3V8JA

Crystal structure of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
306
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin ligase
total genus 98
structure length 306
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8jA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8jA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8jA02
4L9JA 3T0YA 5DYMA 2ODRC 2JN0A 4WXDA 2V1XA 5GAN3 3JB9I 2C8MA 5K5RA 2QLZA 3U9GA 4ESFA 3FMQA 3PFIA 3TO9A 1DPRA 1EV7A 4P96A 4BXUA 1YFSA 2I4OA 5D4RA 2A69F 3SHFA 3HUGA 1Z05A 4F7UG 4F7UA 1TW3A 1M5Q1 2PQ8A 4RGRA 5GMKe 1UCRA 4BYYA 4XTVA 4YRIA 4H2XB 4XSXF 4XTZA 3DEUA 4RGXA 2P7VB 1ZH5A 2KIFA 4HF2A 5H6RA 5LHGA 4YRSA 4CGZA 2FA5A 1FYLA 4XBFA 1SETA 4YREA 5AIPA 5GMKm 4CH5A 1ASYA 2LNBA 1TQPA 2Z5UA 3MQ0A 3ELKA 4M7AC 2ZNIA 2AS5F 4I0BA 2Q7EA 2Z9OA 3WQZA 4K88A 2RQPA 4P3PA 2GWRA 2ESHA 4G85A 1SFEA 5LJ3e 1B9NA 1FBUA 1V3FA 4O3MA 1ZN2A 5AIQA 4M75F 5AONA 4OINF 4EGZA 1B59A 2E10A 4HA8A 1H4VB 2QM3A 3KP2A 1R1UA 1BI3A 3OV8A 3FJPA 5KNNA 3PCOA 4RGSA 2ZZEA 3KFUA 1NJ6A 1QZYA 4HDUA 4LLNA 3HSRA 2RN7A 2DBBA 3CO6C 2L02A 4MTEA 1CF7A 4CH4A 1XD7A 1L0WA 1X01A 3WODF 1MJ9A 1R5GA 1T39A 5CAIA 4CICA 1E1TA 2FOKA 1O3RA 4KQEA 3L09A 4L9TA 1YB3A 4YCUA 1N9RA 4HW0A 1QGPA 3ZMVA 1I1SA 1FPQA 3ERED 4N0AC 2ZIOA 3FXRA 1X3UA 3ERRA 5LGTA 4M7AB 1I6XA 1E1OA 3AHUA 4J6WA 2QTXA 1NYRA 1O3QA 3VB2A 4UNOA 3HFNA 1S29A 4C92B 3IKLA 2Q7GA 2FU4A 1QPMA 2JZYA 4PJOF 2EA4A 3EFRA 4P75C 5HLIA 4EM0B 2RHSA 1VQZA 4O5VA 2W25A 3NENA 2QENA 2HQNA 2OU2A 4UP8A 3HFVA 1KQ8A 4H2XA 3E9IA 2D2WA 3KP5A 3RF1A 3HY0A 3AAFA 5L3FA 1B6AA 3E6BA 3SXYA 1IUYA 2NNYA 2VN2A 4HWOA 2M1BA 1W5TA 1R5HA 1N9WA 2VT2A 1YFHA 2CSOA 3FF5A 4WX9A 5A2QK 2XRNA 2FBKA 2F5FA 2E1NA 1W7PB 5L3BA 3KETA 4YRLA 2EWNA 5LJ3j 3FB9A 2YX4A 5GAOm 2E1HA 5J8CA 4RB0A 1U5TC 3MEXA 4M9XA 1A04A 5BQTA 4U0VA 5J8FA 1B8AA 3LSQA 1IN7A 5TRDA 1PP8F 4XEMA 3I7FA 4HX4A 2ALYA 1IN4A 3HRTA 5HGQA 3JSOA 1ATIA 1I1GA 2VBWA 3WG9A 1K78A 3GFIA 1PYSA 2QHSA 2ZZGA 3QAHA 2I2LA 4LK1F 4M7DD 1USSA 3HXZA 3KZYA 1XB4A 4Q47A 4HT9A 2XKPA 3L1AA 3SWNA 2DVEA 4M77A 1XGOA 5BMZA 5CVVA 3DV8A 2KIMA 1I5LA 1J75A 4PJOA 1ZAOA 2AXLA 3IHUA 1FSEA 2A6HF 1HK9A 4LG0B 5H20A 2H27A 2J3MA 1BIBA 3BJUA 1ZARA 1PP7U 1FP1D 4U88A 2W85A 4O6JA 3IALA 1J7KA 2ZO4A 4EMKA 2IT0A 3R0AA 4LJZF 1GXPA 3IC7A 4I0AA 3ISPA 2HEOA 5EEGA 1FNNA 3MFKA 2STTA 3TEHA 1DP7P 1JGSA 4Q5SF 4M77F 1S6LA 1MJBA 3K1PA 1YO5C 2DXTA 1XDSA 3INZA 4QVCA 1BOAA 1IN5A 1TNTA 2P0LA 2K7LA 4KDPA 2RHSB 3D5LA 2I4LA 4H2YA 5D4SA 3K1MA 3D0SA 3FWEA 1MD0A 4KIBA 4IPAA 4JK1X 1IXSB 2KJBA 1O3TA 1IXRC 4YG2F 2YLCA 4M7DC 3KCCA 4UV8A 4A0XA 1D3BB 3P8VA 1R23A 1X55A 1ZRCA 3B02A 4C8QC 2Y0MA 2VBZA 2KKOA 4GO1A 5DD4A 3R4KA 1USTA 3WTZA 4RCCA 1P4AA 4ENNA 4EX5A 4M75A 4UVAA 4TQFA 4KR3A 5CYVA 4JRIA 1MGQA 2JPBA 1WYDA 3OOPA 2JT1A 3CDHA 5JI6A 5JR3A 4GYIA 1NJ1A 4MNUA 3B73A 1S8NA 2ZT6A 1R1TA 5DEQA 1K79A 2D45A 2FE3A 1I8FA 2IVMA 3BJOA 3WTWC 3RI4A 5D6FA 2HFHA 3E9HA 3GXOA 5F1RA 1BBYA 3JB9J 3HTUA 1H4SA 5FLXK 4CZZA 2HYFA 3SQNA 5E3IA 5FD6A 1ON1A 1SFUA 2PFBA 1ZLJA 2P7CB 1MGTA 2EL9A 2VODA 4WJ4A 2P5KA 4EMKB 5LJ5e 2P5IA 3BW1A 4MQVA 3M9AA 2A61A 2WC2A 2VC8A 4U7DA 3QU3A 3IRQA 1UHWA 1OMIA 3CUQA 4A0ZA 3VOEA 2B0LA 2A3SA 3GUDA 1YW8A 4LK0F 2E3CA 2XROA 1B70A 2LSOA 4HF1A 2GIVA 2O8XA 5D6EA 2CGPA 3KEOA 3NEMA 3VODA 4PGGA 3TO7A 4IF4A 3HRKA 3GO5A 4KN7X 3LWFA 4I02A 4N0AA 2XUBA 4EO4A 2DU9A 2G4CA 3LC0A 2D1VA 5LJ3f 1Z7MA 2W84A 1U5TA 1FLIA 4M7DE 2DZCA 3HXYA 1USYA 4KN4X 2DTIA 4YFKF 4P9FA 3MF1A 5LGNA 2K4BA 2FBHA 2YSRA 3WTXC 2GA1A 4EVIA 4N9HA 3F6VA 2QHTA 3C7JA 4A5NA 2ZNJA 3RKXA 1WI9A 1BC8C 3UFGA 3SZPA 2Q5IA 1OR7A 4MGRA 2A6EF 6PAXA 1KQ9A 2E64A 1ADYA 2JPCA 2GQQA 3F3XA 4IVNA 3L4GA 1J0RA 4PJOD 4QLCU 1Z6TA 3JB9H 5F5WA 1K7AA 1WKMA 4AH6A 2DFIA 3PQKA 4A5MA 4EM2A 3FIFA 2ZMEB 2VE9A 1U6GA 2VE8A 3JSPA 3A31A 1R7JA 1ONVA 4HX7A 3KZZA 1OYYA 1NHAA 5D8LB 5L3EA 4M75C 3IWZA 1M8VA 2HOEA 3F72A 3KLOA 3LA3A 3E5QA 4H2UA 1LEAA 3JCMV 1WU7A 1IXCA 2EV0A 2EFWA 3RESA 2ZCEA 1Z1DA 4YPFA 1EIYB 3RKYA 5HOOA 5ED4A 5HLGA 2RDPA 2FSWA 4M7AF 4CH3A 2EJGA 1XDUA 4TQDA 5KVRA 2ESNA 5LHIA 4JLIA 2XAHA 1BI1A 4UXNA 3PQJA 5LRSA 4R1HA 1SD6A 4ESJA 1LNWA 3J80Z 1ZG3A 4MMKA 5E1ZB 2CQKA 4C8QB 3M8FA 3MAJA 5GAN4 2FB7A 2ZT7A 2ZXJA 3I71A 3VQYA 2JRTA 3OD1A 3M8EA 1UFMA 5ELNA 4R79A 1FP2A 4WXCA 1YFRA 4OU0A 5ICEA 1YQAA 2QYOA 1LDKB 1RNLA 1HXDA 5LGUA 2UZKA 3V8KA 4L87A 2MC3A 2GAUA 2XASA 1LEBA 3CJNA 1SERA 1ON2A 1SMTA 4RMFA 5DUIA 3F21A 1TQIA 2P6TA 1U1SA 2V9VA 4MMLA 5FFXA 1MZBA 2G7HA 4A6EA 5C53B 1MDMB 1YIOA 4HQEA 1J2XA 2HKOA 2HZTA 4TVAB 3KP3A 1P92A 1H4TA 5C52B 4OMYA 3F8BA 4HAMA 1NJ5A 3JCMX 2EJRA 2HTSA 1FY7A 4C92A 2UXXA 2VC1A 5TJJA 4P73A 4YRPA 5GAOq 2VC0A 3E6MA 1YW9A 3A7AA 4RDXA 1H9TA 2P6SA 2DK8A 2PMHA 4YRGA 2I4MA 3HSEA 4XTWA 3Q9SA 5HVQC 2O0YA 5D5UB 5ILUA 1V4RA 1ZRDA 4YP0A 3E6DA 4A54A 4M75B 4NHJA 3V8JA 5A2QZ 2A07F 3K1NA 1R22A 1XN7A 2HKXA 3H3UA 1P2FA 3ML6A 1QBJA 4HV5A 2G9WA 1LB2A 4Y91A 4P9UA 2LDUA 1X56A 3KFWX 2ZNYA 1HSJA 4EJUA 2FEZA 3E5XA 1ADJA 2L4AA 1RIQA 2H94A 4LG0A 3G73A 2J5OA 2XVCA 4B8XA 1QF6A 4WK8F 1QQIA 4P75A 4P5OA 4UHTA 5IT9Z 2FRHA 3GFMA 3TQNA 