3V8JA

Crystal structure of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
306
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 98
structure length 306
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8jA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8jA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8jA02
5D5WB 4C92B 5K5QA 3D5LA 3IKLA 1K78A 1MJBA 1WI9A 4JLIA 1BC8C 5KNNA 4KN7X 1XCBA 2ESNA 2BYVE 1GXPA 5GMKe 3C18A 2P6SA 1QPMA 2K86A 2E3CA 3HOTA 5LJ3h 2YPRA 4M77G 2XKOA 4F7UE 4ZTZB 2K02A 2RHSB 2PBIA 4GO1A 2OZUA 1SETA 2PG4A 1XGMA 2ZT6A 4C92C 1JXSA 3HSBA 1T2KA 1O57A 4H2WA 1GXQA 4PGHA 2LNBA 4YRGA 5AIQA 4YRIA 3CTAA 1BBUA 4O5VA 4AD9A 4YIFA 4UVBA 1TNSA 4WWCA 5FB2A 5IT9K 1ZG5A 1ZHFA 1XGNA 4E70A 5L3EA 5HVQC 1TW3A 2DTIA 3KP6A 3FWEA 1XGOA 2JZYA 4M77B 4M75B 2HFHA 1UCRA 3R4KA 4QWQA 4M78A 2Z5UA 3SXYA 4F7ZA 4DNCA 2IA2A 2EJ9A 3VOEA 1H4SA 1B9NA 4YCVA 2OQGA 5DYMA 2P5KA 2UWMA 4M7DE 3JCMd 3KLNA 4HWRA 3TEHB 2P7CB 1JE8A 3RTRA 4WF2A 3L2CA 4YPFA 1YFTA 4GYGA 4MMLA 2D2WA 5ICCA 4PJOD 5D8KB 5LJ5g 4XEOA 3A5ZA 4JRIA 5I21A 2YLBA 2YU3A 2Y0MA 5L3CA 4HWOA 1OPCA 4M77C 4M75C 2HKXA 2W25A 4ENNA 5LRSA 4HX7A 4J15A 3F6VA 3BDUA 5DV5A 2VC1A 1WLEA 2Q5HA 3S2WA 3P7NA 1FP1D 2GA2A 4KICA 3COAC 5DY9A 2P8TA 1SMYF 3KLOA 3DPTA 5GAMj 3F21A 2OD5A 4IRHA 3LSTA 1KMNA 3MFKA 4A0ZA 4OOIA 2HOEA 2Z33A 11ASA 2L4AA 1LNXA 3H3ZA 4I01A 3WQZA 3R07A 4YREA 3A32A 3DPLC 1XCVA 2HGCA 3JB9I 2QHUA 1MDMB 1ASZA 2DPUA 2PMHA 3GWZA 3OOPA 1SD6A 2A68F 2FE3A 1SD5A 4M9ZA 3JSOA 2DKGA 3GZ5A 2AXLA 4Q47A 2FBIA 1JBMA 3JCMc 3HXYA 5JHUA 4H2XB 5L3FA 1FYMA 5D6EA 1B76A 4F7UA 2JT1A 1NHAA 4LFUA 5LJ5h 1NYRA 1X55A 2PMEA 4A6DA 4HVCA 2EFNA 2ALYA 4P3PA 2HQNA 4ESBA 1YYVA 2MLKA 3JW4A 3LSQA 2KIMA 1FZPB 3HRTA 1FNNA 3WGHA 4P72C 4GCVA 4LNSA 3H3UA 2MH9A 2RA2A 3ELKA 3H92A 1FSEA 2KIFA 2ZT5A 1YS6A 2V1XA 2QVOA 3LSSA 3ROUA 3HUGA 2UZKA 3RF1A 4Z2YA 2HS5A 4TQFA 5GAN2 2HKOA 3QAHA 1LJOA 4FT8A 1B4AA 3IC7A 1F4KA 3RESA 2QQ9A 1PYSB 5D4RA 4G7ZF 4KN4X 1B70B 3GFLA 1BI2A 3JB9G 5CVJA 5E1WA 4NL3A 1WRJA 1FPQA 4EMSA 2TDXA 3TQNA 5FO5A 5LGNA 1ZYRF 4M7DA 4QLCU 2F5DA 1RIQA 4KIGA 2DO7A 1HKQA 4MQ9F 1TLHB 2V9VA 1FYKA 5BPDA 1W7PD 2W57A 3PQJA 3RIRA 2RD1A 1E22A 3ULQB 2FBKA 2H94A 4I7HA 2E1HA 2MLGA 3ZMDA 3RYPA 4P3OA 2NS0A 1BBWA 3ISPA 1BI0A 4HF1A 3KP4A 1XMKA 5K1PA 4X9DA 4IHTA 3HXVA 5JI6A 2ARUA 1P92A 3ML6A 3LAJA 1KU3A 4YRQA 2VE8A 1YW9A 1ON2A 1HK9A 3FB9A 3JCMe 4KYWA 4C92E 3F8BA 4ZYHA 4IHSA 3QOPA 3A31A 1ULYA 1R36A 4ZZLA 2K4JA 1EOVA 4ESFA 3NEMA 2H09A 2JSCA 4NQWA 5GAOl 5K1YA 4NCXA 5LHHA 4RQFA 5LJ3j 4UP8A 1U78A 3IKVA 4PGGA 2C6YA 3EYIA 2GZWA 4XSXF 3WGIA 1Y96B 4K88A 3M4GA 3PQKA 4OU0A 3HTUA 2QHSA 4HT9A 3K0LA 4CXFA 3IKMB 3VQXA 3HXXA 2X4HA 3RKXA 2NRAC 1P2FA 4YIIA 3RJPA 2K4BA 2A07F 1YCYA 4IRIA 3HRMA 5KK1A 5CYVA 3HHHA 2QHVA 3I59A 3BWGA 4M7AG 4M7AF 2DK8A 1F5TA 3G1ZA 4EMHA 5FFZA 2L3DA 2H6BA 2M1BA 1SFEA 2AKWA 1E2XA 1UHMA 1F1ZA 4M77E 4TV7A 4OMYA 3BJ6A 5BQTA 2KJBA 3GFIA 5HS9A 2DQ0A 2I2LA 2OQRA 1WPYA 2WWYA 4EQQA 1TQMA 1B9MA 4EMKB 1ZLKA 4R79A 4O2DA 4L87A 1S8NA 2ISZA 3VB2A 3KZZA 2HYFA 1QGPA 1XMAA 1P4WA 1J9IA 3L4GB 3CDHA 4YRRA 2VC8A 2G7HA 2IY5A 4L5IA 4DPGA 3O3KA 5LHGA 4HA8A 2DXTA 4Q4ZF 1IN8A 5LGTA 2FYKA 4EMKC 1KGSA 2O03A 2GIVA 4ZYEA 1YGBA 1B6AA 1OYIA 1N9WA 1R5HA 1X56A 4QVCA 1J5WA 1ADYA 4ENKA 4A53A 2VBXA 4BQAA 4M71A 1H9GA 1MJAA 4C8QG 4CH6A 3E9IA 3QP5A 3VU3C 4K87A 4C92A 2QQBA 1QE0A 2IP2A 3F22A 1WWXA 3MEYA 4L9JA 2E7XA 1QZZA 5EEHA 1XD7A 1ZRCA 5GAN4 3ICAA 3V7SA 4HWSA 1O3SA 1FYLA 5H6QA 4JBAA 3HFVA 2G9WA 5GAMh 2M30A 1U5TB 1DPUA 5LJ5j 4G8XA 2RHSA 2ZTGA 1D3YA 2YLCA 3CUQB 4YRNA 5DD4A 4OIPF 3NEUA 4M74A 2XGTA 4MEXF 3I0TA 1Z7UA 3LAPA 4YRJA 1HKTA 3FZVA 1LEAA 1QO0D 3I64A 4JK1X 1SAXA 2FSWA 2FMYA 3E97A 1UB9A 4I0AA 3R0JA 2CJAA 4GXOA 4LD5A 3WTUC 5LHIA 1WQWA 1QZYA 3J80Z 3N97A 2ARTA 4CS2A 2EWNA 3A5YA 4FHTA 1U5TC 4AIKA 5GANg 3EFRA 2ZIOA 2KJCA 4M77A 4M75A 3CUQC 3KCCA 1S7OA 1LDDA 1HSTA 1DDNA 5F6FA 2KKOA 5KVRA 1Z7NA 1EVLA 3A7RA 3K1PA 4HQMA 4NB5A 4BAYA 3TEHA 1E1TA 3GFMA 4M7DD 2I4NA 5JVTA 2O6GE 4XU3A 3TDZC 2XROA 3REOA 2QBYB 3KP3A 2DT5A 4UP7A 3T1BA 3O6BB 3L7WA 4RGUA 2CW0F 4EM0B 5L3BA 5HS8A 1ON1A 2XKPA 2FA5A 12ASA 1I1SA 3MZHA 3U1DA 3HSFA 2DEQA 1WQ7A 2QZ8A 1EFWA 3L09A 3W6KB 2GWRA 4XTYA 3EQLF 4PJOG 1ONVA 1O7FA 3ECOA 4I0BA 4UNOA 3F8FA 4IXAA 5GMKl 3SQNA 4HW0A 1IZ1A 3DEUA 4CDGA 1NJ5A 1O7LA 1Z6RA 2XHKA 2IJLA 4P75C 2MD5A 3TO6A 2VOPA 1G3TA 4ZH4F 1YIOA 2HTSA 1MDMA 3CO6C 4A5MA 3IL2A 5GANh 2Y48A 2EJGA 2CJ9A 4P72A 3JCMJ 1W4MA 4EJTA 1BJAA 2RGVA 2VE9A 4AH6A 4IVNA 2ZNYA 3IWZA 2DQ3A 3RI4A 1YW7A 4KIFA 5E3IA 3M4QA 2XTIA 2FF4A 4H2XA 2DJZA 3JCMg 2ZCWA 4TTVA 4PJOB 4FX4A 3IHUA 1R1TA 1IXRC 3G3ZA 4UVAA 4RB2C 3QTCA 2DTOA 5E18F 1TW2A 3K2ZA 1R58A 2NAZA 2K57A 2M45A 4LK1F 1P4XA 5HDKA 5AIPA 1B34B 2EJFA 1QQIA 2ZO4A 1R1VA 3NRVA 3F72A 4AVPA 1WU7A 3MAJA 1D5VA 1WKMA 1ZRDA 4QVDA 3BW1A 1WNLA 2D1HA 3BPVA 1B1BA 3M7GA 1J0RA 4LLNA 2VXFA 1P4AA 4U0WA 2D1VA 4PJOC 3GIBA 1PYSA 3UFGA 4UV9A 5FLXZ 3KP7A 2DU7A 5LJ3d 2DBBA 1B70A 4LMYA 4EM2A 4WK8F 2QQAA 4M75F 1EQRA 3HFNA 1RUOA 1XDSA 2P7VB 2EV6A 3JCMf 4OLFA 1G5IA 4KNYA 4YRPA 