2DQ3A

Crystal structure of aq_298
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
425
structure length
425
Chain Sequence
MIDINLIREKPDYVKERLATRDKELVSLVDKVLELDKRRREIIKRLEALRSERNKLSKEIGKLKREGKDTTEIQNRVKELKEEIDRLEEELRKVEEELKNTLLWIPNLPHPSVPVGEDEKDNVEVRRWGEPRKFDFEPKPHWEIGERLGILDFKRGAKLSGSRFTVIAGWGARLERALINFMLDLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKCERDNLYLIPTAEVPLTNLYREEILKEENLPIYLTAYTPCYRREAGAYGKDIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVVELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRMNTRFKDSKTGKNRFVHTLNGSGLAVGRTLAAILENYQQEDGSVVVPEVLRDYVGTDVIRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Seryl-tRNA synthetase
publication title Crystal structure of aq_298
rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 133
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dq3A01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2dq3A02
3HXXA 1WNLA 4P3NA 2C7IA 5ELNA 3VQWA 3TEHA 2E5AA 1NYQA 2ZT8A 4P73A 4CH6A 4P3PA 2DU7A 4TVWA 4K86A 3ICAA 3REUA 4YRNA 2E3CA 4YRCA 3VQYA 1SETA 4P72C 1NYRA 1X55A 1EIYB 4XEMA 5C51B 1USYA 2EJFA 4WF2A 1C0AA 4H2SA 4H2WA 2QHSA 3L4GB 4XTUA 4YYEA 2DXUA 4XU3A 3G1ZA 5K1XA 3A7UA 2ZNIA 4YRMA 4YRFA 3IALA 4RMFA 1WQ7A 3NENA 4XTXA 1E24A 2P0LA 2ALYA 4YRJA 1RIQA 1L0WA 3UH0A 2RHSB 2I4LA 3TEGA 1B7YA 1YB3A 4YCWA 2EJGA 4Q15A 2J3LA 2I4NA 4YRTA 4HA8A 3FJPA 4WI1A 3QTCA 1B76A 1BIAA 2CIMA 3DSQA 4PG3A 4YCUA 4AH6A 3QNEA 3R07A 1E1OA 3RGLA 11ASA 4KR3A 3HFVA 4NCXA 4H2XA 4YROA 4TQDA 4CH3A 3V8LA 3VQXA 1NJ2A 4XEOA 3UGQA 2ODRC 4XTZA 4YRPA 2XTIA 3A32A 1Z7MA 4ZIBA 4P71A 4DQ2A 4UP7A 4P74C 4G85A 1J5WA 1WLEA 2IY5A 3HXVA 5KNNA 1EFWA 3QO5A 2ZZGA 1PYSB 3CMQA 1QE0A 1VQZA 4E51A 1KMNA 4OLFA 3VQVA 2ZCEA 1G5HA 1G51A 3PCOB 2ZT5A 2J3MA 4YRLA 1LYLA 3P8TA 4XTVA 3A5YA 4TVAB 1PYSA 3L1AA 4YDQA 3P8YA 2Q7GA 4BW9A 4UP9A 1E22A 5HGQA 3RUXA 5K1PA 4ZTUB 1EOVA 1EVLA 3W3SA 4XTWA 3RF1A 3TEHB 3MEYA 1QF6A 2G4CA 2I4MA 3NELA 4LNSA 4YP0A 4KR2A 1NJ5A 2DDZA 2ARSA 2QHTA 4XU1A 2CGHA 1HXDA 2AKWA 3LSSA 2ODRD 3HY0A 3OD1A 3V7RA 4P72A 2DQ3A 3QO8A 4CS2A 4YRKA 3MF2A 4WJ4A 2DVEA 4UPAA 3BFMA 4YRRA 2AMCA 3IKLA 1WPYA 2ALYB 1Z7NA 2ZT7A 2C8MA 1B7YB 3LSQA 4X5OA 3IG2A 1ADJA 2DTHA 2E65A 4P3OA 4L87A 3RIRA 2FYKA 4P75A 2EJ9A 3A5ZA 4EX5A 2QHUA 3I7FA 4HWRA 3HFZA 1X2GA 3NETA 1H4TA 1SERA 5ELOA 4YRGA 3A74A 2ZNJA 4H2XB 2DJZA 3HRIA 4YRSA 1B70A 4HWSA 1EQRA 2E1HA 2DXTA 1H4VB 3HXWA 2IY5B 4XTYA 2CJAA 1WU7A 2ZZEA 1X56A 4YRIA 2QHVA 2CJ9A 4P74A 1YFRA 2XGTA 1ASYA 3M4QA 1G5IA 4DPGA 4K88A 4OP0A 1IL2A 1ATIA 4YPFA 3MF1A 2ZIMA 4HWOA 1H4QA 3KFUA 2Q5IA 2ZGWA 4H2UA 1WYDA 4J15A 3HTZA 1HTTA 2ARTA 3A7AA 4EO4A 1N9WA 4CS3A 2AKWB 2PMFA 2ZTGA 3P8VA 3UFGA 1E1TA 1FYFA 4O2DA 1BBUA 1YFSA 5F5WA 3HRKA 4H2YA 5C53B 2DQ0A 1YFTA 4UP8A 3E9HA 4HWPA 1EVKA 2ZXFA 1SESA 1BBWA 4RQFA 4CH5A 3PZCA 2RHQA 3RKWA 2AMCB 3A31A 4KQEA 2ZINA 3V8KA 4P73C 3ERRA 4YCVA 3E9IA 2CJBA 4RDXA 1HC7A 2I4OA 1GGMA 4H2VA 2E10A 2EWNA 2DU5A 1USYC 1KOGA 4CS4A 3A7RA 4TWAA 4XU0A 1W66A 3M4PA 4CH4A 1EIYA 4WJ3M 3HFZB 2Q7EA 2DZ9A 5E3IA 2E41A 3RACA 3L4GA 4K87A 2DTOA 3UGTA 1NJ1A 2DKGA 3BJUA 4YRQA 5C52B 3TUPA 1WQWA 3RKXA 1JJCB 1B70B 4TTVA 1BIBA 4TVYA 1KMMA 4Q6GA 1X2HA 4H02A 4TQFA 4ZTZB 1JJCA 2ZR2A 12ASA 3HY1A 3IKMB 4P75C 3HXUA 1X01A 1ASZA 1ADYA 2HNIA 4YREA 1H4SA 2RHSA 2P5IA 3NEMA 2ZZFA 2ZT6A 4H2TA 4HVCA 3EFSA 3EFRA 1YGBA 2EAYA 1X54A 1B8AA 4PHCA 2DEQA 3HXZA 4P71C 2Q5HA 3V8JA 3QO7A 2PMEA 3V7SA 3V7CA 3VBBA 3RL6A 2ARUA 2ZR3A 1NJ6A 1SRYA 3HXYA 2DZCA 4HWTA 2Q7HA 1NJ8A 4BWAA 3RKYA 4G84A 3L2ZA 3REXA 2EL9A 2RHQB 3LC0A 4RQEA 2E64A 2DTIA 3PCOA 4TVAA 2ZIOA 1NNHA 4XU2A 3WQZA
chains in the Genus database with same CATH superfamily
3HXXA 4K35A 4GKKB 4P2ZA 4KUMA 3STZC 4J9YB 4Z1VA 4CBCA 3S3XA 5ELNA 3JAWA 2YXYA 1S72V 2JVDA 2WLMA 2ZT8A 1D2DA 3JARA 1AB3A 4PV1B 3REUA 4FLVA 4YRNA 3AG3B 4G28B 5IYCO 4Q20A 4P72C 3P3NA 3OTOO 3FB8C 3OTOB 1X55A 4XEMA 1C0AA 5IY5B 3SJBC 4FLTA 1OCZB 4LF5O 4LF5B 3L4GB 2EULA 2E75B 3UT5B 4P9OA 4X20A 2OTJV 3SR2C 5DN6G 4LWSA 4MVOA 1H2KA 3C90A 4JI7O 4JI7B 3A7UA 5H9CA 2HP8A 3KCXA 2R72A 1NH2B 1TUEB 3ABMB 3JD2A 2DOSA 2XTAA 3QVNA 2P0LA 1VQ6V 1IBMB 1ZL8B 4U7NA 1ZUQA 5KA5A 3T4ZA 2KKWA 2I4LA 3TEGA 2Q9LA 4OX9O 4OX9B 2BTQB 3RN4A 4YCWA 2J3LA 1I5YA 3U0ZA 2I4NA 3RVYA 2PI5A 4R8CA 4JF3A 1Y74B 1QBZA 4FFKA 1ZAUA 4O4LB 1XMQO 1XMQB 2Z0AA 5B66Z 1BIAA 2LFRA 3DSQA 5EBMC 5B1AC 4YCUA 4JTCB 1A32A 3RGLA 3ZRWA 1NTZH 3JALB 2JRIA 1L0NH 4X1KB 4RO2A 2E76B 4UB8Z 2XAQA 4H2XA 4YROA 5BY1A 3W7UA 4CH3A 3V8LA 1RPOA 5JJJB 4XTZA 4YRPA 2XTIA 1KB9F 1MOFA 4MSWC 3ZMUA 2UUBO 1LUWA 2FL4A 3IC9A 2W0XA 1Z7MA 4ZIBA 2DJVA 2QR4A 3BA8A 1J5WA 1MA1A 5CBGA 2AHYA 5KNNA 3QO5A 1RSOB 1HW7A 3ETDA 2YIDA 2OYQA 2ZZGA 4Z2WA 5LOVB 2GDSA 1VQZA 1K5QA 1IBKB 1IBKO 2P06A 1FXVA 3PCOB 4XTVA 3A5YA 1FS0G 1GM9A 3P8YA 5IE9A 1E1RG 5LMNO 5LMNB 3FB6C 3EVKA 2CK3G 1E22A 3FYIB 3K5OA 4BR6A 1VQLV 2VRZA 1GH6A 3JAWB 4I9QA 3RF1A 4MVSA 2AZ2A 3MEYA 3CRRA 1OV9A 4J80A 2B9ZA 2I4MA 3JARB 3NELA 3MDSA 4BIZA 4KR2A 4DUZO 4DUZB 2DE0X 4UV8A 1F7YA 5EYPA 2ODRD 2B1IA 2RNBA 1PKXA 3E8HA 4MVQA 2QM8A 3A8TA 1VQPV 2DQ3A 2QJ1A 4X20B 3LSUA 1XNQO 1XNQB 1I08A 4LWSB 5KMGA 4YRKA 2Q4PA 2R9AA 3MF2A 5BXZA 1VF6C 5L3DA 4ZHQA 4YY3O 1Q7YW 2JEXA 4YRRA 3CRMA 4E4EA 1OZ0A 4O2BA 1MZEA 3OEHG 4LBEC 1K9MW 4B3MB 4B3MO 1N36O 1N36B 1MG1A 2ZT7A 1G6UA 3AG3C 3ZS8C 3G71V 1WNSA 2ADPA 3IG2A 2IJKA 4UCRA 5DEDA 5LL6Y 1RM1B 4DV5O 4DV5B 4DR2O 5H6QA 1EN5A 3CCUV 2E65A 5IY5C 4P3OA 4L87A 2B1GA 3D36C 2FYKA 3ETGA 4P75A 4TSFG 3A5ZA 4ZI7A 4EX5A 4HWRA 5B1BB 1AJPA 2A3QA 3HFZA 4WF9V 1H38A 3ZRWB 4KP4A 4DV3O 4DV3B 4JI4O 4JI4B 1SERA 4YRGA 1P49A 3A74A 4R50A 1VQ9V 3HR0A 4H2XB 2KQXA 3IAYA 3J7AU 2UXCO 2UXCB 5KHJA 4GX0A 4HAMA 3ABMC 4YRSA 1SC5B 1AR5A 2GSMB 5IWAO 5IWAB 3HXWA 2IBZH 4XTYA 1YF2A 3ZIAG 2CJAA 2EBOA 4YRIA 2YDEA 3NXSA 4IHJA 1NKDA 2YI8A 3SPGA 2N74A 1V54B 3M4QA 4DPGA 2EILC 4DR1B 4O4JA 1BCCH 5EIBC 1WB7A 2ZIMA 2PYJA 2WLIA 1H4QA 2F95B 3T2MA 2IW5A 4JASA 1P84F 3OE7G 1VQOV 4FLWA 5KA6A 3GWKC 1R6NA 4RWUA 4J15A 1EZJA 2VWKA 5LGTA 4YIPA 3AK1A 2YIAA 4IGGA 1WA8A 1GN2A 1FYJA 3T1YO 3HKEA 5EYPB 4LCUC 4FLUA 2ZE6A 4UCVA 3WFVA 5IT9N 2WPDG 3ZBHA 1XMOO 1XMOB 3ABLB 1PV0A 3DC5A 1YJNV 3GB7C 2QGNA 5F5WA 3IC7A 4H2YA 4XDKA 5KMGB 4MTFA 2QM4A 2VQFO 2VQFB 4J41A 1BS3A 4ZHQB 1SESA 1BBWA 4RQFA 2B5UA 4ZOLA 5A9GA 1CEZA 4O2BB 3F5TA 4AQYB 1LUVA 4QGPA 5F2VO 4GKJB 4GKJO 2ZINA 5KHHA 4UFZA 3ERRA 3K04A 4RDXA 4K8XA 1H2NA 4MVUA 4WFAV 5BZBA 2YIBA 3JATA 2DU5A 4DK0A 2WAMA 5J2TA 4LF6O 3SYPA 2GTSA 3CC7V 3M4PA 1YDXA 4JZ2A 4ZI7B 3LNMB 3HFZB 3CX5F 2W0FC 1GK9A 4LVKA 4QPKA 2DYRC 1F4MA 3U11A 2DZ9A 3H9VA 2DYSC 1SZXA 2ILMA 1F23A 4B7KA 2WLHA 2QKCA 3ZHVA 3BJUA 3G6BA 4FM0A 4OGQB 2NN4A 1K4DC 1R6KA 3CP1A 2YC0A 4LFCO 4LFCB 2QEXV 1SQQH 1X2HA 1S0VA 1CXZB 1VEWA 2L6LA 2P90A 2RCVA 3CC2V 1JJCA 1M1KW 3IKMB 4IHJB 5L3FA 5CB4A 2UUAB 4N21A 5LYJA 1ADYA 1H4SA 3WG7B 5EK0A 4O4JB 1K4CC 1G8MA 2ZE5A 3T4DA 2D2CB 4H2TA 4LF8O 4LF8B 1AI5A 5B1BC 3OR7C 3K9SA 3EFRA 2P67A 3B40A 2WLIB 2Q73A 4QJFB 1SZTA 1X54A 2Q67A 3CRCA 4TWKA 2QWQB 4B3SO 2P22C 3P32A 2E74B 2QWPB 4PDMA 1WA8B 2LP7A 1VQ4V 3K59A 3V8JA 3HKEB 2QA4V 3QO7A 2PMEA 2ZE7A 3VBBA 3RL6A 2ZR3A 2Q0AA 1NJ6A 1DF5A 1S5HC 1R73A 3P30A 2HKOA 3W7XA 1BQZA 1GTOA 4JTAB 1V54C 3RKYA 1AJNA 3SJQC 1SA0A 3CCLV 4ZOLB 1ZWIC 4DR4O 4DR4B 2EL9A 3RYIA 1BHBA 4GYCB 2DTIA 2BE3A 1K97A 1Q82W 1NNHA 4XU2A 4DV1O 4DV1B 4FMTA 3AG1B 2UXDO 2UXDB 1TA8A 3ETQA 3W7WA 4DV7O 4DV7B 3KG2A 2ZDIA 2XOKG 2C7IA 1AI6A 1GO3F 1NTKH 1RP3B 1RFYA 1NYQA 1PL0A 3JATB 1BMFG 4UVBA 5J2TB 4P73A 5H5NA 4P3PA 1YJ9V 4K86A 4H44B 3ICAA 1KMIZ 2E3CA 1J5EO 1J5EB 3ABLC 2K1EA 4LFBO 4LFBB 5C51B 2A0LA 3STLC 5KHKA 3W7TA 1WP7A 1XHZA 3H1HH 3K79A 4XTUA 1JCHA 1UFIA 4J7KA 3TGUH 1LR1A 4J7ZA 3M99B 5JH7A 