2DQ3A

Crystal structure of aq_298
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
425
Chain Sequence
MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGTDVIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seryl-tRNA synthetase
publication title Crystal structure of aq_298
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 133
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dq3A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dq3A02
1E22A 1H4TA 3W3SA 4YCWA 3RUXA 2Q7GA 4OLFA 2E5AA 2ZT5A 3G1ZA 1WU7A 4P71A 1H4VB 3HXXA 4NCXA 3A31A 3L4GA 2ALYB 1PYSB 1BIBA 3A7UA 1Z7NA 4P73C 1USYC 1B70A 1B8AA 4BW9A 4H02A 2Q7HA 1GGMA 1BBUA 4ZTUB 3LSSA 2ZIMA 3IALA 3IG2A 4HWPA 4XU2A 4RQEA 3A7RA 2I4OA 4TTVA 4P3NA 1NNHA 5KNNA 5C52B 2EWNA 3HFZA 2AMCB 3I7FA 3V7RA 3VQYA 1JJCA 3V8JA 4XEOA 2AKWB 4HWSA 2CJAA 4XTUA 3A5YA 2DQ3A 4H2XB 3LSQA 4G85A 4LNSA 2RHQA 1B7YB 4TQDA 1WQ7A 3KFUA 4P75C 4TVAA 1KOGA 4UPAA 4KR3A 1KMNA 1EVLA 3MEYA 1NJ1A 1WLEA 3R07A 3EFRA 1X2HA 2E41A 2Q5HA 2XTIA 3RACA 3MF2A 2ZNIA 1X55A 5C53B 4J15A 2DVEA 1WQWA 1L0WA 3M4PA 2IY5B 3L4GB 2QHTA 3E9IA 4UP8A 2FYKA 1B70B 3OD1A 3A5ZA 4EX5A 4YRKA 1G5IA 2PMFA 4YRGA 3HFVA 4HWOA 4XTYA 2ZT8A 1ASZA 3PZCA 1G5HA 4EO4A 3RL6A 1EIYB 3HFZB 2DZCA 1YFTA 1N9WA 1YB3A 4RQFA 4H2TA 1JJCB 1WPYA 2ODRD 3P8YA 3VQWA 1ADJA 4YDQA 3WQZA 4K87A 2ARUA 4UP7A 3V7SA 1QF6A 4P3OA 2ZNJA 4TVAB 3QO5A 3RF1A 3A32A 4WI1A 3RKXA 4YPFA 5F5WA 4DQ2A 2QHUA 4PHCA 11ASA 2DJZA 1FYFA 1EQRA 4YRSA 3HY1A 12ASA 1WNLA 3QTCA 3VQXA 4L87A 3LC0A 2ZXFA 4YRMA 2I4LA 2P0LA 3IKLA 1B76A 4P73A 1SERA 2J3MA 3CMQA 4P3PA 1SESA 4HA8A 3P8TA 2CJ9A 1Z7MA 4P74C 2PMEA 4YCUA 1EFWA 2XGTA 3PCOA 4Q6GA 1X01A 5HGQA 4H2SA 4YROA 4HWRA 4WJ3M 1ADYA 3HXVA 3HRIA 2DZ9A 1NJ2A 3DSQA 1W66A 5C51B 2E1HA 1YFRA 3QNEA 4P75A 2I4NA 3FJPA 2DU7A 1LYLA 4RDXA 1QE0A 4UP9A 2ARTA 2Q5IA 4X5OA 4TQFA 1H4QA 4RMFA 1YFSA 4P72C 3VBBA 4HVCA 3V7CA 4CS2A 4ZIBA 3V8KA 3NENA 4KQEA 3M4QA 1H4SA 2CJBA 3REUA 2DKGA 2ARSA 4YRFA 2EAYA 3NETA 4H2YA 4ZTZB 2ZINA 3L1AA 4XTZA 2RHSA 4CH6A 2C7IA 4K86A 2EJFA 2EJ9A 4AH6A 4XTVA 1NYRA 2AMCA 1C0AA 2E64A 4TVYA 3ERRA 3PCOB 2DXTA 1KMMA 3TEHA 2RHQB 1EOVA 4O2DA 1NJ5A 4PG3A 1X56A 4XU0A 4YRTA 3HXUA 1B7YA 3RGLA 4TWAA 4YRRA 3HXWA 1HC7A 3RKWA 4P71C 4YYEA 3E9HA 4KR2A 2I4MA 3HTZA 4XU1A 2ZR3A 3VQVA 2J3LA 3HXZA 4YRNA 2ZZGA 2HNIA 1HTTA 2EJGA 4CH5A 4WJ4A 1USYA 2IY5A 5E3IA 4CH4A 4K88A 2DTHA 3NEMA 1ATIA 1NYQA 1IL2A 1VQZA 1RIQA 4YRJA 4XEMA 4XTWA 2DEQA 5ELNA 2ZZEA 3HY0A 4Q15A 2RHSB 4XU3A 2DQ0A 3BFMA 1EIYA 1NJ8A 5K1PA 2ODRC 4P74A 2ZT7A 1SETA 3UGQA 1J5WA 4YRQA 1SRYA 4YREA 3RIRA 1WYDA 2ZCEA 3UH0A 2DTOA 3TEHB 4E51A 1E1OA 2ZTGA 3QO8A 3UFGA 4CS3A 2E3CA 1ASYA 3A74A 3EFSA 1HXDA 3A7AA 3L2ZA 4TVWA 1NJ6A 3TUPA 2EL9A 4H2WA 5K1XA 2QHSA 4G84A 2ALYA 1PYSA 2DTIA 4YCVA 2DU5A 2ZIOA 5ELOA 2CIMA 4BWAA 1E1TA 2ZT6A 4OP0A 3P8VA 4P72A 2DDZA 2CGHA 4YRCA 3V8LA 1BBWA 2ZR2A 3QO7A 4CS4A 3BJUA 3REXA 2G4CA 4XTXA 4DPGA 1X54A 4CH3A 2QHVA 4HWTA 1BIAA 1X2GA 3NELA 2DXUA 2P5IA 2AKWA 3TEGA 2C8MA 4YP0A 4YRLA 1G51A 4H2XA 2E65A 1E24A 4H2UA 3UGTA 3HRKA 2Q7EA 4H2VA 2E10A 3MF1A 2ZZFA 4YRIA 2ZGWA 3ICAA 3IKMB 3RKYA 4YRPA 3HXYA 4WF2A 1YGBA 1EVKA
chains in the Genus database with same CATH superfamily
4LF9O 3W3SA 4K8XA 4X9QA 1NVPB 3RUXA 3AK2A 3K58A 4YJ3B 2E5AA 1VQ5V 4GKJB 5IJ0B 4DR4O 3D8CA 4JV5O 2EIMB 1WA8A 3SYAA 1IBKO 4RO2A 4JYAO 3E22B 3CPWU 4Z1VA 2W6JG 1GN6A 1B70A 4BW9A 2ETNA 3Q4HA 2BOBC 2QGNA 1GGMA 3UKMA 4GX0A 1PP9H 4ZTUB 2E5LO 1NZ6A 3LSSA 2RN9A 3IALA 2EIJC 4O4JB 3A7RA 4PJ0Z 2I4OA 4I7ZB 1OV9A 1FFTB 5KNNA 4JI3O 3WU2Z 4JI7B 2ZE7A 5JVDA 4NR1A 4WFBV 2AMCB 3HFZA 1OCRB 2EIKC 1HNZO 2OIGA 1XMQB 3V8JA 3KKYA 4X64B 4DUYB 1KD1W 4BIUA 3A5YA 4X1IB 2DQ3A 2VWKA 1JFFA 2Y69B 5GTHZ 1M56B 3K5MA 3FYIB 3B8MA 4MVZA 4FZ1A 4WF9V 3KFUA 3ML0A 4P75C 2OT5A 1AILA 1KOGA 4AILC 3CYOA 3E8BA 5DEDA 2JJ2G 3ZBHA 4FPPA 1EVLA 2ZXWB 2ZKOA 4LVLA 1JA8A 2QM7A 2ITDC 2KB1A 3EFRA 3GWOA 1SQGA 3L71H 4GX2A 1SQPH 2DWEC 3THOA 3RYIB 3CD6V 3HKCA 1WQWA 1YEWA 3M4PA 1AP6A 2IY5B 3MHHC 3L4GB 4UP8A 1R3IC 3JATB 1V55B 5IYZA 2FYKA 4ZKIA 3A5ZA 4MTOA 2HJDA 3HFVA 2Q6AA 3BEHA 4U3JB 5B3SB 1WPXA 3CS5A 4FLUA 4XTYA 4DR1O 1G5HA 1GM9A 1THZA 5B5EZ 2MW2B 3RL6A 2AZ0A 1EIYB 1YXBA 2LP7A 3CCLV 1Q7YW 4LC1A 1J5EB 2P7TC 5L3DA 2C2AA 1K7DA 2AXTZ 4DUZB 3P8YA 4YDQA 4NYKA 5LP6C 4K87A 3ZCCA 5L3GA 2QWPB 5EBLC 1CEZA 5GTIZ 5IT9N 4UP7A 3V7SA 4UVCA 2ZNJA 3T1YO 1QR9A 2EILC 3DGEA 1SA0B 3QO5A 2UUBO 3RF1A 1XDCA 1FD9A 3AK1A 3BHPA 4UVBA 5CA3A 3EXAA 2N04A 2LO1A 4UCRA 2JEUA 2W0XA 11ASA 5IY5C 3S3WA 4YRSA 3ASNC 12ASA 1KP2A 3VQXA 4BIOA 2JK5C 5JH7B 2ZXFA 1QU7A 1XOUA 1N34B 1TUBB 1M9NA 3ASOB 1B76A 4Q20A 1FS0G 4P30A 2VQFO 1AI6A 2J3MA 3AG2B 2UXNA 1SESA 3A0HZ 1I5XA 1HDJA 3RWRD 2CTWA 1Q81W 3OD4A 1VQOV 2QTSA 2Z5UA 5EZYB 1EFWA 4LFBB 2QKCA 4DR3O 2R70A 4YROA 1GH6A 2HVKC 4QNHB 2L6LA 1SZXA 1OHHG 1ZWIC 2DZ9A 4N21A 2FB5A 2ITCC 4ABMA 5J2UA 2JGDB 1BS3A 3W7TA 4GCZA 4H37A 3K5OA 4Z2WA 4I0XB 5IJ9A 4D7SA 3E89A 1YJWV 3SYCA 2GDSA 3QNEA 2P6JA 5KA5A 2I4NA 2OYQA 4RDXA 2XNDG 3A8TA 2WLLB 4PI0A 3SJAC 4UP9A 2ARTA 3STLC 2EJRA 4H44B 5FNVB 4RMFA 1IBLB 1YFSA 1N33B 4P72C 4DR6O 1VEWA 1VP7A 4UVAA 5D5PA 1VQMV 1BCCH 1KYOF 2JDIG 4FZ0A 4DXWA 1KUQA 3OE7G 1OCRC 3SPCA 2DKGA 3JARB 1SC5B 2ARSA 4J42A 4YRFA 2JS3A 4QIWF 5CA1B 3L70H 1TA8A 2Q0OC 4FLXA 2GHYA 1N8RW 2ZM6B 2RHSA 4DV6O 2EJFA 4DV1O 2AMCA 4L8JA 4QJFB 4WBNA 3CHXA 1K4CC 3CSXA 4W4KA 4IHJB 4JI4O 4MTGA 4TV9B 3OTOB 3GB7C 2DYRB 3ERRA 1Z5VA 5LA6A 4PA4A 3WB2A 2JRIA 2RHQB 1EZJA 1UPGA 1FFXA 3CRMA 4BR6A 4O2DA 4XU0A 4PG3A 2ZXWC 2ZT9B 2ODMA 3H1IH 2UUAB 3WG7C 5J2TB 1HNWO 3G4SV 2OIEA 3A0BZ 3IGAC 2CUGA 5H6RA 3W7XA 3HXWA 4K8ZA 2V1DA 4UB8Z 4NXMB 3KG2A 2QKSA 4P71C 1NR7A 3E9HA 4RUEA 3HTZA 4MTFA 4XU1A 5CN0A 1URFA 2QDOA 5HFMA 1FXKB 4O4IA 3CJHB 4P9OA 4PDVA 1L8DA 3HXZA 3ZMVA 3ABMC 3CMAV 2IM9A 4DV0B 4UCTA 1MZEA 3P32A 3OMNB 3RYIA 1BHAA 3SYOA 5B3SC 1USYA 2IY5A 1IBMB 3GWKC 3N27A 1GN4A 2CH7B 5E3IA 2YXHA 2R9AA 4XDJA 1H2GA 2CTPA 1ATIA 4ZHQB 1J95A 4JTAB 3SJCC 4XEMA 2DEQA 1XUQA 1DF4A 4U3JA 1VF5B 3P30A 3E86A 3HKEB 3L75H 1F4NA 3BFMA 5LMNB 1EIYA 3TCUA 1SZTA 4LP8A 2OTLV 3HB3B 2ZT7A 1Q3EA 1OCZC 2F66C 1J5WA 2W0FC 5EBMC 4YRQA 3BAAA 1SRYA 1S76D 3UT5B 1F23A 1M93A 1SQBH 3EHBB 4J10A 4D7TA 1SQFA 2DTOA 4LWSB 2ZTGA 4CS3A 3OGIB 2DOSA 2R9IA 2UXDB 3U10A 4X65O 1BMFG 1YSCA 2RMKB 4RUFA 4MS2A 1KP3A 3A7AA 4MVMA 4TVWA 3UO2A 1NJ6A 1FJGO 3TUPA 2Y4TA 3ZRSA 5K1XA 3ASOC 1JOYA 2QHSA 1S5JA 2YIAA 1S3JA 2F23A 2CIMA 1F4MA 1Z5WA 4BWAA 3R65A 4BAYA 2HG5C 2ZT6A 1GMGA 3F5TA 1NBMG 2O57A 3QF7A 4I55A 3P8VA 1FXVA 1P49A 1CXZB 1X4TA 2BTQB 4O4LB 4YJ2B 3WFVA 4CS4A 3A2FA 5CMUA 3REXA 2FTKA 4XTXA 1IDSA 4AHCA 2EIJB 2P5IA 2AKWA 4YP0A 5BR8B 5GONB 3SJBC 2CDYA 4H2XA 1KB9F 3TETA 2P5OA 4H2UA 1TVKB 2LFRA 2EIKB 3T1HO 2Q7EA 3ZHTA 1R1BA 3OUSA 4UV8A 2E76B 5B1BC 2OCHA 2JGDA 4ZI7A 4O2BB 4YRPA 1BHBA 1K34A 4I0XA 2HHHB 5LGUA 3LDEA 1H4TA 3JSNA 1ZTEA 2Q7GA 3ZMUA 5IE9A 4K0KO 3T1CA 5CA0B 5FNVA 1QLEC 1H4VB 1H38A 3HXXA 1XNRB 2QWQB 2K9PA 1VQNV 1KBHA 4PV1B 4F4LA 2ALYB 1BIBA 2DE0X 2JGUA 4P73C 4U7NA 1B8AA 2NLJC 1JCHA 4MVSA 2E5LB 2ADQB 4GUNA 2ZIMA 4UCSA 5JCOA 3FD9A 4XU2A 4FM2A 1Y76A 4H0LB 1NNHA 2EWNA 1P84F 4N23A 1YIJV 1HNZB 3OEEG 5HFLA 3CCEV 1JJCA 1LUVA 1WP7A 4JTCB 3DC6A 5EC1C 1XL6A 2CJAA 4IHJA 4TV9A 2HP8A 2FL4A 1YCIA 3ZN1A 1FPOA 3BFRA 1Q82W 4DRXB 4JPRA 1Q6IA 4G85A 1RSOB 4B7EA 2RHQA 1RPRA 5EBWC 4OX9B 2WLNA 2XAJA 1MSDA 4PELA 4TQDA 3MHSC 4X89A 2YI9A 4DR5B 2XAGA 5FLXN 4X20B 4TVAA 3CCQV 1H8HG 1FXKC 1MG1A 4KR3A 5LP6B 1YTFB 1I08A 4JI5O 3SPJA 3MEYA 2YUAA 2MK3A 2EILB 2CTRA 1WLEA 1ZL8B 1X2HA 4DV7B 4LF5B 2Q5HA 2IJIA 3RACA 2BTOA 4LF4B 4J15A 4NVPA 5IY5B 4GX5A 1L0WA 4B3SB 3P3PA 3OMIB 2QHTA 