3V8JA

Crystal structure of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
306
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords Biotin ligase
total genus 98
structure length 306
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8jA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8jA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8jA02
5K1XA 5ELOA 4LG0A 1QQIA 2GIVA 3DFGA 2DK8A 5JHUA 3MQ0A 5FLXK 4WF2A 5LJ5e 3KCCA 1F5TA 2M5WA 4K86A 4ENMA 2VODA 2Z99A 1H641 2XIGA 2IP2A 4N0BA 3BY6A 3SB2A 5JR3A 3LQRA 4E70A 4YDQA 3RF1A 2VBZA 1R00A 4J6WA 3P7NA 1R1TA 3HFZB 1T0FA 5L3DA 2UXXA 1LEAA 2DI3A 2ZMEA 3ECOA 3E6CC 3JCMJ 3GW2A 4OLFA 3INZA 3JCMe 3KP5A 2DZ9A 1P4WA 1EH8A 2L3DA 1B59A 1GXPA 2W25A 3IALA 2K57A 4HWSA 5A2QZ 2ZBKA 4EGZA 4U88A 5LGUA 1LNXA 4HX8A 5DY9A 4NL2A 3RERA 4J15A 5DCFA 1HXDA 1USTA 4TVAB 2VC8A 3F8BA 1X01A 3HFVA 2IA1A 2AMCA 5E18F 2V1UA 2LNBA 2FF4A 2FYKA 3LSSA 4U0WA 1Z1DA 3E5QA 4HT8A 1EIYB 4J5YA 2XRNA 3QUIA 4HOBA 2H94A 3Q9SA 2RB6A 5LEJA 1GXQA 2QBYA 4PJOB 4KR3A 5BQTA 1E2XA 3WTZA 5LJ3j 1TH7A 3ZQ7A 1FBQA 1ODDA 1S7OA 1I1GA 4GGGA 4M71A 1SESA 1B4AA 1WSUA 1MJAA 5TRDA 3R61A 1DDNA 5CYVA 2IW5A 3RUXA 2EAYA 2Q8KA 3SWNC 5DCMB 3JB9F 2ZR3A 1KGSA 1TNSA 5DYMA 4JRIA 3LC0A 4M7DA 3QO5A 1QE0A 4F7UA 2JT1A 3GWZA 1EQRA 2Z5UA 5FFZA 4BWAA 3HIFA 3D0SA 1P92A 2J5OA 2F5DA 3HRIA 4PJOF 2RM4A 3IWFA 4A5NA 1NJ5A 2V1XA 3VODA 2WWYA 1S8NA 3WTSC 4P3NA 3VBBA 1KA8A 1FSEA 4UV8A 1FBUA 3KETA 2RDPA 1U6GA 3GFLA 1Z6TA 4HWTA 2K4BA 2LKPA 3ZN0A 2DQ3A 1JGSA 3HTZA 1L0WA 2H6CA 4ZYDA 5K5RA 3L2CA 2YX7A 4KDPA 1BIAA 3PCOA 4G84A 2PFBA 2XASA 3T5XA 3J80K 2RD1A 4P74A 2FOKA 4C8QG 2G4CA 4LLGF 4YRIA 2ZIOA 2QHSA 2RHSB 3HRSA 2GAUA 4KA4A 2YLBA 3ML6A 2YHTA 3W3SA 4EJUA 5GAMf 2HOEA 5EEGA 4DPGA 5DEQA 2LF8A 3L7WA 3W6JB 4RQEA 4PNOA 4XTVA 3C18A 1ASZA 1MDMA 5GAOq 2B0LA 3VQVA 1YW9A 2KJCA 3IG2A 2EFQA 3PZCA 3JCMf 2VE8A 5GANe 2VXEA 4J6XA 2HQRA 4WX9A 2G9WA 1OPCA 1LQ1A 2QVOA 3QU6A 3ZN1A 1W7PD 2OZ6A 4OOIA 5LJ5j 1KQ0A 4U0VA 1R5HA 4YRJA 2MLGA 1U1SA 4E51A 2XTIA 3GZ5A 4L18B 5D8LB 3UGQA 5GAN7 2R7FA 2XUBA 2RN7A 5HS8A 4HWPA 3JCMg 2P5VA 4P9UA 1FX7A 4IRHA 2E1CA 4RCCA 3ROUA 1IN7A 3R4KA 2XAGA 4XLPF 3OV8A 1IXCA 2Z33A 2YR2A 1VQZA 1XGNA 1Z91A 3BY7A 1BBUA 5GAN8 2ZNYA 2CGHA 1ZREA 3JCMP 4YIFA 2EB7A 4BYYA 2PLYA 4ZYEA 5ICFA 1B7YB 4S05A 4AD9A 1X56A 1TW3A 1SERA 3ABTA 3KLOA 4M6YA 4QVDA 1IL2A 1MJBA 3ABUA 2K02A 1ADYA 2ZZGA 1G3SA 2CW0F 2DJZA 2P6TA 4EV0A 2UZKA 3IKTA 2O8XA 2QUFA 1EIYA 4H2TA 5TJJA 1KMMA 4A2UA 5GMKm 2M87A 1G6NA 4NQWA 4GXOA 1W66A 1JRIA 3A7AA 4C8QE 1N9WA 1SD6A 1T2KA 4IRIA 3CUQB 4P9FA 2ZT8A 4XU0A 5LJ3e 2ZJ2A 3M8EA 3CUOA 3R07A 1C0AA 1HW2A 2L4AA 5GANh 1FZPB 1UHMA 5GANg 4M77F 1WRJA 2ZNIA 4H0EA 1YFRA 3JB9D 4KIGA 4M7DC 3E3VA 3HRKA 1RUNA 1ZARA 2BYVE 1CGPA 5LJ5d 4H2YA 4OMYA 3LAPA 1J75A 3JB9J 2CG4A 3DV8A 3VFZA 2MD5A 3JSPA 4HX4A 4RAYA 3P8VA 2P8TA 5LJ3f 4QVCA 1OKRA 3DKWA 2MH2A 4RMFA 5GAOn 4H2XA 2AXLA 2I4NA 1SAXA 4WWCA 2J5PA 2HTSA 4BNCA 3V4GA 3L4GA 4KIBA 5HS9A 1HTTA 4CGZA 4L0YB 1OYIA 4XU2A 3RL6A 3K9TA 1F9NA 1QGPA 5FB2A 1Z9CA 4U7DA 4M75A 1CF7A 3RGLA 4HW0A 3QO3A 4XTYA 5GANj 3M4PA 2DBBA 1WKMA 2KKOA 3FXUA 2H6BA 1JHHA 4G6QA 1IRFA 4L5JA 2FU4A 3WE3A 5LRSA 5GAMd 4LB6B 1E22A 2QENA 1V3FA 1WI9A 2TDXA 4Q5SF 2NNYA 3SZPA 3DXJF 2FBKA 4LK0F 3WTTC 4MEYF 1SETA 1IN4A 4WXDA 5E8GA 4I2OA 1LDKB 1NJ2A 5ELNA 5L3EA 3RYRA 1O57A 1I6XA 3QAHA 3FXRA 1GGMA 2DKGA 5CVRA 1EFWA 1BOAA 1A04A 5ICCA 3HFOA 3QU3A 5BPIA 4KICA 4B09A 4YCUA 1UB9A 3ZMSA 4YRSA 4C92A 1YS6A 5DUKA 1RZ4A 4HBLA 1XSDA 12ASA 1XGMA 5D4SA 3VQYA 1ONVA 5F6FA 4X9DA 3BPVA 1BC8C 2H09A 1E24A 2ZXJA 2V6CA 1YB3A 5H6RA 2UXNA 4PJOD 4ESBA 4QWQA 5D6EA 4JLIA 1FT9A 3MAJA 1ZRFA 5LJ3h 3KP2A 4P55A 4TTVA 4U0YA 2MLKA 4MNUA 3R0AA 1YS7A 4RB3C 4EMGA 3PCOB 5CVUA 4YPFA 2F2EA 1IRGA 1RIOH 1PYSA 2Q7GA 4KMFA 3WTXC 3R60A 2A5YB 2X0LA 5HLIA 4A54A 1WPYA 1BBYA 2O0YA 4JQFA 2WC2A 3JTGA 4WXCA 3JCMb 1HW5A 3IL2A 5LGNA 2CWEA 3TOAA 3QRFF 3GZ6A 3TQNA 3HXUA 4P74C 2EFOA 2VOPA 5BMZA 5F5WA 4EX5A 4HYEA 1MJ9A 1NJ6A 4MTDA 1QF6A 4EM0B 2KRFA 5FO5A 3LA2A 4NOYA 4HWRA 2YPRA 4WCGA 4PDKA 5LHIA 2XAFA 2P5IA 5DDGA 2IRFG 2HNIA 1K7AA 1U5TB 5KK1A 3SWNB 1KQ1A 2Q5IA 1KQ2A 5GAN2 1BJAA 2HEOA 3O6BB 1FLIA 1H4VB 2OBPA 1YW8A 4P96A 3AHUA 1L3LA 5LEKA 2VC0A 2RA2A 2RKHA 4BAYA 3DP7A 1IN5A 2MBFA 3ICAA 1D5VA 2PBIA 4UVAA 4BW9A 2DXTA 3E9IA 2ACJA 2NYXA 4ZIBA 2P6SA 4HLXA 3Q5FA 4M9XA 4PCQA 2QZ8A 1U1TA 1ZYRF 2YLCA 3K1NA 3TDZC 2STTA 4X9CA 1OR7A 2PMHA 5AONA 2R7DA 3KEQA 5DCMA 3VQWA 2HYFA 3HXZA 4OINF 3P9CA 4ZTZB 2I4LA 4K87A 1U5TA 1K6OA 2DU7A 3JCMQ 2PJPA 1YYVA 4DNCA 1JJCB 3FF5A 3GUDA 2BGCA 4GYIA 4M7DG 6PAXA 2EA4A 5DD4A 2DTHA 1MGQA 3ISPA 2VT2A 4TQDA 1USYA 1R1VA 1JBMA 2OD5A 4KR2A 3M9AA 5F1RA 1GHCA 3JCMX 5LJ3g 5GAMe 1JHFA 5FGMA 4YROA 5GAMh 1B9NA 1SMTA 4GCVA 2UWMA 3CMQA 1FYKA 3H3ZA 1E1OA 5E1ZB 4G9YA 1M8VA 4YRQA 1ZG1A 3JAMZ 4M75D 3MFKA 4HVCA 3E5UA 2FQ3A 4P73A 2PMFA 1ZG3A 5E8IA 1AOYA 2ISYA 3DQVC 2CFXA 3C3WA 4C92E 3Q9VA 2PEXA 4M77G 1LVAA 2XKPA 4H2VA 4U7BA 1R5GA 1JE8A 3GF2A 2X4HA 2PG4A 3R6SA 4TWAA 5IT3A 2A69F 3HRMA 4FX0A 3CLOA 4RGSA 4LLNA 4M78E 3RPUA 1LOJA 3IKLA 4CZZA 