3BRC A;  2YI9 A;  2PYL A;  3HKE A;  1SQF A;  4DR2 B;  1HDJ A;  4X1K A;  1GN4 A;  2CDY A;  1I5Y A;  4GCZ A;  4OPH A;  2XOK G;  4MVS A;  1L0N H;  4LP8 A;  1YJN V;  4O4L B;  1R1B A;  2AZ2 A;  3ICA A;  1NTZ H;  4WCE V;  3JCZ A;  2XGT A;  1ADY A;  3A32 A;  4DK1 A;  4YYE A;  5J2U A;  3A7R A;  1FPO A;  4G85 A;  3L73 H;  3K06 A;  2ZZE A;  4LVJ A;  3A0R A;  1W0J G;  3BHP A;  5FL7 G;  4WFE A;  3L4G B;  4J15 A;  2LGW A;  2CH7 A;  3JAS B;  1NTM H;  2OYQ A;  1AR5 A;  3DGE A;  1YJ9 V;  4GKK O;  3E89 A;  5KX5 A;  4DUZ B;  4FLZ A;  4P2Z A;  1PPJ H;  4FFB B;  3HXV A;  1HNX O;  4PHZ A;  3APO A;  4BAY A;  1Q82 W;  5CA0 B;  3CCJ V;  4U7N A;  1GN6 A;  1ROP A;  1WA8 A;  3UH0 A;  3CCR V;  3ZHR A;  5B3S B;  1DLB A;  1ZL8 B;  3CCU V;  1YF2 A;  5KAF Z;  1ZUQ A;  3E35 A;  4DV1 B;  1SC5 B;  4CC6 A;  2RCV A;  3PJS K;  2Q7E A;  4CZZ A;  3A31 A;  2V4D A;  1Z7M A;  1N36 B;  4JV5 O;  4KHP B;  4LFB O;  2QM8 A;  1NVP D;  2PMF A;  4NTY A;  4BIO A;  3AK3 A;  3A5Y A;  2Y69 B;  1NJ8 A;  5GON B;  1ENV A;  4DV2 B;  2A8E A;  2JGU A;  3TUP A;  3OD4 A;  1VAR A;  4MW8 A;  2E76 B;  3OW2 U;  2QWO B;  1P7B A;  5KMG A;  4XTX A;  2NN4 A;  3G80 A;  1US6 A;  4YJ3 B;  1MSW D;  4JTA B;  2UU9 B;  4YPF A;  5JWP A;  1PKX A;  1X2G A;  2LFR A;  1GN2 A;  1OHH G;  2Q7H A;  4X1K B;  2F95 B;  2ZZF A;  4P71 C;  4LBE C;  5B66 Z;  3LC0 A;  4PA9 A;  2JIZ G;  2X7R B;  5A9G A;  4UVC A;  5LYJ B;  2V7Q G;  2GV9 A;  3AG4 B;  1J5E O;  3ZIA G;  4X5O A;  4PA4 A;  1HR0 B;  2LFS A;  2KQX A;  5J2U B;  5LXT A;  3I5D A;  4QE7 A;  2IH3 C;  2FL4 A;  5J9P C;  3CC2 V;  2ZT7 A;  1N33 B;  5GTI Z;  1WP7 A;  2CK3 G;  2CH7 B;  1JMK C;  1XHZ A;  2E5L B;  1NT2 B;  1PD3 A;  4X64 O;  1P84 F;  3GWO A;  4LF4 O;  5KX5 B;  3CC4 V;  1LUV A;  2ADP A;  1E79 G;  1VF6 C;  2ZDI C;  3M7M X;  2Q4P A;  2P0L A;  3EVK A;  1RFY A;  1VQ8 V;  4EEQ A;  3ZX6 A;  4TOI A;  1BBW A;  4P72 A;  4UVA A;  4O2D A;  3SYP A;  1PNL A;  2PYJ A;  2EZP A;  3IC9 A;  3E9H A;  3HRK A;  2CTQ A;  4X89 A;  2Q7G A;  1TVK B;  5HGQ A;  4DR7 B;  3UFG A;  4YRN A;  3UQ8 A;  4HA8 A;  2CTR A;  2E10 A;  2BSK A;  5EK0 A;  1N34 B;  4OX9 B;  4FLU A;  2H8P C;  3RKX A;  1ZTE A;  4TQF A;  2QJ1 A;  5LBQ A;  3ZRW A;  1NJ6 A;  4KL1 A;  2ZCE A;  1AI7 A;  3OUF A;  4DW0 A;  2AMC