3V8JA

Crystal structure of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
306
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 98
structure length 306
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8jA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8jA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8jA02
3K9TA 4UNOA 4U0YA 3R61A 1JE8A 3GUDA 4S05A 1H9GA 5DCMA 1ZG5A 5D5VB 5J6XA 5LHGA 3HSEA 5J8CA 1MD0A 1W7PB 2KJBA 5GAMj 3NRVA 4ESBA 2FE3A 1A04A 1HKQA 1XGOA 1NJ5A 2DFIA 4BHPA 1TQPA 4P9UA 2ODRC 3KP2A 2EK5A 3GFLA 2IA2A 3RACA 1LYLA 4TVYA 2DEQA 1KU7A 5LJ3h 1BBYA 2WV0A 5D4RA 4CGZA 1XGSA 3REUA 2HOEA 2QQ9A 2DW4A 3CUQC 4WX9A 4L0YB 4BQAA 3J81K 3A7AA 4RCCA 2A5YB 1HW5A 4J15A 1OR7A 4HF1A 4YRPA 3KZYA 4LFUA 5GAOm 1D5VA 1SETA 2UXNA 1JRIA 5GMKi 2DKGA 2HGCA 1BI2A 5LJ3j 3A5ZA 4H2UA 3FMRA 3HXZA 1B34B 4YG2F 3HY1A 4Z2YA 4YCVA 3SXYA 1D3YA 3R60A 1S3JA 3M4PA 4N0AA 5JFRA 4GGGA 2L4MA 1R1TA 3LSTA 1C0WA 1H4VB 2BYVE 4R79A 1X54A 2HKOA 2BV6A 3F8CA 5CLSA 4XBFA 1NHAA 5GANe 2A61A 2I2LA 3F72A 1QNTA 3KFUA 4IRGA 5JR3A 4ENMA 1K78A 5ERIA 5J8FA 3OD1A 4AIJA 3GYHX 4G6QA 1I6XA 1KGSA 2ISZA 1OYWA 5ILVA 2CG4A 4FHTA 2VE8A 3ZMSA 2GAUA 5TRDA 2ARTA 4HWPA 2VOOA 1X2HA 2K86A 3PZCA 2F5DA 4CDGA 1T2KA 3G3ZA 3P7NA 3T5XA 4K2EA 2WTEA 3FXRA 3C18A 3VQVA 5BPIA 5BOXA 2DQRA 4MMLA 3WTYC 1M8VA 1NJ6A 3LA3A 4RCBA 4IVNA 5I21A 3E6BA 2HFHA 1JXSA 2ZJ2A 3ULQB 4HQEA 3HRMA 4N9HA 4I01A 1FC3A 1RUNA 4CXFA 2ZINA 2ALYB 2PFBA 1U1TA 2A3SA 3SZTA 4BHCA 2NS0A 3FXUA 4ZYEA 5K5QA 3OV8A 1I81A 2E1CA 3F6VA 2QHVA 5ELNA 3FX3A 3FIFA 2CJAA 3OOPA 5ILUA 1R5GA 1Z9CA 4TTVA 1EH8A 4G7OF 4GYIA 3A31A 5HVQC 3LSSA 4RS8A 5KNNA 5DD4A 2DTIA 4FT8A 2EFOA 4E70A 3EFRA 4EJUA 2M30A 2XUBA 4DPGA 3FZVA 2RC4A 1RIOH 1PUEE 3JB9G 4H2WA 2IY5A 3HXYA 2QYOA 4P74C 1H641 4CHUA 4A12A 4GYGA 2ZNIA 4H02A 2M8EA 1MJAA 2VBXA 3TEHA 3BPVA 2Q7HA 4EJOA 4L18B 2J3LA 4OMZA 5GAN2 1SD4A 5D5XB 3J81Z 5ICGA 4H2VA 5D6FA 4RAYA 4BYYA 4ZYGA 3GVAA 5F64A 3RPQA 3G1ZA 1DPRA 3P8YA 1BC7C 2HKXA 3IKTA 2EJ9A 1YW8A 2VC0A 4AIKA 2PG4A 4KR3A 1QZYA 2JRTA 2CFXA 2BBYA 4NHJA 2QUFA 3BROA 2CW0F 4YRRA 2ARSA 4HOBA 2ZT8A 3VQXA 1TH7A 4KIBA 4UP8A 4X9CA 3QO8A 3Q9VA 2YPRA 4PJOE 2M5WA 3JB9D 1LNWA 2DAOA 1FYMA 4OIQF 1P4XA 3VEPA 4L9NA 2EV0A 3ZMDA 1NJ8A 4YP0A 5LJ5j 3MF1A 5DV5A 3VFZA 4M78B 2ZCEA 4LJZF 3MFKA 2CSOA 1PP7U 2D1HA 2Y90A 4XTYA 2P6TA 3K1MA 3V8LA 1RNLA 2GZWA 2DU5A 4MHGA 4OOIA 2YLCA 4H2SA 2DU7A 1YW7A 2JPBA 1O3QA 1LDDA 4OINF 2EL9A 3ZMTA 3EYYA 3HYIA 3UH0A 3RF1A 2RDPA 4MMKA 1RZ4A 2B0LA 2E3CA 3CMQA 3O2PE 3CTAA 1WLEA 3L09A 4M77E 1FBSA 1KQ1A 2PMFA 3GIBA 2ZBKA 4P74A 4YREA 4NB5A 1ULYA 1UCRA 1ZYRF 2DXUA 3E6DA 2HQNA 4QVCA 1JJCB 5FB2A 5LBQA 4QVDA 5GAOp 1YGBA 4YRGA 1FSEA 1E22A 3GXOA 4M74A 1J7KA 3C1DA 1G3YA 3L7WA 2COMA 4TVWA 4EJVA 4OLFA 3ELKA 1JGSA 3UGTA 4PJOB 4M77G 3HTSB 3WQZA 4CYDA 1Q1HA 2VXEA 1SD5A 1XCBA 2QBYB 1LEBA 4K88A 4OP0A 2QHSA 1T98A 1G3TA 4MTEA 2XAJA 2K4JA 2LNBA 1H0MA 2IT0A 4G85A 4M75F 3RERA 3A7UA 2IJLA 3R0AA 3P8TA 4YFNF 1QO0D 5L3EA 1U3EM 1HSJA 1LJOA 2DT5A 4O3MA 1IXRC 1V4RA 4M77A 5K1PA 3M4GA 4KQEA 4CS3A 3KE2A 4YROA 4XSZF 5E1WA 2QM3A 5LRSA 1R00A 2VONA 2IVMA 3HXXA 4UHTA 2DQ3A 2VT3A 3JB9H 1B70A 1YS6A 4M77D 4M7AE 4NL2A 2H6CA 2L4AA 5GAMe 1GXPA 1GVJA 1YFHA 1HKSA 1S29A 4BHBA 1IAWA 1B76A 1OYYA 2ZIOA 3JCMc 4WF2A 3DXJF 4C92E 4A5NA 1TQIA 5IT9K 1LDKB 4Y15A 3SHFA 4YRSA 1CF7A 5HDNA 3KFWX 3TKYA 1E2XA 3IL2A 1IUYA 4M7AG 2Q5IA 4HF2A 2K7LA 3PCOA 1HC7A 1ZLJA 2Z3YA 5HDKA 1I5LA 1Z7UA 3GZ6A 1P4AA 2EAYA 2OQGA 5GAOq 3Q5FA 3JTHA 5DEQA 2PQ8A 3NETA 5LJ3e 3V4GA 2I4LA 3LAJA 3PGGA 4C92G 3IKVA 3EFSA 1X2GA 4PGHA 1LOJA 4XU2A 5DYMA 1BC8C 3LQRA 1U2WA 2ZZFA 4UXNA 5BQTA 2L3DA 1RI7A 1UHWA 1YB3A 3QO7A 2CQKA 1YG2A 1EVKA 3I59B 2GQQA 2K02A 1SD6A 1D3BB 1KQ9A 4L9VA 1X56A 3FHZA 2OU2A 1B1BA 3EYIA 1FP1D 4Q6GA 5HDGA 4M7AD 4EMGA 3TEGA 1UB9A 3J7AO 4UV9A 1JHFA 4M7AB 1Z7NA 1FWZA 1GHCA 3ABTA 2A07F 5A2QK 1LNXA 4IHSA 1T39A 4YPFA 2EV6A 4A53A 2CJ9A 1X3UA 1B7YB 4P96A 5D8LB 3ZPLA 4EGZA 5GMKj 1WI9A 4C92D 1EIYA 2ISYA 4O5VA 1JHHA 3RYPA 4H2XB 4WXCA 1EH6A 3NEMA 4IRIA 5FLXK 1ZRFA 3GWZA 3TDUC 2ELHA 3RYRA 4YFKF 2UXXA 2IA1A 3WG9A 1I8FA 2YU3A 4U88A 3FMSA 5C51B 2F5FA 3I7FA 1TW3A 1HBXG 3DEUA 3GFJA 2ZKZA 1USSA 4E51A 2RHSA 1J9IA 1L3LA 2FEZA 2IA0A 1U5TC 3DP7A 2ZNZA 1ZGJA 2MA3A 1P6RA 2PI0A 1Y96B 3BW1A 4F7UB 3HRTA 1IF1A 3E6MA 3C3WA 2XVCA 3D0SA 2DXTA 1J0RA 4PHCA 4CZZA 1H9TA 1Z1DA 1XN7A 4YRMA 1FY7A 3W6JB 2ZFWA 1XGNA 5CVVA 3WGGA 4C8QC 3HFZA 5LLQA 5BPDA 4M7DC 1ONVA 5LEKA 1J5YA 5GAOr 1D8JA 3R07A 1WRJA 3CO7C 4HBLA 4EMSA 4YRLA 4J5YA 4A2UA 1IW7F 4L87A 5IT9Z 3GFMA 2J5OA 4G94A 1PP8F 2HDCA 2M1BA 3TUPA 2QHUA 1W7PA 3WTTC 3F8BA 2EJRA 2OBPA 3WTUC 2ZXFA 3AAFA 2ARUA 4YRQA 1SERA 2H6BA 3TO6A 1HK9A 4KT5C 4M73A 4HWSA 1H4QA 4K86A 3F8FA 2EFPA 4XSXF 1GGMA 4ENKA 5DCMB 3FMQA 1QBJA 4UVBA 5D8KB 4MEYF 1ZREA 3KEOA 2STTA 1R22A 1ADYA 3WODF 2IPQX 4I02A 3IKMB 3KP7A 3DF8A 4M78F 3E5UA 5LGNA 2ZR3A 5CYVA 3SWNC 5LJ5e 2M87A 2RKHA 2P6SA 5HS8A 3ZMZA 1IN6A 3P8VA 1XDSA 1U5TA 2E1NA 1Y0UA 5A2QZ 4WI1A 1O3TA 3HRUA 2ZR2A 2ZMEA 4XQ3A 4TWAA 3A74A 4KA4A 4JUVA 4ZZDA 1SAXA 2CO5A 2DQ0A 