3V8JA

Crystal structure of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
306
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin ligase
total genus 98
structure length 306
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8jA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8jA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8jA02
2YHTA 5FGMA 4EJWA 1CGPA 4P3NA 5F5WA 2ARSA 2ODRC 1WYDA 2CG4A 3SZPA 2HQNA 3L2ZA 1SMTA 3R61A 1ON1A 3BJAA 2FBIA 3ABTA 2F5DA 2FNAA 2UZKA 1JE8A 1I5LA 5HLGA 4M7AD 1J75A 2O03A 5FFZA 2MBFA 3LA7A 1BBUA 5EEHA 3F23A 2RHQA 1NJ5A 4H2UA 4A0XA 4P74C 4HV6A 2ISZA 2DKGA 3ML6A 4PJOE 3K0LA 3ZP5A 3RERA 2ZXJA 5GMKm 3UFGA 3I59A 3L4GA 4GCVA 2EFOA 4UP7A 1FLIA 5LJ5f 3PZCA 2GQQA 3T8RA 3N4MA 4K88A 4C8QB 2EA4A 2V1UA 4ZYEA 2XKOA 3WE2A 3B02A 3GX4X 1XMAA 1Z6RA 3F3XA 3COAC 2UWMA 3PCOA 3CUOA 3P8TA 3KFUA 3GWZA 2E7XA 2RQPA 3MFKA 2E3CA 4YRMA 1H0MA 2CJ9A 4HQEA 1R58A 3RYRA 1O3RA 1B70A 4X9DA 3DEUA 4YRFA 1USSA 1D3BB 3VQXA 2DPUA 3E9IA 1S3JA 5JI6A 1I8FA 3M7GA 1XCVA 2YX4A 4BYYA 3FMRA 3HOTA 4M77B 2EWNA 2W57A 1KU9A 3FJPA 4EJUA 2L4MA 2AMCA 1O3TA 4HLYA 2VXFA 3BROA 3TOAA 1UFMA 4L9NA 4FX4A 4IXAA 4ZYDA 4JQFA 4N0BA 5DYMA 4YG2F 4WWCA 5GAOm 2ZINA 4G9YA 4XTXA 1ZLJA 3R0JA 1PUEE 1B59A 3INZA 1ULYA 2P5LC 2R3SA 4L0YB 1LYLA 1KQ2A 3QHSA 2H09A 4EMHA 5E1ZB 3CDHA 4MMKA 5DCFA 3L1AA 1FX7A 2BBYA 3DP7A 1SD4A 4Q48A 4A5NA 3QUIA 1J5WA 4XTZA 3VB2A 3OOPA 1ONVA 1ASZA 1I1GA 4YRNA 5GAMj 1NNHA 1JXSA 4ZTZB 4P9UA 2QHSA 4RAZA 3VOEA 2VXZA 2ZNYA 3I59B 1G6NA 1ADJA 4I98B 2XAHA 3C18A 12ASA 4P72C 3VODA 2QBYA 1IUYA 3DQVC 3A5YA 3GLXA 4R79A 5LJ5g 1KU3A 3M4QA 2COMA 4XU1A 5LJ3e 4YREA 3TOBA 1HW2A 4M7AC 2HNIA 5LJ3f 4P75A 5BMZA 4IRHA 3WGIA 3KZZA 5D4SA 2GIVA 3JB9J 3E5XA 4Y13A 5E20A 2Q7EA 4I0AA 4M7DF 1YB3A 4O2DA 3UH0A 2Z99A 5CYVA 1K78B 4C8QC 2FBKA 3WTYC 4L9TA 2ETHA 1B76A 1MJBA 3K1MA 4BHBA 4P3PA 2LDUA 2FNPA 3E6CC 2HKXA 3RYPA 2E7WA 5DD8A 2VE9A 1NHAA 2HWVA 2J5PA 1U5TC 4RAYA 4OLFA 1SRYA 4YRJA 1Z7MA 2I4NA 3W3SA 2K02A 4M7DD 1B7YB 4H2WA 2HQRA 3PGGA 3CO7C 4PJOF 2HS5A 3MF2A 1QNTA 5BOXA 4C92F 4L87A 3F8NA 1YO5C 5FLXK 4U0WA 4LMYA 2GXGA 4EJOA 4U7DA 2G7UA 2DLLA 3K2ZA 1W7PB 4EMGA 2FF4A 4EX5A 2F2EA 2W25A 4DPGA 5JR3A 5E3IA 4ENNA 4F7UF 4RS8A 2RV8A 1T98A 2LNBA 3MWMA 1YG2A 3V7RA 1XDUA 1TW3A 2L01A 4EQQA 3R4KA 1E1TA 4PG3A 4M78F 2YPRA 4M75E 3CMQA 2EJFA 2NS0A 2VN2A 5C53B 4YRKA 5K5OA 4M78G 2CO5A 4M75B 5H6QA 5CLSA 1QBJA 2Y75A 2IVMA 4N0AA 1Z7UA 1V4RA 3MQ0A 4HWTA 1LVAA 1KA8A 4A0ZA 1YW9A 1P4XA 2Q8KA 5GAMf 1HK9A 4UVCA 4IHTA 3GVAA 4L9VA 3JSPA 4A2UA 4HWPA 2ZIOA 2ZNZA 1HQCA 5HS7A 3J7AO 3QO3A 5GMKl 3F21A 4NB5A 4M72A 2JTVA 4ZYGA 3KFWX 3A7RA 1G51A 1TH7A 3JCMf 2DDZA 2XGTA 1ZGJA 4EMSA 1KU2A 1HSTA 4HW0A 1OYWA 5LJ3d 2ACJA 2GWRA 5GANg 4H02A 1T2KA 4XTVA 2BYVE 4M74A 3JTGA 3ZMUA 1WI9A 2Y48A 3BFMA 1EH8A 4XLPF 3LSQA 4M7DB 2CJBA 4BNCA 1PP7U 4ZZDA 2VT3A 2A61A 5LGNA 1RIQA 1P92A 1ZH5A 3ECOA 3GZ6A 1RIOH 3ZPLA 1LQ1A 2VBWA 2G4CA 3TEGA 4YRPA 2ZNJA 2HYFA 4HF0A 1P6RA 2WWYA 1LNWA 4WCGA 1J59A 5AIQA 3UGTA 2XRNA 3K1NA 3RTRA 3JCMP 4YFXF 4JLIA 1M8VA 3WTZA 4H2XA 2IP2A 4TQDA 1Z7NA 4Y15A 2CFXA 1H4TA 1U6GA 3L00A 3M9AA 4MQ9F 2FB7A 5CJ9A 4PNOA 3WU0A 1G5IA 2FE3A 4Q4ZF 2OZ6A 1PYSA 1RNLA 3GFJA 2DVEA 1WU7A 4RQEA 4LB6B 2EV0A 2E1CA 2WTEA 1MZBA 1IN5A 5D5VB 3KEOA 5ICGA 1B8AA 4YDQA 4XTWA 1BIAA 3BJUA 4G8XA 1B34B 2M45A 2I4LA 2JPCA 1LJ9A 1GVJA 3EQLF 1GGMA 3O3KA 2P5KA 4CO8A 2DTRA 2EA2A 4RCBA 2OAZA 1TNSA 5KNNA 2CWEA 1G3TA 3F8MA 4HX7A 1MGTA 4AVPA 4BHCA 4C8QD 1FSEA 5DDGA 5F64A 2G7HA 1MJAA 3BP8A 3A5ZA 5FLXZ 4LB5A 5HS9A 4ZZLA 3BPXA 2JPBA 4F7ZA 1RZ4A 3R6SA 3HRTA 5LEKA 2GA1A 1W7PD 1U1SA 1X54A 2STWA 5DD4A 2DBBA 4H2TA 2FOKA 3ELKA 4CDGA 2ZFWA 1FPQA 2IA0A 3BJOA 4EMKA 3I54A 1IN7A 4P73C 2DK5A 2DXUA 3V4GA 1EIYA 2PMUA 1ZN2A 1QE0A 2V9VA 3RI4A 3K1PA 4MTDA 3JTHA 1EQRA 1HC7A 4LK0F 1BBWA 3GYHX 1UCRA 1L3LA 2ALYB 3NEMA 1EH6A 3JCMQ 4JRIA 2X4HA 1SETA 2VE8A 4YIFA 1EOVA 4RGUA 4HOBA 3SXYA 2VODA 1WQ2A 2UXNA 2E10A 4HDVA 4CHUA 2EFNA 1X3UA 3NETA 5JFRA 2J3MA 4M75D 3G73A 4NL3A 2DEQA 3SB2A 2EB7A 4M73A 4YROA 3PCOB 3P9KA 1YW8A 1OKRA 3REXA 4B8XA 3JCMg 1NJ6A 5A2QZ 1USYA 3IKMB 1JJCB 3HOSA 3DPLC 3HXUA 2DU5A 4WJ3M 1ATIA 3JCMb 5JHUA 1WPYA 1GXQA 2ZMEB 1U3EM 1U8RA 4EVIA 5TRDA 5GANf 4ASNA 1O57A 4QWQA 1FZPB 3F6VA 5GAMg 5CAIA 3T8TA 3SWNB 5JVTA 2QQ9A 1OPCA 2PN6A 5CVUA 2FU4A 2CYYA 4L9JA 4BW9A 3F22A 2VBZA 2GAUA 1XGSA 1HKQA 2RKHA 3JB9I 1S7AA 1SFUA 5ICEA 1VTNC 1SFXA 1LEBA 3HSFA 3TEHA 3WQZA 5HLIA 1NYQA 4TWAA 2E5AA 3LA2A 3WTUC 4M78A 1LOJA 1Z9CA 1HSJA 4H2XB 4ZTUB 1R1VA 1K6OA 4KN7X 4X5OA 3F8CA 1D8JA 3HFNA 4KICA 4CGZA 1FYKA 3T1BA 4M77C 5LGTA 2VC1A 3T0YA 2D1VA 4HF2A 2H6BA 4P5OA 3ZQ7A 4HX8A 1S6LA 3JCMW 5CVVA 4BQAA 2PJPA 3CUQB 3HRSA 4BHPA 3I7FA 4BH9A 3FIFA 3WTVC 4UPAA 2MLGA 2E64A 2AKWA 3HFVA 2IY5A 1RUNA 3WGHA 1J5YA 3SWNC 3L09A 3WE3A 2OU2A 4QLCU 4YRTA 2ARTA 4C92A 3RPQA 5ICFA 4A5MA 1E17A 3MEYA 2XGXA 2QHUA 2DW4A 4O3MA 3ICAA 2Y0MA 3J80Z 2O0YA 4ETSA 3TEHB 1EVKA 2P6TA 2HGCA 3GFLA 4O5VA 2E65A 4WF2A 2CGHA 1O7FA 2KRFA 3JB9D 1FBUA 1R00A 3RACA 2STTA 4MNUA 5L3EA 3IG2A 5GANh 4HWSA 1R7JA 2R7FA 4FX0A 1IW7F 