1ZLZA 3HPLC 1Q86W 2ZNIA 5B1AB 4YRMA 4PELA 3SYOA 4RMFA 4I4TA 1I94O 2IJIA 3BEHA 1I94B 1DK1A 4YJ2A 4G2KA 4I9WA 3CXHF 2WLLA 3AG4C 1D5AA 4XTXA 5BR8B 2IJHA 4EFBA 5FLXN 1JX9A 4X8AA 3K03A 5CB4B 5LYJB 1AR4A 5LHHA 1L0WA 5BMVA 1L1FA 1W0JG 4Z1MG 1QVGU 4FIPC 4YRTA 3JSLA 4DW1A 5L3BA 4EFEA 1IXMA 4WI1A 3MQZA 3IFXA 1B76A 2CIMA 1VQNV 3QNEA 4B08A 4D7TA 1BGYH 3R07A 1E1OA 3CMAV 3HFVA 4H13B 2X6BA 3O9OA 1ZSPA 3K0GA 3BFRA 4NTXA 2IM9A 3B8NA 3VQXA 3B77A 1NJ2A 2UUCO 2UUCB 2JJ2G 2CTWA 3CSXA 3FKSG 4JI6B 4JI6O 1US6A 4X65O 4X65B 4QPJA 4P71A 1Q81W 2K9PA 3CWBH 4HZ3A 1WLEA 2IY5A 2GHYA 1LNQA 2Q5ZA 2EIJB 1Y4MA 3WG7C 1EFWA 4EB6A 1M4UA 1CPYA 4X1IA 1PYSB 1SA0B 1Z2GA 4WBNA 4IYIA 1QE0A 2Y4UA 3UO3A 1DF4A 1OCCC 3CB2A 4OLFA 3RYIB 3VQVA 1DLBA 2A06H 4LC1A 2ZT5A 4LVMA 3P8TA 1XL6A 3L1AA 1Z5WA 5LOVA 2H3OA 4DR5B 4R7CA 5CN0A 1EVLA 2E5LO 2E5LB 1M93A 3K08A 2VWJA 4JGSA 2DMXA 3CYOA 4DRXA 4GKKO 3OTFA 4PDLA 3QG5A 1AP5A 1X59A 2DDZA 2ARSA 5EC2C 5CA3A 1WPXA 4OXSA 2CH7A 3L75H 1HXDA 3LSSA 5B5EZ 2OCHA 3HY0A 3ZCCA 2P7TC 5EC1C 2YUAA 4IL6Z 2A79B 3HKCA 1ZX3A 4H37A 3A0HZ 3CCVV 1R3KC 2OIEA 5JH7B 4LF7B 3GVMA 4WJ4A 2UXXA 2GUZA 3RFRA 1NR1A 4I4TB 4YJ2B 5FL7G 1KC8W 2WLLB 3KKYA 3AG1C 3WB1A 1GKFA 2DN9A 1CP9A 2XT9A 1S76D 5KHIA 5KUKA 1VQ5V 4A5UB 3BHPA 3K06A 5BMVB 2BOBC 2KG7A 2V1DA 2C8MA 1H2SB 2PTMA 4MT8A 4PA4A 1Z5VA 1IBMO 1VIBA 1ADJA 2ADQB 3ZMVA 3N27A 3T1CA 3I56V 3RIRA 3ASOB 2RN9A 2EJ9A 2QHUA 1BL8A 1XOUA 3ETEA 5GONA 4TV9A 1X2GA 1H4TA 2EILB 3UQ8A 4TT3G 1MMMA 1FFTB 4XDLA 3F7YC 3RWRD 4NXNB 2DJZA 1E1QG 4IIJA 3HRIA 1QR8A 4DXWA 1EQRA 2E1HA 1PL4A 3KZIZ 5AG2A 2IY5B 3ZN1A 1MNGA 2R9RB 1YHQV 1Q3EA 5J9PC 2ZZEA 2QWNB 4EB6B 1X56A 1FKAO 4X1IB 2CJ9A 1M57B 4WBNB 3F7VC 1ASYA 1VQMV 4UXNA 4PA9A 3LDDA 1PNMA 4PD4F 1NJIW 2BTOA 1XEQA 1M5IA 5FPRA 3MF1A 3KFUA 2ZGWA 3C3TA 4U3JA 4DRXB 1AJQA 1HTTA 4JTDB 2ARTA 2R70A 3A7AA 4JI5O 4JI5B 1N9WA 2CTRA 2CH7B 1NH2D 1IBLO 1IBLB 1BZKA 3D3QA 4K8ZA 1M9NA 1E79G 2EIJC 3P8VA 1F4NA 1FYFA 4ZBMA 3HKCB 4MTXA 4E2LA 3HRKA 2DQ0A 4UP8A 4N23A 4PA7A 1R3JC 1V9PA 3E9HA 2PF4E 2GUZB 2QWOB 3VOUA 4HWPA 1HP8A 1R1BA 5EZYA 4KFMA 2DYRB 2OIGA 2RHQA 2DYSB 2ZDIC 1XILA 5EIBD 1XDCA 2JK5C 3V8KA 4P73C 3E9IA 2CJBA 4IT5A 2KG7B 2HHHO 2HHHB 3RW0A 4FM2A 3E2EA 5LXTA 3JASA 2EWNA 2QDOA 2YXLA 4F6RA 1GN4A 4CS4A 1M56B 4XU0A 1W66A 4GX2A 1K33A 3ML0A 2OTLV 2EX3A 4CH4A 1EIYA 4NTYA 1K7DA 2ARHA 5GONB 4TV9B 4JPRA 4NB5A 1ORQC 3BAAA 4MTOA 1RPRA 5E3IA 3CRQA 2AZ0A 1FD9A 1QQCA 4RAIA 1S5JA 2DTOA 4K87A 3UGTA 2P5OA 4JAUA 4OPHA 1PPJH 2DKGA 3ZHQA 2X6AA 3L71H 4IIJB 3TUPA 3RKXA 4I5SA 4I55A 4TTVA 3ZX6A 1BT8A 4Q6GA 2WLJA 4I0XA 5H6RA 1QNMA 4H02A 4WFEA 3J81N 4TQFA 3L72H 3K58A 3HY1A 1K3EA 3K9AA 4YIOA 2RHSA 2P5IA 3OMNB 3SJCC 3TXSA 4JI1O 1W0KG 3ASOC 4JI1B 3MD0A 3NEMA 4HT4A 1K8AW 4W4LA 4X62O 4X62B 1YGBA 4QE7A 4DR1O 1WAZA 3OMIB 3G67A 3G80A 4DUYB 4BAYA 4U3JB 1FXHA 5E79Z 1KD1W 1NVPB 4FZ0A 4MVRA 3K5LA 1B8AA 3B09A 4PHCA 4CC5A 1JVMA 2JGDA 4KL1A 5KLVH 3HXZA 2Q0OC 1IDSA 2XNDG 3BA9A 4P71C 3JD3A 3SPJA 2Q5HA 4FFBA 2IH3C 4GUNA 1SQPH 2R9IA 3ZEDA 1SRYA 2IU0A 2WLNA 1SQVH 1M57C 1UJWB 3OGIB 2DZCA 1KYOF 4YHHO 4YHHB 1NJ8A 1AI7A 1KP2A 3K5MA 5KAFZ 3R66A 5EZYB 1KKCA 2RHQB 4RQEA 2E64A 3FD9A 2ZIOA 1SQFA 3CEIA 3WQZA 3T1HO 3T1HB 2M6YA 2H8PC 3B2EE 1TUBA 4QIWF 4P3NA 1XUQA 1XHXA 2UXBB 1N8RW 5C93A 1AP6A 3VQWA 4BW5A 1H2LA 2ATKC 2E5AA 4AQYO 5LXTB 3JASB 3TCUA 2F43G 4F6RB 4X66O 4X66B 2OT5A 4CH6A 1J95A 1HNWB 3AG4B 4TVWA 4PA6A 1HWYA 3RGBA 1N34B 1N34O 4LVIA 3WB0A 1PP9H 1YSCA 4LH6A 1SETA 1JQ0A 1OCRB 2YXHA 4DV2B 1NYRA 1EIYB 1KBHA 1U97A 2FMLA 4YXWG 2EJFA 4WF2A 2GTAA 4H2SA 1QHTA 3ABKC 4UUJC 3ZRXA 1URFA 4XU3A 3WU2Z 1WN7A 3DXRA 4P30A 5K1XA 4PHZA 4I55B 4D6TH 1YEWA 5B1NA 2PI4A 5LA6A 4DR6O 1NVPD 1VARA 4DR6B 4I0XB 1BQ0A 1L8DA 3ASNB 3RVZA 1GN6A 3AEIA 3FB5C 2XAHA 1EM1A 3FYEB 2F23A 1OCOC 4LF9O 4LF9B 4L8JA 3CCJV 1YXBA 1M56C 2RHSB 3UH0A 2EZOA 3H1KH 5IYZA 1KECA 3CJHA 2EJGA 4JAAA 2UUAO 2QSAA 1EZVH 2CE4A 3FJPA 2NLJC 2AXTZ 3ZJZA 2V4DA 5JVDA 1OCCB 4JYCA 1N32O 3ZN0A 1N32B 11ASA 3ZMTA 2JGDB 3DTUB 5E1AC 2FTKA 3P3PA 2WA3A 3APQA 4FFBB 1XI1A 3A32A 2X6CA 4RUEA 4AILC 2LW7A 4G85A 3M8AA 4LFAO 4LFAB 3L9DA 3ZHRA 1IZ3A 3OGCC 4HNAA 2D3OW 3UKMA 3HXVA 1YCIA 1OJHA 4E51A 3HKBA 2BCCH 2ZCEA 1W59A 4C7UA 1G51A 2J3MA 2DW4A 2NS6A 2W6JG 3CMEV 3NR7A 1PYSA 2ZE8A 4MTGA 2HLDG 4BW9A 1TUBB 4UP9A 5HFLA 5HGQA 3OUSA 2XAGA 4X64B 5K1PA 3G4SV 1QCEA 2QTSA 1YTFB 4XTWA 1TAEA 1QF6A 2G4CA 5DECA 1IVSA 2A8EA 4GCZA 4YP0A 3A2FA 1NJ5A 4DV0O 4DV0B 1YJWV 1L0LH 2CGHA 4PA3A 1SKVA 1HNXO 1HNXB 2QE7G 5B1OA 3V7RA 1SQGA 2FKXA 1PNKA 5FNVA 3ZHSA 4EEQA 5LGNA 3A0BZ 1AILA 1QLEC 5LP6A 3QO8A 4CS2A 3DXRB 3JD0A 4B3TO 4B3TB 2DWDC 5IJ9A 1SQBH 4X9QA 3RYFA 3J80N 2DVEA 2RMKB 4UPAA 1EN4A 1F51A 5LA6B 2HEPA 4NKGB 4LNUA 4LF4O 4LF4B 2JS5A 2UU9O 2UU9B 3IKLA 4LR3A 5B3SB 1N0NA 2Z5UA 2Y0IA 5IYZB 5BR8O 3LSQA 2RQ6A 4DV6B 1EFRG 3CJHB 3AK3A 1Q6IA 1OCRC 3GWOA 3L70H 2X7RB 3TETA 4X88A 1WP8A 1KUQA 2QTOA 3I7FA 1VF5B 5JVDB 1WB8A 4DYLA 3JAKA 4K3AA 3N2KA 3CC4V 2AHZA 2ZNJA 3DC6A 4FZ1A 1B6QA 2IU3A 4PDVA 2MW2B 3ASNC 5D5QA 2ZXWB 1B70A 1YTFD 1QU7A 2DXTA 1H4VB 4KHPB 1GN3A 3W7SA 4LVLA 1HR0O 1HR0B 1GM7A 4HNAB 4J7JA 1NBMG 2YIBD 4P74A 1M90W 1H8EG 4FM1A 2JIZG 1VMGA 2XGTA 1NR7A 1HNZO 3HKBB 2HR3A 4F6EA 1HNZB 3ABUA 4WFBV 3MHHC 1IL2A 1P7BA 4GX5A 3CHXA 1ATIA 4YPFA 3AG7A 4HWOA 3R65A 4H2UA 3EFFK 4DR5O 3FB7C 4FLZA 3UO2A 3HTZA 3B4SA 1NZ6A 4MW3A 4UB6Z 5CA1A 1SS3A 4CS3A 2L35A 2XASA 3TK1A 3AG2B 2ZTGA 3APOA 4P9PA 5KAIZ 2PUSA 2WLKA 1P7GA 5FNVB 4GT1A 2OCCB 5LP6B 4R6ZA 5IJ9B 2EIMC 4B3RO 4B3RB 3RYFB 1MSDA 2JDIG 3OR6C 3D8CA 2ZXFA 3B8MA 4CH5A 4WFHA 3MHSC 1N0JA 2N05A 3PZCA 4LNUB 5IDJA 3E35A 4UCTA 4LF7O 4KQEA 1G4YB 4DW0A 1G1XB 3ZMZA 5LHIA 1VF7A 2YI9A 3K5NA 3ZMSA 2I4OA 1GGMA 3OM3B 5EBLC 3FFQA 2O57A 1WPBA 3A7RA 2JGUA 2V7QG 1KQSU 5IYDO 2BOCC 4IYHA 5CA0A 1ZTEA 3AK2A 3SPCA 3JAKB 1BE3H 3N2KB 4J9ZB 3RYHA 2E41A 3RACA 4H0LB 2QM7A 1JJ2U 1NJ1A 5A2QN 2GBOA 1XL4A 4F4LA 3CXCU 1UPGA 1WQWA 1I5XA 1KKDA 2WWWA 3OD4A 1B70B 1AI4A 3Q4HA 2LQTA 4RUFA 1KMMA 3ZHUA 5B3SC 4LP8A 4NXNO 3BVOA 5GW7A 2EJ7A 1GAXA 2A9HA 3LUTB 4O4HA 2ZR2A 4HBNA 3CD6V 3OT7A 4QE9A 2Y48A 4LH7A 1MZFA 3HXUA 4X1YA 1X01A 3ABTA 2AW9A 4JAVA 1ASZA 4WFGA 4YREA 1Y67A 4I7ZB 5JWPA 3X2QB 2Z3YA 4HVCA 3EFSA 4GZRB 4I50A 2ZT9B 4AI8A 1FFXA 1X4TA 2XUMA 1QLNA 2ETNA 3A0RA 5KUMA 2EZPA 2UUBB 2ZXWC 1XREA 1TVKA 4GX1A 1SF9A 5CA1B 3E83A 3JYCA 2ARUA 2HFEC 2Q6AA 4JYYA 5L3EA 2Q7HA 1MABG 4JV5B 4JV5O 4FLYA 3L2ZA 4MVZA 3REXA 2ZQMA 1B06A 3LC0A 3ABKB 1WJZA 3BRCA 3JD4A 4DK1A 4X89A 4TVAA 3LDEA 3CCEV 2OWOA 2AGAA 1O9GA 3S3WA 1WNLA 4U7OA 2UXNA 2XAJA 4FPPA 3ZRVA 3TEHA 2PZSA 4J10A 1JOYA 4W4KA 2DU7A 4UCUA 3OEEG 3AG2C 4YRCA 3VQYA 3RT3C 1OCOB 1AVMA 5CA0B 2EIKB 2OCCC 1USYA 1FJGO 1FJGB 5LP6C 2CAZC 3RYCA 5LGUA 4H2WA 2QKAA 3RYHB 3E8FA 2QHSA 3RBZA 3H1IH 4YYEA 1R3LC 5JQGA 2DXUA 2CUGA 4YY3B 3G1ZA 1N4CA 5JCOA 2N04A 1AROP 3C3SA 2LGWA 4CZZA 4O2AA 3Q4HB 4YRFA 3IALA 1WQ7A 1V55B 3NENA 1KU9A 4JZGA 4O4HB 5JJNB 3CS5A 2Y4TA 5DM6V 1E24A 1Q43A 2WA4A 2G38A 2ALYA 1HDJA 4X1YB 4YRJA 2QWRB 1RIQA 4DR2B 3PJSK 5GTIZ 1OCZC 2HVKC 3BPZA 1B7YA 2ITCC 1YB3A 4HYOA 2PYLA 4Q15A 4NVPA 4JI2O 4JI2B 2GV9A 4HA8A 3F5WC 4I50B 3JAMN 2JJ1G 3QTCA 4PG3A 4AH6A 1H8HG 4JI3O 4JI3B 1FFXB 1GMGA 3ZRSA 3WB2A 4XBFA 4KR3A 4JYBA 1Q6HA 1K92A 4NCXA 2ITDC 4ICGA 4DUYO 3D3IA 4CC6A 1TVKB 1MSWD 4TQDA 1JMKC 2LO1A 2YS8A 4XEOA 3UGQA 2ODRC 4YJ3A 3N2GA 3MAQA 4DQ2A 4UP7A 4P74C 4UVCA 1T5EA 5CMUA 1K5SA 2BSKA 3KCYA 3TXQA 4J11A 1D5NA 2ODMA 2RDCA 4FJCC 1S5LZ 3H1LH 3X2QC 3JSNA 3CMQA 2HVJC 2W6IG 3FAVA 4MW8A 1KMNA 1G5HA 2P4VA 4J42A 5FPOA 3LNNA 1FXKA 4YRLA 1PM9A 1LYLA 4TVAB 4YDQA 3E86A 1QLEB 1FPOA 2Q7GA 2QKSA 5IJ0A 3RUXA 4DV4O 4DV4B 4ZTUB 4PI2A 1EOVA 3W3SA 4DR3O 4DR3B 3TEHB 3HKDA 3T1YB 4WCEV 3U10A 4LNSA 