3V8JA

Crystal structure of staphylococcus aureus biotin protein ligase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
322
structure length
306
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Biotin ligase
publication title Selective inhibition of biotin protein ligase from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 98
structure length 306
sequence length 322
ec nomenclature
pdb deposition date 2011-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3v8jA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3v8jA03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3v8jA02
1Z6RA 3MZYA 2TDXA 2P5LC 4YRMA 1G5HA 2HTJA 2RN7A 2P6SA 3DF8A 4HOBA 2RDPA 3NETA 1J5YA 2IA0A 3ML6A 1B1BA 2E65A 4RGUA 3KP2A 4S04A 4H02A 4EJVA 4IVNA 3BP8A 4P3OA 3BZ6A 3A5ZA 1P2FA 1B7YB 2AMCB 4NHJA 3S2WA 2F5FA 4EM0B 4UNOA 3QNEA 1FYLA 1D5VA 2H6CA 3E5QA 1ZRCA 2FA5A 4YRTA 2VBXA 3VQVA 1ASZA 1U78A 1BI2A 4CICA 4G7HF 2HYGD 3KZYA 2EFNA 4C8QF 2L4MA 2G9WA 4GYGA 4HAMA 2RGVA 5LLQA 3QSUA 2OA4A 4RS8A 3LA7A 5ICFA 3TDUC 1D3YA 2QTXA 3D0SA 5EEGA 3PGGA 5GAMe 3JB9H 2HDCA 1Z91A 1YYVA 5GMKi 2P5KA 2D1HA 4YCVA 4K87A 4HZFA 1XGSA 2XGXA 3UFGA 1IF1A 4M77C 1PUEE 4KIBA 3GLXA 1E2XA 4OMZA 4L0ZB 1H9GA 1SETA 2FF4A 4AVPA 4IHTA 4M7AC 2R7FA 3MFKA 3CO6C 1QF6A 2GQQA 4EGZA 1TQIA 3FXRA 1J75A 2IA1A 1KMMA 2XASA 4I02A 3LAPA 3QOPA 1R1VA 1WU7A 2ZNIA 3NEUA 4RCBA 1XSVA 1QGPA 1Z1DA 1NHAA 1HXDA 2H6BA 1FP2A 3E97A 2ZT8A 1DUXC 4RAZA 3PCOB 2VOOA 3GYHX 4IXAA 3QO8A 3JCMf 3OD1A 2I4MA 5LGTA 4H2XB 1IZ1A 1IRGA 5TRDA 2DK8A 4WJ4A 1RNLA 2QVOA 4Q4ZF 3WODF 3TEGA 3B02A 4IHSA 1ZRDA 3DKWA 2RHSA 4YCUA 4YROA 5GANj 3FIFA 5FO5A 3RYRA 2M30A 4RB1A 3WTSC 2V9VA 4HDUA 1XGNA 4M75B 4A6DA 1LJOA 4V2SA 2DPUA 3E3VA 3SWNB 5E8GA 2EJGA 2XRNA 4ZZLA 2QZ8A 4ZYHA 4OINF 1SD4A 4AIJA 4LLNA 4YFKF 1Z05A 2O0YA 2BGCA 1ODDA 5D6FA 4G7OF 3ZMVA 3V8KA 2PG4A 4YRKA 3ZMTA 4U88A 4P74A 3ECOA 4G6DA 4RMFA 1B70A 4EO4A 5HS7A 1DPRA 1G3TA 1S3JA 4M7AF 1FBSA 1KYZA 3O2PE 3ZN1A 2YLCA 1B34A 2KJCA 5HLIA 3HXYA 4XTZA 3JW4A 4Q47A 5FFXA 1QNTA 2GAUA 2RA2A 1ZN2A 2FNPA 2LSOA 2ZZFA 2L4AA 1ZGAA 4N9HA 1JBMA 3F72A 2EK5A 4OMYA 4OLFA 2DU7A 4P71C 1JJCA 5DEQA 1KQ1A 4U0YA 1SD5A 4M74A 4MTEA 3T8TA 3WG9A 5K5OA 2ALYB 4I0AA 1FC3A 2F5DA 2HFHA 4XTXA 3JCMW 1JXSA 2DU9A 4C8QA 11ASA 3JTHA 5CLSA 1ZG1A 2STWA 4BH9A 2ODRD 5BMZA 4KMFA 3I54A 1T98A 2I4OA 2P8TA 5A2QK 4HQMA 3CUQC 1JE8A 2BV6A 3PQKA 3OV8A 2E3CA 4ZZDA 3I64A 5FB2A 3HY1A 4Q48A 5E17F 5KK1A 2VT3A 2A6EF 3KEOA 1S6LA 3BOQA 2FRHA 2NRAC 4YFNF 4YIIA 4PJOC 2QHTA 4BAYA 4EMKB 5L3DA 1FYMA 3K0LA 3J7AO 1R1UA 2ZCEA 1XDSA 2I4LA 1G6NA 3ZPLA 3I5UA 4N0AA 4JQFA 3P9CA 1I6XA 4K86A 3ZMUA 4R79A 3MF1A 1LQ1A 1G5IA 1FT9A 4WCGA 3BW1A 3HTSB 4A2UA 4ON0A 1O57A 5GANe 1B59A 3GFJA 3LSTA 3M8EA 5D8LB 3EUHA 1YFRA 2ZIOA 1RIOH 2IP2A 5E18F 4ZTUB 4G6QA 3EETA 5LJ3d 5K1PA 1T39A 1WQ7A 4H2UA 2ISYA 4YRLA 2VBYA 2FOKA 4HV6A 2HQRA 1IN6A 4TVYA 1TW2A 1WQ2A 1EH8A 2HZTA 3KFUA 4M75D 4KQEA 1YW8A 1FSHA 2VXZA 1K7AA 4KN7X 4C92B 4HA8A 4A5MA 4HW0A 3UGQA 3L4GA 2VBWA 3KZZA 1AWCA 2XAGA 1Z9CA 2XGTA 2D45A 4P72C 2VONA 3F3XA 4UXNA 2W85A 5CVUA 1P4AA 1T2KA 4G85A 2MH2A 5DD8A 2EB7A 5LGNA 4E70A 1LDDA 3HFVA 4I01A 2XUBA 2HOEA 2EJ9A 5D4SA 4TQDA 2K7LA 1LJ9A 5H6RA 4A54A 2EFPA 4BYYA 1JHHA 3I58A 2L54A 4RB3C 1P4XA 3M4PA 1F5TA 4LNSA 2E10A 2XVCA 2CJBA 5I21A 3IALA 3E6DA 1W66A 2WWYA 5K1YA 4YRSA 2LF8A 1W7PA 3EQLF 3I59B 5GMKm 1YFTA 4M7AA 1EIYA 4U0WA 1XMAA 1HKQA 1SMYF 4Y15A 1N9WA 3RTRA 2VT2A 2Y75A 4M75G 4RGXA 2DW4A 1GGMA 5JR3A 2K27A 3DV8A 4CXFA 3VU3C 3VFZA 1LOJA 3K1NA 5LHGA 1XMKA 4XU1A 3BJOA 1Z6TA 3REUA 1WQWA 3MZHA 4CS2A 4ZIBA 4L9NA 4HX4A 3SWNC 4RGSA 4IRIA 3G1ZA 3SZPA 3MCZA 3R60A 3ZMSA 5LHHA 2ZNJA 5D5WB 5LJ5g 2C6YA 2FE3A 3EYYA 1ZLJA 4XSZF 2JN0A 1H4SA 1O3TA 4LG0A 3C7JA 1UHWA 2OU2A 3F6OA 2Q8KA 1B6AA 2DZCA 1RUNA 2FYKA 3HRMA 3HRSA 5GAOn 1HTTA 4G8XA 3KE2A 1P92A 3RYPA 3CJNA 4I09A 3ERRA 1ASYA 3DFGA 2DEQA 1EVLA 2ZNZA 4HDVA 2LF7A 1Y96A 1L3LA 1ONVA 4A53A 3QPTA 2JPBA 4RB0A 5KNNA 4H2YA 1U5TA 4UVCA 2ZMEB 1R5GA 1L0WA 1IXRC 1X01A 4YRGA 5DUIA 4FX0A 3TDZC 3HSEA 3BY7A 2PQ8A 3CMQA 3L00A 1W5TA 1ZG5A 1TQMA 3M7GA 1BJAA 3TOBA 3WGGA 2E1CA 1BC7C 4OIOF 4M7DB 4RAYA 2ZT6A 1YLFA 3GXOA 1QE0A 4GCVA 4P9FA 4F7ZA 3R6SA 4NB5A 4P74C 1U1TA 2UWMA 4B8XA 4UP8A 2KIFA 2ZGWA 2XKPA 3K69A 2Z9OA 2JRTA 1VTNC 3VBBA 2K02A 2HS5A 2RM4A 1EVKA 4RGRA 1NJ5A 1PP7U 4CH6A 5LJ3f 4BNCA 2DAOA 3U2RA 4ENKA 2GA1A 3EFSA 3VQWA 4AIKA 4BHCA 4UV8A 2XKOA 2H09A 3D5LA 4EMKC 5HLGA 1XGOA 4QVCA 6PAXA 4UPAA 3CUQA 3GO5A 4WXCA 3GFIA 4PZJA 4U0VA 1YG2A 4YG2F 4X5OA 3FMSA 1WI9A 1XB4A 1K78A 1NYRA 5DY9A 5ICCA 3M1EA 3I71A 1O3QA 3P8YA 3EFRA 2R3SA 2HEOA 1HC7A 4GXOA 1ZYRF 3SQNA 4LB6B 4QLCU 2DFIA 5GAOl 3HSBA 1Q1HA 5ED4A 4I98B 1B7YA 2AMCA 2JTVA 1XCBA 2QYOA 3KP5A 3IWZA 3P7NA 2IA2A 1TBXA 3ELKA 3ZN0A 3DP7A 4ZYEA 2RHQB 4ESBA 2BE5F 2LKPA 2ZNYA 1BM9A 1FP1D 4IF4A 2AKWB 4LJZF 4YIFA 2CYYA 3L1AA 3RL6A 4B09A 2L01A 2V1XA 3KLOA 1T6SA 5ILUA 3IHUA 3JCMQ 3WTVC 3REXA 1I5ZA 2YSRA 2DZ9A 2O03A 1V3FA 3HFOA 4ESFA 1BBUA 3HXUA 3KCCA 1OR7A 3IKVA 3HTUA 3LWFA 2DJZA 1FSEA 3O6BB 4L9VA 4OIPF 1NJ1A 2STTA 3F8FA 2FXAA 1UFMA 3T0YA 1BOAA 4AWXB 1FNNA 