B;  4WBN B;  4EB6 A;  4YRT A;  1WQ7 A;  1ARO P;  3Q4H B;  3ZMU A;  2QWP B;  2WLM A;  2CGN A;  3D3Q A;  1ASZ A;  3IGA C;  2HP8 A;  5JJE B;  1NS1 A;  4PI0 A;  3OTO B;  3W7T A;  1B7Y A;  2LW1 A;  3HFZ A;  4ZKI A;  4DR2 O;  1XNR O;  2LJ2 A;  4DR4 B;  4TTV A;  5D5Q A;  1A32 A;  4YRO A;  4PJ0 Z;  2HJD A;  3ERR A;  1XIL A;  3LUT B;  4OLF A;  3VQV A;  2ILM A;  4KQE A;  3B40 A;  2HEP A;  4FIP C;  5A2Q N;  1KD1 W;  1X01 A;  3AEI A;  2RHQ A;  2BTO A;  1GM7 A;  4EKW A;  2DWE C;  2N74 A;  4UP8 A;  1WLE A;  4DUZ O;  1GRJ A;  2DDZ A;  5IYC O;  4E51 A;  4DV5 O;  4ZTU B;  3RF1 A;  2IW5 A;  4MVR A;  4UP7 A;  1IVS A;  1SKV A;  4DV0 B;  4B3S B;  1SET A;  3ZHS A;  3JAW A;  3CRR A;  4QIW F;  1NI8 A;  4MT8 A;  1Y66 A;  2AKW A;  4QPK A;  1RPR A;  1BQ0 A;  4G27 B;  1ZWI C;  5H5N A;  3E8F A;  3RGB A;  5KA5 A;  4IIJ A;  2A9H A;  3DC5 A;  1I5X A;  4B3T B;  3ZBH A;  1BQZ A;  1Y6X A;  4H2U A;  2BSK B;  5FPR A;  4CH4 A;  3RYH A;  1USY C;  3D8C A;  1N36 O;  4KHP O;  2HLD G;  4UCR A;  4I9Q A;  1SA0 A;  3VQW A;  3RL6 A;  5E79 Z;  3RYF A;  4LF9 B;  4FZ1 A;  2WLI A;  3A2F A;  1XI1 A;  1C0A A;  4DO2 A;  5KHK A;  1M93 A;  3ZHU A;  3HY0 A;  4YRP A;  3C3T A;  5LA6 A;  1SQB H;  3HB3 B;  4WFG A;  1I7F A;  2PF4 E;  4XTY A;  3ZMT A;  4GKJ B;  3ZN1 A;  2M6Y A;  4B7K A;  3B8M A;  12AS A;  1S3J A;  1M4U A;  4LNS A;  4CH3 A;  2UUA O;  1Q7Y W;  1B7Y B;  4JI2 O;  2EX3 A;  4X88 A;  1XQ8 A;  4BWA A;  2L6L A;  4XTZ A;  5JVD A;  4P30 A;  1XHX A;  3CPW U;  3UGT A;  3IC7 A;  4C7U A;  1UJW B;  3T2M A;  1FAF A;  1JCH A;  3SDL A;  3HRI A;  2ZT6 A;  4TWA A;  2DU5 A;  1E24 A;  1BBU A;  3CP1 A;  2I4L A;  3SYC A;  1HR0 O;  3CB2 A;  2QM4 A;  2XAJ A;  2DN9 A;  5IWA B;  3RGL A;  3EFR A;  3K08 A;  2FB5 A;  3CHX A;  1N33 O;  2YI8 A;  1FXH A;  3PCO A;  1PNM A;  1VQN V;  4P9O A;  3I55 V;  4ZOL B;  2Q0A A;  2ZZG A;  3AG3 C;  3CJH A;  3OUS A;  3S3W A;  3LDE A;  3C3S A;  1XMQ B;  4CBC A;  5B5E Z;  1V55 C;  2CAZ C;  1YIJ V;  1ZLZ A;  1LUW A;  2HFE C;  3JAW B;  4F4L A;  5IYD O;  4IYH A;  2AKW B;  4B7E A;  2EJ9 A;  3KG2 A;  2VQE O;  1QU7 A;  4DK0 A;  1S76 D;  1QLN A;  4P73 A;  5LHG A;  2XTI A;  3NET A;  4PA3 A;  3A0H Z;  4U3J B;  4WJ4 A;  2ART A;  2Q6A A;  4FLX A;  1ORQ C;  3RYH B;  3ZMZ A;  4DR7 