2DQ3A

Crystal structure of aq_298
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
425
Chain Sequence
MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGTDVIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aq_298
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
total genus 133
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dq3A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dq3A02
3HFVA 1ATIA 4YCWA 1BBWA 2QHSA 1NJ6A 4HWSA 1EFWA 2EJ9A 2PMFA 4ZTUB 3HXZA 2E5AA 4X5OA 4P75A 1E24A 3HFZA 1B7YA 3QTCA 5ELOA 2E64A 3UGQA 5ELNA 2ALYA 2ARUA 4WF2A 3BFMA 2DU7A 3WQZA 4P73A 2Q7GA 1GGMA 2DTOA 2J3MA 1G51A 4K87A 4P74C 1WU7A 1IL2A 3NEMA 2AKWB 1HC7A 3E9HA 1WQ7A 3HFZB 3IALA 4YRMA 5C51B 4CH6A 2ARTA 4H2UA 2EWNA 4TTVA 1EQRA 3MF1A 3QO5A 3PCOB 3L1AA 1BBUA 3LC0A 4H2VA 4G85A 3M4PA 3V7SA 3NETA 2ZT8A 4P75C 3RKWA 4P3NA 1YFSA 2C7IA 3EFRA 3HXYA 2DQ0A 4L87A 2ZNJA 2CJAA 3V7CA 3PCOA 11ASA 4XTVA 2EJGA 3UH0A 4YRTA 3NENA 3M4QA 4UP9A 3IG2A 3IKMB 3TEHB 4TVAA 5C52B 2AMCA 4DPGA 4H2YA 3PZCA 2DQ3A 1E22A 4YREA 2RHQA 4YRSA 1USYA 4CH3A 4TVYA 2E65A 1PYSA 2I4OA 2XTIA 3HTZA 1NJ8A 3UGTA 4DQ2A 4Q15A 2E10A 4YRQA 2CIMA 2ZR3A 1JJCB 3HY1A 2DDZA 1ADYA 1H4VB 3VQXA 1EIYA 2P5IA 1SRYA 4XTUA 4ZIBA 4YRKA 4AH6A 4XU3A 3HXXA 4BWAA 3R07A 2CJBA 1HTTA 3TEHA 3A7RA 4RMFA 2EJFA 4EX5A 1YFRA 2ZXFA 4P72A 4K86A 4Q6GA 2DEQA 3L4GA 3MEYA 2ZZEA 1G5HA 2EL9A 2ZINA 2QHUA 4HWTA 4TVWA 5KNNA 2ZT5A 4BW9A 4XU0A 2DTHA 1WPYA 3A7AA 4HWPA 4P72C 1NYQA 3RKYA 2I4MA 1B70A 4YRPA 3CMQA 3V8JA 2ZIMA 3NELA 4YDQA 1Z7NA 2HNIA 1J5WA 1H4SA 2P0LA 2QHVA 2ZGWA 2E41A 3HXUA 5K1PA 4YROA 1EVLA 3HRKA 4H2TA 1ADJA 3OD1A 1NJ2A 4HWOA 4YRCA 2EAYA 1BIBA 1SERA 1X56A 1NJ1A 1B8AA 4G84A 3HXWA 4CH4A 1C0AA 4KR3A 4YRJA 3P8YA 2ZZFA 4P71A 2IY5A 4YRNA 1YB3A 1B70B 1X54A 4KR2A 2ZT6A 1G5IA 1PYSB 1KMMA 3HXVA 1WNLA 4YCVA 3G1ZA 5HGQA 2DJZA 1WLEA 3LSQA 2ZT7A 3BJUA 4K88A 3A7UA 4UPAA 2DXUA 4XTXA 2I4NA 4ZTZB 3V8LA 2CJ9A 4H2XA 1BIAA 4P3PA 1W66A 1QF6A 2XGTA 2DTIA 3REUA 3V8KA 1H4QA 3EFSA 2I4LA 2PMEA 3KFUA 2DVEA 2E3CA 3DSQA 3IKLA 3VQVA 3A5ZA 4YRFA 1E1OA 2ZIOA 3P8TA 1ASYA 5E3IA 4TVAB 4YRRA 1SETA 3VBBA 4YYEA 4YRIA 4TWAA 3MF2A 1JJCA 3RL6A 2ODRD 4HWRA 5K1XA 3A5YA 2G4CA 2J3LA 4OLFA 2C8MA 4HA8A 2ZZGA 3QNEA 4E51A 1HXDA 4YP0A 1NJ5A 4HVCA 1ASZA 1X2GA 3V7RA 4OP0A 3A31A 3VQYA 1WQWA 2Q5HA 2Q7HA 1NNHA 4CS3A 4YPFA 3REXA 1B76A 2ALYB 4LNSA 1LYLA 5C53B 3QO7A 2ODRC 1EIYB 4NCXA 4YCUA 2AKWA 1EOVA 1EVKA 3ICAA 4PHCA 4RDXA 4XU1A 2RHSB 3FJPA 3RACA 4WJ3M 1QE0A 3P8VA 1L0WA 1E1TA 2DZ9A 4WI1A 4PG3A 3QO8A 2QHTA 2IY5B 3L4GB 3RUXA 2ZR2A 4XTZA 4J15A 4H2SA 2E1HA 2AMCB 3RIRA 4KQEA 3HY0A 1Z7MA 3RGLA 1USYC 2RHQB 1NYRA 3L2ZA 4P74A 4CH5A 3W3SA 1X2HA 3ERRA 2DZCA 2ZNIA 1RIQA 3TEGA 1YFTA 4H2XB 2ZTGA 3LSSA 2CGHA 2FYKA 12ASA 2Q7EA 4EO4A 1WYDA 1X55A 4P3OA 4RQFA 3TUPA 4H2WA 3UFGA 2ARSA 4TQDA 2RHSA 4RQEA 2ZCEA 3A74A 4XTWA 3RKXA 4O2DA 3RF1A 1KMNA 2DKGA 4P71C 4H02A 3VQWA 2Q5IA 4XEOA 4UP8A 1KOGA 1VQZA 2DXTA 3E9IA 4XEMA 2DU5A 1FYFA 3I7FA 4P73C 4XTYA 4XU2A 4WJ4A 5F5WA 4YRLA 1H4TA 4CS4A 4YRGA 3A32A 4TQFA 4CS2A 1X01A 1SESA 4UP7A 1B7YB 3HRIA 1N9WA 1YGBA
chains in the Genus database with same CATH superfamily
1I94O 3BRCA 1W0KG 1ATIA 1BBWA 3AG7A 4O4IB 2QWNB 1R3LC 1KUQA 1Q43A 1J5EB 1EFWA 3N2KB 2EJ9A 5IY5C 1RFYA 2HKOA 5CBHA 4ICGA 3DTUB 4LF9B 1GH6A 2NR5A 1KKDA 5H6RA 2BSKB 4GT1A 1AROP 1H8HG 1BMFG 1B06A 3A0HZ 3QTCA 3K59A 1XL4A 1R6NA 2KG7B 5ELNA 5L3CA 4P73A 2CTWA 3FYIB 2Q7GA 3WFVA 2YS8A 4LR3A 1YVWA 5JVDB 5FL7G 1YCIA 4U3JB 3MHSC 4PA6A 1IL2A 3JYCA 1ZUQA 2VQEO 5E1AC 3SPIA 2ZQMA 4FZ1A 2DJVA 4OPAA 4H2UA 1EQRA 4PV1B 1IBMB 2W0XA 1R3JC 1NT2B 3CCMV 1BBUA 4PA4A 4DR5O 2P7TC 2ZM6B 4G85A 2XAGA 2AXTZ 1AI7A 4FLTA 1Q90D 4X8AA 5B3SC 3ZHVA 5JH7B 2ZT8A 2KB1A 2IJIA 4P3NA 1R6KA 3M7MX 2YXHA 5ITZB 3K3WA 5CA0A 3OMAB 4X65B 2ZNJA 3CPWU 3BABA 3PCOA 4XTVA 3TGUH 4DUZO 4DR6B 4FLVA 2BTQB 3NENA 4FLYA 3HKDB 1N34B 2R9IA 4FM2A 4AQYB 2YC0A 3W7UA 3PZCA 1NZ6A 1P84F 1Q8IA 3BFRA 3OUSA 1WA8A 2EIKB 2RHQA 4WBNB 5LXTB 2QR4A 4J7KA 2E65A 1NTKH 3PN1A 1X59A 4MVMA 3OTFA 1NJ8A 4NTWA 5LA6B 4N23A 4W4KA 2JS3A 2EILB 2ZM6O 5GTIZ 1J95A 5DEDA 2OCCC 3JASA 2E10A 3JD4A 4YRQA 2CIMA 3IGAC 5D5QA 4QE9A 2DDZA 1IBMO 1GKFA 2PI5A 5EC1C 1M5IA 1SQQH 3JAKA 3MHHC 4O4IA 1W2BU 2UXXA 3E8HA 1EIYA 1SRYA 2ZXWC 2ADPA 4C7UA 4XTUA 4ZIBA 2PI4A 4AH6A 2P6JA 3RFRA 1NR7A 2YXYA 2Q5ZA 2Z5UA 1BL8A 1K33A 2CJBA 2MW2B 3OTOB 2RDCA 4U7OA 1L1FA 4UV9A 2NLJC 4TT3G 3A7RA 4RMFA 1V55C 1XBLA 1QLNA 2VWJA 2UXBB 1M57B 2XUMA 3HB3B 4K86A 4TSFG 3CD6V 2DN9A 4XDJA 1VQ5V 5J2UB 1P7BA 2ZZEA 3ZHSA 5J2TB 4X88A 2X6CA 2DWDC 1PL4A 4HWTA 4FMTA 4BW9A 1Z2GA 2A9HA 3A7AA 2Y0IA 1SA0B 1ZAUA 1JVMA 1AP5A 4PA7A 5LOVA 1VQ9V 3BPZA 4UCOA 3T4ZA 1IZ3A 4LFAO 2LW7A 1QLEC 4DR2B 4B3RO 5JH7A 3TXQA 4EFBA 1S76D 5JCOA 4H44B 5CA1A 3B2EE 3ZRXA 2QHVA 3RVYA 5A2QN 3K03A 3JD2A 3BA8A 3BEHA 5L3FA 4KHPO 4HWOA 3IFXA 1R1BA 4X66O 4AILC 4JZGA 1Q6IA 2DWEC 1VF7A 4HAMA 1BIBA 4CH4A 3ZRVA 3TK1A 2R70A 2ZZFA 4LF4B 5IYDO 1JMKC 4F6RB 3E2EA 2XTAA 1JOYA 4O2AA 4JI3B 2YI8A 2DMXA 1M9NA 4TV9B 2LJ2A 5A9GA 1WNLA 3AG2B 4PD4F 1HNXO 3LSQA 1G4YB 1H2SB 5L3GA 3HPLC 1XREA 3L9DA 3CMAV 1NVPD 5B1BB 4XTXA 5JCOC 2UUAB 1K97A 4DV5O 4LFCO 1VQ8V 4H37A 5FPOA 1XNQB 1URFA 1W0JG 4ZBMA 3B4SA 4LNUB 2DTIA 1SZXA 1H4QA 5CBGA 1YIJV 4EB6A 5LXTA 1N4CA 4WFHA 4FM0A 3KKYA 1NS1A 3QVNA 3H1JH 3DSQA 3OTOO 2QM7A 2YIBA 2GTAA 4I5SA 3VQVA 4JV5O 1NVPB 1Q6UA 2WA4A 2ZIOA 2UUBO 1VARA 3C3TA 5E3IA 4NXNO 1SETA 3SYCA 4IT5A 4DV4O 5DN6G 1U96A 4HWRA 2WLLA 5F2VO 2C8MA 3JD0A 2ZZGA 1GK9A 2F93B 1HNWB 2W0FC 1PP9H 3V7RA 4B3MO 4OP0A 4H0LB 3CWBH 4DK0A 2XNDG 3DC6A 1NQTA 1HR0O 4I4TA 3RYIB 4Z1MG 3SPJA 4CS3A 4L8JA 1KMIZ 2NNUA 3CRQA 2ZKOA 1R3IC 2ALYB 3REXA 4LF6B 3AK3A 4LF5B 1HR0B 3CCEV 1N36O 4YCUA 5CA1B 4MVRA 3ZX6A 4MTOA 2AKWA 3J81N 3ICAA 2RN9A 3ASNB 3DC5A 4PDLA 3I55V 1OJHA 2P5OA 3FB6C 4KL1A 4HBNA 4UCSA 3RACA 5ITZA 3CS5A 5IYCO 1EN5A 1OCZC 3T4DA 1NI8A 3IC9A 1E1TA 3AG3C 4DV4B 4WI1A 4LVMA 2YEVA 4PG3A 4XDKA 5J2TA 1PV0A 1NJIW 4QPKA 3LNNA 4XTZA 4J15A 4DV3B 4LVKA 2E1HA 4B3MB 4GX2A 3RIRA 4DV2B 2ATKC 2V4DA 1AI5A 1LUWA 1USYC 1MABG 1IBKO 4I4TB 2FB5A 2QKCA 2ZE8A 1Y6XA 1X2HA 3OMIB 2ZNIA 5B1NA 2Y4UA 4G28B 4RWUA 1YSCA 2FYUH 1JFFB 3OFNG 5C8YA 1AB3A 2CGHA 2IU0A 2FYKA 4AQYO 4MTFA 1YDXA 3OR6C 4GKKB 1FAFA 4DR7O 4EO4A 1K92A 2E76B 4YJ2B 2LGWA 3ZS8C 1Y74B 3ABUA 2A06H 4I55B 2AHZA 2VRZA 3HR0A 1H2KA 4XTWA 4YHHO 3MAQA 3RKXA 1N0NA 5LYJA 3WG7C 4NTYA 4EFEA 4MTXA 4P71C 4DW0A 3H1LH 4LH6A 2HJDA 1DF5A 1RPOA 5JWPA 4UB8Z 2FMLA 2WA3A 2YI9A 3O65A 1WA8B 4XEMA 3Q4HB 1HNZB 1FYFA 4P73C 4DV0B 2LO1A 4PI2A 4JI1B 4KXRA 5BXZA 1EN6A 1QNMA 2JDIG 4JTAB 3ZEDA 4YRGA 2CTQA 2YXLA 2EIMC 2Z0AA 4PDRA 4WFGA 3HRIA 5H6QA 4JI2O 3CCSV 3ZCCA 4H33A 4JI5O 2UXNA 3RYHB 2W6JG 1NU1H 1D2DA 2P4VA 1SQFA 1BGYH 3C3SA 1S0VA 4HWSA 5BR8O 1IURA 3AG2C 2PMFA 1NTMH 1JJ2U 4ZTUB 2L35A 3LDDA 3HXZA 1B6QA 4DR2O 4B3RB 5LYJB 4P30A 1E24A 4D7TA 3HFZA 1XUQA 1Y76B 4K0KO 3NXSA 1Z5VA 1G1XB 4DV7B 2HVKC 3UGQA 4CZZA 2WLIB 2DTOA 3JCZA 3P30A 2J3MA 4GZRB 1RM1C 1WU7A 1VQ4V 4XBFA 3IAYA 1HC7A 2P67A 1FYJA 4GX1A 1WJZA 1GN4A 4NTXA 2DYRB 3IALA 2LFRA 4WFFA 4YRMA 3STLC 1HNZO 4TTVA 3QO5A 4NVPA 2ZD9A 1RSOA 5KHHA 3PCOB 4DW1A 4JI2B 1FS0G 4OXSA 4H2VA 4OX9B 2YEVB 2XOKG 5JJJB 2DW4A 5DECA 1XI1A 1QR9A 1FXKB 1K7DA 3NETA 4UCVA 2JJ2G 4IIJA 3RKWA 2Q73A 2HJFC 3SYPA 3JARB 4DR4O 1JPXA 1AR5A 4L87A 1PNLA 2GUZA 3V7CA 5EIBC 11ASA 4X64O 3CRRA 3C90A 1N8RW 3ETGA 4JAVA 1EN4A 2X6AA 4FM1A 2BOCC 1FPOA 4DUYB 5LA6A 4DYLA 3IKMB 2OIEA 4PELA 4DPGA 1K4DC 1S77D 3PJSK 5HFMA 2JEXA 3OGIB 3E89A 4DXWA 1E22A 4YRSA 4X65O 2CUGA 2Q0OC 3D3QA 4TV8A 1MSDA 5BY1A 3UGTA 5DM6V 1BZKA 2UU9O 4FJCC 4E2LA 3JD3A 3CC7V 5CBFA 