4JLIA 1OKRA 4P72A 4A6EA 1P6RA 5DCFA 3T5XA 1XSXA 2JZYA 2V6CA 1C0AA 1H4QA 3LA2A 4KYWA 4L87A 2GZWA 4XU2A 1SD6A 4LGWA 3ICAA 3B73A 2IY5B 1YW7A 2DTRA 4M7DD 3ZMDA 1LNXA 1LEBA 2ZFWA 4NL3A 5DYMA 3QP6A 1KQ9A 3E5UA 1EH7A 2ELHA 3ECHA 1USSA 3GEZA 2FBKA 1ZG3A 5FLXZ 2PMEA 4WF2A 5GAMh 4XRFA 4M75E 5LJ5j 3GVAA 3VQYA 4WXHA 4A0ZA 3PCOA 3F8BA 4CO8A 4H2XA 3AHUA 3RGLA 2XAHA 2EA2A 3J80K 3R4KA 1WSUA 5JHUA 4YYEA 2ZZEA 2DO7A 3BJ6A 4TWAA 2DTOA 1HK9A 3RPQA 1TNTA 2QQBA 1K6OA 4HWRA 4HF2A 4XTVA 3JAMZ 4IRGA 4JBAA 1DP7P 4CHUA 4EMSA 4M72A 1EQRA 3MQ0A 5CAIA 4EV0A 4X9CA 1HSTA 2X4HA 5KVRA 3SWNA 2K57A 3GF2A 2DPDA 1IL2A 3GUDA 1QBJA 2QLZA 3BDUA 1HKTA 1X54A 3KFWX 2XTIA 4JRIA 1OYYA 4XLPF 4NQWA 5BPIA 1B4AA 5E8IA 3KLNA 4L0YB 4H2WA 4M7DG 4OU0A 3IRQA 1EH6A 1F1ZA 2QBYB 3WU0A 2Z5UA 4M78E 4EJUA 1SFUA 2QQ9A 2YX7A 3PQJA 4KR3A 2VC0A 5GAN8 1KQ0A 4EVIA 3TEHB 1SERA 1TH7A 5LJ3h 1EFWA 2EJRA 2M87A 4AH6A 2P4WA 2Z33A 3G73A 4HWPA 5EEHA 4UP7A 4KFCA 3MEXA 1IXSB 2FSWA 3DXJF 3FJPA 4YRFA 1HKSA 3R0AA 4JK1X 4WX9A 1YS6A 4TVAA 3WGHA 4KR2A 4A0XA 1U5TC 2ZT5A 3N97A 3DEUA 3LSQA 4O6JA 5BPDA 1CF7A 4S05A 4UUVA 3FB9A 3DQVC 4LK1F 4JUVA 2J3MA 4YRQA 4R1HA 2ZINA 3GZ6A 1H641 3EYIA 3W3SA 5L3BA 3RACA 1KU7A 4ZTZB 4BW9A 2C7IA 4BXUA 3E6BA 1LDKB 4J6YA 4FX4A 3L09A 4BHPA 1YO5C 5D5XB 2RHSB 1DDNA 1X55A 4M78B 1E24A 5J8CA 2G7UA 5HLHA 4A5NA 3WTYC 1BC8C 4P55A 5LJ5e 1J7KA 4EMKA 2QHVA 1FZPB 2DT5A 1G3YA 4AD9A 5L3EA 2ACJA 5GAOp 4KUMA 1G4DA 5GAMd 3KP7A 1MD0A 3QTCA 4OIQF 5JFRA 4C92E 4M7DF 2Q7HA 2CO5A 3HXXA 1LB2A 3MEYA 1IW7F 1HW5A 4YREA 4LK0F 1EV7A 2E7WA 1KYWA 3V7RA 1I81A 4PNOA 5FD5A 1GXPA 5ERIA 2ADUA 1QQIA 3NELA 1WNLA 3L9FA 1B34B 3TO7A 3P8TA 5HS9A 4GO1A 1TLHB 2QHSA 4D0PA 4EM1A 4XBFA 4KN4X 5D5VB 5GAMg 4H2TA 5DUKA 2P7CB 4PDKA 3OOPA 3WGIA 2EV5A 3A7RA 4ENMA 2J3LA 2LDUA 4BWAA 2AXLA 1JJCB 2GWRA 4P73A 1FX7A 2PEXA 2JT1A 4ENJA 4CH5A 5K5QA 3P8VA 3HSRA 3RESA 5GANh 4RB2C 4C8QB 5LEKA 5GMKj 2W57A 2XAFA 3A7AA 2VC1A 4KICA 2K4JA 3C18A 1SESA 2K86A 1FOKA 4HX7A 4TVWA 3IC7A 4LFUA 1B9NA 5DCMB 2CIMA 5GAN3 3A7UA 1U6GA 1XD7A 2A5YB 4XEOA 5ELOA 2ODRC 2JSCA 3FM5A 1I8FA 1W5SA 5CVRA 5HVQC 1R22A 4H0EA 3QPHA 4G9YA 1ATIA 3HRTA 3RIRA 1ZLKA 2OZUA 1C0WA 4YRIA 2A07F 2CJ9A 5CVJA 4PHCA 3RI4A 3C3WA 1I1GA 4MHGA 3WU1B 1R36A 1R23A 4DQ2A 2E1HA 1R58A 3U9GA 4WI1A 1B8AA 2Q2EA 2VC8A 1BI0A 3JB9D 1LVAA 4EX5A 2XIGA 3JB9I 4LLLA 4L9JA 1JHFA 4NL2A 5LJ3g 1I1SA 4I7HA 2HWVA 1U1SA 2DQRA 3R61A 3TKYA 2Z3YA 3JCMe 2F5EA 3C1DA 1QZZA 3JCMX 2Z99A 5FFZA 3JSPA 4YFXF 3VOEA 1MZBA 5H6QA 3NEMA 1H0MA 3E5XA 2QWWA 1SFXA 2CW0F 4N9IA 4ENNA 2M1BA 4M78D 3MAJA 3SZTA 4L9TA 1R00A 4UP9A 2HKOA 4AIHA 4J5YA 3HOTA 3RKYA 4M7DE 1GXQA 3TGNA 5L3GA 4RCCA 4MTDA 1YGBA 2OD5A 2GA2A 3R0JA 1ADJA 2COMA 3IL2A 3L4GB 3L7WA 3A74A 1PDNC 5F6FA 2LNBA 3JCMP 4M75C 2RNJA 2ZMEA 2CQKA 4UVBA 2CG4A 1XSDA 1HW2A 4P75C 3HYIA 1FWZA 2Y48A 4GYIA 4X9DA 4P9UA 3JB9G 3DPLC 3A31A 3P9KA 1ZGJA 2EV6A 4CDGA 3H3UA 3QO7A 3F8MA 1V4RA 4TV7A 2NAZA 4M7DA 4LMYA 3A5YA 3WTWC 2A3SA 1SFEA 2FMLA 1FYKA 4M77B 3Q5FA 1HW1A 5GAMf 4G84A 2DDZA 2UXXA 1W7PB 5GAOm 3IRRA 4M7AB 3TOAA 2DK5A 5C52B 4QWQA 1WYDA 4M78G 1D8JA 1S8NA 5GMKe 2HGCA 5F5WA 3TO6A 4CS4A 1SRYA 4MMLA 2HR3A 2A61A 4YRCA 1Z7UA 2V1DA 4CH3A 3WTZA 4M78C 4HT8A 4C8QD 5GANd 1ON2A 1SMTA 3JCMV 4Q6GA 3TQNA 2ZXJA 4WJ3M 1R5HA 2D2WA 4MQVA 1USYA 1H4TA 5C51B 1K79A 2XROA 1KQ2A 1MDMA 4F7UE 1ZAOA 5LBQA 3LA3A 3HFZB 1GHCA 4CZZA 2ZT7A 2CWEA 3VEPA 4C92D 1KOGA 2EAYA 1REPC 3RERA 2L3DA 3L2CA 1NJ8A 4M6YA 1WWXA 2P6TA 1RI7A 3IKLA 4Y17A 1J2XA 2F2EA 4M75F 4KA4A 2D1VA 4ASNA 3PZCA 2QENA 4RDXA 3FHZA 3W6KB 3M4GA 3GZ5A 3T1BA 4L18B 5GANg 1KU9A 4A12A 3E6CC 2ZR2A 1J0RA 3E9IA 2Y90A 3M4QA 4K88A 1IRFA 4UV9A 2GIVA 4LD5A 4KIGA 2PJPA 2RHQA 1YIOA 3JCMd 3INZA 4NOYA 4PGGA 1D3BB 1WKMA 3Q9VA 2XAQA 1XDUA 3JB9F 3F8NA 2AKWA 3LQQA 3LSSA 3RKWA 4C8QG 1X2GA 1PYSA 2OBPA 3JCMJ 1QO0D 1XCVA 2CJAA 2L02A 5LEJA 1T38A 3NRVA 2MLKA 2VE8A 3K1PA 3HXWA 3FF5A 5HDKA 1Z7MA 4EMHA 2M45A 2HQNA 2XHKA 3I53A 1O7LA 5GAOq 1J9IA 3PFIA 2DQLA 4C92G 3HY0A 1MJAA 1IAWA 2EV0A 1HQCA 4F7UB 4HLYA 5LGUA 2O6GE 5CVVA 4M78F 1VQZA 4HWOA 2FEZA 4ESJA 3CLOA 4M9XA 1YB3A 5E3IA 2H94A 1ON1A 5IT9K 1M8VA 4XTYA 1DPUA 1IUYA 2RD1A 1ZH5A 4Q15A 4C92C 4E51A 2JPCA 4G7ZF 5L3FA 2NNNA 3W6JB 2AS5F 3CDHA 3T8RA 2PN6A 3E6MA 1RIQA 2EL9A 4H2VA 2C8MA 2ZO4A 1ZARA 3O3KA 2HNIA 5LJ3j 4P73C 3COAC 4WXDA 3SXYA 1HSJA 3MWMA 2E7XA 4M77D 2QQAA 1IXCA 2GXBA 4R8HA 5TJJA 5IT3A 4XU0A 5HOOA 3FX3A 1F4KA 4M7AD 1K78B 4M71A 3V7CA 1S7OA 3BFMA 4YDQA 3LQRA 2Y0MA 4MEXF 1X3UA 3H92A 4XTUA 2ETHA 5A2QZ 1ZHFA 4XEMA 1Y0UA 3QP5A 4PJOB 5JVTA 3FMRA 4ZH4F 2UZKA 3F22A 4P3NA 2HYFA 2IVMA 1KU2A 4OP0A 4XSXF 4CYDA 3HSFA 3FXQA 1OPCA 1OYWA 5BOXA 1J5WA 2Q7EA 2DLLA 2W24A 2ZKZA 3RUXA 2EWNA 3ABTA 2DTIA 4DPGA 1BN5A 2KIMA 4HQEA 4L5IA 2ZTGA 5ICGA 1E17A 3NENA 2FBIA 2PI0A 1I4K1 1I27A 2QBYA 4XU3A 3M9AA 2M8EA 4QVDA 1ULYA 3R07A 4M77G 3JTGA 2OAZA 3QAHA 3TEHA 5GANf 2IT0A 2P5VA 1YW9A 4C92F 1MGTA 2ARUA 3CO7C 4M7AG 3WTUC 4N0BA 4YRNA 2PLYA 4M75A 5FD6A 3QU6A 2EFQA 5HDNA 5GAOr 3UGTA 3F6VA 4P75A 4ZYDA 1ZREA 1IN8A 2K4BA 3GFMA 2PFBA 4YRRA 4EGYA 4IJAA 1G3WA 4XTWA 4GGGA 1YTYA 1NNHA 1UHMA 5CVIA 5L3CA 3VODA 