2DQ3A

Crystal structure of aq_298
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
425
Chain Sequence
MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGTDVIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aq_298
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Seryl-tRNA synthetase
total genus 133
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dq3A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dq3A02
2ARUA 3HFZB 2RHSB 3A5YA 1EFWA 4AH6A 4XTXA 1E22A 1WNLA 3UGTA 3V7RA 3NENA 3EFRA 2DDZA 4H2WA 2PMFA 2QHVA 2DU5A 4P74A 4CS2A 2RHQB 5KNNA 4WJ3M 4CS4A 3NETA 2G4CA 4X5OA 4YRFA 2DEQA 1X2GA 3RF1A 4XTUA 4XU0A 4XTVA 3HRKA 3P8TA 4P3OA 3TEHA 3M4QA 3QO8A 1BIAA 3TEHB 4YRCA 4YRLA 2ZZGA 2AKWB 4O2DA 4RMFA 4WF2A 5C52B 4EO4A 4K88A 3E9HA 1H4QA 2ZNIA 2EJ9A 1EIYB 1WPYA 2DKGA 2IY5B 4G85A 1EIYA 4OLFA 4TVWA 1SETA 3REXA 3NELA 2CJ9A 3RUXA 3IKMB 1N9WA 3W3SA 2ODRD 1E24A 2CIMA 3P8VA 2DZCA 1ADJA 2Q7HA 4HWRA 4H2XB 4TWAA 4P73A 1BIBA 4H2XA 1NJ1A 1H4SA 2AMCB 4YRJA 4P74C 3HXVA 1B70A 1X56A 1NYRA 2EJGA 1X01A 3HTZA 4UPAA 1WLEA 1NJ8A 1X55A 3E9IA 2ZNJA 3HFZA 4ZTUB 2ZCEA 3BJUA 1LYLA 4L87A 2J3MA 4UP9A 1G51A 4PG3A 4P75A 1GGMA 1E1TA 1H4VB 2QHSA 2C7IA 5HGQA 3CMQA 4XEMA 3V8LA 2DQ0A 2ALYA 2E1HA 4Q6GA 2ALYB 2XGTA 4DQ2A 2I4MA 4YYEA 3PZCA 3NEMA 3PCOA 3L4GA 1QE0A 2DXTA 3TEGA 3MF1A 1YB3A 3L1AA 1EQRA 1NJ6A 2E3CA 4YP0A 2CGHA 5E3IA 3RKXA 4YRTA 4KQEA 1HTTA 1G5IA 2DZ9A 2Q7GA 2E64A 1C0AA 2Q5HA 2ZT7A 2Q7EA 1NJ5A 4RQFA 5K1PA 1PYSB 5F5WA 2RHSA 1SERA 2ZT5A 1ASYA 3V7CA 2ZIOA 1YFRA 4YRSA 3KFUA 1USYC 2I4LA 3LSSA 4E51A 4BW9A 3TUPA 4PHCA 1YFSA 2XTIA 2I4NA 1E1OA 1YGBA 3RL6A 2DTIA 3A74A 3REUA 5ELOA 2EL9A 1J5WA 3RKWA 1SRYA 1BBUA 3DSQA 4TVAA 1VQZA 4P73C 1JJCB 1HXDA 3VQVA 1H4TA 2QHTA 3VQYA 3UFGA 3ERRA 3BFMA 2DXUA 2ZR2A 1L0WA 4HWSA 2ZT6A 4YRGA 2ARSA 2DVEA 4UP8A 4YRIA 2IY5A 1ADYA 2DTOA 3WQZA 2DU7A 2ZINA 2EJFA 2I4OA 1HC7A 4BWAA 3HXUA 1NYQA 3UH0A 3QTCA 3MF2A 4OP0A 4YCUA 2P5IA 3QO7A 2AMCA 3A32A 3HRIA 4P3NA 2ZZFA 4XTWA 4XU3A 1IL2A 3HXZA 4YRPA 4YPFA 4TVYA 3A7UA 4CS3A 1EOVA 1EVLA 4CH3A 1EVKA 4TQFA 4H2SA 4CH4A 2HNIA 4RQEA 1PYSA 1B76A 4J15A 4TQDA 4XU1A 3QO5A 4YRRA 3A7AA 3L2ZA 1NNHA 4P3PA 4P72A 3QNEA 3V8JA 2E5AA 4YRNA 3HY1A 2P0LA 1Z7MA 3V8KA 1NJ2A 2ZGWA 1RIQA 2PMEA 3I7FA 4RDXA 4XTYA 4P71C 3VBBA 2AKWA 2CJBA 4H2UA 1G5HA 1Z7NA 5K1XA 1JJCA 2ZZEA 1X2HA 4HWPA 1FYFA 4XTZA 4YRQA 3A7RA 5C53B 4KR2A 3IALA 4UP7A 4YROA 4YCVA 2ZR3A 3A5ZA 1QF6A 2EWNA 2ZT8A 3HY0A 2ZXFA 1WU7A 2DJZA 4YRKA 3RACA 1W66A 1B8AA 3RGLA 1KMNA 3IG2A 4HVCA 4P72C 4G84A 2E10A 4K87A 1B70B 2C8MA 5ELNA 2E65A 1YFTA 2RHQA 4ZTZB 4CH5A 4XU2A 3UGQA 4WJ4A 3M4PA 1WYDA 3ICAA 3MEYA 3IKLA 4CH6A 3G1ZA 1B7YB 3HXXA 2ZTGA 4YRMA 1KMMA 1B7YA 4H02A 4LNSA 3LSQA 4H2VA 4YCWA 3VQXA 4YREA 3EFSA 2J3LA 3A31A 4KR3A 2FYKA 4TVAB 1ASZA 4WI1A 2ODRC 1USYA 3R07A 4P75C 1BBWA 1KOGA 4XEOA 12ASA 3RIRA 2QHUA 4HWTA 2ZIMA 1SESA 3OD1A 4ZIBA 2Q5IA 4NCXA 11ASA 3FJPA 4YDQA 4H2YA 4HWOA 5C51B 1ATIA 3PCOB 3L4GB 2CJAA 3P8YA 3LC0A 4HA8A 2DTHA 3VQWA 3V7SA 4TTVA 4K86A 3HXYA 2EAYA 1WQWA 1X54A 3HFVA 4EX5A 2ARTA 4DPGA 4H2TA 2E41A 1WQ7A 3HXWA 3RKYA 4Q15A 2DQ3A 4P71A
chains in the Genus database with same CATH superfamily
1KUQA 3FAVA 1VEWA 2EIKC 4NTYA 3U10A 1NVPB 4MTFA 5GTIZ 3QG5A 3EFRA 4OGQB 2QWQB 1VARA 1DLBA 2QHVA 5LXTA 1LUVA 3AK2A 3S3XA 4X9QA 5DEDA 4WJ3M 2G4CA 2YXYA 1N4CA 1WN7A 2Y0IA 1ZAUA 2K1EA 3RF1A 3ASOC 5J2UA 1I08A 3HRKA 4P3OA 1SZXA 3M4QA 3QO8A 1S77D 3F7YC 4UXNA 3TEHB 1HR0O 1WP8A 4YRLA 4J10A 1ZLZA 2L35A 3K79A 4X1YA 2RQ6A 5JCOC 2UUCO 1WNSA 4DR6B 3GWKC 3RVZA 3BHPA 3JASB 3E9HA 1VF6C 1YXBA 1VQ5V 2EBOA 2ZNIA 2DKGA 1JA8A 2IY5B 3OR6C 4OLFA 4X20B 1N32B 1XHXA 3C90A 1ENVA 2JK5C 2MK3A 4O4LA 2UU9B 3REXA 4H0LB 2X6BA 3ZHUA 1N9WA 1K8AW 1PM9A 4WFAV 2PUSA 3ABTA 3HKBB 3UM7A 4I50A 3P8VA 2QM4A 1WA8B 1EM1A 2Q7HA 3TXQA 5BR8O 1BL8A 4X64O 5E79Z 4H2XB 4K3AA 4YJ2B 3OEHG 2R9RB 2B9ZA 1R3JC 5FPRA 2LGQA 1NYRA 1US6A 3D36A 1I5YA 3CXCU 2BOBC 2EINB 4QNHB 1JMKC 1YZBA 3OMAB 3P3PA 2P90A 1WLEA 4P9OA 1NJ8A 2P67A 1EN4A 4B3TB 4OX9B 3E22B 1XBLA 3HKEB 4UCUA 3CC7V 3UO2A 2ZCEA 5KUMA 3BJUA 2HVKC 2V4DA 2VS0A 1VF6A 2CGOA 1Y76B 1ZUQA 2J3MA 3C3SA 4JYCA 1ZL8A 2XAFA 4PG3A 3CRRA 1QR9A 4GYCB 1KD1W 1H4VB 1G4YB 1SKVA 4FLXA 1V54C 2EZPA 3CC2V 1FJGB 2DQ0A 2ALYA 4Q6GA 1AJNA 2XGTA 3IAYA 2I4MA 3PZCA 3NEMA 4NVPA 4UCTA 1R73A 1HNXO 3TEGA 1XOUA 3MF1A 2R70A 2WLIB 4JTCB 4JI6B 4JZ2A 5LL6Y 4FZ0A 4JI7B 4C7UA 2BTQB 4YRTA 4IL6Z 3T2MA 1MABG 2YC0A 2JS3A 2Q4PA 4JI4B 1G5IA 3T1HB 4PA4A 3CCEV 2DZ9A 2Q5ZA 1AI5A 1R3LC 4LC1A 3GWOA 4MVOA 3RT3C 3ABMB 3LDCA 3CEIA 3STLC 3FFQA 3TK1A 3STZC 2Q7EA 1PYSB 2IJJA 3CWBH 3K0DA 2RHSA 3FAVB 1L8DA 2IW5A 1RPOA 3FB6C 1YFRA 2LW1A 1MZFA 3E8HA 3T4DA 1K33A 1PNMA 4QJFB 4DRXB 4U3JB 1TUBA 1HNZB 3F5TA 3BFRA 1FXKB 1I5XA 5CBGA 3NR7A 4I9WA 1Q81W 3TUPA 2Q68A 1DF4A 1YFSA 2XTIA 4DR3O 2ZT9B 1TVKA 4LVIA 3RL6A 3AG4B 1VQNV 2EIJB 2DTIA 2VQFO 3ZMSA 3A74A 3REUA 3AG4C 1H2GA 5ELOA 2EL9A 1HNZO 4IGGA 3I5DA 3ASNC 2DW4A 1Q7YW 2IJHA 1VQZA 1JJCB 4D7SA 1G8MA 1GN4A 2QKCA 4X1YB 2E75B 1Y6XA 1L0WA 2VWJA 4HWSA 2QGNA 4IHJA 2ZT6A 5KMGB 3EHBB 2ARSA 4FLVA 2IY5A 2K9PA 3CS5A 3M8AA 4DV1O 3LDEA 1IURA 4ICGA 1GKFA 3UT5A 2WA4A 2ADQB 3C3TA 1CEZA 3J80N 5LYJA 4GZRB 4F6RB 1N0JA 2CTQA 2H3OA 4LF8B 4I55A 1YITV 4WFBV 2QSAA 3QO7A 1X4TA 3FYIB 4ZI7B 3WU2Z 5FPOA 5C8YA 1SQQH 2BTOA 4JAAA 5BMVB 4P3NA 2B5UA 4XTWA 1FJGO 1FFXB 3K08A 3KZIZ 1VF5B 5JJEB 4RAIA 2G38A 4CS3A 1EVLA 1MMMA 3ABKB 4CH3A 1EVKA 4J7JA 3ZHVA 4ZOLB 4JYBA 3K58A 1BCCH 4B3RB 4H2SA 2Z0AA 2WAMA 2AZ0A 3SYCA 1XMOO 4J15A 3CRCA 4OXSA 4D6TH 3QO5A 3A7AA 3JALA 4X62O 3HKCA 2EIKB 2RDCA 3BRCA 1SA0A 1R6KA 4FVMA 3QNEA 3K5OA 3OFNG 3RBZA 3OTOB 1L0LH 1AR4A 2CDYA 3FYEB 5EBWC 1H2MA 4PI2A 1P49A 4I4TA 1RIQA 4JI6O 2Y0PA 4X1IA 3I7FA 4XTYA 2Q0AA 2QA4V 2UUAO 2KQXA 4DUZB 5EC2C 2AKWA 5KHGA 3SYPA 4FFBA 4NXMO 2X6AA 4O2BA 2IBZH 5HFLA 5K1XA 4YY3O 3ML0A 4MTOA 1PKXA 1WB7A 1QVGU 2CH7A 1FXHA 4XTZA 4KR2A 3A7RA 1IXMA 3Q4HA 1RPRA 4LFAB 3IALA 5CA0B 2QDOA 4YCVA 3APQA 1H2KA 1NZ6A 3QVNA 4MVRA 1IVSA 4CBCA 4JGSA 2ZXFA 1WU7A 4BW5A 2WLJA 2XUMA 4JV5O 1B8AA 3EFFK 2UXNA 3IG2A 2NS6A 1RSOA 2YXLA 1B70B 4IYIA 1UJWB 1QLEB 5IJ0A 3L73H 4B08A 3B2EE 1XREA 1O9GA 4LVLA 5LA6B 1MSDA 2P7TC 4FK5C 4MT8A 2GBOA 1B7YB 1P7GA 1D2DA 2ZTGA 4LNSA 5DECA 3LSQA 1J95A 1XEQA 1PNLA 4H2VA 4UCSA 5LHIA 4X88A 4WI1A 4FJCC 3JCZA 4PA7A 4DK0A 1H38A 3R07A 2HJDA 4DV0O 4XEOA 1AVMA 1XNRB 2NLJC 4OPHA 3ETGA 5EIBC 4K0KO 1KU9A 3H1KH 3L9DA 3T1YB 4HWTA 1KB9F 2UUCB 2XHBA 3OTOO 4LWSB 2Q5IA 1M56C 4NCXA 4X62B 5EZYA 1BZKA 1XMQB 1QHTA 5E1AC 2YSUB 4H37A 2JGDA 2M6YA 3VQWA 2N04A 3TETA 4TTVA 3RVYA 1Z2GA 1F4MA 3CRAA 5IYZA 2CTWA 3D3QA 4DV3B 2Y69B 1QQCA 1M1KW 1WQ7A 3RKYA 5GONA 4MW8A 2HJFC 3AG7A 2CGNA 2ARUA 4R7CA 5H2FZ 3CRMA 1K97A 4DV7B 1EFWA 5LMUO 4JI3O 2VWKA 2YXHA 4CC6A 3G4SV 1AP6A 3V7RA 3EXAA 1I7FA 3TCUA 2DU5A 4CS2A 5KHIA 4FZ1A 2DJVA 2RHQB 1FXKC 3NETA 2DEQA 1JVMA 4TUYA 1X2GA 2GSMB 3O65A 3E35A 4I4TB 4XTVA 5J2UB 5IE9A 3P8TA 2AW9A 2ZXWB 1QR8A 3BA9A 2Q69A 4DV4O 1JQ0A 2ZZGA 3RYIA 1IX9A 1S5HC 5C52B 2AXTZ 3JAWA 1SF9A 3SJCC 4WBNA 4NXNB 4G85A 3OT7A 4PDRA 2CJ9A 4MTGA 4K8ZA 1FD9A 4DR7B 1RP3B 5EBLC 4HYOA 1MNGA 2R9AA 3DXRA 3F5WC 4LF7O 2ODRD 1M9NA 1GN3A 3W7TA 2RJZA 4PD4F 1OZ0A 4NXNO 1VQOV 2PTMA 4P73A 4H2XA 4GKKO 2PF4E 5IWAO 2P4KA 1OCCB 3J81N 4DUZO 1X56A 2JEXA 2GTSA 1X01A 3HTZA 2F4VB 2PYLA 2WPDG 4QIWF 3JATA 3DGEA 2A79B 1U96A 2BOCC 1BT8A 2DOSA 3K9AA 2ZNJA 1JFFB 2XT9A 3HFZA 2AGAA 1NTZH 1JOYA 1F51A 2EILB 4NKGB 1N32O 2Q6AA 1LYLA 4LVJA 4L87A 4O2AB 4UP9A 4X1KA 4B3RO 2LQTA 4BR6A 1H2NA 2QTOA 3NXSA 4P75A 1EFRG 1GGMA 4LNUB 2UUAB 2QWPB 2QHSA 2Z3YA 5HGQA 3CMQA 1QLNA 1V54B 4JTDB 4PA9A 1JJOA 3HKDB 