5C53B 3A7RA 1R58A 1P6RA 5CJ9A 2GXGA 4KN4X 4EJTA 1QZYA 3BDDA 3SWNA 3IWZA 4R79A 4UP7A 2VXFA 4TVYA 3QNEA 5LJ3d 3EYYA 4AIJA 4P3OA 1USSA 3LA7A 1X2HA 2F5CA 4M75C 4F7UE 2AKWA 1IXSB 1QO0D 3KP3A 4EMSA 4M77D 3HXWA 4EO4A 4JBAA 5JVTA 3WGIA 4EMKB 4P3PA 1N9RA 2QQBA 2O6GE 4GO1A 3KZYA 4P73C 4YRLA 1EV7A 4UHTA 3OOPA 3JB9H 3GX4X 3IRRA 4O6JA 1MGTA 3RKYA 2FBIA 4MGRA 5F64A 2E5AA 2K7LA 3WU0A 3WTUC 4L9TA 4YRCA 1J5WA 4A0YA 4UVBA 1S29A 4NHJA 1J2XA 1FSHA 3CO6C 3P8TA 3ZP5A 3F8MA 2A6HF 4M7DB 3HXXA 3ZMUA 1TBXA 3TO7A 3V8LA 3LSTA 4PJOG 4HQEA 3BFMA 1AWCA 5LJ5f 4CDGA 3D5LA 3C1DA 2F5FA 5ICEA 1SD7A 3MEXA 5K5OA 3LAJA 3G73A 4ZYGA 3HXVA 1K79A 4TQFA 2PMEA 1ON2A 4MMLA 1CF7B 4I02A 2JZYA 1OYWA 3GO5A 3SHFA 3HFZA 2Y75A 1VTNC 4HV5A 4A5MA 1NHAA 4XRFA 2XHKA 2C8MA 3EFSA 4NCXA 2EJ9A 3P9IA 1XSXA 3EQLF 1FYMA 3DF8A 1T98A 1H0MA 2VONA 2HDCA 4M9SA 4CO8A 1DPRA 2E1NA 1WQ7A 2G7UA 4F7ZA 4M78D 2KJBA 1W5SA 1XGSA 2DK5A 2WV0A 4XSXF 5J8FA 4EM2A 1FBSA 3ECHA 4Y15A 4P71C 2HKOA 4PGHA 2E64A 1F1ZA 4M73A 1YFHA 3FZVA 2NNNA 4BHBA 2ESHA 4A53A 2ZCWA 4Q6GA 5I21A 4H2WA 3KZZA 2D1HA 4HA8A 5GANf 5L3FA 1HW1A 4UUVA 1YO5C 2CIMA 4CH5A 4LK1F 2DAOA 4RAZA 3O2PE 2COMA 2DT5A 3TO6A 5CVJA 4PHCA 2J3LA 2ZR2A 2D2WA 5HDGA 3ULQB 5GMKe 2FE3A 4M75G 5E17F 5GAN3 2O03A 3I0TA 1J7KA 1O3RA 3JB9G 3IC7A 2EFWA 1EVKA 2G7HA 4HT9A 4HDUA 4XEOA 4HF1A 3KP4A 2BBYA 4RCBA 5AIQA 3ZMDA 2JTVA 1T6SA 2FMYA 3W6KB 3F72A 2ARTA 1H9TA 3RPQA 4LFUA 1ULYA 2IY5B 4JK1X 4M78B 3IKMB 3WU1B 4YRNA 1RUOA 2O61A 4XTXA 4A6DA 4ENJA 5CVIA 4BHPA 1NJ8A 1W4MA 3H3UA 1SFUA 1B6AA 2L4MA 2E65A 1BIBA 2R3SA 4M6XA 2ZXFA 2QQAA 2DTOA 2EV5A 4LLLA 4M72A 1RNLA 1PP8F 4NL3A 3J7AO 1KU2A 2ZNZA 2FSWA 2CYYA 2ZT6A 2A6EF 3V7SA 2D45A 5GAMg 2RGVA 3EYIA 3EETA 3A5ZA 4C92C 3QHSA 1U5TC 1M5Q1 1NJ1A 1KYWA 2XAHA 3QPHA 1EVLA 2ZZEA 1H9GA 4LMYA 2DQRA 3CTAA 1J59A 5JFRA 1HKTA 1B70B 4IRGA 3N97A 4LD5A 4R1HA 3GLXA 2ESNA 4M7AE 3KFUA 1DP7P 3VEPA 4M77B 2M1BA 3K0LA 2A61A 4A0XA 4CHUA 5D5XB 4M7AD 4X5OA 1FYLA 1T38A 2VE9A 4EJWA 2RV8A 3JTHA 3FMRA 4OIQF 3NRVA 4L9VA 1GVJA 1TW2A 5FD6A 4F7UG 1D8JA 2L54A 4XTZA 5HDNA 3MZYA 5GAN6 3G3ZA 3BJAA 3VOEA 3WQZA 1S3JA 3E6DA 3QTCA 4Y17A 3HXYA 5GAOl 4ZZLA 2V9VA 1JXSA 5GMKi 2PMUA 3HTUA 3RACA 2CO5A 1JJCA 3RI4A 2OU2A 2VBXA 4AWXB 1ATIA 4KQEA 5CVVA 5D4RA 3HOTA 2MC3A 1Z05A 1PYSB 3TKYA 1SRYA 4M78G 4YG2F 3T1BA 5E1XA 4HLYA 5A2QK 5H6QA 2ODRD 3PFIA 3BROA 4UNOA 1TNTA 4C8QA 5K5QA 1FC3A 2L01A 4HAMA 3RJPA 2GA1A 2YX4A 4C92G 2FBHA 4PJOE 3DEUA 1KMNA 1DUXC 2ZZFA 3DPLC 5E3IA 3ERED 4N0AC 5GMKl 4G6DA 2DTIA 1N9SA 3RKXA 4G7OF 4YREA 3F8NA 3BJ6A 2STWA 1KOGA 5D5VB 2ETHA 1MZBA 1XCVA 4EM1A 4AH6A 2ZGWA 4WI1A 3SXYA 1IN6A 4AVPA 3LFKA 2RHQB 3T8TA 2IY5A 3JAMK 1SD5A 3FM3A 1BBWA 2BV6A 2EL9A 3F6VA 1NYQA 3GIBA 3O3KA 3JCMd 4M77C 2ZINA 5H20A 2DPUA 3A32A 2P7CB 3EDPA 1YCYA 2ZCEA 1Y0UA 5HLHA 2VOOA 1BM9A 3RIRA 4M75B 4P75C 1EH6A 3B02A 2BEOA 3FMQA 4I0AA 4OIPF 1ZLKA 5D5WB 1X55A 5DUIA 4G7ZF 4IXAA 1USYC 3M1EA 2YU3A 5HDKA 1G51A 3WG9A 2A07F 4MQ9F 2VBWA 4ESJA 4KT5C 3TEGA 1FY7A 2AKWB 5DV5A 1Q1HA 5BOXA 5FFXA 1U3EM 4C8QC 1RI7A 3GEZA 4O3MA 3KLNA 4M78F 1IXRC 1R23A 1LB2A 1LJOA 1E17A 2DQLA 4YFKF 4H02A 5C51B 3HSEA 4KYWA 4EMKC 3U1DA 2DPDA 1PUEE 2EK5A 1F4KA 3G1ZA 3MZHA 2ZMEB 3F6OA 3L9FA 1HKQA 3I4PA 1BI1A 2EA2A 1ZGAA 2IA0A 4XSZF 3I5UA 3FXQA 2Q7HA 1G3WA 3REXA 5IT9Z 3TEHB 2E1HA 4MHGA 2Q7EA 3P9KA 4CH6A 1KQ9A 1P2FA 2QWWA 4UPAA 3M7GA 3L09A 4WK8F 2EJFA 1ZG5A 1G3TA 1B76A 3QOPA 1IUYA 1YGBA 4ESFA 5BS6A 3JW4A 4C8QD 4RB1A 2P4WA 4FHTA 4L0ZB 1O3QA 2ZT5A 2NAZA 1J5YA 1NYRA 1ZAOA 1XD7A 1FNNA 3T8RA 4XBFA 2RHQA 2ZTGA 1I5LA 4CXFA 2ZT7A 2ZKZA 1ZN2A 4CH3A 3C7JA 1H4QA 3WGGA 4MEXF 1YFTA 5GAN5 1ZHFA 1WQ2A 4I09A 3UFGA 1X3UA 4N9HA 2XAJA 4UVCA 1YQAA 2PI0A 1QBJA 3J81K 3HSBA 3FWEA 5DD8A 3E6BA 4HX7A 4XLNF 4EMHA 4YRMA 2HWVA 2M45A 4V2SA 5LHGA 2DEQA 1PP7U 4JUVA 4J6YA 3MF1A 4KFCA 1Z7MA 2RVCA 1IF1A 1HSTA 2QLZA 2AMCB 1I4K1 2Q5HA 2DU5A 2V79A 1UCRA 4L5IA 5GAOr 3JSOA 4GYGA 1TQIA 1R22A 2E10A 1WWXA 2KIFA 3B73A 2J3MA 4G94A 4K2EA 3SFZA 4M77A 3I59B 1B34B 4C92D 4IVNA 4L9NA 4BH9A 4Q47A 1OYYA 2OQGA 1MKMA 1ADJA 1U8RA 2JSCA 3EFRA 5CLSA 2DLLA 4XQ3A 4TV7A 4CS4A 1HK9A 3IHUA 2XGTA 2XVCA 3QPTA 3AAFA 1I8FA 1K78A 2VXZA 3L00A 1P4XA 2IJLA 4A12A 3JB9I 1KU9A 3E6MA 4F7UB 2E7WA 3J80Z 4YRPA 1HBXG 5GMKh 1Z6RA 4P72A 3PQKA 4FT8A 4NB5A 2QM3A 5IT9K 4RQFA 5C52B 1SMYF 4Z2YA 5J6XA 2EFPA 5GAOp 4ENNA 1KU7A 5LRRA 3E97A 4ETSA 3S2WA 2OZUA 1B1BA 3V8KA 1D3BA 2ARUA 1FP1D 4L9JA 1J0RA 1W7PA 2DU9A 1YG2A 3BWGA 1WU7A 3FIFA 5K1PA 4UXNA 1TQMA 1U78A 4HWOA 1YLFA 4UP9A 3NQOA 5J8CA 2P5KA 1HKSA 1ON1A 1U2WA 4A0ZA 4H2SA 1WQWA 1ZH5A 3TEHA 3HY1A 5LJ5g 1BI3A 3F8FA 2FXAA 4M75F 4IJAA 4XU1A 4EVIA 1G5IA 2ODRC 5GANd 1RIQA 2IA2A 3BOQA 3V8JA 1UHWA 1Z7NA 3HRUA 2OQRA 5LHHA 4ENKA 1E1TA 3K69A 4DQ2A 2W24A 3KFWX 3N4MA 4H2XB 2HQNA 2C7IA 3JCMc 11ASA 2DXUA 2RQPA 3NEMA 3HFNA 1XCBA 3M4QA 1KYZA 1T39A 4XTUA 5LLQA 2D1VA 5L3BA 3TOBA 4CS3A 4YIIA 4I0BA 4O2DA 1V4RA 2CGPA 4B8XA 3I7FA 3P8YA 2AS5F 1R7JA 4HV6A 2FA5A 4ASNA 3GVAA 4PGGA 3IKVA 1YTYA 4ZTUB 3LSQA 2OAZA 4CS2A 2K86A 3HHGA 4BHCA 1H4SA 2VC1A 3REUA 4MMKA 3I53A 4IHTA 2HZTA 1LYLA 2IVMA 4P75A 