4YYEA 4HWTA 2W84A 2EL9A 3WTWC 3JAMZ 1UFMA 5DCMB 3OD1A 3FJPA 3TKYA 1N9RA 3A7UA 2M87A 1U2WA 3U2RA 2HDCA 4TVAB 4HF0A 2DDZA 3K69A 2M5WA 4HDUA 4R1HA 1IXSB 1R5GA 3FIFA 4EMGA 3L00A 2QM3A 3E3VA 4YRLA 2PEXA 4Y13A 3IALA 3QO7A 5GMKj 1EIYB 1NNHA 2VBYA 4YRMA 4Y15A 4HWPA 4Q48A 4EVIA 4HBLA 5ERIA 5L3DA 1CGPA 1EH8A 2P4WA 4BYYA 1MZBA 2LF8A 4KIBA 4LG0B 1YFHA 3QP6A 2I4LA 4KFCA 2RV8A 1K7AA 4RDXA 1OR7A 1WYDA 3BOQA 5D5XB 4ZIBA 4CH4A 4Y91A 2BBYA 4PDKA 3E5QA 3I53A 1CF7B 3DF8A 4HF2A 2OAZA 2Z99A 3EDPA 1X3UA 5J6XA 3HSRA 3BJUA 3HY1A 1Y96A 1ZLJA 2RB6A 5D5VB 1FOKA 3VODA 4RGSA 4RGRA 4I02A 2EJRA 3HSEA 5GAN6 2ZKZA 5JR3A 1I27A 2CWEA 4D0PA 3FM5A 2LDUA 2G4CA 2Q7GA 3FX3A 4G7HF 3WTYC 3ZN0A 3FXUA 2XIGA 2Y90A 1HBXG 2VXEA 3MF2A 5DEQA 2L01A 5LBQA 1YLFA 2HTJA 4ETSA 3KFWX 3B02A 2RHQB 4LJZF 1ZRFA 3GFJA 1X01A 4M75D 3CUOA 2J3LA 5GAOn 5ELNA 2DAOA 2I4MA 1SESA 1U3EM 3MCZA 2R7DA 2EFOA 1U1SA 5LJ5d 1BC7C 4EMKA 4KR2A 2CSOA 1K6OA 2DI3A 4MEYF 2PFBA 3BROA 4P73C 5C52B 3HRUA 2DFIA 3WTVC 4XU2A 1G5HA 3M8FA 1Z9CA 3UGTA 2FNPA 2Z3YA 2VBWA 4J6WA 3KP2A 4M6YA 2RM4A 1U8RA 3L4GA 1GHCA 4YRTA 1BBYA 1G6NA 2DU9A 1SFUA 3U9GA 3ZMTA 5HDNA 4M78F 1LVAA 1FBSA 4KDPA 1JHFA 1HKSA 5IT9Z 1OKRA 4I09A 3ZMZA 2HNIA 5LJ3e 2PMUA 3SWNB 4S05A 4J5YA 3FHZA 5ILVA 3M8EA 1QF6A 4L0ZB 4YDQA 1FT9A 5GANj 4WXHA 5D5UB 2EFPA 2MBFA 5BMZA 3GUDA 5GMKm 3O2PE 4H2UA 1VTNC 1I6XA 4L5JA 5A2QK 3VBBA 1HXDA 2E7WA 4XEMA 2YX4A 3HHGA 4P5OA 2Q8KA 4YFKF 1TQPA 1H4QA 4WJ3M 5D8LB 3F23A 3SWNC 3SB2A 4PNOA 2L02A 1YTYA 1U5TA 3DV8A 4PJOE 3ERED 4XRFA 3HTSB 1D3BB 3C7JA 1EH7A 3CUQA 4ZZDA 2ZCEA 2OBPA 1I4K1 4L18B 1EH6A 4P55A 3T5XA 3P8YA 3P9IA 1FWZA 3FXQA 4ASNA 5CVRA 4O3MA 4YRSA 2V1DA 3G73A 1SRYA 5ICGA 4HQEA 2A3SA 3I4PA 4A0YA 2O3FA 4HLYA 2M8EA 4F7UF 3JCMP 2FEZA 1I8FA 2YSRA 4YG2F 1DPRA 1KU7A 2ZINA 3ECHA 1H641 2E10A 3J80K 2STWA 1H9TA 1G3WA 1DUXC 2QYOA 4CGZA 2O0YA 1WSUA 4P9UA 4M72A 1ZAOA 4ZTUB 3QO3A 4N0AC 3R6SA 3LQRA 1I5LA 1JRIA 2A6HF 4X5OA 2QBYA 5C53B 3QNEA 4M78D 4TVYA 4G9YA 4LLGF 2XRNA 2WC2A 3R60A 4LK0F 4OIQF 4P75A 5FD5A 4LB5A 3BY7A 2FNAA 2WV0A 3IKTA 4M7AB 3FXRA 2IA1A 4UV8A 4M7DG 4M7DF 5ICEA 5GAN8 1JGSA 2ZR2A 1YG2A 3ERRA 3J7AO 5LGUA 5LJ5e 1BI1A 1KQ2A 1FBUA 1R22A 3V8KA 1U1TA 4G94A 4HT8A 2A61A 3IWFA 2R3SA 4CH3A 3EETA 4B09A 1RZ4A 5CVUA 4K86A 3F3XA 2HQRA 5F64A 4GGGA 1YB3A 4GYIA 4OINF 4XU0A 5GAN7 4P3NA 4ZYGA 3P9CA 1KYZA 4XSZF 2P5VA 4M7AC 2CIMA 1ZG1A 4P74C 4RMFA 2ZZFA 2EFQA 5CLSA 4P96A 1XSDA 3QHSA 2ZXFA 5GMKh 1MD0A 2KRFA 4P9FA 1E1OA 1FSHA 2ELHA 2JPCA 2E64A 4L9VA 1BI3A 4PJOA 1BM9A 1IAWA 3GEZA 1G4DA 4NL2A 3J81K 1IN7A 4U0YA 2EK5A 1KA8A 2VC0A 3LQQA 3ZMUA 2FRHA 5GAMf 3ZN1A 1YQAA 1B34A 2E1CA 5GAOp 3KP5A 3QU6A 3GW2A 2XASA 3TO9A 3TDUC 3I71A 4BXUA 1KMMA 4WJ4A 2IPQX 3BZ6A 1J5YA 2QLZA 3N4MA 5E17F 1KQ8A 3NQOA 1B59A 1M8VA 2ZIMA 3TOBA 4C8QB 4CHUA 1T0FA 2Y75A 5GAMd 4A12A 2QUFA 4PG3A 1L0OC 4YRFA 1V4RA 1HSJA 3GF2A 4UPAA 2XV4S 3T0YA 4MTDA 4EGYA 4YRKA 2ZNIA 1S6LA 5HGQA 1GVJA 1H4TA 3SZTA 2DTHA 4AIJA 4U7DA 1GGMA 2O8XA 5DCMA 4A0XA 5ED4A 2Q2EA 4ENMA 4HV6A 4C8QC 1SFXA 1ZGJA 1FC3A 4XTUA 3RPQA 4RAYA 4CO8A 1USTA 1H4VB 4TVAA 2BV6A 1KQ9A 5D4SA 4UP9A 1V3FA 4L9NA 4N9IA 3ABUA 4J6XA 3RKWA 3GX4X 2E65A 3KEQA 2B0LA 2VBZA 2ZMEB 1C0AA 5BOXA 1I81A 1TBXA 1EIYA 5E20A 3OV8A 1JJCB 3E6BA 4WXDA 4EJUA 2F5FA 3EUHA 4K2EA 4FX0A 5GMKi 2CO5A 1NJ1A 4U7BA 4NHJA 5BPIA 5DDGA 3INZA 2V1UA 1TQIA 2DW4A 4MQVA 1HC7A 1YW8A 2YX7A 3MF1A 3PGGA 4LG0A 1ZG3A 4EV0A 3R0AA 1D8KA 1XSVA 4RQEA 4XLNF 4HZFA 4H2SA 3RKYA 2XGXA 5DCFA 3LA3A 2K27A 1CF7A 3MZYA 3BPXA 4U88A 1ODDA 2QHTA 4XTWA 4CS4A 1IF1A 3FF5A 5K1XA 2GAUA 4H2VA 5LLQA 4RCCA 1ATIA 3WE3A 3WTSC 2CGPA 3VQYA 4C92F 2RVCA 1R7JA 1USYC 2Q7HA 5H6RA 2DPDA 1I5ZA 4HLXA 5J8CA 4P71C 4P73A 1T39A 1T6SA 2MC3A 1JHHA 1YFSA 3T8TA 1BIBA 2ETHA 1WQ2A 5GANd 3WGGA 4BWAA 2JRTA 2EA2A 3FM3A 2X0LA 4YFNF 4G84A 2ZGWA 1X2GA 2RHQA 3QRFF 3HXUA 3HOSA 1F9NA 3RACA 4BNCA 2GA1A 2QWWA 1X54A 2UXXA 3FMSA 5LJ3f 4Q6GA 3JTGA 2P5LC 2XAJA 4L0YB 1Z1DA 3QSUA 4V2SA 4H02A 2Q7EA 1W66A 1AOYA 5FGMA 1B7YB 4EX5A 1O3TA 2RNJA 2E41A 2W85A 4LLLA 2Q5IA 2EV5A 3PFIA 3VEPA 3BDDA 1IN5A 1L3LA 3SHFA 4OP0A 2A5YB 4AWXB 4CH5A 3RDIA 4A5NA 1FP2A 3ZPLA 3QO8A 5K5RA 4J6YA 4M75G 2DQLA 4M77F 2STTA 1NJ2A 2LKPA 5HS7A 2ACJA 3PCOB 1RNLA 5LEJA 4M7AE 1KOGA 3FMQA 4YRCA 4KA4A 2NYXA 4UHTA 2GXGA 4EGZA 1S3JA 5GAMe 2FMLA 4XQ3A 1T38A 4EJWA 2ODRD 2E1NA 2I4OA 2UXNA 2CFXA 3SWNA 2RKHA 1I1GA 2NNYA 1MGQA 5EEGA 4WCGA 2QTXA 4OIOF 3RGLA 2F5EA 3HRSA 2OU2A 2IT0A 2FOKA 2O61A 3HYIA 4U0VA 2ARSA 1W5SA 1PP8F 1HQCA 2RC4A 4G85A 3JCMh 1FX7A 3HXZA 2EV0A 2L4MA 2ZT8A 2PN6A 2FXAA 4KQEA 3ZMVA 1BIAA 4M6XA 4YCWA 1U6GA 3HFZB 2ZNJA 1TTYA 2DZCA 3GYHX 3WODF 4BHCA 3K1MA 1KYWA 1SERA 2DVEA 2ZZGA 4C92D 1DP7P 3L1AA 3E6DA 1D3BA 1Y0UA 2FQ3A 4Q5SF 4KMUX 1IW7F 1P6RA 1ZGAA 3MWMA 1LB2A 4CYDA 2VT2A 3I5UA 3REUA 3MQ0A 2V6CA 1BOAA 5DUKA 1ZARA 1REPC 3HIFA 1S7AA 2YR2A 1SD7A 6PAXA 1J59A 1KQ1A 5F1RA 4N0AA 1QNTA 3DKWA 2AMCB 2PMFA 2DK5A 4EO4A 4C8QE 2G7UA 2Z9OA 3GLXA 4BH9A 4X9CA 3EYYA 2VODA 1EV7A 1W7PB 2BEOA 5GAN5 4WX9A 1LJ9A 2QENA 4TWAA 1Z05A 2R7FA 1XB4A 2DQRA 3P8TA 2HR3A 4EJVA 3IRQA 4G6QA 2EAYA 1B8AA 