2F95B 3ZEDA 3CCQV 4YYEA 4TV8A 2ZKOA 2UXCO 3L4GA 4O4HA 2DXTA 2WLLB 3ZMVA 5EZYB 1EQRA 5EIBD 1NJ6A 3JD0A 2A7WA 4ZI7A 2CGHA 2Q9LA 4DK1A 3GVMA 2QWOB 1MA1A 4U7NA 3AG3C 4RUEA 4UVCA 3HPLC 1HTTA 2Y69C 3BCCH 2Q7GA 3JD2A 2E64A 2CTPA 1R3IC 3M99B 5AG2A 5LGTA 4PDMA 2ZT7A 1H2LA 1NJ5A 4RQFA 1SERA 2ZT5A 3K0GA 1ASYA 1NTMH 4YRSA 4BIUA 3CJHB 3K3WA 4G27B 2P4VA 1N34B 4PHCA 2JGUA 3OAAG 2IU3A 4JI1O 1K9MW 4KL1A 4AQYO 3FB5C 4I9QA 1V55C 2OCCC 4PI0A 3R65A 1IBLB 2HP8A 1BBUA 3DSQA 2ATKC 4LH7A 5LHGA 3OD4A 2KB1A 3KKYA 4TWKA 1M93A 1WAZA 3JAKB 3UQ8A 5L3FA 1HXDA 3VQVA 2QHTA 4PELA 4QPJA 2H94A 2V7QG 4TOIA 1OHHG 5CA0A 4UP8A 4KHPB 4X20A 3E89A 3K5LA 1SS3A 1XL6A 1GRJA 3B40A 1J5EB 4EFBA 5IYDO 3UT5B 1HC7A 4UB8Z 3HXUA 4O4JB 1M56B 5KX5A 1EZJA 1K34A 1LR1A 3QTCA 1N36O 4YCUA 1YSCA 5EYPA 2BE3A 3T1HO 1GM8A 2AMCA 2ZDIC 5DN6G 2WLKA 2YEVB 3RYFB 4CZZA 1KP2A 3ZMZA 2ZD9A 4DV3O 3KG2A 4LF4O 1M5IA 5JJJB 1PNKA 4YPFA 1SC5B 1Q86W 1OCOC 2QKSA 2ZE7A 4EB6A 2HHHO 3SJAC 4B3MO 1AR1B 1AJPA 1NS1A 1OCOB 2XTAA 5D5QA 5KAIZ 3CCRV 2EIMC 3SYOA 4RQEA 3L74H 4MVZA 4TQDA 1NR1A 4JI4O 2E74B 4QE9A 4B3TO 1Q43A 2JDIG 3K5MA 3V8JA 4GKJB 4LF8O 1KMIZ 2NR5A 1KYOF 4N21A 5LXTB 5CMUA 4ABMA 5IY5B 4R50A 1Z7MA 3V8KA 3LDDA 4MTXA 4DV5O 1XNQB 1K92A 5LGUA 5B1BC 5B3SC 5B5EZ 2OTLV 4LVKA 3HKDA 2CJBA 4UV9A 2NN4A 4I0XB 1VQMV 1G5HA 4DR1O 4LF9B 1Z7NA 4RO2A 2PYJA 2WLIA 4JI1B 5L3CA 1EN5A 1R1BA 2P06A 2W6IG 2CH7B 4HWPA 2OYQA 1FYFA 3BPZA 1NR7A 3ZJZA 4DV4B 4GCZA 2DWEC 1VP7A 1BE3H 2ZR3A 3LNNA 3A5ZA 1Y74A 1D5NA 4DUYB 2EWNA 1WPXA 1PPJH 5CB4A 4FM1A 1TA8A 3FKSG 4YRKA 3RACA 2JEUA 3RGLA 1AILA 1YJWV 3MHHC 1KMNA 2ZE6A 4DRXA 3BY6A 1I0HA 3ABUA 4HVCA 2E10A 1HW7A 2ETNA 4K87A 5LP6C 4U3JA 1MG1A 1EN6A 2EX3A 1XQ8A 4PDLA 4Z1VA 2C8MA 1Y67A 2E65A 2RHQA 2JRIA 5L3DA 4NXMB 2IM9A 3UGQA 5LOVB 4JYAB 3CX5F 3SPHA 1WJZA 4DR6O 1WYDA 2CK3G 3AG1C 1VMGA 1UPGA 3IKLA 4EKWA 3OW2U 2CE4A 3APOA 3TGUH 1NU1H 4LFCO 3AK3A 1OCRB 2UU9O 2DMXA 1FS0G 2B1IA 1VQLV 2AHZA 1M90W 4XDJA 3VQXA 3RYIB 4JTAB 3EFSA 3A31A 3A2FA 3I56V 3GB7C 2HLDG 1JCHA 2F43G 4HT4A 2GTAA 1VIBA 2N74A 3CMEV 1BBWA 1KOGA 4JYYA 3ZCCA 2QHUA 3P30A 4P30A 2LFSA 1SESA 2RN9A 3ABLB 4WFHA 1FFTB 5GW7A 4E2LA 2YIDA 4J9ZB 3ZHRA 3PCOB 4GUNA 4LF5O 2CJAA 5LP6A 2DTHA 3V7SA 1GK9A 4KP4A 4K86A 3K04A 4UCRA 2ARTA 1Q8IA 2WA3A 2EJRA 1IBKO 1CP9A 1Q6IA 4H2TA 3W7UA 3E83A 1Q82W 4DO2A 4DR1B 3SPCA 3SYQA 4Q15A 1THZA 4P71A 5GONB 4DR4B 4DR5B 3RYCB 4UUJC 4AH6A 3ETDA 4TV9B 1E22A 2XAJA 3ZMTA 4DYLA 4JI0B 3NENA 3IC7A 2LJ2A 5L3EA 3E2EA 4H2WA 2PMFA 5ITZA 2LW7A 2R9IA 1RM1C 5KNNA 3N2KB 1URFA 4NR1A 4XTUA 2ZM6B 4X65O 1GH6A 4XU0A 5BZBA 4X1IB 1FXVA 1EBOA 3EVKA 4JPRA 3ETQA 2HKOA 4TV8B 1BIAA 1O9HA 4YRCA 2F1MA 1I94B 2AKWB 4KXRA 1BSMA 4GX5A 4O2DA 1V55B 2OCCB 1M4UA 1FYJA 4ZHQB 4EO4A 2FL4A 3JAMN 4JV5B 4K88A 1NT2B 4D7TA 3Q4HB 2EJ9A 1EIYB 3H1JH 1XILA 4O4LB 4TVWA 1L1FA 3ZRWA 3IKMB 5H9CA 2E5LB 3PN1A 1N33B 3ASOB 3CSXA 1S3JA 3DXRB 4FIPC 4IT5A 4J42A 1E24A 5JH7B 2DZCA 2GUZA 5KA5A 5LGNA 3CCLV 1XUQA 4RUFA 4AI8A 5CA1B 4TWAA 1NBMG 3H01A 4J7ZA 1NJ1A 4IIJB 1QCEA 4YRJA 2C2AA 1B70A 4B3MB 3ZHQA 1M57C 2RMKB 3AG1B 5FNVA 2EULA 1ORQC 4UPAA 1M57B 2EJ7A 3UO3A 1PL0A 2NNUA 2DYSB 1F7YA 2P22C 5IDJA 3E8FA 1NH2D 4J80A 4G28B 2KKWA 3RWRD 4LF6B 1XNRO 5B1BB 1X55A 1ZWIC 3E9IA 3OMNB 4PHZA 2QWRB 1HNWB 3IGAC 3X2QC 3JARA 3X2QB 4B3SB 5CA3A 2Y4TA 2Z5UA 4QGPA 2QEXV 3BVOA 1BMFG 1SA0B 1NKDA 3ZHTA 4ASUG 2DE0X 4YJ3B 2PI5A 1COWG 1SQVH 4LF7B 2UXBO 1E1TA 2YS8A 3F7VC 2C7IA 4LWSA 3ZIAG 3KCXA 2WLHA 2ALYB 4DV6B 2FB5A 2YICA 2QR4A 3VOUA 5LYJB 3U11A 4GKJO 3G71V 4DV0B 1QE0A 3AG2C 1YB3A 3OEEG 2F4VO 4I7ZB 1FPOA 4LP8A 2HG5C 2VQEO 5E3IA 3RKXA 2E5LO 1DK1A 4MSWC 2JGDB 4KQEA 4Q20A 4BAYA 1BHBA 5LMUB 3AG3B 4X64B 2CAZC 4X66O 3JYCA 4EB6B 1L0NH 5IYZB 3SPIA 4EEQA 2R72A 3RYHA 4JZGA 4FM0A 3ASNB 3S3WA 3HKBA 1OCRC 1WB8A 1RFYA 2XNDG 3IFXA 4LBEC 5A9GA 2ZIOA 5HFMA 3QF7A 1RM1B 2I4LA 5CBFA 5J2TB 2QE7G 4FLUA 1DF5A 1YVWA 4BW9A 1JR9A 3L71H 1E1QG 1ZTEA 5IJ0B 2I4NA 4P2ZA 4YY3B 4NTXA 1E1OA 5EBMC 4TUYB 1HR0B 2ITCC 3THOA 3ABLC 4DR2B 1S5JA 2JS5A 5EC1C 1J5WA 3RKWA 2WLMA 2UXBB 3LNMB 1SRYA 2Y48A 3PJSK 3ZN0A 4LF6O 2A0LA 3RN4A 4ZBMA 1R3KC 3BFMA 3ERRA 2PI4A 4W4LA 3JASA 3OM3B 1XDCA 3OGCC 3ZRXA 1N33O 3RGBA 4YRGA 2IJIA 3TJTA 2DVEA 3SR2C 2KG7B 2WWWA 1QU7A 3WQZA 5A2QN 3JSLA 2ZINA 3H1LH 3U0ZA 4FMTA 2GV9A 4FPPA 1G6UA 4BWAA 3T1YO 2PGGA 1NYQA 3OGIB 5CN0A 3UH0A 1WA8A 4O4JA 1MZEA 2GDSA 3MF2A 4PDVA 1KQSU 3KCYA 3A32A 4YIOA 2ZZFA 2DYSC 5IY5C 4IIJA 4XU3A 1IL2A 3WB1A 1Y66A 1FFXA 1SQPH 1P84F 5H5NA 5JVDA 2OT5A 1IBLO 2IU0A 3A7UA 1HP8A 3ZX6A 1W2BU 4UVAA 2X7RB 1NJIW 1NTKH 1LNQA 3T1CA 5IJ9B 5GTHZ 4GKKB 1GTOA 2X6CA 3E22A 1TGOA 2BSKA 3CCUV 1B76A 4XU1A 2DN9A 4L8JA 1X59A 4X65B 4K0KB 3H1HH 4LCUC 4LR3A 3L2ZA 1FKAO 1TUBB 1AI7A 3P3NA 1IBMB 2LGWA 1BQZA 4DR7O 3K59A 2PZSA 2E5AA 1I94O 1UFIA 1MOFA 4YRNA 2Q8VA 2P0LA 2RNBA 1K5QA 4OPAA 1NJ2A 1YDXA 1OCZB 2OWOA 2PMEA 5C93A 4TT3G 2VQEB 4LFBB 1OCZC 3AK1A 4LFAO 3D8CA 1IBMO 3VBBA 4NYKA 3SGIA 2CTRA 4J7KA 4I0XA 4JI5O 2X0LA 4U3FH 5LP6B 4LVMA 1JJCA 1SZTA 2LFRA 2Q0OC 4KFMA 2ZZEA 3MQZA 1Y4MA 4MVSA 4HZ3A 1X2HA 2UXDO 4MS2A 5C53B 4K8XA 4YROA 4PA6A 3HR0A 1TAEA 5F2VO 2AZ2A 2XASA 1U97A 2AHYA 3ZS8C 5LMNO 3A0HZ 5EK0A 1S5LZ 3W7WA 1ROPA 4G84A 4UVBA 4IYHA 4JI2O 2EILC 2DWDC 2QTSA 1B3QA 1K7DA 4DV1B 1W0KG 3G80A 2WLNA 1IXBA 4H13B 5ELNA 1XMOB 1N0NA 4ZTZB 1KKCA 4N23A 1TVKB 4CH5A 2CUGA 5JQGA 4OX9O 3E8BA 1W59A 4DV7O 2N05A 5LOVA 5LA6A 3ICAA 4QPKA 3T4ZA 2XAGA 1GO3F 4O4IA 5H6RA 3A8TA 3HXXA 4YRMA 1B7YA 5JJNB 2UUBO 3CCVV 1VQPV 3ZHSA 3AG2B 3B09A 4YREA 1KKDA 3K06A 5FLXN 1P7BA 4KR3A 3JALB 3HKCB 2ODRC 4ZHQA 1BGYH 2OIGA 4PA3A 1B04A 1ZL8B 2B1GA 5KMGA 12ASA 3IC9A 1K5SA 1PP9H 2V1DA 3ZRWB 3OD1A 4ZIBA 3WG7B 3CCMV 4BIOA 1H2SB 11ASA 1BS3A 2JIZG 1AB3A 3CMAV 4YDQA 5C51B 3N2GB 2FKXA 3CRQA 1S0VA 3P8YA 1VQ6V 3LC0A 1NI8A 2LP7A 4F4LA 2JJ1G 4DW0A 4Z1MG 3HXYA 2EAYA 4LFBO 1X54A 3HFVA 1JPXA 2E41A 5D5PA 1YHQV 3HXWA 4JI7O 5B1AC 4QE7A 2DQ3A 1N8RW 2ZE5A 1XI1A 1GMGA 1JFFA 4YHHO 3HFZB 5KHHA 2YDEA 1YTFD 2RHSB 3A5YA 4XTXA 4WCEV 1WNLA 3UGTA 4TV9A 2O57A 5JCOA 4B7KA 5KAFZ 4B7EA 2XAQA 2DDZA 2LO1A 4P74A 4JF3A 4JI3B 3AEIA 4LF5B 3OR7C 4HNAB 1AP5A 1VQ4V 3DC5A 4FM2A 1AROP 4CS4A 4X5OA 4YRFA 3N2KA 5B1NA 4GX0A 2ODMA 1WP7A 1LUWA 1BQ0A 2JJ2G 3M7MX 3TEHA 2MW2B 2F93B 2WSSG 1JX9A 3ETEA 4FFBB 2UXDB 1G1XB 4DR3B 3BABA 1OCCC 4RMFA 4WF2A 2QKAA 3B8NA 1AR5A 2HR3A 4IHJB 1H4QA 1Q3EA 3D36C 3JD1A 3W7SA 3FB7C 1WPYA 1VQKV 3W7XA 1EIYA 4ZKIA 1BHAA 1SETA 2W6JG 3NELA 3G6EV 5JWPA 3RUXA 2HVJC 3ICXA 4MVMA 5CB4B 3B8MA 1HDJA 1NQTA 2EZOA 4J9YB 3CC4V 3B4SA 3RW0A 4I50B 4F6RA 3W3SA 4JAUA 2Q67A 5IWAB 4I55B 1QBZA 3A0BZ 4MVQA 2CIMA 5KX5B 4RWUA 4A5UB 3I55V 4YJ2A 1ADJA 4HWRA 4UB6Z 5C8YB 3WFVA 1VF7A 3ZN1A 5BMVA 1BIBA 1JJ2U 1H4SA 2OIEA 2AMCB 4P74C 3HXVA 4DV5B 3CP1A 2A06H 3SPGA 2EJGA 1N36B 3CHXA 1IDSA 5FNVB 1F23A 4G2KA 3DTUB 4TSFG 4X8AA 1P4RA 2QWNB 4J11A 5B3SB 4BIZA 2KSDA 3SJBC 4CC5A 4WFFA 2ZQMA 4FLZA 1W0JG 1TUEB 4WFGA 5KHJA 2VQFB 4ZTUB 2YIBA 1VQ9V 1ZSPA 1H8EG 3SPJA 1GAXA 4EFEA 3G6BA 2IH3C 4MW3A 1G51A 4LNUA 1D5AA 1AJQA 3E8GA 4X1KB 3BA8A 3RFRA 4LH6A 3WB0A 4UFZA 3CPWU 2UXCB 1HWYA 4XEMA 3V8LA 2L6LA 2ITDC 4LF4B 5BR8B 3CE2A 2E1HA 2QM7A 3OUSA 4DQ2A 3PCOA 1IBKB 2IJKA 2DYRB 1OJHA 4UV8A 2FMLA 2XAHA 3N2GA 2DYRC 3L1AA 4K35A 2E3CA 4YP0A 4H44B 4O2BB 1SQBH 2YEVA 3RYFA 4GX2A 2PY5A 3CXHF 2UUBB 4AILC 3JAWB 1T5EA 1DTOA 4JI2B 5B1AB 1Q6UA 3UKMA 1GN2A 4NB5A 1C0AA 2Q5HA 2HEPA 3ZRSA 3ZMUA 1KBHA 1YI2V 5K1PA 1YEWA 2BSKB 1KC8W 3J7AU 5F5WA 3L72H 2A3QA 3V7CA 3RYCA 4E4EA 3D3IA 1B6QA 3KFUA 1USYC 2HHHB 2UXXA 2YIBD 2QJ1A 3LSSA 3MHSC 5J2TA 4AQYB 1HNXB 1PV0A 4E51A 4Z2WA 4DW1A 3JD3A 1YGBA 1E1RG 3OMIB 3UCSC 4NTWA 3WB2A 2P6JA 1YJNV 3WG7C 