O;  3UGQ A;  3K5M A;  3JAT B;  1SA0 B;  2ARS A;  1H2S B;  1FXV A;  2UXX A;  3ZCC A;  4OX9 O;  1J5W A;  3RYF B;  1SER A;  2G4C A;  2IU3 A;  5KHI A;  1B76 A;  4LF8 B;  4TT3 G;  4OGQ B;  4OPA A;  2LQT A;  1AJP A;  4JAA A;  1YFT A;  1HNX B;  1B70 A;  4KR2 A;  4LNU B;  1EN6 A;  1K92 A;  3P3N A;  3UT5 A;  4JAS A;  3FB6 C;  2IM9 A;  1Y74 B;  2QA4 V;  1JJ2 U;  1DF4 A;  1QLE C;  2AHY A;  3IFX A;  4H2X A;  5JVD B;  2QHU A;  4ZIB A;  3OTO O;  3LDC A;  4QNH B;  4JI3 B;  5L3C A;  4LF6 B;  1IXM A;  3SR2 C;  1JFF B;  4DV7 B;  4JV5 B;  4LFB B;  1F23 A;  2ZNI A;  2N05 A;  3K5L A;  1SQQ H;  4UVB A;  3X2Q B;  3T1C A;  3E8B A;  4I0X A;  2PI5 A;  4DRX A;  1FFT B;  1WB7 A;  1QQC A;  1URF A;  3CS5 A;  4JYA B;  1S5L Z;  1N9W A;  1YFS A;  4DR1 O;  4I9W A;  2EJG A;  1YEW A;  2VWK A;  2EIJ B;  3A7A A;  1F4M A;  4IHJ A;  1AR1 B;  1KMN A;  1EBO A;  1AI5 A;  4AQY O;  1F7Y A;  3RYI A;  1SQG A;  3BPZ A;  4PDV A;  4CH5 A;  3CJH B;  2KKW A;  2GDS A;  4DV3 O;  4D7S A;  1H4T A;  4QJF B;  4JAV A;  1GK9 A;  3ASN B;  4RWU A;  4LF7 B;  2J3L A;  1KYO F;  1YCI A;  5BMV A;  4DV0 O;  2FKX A;  2XAG A;  3KCY A;  4B3S O;  1GH6 A;  1TAE A;  5BZB A;  5EBL C;  4JI0 O;  3ETD A;  2XTA A;  5ELO A;  2DTO A;  5IJ9 B;  4O4L A;  2CJA A;  3HFV A;  1H4Q A;  1H4S A;  5IYZ B;  1YFR A;  1OCR B;  3FFQ A;  4NKG B;  4YXW G;  1Q43 A;  1I0H A;  1R3J C;  4MVO A;  2EL9 A;  1VQO V;  2EJ7 A;  4XTV A;  3HY1 A;  3H1K H;  3FYI B;  4EFE A;  4YRM A;  3T4D A;  2XAH A;  3K3W A;  2DE0 X;  3W3S A;  3JAS A;  1NU1 H;  3O9O A;  3OE7 G;  1XEQ A;  1LR1 A;  3ASN C;  3CXC U;  3ZHQ A;  4LF9 O;  4H2S A;  1B70 B;  4H37 A;  4DUY O;  3L74 H;  1VQ7 V;  2VS0 A;  2ALY B;  1VQZ A;  5LGT A;  2PY5 A;  2Z0A A;  4NXN O;  3H01 A;  4GKJ O;  5J2T A;  2OCC C;  3SYA A;  1H2G A;  3BJU A;  3G67 A;  2Y0P A;  1V54 B;  3VQY A;  3T1Y O;  4IL6 Z;  1SQV H;  2DTI A;  4TVY A;  1VIB A;  1WPY A;  2ATK C;  2Q73 A;  4P71 A;  2HG5 C;  3CWB H;  1NH2 B;  4I0X B;  2Z3Y A;  2ZE8 A;  4P3O A;  4DRX B;  4YHH O;  1XNQ B;  4XEM A;  3UO3 A;  1KMM A;  5GON A;  1CP9 A;  4LFA O;  2ADQ B;  4I4T B;  3SJQ C;  4MVU A;  4JI6 B;  1QR8 A;  1BIA A;  4P3P A;  4IHJ B;  3U11 A;  2QE7 G;  5ITZ B;  1EVK A;  1HTT A;  5LMN B;  1KC8 W;  2QSA A;  2YDE A;  4FFK A;  1X54 A;  