4I98B 3I7FA 2RDPA 3L2ZA 3D0SA 4HX4A 4R8HA 1VQZA 2JTVA 3WTTC 5LJ5f 4I2OA 2ZFWA 3DP7A 2IRFG 3LC0A 2J5PA 1EVKA 4M77D 4BW9A 3IG2A 4XU1A 3QPHA 4M73A 5HLHA 1LEBA 2PLYA 2P0LA 4UUVA 4ENJA 3IRRA 5GAOq 5GANe 3ZMSA 3ZQ7A 3HFOA 1R23A 1ZREA 1K78B 2MH2A 2A6EF 5ICFA 4M7AA 4KUMA 4JUVA 4P74A 3LA2A 4CZZA 4B8XA 3NETA 2EFWA 3CO7C 3F6OA 1UHWA 1FLIA 4YCUA 4M78G 4MNUA 1RIOH 2KIUA 3HRIA 2A69F 3I54A 1TH7A 4OMZA 5TRDA 4KT5C 2XAGA 4A54A 4RS8A 3CLOA 5ILUA 2LF7A 2VN2A 2VONA 3JB9F 5C51B 4RB1A 5TJJA 1Q1HA 5HOOA 4IJAA 1L0WA 3E5XA 4MMKA 3V7RA 3WU0A 3WU1B 3JB9J 1LQ1A 4G7OF 5F5WA 4UXNA 1R1UA 4PCQA 5E8GA 3GXOA 1IRFA 4HV5A 4M78B 2DXUA 3QUIA 3E6CC 1G3SA 2MA3A 1NJ6A 5E8IA 1IRGA 3RERA 3UGQA 3GO5A 1C0WA 4WI1A 4IF4A 1ADJA 4A2UA 1PP7U 2BE5F 2PJPA 3QU3A 3A74A 2IVMA 5JFRA 3WG9A 2XAQA 2H6CA 1J7KA 3WTZA 3W3SA 2FBHA 5DD8A 3WTXC 4C8QA 3REXA 3RYRA 5LEKA 1FY7A 1HTTA 2CG4A 1R00A 4RGXA 3C3WA 4M78C 1PDNC 1J75A 2RN7A 1RUNA 1D8JA 2DTRA 5HLGA 3AHUA 3RPUA 3V8LA 1AWCA 2RQPA 1OYWA 1OMIA 5BS6A 3E5UA 1G51A 3V7CA 3BP8A 1J2XA 3TOAA 4F7UG 3P9KA 3TO7A 2VT3A 3TGNA 2HEOA 2HYGD 3M1EA 1NJ8A 4A6EA 4XTZA 3JCMW 2CQKA 1LYLA 1ZH5A 1SMTA 3A7AA 4HX8A 4OIRF 4M9SA 3HTZA 3EFSA 5ELOA 3E9HA 4KR3A 3BJOA 3JB9H 4XTVA 2ZMEA 2XUBA 3V8JA 3HRKA 2ESHA 1LDKB 2P5IA 4HDVA 1JJCA 3Q9VA 4MGRA 1FBQA 1OYYA 3JCMb 4XLPF 4H0EA 1E24A 4G6DA 5E1XA 5CVIA 4XBFA 5FFXA 3KETA 1IN6A 4F7UB 1SD4A 4M75E 3CJNA 4AIHA 1M5Q1 3JB9D 1USYA 2JN0A 2W24A 2ALYB 1IUYA 2PQ8A 1W5TA 1LDJA 4P71A 3BY6A 5D6FA 2H27A 4H2YA 3GZ6A 3SFZA 5GAMg 3ZP5A 2JPBA 1T98A 1HW5A 3NENA 5J8FA 2EB7A 1XN7A 5FD6A 2ZT7A 4RB0A 4PHCA 2IA0A 2ADUA 2F2EA 4TVWA 2CYYA 5HLIA 3JSPA 2NNNA 4BHPA 3R61A 4PZJA 1XDUA 4IPAA 1ZN2A 5K5OA 1USSA 3FMRA 1KU2A 3F8NA 1K79A 2COMA 4WXCA 1IN4A 5ILSA 3BJAA 1YS7A 4M7DB 2V79A 3V4GA 3VQWA 1KQ0A 2ISYA 2E5AA 3HY0A 2D45A 5L3GA 4Q15A 3KZYA 2FB7A 5A2QZ 4N0BA 2J5OA 4RAZA 3NELA 3UH0A 3P8VA 4CICA 4C8QF 1A04A 3M4PA 4ZYDA 1MGTA 3CMQA 4EJOA 4LGWA 1XSXA 1HW2A 3RL6A 5GAOr 2J3MA 2GXBA 1B7YA 1Z7MA 4HYEA 1IXCA 4YROA 5CVVA 2DLLA 2ZJ2A 2AS5F 4L9TA 4M7DC 4ESJA 4HOBA 3BFMA 3C1DA 4YP0A 4KMFA 1PUEE 4RB3C 1O3RA 1TNTA 3T8RA 4O6JA 1MJ9A 1S29A 1HW1A 2F5CA 2OA4A 4N9HA 4BHBA 3Q9SA 3E6MA 2ZZEA 5AONA 5E1ZB 3PCOA 4Y17A 4RCBA 1NYQA 2K7LA 4M7AD 1QBJA 5FLXK 3M9AA 3ABTA 2DZ9A 5LRRA 2GQQA 2DU5A 4S04A 1IL2A 3I58A 2HZTA 2ZXJA 2Q0OA 2YHTA 4JQFA 3W6JB 4NOYA 3DXJF 3TUPA 2ZNZA 1KU9A 1FYFA 3F8MA 1X2HA 4EM1A 5CJ9A 3JAMK 2CGHA 1LNWA 3LFKA 1Z91A 3Q5FA 3PZCA 1H0MA 2OZ6A 3KE2A 2EA4A 3I59B 3HFZA 3L9FA 3MEXA 2XAHA 4YFXF 3AAFA 2VXZA 2VOOA 2CJBA 4M9XA 4HAMA 4E51A 4UVCA 2AKWB 4M78E 3JTHA 5CAIA 3DQVC 3K9TA 3TEGA 3WE2A 4XTXA 4MTEA 3JCMX 5GAN3 3F8CA 2XAFA 1N9SA 3B73A 5LJ3g 4LB6B 3SZPA 1STZA 4IRGA 1Z6TA 3KEOA 2AMCA 1ASYA 3VFZA 2WTEA 3VQVA 4CS3A 5GANf 1BN5A 2IW5A 4C8QD 4JRKA 3QPTA 1LOJA 4C92G 1W7PA 1MKMA 4H2TA 5DUIA 3DSQA 4PJOF 3K1NA 1G3YA 2P6TA 2XVCA 2IY5B 5IT3A 3KFUA 3QO5A 4ON0A 3RUXA 1RI7A 3JCMQ 2PI0A 3LA7A 1XGSA 3LWFA 3JCMV 1YFRA 3HXWA 2HWVA 2C8MA 5HDGA 3DFGA 1O3QA 3GVAA 4DQ2A 2BGCA 3J81Z 1E17A 2C7IA 2LSOA 2L54A 1YO5C 5GAOm 2ZR3A 2FU4A 4TQDA 2ODRC 2ZBKA 4MHGA 5H20A
chains in the Genus database with same CATH superfamily
5D5WB 3OYNA 1VQ5A 1B72B 2JQ7A 3D5LA 3IKLA 3CMAA 1MJBA 1OZ3A 5KNNA 4KN7X 2E60A 2ESNA 2BYVE 5FU7C 5GMKe 2WY8Q 3C18A 1YWOA 2VB6A 2F2XA 2HEQA 1R0CB 4HRIA 2LT1A 2MW8A 5J4YA 5LJ3h 4M77G 2XKOA 4ZTZB 4M6VA 2LP0A 3OMCA 2PG4A 2ED1A 1LPLA 2YWWA 3HSBA 1T2KA 1O57A 2IBDA 1AT1B 4PGHA 2LNBA 2K9LA 2X4XA 3BTIA 4RM2A 3QWLA 3CMMA 2O31A 4UVBA 2LT4A 1ZHFA 4E70A 5HVQC 1TW3A 3EH1A 3FWEA 3CC7A 2JZYA 4M77B 1UCRA 3HXLA 4QWQA 2YU9J 4M78A 2COZA 4KT0E 3KEYA 3SEQA 2CZ6B 1OV3A 4HWRA 3TEHB 1Q81U 5HK0A 1Q82C 4GYGA 4MMLA 1YFTA 2D2WA 2LX9A 3G1JA 4BUGA 5D6WA 4QQDA 3A5ZA 5KE3A 4JZ4A 1PCXA 2Y0MA 3ABLH 5L3CA 1JT6A 4M3EA 3EGXB 2XU8A 4ATOA 2EYZA 1CKBA 4IOAF 4J15A 3BDUA 5A0DA 2L0KA 3D5RC 2QDLA 4QQ6A 2P8TA 4E47A 2LQWA 5GAMj 3F21A 2E5NA 2DIGA 4CCKA 3TSZA 2QQ8A 3MQZA 1JGGA 4A0ZA 2L4AA 4MIMA 5C0MA 3WQZA 3RBBB 5M5XJ 2HZDA 3DPLC 2QHUA 3BTLA 2CH4A 1X1BA 3GWZA 1J09A 1IRXA 3OOPA 2FE3A 2F5VA 1SD5A 1IUFA 3G71A 2AXLA 1JBMA 1NK3P 3OW2P 1FYMA 5D6EA 3SDGA 4A3DJ 1NHAA 3OS0A 5LJ5h 4J9GA 4A6DA 4HVCA 2ALYA 4ESBA 1YYVA 1KJWA 3LSQA 1FZPB 1KC8R 1FNNA 3LWIA 3RDVA 1ZX6A 1W36C 3H92A 3PJRA 1FSEA 3CQTA 3HUGA 1PWTA 3WU2C 4C2MJ 1G2HA 1QPIA 2UV1A 1B4AA 3IC7A 1WJCA 1B70B 3OOUA 1BI2A 1I39A 3PO2J 2HBPA 1WRJA 1FPQA 1T08B 2HXIA 5FO5A 3M0TA 2DO7A 1VQ6Q 2E12A 1XOVA 4MQ9F 5M3MJ 1TLHB 5BPDA 2DETA 5IP9J 1HDDC 4FETA 1OCCH 3G1LA 3K4JA 2E1HA 3ZMDA 2KYBA 3SFIA 2NS0A 2F6CA 4AFQC 3UWNA 1BI0A 3SDZA 4HF1A 5K1PA 2J6OA 3DKMA 1UAAA 4QW2A 3G1MA 4F93B 2JN6A 2JTMA 3FB9A 2EGCA 1TUDA 2GQVA 4ZZLA 2X4JA 2O4XB 2QTVA 3JR9A 4ESFA 4BUPA 3BT9A 5K1YA 2R5YB 2CUBA 4VUBA 2KRCA 3M4YA 1IDYA 1Z21A 1U9NA 3EYIA 4B6MA 1VOMA 2GZWA 4XSXF 2FOWA 2XSJC 4K88A 2JSPA 2D8HA 3E9GA 2WAFA 3K0LA 4NS5A 4CXFA 2DM1A 3HXXA 1YCSB 2EYXA 4P1WA 1YCYA 4IRIA 3S15J 3HHHA 4D7MA 4PJ0C 1F5TA 3G1ZA 2L3DA 2BE7D 1ZBJA 3E9FA 1SFEA 1E3HA 2HSPA 1IGUA 2W00A 4M77E 4FE7A 1VYVA 4IQJA 2F4OB 4QT7A 1QVFA 1MW7A 3GFIA 2I2LA 