2W0FC 1KP3A 4F6EA 5LBQA 3H1IH 1XHZA 4R8CA 3IJ4A 1ZX3A 3SYAA 4DV2O 1S76D 4P9PA 4XBFA 4TVAA 4HAMA 3G67A 3JSNA 2BCCH 4DR2O 4P73C 1H4TA 3VQYA 3UFGA 2DXUA 1GM9A 1MSWD 4LFCB 2D2CB 4DUYO 2ZR2A 5J9PC 3CD6V 3SJQC 2ADPA 4HBNA 3BAAA 4DR4O 4YRIA 2F66C 3L70H 4I5SA 4PV1B 1ADYA 4YXWG 2DTOA 4W4KA 2DU7A 2EJFA 4PJ0Z 3OTFA 2I4OA 3JD4A 1Z5VA 2ZXWC 2RCVA 2FTKA 1SQGA 1IZ3A 4O4HB 5IT9N 1YF2A 2GHYA 4OP0A 2P5IA 4DXWA 5CA1A 4JYAO 1SQFA 2BTQA 2EINC 5L3BA 3HRIA 3LUTB 2ARHA 3CCSV 4DV6O 4JI5B 1NH2B 3HXZA 1S72V 4YRPA 3L75H 4TVYA 2XOKG 4GT1A 1R6TA 5JQGB 3FD9A 4JI8B 3JATB 2QM8A 5JVDB 2E76B 5TISZ 1EOVA 1SQXH 4TQFA 2YUAA 4FLTA 1KECA 2F23A 4CH4A 2HNIA 2YI8A 4J41A 1PYSA 4MVUA 5B1OA 4YRRA 3FB8C 1K3EA 3JARB 2OCHA 1Q90D 1NNHA 4P3PA 4P72A 1FXKA 2W0XA 3BEHA 1K4DC 5L3GA 2HFEC 3P32A 3B77A 3H9VA 1NVPD 1XNQO 3HY1A 5LHHA 1QNMA 4GLXA 2P5OA 4YJ3A 3N27A 2ZGWA 1HNWO 4FFKA 4YIPA 3DC6A 4RDXA 1YJ9V 1B06A 5KHKA 4P71C 4WFEA 3MD0A 2H8PC 2EIMB 1AI6A 5BY1A 4H2UA 3R66A 1YCIA 3JAKA 4UCVA 1F4NA 3O9OA 1A32A 3MDSA 2IH1C 1EZVH 4YRQA 3ABMC 4WBNB 3CB2A 1GM7A 5IYBO 4UP7A 3ZRVA 5LMNB 3TXSA 1QF6A 1YIJV 1Y74B 2ZT8A 3HY0A 3RYHB 1Z5WA 4FLWA 3K9SA 1GN6A 5BXZA 2FYUH 1CXZB 2DJZA 1W66A 4KHPO 5JH7A 2JVDA 1QVFU 5EYPB 3CJHA 4P72C 4XDLA 5KA6A 4X66B 3OUFA 1E79G 5DM6V 1RSOB 1CPYA 1WPBA 5ITZB 1V9PA 2ZM6O 3OE7G 1XMQO 1J5EO 1YFTA 4HNAA 1K4CC 3CCJV 1K73W 4XU2A 3MAQA 4WJ4A 3M4PA 3K57A 3HB3B 2OTJV 2ILMA 4FLYA 5CBHA 3MEYA 4AHCA 4CH6A 3G1ZA 3A0RA 4ZOLA 1VQ7V 2D3OW 4O4IB 1KMMA 1YTFB 4H02A 3HKEA 4U7OA 4YCWA 1DGSA 2J3LA 3K5NA 2FYKA 2ZDIA 4TVAB 1Y76A 4JI8O 1ASZA 2M7WA 1USYA 1H8HG 2YI9A 4YHHB 4P75C 4O2AA 4DR5O 2ZE8A 3E86A 3JCUZ 4H33A 4KUMA 4WF9V 4GX1A 3FX7A 5H6QA 5FL7G 4LF9O 2KG7A 3RIRA 1QLEC 2ZIMA 4UCOA 4X89A 2EIJC 5IYCO 1N34O 5KUKA 2Y4UA 3SDLA 3FJPA 4H2YA 4HWOA 3ZBHA 2WLLA 1ATIA 3K03A 2GUZB 3L4GB 2VRZA 1XL4A 1Q5OA 3LSUA 2Q73A 1PL4A 4R6ZA 4HA8A 5KLVH 1OV9A 2A9HA 4JAVA 4DV2B 1PD3A 1WQWA 1AI4A 3CYOA 3ABKC 4XDKA 4EX5A 4DPGA 1R6NA 1FAFA 5IJ9A 4JASA 4B3SO 1VQ8V 1Q6HA 5B66Z 2A8EA 2YIAA 4JI0O
chains in the Genus database with same CATH topology
1GMGA 4R7CA 2ARUA 2EIKC 4UUJC 3HFZB 1YTFD 2RHSB 3A5YA 1K97A 1EFWA 4AH6A 3ETDA 1NVPB 4XTXA 4MTFA 3G4SV 1E22A 4WCEV 2XAJA 3ZMTA 1WNLA 3UGTA 3V7RA 3NENA 3IC7A 3EFRA 5L3EA 2XAQA 3E2EA 2DDZA 3TCUA 2PMFA 4H2WA 1DLBA 2QHVA 2DU5A 4P74A 4JF3A 4CS2A 3AEIA 2R9IA 1RM1C 3OR7C 2RHQB 5KNNA 1FXKC 1VQ4V 1AROP 4CS4A 3NETA 2G4CA 4X5OA 4YRFA 4WJ3M 2DEQA 1JVMA 2K1EA 2GSMB 1X2GA 5B1NA 3RF1A 4XTUA 4GX0A 3ASOC 3E35A 4XTVA 4XU0A 5BZBA 3HRKA 3P8TA 4P3OA 2JJ2G 2ZXWB 1FXVA 1EBOA 1QR8A 4JPRA 3TEHA 2HKOA 2Q69A 3M4QA 3QO8A 1S77D 3F7YC 4UXNA 1BIAA 3TEHB 4YRCA 2WSSG 1JQ0A 1JX9A 3ETEA 4YRLA 2ZZGA 2AKWB 4GX5A 4O2DA 1V55B 2OCCB 1OCCC 3K79A 4RMFA 1S5HC 4WF2A 3B8NA 2HR3A 3RVZA 5C52B 4EO4A 4K88A 3E9HA 1H4QA 1VQ5V 3JD1A 3W7SA 2EBOA 3FB7C 2EJ9A 1EIYB 2ZNIA 1WPYA 2DKGA 1VQKV 3W7XA 2IY5B 3OR6C 4G85A 4ZKIA 1BHAA 4OLFA 4TVWA 1EIYA 1SETA 1L1FA 1ENVA 2JK5C 2MK3A 2W6JG 3REXA 3NELA 3G6EV 2X6BA 4PDRA 2CJ9A 3RUXA 3ZRWA 2HVJC 4MTGA 4MVMA 3IKMB 3B8MA 1NQTA 5EBLC 1N9WA 4HYOA 2EZOA 5H9CA 4J9YB 1K8AW 3CC4V 4WFAV 3RW0A 3F5WC 3ASOB 3ABTA 3UM7A 4JAUA 2ODRD 2Q67A 3W3SA 1M9NA 1S3JA 4FIPC 1QBZA 4MVQA 3W7TA 1E24A 2CIMA 3P8VA 2DZCA 1ADJA 5KA5A 5LGNA 3I55V 3CCLV 1OZ0A 2Q7HA 1BL8A 4HWRA 4RUFA 3WFVA 4H2XB 1VQOV 4TWAA 3ZN1A 4P73A 3OEHG 1BIBA 1NBMG 1JJ2U 3H01A 4H2XA 1NJ1A 1H4SA 2R9RB 2AMCB 1OCCB 1QCEA 4YRJA 4P74C 2C2AA 3HXVA 1R3JC 1B70A 1X56A 3CP1A 3SPGA 2JEXA 1NYRA 2EJGA 1M57C 1X01A 3D36A 1I5YA 3CXCU 3AG1B 3HTZA 2BOBC 2EINB 4QNHB 1ORQC 4UPAA 1M57B 3OMAB 2WPDG 1F23A 1PL0A 2NNUA 2DYSB 2P90A 4G2KA 1WLEA 4P9OA 4QIWF 5IDJA 1NJ8A 2P67A 3L1AA 3DTUB 3E8FA 2A79B 3DGEA 4TSFG 4X8AA 1NH2D 1P4RA 4G28B 2BOCC 5B1BB 1X55A 1ZWIC 3E9IA 3OMNB 5B3SB 4BIZA 3K9AA 2ZNJA 4WFFA 2ZQMA 3HFZA 1W0JG 3IGAC 3X2QC 1TUEB 4WFGA 3CC7V 1JOYA 4ZTUB 5KUMA 3X2QB 2ZCEA 3BJUA 5CA3A 1F51A 2EILB 2HVKC 2Q6AA 2Z5UA 1VQ9V 2QEXV 1LYLA 4LVJA 1BMFG 1H8EG 1NKDA 3SPJA 4L87A 2J3MA 2IH3C 4ASUG 4JYCA 4MW3A 4UP9A 1G51A 2XAFA 4PG3A 1QR9A 2QTOA 2PI5A 1AJQA 1COWG 3E8GA 1EFRG 3NXSA 1E1TA 1GGMA 1KD1W 4P75A 1H4VB 1G4YB 3F7VC 2QHSA 2Z3YA 1V54C 2EZPA 2C7IA 3CPWU 3CC2V 1HWYA 5HGQA 3ZIAG 3CMQA 4XEMA 3V8LA 2ITDC 1QLNA 2DQ0A 1V54B 4JTDB 4PA9A 2ALYA 2WLHA 2E1HA 2QM7A 3OUSA 4Q6GA 1AJNA 2ALYB 2XGTA 4DQ2A 3VOUA 3CCQV 2I4MA 4YYEA 3PZCA 3NEMA 3PCOA 3G71V 2IJKA 2DYRB 4UV8A 1QE0A 3L4GA 2XAHA 1R73A 2DXTA 3AG2C 2WLLB 3TEGA 3ZMVA 3MF1A 2DYRC 2WLIB 1EQRA 1YB3A 3OEEG 1NJ6A 4JTCB 2E3CA 3JD0A 4LP8A 2CGHA 2HG5C 4YP0A 5E3IA 3RKXA 4MSWC 4YRTA 2YEVA 4KQEA 4GX2A 4Q20A 3T2MA 4U7NA 4BAYA 3AG3C 1MABG 4RUEA 3HPLC 4UVCA 1BHBA 1HTTA 1DTOA 2Y69C 3AG3B 1G5IA 2DZ9A 4PA4A 3CCEV 3JYCA 2Q7GA 5B1AB 1AI5A 1R3LC 3JD2A 4LC1A 2E64A 3UKMA 3GWOA 4MVOA 1R3IC 3ABMB 1C0AA 2Q5HA 3M99B 3LDCA 3SPIA 4PDMA 5LGTA 2ZT7A 3ZRSA 3ZMUA 3STLC 3TK1A 3ASNB 3STZC 2Q7EA 1NJ5A 4RQFA 1OCRC 1YI2V 2IJJA 3K0DA 1KC8W 1PYSB 1SERA 2RHSA 5F5WA 5K1PA 2ZT5A 3K0GA 2XNDG 3IFXA 4LBEC 3V7CA 1ASYA 2ZIOA 5HFMA 3FB6C 2IW5A 1YFRA 1RPOA 3E8HA 3T4DA 3VQYA 1K33A 3D3IA 1PNMA 4BIUA 4QJFB 4YRSA 1B6QA 3KFUA 1RM1B 1USYC 3K3WA 4G27B 1FXKB 2I4LA 1I5XA 2UXXA 5CBGA 5CBFA 2QE7G 4I9WA 1Q81W 1DF5A 3LSSA 3MHSC 4BW9A 4E51A 3TUPA 4PHCA 2Q68A 1DF4A 3OAAG 1E1QG 1YFSA 2XTIA 2IU3A 2I4NA 3JD3A 4P2ZA 1E1OA 5EBMC 1E1RG 3OMIB 1YGBA 1K9MW 4LVIA 2ITCC 3RL6A 3AG4B 2P6JA 1VQNV 1YJNV 2EIJB 3ABLC 3WG7C 2DTIA 2W0FC 3ZMSA 3A74A 3REUA 3AG4C 1H2GA 5ELOA 1KP3A 3FB5C 5EC1C 5LBQA 2EL9A 1J5WA 1V55C 2OCCC 4R8CA 3RKWA 2WLMA 3R65A 3LNMB 1SRYA 1BBUA 2Y48A 3PJSK 2ATKC 3SYAA 3ZN0A 3DSQA 3ASNC 5LHGA 1S76D 2KB1A 2DW4A 4P9PA 1Q7YW 4TWKA 4XBFA 4TVAA 4HAMA 2A0LA 2IJHA 1VQZA 4P73C 5L3FA 4ZBMA 1G8MA 1JJCB 1H4TA 1HXDA 2QHTA 3UFGA 1R3KC 3BFMA 3ERRA 3VQVA 2PI4A 2DXUA 1GM9A 1MSWD 3OM3B 4PELA 2ZR2A 4QPJA 5J9PC 2H94A 3CD6V 1L0WA 3OGCC 3SJQC 4HWSA 2V7QG 3ZRXA 1OHHG 2ZT6A 4YRGA 2IJIA 3EHBB 2ARSA 2DVEA 4UP8A 4YRIA 2IY5A 2WWWA 3E89A 4I5SA 3LDEA 1XL6A 1ADYA 4YXWG 2DTOA 3WQZA 1GKFA 2DU7A 2ZINA 4FMTA 5IYDO 2EJFA 4FPPA 2I4OA 1HC7A 1CEZA 3JD4A 2ZXWC 4BWAA 3HXUA 1NYQA 1M56B 5CN0A 3UH0A 1EZJA 2FTKA 1K34A 3QTCA 3MF2A 2GHYA 4OP0A 1YITV 4YCUA 4WFBV 2P5IA 1YSCA 4DXWA 4PDVA 3QO7A 1KQSU 3FYIB 1GM8A 2AMCA 2ZDIC 5DN6G 2EINC 2WLKA 2YEVB 4CZZA 5L3BA 1KP2A 3ZMZA 3A32A 3HRIA 2ZD9A 3LUTB 2B5UA 2ZZFA 4P3NA 2DYSC 5IY5C 3KG2A 3CCSV 4XTWA 4XU3A 3K08A 1IL2A 1Y66A 1PNKA 1NH2B 3HXZA 1S72V 4YRPA 4RAIA 4YPFA 4TVYA 2XOKG 4GT1A 2OT5A 2IU0A 1Q86W 2QM8A 3A7UA 1OCOC 2QKSA 4CS3A 1EOVA 1EVLA 1W2BU 3ABKB 4UVAA 2X7RB 1AJPA 1OCOB 1AR1B 1NJIW 1EVKA 4TQFA 4CH3A 1LNQA 3T1CA 4H2SA 4JYBA 1KECA 4CH4A 2WAMA 2HNIA 3CCRV 1GTOA 2EIMC 2X6CA 3SYOA 4RQEA 3SYCA 1PYSA 3CCUV 4MVUA 4MVZA 1B76A 4J15A 5B1OA 4TQDA 1NR1A 4OXSA 4XU1A 3QO5A 4YRRA 3A7AA 4LCUC 4QE9A 3FB8C 2EIKB 3L2ZA 1K3EA 1R6KA 1AI7A 1NNHA 4P3PA 1FXKA 3QNEA 4P72A 2JDIG 3BEHA 3OFNG 3RBZA 3V8JA 1K4DC 5L3GA 2HFEC 3P32A 3B77A 2E5AA 1NVPD 1MOFA 4N21A 5CMUA 4YRNA 3HY1A 5IY5B 5LHHA 3FYEB 2P0LA 5EBWC 4R50A 1Z7MA 1K5QA 3V8KA 1NJ2A 2ZGWA 1OCZB 1RIQA 2PMEA 5C93A 3LDDA 4MTXA 4TT3G 1K92A 5LGUA 3I7FA 1OCZC 4RDXA 1YJ9V 5B1BC 4XTYA 5B3SC 2OTLV 4P71C 4LVKA 2QA4V 4WFEA 3VBBA 5EC2C 2AKWA 2CJBA 4UV9A 3MD0A 2H8PC 2EIMB 1AI6A 3SYPA 1VQMV 1G5HA 4H2UA 1Z7NA 2X0LA 2X6AA 4RO2A 5HFLA 5K1XA 1JJCA 1SZTA 2LFRA 2WLIA 5L3CA 4LVMA 3ML0A 4KFMA 4MTOA 1F4NA 1PKXA 1QVGU 2ZZEA 3MQZA 1Y4MA 4MVSA 1FXHA 2W6IG 4HZ3A 1X2HA 4HWPA 2IH1C 1FYFA 4MS2A 4XTZA 3A7RA 1IXMA 3ABMC 4YRQA 5C53B 4KR2A 1RPRA 1GM7A 3IALA 1NR7A 5IYBO 3ZJZA 4GCZA 2DWEC 4PA6A 4UP7A 4YROA 4YCVA 2ZR3A 3ZRVA 3A5ZA 1QF6A 4MVRA 1YIJV 2EWNA 1WPXA 4CBCA 2ZT8A 4JGSA 3HY0A 2ZXFA 