3ML0 A;  4RQE A;  5KHJ A;  1BT8 A;  4YJ3 A;  4LVK A;  1XDC A;  1NJ2 A;  3E22 B;  4J9Y B;  1Q6H A;  2DZC A;  3WFV A;  2F23 A;  4W4L A;  1X56 A;  1XMQ O;  2IBZ H;  1H38 A;  1XNR B;  5BMV B;  4HT4 A;  4N23 A;  3BAA A;  2ZDI A;  4KP4 A;  1NBM G;  1CEZ A;  4X20 B;  2M7W A;  5LYJ A;  1MZE A;  3TJT A;  3RWR D;  4E2L A;  2F43 G;  4GX5 A;  4XU1 A;  1AI4 A; 
#chains in the Genus database with same CATH homology
 2A79 B;  4Q6G A;  1BBW A;  4GX0 A;  5CN0 A;  1X2H A;  4UVA A;  2ODR C;  4O2D A;  3SYP A;  4P72 A;  4TVW A;  1PNL A;  1YTF B;  2EZP A;  1W2B U;  3E9H A;  1JVM A;  1VQK V;  2QEX V;  4P72 C;  1K33 A;  4BIU A;  4FMT A;  3D3I A;  4JPR A;  1QE0 A;  3GB7 C;  2ZIO A;  3HRK A;  2HJF C;  4MW3 A;  4P74 A;  3QTC A;  1YI2 V;  1R6K A;  4X89 A;  2HVJ C;  2Q7G A;  2ARU A;  5HGQ A;  1K5Q A;  1EVL A;  3F7V C;  5C93 A;  1CPY A;  4JYC A;  4P74 C;  4P9P A;  3UFG A;  2P7T C;  2QHV A;  4YRN A;  4HWS A;  4PA6 A;  4HA8 A;  3MHH C;  2E10 A;  4YRE A;  3R65 A;  5EK0 A;  3HFZ B;  2EIL C;  2AHZ A;  2XAF A;  2Q5I A;  2C8M A;  4XU0 A;  2H8P C;  2JJ2 G;  1FS0 G;  1NR7 A;  3VBB A;  4RUF A;  2DZ9 A;  2QTO A;  3RKX A;  4LVL A;  2Q67 A;  4HZ3 A;  2OCC B;  4TQF A;  2ZR2 A;  4WFF A;  3TET A;  2DQ0 A;  1MOF A;  4JTC B;  1ADJ A;  4HWP A;  5LBQ A;  4FK5 C;  3ZMS A;  5C51 B;  3ZRW A;  2DVE A;  1NJ6 A;  2ZCE A;  5B1N A;  1Z7N A;  1AI7 A;  3OUF A;  4MVM A;  5LGU A;  3E2E A;  2AMC B;  2ZT8 A;  3OEH G;  2ZXW C;  1SZT A;  4YRT A;  1WQ7 A;  1ARO P;  3RUX A;  3LDD A;  2QHS A;  3ZMU A;  4PG3 A;  4UPA A;  2WLM A;  1VQL V;  3A5Z A;  1ASZ A;  4CS4 A;  3D36 A;  3IGA C;  4RMF A;  2RHQ B;  4YRS A;  2B5U A;  2IJK A;  3M4P A;  1Y4M A;  1VQ4 V;  4HYO A;  4MSW C;  3W7T A;  1B7Y A;  2EBO A;  4JGS A;  3HFZ A;  4ZKI A;  1WNL A;  1HWY A;  5F5W A;  4WJ3 M;  2DYR B;  3OMI B;  2DTH A;  4YRI A;  1K73 W;  3ABK C;  4DQ2 A;  2ZGW A;  1EIY B;  4PA7 A;  2NLJ C;  4TTV A;  2XND G;  4YRO A;  3TEH A;  3K0D A;  5ELN A;  2W0F C;  2FYK A;  3ABL C;  3ERR A;  3NXS A;  1E1R G;  3LUT B;  2ITC C;  1ASY A;  2YEV A;  2AMC A;  2P67 A;  3ZRS A;  4H33 A;  4XDK A;  4OLF A;  1YJW V;  2I4N A;  3VQV A;  5DN6 G;  4J9Z B;  1H8H G;  2WLL B;  1OCC C;  4XBF A;  4KQE A;  1NVP B;  5EC1 C;  1VQP V;  3ZN0 A;  4Q20 A;  3FJP A;  