3VB2A 2I4MA 1ON1A 3BP8A 2AXLA 2XHKA 4G6DA 4I09A 3FXQA 2ZT6A 4N9IA 3IC7A 1PYSB 5FLXZ 4O2DA 4C8QA 2UWMA 4M7DA 3CLOA 2R3SA 3IRRA 2MLKA 2VC8A 4LNSA 4G7HF 1WSUA 4LK0F 2H27A 2HS5A 3BPXA 3E6CC 3SFZA 3G73A 2VXFA 4YRFA 2EFNA 3QSUA 3TGNA 4R8HA 4TVAA 3VQYA 2QWWA 3JCMV 4RGRA 5DY9A 2WC2A 2A6EF 4RB3C 1ZG1A 2IW5A 2J5PA 1ZN2A 2ZNYA 3DSQA 3F21A 5ICEA 3M4QA 3KP5A 4P3OA 2QENA 3SZPA 1EOVA 3FB9A 4P9FA 1K78B 4UP7A 3R4KA 4PJOF 5L3BA 4AD9A 4AVPA 4HW0A 4KNYA 4WCGA 2DK5A 2Q8KA 3E3VA 1W66A 2PMEA 3MCZA 4KYWA 1ASYA 3QPHA 3ZP5A 4YFXF 2NNYA 4IPAA 3CUQA 4UP9A 1U8RA 3WU0A 1U78A 1K6OA 2W24A 2ODRD 3F8MA 5DDGA 2DI3A 4P5OA 3SWNA 2E10A 4PG3A 2ZTGA 2ZCWA 4HA8A 3O3KA 4FX0A 4EMKB 1FZPB 2ADUA 3LSQA 1O57A 3IRQA 1KYZA 2VBZA 3LA2A 4EGYA 3BDDA 4TQDA 3ICAA 1FX7A 3VODA 1XSDA 4UUVA 1J59A 3I4PA 4BWAA 1IN5A 2Q7EA 4YYEA 2D1VA 4EQQA 1TNTA 3RDIA 4L9TA 1XSXA 1SFEA 4L0ZB 2DLLA 4ASNA 1O7FA 4U0WA 2STWA 1R23A 5HS7A 1FP2A 4XU1A 1FNNA 1MJBA 2GA2A 2YLBA 4AIHA 2DU9A 2C6YA 2H94A 2QTXA 2HTSA 2HR3A 2FF4A 2FMYA 2KJCA 4YIIA 4A0YA 1FYKA 1R1UA 2IY5B 3JCMd 3F23A 4Y13A 3JCMJ 2Z33A 4FX4A 3H3UA 4JQFA 5ICFA 5LEJA 2MH9A 2VT2A 4B8XA 3GW2A 2O61A 2RQPA 4ZYHA 3HTUA 2YX7A 3HFVA 1G51A 4XTZA 1S7AA 4NL3A 4CH3A 2PLYA 2DBBA 3N97A 2KRFA 3P9CA 3TO7A 4XU3A 2FA5A 2MBFA 2LSOA 4IXAA 4WK8F 3GFIA 2HWVA 4CH6A 1B6AA 4X5OA 5GMKl 4BXUA 3KEQA 2DDZA 3IG2A 2XRNA 2XAQA 4EM2A 3KLOA 2AMCB 4KICA 1NYRA 3CO6C 1YFTA 2CJBA 2MD5A 3HFNA 3HSFA 2DJZA 2YX4A 4EJWA 2QQAA 2W85A 1R7JA 2RA2A 4IRHA 2JTVA 1FOKA 1DDNA 5L3CA 5GAN4 1IRFA 1HXDA 3L4GA 5HLGA 3RUXA 2FNAA 1USTA 4M7AF 5JI6A 5FO5A 4KMUX 4RGUA 4H0EA 2RVCA 3PFIA 1Z7MA 5FD6A 2FB7A 2EV5A 3T0YA 3WE3A 4YRJA 2DQLA 4OIRF 1E24A 5E8GA 2P7VB 3R0JA 4HDUA 3BJAA 2HQRA 5LGTA 1HKTA 1QE0A 2K27A 2XAGA 2CGHA 5GMKe 4WJ4A 1ATIA 3K69A 3KP6A 1KA8A 1N9SA 4RB2C 3HUGA 1E1OA 2XTIA 3V7RA 1WQWA 4D0PA 3QP5A 3F3XA 3L9FA 4YRIA 5E3IA 2E65A 2XAFA 1XGMA 4YIFA 1BN5A 4NCXA 5K1YA 3SB2A 1U6GA 2QLZA 2P5LC 4YRNA 4AWXB 2BEOA 1H4TA 4P75C 4IJAA 1KU9A 4F7UF 4KMFA 1SMTA 3C7JA 4ENJA 1EVLA 4I7HA 5CVJA 5ILSA 5L3FA 2NNNA 2QBYA 3DFGA 3RJPA 1TTYA 1FYLA 4A5MA 5HS9A 2G9WA 5H6QA 3ZQ7A 3QU6A 2UZKA 4ENNA 4NOYA 5K5OA 4X9DA 4WWCA 2G7HA 1D8KA 5E8IA 1EV7A 3CDHA 3WU1B 3QHSA 2OAZA 1TQMA 1BIBA 5AIPA 5E1ZB 1L0OC 4XU0A 4MQVA 3EQLF 3HXUA 5ED4A 1BBWA 3I58A 4M71A 1SMYF 1I5ZA 4HLXA 2RHQA 4M77B 3JCMg 3JTGA 3V7SA 2VC1A 2EFWA 1BM9A 4M9SA 1K7AA 3QO3A 3F22A 2O03A 2OA4A 1R1VA 1TLHB 4H2TA 3M8EA 3REOA 3JCMb 2E41A 1ODDA 1B70B 2NAZA 2RM4A 4I98B 2DPUA 2XIGA 2Y75A 1KQ2A 2GXBA 3HTZA 3RKWA 2FMLA 3LFKA 1LVAA 4QWQA 5JVTA 2PJPA 3I0TA 1P92A 3JCMP 3DKWA 3IKLA 1S8NA 4UVCA 5L3DA 1EH7A 3ZMVA 1BI3A 2LDUA 4P75A 1ZAOA 4ZH4F 2KIMA 4M75C 1CF7B 1IXSB 2L54A 2AKWA 4JRKA 3KP3A 3PCOB 4HWTA 2JSCA 1ZRCA 1FSHA 3I59A 4RAZA 1LQ1A 5H6RA 3WGHA 4RB0A 1EFWA 1B4AA 3ISPA 2GA1A 4UPAA 4ON0A 2EJFA 3K1PA 4ESFA 2RV8A 4A0ZA 3JCMf 4HQMA 5D5WB 2P8TA 4G84A 5E1XA 3FJPA 3B02A 2Y48A 4KIGA 3ML6A 4K87A 2Q5HA 12ASA 3NQOA 5D6EA 4HVCA 1UHMA 2CGPA 1LEAA 3FM3A 4M75E 4HT8A 3WTWC 2XGXA 4I0AA 2ETHA 4ZTUB 5LJ5d 2GXGA 3BOQA 4M6XA 4C92B 4P73C 1F4KA 3FF5A 3HXVA 3JW4A 1MDMA 1ZLKA 1HW2A 3VU3C 2DTOA 2FYKA 4LG0A 3TDZC 2MC3A 2DVEA 3GZ5A 4IHTA 2DK8A 1EIYB 4HWOA 4M75G 4LLGF 3TOBA 4Q15A 1QGPA 4HX8A 5HLHA 2P5VA 5GANd 1ASZA 4F7UA 2L01A 3E5XA 1G4DA 1TNSA 2O3FA 4BW9A 5EEGA 1RIQA 1YYVA 5CVRA 3JCMh 3O6BB 1I1SA 3WTSC 2VE9A 1LJ9A 4HZFA 2W57A 1DP7P 2FU4A 3U2RA 4HF0A 4GCVA 4TQFA 2ZIMA 3INZA 2P5IA 1R58A 4PCQA 4M75A 2RHSB 4ZTZB 3T1BA 3DQVC 1WWXA 2I4OA 3QU3A 4Y91A 1QPMA 2HNIA 1XCVA 5GAN6 1REPC 2F2EA 1YW9A 4XTXA 1Z6RA 4J6YA 4XTWA 3BWGA 1P2FA 4LGWA 4A6EA 1YTYA 4M75D 2C8MA 2FSWA 1GXQA 1B9MA 5GAN3 2CIMA 3HSRA 3HFZB 1O7LA 2LF7A 2QQBA 1STZA 2JZYA 3E9IA 5K1XA 1B9NA 5DCFA 4HLYA 2D2WA 3BZ6A 4LB6B 1XDUA 2W25A 4P72C 1BI1A 4Y17A 1X55A 1T0FA 5HLIA 4C8QE 1YQAA 2RD1A 4M7DE 1KU3A 2GIVA 3GO5A 1W7PD 4I0BA 4EMHA 4ZZLA 5HOOA 1G6NA 2A6HF 1G5IA 3BJUA 3BY6A 4P73A 1MKMA 4Q47A 5FFXA 1BI0A 3QP6A 2XROA 3L1AA 3JB9F 3BY7A 2LF8A 5L3GA 2A69F 2V1DA 1I27A 3K2ZA 2IP2A 1YO5C 4YRCA 2LKPA 3WTVC 3GLXA 5GAOn 4M9XA 4EMKC 3I5UA 4P55A 3LAPA 4Q48A 1B34A 2DO7A 2F5EA 1TBXA 3JAMK 4C8QG 2F5CA 3JB9J 4M7DG 2XAHA 3FM5A 3R6SA 4DNCA 3L2CA 2G7UA 3RTRA 3IALA 5KK1A 1J2XA 4CH4A 5AONA 3E97A 3W3SA 2KIFA 3UGQA 5HGQA 2CYYA 3PQJA 4S04A 3T8RA 4M9ZA 4NQWA 1VTNC 4RGXA 3MEXA 1QZZA 1W4MA 1PYSA 5FGMA 3J80K 2XV4S 4A54A 1N9WA 2XKPA 3CUOA 1LDJA 1AWCA 2Z9OA 2VN2A 3ROUA 4PNOA 2FRHA 4PZJA 2ZT7A 4CO8A 3HRSA 2EJGA 3ERRA 1U5TB 5LJ5g 2ZXJA 4XTUA 11ASA 4KFCA 2ZMEB 2V9VA 1JBMA 4UVAA 3A32A 3HSBA 3BFMA 3TOAA 1FBUA 3BJ6A 4P3NA 2PEXA 4RQEA 2NYXA 4C8QD 4EX5A 4M7DD 1J75A 5E20A 4C8QB 2O0YA 4M7DB 4KIFA 4ETSA 1O3SA 2DZ9A 3U1DA 2VBYA 4PDKA 5GANg 3E5QA 4MNUA 4TVAB 1WQ2A 4P72A 4P3PA 3RI4A 5LRRA 1LB2A 2ESHA 3ECHA 4MGRA 4RQFA 3V7CA 2PBIA 4M78C 3JCMQ 2X4HA 1OYIA 2ALYA 3RGLA 4GXOA 2PMUA 2TDXA 4ZYDA 3DPTA 3L2ZA 1P4WA 4ZIBA 1FYFA 2BGCA 2BE5F 2E1HA 2ACJA 1NNHA 4CICA 4L5IA 1NJ1A 4LD5A 4JRIA 2JPCA 3I64A 4HX7A 4OIOF 4HWRA 2JT1A 1FBQA 2HZTA 3DPLC 2XGTA 1YFSA 4GO1A 4LB5A 3RL6A 3W6KB 1SESA 4EMKA 2ZZGA 2DPDA 2RGVA 1KQ0A 3ABUA 