1WU7A 2XASA 4BW5A 2DJZA 2WLJA 2AHYA 3FKSG 3RACA 4YRKA 1W66A 2JEUA 1B8AA 3RGLA 3EFFK 1YJWV 3MHHC 1KMNA 2UXNA 3IG2A 5EK0A 3W7WA 3BY6A 1ROPA 3ABUA 1QVFU 4G84A 4UVBA 4P72C 4XDLA 5KA6A 2EILC 3OUFA 4HVCA 1E79G 2E10A 5DM6V 2NS6A 2DWDC 1CPYA 4K87A 1MG1A 1K7DA 1W0KG 4PDLA 2WLNA 1B70B 3OE7G 2C8MA 5ELNA 2E65A 1UJWB 1QLEB 1YFTA 1K4CC 2RHQA 4ZTZB 4N23A 5L3DA 3CCJV 1K73W 4CH5A 4XU2A 3UGQA 4LVLA 4WJ4A 3SPHA 3M4PA 3E8BA 3HB3B 2P7TC 1WYDA 2CK3G 3AG1C 4FK5C 4MT8A 2OTJV 3ICAA 4QPKA 3T4ZA 5CBHA 3MEYA 3IKLA 4EKWA 3OW2U 4CH6A 3G1ZA 2XAGA 1GO3F 5H6RA 3A0RA 1VQ7V 2D3OW 1B7YB 3HXXA 2ZTGA 1OCRB 1KMMA 1YTFB 1B7YA 4H02A 4LNSA 4YRMA 3LSQA 1J95A 1FS0G 2B1IA 1VQLV 3CCVV 1PNLA 2AHZA 1M90W 4U7OA 4XDJA 1VQPV 4H2VA 4YCWA 3AG2B 3VQXA 4JTAB 4YREA 3EFSA 5LHIA 1KKDA 4X88A 2J3LA 3K06A 3A31A 1P7BA 3I56V 3GB7C 4KR3A 2FYKA 2HLDG 2ZDIA 1JCHA 4TVAB 1ASZA 4WI1A 4FJCC 2M7WA 3JCZA 4PA7A 2ODRC 1H38A 2F43G 1H8HG 1USYA 3R07A 3CMEV 4PA3A 1BBWA 4P75C 4HT4A 4XEOA 1KOGA 2NLJC 3E86A 4H33A 2B1GA 4KUMA 4WF9V 4GX1A 3ETGA 12ASA 3ZCCA 5H6QA 5FL7G 3RIRA 1QLEC 2QHUA 3P30A 1K5SA 2ZIMA 4P30A 2LFSA 4HWTA 1SESA 2V1DA 3ZRWB 3OD1A 4X89A 4ZIBA 2EIJC 3ABLB 4WFHA 3WG7B 1M56C 5IYCO 3CCMV 2Q5IA 1FFTB 4NCXA 5KUKA 5GW7A 2JIZG 4E2LA 3CMAV 3FJPA 11ASA 4YDQA 4H2YA 4HWOA 5C51B 2WLLA 4J9ZB 1ATIA 3PCOB 3K03A 3L4GB 1XL4A 1S0VA 2CJAA 3P8YA 1VQ6V 4R6ZA 5E1AC 3LC0A 4HA8A 2YSUB 2DTHA 4H37A 2A9HA 2LP7A 3TETA 3VQWA 3V7SA 4JAVA 4TTVA 4F4LA 2JJ1G 4Z1MG 1GK9A 4KP4A 3RVYA 4K86A 3HXYA 2EAYA 1PD3A 1WQWA 1AI4A 3CYOA 3K04A 3ABKC 1X54A 4XDKA 3HFVA 2ARTA 4DPGA 4EX5A 2EJRA 1F4MA 1CP9A 4H2TA 1JPXA 3W7UA 1R6NA 3E83A 2E41A 2Y69B 1Q82W 1YHQV 4DO2A 1M1KW 1WQ7A 3HXWA 3RKYA 4JASA 5B1AC 3SPCA 3SYQA 4MW8A 1VQ8V 2HJFC 2DQ3A 4QE7A 2A8EA 1THZA 4P71A 4Q15A 1N8RW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARU A;  3HFZ B;  2RHS B;  3A5Y A;  1EFW A;  4AH6 A;  4XTX A;  1E22 A;  1WNL A;  3UGT A;  3V7R A;  3NEN A;  3EFR A;  2DDZ A;  4H2W A;  2PMF A;  2QHV A;  2DU5 A;  4P74 A;  4CS2 A;  2RHQ B;  5KNN A;  4WJ3 M;  4CS4 A;  3NET A;  2G4C A;  4X5O A;  4YRF A;  2DEQ A;  1X2G A;  3RF1 A;  4XTU A;  4XU0 A;  4XTV A;  3HRK A;  3P8T A;  4P3O A;  3TEH A;  3M4Q A;  3QO8 A;  1BIA A;  3TEH B;  4YRC A;  4YRL A;  2ZZG A;  2AKW B;  4O2D A;  4RMF A;  4WF2 A;  5C52 B;  4EO4 A;  4K88 A;  3E9H A;  1H4Q A;  2ZNI A;  2EJ9 A;  1EIY B;  1WPY A;  2DKG A;  2IY5 B;  4G85 A;  1EIY A;  4OLF A;  4TVW A;  1SET A;  3REX A;  3NEL A;  2CJ9 A;  3RUX A;  3IKM B;  1N9W A;  3W3S A;  2ODR D;  1E24 A;  2CIM A;  3P8V A;  2DZC A;  1ADJ A;  2Q7H A;  4HWR A;  4H2X B;  4TWA A;  4P73 A;  1BIB A;  4H2X A;  1NJ1 A;  1H4S A;  2AMC B;  4YRJ A;  4P74 C;  3HXV A;  1B70 A;  1X56 A;  1NYR A;  2EJG A;  1X01 A;  3HTZ A;  4UPA A;  1WLE A;  1NJ8 A;  1X55 A;  3E9I A;  2ZNJ A;  3HFZ A;  4ZTU B;  2ZCE A;  3BJU A;  1LYL A;  4L87 A;  2J3M A;  4UP9 A;  1G51 A;  4PG3 A;  4P75 A;  1GGM A;  1E1T A;  1H4V B;  2QHS A;  2C7I A;  5HGQ A;  3CMQ A;  4XEM A;  3V8L A;  2DQ0 A;  2ALY A;  2E1H A;  4Q6G A;  2ALY B;  2XGT A;  4DQ2 A;  2I4M A;  4YYE A;  3PZC A;  3NEM A;  3PCO A;  3L4G A;  1QE0 A;  2DXT A;  3TEG A;  3MF1 A;  1YB3 A;  3L1A A;  1EQR A;  1NJ6 A;  2E3C A;  4YP0 A;  2CGH A;  5E3I A;  3RKX A;  4YRT A;  4KQE A;  1HTT A;  1G5I A;  2DZ9 A;  2Q7G A;  2E64 A;  1C0A A;  2Q5H A;  2ZT7 A;  2Q7E A;  1NJ5 A;  4RQF A;  5K1P A;  1PYS B;  5F5W A;  2RHS A;  1SER A;  2ZT5 A;  1ASY A;  3V7C A;  2ZIO A;  1YFR A;  4YRS A;  3KFU A;  1USY C;  2I4L A;  3LSS A;  4E51 A;  4BW9 A;  3TUP A;  4PHC A;  1YFS A;  2XTI A;  2I4N A;  1E1O A;  1YGB A;  3RL6 A;  2DTI A;  3A74 A;  3REU A;  5ELO A;  2EL9 A;  1J5W A;  3RKW A;  1SRY A;  1BBU A;  3DSQ A;  4TVA A;  1VQZ A;  4P73 C;  1JJC B;  1HXD A;  3VQV A;  1H4T A;  2QHT A;  3VQY A;  3UFG A;  3ERR A;  3BFM A;  2DXU A;  2ZR2 A;  1L0W A;  4HWS A;  2ZT6 A;  4YRG A;  2ARS A;  2DVE A;  4UP8 A;  4YRI A;  2IY5 A;  1ADY A;  2DTO A;  3WQZ A;  2DU7 A;  2ZIN A;  2EJF A;  2I4O A;  1HC7 A;  4BWA A;  3HXU A;  1NYQ A;  3UH0 A;  3QTC A;  3MF2 A;  4OP0 A;  4YCU A;  2P5I A;  3QO7 A;  2AMC A;  3A32 A;  3HRI A;  4P3N A;  2ZZF A;  4XTW A;  4XU3 A;  1IL2 A;  3HXZ A;  4YRP A;  4YPF A;  4TVY A;  3A7U A;  4CS3 A;  1EOV A;  1EVL A;  4CH3 A;  1EVK A;  4TQF A;  4H2S A;  4CH4 A;  2HNI A;  4RQE A;  1PYS A;  1B76 A;  4J15 A;  4TQD A;  4XU1 A;  3QO5 A;  4YRR A;  3A7A A;  3L2Z A;  1NNH A;  4P3P A;  4P72 A;  3QNE A;  3V8J A;  2E5A A;  4YRN A;  3HY1 A;  2P0L A;  1Z7M A;  3V8K A;  1NJ2 A;  2ZGW A;  1RIQ A;  2PME A;  3I7F A;  4RDX A;  4XTY A;  4P71 C;  3VBB A;  2AKW A;  2CJB A;  4H2U A;  1G5H A;  1Z7N A;  5K1X A;  1JJC A;  2ZZE A;  1X2H A;  4HWP A;  1FYF A;  4XTZ A;  4YRQ A;  3A7R A;  5C53 B;  4KR2 A;  3IAL A;  4UP7 A;  4YRO A;  4YCV A;  2ZR3 A;  3A5Z A;  1QF6 A;  2EWN A;  2ZT8 A;  3HY0 A;  2ZXF A;  1WU7 A;  2DJZ A;  4YRK A;  3RAC A;  1W66 A;  1B8A A;  3RGL A;  1KMN A;  3IG2 A;  4HVC A;  4P72 C;  4G84 A;  2E10 A;  4K87 A;  1B70 B;  2C8M A;  5ELN A;  2E65 A;  1YFT A;  2RHQ A;  4ZTZ B;  4CH5 A;  4XU2 A;  3UGQ A;  4WJ4 A;  3M4P A;  1WYD A;  3ICA A;  3MEY A;  3IKL A;  4CH6 A;  3G1Z A;  1B7Y B;  3HXX A;  2ZTG A;  4YRM A;  1KMM A;  1B7Y A;  4H02 A;  4LNS A;  3LSQ A;  4H2V A;  4YCW A;  3VQX A;  4YRE A;  3EFS A;  2J3L A;  3A31 A;  4KR3 A;  2FYK A;  4TVA B;  1ASZ A;  4WI1 A;  2ODR C;  1USY A;  3R07 A;  4P75 C;  1BBW A;  1KOG A;  4XEO A;  12AS A;  3RIR A;  2QHU A;  4HWT A;  2ZIM A;  1SES A;  3OD1 A;  4ZIB A;  2Q5I A;  4NCX A;  11AS A;  3FJP A;  4YDQ A;  4H2Y A;  4HWO A;  5C51 B;  1ATI A;  3PCO B;  3L4G B;  2CJA A;  3P8Y A;  3LC0 A;  4HA8 A;  2DTH A;  3VQW A;  3V7S A;  4TTV A;  4K86 A;  3HXY A;  2EAY A;  1WQW A;  1X54 A;  3HFV A;  4EX5 A;  2ART A;  4DPG A;  4H2T A;  2E41 A;  1WQ7 A;  3HXW A;  3RKY A;  4Q15 A;  2DQ3 A;  4P71 A; 
#chains in the Genus database with same CATH topology
 1KUQ A;  3FAV A;  1VEW A;  2EIK C;  4NTY A;  3U10 A;  1NVP B;  4MTF A;  5GTI Z;  3QG5 A;  3EFR A;  4OGQ B;  2QWQ B;  1VAR A;  1DLB A;  2QHV A;  5LXT A;  1LUV A;  3AK2 A;  3S3X A;  4X9Q A;  5DED A;  4WJ3 M;  2G4C A;  2YXY A;  1N4C A;  1WN7 A;  2Y0I A;  1ZAU A;  2K1E A;  3RF1 A;  3ASO C;  5J2U A;  1I08 A;  3HRK A;  4P3O A;  1SZX A;  3M4Q A;  3QO8 A;  1S77 D;  3F7Y C;  4UXN A;  3TEH B;  1HR0 O;  1WP8 A;  4YRL A;  4J10 A;  1ZLZ A;  2L35 A;  3K79 A;  4X1Y A;  2RQ6 A;  5JCO C;  2UUC O;  1WNS A;  4DR6 B;  3GWK C;  3RVZ A;  3BHP A;  3JAS B;  3E9H A;  1VF6 C;  1YXB A;  1VQ5 V;  2EBO A;  2ZNI A;  2DKG A;  1JA8 A;  2IY5 B;  3OR6 C;  4OLF A;  4X20 B;  1N32 B;  1XHX A;  3C90 A;  1ENV A;  2JK5 C;  2MK3 A;  4O4L A;  2UU9 B;  3REX A;  4H0L B;  2X6B A;  3ZHU A;  1N9W A;  1K8A W;  1PM9 A;  4WFA V;  2PUS A;  3ABT A;  3HKB B;  3UM7 A;  4I50 A;  3P8V A;  2QM4 A;  1WA8 B;  1EM1 A;  2Q7H A;  3TXQ A;  5BR8 O;  1BL8 A;  4X64 O;  5E79 Z;  4H2X B;  4K3A A;  4YJ2 B;  3OEH G;  2R9R B;  2B9Z A;  1R3J C;  5FPR A;  2LGQ A;  1NYR A;  1US6 A;  3D36 A;  1I5Y A;  3CXC U;  2BOB C;  2EIN B;  4QNH B;  1JMK C;  1YZB A;  3OMA B;  3P3P A;  2P90 A;  1WLE A;  4P9O A;  1NJ8 A;  2P67 A;  1EN4 A;  4B3T B;  4OX9 B;  3E22 B;  1XBL A;  3HKE B;  4UCU A;  3CC7 V;  3UO2 A;  2ZCE A;  5KUM A;  3BJU A;  2HVK C;  2V4D A;  2VS0 A;  1VF6 A;  2CGO A;  1Y76 B;  1ZUQ A;  2J3M A;  3C3S A;  4JYC A;  1ZL8 A;  2XAF A;  4PG3 A;  3CRR A;  1QR9 A;  4GYC B;  1KD1 W;  1H4V B;  1G4Y B;  1SKV A;  4FLX A;  1V54 C;  2EZP A;  3CC2 V;  1FJG B;  2DQ0 A;  2ALY A;  4Q6G A;  1AJN A;  2XGT A;  3IAY A;  2I4M A;  3PZC A;  3NEM A;  4NVP A;  4UCT A;  1R73 A;  1HNX O;  3TEG A;  1XOU