1KQ9A 5K5QA 2P0LA 5D5XB 2M1BA 4M75A 5HDNA 4X9CA 5IT3A 3E5QA 2L3DA 1YW7A 2J3LA 4LFUA 2Q5IA 3CUQA 3PQJA 5ILUA 5GANd 3HY0A 1F1ZA 4M7DC 3ULQB 1XSXA 1ZRCA 4I09A 4HZFA 1FBSA 3TQNA 3BW1A 1T0FA 1U2WA 4UV8A 4YRIA 2EFPA 2RHSA 1R1UA 1BC8C 1WQWA 3WG9A 2FYKA 5J8CA 3JCMV 4RB3C 4NHJA 1I5ZA 4XU0A 2FXAA 2PMFA 3LA3A 1U5TB 2EJRA 4M78D 3HRUA 4BAYA 2ZBKA 4LLGF 4WXHA 3SFZA 2CQKA 4HYEA 2I4MA 5HS8A 2L02A 2DJZA 5K1XA 3HXVA 4L18B 1EIYB 4HBLA 5CVRA 3E6DA 1L0OC 3VU3C 3VQVA 4M6XA 2AMCB 2Z5UA 4F7UB 5HVQC 3P9CA 2Q2EA 2BEOA 4PHCA 4A6DA 2DAOA 5TJJA 4J6XA 3FZVA 4C8QF 3QO7A 1B70B 3KEQA 1WKMA 4L0ZB 3WTSC 1KGSA 2QHVA 3GFIA 2YU3A 3EFRA 1J2XA 4TVAB 1TW2A 2P5IA 1XGOA 1WRJA 2YSRA 2ZT5A 4UHTA 1X56A 4JK1X 2QLZA 4M7AF 2K27A 2YX7A 2P7CB 5E18F 5D8LB 1YLFA 4IRIA 2HZTA 1ON2A 3QPTA 2VC8A 3F8BA 4NCXA 2RC4A 5GAN2 5J6XA 1N9RA 1TQPA 3CJNA 1YQAA 1G3SA 2V1DA 3IWZA 3KP3A 4MMLA 3HFZA 1I27A 1SMYF 2QUFA 4NQWA 2KJCA 3V7CA 2BV6A 4KNYA 4M78E 2DZCA 4R1HA 1Y0UA 1MDMB 1KOGA 1DPUA 4UVAA 1G5HA 3H92A 2RM4A 3LQRA 1XSDA 2DXTA 3HTSB 4UVBA 3GEZA 2LSOA 3KP7A 3H3UA 1R5GA 3IKTA 2DU9A 1Y96A 1YS7A 4RMFA 1ZGAA 2YLBA 4EJVA 3L2CA 3E3VA 2A5YB 3VBBA 4IJAA 1HBXG 4OP0A 5LJ3j 4OIQF 4EMKB 1LJOA 3HHGA 5FD6A 3GZ5A 1PDNC 1P4WA 4UV9A 2DQ3A 4YRGA 4ESFA 5GAN7 1YGBA 1UHWA 1W66A 2PMHA 4EM0B 3IL2A 2IY5B 3KP5A 3LSTA 2ZXFA 2C8MA 2HDCA 4J6YA 4HLXA 1G3YA 1YFRA 3MCZA 3JCMh 2MD5A 4CS3A 2O8XA 1TQMA 3VQYA 4A0YA 5F6FA 1ZLKA 4IF4A 1FWZA 1JJCA 3NRVA 4M71A 2IPQX 2O3FA 2ZNIA 1R1TA 4P72A 2ZMEA 3KZYA 1GXPA 3I71A 3GFMA 2AXLA 1BI2A 1FOKA 3E6MA 3RJPA 3GW2A 1U78A 3QP6A 3E9HA 4KFCA 4A6EA 3CLOA 3QO5A 4WXCA 4P75C 5LHHA 1RUOA 2EFWA 1KMMA 5D8KB 3HXXA 2QQBA 2PEXA 4OOIA 4ENKA 2FBHA 2QM3A 3GUDA 3BOQA 1I4K1 4KMUX 3FWEA 1KQ1A 4G7ZF 3A7AA 4CH5A 4YRSA 2A68F 5DEQA 1T38A 2P5VA 4KN4X 1FYMA 4M75F 1B34A 4XSXF 1W5SA 2RGVA 3ISPA 1AWCA 4GO1A 4TVAA 3I58A 1TTYA 5LJ3h 2V6CA 4CH3A 3F8FA 2FEZA 3MZHA 2HR3A 5FO5A 3CTAA 4RGSA 2QBYB 1EFWA 4YCUA 2Z9OA 4AWXB 4GGGA 4XU3A 2HKOA 4CH4A 1FC3A 2UXXA 2OBPA 4N9HA 3QSUA 2PLYA 3KLOA 2Q7GA 3MEXA 4MHGA 2EFQA 2ZIMA 3HTUA 4I02A 1IAWA 4Y17A 1O3QA 3P8YA 3BZ6A 2XAFA 3ZMTA 2H27A 6PAXA 3SZTA 2AKWB 5GAN3 5GANe 4KDPA 1KYWA 4K86A 3QRFF 4TTVA 3K69A 1P4AA 4MQVA 3WU1B 2K7LA 3C7JA 2FA5A 3LWFA 1MDMA 1HW5A 2DTOA 2A3SA 5GAMd 4YCVA 3BWGA 5GMKe 2QTXA 2JSCA 3R0AA 1BM9A 2E1NA 2DQLA 2ZO4A 1R5HA 5LLQA 4LJZF 2DTHA 4M77F 3KCCA 1YFTA 4JUVA 2JZYA 2ALYA 3HXYA 5BPIA 4PJOB 2DQRA 1J9IA 4IVNA 5LHIA 2PI0A 1FP1D 3IHUA 3JCMX 5D5UB 2XROA 5F1RA 3WODF 4P71A 4PJOC 1MD0A 4G7OF 4WJ4A 2MH9A 3QU6A 5GAN8 1S29A 1UB9A 1FSHA 4KT5C 4N0AC 2BGCA 3MAJA 2C7IA 2PBIA 5L3CA 4AIHA 4G84A 3ZMVA 2CW0F 4I7HA 3JW4A 4M7AE 2J5OA 2Z3YA 4TVYA 3FM3A 2K4BA 4LD5A 4N9IA 1SD5A 3I64A 1HKSA 4EGZA 5LEJA 3T5XA 1PYSB 1BJAA 3HYIA 4U7BA 4H2YA 4OMYA 2BE5F 2WC2A 4L5JA 2LF7A 1BC7C 5L3BA 2XASA 2HEOA 4KUMA 3HRIA 4LG0A 1E2XA 1BN5A 4OIRF 2KIUA 1RI7A 3D0SA 2XIGA 1HXDA 3H3ZA 4M77G 3U9GA 1CF7B 3W6JB 1Z91A 2ZGWA 2RB6A 1MGQA 3DFGA 4P55A 4M7DG 1J0RA 3E5UA 4RGXA 4M78B 3IC7A 1IN8A 1USTA 3NEUA 4CXFA 2DK8A 2F5FA 4J6WA 1JHFA 1ZYRF 4XLNF 4AH6A 4Z2YA 3EDPA 1OR7A 1HKTA 5GAN5 1G4DA 3JAMZ 3DV8A 4C92D 1HTTA 3MZYA 2ZT6A 1IN4A 2CJAA 1HW1A 4ESBA 3V8LA 5E1XA 3MF1A 5E17F 4M6YA 2I4OA 1OMIA 4H0EA 4HDUA 4YPFA 1R22A 3J80K 2DFIA 2JT1A 4P74A 2ELHA 3G1ZA 4F7UG 2XTIA 3L7WA 4LG0B 4XTYA 3HXZA 1S8NA 4EM1A 1QGPA 3JB9H 1EV7A 2VOOA 2IA2A 1VQZA 4J15A 4ENJA 2FSWA 4RB1A 4KIBA 3HXWA 1QZZA 2HOEA 3VQWA 1IN6A 5LJ5h 4OMZA 2H94A 2L54A 3ZMSA 1KU7A 3Q9VA 4A12A 1X55A 4XTUA 5GAOq 2A6EF 4WX9A 4OINF 1H9TA 2O61A 3QNEA 2JN0A 1I1SA 3M4PA 5GAMh 2FMLA 4A53A 2EV6A 2F5CA 2HTJA 2OZUA 3WGGA 5H20A 1TBXA 4TQFA 1WSUA 4BWAA 3TO6A 2O6GE 1WQ7A 4PJOD 4Q6GA 2P6SA 4ENMA 1KQ8A 3ZN0A 4EM2A 3NQOA 1K7AA 1BI3A 4UXNA 3HSBA 2ARUA 3ECHA 4TV7A 1B4AA 1N9SA 1ZREA 2PMEA 3JCMc 3R07A 1QPMA 4UNOA 3U1DA 4A54A 3LSSA 2IJLA 4IHSA 4KR2A 4S04A 4HWOA 1IXRC 3TDUC 4NL2A 3I0TA 4Q15A 1SESA 3LC0A 1IZ1A 2PFBA 4WK8F 1JGSA 2ZR2A 3HRMA 4EMKC 2ISYA 3QTCA 3FXQA 4JRKA 2Y90A 2A07F 1DUXC 3RKWA 4YRQA 2IRFG 2QWWA 5AIPA 2K86A 4CZZA 4RB0A 1MKMA 4G85A 4HWRA 4H2VA 3TO9A 3WTXC 1SERA 1OYIA 1SFEA 5ILSA 1ZG5A 2XHKA 4YFKF 4PJOG 2ZT8A 3FMSA 4M7AA 4Q5SF 2E1HA 1L0WA 4XQ3A 2H6CA 1K78A 3ZN1A 2IT0A 3TDZC 4H2SA 4CS4A 2Q0OA 4GYIA 2XKPA 5L3GA 1BIBA 3BJ6A 4JBAA 5GAOp 1FY7A 2GA2A 3M4GA 1REPC 3KP4A 3DKWA 1SAXA 4HVCA 3QO8A 4C8QA 5BS6A 4B09A 2FMYA 4EGYA 4EV0A 2W85A 5EEGA 4PGHA 4PCQA 2IW5A 2X0LA 2MH2A 1QQIA 1WWXA 3P7NA 5GAOn 1IF1A 1LDJA 4Y91A 4AIJA 4BXUA 2VONA 2WV0A 3TUPA 4HA8A 5DUIA 1OYYA 5D6EA 3JCMd 1YYVA 1U5TA 3BY7A 3GO5A 1R36A 2C6YA 4M77E 2NAZA 2QVOA 1TLHB 5LJ5d 4ZYHA 1FP2A 2RNJA 3KE2A 2XAJA 3GF2A 3OV8A 5KVRA 5D5WB 3VFZA 5CVIA 4U0VA 2ZZFA 4C92G 3JB9G 2MA3A 3K9TA 1IRFA 2XVCA 3ROUA 3A7UA 4YRLA 4G94A 4G6DA 2LF8A 4M7AG 3P8VA 2DI3A 1FBQA 4E51A 5DCMB 1PP8F 4I0BA 3M8FA 3P9IA 2ZCEA 4KMFA 4TVWA 5LGUA 1C0AA 2TDXA 2P4WA 5IT9Z 4QVCA 1B1BA 2A6HF 2ZJ2A 3QPHA 1IRGA 3IRQA 3BPVA 4FT8A 2RD1A 2HYGD 4LLLA 4YYEA 3DF8A 3SWNA 3EYYA 1B6AA 3RESA 4C92C 1STZA 3LFKA 3AAFA 3AHUA 11ASA 3EUHA 3ZMZA 1ZRDA 4HX4A 2PQ8A 3REOA 3LQQA 5BQTA 3L9FA 2K4JA 