3V8JA

Crystal structure of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
306
Chain Sequence
b'SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 98
structure length 306
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8jA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8jA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8jA02
4F7ZA 1WQ7A 4CXFA 4KMUX 1X2GA 3TUPA 4E51A 5ICEA 1L0OC 1ZRFA 2FA5A 4JQFA 2HWVA 2DVEA 4Q4ZF 3KP4A 3V7CA 4WCGA 4MMKA 1B7YA 1USYC 4YFNF 1QZYA 4PDKA 4H0EA 4PJOC 3RKXA 3ELKA 4I7HA 4A6EA 2Q7GA 3F8CA 2XKOA 2CWEA 5TJJA 1PYSB 3GVAA 4LFUA 4HDUA 4UXNA 5F5WA 4RMFA 4RB2C 4YCUA 3RYRA 1PP7U 1QGPA 1U5TA 4HWRA 2UWMA 4XSXF 1KU2A 3FXUA 4S04A 1QNTA 1U5TC 1G3SA 2C8MA 5LJ5f 4ZYDA 4U0WA 4TVWA 1K6OA 1IUYA 4MQ9F 3RL6A 3BZ6A 3L00A 3JCMQ 2AKWB 2H27A 3GZ5A 5FD6A 3E97A 4OIPF 1HTTA 4Z2YA 3R0AA 3HHGA 2KIMA 1P4XA 2VT3A 4OMYA 3BJUA 2WV0A 2OBPA 2A07F 4J5YA 1ZYRF 2AMCA 4LNSA 3TQNA 2D2WA 4UP7A 1ONVA 2PEXA 3BDDA 2XASA 2UXXA 4XTUA 4AIHA 3F21A 1YFSA 1R5HA 4YRRA 5HS8A 3HFZB 1ULYA 1KGSA 3HRUA 4IF4A 1OMIA 2VT2A 4HX4A 5JHUA 2QUFA 1RUNA 4M7DE 3BY7A 1BIAA 1MJBA 1U3EM 3JAMK 1FBUA 4R79A 1IN4A 3WU1B 5BQTA 3J81Z 1O3TA 2Y0MA 5KVRA 4JRIA 1ZRDA 1QO0D 2HGCA 4L9TA 1P2FA 2K86A 3FXQA 2PMHA 4C8QG 4M6XA 1YS7A 3HHHA 3ICAA 2M1BA 4WJ3M 3P9IA 5GANf 2QHSA 2B0LA 2DQRA 5K1YA 2DTHA 1ADYA 4IPAA 1B6AA 2CGHA 4P72C 3HOTA 5LGUA 5A2QK 2EJ9A 2EFPA 3FJPA 4O3MA 11ASA 4XLPF 2ZZGA 3PZCA 2P6TA 4X9CA 1T0FA 4IJAA 5HS7A 4P9FA 2IW5A 3JCMf 4XU0A 1Z7UA 1K7AA 4ZYEA 1SAXA 1YYVA 3HUGA 2HOEA 5TRDA 1IXCA 2DW4A 2E3CA 4M7DA 3MEXA 3GWZA 3IRRA 3ZMTA 3WGGA 4M71A 2LSOA 5LRSA 3GFLA 5GANd 1B59A 4PZJA 1R22A 2V1DA 4LB6B 1DPRA 3ERRA 4XTXA 2XAJA 4RGRA 1EH6A 2EL9A 2E7WA 3KP2A 3HXUA 4HF1A 2L01A 5D5WB 2FE3A 3T0YA 5GMKj 5HDKA 2NYXA 3TDZC 2P7CB 1JXSA 1B7YB 4PJOB 4GYIA 3I58A 4RAYA 2STTA 1IN6A 3REUA 1W7PD 2DTOA 3V8JA 5E8GA 1HBXG 4IRGA 2ISZA 4YRNA 5GMKl 3L09A 3SQNA 2YU3A 2Y90A 2HEOA 3LSQA 5AIQA 5E20A 1GHCA 2J5PA 1I1SA 1IF1A 1U5TB 4J6YA 5LGNA 2DBBA 1YIOA 3A5ZA 1F1ZA 2YLCA 2ZKZA 4WWCA 4NL3A 4A2UA 4ASNA 4IRIA 4L0YB 4RGSA 4CS2A 2GAUA 1FBSA 3HSRA 4KR2A 1GXPA 2QTXA 1BBUA 4PJOG 1E1TA 2FBIA 3K1NA 4I2OA 3JCMJ 3QU6A 4CH3A 3UGQA 4EGZA 5K5OA 2O6GE 5KNNA 2CJBA 3MQ0A 2IRFG 3TEHB 1E1OA 4LGWA 4AIJA 3QO5A 3I4PA 4ZTUB 3BPXA 2I2LA 3MF1A 2CGPA 4RB1A 4Q15A 1B34A 4RDXA 1TBXA 4YREA 3DXJF 1Z7MA 2VBWA 3V7SA 1TW3A 3M4QA 3RF1A 4V2SA 3UFGA 4DNCA 3ZPLA 3ZN1A 2F5EA 1X01A 3T5XA 4JRKA 4X5OA 5K1XA 2EA2A 5LEJA 2AXLA 2V1UA 1IRGA 1S7OA 3KLNA 2DTRA 4I02A 5DD8A 1HXDA 2ARSA 2HDCA 1I4K1 2A69F 3I54A 4F7UB 3EDPA 5H6RA 4HW0A 5J6XA 1FYMA 1W66A 4YIIA 1FYKA 4XQ3A 5HDGA 4M75D 4I98B 3BW1A 2CW0F 1RIQA 1XCVA 1HK9A 2RA2A 5K1PA 1O3RA 4ZYHA 5DD4A 5GAMd 1X54A 1YW9A 3PFIA 5LJ3j 3A7UA 2J3LA 4FT8A 4DPGA 4C8QF 2ZT8A 1ZRCA 5H6QA 2DFIA 1DPUA 3EYYA 4O5VA 2HKOA 1IN7A 2DK5A 1CGPA 1ZGJA 1EOVA 1R1UA 3Q9VA 4XTYA 4CS4A 1DUXC 1HKQA 2OZUA 4CGZA 5EEGA 1B1BA 1Y96A 5JFRA 4JLIA 2L02A 3HRSA 4P74A 3RDIA 1AOYA 4KN7X 1X3UA 3VU3C 4M7AG 1SRYA 1YFRA 2I4OA 4AIKA 2PBIA 3VODA 2NS0A 1BI1A 2G4CA 1U78A 1SMTA 2ZMEA 3F8FA 3EFRA 3JB9J 3CDHA 3UH0A 3W3SA 3DF8A 4HQEA 2ISYA 2A61A 3T1BA 3TOBA 5GAN4 4HVCA 2QWWA 3F23A 1S8NA 2QZ8A 1U2WA 4UVBA 4CDGA 1YLFA 2MH2A 4BYYA 2ZNJA 3PGGA 3VOEA 2P4WA 1O3SA 2CFXA 5FGMA 5IT9K 5GAOq 3EETA 5LJ5j 4B8XA 3J80Z 3F3XA 2EJFA 1Z9CA 4ENMA 4U0VA 2ZZFA 4A6DA 2VBZA 2A6EF 4HAMA 1IN8A 1SFUA 1XN7A 4P73C 1ASYA 1WYDA 1Z91A 1NNHA 2QBYA 1NJ1A 1LB2A 2PJPA 2I4NA 3VB2A 2PI0A 2BGCA 4QVCA 4YRTA 4OP0A 1NYQA 2ZIOA 3O2PE 3WODF 4XTWA 5FLXZ 2HFHA 2DKGA 4ZIBA 3TKYA 1O7FA 1JHFA 4YRFA 2A5YB 5AIPA 4HWTA 1UFMA 3BPVA 5ERIA 2DI3A 4HWSA 3UGTA 1DP7P 4BHPA 5IT3A 4LLLA 2F2EA 1T6SA 1LDDA 3W6KB 3G1ZA 1SMYF 4H2YA 1Q1HA 2XAFA 4Y13A 2IT0A 2F5CA 3M8FA 3GIBA 4PG3A 1OKRA 3EUHA 3HTSB 1ZGAA 2P8TA 4L5IA 5GAOp 4YP0A 1FC3A 2MH9A 3FMQA 2V79A 1USTA 5E8IA 1YFTA 2VC1A 2YHTA 4EMHA 1EFWA 1ASZA 2IA1A 2TDXA 2JRTA 4KNYA 4A53A 2DPDA 1KU9A 2ZJ2A 3ECOA 5I21A 2M5WA 3IKTA 3EQLF 3LC0A 3HFNA 4RQFA 4UVCA 5LEKA 2M45A 4UVAA 4C8QC 1R58A 1F4KA 4M77D 3H92A 3W6JB 4EQQA 2OQRA 4M9SA 5K5QA 2UXNA 3KE2A 3E6DA 4XRFA 3OV8A 1JE8A 3LA3A 3NRVA 2VC8A 3E5UA 5HLGA 3A7RA 1NHAA 4RGXA 3RESA 3PCOB 2M30A 4OLFA 1KU3A 1R5GA 1Z7NA 5GMKi 5E1XA 2H94A 1G5HA 1SFEA 2RHQB 4P71C 5D6EA 5JVTA 2RN7A 3E6MA 3QPHA 2A68F 4BXUA 1C0WA 1BM9A 4PJOE 1W4MA 3NEUA 4O2DA 5LGTA 2ARTA 4L5JA 4HZFA 4QLCU 3WQZA 5CVRA 2HQNA 1LOJA 2YLBA 1EQRA 2XTIA 5ELOA 1Z6TA 2QQAA 4R1HA 4EM2A 1XB4A 1FYLA 4TV7A 5L3CA 3WGIA 2EV5A 4M7AF 2RKHA 4P3NA 4M75G 4YCWA 1KQ9A 5GAMe 3DV8A 2DO7A 1WWXA 3HSFA 1SFXA 4HT8A 3P8VA 1SD4A 1IRFA 3QHSA 4NCXA 4RAZA 2PQ8A 2V9VA 2K4JA 1TQIA 1UHWA 3RPUA 2RHSB 1S6LA 4M78G 5L3BA 3LAPA 4M72A 4J15A 4LK0F 3HTUA 2L3DA 3QOPA 4G9YA 5BMZA 1A04A 1MDMB 1FT9A 3LFKA 5F1RA 1USYA 1XGOA 5HOOA 3L4GA 1R23A 5D5VB 2HTSA 2O03A 4PJOA 2VXEA 2FMYA 5GANh 4OMZA 1S29A 4KQEA 2O3FA 3Q9SA 2QBYB 5HGQA 1ON1A 5FFZA 2Q5IA 2RV8A 3K2ZA 4CH5A 3MEYA 2L4MA 4K2EA 4IRHA 4QWQA 3WE3A 1HSJA 4C92G 1YW8A 3BY6A 3CUQC 4M9ZA 2FB7A 4LJZF 3JCMh 4PCQA 1LVAA 3FHZA 5C51B 4KICA 2CIMA 1Z05A 4G94A 