2DQ3A

Crystal structure of aq_298
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
425
Chain Sequence
b'MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGTDVIRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seryl-tRNA synthetase
publication title Crystal structure of aq_298
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 133
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dq3A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dq3A02
4YRKA 3RF1A 3HFZA 1ASZA 3IKLA 2P5IA 2XGTA 4YRMA 1PYSB 3HXXA 1L0WA 3V7CA 2E41A 4KR3A 2DEQA 1X01A 2J3LA 3PCOB 4RQEA 2DXTA 1B7YA 4H2UA 1JJCA 3KFUA 4ZTUB 2Q7GA 2ZXFA 2ZTGA 1J5WA 2ZCEA 3HRKA 4P71A 3I7FA 1SERA 3QNEA 2I4NA 4PHCA 3EFSA 3RACA 3VBBA 1EFWA 1NYQA 1BIAA 4OLFA 2C7IA 2ZT7A 4L87A 1NJ1A 4XU1A 2RHSA 1E24A 3L4GB 1USYA 3P8YA 4TVWA 4YRRA 4K88A 5C53B 4BWAA 4J15A 3NETA 3HXZA 4XTVA 3ERRA 1GGMA 2AMCA 3VQXA 2E5AA 3A7AA 4YP0A 3MEYA 2CIMA 3HRIA 2EJFA 4TVAB 2QHSA 3A5ZA 4TQDA 4XTZA 4P71C 4UP8A 1H4SA 2ARSA 2RHQB 2ALYB 4H2XB 4YRLA 3V8LA 4TQFA 1BBWA 1NJ8A 3VQVA 1WPYA 2FYKA 1NNHA 2CGHA 2Q5IA 4RMFA 3A5YA 4XU0A 2DQ0A 11ASA 1WU7A 1KMNA 2QHUA 3RKWA 5HGQA 5ELNA 3HXUA 1WQWA 3UGQA 4H2WA 3V7RA 2ZZGA 3HY1A 1H4TA 3E9IA 1PYSA 1ADYA 1USYC 2DDZA 1E1TA 4YROA 2ZT8A 3RIRA 3V8JA 3IALA 1H4QA 4K87A 1ATIA 2DVEA 1E22A 3M4PA 1B70B 4XU3A 4DPGA 2Q7HA 4H2SA 4UP9A 3A7UA 1WLEA 4CH6A 2CJBA 3R07A 4KQEA 3A7RA 1EIYA 4CH3A 3G1ZA 2ZNIA 3TUPA 2J3MA 1YGBA 4P3NA 3QO7A 4UP7A 3LSSA 1FYFA 3A31A 3BJUA 3QO5A 3UH0A 4YRGA 4NCXA 3TEHB 1EQRA 1HC7A 2E64A 2Q7EA 1WNLA 4TWAA 1HXDA 3HFZB 4WI1A 4XU2A 4KR2A 4P72A 4X5OA 4HWTA 2DU7A 2DKGA 1EOVA 2DZCA 4HWSA 1SRYA 1JJCB 1EVKA 4PG3A 4DQ2A 4XEMA 1Z7MA 2I4MA 4YRSA 4H02A 2DTOA 4YDQA 5E3IA 3HXVA 2ALYA 3MF2A 3L2ZA 1SESA 1YB3A 2EAYA 3HTZA 4UPAA 2ARTA 1X56A 4YRIA 5C51B 5ELOA 3RL6A 4Q15A 5C52B 4XTWA 3QO8A 4TTVA 1G5HA 3CMQA 4YPFA 4CH4A 3MF1A 4CS2A 4P72C 1X55A 2ZT6A 4AH6A 3EFRA 4YCUA 2ZNJA 2RHSB 2I4OA 4CS4A 1YFRA 1NJ5A 1SETA 2DZ9A 2AKWA 5K1PA 2IY5A 4O2DA 2DU5A 2ODRD 3HY0A 2E10A 1QF6A 2ODRC 4CS3A 4E51A 1NJ6A 4RQFA 4P73A 3TEGA 3UGTA 3RGLA 2DQ3A 3M4QA 3VQWA 4YRTA 3REUA 2AMCB 3PCOA 2ZR3A 4YRCA 4G85A 2ZR2A 2ARUA 2ZZEA 4ZTZB 2C8MA 5F5WA 4XEOA 1VQZA 4YCVA 3WQZA 4P74A 1KMMA 4YYEA 1IL2A 4RDXA 3VQYA 2ZIOA 2E65A 2I4LA 5KNNA 2ZIMA 1NYRA 1E1OA 1N9WA 1B76A 4Q6GA 4HWPA 1X2GA 2DTHA 4P73C 2ZGWA 4XTXA 3IKMB 2EJ9A 3V8KA 1X2HA 3HXYA 4CH5A 4XTYA 2E1HA 3L4GA 4OP0A 1BBUA 3NELA 1NJ2A 3W3SA 2EJGA 3RKYA 4P75A 2Q5HA 4EO4A 1B7YB 1Z7NA 3V7SA 3RUXA 1EIYB 4TVYA 4HWRA 4LNSA 4YCWA 1BIBA 4P74C 1ASYA 3HXWA 3REXA 3A32A 2QHTA 4WJ3M 2ZT5A 2XTIA 4EX5A 4TVAA 1WQ7A 3E9HA 3NEMA 1KOGA 2RHQA 3A74A 2DTIA 1EVLA 4H2XA 3P8VA 2CJ9A 1YFSA 4XTUA 4G84A 4HWOA 3P8TA 12ASA 1W66A 3FJPA 3QTCA 1G51A 3HFVA 3ICAA 3UFGA 3IG2A 4YRNA 2EWNA 2E3CA 4YRFA 4K86A 1HTTA 3LSQA 3L1AA 4P3OA 3OD1A 2EL9A 4WF2A 4P75C 4YRQA 1YFTA 2G4CA 1G5IA 3RKXA 4H2TA 1B70A 1C0AA 1QE0A 4YREA 2P0LA 1X54A 1RIQA 4YRJA 3NENA 2HNIA 4H2VA 2ZINA 5K1XA 3PZCA 4H2YA 2PMFA 1B8AA 1WYDA 2CJAA 4HVCA 3DSQA 2DJZA 2PMEA 1ADJA 2DXUA 4HA8A 3TEHA 4BW9A 2QHVA 1LYLA 4YRPA 4P3PA 4ZIBA 4WJ4A 2AKWB 3BFMA 2IY5B 2ZZFA 3LC0A 1H4VB
chains in the Genus database with same CATH superfamily
1HWYA 4YRKA 3HFZA 3IKLA 5KHJA 3NXSA 4PV1B 1YXBA 1PNMA 2KB1A 2DEQA 1JFFB 2K1EA 1S0VA 2OYQA 4RQEA 2QTOA 1WP8A 1VQ7V 4O2AB 3D36C 2W0XA 3KFUA 3OUSA 3IJ4A 5J2UB 1M4UA 2JDIG 1OZ0A 1NR1A 1SQBH 2CGOA 2H8PC 3F5WC 1ZLZA 2P67A 2ZCEA 1J5WA 4WFAV 4FLXA 3FB5C 3HB3B 4P71A 3I7FA 2Q68A 3JD4A 3QNEA 2PI4A 2YXYA 3J80N 5LP6B 4GCZA 2QM8A 3EFFK 3CHXA 2P7TC 4DUYB 1NYQA 1DF4A 3APOA 3CXHF 3OUFA 4EEQA 1XNRO 4OLFA 4PHZA 1OCRC 2ZDIC 4NVPA 5KX5A 5JQGB 1NJ1A 1G1XB 1E24A 1HNWB 1AILA 5EBWC 3PN1A 1LUVA 1P7GA 2RJZA 3RYCA 5JH7B 4GX2A 5C53B 3OT7A 4LFBO 1LUWA 4J15A 3NETA 3HXZA 3ZMVA 4XTVA 2DWEC 3JALA 1MG1A 3OMNB 2E5AA 3A7AA 2DOSA 3MEYA 2EJFA 2QDOA 2EILC 1AJQA 2DYRC 2ARSA 2RHQB 4H2XB 4TQFA 1OJHA 4U3JB 1BBWA 1DF5A 3JSLA 2OCCB 4DR5B 1YHQV 1SQXH 5EIBD 2JS3A 3RWRD 4F6RA 5EIBC 3P3NA 2CGHA 5BZBA 3AK2A 4O4LB 3A5YA 2WLLB 3IC7A 4Z1VA 2CTQA 2DQ0A 11ASA 5FL7G 1WU7A 2LO1A 3AG4C 4DR2B 5CA1A 4QE7A 3STLC 3UGQA 1EZVH 2ZZGA 2LW7A 1PYSA 1VIBA 1ADYA 1USYC 1SA0A 1E1TA 4YROA 2PY5A 2JRIA 5H6RA 2IU3A 1SKVA 1RPRA 1WAZA 3HKCB 5LA6B 2WSSG 3QVNA 2EBOA 2EIMC 5LHIA 4FIPC 1Q6IA 4DPGA 2Q67A 1BHBA 4K8XA 4JAUA 3DTUB 4UP9A 1UPGA 3IFXA 1NTMH 4DUYO 2BOBC 2AXTZ 4DXWA 3R07A 3ZHUA 1ZX3A 4UVBA 1VMGA 3A7RA 2IJJA 3L71H 1BE3H 5C8YB 3F7VC 1HNWO 3L9DA 1QLEC 3G1ZA 2ZNIA 3QO7A 5EYPA 1PL0A 1FYFA 3CCUV 1WN7A 3QO5A 4AILC 4MVSA 3UH0A 3TEHB 3GWOA 4NTXA 1VEWA 3RGBA 2ODMA 1HR0B 5KUKA 2YUAA 4RAIA 5CN0A 3OGIB 3H9VA 1VF5B 4TSFG 1TUBA 2Q7EA 1XBLA 4WI1A 2Y69B 4XU2A 3K57A 3RN4A 4LNUB 5B1OA 2P22C 2F93B 3GWKC 3JASA 1K34A 2HP8A 4OX9B 3LDDA 4JTDB 2XAGA 1ZL8A 1YZBA 4O2BB 4JI3B 5LYJB 1MZEA 4DR5O 4DV2B 4I55B 1SRYA 4FZ1A 3N27A 4D7TA 4XEMA 2I4MA 4YRSA 1W0KG 1U96A 2DTOA 1E1QG 4TV9A 4YDQA 2A79B 1YSCA 4IYHA 3LUTB 1G4YB 2DJVA 2WA3A 2ALYA 2O57A 1OCZB 3UKMA 3RYFA 3ML0A 1R73A 4WBNB 3RYIA 5KAFZ 1EM1A 4I4TA 3L2ZA 5FPRA 1KUQA 1EN6A 1SESA 1SS3A 3RVZA 3L72H 5B1BB 3W7WA 3CCEV 5C51B 4KHPO 5C52B 4YJ2B 3CMQA 4YPFA 2A06H 4X1KB 4AH6A 3BVOA 2ZNJA 1AI5A 3U0ZA 1CEZA 2LJ2A 3A0BZ 4U3FH 4NB5A 4PD4F 2EULA 5EBMC 5KMGB 3SYPA 5K1PA 2IY5A 1YIJV 3P32A 1JPXA 2BSKB 1N33B 2ODRD 4CC6A 1QF6A 4RO2A 1H8HG 2ODRC 3ZRSA 2Q6AA 1NJ6A 4MVOA 1PNKA 3OEEG 3RFRA 4RQFA 3TXSA 1OCCC 1HR0O 3ABUA 3TXQA 3VQWA 2UU9B 1JFFA 5DEDA 1SZTA 2ZR3A 4J11A 2ZR2A 4O2AA 1VQ6V 2QWOB 1BGYH 4K0KB 1YDXA 3FB8C 5J2UA 5IWAB 1U97A 4DR4B 4P74A 1KMMA 4GUNA 1QBZA 4BW5A 5LMNB 4DV2O 1Q8IA 2CK3G 2N05A 1KKCA 4UCVA 2ZIOA 1GK9A 2E65A 5LP6A 2I4LA 5KNNA 1PD3A 1TUEB 2ZIMA 3E8BA 1K7DA 1M57B 3OE7G 3CE2A 2V4DA 1N9WA 4RUEA 4QJFB 1VQKV 4Q6GA 1A32A 2LGWA 5AG2A 3L74H 2DYSB 3TCUA 4L8JA 1XI1A 3ZMSA 1I5XA 5JQGA 2ZGWA 1S5LZ 3V8KA 4MVQA 4HNAB 2JEUA 1BBUA 2BTQB 3NELA 2QWNB 5JH7A 3B40A 5DN6G 1M1KW 3RKYA 4XDKA 2P06A 5H9CA 5B66Z 4TUYB 4DV7B 2Q5ZA 4PA4A 4FLYA 4YCWA 4LFCB 2NN4A 2NR5A 5CBGA 4DV0O 3A32A 1OCOC 5LHGA 1N33O 4WJ3M 1WQ7A 1BMFG 4Z1MG 3E9HA 3UCSC 2MK3A 2RHQA 3K5LA 2N74A 3E89A 2DTIA 2WA4A 5IYZB 3ETGA 1EVLA 4H2XA 2X7RB 4U3JA 3ZHRA 3THOA 4XTUA 2P6JA 3UO3A 4G84A 2VS0A 2UU9O 4HWOA 1Q6HA 3TGUH 1QLNA 1JCHA 3ZN0A 1YTFB 3FJPA 4O4LA 4X9QA 1VQ9V 4CBCA 4JZGA 2WLLA 1NH2B 3HFVA 5LHHA 3MD0A 2EWNA 4K0KO 3FAVA 4PDLA 1Y66A 4WFBV 3LSQA 2EJ7A 5IWAO 4LFAB 1N32B 2UXDB 4DR4O 3L1AA 4BAYA 4BIZA 4P3OA 1AI6A 3OD1A 1FYJA 2UXXA 2UUCB 3K04A 5LMNO 4P75C 3HKCA 5LA6A 1BQZA 2G4CA 3RYCB 5KUMA 4R8CA 3LDEA 5JWPA 5B1AB 2QE7G 5KHHA 1HW7A 1S3JA 3B09A 4G2KA 2ZINA 4UB6Z 4PDVA 2PMFA 3RW0A 3ABTA 2CJAA 4HVCA 4JI8B 2PF4E 1XOUA 5C8YA 3OTFA 2EZPA 4GKKB 4PDMA 5FPOA 4HA8A 3TEHA 2N04A 3AG1C 1ROPA 3AK1A 4I7ZB 4ZIBA 4WJ4A 3D3QA 2YEVB 2BE3A 2WWWA 5LOVA 4DV7O 2ZZFA 2QGNA 3LC0A 3HKDB 1LR1A 4DR6B 4LFCO 4KL1A 3RF1A 1FFTB 1PYSB 3HXXA 3TETA 1WNSA 1H2MA 4FLUA 1K4CC 1X01A 2MW2B 4O2BA 5LYJA 3JARB 2DXTA 1PL4A 2Y4TA 3OW2U 1B7YA 4I55A 4H2UA 4U7OA 4NTYA 1B3QA 3SPIA 2YIBD 4RUFA 1KMIZ 2QKCA 3ABLB 3O65A 1ZTEA 2CDYA 2ZXFA 2WLIB 2ZTGA 2ZKOA 4LFAO 1N32O 2UXDO 4WBNA 4FLWA 1QVFU 3JD1A 4FM0A 5IY5B 2UUCO 1OV9A 5LXTB 5IJ0B 2OT5A 1H2NA 3JD0A 1JOYA 2GTSA 1O9GA 3WG7C 4UXNA 3BEHA 2IJHA 4C7UA 1FS0G 4YJ2A 2C7IA 1H2KA 3G67A 2AHYA 4X1KA 2ZT7A 4H33A 4XU1A 1GN6A 4JI8O 1JX9A 5KMGA 3AG3C 3SJAC 1W59A 2Q0OC 2WLKA 3JASB 2BSKA 3B4SA 4PI2A 2F23A 3P8YA 3BCCH 4K88A 4GKKO 4LF6B 3KCYA 1COWG 4FMTA 2R9RB 2B9ZA 3ZX6A 2VWKA 5CB4B 1RM1B 4WFFA 3K9AA 1V55C 5DM6V 1DGSA 4DR6O 4LF7B 1H4SA 2LFSA 2QM4A 1UJWB 2ALYB 2CTRA 3T1CA 1IZ3A 4WF9V 3ZMTA 3VQVA 1NJ8A 3A8TA 3IGAC 1Q43A 2GTAA 1WPYA 1ZUQA 