2BSKA 3ETGA 3IJ4A 2WLKA 4B3TO 4EX5A 4DV4O 4YRKA 4EB6A 3LDDA 4PHZA 4ZHQA 4YRGA 5LHIA 4JI8B 2IJKA 3TXSA 2HEPA 4HYOA 2F43G 1NS1A 4FFBB 4QPJA 3HKEA 4KXRA 2DZCA 4JI6O 4IL6Z 3ZHQA 1W0JG 1EN6A 3OR6C 2A3QA 3UT5A 3K9SA 2M7WA 1MA1A 1LR1A 4TUYA 1VQ8V 1QF6A 2B5UA 3CXCU 4B3MO 3T1YB 4O2AB 1VMGA 2JVDA 4X1KB 4GZRB 5A2QN 4WI1A 1ROPA 4G2KA 4DQ2A 1XNQB 3WB0A 2UUCO 4XDLA 2F95B 1R3LC 5LBQA 2UXBO 3HY1A 3UCSC 4YRMA 4LF7O 2I4LA 4IYHA 3IKLA 4IYIA 2VQFB 4JI0O 4MVUA 3CMQA 3K79A 3KCXA 4X66O 4NKGB 1L0NH 4JASA 4PA9A 3P8TA 3W7SA 1Z7MA 4FK5C 4P74C 2PMEA 4J9YB 4DR3B 1XQ8A 5LOVB 3O65A 3T4ZA 1I94O 3PCOA 5HGQA 4PA6A 3C90A 5KX5B 1TVKA 1UFIA 4KHPO 1ADYA 4DV2O 4XDKA 3HRIA 1AROP 3ETEA 4R50A 3I55V 3ZHSA 3H01A 4FLWA 4MW8A 5TISZ 2YDEA 4FJCC 3DSQA 1I0HA 2WLJA 1N36O 1W66A 1SQQH 2UXCB 5C93A 1AJPA 4GKKB 3EFFK 1F51A 5IYDO 4GX1A 3WG7B 5JQGB 1U97A 4LCUC 4LF6O 1YFRA 2AHZA 2QM4A 4DV5B 3K3WA 4D6TH 3FJPA 4P75A 2CE4A 3L9DA 1XREA 4AQYO 1QE0A 2JEXA 4TQFA 1H4QA 4LFCB 4J7ZA 1QR8A 4G28B 3CB2A 1K73W 2RNBA 4DW0A 2WLMA 2KG7B 3D36C 4X62B 4CS2A 1XHXA 4ZIBA 4F6EA 3V8KA 3NENA 3AG1C 1GM8A 3B09A 3ABMB 1QBZA 2BCCH 4FIPC 1H4SA 2CJBA 2IU0A 2WA4A 2B9ZA 3M8AA 2PF4E 2EAYA 4JI1O 2ARHA 4ZTZB 2ZINA 4DV6B 4XTZA 4B3RO 5LXTB 1QHTA 4CH6A 3G71V 1R6TA 4AH6A 3UO3A 3ZHVA 5LMUO 1C0AA 4IIJA 1HR0B 4I50B 4JI4B 1V9PA 3KCYA 5B66Z 1HP8A 3LNNA 3JAKB 3TEHA 2OWOA 3G80A 2HFEC 3FX7A 3K57A 1EOVA 3K04A 5EYPA 3IFXA 1X56A 3CP1A 1OCZB 4LH6A 3HXUA 5KLVH 1XMOB 1DF5A 1I5YA 2PTMA 3RGLA 4PD4F 1PPJH 2AHYA 3LDCA 4TWAA 1VF6C 3RVYA 3SGIA 1HC7A 1GK9A 4F6RB 4LVJA 5LP6A 2QWRB 1I7FA 1K33A 2D3OW 5ITZB 4YYEA 4NXNO 4YHHB 2I4MA 1S0VA 3CC4V 1R3JC 1NKDA 1ZL8A 4KFMA 1SKVA 3W7UA 3BVOA 2NN4A 3SPIA 3APQA 4YRNA 3E83A 3K0DA 1EBOA 2XUMA 4CH5A 4WJ4A 1OCOC 2CK3G 5C8YA 2YEVB 1K4DC 4JAUA 5KMGB 3ICXA 4TV8A 3NEMA 2WA3A 2PYLA 5LL6Y 3FB5C 1VQZA 4YRJA 3JASB 2ZE8A 1RM1C 3UM7A 3SDLA 1ZAUA 3JSLA 3FAVB 4X1YA 4FFBA 4LNUB 3C3TA 1GKFA 2ODRC 3RN4A 1PNMA 1E1RG 3NR7A 1XMQO 2CGOA 1MNGA 4PI2A 4X64O 1WYDA 2ZCEA 1JJOA 4DUYO 3F7YC 4CC5A 1PL0A 1M1KW 2XT9A 3HR0A 3JD0A 4J11A 1ASYA 2X0LA 1BSMA 5B1BB 3A74A 3OW2U 3EFSA 1Y6XA 1YTFD 2YXYA 3AG3C 1D2DA 4O2AA 3L73H 1N0NA 4HNAB 4YJ3A 3CCMV 5IJ0A 4MTXA 4EFBA 3J81N 3CX5F 1FJGB 2IJJA 3RYCB 5L3FA 2DTIA 2DU5A 2ZIOA 3CEIA 3E22A 3H1JH 3JCZA 4OP0A 1QLEB 5IWAB 4EEQA 4MSWC 4P72A 4FM0A 1PM9A 3IC9A 2L35A 3JALB 4O4JA 3HPLC 3V8LA 2EULA 3UQ8A 2GUZB 2DYSB 2IH1C 2ZR2A 4JYCA 4B08A 1IXBA 3N2GB 1M57C 4HWTA 2Q69A 3NELA 2DXUA 2YXLA 3FFQA 1AJNA 1AP5A 4FLVA 3CRRA 5LOVA 4YRLA 4X1IA 2OCCC 2YIBD 4UUJC 3UGTA 3HRKA 2CAZC 1M5IA 4H2VA 2UXXA 2E10A 1N4CA 1U96A 2H94A 2ZZFA 1F7YA 2IW5A 4DV3O 3IKMB 5B1NA 2PGGA 2P4VA 4JI2B 5CBHA 1J5EO 2BE3A 3O9OA 3HKDB 1EZVH 4WF2A 1L1FA 3CRCA 4DUZO 1Z2GA 2AW9A 1SS3A 3BA9A 2N74A 1EVKA 3OR7C 1CP9A 1PNLA 2DMXA 4YCWA 2HKOA 4FVMA 2QE7G 3G1ZA 1WU7A 2WLIB 4P71A 1NQTA 4O4HB 1Y67A 3SR2C 1R73A 5CBGA 4NCXA 3T4DA 3A31A 4QE9A 3L4GA 1PYSB 3JATA 1USYC 3T2MA 1NH2D 2PI5A 4H02A 5KUMA 1HNXB 3RGBA 4HAMA 2LGQA 2Q7HA 2NR5A 1B6QA 1BBUA 2QWNB 1KC8W 5KHGA 3K06A 3LSUA 1N34O 1A32A 4RQEA 4P3NA 5EIBC 3VQYA 4ZOLB 2D2CB 2H8PC 4XEOA 5KUKA 2LW1A 1YF2A 2YSUB 3BY6A 1MMMA 4XTUA 1N32B 5JJEB 4U7OA 1WNSA 4LFBO 1HW7A 1BE3H 3LSQA 4LF8B 1XEQA 2R72A 4YXWG 1S77D 2B1GA 4MT8A 4LFAB 1WQ7A 2B1IA 3QVNA 5EC2C 4FLZA 1SA0A 2DN9A 4YY3B 3CRAA 1RP3B 2HJFC 1XL4A 4WCEV 4CBCA 4A5UB 2LW7A 4AI8A 5ITZA 2QWOB 1NJ1A 1VQ6V 2Y0PA 2V4DA 4I9QA 3ZRVA 5JH7A 3MF2A 2ZNIA 4UV9A 3ZRWB 1G4YB 1H8EG 1TUBA 4ICGA 5E79Z 2QA4V 1JX9A 1X55A 5C53B 1D5AA 1WA8B 4NTXA 2DVEA 3ZMTA 3E9IA 4MVRA 4B3TB 2YS8A 2QEXV 1N0JA 1Q8IA 1B70B 1VQLV 3DXRB 1G5IA 2A0LA 2PMFA 3Q4HB 1S5LZ 4J9ZB 5EZYA 4JAAA 2IBZH 3JASA 3B2EE 3BABA 2ZDIC 4HWOA 4DR7B 1PNKA 3G6EV 3PZCA 3FB7C 3ZS8C 3FAVA 4JI6B 2ZM6O 3HFZB 1YFTA 1K3EA 4LNUA 1YB3A 1KMIZ 2UU9O 4G27B 1TUEB 5EIBD 4FM1A 4RWUA 3OTOO 1DLBA 2EZPA 1JFFB 1UJWB 3WQZA 2LGWA 4LF9B 1S5HC 1Y74B 1V54C 1QQCA 2UUAO 1SQXH 1RFYA 2WLLA 2QM8A 1S72V 1VQPV 4DR4B 3A32A 4EFEA 4JV5B 1IBKB 3IC7A 3ZX6A 3MDSA 1IXMA 4JYAB 5LGNA 4NXMO 4PHCA 5KA6A 1G1XB 1FYFA 2FYUH 2DYSC 2VS0A 2ZE6A 1EQRA 1WNLA 3C3SA 5KHHA 2G38A 4L87A 3F5WC 3JARA 3DC5A 1MABG 2P0LA 1VARA 4JZ2A 3JAMN 4DV0O 5CA1A 1QCEA 3CCVV 4JI3B 3AG1B 4P73A 1IVSA 3ABLC 3ZN0A 4HA8A 4UFZA 1YITV 4QGPA 3VOUA 1P7BA 5JJNB 4YCUA 5J9PC 2XGTA 1X01A 4GT1A 4H2SA 4KHPB 4PDLA 3F7VC 4FMTA 1BZKA 2HLDG 3HXVA 2JJ1G 4LVIA 3OAAG 3AG4C 1W59A 2IU3A 4FLTA 3OEHG 5J2TA 1Q6UA 2Z3YA 5KHIA 5IYBO 4I4TB 2P06A 2NNUA 1EN5A 1PKXA 1MSWD 2CGNA 4P9PA 1K8AW 1M90W 1NTMH 3CE2A 4JTDB 1FXKA 3RYFB 2UXDO 4ASUG 2KKWA 3CJHA 3SPGA 3BPZA 4CZZA 4X5OA 4FFKA 4C7UA 1NR1A 2GSMB 5B1AC 2XOKG 2A7WA 4J7JA 4HVCA 2P67A 3M99B 2CH7A 2QR4A 3ABUA 5BXZA 3FKSG 4LVKA 2CTQA 2GV9A 2YICA 4CC6A 3I56V 3FB6C 4JI1B 1OCOB 4BW5A 4DR1B 2Q73A 5H2FZ 3L1AA 1IZ3A 2LFSA 2C7IA 3PJSK 4K86A 2EJ9A 5AG2A 4DO2A 4HBNA 3E2EA 5LMUB 1NJIW 2NS6A 1NYRA 1K97A 1EM1A 1YJ9V 1RM1B 2E64A 1LUWA 2BOCC 2DXTA 5BR8O 1KMMA 4LWSA 4I5SA 1NJ5A 2YIDA 1W2BU 1QLNA 2UUBB 1MZFA 3ETDA 3APOA 5J2UB 3H1KH 2ZE5A 3ABKC 4GYCB 4YRRA 1GM7A 3SJQC 4GLXA 3RKWA 2KSDA 2LQTA 2HHHO 3LUTB 3SYPA 1DTOA 3AG3B 2P22C 1COWG 2A9HA 3VQVA 2J3LA 1QVFU 1GN3A 1IX9A 1RPOA 3E35A 3TXQA 1XILA 3TJTA 2RCVA 3ZRWA 1NH2B 1HTTA 1NU1H 3W7WA 2RJZA 2XAQA 4OPAA 1PD3A 1XNRO 2BTQA 4O4LA 4YJ2A 1AR5A 1H2LA 3DTUB 2DTHA 1GTOA 3HKBB 4K88A 5GW7A 4W4LA 3DXRA 3PN1A 2HVJC 1NT2B 2X7RB 2Y0IA 1EFRG 5GONA 2EJ7A 2ZZEA 5H9CA 2GBOA 4Q15A 2RHSB 4DW1A 1M57B 3CCSV 2DQ0A 4QPKA 3ZIAG 1NJ8A 3ZHUA 1G6UA 3ZRXA 5K1PA 5LYJB 4P74A 4WBNB 1OCCB 1SETA 2OCCB 4EKWA 5LA6B 4O2BA 3UH0A 1JPXA 4E51A 1E1OA 3QO8A 5DN6G 1FFXB 3TK1A 5F2VO 1YZBA 2WSSG 2WWWA 4OX9O 4YIOA 1HXDA 4DR5O 1Y74A 2PY5A 1AI5A 1FAFA 1WB8A 1Y66A 5L3EA 5CA0A 4DR6B 3R66A 5EK0A 4JAVA 2EL9A 4H2WA 4G84A 2ALYA 4YCVA 1AJQA 1NTZH 1E79G 2WAMA 4UXNA 1E1TA 4O4IB 1AR1B 1NTKH 4DV7O 4LF5O 3J7AU 2XAFA 2DDZA 1AVMA 3AG7A 3D36A 3OT7A 5H6QA 5LGTA 4LF4O 4NTWA 5H5NA 4TOIA 5JJJB 4DV1B 1BBWA 3G6BA 4B3SO 3AK3A 1MOFA 3QO7A 3WB1A 3RVZA 4CH3A 1X54A 2QHVA 1BIAA 2EINB 2Y48A 3TEGA 3K0GA 4J41A 4UB6Z 2X6CA 3GVMA 1G51A 2X6BA 2E65A 4JI8O 4DR2O 4DRXA 1O9HA 2VQEO 3N2KB 1RSOA 1AI4A 1BL8A 3MF1A 1WJZA 4YRIA 1HNWB 2PYJA 4DV3B 3ICAA 4X20A 3RKYA 4LBEC 2F4VO 4R6ZA 3JD3A 2E74B 3CMEV 4LR3A 3B4SA 2Q5ZA 4XBFA 4HZ3A 4PDRA 1YGBA 2ZQMA 4I4TA 2N05A 1ZSPA 1E22A 1Y4MA 3MD0A 4MVOA 1VF6A 3RYFA 4OLFA 2Z0AA 4J80A 5IYCO 2ZT5A 2PZSA 4GKJO 4E4EA 1WPBA 3SPHA 3P3NA 2RDCA 3CC2V 1XNQO 4RAIA 3CCRV 3IAYA 1Z7NA 3A7UA 1BGYH 2Q67A 3EVKA 4ZBMA 3BCCH 5BY1A 1PL4A 4I55B 3OMAB 2R9RB 1P7GA 4P2ZA 3IG2A 4HWPA 4E2LA 2KQXA 5BMVB 4TTVA 5C52B 2XAHA 1FKAO 1K5SA 3I7FA 3ETQA 4JI7O 3V7RA 2QSAA 2YIBA 1XBLA 2AKWB 4HWSA 2W6IG 3FYEB 4X88A 4H2XB 3RBZA 4LNSA 4JGSA 4X65B 1B7YB 1OZ0A 2F93B 3TGUH 4X1KA 2VWJA 1WN7A 3I5DA 4UPAA 2LJ2A 4ZI7B 1KMNA 1B3QA 2UXCO 1K92A 3H1LH 4GKKO 3U11A 2K1EA 1FXHA 2XASA 3BRCA 1DGSA 1OJHA 1V54B 2EIMC 4K3AA 3R07A 5A9GA 1R3KC 2E41A 4DV5O 2XTIA 2OTJV 3ZMZA 4BIZA 4MW3A 4YIPA 3JCUZ 2P4KA 3RYHB 5DM6V 4LFCO 3OTFA 1KKCA 4K35A 1WP8A 2A79B 3CRQA 4X62O 1K9MW 3HKBA 3OD1A 4OXSA 1OCCC 4UCUA 1JR9A 1Y76B 1GAXA 3T1HB 2HR3A 2ZT8A 5KX5A 1ASZA 4UCVA 3ABLB 3OUFA 3CC7V 1B04A 4EO4A 1VIBA 5BZBA 2P90A 2Y69C 2UU9B 1M56C 1N9WA 4RQFA 4H2TA 5LYJA 1JJCB 1WPYA 1Q43A 2ILMA 2AZ2A 1HR0O 1WAZA 4TSFG 2ODRD 1XHZA 1FYJA 1AB3A 5KHJA 1YI2V 2GTSA 3VQWA 5CB4B 1ADJA 3AG4B 4OPHA 1NI8A 1US6A 2ARUA 5JQGA 1GO3F 2XHBA 4P3OA 4KP4A 3M7MX 1XMOO 3CXHF 4K0KB 4TVAB 2JS5A 3RKXA 3JAWB 1GRJA 1O9GA 4YPFA 1JMKC 5F5WA 1H2SB 2DW4A 2QHUA 1NVPD 3JD4A 2KG7A 1WB7A 2DJZA 4YHHO 2F1MA 5B1AB 3QTCA 1V55C 3ZHRA 1VQ4V 2X6AA 3CCJV 3LC0A 1HWYA 4QE7A 1KECA 2EINC 4J7KA 3KZIZ 1ZX3A 4I9WA 5LXTA 