1QCNA 1WPYA 2R5ZB 1YHQT 1N6AA 1MV3A 4O2DA 4L87A 1S8NA 2YS9A 3VB2A 2COBA 5C6SA 2R0QC 1XMAA 3KX2A 3CDHA 4PJLA 3LYIA 2VC8A 1WIEA 3DBLB 4DBHA 5LHGA 4HA8A 2QDYB 2DXTA 2V7FA 4CSWA 2K5FA 4EMKC 1KGSA 3AKZA 4LE9A 3CD6I 1OYIA 1JKOC 1J5WA 1ADYA 1H9GA 4A3MJ 4JX6A 3E9IA 3VU3C 2DF6A 3T9NA 1QE0A 1TC3C 2RHZA 2IP2A 1WWXA 2KY9A 3CCQQ 1X1DA 2DFUA 3PFYA 5HK3A 2NVQJ 2ABLA 2DYRH 1FYLA 4JBAA 3HFVA 3IUOA 4GY5A 2RHSA 2ZTGA 3Q0WA 3L2UA 2IPOB 2ECCA 3UPUA 1B8IB 4CCOA 2HNHA 2FSWA 3K4LA 2BKDN 3E97A 2CJAA 5LHIA 2CJJA 3N97A 3L1PA 4AIKA 2LQ8A 5GANg 3EFRA 1F43A 3MKWB 4M75A 3KCCA 2AO9A 2DFFA 1S7OA 3BTCA 1LDDA 2GNCA 5F6FA 1VFCA 1EVLA 2X6YA 1W5CC 3K1PA 4BAYA 4AMCA 2LBFA 4IIOA 2O6GE 2LCCA 3OB9A 1VQ8Q 1UTIA 3CCLA 1M90C 2XROA 5E3MA 2QBYB 1ETKA 2OC6A 2DT5A 3LSJA 2K6DA 4FIBA 3T1BA 4EM0B 4OB3B 5L3BA 1HDPA 4MZMA 3K7AJ 3ZQLA 1VQ4T 1BKBA 1I1SA 1X4PA 1UGPB 3HSFA 2M0OA 1VQOT 1RR8C 3L09A 4XTYA 2E1MB 1NM7A 4PJOG 2E6NA 5KYNA 1M2OA 1NEGA 1K8AR 1Z6RA 3HC7A 2IJLA 4RAFA 1EIFA 3S32A 3TO6A 1B7TA 5FU7B 1QHGA 1G3TA 1BBZA 1H8KA 4BD3A 2Y48A 1WXTA 4EJTA 8ATCB 4IVNA 3IWZA 1I1JA 2DQ3A 5IHIA 3TMOA 2EQUA 1JQQA 3MP8A 3CXCS 4TTVA 4PJOB 3DTEA 3IHUA 2XIDA 4EATA 2W10A 4JZ3A 2DTOA 3HGGA 3LH5A 1NG2A 2NAZA 5CKEA 4QPQA 1P4XA 1KQSA 1W1FA 1WJFA 2M7BA 3QYHB 1TWCJ 4AVPA 1ZUKA 1D5VA 1ZRDA 1WNLA 3M7GA 3M59A 2CSIA 3M4OJ 3UFGA 4UV9A 1Q95G 1YHQQ 4WK8F 1U5SA 2QQAA 5EG2A 2G0EA 2P4TA 1OX9A 4YRPA 2KVQG 2W82A 3WTWC 2FZCB 3FJPA 1N9RA 3A7UA 3VKIA 3U2RA 1IHWA 4HF0A 2DDZA 4RLFA 1IXSB 2ICWG 2PEXA 3IALA 1ZHIA 3QO7A 2VJJA 1Q86U 1NJIU 4Y15A 5J39A 4Q48A 4ME7A 1EH8A 2BE9B 3H41A 4E7IA 4KFCA 2RV8A 3FKIJ 1Y0NA 3BOQA 5D5XB 5FRMA 2BBYA 2RQRA 5EDNA 2OAZA 3BJUA 3H5RA 4NC6A 3ZQQA 2RB6A 2XHCA 4RGRA 3HOXJ 5GAN6 5JR3A 1I27A 3QG1A 4D0PA 3CC7I 2IGMA 1GDTA 2Q7GA 1ORKA 4G7HF 2DXIA 1HBXG 2VXEA 3MF2A 5DEQA 2BZXA 2FZGB 2HTJA 2Y9ZA 4F55A 1JI8A 3B02A 1QKXA 4J19A 3GFJA 2WB1N 5CKHA 2J3LA 3QWYA 5GAOn 5ELNA 5DLOA 2LMDA 2R7DA 2EFOA 4GFBA 2DOAA 1AKHA 2DN0A 2YDLA 2DFIA 1TU0B 4BI3A 2Z3YA 4J6WA 3BC8A 3KP2A 3LFUA 2JM8A 3L4GA 2LK2A 2DA7A 5D6XA 1KZHA 3U9GA 1YN8A 4M78F 4DIQA 1LVAA 1ACMB 1QW1A 1WYXA 1VQOQ 4I09A 5LJ3e 3CCMT 1Z3XA 3G71I 2CUZA 3FHZA 5ILVA 1KD1R 1YOVB 4HCKA 4L0ZB 1YRNB 2ZSIB 4HXJA 3GUDA 2LH9A 2HOTA 2I10A 1QVFP 2Q8KA 1W36D 2DX1A 2P81A 5EEAA 2L02A 1U5TA 3DV8A 3CCRQ 4PJOE 1XG1A 2BHZA 1FXXA 3QYGB 1Z0XA 3HPGA 1EH7A 2OBPA 1SSFA 4L18B 4P55A 1OPKA 3P9IA 1X1CA 1TS9A 2KSSA 1APLC 4YRSA 2K40A 2M8EA 3J80E 4XK4A 4OB0B 1QVUA 2ZINA 2J06A 4Y28E 2E10A 2QG9B 3S1QJ 3X28B 2R7VA 1ACIA 3QKJA 4MDXA 1WSUA 3FEOA 4M72A 4ZTUB 3QO3A 1OQYA 1I5LA 2KGTA 3O5ZA 3DTIA 2X48A 3QNEA 3BR5A 3TQ7P 2WC2A 3C2BA 2A8EA 4P75A 5EGOB 4PL6A 3CPWS 3BY7A 3W2VA 3U21A 2FNAA 2GCXA 4HSRA 4F16A 1W6XA 4B47A 2E70A 4M7AB 5C3EJ 5J40A 4UV8A 1X19A 3OS5A 2QAZA 5GAN8 2D5VA 1QKWA 1YG2A 3FHNA 4OMOA 3J7AO 5LJ5e 2RI3A 2R93J 2XAUA 5F64A 4GGGA 3P9CA 4P74C 2EFQA 2E2JJ 4P96A 3QHSA 2ZXFA 2LKXA 2P84A 2E64A 4N4OB 4NL2A 2CP5A 2EK5A 2I8DA 4WTOB 1KA8A 3LQQA 3ZMUA 4ITVA 1LFUP 4BI8B 5GAMf 3LSIA 1YQAA 4PLLA 2XASA 3TO9A 1LE8A 2JMAA 4PJMA 1KQ8A 4NBQA 1M8VA 4C8QB 4CHUA 2QA4A 2VUBA 1OULA 4PG3A 3OR1C 1Y56A 1JB0E 2OAUA 1AWXA 3GF2A 3T0YA 4EGYA 1SC7A 2ZNIA 4E6RA 1A0NB 3M57A 4B3AA 1ABOA 2O8XA 1MNDA 2EVRA 2KE9A 3G4SA 2M0YA 1SFXA 1ZGJA 3RPQA 2PU9B 2NWMA 1USTA 2AIRB 2BV6A 1KQ9A 5D4SA 1U06A 3ABUA 2KR3A 1BCOA 4FTHA 3CCMQ 2XDDA 1PUFA 2B0LA 1YITA 2VBZA 4C0GA 2OUMA 4AFZC 1BR2A 2CU7A 1KQSP 4WXDA 3NWTA 4EJUA 3GTMJ 3MKDA 4NC7A 3EUHA 5GMKi 1NJ1A 4U7BA 5BPIA 5DDGA 1TQIA 2K79A 1YW8A 2DLPA 1Q7YR 2XGXA 2MCNA 1CF7A 5FLMJ 2ZMEC 4U88A 4HCCA 2EIKH 4A3JJ 4XLFA 4HSTA 2LTPA 4H2VA 1W0UA 4RCCA 1JKPC 1ATIA 2RPNA 2XMFA 2JZ2A 3WTSC 3QJ6A 2CGPA 3OSSC 3VQYA 2EQMA 5C44J 3CP2A 1USYC 2ZPBB 2HQ5A 4P73A 1T39A 4C5GA 2RK2A 3JRFA 1XJWB 3T8TA 2ETHA 2CMPA 4IUVA 2BY3A 2EKOA 4YFNF 1TSFA 1X2GA 3CCLI 1F9NA 3BR0A 4BNCA 3TVTA 2GA1A 3H9QA 4Y92A 3ZQGA 3VWBA 4EPCA 3KYLA 2ZZDA 4L0YB 3BR6A 1Z1DA 2MAMA 2FRYA 4V2SA 3RMSA 1AOYA 3FLGA 2R5AA 1B7YB 1O3TA 2E41A 1VQLT 3BQYA 4II2A 2L0AA 2Q5IA 3PFIA 1ZLMA 3BDDA 1QP2A 5KCMA 4Y4RA 4CH7A 3RDIA 3QO8A 4J6YA 2VLAA 4M75G 2STTA 5LEJA 4MO7A 4M7AE 3DEWA 4UHTA 4RAGA 2FMLA 4J9CA 4QTRA 4EJWA 4ZGEB 2E1NA 2I4OA 2UXNA 3SWNA 2CH4W 2RKHA 2JJ7A 2GFAA 3VYUB 3UNGC 2F5EA 4ORZA 2K5LA 2QCOA 1W5SA 1PP8F 3TSWA 1HQCA 2VQCA 4UB8C 4G85A 3JCMh 3HXZA 3M9QA 3OL4A 2ZT8A 2FXAA 1BIAA 3EGUA 4B9XA 2DA4A 1ZKGA 1U6GA 2DEUA 1OI1A 1TTYA 1OYXA 1SPKA 5LL6S 2DVEA 2LREA 1DP7P 3E6DA 1D3BA 1WXBA 1Y0UA 3PFSA 4KMUX 1IW7F 2LMJA 1LB2A 3REUA 2V6CA 1REPC 6PAXA 1YJ9A 3DKWA 2AMCB 2PMFA 2M4KA 4HPQA 5K7FA 4C8QE 2G7UA 4C0DB 1O75A 3OYYA 2NVUB 1W7PB 2BEOA 2GOXB 1LJ9A 2QENA 3P8TA 3G2BA 2EAYA 4D5FA 1Q81C 1M3CA 3X26B 5IOZA 3S3MA 3MKLA 4NNJA 2J5PA 4M77D 1SVMA 1VQMI 3LMMA 1K78B 1JXOA 3O8HA 2MOXA 1QU3A 2QGUA 5KYXB 4B8XA 2BZ8A 1UHWA 4YCUA 4UUTA 5EYRA 2HBWA 1RIOH 5TRDA 3CLOA 3DCFA 2VONA 5C51B 3S3NA 4EIKA 4HCBA 2GM4A 5HOOA 3BZKA 1PHTA 1VIEA 3WU1B 4G7OF 3PIPA 2H8HA 2BY0A 1SG5A 2XKOC 2BW3A 4C0FA 2CP7A 2F4IA 3ASNH 1YI2A 3E6CC 1K83J 2JA2A 2JA5J 1IRGA 2B63J 5IPAA 5JFRA 2X6WA 6AT1B 2W0ZA 