1E2XA 4XTZA 1ZHFA 4ESJA 3JW4A 4WJ4A 1MZBA 2EFQA 2XAHA 1YO5C 3BFMA 3QSUA 4NQWA 1MJAA 1QQIA 5JI6A 3JCMW 3HSBA 4F7UE 1XGNA 3KETA 1Z6RA 1VTNC 3K0LA 2G9WA 2DTIA 5E18F 1WQWA 3BOQA 4EV0A 1I27A 3E3VA 2PN6A 4B09A 3F22A 4EM1A 4N9IA 2VBYA 4XU2A 2DLLA 4OIOF 4K86A 3TEHA 4RB0A 1TQMA 2Z99A 2STWA 2HYFA 2JTVA 5D4RA 1RIOH 1N9WA 3VQYA 2CJ9A 3FM3A 3NETA 4C8QB 1X2HA 4AD9A 1XGSA 2IVMA 2XROA 2O61A 3M1EA 1ZH5A 2BBYA 1J5YA 1KYZA 5CLSA 4CH6A 3INZA 2VC0A 1T38A 2OAZA 2NAZA 1ATIA 3PQJA 3QUIA 2XAGA 3FIFA 2M87A 1B4AA 3QO8A 3E9IA 3MWMA 2QENA 2DJZA 1W5TA 1J7KA 4MTDA 1JBMA 4F7UA 3CJNA 3KP5A 1SETA 3J7AO 2ESHA 3O3KA 4P72A 2FQ3A 1TLHB 3MF2A 4EJTA 1D5VA 5GAOm 2MLKA 2X4HA 1DDNA 1V3FA 4M7AA 3JB9I 1EVLA 4HYEA 4J6XA 3QAHA 3RACA 4M7AC 5FD5A 1XGMA 1VQZA 3JSOA 5LHGA 2GA1A 3V8LA 1Y0UA 1I8FA 2F5DA 5GAMh 4M7DD 4S05A 1O7LA 1OYIA 1TH7A 5GAN3 1BIBA 5HLIA 3ULQB 2GZWA 2HKXA 2WTEA 4HX8A 2KJCA 3P7NA 1AWCA 3KLOA 4BWAA 1FPQA 2CG4A 3GLXA 4EMKC 4M75F 4H2SA 4ZTZB 3ROUA 3BDUA 3JTGA 2IA2A 3CO6C 3M4PA 2DK8A 3JCMV 3L4GB 4M78F 4BHBA 4TQFA 1SESA 5LHHA 2EJGA 4Q48A 1M8VA 5ED4A 4NL2A 1J59A 3CUQB 3ABTA 3A5YA 5D8KB 1G3TA 4YRJA 1EH8A 3WGHA 3GW2A 1QPMA 4HV6A 1IW7F 4PGGA 4G7ZF 2OQGA 2XIGA 4YRGA 1KQ8A 3DEUA 2NRAC 3CLOA 5E1WA 1L0WA 3L2ZA 1I5ZA 3MFKA 4C92F 4CICA 3E5QA 3HYIA 2HZTA 4OOIA 4HF2A 4YYEA 3H3ZA 4G85A 2J3MA 2RB6A 3ZN0A 2KRFA 2IJLA 4L0ZB 2QQ9A 2ZCWA 1FWZA 1FOKA 3DSQA 2EJRA 5LJ3g 3TO9A 1O3QA 3DP7A 2K4BA 4TVYA 2LKPA 2VE9A 4KYWA 2FEZA 2BYVE 4L9NA 3E5XA 2ZTGA 2YX4A 3DQVC 1JRIA 2DZCA 1LJOA 2QHUA 1I1GA 4P5OA 2DAOA 2E65A 5ELNA 2ODRD 3GO5A 1P4AA 1RI7A 2ARUA 1XSXA 3FX3A 1S3JA 1GXQA 4OU0A 1YTYA 1OYWA 3JCMb 3JAMZ 3V7RA 2JT1A 2VXFA 4J6WA 1H4VB 1G51A 5GAMf 2IY5B 4IHTA 1B70B 2ZNIA 4M73A 2PFBA 3IHUA 4EMGA 1ZN2A 1GGMA 5ILUA 3GUDA 3ZMUA 2COMA 3VQVA 3WTUC 5GAOr 1WU7A 2GXBA 3T8RA 5A2QZ 2RQPA 2KIUA 3KEQA 2H09A 3KFWX 3ZMSA 2QVOA 3C18A 3PQKA 2K02A 4TWAA 4RGUA 1HSTA 1KMNA 1STZA 2XKPA 1WNLA 2MC3A 4N0BA 5GAOn 3JSPA 2P5LC 4YCVA 3RPQA 3I53A 3RGLA 4H2UA 5LJ5g 4M7AB 1G3WA 2GQQA 3FMSA 4YRSA 3I64A 3PCOA 3JB9D 3U9GA 3REXA 1QBJA 3IG2A 4P75A 2QHVA 4BQAA 2VOOA 1O57A 3OD1A 2RHQA 4P75C 4M75C 3F8NA 5GAN6 3I7FA 4EMKB 4YPFA 1KOGA 4HWOA 5DUIA 3SZTA 3VEPA 2QLZA 4XU3A 2KJBA 3WE2A 5K5RA 4M78A 4M77F 4GCVA 3C3WA 1LDKB 3R6SA 2P0LA 1FP2A 4OIRF 4L18B 2W24A 3EYIA 4M78C 1ZG5A 3G73A 2KIFA 5DCFA 1PP8F 3ERED 2VONA 4EJWA 4OINF 2HTJA 1WPYA 2QHTA 5C53B 1RZ4A 4GXOA 2FU4A 3TO7A 5J8CA 2FOKA 1R00A 2FBHA 5CJ9A 2JPCA 1P6RA 3REOA 1JHHA 5CVUA 4XEOA 1L3LA 2FXAA 5CVIA 4C92A 4EVIA 2RHSA 2IPQX 3R4KA 1X55A 5E1ZB 4C92C 3A7AA 1PDNC 2JSCA 2W57A 1LQ1A 5DDGA 2CO5A 5CVVA 3N97A 1MDMA 4XTVA 2XRNA 3HSEA 2E1HA 4YG2F 3V8KA 1W7PB 12ASA 4P73A 2CJAA 2DT5A 2ELHA 2XVCA 4JBAA 3CUOA 4E70A 1BBYA 4L9VA 1R36A 5D4SA 2PG4A 1B9NA 4YRQA 4C8QE 1WKMA 5DV5A 5AONA 2DU5A 1EH7A 3K9TA 2EFOA 3DPLC 2UZKA 4CZZA 1FLIA 3FZVA 1J75A 2DDZA 1BC7C 5C52B 4X9DA 2BEOA 1HW5A 5HDNA 2XV4S 3D5LA 2FYKA 3TO6A 1FBQA 1OR7A 1ZAOA 1G4DA 1EVKA 5HS9A 1U1SA 4HOBA 1R1VA 5GAN7 1D3YA 5HLHA 4L9JA 4G7OF 2X0LA 1I6XA 1IN5A 2D45A 3SHFA 3QPTA 1SD6A 2MD5A 5KK1A 2K57A 3ZMVA 4KR3A 5DEQA 2Q2EA 2R3SA 2Z3YA 1CF7B 4HT9A 1BI2A 1Z1DA 2ZT5A 2QM3A 3L9FA 4C8QA 4UPAA 4UUVA 5GANj 1BBWA 3ECHA 4H2VA 2NNYA 1LYLA 4WF2A 2J5OA 1KU7A 1ZLKA 1XMKA 5D8LB 3WTYC 5FFXA 1QF6A 1D3BB 5E3IA 3DFGA 4HQMA 4Y15A 4EMSA 1JJCA 4ZZLA 3A32A 2CSOA 3M4GA 2E5AA 4P71A 1XMAA 4M75B 1ZG3A 3QRFF 4NOYA 4FX4A 2Q0OA 1KYWA 4ENJA 4IHSA 2VXZA 3MZHA 4FX0A 2GXGA 5GAN8 2E41A 4H2TA 3GFJA 2EFNA 3FF5A 3GF2A 4LMYA 3IC7A 2E10A 4M78B 3IALA 1S7AA 1K78B 1D8KA 3V4GA 4MHGA 2PMUA 1TNTA 2Q7EA 1KA8A 4RCBA 4EJOA 2R7DA 3FMRA 1FZPB 2XGXA 3GYHX 3I0TA 3N4MA 3HXXA 5IT9Z 1SD7A 2G7HA 2DPUA 4TVAB 5LJ3f 2ALYA 3OOPA 4EX5A 1TQPA 3KZZA 5GMKm 1R1TA 1UHMA 5DCMB 4CO8A 3SWNC 4C92B 3T8TA 3ML6A 3QO3A 4I0BA 4MEXF 1XDSA 2ZR3A 3HXYA 4PJOD 3HRKA 1D8JA 2EB7A 2RGVA 5JR3A 5GAN5 3KCCA 1E17A 1WLEA 4RQEA 3CTAA 1H4TA 1UCRA 4M7DF 2BE5F 4ZYGA 5LJ3d 4Q6GA 3CUQA 1QZZA 2YX7A 1LEBA 3KFUA 1BC8C 1LNWA 3AAFA 1XSDA 3LSSA 3WG9A 5L3FA 3L7WA 4BW9A 3FB9A 3L2CA 1U1TA 4D0PA 3JCMP 2A6HF 4UNOA 3JCMc 1G3YA 2ZNZA 4M74A 1FSEA 3R61A 2GA2A 5ICFA 4H2XA 1UB9A 3RIRA 3FM5A 5GAMj 2RC4A 4ESFA 3IWFA 4HBLA 1R7JA 1NYRA 2LF8A 2Z5UA 1MD0A 3BJ6A 1T39A 4XBFA 2ETHA 3M9AA 4EGYA 3B02A 3QU3A 4BNCA 2DU9A 2M8EA 3HTZA 2DXTA 4I01A 3LA2A 4M7AE 1M5Q1 1W5SA 4WXDA 2EAYA 1USSA 1ZLJA 3HRMA 1REPC 4A0YA 3K1MA 3R0JA 4RB3C 2FNPA 4A0XA 3RYPA 3K69A 4YRMA 3RI4A 2IY5A 4ZZDA 2BV6A 3QP5A 4EM0B 1B70A 1ODDA 4MNUA 1E24A 3K1PA 3D0SA 3VFZA 1N9SA 2DXUA 2K27A 3ZQ7A 4LB5A 2JN0A 4HDVA 5LJ5d 2LDUA 1JJCB 5D6FA 4YRKA 2RD1A 1LNXA 4JUVA 2DQ0A 3P8TA 2YSRA 1KQ2A 3U1DA 4KIBA 1SERA 4U7BA 4BAYA 4N9HA 2P7VB 4WK8F 4M77B 4QVDA 2RVCA 1NJ2A 2C6YA 1G6NA 1GVJA 4AVPA 4HV5A 1ZARA 3QNEA 2D1HA 1BI0A 3WTSC 4G6DA 2EV0A 4YRLA 3S2WA 2OU2A 4M7AD 4U88A 4KN4X 3I71A 2JZYA 2XAQA 1WQ2A 5GMKe 1LJ9A 2ESNA 4I09A 4XU1A 3HOSA 2IP2A 2OZ6A 2Q8KA 4YDQA 4NB5A 3QTCA 1LDJA 5DUKA 2CQKA 1MJ9A 1T98A 4M77G 2GWRA 3DKWA 1KMMA 1XDUA 2O0YA 1IZ1A 1U8RA 2ALYB 4EMKA 3SWNB 2ZINA 1WSUA 3I59A 1YG2A 3MAJA 1V4RA 3ZMZA 1YCYA 3KP7A 