4P3OA 2RDPA 3Q9SA 2EAYA 1WLEA 4LGWA 4MEYF 4I2OA 1XCBA 3R60A 2DQ0A 3HSRA 3RKYA 3RGLA 1K79A 2D1HA 4IRGA 4MEXF 4M75C 4RGRA 2A69F 1N9WA 2I2LA 3I53A 1ODDA 4YIIA 4M7DA 4HT9A 1YCYA 3NELA 3GIBA 3A74A 4M77D 2VXEA 1YFSA 1E1OA 5ED4A 1G3WA 1XGNA 4HAMA 1Y96B 3RPUA 2W84A 2DO7A 4EO4A 2ODRD 3FX3A 3S2WA 4KIGA 2IA1A 5DUKA 2VOPA 3KLNA 4LNSA 1FNNA 2Z33A 4KIFA 3RUXA 2R7DA 1MJ9A 1F4KA 2OA4A 3J81K 3GXOA 3ERED 5E1WA 2P8TA 3WTTC 1R23A 1LB2A 3QU3A 1S7OA 4P9FA 1ZG1A 2KKOA 2ZZEA 1UHMA 3REUA 4OU0A 4C8QE 3SQNA 2RHSB 5LJ5j 5D6FA 2XAQA 3RKXA 2PG4A 5ERIA 4XU2A 4M7AB 1FYFA 5BPDA 4HF1A 4LLNA 4YP0A 1T6SA 2ESHA 3IKLA 5E8IA 2NNNA 4HQMA 3TGNA 1BOAA 1XMKA 3ZMDA 1DDNA 2M30A 1YTYA 1LDDA 1F9NA 5LJ3g 5K5RA 4CS2A 3JAMK 1J7KA 1I6XA 4HT8A 1QF6A 4KR3A 4U88A 5GAN4 4GXOA 4UP8A 5LRRA 3IRRA 3A32A 5J8FA 1XSVA 1XD7A 5DY9A 2OQRA 4CYDA 1ZHFA 4EJTA 4K87A 3C1DA 5GAN6 1QZYA 1LEAA 5A2QK 1ZARA 4D0PA 5K1PA 3RDIA 3WTWC 2XV4S 4MTEA 1DP7P 2CGPA 4PGGA 4L5IA 2GXBA 1H4VB 1JHHA 2ZKZA 3FXUA 3SHFA 4C92E 4QVDA 4NOYA 4O6JA 4OIOF 4WI1A 4KYWA 3LAPA 4YRCA 2VT2A 1BI1A 5GANj 3EETA 2W24A 3FHZA 4MGRA 3EFSA 4P73A 5FD5A 5L3FA 1YS6A 1TNTA 4XEMA 3HUGA 5ELNA 3RL6A 2HTSA 3F6OA 3V8JA 4AD9A 4CICA 1NJ1A 2D2WA 1NJ8A 4U0YA 2QYOA 1D3YA 3HHHA 5GMKi 1H9GA 5HDGA 4M9XA 3F72A 1C0WA 1P2FA 3JB9F 1CF7A 2GZWA 4OIPF 5GAMe 4KQEA 3DPTA 4M9SA 1I81A 1V3FA 5K1YA 1JBMA 1LNXA 3PFIA 3NENA 5GMKh 3QAHA 1AOYA 4CH6A 1F5TA 5HDKA 4G7HF 4RCCA 4XSZF 3D5LA 4K2EA 2MLKA 1T39A 1Z6TA 2CSOA 1B9MA 3I5UA 4XBFA 4M7DE 2VBYA 3J81Z 2V1XA 3HFOA 3JCMe 4E70A 2JRTA 3IWFA 4RB2C 2VBXA 4I01A 3JSOA 1XGMA 1USYC 5LJ5e 4P96A 1X01A 2KIFA 1B9NA 3DXJF 2HFHA 3FMQA 3TKYA 2K57A 2RA2A 1D5VA 1NYRA 1JRIA 4ESJA 5ICCA 3HSEA 2RHQB 2QZ8A 4YCWA 3HRKA 1NJ2A 4IPAA 4ZIBA 5H6RA 4M75G 1FYLA 3HIFA 3FM5A 1U1TA 1KQ0A 4C8QG 4ON0A 4ZH4F 2ADUA 5GAOr 2ZCWA 5GAOl 2OQGA 2P7VB 4R8HA 3A31A 4M78C 3M8EA 2M87A 3W6KB 4C92B 2ESNA 5E8GA 2EK5A 4M77A 3FF5A 1TQIA 3N97A 5DV5A 2EJGA 2EJ9A 2NYXA 2AS5F 3HFZB 5KK1A 2KJBA 3M1EA 2ZR3A 4KA4A 4PDKA 1QO0D 2DTIA 4XRFA 3E6BA 1D8KA 2KIMA 5DCMA 1D3BA 4DQ2A 1H4SA 2ZT7A 4RQFA 2E41A 1YFHA 3OD1A 3IKVA 5LHGA 2LKPA 5LRSA 2ZTGA 4HV5A 2EL9A 4AIKA 4WXDA 5HOOA 1Z05A 3KP6A 4G6QA 1ASYA 2QHTA 3UGQA 1ZAOA 1B7YA 1A04A 3QP5A 3HY1A 1BI0A 1O3SA 4PZJA 5ILVA 3BY6A 4YFNF 5D4RA 2XAGA 5GMKj 3RIRA 4XEOA 5IT9K 3RF1A 2DU7A 1GHCA 3I4PA 2RVCA 2EV5A 1WNLA 3O2PE 2QQAA 5AONA 1E24A 5FB2A 3C3WA 4S05A 1EVLA 3V8KA 2RN7A 1ADYA 4F7UA 2FQ3A 3DSQA 1YIOA 3CUQC 4Q47A 3BDUA 2DPDA 2Q5HA 1SD7A 1LDKB 1IXSB 4UP9A 1DPRA 3B73A 5FFXA 2FRHA 4UUVA 1W5TA 3ABUA 3KETA 3FB9A 1ZG3A 1FT9A 1O7LA 2B0LA 3KP2A 3ERRA 1W7PA 2XUBA 1ZRFA 4J5YA 2MC3A 2M8EA 1XB4A 2L4AA 2QENA 3LAJA 3PQKA 1IL2A 3CO6C 2F5EA 2YR2A 4P71C 4PJOA 1KYZA 2CIMA 1SD6A 3EYIA 3BDDA 3QOPA 3O6BB 3U2RA 3Q5FA 5C51B 4GYGA 2V79A 2G9WA 2NNYA 4RDXA 1BBYA 2ZZGA 5HGQA 3G3ZA 1H641 2DT5A 1E22A 1W4MA 1X2GA 2DZ9A 1X2HA 2D45A 1Z1DA 3HTZA 2VC0A 4DNCA 2Q7HA 5I21A 4V2SA 3V7SA 3VEPA 1M5Q1 2NRAC 5CVJA 3JCMJ 1IXCA 1EH7A 3FXRA 5L3DA 1XDSA 4YRRA 5ELOA 4LK1F 2M5WA 3IALA 3E97A 5LBQA 2YLCA 1Q1HA 1XN7A 4FHTA 4F7UE 5C52B 1H4QA 2OD5A 3TO7A 4M9ZA 3L4GB 5HLHA 1KMNA
chains in the Genus database with same CATH superfamily
2YHTA 1X3WB 1EX4A 3WXMB 1Y07A 5FGMA 4ZGEB 4EJWA 2GBQA 2LTOA 1CGPA 4BQQA 4P3NA 2LREA 5F5WA 3EHRA 2ARSA 3TSZA 3G1MA 1VQNQ 2ODRC 1VQMI 1WYDA 1GFDA 2CG4A 3SZPA 2HQNA 3L2ZA 1SMTA 2DMNA 4A4HA 3R61A 4AYBN 1ON1A 5C0MA 3A1YA 3BJAA 4B43A 3A0BC 1TUCA 2FBIA 4E7IA 3ABTA 1X2KA 2F5DA 3BCAA 1R8OB 3OOUA 2D9TA 2FNAA 1VQ7Q 4LUDA 2E71A 3H6ZA 3OA6A 3HTZA 2UZKA 1M3AA 1JE8A 5KNNA 1I5LA 5HLGA 2LJ3A 4M7AD 1J75A 2LCCA 3LH0A 2O03A 5FFZA 1EIFA 2MBFA 4CRIA 3A0HC 3LA7A 1BBUA 2DMOA 1JTYA 1VQ6I 1W0TA 1AA7A 5EEHA 3JSCA 3F23A 3S1RJ 1KQSA 2RHQA 1NJ5A 1K9AA 2BW3A 4H2UA 4A0XA 5M3MJ 1WIEA 4P74C 4HV6A 3S1MJ 2LZ6B 2X51A 2ISZA 1X1BA 2JA7J 2M4GA 3H35A 3I4NJ 1Z67A 1NK2P 2DKGA 3ML6A 3TEDA 4C5HA 2KRCA 3CCST 1C0MA 3UKGA 4PJOE 3K0LA 3JAME 3ZP5A 1Q95G 2X3WD 4DBQA 3RERA 2ZXJA 5GMKm 3UFGA 3PMIA 5FU7B 4XK4A 2VKNA 3I59A 3L4GA 4GCVA 4Y28E 2VGNA 4A3MJ 2EFOA 1R5ID 1SFKA 4UP7A 1FLIA 5LJ5f 3LSIA 3PZCA 3D5SC 2GQQA 3T8RA 3N4MA 1VQ4A 4K88A 5A2QE 3VRYA 2L7FP 4C8QB 2EA4A 2XKOA 2YS9A 3WE2A 4ZYEA 2V1UA 3B02A 3GX4X 1XMAA 1Z6RA 3F3XA 3COAC 2UWMA 2F2VA 3PCOA 3CUOA 2JVHA 2K9LA 1YJWT 3P8TA 1WI7A 3KFUA 3GWZA 2R7TA 2E7XA 2CUFA 2RQPA 3MFKA 2E3CA 4YRMA 2LRDA 2WACA 5GJWB 1R6RA 1XPXA 1H0MA 4E6RA 2RNGA 4HQEA 1R58A 5IHIA 1WZOA 2CJ9A 2KZGA 2WB1N 3K7AJ 3RYRA 1O3RA 2JTFA 8ATCB 1M1KU 1B70A 4X9DA 2DRKA 3DEUA 4B3AA 4N4NB 2E2IJ 4UUSB 1BL0A 3CCMQ 4YRFA 1USSA 1D3BB 2KIQA 3BZKA 3VQXA 3HPGA 2PNIA 3L42A 3BQZA 2DPUA 1VIEA 1S3JA 4N4IA 1VQOA 3E9IA 5JI6A 1I8FA 3M7GA 2H8RA 1XCVA 2RMOA 2YX4A 4BYYA 3BG5A 2B8AA 4D8DA 3I4MJ 2WSCE 1P9QC 2N8GA 3FMRA 3HOTA 2GM4A 2EWNA 3AL0B 4M77B 2W57A 1KD1R 2P0KA 1QPIA 5IOYA 1KU9A 4CCOA 3FJPA 5FKLA 4EJUA 2LQNA 2L4MA 2CYZB 3VJPA 1CSKA 2ATCB 1QHHD 2AMCA 2XG8D 1RI9A 1O3TA 4HLYA 3ER0A 4J9CA 2A8EA 2VXFA 2M16A 3BROA 1TWCJ 3TOAA 3NPFA 1PSEA 1UFMA 3S15J 4L9NA 4ZYDA 4IXAA 4FX4A 4JQFA 4N0BA 5DYMA 4YG2F 4WWCA 1Z0XA 5GAOm 4G9YA 4OAYA 