1R8OB 2J7IA 2GBYA 1J7KA 1H88C 3WTZA 4X1EA 3H9JA 5DD8A 1VQ7A 3WTXC 2MK5A 3RYRA 5LEKA 4R0KA 1K4SA 4RGXA 3C3WA 4M78C 1RUNA 1VQLQ 3I56A 1VQNQ 5IAYA 2K9GA 2H8WA 2BUDA 3E5UA 1G51A 3WXMB 2ZXIA 4Q5WA 4PSXA 2VT3A 3Q0VA 1ZK8A 3M1EA 2M51A 1S72Q 4M9SA 2IVWA 2KAFA 3EFSA 1M1KR 3E9HA 3ZR8X 2XUBA 3HRKA 5I22A 1LDKB 1QVFS 2P5IA 2VGMA 4HDVA 1JJCA 3Q9VA 1FBQA 2CQ7A 3JCMb 3SZGA 1XTAA 3JRGA 5E1XA 5CVIA 5FFXA 4FE4A 4M75E 2LNVA 3FXJA 2KROA 3LWHA 2W24A 1IUYA 4YELA 1ITYA 2EFIA 1W5TA 3CCVA 3BY6A 4P71A 2H27A 1R0BG 3GZ6A 3TL4X 1BB9A 3NENA 5J8FA 2OF7A 2ADUA 1VQKT 2MG4A 2AK5A 3JSPA 3QPLA 2NNNA 3H6ZA 2A05A 5K5OA 3H9GA 1TT0A 1QHHD 1USSA 1RL2A 3F8NA 1K79A 2COMA 2P0PA 4M7DB 3V4GA 1QVPA 1KQ0A 2ISYA 2CZ0B 2E5AA 3HY0A 5L3GA 2LY1A 4Q15A 2FB7A 3NELA 4CICA 1OJLA 4ZYDA 2DRMA 1MGTA 1S7EA 1HW2A 5GAOr 2J3MA 2GXBA 1Z7MA 4HYEA 4YROA 5CVVA 3OS2A 2GLOA 4L9TA 5HY6A 3M55A 4HOBA 4FYXB 2DK3A 2LX7A 3C1DA 3GP8A 2DE0X 1OU9A 2DNUA 3BLYA 3M1CA 4N9HA 3Q9SA 4NQWB 3HG9A 4RCBA 4MFEA 3AL0B 2IS6A 1QBJA 1T0HA 3M9AA 1VQ5T 3CMAT 2HZTA 1EF4A 3TUPA 3A01A 4FSSA 3JAMK 1GT0C 1LNWA 1K1ZA 2WBMA 2DOFA 3LW5E 3Q5FA 1H0MA 1RAEB 3KE2A 4ZTFA 2VWFA 3I59B 2QSGX 2OTJA 2LTOA 4MZTA 2XAHA 1JUMA 2VOOA 2VXZA 2CJBA 4BQNA 4OMLA 2R7QA 4E51A 5F08A 3S8PA 2AKWB 2ZPEB 3TEDA 1VQPQ 3FDYA 4BKXA 3LSRA 1ETXA 4L5EA 3A1PA 3DQVC 5IH2A 3JRBA 1PVEA 2QA4I 3WE2A 3F8CA 2XAFA 3SZPA 3CC7T 4IRGA 2MD0A 4D5CA 1ASYA 2DFEA 2WTEA 3VQVA 1KD1C 1MBFA 4JRKA 3QPTA 1LOJA 4C92G 4DYRA 5DUIA 3G4SI 3K1NA 2OV7A 2IY5B 3QO5A 1FYNA 3LA7A 1XGSA 1XQHA 3PIOA 1YFRA 3HXWA 5CKDA 1VQ9Q 1YITI 2NUPB 3PSIA 1BR1A 4XN0A 2F2WA 2L54A 1A36A 2FU4A 2TCTA 2KEAA 4MHGA 3G7ZA 2GTJA 4C92B 1WJEA 5K5QA 3HL2A 3J7AY 4KISA 4JLIA 1PSFA 3AT1B 4UY8I 2K86A 2JUGA 4BE1A 2YUOA 1MIJA 1LVKA 1WJ5A 4LOCA 1P9QC 1VA7A 3TP0A 2IGKA 1M30A 5CKTA 4RDUA 3ME9A 2AHJB 3CJRB 1SETA 1ETOA 1XGMA 1JXSA 1S5LC 3I4NJ 3CTAA 1BBUA 3K4KA 2XK0A 3QYFA 3GBGA 2ZPFB 2DA3A 3G6EA 1TNSA 1VQKQ 5FB2A 3EG9A 2LDMA 4Z6YA 5IT9K 1T3LA 5DLQE 1XGNA 1WGXA 4A4EA 3RQIA 2HFHA 1YJNI 4BDZA 2Z5UA 4F7ZA 4DNCA 2IA2A 3ZBDA 3VOEA 2K4YA 4B43A 2A08A 1H4SA 4YCVA 1OZ2A 2OQGA 5DYMA 2A36A 4NC8A 5HCKA 4M7DE 3KLNA 2RAEA 1JE8A 3L2CA 2PX9A 4PJOD 2RI2A 1K73R 1WGSA 4IURA 1OPCA 3DB4A 4M75C 2HKXA 2NUTA 3C4SA 4FYVB 1WLEA 2VQGA 3P7NA 4M3BA 1ZSZC 3COAC 2DIQA 5DY9A 1M1GA 1NG7A 5E3LA 3LSTA 2RQTA 1KMNA 2F48A 2JVGA 2HOEA 2O7OA 2Z33A 3DPUA 3CEYA 1NLOC 2M16A 2LD5A 3A32A 3K4MA 1MDMB 2PZ1A 1WPKA 3CMAQ 2FD5A 2ZFUA 2A68F 4XKWA 1YJNQ 3BG6A 2FBIA 3VS3A 3HXYA 2GF7A 1PD0A 4H2XB 1JUSA 4LFUA 1D1CA 4UB6C 4ABZA 2Y4YA 2HQNA 3JW4A 3L42A 2KIMA 4XMYA 4GCVA 4LNSA 2MH9A 3C94A 2F69A 1IGNA 2RA2A 3OYCA 4D1QA 1YJ9I 2YT6A 2V1XA 3ROUA 2UZKA 2HS5A 5GAN2 3TW6A 3QAHA 4FT8A 4RTVA 2QQ9A 4JJBA 4KN4X 4E7HA 1R71A 2OTLA 3GFLA 2E34A 5E1WA 3TU4K 1WI3A 2KQWA 5LGNA 2Q1ZB 3HBLA 2X4YA 1ZYRF 3VYTB 2F5DA 5GADJ 1RIQA 2V4JC 4KIGA 5IXFA 2JA8J 2CV1A 2V9VA 2CV2A 2RD1A 4BQQA 5A2QE 1KK7A 4I7HA 2RHXA 2HCKA 4XORA 3ISPA 2CP6A 2DA9A 1TT5B 1GUUA 4X34A 2JA7J 1G2BA 1JXMA 3KP4A 2ARUA 3LAJA 3M0RA 4YRQA 1SVOA 2PMZA 1TWAJ 1YW9A 1ON2A 2F5TX 3JCMe 1Y8QB 4KYWA 4C92E 4ZYHA 4IHSA 2E71A 1T0JA 2K4JA 2JSCA 2PUOB 5GAOl 2F4MB 5LHHA 1Y1WJ 5LJ3j 2E2HJ 2FUG2 1UB4A 4RTZA 3WGIA 1WX6A 3M4GA 3N5BB 3PQKA 3HTUA 3OYGA 4HT9A 3IKMB 3VQXA 2K3PA 3RJPA 2K4BA 1YI2I 5CYVA 3BWGA 4EMHA 3M3YJ 2YRDA 3BTJA 2M3AA 2RQUA 1I5OB 1VQ7I 1PKTA 5BQTA 3S1NJ 2DQ0A 1V76A 2OQRA 3I4MJ 2C0TA 2L8DA 2ELJA 3HKZN 4IHXA 3I56I 1ZLKA 1UEBA 3A02A 4F3QA 2ISZA 3KZZA 4BEHA 1QGPA 4HVUA 2V1QA 3HDDA 3PMTA 2L7FP 1Q82R 3MP1A 2DT7B 3IH2A 2R58A 3QBYA 2DODA 3OIQA 2X4WA 2GIVA 1WJBA 4ZYEA 2HKQB 2X9HA 5KYYA 2NS7A 3EH2A 2X6XA 2OAWA 2VBXA 2ZC2A 3OR2C 2JRMA 1H89C 2X6OA 1WHLA 1M2VB 3CCJQ 1B72A 5KNLA 1UFFA 4ZGJB 3BQZA 4L9JA 2E7XA 1QZZA 3HGYA 5EEHA 3CCVI 1ZRCA 3C0CA 3V7SA 1O3SA 3H0GJ 3FDRA 2G9WA 1UHCA 5GAMh 1X2QA 1KG1A 5LJ5j 4XICA 1GCQA 2LQKA 4BDYA 3EG2A 2Z0WA 2YLCA 2NUZA 3CUQB 4YRNA 1NEBA 1V1CA 1Z7UA 4YRJA 1HKTA 2E4HA 3I64A 3DB3A 2FMYA 4GXOA 4Y52J 4LD5A 3WTUC 1K76A 1WQWA 2M34A 4FHTA 1U5TC 3CDIA 4B9WA 4M77A 2R5MA 1FMKA 2R4GA 2KKOA 1V5EA 3TEHA 3OYAA 4E7JA 4FT2A 2I4NA 4XU3A 2BTTA 2DL5A 1YJWT 3I9QA 4Y7NJ 3O6BB 2CW0F 3EGXA 5I11A 5EG0B 1ON1A 2ZAEA 2M7AA 12ASA 3MJXA 1GCPA 3JRIA 1WQ7A 3UF4A 1BA5A 3W6KB 4FW2A 4UNOA 1O7FA 3ECOA 3UR3C 1WZ2A 1P7JA 1HD3A 1IZ1A 4CDGA 2LP5A 2FVUA 3Q0UA 2BIVA 1M1KU 2KDZA 2B8AA 4P75C 5EZHA 2SEMA 3SHWA 3JRDA 5KYWB 5GANh 2EJGA 2CJ9A 4P72A 2L7MP 4AH6A 2ZNYA 1SAUA 3RI4A 4KIFA 2FF4A 1MHNA 1TL8A 3JCMg 3CMEQ 4FX4A 2QEXT 4RB2C 3S3OA 2RN8A 4OWRB 1TW2A 1R58A 2QGFB 3ESWB 5HDKA 5AIPA 1B34B 4C3IJ 2ZO4A 3CXCA 4MZPA 1WKMA 4QVDA 2ELKA 3BW1A 2HPIA 2KXDA 2LVSA 3FXKA 4LLNA 3GIBA 2M1HA 2DU7A 5LJ3d 1B70A 4L59A 1ZBXA 1EQRA 1RPWA 1RRJA 1RUOA 1XDSA 2P7VB 2EV6A 1G5IA 4IZZA 3Q1JA 1ZGWA 1I6HJ 3JAMZ 2Q2EB 3TKYA 2M87A 1WDXA 2L9RA 5B66C 1U2WA 1ZSZB 4X1VA 1HCRA 1VQ6A 2O5RA 4EMGA 4Y13A 2PVDB 3DBHB 2NOGA 2VBYA 4PK4A 4D7NA 2VI6A 3ERMA 2AZSA 2O4XA 3ER0A 4LG0B 2XRLA 1OR7A 1WYDA 1MSEC 2R5YA 4PDKA 4IUQA 3PIOF 2LR8A 1FIPA 4ZDPA 2XGEA 5J6XA 2DL8A 4V19K 1ZLJA 3G6EI 2LYCA 5D5VB 3CCSQ 1SVLA 3VODA 