4M7AB 3COAC 4L87A 4RB0A 1YIOA 4HDVA 3DPTA 3I64A 2C6YA 4G7HF 5LJ5h 2WTEA 4HZFA 4R8HA 2EJRA 1B70A 3VB2A 2DW4A 2L02A 3LA3A 3MF2A 2DZCA 2V1DA 1TLHB 1TQPA 2E41A 3WTYC 3NENA 2E7XA 2IPQX 4G85A 4RS8A 4RGUA 1MDMB 5KNNA 3MEYA 2ALYA 2JN0A 3NETA 3FX3A 1O3SA 3PQJA 5CAIA 1BC7C 3HSRA 2DQ0A 2FEZA 1B8AA 1C0WA 2FB7A 4XEMA 2ELHA 3I71A 2EV0A 2OA4A 4KIFA 3CO7C 3MCZA 2HTJA 1O7FA 4ZZDA 2PQ8A 4YRRA 4LGWA 3F21A 3RYPA 2F5EA 3GFMA 3U2RA 4EMKA 4I7HA 1TTYA 3REOA 4YRFA 5ERIA 4QLCU 1ZGJA 1XGOA 2GXBA 2LF7A 1L0OC 4RGRA 2DVEA 4N0AA 2QBYB 3TGNA 4A6EA 4WJ4A 1R36A 1K78B 2HR3A 3L2ZA 3K2ZA 4LJZF 3I54A 2W57A 3RTRA 2XROA 1REPC 1FYFA 4OU0A 1G3YA 1G4DA 1SFEA 1IN8A 4F7UF 2FNPA 3M8FA 2ZFWA 5JI6A 4M74A 3RKWA 5LGTA 2NRAC 5HGQA 4WXHA 2QQ9A 3TDUC 4MTEA 4YCVA 2CQKA 2Y0MA 5D8KB 2GQQA 2K27A 4YP0A 1ZRCA 4M7DF 3HHHA 1LEBA 3BDUA 3WTWC 3HTSB 2ZO4A 3F3XA 1EH7A 2CJBA 5ICGA 1QZZA 2I4OA 5FLXZ 3A74A 3E9HA 2CJ9A 2DDZA 5KVRA 1FP2A 5D6FA 2GA2A 1I1SA 1XMAA 4IHSA 4P5OA 1BI2A 3A31A 1B34A 3WTVC 2Z9OA 5FD5A 5E1WA 4TVWA 2EFNA 1X54A 3CJNA 2DTRA 1FOKA 1B7YA 5AIPA 2ARSA 3ZPLA 1W5TA 2P5LC 3QP5A 5BPDA 1OMIA 2LDUA 4OP0A 3WODF 5ILVA 5EEHA 3BW1A 2XAQA 1XB4A 4G8XA 3LWFA 2O3FA 3BJUA 3BPXA 4O5VA 3QO8A 2QHTA 5D5UB 4K88A 2P7VB 4AIKA 1EOVA 4TVAA 1HQCA 4S04A 1ZLJA 2XGXA 4JRKA 3QSUA 3H92A 1NNHA 2FNAA 2RHSA 1O3TA 4C92B 4M7DD 3K1MA 4EGYA 3I59A 4KNYA 1IZ1A 5LBQA 2HFHA 4M78A 3A5YA 2BE5F 3UGTA 2NS0A 3HY0A 3KP6A 1FPQA 1D3BB 4P71A 3L1AA 4PJOA 1W7PB 1XDUA 4Y13A 3BZ6A 4LB5A 4FX4A 1DPUA 2MH9A 1S7AA 2QHVA 2FRHA 3CDHA 3JCMh 3ZMVA 5ED4A 3IRQA 4EJOA 2QHUA 3HOSA 3M4GA 4RDXA 3F8CA 1WLEA 4KN7X 4MQVA 1BI0A 4EQQA 4H2UA 4M7AA 1S6LA 2Y90A 2P0LA 4AIHA 4LG0B 2DFIA 1KQ8A 2LSOA 1J9IA 2Q0OA 2GZWA 1ASYA 3R0JA 1I5ZA 2A3SA 3E5XA 4M7AF 3JCMV 2KIMA 3FMSA 4ZH4F 2XV4S 1UFMA 4I98B 2EWNA 1FWZA 2K4JA 3BJOA 3BP8A 3PGGA 3F22A 4PZJA 4OIRF 3HSFA 2JPBA 2A68F 4Q48A 1I27A 3DSQA 3MWMA 1HSJA 1D3YA 2W84A 3HYIA 2ADUA 4PG3A 4BQAA 2VN2A 3HUGA 3OD1A 3EUHA 4KUMA 4M7AG 3FM5A 1QNTA 5E20A 1SD4A 5HOOA 4XU3A 4I01A 4IPAA 4M77E 2GWRA 3GXOA 3I58A 3V7RA 2RNJA 2RC4A 3UH0A 1I81A 3CUQA 4YFXF 1LDJA 2JRTA 3QP6A 4N9IA 2QYOA 2W85A 4YRKA 3T0YA 1G5HA 2HKXA 4YFNF 2Q2EA 1BN5A 2Z3YA 1Z7UA 4HF0A 1D8KA 2KIUA 3V7CA 4IF4A 2XKOA 4KMUX 3FJPA 5L3CA 5HLGA 4YYEA 4EJVA 4C8QF 2EV6A 1IAWA 4YRTA 3NEUA 3WGHA 4M78C 4UP8A 3NELA 2I2LA 1R1UA 2VBYA 4P72C 1LDDA 2CJAA 2H27A 4HQMA 4M7AC 4CICA 4ZYHA 4M7DE 2FMLA 1QPMA 3GFJA 1Y96A 2HS5A 2E3CA 3FB9A 3QO7A 2PN6A 1SFXA 3RDIA 4OIOF 1YW7A 3GFIA 3JCMW 2ZNJA 3TUPA 2VT3A 3L4GB 3KEOA 4M75E 1ZRDA 4ON0A 4WJ3M 2QTXA 3TO9A 4C8QB 4OMZA 4HF2A 4BXUA 2CSOA 3WE2A 1LNWA 3K1PA 3SQNA 3ZMTA 3KP7A 4CYDA 2IT0A 4XTWA 1P4AA 4Y91A 3KE2A 4CH4A 1O7LA 1KU3A 1XN7A 3ELKA 1PDNC 2ISZA 4YRGA 1WYDA 4M9ZA 1LJ9A 2I4MA 1IW7F 3CUQC 4Q4ZF 5HS7A 5GAOm 1X2GA 1HC7A 1YFSA 2JPCA 3RESA 1H4TA 3HRTA 2YSRA 1MD0A 3J81Z 5K1YA 3A7UA 3VQXA 4D0PA 2HYGD 1Y96B 4C92F 2HGCA 4LNSA 4UV9A 1B9MA 2M30A 2EJGA 3VU3C 2Y48A 4Q15A 1XDSA 3U9GA 1XSVA 3FHZA 4PJOC 2ALYB 4YCWA 1WNLA 3GYHX 5GAMj 1STZA 3SZTA 5ILSA 3ZMZA 2MA3A 4RB2C 1XMKA 4RGXA 5L3GA 5ILUA 2M8EA 3F23A 2DO7A 5HVQC 5GAN4 3LQQA 3ERRA 2ZIMA 5GMKj
chains in the Genus database with same CATH superfamily
5K1XA 1KJWA 2LK2A 2LTPA 3AG1H 3VYRB 4B48A 4QQDA 2HDAA 5J4YA 4A63B 2QA4Q 5ELOA 4LG0A 1QQIA 3V42A 3A02A 2R7TA 2JJ9A 2GIVA 4QIWN 3DFGA 2DK8A 5JHUA 2PJRB 2KISA 3MQ0A 5FLXK 4KT6A 3K4KA 4ANJA 3M4OJ 4WF2A 1YI2Q 4HCCA 3CCJQ 1WZ2A 5LJ5e 1FOWA 1UHSA 3KCCA 1EFNA 2DJIA 2I10A 5EC7A 2L9RA 1F5TA 2M5WA 1OCTC 4IEJA 3LSHA 1OPLA 2QGGA 2DEUA 4K86A 2DFHA 4ENMA 2VODA 2Z99A 1H641 1NEBA 2MFZA 2VQGA 2XIGA 2IP2A 4N0BA 3BY6A 2ECBA 1Q95G 3SB2A 2DL4A 1X4OA 1VQ6Q 4AFQC 2LQNA 2ZXHA 3LQRA 4E70A 5JR3A 4YDQA 3RF1A 3GZNB 3TU4K 2VBZA 3TVTA 2CZ0B 1R00A 3G7ZA 4J6WA 3MD2A 2E1OA 1R1TA 3P7NA 4AC0A 1T0FA 3BZKA 5L3DA 1X19A 2UXXA 1QWFA 3HFZB 1LEAA 2DI3A 2ZMEA 2NUTA 2XIDA 3ECOA 3PSFA 2FHDA 3E6CC 3JCMJ 4L5GA 4AIDA 3GW2A 4ESRA 4OLFA 2VYTA 2HOTA 3INZA 5A0GA 3JCMe 2EQUA 3KP5A 4B3AA 5F0FA 2DZ9A 1P4WA 4UUSB 1EH8A 2L3DA 1XC5A 1B59A 1YIJT 2XPWA 4JS5A 1GXPA 1QU3A 2W25A 3IALA 2K57A 4HWSA 5A2QZ 1WJQA 2ZBKA 4EGZA 2DDBA 4U88A 5LGUA 1LNXA 1UG1A 4FYWB 2F4MB 4FETA 3EFOB 4HX8A 1X2QA 5DY9A 5F0CA 4GFBA 1WJBA 4E4HA 3W3CA 2Y31A 4NL2A 4BD3A 3UA6A 3EUAA 2DPPB 3TSZA 3RERA 2M3AA 1VUBA 1X27A 2BVMA 1HXDA 1USTA 5DCFA 2VC8A 3F8BA 2PMZN 4XKBA 4RUGA 1X01A 2FL7A 3HFVA 2IA1A 5CO7A 4DYQA 1AD5A 3PJRA 4QQGA 2AMCA 5GJVB 1UHCA 1WA7A 2K6DA 5E18F 3PUBA 2V1UA 2MK5A 2XG8D 4BI8B 1VQMI 3REBB 2LNBA 2FF4A 2XRLA 2FYKA 1Q7YC 4JX4A 2QDLA 3BTJA 1VI0A 5C4XJ 4U0WA 4LIVA 3LSSA 2XDVA 4R0KA 2YUQA 3FXMA 5HY6A 1Z1DA 1JB0E 2JT4A 2K3YA 2JSPA 2RNGA 3E5QA 4ZTJA 1RAEB 4HT8A 1T33A 1EIYB 1K76A 4J5YA 4JX6A 2XRNA 2HSPA 4OB1B 3H3VK 1E3HA 3QUIA 1HOMA 1IRXA 4HOBA 4HNUA 2H94A 4DBHA 4S0HB 3Q9SA 4EO4A 2R5AA 5HK3A 2RREA 2B63J 2RB6A 3QYGB 5LEJA 4LUEA 1GXQA 3DWLE 4EPCA 2QBYA 4PJOB 2C0TA 3IQLA 4KR3A 3VUBA 5IPAA 4FISA 5BQTA 3HHTB 1E2XA 3WTZA 3OYCA 3CCMQ 4JJCA 1SHGA 5LJ3j 3QBYA 1TH7A 3EUKL 2HVSA 3SDBA 3ZQ7A 2BZ8A 1XPXA 1FBQA 5AYFA 1ODDA 1S7OA 4QT7A 2IY5B 4IZZA 4I6ZA 1I1GA 