1SAXA 4KIFA 1E22A 4JRKA 5GAN6 1H4VB 2ZZGA 2DQ3A 3GWZA 3BPXA 1Z7NA 4M7DC 3V7SA 2ESNA 4IPAA 3J81K 4HF1A 5LRRA 2WTEA 2ZBKA 4HF0A 4BQAA 4RQFA 4M6XA 1QZYA 5LJ3e 4CH4A 1MJBA 3F23A 3ZQ7A 4M9SA 2ZXFA 3WTXC 4M78A 3IKMB 1QPMA 2EA4A 3HUGA 2J5PA 1GVJA 4TQFA 1LDJA 1PP8F 1FYFA 1FPQA 2ARTA 3RDIA 4H2SA 5BS6A 2ALYA 1KU3A 3GIBA 4ZYGA 1LNWA 3QUIA 2BEOA 2RC4A 3WTTC 2DXTA 1USYC 1A04A 3IKTA 2E5AA 5E1ZB 4PCQA 1U2WA 2KKOA 4L5JA 4K2EA 3HRIA 4M73A 4DNCA 3V8JA 4M77F 4Z2YA 4PJOD 4YPFA 2VN2A 2W25A 3KP4A 4G94A 5AIPA 5K5RA 2WC2A 1X56A 2Q0OA 2A68F 4RQEA 5H20A 2IW5A 2X0LA 4F7UG 2MLGA 4C8QE 3HOSA 2KIUA 3BWGA 3BDDA 1OMIA 2MBFA 5LJ5h 1TW3A 1KQ8A 4MQ9F 1L0OC 4UVAA 2MD5A 2YLBA 3HIFA 5CYVA 5LHIA 2YPRA 4TVAB 3RPUA 2MA3A 2FNAA 2EFWA 3V8LA 5ILSA 3I0TA 4UHTA 2EFOA 2FU4A 1P4WA 5BQTA 2O8XA 3WE3A 2VOPA 3HRKA 1CF7B 2CGPA 1E1OA 1TTYA 1TQPA 5JI6A 3WE2A 3MF2A 3KETA 2RVCA 1B70B 3G3ZA 3M8FA 2OQGA 4KT5C 5AIQA 5DV5A 2DXUA 5DCMA 2PMHA 4I2OA 2H27A 3GFLA 2OZ6A 1D8KA 5F64A 1O3SA 1FLIA 4C92A 4PJOG 4O2DA 3EDPA 2ZJ2A 1IN7A 2I4NA 4YRPA 1YS7A 2Q5IA 1LEAA 2Q5HA 1WPYA 2I2LA 4HYEA 4WK8F 2XAJA 3I4PA 4J15A 2QHUA 3L2ZA 3GX4X 1CGPA 1STZA 5FLXK 12ASA 3HFNA 5ELNA 2NNYA 3RF1A 4KNYA 5E1WA 1E1TA 1R1TA 4P3PA 2YX4A 5AONA 1O7FA 4J6WA 2M5WA 3BJAA 4MMKA 5GAN7 2CFXA 2IJLA 3SFZA 1N9RA 3I59A 2VE9A 2DVEA 3BJUA 3IWFA 3JAMK 4HV5A 3JB9J 1LYLA 3LC0A 1IN5A 1IN4A 1H9TA 4J6XA 4F7UF 2R7DA 4EJOA 2EJFA 3HHHA 3FWEA 1ZRFA 1N9SA 2KRFA 3FZVA 4XLNF 5DD4A 4LB5A 3SB2A 4M77E 4I0BA 3WQZA 4A0YA 4EJWA 2YHTA 1F9NA 3I7FA 1BIBA 3CTAA 1SD7A 2IRFG 1OYIA 3FM3A 3N4MA 2DU5A 4U7DA 4U7BA 3JCMh 5ILVA 5D5UB 1B76A 5IT9Z 4M7AE 4NCXA 1NJ2A 3JCMc 1O3RA 1ADYA 2DQ0A 1KA8A 5GAN5 2RV8A 2HTSA 1MGQA 5J8FA 4HVCA 3HTZA 4MGRA 2HKXA 2ISZA 4HLXA 4YRJA 3DPTA 3FXUA 2RKHA 1KMNA 4M77A 2YR2A 2O3FA 3A32A 1JRIA 4FT8A 3UH0A 4PJOF 5LJ5d 2A6HF 1T0FA 3ZMZA 1MJ9A 1AOYA 4YCWA 3REOA 3U1DA 3QHSA 5F1RA 1FY7A 5D6EA 4M9ZA 1J59A 1UB9A 1RUOA 3P9IA 2ZR3A 3QO3A 3BPVA 4HWSA 2P7VB 2PMUA 1EOVA 3ERED 1RZ4A 1YFHA 2FMYA 2BYVE 3RKXA 4EJTA 1XGMA 4LLGF 4EM2A 3TUPA 1MKMA 3LAJA 3ABUA 2B0LA 3JSOA 1YQAA 5LRSA 3IG2A 3HHGA 2YU3A 3HFZA 4KMUX 3BROA 5ICEA 5D8KB 3DSQA 3VQXA 2FB7A 1EIYB 1JGSA 4TTVA 5E1XA 1WRJA 4OOIA 2NYXA 3J80Z 3HXZA 1U8RA 4EMGA 2ZIMA 3ISPA 3CUOA 3H3ZA 3K1MA 5GMKh 4HWTA 3QU3A 4EQQA 2KJBA 1TNSA 1W4MA 4MNUA 2GXGA 2P0LA 3F8CA 3VB2A 2G7HA 4Q5SF 1G3SA 2UXNA 4P96A 1S29A 2PBIA 1S7AA 4O5VA 5E20A 1D3BA 2Q7GA 1X2HA 4FHTA 1B9MA 4PG3A 4OIRF 1UCRA 3JCMb 2WV0A 2E64A 3LFKA 4PGHA 4KDPA 2E1NA 4LG0B 2RQPA 3QRFF 1KGSA 2VXFA 2DBBA 5HDGA 2G4CA 1YFSA 4HBLA 3ULQB 5FGMA 4ETSA 2FBHA 4XQ3A 1FBQA 5C53B 3E9HA 5K1XA 5GMKl 4CS3A 2BBYA 2P5IA 1G51A 1NJ6A 1Y96B 4F7UA 5GAMj 5J6XA 1BBYA 2W84A 3ROUA 2QUFA 3KEQA 4HX8A 1I5LA 1HBXG 3J81Z 2O61A 1BI1A 4P71A 4YP0A 1U5TB 4Y91A 2CGHA 3FMQA 2QM3A 5HGQA 1XN7A 2RB6A 2DTHA 3GW2A 1BI3A 1M5Q1 3V4GA 4PJOE 3RJPA 1R7JA 4WWCA 3SHFA 4Y13A 4O3MA 3Q9SA 1MDMB 5DDGA 5GAN2 3AAFA 2ZCWA 2VBZA 4HT9A 2XV4S 2DI3A 2E41A 4C8QC 3ZP5A 2FQ3A 1FBUA 4CGZA 2DKGA 2MC3A 2VODA 1U3EM 1BIAA 3JCMg 4PJOA 3TO9A 1YCYA 2A69F 2ESHA 3QO5A 4IRHA 5GAN4 1BBWA 3F21A 4MEYF 5HS8A 5D4RA 2IPQX 2IY5A 2ARSA 2PMFA 1WLEA 3BY6A 2VXEA 1USTA 3KP3A 4P5OA 3HRUA 5CJ9A 4BHBA 1NYQA 5LJ5f 3CUQB 2CSOA 2V79A 3NQOA 2J5OA 2F5CA 2V1UA 2OQRA 3KP6A 2MH9A 1W7PD 3K9TA 4N0AC 2NS0A 3HXVA 3K2ZA 1PYSB
chains in the Genus database with same CATH superfamily
3LGFA 2HKQB 4PFZA 3S2HJ 2KT0A 2RN7A 2P6SA 2R7VA 3QZ9B 1FYNA 2RDPA 5CQGA 1J5YA 1YNZA 2E65A 4S04A 2DL4A 3MZ8A 3PIPA 2F5FA 4EM0B 3GTLJ 1H8KA 3CMEQ 1D5VA 2H6CA 2K6DA 2FA5A 2VBXA 3VQVA 1U78A 1MMNA 4G7HF 2L7ZA 4C3JJ 4AIDA 4CCMA 3CPWP 2GM4A 5LLQA 3QSUA 4RS8A 3LA7A 5ICFA 2D9TA 1D3YA 2WAFA 3CD6I 2E35A 1FOWA 2P5KA 2A05A 1BYMA 2BHZA 4YCVA 4K87A 2XHCA 3SHWA 2XC7A 2XGXA 2XB5A 2VI6A 4BXFA 5FRMA 5E3LA 2CP2A 3OMGA 1D0YA 4AVPA 4I6ZA 1S72I 4K11A 2IPOB 2XASA 4D6WA 5CKBA 4EDUA 2RHZA 4ZGDB 2JTFA 3CCST 2KRNA 4RCBA 1Z1DA 2H6BA 3E97A 2ED0A 5FKLA 4RAZA 2JRMA 3B6CA 3JCMf 1IZ1A 2JS2A 2YXYA 2V9KA 3TEGA 2PZ1A 4QPQA 4YROA 5GANj 4M75B 4A6DA 4V2SA 2DPUA 2XRNA 2NUZA 1NE8A 1VZ0A 1X1PA 1B8IB 4DBQA 4OB2B 1SVOA 2ZPHB 2HZDA 1T08B 2QI2A 3CC7I 4OINF 3UKGA 2B8AA 2O0YA 4NDLA 3V8KA 2PG4A 4YRKA 3ZMTA 2IG0A 2M34A 5HS7A 1IRXA 3QPSA 4LDUA 1FBSA 2YLCA 3UWNA 4IL6C 2WY8Q 2R7QA 3IAM2 2EK5A 3HL2A 3HKSA 2L3RA 4U0YA 1Y1VJ 4OF1A 5HK0A 5K5OA 4I0AA 2V8JA 3OYDA 1R4NB 1JXSA 2DD4A 2DU9A 5D6YA 3LNQA 1GUUA 2DRMA 1Y7XA 3VYSB 3OSSC 1KIKA 2QQ8A 3BC8A 3CUQC 3HP9A 1ZQ1A 2E3CA 4U87A 4Q48A 5KK1A 4AG1C 2A6EF 2ECBA 3KEOA 2DA5A 2CH0A 2R5AA 2NRAC 2E36A 1TWBA 4C5HA 1KD1R 4YIIA 2QHTA 3AG3H 1A31A 1FYMA 3QWYA 2ZCEA 1XDSA 2I4LA 1GCQC 3TL4X 5FWCA 1LQ1A 3LL7A 4ON0A 5GANe 2HQ5A 3IQLA 1SRMA 1EA3A 5D8LB 2XF7A 1OJLA 3EUHA 3TW6A 2QCOA 1UTIA 2ZIOA 1EF4A 3CCQI 4E7JA 3EETA 4OMNA 2VQGA 1T39A 3VUBA 2Y9ZA 1EH8A 2HZTA 1M1GA 4KQEA 2VPLA 4C92B 5JLXA 4HW0A 3HOVJ 3KZZA 2DD5A 3OSFA 4F93B 2D45A 2EBIA 1N8RR 3CPWS 4UXNA 4G85A 2MH2A 4PJ0C 4EEFG 5DD8A 2EB7A 5LGNA 3HFVA 2XIDA 4J9CA 2VL8A 2DXCA 1FMWA 2EFPA 2L54A 4RB3C 2RHIA 4AFZC 4FQGA 5K1YA 1W7PA 5GMKm 1YFTA 1YJNQ 4II3A 2VLAA 1BW6A 4OGCA 1SSHA 4Y15A 2VT2A 