3G3ZA 2DZ9A 3O3KA 3JB9D 1IW7F 2ZJ2A 1DPUA 3K9TA 3BFMA 2BEOA 4KIFA 1ODDA 5DD8A 1IAWA 2MD5A 3HIFA 3J81K 3TDZC 3P8YA 4CS4A 3MWMA 4XTYA 2PEXA 4PJOG 2RVCA 1OPCA 2IA1A 2VT3A 1KQ0A 4JUVA 3QO5A 3RJPA 1I5ZA 4TTVA 3TEHB 4A2UA 5HS9A 1GVJA 4CH6A 1YFTA 5DCFA 2RHQA 3GWZA 1OYIA 5FB2A 1LOJA 3GVAA 4ZZLA 3J7AO 3TDUC 1OKRA 4WJ3M 1C0WA 4P72A 1J5YA 4PG3A 1U5TB 2LKPA 3L2CA 3HXXA 4M7DF 1VTNC 1JJCA 1JJCB 2EJFA 3I54A 3T8RA 4HOBA 5DCMA 3PZCA 3I59A 2DQLA 3FM5A 3LFKA 4XLNF 3JCMJ 1USYC 4KFCA 5DUKA 2Q8KA 5LJ3g 2Y75A 4BHBA 3F8NA 3VU3C 4HBLA 3T5XA 2BYVE 3ABUA 1H0MA 4WXHA 4MQ9F 4M75D 1HKSA 2K4JA 2RA2A 3EUHA 3N97A 3LAPA 5HS8A 4P73C 4L5JA 1WNLA 3HHHA 3WTSC 1JXSA 2M5WA 4KA4A 3JAMK 1HC7A 4CXFA 3QNEA 1E2XA 1IN8A 2NAZA 4X5OA 3K2ZA 3C1DA 1IF1A 5JHUA 4C92E 1B76A 3P8TA 5FGMA 2COMA 2NS0A 4MEYF 3MZYA 2BE5F 4M7AE 1D8JA 3F6OA 4RQFA 3HSFA 1LNXA 2C7IA 1FOKA 2CJ9A 3ZP5A 3A7UA 1G4DA 3WGIA 3RYRA 4KMUX 2EFQA 3RACA 4A0YA 1HKQA 3T1BA 2VXZA 3I58A 4AIJA 4WI1A 3U2RA 2IY5A 3QPHA 1KYZA 2ZT5A 3QPTA 4H0EA 3FMRA 3REXA 2IW5A 3GEZA 4G6QA 2ZTGA 4M75E 3DXJF 3FHZA 5LJ5d 2E1CA 1HTTA 3HTZA 1MKMA 2JSCA 3M4PA 3HFZB 1EH8A 4TVYA 3MZHA 3ZMUA 2BGCA 4IXAA 2QQ9A 2V1DA 4F7ZA 1S7AA 5DV5A 4C8QA 1HQCA 2RKHA 2Q0OA 2UXNA 3F22A 5K5OA 4C8QD 3ZMDA 2DK5A 4M7DA 5J6XA 1LQ1A 2OAZA 2OZ6A 3C3WA 5CJ9A 1FBSA 2ZFWA 1BM9A 5ICFA 1G5IA 4C8QG 4NOYA 2ISYA 1EVKA 4ZZDA 2DXUA 2LF7A 1QO0D 4H2SA 2KRFA 4ZIBA 2M87A 3GZ6A 2RNJA 4EMGA 5GANh 1W4MA 4XQ3A 3HFOA 3VBBA 1U1TA 4N9IA 3HXWA 4Y17A 1B7YA 3CO7C 4M78A 1S3JA 1ZREA 1YS7A 3ROUA 2ZMEA 2J5PA 5LEJA 2VXFA 5E17F 3REUA 3VEPA 4S05A 4G6DA 2FYKA 4EM1A 2DI3A 3HRIA 2WWYA 4JBAA 4H2WA 3UH0A 1XSDA 4HV6A 3DSQA 4NL2A 2CYYA 3HRUA 5E1XA 3V7RA 5GMKh 2ODRD 4EMHA 5E1WA 2XV4S 3LSTA 1BI2A 1T6SA 4ENKA 1G3SA 3GFLA 5GAOr 4KUMA 1QNTA 1WQ7A 2BV6A 3LSSA 3FXUA 3R61A 2F5EA 1E22A 3U1DA 1KMMA 1MDMA 4IHTA 4CO8A 2EFPA 1EOVA 3BWGA 3CMQA 3E6CC 3HSBA 4E70A 5ILSA 1W66A 5ELOA 3NEUA 4H2VA 4HWTA 2L3DA 4K2EA 3RPQA 3JB9F 3QSUA 4V2SA 3QO8A 1FWZA 2F2EA 2FMLA 3G1ZA 5GAMe 3DPTA 4D0PA 4M7DG 1D5VA 2O6GE 4ZYGA 3EETA 1CF7B 2MBFA 1TNSA 1WQ2A 4OOIA 1XMAA 4CS3A 4RCBA 5C51B 1DDNA 4M7AD 1Q1HA 4ZYDA 3VQXA 4HZFA 4BAYA 2XIGA 4RB3C 4YRQA 3WGHA 1H4QA 4M73A 1EQRA 3PGGA 4KNYA 2V1UA 1ZHFA 2QHVA 5GANe 3EYIA 2GZWA 1U2WA 1ZG5A 2VBXA 4ZTZB 4U7BA 5H6QA 1B70B 4M77E 3EDPA 2AKWA 1LJ9A 4RGUA 5LBQA 1J9IA 4CYDA 1O57A 3L9FA 4EV0A 4YCWA 2GXBA 2GA2A 3GIBA 5GANg 2E5AA 4ZYEA 5K1YA 2HDCA 4L9NA 4PZJA 3QO3A 2GXGA 2RGVA 1QE0A 4HLYA 3MF2A 5BOXA 1YCYA 4XTXA 1LDJA 1RUOA 3QOPA 2AKWB 4NB5A 1GXQA 5CVIA 4G9YA 1HKTA 3JCMW 2P5LC 3JCMf 4Q15A 2FXAA 3BROA 3RIRA 4LNSA 1YYVA 3HRSA 11ASA 4HT8A 3Q9VA 4P74C 2DEQA 4ESBA 1RI7A 1RUNA 2O3FA 5D8KB 5ERIA 4F7UF 1N9SA 3QTCA 1T0FA 3WE3A 2V79A 2AMCB 5E8GA 4ENJA 1YW7A 4WWCA 2K57A 5LHHA 3GFJA 3WU0A 4YRTA 1LVAA 4IHSA 3TOBA 1Y96B 4MTDA 3F8FA 1C0AA 4L9VA 4XU1A 5LJ5f 3K0LA 2MH2A 2XHKA 5DCMB 2DDZA 1OYWA 2O03A 2MLGA 4M77D 4EJWA 5LJ3d 4M78D 3P9KA 5FLXZ 1WRJA 1YS6A 2ARTA 2RC4A 3HOTA 3P9IA 4G7OF 5GMKl 4PJOC 3RPUA 4LFUA 2R7DA 3GW2A 2XAFA 4M77C 4YYEA 1G51A 1Z9CA 3JW4A 3SWNC 2E7WA 5FFZA 4C92F 1JBMA 3JTGA 4PJOE 3TOAA 4RAYA 2RV8A 1WLEA 1Y0UA 3ZMSA 3TUPA 3RTRA 1HBXG 4FX0A 2QUFA 2Y90A 4EMSA 4AIHA 1U78A 1X2HA 4FHTA 4TWAA 1G3WA 1NJ8A 3MCZA 2ZINA 1KA8A 4UV9A 2EK5A 1FYMA 4M71A 3FXQA 2IA0A 2Q5HA 3BZ6A 1TLHB 3IRRA 4JQFA 4RB2C 1JE8A 4ASNA 3IWFA 4M7DB 3VQVA 2PI0A 2DTRA 2EA2A 1TTYA 4J15A 5IT9K 1DUXC 4ON0A 1STZA 4AD9A 4C8QF 5LJ5h 3E97A 4XU2A 4M78B 4DNCA 4E51A 2M45A 2ZR2A 1NNHA 4EJVA 4IRGA 4XTUA 1KMNA 4YRKA 1RIOH 5ICCA 1LDDA 4K87A 1SRYA 2HGCA 4NQWA 4PHCA 2QZ8A 1W7PA 2VOOA 3QP5A 4AVPA 5L3DA 3HOSA 3QRFF 3GF2A 2M8EA 3HXUA 2CIMA 2Z33A 4AIKA 3I0TA 4L5IA 3LA7A 3CLOA 1KU9A 3V8LA 4KR2A 3I5UA 2DAOA 4PGHA 4M78G 1BBUA 4U0YA 2F5CA 1UHMA 5LRRA 1KQ2A 3ECHA 3RGLA 5L3GA 4YIIA 4BHPA 1TBXA 3W3SA 2ALYB 3MEYA 4UP9A 5GANd 1X2GA 1SD5A 4AWXB 1AWCA 1FX7A 3QHSA 5F64A 3RYPA 5HDKA 4IRIA 1Z7UA 2CG4A 3ULQB 4L0ZB 4NCXA 3BJ6A 1REPC 4YRNA 3V4GA 3GX4X 4M72A 4Y15A 5HDGA 4KYWA 3IKMB 3JCMP 5CVUA 2ARUA 2TDXA 1ZYRF 2ZCWA 1SD4A 2PBIA 3T8TA 4YRRA 3ICAA 4OIQF 4M7AG 3WE2A 5LLQA 3ECOA 3GZ5A 3HYIA 5DY9A 4YIFA 12ASA 4MHGA 3UGQA 4HQMA 1Y96A 2W24A 3HY1A 1KU2A 3Q5FA 4EJOA 3ZN0A 3H92A 2FMYA 2DW4A 2ZZFA 2RM4A 2NYXA 1EVLA 1U3EM 4KT5C 3CUQB 2FNAA 4M7AA 2OBPA 1E17A 5GMKi 2HS5A 3C18A 2H6BA 3FX3A 2P5VA 4ZTUB 3A5ZA 1IZ1A 2PLYA 4C92C 5CVJA 5GAN6 1BJAA 1HW1A 2CW0F 4TVAA 3ZPLA 1B34A 1R1VA 4A53A 2CO5A 2XTIA 3ZQ7A 4P3OA 4I09A 2Z3YA 4Y13A 4X9CA 1TW2A 2IPQX 3BPXA 3M4QA 3JCMe 4UPAA 5HDNA 4EQQA 4H02A 2PMUA 2QQBA 4U0WA 5D5XB 4RAZA 1F1ZA 3ZMZA 1QZZA 3R07A 3I53A 2OD5A 5LJ5j 3F8CA 3FM3A 5GAN5 1ZGJA 4HWRA 4PCQA 3E5UA 1O3SA 2STWA 4RS8A 2XKOA 3A7RA 1SD7A 4KIGA 2AMCA 2P8TA 2YLBA 4P55A 3KEQA 5JVTA 2F5DA 4OIOF 3TKYA 4G7HF 4LGWA 4WF2A 1IN6A 4M74A 4ETSA 3L4GB 1XGMA 1TH7A 2DT5A 3A74A 4M9SA 2PN6A 3GLXA 1I27A 4UP7A 1JRIA 5GAOp 3W6JB 4LB5A 1GHCA 1YLFA 4I98B 4NL3A 2DO7A 5L3CA 3BPVA 3WU1B 1HW5A 1L3LA 3NETA 1JHFA 5DDGA 2Q7HA 3JCMc 4G94A 2P4WA 3BY6A 1T98A 1F5TA 3RUXA 2WV0A 2L01A 4RQEA 1AOYA 3TEGA 2EV5A 4L0YB 3UGTA 3COAC 2PMFA 2DQ3A 