A;  3MF1 A;  2R70 A;  2WLI B;  4JTC B;  4JI6 B;  4JZ2 A;  5LL6 Y;  4FZ0 A;  4JI7 B;  4C7U A;  2BTQ B;  4YRT A;  4IL6 Z;  3T2M A;  1MAB G;  2YC0 A;  2JS3 A;  2Q4P A;  4JI4 B;  1G5I A;  3T1H B;  4PA4 A;  3CCE V;  2DZ9 A;  2Q5Z A;  1AI5 A;  1R3L C;  4LC1 A;  3GWO A;  4MVO A;  3RT3 C;  3ABM B;  3LDC A;  3CEI A;  3STL C;  3FFQ A;  3TK1 A;  3STZ C;  2Q7E A;  1PYS B;  2IJJ A;  3CWB H;  3K0D A;  2RHS A;  3FAV B;  1L8D A;  2IW5 A;  1RPO A;  3FB6 C;  1YFR A;  2LW1 A;  1MZF A;  3E8H A;  3T4D A;  1K33 A;  1PNM A;  4QJF B;  4DRX B;  4U3J B;  1TUB A;  1HNZ B;  3F5T A;  3BFR A;  1FXK B;  1I5X A;  5CBG A;  3NR7 A;  4I9W A;  1Q81 W;  3TUP A;  2Q68 A;  1DF4 A;  1YFS A;  2XTI A;  4DR3 O;  2ZT9 B;  1TVK A;  4LVI A;  3RL6 A;  3AG4 B;  1VQN V;  2EIJ B;  2DTI A;  2VQF O;  3ZMS A;  3A74 A;  3REU A;  3AG4 C;  1H2G A;  5ELO A;  2EL9 A;  1HNZ O;  4IGG A;  3I5D A;  3ASN C;  2DW4 A;  1Q7Y W;  2IJH A;  1VQZ A;  1JJC B;  4D7S A;  1G8M A;  1GN4 A;  2QKC A;  4X1Y B;  2E75 B;  1Y6X A;  1L0W A;  2VWJ A;  4HWS A;  2QGN A;  4IHJ A;  2ZT6 A;  5KMG B;  3EHB B;  2ARS A;  4FLV A;  2IY5 A;  2K9P A;  3CS5 A;  3M8A A;  4DV1 O;  3LDE A;  1IUR A;  4ICG A;  1GKF A;  3UT5 A;  2WA4 A;  2ADQ B;  3C3T A;  1CEZ A;  3J80 N;  5LYJ A;  4GZR B;  4F6R B;  1N0J A;  2CTQ A;  2H3O A;  4LF8 B;  4I55 A;  1YIT V;  4WFB V;  2QSA A;  3QO7 A;  1X4T A;  3FYI B;  4ZI7 B;  3WU2 Z;  5FPO A;  5C8Y A;  1SQQ H;  2BTO A;  4JAA A;  5BMV B;  4P3N A;  2B5U A;  4XTW A;  1FJG O;  1FFX B;  3K08 A;  3KZI Z;  1VF5 B;  5JJE B;  4RAI A;  2G38 A;  4CS3 A;  1EVL A;  1MMM A;  3ABK B;  4CH3 A;  1EVK A;  4J7J A;  3ZHV A;  4ZOL B;  4JYB A;  3K58 A;  1BCC H;  4B3R B;  4H2S A;  2Z0A A;  2WAM A;  2AZ0 A;  3SYC A;  1XMO O;  4J15 A;  3CRC A;  4OXS A;  4D6T H;  3QO5 A;  3A7A A;  3JAL A;  4X62 O;  3HKC A;  2EIK B;  2RDC A;  3BRC A;  1SA0 A;  1R6K A;  4FVM A;  3QNE A;  3K5O A;  3OFN G;  3RBZ A;  3OTO B;  1L0L H;  1AR4 A;  2CDY A;  3FYE B;  5EBW C;  1H2M A;  4PI2 A;  1P49 A;  4I4T A;  1RIQ A;  4JI6 O;  2Y0P A;  4X1I A;  3I7F A;  4XTY A;  2Q0A A;  2QA4 V;  2UUA O;  2KQX A;  4DUZ B;  5EC2 C;  2AKW A;  5KHG A;  3SYP A;  4FFB A;  4NXM O;  2X6A A;  4O2B A;  2IBZ H;  5HFL A;  5K1X A;  4YY3 O;  3ML0 A;  4MTO A;  1PKX A;  1WB7 A;  1QVG U;  2CH7 A;  1FXH A;  4XTZ A;  4KR2 A;  3A7R A;  1IXM A;  3Q4H A;  1RPR A;  4LFA B;  3IAL A;  5CA0 B;  2QDO A;  4YCV A;  3APQ A;  1H2K A;  1NZ6 A;  3QVN A;  4MVR A;  1IVS A;  4CBC A;  4JGS A;  2ZXF A;  1WU7 A;  4BW5 A;  2WLJ A;  2XUM A;  4JV5 O;  1B8A A;  3EFF K;  2UXN A;  3IG2 A;  2NS6 A;  1RSO A;  2YXL A;  1B70 B;  4IYI A;  1UJW B;  1QLE B;  5IJ0 A;  3L73 H;  4B08 A;  3B2E E;  1XRE A;  1O9G A;  4LVL A;  5LA6 B;  1MSD A;  2P7T C;  4FK5 C;  4MT8 A;  2GBO A;  1B7Y B;  1P7G A;  1D2D A;  2ZTG A;  4LNS A;  5DEC A;  3LSQ A;  1J95 A;  1XEQ A;  1PNL A;  4H2V A;  4UCS A;  5LHI A;  4X88 A;  4WI1 A;  4FJC C;  3JCZ A;  4PA7 A;  4DK0 A;  1H38 A;  3R07 A;  2HJD A;  4DV0 O;  4XEO A;  1AVM A;  1XNR B;  2NLJ C;  4OPH A;  3ETG A;  5EIB C;  4K0K O;  1KU9 A;  3H1K H;  3L9D A;  3T1Y B;  4HWT A;  1KB9 F;  2UUC B;  2XHB A;  3OTO O;  4LWS B;  2Q5I A;  1M56 C;  4NCX A;  4X62 B;  5EZY A;  1BZK A;  1XMQ B;  1QHT A;  5E1A C;  2YSU B;  4H37 A;  2JGD A;  2M6Y A;  3VQW A;  2N04 A;  3TET A;  4TTV A;  3RVY A;  1Z2G A;  1F4M A;  3CRA A;  5IYZ A;  2CTW A;  3D3Q A;  4DV3 B;  2Y69 B;  1QQC A;  1M1K W;  1WQ7 A;  3RKY A;  5GON A;  4MW8 A;  2HJF C;  3AG7 A;  2CGN A;  2ARU A;  4R7C A;  5H2F Z;  3CRM A;  1K97 A;  4DV7 B;  1EFW A;  5LMU O;  4JI3 O;  2VWK A;  2YXH A;  4CC6 A;  3G4S V;  1AP6 A;  3V7R A;  3EXA A;  1I7F A;  3TCU A;  2DU5 A;  4CS2 A;  5KHI A;  4FZ1 A;  2DJV A;  2RHQ B;  1FXK C;  3NET A;  2DEQ A;  1JVM A;  4TUY A;  1X2G A;  2GSM B;  3O65 A;  3E35 A;  4I4T B;  4XTV A;  5J2U B;  5IE9 A;  3P8T A;  2AW9 A;  2ZXW B;  1QR8 A;  3BA9 A;  2Q69 A;  4DV4 O;  1JQ0 A;  2ZZG A;  3RYI A;  1IX9 A;  1S5H C;  5C52 B;  2AXT Z;  3JAW A;  1SF9 A;  3SJC C;  4WBN A;  4NXN B;  4G85 A;  3OT7 A;  4PDR A;  2CJ9 A;  4MTG A;  4K8Z A;  1FD9 A;  4DR7 B;  1RP3 B;  5EBL C;  4HYO A;  1MNG A;  2R9A A;  3DXR A;  3F5W C;  4LF7 O;  2ODR D;  1M9N A;  1GN3 A;  3W7T A;  2RJZ A;  4PD4 F;  1OZ0 A;  4NXN O;  1VQO V;  2PTM A;  4P73 A;  4H2X A;  4GKK O;  2PF4 E;  5IWA O;  2P4K A;  1OCC B;  3J81 N;  4DUZ O;  1X56 A;  2JEX A;  2GTS A;  1X01 A;  3HTZ A;  2F4V B;  2PYL A;  2WPD G;  4QIW F;  3JAT A;  3DGE A;  2A79 B;  1U96 A;  2BOC C;  1BT8 A;  2DOS A;  3K9A A;  2ZNJ A;  1JFF B;  2XT9 A;  3HFZ A;  2AGA A;  1NTZ H;  1JOY A;  1F51 A;  2EIL B;  4NKG B;  1N32 O;  2Q6A A;  1LYL A;  4LVJ A;  4L87 A;  4O2A B;  4UP9 A;  4X1K A;  4B3R O;  2LQT A;  4BR6 A;  1H2N A;  2QTO A;  3NXS A;  4P75 A;  1EFR G;  1GGM A;  4LNU B;  2UUA B;  2QWP B;  2QHS A;  2Z3Y A;  5HGQ A;  3CMQ A;  1QLN A;  1V54 B;  4JTD B;  4PA9 A;  1JJO A;  3HKD B;  2F95 B;  3ZED A;  3CCQ V;  4YYE A;  4TV8 A;  2ZKO A;  2UXC O;  3L4G A;  4O4H A;  2DXT A;  2WLL B;  3ZMV A;  5EZY B;  1EQR A;  5EIB D;  1NJ6 A;  3JD0 A;  2A7W A;  4ZI7 A;  2CGH A;  2Q9L A;  4DK1 A;  3GVM A;  2QWO B;  1MA1 A;  4U7N A;  3AG3 C;  4RUE A;  4UVC A;  3HPL C;  1HTT A;  2Y69 C;  3BCC H;  2Q7G A;  3JD2 A;  2E64 A;  2CTP A;  1R3I C;  3M99 B;  5AG2 A;  5LGT A;  4PDM A;  2ZT7 A;  1H2L A;  1NJ5 A;  4RQF A;  1SER A;  2ZT5 A;  3K0G A;  1ASY A;  1NTM H;  4YRS A;  4BIU A;  3CJH B;  3K3W A;  4G27 B;  2P4V A;  1N34 B;  4PHC A;  2JGU A;  3OAA G;  2IU3 A;  4JI1 O;  1K9M W;  4KL1 A;  4AQY O;  3FB5 C;  4I9Q A;  1V55 C;  2OCC C;  4PI0 A;  3R65 A;  1IBL B;  2HP8 A;  1BBU A;  3DSQ A;  2ATK C;  4LH7 A;  5LHG A;  3OD4 A;  2KB1 A;  3KKY A;  4TWK A;  1M93 A;  1WAZ A;  3JAK B;  3UQ8 A;  5L3F A;  1HXD A;  3VQV A;  2QHT A;  4PEL A;  4QPJ A;  2H94 A;  2V7Q G;  4TOI A;  1OHH G;  5CA0 A;  4UP8 A;  4KHP B;  4X20 A;  3E89 A;  3K5L A;  1SS3 A;  1XL6 A;  1GRJ A;  3B40 A;  1J5E B;  4EFB A;  5IYD O;  3UT5 B;  1HC7 A;  4UB8 Z;  3HXU A;  4O4J B;  1M56 B;  5KX5 A;  1EZJ A;  1K34 A;  1LR1 A;  3QTC A;  1N36 O;  4YCU A;  1YSC A;  5EYP A;  2BE3 A;  3T1H O;  1GM8 A;  2AMC A;  2ZDI C;  5DN6 G;  2WLK A;  2YEV B;  3RYF B;  4CZZ A;  1KP2 A;  3ZMZ A;  2ZD9 A;  4DV3 O;  3KG2 A;  4LF4 O;  1M5I A;  5JJJ B;  1PNK A;  4YPF A;  1SC5 B;  1Q86 W;  1OCO C;  2QKS A;  2ZE7 A;  4EB6 A;  2HHH O;  3SJA C;  4B3M O;  1AR1 B;  1AJP A;  1NS1 A;  1OCO B;  2XTA A;  5D5Q A;  5KAI Z;  3CCR V;  2EIM C;  3SYO A;  4RQE A;  3L74 H;  4MVZ A;  4TQD A;  1NR1 A;  4JI4 O;  2E74 B;  4QE9 A;  4B3T O;  1Q43 A;  2JDI G;  3K5M A;  3V8J A;  4GKJ B;  4LF8 O;  1KMI Z;  2NR5 A;  1KYO F;  4N21 A;  5LXT B;  5CMU A;  4ABM A;  5IY5 B;  4R50 A;  1Z7M A;  3V8K A;  3LDD A;  4MTX A;  4DV5 O;  1XNQ B;  1K92 A;  5LGU A;  5B1B C;  5B3S C;  5B5E Z;  2OTL V;  4LVK A;  3HKD A;  2CJB A;  4UV9 A;  2NN4 A;  4I0X B;  1VQM V;  1G5H A;  4DR1 O;  4LF9 B;  1Z7N A;  4RO2 A;  2PYJ A;  2WLI A;  4JI1 B;  5L3C A;  1EN5 A;  1R1B A;  2P06 A;  2W6I G;  2CH7 B;  4HWP A;  2OYQ A;  1FYF A;  3BPZ A;  1NR7 A;  3ZJZ A;  4DV4 B;  4GCZ A;  2DWE C;  1VP7 A;  1BE3 H;  2ZR3 A;  3LNN A;  3A5Z A;  1Y74 A;  1D5N A;  4DUY B;  2EWN A;  1WPX A;  1PPJ H;  5CB4 A;  4FM1 A;  1TA8 A;  3FKS G;  4YRK A;  3RAC A;  2JEU A;  3RGL A;  1AIL A;  1YJW V;  3MHH C;  1KMN A;  2ZE6 A;  4DRX A;  3BY6 A;  1I0H A;  3ABU A;  4HVC A;  2E10 A;  1HW7 A;  2ETN A;  4K87 A;  5LP6 C;  4U3J A;  1MG1 A;  1EN6 A;  2EX3 A;  1XQ8 A;  4PDL A;  4Z1V A;  2C8M A;  1Y67 A;  2E65 A;  2RHQ A;  2JRI A;  5L3D A;  4NXM B;  2IM9 A;  3UGQ A;  5LOV B;  4JYA B;  3CX5 F;  3SPH