3QG1A 4M75G 2HQEA 2K27A 1TTHB 3VU3C 1ZUUA 1LOJA 3K1NA 5LHGA 1YI2Q 2EQKA 4L9NA 4HX4A 3MCZA 2UUZA 3ZMSA 2BE7D 1ZQ3P 3EYYA 1O3TA 1UHWA 2NVXJ 4CSWA 1K4SA 1TUGB 1M30A 1OOTA 4TVRA 4G8XA 3KE2A 2W10A 4A3DJ 1ASYA 3DFGA 2DEQA 3IUOA 4MFEA 4RTYA 2O31A 4UB6C 3TW7A 2HKNA 3CCEQ 5KYNA 5KNNA 3RPUD 4DW6A 4RKUE 1OYXA 1L0WA 1ZSZA 2M0YA 4DZJA 5E79C 5DUIA 4FX0A 1KG1A 3CMQA 2KEAA 1TQMA 2J06A 1M3AA 3BG6A 4LVLA 4M7DB 4OIOF 4L6V5 3UDCA 2VQLA 1AVZC 3NARA 2JT4A 3ABKH 4BXXJ 3S15J 3CCSI 4P74C 3FKIJ 1U1TA 2L9RA 3WHCA 2XDBA 2M9HA 2JA5J 3CXCP 1Q82C 2Z9OA 3GTOJ 1QVTA 1U9OA 2X48A 3CCSQ 1NJ5A 2CW7A 2FPFA 1RAHB 5FU7B 2F6CA 3VQWA 4AIKA 1LFPA 2XKOA 3BE3A 4KGXB 2OF7A 4EMKC 5HLGA 2H1LA 4WXCA 1GCPA 4XOPA 3M0TA 4X5OA 3OA6A 2Y9YA 1NYRA 3G4ST 3M07A 2OI3A 3VS3A 5LD2C 1NG2A 1EKEA 3TEEA 1SKUB 3CDIA 1VQ4T 1ZYRF 4IKFA 2DFIA 1MW7A 1R5ID 2AMCA 1XCBA 3G7ZA 1JXOA 1JI8A 3BR3A 3GNFB 4B43A 3A2KA 2LKPA 1UDLA 2K3XA 2ZSIB 1FP1D 4OMFB 3AL0C 4LJZF 2CYYA 3I55Q 5KE2A 4B09A 1PWTA 2DL7A 4PFOA 2B9SA 5ILUA 4N4IA 3WTVC 2O03A 1X4OA 2HSEB 1APLC 2IVWA 3LWFA 1YJWQ 1FSEA 2STTA 2KRSA 3ZEHA 1FNNA 3NAUA 5M3FJ 1WHLA 4XIDA 5B1AH 3LA2A 2GZWA 4FW1A 1SD6A 2JVHA 3HKZN 3QP6A 1PSEA 1USSA 3G1LA 3DBLB 3GVAA 1YIJA 4WXHA 3ZL7C 5DS9A 3REAB 2F2WA 1JQQA 4CO8A 3AHUA 2QEXT 3MP8A 2XF5A 3EGXA 2QKMB 2DTOA 3OYYA 1Y8QB 3MO8A 1PJRA 4HF2A 4MZTA 3DBHB 2GFUA 2M7BA 1MV3A 1M1KU 5FW9A 5B66C 2K57A 2DDAA 4BJ5C 3GF2A 2DPDA 4R56A 1QBJA 4XORA 1HKTA 2VXDA 4JRIA 1U0JA 4RMOA 4RG8A 4NQWA 2LRDA 1Y39A 1B4AA 3KLNA 4M7DG 1EH6A 2QBYB 2AZSA 2YX7A 2KAFA 2VC0A 3S6WA 3TEHB 1SERA 1TH7A 4F91B 3BR5A 1PVEA 4KFCA 3FJPA 1HKSA 5IHNA 2NXNB 1SANA 3X20B 4C3IJ 2L0AA 3PNWC 2L9VA 1FTTA 3CESA 1GT0C 2M51A 1QVFP 5IAYA 5BPDA 1T56A 4BBSJ 2B86A 4LK1F 4JUVA 3MD2A 4R1HA 1H641 3W3SA 1Q81C 1SRLA 4ZTZB 2C7IA 1M2VB 4J7IA 3CXCS 4BHPA 1YO5C 3O8HA 2RHSB 5J8CA 1VQ9A 3M1CA 2G7UA 2DPPB 3C2HA 2CT4A 4AD9A 5FROA 5GAMd 2EH3A 3KP7A 2JSPA 1MD0A 2O2OA 4OIQF 5JFRA 1VQ6Q 3VYHB 2Q7HA 3CBPA 2ZXHA 3MEYA 1IW7F 2DILA 1EV7A 3CCVA 3G6EA 4BY1J 2HNHA 5FD5A 2DODA 2K2VA 2J6KA 2LT4A 3NELA 3L9FA 3TO7A 2VB6A 5HS9A 1WJCA 1Q86R 4IHWA 4GO1A 1XOVA 4D0PA 4KN4X 5D5VB 5DUKA 2P7CB 4PDKA 3RQIA 3OOPA 3WGIA 3A7RA 4ENMA 1OCPA 2J3LA 4WTOB 2AXLA 1JJCB 2GWRA 4P73A 3S1NJ 1ABOA 1WZOA 4Y33A 2VASA 2JT1A 1Z3YA 2KT8A 4CH5A 2OTLT 2QSHX 5I22A 5GANh 2LJ0A 5LEKA 5GMKj 1EJ9A 4XN3A 3TVTA 4Z6YA 4M4ZA 3C18A 2DT6A 3FK7A 5L8RE 2HXOA 1T0JA 2QQRA 3A7UA 3E9GA 4LVJA 1XNIA 2HDWA 2ZJRF 2VQCA 1XD7A 1OR7C 5CVRA 1ZX6A 2EIJH 1R22A 3EFOB 1ATIA 4RAFA 1C0WA 3G4SI 4P1WA 4YRIA 2A07F 3BZCA 2F4IA 5CVJA 3C3WA 3BTJA 2WB1A 1VQ4I 4JRQA 1GXIE 2XIGA 3JB9I 4LLLA 4NL2A 4I7HA 4J8OA 3W6VA 4CC2A 2GGRA 1QZZA 5KYUB 1I07A 1UE9A 1VQ4Q 4UUSA 2KDSA 4BE2A 2LBFB 3JSPA 4YFXF 3VOEA 2DDBA 3JRIA 4N9IA 1IXDA 3PTAA 4IIOA 2GOXB 1KC8U 4UP9A 2HKOA 4AIHA 4J5YA 2RREA 3TGNA 4RCCA 2GA2A 2O4XB 5HKCA 1ADJA 3L7WA 2LNBA 3G1OA 3DEEA 5B1BH 1UB4A 3S17J 3LX7A 2CG4A 3HYIA 4II2A 1NLPC 2CH4W 3DPLC 3P9KA 2QSFX 1HD3A 4TV7A 2NAZA 3D5SC 3WTWC 1SFEA 2PVGB 1FYKA 3ESWB 5GAMf 4VUBA 4J9GA 3S3MA 4AFSC 3H3VK 2C0IA 1D8JA 2QEXI 3VS7A 1Z3XA 5GMKe 3TO6A 1SRYA 2V1DA 3MKZA 2OUMA 2WV1A 4PSWA 2D2WA 1H4TA 1K79A 1MDMA 2H3EB 4KRTA 1C0MA 1ZAOA 1QZEA 1SVLA 4NC6A 3WHBA 3RERA 3K2AA 2L3DA 4IHVA 4V2GA 3CPFA 2R7XA 3IH3A 4OMLA 4M6YA 1RI7A 2KROA 2COBA 2ZSHB 4ASNA 3PZCA 2QENA 2KNBB 1Q82R 4D7NA 3M4GA 5EG0B 4A12A 3VKIA 1VQ5T 2E5NA 3KXTA 1VQNA 4UV9A 1G2BA 4PKCC 3HEFA 2GIVA 4KIGA 2RHQA 1YIOA 5EZGA 3INZA 2DIGA 4OMOA 4PGGA 5J3LA 3VS2A 2YT6A 1XDUA 4Q5WA 1VQMT 3JB9F 1HF0A 2CJJA 3LQQA 2RJFA 3PL8A 2RHYA 3M5AA 3DBRB 2VE8A 3FF5A 5M5YJ 4C30A 4HKEA 3HY0A 4AM3A 1IAWA 2EV0A 2DL8A 4M78F 4ESJA 4M9XA 2GTOA 1D0ZA 1M8VA 2KQWA 4E51A 2JPCA 4G7ZF 2NNNA 3E6MA 2EL9A 2AQFA 1ZARA 2DXIA 4WXDA 3A4CA 3H5AA 2E7XA 3I3LA 3JREA 2DT7B 4M77D 3C95A 4OB3B 3H0DA 3HG9A 4XU0A 4CC7A 1PD1A 3FX3A 4M7AD 2PVOB 4YDQA 2LCCA 4V19K 1XJWB 2ETHA 1W36D 2AQEA 4XEMA 4PJOB 3I4NJ 4NC8A 4CZCA 3NTIA 2IVMA 1KU2A 4OP0A 4CYDA 3HSFA 2ZJQF 4CYCB 1PKSA 1CKAA 1OYWA 3EG9B 2E6ZA 1J5WA 4ZGEB 2X6OA 2ZKZA 2EWNA 2QG9B 2DTIA 2DN0A 4DPGA 4HQEA 4HNVA 2OTJT 3OW2P 1EZZB 1W2BS 3O8VA 3R07A 2OTLI 2EIMH 2JWTA 1WA7A 4PJJA 1Q7YR 2CQNA 2LY1A 3A5ZB 3CO7C 1OULA 2HD0A 1OU8A 4M75A 1AWXA 2GOMA 2RF0A 2PUOB 1OLTA 4YRRA 1AHDP 3QYHB 1W36C 4XTWA 3PUBA 4HG2A 1UHMA 2H8HA 1E22A 2YDLA 3BG5A 4E7ZA 4NNJA 2ZZGA 2KYBA 4IPAA 3M4OJ 5I11A 5LRRA 4C5IA 3BR0A 4HF0A 4BQAA 4M6XA 1KD1U 2RQRA 4YRVA 3ZQ7A 4JX4A 3OS5A 3IKMB 2JQ7A 3HUGA 1K4US 3D5RC 5KE3A 4PSXA 1FPQA 1T3LA 2KZVA 3S3OA 2AKLA 2DM1A 2E3HA 1LNWA 3QUIA 2CUJA 1V5EA 1PG5B 2ESWA 3ZQQA 3BT9A 4K2EA 1Q81R 4LVMA 4Z2YA 1KQSA 2W25A 3KP4A 1P7IA 1M27C 5AIPA 2Q0OA 2R5YB 3GP8A 1TWHJ 3HOSA 5F04A 2MBFA 1ZHIA 1N8RU 1K0SA 3G1MA 2FRYA 2NVYJ 3L2QA 5LHIA 4TVAB 2MA3A 2FNAA 2NOJB 3OYBA 1I50J 5ILSA 3HPWA 3M9QA 1P4WA 1AZEA 2VOPA 1TXQA 2VJJA 1E1OA 1TTYA 4X0GA 3KETA 1S1NA 2TRTA 4KT5C 2EINH 2PMHA 4I2OA 2E2JJ 2H27A 3VRYA 4LD9K 5F64A 1O3SA 4C92A 3PM1A 4PJOG 3FBIB 3CP8A 2Q5IA 2JUGA 3CCUA 1JJ6C 3I4PA 4B3AA 3L2ZA 1UGRB 3GX4X 1CGPA 4X34A 1IHVA 2JMAA 1N6AA 2LCLA 5KAIC 5EYRA 1E1TA 5GTIC 3OL4A 1VQ5I 2M5WA 4MMKA 5GAN7 