2BSKB 1SERA 4P3PA 3RW0A 5L3CA 4EB6B 2CJ9A 4I50A 2FMLA 3K03A 4OGQB 1TAEA 2RQ6A 3BA8A 4JYYA 4Q6GA 1VQKV 3JAKA 4HWRA 3LNMB 3B8NA 3J80N 5D5QA 4WJ3M 3N2KA 5L3BA 1NJ2A 3X2QB 4HT4A 2FKXA 1QNMA 4H33A 4DK0A 5C51B 2E1HA 1JJ2U 3JYCA 4JI5B 4F6RA 4JF3A 1L0LH 1QVGU 4TUYB 1YHQV 3ABKB 1P4RA 1K5QA 3K5LA 3RT3C 2YC0A 2DU7A 5IDJA 1LYLA 2Q9LA 4WFFA 1SF9A 4WFEA 2Q5IA 2E75B 5KAFZ 1YVWA 1ORQC 1T5EA 1IBLO 1ENVA 1N33O 3VBBA 1Q90D 1H2NA 3V7CA 4IGGA 1AR4A 2YEVA 2IJHA 4DV4B 5KMGA 4KQEA 1X59A 3M4QA 2Q68A 4LVMA 3AG2C 2EBOA 3REUA 3E8FA 3L74H 5IWAO 1VF7A 1TGOA 3NETA 4H2YA 1Q86W 3ZEDA 5BMVA 3MQZA 1BQZA 5JVDB 1KKDA 1H2MA 1R6NA 4PA3A 4XTVA 4JYBA 1BT8A 5FPOA 1IURA 2ZDIA 4TVYA 3PCOB 4NB5A 2QKAA 1E1QG 3ZMSA 4B3MB 3D3QA 4YRTA 2ADPA 3A0RA 1B7YA 2DJVA 4JZGA 4KUMA 2WPDG 1Q6HA 1G8MA 1VQ9V 4HNAA 1PV0A 4PDMA 4JI2O 2UUCB 2Y4UA 5B1OA 1B06A 4R8CA 4DYLA 3G67A 3RYCA 4KR2A 1ZUQA 1XI1A 2UXBB 2ZR3A 3OM3B 3U0ZA 2GTAA 5DECA 3K59A 4LF7B 2XTAA 1JQ0A 2EZOA 2ZZGA 3RYHA 2HNIA 3JALA 3HKCB 3K9AA 4IT5A 2EJGA 4JI0B 1D5NA 5E1AC 5LHHA 3SYQA 5JCOC 2GUZA 4X66B 3OGCC 1IBMO 2EX3A 4CH4A 5IYZB 3N2GA 1NYQA 1IL2A 1JVMA 3JD2A 1RIQA 1HNXO 1I94B 3L72H 4XTWA 4X8AA 3ABTA 5ELNA 2DYRC 3HY0A 4DV2B 4XU3A 3E8HA 4FLYA 3RFRA 2M6YA 4WFHA 5LMNO 4IIJB 1N36B 4H13B 3UGQA 2ATKC 2QJ1A 2PUSA 2Q4PA 2Q0AA 5JWPA 4YREA 3RIRA 5LHGA 3HKDA 4PA7A 3CWBH 3TEHB 4TT3G 1N32O 4LF6B 2A06H 5CB4A 3UFGA 4Z1MG 4WFGA 5EYPB 2E3CA 4UCOA 2AGAA 4LF8O 3AEIA 1GN2A 1M4UA 4AQYB 4LFAO 1VQ7V 3E8GA 3L2ZA 5KHKA 4B7KA 4YY3O 1KU9A 2WLIA 3D3IA 3JAWA 4O4HA 2DWDC 1W0KG 1CPYA 1PYSA 1YJNV 5ELOA 1EN4A 4R7CA 4MVQA 4LH7A 1LNQA 5FPRA 3B40A 2JIZG 2CGHA 3H1HH 4B3RB 4YRCA 2IH3C 4U3FH 5C8YB 1SQVH 3FB8C 2Q8VA 3ASNB 4DK1A 2V7QG 3K5NA 4KL1A 4TWKA 1YDXA 4TV8B 2YI8A 2ZD9A 3BJUA 2G4CA 3OFNG 4DPGA 5CBFA 1X2GA 3ZJZA 4ZOLA 2VRZA 3JD1A 3X2QC 1KQSU 2PI4A 3MAQA 4NTYA 2A8EA 2C8MA 3QG5A 1R6KA 4DR2B 2VQEB 4DR7O 3STZC 4WFAV 1E24A 3NXSA 4X1YB 1ZLZA 1H2KA 3S3XA 2ZGWA 2H3OA 5FL7G 3B77A 2F4VB 2WLHA 1AI7A 5IJ9B 1Q5OA 3HXYA 4NXNB 3K08A 3H9VA 1BQ0A 2QTOA 3CCUV 1DK1A 5KAIZ
chains in the Genus database with same CATH topology
1E22A 1H4TA 1Y4MA 3MD0A 4YCWA 3W3SA 4MVOA 1NVPB 2HKOA 3RUXA 2Q7GA 3ZMUA 2QE7G 5IYCO 4OLFA 2E5AA 1VQ5V 2ZT5A 3T1CA 3G1ZA 1WU7A 1QLEC 2WLIB 4P71A 1H4VB 3SPHA 1NQTA 1H38A 2EIMB 3HXXA 3SYAA 5CBGA 1R73A 4NCXA 1VQNV 3T4DA 3CC2V 3A31A 4QE9A 4RO2A 4F4LA 2ALYB 4RAIA 3CCRV 1BIBA 1PYSB 3L4GA 4CH3A 3A7UA 1Z7NA 3CPWU 4P73C 1USYC 4U7NA 2W6JG 3T2MA 1NH2D 2PI5A 1B70A 1B8AA 4H02A 4BW9A 2NLJC 5KUMA 2Q67A 4HAMA 1JCHA 2Q7HA 2BOBC 4MVSA 1B6QA 4ZBMA 4GX0A 3UKMA 1BBUA 1GGMA 4ZTUB 1KC8W 3OMAB 3LSSA 2ZIMA 2R9RB 3K06A 3IALA 2EIJC 3IG2A 4P2ZA 4HWPA 4XU2A 4E2LA 4RQEA 3A7RA 2I4OA 4TTVA 1FFTB 1NNHA 4P3NA 5KNNA 5C52B 2XAHA 2EWNA 1K5SA 4N23A 1YIJV 4WFBV 2AMCB 3HFZA 3I7FA 1OCRB 2EIKC 3OEEG 5HFLA 3CCEV 3V7RA 3VQYA 1JJCA 3V8JA 4JTCB 4XEOA 2H8PC 5EC1C 5KUKA 2AKWB 1XL6A 2CJAA 2W6IG 4HWSA 2YSUB 3BY6A 1KD1W 4XTUA 3FYEB 4X88A 4BIUA 3A5YA 3ZN1A 2DQ3A 4U7OA 4H2XB 3RBZA 1Q82W 2Y69B 4JPRA 1M56B 3LSQA 4G85A 4LNSA 3FYIB 2RHQA 1RPRA 5EBWC 4YXWG 3B8MA 4JGSA 2WLNA 2XAJA 4MVZA 4WF9V 1S77D 4PELA 1OZ0A 2B1GA 3MHSC 1B7YB 4MT8A 4X89A 4TQDA 1WQ7A 2B1IA 2XAGA 5EC2C 3KFUA 3ML0A 4P75C 4TVAA 3CCQV 1H8HG 2OT5A 1FXKC 1KOGA 4UPAA 1MG1A 4KR3A 3CYOA 3E8BA 2HJFC 1XL4A 2JJ2G 4WCEV 1KMNA 1YTFB 4CBCA 1K92A 4FPPA 3SPJA 1EVLA 2ZXWB 3MEYA 2K1EA 1FXHA 2MK3A 2XASA 4LVLA 2EIMC 1V54B 2EILB 1VQ6V 1NJ1A 1WLEA 3R07A 2QM7A 2ITDC 2KB1A 3EFRA 1X2HA 1R3KC 3GWOA 2E41A 2Q5HA 2IJIA 2XTIA 2OTJV 3ZRVA 3ZMZA 4GX2A 4BIZA 4MW3A 2DWEC 3MF2A 3RACA 2ZNIA 4UV9A 3ZRWB 1G4YB 1H8EG 3CD6V 5DM6V 2QA4V 1JX9A 1X55A 5C53B 4J15A 2DVEA 5IY5B 4GX5A 1WQWA 1L0WA 3ZMTA 3M4PA 2IY5B 3MHHC 3OMIB 3L4GB 2QHTA 3E9IA 4UP8A 1R3IC 3ETGA 4MVRA 1V55B 2A79B 2WLKA 1K9MW 2FYKA 2QEXV 4ZKIA 1B70B 3OD1A 1VQLV 3A5ZA 4EX5A 4MTOA 4YRKA 4OXSA 1G5IA 2A0LA 2PMFA 3LDDA 4YRGA 4J9ZB 2Q6AA 3HFVA 1OCCC 3BEHA 2ZDIC 5LHIA 4HWOA 5B3SB 2IJKA 1PNKA 1WPXA 3G6EV 4XTYA 2ZT8A 2HR3A 4HYOA 3PZCA 1G5HA 1ASZA 3ABLB 3FB7C 2F43G 3OUFA 3CC7V 1GM9A 1THZA 4EO4A 4QPJA 5BZBA 3RL6A 1EIYB 2P90A 3HFZB 2Y69C 2DZCA 1M56C 2LP7A 1YFTA 1K3EA 1N9WA 1YB3A 4RQFA 4H2TA 1JJCB 3CCLV 1Q7YW 1W0JG 4G27B 1WPYA 4LC1A 4TSFG 2ODRD 1TUEB 2P7TC 3OR6C 5L3DA 2C2AA 1K7DA 1YI2V 3P8YA 1DLBA 2EZPA 3VQWA 1ADJA 4YDQA 1UJWB 3WQZA 3AG4B 4K87A 2M7WA 2ARUA 4P75A 3ZCCA 5L3GA 1CEZA 1S5HC 5EBLC 1GO3F 1VQ8V 4UP7A 2B5UA 3V7SA 1QF6A 3CXCU 4P3OA 4UVCA 4KP4A 2ZNJA 1QR9A 1V54C 2EILC 3DGEA 4TVAB 3QO5A 3RF1A 2WLLA 2QM8A 1S72V 1VQPV 3A32A 4UVBA 4WI1A 5CA3A 3RKXA 1ROPA 3IC7A 4YPFA 5F5WA 4G2KA 2JEUA 2DW4A 4DQ2A 1IXMA 2QHUA 1NVPD 4XDLA 5LGNA 4PHCA 3JD4A 11ASA 5IY5C 5KA6A 1R3LC 2DJZA 1FYFA 5LBQA 2DYSC 1EQRA 4YRSA 3ASNC 3HY1A 12ASA 1KP2A 1WNLA 5B1AB 3QTCA 1V55C 3VQXA 4L87A 1VQ4V 2JK5C 2X6AA 3CCJV 3LC0A 1HWYA 3F5WC 4QE7A 2ZXFA 1KECA 1MABG 2EINC 4YRMA 2I4LA 2P0LA 4LVMA 3IKLA 1M9NA 3ASOB 1QCEA 1B76A 3CCVV 4Q20A 1FS0G 4P30A 4I9WA 3AG1B 4P73A 1AI6A 1SERA 2J3MA 4MVUA 3CMQA 3AG2B 4P3PA 2UXNA 3K79A 1SESA 3RW0A 3ABLC 1I5XA 4JASA 5L3CA 4PA9A 3ZN0A 4HA8A 3P8TA 3W7SA 1YITV 2CJ9A 1Q81W 3VOUA 1VQOV 1Z7MA 4FK5C 4P74C 2PMEA 3K03A 4J9YB 2Z5UA 1P7BA 4YCUA 1EFWA 3T4ZA 5J9PC 2XGTA 3PCOA 4Q6GA 1X01A 5HGQA 4PA6A 4GT1A 4H2SA 1VQKV 4YROA 4HWRA 2HVKC 4PDLA 3LNMB 3B8NA 4QNHB 4DPGA 4WJ3M 3F7VC 4FMTA 1ZWIC 1OHHG 2HLDG 1ADYA 2JJ1G 3HXVA 3HRIA 4XDKA 2DZ9A 4LVIA 1AROP 3ETEA 3OAAG 4N21A 3AG4C 4R50A 5L3BA 3X2QB 3H01A 3I55V 1NJ2A 2IU3A 4HT4A 3OEHG 2ITCC 4MW8A 4FJCC 4H33A 3DSQA 2WLJA 2Z3YA 3W7TA 4GCZA 1W66A 4H37A 5C51B 2E1HA 5C93A 1JJ2U 3JYCA 1AJPA 3EFFK 4JF3A 5IYBO 1QVGU 3E89A 1YJWV 1F51A 5IYDO 4GX1A 3WG7B 1YFRA 2NNUA 4LCUC 1PKXA 3SYCA 2AHZA 1MSWD 4P9PA 1YHQV 1K8AW 3QNEA 3ABKB 1P4RA 1K5QA 2P6JA 3K3WA 5KA5A 1M90W 4JTDB 2I4NA 2DU7A 3FJPA 5IDJA 1FXKA 1LYLA 4RDXA 2XNDG 4ASUG 2WLLB 4WFFA 1QE0A 4UP9A 4WFEA 3SPGA 4CZZA 3STLC 2EJRA 2ARTA 2JEXA 2Q5IA 4X5OA 4TQFA 1NR1A 2GSMB 5B1AC 4RMFA 1H4QA 1QR8A 4G28B 1YFSA 1ORQC 2XOKG 1ENVA 4P72C 3VBBA 1K73W 4HVCA 2P67A 3M99B 3V7CA 2WLMA 4CS2A 2YEVA 4ZIBA 4UVAA 2IJHA 1VQMV 3V8KA 3NENA 3AG1C 1GM8A 4KQEA 3ABUA 3ABMB 3M4QA 3FKSG 1QBZA 2JDIG 4DXWA 2Q68A 4FIPC 3AG2C 3OE7G 1OCRC 2EBOA 3SPCA 2CJBA 2IU0A 4LVKA 3E8FA 3REUA 2DKGA 3I56V 3FB6C 1OCOB 4BW5A 2ARSA 4YRFA 2EAYA 4QIWF 3NETA 4H2YA 4ZTZB 1Q86W 2ZINA 3L1AA 1H4SA 4XTZA 2GHYA 1N8RW 2RHSA 3MQZA 2LFSA 4CH6A 1KKDA 2C7IA 3PJSK 1R6NA 4PA3A 3G71V 2EJFA 4DO2A 3E2EA 2EJ9A 4K86A 4XTVA 4AH6A 1NJIW 2NS6A 1NYRA 1K97A 2AMCA 4JYBA 1C0AA 4QJFB 1YJ9V 1RM1B 2E64A 1K4CC 2ZDIA 4MTGA 2BOCC 3GB7C 2DYRB 4TVYA 3ERRA 3PCOB 2DXTA 4PA4A 1KMMA 3TEHA 1E1QG 4I5SA 2RHQB 2HFEC 1EZJA 3ZMSA 1EOVA 4O2DA 3K04A 1NJ5A 4PG3A 3IFXA 1X56A 3CP1A 1OCZB 4XU0A 3HXUA 4YRTA 2ZXWC 1W2BU 3A0RA 1B7YA 1DF5A 1I5YA 4KUMA 3WG7C 2WPDG 1QLNA 3ETDA 3RGLA 3G4SV 2AHYA 1G8MA 3LDCA 4TWAA 3ABKC 1VQ9V 3IGAC 3RVYA 5H6RA 4YRRA 3W7XA 3HXWA 4PDMA 1HC7A 1GK9A 1GM7A 3SJQC 4LVJA 2V1DA 3RKWA 5B1OA 1K33A 2D3OW 3KG2A 2QKSA 4R8CA 1NR7A 4P71C 4YYEA 3E9HA 3LUTB 4RUEA 1DTOA 3SYPA 3AG3B 4KR2A 2I4MA 1COWG 4MTFA 2ZR3A 3CC4V 2A9HA 1S0VA 3HTZA 5CN0A 4XU1A 3OM3B 1R3JC 1NKDA 5HFMA 1FXKB 4KFMA 2J3LA 3VQVA 1QVFU 4PDVA 4P9OA 3W7UA 1JQ0A 3SPIA 2EZOA 1RPOA 3E35A 3HXZA 3ZMVA 3ABMC 4YRNA 3E83A 3CMAV 3K0DA 2ZZGA 1EBOA 3ZRWA 1NH2B 3K9AA 3W7WA 1HTTA 2HNIA 3P32A 3OMNB 2EJGA 1BHAA 4CH5A 3SYOA 4WJ4A 5E1AC 2XAQA 5LHHA 5B3SC 1OCOC 3SYQA 1USYA 2CK3G 1PD3A 2IY5A 2YEVB 3OGCC 1K4DC 5E3IA 4CH4A 3DTUB 2DTHA 4JAUA 4K88A 1GTOA 4XDJA 1H2GA 5GW7A 3NEMA 1ATIA 3FB5C 1NYQA 1IL2A 1JVMA 1VQZA 3JD2A 2HVJC 1J95A 1RIQA 4YRJA 2X7RB 4JTAB 4XEMA 1EFRG 1RM1C 2DEQA 4X8AA 4XTWA 3ABTA 5ELNA 1DF4A 