4J5YA 2IRFG 1ZLKA 3HRMA 2CJAA 1J5WA 4L18B 4LD5A 2DU7A 4LLLA 3HHGA 1PUEE 3JCMd 5KK1A 2ZKZA 3P9CA 4FT8A 1MJAA 3JTHA 4HYEA 4MEXF 1G3YA 3RDIA 1IL2A 1BIAA 5JFRA 3N4MA 4ENMA 1FC3A 3LA2A 3VQWA 1WWXA 3WTTC 2DU5A 1FSHA 4P71A 5GANf 2L54A 5HS7A 4P74A 3BDDA 3IKTA 1KU7A 4HWSA 2FBIA 3A5YA 3ABTA 3BY7A 1O7LA 1I81A 1F4KA 2DKGA 4A6DA 5E18F 4QWQA 4ZH4F 3A32A 1KGSA 3JCMg 1LJOA 2X0LA 2RD1A 2PG4A 4EMKC 4J6YA 4XU3A 1K6OA 2QWWA 5GAMf 4C8QE 4KMFA 3TO6A 3J80K 4M6YA 3HTSB 2ARSA 4CDGA 1P6RA 2A5YB 1W7PD 3LAJA 5LJ3h 4XU0A 2YHTA 2LF8A 1FYFA 2CWEA 3KP4A 4LB6B 2ZGWA 5GAOn 2QBYA 2BBYA 3IL2A 4YDQA 3L00A 2JTVA 4BHCA 1L0OC 1BI0A 5K5QA 1D8KA 1ULYA 4Q4ZF 1S7OA 3QO7A 3FZVA 3REOA 3CUQC 2VXEA 5BPIA 4PNOA 1O7FA 2ETHA 2OQGA 3FMSA 2O61A 4F7UB 4YCVA 1XMKA 4HLXA 4QVDA 3QP6A 1Z6RA 3QU6A 1ASZA 4LLGF 4FX4A 5GAN2 4J6XA 4UVBA 4YROA 1P4WA 2MA3A 3IG2A 3JCMh 3R60A 3L2ZA 4YRCA 2FQ3A 1FZPB 3W6KB 2XAGA 2DJZA 4OIPF 2Z99A 3PCOB 2PMEA 4CHUA 2J3LA 4M77B 3SWNB 1EFWA 3SZTA 2IY5B 1B34B 1XCBA 1XGSA 2OA4A 1B4AA 3F8MA 1NYQA 2H09A 4M9ZA 5BS6A 2K02A 1RZ4A 3K69A 3WTYC 4WCGA 3P7NA 1T38A 2HQRA 3O2PE 3DF8A 3KLNA 1T2KA 4C92G 3CUOA 2DPDA 3S2WA 4H2TA 1D3BA 3V7SA 1YG2A 1F9NA 3L7WA 4HF0A 4IJAA 1G5HA 4R8HA 4M6XA 2IJLA 4EJTA 2HTJA 2K86A 3I59B 4HVCA 5EEHA 4M78C 2ELHA 1XGNA 3BDUA 3R0JA 4HX8A 1B7YB 3LQRA 1WQWA 1SFXA 3J81Z 1R36A 4GCVA 1H641 4P71C 1R58A 1TQMA 4C92D 4F7UE 5ILVA 3CTAA 1SESA 1WPYA 3GYHX 2Y48A 1GGMA 1YGBA 2KJCA 2C6YA 5K1XA 3E3VA 4G7ZF 1XCVA 1G6NA 3M7GA 4TV7A 3EFSA 2ZBKA 3JAMZ 4B09A 5GAN7 2ZIMA 1HW2A 1PDNC 2L4MA 1IRFA 4OMZA 3WTVC 5CLSA 3JB9G 3EYYA 4BW9A 2D1HA 4HDVA 2K27A 1IRGA 2ISZA 2EB7A 2QQAA 1FYKA 5GANj 2PJPA 1XSXA 5E8IA 1PYSB 1G3TA 2RHQB 1HSTA 2FF4A 1EIYA 4Z2YA 5F6FA 5GMKj 3ZMTA 2Q2EA 1D3YA 5GAMd 1J59A 3DP7A 2G7UA 1ZGAA 1JHHA 4UVCA 1KOGA 2DLLA 2EJ9A 4EGYA 2QVOA 1SMYF 5FD5A 2ADUA 2NNNA 2ACJA 1CGPA 5D5WB 5GAOl 2HYGD 3I4PA 3I64A 2HR3A 4UUVA 1ZG1A 1YTYA 2DTOA 5GAMj 1W5SA 2FNPA 3RKWA 3DKWA 4GYGA 4YRMA 1P4XA 2E7XA 1XSVA 2KIUA 1KYWA 3DFGA 3SB2A 1BBWA 5LEKA 2OQRA 3WGGA 2DPUA 1U8RA 3LQQA 1BC7C 2NRAC 4M77G 2QHUA 2EFOA 4XEOA 3JCMb 4I01A 5LJ5g 4O2DA 2DQ0A 2DQRA 4P72C 3WTUC 2OZUA 3HFZA 4BNCA 3V7CA 2XAQA 2R7FA 2E41A 5ICGA 2V6CA 1Z91A 4A12A 1FBQA 1Z7NA 5CVRA 2DTHA 4IRHA 2I4NA 2IA2A 3QUIA 3DQVC 4OIRF 3M1EA 4BH9A 2RB6A 4JRKA 3M4GA 3R6SA 1E24A 3BOQA 1I4K1 3KP6A 2YU3A 2CGHA 4XRFA 4M75G 4I2OA 1B9MA 2ZT8A 1FT9A 3DPLC 4N0BA 3JCMQ 2ZXFA 2W57A 2WTEA 4RB1A 3HXVA 5HLHA 4X9DA 2E65A 2R3SA 2QBYB 4S04A 3IKVA 3BJAA 4M78F 3NELA 3EQLF 4M78E 5D5VB 3H3ZA 1EH7A 4KICA 2XGTA 2YPRA 2HWVA 5FO5A 5GAN8 2VOPA 2YR2A 1KQ1A 2VONA 3NRVA 2EAYA 4OP0A 1B1BA 1NJ2A 2VBYA 1LYLA 3ZN1A 3TGNA 4TVWA 2CFXA 4DPGA 1BN5A 1R00A 4BWAA 3NQOA 4P3NA 4GGGA 4GXOA 2CJBA 4DQ2A 1X54A 3KP7A 1K78B 2UWMA 2MLKA 4XSZF 2MH9A 1EH6A 4Q6GA 2H6CA 2YX7A 2HNIA 3RL6A 1UB9A 4K86A 1WSUA 1H9GA 4CS2A 4YRJA 1KU3A 4LMYA 4YFXF 2IP2A 3RERA 4BQAA 1SAXA 4PJOB 3O6BB 4YRFA 4OLFA 5BPDA 4HWPA 2EV6A 3F23A 2ZR3A 2EFNA 4G8XA 4PDKA 3SFZA 4G84A 4I7HA 2X4HA 2A68F 4YFNF 5IT3A 5I21A 5GAMg 5GAMh 4Q48A 4ZYHA 3KE2A 5K1PA 2XGXA 2XAJA 5E20A 3VFZA 2M30A 2ZNZA 1ZRFA 3BP8A 4XLPF
chains in the Genus database with same CATH superfamily
1VYUA 4L9JA 3T0YA 5IP6A 1EJ9A 5DYMA 3MCAB 2BOLA 2ODRC 1QVFP 2JN0A 1VIFA 3MEAA 4OMPA 4QSHA 4V2GA 4WXDA 3FIWA 2V1XA 2VQLA 3U1KA 1Y57A 3OB9A 2EBPA 5GAN3 3X26B 2MI6A 3JB9I 2C8MA 3IUOA 5K5RA 4BBSJ 2QLZA 3U9GA 4C5HA 4ESFA 3FMQA 3PFIA 3TO9A 1NYFA 1DPRA 1EV7A 4P96A 4BXUA 1OX8A 1UGVA 2VWFA 4XKCA 1YFSA 2I4OA 2EIMH 5D4RA 2K85A 2L7KA 3JRAA 3CMEI 2A69F 2M02A 1U0JA 4IUPA 3SHFA 4I6ZA 3HUGA 3X20B 2CREA 1Z05A 3QQAA 3SDZA 1GXIE 2LQNA 2JVGA 2EQIA 1TT0A 4F7UG 4F7UA 2JQ7A 2PJRA 1TW3A 4ZTFA 3PO3J 1KHIA 1M5Q1 2PQ8A 4RGRA 2LT1A 4IHYA 3CCSI 1K73R 3ME9A 5GMKe 3CPWA 2CFOA 1UCRA 4BYYA 4XTVA 2MGQA 3VS2A 4H2XB 4YRIA 4KGVB 4RTYA 3HM5A 2FVUA 3CEYA 4KRTA 2KQRA 4XSXF 4XTZA 3M1CA 3G71I 4MDWA 2OTLQ 3A8MB 2A37A 1VQ8A 3DEUA 4RGXA 2E35A 1X6BA 1Y1WJ 3HTRA 4CCJA 1QLYA 5KH6A 1VQ4Q 2P7VB 2DL3A 1ZH5A 3NPFA 2KIFA 1IG7A 2EZIA 2DDAA 3AL0B 2MWPA 2R0QC 4HF2A 4UUSB 5H6RA 5LHGA 4YRSA 5EJCA 4CGZA 2MF2A 3QODA 2FA5A 2WB1N 4XBFA 1FYLA 3OYBA 1R49A 2DO3A 5AIPA 1SETA 4YREA 1X3ZB 4BQQA 4Y3OA 1K1ZA 5GMKm 2NVTJ 2L0KA 3FKIJ 5DM7F 1Z3YA 2LNBA 1TQPA 4D1QA 2AZVA 3CQTA 3AG3H 4QT7A 2Z5UA 3MQ0A 1QVFS 3IP4B 3ELKA 3RQ4A 1KK7A 3M0QA 4XK8E 4M7AC 4AC0A 2ZNIA 2AS5F 4BJTA 4I0BA 2EGCA 2H3EB 3KUFA 2Q7EA 3I3LA 5C3EJ 2Z9OA 4JYKA 4BXFA 4K88A 2RQPA 1ZUKA 2GWRA 2ESHA 4P3PA 3WQZA 4G85A 3E1SA 3KBGA 3SD4A 3RDVA 3UDCA 1SFEA 5LJ3e 4CSWA 4HVVA 1B9NA 2KROA 1FBUA 1V3FA 3ZCOA 4O3MA 1YJNQ 1ZN2A 2HXOA 5AIQA 2NS8A 3ZQGA 5M3FJ 3URGA 4CI0C 4M75F 3K4LA 5CQYA 4XLAA 3META 3NTHA 1X1DA 5AONA 1QWFA 4OINF 4EGZA 4EPCA 3CC7T 1B59A 2E10A 3TSZA 4A93J 4HA8A 1H4VB 2VGMA 1U9OA 2QM3A 3ZQCA 1IV6A 1WDXA 4HEA2 3KP2A 1WGXA 2V26A 3CCQA 1R1UA 1BI3A 3OV8A 3FJPA 5KNNA 2KRCA 3PCOA 3S8PA 4RGSA 3IH3A 2NS7A 3ASOH 3CJQB 5IOYA 1VQ9I 1TUDA 2QEXQ 2LRDA 2ZZEA 2PNIA 2KBTA 3TW6A 1VOMA 3KFUA 3GCMA 1NJ6A 1QZYA 3LL7A 1OFCX 1UHSA 4QTRA 1ZBJA 2HQEA 4HDUA 1IC8A 4LLNA 1RPWA 5IY5H 1WJDA 1N77A 