4WXHA 1KYWA 3LQQA 2PN6A 2IRFG 4YRKA 2X0LA 5KVRA 5F1RA 1MGTA 1ZRDA 5LHIA 3CUQB 5LJ5f 2VXZA 4B09A 3KZZA 2Z5UA 3CJNA 1WNLA 4M78E 4A6DA 4M77F 3TQNA 2V1UA 5BMZA 5C53B 3P9IA 3K1NA 5DUIA 1ADJA 3HXWA 3SWNB 5CJ9A 5E17F 3GEZA 2OD5A 1R36A 1B8AA 4MQ9F 3AHUA 3QNEA 4Q5SF 1XB4A 3RESA 4HDVA 3N4MA 4KR2A 1SFXA 4RDXA 4DQ2A 4EO4A 5GANf 1R5HA 2E64A 1WYDA 5D5UB 4KDPA 4PJOC 1G3SA 3GF2A 3QO5A 4M78G 4LMYA 2O8XA 1I4K1 3JAMZ 3COAC 1FPQA 2V1XA 3TEHB 3Q9SA 3F8NA 1XMAA 3LA7A 4L9JA 3ECOA 1DPUA 1ZARA 2Q0OA 3HRIA 4HV6A 3HY0A 2EFQA 1W5SA 5LJ5h 3LC0A 3J80Z 2FBKA 4KN7X 4CS4A 4M78A 2E5AA 4YCUA 2AMCA 2HEOA 2ZNJA 3QTCA 4HV5A 3MEYA 5GAMd 3IHUA 2W84A 2D45A 3V8JA 2ZO4A 3VBBA 1OKRA 4OU0A 2RB6A 3JSOA 2E7WA 1Z6TA 3M8FA 3VOEA 4M78D 3GX4X 2KKOA 4M77C 4H2YA 3RKXA 2P4WA 5IT3A 3KLNA 4I2OA 5GANh 2YHTA 2Q7GA 4QLCU 1ON2A 3WTZA 3JB9I 4U7DA 1OPCA 1WU7A 3M7GA 4HT9A 1F9NA 2EA4A 2FBHA 4WXDA 4C92F 3VQWA 1IRGA 4PJOG 2FQ3A 1C0AA 3L4GB 3L00A 4OIPF 4JLIA 3A7RA 4WJ3M 3RIRA 2C7IA 5LJ3d 1JJCA 5GANj 2JN0A 2QVOA 1IZ1A 2E7XA 2QHTA 1OMIA 1W5TA 4JBAA 5DD8A 4PJOA 4A0XA 2V79A 3T8TA 2RNJA 3RPUA 1IN7A 3IWFA 1ZH5A 1HSTA 3H3ZA 4CH5A 1BJAA 3QOPA 5CVUA 1VQZA 4P71C 1L0WA 4J6WA 4F7ZA 2RN7A 2DTHA 2ZT5A 3F6OA 3MZYA 2O6GE 2CWEA 1SFUA 1M5Q1 4PJOD 1H4SA 2P7CB 3FWEA 2K4BA 2PMHA 1ZHFA 1E17A 4JK1X 4U0VA 1XD7A 5JHUA 4M7AC 2DTRA 3HIFA 3RKYA 5GAN5 3I71A 2VOPA 5GAN8 2VODA 3WGIA 3HOSA 2NRAC 1E1TA 5GAOl 3M9AA 2Z99A 3JCMe 1EQRA 5LGUA 2XKOA 2DZCA 4MEXF 1XSVA 3ZN1A 4C92C 3MQ0A 4CS2A 2MLGA 1USYC 4EM0B 4HAMA 4UV8A 2R7DA 1U1SA 4M72A 5F5WA 3S2WA 2VBWA 1YFRA 3QPTA 4L5JA 4XLPF 2XASA 3BJOA 2A68F 1HQCA 4Q4ZF 4LK1F 1WQ7A 1XMKA 4M6YA 4EM1A 2OZ6A 3JSPA 1PDNC 1AOYA 1IL2A 2FNPA 3PQKA 1YCYA 2RHQB 1O3RA 2V6CA 1I1GA 3E9HA 1B59A 1HTTA 1S6LA 1SRYA 2YSRA 6PAXA 2P0LA 3A5YA 1BIAA 3NELA 3TO9A 1G3WA 5GAMg 1Z91A 5CVIA 3MF2A 3REXA 2Y0MA 2AS5F 1KOGA 1YIOA 3QAHA 3NENA 1Z05A 2KIUA 3V8KA 1RUOA 2HYGD 5BS6A 4XTVA 1KMNA 5AIQA 3HOTA 2HTJA 3ZMUA 4EJTA 3QRFF 3EDPA 1NJ2A 2GWRA 2ZZEA 5EEHA 1S7OA 4AH6A 1DUXC 5TJJA 4P71A 2Q2EA 3QUIA 1HW1A 1G5HA 4BAYA 1T6SA 5CAIA 1IXCA 1ZG3A 4EVIA 1D3BA 5K5RA 4N0BA 3U9GA 1NYQA 1YS7A 4BNCA 2QZ8A 3LWFA 3WE2A 4F7UE 4G8XA 1QF6A 3MZHA 3IWZA 4O6JA 2J3MA 5LHHA 1X01A 4M7AA 2K57A 4YRTA 3HHGA 2AKWB 5LJ3g 2YR2A 4OMYA 5H20A 2EB7A 3JCMX 3KETA 2EA2A 3ERED 1TW2A 5GMKh 1J5WA 1FT9A 3DV8A 4EV0A 4C8QF 1B7YA 4M7DF 3P9KA 1UFMA 4PGGA 4MTDA 4BH9A 4YDQA 4H2XA 4C92A 3I53A 1MZBA 5C52B 1USYA 3UFGA 1MJ9A 4HYEA 4F7UG 3D5LA 2FOKA 3B73A 1WKMA 3MAJA 3KP4A 3HFOA 4KN4X 4J6XA 5E18F 4TV7A 1F5TA 5GAMf 5FFZA 3MWMA 1N9RA 2HYFA 3SQNA 4LLNA 2L02A 5GMKm 2G4CA 5ICCA 5DUKA 4R1HA 4RGSA 1Y96A 4XEOA 3EETA 4RMFA 4XRFA 1K79A 3ZN0A 1IN4A 3EUHA 1MDMB 2OQRA 1ZGAA 4G7ZF 1FLIA 2P5KA 4G9YA 4LG0B 1YLFA 2ZGWA 3I54A 3K0LA 3JCMW 5FD5A 2H09A 1QQIA 1CGPA 3BDUA 4N0AC 2R7FA 1KU2A 1WPYA 5LJ3f 4KUMA 4ESJA 5ELOA 3KCCA 3HHHA 1V3FA 1F1ZA 2FXAA 1IN8A 2WWYA 4XLNF 1SD7A 4YCWA 1KMMA 4U7BA 5D4SA 4LLLA 2OZUA 2I4NA 1MGQA 3H92A 4IF4A 4RB1A 1BOAA 2FBIA 1KQ8A 4XEMA 4HX4A 5GAMh 4M75B 3NEUA 4V2SA 2EWNA 2MH2A 3WTXC 3M1EA 1BBUA 1T38A 2M45A 5GAN7 2ESNA 5F6FA 3HRKA
chains in the Genus database with same CATH superfamily
4U0YA 2KPMA 1H9GA 2AKLA 4Z89A 3HSEA 1W7PB 3W2AA 4NNJA 2R93J 2NS6A 4JS5A 1HKQA 2X48A 2ODRC 3KP2A 2EK5A 1ZQ3P 2VYTA 1T56A 2EW3A 2PQWA 3CUQC 4WX9A 1RADB 2LCCA 4BQAA 4RCCA 1HW5A 5CKFA 1OR7A 1OI1A 3OIQA 5B1BH 4LFUA 2NUPB 4KGVB 2ZCFB 4JJNK 3RMSA 1JRIA 2DKGA 1Y8RB 1B7TA 2JMWA 1HA8A 3HY1A 4Z2YA 3DBHB 1YNZA 2WSEE 5JFRA 2L4MA 1SEMA 3Q0UA 4E7IA 2BV6A 3HGGA 3VSLA 4XBFA 2ZZDA 1QVFS 2I2LA 1D1AA 4ENMA 1B8IB 4RTYA 5ERIA 3KBGA 1M90U 3GYHX 2ISZA 5B66C 4FHTA 1N27A 1UELB 2EGAA 1X2HA 2VJ5A 3G3ZA 4K2EA 2DL5A 3MP8A 4RAFA 1YN8A 5BPIA 1S7EA 2LJ0A 4RCBA 4IVNA 3HOYJ 1FC3A 1PNJA 4CXFA 3JV3A 3EH1A 2ALYB 2PFBA 4FSSA 2A3SA 2OTJQ 1HSQA 3HP9A 4CC3A 5K5QA 4IUUA 3F6VA 1PUFA 1X6GA 3OBWA 4W97A 1RRJA 3FX3A 3FIFA 1X2NA 4LN2A 2CJAA 5ILUA 4TTVA 1EH8A 4G7OF 2DL8A 3CCQT 5HVQC 4C3JJ 5DD4A 2V8KA 2DTIA 4YIRX 3G4SA 1JUMA 2WAEA 2XUBA 2LLKA 2DM1A 2Y2ZA 3JB9G 1BJZA 1NTCA 4H02A 3HTRA 5C4XJ 3M56A 4L18B 4OMZA 2DL4A 5D5XB 5D6FA 1NEBA 2E60A 4ZYGA 2NVXJ 3RPQA 3AG4H 3G4SI 3OS5A 1K73C 1YW8A 3CD6Q 2DETA 1TP4A 4H4KC 3A98A 3O8VA 1QZYA 2JRTA 1SC7A 2CFXA 2BBYA 1Z0XA 2QUFA 3M53A 1WJSA 3BROA 4EEFG 2CW0F 2ARSA 1WJBA 4UP8A 4PJNA 1XTDA 2JT4A 3ZMDA 3VFZA 4M78B 2Y9YA 2XGEA 1DJ7B 4OOIA 3BR5A 2DU7A 5KYYB 4A3JJ 1LDDA 1D0ZA 3JAME 2LG4A 2AQFA 1NG7A 4P5NA 2K4YA 2CDTA 3RF1A 2RDPA 4MMKA 3CTAA 2RI2A 1OLTA 3HDDA 1WPKA 4P74A 3VUZA 3E9FA 1ZYRF 3E6DA 2JA8J 3CP2A 1JJCB 5GAOp 1YGBA 1G59A 1EA3A 1FSEA 1E22A 1K1ZA 3GXOA 2DMTA 3C1DA 2L3PA 3VS0A 2W48A 3L7WA 4FIBA 4J7FA 4D9JA 2QGUA 3AFHA 2COYA 3CCLA 1QVUA 3WQZA 3CCJT 2QEXA 3OYYA 1SD5A 3ESWB 5KE3A 1LEBA 2KYBA 4MTEA 2R5ZA 2FZKB 2XAJA 2DYBA 3A7UA 3R0AA 2CQNA 1LJOA 1XNIA 1V4RA 4IUQA 4M77A 4EATA 4CS3A 2CZ6B 2FVUA 4CSWA 5J39A 1YITT 4A3CJ 3CCLI 2JXBA 2QEXI 2VONA 1VQNA 1RAEB 2HL5C 2MW8A 4RM3A 3GTQJ 3HXXA 4UHTA 3G71Q 2RNGA 2VT3A 2X35A 1YS6A 2M7AA 4NL2A 1N8RC 5A0GA 3S2DJ 2PZ1A 4BHBA 1IAWA 1B76A 1OYYA 2ZIOA 2KE9A 2FX0A 