2IY5 B;  4FIP C;  4WFA V;  3SYO A;  5L3F A;  1KD1 W;  4PDL A;  1E1T A;  1WU7 A;  3ZMV A;  4NCX A;  1X01 A;  1GM8 A;  2X6C A;  3AEI A;  4GX2 A;  2RHQ A;  2DEQ A;  4HAM A;  2CJ9 A;  1GM7 A;  1OCO C;  2IH1 C;  4EKW A;  3G1Z A;  4P73 C;  3SYQ A;  1W0K G;  2ZIN A;  2X0L A;  1K9M W;  2DWE C;  3E8G A;  4UP8 A;  1KP2 A;  2UXN A;  4G84 A;  1WLE A;  3FB8 C;  3FB7 C;  2E64 A;  2DYR C;  3JD4 A;  2DDZ A;  4FPP A;  5IYC O;  4E51 A;  4ZTU B;  1BIB A;  3RF1 A;  2IW5 A;  2HVK C;  1L0W A;  3E83 A;  1NNH A;  4MVR A;  4UP7 A;  3AG2 C;  3AG1 C;  1F51 A;  1KP3 A;  1MAB G;  3ABU A;  4FJC C;  3UKM A;  2P90 A;  3MEY A;  3REU A;  2WLI B;  3EFF K;  5H6R A;  1H8E G;  1MG1 A;  3OMN B;  3B8N A;  1R3I C;  1SET A;  2GSM B;  1JQ0 A;  3FYE B;  3LSS A;  3P8Y A;  3HXZ A;  2WLH A;  4QIW F;  1VQM V;  2JDI G;  4MT8 A;  1Y66 A;  2AKW A;  3W7U A;  3RVZ A;  4QPK A;  3G71 V;  1RPR A;  3UM7 A;  4CS3 A;  1QF6 A;  4G27 B;  4MS2 A;  2P5I A;  2E5A A;  1G5H A;  1ZWI C;  4YRG A;  2MK3 A;  1AI6 A;  2EJF A;  3E8F A;  4WF2 A;  5LGN A;  1YSC A;  3F7Y C;  5KA5 A;  2ZNJ A;  2I4O A;  2EIL B;  3TEG A;  4N21 A;  2A9H A;  1R3K C;  1USY A;  4XEO A;  1I5X A;  4UXN A;  3JD2 A;  3W7S A;  4H2U A;  3K9A A;  1COW G;  1THZ A;  1USY C;  3L2Z A;  4CH4 A;  2WAM A;  1GTO A;  4YCU A;  1QCE A;  2HLD G;  4QPJ A;  4P3N A;  4AH6 A;  1PNK A;  3VQW A;  3OM3 B;  1K3E A;  3RL6 A;  3A7U A;  1M57 B;  1SES A;  2ITD C;  1XL6 A;  1KOG A;  4YP0 A;  1AJN A;  4JTD B;  2ZXW B;  5EC2 C;  2WLI A;  3OMA B;  1C0A A;  2WSS G;  4DO2 A;  2QM7 A;  2XAS A;  3OR7 C;  5H6Q A;  1FXK A;  2NNU A;  5EBM C;  5B1B C;  4RO2 A;  4BIZ A;  3HY0 A;  3PZC A;  3BY6 A;  1N8R W;  4YRP A;  1YB3 A;  3HB3 B;  4WFG A;  1FXK C;  4XTY A;  3P32 A;  1SRY A;  2DYS C;  3ZMT A;  5LHH A;  2P6J A;  4JAU A;  3MF2 A;  5DM6 V;  3ZN1 A;  3IKL A;  4BW9 A;  1YGB A;  3LNM B;  3CCE V;  3B8M A;  12AS A;  1S3J A;  3VOU A;  3M99 B;  4YRK A;  4PDM A;  3DSQ A;  4P75 A;  3PCO B;  1HC7 A;  4LNS A;  4CH3 A;  4CS2 A;  1Q7Y W;  1JPX A;  1B7Y B;  4WFH A;  3ABK B;  2OTJ V;  1XL4 A;  4X88 A;  3STZ C;  4G28 B;  4P75 C;  4K86 A;  4BWA A;  4R6Z A;  4XTZ A;  1M56 B;  3E8H A;  4P30 A;  5GW7 A;  4ASU G;  1H4V B;  3DTU B;  3JYC A;  3CPW U;  3KFU A;  3QO5 A;  3ABL B;  1NYQ A;  2EIK