2CFXA 2RQTA 1WHGA 4BY7J 3GTGJ 3SFZA 1N9RA 1VQMI 2VE9A 2DVEA 3BJUA 3DWLE 4LG3A 1R0CB 1SSFA 1IN5A 1IN4A 5KYXA 2KVQG 4BDYA 1YIJQ 3CMAA 1JTYA 4EJOA 1VQKA 3HHHA 3FWEA 3A02A 4I0BA 5IXFA 2RO0A 1BIBA 2JMWA 4A4KA 2IRFG 4XKCA 2DU5A 3OR2C 5ILVA 1UGVA 5IT9Z 4NCXA 3JCMc 3OBYA 1OCRH 1QMCA 5J3BA 1ADYA 4Y7NJ 3OW2S 2LVSA 1MGQA 4HVCA 3OYCA 1OZ3A 3FXOA 4YRJA 3DPTA 1JKPC 3A32A 1JRIA 1IRZA 3UH0A 5LJ5d 3SEMA 1AOYA 3OYNA 3U1DA 3OSGA 3VV0A 5D6EA 5F0CA 4M9ZA 1J59A 3P9IA 2HL5C 1SPKA 3ERED 1JJ2A 2FL7A 4OAYA 4ATOA 1XGMA 3FRNA 3ABUA 1GDTA 4B3XA 5LRSA 3IG2A 3HHGA 2YU3A 5IYCJ 3SFMA 4HNUA 1UG2A 2FB7A 4E6RA 1X1AA 4F52A 2YWWA 1EIYB 4XLCA 2BZTA 1VA7A 2O9VA 1WRJA 3DKYA 2MFZA 2NYXA 2GNCA 3HXZA 1G8XA 1U8RA 4OB0B 2K2MA 3K1MA 5GMKh 4HWTA 2KJBA 3D7SB 4BI3A 1W4MA 4BU2A 4DEXA 2ME6A 1TWCJ 4KGVB 1S9HA 2PBIA 5K7ZA 1VQ9Q 4XL9A 4O5VA 5HY6A 3IH2A 4FHTA 1B9MA 2WV0A 2E64A 2RQPA 3W2WA 2V6EA 2VXFA 4IO9F 2QQSA 3ULQB 1VQOT 5FGMA 2WB1N 3MN2A 2FBHA 4DOZA 5C53B 5C44J 5K1XA 3UR3C 2P5IA 1Y96B 4F7UA 3CCVQ 3G6EQ 5J6XA 4HXJA 1U5TB 3U21A 1FXXA 2I5UA 1MNEA 2RB6A 2DTHA 5EGOA 4WWCA 2NVUB 2NUPB 3AAFA 3A0HC 2X9DA 4Z02A 2OC6A 2JK3A 1FBUA 2OCCH 4CGZA 1X2KA 2L3SA 1UFFA 2MC3A 1U3EM 2F1LA 2RI2A 4MEYF 3EG0A 5GPCA 2KR3A 2IPQX 1Z9ZA 1GCQA 1USTA 2A7YA 3HRUA 4BHBA 1VQLA 5LJ5f 3CUQB 2DX1A 1JJ8C 2F5CA 3KP6A 1W7PD 2M7AA 1HCRA 1DGWY 2H3JA 3K2ZA 1Z6RA 5KYWA 1NK3P 1G5HA 2HTJA 3SEQA 3DF8A 4HOBA 3EUHC 2IA0A 3FISA 1ZR4A 4EJVA 3IAS2 4LUDA 4UNOA 3QNEA 3X26B 1F1BB 1BL0A 5K7HA 4BE0A 2HYGD 3KZYA 1WXTA 2CZ7B 4XK4A 4HAMA 2A36A 2RGVA 1VQ7A 3E7LA 2HSPA 3TDUC 5EEGA 3JB9H 1Z91A 2XDVA 1K73C 3CF5F 2TCTA 4KULA 4HZFA 1UUEA 2IGNA 2X9HA 2VKDA 1JXMA 2YUNA 2ABLA 4L0ZB 1H9GA 2R7FA 1Y8RB 3CO6C 2RH2A 1E0EA 1J75A 4I02A 3LAPA 1WU7A 3NEUA 1XSVA 1NHAA 1FP2A 3CQTA 4S0HB 3PCOB 1R0BG 4IXAA 3OD1A 2I4MA 5LGTA 1IRGA 3CCRT 1M2VA 1RNLA 1V54H 1WHUA 3WODF 1OFCX 4ESRA 3GBGA 1IREB 5L23A 1X1CA 3DKWA 2RHSA 3KFVA 3FIFA 4RB1A 4RTWA 6AT1B 2L7FP 4C9YA 3MEWA 2CU7A 3E3VA 1Z77A 4ZZLA 1QCNA 3CC2I 3J81E 1AKHB 2VKNA 3JRZA 2FG0A 2CP6A 2LKSA 4YFKF 1RABB 4G7OF 3A8MB 2F48A 3CC2Q 4U88A 1NJIC 4P74A 3ECOA 4RMFA 2VJIA 3OWTA 1G3TA 4M7AF 2LC4A 4PLIA 1JU5C 2KJCA 5HLIA 3P8HA 1IV8A 4XTZA 3RDVA 3JW4A 4Q47A 2RA2A 1ZN2A 2KRMA 2L4AA 4N9HA 2DJQA 4OMYA 2DMPA 2DU7A 4P71C 1JJCA 5DEQA 1KQ1A 1SD5A 3T8TA 2ALYB 3H36A 2HQAA 1M4ZA 2AHQA 2HFHA 3JCMW 2M2EA 2X1DA 4GY5A 2ODRD 4KMFA 3I54A 3DU6A 1T98A 2XKOC 2I4OA 2P8TA 5A2QK 2AO9A 1UJ0A 4L59A 3MEVA 3PQKA 4KH1B 2NOGA 2COWA 2VT3A 4D8DA 4JP0A 1VQOI 4YFNF 5A0GA 4EMKB 5FRNA 2MCNA 3K0LA 1R1UA 1PSFA 1KK7A 3CC4T 1GV2A 2MG4A 2JJ7A 3WVDB 4N0AA 3BCBA 1MUZA 1I6XA 4R79A 3MF1A 1G5IA 1FT9A 4WCGA 5KYUA 3BW1A 2HXIA 1HA8A 1VQOQ 2BW3A 3HTSB 1O57A 1B59A 4P5NA 2QF7A 1RIOH 4B44A 5LJ3d 1WQ7A 4H2UA 1X4PA 4YRLA 3NWTA 3OMCA 2HQRA 2DNUA 1IN6A 1TW2A 1WQ2A 5FU6C 1MBEA 2ECCA 2BIVA 2VKHA 2ZFUA 4Z89A 1FSHA 2E4HA 1K7AA 2R7OA 1BU1A 2QYZA 4MDXA 3DLMA 2ME0A 2HOSA 1Z9CA 4QQGA 2XGTA 2XPVA 5CVUA 1P4AA 2JNGA 1T2KA 4E70A 4I01A 2QGUA 3NMZC 5EZHA 2PJRB 1QW1A 4A54A 1JHHA 3I58A 4CCOA 4OMMA 2X35A 2MI6A 3M4PA 1F5TA 4LNSA 3BDLA 1NZ9A 3WXMB 1TWAJ 2WWYA 4YRSA 3EQLF 1VYUA 1YOVB 3TQ7P 1Q82U 3QXEB 1SMYF 1VI0A 2L2PA 1N9WA 3RTRA 4GRIA 2DW4A 5JR3A 1RKTA 1QVGA 1XQHA 2A28A 4XU1A 2JVGA 3BJOA 1WQWA 3MMYB 4FW2A 3KUFA 3G1ZA 4C0DC 2IIMA 5D5WB 5LJ5g 1H4SA 4LG0A 3C7JA 3J7AY 2OU2A 1WHMA 3F6OA 3MVPA 2Q8KA 1RUNA 2FYKA 3HRMA 2LQKA 3H5RA 3CD6A 2W48A 1HTTA 1Y0NA 4I09A 1A6QA 5EG0A 1RADB 1EVLA 1VUBA 1L3LA 1ONVA 5IP6A 4RB0A 2ZB9A 2HVRA 1W6XA 4A3BJ 1NEGA 5FKMA 1IXRC 2VQHA 2E1OA 4YRGA 1S72A 4DZPA 2DA3A 1W5TA 1IB8A 2HPIA 3M7GA 2CFOA 3TOBA 5IYBJ 1QPIA 3HL8A 3GXOA 4GCVA 4AYBA 4F7ZA 8ATCB 4AMCA 3NGPA 3ZFJA 4B8XA 4UP8A 2KIFA 2ZGWA 1X27A 2XKPA 1RR7A 3CCRI 2HQHA 2LMDA 5A0LA 1VTNC 2HS5A 1AT1B 2RM4A 9ANTA 4CH6A 5LJ3f 4BNCA 3U2RA 3CMYA 3EFSA 4UV8A 3ZQGA 3QPLA 4PL6A 2H09A 3D5LA 2PNIA 4HVVA 1XGOA 3H0FA 4QVCA 3BZKA 4B4CA 1WJ5A 4PZJA 3GFIA 2L3QA 3LSKA 4YG2F 2NLUA 3CC7A 3FMSA 5FLVA 2WSCE 3CMMA 3I71A 1O3QA 2ZXWH 2LR8A 3P8YA 3QQAA 1WFWA 1JUMA 2HEOA 4XLEA 1HC7A 4GXOA 5DM7R 3SQNA 3CMAI 4LB6B 4QLCU 5ED4A 1K9AA 2W0ZA 3EGDB 3JRAA 1B7YA 1MNMC 2CREA 4CYCA 2G3RA 2QYOA 1FEXA 1T95A 3EG9A 2L2OA 3K4BA 3KPHA 2IA2A 1K6YA 1TBXA 1NG7A 4ESBA 3CPWA 3CMAQ 1IGNA 1VQKQ 3TREA 3RMSA 2A0FB 4XKVA 2L01A 2V1XA 2MIOA 3CCLT 1X58A 3VYRB 4ESFA 2YUOA 1OR7A 3IKVA 3HTUA 2R7RA 2DJZA 3KEYA 3FBNB 3BQYA 4OIPF 3F8FA 1UFMA 2RAEA 1PKTA 4JLIA 1OKRA 2RK1A 3QBYA 2O9LA 3LSIA 2K9MA 5DCFA 2V6CA 4E4HA 4XU2A 4LGWA 3ICAA 3M54A 3B73A 2D5VA 2EW3A 1KQ9A 2RQQA 3E5UA 3ZQFA 2ELHA 3ECHA 2WADA 3PMTA 3JV3A 1NG6A 3CC4I 1Q81U 4XRFA 4M75E 4EPCA 2GIZA 3F8BA 2EYQA 3RGLA 4H2XA 1K73R 3J80K 3R4KA 1WSUA 1IUFA 2DO7A 3BJ6A 2ZZDA 3CCQA 2QQBA 1K6OA 4ABZA 3C12A 2ELJA 4CHUA 3GTQJ 4C2MJ 1TU0B 2FUG2 3MQ0A 2RNAA 1I0CA 1HSTA 1VQPA 2X4HA 5KVRA 3SWNA 1OI1A 1LFBA 3K70D 4GDFA 1IL2A 2RJEA 3BDUA 2K79A 3MCAB 1X54A 2KRCA 2EPFA 3NTHA 5EF6A 2GFAA 1SFKA 5BPIA 4OU0A 3IRQA 4R55A 4A4EA 3WU0A 4LDXA 4EJUA 5GAN8 1KQ0A 4EVIA 1FMVA 2M87A 2E1MC 1QKXA 2K9QA 5KHDA 1D5YA 3MEXA 2FSWA 1GFCA 1XG1A 3R0AA 4JK1X 3H9QA 4TVAA 4A0XA 2KXCA 3N97A 3DEUA 