3UM7A 2ZZEA 3P30A 5H9CA 3E86A 2DYRC 3HY0A 2RHSB 4Q15A 1M57B 3CCSV 4XU3A 3E8HA 1F4NA 2DQ0A 4QPKA 3BFMA 1EIYA 4WFHA 3ZIAG 1NJ8A 3TCUA 1SZTA 1GKFA 4LP8A 3ZRXA 5K1PA 2OTLV 2ODRC 3HB3B 4P74A 1PNMA 2ZT7A 1E1RG 1OCZC 1OCCB 1SETA 3UGQA 1J5WA 2W0FC 2ATKC 5EBMC 4YRQA 2OCCB 1SRYA 4YREA 3RIRA 1S76D 4EKWA 1WYDA 1F23A 2ZCEA 5LHGA 3EHBB 4PA7A 3F7YC 1M1KW 1PL0A 1JPXA 3UH0A 2DTOA 3TEHB 4TT3G 4E51A 1E1OA 2ZTGA 3QO8A 3UFGA 5DN6G 3JD0A 4WFGA 4Z1MG 4CS3A 3TK1A 2E3CA 1ASYA 3AEIA 2X0LA 2R9IA 2WSSG 2WWWA 5B1BB 3A74A 1BMFG 3OW2U 3EFSA 1YTFD 1YSCA 3AG3C 1HXDA 4RUFA 1VQ7V 4MS2A 1KP3A 3E8GA 1AI5A 3A7AA 3L2ZA 3CCMV 4MTXA 1Y66A 5L3EA 4MVMA 4TVWA 2WLIA 5EK0A 4JAVA 3D3IA 1NJ6A 3TUPA 2IJJA 2EL9A 4H2WA 3ZRSA 2DWDC 5K1XA 1W0KG 3ASOC 1JOYA 2QHSA 4G84A 1CPYA 5L3FA 1S3JA 1YJNV 1PYSA 2ALYA 2DTIA 2ZIOA 2CIMA 1AJQA 4YCVA 1F4MA 5ELOA 2DU5A 4R7CA 4BWAA 4MVQA 1E79G 3JCZA 3R65A 2HG5C 2WAMA 4UXNA 4BAYA 1E1TA 2ZT6A 4OP0A 1AR1B 1GMGA 1QLEB 1NBMG 4MSWC 3P8VA 4P72A 1LNQA 1FXVA 2XAFA 2DDZA 2JIZG 2CGHA 4YRCA 3D36A 3HPLC 3V8LA 2IH3C 5H6QA 5LGTA 2DYSB 3FB8C 2IH1C 2ZR2A 3ASNB 4JYCA 1BBWA 3WFVA 2V7QG 1MOFA 3QO7A 4TWKA 4CS4A 3BJUA 2ZD9A 5CMUA 2G4CA 3REXA 1M57C 2FTKA 3OFNG 3RVZA 5CBFA 1X54A 2QHVA 1BIAA 1X2GA 4HWTA 4XTXA 2EINB 2Q69A 3ZJZA 2PI4A 3JD1A 3X2QC 1KQSU 3NELA 2DXUA 2EIJB 2Y48A 2AKWA 2P5IA 1AJNA 3TEGA 2A8EA 2C8MA 4YP0A 3K0GA 4YRLA 2X6CA 1G51A 1R6KA 2X6BA 2OCCC 4H2XA 3TETA 2E65A 1E24A 3STZC 4UUJC 4WFAV 4H2UA 2LFRA 3UGTA 2EIKB 3NXSA 3HRKA 2Q7EA 4H2VA 2UXXA 2E10A 1AI4A 1BL8A 2H94A 3MF1A 2ZZFA 4YRIA 2ZGWA 3OUSA 2IW5A 4UV8A 3ICAA 5FL7G 3B77A 5B1BC 3IKMB 5B1NA 3RKYA 2WLHA 4LBEC 4R6ZA 5CBHA 1AI7A 3JD3A 3CMEV 4YRPA 1BHBA 1L1FA 1K34A 3HXYA 4WF2A 4XBFA 4HZ3A 3K08A 4PDRA 1YGBA 2ZQMA 5LGUA 3LDEA 1EVKA 2QTOA 3OR7C 3CCUV 1CP9A 1PNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E22 A;  1H4T A;  3W3S A;  4YCW A;  3RUX A;  2Q7G A;  4OLF A;  2E5A A;  2ZT5 A;  3G1Z A;  1WU7 A;  4P71 A;  1H4V B;  3HXX A;  4NCX A;  3A31 A;  3L4G A;  2ALY B;  1PYS B;  1BIB A;  3A7U A;  1Z7N A;  4P73 C;  1USY C;  1B70 A;  1B8A A;  4BW9 A;  4H02 A;  2Q7H A;  1GGM A;  1BBU A;  4ZTU B;  3LSS A;  2ZIM A;  3IAL A;  3IG2 A;  4HWP A;  4XU2 A;  4RQE A;  3A7R A;  2I4O A;  4TTV A;  4P3N A;  1NNH A;  5KNN A;  5C52 B;  2EWN A;  3HFZ A;  2AMC B;  3I7F A;  3V7R A;  3VQY A;  1JJC A;  3V8J A;  4XEO A;  2AKW B;  4HWS A;  2CJA A;  4XTU A;  3A5Y A;  2DQ3 A;  4H2X B;  3LSQ A;  4G85 A;  4LNS A;  2RHQ A;  1B7Y B;  4TQD A;  1WQ7 A;  3KFU A;  4P75 C;  4TVA A;  1KOG A;  4UPA A;  4KR3 A;  1KMN A;  1EVL A;  3MEY A;  1NJ1 A;  1WLE A;  3R07 A;  3EFR A;  1X2H A;  2E41 A;  2Q5H A;  2XTI A;  3RAC A;  3MF2 A;  2ZNI A;  1X55 A;  5C53 B;  4J15 A;  2DVE A;  1WQW A;  1L0W A;  3M4P A;  2IY5 B;  3L4G B;  2QHT A;  3E9I A;  4UP8 A;  2FYK A;  1B70 B;  3OD1 A;  3A5Z A;  4EX5 A;  4YRK A;  1G5I A;  2PMF A;  4YRG A;  3HFV A;  4HWO A;  4XTY A;  2ZT8 A;  1ASZ A;  3PZC A;  1G5H A;  4EO4 A;  3RL6 A;  1EIY B;  3HFZ B;  2DZC A;  1YFT A;  1N9W A;  1YB3 A;  4RQF A;  4H2T A;  1JJC B;  1WPY A;  2ODR D;  3P8Y A;  3VQW A;  1ADJ A;  4YDQ A;  3WQZ A;  4K87 A;  2ARU A;  4UP7 A;  3V7S A;  1QF6 A;  4P3O A;  2ZNJ A;  4TVA B;  3QO5 A;  3RF1 A;  3A32 A;  4WI1 A;  3RKX A;  4YPF A;  5F5W A;  4DQ2 A;  2QHU A;  4PHC A;  11AS A;  2DJZ A;  1FYF A;  1EQR A;  4YRS A;  3HY1 A;  12AS A;  1WNL A;  3QTC A;  3VQX A;  4L87 A;  3LC0 A;  2ZXF A;  4YRM A;  2I4L A;  2P0L A;  3IKL A;  1B76 A;  4P73 A;  1SER A;  2J3M A;  3CMQ A;  4P3P A;  1SES A;  4HA8 A;  3P8T A;  2CJ9 A;  1Z7M A;  4P74 C;  2PME A;  4YCU A;  1EFW A;  2XGT A;  3PCO A;  4Q6G A;  1X01 A;  5HGQ A;  4H2S A;  4YRO A;  4HWR A;  4WJ3 M;  1ADY A;  3HXV A;  3HRI A;  2DZ9 A;  1NJ2 A;  3DSQ A;  1W66 A;  5C51 B;  2E1H A;  1YFR A;  3QNE A;  4P75 A;  2I4N A;  3FJP A;  2DU7 A;  1LYL A;  4RDX A;  1QE0 A;  4UP9 A;  2ART A;  2Q5I A;  4X5O A;  4TQF A;  1H4Q A;  4RMF A;  1YFS A;  4P72 C;  3VBB A;  4HVC A;  3V7C A;  4CS2 A;  4ZIB A;  3V8K A;  3NEN A;  4KQE A;  3M4Q A;  1H4S A;  2CJB A;  3REU A;  2DKG A;  2ARS A;  4YRF A;  2EAY A;  3NET A;  4H2Y A;  4ZTZ B;  2ZIN A;  3L1A A;  4XTZ A;  2RHS A;  4CH6 A;  2C7I A;  4K86 A;  2EJF A;  2EJ9 A;  4AH6 A;  4XTV A;  1NYR A;  2AMC A;  1C0A A;  2E64 A;  4TVY A;  3ERR A;  3PCO B;  2DXT A;  1KMM A;  3TEH A;  2RHQ B;  1EOV A;  4O2D A;  1NJ5 A;  4PG3 A;  1X56 A;  4XU0 A;  4YRT A;  3HXU A;  1B7Y A;  3RGL A;  4TWA A;  4YRR A;  3HXW A;  1HC7 A;  3RKW A;  4P71 C;  4YYE A;  3E9H A;  4KR2 A;  2I4M A;  3HTZ A;  4XU1 A;  2ZR3 A;  3VQV A;  2J3L A;  3HXZ A;  4YRN A;  2ZZG A;  2HNI A;  1HTT A;  2EJG A;  4CH5 A;  4WJ4 A;  1USY A;  2IY5 A;  5E3I A;  4CH4 A;  4K88 A;  2DTH A;  3NEM A;  1ATI A;  1NYQ A;  1IL2 A;  1VQZ A;  1RIQ A;  4YRJ A;  4XEM A;  4XTW A;  2DEQ A;  5ELN A;  2ZZE A;  3HY0 A;  4Q15 A;  2RHS B;  4XU3 A;  2DQ0 A;  3BFM A;  1EIY A;  1NJ8 A;  5K1P A;  2ODR C;  4P74 A;  2ZT7 A;  1SET A;  3UGQ A;  1J5W A;  4YRQ A;  1SRY A;  4YRE A;  3RIR A;  1WYD A;  2ZCE A;  3UH0 A;  2DTO A;  3TEH B;  4E51 A;  1E1O A;  2ZTG A;  3QO8 A;  3UFG A;  4CS3 A;  2E3C A;  1ASY A;  3A74 A;  3EFS A;  1HXD A;  3A7A A;  3L2Z A;  4TVW A;  1NJ6 A;  3TUP A;  2EL9 A;  4H2W A;  5K1X A;  2QHS A;  4G84 A;  2ALY A;  1PYS A;  2DTI A;  4YCV A;  2DU5 A;  2ZIO A;  5ELO A;  2CIM A;  4BWA A;  1E1T A;  2ZT6 A;  4OP0 A;  3P8V A;  4P72 A;  2DDZ A;  2CGH A;  4YRC A;  3V8L A;  1BBW A;  2ZR2 A;  3QO7 A;  4CS4 A;  3BJU A;  3REX A;  2G4C A;  4XTX A;  4DPG A;  1X54 A;  4CH3 A;  2QHV A;  4HWT A;  1BIA A;  1X2G A;  3NEL A;  2DXU A;  2P5I A;  2AKW A;  3TEG A;  2C8M A;  4YP0 A;  4YRL A;  1G51 A;  4H2X A;  2E65 A;  1E24 A;  4H2U A;  3UGT A;  3HRK A;  2Q7E A;  4H2V A;  2E10 A;  3MF1 A;  2ZZF A;  4YRI A;  2ZGW A;  3ICA A;  3IKM B;  3RKY A;  4YRP A;  3HXY A;  4WF2 A;  1YGB A;  1EVK A; 
#chains in the Genus database with same CATH topology
 4LF9 O;  3W3S A;  4K8X A;  4X9Q A;  1NVP B;  3RUX A;  3AK2 A;  3K58 A;  4YJ3 B;  2E5A A;  1VQ5 V;  4GKJ B;  5IJ0 B;  4DR4 O;  3D8C A;  4JV5 O;  2EIM B;  1WA8 A;  3SYA A;  1IBK O;  4RO2 A;  4JYA O;  3E22 B;  3CPW U;  4Z1V A;  2W6J G;  1GN6 A;  1B70 A;  4BW9 A;  2ETN A;  3Q4H A;  2BOB C;  2QGN A;  1GGM A;  3UKM A;  4GX0 A;  1PP9 H;  4ZTU B;  2E5L O;  1NZ6 A;  3LSS A;  2RN9 A;  3IAL A;  2EIJ C;  4O4J B;  3A7R A;  4PJ0 Z;  2I4O A;  4I7Z B;  1OV9 A;  1FFT B;  5KNN A;  4JI3 O;  3WU2 Z;  4JI7 B;  2ZE7 A;  5JVD A;  4NR1 A;  4WFB V;  2AMC B;  3HFZ A;  1OCR B;  2EIK C;  1HNZ O;  2OIG A;  1XMQ B;  3V8J A;  3KKY A;  4X64 B;  4DUY B;  1KD1 W;  4BIU A;  3A5Y A;  4X1I B;  2DQ3 A;  2VWK A;  1JFF A;  2Y69 B;  5GTH Z;  1M56 B;  3K5M A;  3FYI B;  3B8M A;  4MVZ A;  4FZ1 A;  4WF9 V;  3KFU A;  3ML0 A;  4P75 C;  2OT5 A;  1AIL A;  1KOG A;  4AIL C;  3CYO A;  3E8B A;  5DED A;  2JJ2 G;  3ZBH A;  4FPP A;  1EVL A;  2ZXW B;  2ZKO A;  4LVL A;  1JA8 A;  2QM7 A;  2ITD C;  2KB1 A;  3EFR A;  3GWO A;  1SQG A;  3L71 H;  4GX2 A;  1SQP H;  2DWE C;  3THO A;  3RYI B;  3CD6 V;  3HKC A;  1WQW A;  1YEW A;  3M4P A;  1AP6 A;  2IY5 B;  3MHH C;  3L4G B;  4UP8 A;  1R3I C;  3JAT B;  1V55 B;  5IYZ A;  2FYK A;  4ZKI A;  3A5Z A;  4MTO A;  2HJD A;  3HFV A;  2Q6A A;  3BEH A;  4U3J B;  5B3S B;  1WPX A;  3CS5 A;  4FLU A;  4XTY A;  4DR1 O;  1G5H A;  1GM9 A;  1THZ A;  5B5E Z;  2MW2 B;  3RL6 A;  2AZ0 A;  1EIY B;  1YXB A;  2LP7 A;  3CCL V;  1Q7Y W;  4LC1 A;  1J5E B;  2P7T C;  5L3D A;  2C2A A;  1K7D A;  2AXT Z;  4DUZ B;  3P8Y A;  4YDQ A;  4NYK A;  5LP6 C;  4K87 A;  3ZCC A;  5L3G A;  2QWP B;  5EBL C;  1CEZ A;  5GTI Z;  5IT9 N;  4UP7 A;  3V7S A;  