4P3OA 4HLXA 3VQWA 4MMLA 4HF0A 2P5VA 4KMFA 1FX7A 1FP1D 2XGTA 4IXAA 3ZMDA 4HWPA 3TOAA 5LHIA 4UV9A 3HRIA 3JB9H 2H6BA 5J8FA 2GIVA 2ZNYA 4KT5C 2HQRA 4M7DC 3JB9F 4LG0B 1MKMA 1J9IA 3IRQA 3F8BA 2F5FA 1H641 4P96A 2JPBA 3SFZA 5E17F 4WX9A 1B76A 3LQQA 1HW2A 4HA8A 1MGTA 4NHJA 3QO7A 4YFXF 3C1DA 2ADUA 3IKMB 1BJAA 4M9XA 4G84A 1OYYA 3RTRA 3JCMd 3G3ZA 3HXZA 1TTYA 3P9KA 4LLNA 2HS5A 5BOXA 4WI1A 4H2XB 3KP6A 5ICCA 2WWYA 1G5IA 1W7PA 3HXVA 4GO1A 1KQ0A 3F8MA 5CVJA 1J2XA 2ZFWA 4WXCA 5FB2A 2MA3A 3NELA 4LLGF 1H9GA 4A5NA 4JK1X 5F64A 2XHKA 3BP8A 4XLNF 3FXRA 1HKSA 2MBFA 1IXRC 2ZO4A 4UV8A 4Q5SF 3A74A 3BROA 3I5UA 1X56A 4LK1F 5ILSA 3GEZA 1YGBA 4HLYA 3L1AA 2ZZEA 2ZT7A 3BJAA 1F9NA 2H6CA 5ILVA 4MTEA 3WTZA 2I4MA 1H4QA 2V1XA 4P3PA 1P92A 3J80K 4Y91A 4WXHA 5LJ3e 2HNIA 4TTVA 1IL2A 2W25A 1F5TA 4ETSA 4M6YA 5F6FA 3SXYA 4M75E 1BN5A 3RKWA 4G7HF 2ZXFA 2ZXJA 3EFSA 2AMCB 5D5XB 2FNAA 4CYDA 3WTVC 4DQ2A 2VBXA 2C7IA 3ISPA 5GAN2 2EFWA 4KA4A 2ODRC 1OPCA 3H3UA 2EV6A 4M78E 4ENKA 5HVQC 2FRHA 2ZBKA 1CF7A 5FLXK 3R60A 2A3SA 1NJ8A 2D1VA 1YQAA 5BPIA 2PMEA 4KDPA 1PUEE 4AWXB 2L4AA 4A5MA 2DEQA 1FSHA 1H4SA 3U2RA 3JTHA 2Q7HA 3COAC 3HFOA 5GMKh 1B8AA 2YR2A 4H2WA 2PLYA 1D3BA 4I0AA 2KKOA 1IXSB 4C92E 2EWNA 2E1NA 3KP3A 2Q5HA 4M75A 4O6JA 4PGHA 5L3EA 1XSVA 3HFVA 3Q5FA 4P9UA 1FYFA 3I59B 2Y75A 4M78D 2VODA 4UHTA 2AS5F 4RCCA 4MQVA 5LJ5e 2DQLA 4G8XA 4RS8A 1K78A 2OA4A 4BH9A 2E1CA 4F7UG 5LBQA 5EEHA 3M8EA 3AHUA 1KQ1A 3SB2A 5D5UB 5FO5A 4KUMA 4HX7A 4M7DB 1NJ5A 3NEMA 4U0YA 4G6QA 3ZP5A 2ZGWA 5GAOl 4TVAA 3FWEA 4P74C 2RDPA 4C92D 5DCMA 4BHCA 1TW2A 1ZG1A 4XEMA 2OD5A 3F6OA 3HIFA 3TGNA 3GFIA 5DY9A 2PMFA 3RKYA 3F6VA 1WI9A 2IA0A 2FMLA 1HW1A 1LEAA 3RJPA 5GANg 1MGQA 4M7DG 4YRPA 1YS6A 3QP6A 1EIYA 2P6SA 2NNNA 2E7XA 1YFHA 4YRIA 4KIGA 2R7FA 3LA7A 2YPRA 1N9RA 1EV7A 2P5IA 3HRTA 1WRJA 1P4WA 4YROA 1J5WA 1ADJA 3JCMg 2VOPA 1RNLA 2DU7A 4PNOA 1ON2A 1I5LA 4Y17A 1B9MA 3BWGA 4MEYF 2EK5A 1NJ6A 4KIFA 4R8HA 4PHCA 5GANe 3WTXC 1YW7A 3E6CC 2ZT6A 3C7JA 1ZREA 1PYSA 3ABUA 3LWFA 4IVNA 2K7LA 3LAJA 5LJ3h 4PJOF 2HR3A 2XUBA 4TQDA 2FF4A 1BOAA 4N0AA 1BI3A 1U6GA 4M77E 1IAWA 3JCMe 5L3DA 4N0AC 3MCZA 2QQBA 4GYGA 4EJUA 2P5KA 5BS6A 3WU0A 4H02A 3GXOA 2E64A 3KZYA 3HY0A 3SZPA 2ACJA 1B34B 2AKWA 1HQCA 4YFKF 4ON0A 2Z9OA 4K87A 1XD7A 4C8QD 3VBBA 4CH4A 6PAXA 4LD5A 5H20A 2DZ9A 4ESBA 4Q47A 2Z33A 3E9HA 3VQXA 2RNJA 1C0AA 1J0RA 4A12A 2W84A 3DPTA 3LQRA 4XSZF 3KEOA 4AH6A 3O6BB 2V6CA 2ZR2A 3WTWC 5LRRA 2I4LA 3HFZA 3RERA 3CO7C 4A0ZA 2EA4A 4MGRA 2HYGD 3NQOA 4EO4A 1HC7A 4M77A 3RUXA 3B73A 5ICGA 4M77C 2FBKA 3IL2A 3IWZA 4YRCA 4CS3A 1SD5A 5LJ5h 3HXWA 2W85A 3NENA 3WTTC 2RM4A 1XCBA 3M7GA 5BPDA 2L54A 2DQ3A 3F72A 1YB3A 4KFCA 4ZH4F 2CYYA 5LLQA 1Y96B 5GAMg 4K88A 3GZ6A 1TNSA 1K79A 1H0MA 4F7UF 1JGSA 1T2KA 4UP8A 3J81K 2MLGA 4EJVA 3TEGA 5L3GA 3IKLA 2LNBA 1RUOA 1FNNA 1E22A 2ZIMA 4UP9A 2VE8A 4A54A 1H9TA 3SWNA 3P9CA 3CMQA 5CYVA 2O8XA 3A31A 5CAIA 4FHTA 3HY1A 4U7DA 3JCMX 2Y48A 4L87A 2ZCEA 3R07A 4GGGA 4OIQF 3JB9G 1QE0A 3IKVA 2LF7A 2QYOA 3GX4X 2ZMEB 1HKTA 4CHUA 2G7UA 1FY7A 2VN2A 3LSTA 2FSWA 4ENNA 3BJOA 4P55A 3TDUC 3P8YA 1EIYB 4LG0A 5DYMA 2WC2A 3GFMA 3MZYA 3E6BA 1I81A 4YIFA
chains in the Genus database with same CATH superfamily
1VIFA 2DVEA 3KP4A 3H0GJ 1TUCA 1PKTA 4GBQA 1IDZA 2QSFX 4PDKA 4H0EA 3RKXA 2Q7GA 2GM4A 2JA2A 2RJDA 2XIDA 1PYSB 4HDUA 5F5WA 1QP2A 3OA6A 2XKOC 2ID6A 2AQFA 2OCCH 3FXUA 2L3QA 4ZYDA 1K6OA 2ZPGB 1WHGA 3RL6A 3BZ6A 3L00A 3RQ4A 2AKWB 3VYGA 4RA2A 3RNJA 3L2WA 2A0FB 4QVZA 2QA4Q 2AMCA 4LNSA 5LFAA 1PHTA 1YFSA 4YRRA 3HFZB 1VQNA 1IG7A 1QVFA 3CBPA 3M8JA 4A3LJ 1BIAA 3CMEI 1RACB 2ZSIB 1FBUA 4R79A 2HSEB 5BQTA 5KVRA 2R4GA 1QO0D 1TWGJ 3GP8A 4OMFB 3ME9A 2HGCA 3DBHB 5J3BA 3VS7A 1P2FA 3ASKA 4Z02A 1YS7A 3P9IA 1RR7A 3CCVA 5D6WA 3BG6A 5K1YA 2DTHA 2CGHA 2EFPA 3L2UA 3ER0A 2ZZGA 4BY1J 4IJAA 4P9FA 1ETVA 3P8HA 3RMSA 2DFFA 4LDWA 1YRNA 1PCXA 1YIJQ 1GCQA 3ZMTA 3HJEA 4M71A 2LSOA 5LRSA 2M02A 2KIQA 5KNLA 2LR8A 2CV0A 1RAIB 2V1DA 1EH6A 3GBGA 4PJNA 2DMPA 3HXUA 2KRMA 5GMKj 5HDKA 1JXSA 4PJOB 2GIZA 1TL8A 1HBXG 2ISZA 2KY9A 2DCEA 5GMKl 1ETQA 2A7YA 1X6BA 4LE9A 1YIOA 2DBBA 2CP6A 4M3EA 2KR3A 4IRIA 4L0YB 2QGUA 2I8DA 1GXPA 2QTXA 4OMOA 4I2OA 1G5VA 4CH3A 1NM7A 4EGZA 1PSFA 2X1EA 5CQGA 1TOVA 5K5OA 3QOEA 3CCEQ 4A4GA 2VGNA 1JJ6C 5BNGA 2W48A 4XLCA 3I4PA 2P0PA 4ZTUB 1T95A 2J6FA 3MF1A 4RB1A 4Q15A 1GRIA 1TBXA 2K85A 2LFBA 1Z7MA 3V7SA 1TW3A 1I3AA 3S32A 1U9NA 2F5EA 4B3AA 1ZQ3P 4X5OA 2EA2A 5LEJA 2AXLA 1S7OA 1HXDA 3GTQJ 1ENHA 2HDCA 1I4K1 1J09A 2QDYB 4M3FA 5H6RA 1W66A 3JSCA 5HDGA 4QPQA 3J7ZI 1HK9A 4FETA 2M7BA 2RA2A 1TWHJ 1O3RA 2C0TA 2J3LA 1UG2A 4FT8A 4DPGA 3I9V2 3Q1JA 2DFIA 2ZC2A 3EYYA 3O8HA 1IN7A 5IHIA 2DK5A 2R7SA 1CGPA 3Q9VA 1DUXC 5EGOA 4CGZA 3NFCA 4ATOA 2C0IA 2D0NA 1Y56A 5JFRA 2L02A 3HRSA 3X2QH 4P74A 5CKHA 4KN7X 1AWOA 1K9MU 3HOVJ 3VU3C 2VV5A 2MI6A 4AIKA 2L7FP 1X1BA 3FDRA 1RKTA 4II3A 4BQNA 3F8FA 3JB9J 2R5YB 2ISYA 2A61A 1D5YA 4HVCA 2LX7A 2QZ8A 1T08B 2IG0A 4BDZA 4CDGA 1W2BS 3CD6Q 4E7LA 3SFIA 2CFXA 5FGMA 5IT9K 1SVOA 4U0VA 3GF5A 2A6EF 2V26A 1SFUA 1XN7A 2K9LA 1HJDA 1WYDA 2E6ZA 2I4NA 2VXDA 5EZGA 3VWBA 2F5TX 3WODF 3TKYA 2JS2A 2K40A 