2M0OA 4A5NA 2RQQA 1TQIA 1WJCA 1VQNI 2YUSA 5HDNA 3KFWX 1X4OA 2VASA 4M7AG 1LKXA 4XK8E 1HC7A 1ZLJA 2Z3YA 3RCOA 2OQGA 3LNQA 4YRVA 5GAOq 3NETA 3REBB 5EDNA 1X2GA 4C2UA 1LOJA 2RHYA 4XU2A 1KG1A 4XNFA 5GAEJ 3UATA 3GNFB 1U2WA 1GBQA 2L3DA 1UHWA 1YB3A 1YG2A 3I59B 2K02A 1VQ9Q 1LPQA 3EYIA 1IB8A 3H41A 1F36A 4ZDOA 3M0RA 2M0CA 4A53A 3CCMA 4AYBN 3WU2C 2CJ9A 5D8LB 3ZPLA 3G1OA 5GMKj 1S9HA 3Q3SA 3ZGKA 1JHHA 3RYPA 3NEMA 2P81A 3GWZA 1XC5A 2IA1A 1AHJB 3RNJA 4CCJA 4BXFA 3I7FA 2D6FA 3DEUA 4RTVA 1USSA 3CCMI 1U5TC 1OCRH 3BR1A 1ZBJA 2QCOA 4KT0E 1Y96B 3HRTA 3C3WA 4KUDK 1YIJT 2XVCA 2K3FA 1SFOJ 2Y30A 3RQ4A 2K9QA 4PHCA 2KXCA 3OOUA 4XLAA 1XN7A 2ZFWA 2PJRA 4C8QC 4M7DC 3OSFA 3BR2A 5LEKA 1D8JA 3OR1C 1NEGA 2IG0A 2TCTA 5IT9Z 3GFMA 5IOZA 3ZRGA 3S1RJ 2HDCA 2M1BA 1YI2Q 1W7PA 3KIOA 3WTTC 2L7FP 2HSPA 2OBPA 2ARUA 4YRQA 2KRCA 1JXOA 3OYAA 1ARKA 4KT5C 4M73A 1H4QA 4J9GA 1UEBA 2EFPA 4BGDA 5A0DA 5DCMB 4PJMA 3KEOA 3L2RA 4JYKA 1OULA 3PMIA 1R22A 1VQMA 3I35A 5FWBA 4I02A 2YUQA 3KP7A 3I56Q 1MBEA 4M78F 2NUTA 5CYVA 2RKHA 1Y39A 5HS8A 3ZMZA 3K2AA 2YT6A 1E3HA 1Y0UA 4KA4A 4IOCF 2VLAA 3CCVQ 2CO5A 1I07A 2DQ0A 1VQMI 2OX7A 2BHYA 3FXQA 3G1MA 4JX4A 3IC7A 3CDIA 4O2DA 3CCYA 3CLOA 2R3SA 4BY1J 2VC8A 2W82A 4G7HF 2VXDA 2H27A 4LK0F 2VXFA 2EFNA 4TVAA 1I5OB 2WC2A 3TW7A 4XKCA 2J5PA 1M1KU 3DSQA 3F21A 1K9AA 1AKHB 2MYSA 1KC8C 3JRBA 3CMEA 2KMTA 2JA6J 4P3OA 3CCUT 2QENA 1EOVA 2LZ6B 3K4NA 2MCNA 1NBEB 4J9DA 4WCGA 2DK5A 2DJNA 4OAYA 3E3VA 4BEHA 4F93B 3HOWJ 3BZCA 3MCZA 3A2KA 2F4OB 2LNVA 2KFDA 2NNYA 3CUQA 1U78A 3CMEI 1QW1A 3CCRT 1MNMC 3DBLB 2O9LA 1NZ9A 5DDGA 4P5OA 2GM4A 1QHHD 4DBFA 2ZTGA 2J05A 2A36A 2ZCWA 3CC2A 3O3KA 4FX0A 1FZPB 4Q5WA 2HYJA 3PE0A 3LA2A 4EGYA 3BDDA 5FLVA 2IGMA 4AYBA 3ICAA 2IS4A 3ZQHA 3CC4A 1IN5A 2Q7EA 2D1VA 2JS2A 4KJZA 3EGDA 1QU3A 2STWA 2GA2A 2DU9A 2FMYA 4YIIA 4A0YA 2IY5B 2HZYA 2LX7A 2XF6A 4FX4A 5KYUA 3QPLA 1QCNA 4B8XA 3BR6A 2O61A 3HTUA 2YX7A 2Q1ZB 2XPUA 3FISA 1X27A 3CDLA 4NL3A 2YUOA 2KRFA 3CCST 3UT1A 5LL6S 2LSOA 1VQ7T 4IXAA 3CC7T 5K7FA 2XRNA 2XAQA 3KLOA 1YHQA 4KICA 3ZOBA 4CZCA 2DJZA 5J4YA 5FKMA 2RA2A 1MBHA 1FOKA 2VQLA 1QWFA 5JI6A 4RGUA 3PFIA 4CH7A 3TW6A 3LYIA 1E24A 2P4RA 2LFBA 2ZPGB 1QE0A 4N4OB 2EYZA 5GMKe 2CGHA 1Z3XA 4WCIA 3KP6A 2A28A 2PVGB 1QVTA 1WQWA 4D0PA 3L9FA 5E3MA 2D0NA 4XM3A 4F91B 1ZELA 1IHVA 2UV1A 2A3LA 1BR4A 4LE9A 4I7HA 3DFGA 4BDYA 1TTYA 3JR9A 3KYDB 5DM6F 3ZQ7A 3VRZA 2KEAA 3FXJA 2EFIA 1VQLT 3LGLA 2F4MB 3CMAQ 5E8IA 2JSPA 1EV7A 5HCKA 1E6GA 1WXTA 5AIPA 4KT6A 3JRFA 2QA4T 4ABZA 2LC4A 3MQZA 1M3AA 3I58A 2CP2A 1G83A 4XLEA 4J19A 2KRSA 3EUKL 4BY6C 2OJ2A 4MO7A 1AHDP 1K7AA 3QO3A 5EZGA 2QSGX 3JCUC 4H2TA 2E41A 1ODDA 1M2VA 4I98B 2DVJA 2FQ4A 2XIGA 1KQ2A 2VJ4A 4HRIA 3BG6A 2K79A 4QWQA 5JVTA 1Q82U 3I0TA 4A63B 1P92A 1WJRA 2DAQA 2MWOA 1EH7A 2LTOA 4C2TA 1IXSB 2AKWA 2EYWA 1RUWA 3KYLA 2LVMA 3PCOB 1UZCA 3I59A 5H6RA 3LH5A 2ZC2A 2GA1A 4ON0A 2EJFA 1ETQA 4FU6A 1JXMA 3H5NA 2QKMB 2P8TA 2JTEA 3IP4B 4J7IA 5EG0B 4EDUA 2Q5HA 2YUPA 5D6EA 4HVCA 2CGPA 3FM3A 5L23A 4DJAA 3QJYA 4ZTUB 5LJ5d 3H5AA 4XLHA 2HPIA 4M6XA 4P73C 2LTPA 3PO2J 4LDVA 5IP7J 1VYUA 1CKBA 4CCMA 3HXVA 3JW4A 1ZLKA 1HW2A 2O2OA 2L3QA 5IN1A 2D8HA 1KD1C 1EIYB 1G2BA 4HWOA 4Q15A 4FT4A 1QGPA 2P5VA 2R5YA 3OS2A 3E5XA 5CKBA 4CCKA 1YYVA 2BXYA 2DJIA 3O6BB 2VE9A 1N6AA 2K3YA 4HG2A 2FU4A 4HF0A 1MMGA 2QSFX 1MV0B 3E0JB 1GCPA 4M75A 2RHSB 4RUGA 3DQVC 4L5EA 2MG4A 1OPLA 2NYSA 5GAN6 1RLQC 3QG1A 2LQWA 2CKKA 1P2FA 3NFCA 4A6EA 2C8MA 1I3QJ 4FYWB 1GXQA 1MBKA 2CIMA 3H35A 1O7LA 3LWHA 2HL3A 1K0XA 2PVOB 3HGYA 3E9IA 1X6OA 2RK2A 2D2WA 3BZ6A 1XDUA 2W25A 2HKQB 1T0FA 2VV5A 2RD1A 2GIVA 1C0MA 4EMHA 4V19K 2ECCA 1NYGA 3GNGA 4NC8A 3J7YJ 4Y28E 1X1PA 3CMYA 2GTOA 3GLLA 4KULA 3QP6A 3CMMA 5L3GA 2V1DA 1YWPA 4OMPA 2IP2A 2OCEA 3GLXA 3QXEB 2BE9B 2HQHA 3I4MJ 3M54A 2F5EA 1TBXA 2F5CA 2UUZA 3L2CA 2G7UA 3RTRA 1J2XA 2B7EA 4RTXA 5AONA 3E97A 2JRMA 3VUBA 5IT9E 2JA7J 4A54A 4PJ0C 1RI0A 2GTJA 1AWCA 3MJXA 4PNOA 3GTGJ 4PZJA 4CO8A 5IPAA 2ZXJA 2ZMEB 4ZJZA 2E3IA 2V9VA 1UGPB 3A32A 3H8ZA 1AT1B 1ZSZB 2MSYA 3BFMA 3BJ6A 2PEXA 2CQ7A 2DA3A 3HPHA 1J75A 1YJNQ 4ETSA 3AG3H 2R57A 2DT7B 2DZ9A 2KQRA 5DLQE 4NUBA 2JW4A 5GANg 2AKKA 3E5QA 4MNUA 3U1KA 4P3PA 3RI4A 1KQSA 5LRRA 1BL0A 2E2JJ 1M90R 4MGRA 2WY7Q 4M78C 1WHMA 2JVGA 3RMQA 1FMWA 1Q1VA 4E6RA 3BR3A 4ZYDA 3L2ZA 3OW2A 1AZEA 3FKJA 1Q86R 4CICA 1NJ1A 2JPCA 4C5GA 4HWRA 2HZTA 3DPLC 2XGTA 1YFSA 3RL6A 1MHNA 2PVDB 1SESA 3CCQA 3ABUA 1KYWA 3LQQA 5F1RA 2ZPEB 4PJLA 1VQOQ 4B09A 3CJNA 2DN0A 1WNLA 4XN0A 4CC7A 2WAFA 2CP0A 5CJ9A 4MQ9F 3QNEA 3RESA 3VRYA 1SFXA 1QVGA 3HB9A 3CCQI 1VQ6A 5GANf 2E64A 1WYDA 1JT0A 5D5UB 4KDPA 3GF2A 1X2KA 4M78G 1SAUA 4LMYA 2O8XA 4J00A 3SEQA 2QI2A 1XMAA 2L3SA 2X9DA 1DPUA 2Q0OA 3HRIA 1WHKA 1ETYA 1DQUA 1W5SA 5LJ5h 3S8PA 3J80Z 4AG1C 1VQ6I 3I9QA 1WHLA 2PUKB 5F04A 1YJWA 3IHUA 2D45A 5F08A 2CH4A 1OKRA 5GTHC 3HOXJ 4Y33A 3JSOA 3OMYA 2XKOC 3M8FA 4MZTA 3VOEA 2EQUA 4H2YA 2P4WA 2Y0SN 2CREA 4BS9A 5JVGF 2XB5A 4XAXB 1ETOA 3G7ZA 4Y3OA 3W2VA 2XDPA 2CSQA 1R8OB 3GBGA 2FBHA 1YJWI 2X4XA 2L2PA 2M9HA 3A7RA 3RIRA 2VI6A 3FXOA 5GANj 3HOVJ 1IZ1A 2E7XA 3UPUA 1NG6A 2VB6A 3PL8A 1W5TA 3TBIA 4KBMB 