4GGGA 4M71A 2H1KA 3S3OA 1B4AA 2ECCA 1WSUA 1SESA 1MJAA 4WJ3M 3BG3A 3H9NA 5TRDA 3Q3SA 4A3GJ 3R61A 5IHKA 4BQOA 1DDNA 1OI1A 2XDPA 4Y4RA 2MIOA 3DTEA 5CYVA 1QVPA 3OA6A 2JA2A 2IW5A 3RUXA 2EAYA 1K73R 2A6TA 3CLQA 2Q8KA 1Y0MA 3OSSC 3SWNC 5DCMB 2H1LA 3JB9F 1HJDA 2ZR3A 1KGSA 1TNSA 1BOBA 5DYMA 1ETXA 4IX7A 4JRIA 3LC0A 4M7DA 3QWXX 1VA7A 2CV1A 3GTMJ 3LW5E 1Q86C 3CCVI 2AIRB 3DB3A 4C5EA 3QO5A 2LP5A 1QE0A 2WB1A 3GNFB 4F7UA 3P8BB 2JT1A 2M34A 2F1LA 3GWZA 1EQRA 3KIOA 4BI3A 4A3LJ 1UDLA 1IRZA 2MMPA 3DU6A 2Z5UA 5FFZA 4BWAA 3MEUA 1WPYA 3GBGA 3HIFA 3D0SA 1P92A 4BJTA 3OYYA 4C0DB 2J5OA 2F5DA 2X6YA 3HRIA 1TS9A 2YRVA 4PJOF 3DTKA 2RM4A 1OCCH 3IWFA 4A5NA 2CRGA 3ASNH 3HB9A 1OJLA 4E6KG 4OB2B 2V1XA 4BY7J 3PNWC 3VODA 4HXJA 2WWYA 1S8NA 3WTSC 1Y07A 3PFYA 5HLTA 3R6OA 1KA8A 3DLLF 4YIRX 4FL6A 5KCOA 1FSEA 3VBBA 4UV8A 2HXOA 1FBUA 3LH5A 2EQMA 5J3BA 3KETA 2RDPA 3MEWA 4HRIA 1U6GA 3GFLA 1NJ5A 1Z6TA 2LX9A 1MSEC 4HWTA 4P3PA 1VIEA 2K4BA 2RN8A 1CKAA 2LKPA 3PNYA 1OCPA 1FIPA 3ZN0A 1RAHB 2HL5C 1JGSA 2DQ3A 3HTZA 4AFSC 5FWBA 4Z02A 2GQIA 1L0WA 3L42A 2H6CA 4ZYDA 5K5RA 1QRYA 2YX7A 2E60A 3L2CA 3ER0A 4KDPA 1BIAA 1Q82R 1WCMJ 3PCOA 1OV3A 4G84A 2PFBA 2XASA 3T5XA 3J80K 4RDUA 2RD1A 2FOKA 4P74A 4C8QG 2G4CA 3OYGA 3J7AF 5CR2A 4LLGF 2P84A 4YRIA 2XMFA 3CCST 2ZIOA 2LJ3A 3UDCA 3I56A 2HYJA 3GTPJ 2QHSA 4ZC3A 4JP0A 4RA2A 1RABB 2LYCA 2JTEA 2DN0A 1YHQA 2RHSB 3HRSA 2GAUA 3BR2A 2R5ZB 3S17J 1C6VX 4KA4A 2R7UA 1O9SA 2E5QA 2YLBA 3ML6A 3CXCP 2YHTA 1B3QA 3W3SA 4EJUA 1FTZA 5GAMf 5HNHA 2FX0A 2AT1B 3CCLI 2HOEA 5EEGA 3KXTA 5DEQA 2LF8A 3M3YJ 4GRIA 1RI9A 3L7WA 2QEXI 4DPGA 3W6JB 2XDBA 3A0HC 4PNOA 4XTVA 3C18A 3VRYA 1YJNQ 3EG3A 4RQEA 1ASZA 3M54A 1J3TA 2BZXA 1T56A 2YRCA 2QTVA 4KT0E 3CMAA 1MDMA 2KVQG 2LNVA 3M9QA 5GAOq 4DYCA 2B0LA 3VQVA 4CI0C 1YW9A 1KONA 2KJCA 3IG2A 3M5AA 2EFQA 1X2MA 4NNJA 3MKZA 3KPHA 3PZCA 2E36A 1NYFA 2W48A 1T3LA 2LCLA 2EZHA 4BE0A 4X1EA 2KK4A 3JCMf 3CJQB 3C94A 3TCJA 2VE8A 2EBPA 2KR3A 5GANe 3OYKA 3OYDA 2VXEA 1BBWA 4JJNK 4J6XA 5D6YA 2R7QA 4IUTA 2HQRA 4WX9A 4CCOA 2WSCE 2G9WA 1TXQA 1OPCA 5CQEA 1LQ1A 4QVZA 1VQ9Q 2QVOA 3QU6A 3ZN1A 3LH0A 1W7PD 3X20B 2OTJI 2OZ6A 4OOIA 2JMWA 1A35A 5LJ5j 1KQ0A 2AXTC 3CP2A 4U0VA 1R5HA 3F0CA 3OYEA 2IPOB 3P8DA 2MLGA 1W2BA 1JI8A 1U1SA 1VQLT 4E51A 2XTIA 3GZ5A 5JHFA 2K9QA 5D8LB 4XIDA 4L18B 3D1NI 1UECA 2J06A 2WSEE 2KRHA 4IUUA 3UGQA 1OOTA 5GAN7 2EKHA 2OCCH 3OSFA 2EILH 2R7FA 2XUBA 1QHHD 5EZGA 2R5ZA 1D1BA 2RN7A 2I4MA 2AHJB 5HS8A 4HWPA 3JCMg 1XTDA 1S1NA 2ZCFB 5FRMA 3M55A 2FVUA 2P5VA 4B47A 3MP6A 4P9UA 1FX7A 4IRHA 2E1CA 3RZOJ 2RQTA 1HYOA 3ROUA 4RCCA 1IN7A 1BJZA 1VQMA 1Q7YU 3R4KA 1MMGA 2XAGA 3VKIA 1SEMA 2ID6A 2K85A 3FKJA 3G2BA 5F27A 3AFHA 4XLPF 1GDTA 1BW6A 3OV8A 2FPDA 1IXCA 2LC4A 1AU7A 3E7LA 3HBLA 3UATA 1PVEA 2Z33A 3AG2H 2YR2A 4Y3OA 3OY9A 3IAS2 2VJIA 2CH4W 1VQZA 1XGNA 1Z91A 1DU0A 1VQOQ 5EYRA 3BY7A 1BBUA 5GAN8 1ABQA 2UV1A 3S15J 2ZNYA 2CGHA 1ZREA 1VNDA 2QKMB 4ME7A 1TUCA 3EFOA 3JCMP 4YIFA 1VQ5Q 2EB7A 3FK7A 4R55A 4BYYA 5KNLA 2PU9B 2Q1ZB 2PLYA 4ZYEA 5CQYA 5ICFA 1B7YB 4S05A 1GL5A 4LNPA 2Y2ZA 3HEFA 3OYNA 4AD9A 1ZSZB 1TW3A 2LQ8A 1X56A 1SERA 3ABTA 3DPUA 3KLOA 4M6YA 2A0FB 2MAMA 5D7UA 5FU7B 1GRIA 2Y4XA 1MBGA 1UG0A 3I55I 4RTUA 3J7ZI 4QVDA 1IL2A 1OULA 3CD6T 2VI6A 2BXYA 4A4FA 1MJBA 3ABUA 2K02A 2DO3A 1ADYA 2XDDA 2ZZGA 1WIEA 3I4NJ 1TWCJ 5CKTA 1G3SA 4NC6A 4Z6YA 4HVWA 3ZQIA 3OSGA 1KD1R 2CW0F 2DJZA 2KT1A 2P6TA 4EV0A 2EVRA 4PLIA 4PLLA 2UZKA 2HI3A 3IKTA 2QEXA 2LR8A 2E1MB 2O8XA 3AG4H 1V5FA 3BTCA 1X2NA 2QUFA 3DEWA 3CC7I 1X1DA 2RH2A 4J9GA 4RKUE 5TJJA 3HC7A 1KMMA 4H2TA 1M1KC 4XOPA 4A2UA 1FOXA 2BKDN 3M0RA 2EIMH 8AT1B 2M87A 5GMKm 3F9KA 3O8HA 3HPGA 1G6NA 3E9GA 11ASA 4NQWA 4GXOA 1W66A 1JRIA 2YS9A 3A7AA 4C8QE 2EKOA 1N9WA 1SD6A 1T2KA 4IRIA 3H9GA 2VPRA 3CUQB 4P9FA 2ZT8A 4LVIA 1X1AA 2MW8A 4XU0A 5CPRB 5LJ3e 2D0QB 2ZJ2A 5GJWB 3SDZA 3M8EA 3TEGA 2SEMA 4FASD 1TT0A 3CUOA 3LSKA 3R07A 1YWPA 3JSCA 3BE3A 3VYTB 1C0AA 3ZXSA 1HW2A 2JA6J 2L4AA 5GANh 1FZPB 1UHMA 5GANg 3J80E 4M77F 5KYUA 3S6WA 4LE9A 3E0JB 2LFBA 2LKSA 4BBSJ 1N25A 1WRJA 2ZNIA 4H0EA 3ZBDA 5C3EJ 4JX5A 1LPQA 4FT4A 4OMFB 3OW2A 1PWTA 3JB9D 2X6XA 1W2BS 1YFRA 4IQ4A 4KIGA 3EG9A 2RJEA 4M7DC 1NG2A 1AWOA 3E3VA 1JJ6C 1RUNA 1ZARA 2XKOC 3AKZA 3H0HA 2BYVE 3LSIA 3HRKA 1EIYA 3RCOA 1CGPA 4VUBA 4C0GA 4OMYA 3LAPA 4E2FB 5LJ5d 2BZTA 1AKHB 2QGUA 1W4SA 3CCEA 2GBYA 4PKCC 1J75A 3JB9J 2CG4A 5CCAA 3DV8A 1AWJA 3VFZA 2MD5A 3JSPA 3S3NA 2LJ1A 4HX4A 4RAYA 4AYBN 4ZDPA 1V1CA 3P8VA 2HDWA 2IBDA 2V1NA 4HVVA 2P8TA 4HT4A 2LC2A 3TEDA 5LJ3f 4QVCA 1OKRA 3DKWA 2MH2A 4BXFA 1T0FC 3HPHA 2GOXB 2D0NA 3HKZN 1UUEA 2NVXJ 2P4RA 2PVOB 5GAOn 4RMFA 4H2XA 2AXLA 1Q82C 3LMMA 1U3OA 2I4NA 3HKZA 5IOYA 4WWCA 1SAXA 4MZTA 3BZCA 1VQLQ 2Y0SN 1ENHA 2J5PA 2W4SA 2HTSA 4BNCA 3V4GA 1QQJA 3L4GA 3AL0B 4KIBA 2XSDC 3JRZA 2DMOA 2KE9A 5HS9A 1HTTA 5EDNA 4FCYA 3NPFA 4YELA 1I39A 4L0YB 4CGZA 1OYIA 4XU2A 2XPVA 1K73C 3RL6A 3K9TA 1EIFA 4JLGA 1F9NA 1QGPA 5FB2A 2I0NA 3CPWP 1Z9CA 4U7DA 4M75A 4BUPA 1CF7A 3RGLA 4HW0A 2WBMA 1PSFA 3QO3A 2CUEA 4XTYA 5GANj 2E19A 1AVZC 3M4PA 3CCSI 2DBBA 1E3PA 4XQFA 1WKMA 3Q0UA 4KH0B 1KD1C 2KKOA 4IUPA 3FXUA 2LOOA 1E7OA 