4TUYA 2Y69B 2UXBO 5KX5A 2P4KA 1JPXA 2PY5A 2QHTA 4B7EA 4XU1A 1NU1H 2YEVA 2KB1A 3CE2A 3JCUZ 4DO2A 2HG5C 2AKWA 1HNWO 3RYCB 3OD1A 3L73H 5J2UA 1YITV 3DGEA 4TOIA 5CBFA 1COWG 3OMAB 4P72A 3G6EV 2JEUA 4DV2O 5JQGB 1GM8A 1PD3A 4JI0O 1P4RA 4JI0B 4FVMA 1EBOA 4O2AB 3ICXA 2EINB 2Q8VA 3BFMA 2M7WA 1I0HA 2WSSG 1GRJA 2LFSA 2FB5A 1ROPA 1AR1B 2AMCA 4JI8O 4JI8B 1Q8IA 4U3FH 2H94A 2JS3A 1WPYA 1O9HA 4XDJA 2ALYB 2XHBA 4LF6B 1Z7NA 1ENVA 4KXRA 1B7YB 3IGAC 4X5OA 1YZBA 2F1MA 1R6TA 2EIKC 2DTHA 4NR1A 1BHAA 3E22A 3I5DA 2F66C 3OAAG 1R3IC 5TISZ 2ZD9A 3NETA 3H01A 3SPIA 5ELOA 1JR9A 3H1JH 4G27B 4NYKA 4PJ0Z 4NTWA 1V55C 1IURA 3SPHA 4YJ3B 4HWSA 1Y6XA 1H2MA 3N2GB 5GTHZ 1JJOA 1S77D 4OPAA 1Y76A 2KSDA 4H33A 5L3GA 3CCRV 2BSKB 1RM1C 3BY6A 1S3JA 1WU7A 4ABMA 3BABA 1DGSA 2QHVA 3QF7A 3I55V 4UVAA 3FAVB 1YFRA 3SYAA 5LBQA 1G5IA 1Q5OA 2CGNA 1K73W 2Y0PA 1NS1A 1FXKB 1XQ8A 2CTQA 4K88A 4OP0A 5C8YA 4PI0A 5IJ0B 2YSUB 4O4IA 4B3SB 1EN6A 1NQTA 1YI2V 4FK5C 2EIMB 2Q5IA 1NT2B 2ZKOA 3HKDB 1WYDA 1JFFA 5ITZA 4FLXA 4MS2A 5LMUO 5LMUB 4EKWA 4TUYB 4X64O 5KX5B 3M7MX 3JD1A 3CPWU 4EO4A 2YEVB 2NR5A 2CDYA 2CGOA 2AKWB 1KP3A 4BIOA 2PMFA 4GLXA 2IH1C 4NXMO 4NXMB 5J2UB 3UFGA 3PN1A 1E1TA 3K57A 1QR9A 4TV8A 5D5PA 4O2DA 1BBUA 1N33O 1N33B 4UCOA 1YFSA 5EBWC 5C53B 1YFTA 1VQKV 1H2GA 4LVJA 1EVKA 1TGOA 3UM7A 2Q69A 1XNRO 1XNRB 5JJEB 3RKWA 2X0LA 4UV9A 1VF6A 2AMCB 3A31A 2Q68A 4YCVA 1NI8A 3SYQA 2Y69C 1SQXH 1HC7A 3K0DA 3JCZA 2NNUA 4H2VA 3UCSC 1Q90D 3EHBB 2E10A 1I7FA 1USYC 1KOGA 3E22B 3IJ4A 4TWAA 3ZHTA 2DWEC 2VQEO 2VQEB 3FX7A 4DV6O 1VP7A 2F93B 1XBLA 4WJ3M 5L3CA 1IX9A 3O65A 1PNLA 2Q7EA 2LGQA 3D36A 5JCOC 3L4GA 3CCSV 2EINC 3UT5A 1K34A 2HJFC 4YRQA 4MVMA 3BCCH 1JA8A 3SDLA 5C52B 5KHGA 2C2AA 3L74H 1JJCB 1QVFU 2VS0A 1BIBA 4TVYA 2LJ2A 3K3WA 4WFFA 1W2BU 1NTMH 1Y76B 4ZTZB 12ASA 4DR7O 3SJAC 4DR7B 4P75C 4KHPO 3HB3B 5HFMA 1ZL8A 2CTPA 3EXAA 1B3QA 3THOA 1BSMA 5H2FZ 2HNIA 1VQ7V 2ZM6O 2ZM6B 2BTQA 2HJDA 2ZZFA 5C8YB 2ZT6A 1YVWA 2MK3A 4O4IB 1Y74A 1B04A 4ZKIA 3CCMV 2EAYA 5IYBO 2FYUH 4O4LA 1FAFA 2F4VO 2F4VB 1OHHG 1JFFB 5ITZB 4BIUA 1U96A 3E8GA 3JALA 4ASUG 4X1KA 3SGIA 2DEQA 3OUFA 1Q6UA 1THZA 2LW1A 3V7SA 3V7CA 4JYAO 4JYAB 3OFNG 2IJJA 4PDRA 3HXYA 5LHGA 4K0KO 4K0KB 4TV8B 4UCSA 1Y66A 4QNHB 3TJTA 4HWTA 4BWAA 3SYCA 3CRAA 1RSOA 3LDCA 4G84A 3E89A 1YIJV 1FXKC 3OW2U 4AHCA 2EJRA 1IXBA 2YICA 2PGGA 4D7SA 2A7WA 3E8BA 2RJZA 3CCQV 5CBHA 3PCOA 1DTOA 2P6JA 1VQ8V 2XAFA
chains in the Genus database with same CATH topology
2H8PC 3AG1B 3HXXA 4QIWF 3W7WA 3VQWA 4P2ZA 1WNLA 4P3NA 4KUMA 4U7OA 3KG2A 3STZC 2ZDIA 1N8RW 2XOKG 4J9YB 5C93A 2C7IA 4CBCA 2UXNA 1AI6A 1GO3F 2XAJA 2ATKC 4FPPA 3ZRVA 4BW5A 1S72V 2E5AA 3TEHA 1NYQA 1PL0A 3TCUA 1BMFG 2F43G 2WLMA 4UVBA 2ZT8A 4P73A 2OT5A 1JOYA 2DU7A 4P3PA 1J95A 1YJ9V 4CH6A 3AG4B 4K86A 4TVWA 4PA6A 3ICAA 1HWYA 3REUA 4YRNA 3AG3B 3OEEG 3AG2C 4LVIA 2E3CA 4G28B 4YRCA 3VQYA 5IYCO 1YSCA 4Q20A 3ABLC 1SETA 4P72C 1JQ0A 1OCRB 1NYRA 1OCOB 2K1EA 3FB8C 1X55A 4XEMA 5C51B 1EIYB 2EIKB 2OCCC 1USYA 4YXWG 2EJFA 4WF2A 1C0AA 2A0LA 3STLC 4H2SA 5IY5B 5LGUA 1OCZB 3W7TA 4H2WA 3ABKC 3E8FA 2QHSA 3K79A 3L4GB 4XTUA 3RBZA 4UUJC 3ZRXA 1JCHA 4YYEA 4P9OA 1R3LC 2OTJV 2DXUA 4XU3A 3G1ZA 5DN6G 4P30A 3M99B 4MVOA 5K1XA 1AROP 3HPLC 3A7UA 4CZZA 1Q86W 5H9CA 2ZNIA 5B1NA 5B1AB 2PI4A 4YRMA 4PELA 3SYOA 3IALA 4RMFA 4YRFA 2IJIA 3BEHA 1NVPD 1NH2B 4G2KA 1WQ7A 1V55B 4I9WA 3NENA 2WLLA 3ASNB 3RVZA 3FB5C 3AEIA 1TUEB 3ABMB 3AG4C 3JD2A 4XTXA 2XAHA 2IJHA 5DM6V 1E24A 3FYEB 1JX9A 4X8AA 2P0LA 3K03A 1VQ6V 1OCOC 2ALYA 4U7NA 4YRJA 5KA5A 5LHHA 1RIQA 3T4ZA 3PJSK 3CCJV 1L0WA 1M56C 2RHSB 2I4LA 3TEGA 3UH0A 2EZOA 1L1FA 1OCZC 2HVKC 1W0JG 1B7YA 2ITCC 1YB3A 1KECA 4HYOA 4Z1MG 4YCWA 1QVGU 2EJGA 4Q15A 2J3LA 1I5YA 2I4NA 3RVYA 4FIPC 2PI5A 4R8CA 4YRTA 4JF3A 3F5WC 4HA8A 1QBZA 5L3BA 1IXMA 2JJ1G 3FJPA 4WI1A 2NLJC 3MQZA 3IFXA 3QTCA 1B76A 2LFRA 5B1AC 1H8HG 5EBMC 3ZJZA 1VQNV 4JTCB 1BIAA 3QNEA 2CIMA 4YCUA 1OCCB 4JYCA 1GMGA 3R07A 3ZN0A 3ZRSA 1E1OA 3RGLA 4XBFA 3ZMTA 4JYBA 3CMAV 3ZRWA 2X6BA 1K92A 3HFVA 4NCXA 4KR3A 2ITDC 3K0GA 4RO2A 3DTUB 3D3IA 5E1AC 2FTKA 2XAQA 1MSWD 4H2XA 4YROA 4TQDA 3W7UA 3B8NA 3V8LA 4CH3A 3VQXA 3B77A 1NJ2A 4XEOA 1RPOA 3UGQA 2ODRC 4XTZA 4YRPA 2JJ2G 2XTIA 1MOFA 4MSWC 3A32A 3FKSG 3ZMUA 2X6CA 1Z7MA 4QPJA 4ZIBA 4P71A 4DQ2A 1Q81W 4UP7A 4RUEA 4UVCA 4P74C 4G85A 4HZ3A 1J5WA 1WLEA 5CMUA 2IY5A 1K5SA 2GHYA 1LNQA 2D3OW 3OGCC 5CBGA 2EIJB 3UKMA 1Y4MA 2AHYA 3WG7C 3QO5A 4FJCC 3HXVA 5KNNA 1EFWA 3ETDA 1CPYA 2ZZGA 3X2QC 1PYSB 4YDQA 3CMQA 2HVJC 2W6IG 1QE0A 1VQZA 4E51A 1DF4A 1OCCC 4MW8A 1KMNA 4OLFA 1K5QA 3VQVA 2ZCEA 1G5HA 1G51A 1FXVA 1DLBA 4LC1A 2ZT5A 1FXKA 3PCOB 2J3MA 2DW4A 1LYLA 2NS6A 2W6JG 3A5YA 3CMEV 1FS0G 1XL6A 1GM9A 1PYSA 3L1AA 3P8TA 4XTVA 3E86A 4MTGA 3P8YA 1E1RG 1QLEB 2Q7GA 2QKSA 2HLDG 4BW9A 4UP9A 3FB6C 4R7CA 2CK3G 5HFLA 3FYIB 3OUSA 1E22A 2XAGA 3G4SV 3RUXA 5CN0A 1VQLV 1EOVA 1EVLA 5K1PA 4LVMA 4ZTUB 1QCEA 3W3SA 1YTFB 4XTWA 3RF1A 3K08A 3TEHB 4MVSA 3MEYA 1QF6A 4JGSA 2G4CA 2I4MA 3CYOA 4WCEV 3NELA 2A8EA 4LNSA 2Y69B 4GCZA 4BIZA 4PDLA 4YP0A 1JPXA 1NJ5A 4KR2A 2DDZA 1YJWV 2ARSA 2QHTA 4XU1A 5EC2C 2YEVA 2KB1A 4UV8A 1WPXA 4OXSA 4PA3A 4DO2A 2HG5C 5CA3A 2QE7G 1HXDA 2AKWA 3LSSA 2ODRD 2B1IA 5B1OA 3HY0A 3E8HA 1PKXA 3ZCCA 3OD1A 2P7TC 5EC1C 1YITV 3V7RA 4MVQA 2QM8A 3DGEA 1VQPV 5CBFA 1COWG 3OMAB 4P72A 1PNKA 3G6EV 2DQ3A 2JEUA 5LGNA 2A79B 1GM8A 1QLEC 3QO8A 4H37A 4CS2A 1PD3A 1P4RA 3JD0A 3CCVV 2DWDC 1R3KC 4YRKA 1EBOA 3MF2A 11ASA 2UXXA 2EINB 2DVEA 4WJ4A 4UPAA 1NR1A 1F51A 3BFMA 5L3DA 2M7WA 5FL7G 1KC8W 1Q7YW 2WLLB 3AG1C 1GKFA 2WSSG 1CP9A 2JEXA 4YRRA 2LFSA 1S76D 1ROPA 1AR1B 1OZ0A 2AMCA 5KUKA 5B3SB 3IKLA 2H94A 1VQ5V 1WPYA 4XDJA 3OEHG 2ALYB 4LBEC 1K9MW 2Z5UA 1Z7NA 3K06A 1MG1A 2BOBC 1ENVA 2V1DA 3AG3C 2C8MA 2ZT7A 1B7YB 3LSQA 3IGAC 1EFRG 4X5OA 4MT8A 4PA4A 3G71V 1OCRC 3GWOA 3IG2A 1ADJA 2EIKC 2IJKA 1RM1B 2X7RB 2DTHA 3TETA 5H6QA 1BHAA 3ZMVA 3CCUV 5IY5C 4X88A 2E65A 4L87A 4P3OA 3T1CA 2B1GA 3I56V 3OAAG 3ASOB 2FYKA 3RIRA 3ETGA 4P75A 4TSFG 2EJ9A 3A5ZA 4EX5A 2QTOA 2QHUA 1R3IC 1AJPA 1BL8A 5B1BB 3HFZA 3I7FA 4HWRA 3ETEA 4WF9V 2ZD9A 1X2GA 3NETA 1H38A 3H01A 1H4TA 3SPIA 3ZRWB 2EILB 4KP4A 1SERA 4TT3G 3CC4V 5ELOA 1FFTB 4XDLA 4YRGA 3A74A 4R50A 1VQ9V 3F7YC 4G27B 2AHZA 2ZNJA 4H2XB 1B6QA 2DJZA 4TVAB 1E1QG 1V55C 2IU3A 4PDVA 3HRIA 3SPHA 3ASNC 4GX0A 4HAMA 3ABMC 1QR8A 4DXWA 2ZXWB 4YRSA 1B70A 4HWSA 1YTFD 2GSMB 1EQRA 2E1HA 2DXTA 1H4VB 1S77D 3W7SA 3DSQA 3HXWA 4LVLA 5L3GA 4H33A 2IY5B 4XTYA 3CCRV 1RM1C 3ZN1A 3ZIAG 1GM7A 3BY6A 2R9RB 2CJAA 1S3JA 2EBOA 1YHQV 5J9PC 1WU7A 2ZZEA 1X56A 4YRIA 1NBMG 2QHVA 3NXSA 2CJ9A 4P74A 3I55V 1M90W 1M57B 4UVAA 1NKDA 1H8EG 3F7VC 2JIZG 3SPGA 1YFRA 2XGTA 1ASYA 1NR7A 3SYAA 1V54B 4UXNA 2HR3A 4PA9A 5LBQA 1VQMV 1G5IA 3M4QA 4DPGA 3LDDA 2EILC 3ABUA 4WFBV 1K73W 1PNMA 5ELNA 1FXKB 1NJIW 3MHHC 4K88A 4OP0A 1IL2A 1P7BA 4GX5A 2YSUB 1ATIA 4YPFA 3MF1A 2ZIMA 4HWOA 1NQTA 1YI2V 4FK5C 2WLIA 2EIMB 1H4QA 3KFUA 2Q5IA 3T2MA 2ZGWA 2IW5A 3R65A 4H2UA 4JASA 1WYDA 3EFFK 3OE7G 1VQOV 4MS2A 5KA6A 3FB7C 4EKWA 1R6NA 4J15A 1AJQA 3HTZA 4AH6A 1HTTA 4JTDB 1EZJA 3JD1A 3CPWU 2ARTA 3A7AA 4YRLA 5LGTA 2CGHA 4MW3A 4EO4A 2YEVB 1N9WA 1NH2D 4CS3A 2AKWB 1KP3A 4LCUC 2PMFA 1M9NA 1E79G 2IH1C 2XASA 3TK1A 3AG2B 3WFVA 2ZTGA 2EIJC 3P8VA 4P9PA 2WPDG 3UFGA 1F4NA 1E1TA 3ABLB 1QR9A 1FYFA 2WLKA 1YJNV 4O2DA 4GT1A 3GB7C 1BBUA 2OCCB 4ZBMA 5HGQA 1YFSA 4MTXA 5EBWC 5F5WA 4E2LA 3IC7A 3HRKA 4H2YA 4XDKA 5C53B 2DQ0A 4R6ZA 1YFTA 4UP8A 2EIMC 4N23A 4PA7A 1R3JC 4MTFA 1VQKV 3E9HA 1H2GA 3VOUA 4HWPA 4LVJA 2JDIG 3OR6C 1EVKA 2ZXFA 1SESA 4KFMA 3B8MA 4RQFA 2B5UA 4WFHA 1BBWA 3MHSC 2DYRB 4CH5A 3UM7A 2Q69A 1CEZA 3PZCA 2RHQA 5IDJA 3E35A 2DYSB 2ZDIC 3RKWA 2X0LA 4UV9A 2AMCB 3A31A 4KQEA 1G4YB 2JK5C 2ZINA 3V8KA 2Q68A 3ZMZA 4P73C 3ERRA 4YCVA 3K04A 