C;  4Q15 A;  3CD6 V;  2ZR3 A;  3IC7 A;  4KFM A;  4TVA B;  3UGT A;  4RUE A;  3TEH B;  1UJW B;  2GHY A;  2JEX A;  3T2M A;  3W7X A;  4XTW A;  1M1K W;  1JCH A;  2BOC C;  1L1F A;  1PYS B;  4DPG A;  3HRI A;  3V8K A;  1OCC B;  1BL8 A;  1M57 C;  4MVZ A;  2YEV B;  1S5H C;  2OT5 A;  4UUJ C;  5CBG A;  2EIM B;  1EQR A;  1LYL A;  4TWA A;  4G2K A;  1G8M A;  1ATI A;  2DU5 A;  4YRR A;  1E24 A;  1BBU A;  3CP1 A;  2I4L A;  2I4M A;  3SYC A;  3X2Q C;  2JEU A;  4PHC A;  1EZJ A;  2JJ1 G;  5B1O A;  4LVM A;  1S72 V;  2QHT A;  2XAJ A;  1X55 A;  4DXW A;  2IU0 A;  4GT1 A;  1GMG A;  3R07 A;  1OCO B;  4OP0 A;  1M9N A;  5KA6 A;  1K8A W;  3EFR A;  5L3D A;  5LHI A;  1Q81 W;  3RGL A;  3K08 A;  3V8L A;  3OR6 C;  2D3O W;  5CBF A;  1FXH A;  1WQW A;  3PCO A;  3SPH A;  3RW0 A;  1PNM A;  1VQN V;  3ASO C;  4P9O A;  3LSQ A;  3I55 V;  2EIJ C;  2ZZG A;  3AG3 C;  4H2T A;  4LCU C;  1NYR A;  3TK1 A;  4YRL A;  4L87 A;  1YIT V;  3K03 A;  3AG2 B;  2DQ3 A;  3AG1 B;  3K0G A;  1G51 A;  3QO7 A;  2DKG A;  2DJZ A;  3V8J A;  2XAQ A;  2EIN C;  3I56 V;  4QE9 A;  1M56 C;  4TVA A;  3OUS A;  3LDE A;  3ABM B;  3CCQ V;  3L4G A;  5EBW C;  3RAC A;  4CBC A;  1K4C C;  4U7O A;  3E86 A;  4Z1M G;  1V55 C;  2FTK A;  3B77 A;  2ZQM A;  1YIJ V;  1PYS A;  3P8V A;  3ETE A;  1J95 A;  2Q68 A;  3K79 A;  2HFE C;  5L3G A;  2QKS A;  1S0V A;  3TCU A;  1KEC A;  2A0L A;  2E1H A;  4F4L A;  2NS6 A;  5IYD O;  2AKW B;  5E3I A;  1K7D A;  3WQZ A;  1RIQ A;  2EIM C;  3KG2 A;  2EJ9 A;  5CA3 A;  5L3B A;  1W66 A;  3EFS A;  2CGH A;  3L1A A;  3STL C;  1S76 D;  1QLN A;  1R6N A;  2B1I A;  1AJQ A;  4P73 A;  5LHG A;  3RIR A;  1NH2 D;  2EAY A;  2XTI A;  1F4N A;  1JOY A;  4OXS A;  4PA3 A;  3NET A;  1QVF U;  4WJ4 A;  3FB5 C;  2ART A;  2Q6A A;  1ORQ C;  2Z5U A;  3SPJ A;  4R7C A;  2PI4 A;  3ZMZ A;  5HFL A;  2C7I A;  4LC1 A;  4H2X B;  3HXW A;  3UGQ A;  3CMA V;  1OCR C;  4KR3 A;  3CC7 V;  1K4D C;  3HXU A;  2ARS A;  3IAL A;  5C53 B;  1FXV A;  2UXX A;  5B3S C;  3ZCC A;  1J5W A;  3P8T A;  3V7R A;  3I7F A;  4R8C A;  1SER A;  2G4C A;  4YRC A;  2IU3 A;  5IY5 B;  1B76 A;  4YRQ A;  1NQT A;  2IJI A;  1TUE B;  2ZD9 A;  3CME V;  4TT3 G;  4WF9 V;  1K5S A;  2X6B A;  5B1B B;  3CCS V;  4HWO A;  3ABM C;  4H02 A;  2E65 A;  3SPI A;  4JF3 A;  1AJP A;  