2H6BA 1JHHA 4G6QA 1WHGA 2D8JA 3VWBA 2ECZA 3H5AA 3OYBA 1W0UA 4OMPA 1YITI 1IRFA 1X1CA 4L5JA 1O4XA 3GTOJ 3E19A 2FU4A 3WE3A 1ZSZA 1Q1VA 5LRSA 3Q1JA 4J7FA 5GAMd 1WHKA 2KBTA 2DOAA 4LB6B 5KYYA 1E22A 1AKHA 2QENA 1V3FA 1WI9A 2TDXA 1K0SA 4KBMB 4Q5SF 2OV7A 1ZSZC 2C06A 2LBFA 5CQGA 1S9HA 5GAHJ 3BT9A 2NNYA 1OQKA 1E0EA 1WYXA 3SZPA 3DXJF 5FLXE 2OJED 2FBKA 2ZAEA 4LK0F 4MEYF 3WTTC 1SETA 4X6AJ 3MKYB 3VSKA 2K5IA 1IN4A 1FMVA 4WXDA 2OTJA 4HPQA 5E8GA 4I2OA 1LDKB 1QP2A 1YWOA 3UNGC 5L3EA 5GTIC 3RYRA 1MBJA 1I6XA 1O57A 3QAHA 1TUDA 4JZ3A 3FXRA 5C6SA 1MV0B 3ZQHA 2LRDA 1GGMA 2DKGA 1RKTA 5CVRA 1WJ5A 1EFWA 1BOAA 1A04A 5KH6A 5ICCA 3HFOA 3LGLA 3QU3A 4GLKA 1YHQI 5BPIA 1OFCX 2BY3A 4KICA 4B09A 4YCUA 2M2EA 4LUDA 4C0ZA 3BG7A 4B1RA 2DF6A 1UB9A 1M3BA 3ZMSA 4YRSA 4OGCA 4C92A 1YS6A 2Y0SA 5DUKA 3C2GA 1RZ4A 2DTZA 2JVHA 4HBLA 1XGMA 5D4SA 1XSDA 1WFXA 12ASA 3EG0A 2X4YA 5KHDA 1FTTA 3VQYA 1ONVA 3H36A 2HVRA 5F6FA 2EW3A 4X9DA 2MOXA 4B9WA 3BPVA 5DM7F 1BC8C 2EZKA 3FJ5A 1YCSB 1VQ7Q 3CC4I 2H09A 1E24A 2GM4A 2ZXJA 1TWFJ 1JT6A 2V6CA 1Q86R 1YB3A 2L9VA 5H6RA 2UXNA 5CKEA 4PJOD 2JWTA 4ESBA 4QWQA 3CF5F 5D6EA 4JLIA 2L7FP 2CS3A 1FT9A 3MAJA 5J47A 1NG7A 1ZRFA 2LT4A 2BIVA 3KP2A 4FT2A 3CESA 4P55A 1SG5A 5LJ3h 4KUDK 4TTVA 1M90C 4QSHA 2R7XA 4U0YA 2MLKA 2KMUA 4XLAA 4MNUA 3R0AA 1YS7A 4RB3C 4E7HA 2GFAA 4EMGA 1IZ6A 5KAIC 3PCOB 1B8IA 5CVUA 1X3ZB 5DM7R 1CSKA 2F2EA 1YIJA 4YPFA 1IRGA 3VRZA 1RPWA 1RIOH 3L1PA 2K3XA 4QQ6A 1PYSA 2Q7GA 3A03A 4KMFA 3EHRA 3FRNA 4C0FA 5EF6A 2Y9ZA 2DK3A 4RLQA 5IN1A 3WTXC 3R60A 2A5YB 4LVKA 3HOUJ 2X0LA 2XB0X 2P4TA 3UT1A 1BYMA 4CC2A 5FU6B 2VJ4A 3O8GA 3DLAA 5HLIA 4HNVA 3CCQI 1OU9A 2MG4A 1BBYA 2O0YA 4II3A 4JQFA 3PO2J 1QW1A 2E12A 2WC2A 4A3DJ 3CCRQ 3QWLA 3JTGA 1QPIA 4WXCA 1RAFB 2AO9A 5M3FJ 3JCMb 1HW5A 2L3SA 3VS4A 3IL2A 2JUCA 5LGNA 3H0IA 2CWEA 1M1FA 2CT4A 5LL6S 1WHJA 3TOAA 3KZIC 2B7EA 3I3LA 3QRFF 1R9TJ 1WHHA 3G71T 1ZR2A 3GZ6A 3WG7H 3TQNA 2HXIA 3RNJA 2VWFA 3HXUA 4P74C 2EFOA 2EZLA 2VOPA 5BMZA 5F5WA 4EX5A 2RQQA 3BTIA 1YHQT 4HYEA 1JTXA 3EGUA 1MJ9A 3DU5A 4MTDA 1S72Q 4EM0B 1NJ6A 1QF6A 2ESWA 2KRFA 2DOEA 1X6BA 1UGPB 4CCJA 5FO5A 2PZ1A 4OMNA 2O4XA 1VOMA 1TT5B 3LA2A 2GGRA 4NOYA 2Z16A 1SRLA 4C3HJ 1YJ9Q 4TVAB 4HWRA 2WY7Q 2YPRA 3OOUA 4WCGA 4PDKA 5LHIA 4E7KA 2BVLA 2XAFA 2R92J 2P5IA 5DDGA 2IRFG 2LCSA 4A4HA 2HNIA 4A3EJ 1U5TB 1K7AA 5KK1A 2DL3A 2LMJA 9ANTA 3BR0A 1KQ1A 3SWNB 1OEBA 1VQ4T 1I5OB 2HMAA 2WSFE 4AG2C 2Q5IA 1KQ2A 1SKUB 2XGCA 1H8AC 2RJCA 1BR4A 3CCJI 2DIGA 5ECAA 5CKDA 1BJAA 5GAN2 3NWSA 1GBRA 2HEOA 2F4IA 3O6BB 1N6AA 1FLIA 1WX6A 2BHYA 1H4VB 3IH4A 2Z1DA 1ETVA 2OBPA 2ZSIB 1HD3A 1YW8A 1ZGWA 4P96A 4LOCA 5IHIA 3OMGA 4CUGA 2KGTA 3AHUA 4NQWB 1UGRB 2NLUA 4J01A 1W36D 1L3LA 4KULA 5LEKA 1VQ6I 2VC0A 2W00A 4MFDA 3S93A 3LX7A 4L6V5 2RA2A 2RKHA 3OW2S 4BAYA 2LY2A 2XPUA 3DP7A 2FRYA 1IN5A 2KZGA 2MBFA 3TBIA 3ICAA 1M3AA 4N4HA 1D5VA 2PBIA 1VQKQ 2E34A 1WGSA 4UVAA 4BW9A 1H89C 5IP7J 5IAYA 1WJCA 2DXTA 3E9IA 2ACJA 1VQ5A 2NYXA 4ZIBA 4P5NA 2P6SA 4OF1A 3MEAA 4HLXA 3Q5FA 2EPFA 4M9XA 2K3BA 3PNTA 4PCQA 2QZ8A 1UGQB 1IUFA 3FISA 4DEYA 2RHXA 1X58A 1U1TA 1JKOC 1IV8A 2GQVA 4C5GA 1PG5B 3GF5A 1ZYRF 2V7FA 3RQ4A 2YLCA 4B9XA 2KYMA 3K1NA 3TDZC 2STTA 2MF2A 4X9CA 1SSHA 1OR7A 2PMHA 3TSWA 5FKOA 5AONA 2R7DA 3KEQA 5DCMA 3VPRA 2HYFA 4DBQA 5GAEJ 1A31A 3VQWA 3HXZA 3K4BA 4OINF 4J9CA 3CCSA 1M1KR 3P9CA 1UTIA 4NC8A 1RR7A 2LCCA 3CC2A 5HODA 2I4LA 4ZTZB 3FLGA 4K87A 1OISA 4J9BA 2OAWA 4P3NA 1YE9A 1B8IB 4X1VA 4JRPA 1U5TA 1K6OA 2DA6A 1BCMA 2DU7A 3TL4X 4NUBA 2CZ7B 3JCMQ 3CCUI 1UG2A 1KSWA 1ORKA 4C3IJ 2PJPA 3I4MJ 1YYVA 1XTAA 5GADJ 4XR6A 2EYWA 1Y1WJ 4ZJZA 4DNCA 1JJCB 4IO9F 2QF7A 3FF5A 3GUDA 2BGCA 3B6CA 3FK6A 4GYIA 5KYXB 3VYUB 6PAXA 2EA4A 4M7DG 4JZ4A 1SFKA 1YJWA 5DD4A 4PFOA 3HOWJ 1OYXA 2EIKH 3A1YA 2A7YA 2DTHA 2K79A 4OMQA 5FU6C 1MW7A 2LMDA 3Q0VA 3ISPA 2VT2A 1MGQA 3WVEB 2CUBA 2DDAA 3BR3A 1USYA 1R1VA 2IAIA 2OD5A 1JBMA 4TQDA 3DKXA 1AHJB 2GNCA 2V9KA 1T0HA 2CUDA 4KR2A 1G8XA 2BE9B 2DMUA 5HCKA 2RI2A 3M9AA 5F1RA 1A6IA 3CCMI 4IHVA 1GHCA 2EYYA 4IURA 3JCMX 4V19K 3X26B 5FLVA 2R0QC 2EGEA 5CIUA 5LJ3g 3S1MJ 2ED1A 2O7OA 5GAMe 1JHFA 5FGMA 1ACMB 4YROA 5GAMh 1B9NA 2K9MA 2X48A 2CV0A 4FIBA 2BXZA 1SMTA 4GCVA 1NZ9A 2UWMA 3S2DJ 3CMQA 1FYKA 3H3ZA 2CP7A 1E1OA 1EZZB 4XRMA 4UP8A 1R8OB 5E1ZB 5M5WJ 1X1PA 4G9YA 4JRQA 1M8VA 2ME6A 4YRQA 1ZG1A 4BDYA 1N27A 3JAMZ 1OLTA 2HQ5A 2NS6A 1WJDA 4XKCA 1YN8A 3EG9B 4M75D 1HDPA 3MFKA 5CKHA 4K11A 3E5UA 2FQ3A 4RMOA 2A8EA 4P73A 4HVCA 1BBZA 2PMFA 1ZG3A 3OR1C 5E8IA 3G4SI 1AOYA 2ISYA 3OMYA 3DQVC 2GLOA 2CFXA 2RK2A 3C3WA 3IAM2 4C92E 3Q9VA 2OTLA 2PEXA 1ZBXA 1LVAA 2XKPA 1VFCA 4M77G 2IS6A 1N5ZA 3JAME 4H2VA 2MD0A 2WAQN 1R5GA 4U7BA 4FW2A 4M78D 1W70A 2IG0A 1JE8A 2VJJA 3GF2A 2J6OA 5JVGF 2R7ZJ 3N05A 1Z3YA 4L59A 3A8LB 3TQ7P 2L2OA 1R4MB 2X4HA 2CQNA 1WGXA 2PG4A 3BG5A 3R6SA 1W0TA 2O9SA 2JW4A 3CBPA 3GNGA 3PVLA 4TWAA 4HNTA 5IT3A 2A69F 3HRMA 4FX0A 3CLOA 4RGSA 1YJWT 4LLNA 4OMMA 4M78E 5E79C 3RPUA 4C3JJ 3HDDA 1LOJA 3VS5A 4BU2A 4RLFA 3G1MA 5FRNA 2C0IA 3OQ5A 3CJTB 1I3AA 3IKLA 4CZZA 1TUGB 2XU8A 5C53B 3A7RA 1VQ4Q 1R58A 5IYBJ 4E6RA 5L23A 2KSSA 2M7AA 1P6RA 2DJQA 3S2HJ 5CJ9A 4M4ZA 