5LHIA 3E9IA 2CJBA 3SYQA 4RDXA 2Y69C 3RW0A 3ZMSA 3E2EA 1HC7A 2I4OA 4MVUA 4WFAV 3K0DA 3OM3B 3JCZA 2NNUA 5EBLC 5BZBA 1GGMA 4H2VA 3EHBB 2E10A 2EWNA 2DU5A 2WAMA 4PG3A 1USYC 1KOGA 4CS4A 1M56B 3A7RA 4TWAA 3SYPA 4XU0A 3CC7V 1W66A 2V7QG 2DWEC 4GX2A 3M4PA 1K33A 1KQSU 5IYDO 2BOCC 3ML0A 2OTLV 4CH4A 1EIYA 4WJ3M 3LNMB 3HFZB 5L3CA 1K7DA 2W0FC 1GK9A 4LVKA 4QPKA 1PNLA 4JPRA 2DYRC 1F4MA 1ORQC 3SPCA 2Q7EA 4MTOA 1RPRA 2DZ9A 3D36A 4J9ZB 2E41A 5E3IA 2DYSC 3L4GA 3RACA 1F23A 3CCSV 4K87A 4RAIA 2DTOA 2EINC 3UGTA 2QM7A 1K34A 2WLHA 4JAUA 1JJ2U 1NJ1A 2DKGA 3BJUA 2HJFC 4YRQA 4MVMA 2X6AA 5C52B 3TUPA 1XL4A 4F4LA 3CXCU 1WQWA 1K4DC 3RKXA 1I5XA 1R6KA 2C2AA 2WWWA 3CP1A 4I5SA 1KKDA 1B70B 2QEXV 1JJCB 4TTVA 1QVFU 1AI4A 1BIBA 4TVYA 4RUFA 1KMMA 3K3WA 4Q6GA 5B3SC 2WLJA 4WFFA 1X2HA 4LP8A 1W2BU 1S0VA 5H6RA 5GW7A 2A9HA 3LUTB 4H02A 4WFEA 2P90A 4TQFA 3CC2V 1JJCA 4ZTZB 2ZR2A 12ASA 3CD6V 3HY1A 4QE9A 1M1KW 1K3EA 3K9AA 3IKMB 4P75C 2Y48A 3HB3B 5L3FA 5HFMA 3HXUA 1X01A 3ABTA 4N21A 1ASZA 4JAVA 1ADYA 4WFGA 2HNIA 1VQ7V 3WG7B 2RHSA 5EK0A 2P5IA 4YREA 1H4SA 3OMNB 3X2QB 1K4CC 1W0KG 3ASOC 3MD0A 1G8MA 3NEMA 2ZZFA 4HT4A 1K8AW 2Z3YA 3T4DA 2ZT6A 4H2TA 4HVCA 1AI5A 5B1BC 3EFSA 3OR7C 2MK3A 3EFRA 2P67A 1YGBA 4ZKIA 2WLIB 4QE7A 3CCMV 2EAYA 5IYBO 3OMIB 1OHHG 4QJFB 4BAYA 1SZTA 1FXHA 1KD1W 1NVPB 1X54A 2Q67A 4MVRA 4BIUA 4TWKA 1B8AA 1QLNA 4PHCA 3A0RA 5KUMA 3E8GA 2EZPA 3P32A 1JVMA 4ASUG 2ZXWC 2DEQA 3HXZA 3OUFA 2LP7A 2XNDG 4PDMA 4P71C 4GX1A 3JD3A 3SPJA 1VQ4V 1THZA 2Q5HA 3V8JA 2IH3C 2QA4V 3QO7A 2PMEA 3V7SA 3V7CA 2R9IA 3E83A 3JYCA 3OFNG 3VBBA 2ARUA 3RL6A 2ZR3A 1NJ6A 1SRYA 2IJJA 4PDRA 3HXYA 1DF5A 5LHGA 1S5HC 1R73A 1Y66A 2IU0A 2WLNA 2HFEC 2HKOA 2Q6AA 3P30A 1M57C 4QNHB 1UJWB 3W7XA 1GTOA 4JTAB 5L3EA 2DZCA 4HWTA 1V54C 1NJ8A 2Q7HA 1MABG 1AI7A 1KP2A 3SYCA 3RKYA 4BWAA 1AJNA 3LDCA 4G84A 3E89A 3SJQC 1YIJV 1FXKC 3OW2U 2EJRA 3L2ZA 4MVZA 3CCLV 3REXA 1ZWIC 3E8BA 2EL9A 3CCQV 5CBHA 2ZQMA 2RHQB 1BHBA 3LC0A 4RQEA 3ABKB 2E64A 2DTIA 3JD4A 1DTOA 2P6JA 1VQ8V 3PCOA 1K97A 4X89A 1Q82W 4TVAA 3LDEA 2ZIOA 3CCEV 2XAFA 1NNHA 4XU2A 3WQZA 4FMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXX A;  1WNL A;  4P3N A;  2C7I A;  5ELN A;  3VQW A;  3TEH A;  2E5A A;  1NYQ A;  2ZT8 A;  4P73 A;  4CH6 A;  4P3P A;  2DU7 A;  4TVW A;  4K86 A;  3ICA A;  3REU A;  4YRN A;  2E3C A;  4YRC A;  3VQY A;  1SET A;  4P72 C;  1NYR A;  1X55 A;  1EIY B;  4XEM A;  5C51 B;  1USY A;  2EJF A;  4WF2 A;  1C0A A;  4H2S A;  4H2W A;  2QHS A;  3L4G B;  4XTU A;  4YYE A;  2DXU A;  4XU3 A;  3G1Z A;  5K1X A;  3A7U A;  2ZNI A;  4YRM A;  4YRF A;  3IAL A;  4RMF A;  1WQ7 A;  3NEN A;  4XTX A;  1E24 A;  2P0L A;  2ALY A;  4YRJ A;  1RIQ A;  1L0W A;  3UH0 A;  2RHS B;  2I4L A;  3TEG A;  1B7Y A;  1YB3 A;  4YCW A;  2EJG A;  4Q15 A;  2J3L A;  2I4N A;  4YRT A;  4HA8 A;  3FJP A;  4WI1 A;  3QTC A;  1B76 A;  1BIA A;  2CIM A;  3DSQ A;  4PG3 A;  4YCU A;  4AH6 A;  3QNE A;  3R07 A;  1E1O A;  3RGL A;  11AS A;  4KR3 A;  3HFV A;  4NCX A;  4H2X A;  4YRO A;  4TQD A;  4CH3 A;  3V8L A;  3VQX A;  1NJ2 A;  4XEO A;  3UGQ A;  2ODR C;  4XTZ A;  4YRP A;  2XTI A;  3A32 A;  1Z7M A;  4ZIB A;  4P71 A;  4DQ2 A;  4UP7 A;  4P74 C;  4G85 A;  1J5W A;  1WLE A;  2IY5 A;  3HXV A;  5KNN A;  1EFW A;  3QO5 A;  2ZZG A;  1PYS B;  3CMQ A;  1QE0 A;  1VQZ A;  4E51 A;  1KMN A;  4OLF A;  3VQV A;  2ZCE A;  1G5H A;  1G51 A;  3PCO B;  2ZT5 A;  2J3M A;  4YRL A;  1LYL A;  3P8T A;  4XTV A;  3A5Y A;  4TVA B;  1PYS A;  3L1A A;  4YDQ A;  3P8Y A;  2Q7G A;  4BW9 A;  4UP9 A;  1E22 A;  5HGQ A;  3RUX A;  5K1P A;  4ZTU B;  1EOV A;  1EVL A;  3W3S A;  4XTW A;  3RF1 A;  3TEH B;  3MEY A;  1QF6 A;  2G4C A;  2I4M A;  3NEL A;  4LNS A;  4YP0 A;  4KR2 A;  1NJ5 A;  2DDZ A;  2ARS A;  2QHT A;  4XU1 A;  2CGH A;  1HXD A;  2AKW A;  3LSS A;  2ODR D;  3HY0 A;  3OD1 A;  3V7R A;  4P72 A;  2DQ3 A;  3QO8 A;  4CS2 A;  4YRK A;  3MF2 A;  4WJ4 A;  2DVE A;  4UPA A;  3BFM A;  4YRR A;  2AMC A;  3IKL A;  1WPY A;  2ALY B;  1Z7N A;  2ZT7 A;  2C8M A;  1B7Y B;  3LSQ A;  4X5O A;  3IG2 A;  1ADJ A;  2DTH A;  2E65 A;  4P3O A;  4L87 A;  3RIR A;  2FYK A;  4P75 A;  2EJ9 A;  3A5Z A;  4EX5 A;  2QHU A;  3I7F A;  4HWR A;  3HFZ A;  1X2G A;  3NET A;  1H4T A;  1SER A;  5ELO A;  4YRG A;  3A74 A;  2ZNJ A;  4H2X B;  2DJZ A;  3HRI A;  4YRS A;  1B70 A;  4HWS A;  1EQR A;  2E1H A;  2DXT A;  1H4V B;  3HXW A;  2IY5 B;  4XTY A;  2CJA A;  1WU7 A;  2ZZE A;  1X56 A;  4YRI A;  2QHV A;  2CJ9 A;  4P74 A;  1YFR A;  2XGT A;  1ASY A;  3M4Q A;  1G5I A;  4DPG A;  4K88 A;  4OP0 A;  1IL2 A;  1ATI A;  4YPF A;  3MF1 A;  2ZIM A;  4HWO A;  1H4Q A;  3KFU A;  2Q5I A;  2ZGW A;  4H2U A;  1WYD A;  4J15 A;  3HTZ A;  1HTT A;  2ART A;  3A7A A;  4EO4 A;  1N9W A;  4CS3 A;  2AKW B;  2PMF A;  2ZTG A;  3P8V A;  3UFG A;  1E1T A;  1FYF A;  4O2D A;  1BBU A;  1YFS A;  5F5W A;  3HRK A;  4H2Y A;  5C53 B;  2DQ0 A;  1YFT A;  4UP8 A;  3E9H A;  4HWP A;  1EVK A;  2ZXF A;  1SES A;  1BBW A;  4RQF A;  4CH5 A;  3PZC A;  2RHQ A;  3RKW A;  2AMC B;  3A31 A;  4KQE A;  2ZIN A;  3V8K A;  4P73 C;  3ERR A;  4YCV A;  3E9I A;  2CJB A;  4RDX A;  1HC7 A;  2I4O A;  1GGM A;  4H2V A;  2E10 A;  2EWN A;  2DU5 A;  1USY C;  1KOG A;  4CS4 A;  3A7R A;  4TWA A;  4XU0 A;  1W66 A;  3M4P A;  4CH4 A;  1EIY A;  4WJ3 M;  3HFZ B;  2Q7E A;  2DZ9 A;  5E3I A;  2E41 A;  3RAC A;  3L4G A;  4K87 A;  2DTO A;  3UGT A;  1NJ1 A;  2DKG A;  3BJU A;  4YRQ A;  5C52 B;  3TUP A;  1WQW A;  3RKX A;  1JJC B;  1B70 B;  4TTV A;  1BIB A;  4TVY A;  1KMM A;  4Q6G A;  1X2H A;  4H02 A;  4TQF A;  4ZTZ B;  1JJC A;  2ZR2 A;  12AS A;  3HY1 A;  3IKM B;  4P75 C;  3HXU A;  1X01 A;  1ASZ A;  1ADY A;  2HNI A;  4YRE A;  1H4S A;  2RHS A;  2P5I A;  3NEM A;  2ZZF A;  2ZT6 A;  4H2T A;  4HVC A;  3EFS A;  3EFR A;  1YGB A;  2EAY A;  1X54 A;  1B8A A;  4PHC A;  2DEQ A;  3HXZ A;  4P71 C;  2Q5H A;  3V8J A;  3QO7 A;  2PME A;  3V7S A;  3V7C A;  3VBB A;  3RL6 A;  2ARU A;  2ZR3 A;  1NJ6 A;  1SRY A;  3HXY A;  2DZC A;  4HWT A;  2Q7H A;  1NJ8 A;  4BWA A;  3RKY A;  4G84 A;  3L2Z A;  3REX A;  2EL9 A;  2RHQ B;  3LC0 A;  4RQE A;  2E64 A;  2DTI A;  3PCO A;  4TVA A;  2ZIO A;  1NNH A;  4XU2 A;  3WQZ A; 
#chains in the Genus database with same CATH topology
 3HXX A;  4K35 A;  4GKK B;  4P2Z A;  4KUM A;  3STZ C;  4J9Y B;  4Z1V A;  4CBC A;  3S3X A;  5ELN A;  3JAW A;  2YXY A;  1S72 V;  2JVD A;  2WLM A;  2ZT8 A;  1D2D A;  3JAR A;  1AB3 A;  4PV1 B;  3REU A;  4FLV A;  4YRN A;  3AG3 B;  4G28 B;  5IYC O;  4Q20 A;  4P72 C;  3P3N A;  3OTO O;  3FB8 C;  3OTO B;  1X55 A;  4XEM A;  1C0A A;  5IY5 B;  3SJB C;  4FLT A;  1OCZ B;  4LF5 O;  4LF5 B;  3L4G B;  2EUL A;  2E75 B;  3UT5 B;  4P9O A;  4X20 A;  2OTJ V;  3SR2 C;  5DN6 G;  4LWS A;  4MVO A;  1H2K A;  3C90 A;  4JI7 O;  4JI7 B;  3A7U A;  5H9C A;  2HP8 A;  3KCX A;  2R72 A;  1NH2 B;  1TUE B;  3ABM B;  3JD2 A;  2DOS A;  2XTA A;  3QVN A;  2P0L A;  1VQ6 V;  1IBM B;  1ZL8 B;  4U7N A;  1ZUQ A;  5KA5 A;  3T4Z A;  2KKW A;  2I4L A;  3TEG A;  2Q9L A;  4OX9 O;  4OX9 B;  2BTQ B;  3RN4 A;  4YCW A;  2J3L A;  1I5Y A;  3U0Z A;  2I4N A;  3RVY A;  2PI5 A;  4R8C A;  4JF3 A;  1Y74 B;  1QBZ A;  4FFK A;  1ZAU A;  4O4L B;  1XMQ O;  1XMQ B;  2Z0A A;  5B66 Z;  1BIA A;  2LFR A;  3DSQ A;  5EBM C;  5B1A C;  4YCU A;  4JTC B;  1A32 A;  3RGL A;  3ZRW A;  1NTZ H;  3JAL B;  2JRI A;  1L0N H;  4X1K B;  4RO2 A;  2E76 B;  4UB8 Z;  2XAQ A;  4H2X A;  4YRO A;  5BY1 A;  3W7U A;  4CH3 A;  3V8L A;  1RPO A;  5JJJ B;  4XTZ A;  4YRP A;  2XTI A;  1KB9 F;  1MOF A;  4MSW C;  3ZMU A;  2UUB O;  1LUW A;  2FL4 A;  3IC9 A;  2W0X A;  1Z7M A;  4ZIB A;  2DJV A;  2QR4 A;  3BA8 A;  1J5W A;  1MA1 A;  5CBG A;  2AHY A;  5KNN A;  3QO5 A;  1RSO B;  1HW7 A;  