1HDJA 2ZE5A 1R3KC 1VEWA 4BIZA 4FLUA 5L3EA 1ZWIC 3E35A 3LSUA 1IBKB 2EJRA 4Z1VA 3CB2A 3FFQA 2PUSA 4YRKA 2VQEB 3CXHF 2QE7G 5LP6C 4K3AA 4DR3O 2OCCB 3CCJV 3OEHG 2A3QA 2BOBC 2XASA 1YJ9V 2CH7A 1FKAO 1THZA 1E1RG 4TV9A 3ETDA 4HT4A 3HKEB 5CMUA 4JI7B 4Q6GA 4ZHQB 3AG4B 3M99B 2DEQA 1VP7A 3F7YC 3DGEA 3JAWA 1U97A 2AHYA 4R8CA 1IXBA 1J5EO 5KNNA 3FX7A 4D7SA 3OD4A 5KX5B 1H2GA 1B70A 4YRPA 3CMQA 3JCUZ 3AK2A 2X0LA 3U0ZA 2IM9A 4JYBA 4LF9O 3THOA 4FLWA 1JJOA 1Z7NA 4YY3B 4J11A 1P49A 2JK5C 3ZBHA 4Z2WA 4UUJC 1OCOC 2ZGWA 4F4LA 2E41A 1SQGA 2R9AA 3GVMA 3VOUA 2IW5A 5K1PA 3HXUA 1EVLA 4DV1O 3LDEA 1WPXA 1HNWO 4HNAA 1K5QA 2ITDC 1ADJA 5E79Z 3J80N 1NJ2A 3E83A 2DYSB 3F5WC 4K8XA 1ENVA 1H38A 1SERA 1DF4A 1B8AA 3HXWA 1C0AA 1GN2A 2ZDIC 4JI5B 4LFCB 4UVAA 4YRNA 4HYOA 3CRAA 3RYIA 4KR2A 1KD1W 3X2QB 1G5IA 2P4KA 1AILA 1EFRG 1KMMA 2IH1C 2RMKB 1X4TA 2EINC 3G1ZA 3T1HB 1FFTB 4LC1A 1WLEA 4O2BA 1K4CC 1UJWB 1H2MA 3D3IA 5FPRA 4UCRA 1XNRB 3BJUA 4K88A 4JI8O 4YIOA 2DXUA 5IJ9B 2I4NA 4DR5B 4ZTZB 4YJ3B 4ASUG 4TOIA 4GYCB 4CC5A 3OE7G 2HLDG 1CEZA 1PPJH 1W66A 1QF6A 4HZ3A 2QM8A 2AW9A 1FXVA 2I4LA 2O57A 2PMEA 1IBLB 4PA3A 5JJNB 3A5ZA 4YRFA 4J7ZA 3ZRWB 1E1OA 1ASYA 2Q0AA 3G4SV 3VBBA 4YYEA 1QCEA 4DK1A 1N33O 1TVKB 4R50A 3MF2A 5KA6A 5K1XA 2J3LA 4UCUA 4HA8A 1DGSA 5BZBA 2HG5C 1K8AW 4X64B 2Y69B 2UUAO 2N04A 2W6IG 1JR9A 5KMGB 2OTLV 4NKGB 1OCCC 1BS3A 1M57C 3X2QC 5KHGA 2Q7HA 4B7KA 5KLVH 3ABMB 1B76A 3CXCU 1XMQO 1LYLA 2JS5A 1EIYB 2Q67A 1O9GA 1AP6A 5IY5B 1G8MA 2E5LO 2H3OA 3APOA 2VQFB 1WP8A 4I50A 1KBHA 2XAFA 3ZMTA 4PHCA 1SC5B 3UT5B 1FXKA 3K04A 4X1YA 4XU1A 3ZHQA 1VF5B 1M93A 2QWOB 2G38A 2ZDIA 1UFIA 1TVKA 1WAZA 1KYOF 4UXNA 4A5UB 4WCEV 1CP9A 1Y76A 1L0WA 3T1CA 2QHTA 2IY5B 4OPHA 4DV1B 3L4GB 1XMOB 5B3SB 4J9YB 2YIDA 2K1EA 4LFAB 3UM7A 1PM9A 4WF9V 2KSDA 1K34A 3TETA 1NTZH 4JASA 3E8BA 3HY0A 1BT8A 4X1KA 3RGLA 1S5JA 2FTKA 5KUKA 3K5OA 3QG5A 3FYEB 3W3SA 2P90A 5EBMC 3ERRA 1WPBA 2Y69C 4NR1A 3HKBB 5CB4A 1RIQA 1BHBA 2QWRB 1VQ7V 3OM3B 2WWWA 1KQSU 1YFTA 2DE0X 3LSSA 3SJQC 1H2LA 4MSWC 2Q7EA 2WLNA 4HNAB 3ICXA 1VQMV 2ODMA 4B3TO 4QIWF 3KZIZ 3FD9A 4K35A 3UFGA 4YXWG 3W7XA 1GM8A 3JALB 4RQEA 1XEQA 3DXRA 3RF1A 3SJCC 4X1IA 4J41A 4D6TH 1VQKV 3G71V 2QJ1A 4PA9A 3VQWA 4H02A 2CDYA 3OMNB 5EBLC 5LGTA 1D5AA 1XNQO 4DR3B 4JTDB 2Y48A 3KCYA 2Q8VA 2YUAA 1KOGA 1VQZA 4JI0B 4JI0O 5KHKA 1JFFA 4LNUA 5C8YB 4FLXA 3KG2A 5B1AC 1MMMA 4ZKIA 1RP3B 4WJ4A 1MA1A 1VF6C 3G6EV 3RBZA 4ZHQA 2F66C 2QWQB 3K9SA 1H4TA 1VQOV 3T2MA 4B7EA 3F7VC 3A32A 5EIBD 2ADQB 5LGNA 1OCOB 1BQZA 2GUZB 1N9WA 3HFVA 4YCWA 1GN3A 2UXDB 4MVUA 2BTQA 3E22A 2YICA 2Q6AA 2F4VO 3DXRB 5KMGA 5EK0A 2XHBA 5EYPB 4X5OA 2IH3C 2A79B 4WFAV 3BAAA 2CAZC 1B7YA 1NH2D 5ELOA 1YITV 3S3XA 1XOUA 4JF3A 1EBOA 2ALYA 2ARUA 3BFMA 3WQZA 1TA8A 3WB0A 2VS0A 2P22C 1G51A 4DRXA 3T1YO 5TISZ 2ZT9B 4K87A 2R72A 1SS3A 2AKWB 1FJGB 1XDCA 3L74H 2UUCO 3ZRSA 1IX9A 3E9HA 1WQ7A 4PJ0Z 4B08A 5C51B 4CH6A 2EIMB 3UKMA 2EWNA 3MF1A 4RUEA 5LMUB 3L1AA 1QLEB 2PF4E 5LMUO 4LF6O 1UPGA 4WFEA 3M4PA 2B5UA 1I0HA 1F4NA 4O4LA 1YJWV 4LP8A 3ZJZA 3SR2C 3IJ4A 1YFSA 3JATB 1L0NH 5IDJA 3R65A 1XMQB 2CJAA 2EILC 4DV6O 1AJNA 3CSXA 2PYJA 2RCVA 5LHHA 2EJGA 3ABMC 4YRTA 1D5NA 4JI4O 3BHPA 3CEIA 1Q6HA 1OCRB 1FD9A 4UP9A 3IG2A 4LVLA 1KB9F 1M56C 3TEHB 4TVAA 5C52B 4DRXB 2AMCA 2EZPA 4FIPC 4IHJB 2JGUA 1VF6A 1Y66A 4N21A 1USYA 3GB7C 2KG7A 4TVYA 4X89A 3OR7C 4UCTA 5KX5A 4W4LA 1XMOO 4BR6A 4IIJB 2I4OA 1N32B 2EIJB 4I55A 1QBZA 3HTZA 3JARA 4MVZA 5CA0B 3AG1B 5BR8B 1N0JA 3K79A 4DR1O 1K73W 4Q15A 3ABKB 3L75H 1KP2A 1DLBA 3HY1A 5KUMA 1QHTA 4CC6A 1AJPA 1G6UA 1ADYA 1H4VB 3VQXA 3CP1A 2P5IA 2E5LB 3IC7A 4I9WA 1DTOA 3RYFA 3A0RA 5EBWC 4DV0O 4BWAA 4I50B 1ZX3A 3EFFK 3TEHA 2QKAA 3L72H 3RVZA 2EJFA 5IT9N 1YFRA 4P72A 4GKKO 2BTOA 4NXMB 1GAXA 1XQ8A 4RAIA 2MK3A 4KFMA 1G5HA 2A8EA 2AGAA 4DR7B 2EL9A 2ZINA 3M8AA 2QHUA 3AEIA 3JAMN 4XU0A 2DTHA 1WPYA 2QTOA 4TWKA 2QKSA 2QSAA 3RKYA 3BA9A 4FZ0A 1PD3A 3V8JA 4YDQA 4B3SO 5GONB 1J5WA 3ABKC 4IL6Z 3CC4V 3KCXA 3EXAA 3SDLA 5BMVA 2P0LA 2K9PA 3ASNC 2ZE6A 2F1MA 3EHBB 5H2FZ 3BY6A 3B77A 4JGSA 4YROA 3HRKA 4H2TA 2WLHA 1MSWD 1MZFA 4J80A 2B1IA 4YRCA 4DV6B 1BHAA 1X56A 4G84A 4Q20A 2OCHA 5KHIA 4JI4B 4KR3A 4YRJA 3P8YA 1I94B 4YY3O 4P71A 2IY5A 2UXCO 1YB3A 4JI6B 1B70B 4RUFA 1F51A 3NR7A 5JQGA 3R66A 2UXBO 2ZT6A 2VWKA 1TUEB 5C93A 4YIPA 1S5LZ 2ZT7A 2HHHB 3OAAG 5FNVA 3A7UA 2F43G 1LR1A 1F23A 5J2UA 3LNMB 3V8LA 1L8DA 1YHQV 2IJJA 1B3QA 2L6LA 3SPHA 1BIAA 5IYZB 3T1YB 4IHJA 4MT8A 3V8KA 5LP6A 5CN0A 4ZOLB 4FFKA 1RPRA 4JAAA 1COWG 1ORQC 3IKLA 4AHCA 1OHHG 4LWSA 3P8TA 1AI4A 2IJHA 3P3PA 2E75B 4YRRA 3LUTB 4R7CA 4TWAA 5KHJA 2HFEC 2UUBB 3P32A 2M6YA 3ASOC 5EYPA 3RL6A 2YSUB 5B1OA 2ODRD 2DOSA 1ZSPA 3A5YA 2G4CA 1GTOA 4DUZB 4DR6O 3ZMUA 3K58A 3QNEA 4U7NA 1H2NA 4YP0A 1NJ5A 2RQ6A 3D36A 3K5LA 1ASZA 1I7FA 2GHYA 4FVMA 5D5PA 4GCZA 4EEQA 2QEXV 1HNXB 1AR1B 4EB6B 3K5MA 3A2FA 1I5XA 1WQWA 4LCUC 1VIBA 3OW2U 4JYCA 1F4MA 1HP8A 2GDSA 3N2GA 4DR4B 3CHXA 3CX5F 3B8MA 2WSSG 1RM1B 2LGQA 4CBCA 1Q7YW 2AZ0A 5L3BA 1BCCH 4P9PA 1EOVA 2HR3A 1EVKA 1XNRO 4RDXA 4J7JA 4KHPB 3J7AU 1SQPH 4O4LB 1M56B 2RHSB 4LBEC 3SYOA 2WLKA 1R73A 4DR1B 4WJ3M 3A0BZ 1QE0A 2QDOA 1M90W 3WU2Z 2DZ9A 2BCCH 3STZC 4LF4O 1ROPA 3ZN0A 1FXKC 3RUXA 3JAWB 3N27A 1DK1A 1Q86W 3SJBC 2QM4A 4I0XB 3U11A 4X66B 4ZI7B 3CCVV 2RHQB 4P74A 1AI6A 1M1KW 4G2KA 5B1BC 4DO2A 1R6TA 3UT5A 3K08A 4MS2A 2F23A 1I08A 4BW5A 4X20A 3H1KH 1N32O 4G27B 4MTGA 1FJGO 2ZTGA 4LVJA 5IYZA 4JYAO 5LBQA 3MQZA 2P06A 4OGQB 1GMGA 4PHZA 5H5NA 3H1IH 1YZBA 1JX9A 3ZMSA 3JAKB 3CMEV 1X55A 4P3OA 4J9ZB 3ZHUA 1K5SA 4RQFA 4H2WA 2ARSA 1YF2A 2RHSA 1NH2B 1GM9A 2N05A 2ZCEA 4LWSB 4R6ZA 5EZYA 5GTHZ 4O2DA 1NKDA 1XHZA 3G67A 4UB6Z 3SGIA 2QA4V 1KMNA 3RYHA 3S3WA 2DKGA 4QJFB 2Q5IA 3HKCA 1GN6A 4O4JB 2VQFO 4XEOA 4J42A 3APQA 1LNQA 4PI0A 2DXTA 1QVFU 3K5NA 3ETQA 1RSOB 5FLXN 1SQBH 3ZHRA 3I7FA 1MG1A 4XTYA 2X7RB 4MW8A 5LMNB 4XU2A 3RN4A 2AZ2A 2C2AA 5F5WA 4YJ2A 4IGGA 2EZOA 3FAVB 4GLXA 2UU9B 2KQXA 4IYHA 2IU3A 4PDVA 1PNKA 3K57A 4JTCB 4QPJA 1YI2V 1YGBA 5LOVB 2QHSA 4FK5C 1NJ6A 3W7SA 5KA5A 1Q81W 2GV9A 1PL0A 2PYLA 3ABTA 2HEPA 2Z3YA 4UVCA 2E5AA 4JI7O 4P75A 1QR8A 1SA0A 2E64A 1Y74A 1MNGA 4WF2A 2DU7A 4B3TB 4U3FH 2B9ZA 1GGMA 1I5YA 3AK1A 2YIAA 2NS6A 1P4RA 1ZTEA 4P74C 3W7WA 1HW7A 1ZL8B 3NEMA 1IBLO 5LHIA 4UV8A 3HFZB 1MOFA 4NXMO 4JYYA 1L0LH 1ZLZA 2N74A 3JATA 2E74B 2ARTA 1IVSA 2EJ7A 4OX9O 2DYSC 1O9HA 1SF9A 3SPCA 3LC0A 3AG3B 2YIBD 5LMNO 3CYOA 1JCHA 3V7SA 2HHHO 2ARHA 4P75C 2XAQA 1E79G 1N36B 2C7IA 4TV8B 5IJ0A 3EFRA 3HXYA 2DQ0A 4IYIA 3JSNA 3CRCA 3GWKC 4KUMA 1VQ6V 3UH0A 3P3NA 3RYFB 3HKEA 2DYRC 2GBOA 2KKWA 4ABMA 1SQVH 1FXHA 2CTRA 4O4HB 4X20B 3RYCB 3M4QA 3ZRWA 1BE3H 3A8TA 1SQXH 4H2YA 3D8CA 2DQ3A 3MDSA 1ZL8A 1Y4MA 2Q4PA 4DV7O 4YREA 1QQCA 3MD0A 4K0KB 3OGCC 4CH3A 3G6BA 1A32A 1K3EA 1V54B 2WLLB 3SJAC 3UCSC 2QGNA 4RO2A 1PYSA 1JQ0A 3HKBA 5CB4B 5KAFZ 4MVSA 2XTIA 5JVDA 1LUVA 4P9OA 5AG2A 4FPPA 3L71H 2A7WA 2V1DA 4DQ2A 2ILMA 3SYQA 1WB8A 2ZR3A 1JJCB 4WBNA 3HKCB 3OT7A 2F4VB 1CPYA 4X9QA 4AI8A 5HFLA 1BSMA 1N34O 4GX0A 4NYKA 3JALA 2EIJC 4I7ZB 3I5DA 2UUCB 2ZE7A 4X62B 1TUBA 2Q69A 2D3OW 4LF5O 2JEUA 4LVIA 4XU3A 3ASOB 3HXXA 1OZ0A 3E8FA 4NB5A 3R07A 1IXMA 4P2ZA 3RWRD 3O9OA 1HTTA 1FFXB 3TJTA 3QF7A 2CGNA 1KC8W 2CGOA 4JZ2A 2IJKA 3SPGA 4EX5A 1SZTA 4LH7A 2ZXFA 3Q4HA 3K06A 3ETEA 4BIUA 3HKDA 3UO2A 2CK3G 2NN4A 4I9QA 3ABLC 1OCCB 3L4GA 3E22B 3MEYA 2JRIA 3FKSG 4F6EA 1V9PA 5BMVB 3AG1C 4TVWA 2QWPB 3JD1A 4BIOA 4JPRA 2ZT5A 1XILA 2WLJA 3FB8C 4HWPA 4P72C 3E8GA 3OUFA 1NYQA 2RNBA 1VQPV 3K0DA 5LL6Y 3B40A 1QU7A 2I4MA 2M7WA 4JV5B 4F6RA 3CE2A 4H13B 2ZIMA 1GO3F 3NELA 2BE3A 3ZMZA 2HNIA 2ZXWB 1H4SA 1OCZB 3ZMVA 5IE9A 2QTSA 1EM1A 1QVGU 4ZOLA 1IDSA 1S3JA 2RJZA 1XHXA 4FLZA 3OD1A 1YJNV 3ABLB 