2BZ8A 5AIPA 3VUBA 2CJJA 2DI3A 1DP7P 1RL2A 1T6SA 1LDDA 4D7MA 3B6CA 4B9XA 4J9IA 4H2YA 3SYTA 1Q1HA 2M4KA 1WCMJ 4KBMB 3M8FA 3GIBA 1OKRA 3EUHA 1VQ6Q 1ZGAA 2P8TA 1KHIA 1FC3A 1USTA 1ASZA 2QEXT 3CQTA 3S17J 3C2GA 2NOJB 5I21A 2M5WA 4QQ6A 3LC0A 1X3ZB 5LEKA 2M45A 4M77D 2HVRA 4EQQA 1VQ5Q 5FWBA 4AG2C 2OQRA 4M9SA 4BB7A 1UHSA 3BG5A 3H9QA 3E6DA 4XRFA 3OV8A 1JE8A 4DZPA 1YJWT 1KSWA 2E5QA 1POGA 3SEZA 4RGXA 2M30A 1MBJA 2H94A 3J81E 4UB6C 5EGOB 4BJ5C 3E6MA 4BXUA 1C0WA 1BM9A 2WAQN 4IO9F 4LD9K 4L5JA 4HZFA 1OYXA 5K7HA 5J4VA 2YUPA 4A3BJ 1FYLA 3WGIA 2EV5A 4M7AF 2RJEA 2X4XA 1KQ9A 5H2FC 4BGDA 3VS0A 3TP3A 4BE0A 1V5GA 3VYSB 4HT8A 3AL0B 3RPUA 1S6LA 5L3BA 1AOJA 2D0QB 2WY8Q 4LK0F 4G9YA 3ZQCA 1MDMB 1FT9A 3CC7T 2HTSA 3CC2I 2D9TA 2XMFA 3MEUA 3I35A 3QJYA 5GANh 3Q9SA 2FO0A 2FEIA 3PT9A 2RV8A 4K2EA 3U23A 3WE3A 2PQWA 4C92G 1YW8A 3BY6A 4M9ZA 2FB7A 1Y07A 3EHRA 2E1MB 3MEVA 4KICA 3FK7A 4G94A 1T0HA 3HOYJ 4ESJA 5KYYA 4WJ4A 2JA8J 1AD5A 4F92B 3BFMA 5CKTA 4NQWA 1SVMA 2QEXA 1GL5A 1XGNA 5IY5H 3K0LA 2FX0A 3BOQA 1I27A 3E3VA 1LKXA 2NXNB 4N9IA 4XU2A 1T0JA 1TQMA 1VQLI 1YJWA 1Q86R 2ZB9A 1S1NA 3NETA 3BCBA 4C8QB 3JRDA 2IVMA 1T38A 5E3NA 1PJRA 5KHDA 1ATIA 5IXBA 3QO8A 3GTMJ 3ZRGA 1JJ2P 2QENA 4PFZA 1J7KA 1VQ7T 1APLC 3J7AO 4ITVA 4XLHA 1Q82C 3O3KA 3FKJA 3KYCB 3OYBA 4MFEA 4RMOA 1HC8A 1WHJA 2KRCA 2X4HA 3BG9A 1OX8A 3RACA 2XDVA 1PD0A 4KULA 2GA1A 3V8LA 1I8FA 1X69A 4A4EA 3G71T 3CC7A 1OYIA 1BIBA 2GZWA 2KL4A 3CCQI 3P7NA 1AWCA 1UGVA 1Q81R 2YUQA 1M3AA 2AHJB 1MH4A 1JQQA 3RDVA 2IA2A 3M4PA 4X0GA 3ZQHA 4DW6A 9ATCB 2EJGA 1MNEA 1M90R 2IS2A 5FU6C 4Q48A 2QQ8A 2LTOA 5ED4A 1Y71A 4NL2A 2J06A 4XAXB 5D8KB 1G3TA 2M8GX 2EYYA 1IW7F 4PGGA 1KQ8A 4F04B 5E1WA 4H4KC 2LY9A 4OAYA 1L0WA 1RAAB 4MDXA 1I5ZA 5KYYB 3E5QA 2DMQA 2HZTA 3HYIA 4HF2A 3H3ZA 4EDUA 3WHBA 4L0ZB 2QQ9A 2ZCWA 4BL0B 2HOTA 4JRQA 1Q86U 4TVYA 3HKZN 3I9QA 1K8AC 4KYWA 2FEZA 3CCLQ 1IV8A 3DQVC 3DLLF 3CF5F 2E65A 3F70A 3FISA 1LUJB 3FX3A 1KD1R 5HLTA 2HKNA 3P8BB 1IO6A 2DVJA 1NK2P 2JT1A 4J6WA 3A8OB 1OCPA 3QPSA 1VQ7A 2ZXWH 4EMGA 2H8HA 3EG9A 3KUFA 3J7AY 3ZMUA 2COMA 2D8JA 2HZYA 4J9CA 5GAOr 2TCTA 2RQPA 3KEQA 2QVOA 5K7ZA 4TWAA 1HSTA 4BXXJ 3JSPA 2GLOA 2P5LC 3G71A 2F4MB 4E4HA 4A4FA 5AYFA 5LJ5g 2CT4A 3OL4A 1JXOA 2GQQA 3FMSA 2DYRH 3PUBA 1Q81U 3U9GA 2F69A 1WJAA 2JA5J 4G6TB 1QBJA 5DS9A 2HDWA 2DODA 2KYBA 1W0UA 1YJ9I 4AUXA 3OD1A 1T8IA 4P75C 3GPLA 1LPLA 4YPFA 3CXCS 5DUIA 1VUBA 3SZTA 3VEPA 2XAUA 1M90U 3OOUA 1OPKA 3R6SA 2P0LA 1FP2A 3EYIA 3LFUA 4CCJA 4KH0B 4B44A 3HBLA 1VQKI 1LFUP 2CP0A 1V5EA 1VQOI 4OINF 2HTJA 1ZX6A 5C53B 4J9FA 2NUZA 1OISA 1IRZA 4CC7A 3BT9A 2AK5A 1YFNA 2ROTA 1JHHA 5CVUA 5F0FA 5CVIA 2COBA 2RHSA 1V54H 2IPQX 3SHWA 4C92C 2SRCA 5D6YA 1E7OA 4XTVA 2XRNA 3H41A 5DM7F 3A98A 3V8KA 2DT5A 1BBYA 4NC6A 3PVLA 3CDLA 1W5CC 2PG4A 1B9NA 2XGDA 5AONA 2DU5A 2BZTA 4B3XA 3OMGA 2DDZA 1TWAJ 3PSFA 1HW5A 3LH0A 2L7ZA 3UNGC 2HNHA 3S16J 1ZAOA 3UKGA 5HS9A 4C9YA 4HOBA 2NS6A 1D3YA 1OCZH 1S72Q 4L9JA 4G7OF 4LUEA 1I6XA 1MBKA 3QPTA 1SD6A 4Y52J 2MD5A 3OBWA 2XPWA 2R3SA 5FWCA 4HT9A 1BJZA 1TP4A 1PC0A 4UUVA 4UY8I 4PSWA 2NNYA 2XK0A 1KU7A 3DKXA 2XSDC 4IIMA 1Y8RB 4S0HB 1LPQA 4HQMA 4Y15A 1RADB 3OYKA 1IJWC 2LQ8A 4JZ3A 2HZDA 1S9HA 4P71A 4M75B 4J9HA 4B9WA 2WAEA 4XM3A 4B1RA 1KC8U 3MZHA 2GXGA 2K9GA 4PJ0C 4QW2A 2K7AA 1ZSZC 4C2TA 2B7EA 3SFMA 3HG9A 4C3JJ 2FOWA 3HOUJ 3MMYB 3ZQLA 4FSSA 3OOPA 1TQPA 1WZOA 1UHMA 4CO8A 2RHYA 4F3QA 1HDPA 3RPUD 1UFFA 2R5AA 4MLOA 2LJ3A 4A69C 2LRDA 1M1GA 1O4XA 2EB7A 1A36A 1E17A 4HG2A 1UGPB 2NWMA 3BR0A 1NJIC 4RQEA 3CTAA 3OYMA 1AU7A 1B8IB 4M7DF 1RUWA 2F1LA 3PUFA 4Q6GA 3CUQA 1GV2A 4ORZA 1BC8C 3AAFA 3WG9A 5F1JA 4EPCA 2LDMA 2A6HF 1VQ9Q 1GBRA 4AT1B 4ZN3A 4J01A 5GAMj 2RC4A 2COWA 4AM3A 3BJ6A 4XBFA 5FU7C 2ABLA 2ETHA 3M9AA 3QU3A 1Z3XA 3VS1A 1PUFA 4AYBA 4C0DC 4M7AE 2E60A 1W5SA 2EAYA 3CMAT 4RB3C 1XX5A 3M0RA 2FNPA 2MW8A 2RO0A 3RYPA 1OJLA 1NG7A 3RI4A 1GFCA 4ZZDA 2BV6A 1B70A 5FLVA 4MNUA 2VIXA 2VPRA 1N9SA 1T33A 3HHTB 5CK9A 2LQWA 2JN0A 2VPLA 1UJ0A 2LDUA 4DYCA 2CQNA 2RD1A 4OB3B 3CJQB 5E79C 2DQ0A 1KQ2A 5KYWB 2W7NA 4N9HA 1G2BA 3LSGA 1G6NA 2JUFA 2D1HA 1BI0A 1ZLMA 4V2FA 3H9NA 3P8DA 3S2WA 1R49A 2LCCA 1UECA 5B1AH 4KGVB 3G4ST 4IUTA 3LL7A 1P7JA 2IP2A 4YDQA 3K70C 4M77G 3QYEA 2TRTA 4EMKA 1M27C 3ZMZA 1WJBA 4P3OA 2DMOA 4HLXA 1U8BA 4BBRJ 4HF0A 1YWPA 4BI4A 3ZMDA 3CMEQ 3M9QA 3S1RJ 2XDBA 3HRIA 1YI2I 3ABKH 5J8FA 4KT5C 1G59A 2XB0X 3JB9F 3H9GA 1J9IA 3F8BA 3DU6A 3NTHA 2JPBA 4WX9A 1B76A 4YFXF 2ADUA 1BJAA 1OYYA 4XLEA 4PL6A 1NBEB 5IHNA 2ED0A 5HNHA 2KNBB 1TUDA 1KQ0A 5CVJA 3X20B 5FB2A 3CMAA 2R57A 4BY7J 2O31A 3M0TA 1EKEA 2ZO4A 4ELYC 3PL8A 4Q5SF 2LRQA 5ILSA 3GEZA 1YGBA 3L1AA 2N8GA 4RTXA 1F9NA 5ILVA 4HNVA 3TREA 2ECZA 4I76A 3M55A 4FYXB 3PFYA 1H4QA 2R5MA 2XHCA 4JJBA 3DBLB 5LJ3e 4TTVA 1IL2A 2W25A 4LIUA 1F5TA 4GFBA 5HCKA 2RAEA 2O7OA 3CCJI 1BN5A 2LT4A 3GTLJ 3EFSA 2ZSHB 4A4KA 2LQKA 2VVKA 2C7IA 2GOMA 2LVMA 2VYTA 3H3UA 1QW1A 2VLAA 1JJ2A 3G4SA 2ZBKA 1CF7A 1G83A 3G6EI 1YHQT 4KDPA 2E2JJ 3NHNA 3O8GA 2K3FA 1PUEE 2P4RA 1K9MC 1JT6A 3U2RA 2RK2A 1IREB 3I55T 4CUGA 4JJDA 3DWLE 2NVXJ 2EYZA 2KKOA 4A4HA 3HDDA 2EWNA 1W1FA 1X1PA 2E1NA 3TEDA 4JOMA 1X1CA 