4LBEC 1NNHA 1FXKC 4IL6Z 1NR7A 1NBMG 3K5MA 1N36B 3JCUZ 2Z5UA 3T1HB 1QU7A 2HR3A 2EINB 2JGUA 2ITCC 1FXHA 5H5NA 3V7RA 5B5EZ 1FKAO 5BR8B 3E9IA 1KECA 1S77D 2D3OW 2JEXA 4CZZA 1BL8A 3RIRA 3V8JA 3DXRB 5H6QA 4K87A 1F7YA 2UXNA 2W6IG 2DVEA 1E22A 2WLMA 3CCVV 1K9MW 1KC8W 4B3RB 3JYCA 4N21A 1Q86W 1ENVA 3R66A 4HNAA 1I08A 4H2SA 3M7MX 3A7UA 2BTQA 2Q9LA 4MT8A 3S3XA 3BRCA 4B3MB 2QWRB 5L3CA 1L0NH 3DC5A 1R6NA 2Y0PA 4EB6B 3G71V 4TUYA 1QCEA 1YEWA 1QR8A 3E8HA 4NXNB 3X2QC 4P3NA 3CMEV 3ABMC 4OGQB 4UP7A 4DV3B 2HEPA 1FJGB 4JYBA 1BCCH 4NCXA 3IAYA 4JI4B 2EIKC 1XQ8A 2XUMA 4JI1B 5IYZA 4DV6B 3CC2V 4LF6O 2E64A 5GONB 2Q73A 2NLJC 1Q7YW 5LGTA 1SC5B 3CWBH 4TWAA 3CCJV 4E2LA 1PPJH 2XAFA 1OCRB 4KR2A 4P72A 4LF7O 4NXMO 3J7AU 2UUAB 3SPGA 3ETQA 1R1BA 5A2QN 1S5HC 4AHCA 2PUSA 4J7JA 2DKGA 1EOVA 2IBZH 4P9PA 2DZCA 2JIZG 2ZXWC 4LF9B 4HWSA 4YJ3B 1MOFA 1XHXA 4LH7A 1JJCB 1EVKA 4PG3A 4DQ2A 2B5UA 4D6TH 1Z7MA 1HDJA 4DR7B 1N36O 4K8ZA 3T1HO 1ORQC 1GN4A 3H1IH 1QHTA 3ZN1A 3MF2A 5BR8O 1PKXA 4LCUC 2EILB 2DYRB 3OD4A 4TV8B 1YB3A 2ARTA 2GHYA 5ELOA 4Q15A 4B3RO 1PV0A 4GLXA 3QO8A 4CH4A 1US6A 1Z5WA 1GM7A 1YI2V 3EHBB 2RHSB 2I4OA 3AG4B 3N2GB 1SETA 3KZIZ 2W6JG 2A8EA 1F4NA 2GBOA 4DUZB 2Y4UA 2YEVA 1MSDA 4W4LA 1NJIW 4O2DA 3HKDA 3HY0A 4NXNO 1J95A 3FAVB 4DV3O 2VQEB 4TT3G 2EIMB 4B3TB 4J42A 3TEGA 1W0JG 3RGLA 2DQ3A 5KHKA 4JI1O 4DV6O 1I5YA 3REUA 4J10A 5JJEB 2AMCB 3T1YB 3K5NA 4IIJB 3JARA 2YIBA 1NTKH 2B1GA 3ASNC 3GB7C 2ZZEA 3D3IA 2QWPB 3L70H 2C8MA 2OWOA 3CCQV 2VWJA 5F5WA 1WA8B 4OXSA 4YCVA 4LVLA 3WQZA 1QLEB 2Q69A 4I0XB 2WLIA 1B06A 3K0GA 2HKOA 5BXZA 2LFRA 5L3FA 3OEHG 1GMGA 2DMXA 3TK1A 4QGPA 3B77A 3ZJZA 5LXTA 5IJ0A 4DR7O 4GT1A 1QVGU 1XMOB 4JV5B 1E1OA 2EIJC 4CC5A 1KKDA 4OPAA 5LOVB 1S72V 2DTHA 3J81N 3CRCA 4P73C 4XTXA 3CJHA 2EJ9A 1CPYA 1GN2A 2JK5C 3ZMZA 1WB8A 3I56V 1BT8A 4FM1A 1NJ2A 3W3SA 5CBFA 1GAXA 2EJGA 2HVJC 2PYLA 2ITDC 4R7CA 1VP7A 4EO4A 1B7YB 3P3PA 3V7SA 2G38A 4HWRA 4TVYA 4UVAA 2FL4A 1ASYA 3SDLA 4DUZO 5CB4A 1IVSA 2XTIA 4EX5A 1R3IC 1AB3A 2EJRA 4DR2O 1FXVA 3SJCC 4FVMA 2UUBB 3SYCA 3LDCA 2VQEO 1K5SA 1YFSA 1Z2GA 4B08A 2DE0X 5E79Z 1SQGA 5JCOC 1W66A 1B04A 2A7WA 2JGDB 3IG2A 5HFMA 4ZOLB 2Q8VA 2R9IA 1YJWV 4PI0A 2WPDG 3JSNA 4YHHB 3OR7C 4QIWF 3K58A 3KG2A 4WFEA 2XNDG 1MA1A 3CC4V 1WJZA 1WPBA 4MTFA 3UQ8A 4WF2A 4YRQA 3DXRA 1YFTA 3LSUA 3RKXA 2XTAA 4H2TA 3SPHA 1OCCB 4G28B 4X1YB 1H8EG 3WB1A 1XMOO 3JAWB 1DK1A 4LF4B 4JV5O 4YRJA 4JI7B 3D36A 4H2VA 2IU0A 2ILMA 3OMIB 1H2SB 1WYDA 2HJFC 4FFBB 3ZIAG 3ABKC 3DSQA 1K73W 4EB6A 2KG7B 3A0RA 3B8NA 2ZT9B 4JI2B 2OIGA 4DV5B 4ICGA 3K59A 2QR4A 2A9HA 3IC9A 3UO2A 2ZD9A 4OX9O 2QHVA 3E22B 2H94A 1VQOV 4JI3O 1XUQA 1XILA 1J5EB 1AJNA 2CUGA 5GONA 4UV8A 4PA6A 3VOUA 2WLJA 2H3OA 2XGTA 3CS5A 2ZDIA 3AG2C 1K97A 1L0WA 3V7CA 2QKAA 2E41A 3JATB 2UUBO 1CP9A 4XDLA 1VF6C 4YJ3A 5CMUA 3WFVA 3S3WA 3CXCU 1NKDA 1M56C 1I94B 1JJCA 4JGSA 3LNMB 2GSMB 5CA0B 4YHHO 1BHAA 2K9PA 1N8RW 2XHBA 1OCOB 4X88A 1FFXB 4MTXA 1JR9A 3SJBC 2RCVA 2L35A 4TV8A 5KHGA 4GX1A 5LGUA 1B6QA 2YXLA 4B7EA 2I4NA 4JASA 1GM8A 3EFSA 1SQVH 2M7WA 1Q5OA 2HLDG 4LC1A 1BIAA 5EZYA 1E1RG 4JI7O 4L87A 3F7YC 2RHSA 3N2GA 4YY3B 1K8AW 2UXCB 2HVKC 3H1KH 1NVPB 2YIAA 2M6YA 4JI2O 5JVDB 1USYA 4DV5O 3SPCA 4TVWA 2FYUH 5IYCO 1K33A 2PZSA 1XHZA 1NVPD 3RBZA 3MQZA 4BWAA 2KSDA 3AEIA 3UM7A 3HPLC 2XAQA 2IM9A 4LWSB 1EFRG 4JTAB 4X65B 3ERRA 4UVCA 3VQXA 2AMCA 5BY1A 4YP0A 4FLVA 4TQDA 3JD3A 4IIJA 5L3EA 4I50B 4P71C 4XTZA 3FB7C 2QKSA 3SYQA 4X20B 1IBMB 4B7KA 1WA8A 4BR6A 2FYKA 2BOCC 1SQFA 3K79A 1KYOF 4I0XA 1KD1W 1IBKB 4RMFA 5F2VO 3G80A 4PA9A 2IJIA 2CTWA 1KBHA 1I94O 1KMNA 2QHUA 3RKWA 4I9WA 3AG1B 3HXUA 2ZQMA 4X89A 5KA5A 4K3AA 1WQWA 1H4TA 5GTIZ 3CCLV 1TAEA 1F23A 2DDZA 3HR0A 1THZA 2ZT8A 3OM3B 1MSWD 3ZCCA 4P30A 2AZ0A 1H4QA 1ATIA 1R6TA 1NZ6A 3FKSG 4YXWG 3FYEB 3M4PA 3AK3A 4XU3A 4X1IB 4MVUA 4JYYA 1BS3A 3APQA 2CJBA 2JVDA 4DR1B 3E8FA 1YJNV 1VQ8V 4P9OA 2PTMA 5KA6A 1TVKB 3WU2Z 5IE9A 4YY3O 3AG7A 2UXCO 3TUPA 5J9PC 2J3MA 4A5UB 3T4ZA 1I7FA 3A31A 4FJCC 2DWDC 3L73H 4YRGA 4NYKA 1EQRA 4R50A 1R3KC 1HC7A 1EZJA 3E2EA 5B3SC 5C93A 3E35A 3WG7B 3SYAA 2A0LA 1ZAUA 4W4KA 4X65O 1WNLA 1HXDA 3C90A 4I5SA 2LQTA 1PNLA 4E4EA 3ZHSA 4HWTA 1AJPA 4J7KA 2JGDA 4ABMA 4ZOLA 4UUJC 3FX7A 4WFGA 1MMMA 3B8MA 1IBMO 2GUZB 3AG3B 2CE4A 1S5JA 2D2CB 1O9HA 3CJHB 1T5EA 3CRAA 3K3WA 1IBKO 3OMAB 4FPPA 3M8AA 5IDJA 3FD9A 1AR5A 1YCIA 5EBLC 3K03A 4X1YA 4X66B 1D2DA 1UFIA 3HKEA 5KAIZ 4FLZA 3BA8A 3JAWA 2FKXA 1V55B 1HNZB 1JMKC 4AI8A 2GV9A 4FFBA 4G27B 3HTZA 4UPAA 3CP1A 2KG7A 4XTWA 3A2FA 3SGIA 4TTVA 1G5HA 3FB6C 3MF1A 3MDSA 4CS2A 1TA8A 1FXKB 3Q4HB 3CPWU 2OCHA 5JJJB 3EFRA 2PGGA 3CRQA 4ZI7A 4YCUA 2DN9A 5IJ9B 4DR1O 2BTOA 1NJ5A 1GN3A 3H1HH 3E22A 5EC1C 3JD2A 2DU5A 2E10A 5D5PA 3K9SA 4CS3A 1XNRB 5L3BA 4WCEV 3ASOC 1RP3B 2ZE5A 3UGTA 3I5DA 3JATA 2XOKG 3ZRWA 1D5AA 2ATKC 1P49A 4YRCA 1SF9A 4JI6B 1M5IA 2ARUA 4B3SB 5GTHZ 3A0HZ 5CA0A 2VQFB 4ZTZB 1QR9A 3D8CA 3ZRVA 5KLVH 4JI5B 1WB7A 2XAHA 3BABA 3X2QB 3ABMB 2FB5A 1V54C 1FFXA 1AP6A 4MSWC 4J7ZA 4YYEA 4BIOA 3CCSV 1IL2A 2QEXV 3HKBB 3VQYA 4N23A 2EIKB 2F95B 5LMUB 3N2KB 3RVYA 4ZHQB 3U11A 1NYRA 4TWKA 4FZ0A 4X66O 1B76A 1Q6UA 1GH6A 1HNZO 1X2GA 1KP3A 4ZBMA 1Y74B 2E1HA 1FAFA 4YIPA 4YIOA 2ZXWB 2ETNA 1YJ9V 1HP8A 2YXHA 5JVDA 1KU9A 1P84F 2LGQA 5FNVB 2HJDA 2XASA 4MVMA 4FLTA 2Q5HA 4P75A 2P4VA 1EIYB 2W0FC 1E79G 1AVMA 4LNSA 1GTOA 4LWSA 1L1FA 5BMVB 1BIBA 4P74C 3ZS8C 1L8DA 2PYJA 1EN5A 3BHPA 2HHHB 1R3JC 4I50A 1AP5A 3A74A 3OFNG 3M99B 5LP6C 2CJ9A 4X20A 5EK0A 4DR3B 2X6BA 4IT5A 5ITZB 2E76B 4J9ZB 1Q3EA 3EXAA 1NS1A 3RYHB 3SR2C 4JI6O 3ICAA 3ZHTA 5CBHA 3ZMUA 4YRNA 1XDCA 4B3SO 2E3CA 2VQFO 2XAJA 1PM9A 5EZYB 1HTTA 1VQMV 3W7UA 1RSOB 1Y76A 4B3MO 4JI5O 1GRJA 1F4MA 3ICXA 5TISZ 4UCRA 3CCRV 1R3LC 1G5IA 2KQXA 3CRMA 3QF7A 1IXBA 1C0AA 5LMUO 1Q81W 1IBLB 1G8MA 5DECA 3BAAA 1M93A 1FJGO 2P0LA 1N0NA 1X54A 1RIQA 4X1IA 4QNHB 1NI8A 1MNGA 2HNIA 3ASNB 4JI4O 5K1XA 3PZCA 2ADQB 1B8AA 2QTSA 1DTOA 2R9AA 1TVKA 2F1MA 2DJZA 2OCCC 3CYOA 3I55V 3H1LH 2PMEA 3OGCC 1MABG 1ADJA 1F51A 2UUAO 1H2GA 4MVRA 2DXUA 1P7BA 4BW9A 3CD6V 1LYLA 4RWUA 4QPKA 4P3PA 4LF9O 2AKWB 3BFMA 4LVIA 1RFYA 2ADPA 4FK5C 1M90W 3SYOA 3K0DA 2EIJB 1WPXA 1ASZA 4KHPB 2P5IA 2HHHO 4DRXB 4H44B 4JI0B 4Z2WA 3CRRA 2BCCH 4YRMA 1AI4A 4GKJB 4PA3A 1JJ2U 4KR3A 2X6AA 1Y4MA 3C3TA 3DGEA 2J3LA 3PCOB 1XNQB 3G6BA 2GUZA 4DR3O 4FFKA 3WB0A 5LBQA 1H38A 2NS6A 2WAMA 4DV1B 4DV4B 1VQ5V 2X6CA 3O9OA 4KXRA 3E83A 4LF8B 1AI7A 1JVMA 3H01A 1K5QA 2CH7B 4H13B 4K35A 4ZTUB 2Q7GA 1LNQA 1VARA 3G4SV 1AROP 4UCTA 3HRKA 1KP2A 5IT9N 1SERA 4JYAB 5HFLA 4IHJB 4PHCA 4NR1A 3RACA 2ZE6A 1JA8A 2IH1C 3VBBA 1EFWA 2HFEC 1IBLO 2Y69C 1XMQB 4EFBA 1FXKA 3Q4HA 4B3TO 1IXMA 2QSAA 2OTLV 5IJ9A 1OHHG 3T1YO 2F4VB 3L4GB 1K4DC 1XREA 4ZKIA 3JAKB 4LH6A 2JS5A 1KB9F 2GDSA 4YRRA 1EN4A 2P5OA 4LVKA 5H2FZ 1JJOA 3NR7A 3RT3C 1OCZC 1GGMA 2DW4A 2FTKA 2CIMA 1R6KA 3CC7V 3HRIA 4TVAB 2QHSA 3A5ZA 2B1IA 3W7SA 4UP8A 3CSXA 5IYDO 3HKEB 4JI0O 2CAZC 4YRLA 3V8LA 3ABKB 5B1BC 1CXZB 4GKJO 2OTJV 2F43G 2QJ1A 5L3DA 3LNNA 1V9PA 2LW1A 1SQQH 2V7QG 1Y6XA 3U10A 1K3EA 4O4HB 4MS2A 1SQPH 2WLHA 3KKYA 1Q82W 1XNQO 2Q5IA 1X4TA 2QA4V 4DV0B 4XU0A 2RDCA 4HZ3A 2YICA 4DV1O 4JF3A 4DV4O 3K5OA 3HKBA 5HGQA 5ELNA 1AR4A 1HNXB 4LF8O 4H2WA 3HY1A 5LL6Y 3N2KA 4ZI7B 4MW3A 4ZHQA 4O4IB 4O4JB 3FFQA 2JJ1G 4DW0A 1YVWA 3CEIA 2Q4PA 2E75B 1VQ4V 3IALA 4F4LA 4BIUA 2AGAA 2R70A 3F5TA 3AG2B 1B70B 4JYAO 3MHSC 1Y74A 5B1NA 4GX0A 3QG5A 2Q7HA 2JJ2G 4I9QA 1WLEA 3K08A 4LVJA 1XL6A 4CH6A 1M56B 1XMQO 2P90A 3ZRWB 5FNVA 4WFHA 1DLBA 4LP8A 4KQEA 3CMAV 2WLNA 4UB8Z 4J80A 4IGGA 1EIYA 4PA7A 4CH3A 5BMVA 2F4VO 5J2TB 3E8GA 4HYOA 2ARHA 2RNBA 1FD9A 1YGBA 1WP7A 3LSSA 4P2ZA 3BJUA 3UT5B 3L75H 5A9GA 3T2MA 3JAMN 2IH3C 1Y67A 2FMLA 2RN9A 2OIEA 1VQNV 