1JUMA 3HSRA 2RN7A 3F0CA 1GDTA 3M4OJ 3UA6A 2DBBA 3CO6C 2L02A 2ZXHA 4MTEA 4QPQA 4XKVA 1CF7A 4BI3A 4E2FB 2KYMA 4CH4A 3AG4H 1XD7A 1L0WA 1X01A 3WODF 1MJ9A 3A0HC 4XRSG 5HK0A 1R5GA 4MIMA 1Q1VA 3DLLA 2ZFUA 2ZSIB 3BG5A 1T39A 3QJ6A 1PWTA 1NPPA 5CAIA 1ZSGA 3HEFA 3NTKA 3G6EA 3CCLQ 2EZHA 3MD2A 4CICA 1VF9A 3CCQT 1E1TA 2FOKA 2E1OA 2NUTA 2DFFA 1O3RA 2R57A 4KQEA 2IVWA 5IYDJ 3L09A 4L9TA 3PM1A 3CCEQ 1YB3A 2YUQA 1N9RA 4YCUA 4HW0A 1SF9A 4DZPA 4L59A 1PD0A 1QGPA 1WI7A 1IGNA 3ZMVA 1I1SA 3H0HA 2KI7A 1FPQA 5D6XA 2I5UA 3ERED 4N0AC 3FXRA 1P7JA 1X3UA 1Q81U 2ZIOA 3ERRA 5LGTA 2LBFB 1I6XA 4M7AB 1ABOA 3TL4X 1QVGA 2PVGB 3AHUA 4J6WA 1E1OA 3FXJA 2QTXA 4J9IA 1NYRA 3C2HA 1O3QA 3VB2A 4UNOA 2VJIA 3HFNA 1S29A 1YBYA 4C92B 2KNBB 5LL6S 3IKLA 4D5CA 1A6QA 3JRHA 2H1LA 2FU4A 2QSFX 2Q7GA 2V7FA 2ZC2A 1QPMA 2JZYA 2BY3A 4PJOF 8ATCB 5J40A 4A3LJ 2XMFA 3ZFJA 1OULA 2EA4A 1Z7LA 3A02A 2WSCE 3EFRA 3I9QA 4P75C 5CQEA 5HLIA 4EM0B 2RHSA 2R7RA 1VQZA 4O5VA 2W25A 3NENA 2QENA 2HQNA 2OU2A 4UP8A 5CKBA 3HFVA 1KQ8A 2L0AA 4H2XA 2RREA 2LTPA 2R5MA 1YP5A 3E9IA 1VQPI 2D2WA 3KP5A 1VQPT 2BZXA 2KT1A 3CC4I 3RF1A 3HY0A 3AAFA 4XORA 5L3FA 4HG2A 2CZ1B 1B6AA 3A1PA 3E6BA 3SXYA 1IUYA 1D1AA 2NNYA 2QGUA 2VN2A 3VDXA 2VKNA 4ELYC 4HWOA 2M1BA 1QPIA 1W5TA 1R5HA 1TZLA 5FLMJ 1N9WA 3CP8A 2E70A 1XTDA 3WVDB 1VQOQ 2VT2A 4NC8A 1QVUA 2CSOA 1YFHA 3FF5A 4WX9A 5A2QK 2KVQG 2XRNA 3A8OB 2FBKA 2F5FA 1PC0A 2E1NA 1W7PB 3BG3A 5L3BA 3KETA 4YRLA 1G2BA 2EWNA 1YRNA 2GOMA 3FB9A 5LJ3j 4N4NB 4A3KJ 2YX4A 2G6FX 2EGEA 4KH0B 5GAOm 3DWLE 1MSEC 2E1HA 5J8CA 4RB0A 1U5TC 2MW8A 3HXLA 1Y0NA 3MEXA 4M9XA 4UB8C 1A04A 4E7SA 5BQTA 3OYEA 4U0VA 4PLLA 1YIJA 4XIDA 2AHQA 5J8FA 3CCMI 4IKFA 1B8AA 3LSQA 1R4NB 3X2QH 1IN7A 5TRDA 1PP8F 4CH5A 3DB4A 4FW1A 3DLAA 1TTHB 3I7FA 5BNGA 4XEMA 4DA4A 2OCCH 2I10A 2A05A 4HX4A 2ALYA 1IN4A 4FIBA 1V5FA 3HRTA 3FDYA 2VKVA 4C30A 3JSOA 4IO9F 2GXAA 1ATIA 5HGQA 4Z8AA 1I1GA 2VBWA 3WG9A 2TCTA 2ME0A 3REBB 1WJAA 1RR8C 1K78A 5CCAA 3GFIA 2J05A 3CDIA 1PYSA 2QHSA 2ZZGA 3QAHA 1KSWA 2LY1A 2I2LA 4PJMA 2MMPA 4LK1F 4M7DD 1USSA 3HXZA 1TUCA 1IGQA 3H5RA 3LSHA 3KZYA 1XB4A 1XNIA 4R56A 4Q47A 4HT9A 2XKPA 2X4YA 2XDDA 3L1AA 3SWNA 2DVEA 3GPLA 4PK4A 4Y33A 4M77A 4JRQA 1XGOA 5K7FA 5BMZA 5CVVA 1N27A 4DYCA 1G83A 3DV8A 3EPZA 2X9DA 2KIMA 2RNAA 1I5LA 3HDDA 3OYGA 1R9TJ 3I55I 1J75A 3RBBB 1VQ9T 4S0HB 1ZAOA 4PJOA 2AXLA 3IHUA 2D8JA 2OI3A 3VV0A 3UATA 1FSEA 2A6HF 3PIOA 1HK9A 2NUZA 2XIDA 2KXCA 3S3OA 3CPWS 4LG0B 2Z1DA 5H20A 2K79A 2H27A 4LDWA 1BIBA 3MZ8A 2J3MA 3BJUA 1ZARA 1PP7U 1FP1D 4LIUA 4U88A 2W85A 1BB9A 4O6JA 1ZHIA 2KRSA 2M8GX 3IALA 1VQKI 1J7KA 1FIAA 2O5RA 2GOXB 2ZO4A 1BCOA 4EMKA 3HPWA 2IT0A 4DZJA 3R0AA 2Z2SB 3HG9A 4LJZF 2MIOA 5KYYB 1GXPA 3IC7A 4FYXB 4RKUE 4I0AA 4ATOA 3ISPA 2HEOA 2M4KA 5EEGA 1FNNA 4BBRJ 3MFKA 1APLC 1FEXA 2P0KA 4BQOA 1AT1B 3I35A 2DOAA 1YX5A 4ZDPA 1XTAA 3I5SA 2ZMEC 2STTA 1D0YA 1NK3P 5EG0B 3TEHA 2AXTC 1DP7P 3QWYA 5J39A 1JGSA 4Q5SF 4I76A 1EIFA 4ME7A 4M77F 2K2VA 3CD6Q 1S6LA 1S7EA 2Y0SA 1MJBA 1JT6A 2MK5A 3FBIB 3K1PA 3M0SA 1TWAJ 4YELA 2BZTA 1YO5C 1ZLMA 2VL8A 2DXTA 1XDSA 2O8KA 3INZA 3VS1A 4IL6C 1BOAA 5FKMA 4QVCA 3CCVI 4X0GA 1IN5A 2OX7A 5A0LA 3PVLA 1G5VA 2UV1A 3I9V2 4LOCA 2AT1B 1TNTA 2GBQA 5CO7A 3VRYA 2JT4A 2P0LA 2K7LA 5JLWA 3OYDA 4J7IA 4KDPA 2RHSB 2CJJA 1KD1U 3D5LA 4OMQA 4FT2A 2I4LA 2AQEA 3NWSA 2HVSA 5D4SA 4H2YA 3K1MA 3D0SA 2E1MC 4CCLA 3FWEA 2XSDC 2K9GA 5FW9A 3CCVQ 1MD0A 2VC8A 2FHDA 5HNFA 2EVRA 1E3HA 4KIBA 3QBYA 3DB3A 2PVDB 5J1RA 4IPAA 4Z6YA 4JK1X 1IXSB 3O8VA 2KJBA 2LCCA 5EZHA 2FUG2 5CK9A 1ETXA 2AO9A 1O3TA 2C0IA 3E7LA 1UJYA 2EPDA 1IXRC 4YG2F 1AKHA 2CP5A 2YLCA 3KCCA 4UV8A 4A0XA 1IDZA 5E3LA 3BZCA 3HL8A 4M7DC 1D3BB 1BYMA 4MZTA 3P8VA 4IQ4A 2HBWA 2JUGA 2P0PA 5CKTA 1R23A 1X55A 3CXCA 4OB0B 3J81E 2M0CA 3I56A 1VNDA 1ZRCA 1QW1A 3B02A 2AK5A 4C8QC 5D6YA 2Y0MA 3SDGA 4J9GA 3OQ5A 2VBZA 2KKOA 4GO1A 3J7AY 2MFZA 2CQNA 3R4KA 4ITVA 5DD4A 4EEFG 3H3VK 4ZN3A 1USTA 3SEMA 3WTZA 4RCCA 1P4AA 2CUZA 4ENNA 2JUCA 4EX5A 4M75A 4UVAA 1JJ2P 4TQFA 2L2PA 4ABZA 3KX2A 4KR3A 2BY1A 5CYVA 3L2VA 2KYBA 5GADJ 2P4TA 4JRIA 1SVLA 4Y4RA 1NLPC 1E7OA 1MGQA 2RMOA 2JPBA 1S72I 5C4XJ 4ZN1A 3TP3A 1PUFA 1WYDA 3OOPA 2JT1A 1WH5A 2R7SA 1RESA 3CDHA 5JI6A 1X2NA 1MNEA 4HSRA 3TREA 2HDAA 4JZ4A 5JR3A 4GYIA 2DMTA 3CCVT 1X3WB 1JKOC 4BGDA 1NJ1A 4IUUA 4R55A 4DEYA 1WA7A 4MNUA 4RTXA 3B73A 1S8NA 5DTDA 2MYSA 3HOUJ 2ZT6A 5AYFA 1R1TA 2BY0A 2F5KA 3ZQHA 2HKQB 5DEQA 1WXTA 1AEYA 2CS3A 4N4OB 2D45A 4CYCB 4DIQA 2FE3A 3L2RA 2R5ZB 1K79A 1I8FA 1X1PA 2IVMA 2KEAA 5HY6A 3G4SQ 3BJOA 3WTWC 3RI4A 1IUFA 5D6FA 3S14J 2HFHA 1UECA 3M5AA 3P8DA 3E9HA 3GXOA 3HGGA 5F1RA 1BBYA 3JB9J 3HTUA 4F91B 1H4SA 5FLXK 4CZZA 2HYFA 2VKEA 2EZLA 2K40A 3HBLA 3SQNA 5FD6A 4RDUA 1LPQA 2A0FB 3X28B 2KP6A 4AG1C 1ON1A 1SFUA 2F5VA 1G59A 1T95A 4QPOA 1YI2I 2PFBA 4PFZA 1ZLJA 5M5WJ 1WJSA 3PNYA 2EIFA 3BZKA 3K2AA 2O9LA 2P7CB 2K3XA 3RNJA 1MGTA 2IS1A 2EL9A 2DVJA 4ZJZA 2NYSA 2VODA 2LRQA 5KYUA 4WJ4A 2R5YB 2P5KA 4EMKB 1UG2A 5B5EC 1K4SA 1VQ4I 5LJ5e 2P5IA 1OCOH 1SPKA 3P8YA 2XK0A 1MV0B 2OTLI 3BW1A 4MQVA 3M9AA 4B6MA 2A61A 2PMZN 1VQOA 2WC2A 1U8BA 4U7DA 3QU3A 3IRQA 1AU7A 2KE9A 2M16A 1UHWA 