1VQ9T 2CZ1B 3QZ9B 1ZLJA 2W00A 5K7FA 3R0JA 4XTXA 1PUEE 3I55Q 1CKBA 1B59A 3INZA 3DCFA 1ULYA 2P5LC 2R3SA 4L0YB 1LYLA 4C0ZA 3BT9A 5KE2A 1KQ2A 2EYWA 3QHSA 2O4XB 2BZ8A 1YIJT 2EQIA 2H09A 2YSQA 4EMHA 2DBMA 4JRPA 3DU5A 1UG0A 2Y30A 3N05A 2F1LA 3PIOF 3VS1A 3S14J 5E1ZB 3CDHA 2OTLI 4MMKA 3K10A 2A0FB 5DCFA 2L3SA 2Z16A 1FX7A 2BBYA 2KISA 1SD4A 3DP7A 3PL8A 4MO7A 4Q48A 4A5NA 3QUIA 3I3LA 4FSSA 4X0GA 3VB2A 2DMTA 4E7LA 3OOPA 1ONVA 3DKMA 3OSVA 1YHQQ 1ASZA 1YWOA 2C06A 3S1QJ 1I1GA 1E3PA 2AXTC 4ESRA 5KYYA 5GAMj 1NNHA 4YRNA 2XF5A 3CEYA 2DDBA 1JXSA 4ZTZB 4P9UA 2QHSA 4RAZA 3VOEA 3V42A 2VXZA 2EZHA 2ZNYA 3I59B 3ZQQA 1G6NA 1FJLA 1YFNA 2QEXA 1ADJA 2L7MP 4I98B 4XRSG 2XAHA 1BR1A 1WJDA 2JSPA 3C18A 3IP4B 1UGPB 3BE3A 4FU6A 12ASA 4P72C 4Q6GA 3VODA 2QBYA 3MEUA 3C2BA 2WADA 3HHTB 1IUYA 3DQVC 3A5YA 2DL5A 3GLXA 3Q0VA 4R79A 3ULRB 5LJ5g 2DILA 1KU3A 1JB0E 1PSFA 4XMYA 3FRNA 1JEGA 3M4QA 2COMA 4XU1A 2Y4YA 4RTWA 3ZQGA 5LJ3e 1OYXA 5EG0A 2NUTA 2P4RA 1WZ2A 5TGTA 3TOBA 4AUXA 1WH5A 1HW2A 3HDDA 2HNIA 3WVEB 4M7AC 1YJ9Q 5LJ3f 4P75A 3VQYA 2NOGA 5BMZA 2OUMA 1UJ0A 4IRHA 2PVGB 5IP9J 3KZZA 5D4SA 3WGIA 1WJBA 2QK0A 3CC7I 4BY1J 5FKMA 3O8HA 2JMWA 4OAZA 4B4CA 1UGQB 2JK3A 4KGVB 2LR8A 2GIVA 2BVLA 1IC8A 4BY6C 3JB9J 2HI3A 3E5XA 1S9HA 4Y13A 2ZAEA 4NC8A 5E20A 3KXTA 3H41A 4IURA 1T3SA 1JJ2A 2Q7EA 4I0AA 4M7DF 1YB3A 4O2DA 3UH0A 3L2VA 1SFOJ 2Z99A 2CP3A 5CYVA 1K78B 2ARUA 2RK1A 4C8QC 2EYYA 3CCVA 2HCKA 2EIJH 2AQEA 2CV2A 2FBKA 3WTYC 1Z77A 3W3CA 2KI7A 2ZFUA 3EH1A 3SDZA 2K7AA 4F04B 1ZSZC 4L9TA 3LWIA 2ETHA 2CP7A 3CC7A 2PQWA 1B76A 1MJBA 3K1MA 4BHBA 4P3PA 2M9UA 2X4XA 2LDUA 2BUDA 2DJIA 2FNPA 3E6CC 3HTRA 2HKXA 4B9WA 3RYPA 4CCNA 3UNGC 2E7WA 5DD8A 4D1QA 1KC8C 2VE9A 3SEMA 1NHAA 4FE4A 2HWVA 5J3LA 2JA2A 5J1RA 1TT0A 1XJWB 5B1AH 2CKKA 2CUBA 2J5PA 1OU8A 1WXTA 2QGUA 4KT6A 1U5TC 3CP8A 4RAYA 2V9PA 3I7FA 3R07A 1XNIA 1SRYA 4OLFA 4YRJA 3TSWA 1RUWA 1M90C 1VQLQ 1Z7MA 3TL4X 1E6GA 1B07A 1R0CB 2VQCA 2I4NA 3W3SA 2K02A 2QAZA 2F6CA 4M7DD 1B7YB 2HQRA 1VZ0A 5FKNA 4H2WA 3PGGA 3NHNA 3CO7C 4LN2A 3OL4A 1R9TJ 4PJOF 2OJED 3G4SI 3I56T 4IHVA 2CZ6B 2H3JA 2HS5A 4UB8C 3ASNH 1ZSGA 1QWEA 3MF2A 1QNTA 3O5ZA 1VQOQ 2D0NA 5BOXA 4M3FA 1GDTA 4FW2A 3THKA 3CJQB 4C92F 4JRQA 1WFWA 1OEBA 4L87A 1WGXA 1XG1A 2L9RA 1DGRM 3CD6T 2E19A 3L2UA 1VQNI 3F8NA 1VQ8T 1YO5C 5FLXK 4U0WA 5HY6A 4QQGA 4LMYA 2GXGA 3CMYA 4RG8A 4EJOA 1Z9QA 2QI2A 1OFCX 4JS4A 4U7DA 3G71T 1HDPA 2G7UA 3OYYA 3LGLA 2ICWG 2A05A 2DLLA 3K2ZA 1O9SA 1W7PB 3P8BB 1MH4A 3KZIC 4EMGA 4L6V5 1DGWY 2FF4A 2QYZA 3G71A 2F2EA 2VQHA 2W25A 3H36A 4JDSA 2HPIA 3LL7A 5JR3A 4ABZA 1ZX6A 2FO0A 4FL6A 3QWLA 3MD2A 4ENNA 3BTIA 4EATA 3MP1A 3H0IA 3R6OA 4RS8A 3UA6A 1ETWA 1FXXA 4F7UF 1X6GA 2RV8A 1T98A 2LNBA 3CCEQ 2NS8A 4PFOA 4PFZA 5A0GA 1YI2Q 5FW9A 3MWMA 2Y4XA 3EGDB 2X6WA 2JTEA 1YG2A 3V7RA 3I35A 1XDUA 1MNEA 2E1MB 1TOVA 1TW3A 2ZT5A 2L01A 2HXOA 2OC6A 2SRCA 4EQQA 2LX7A 3R4KA 3ZEHA 3CCLT 4E4HA 1AEYA 2J7IA 1I6HJ 2RJCA 1E1TA 4F91B 4PG3A 4M78F 2YPRA 4M75E 5KH6A 3CMQA 4FE7A 2CQNA 2EJFA 4II1A 5CKHA 4KGZB 2X1EA 2XDDA 4KJZA 2NS0A 3A02A 2VN2A 5C53B 1U0JA 4YRKA 4ZJZA 3M58A 4H02A 5K5OA 2JXBA 1VF9A 2FPFA 4M78G 4ZYAA 3OSSC 1LVKA 1KONA 2CO5A 3ONQA 2LKXA 3FK7A 2W10A 1ZUKA 5H6QA 3WHCA 2ZSIB 5IYDJ 1X1CA 2M51A 5CLSA 3LSJA 4M75B 1QBJA 2Y75A 1HOMA 3CPWS 2IVMA 4N0AA 1Z7UA 1V4RA 2Y31A 3J7ZI 1NJIC 2QA4I 2E2JJ 3WVDB 3MQ0A 2JMCA 2R7VA 2GTJA 4HWTA 1LVAA 1KA8A 4A0ZA 2MPXC 4Y92A 1PUFA 3HC7A 4JX6A 1YW9A 4XN0A 1P4XA 2Q8KA 3Q0WA 3ZR8X 1I1JA 5GAMf 2VPLA 2LFBA 1HK9A 4UVCA 3TMOA 4IHTA 3GVAA 4KISA 4L9VA 3VPRA 2IGMA 4BD3A 5GJVB 5J4VA 3JSPA 4A2UA 3ASKA 3NGPA 2BY0A 4HWPA 4FISA 2ZIOA 1YJ9A 2ZNZA 1HQCA 5HS7A 3J7AO 1GCQC 3QO3A 2GF7A 4A3DJ 3F21A 5GMKl 3VYHB 2ZCFB 3RNJA 4NB5A 2YRCA 3PIOA 3I56I 4M72A 3PO3J 2F4OB 2JTVA 3OYLA 3G4ST 4ZYGA 3KFWX 4JJDA 1QCFA 3A7RA 2IS6A 5GAGJ 1W4SA 1G51A 1TH7A 1NE8A 3OBYA 3NMZC 3JCMf 2DDZA 3CC4Q 2XGTA 4N4OB 1ZGJA 4EMSA 3E9FA 2IS1A 4J83A 1KU2A 1MBGA 3GPLA 1YHQA 4GFBA 1HSTA 3IAS2 4HW0A 1OYWA 2COYA 4OB2B 2D8HA 4BY6B 2XD0A 3OIQA 5LJ3d 2ACJA 1WYXA 2GWRA 1O4XA 1ABOA 5GANg 1K73U 2XPWA 4RAGA 1T2KA 4J7IA 4XTVA 3CCUA 2EZLA 2BYVE 1VQ4Q 4M74A 3JTGA 3ZMUA 1ZQ1A 1WI9A 2Y48A 2LLKA 3RCOA 2PJRB 1HC8A 3OW2S 2QEXQ 3J7AF 2MYSA 1UGVA 3BFMA 4FIBA 1EH8A 4RM2A 1H8AC 3RMSA 4BJ5C 2KRHA 4XLPF 3AKZA 4HXJA 5CIUA 4M7DB 2CJBA 3LSQA 3SDGA 4BNCA 3FC3A 1OR7C 1PP7U 2LX9A 4BUPA 1VYVA 2K9GA 4ZZDA 2VT3A 2A61A 5LGNA 1RIQA 3MO8A 1P92A 1ZH5A 3ECOA 3GZ6A 2FL7A 3HBLA 1RIOH 3ZPLA 2CQQA 1LQ1A 2VBWA 1VQLA 2G4CA 3TEGA 4YRPA 2ZNJA 1VQ9I 1T33A 1WVRA 2HYFA 4NUBA 4HF0A 4ME7A 1K4SA 2CREA 3M4OJ 3GOXA 1P6RA 2WWYA 4BE0A 1LNWA 3GTJJ 1ZELA 4WCGA 1J59A 1QP2A 2KYBA 5AIQA 4XLCA 3OYFA 1WJAA 4Z8AA 3UGTA 2XRNA 4RTTA 3IH2A 2HVSA 4ITVA 2F4MB 3K1NA 1HSQA 4BUGA 3RTRA 3B6AA 3JCMP 4YFXF 1MV0B 1UJYA 4JLIA 1M8VA 4BBSJ 2D6FA 3WTZA 5F0HA 3RKQA 2CH4W 3UPUA 2DJNA 4H2XA 2IP2A 4ZDLA 2R5YA 1Z7NA 4TQDA 1ACMB 2CSQA 2HDWA 1ZQ3P 2NVXJ 4Y15A 9ANTA 3VS0A 2CFXA 5A0LA 2DK3A 1H4TA 2HPMA 1U6GA 1LFUP 4HVVA 2OV7A 1YJ9I 2RHIA 3HFNA 3L00A 3M9AA 4MQ9F 3C2HA 5CJ9A 2EYZA 2FB7A 2EBPA 4PNOA 4JJNK 1V54H 3SEZA 2M9HA 3WU0A 4RLQA 2FE3A 