4UVC A;  2ZNJ A;  3T1Y O;  1QR9 A;  2EIL C;  3DGE A;  1SA0 B;  3QO5 A;  2UUB O;  3RF1 A;  1XDC A;  1FD9 A;  3AK1 A;  3BHP A;  4UVB A;  5CA3 A;  3EXA A;  2N04 A;  2LO1 A;  4UCR A;  2JEU A;  2W0X A;  11AS A;  5IY5 C;  3S3W A;  4YRS A;  3ASN C;  12AS A;  1KP2 A;  3VQX A;  4BIO A;  2JK5 C;  5JH7 B;  2ZXF A;  1QU7 A;  1XOU A;  1N34 B;  1TUB B;  1M9N A;  3ASO B;  1B76 A;  4Q20 A;  1FS0 G;  4P30 A;  2VQF O;  1AI6 A;  2J3M A;  3AG2 B;  2UXN A;  1SES A;  3A0H Z;  1I5X A;  1HDJ A;  3RWR D;  2CTW A;  1Q81 W;  3OD4 A;  1VQO V;  2QTS A;  2Z5U A;  5EZY B;  1EFW A;  4LFB B;  2QKC A;  4DR3 O;  2R70 A;  4YRO A;  1GH6 A;  2HVK C;  4QNH B;  2L6L A;  1SZX A;  1OHH G;  1ZWI C;  2DZ9 A;  4N21 A;  2FB5 A;  2ITC C;  4ABM A;  5J2U A;  2JGD B;  1BS3 A;  3W7T A;  4GCZ A;  4H37 A;  3K5O A;  4Z2W A;  4I0X B;  5IJ9 A;  4D7S A;  3E89 A;  1YJW V;  3SYC A;  2GDS A;  3QNE A;  2P6J A;  5KA5 A;  2I4N A;  2OYQ A;  4RDX A;  2XND G;  3A8T A;  2WLL B;  4PI0 A;  3SJA C;  4UP9 A;  2ART A;  3STL C;  2EJR A;  4H44 B;  5FNV B;  4RMF A;  1IBL B;  1YFS A;  1N33 B;  4P72 C;  4DR6 O;  1VEW A;  1VP7 A;  4UVA A;  5D5P A;  1VQM V;  1BCC H;  1KYO F;  2JDI G;  4FZ0 A;  4DXW A;  1KUQ A;  3OE7 G;  1OCR C;  3SPC A;  2DKG A;  3JAR B;  1SC5 B;  2ARS A;  4J42 A;  4YRF A;  2JS3 A;  4QIW F;  5CA1 B;  3L70 H;  1TA8 A;  2Q0O C;  4FLX A;  2GHY A;  1N8R W;  2ZM6 B;  2RHS A;  4DV6 O;  2EJF A;  4DV1 O;  2AMC A;  4L8J A;  4QJF B;  4WBN A;  3CHX A;  1K4C C;  3CSX A;  4W4K A;  4IHJ B;  4JI4 O;  4MTG A;  4TV9 B;  3OTO B;  3GB7 C;  2DYR B;  3ERR A;  1Z5V A;  5LA6 A;  4PA4 A;  3WB2 A;  2JRI A;  2RHQ B;  1EZJ A;  1UPG A;  1FFX A;  3CRM A;  4BR6 A;  4O2D A;  4XU0 A;  4PG3 A;  2ZXW C;  2ZT9 B;  2ODM A;  3H1I H;  2UUA B;  3WG7 C;  5J2T B;  1HNW O;  3G4S V;  2OIE A;  3A0B Z;  3IGA C;  2CUG A;  5H6R A;  3W7X A;  3HXW A;  4K8Z A;  2V1D A;  4UB8 Z;  4NXM B;  3KG2 A;  2QKS A;  4P71 C;  1NR7 A;  3E9H A;  4RUE A;  3HTZ A;  4MTF A;  4XU1 A;  5CN0 A;  1URF A;  2QDO A;  5HFM A;  1FXK B;  4O4I A;  3CJH B;  4P9O A;  4PDV A;  1L8D A;  3HXZ A;  3ZMV A;  3ABM C;  3CMA V;  2IM9 A;  4DV0 B;  4UCT A;  1MZE A;  3P32 A;  3OMN B;  3RYI A;  1BHA A;  3SYO A;  5B3S C;  1USY A;  2IY5 A;  1IBM B;  3GWK C;  3N27 A;  1GN4 A;  2CH7 B;  5E3I A;  2YXH A;  2R9A A;  4XDJ A;  1H2G A;  2CTP A;  1ATI A;  4ZHQ B;  1J95 A;  4JTA B;  3SJC C;  4XEM A;  2DEQ A;  1XUQ A;  1DF4 A;  4U3J A;  1VF5 B;  3P30 A;  3E86 A;  3HKE B;  3L75 H;  1F4N A;  3BFM A;  5LMN B;  1EIY A;  3TCU A;  1SZT A;  4LP8 A;  2OTL V;  3HB3 B;  2ZT7 A;  1Q3E A;  1OCZ C;  2F66 C;  1J5W A;  2W0F C;  5EBM C;  4YRQ A;  3BAA A;  1SRY A;  1S76 D;  3UT5 B;  1F23 A;  1M93 A;  1SQB H;  3EHB B;  4J10 A;  4D7T A;  1SQF A;  2DTO A;  4LWS B;  2ZTG A;  4CS3 A;  3OGI B;  2DOS A;  2R9I A;  2UXD B;  3U10 A;  4X65 O;  1BMF G;  1YSC A;  2RMK B;  4RUF A;  4MS2 A;  1KP3 A;  3A7A A;  4MVM A;  4TVW A;  3UO2 A;  1NJ6 A;  1FJG O;  3TUP A;  2Y4T A;  3ZRS A;  5K1X A;  3ASO C;  1JOY A;  2QHS A;  1S5J A;  2YIA A;  1S3J A;  2F23 A;  2CIM A;  1F4M A;  1Z5W A;  4BWA A;  3R65 A;  4BAY A;  2HG5 C;  2ZT6 A;  1GMG A;  3F5T A;  1NBM G;  2O57 A;  3QF7 A;  4I55 A;  3P8V A;  1FXV A;  1P49 A;  1CXZ B;  1X4T A;  2BTQ B;  4O4L B;  4YJ2 B;  3WFV A;  4CS4 A;  3A2F A;  5CMU A;  3REX A;  2FTK A;  4XTX A;  1IDS A;  4AHC A;  2EIJ B;  2P5I A;  2AKW A;  4YP0 A;  5BR8 B;  5GON B;  3SJB C;  2CDY A;  4H2X A;  1KB9 F;  3TET A;  2P5O A;  4H2U A;  1TVK B;  2LFR A;  2EIK B;  3T1H O;  2Q7E A;  3ZHT A;  1R1B A;  3OUS A;  4UV8 A;  2E76 B;  5B1B C;  2OCH A;  2JGD A;  4ZI7 A;  4O2B B;  4YRP A;  1BHB A;  1K34 A;  4I0X A;  2HHH B;  5LGU A;  3LDE A;  1H4T A;  3JSN A;  1ZTE A;  2Q7G A;  3ZMU A;  5IE9 A;  4K0K O;  3T1C A;  5CA0 B;  5FNV A;  1QLE C;  1H4V B;  1H38 A;  3HXX A;  1XNR B;  2QWQ B;  2K9P A;  1VQN V;  1KBH A;  4PV1 B;  4F4L A;  2ALY B;  1BIB A;  2DE0 X;  2JGU A;  4P73 C;  4U7N A;  1B8A A;  2NLJ C;  1JCH A;  4MVS A;  2E5L B;  2ADQ B;  4GUN A;  2ZIM A;  4UCS A;  5JCO A;  3FD9 A;  4XU2 A;  4FM2 A;  1Y76 A;  4H0L B;  1NNH A;  2EWN A;  1P84 F;  4N23 A;  1YIJ V;  1HNZ B;  3OEE G;  5HFL A;  3CCE V;  1JJC A;  1LUV A;  1WP7 A;  4JTC B;  3DC6 A;  5EC1 C;  1XL6 A;  2CJA A;  4IHJ A;  4TV9 A;  2HP8 A;  2FL4 A;  1YCI A;  3ZN1 A;  1FPO A;  3BFR A;  1Q82 W;  4DRX B;  4JPR A;  1Q6I A;  4G85 A;  1RSO B;  4B7E A;  2RHQ A;  1RPR A;  5EBW C;  4OX9 B;  2WLN A;  2XAJ A;  1MSD A;  4PEL A;  4TQD A;  3MHS C;  4X89 A;  2YI9 A;  4DR5 B;  2XAG A;  5FLX N;  4X20 B;  4TVA A;  3CCQ V;  1H8H G;  1FXK C;  1MG1 A;  4KR3 A;  5LP6 B;  1YTF B;  1I08 A;  4JI5 O;  3SPJ A;  3MEY A;  2YUA A;  2MK3 A;  2EIL B;  2CTR A;  1WLE A;  1ZL8 B;  1X2H A;  4DV7 B;  4LF5 B;  2Q5H A;  2IJI A;  3RAC A;  2BTO A;  4LF4 B;  4J15 A;  4NVP A;  5IY5 B;  4GX5 A;  1L0W A;  4B3S B;  3P3P A;  3OMI B;  2QHT A;  2BSK A;  3ETG A;  3IJ4 A;  2WLK A;  4B3T O;  4EX5 A;  4DV4 O;  4YRK A;  4EB6 A;  3LDD A;  4PHZ A;  4ZHQ A;  4YRG A;  5LHI A;  4JI8 B;  2IJK A;  3TXS A;  2HEP A;  4HYO A;  2F43 G;  1NS1 A;  4FFB B;  4QPJ A;  3HKE A;  4KXR A;  2DZC A;  4JI6 O;  4IL6 Z;  3ZHQ A;  1W0J G;  1EN6 A;  3OR6 C;  2A3Q A;  3UT5 A;  3K9S A;  2M7W A;  1MA1 A;  1LR1 A;  4TUY A;  1VQ8 V;  1QF6 A;  2B5U A;  3CXC U;  4B3M O;  3T1Y B;  4O2A B;  1VMG A;  2JVD A;  4X1K B;  4GZR B;  5A2Q N;  4WI1 A;  1ROP A;  4G2K A;  4DQ2 A;  1XNQ B;  3WB0 A;  2UUC O;  4XDL A;  2F95 B;  1R3L C;  5LBQ A;  2UXB O;  3HY1 A;  3UCS C;  4YRM A;  4LF7 O;  2I4L A;  4IYH A;  3IKL A;  4IYI A;  2VQF B;  4JI0 O;  4MVU A;  3CMQ A;  3K79 A;  3KCX A;  4X66 O;  4NKG B;  1L0N H;  4JAS A;  4PA9 A;  3P8T A;  3W7S A;  1Z7M A;  4FK5 C;  4P74 C;  2PME A;  4J9Y B;  4DR3 B;  1XQ8 A;  5LOV B;  3O65 A;  3T4Z A;  1I94 O;  3PCO A;  5HGQ A;  4PA6 A;  3C90 A;  5KX5 B;  1TVK A;  1UFI A;  4KHP O;  1ADY A;  4DV2 O;  4XDK A;  3HRI A;  1ARO P;  3ETE A;  4R50 A;  3I55 V;  3ZHS A;  3H01 A;  4FLW A;  4MW8 A;  5TIS Z;  2YDE A;  4FJC C;  3DSQ A;  1I0H A;  2WLJ A;  1N36 O;  1W66 A;  1SQQ H;  2UXC B;  5C93 A;  1AJP A;  4GKK B;  3EFF K;  1F51 A;  5IYD O;  4GX1 A;  3WG7 B;  5JQG B;  1U97 A;  4LCU C;  4LF6 O;  1YFR A;  2AHZ A;  2QM4 A;  4DV5 B;  3K3W A;  4D6T H;  3FJP A;  4P75 A;  2CE4 A;  3L9D A;  1XRE A;  4AQY O;  1QE0 A;  2JEX A;  4TQF A;  1H4Q A;  4LFC B;  4J7Z A;  1QR8 A;  4G28 B;  3CB2 A;  1K73 W;  2RNB A;  4DW0 A;  2WLM A;  2KG7 B;  3D36 C;  4X62 B;  4CS2 A;  1XHX A;  4ZIB A;  4F6E A;  3V8K A;  3NEN A;  3AG1 C;  1GM8 A;  3B09 A;  3ABM B;  1QBZ A;  2BCC H;  4FIP C;  1H4S A;  2CJB A;  2IU0 A;  2WA4 A;  2B9Z A;  3M8A A;  2PF4 E;  2EAY A;  4JI1 O;  2ARH A;  4ZTZ B;  2ZIN A;  4DV6 B;  4XTZ A;  4B3R O;  5LXT B;  1QHT A;  4CH6 A;  3G71 V;  1R6T A;  4AH6 A;  3UO3 A;  3ZHV A;  5LMU O;  1C0A A;  4IIJ A;  1HR0 B;  4I50 B;  4JI4 B;  1V9P A;  3KCY A;  5B66 Z;  1HP8 A;  3LNN A;  3JAK B;  3TEH A;  2OWO A;  3G80 A;  2HFE C;  3FX7 A;  3K57 A;  1EOV A;  3K04 A;  5EYP A;  3IFX A;  1X56 A;  3CP1 A;  1OCZ B;  4LH6 A;  3HXU A;  5KLV H;  1XMO B;  1DF5 A;  1I5Y A;  2PTM A;  3RGL A;  4PD4 F;  1PPJ H;  2AHY A;  3LDC A;  4TWA A;  1VF6 C;  3RVY A;  3SGI A;  1HC7 A;  1GK9 A;  4F6R B;  4LVJ A;  5LP6 A;  2QWR B;  1I7F A;  1K33 A;  2D3O W;  5ITZ B;  4YYE A;  4NXN O;  4YHH B;  2I4M A;  1S0V A;  3CC4 V;  1R3J C;  1NKD A;  1ZL8 A;  4KFM A;  1SKV A;  3W7U A;  3BVO A;  2NN4 A;  3SPI A;  3APQ A;  4YRN A;  3E83 A;  3K0D A;  1EBO A;  2XUM A;  4CH5 A;  4WJ4 A;  1OCO C;  2CK3 G;  5C8Y A;  2YEV B;  1K4D C;  4JAU A;  5KMG B;  3ICX A;  4TV8 A;  3NEM A;  2WA3 A;  2PYL