2O4XB 1OMIA 2IBDA 3EGXB 3OW2S 2Y9YA 3CUQA 3PSFA 2PUOB 4A0ZA 3VOEA 2W0ZA 2ECCA 2B0LA 3ZR8X 2MCNA 2A3SA 3GUDA 3UT1A 3BR0A 1YW8A 3G7ZA 4LK0F 1K6YA 1PSFA 4PLIA 2XROA 3RR6A 2E3CA 1SERA 1UELB 3NMZC 1B70A 2DMQA 2LSOA 1VQLI 4HF1A 2X35A 2ZXFA 1MMNA 4RA2A 1KQSS 1MUZA 3K7AJ 2GIVA 2O8XA 2P84A 4NNJA 5D6EA 4HNUA 2CGPA 2CP3A 1C0AA 3KEOA 3NEMA 3VODA 4PGGA 2L3PA 3DKMA 3TO7A 2K2MA 1X27A 2I8DA 4IF4A 2MG4A 5HK3A 1TU0B 4IOAF 3HRKA 3GO5A 4KN7X 4BDZA 3LWFA 1QA6A 1FOXA 1N6AA 2WADA 3VJPA 2P0WA 4I02A 2XUBA 1JXMA 1WI3A 2DU9A 1ERDA 4N0AA 2G4CA 4EO4A 3LC0A 2D1VA 5LJ3f 4JJDA 1Z7MA 1JGGA 2L9SA 2W84A 2K5CA 2CZ7B 3H9NA 2A6TA 2ZPEB 1U5TA 1FLIA 5F27A 4F17A 4M7DE 2DZCA 4XM3A 3HXYA 2L7FP 1USYA 4XLHA 4KN4X 2HOAA 4YFKF 4P9FA 1R0CB 5F04A 2ABLA 2DTIA 4RG2A 2L2OA 3PFYA 4BQNA 2K4BA 5LGNA 2YSRA 2FBHA 5KNLA 3MF1A 3WTXC 2GA1A 2XF5A 5A2QE 2X3XD 4EVIA 3DTKA 3DLMA 2QEXT 3C12A 2CKKA 3SDBA 4N9HA 3K4MA 3F6VA 5GP9A 2QHTA 3C7JA 4A5NA 3FRNA 3S3MA 2ZNJA 2XD0A 4FE4A 3ZQIA 2LMJA 3RKXA 1WI9A 1BC8C 3UFGA 2DJIA 3SZPA 1WJ5A 3PVQA 2Q5IA 1OR7A 4MGRA 2A6EF 3ERMA 6PAXA 1KQ9A 2W4SA 2CP7A 2E64A 3QYGB 3I5RA 1SANA 2NWMA 1ADYA 2DFHA 2GQQA 2JPCA 2W00A 4HPQA 3F3XA 4IVNA 1EF4A 1F43A 1NH3A 1J0RA 3L4GA 4PJOD 2CZ6B 4QLCU 1Z6TA 3JB9H 5F5WA 1K7AA 1DU6A 4M3DA 4OVAA 2QA4A 3A5ZA 3CF5F 1PM3A 1WKMA 1BBZA 2V8JA 4AH6A 2DFIA 3PQKA 4GBQA 4A5MA 4EM2A 1PKTA 2QEXA 2BUDA 3FIFA 2V9PA 3L2UA 2BW3B 2ZMEB 4XLEA 2VE9A 3OL3A 1U6GA 3OYJA 2HNHA 2F4IA 2VE8A 3JSPA 1R7JA 1ONVA 3OR1C 4E7KA 4HX7A 1VQ5I 3CBPA 3TSWA 4DOVA 3KZZA 1OYYA 1D0XA 1NHAA 5D8LB 4LDXA 5L3EA 2R5ZA 1VQ8I 4M75C 3IWZA 1M8VA 2HOEA 3F72A 3KLOA 2CSQA 2RHZA 3LA3A 3DU6A 5HKCA 4C2MJ 1YIJI 1TS9A 3E5QA 5FU7C 1LEAA 3CCRQ 4H2UA 3JCMV 4QIWN 2KDSA 3CCYA 2QQRA 1IXCA 2EV0A 1WU7A 2EFWA 2IAIA 3F9KA 3RESA 2ZCEA 1Z1DA 1Z0XA 4XKWA 2QKLB 1F1BB 2DL5A 1RETA 3RKYA 4BI8B 5HOOA 1M4ZA 5ED4A 5HLGA 3M9QA 3CXCP 2RDPA 4JZ3A 2FSWA 3RKQA 2HSPA 2OJ2A 4A3GJ 4M7AF 1W2BP 1UE9A 3KFVA 1SG5A 4CH3A 1E6HA 2JTFA 2EJGA 1XDUA 2D0NA 5KVRA 4TQDA 2ESNA 1D1BA 5LHIA 4JLIA 2EKHA 1GBRA 2XAHA 3BTCA 1BI1A 4D7MA 2XI9A 4UXNA 2EPFA 1K4US 4A3IJ 2ZAEA 3PQJA 5LRSA 4R1HA 5J1UA 1SD6A 4ESJA 4J9HA 3GLLA 1LNWA 3J80Z 2IS2A 1ZG3A 2I4NA 4MMKA 5E1ZB 2CQKA 2JA8J 4C8QB 3M8FA 3MAJA 1UUEA 5GAN4 1DP3A 1W0UA 2ZXJA 3I71A 5HLTA 2FB7A 1TXQA 2LP5A 3OW2A 1VQ7Q 3NAUA 4CCNA 4MDXA 2JRTA 2ATCB 4OMOA 3DBLB 2M51A 3OD1A 2HQHA 3M8EA 1UFMA 1WLPB 4R79A 5ELNA 1GCQC 1QCNA 1FP2A 2RO0A 4WXCA 4J83A 1YFRA 4OU0A 2YDLA 3U23A 5ICEA 1YQAA 2QYOA 2W10A 4OWRB 1LDKB 1RNLA 1HXDA 5LGUA 4X1VA 2FX0A 1QVPA 2CH4A 2UZKA 2R7UA 3V8KA 2ED1A 1IHWA 2HOTA 2RAEA 4QVZA 5FJ8J 4QKUA 1BR1A 2MC3A 4L87A 2GAUA 2KPMA 3NFCA 2XASA 3OW2P 5J3LA 2O01E 1LEBA 2LFBA 5B66C 1B8IA 3J7ZI 2H3JA 3CJNA 1I0CA 1ZKGA 1ON2A 2M4GA 4BU2A 2YUNA 3EGXA 3O5ZA 4Z88A 1JJ2S 4XKBA 3CPFA 1SMTA 2N8GA 4RMFA 3TBIA 5DUIA 1Z3XA 5IH2A 3BG6A 3F21A 1CSKA 1NK2P 1TQIA 3L42A 1MW7A 2P6TA 1U1SA 1AOJA 2V9VA 1W36D 4MMLA 2R7XA 2DFUA 4M3BA 3A31A 1UJ8A 1MZBA 5FFXA 4A4FA 4RTWA 2KDZA 2G7HA 3PSIA 4A6EA 1HYOA 5K7ZA 4KJZA 5C53B 2E5ZA 1MDMB 2GTOA 3G71T 4YRVA 1V29B 1YIOA 3SEZA 4HQEA 1C6VX 1J2XA 2HKOA 2HZTA 2PU9B 1AKHB 3QYHB 4D8KA 2K3BA 1VQ7T 4TVAB 3KP3A 4FYWB 1P92A 1H4TA 2I0NA 5C52B 4OMYA 3PL8A 2AKKA 1T8IA 4RAGA 3K4JA 3HKSA 3F8BA 4HAMA 4NQWB 1NJ5A 1WXUA 4ZGJB 3JCMX 1X58A 1Y8RB 2EJRA 3DCFA 2HTSA 4PJLA 3OA6A 1FY7A 2DTZA 2UXXA 4C92A 4PSWA 5A0DA 4JX4A 2VC1A 5TJJA 3RCOA 2FQ4A 3W2WA 4P73A 2FEIA 4YRPA 2DT7B 1M1FA 5IXFA 2VC0A 3E6MA 5GAOq 4LVKA 3C95A 3OIOA 2GTJA 2JM8A 1YW9A 3SFMA 3A7AA 4E6RA 1M8MA 2L3QA 4RDXA 1H9TA 2P6SA 2DK8A 2R5AA 2PMHA 4YRGA 3FISA 3IH2A 2LQKA 4LVJA 4ELZC 1OCTC 2I4MA 2B8AA 2J6KA 3HSEA 4XTWA 3Q9SA 5HVQC 5GJWB 2O0YA 3OS5A 2WSEE 5D5UB 5ILUA 1V4RA 4C5EA 3NHNA 1ZRDA 4JJCA 4YP0A 3E6DA 4A54A 1W6XA 1QVTA 5AT1B 1VQKT 4M75B 3QJYA 4NHJA 3V8JA 1FOWA 4OMFB 4J9CA 5A2QZ 2A07F 1QP2A 3H3UA 1R22A 1XN7A 2HKXA 1NTCA 3HC7A 3K1NA 1P2FA 3ML6A 1ZGWA 1QBJA 4HV5A 2RF0A 2G9WA 1LB2A 4LN2A 4PKCC 4F04B 4Y91A 3G6ET 3CCJQ 1VQMA 4P9UA 1DU0A 2LDUA 2RQRA 3OYYA 3KFWX 3MN2A 2ZNYA 1HSJA 4EJUA 2FEZA 3E5XA 3PIPF 3K70C 5JLXA 3S1NJ 3M0RA 1N8RU 1ADJA 2L4AA 1RIQA 4QW2A 1YHQQ 2K7AA 2H94A 4LG0A 1MH4A 2DA2A 4FTHA 3G73A 1QE0A 2RQQA 4OMMA 4UC4A 2J5OA 2QAZA 4A4KA 4ZGDB 5IXBA 4V2FA 3LH0A 2HOSA 3GBGA 1NG6A 1N25A 2XVCA 4B8XA 3GTLJ 2G0EA 1OQKA 1RADB 1IO6A 1ZUYA 3FEOA 4WK8F 1JJ2A 1QF6A 3P8HA 3QYBA 1QQIA 4P75A 4P5OA 4UHTA 5IT9Z 4XNFA 1XOVA 1VFCA 4C0GA 2FRHA 2YWWA 3GFMA 3TQNA 3MVPA 1VQ6I 3G3ZA 2DZ9A 3O3KA 3JB9D 1IW7F 1YJ9Q 5CQGA 1TSFA 3TU4K 4HCBA 2MABA 2ZJ2A 2PTKA 2RHIA 2VYTA 2ZPFB 3EH1A 1DPUA 3K9TA 3BFMA 1MV3A 3TEDA 4M3FA 4F52A 2XF7A 2HL3A 2VQGA 2D5VA 2WAFA 4L5GA 4OMLA 2BEOA 3LSMA 2CRGA 3BTIA 4KIFA 2XG8D 1YIJT 1ODDA 2K4YA 3ZRGA 4B1RA 5DD8A 5KHDA 5IYBJ 1IAWA 1VUBA 2LC4A 2MD5A 3A01A 2KRNA 3G71Q 2X6WA 2OCEA 1XG1A 3HIFA 3TDZC 3J81K 4D9JA 3BR3A 3GTMJ 3MWMA 1GFCA 2OAUA 3F70A 2RHXA 3M54A 3X25B 4XTYA 2PEXA 4PJOG 2RVCA 1OPCA 3HGYA 2DE0X 3I55A 4F93B 1OZ2A 3CDLA 2IA1A 2VT3A 2IGNA 1KQ0A 3TCJA 2F5TX 2ELKA 3W2AA 1BU1A 4JUVA 3JAME 4OAZA 1I5ZA 3RJPA 5GAHJ 3QO5A 4TTVA 3BQYA 2XDBA 