1VF7A 1JQ0A 1M57C 2YS8A 4GYCB 3JCZA 5ITZA 3ZHQA 3HFZB 1S76D 1D5NA 3E86A 1NTZH 2AW9A 4QPJA 4X5OA 3RYHA 4XBFA 2DYSC 2DU7A 4MVZA 4X8AA 2NNUA 2ZE7A 3BY6A 2E5LB 4X64B 4D7SA 2Z3YA 4LF4O 4PELA 2YI8A 4MW8A 1RSOA 4JAAA 2EX3A 1Z5VA 3MHHC 2YI9A 4H02A 4HT4A 2X0LA 5LGNA 2LP7A 5E3IA 4EFEA 3ZHVA 2RMKB 3HXVA 2F66C 2RQ6A 4QE9A 1HNXO 1RPOA 1W2BU 4DW1A 4X62B 1N34B 2KKWA 4KFMA 1N0JA 5CA3A 3KCXA 2QM7A 2EAYA 1J5EO 1X56A 3CX5F 4YRIA 4FM2A 4UCOA 3RL6A 4J41A 1SZXA 1YTFD 3R65A 1NH2D 2EZOA 3B2EE 4P72C 1X55A 2ZT6A 5KX5B 1KQSU 4CS4A 1YFRA 4LR3A 2DZ9A 2AKWA 3SPJA 4NTWA 2CTPA 3SJQC 4H37A 1GO3F 2Q0AA 4JAVA 4E51A 4HAMA 1L0LH 3CCMV 4AQYB 2YDEA 4DRXA 3FYIB 1G6UA 1Y76B 3CB2A 4P73A 4UCSA 1XL4A 3EVKA 1BZKA 2IJKA 3M4QA 3JALB 4YRTA 5B1AC 3PCOA 4G85A 4GX5A 5KHIA 4JYCA 2ZM6B 5JJNB 4XDJA 2E74B 3PJSK 2E5LO 4X64O 1EBOA 2CH7A 4XEOA 1VQZA 1NQTA 4F6RB 1NT2B 3W7TA 3ZBHA 3DC6A 2PI5A 4F6EA 2A3QA 4LF5B 3ETEA 4RDXA 3OTOB 4DK1A 4LVMA 5CA1B 2YIDA 5L3GA 4U7NA 5B3SB 1ZWIC 2AZ2A 4LNUA 4IHJA 4Q20A 1SA0B 3WB2A 2Z0AA 4X62O 5JCOA 4HWPA 1N34O 2YC0A 4UFZA 3IKMB 2UXBB 1IX9A 1X2HA 3HXYA 3P30A 4CH5A 4XTYA 3L4GA 4OP0A 2L6LA 4PDRA 2CGNA 4DK0A 3ZEDA 3JAKA 5FLXN 1N4CA 3ZRXA 1ZSPA 4NKGB 2C2AA 2R72A 1GM9A 3STZC 3T4DA 5IYBO 2Y0IA 1Z7NA 1MZFA 3RUXA 4MTGA 3H1JH 3ABLC 4DO2A 1H2LA 3HXWA 4KP4A 3REXA 5EYPB 2QHTA 2ZT5A 1M9NA 4TVAA 3NEMA 1KOGA 4JPRA 5IY5C 4AQYO 2HG5C 4UCUA 5GW7A 3P8VA 1TGOA 1P4RA 3BPZA 1TUBB 5E1AC 1AR1B 3P8TA 1Q90D 2Y48A 4O4HA 12ASA 2IW5A 3QTCA 2QWQB 3OR6C 1G51A 3UFGA 2V1DA 1XEQA 3BA9A 5D5QA 4JZ2A 4GZRB 4H0LB 4TOIA 2ZM6O 1BSMA 4YRFA 4K86A 1X59A 1ZL8B 1QNMA 3OAAG 4O4IA 4O4JA 2ZE8A 1GKFA 2EL9A 1NU1H 1URFA 2VRZA 1IURA 4TV9B 3W7XA 4IYIA 4LF5O 3ASOB 4ASUG 4NXMB 4J9YB 1B70A 3OTOO 1VQPV 1QE0A 2YSUB 4OPHA 3BFRA 3RYFB 4YREA 1RM1C 2AHZA 3RYIB 1QQCA 4DYLA 4I4TB 3GVMA 3NENA 4MTOA 1VF6A 1I0HA 4H2YA 4HBNA 1VQLV 1YF2A 1K92A 2P4KA 2UXBO 1PP9H 2XT9A 4JTCB 1FPOA 5J2TA 4UV9A 3C3SA 3G6EV 1V54B 3UT5A 3K06A 4LFBB 3TJTA 3ETDA 4EKWA 1YITV 2EINC 3MAQA 4YRPA 5EC2C 1BQ0A 4PJ0Z 1IDSA 4R6ZA 2IY5B 4KUMA 1H4VB
chains in the Genus database with same CATH topology
4UV8A 1M90W 3SYOA 3K0DA 2EIJB 1HWYA 4PA6A 1WPXA 3VOUA 3HFZA 3RF1A 4YRKA 3IKLA 1ASZA 1FFTB 2P5IA 2WLJA 4KQEA 2XGTA 2ZDIA 3NXSA 3AG2C 1K97A 4YRMA 1PYSB 3HXXA 1AI4A 1L0WA 1PNMA 4PA3A 3V7CA 3TETA 2E41A 2KB1A 1JJ2U 4KR3A 1K4CC 2X6AA 2DEQA 1Y4MA 3DGEA 2K1EA 1X01A 1CP9A 2J3LA 3PCOB 1S0VA 4RQEA 2QTOA 1VQ7V 2DXTA 4XDLA 3OW2U 5LBQA 1H38A 1B7YA 2NS6A 4H2UA 2WAMA 5CMUA 3WFVA 3CXCU 4U7OA 1NKDA 1M56C 1JJCA 4JGSA 3KFUA 3LNMB 1VQ5V 2GSMB 3SPIA 3OUSA 2X6CA 3E83A 4RUFA 1AI7A 1JVMA 3H01A 1K5QA 2JDIG 1OZ0A 4ZTUB 3ABLB 1NR1A 2Q7GA 1BHAA 1LNQA 2ZXFA 2H8PC 2WLIB 3F5WC 3G4SV 1N8RW 2ZTGA 2P67A 1OCOB 1AROP 4X88A 1J5WA 4MTXA 2ZCEA 4WFAV 3HRKA 3FB5C 3HB3B 4P71A 1QVFU 1KP2A 3JD1A 3I7FA 2Q68A 3JD4A 3QNEA 4GX1A 5IY5B 2PI4A 5LGUA 1B6QA 1SERA 2OT5A 5HFLA 3JD0A 4GCZA 2QM8A 1JOYA 2I4NA 3EFFK 4JASA 1GM8A 3WG7C 4UXNA 3BEHA 4PHCA 3EFSA 3RACA 2IJHA 2M7WA 2IH1C 2P7TC 3VBBA 1EFWA 2HFEC 1FS0G 2HLDG 1NYQA 1DF4A 3OUFA 4LC1A 1BIAA 4OLFA 2Y69C 2C7IA 1FXKA 1OCRC 2ZDIC 2AHYA 2ZT7A 1IXMA 1E1RG 4L87A 3F7YC 2OTLV 4H33A 1NJ1A 4XU1A 2RHSA 1E24A 1OHHG 1K8AW 2HVKC 5EBWC 1JX9A 3L4GB 1K4DC 3AG3C 1NVPB 2WLKA 4ZKIA 1USYA 3P8YA 3SPCA 4TVWA 4YRRA 5IYCO 1K33A 4HA8A 4K88A 1NVPD 4GX2A 3RBZA 3MQZA 5C53B 4BWAA 3AEIA 1COWG 3UM7A 4J15A 3HPLC 4FMTA 3NETA 2XAQA 4LVKA 2R9RB 1EFRG 4JTAB 3ZMVA 2DWEC 4UVCA 3ERRA 3HXZA 4XTVA 1OCZC 1GGMA 1RM1B 1MG1A 3OMNB 4WFFA 2AMCA 2DW4A 2FTKA 2E5AA 2CIMA 1R6KA 1V55C 3K9AA 5DM6V 3CC7V 2EJFA 3HRIA 2QHSA 3JD3A 5L3EA 3A5ZA 4TQDA 4P71C 4TVAB 2B1IA 2EILC 1AJQA 2DYRC 3W7SA 2ARSA 2RHQB 4UP8A 1H4SA 2LFSA 5IYDO 3FB7C 2QKSA 1UJWB 2ALYB 3SYQA 4H2XB 4YRLA 3V8LA 3ABKB 5B1BC 1BBWA 3T1CA 4TQFA 2OTJV 4WF9V 2F43G 5L3DA 1DF5A 3ZMTA 1NJ8A 3VQVA 1YHQV 2OCCB 3IGAC 2V7QG 4BW9A 1WPYA 2FYKA 1K3EA 4LBEC 1NNHA 2BOCC 4MS2A 2WLHA 3K79A 1Q82W 5BZBA 2CGHA 1FXKC 1KD1W 1NR7A 2Q5IA 2QA4V 1NBMG 4RMFA 3A5YA 2WLLB 4XU0A 3IC7A 4PA9A 2IJIA 2DQ0A 4HZ3A 11ASA 2Z5UA 5FL7G 1WU7A 4JF3A 1KMNA 3AG4C 2QHUA 3RKWA 2HR3A 2EINB 4I9WA 5HGQA 3AG1B 5ELNA 2ITCC 3HXUA 1FXHA 2ZQMA 4X89A 5KA5A 4QE7A 3STLC 1WQWA 4H2WA 3UGQA 3V7RA 2ZZGA 3HY1A 1H4TA 3CCLV 4MW3A 1F23A 3E9IA 1KECA 1PYSA 1S77D 1ADYA 2D3OW 2JEXA 1USYC 2DDZA 2JJ1G 1E1TA 1THZA 4CZZA 2ZT8A 1BL8A 3OM3B 4YROA 1MSWD 3RIRA 3V8JA 5H6RA 3TEHA 1VQ4V 3ZCCA 2IU3A 4P30A 4F4LA 3IALA 4BIUA 4K87A 5H6QA 1H4QA 1RPRA 1ATIA 2UXNA 3AG2B 2W6IG 2WSSG 2DVEA 2EBOA 3FKSG 2EIMC 1E22A 2WLMA 4YXWG 3FYEB 5LHIA 3CCVV 1B70B 3A7AA 1K9MW 3MHSC 1KC8W 3M4PA 4FIPC 4XU3A 5B1NA 4DPGA 3JYCA 2Q67A 4GX0A 4N21A 1Q86W 1BHBA 4JAUA 1ENVA 2Q7HA 2JJ2G 3DTUB 4H2SA 4UP9A 3A7UA 4MVUA 3IFXA 1WLEA 3K08A 4MT8A 4LVJA 1XL6A 4CH6A 2CJBA 2BOBC 1M56B 2P90A 4DXWA 3R07A 3ZRWB 3E8FA 1YJNV 5L3CA 4WFHA 1DLBA 1R6NA 4LP8A 4P9OA 4UVBA 1VQ8V 3CMAV 2WLNA 5KA6A 3A7RA 3G71V 2IJJA 1EIYA 1QCEA 4PA7A 3F7VC 1QR8A 4CH3A 1QLEC 3E8HA 3G1ZA 3X2QC 5J9PC 2ZNIA 2J3MA 3E8GA 4HYOA 3ABMC 3QO7A 1PL0A 3T4ZA 3CMEV 3LSSA 4P2ZA 4FJCC 1FYFA 3CCUV 2DWDC 3QO5A 3A31A 3BJUA 4JYBA 4MVSA 3UH0A 4YRGA 4NCXA 2EJGA 3TEHB 1EQRA 4R50A 3T2MA 3GWOA 2EIKC 2IH3C 1R3KC 1HC7A 1EZJA 2E64A 3CC2V 5KUKA 3E2EA 4RAIA 5CN0A 5B3SC 1VQNV 1JQ0A 5C93A 3E35A 3WG7B 1M57C 3SYAA 2A0LA 4TSFG 4XTZA 2NLJC 1Q7YW 2Q7EA 3JCZA 1WNLA 5LGTA 4TWAA 1HXDA 1S76D 3HFZB 3CCJV 4I5SA 2Y69B 4E2LA 3E86A 4WI1A 4XU2A 2XAFA 1OCRB 1PNLA 4P72A 4QPJA 4X5OA 4XBFA 4KR2A 5B1OA 4HWTA 1AJPA 2DYSC 3SPGA 4MVZA 2DU7A 4X8AA 2NNUA 3BY6A 4UUJC 4WFGA 1S5HC 1K34A 2Z3YA 2DKGA 1EOVA 3LDDA 4JTDB 3B8MA 2JIZG 4P9PA 2XAGA 2ZXWC 3AG3B 4PELA 2DZCA 4HWSA 4MW8A 1SRYA 1MOFA 1JJCB 3K3WA 1EVKA 4PG3A 3MHHC 4DQ2A 2B5UA 4XEMA 1Z7MA 3OMAB 4FPPA 2I4MA 1W0KG 4H02A 4YRSA 4HT4A 2DTOA 1E1QG 2X0LA 5IDJA 5LGNA 2LP7A 4YDQA 1ORQC 2A79B 5E3IA 1YSCA 3HXVA 3LUTB 3VQXA 1G4YB 1H4VB 5EBLC 3K03A 4QE9A 2ALYA 1RPOA 3ZN1A 1OCZB 3MF2A 3UKMA 3ML0A 1W2BU 1R73A 1V55B 3L2ZA 1PKXA 4YP0A 4KFMA 4LCUC 2EILB 5CA3A 2DYRB 1SESA 1YB3A 2QM7A 2EAYA 3RVZA 4G27B 5B1BB 3W7WA 3HTZA 2ARTA 4UPAA 1X56A 2GHYA 3CCEV 4YRIA 5C51B 5ELOA 3CP1A 3RL6A 4Q15A 5C52B 4XTWA 3QO8A 4TTVA 1G5HA 3CMQA 4YPFA 1YTFD 4CH4A 3FB6C 3MF1A 4CS2A 1FXKB 3R65A 1GM7A 3CPWU 2EZOA 1NH2D 4P72C 1X55A 1YI2V 2ZT6A 3EHBB 3EFRA 4YCUA 4AH6A 1KQSU 2ZNJA 1AI5A 1CEZA 2RHSB 2I4OA 4CS4A 3AG4B 1YFRA 1NJ5A 1SETA 2W6JG 2A8EA 4UP7A 2DZ9A 5EC1C 3JD2A 1F4NA 5EBMC 2AKWA 3SYPA 5K1PA 2YEVA 3SPJA 1YIJV 3P32A 2IY5A 3SJQC 4H37A 3TUPA 1JPXA 4O2DA 1NJIW 2DU5A 1GO3F 2ODRD 3HY0A 2E10A 1QF6A 4RO2A 1H8HG 4JAVA 2ODRC 4CS3A 4E51A 1J95A 4HAMA 3ZRSA 3CCMV 2Q6AA 1NJ6A 4MVOA 5L3BA 3FYIB 4WCEV 3ASOC 4TT3G 2EIMB 1PNKA 3OEEG 4RQFA 4P73A 3TEGA 1XL4A 3UGTA 1OCCC 1W0JG 3ABUA 2DQ3A 3RGLA 2IJKA 3M4QA 3RKYA 1I5YA 3VQWA 2XOKG 4YRTA 3ZRWA 3REUA 2AMCB 5B1AC 1YGBA 3PCOA 1SZTA 2ATKC 2ZR3A 4YRCA 4G85A 4GX5A 2ZR2A 2B1GA 3GB7C 3ASNC 1VQ6V 2ARUA 2ZZEA 4JYCA 4ZTZB 4XDJA 1QR9A 3D3IA 3FB8C 3PJSK 3ZRVA 2C8MA 3CCQV 5F5WA 1EBOA 4XEOA 1VQZA 1NQTA 4OXSA 4YCVA 2XAHA 4LVLA 3WQZA 4P74A 3W7TA 1QLEB 2Q69A 1KMMA 3X2QB 2WLIA 3ABMB 3K0GA 1QBZA 1V54C 4BW5A 2HKOA 2PI5A 2LFRA 5L3FA 4MSWC 3OEHG 2CK3G 1GMGA 4YYEA 3CCSV 3TK1A 3ETEA 4P3NA 1IL2A 2QEXV 4RDXA 3VQYA 3B77A 4N23A 2EIKB 4LVMA 3ZJZA 5L3GA 4U7NA 1GK9A 4GT1A 5B3SB 1QVGU 2E65A 1ZWIC 2ZIOA 2I4LA 5KNNA 1PD3A 1TUEB 3RVYA 3E8BA 2ZIMA 1K7DA 1M57B 3OE7G 4Q20A 1NYRA 4TWKA 1E1OA 2EIJC 1N9WA 4RUEA 4QJFB 1VQKV 1B76A 4Q6GA 1KKDA 4HWPA 1S72V 1X2GA 2DTHA 2DYSB 3TCUA 3ZMSA 1KP3A 1I5XA 2ZGWA 4ZBMA 4P73C 4XTXA 3IKMB 2EJ9A 3V8KA 1CPYA 1X2HA 3HXYA 4MVQA 3P30A 4CH5A 4XTYA 2E1HA 3L4GA 4OP0A 2JK5C 2ZXWB 3ZMZA 4PDRA 3I56V 2JEUA 