3CCQV 2ETNA 2FL4A 3ZHTA 4LF8O 3LDCA 3FB7C 2EAYA 1KKCA 3I56V 1NJ1A 2WLMA 5CA3A 4X1IB 2WPDG 3B8NA 2B1GA 3L73H 3JSLA 4MW3A 2JIZG 4FFBB 1X54A 1JA8A 2Y0PA 3CJHB 1PYSB 1YEWA 3HXVA 5LGUA 4YCVA 5HGQA 2FKXA 2PTMA 2DJZA 3GWOA 2Y4TA 1OV9A 1EZJA 5LHGA 1HWYA 4JI8B 1F7YA 4UPAA 3BCCH 2PY5A 3D36C 1WN7A 2UXCB 1MZEA 1Q82W 2CJ9A 3H01A 3OEEG 1AR4A 4H2XA 2YDEA 2X6BA 4P3PA 2LQTA 1WB7A 3N2GB 2GTSA 2XGTA 1CXZB 3REUA 3H1HH 1VQLV 3EFSA 2HVJC 3RW0A 3WG7B 4KP4A 4TUYB 5B1AB 3KFUA 2H94A 4O4HA 3RYCA 5IWAB 3WB2A 2E3CA 2DVEA 1XL6A 4YJ3A 3FB5C 4JYAB 5IWAO 5H9CA 1FFXA 5EZYB 2EINB 5L3DA 4TVAB 3UO3A 1B04A 4YRIA 4O2BB 5FNVB 4ZI7A 3B09A 1JJCA 2D2CB 1US6A 2F95B 1SKVA 5IJ9A 4WFBV 1NBMG 4FFBA 4OLFA 1K9MW 2A0LA 1H8EG 1TAEA 3N2KA 5IYBO 4B3SB 2CTPA 4LF7B 4E51A 1HXDA 4HVCA 1X2GA 3A31A 1Q5OA 2Q68A 2UXDO 5LP6B 1NR1A 1P7GA 3VQYA 2XT9A 4BAYA 1YTFD 4QE7A 2Q5HA 4NXNB 4O2AB 1NNHA 3FAVA 4XDLA 1KECA 5J9PC 4YPFA 2JGDB 4K8ZA 2WLIA 1WNSA 4LNSA 5C53B 4JI6O 3QO7A 2ODRC 1TUBB 3W7TA 4NCXA 2PGGA 3AG4C 3ZIAG 3L70H 4JI1O 2EIKC 4MVQA 2LW1A 1W59A 4I0XA 1YTFB 3ML0A 5GW7A 4O4JA 4DV5B 4QNHB 3FJPA 4JI3O 2BSKA 4GKJB 5IJ0B 2PZSA 5B5EZ 3P8VA 3K9AA 1E1QG 1N33B 2OTJV 5JJEB 1BQ0A 3QO8A 2R9RB 4YHHB 2EX3A 2ZR2A 1S72V 4H2SA 1Y67A 3CC2V 4UFZA 2AMCB 2XAJA 3F5TA 4LF8B 4U3JA 1V55B 1PKXA 4KQEA 2V7QG 1Z7MA 4PDMA 3RT3C 3U10A 4JAUA 3UQ8A 1NYRA 3L2ZA 4CH5A 4EKWA 4DUYO 2DZCA 1Q3EA 1S5HC 1GM7A 3TXSA 3TEGA 1KP3A 2GSMB 4H2XB 3ZN1A 4E4EA 4QGPA 5GONA 4DV2O 2OYQA 2EBOA 3BVOA 12ASA 5EC2C 2WAMA 4DV3O 1YXBA 1TGOA 1M4UA 5KAIZ 3T1HO 1GRJA 2EULA 1WYDA 3K0GA 3CJHA 1WP7A 2LP7A 2ITCC 3CCLV 3TUPA 4TQDA 1AJQA 1VQNV 4GKJO 1VMGA 3A74A 1OCRC 2H8PC 2CE4A 4X1KB 1Z5WA 3EVKA 2LFSA 2OWOA 4GUNA 3WB1A 2JVDA 3CCRV 1V54C 4UVBA 4LFBO 3H9VA 4X1YB 3CRMA 5JQGB 1T5EA 3CCUV 4UP8A 2IBZH 1KU9A 2Q9LA 4X62O 3E9IA 3RGBA 3E86A 2DU5A 4TUYA 2XAHA 4LFBB 5B66Z 1EZVH 2OIGA 4MVOA 4YRLA 2OT5A 4J10A 3TCUA 4CS4A 4GX5A 2JGDA 4TQFA 4CS2A 1SESA 2CH7B 1AVMA 3G80A 3SYAA 3JASB 1PNMA 2JJ1G 4UP7A 1B7YB 4LF7O 2HP8A 1X01A
chains in the Genus database with same CATH topology
2UXNA 3HFVA 1W0KG 1ATIA 2W6JG 1BBWA 4YCWA 2QHSA 4FK5C 4MVUA 1R3LC 1S0VA 1NJ6A 3W7SA 4HWSA 1EFWA 5KA5A 1Q81W 2EJ9A 3AG2C 5IY5C 1PL0A 2Q6AA 2PMFA 1JJ2U 2HKOA 3ABTA 5CBHA 4ZTUB 2Z3YA 3LDDA 4UVCA 5EK0A 2E5AA 3HXZA 1B6QA 3DTUB 4X5OA 1KKDA 2IH3C 5H6RA 4GT1A 4P30A 2A79B 1E24A 4WFAV 4P75A 1QR8A 3HFZA 1AROP 1H8HG 1BMFG 1NH2D 1B7YA 1YITV 2E64A 3QTCA 3NXSA 5ELOA 1XL4A 1R6NA 2HVKC 4JF3A 5ELNA 1EBOA 2WLIB 4CZZA 2ALYA 2ARUA 3BFMA 2DU7A 4WF2A 5L3CA 4P73A 3WQZA 3FYIB 2Q7GA 1GGMA 3WFVA 2DTOA 3JCZA 3P30A 2J3MA 1G51A 1I5YA 2NS6A 1P4RA 1RM1C 5FL7G 4K87A 3W7WA 4P74C 1WU7A 3MHSC 4PA6A 1VQ4V 1IL2A 3NEMA 3JYCA 2AKWB 4XBFA 1HC7A 2P67A 4GX1A 5LHIA 3E9HA 4UV8A 5E1AC 3ZRSA 2DYRB 3SPIA 1WQ7A 3HFZB 1MOFA 3IALA 2LFRA 4WFFA 2ZQMA 4YRMA 5C51B 4CH6A 3STLC 2EIMB 2ARTA 3UKMA 2EWNA 4H2UA 1EQRA 4TTVA 3MF1A 3QO5A 2DYSC 4RUEA 2ZD9A 3PCOB 3L1AA 1QLEB 3SPCA 1R3JC 3CCMV 1BBUA 3LC0A 3AG3B 1FS0G 4OXSA 4H2VA 4PA4A 4WFEA 2P7TC 2YEVB 4G85A 2XAGA 2XOKG 3CYOA 3M4PA 2B5UA 1AI7A 1JCHA 2DW4A 3V7SA 1QR9A 1F4NA 1FXKB 1K7DA 4X8AA 5B3SC 4LP8A 2JJ2G 3ZJZA 1YJWV 3NETA 2ZT8A 2KB1A 4P75C 3RKWA 2IJIA 2HJFC 1E79G 2XAQA 3SYPA 1R6KA 4P3NA 1YFSA 2C7IA 3EFRA 3HXYA 1JPXA 2DQ0A 3K3WA 5IDJA 4L87A 1PNLA 3OMAB 3R65A 2ZNJA 3CPWU 4KUMA 2CJAA 2EILC 1AJNA 1VQ6V 3PCOA 3V7CA 11ASA 5LHHA 4XTVA 2EJGA 3UH0A 1N8RW 3ETGA 4JAVA 3ABMC 4YRTA 2X6AA 2DYRC 3NENA 2BOCC 1OCRB 1FXHA 3M4QA 3ZRWA 2R9IA 3IG2A 4UP9A 4LVLA 1M56C 3IKMB 3TEHB 4PELA 4TVAA 5C52B 2AMCA 4DPGA 1K4DC 1S77D 3PJSK 3W7UA 3PZCA 4H2YA 2EZPA 2DQ3A 2JEXA 4FIPC 5HFMA 3OUSA 1Y4MA 3E89A 4DXWA 1E22A 2EIKB 4YREA 2RHQA 4YRSA 3MD0A 1Y66A 1USYA 3OGCC 4N21A 3GB7C 4TVYA 4CH3A 4X89A 3OR7C 1K3EA 1V54B 2WLLB 2E65A 4RO2A 1PYSA 1JQ0A 4MVMA 2I4OA 2EIJB 1QBZA 4MVSA 2XTIA 3HTZA 1NJ8A 4N23A 4MVZA 4P9OA 4FPPA 3AG1B 3UGTA 3K79A 5DM6V 2EILB 2V1DA 1K73W 1J95A 4DQ2A 2OCCC 3ABKB 4Q15A 2E10A 1KP2A 1DLBA 3JD4A 4YRQA 2CIMA 3IGAC 3SYQA 2ZR3A 4FJCC 1JJCB 4E2LA 3HY1A 3JD3A 4QE9A 3CC7V 2DDZA 1GKFA 5KUMA 5EC1C 2PI5A 1AJPA 5CBFA 1CPYA 3MHHC 1R3KC 5HFLA 1W2BU 2UXXA 3E8HA 1ADYA 1H4VB 3VQXA 1EIYA 4GX0A 4BIZA 3CP1A 5L3EA 2P5IA 1ZWIC 3E35A 1SRYA 2EIJC 2EJRA 2ZXWC 3IC7A 4XTUA 4I9WA 2PI4A 4ZIBA 2Q69A 4YRKA 2D3OW 4AH6A 2JEUA 4LVIA 2P6JA 1DTOA 1NR7A 4XU3A 2QE7G 3ASOB 3HXXA 3A0RA 1OZ0A 3E8FA 2Z5UA 5EBWC 1BL8A 1K33A 2OCCB 3CCJV 4BWAA 3R07A 2CJBA 1IXMA 4P2ZA 4U7OA 1L1FA 3OEHG 4UV9A 1HTTA 2NLJC 3EFFK 4TT3G 2BOBC 3TEHA 1KC8W 3A7RA 2XASA 1YJ9V 4RMFA 3RVZA 1V55C 1THZA 2IJKA 3SPGA 2EJFA 1E1RG 4EX5A 1QLNA 1YFRA 1SZTA 3ETDA 2ZXFA 1M57B 4P72A 3HB3B 4HT4A 4K86A 3K06A 5CMUA 4Q6GA 3ETEA 4TSFG 3CD6V 4RAIA 4BIUA 3AG4B 2MK3A 3M99B 2DEQA 4XDJA 2CK3G 1X56A 1VQ5V 3ABLC 1OCCB 3L4GA 4KFMA 3F7YC 3DGEA 1P7BA 2ZZEA 1G5HA 2A8EA 3MEYA 2AHYA 3FKSG 4X88A 4R8CA 2X6CA 2EL9A 2DWDC 2ZINA 2QHUA 3AEIA 3AG1C 4HWTA 4TVWA 3JD1A 2ZT5A 4FMTA 4JPRA 2WLJA 3FB8C 4BW9A 4XU0A 2A9HA 2DTHA 1WPYA 3A7AA 2QTOA 4TWKA 4HWPA 4P72C 3E8GA 3OUFA 1NYQA 1VQPV 2QKSA 3RKYA 3K0DA 1JVMA 4PA7A 2I4MA 2M7WA 1VQ9V 1PD3A 1H2GA 1B70A 4YRPA 3T4ZA 3CMQA 3V8JA 2X0LA 2ZIMA 1GO3F 4JYBA 1QLEC 3NELA 4YDQA 3ZMZA 1Z7NA 2HNIA 1J5WA 3ABKC 1S76D 2ZXWB 3CC4V 1H4SA 1OCZB 2P0LA 2JK5C 3ZMVA 3ZRXA 4UUJC 2QHVA 1OCOC 3RVYA 4F4LA 2ZGWA 2E41A 3ASNC 1QVGU 3K03A 3EHBB 3JD2A 3BY6A 1S3JA 3B77A 2IW5A 3BEHA 4JGSA 3VOUA 1EVLA 3HXUA 3HRKA 3LDEA 1WPXA 5L3FA 4H2TA 4YROA 1K5QA 2ITDC 2WLHA 1MSWD 1YJNV 1ADJA 1NJ2A 3OD1A 4HWOA 3ABLB 2B1IA 3IFXA 3CCQV 4YRCA 2DWEC 3E83A 2DYSB 3LDCA 3FB7C 2EAYA 3F5WC 4HAMA 1ENVA 3I56V 1H38A 1SERA 1BHAA 1BIBA 1DF4A 2WLMA 5CA3A 1B8AA 1NJ1A 3HXWA 4Q20A 4G84A 4CH4A 2WPDG 1C0AA 3ZRVA 3B8NA 2ZDIC 3TK1A 3P8YA 4YRJA 4KR3A 2ZZFA 4P71A 2B1GA 2IY5A 5IYDO 4UVAA 1YB3A 4MW3A 3E2EA 1JOYA 4HYOA 1B70B 4YRNA 4RUFA 2JIZG 1X54A 1F51A 4KR2A 1KD1W 2ZT6A 3X2QB 1G5IA 1PYSB 1M9NA 1EFRG 1KMMA 3EFSA 1TUEB 2IH1C 5C93A 5LGUA 1WNLA 2EINC 3HXVA 3AG2B 3G1ZA 4YCVA 5HGQA 1FFTB 4LC1A 2DJZA 1WLEA 3LSQA 1K4CC 3GWOA 1G4YB 3OAAG 1UJWB 2ZT7A 3D3IA 3BJUA 5L3GA 1EZJA 3HPLC 5LHGA 4K88A 1HWYA 3A7UA 2F43G 3CMAV 4UPAA 1NVPD 1F23A 5B1BB 2DXUA 4XTXA 2I4NA 3LNMB 4ZTZB 1K97A 4ASUG 1Q82W 3V8LA 1YHQV 2CJ9A 3OE7G 2IJJA 3H01A 1VQ8V 4H37A 3OEEG 4H2XA 2HLDG 1CEZA 2X6BA 3SPHA 1BIAA 4P3PA 3UGQA 1W66A 1QF6A 1W0JG 4ZBMA 1YGBA 4MT8A 2XGTA 2DTIA 3REUA 1VQLV 3V8KA 1H4QA 4HZ3A 2QM8A 5CBGA 2HVJC 3RW0A 1YIJV 1FXVA 4KP4A 3WG7B 2I4LA 2PMEA 5CN0A 5B1AB 1RPRA 3KFUA 4WFHA 4PA3A 1COWG 2H94A 1ORQC 2DVEA 2E3CA 3DSQA 1XL6A 2QM7A 3IKLA 3FB5C 4I5SA 3VQVA 3A5ZA 4YRFA 1NVPB 1OHHG 3ZRWB 1E1OA 5H9CA 2ZIOA 1AI4A 3P8TA 1ASYA 2EINB 2IJHA 5L3DA 3G4SV 4TVAB 5E3IA 4YRRA 3LUTB 4R7CA 1SETA 3VBBA 4YYEA 1QCEA 3SYCA 4YRIA 4TWAA 5DN6G 2HFEC 4R50A 3P32A 3MF2A 3ASOC 1JJCA 5KA6A 2YSUB 5B1OA 2ODRD 4HWRA 3RL6A 4WFBV 5K1XA 3A5YA 2G4CA 1NBMG 2WLLA 2J3LA 2C8MA 1GTOA 3JD0A 1K9MW 4HA8A 4OLFA 2A0LA 2ZZGA 1GK9A 1H8EG 3ZMUA 5BZBA 3QNEA 5IYBO 4E51A 2HG5C 1HXDA 3RUXA 4U7NA 1K8AW 4YP0A 2W0FC 2Y69B 1NJ5A 4HVCA 3D36A 1X2GA 1ASZA 2GHYA 4OP0A 3V7RA 3A31A 2W6IG 2OTLV 2Q68A 1OCCC 2XNDG 4GCZA 2QEXV 1NR1A 1M57C 1AR1B 3VQYA 1NQTA 4BAYA 1YTFD 1I5XA 4QE7A 1WQWA 2Q5HA 4LCUC 3X2QC 2Q7HA 1NNHA 3OW2U 4XDLA 4Z1MG 1KECA 3SPJA 4CS3A 2NNUA 3ABMB 5J9PC 4JYCA 4YPFA 1R3IC 2WLIA 1B76A 2ALYB 3CXCU 4LNSA 1F4MA 3REXA 1LYLA 5C53B 3QO7A 2ODRC 3W7TA 1EIYB 4NCXA 2Q67A 3B8MA 2WSSG 3CCEV 4YCUA 5IY5B 1G8MA 1RM1B 4CBCA 4MVRA 3AG4C 3ZIAG 1Q7YW 4MTOA 5L3BA 2AKWA 4P9PA 2EIKC 2HR3A 1EOVA 1EVKA 3ASNB 4MVQA 2XAFA 4PDLA 3ZMTA 3I55V 3ICAA 4PHCA 4RDXA 5KNNA 1FXKA 1YTFB 3FB6C 3K04A 3ML0A 1M56B 5GW7A 4XU1A 4QNHB 4LVKA 2RHSB 3FJPA 