3QG1A 3SD4A 4E2FB 1VA7A 3MP8A 5CR2A 1S72T 1G5IA 4Q4ZF 4DW6A 2OZ6A 4G6TB 4RG2A 3R6NA 2LTPA 1PYSA 2QG9B 1RNLA 1X19A 3GFJA 2DVEA 3A5ZB 3A01B 1WU7A 3CD6Q 4RQEA 1B72A 4LB6B 1YI2A 2EV0A 1M1EB 2E1CA 2WTEA 3HOVJ 1MZBA 1IN5A 5D5VB 2I5UA 3KEOA 2KRSA 1RETA 2ZJRF 5ICGA 4GRIA 1X4PA 1A0NB 1B8AA 2KBTA 1FYFA 4YDQA 4RA2A 1VQ7I 2PZ1A 4XTWA 1FMKA 5CQXA 1T0HA 2V1QA 4EIKA 5KYUB 3J80E 4M3DA 1BIAA 3BJUA 3GTOJ 4G8XA 1B34B 2OTLT 2M45A 1MUZA 4PSWA 5EG2A 2JPCA 5CKFA 1I0CA 2I4LA 1GT0C 1IZ6A 2DD4A 1VQ6Q 5FJ8J 2BZXA 1K9MR 1LJ9A 1UG1A 1J3TA 5HNFA 3EH2A 4LG3A 2PMEA 1GVJA 3L2QA 5LFAA 3EQLF 5CPRB 3CZ6A 1AHJB 1LPQA 2EYXA 1D0ZA 2ZXIA 4UB6C 3O3KA 1GGMA 5DTDA 2P5KA 1OCPA 4CO8A 1MBFA 3CCRQ 2DTRA 2H1KA 4NBQA 4BI4A 4QSHA 2EA2A 2XU8A 3VS3A 1VQ5I 4ORZA 4QVZA 2CV0A 4RCBA 4HG2A 2OAZA 1TNSA 2KP6A 2VXDA 1OX8A 2ELKA 1VQ7A 2CWEA 4RTXA 4JZ4A 3U23A 1G3TA 3F8MA 4E47A 1X1AA 1I5OB 4HX7A 3G71I 1MGTA 4AVPA 4BHCA 5IY5H 4IUQA 2K9NA 4C8QD 4DZJA 4A3GJ 1FSEA 3KYDB 3EG0A 2JM9A 3BZCA 2G7HA 1D1CA 2LKSA 1MJAA 3BP8A 5F64A 5J1UA 5DDGA 5CKBA 4JZ3A 3A5ZA 5FLXZ 3CPFA 4LB5A 1AKHA 3TW7A 3RR6A 3NAUA 2M3AA 1ETOA 5HS9A 4ZZLA 1Y71A 1WH7A 2WB1A 3BPXA 1IV8A 2JPBA 1A35A 1A36A 4RAFA 4F7ZA 2QSHX 1RZ4A 3OYKA 3R6SA 2DRMA 3HRTA 5LEKA 2GA1A 1W7PD 2K9SA 1U1SA 1WJSA 1NPRA 3NTHA 3PIPA 2LY9A 2STWA 5DD4A 2DBBA 1X54A 2QXFA 4H2TA 3DLLF 2QQSA 5FKKA 3G7ZA 2QEXT 3FEOA 2MC4A 2FOKA 3ELKA 3OR1C 1U3OA 2FG0A 4CDGA 2ZFWA 4W97A 1D0XA 5KYUA 4XLAA 1VQ4T 1FPQA 2IA0A 3BJOA 4EMKA 1YBYA 2HQ5A 2IS4A 3OW2P 3I54A 2QDLA 3CC4A 1IN7A 4P73C 3JREA 4ELZC 1RAHB 1ZLMA 3RQ4A 2DK5A 2DXUA 2XPVA 3V4GA 1N6AA 2W7NA 4MDXA 1EIYA 2GOMA 2PMUA 3HP9A 1QCNA 1ZN2A 3EG2A 2V9VA 1QE0A 4V2FA 2A5WA 3RI4A 5H2FC 1YCSB 3CDIA 4FASD 5LD2C 2CP0A 2L2PA 5FU6B 1VQPI 2BY1A 3K1PA 4MTDA 3UF4A 3JTHA 1G2HA 1LFBA 2PVOB 1EQRA 4LK0F 1HC7A 1BBWA 1MW7A 3K2AA 4IOCF 3EFOA 3GYHX 1UCRA 1WDXA 2GFUA 4CSWA 1L3LA 4U87A 2GFAA 2DYBA 2ALYB 4YTLA 3LYIA 1D0YA 1EH6A 1XTDA 3M54A 3JCMQ 2YXYA 2X4HA 4JRIA 1SETA 3NEMA 3HXLA 3CP2A 2VE8A 4YIFA 1EOVA 4B6MA 3MKDA 4RGUA 2F4IA 3Q3SA 2EIKH 2E5QA 3CMEA 2X35A 1UFFA 4HOBA 3SXYA 1A6IA 3SEQA 5HCKA 2VODA 1WQ2A 1EKEA 2UXNA 2E10A 2DL4A 1Q7YU 1PRMC 3CCUT 4HDVA 4CHUA 2EFNA 1X3UA 1N8RC 3NETA 4F16A 5JFRA 3MZ8A 1UE9A 2LT4A 2X9HA 3HUGB 1VIFA 2J3MA 4M75D 3G73A 4NL3A 3L1AA 1DP3A 4V19K 2DEQA 2CQXA 3SB2A 2EB7A 4AYBA 2CU7A 4M73A 1UAAA 1FTZA 5FU6C 4YROA 3PCOB 3P9KA 1APLC 1YW8A 1OKRA 4DYRA 2E3HA 3REXA 2ME0A 4B8XA 2HXIA 1UDLA 1YHQI 1E0EA 2DL8A 2MF2A 1SF9A 3META 2X1DA 3M8JA 3JCMg 5J39A 2QA4T 5C6SA 1NJ6A 4JOMA 2XHCA 3QYFA 3LSKA 5A2QZ 1USYA 3IKMB 4QPQA 4BDYA 3HOSA 2KRMA 3DPLC 1JJCB 3HXUA 2CFOA 2DU5A 1D1AA 4WJ3M 1PUFB 1ATIA 3JCMb 5JHUA 2IBDA 4AM3A 2KMTA 1VQKQ 1WPYA 2DERA 1GXQA 2ZMEB 1U3EM 4CC3A 2VVKA 3CCEA 2QA4A 1U8RA 4EVIA 5TRDA 2A28A 5GANf 1PRLC 4QTRA 2W4SA 1X2QA 4ASNA 1Y6IA 1K73C 4G12A 1O57A 4QWQA 1FZPB 1IJWC 4J9GA 4IUPA 3F6VA 1S7EA 3DEWA 5GAMg 2XGCA 2QSFX 1GVDA 5CAIA 3T8TA 3KX2A 3SWNB 3OL3A 5JVTA 4AFSC 4E7KA 1IXDA 2QQ9A 3CJRB 1OPCA 3E7LA 2VGMA 2PN6A 1ZK8A 5CVUA 4C9YA 1Q81R 2FU4A 4Y4RA 2CYYA 3BR3A 4L9JA 4Y33A 3JRBA 2DFFA 2K85A 3IUOA 1AHDP 2M4KA 2MMPA 4BW9A 3F22A 2VBZA 2GAUA 4BY7J 1XGSA 2Y0SA 3EAEA 1HKQA 2RKHA 4XONA 2DFUA 3JB9I 2PX9A 1S7AA 1SFUA 5ICEA 1VTNC 1SFXA 3TBIA 3HSFA 1RR8C 1LEBA 1IHVA 2ED0A 3WQZA 5HLIA 2O7OA 3QYHB 2CRGA 2K40A 1NYQA 3BCBA 4TWAA 4XIDA 4LITA 3LA2A 3WTUC 2E5AA 4M78A 1LOJA 2X48A 1OZ3A 1Z9CA 1OI1A 1HSJA 3A03A 1WJEA 2RHUA 2W0ZA 3AT1B 4OVAA 5BNGA 2DLPA 2BY2A 4A4GA 4H2XB 1R1VA 4KN7X 1K6OA 1ZTRA 5KYXA 4X5OA 3F8CA 1BA5A 3S17J 4A3KJ 2AHQA 1WHUA 1D8JA 2E2HJ 4KICA 3PFYA 1FYKA 3T1BA 4CGZA 1X6OA 2KR3A 3M53A 3MEWA 4M77C 5LGTA 2IVWA 2VC1A 3T0YA 3CCUI 2D1VA 4DGWB 4HF2A 2VJJA 2EYQA 1QVPA 2H6BA 3CC2I 3CBPA 4HVWA 2DMPA 2HVRA 4BE1A 3D7SB 4P5OA 4Y91A 2WAQA 3ZQ7A 4HX8A 1HLVA 1WA7A 4CCJA 1S6LA 3JCMW 4MDWA 5CVVA 1KHIA 4BQAA 3L2WA 3CUQB 3HRSA 4KITB 2PJPA 1KC8R 2HQHA 3S93A 2VKVA 4BHPA 5EGOA 4BH9A 5EF6A 3WTVC 3FIFA 1FTTA 2MLGA 2E64A 5IH2A 2OAWA 2AKWA 2M0OA 3HFVA 2EQRA 2IY5A 1LFPA 1RUNA 3WGHA 3MQZA 1J5YA 3SWNC 1YJNT 3L09A 3WE3A 2OU2A 4QLCU 4YRTA 2KVQG 5F1JA 2LCSA 2ARTA 5FRNA 3HOZJ 3RPQA 5ICFA 4A5MA 1U9NA 4BJTA 2XGXA 1E17A 2DW4A 4XRMA 4O3MA 2QHUA 3MEYA 3ICAA 2Y0MA 3J80Z 2NUPB 2O0YA 2RHYA 2P81A 3EUHC 2XSJC 4ETSA 2IPOB 1YITT 4ZDOA 3HKSA 4BQNA 1EVKA 3TEHB 1YP5A 2JUGA 2P6TA 2R5YB 4J9EA 1NH3A 2HGCA 3GFLA 4O5VA 2E65A 4WF2A 2CGHA 1O7FA 2KRFA 4P1WA 1FBUA 1R00A 1GV2A 3IQLA 4OMFB 3JB9D 2STTA 3FDYA 1ITYA 2O5RA 4M3EA 2O9SA 4FYVB 4MNUA 2L5QA 5E3OA 1SAUA 2DA6A 5L3EA 1UUEA 4DBHA 3IG2A 2E5KA 2BW3B 5CO7A 5AT1B 5GANh 4HWSA 5IP7J 1R7JA 2R7FA 4FX0A 1KIKA 1IW7F 2AT1B 2KL4A 3K4MA 2K5FA 1KQ9A 5K5QA 2P0LA 2GGRA 1M9SA 5D5XB 4D7NA 1B72B 2HOTA 2M1BA 2HQXA 5HDNA 4M75A 4X9CA 5IT3A 2R0QC 2DF6A 3E5QA 4I76A 2L3DA 1YW7A 3RPUD 3HOWJ 4LFUA 2C0OA 2RF0A 2J3LA 3CUQA 3PQJA 2Q5IA 1U06A 5ILUA 3EUKL 2EFIA 2LJ0A 3PMTA 5GANd 3QWXX 4XORA 3HY0A 1F1ZA 4M7DC 1AWWA 3ULQB 1YI2I 2QQ8A 2R92J 4MFDA 1RAFB 3NTIA 4BXFA 4F92B 2CQ7A 1XSXA 1ZRCA 2CP6A 4I09A 3VUBA 4LVKA 1W36D 3MEVA 1A6QA 4HZFA 1FBSA 3TQNA 3MKZA 2HSEB 2HNHA 