2Q5HA 3CJRB 2VJJA 2OTJI 3HFVA 1FYFA 1IGUA 2DM1A 4G8XA 2DA5A 3HUGB 5F0HA 5LBQA 1E0EA 4PJLA 3AHUA 3IV5A 3VRZA 2JT4A 3SDGA 3NEMA 2KBTA 2ZGWA 1WYXA 3GNFB 5EG0A 1UTIA 1ZG1A 1ZHIA 1Q7YR 3TGNA 2LTPA 4PFOA 3ZFJA 1FOXA 2FMLA 5GTIC 3PNWC 2ZMEC 5GANg 4YRPA 1D0ZA 2BZYA 2P6SA 3DLLA 4YRIA 4P5NA 3LA7A 2X1CA 2P5IA 3UA6A 3HRTA 1WRJA 3A5ZB 2M7AA 1J5WA 1B7TA 4XNFA 4PNOA 3OW2S 1DQUA 1I5LA 1B9MA 2X4WA 3BWGA 3VSLA 1NJ6A 3OMYA 4KIFA 4R8HA 1YITI 2DMUA 3A1YA 2LKXA 3ABUA 5LJ3h 2WBMA 2HR3A 1BOAA 1YHQA 1BI3A 2DNUA 3JCMe 4N0AC 2JQ7A 2FPDA 2P5KA 2P0WA 3H8ZA 1AZGB 3JRIA 2E64A 3KZYA 4BEHA 3I55A 1HQCA 4YFKF 3VBBA 4CH4A 5EC7A 4B4CA 2PTKA 2F5VA 1UG1A 2HBPA 1X4OA 1VYVA 1Y7XA 4A12A 4HRIA 1AWWA 1MV0B 3KEOA 1BW6A 2LH9A 4FYWB 2V6CA 1VQ4T 3WTWC 4NUBA 1ZUYA 3BR2A 3RERA 4A0ZA 4MGRA 2HYGD 1JT0A 2DL5A 1QWFA 4EO4A 4GLMA 3B73A 4A3DJ 4M77C 3IL2A 2ELJA 3VS2A 1SD5A 3NENA 1XCBA 3M7GA 4D8DA 1ZK8A 2L54A 2DJIA 2DQ3A 3F72A 1PD1A 4TVRA 5LLQA 4K88A 3GZ6A 2JM8A 1TNSA 1Q7YU 2HU9A 2VQHA 3OYLA 4UP8A 3J81K 4EJVA 3TEGA 3IKLA 2VE8A 1H9TA 1PWTA 2YRDA 3CMQA 4OMLA 2KZVA 2LK2A 2O8XA 5J4YA 4U7DA 5C0MA 4L87A 2Z0WA 4XK8E 1TS9A 1HKTA 4CHUA 2RQRA 4XKBA 3LSTA 4ENNA 4U87A 1OOTA 4LG0A 2WC2A 3GFMA 1TUGB 3MZYA 1I81A 8AT1B 1X2GA 3OYYA 1ZRFA 2O2OA 4Q4ZF 3CC4T 1EZZB 1UMQA 2W4SA 1B7YA 1XC5A 2KXDA 4LNPA 4YFNF 1UZCA 5GJWB 2QA4I 1VQPT 4PJOC 4I7HA 4A6EA 3JRCA 1Y8QB 1WZ2A 4BACA 4UXNA 3VKIA 2FJ1A 3CCST 4CSWA 4PLLA 2QYZA 1AWJA 2ECCA 4XSXF 1KU2A 3TL4X 3JRAA 4A3KJ 5LJ5f 4AYBN 2MC4A 4OIPF 3E97A 2RHUA 1VQ4A 2VT3A 4OMYA 2WV0A 2OBPA 4MZPA 1RABB 4OB1B 1M8MA 3M54A 3H5AA 2D2WA 4UP7A 2AXTC 2PEXA 1WFXA 2XASA 2UXXA 4P1WA 3F21A 1QVFS 5A0GA 2RQUA 2KQWA 1HOMA 1BR2A 5JHUA 2QUFA 3FXMA 2JOYA 4M7DE 1O9SA 3BY7A 1NLOC 1UGQB 3OYIA 2DDAA 3LWIA 3J81Z 1O3TA 1SVLA 5CIUA 1ZRDA 2KLOA 4W97A 5GPAA 4C8QG 3ICAA 4WJ3M 2QHSA 2DQRA 2P0KA 4P72C 1VI0A 4MFDA 4O3MA 4HCZA 3M0QA 2P6TA 1T0FA 2IW5A 3S1QJ 4XU0A 1Z7UA 3ESWB 1SAXA 1YYVA 2DILA 3CEYA 5EDNA 3EH1A 2HOEA 3LSPA 3VYUB 2DW4A 4XICA 4M7DA 3NWTA 3IRRA 1Q86C 1BK2A 1VQPA 3GFLA 1SEUA 1NLPC 4LB6B 4XTXA 2OAUA 2E7WA 3CCSA 3PFSA 5D5WB 3Q3SA 2P7CB 3J7AF 1B7YB 2XC7A 3I58A 3REUA 1ZGWA 3IQLA 4LDUA 3B6AA 4LG3A 4N4OB 2JMAA 3ZEHA 3G1LA 3OS1A 2EQMA 3LSQA 2XF6A 5E20A 2OTLQ 1IF1A 4J6YA 3CCQQ 6AT1B 2V1RA 1F1ZA 1X1AA 4NL3A 4ASNA 2RPNA 4RGSA 2QGGA 1W2BP 1FBSA 3K10A 3HSRA 3QXEB 1E1TA 3FEOA 4IEJA 3QU6A 3DKYA 3E9GA 2Y0SA 5KAFC 2O6GE 5KNNA 4IUQA 2CJBA 2IRFG 1T56A 1Q81C 4BI3A 4CYCA 4AIJA 3QQAA 3QO5A 5L8RE 2I2LA 2I0NA 2EKHA 1PYVA 1B34A 1JKRC 2WB1A 3M4QA 2L5QA 3ZN1A 1X01A 1SSHA 1M90C 2ED1A 2CFOA 4CC4B 3KLNA 2DTRA 4IQ4A 2A69F 3I54A 2VJIA 4F7UB 1SANA 4DOWA 1A5JA 1JGGA 4OGEA 1M2VB 1FXXA 1FYMA 2OCEA 5J39A 4YIIA 4E7HA 4I98B 2CW0F 1XCVA 1NE8A 4E7IA 1N25A 5DD4A 5GAMd 4BDYA 1VQ8I 4XRSG 3K4JA 5KYXB 3GLLA 1ZSGA 1ZRCA 1DPUA 1BBZA 1IZ6A 2HKOA 2NUPA 2LJ0A 2A08A 1EOVA 1GLNA 3FBNB 2K3BA 4XTYA 1P7IA 1AVZC 5IXFA 1Z9QA 2X3WD 1Y96A 2K5FA 4CCOA 3HC7A 1TT0A 4JLIA 3BTIA 2MIOA 1HD3A 1X3UA 1SF9A 1QPIA 1YFRA 1SRYA 2I4OA 2PBIA 1D1CA 1BI1A 3OSVA 4ME7A 2Q1ZB 2PMZN 4FU6A 5GAN4 2QWWA 1YJ9Q 2DL7A 3GCMA 4UVBA 1YLFA 3AL0C 3PGGA 3EG2A 2P4WA 5M3FJ 3A0HC 4B8XA 3J80Z 3C4SA 1QCOA 1SSFA 2VBZA 1VQ6I 3LX7A 3FKIJ 1Z91A 1NNHA 2F6CA 2JN6A 2QBYA 2PJPA 3K4LA 4C5IA 4YRTA 4QVCA 1GXIE 4OP0A 2ZIOA 4VUBA 3H0DA 5FLXZ 2HFHA 1Z21A 2KDOA 2A5YB 2E1MC 3UDCA 1JUMA 5ERIA 1VQ5I 3VYRB 4HKEA 1K83J 5GAEJ 2LNVA 5IT3A 1AEYA 1KC8C 4Y13A 4HPQA 5FJ8J 2IT0A 4ELZC 2GNCA 2K2MA 5GAOp 2MH9A 2V79A 1EFWA 3EUHC 1YFTA 2VC1A 4A3CJ 1X2MA 2WSFE 5CKBA 3ECOA 3S3OA 2NVUB 4RQFA 2PNIA 3HTRA 2ELKA 4C8QC 1MSFC 4ZGJB 4QQGA 1UJYA 1X19A 4OF1A 3VS3A 4LDXA 1YNZA 5K5QA 4RKUE 3KE2A 1QKXA 3LA3A 3HOWJ 2DX1A 3OQ5A 3BC8A 4OLFA 1SAUA 3CCVI 3META 3MEWA 3ZQGA 5J26A 2RHQB 5JVTA 2A37A 4K11A 3NEUA 2JVGA 4QLCU 5CPRB 5CVRA 1LOJA 2YLBA 1K4SA 1DJ7B 3JREA 5ELOA 2QQAA 2K5IA 4EM2A 4ZDOA 3CCYA 4DBFA 2RKHA 4P3NA 4M75G 3HL2A 1VYTA 4RDUA 1R0CB 1SFXA 1FEXA 1Z3YA 1CQTA 4RAZA 2PQ8A 2Y2ZA 4M72A 2L3DA 3M59A 1A04A 3L4GA 2X9DA 1TWBA 2FMYA 1K76A 4OMZA 1S29A 4ZGDB 2O3FA 2XF5A 1M3CA 3CC4Q 3MKZA 2QBYB 5IH2A 1ON1A 5FFZA 2Q5IA 2X6XA 3MEYA 2MCNA 4IRHA 3FC3A 1HSJA 1OCTC 3FHZA 5C51B 4J7FA 1Z05A 1ZHFA 2Y69H 2QK0A 4RAFA 1MZBA 2J6KA 2E5NA 3CC2T 2PU9B 1YO5C 2VQGA 3S1NJ 1Z6RA 3CP8A 1VTNC 2G9WA 2DTIA 3KZIC 2DE0X 1Y57A 2PN6A 4B09A 3F22A 4EM1A 1B72A 4OIOF 2JTEA 2O88A 4K86A 4BJ6C 3TEHA 2MG4A 2Z99A 2HYFA 5HK0A 1RIOH 2I5UA 3WU2C 3A8MB 2XROA 2O61A 3M1EA 3EG1A 1J5YA 1KYZA 3INZA 3JRZA 2VC0A 1OFCX 2NAZA 3PQJA 1YJNQ 1E6GA 3MP1A 2ZJPF 2WV1A 1JBMA 1VQLT 2DD5A 2CH0A 3HZJA 2FQ3A 1TLHB 4EJTA 2AQEA 1D5VA 2JA7J 1DDNA 2GTJA 3WVEB 4J6XA 3C2HA 3QAHA 2HDDA 5FD5A 1XGMA 3KX2A 1FJLA 3HPWA 3HXLA 2M9UA 3A01A 4M7DD 1TH7A 2EQUA 4M3GA 2HKXA 3KLOA 1N75A 2X85A 2A28A 3J7YJ 4H2SA 1K6YA 1WHMA 2DETA 4C0ZA 3BQZA 2L2OA 1H8AC 3CO6C 2ROLA 1W4SA 5IYCJ 3L4GB 4OMMA 4BHBA 5LHHA 2YUOA 4FL6A 3CCRQ 2H1LA 2RF0A 3CC2A 3SZGA 3JRBA 3ABTA 3A5YA 1MHNA 2V8IA 2R7RA 1E3OC 1QPMA 4HV6A 1VOMA 1RESA 4YRGA 2DA4A 2NRAC 1AHJB 1K4US 3MFKA 4C92F 5KE3A 4G85A 2J3MA 2QQRA 3AG2H 1M1FA 3ASNH 1FWZA 5LJ3g 3TO9A 