3ETD A;  2YID A;  2OYQ A;  2ZZG A;  4Z2W A;  5LOV B;  2GDS A;  1VQZ A;  1K5Q A;  1IBK B;  1IBK O;  2P06 A;  1FXV A;  3PCO B;  4XTV A;  3A5Y A;  1FS0 G;  1GM9 A;  3P8Y A;  5IE9 A;  1E1R G;  5LMN O;  5LMN B;  3FB6 C;  3EVK A;  2CK3 G;  1E22 A;  3FYI B;  3K5O A;  4BR6 A;  1VQL V;  2VRZ A;  1GH6 A;  3JAW B;  4I9Q A;  3RF1 A;  4MVS A;  2AZ2 A;  3MEY A;  3CRR A;  1OV9 A;  4J80 A;  2B9Z A;  2I4M A;  3JAR B;  3NEL A;  3MDS A;  4BIZ A;  4KR2 A;  4DUZ O;  4DUZ B;  2DE0 X;  4UV8 A;  1F7Y A;  5EYP A;  2ODR D;  2B1I A;  2RNB A;  1PKX A;  3E8H A;  4MVQ A;  2QM8 A;  3A8T A;  1VQP V;  2DQ3 A;  2QJ1 A;  4X20 B;  3LSU A;  1XNQ O;  1XNQ B;  1I08 A;  4LWS B;  5KMG A;  4YRK A;  2Q4P A;  2R9A A;  3MF2 A;  5BXZ A;  1VF6 C;  5L3D A;  4ZHQ A;  4YY3 O;  1Q7Y W;  2JEX A;  4YRR A;  3CRM A;  4E4E A;  1OZ0 A;  4O2B A;  1MZE A;  3OEH G;  4LBE C;  1K9M W;  4B3M B;  4B3M O;  1N36 O;  1N36 B;  1MG1 A;  2ZT7 A;  1G6U A;  3AG3 C;  3ZS8 C;  3G71 V;  1WNS A;  2ADP A;  3IG2 A;  2IJK A;  4UCR A;  5DED A;  5LL6 Y;  1RM1 B;  4DV5 O;  4DV5 B;  4DR2 O;  5H6Q A;  1EN5 A;  3CCU V;  2E65 A;  5IY5 C;  4P3O A;  4L87 A;  2B1G A;  3D36 C;  2FYK A;  3ETG A;  4P75 A;  4TSF G;  3A5Z A;  4ZI7 A;  4EX5 A;  4HWR A;  5B1B B;  1AJP A;  2A3Q A;  3HFZ A;  4WF9 V;  1H38 A;  3ZRW B;  4KP4 A;  4DV3 O;  4DV3 B;  4JI4 O;  4JI4 B;  1SER A;  4YRG A;  1P49 A;  3A74 A;  4R50 A;  1VQ9 V;  3HR0 A;  4H2X B;  2KQX A;  3IAY A;  3J7A U;  2UXC O;  2UXC B;  5KHJ A;  4GX0 A;  4HAM A;  3ABM C;  4YRS A;  1SC5 B;  1AR5 A;  2GSM B;  5IWA O;  5IWA B;  3HXW A;  2IBZ H;  4XTY A;  1YF2 A;  3ZIA G;  2CJA A;  2EBO A;  4YRI A;  2YDE A;  3NXS A;  4IHJ A;  1NKD A;  2YI8 A;  3SPG A;  2N74 A;  1V54 B;  3M4Q A;  4DPG A;  2EIL C;  4DR1 B;  4O4J A;  1BCC H;  5EIB C;  1WB7 A;  2ZIM A;  2PYJ A;  2WLI A;  1H4Q A;  2F95 B;  3T2M A;  2IW5 A;  4JAS A;  1P84 F;  3OE7 G;  1VQO V;  4FLW A;  5KA6 A;  3GWK C;  1R6N A;  4RWU A;  4J15 A;  1EZJ A;  2VWK A;  5LGT A;  4YIP A;  3AK1 A;  2YIA A;  4IGG A;  1WA8 A;  1GN2 A;  1FYJ A;  3T1Y O;  3HKE A;  5EYP B;  4LCU C;  4FLU A;  2ZE6 A;  4UCV A;  3WFV A;  5IT9 N;  2WPD G;  3ZBH A;  1XMO O;  1XMO B;  3ABL B;  1PV0 A;  3DC5 A;  1YJN V;  3GB7 C;  2QGN A;  5F5W A;  3IC7 A;  4H2Y A;  4XDK A;  5KMG B;  4MTF A;  2QM4 A;  2VQF O;  2VQF B;  4J41 A;  1BS3 A;  4ZHQ B;  1SES A;  1BBW A;  4RQF A;  2B5U A;  4ZOL A;  5A9G A;  1CEZ A;  4O2B B;  3F5T A;  4AQY B;  1LUV A;  4QGP A;  5F2V O;  4GKJ B;  4GKJ O;  2ZIN A;  5KHH A;  4UFZ A;  3ERR A;  3K04 A;  4RDX A;  4K8X A;  1H2N A;  4MVU A;  4WFA V;  5BZB A;  2YIB A;  3JAT A;  2DU5 A;  4DK0 A;  2WAM A;  5J2T A;  4LF6 O;  3SYP A;  2GTS A;  3CC7 V;  3M4P A;  1YDX A;  4JZ2 A;  4ZI7 B;  3LNM B;  3HFZ B;  3CX5 F;  2W0F C;  1GK9 A;  4LVK A;  4QPK A;  2DYR C;  1F4M A;  3U11 A;  2DZ9 A;  3H9V A;  2DYS C;  1SZX A;  2ILM A;  1F23 A;  4B7K A;  2WLH A;  2QKC A;  3ZHV A;  3BJU A;  3G6B A;  4FM0 A;  4OGQ B;  2NN4 A;  1K4D C;  1R6K A;  3CP1 A;  2YC0 A;  4LFC O;  4LFC B;  2QEX V;  1SQQ H;  1X2H A;  1S0V A;  1CXZ B;  1VEW A;  2L6L A;  2P90 A;  2RCV A;  3CC2 V;  1JJC A;  1M1K W;  3IKM B;  4IHJ B;  5L3F A;  5CB4 A;  2UUA B;  4N21 A;  5LYJ A;  1ADY A;  1H4S A;  3WG7 B;  5EK0 A;  4O4J B;  1K4C C;  1G8M A;  2ZE5 A;  3T4D A;  2D2C B;  4H2T A;  4LF8 O;  4LF8 B;  1AI5 A;  5B1B C;  3OR7 C;  3K9S A;  3EFR A;  2P67 A;  3B40 A;  2WLI B;  2Q73 A;  4QJF B;  1SZT A;  1X54 A;  2Q67 A;  3CRC A;  4TWK A;  2QWQ B;  4B3S O;  2P22 C;  3P32 A;  2E74 B;  2QWP B;  4PDM A;  1WA8 B;  2LP7 A;  1VQ4 V;  3K59 A;  3V8J A;  3HKE B;  2QA4 V;  3QO7 A;  2PME A;  2ZE7 A;  3VBB A;  3RL6 A;  2ZR3 A;  2Q0A A;  1NJ6 A;  1DF5 A;  1S5H C;  1R73 A;  3P30 A;  2HKO A;  3W7X A;  1BQZ A;  1GTO A;  4JTA B;  1V54 C;  3RKY A;  1AJN A;  3SJQ C;  1SA0 A;  3CCL V;  4ZOL B;  1ZWI C;  4DR4 O;  4DR4 B;  2EL9 A;  3RYI A;  1BHB A;  4GYC B;  2DTI A;  2BE3 A;  1K97 A;  1Q82 W;  1NNH A;  4XU2 A;  4DV1 O;  4DV1 B;  4FMT A;  3AG1 B;  2UXD O;  2UXD B;  1TA8 A;  3ETQ A;  3W7W A;  4DV7 O;  4DV7 B;  3KG2 A;  2ZDI A;  2XOK G;  2C7I A;  1AI6 A;  1GO3 F;  1NTK H;  1RP3 B;  1RFY A;  1NYQ A;  1PL0 A;  3JAT B;  1BMF G;  4UVB A;  5J2T B;  4P73 A;  5H5N A;  4P3P A;  1YJ9 V;  4K86 A;  4H44 B;  3ICA A;  1KMI Z;  2E3C A;  1J5E O;  1J5E B;  3ABL C;  2K1E A;  4LFB O;  4LFB B;  5C51 B;  2A0L A;  3STL C;  5KHK A;  3W7T A;  1WP7 A;  1XHZ A;  3H1H H;  3K79 A;  4XTU A;  1JCH A;  1UFI A;  4J7K A;  3TGU H;  1LR1 A;  4J7Z A;  3M99 B;  5JH7 A;  1ZLZ A;  3HPL C;  1Q86 W;  2ZNI A;  5B1A B;  4YRM A;  4PEL A;  3SYO A;  4RMF A;  4I4T A;  1I94 O;  2IJI A;  3BEH A;  1I94 B;  1DK1 A;  4YJ2 A;  4G2K A;  4I9W A;  3CXH F;  2WLL A;  3AG4 C;  1D5A A;  4XTX A;  5BR8 B;  2IJH A;  4EFB A;  5FLX N;  1JX9 A;  4X8A A;  3K03 A;  5CB4 B;  5LYJ B;  1AR4 A;  5LHH A;  1L0W A;  5BMV A;  1L1F A;  1W0J G;  4Z1M G;  1QVG U;  4FIP C;  4YRT A;  3JSL A;  4DW1 A;  5L3B A;  4EFE A;  1IXM A;  4WI1 A;  3MQZ A;  3IFX A;  1B76 A;  2CIM A;  1VQN V;  3QNE A;  4B08 A;  4D7T A;  1BGY H;  3R07 A;  1E1O A;  3CMA V;  3HFV A;  4H13 B;  2X6B A;  3O9O A;  1ZSP A;  3K0G A;  3BFR A;  4NTX A;  2IM9 A;  3B8N A;  3VQX A;  3B77 A;  1NJ2 A;  2UUC O;  2UUC B;  2JJ2 G;  2CTW A;  3CSX A;  3FKS G;  4JI6 B;  4JI6 O;  1US6 A;  4X65 O;  4X65 B;  4QPJ A;  4P71 A;  1Q81 W;  2K9P A;  3CWB H;  4HZ3 A;  1WLE A;  2IY5 A;  2GHY A;  1LNQ A;  2Q5Z A;  2EIJ B;  1Y4M A;  3WG7 C;  1EFW A;  4EB6 A;  1M4U A;  1CPY A;  4X1I A;  1PYS B;  1SA0 B;  1Z2G A;  4WBN A;  4IYI A;  1QE0 A;  2Y4U A;  3UO3 A;  1DF4 A;  1OCC C;  3CB2 A;  4OLF A;  3RYI B;  3VQV A;  1DLB A;  2A06 H;  4LC1 A;  2ZT5 A;  4LVM A;  3P8T A;  1XL6 A;  3L1A A;  1Z5W A;  5LOV A;  2H3O A;  4DR5 B;  4R7C A;  5CN0 A;  1EVL A;  2E5L O;  2E5L B;  1M93 A;  3K08 A;  2VWJ A;  4JGS A;  2DMX A;  3CYO A;  4DRX A;  4GKK O;  3OTF A;  4PDL A;  3QG5 A;  1AP5 A;  1X59 A;  2DDZ A;  2ARS A;  5EC2 C;  5CA3 A;  1WPX A;  4OXS A;  2CH7 A;  3L75 H;  1HXD A;  3LSS A;  5B5E Z;  2OCH A;  3HY0 A;  3ZCC A;  2P7T C;  5EC1 C;  2YUA A;  4IL6 Z;  2A79 B;  3HKC A;  1ZX3 A;  4H37 A;  3A0H Z;  3CCV V;  1R3K C;  2OIE A;  5JH7 B;  4LF7 B;  3GVM A;  4WJ4 A;  2UXX A;  2GUZ A;  3RFR A;  1NR1 A;  4I4T B;  4YJ2 B;  5FL7 G;  1KC8 W;  2WLL B;  3KKY A;  3AG1 C;  3WB1 A;  1GKF A;  2DN9 A;  1CP9 A;  2XT9 A;  1S76 D;  5KHI A;  5KUK A;  1VQ5 V;  4A5U B;  3BHP A;  3K06 A;  5BMV B;  2BOB C;  2KG7 A;  2V1D A;  2C8M A;  1H2S B;  2PTM A;  4MT8 A;  4PA4 A;  1Z5V A;  1IBM O;  1VIB A;  1ADJ A;  2ADQ B;  3ZMV A;  3N27 A;  3T1C A;  3I56 V;  3RIR A;  3ASO B;  2RN9 A;  2EJ9 A;  2QHU A;  1BL8 A;  1XOU A;  3ETE A;  5GON A;  4TV9 A;  1X2G A;  1H4T A;  2EIL B;  3UQ8 A;  4TT3 G;  1MMM A;  1FFT B;  4XDL A;  3F7Y C;  3RWR D;  4NXN B;  2DJZ A;  1E1Q G;  4IIJ A;  3HRI A;  1QR8 A;  4DXW A;  1EQR A;  2E1H A;  1PL4 A;  3KZI Z;  5AG2 A;  2IY5 B;  3ZN1 A;  1MNG A;  2R9R B;  1YHQ V;  1Q3E A;  5J9P C;  2ZZE A;  2QWN B;  4EB6 B;  1X56 A;  1FKA O;  4X1I B;  2CJ9 A;  1M57 B;  4WBN B;  3F7V C;  1ASY A;  1VQM V;  4UXN A;  4PA9 A;  3LDD A;  1PNM A;  4PD4 F;  1NJI W;  2BTO A;  1XEQ A;  1M5I A;  5FPR A;  3MF1 A;  3KFU A;  2ZGW A;  3C3T A;  4U3J A;  4DRX B;  1AJQ A;  1HTT A;  4JTD B;  2ART A;  2R70 A;  3A7A A;  4JI5 O;  4JI5 B;  1N9W A;  2CTR A;  2CH7 B;  1NH2 D;  1IBL O;  1IBL B;  1BZK A;  3D3Q A;  4K8Z A;  1M9N A;  1E79 G;  2EIJ C;  3P8V A;  1F4N A;  1FYF A;  4ZBM A;  3HKC B;  4MTX A;  4E2L A;  3HRK A;  2DQ0 A;  4UP8 A;  4N23 A;  4PA7 A;  1R3J C;  1V9P A;  3E9H A;  2PF4 E;  2GUZ B;  2QWO B;  3VOU A;  4HWP A;  1HP8 A;  1R1B A;  5EZY A;  4KFM A;  2DYR B;  2OIG