3LSQA 1WGSA 5J1YA 4UUVA 3FB9A 1YJ9T 2J3MA 2VUMJ 4HEA2 2ZINA 3FXKA 3GZ6A 3EYIA 2O88A 1NJIR 2BUDA 1TOVA 1QP2A 4BW9A 1XTDA 1LDKB 3NFCA 3H0GJ 4FX4A 3H0HA 2H8WA 4XK8E 4IUPA 4LIUA 1K61A 4ZC3A 1E24A 2DA9A 4P55A 3UA7A 3HHTB 2QHVA 1G3YA 1XPXA 2ACJA 4JRPA 5E3MA 4KUMA 4HCZA 1NM7A 1MMDA 1D1BA 4C92E 1AWWA 4M7DF 3EAEA 3TCJA 4J9HA 4LK0F 2M8GX 1I81A 4PNOA 2KMUA 2ROTA 2ZC2A 3CCSA 3OYEA 1WNLA 3P8TA 2CRGA 1HLVA 1B34B 4I76A 1E7OA 1TLHB 2AZVA 2VKEA 1RL2A 3FK6A 4H2TA 2RHUA 3TSWA 3DEWA 1YHQI 3RBBB 3VJPA 4BWAA 5J4VA 2FQ4A 3HSRA 2X6WA 4PJNA 2XAFA 3A7AA 3A01B 5CCAA 5C4XJ 4B1RA 1SESA 2K86A 1YHQQ 4HX7A 2GXAA 2CIMA 1VQ7Q 3ZQHA 2MWOA 2A5YB 2CUZA 4BEHB 4H0EA 3QPHA 4G9YA 3RIRA 1ZLKA 2OZUA 3ZR8X 2CMPA 3PMIA 4PHCA 1I39A 5GAHJ 2HCKA 2LH9A 3L42A 2WAQA 4DQ2A 3U9GA 4WI1A 2Q2EA 2VC8A 2EQMA 5LJ3g 1I1SA 3DB4A 2HWVA 3TKYA 2F5EA 1TS9A 3L2VA 2A08A 2CS7A 1VQNT 2VVKA 5J40A 5JHFA 4IOCF 4AT1B 1MZBA 3NEMA 1IDZA 2VPRA 3MHXA 4ENNA 2M1BA 1VYTA 3CCLI 4L9TA 1BA5A 4RBOA 4PK4A 5FKNA 3HOTA 4M7DE 1GXQA 5L3GA 5E3NA 2OD5A 2D1XA 3R0JA 2MW8A 1RAEB 1QWEA 3L4GB 5F6FA 3JRFA 2D0QB 3JCMP 4M75C 4RM2A 2RNJA 2ZMEA 2X3XD 3M57A 4UVBA 4A3CJ 3BLYA 3TP3A 1ZGJA 4ELZC 4CDGA 3QO7A 1WJDA 3DLAA 4AG2C 3KZIC 5F0HA 1W1FA 4CCNA 3KYLA 3GOXA 4M77B 3Q5FA 2DDZA 3TEDA 4KUIA 2OX7A 4M7AB 2JOYA 3TOAA 4QWQA 2CUEA 3OR1C 5GJWB 1PRLC 1S8NA 2K9GA 4MMLA 2HR3A 4KBMB 1BCOA 2R93J 3HM5A 3Q0UA 1MBFA 3WTZA 4HT8A 4C8QD 5GANd 3JCMV 2LQNA 2XROA 2R0QC 2NUPA 1V76A 3OYHA 4E6KG 4F7UE 4XKWA 2P81A 1WXUA 2QGGA 2ZT7A 3VEPA 4C92D 1YRNA 2BKDN 1REPC 1NJ8A 3M58A 2CT3A 1WWXA 4YELA 4BJ6C 3UATA 3VS0A 1EX4A 3FHZA 3W6KB 3GZ5A 3T1BA 1KU9A 2ZR2A 1J0RA 3M4QA 2MWPA 1IRFA 2AXTC 4JYKA 2PJPA 3JCMd 3OIOA 4NOYA 1AWJA 5EG2A 2K5LA 1FTZA 3F8NA 2AKWA 2KPMA 2KIQA 3JCMJ 4E7LA 2HDDA 2LYCA 1WYXA 2XPUA 5D6XA 3HXWA 5HDKA 1Z7MA 2MPXC 1XX5A 4GFBA 1YJ9I 1J9IA 3PFIA 4XM3A 4FE4A 5LGUA 5CVVA 4HWOA 2FEZA 1YB3A 1BR1A 1ON1A 2GQVA 4C92C 5KYYB 5L3FA 3W6JB 3QJYA 1RIQA 1ETVA 4H2VA 4E7SA 2JTEA 2ZO4A 2HNIA 1POGA 3URGA 5K7FA 2GXBA 3OYMA 4HRIA 1SEMA 5HOOA 3PVQA 4FYXB 1R71A 1F4KA 3BR1A 2HQXA 3JRCA 1S7OA 3BFMA 3LQRA 5IP7J 4N4NB 2QK0A 3I56T 3H92A 4XTUA 5A2QZ 3FMRA 4ZH4F 3P5JA 4XRSG 2UZKA 2Y4YA 1V55H 3F22A 4CCLA 2DL5A 3P8BB 3V42A 3FXQA 1K0XA 2EIFA 1RUWA 3A8GB 2V4JC 2BXZA 4AYBN 1M1EB 3M8JA 1MBHA 1BN5A 1S5LC 3DU5A 4L5IA 2ZTGA 2FBIA 2PI0A 1I4K1 1I27A 1UGSB 3PSIA 2M8EA 2HOAA 1ULYA 4M77G 3JTGA 5GANf 2IT0A 1YW9A 4JX5A 1MGTA 2JM9A 5HLTA 2MABA 4MDWA 3WTUC 4M7AG 1X1DA 4YRNA 2G6FX 5FD6A 2EFQA 5HDNA 1X2QA 1V5FA 3UGTA 4IUTA 3G4SA 3CD6Q 4M3DA 5LL6S 2PFBA 1VQ4A 5D7UA 1QVFA 1G3WA 4GGGA 1YTYA 3M53A 3A8OB 5L3CA 2DLPA 4KIFA 2R5MA 4JRKA 5H2FC 1ZUYA 1VQ8T 5GAN6 2LNVA 3GMEA 2DQ3A 3GWZA 3BPXA 4M7DC 3G1JA 2DA1A 1S72Q 2WTEA 5JLWA 3MKWB 1MJBA 2QSGX 3F23A 1PM3A 1W0UA 4M78A 1QPMA 2J5PA 1GVJA 3CCJI 4TQFA 1PP8F 2ARTA 3RDIA 2ALYA 4NBQA 4ZYGA 3QDRB 1OCTC 5FU7C 1A04A 3CCJQ 4PCQA 5E1ZB 3EHQA 2KKOA 3HRIA 3OSVA 2XD0A 1T8IA 2HPMA 2LD5A 5K5RA 1CSKA 2A68F 2IW5A 2X0LA 1C6VX 3CC7Q 1X3ZB 1WJBA 4F17A 5HNHA 5GTHC 1KQ8A 1L0OC 2MD5A 3HIFA 3ONQA 2QEXA 2YPRA 3RPUA 3V8LA 5F08A 1AEYA 4N4GA 3WE3A 1CF7B 4BY6B 3TP0A 2XF6A 1HSQA 2RVCA 1KQSP 2OQGA 5DCMA 1QP3A 1FLIA 4O2DA 1RESA 4A69C 2PU9B 1Q86C 3AG2H 4CI0C 4G6TB 1ETOA 2HMAA 2XAJA 4RTZA 4Y3OA 12ASA 5FLXK 2LT1A 2KRHA 2YX4A 4J6WA 3FLGA 1JKRC 2Y0SA 5KCOA 4A3IJ 2OAWA 3IWFA 4HV5A 1N27A 2OJED 1LYLA 3LC0A 4J6XA 2R7DA 1N9SA 3FZVA 1VQPI 4XLNF 5DD4A 2M02A 4LB5A 3HOUJ 3WQZA 4EJWA 3CCQQ 5TISC 5FWBA 1O3RA 4A3GJ 1X6OA 1VQPQ 2RV8A 2HTSA 5J8FA 3QWLA 3IV5A 1LPLA 3M0PA 3GNGA 4HLXA 4E7HA 1UZCA 3EHRA 4IIMA 4PJOF 2E71A 3ZMZA 1ACIA 4BS9A 3P8DA 2ZPGB 1X6GA 5F1RA 3K10A 1FY7A 1MBGA 1UB9A 3KYCB 1B3QA 3G71T 1T3SA 3LSGA 3BPVA 2PMUA 3OY9A 4M3EA 2FMYA 4JJBA 4EJTA 1BJZA 4EM2A 1MKMA 2HVSA 2B0LA 3JSOA 1I3AA 1WDXA 3HFZA 4G12A 1NLOC 4L5GA 4KMUX 3BROA 2VWFA 1VQLT 5AYFA 1PRMC 2YRVA 1JGSA 1YITT 4OOIA 2OTLA 2Z1DA 1D1AA 3EPZA 3J80Z 4EMGA 2QA4T 2ZIMA 3LYIA 3CUOA 2WSFE 1N5ZA 2KGTA 3AKZA 2XGEA 1PCXA 2P0PA 2GXGA 3ER0A 1QCOA 3F8CA 2KI7A 3VB2A 2CP7A 4D8KA 2UXNA 4P96A 1S29A 1JJ2P 5GPAA 5E20A 1D3BA 1X2HA 3IH4A 1UCRA 1QVUA 3JCMb 3LFKA 4KDPA 3W3CA 2DBBA 5HDGA 4HBLA 4ETSA 3W2VA 1VQ8I 3I35A 3HPGA 3EGDA 2W84A 4HX8A 1HBXG 3J81Z 2O61A 3J7ZI 4P71A 2EGCA 2CGHA 2XICA 3E19A 3MQZA 1IO2A 5HGQA 1ZSZB 5CR2A 1PNJA 1BI3A 3DTKA 4PJOE 4C5GA 3ZQIA 4Y13A 3Q9SA 1KQSS 2VBZA 1K73U 1F43A 2DI3A 2CS3A 3ZP5A 1R9TJ 1WZ2A 1BR4A 3VDXA 2J6FA 2DKGA 2LCSA 2BZXA 3JCMg 3OIQA 2O5RA 1WHHA 3TO9A 2A69F 2ESHA 4JOMA 2YRDA 4IRHA 5GAN4 2R5ZB 1SHFA 5HS8A 5D4RA 4FT4A 2IBDA 2KDOA 1OPLA 3BY6A 2VIXA 2VXEA 3KP3A 4P5OA 3QYFA 1NYQA 1UG0A 2CSOA 2V79A 2CZ6B 1VYVA 3NQOA 3HOWJ 2KK4A 4Y92A 2V1UA 2OQRA 2DFHA 4N0AC 2PUKB 1E6GA 4ITVA 1PYSB 4ZDPA 3MZYA 2TDXA 5EEAA 4YRMA 4YTLA 1H92A 1JKOC 5AT1B 4RGUA 1PYVA 5FJ8J 3BP8A 2RI3A 3BZ6A 1MHNA 2DYRH 4P3OA 3H9NA 2CUDA 2AMCB 1OQYA 4ZYAA 1ETYA 4NUBA 1LE8A 1ASZA 4D5FA 1J3TA 2KBTA 1BI2A 4CICA 2IS1A 2C06A 2EFNA 2ZPFB 4C8QF 2G9WA 4GYGA 2VGMA 3M55A 2OPTA 1BKBA 2QTXA 2BVMA 1NJIU 3PGGA 2VV5A 2P0KA 1VQ5A 1YYVA 1RLQC 5B3SH 4XOTA 2VKVA 1NEBA 1M90C 1XGSA 4BI4A 3CCMT 2EZLA 3I9V2 