4LIVA 2K4BA 4AFQC 2BYVE 3NTIA 2DZCA 2UV1A 4P5OA 1W1WE 2ODRD 1QU3A 3GO5A 1P4AA 1RI7A 1UE9A 1XSXA 1YTYA 4KJZA 1HSQA 1OYWA 3JCMb 3JAMZ 3OIQA 1G51A 2IY5B 1VQLA 5I22A 1UJ8A 1YE9A 3E7LA 3GBQA 1RC9A 4RLQA 2OAWA 3Q0UA 2GXBA 5A2QZ 5EYRA 2KIUA 2H09A 3ZMSA 3UF4A 2K02A 3I56Q 2W0ZA 4RGUA 2HKQB 1KMNA 2XKPA 2OJED 3EHQA 2R7TA 2MC3A 4N0BA 2CP2A 4YCVA 4X6AJ 2FD5A 3I4MJ 4BU2A 2ZCFB 2RK1A 2DOEA 2HYJA 3I64A 3PCOA 3JB9D 3BR3A 3REXA 2DYSH 5J1YA 3A8HB 3ZBDA 2QHVA 4YTLA 4BQAA 2VOOA 1O57A 4HCKA 4M75C 3F8NA 3OS5A 3S3MA 5GAN6 1LFPA 3K4NA 3F9KA 2HPIA 4RLFA 1IGNA 2KJBA 5K5RA 3G6EQ 4M78A 1LDKB 4FE4A 2LMJA 4OIRF 2W24A 1ZG5A 5DCFA 3V42A 2GF7A 2ECBA 2CP7A 3ERED 2QHTA 4Z89A 4GXOA 2JTFA 2FU4A 5J8CA 2FOKA 4J83A 4LD6A 2JPCA 3REOA 2BW3B 2DRKA 1NYGA 2NVYJ 2KSSA 2OTJQ 1T3SA 3A7AA 5GAHJ 1PDNC 2JSCA 1LQ1A 2PUKB 1S7EA 2CQXA 2XDDA 1S72I 1W2BA 2VKEA 12ASA 2CJAA 1VQOT 5IP9J 3CUOA 3K2AA 4E70A 5A0DA 3H0IA 4DEXA 5D4SA 2XICA 1N77A 2UZKA 4CZZA 1FLIA 4KUIA 1BC7C 2QEXI 3KFVA 5C52B 3A02A 1NZ9A 2XD0A 2PJRA 3TO6A 2KISA 1VQMQ 2FHDA 3IH3A 3JRHA 5FKKA 1EVKA 1U1SA 5GAN7 1WJDA 1AWXA 5HLHA 2X0LA 3VYTB 1YJWI 2D45A 3SHFA 3VS6A 1ZELA 2VASA 1X3WB 3AT1B 5KK1A 1QVTA 3ZMVA 4G12A 5DEQA 2Q2EA 3DEEA 2Z3YA 4W1UA 1V76A 1Q7YC 3DTKA 1Z1DA 2ZT5A 2QM3A 4XR6A 1PKSA 1W6XA 4MZTA 4XL9A 2IS6A 3ONQA 1D3BB 2X51A 4JX5A 2BVLA 4E6KG 3W2AA 3DFGA 3LGFA 2FPEA 3A32A 2CSOA 1LVKA 3I4NJ 1XMAA 1ZG3A 4IHSA 2GBQA 1X6GA 2H1KA 2MSYA 4N4NB 2E41A 3A8LB 1BOBA 2X9HA 3HEFA 4M78B 2HAXA 2LCSA 3IALA 2PMUA 1VQNT 1TNTA 2ZXIA 4EJOA 3FMRA 2XGXA 3N4MA 4LVKA 3HXXA 2WAQA 3QWLA 5KH6A 1VQKA 3ZR8X 2M1HA 2ZPEB 4Z8AA 5F0CA 1VQOA 2K9NA 1R4NB 4JYKA 3T8TA 3ML6A 1VA7A 2DDBA 4I0BA 4MEXF 1XDSA 2EQRA 2ZR3A 3HXYA 3HRKA 1D8JA 3D7SB 1NEGA 1WLEA 2RQTA 1H4TA 4JX4A 5KYUA 2YX7A 1UDLA 3DLMA 2Y30A 3LSSA 5L3FA 1NH3A 1A6IA 5JLWA 3TBIA 4UNOA 3GNGA 2K79A 1G3YA 4AC0A 2ZNZA 5ICFA 4H2XA 1UB9A 2JJ7A 3FM5A 4B6MA 2PJRB 4CH7A 2GGRA 3IWFA 3ZCOA 1AZEA 3JV3A 2EYWA 1R7JA 1NYRA 2Z5UA 1MD0A 3CPWA 4DBRA 2B86A 7AT1B 4EGYA 2DU9A 2M8EA 1E3HA 3K7AJ 1QHGA 2DXTA 4XK4A 3HRMA 4KGXB 1MBFA 4KISA 3K69A 4YRMA 3HGYA 4EM0B 1MBHA 4YRVA 1WPKA 1ODDA 1E24A 3D0SA 4DYQA 3VFZA 3CQZJ 2LREA 4IHVA 1KHCA 4HDVA 2LVSA 1U9OA 1LNXA 4JUVA 3G71I 1SERA 2P7VB 4M77B 2RVCA 2C6YA 4AVPA 2FRYA 3WTSC 2WACA 2C06A 4G6DA 2EV0A 2P84A 1OULA 4U88A 5FLMJ 1D0YA 1QRYA 5GMKe 2JRMA 4I09A 3QYBA 2OZ6A 1JTYA 4NB5A 1OX9A 1RAEB 3A1PA 3QTCA 2KGTA 2EPFA 1DGWY 3OWTA 1MJ9A 3DKWA 2O0YA 1IZ1A 5J47A 3SWNB 1WSUA 3I59A 1YCYA 3KP7A 5F04A 2BY0A 1ACIA 3BZKA 4KMFA 1FX7A 1FP1D 4Z88A 5E3OA 4IXAA 2H8RA 4BI8B 1ABOA 2CQQA 3HGGA 2ZNYA 2E3HA 2HDAA 1MKMA 2LY1A 1ZR2A 1WJQA 3D5SC 1N8RU 3T9NA 2LC2A 2CP3A 1BKBA 5KYUB 3SFZA 2H8WA 3UPUA 5E17F 3LQQA 1HW2A 3C1DA 3IKMB 2FPFA 4G84A 3RTRA 2L9VA 3P9KA 4YELA 2HS5A 1K9MR 5BOXA 3EGXA 1Y0MA 3FLGA 4H2XB 1G5IA 5ICCA 3HXVA 1W7PA 4GO1A 3F8MA 2Z1DA 2DT7B 2ZFWA 3N5BB 1H9GA 2HD0A 2BE7D 1VF9A 4XLNF 3BP8A 1QHHD 4FQGA 1NPRA 4XN0A 2BZXA 3EG3A 2HQ5A 1MMGA 4GLKA 2YUNA 2I10A 2ZT7A 3BJAA 1WJ5A 2GOXB 2CS7A 1WI3A 3HKZA 2BXZA 2V1XA 4P3PA 1P92A 4WXHA 5F6FA 1JTXA 2LMDA 2KT1A 1PM3A 2AMCB 1OLTA 2FNAA 5FKOA 5GAN2 1W36C 2EFWA 4KA4A 3M58A 2XU8A 2E4HA 1ETKA 1NJ8A 2L3RA 2K5LA 3LGLA 4IX7A 3W3CA 4ZGEB 1GV5A 2L4AA 3JTHA 3CCJT 1MNDA 4GDFA 5GMKh 2YR2A 2PLYA 4C92E 3NARA 3ZL7C 4NDLA 2DFEA 1Y1VJ 4O6JA 3KXTA 1XSVA 4P9UA 3I59B 4M78D 1J3TA 2VODA 4UHTA 4RG8A 3A03A 4RCCA 4MQVA 2DQLA 1U06A 1K78A 1YRNB 4BH9A 4F7UG 1KQSP 3SB2A 3G1JA 5D5UB 2YWWA 5FO5A 3CESA 1NJ5A 3PIOF 2O01E 4TVAA 1YI2A 5DCMA 1A0NB 4XIDA 3OS0A 1VQ8Q 3HIFA 3MEAA 2PMFA 3F6VA 2WAFA 1WI9A 2IA0A 2JXBA 3BR1A 2Y4YA 3LSHA 3X24B 4M7DG 1EIYA 1OCCH 5F08A 2E7XA 4KIGA 2R7FA 1N9RA 1EV7A 4QKUA 1WX6A 5HNFA 1LFBA 1K4TA 2W1OA 1RKWA 2VOPA 3G7ZA 1RNLA 4XN3A 5GANe 1WGSA 3E6CC 2RN8A 5J1UA 3LWFA 2K7LA 3CCMT 4PJOF 4JS4A 4TQDA 1ZUKA 1D09B 1U3OA 1QVUA 4XRMA 1IAWA 2YSQA 4LVLA 3MCZA 2QQBA 2X48A 3CCJA 4H02A 4RM2A 2ACJA 4ON0A 1OI1A 1GT0C 1YITT 4Q47A 3E9HA 3ZQIA 3QKJA 1A31A 3VQXA 2RNJA 1WFWA 5IN1A 5HKCA 2W84A 2FL7A 4XSZF 2MD0A 2DA3A 3O6BB 1XS9A 4I6ZA 2E2IJ 2VKVA 3QYGB 1QVFP 1HC7A 5FKLA 3RUXA 3UA7A 4D5FA 5ICGA 1IB8A 2OI3A 3S1MJ 1WJSA 1JKQC 3IWZA 2NUTA 2HXIA 4YRCA 3HXWA 4GY5A 3MKDA 2RM4A 1AT1B 1FMKA 4J9GA 3CCUT 2CYYA 1IGQA 1B3QA 3K4CA 1K79A 1VQNQ 1T2KA 2HL3A 2X1DA 2LNBA 1RUOA 1FNNA 1E22A 2EZHA 2LY2A 5CAIA 4FHTA 2E35A 5IP7J 3LSRA 1CSKA 2ZCEA 1YOVB 4OIQF 3JB9G 1QE0A 2QYOA 4CCLA 4OWRB 2G7UA 2V1QA 2VN2A 3LLRA 3FXKA 1EIYB 2EGAA 3CCVQ 1X2NA 4RMNA 5DYMA 2NS7A 3KYDB 1XJWB 2XDPA 2EIJH 2KQRA 3CCMA 2DN0A 1ITYA 4CXFA 4KMUX 2YXYA 3TUPA 4RTWA 5ICEA 1L0OC 2FA5A 2HWVA 2ESWA 4Y3OA 3V7CA 1USYC 1HDDC 1QZYA 3DCFA 3NPFA 3ELKA 3Q0WA 1H8KA 2CWEA 5TJJA 3GVAA 5CQXA 3ZXSA 4RB2C 1ZQ1A 1YITA 2QGFB 1PP7U 1QGPA 1U5TA 4V2GA 4LXCA 5KCMA 4S04A 1QNTA 2C8MA 5EJCA 4U0WA 2JK3A 4TVWA 3JCMQ 3GZ5A 2CRGA 1QVPA 3MN2A 2K3PA 4Z2YA 2KIMA 2LBFA 2DA6A 1A35A 1ZYRF 3WXMB 3BE3A 3TQNA 3G4SI 1ONVA 3VRYA 4LVMA 4XTUA 3OYJA 3VS5A 2L89A 1R5HA 5HK3A 5HS8A 1UUEA 1ULYA 1PSEA 1KGSA 1RETA 3HRUA 4IF4A 1OMIA 4HX4A 2NVQJ 2R7ZJ 3CCUA 4J9BA 1M3BA 1U3EM 2NUTB 4BQQA 1IN4A 