3TEHB 1WXBA 2RK1A 4A2UA 1O4XA 4KUIA 3SEQA 2A3LA 5HS9A 1GVJA 4CH6A 1YFTA 2GM4A 1QRYA 1NE8A 4Z89A 2FZCB 5DCFA 3M0PA 2RHQA 3GWZA 1OYIA 5FB2A 3BR6A 2HD0A 1LOJA 3GVAA 4ZZLA 3MJXA 4ZNXA 3OR2C 3J7AO 5CKHA 4NUBA 3TDUC 2P0QA 3I56Q 1OKRA 4WJ3M 1YJNA 3HOYJ 2AKLA 1IL2A 5JHFA 4IUTA 2JN6A 4KGZB 1K0XA 1C0WA 1Q7YC 1J5YA 4P72A 2RI3A 2JS0A 2LC2A 2IIMA 4PG3A 1U5TB 2IGOA 2LKPA 1QVFA 3L2CA 3HXXA 4M7DF 2R92J 4KULA 3M8JA 4KT6A 1VTNC 1FJLA 1JJCA 3GOXA 3JREA 3CCQQ 3FJ5A 1JJCB 2EJFA 5FKNA 3I54A 1Q82U 2KMUA 3T8RA 2DL4A 1X69A 3QNEA 4LUDA 1T3SA 2QI2A 2NVYJ 3VUZA 4HOBA 5DCMA 1V5GA 3PZCA 2ZPHB 2VV5A 3I59A 2DQLA 3FM5A 1UHCA 3LFKA 2DJQA 5K7HA 4XLNF 4FASD 1IDYA 3WXMB 3ESWB 1OCPA 3H36A 3EAEA 3VRZA 3CC2A 3CC2T 3JCMJ 2WACA 4J9FA 2DYRH 1USYC 1FMWA 2CV0A 5DUKA 2Q8KA 4KFCA 2QASA 2V8KA 5LJ3g 4B9WA 2Y75A 2O9VA 3UKGA 3KXTA 1TWCJ 1YX3A 4WTOB 1Q86C 4ZYAA 4BHBA 3F8NA 3VU3C 4HBLA 3T5XA 2BYVE 4E6KG 2RI2A 4W1UA 2YRVA 1N8RR 1UZCA 1I39A 3ABUA 1H0MA 4WXHA 4MQ9F 2VUMJ 1VQ5Q 4M75D 2BXZA 3PJRA 1HKSA 1KONA 2K4JA 3JRCA 2RA2A 2WAEA 1UDLA 3EUHA 1ETOA 2GBYA 3N97A 3LAPA 2X1CA 4BJ6C 3E9GA 5KYWB 5HS8A 3I56T 3WU2C 3UWNA 4P73C 4L5JA 3CCRT 3LWHA 1WNLA 3HHHA 2R4GA 5DM6F 2HCKA 2RJDA 3BR1A 5KYNA 3WTSC 1JXSA 3NARA 2H8HA 1LE8B 1K4TA 4F92B 2M5WA 3H9QA 3OYKA 2EQKA 4AFUC 2A5WA 4KA4A 1V1CA 8AT1B 2CH4W 5IOZA 3JAMK 1FXXA 4CXFA 3N5BB 4XLFA 2Z16A 4C3JJ 3H6ZA 3LH5A 1HC7A 1WHHA 3PNVA 1E2XA 1IN8A 2ID6A 2NAZA 1BCMA 1X6OA 5E3IA 4X5OA 4I99C 3K2ZA 4RAFA 1EA3A 3PMIA 5IPAA 3C1DA 3QKJA 1X2QA 4A3EJ 1IF1A 2HMAA 5EEAA 5JHUA 2L9VA 4C92E 1QHGA 1S72A 5FGMA 4B9XA 3JSCA 1B76A 3P8TA 4XOPA 1X2MA 2COMA 2RI5A 2C0OA 2C06A 3B6AA 2NS0A 3K4CA 1ZA1B 2O9SA 4MEYF 2EQJA 3MZYA 2BE5F 2ZXWH 1N5ZA 1YWOA 4CC7A 4M7AE 4HT4A 4CYCA 1D8JA 4ZGEB 1KC8U 3F6OA 1XC5A 3VS3A 2IXSA 2KZVA 4RQFA 2FPFA 2GFUA 2NLUA 5B3SH 3VWBA 2M7BA 3HSFA 2A7YA 4RTVA 3EG9A 5EC7A 2IEKA 1D5YA 4V19K 1LNXA 2A8EA 2C7IA 1FOKA 3CCEA 2CJ9A 4II2A 4P1WA 3ZP5A 2MC4A 3EHRA 2VJJA 1QCOA 2CDTA 3A7UA 1K9MR 1G4DA 3WGIA 3RYRA 4KMUX 2EFQA 2QSHX 3PTAA 4A0YA 1HKQA 3RACA 3T1BA 2VXZA 2LLKA 3I58A 4AIJA 3LWIA 4WI1A 3W3CA 4J9DA 5HCKA 2DN0A 4IX7A 3TEEA 3DBRB 4G12A 3U2RA 4OGCA 2IY5A 3QPHA 5FLVA 1KYZA 2OPTA 4LE9A 3OBYA 4IUQA 1YJWA 1HC8A 2JS2A 2ZT5A 1UFFA 5GTIC 1PD1A 2YUSA 3QPTA 4PJJA 1VQLQ 1T0FC 4H0EA 4BY6B 2XB5A 3FMRA 2DYSH 1K8AR 3REXA 5EZGA 3RPUD 2IW5A 1SVMA 4FQGA 2EW3A 3GEZA 2MOXA 3H0FA 4LD9K 4G6QA 5E79C 2ZTGA 4PFPA 4A3FJ 1HD3A 2GGRA 4M75E 4CA0A 3DXJF 1TC3C 3FHZA 1SSHA 2L5QA 5LJ5d 2OTJI 2FL7A 4XLCA 2WSFE 3C0CA 5ECAA 2E1CA 2UUZA 4CC2A 4CRIA 5C44J 2DMNA 2B86A 5C4JJ 1FYNA 1HTTA 3HTZA 1MKMA 3CC7A 2HQ5A 1MBHA 2JSCA 1ZQ1A 2DA3A 3EGUA 4J9BA 3M4PA 1EX4A 1UHFA 2EINH 1SVOA 3HFZB 4B43A 3JRZA 1EH8A 3M0TA 3PT9A 2DILA 3M57A 2JA5J 1PJRA 3B6CA 4XONA 5B1AH 1D1CA 9ATCB 4TVYA 3MZHA 3LLRA 3Q1JA 3ZMUA 1IRXA 1YJ9A 2BGCA 3FKJA 5KCOA 1GL5A 4IXAA 3OBWA 2QQ9A 2RNGA 2V1DA 4CCMA 4F7ZA 1S7AA 3J7YJ 2QDYB 5DV5A 1ZBXA 3TP0A 4C8QA 5J3BA 4OB3B 2KZGA 1HQCA 1W2BS 2RKHA 1F36A 2OV7A 4QQDA 1VZ0A 2Q0OA 2F69A 2UXNA 3M53A 3F22A 4MFDA 5K5OA 4C8QD 3ZMDA 4XL9A 2LQ8A 2DK5A 1O75A 1X6GA 2DBKA 2JMAA 2RJFA 3BTLA 3IH4A 3RZDJ 4CCOA 2KRHA 2EFIA 3M56A 4M7DA 1YHQI 3KYCB 3MQZA 5J6XA 4CC3A 2DMOA 1LQ1A 2OAZA 2ZPIB 5CKDA 2OZ6A 2M2EA 5KAIC 3C3WA 1NEBA 1KQ2A 5CJ9A 4HXJA 2F2XA 1FBSA 2ZFWA 3D7SB 1VQ8T 3Q0UA 4X6AJ 3I4NJ 4GLKA 1BM9A 5ICFA 4J01A 2R7ZJ 3OYMA 1YN8A 1Z9QA 4KT0E 3EUAA 4LVLA 3G1JA 1G5IA 4HNTA 3PNWC 2XGEA 2EYWA 4C8QG 3WHCA 2ISYA 1OPLA 2DXCA 4NOYA 1EVKA 3PIPA 3G1MA 1XX5A 4ZZDA 2LF7A 1QO0D 1T56A 2DXUA 4IIOA 2KRFA 1YJWT 2M87A 4H2SA 3MP1A 4ZIBA 4QQGA 2DCEA 3GZ6A 4A3JJ 2RNJA 2GQVA 4RMNA 3CD6I 3M55A 4WCIA 4L5EA 4EMGA 5GANh 1VQ4A 1A0NB 2BE9B 3DEWA 2DRMA 1W4MA 4XQ3A 2R7OA 3BG9A 1CQTA 1ZSZA 3HFOA 5KYXB 5J4YA 3VBBA 2LR8A 4B3XA 3SYTA 4IHWA 1U1TA 3CC4A 4N9IA 4UUSA 1IRZA 3HXWA 2WA0A 4Y17A 1B7YA 1NLOC 3CO7C 4D5FA 2EIKH 5GAEJ 3LSPA 4M78A 3HJEA 3UNGC 1S3JA 1QVGP 1ZREA 1YS7A 3ROUA 2BW3A 2ZMEA 2KXDA 4JRPA 3H5NA 1RAEB 3OYNA 2J5PA 2WY7Q 5LEJA 4IOCF 3E2UA 4DJAA 1TWBA 2VXFA 5E17F 3REUA 3CP2A 3ABLH 4E47A 1Q81C 3VEPA 4S05A 1K76A 4QQ6A 2QEXI 2DIGA 2VPRA 4G6DA 2FYKA 2CYZB 3JRIA 4EM1A 2DI3A 3HRIA 2LJ0A 2WWYA 1RI9A 4JBAA 4H2WA 3UH0A 3MEVA 3OMGA 3HUGB 2AZSA 1XSDA 2X51A 4HV6A 3KYLA 3M58A 3DSQA 3PMTA 4A3DJ 2WAQA 2CYYA 2DA5A 3HRUA 4NL2A 5E1XA 4TVRA 3V7RA 3CCMA 1YITA 1M2VA 3ICAA 5GMKh 2PMZA 1CKBA 2X1EA 1WHJA 3JR9A 2ZJQF 2ODRD 3HB9A 1ZUUA 3FXOA 4EMHA 2VGNA 5E1WA 2XV4S 2DA1A 3LSTA 4BY1J 2OAWA 5CKEA 1BI2A 5IYCJ 2QKMB 1NJIU 1T6SA 4ENKA 1JQQA 3REAB 1G3SA 1OQYA 3GFLA 3MEWA 5GAOr 2L8DA 4ZDLA 4KUMA 2ZJRF 1M1KR 1JEGA 9ANTA 2LKXA 1P9QC 1B07A 1QNTA 1WQ7A 2BV6A 3LSSA 3FXUA 3R61A 2F5EA 4GDFA 1NBEB 4OF1A 3FK6A 3HPHA 3U1DA 2A28A 2DPPB 4NC6A 1E22A 1W5CC 1KMMA 3FBNB 1RAGB 1X1AA 1MDMA 4IHTA 2M1HA 1M90U 4CO8A 3S1QJ 2E12A 2EFPA 1EOVA 3EUHC 3BWGA 5H2FC 3CMQA 3OYCA 3E6CC 3BR2A 2DU5A 4BXXJ 3C2GA 4JJNK 1VQMQ 2Q1ZB 4E70A 5ILSA 5IAYA 2J06A 1X2KA 3HSBA 1W66A 5ELOA 3WG7H 3LSKA 3S15J 4XK4A 2QYZA 1S72Q 4CS4A 3NEUA 4HKEA 2V8IA 2L3DA 2ZCFB 4H2VA 4HWTA 4K2EA 3RPQA 4UY8I 1W70A 3QDFA 3JB9F 3QSUA 