3PVQA 1WCMJ 3EUHC 3HSEA 2ZKZA 1WZOA 2IGOA 3TREA 2LDUA 2G4CA 4LDVA 3SJMA 1K9MC 5J3LA 5FU6C 2ZB9A 1SHFA 5LBQA 4F91B 3JSCA 3KPHA 1ZRFA 1IREB 3PVLA 2RJFA 1X01A 2RHIA 1ETQA 5KHDA 3IH3A 4M75D 3CUOA 2KYMA 4AFSC 2R5ZA 1U3EM 5LJ5d 4DEYA 1BC7C 3S1RJ 4KR2A 3OYBA 4RG8A 4P73C 3HRUA 3WTVC 4XU2A 1YJWQ 1Z9CA 2EH3A 5F0FA 2VBWA 1U8RA 2ZPGB 1M90R 2DJNA 3ZMTA 5HDNA 4IX7A 2X3XD 5IT9Z 3H0HA 2DOEA 2V26A 3ZMZA 4E7ZA 1NE8A 1G8XA 2PMUA 4S05A 5TISC 2B86A 1Z9ZA 2RHYA 3A0HC 1SEMA 4FW1A 2L3QA 2CSQA 4OF1A 5BMZA 4L5GA 4B1RA 1U9OA 1XMXA 2E5ZA 4XEMA 3HHGA 4H4KC 1TUGB 1FIAA 3F23A 3A4CA 3SWNC 3ERED 3CCQA 2MYSA 3A1YA 2QEXQ 3FRNA 2WSEE 2XSDC 3S2DJ 4ZZDA 3EFOB 1I4K1 1B8IA 1X3WB 3T5XA 2JS2A 3F9KA 3FXOA 1MSFC 3P8YA 2OTLI 4D9JA 1FWZA 1BW5A 1M3AA 3FXQA 1RAFB 4O3MA 5FJ8J 3G73A 1BJZA 5ICGA 1W0TA 1SRYA 2MFZA 2A3SA 4A0YA 3A8GB 4C2TA 1FTZA 1N78A 5C4XJ 2FEZA 3JCMP 1I8FA 2CDTA 3HHTB 3ZQHA 4A3CJ 2STWA 5B1BH 1KSWA 2QA4T 1DUXC 1ZAOA 4X5OA 2QBYA 1NH3A 2EQKA 4LVJA 4G9YA 2XRNA 1Q1VA 3R60A 5FD5A 4LB5A 4OB2B 2X1DA 2EPDA 2G3RA 1OX8A 1VQ8A 3G4ST 1IJWC 1H8AC 3KIOA 2R7SA 2A28A 1JGSA 4FSXA 3ERRA 2QKMB 1YITT 3VUZA 5LGUA 2A3LA 3CPWA 1R22A 1VZ0A 2R3SA 2V9PA 5KCHA 3MKYB 1YB3A 4GYIA 2P5VA 4DGWB 1Z3YA 1NPRA 2ZZFA 4G6TB 5IN1A 1FSHA 4HNTA 3S6WA 1N27A 2JPCA 4L9VA 4PJOA 1IAWA 1G4DA 1VYUA 5FWCA 4HVWA 1ABQA 3JRAA 3WVDB 3CP8A 1ZTRA 2V1NA 2E1CA 4CZCA 2BY2A 2CT3A 3I71A 2CP2A 2IPQX 4KULA 2QLZA 5E17F 3NQOA 2AZVA 5IHKA 3NARA 1T0FA 2QUFA 2M9HA 1PKSA 4ZN3A 4YRFA 2R7XA 3BG7A 5FLXE 1HSJA 5IYBJ 3K70D 1OCTC 4UPAA 4MTDA 2VKVA 4BY6B 2O9VA 1GVJA 1H4TA 3SZTA 1ZR2A 4U7DA 1YHQA 1GGMA 5F0HA 4J83A 5ED4A 3OBYA 1JJ2A 2RO0A 1H4VB 3K2AA 3KEQA 2QK0A 1C0AA 2HKNA 3E6BA 1GXIE 3CXCP 2F5FA 4NHJA 2EKHA 2V1UA 2DW4A 4MQVA 1HC7A 2YX7A 4EV0A 1D8KA 1K9AA 4YTLA 4RQEA 3QYBA 1NG6A 4H2SA 3RKYA 4X6AJ 1UG0A 2LVMA 2CUFA 1X6OA 3ZFJA 3FF5A 2DAQA 2E35A 2NLUA 2H1LA 3WE3A 4XOPA 2L3RA 3OA6A 3EUKL 4GBQA 4ZJZA 3H5AA 3KYCB 3FBNB 2RVCA 1R7JA 1BK2A 4UC4A 5H6RA 2HL5C 4P71C 2K9NA 1T6SA 1JHHA 3PO3J 1WQ2A 3WGGA 4KGVB 2JRTA 1Z77A 3LOCA 3FM3A 3K4BA 3GTOJ 3QRFF 3OYIA 3HOSA 3GF5A 2LRDA 3RACA 4L6V5 3PNYA 1A5JA 2QASA 2UXXA 5LJ3f 4J9IA 4Q6GA 4BQOA 2P5LC 1D0XA 3QSUA 2CP3A 5FGMA 2RNJA 3BCBA 2XDBA 2DXBA 3VEPA 1ZQ1A 2AQFA 1FP2A 2P0QA 5K5RA 2DQLA 4M77F 2E3HA 2ZXWH 5HS7A 2ACJA 2MWOA 3CF2A 3PCOB 4E7SA 4YRCA 4KA4A 5GAMe 4XQ3A 3QPSA 4IL6C 2CFXA 1MGQA 1I1GA 2NNYA 5FWBA 5EEGA 4WCGA 1F36A 3OIPA 2YSQA 3HRSA 2OU2A 2O61A 4UUSB 5K7ZA 2ARSA 1VQOA 3PMIA 4IKFA 2HYJA 1YRNA 2PN6A 4KQEA 3ZMVA 3IQLA 4HNUA 4M6XA 1R77A 1N77A 3R6NA 3K4CA 4LDYA 2DZCA 3GYHX 2K9SA 4C92D 2MIOA 3L1AA 1PC0A 1IO6A 4Q5SF 3I5UA 3CMYA 2WACA 5CR2A 3CCRA 2VGNA 1YI2T 1MUZA 4LVKA 5F1RA 4N0AA 3D5SC 4EO4A 2Z9OA 3GLXA 2CUJA 3HZJA 4G12A 3EG1A 4E2FB 5GAN5 4WX9A 5CQXA 1OFCX 2JNGA 4E7LA 4C30A 1E7OA 2DBKA 1XB4A 2DQRA 1WH5A 2HR3A 4EJVA 3VYRB 4G6QA 3IRQA 1LFBA 2IXSA 1VQ7T 1IDZA 1VQ6I 3I7FA 3D0SA 4R8HA 5LJ5f 2KMTA 4I2OA 1X75C 2IRFG 3NHNA 3I56T 4BW9A 1R49A 2LG4A 4JOMA 4XU1A 4M73A 4Z8AA 1K0SA 3TEEA 3I55Q 4UUVA 5EGOA 3CC4I 5GANe 3ZQ7A 3IH4A 4ZDLA 1GBRA 3K4NA 1C1AA 4IUUA 1R23A 1ZREA 2A7YA 2NXNB 5ICFA 4M7AA 5FRNA 2FRWA 1AZEA 3F6OA 1FLIA 5HODA 4MNUA 2LLKA 2KIUA 2DMOA 1TH7A 4OMZA 4RS8A 2HXOA 1YE9A 1G59A 2LF7A 4XL9A 4RB1A 2COYA 5TJJA 1NLPC 1L0WA 2CS7A 4JRPA 4MMKA 3DLLA 1ETYA 2DT6A 4PCQA 1ENHA 3GXOA 1D0YA 2DXUA 1G3SA 4LD9K 1NJ6A 2CV0A 2KL4A 1Y8RB 5E8IA 3RERA 1ADJA 1PP7U 2BE5F 3QU3A 3A74A 3WG9A 3CC4Q 1HLVA 3MEWA 1DP3A 3W3SA 2FBHA 1J3TA 3HPWA 3HOVJ 4C8QA 1HTTA 3QDRB 1UG2A 5EF6A 1PDNC 2RN7A 3CPWP 1D8JA 1MMDA 2CQXA 2MMPA 1M4ZA 4OAYA 1Z67A 4NDLA 4F7UG 3TO7A 2HEOA 2HYGD 1MMGA 3LH0A 4A6EA 4XTZA 3JCMW 2CQKA 3E0JB 1LYLA 1ZH5A 4HX8A 4OIRF 3OSFA 2MWPA 2DYIA 3JB9H 3U1KA 4KH1B 4H0EA 1E0EA 1R4MB 3CCQI 3CCMA 4XBFA 4F7UB 5EJCA 3CJNA 5J26A 1UHFA 1LDJA 1PD1A 4Z89A 3H5NA 5DM7R 1G83A 3SFZA 5GAMg 1HW5A 5M3FJ 2ZT7A 4PHCA 3MCAB 1MNEA 2CYYA 2OTJT 3GBQA 2DMNA 2WA0A 4N4HA 3CCET 4BHPA 1KHIA 1XDUA 1JJ2P 1KU2A 1EA3A 4WXCA 5CCAA 3BJAA 2WAQA 2CUEA 4LD6A 3KZYA 1BL0A 2K3FA 1W1WE 3E7LA 1EFNA 2EYYA 2DMTA 1KONA 1VQ8I 1Y7XA 3ZQCA 3RL6A 2M02A 4V2FA 1B7YA 1IXCA 3A2KA 1RI9A 1XC5A 1M90U 1Q81R 4ESJA 1R4NB 2DFHA 4A63B 4YP0A 4DOZA 1RR7A 4RB3C 1O3RA 3CF5F 3GTLJ 1MJ9A 1S29A 1UG1A 1M3BA 1FOWA 2ZZEA 3OMGA 5GAHJ 3QZ5B 5J1YA 2D6FA 2XPUA 4XONA 2COWA 2QYZA 2GQQA 2V9KA 2DU5A 3I3LA 1IL2A 3DKYA 2KNBB 1KU9A 2YUNA 1FYFA 3RQ4A 3F8MA 5CJ9A 2CGHA 3LFKA 5F0CA 1IV6A 3REBB 3HEFA 1PSEA 4II3A 3CC2T 2Y30A 4UVCA 3KXTA 4LXCA 3PL8A 3JTHA 2HDWA 2ED0A 3G6ET 1SFKA 3A8HB 4MTEA 2WADA 2FZKB 3B73A 4LB6B 1STZA 4XOTA 2FX0A 4C5IA 3B6AA 2ZXHA 2AMCA 1QVGS 2HOAA 1YHQI 1W7PA 1JKQC 4PJOF 2CH0A 1JO8A 3L2WA 3MVPA 1QZEA 2XVCA 5IT3A 4AUXA 1RI7A 3OYEA 2PI0A 4FU6A 4A3GJ 2DD4A 4FYWB 1XPXA 3QJYA 4DQ2A 2LSOA 4N4NB 5GAOm 4FYYB 2KIQA 4ZNXA 2KK4A 5JVGF 4HCZA 3RCOA 3W6VA 1K78A 5DM7F 1BC8C 2NVXJ 1XCBA 5KYXA 2P6SA 1UJYA 2DILA 2E3CA 3HOTA 4F7UE 2YPRA 4GLMA 4DBQA 2CRGA 1AHDP 1SHGA 2IG0A 4KH0B 4H2WA 3L2RA 4YRIA 5CK9A 4O5VA 4AD9A 4WWCA 4HVVA 3MKZA 1ZG5A 3FC3A 5L3EA 3CCEQ 1GCQC 2CZ7B 2DTIA 3KP6A 4KITB 2Y0SA 4CYCB 1UMQA 