A;  2RHQ A;  2DYS B;  2ZDI C;  1XIL A;  5EIB D;  1XDC A;  2JK5 C;  3V8K A;  4P73 C;  3E9I A;  2CJB A;  4IT5 A;  2KG7 B;  2HHH O;  2HHH B;  3RW0 A;  4FM2 A;  3E2E A;  5LXT A;  3JAS A;  2EWN A;  2QDO A;  2YXL A;  4F6R A;  1GN4 A;  4CS4 A;  1M56 B;  4XU0 A;  1W66 A;  4GX2 A;  1K33 A;  3ML0 A;  2OTL V;  2EX3 A;  4CH4 A;  1EIY A;  4NTY A;  1K7D A;  2ARH A;  5GON B;  4TV9 B;  4JPR A;  4NB5 A;  1ORQ C;  3BAA A;  4MTO A;  1RPR A;  5E3I A;  3CRQ A;  2AZ0 A;  1FD9 A;  1QQC A;  4RAI A;  1S5J A;  2DTO A;  4K87 A;  3UGT A;  2P5O A;  4JAU A;  4OPH A;  1PPJ H;  2DKG A;  3ZHQ A;  2X6A A;  3L71 H;  4IIJ B;  3TUP A;  3RKX A;  4I5S A;  4I55 A;  4TTV A;  3ZX6 A;  1BT8 A;  4Q6G A;  2WLJ A;  4I0X A;  5H6R A;  1QNM A;  4H02 A;  4WFE A;  3J81 N;  4TQF A;  3L72 H;  3K58 A;  3HY1 A;  1K3E A;  3K9A A;  4YIO A;  2RHS A;  2P5I A;  3OMN B;  3SJC C;  3TXS A;  4JI1 O;  1W0K G;  3ASO C;  4JI1 B;  3MD0 A;  3NEM A;  4HT4 A;  1K8A W;  4W4L A;  4X62 O;  4X62 B;  1YGB A;  4QE7 A;  4DR1 O;  1WAZ A;  3OMI B;  3G67 A;  3G80 A;  4DUY B;  4BAY A;  4U3J B;  1FXH A;  5E79 Z;  1KD1 W;  1NVP B;  4FZ0 A;  4MVR A;  3K5L A;  1B8A A;  3B09 A;  4PHC A;  4CC5 A;  1JVM A;  2JGD A;  4KL1 A;  5KLV H;  3HXZ A;  2Q0O C;  1IDS A;  2XND G;  3BA9 A;  4P71 C;  3JD3 A;  3SPJ A;  2Q5H A;  4FFB A;  2IH3 C;  4GUN A;  1SQP H;  2R9I A;  3ZED A;  1SRY A;  2IU0 A;  2WLN A;  1SQV H;  1M57 C;  1UJW B;  3OGI B;  2DZC A;  1KYO F;  4YHH O;  4YHH B;  1NJ8 A;  1AI7 A;  1KP2 A;  3K5M A;  5KAF Z;  3R66 A;  5EZY B;  1KKC A;  2RHQ B;  4RQE A;  2E64 A;  3FD9 A;  2ZIO A;  1SQF A;  3CEI A;  3WQZ A;  3T1H O;  3T1H B;  2M6Y A;  2H8P C;  3B2E E;  1TUB A;  4QIW F;  4P3N A;  1XUQ A;  1XHX A;  2UXB B;  1N8R W;  5C93 A;  1AP6 A;  3VQW A;  4BW5 A;  1H2L A;  2ATK C;  2E5A A;  4AQY O;  5LXT B;  3JAS B;  3TCU A;  2F43 G;  4F6R B;  4X66 O;  4X66 B;  2OT5 A;  4CH6 A;  1J95 A;  1HNW B;  3AG4 B;  4TVW A;  4PA6 A;  1HWY A;  3RGB A;  1N34 B;  1N34 O;  4LVI A;  3WB0 A;  1PP9 H;  1YSC A;  4LH6 A;  1SET A;  1JQ0 A;  1OCR B;  2YXH A;  4DV2 B;  1NYR A;  1EIY B;  1KBH A;  1U97 A;  2FML A;  4YXW G;  2EJF A;  4WF2 A;  2GTA A;  4H2S A;  1QHT A;  3ABK C;  4UUJ C;  3ZRX A;  1URF A;  4XU3 A;  3WU2 Z;  1WN7 A;  3DXR A;  4P30 A;  5K1X A;  4PHZ A;  4I55 B;  4D6T H;  1YEW A;  5B1N A;  2PI4 A;  5LA6 A;  4DR6 O;  1NVP D;  1VAR A;  4DR6 B;  4I0X B;  1BQ0 A;  1L8D A;  3ASN B;  3RVZ A;  1GN6 A;  3AEI A;  3FB5 C;  2XAH A;  1EM1 A;  3FYE B;  2F23 A;  1OCO C;  4LF9 O;  4LF9 B;  4L8J A;  3CCJ V;  1YXB A;  1M56 C;  2RHS B;  3UH0 A;  2EZO A;  3H1K H;  5IYZ A;  1KEC A;  3CJH A;  2EJG A;  4JAA A;  2UUA O;  2QSA A;  1EZV H;  2CE4 A;  3FJP A;  2NLJ C;  2AXT Z;  3ZJZ A;  2V4D A;  5JVD A;  1OCC B;  4JYC A;  1N32 O;  3ZN0 A;  1N32 B;  11AS A;  3ZMT A;  2JGD B;  3DTU B;  5E1A C;  2FTK A;  3P3P A;  2WA3 A;  3APQ A;  4FFB B;  1XI1 A;  3A32 A;  2X6C A;  4RUE A;  4AIL C;  2LW7 A;  4G85 A;  3M8A A;  4LFA O;  4LFA B;  3L9D A;  3ZHR A;  1IZ3 A;  3OGC C;  4HNA A;  2D3O W;  3UKM A;  3HXV A;  1YCI A;  1OJH A;  4E51 A;  3HKB A;  2BCC H;  2ZCE A;  1W59 A;  4C7U A;  1G51 A;  2J3M A;  2DW4 A;  2NS6 A;  2W6J G;  3CME V;  3NR7 A;  1PYS A;  2ZE8 A;  4MTG A;  2HLD G;  4BW9 A;  1TUB B;  4UP9 A;  5HFL A;  5HGQ A;  3OUS A;  2XAG A;  4X64 B;  5K1P A;  3G4S V;  1QCE A;  2QTS A;  1YTF B;  4XTW A;  1TAE A;  1QF6 A;  2G4C A;  5DEC A;  1IVS A;  2A8E A;  4GCZ A;  4YP0 A;  3A2F A;  1NJ5 A;  4DV0 O;  4DV0 B;  1YJW V;  1L0L H;  2CGH A;  4PA3 A;  1SKV A;  1HNX O;  1HNX B;  2QE7 G;  5B1O A;  3V7R A;  1SQG A;  2FKX A;  1PNK A;  5FNV A;  3ZHS A;  4EEQ A;  5LGN A;  3A0B Z;  1AIL A;  1QLE C;  5LP6 A;  3QO8 A;  4CS2 A;  3DXR B;  3JD0 A;  4B3T O;  4B3T B;  2DWD C;  5IJ9 A;  1SQB H;  4X9Q A;  3RYF A;  3J80 N;  2DVE A;  2RMK B;  4UPA A;  1EN4 A;  1F51 A;  5LA6 B;  2HEP A;  4NKG B;  4LNU A;  4LF4 O;  4LF4 B;  2JS5 A;  2UU9 O;  2UU9 B;  3IKL A;  4LR3 A;  5B3S B;  1N0N A;  2Z5U A;  2Y0I A;  5IYZ B;  5BR8 O;  3LSQ A;  2RQ6 A;  4DV6 B;  1EFR G;  3CJH B;  3AK3 A;  1Q6I A;  1OCR C;  3GWO A;  3L70 H;  2X7R B;  3TET A;  4X88 A;  1WP8 A;  1KUQ A;  2QTO A;  3I7F A;  1VF5 B;  5JVD B;  1WB8 A;  4DYL A;  3JAK A;  4K3A A;  3N2K A;  3CC4 V;  2AHZ A;  2ZNJ A;  3DC6 A;  4FZ1 A;  1B6Q A;  2IU3 A;  4PDV A;  2MW2 B;  3ASN C;  5D5Q A;  2ZXW B;  1B70 A;  1YTF D;  1QU7 A;  2DXT A;  1H4V B;  4KHP B;  1GN3 A;  3W7S A;  4LVL A;  1HR0 O;  1HR0 B;  1GM7 A;  4HNA B;  4J7J A;  1NBM G;  2YIB D;  4P74 A;  1M90 W;  1H8E G;  4FM1 A;  2JIZ G;  1VMG A;  2XGT A;  1NR7 A;  1HNZ O;  3HKB B;  2HR3 A;  4F6E A;  1HNZ B;  3ABU A;  4WFB V;  3MHH C;  1IL2 A;  1P7B A;  4GX5 A;  3CHX A;  1ATI A;  4YPF A;  3AG7 A;  4HWO A;  3R65 A;  4H2U A;  3EFF K;  4DR5 O;  3FB7 C;  4FLZ A;  3UO2 A;  3HTZ A;  3B4S A;  1NZ6 A;  4MW3 A;  4UB6 Z;  5CA1 A;  1SS3 A;  4CS3 A;  2L35 A;  2XAS A;  3TK1 A;  3AG2 B;  2ZTG A;  3APO A;  4P9P A;  5KAI Z;  2PUS A;  2WLK A;  1P7G A;  5FNV B;  4GT1 A;  2OCC B;  5LP6 B;  4R6Z A;  5IJ9 B;  2EIM C;  4B3R O;  4B3R B;  3RYF B;  1MSD A;  2JDI G;  3OR6 C;  3D8C A;  2ZXF A;  3B8M A;  4CH5 A;  4WFH A;  3MHS C;  1N0J A;  2N05 A;  3PZC A;  4LNU B;  5IDJ A;  3E35 A;  4UCT A;  4LF7 O;  4KQE A;  1G4Y B;  4DW0 A;  1G1X B;  3ZMZ A;  5LHI A;  1VF7 A;  2YI9 A;  3K5N A;  3ZMS A;  2I4O A;  1GGM A;  3OM3 B;  5EBL C;  3FFQ A;  2O57 A;  1WPB A;  3A7R A;  2JGU A;  2V7Q G;  1KQS U;  5IYD O;  2BOC C;  4IYH A;  5CA0 A;  1ZTE A;  3AK2 A;  3SPC A;  3JAK B;  1BE3 H;  3N2K B;  4J9Z B;  3RYH A;  2E41 A;  3RAC A;  4H0L B;  2QM7 A;  1JJ2 U;  1NJ1 A;  5A2Q N;  2GBO A;  1XL4 A;  4F4L A;  3CXC U;  1UPG A;  1WQW A;  1I5X A;  1KKD A;  2WWW A;  3OD4 A;  1B70 B;  1AI4 A;  3Q4H A;  2LQT A;  4RUF A;  1KMM A;  3ZHU A;  5B3S C;  4LP8 A;  4NXN O;  3BVO A;  5GW7 A;  2EJ7 A;  1GAX A;  2A9H A;  3LUT B;  4O4H A;  2ZR2 A;  4HBN A;  3CD6 V;  3OT7 A;  4QE9 A;  2Y48 A;  4LH7 A;  1MZF A;  3HXU A;  4X1Y A;  1X01 A;  3ABT A;  2AW9 A;  4JAV A;  1ASZ A;  4WFG A;  4YRE A;  1Y67 A;  4I7Z B;  5JWP A;  3X2Q B;  2Z3Y A;  4HVC A;  3EFS A;  4GZR B;  4I50 A;  2ZT9 B;  4AI8 A;  1FFX A;  1X4T A;  2XUM A;  1QLN A;  2ETN A;  3A0R A;  5KUM A;  2EZP A;  2UUB B;  2ZXW C;  1XRE A;  1TVK A;  4GX1 A;  1SF9 A;  5CA1 B;  3E83 A;  3JYC A;  2ARU A;  2HFE C;  2Q6A A;  4JYY A;  5L3E A;  2Q7H A;  1MAB G;  4JV5 B;  4JV5 O;  4FLY A;  3L2Z A;  4MVZ A;  3REX A;  2ZQM A;  1B06 A;  3LC0 A;  3ABK B;  1WJZ A;  3BRC A;  3JD4 A;  4DK1 A;  4X89 A;  4TVA A;  3LDE A;  3CCE V;  2OWO A;  2AGA A;  1O9G A;  3S3W A;  1WNL A;  4U7O A;  2UXN A;  2XAJ A;  4FPP A;  3ZRV A;  3TEH A;  2PZS A;  4J10 A;  1JOY A;  4W4K A;  2DU7 A;  4UCU A;  3OEE G;  3AG2 C;  4YRC A;  3VQY A;  3RT3 C;  1OCO B;  1AVM A;  5CA0 B;  2EIK B;  2OCC C;  1USY A;  1FJG O;  1FJG B;  5LP6 C;  2CAZ C;  3RYC A;  5LGU A;  4H2W A;  2QKA A;  3RYH B;  3E8F A;  2QHS A;  3RBZ A;  3H1I H;  4YYE A;  1R3L C;  5JQG A;  2DXU A;  2CUG A;  4YY3 B;  3G1Z A;  1N4C A;  5JCO A;  2N04 A;  1ARO P;  3C3S A;  2LGW A;  4CZZ A;  4O2A A;  3Q4H B;  4YRF A;  3IAL A;  1WQ7 A;  1V55 B;  3NEN A;  1KU9 A;  4JZG A;  4O4H B;  5JJN B;  3CS5 A;  2Y4T A;  5DM6 V;  1E24 A;  1Q43 A;  2WA4 A;  2G38 A;  2ALY A;  1HDJ A;  4X1Y B;  4YRJ A;  2QWR B;  1RIQ A;  4DR2 B;  3PJS K;  5GTI Z;  1OCZ C;  2HVK C;  3BPZ A;  1B7Y A;  2ITC C;  1YB3 A;  4HYO A;  2PYL A;  4Q15 A;  4NVP A;  4JI2 O;  4JI2 B;  2GV9 A;  4HA8 A;  3F5W C;  4I50 B;  3JAM N;  2JJ1 G;  3QTC A;  4PG3 A;  4AH6 A;  1H8H G;  4JI3 O;  4JI3 B;  1FFX B;  1GMG A;  3ZRS A;  3WB2 A;  4XBF A;  4KR3 A;  4JYB A;  1Q6H A;  1K92 A;  4NCX A;  2ITD C;  4ICG A;  