4BQOA 1IF1A 1VQMA 2GQIA 1Q7YC 3GLXA 1E2XA 3S2DJ 3D1NI 4CH7A 1WH7A 4IHTA 3DKMA 5HK3A 3VYTB 4FSSA 5CQYA 3QOPA 3PFSA 5CKHA 2FPEA 2ZNIA 2D6FA 4MZMA 1HXDA 3EG2A 4C3HJ 4FYWB 2OV7A 3GYHX 2P4RA 2Z0WA 3QDFA 3EH1A 3QO8A 5KCMA 2DK8A 4KISA 2QDLA 3EGXB 1ZLMA 3B02A 2JA7J 1ZRDA 4PFPA 4YCUA 5FKOA 1FOYA 5FO5A 3RYRA 2M30A 4BL0B 2LC2A 2V9VA 4HDUA 5JVGF 5IP9J 3FHNA 5E8GA 1UHFA 2EJGA 4F92B 1JJ2S 1Z21A 3RNJA 4A3MJ 2QZ8A 4LDWA 2H8RA 1SD4A 4LLNA 1H88C 3HPHA 3HOZJ 3G71I 3LLRA 4DOWA 3RZDJ 4G6DA 1TC3C 1B70A 2CQXA 4EO4A 2VGNA 1DPRA 4XMYA 2DERA 1B34A 4KGZB 5CK9A 4C2TA 1QNTA 2FNPA 2LSOA 2ZZFA 5HNFA 4OLFA 2LNHB 3FC3A 4NC7A 1M1KR 1YITI 1PUFA 1MBKA 1QQJA 3CMET 1ORKA 2WAEA 2X4YA 4MTEA 3WG9A 4PJLA 2F5DA 2LJ3A 4XTXA 11ASA 3JTHA 2STWA 1ZG1A 5BMZA 2E70A 2M0OA 4LN2A 1RETA 4HQMA 3L2UA 1JE8A 2X4JA 2BV6A 3OV8A 4FYVB 3AG1H 4ZZDA 5FB2A 4BEHA 5E17F 2SRCA 4RLQA 1S6LA 3BOQA 2FRHA 4UB8C 4LD6A 4PJOC 4ZN1A 5IY5H 5J4YA 5L3DA 3ZRGA 2E12A 2QAZA 3ZPLA 1R8OB 1DQUA 3I5UA 2K3YA 2A5WA 4K86A 4YIRX 3PO3J 1M9SA 4A2UA 5HODA 3ERMA 2A8EA 1D09B 3GFJA 3M3YJ 4MLOA 1H3HA 4CA0A 5E18F 4ZTUB 4G6QA 5K1PA 2ISYA 3VYGA 2FOKA 4HV6A 4TVYA 3DLLF 3KFUA 5C4JJ 3MKLA 4XRSA 2VXZA 2JTMA 3UGQA 3LGLA 3L4GA 3CQZJ 1I1JA 4IQJA 3PSFA 3NWSA 2XAGA 3RCOA 3MEUA 2VONA 1DU6A 2W85A 4QPOA 4BUPA 2K5FA 2EJ9A 5D4SA 2K7LA 1LJ9A 5H6RA 3G4SQ 2XPWA 1I5OB 5KAFC 4LVKA 2R7ZJ 1P4XA 2V26A 3VS1A 2E10A 3IALA 3E6DA 1W66A 3HXLA 2LF8A 4Z8AA 1X19A 4M7AA 4IHYA 4U0WA 3ASNH 1W2BP 2EGAA 8AT1B 2Y75A 2EGEA 2EZHA 4ZTJA 4CXFA 3VFZA 3J7YJ 3CJQB 1KFZA 4HVWA 1Z6TA 3OBWA 3REUA 4CS2A 3SWNC 4IRIA 3SZPA 3R60A 2X4XA 1QHGA 5LHHA 2Q1ZB 4UUSB 2C6YA 3S8PA 1ZLJA 2JN0A 2QXFA 1B6AA 2DZCA 4ELYC 2R7SA 5GAOn 4LITA 3SDGA 1P92A 3RYPA 4DA4A 3S1MJ 2F2XA 1X1BA 4XLFA 1H89C 4HDVA 4A53A 3MPUB 3QPTA 2JPBA 2V8IA 4H2YA 1OCCH 2LY2A 4UVCA 3CCMI 1QVGP 2Y0SN 1GBQA 1K4TA 1R5GA 4E47A 3B6AA 2NWMA 3TDZC 1ZG5A 2DMOA 1N77A 1BJAA 3WGGA 1BC7C 1YLFA 4BD3A 4KUDK 4KT0E 2QEXQ 2KHMA 1QE0A 3K4KA 3X2QH 4B47A 1XMXA 1JKQC 4JJCA 1YFNA 2JRTA 1FMKA 2K02A 1Z9QA 1EVKA 4RGRA 2CH4A 2DAOA 1ETKA 4ENKA 4D1QA 4BHCA 4KT6A 2CP5A 1K9MC 3PNTA 3CC2A 1B07A 1IJWC 6PAXA 1PC0A 4UPAA 3K4JA 4DIQA 4B48A 4U0VA 1QCFA 1YG2A 3DTIA 1JO8A 2CQ7A 3C94A 4XKBA 1XB4A 3X28B 5DY9A 1MH3A 1AD5A 5ICCA 3M1EA 2R3SA 4FASD 2CP0A 4OWRB 3PE0A 4DBHA 5GAOl 1YJNT 4I98B 1ITYA 2B7EA 1RPWA 3KP5A 3JRDA 3IWZA 3ZN0A 2RHQB 4QT7A 2BE5F 3LWIA 2ZNYA 1BM9A 4IF4A 4YIFA 2VUBA 1YI2T 3L2WA 2KMTA 1T6SA 2ZCFB 3IHUA 3CMEI 1I5ZA 2DZ9A 4F14A 1V3FA 2BXYA 3HFOA 2CV2A 1BBUA 2MMPA 3KYDB 2HI3A 3SDBA 1OQKA 3O6BB 4L9VA 1NJ1A 4AWXB 4P72A 2P4TA 5DTDA 4KYWA 1VQOA 3CCET 1YW7A 2R57A 3ZMDA 1LEBA 3OYIA 4MO7A 4NL3A 1FIAA 2Z2SB 3JR9A 5IXBA 1EH7A 2XI9A 2ICWG 1RAIB 2FBKA 1ZG3A 5FLXZ 1GVDA 2Y69H 2PMEA 3W2AA 3ZQLA 3UF4A 1A36A 2XAHA 4IX7A 4YYEA 2M4GA 4A3LJ 2ZZEA 4TWAA 2AK5A 1HK9A 1M90R 3RPQA 2MD0A 4HWRA 4IRGA 4JBAA 2YRCA 2DOEA 4XNFA 4M72A 2NS8A 4EV0A 2D0NA 4L5EA 2GBYA 1NH3A 1B8IA 2OTLQ 1KZHA 2BTTA 1QKWA 3FXLA 2YU9J 2DL3A 2MGQA 2LY9A 2XAUA 2FRWA 4H2WA 5LFAA 2ZMEC 1RRJA 2Z5UA 4M78E 5EDNA 2QQ9A 1IO6A 3PQJA 4XR6A 4LUEA 3LH0A 5LJ3h 3UNGC 2ZAEA 4FISA 5FLMJ 5ECAA 4CC4B 1I3QJ 2P4WA 3G73A 4HWPA 1VNDA 1QVGS 5CQXA 3DXJF 4YRFA 3LWHA 2HDAA 1U5TC 4AUXA 4JDSA 4CC3A 2YUPA 4O6JA 1WH5A 2V8KA 1CF7A 4S05A 3DQVC 2M0CA 3NHNA 2JMCA 4F55A 3I55T 1BB9A 4C0GA 5L3BA 1B72B 1BOBA 4BUGA 4BXUA 4HNTA 2NUTB 1OEBA 3L09A 1YJWT 1IDYA 2DOAA 3QIIA 5D5XB 1DDNA 2L3PA 3TMOA 3HUGB 4A5NA 5GADJ 2LTPA 4KITB 1J7KA 1FZPB 5GAOp 2Y4XA 4OB1B 2XSDC 3QTCA 3HXXA 1HW5A 4YREA 4C5EA 4CRIA 3V7RA 3KX2A 1GXPA 3CP2A 2ADUA 2R58A 1QQIA 4RUGA 2BOLA 2QHSA 1MSFC 5GAMg 3GBQA 2COYA 1U5SA 5A2QE 2JW4A 4RTUA 3CCRA 2DMNA 2PEXA 5M9OA 5HCKA 5A0DA 5GAGJ 1OU9A 2KXDA 4QQ6A 5K5QA 3RESA 4RB2C 4C8QB 2ZXIA 2FX0A 1IG7A 2W57A 2AKKA 3RKQA 4JJDA 2VC1A 1W70A 1SG5A 3PT9A 1FOKA 4TVWA 5GAN3 1U6GA 1NTCA 3Q0WA 4XEOA 5ELOA 1I8FA 5HVQC 4XONA 3L2RA 4EATA 3HRTA 2X1EA 3E1SA 1MH4A 1VQ5Q 1LPQA 4MHGA 1R36A 3JAME 1R23A 1ZGWA 2E1HA 4DBRA 4A93J 4A4GA 4UC4A 2ID3A 3JB9D 1VQMQ 1LVAA 1YJNI 4EX5A 2LDMA 1JT6A 1F36A 3JCMe 2CZ0B 3QJ6A 3U23A 3JCMX 3C2BA 2Z99A 3K4NA 1TT5B 1YI2I 5H6QA 5CKDA 3E5XA 2QWWA 1SFXA 2CW0F 2M9UA 5KYXB 4M78D 3MAJA 3SZTA 1IZ6A 2BY2A 1RI0A 1R00A 1LFUP 5M3MJ 2I10A 3IL2A 2MAMA 3A74A 2YUQA 1MSEC 3Q3SA 2M0MA 2WY7Q 1W1WE 4BJTA 2CQKA 1FWZA 3CBOA 1RACB 2LOOA 4P9UA 2YSQA 3F70A 3H3UA 1V4RA 3CCEI 4M7DA 4LMYA 1VQ6T 2FMLA 3CC4A 3GZNB 4G84A 2EQRA 2UXXA 1X6BA 5GAOm 2KYMA 2DK5A 5C52B 3F0CA 1WYDA 1ZSGA 3M59A 4II1A 2OTJI 2HGCA 1RKWA 4LVIA 2DE0X 2K9SA 4M78C 1ON2A 1SMTA 4Q6GA 2ZXJA 5C51B 4M3BA 2OTJQ 1W5CC 2O01E 3SD4A 2JN6A 4CZZA 2E6NA 2JVVA 1KOGA 3L2CA 4BGDA 4YEJA 3SZGA 3H6ZA 2P6TA 2IGMA 3IKLA 3META 2EPDA 3I4MJ 1M3BA 2R5ZA 4RDXA 3E6CC 2AIRB 3PVLA 2Y90A 3E9IA 4ZJZA 2RMOA 2PQWA 3PIOF 2BE9B 2RQVA 3BR6A 9ATCB 1BR2A 2WA0A 2K40A 1WKMA 2V7FA 1K9MR 2XAQA 2F69A 1I6HJ 3LSSA 1JB0E 4C8QG 1X2GA 1PYSA 1QO0D 1XCVA 2L02A 5LEJA 2MLKA 2DYBA 4EMHA 2M45A 2HQNA 2W00A 3I53A 1O7LA 2L5QA 1X2MA 3I55I 4C92G 2N8GA 2OJ2A 1HQCA 4F7UB 4HLYA 1VIEA 2DA6A 5E3IA 2H94A 5IT9K 1AA7A 4W97A 2RD1A 1YJWI 2EVRA 2OAUA 5EGOB 2FEIA 1TZLA 3O3KA 2DVJA 