3M57A 3UDCA 2CSIA 2V79A 3OQ5A 1ZQ1A 1IGNA 3HUGB 4CH5A 3CCJA 4J6WA 4F7ZA 2ZT5A 2O6GE 1LVKA 2H3JA 1SFUA 2EPFA 2P7CB 3NAUA 2PMHA 1MMSA 3EAEA 3M0PA 2FO0A 4DBRA 3HIFA 3RKYA 5GAN8 3URGA 4RLFA 3HOSA 4RTWA 2HDDA 2NRAC 4OB1B 1E1TA 2Z99A 3OSSC 1EQRA 3CCJI 2M51A 4X1VA 1ZGWA 1USYC 3C12A 1WGSA 4I76A 1U1SA 2JNGA 4HCBA 3QPTA 4L5JA 4XLPF 3ER0A 3G6EQ 2DFUA 4LK1F 3RBBB 1JKQC 4BDZA 1XMKA 2OZ6A 3G1LA 4FE7A 4LDUA 2E5NA 3ZQQA 2RHQB 1UG2A 1NPRA 2CUEA 1B59A 1S6LA 2YSRA 4CCLA 1HOMA 3EUHC 2K2MA 3EGUA 2LQKA 5GAMg 5CVIA 5J1RA 3OMCA 1WYXA 2OTJA 3NENA 1SEUA 2XGCA 5BS6A 4XTVA 2HOAA 5AIQA 4JX5A 1K9MU 2HTJA 4EJTA 4C0DB 3Q1JA 1NJ2A 2OUMA 2GWRA 1HW1A 1G5HA 3M0UA 2YSQA 1IXCA 1D3BA 1NJIU 1NYQA 3ZQIA 2EVRA 4OGCA 2NS7A 4A3FJ 1X01A 4GDFA 2O88A 2OTJI 4RAGA 3ZR8X 2YR2A 4OMYA 4BU2A 2EA2A 1TW2A 5F0CA 4BH9A 1TOVA 2LJ3A 1JJ2P 4H2XA 3I53A 5C52B 3K4LA 3B73A 2E35A 3FIWA 4B9XA 4KN4X 3K4BA 5GAMf 3ZFJA 4EPCA 1LPLA 4E7HA 2HYFA 5AYFA 3MP6A 5ICCA 2GFUA 5CPRB 1F1BB 3VSKA 4LNPA 1K79A 3MKYB 3IH2A 1IN4A 4BI4A 1MDMB 2OQRA 1ETWA 2IVWA 2KGTA 1YIJA 1I6HJ 4B4CA 3CD6I 3PT9A 1ZUUA 2Y0SA 2FG0A 2EIMH 2H09A 1CGPA 4P1WA 4HCCA 2CUBA 1KU2A 4KUMA 5A0LA 1YBYA 3HHHA 2WWYA 4L6V5 3CZ6A 3JRIA 1K8AR 4U7BA 2OZUA 4DGWB 3OS1A 1X58A 5KYXB 2O5RA 2EWNA 2MH2A 1BBUA 4LVLA 2ESNA 5F6FA 3K9TA 4UNOA 2KBTA 1WJFA 3R61A 4IO9F 2DCEA 3GUDA 4S05A 1OZ3A 1JKRC 5J6XA 5J8CA 4ORZA 5GAMj 2OTLQ 3L1PA 4ESBA 1A04A 1XGOA 1NJ5A 2BKDN 4BHPA 9ANTA 4BXXJ 4MFEA 4TVYA 1TWBA 1KU7A 2DEQA 1BBYA 4DYQA 3OBYA 4DZJA 2ECZA 4IUPA 2DW4A 2BUDA 5EEAA 3J81K 1X1AA 1WI3A 4HF1A 5GAOm 1FTTA 3LWIA 1D5VA 2UXNA 4BKXA 1B72B 2K85A 4LVIA 4H2UA 3HXZA 4D1QA 1B34B 2NUZA 3SXYA 4Y52J 3R60A 4N0AA 4RBOA 1U06A 2RHUA 1U9OA 1R1TA 1ZSZA 3LSTA 4R79A 1X54A 2J6OA 1TUDA 1FJLA 2RPNA 4CYCB 2XI9A 2MMPA 5GANe 2VKVA 3KFUA 5JR3A 3OD1A 3CCUA 1TG0A 5ILVA 2CG4A 5KHDA 2WBMA 5EZHA 3G71I 4HWPA 4FETA 4CDGA 1M1KR 3P7NA 1RETA 3C18A 3K7AJ 1M8VA 1WI7A 2YS9A 1NJ6A 5CQXA 3EPZA 3CCUI 1ZR2A 1HDDC 2ZJ2A 1A36A 4N9HA 2X4YA 1U1TA 4D7NA 4RM2A 2DEUA 2CV1A 1RR7A 1YJ9Q 3OV8A 1VQ9A 3M8JA 4UY8I 4DOWA 3OOPA 2XIDA 2YDLA 1Z9CA 3UF4A 5GPAA 4UUSB 2ICWG 2W10A 2TRTA 2XF5A 4FTHA 3LSSA 4EJUA 3K4CA 2M30A 2E6ZA 3FZVA 1VUBA 1PUEE 2JA5J 1WH5A 4A12A 1VQ9I 1MJAA 2ECBA 2LKSA 2VBXA 3GTLJ 1VQPT 4RG2A 1Y57A 5IHNA 1K73R 1MH4A 2GOMA 2DXIA 5GAN2 5ICGA 1X3WB 5CR2A 4H2VA 3EG0A 4HSTA 4RAYA 4BYYA 2HI3A 1DPRA 3P8YA 1XG1A 2HKNA 2F48A 2QDLA 1TZLA 2PG4A 2JJ7A 4QSHA 1VQ7A 2K5IA 4OMFB 2RK1A 4KIBA 3Q9VA 5K7HA 4PJOE 3JB9D 2DAOA 1SHGA 1OCOH 4YP0A 1NJ8A 2SRCA 5DV5A 4DYRA 3OR2C 2X4WA 2EQJA 4OMNA 2ZCEA 4LJZF 2ZFUA 3JRZA 3SDGA 2CSOA 3PIOA 4DEXA 2D1HA 4DW6A 3VS7A 1YI2A 1BKBA 2E71A 2GZWA 5KYWA 4H2SA 1MUZA 3ZL7C 3LSGA 2CJJA 2PX9A 4IHYA 2WA0A 1WIEA 3HYIA 3J81E 2MABA 2FPFA 4ZTJA 1O9SA 2WSCE 3CMQA 3O2PE 4MIMA 1ZUKA 1WLEA 4DBHA 2F2XA 4BD3A 3EH2A 2M8GX 1NPPA 3J80E 4D7MA 3H9GA 2ZBKA 2GNCA 4YREA 1YI2I 3O8GA 2HQNA 4QVCA 5FB2A 5LBQA 4IHXA 1QP2A 2CQXA 4M74A 3M3YJ 1AWJA 3CPWP 3OYJA 3H0GJ 1G3YA 1PKSA 5CK9A 1UHSA 4EJVA 3RPUD 3ELKA 1JGSA 3JSCA 4PJOB 2VIXA 3OYBA 4DBQA 1E7OA 1VQLA 3CCVA 1Q1HA 4JJCA 2QBYB 4K88A 4OP0A 2QHSA 2DXCA 2LJ1A 2K4JA 1H0MA 2IT0A 3BZKA 2YRCA 2IJLA 1U3EM 1HSJA 4O3MA 1IXRC 3BG5A 5K1PA 3KE2A 2NVUB 1QCFA 3GOXA 4YROA 1GLNA 1RI9A 1GCQC 2B8AA 1VQLI 3OW2S 3CCVI 4GBQA 2IVMA 4A3BJ 2P84A 1FEXA 4XORA 3WHCA 2CUFA 4M7AE 2H6CA 3IH4A 4FE4A 2L4AA 1JO8A 5GAMe 2X3WD 1GVJA 2VKNA 3DWLE 1HKSA 1S29A 2HQEA 3EFOA 1GV2A 2H1LA 5E3OA 4N4NB 1LDKB 4Y15A 4F92B 3NGPA 4DEYA 1K4TA 1R4MB 4AVZA 1MMNA 1Z3YA 2ELKA 4LUEA 5FKKA 1M4ZA 3P8HA 1QVGS 4J01A 2DL7A 2F5KA 3IKVA 3DPUA 4PGHA 2KT1A 5KCMA 5BQTA 4NBQA 1RI7A 1VQ5Q 2CQKA 2Q2EB 2LD5A 2IBDA 3HM5A 3G2BA 4HNTA 1X56A 4A3LJ 2QQ8A 2ZJQF 2YRDA 5KAFC 4M7AD 1UB9A 3J7AO 4M7AB 3ABTA 2A07F 3DB4A 1GRIA 2A6TA 4IHSA 3CC2Q 1T39A 1X3UA 3I55T 1B7YB 4P96A 1U9NA 2E19A 1I39A 2ISYA 1JEGA 4WXCA 5FLXK 3CC4Q 1ZRFA 3TDUC 2ELHA 3WG9A 3NARA 2CUJA 2YU3A 3EG3A 3FMSA 2F5FA 1TW3A 1HBXG 3OYMA 3GFJA 2KRNA 2QG9B 1L3LA 4FM4B 2WB1A 2ZNZA 1ETXA 2L8DA 2MA3A 3N5BB 2ZMEC 4OVAA 3X20B 4RLQA 3K4MA 3BW1A 3CPWS 1W36D 1H9TA 1Z1DA 1FY7A 2Y4YA 1XGNA 3AG2H 4XK4A 2W7NA 1ONVA 5GAOr 1SRMA 1YHQQ 4EMSA 4J5YA 2V4JC 4L87A 2LRQA 2J5OA 1AZGB 4G94A 3TUPA 1U0JA 2QHUA 2RQUA 3F8BA 2Y4XA 2ZXFA 3WTUC 3AAFA 2ED0A 2RF0A 1TUCA 4E7KA 3TO6A 1VQ4T 3PNVA 3L2VA 4D8KA 4XSXF 1GGMA 2Y9ZA 4ENKA 1GDTA 4CI0C 3CF5F 3WVEB 1ZREA 3WODF 2W0ZA 4LDYA 2EILH 3CMAA 2KHMA 2RJEA 2ZR3A 4L59A 3DKYA 2M87A 3FBNB 5CCAA 1IN6A 4Y4RA 2K9SA 3KXTA 2E1NA 1KC8U 5A2QZ 3A1PA 3FXMA 4KITB 4XQ3A 1X3ZB 4JUVA 1KIKA 1SAXA 2OAWA 1WHUA 3VB2A 2I4MA 1QPIA 2AXLA 3A8MB 3CMAI 1PYSB 2P0QA 3I3LA 2LQ8A 2UWMA 5D7UA 3FDYA 3E6CC 1K61A 3G73A 1Y1VJ 2KYMA 3UR3C 4Z8AA 2IPOB 2K5CA 3CEYA 3TGNA 4R8HA 1LFBA 1NH3A 2QWWA 4RGRA 2A6EF 3CF2A 2NXNB 4ELYC 4C0GA 1X2MA 3SFIA 3M4QA 4PFPA 3KP5A 1AD5A 1KZHA 4UP7A 3R4KA 4PJOF 5L3BA 4AD9A 4AVPA 1P7IA 2J6FA 4A4FA 1H89C 1HD3A 1JUPA 2Q8KA 4ME7A 2PMEA 3CESA 3ZP5A 4YFXF 1ABQA 1M90C 4IPAA 4A3MJ 2DDBA 3MEVA 1U8RA 3WU0A 3UA6A 2JK3A 1D09B 2GQIA 2DI3A 3SWNA 2BY3A 3X25B 2BZXA 4PG3A 4EMKB 1D5YA 2EGEA 3LSQA 2QGFB 