4LBEC 3SYOA 2WLKA 1R73A 2ZDIA 3RACA 5IYCO 4WJ3M 1OCZC 4UXNA 3T4DA 4WCEV 3K9AA 1QE0A 3P8VA 1CP9A 1E1QG 1M90W 3T1CA 1E1TA 2DZ9A 3AG3C 1L0WA 4WI1A 4LVMA 2YEVA 3STZC 2OTJV 4PG3A 3QO8A 4XDKA 2QHTA 2R9RB 2IY5B 1ROPA 1NJIW 4QPKA 5K1PA 3L4GB 3ZN0A 1FXKC 2ZR2A 4J9YB 5B3SB 1S72V 2K1EA 4H2SA 4J15A 4XTZA 3UM7A 3CC2V 2E1HA 2AMCB 2XAJA 4GX2A 3TETA 1K34A 4WF9V 1Q86W 3RIRA 1V55B 1PKXA 2ATKC 4JASA 3E8BA 3HY0A 4KQEA 1AI5A 2V7QG 1Z7MA 3RGLA 4PDMA 2FTKA 1USYC 3CCVV 2RHQB 1MABG 5KUKA 4JAUA 1NYRA 3L2ZA 4P74A 4CH5A 3FYEB 1AI6A 3W3SA 2P90A 5EBMC 4G2KA 4EKWA 1M1KW 1X2HA 2DZCA 3ERRA 1S5HC 3OMIB 2Y69C 5B1BC 2ZNIA 1RIQA 1GM7A 4G28B 3K08A 5B1NA 4DO2A 4MS2A 1BHBA 4BW5A 3TEGA 1VQ7V 1YSCA 3OM3B 2WWWA 4G27B 1KP3A 1KQSU 2GSMB 4MTGA 1YFTA 4H2XB 3OFNG 3ZN1A 2ZTGA 4LVJA 3LSSA 2IU0A 3SJQC 2CGHA 2FYKA 2EBOA 4MTFA 3OR6C 12ASA 5EC2C 2WAMA 4MSWC 5LBQA 2Q7EA 2WLNA 3MQZA 1VQMV 4EO4A 1K92A 1GMGA 4QIWF 1JX9A 3ZMSA 1WYDA 3K0GA 3CMEV 1X55A 4P3OA 2LP7A 2ITCC 1K5SA 4J9ZB 4RQFA 3CCLV 4H2WA 3UFGA 2ARSA 4TQDA 1AJQA 3ABUA 3TUPA 1VQNV 4YXWG 3W7XA 2AHZA 1GM8A 1NH2B 2RHSA 1GM9A 4RQEA 2ZCEA 3A74A 1OCRC 2H8PC 4R6ZA 4XTWA 3RKXA 4O2DA 3RF1A 1NKDA 2LFSA 1VQKV 3WG7C 2QA4V 1KMNA 3G71V 3CCRV 2DKGA 4PA9A 4MTXA 4QJFB 1V54C 1N9WA 4P71C 4UVBA 4H02A 3VQWA 2Q5IA 3OMNB 5EBLC 4XEOA 5LGTA 4JTDB 3CCUV 2Y48A 4UP8A 1KOGA 1DF5A 1VQZA 1RPOA 1LNQA 2DXTA 1QVFU 3E9IA 4XEMA 3E86A 2DU5A 3KG2A 5B1AC 1FYFA 2XAHA 3I7FA 1MG1A 4ZKIA 4P73C 4XTYA 2X7RB 4MW8A 4XU2A 4WJ4A 2C2AA 5F5WA 3G6EV 4MVOA 3RBZA 4YRLA 2JDIG 1H4TA 2OT5A 3TCUA 4JTAB 1VQOV 3T2MA 2EZOA 4CS4A 4GX5A 4YRGA 3F7VC 3A32A 4TQFA 4CS2A 2EIMC 1X01A 1SESA 2IU3A 4PDVA 1PNKA 3SYAA 5LGNA 1PNMA 2JJ1G 1OCOB 4UP7A 4PDRA 4WFGA 1B7YB 3HRIA 4JTCB 5H6QA 4QPJA 1YI2V 3CCSV 3ZCCA 4H33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFV A;  1ATI A;  4YCW A;  1BBW A;  2QHS A;  1NJ6 A;  4HWS A;  1EFW A;  2EJ9 A;  2PMF A;  4ZTU B;  3HXZ A;  2E5A A;  4X5O A;  4P75 A;  1E24 A;  3HFZ A;  1B7Y A;  3QTC A;  5ELO A;  2E64 A;  3UGQ A;  5ELN A;  2ALY A;  2ARU A;  4WF2 A;  3BFM A;  2DU7 A;  3WQZ A;  4P73 A;  2Q7G A;  1GGM A;  2DTO A;  2J3M A;  1G51 A;  4K87 A;  4P74 C;  1WU7 A;  1IL2 A;  3NEM A;  2AKW B;  1HC7 A;  3E9H A;  1WQ7 A;  3HFZ B;  3IAL A;  4YRM A;  5C51 B;  4CH6 A;  2ART A;  4H2U A;  2EWN A;  4TTV A;  1EQR A;  3MF1 A;  3QO5 A;  3PCO B;  3L1A A;  1BBU A;  3LC0 A;  4H2V A;  4G85 A;  3M4P A;  3V7S A;  3NET A;  2ZT8 A;  4P75 C;  3RKW A;  4P3N A;  1YFS A;  2C7I A;  3EFR A;  3HXY A;  2DQ0 A;  4L87 A;  2ZNJ A;  2CJA A;  3V7C A;  3PCO A;  11AS A;  4XTV A;  2EJG A;  3UH0 A;  4YRT A;  3NEN A;  3M4Q A;  4UP9 A;  3IG2 A;  3IKM B;  3TEH B;  4TVA A;  5C52 B;  2AMC A;  4DPG A;  4H2Y A;  3PZC A;  2DQ3 A;  1E22 A;  4YRE A;  2RHQ A;  4YRS A;  1USY A;  4CH3 A;  4TVY A;  2E65 A;  1PYS A;  2I4O A;  2XTI A;  3HTZ A;  1NJ8 A;  3UGT A;  4DQ2 A;  4Q15 A;  2E10 A;  4YRQ A;  2CIM A;  2ZR3 A;  1JJC B;  3HY1 A;  2DDZ A;  1ADY A;  1H4V B;  3VQX A;  1EIY A;  2P5I A;  1SRY A;  4XTU A;  4ZIB A;  4YRK A;  4AH6 A;  4XU3 A;  3HXX A;  4BWA A;  3R07 A;  2CJB A;  1HTT A;  3TEH A;  3A7R A;  4RMF A;  2EJF A;  4EX5 A;  1YFR A;  2ZXF A;  4P72 A;  4K86 A;  4Q6G A;  2DEQ A;  3L4G A;  3MEY A;  2ZZE A;  1G5H A;  2EL9 A;  2ZIN A;  2QHU A;  4HWT A;  4TVW A;  5KNN A;  2ZT5 A;  4BW9 A;  4XU0 A;  2DTH A;  1WPY A;  3A7A A;  4HWP A;  4P72 C;  1NYQ A;  3RKY A;  2I4M A;  1B70 A;  4YRP A;  3CMQ A;  3V8J A;  2ZIM A;  3NEL A;  4YDQ A;  1Z7N A;  2HNI A;  1J5W A;  1H4S A;  2P0L A;  2QHV A;  2ZGW A;  2E41 A;  3HXU A;  5K1P A;  4YRO A;  1EVL A;  3HRK A;  4H2T A;  1ADJ A;  3OD1 A;  1NJ2 A;  4HWO A;  4YRC A;  2EAY A;  1BIB A;  1SER A;  1X56 A;  1NJ1 A;  1B8A A;  4G84 A;  3HXW A;  4CH4 A;  1C0A A;  4KR3 A;  4YRJ A;  3P8Y A;  2ZZF A;  4P71 A;  2IY5 A;  4YRN A;  1YB3 A;  1B70 B;  1X54 A;  4KR2 A;  2ZT6 A;  1G5I A;  1PYS B;  1KMM A;  3HXV A;  1WNL A;  4YCV A;  3G1Z A;  5HGQ A;  2DJZ A;  1WLE A;  3LSQ A;  2ZT7 A;  3BJU A;  4K88 A;  3A7U A;  4UPA A;  2DXU A;  4XTX A;  2I4N A;  4ZTZ B;  3V8L A;  2CJ9 A;  4H2X A;  1BIA A;  4P3P A;  1W66 A;  1QF6 A;  2XGT A;  2DTI A;  3REU A;  3V8K A;  1H4Q A;  3EFS A;  2I4L A;  2PME A;  3KFU A;  2DVE A;  2E3C A;  3DSQ A;  3IKL A;  3VQV A;  3A5Z A;  4YRF A;  1E1O A;  2ZIO A;  3P8T A;  1ASY A;  5E3I A;  4TVA B;  4YRR A;  1SET A;  3VBB A;  4YYE A;  4YRI A;  4TWA A;  3MF2 A;  1JJC A;  3RL6 A;  2ODR D;  4HWR A;  5K1X A;  3A5Y A;  2G4C A;  2J3L A;  4OLF A;  2C8M A;  4HA8 A;  2ZZG A;  3QNE A;  4E51 A;  1HXD A;  4YP0 A;  1NJ5 A;  4HVC A;  1ASZ A;  1X2G A;  3V7R A;  4OP0 A;  3A31 A;  3VQY A;  1WQW A;  2Q5H A;  2Q7H A;  1NNH A;  4CS3 A;  4YPF A;  3REX A;  1B76 A;  2ALY B;  4LNS A;  1LYL A;  5C53 B;  3QO7 A;  2ODR C;  1EIY B;  4NCX A;  4YCU A;  2AKW A;  1EOV A;  1EVK A;  3ICA A;  4PHC A;  4RDX A;  4XU1 A;  2RHS B;  3FJP A;  3RAC A;  4WJ3 M;  1QE0 A;  3P8V A;  1L0W A;  1E1T A;  2DZ9 A;  4WI1 A;  4PG3 A;  3QO8 A;  2QHT A;  2IY5 B;  3L4G B;  3RUX A;  2ZR2 A;  4XTZ A;  4J15 A;  4H2S A;  2E1H A;  2AMC B;  3RIR A;  4KQE A;  3HY0 A;  1Z7M A;  3RGL A;  1USY C;  2RHQ B;  1NYR A;  3L2Z A;  4P74 A;  4CH5 A;  3W3S A;  1X2H A;  3ERR A;  2DZC A;  2ZNI A;  1RIQ A;  3TEG A;  1YFT A;  4H2X B;  2ZTG A;  3LSS A;  2CGH A;  2FYK A;  12AS A;  2Q7E A;  4EO4 A;  1WYD A;  1X55 A;  4P3O A;  4RQF A;  3TUP A;  4H2W A;  3UFG A;  2ARS A;  4TQD A;  2RHS A;  4RQE A;  2ZCE A;  3A74 A;  4XTW A;  3RKX A;  4O2D A;  3RF1 A;  1KMN A;  2DKG A;  4P71 C;  4H02 A;  3VQW A;  2Q5I A;  4XEO A;  4UP8 A;  1KOG A;  1VQZ A;  2DXT A;  3E9I A;  4XEM A;  2DU5 A;  1FYF A;  3I7F A;  4P73 C;  4XTY A;  4XU2 A;  4WJ4 A;  5F5W A;  4YRL A;  1H4T A;  4CS4 A;  4YRG A;  3A32 A;  4TQF A;  4CS2 A;  1X01 A;  1SES A;  4UP7 A;  1B7Y B;  3HRI A;  1N9W A;  1YGB A; 
#chains in the Genus database with same CATH topology
 1I94 O;  3BRC A;  1W0K G;  1ATI A;  1BBW A;  3AG7 A;  4O4I B;  2QWN B;  1R3L C;  1KUQ A;  1Q43 A;  1J5E B;  1EFW A;  3N2K B;  2EJ9 A;  5IY5 C;  1RFY A;  2HKO A;  5CBH A;  4ICG A;  3DTU B;  4LF9 B;  1GH6 A;  2NR5 A;  1KKD A;  5H6R A;  2BSK B;  4GT1 A;  1ARO P;  1H8H G;  1BMF G;  1B06 A;  3A0H Z;  3QTC A;  3K59 A;  1XL4 A;  1R6N A;  2KG7 B;  5ELN A;  5L3C A;  4P73 A;  2CTW A;  3FYI B;  2Q7G A;  3WFV A;  2YS8 A;  4LR3 A;  1YVW A;  5JVD B;  5FL7 G;  1YCI A;  4U3J B;  3MHS C;  4PA6 A;  1IL2 A;  3JYC A;  1ZUQ A;  2VQE O;  5E1A C;  3SPI A;  2ZQM A;  4FZ1 A;  2DJV A;  4OPA A;  4H2U A;  1EQR A;  4PV1 B;  1IBM B;  2W0X A;  1R3J C;  1NT2 B;  3CCM V;  1BBU A;  4PA4 A;  4DR5 O;  2P7T C;  2ZM6 B;  4G85 A;  2XAG A;  2AXT Z;  1AI7 A;  4FLT A;  1Q90 D;  4X8A A;  5B3S C;  3ZHV A;  5JH7 B;  2ZT8 A;  2KB1 A;  2IJI A;  4P3N A;  1R6K A;  3M7M X;  2YXH A;  5ITZ B;  3K3W A;  5CA0 A;  3OMA B;  4X65 B;  2ZNJ A;  3CPW U;  3BAB A;  3PCO A;  4XTV A;  3TGU H;  4DUZ O;  4DR6 B;  4FLV A;  2BTQ B;  3NEN A;  4FLY A;  3HKD B;  1N34 B;  2R9I A;  4FM2 A;  4AQY B;  2YC0 A;  3W7U A;  3PZC A;  1NZ6 A;  1P84 F;  1Q8I A;  3BFR A;  3OUS A;  1WA8 A;  2EIK B;  2RHQ A;  4WBN B;  5LXT B;  2QR4 A;  4J7K A;  2E65 A;  1NTK H;  3PN1 A;  1X59 A;  4MVM A;  3OTF A;  1NJ8 A;  4NTW A;  5LA6 B;  4N23 A;  4W4K A;  2JS3 A;  2EIL B;  2ZM6 O;  5GTI Z;  1J95 A;  5DED A;  2OCC C;  3JAS A;  2E10 A;  3JD4 A;  4YRQ A;  2CIM A;  3IGA C;  5D5Q A;  4QE9 A;  2DDZ A;  1IBM O;  1GKF A;  2PI5 A;  5EC1 C;  1M5I A;  1SQQ H;  3JAK A;  3MHH C;  4O4I A;  1W2B U;  2UXX A;  3E8H A;  1EIY A;  1SRY A;  2ZXW C;  2ADP A;  4C7U A;  4XTU A;  4ZIB A;  2PI4 A;  4AH6 A;  2P6J A;  3RFR A;  1NR7 