2L9NA 3COAC 3O5ZA 3SXYA 3MWMA 1GFDA 2QQAA 1IXCA 4JPBW 3NTKA 5IN1A 5KNLA 1K78B 3LMMA 4M71A 2Y0MA 2A37A 4MEXF 3VS4A 1X3UA 1ZHFA 2L7MP 5GP9A 2GBQA 4P3NA 2HYFA 2LMJA 1OPCA 1QA6A 5BOXA 2DEUA 4ANJA 2Q7EA 2DLLA 4IZZA 3RUXA 1G59A 1YBYA 2CW8A 4OMPA 2KIMA 1Y56A 4LE9A 5I2SA 1YHQA 5DLOA 4FE7A 3ZXSA 4DYCA 1WJQA 3NENA 2QBYA 5KYWB 4XU3A 3M9AA 2ZPIB 3RQ4A 4PLLA 4QVDA 2O9SA 3QAHA 4FTHA 3TEHA 2KZGA 4LDYA 2EQJA 1Z67A 4N0BA 3H8ZA 2M1HA 3H0IA 1MV0B 3F6VA 4P75A 4ZYDA 1ZBXA 1ZREA 3OS2A 3GFMA 3J80E 4BACA 2NYSA 2JS0A 1SVMA 1NNHA 5CVIA 5I2MA 3VODA 1RAAB 2F4MB 2X4WA 5BNGA 1H4VB 3MJXA 1D1CA 3OYJA 4GBQA 1Z7NA 3V7SA 2ESNA 1TUCA 1JT0A 5CO7A 2ZBKA 1R77A 1WI7A 1B7TA 3OYAA 3CDLA 4RQFA 1WJRA 4CH4A 1YWPA 1Q86U 1Z7LA 2XU8A 3WTXC 3CCLA 3H41A 1K76A 4N4OB 2DETA 1FYFA 2K3FA 2COZA 1KU3A 1LKXA 2M16A 3GIBA 1DP3A 2P0WA 5GAEJ 2BEOA 3CEYA 3WTTC 4UY8I 4N4HA 2LZ6B 2DXTA 1USYC 3IKTA 2E5AA 1R6RA 2R7WA 1RLPC 2KL4A 1U2WA 4L5JA 4M73A 4DNCA 4M77F 4YPFA 2VN2A 4G94A 2WC2A 1RAGB 1X56A 4QTRA 1VQ6I 2PX9A 5H20A 4F7UG 2MLGA 5IHKA 2KIUA 2UV1A 1Z0XA 1TW3A 4JJNK 1FOXA 2YLBA 1E3PA 3LSJA 1Y1WJ 1U8BA 3I0TA 4UHTA 2FU4A 3FEOA 1WJEA 3VUZA 3HRKA 1NYGA 1TQPA 3WE2A 1WGXA 3MEAA 2VJ4A 1N25A 3M8FA 5AIQA 2DXUA 3Q1JA 3GFLA 2QASA 2OZ6A 1X2NA 1HJDA 4J9EA 3ULRB 3EFOA 1IN7A 3BCAA 3FIWA 3E9FA 1X43A 2I4NA 4YRPA 1KHCA 3VRZA 1LEAA 4M3GA 3ZOBA 3WG7H 1UJYA 3VS5A 4WK8F 4J15A 2QHUA 1STZA 1M1FA 3HFNA 3HB9A 5ELNA 4ORZA 3RF1A 1R1TA 4RA2A 2HVQA 2IJLA 2LBFA 2EIKH 1YWOA 3JAMK 3JB9J 3KBGA 4KJZA 1H9TA 4B9WA 1YJ9A 1ZRFA 2KRFA 2O4XA 4E2FB 4D7MA 1UAAA 3SB2A 4M77E 4RM3A 3AL0B 3I7FA 3CTAA 1OYIA 3N4MA 1JEGA 4U7DA 4U7BA 2CKKA 3JCMh 4M7AE 1TT0A 1FJLA 1NJ2A 3GTKJ 2BW3B 3RR6A 1AU7A 4D5CA 1UGPB 4XLAA 4X6AJ 2HKXA 2CQQA 4A3KJ 2O3FA 2J7IA 3MKDA 4FT8A 2LP0A 3LH5A 2DTZA 2W7NA 1XTAA 1EFNA 1MJ9A 3QHSA 3C0CA 1RUOA 1X3WB 5B5EC 2P7VB 1EOVA 4OMQA 2BYVE 3TU4K 3IP4B 3RKXA 4LLGF 1OISA 3ASKA 1YQAA 3S3NA 3SJMA 4XRMA 4J83A 5ICEA 1BK2A 3S1RJ 3H35A 4HCBA 3PIPF 5E1XA 3DPUA 4RTTA 3JSCA 3QU3A 1W4SA 1P9QC 1QVFS 3ABLH 4MNUA 1NPPA 4FT2A 2P0LA 4X1VA 2DXBA 4Q5SF 3HOYJ 7AT1B 3SDZA 3K7AJ 5CKFA 4PGHA 2CUFA 4LG0B 3QRFF 1ZR2A 4FYYB 1KGSA 1AHJB 3S32A 2FZKB 2G4CA 3A8LB 4ZNXA 3ZCOA 4XQ3A 1FBQA 1K8AC 1WHJA 2W4SA 2Y2ZA 4CS3A 3FJ5A 4F04B 2X85A 2ID6A 1NJ6A 5GAMj 1BBYA 2QUFA 2VYTA 1BI1A 1YIJT 4YP0A 4Y91A 1UHSA 3FMQA 2QM3A 2A3LA 1XN7A 4XAXB 3CCJA 5CKEA 3BR2A 2EYZA 3SHFA 3N05A 5CPRB 4O3MA 2E5KA 2V9PA 2V1NA 5DDGA 3CCRQ 2X1CA 2ZCWA 4Y4RA 1WJSA 2X6XA 2FQ3A 1M90U 3R6NA 1Q7YU 5IOYA 4R0KA 2VODA 1BIAA 4AFQC 2L89A 4PJOA 3QO5A 3GLLA 1BBWA 3RMQA 2PMFA 1WLEA 5J1RA 5CJ9A 1RR8C 2LK2A 2XGDA 2J5OA 2E2IJ 4BQQA 2NS0A 3M56A 3HXVA 1QHHD 2R4GA 2P5LC 2CV0A 1JUSA 3HZJA 3NETA 3ML6A 4A3JJ 1B1BA 3GTPJ 3KP2A 4H02A 4IVNA 3KIOA 3A5ZA 1P2FA 4J01A 1B7YB 4NHJA 3GTJJ 3S2WA 4V2FA 1MMAA 1FYLA 3E5QA 1ZRCA 4YRTA 3GTMJ 3HDDA 2L4MA 2OA4A 4ME7A 2LX9A 3D0SA 5DM7F 1VQ9T 5GAMe 5J26A 2HDCA 3ABMH 1TP4A 2RQWA 4A63B 1AWOA 3A03A 5C0MA 5GMKi 2D1HA 1QLYA 1W0TA 3UFGA 4M77C 1DGRM 1PUEE 2J6OA 1Q1VA 4KIBA 4OMZA 2W82A 4J7FA 1SETA 1T0FC 3WU2C 2FF4A 3CC4Q 4M7AC 2RI5A 2WACA 3MFKA 2DA4A 3CCVT 3G6ET 1QF6A 3Q0VA 2DBMA 2GQQA 4EGZA 1TQIA 3FXRA 1ZUKA 2IA1A 1KMMA 2EZIA 1Y0MA 1X69A 2L8DA 1R1VA 3LFUA 2B63J 1QGPA 4C2UA 2ZT8A 1DUXC 2DAQA 2VOOA 1B72A 3S1QJ 4H2XB 5TRDA 4WJ4A 2QVOA 2NUTA 4Q4ZF 2IS2A 4IHSA 1YP5A 4FIBA 4CCKA 2R5YA 4XN0A 3WTSC 1XGNA 4QKUA 1LJOA 1AZGB 2IS6A 1UG1A 4IQ4A 3SWNB 3PFYA 2NVTJ 4AFUC 3MP6A 4FSXA 3OS0A 3OQ5A 3I56A 3JRGA 4ZYHA 4IHXA 4MIMA 4AIJA 4IURA 1Z05A 2DRKA 2BGCA 1ODDA 5D6FA 1R4MB 3ZMVA 5F27A 4QQDA 3PJRA 2QKLB 4IUQA 1S3JA 1KYZA 3O2PE 3ZN1A 1XS9A 3HXYA 2JM8A 5FFXA 2GAUA 1ZGAA 1WHKA 1JBMA 3F72A 4HVUA 2KLOA 2DK3A 2DA7A 2DFFA 4XQFA 4M74A 1FC3A 2O7OA 4C8QA 3H9GA 5CLSA 2K3PA 4BH9A 4RAGA 1UECA 2CYZB 4D9JA 1YN8A 2CUBA 1GBRA 2EQUA 3I64A 1YCSB 3HY1A 2FD5A 3HTRA 3R6OA 1VQ8A 3I5RA 4BAYA 1VOMA 2DYIA 3J7AO 1U3OA 4F16A 2HEQA 1G6NA 1WIEA 4JQFA 3P9CA 3QYEA 1YIJI 3ZMUA 4H4KC 3K4MA 2CP3A 3LSTA 3M8EA 2R7UA 1YFRA 4FCYA 2IP2A 2VBYA 2BY0A 5FLXE 1QRYA 4HT4A 4M75D 4Y28E 1YW8A 1H3ZA 4J9DA 2DIQA 4KN7X 3O8GA 4HA8A 4A5MA 2XK0A 2VBWA 1V29B 4RTXA 1AOJA 1AWCA 4BI8B 1UEBA 1M2OA 4P72C 2KSSA 2P84A 3F3XA 2BHYA 4JS5A 1SC7A 1LDDA 2XUBA 2HOEA 2KT1A 3J7AF 5D6WA 4TQDA 2E34A 4BYYA 2FO0A 2EYYA 2XVCA 2CJBA 5J1UA 5I21A 3M0SA 2L9SA 5J39A 3I59B 3CC2T 3EUAA 2XMFA 1EIYA 3TBIA 1XMAA 1HKQA 3BG3A 1NK2P 3UPUA 3A8HB 4JS4A 5F1JA 4RGXA 1GGMA 5KCHA 3DV8A 2Q2EB 3DKXA 1K9MU 1XMKA 2EILH 5CIUA 3MZHA 4ZIBA 4A3FJ 3CCLQ 3OS1A 2HOTA 4RGSA 2WSEE 1KHIA 2ZNJA 5IPAA 4ZDLA 2FE3A 2FOWA 4XSZF 4QW2A 2YUSA 2ZPBB 2HL3A 3HRSA 2K5CA 1ETXA 1VQ9I 3CJNA 3ERRA 1WVRA 3REBB 2RK2A 2ZNZA 2LF7A 1Y96A 3CXCA 1Y57A 3A1PA 3QKJA 1LCKA 1U5TA 4J9IA 2ZMEB 4J00A 1X01A 1A35A 3HSEA 3BY7A 2PQ8A 3L00A 1PHTA 3CCVI 3G6EI 1U9NA 2IGOA 2E1CA 4RAYA 2ZT6A 3X24B 5CQEA 4DEYA 4P9FA 4BY6C 3R6SA 4NB5A 2UWMA 1IHWA 1J09A 1K8AR 2DFUA 3DLLA 3K69A 2EFIA 1SEUA 3VBBA 3FXJA 1PP7U 2M4KA 2R7TA 2F4OB 2GA1A 3PNYA 1ZTRA 2AHJB 1M8MA 3CUQA 3GO5A 4W1UA 1YX3A 2M3AA 1WI9A 1YRNB 3I5SA 1K78A 2BY3A 2RJCA 2CZ1B 3G71A 3EFRA 2A6TA 3PO2J 1E3HA 2HU9A 1RAFB 3HSBA