3CCET 4V2SA 4CUGA 2VLAA 1R8OB 3IQLA 4FYYB 3QO8A 1FWZA 2L9RA 3VPRA 3OYIA 2F2EA 2FMLA 4GFBA 3G1ZA 2X6OA 5GAMe 3DPTA 4AVZA 5M9OA 1N8RC 4D0PA 1W1FA 1VQKA 4M7DG 1D5VA 2E3HA 2O6GE 4ZYGA 2XDVA 3EETA 1CF7B 1H88C 3OMCA 2MBFA 1Y07A 3LGFA 1TNSA 1WQ2A 4OOIA 4LXCA 2GNCA 3CC2Q 1VQ6T 2RHUA 5EGOA 3CMEQ 1XMAA 4CS3A 5E3OA 4RCBA 1BKBA 3S1RJ 5C51B 4B48A 3GBQA 4YIRX 1DDNA 5CKFA 1PVEA 1Q1HA 1VQ6Q 4AYBN 4C2TA 4M7AD 4ZYDA 1WPKA 3VQXA 2JZ2A 4HZFA 4HVUA 4BAYA 2XIGA 3NTIA 1ETWA 3N05A 4RB3C 3QXEB 4GLMA 3DTIA 3PNTA 5FRMA 1HCRA 4YRQA 3WGHA 2CUEA 4RTZA 2DBMA 3WVEB 3EH2A 7AT1B 4Y52J 1FTZA 4DGWB 1ACIA 1H4QA 4M73A 4VUBA 1EQRA 3CBMA 3EFOB 2DT6A 1EZZB 2CUFA 2J7IA 2D6FA 1ABQA 3PGGA 4KNYA 2CP0A 2V1UA 1ZHFA 3CCRA 1UGPB 2QHVA 5J47A 1SKUB 1UGRB 5GANe 3EYIA 2JXBA 2GZWA 3QPLA 2RQVA 1Q7YR 2JTMA 1U2WA 1ZG5A 2VBXA 4AFSC 2TRTA 4ZTZB 4U7BA 2L89A 2OF7A 3CQZJ 5H6QA 4X9DA 2JVVA 1B70B 4M77E 2F1LA 3CC7Q 3EDPA 2AKWA 1LJ9A 4RGUA 4FSSA 5GTHC 5FKLA 5LBQA 4CYDA 1J9IA 3H9GA 1OCCH 1O57A 2E2HJ 3L9FA 4Z02A 5IT9E 3EHQA 5F0HA 4EV0A 4DOWA 1J3TA 1KC8R 2GXBA 2GA2A 3GIBA 4YCWA 3CCLI 3DU5A 1M2VB 5GANg 3DPUA 4ZYEA 5K1YA 3JRFA 2HDCA 1PKSA 2EYQA 2E5AA 4L9NA 4PZJA 2HU9A 1SAUA 4BE1A 3QO3A 5LD2C 2GXGA 2RGVA 2VKDA 1MNMC 1K9AA 4KH1B 1JU5C 4HLYA 1AHJB 4ORZA 1KFZA 4LIVA 3DKXA 3L2QA 3A98A 3VUBA 5BOXA 3MF2A 1YCYA 2DYIA 2R93J 5TGTA 3VS0A 4XTXA 2PUKB 1IZ6A 1LDJA 1RUOA 3QOPA 2ENMA 2AKWB 4NB5A 3CC4Q 1GXQA 5CVIA 2R7QA 4G9YA 1KG1A 1HKTA 1VQPQ 3CCVA 1K73C 3JCMW 2P5LC 3JCMf 4Q15A 1ETQA 2QGGA 2FXAA 3HOZJ 3MO8A 3BROA 3RIRA 4M6VA 2CT3A 3AL0C 4LNSA 1YYVA 3QPSA 3HRSA 2YUOA 3QIIA 11ASA 2QXFA 1SEMA 4KISA 1C0MA 1Y56A 4HT8A 3CCUI 3Q9VA 4P74C 2DEQA 1VQOT 4ESBA 3ZGKA 1R6RA 1BL0A 3I4MJ 1ETVA 1BR4A 1RI7A 1RUNA 2O3FA 5D8KB 3G1OA 5ERIA 4F7UF 1M3CA 1N9SA 3QTCA 1T0FA 2F6CA 2K9SA 3WE3A 3MEUA 2V79A 2AMCB 4E7ZA 5E8GA 4ENJA 3H8ZA 2L3RA 3NWTA 2VQHA 3A8GB 1YW7A 4F16A 2GLOA 2YT6A 1M1EB 4WWCA 2LG4A 2K57A 3QWLA 2OJED 1T0JA 5LHHA 3GFJA 3WU0A 2PVOB 3CPWP 4YRTA 1WHLA 4BUPA 1M90C 1GLNA 1LVAA 1QZEA 4IHSA 3C94A 3ZQFA 2IGMA 3OS2A 1M1GA 4DBRA 4AM3A 4W97A 2EBIA 2V9KA 3TOBA 1AVZC 1Y96B 3JRDA 3H0IA 1Q82R 4MTDA 1QVGS 1WH7A 3F8FA 2O88A 5KCHA 4L9VA 4XU1A 5LJ5f 3K0LA 2DDBA 2MH2A 2XB0X 4A3MJ 2XHKA 4M4ZA 1VQ6A 2VXDA 5DCMB 3W6VA 2DDZA 1OYWA 2JVHA 2O03A 3CMAT 2MLGA 2CUBA 3QOEA 4M77D 4EJWA 4BDYA 4M78D 3P9KA 5LJ3d 1K73U 4Y7NJ 5FLXZ 1WRJA 4LG3A 2M0MA 1NG7A 1YS6A 4Y92A 2ARTA 1G2HA 1VQNQ 2EZKA 2RC4A 2ZB9A 5LFAA 3HOTA 4A69C 3P9IA 1RAIB 4G7OF 5KE3A 2DMUA 2QG9B 5GMKl 1VQKQ 2YRCA 2JA6J 4PJOC 1ENHA 4LFUA 3RPUA 3H41A 3M4YA 4AT1B 1VQOI 1QMCA 2LYCA 5EG0A 2XPUA 2R7DA 1TT5B 3MP8A 3GW2A 1RUWA 3ZQLA 4JJBA 2XAFA 3GNGA 2HVRA 5E3MA 3FC3A 4M77C 4YYEA 1G51A 2LY2A 1Z9CA 3JW4A 3SWNC 5M5YJ 2E7WA 5FFZA 4A4GA 5IN1A 2Z0WA 3MPUB 4C92F 4MO7A 2EQRA 3CF2A 3HP9A 4AUXA 1JBMA 3JTGA 4PJOE 3TOAA 4EATA 5F1JA 4RAYA 1VQLA 2RV8A 1WLEA 1Y0UA 3ZMSA 1SSFA 3VQYA 2HI3A 3TUPA 3RTRA 1AWXA 1HBXG 3NGPA 5D6WA 4FX0A 2QUFA 3A03A 2CMPA 4BE2A 4GRIA 2Y90A 4EMSA 3EG3A 4AIHA 3LGLA 1OX9A 3CCUT 2PX9A 4MLOA 3S16J 1M3AA 4FETA 4C5GA 1U78A 3HOVJ 1X2HA 2L3SA 4FHTA 3GTJJ 4TWAA 3BCBA 1G3WA 5IHKA 1NJ8A 2ZPGB 4KBMB 3MCZA 2ZINA 1I50J 1KA8A 2H8WA 3LSGA 4UV9A 1HSQA 1OU8A 1E3PA 1LPLA 3CCLT 2E1MB 2EK5A 1ZK8A 3H35A 1FYMA 2E3IA 4M71A 1RAFB 2Y0SN 3FXQA 2IA0A 1YIJQ 3BZ6A 2Y4YA 4OB1B 2Q5HA 1TLHB 2CQ7A 3IRRA 3BR5A 4JQFA 4II3A 4RB2C 2DYBA 1VQNT 1JE8A 3MMYB 3CCMQ 2CV1A 1PCXA 4ASNA 3CJRB 2FZGB 2SEMA 1H3ZA 1JTXA 2E2JJ 3IWFA 4M7DB 3VQVA 4BEHA 2PI0A 2DTRA 2EA2A 1TTYA 1UMQA 1M30A 4P5NA 2VVKA 2O7OA 5IT9K 4JS5A 4J15A 1DUXC 1WIEA 2P81A 4ON0A 1STZA 4AD9A 3CC2I 1SHGA 3EGDB 4C8QF 5LJ5h 4RMOA 1Y1VJ 3E97A 2E6NA 4AYBA 4M78B 4XU2A 3CESA 4DNCA 1AD5A 2ESWA 2M45A 4E51A 3GTKJ 2M7AA 3FXMA 1HF0A 1IGUA 1RI0A 4FM4B 2ZR2A 3A2KA 3G1LA 3PFSA 1NNHA 4EJVA 4IRGA 1TWHJ 3UR3C 3GTGJ 4XTUA 1VQ7A 1KMNA 4YRKA 1GV5A 1K83J 3K4NA 5ICCA 1RIOH 1LDDA 3PO2J 3OYLA 3OYAA 1OZ3A 3G71A 5GJVB 1SRYA 4K87A 2JMCA 2HGCA 4NQWA 4RLQA 4PHCA 1YRNB 2K9NA 2HSEB 2QZ8A 2WAQN 3IAM2 1W7PA 2JWTA 2O2OA 2Y4XA 3CC4T 1GRIA 4DBQA 2VOOA 3QP5A 5L3DA 3K4BA 4AVPA 3HOSA 3QRFF 1WHMA 3GF2A 2QA4I 4NS5A 2DETA 2M8EA 3KEYA 3HXUA 1RLPC 2CIMA 1Z67A 2Z33A 4AIKA 3G4ST 5L23A 2D1XA 3I0TA 4L5IA 2B63J 1JO8A 3CMAA 1W0TA 2YUPA 3LA7A 2LX9A 1W2BA 3CLOA 4BUGA 1VQ5A 1KU9A 4PFOA 3V8LA 3I5UA 4KR2A 2DAOA 4NDLA 4PGHA 2PQWA 4YEJA 2QQSA 4M78G 4U0YA 1BBUA 2F5CA 1UHMA 5LRRA 1WHKA 3FXLA 3ECHA 2CQXA 5L3GA 1G8XA 4YIIA 4NBQA 4BHPA 1TBXA 2YXYA 3W3SA 2ALYB 2X48A 3MEYA 5FU7B 3LNQA 1Y8QB 2DA6A 3K6GA 4UP9A 4XN0A 1PG5B 2JJ9A 5I22A 5GANd 1X2GA 1WHGA 1SD5A 3MKDA 5I2MA 4AWXB 4C3HJ 1AWCA 1FX7A 4IHXA 2E5QA 4Y28E 1LFBA 1U5SA 3QHSA 5F64A 3A0BC 2ZT8A 3CCJA 3AFHA 5F0CA 2IGKA 3RYPA 4HSTA 5HDKA 2CQQA 1X4OA 4IRIA 1Z7UA 4NC7A 2EYXA 2CG4A 3ULQB 2ELJA 4L0ZB 2HQAA 2LOOA 3BJ6A 1XQHA 2DK3A 1Y6IA 1REPC 2LQWA 1WCMJ 4YRNA 3V4GA 3VYUB 1V54H 3GX4X 3CCQI 2XDPA 4XMYA 1AWJA 1X75C 4M72A 4UB6C 4Y15A 2W48A 1WX6A 3IAS2 5HDGA 4KYWA 5TISC 3IKMB 3JCMP 2LCLA 2ED0A 2O4XA 1OLTA 5EYRA 5CVUA 3H1CA 1XJWB 2RJCA 2ROTA 1LVKA 1RAAB 2LDMA 2X4WA 2ARUA 2KISA 2XPWA 5FKKA 