1T0FA 1U2WA 3AG2H 2DA4A 4UV8A 3BW1A 1RI0A 4J9BA 2EFPA 1KG1A 2RHSA 4YRIA 1R1UA 3OIPA 1JJ2P 3SFIA 4CA0A 1BC8C 1WQWA 2ZB9A 3WG9A 2E35A 2QCOA 5J8CA 3LSRA 3DBLB 2FYKA 4L5EA 4RB3C 4NHJA 1I5ZA 2EQUA 2FXAA 4XU0A 5TISC 2DA9A 3JCMV 3I56A 4CC4B 2WY8Q 2PMFA 3LA3A 1U5TB 1QVGS 2ZC2A 2KHMA 3K4KA 4RDUA 1SVLA 2IIMA 2EJRA 1KD1C 4M78D 1M3BA 3HRUA 4HRIA 2NXNB 2HQAA 1MBJA 4BAYA 2ZBKA 4LLGF 4C0GA 1WJFA 2L9NA 2OF7A 3A8OB 5ECAA 4WXHA 1L0WA 2LOOA 3SFZA 4E7SA 1PD1A 2CQKA 4HYEA 2EZKA 3M3YJ 5I11A 2NUZA 5HS8A 1JUPA 2QA4Q 3G1OA 3WG7H 2I4MA 4PJNA 2L02A 2DJZA 5K1XA 1RPWA 4L18B 3HXVA 1EIYB 4ANJA 4HPQA 3L2RA 1RRJA 2K3FA 1X3ZB 4HBLA 5EGOB 3H9QA 3ME9A 5CVRA 3DPUA 1YRNA 3E6DA 2EQKA 1L0OC 3G4SA 2FD5A 4MZPA 3VU3C 3VQVA 1S72Q 2MGQA 4M6XA 1ZHIA 1SANA 1W2BS 3BG6A 1YIJI 1WFXA 3F0CA 3ZQFA 2AMCB 2XIDA 2Z5UA 2DL3A 4F7UB 5HVQC 3P9CA 2Q2EA 2BEOA 2K5LA 2ZINA 3MEAA 4PHCA 4A6DA 2DAOA 2EILH 3CCSI 3EG3A 2A6TA 2IS2A 3PT9A 1TWHJ 1KK7A 5TJJA 1UJ8A 3JRFA 4J6XA 3NARA 3FZVA 1IGNA 2MWPA 3QJ6A 4RLFA 5CKEA 4C8QF 3DTKA 1B70B 4BJ6C 1VQLI 3W2AA 3QO7A 3DTEA 1TZLA 1Z21A 3KEQA 1NLOC 1WKMA 2OJ2A 3CC4I 3S16J 3LW5E 3PNVA 1Y1WJ 3WTSC 4L0ZB 1KGSA 2QQRA 4A93J 2DX1A 5IYBJ 2ZZDA 2Y69H 2QHVA 2VUMJ 1AD5A 2M0YA 3GFIA 2CT4A 1BCMA 2HZDA 5FROA 3S3OA 2YU3A 2E1MC 1VQ8I 2JNGA 3EFRA 3CF5F 1MIJA 1J2XA 5KAIC 2C0TA 1UHSA 3KYLA 4Q5WA 4FQGA 4TVAB 1TW2A 5HODA 2P5IA 1ZA2B 1XGOA 1WRJA 2KY9A 3K70C 1MMSA 1X1DA 2YSRA 2DCEA 2VPRA 4UHTA 4XLEA 4D9JA 1AU7A 3W2VA 1ACIA 4PLIA 4EPCA 1X56A 1P7JA 4JK1X 3VV0A 2QLZA 1G59A 3LWHA 4M7AF 4X1EA 3KUFA 3C94A 2K27A 2YX7A 3DLMA 3CCYA 3SHWA 1GFCA 2EGAA 2P7CB 5E18F 1XS9A 4RTZA 1CKAA 5D8LB 1YLFA 1FIAA 4E7HA 4IRIA 1X69A 2HZTA 1ZA1B 1ON2A 2YRDA 1AZEA 3QPTA 1YX5A 3F8BA 4II3A 2VC8A 2RC4A 5L8RE 2X85A 4XRSA 5KYYB 5GAN2 4NCXA 1KZHA 2LNHB 5J6XA 1PKSA 3M0TA 5JHFA 1N9RA 1DQUA 3O8GA 1M8MA 3I5SA 4HVUA 3CCRT 1TQPA 3CJNA 1YQAA 3OYCA 2R93J 1G3SA 4UY8I 2WAEA 1V1CA 2DN0A 1GUUA 5FKOA 2V1DA 3IWZA 2RQVA 3KP3A 3P5JA 4MMLA 3HFZA 3MCAB 2EINH 1NLPC 1I27A 3HPWA 1AKHB 1SMYF 2DA7A 2MSYA 2QUFA 2DYRH 4NQWA 3FIWA 1G83A 2KJCA 3DKYA 3F9KA 3V7CA 1OV3A 2BV6A 3HKZN 4KNYA 2JOYA 4M78E 2DZCA 1WHHA 3GBQA 2F5KA 4R1HA 4KUIA 4DEYA 3PTAA 4DOVA 1X2NA 1Y0UA 5B3SH 1MDMB 3VSLA 2R7OA 1DPUA 4IX7A 1NEGA 3I55I 2DL7A 1B8IA 4F55A 1KOGA 3K4CA 1OCCH 1YJWA 1OCZH 3LFUA 3X20B 2QSGX 3CCJA 4UVAA 4JPBW 1G5HA 2EIMH 5GPCA 3H92A 4LDXA 2RM4A 3LQRA 4F93B 5K7HA 1S1NA 1M1KC 1XSDA 2GTOA 4FETA 2DXTA 3HTSB 4UVBA 3GEZA 4F17A 2ED1A 1IB8A 1AOJA 2EKOA 2HU9A 4OMOA 2OTLQ 2LSOA 3KP7A 3GTMJ 4FT2A 2D8JA 2G6FX 3OSFA 3H3UA 1JU5C 1R5GA 2QKLB 4CUGA 3IKTA 2LC4A 3P8DA 1Q82U 3CCVQ 2DU9A 5C3EJ 5FLVA 3X2QH 1A5JA 1Y96A 2DPPB 1YS7A 1K9MU 4RMFA 1IG7A 4OB0B 1ZGAA 2K9MA 3OYMA 2YLBA 2KXCA 4DPGA 4EJVA 3L2CA 4ZN3A 5CCAA 5EEAA 4GBQA 2LT1A 3E3VA 2A5YB 2JRMA 2XSDC 3BG9A 3VBBA 1OCRH 4IJAA 1WX6A 2QGFB 3A8LB 1UTIA 1NJIR 3QYGB 1HBXG 2DOEA 4UUTA 1M2VA 5IXFA 3OSGA 2COBA 3M57A 3FBNB 2XPUA 3CC2Q 4AG1C 3TW6A 1RAIB 3VYSB 3I56Q 3IH4A 4OP0A 5LJ3j 1GL5A 2X4JA 2BTTA 1RACB 4CI0C 2Z1DA 4OIQF 3CCLI 4EMKB 3QIIA 1LJOA 3UDCA 3CXCS 3HHGA 1K8AR 1UZCA 5FD6A 4IIOA 2P84A 4HCKA 3CCRI 3BTLA 3GZ5A 1PDNC 1AWOA 1P4WA 3PUBA 4UV9A 3CMAQ 2LH9A 2NYSA 2DQ3A 1JI8A 1BW5A 1VQ5Q 4YRGA 4ESFA 2ID6A 2JVVA 5GAN7 1YGBA 2A08A 4XK8E 1UHWA 5KYNA 1TUDA 5J47A 3QYBA 1W66A 2PMHA 1JXMA 3RDVA 4EM0B 3IL2A 2IY5B 4BEHB 1ETYA 3KP5A 2ELJA 3LSTA 1VQ4I 2KE9A 1K9MC 2ZXFA 2C8MA 2HDCA 4A4KA 4J6YA 4HLXA 2CV1A 3CQTA 7AT1B 1G3YA 1YFRA 2O8KA 4IUTA 3LOCA 3MCZA 1JT6A 3JCMh 1NG7A 5FLMJ 5CQEA 2HOAA 2MD5A 2PMZN 2I0NA 2O01E 2ZPHB 4CS3A 2DAQA 3JRDA 1I50J 1Y56A 1TC3C 2O8XA 4C2UA 2JVGA 3G6EI 1TQMA 3DKXA 2WY7Q 2DVJA 2KK4A 3LGFA 3QDRB 3I55A 1SVMA 3BR1A 3GZNB 4HEA2 4PFPA 5F6FA 4A0YA 1ZLKA 2P0PA 2ZJPF 2W1OA 1BB9A 2GNCA 4IF4A 5EYRA 2Y9YA 1FWZA 3FXLA 4PSXA 1AWXA 1T08B 3M59A 4KBMB 9ATCB 1JKOC 4CCMA 2D1XA 1JJCA 3FKJA 3J7YJ 3NRVA 1KC8U 4M71A 1R4NB 2IPQX 4CYCA 2O3FA 1RKTA 2ZNIA 1R1TA 4P72A 2EQJA 2ZMEA 3KZYA 3U1KA 1TWBA 1H92A 4B44A 1GXPA 3I71A 4ELYC 3GFMA 2XF6A 3FXMA 4ZGJB 2AXLA 1WJCA 4DOWA 1BI2A 1K8AC 1FOKA 3E6MA 2VWFA 3M0PA 1M90U 2NS6A 1MH3A 3RJPA 3VRZA 4R55A 3GW2A 3PO2J 1U78A 3QP6A 2LYCA 4KFCA 3E9HA 4GDFA 4A6EA 2HOSA 2MWOA 3MP6A 4M4ZA 1MMNA 4JJCA 3CLOA 2FZGB 4TVRA 3TVTA 3QO5A 4WXCA 1E3HA 1G8XA 3EG9A 1NK3P 3QYEA 3VDXA 5M3FJ 5LHHA 2ZPEB 4P75C 1RUOA 2EFWA 1KMMA 5D8KB 4Y52J 3HXXA 2QQBA 4OWRB 1YIJA 2PEXA 2ZSHB 1FEXA 3G4SQ 1X1PA 4OOIA 3CCQI 5A0DA 4ENKA 3M07A 2FBHA 2QM3A 5EZGA 3GUDA 3BOQA 1I4K1 2E5ZA 4KMUX 2VASA 4OB1B 3FWEA 3DBRB 3ZOBA 4KRTA 4BGDA 4BI3A 2L2OA 1KQ1A 4G7ZF 2ZPGB 1K4US 4FYXB 3A7AA 4Z6YA 2CP2A 5D7UA 4CH5A 5HNHA 4YRSA 2A68F 5DEQA 1IHWA 1QVGA 1T38A 2P5VA 2UV1A 1NBEB 4C5IA 4KN4X 1FYMA 4M75F 1M3CA 1B34A 2M02A 3EGXA 1ZSZA 4HSRA 1TWGJ 2ZXHA 4XSXF 1W5SA 2RGVA 3ISPA 1B3QA 1AWCA 2HMAA 4L5GA 4GO1A 4TVAA 2KNBB 3I58A 5FLXE 1TTYA 2HAXA 2FPDA 2V6CA 2F48A 4IQJA 1EF4A 1HCRA 2DYSH 5K7ZA 5LJ3h 2OTJA 4CH3A 3F8FA 2FEZA 3TEHA 3MZHA 2HR3A 1VQKI 1WLPB 5FO5A 3CTAA 2M1HA 1VFCA 1E3OC 4RGSA 1GCPA 2ECZA 2CW8A 2QBYB 1UEBA 4MZMA 4OB3B 3I55T 4AMCA 2L0KA 1VQ6T 4YCUA 1EFWA 2Z9OA 