A;  1WJZ A;  4DR6 O;  1WYD A;  2CK3 G;  3AG1 C;  1VMG A;  1UPG A;  3IKL A;  4EKW A;  3OW2 U;  2CE4 A;  3APO A;  3TGU H;  1NU1 H;  4LFC O;  3AK3 A;  1OCR B;  2UU9 O;  2DMX A;  1FS0 G;  2B1I A;  1VQL V;  2AHZ A;  1M90 W;  4XDJ A;  3VQX A;  3RYI B;  4JTA B;  3EFS A;  3A31 A;  3A2F A;  3I56 V;  3GB7 C;  2HLD G;  1JCH A;  2F43 G;  4HT4 A;  2GTA A;  1VIB A;  2N74 A;  3CME V;  1BBW A;  1KOG A;  4JYY A;  3ZCC A;  2QHU A;  3P30 A;  4P30 A;  2LFS A;  1SES A;  2RN9 A;  3ABL B;  4WFH A;  1FFT B;  5GW7 A;  4E2L A;  2YID A;  4J9Z B;  3ZHR A;  3PCO B;  4GUN A;  4LF5 O;  2CJA A;  5LP6 A;  2DTH A;  3V7S A;  1GK9 A;  4KP4 A;  4K86 A;  3K04 A;  4UCR A;  2ART A;  1Q8I A;  2WA3 A;  2EJR A;  1IBK O;  1CP9 A;  1Q6I A;  4H2T A;  3W7U A;  3E83 A;  1Q82 W;  4DO2 A;  4DR1 B;  3SPC A;  3SYQ A;  4Q15 A;  1THZ A;  4P71 A;  5GON B;  4DR4 B;  4DR5 B;  3RYC B;  4UUJ C;  4AH6 A;  3ETD A;  4TV9 B;  1E22 A;  2XAJ A;  3ZMT A;  4DYL A;  4JI0 B;  3NEN A;  3IC7 A;  2LJ2 A;  5L3E A;  3E2E A;  4H2W A;  2PMF A;  5ITZ A;  2LW7 A;  2R9I A;  1RM1 C;  5KNN A;  3N2K B;  1URF A;  4NR1 A;  4XTU A;  2ZM6 B;  4X65 O;  1GH6 A;  4XU0 A;  5BZB A;  4X1I B;  1FXV A;  1EBO A;  3EVK A;  4JPR A;  3ETQ A;  2HKO A;  4TV8 B;  1BIA A;  1O9H A;  4YRC A;  2F1M A;  1I94 B;  2AKW B;  4KXR A;  1BSM A;  4GX5 A;  4O2D A;  1V55 B;  2OCC B;  1M4U A;  1FYJ A;  4ZHQ B;  4EO4 A;  2FL4 A;  3JAM N;  4JV5 B;  4K88 A;  1NT2 B;  4D7T A;  3Q4H B;  2EJ9 A;  1EIY B;  3H1J H;  1XIL A;  4O4L B;  4TVW A;  1L1F A;  3ZRW A;  3IKM B;  5H9C A;  2E5L B;  3PN1 A;  1N33 B;  3ASO B;  3CSX A;  1S3J A;  3DXR B;  4FIP C;  4IT5 A;  4J42 A;  1E24 A;  5JH7 B;  2DZC A;  2GUZ A;  5KA5 A;  5LGN A;  3CCL V;  1XUQ A;  4RUF A;  4AI8 A;  5CA1 B;  4TWA A;  1NBM G;  3H01 A;  4J7Z A;  1NJ1 A;  4IIJ B;  1QCE A;  4YRJ A;  2C2A A;  1B70 A;  4B3M B;  3ZHQ A;  1M57 C;  2RMK B;  3AG1 B;  5FNV A;  2EUL A;  1ORQ C;  4UPA A;  1M57 B;  2EJ7 A;  3UO3 A;  1PL0 A;  2NNU A;  2DYS B;  1F7Y A;  2P22 C;  5IDJ A;  3E8F A;  1NH2 D;  4J80 A;  4G28 B;  2KKW A;  3RWR D;  4LF6 B;  1XNR O;  5B1B B;  1X55 A;  1ZWI C;  3E9I A;  3OMN B;  4PHZ A;  2QWR B;  1HNW B;  3IGA C;  3X2Q C;  3JAR A;  3X2Q B;  4B3S B;  5CA3 A;  2Y4T A;  2Z5U A;  4QGP A;  2QEX V;  3BVO A;  1BMF G;  1SA0 B;  1NKD A;  3ZHT A;  4ASU G;  2DE0 X;  4YJ3 B;  2PI5 A;  1COW G;  1SQV H;  4LF7 B;  2UXB O;  1E1T A;  2YS8 A;  3F7V C;  2C7I A;  4LWS A;  3ZIA G;  3KCX A;  2WLH A;  2ALY B;  4DV6 B;  2FB5 A;  2YIC A;  2QR4 A;  3VOU A;  5LYJ B;  3U11 A;  4GKJ O;  3G71 V;  4DV0 B;  1QE0 A;  3AG2 C;  1YB3 A;  3OEE G;  2F4V O;  4I7Z B;  1FPO A;  4LP8 A;  2HG5 C;  2VQE O;  5E3I A;  3RKX A;  2E5L O;  1DK1 A;  4MSW C;  2JGD B;  4KQE A;  4Q20 A;  4BAY A;  1BHB A;  5LMU B;  3AG3 B;  4X64 B;  2CAZ C;  4X66 O;  3JYC A;  4EB6 B;  1L0N H;  5IYZ B;  3SPI A;  4EEQ A;  2R72 A;  3RYH A;  4JZG A;  4FM0 A;  3ASN B;  3S3W A;  3HKB A;  1OCR C;  1WB8 A;  1RFY A;  2XND G;  3IFX A;  4LBE C;  5A9G A;  2ZIO A;  5HFM A;  3QF7 A;  1RM1 B;  2I4L A;  5CBF A;  5J2T B;  2QE7 G;  4FLU A;  1DF5 A;  1YVW A;  4BW9 A;  1JR9 A;  3L71 H;  1E1Q G;  1ZTE A;  5IJ0 B;  2I4N A;  4P2Z A;  4YY3 B;  4NTX A;  1E1O A;  5EBM C;  4TUY B;  1HR0 B;  2ITC C;  3THO A;  3ABL C;  4DR2 B;  1S5J A;  2JS5 A;  5EC1 C;  1J5W A;  3RKW A;  2WLM A;  2UXB B;  3LNM B;  1SRY A;  2Y48 A;  3PJS K;  3ZN0 A;  4LF6 O;  2A0L A;  3RN4 A;  4ZBM A;  1R3K C;  3BFM A;  3ERR A;  2PI4 A;  4W4L A;  3JAS A;  3OM3 B;  1XDC A;  3OGC C;  3ZRX A;  1N33 O;  3RGB A;  4YRG A;  2IJI A;  3TJT A;  2DVE A;  3SR2 C;  2KG7 B;  2WWW A;  1QU7 A;  3WQZ A;  5A2Q N;  3JSL A;  2ZIN A;  3H1L H;  3U0Z A;  4FMT A;  2GV9 A;  4FPP A;  1G6U A;  4BWA A;  3T1Y O;  2PGG A;  1NYQ A;  3OGI B;  5CN0 A;  3UH0 A;  1WA8 A;  4O4J A;  1MZE A;  2GDS A;  3MF2 A;  4PDV A;  1KQS U;  3KCY A;  3A32 A;  4YIO A;  2ZZF A;  2DYS C;  5IY5 C;  4IIJ A;  4XU3 A;  1IL2 A;  3WB1 A;  1Y66 A;  1FFX A;  1SQP H;  1P84 F;  5H5N A;  5JVD A;  2OT5 A;  1IBL O;  2IU0 A;  3A7U A;  1HP8 A;  3ZX6 A;  1W2B U;  4UVA A;  2X7R B;  1NJI W;  1NTK H;  1LNQ A;  3T1C A;  5IJ9 B;  5GTH Z;  4GKK B;  1GTO A;  2X6C A;  3E22 A;  1TGO A;  2BSK A;  3CCU V;  1B76 A;  4XU1 A;  2DN9 A;  4L8J A;  1X59 A;  4X65 B;  4K0K B;  3H1H H;  4LCU C;  4LR3 A;  3L2Z A;  1FKA O;  1TUB B;  1AI7 A;  3P3N A;  1IBM B;  2LGW A;  1BQZ A;  4DR7 O;  3K59 A;  2PZS A;  2E5A A;  1I94 O;  1UFI A;  1MOF A;  4YRN A;  2Q8V A;  2P0L A;  2RNB A;  1K5Q A;  4OPA A;  1NJ2 A;  1YDX A;  1OCZ B;  2OWO A;  2PME A;  5C93 A;  4TT3 G;  2VQE B;  4LFB B;  1OCZ C;  3AK1 A;  4LFA O;  3D8C A;  1IBM O;  3VBB A;  4NYK A;  3SGI A;  2CTR A;  4J7K A;  4I0X A;  4JI5 O;  2X0L A;  4U3F H;  5LP6 B;  4LVM A;  1JJC A;  1SZT A;  2LFR A;  2Q0O C;  4KFM A;  2ZZE A;  3MQZ A;  1Y4M A;  4MVS A;  4HZ3 A;  1X2H A;  2UXD O;  4MS2 A;  5C53 B;  4K8X A;  4YRO A;  4PA6 A;  3HR0 A;  1TAE A;  5F2V O;  2AZ2 A;  2XAS A;  1U97 A;  2AHY A;  3ZS8 C;  5LMN O;  3A0H Z;  5EK0 A;  1S5L Z;  3W7W A;  1ROP A;  4G84 A;  4UVB A;  4IYH A;  4JI2 O;  2EIL C;  2DWD C;  2QTS A;  1B3Q A;  1K7D A;  4DV1 B;  1W0K G;  3G80 A;  2WLN A;  1IXB A;  4H13 B;  5ELN A;  1XMO B;  1N0N A;  4ZTZ B;  1KKC A;  4N23 A;  1TVK B;  4CH5 A;  2CUG A;  5JQG A;  4OX9 O;  3E8B A;  1W59 A;  4DV7 O;  2N05 A;  5LOV A;  5LA6 A;  3ICA A;  4QPK A;  3T4Z A;  2XAG A;  1GO3 F;  4O4I A;  5H6R A;  3A8T A;  3HXX A;  4YRM A;  1B7Y A;  5JJN B;  2UUB O;  3CCV V;  1VQP V;  3ZHS A;  3AG2 B;  3B09 A;  4YRE A;  1KKD A;  3K06 A;  5FLX N;  1P7B A;  4KR3 A;  3JAL B;  3HKC B;  2ODR C;  4ZHQ A;  1BGY H;  2OIG A;  4PA3 A;  1B04 A;  1ZL8 B;  2B1G A;  5KMG A;  12AS A;  3IC9 A;  1K5S A;  1PP9 H;  2V1D A;  3ZRW B;  3OD1 A;  4ZIB A;  3WG7 B;  3CCM V;  4BIO A;  1H2S B;  11AS A;  1BS3 A;  2JIZ G;  1AB3 A;  3CMA V;  4YDQ A;  5C51 B;  3N2G B;  2FKX A;  3CRQ A;  1S0V A;  3P8Y A;  1VQ6 V;  3LC0 A;  1NI8 A;  2LP7 A;  4F4L A;  2JJ1 G;  4DW0 A;  4Z1M G;  3HXY A;  2EAY A;  4LFB O;  1X54 A;  3HFV A;  1JPX A;  2E41 A;  5D5P A;  1YHQ V;  3HXW A;  4JI7 O;  5B1A C;  4QE7 A;  2DQ3 A;  1N8R W;  2ZE5 A;  1XI1 A;  1GMG A;  1JFF A;  4YHH O;  3HFZ B;  5KHH A;  2YDE A;  1YTF D;  2RHS B;  3A5Y A;  4XTX A;  4WCE V;  1WNL A;  3UGT A;  4TV9 A;  2O57 A;  5JCO A;  4B7K A;  5KAF Z;  4B7E A;  2XAQ A;  2DDZ A;  2LO1 A;  4P74 A;  4JF3 A;  4JI3 B;  3AEI A;  4LF5 B;  3OR7 C;  4HNA B;  1AP5 A;  1VQ4 V;  3DC5 A;  4FM2 A;  1ARO P;  4CS4 A;  4X5O A;  4YRF A;  3N2K A;  5B1N A;  4GX0 A;  2ODM A;  1WP7 A;  1LUW A;  1BQ0 A;  2JJ2 G;  3M7M X;  3TEH A;  2MW2 B;  2F93 B;  2WSS G;  1JX9 A;  3ETE A;  4FFB B;  2UXD B;  1G1X B;  4DR3 B;  3BAB A;  1OCC C;  4RMF A;  4WF2 A;  2QKA A;  3B8N A;  1AR5 A;  2HR3 A;  4IHJ B;  1H4Q A;  1Q3E A;  3D36 C;  3JD1 A;  3W7S A;  3FB7 C;  1WPY A;  1VQK V;  3W7X A;  1EIY A;  4ZKI A;  1BHA A;  1SET A;  2W6J G;  3NEL A;  3G6E V;  5JWP A;  3RUX A;  2HVJ C;  3ICX A;  4MVM A;  5CB4 B;  3B8M A;  1HDJ A;  1NQT A;  2EZO A;  4J9Y B;  3CC4 V;  3B4S A;  3RW0 A;  4I50 B;  4F6R A;  3W3S A;  4JAU A;  2Q67 A;  5IWA B;  4I55 B;  1QBZ A;  3A0B Z;  4MVQ A;  2CIM A;  5KX5 B;  4RWU A;  4A5U B;  3I55 V;  4YJ2 A;  1ADJ A;  4HWR A;  4UB6 Z;  5C8Y B;  3WFV A;  1VF7 A;  3ZN1 A;  5BMV A;  1BIB A;  1JJ2 U;  1H4S A;  2OIE A;  2AMC B;  4P74 C;  3HXV A;  4DV5 B;  3CP1 A;  2A06 H;  3SPG A;  2EJG A;  1N36 B;  3CHX A;  1IDS A;  5FNV B;  1F23 A;  4G2K A;  3DTU B;  4TSF G;  4X8A A;  1P4R A;  2QWN B;  4J11 A;  5B3S B;  4BIZ A;  2KSD A;  3SJB C;  4CC5 A;  4WFF A;  2ZQM A;  4FLZ A;  1W0J G;  1TUE B;  4WFG