A;  5LL6 Y;  3FB5 C;  1VQZ A;  4YRJ A;  3JAS B;  2ZE8 A;  1RM1 C;  3UM7 A;  3SDL A;  1ZAU A;  3JSL A;  3FAV B;  4X1Y A;  4FFB A;  4LNU B;  3C3T A;  1GKF A;  2ODR C;  3RN4 A;  1PNM A;  1E1R G;  3NR7 A;  1XMQ O;  2CGO A;  1MNG A;  4PI2 A;  4X64 O;  1WYD A;  2ZCE A;  1JJO A;  4DUY O;  3F7Y C;  4CC5 A;  1PL0 A;  1M1K W;  2XT9 A;  3HR0 A;  3JD0 A;  4J11 A;  1ASY A;  2X0L A;  1BSM A;  5B1B B;  3A74 A;  3OW2 U;  3EFS A;  1Y6X A;  1YTF D;  2YXY A;  3AG3 C;  1D2D A;  4O2A A;  3L73 H;  1N0N A;  4HNA B;  4YJ3 A;  3CCM V;  5IJ0 A;  4MTX A;  4EFB A;  3J81 N;  3CX5 F;  1FJG B;  2IJJ A;  3RYC B;  5L3F A;  2DTI A;  2DU5 A;  2ZIO A;  3CEI A;  3E22 A;  3H1J H;  3JCZ A;  4OP0 A;  1QLE B;  5IWA B;  4EEQ A;  4MSW C;  4P72 A;  4FM0 A;  1PM9 A;  3IC9 A;  2L35 A;  3JAL B;  4O4J A;  3HPL C;  3V8L A;  2EUL A;  3UQ8 A;  2GUZ B;  2DYS B;  2IH1 C;  2ZR2 A;  4JYC A;  4B08 A;  1IXB A;  3N2G B;  1M57 C;  4HWT A;  2Q69 A;  3NEL A;  2DXU A;  2YXL A;  3FFQ A;  1AJN A;  1AP5 A;  4FLV A;  3CRR A;  5LOV A;  4YRL A;  4X1I A;  2OCC C;  2YIB D;  4UUJ C;  3UGT A;  3HRK A;  2CAZ C;  1M5I A;  4H2V A;  2UXX A;  2E10 A;  1N4C A;  1U96 A;  2H94 A;  2ZZF A;  1F7Y A;  2IW5 A;  4DV3 O;  3IKM B;  5B1N A;  2PGG A;  2P4V A;  4JI2 B;  5CBH A;  1J5E O;  2BE3 A;  3O9O A;  3HKD B;  1EZV H;  4WF2 A;  1L1F A;  3CRC A;  4DUZ O;  1Z2G A;  2AW9 A;  1SS3 A;  3BA9 A;  2N74 A;  1EVK A;  3OR7 C;  1CP9 A;  1PNL A;  2DMX A;  4YCW A;  2HKO A;  4FVM A;  2QE7 G;  3G1Z A;  1WU7 A;  2WLI B;  4P71 A;  1NQT A;  4O4H B;  1Y67 A;  3SR2 C;  1R73 A;  5CBG A;  4NCX A;  3T4D A;  3A31 A;  4QE9 A;  3L4G A;  1PYS B;  3JAT A;  1USY C;  3T2M A;  1NH2 D;  2PI5 A;  4H02 A;  5KUM A;  1HNX B;  3RGB A;  4HAM A;  2LGQ A;  2Q7H A;  2NR5 A;  1B6Q A;  1BBU A;  2QWN B;  1KC8 W;  5KHG A;  3K06 A;  3LSU A;  1N34 O;  1A32 A;  4RQE A;  4P3N A;  5EIB C;  3VQY A;  4ZOL B;  2D2C B;  2H8P C;  4XEO A;  5KUK A;  2LW1 A;  1YF2 A;  2YSU B;  3BY6 A;  1MMM A;  4XTU A;  1N32 B;  5JJE B;  4U7O A;  1WNS A;  4LFB O;  1HW7 A;  1BE3 H;  3LSQ A;  4LF8 B;  1XEQ A;  2R72 A;  4YXW G;  1S77 D;  2B1G A;  4MT8 A;  4LFA B;  1WQ7 A;  2B1I A;  3QVN A;  5EC2 C;  4FLZ A;  1SA0 A;  2DN9 A;  4YY3 B;  3CRA A;  1RP3 B;  2HJF C;  1XL4 A;  4WCE V;  4CBC A;  4A5U B;  2LW7 A;  4AI8 A;  5ITZ A;  2QWO B;  1NJ1 A;  1VQ6 V;  2Y0P A;  2V4D A;  4I9Q A;  3ZRV A;  5JH7 A;  3MF2 A;  2ZNI A;  4UV9 A;  3ZRW B;  1G4Y B;  1H8E G;  1TUB A;  4ICG A;  5E79 Z;  2QA4 V;  1JX9 A;  1X55 A;  5C53 B;  1D5A A;  1WA8 B;  4NTX A;  2DVE A;  3ZMT A;  3E9I A;  4MVR A;  4B3T B;  2YS8 A;  2QEX V;  1N0J A;  1Q8I A;  1B70 B;  1VQL V;  3DXR B;  1G5I A;  2A0L A;  2PMF A;  3Q4H B;  1S5L Z;  4J9Z B;  5EZY A;  4JAA A;  2IBZ H;  3JAS A;  3B2E E;  3BAB A;  2ZDI C;  4HWO A;  4DR7 B;  1PNK A;  3G6E V;  3PZC A;  3FB7 C;  3ZS8 C;  3FAV A;  4JI6 B;  2ZM6 O;  3HFZ B;  1YFT A;  1K3E A;  4LNU A;  1YB3 A;  1KMI Z;  2UU9 O;  4G27 B;  1TUE B;  5EIB D;  4FM1 A;  4RWU A;  3OTO O;  1DLB A;  2EZP A;  1JFF B;  1UJW B;  3WQZ A;  2LGW A;  4LF9 B;  1S5H C;  1Y74 B;  1V54 C;  1QQC A;  2UUA O;  1SQX H;  1RFY A;  2WLL A;  2QM8 A;  1S72 V;  1VQP V;  4DR4 B;  3A32 A;  4EFE A;  4JV5 B;  1IBK B;  3IC7 A;  3ZX6 A;  3MDS A;  1IXM A;  4JYA B;  5LGN A;  4NXM O;  4PHC A;  5KA6 A;  1G1X B;  1FYF A;  2FYU H;  2DYS C;  2VS0 A;  2ZE6 A;  1EQR A;  1WNL A;  3C3S A;  5KHH A;  2G38 A;  4L87 A;  3F5W C;  3JAR A;  3DC5 A;  1MAB G;  2P0L A;  1VAR A;  4JZ2 A;  3JAM N;  4DV0 O;  5CA1 A;  1QCE A;  3CCV V;  4JI3 B;  3AG1 B;  4P73 A;  1IVS A;  3ABL C;  3ZN0 A;  4HA8 A;  4UFZ A;  1YIT V;  4QGP A;  3VOU A;  1P7B A;  5JJN B;  4YCU A;  5J9P C;  2XGT A;  1X01 A;  4GT1 A;  4H2S A;  4KHP B;  4PDL A;  3F7V C;  4FMT A;  1BZK A;  2HLD G;  3HXV A;  2JJ1 G;  4LVI A;  3OAA G;  3AG4 C;  1W59 A;  2IU3 A;  4FLT A;  3OEH G;  5J2T A;  1Q6U A;  2Z3Y A;  5KHI A;  5IYB O;  4I4T B;  2P06 A;  2NNU A;  1EN5 A;  1PKX A;  1MSW D;  2CGN A;  4P9P A;  1K8A W;  1M90 W;  1NTM H;  3CE2 A;  4JTD B;  1FXK A;  3RYF B;  2UXD O;  4ASU G;  2KKW A;  3CJH A;  3SPG A;  3BPZ A;  4CZZ A;  4X5O A;  4FFK A;  4C7U A;  1NR1 A;  2GSM B;  5B1A C;  2XOK G;  2A7W A;  4J7J A;  4HVC A;  2P67 A;  3M99 B;  2CH7 A;  2QR4 A;  3ABU A;  5BXZ A;  3FKS G;  4LVK A;  2CTQ A;  2GV9 A;  2YIC A;  4CC6 A;  3I56 V;  3FB6 C;  4JI1 B;  1OCO B;  4BW5 A;  4DR1 B;  2Q73 A;  5H2F Z;  3L1A A;  1IZ3 A;  2LFS A;  2C7I A;  3PJS K;  4K86 A;  2EJ9 A;  5AG2 A;  4DO2 A;  4HBN A;  3E2E A;  5LMU B;  1NJI W;  2NS6 A;  1NYR A;  1K97 A;  1EM1 A;  1YJ9 V;  1RM1 B;  2E64 A;  1LUW A;  2BOC C;  2DXT A;  5BR8 O;  1KMM A;  4LWS A;  4I5S A;  1NJ5 A;  2YID A;  1W2B U;  1QLN A;  2UUB B;  1MZF A;  3ETD A;  3APO A;  5J2U B;  3H1K H;  2ZE5 A;  3ABK C;  4GYC B;  4YRR A;  1GM7 A;  3SJQ C;  4GLX A;  3RKW A;  2KSD A;  2LQT A;  2HHH O;  3LUT B;  3SYP A;  1DTO A;  3AG3 B;  2P22 C;  1COW G;  2A9H A;  3VQV A;  2J3L A;  1QVF U;  1GN3 A;  1IX9 A;  1RPO A;  3E35 A;  3TXQ A;  1XIL A;  3TJT A;  2RCV A;  3ZRW A;  1NH2 B;  1HTT A;  1NU1 H;  3W7W A;  2RJZ A;  2XAQ A;  4OPA A;  1PD3 A;  1XNR O;  2BTQ A;  4O4L A;  4YJ2 A;  1AR5 A;  1H2L A;  3DTU B;  2DTH A;  1GTO A;  3HKB B;  4K88 A;  5GW7 A;  4W4L A;  3DXR A;  3PN1 A;  2HVJ C;  1NT2 B;  2X7R B;  2Y0I A;  1EFR G;  5GON A;  2EJ7 A;  2ZZE A;  5H9C A;  2GBO A;  4Q15 A;  2RHS B;  4DW1 A;  1M57 B;  3CCS V;  2DQ0 A;  4QPK A;  3ZIA G;  1NJ8 A;  3ZHU A;  1G6U A;  3ZRX A;  5K1P A;  5LYJ B;  4P74 A;  4WBN B;  1OCC B;  1SET A;  2OCC B;  4EKW A;  5LA6 B;  4O2B A;  3UH0 A;  1JPX A;  4E51 A;  1E1O A;  3QO8 A;  5DN6 G;  1FFX B;  3TK1 A;  5F2V O;  1YZB A;  2WSS G;  2WWW A;  4OX9 O;  4YIO A;  1HXD A;  4DR5 O;  1Y74 A;  2PY5 A;  1AI5 A;  1FAF A;  1WB8 A;  1Y66 A;  5L3E A;  5CA0 A;  4DR6 B;  3R66 A;  5EK0 A;  4JAV A;  2EL9 A;  4H2W A;  4G84 A;  2ALY A;  4YCV A;  1AJQ A;  1NTZ H;  1E79 G;  2WAM A;  4UXN A;  1E1T A;  4O4I B;  1AR1 B;  1NTK H;  4DV7 O;  4LF5 O;  3J7A U;  2XAF A;  2DDZ A;  1AVM A;  3AG7 A;  3D36 A;  3OT7 A;  5H6Q A;  5LGT A;  4LF4 O;  4NTW A;  5H5N A;  4TOI A;  5JJJ B;  4DV1 B;  1BBW A;  3G6B A;  4B3S O;  3AK3 A;  1MOF A;  3QO7 A;  3WB1 A;  3RVZ A;  4CH3 A;  1X54 A;  2QHV A;  1BIA A;  2EIN B;  2Y48 A;  3TEG A;  3K0G A;  4J41 A;  4UB6 Z;  2X6C A;  3GVM A;  1G51 A;  2X6B A;  2E65 A;  4JI8 O;  4DR2 O;  4DRX A;  1O9H A;  2VQE O;  3N2K B;  1RSO A;  1AI4 A;  1BL8 A;  3MF1 A;  1WJZ A;  4YRI A;  1HNW B;  2PYJ A;  4DV3 B;  3ICA A;  4X20 A;  3RKY A;  4LBE C;  2F4V O;  4R6Z A;  3JD3 A;  2E74 B;  3CME V;  4LR3 A;  3B4S A;  2Q5Z A;  4XBF A;  4HZ3 A;  4PDR A;  1YGB A;  2ZQM A;  4I4T A;  2N05 A;  1ZSP A;  1E22 A;  1Y4M A;  3MD0 A;  4MVO A;  1VF6 A;  3RYF A;  4OLF A;  2Z0A A;  4J80 A;  5IYC O;  2ZT5 A;  2PZS A;  4GKJ O;  4E4E A;  1WPB A;  3SPH A;  3P3N A;  2RDC A;  3CC2 V;  1XNQ O;  4RAI A;  3CCR V;  3IAY A;  1Z7N A;  3A7U A;  1BGY H;  2Q67 A;  3EVK A;  4ZBM A;  3BCC H;  5BY1 A;  1PL4 A;  4I55 B;  3OMA B;  2R9R B;  1P7G A;  4P2Z A;  3IG2 A;  4HWP A;  4E2L A;  2KQX A;  5BMV B;  4TTV A;  5C52 B;  2XAH A;  1FKA O;  1K5S A;  3I7F A;  3ETQ A;  4JI7 O;  3V7R A;  2QSA A;  2YIB A;  1XBL A;  2AKW B;  4HWS A;  2W6I G;  3FYE B;  4X88 A;  4H2X B;  3RBZ A;  4LNS A;  4JGS A;  4X65 B;  1B7Y B;  1OZ0 A;  2F93 B;  3TGU H;  4X1K A;  2VWJ A;  1WN7 A;  3I5D A;  4UPA A;  2LJ2 A;  4ZI7 B;  1KMN A;  1B3Q A;  2UXC O;  1K92 A;  3H1L H;  4GKK O;  3U11 A;  2K1E A;  1FXH A;  2XAS A;  3BRC A;  1DGS A;  1OJH A;  1V54 B;  2EIM C;  4K3A A;  3R07 A;  5A9G A;  1R3K C;  2E41 A;  4DV5 O;  2XTI A;  2OTJ V;  