3S1QJ 1KYZA 1PUFB 3EGXA 4TQDA 3SD4A 1XSDA 4UUVA 3PIPF 4YYEA 1Y56A 1TNTA 4L0ZB 5J1YA 1UECA 1VQ8T 2DJQA 1O7FA 1CKAA 1R23A 2R7QA 1FP2A 2H94A 1FYKA 4Y13A 1S72T 4V2GA 3ZQGA 4JQFA 5ICFA 3WG7H 2K5LA 4E7ZA 1UG1A 2LT1A 4ZYHA 3HFVA 2DBBA 3N97A 2D0QB 4LG3A 3M9QA 4XU3A 2RH2A 1SF9A 4XIDA 1U5SA 1VI0A 2M02A 4BUPA 4WK8F 4CH6A 3IG2A 1W6XA 4EM2A 1WX6A 3CO6C 1YFTA 2CJBA 3HSFA 3BQYA 2EQKA 4EJWA 3O8HA 1VQKQ 2QQAA 2W85A 4IRHA 2ZSHB 2A5WA 1DDNA 1AWOA 4D5FA 1IRFA 3L4GA 4M7AF 4KMUX 4H0EA 1Z7MA 1GVDA 2WACA 3WE3A 2BTTA 3FXKA 4OIRF 5HKCA 1WFWA 3RR6A 4HDUA 3BJAA 1BW6A 3HOUJ 2H8HA 1WCMJ 1KA8A 1J09A 4C0DC 2XTIA 1X4PA 1X43A 3F3XA 2O8KA 4YRIA 2XAFA 2HNHA 4YIFA 1Y0NA 4NCXA 2K6DA 3SB2A 1U6GA 2P5LC 5FKLA 4AWXB 4P75C 1E6HA 2QK0A 2ME0A 4KMFA 1SMTA 3C7JA 3TP0A 1BR2A 5CVJA 5ILSA 2DLPA 5L3FA 2NNNA 4ZYAA 2QBYA 3NTHA 2KRHA 3BDLA 5HS9A 2EIJH 2G9WA 4OF1A 2RJDA 3EG9A 4XLCA 5H6QA 4DYCA 1WH7A 4X9DA 2COWA 2G7HA 2XD0A 3WU1B 1VYTA 2CW8A 1TQMA 3M4YA 5E1ZB 4XU0A 2KT8A 2CQQA 3FEOA 2R5ZB 2L0AA 2QASA 2HZDA 2E5KA 4E2FB 4M71A 3ZCOA 3GTMJ 4QT7A 2FZCB 2JZ2A 4M77B 3JCMg 3PIPA 3JTGA 3V7SA 5BNGA 2LP0A 3HPWA 4A3DJ 1R1VA 2ZAEA 3M8EA 2KMUA 3BC8A 1RAAB 1W2BA 2LR8A 2Y75A 2KRMA 3CBMA 2GXBA 1PYVA 3RKWA 3HHTB 3LFKA 2PJPA 3JCMP 3IKLA 4MLOA 5L3DA 3L2UA 5J3BA 2LDUA 1M8MA 1VQOA 2FOWA 3OYLA 5I2MA 2RQWA 4JRKA 2F5VA 2JSCA 1ZRCA 1K9MR 2EZHA 1MMAA 3OSGA 2H8WA 4XN3A 2DIGA 3DKMA 4RB0A 1ZBXA 1B4AA 3K1PA 1Z9QA 3JCMf 5D5WB 1VQOI 3CCQQ 2KNBB 2Y48A 4L5GA 4K87A 5E79C 1FMKA 4IUVA 4PKCC 2ETHA 2IGOA 1Q7YU 4BE0A 1R49A 4C92B 2RAEA 3FF5A 1MH3A 3FRNA 2FYKA 4LG0A 3GZ5A 2EKHA 5HLHA 5GANd 1ASZA 2L01A 2BZTA 1G4DA 1TWFJ 2O3FA 4BW9A 1RIQA 2LT4A 4TQFA 2ZIMA 1D0XA 2P5IA 1R58A 2P0WA 3QU3A 4Y91A 2IGKA 2F2EA 2CP5A 3U21A 4J6YA 4A69C 3M1CA 5L8RE 5F27A 1B9MA 2XSJC 2LF7A 4GLMA 1V5EA 2QQBA 2E2HJ 1STZA 1MNEA 1B9NA 2R7UA 1RAFB 4P72C 2D8JA 3MPUB 3DTEA 5HLIA 3Q0WA 1W7PD 4I0BA 2BW3A 1Y7XA 5HOOA 3BY6A 4Q47A 2XDDA 3DKXA 4V2FA 2HSEB 2V7FA 2A69F 3K2ZA 1YO5C 5GAOn 3I5UA 3JAMK 4IHWA 2XAHA 2RMOA 2KIFA 2VUMJ 2L9VA 4BQOA 2DRKA 4S04A 5D6YA 4NQWA 3CCJQ 2NUTB 4C5HA 1PYSA 2X6XA 1C1AA 1N9WA 3BLYA 2XKPA 3CUOA 4CCOA 3G6EA 3NMZC 1LDJA 2Z9OA 2VN2A 3ROUA 4Z88A 4OB2B 2LVSA 1EKEA 1BBZA 5CKEA 4OWRB 4UVAA 1S5LC 3JREA 2VPLA 3HSBA 3L42A 1YX5A 4RQEA 1YITQ 2NYXA 4MZMA 5E20A 2I8DA 2JN6A 4KIFA 1O3SA 3G6EI 3OS0A 4TVAB 4PSXA 1WJAA 1LB2A 2ESHA 2VQGA 3ECHA 4RQFA 3A0BC 4HVUA 5A2QE 3QYGB 4ZIBA 3MEWA 4XOTA 2KL4A 1DGRM 1NNHA 1NK2P 4HX7A 4OIOF 1M1KC 4BEHB 4EMKA 1T0HA 4WXHA 2IRFG 2X0LA 3CUQB 5B5EC 1R0CB 2VXZA 2X1DA 2Z5UA 2NOGA 1TL8A 4M78E 4M77F 5C53B 3P9IA 3K1NA 1NLOC 3HXWA 3G4ST 3AHUA 1VQPA 1XB4A 4HDVA 3N4MA 4KR2A 1QVPA 4RDXA 2HBPA 1APLC 2JTMA 3KFVA 3OL3A 1ZA2B 4PJOC 1G3SA 3M58A 2IS6A 3ULRB 4BE2A 1FPQA 1WXUA 2L2OA 2V1XA 3TEHB 1X2QA 2R7WA 3EGDB 3X26B 4JDSA 1OX9A 2VL8A 3ECOA 1VQPI 1ZARA 4HXJA 1LE8A 2F4IA 1SPKA 3EG1A 3VYHB 4HV6A 2EFQA 2C0TA 3LC0A 4CS4A 1QCOA 5KYUB 2E5AA 4YCUA 2HEOA 4LVMA 2Z0WA 4BBRJ 3DLLA 5GAMd 2KISA 2W84A 2ZO4A 4MDXA 5HY6A 3ZEHA 4M78D 2KKOA 1Y6IA 5GANh 2Q7GA 1YIJQ 1OPCA 2JTFA 1WU7A 3M7GA 3QODA 2ID3A 2XF7A 2DYSH 2EA4A 4WXDA 4C92F 2L9SA 3VQWA 1IRGA 4PJOG 2FQ3A 3LSHA 2OTLA 4OIPF 3J7AF 3P5JA 4WJ3M 2L3RA 4II1A 2JN0A 2QVOA 3ASKA 2GOXB 2B86A 5EG2A 1OMIA 4ELZC 3SHWA 4ATOA 1W1WE 2DFFA 1IN7A 1KSWA 3IWFA 3H3ZA 2M2EA 1BJAA 2OTLI 1VQZA 4QKUA 1L0WA 3HOZJ 2RN7A 3MZYA 2ROTA 3HL2A 3BG3A 4XKWA 3CCLT 1H4SA 2IAIA 1ZHFA 2QEXT 1XD7A 4M7AC 1TWGJ 2VOPA 1BB9A 2VODA 4S0HB 3WGIA 3EHQA 3JCMe 1HJDA 5LGUA 4MEXF 1XSVA 4AFZC 2M34A 2MLGA 4EM0B 4HAMA 1ZA1B 3S2WA 1VQNT 5EC7A 3NTIA 4M6YA 1WHHA 3KYCB 3VS3A 2BZYA 1YCYA 1O3RA 2V6CA 4C0ZA 1I1GA 3E9HA 3WXMB 1SRYA 3VS5A 2P0KA 2P0LA 3OYGA 1W36C 1Z7LA 1ETKA 2NVQJ 4XONA 3QQAA 5E3LA 3REXA 2Y0MA 1UJ8A 2KQWA 2PTKA 3CCUQ 1E3PA 1QVFA 1M2VB 1YJ9A 2KIUA 2HYGD 2L7KA 1KMNA 3OYNA 3QRFF 4F17A 5EEHA 4P71A 5KAIC 1F43A 2OV7A 4BAYA 5CAIA 5K5RA 1SVMA 2R7TA 3LSMA 5GAHJ 2QZ8A 3IQLA 3MZHA 3UA7A 3IWZA 3CCRQ 5LHHA 4YRTA 2AKWB 5LJ3g 3RSNA 5JHFA 1YJ9I 1Q82C 1N75A 1OCTC 3KETA 1OCZH 3H36A 3LH0A 1J5WA 1FT9A 3DV8A 3P9KA 2DXBA 4JJBA 4PGGA 2FL7A 2FJ1A 4QIWN 2LBFA 5F0HA 3I55A 4YDQA 4C92A 1MZBA 2ZXWH 1QQJA 3D5LA 1PSEA 1T0JA 1WKMA 4FASD 4CC2A 3KP4A 3J7AY 4CRIA 3CCMT 3HFOA 2R5MA 1Z67A 2DIQA 1GUUA 3ABLH 3SQNA 3CXCA 2L02A 5GMKm 5DUKA 5JLWA 1OR7C 1S1NA 1UJ0A 3EETA 3I55I 4RMFA 2BOLA 5CQEA 3K70D 1ZGAA 4G7ZF 3B6AA 3MKDA 1OU9A 2XICA 2CT3A 2XPVA 2LMJA 1I3AA 1QKWA 4U87A 3CCSQ 2R5YB 1WA7A 2R7FA 2QQRA 5LJ3f 1VQ7Q 3V42A 2HD0A 3CC7Q 1IN8A 3KX2A 2HOSA 4YCWA 2IGNA 4LLLA 1MGQA 4RB1A 1BOAA 2FBIA 1X19A 4XEMA 5GAMh 1OZ2A 4M75B 3NEUA 1SRLA 1IV6A 3E9GA 5GAN7 2BVMA 4OGEA 3CPFA 2LCSA 1ZX6A 4D8DA 5D5VB 2Z2SB 1UE9A 3PSIA 5HNFA 1BYMA 3NRVA 2JM8A 1W5CC 1OQKA 4J9EA 1TQPA 2IA2A 3RACA 2RI5A 1LYLA 2CMPA 1Z9ZA 2HPMA 2V1RA 3REUA 2HOEA 3ABKH 3VS2A 4RDUA 1VQMT 2V8JA 4L0YB 2M7BA 2X4JA 3KZYA 3FDRA 1SETA 2K40A 5GMKi 2JVHA 5LJ3j 3RQIA 3A5ZA 2CZ7B 3FMRA 1RL2A 3M4PA 3IAM2 2HVRA 1VQLQ 4F16A 1C0WA 2BYVE 2HKOA 2QF7A 3VYGA 1NM7A 5TISC 1NHAA 1OPKA 2A61A 2QA4Q 2ZSIB 3F72A 1JGGA 1H3HA 1QNTA 4IRGA 1K78A 2R7ZJ 4AIJA 