4DUY O;  3D3I A;  4CC6 A;  1TVK B;  1MSW D;  4TQD A;  1JMK C;  2LO1 A;  2YS8 A;  4XEO A;  3UGQ A;  2ODR C;  4YJ3 A;  3N2G A;  3MAQ A;  4DQ2 A;  4UP7 A;  4P74 C;  4UVC A;  1T5E A;  5CMU A;  1K5S A;  2BSK A;  3KCY A;  3TXQ A;  4J11 A;  1D5N A;  2ODM A;  2RDC A;  4FJC C;  1S5L Z;  3H1L H;  3X2Q C;  3JSN A;  3CMQ A;  2HVJ C;  2W6I G;  3FAV A;  4MW8 A;  1KMN A;  1G5H A;  2P4V A;  4J42 A;  5FPO A;  3LNN A;  1FXK A;  4YRL A;  1PM9 A;  1LYL A;  4TVA B;  4YDQ A;  3E86 A;  1QLE B;  1FPO A;  2Q7G A;  2QKS A;  5IJ0 A;  3RUX A;  4DV4 O;  4DV4 B;  4ZTU B;  4PI2 A;  1EOV A;  3W3S A;  4DR3 O;  4DR3 B;  3TEH B;  3HKD A;  3T1Y B;  4WCE V;  3U10 A;  4LNS A;  4TUY A;  2Y69 B;  2UXB O;  5KX5 A;  2P4K A;  1JPX A;  2PY5 A;  2QHT A;  4B7E A;  4XU1 A;  1NU1 H;  2YEV A;  2KB1 A;  3CE2 A;  3JCU Z;  4DO2 A;  2HG5 C;  2AKW A;  1HNW O;  3RYC B;  3OD1 A;  3L73 H;  5J2U A;  1YIT V;  3DGE A;  4TOI A;  5CBF A;  1COW G;  3OMA B;  4P72 A;  3G6E V;  2JEU A;  4DV2 O;  5JQG B;  1GM8 A;  1PD3 A;  4JI0 O;  1P4R A;  4JI0 B;  4FVM A;  1EBO A;  4O2A B;  3ICX A;  2EIN B;  2Q8V A;  3BFM A;  2M7W A;  1I0H A;  2WSS G;  1GRJ A;  2LFS A;  2FB5 A;  1ROP A;  1AR1 B;  2AMC A;  4JI8 O;  4JI8 B;  1Q8I A;  4U3F H;  2H94 A;  2JS3 A;  1WPY A;  1O9H A;  4XDJ A;  2ALY B;  2XHB A;  4LF6 B;  1Z7N A;  1ENV A;  4KXR A;  1B7Y B;  3IGA C;  4X5O A;  1YZB A;  2F1M A;  1R6T A;  2EIK C;  2DTH A;  4NR1 A;  1BHA A;  3E22 A;  3I5D A;  2F66 C;  3OAA G;  1R3I C;  5TIS Z;  2ZD9 A;  3NET A;  3H01 A;  3SPI A;  5ELO A;  1JR9 A;  3H1J H;  4G27 B;  4NYK A;  4PJ0 Z;  4NTW A;  1V55 C;  1IUR A;  3SPH A;  4YJ3 B;  4HWS A;  1Y6X A;  1H2M A;  3N2G B;  5GTH Z;  1JJO A;  1S77 D;  4OPA A;  1Y76 A;  2KSD A;  4H33 A;  5L3G A;  3CCR V;  2BSK B;  1RM1 C;  3BY6 A;  1S3J A;  1WU7 A;  4ABM A;  3BAB A;  1DGS A;  2QHV A;  3QF7 A;  3I55 V;  4UVA A;  3FAV B;  1YFR A;  3SYA A;  5LBQ A;  1G5I A;  1Q5O A;  2CGN A;  1K73 W;  2Y0P A;  1NS1 A;  1FXK B;  1XQ8 A;  2CTQ A;  4K88 A;  4OP0 A;  5C8Y A;  4PI0 A;  5IJ0 B;  2YSU B;  4O4I A;  4B3S B;  1EN6 A;  1NQT A;  1YI2 V;  4FK5 C;  2EIM B;  2Q5I A;  1NT2 B;  2ZKO A;  3HKD B;  1WYD A;  1JFF A;  5ITZ A;  4FLX A;  4MS2 A;  5LMU O;  5LMU B;  4EKW A;  4TUY B;  4X64 O;  5KX5 B;  3M7M X;  3JD1 A;  3CPW U;  4EO4 A;  2YEV B;  2NR5 A;  2CDY A;  2CGO A;  2AKW B;  1KP3 A;  4BIO A;  2PMF A;  4GLX A;  2IH1 C;  4NXM O;  4NXM B;  5J2U B;  3UFG A;  3PN1 A;  1E1T A;  3K57 A;  1QR9 A;  4TV8 A;  5D5P A;  4O2D A;  1BBU A;  1N33 O;  1N33 B;  4UCO A;  1YFS A;  5EBW C;  5C53 B;  1YFT A;  1VQK V;  1H2G A;  4LVJ A;  1EVK A;  1TGO A;  3UM7 A;  2Q69 A;  1XNR O;  1XNR B;  5JJE B;  3RKW A;  2X0L A;  4UV9 A;  1VF6 A;  2AMC B;  3A31 A;  2Q68 A;  4YCV A;  1NI8 A;  3SYQ A;  2Y69 C;  1SQX H;  1HC7 A;  3K0D A;  3JCZ A;  2NNU A;  4H2V A;  3UCS C;  1Q90 D;  3EHB B;  2E10 A;  1I7F A;  1USY C;  1KOG A;  3E22 B;  3IJ4 A;  4TWA A;  3ZHT A;  2DWE C;  2VQE O;  2VQE B;  3FX7 A;  4DV6 O;  1VP7 A;  2F93 B;  1XBL A;  4WJ3 M;  5L3C A;  1IX9 A;  3O65 A;  1PNL A;  2Q7E A;  2LGQ A;  3D36 A;  5JCO C;  3L4G A;  3CCS V;  2EIN C;  3UT5 A;  1K34 A;  2HJF C;  4YRQ A;  4MVM A;  3BCC H;  1JA8 A;  3SDL A;  5C52 B;  5KHG A;  2C2A A;  3L74 H;  1JJC B;  1QVF U;  2VS0 A;  1BIB A;  4TVY A;  2LJ2 A;  3K3W A;  4WFF A;  1W2B U;  1NTM H;  1Y76 B;  4ZTZ B;  12AS A;  4DR7 O;  3SJA C;  4DR7 B;  4P75 C;  4KHP O;  3HB3 B;  5HFM A;  1ZL8 A;  2CTP A;  3EXA A;  1B3Q A;  3THO A;  1BSM A;  5H2F Z;  2HNI A;  1VQ7 V;  2ZM6 O;  2ZM6 B;  2BTQ A;  2HJD A;  2ZZF A;  5C8Y B;  2ZT6 A;  1YVW A;  2MK3 A;  4O4I B;  1Y74 A;  1B04 A;  4ZKI A;  3CCM V;  2EAY A;  5IYB O;  2FYU H;  4O4L A;  1FAF A;  2F4V O;  2F4V B;  1OHH G;  1JFF B;  5ITZ B;  4BIU A;  1U96 A;  3E8G A;  3JAL A;  4ASU G;  4X1K A;  3SGI A;  2DEQ A;  3OUF A;  1Q6U A;  1THZ A;  2LW1 A;  3V7S A;  3V7C A;  4JYA O;  4JYA B;  3OFN G;  2IJJ A;  4PDR A;  3HXY A;  5LHG A;  4K0K O;  4K0K B;  4TV8 B;  4UCS A;  1Y66 A;  4QNH B;  3TJT A;  4HWT A;  4BWA A;  3SYC A;  3CRA A;  1RSO A;  3LDC A;  4G84 A;  3E89 A;  1YIJ V;  1FXK C;  3OW2 U;  4AHC A;  2EJR A;  1IXB A;  2YIC A;  2PGG A;  4D7S A;  2A7W A;  3E8B A;  2RJZ A;  3CCQ V;  5CBH A;  3PCO A;  1DTO A;  2P6J A;  1VQ8 V;  2XAF A; 
#chains in the Genus database with same CATH homology
 2H8P C;  3AG1 B;  3HXX A;  4QIW F;  3W7W A;  3VQW A;  4P2Z A;  1WNL A;  4P3N A;  4KUM A;  4U7O A;  3KG2 A;  3STZ C;  2ZDI A;  1N8R W;  2XOK G;  4J9Y B;  5C93 A;  2C7I A;  4CBC A;  2UXN A;  1AI6 A;  1GO3 F;  2XAJ A;  2ATK C;  4FPP A;  3ZRV A;  4BW5 A;  1S72 V;  2E5A A;  3TEH A;  1NYQ A;  1PL0 A;  3TCU A;  1BMF G;  2F43 G;  2WLM A;  4UVB A;  2ZT8 A;  4P73 A;  2OT5 A;  1JOY A;  2DU7 A;  4P3P A;  1J95 A;  1YJ9 V;  4CH6 A;  3AG4 B;  4K86 A;  4TVW A;  4PA6 A;  3ICA A;  1HWY A;  3REU A;  4YRN A;  3AG3 B;  3OEE G;  3AG2 C;  4LVI A;  2E3C A;  4G28 B;  4YRC A;  3VQY A;  5IYC O;  1YSC A;  4Q20 A;  3ABL C;  1SET A;  4P72 C;  1JQ0 A;  1OCR B;  1NYR A;  1OCO B;  2K1E A;  3FB8 C;  1X55 A;  4XEM A;  5C51 B;  1EIY B;  2EIK B;  2OCC C;  1USY A;  4YXW G;  2EJF A;  4WF2 A;  1C0A A;  2A0L A;  3STL C;  4H2S A;  5IY5 B;  5LGU A;  1OCZ B;  3W7T A;  4H2W A;  3ABK C;  3E8F A;  2QHS A;  3K79 A;  3L4G B;  4XTU A;  3RBZ A;  4UUJ C;  3ZRX A;  1JCH A;  4YYE A;  4P9O A;  1R3L C;  2OTJ V;  2DXU A;  4XU3 A;  3G1Z A;  5DN6 G;  4P30 A;  3M99 B;  4MVO A;  5K1X A;  1ARO P;  3HPL C;  3A7U A;  4CZZ A;  1Q86 W;  5H9C A;  2ZNI A;  5B1N A;  5B1A B;  2PI4 A;  4YRM A;  4PEL A;  3SYO A;  3IAL A;  4RMF A;  4YRF A;  2IJI A;  3BEH A;  1NVP D;  1NH2 B;  4G2K A;  1WQ7 A;  1V55 B;  4I9W A;  3NEN A;  2WLL A;  3ASN B;  3RVZ A;  3FB5 C;  3AEI A;  1TUE B;  3ABM B;  3AG4 C;  3JD2 A;  4XTX A;  2XAH A;  2IJH A;  5DM6 V;  1E24 A;  3FYE B;  1JX9 A;  4X8A A;  2P0L A;  3K03 A;  1VQ6 V;  1OCO C;  2ALY A;  4U7N A;  4YRJ A;  5KA5 A;  5LHH A;  1RIQ A;  3T4Z A;  3PJS K;  3CCJ V;  1L0W A;  1M56 C;  2RHS B;  2I4L A;  3TEG A;  3UH0 A;  2EZO A;  1L1F A;  1OCZ C;  2HVK C;  1W0J G;  1B7Y A;  2ITC C;  1YB3 A;  1KEC A;  4HYO A;  4Z1M G;  4YCW A;  1QVG U;  2EJG A;  4Q15 A;  2J3L A;  1I5Y A;  2I4N A;  3RVY A;  4FIP C;  2PI5 A;  4R8C A;  4YRT A;  4JF3 A;  3F5W C;  4HA8 A;  1QBZ A;  5L3B A;  1IXM A;  2JJ1 G;  3FJP A;  4WI1 A;  2NLJ C;  3MQZ A;  3IFX A;  3QTC A;  1B76 A;  2LFR A;  5B1A C;  1H8H G;  5EBM C;  3ZJZ A;  1VQN V;  4JTC B;  1BIA A;  3QNE A;  2CIM A;  4YCU A;  1OCC B;  4JYC A;  1GMG A;  3R07 A;  3ZN0 A;  3ZRS A;  1E1O A;  3RGL A;  4XBF A;  3ZMT A;  4JYB A;  3CMA V;  3ZRW A;  2X6B A;  1K92 A;  3HFV A;  4NCX A;  4KR3 A;  2ITD C;  3K0G A;  4RO2 A;  3DTU B;  3D3I A;  5E1A C;  2FTK A;  2XAQ A;  1MSW D;  4H2X A;  4YRO A;  4TQD A;  3W7U A;  3B8N A;  3V8L A;  4CH3 A;  3VQX A;  3B77 A;  1NJ2 A;  4XEO A;  1RPO A;  3UGQ A;  2ODR C;  4XTZ A;  4YRP A;  2JJ2 G;  2XTI A;  1MOF A;  4MSW C;  3A32 A;  3FKS G;  3ZMU A;  2X6C A;  1Z7M A;  4QPJ A;  4ZIB A;  4P71 A;  4DQ2 A;  1Q81 W;  4UP7 A;  4RUE A;  4UVC A;  4P74 C;  4G85 A;  4HZ3 A;  1J5W A;  1WLE A;  5CMU A;  2IY5 A;  1K5S A;  2GHY A;  1LNQ A;  2D3O W;  3OGC C;  5CBG A;  2EIJ B;  3UKM A;  1Y4M A;  2AHY A;  3WG7 C;  3QO5 A;  4FJC C;  3HXV A;  5KNN A;  1EFW A;  3ETD A;  1CPY A;  2ZZG A;  3X2Q C;  1PYS B;  4YDQ A;  3CMQ A;  2HVJ C;  2W6I G;  1QE0 A;  1VQZ A;  4E51 A;  1DF4 A;  1OCC C;  4MW8 A;  1KMN A;  4OLF A;  1K5Q A;  3VQV A;  2ZCE A;  1G5H A;  1G51 A;  1FXV A;  1DLB A;  4LC1 A;  2ZT5 A;  1FXK A;  3PCO B;  2J3M A;  2DW4 A;  1LYL A;  2NS6 A;  2W6J G;  3A5Y A;  3CME V;  1FS0 G;  1XL6 A;  1GM9 A;  1PYS A;  3L1A A;  3P8T A;  4XTV A;  