1YJ9V 1BBUA 3NELA 1NJ2A 3W3SA 5CBFA 3ZRXA 5DN6G 2HVJC 1M1KW 2C2AA 4XDKA 1GM9A 3STZC 2ITDC 4R7CA 2XASA 4MVMA 3T4DA 5H9CA 5IYBO 2Q5HA 4P75A 4EO4A 1B7YB 1Z7NA 3V7SA 2W0FC 3RUXA 1EIYB 4MTGA 1E79G 4HWRA 4PA4A 3ABLC 4TVYA 4DO2A 4UVAA 4LNSA 4YCWA 1GTOA 1BIBA 1L1FA 4P74C 1ASYA 3HXWA 4KP4A 5CBGA 3A32A 3REXA 1OCOC 5LHGA 2QHTA 4WJ3M 2ZT5A 1R3JC 2XTIA 4EX5A 1R3IC 2EJRA 1M9NA 1WQ7A 1BMFG 4Z1MG 1FXVA 3E9HA 4TVAA 3NEMA 1KOGA 4JPRA 2MK3A 2RHQA 3A74A 5IY5C 2HG5C 3E89A 2DTIA 3OFNG 3ETGA 1EVLA 3M99B 4H2XA 2X7RB 5GW7A 3LDCA 3SYCA 1K5SA 3P8VA 3MEYA 2CJ9A 1YFSA 5EK0A 1P4RA 4XTUA 2X6BA 2P6JA 5E1AC 4G84A 1AR1B 4HWOA 3P8TA 2Y48A 4J9ZB 12ASA 1QLNA 1JCHA 2IW5A 3ZN0A 1YTFB 1W66A 3OR6C 3FJPA 3QTCA 1VQ9V 4CBCA 2WLLA 1NH2B 1G51A 3HFVA 3ICAA 3UFGA 5LHHA 2V1DA 3MD0A 5HFMA 5CBHA 3IG2A 3ZMUA 4YRNA 2R9IA 1YJWV 2EWNA 2E3CA 2WPDG 4YRFA 3OR7C 4PDLA 1Y66A 2XAJA 4K86A 4QIWF 1HTTA 1VQMV 4WFBV 3KG2A 3LSQA 3W7UA 4WFEA 2XNDG 3L1AA 4BAYA 3OAAG 4BIZA 3CC4V 4P3OA 4MTFA 1AI6A 3OD1A 1GKFA 2EL9A 1F4MA 2UXXA 4WF2A 3K04A 4P75C 4YRQA 1YFTA 3W7XA 3CCRV 2G4CA 1R3LC 1G5IA 3ASOB 4ASUG 3RKXA 4J9YB 5KUMA 3SPHA 4H2TA 1OCCB 4R8CA 1B70A 4G28B 3LDEA 1VQPV 1C0AA 1QE0A 1H8EG 2YSUB 1Q81W 1G8MA 4YREA 1RM1C 2QE7G 5B1AB 2AHZA 2P0LA 1S3JA 1X54A 1RIQA 4QNHB 4YRJA 3NENA 4MTOA 4G2KA 2HNIA 4H2VA 3ASNB 3D36A 2ZINA 2IU0A 5K1XA 3PZCA 4H2YA 4PDVA 2PMFA 1B8AA 3RW0A 3ABTA 3OMIB 1VQLV 2HJFC 1WYDA 2CJAA 4HVCA 3ZIAG 3ABKC 3DSQA 1K73W 1DTOA 1K92A 2DJZA 2OCCC 3CYOA 3I55V 3A0RA 3B8NA 2EZPA 2PMEA 3OGCC 1MABG 4JTCB 1ADJA 4UV9A 1F51A 3G6EV 1V54B 4PDMA 1H2GA 4MVRA 3K06A 2A9HA 3ETDA 1P7BA 4EKWA 2ZD9A 1YITV 2DXUA 2EINC 3CD6V 1LYLA 3AG1C 2QHVA 4QPKA 5EC2C 1ROPA 4YRPA 4P3PA 2H94A 4R6ZA 1VQOV 2AKWB 3BFMA 4ZIBA 4LVIA 4WJ4A 2YEVB 2IY5B 4KUMA 1AJNA 2WWWA 2ZZFA 3LC0A 4FK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRK A;  3RF1 A;  3HFZ A;  1ASZ A;  3IKL A;  2P5I A;  2XGT A;  4YRM A;  1PYS B;  3HXX A;  1L0W A;  3V7C A;  2E41 A;  4KR3 A;  2DEQ A;  1X01 A;  2J3L A;  3PCO B;  4RQE A;  2DXT A;  1B7Y A;  4H2U A;  1JJC A;  3KFU A;  4ZTU B;  2Q7G A;  2ZXF A;  2ZTG A;  1J5W A;  2ZCE A;  3HRK A;  4P71 A;  3I7F A;  1SER A;  3QNE A;  2I4N A;  4PHC A;  3EFS A;  3RAC A;  3VBB A;  1EFW A;  1NYQ A;  1BIA A;  4OLF A;  2C7I A;  2ZT7 A;  4L87 A;  1NJ1 A;  4XU1 A;  2RHS A;  1E24 A;  3L4G B;  1USY A;  3P8Y A;  4TVW A;  4YRR A;  4K88 A;  5C53 B;  4BWA A;  4J15 A;  3NET A;  3HXZ A;  4XTV A;  3ERR A;  1GGM A;  2AMC A;  3VQX A;  2E5A A;  3A7A A;  4YP0 A;  3MEY A;  2CIM A;  3HRI A;  2EJF A;  4TVA B;  2QHS A;  3A5Z A;  4TQD A;  4XTZ A;  4P71 C;  4UP8 A;  1H4S A;  2ARS A;  2RHQ B;  2ALY B;  4H2X B;  4YRL A;  3V8L A;  4TQF A;  1BBW A;  1NJ8 A;  3VQV A;  1WPY A;  2FYK A;  1NNH A;  2CGH A;  2Q5I A;  4RMF A;  3A5Y A;  4XU0 A;  2DQ0 A;  11AS A;  1WU7 A;  1KMN A;  2QHU A;  3RKW A;  5HGQ A;  5ELN A;  3HXU A;  1WQW A;  3UGQ A;  4H2W A;  3V7R A;  2ZZG A;  3HY1 A;  1H4T A;  3E9I A;  1PYS A;  1ADY A;  1USY C;  2DDZ A;  1E1T A;  4YRO A;  2ZT8 A;  3RIR A;  3V8J A;  3IAL A;  1H4Q A;  4K87 A;  1ATI A;  2DVE A;  1E22 A;  3M4P A;  1B70 B;  4XU3 A;  4DPG A;  2Q7H A;  4H2S A;  4UP9 A;  3A7U A;  1WLE A;  4CH6 A;  2CJB A;  3R07 A;  4KQE A;  3A7R A;  1EIY A;  4CH3 A;  3G1Z A;  2ZNI A;  3TUP A;  2J3M A;  1YGB A;  4P3N A;  3QO7 A;  4UP7 A;  3LSS A;  1FYF A;  3A31 A;  3BJU A;  3QO5 A;  3UH0 A;  4YRG A;  4NCX A;  3TEH B;  1EQR A;  1HC7 A;  2E64 A;  2Q7E A;  1WNL A;  4TWA A;  1HXD A;  3HFZ B;  4WI1 A;  4XU2 A;  4KR2 A;  4P72 A;  4X5O A;  4HWT A;  2DU7 A;  2DKG A;  1EOV A;  2DZC A;  4HWS A;  1SRY A;  1JJC B;  1EVK A;  4PG3 A;  4DQ2 A;  4XEM A;  1Z7M A;  2I4M A;  4YRS A;  4H02 A;  2DTO A;  4YDQ A;  5E3I A;  3HXV A;  2ALY A;  3MF2 A;  3L2Z A;  1SES A;  1YB3 A;  2EAY A;  3HTZ A;  4UPA A;  2ART A;  1X56 A;  4YRI A;  5C51 B;  5ELO A;  3RL6 A;  4Q15 A;  5C52 B;  4XTW A;  3QO8 A;  4TTV A;  1G5H A;  3CMQ A;  4YPF A;  4CH4 A;  3MF1 A;  4CS2 A;  4P72 C;  1X55 A;  2ZT6 A;  4AH6 A;  3EFR A;  4YCU A;  2ZNJ A;  2RHS B;  2I4O A;  4CS4 A;  1YFR A;  1NJ5 A;  1SET A;  2DZ9 A;  2AKW A;  5K1P A;  2IY5 A;  4O2D A;  2DU5 A;  2ODR D;  3HY0 A;  2E10 A;  1QF6 A;  2ODR C;  4CS3 A;  4E51 A;  1NJ6 A;  4RQF A;  4P73 A;  3TEG A;  3UGT A;  3RGL A;  2DQ3 A;  3M4Q A;  3VQW A;  4YRT A;  3REU A;  2AMC B;  3PCO A;  2ZR3 A;  4YRC A;  4G85 A;  2ZR2 A;  2ARU A;  2ZZE A;  4ZTZ B;  2C8M A;  5F5W A;  4XEO A;  1VQZ A;  4YCV A;  3WQZ A;  4P74 A;  1KMM A;  4YYE A;  1IL2 A;  4RDX A;  3VQY A;  2ZIO A;  2E65 A;  2I4L A;  5KNN A;  2ZIM A;  1NYR A;  1E1O A;  1N9W A;  1B76 A;  4Q6G A;  4HWP A;  1X2G A;  2DTH A;  4P73 C;  2ZGW A;  4XTX A;  3IKM B;  2EJ9 A;  3V8K A;  1X2H A;  3HXY A;  4CH5 A;  4XTY A;  2E1H A;  3L4G A;  4OP0 A;  1BBU A;  3NEL A;  1NJ2 A;  3W3S A;  2EJG A;  3RKY A;  4P75 A;  2Q5H A;  4EO4 A;  1B7Y B;  1Z7N A;  3V7S A;  3RUX A;  1EIY B;  4TVY A;  4HWR A;  4LNS A;  4YCW A;  1BIB A;  4P74 C;  1ASY A;  3HXW A;  3REX A;  3A32 A;  2QHT A;  4WJ3 M;  2ZT5 A;  2XTI A;  4EX5 A;  4TVA A;  1WQ7 A;  3E9H A;  3NEM A;  1KOG A;  2RHQ A;  3A74 A;  2DTI A;  1EVL A;  4H2X A;  3P8V A;  2CJ9 A;  1YFS A;  4XTU A;  4G84 A;  4HWO A;  3P8T A;  12AS A;  1W66 A;  3FJP A;  3QTC A;  1G51 A;  3HFV A;  3ICA A;  3UFG A;  3IG2 A;  4YRN A;  2EWN A;  2E3C A;  4YRF A;  4K86 A;  1HTT A;  3LSQ A;  3L1A A;  4P3O A;  3OD1 A;  2EL9 A;  4WF2 A;  4P75 C;  4YRQ A;  1YFT A;  2G4C A;  1G5I A;  3RKX A;  4H2T A;  1B70 A;  1C0A A;  1QE0 A;  4YRE A;  2P0L A;  1X54 A;  1RIQ A;  4YRJ A;  3NEN A;  2HNI A;  4H2V A;  2ZIN A;  5K1X A;  3PZC A;  4H2Y A;  2PMF A;  1B8A A;  1WYD A;  2CJA A;  4HVC A;  3DSQ A;  2DJZ A;  2PME A;  1ADJ A;  2DXU A;  4HA8 A;  3TEH A;  4BW9 A;  2QHV A;  1LYL A;  4YRP A;  4P3P A;  4ZIB A;  4WJ4 A;  2AKW B;  3BFM A;  2IY5 B;  2ZZF A;  3LC0 A;  1H4V B; 
#chains in the Genus database with same CATH topology
 1HWY A;  4YRK A;  3HFZ A;  3IKL A;  5KHJ A;  3NXS A;  4PV1 B;  1YXB A;  1PNM A;  2KB1 A;  2DEQ A;  1JFF B;  2K1E A;  1S0V A;  2OYQ A;  4RQE A;  2QTO A;  1WP8 A;  1VQ7 V;  4O2A B;  3D36 C;  2W0X A;  3KFU A;  3OUS A;  3IJ4 A;  5J2U B;  1M4U A;  2JDI G;  1OZ0 A;  1NR1 A;  1SQB H;  2CGO A;  2H8P C;  3F5W C;  1ZLZ A;  2P67 A;  2ZCE A;  1J5W A;  4WFA V;  4FLX A;  3FB5 C;  3HB3 B;  4P71 A;  3I7F A;  2Q68 A;  3JD4 A;  3QNE A;  2PI4 A;  2YXY A;  3J80 N;  5LP6 B;  4GCZ A;  2QM8 A;  3EFF K;  3CHX A;  2P7T C;  4DUY B;  1NYQ A;  1DF4 A;  3APO A;  3CXH F;  3OUF A;  4EEQ A;  1XNR O;  4OLF A;  4PHZ A;  1OCR C;  2ZDI C;  4NVP A;  5KX5 A;  5JQG B;  1NJ1 A;  1G1X B;  1E24 A;  1HNW B;  1AIL A;  5EBW C;  3PN1 A;  1LUV A;  1P7G A;  2RJZ A;  3RYC A;  5JH7 B;  4GX2 A;  5C53 B;  3OT7 A;  4LFB O;  1LUW A;  4J15 A;  3NET A;  3HXZ A;  3ZMV A;  4XTV A;  2DWE C;  3JAL A;  1MG1 A;  3OMN B;  2E5A A;  3A7A A;  2DOS A;  3MEY A;  2EJF A;  2QDO A;  2EIL C;  1AJQ A;  2DYR C;  2ARS A;  2RHQ B;  4H2X B;  4TQF A;  1OJH A;  4U3J B;  1BBW A;  1DF5 A;  3JSL A;  2OCC B;  4DR5 B;  1YHQ V;  1SQX H;  5EIB D;  2JS3 A;  3RWR D;  4F6R A;  5EIB C;  3P3N A;  2CGH A;  5BZB A;  3AK2 A;  4O4L B;  3A5Y A;  2WLL B;  3IC7 A;  4Z1V A;  2CTQ A;  2DQ0 A;  11AS A;  5FL7 G;  1WU7 A;  2LO1 A;  3AG4 C;  4DR2 B;  5CA1 A;  4QE7 A;  3STL C;  3UGQ A;  1EZV H;  2ZZG A;  2LW7 A;  1PYS A;  1VIB A;  1ADY A;  1USY C;  1SA0 A;  1E1T A;  4YRO A;  2PY5 A;  2JRI A;  5H6R A;  2IU3 A;  1SKV A;  1RPR A;  1WAZ A;  3HKC B;  5LA6 B;  2WSS G;  3QVN A;  2EBO A;  2EIM C;  5LHI A;  4FIP C;  1Q6I A;  4DPG A;  2Q67 A;  1BHB A;  4K8X A;  4JAU A;  3DTU B;  4UP9 A;  1UPG A;  