2EJ9A 1B9NA 5FW9A 1S1NA 2KRMA 3JCMd 3H0DA 2P7CB 3RTRA 4YPFA 3QIIA 2OI3A 4XEOA 1VQMA 4M77C 4BS9A 5GJVB 4HX7A 2Q5HA 4KICA 1SMYF 3KLOA 3DPTA 1ETWA 1YBYA 4CC4B 2FO0A 2WV1A 1VQNA 4OOIA 1HF0A 2M4GA 1VQOI 1LNXA 4OMFB 3JB9I 4M3FA 1ASZA 5KYUB 2DRKA 2PMHA 3OQ5A 4M9ZA 3JSOA 2DKGA 3GZ5A 4Q47A 1S72A 1QCOA 4NUBA 4BE0A 5L3FA 3GTJJ 1GBQA 1X55A 3SFMA 2OCCH 2PMEA 2X3WD 2DA6A 4P3PA 2DTZA 2IS2A 1AU7A 2B7EA 3CC2Q 3CCRI 4P72C 1D1BA 2DXCA 3ELKA 2KIFA 2ZT5A 3LSSA 4XLEA 3RF1A 4Z2YA 1YP5A 2P4RA 3RKQA 3ASOH 1F4KA 1PYSB 3FKJA 5D4RA 4G7ZF 3B6CA 3JB9G 3MO8A 1VQ4Q 4NL3A 3OYFA 4EMSA 2R57A 3TQNA 2F2VA 2BXYA 2WSFE 4M7DA 3D7SB 2VPRA 1XTDA 2KQRA 5EC7A 3SEMA 3PQJA 3QWXX 3ULQB 2FBKA 2NVTJ 3V42A 3L2VA 4P3OA 5AT1B 4FASD 2Y31A 1BBWA 5IOYA 4PJJA 4RTTA 1QVTA 2P0WA 1XMKA 4X9DA 3HXVA 5JI6A 1YIJT 1P92A 3ML6A 1ZA1B 4GDFA 2JVHA 2VE8A 2KT8A 3ZL7C 3AFHA 3CCUT 3QOPA 1EOVA 1IG7A 4B4CA 2X1EA 2H09A 4NQWA 3M0QA 1M27C 3H0FA 4NCXA 4B3XA 4IEJA 4ESRA 1JU5C 4UP8A 2EBPA 4PGGA 3S16J 3VYGA 1Y96B 1OPLA 4OU0A 4IO9F 2FL7A 1N25A 2LOOA 3RKXA 1P2FA 4YIIA 2R7ZJ 2A07F 4ZGDB 4OGEA 1OR7C 5KK1A 2QHVA 3I59A 4BE2A 4M7AG 4M7AF 2K5CA 3K10A 2AKWA 2QGGA 5KAIC 1F1ZA 5A0GA 2VIXA 4TV7A 2K2VA 5HS9A 1T8IA 2M8GX 2HPMA 3FXLA 2WWYA 2K3BA 1VQPA 1TQMA 2MPXC 4EMKB 4R79A 5F27A 2JOYA 3QZ9B 1AHJB 5FKNA 3DLLF 2NVYJ 3I5SA 2MC4A 3EAEA 3I5RA 4YRRA 2IY5A 3LLRA 2ZPIB 2L2OA 3VS4A 4AIDA 1QA6A 5LGTA 2M0CA 2KHMA 2FYKA 2NUPA 2O03A 1DQUA 1LFPA 1H92A 1YGBA 5FROA 1N9WA 1X56A 3J81E 4A53A 4BQAA 2K9QA 4M71A 3C2HA 1MJAA 1VYTA 4LDWA 4C8QG 4CH6A 3QP5A 3CCMI 1WFWA 1VQ9A 4K87A 4C92A 2QQBA 1KC8U 3EG0A 5KH6A 1RADB 2Y69H 5GAN4 3ICAA 1Z9QA 4LITA 3UKGA 2MI6A 5H6QA 4LUEA 2CREA 2M30A 1TOVA 3M0UA 1DPUA 2HDDA 1H3ZA 1NJIR 3H35A 5DD4A 5F04A 1OU8A 3NEUA 3OYMA 4M74A 2XGTA 4MEXF 3LAPA 3FZVA 5GP9A 1LEAA 4F14A 4JK1X 1JJ2S 3R0JA 2RQWA 2L9NA 4A3IJ 2K2MA 3CDLA 4DOVA 1QZYA 3J80Z 3W2AA 4CS2A 2EWNA 3A0BC 2LC4A 2KJCA 1RAGB 1RI0A 2XDPA 1HSTA 4A4KA 1VQKA 3A7RA 1AZGB 4NB5A 1E1TA 5JVTA 2Z1DA 2YXYA 3REOA 1Y39A 4C3HJ 3KP3A 3CPFA 4CRIA 5HS8A 2EGAA 1AWJA 2XKPA 1O4XA 4BBSJ 4XM3A 3MZHA 1YIJQ 2CQQA 2QZ8A 1NZ9A 4BU2A 1EFWA 2GWRA 3EQLF 2ME0A 3CCUQ 1ONVA 3F8FA 3SQNA 4HW0A 1C0MA 2XPWA 5FKMA 1NJ5A 1FOXA 2JMWA 2GFUA 4CC2A 2P0KA 1EZZB 3S14J 1IXDA 2VUMJ 2PNIA 2A6TA 1WHUA 1YIOA 1MDMA 3IL2A 1W4SA 3JCMJ 1W4MA 1MH4A 2O9SA 2RGVA 2VE9A 4AC0A 2VQHA 4RTYA 3MZ8A 3VS0A 1YW7A 3DU6A 5E3IA 2E1MC 3HOWJ 4J8OA 2XTIA 4H2XA 2JJ9A 3X2QH 2ZCWA 1R1TA 4UVAA 1YJNA 3K2ZA 2EBIA 2K57A 2BY1A 3MN2A 4BXFA 3F70A 2M45A 4LK1F 2E6ZA 2EJFA 1QQIA 2CT4A 2WAEA 3WVEB 1R1VA 1CKAA 3VS6A 4W97A 2D1HA 3BPVA 2L2PA 1J0RA 2VXFA 3HJEA 2LY9A 2D1VA 4PJOC 4ZDOA 3KP7A 5I2MA 4M75F 3HFNA 3CLQA 3DEEA 3P8BB 3JCMf 4OLFA 4KNYA 2ECBA 1FEXA 4HWTA 1N8RC 2EL9A 1UFMA 5DCMB 2XC7A 3OD1A 2DL3A 3GTKJ 2YUPA 1T95A 1T0FC 3OYKA 4TVAB 3K69A 2M5WA 2BZYA 1RUWA 2EZHA 3OS1A 2QM3A 4YRLA 5GMKj 1EIYB 1NNHA 3QXEB 4YRMA 4EVIA 4HBLA 3LGFA 3EGDB 5M5WJ 2LF8A 4KIBA 1K4US 1YFHA 4CA0A 1Y6IA 4RDXA 2DMPA 3QOEA 4ZIBA 4JYKA 2E5QA 3A03A 5M5YJ 3RZDJ 2Y2ZA 3DF8A 4HF2A 2Z99A 3EDPA 2X51A 2M9UA 3M8JA 3HY1A 1X2NA 1FOKA 4RGSA 4I02A 2EJRA 2RQVA 3GNFB 4XRSG 4BACA 1Y71A 3CCQT 3WTYC 3FXUA 3SEZA 2Y90A 4LDXA 3VV0A 1FMWA 2L01A 5FLVA 2DBMA 1UGRB 2XI9A 3PT9A 2J6FA 4LN2A 2A5WA 4ETSA 3KFWX 2RHQB 1RAAB 2ECZA 3SDBA 1M1EB 1XS9A 3PNWC 2I4MA 3OMYA 5CKFA 1RETA 2FPDA 5J1UA 1WFXA 2CSOA 1K6OA 2DI3A 2PFBA 3BROA 5C52B 1G5HA 3NTHA 5JLWA 1K8AU 4M6YA 1UGQB 4I6ZA 2RM4A 4YRTA 1BBYA 1VQLI 1G6NA 1VQNI 1SFUA 3NTKA 4DZJA 2QXFA 4XN3A 5ECAA 3CD6T 4YRVA 1FBSA 1JHFA 2L3SA 1HKSA 2CW8A 3ASKA 2GXAA 1TP4A 3UT1A 1VQ8T 4J5YA 2HU9A 1S72I 3M58A 2JTEA 3H0IA 2DO3A 1QF6A 1MH3A 4YDQA 5GANj 5D5UB 3MP6A 2MBFA 1M2VA 3S93A 5GMKm 1SEUA 3O2PE 1I6XA 2IEKA 4L5JA 5A2QK 1HXDA 2DJQA 2C0OA 1DGWY 4YFKF 2PJRB 4WJ3M 3ZQFA 1PG5B 1TTHB 4PNOA 3CCJA 3EG3A 4Y33A 4KJZA 1G5VA 3C7JA 3CUQA 2L9SA 2WY7Q 3ABMH 2YUSA 1VUBA 3EPZA 3TCJA 1RABB 4HQEA 4BJ6C 2O3FA 4HLYA 1QP3A 4HT4A 3LL7A 4JS4A 1AVZC 2H1KA 1LCKA 4I76A 1DPRA 4FL6A 1KU7A 2K9MA 1UDLA 1H9TA 3PM1A 2QYOA 4CGZA 2O0YA 4P9UA 4N0AC 4C3JJ 2R7UA 1JRIA 2A6HF 5CO7A 4TVYA 4LLGF 4OIQF 5EG0A 2XF6A 1SRMA 4DW6A 4LUDA 1MMNA 2WV0A 3X20B 4BB7A 1JUPA 2DJIA 3FXRA 3I35A 4M7DG 4M7DF 5ICEA 2ZR2A 3H3VK 3BR3A 4BXXJ 1WI7A 3RMQA 3V8KA 1U1TA 4G94A 4HT8A 2A61A 3IWFA 1OCRH 2EZLA 4LG3A 4CH3A 3EETA 4B09A 2EIMH 1RZ4A 5KYWA 2PTKA 4K86A 5B1AH 5GAN7 4XNFA 3MHXA 1DGRM 4ZYGA 4XSZF 1KYZA 3HPHA 1WHMA 2L3PA 4M7AC 1ZG1A 3OYLA 5CLSA 1XSDA 4XKVA 1TXQA 2ELHA 1BM9A 3GEZA 2CS3A 1IN7A 4U87A 4U0YA 2EYQA 2VC0A 1WLPB 3A8MB 1PRLC 3ZN1A 3H8ZA 1VQPI 1B34A 3KP5A 2R92J 3CMEA 3K6GA 1K9MR 3TDUC 1KMMA 1PRMC 2KRSA 1V55H 3N4MA 1IHVA 3TOBA 2Y75A 5GAMd 4IOCF 1V4RA 1UECA 4CI0C 2XV4S 3M0PA 4RKUE 4EDUA 1YFNA 2RNAA 1KD1U 2DTHA 4KT6A 4A0XA 4XRMA 3VDXA 2Q2EA 4HV6A 2X35A 1WJAA 4C8QC 4JS5A 3OSVA 3CD6Q 2RJCA 1FC3A 1T33A 4RAYA 1VQ9I 2PUKB 1ZSZA 4CO8A 3U23A 4UP9A 1V3FA 4L9NA 1WJDA 4LNPA 3C95A 4XQFA 3RKWA 3GX4X 4IHWA 3CBPA 2ZMEB 5BOXA 3VSKA 1TBXA 3OV8A 4FX0A 4N4GA 2NOJB 3INZA 2HAXA 4LG0A 3R0AA 3E1SA 1XSVA 4YEJA 4J9FA 4XLNF 4F04B 4JX5A 4OMQA 