4E7SA 1RACB 1G5VA 1OYWA 2VE8A 5I22A 2GAUA 5TRDA 2VOOA 3CMET 1MSFC 4QW2A 2F5DA 1ETVA 4M3FA 1T2KA 2NVYJ 3T5XA 2O4XB 2WTEA 4LUDA 5BOXA 1UTIA 3TMOA 4MMLA 3WTYC 4HPQA 3PTAA 2E2IJ 3E6BA 1JKOC 2HFHA 3ULQB 4HQEA 3HRMA 2OI3A 2E5ZA 1VQ5A 2ZINA 3PJRA 3HKZN 4BHCA 4J9BA 2KXDA 2E1MB 5DM7F 1I81A 1ZSGA 2ZJRF 2E1CA 1MNDA 1UMQA 5J40A 3OSVA 2VGMA 2WY8Q 4RS8A 4FT8A 2EFOA 4E70A 1JJ8C 3F0CA 2L9RA 1ACIA 2DMNA 4DPGA 2RC4A 1VQ5I 4QQGA 2OPTA 2ID6A 3HXYA 2QYOA 4P74C 1H641 4GYGA 2XPWA 3OB9A 2M8EA 1B07A 2EBPA 2DO3A 1PHTA 3TEHA 1W0UA 4FYYB 4KGXB 1WJDA 4EJOA 2J3LA 1PRMC 4J9IA 2AIRB 3CC2I 1R0BG 3G1ZA 2DL3A 3CQZJ 3PMTA 1BC7C 3IKTA 2EZKA 1I0CA 3CC4I 4NHJA 3TEEA 3RKQA 4YRRA 2XB0X 3VQXA 1WVRA 1PWTA 1TH7A 2FPEA 2YPRA 5FWCA 1LNWA 4Y7NJ 1FYMA 3PUFA 1P4XA 2EV0A 1U3OA 5LJ5j 3MF1A 1SHFA 2HVQA 3MFKA 3G1JA 2HEQA 1PP7U 4D5CA 4XTYA 2P6TA 3K1MA 4LD9K 2E34A 4IZZA 1ZR4A 3JRCA 3ZMTA 2EL9A 2AT1B 4BI3A 4JRQA 4CC4B 5FW9A 2DA6A 1M30A 1T8IA 4BUGA 2ELJA 1RZ4A 2B0LA 2F6CA 2KDSA 1YHQI 1FBSA 2PMFA 4N4IA 3QWXX 1TWAJ 3X28B 1UCRA 2HU9A 2DXUA 3KPHA 4RTTA 1TU0B 4KH1B 3AT1B 4F3QA 3S2HJ 3DU5A 2PU9B 2COMA 4TVWA 4M77G 3A0HC 1YRNA 4QPQA 4CYDA 1VZ0A 3CCET 2CP7A 1XCBA 3LSPA 1RKTA 4G85A 4M75F 2KZGA 3P8TA 2DOAA 1M1EB 1QO0D 4R56A 2BE7D 2CT4A 4XSZF 5E1WA 3A01B 3H0FA 4JX6A 1B70A 4AC0A 2EZIA 1YCSB 3W6VA 3IUOA 3VYRB 5EGOA 1YFHA 2GBQA 4JS4A 1RR8C 2R7OA 3JCMc 3DXJF 3FC3A 5IT9K 2CFOA 1CSKA 3SHFA 1CF7A 3TKYA 1E2XA 3IL2A 2DNUA 3IH3A 3HKZA 4OAZA 3MN2A 2O9SA 4HF2A 2K7LA 1ACMB 1I5LA 3GZ6A 3DEWA 2EAYA 1IGQA 2ED1A 3Q5FA 3UWNA 2EH3A 5DEQA 2PQ8A 1N77A 2DK3A 5LJ3e 3Q0VA 2I4LA 4QQDA 4XLFA 3PGGA 4JOMA 4C92G 2HVSA 1UGVA 1BC8C 1J3TA 3OYIA 3LQRA 1IUFA 2JM9A 2ZZFA 3DLMA 4C9YA 1EVKA 2GQQA 1XTAA 1D3BB 3A8GB 4L9VA 4QQ6A 3FHZA 2OU2A 1B1BA 3ZQLA 1K9MC 1IO2A 3TEGA 5M3FJ 1JHFA 1Z7NA 1GHCA 3DTIA 1SSFA 1P9QC 1LNXA 4AU7A 1GT0C 4E47A 4ITVA 1NJIC 2R7VA 5C4JJ 1M2OA 4ZGDB 3QZ5B 2R7SA 3ZXSA 1WI9A 1ZUYA 4O5VA 4H2XB 1EH6A 1WGXA 1OEBA 1Q7YR 2UXXA 4M3EA 2X6YA 4GLKA 1TS9A 3HL8A 3B6CA 2LY2A 4U88A 4UB8C 4C30A 4E51A 1VQKA 1AEYA 1UGQB 2FEZA 4X1EA 1ZGJA 4LVKA 4LD6A 1P6RA 1BU1A 4F7UB 3A1YA 2HDWA 1SANA 2DXTA 2G3RA 3CJQB 4CZZA 4YRMA 3W6JB 4AFUC 2XRLA 1WJQA 5CVVA 3WGGA 3HFZA 4HCKA 5LLQA 5BPDA 4HEA2 1TC3C 1SSHA 3RDVA 3R07A 1VQKI 3CO7C 2BY2A 4YRLA 4A2UA 3CBOA 3H9NA 1M3CA 1D1CA 2KIQA 5GJVB 4FW2A 3OYKA 2EJRA 1SERA 2F1LA 2H6BA 2IIMA 4HWSA 3F8FA 4A3EJ 2EIFA 4PFZA 3FMQA 1QBJA 4UVBA 4MEYF 3UNGC 3H0IA 3BTJA 5CQGA 5F1JA 2FD5A 1A0NB 2RHIA 2IPQX 4IUTA 1EF4A 4Z02A 2YUNA 3E5UA 3QBYA 5LJ5e 3CJTB 2P6SA 5GAGJ 3VJPA 3C2GA 3P8VA 1XDSA 1U5TA 2V6EA 1AWWA 3HRUA 5D6WA 4TWAA 3A74A 4ZZDA 2IS2A 1XX5A 1MBGA 1A5JA 1ON1A 2C06A 4A3GJ 4G6DA 2ZT6A 2RJCA 4N9IA 2A7YA 1YOVB 2XMFA 4C8QA 4DOVA 3S1MJ 4M7DA 2MLKA 4LNSA 4B3AA 1WSUA 3VDXA 3BPXA 4YRFA 1BCOA 4M4ZA 3QSUA 3VQYA 3JCMV 5DY9A 1ZG1A 1ZN2A 1A35A 2ZNYA 1N25A 2O4XA 4C5IA 1Q86U 4I6ZA 3SZPA 3VYSB 4P9FA 1UGSB 4RKUE 4OMQA 1T3LA 2DPPB 2J06A 1W66A 4A93J 3QPHA 3M0SA 4A4KA 1WZ2A 2DE0X 1K6OA 2W24A 2WAQA 3TL4X 2E10A 4HA8A 1MBJA 3CXCS 5FU7B 1TT5B 2EBIA 4M3BA 4AM3A 3LSRA 3IRQA 2DILA 2VBZA 5M5XJ 1J59A 3ABMH 4Z6YA 2KZVA 3NTKA 4EQQA 1UB4A 5CQYA 3QYEA 1SFEA 1JU5C 4KUIA 2DLLA 1T3SA 2CZ0B 2FEIA 2LC2A 3I5SA 1VQ6T 5HS7A 4XU1A 1FNNA 3LLRA 4AIHA 2QTXA 2C6YA 2HTSA 2HR3A 2DRMA 1R1UA 3JCMd 3F23A 4QPOA 2DMPA 2Z33A 1XOVA 5LEJA 1M9SA 2RQPA 2X1EA 2JUCA 1G51A 4C3HJ 4XTZA 2RQVA 4MFDA 3P9CA 1R71A 1PD1A 2FA5A 1X75C 2DYRH 1V55H 4B43A 3GFIA 3C2BA 2HWVA 5C44J 3RZOJ 4X5OA 5GMKl 3KEQA 2DDZA 3D7SB 1YJWT 2DTZA 2C0OA 4FL6A 2JVVA 1VOMA 3QYBA 2JTVA 5L3CA 5GAN4 1WJ5A 5HLGA 3RUXA 5M5YJ 5FO5A 2RVCA 4OB0B 2CP3A 4YRJA 2DQLA 5E8GA 3PVLA 1V76A 4ZN1A 3R0JA 2HQRA 5LGTA 1HKTA 2K27A 5KYWB 4WJ4A 1ATIA 3H1CA 4IEJA 3F9KA 3OWTA 3V7RA 2O31A 3HEFA 2M0MA 2O7OA 1WLPB 5J47A 3SDBA 4YRNA 2BEOA 1H4TA 2VJJA 4IJAA 4F7UF 1JQQA 1EVLA 4A4EA 3TP3A 1FYLA 3MMYB 4JPBW 3QU6A 4J8OA 2W00A 4HVWA 2UZKA 4ENNA 4NOYA 2R5AA 2LYCA 5K5OA 4WWCA 2E5QA 3E2UA 1D8KA 3BTCA 3CDHA 3QHSA 2J6KA 2OJED 3DEEA 1GBRA 1BIBA 3E7LA 3A01A 1IXDA 1YITA 2RNAA 1VF9A 1OOTA 4LITA 1SMYF 2VKHA 1I5ZA 2CH4W 3X2QH 2KAFA 3W2WA 1BM9A 2HAXA 3K70C 3FBIB 1TWHJ 3KEYA 1EX4A 1TLHB 1OU8A 3REOA 2E4HA 4IQJA 5CIUA 1PG5B 3TSZA 3JCMb 1YITI 3C94A 3PM1A 1IRZA 2RM4A 4G6TB 2XC7A 4X34A 3HTZA 3EFOB 3DKWA 4HNVA 2E12A 5DLOA 2OTJT 4UVCA 2HXOA 1BI3A 4QVZA 2KIMA 4M75C 3KP3A 4R0KA 4HWTA 4R55A 3C95A 1BR1A 4N4HA 1LQ1A 4XKVA 3WGHA 3C2HA 2VPRA 1EFWA 3ISPA 1HYOA 2N8GA 1Q81U 4ESFA 5HK3A 2RV8A 4A0ZA 2XG8D 4RTUA 1X1DA 5E1XA 3FJPA 2XAUA 2QSHX 4ZDPA 3ML6A 12ASA 3NQOA 1T0FC 2I5UA 4HT8A 1LEAA 3WTWC 2LK2A 2LQNA 2GXGA 3CD6T 3S14J 4GRIA 1OV3A 3J7ZI 1VQPQ 2A05A 3VU3C 2DTOA 2FRWA 3PFSA 2WSFE 2MC3A 2DVEA 4IHTA 4JJDA 4M75G 4LLGF 4HX8A 2H1KA 4BB7A 4F7UA 4EIKA 1TNSA 4NDLA 1K8AU 4B47A 3JCMh 2AQEA 3WTSC 4HZFA 2AXTC 2W57A 2LNHB 3U2RA 2RO0A 2CYZB 2LDMA 3P8BB 4ZTZB 1WWXA 2HNIA 1XCVA 2DA7A 1YW9A 4ANJA 1IDZA 4A4GA 4IOAF 4IX7A 3S17J 3CQTA 3CJRB 1YTYA 3LOCA 2FSWA 2P4TA 1YIJI 5GAN3 3HSRA 4B44A 2X85A 1WHGA 2V1NA 2VGNA 2DODA 2JZYA 1BCMA 2WV1A 4AMCA 3MCAB 4OMLA 4Y17A 1X55A 2B63J 