3IFX A;  1NTM H;  4DUY O;  2BOB C;  2AXT Z;  4DXW A;  3R07 A;  3ZHU A;  1ZX3 A;  4UVB A;  1VMG A;  3A7R A;  2IJJ A;  3L71 H;  1BE3 H;  5C8Y B;  3F7V C;  1HNW O;  3L9D A;  1QLE C;  3G1Z A;  2ZNI A;  3QO7 A;  5EYP A;  1PL0 A;  1FYF A;  3CCU V;  1WN7 A;  3QO5 A;  4AIL C;  4MVS A;  3UH0 A;  3TEH B;  3GWO A;  4NTX A;  1VEW A;  3RGB A;  2ODM A;  1HR0 B;  5KUK A;  2YUA A;  4RAI A;  5CN0 A;  3OGI B;  3H9V A;  1VF5 B;  4TSF G;  1TUB A;  2Q7E A;  1XBL A;  4WI1 A;  2Y69 B;  4XU2 A;  3K57 A;  3RN4 A;  4LNU B;  5B1O A;  2P22 C;  2F93 B;  3GWK C;  3JAS A;  1K34 A;  2HP8 A;  4OX9 B;  3LDD A;  4JTD B;  2XAG A;  1ZL8 A;  1YZB A;  4O2B B;  4JI3 B;  5LYJ B;  1MZE A;  4DR5 O;  4DV2 B;  4I55 B;  1SRY A;  4FZ1 A;  3N27 A;  4D7T A;  4XEM A;  2I4M A;  4YRS A;  1W0K G;  1U96 A;  2DTO A;  1E1Q G;  4TV9 A;  4YDQ A;  2A79 B;  1YSC A;  4IYH A;  3LUT B;  1G4Y B;  2DJV A;  2WA3 A;  2ALY A;  2O57 A;  1OCZ B;  3UKM A;  3RYF A;  3ML0 A;  1R73 A;  4WBN B;  3RYI A;  5KAF Z;  1EM1 A;  4I4T A;  3L2Z A;  5FPR A;  1KUQ A;  1EN6 A;  1SES A;  1SS3 A;  3RVZ A;  3L72 H;  5B1B B;  3W7W A;  3CCE V;  5C51 B;  4KHP O;  5C52 B;  4YJ2 B;  3CMQ A;  4YPF A;  2A06 H;  4X1K B;  4AH6 A;  3BVO A;  2ZNJ A;  1AI5 A;  3U0Z A;  1CEZ A;  2LJ2 A;  3A0B Z;  4U3F H;  4NB5 A;  4PD4 F;  2EUL A;  5EBM C;  5KMG B;  3SYP A;  5K1P A;  2IY5 A;  1YIJ V;  3P32 A;  1JPX A;  2BSK B;  1N33 B;  2ODR D;  4CC6 A;  1QF6 A;  4RO2 A;  1H8H G;  2ODR C;  3ZRS A;  2Q6A A;  1NJ6 A;  4MVO A;  1PNK A;  3OEE G;  3RFR A;  4RQF A;  3TXS A;  1OCC C;  1HR0 O;  3ABU A;  3TXQ A;  3VQW A;  2UU9 B;  1JFF A;  5DED A;  1SZT A;  2ZR3 A;  4J11 A;  2ZR2 A;  4O2A A;  1VQ6 V;  2QWO B;  1BGY H;  4K0K B;  1YDX A;  3FB8 C;  5J2U A;  5IWA B;  1U97 A;  4DR4 B;  4P74 A;  1KMM A;  4GUN A;  1QBZ A;  4BW5 A;  5LMN B;  4DV2 O;  1Q8I A;  2CK3 G;  2N05 A;  1KKC A;  4UCV A;  2ZIO A;  1GK9 A;  2E65 A;  5LP6 A;  2I4L A;  5KNN A;  1PD3 A;  1TUE B;  2ZIM A;  3E8B A;  1K7D A;  1M57 B;  3OE7 G;  3CE2 A;  2V4D A;  1N9W A;  4RUE A;  4QJF B;  1VQK V;  4Q6G A;  1A32 A;  2LGW A;  5AG2 A;  3L74 H;  2DYS B;  3TCU A;  4L8J A;  1XI1 A;  3ZMS A;  1I5X A;  5JQG A;  2ZGW A;  1S5L Z;  3V8K A;  4MVQ A;  4HNA B;  2JEU A;  1BBU A;  2BTQ B;  3NEL A;  2QWN B;  5JH7 A;  3B40 A;  5DN6 G;  1M1K W;  3RKY A;  4XDK A;  2P06 A;  5H9C A;  5B66 Z;  4TUY B;  4DV7 B;  2Q5Z A;  4PA4 A;  4FLY A;  4YCW A;  4LFC B;  2NN4 A;  2NR5 A;  5CBG A;  4DV0 O;  3A32 A;  1OCO C;  5LHG A;  1N33 O;  4WJ3 M;  1WQ7 A;  1BMF G;  4Z1M G;  3E9H A;  3UCS C;  2MK3 A;  2RHQ A;  3K5L A;  2N74 A;  3E89 A;  2DTI A;  2WA4 A;  5IYZ B;  3ETG A;  1EVL A;  4H2X A;  2X7R B;  4U3J A;  3ZHR A;  3THO A;  4XTU A;  2P6J A;  3UO3 A;  4G84 A;  2VS0 A;  2UU9 O;  4HWO A;  1Q6H A;  3TGU H;  1QLN A;  1JCH A;  3ZN0 A;  1YTF B;  3FJP A;  4O4L A;  4X9Q A;  1VQ9 V;  4CBC A;  4JZG A;  2WLL A;  1NH2 B;  3HFV A;  5LHH A;  3MD0 A;  2EWN A;  4K0K O;  3FAV A;  4PDL A;  1Y66 A;  4WFB V;  3LSQ A;  2EJ7 A;  5IWA O;  4LFA B;  1N32 B;  2UXD B;  4DR4 O;  3L1A A;  4BAY A;  4BIZ A;  4P3O A;  1AI6 A;  3OD1 A;  1FYJ A;  2UXX A;  2UUC B;  3K04 A;  5LMN O;  4P75 C;  3HKC A;  5LA6 A;  1BQZ A;  2G4C A;  3RYC B;  5KUM A;  4R8C A;  3LDE A;  5JWP A;  5B1A B;  2QE7 G;  5KHH A;  1HW7 A;  1S3J A;  3B09 A;  4G2K A;  2ZIN A;  4UB6 Z;  4PDV A;  2PMF A;  3RW0 A;  3ABT A;  2CJA A;  4HVC A;  4JI8 B;  2PF4 E;  1XOU A;  5C8Y A;  3OTF A;  2EZP A;  4GKK B;  4PDM A;  5FPO A;  4HA8 A;  3TEH A;  2N04 A;  3AG1 C;  1ROP A;  3AK1 A;  4I7Z B;  4ZIB A;  4WJ4 A;  3D3Q A;  2YEV B;  2BE3 A;  2WWW A;  5LOV A;  4DV7 O;  2ZZF A;  2QGN A;  3LC0 A;  3HKD B;  1LR1 A;  4DR6 B;  4LFC O;  4KL1 A;  3RF1 A;  1FFT B;  1PYS B;  3HXX A;  3TET A;  1WNS A;  1H2M A;  4FLU A;  1K4C C;  1X01 A;  2MW2 B;  4O2B A;  5LYJ A;  3JAR B;  2DXT A;  1PL4 A;  2Y4T A;  3OW2 U;  1B7Y A;  4I55 A;  4H2U A;  4U7O A;  4NTY A;  1B3Q A;  3SPI A;  2YIB D;  4RUF A;  1KMI Z;  2QKC A;  3ABL B;  3O65 A;  1ZTE A;  2CDY A;  2ZXF A;  2WLI B;  2ZTG A;  2ZKO A;  4LFA O;  1N32 O;  2UXD O;  4WBN A;  4FLW A;  1QVF U;  3JD1 A;  4FM0 A;  5IY5 B;  2UUC O;  1OV9 A;  5LXT B;  5IJ0 B;  2OT5 A;  1H2N A;  3JD0 A;  1JOY A;  2GTS A;  1O9G A;  3WG7 C;  4UXN A;  3BEH A;  2IJH A;  4C7U A;  1FS0 G;  4YJ2 A;  2C7I A;  1H2K A;  3G67 A;  2AHY A;  4X1K A;  2ZT7 A;  4H33 A;  4XU1 A;  1GN6 A;  4JI8 O;  1JX9 A;  5KMG A;  3AG3 C;  3SJA C;  1W59 A;  2Q0O C;  2WLK A;  3JAS B;  2BSK A;  3B4S A;  4PI2 A;  2F23 A;  3P8Y A;  3BCC H;  4K88 A;  4GKK O;  4LF6 B;  3KCY A;  1COW G;  4FMT A;  2R9R B;  2B9Z A;  3ZX6 A;  2VWK A;  5CB4 B;  1RM1 B;  4WFF A;  3K9A A;  1V55 C;  5DM6 V;  1DGS A;  4DR6 O;  4LF7 B;  1H4S A;  2LFS A;  2QM4 A;  1UJW B;  2ALY B;  2CTR A;  3T1C A;  1IZ3 A;  4WF9 V;  3ZMT A;  3VQV A;  1NJ8 A;  3A8T A;  3IGA C;  1Q43 A;  2GTA A;  1WPY A;  1ZUQ A;  4LBE C;  1NNH A;  1FXK C;  4IL6 Z;  1NR7 A;  1NBM G;  3K5M A;  1N36 B;  3JCU Z;  2Z5U A;  3T1H B;  1QU7 A;  2HR3 A;  2EIN B;  2JGU A;  2ITC C;  1FXH A;  5H5N A;  3V7R A;  5B5E Z;  1FKA O;  5BR8 B;  3E9I A;  1KEC A;  1S77 D;  2D3O W;  2JEX A;  4CZZ A;  1BL8 A;  3RIR A;  3V8J A;  3DXR B;  5H6Q A;  4K87 A;  1F7Y A;  2UXN A;  2W6I G;  2DVE A;  1E22 A;  2WLM A;  3CCV V;  1K9M W;  1KC8 W;  4B3R B;  3JYC A;  4N21 A;  1Q86 W;  1ENV A;  3R66 A;  4HNA A;  1I08 A;  4H2S A;  3M7M X;  3A7U A;  2BTQ A;  2Q9L A;  4MT8 A;  3S3X A;  3BRC A;  4B3M B;  2QWR B;  5L3C A;  1L0N H;  3DC5 A;  1R6N A;  2Y0P A;  4EB6 B;  3G71 V;  4TUY A;  1QCE A;  1YEW A;  1QR8 A;  3E8H A;  4NXN B;  3X2Q C;  4P3N A;  3CME V;  3ABM C;  4OGQ B;  4UP7 A;  4DV3 B;  2HEP A;  1FJG B;  4JYB A;  1BCC H;  4NCX A;  3IAY A;  4JI4 B;  2EIK C;  1XQ8 A;  2XUM A;  4JI1 B;  5IYZ A;  4DV6 B;  3CC2 V;  4LF6 O;  2E64 A;  5GON B;  2Q73 A;  2NLJ C;  1Q7Y W;  5LGT A;  1SC5 B;  3CWB H;  4TWA A;  3CCJ V;  4E2L A;  1PPJ H;  2XAF A;  1OCR B;  4KR2 A;  4P72 A;  4LF7 O;  4NXM O;  3J7A U;  2UUA B;  3SPG A;  3ETQ A;  1R1B A;  5A2Q N;  1S5H C;  4AHC A;  2PUS A;  4J7J A;  2DKG A;  1EOV A;  2IBZ H;  4P9P A;  2DZC A;  2JIZ G;  2ZXW C;  4LF9 B;  4HWS A;  4YJ3 B;  1MOF A;  1XHX A;  4LH7 A;  1JJC B;  1EVK A;  4PG3 A;  4DQ2 A;  2B5U A;  4D6T H;  1Z7M A;  1HDJ A;  4DR7 B;  1N36 O;  4K8Z A;  3T1H O;  1ORQ C;  1GN4 A;  3H1I H;  1QHT A;  3ZN1 A;  3MF2 A;  5BR8 O;  1PKX A;  4LCU C;  2EIL B;  2DYR B;  3OD4 A;  4TV8 B;  1YB3 A;  2ART A;  2GHY A;  5ELO A;  4Q15 A;  4B3R O;  1PV0 A;  4GLX A;  3QO8 A;  4CH4 A;  1US6 A;  1Z5W A;  1GM7 A;  1YI2 V;  3EHB B;  2RHS B;  2I4O A;  3AG4 B;  3N2G B;  1SET A;  3KZI Z;  2W6J G;  2A8E A;  1F4N A;  2GBO A;  4DUZ B;  2Y4U A;  2YEV A;  1MSD A;  4W4L A;  1NJI W;  4O2D A;  3HKD A;  3HY0 A;  4NXN O;  1J95 A;  3FAV B;  4DV3 O;  2VQE B;  4TT3 G;  2EIM B;  4B3T B;  4J42 A;  3TEG A;  1W0J G;  3RGL A;  2DQ3 A;  5KHK A;  4JI1 O;  4DV6 O;  1I5Y A;  3REU A;  4J10 A;  5JJE B;  2AMC B;  3T1Y B;  3K5N A;  4IIJ B;  3JAR A;  2YIB A;  1NTK H;  2B1G A;  3ASN C;  3GB7 C;  2ZZE A;  3D3I A;  2QWP B;  3L70 H;  2C8M A;  2OWO A;  3CCQ V;  2VWJ A;  5F5W A;  1WA8 B;  4OXS A;  4YCV A;  4LVL A;  3WQZ A;  1QLE B;  2Q69 A;  4I0X B;  2WLI A;  1B06 A;  3K0G A;  2HKO A;  5BXZ A;  2LFR A;  5L3F A;  3OEH G;  1GMG A;  2DMX A;  3TK1 A;  4QGP A;  3B77 A;  3ZJZ A;  5LXT A;  5IJ0 A;  4DR7 O;  4GT1 A;  1QVG U;  1XMO B;  4JV5 B;  1E1O A;  2EIJ C;  4CC5 A;  1KKD A;  4OPA A;  5LOV B;  1S72 V;  2DTH A;  3J81 N;  3CRC A;  4P73 C;  4XTX A;  3CJH A;  2EJ9 A;  1CPY A;  1GN2 A;  2JK5 C;  3ZMZ A;  1WB8 A;  3I56 V;  1BT8 A;  4FM1 A;  1NJ2 