A;  2YXY A;  2Q5Z A;  2Z5U A;  1BL8 A;  1K33 A;  2CJB A;  2MW2 B;  3OTO B;  2RDC A;  4U7O A;  1L1F A;  4UV9 A;  2NLJ C;  4TT3 G;  3A7R A;  4RMF A;  1V55 C;  1XBL A;  1QLN A;  2VWJ A;  2UXB B;  1M57 B;  2XUM A;  3HB3 B;  4K86 A;  4TSF G;  3CD6 V;  2DN9 A;  4XDJ A;  1VQ5 V;  5J2U B;  1P7B A;  2ZZE A;  3ZHS A;  5J2T B;  4X88 A;  2X6C A;  2DWD C;  1PL4 A;  4HWT A;  4FMT A;  4BW9 A;  1Z2G A;  2A9H A;  3A7A A;  2Y0I A;  1SA0 B;  1ZAU A;  1JVM A;  1AP5 A;  4PA7 A;  5LOV A;  1VQ9 V;  3BPZ A;  4UCO A;  3T4Z A;  1IZ3 A;  4LFA O;  2LW7 A;  1QLE C;  4DR2 B;  4B3R O;  5JH7 A;  3TXQ A;  4EFB A;  1S76 D;  5JCO A;  4H44 B;  5CA1 A;  3B2E E;  3ZRX A;  2QHV A;  3RVY A;  5A2Q N;  3K03 A;  3JD2 A;  3BA8 A;  3BEH A;  5L3F A;  4KHP O;  4HWO A;  3IFX A;  1R1B A;  4X66 O;  4AIL C;  4JZG A;  1Q6I A;  2DWE C;  1VF7 A;  4HAM A;  1BIB A;  4CH4 A;  3ZRV A;  3TK1 A;  2R70 A;  2ZZF A;  4LF4 B;  5IYD O;  1JMK C;  4F6R B;  3E2E A;  2XTA A;  1JOY A;  4O2A A;  4JI3 B;  2YI8 A;  2DMX A;  1M9N A;  4TV9 B;  2LJ2 A;  5A9G A;  1WNL A;  3AG2 B;  4PD4 F;  1HNX O;  3LSQ A;  1G4Y B;  1H2S B;  5L3G A;  3HPL C;  1XRE A;  3L9D A;  3CMA V;  1NVP D;  5B1B B;  4XTX A;  5JCO C;  2UUA B;  1K97 A;  4DV5 O;  4LFC O;  1VQ8 V;  4H37 A;  5FPO A;  1XNQ B;  1URF A;  1W0J G;  4ZBM A;  3B4S A;  4LNU B;  2DTI A;  1SZX A;  1H4Q A;  5CBG A;  1YIJ V;  4EB6 A;  5LXT A;  1N4C A;  4WFH A;  4FM0 A;  3KKY A;  1NS1 A;  3QVN A;  3H1J H;  3DSQ A;  3OTO O;  2QM7 A;  2YIB A;  2GTA A;  4I5S A;  3VQV A;  4JV5 O;  1NVP B;  1Q6U A;  2WA4 A;  2ZIO A;  2UUB O;  1VAR A;  3C3T A;  5E3I A;  4NXN O;  1SET A;  3SYC A;  4IT5 A;  4DV4 O;  5DN6 G;  1U96 A;  4HWR A;  2WLL A;  5F2V O;  2C8M A;  3JD0 A;  2ZZG A;  1GK9 A;  2F93 B;  1HNW B;  2W0F C;  1PP9 H;  3V7R A;  4B3M O;  4OP0 A;  4H0L B;  3CWB H;  4DK0 A;  2XND G;  3DC6 A;  1NQT A;  1HR0 O;  4I4T A;  3RYI B;  4Z1M G;  3SPJ A;  4CS3 A;  4L8J A;  1KMI Z;  2NNU A;  3CRQ A;  2ZKO A;  1R3I C;  2ALY B;  3REX A;  4LF6 B;  3AK3 A;  4LF5 B;  1HR0 B;  3CCE V;  1N36 O;  4YCU A;  5CA1 B;  4MVR A;  3ZX6 A;  4MTO A;  2AKW A;  3J81 N;  3ICA A;  2RN9 A;  3ASN B;  3DC5 A;  4PDL A;  3I55 V;  1OJH A;  2P5O A;  3FB6 C;  4KL1 A;  4HBN A;  4UCS A;  3RAC A;  5ITZ A;  3CS5 A;  5IYC O;  1EN5 A;  1OCZ C;  3T4D A;  1NI8 A;  3IC9 A;  1E1T A;  3AG3 C;  4DV4 B;  4WI1 A;  4LVM A;  2YEV A;  4PG3 A;  4XDK A;  5J2T A;  1PV0 A;  1NJI W;  4QPK A;  3LNN A;  4XTZ A;  4J15 A;  4DV3 B;  4LVK A;  2E1H A;  4B3M B;  4GX2 A;  3RIR A;  4DV2 B;  2ATK C;  2V4D A;  1AI5 A;  1LUW A;  1USY C;  1MAB G;  1IBK O;  4I4T B;  2FB5 A;  2QKC A;  2ZE8 A;  1Y6X A;  1X2H A;  3OMI B;  2ZNI A;  5B1N A;  2Y4U A;  4G28 B;  4RWU A;  1YSC A;  2FYU H;  1JFF B;  3OFN G;  5C8Y A;  1AB3 A;  2CGH A;  2IU0 A;  2FYK A;  4AQY O;  4MTF A;  1YDX A;  3OR6 C;  4GKK B;  1FAF A;  4DR7 O;  4EO4 A;  1K92 A;  2E76 B;  4YJ2 B;  2LGW A;  3ZS8 C;  1Y74 B;  3ABU A;  2A06 H;  4I55 B;  2AHZ A;  2VRZ A;  3HR0 A;  1H2K A;  4XTW A;  4YHH O;  3MAQ A;  3RKX A;  1N0N A;  5LYJ A;  3WG7 C;  4NTY A;  4EFE A;  4MTX A;  4P71 C;  4DW0 A;  3H1L H;  4LH6 A;  2HJD A;  1DF5 A;  1RPO A;  5JWP A;  4UB8 Z;  2FML A;  2WA3 A;  2YI9 A;  3O65 A;  1WA8 B;  4XEM A;  3Q4H B;  1HNZ B;  1FYF A;  4P73 C;  4DV0 B;  2LO1 A;  4PI2 A;  4JI1 B;  4KXR A;  5BXZ A;  1EN6 A;  1QNM A;  2JDI G;  4JTA B;  3ZED A;  4YRG A;  2CTQ A;  2YXL A;  2EIM C;  2Z0A A;  4PDR A;  4WFG A;  3HRI A;  5H6Q A;  4JI2 O;  3CCS V;  3ZCC A;  4H33 A;  4JI5 O;  2UXN A;  3RYH B;  2W6J G;  1NU1 H;  1D2D A;  2P4V A;  1SQF A;  1BGY H;  3C3S A;  1S0V A;  4HWS A;  5BR8 O;  1IUR A;  3AG2 C;  2PMF A;  1NTM H;  1JJ2 U;  4ZTU B;  2L35 A;  3LDD A;  3HXZ A;  1B6Q A;  4DR2 O;  4B3R B;  5LYJ B;  4P30 A;  1E24 A;  4D7T A;  3HFZ A;  1XUQ A;  1Y76 B;  4K0K O;  3NXS A;  1Z5V A;  1G1X B;  4DV7 B;  2HVK C;  3UGQ A;  4CZZ A;  2WLI B;  2DTO A;  3JCZ A;  3P30 A;  2J3M A;  4GZR B;  1RM1 C;  1WU7 A;  1VQ4 V;  4XBF A;  3IAY A;  1HC7 A;  2P67 A;  1FYJ A;  4GX1 A;  1WJZ A;  1GN4 A;  4NTX A;  2DYR B;  3IAL A;  2LFR A;  4WFF A;  4YRM A;  3STL C;  1HNZ O;  4TTV A;  3QO5 A;  4NVP A;  2ZD9 A;  1RSO A;  5KHH A;  3PCO B;  4DW1 A;  4JI2 B;  1FS0 G;  4OXS A;  4H2V A;  4OX9 B;  2YEV B;  2XOK G;  5JJJ B;  2DW4 A;  5DEC A;  1XI1 A;  1QR9 A;  1FXK B;  1K7D A;  3NET A;  4UCV A;  2JJ2 G;  4IIJ A;  3RKW A;  2Q73 A;  2HJF C;  3SYP A;  3JAR B;  4DR4 O;  1JPX A;  1AR5 A;  4L87 A;  1PNL A;  2GUZ A;  3V7C A;  5EIB C;  11AS A;  4X64 O;  3CRR A;  3C90 A;  1N8R W;  3ETG A;  4JAV A;  1EN4 A;  2X6A A;  4FM1 A;  2BOC C;  1FPO A;  4DUY B;  5LA6 A;  4DYL A;  3IKM B;  2OIE A;  4PEL A;  4DPG A;  1K4D C;  1S77 D;  3PJS K;  5HFM A;  2JEX A;  3OGI B;  3E89 A;  4DXW A;  1E22 A;  4YRS A;  4X65 O;  2CUG A;  2Q0O C;  3D3Q A;  4TV8 A;  1MSD A;  5BY1 A;  3UGT A;  5DM6 V;  1BZK A;  2UU9 O;  4FJC C;  4E2L A;  3JD3 A;  3CC7 V;  5CBF A;  1HDJ A;  2ZE5 A;  1R3K C;  1VEW A;  4BIZ A;  4FLU A;  5L3E A;  1ZWI C;  3E35 A;  3LSU A;  1IBK B;  2EJR A;  4Z1V A;  3CB2 A;  3FFQ A;  2PUS A;  4YRK A;  2VQE B;  3CXH F;  2QE7 G;  5LP6 C;  4K3A A;  4DR3 O;  2OCC B;  3CCJ V;  3OEH G;  2A3Q A;  2BOB C;  2XAS A;  1YJ9 V;  2CH7 A;  1FKA O;  1THZ A;  1E1R G;  4TV9 A;  3ETD A;  4HT4 A;  3HKE B;  5CMU A;  4JI7 B;  4Q6G A;  4ZHQ B;  3AG4 B;  3M99 B;  2DEQ A;  1VP7 A;  3F7Y C;  3DGE A;  3JAW A;  1U97 A;  2AHY A;  4R8C A;  1IXB A;  1J5E O;  5KNN A;  3FX7 A;  4D7S A;  3OD4 A;  5KX5 B;  1H2G A;  1B70 A;  4YRP A;  3CMQ A;  3JCU Z;  3AK2 A;  2X0L A;  3U0Z A;  2IM9 A;  4JYB A;  4LF9 O;  3THO A;  4FLW A;  1JJO A;  1Z7N A;  4YY3 B;  4J11 A;  1P49 A;  2JK5 C;  3ZBH A;  4Z2W A;  4UUJ C;  1OCO C;  2ZGW A;  4F4L A;  2E41 A;  1SQG A;  2R9A A;  3GVM A;  3VOU A;  2IW5 A;  5K1P A;  3HXU A;  1EVL A;  4DV1 O;  3LDE A;  1WPX A;  1HNW O;  4HNA A;  1K5Q A;  2ITD C;  1ADJ A;  5E79 Z;  3J80 N;  1NJ2 A;  3E83 A;  2DYS B;  3F5W C;  4K8X A;  1ENV A;  1H38 A;  1SER A;  1DF4 A;  1B8A A;  3HXW A;  1C0A A;  1GN2 A;  2ZDI C;  4JI5 B;  4LFC B;  4UVA A;  4YRN A;  4HYO A;  3CRA A;  3RYI A;  4KR2 A;  1KD1 W;  3X2Q B;  1G5I A;  2P4K A;  1AIL A;  1EFR G;  1KMM A;  2IH1 C;  2RMK B;  1X4T A;  2EIN C;  3G1Z A;  3T1H B;  1FFT B;  4LC1 A;  1WLE A;  4O2B A;  1K4C C;  1UJW B;  1H2M A;  3D3I A;  5FPR A;  4UCR A;  1XNR B;  3BJU A;  4K88 A;  4JI8 O;  4YIO A;  2DXU A;  5IJ9 B;  2I4N A;  4DR5 B;  4ZTZ B;  4YJ3 B;  4ASU G;  4TOI A;  4GYC B;  4CC5 A;  3OE7 G;  2HLD G;  1CEZ A;  1PPJ H;  1W66 A;  1QF6 A;  4HZ3 A;  2QM8 A;  2AW9 A;  1FXV A;  2I4L A;  2O57 A;  2PME A;  1IBL B;  4PA3 A;  5JJN B;  3A5Z A;  4YRF A;  4J7Z A;  3ZRW B;  1E1O A;  1ASY A;  2Q0A A;  3G4S V;  3VBB A;  4YYE A;  1QCE A;  4DK1 A;  1N33 O;  1TVK B;  4R50 A;  3MF2 A;  5KA6 A;  5K1X A;  2J3L A;  4UCU A;  4HA8 A;  1DGS A;  5BZB A;  2HG5 C;  1K8A W;  4X64 B;  2Y69 B;  2UUA O;  2N04 A;  2W6I G;  1JR9 A;  5KMG B;  2OTL V;  4NKG B;  1OCC C;  1BS3 A;  1M57 C;  3X2Q C;  5KHG A;  2Q7H A;  4B7K A;  5KLV H;  3ABM B;  1B76 A;  3CXC U;  1XMQ O;  1LYL A;  2JS5 A;  1EIY B;  2Q67 A;  1O9G A;  1AP6 A;  5IY5 B;  1G8M A;  2E5L O;  2H3O A;  3APO A;  2VQF B;  1WP8 A;  4I50 A;  1KBH A;  2XAF A;  3ZMT A;  4PHC A;  1SC5 B;  3UT5 B;  1FXK A;  3K04 A;  4X1Y A;  4XU1 A;  3ZHQ A;  1VF5 B;  1M93 A;  2QWO B;  2G38 A;  2ZDI A;  1UFI A;  1TVK A;  1WAZ A;  1KYO F;  4UXN A;  4A5U B;  4WCE V;  1CP9 A;  1Y76 A;  1L0W A;  3T1C A;  2QHT A;  2IY5 B;  4OPH A;  4DV1 B;  3L4G B;  1XMO B;  5B3S B;  4J9Y B;  2YID A;  2K1E A;  4LFA B;  3UM7 A;  1PM9 A;  4WF9 V;  2KSD A;  1K34 