2BY3A 4JRIA 4FM4B 4DJAA 4HVVA 2V1NA 3MP8A 3S2DJ 2XSJC 2KXCA 2CYZB 2M1BA 2B0LA 5FROA 1ADYA 4IPAA 1B6AA 3K6GA 3HOTA 3OIPA 5LGUA 2CV1A 1O75A 11ASA 4XLPF 3PZCA 1TZLA 1YIJT 4JPBW 3JCMf 1K7AA 2CU7A 3LSMA 2OTLI 3MEXA 2DD4A 1K1ZA 3WGGA 3GTPJ 1B59A 1R22A 1XG1A 4YEJA 5FKMA 4J00A 1DPRA 1I3QJ 4RGRA 3KP2A 4HF1A 2E3IA 3T0YA 1LCKA 4KRTA 3S15J 4RAYA 2STTA 1IN6A 2GBYA 1W7PD 2DTOA 5E3LA 3VUZA 4YRNA 3L09A 3SQNA 2Y90A 2DL4A 5AIQA 2QA4A 4KT6A 1I1SA 2F5KA 1U5TB 5LGNA 1BYMA 2YLCA 1I6HJ 2ZKZA 2V9KA 2GAUA 2W00A 1BBUA 2YRVA 3J80E 4NQWB 3TSZA 2FBIA 3K1NA 2O4XA 2RI3A 2LJ1A 3CCET 1YHQI 3OYHA 3QDRB 2EQIA 2LQNA 4BBSJ 2DOFA 1FIAA 1I1JA 1ETWA 5J40A 3WHCA 4FSXA 3MQ0A 3RSNA 1E1OA 2X4JA 4DBHA 5FLXE 4A3EJ 2CGPA 4YREA 4L6V5 4J9DA 2RHZA 3UFGA 4DNCA 3T5XA 4JRKA 1T3LA 2V1UA 2X4YA 1K8AU 1SC7A 3EDPA 1YIJA 4XQ3A 3BW1A 2WSEE 1RIQA 2Y9YA 5KCHA 5K1PA 2YUSA 1RI0A 1YW9A 3PFIA 3A7UA 3SDBA 1BR4A 4C8QF 3FIWA 3GTOJ 1ZR4A 5H6QA 2FRWA 4O5VA 3AFHA 1ZGJA 2CS3A 1I07A 2QG9B 1QZEA 4NNJA 1HKQA 3PMTA 5EEGA 5M5XJ 1B1BA 4E7ZA 3QZ5B 3RDIA 1R0BG 1AOYA 1P9QC 2CUEA 1FIPA 3VODA 5B66C 1KC8R 1QA6A 4WTOB 2G4CA 1MNMC 3AG3H 2ZMEA 3EFRA 4N4GA 3CDHA 3UH0A 3W3SA 1NEBA 4HQEA 3CD6T 3T1BA 3TOBA 1TT5B 2DT6A 3F23A 1S8NA 1OZ2A 3CCEA 2L7KA 5FRMA 2MH2A 3CBOA 2JNGA 1O3SA 2JM9A 5GAOq 5LJ5j 4M4ZA 2DMNA 2EJFA 3VPRA 3NWSA 1Z9CA 2ZZFA 2DPPB 1K61A 1PVEA 1DU6A 1I39A 1UAAA 3GMEA 3PNVA 2O4XB 4P73C 2CZ1B 1AHDP 3OYEA 3VB2A 2BGCA 3O2PE 3D1NI 4XTWA 1O7FA 4FW2A 2LD5A 4HWTA 1BCMA 4HWSA 4BHPA 3FXJA 4F91B 2F2EA 1EX4A 2EBPA 3W6KB 3G1ZA 1X2KA 2F2VA 2F5CA 3EG9B 4L5IA 4YP0A 3BG3A 5E8IA 2D8HA 2E2HJ 2IA1A 2JRTA 1KU9A 2JSPA 4B47A 3HFNA 1VQ5T 4XQFA 2K4YA 4UVAA 2QEXQ 1A6QA 1F4KA 3LYIA 2M0CA 4QTRA 1MSEC 4HXJA 1QVGS 2VC8A 3A7RA 1NHAA 2IIMA 3PIOA 3VYHB 1KU3A 1R5GA 3OL3A 4JJCA 1YJWQ 1KQSA 5D6EA 2RN7A 3QPHA 4PJOE 1SFOJ 1W4MA 3DTIA 1WJCA 2ARTA 3M5AA 3CD6A 2R7UA 2XTIA 3CC4I 2O9VA 3UT1A 1Y39A 4TV7A 1VQPI 2ZJQF 2DFHA 1V5FA 5GAMe 3QPLA 2EYQA 3DV8A 2DO7A 1WWXA 5JLXA 4BQOA 3CCSI 1IRFA 4NCXA 2V9VA 2K4JA 1UHWA 2RHSB 4M78G 4J15A 3QOPA 5F1RA 1R23A 4PJOA 2VXEA 5GAGJ 4XOTA 2CV2A 4KQEA 1MIJA 3CC7Q 1V29B 1ETXA 4XLFA 5HGQA 1VQ6A 2L4MA 4RTZA 1TWCJ 1KIKA 4PCQA 2CIMA 4XTZA 4LOCA 5IP6A 2IGNA 2XAHA 4RTVA 3QSUA 1YJNI 1MJAA 1QQIA 5JI6A 3HSBA 4HEA2 3L2RA 3NGPA 3KETA 1QLYA 4ZDLA 2LT1A 1VQ5A 5E18F 1WQWA 2JUCA 1NJIU 2VBYA 1RPWA 2DLLA 4RB0A 2KT8A 2JTVA 2B8AA 5D4RA 2EYXA 4Y28E 5M5WJ 1C6VX 3VQYA 2LLKA 4PUSA 4F14A 1XGSA 2M3AA 1ZH5A 3JAME 5CLSA 2RNAA 2OAZA 3R6NA 3QUIA 3FIFA 5B5EC 1WGXA 3SJMA 2CDTA 3REAB 3MD2A 2DJZA 1W5TA 1OU9A 3KP5A 3K70D 3SDZA 1RR8C 2ESHA 5A2QE 1N8RC 4P72A 2VKNA 2VGMA 3MF2A 1VQ7Q 4EATA 2R92J 4M7AA 3JB9I 3SD4A 3RQIA 1EVLA 4HYEA 3CCRI 3H0HA 3S93A 4BY6B 5LHGA 2Y31A 2DYIA 1Y0UA 4Z6YA 2JVHA 3CDIA 5GAMh 3VSKA 1O7LA 5GAN3 1IRXA 2EZKA 3L42A 4BWAA 1FPQA 2CG4A 3GLXA 4M75F 3G71Q 3M0UA 1RAFB 2ICWG 1BW5A 3BDUA 3JTGA 1XNIA 3JCMV 3EGUA 4C2MJ 5IAYA 4TQFA 2R5YA 1EIFA 3QBYA 3CUQB 4YRJA 1EH8A 3WGHA 3GW2A 4AVZA 1QP3A 2BIVA 3DEUA 1C1AA 2V9PA 1V1CA 3E2UA 4OOIA 2PVGB 2DL8A 3ZN0A 2LZ6B 2IJLA 3CCLT 3BTCA 1FOKA 3DSQA 3QYFA 2VE9A 3OY9A 5C6SA 2YX4A 1JRIA 2QHUA 3PO2J 3I56I 2K9SA 3M3YJ 1PUFB 1WJRA 5IYDJ 2ARUA 1S3JA 4OU0A 2X35A 3V7RA 1H4VB 2LP0A 1B70B 2ZNIA 2J7IA 1VZ0A 3K4KA 3GTJJ 1ZN2A 1GGMA 1AKHA 4CZCA 1BB9A 1F43A 3WTUC 1WU7A 3T8RA 2G6FX 5TISC 4CCNA 3KFWX 5IHKA 3OYAA 5LL6S 1STZA 2M4GA 2HQXA 2OV7A 5GAOn 1XQHA 1OCRH 4AMCA 3RPQA 3I53A 3RGLA 2DAQA 3EH2A 3BR5A 1GDTA 4M7AB 2M16A 2PVDB 1G3WA 5HODA 2ZPHB 4YRSA 4L5EA 1HLVA 1NG6A 3EG0A 2M0OA 5TGTA 3C12A 3CZ6A 3DEWA 4EMKB 2DEUA 1KOGA 4L59A 1R5ID 3H1CA 2L8DA 4R56A 4AIDA 4XU3A 1SHFA 4IUPA 3WE2A 4II2A 4HCBA 4M78C 3G73A 1PP8F 1TG0A 2QKLB 3TEEA 4C30A 1Y6IA 3VDXA 3Q0VA 1BL0A 1WPYA 1RZ4A 5CJ9A 3CCLA 4XEOA 2B9SA 4C3HJ 5CO7A 4EVIA 2PMZA 3R4KA 3E0JB 1VQMI 2W57A 2A5WA 5CVVA 1MDMA 3HSEA 2E1HA 4YG2F 4QT7A 5EZHA 2WA0A 2EBIA 2XVCA 1IHVA 2W82A 4JBAA 2CUDA 4L9VA 3M0PA 1R36A 3NAUA 2LG4A 4YRQA 4C8QE 5K7FA 1R77A 2C0OA 1EH7A 2EFOA 3DPLC 2RQQA 3FZVA 1X1DA 1J75A 3G2BA 2LP5A 5JHFA 4X9DA 4PLIA 1IDYA 5HDNA 2XV4S 2RREA 3MCAB 3D5LA 2FYKA 2QSHX 1S72T 1OR7A 1G4DA 4J7IA 3LSKA 2L2PA 1IN5A 1AKHB 2K57A 5CKFA 1WDXA 1CF7B 3OSFA 2W10A 4OMNA 1BI2A 5CQYA 1WHLA 3L9FA 3DKMA 4C8QA 3QJ6A 4C5HA 5GANj 4V19K 2IGMA 4GRIA 4FISA 2J5OA 3PMIA 1ZLKA 3WTYC 1QF6A 4BD3A 2P81A 3IAM2 5E3IA 3H3VK 4A3MJ 2Z16A 3M4GA 5M3MJ 2GCXA 4NBQA 4NOYA 4DOZA 2D5VA 5CQEA 4FX0A 4H2TA 1M9SA 3FF5A 4LMYA 2E10A 1FYNA 4RBOA 1S7AA 1D8KA 4MIMA 2MK5A 3V4GA 4IOCF 3GZNB 2Q7EA 1IHWA 1KA8A 3I0TA 4J19A 1JI8A 4AFSC 5IT9Z 4EX5A 3KZZA 4M6VA 4ABZA 1R9TJ 5EG0B 2R0QC 4JP0A 3SWNC 3TP0A 4AU7A 2EH3A 3CJTB 3GOXA 3QO3A 3H0FA 3MHXA 1ZA2B 4JJNK 1GFDA 4PJOD 3SEMA 3OYFA 5GAN5 3KCCA 2YDLA 3E9FA 3QIIA 4FT2A 1WI7A 1UCRA 1S72A 1QCFA 1VQ9T 2MF2A 2HQHA 3HOZJ 2E70A 3KFUA 3RZDJ 2DJQA 1H88C 2LX9A 3L2CA 2K6DA 4WCIA 3JCMc 2RHIA 3R61A 2GA2A 4ZJZA 4AG1C 3CPWS 4IUVA 3RIRA 4PSXA 2K3XA 3BQYA 4Y92A 4HBLA 2ZPIB 4FYYB 3B02A 4BEHB 4I01A 3KPHA 3LA2A 4A3FJ 3NTKA 1USSA 1ZLJA 1REPC 2FQ4A 4A0YA 5CKEA 2NVTJ 3K1MA 3R0JA 5GPCA 1D1BA 2EIKH 4A0XA 2KT0A 