A;  3W3S A;  5CBF A;  1GAX A;  2EJG A;  2HVJ C;  2PYL A;  2ITD C;  4R7C A;  1VP7 A;  4EO4 A;  1B7Y B;  3P3P A;  3V7S A;  2G38 A;  4HWR A;  4TVY A;  4UVA A;  2FL4 A;  1ASY A;  3SDL A;  4DUZ O;  5CB4 A;  1IVS A;  2XTI A;  4EX5 A;  1R3I C;  1AB3 A;  2EJR A;  4DR2 O;  1FXV A;  3SJC C;  4FVM A;  2UUB B;  3SYC A;  3LDC A;  2VQE O;  1K5S A;  1YFS A;  1Z2G A;  4B08 A;  2DE0 X;  5E79 Z;  1SQG A;  5JCO C;  1W66 A;  1B04 A;  2A7W A;  2JGD B;  3IG2 A;  5HFM A;  4ZOL B;  2Q8V A;  2R9I A;  1YJW V;  4PI0 A;  2WPD G;  3JSN A;  4YHH B;  3OR7 C;  4QIW F;  3K58 A;  3KG2 A;  4WFE A;  2XND G;  1MA1 A;  3CC4 V;  1WJZ A;  1WPB A;  4MTF A;  3UQ8 A;  4WF2 A;  4YRQ A;  3DXR A;  1YFT A;  3LSU A;  3RKX A;  2XTA A;  4H2T A;  3SPH A;  1OCC B;  4G28 B;  4X1Y B;  1H8E G;  3WB1 A;  1XMO O;  3JAW B;  1DK1 A;  4LF4 B;  4JV5 O;  4YRJ A;  4JI7 B;  3D36 A;  4H2V A;  2IU0 A;  2ILM A;  3OMI B;  1H2S B;  1WYD A;  2HJF C;  4FFB B;  3ZIA G;  3ABK C;  3DSQ A;  1K73 W;  4EB6 A;  2KG7 B;  3A0R A;  3B8N A;  2ZT9 B;  4JI2 B;  2OIG A;  4DV5 B;  4ICG A;  3K59 A;  2QR4 A;  2A9H A;  3IC9 A;  3UO2 A;  2ZD9 A;  4OX9 O;  2QHV A;  3E22 B;  2H94 A;  1VQO V;  4JI3 O;  1XUQ A;  1XIL A;  1J5E B;  1AJN A;  2CUG A;  5GON A;  4UV8 A;  4PA6 A;  3VOU A;  2WLJ A;  2H3O A;  2XGT A;  3CS5 A;  2ZDI A;  3AG2 C;  1K97 A;  1L0W A;  3V7C A;  2QKA A;  2E41 A;  3JAT B;  2UUB O;  1CP9 A;  4XDL A;  1VF6 C;  4YJ3 A;  5CMU A;  3WFV A;  3S3W A;  3CXC U;  1NKD A;  1M56 C;  1I94 B;  1JJC A;  4JGS A;  3LNM B;  2GSM B;  5CA0 B;  4YHH O;  1BHA A;  2K9P A;  1N8R W;  2XHB A;  1OCO B;  4X88 A;  1FFX B;  4MTX A;  1JR9 A;  3SJB C;  2RCV A;  2L35 A;  4TV8 A;  5KHG A;  4GX1 A;  5LGU A;  1B6Q A;  2YXL A;  4B7E A;  2I4N A;  4JAS A;  1GM8 A;  3EFS A;  1SQV H;  2M7W A;  1Q5O A;  2HLD G;  4LC1 A;  1BIA A;  5EZY A;  1E1R G;  4JI7 O;  4L87 A;  3F7Y C;  2RHS A;  3N2G A;  4YY3 B;  1K8A W;  2UXC B;  2HVK C;  3H1K H;  1NVP B;  2YIA A;  2M6Y A;  4JI2 O;  5JVD B;  1USY A;  4DV5 O;  3SPC A;  4TVW A;  2FYU H;  5IYC O;  1K33 A;  2PZS A;  1XHZ A;  1NVP D;  3RBZ A;  3MQZ A;  4BWA A;  2KSD A;  3AEI A;  3UM7 A;  3HPL C;  2XAQ A;  2IM9 A;  4LWS B;  1EFR G;  4JTA B;  4X65 B;  3ERR A;  4UVC A;  3VQX A;  2AMC A;  5BY1 A;  4YP0 A;  4FLV A;  4TQD A;  3JD3 A;  4IIJ A;  5L3E A;  4I50 B;  4P71 C;  4XTZ A;  3FB7 C;  2QKS A;  3SYQ A;  4X20 B;  1IBM B;  4B7K A;  1WA8 A;  4BR6 A;  2FYK A;  2BOC C;  1SQF A;  3K79 A;  1KYO F;  4I0X A;  1KD1 W;  1IBK B;  4RMF A;  5F2V O;  3G80 A;  4PA9 A;  2IJI A;  2CTW A;  1KBH A;  1I94 O;  1KMN A;  2QHU A;  3RKW A;  4I9W A;  3AG1 B;  3HXU A;  2ZQM A;  4X89 A;  5KA5 A;  4K3A A;  1WQW A;  1H4T A;  5GTI Z;  3CCL V;  1TAE A;  1F23 A;  2DDZ A;  3HR0 A;  1THZ A;  2ZT8 A;  3OM3 B;  1MSW D;  3ZCC A;  4P30 A;  2AZ0 A;  1H4Q A;  1ATI A;  1R6T A;  1NZ6 A;  3FKS G;  4YXW G;  3FYE B;  3M4P A;  3AK3 A;  4XU3 A;  4X1I B;  4MVU A;  4JYY A;  1BS3 A;  3APQ A;  2CJB A;  2JVD A;  4DR1 B;  3E8F A;  1YJN V;  1VQ8 V;  4P9O A;  2PTM A;  5KA6 A;  1TVK B;  3WU2 Z;  5IE9 A;  4YY3 O;  3AG7 A;  2UXC O;  3TUP A;  5J9P C;  2J3M A;  4A5U B;  3T4Z A;  1I7F A;  3A31 A;  4FJC C;  2DWD C;  3L73 H;  4YRG A;  4NYK A;  1EQR A;  4R50 A;  1R3K C;  1HC7 A;  1EZJ A;  3E2E A;  5B3S C;  5C93 A;  3E35 A;  3WG7 B;  3SYA A;  2A0L A;  1ZAU A;  4W4K A;  4X65 O;  1WNL A;  1HXD A;  3C90 A;  4I5S A;  2LQT A;  1PNL A;  4E4E A;  3ZHS A;  4HWT A;  1AJP A;  4J7K A;  2JGD A;  4ABM A;  4ZOL A;  4UUJ C;  3FX7 A;  4WFG A;  1MMM A;  3B8M A;  1IBM O;  2GUZ B;  3AG3 B;  2CE4 A;  1S5J A;  2D2C B;  1O9H A;  3CJH B;  1T5E A;  3CRA A;  3K3W A;  1IBK O;  3OMA B;  4FPP A;  3M8A A;  5IDJ A;  3FD9 A;  1AR5 A;  1YCI A;  5EBL C;  3K03 A;  4X1Y A;  4X66 B;  1D2D A;  1UFI A;  3HKE A;  5KAI Z;  4FLZ A;  3BA8 A;  3JAW A;  2FKX A;  1V55 B;  1HNZ B;  1JMK C;  4AI8 A;  2GV9 A;  4FFB A;  4G27 B;  3HTZ A;  4UPA A;  3CP1 A;  2KG7 A;  4XTW A;  3A2F A;  3SGI A;  4TTV A;  1G5H A;  3FB6 C;  3MF1 A;  3MDS A;  4CS2 A;  1TA8 A;  1FXK B;  3Q4H B;  3CPW U;  2OCH A;  5JJJ B;  3EFR A;  2PGG A;  3CRQ A;  4ZI7 A;  4YCU A;  2DN9 A;  5IJ9 B;  4DR1 O;  2BTO A;  1NJ5 A;  1GN3 A;  3H1H H;  3E22 A;  5EC1 C;  3JD2 A;  2DU5 A;  2E10 A;  5D5P A;  3K9S A;  4CS3 A;  1XNR B;  5L3B A;  4WCE V;  3ASO C;  1RP3 B;  2ZE5 A;  3UGT A;  3I5D A;  3JAT A;  2XOK G;  3ZRW A;  1D5A A;  2ATK C;  1P49 A;  4YRC A;  1SF9 A;  4JI6 B;  1M5I A;  2ARU A;  4B3S B;  5GTH Z;  3A0H Z;  5CA0 A;  2VQF B;  4ZTZ B;  1QR9 A;  3D8C A;  3ZRV A;  5KLV H;  4JI5 B;  1WB7 A;  2XAH A;  3BAB A;  3X2Q B;  3ABM B;  2FB5 A;  1V54 C;  1FFX A;  1AP6 A;  4MSW C;  4J7Z A;  4YYE A;  4BIO A;  3CCS V;  1IL2 A;  2QEX V;  3HKB B;  3VQY A;  4N23 A;  2EIK B;  2F95 B;  5LMU B;  3N2K B;  3RVY A;  4ZHQ B;  3U11 A;  1NYR A;  4TWK A;  4FZ0 A;  4X66 O;  1B76 A;  1Q6U A;  1GH6 A;  1HNZ O;  1X2G A;  1KP3 A;  4ZBM A;  1Y74 B;  2E1H A;  1FAF A;  4YIP A;  4YIO A;  2ZXW B;  2ETN A;  1YJ9 V;  1HP8 A;  2YXH A;  5JVD A;  1KU9 A;  1P84 F;  2LGQ A;  5FNV B;  2HJD A;  2XAS A;  4MVM A;  4FLT A;  2Q5H A;  4P75 A;  2P4V A;  1EIY B;  2W0F C;  1E79 G;  1AVM A;  4LNS A;  1GTO A;  4LWS A;  1L1F A;  5BMV B;  1BIB A;  4P74 C;  3ZS8 C;  1L8D A;  2PYJ A;  1EN5 A;  3BHP A;  2HHH B;  1R3J C;  4I50 A;  1AP5 A;  3A74 A;  3OFN G;  3M99 B;  5LP6 C;  2CJ9 A;  4X20 A;  5EK0 A;  4DR3 B;  2X6B A;  4IT5 A;  5ITZ B;  2E76 B;  4J9Z B;  1Q3E A;  3EXA A;  1NS1 A;  3RYH B;  3SR2 C;  4JI6 O;  3ICA A;  3ZHT A;  5CBH A;  3ZMU A;  4YRN A;  1XDC A;  4B3S O;  2E3C A;  2VQF O;  2XAJ A;  1PM9 A;  5EZY B;  1HTT A;  1VQM V;  3W7U A;  1RSO B;  1Y76 A;  4B3M O;  4JI5 O;  1GRJ A;  1F4M A;  3ICX A;  5TIS Z;  4UCR A;  3CCR V;  1R3L C;  1G5I A;  2KQX A;  3CRM A;  3QF7 A;  1IXB A;  1C0A A;  5LMU O;  1Q81 W;  1IBL B;  1G8M A;  5DEC A;  3BAA A;  1M93 A;  1FJG O;  2P0L A;  1N0N A;  1X54 A;  1RIQ A;  4X1I A;  4QNH B;  1NI8 A;  1MNG A;  2HNI A;  3ASN B;  4JI4 O;  5K1X A;  3PZC A;  2ADQ B;  1B8A A;  2QTS A;  1DTO A;  2R9A A;  1TVK A;  2F1M A;  2DJZ A;  2OCC C;  3CYO A;  3I55 V;  3H1L H;  2PME A;  3OGC C;  1MAB G;  1ADJ A;  1F51 A;  2UUA O;  1H2G A;  4MVR A;  2DXU A;  1P7B A;  4BW9 A;  3CD6 V;  1LYL A;  4RWU A;  4QPK A;  4P3P A;  4LF9 O;  2AKW B;  3BFM A;  4LVI A;  1RFY A;  2ADP A;  4FK5 C;  1M90 W;  3SYO A;  3K0D A;  2EIJ B;  1WPX A;  1ASZ A;  4KHP B;  2P5I A;  2HHH O;  4DRX B;  4H44 B;  4JI0 B;  4Z2W A;  3CRR A;  2BCC H;  4YRM A;  1AI4 A;  4GKJ B;  4PA3 A;  1JJ2 U;  4KR3 A;  2X6A A;  1Y4M A;  3C3T A;  3DGE A;  2J3L A;  3PCO B;  1XNQ B;  3G6B A;  2GUZ A;  4DR3 O;  4FFK A;  3WB0 A;  5LBQ A;  1H38 A;  2NS6 A;  2WAM A;  4DV1 B;  4DV4 B;  1VQ5 V;  2X6C A;  3O9O A;  4KXR A;  3E83 A;  4LF8 B;  1AI7 A;  1JVM A;  3H01 A;  1K5Q A;  2CH7 B;  4H13 B;  4K35 A;  4ZTU B;  2Q7G A;  1LNQ A;  1VAR A;  3G4S V;  1ARO P;  4UCT A;  3HRK A;  1KP2 A;  5IT9 N;  1SER A;  4JYA B;  5HFL A;  4IHJ B;  4PHC A;  4NR1 A;  3RAC A;  2ZE6 A;  1JA8 A;  2IH1 C;  3VBB A;  1EFW A;  2HFE C;  1IBL O;  2Y69 C;  1XMQ B;  4EFB A;  1FXK A;  3Q4H A;  4B3T O;  1IXM A;  2QSA A;  2OTL V;  5IJ9 A;  1OHH G;  3T1Y O;  2F4V B;  3L4G B;  1K4D C;  1XRE A;  4ZKI A;  3JAK B;  4LH6 A;  2JS5 A;  1KB9 F;  2GDS A;  4YRR A;  1EN4 A;  2P5O A;  4LVK A;  5H2F Z;  1JJO A;  3NR7 A;  3RT3 C;  1OCZ C;  1GGM A;  2DW4 A;  2FTK A;  2CIM A;  1R6K A;  3CC7 V;  3HRI A;  4TVA B;  2QHS A;  3A5Z A;  2B1I A;  3W7S A;  4UP8 A;  3CSX A;  5IYD O;  3HKE B;  4JI0 O;  2CAZ C;  4YRL A;  3V8L A;  3ABK B;  5B1B C;  1CXZ B;  4GKJ O;  2OTJ V;  2F43 G;  2QJ1 A;  5L3D