1Q7YR 1I0CA 3CCMT 1Y57A 2GXGA 4KN4X 3RR6A 4EJTA 4F14A 1QZYA 3BDDA 4XORA 3SWNA 5IXFA 3IWZA 1V5EA 2V8JA 4BJ6C 3QODA 1MBKA 3FIWA 2AQFA 3EGXA 4R79A 2RQUA 3LWIA 1K73U 4UP7A 2VXFA 3ZL7C 4TVYA 4M3BA 2PVDB 1YOVB 3QNEA 5LJ3d 3CC4T 3EYYA 5IP6A 1K9AA 4AIJA 1RUWA 1POGA 3K4JA 4P3OA 1USSA 3CQTA 3LA7A 1X2HA 3J7AY 2HAXA 1W1FA 2E3IA 3LSRA 2F5CA 1OCRH 2TCTA 5C4JJ 1WXBA 2DNUA 1V54H 2N8GA 4M75C 4F7UE 5KYWB 3FC3A 4IL6C 2C0OA 2AKWA 1IXSB 1QO0D 1Z67A 3KP3A 1WZOA 3GPLA 2R7WA 2DETA 4BUGA 4EMSA 5EGOB 4M77D 2KXCA 3CMEQ 2L3RA 4JBAA 5JVTA 3WGIA 1JTYA 2LVMA 3HXWA 4BY1J 2ZJPF 1G59A 1SRMA 2NOGA 1N9RA 2QQBA 2O6GE 4GO1A 3KZYA 1Y7XA 2AZSA 4KH1B 1EV7A 4HEA2 4UHTA 4P73C 4YRLA 1FIAA 3OOPA 3LL7A 2EQIA 3JB9H 3GX4X 1XOVA 4DZJA 3NGPA 1ZX6A 2PUKB 5J26A 1MBFA 3IRRA 4O6JA 1M30A 1MGTA 3RKYA 2FBIA 4MGRA 1Z0XA 5CKBA 2VKDA 1SEUA 5F64A 3EGDA 2E5AA 2K7LA 4QTRA 3WU0A 4E7IA 3WVDB 3WTUC 4A4GA 2AQEA 3H6ZA 4BGDA 2JJ7A 4L9TA 4YRCA 1J5WA 4A0YA 1YIJQ 4YRJA 2DYRH 4UVBA 1S29A 4NHJA 2RI5A 4XRSA 3EAEA 3QJYA 3JRIA 1J2XA 1VQ9I 3CO6C 1FSHA 2XAUA 3TP0A 5J1YA 2CYZB 3ZP5A 3P8TA 3F8MA 3G71I 2A6HF 4M7DB 1LUJB 3HJEA 2HKQB 2ELJA 3HXXA 3ZMUA 1GUUA 1MMAA 4C30A 1TBXA 2XF6A 2Z0WA 4DW6A 1M1EB 5AT1B 3CXCS 3TO7A 5F04A 2G6FX 3CBMA 3ZQFA 3ESWB 3SEZA 3V8LA 3LSTA 2NUZA 1D0YA 2JQ7A 1X69A 4PK4A 4PJOG 3THKA 2RJFA 4BY6B 4XKWA 1FMWA 5M5YJ 1AA7A 5H2FC 4JJDA 3BR5A 4HQEA 1UHFA 3BFMA 1SFOJ 1AWCA 2GCXA 4CDGA 4C5IA 3D5LA 5KYNA 5LJ5f 3LSGA 3GTJJ 3C1DA 2F5FA 2G0EA 3ASOH 1SD7A 1Z21A 2BW3B 3MEXA 3ONQA 4ZYGA 5ICEA 5K5OA 3LAJA 3G73A 1NM7A 2QK0A 2KRNA 2ZJQF 4J83A 5CK9A 2VB6A 2RQWA 1K79A 3ASKA 4TQFA 2FD5A 5B3SH 2PMEA 1SPKA 3CCJT 2E6ZA 1JJ8C 1ON2A 3JV3A 4MMLA 2F5TX 1MH4A 1RL2A 1JT0A 2M4GA 4I02A 1W5CC 1CF7B 3PO3J 2AK5A 1JUSA 2JZYA 2HOSA 1OYWA 3GO5A 3SHFA 1WH5A 5KCMA 2JNGA 3HFZA 1U5SA 2Y75A 1VTNC 1MNMC 2LT1A 2CZ1B 1JJ2A 4IUVA 4HV5A 4A5MA 1NHAA 4XRFA 4JDSA 2XHKA 2OJ2A 2C8MA 1FXXA 3EFSA 4NCXA 2EJ9A 3P9IA 1XSXA 3EQLF 2ZB9A 1FYMA 1NYGA 2BUDA 3DF8A 1T98A 2IEKA 1H0MA 1T95A 1NE8A 1VQ5I 1WI7A 1MBHA 2XK0A 2YUNA 1X3WB 2QA4I 2VONA 3NARA 2HBWA 1K4US 1M9SA 4XRSG 2HDCA 4M9SA 2HU9A 3QPLA 4CO8A 1DPRA 2NS7A 3PIPF 2E1NA 3KYCB 4ZDLA 2CW8A 2E5NA 2P81A 2G7UA 3CF2A 3DBRB 4F7ZA 2KJBA 1W5SA 1XGSA 2DK5A 2WV0A 3PL8A 3QYEA 4XSXF 1M2OA 5J8FA 3S1NJ 4EM2A 1FBSA 3ECHA 1YI2I 2IIMA 4LN2A 4Y15A 5EG0A 1LVKA 4P71C 2HKOA 4PGHA 1MV3A 2E64A 2P0PA 5GPCA 2PQWA 1UJYA 3M0SA 4HCBA 3C4SA 1F1ZA 4M73A 1UE9A 2K3PA 2K5CA 3OL3A 3TREA 4WTOB 3ZQCA 1YFHA 1TU0B 2YUOA 5GP9A 3FZVA 4NS5A 2NNNA 4BHBA 3OSVA 1R0CB 3W6VA 1T8IA 2FOWA 4D1QA 3HXVA 1JQQA 2ESHA 1WQ7A 4A53A 2ZCWA 4AM3A 4Q6GA 5I21A 3C95A 1H92A 2IGKA 3JR9A 4EATA 2L9NA 1LCKA 1T08B 3KZZA 5E3LA 2D1HA 4HA8A 5GANf 3I55T 4H2WA 3L2QA 5L3FA 2VQHA 1Y56A 3IUOA 2LX7A 1HW1A 4G12A 4RG8A 3CMAT 4LG3A 4UUVA 3CCLA 4CC4B 1APLC 1EA3A 1YO5C 2HEQA 2DERA 2DL8A 2CIMA 2OTLI 4CH5A 2TRTA 1VZ0A 1T0JA 4H4KC 4LK1F 4DIQA 2DAOA 1N75A 4RAZA 1PD0A 3M0TA 3TEEA 4XK4A 3TMOA 1JXMA 3O2PE 4BL0B 2COMA 2DT5A 2HVQA 3TO6A 5CVJA 2E2HJ 1GBQA 1OU8A 2MWPA 3D7SB 3CC2Q 4PHCA 1KQSS 2MC4A 2KRSA 2KP6A 2J3LA 2BOLA 2ZR2A 3S16J 2JMCA 2W82A 2D2WA 3ZCOA 4A3IJ 2X1CA 3L2WA 3LSMA 5HDGA 3ULQB 1K61A 1B7TA 3RMSA 5GMKe 3G71A 4FW1A 1VQ8I 2FE3A 5FW9A 3A4CA 4M75G 5E17F 2YWWA 3X28B 4JOMA 1IXDA 2RHYA 4CRIA 5IYDJ 3H41A 5GAN3 1J09A 2JK3A 2O03A 3I0TA 3CCLT 3OL4A 1J7KA 1O3RA 2DRKA 2M0OA 3N5BB 1NJIR 1UJ0A 2QXFA 3JB9G 3OWTA 4BDZA 3IC7A 1VQLA 3A2KA 2EFWA 1IJWC 1YJWQ 2Y30A 2G7HA 3MEVA 4HDUA 4HT9A 1YI2A 1EVKA 4XEOA 4HF1A 3LSJA 1VYVA 1U8BA 2HQEA 1ZBJA 3KP4A 3ZFJA 5KYYB 3DTIA 2CDTA 2BBYA 2CREA 2ROTA 4RCBA 4KJZA 5AIQA 5LFAA 1BW5A 1A6QA 4J00A 3ZMDA 2JTVA 1KG1A 1T6SA 2BW3A 2LH9A 4ABZA 2FMYA 4IUQA 3W6KB 2EFIA 4F3QA 1PUFB 2VQLA 5EGOA 2KMTA 3F72A 2ARTA 4PSXA 1RKWA 1H9TA 4Y28E 1FOYA 2QSFX 3RPQA 2F2XA 2K2MA 4FSXA 1EX4A 4HG2A 4LFUA 2DXBA 1ULYA 4XN3A 3I56T 4JK1X 3X24B 4A3MJ 1BA5A 1MBEA 4M78B 3WU1B 3IKMB 4YRNA 2LD5A 4D9JA 5JLWA 1RUOA 3M53A 2O61A 3NMZC 3S1QJ 3WHBA 1VQPI 1BU1A 1SSFA 3MJXA 4XTXA 2E35A 4N4NB 4A6DA 4BJ5C 3OYJA 4BE1A 4ENJA 5CVIA 4BHPA 1U0JA 3PUFA 4RTWA 1NJ8A 5FLMJ 2R57A 1W4MA 2RF0A 3H3UA 1XX5A 2IGOA 1SFUA 1B6AA 2QEXT 1AEYA 3OS5A 1Y1VJ 2L4MA 2E65A 3VUZA 1VQNQ 4F52A 3BG6A 1Q86U 1BIBA 2R3SA 4M6XA 1WHLA 2ZXFA 2QQAA 2DTOA 2EV5A 4BEHB 4LLLA 4M72A 3VS7A 1LFPA 1RNLA 4A3JJ 2CSQA 2EYQA 3CC7A 1Y8RB 1PP8F 4NL3A 3J7AO 2R5YA 2DOFA 1KU2A 2ZNZA 2FSWA 3BTLA 2CYYA 5DTDA 2A6EF 2NWMA 2KT0A 3V7SA 3KYLA 2D45A 1YFNA 4F04B 2RGVA 5GAMg 3EYIA 1XMXA 1MNDA 2DFFA 1TWGJ 3EETA 2L7ZA 3A5ZA 4C92C 2O5RA 3G6EQ 1GFCA 2J6FA 2QCOA 5KAFC 4LITA 3QHSA 1KQSA 4DOVA 1U5TC 2L7MP 2MI6A 1M5Q1 3CBOA 4Z89A 1NJ1A 4LXCA 1KYWA 2HOAA 2XAHA 3QPHA 3MCAB 1YITT 2DILA 3K4LA 4XK8E 1EVLA 2ZZEA 1H9GA 2CP6A 4LMYA 2GBQA 2DQRA 4XKVA 3CTAA 2FPFA 5DLOA 1J59A 5JFRA 1HKTA 1M1KU 3A0BC 4IRGA 4IHYA 2Y69H 3N97A 4LD5A 1B70B 4R1HA 3GLXA 4FSSA 4BB7A 2ESNA 2K2VA 1KC8U 2L5QA 4M7AE 3KFUA 1DP7P 3VEPA 4M77B 2M1BA 3K0LA 3MP1A 9ATCB 2ZFUA 2A61A 2JOYA 3IP4B 2FUG2 4A0XA 1MMDA 4D5FA 4CHUA 2NVQJ 5D5XB 3NWTA 1DGWY 4PJMA 1QCOA 4M7AD 1Z7LA 4Y7NJ 4X5OA 2HCKA 1FYLA 3QYHB 1T38A 