3ZMZ A;  4BIZ A;  4MW3 A;  4YIP A;  3JCU Z;  2P4K A;  3RYH B;  5DM6 V;  4LFC O;  3OTF A;  1KKC A;  4K35 A;  1WP8 A;  2A79 B;  3CRQ A;  4X62 O;  1K9M W;  3HKB A;  3OD1 A;  4OXS A;  1OCC C;  4UCU A;  1JR9 A;  1Y76 B;  1GAX A;  3T1H B;  2HR3 A;  2ZT8 A;  5KX5 A;  1ASZ A;  4UCV A;  3ABL B;  3OUF A;  3CC7 V;  1B04 A;  4EO4 A;  1VIB A;  5BZB A;  2P90 A;  2Y69 C;  2UU9 B;  1M56 C;  1N9W A;  4RQF A;  4H2T A;  5LYJ A;  1JJC B;  1WPY A;  1Q43 A;  2ILM A;  2AZ2 A;  1HR0 O;  1WAZ A;  4TSF G;  2ODR D;  1XHZ A;  1FYJ A;  1AB3 A;  5KHJ A;  1YI2 V;  2GTS A;  3VQW A;  5CB4 B;  1ADJ A;  3AG4 B;  4OPH A;  1NI8 A;  1US6 A;  2ARU A;  5JQG A;  1GO3 F;  2XHB A;  4P3O A;  4KP4 A;  3M7M X;  1XMO O;  3CXH F;  4K0K B;  4TVA B;  2JS5 A;  3RKX A;  3JAW B;  1GRJ A;  1O9G A;  4YPF A;  1JMK C;  5F5W A;  1H2S B;  2DW4 A;  2QHU A;  1NVP D;  3JD4 A;  2KG7 A;  1WB7 A;  2DJZ A;  4YHH O;  2F1M A;  5B1A B;  3QTC A;  1V55 C;  3ZHR A;  1VQ4 V;  2X6A A;  3CCJ V;  3LC0 A;  1HWY A;  4QE7 A;  1KEC A;  2EIN C;  4J7K A;  3KZI Z;  1ZX3 A;  4I9W A;  5LXT A;  2BSK B;  1SER A;  4P3P A;  3RW0 A;  5L3C A;  4EB6 B;  2CJ9 A;  4I50 A;  2FML A;  3K03 A;  4OGQ B;  1TAE A;  2RQ6 A;  3BA8 A;  4JYY A;  4Q6G A;  1VQK V;  3JAK A;  4HWR A;  3LNM B;  3B8N A;  3J80 N;  5D5Q A;  4WJ3 M;  3N2K A;  5L3B A;  1NJ2 A;  3X2Q B;  4HT4 A;  2FKX A;  1QNM A;  4H33 A;  4DK0 A;  5C51 B;  2E1H A;  1JJ2 U;  3JYC A;  4JI5 B;  4F6R A;  4JF3 A;  1L0L H;  1QVG U;  4TUY B;  1YHQ V;  3ABK B;  1P4R A;  1K5Q A;  3K5L A;  3RT3 C;  2YC0 A;  2DU7 A;  5IDJ A;  1LYL A;  2Q9L A;  4WFF A;  1SF9 A;  4WFE A;  2Q5I A;  2E75 B;  5KAF Z;  1YVW A;  1ORQ C;  1T5E A;  1IBL O;  1ENV A;  1N33 O;  3VBB A;  1Q90 D;  1H2N A;  3V7C A;  4IGG A;  1AR4 A;  2YEV A;  2IJH A;  4DV4 B;  5KMG A;  4KQE A;  1X59 A;  3M4Q A;  2Q68 A;  4LVM A;  3AG2 C;  2EBO A;  3REU A;  3E8F A;  3L74 H;  5IWA O;  1VF7 A;  1TGO A;  3NET A;  4H2Y A;  1Q86 W;  3ZED A;  5BMV A;  3MQZ A;  1BQZ A;  5JVD B;  1KKD A;  1H2M A;  1R6N A;  4PA3 A;  4XTV A;  4JYB A;  1BT8 A;  5FPO A;  1IUR A;  2ZDI A;  4TVY A;  3PCO B;  4NB5 A;  2QKA A;  1E1Q G;  3ZMS A;  4B3M B;  3D3Q A;  4YRT A;  2ADP A;  3A0R A;  1B7Y A;  2DJV A;  4JZG A;  4KUM A;  2WPD G;  1Q6H A;  1G8M A;  1VQ9 V;  4HNA A;  1PV0 A;  4PDM A;  4JI2 O;  2UUC B;  2Y4U A;  5B1O A;  1B06 A;  4R8C A;  4DYL A;  3G67 A;  3RYC A;  4KR2 A;  1ZUQ A;  1XI1 A;  2UXB B;  2ZR3 A;  3OM3 B;  3U0Z A;  2GTA A;  5DEC A;  3K59 A;  4LF7 B;  2XTA A;  1JQ0 A;  2EZO A;  2ZZG A;  3RYH A;  2HNI A;  3JAL A;  3HKC B;  3K9A A;  4IT5 A;  2EJG A;  4JI0 B;  1D5N A;  5E1A C;  5LHH A;  3SYQ A;  5JCO C;  2GUZ A;  4X66 B;  3OGC C;  1IBM O;  2EX3 A;  4CH4 A;  5IYZ B;  3N2G A;  1NYQ A;  1IL2 A;  1JVM A;  3JD2 A;  1RIQ A;  1HNX O;  1I94 B;  3L72 H;  4XTW A;  4X8A A;  3ABT A;  5ELN A;  2DYR C;  3HY0 A;  4DV2 B;  4XU3 A;  3E8H A;  4FLY A;  3RFR A;  2M6Y A;  4WFH A;  5LMN O;  4IIJ B;  1N36 B;  4H13 B;  3UGQ A;  2ATK C;  2QJ1 A;  2PUS A;  2Q4P A;  2Q0A A;  5JWP A;  4YRE A;  3RIR A;  5LHG A;  3HKD A;  4PA7 A;  3CWB H;  3TEH B;  4TT3 G;  1N32 O;  4LF6 B;  2A06 H;  5CB4 A;  3UFG A;  4Z1M G;  4WFG A;  5EYP B;  2E3C A;  4UCO A;  2AGA A;  4LF8 O;  3AEI A;  1GN2 A;  1M4U A;  4AQY B;  4LFA O;  1VQ7 V;  3E8G A;  3L2Z A;  5KHK A;  4B7K A;  4YY3 O;  1KU9 A;  2WLI A;  3D3I A;  3JAW A;  4O4H A;  2DWD C;  1W0K G;  1CPY A;  1PYS A;  1YJN V;  5ELO A;  1EN4 A;  4R7C A;  4MVQ A;  4LH7 A;  1LNQ A;  5FPR A;  3B40 A;  2JIZ G;  2CGH A;  3H1H H;  4B3R B;  4YRC A;  2IH3 C;  4U3F H;  5C8Y B;  1SQV H;  3FB8 C;  2Q8V A;  3ASN B;  4DK1 A;  2V7Q G;  3K5N A;  4KL1 A;  4TWK A;  1YDX A;  4TV8 B;  2YI8 A;  2ZD9 A;  3BJU A;  2G4C A;  3OFN G;  4DPG A;  5CBF A;  1X2G A;  3ZJZ A;  4ZOL A;  2VRZ A;  3JD1 A;  3X2Q C;  1KQS U;  2PI4 A;  3MAQ A;  4NTY A;  2A8E A;  2C8M A;  3QG5 A;  1R6K A;  4DR2 B;  2VQE B;  4DR7 O;  3STZ C;  4WFA V;  1E24 A;  3NXS A;  4X1Y B;  1ZLZ A;  1H2K A;  3S3X A;  2ZGW A;  2H3O A;  5FL7 G;  3B77 A;  2F4V B;  2WLH A;  1AI7 A;  5IJ9 B;  1Q5O A;  3HXY A;  4NXN B;  3K08 A;  3H9V A;  1BQ0 A;  2QTO A;  3CCU V;  1DK1 A;  5KAI Z; 
#chains in the Genus database with same CATH homology
 1E22 A;  1H4T A;  1Y4M A;  3MD0 A;  4YCW A;  3W3S A;  4MVO A;  1NVP B;  2HKO A;  3RUX A;  2Q7G A;  3ZMU A;  2QE7 G;  5IYC O;  4OLF A;  2E5A A;  1VQ5 V;  2ZT5 A;  3T1C A;  3G1Z A;  1WU7 A;  1QLE C;  2WLI B;  4P71 A;  1H4V B;  3SPH A;  1NQT A;  1H38 A;  2EIM B;  3HXX A;  3SYA A;  5CBG A;  1R73 A;  4NCX A;  1VQN V;  3T4D A;  3CC2 V;  3A31 A;  4QE9 A;  4RO2 A;  4F4L A;  2ALY B;  4RAI A;  3CCR V;  1BIB A;  1PYS B;  3L4G A;  4CH3 A;  3A7U A;  1Z7N A;  3CPW U;  4P73 C;  1USY C;  4U7N A;  2W6J G;  3T2M A;  1NH2 D;  2PI5 A;  1B70 A;  1B8A A;  4H02 A;  4BW9 A;  2NLJ C;  5KUM A;  2Q67 A;  4HAM A;  1JCH A;  2Q7H A;  2BOB C;  4MVS A;  1B6Q A;  4ZBM A;  4GX0 A;  3UKM A;  1BBU A;  1GGM A;  4ZTU B;  1KC8 W;  3OMA B;  3LSS A;  2ZIM A;  2R9R B;  3K06 A;  3IAL A;  2EIJ C;  3IG2 A;  4P2Z A;  4HWP A;  4XU2 A;  4E2L A;  4RQE A;  3A7R A;  2I4O A;  4TTV A;  1FFT B;  1NNH A;  4P3N A;  5KNN A;  5C52 B;  2XAH A;  2EWN A;  1K5S A;  4N23 A;  1YIJ V;  4WFB V;  2AMC B;  3HFZ A;  3I7F A;  1OCR B;  2EIK C;  3OEE G;  5HFL A;  3CCE V;  3V7R A;  3VQY A;  1JJC A;  3V8J A;  4JTC B;  4XEO A;  2H8P C;  5EC1 C;  5KUK A;  2AKW B;  1XL6 A;  2CJA A;  2W6I G;  4HWS A;  2YSU B;  3BY6 A;  1KD1 W;  4XTU A;  3FYE B;  4X88 A;  4BIU A;  3A5Y A;  3ZN1 A;  2DQ3 A;  4U7O A;  4H2X B;  3RBZ A;  1Q82 W;  2Y69 B;  4JPR A;  1M56 B;  3LSQ A;  4G85 A;  4LNS A;  3FYI B;  2RHQ A;  1RPR A;  5EBW C;  4YXW G;  3B8M A;  4JGS A;  2WLN A;  2XAJ A;  4MVZ A;  4WF9 V;  1S77 D;  4PEL A;  1OZ0 A;  2B1G A;  3MHS C;  1B7Y B;  4MT8 A;  4X89 A;  4TQD A;  1WQ7 A;  2B1I A;  2XAG A;  5EC2 C;  3KFU A;  3ML0 A;  4P75 C;  4TVA A;  3CCQ V;  1H8H G;  2OT5 A;  1FXK C;  1KOG A;  4UPA A;  1MG1 A;  4KR3 A;  3CYO A;  3E8B A;  2HJF C;  1XL4 A;  2JJ2 G;  4WCE V;  1KMN A;  1YTF B;  4CBC A;  1K92 A;  4FPP A;  3SPJ A;  1EVL A;  2ZXW B;  3MEY A;  2K1E A;  1FXH A;  2MK3 A;  2XAS A;  4LVL A;  2EIM C;  1V54 B;  2EIL B;  1VQ6 V;  1NJ1 A;  1WLE A;  3R07 A;  2QM7 A;  2ITD C;  2KB1 A;  3EFR A;  1X2H A;  1R3K C;  3GWO A;  2E41 A;  2Q5H A;  2IJI A;  2XTI A;  2OTJ V;  3ZRV A;  3ZMZ A;  4GX2 A;  4BIZ A;  4MW3 A;  2DWE C;  3MF2 A;  3RAC A;  2ZNI A;  4UV9 A;  3ZRW B;  1G4Y B;  1H8E G;  3CD6 V;  5DM6 V;  2QA4 V;  1JX9 A;  1X55 A;  5C53 B;  4J15 A;  2DVE A;  5IY5 B;  4GX5 A;  1WQW A;  1L0W A;  3ZMT A;  3M4P A;  2IY5 B;  3MHH C;  3OMI B;  3L4G B;  2QHT A;  3E9I A;  4UP8 A;  1R3I C;  3ETG A;  4MVR A;  1V55 B;  2A79 B;  2WLK A;  1K9M W;  2FYK A;  2QEX V;  4ZKI A;  1B70 B;  3OD1 A;  1VQL V;  3A5Z A;  4EX5 A;  4MTO A;  4YRK A;  4OXS A;  1G5I A;  2A0L A;  2PMF A;  3LDD A;  4YRG A;  4J9Z B;  2Q6A A;  3HFV A;  1OCC C;  3BEH A;  2ZDI C;  5LHI A;  4HWO A;  5B3S B;  2IJK A;  1PNK A;  1WPX A;  3G6E V;  4XTY A;  2ZT8 A;  2HR3 A;  4HYO A;  3PZC A;  1G5H A;  1ASZ A;  3ABL B;  3FB7 C;  2F43 G;  3OUF A;  3CC7 V;  1GM9 A;  1THZ A;  4EO4 A;  4QPJ A;  5BZB A;  3RL6 A;  1EIY B;  2P90 A;  3HFZ B;  2Y69 C;  2DZC A;  1M56 C;  2LP7 A;  1YFT A;  1K3E A;  1N9W A;  1YB3 A;  4RQF A;  4H2T A;  1JJC B;  3CCL V;  1Q7Y W;  1W0J G;  4G27 B;  1WPY A;  4LC1 A;  4TSF G;  2ODR D;  1TUE B;  2P7T C;  3OR6 C;  5L3D A;  2C2A A;  1K7D A;  1YI2 V;  3P8Y A;  1DLB A;  2EZP A;  3VQW A;  1ADJ A;  4YDQ A;  1UJW B;  3WQZ A;  3AG4 B;  4K87 A;  2M7W A;  2ARU A;  4P75 A;  3ZCC A;  5L3G A;  1CEZ A;  1S5H C;  