A;  3LNN A;  1V9P A;  2LW1 A;  1SQQ H;  2V7Q G;  1Y6X A;  3U10 A;  1K3E A;  4O4H B;  4MS2 A;  1SQP H;  2WLH A;  3KKY A;  1Q82 W;  1XNQ O;  2Q5I A;  1X4T A;  2QA4 V;  4DV0 B;  4XU0 A;  2RDC A;  4HZ3 A;  2YIC A;  4DV1 O;  4JF3 A;  4DV4 O;  3K5O A;  3HKB A;  5HGQ A;  5ELN A;  1AR4 A;  1HNX B;  4LF8 O;  4H2W A;  3HY1 A;  5LL6 Y;  3N2K A;  4ZI7 B;  4MW3 A;  4ZHQ A;  4O4I B;  4O4J B;  3FFQ A;  2JJ1 G;  4DW0 A;  1YVW A;  3CEI A;  2Q4P A;  2E75 B;  1VQ4 V;  3IAL A;  4F4L A;  4BIU A;  2AGA A;  2R70 A;  3F5T A;  3AG2 B;  1B70 B;  4JYA O;  3MHS C;  1Y74 A;  5B1N A;  4GX0 A;  3QG5 A;  2Q7H A;  2JJ2 G;  4I9Q A;  1WLE A;  3K08 A;  4LVJ A;  1XL6 A;  4CH6 A;  1M56 B;  1XMQ O;  2P90 A;  3ZRW B;  5FNV A;  4WFH A;  1DLB A;  4LP8 A;  4KQE A;  3CMA V;  2WLN A;  4UB8 Z;  4J80 A;  4IGG A;  1EIY A;  4PA7 A;  4CH3 A;  5BMV A;  2F4V O;  5J2T B;  3E8G A;  4HYO A;  2ARH A;  2RNB A;  1FD9 A;  1YGB A;  1WP7 A;  3LSS A;  4P2Z A;  3BJU A;  3UT5 B;  3L75 H;  5A9G A;  3T2M A;  3JAM N;  2IH3 C;  1Y67 A;  2FML A;  2RN9 A;  2OIE A;  1VQN V;  1VF7 A;  1JQ0 A;  1M57 C;  2YS8 A;  4GYC B;  3JCZ A;  5ITZ A;  3ZHQ A;  3HFZ B;  1S76 D;  1D5N A;  3E86 A;  1NTZ H;  2AW9 A;  4QPJ A;  4X5O A;  3RYH A;  4XBF A;  2DYS C;  2DU7 A;  4MVZ A;  4X8A A;  2NNU A;  2ZE7 A;  3BY6 A;  2E5L B;  4X64 B;  4D7S A;  2Z3Y A;  4LF4 O;  4PEL A;  2YI8 A;  4MW8 A;  1RSO A;  4JAA A;  2EX3 A;  1Z5V A;  3MHH C;  2YI9 A;  4H02 A;  4HT4 A;  2X0L A;  5LGN A;  2LP7 A;  5E3I A;  4EFE A;  3ZHV A;  2RMK B;  3HXV A;  2F66 C;  2RQ6 A;  4QE9 A;  1HNX O;  1RPO A;  1W2B U;  4DW1 A;  4X62 B;  1N34 B;  2KKW A;  4KFM A;  1N0J A;  5CA3 A;  3KCX A;  2QM7 A;  2EAY A;  1J5E O;  1X56 A;  3CX5 F;  4YRI A;  4FM2 A;  4UCO A;  3RL6 A;  4J41 A;  1SZX A;  1YTF D;  3R65 A;  1NH2 D;  2EZO A;  3B2E E;  4P72 C;  1X55 A;  2ZT6 A;  5KX5 B;  1KQS U;  4CS4 A;  1YFR A;  4LR3 A;  2DZ9 A;  2AKW A;  3SPJ A;  4NTW A;  2CTP A;  3SJQ C;  4H37 A;  1GO3 F;  2Q0A A;  4JAV A;  4E51 A;  4HAM A;  1L0L H;  3CCM V;  4AQY B;  2YDE A;  4DRX A;  3FYI B;  1G6U A;  1Y76 B;  3CB2 A;  4P73 A;  4UCS A;  1XL4 A;  3EVK A;  1BZK A;  2IJK A;  3M4Q A;  3JAL B;  4YRT A;  5B1A C;  3PCO A;  4G85 A;  4GX5 A;  5KHI A;  4JYC A;  2ZM6 B;  5JJN B;  4XDJ A;  2E74 B;  3PJS K;  2E5L O;  4X64 O;  1EBO A;  2CH7 A;  4XEO A;  1VQZ A;  1NQT A;  4F6R B;  1NT2 B;  3W7T A;  3ZBH A;  3DC6 A;  2PI5 A;  4F6E A;  2A3Q A;  4LF5 B;  3ETE A;  4RDX A;  3OTO B;  4DK1 A;  4LVM A;  5CA1 B;  2YID A;  5L3G A;  4U7N A;  5B3S B;  1ZWI C;  2AZ2 A;  4LNU A;  4IHJ A;  4Q20 A;  1SA0 B;  3WB2 A;  2Z0A A;  4X62 O;  5JCO A;  4HWP A;  1N34 O;  2YC0 A;  4UFZ A;  3IKM B;  2UXB B;  1IX9 A;  1X2H A;  3HXY A;  3P30 A;  4CH5 A;  4XTY A;  3L4G A;  4OP0 A;  2L6L A;  4PDR A;  2CGN A;  4DK0 A;  3ZED A;  3JAK A;  5FLX N;  1N4C A;  3ZRX A;  1ZSP A;  4NKG B;  2C2A A;  2R72 A;  1GM9 A;  3STZ C;  3T4D A;  5IYB O;  2Y0I A;  1Z7N A;  1MZF A;  3RUX A;  4MTG A;  3H1J H;  3ABL C;  4DO2 A;  1H2L A;  3HXW A;  4KP4 A;  3REX A;  5EYP B;  2QHT A;  2ZT5 A;  1M9N A;  4TVA A;  3NEM A;  1KOG A;  4JPR A;  5IY5 C;  4AQY O;  2HG5 C;  4UCU A;  5GW7 A;  3P8V A;  1TGO A;  1P4R A;  3BPZ A;  1TUB B;  5E1A C;  1AR1 B;  3P8T A;  1Q90 D;  2Y48 A;  4O4H A;  12AS A;  2IW5 A;  3QTC A;  2QWQ B;  3OR6 C;  1G51 A;  3UFG A;  2V1D A;  1XEQ A;  3BA9 A;  5D5Q A;  4JZ2 A;  4GZR B;  4H0L B;  4TOI A;  2ZM6 O;  1BSM A;  4YRF A;  4K86 A;  1X59 A;  1ZL8 B;  1QNM A;  3OAA G;  4O4I A;  4O4J A;  2ZE8 A;  1GKF A;  2EL9 A;  1NU1 H;  1URF A;  2VRZ A;  1IUR A;  4TV9 B;  3W7X A;  4IYI A;  4LF5 O;  3ASO B;  4ASU G;  4NXM B;  4J9Y B;  1B70 A;  3OTO O;  1VQP V;  1QE0 A;  2YSU B;  4OPH A;  3BFR A;  3RYF B;  4YRE A;  1RM1 C;  2AHZ A;  3RYI B;  1QQC A;  4DYL A;  4I4T B;  3GVM A;  3NEN A;  4MTO A;  1VF6 A;  1I0H A;  4H2Y A;  4HBN A;  1VQL V;  1YF2 A;  1K92 A;  2P4K A;  2UXB O;  1PP9 H;  2XT9 A;  4JTC B;  1FPO A;  5J2T A;  4UV9 A;  3C3S A;  3G6E V;  1V54 B;  3UT5 A;  3K06 A;  4LFB B;  3TJT A;  3ETD A;  4EKW A;  1YIT V;  2EIN C;  3MAQ A;  4YRP A;  5EC2 C;  1BQ0 A;  4PJ0 Z;  1IDS A;  4R6Z A;  2IY5 B;  4KUM A;  1H4V B; 
#chains in the Genus database with same CATH homology
 4UV8 A;  1M90 W;  3SYO A;  3K0D A;  2EIJ B;  1HWY A;  4PA6 A;  1WPX A;  3VOU A;  3HFZ A;  3RF1 A;  4YRK A;  3IKL A;  1ASZ A;  1FFT B;  2P5I A;  2WLJ A;  4KQE A;  2XGT A;  2ZDI A;  3NXS A;  3AG2 C;  1K97 A;  4YRM A;  1PYS B;  3HXX A;  1AI4 A;  1L0W A;  1PNM A;  4PA3 A;  3V7C A;  3TET A;  2E41 A;  2KB1 A;  1JJ2 U;  4KR3 A;  1K4C C;  2X6A A;  2DEQ A;  1Y4M A;  3DGE A;  2K1E A;  1X01 A;  1CP9 A;  2J3L A;  3PCO B;  1S0V A;  4RQE A;  2QTO A;  1VQ7 V;  2DXT A;  4XDL A;  3OW2 U;  5LBQ A;  1H38 A;  1B7Y A;  2NS6 A;  4H2U A;  2WAM A;  5CMU A;  3WFV A;  3CXC U;  4U7O A;  1NKD A;  1M56 C;  1JJC A;  4JGS A;  3KFU A;  3LNM B;  1VQ5 V;  2GSM B;  3SPI A;  3OUS A;  2X6C A;  3E83 A;  4RUF A;  1AI7 A;  1JVM A;  3H01 A;  1K5Q A;  2JDI G;  1OZ0 A;  4ZTU B;  3ABL B;  1NR1 A;  2Q7G A;  1BHA A;  1LNQ A;  2ZXF A;  2H8P C;  2WLI B;  3F5W C;  3G4S V;  1N8R W;  2ZTG A;  2P67 A;  1OCO B;  1ARO P;  4X88 A;  1J5W A;  4MTX A;  2ZCE A;  4WFA V;  3HRK A;  3FB5 C;  3HB3 B;  4P71 A;  1QVF U;  1KP2 A;  3JD1 A;  3I7F A;  2Q68 A;  3JD4 A;  3QNE A;  4GX1 A;  5IY5 B;  2PI4 A;  5LGU A;  1B6Q A;  1SER A;  2OT5 A;  5HFL A;  3JD0 A;  4GCZ A;  2QM8 A;  1JOY A;  2I4N A;  3EFF K;  4JAS A;  1GM8 A;  3WG7 C;  4UXN A;  3BEH A;  4PHC A;  3EFS A;  3RAC A;  2IJH A;  2M7W A;  2IH1 C;  2P7T C;  3VBB A;  1EFW A;  2HFE C;  1FS0 G;  2HLD G;  1NYQ A;  1DF4 A;  3OUF A;  4LC1 A;  1BIA A;  4OLF A;  2Y69 C;  2C7I A;  1FXK A;  1OCR C;  2ZDI C;  2AHY A;  2ZT7 A;  1IXM A;  1E1R G;  4L87 A;  3F7Y C;  2OTL V;  4H33 A;  1NJ1 A;  4XU1 A;  2RHS A;  1E24 A;  1OHH G;  1K8A W;  2HVK C;  5EBW C;  1JX9 A;  3L4G B;  1K4D C;  3AG3 C;  1NVP B;  2WLK A;  4ZKI A;  1USY A;  3P8Y A;  3SPC A;  4TVW A;  4YRR A;  5IYC O;  1K33 A;  4HA8 A;  4K88 A;  1NVP D;  4GX2 A;  3RBZ A;  3MQZ A;  5C53 B;  4BWA A;  3AEI A;  1COW G;  3UM7 A;  4J15 A;  3HPL C;  4FMT A;  3NET A;  2XAQ A;  4LVK A;  2R9R B;  1EFR G;  4JTA B;  3ZMV A;  2DWE C;  4UVC A;  3ERR A;  3HXZ A;  4XTV A;  1OCZ C;  1GGM A;  1RM1 B;  1MG1 A;  3OMN B;  4WFF A;  2AMC A;  2DW4 A;  2FTK A;  2E5A A;  2CIM A;  1R6K A;  1V55 C;  3K9A A;  5DM6 V;  3CC7 V;  2EJF A;  3HRI A;  2QHS A;  3JD3 A;  5L3E A;  3A5Z A;  4TQD A;  4P71 C;  4TVA B;  2B1I A;  2EIL C;  1AJQ A;  2DYR C;  3W7S A;  2ARS A;  2RHQ B;  4UP8 A;  1H4S A;  2LFS A;  5IYD O;  3FB7 C;  2QKS A;  1UJW B;  2ALY B;  3SYQ A;  4H2X B;  4YRL A;  3V8L A;  3ABK B;  5B1B C;  1BBW A;  3T1C A;  4TQF A;  2OTJ V;  4WF9 V;  2F43 G;  5L3D A;  1DF5 A;  3ZMT A;  1NJ8 A;  3VQV A;  1YHQ V;  2OCC B;  3IGA C;  2V7Q G;  4BW9 A;  1WPY A;  2FYK A;  1K3E A;  4LBE C;  1NNH A;  2BOC C;  4MS2 A;  2WLH A;  3K79 A;  1Q82 W;  5BZB A;  2CGH A;  1FXK C;  1KD1 W;  1NR7 A;  2Q5I A;  2QA4 V;  1NBM G;  4RMF A;  3A5Y A;  2WLL B;  4XU0 A;  3IC7 A;  4PA9 A;  2IJI A;  2DQ0 A;  4HZ3 A;  11AS A;  2Z5U A;  5FL7 G;  1WU7 A;  4JF3 A;  1KMN A;  3AG4 C;  2QHU A;  3RKW A;  2HR3 A;  2EIN B;  4I9W A;  5HGQ A;  3AG1 B;  5ELN A;  2ITC C;  3HXU A;  1FXH A;  2ZQM A;  4X89 A;  5KA5 A;  4QE7 A;  3STL C;  1WQW A;  4H2W A;  3UGQ A;  3V7R A;  2ZZG A;  3HY1 A;  1H4T A;  3CCL V;  4MW3 A;  1F23 A;  3E9I A;  1KEC A;  1PYS A;  1S77 D;  1ADY A;  2D3O W;  2JEX A;  1USY C;  2DDZ A;  2JJ1 G;  1E1T A;  1THZ A;  4CZZ A;  2ZT8 A;  1BL8 A;  3OM3 B;  4YRO A;  1MSW D;  3RIR A;  3V8J A;  5H6R A;  3TEH A;  