A;  3TET A;  1NTZ H;  4JAS A;  3E8B A;  3HY0 A;  1BT8 A;  4X1K A;  3RGL A;  1S5J A;  2FTK A;  5KUK A;  3K5O A;  3QG5 A;  3FYE B;  3W3S A;  2P90 A;  5EBM C;  3ERR A;  1WPB A;  2Y69 C;  4NR1 A;  3HKB B;  5CB4 A;  1RIQ A;  1BHB A;  2QWR B;  1VQ7 V;  3OM3 B;  2WWW A;  1KQS U;  1YFT A;  2DE0 X;  3LSS A;  3SJQ C;  1H2L A;  4MSW C;  2Q7E A;  2WLN A;  4HNA B;  3ICX A;  1VQM V;  2ODM A;  4B3T O;  4QIW F;  3KZI Z;  3FD9 A;  4K35 A;  3UFG A;  4YXW G;  3W7X A;  1GM8 A;  3JAL B;  4RQE A;  1XEQ A;  3DXR A;  3RF1 A;  3SJC C;  4X1I A;  4J41 A;  4D6T H;  1VQK V;  3G71 V;  2QJ1 A;  4PA9 A;  3VQW A;  4H02 A;  2CDY A;  3OMN B;  5EBL C;  5LGT A;  1D5A A;  1XNQ O;  4DR3 B;  4JTD B;  2Y48 A;  3KCY A;  2Q8V A;  2YUA A;  1KOG A;  1VQZ A;  4JI0 B;  4JI0 O;  5KHK A;  1JFF A;  4LNU A;  5C8Y B;  4FLX A;  3KG2 A;  5B1A C;  1MMM A;  4ZKI A;  1RP3 B;  4WJ4 A;  1MA1 A;  1VF6 C;  3G6E V;  3RBZ A;  4ZHQ A;  2F66 C;  2QWQ B;  3K9S A;  1H4T A;  1VQO V;  3T2M A;  4B7E A;  3F7V C;  3A32 A;  5EIB D;  2ADQ B;  5LGN A;  1OCO B;  1BQZ A;  2GUZ B;  1N9W A;  3HFV A;  4YCW A;  1GN3 A;  2UXD B;  4MVU A;  2BTQ A;  3E22 A;  2YIC A;  2Q6A A;  2F4V O;  3DXR B;  5KMG A;  5EK0 A;  2XHB A;  5EYP B;  4X5O A;  2IH3 C;  2A79 B;  4WFA V;  3BAA A;  2CAZ C;  1B7Y A;  1NH2 D;  5ELO A;  1YIT V;  3S3X A;  1XOU A;  4JF3 A;  1EBO A;  2ALY A;  2ARU A;  3BFM A;  3WQZ A;  1TA8 A;  3WB0 A;  2VS0 A;  2P22 C;  1G51 A;  4DRX A;  3T1Y O;  5TIS Z;  2ZT9 B;  4K87 A;  2R72 A;  1SS3 A;  2AKW B;  1FJG B;  1XDC A;  3L74 H;  2UUC O;  3ZRS A;  1IX9 A;  3E9H A;  1WQ7 A;  4PJ0 Z;  4B08 A;  5C51 B;  4CH6 A;  2EIM B;  3UKM A;  2EWN A;  3MF1 A;  4RUE A;  5LMU B;  3L1A A;  1QLE B;  2PF4 E;  5LMU O;  4LF6 O;  1UPG A;  4WFE A;  3M4P A;  2B5U A;  1I0H A;  1F4N A;  4O4L A;  1YJW V;  4LP8 A;  3ZJZ A;  3SR2 C;  3IJ4 A;  1YFS A;  3JAT B;  1L0N H;  5IDJ A;  3R65 A;  1XMQ B;  2CJA A;  2EIL C;  4DV6 O;  1AJN A;  3CSX A;  2PYJ A;  2RCV A;  5LHH A;  2EJG A;  3ABM C;  4YRT A;  1D5N A;  4JI4 O;  3BHP A;  3CEI A;  1Q6H A;  1OCR B;  1FD9 A;  4UP9 A;  3IG2 A;  4LVL A;  1KB9 F;  1M56 C;  3TEH B;  4TVA A;  5C52 B;  4DRX B;  2AMC A;  2EZP A;  4FIP C;  4IHJ B;  2JGU A;  1VF6 A;  1Y66 A;  4N21 A;  1USY A;  3GB7 C;  2KG7 A;  4TVY A;  4X89 A;  3OR7 C;  4UCT A;  5KX5 A;  4W4L A;  1XMO O;  4BR6 A;  4IIJ B;  2I4O A;  1N32 B;  2EIJ B;  4I55 A;  1QBZ A;  3HTZ A;  3JAR A;  4MVZ A;  5CA0 B;  3AG1 B;  5BR8 B;  1N0J A;  3K79 A;  4DR1 O;  1K73 W;  4Q15 A;  3ABK B;  3L75 H;  1KP2 A;  1DLB A;  3HY1 A;  5KUM A;  1QHT A;  4CC6 A;  1AJP A;  1G6U A;  1ADY A;  1H4V B;  3VQX A;  3CP1 A;  2P5I A;  2E5L B;  3IC7 A;  4I9W A;  1DTO A;  3RYF A;  3A0R A;  5EBW C;  4DV0 O;  4BWA A;  4I50 B;  1ZX3 A;  3EFF K;  3TEH A;  2QKA A;  3L72 H;  3RVZ A;  2EJF A;  5IT9 N;  1YFR A;  4P72 A;  4GKK O;  2BTO A;  4NXM B;  1GAX A;  1XQ8 A;  4RAI A;  2MK3 A;  4KFM A;  1G5H A;  2A8E A;  2AGA A;  4DR7 B;  2EL9 A;  2ZIN A;  3M8A A;  2QHU A;  3AEI A;  3JAM N;  4XU0 A;  2DTH A;  1WPY A;  2QTO A;  4TWK A;  2QKS A;  2QSA A;  3RKY A;  3BA9 A;  4FZ0 A;  1PD3 A;  3V8J A;  4YDQ A;  4B3S O;  5GON B;  1J5W A;  3ABK C;  4IL6 Z;  3CC4 V;  3KCX A;  3EXA A;  3SDL A;  5BMV A;  2P0L A;  2K9P A;  3ASN C;  2ZE6 A;  2F1M A;  3EHB B;  5H2F Z;  3BY6 A;  3B77 A;  4JGS A;  4YRO A;  3HRK A;  4H2T A;  2WLH A;  1MSW D;  1MZF A;  4J80 A;  2B1I A;  4YRC A;  4DV6 B;  1BHA A;  1X56 A;  4G84 A;  4Q20 A;  2OCH A;  5KHI A;  4JI4 B;  4KR3 A;  4YRJ A;  3P8Y A;  1I94 B;  4YY3 O;  4P71 A;  2IY5 A;  2UXC O;  1YB3 A;  4JI6 B;  1B70 B;  4RUF A;  1F51 A;  3NR7 A;  5JQG A;  3R66 A;  2UXB O;  2ZT6 A;  2VWK A;  1TUE B;  5C93 A;  4YIP A;  1S5L Z;  2ZT7 A;  2HHH B;  3OAA G;  5FNV A;  3A7U A;  2F43 G;  1LR1 A;  1F23 A;  5J2U A;  3LNM B;  3V8L A;  1L8D A;  1YHQ V;  2IJJ A;  1B3Q A;  2L6L A;  3SPH A;  1BIA A;  5IYZ B;  3T1Y B;  4IHJ A;  4MT8 A;  3V8K A;  5LP6 A;  5CN0 A;  4ZOL B;  4FFK A;  1RPR A;  4JAA A;  1COW G;  1ORQ C;  3IKL A;  4AHC A;  1OHH G;  4LWS A;  3P8T A;  1AI4 A;  2IJH A;  3P3P A;  2E75 B;  4YRR A;  3LUT B;  4R7C A;  4TWA A;  5KHJ A;  2HFE C;  2UUB B;  3P32 A;  2M6Y A;  3ASO C;  5EYP A;  3RL6 A;  2YSU B;  5B1O A;  2ODR D;  2DOS A;  1ZSP A;  3A5Y A;  2G4C A;  1GTO A;  4DUZ B;  4DR6 O;  3ZMU A;  3K58 A;  3QNE A;  4U7N A;  1H2N A;  4YP0 A;  1NJ5 A;  2RQ6 A;  3D36 A;  3K5L A;  1ASZ A;  1I7F A;  2GHY A;  4FVM A;  5D5P A;  4GCZ A;  4EEQ A;  2QEX V;  1HNX B;  1AR1 B;  4EB6 B;  3K5M A;  3A2F A;  1I5X A;  1WQW A;  4LCU C;  1VIB A;  3OW2 U;  4JYC A;  1F4M A;  1HP8 A;  2GDS A;  3N2G A;  4DR4 B;  3CHX A;  3CX5 F;  3B8M A;  2WSS G;  1RM1 B;  2LGQ A;  4CBC A;  1Q7Y W;  2AZ0 A;  5L3B A;  1BCC H;  4P9P A;  1EOV A;  2HR3 A;  1EVK A;  1XNR O;  4RDX A;  4J7J A;  4KHP B;  3J7A U;  1SQP H;  4O4L B;  1M56 B;  2RHS B;  4LBE C;  3SYO A;  2WLK A;  1R73 A;  4DR1 B;  4WJ3 M;  3A0B Z;  1QE0 A;  2QDO A;  1M90 W;  3WU2 Z;  2DZ9 A;  2BCC H;  3STZ C;  4LF4 O;  1ROP A;  3ZN0 A;  1FXK C;  3RUX A;  3JAW B;  3N27 A;  1DK1 A;  1Q86 W;  3SJB C;  2QM4 A;  4I0X B;  3U11 A;  4X66 B;  4ZI7 B;  3CCV V;  2RHQ B;  4P74 A;  1AI6 A;  1M1K W;  4G2K A;  5B1B C;  4DO2 A;  1R6T A;  3UT5 A;  3K08 A;  4MS2 A;  2F23 A;  1I08 A;  4BW5 A;  4X20 A;  3H1K H;  1N32 O;  4G27 B;  4MTG A;  1FJG O;  2ZTG A;  4LVJ A;  5IYZ A;  4JYA O;  5LBQ A;  3MQZ A;  2P06 A;  4OGQ B;  1GMG A;  4PHZ A;  5H5N A;  3H1I H;  1YZB A;  1JX9 A;  3ZMS A;  3JAK B;  3CME V;  1X55 A;  4P3O A;  4J9Z B;  3ZHU A;  1K5S A;  4RQF A;  4H2W A;  2ARS A;  1YF2 A;  2RHS A;  1NH2 B;  1GM9 A;  2N05 A;  2ZCE A;  4LWS B;  4R6Z A;  5EZY A;  5GTH Z;  4O2D A;  1NKD A;  1XHZ A;  3G67 A;  4UB6 Z;  3SGI A;  2QA4 V;  1KMN A;  3RYH A;  3S3W A;  2DKG A;  4QJF B;  2Q5I A;  3HKC A;  1GN6 A;  4O4J B;  2VQF O;  4XEO A;  4J42 A;  3APQ A;  1LNQ A;  4PI0 A;  2DXT A;  1QVF U;  3K5N A;  3ETQ A;  1RSO B;  5FLX N;  1SQB H;  3ZHR A;  3I7F A;  1MG1 A;  4XTY A;  2X7R B;  4MW8 A;  5LMN B;  4XU2 A;  3RN4 A;  2AZ2 A;  2C2A A;  5F5W A;  4YJ2 A;  4IGG A;  2EZO A;  3FAV B;  4GLX A;  2UU9 B;  2KQX A;  4IYH A;  2IU3 A;  4PDV A;  1PNK A;  3K57 A;  4JTC B;  4QPJ A;  1YI2 V;  1YGB A;  5LOV B;  2QHS A;  4FK5 C;  1NJ6 A;  3W7S A;  5KA5 A;  1Q81 W;  2GV9 A;  1PL0 A;  2PYL A;  3ABT A;  2HEP A;  2Z3Y A;  4UVC A;  2E5A A;  4JI7 O;  4P75 A;  1QR8 A;  1SA0 A;  2E64 A;  1Y74 A;  1MNG A;  4WF2 A;  2DU7 A;  4B3T B;  4U3F H;  2B9Z A;  1GGM A;  1I5Y A;  3AK1 A;  2YIA A;  2NS6 A;  1P4R A;  1ZTE A;  4P74 C;  3W7W A;  1HW7 A;  1ZL8 B;  3NEM A;  1IBL O;  5LHI A;  4UV8 A;  3HFZ B;  1MOF A;  4NXM O;  4JYY A;  1L0L H;  1ZLZ A;  2N74 A;  3JAT A;  2E74 B;  2ART A;  1IVS A;  2EJ7 A;  4OX9 O;  2DYS C;  1O9H A;  1SF9 A;  3SPC A;  3LC0 A;  3AG3 B;  2YIB D;  5LMN O;  3CYO A;  1JCH A;  3V7S A;  2HHH O;  2ARH A;  4P75 C;  2XAQ A;  1E79 G;  1N36 B;  2C7I A;  4TV8 B;  5IJ0 A;  3EFR A;  3HXY A;  2DQ0 A;  4IYI A;  3JSN A;  3CRC A;  3GWK C;  4KUM A;  1VQ6 V;  3UH0 A;  3P3N A;  3RYF B;  3HKE A;  2DYR C;  2GBO A;  2KKW A;  4ABM A;  1SQV H;  1FXH A;  2CTR A;  4O4H B;  4X20 B;  3RYC B;  3M4Q A;  3ZRW A;  1BE3 H;  3A8T A;  1SQX H;  4H2Y A;  3D8C A;  2DQ3 A;  3MDS A;  1ZL8 A;  1Y4M A;  2Q4P A;  4DV7 O;  4YRE A;  1QQC A;  3MD0 A;  4K0K B;  3OGC C;  4CH3 A;  3G6B A;  1A32 A;  1K3E A;  1V54 B;  2WLL B;  3SJA C;  3UCS C;  2QGN A;  4RO2 A;  1PYS A;  1JQ0 A;  3HKB A;  5CB4 B;  5KAF Z;  4MVS A;  2XTI A;  5JVD A;  1LUV A;  4P9O A;  5AG2 A;  4FPP A;  3L71 H;  2A7W A;  2V1D A;  4DQ2 A;  2ILM A;  3SYQ A;  1WB8 A;  2ZR3 A;  1JJC B;  