3ERMA 2O8KA 3CMAQ 3K1PA 4XRSA 2OC6A 2DXUA 4MZMA 1Z9ZA 4D5CA 1H92A 5LJ5d 2Y4XA 4KH1B 4BKXA 3P8TA 2YSRA 3U1DA 4KIBA 4BAYA 4U7BA 1GVJA 3QNEA 5A0LA 4YRLA 1H89C 2X6OA 2OU2A 4M7AD 2YS9A 4KN4X 3ABLH 2XAQA 4IHWA 5DM6F 3OIOA 1LJ9A 2ESNA 2VUMJ 2M2EA 2ZXHA 3G4SQ 5DUKA 1KFZA 3RBBB 1TWFJ 4CRIA 1XTDA 4OGCA 1KMMA 1XDUA 4JZ4A 2ZINA 3FDYA 1YG2A 3MAJA 2DXBA 1V4RA 3CMET 3S3NA 2A3LA 3DU5A 2OJ2A 2G0EA 1VQ9A 2XGTA 2X6WA 4JDSA 4DGWB 2R7WA 5LHIA 2E1OA 2IAIA 4UV9A 1ABQA 1GCQC 5C3EJ 2GIVA 1RLQC 2HQRA 4LG0B 3IRQA 3L2QA 3C2BA 1H641 4X34A 4NHJA 4HA8A 1MGTA 3PIPF 3QO7A 2DA1A 1KONA 4M9XA 4PJJA 4WI1A 3KP6A 2WWYA 1J2XA 1JJ8C 2MA3A 4LLGF 3OSSC 3M4YA 2XGCA 4A5NA 5F64A 2XHKA 4XKWA 2XGEA 3FXRA 1HKSA 1KJWA 4UV8A 4Y4RA 3A74A 2JA6J 3I5UA 1X56A 2KPMA 2HPMA 4HVUA 4LK1F 4HLYA 1WIEA 2F4OB 1IC8A 4A93J 4DYRA 3WTZA 2QDLA 3J80K 3OMCA 4M6YA 3SXYA 4M75E 4G7HF 2KI7A 2ZXJA 3L1PA 5J3LA 4LDYA 3WTVC 3PO3J 3PNTA 2VBXA 4HNUA 2LYCA 3PSIA 1X6OA 2EV6A 3I5RA 2H3JA 3ZQQA 5FLXK 3R60A 2D1VA 1YQAA 2VUBA 1N78A 2PMEA 4DBQA 4AWXB 1JKPC 5KYNA 3W2WA 4A5MA 2DEQA 1FSHA 3HL8A 1K0XA 1H4SA 1YHQQ 2Q7HA 2HQAA 1B07A 3COAC 3HFOA 2R58A 3QZ9B 2M0MA 2K9MA 1ZTRA 3CMEA 4I0AA 3CF2A 2RQVA 1WXBA 4RM3A 4XKVA 3I55Q 4XMYA 4M75A 4PGHA 5L3EA 4II1A 4IHYA 3Q5FA 5CKDA 1MUZA 1DGRM 2L0KA 2AS5F 2DA9A 4RS8A 2WADA 5GP9A 1QMCA 2AZVA 4HCCA 1FOWA 5EEHA 3LMMA 2MMPA 4HX7A 4M7DB 5DLQE 2D1XA 2BHYA 3ZP5A 4B43A 4OB0B 3FWEA 4P74C 1R6RA 1X75C 2M34A 1TW2A 4XEMA 2Z2SB 2OD5A 3F6OA 3GFIA 1N6AA 5DY9A 4ZYAA 9ANTA 1HW1A 1LEAA 1NPPA 4ZN1A 1HA8A 2VJ4A 2J6OA 2PUOB 1YFHA 5IYBJ 1KD1U 1B8IA 1M1KR 4YROA 2HEQA 1ADJA 4D8KA 1SEMA 4MEYF 3NMZC 3QODA 4PHCA 2QCOA 3A0BC 3WTXC 4IUUA 1YW7A 2ZT6A 2G3RA 1YX5A 2F4IA 4FTHA 1U6GA 5F27A 4XLAA 4CYCB 1Y0NA 4GYGA 2E5KA 2R7XA 1MV3A 5BS6A 3GXOA 2O9LA 2IS1A 1B34B 2Z9OA 1XD7A 4C8QD 4LD5A 2DZ9A 2Z33A 3M57A 5DM7R 1C0AA 1J0RA 1FTZA 5J1RA 3QWXX 1VQNI 4C5EA 5M5YJ 5LRRA 3BTJA 3FXOA 5JVGF 4IZZA 1XOVA 4E7KA 5I2SA 5KYWA 2CMPA 2QF7A 1VQ4Q 2A05A 4CI0C 5C4JJ 3HM5A 3WTTC 2NUPB 5BPDA 3DTEA 1OQYA 4F52A 1FOYA 2L3SA 1YB3A 5EF6A 2DJNA 4N4HA 2FUG2 5D7UA 1Y96B 5GAMg 1YCSB 2L9RA 1H0MA 4F7UF 2BTTA 4BS9A 4XONA 3M0SA 4ZTFA 4UP9A 2ATCB 1WLPB 4A54A 2R5ZA 3P9CA 2IS4A 4XOPA 2WY7Q 3W2VA 4A63B 1M1KU 2OX7A 3IKVA 2LF7A 1N5ZA 4RUGA 3GTGJ 2VQLA 2KZGA 2GQVA 3BZCA 3TDUC 1PNJA 1IO2A 2EIFA 4JS5A 1OPLA 3E6BA 1G2HA 4KUDK 5KAIC 2EIMH 4F7ZA 1WQ7A 4MDWA 4E51A 4JQFA 2DTZA 2JTMA 1MMSA 4WCGA 4MMKA 3TQ7P 3HB9A 1ZKGA 4E7SA 1M30A 3F8CA 1YWOA 2XKOA 4LFUA 2AIRB 2OPTA 1VQPQ 4A3JJ 4RMFA 1U5SA 4YCUA 4BE1A 3RYRA 4ZTJA 1VYUA 4HWRA 2UWMA 3CCSQ 1U5TC 1G3SA 5EEAA 3HKSA 3C0CA 1KZHA 1IUYA 4MQ9F 2H27A 2RNGA 5FD6A 3RMQA 1HTTA 2DIQA 1ZUUA 3R0AA 3HHGA 1ERDA 1P4XA 3QDFA 3BJUA 3FJ5A 2A07F 4J5YA 2EQKA 1HCRA 2KYMA 3BDDA 2L7MP 4AIHA 3X25B 1VIEA 3OYGA 2VT2A 4XKCA 1RUNA 2EPDA 1MJBA 3JAMK 4L5GA 1GCPA 3WU1B 4Y33A 4UUTA 2A6TA 2Y0MA 2IGKA 3SEQA 4A3IJ 4L9TA 1UG0A 2K86A 3FXQA 2PMHA 4M6XA 3HHHA 5GANf 2HVSA 2HL5C 3VV0A 5A2QK 2EJ9A 3FJPA 3DB3A 4RTUA 2R5ZB 1TSFA 1WXTA 4X9CA 2MWOA 3PNYA 5HS7A 2KAFA 3A4CA 4ZYEA 3H5NA 1NYFA 3HUGA 3PM1A 2KDSA 5TRDA 1IXCA 2E3CA 2JUGA 2VI6A 3GWZA 2DBKA 2KFDA 1BR1A 5GANd 1IXDA 4PZJA 4OB2B 2BXYA 3ERRA 2CUBA 2XAJA 2VL8A 2EL9A 3CXCP 2AT1B 4NS5A 2L01A 2FE3A 2KEAA 2VKDA 2VJ5A 3TW6A 2NYXA 4QIWN 3TDZC 2AKKA 1SRLA 4GYIA 2CUJA 4XORA 4FE7A 1X58A 1BU1A 3V8JA 5E8GA 4IRGA 1WJEA 2OTLT 1OZ3A 1EFNA 3CCQT 2YU3A 2HEOA 3K4BA 1GHCA 2KE9A 2J5PA 2DXIA 1F1BB 1MMNA 3A5ZA 4LVJA 3S14J 1GVDA 4QPOA 1WHUA 4WWCA 3CP2A 4A2UA 4BJTA 4CS2A 2K5CA 4KR2A 4PJOG 2MPXC 2XRLA 2CSQA 3JCMJ 3UGQA 3O8VA 3DB4A 2HVQA 4LITA 3BR6A 3N05A 3EUKL 1B72B 2IVWA 2XI9A 3TEHB 4LGWA 4UC4A 3BPXA 3M1CA 4I99C 3MPUB 4RDXA 3DXJF 2VBWA 1KK7A 3RF1A 4E2FB 4V2SA 1QCNA 3ZPLA 3RZOJ 2M0YA 5K1XA 2BVMA 1OQKA 2QXFA 1IRGA 4I02A 5DD8A 4PJMA 2ARSA 5M9OA 3ZQFA 3KYLA 4HW0A 5J6XA 1FYKA 4M75D 5IOZA 1Q1VA 4C3IJ 4ZYHA 1X2QA 1X54A 1E6HA 2YT6A 5LJ3j 2X6YA 1WVRA 3JRFA 1YN8A 2ZT8A 2E12A 2LKSA 2COYA 2MWPA 1NK3P 1R1UA 1Y1WJ 3A01B 4HSTA 1QVGP 4CS4A 2OZUA 1K73R 2ZAEA 3PIPA 2ZJRF 2CH4W 2OTLA 3CCQA 4M7AG 2Y9ZA 4FT4A 3EUAA 5E3MA 3L2VA 2NS0A 2HMAA 1U78A 2JW4A 2ZPBB 1EF4A 2FZGB 1R4MB 1SMTA 1YJ9T 2ID3A 3DF8A 3CCMI 2CW8A 4IURA 2HBWA 1OV3A 1U2WA 1JUSA 3BG7A 4BYYA 2ZNJA 3VOEA 3W6VA 3EETA 4EIKA 3BCAA 3F3XA 2L0AA 4ENMA 1VQKT 4A6DA 1X27A 3MKLA 2QI2A 4HAMA 1IN8A 1OCOH 3R6OA 1MMDA 1ASYA 4F93B 1NJ1A 1LB2A 3PJRA 2PI0A 2LNHB 1JXMA 1RAHB 1NYQA 4FIBA 2DKGA 4ZIBA 1YX3A 1JHFA 2DXCA 4YRFA 3TU4K 1UFMA 3BPVA 1TC3C 3UGTA 1QKWA 4LLLA 4Q5WA 1SMYF 5IOYA 3JR9A 2XAFA 4PG3A 3LSIA 3HTSB 3PVQA 1AA7A 1FMWA 1NG2A 3FMQA 4E7JA 1UEBA 2YHTA 4EMHA 2FZCB 4FASD 2GTOA 2TDXA 4KNYA 4A53A 2DPDA 2ZJ2A 3IKTA 3CCUI 3EQLF 1OU8A 2XPUA 4LUDA 1GBQA 4UVCA 1UB4A 1R58A 3RCOA 3H92A 3W6JB 3IUOA 3IP4B 2UXNA 2EZLA 1K73U 1KQSS 3NRVA 3E5UA 5HLGA 2HI3A 3RESA 1HYOA 3PCOB 1SHGA 1JO8A 1ETYA 1Z7NA 5GMKi 5E1XA 1G5HA 4P71C 1SFEA 1JU5C 2V7FA 4RTTA 2A68F 4ANJA 3JCUC 2MABA 4O2DA 4RAGA 1YJ9A 4F55A 5LGTA 3WQZA 2HQNA 2UUZA 1EQRA 4D6WA 3CC7I 1Z6TA 4R1HA 1VNDA 1XB4A 2EGCA 4D7NA 5L3CA 3LW5E 4BY6C 3H5RA 4YCWA 2DLPA 4C5GA