1VQ9T 2VE9A 4EJWA 2QASA 3PTAA 4J9DA 4DYRA 1PJRA 1VQ8T 2JM8A 2RV8A 2FRWA 3VV0A 3JTHA 3FMRA 4UY8I 1JO8A 2L9SA 2DJNA 3NRVA 4AVZA 4OIQF 4L9VA 2O4XB 4MZPA 4CH7A 3CC4Q 1GVJA 1TW2A 5FD6A 3QXEB 4IIOA 4F7UG 4PFPA 1D8JA 1AOJA 2L54A 4XTZA 5HDNA 2V8IA 1VQPT 1FEXA 5I2SA 3MZYA 5GAN6 2NOJB 3D5RC 3G3ZA 3BJAA 4ZTFA 3VOEA 3K70C 1VQ5T 3WQZA 3OS1A 1S3JA 2DFEA 3E6DA 5B66C 4DEXA 3CD6A 2M1HA 4Z8AA 1KC8R 3QTCA 4Y17A 2XSJC 1Z9QA 3HXYA 5GAOl 1QVUA 2V9VA 4ZZLA 2VLAA 2A37A 1JXSA 2QGFB 5GMKi 1IO6A 2SRCA 3CMEA 2DA1A 2PMUA 3HTUA 3JRDA 3RACA 2DIQA 3CCEI 4HSTA 2CO5A 2ZXIA 3QWYA 2AKLA 1JJCA 1X4PA 1SAUA 2DA7A 2LBFB 2BZYA 3RI4A 2OU2A 2VBXA 2QEXQ 5F08A 4AWXB 3SFIA 1E6HA 1GFDA 2ZXWH 1RESA 1ATIA 2ID3A 1IC8A 4KQEA 1VQOT 5CVVA 5D4RA 3HOTA 2MC3A 1Z05A 1YBYA 1PYSB 3TKYA 2ZPGB 1SRYA 3HP9A 1UAAA 3I35A 4M78G 1OR7C 3JRCA 4Y92A 4YG2F 3T1BA 4E7SA 5E1XA 4HLYA 4XMYA 2R58A 2F5VA 2KROA 2ZPHB 5A2QK 4LVMA 5H6QA 3DEEA 2QYZA 1VQ6A 3GOXA 3PFIA 2ODRD 4RG2A 3BROA 4UNOA 2YRDA 1TNTA 2DL5A 4L5EA 4C8QA 5K5QA 3SYTA 1X43A 2KRMA 1FC3A 2VKEA 2RQVA 4J7IA 2L01A 4HAMA 3RJPA 2GA1A 1DP3A 1NJIC 2YX4A 2FQ4A 4BEHA 1X75C 1PRMC 1OCOH 2IVWA 2D5VA 1M4ZA 2O31A 3K4CA 4DA4A 3S14J 3SD4A 4C92G 4CA0A 3GTKJ 3CPFA 2FBHA 1GLNA 4PJOE 3DEUA 2M8GX 4M3DA 4EEFG 1KMNA 2QSHX 3OBYA 3CCYA 3S1RJ 3WHCA 1DUXC 3EGDB 2CQXA 3RBBB 1WVRA 3DPLC 3KEYA 1M3CA 2ZZFA 4LDXA 4MZMA 5E3IA 2DT7B 3ERED 2DLPA 4N0AC 5GMKl 3NTIA 1UEBA 3K4MA 4BXXJ 4G6DA 2DTIA 3ZOBA 1N9SA 3RKXA 4G7OF 3HTRA 4YREA 3F8NA 2DE0X 3BJ6A 2STWA 1KOGA 2DA2A 4BS9A 1ETQA 1QHGA 5D5VB 2ETHA 1KK7A 1S7EA 1MZBA 4EDUA 3LSPA 6AT1B 2OTLT 1XCVA 3AG3H 2JA8J 2EH3A 4EM1A 4AH6A 1HA8A 2DMPA 2ZGWA 1DQUA 4WI1A 2HPIA 2E4HA 1HSQA 2O2OA 3SXYA 2QG9B 2PNIA 3P8HA 1IN6A 4AVPA 3JRGA 3LFKA 2ZPBB 3GCMA 1S72T 3PFSA 2RHQB 4JYKA 4II2A 3T8TA 2IY5A 3JAMK 1SD5A 3FM3A 3VSLA 2RMOA 2IS2A 3PIOF 2BV6A 2CH0A 2V4JC 1NEGA 1V29B 2QQSA 4D8KA 3CMAQ 3F6VA 1UELB 1OZ3A 2V6EA 1QVFP 1NYQA 2EL9A 1KHCA 3GIBA 3O3KA 3JCMd 3I56I 4M77C 5B5EC 2J7IA 3J81E 2ZINA 5H20A 2PTKA 2DPUA 1VQOI 4KITB 5J4VA 1ZLMA 3AT1B 1WHUA 2NUPA 2VKHA 3K10A 3GTLJ 3UPUA 2P7CB 3EDPA 1AWWA 3A32A 1YCYA 2VPLA 5E3MA 2ZCEA 2CU7A 3CJRB 1Y0UA 3BQYA 5HLHA 2E2JJ 3MN2A 2KQWA 5FKNA 2VOOA 3A8HB 1K6YA 1U9OA 4IIMA 1BM9A 1AWXA 3PE0A 3RIRA 4M75B 3NTHA 4P75C 1EH6A 4WCIA 3B02A 4RTVA 4BE2A 2BEOA 3FMQA 1RRJA 4I0AA 3G1JA 4OIPF 4BQNA 1ZLKA 3WU2C 3CMMA 4XM3A 2WACA 3I55Q 5D5WB 3H0FA 1VQ9A 1X55A 5DUIA 4G7ZF 2UUZA 2GTJA 3HKSA 4RBOA 2CUJA 1JUPA 1OX8A 4IXAA 2ROLA 1USYC 3M1EA 2WADA 2YU3A 2D1XA 1PKTA 4II1A 1M2VA 3CCUA 5HDKA 2ZT6A 2E5KA 4RM3A 2RHZA 3WG9A 2A07F 2CP2A 3CCUQ 4MQ9F 4GY5A 2VBWA 1YJ9T 1G51A 2BY1A 4ESJA 2DMTA 2WA0A 4KT5C 3ZQLA 1GT0C 1VQ7T 3QDRB 5M5XJ 4CZCA 1FY7A 2DXIA 4RAFA 5DV5A 2AKWB 1Q1HA 5BOXA 5FFXA 1U3EM 3OIQA 2QQRA 4C8QC 2FZCB 1RI7A 3GEZA 4O3MA 2COWA 3CQZJ 3UR3C 3OYFA 3VS3A 3KLNA 4A93J 1RAAB 4M78F 1IXRC 1R23A 3ZRGA 1LB2A 1LJOA 1WDXA 1E17A 1K4TA 3M0PA 1F36A 2KYBA 2DQLA 2JA7J 4YFKF 1DU6A 3MZ8A 4H02A 5C51B 3HSEA 1VQMQ 1IHVA 4KYWA 4J9EA 3U1DA 2DPDA 1PUEE 1WLPB 1LFBA 2EK5A 3S32A 4UB6C 3KUFA 4KUIA 1F4KA 2EGCA 3G1ZA 3IH2A 3JREA 2NS8A 3ZQGA 3MZHA 3BCBA 2B8AA 4ZNXA 5IT9E 2ZMEB 3F6OA 2NUTB 3L9FA 3QYFA 1HKQA 4ZDOA 2G3RA 3I4PA 2FO0A 3SEQA 3QYBA 3OYLA 1HCRA 2VUMJ 5EG2A 1BI1A 3SJMA 4C2MJ 4AFZC 4BY6C 2VKVA 2EA2A 1EKEA 4OAYA 1ZGAA 1LE8B 3GP8A 2IA0A 4V2FA 4XSZF 3I5UA 1ACIA 1NK2P 3FXQA 3VDXA 2WAFA 4PJ0C 3BDLA 4FYVB 4XAXB 3IH3A 2Q7HA 1G3WA 1Z3XA 1QVTA 2RJDA 3REXA 2YU9J 2CQQA 5IT9Z 3A5ZB 3TEHB 2E1HA 5KCHA 4MHGA 3PVQA 2Q7EA 2O9LA 3P9KA 4CH6A 5M9OA 3CD6I 2FPEA 2K5LA 1KQ9A 1P2FA 3FBIB 2H8RA 1ZUUA 2QWWA 2O9VA 2FG0A 4N4GA 3M7GA 4UPAA 3FDYA 5J39A 3L09A 4FE4A 4WK8F 2EJFA 3MPUB 3NHNA 1D0XA 1ZG5A 1G3TA 2E71A 5FROA 3QOPA 1EJ9A 2CP5A 3CCVT 1B76A 1HC8A 1IUYA 4G6TB 2W0ZA 4ESFA 5BS6A 1IG7A 5J1RA 3JW4A 1BB9A 1Y71A 2LJ0A 2X3XD 3H8ZA 4HVUA 4C8QD 4RB1A 2P4WA 4FHTA 4DOZA 4CCLA 4L0ZB 3A8MB 3I9V2 1TTHB 1R0BG 1O3QA 1A36A 5A2QE 2ZT5A 3VS6A 2NAZA 1J5YA 3EG2A 1NYRA 1ZAOA 1QVGS 1XD7A 1FNNA 3T8RA 1KC8C 4XBFA 3CCVQ 3CDLA 1JXOA 2XHCA 2RHQA 3M57A 2KDZA 3QZ5B 1I5LA 4CXFA 2H3EB 2KY9A 2RI3A 1G83A 2AKKA 4JS4A 8ATCB 2ZT7A 2ZKZA 4XOTA 1ZN2A 1ZHIA 4CH3A 1V5GA 3C7JA 5CQXA 3WGGA 4MEXF 2WV1A 1H4QA 1VQ6T 3OW2P 5GAN5 1YFTA 1ZHFA 1IGQA 2M02A 3MKDA 2VASA 1WQ2A 2LNHB 3ABLH 4I09A 4RTYA 1Q82U 1X3UA 3UFGA 2X51A 3GMEA 4N9HA 1WXTA 2XAJA 4UVCA 1YQAA 2PI0A 1SC7A 3CPWA 1QBJA 3J81K 2KEAA 3HSBA 3KX2A 1S72A 1SVOA 3FWEA 3E6BA 5DD8A 3TW6A 3RKQA 1H8KA 1ZSGA 2ZPFB 4U87A 4E7LA 3QJ6A 4PJNA 1BCOA 1UZCA 4KGXB 4HX7A 4XLNF 2VJ5A 4EMHA 4YRMA 2HWVA 1JU5C 2BY0A 1HLVA 2M45A 4XNFA 3HL8A 4V2SA 2Y4YA 3M59A 3BC8A 4RTXA 1TWHJ 4NC7A 5LHGA 2IS4A 2DEQA 3OIPA 2ZPIB 3PIOA 3A98A 1PP7U 1WHMA 4JUVA 2KFDA 1W36C 3L2UA 2R4GA 2X1DA 4KFCA 2RVCA 4J6YA 1Z7MA 3MF1A 1IF1A 1QWEA 1HSTA 2A5WA 2YXYA 2QLZA 3ULRB 2DBMA 5KE3A 1K8AC 2AMCB 1I4K1 2Q5HA 4CYCA 2VV5A 2COBA 2K7AA 4RAGA 3FHNA 4XL9A 3M56A 2DU5A 4E47A 2V79A 5KYXA 1NLOC 1UCRA 4L5IA 5GAOr 3JSOA 4GYGA 1TQIA 1R22A 5EZHA 4MFEA 2E10A 1SF9A 2W7NA 1WWXA 5D6WA 1X1BA 2X3WD 2OCEA 1XQHA 4DGWB 1G2BA 2E2IJ 3CMET 2KIFA 3B73A 4CC3A 