A;  5KHJ A;  2VQF B;  4ZTU B;  2YIB A;  1VQ9 V;  1ZSP A;  1H8E G;  3SPJ A;  1GAX A;  4EFE A;  3G6B A;  2IH3 C;  4MW3 A;  1G51 A;  4LNU A;  1D5A A;  1AJQ A;  3E8G A;  4X1K B;  3BA8 A;  3RFR A;  4LH6 A;  3WB0 A;  4UFZ A;  3CPW U;  2UXC B;  1HWY A;  4XEM A;  3V8L A;  2L6L A;  2ITD C;  4LF4 B;  5BR8 B;  3CE2 A;  2E1H A;  2QM7 A;  3OUS A;  4DQ2 A;  3PCO A;  1IBK B;  2IJK A;  2DYR B;  1OJH A;  4UV8 A;  2FML A;  2XAH A;  3N2G A;  2DYR C;  3L1A A;  4K35 A;  2E3C A;  4YP0 A;  4H44 B;  4O2B B;  1SQB H;  2YEV A;  3RYF A;  4GX2 A;  2PY5 A;  3CXH F;  2UUB B;  4AIL C;  3JAW B;  1T5E A;  1DTO A;  4JI2 B;  5B1A B;  1Q6U A;  3UKM A;  1GN2 A;  4NB5 A;  1C0A A;  2Q5H A;  2HEP A;  3ZRS A;  3ZMU A;  1KBH A;  1YI2 V;  5K1P A;  1YEW A;  2BSK B;  1KC8 W;  3J7A U;  5F5W A;  3L72 H;  2A3Q A;  3V7C A;  3RYC A;  4E4E A;  3D3I A;  1B6Q A;  3KFU A;  1USY C;  2HHH B;  2UXX A;  2YIB D;  2QJ1 A;  3LSS A;  3MHS C;  5J2T A;  4AQY B;  1HNX B;  1PV0 A;  4E51 A;  4Z2W A;  4DW1 A;  3JD3 A;  1YGB A;  1E1R G;  3OMI B;  3UCS C;  4NTW A;  3WB2 A;  2P6J A;  1YJN V;  3WG7 C;  2W0F C;  1KP3 A;  4F6E A;  5LBQ A;  3H1I H;  1XHZ A;  4R8C A;  3IJ4 A;  1ZX3 A;  3SYA A;  4DV2 O;  1S76 D;  4P9P A;  4XBF A;  4TVA A;  4HAM A;  3G67 A;  3JSN A;  2BCC H;  4DR2 O;  4P73 C;  1H4T A;  3VQY A;  3UFG A;  2DXU A;  1GM9 A;  1MSW D;  4LFC B;  2D2C B;  4DUY O;  2ZR2 A;  5J9P C;  3CD6 V;  3SJQ C;  2ADP A;  4HBN A;  3BAA A;  4DR4 O;  4YRI A;  2F66 C;  3L70 H;  4I5S A;  4PV1 B;  1ADY A;  4YXW G;  2DTO A;  4W4K A;  2DU7 A;  2EJF A;  4PJ0 Z;  3OTF A;  2I4O A;  3JD4 A;  1Z5V A;  2ZXW C;  2RCV A;  2FTK A;  1SQG A;  1IZ3 A;  4O4H B;  5IT9 N;  1YF2 A;  2GHY A;  4OP0 A;  2P5I A;  4DXW A;  5CA1 A;  4JYA O;  1SQF A;  2BTQ A;  2EIN C;  5L3B A;  3HRI A;  3LUT B;  2ARH A;  3CCS V;  4DV6 O;  4JI5 B;  1NH2 B;  3HXZ A;  1S72 V;  4YRP A;  3L75 H;  4TVY A;  2XOK G;  4GT1 A;  1R6T A;  5JQG B;  3FD9 A;  4JI8 B;  3JAT B;  2QM8 A;  5JVD B;  2E76 B;  5TIS Z;  1EOV A;  1SQX H;  4TQF A;  2YUA A;  4FLT A;  1KEC A;  2F23 A;  4CH4 A;  2HNI A;  2YI8 A;  4J41 A;  1PYS A;  4MVU A;  5B1O A;  4YRR A;  3FB8 C;  1K3E A;  3JAR B;  2OCH A;  1Q90 D;  1NNH A;  4P3P A;  4P72 A;  1FXK A;  2W0X A;  3BEH A;  1K4D C;  5L3G A;  2HFE C;  3P32 A;  3B77 A;  3H9V A;  1NVP D;  1XNQ O;  3HY1 A;  5LHH A;  1QNM A;  4GLX A;  2P5O A;  4YJ3 A;  3N27 A;  2ZGW A;  1HNW O;  4FFK A;  4YIP A;  3DC6 A;  4RDX A;  1YJ9 V;  1B06 A;  5KHK A;  4P71 C;  4WFE A;  3MD0 A;  2H8P C;  2EIM B;  1AI6 A;  5BY1 A;  4H2U A;  3R66 A;  1YCI A;  3JAK A;  4UCV A;  1F4N A;  3O9O A;  1A32 A;  3MDS A;  2IH1 C;  1EZV H;  4YRQ A;  3ABM C;  4WBN B;  3CB2 A;  1GM7 A;  5IYB O;  4UP7 A;  3ZRV A;  5LMN B;  3TXS A;  1QF6 A;  1YIJ V;  1Y74 B;  2ZT8 A;  3HY0 A;  3RYH B;  1Z5W A;  4FLW A;  3K9S A;  1GN6 A;  5BXZ A;  2FYU H;  1CXZ B;  2DJZ A;  1W66 A;  4KHP O;  5JH7 A;  2JVD A;  1QVF U;  5EYP B;  3CJH A;  4P72 C;  4XDL A;  5KA6 A;  4X66 B;  3OUF A;  1E79 G;  5DM6 V;  1RSO B;  1CPY A;  1WPB A;  5ITZ B;  1V9P A;  2ZM6 O;  3OE7 G;  1XMQ O;  1J5E O;  1YFT A;  4HNA A;  1K4C C;  3CCJ V;  1K73 W;  4XU2 A;  3MAQ A;  4WJ4 A;  3M4P A;  3K57 A;  3HB3 B;  2OTJ V;  2ILM A;  4FLY A;  5CBH A;  3MEY A;  4AHC A;  4CH6 A;  3G1Z A;  3A0R A;  4ZOL A;  1VQ7 V;  2D3O W;  4O4I B;  1KMM A;  1YTF B;  4H02 A;  3HKE A;  4U7O A;  4YCW A;  1DGS A;  2J3L A;  3K5N A;  2FYK A;  2ZDI A;  4TVA B;  1Y76 A;  4JI8 O;  1ASZ A;  2M7W A;  1USY A;  1H8H G;  2YI9 A;  4YHH B;  4P75 C;  4O2A A;  4DR5 O;  2ZE8 A;  3E86 A;  3JCU Z;  4H33 A;  4KUM A;  4WF9 V;  4GX1 A;  3FX7 A;  5H6Q A;  5FL7 G;  4LF9 O;  2KG7 A;  3RIR A;  1QLE C;  2ZIM A;  4UCO A;  4X89 A;  2EIJ C;  5IYC O;  1N34 O;  5KUK A;  2Y4U A;  3SDL A;  3FJP A;  4H2Y A;  4HWO A;  3ZBH A;  2WLL A;  1ATI A;  3K03 A;  2GUZ B;  3L4G B;  2VRZ A;  1XL4 A;  1Q5O A;  3LSU A;  2Q73 A;  1PL4 A;  4R6Z A;  4HA8 A;  5KLV H;  1OV9 A;  2A9H A;  4JAV A;  4DV2 B;  1PD3 A;  1WQW A;  1AI4 A;  3CYO A;  3ABK C;  4XDK A;  4EX5 A;  4DPG A;  1R6N A;  1FAF A;  5IJ9 A;  4JAS A;  4B3S O;  1VQ8 V;  1Q6H A;  5B66 Z;  2A8E A;  2YIA A;  4JI0 O; 
#chains in the Genus database with same CATH homology
 1GMG A;  4R7C A;  2ARU A;  2EIK C;  4UUJ C;  3HFZ B;  1YTF D;  2RHS B;  3A5Y A;  1K97 A;  1EFW A;  4AH6 A;  3ETD A;  1NVP B;  4XTX A;  4MTF A;  3G4S V;  1E22 A;  4WCE V;  2XAJ A;  3ZMT A;  1WNL A;  3UGT A;  3V7R A;  3NEN A;  3IC7 A;  3EFR A;  5L3E A;  2XAQ A;  3E2E A;  2DDZ A;  3TCU A;  2PMF A;  4H2W A;  1DLB A;  2QHV A;  2DU5 A;  4P74 A;  4JF3 A;  4CS2 A;  3AEI A;  2R9I A;  1RM1 C;  3OR7 C;  2RHQ B;  5KNN A;  1FXK C;  1VQ4 V;  1ARO P;  4CS4 A;  3NET A;  2G4C A;  4X5O A;  4YRF A;  4WJ3 M;  2DEQ A;  1JVM A;  2K1E A;  2GSM B;  1X2G A;  5B1N A;  3RF1 A;  4XTU A;  4GX0 A;  3ASO C;  3E35 A;  4XTV A;  4XU0 A;  5BZB A;  3HRK A;  3P8T A;  4P3O A;  2JJ2 G;  2ZXW B;  1FXV A;  1EBO A;  1QR8 A;  4JPR A;  3TEH A;  2HKO A;  2Q69 A;  3M4Q A;  3QO8 A;  1S77 D;  3F7Y C;  4UXN A;  1BIA A;  3TEH B;  4YRC A;  2WSS G;  1JQ0 A;  1JX9 A;  3ETE A;  4YRL A;  2ZZG A;  2AKW B;  4GX5 A;  4O2D A;  1V55 B;  2OCC B;  1OCC C;  3K79 A;  4RMF A;  1S5H C;  4WF2 A;  3B8N A;  2HR3 A;  3RVZ A;  5C52 B;  4EO4 A;  4K88 A;  3E9H A;  1H4Q A;  1VQ5 V;  3JD1 A;  3W7S A;  2EBO A;  3FB7 C;  2EJ9 A;  1EIY B;  2ZNI A;  1WPY A;  2DKG A;  1VQK V;  3W7X A;  2IY5 B;  3OR6 C;  4G85 A;  4ZKI A;  1BHA A;  4OLF A;  4TVW A;  1EIY A;  1SET A;  1L1F A;  1ENV A;  2JK5 C;  2MK3 A;  2W6J G;  3REX A;  3NEL A;  3G6E V;  2X6B A;  4PDR A;  2CJ9 A;  3RUX A;  3ZRW A;  2HVJ C;  4MTG A;  4MVM A;  3IKM B;  3B8M A;  1NQT A;  5EBL C;  1N9W A;  4HYO A;  2EZO A;  5H9C A;  4J9Y B;  1K8A W;  3CC4 V;  4WFA V;  3RW0 A;  3F5W C;  3ASO B;  3ABT A;  3UM7 A;  4JAU A;  2ODR D;  2Q67 A;  3W3S A;  1M9N A;  1S3J A;  4FIP C;  1QBZ A;  4MVQ A;  3W7T A;  1E24 A;  2CIM A;  3P8V A;  2DZC A;  1ADJ A;  5KA5 A;  5LGN A;  3I55 V;  3CCL V;  1OZ0 A;  2Q7H A;  1BL8 A;  4HWR A;  4RUF A;  3WFV A;  4H2X B;  1VQO V;  4TWA A;  3ZN1 A;  4P73 A;  3OEH G;  1BIB A;  1NBM G;  1JJ2 U;  3H01 A;  4H2X A;  1NJ1 A;  1H4S A;  2R9R B;  2AMC B;  1OCC B;  1QCE A;  4YRJ A;  4P74 C;  2C2A A;  3HXV A;  1R3J C;  1B70 A;  1X56 A;  3CP1 A;  3SPG A;  2JEX A;  1NYR A;  2EJG A;  1M57 C;  1X01 A;  3D36 A;  1I5Y A;  3CXC U;  3AG1 B;  3HTZ A;  2BOB C;  2EIN B;  4QNH B;  1ORQ C;  4UPA A;  1M57 B;  3OMA B;  2WPD G;  1F23 A;  1PL0 A;  2NNU A;  2DYS B;  2P90 A;  4G2K A;  1WLE A;  4P9O A;  4QIW F;  5IDJ A;  1NJ8 A;  2P67 A;  3L1A A;  3DTU B;  3E8F A;  2A79 B;  3DGE A;  4TSF G;  4X8A A;  1NH2 D;  1P4R A;  4G28 B;  2BOC C;  5B1B B;  1X55 A;  1ZWI C;  3E9I A;  3OMN B;  5B3S B;  4BIZ A;  3K9A A;  2ZNJ A;  4WFF A;  2ZQM A;  3HFZ A;  1W0J G;  3IGA C;  3X2Q C;  1TUE B;  4WFG A;  3CC7 V;  1JOY A;  4ZTU B;  5KUM A;  3X2Q B;  2ZCE A;  3BJU A;  5CA3 A;  1F51 A;  2EIL B;  2HVK C;  2Q6A A;  2Z5U A;  1VQ9 V;  2QEX V;  1LYL A;  4LVJ A;  1BMF G;  1H8E G;  1NKD A;  3SPJ A;  4L87 A;  2J3M A;  2IH3 C;  4ASU G;  4JYC A;  4MW3 A;  4UP9 A;  1G51 A;  2XAF A;  4PG3 A;  1QR9 A;  2QTO A;  2PI5 A;  1AJQ A;  1COW G;  3E8G A;  1EFR G;  3NXS A;  1E1T A;  1GGM A;  1KD1 W;  4P75 A;  1H4V B;  1G4Y B;  3F7V C;  2QHS A;  2Z3Y A;  1V54 C;  2EZP A;  2C7I A;  3CPW U;  3CC2 V;  1HWY A;  5HGQ A;  3ZIA G;  3CMQ A;  4XEM A;  3V8L A;  2ITD C;  1QLN A;  2DQ0 A;  1V54 B;  4JTD B;  4PA9 A;  2ALY A;  2WLH A;  2E1H A;  2QM7 A;  3OUS A;  4Q6G A;  1AJN A;  2ALY B;  2XGT A;  4DQ2 A;  3VOU A;  3CCQ V;  2I4M A;  4YYE A;  3PZC A;  3NEM