3E86 A;  4MTG A;  3P8Y A;  1E1R G;  1QLE B;  2Q7G A;  2QKS A;  2HLD G;  4BW9 A;  4UP9 A;  3FB6 C;  4R7C A;  2CK3 G;  5HFL A;  3FYI B;  3OUS A;  1E22 A;  2XAG A;  3G4S V;  3RUX A;  5CN0 A;  1VQL V;  1EOV A;  1EVL A;  5K1P A;  4LVM A;  4ZTU B;  1QCE A;  3W3S A;  1YTF B;  4XTW A;  3RF1 A;  3K08 A;  3TEH B;  4MVS A;  3MEY A;  1QF6 A;  4JGS A;  2G4C A;  2I4M A;  3CYO A;  4WCE V;  3NEL A;  2A8E A;  4LNS A;  2Y69 B;  4GCZ A;  4BIZ A;  4PDL A;  4YP0 A;  1JPX A;  1NJ5 A;  4KR2 A;  2DDZ A;  1YJW V;  2ARS A;  2QHT A;  4XU1 A;  5EC2 C;  2YEV A;  2KB1 A;  4UV8 A;  1WPX A;  4OXS A;  4PA3 A;  4DO2 A;  2HG5 C;  5CA3 A;  2QE7 G;  1HXD A;  2AKW A;  3LSS A;  2ODR D;  2B1I A;  5B1O A;  3HY0 A;  3E8H A;  1PKX A;  3ZCC A;  3OD1 A;  2P7T C;  5EC1 C;  1YIT V;  3V7R A;  4MVQ A;  2QM8 A;  3DGE A;  1VQP V;  5CBF A;  1COW G;  3OMA B;  4P72 A;  1PNK A;  3G6E V;  2DQ3 A;  2JEU A;  5LGN A;  2A79 B;  1GM8 A;  1QLE C;  3QO8 A;  4H37 A;  4CS2 A;  1PD3 A;  1P4R A;  3JD0 A;  3CCV V;  2DWD C;  1R3K C;  4YRK A;  1EBO A;  3MF2 A;  11AS A;  2UXX A;  2EIN B;  2DVE A;  4WJ4 A;  4UPA A;  1NR1 A;  1F51 A;  3BFM A;  5L3D A;  2M7W A;  5FL7 G;  1KC8 W;  1Q7Y W;  2WLL B;  3AG1 C;  1GKF A;  2WSS G;  1CP9 A;  2JEX A;  4YRR A;  2LFS A;  1S76 D;  1ROP A;  1AR1 B;  1OZ0 A;  2AMC A;  5KUK A;  5B3S B;  3IKL A;  2H94 A;  1VQ5 V;  1WPY A;  4XDJ A;  3OEH G;  2ALY B;  4LBE C;  1K9M W;  2Z5U A;  1Z7N A;  3K06 A;  1MG1 A;  2BOB C;  1ENV A;  2V1D A;  3AG3 C;  2C8M A;  2ZT7 A;  1B7Y B;  3LSQ A;  3IGA C;  1EFR G;  4X5O A;  4MT8 A;  4PA4 A;  3G71 V;  1OCR C;  3GWO A;  3IG2 A;  1ADJ A;  2EIK C;  2IJK A;  1RM1 B;  2X7R B;  2DTH A;  3TET A;  5H6Q A;  1BHA A;  3ZMV A;  3CCU V;  5IY5 C;  4X88 A;  2E65 A;  4L87 A;  4P3O A;  3T1C A;  2B1G A;  3I56 V;  3OAA G;  3ASO B;  2FYK A;  3RIR A;  3ETG A;  4P75 A;  4TSF G;  2EJ9 A;  3A5Z A;  4EX5 A;  2QTO A;  2QHU A;  1R3I C;  1AJP A;  1BL8 A;  5B1B B;  3HFZ A;  3I7F A;  4HWR A;  3ETE A;  4WF9 V;  2ZD9 A;  1X2G A;  3NET A;  1H38 A;  3H01 A;  1H4T A;  3SPI A;  3ZRW B;  2EIL B;  4KP4 A;  1SER A;  4TT3 G;  3CC4 V;  5ELO A;  1FFT B;  4XDL A;  4YRG A;  3A74 A;  4R50 A;  1VQ9 V;  3F7Y C;  4G27 B;  2AHZ A;  2ZNJ A;  4H2X B;  1B6Q A;  2DJZ A;  4TVA B;  1E1Q G;  1V55 C;  2IU3 A;  4PDV A;  3HRI A;  3SPH A;  3ASN C;  4GX0 A;  4HAM A;  3ABM C;  1QR8 A;  4DXW A;  2ZXW B;  4YRS A;  1B70 A;  4HWS A;  1YTF D;  2GSM B;  1EQR A;  2E1H A;  2DXT A;  1H4V B;  1S77 D;  3W7S A;  3DSQ A;  3HXW A;  4LVL A;  5L3G A;  4H33 A;  2IY5 B;  4XTY A;  3CCR V;  1RM1 C;  3ZN1 A;  3ZIA G;  1GM7 A;  3BY6 A;  2R9R B;  2CJA A;  1S3J A;  2EBO A;  1YHQ V;  5J9P C;  1WU7 A;  2ZZE A;  1X56 A;  4YRI A;  1NBM G;  2QHV A;  3NXS A;  2CJ9 A;  4P74 A;  3I55 V;  1M90 W;  1M57 B;  4UVA A;  1NKD A;  1H8E G;  3F7V C;  2JIZ G;  3SPG A;  1YFR A;  2XGT A;  1ASY A;  1NR7 A;  3SYA A;  1V54 B;  4UXN A;  2HR3 A;  4PA9 A;  5LBQ A;  1VQM V;  1G5I A;  3M4Q A;  4DPG A;  3LDD A;  2EIL C;  3ABU A;  4WFB V;  1K73 W;  1PNM A;  5ELN A;  1FXK B;  1NJI W;  3MHH C;  4K88 A;  4OP0 A;  1IL2 A;  1P7B A;  4GX5 A;  2YSU B;  1ATI A;  4YPF A;  3MF1 A;  2ZIM A;  4HWO A;  1NQT A;  1YI2 V;  4FK5 C;  2WLI A;  2EIM B;  1H4Q A;  3KFU A;  2Q5I A;  3T2M A;  2ZGW A;  2IW5 A;  3R65 A;  4H2U A;  4JAS A;  1WYD A;  3EFF K;  3OE7 G;  1VQO V;  4MS2 A;  5KA6 A;  3FB7 C;  4EKW A;  1R6N A;  4J15 A;  1AJQ A;  3HTZ A;  4AH6 A;  1HTT A;  4JTD B;  1EZJ A;  3JD1 A;  3CPW U;  2ART A;  3A7A A;  4YRL A;  5LGT A;  2CGH A;  4MW3 A;  4EO4 A;  2YEV B;  1N9W A;  1NH2 D;  4CS3 A;  2AKW B;  1KP3 A;  4LCU C;  2PMF A;  1M9N A;  1E79 G;  2IH1 C;  2XAS A;  3TK1 A;  3AG2 B;  3WFV A;  2ZTG A;  2EIJ C;  3P8V A;  4P9P A;  2WPD G;  3UFG A;  1F4N A;  1E1T A;  3ABL B;  1QR9 A;  1FYF A;  2WLK A;  1YJN V;  4O2D A;  4GT1 A;  3GB7 C;  1BBU A;  2OCC B;  4ZBM A;  5HGQ A;  1YFS A;  4MTX A;  5EBW C;  5F5W A;  4E2L A;  3IC7 A;  3HRK A;  4H2Y A;  4XDK A;  5C53 B;  2DQ0 A;  4R6Z A;  1YFT A;  4UP8 A;  2EIM C;  4N23 A;  4PA7 A;  1R3J C;  4MTF A;  1VQK V;  3E9H A;  1H2G A;  3VOU A;  4HWP A;  4LVJ A;  2JDI G;  3OR6 C;  1EVK A;  2ZXF A;  1SES A;  4KFM A;  3B8M A;  4RQF A;  2B5U A;  4WFH A;  1BBW A;  3MHS C;  2DYR B;  4CH5 A;  3UM7 A;  2Q69 A;  1CEZ A;  3PZC A;  2RHQ A;  5IDJ A;  3E35 A;  2DYS B;  2ZDI C;  3RKW A;  2X0L A;  4UV9 A;  2AMC B;  3A31 A;  4KQE A;  1G4Y B;  2JK5 C;  2ZIN A;  3V8K A;  2Q68 A;  3ZMZ A;  4P73 C;  3ERR A;  4YCV A;  3K04 A;  5LHI A;  3E9I A;  2CJB A;  3SYQ A;  4RDX A;  2Y69 C;  3RW0 A;  3ZMS A;  3E2E A;  1HC7 A;  2I4O A;  4MVU A;  4WFA V;  3K0D A;  3OM3 B;  3JCZ A;  2NNU A;  5EBL C;  5BZB A;  1GGM A;  4H2V A;  3EHB B;  2E10 A;  2EWN A;  2DU5 A;  2WAM A;  4PG3 A;  1USY C;  1KOG A;  4CS4 A;  1M56 B;  3A7R A;  4TWA A;  3SYP A;  4XU0 A;  3CC7 V;  1W66 A;  2V7Q G;  2DWE C;  4GX2 A;  3M4P A;  1K33 A;  1KQS U;  5IYD O;  2BOC C;  3ML0 A;  2OTL V;  4CH4 A;  1EIY A;  4WJ3 M;  3LNM B;  3HFZ B;  5L3C A;  1K7D A;  2W0F C;  1GK9 A;  4LVK A;  4QPK A;  1PNL A;  4JPR A;  2DYR C;  1F4M A;  1ORQ C;  3SPC A;  2Q7E A;  4MTO A;  1RPR A;  2DZ9 A;  3D36 A;  4J9Z B;  2E41 A;  5E3I A;  2DYS C;  3L4G A;  3RAC A;  1F23 A;  3CCS V;  4K87 A;  4RAI A;  2DTO A;  2EIN C;  3UGT A;  2QM7 A;  1K34 A;  2WLH A;  4JAU A;  1JJ2 U;  1NJ1 A;  2DKG A;  3BJU A;  2HJF C;  4YRQ A;  4MVM A;  2X6A A;  5C52 B;  3TUP A;  1XL4 A;  4F4L A;  3CXC U;  1WQW A;  1K4D C;  3RKX A;  1I5X A;  1R6K A;  2C2A A;  2WWW A;  3CP1 A;  4I5S A;  1KKD A;  1B70 B;  2QEX V;  1JJC B;  4TTV A;  1QVF U;  1AI4 A;  1BIB A;  4TVY A;  4RUF A;  1KMM A;  3K3W A;  4Q6G A;  5B3S C;  2WLJ A;  4WFF A;  1X2H A;  4LP8 A;  1W2B U;  1S0V A;  5H6R A;  5GW7 A;  2A9H A;  3LUT B;  4H02 A;  4WFE A;  2P90 A;  4TQF A;  3CC2 V;  1JJC A;  4ZTZ B;  2ZR2 A;  12AS A;  3CD6 V;  3HY1 A;  4QE9 A;  1M1K W;  1K3E A;  3K9A A;  3IKM B;  4P75 C;  2Y48 A;  3HB3 B;  5L3F A;  5HFM A;  3HXU A;  1X01 A;  3ABT A;  4N21 A;  1ASZ A;  4JAV A;  1ADY A;  4WFG A;  2HNI A;  1VQ7 V;  3WG7 B;  2RHS A;  5EK0 A;  2P5I A;  4YRE A;  1H4S A;  3OMN B;  3X2Q B;  1K4C C;  1W0K G;  3ASO C;  3MD0 A;  1G8M A;  3NEM A;  2ZZF A;  4HT4 A;  1K8A W;  2Z3Y A;  3T4D A;  2ZT6 A;  4H2T A;  4HVC A;  1AI5 A;  5B1B C;  3EFS A;  3OR7 C;  2MK3 A;  3EFR A;  2P67 A;  1YGB A;  4ZKI A;  2WLI B;  4QE7 A;  3CCM V;  2EAY A;  5IYB O;  3OMI B;  1OHH G;  4QJF B;  4BAY A;  1SZT A;  1FXH A;  1KD1 W;  1NVP B;  1X54 A;  2Q67 A;  4MVR A;  4BIU A;  4TWK A;  1B8A A;  1QLN A;  4PHC A;  3A0R A;  5KUM A;  3E8G A;  2EZP A;  3P32 A;  1JVM A;  4ASU G;  2ZXW C;  2DEQ A;  3HXZ A;  3OUF A;  2LP7 A;  2XND G;  4PDM A;  4P71 C;  4GX1 A;  3JD3 A;  3SPJ A;  1VQ4 V;  1THZ A;  2Q5H A;  3V8J A;  2IH3 C;  2QA4 V;  3QO7 A;  2PME A;  3V7S A;  3V7C A;  2R9I A;  3E83 A;  3JYC A;  3OFN G;  3VBB A;  2ARU A;  3RL6 A;  2ZR3 A;  1NJ6 A;  1SRY A;  2IJJ A;  4PDR A;  3HXY A;  1DF5 A;  5LHG A;  1S5H C;  1R73 A;  1Y66 A;  2IU0 A;  2WLN A;  2HFE C;  2HKO A;  2Q6A A;  3P30 A;  1M57 C;  4QNH B;  1UJW B;  3W7X A;  1GTO A;  4JTA B;  5L3E A;  2DZC A;  4HWT A;  1V54 C;  1NJ8 A;  2Q7H A;  1MAB G;  1AI7 A;  1KP2 A;  3SYC A;  3RKY A;  4BWA A;  1AJN A;  3LDC A;  4G84 A;  3E89 A;  3SJQ C;  1YIJ V;  1FXK C;  3OW2 U;  2EJR A;  3L2Z A;  4MVZ A;  3CCL V;  3REX A;  1ZWI C;  3E8B A;  2EL9 A;  3CCQ V;  5CBH A;  2ZQM A;  2RHQ B;  1BHB A;  3LC0 A;  4RQE A;  3ABK B;  2E64 A;  2DTI A;  3JD4 A;  1DTO A;  2P6J A;  1VQ8 V;  3PCO A;  1K97 A;  4X89 A;  1Q82 W;  4TVA A;  3LDE A;  2ZIO A;  3CCE V;  2XAF A;  1NNH A;  4XU2 A;  3WQZ A;  4FMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...