1KU3A 3GO5A 1JJ6C 4XQFA 4ZZLA 2A6HF 1G5IA 3I4NJ 3TSWA 2E1MC 4PUSA 4P73A 2XROA 2RI3A 2LF8A 2NUPA 1ITYA 1I27A 5CKTA 4YRCA 3FJ5A 4A3IJ 2LKPA 3WTVC 4IIMA 4M9XA 1HC8A 4C8QG 4AIDA 2YRVA 4M7DG 2KSSA 1AOJA 4TVRA 3FM5A 4DNCA 2CUDA 4X6AJ 5KK1A 2DBKA 3IALA 4CH4A 3PNTA 1QHGA 4RGXA 3MEXA 5EYRA 1W4MA 3J80K 2XV4S 4F52A 3PIOF 1MIJA 5IH2A 2FHDA 2ZT7A 2HCKA 1QZEA 3G71T 1B8IA 4ZNXA 1V1CA 11ASA 4KFCA 2BHZA 4DZPA 5FLMJ 1JBMA 1UGRB 3H0DA 2EZLA 3TOAA 1YE9A 4XMYA 3TVTA 2R7RA 2A0FB 1EIFA 2M16A 5HNHA 3LSKA 4OB3B 1V54H 2D9TA 1QP3A 2O0YA 3U1DA 4PDKA 3S16J 1R6RA 1SKUB 3V7CA 2PBIA 3JCMQ 2XDVA 1QLYA 1Q95G 2ALYA 1NLPC 4RA2A 5FKNA 1ZK8A 2BE5F 1WHJA 2ACJA 2E1HA 4LD5A 4JRIA 3I64A 1FBQA 2SEMA 3CCRA 3TREA 4GO1A 1KQSP 4LB5A 2DT6A 4UB6C 4PLIA 1OFCX 2ZZGA 2DPDA 4XICA 1SVOA 1KQ0A 4LIVA 1YP5A 2PN6A 4YRKA 2JUFA 2DA2A 1GXIE 1VQ9T 6AT1B 5LHIA 2JQ7A 2QDYB 3OW2P 4A6DA 2CS7A 3M07A 1CQTA 2B9SA 1K73U 3MVPA 5DUIA 3SWNB 5E17F 3GEZA 2OD5A 1R36A 2RREA 3CCRI 4KISA 1VFCA 3EHRA 2VVKA 4DQ2A 3PNYA 4EO4A 3EGXB 1NE8A 1C6VX 1I4K1 3COAC 1MBFA 2CZ1B 5KYNA 3I55Q 3H0HA 2NLUA 3M5AA 1MSEC 2G0EA 1QVGP 4II2A 5KCHA 3HY0A 3CCSA 3ZBDA 2AHJB 2FBKA 4M78A 2K9MA 3CC7A 2ZNJA 2JWTA 3N05A 3VBBA 2RB6A 4OU0A 3TCJA 5KYYA 3RKXA 4I2OA 2WB1N 3CCSI 4U7DA 1IV8A 1VIEA 1KHCA 2ESWA 1BK2A 1YI2T 1VQ7I 1GL5A 1RLPC 3CC7I 4DA4A 3S3NA 3I9V2 1O75A 1C0AA 3L4GB 3L00A 3S6WA 2C7IA 5LJ3d 1JJCA 1TWCJ 1BA5A 1KK7A 2CU7A 2ZPHB 3LMMA 3QIIA 2MD0A 5DD8A 4PJJA 3T8TA 3I56T 1VQ4Q 4C0FA 4XOPA 1ZH5A 1V5FA 3QKJA 5CVUA 3QOPA 5DS9A 2YXYA 3E1SA 3CCEA 4IQ4A 3M4OJ 2DTHA 2M4KA 3F6OA 1VA7A 2CWEA 5J3LA 4PFOA 1M5Q1 2JMAA 4PJOD 2V1QA 3FLGA 1LFPA 2K4BA 3CCVT 1E17A 4U0VA 3ZQFA 5JHUA 1N8RU 5GAN5 3I71A 4RTZA 2EIKH 3DBRB 3OYEA 2MFZA 3RZDJ 3M0TA 2XHCA 2QA4A 3EG9B 1DU6A 2ZPFB 2XKOA 1KQSS 3CCEI 4IKFA 3MQ0A 4CS2A 2X6OA 2R7DA 1R4NB 9ATCB 1NYFA 5F5WA 2VBWA 1YFRA 1JT6A 3BJOA 1HQCA 4Q4ZF 1N5ZA 1UFFA 1H88C 2EGCA 1PDNC 1SFKA 5IHKA 3PQKA 2QA4I 2DFEA 4FW1A 1BIAA 3NELA 3TO9A 3E19A 1G3WA 1Z91A 2R4GA 3MF2A 3NPFA 2AS5F 3QAHA 1Z05A 3V8KA 1RUOA 3SDZA 5FU6B 3DU6A 3ZMUA 1A6QA 5DTDA 3EDPA 2EPDA 4AH6A 1DUXC 5TJJA 2C0IA 4EVIA 1ZG3A 1JJ2A 4N0BA 3U9GA 1JI8A 1Q82R 3LWFA 3ASOH 3QZ9B 3PNWC 5CKDA 1QF6A 2EINH 5E3NA 4O6JA 2J3MA 2R7XA 3HHGA 3UKGA 5FKOA 3DCFA 3JCMX 4ZGJB 3ERED 4CUGA 1TSFA 5GMKh 2E3HA 4EV0A 2FRYA 2FZGB 2XGDA 1USYA 4F7UG 4M6VA 1POGA 3IAS2 2FOKA 4PK4A 3MAJA 2MPXC 4J6XA 1F5TA 1VQ8Q 4LLNA 1RC9A 3QWYA 4R1HA 2EQMA 4RGSA 1Y96A 2XSDC 4XEOA 2EYQA 2NOJB 1S72Q 3ZN0A 2PNIA 3EUHA 2DA5A 5HLTA 7AT1B 2P5KA 1YWOA 2AHQA 4G9YA 4HSRA 2LY9A 4LG0B 1MW7A 1VIFA 1YLFA 1Q7YC 3I54A 3K0LA 3OYCA 3JCMW 5GP9A 2Y31A 1QQIA 4N0AC 4BJ6C 1ZSZC 1K83J 3KCCA 2CRGA 1KJWA 1F1ZA 4CA0A 1EFNA 4XLNF 4PL6A 1GV5A 1KMMA 1JKPC 2ZJPF 1IJWC 3H92A 1KQ8A 1IGUA 5LFAA 2MIOA 4OMOA 1T38A 2M45A 5B1AH 2BZ8A 1JE8A 5DCMA 1ZG5A 5LHGA 1MD0A 1R77A 2KK4A 2KJBA 5I11A 2FE3A 3X24B 4FYVB 4ZGEB 3VS4A 2DFIA 4P9UA 1H3ZA 3GFLA 4IURA 4WTOB 5LJ3h 3JRHA 2WV0A 5D4RA 4CGZA 1JUSA 1XGSA 5FU7C 2BW3B 2QQ9A 1IHWA 3R6OA 3A7AA 2A5YB 5KNLA 3F70A 3CMAT 4J15A 1WZOA 1UG0A 4YRPA 1JTYA 2HGCA 1BI2A 1PM3A 4YG2F 4YCVA 3FK6A 1D3YA 1S3JA 2QAZA 4GGGA 1H4VB 2KDZA 2DOEA 3F8CA 4NQWB 5CLSA 2L7MP 2M9UA 3EUAA 1AKHA 3HG9A 4BJ5C 4XR6A 5J8FA 5JLXA 4G6QA 1I6XA 1KGSA 3M0QA 3MKWB 3NWSA 3SFMA 4J83A 3ZMSA 1PRLC 4YELA 4KH0B 2ARTA 2K86A 3PZCA 4B9WA 3MP1A 4ZDLA 1OCPA 3GBQA 1ERDA 2EYYA 3S15J 3FXRA 1TUGB 3VQVA 2DQRA 4HVVA 5C3EJ 1XQHA 3LA3A 5I21A 3OY9A 1JXSA 2V26A 4I01A 1RUNA 2X9HA 4B1RA 3R6NA 1UHFA 4OMMA 1TXQA 3SZTA 2NS0A 3FXUA 4ZYEA 2F5TX 2QHVA 5ELNA 1R5GA 1R9TJ 3SEMA 1LCKA 1OJLA 8AT1B 4GYIA 3JRDA 3A31A 5KNNA 3ME9A 3EFRA 3MHXA 1RIOH 2KLOA 2IY5A 4H2WA 2X3XD 4CHUA 3OIPA 2ZNIA 1T33A 2K9GA 3QWLA 3BPVA 1I50J 2Q7HA 1IZ6A 1SD4A 3J81Z 2DMQA 4E6KG 2KI7A 2A08A 2CP6A 2YU9J 3GVAA 5F64A 5FROA 2HKXA 2EJ9A 2VC0A 4AIKA 4ZC3A 1G8XA 3I5RA 3LSJA 4KR3A 5IY5H 1MMDA 4HOBA 2ZT8A 3GP8A 1YX3A 5KE2A 4X9CA 3QO8A 2KY9A 2M5WA 2R92J 1LE8B 4OIQF 3SJMA 2KROA 3VEPA 4L9NA 4MDWA 3HJEA 2YWWA 2Y90A 2Z16A 1KFZA 3GTOJ 3V8LA 2DDAA 4FCYA 1RNLA 2AK5A 2DU5A 4MHGA 2D1XA 2YLCA 1QA6A 1YW7A 4IIOA 2JPBA 3MEAA 1O3QA 1AWXA 4OINF 2ATCB 3SYTA 3EYYA 4LDXA 1BOBA 4J9FA 3HBLA 3UH0A 4W1UA 3CPWA 2E3CA 3L09A 1TT0A 4M77E 3GTJJ 2MAMA 1KQ1A 3GIBA 5CKHA 1E0EA 2DA1A 5C6SA 4NB5A 1ULYA 3PFYA 4QVDA 4YRGA 1J7KA 2F69A 2M1HA 2KDOA 1XPXA 1X6BA 1Y1WJ 1OISA 4II3A 4HT4A 2IEKA 4LOCA 2ME6A 4OLFA 2H3EB 3UGTA 3HTSB 2VXEA 5IYCJ 5IXBA 3P8DA 1T98A 1G3TA 1FIPA 3A02A 2DD5A 2LNBA 4AG2C 3KZIC 3RERA 1XS9A 4YFNF 5L3EA 2PMZN 5KH6A 4DOZA 2HOTA 2DT5A 3THKA 2L0KA 3M4GA 4KQEA 3W3CA 3DTKA 1K76A 3NHNA 2RHZA 2QM3A 5LRSA 1OQYA 1R00A 2GLOA 1YJNT 2DX1A 1PKTA 2DQ3A 3JB9H 3OYHA 4M77D 2GGRA 1WJEA 1GXPA 3O5ZA 2HQXA 2EQRA 2Y69H 1Y8QB 2LKXA 2QGGA 1FOWA 3H9JA 4WF2A 4C92E 4YRSA 1FOXA 4CCNA 4F04B 2E36A 5IOYA 1VNDA 1K0SA 1IUYA 4NC6A 4NS5A 3TU4K 2Q5IA 5IHIA 3PCOA 1UDLA 3MKZA 5HDKA 2EKOA 1XMXA 1Z7UA 1P4AA 1M27C 5HK0A 2HMAA 2GCXA 1M1GA 3JTHA 2ZXIA 2V8IA 3V4GA 1VQOT 4VUBA 3LAJA 4RG8A 1RAGB 3EFSA 5DYMA 1D1BA 3K6GA 1HCRA 5EG0A 4UXNA 3BCBA 3QO7A 3PVQA 3KUFA 3GTPJ 1MV3A 1SD6A