4AWXB 4GGGA 4RM3A 1Q1VA 3HJEA 1X58A 1MV3A 4XU3A 3TQ7P 8AT1B 1K0XA 4OMMA 4LDWA 5DM6F 2AO9A 2HKOA 4CH4A 1FC3A 1QCOA 4BDZA 2UXXA 1R77A 2OBPA 4N9HA 3TU4K 4HNTA 3QSUA 2WBMA 3KLOA 2PLYA 3G71Q 3MEXA 4MHGA 2Q7GA 2EFQA 2ZIMA 1JO8A 2PU9B 3HTUA 4I02A 3ZRGA 4Y17A 4HNVA 1O3QA 1IAWA 1RABB 3BZ6A 5FWCA 3P8YA 2KDOA 2LQ8A 3C4SA 2XAFA 2M0CA 3ZMTA 1LE8B 2JA5J 2H27A 1IGUA 1NG2A 6PAXA 1WHJA 3SZTA 5E3NA 3CMEI 2EIFA 2OX7A 2K3BA 2AKWB 2JA8J 4M6VA 3K4BA 3PFSA 5GAN3 4A3EJ 3A8MB 2B9SA 3HGGA 1K76A 5GANe 2O31A 4KDPA 1KYWA 4K86A 3QRFF 2O9LA 4CYCB 2K2VA 2QGGA 3CCVT 3K69A 1P4AA 4TTVA 4MQVA 2YUNA 1W0UA 3WU1B 3ABMH 2K7LA 2Z2SB 2K9QA 1VUBA 3C7JA 5C4JJ 1Z7LA 2FA5A 4DZPA 2YUPA 3A98A 3BR0A 1NYFA 1ZUYA 3LWFA 3OYIA 1MDMA 2DXIA 3H8ZA 1HW5A 2RQTA 4IIMA 4F14A 3CMET 1V5FA 2A3SA 2V4JC 4XM3A 2DTOA 1WHKA 4A63B 5GAMd 2AIRB 2O88A 4YCVA 3BWGA 1UG2A 2QTXA 2JSCA 2JM8A 5GMKe 5E3MA 1YITQ 2H1LA 3H1CA 3R0AA 2JS2A 2DT7B 1BM9A 2E1NA 1T56A 2DQLA 4A3FJ 2ZO4A 2PJRA 5J26A 1VQOT 1R5HA 5LLQA 4ZTJA 4LD6A 4N4GA 2L7ZA 3G2BA 1M4ZA 1R71A 4LJZF 2DTHA 2QTVA 3KCCA 3C95A 4M77F 1MBHA 2OTJQ 1YFTA 4JUVA 2JZYA 2B86A 2HBPA 2ALYA 2IGKA 5BPIA 1YITA 4PJOB 3HXYA 2DT6A 1WI3A 2G3RA 2F2XA 1GBRA 2DQRA 2LBFB 1G2BA 5KNLA 2AK5A 4OMPA 3BQYA 1J9IA 2DA5A 3E1SA 4IVNA 5LHIA 2PI0A 5F08A 5M5YJ 2Q1ZB 2LQWA 3MN2A 1FP1D 3IHUA 3JCMX 3JRAA 2G0EA 2IG0A 1LE8A 1OU9A 2XI9A 3DU6A 5D5UB 1GBQA 3KFVA 2XROA 1EFNA 5F1RA 3WODF 2XK0A 2BZTA 4P71A 2W82A 4KGXB 2PUOB 4PJOC 1MD0A 5E3LA 4G7OF 4WJ4A 3LLRA 2MH9A 2WAFA 3QU6A 5GAN8 1S29A 3CBMA 1OCOH 1UB9A 2YUSA 3CD6A 1NJIU 2KGTA 4HNUA 1FSHA 4KT5C 2O9VA 2V9KA 4N0AC 4C0DB 2BGCA 3MAJA 5B5EC 2PBIA 5L3CA 1QW1A 2C7IA 1Y0NA 4AIHA 3I9V2 2O4XA 3GF5A 1VQMT 4G84A 3ZMVA 2CW0F 4I7HA 3JW4A 3CCVI 2K3XA 4M7AE 1M2VB 4AVZA 2J5OA 2Z3YA 1JTXA 4TVYA 2R5AA 3FM3A 2K4BA 4LD5A 1QHGA 1X43A 4N9IA 3CCQT 1XMXA 1SD5A 1Q7YC 2VYTA 3I64A 2H8HA 1HKSA 2FX0A 4EGZA 4ZTFA 1DU6A 3M0SA 5B66C 5LEJA 1J09A 2HYJA 2IXSA 3T5XA 2FRYA 1P7IA 2MOXA 5D6XA 1BJAA 3HYIA 4U7BA 2A3LA 4AFZC 1PYSB 2R7XA 4H2YA 2DETA 4OMYA 2BE5F 2WC2A 2HL5C 1FMWA 4L5JA 5HLTA 2LF7A 1BC7C 1LCKA 4D5FA 2JTMA 3N5BB 1RLQC 5L3BA 3FLGA 2XASA 2QASA 2HEOA 2YDLA 4KUMA 3HRIA 2CS3A 4LG0A 2YU9J 2L3RA 3QKJA 1E2XA 1BN5A 4OIRF 1JQQA 2KIUA 1RI7A 1K73R 2ECCA 3D0SA 4YIRX 2XIGA 1AWJA 1HXDA 3H3ZA 2RNAA 1VQKT 4M77G 3U9GA 4S0HB 2LK2A 3OMYA 2HL3A 1NJ1A 1Y0MA 1CF7B 1NYGA 4X34A 2DEUA 2RQWA 3W6JB 1Z91A 1RKWA 2ZGWA 1U5SA 2A37A 2RB6A 2KXDA 3CCJQ 1MGQA 2HD0A 3DFGA 4P55A 5KCOA 1J0RA 3E5UA 4M7DG 4RGXA 3H5RA 4M78B 3IC7A 1IN8A 4NC6A 2RJDA 1USTA 3G6ET 3NEUA 4CXFA 2DK8A 1V55H 2F5FA 3O8VA 2K2MA 3URGA 4J6WA 1JHFA 1ZYRF 2RQUA 4BEHA 4CZCA 4RTYA 2FQ4A 4XLNF 4QQ6A 4Z2YA 1GRIA 3EDPA 4X6AJ 2JT4A 2QDYB 1OR7A 1HKTA 1V5EA 4J9DA 5GAN5 3OB9A 3CPWA 1G4DA 5FWBA 3SJMA 1YE9A 3JAMZ 3DV8A 3F70A 4C92D 3MZYA 1QLYA 1HTTA 2ZT6A 3SZGA 1IN4A 3X24B 1HW1A 3CCUQ 4ESBA 2FHDA 3V8LA 1M2OA 2CJAA 5E1XA 3MF1A 4C5GA 5E17F 4WTOB 2XRLA 3BDLA 2AQFA 4M6YA 2I4OA 1OMIA 4H0EA 4HDUA 1H8KA 4C0FA 1I3AA 1R22A 1YIJQ 4YPFA 3M9QA 3J80K 4AU7A 2DFIA 2P0WA 2JT1A 4P74A 2ROTA 2ELHA 4ZTUB 4LVLA 3HKZA 3G1ZA 2VJIA 2MFZA 1MMDA 5DS9A 1O75A 3L7WA 4LG0B 3I5RA 2MD0A 2NS7A 4JX5A 1S8NA 4EM1A 1IDZA 4XTYA 1QGPA 2F5VA 3JB9H 1TS9A 1EV7A 2VOOA 3G1JA 3K6GA 2IA2A 1VQZA 1KFZA 4J15A 1OLTA 5FU7C 4ENJA 2FSWA 4RB1A 5M5WJ 4HCZA 3CCMT 3CMMA 2ID3A 3VS2A 2J6KA 3FK6A 4KIBA 3HXWA 1QZZA 2HOEA 3VQWA 2BKDN 4A69C 3CCMA 3HL8A 1VQ8Q 4ZC3A 3CXCP 2J05A 1IN6A 5LJ5h 1B7TA 4OMZA 2XKOC 1NG6A 2H94A 2L54A 4J9IA 1ORKA 4QQDA 3ZMSA 1KU7A 2ME6A 3LX7A 3Q9VA 1ZR4A 2XICA 3X25B 3RBBB 4LIUA 1HD3A 4OMNA 4A12A 4AG2C 1HJDA 1X55A 2B63J 4XTUA 1K4TA 5GAOq 2A6EF 1BJZA 4A3BJ 4WX9A 4OINF 3DB4A 2DOAA 2HEQA 1N77A 1H9TA 4AFQC 4D6WA 4NNJA 2O61A 3PVQA 1H89C 4NS5A 3QNEA 1C6VX 1Q81C 3AG4H 5EC7A 1VQLT 4V2GA 4B48A 2R5ZA 1ZGWA 3ASOH 1I1SA 2JN0A 2K4YA 3M4PA 2L3PA 5E3IA 2X4YA 5GAMh 4JP0A 2FMLA 2D5VA 4A53A 2EV6A 3C2GA 4PKCC 2F5CA 1OJLA 2HTJA 2JS0A 4N4HA 4CC7A 1OCTC 2K3PA 4J8OA 1YJNQ 2P0QA 2OZUA 3WGGA 1BU1A 1RAAB 1ZSZB 2L0AA 5H20A 4J7FA 1TBXA 1SPKA 3G6EA 3M5AA 4TQFA 1WSUA 4C92A 4BWAA 2V1NA 1QVFA 3TO6A 4PJLA 3MKYB 2FUG2 3OYDA 2O6GE 2XB0X 1AZGB 1WQ7A 4PJOD 2RHXA 5IAYA 2VB6A 2P6SA 4B1RA 1ZKGA 3QQAA 4F52A 4ENMA 3FXKA 1KQ8A 1W70A 2VV5A 3ESWB 3VYTB 2YUOA 3ZN0A 4EM2A 3NQOA 2DTZA 1K7AA 1BI3A 4UXNA 2EH3A 4LOCA 2GCXA 3M0QA 1WXBA 3QXEB 5CQGA 3ECHA 4TV7A 3HSBA 3CCSA 1B4AA 1H3HA 2LMDA 1N9SA 2LG4A 1ZREA 2EPDA 1UB4A 2EGCA 2EKHA 3MPUB 5F27A 3JCMc 1D5YA 1QPMA 3OY9A 1Y57A 4UNOA 3CLQA 2MAMA 1C1AA 1UELB 3U1DA 2XDPA 4A54A 1EJ9A 2E70A 3VS7A 3LSSA 2IJLA 1N8RU 4IHSA 5B1BH 2R58A 1M1KR 4KR2A 1OOTA 4YEJA 4S04A 5M5XJ 3NFCA 5GAEJ 1T0JA 3VS6A 4HWOA 4VUBA 4MLOA 1IXRC 3TDUC 2KEAA 3I0TA 4IUUA 1WPKA 2XGDA 4NL2A 3VS5A 1SESA 1IZ1A 1VYTA 2FPEA 2RI5A 3LC0A 3PE0A 2PFBA 4WK8F 1JGSA 5DLOA 1JJ2S 1TTHB 2ZR2A 2YUQA 3HRMA 2DFEA 2UUZA 1T95A 1T8IA 2KFDA 2CSIA 1BW6A 2V1RA 3UWNA 2ISYA 4EMKC 3FXQA 1S72I 4JRKA 2ESWA 2RH2A 2Y90A 4MZTA 3ZBDA 3QTCA 4BACA 2A07F 1DUXC 5GAOn 4PJJA 3M1CA 4XLFA 3RKWA 1VQNT 2CJJA 3AL0C 4LDYA 2H8WA 4FYWB 4ZGDB 3RQIA 2JA6J 2QWWA 2IRFG 2ABLA 