5EBL C;  1GO3 F;  1VQ8 V;  4UP7 A;  2B5U A;  3V7S A;  1QF6 A;  3CXC U;  4P3O A;  4UVC A;  4KP4 A;  2ZNJ A;  1QR9 A;  1V54 C;  2EIL C;  3DGE A;  4TVA B;  3QO5 A;  3RF1 A;  2WLL A;  2QM8 A;  1S72 V;  1VQP V;  3A32 A;  4UVB A;  4WI1 A;  5CA3 A;  3RKX A;  1ROP A;  3IC7 A;  4YPF A;  5F5W A;  4G2K A;  2JEU A;  2DW4 A;  4DQ2 A;  1IXM A;  2QHU A;  1NVP D;  4XDL A;  5LGN A;  4PHC A;  3JD4 A;  11AS A;  5IY5 C;  5KA6 A;  1R3L C;  2DJZ A;  1FYF A;  5LBQ A;  2DYS C;  1EQR A;  4YRS A;  3ASN C;  3HY1 A;  12AS A;  1KP2 A;  1WNL A;  5B1A B;  3QTC A;  1V55 C;  3VQX A;  4L87 A;  1VQ4 V;  2JK5 C;  2X6A A;  3CCJ V;  3LC0 A;  1HWY A;  3F5W C;  4QE7 A;  2ZXF A;  1KEC A;  1MAB G;  2EIN C;  4YRM A;  2I4L A;  2P0L A;  4LVM A;  3IKL A;  1M9N A;  3ASO B;  1QCE A;  1B76 A;  3CCV V;  4Q20 A;  1FS0 G;  4P30 A;  4I9W A;  3AG1 B;  4P73 A;  1AI6 A;  1SER A;  2J3M A;  4MVU A;  3CMQ A;  3AG2 B;  4P3P A;  2UXN A;  3K79 A;  1SES A;  3RW0 A;  3ABL C;  1I5X A;  4JAS A;  5L3C A;  4PA9 A;  3ZN0 A;  4HA8 A;  3P8T A;  3W7S A;  1YIT V;  2CJ9 A;  1Q81 W;  3VOU A;  1VQO V;  1Z7M A;  4FK5 C;  4P74 C;  2PME A;  3K03 A;  4J9Y B;  2Z5U A;  1P7B A;  4YCU A;  1EFW A;  3T4Z A;  5J9P C;  2XGT A;  3PCO A;  4Q6G A;  1X01 A;  5HGQ A;  4PA6 A;  4GT1 A;  4H2S A;  1VQK V;  4YRO A;  4HWR A;  2HVK C;  4PDL A;  3LNM B;  3B8N A;  4QNH B;  4DPG A;  4WJ3 M;  3F7V C;  4FMT A;  1ZWI C;  1OHH G;  2HLD G;  1ADY A;  2JJ1 G;  3HXV A;  3HRI A;  4XDK A;  2DZ9 A;  4LVI A;  1ARO P;  3ETE A;  3OAA G;  4N21 A;  3AG4 C;  4R50 A;  5L3B A;  3X2Q B;  3H01 A;  3I55 V;  1NJ2 A;  2IU3 A;  4HT4 A;  3OEH G;  2ITC C;  4MW8 A;  4FJC C;  4H33 A;  3DSQ A;  2WLJ A;  2Z3Y A;  3W7T A;  4GCZ A;  1W66 A;  4H37 A;  5C51 B;  2E1H A;  5C93 A;  1JJ2 U;  3JYC A;  1AJP A;  3EFF K;  4JF3 A;  5IYB O;  1QVG U;  3E89 A;  1YJW V;  1F51 A;  5IYD O;  4GX1 A;  3WG7 B;  1YFR A;  2NNU A;  4LCU C;  1PKX A;  3SYC A;  2AHZ A;  1MSW D;  4P9P A;  1YHQ V;  1K8A W;  3QNE A;  3ABK B;  1P4R A;  1K5Q A;  2P6J A;  3K3W A;  5KA5 A;  1M90 W;  4JTD B;  2I4N A;  2DU7 A;  3FJP A;  5IDJ A;  1FXK A;  1LYL A;  4RDX A;  2XND G;  4ASU G;  2WLL B;  4WFF A;  1QE0 A;  4UP9 A;  4WFE A;  3SPG A;  4CZZ A;  3STL C;  2EJR A;  2ART A;  2JEX A;  2Q5I A;  4X5O A;  4TQF A;  1NR1 A;  2GSM B;  5B1A C;  4RMF A;  1H4Q A;  1QR8 A;  4G28 B;  1YFS A;  1ORQ C;  2XOK G;  1ENV A;  4P72 C;  3VBB A;  1K73 W;  4HVC A;  2P67 A;  3M99 B;  3V7C A;  2WLM A;  4CS2 A;  2YEV A;  4ZIB A;  4UVA A;  2IJH A;  1VQM V;  3V8K A;  3NEN A;  3AG1 C;  1GM8 A;  4KQE A;  3ABU A;  3ABM B;  3M4Q A;  3FKS G;  1QBZ A;  2JDI G;  4DXW A;  2Q68 A;  4FIP C;  3AG2 C;  3OE7 G;  1OCR C;  2EBO A;  3SPC A;  2CJB A;  2IU0 A;  4LVK A;  3E8F A;  3REU A;  2DKG A;  3I56 V;  3FB6 C;  1OCO B;  4BW5 A;  2ARS A;  4YRF A;  2EAY A;  4QIW F;  3NET A;  4H2Y A;  4ZTZ B;  1Q86 W;  2ZIN A;  3L1A A;  1H4S A;  4XTZ A;  2GHY A;  1N8R W;  2RHS A;  3MQZ A;  2LFS A;  4CH6 A;  1KKD A;  2C7I A;  3PJS K;  1R6N A;  4PA3 A;  3G71 V;  2EJF A;  4DO2 A;  3E2E A;  2EJ9 A;  4K86 A;  4XTV A;  4AH6 A;  1NJI W;  2NS6 A;  1NYR A;  1K97 A;  2AMC A;  4JYB A;  1C0A A;  4QJF B;  1YJ9 V;  1RM1 B;  2E64 A;  1K4C C;  2ZDI A;  4MTG A;  2BOC C;  3GB7 C;  2DYR B;  4TVY A;  3ERR A;  3PCO B;  2DXT A;  4PA4 A;  1KMM A;  3TEH A;  1E1Q G;  4I5S A;  2RHQ B;  2HFE C;  1EZJ A;  3ZMS A;  1EOV A;  4O2D A;  3K04 A;  1NJ5 A;  4PG3 A;  3IFX A;  1X56 A;  3CP1 A;  1OCZ B;  4XU0 A;  3HXU A;  4YRT A;  2ZXW C;  1W2B U;  3A0R A;  1B7Y A;  1DF5 A;  1I5Y A;  4KUM A;  3WG7 C;  2WPD G;  1QLN A;  3ETD A;  3RGL A;  3G4S V;  2AHY A;  1G8M A;  3LDC A;  4TWA A;  3ABK C;  1VQ9 V;  3IGA C;  3RVY A;  5H6R A;  4YRR A;  3W7X A;  3HXW A;  4PDM A;  1HC7 A;  1GK9 A;  1GM7 A;  3SJQ C;  4LVJ A;  2V1D A;  3RKW A;  5B1O A;  1K33 A;  2D3O W;  3KG2 A;  2QKS A;  4R8C A;  1NR7 A;  4P71 C;  4YYE A;  3E9H A;  3LUT B;  4RUE A;  1DTO A;  3SYP A;  3AG3 B;  4KR2 A;  2I4M A;  1COW G;  4MTF A;  2ZR3 A;  3CC4 V;  2A9H A;  1S0V A;  3HTZ A;  5CN0 A;  4XU1 A;  3OM3 B;  1R3J C;  1NKD A;  5HFM A;  1FXK B;  4KFM A;  2J3L A;  3VQV A;  1QVF U;  4PDV A;  4P9O A;  3W7U A;  1JQ0 A;  3SPI A;  2EZO A;  1RPO A;  3E35 A;  3HXZ A;  3ZMV A;  3ABM C;  4YRN A;  3E83 A;  3CMA V;  3K0D A;  2ZZG A;  1EBO A;  3ZRW A;  1NH2 B;  3K9A A;  3W7W A;  1HTT A;  2HNI A;  3P32 A;  3OMN B;  2EJG A;  1BHA A;  4CH5 A;  3SYO A;  4WJ4 A;  5E1A C;  2XAQ A;  5LHH A;  5B3S C;  1OCO C;  3SYQ A;  1USY A;  2CK3 G;  1PD3 A;  2IY5 A;  2YEV B;  3OGC C;  1K4D C;  5E3I A;  4CH4 A;  3DTU B;  2DTH A;  4JAU A;  4K88 A;  1GTO A;  4XDJ A;  1H2G A;  5GW7 A;  3NEM A;  1ATI A;  3FB5 C;  1NYQ A;  1IL2 A;  1JVM A;  1VQZ A;  3JD2 A;  2HVJ C;  1J95 A;  1RIQ A;  4YRJ A;  2X7R B;  4JTA B;  4XEM A;  1EFR G;  1RM1 C;  2DEQ A;  4X8A A;  4XTW A;  3ABT A;  5ELN A;  1DF4 A;  3UM7 A;  2ZZE A;  3P30 A;  5H9C A;  3E86 A;  2DYR C;  3HY0 A;  2RHS B;  4Q15 A;  1M57 B;  3CCS V;  4XU3 A;  3E8H A;  1F4N A;  2DQ0 A;  4QPK A;  3BFM A;  1EIY A;  4WFH A;  3ZIA G;  1NJ8 A;  3TCU A;  1SZT A;  1GKF A;  4LP8 A;  3ZRX A;  5K1P A;  2OTL V;  2ODR C;  3HB3 B;  4P74 A;  1PNM A;  2ZT7 A;  1E1R G;  1OCZ C;  1OCC B;  1SET A;  3UGQ A;  1J5W A;  2W0F C;  2ATK C;  5EBM C;  4YRQ A;  2OCC B;  1SRY A;  4YRE A;  3RIR A;  1S76 D;  4EKW A;  1WYD A;  1F23 A;  2ZCE A;  5LHG A;  3EHB B;  4PA7 A;  3F7Y C;  1M1K W;  1PL0 A;  1JPX A;  3UH0 A;  2DTO A;  3TEH B;  4TT3 G;  4E51 A;  1E1O A;  2ZTG A;  3QO8 A;  3UFG A;  5DN6 G;  3JD0 A;  4WFG A;  4Z1M G;  4CS3 A;  3TK1 A;  2E3C A;  1ASY A;  3AEI A;  2X0L A;  2R9I A;  2WSS G;  2WWW A;  5B1B B;  3A74 A;  1BMF G;  3OW2 U;  3EFS A;  1YTF D;  1YSC A;  3AG3 C;  1HXD A;  4RUF A;  1VQ7 V;  4MS2 A;  1KP3 A;  3E8G A;  1AI5 A;  3A7A A;  3L2Z A;  3CCM V;  4MTX A;  1Y66 A;  5L3E A;  4MVM A;  4TVW A;  2WLI A;  5EK0 A;  4JAV A;  3D3I A;  1NJ6 A;  3TUP A;  2IJJ A;  2EL9 A;  4H2W A;  3ZRS A;  2DWD C;  5K1X A;  1W0K G;  3ASO C;  1JOY A;  2QHS A;  4G84 A;  1CPY A;  5L3F A;  1S3J A;  1YJN V;  1PYS A;  2ALY A;  2DTI A;  2ZIO A;  2CIM A;  1AJQ A;  4YCV A;  1F4M A;  5ELO A;  2DU5 A;  4R7C A;  4BWA A;  4MVQ A;  1E79 G;  3JCZ A;  3R65 A;  2HG5 C;  2WAM A;  4UXN A;  4BAY A;  1E1T A;  2ZT6 A;  4OP0 A;  1AR1 B;  1GMG A;  1QLE B;  1NBM G;  4MSW C;  3P8V A;  4P72 A;  1LNQ A;  1FXV A;  2XAF A;  2DDZ A;  2JIZ G;  2CGH A;  4YRC A;  3D36 A;  3HPL C;  3V8L A;  2IH3 C;  5H6Q A;  5LGT A;  2DYS B;  3FB8 C;  2IH1 C;  2ZR2 A;  3ASN B;  4JYC A;  1BBW A;  3WFV A;  2V7Q G;  1MOF A;  3QO7 A;  4TWK A;  4CS4 A;  3BJU A;  2ZD9 A;  5CMU A;  2G4C A;  3REX A;  1M57 C;  2FTK A;  3OFN G;  3RVZ A;  5CBF A;  1X54 A;  2QHV A;  1BIA A;  1X2G A;  4HWT A;  4XTX A;  2EIN B;  2Q69 A;  3ZJZ A;  2PI4 A;  3JD1 A;  3X2Q C;  1KQS U;  3NEL A;  2DXU A;  2EIJ B;  2Y48 A;  2AKW A;  2P5I A;  1AJN A;  3TEG A;  2A8E A;  2C8M A;  4YP0 A;  3K0G A;  4YRL A;  2X6C A;  1G51 A;  1R6K A;  2X6B A;  2OCC C;  4H2X A;  3TET A;  2E65 A;  1E24 A;  3STZ C;  4UUJ C;  4WFA V;  4H2U A;  2LFR A;  3UGT A;  2EIK B;  3NXS A;  3HRK A;  2Q7E A;  4H2V A;  2UXX A;  2E10 A;  1AI4 A;  1BL8 A;  2H94 A;  3MF1 A;  2ZZF A;  4YRI A;  2ZGW A;  3OUS A;  2IW5 A;  4UV8 A;  3ICA A;  5FL7 G;  3B77 A;  5B1B C;  3IKM B;  5B1N A;  3RKY A;  2WLH A;  4LBE C;  4R6Z A;  5CBH A;  1AI7 A;  3JD3 A;  3CME V;  4YRP A;  1BHB A;  1L1F A;  1K34 A;  3HXY A;  4WF2 A;  4XBF A;  4HZ3 A;  3K08 A;  4PDR A;  1YGB A;  2ZQM A;  5LGU A;  3LDE A;  1EVK A;  2QTO A;  3OR7 C;  3CCU V;  1CP9 A;  1PNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...