1FXK B;  1NKD A;  2DYS B;  1K97 A;  1P4R A;  2EJR A;  4MTF A;  3WG7 C;  1VQ6 V;  1B70 A;  4MTG A;  2WPD G;  3EHB B;  1YFT A;  4CH6 A;  4KR2 A;  4HVC A;  3ZRV A;  2ZT6 A;  1Q86 W;  3NEL A;  2IJH A;  4J15 A;  4UP9 A;  1QBZ A;  1K92 A;  2OTL V;  4JAS A;  2Y69 C;  1G5I A;  3FB6 C;  4X8A A;  1OCZ C;  3CCL V;  2ZT5 A;  3IG2 A;  1DF5 A;  1NJ5 A;  3MF1 A;  1EFW A;  3MHS C;  2WLJ A;  2QA4 V;  3F5W C;  4I5S A;  2ZIM A;  1JJ2 U;  3BFM A;  3P30 A;  1DF4 A;  3V7S A;  2EZO A;  4EX5 A;  4WFB V;  1QLE C;  2AHY A;  3T4Z A;  3IFX A;  5KNN A;  3SPG A;  2EIK B;  1NR1 A;  3ZJZ A;  4H2X A;  2QHU A;  3HXX A;  4ZTZ B;  4XU2 A;  4ZIB A;  3BEH A;  3HPL C;  5L3E A;  1GM9 A;  3LDC A;  4QNH B;  1DTO A;  4RQF A;  2CIM A;  5L3C A;  4JYB A;  2DWD C;  1BMF G;  1IXM A;  2WLK A;  2R9R B;  2YSU B;  1V54 C;  3JD0 A;  4KUM A;  5IDJ A;  4K87 A;  5K1X A;  2J3M A;  1F23 A;  2ZNI A;  3MD0 A;  2IJJ A;  4UVB A;  5B1A C;  3X2Q B;  3T1C A;  3E8B A;  5IY5 C;  4XTU A;  1YTF D;  2PI5 A;  4TWK A;  3ETG A;  3M4Q A;  1FFT B;  4MTX A;  3W7W A;  1I5Y A;  4GCZ A;  1JJC A;  1EFR G;  2XOK G;  4MVS A;  3CCV V;  1BHA A;  1GKF A;  1N9W A;  3QO8 A;  1YFS A;  3IKM B;  4LP8 A;  2B1G A;  1YJN V;  4I9W A;  2EJG A;  2HKO A;  4MVQ A;  1VQ5 V;  3ASO B;  1GGM A;  2EIJ B;  3ICA A;  3AG3 B;  4HWT A;  3A7A A;  4MTO A;  1F4M A;  1AR1 B;  4WCE V;  3JCZ A;  1KMN A;  1EBO A;  1AI5 A;  4R50 A;  1ADY A;  2XGT A;  3AG4 C;  4RAI A;  2EIN B;  3RVY A;  3A32 A;  4YYE A;  4GX1 A;  4PDV A;  4XDL A;  3OAA G;  3A7R A;  4G85 A;  4YCV A;  4CH5 A;  2W6I G;  3K06 A;  2ZZE A;  4LVJ A;  1V55 B;  3A0R A;  1W0J G;  4WFE A;  5FL7 G;  3JD1 A;  4QJF B;  3G6E V;  1H4T A;  4JAV A;  3L4G B;  1GK9 A;  3ASN B;  1RM1 C;  4XU3 A;  3DGE A;  1YJ9 V;  1VQ9 V;  1NJ1 A;  2J3L A;  3E89 A;  2XAG A;  4UV8 A;  1G4Y B;  3MQZ A;  4LVI A;  1PL0 A;  4P2Z A;  5BZB A;  3A74 A;  3HXV A;  5EBL C;  5C52 B;  3ETD A;  4TQD A;  5ELO A;  2DTO A;  1EOV A;  4BAY A;  1WPX A;  1Q82 W;  2CJA A;  1QR9 A;  2V1D A;  2LP7 A;  2E3C A;  3CCJ V;  3HFV A;  4H2S A;  1H4Q A;  1H4S A;  1IL2 A;  4U7N A;  1YFR A;  3RKY A;  1OCR B;  1ROP A;  2WLN A;  3RKW A;  3UH0 A;  3CCR V;  3SPC A;  2X6A A;  3OD1 A;  4YXW G;  1R3J C;  1DLB A;  4MVO A;  5B3S B;  3CCU V;  2EL9 A;  