3LA3A 3OYHA 2K27A 3MZYA 2MGQA 2QHTA 2FPFA 4XTWA 4DOWA 1IF1A 1OLTA 4Z02A 5LLQA 2JUFA 3FK6A 4C92F 1YNZA 1TWHJ 3KUFA 1VQKI 5HNHA 2DPDA 3CCSA 5J8CA 2MC3A 1YFSA 2QQSA 2NS6A 2O2OA 2VV5A 5GANd 4E4HA 2EA2A 3CCRT 4G84A 3GTGJ 4F17A 4CCNA 3OIOA 3R6OA 2QWWA 3AG3H 1X54A 5IYCJ 1Y0MA 4CUGA 1W66A 2RHUA 4RUGA 2W85A 4LLLA 4LDUA 2QI2A 2ROLA 4A5NA 2EQRA 2PMZN 2LKPA 1YJWA 3URGA 1RNLA 4I99C 1E6HA 3G71T 1KOGA 3HP9A 3J7AF 3FMQA 5J1RA 1S3JA 2VXDA 2JTFA 1M9SA 2DVJA 4AG1C 2ODRD 4KGXB 2HMAA 1R6RA 1WHGA 3RGLA 2XF5A 2GQIA 4A3FJ 4U0VA 1BOBA 1VQ5I 1AEYA 3CMAI 3GLLA 1BCMA 2EV0A 1WHJA 2ENMA 4YCWA 3HFZB 2ZNJA 2N8GA 2YUQA 2KI7A 3VJPA 1HSQA 3WODF 1KYWA 1SERA 3C2GA 3CBMA 5IP7J 1BR4A 3CQZJ 1SSHA 4PFOA 1P6RA 3EFOA 2DDBA 3MWMA 2OCEA 3MQ0A 1UHSA 4AT1B 1ZARA 1HYOA 2QEXA 4P5NA 1S7AA 2YR2A 2H3EB 1J59A 1KQ1A 1GFDA 4BH9A 2VODA 3CCYA 1EV7A 3PTAA 5IY5H 4FCYA 4TWAA 1Z05A 1JJ6C 2R7FA 4BGDA 4A3KJ 4I98B 2RDPA 2IGNA 2JTVA 3WTTC 1VQ5Q 4J7FA 2VJIA 2ZFWA 3DP7A 2HVQA 1EVKA 2W1OA 1Q86C 4C0DC 1NJIC 3DLMA 3QPHA 4RTUA 1LEBA 1W2BA 2PLYA 1I50J 3WHCA 3IRRA 5GAOq 2OJ2A 3ZMSA 2LJ0A 5HKCA 1Q7YU 3HFOA 2CKKA 2MH2A 4KUMA 4JUVA 3LA2A 5TGTA 4CZZA 2SRCA 9ANTA 3NETA 3AG1H 3CO7C 4M78G 3CZ6A 1YWPA 2HQXA 1C6VX 4D8KA 3HRIA 3I54A 4KT5C 2XAGA 3NPFA 2ID3A 3FBIB 2AKLA 5BNGA 1POGA 4DYCA 4IIMA 3WG7H 3CC7Q 2QKLB 1Q1HA 3V7RA 3JB9J 3WU0A 5F5WA 3HM5A 1R1UA 3OW2S 5E8GA 1Y1VJ 1IRFA 1WA7A 4M78B 3QUIA 4YIRX 2AKKA 1B3QA 3UGQA 3GO5A 4WI1A 3NTIA 5B5EC 2IVMA 3EHRA 2DYSH 3OY9A 3A5ZB 2HOSA 3REXA 1FY7A 3C12A 3EUAA 2DTRA 5HLGA 3SYTA 3AHUA 3RPUA 3V8LA 2XB0X 4DZPA 5BS6A 3V7CA 3BG5A 2HD0A 1TUCA 1HOMA 2XICA 2RH2A 5K7HA 3G71Q 4FQGA 5ELOA 1FJLA 3NWSA 1NPPA 2FG0A 1WVRA 3PSFA 4C2UA 1BYMA 3CCJI 1K61A 1O9SA 2ZSHB 2VJ4A 1MBHA 2OX7A 1GRIA 1IN6A 2EW3A 1SKUB 2GGRA 1SD4A 2LJ3A 4AIHA 3JB9D 4BY7J 3GOXA 2ALYB 4R55A 3RZOJ 1A6IA 4XKBA 4H2YA 2K5IA 1E3PA 1T98A 1I3QJ 1XN7A 5FD6A 3HUGB 3J7YJ 4TVWA 5HLIA 2KT1A 2RK1A 4FM4B 4XKCA 4PLIA 3PIPF 1KIKA 4PZJA 4IPAA 4R56A 1UGVA 1UJ8A 3FMRA 3VS5A 3CCLT 2VYTA 1KFZA 3JV3A 1IN4A 1B07A 2WB1A 3MEVA 5ILSA 3K70C 2CW7A 2ZJQF 1A31A 3VQWA 2ZJPF 1UUEA 4KBMB 2D45A 5J47A 1A6QA 3NGPA 5A2QZ 4N0BA 2J5OA 3VRZA 2W48A 4RAZA 2EZIA 1MV0B 3M4PA 2C06A 3LSPA 2XF7A 4IQ4A 2A0FB 4LGWA 4B44A 1XSXA 3ULRB 3W3CA 3IP4B 4A93J 1RLPC 2DLLA 2ZJ2A 2R7OA 2JT4A 4M7DC 4B48A 1NTCA 2ESWA 4KMFA 4JP0A 2QSHX 1OISA 1FMVA 3DBRB 1TNTA 4O6JA 2KLOA 1HW1A 1NYGA 3PCOA 3E6MA 5AONA 5E1ZB 4Y17A 5I2SA 1RLQC 2V1RA 4M7AD 1I07A 5FLXK 2L5QA 3ABTA 4FISA 5LRRA 3I58A 2Q0OA 2YHTA 3W6JB 4NOYA 3DXJF 4CCJA 4UUSA 1X2HA 1KC8C 2KT0A 3ABKH 1Z91A 3AL0C 4RA2A 1NK2P 5CIUA 3L9FA 3MEXA 4YFXF 3CMEI 3AAFA 3O8GA 1RAIB 3GMEA 2E2IJ 1NYFA 4M78E 3NFCA 5CAIA 3K9TA 4ELZC 2X1CA 2Y4XA 4A4FA 2IS4A 1TZLA 1N9SA 5LJ3g 1Z6TA 3KEOA 3JCUC 5GANf 1BN5A 2Z16A 2DERA 2IW5A 4LIUA 4C8QD 3ZQIA 3PNVA 2J6KA 3DSQA 4BJ5C 3KFUA 4ON0A 2FQ4A 3LSHA 3SD4A 3LWFA 3JCMV 1QVGA 1VQMT 1SF9A 2C8MA 4RLQA 5HDGA 3DFGA 4GLKA 3GVAA 2BGCA 1E17A 2C7IA 1YO5C 2ZR3A 2KISA 4TQDA 2ZBKA 1MMSA 1VQNT 1WI9A 1GXPA 3I55A 1QPMA 2HZYA 2K02A 1RESA 2RHSB 2PBIA 4GO1A 2OZUA 3IAS2 2KDOA 1CQTA 1S72T 2ZT6A 4C92C 2O8KA 1GXQA 1QMCA 4TVRA 4YRGA 5AIQA 3VRYA 3CCSI 3PUBA 1ARKA 4YIFA 5KCOA 3P5JA 1BW6A 4OGCA 1XGOA 4M75B 3R4KA 3SXYA 3CCLQ 1W2BP 1K9MU 1WH7A 2JXBA 5F1JA 2P5KA 2UWMA 4K11A 2LBFB 4WF2A 2VASA 1A35A 2KFDA 2D9TA 5ICCA 2K3XA 5D8KB 5LJ5g 4JRIA 5I21A 2YLBA 2YU3A 4Y3OA 4HWOA 5C4JJ 1N5ZA 2DA5A 2W25A 4ENNA 5LRSA 1YJWI 3CC4A 3F6VA 2R7TA 5DV5A 2VC1A 1IV8A 4PUSA 3S2WA 1FP1D 2GA2A 2BXZA 3KBGA 1VNDA 2OD5A 3LX7A 4IRHA 1X2KA 2LFBA 1U0JA 4OB1B 4RBOA 3MFKA 2E19A 1UGSB 4C5EA 11ASA 4ZTJA 2W4SA 3H3ZA 4I01A 3R07A 3E19A 4YREA 1XCVA 2HGCA 2E5KA 2DPUA 3HKSA 2K7AA 1SD6A 3ZRGA 1M8MA 4JRQA 4MLOA 3MEUA 3JCMc 2NYSA 5JHUA 7AT1B 3DKXA 2X85A 1B76A 2F1LA 4F7UA 1IB8A 2JT1A 2JMCA 2QQRA 1NYRA 2EFNA 2E1OA 4HEA2 2MLKA 3HRTA 1DU0A 3WGHA 2M0MA 3H3UA 2QEXI 5DM6F 4OAZA 3IV5A 1YS6A 2QVOA 4D8DA 4TQFA 2HKOA 1LJOA 3VUBA 2DDAA 3RESA 2ATCB 5CVJA 2TDXA 4A3LJ 4QLCU 1V5FA 1HKQA 3PNTA 1VQPT 1FYKA 1W7PD 2W57A 1FTTA 3RIRA 1E22A 4C0ZA 2H94A 1GV5A 1X6GA 2MLGA 1VQMQ 3RYPA 2R7RA 2RQQA 4IHTA 1I3AA 2EIJH 2KZVA 1K8AC 4KGZB 1KU3A 2BVMA 4DYQA 1HK9A 2JWTA 2GTOA 4QKUA 3F8BA 4AYBN 3A31A 1ULYA 1N75A 1R36A 3NEMA 3DTKA 4J9EA 2XB5A 3BR1A 1VQ9T 1TWGJ 4RQFA 1U78A 3IKVA 2C6YA 3MEAA 4RMOA 5KAFC 2QHSA 1T56A 2X4HA 3G1OA 2NRAC 2RF0A 4LVMA 3HRMA 2DMUA 2JUCA 5DTDA 2DK8A 3H9NA 4LVIA 5FFZA 2VQLA 2H6BA 2M1BA 1E2XA 4IUTA 1UHMA 1K73U 3THKA 3M56A 1AWWA 4OMYA 4DEXA 5FKOA 3BJ6A 2KJBA 1XX5A 3RSNA 4IUPA 2MABA 4EQQA 1B9MA 2A37A 2LCLA 1AKHB 1V29B 2QSFX 5HLTA 2HYFA 1GVDA 2VPLA 1P4WA 1J9IA 3L4GB 2JVVA 2OPTA 3MPUB 4PSWA 4F92B 4BL0B 2G7HA 4L5IA 4DPGA 2Z2SB 3O3KA 4Q4ZF 1IN8A 1V5GA 1QLYA 1R5ID 1B6AA 1Y57A 1UELB 2KMUA 1R5HA 4QVCA 3A8LB 4ENKA 5FKLA 2JW4A 4ZN1A 2XDVA 2MF2A 1X69A 3OYJA 1PJRA 3F22A 3MEYA 4RTWA 2CZ1B 2K85A 4ELYC 1XD7A 1D0ZA 4HWSA 3LSMA 1U5TB 5LD2C 1YX5A 1OCPA 4G8XA 1WJRA 1JT0A 2HQEA 2D0QB 1D3YA 2FHDA 1HC8A 1W70A 2L7KA 1LUJB 4OIPF 1X1PA 5IYDJ 3I0TA 1QO0D 3DLAA 1SAXA 4AFUC 2HDAA 1UB9A 4I0AA 1OCZH 5GPCA 1I0CA 1YJNT