A;  3PCO A;  3G71 V;  2IJK A;  2DYR B;  4UV8 A;  1QE0 A;  3L4G A;  2XAH A;  1R73 A;  2DXT A;  3AG2 C;  2WLL B;  3TEG A;  3ZMV A;  3MF1 A;  2DYR C;  2WLI B;  1EQR A;  1YB3 A;  3OEE G;  1NJ6 A;  4JTC B;  2E3C A;  3JD0 A;  4LP8 A;  2CGH A;  2HG5 C;  4YP0 A;  5E3I A;  3RKX A;  4MSW C;  4YRT A;  2YEV A;  4KQE A;  4GX2 A;  4Q20 A;  3T2M A;  4U7N A;  4BAY A;  3AG3 C;  1MAB G;  4RUE A;  3HPL C;  4UVC A;  1BHB A;  1HTT A;  1DTO A;  2Y69 C;  3AG3 B;  1G5I A;  2DZ9 A;  4PA4 A;  3CCE V;  3JYC A;  2Q7G A;  5B1A B;  1AI5 A;  1R3L C;  3JD2 A;  4LC1 A;  2E64 A;  3UKM A;  3GWO A;  4MVO A;  1R3I C;  3ABM B;  1C0A A;  2Q5H A;  3M99 B;  3LDC A;  3SPI A;  4PDM A;  5LGT A;  2ZT7 A;  3ZRS A;  3ZMU A;  3STL C;  3TK1 A;  3ASN B;  3STZ C;  2Q7E A;  1NJ5 A;  4RQF A;  1OCR C;  1YI2 V;  2IJJ A;  3K0D A;  1KC8 W;  1PYS B;  1SER A;  2RHS A;  5F5W A;  5K1P A;  2ZT5 A;  3K0G A;  2XND G;  3IFX A;  4LBE C;  3V7C A;  1ASY A;  2ZIO A;  5HFM A;  3FB6 C;  2IW5 A;  1YFR A;  1RPO A;  3E8H A;  3T4D A;  3VQY A;  1K33 A;  3D3I A;  1PNM A;  4BIU A;  4QJF B;  4YRS A;  1B6Q A;  3KFU A;  1RM1 B;  1USY C;  3K3W A;  4G27 B;  1FXK B;  2I4L A;  1I5X A;  2UXX A;  5CBG A;  5CBF A;  2QE7 G;  4I9W A;  1Q81 W;  1DF5 A;  3LSS A;  3MHS C;  4BW9 A;  4E51 A;  3TUP A;  4PHC A;  2Q68 A;  1DF4 A;  3OAA G;  1E1Q G;  1YFS A;  2XTI A;  2IU3 A;  2I4N A;  3JD3 A;  4P2Z A;  1E1O A;  5EBM C;  1E1R G;  3OMI B;  1YGB A;  1K9M W;  4LVI A;  2ITC C;  3RL6 A;  3AG4 B;  2P6J A;  1VQN V;  1YJN V;  2EIJ B;  3ABL C;  3WG7 C;  2DTI A;  2W0F C;  3ZMS A;  3A74 A;  3REU A;  3AG4 C;  1H2G A;  5ELO A;  1KP3 A;  3FB5 C;  5EC1 C;  5LBQ A;  2EL9 A;  1J5W A;  1V55 C;  2OCC C;  4R8C A;  3RKW A;  2WLM A;  3R65 A;  3LNM B;  1SRY A;  1BBU A;  2Y48 A;  3PJS K;  2ATK C;  3SYA A;  3ZN0 A;  3DSQ A;  3ASN C;  5LHG A;  1S76 D;  2KB1 A;  2DW4 A;  4P9P A;  1Q7Y W;  4TWK A;  4XBF A;  4TVA A;  4HAM A;  2A0L A;  2IJH A;  1VQZ A;  4P73 C;  5L3F A;  4ZBM A;  1G8M A;  1JJC B;  1H4T A;  1HXD A;  2QHT A;  3UFG A;  1R3K C;  3BFM A;  3ERR A;  3VQV A;  2PI4 A;  2DXU A;  1GM9 A;  1MSW D;  3OM3 B;  4PEL A;  2ZR2 A;  4QPJ A;  5J9P C;  2H94 A;  3CD6 V;  1L0W A;  3OGC C;  3SJQ C;  4HWS A;  2V7Q G;  3ZRX A;  1OHH G;  2ZT6 A;  4YRG A;  2IJI A;  3EHB B;  2ARS A;  2DVE A;  4UP8 A;  4YRI A;  2IY5 A;  2WWW A;  3E89 A;  4I5S A;  3LDE A;  1XL6 A;  1ADY A;  4YXW G;  2DTO A;  3WQZ A;  1GKF A;  2DU7 A;  2ZIN A;  4FMT A;  5IYD O;  2EJF A;  4FPP A;  2I4O A;  1HC7 A;  1CEZ A;  3JD4 A;  2ZXW C;  4BWA A;  3HXU A;  1NYQ A;  1M56 B;  5CN0 A;  3UH0 A;  1EZJ A;  2FTK A;  1K34 A;  3QTC A;  3MF2 A;  2GHY A;  4OP0 A;  1YIT V;  4YCU A;  4WFB V;  2P5I A;  1YSC A;  4DXW A;  4PDV A;  3QO7 A;  1KQS U;  3FYI B;  1GM8 A;  2AMC A;  2ZDI C;  5DN6 G;  2EIN C;  2WLK A;  2YEV B;  4CZZ A;  5L3B A;  1KP2 A;  3ZMZ A;  3A32 A;  3HRI A;  2ZD9 A;  3LUT B;  2B5U A;  2ZZF A;  4P3N A;  2DYS C;  5IY5 C;  3KG2 A;  3CCS V;  4XTW A;  4XU3 A;  3K08 A;  1IL2 A;  1Y66 A;  1PNK A;  1NH2 B;  3HXZ A;  1S72 V;  4YRP A;  4RAI A;  4YPF A;  4TVY A;  2XOK G;  4GT1 A;  2OT5 A;  2IU0 A;  1Q86 W;  2QM8 A;  3A7U A;  1OCO C;  2QKS A;  4CS3 A;  1EOV A;  1EVL A;  1W2B U;  3ABK B;  4UVA A;  2X7R B;  1AJP A;  1OCO B;  1AR1 B;  1NJI W;  1EVK A;  4TQF A;  4CH3 A;  1LNQ A;  3T1C A;  4H2S A;  4JYB A;  1KEC A;  4CH4 A;  2WAM A;  2HNI A;  3CCR V;  1GTO A;  2EIM C;  2X6C A;  3SYO A;  4RQE A;  3SYC A;  1PYS A;  3CCU V;  4MVU A;  4MVZ A;  1B76 A;  4J15 A;  5B1O A;  4TQD A;  1NR1 A;  4OXS A;  4XU1 A;  3QO5 A;  4YRR A;  3A7A A;  4LCU C;  4QE9 A;  3FB8 C;  2EIK B;  3L2Z A;  1K3E A;  1R6K A;  1AI7 A;  1NNH A;  4P3P A;  1FXK A;  3QNE A;  4P72 A;  2JDI G;  3BEH A;  3OFN G;  3RBZ A;  3V8J A;  1K4D C;  5L3G A;  2HFE C;  3P32 A;  3B77 A;  2E5A A;  1NVP D;  1MOF A;  4N21 A;  5CMU A;  4YRN A;  3HY1 A;  5IY5 B;  5LHH A;  3FYE B;  2P0L A;  5EBW C;  4R50 A;  1Z7M A;  1K5Q A;  3V8K A;  1NJ2 A;  2ZGW A;  1OCZ B;  1RIQ A;  2PME A;  5C93 A;  3LDD A;  4MTX A;  4TT3 G;  1K92 A;  5LGU A;  3I7F A;  1OCZ C;  4RDX A;  1YJ9 V;  5B1B C;  4XTY A;  5B3S C;  2OTL V;  4P71 C;  4LVK A;  2QA4 V;  4WFE A;  3VBB A;  5EC2 C;  2AKW A;  2CJB A;  4UV9 A;  3MD0 A;  2H8P C;  2EIM B;  1AI6 A;  3SYP A;  1VQM V;  1G5H A;  4H2U A;  1Z7N A;  2X0L A;  2X6A A;  4RO2 A;  5HFL A;  5K1X A;  1JJC A;  1SZT A;  2LFR A;  2WLI A;  5L3C A;  4LVM A;  3ML0 A;  4KFM A;  4MTO A;  1F4N A;  1PKX A;  1QVG U;  2ZZE A;  3MQZ A;  1Y4M A;  4MVS A;  1FXH A;  2W6I G;  4HZ3 A;  1X2H A;  4HWP A;  2IH1 C;  1FYF A;  4MS2 A;  4XTZ A;  3A7R A;  1IXM A;  3ABM C;  4YRQ A;  5C53 B;  4KR2 A;  1RPR A;  1GM7 A;  3IAL A;  1NR7 A;  5IYB O;  3ZJZ A;  4GCZ A;  2DWE C;  4PA6 A;  4UP7 A;  4YRO A;  4YCV A;  2ZR3 A;  3ZRV A;  3A5Z A;  1QF6 A;  4MVR A;  1YIJ V;  2EWN A;  1WPX A;  4CBC A;  2ZT8 A;  4JGS A;  3HY0 A;  2ZXF A;  1WU7 A;  2XAS A;  4BW5 A;  2DJZ A;  2WLJ A;  2AHY A;  3FKS G;  3RAC A;  4YRK A;  1W66 A;  2JEU A;  1B8A A;  3RGL A;  3EFF K;  1YJW V;  3MHH C;  1KMN A;  2UXN A;  3IG2 A;  5EK0 A;  3W7W A;  3BY6 A;  1ROP A;  3ABU A;  1QVF U;  4G84 A;  4UVB A;  4P72 C;  4XDL A;  5KA6 A;  2EIL C;  3OUF A;  4HVC A;  1E79 G;  2E10 A;  5DM6 V;  2NS6 A;  2DWD C;  1CPY A;  4K87 A;  1MG1 A;  1K7D A;  1W0K G;  4PDL A;  2WLN A;  1B70 B;  3OE7 G;  2C8M A;  5ELN A;  2E65 A;  1UJW B;  1QLE B;  1YFT A;  1K4C C;  2RHQ A;  4ZTZ B;  4N23 A;  5L3D A;  3CCJ V;  1K73 W;  4CH5 A;  4XU2 A;  3UGQ A;  4LVL A;  4WJ4 A;  3SPH A;  3M4P A;  3E8B A;  3HB3 B;  2P7T C;  1WYD A;  2CK3 G;  3AG1 C;  4FK5 C;  4MT8 A;  2OTJ V;  3ICA A;  4QPK A;  3T4Z A;  5CBH A;  3MEY A;  3IKL A;  4EKW A;  3OW2 U;  4CH6 A;  3G1Z A;  2XAG A;  1GO3 F;  5H6R A;  3A0R A;  1VQ7 V;  2D3O W;  1B7Y B;  3HXX A;  2ZTG A;  1OCR B;  1KMM A;  1YTF B;  1B7Y A;  4H02 A;  4LNS A;  4YRM A;  3LSQ A;  1J95 A;  1FS0 G;  2B1I A;  1VQL V;  3CCV V;  1PNL A;  2AHZ A;  1M90 W;  4U7O A;  4XDJ A;  1VQP V;  4H2V A;  4YCW A;  3AG2 B;  3VQX A;  4JTA B;  4YRE A;  3EFS A;  5LHI A;  1KKD A;  4X88 A;  2J3L A;  3K06 A;  3A31 A;  1P7B A;  3I56 V;  3GB7 C;  4KR3 A;  2FYK A;  2HLD G;  2ZDI A;  1JCH A;  4TVA B;  1ASZ A;  4WI1 A;  4FJC C;  2M7W A;  3JCZ A;  4PA7 A;  2ODR C;  1H38 A;  2F43 G;  1H8H G;  1USY A;  3R07 A;  3CME V;  4PA3 A;  1BBW A;  4P75 C;  4HT4 A;  4XEO A;  1KOG A;  2NLJ C;  3E86 A;  4H33 A;  2B1G A;  4KUM A;  4WF9 V;  4GX1 A;  3ETG A;  12AS A;  3ZCC A;  5H6Q A;  5FL7 G;  3RIR A;  1QLE C;  2QHU A;  3P30 A;  1K5S A;  2ZIM A;  4P30 A;  2LFS A;  4HWT A;  1SES A;  2V1D A;  3ZRW B;  3OD1 A;  4X89 A;  4ZIB A;  2EIJ C;  3ABL B;  4WFH A;  3WG7 B;  1M56 C;  5IYC O;  3CCM V;  2Q5I A;  1FFT B;  4NCX A;  5KUK A;  5GW7 A;  2JIZ G;  4E2L A;  3CMA V;  3FJP A;  11AS A;  4YDQ A;  4H2Y A;  4HWO A;  5C51 B;  2WLL A;  4J9Z B;  1ATI A;  3PCO B;  3K03 A;  3L4G B;  1XL4 A;  1S0V A;  2CJA A;  3P8Y A;  1VQ6 V;  4R6Z A;  5E1A C;  3LC0 A;  4HA8 A;  2YSU B;  2DTH A;  4H37 A;  2A9H A;  2LP7 A;  3TET A;  3VQW A;  3V7S A;  4JAV A;  4TTV A;  4F4L A;  2JJ1 G;  4Z1M G;  1GK9 A;  4KP4 A;  3RVY A;  4K86 A;  3HXY A;  2EAY A;  1PD3 A;  1WQW A;  1AI4 A;  3CYO A;  3K04 A;  3ABK C;  1X54 A;  4XDK A;  3HFV A;  2ART A;  4DPG A;  4EX5 A;  2EJR A;  1F4M A;  1CP9 A;  4H2T A;  1JPX A;  3W7U A;  1R6N A;  3E83 A;  2E41 A;  2Y69 B;  1Q82 W;  1YHQ V;  4DO2 A;  1M1K W;  1WQ7 A;  3HXW A;  3RKY A;  4JAS A;  5B1A C;  3SPC A;  3SYQ A;  4MW8 A;  1VQ8 V;  2HJF C;  2DQ3 A;  4QE7 A;  2A8E A;  1THZ A;  4P71 A;  4Q15 A;  1N8R W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...