4YRQA 4XKCA 1QVTA 4B47A 1W1WE 5AIPA 1H3ZA 4A3LJ 2K86A 4CZZA 5E79C 1X27A 3IAM2 1RL2A 4RB0A 3UATA 4Z89A 5KYWB 1MKMA 3H0FA 4G85A 1M1GA 3TO9A 3CXCA 4H2VA 3K4JA 1V76A 3JRIA 4HWRA 3WTXC 2RO0A 4UPAA 2LJ1A 1SERA 1QVFP 1OYIA 1SFEA 5ILSA 2BVMA 1ZG5A 2KDSA 2XHKA 3W6VA 1OQYA 4YFKF 4XICA 1KSWA 2COZA 2CT3A 4GY5A 4JLGA 4IHXA 4Z88A 4PJOG 2ZT8A 3FMSA 1N75A 4M7AA 3K4LA 4Q5SF 2E1HA 2K5IA 4Y7NJ 3S6WA 4DA4A 2BY3A 2IAIA 3M4YA 4XQ3A 2H6CA 1QA6A 1PVEA 1JUMA 1XTAA 1K78A 3ZN1A 2HBWA 2IT0A 3OMGA 3TDZC 4H2SA 4EDUA 2DJQA 1KHCA 2HQEA 1UMQA 4CS4A 2Q0OA 1VI0A 1HYOA 4GYIA 2XKPA 5L3GA 1BIBA 3BJ6A 4JBAA 5EZHA 5GAOp 1FY7A 1G5VA 1U9OA 2EZIA 2GA2A 3M4GA 1REPC 4IKFA 3KP4A 3DKWA 3BLYA 4DYQA 1SAXA 4HVCA 1SEUA 5KYXB 3QO8A 4C8QA 4IOAF 1HA8A 5BS6A 4LD9K 4B09A 2FMYA 1XQHA 3CCQA 3GLLA 4EGYA 4EV0A 2W85A 5EEGA 4D5CA 4MIMA 3E0JB 4LE9A 4PGHA 4PCQA 2IW5A 2X0LA 3K4NA 1D09B 2MCNA 3RZDJ 2MH2A 1YX3A 1QQIA 1CQTA 1WWXA 3UT1A 3P7NA 4C3HJ 2F2WA 2K3YA 4L59A 5KYWA 2JMAA 1IF1A 1LDJA 1RESA 2LC2A 2XAUA 4BKXA 4NQWB 4YRVA 4AIJA 4C30A 2I10A 3AG3H 4BXUA 3RZOJ 1OPKA 4BL0B 2VONA 1V29B 4ZNXA 5D6YA 3CC4T 2WV0A 3FDRA 3SDBA 4C2TA 3PVLA 3TUPA 2K5CA 4HA8A 5DUIA 2GBYA 1OYYA 2VI6A 2XB5A 1YYVA 5D6EA 1U5TA 3JCMd 4HSTA 4XKWA 3S3MA 3BY7A 3GO5A 1R36A 3QZ5B 2C6YA 4M77E 4XNFA 2NAZA 2OAUA 2LD5A 6AT1B 2QVOA 1TLHB 1ETQA 3LMMA 2EPFA 5LJ5d 2KLOA 1ENHA 4ZYHA 5DLQE 5GTHC 3U21A 1FP2A 5GAHJ 1TG0A 1WJRA 2RNJA 4M3BA 5KE3A 1POGA 5J3BA 5L23A 2MK5A 2AZVA 3KE2A 3H5NA 1PM3A 3OMCA 2XAJA 3EGDA 5HK0A 2V8KA 3CC7Q 1QU3A 1VQMA 2BXZA 2IGOA 2KQRA 3GF2A 3OV8A 5KVRA 1YRNB 3VWBA 2CP5A 2M8GX 5D5WB 2CH4A 4QIWN 3B6CA 3VFZA 5CVIA 2LCLA 4U0VA 2ZZFA 3CF2A 1M27C 4IO9F 4C92G 3JB9G 2MA3A 4PJMA 2PUKB 2RHZA 4GLKA 3K9TA 1IRFA 1YJWI 2R7QA 1QMCA 2HDAA 2CUZA 3P8HA 5I2SA 2DDAA 5FRMA 1ETVA 2X6YA 2XVCA 3ROUA 2LDMA 4RKUE 4G94A 4G6DA 4F3QA 2Y0SN 3A7UA 4YRLA 1LUJB 1MNDA 2BE9B 2LF8A 4PUSA 4M7AG 3P8VA 2DI3A 1FBQA 3BC8A 1Q82R 2HZYA 3PNWC 4HKEA 3VS4A 2V7FA 1DU0A 3KIOA 4E51A 5DCMB 1PP8F 1SG5A 2IEKA 4I0BA 1Y7XA 2DXCA 2HVQA 3M8FA 3P9IA 2ROLA 2ZCEA 4KMFA 4TVWA 3ZQCA 5LGUA 1C0AA 2TDXA 2P4WA 5IT9Z 2AKLA 1GLNA 3MKWB 4QVCA 1B1BA 2A6HF 2ZJ2A 2R7UA 2VJ4A 2MABA 2TCTA 3QPHA 1IRGA 3IRQA 3BPVA 4FT8A 3CMAI 2RD1A 2HYGD 4LLLA 1GV5A 3H5AA 1JXOA 4LNPA 4YYEA 3DF8A 3SWNA 3EYYA 1UECA 2EW3A 2RI3A 4ZN1A 1YI2T 1B6AA 3RESA 2L7KA 2XC7A 3CCET 3HGYA 4C92C 2DFHA 3DWLE 1STZA 3CDLA 3LFKA 4W1UA 3VSKA 2ZXWH 1E7OA 1UGSB 1FMVA 2FVUA 3AAFA 3OW2A 3ZQIA 3AHUA 2DO3A 11ASA 3EUHA 3ZMZA 1ZRDA 4HX4A 4II2A 2C0IA 3TEEA 2ZPBB 3REAB 3AG1H 2PQ8A 3LQQA 4XLHA 3REOA 2R7SA 2AKKA 5BQTA 4B3XA 1IRZA 1W6XA 3BR2A 1K6YA 2WSFE 1QVFS 2VQGA 3L9FA 2FRWA 4BB7A 1TL8A 2K4JA 1UHCA 4P3OA 3FKIJ 1MSEC 1VQOI 2L8DA 2RDPA 1SRMA 3A8GB 2JUCA 3VKIA 3Q9SA 1YJNA 4ZDPA 2DXBA 3OYJA 2EAYA 4LGWA 1WLEA 4MEYF 4M3GA 2BXYA 4I2OA 1XCBA 3H0GJ 4A4EA 3G6EQ 1SSFA 1Q86U 3R60A 1TXQA 4CH7A 3HSRA 1OQKA 2DQ0A 3OR2C 3RKYA 3RGLA 1NTCA 1K79A 1XOVA 1ARKA 2D1HA 2NVQJ 2DMQA 1E6HA 2BHYA 2VJ5A 2NOJB 3CCMI 1QVUA 3HB9A 4PJ0C 4IRGA 5IPAA 4MEXF 4M75C 3RMQA 2JW4A 4RGRA 2A69F 1N9WA 4OGCA 1VQPT 1VOMA 2I2LA 3I53A 1TP4A 3PUFA 1GCQA 3OBWA 3ZL7C 3OYGA 1ODDA 5GPAA 3H9NA 3CCSQ 2NUPA 4YIIA 2BZYA 3E19A 2KT0A 2B7EA 5M9OA 4M7DA 4OMLA 2L9SA 3ABLH 1JT0A 2FZCB 4HT9A 1YJNI 3PNYA 1YCYA 3NELA 2ZPIB 4JJBA 3GIBA 1SC7A 2RJFA 5GP9A 1M1FA 2P4TA 1F43A 2FJ1A 3A74A 2X6OA 2Y2ZA 3EFOB 4M77D 2VXEA 3BG7A 5J1YA 2HKNA 4KUDK 1YFSA 2M0MA 3OYHA 1E1OA 3Q0UA 2X4WA 5ED4A 3OIOA 3WU2C 1AT1B 1BCOA 3JRZA 1PNJA 3CCQQ 4BU2A 1G3WA 1XGNA 4HAMA 1N25A 4D7MA 1MNMC 1Y96B 3RPUA 2W84A 2DIQA 4GLMA 2M34A 3T9NA 1Q86C 1VQ8A 3HXZA 1Y1VJ 2KZVA 2DO7A 1TT5B 1AVZC 3PIPF 4EO4A 2ODRD 4RBOA 3DB3A 4RTVA 3FX3A 3S2WA 4UUSA 4D8KA 5J40A 3BR6A 4XQFA 4NDLA 2CMPA 4KIGA 3HM5A 4PL6A 2OCCH 2IA1A 1GXIE 3GMEA 2X6XA 5DUKA 1JKPC 1WHGA 3FBIB 2VOPA 5IN1A 3KLNA 1ETKA 2F5TX 2CW7A 2MI6A 3EHQA 1FNNA 4XTZA 4LNSA 3D5RC 4A3CJ 3I9QA 2Z33A 4KIFA 4FSXA 3HPHA 1D1BA 1BR2A 3RUXA 2R7DA 2XF7A 1MJ9A 5GADJ 1VYUA 3NWSA 1N8RR 1F4KA 5C4XJ 3CC2A 2FOWA 2OA4A 3H0DA 3J81K 5C44J 3GXOA 3ERED 5E1WA 2R7ZJ 3M0RA 1BYMA 2P8TA 3KPHA 3ZXSA 3WTTC 1OULA 1R23A 3QPSA 3GTPJ 3G1LA 2E34A 4BI8B 4R0KA 3NTKA 2DA2A 1LB2A 3QU3A 2RAEA 1ERDA 5DM7F 1I07A 1S7OA 4P9FA 2DE0X 3MJXA 2VIXA 1NM7A 4LIVA 1ZG1A 1PHTA 2R5MA 1OISA 2KKOA 1VQ5A 2ZZEA 1UHMA 3HOUJ 1S72A 2DYIA 1OX9A 2EGEA 2LNVA 3LSPA 4E7ZA 4OU0A 3HL2A 2JZ2A 4C8QE 3REUA 5I2MA 3SQNA 2YWWA 2MW8A 2RHSB 5LJ5j 2LVSA 5KCHA 5D6FA 2JJ9A 4C3IJ 2L9VA 1I39A 2XAQA 1YOVB 3RKXA 5JVGF 1ZBJA 4KULA 2Y9ZA 2PG4A 5ERIA 1IRXA 3A2KA 4XU2A 3OS2A 5DM7R 3CMEQ 2XTIA 5J4YA 3OYAA 3ZFJA 2A36A 4M7AB 1EZZB 5BPDA 2NWMA 4HF1A 4LLNA 1BK2A 2NLUA 1YHQT 2L3QA 2LVMA 4YP0A 1T6SA 2GXAA 1OPLA 2PMZA 1WHLA 2ESHA 3JRGA 3GTQJ 4AC0A 1TSFA 3IKLA 2M7AA 1ZR2A 3VYUB 2VUBA 1BKBA 4AT1B 3QPLA 2NNNA 2NVYJ 4HQMA 5E8IA 3TGNA 1BOAA 4YREA 1XMKA 3ZMDA 2MG4A 2M30A 2V26A 3JRCA 1LDDA 1F9NA 1YTYA 1DDNA 2DM1A 2DD5A 2F69A 5LJ3g 4LVMA 5K5RA 3QWYA 2BOLA 1IO2A 3A4CA 4BBRJ 4CS2A 2JN6A 3JAMK 3ZQHA 1J7KA 1PYVA 3E9GA 1I6XA 3S3NA 1S5LC 2D0QB 1QWFA 4J00A 1TUGB 3EGUA 3EPZA 5IOZA 1VQ9Q 4HT8A 1QF6A