4WBN A;  3HKC B;  3OT7 A;  2F4V B;  1CPY A;  4X9Q A;  4AI8 A;  5HFL A;  1BSM A;  1N34 O;  4GX0 A;  4NYK A;  3JAL A;  2EIJ C;  4I7Z B;  3I5D A;  2UUC B;  2ZE7 A;  4X62 B;  1TUB A;  2Q69 A;  2D3O W;  4LF5 O;  2JEU A;  4LVI A;  4XU3 A;  3ASO B;  3HXX A;  1OZ0 A;  3E8F A;  4NB5 A;  3R07 A;  1IXM A;  4P2Z A;  3RWR D;  3O9O A;  1HTT A;  1FFX B;  3TJT A;  3QF7 A;  2CGN A;  1KC8 W;  2CGO A;  4JZ2 A;  2IJK A;  3SPG A;  4EX5 A;  1SZT A;  4LH7 A;  2ZXF A;  3Q4H A;  3K06 A;  3ETE A;  4BIU A;  3HKD A;  3UO2 A;  2CK3 G;  2NN4 A;  4I9Q A;  3ABL C;  1OCC B;  3L4G A;  3E22 B;  3MEY A;  2JRI A;  3FKS G;  4F6E A;  1V9P A;  5BMV B;  3AG1 C;  4TVW A;  2QWP B;  3JD1 A;  4BIO A;  4JPR A;  2ZT5 A;  1XIL A;  2WLJ A;  3FB8 C;  4HWP A;  4P72 C;  3E8G A;  3OUF A;  1NYQ A;  2RNB A;  1VQP V;  3K0D A;  5LL6 Y;  3B40 A;  1QU7 A;  2I4M A;  2M7W A;  4JV5 B;  4F6R A;  3CE2 A;  4H13 B;  2ZIM A;  1GO3 F;  3NEL A;  2BE3 A;  3ZMZ A;  2HNI A;  2ZXW B;  1H4S A;  1OCZ B;  3ZMV A;  5IE9 A;  2QTS A;  1EM1 A;  1QVG U;  4ZOL A;  1IDS A;  1S3J A;  2RJZ A;  1XHX A;  4FLZ A;  3OD1 A;  1YJN V;  3ABL B;  3CCQ V;  2ETN A;  2FL4 A;  3ZHT A;  4LF8 O;  3LDC A;  3FB7 C;  2EAY A;  1KKC A;  3I56 V;  1NJ1 A;  2WLM A;  5CA3 A;  4X1I B;  2WPD G;  3B8N A;  2B1G A;  3L73 H;  3JSL A;  4MW3 A;  2JIZ G;  4FFB B;  1X54 A;  1JA8 A;  2Y0P A;  3CJH B;  1PYS B;  1YEW A;  3HXV A;  5LGU A;  4YCV A;  5HGQ A;  2FKX A;  2PTM A;  2DJZ A;  3GWO A;  2Y4T A;  1OV9 A;  1EZJ A;  5LHG A;  1HWY A;  4JI8 B;  1F7Y A;  4UPA A;  3BCC H;  2PY5 A;  3D36 C;  1WN7 A;  2UXC B;  1MZE A;  1Q82 W;  2CJ9 A;  3H01 A;  3OEE G;  1AR4 A;  4H2X A;  2YDE A;  2X6B A;  4P3P A;  2LQT A;  1WB7 A;  3N2G B;  2GTS A;  2XGT A;  1CXZ B;  3REU A;  3H1H H;  1VQL V;  3EFS A;  2HVJ C;  3RW0 A;  3WG7 B;  4KP4 A;  4TUY B;  5B1A B;  3KFU A;  2H94 A;  4O4H A;  3RYC A;  5IWA B;  3WB2 A;  2E3C A;  2DVE A;  1XL6 A;  4YJ3 A;  3FB5 C;  4JYA B;  5IWA O;  5H9C A;  1FFX A;  5EZY B;  2EIN B;  5L3D A;  4TVA B;  3UO3 A;  1B04 A;  4YRI A;  4O2B B;  5FNV B;  4ZI7 A;  3B09 A;  1JJC A;  2D2C B;  1US6 A;  2F95 B;  1SKV A;  5IJ9 A;  4WFB V;  1NBM G;  4FFB A;  4OLF A;  1K9M W;  2A0L A;  1H8E G;  1TAE A;  3N2K A;  5IYB O;  4B3S B;  2CTP A;  4LF7 B;  4E51 A;  1HXD A;  4HVC A;  1X2G A;  3A31 A;  1Q5O A;  2Q68 A;  2UXD O;  5LP6 B;  1NR1 A;  1P7G A;  3VQY A;  2XT9 A;  4BAY A;  1YTF D;  4QE7 A;  2Q5H A;  4NXN B;  4O2A B;  1NNH A;  3FAV A;  4XDL A;  1KEC A;  5J9P C;  4YPF A;  2JGD B;  4K8Z A;  2WLI A;  1WNS A;  4LNS A;  5C53 B;  4JI6 O;  3QO7 A;  2ODR C;  1TUB B;  3W7T A;  4NCX A;  2PGG A;  3AG4 C;  3ZIA G;  3L70 H;  4JI1 O;  2EIK C;  4MVQ A;  2LW1 A;  1W59 A;  4I0X A;  1YTF B;  3ML0 A;  5GW7 A;  4O4J A;  4DV5 B;  4QNH B;  3FJP A;  4JI3 O;  2BSK A;  4GKJ B;  5IJ0 B;  2PZS A;  5B5E Z;  3P8V A;  3K9A A;  1E1Q G;  1N33 B;  2OTJ V;  5JJE B;  1BQ0 A;  3QO8 A;  2R9R B;  4YHH B;  2EX3 A;  2ZR2 A;  1S72 V;  4H2S A;  1Y67 A;  3CC2 V;  4UFZ A;  2AMC B;  2XAJ A;  3F5T A;  4LF8 B;  4U3J A;  1V55 B;  1PKX A;  4KQE A;  2V7Q G;  1Z7M A;  4PDM A;  3RT3 C;  3U10 A;  4JAU A;  3UQ8 A;  1NYR A;  3L2Z A;  4CH5 A;  4EKW A;  4DUY O;  2DZC A;  1Q3E A;  1S5H C;  1GM7 A;  3TXS A;  3TEG A;  1KP3 A;  2GSM B;  4H2X B;  3ZN1 A;  4E4E A;  4QGP A;  5GON A;  4DV2 O;  2OYQ A;  2EBO A;  3BVO A;  12AS A;  5EC2 C;  2WAM A;  4DV3 O;  1YXB A;  1TGO A;  1M4U A;  5KAI Z;  3T1H O;  1GRJ A;  2EUL A;  1WYD A;  3K0G A;  3CJH A;  1WP7 A;  2LP7 A;  2ITC C;  3CCL V;  3TUP A;  4TQD A;  1AJQ A;  1VQN V;  4GKJ O;  1VMG A;  3A74 A;  1OCR C;  2H8P C;  2CE4 A;  4X1K B;  1Z5W A;  3EVK A;  2LFS A;  2OWO A;  4GUN A;  3WB1 A;  2JVD A;  3CCR V;  1V54 C;  4UVB A;  4LFB O;  3H9V A;  4X1Y B;  3CRM A;  5JQG B;  1T5E A;  3CCU V;  4UP8 A;  2IBZ H;  1KU9 A;  2Q9L A;  4X62 O;  3E9I A;  3RGB A;  3E86 A;  2DU5 A;  4TUY A;  2XAH A;  4LFB B;  5B66 Z;  1EZV H;  2OIG A;  4MVO A;  4YRL A;  2OT5 A;  4J10 A;  3TCU A;  4CS4 A;  4GX5 A;  2JGD A;  4TQF A;  4CS2 A;  1SES A;  2CH7 B;  1AVM A;  3G80 A;  3SYA A;  3JAS B;  1PNM A;  2JJ1 G;  4UP7 A;  1B7Y B;  4LF7 O;  2HP8 A;  1X01 A; 
#chains in the Genus database with same CATH homology
 2UXN A;  3HFV A;  1W0K G;  1ATI A;  2W6J G;  1BBW A;  4YCW A;  2QHS A;  4FK5 C;  4MVU A;  1R3L C;  1S0V A;  1NJ6 A;  3W7S A;  4HWS A;  1EFW A;  5KA5 A;  1Q81 W;  2EJ9 A;  3AG2 C;  5IY5 C;  1PL0 A;  2Q6A A;  2PMF A;  1JJ2 U;  2HKO A;  3ABT A;  5CBH A;  4ZTU B;  2Z3Y A;  3LDD A;  4UVC A;  5EK0 A;  2E5A A;  3HXZ A;  1B6Q A;  3DTU B;  4X5O A;  1KKD A;  2IH3 C;  5H6R A;  4GT1 A;  4P30 A;  2A79 B;  1E24 A;  4WFA V;  4P75 A;  1QR8 A;  3HFZ A;  1ARO P;  1H8H G;  1BMF G;  1NH2 D;  1B7Y A;  1YIT V;  2E64 A;  3QTC A;  3NXS A;  5ELO A;  1XL4 A;  1R6N A;  2HVK C;  4JF3 A;  5ELN A;  1EBO A;  2WLI B;  4CZZ A;  2ALY A;  2ARU A;  3BFM A;  2DU7 A;  4WF2 A;  5L3C A;  4P73 A;  3WQZ A;  3FYI B;  2Q7G A;  1GGM A;  3WFV A;  2DTO A;  3JCZ A;  3P30 A;  2J3M A;  1G51 A;  1I5Y A;  2NS6 A;  1P4R A;  1RM1 C;  5FL7 G;  4K87 A;  3W7W A;  4P74 C;  1WU7 A;  3MHS C;  4PA6 A;  1VQ4 V;  1IL2 A;  3NEM A;  3JYC A;  2AKW B;  4XBF A;  1HC7 A;  2P67 A;  4GX1 A;  5LHI A;  3E9H A;  4UV8 A;  5E1A C;  3ZRS A;  2DYR B;  3SPI A;  1WQ7 A;  3HFZ B;  1MOF A;  3IAL A;  2LFR A;  4WFF A;  2ZQM A;  4YRM A;  5C51 B;  4CH6 A;  3STL C;  2EIM B;  2ART A;  3UKM A;  2EWN A;  4H2U A;  1EQR A;  4TTV A;  3MF1 A;  3QO5 A;  2DYS C;  4RUE A;  2ZD9 A;  3PCO B;  3L1A A;  1QLE B;  3SPC A;  1R3J C;  3CCM V;  1BBU A;  3LC0 A;  3AG3 B;  1FS0 G;  4OXS A;  4H2V A;  4PA4 A;  4WFE A;  2P7T C;  2YEV B;  4G85 A;  2XAG A;  2XOK G;  3CYO A;  3M4P A;  2B5U A;  1AI7 A;  1JCH A;  2DW4 A;  3V7S A;  1QR9 A;  1F4N A;  1FXK B;  1K7D A;  4X8A A;  5B3S C;  4LP8 A;  2JJ2 G;  3ZJZ A;  1YJW V;  3NET A;  2ZT8 A;  2KB1 A;  4P75 C;  3RKW A;  2IJI A;  2HJF C;  1E79 G;  2XAQ A;  3SYP A;  1R6K A;  4P3N A;  1YFS A;  2C7I A;  3EFR A;  3HXY A;  1JPX A;  2DQ0 A;  3K3W A;  5IDJ A;  4L87 A;  1PNL A;  3OMA B;  3R65 A;  2ZNJ A;  3CPW U;  4KUM A;  2CJA A;  2EIL C;  1AJN A;  1VQ6 V;  3PCO A;  3V7C A;  11AS A;  5LHH A;  4XTV A;  2EJG A;  3UH0 A;  1N8R W;  3ETG A;  4JAV A;  3ABM C;  4YRT A;  2X6A A;  2DYR C;  3NEN A;  2BOC C;  1OCR B;  1FXH A;  3M4Q A;  3ZRW A;  2R9I A;  3IG2 A;  4UP9 A;  4LVL A;  1M56 C;  3IKM B;  3TEH B;  4PEL A;  4TVA A;  5C52 B;  2AMC A;  4DPG A;  1K4D C;  1S77 D;  3PJS K;  3W7U A;  3PZC A;  4H2Y A;  2EZP A;  2DQ3 A;  2JEX A;  4FIP C;  5HFM A;  3OUS A;  1Y4M A;  3E89 A;  4DXW A;  1E22 A;  2EIK B;  4YRE A;  2RHQ A;  4YRS A;  3MD0 A;  1Y66 A;  1USY A;  3OGC C;  4N21 A;  3GB7 C;  4TVY A;  4CH3 A;  4X89 A;  3OR7 C;  1K3E A;  1V54 B;  2WLL B;  2E65 A;  4RO2 A;  1PYS A;  1JQ0 A;  4MVM A;  2I4O A;  2EIJ B;  1QBZ A;  4MVS A;  2XTI A;  3HTZ A;  1NJ8 A;  4N23 A;  4MVZ A;  4P9O A;  4FPP A;  3AG1 B;  3UGT A;  3K79 A;  5DM6 V;  2EIL B;  2V1D A;  1K73 W;  1J95 A;  4DQ2 A;  2OCC C;  3ABK B;  4Q15 A;  2E10 A;  1KP2 A;  1DLB A;  3JD4 A;  4YRQ A;  2CIM A;  3IGA C;  3SYQ A;  2ZR3 A;  4FJC C;  1JJC B;  4E2L A;  3HY1 A;  3JD3 A;  4QE9 A;  3CC7 V;  2DDZ A;  1GKF A;  5KUM A;  5EC1 C;  2PI5 A;  1AJP A;  5CBF A;  1CPY A;  3MHH C;  1R3K C;  5HFL A;  1W2B U;  2UXX A;  3E8H A;  1ADY A;  1H4V B;  3VQX A;  1EIY A;  4GX0 A;  4BIZ A;  3CP1 A;  5L3E A;  2P5I A;  1ZWI C;  3E35 A;  1SRY A;  2EIJ C;  2EJR A;  2ZXW C;  3IC7 A;  4XTU A;  4I9W A;  2PI4 A;  4ZIB A;  2Q69 A;  4YRK A;  2D3O W;  4AH6 A;  2JEU A;  4LVI A;  2P6J A;  1DTO A;  1NR7 A;  4XU3 A;  2QE7 G;  3ASO B;  3HXX A;  