3AT1B 2E36A 1DGWY 1A6IA 2KK4A 1MIJA 1VIEA 4J8OA 2TDXA 4XICA 1ZYRF 2R5YA 2ZCWA 1SD4A 2PBIA 4XR6A 2J6FA 1MBFA 2AIRB 4PJ0C 3T8TA 1S5LC 1UG0A 1C1AA 4YRRA 1LCKA 2F4OB 3LFUA 2YS9A 4OIQF 3WE2A 5LLQA 4M7AG 3ECOA 3GZ5A 3HYIA 3Q0VA 5DY9A 1IO2A 4YIFA 1QHHD 4PUSA 2XICA 12ASA 4MHGA 3H0DA 4KITB 3G6EI 3UGQA 2HDDA 4HQMA 1Y96A 2W24A 3HY1A 3ZXSA 2ROLA 5CQXA 1KD1R 1EIYB 3IV5A 3I55Q 2DNUA 1AWWA 2BTTA 1LFPA 1I1JA 1WZOA 1KU2A 1Y0MA 3A5ZB 4OMNA 3Q5FA 1MNDA 4EJOA 3ZN0A 2E60A 3H92A 2FMYA 2COYA 2JW4A 2LKSA 3HL2A 1RL2A 1Q86U 2DW4A 3JRBA 2RM4A 2NYXA 3VYGA 2ZZFA 1OJLA 1EVLA 1JXOA 2HKNA 1ZR2A 1U3EM 4KT5C 3CUQB 2FNAA 1BOBA 4GY5A 1YJ9I 1EFNA 2LBFA 2OBPA 1E17A 1KJWA 4JPBW 4M7AA 1K61A 3U21A 4FU6A 2HS5A 5GMKi 2VIXA 1R77A 3C18A 5M3MJ 2H6BA 2X85A 4AFQC 3FX3A 3LYIA 2P5VA 1PSEA 5EG2A 4ZTUB 3G4SI 4LDVA 1IZ1A 1WFXA 3BLYA 4F3QA 2PLYA 1IB8A 3P5JA 2JNGA 4N4HA 4C92C 4DBHA 1KHCA 5C0MA 3HKZN 5CVJA 1OV3A 5GAN6 1BJAA 1HW1A 2O31A 2CW0F 3EGDA 4A3BJ 3M07A 4TVAA 3CMMA 3ZPLA 1R1VA 1WJCA 1B34A 2EGAA 4A53A 2CO5A 2NVXJ 3CJTB 2E6ZA 1IV8A 2P4RA 1YHQA 2XTIA 1MHNA 3EFOA 3ZQ7A 1NEGA 4NCXA 2FRYA 4LUEA 2X1DA 5KCMA 4I09A 4B44A 2MD0A 1H3HA 2Z3YA 1S72T 4P3OA 4Y13A 4X9CA 1TW2A 2IPQX 3BPXA 3VS4A 4C0FA 3S2HJ 1M1KC 3M4QA 4BL0B 3JCMe 1RLQC 1WJRA 4UPAA 5HDNA 1A35A 4EQQA 3JRGA 4M3GA 2F2VA 4N4IA 4H02A 3H9JA 3CCST 2H8RA 2LX7A 2PMUA 2QQBA 4AG2C 5KYWA 2DODA 2IPOB 4U0WA 5D5XB 4RAZA 3GMEA 2AHJB 1F1ZA 2RK2A 2KMTA 1T08B 1POGA 1QZZA 3ZMZA 1SEUA 3I53A 2JOYA 3CD6A 2OD5A 2OTJQ 3R07A 1T3LA 5LJ5j 1VQNI 3F8CA 2G3RA 2L7ZA 1AZGB 2CH0A 3FM3A 1WFWA 3W2VA 4PL6A 1K9MU 2K3PA 5CPRB 5GAN5 4IUVA 1ZGJA 4IQJA 4HWRA 3KZIC 3BTJA 1I3QJ 3E5UA 4PCQA 1O3SA 2STWA 1O9SA 1UG1A 2DD5A 1BJZA 1DGRM 3OIPA 4RS8A 1A5JA 1ETKA 3LOCA 2W82A 1MMGA 2XKOA 1BW5A 3MKLA 3A7RA 1SD7A 2KSSA 2MPXC 4KIGA 3THKA 2AMCA 2P8TA 2DAQA 2YLBA 4P55A 2Y31A 2F48A 3KEQA 1AA7A 5F08A 2F5DA 5J4VA 5JVTA 4OIOF 2V1QA 3TKYA 4G7HF 4LGWA 1Y39A 4WF2A 1IN6A 4M74A 4ETSA 2KRMA 4JX5A 2NOJB 3L4GB 3D5RC 2VASA 1XGMA 3L2WA 2VJ5A 5A0GA 2BXYA 2DT5A 3ASNH 1GVDA 1TH7A 2VB6A 2BZYA 3K70D 3OSGA 4LNPA 3T9NA 1ZR4A 3A74A 3OOUA 1RACB 4BD3A 4M9SA 2PN6A 3GLXA 1I27A 4UP7A 2KIQA 1R5ID 1JRIA 5GAOp 4XAXB 4IEJA 2X4JA 3M3YJ 3W6JB 1YITQ 4LB5A 1D0ZA 1TWGJ 2CUJA 1FTTA 1GHCA 2HPMA 4C0DB 1RKTA 1YLFA 2VPLA 1AWOA 4I98B 4NL3A 2FPEA 1MMAA 2QQ8A 1Z21A 3VYTB 1JUPA 5KYYA 1OISA 2WBMA 2DO7A 5L3CA 4RBOA 2SRCA 4LDYA 2OTJT 3BPVA 3WU1B 3SJMA 1HW5A 1L3LA 3NETA 1JHFA 3LSJA 2BHZA 5DDGA 2WV1A 4G94A 5FWCA 2L7MP 2P4WA 1T98A 3BY6A 5DS9A 1QCFA 2RHYA 1PNJA 4YPFA 1F5TA 3EG0A 3RUXA 2WV0A 1JKPC 2L01A 3FHNA 1P7IA 2LJ3A 1AOYA 4FW2A 4LD6A 3TEGA 3FLGA 4RQEA 4E4HA 2EV5A 3FDRA 1H8AC 4L0YB 3O8GA 2QA4Q 5FRNA 4J7FA 3UGTA 3EG1A 1TP4A 4LITA 3COAC 2PMFA 2HZYA 1WJFA 3S2DJ 2DQ3A 4IZZA 5J1YA 2A36A 2V1RA 1OI1A 3WHBA 4J5YA 4BJ5C 5E3NA 2IRFG 4XRMA 3KIOA 1QKXA 1ZLKA 1VI0A 2CUDA 2ID3A 2ME6A 1W36C 2JUFA 2DA4A 3HRMA 3A8LB 2QGFB 2CJAA 1J5WA 1XPXA 1B8IB 4L18B 6AT1B 4LD5A 3I55T 2WY8Q 1MBJA 1K9MC 3MKYB 4LLLA 2DU7A 3QYEA 2CZ0B 3HHGA 1NM7A 3S17J 1PUEE 4J19A 3JCMd 1MMDA 3DTEA 2E71A 5KK1A 3K10A 5D7UA 2ZKZA 4YTLA 4DBFA 4DOZA 1CKAA 3A8HB 1YWPA 3P9CA 4FT8A 3RGLA 2CS7A 1MJAA 1VQ5T 1FOYA 4BY7J 4E7JA 3ULRB 4A4HA 3JTHA 4HYEA 4MEXF 1G3YA 2NOGA 1GCQA 4XOTA 3RDIA 1E3OC 1WGSA 1BIAA 5JFRA 3DLLF 3N4MA 4ENMA 1FC3A 3LA2A 2VI6A 2K5IA 4A3CJ 1M9SA 3VQWA 1WWXA 2DJNA 1IXDA 3WTTC 1UB4A 1YJNI 2DEUA 2RQUA 4B4CA 1FSHA 2RPNA 3AG2H 3MKWB 3OSVA 5GANf 1GFDA 2L54A 4P71A 5DM7R 3A4CA 5HS7A 4BB7A 1S1NA 4HCZA 3BDDA 3KPHA 3IKTA 3RZOJ 1YI2Q 3HOXJ 3BDLA 4N4GA 1KU7A 4HWSA 1OR7C 1SRMA 2IG0A 2FBIA 2K5FA 3A5YA 3OS0A 1SC7A 3ABTA 3BY7A 1IJWC 5FKOA 1O7LA 4FYVB 3OYHA 1I81A 1F4KA 2CP2A 3JCMc 2EILH 1RAHB 2DKGA 4A6DA 1V55H 3QYFA 1UTIA 5E18F 4QWQA 4ZH4F 2D9TA 3A32A 3UPUA 5IP9J 2RQTA 1KIKA 1DJ7B 1KGSA 4RTTA 3JCMg 3A1YA 1LJOA 2X0LA 2RD1A 1VQMT 2PG4A 3CCRI 3CMEA 1LFUP 2F4MB 4EMKC 2ECZA 1BK2A 2NVUB 4BS9A 4ANJA 2PJRB 1QU3A 1Q7YU 2GFAA 1E0EA 2YRDA 1YJ9T 3H0GJ 1B3QA 4J6YA 4XU3A 1K6OA 1VA7A 2CSIA 2QWWA 5GAMf 3CCSA 1JKRC 3GTPJ 4C8QE 4KMFA 3HKZA 3TO6A 1RABB 3J80K 4M6YA 3HTSB 3QZ9B 2ARSA 4CDGA 1P6RA 2A5YB 3CCLA 1W7PD 3LAJA 2DOEA 4J00A 2B7EA 3D1NI 5LJ3h 1LUJB 4XU0A 2QDLA 2YHTA 1PYVA 4E7LA 2LF8A 4L6V5 1FYFA 1UEBA 2CWEA 3KP4A 4LB6B 3BQZA 5EF6A 2ZGWA 3C4SA 2V1NA 3ABMH 5B1BH 1WYXA 5GAOn 2QBYA 2EQUA 2HQXA 2BBYA 3DKYA 3IL2A 1PUFB 4YDQA 3L00A 2JTVA 4BHCA 1L0OC 2QTVA 1ACMB 5JVGF 1I5OB 4D6WA 1BI0A 1UGQB 2HXIA 1OPKA 1JTYA 5K5QA 1D8KA 1ULYA 4XN3A 3HHTB 2JMWA 1VQLT 2LREA 1T33A 4Q4ZF 3E9FA 4RG8A 1ASYA 1S7OA 1GV2A 3QO7A 3FZVA 3REOA 2BIVA 3CUQC 1QP3A 2VXEA 5BPIA 1E6GA 4PNOA 1O7FA 2ETHA 2OQGA 1EKEA 3FMSA 2O61A 4F7UB 4YCVA 2ZPBB 1XMKA 4HLXA 4QVDA 3QP6A 1Z6RA 2Y69H 5KYUB 1I07A 4EIKA 1DQUA 3QU6A 1KD1C 1ASZA 1V5EA 3HOWJ 2XU8A 4LLGF 1I3AA 1WHUA 1BR2A 4FX4A 1YE9A 4UVBA 4J6XA 1TL8A 4E7HA 5GPCA 5GAN2 4YROA 1P4WA 1VQ4T 4B47A 1M90R 2M0YA 2E5NA 1A31A 1ZQ3P 5IHNA 1KC8C 3OYFA 1SRLA 1QQJA 2MA3A 1T0HA 1N78A 1Q86R 3CCEI 1PHTA 5FWBA 3IG2A 2OUMA 3D5SC 3R60A 3QWXX 3JCMh 1HOMA 3ER0A 1TUGB 3RSNA 2V6EA 2FZKB 2C0TA 3L2ZA 4F14A 4YRCA 1VQ9A