3CC4A 1PHTA 2DYSH 2DVJA 1QZEA 2J3MA 4G94A 2EINH 3S3MA 1KHIA 4K2EA 3SFZA 3HL2A 4M77A 2KHMA 2E5ZA 3I59B 2OAUA 4NDLA 1K9MC 1B34B 1YJNI 1IV6A 2X1EA 4C92D 4B3XA 1AZGB 3FEOA 4IVNA 4BBRJ 1N8RR 4MDXA 3BJUA 1YX3A 2DD5A 1C0MA 1VQPA 4L9NA 4BH9A 1YRNB 2NVTJ 2XC7A 2DRMA 3FXKA 4Q47A 2X4WA 1ZTRA 1OYYA 3P5JA 2OQGA 1MKMA 3W2WA 3JRBA 3UKGA 4GBQA 2PVGB 1ADJA 1U8RA 2JSCA 4C0DC 1ETOA 3QDFA 3EFRA 5CLSA 2DLLA 1GCQC 4XQ3A 4TV7A 2ZPEB 2O88A 2CW7A 2LRQA 4CCMA 5IOZA 3PMTA 4CS4A 5EG0B 3IHUA 1HK9A 1WJRA 2XVCA 3QPTA 3AAFA 2XGTA 1I8FA 4Q5WA 1K78A 2VXZA 4HSRA 3L00A 1PYVA 4ATOA 4XLFA 2RHUA 1P4XA 2DCEA 2IJLA 4A12A 3JB9I 5K7ZA 1JKPC 3H35A 2A28A 4M3EA 1KU9A 3E6MA 3META 2CQ7A 2E7WA 3J80Z 1TP4A 1TSFA 2DX1A 2RK1A 4YRPA 2F48A 4DBRA 2DFUA 1HBXG 4KGZB 5GMKh 2M0CA 1MMSA 3HUGB 2DYIA 2E70A 3SDGA 4CSWA 1Z6RA 2ME0A 4P72A 3PQKA 2OTJQ 1YJNT 2DA3A 2JN6A 2V1QA 1ERDA 3DKMA 5EEAA 4FT8A 3ZQQA 3CCRI 4NB5A 4FM4B 2QM3A 3L2VA 5IT9K 1YITA 1Y6IA 2IGMA 3I5RA 3QPSA 3HOVJ 4FQGA 2LQWA 4RQFA 5C52B 1JUMA 1SMYF 2CP3A 3C2HA 4Z2YA 5J6XA 2EFPA 1LFUP 1RI0A 4ENNA 1KU7A 1LKXA 5LRRA 3E97A 5GAOp 2XD0A 2GTOA 4ETSA 3K70D 1RAIB 3S2WA 2OZUA 1B1BA 2A3LA 3V8KA 3NFCA 2HZYA 3CCUT 1D3BA 2ARUA 1FP1D 4L9JA 1J0RA 3D5SC 3H0DA 1WJFA 1ETYA 2X35A 1W7PA 2DU9A 1YG2A 2ZSHB 4MLOA 2HQAA 3BWGA 4QPOA 3FIFA 2A36A 1WU7A 4UXNA 5K7HA 1S72I 5K1PA 1TQMA 1U78A 4IHXA 2KDSA 4HWOA 1YLFA 4UP9A 2CFOA 3NQOA 5J8CA 2EPDA 4PL6A 3R6NA 5EJCA 1YJ9I 2P5KA 3K4NA 3QKJA 1HKSA 1U2WA 1ON1A 4A0ZA 1PNJA 1ZA2B 2COZA 3VS1A 1K8AU 4F16A 4H2SA 1WQWA 4BQQA 1F43A 1ZH5A 3TEHA 1E6GA 1IO2A 3ZEHA 2D8HA 3HY1A 5LJ5g 1BI3A 3F8FA 2FXAA 2ATCB 4M75F 4I99C 5I11A 1M1GA 1M90U 5I2MA 3NAUA 4IJAA 2VGMA 1UB4A 1I6HJ 1IDZA 1NPPA 3CDIA 1RLQC 2QAZA 2MGQA 3MVPA 4XU1A 4CCKA 2ENMA 2OX7A 1SHFA 3M0QA 4IQJA 4EVIA 4CYCB 1G5IA 5F1JA 2L0AA 2ODRC 5GANd 1K0XA 1RIQA 2IA2A 1Y0NA 3BOQA 1XS9A 5KYWA 1W2BP 3C2BA 3V8JA 1UHWA 2KQRA 2W1OA 4Y52J 1Z7NA 1R4NB 1MIJA 3HRUA 2OQRA 4MO7A 5LHHA 4ENKA 3CC7T 4MIMA 1E1TA 3K69A 4DQ2A 2W24A 3KFWX 3N4MA 4XICA 2HQNA 5GAGJ 5FKKA 1VQKI 3PMIA 2R7VA 2JVVA 3JCMc 4ZN3A 2C7IA 4EIKA 2DXUA 4H2YA 4LVLA 3CCRA 2RQPA 1D1CA 4CCNA 1Z9ZA 2KDOA 3HGGA 1GV5A 2F2WA 1ZQ1A 2LG4A 1VQNT 4LDYA 4Y33A 4JJBA 3NEMA 1Y8QB 2I5UA 2KL4A 3HFNA 1XCBA 3CC7Q 3QZ9B 3FBNB 3M4QA 1KYZA 5BNGA 5IXBA 3QG1A 4TVRA 1T39A 4XTUA 1R6RA 3I9QA 4PUSA 5LLQA 1KFZA 3CEYA 5CKFA 1OZ2A 2D1VA 5L3BA 2KLOA 3DCFA 3HOXJ 3I55A 3TOBA 3CC2I 2F69A 4CS3A 4YIIA 4I0BA 4RTZA 2JUFA 4O2DA 1V4RA 2R5YB 4RTTA 4ITVA 2CGPA 3URGA 2IXSA 4F93B 7AT1B 2DODA 2JUGA 4B8XA 3C12A 1JKQC 3O8VA 3I7FA 2F6CA 4FU6A 2M51A 5IY5H 3P8YA 1YNZA 1VQ8Q 2AS5F 2GIZA 3RPUD 1R7JA 1HDDC 4HV6A 2FA5A 4ASNA 3GVAA 3TW7A 4OB3B 2X6OA 2R7SA 1WJEA 4W1UA 1IGUA 2QI2A 3RMQA 4PGGA 3IKVA 3K2AA 1YTYA 3MO8A 1ARKA 4ZTUB 4FYYB 3LSQA 2OAZA 4AG1C 1QA6A 4CS2A 3F70A 2MABA 2K86A 4B6MA 3HHGA 4BHCA 1H4SA 2VC1A 4A69C 4MMKA 3REUA 3DBHB 3I53A 4IHTA 2DYBA 2HZTA 4M3GA 2IVMA 1MSFC 4EMKC 1LYLA 5D6XA 4P75A 3BCAA 3EUHC 1GCQA 2PX9A 2DA4A 2JTMA 4LDWA 3COAC 4M7AB 4RB0A 1YIOA 3FKIJ 5KE2A 4L87A 2OC6A 5HK0A 4HDVA 3DPTA 1SVMA 2H8WA 3I64A 1N77A 1N8RC 1HF0A 2QQ8A 2C6YA 4G7HF 5LJ5h 2WTEA 4HZFA 4R8HA 2EJRA 2LDMA 4LDUA 1KIKA 1E3OC 1B70A 3VB2A 1NK3P 1AT1B 2DW4A 1OCZH 2L02A 3LA3A 3MF2A 2VXDA 3A01B 1VQKT 4C9YA 2DZCA 2L7KA 5J3LA 2V1DA 1TLHB 1TQPA 1WFWA 1SVLA 3WTYC 2E41A 3OR2C 2CS7A 3NENA 4FE7A 2E7XA 3H9QA 2IPQX 2J05A 2X6WA 4ELZC 4G85A 4BKXA 4RS8A 3G4SA 2LREA 4RGUA 1MDMB 1K4SA 5KNNA 3MEYA 2ALYA 2JN0A 4EMKB 3NETA 3FX3A 1O3SA 4IKFA 1UGSB 1VQOA 3FXLA 4KISA 1VQ7A 2DD4A 3PQJA 4D8DA 5CAIA 4HCKA 1BC7C 4C2TA 2R5MA 1OQYA 3HSRA 1P7IA 1PCXA 3EHQA 3L4GB 3CCSQ 2HKNA 4FTHA 2DQ0A 2FEZA 1RR8C 4DJAA 1B8AA 2JTFA 2KRCA 3A8GB 2P0QA 1GXIE 3PNVA 5GTHC 1QKXA 1C0WA 3FXOA 1OPKA 1WI3A 2FB7A 3CCVA 1JKRC 4XEMA 3VJPA 3OIOA 1MH3A 1TZLA 2ELHA 5J40A 2V9PA 5FKMA 4FYXB 3I71A 1IDYA 2EV0A 3E9FA 1D09B 2OA4A 4KIFA 3CO7C 1S5LC 4AUXA 2CT3A 3CZ6A 4ZGEB 2D6FA 1QCNA 3MCZA 3DB4A 1MMNA 5B1BH 2HTJA 2K9NA 5JLXA 1BK2A 1O7FA 4ZZDA 2PQ8A 2K5FA 5LD2C 3ZR8X 2X4XA 4YRRA 1BR1A 2WAEA 5I22A 2BY2A 4XN0A 4LGWA 3F21A 3RYPA 1PUFA 1QP3A 4A4KA 2D9TA 1K83J 2F5EA 3PSIA 5IYCJ 4ZN1A 3GFMA 3CC2T 3U2RA 2LQKA 4EMKA 1VYTA 1N8RU 4I7HA 4IHWA 1TTYA 1GV2A 4LDVA 1Q81R 3REOA 2VUBA 2VQCA 4XONA 4J9HA 4MDWA 3PM1A 3G6ET 4GDFA 1T3SA 4YRFA 2JM9A 2X85A 5ERIA 3RZDJ 5KYUB 4QLCU 2M7BA 1K8AR 1ZGJA 1XGOA 2GXBA 3BR1A 2K9SA 2JMAA 3OYMA 5M3MJ 2LF7A 3JRAA 3U1KA 1L0OC 2HBPA 4RGRA 2V26A 1X2KA 2DVEA 4N0AA 2OF7A 2QBYB 5HKCA 3TGNA 4A6EA 3W2AA 2EIJH 4WJ4A 1R36A 1K78B 2HR3A 1GVDA 1TC3C 2KT8A 3L2ZA 1ZK8A 3K2ZA 3I54A 2W57A 4LJZF 3RTRA 2XROA 1Y39A 1REPC 1VQ7I 3EG1A 4IOCF 3KBGA 3G4ST 4OU0A 1FYFA 2F2VA 1G3YA 5E3NA 1SFEA 1G4DA 1IN8A 2FEIA 1YJ9A 4F7UF 1Z77A 2FNPA 3E1SA 3M8FA 2ZFWA 5JI6A 4M74A 2EQJA 3RKWA 5LGTA 3GTQJ 4R56A 3CCMA 4XLCA 3IV5A 3CCEQ 2NRAC 3TP3A 4PSWA 2HQXA 5HGQA 2DAQA 4C5HA 2E3HA 4F91B 1I1JA 4WXHA 3OYAA 2LY1A 3L2RA 2PJRA 3PIPA 1NJIU 2QQ9A 2I8DA 1O75A 3TDUC 3CCQT 4MTEA 4YCVA 3RSNA 4F7UB 2CQKA 2Y0MA 5D8KB 4LVJA 3LWHA 2GQQA 2K27A 2LZ6B 2MPXC 2K4YA 4YP0A 4ZGJB 1ZRCA 3J7YJ 1QMCA 4M7DF 4ZYAA