3A0R A;  1OZ0 A;  3E8F A;  2Z5U A;  5EBW C;  1BL8 A;  1K33 A;  2OCC B;  3CCJ V;  4BWA A;  3R07 A;  2CJB A;  1IXM A;  4P2Z A;  4U7O A;  1L1F A;  3OEH G;  4UV9 A;  1HTT A;  2NLJ C;  3EFF K;  4TT3 G;  2BOB C;  3TEH A;  1KC8 W;  3A7R A;  2XAS A;  1YJ9 V;  4RMF A;  3RVZ A;  1V55 C;  1THZ A;  2IJK A;  3SPG A;  2EJF A;  1E1R G;  4EX5 A;  1QLN A;  1YFR A;  1SZT A;  3ETD A;  2ZXF A;  1M57 B;  4P72 A;  3HB3 B;  4HT4 A;  4K86 A;  3K06 A;  5CMU A;  4Q6G A;  3ETE A;  4TSF G;  3CD6 V;  4RAI A;  4BIU A;  3AG4 B;  2MK3 A;  3M99 B;  2DEQ A;  4XDJ A;  2CK3 G;  1X56 A;  1VQ5 V;  3ABL C;  1OCC B;  3L4G A;  4KFM A;  3F7Y C;  3DGE A;  1P7B A;  2ZZE A;  1G5H A;  2A8E A;  3MEY A;  2AHY A;  3FKS G;  4X88 A;  4R8C A;  2X6C A;  2EL9 A;  2DWD C;  2ZIN A;  2QHU A;  3AEI A;  3AG1 C;  4HWT A;  4TVW A;  3JD1 A;  2ZT5 A;  4FMT A;  4JPR A;  2WLJ A;  3FB8 C;  4BW9 A;  4XU0 A;  2A9H A;  2DTH A;  1WPY A;  3A7A A;  2QTO A;  4TWK A;  4HWP A;  4P72 C;  3E8G A;  3OUF A;  1NYQ A;  1VQP V;  2QKS A;  3RKY A;  3K0D A;  1JVM A;  4PA7 A;  2I4M A;  2M7W A;  1VQ9 V;  1PD3 A;  1H2G A;  1B70 A;  4YRP A;  3T4Z A;  3CMQ A;  3V8J A;  2X0L A;  2ZIM A;  1GO3 F;  4JYB A;  1QLE C;  3NEL A;  4YDQ A;  3ZMZ A;  1Z7N A;  2HNI A;  1J5W A;  3ABK C;  1S76 D;  2ZXW B;  3CC4 V;  1H4S A;  1OCZ B;  2P0L A;  2JK5 C;  3ZMV A;  3ZRX A;  4UUJ C;  2QHV A;  1OCO C;  3RVY A;  4F4L A;  2ZGW A;  2E41 A;  3ASN C;  1QVG U;  3K03 A;  3EHB B;  3JD2 A;  3BY6 A;  1S3J A;  3B77 A;  2IW5 A;  3BEH A;  4JGS A;  3VOU A;  1EVL A;  3HXU A;  3HRK A;  3LDE A;  1WPX A;  5L3F A;  4H2T A;  4YRO A;  1K5Q A;  2ITD C;  2WLH A;  1MSW D;  1YJN V;  1ADJ A;  1NJ2 A;  3OD1 A;  4HWO A;  3ABL B;  2B1I A;  3IFX A;  3CCQ V;  4YRC A;  2DWE C;  3E83 A;  2DYS B;  3LDC A;  3FB7 C;  2EAY A;  3F5W C;  4HAM A;  1ENV A;  3I56 V;  1H38 A;  1SER A;  1BHA A;  1BIB A;  1DF4 A;  2WLM A;  5CA3 A;  1B8A A;  1NJ1 A;  3HXW A;  4Q20 A;  4G84 A;  4CH4 A;  2WPD G;  1C0A A;  3ZRV A;  3B8N A;  2ZDI C;  3TK1 A;  3P8Y A;  4YRJ A;  4KR3 A;  2ZZF A;  4P71 A;  2B1G A;  2IY5 A;  5IYD O;  4UVA A;  1YB3 A;  4MW3 A;  3E2E A;  1JOY A;  4HYO A;  1B70 B;  4YRN A;  4RUF A;  2JIZ G;  1X54 A;  1F51 A;  4KR2 A;  1KD1 W;  2ZT6 A;  3X2Q B;  1G5I A;  1PYS B;  1M9N A;  1EFR G;  1KMM A;  3EFS A;  1TUE B;  2IH1 C;  5C93 A;  5LGU A;  1WNL A;  2EIN C;  3HXV A;  3AG2 B;  3G1Z A;  4YCV A;  5HGQ A;  1FFT B;  4LC1 A;  2DJZ A;  1WLE A;  3LSQ A;  1K4C C;  3GWO A;  1G4Y B;  3OAA G;  1UJW B;  2ZT7 A;  3D3I A;  3BJU A;  5L3G A;  1EZJ A;  3HPL C;  5LHG A;  4K88 A;  1HWY A;  3A7U A;  2F43 G;  3CMA V;  4UPA A;  1NVP D;  1F23 A;  5B1B B;  2DXU A;  4XTX A;  2I4N A;  3LNM B;  4ZTZ B;  1K97 A;  4ASU G;  1Q82 W;  3V8L A;  1YHQ V;  2CJ9 A;  3OE7 G;  2IJJ A;  3H01 A;  1VQ8 V;  4H37 A;  3OEE G;  4H2X A;  2HLD G;  1CEZ A;  2X6B A;  3SPH A;  1BIA A;  4P3P A;  3UGQ A;  1W66 A;  1QF6 A;  1W0J G;  4ZBM A;  1YGB A;  4MT8 A;  2XGT A;  2DTI A;  3REU A;  1VQL V;  3V8K A;  1H4Q A;  4HZ3 A;  2QM8 A;  5CBG A;  2HVJ C;  3RW0 A;  1YIJ V;  1FXV A;  4KP4 A;  3WG7 B;  2I4L A;  2PME A;  5CN0 A;  5B1A B;  1RPR A;  3KFU A;  4WFH A;  4PA3 A;  1COW G;  2H94 A;  1ORQ C;  2DVE A;  2E3C A;  3DSQ A;  1XL6 A;  2QM7 A;  3IKL A;  3FB5 C;  4I5S A;  3VQV A;  3A5Z A;  4YRF A;  1NVP B;  1OHH G;  3ZRW B;  1E1O A;  5H9C A;  2ZIO A;  1AI4 A;  3P8T A;  1ASY A;  2EIN B;  2IJH A;  5L3D A;  3G4S V;  4TVA B;  5E3I A;  4YRR A;  3LUT B;  4R7C A;  1SET A;  3VBB A;  4YYE A;  1QCE A;  3SYC A;  4YRI A;  4TWA A;  5DN6 G;  2HFE C;  4R50 A;  3P32 A;  3MF2 A;  3ASO C;  1JJC A;  5KA6 A;  2YSU B;  5B1O A;  2ODR D;  4HWR A;  3RL6 A;  4WFB V;  5K1X A;  3A5Y A;  2G4C A;  1NBM G;  2WLL A;  2J3L A;  2C8M A;  1GTO A;  3JD0 A;  1K9M W;  4HA8 A;  4OLF A;  2A0L A;  2ZZG A;  1GK9 A;  1H8E G;  3ZMU A;  5BZB A;  3QNE A;  5IYB O;  4E51 A;  2HG5 C;  1HXD A;  3RUX A;  4U7N A;  1K8A W;  4YP0 A;  2W0F C;  2Y69 B;  1NJ5 A;  4HVC A;  3D36 A;  1X2G A;  1ASZ A;  2GHY A;  4OP0 A;  3V7R A;  3A31 A;  2W6I G;  2OTL V;  2Q68 A;  1OCC C;  2XND G;  4GCZ A;  2QEX V;  1NR1 A;  1M57 C;  1AR1 B;  3VQY A;  1NQT A;  4BAY A;  1YTF D;  1I5X A;  4QE7 A;  1WQW A;  2Q5H A;  4LCU C;  3X2Q C;  2Q7H A;  1NNH A;  3OW2 U;  4XDL A;  4Z1M G;  1KEC A;  3SPJ A;  4CS3 A;  2NNU A;  3ABM B;  5J9P C;  4JYC A;  4YPF A;  1R3I C;  2WLI A;  1B76 A;  2ALY B;  3CXC U;  4LNS A;  1F4M A;  3REX A;  1LYL A;  5C53 B;  3QO7 A;  2ODR C;  3W7T A;  1EIY B;  4NCX A;  2Q67 A;  3B8M A;  2WSS G;  3CCE V;  4YCU A;  5IY5 B;  1G8M A;  1RM1 B;  4CBC A;  4MVR A;  3AG4 C;  3ZIA G;  1Q7Y W;  4MTO A;  5L3B A;  2AKW A;  4P9P A;  2EIK C;  2HR3 A;  1EOV A;  1EVK A;  3ASN B;  4MVQ A;  2XAF A;  4PDL A;  3ZMT A;  3I55 V;  3ICA A;  4PHC A;  4RDX A;  5KNN A;  1FXK A;  1YTF B;  3FB6 C;  3K04 A;  3ML0 A;  1M56 B;  5GW7 A;  4XU1 A;  4QNH B;  4LVK A;  2RHS B;  3FJP A;  4LBE C;  3SYO A;  2WLK A;  1R73 A;  2ZDI A;  3RAC A;  5IYC O;  4WJ3 M;  1OCZ C;  4UXN A;  3T4D A;  4WCE V;  3K9A A;  1QE0 A;  3P8V A;  1CP9 A;  1E1Q G;  1M90 W;  3T1C A;  1E1T A;  2DZ9 A;  3AG3 C;  1L0W A;  4WI1 A;  4LVM A;  2YEV A;  3STZ C;  2OTJ V;  4PG3 A;  3QO8 A;  4XDK A;  2QHT A;  2R9R B;  2IY5 B;  1ROP A;  1NJI W;  4QPK A;  5K1P A;  3L4G B;  3ZN0 A;  1FXK C;  2ZR2 A;  4J9Y B;  5B3S B;  1S72 V;  2K1E A;  4H2S A;  4J15 A;  4XTZ A;  3UM7 A;  3CC2 V;  2E1H A;  2AMC B;  2XAJ A;  4GX2 A;  3TET A;  1K34 A;  4WF9 V;  1Q86 W;  3RIR A;  1V55 B;  1PKX A;  2ATK C;  4JAS A;  3E8B A;  3HY0 A;  4KQE A;  1AI5 A;  2V7Q G;  1Z7M A;  3RGL A;  4PDM A;  2FTK A;  1USY C;  3CCV V;  2RHQ B;  1MAB G;  5KUK A;  4JAU A;  1NYR A;  3L2Z A;  4P74 A;  4CH5 A;  3FYE B;  1AI6 A;  3W3S A;  2P90 A;  5EBM C;  4G2K A;  4EKW A;  1M1K W;  1X2H A;  2DZC A;  3ERR A;  1S5H C;  3OMI B;  2Y69 C;  5B1B C;  2ZNI A;  1RIQ A;  1GM7 A;  4G28 B;  3K08 A;  5B1N A;  4DO2 A;  4MS2 A;  1BHB A;  4BW5 A;  3TEG A;  1VQ7 V;  1YSC A;  3OM3 B;  2WWW A;  4G27 B;  1KP3 A;  1KQS U;  2GSM B;  4MTG A;  1YFT A;  4H2X B;  3OFN G;  3ZN1 A;  2ZTG A;  4LVJ A;  3LSS A;  2IU0 A;  3SJQ C;  2CGH A;  2FYK A;  2EBO A;  4MTF A;  3OR6 C;  12AS A;  5EC2 C;  2WAM A;  4MSW C;  5LBQ A;  2Q7E A;  2WLN A;  3MQZ A;  1VQM V;  4EO4 A;  1K92 A;  1GMG A;  4QIW F;  1JX9 A;  3ZMS A;  1WYD A;  3K0G A;  3CME V;  1X55 A;  4P3O A;  2LP7 A;  2ITC C;  1K5S A;  4J9Z B;  4RQF A;  3CCL V;  4H2W A;  3UFG A;  2ARS A;  4TQD A;  1AJQ A;  3ABU A;  3TUP A;  1VQN V;  4YXW G;  3W7X A;  2AHZ A;  1GM8 A;  1NH2 B;  2RHS A;  1GM9 A;  4RQE A;  2ZCE A;  3A74 A;  1OCR C;  2H8P C;  4R6Z A;  4XTW A;  3RKX A;  4O2D A;  3RF1 A;  1NKD A;  2LFS A;  1VQK V;  3WG7 C;  2QA4 V;  1KMN A;  3G71 V;  3CCR V;  2DKG A;  4PA9 A;  4MTX A;  4QJF B;  1V54 C;  1N9W A;  4P71 C;  4UVB A;  4H02 A;  3VQW A;  2Q5I A;  3OMN B;  5EBL C;  4XEO A;  5LGT A;  4JTD B;  3CCU V;  2Y48 A;  4UP8 A;  1KOG A;  1DF5 A;  1VQZ A;  1RPO A;  1LNQ A;  2DXT A;  1QVF U;  3E9I A;  4XEM A;  3E86 A;  2DU5 A;  3KG2 A;  5B1A C;  1FYF A;  2XAH A;  3I7F A;  1MG1 A;  4ZKI A;  4P73 C;  4XTY A;  2X7R B;  4MW8 A;  4XU2 A;  4WJ4 A;  2C2A A;  5F5W A;  3G6E V;  4MVO A;  3RBZ A;  4YRL A;  2JDI G;  1H4T A;  2OT5 A;  3TCU A;  4JTA B;  1VQO V;  3T2M A;  2EZO A;  4CS4 A;  4GX5 A;  4YRG A;  3F7V C;  3A32 A;  4TQF A;  4CS2 A;  2EIM C;  1X01 A;  1SES A;  2IU3 A;  4PDV A;  1PNK A;  3SYA A;  5LGN A;  1PNM A;  2JJ1 G;  1OCO B;  4UP7 A;  4PDR A;  4WFG A;  1B7Y B;  3HRI A;  4JTC B;  5H6Q A;  4QPJ A;  1YI2 V;  3CCS V;  3ZCC A;  4H33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...