2PME A;  1VQO V;  4XTV A;  1OZ0 A;  2E41 A;  5IYB O;  2EWN A;  4H2W A;  3E35 A;  3HY1 A;  1M90 W;  3NEN A;  3HTZ A;  3FYI B;  3OGC C;  4YRM A;  3T4D A;  2XAH A;  3K3W A;  4PDR A;  5CBH A;  3W3S A;  3PJS K;  2Q7E A;  2DW4 A;  3WG7 B;  5H9C A;  3OE7 G;  4CZZ A;  3A31 A;  1Z7M A;  3ASN C;  3CXC U;  3OEE G;  3CCM V;  3CMQ A;  1RPO A;  2QM8 A;  1B70 B;  1NVP D;  5KUK A;  4H37 A;  5E1A C;  2K1E A;  1BHB A;  2DXT A;  2R9I A;  2HNI A;  2PMF A;  3A5Y A;  2Y69 B;  1NJ8 A;  1OCZ B;  1KKD A;  1VQ7 V;  4XDJ A;  2ALY B;  1ENV A;  1NJI W;  1GO3 F;  1VQZ A;  5LGT A;  2A8E A;  3TUP A;  1QLE B;  1YHQ V;  4HWR A;  3H01 A;  4MW8 A;  4K88 A;  1E1O A;  2H94 A;  2OCC C;  3SYA A;  1H2G A;  3OW2 U;  2CJB A;  1LNQ A;  2ZTG A;  3BJU A;  1P7B A;  4EO4 A;  1R73 A;  1V54 B;  2DXU A;  2ZXF A;  4XTX A;  1K34 A;  2DU7 A;  2BOB C;  4YCW A;  4H2V A;  5KUM A;  4ZBM A;  2RHS B;  3VQY A;  5K1P A;  2WWW A;  1MSW D;  3CYO A;  4JTA B;  2DTI A;  4TVY A;  4YPF A;  5B1A B;  2ODR D;  4UV9 A;  1PKX A;  1WPY A;  2ATK C;  2HR3 A;  1X2G A;  2LFR A;  1OHH G;  2HG5 C;  4P71 A;  1NH2 B;  4PEL A;  2Z3Y A;  2Q7H A;  2ZZF A;  4P3O A;  4P71 C;  4LBE C;  3RBZ A;  3LC0 A;  4PA9 A;  2JIZ G;  1JJC B;  4XEM A;  3VQX A;  1FYF A;  3G4S V;  1KMM A;  1JX9 A;  2X7R B;  4H2Y A;  4YDQ A;  1CP9 A;  4UVC A;  2ALY A;  1E1Q G;  4YRJ A;  3SJQ C;  4MVU A;  2V7Q G;  1EIY A;  1QR8 A;  3QNE A;  1BIA A;  4P3P A;  3AG4 B;  2QE7 G;  3ZIA G;  4X5O A;  1EVK A;  4PA4 A;  2W6J G;  1HTT A;  2JK5 C;  2LFS A;  1KC8 W;  2Q5H A;  4RDX A;  4TSF G;  1QVG U;  1WYD A;  1X54 A;  3ML0 A;  4RQE A;  1B6Q A;  2WLL A;  3JD3 A;  4QE7 A;  2IH3 C;  2RHS A;  4YRF A;  5J9P C;  3E9I A;  3CC2 V;  2ZT7 A;  4LVK A;  1RM1 B;  2IY5 A;  1NJ2 A;  4WI1 A;  3OFN G;  4J9Y B;  2DZC A;  2CK3 G;  3REX A;  3WFV A;  1KQS U;  1PD3 A;  2Y48 A;  3HXY A;  3GWO A;  3ZRX A;  1X56 A;  1H38 A;  3K04 A;  3CC4 V;  4HT4 A;  4N23 A;  1S77 D;  2KB1 A;  1HXD A;  11AS A;  2ZDI A;  4KP4 A;  3NEM A;  1NBM G;  5CMU A;  1CEZ A;  1E79 G;  2M7W A;  2Q69 A;  4BW5 A;  3V7C A;  2ZDI C;  3ABT A;  1E22 A;  1B8A A;  2C2A A;  3FKS G;  2P0L A;  4E2L A;  3ZRW B;  1VQ8 V;  2F43 G;  5HFM A;  4GX5 A;  4XU1 A;  1R3L C;  1AI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...