1VQ4 V;  3ZCC A;  2IU3 A;  4P30 A;  4F4L A;  3IAL A;  4BIU A;  4K87 A;  5H6Q A;  1H4Q A;  1RPR A;  1ATI A;  2UXN A;  3AG2 B;  2W6I G;  2WSS G;  2DVE A;  2EBO A;  3FKS G;  2EIM C;  1E22 A;  2WLM A;  4YXW G;  3FYE B;  5LHI A;  3CCV V;  1B70 B;  3A7A A;  1K9M W;  3MHS C;  1KC8 W;  3M4P A;  4FIP C;  4XU3 A;  5B1N A;  4DPG A;  3JYC A;  2Q67 A;  4GX0 A;  4N21 A;  1Q86 W;  1BHB A;  4JAU A;  1ENV A;  2Q7H A;  2JJ2 G;  3DTU B;  4H2S A;  4UP9 A;  3A7U A;  4MVU A;  3IFX A;  1WLE A;  3K08 A;  4MT8 A;  4LVJ A;  1XL6 A;  4CH6 A;  2CJB A;  2BOB C;  1M56 B;  2P90 A;  4DXW A;  3R07 A;  3ZRW B;  3E8F A;  1YJN V;  5L3C A;  4WFH A;  1DLB A;  1R6N A;  4LP8 A;  4P9O A;  4UVB A;  1VQ8 V;  3CMA V;  2WLN A;  5KA6 A;  3A7R A;  3G71 V;  2IJJ A;  1EIY A;  1QCE A;  4PA7 A;  3F7V C;  1QR8 A;  4CH3 A;  1QLE C;  3E8H A;  3G1Z A;  3X2Q C;  5J9P C;  2ZNI A;  2J3M A;  3E8G A;  4HYO A;  3ABM C;  3QO7 A;  1PL0 A;  3T4Z A;  3CME V;  3LSS A;  4P2Z A;  4FJC C;  1FYF A;  3CCU V;  2DWD C;  3QO5 A;  3A31 A;  3BJU A;  4JYB A;  4MVS A;  3UH0 A;  4YRG A;  4NCX A;  2EJG A;  3TEH B;  1EQR A;  4R50 A;  3T2M A;  3GWO A;  2EIK C;  2IH3 C;  1R3K C;  1HC7 A;  1EZJ A;  2E64 A;  3CC2 V;  5KUK A;  3E2E A;  4RAI A;  5CN0 A;  5B3S C;  1VQN V;  1JQ0 A;  5C93 A;  3E35 A;  3WG7 B;  1M57 C;  3SYA A;  2A0L A;  4TSF G;  4XTZ A;  2NLJ C;  1Q7Y W;  2Q7E A;  3JCZ A;  1WNL A;  5LGT A;  4TWA A;  1HXD A;  1S76 D;  3HFZ B;  3CCJ V;  4I5S A;  2Y69 B;  4E2L A;  3E86 A;  4WI1 A;  4XU2 A;  2XAF A;  1OCR B;  1PNL A;  4P72 A;  4QPJ A;  4X5O A;  4XBF A;  4KR2 A;  5B1O A;  4HWT A;  1AJP A;  2DYS C;  3SPG A;  4MVZ A;  2DU7 A;  4X8A A;  2NNU A;  3BY6 A;  4UUJ C;  4WFG A;  1S5H C;  1K34 A;  2Z3Y A;  2DKG A;  1EOV A;  3LDD A;  4JTD B;  3B8M A;  2JIZ G;  4P9P A;  2XAG A;  2ZXW C;  3AG3 B;  4PEL A;  2DZC A;  4HWS A;  4MW8 A;  1SRY A;  1MOF A;  1JJC B;  3K3W A;  1EVK A;  4PG3 A;  3MHH C;  4DQ2 A;  2B5U A;  4XEM A;  1Z7M A;  3OMA B;  4FPP A;  2I4M A;  1W0K G;  4H02 A;  4YRS A;  4HT4 A;  2DTO A;  1E1Q G;  2X0L A;  5IDJ A;  5LGN A;  2LP7 A;  4YDQ A;  1ORQ C;  2A79 B;  5E3I A;  1YSC A;  3HXV A;  3LUT B;  3VQX A;  1G4Y B;  1H4V B;  5EBL C;  3K03 A;  4QE9 A;  2ALY A;  1RPO A;  3ZN1 A;  1OCZ B;  3MF2 A;  3UKM A;  3ML0 A;  1W2B U;  1R73 A;  1V55 B;  3L2Z A;  1PKX A;  4YP0 A;  4KFM A;  4LCU C;  2EIL B;  5CA3 A;  2DYR B;  1SES A;  1YB3 A;  2QM7 A;  2EAY A;  3RVZ A;  4G27 B;  5B1B B;  3W7W A;  3HTZ A;  2ART A;  4UPA A;  1X56 A;  2GHY A;  3CCE V;  4YRI A;  5C51 B;  5ELO A;  3CP1 A;  3RL6 A;  4Q15 A;  5C52 B;  4XTW A;  3QO8 A;  4TTV A;  1G5H A;  3CMQ A;  4YPF A;  1YTF D;  4CH4 A;  3FB6 C;  3MF1 A;  4CS2 A;  1FXK B;  3R65 A;  1GM7 A;  3CPW U;  2EZO A;  1NH2 D;  4P72 C;  1X55 A;  1YI2 V;  2ZT6 A;  3EHB B;  3EFR A;  4YCU A;  4AH6 A;  1KQS U;  2ZNJ A;  1AI5 A;  1CEZ A;  2RHS B;  2I4O A;  4CS4 A;  3AG4 B;  1YFR A;  1NJ5 A;  1SET A;  2W6J G;  2A8E A;  4UP7 A;  2DZ9 A;  5EC1 C;  3JD2 A;  1F4N A;  5EBM C;  2AKW A;  3SYP A;  5K1P A;  2YEV A;  3SPJ A;  1YIJ V;  3P32 A;  2IY5 A;  3SJQ C;  4H37 A;  3TUP A;  1JPX A;  4O2D A;  1NJI W;  2DU5 A;  1GO3 F;  2ODR D;  3HY0 A;  2E10 A;  1QF6 A;  4RO2 A;  1H8H G;  4JAV A;  2ODR C;  4CS3 A;  4E51 A;  1J95 A;  4HAM A;  3ZRS A;  3CCM V;  2Q6A A;  1NJ6 A;  4MVO A;  5L3B A;  3FYI B;  4WCE V;  3ASO C;  4TT3 G;  2EIM B;  1PNK A;  3OEE G;  4RQF A;  4P73 A;  3TEG A;  1XL4 A;  3UGT A;  1OCC C;  1W0J G;  3ABU A;  2DQ3 A;  3RGL A;  2IJK A;  3M4Q A;  3RKY A;  1I5Y A;  3VQW A;  2XOK G;  4YRT A;  3ZRW A;  3REU A;  2AMC B;  5B1A C;  1YGB A;  3PCO A;  1SZT A;  2ATK C;  2ZR3 A;  4YRC A;  4G85 A;  4GX5 A;  2ZR2 A;  2B1G A;  3GB7 C;  3ASN C;  1VQ6 V;  2ARU A;  2ZZE A;  4JYC A;  4ZTZ B;  4XDJ A;  1QR9 A;  3D3I A;  3FB8 C;  3PJS K;  3ZRV A;  2C8M A;  3CCQ V;  5F5W A;  1EBO A;  4XEO A;  1VQZ A;  1NQT A;  4OXS A;  4YCV A;  2XAH A;  4LVL A;  3WQZ A;  4P74 A;  3W7T A;  1QLE B;  2Q69 A;  1KMM A;  3X2Q B;  2WLI A;  3ABM B;  3K0G A;  1QBZ A;  1V54 C;  4BW5 A;  2HKO A;  2PI5 A;  2LFR A;  5L3F A;  4MSW C;  3OEH G;  2CK3 G;  1GMG A;  4YYE A;  3CCS V;  3TK1 A;  3ETE A;  4P3N A;  1IL2 A;  2QEX V;  4RDX A;  3VQY A;  3B77 A;  4N23 A;  2EIK B;  4LVM A;  3ZJZ A;  5L3G A;  4U7N A;  1GK9 A;  4GT1 A;  5B3S B;  1QVG U;  2E65 A;  1ZWI C;  2ZIO A;  2I4L A;  5KNN A;  1PD3 A;  1TUE B;  3RVY A;  3E8B A;  2ZIM A;  1K7D A;  1M57 B;  3OE7 G;  4Q20 A;  1NYR A;  4TWK A;  1E1O A;  2EIJ C;  1N9W A;  4RUE A;  4QJF B;  1VQK V;  1B76 A;  4Q6G A;  1KKD A;  4HWP A;  1S72 V;  1X2G A;  2DTH A;  2DYS B;  3TCU A;  3ZMS A;  1KP3 A;  1I5X A;  2ZGW A;  4ZBM A;  4P73 C;  4XTX A;  3IKM B;  2EJ9 A;  3V8K A;  1CPY A;  1X2H A;  3HXY A;  4MVQ A;  3P30 A;  4CH5 A;  4XTY A;  2E1H A;  3L4G A;  4OP0 A;  2JK5 C;  2ZXW B;  3ZMZ A;  4PDR A;  3I56 V;  2JEU A;  1YJ9 V;  1BBU A;  3NEL A;  1NJ2 A;  3W3S A;  5CBF A;  3ZRX A;  5DN6 G;  2HVJ C;  1M1K W;  2C2A A;  4XDK A;  1GM9 A;  3STZ C;  2ITD C;  4R7C A;  2XAS A;  4MVM A;  3T4D A;  5H9C A;  5IYB O;  2Q5H A;  4P75 A;  4EO4 A;  1B7Y B;  1Z7N A;  3V7S A;  2W0F C;  3RUX A;  1EIY B;  4MTG A;  1E79 G;  4HWR A;  4PA4 A;  3ABL C;  4TVY A;  4DO2 A;  4UVA A;  4LNS A;  4YCW A;  1GTO A;  1BIB A;  1L1F A;  4P74 C;  1ASY A;  3HXW A;  4KP4 A;  5CBG A;  3A32 A;  3REX A;  1OCO C;  5LHG A;  2QHT A;  4WJ3 M;  2ZT5 A;  1R3J C;  2XTI A;  4EX5 A;  1R3I C;  2EJR A;  1M9N A;  1WQ7 A;  1BMF G;  4Z1M G;  1FXV A;  3E9H A;  4TVA A;  3NEM A;  1KOG A;  4JPR A;  2MK3 A;  2RHQ A;  3A74 A;  5IY5 C;  2HG5 C;  3E89 A;  2DTI A;  3OFN G;  3ETG A;  1EVL A;  3M99 B;  4H2X A;  2X7R B;  5GW7 A;  3LDC A;  3SYC A;  1K5S A;  3P8V A;  3MEY A;  2CJ9 A;  1YFS A;  5EK0 A;  1P4R A;  4XTU A;  2X6B A;  2P6J A;  5E1A C;  4G84 A;  1AR1 B;  4HWO A;  3P8T A;  2Y48 A;  4J9Z B;  12AS A;  1QLN A;  1JCH A;  2IW5 A;  3ZN0 A;  1YTF B;  1W66 A;  3OR6 C;  3FJP A;  3QTC A;  1VQ9 V;  4CBC A;  2WLL A;  1NH2 B;  1G51 A;  3HFV A;  3ICA A;  3UFG A;  5LHH A;  2V1D A;  3MD0 A;  5HFM A;  5CBH A;  3IG2 A;  3ZMU A;  4YRN A;  2R9I A;  1YJW V;  2EWN A;  2E3C A;  2WPD G;  4YRF A;  3OR7 C;  4PDL A;  1Y66 A;  2XAJ A;  4K86 A;  4QIW F;  1HTT A;  1VQM V;  4WFB V;  3KG2 A;  3LSQ A;  3W7U A;  4WFE A;  2XND G;  3L1A A;  4BAY A;  3OAA G;  4BIZ A;  3CC4 V;  4P3O A;  4MTF A;  1AI6 A;  3OD1 A;  1GKF A;  2EL9 A;  1F4M A;  2UXX A;  4WF2 A;  3K04 A;  4P75 C;  4YRQ A;  1YFT A;  3W7X A;  3CCR V;  2G4C A;  1R3L C;  1G5I A;  3ASO B;  4ASU G;  3RKX A;  4J9Y B;  5KUM A;  3SPH A;  4H2T A;  1OCC B;  4R8C A;  1B70 A;  4G28 B;  3LDE A;  1VQP V;  1C0A A;  1QE0 A;  1H8E G;  2YSU B;  1Q81 W;  1G8M A;  4YRE A;  1RM1 C;  2QE7 G;  5B1A B;  2AHZ A;  2P0L A;  1S3J A;  1X54 A;  1RIQ A;  4QNH B;  4YRJ A;  3NEN A;  4MTO A;  4G2K A;  2HNI A;  4H2V A;  3ASN B;  3D36 A;  2ZIN A;  2IU0 A;  5K1X A;  3PZC A;  4H2Y A;  4PDV A;  2PMF A;  1B8A A;  3RW0 A;  3ABT A;  3OMI B;  1VQL V;  2HJF C;  1WYD A;  2CJA A;  4HVC A;  3ZIA G;  3ABK C;  3DSQ A;  1K73 W;  1DTO A;  1K92 A;  2DJZ A;  2OCC C;  3CYO A;  3I55 V;  3A0R A;  3B8N A;  2EZP A;  2PME A;  3OGC C;  1MAB G;  4JTC B;  1ADJ A;  4UV9 A;  1F51 A;  3G6E V;  1V54 B;  4PDM A;  1H2G A;  4MVR A;  3K06 A;  2A9H A;  3ETD A;  1P7B A;  4EKW A;  2ZD9 A;  1YIT V;  2DXU A;  2EIN C;  3CD6 V;  1LYL A;  3AG1 C;  2QHV A;  4QPK A;  5EC2 C;  1ROP A;  4YRP A;  4P3P A;  2H94 A;  4R6Z A;  1VQO V;  2AKW B;  3BFM A;  4ZIB A;  4LVI A;  4WJ4 A;  2YEV B;  2IY5 B;  4KUM A;  1AJN A;  2WWW A;  2ZZF A;  3LC0 A;  4FK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...